4A3KJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3kJ00
3JRIA 1BJZA 1JT0A 3HKZN 3A01B 2HOTA 2EBIA 2WAQN 1QVUA 2DA1A 4AYBN 1DU6A 4A3LJ 1X58A 3S2DJ 1H89C 4C3HJ 1ENHA 3IH3A 2CUEA 1HDDC 3S2HJ 4DYCA 2XGCA 3ZQLA 3HGGA 4A3EJ 1JKPC 1UHSA 3G1OA 2NOGA 2L7MP 1RETA 3LSRA 2XGDA 1H88C 3HM5A 1MBEA 3IH4A 4DYQA 1BW5A 4MFDA 3BR3A 1I6HJ 2M0CA 3BR2A 5M5WJ 5DTDA 3BR5A 2G0EA 4FISA 4CYCB 5EGOA 2DMTA 2P81A 1OJLA 2QF7A 3ZOBA 2E19A 1IJWC 1U78A 5EG0A 1JTXA 5E3OA 2Y0SN 3TEDA 1HF0A 1FEXA 2GBYA 4MLOA 5F08A 1ZTRA 2M2EA 2XSDC 1E3OC 2XB0X 2HXIA 1TWHJ 3JR9A 2K9SA 3I4NJ 1LFUP 1JGGA 1ORKA 1JKRC 3O8HA 4JX6A 3S1QJ 2LKXA 2CQQA 5FKNA 1MBGA 4JX4A 4V2FA 2DJNA 3JRAA 2QCOA 4D7MA 1NK2P 1YRNA 3GTKJ 2ID6A 4HNVA 3ZQIA 1EF4A 1OFCX 3RQIA 2HDDA 4I6ZA 2LTPA 1A6IA 2L0KA 3G1LA 3BR0A 2OF7A 2CJJA 4Y52J 1FTZA 5IPAA 3LOCA 2FJ1A 5E3MA 5IYCJ 4D7NA 4A3DJ 3H3VK 3M4OJ 1PUFA 4BKXA 5F0FA 3ZQHA 4NDLA 4XK4A 1TWCJ 3K7AJ 1MH3A 3S16J 1TC3C 3W6VA 4CYCA 2JJ7A 4M3FA 2LD5A 1D5YA 1ETQA 4M3DA 1JT6A 3GTMJ 3BQYA 4XICA 3S1NJ 2VKEA 1AU7A 5EZGA 1T56A 2DA2A 3MKLA 5M3MJ 2K9QA 5M5XJ 3OSFA 4IEJA 1GV5A 1FIPA 5F27A 3QPLA 2XPUA 1XS9A 9ANTA 1GVDA 1NK3P 3LSJA 5GPCA 1XG1A 1MSEC 4MFEA 2JA7J 2MG4A 3LSGA 1ETKA 4XRSA 5J3LA 4DW6A 3ZQGA 2N8GA 4XRMA 4BBSJ 3BR6A 3CDLA 2O7OA 1CQTA 3DEWA 4J19A 1RPWA 4A3GJ 1WH7A 3VPRA 2Y30A 2X9DA 4Y7NJ 2ZB9A 1ZGWA 2NS8A 4MO7A 1JJ8C 2R7ZJ 5BNGA 3S17J 1MSFC 4LOCA 3TW6A 5FLVA 1Z0XA 1K61A 5GPAA 1JKQC 5FKMA 2XPWA 3QQAA 1YRNB 2L9RA 1FJLA 2JN6A 3BQZA 2PMZN 5K7HA 5JLXA 1I50J 5C4XJ 2XGEA 2VUMJ 3WHBA 1GUUA 4C3IJ 1K83J 1LE8B 1WH5A 5C4JJ 4QTRA 2EZHA 1ZR2A 1PUFB 3BG5A 1JUSA 2DN0A 3FK7A 1JUPA 3ZQFA 5EDNA 1A5JA 3GTOJ 1OCPA 4QIWN 3GTGJ 2FX0A 5EZHA 1ETYA 4UUTA 2XRLA 2VPRA 3S1RJ 2IAIA 4EEFG 3GTLJ 3B6AA 3JRFA 3FKIJ 2XPVA 3ZQCA 2R5ZA 4S0HB 1B8IA 1TWFJ 5C44J 1O4XA 1HCRA 2M8GX 1MNMC 2MW8A 5J1RA 1FIAA 2ID3A 4IHXA 2KDZA 3BG3A 2NVYJ 3FISA 1WPKA 2E2JJ 5F04A 1ZQ3P 2DA3A 2DMPA 1ETVA 5M5YJ 4AC0A 1HLVA 4A3CJ 3G1MA 1IDYA 1QVTA 1LE8A 4DYRA 2M34A 4DZPA 1ZK8A 3B6CA 3C2BA 4BXXJ 2L7ZA 2CRGA 4A93J 2VI6A 2CQXA 5E3LA 3K2AA 5IP7J 5IYDJ 2Y9YA 2K40A 5JLWA 2DMUA 1IV6A 3E7LA 5J1YA 4IHVA 2X6OA 3L1PA 2R0QC 2VKVA 2NS7A 3BG9A 3CCYA 4A3MJ 2FQ4A 1P7IA 1G2HA 3HOUJ 4D5CA 2JMWA 1QPIA 3HB9A 3RKQA 2ECCA 4UUSA 2DA7A 4JYKA 4M6VA 1IG7A 5EF6A 2Y9ZA 1B72B 2NVTJ 1ETWA 1MBFA 3BTCA 3LNQA 1W0TA 3JRHA 4BY7J 2HOAA 3HGYA 1JKOC 5FKKA 1ITYA 1F43A 3HEFA 2FD5A 2JA8J 3TP0A 2TRTA 3HOZJ 1X2NA 2CUFA 2HI3A 4V2GA 1POGA 3S14J 1GV2A 1RKWA 1S7EA 3D1NI 4A69C 4XRSG 2W48A 1MBJA 4B4CA 1IUFA 2EQRA 1W0UA 5K7FA 4XIDA 3Q0VA 3SFIA 3SJMA 3HOVJ 4X6AJ 2JWTA 4FE4A 5IP6A 2R5ZB 5EYRA 2GM4A 1B8IB 3IH2A 1UMQA 2MSYA 1RESA 2KT0A 2EZIA 1QRYA 3TW7A 2M9HA 3BTIA 2YS9A 4X1EA 4MIMA 5IYBJ 3NAUA 1AHDP 1GT0C 3HOWJ 4RDUA 3JREA 1XC5A 5J1UA 3S1MJ 1JJ6C 2E2HJ 1B72A 3GTQJ 1FTTA 1MH4A 3H0GJ 5GP9A 4GFBA 3OSGA 2LVSA 2DMQA 2IBDA 4A3FJ 3JRDA 3HBLA 4DZJA 5FLMJ 3MN2A 1RR7A 3WHCA 3MVPA 4M3GA 2HYJA 1MBKA 1RKTA 2ME0A 1Y1WJ 3LSPA 1HOMA 1IRZA 4L5EA 1WCMJ 5IP9J 3TP3A 2EZKA 3Q0UA 1AKHA 3PO3J 2COBA 4IHYA 2DTZA 2MGQA 4UUSB 3GTPJ 2IEKA 5IOZA 1BA5A 1Q1VA 4ABZA 2NVXJ 1ETOA 2DA4A 4W97A 3OIOA 2L7FP 2EZLA 4D5FA 2O9LA 5M3FJ 2I10A 4JX5A 2R5YB 2DA6A 3OOUA 4M3BA 5C3EJ 3IV5A 2OPTA 2HOSA 2YUSA 3I4MJ 4A3IJ 5F0CA 1VF9A 2CU7A 3SDGA 1ZKGA 2Y2ZA 2LK2A 2AO9A 5K7ZA 2TCTA 1IGNA 2LR8A 2E2IJ 2HXOA 1ZR4A 1R9TJ 1Z77A 1WGXA 2LFBA 1GDTA 4FTHA 3CQZJ 1IC8A 3BTLA 2LLKA 4A3KJ 4M3EA 3A01A 5E3NA 2R93J 2LY9A 3DCFA 5FKOA 3BR1A 4B3AA 2Y31A 3RZDJ 1VI0A 2K9NA 1IDZA 5FKLA 2JK3A 4FCYA 3S15J 3NARA 3BTJA 2ELKA 4G12A 5FJ8J 1I3QJ 3Q3SA 3PO2J 1SANA 2DMNA 2GLOA 4QSHA 2NVQJ 1UG2A 2YU9J 2JA5J 1BL0A 1P7JA 4C2MJ 4FE7A 5IOYA 3JRBA 1OCTC 2HQ5A 1Y1VJ 2ECBA 3M3YJ 1JUMA 3BT9A 3HDDA 3Q0WA 4A3BJ 1VFCA 2DA5A 2ME6A 3RZOJ 1ETXA 3FIWA 2AHQA 2R5YA 2O8KA 4W1UA 4AUXA 3GBGA 3UKGA 3A03A 1X2MA 3JRGA 2H1KA 4I76A 3PM1A 2H8RA 2WB1N 4RBOA 3HOXJ 3QPSA 1VNDA 4C3JJ 4A3JJ 1AKHB 2X48A 4B1RA 5EEAA 2XB5A 2JA6J 2B63J 2D5VA 5F1JA 2RAEA 1HDPA 4IHWA 4BY1J 1WI3A 2EH3A 5EGOB 1U8BA 1DU0A 4JP0A 3GTJJ 1SFOJ 1APLC 1JTYA 1MBHA 5DS9A 2LP0A 2WV1A 2E1OA 5EG0B 3JRCA 2R92J 3O8GA 1U9OA 3A02A 1BW6A 3FK6A 1U9NA 1TWGJ 3HOYJ 1T33A 1F36A 1H8AC 1LFBA 4BBRJ 1TWAJ 1NTCA 3F0CA 5F0HA 5HODA 3CMYA
chains in the Genus database with same CATH superfamily
1P2FA 3CCJI 1QA6A 1J59A 4TV7A 2EBIA 2WAQN 1MMNA 1DU6A 4IZZA 4B47A 2GIVA 3F8CA 3MEXA 1H89C 2EFWA 1ZH5A 4HF0A 2X0LA 3ZQLA 1CF7B 3HGGA 3WTSC 4A3EJ 2BE5F 5BOXA 1SAXA 3H9GA 3G1OA 5HNHA 4UNOA 4HLXA 2L7MP 1RETA 1TNSA 2PN6A 4QPQA 4RAGA 4NNJA 1XSXA 5E17F 4Y15A 1HSJA 1H88C 1UAAA 2JVGA 1IW7F 4NC8A 1H9TA 3G6EI 1BW5A 1FNNA 2IRFG 1R4MB 3WTXC 4GYGA 1JE8A 5LLQA 2P81A 3ZOBA 5EEHA 2E19A 2DPDA 1IJWC 2R7FA 4XSZF 1XMAA 2LDUA 4ZZDA 3DF8A 3PQKA 3FBNB 1ZTRA 5DCMB 2XSDC 2E36A 1OPCA 1FBUA 2Q1ZB 2BY0A 2XB0X 4U88A 5DUIA 3W2VA 2K9SA 2DT6A 3P5JA 3K70D 3S1QJ 2CQQA 4E7IA 2QCOA 3MFKA 3V8LA 2V1XA 2GWRA 1Z9CA 1FWZA 1YW9A 2EFQA 4XNFA 3I71A 2LTPA 5TISC 3G1LA 3WTTC 2STTA 2K02A 5LGUA 1TL8A 5HOOA 1LVAA 2L9NA 2HDWA 2PEXA 1SFUA 1H9GA 4BKXA 4MGRA 4R1HA 5F0FA 1PUFA 2A3SA 3PJRA 3BPXA 4F7ZA 3AL0C 3S16J 4M9XA 3DEUA 2ZXHA 3FWEA 4PJMA 5BQTA 3EDPA 4M3FA 1VQNI 4F92B 4XMYA 4XOTA 2ZJ2A 1D5YA 1ETQA 3RCOA 4M3DA 1MMGA 1AU7A 2R7XA 1FSEA 2EFPA 3H5NA 2GQQA 2DA2A 3MKLA 5GTHC 5M5XJ 2HYGD 1B59A 3OSFA 1R49A 3HHGA 3OS2A 5F27A 1G3SA 3GF2A 3WE3A 1GVDA 2RV8A 1NK3P 4A0ZA 5GPCA 1XGOA 3WU2C 4XM3A 4MFEA 3TOBA 2RQQA 2DK8A 2JA7J 4L5IA 1J09A 3PIPF 4G6DA 1GLNA 2F48A 4KN7X 3RJPA 3ZQQA 1B4AA 4II3A 1NH3A 3OMYA 3BCBA 2O7OA 1T6SA 4BJTA 2P5LC 2YX4A 1RPWA 1WH7A 2H6BA 2VBZA 3CF5F 2P7VB 1RI7A 2X1DA 3AG1H 1EV7A 4PK4A 4AIHA 1YI2I 4Y3OA 1DPUA 2DTRA 2CS3A 4ASNA 5LRRA 3SFZA 5FO5A 3RPQA 3K10A 3UR3C 3J81Z 2QQBA 4EGYA 2CH0A 1G4DA 2WAQA 3E5XA 3M8FA 1XCBA 5C4XJ 1SEUA 2ZKZA 2AXLA 1GUUA 4XKCA 3J81K 2MD5A 3X2QH 2NNYA 1LE8B 1ZLKA 1JI8A 4XLNF 3J7YJ 1PUFB 1SD7A 3GZ6A 3F8NA 3CC2I 1FY7A 4RAFA 2V4JC 1UHMA 3CDIA 5EDNA 1A5JA 4N9IA 3QOPA 5CJ9A 3TGNA 4LD5A 3CCRI 3U2RA 4QIWN 4AVPA 4Y13A 1V5GA 1IN8A 3BCAA 2FX0A 2F5VA 1SC7A 3KX2A 1ETYA 5AONA 2P8TA 4UUTA 2QVOA 3COAC 2O5RA 1RC9A 1X1DA 2FOWA 4KMUX 2GXBA 3GTLJ 1P92A 3JRFA 2R5ZA 3GFMA 2PFBA 1B8IA 4O3MA 3CJNA 1R5GA 2LF8A 1O4XA 2VQLA 4K2EA 5CQGA 2WC2A 2VONA 3SZTA 2MW8A 1BR2A 2V79A 4IXAA 3ZMZA 3QYFA 4N4NB 2BY3A 1R1VA 2WAFA 4HEA2 4NHJA 3VODA 5F04A 2DA3A 3K1MA 3HPGA 3G1MA 1VZ0A 2EK5A 2EWNA 1GVJA 2M34A 3B6CA 3ZMDA 1ZRCA 5E3LA 2W7NA 5IP7J 1YFHA 2HKOA 2NAZA 2I8DA 3S3NA 1F1ZA 3WU0A 1TNTA 2ZSIB 3DPUA 3AL0B 3DLAA 5J1YA 2VOOA 1UCRA 2X6OA 3KZIC 3OR2C 1UELB 2G7HA 2W57A 2L01A 4ZDOA 4CCKA 3HB9A 3FXJA 1UJ8A 4UUSA 2WB1A 1REPC 3BP8A 3VFZA 2P4WA 2QBYB 2Y9ZA 2WAEA 2DXIA 3GEZA 3SEQA 2NVTJ 3N05A 1MBFA 1ODDA 1Z6RA 3JRHA 4A6DA 5KK1A 2A6TA 2HOAA 1JKOC 5FKKA 1YW7A 4J00A 3GZNB 2VPLA 2XF5A 2FEZA 1POGA 1WWXA 4RAYA 1S6LA 3S14J 4DNCA 1HC8A 1S7EA 4A69C 5D5XB 2ZFUA 2FUG2 3ZGKA 2R3SA 4HF2A 3U1DA 5K7FA 4XIDA 3SFIA 3SJMA 3HOVJ 2JWTA 2EV5A 2R5ZB 4LLNA 1LKXA 2GM4A 4R79A 2HZDA 1B8IB 1TBXA 1UMQA 2MSYA 1RESA 3L2CA 2CWEA 2OJED 3VYSB 3RTRA 2KT0A 1ZREA 3CUQC 3F3XA 4I2OA 2L5QA 3BG6A 1RR8C 3GXOA 4HSRA 2O03A 2P0WA 2VBXA 5E1WA 3FKJA 1G6NA 3CMEI 3VB2A 1K6YA 3K4MA 2KIMA 3G73A 4P9FA 1ZLJA 5LFAA 1SFXA 5J1UA 1SD4A 4RB0A 2YU3A 3LA7A 4UXNA 3SZPA 4BEHA 2E2HJ 1E17A 2DBBA 1O57A 2CQ7A 5GP9A 4MQ9F 4BL0B 5H2FC 3OSGA 4HRIA 2LVSA 2QSHX 5DV5A 2X85A 2E7XA 5FLMJ 1HW5A 2DJIA 5JR3A 1R58A 4PSXA 2ZMEC 1D1AA 3F23A 2HYJA 2W84A 2ME0A 3O6BB 2NNNA 5JFRA 3L2QA 6PAXA 2EV0A 2L9VA 2HQNA 2M3AA 2QQ9A 2CW8A 4PGHA 3L2UA 2R7WA 1PP8F 1AKHA 3TDZC 5DDGA 2E35A 3EPZA 2L4AA 1EH7A 4U0VA 4UUSB 1Z21A 3GTPJ 1BA5A 1Q1VA 3FM5A 3VEPA 2NVXJ 3M07A 2ZC2A 5KCMA 2EIMH 4W97A 2L7FP 4L0ZB 4BAYA 1A35A 2A6EF 5J8FA 3CESA 2I10A 1LDKB 4XORA 3OOUA 3ZN1A 2H6CA 2CG4A 3CDHA 2LG4A 2YUSA 3I4MJ 2Z3YA 3OIQA 4XL9A 4M9ZA 5DCFA 1VF9A 1OCCH 4IF4A 3Q9VA 1GHCA 2Y2ZA 2LK2A 1BOAA 2TCTA 2WY7Q 2OU2A 5DD8A 3DTKA 4HAMA 4B44A 4FTHA 4LK0F 5B3SH 3BY6A 5E3NA 3SHFA 2W85A 2R93J 3DXJF 1M1EB 3M7GA 5E20A 2ZXWH 4CO8A 4RB3C 3RZDJ 3DV8A 3N97A 2CYYA 2M30A 1ZHFA 3S15J 2J5PA 1T38A 3HHHA 1BR1A 4G12A 3CP2A 3SXYA 3PO2J 1T0FC 2GAUA 4BH9A 3HG9A 1UG2A 3C7JA 2YU9J 4GCVA 3I53A 1BL0A 4BEHB 4FE7A 3QWLA 4OMYA 3ZCOA 1Y1VJ 4KT5C 3BT9A 5B5EC 3Q0WA 2A6HF 1BR4A 3DU6A 4B43A 4DGWB 5ILUA 3ZQ7A 4MTDA 1LDDA 2KRCA 3PIOF 4LFUA 4L18B 2LMDA 2OBPA 4AUXA 5AIQA 4EM0B 2E1CA 2PMHA 3ABTA 1SD6A 3F6OA 3CCSI 1DQUA 4HOBA 3ONQA 4I76A 4EVIA 2H1KA 2H8RA 3PL8A 5HS7A 4BXFA 1ONVA 3KZYA 4PJNA 1AKHB 2QKLB 4LMYA 2W4SA 2A05A 2CFOA 3OS1A 3KP2A 4A2UA 3LAPA 2RDPA 3R0AA 3EUHA 1D1CA 3E0JB 3FBIB 2IS4A 1S9HA 2I5UA 1LB2A 4YIRX 2CV1A 1DU0A 2Y48A 2D2WA 2LY1A 5FLXK 2BYVE 1QBJA 2K4JA 1X1CA 5DS9A 4FETA 2WV1A 3RKYA 4A6EA 3JRCA 1S7OA 3CUQB 3O8GA 1U9OA 4HDUA 3OYFA 4V19K 3FX3A 3MWMA 4BQAA 1U9NA 2H27A 3DU5A 1K4SA 5J4VA 1TP4A 3NRVA 1H8AC 4BBRJ 1STZA 1TWAJ 2KISA 2LH9A 1NTCA 4RLQA 3HPHA 2QUFA 5F0HA 4HLYA 4BQOA 1FYMA 2DDAA 3E6BA 3CMYA 2QZ8A 3JRIA 2OZ6A 1TW3A 2YR2A 1QVUA 5B1AH 3FHNA 1YIJI 4A3LJ 3S2WA 4KITB 2M4GA 2CV0A 3S2DJ 3PFYA 4RGSA 2QQAA 3IH3A 1UHSA 3H3ZA 3BJ6A 1DGWY 1SAUA 2NOGA 3GCMA 4EJVA 1HQCA 3E5UA 2LBFA 3BZKA 4DOZA 5D4SA 2E5NA 3HM5A 4DYQA 3KETA 1RUNA 3BR3A 4L9VA 2X4HA 3PSFA 5DTDA 2G0EA 1EH6A 2L4MA 1XGMA 3QAHA 1YHQI 3OR1C 1U78A 2VL8A 2WY8Q 3DTEA 1BJAA 5EG0A 1HF0A 2E60A 1W36C 2R7RA 1YJNI 3V7RA 3ECHA 2XIGA 3JR9A 1QHHD 3I4NJ 3MAJA 1JKRC 2E71A 4XR6A 3O8HA 1T95A 3BROA 4J01A 5FKNA 1MBGA 3DKYA 3K4NA 2DJNA 4PFOA 5FRNA 4I7HA 2UXXA 1NK2P 4YFKF 4BS9A 3GTKJ 1KQ9A 2ID6A 1EF4A 1RZ4A 4S05A 1X3UA 4I6ZA 3E6MA 1FYKA 4XN0A 2OF7A 2CJJA 1SMTA 3ELKA 3M1CA 5IPAA 3CO6C 1Z6TA 2VJ4A 1CF7A 5KAIC 5CVUA 3C2GA 3H3VK 4XK4A 2HWVA 1U0JA 3K7AJ 1MH3A 1TTYA 1TC3C 3TMOA 3P9CA 4PZJA 2BBYA 2E5ZA 3BPVA 1BIBA 5H6QA 3NQOA 4AD9A 2B9SA 1K7AA 2DDBA 3W2WA 4BJ6C 3S1NJ 2VKEA 3PFIA 3WTUC 1DPRA 4IHSA 5M3MJ 2M5WA 4RS8A 2IGOA 4IRHA 3K6GA 5HDGA 5L3DA 3MZ8A 2XPUA 3SQNA 4D1QA 3LSJA 2LBFB 4I01A 4RB2C 1XN7A 2CMPA 4E7KA 4BQQA 3LSGA 4E70A 5J3LA 3SEZA 4DW6A 4JBAA 4E4HA 5F1RA 3E5QA 2N8GA 3K4JA 3WGIA 3BR6A 4HX4A 1U5TC 2XAGA 3MZYA 1YLFA 3EUKL 1LPQA 2VIXA 1XGNA 2Z1DA 2PQ8A 2WTEA 3V4GA 1Y8RB 4F55A 4MO7A 4UVBA 2R7ZJ 1YOVB 3E97A 5BNGA 4ZYDA 2OCEA 2BY1A 2EA2A 5D8KB 4CSWA 5FLVA 1SVMA 3GFIA 3CC7I 4ZJZA 3K9TA 4DQ2A 4XQFA 1QZYA 3ZMTA 2D1VA 2L3DA 4RGRA 1JKQC 5BPIA 5FKMA 1LNWA 4UVCA 4XLPF 3QQAA 5B1BH 4XLHA 2JN6A 2V26A 5K7HA 4H4KC 2NRAC 1I50J 4WK8F 5H20A 2VUMJ 3J7ZI 1XB4A 2W00A 4WCGA 3WHBA 1YJ9I 1PUEE 2KHMA 1B1BA 5J6XA 1K83J 4BJ5C 4E7LA 5DYMA 1W5TA 4QTRA 2EZHA 3BG5A 2QSGX 1HW2A 2DN0A 1MMDA 1KQ0A 2VJIA 2KDOA 1JUPA 1ZAOA 4OAYA 4Q4ZF 3FHZA 2HR3A 4UUVA 1XSVA 3V7SA 3H1CA 3GTGJ 2VODA 2DFIA 2DYRH 3QP5A 3L00A 2M7AA 4ZDLA 1OKRA 3CCMI 1ZRFA 5KNLA 2XGXA 2XRLA 3REOA 2LYCA 2VPRA 2PLYA 2IS1A 2IAIA 4CH7A 3IAM2 3HZJA 1I6XA 3HRUA 1OQYA 4KYWA 3FKIJ 2OQRA 4U7DA 1Z3XA 2DI3A 2OZUA 2P5VA 3EETA 4NBQA 4PSWA 3ZQCA 5HLTA 1LUJB 2DU9A 2Q8KA 4RGXA 4P9UA 2L54A 5C44J 2STWA 4Q48A 5ICCA 4KA4A 1W5CC 1HSTA 2KQRA 3DEEA 1VQ8I 2MH2A 3RI4A 1XD7A 4ZTFA 1MNMC 4B8XA 2W24A 4OIOF 3LSKA 3OL3A 1HKSA 2V9VA 4IHXA 5J47A 1S8NA 2M87A 3QOEA 2PBIA 1QO0D 1P9QC 1WPKA 2VXZA 1GXPA 2DMPA 4U7BA 3RQ4A 4BE1A 5D4RA 2X1CA 1HLVA 2Z16A 1B9MA 4A3CJ 2LRDA 4I09A 1LE8A 1SVLA 2LREA 2JQ7A 4U0YA 1N78A 2Y69H 2E7WA 2CRGA 3GW2A 4A93J 3LQQA 2JT1A 3DPTA 4XLAA 4P55A 1XDSA 5IYDJ 1TLHB 2HYFA 4B3XA 4OIPF 2K40A 4R8HA 3HL2A 3K1NA 2FXAA 2MLKA 2HNHA 3L1PA 3CJRB 2VKVA 2IA1A 3BG9A 1P7IA 5HVQC 1BOBA 2KPMA 5HLGA 3HOUJ 3MKYB 1MZBA 2XVCA 2MLGA 3IRQA 2DA7A 4M6VA 4N4OB 4Z2YA 4HV6A 1G3YA 3WTZA 5EJCA 4CYDA 1YX3A 4BY7J 4CDGA 3OY9A 4C30A 4IHTA 3CUOA 2VE9A 1QQIA 3ZR8X 3N4MA 4IOCF 2TRTA 5DEQA 2HI3A 2CUFA 2K5CA 3GLLA 2QSFX 4A5NA 3EYIA 2K9LA 5D8LB 3GX4X 4AIDA 1MBJA 2H1LA 4B4CA 4EJTA 1IUFA 1KU9A 2LY2A 3PUFA 3P9KA 4G6TB 3Q0VA 2IGMA 4L9NA 4U0WA 2XKPA 2P6SA 4FX0A 4KUMA 3K4BA 2YX7A 3BZ6A 3IH2A 4Q5SF 3R0JA 2XV4S 1ERDA 1IN7A 1QRYA 2UV1A 3TW7A 1QU3A 2M9HA 2BXZA 1ACIA 1JHFA 2XAJA 1J0RA 3R4KA 4X1EA 1T2KA 3K4KA 4M6YA 3KYLA 5CVIA 1UZCA 5IYBJ 4BYYA 3NAUA 1AHDP 1BI1A 3HOWJ 3BWGA 2GA1A 2GZWA 2F4IA 3ERED 3S1MJ 2QBYA 4KICA 4ITVA 5BMZA 1T08B 5FD5A 2V1UA 2KIFA 1MH4A 3E6DA 3H0GJ 4XONA 3HJEA 1ZRDA 1ON1A 1MGTA 3GMEA 2IBDA 4A3FJ 1I39A 4FASD 3JRDA 3B73A 4ZYGA 2AS5F 3MN2A 1WJ5A 4MEYF 4NUBA 3WHCA 3MVPA 4I02A 4UHTA 5LGTA 1RKTA 2DT5A 2BZTA 3KPHA 3LSPA 2JVHA 3H5AA 3LSMA 5L3GA 1ON2A 1GXQA 5GAEJ 1WCMJ 4CXFA 4XSXF 3OYLA 2A68F 4GDFA 5LGNA 2DYSH 4ZYAA 2DTZA 2JSCA 2MGQA 3AG2H 2O8XA 1Y6IA 5JVTA 3V42A 4ABZA 4RGUA 5ICEA 3LFKA 4IJAA 2HVSA 2EZLA 1U3EM 4CCJA 1EA3A 3K4LA 2R5YB 4N0BA 1L3LA 3C1DA 3IV5A 2A07F 2EPFA 3LL7A 3OWTA 4PCQA 1FSHA 1FLIA 3FXQA 2NYXA 2V1DA 3IUOA 2CUJA 4LGWA 2CU7A 2KMUA 3SDGA 5DM7F 1ZKGA 2AO9A 1IGNA 5CKTA 2CW0F 1Y39A 2HXOA 2LFBA 2P5KA 1GDTA 1QZZA 3CQZJ 1IC8A 4UB8C 3JSOA 3QYEA 1R5HA 2F4OB 4C2UA 1VQKI 2ZXJA 3GZ5A 4WXDA 1YG2A 3K4CA 3HRMA 2LY9A 2O0YA 2XAQA 4EQQA 4AVZA 2Y31A 4AIKA 1FMVA 2JK3A 1R7JA 3TKYA 2A61A 1DGRM 3K70C 3BTJA 2ELKA 3KE2A 5HS9A 4HDVA 2VN2A 4BACA 5L3BA 2PG4A 3CJQB 1Y0NA 4S04A 2V6CA 4B48A 4E7JA 3IP4B 5HLIA 1KU2A 2C6YA 2IA0A 5ICFA 3MD2A 1P7JA 4C2MJ 3JRBA 5IT9Z 1OCTC 2ECBA 4HX7A 3ESWB 5J40A 1AA7A 3MMYB 4DBQA 4A3BJ 1VFCA 1FBQA 2BVMA 2GOMA 3ERMA 5GAHJ 3TQNA 2ESHA 4CCOA 2IA2A 3WG9A 1WJCA 1X1AA 2BVLA 1Z05A 5IT9K 3S8PA 5FD6A 1TT0A 2K27A 3HRTA 2H09A 3PNYA 3HRSA 4OIRF 4YFNF 4RBOA 3PNVA 3CC4I 1D8KA 5HLHA 2X48A 4B1RA 1R6RA 2JA6J 3D5SC 4DBRA 2EV6A 4N9HA 1IN6A 2MABA 4M6XA 4CCNA 2D5VA 2OA4A 4OMZA 5F1JA 1X4OA 1HDPA 4IHWA 4LB6B 4BY1J 1WI3A 2OC6A 2V9KA 5EGOB 2EIKH 5F6FA 1U8BA 1K6OA 4JP0A 1APLC 3CTAA 3HIFA 4EJOA 4UB6C 2Q2EB 1KYZA 2X6XA 2RKHA 2E1OA 3TL4X 2OUMA 2FNPA 3L2RA 4G7ZF 4PDKA 1D1BA 1XX5A 2KRHA 3HUGA 2DQRA 4HPQA 1IRXA 3OS0A 4BNCA 2ZJPF 4BE0A 1T33A 2L9SA 1F36A 2Y75A 4I98B 4BDYA 4CUGA 4XN3A 1MIJA 3KLNA 1X3ZB 2UWMA 1WZ2A 4OAZA 1BJZA 1QZEA 1JT0A 3HKZN 1S29A 2FRHA 2HOTA 4RB1A 2BHZA 2RGVA 4AYBN 1MDMA 3DFGA 1X58A 4IOAF 1WJAA 1T98A 2FSWA 4C3HJ 1P6RA 1ENHA 1OR7A 4KMFA 1FX7A 2W25A 3AFHA 1SFKA 1L0OC 1JKPC 1VQLI 2GA2A 4NQWA 1VQMI 2VE8A 3VSKA 3LSRA 4G7OF 1B6AA 1MBEA 3IH4A 4M73A 1YTYA 3J7AO 4L5JA 2IGNA 2M0CA 1I6HJ 3BR2A 2HVQA 4QPOA 5M5WJ 2H94A 4FISA 4CYCB 4KIFA 2QKMB 5DM6F 1LVKA 1OJLA 2QF7A 5GTIC 1A6QA 3CCEI 2VB6A 3F21A 3IWFA 4LB5A 2DQLA 1JTXA 3CUQA 3Q9SA 2Y0SN 5E3OA 3DP7A 3QRFF 1U8RA 2GBYA 4MLOA 5F08A 2VKDA 3KFWX 3T8RA 1FOWA 1E3OC 1RRJA 1TWHJ 4E7SA 2BY2A 2Z33A 2Y0MA 1ORKA 2TDXA 2JRTA 3I56I 1WHUA 4RM2A 5FFXA 2LKXA 4ZTJA 3JRAA 4NC6A 2RN7A 3GWZA 4WXCA 4D7MA 2IGKA 2HPMA 1YRNA 2HOEA 1V5EA 1PJRA 1SFEA 4G8XA 3RQIA 4LJZF 2K3FA 2AQFA 4CCMA 2L0KA 4I0BA 1YJWI 3BR0A 4L0YB 1FTZA 1YS7A 2FBIA 4EM1A 3O3KA 2IPQX 2FJ1A 2ZMEA 4L9JA 5E3MA 4ENJA 5IYCJ 4MHGA 3R60A 3OV8A 1W5SA 2ADUA 4RM3A 3IHUA 4HG2A 2JZYA 1WI9A 3HUGB 3F8FA 2GOXB 4NDLA 2BV6A 3DBLB 4GRIA 1TWCJ 2DW4A 1LDJA 2WADA 2F5DA 1C0WA 1IXRC 3EYYA 4AU7A 4BQNA 5ICGA 3RYRA 4IKFA 4CCLA 3BQYA 2A5YB 2QM3A 1Z7LA 3K2ZA 4E6KG 1MDMB 1T56A 3DWLE 3ZN0A 2CQNA 4WX9A 2G7UA 4YG2F 2Z5UA 1GV5A 3JAMK 5FLXZ 1UB9A 4D0PA 1BI0A 1G3WA 4PUSA 4EJWA 3Q5FA 9ANTA 3H0DA 1D8JA 2DFHA 4NQWB 5HDKA 1A31A 1MJBA 3A0HC 2MG4A 1Q1HA 2VQCA 4MTEA 3ABKH 3SYTA 3VDXA 2FBHA 4XRMA 3CDLA 3DPLC 3S32A 1E2XA 1TQMA 3DEWA 3RKXA 1VQPI 2QWWA 1OCRH 3KLOA 4A3GJ 1BBYA 3VPRA 5IT3A 2X9DA 1TQPA 2F4MB 4G6QA 2JTVA 3F9KA 4II2A 2COMA 2E1MC 4IO9F 2ZB9A 1ZGWA 2NS8A 4PJLA 1IO2A 3OYGA 4G7HF 3S17J 1T0FA 4LOCA 3TW6A 2O61A 1Z0XA 1K61A 5E18F 5GPAA 1R00A 4XKVA 2CO5A 2IT0A 1S7AA 1YRNB 3FMQA 1FJLA 3BQZA 5CLSA 1YW8A 2MC4A 2PMZN 2Z2SB 2EIJH 2X51A 5FGMA 5ILSA 4AYBA 3GFJA 4XKWA 3L09A 2XGEA 2JSPA 2DAOA 1BM9A 3WU1B 4ZZLA 4DJAA 4C3IJ 1SD5A 2GIZA 1K78A 2ZMEB 1KU3A 4BXUA 1NHAA 3I54A 3ML6A 1ZG5A 2WBMA 1YX5A 5C4JJ 4ENKA 1ZR2A 1JUSA 3W6KB 2VLAA 2LNBA 2DFEA 1X1BA 4WWCA 3GTOJ 3SZGA 3U1KA 4KDPA 5EZHA 1N77A 1XMXA 4H0EA 3D5LA 1S72I 4ESJA 2XAUA 1F5TA 3HC7A 1A36A 5A2QZ 3S1RJ 4X0GA 3VYRB 3DTIA 2M4KA 4BHBA 2F5CA 4CHUA 3I3LA 4NB5A 2B0LA 1N75A 2KFDA 3HTSB 1XSDA 3I9V2 2K4BA 1TWFJ 4XRFA 2CV2A 2CW7A 5A2QK 1J7KA 3H9JA 1WRJA 5L3FA 2M8GX 1JXSA 2DOFA 5J1RA 4BGDA 1FIAA 2ID3A 3H3UA 2AXTC 3BG3A 2LKSA 2NVYJ 3CP8A 4IVNA 3MKWB 1VQ6I 3FISA 3DQVC 4G94A 2XC7A 2VQGA 2G9WA 2E2JJ 4ZYEA 1R71A 1R4NB 4PJ0C 2KJBA 5M5YJ 1XMKA 2BHYA 1VQ9I 4AC0A 1HW1A 4KNYA 4DZPA 3BC8A 3QPTA 1ZK8A 1R5ID 5B66C 5BS6A 4BXXJ 2IXSA 1EKEA 2L7ZA 1YYVA 2DK5A 2VI6A 1FOXA 3K2AA 2BW3A 3M8EA 4Y33A 1JGSA 4CICA 5ILVA 3E7LA 1MKMA 1OYIA 3CCVI 2YPRA 2DPUA 3LQRA 2R0QC 2VKHA 3CCYA 3FDYA 3V8JA 4KT6A 3MZHA 1VQ5I 1G2HA 2NXNB 1I1SA 2VT3A 3G4SI 3IL2A 3FXMA 1QPIA 3RKQA 4FX4A 1BI3A 1IUYA 2ECCA 2X6WA 4JYKA 5D5UB 1IG7A 1K78B 2FNAA 3WGHA 2IS2A 1OYYA 2DOAA 1B72B 4EGZA 1ETWA 3LNQA 3IC7A 1IXCA 1W0TA 4HQMA 5CVRA 3HGYA 4NC7A 3V8KA 4YELA 4YFXF 2R7OA 5TGTA 2ZXIA 1X2NA 4V2GA 2KIQA 3ASNH 3RKWA 4BU2A 3D1NI 4O6JA 1J5YA 5EEGA 4FQGA 1T8IA 1VQ7I 2ICWG 3RPUD 2PMUA 4X6AJ 1YO5C 1P4WA 4L9TA 5EYRA 3OYJA 3SDBA 3WTVC 2L2OA 2K86A 2FOKA 1X19A 2EZIA 3H5RA 4LIVA 3OYBA 1KONA 1VTNC 1IZ1A 1FT9A 2FE3A 1LFPA 2YS9A 2PMZA 4C9YA 2E34A 5J8CA 3ZPLA 1GT0C 1PYVA 2K3PA 4RDUA 3UNGC 4E7ZA 3JREA 2PX9A 3D0SA 1XC5A 3W6JB 3BLYA 2WWYA 5JVGF 4BHCA 4ZDPA 1MJAA 1USTA 2KRFA 2DMQA 2WV0A 1FPQA 1A04A 1AOYA 1R22A 2LF7A 5CQEA 1Y56A 3CJTB 1ZARA 3HBLA 2BW3B 4DZJA 3KEQA 1RR7A 4BHPA 4HQEA 2ZO4A 4XBFA 3U21A 3CCQI 2UXNA 4RMNA 1Y1WJ 4WF2A 3T5XA 3D5RC 1HOMA 5K5QA 4HV5A 1IRZA 1KZHA 2R7TA 5IP9J 3AG4H 3TP3A 4KJZA 2EZKA 2X6YA 1W7PA 1U5TA 3BDDA 2COBA 2RQPA 2O6GE 1DUXC 1YITI 2PJRA 2IEKA 5IOZA 4LG0A 4HX8A 3OYKA 3FXLA 1IN5A 2ZFWA 3OIOA 4EJUA 2QYOA 4O5VA 3TO7A 2O9LA 3H35A 1J9IA 4I0AA 1KU7A 4MEXF 2DT7B 4IPAA 3G2BA 1ZG3A 2DA6A 4M3BA 5C3EJ 2OPTA 1D0YA 4CA0A 3EQLF 1UHWA 3J7AY 2QGUA 2E1NA 4Y17A 4A3IJ 1YS6A 1R23A 4ENMA 1UFMA 4I99C 3A2KA 3FXKA 2PJPA 5LD2C 2ZJQF 1TQIA 3CO7C 2LR8A 3A1YA 3I0TA 2E2IJ 1R9TJ 4BDZA 4KISA 5LEJA 1E3HA 3QODA 5LHGA 3A01A 5ED4A 2M0MA 3DCFA 5FKOA 5JHFA 1VI0A 1Z91A 1IDZA 4FCYA 3I59B 4PGGA 1OCOH 1O3SA 4ESFA 2CSOA 1ZG1A 4HF1A 3CF2A 2XAFA 5FJ8J 3Q3SA 1SANA 3PQJA 2GLOA 4QSHA 2NVQJ 1WSUA 1O7LA 4LITA 2JA5J 2QQ8A 1MJ9A 2J5OA 1KA8A 5IOYA 5CVVA 1ZYRF 2HTJA 3M3YJ 2LOOA 1JHHA 3HTUA 3OOPA 3LSHA 2HPIA 2ME6A 4JK1X 1WQ2A 3FIWA 2AHQA 2R5YA 1VQOI 4PJJA 1T39A 4EATA 3CCLI 2XHKA 2O8KA 4W1UA 2JPCA 2KLOA 4OINF 3UKGA 3A03A 4Z6YA 1X2MA 2M7BA 3JRGA 2NS0A 3L9FA 2M1BA 3ZRGA 2WB1N 3I58A 3RIRA 3QPSA 5DUKA 1VNDA 4C3JJ 3TO6A 1W7PB 2VBYA 1U5TB 3QYBA 1CGPA 5LEKA 3HSRA 3TDUC 3JSPA 2PJRB 4LG0B 1BC8C 2B63J 3ABLH 3IAS2 3T8TA 2RAEA 3KYDB 3G3ZA 2MD0A 2JUCA 2DOEA 1Z3YA 1YE9A 3GTJJ 1JTYA 2ZCWA 5LHHA 4GGGA 4U87A 5E8IA 4ZYHA 2LP0A 1TT5B 2R92J 3KP6A 3A02A 2B7EA 4PFPA 2VT2A 3OYCA 4JQFA 5E1ZB 3FZVA 2ISZA 1LFBA 4LK1F 4YIFA 2KZVA 5FFZA 3F0CA 3CCUI 3TBIA 2AQEA 3F22A 4LLLA 4A5MA 3ZXSA 3AG3H 1OYWA 2HQRA 3A01B 3OIPA 2VXDA 3ABMH 2DA1A 4M74A 3KIOA 2R7SA 3G71I 2JPBA 3EUAA 4A12A 5K5OA 2HDCA 2OTJI 2UUZA 3S2HJ 2CUEA 4IQ4A 1HDDC 3QPHA 4DYCA 2RREA 2XGCA 1V3FA 4HNUA 4HW0A 1DDNA 2XF7A 2MC3A 1MD0A 3MQ0A 2XGDA 2EILH 3VYUB 1J2XA 3VSLA 3QP6A 4MFDA 1PDNC 1OCZH 3BR5A 2HGCA 3GUDA 2R7VA 5EGOA 4OIQF 2DMTA 3B02A 3HYIA 1G3TA 2Q2EA 2QA4I 1IF1A 2PI0A 5FROA 3ULQB 4QLCU 3TEDA 4UV9A 2F6CA 1FEXA 4BE2A 1LEBA 1V54H 4F52A 2M2EA 2HXIA 3RPUA 2HVRA 1FP1D 2V6EA 1LFUP 1JGGA 5LBQA 2XROA 4JX6A 4F93B 2QLZA 2ACJA 3FF5A 4JX4A 3A4CA 4V2FA 3OYNA 2HFHA 3HSEA 4DIQA 4WXHA 3OYDA 3CLQA 4HNVA 4IL6C 3ZQIA 2P7CB 1OFCX 1BIAA 2HDDA 5LHIA 4AWXB 4YIIA 1A6IA 3NEUA 4A0YA 3AAFA 2XAHA 2FMYA 4Y52J 1F4KA 2YSRA 2MH9A 3LOCA 3NWSA 4M9SA 2JUGA 4UY8I 3C2HA 2R4GA 4D7NA 1X4PA 4A3DJ 1U6GA 4OWRB 3M4OJ 2OV7A 3ZQHA 2F2EA 3E1SA 1IRGA 4FHTA 4ENNA 3I5UA 3I64A 4F3QA 3RDIA 3ECOA 3W6VA 3OYAA 5D6FA 1QNTA 4HZFA 4CYCA 2JJ7A 2LD5A 4XLCA 1XDUA 1DP3A 5KVRA 1JT6A 3GTMJ 3P9IA 4XICA 1HXDA 2VBWA 3LSTA 1VQ4I 3GO5A 5EZGA 3T0YA 2K9QA 2KZGA 3WGGA 2V7FA 4IEJA 1Y8QB 1FIPA 2GXAA 3QPLA 1XS9A 4KIGA 2VC0A 3RYPA 5K5RA 2EA4A 5D5WB 2JA2A 1XG1A 1IXSB 1MSEC 4IX7A 3CLOA 2BXYA 1ETKA 1FMWA 2FMLA 2EB7A 4XRSA 3JTHA 3DKWA 1OR7C 3ZQGA 5D6EA 4BBSJ 4B09A 4D9JA 1CQTA 3LWFA 1D5VA 4J19A 1V5FA 4QWQA 3QU6A 2JRMA 1FOYA 2Y30A 3L7WA 4Y7NJ 1G59A 1HA8A 2OAZA 2RNJA 1JJ8C 3J80Z 1Z7UA 3I55I 3W2AA 1MNEA 5AIPA 1NG6A 1MSFC 2K9MA 2ZNYA 3F6VA 1I3AA 1I5ZA 3RSNA 3C18A 3LFUA 4C2TA 2FU4A 3AKZA 3LA3A 2WA0A 1WVRA 2XPWA 3MCZA 2KL4A 2VC1A 2L9RA 1PVEA 3DKXA 1XCVA 4ETSA 5FB2A 1TZLA 3VYTB 2FA5A 3J80K 2D1HA 3LA2A 5JLXA 1FZPB 2HQAA 4IRIA 2ZSHB 3CD6I 2DCEA 2EINH 2MA3A 2IS6A 2FF4A 4ANJA 2L02A 3V7CA 3R6SA 4Q47A 1WH5A 1W36D 1V4RA 4FT8A 4BUPA 3FK7A 3ZQFA 2ETHA 5E79C 1D3YA 5L3EA 1HBXG 1I1GA 1ZN2A 1OCPA 1WJFA 3KP4A 2CGPA 3KP5A 3DLLF 1W1WE 3ZMSA 3ZMVA 3DBRB 2M45A 2OTLI 1RUOA 2O3FA 3HXLA 2XASA 3I4PA 3FMRA 2VJJA 4EEFG 5E8GA 1BN5A 2V1NA 3B6AA 2CUZA 2A5WA 3KZZA 2DO7A 2XPVA 2FQ3A 3K0LA 4G9YA 1BI2A 4S0HB 3CZ6A 3IWZA 4OU0A 4ZC3A 3TO9A 1R1TA 2OQGA 3BJOA 3S3OA 2KKOA 3H92A 1FOKA 1B9NA 2Z99A 1HCRA 3OYIA 4RAZA 4AM3A 2OD5A 2KDZA 2IW5A 1WJDA 1WJBA 4P5OA 3PUBA 1ZQ3P 5HNFA 1ETVA 1KGSA 5L3CA 1YIOA 2F5EA 1IDYA 2A69F 1QVTA 5HS8A 4DYRA 2EFNA 1J75A 1EJ9A 3EUHC 3C2BA 3H36A 3OL4A 2ZNZA 1OLTA 2CQXA 5LRSA 3F72A 2Q0OA 1YQAA 2MFZA 3LSIA 4UV8A 2Y9YA 5JLWA 2DMUA 3JAMZ 3BJAA 3FM3A 3KP7A 3LAJA 3L2VA 2K7LA 1IV6A 2XRNA 4IHVA 1V55H 3K1PA 4ON0A 1I27A 1WJEA 4RLFA 3ZP5A 2NS7A 2VJ5A 2QENA 4A3MJ 2FQ4A 2LSOA 4JOMA 5FRMA 3T1BA 3KEOA 4D5CA 4ZH4F 3S93A 1DP7P 2JMWA 2LKPA 4IQJA 1W7PD 1XTAA 1U2WA 1P4XA 3GVAA 5J4YA 5EF6A 3VOEA 1X1PA 3CMAI 2BOLA 1OISA 4ESBA 3JTGA 3BTCA 4XKBA 3ASOH 3DBHB 2W1OA 3W3CA 1ITYA 2GXGA 1TW2A 1F43A 2LC2A 2FD5A 3HEFA 3WODF 2JA8J 3KEYA 3TP0A 3HOZJ 3TOAA 3KCCA 1IN4A 2ELHA 4HBLA 1GV2A 1RKWA 5CPRB 2EFOA 2W48A 2HTSA 2KP6A 3ROUA 4XRSG 2VOPA 1QHGA 1Y0UA 3OYEA 3FXOA 4M72A 4HSTA 4EV0A 2EQRA 5F64A 1W0UA 4GO1A 3OYMA 2NOJB 3E3VA 4FE4A 5IP6A 5KHDA 5ERIA 2BEOA 3IRRA 2MYSA 1LJ9A 4AIJA 3PSIA 2V9PA 5JI6A 3BZCA 2HU9A 4UVAA 4KIBA 4HA8A 3E6CC 1KQ8A 3BTIA 3IKVA 3HKZA 4MIMA 3ZMUA 2OCCH 5GAGJ 2KIUA 3ISPA 3K69A 3NWTA 4XOPA 2L7KA 2UZKA 4GYIA 2HS5A 4MQVA 2F5FA 1WFXA 2R7DA 1W4MA 3M8JA 2HEOA 5D5VB 1JJ6C 2DLLA 2ZBKA 1B72A 3GTQJ 1FTTA 5DD4A 3PNTA 4GFBA 1IV8A 1USSA 3KYCB 2DFFA 1NG7A 2QEXI 1P4AA 1XGSA 1AWCA 3L2WA 3BOQA 2NVUB 4LLGF 3LMMA 3OYHA 1MW7A 4M3GA 1MBKA 2ELJA 1K79A 4CGZA 1SMYF 2VASA 3O2PE 3WE2A 1QPMA 5TRDA 4L5EA 1G8XA 3F8BA 2Y0SA 1Z67A 2H8WA 2HZTA 5CVJA 4YRVA 3Q0UA 3S3MA 3PO3J 5E1XA 4IHYA 3FXUA 3FMSA 1D0ZA 1ETOA 2DA4A 3KP3A 3IKTA 2ISYA 4D5FA 4XLFA 3GYHX 5M3FJ 1D0XA 4JX5A 4KN4X 2CFXA 4M71A 4YEJA 2HOSA 1S5LC 2R7UA 4F91B 5HDNA 3HOSA 5F0CA 3M9AA 1N25A 1RNLA 1EH8A 4CZCA 2R7QA 1RIOH 2IP2A 4GXOA 5BPDA 3U9GA 3QU3A 5K7ZA 1IRFA 5IY5H 1H0MA 3JW4A 5H6RA 1ZGJA 3F8MA 1ZR4A 4MNUA 4P96A 4HNTA 1Z77A 1WGXA 1WKMA 2KJCA 2Z9OA 3BTLA 3WTWC 1F9NA 2LLKA 4A3KJ 2M8EA 4M3EA 5GADJ 1O3QA 1FP2A 3WG7H 3BG7A 1BC7C 4RA2A 3A0BC 3ABUA 3BR1A 4B3AA 3HOTA 2K9NA 1E3PA 5FKLA 1ZGAA 3WTYC 4EMSA 5CYVA 3NARA 3MKZA 1E0EA 2X1EA 3R61A 4IRGA 1I3QJ 2K85A 1O7FA 1FYLA 1HKQA 2DMNA 1SVOA 4HYEA 5KAFC 2ZJRF 2P6TA 4LIUA 1MNDA 2HQ5A 1HKTA 3GFLA 1FBSA 1MMAA 1JUMA 3HDDA 2XF6A 2RC4A 1QGPA 2DA5A 1MMSA 3H9QA 1Z1DA 3RZOJ 1ETXA 1ULYA 1ZELA 2EJRA 2W82A 3P7NA 2HKXA 1KYWA 3GBGA 4P1WA 1UG0A 4KFCA 5DCMA 2XKOA 1PP7U 3PM1A 3JCUC 3HOXJ 1K4TA 2XSJC 4A3JJ 1S3JA 2VQHA 5EEAA 2XB5A 1XPXA 1FC3A 2IJLA 1R1UA 5TJJA 1LQ1A 2IVMA 2XUBA 4Y4RA 2E1MB 1OMIA 1IAWA 2FBKA 2MBFA 5JHUA 2EH3A 1O3RA 3GLXA 3M1EA 3I59A 4XLEA 4A0XA 1SFOJ 5K1YA 1R36A 1MBHA 1LEAA 2BGCA 2ESNA 5EG0B 2DODA 3FXRA 4CZZA 1BW6A 3FK6A 1O3TA 1TWGJ 3C3WA 1X3WB 3HOYJ 3CMMA 3HSFA 2XDVA 4LG3A 4E7HA 2D45A 2RVCA 2CQKA 4OOIA 4EM2A 2RNGA 5HODA 3VWBA
chains in the Genus database with same CATH topology
3JRIA 1BJZA 1JT0A 3HKZN 3A01B 2HOTA 2EBIA 2WAQN 1QVUA 2DA1A 4AYBN 1DU6A 4A3LJ 1X58A 3S2DJ 1H89C 4C3HJ 1ENHA 3IH3A 2CUEA 1HDDC 3S2HJ 4DYCA 2XGCA 3ZQLA 3HGGA 4A3EJ 1JKPC 1UHSA 3G1OA 2NOGA 2L7MP 1RETA 3LSRA 2XGDA 1H88C 3HM5A 1MBEA 3IH4A 4DYQA 1BW5A 4MFDA 3BR3A 1I6HJ 2M0CA 3BR2A 5M5WJ 5DTDA 3BR5A 2G0EA 4FISA 4CYCB 5EGOA 2DMTA 2P81A 1OJLA 2QF7A 3ZOBA 2E19A 1IJWC 1U78A 5EG0A 1JTXA 5E3OA 2Y0SN 3TEDA 1HF0A 1FEXA 2GBYA 4MLOA 5F08A 1ZTRA 2M2EA 2XSDC 1E3OC 2XB0X 2HXIA 1TWHJ 3JR9A 2K9SA 3I4NJ 1LFUP 1JGGA 1ORKA 1JKRC 3O8HA 4JX6A 3S1QJ 2LKXA 2CQQA 5FKNA 1MBGA 4JX4A 4V2FA 2DJNA 3JRAA 2QCOA 4D7MA 1NK2P 1YRNA 3GTKJ 2ID6A 4HNVA 3ZQIA 1EF4A 1OFCX 3RQIA 2HDDA 4I6ZA 2LTPA 1A6IA 2L0KA 3G1LA 3BR0A 2OF7A 2CJJA 4Y52J 1FTZA 5IPAA 3LOCA 2FJ1A 5E3MA 5IYCJ 4D7NA 4A3DJ 3H3VK 3M4OJ 1PUFA 4BKXA 5F0FA 3ZQHA 4NDLA 4XK4A 1TWCJ 3K7AJ 1MH3A 3S16J 1TC3C 3W6VA 4CYCA 2JJ7A 4M3FA 2LD5A 1D5YA 1ETQA 4M3DA 1JT6A 3GTMJ 3BQYA 4XICA 3S1NJ 2VKEA 1AU7A 5EZGA 1T56A 2DA2A 3MKLA 5M3MJ 2K9QA 5M5XJ 3OSFA 4IEJA 1GV5A 1FIPA 5F27A 3QPLA 2XPUA 1XS9A 9ANTA 1GVDA 1NK3P 3LSJA 5GPCA 1XG1A 1MSEC 4MFEA 2JA7J 2MG4A 3LSGA 1ETKA 4XRSA 5J3LA 4DW6A 3ZQGA 2N8GA 4XRMA 4BBSJ 3BR6A 3CDLA 2O7OA 1CQTA 3DEWA 4J19A 1RPWA 4A3GJ 1WH7A 3VPRA 2Y30A 2X9DA 4Y7NJ 2ZB9A 1ZGWA 2NS8A 4MO7A 1JJ8C 2R7ZJ 5BNGA 3S17J 1MSFC 4LOCA 3TW6A 5FLVA 1Z0XA 1K61A 5GPAA 1JKQC 5FKMA 2XPWA 3QQAA 1YRNB 2L9RA 1FJLA 2JN6A 3BQZA 2PMZN 5K7HA 5JLXA 1I50J 5C4XJ 2XGEA 2VUMJ 3WHBA 1GUUA 4C3IJ 1K83J 1LE8B 1WH5A 5C4JJ 4QTRA 2EZHA 1ZR2A 1PUFB 3BG5A 1JUSA 2DN0A 3FK7A 1JUPA 3ZQFA 5EDNA 1A5JA 3GTOJ 1OCPA 4QIWN 3GTGJ 2FX0A 5EZHA 1ETYA 4UUTA 2XRLA 2VPRA 3S1RJ 2IAIA 4EEFG 3GTLJ 3B6AA 3JRFA 3FKIJ 2XPVA 3ZQCA 2R5ZA 4S0HB 1B8IA 1TWFJ 5C44J 1O4XA 1HCRA 2M8GX 1MNMC 2MW8A 5J1RA 1FIAA 2ID3A 4IHXA 2KDZA 3BG3A 2NVYJ 3FISA 1WPKA 2E2JJ 5F04A 1ZQ3P 2DA3A 2DMPA 1ETVA 5M5YJ 4AC0A 1HLVA 4A3CJ 3G1MA 1IDYA 1QVTA 1LE8A 4DYRA 2M34A 4DZPA 1ZK8A 3B6CA 3C2BA 4BXXJ 2L7ZA 2CRGA 4A93J 2VI6A 2CQXA 5E3LA 3K2AA 5IP7J 5IYDJ 2Y9YA 2K40A 5JLWA 2DMUA 1IV6A 3E7LA 5J1YA 4IHVA 2X6OA 3L1PA 2R0QC 2VKVA 2NS7A 3BG9A 3CCYA 4A3MJ 2FQ4A 1P7IA 1G2HA 3HOUJ 4D5CA 2JMWA 1QPIA 3HB9A 3RKQA 2ECCA 4UUSA 2DA7A 4JYKA 4M6VA 1IG7A 5EF6A 2Y9ZA 1B72B 2NVTJ 1ETWA 1MBFA 3BTCA 3LNQA 1W0TA 3JRHA 4BY7J 2HOAA 3HGYA 1JKOC 5FKKA 1ITYA 1F43A 3HEFA 2FD5A 2JA8J 3TP0A 2TRTA 3HOZJ 1X2NA 2CUFA 2HI3A 4V2GA 1POGA 3S14J 1GV2A 1RKWA 1S7EA 3D1NI 4A69C 4XRSG 2W48A 1MBJA 4B4CA 1IUFA 2EQRA 1W0UA 5K7FA 4XIDA 3Q0VA 3SFIA 3SJMA 3HOVJ 4X6AJ 2JWTA 4FE4A 5IP6A 2R5ZB 5EYRA 2GM4A 1B8IB 3IH2A 1UMQA 2MSYA 1RESA 2KT0A 2EZIA 1QRYA 3TW7A 2M9HA 3BTIA 2YS9A 4X1EA 4MIMA 5IYBJ 3NAUA 1AHDP 1GT0C 3HOWJ 4RDUA 3JREA 1XC5A 5J1UA 3S1MJ 1JJ6C 2E2HJ 1B72A 3GTQJ 1FTTA 1MH4A 3H0GJ 5GP9A 4GFBA 3OSGA 2LVSA 2DMQA 2IBDA 4A3FJ 3JRDA 3HBLA 4DZJA 5FLMJ 3MN2A 1RR7A 3WHCA 3MVPA 4M3GA 2HYJA 1MBKA 1RKTA 2ME0A 1Y1WJ 3LSPA 1HOMA 1IRZA 4L5EA 1WCMJ 5IP9J 3TP3A 2EZKA 3Q0UA 1AKHA 3PO3J 2COBA 4IHYA 2DTZA 2MGQA 4UUSB 3GTPJ 2IEKA 5IOZA 1BA5A 1Q1VA 4ABZA 2NVXJ 1ETOA 2DA4A 4W97A 3OIOA 2L7FP 2EZLA 4D5FA 2O9LA 5M3FJ 2I10A 4JX5A 2R5YB 2DA6A 3OOUA 4M3BA 5C3EJ 3IV5A 2OPTA 2HOSA 2YUSA 3I4MJ 4A3IJ 5F0CA 1VF9A 2CU7A 3SDGA 1ZKGA 2Y2ZA 2LK2A 2AO9A 5K7ZA 2TCTA 1IGNA 2LR8A 2E2IJ 2HXOA 1ZR4A 1R9TJ 1Z77A 1WGXA 2LFBA 1GDTA 4FTHA 3CQZJ 1IC8A 3BTLA 2LLKA 4A3KJ 4M3EA 3A01A 5E3NA 2R93J 2LY9A 3DCFA 5FKOA 3BR1A 4B3AA 2Y31A 3RZDJ 1VI0A 2K9NA 1IDZA 5FKLA 2JK3A 4FCYA 3S15J 3NARA 3BTJA 2ELKA 4G12A 5FJ8J 1I3QJ 3Q3SA 3PO2J 1SANA 2DMNA 2GLOA 4QSHA 2NVQJ 1UG2A 2YU9J 2JA5J 1BL0A 1P7JA 4C2MJ 4FE7A 5IOYA 3JRBA 1OCTC 2HQ5A 1Y1VJ 2ECBA 3M3YJ 1JUMA 3BT9A 3HDDA 3Q0WA 4A3BJ 1VFCA 2DA5A 2ME6A 3RZOJ 1ETXA 3FIWA 2AHQA 2R5YA 2O8KA 4W1UA 4AUXA 3GBGA 3UKGA 3A03A 1X2MA 3JRGA 2H1KA 4I76A 3PM1A 2H8RA 2WB1N 4RBOA 3HOXJ 3QPSA 1VNDA 4C3JJ 4A3JJ 1AKHB 2X48A 4B1RA 5EEAA 2XB5A 2JA6J 2B63J 2D5VA 5F1JA 2RAEA 1HDPA 4IHWA 4BY1J 1WI3A 2EH3A 5EGOB 1U8BA 1DU0A 4JP0A 3GTJJ 1SFOJ 1APLC 1JTYA 1MBHA 5DS9A 2LP0A 2WV1A 2E1OA 5EG0B 3JRCA 2R92J 3O8GA 1U9OA 3A02A 1BW6A 3FK6A 1U9NA 1TWGJ 3HOYJ 1T33A 1F36A 1H8AC 1LFBA 4BBRJ 1TWAJ 1NTCA 3F0CA 5F0HA 5HODA 3CMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRI A;  1BJZ A;  1JT0 A;  3HKZ N;  3A01 B;  2HOT A;  2EBI A;  2WAQ N;  1QVU A;  2DA1 A;  4AYB N;  1DU6 A;  4A3L J;  1X58 A;  3S2D J;  1H89 C;  4C3H J;  1ENH A;  3IH3 A;  2CUE A;  1HDD C;  3S2H J;  4DYC A;  2XGC A;  3ZQL A;  3HGG A;  4A3E J;  1JKP C;  1UHS A;  3G1O A;  2NOG A;  2L7M P;  1RET A;  3LSR A;  2XGD A;  1H88 C;  3HM5 A;  1MBE A;  3IH4 A;  4DYQ A;  1BW5 A;  4MFD A;  3BR3 A;  1I6H J;  2M0C A;  3BR2 A;  5M5W J;  5DTD A;  3BR5 A;  2G0E A;  4FIS A;  4CYC B;  5EGO A;  2DMT A;  2P81 A;  1OJL A;  2QF7 A;  3ZOB A;  2E19 A;  1IJW C;  1U78 A;  5EG0 A;  1JTX A;  5E3O A;  2Y0S N;  3TED A;  1HF0 A;  1FEX A;  2GBY A;  4MLO A;  5F08 A;  1ZTR A;  2M2E A;  2XSD C;  1E3O C;  2XB0 X;  2HXI A;  1TWH J;  3JR9 A;  2K9S A;  3I4N J;  1LFU P;  1JGG A;  1ORK A;  1JKR C;  3O8H A;  4JX6 A;  3S1Q J;  2LKX A;  2CQQ A;  5FKN A;  1MBG A;  4JX4 A;  4V2F A;  2DJN A;  3JRA A;  2QCO A;  4D7M A;  1NK2 P;  1YRN A;  3GTK J;  2ID6 A;  4HNV A;  3ZQI A;  1EF4 A;  1OFC X;  3RQI A;  2HDD A;  4I6Z A;  2LTP A;  1A6I A;  2L0K A;  3G1L A;  3BR0 A;  2OF7 A;  2CJJ A;  4Y52 J;  1FTZ A;  5IPA A;  3LOC A;  2FJ1 A;  5E3M A;  5IYC J;  4D7N A;  4A3D J;  3H3V K;  3M4O J;  1PUF A;  4BKX A;  5F0F A;  3ZQH A;  4NDL A;  4XK4 A;  1TWC J;  3K7A J;  1MH3 A;  3S16 J;  1TC3 C;  3W6V A;  4CYC A;  2JJ7 A;  4M3F A;  2LD5 A;  1D5Y A;  1ETQ A;  4M3D A;  1JT6 A;  3GTM J;  3BQY A;  4XIC A;  3S1N J;  2VKE A;  1AU7 A;  5EZG A;  1T56 A;  2DA2 A;  3MKL A;  5M3M J;  2K9Q A;  5M5X J;  3OSF A;  4IEJ A;  1GV5 A;  1FIP A;  5F27 A;  3QPL A;  2XPU A;  1XS9 A;  9ANT A;  1GVD A;  1NK3 P;  3LSJ A;  5GPC A;  1XG1 A;  1MSE C;  4MFE A;  2JA7 J;  2MG4 A;  3LSG A;  1ETK A;  4XRS A;  5J3L A;  4DW6 A;  3ZQG A;  2N8G A;  4XRM A;  4BBS J;  3BR6 A;  3CDL A;  2O7O A;  1CQT A;  3DEW A;  4J19 A;  1RPW A;  4A3G J;  1WH7 A;  3VPR A;  2Y30 A;  2X9D A;  4Y7N J;  2ZB9 A;  1ZGW A;  2NS8 A;  4MO7 A;  1JJ8 C;  2R7Z J;  5BNG A;  3S17 J;  1MSF C;  4LOC A;  3TW6 A;  5FLV A;  1Z0X A;  1K61 A;  5GPA A;  1JKQ C;  5FKM A;  2XPW A;  3QQA A;  1YRN B;  2L9R A;  1FJL A;  2JN6 A;  3BQZ A;  2PMZ N;  5K7H A;  5JLX A;  1I50 J;  5C4X J;  2XGE A;  2VUM J;  3WHB A;  1GUU A;  4C3I J;  1K83 J;  1LE8 B;  1WH5 A;  5C4J J;  4QTR A;  2EZH A;  1ZR2 A;  1PUF B;  3BG5 A;  1JUS A;  2DN0 A;  3FK7 A;  1JUP A;  3ZQF A;  5EDN A;  1A5J A;  3GTO J;  1OCP A;  4QIW N;  3GTG J;  2FX0 A;  5EZH A;  1ETY A;  4UUT A;  2XRL A;  2VPR A;  3S1R J;  2IAI A;  4EEF G;  3GTL J;  3B6A A;  3JRF A;  3FKI J;  2XPV A;  3ZQC A;  2R5Z A;  4S0H B;  1B8I A;  1TWF J;  5C44 J;  1O4X A;  1HCR A;  2M8G X;  1MNM C;  2MW8 A;  5J1R A;  1FIA A;  2ID3 A;  4IHX A;  2KDZ A;  3BG3 A;  2NVY J;  3FIS A;  1WPK A;  2E2J J;  5F04 A;  1ZQ3 P;  2DA3 A;  2DMP A;  1ETV A;  5M5Y J;  4AC0 A;  1HLV A;  4A3C J;  3G1M A;  1IDY A;  1QVT A;  1LE8 A;  4DYR A;  2M34 A;  4DZP A;  1ZK8 A;  3B6C A;  3C2B A;  4BXX J;  2L7Z A;  2CRG A;  4A93 J;  2VI6 A;  2CQX A;  5E3L A;  3K2A A;  5IP7 J;  5IYD J;  2Y9Y A;  2K40 A;  5JLW A;  2DMU A;  1IV6 A;  3E7L A;  5J1Y A;  4IHV A;  2X6O A;  3L1P A;  2R0Q C;  2VKV A;  2NS7 A;  3BG9 A;  3CCY A;  4A3M J;  2FQ4 A;  1P7I A;  1G2H A;  3HOU J;  4D5C A;  2JMW A;  1QPI A;  3HB9 A;  3RKQ A;  2ECC A;  4UUS A;  2DA7 A;  4JYK A;  4M6V A;  1IG7 A;  5EF6 A;  2Y9Z A;  1B72 B;  2NVT J;  1ETW A;  1MBF A;  3BTC A;  3LNQ A;  1W0T A;  3JRH A;  4BY7 J;  2HOA A;  3HGY A;  1JKO C;  5FKK A;  1ITY A;  1F43 A;  3HEF A;  2FD5 A;  2JA8 J;  3TP0 A;  2TRT A;  3HOZ J;  1X2N A;  2CUF A;  2HI3 A;  4V2G A;  1POG A;  3S14 J;  1GV2 A;  1RKW A;  1S7E A;  3D1N I;  4A69 C;  4XRS G;  2W48 A;  1MBJ A;  4B4C A;  1IUF A;  2EQR A;  1W0U A;  5K7F A;  4XID A;  3Q0V A;  3SFI A;  3SJM A;  3HOV J;  4X6A J;  2JWT A;  4FE4 A;  5IP6 A;  2R5Z B;  5EYR A;  2GM4 A;  1B8I B;  3IH2 A;  1UMQ A;  2MSY A;  1RES A;  2KT0 A;  2EZI A;  1QRY A;  3TW7 A;  2M9H A;  3BTI A;  2YS9 A;  4X1E A;  4MIM A;  5IYB J;  3NAU A;  1AHD P;  1GT0 C;  3HOW J;  4RDU A;  3JRE A;  1XC5 A;  5J1U A;  3S1M J;  1JJ6 C;  2E2H J;  1B72 A;  3GTQ J;  1FTT A;  1MH4 A;  3H0G J;  5GP9 A;  4GFB A;  3OSG A;  2LVS A;  2DMQ A;  2IBD A;  4A3F J;  3JRD A;  3HBL A;  4DZJ A;  5FLM J;  3MN2 A;  1RR7 A;  3WHC A;  3MVP A;  4M3G A;  2HYJ A;  1MBK A;  1RKT A;  2ME0 A;  1Y1W J;  3LSP A;  1HOM A;  1IRZ A;  4L5E A;  1WCM J;  5IP9 J;  3TP3 A;  2EZK A;  3Q0U A;  1AKH A;  3PO3 J;  2COB A;  4IHY A;  2DTZ A;  2MGQ A;  4UUS B;  3GTP J;  2IEK A;  5IOZ A;  1BA5 A;  1Q1V A;  4ABZ A;  2NVX J;  1ETO A;  2DA4 A;  4W97 A;  3OIO A;  2L7F P;  2EZL A;  4D5F A;  2O9L A;  5M3F J;  2I10 A;  4JX5 A;  2R5Y B;  2DA6 A;  3OOU A;  4M3B A;  5C3E J;  3IV5 A;  2OPT A;  2HOS A;  2YUS A;  3I4M J;  4A3I J;  5F0C A;  1VF9 A;  2CU7 A;  3SDG A;  1ZKG A;  2Y2Z A;  2LK2 A;  2AO9 A;  5K7Z A;  2TCT A;  1IGN A;  2LR8 A;  2E2I J;  2HXO A;  1ZR4 A;  1R9T J;  1Z77 A;  1WGX A;  2LFB A;  1GDT A;  4FTH A;  3CQZ J;  1IC8 A;  3BTL A;  2LLK A;  4A3K J;  4M3E A;  3A01 A;  5E3N A;  2R93 J;  2LY9 A;  3DCF A;  5FKO A;  3BR1 A;  4B3A A;  2Y31 A;  3RZD J;  1VI0 A;  2K9N A;  1IDZ A;  5FKL A;  2JK3 A;  4FCY A;  3S15 J;  3NAR A;  3BTJ A;  2ELK A;  4G12 A;  5FJ8 J;  1I3Q J;  3Q3S A;  3PO2 J;  1SAN A;  2DMN A;  2GLO A;  4QSH A;  2NVQ J;  1UG2 A;  2YU9 J;  2JA5 J;  1BL0 A;  1P7J A;  4C2M J;  4FE7 A;  5IOY A;  3JRB A;  1OCT C;  2HQ5 A;  1Y1V J;  2ECB A;  3M3Y J;  1JUM A;  3BT9 A;  3HDD A;  3Q0W A;  4A3B J;  1VFC A;  2DA5 A;  2ME6 A;  3RZO J;  1ETX A;  3FIW A;  2AHQ A;  2R5Y A;  2O8K A;  4W1U A;  4AUX A;  3GBG A;  3UKG A;  3A03 A;  1X2M A;  3JRG A;  2H1K A;  4I76 A;  3PM1 A;  2H8R A;  2WB1 N;  4RBO A;  3HOX J;  3QPS A;  1VND A;  4C3J J;  4A3J J;  1AKH B;  2X48 A;  4B1R A;  5EEA A;  2XB5 A;  2JA6 J;  2B63 J;  2D5V A;  5F1J A;  2RAE A;  1HDP A;  4IHW A;  4BY1 J;  1WI3 A;  2EH3 A;  5EGO B;  1U8B A;  1DU0 A;  4JP0 A;  3GTJ J;  1SFO J;  1APL C;  1JTY A;  1MBH A;  5DS9 A;  2LP0 A;  2WV1 A;  2E1O A;  5EG0 B;  3JRC A;  2R92 J;  3O8G A;  1U9O A;  3A02 A;  1BW6 A;  3FK6 A;  1U9N A;  1TWG J;  3HOY J;  1T33 A;  1F36 A;  1H8A C;  1LFB A;  4BBR J;  1TWA J;  1NTC A;  3F0C A;  5F0H A;  5HOD A;  3CMY A; 
#chains in the Genus database with same CATH topology
 1P2F A;  3CCJ I;  1QA6 A;  1J59 A;  4TV7 A;  2EBI A;  2WAQ N;  1MMN A;  1DU6 A;  4IZZ A;  4B47 A;  2GIV A;  3F8C A;  3MEX A;  1H89 C;  2EFW A;  1ZH5 A;  4HF0 A;  2X0L A;  3ZQL A;  1CF7 B;  3HGG A;  3WTS C;  4A3E J;  2BE5 F;  5BOX A;  1SAX A;  3H9G A;  3G1O A;  5HNH A;  4UNO A;  4HLX A;  2L7M P;  1RET A;  1TNS A;  2PN6 A;  4QPQ A;  4RAG A;  4NNJ A;  1XSX A;  5E17 F;  4Y15 A;  1HSJ A;  1H88 C;  1UAA A;  2JVG A;  1IW7 F;  4NC8 A;  1H9T A;  3G6E I;  1BW5 A;  1FNN A;  2IRF G;  1R4M B;  3WTX C;  4GYG A;  1JE8 A;  5LLQ A;  2P81 A;  3ZOB A;  5EEH A;  2E19 A;  2DPD A;  1IJW C;  2R7F A;  4XSZ F;  1XMA A;  2LDU A;  4ZZD A;  3DF8 A;  3PQK A;  3FBN B;  1ZTR A;  5DCM B;  2XSD C;  2E36 A;  1OPC A;  1FBU A;  2Q1Z B;  2BY0 A;  2XB0 X;  4U88 A;  5DUI A;  3W2V A;  2K9S A;  2DT6 A;  3P5J A;  3K70 D;  3S1Q J;  2CQQ A;  4E7I A;  2QCO A;  3MFK A;  3V8L A;  2V1X A;  2GWR A;  1Z9C A;  1FWZ A;  1YW9 A;  2EFQ A;  4XNF A;  3I71 A;  2LTP A;  5TIS C;  3G1L A;  3WTT C;  2STT A;  2K02 A;  5LGU A;  1TL8 A;  5HOO A;  1LVA A;  2L9N A;  2HDW A;  2PEX A;  1SFU A;  1H9G A;  4BKX A;  4MGR A;  4R1H A;  5F0F A;  1PUF A;  2A3S A;  3PJR A;  3BPX A;  4F7Z A;  3AL0 C;  3S16 J;  4M9X A;  3DEU A;  2ZXH A;  3FWE A;  4PJM A;  5BQT A;  3EDP A;  4M3F A;  1VQN I;  4F92 B;  4XMY A;  4XOT A;  2ZJ2 A;  1D5Y A;  1ETQ A;  3RCO A;  4M3D A;  1MMG A;  1AU7 A;  2R7X A;  1FSE A;  2EFP A;  3H5N A;  2GQQ A;  2DA2 A;  3MKL A;  5GTH C;  5M5X J;  2HYG D;  1B59 A;  3OSF A;  1R49 A;  3HHG A;  3OS2 A;  5F27 A;  1G3S A;  3GF2 A;  3WE3 A;  1GVD A;  2RV8 A;  1NK3 P;  4A0Z A;  5GPC A;  1XGO A;  3WU2 C;  4XM3 A;  4MFE A;  3TOB A;  2RQQ A;  2DK8 A;  2JA7 J;  4L5I A;  1J09 A;  3PIP F;  4G6D A;  1GLN A;  2F48 A;  4KN7 X;  3RJP A;  3ZQQ A;  1B4A A;  4II3 A;  1NH3 A;  3OMY A;  3BCB A;  2O7O A;  1T6S A;  4BJT A;  2P5L C;  2YX4 A;  1RPW A;  1WH7 A;  2H6B A;  2VBZ A;  3CF5 F;  2P7V B;  1RI7 A;  2X1D A;  3AG1 H;  1EV7 A;  4PK4 A;  4AIH A;  1YI2 I;  4Y3O A;  1DPU A;  2DTR A;  2CS3 A;  4ASN A;  5LRR A;  3SFZ A;  5FO5 A;  3RPQ A;  3K10 A;  3UR3 C;  3J81 Z;  2QQB A;  4EGY A;  2CH0 A;  1G4D A;  2WAQ A;  3E5X A;  3M8F A;  1XCB A;  5C4X J;  1SEU A;  2ZKZ A;  2AXL A;  1GUU A;  4XKC A;  3J81 K;  2MD5 A;  3X2Q H;  2NNY A;  1LE8 B;  1ZLK A;  1JI8 A;  4XLN F;  3J7Y J;  1PUF B;  1SD7 A;  3GZ6 A;  3F8N A;  3CC2 I;  1FY7 A;  4RAF A;  2V4J C;  1UHM A;  3CDI A;  5EDN A;  1A5J A;  4N9I A;  3QOP A;  5CJ9 A;  3TGN A;  4LD5 A;  3CCR I;  3U2R A;  4QIW N;  4AVP A;  4Y13 A;  1V5G A;  1IN8 A;  3BCA A;  2FX0 A;  2F5V A;  1SC7 A;  3KX2 A;  1ETY A;  5AON A;  2P8T A;  4UUT A;  2QVO A;  3COA C;  2O5R A;  1RC9 A;  1X1D A;  2FOW A;  4KMU X;  2GXB A;  3GTL J;  1P92 A;  3JRF A;  2R5Z A;  3GFM A;  2PFB A;  1B8I A;  4O3M A;  3CJN A;  1R5G A;  2LF8 A;  1O4X A;  2VQL A;  4K2E A;  5CQG A;  2WC2 A;  2VON A;  3SZT A;  2MW8 A;  1BR2 A;  2V79 A;  4IXA A;  3ZMZ A;  3QYF A;  4N4N B;  2BY3 A;  1R1V A;  2WAF A;  4HEA 2;  4NHJ A;  3VOD A;  5F04 A;  2DA3 A;  3K1M A;  3HPG A;  3G1M A;  1VZ0 A;  2EK5 A;  2EWN A;  1GVJ A;  2M34 A;  3B6C A;  3ZMD A;  1ZRC A;  5E3L A;  2W7N A;  5IP7 J;  1YFH A;  2HKO A;  2NAZ A;  2I8D A;  3S3N A;  1F1Z A;  3WU0 A;  1TNT A;  2ZSI B;  3DPU A;  3AL0 B;  3DLA A;  5J1Y A;  2VOO A;  1UCR A;  2X6O A;  3KZI C;  3OR2 C;  1UEL B;  2G7H A;  2W57 A;  2L01 A;  4ZDO A;  4CCK A;  3HB9 A;  3FXJ A;  1UJ8 A;  4UUS A;  2WB1 A;  1REP C;  3BP8 A;  3VFZ A;  2P4W A;  2QBY B;  2Y9Z A;  2WAE A;  2DXI A;  3GEZ A;  3SEQ A;  2NVT J;  3N05 A;  1MBF A;  1ODD A;  1Z6R A;  3JRH A;  4A6D A;  5KK1 A;  2A6T A;  2HOA A;  1JKO C;  5FKK A;  1YW7 A;  4J00 A;  3GZN B;  2VPL A;  2XF5 A;  2FEZ A;  1POG A;  1WWX A;  4RAY A;  1S6L A;  3S14 J;  4DNC A;  1HC8 A;  1S7E A;  4A69 C;  5D5X B;  2ZFU A;  2FUG 2;  3ZGK A;  2R3S A;  4HF2 A;  3U1D A;  5K7F A;  4XID A;  3SFI A;  3SJM A;  3HOV J;  2JWT A;  2EV5 A;  2R5Z B;  4LLN A;  1LKX A;  2GM4 A;  4R79 A;  2HZD A;  1B8I B;  1TBX A;  1UMQ A;  2MSY A;  1RES A;  3L2C A;  2CWE A;  2OJE D;  3VYS B;  3RTR A;  2KT0 A;  1ZRE A;  3CUQ C;  3F3X A;  4I2O A;  2L5Q A;  3BG6 A;  1RR8 C;  3GXO A;  4HSR A;  2O03 A;  2P0W A;  2VBX A;  5E1W A;  3FKJ A;  1G6N A;  3CME I;  3VB2 A;  1K6Y A;  3K4M A;  2KIM A;  3G73 A;  4P9F A;  1ZLJ A;  5LFA A;  1SFX A;  5J1U A;  1SD4 A;  4RB0 A;  2YU3 A;  3LA7 A;  4UXN A;  3SZP A;  4BEH A;  2E2H J;  1E17 A;  2DBB A;  1O57 A;  2CQ7 A;  5GP9 A;  4MQ9 F;  4BL0 B;  5H2F C;  3OSG A;  4HRI A;  2LVS A;  2QSH X;  5DV5 A;  2X85 A;  2E7X A;  5FLM J;  1HW5 A;  2DJI A;  5JR3 A;  1R58 A;  4PSX A;  2ZME C;  1D1A A;  3F23 A;  2HYJ A;  2W84 A;  2ME0 A;  3O6B B;  2NNN A;  5JFR A;  3L2Q A;  6PAX A;  2EV0 A;  2L9V A;  2HQN A;  2M3A A;  2QQ9 A;  2CW8 A;  4PGH A;  3L2U A;  2R7W A;  1PP8 F;  1AKH A;  3TDZ C;  5DDG A;  2E35 A;  3EPZ A;  2L4A A;  1EH7 A;  4U0V A;  4UUS B;  1Z21 A;  3GTP J;  1BA5 A;  1Q1V A;  3FM5 A;  3VEP A;  2NVX J;  3M07 A;  2ZC2 A;  5KCM A;  2EIM H;  4W97 A;  2L7F P;  4L0Z B;  4BAY A;  1A35 A;  2A6E F;  5J8F A;  3CES A;  2I10 A;  1LDK B;  4XOR A;  3OOU A;  3ZN1 A;  2H6C A;  2CG4 A;  3CDH A;  2LG4 A;  2YUS A;  3I4M J;  2Z3Y A;  3OIQ A;  4XL9 A;  4M9Z A;  5DCF A;  1VF9 A;  1OCC H;  4IF4 A;  3Q9V A;  1GHC A;  2Y2Z A;  2LK2 A;  1BOA A;  2TCT A;  2WY7 Q;  2OU2 A;  5DD8 A;  3DTK A;  4HAM A;  4B44 A;  4FTH A;  4LK0 F;  5B3S H;  3BY6 A;  5E3N A;  3SHF A;  2W85 A;  2R93 J;  3DXJ F;  1M1E B;  3M7G A;  5E20 A;  2ZXW H;  4CO8 A;  4RB3 C;  3RZD J;  3DV8 A;  3N97 A;  2CYY A;  2M30 A;  1ZHF A;  3S15 J;  2J5P A;  1T38 A;  3HHH A;  1BR1 A;  4G12 A;  3CP2 A;  3SXY A;  3PO2 J;  1T0F C;  2GAU A;  4BH9 A;  3HG9 A;  1UG2 A;  3C7J A;  2YU9 J;  4GCV A;  3I53 A;  1BL0 A;  4BEH B;  4FE7 A;  3QWL A;  4OMY A;  3ZCO A;  1Y1V J;  4KT5 C;  3BT9 A;  5B5E C;  3Q0W A;  2A6H F;  1BR4 A;  3DU6 A;  4B43 A;  4DGW B;  5ILU A;  3ZQ7 A;  4MTD A;  1LDD A;  2KRC A;  3PIO F;  4LFU A;  4L18 B;  2LMD A;  2OBP A;  4AUX A;  5AIQ A;  4EM0 B;  2E1C A;  2PMH A;  3ABT A;  1SD6 A;  3F6O A;  3CCS I;  1DQU A;  4HOB A;  3ONQ A;  4I76 A;  4EVI A;  2H1K A;  2H8R A;  3PL8 A;  5HS7 A;  4BXF A;  1ONV A;  3KZY A;  4PJN A;  1AKH B;  2QKL B;  4LMY A;  2W4S A;  2A05 A;  2CFO A;  3OS1 A;  3KP2 A;  4A2U A;  3LAP A;  2RDP A;  3R0A A;  3EUH A;  1D1C A;  3E0J B;  3FBI B;  2IS4 A;  1S9H A;  2I5U A;  1LB2 A;  4YIR X;  2CV1 A;  1DU0 A;  2Y48 A;  2D2W A;  2LY1 A;  5FLX K;  2BYV E;  1QBJ A;  2K4J A;  1X1C A;  5DS9 A;  4FET A;  2WV1 A;  3RKY A;  4A6E A;  3JRC A;  1S7O A;  3CUQ B;  3O8G A;  1U9O A;  4HDU A;  3OYF A;  4V19 K;  3FX3 A;  3MWM A;  4BQA A;  1U9N A;  2H27 A;  3DU5 A;  1K4S A;  5J4V A;  1TP4 A;  3NRV A;  1H8A C;  4BBR J;  1STZ A;  1TWA J;  2KIS A;  2LH9 A;  1NTC A;  4RLQ A;  3HPH A;  2QUF A;  5F0H A;  4HLY A;  4BQO A;  1FYM A;  2DDA A;  3E6B A;  3CMY A;  2QZ8 A;  3JRI A;  2OZ6 A;  1TW3 A;  2YR2 A;  1QVU A;  5B1A H;  3FHN A;  1YIJ I;  4A3L J;  3S2W A;  4KIT B;  2M4G A;  2CV0 A;  3S2D J;  3PFY A;  4RGS A;  2QQA A;  3IH3 A;  1UHS A;  3H3Z A;  3BJ6 A;  1DGW Y;  1SAU A;  2NOG A;  3GCM A;  4EJV A;  1HQC A;  3E5U A;  2LBF A;  3BZK A;  4DOZ A;  5D4S A;  2E5N A;  3HM5 A;  4DYQ A;  3KET A;  1RUN A;  3BR3 A;  4L9V A;  2X4H A;  3PSF A;  5DTD A;  2G0E A;  1EH6 A;  2L4M A;  1XGM A;  3QAH A;  1YHQ I;  3OR1 C;  1U78 A;  2VL8 A;  2WY8 Q;  3DTE A;  1BJA A;  5EG0 A;  1HF0 A;  2E60 A;  1W36 C;  2R7R A;  1YJN I;  3V7R A;  3ECH A;  2XIG A;  3JR9 A;  1QHH D;  3I4N J;  3MAJ A;  1JKR C;  2E71 A;  4XR6 A;  3O8H A;  1T95 A;  3BRO A;  4J01 A;  5FKN A;  1MBG A;  3DKY A;  3K4N A;  2DJN A;  4PFO A;  5FRN A;  4I7H A;  2UXX A;  1NK2 P;  4YFK F;  4BS9 A;  3GTK J;  1KQ9 A;  2ID6 A;  1EF4 A;  1RZ4 A;  4S05 A;  1X3U A;  4I6Z A;  3E6M A;  1FYK A;  4XN0 A;  2OF7 A;  2CJJ A;  1SMT A;  3ELK A;  3M1C A;  5IPA A;  3CO6 C;  1Z6T A;  2VJ4 A;  1CF7 A;  5KAI C;  5CVU A;  3C2G A;  3H3V K;  4XK4 A;  2HWV A;  1U0J A;  3K7A J;  1MH3 A;  1TTY A;  1TC3 C;  3TMO A;  3P9C A;  4PZJ A;  2BBY A;  2E5Z A;  3BPV A;  1BIB A;  5H6Q A;  3NQO A;  4AD9 A;  2B9S A;  1K7A A;  2DDB A;  3W2W A;  4BJ6 C;  3S1N J;  2VKE A;  3PFI A;  3WTU C;  1DPR A;  4IHS A;  5M3M J;  2M5W A;  4RS8 A;  2IGO A;  4IRH A;  3K6G A;  5HDG A;  5L3D A;  3MZ8 A;  2XPU A;  3SQN A;  4D1Q A;  3LSJ A;  2LBF B;  4I01 A;  4RB2 C;  1XN7 A;  2CMP A;  4E7K A;  4BQQ A;  3LSG A;  4E70 A;  5J3L A;  3SEZ A;  4DW6 A;  4JBA A;  4E4H A;  5F1R A;  3E5Q A;  2N8G A;  3K4J A;  3WGI A;  3BR6 A;  4HX4 A;  1U5T C;  2XAG A;  3MZY A;  1YLF A;  3EUK L;  1LPQ A;  2VIX A;  1XGN A;  2Z1D A;  2PQ8 A;  2WTE A;  3V4G A;  1Y8R B;  4F55 A;  4MO7 A;  4UVB A;  2R7Z J;  1YOV B;  3E97 A;  5BNG A;  4ZYD A;  2OCE A;  2BY1 A;  2EA2 A;  5D8K B;  4CSW A;  5FLV A;  1SVM A;  3GFI A;  3CC7 I;  4ZJZ A;  3K9T A;  4DQ2 A;  4XQF A;  1QZY A;  3ZMT A;  2D1V A;  2L3D A;  4RGR A;  1JKQ C;  5BPI A;  5FKM A;  1LNW A;  4UVC A;  4XLP F;  3QQA A;  5B1B H;  4XLH A;  2JN6 A;  2V26 A;  5K7H A;  4H4K C;  2NRA C;  1I50 J;  4WK8 F;  5H20 A;  2VUM J;  3J7Z I;  1XB4 A;  2W00 A;  4WCG A;  3WHB A;  1YJ9 I;  1PUE E;  2KHM A;  1B1B A;  5J6X A;  1K83 J;  4BJ5 C;  4E7L A;  5DYM A;  1W5T A;  4QTR A;  2EZH A;  3BG5 A;  2QSG X;  1HW2 A;  2DN0 A;  1MMD A;  1KQ0 A;  2VJI A;  2KDO A;  1JUP A;  1ZAO A;  4OAY A;  4Q4Z F;  3FHZ A;  2HR3 A;  4UUV A;  1XSV A;  3V7S A;  3H1C A;  3GTG J;  2VOD A;  2DFI A;  2DYR H;  3QP5 A;  3L00 A;  2M7A A;  4ZDL A;  1OKR A;  3CCM I;  1ZRF A;  5KNL A;  2XGX A;  2XRL A;  3REO A;  2LYC A;  2VPR A;  2PLY A;  2IS1 A;  2IAI A;  4CH7 A;  3IAM 2;  3HZJ A;  1I6X A;  3HRU A;  1OQY A;  4KYW A;  3FKI J;  2OQR A;  4U7D A;  1Z3X A;  2DI3 A;  2OZU A;  2P5V A;  3EET A;  4NBQ A;  4PSW A;  3ZQC A;  5HLT A;  1LUJ B;  2DU9 A;  2Q8K A;  4RGX A;  4P9U A;  2L54 A;  5C44 J;  2STW A;  4Q48 A;  5ICC A;  4KA4 A;  1W5C C;  1HST A;  2KQR A;  3DEE A;  1VQ8 I;  2MH2 A;  3RI4 A;  1XD7 A;  4ZTF A;  1MNM C;  4B8X A;  2W24 A;  4OIO F;  3LSK A;  3OL3 A;  1HKS A;  2V9V A;  4IHX A;  5J47 A;  1S8N A;  2M87 A;  3QOE A;  2PBI A;  1QO0 D;  1P9Q C;  1WPK A;  2VXZ A;  1GXP A;  2DMP A;  4U7B A;  3RQ4 A;  4BE1 A;  5D4R A;  2X1C A;  1HLV A;  2Z16 A;  1B9M A;  4A3C J;  2LRD A;  4I09 A;  1LE8 A;  1SVL A;  2LRE A;  2JQ7 A;  4U0Y A;  1N78 A;  2Y69 H;  2E7W A;  2CRG A;  3GW2 A;  4A93 J;  3LQQ A;  2JT1 A;  3DPT A;  4XLA A;  4P55 A;  1XDS A;  5IYD J;  1TLH B;  2HYF A;  4B3X A;  4OIP F;  2K40 A;  4R8H A;  3HL2 A;  3K1N A;  2FXA A;  2MLK A;  2HNH A;  3L1P A;  3CJR B;  2VKV A;  2IA1 A;  3BG9 A;  1P7I A;  5HVQ C;  1BOB A;  2KPM A;  5HLG A;  3HOU J;  3MKY B;  1MZB A;  2XVC A;  2MLG A;  3IRQ A;  2DA7 A;  4M6V A;  4N4O B;  4Z2Y A;  4HV6 A;  1G3Y A;  3WTZ A;  5EJC A;  4CYD A;  1YX3 A;  4BY7 J;  4CDG A;  3OY9 A;  4C30 A;  4IHT A;  3CUO A;  2VE9 A;  1QQI A;  3ZR8 X;  3N4M A;  4IOC F;  2TRT A;  5DEQ A;  2HI3 A;  2CUF A;  2K5C A;  3GLL A;  2QSF X;  4A5N A;  3EYI A;  2K9L A;  5D8L B;  3GX4 X;  4AID A;  1MBJ A;  2H1L A;  4B4C A;  4EJT A;  1IUF A;  1KU9 A;  2LY2 A;  3PUF A;  3P9K A;  4G6T B;  3Q0V A;  2IGM A;  4L9N A;  4U0W A;  2XKP A;  2P6S A;  4FX0 A;  4KUM A;  3K4B A;  2YX7 A;  3BZ6 A;  3IH2 A;  4Q5S F;  3R0J A;  2XV4 S;  1ERD A;  1IN7 A;  1QRY A;  2UV1 A;  3TW7 A;  1QU3 A;  2M9H A;  2BXZ A;  1ACI A;  1JHF A;  2XAJ A;  1J0R A;  3R4K A;  4X1E A;  1T2K A;  3K4K A;  4M6Y A;  3KYL A;  5CVI A;  1UZC A;  5IYB J;  4BYY A;  3NAU A;  1AHD P;  1BI1 A;  3HOW J;  3BWG A;  2GA1 A;  2GZW A;  2F4I A;  3ERE D;  3S1M J;  2QBY A;  4KIC A;  4ITV A;  5BMZ A;  1T08 B;  5FD5 A;  2V1U A;  2KIF A;  1MH4 A;  3E6D A;  3H0G J;  4XON A;  3HJE A;  1ZRD A;  1ON1 A;  1MGT A;  3GME A;  2IBD A;  4A3F J;  1I39 A;  4FAS D;  3JRD A;  3B73 A;  4ZYG A;  2AS5 F;  3MN2 A;  1WJ5 A;  4MEY F;  4NUB A;  3WHC A;  3MVP A;  4I02 A;  4UHT A;  5LGT A;  1RKT A;  2DT5 A;  2BZT A;  3KPH A;  3LSP A;  2JVH A;  3H5A A;  3LSM A;  5L3G A;  1ON2 A;  1GXQ A;  5GAE J;  1WCM J;  4CXF A;  4XSX F;  3OYL A;  2A68 F;  4GDF A;  5LGN A;  2DYS H;  4ZYA A;  2DTZ A;  2JSC A;  2MGQ A;  3AG2 H;  2O8X A;  1Y6I A;  5JVT A;  3V42 A;  4ABZ A;  4RGU A;  5ICE A;  3LFK A;  4IJA A;  2HVS A;  2EZL A;  1U3E M;  4CCJ A;  1EA3 A;  3K4L A;  2R5Y B;  4N0B A;  1L3L A;  3C1D A;  3IV5 A;  2A07 F;  2EPF A;  3LL7 A;  3OWT A;  4PCQ A;  1FSH A;  1FLI A;  3FXQ A;  2NYX A;  2V1D A;  3IUO A;  2CUJ A;  4LGW A;  2CU7 A;  2KMU A;  3SDG A;  5DM7 F;  1ZKG A;  2AO9 A;  1IGN A;  5CKT A;  2CW0 F;  1Y39 A;  2HXO A;  2LFB A;  2P5K A;  1GDT A;  1QZZ A;  3CQZ J;  1IC8 A;  4UB8 C;  3JSO A;  3QYE A;  1R5H A;  2F4O B;  4C2U A;  1VQK I;  2ZXJ A;  3GZ5 A;  4WXD A;  1YG2 A;  3K4C A;  3HRM A;  2LY9 A;  2O0Y A;  2XAQ A;  4EQQ A;  4AVZ A;  2Y31 A;  4AIK A;  1FMV A;  2JK3 A;  1R7J A;  3TKY A;  2A61 A;  1DGR M;  3K70 C;  3BTJ A;  2ELK A;  3KE2 A;  5HS9 A;  4HDV A;  2VN2 A;  4BAC A;  5L3B A;  2PG4 A;  3CJQ B;  1Y0N A;  4S04 A;  2V6C A;  4B48 A;  4E7J A;  3IP4 B;  5HLI A;  1KU2 A;  2C6Y A;  2IA0 A;  5ICF A;  3MD2 A;  1P7J A;  4C2M J;  3JRB A;  5IT9 Z;  1OCT C;  2ECB A;  4HX7 A;  3ESW B;  5J40 A;  1AA7 A;  3MMY B;  4DBQ A;  4A3B J;  1VFC A;  1FBQ A;  2BVM A;  2GOM A;  3ERM A;  5GAH J;  3TQN A;  2ESH A;  4CCO A;  2IA2 A;  3WG9 A;  1WJC A;  1X1A A;  2BVL A;  1Z05 A;  5IT9 K;  3S8P A;  5FD6 A;  1TT0 A;  2K27 A;  3HRT A;  2H09 A;  3PNY A;  3HRS A;  4OIR F;  4YFN F;  4RBO A;  3PNV A;  3CC4 I;  1D8K A;  5HLH A;  2X48 A;  4B1R A;  1R6R A;  2JA6 J;  3D5S C;  4DBR A;  2EV6 A;  4N9H A;  1IN6 A;  2MAB A;  4M6X A;  4CCN A;  2D5V A;  2OA4 A;  4OMZ A;  5F1J A;  1X4O A;  1HDP A;  4IHW A;  4LB6 B;  4BY1 J;  1WI3 A;  2OC6 A;  2V9K A;  5EGO B;  2EIK H;  5F6F A;  1U8B A;  1K6O A;  4JP0 A;  1APL C;  3CTA A;  3HIF A;  4EJO A;  4UB6 C;  2Q2E B;  1KYZ A;  2X6X A;  2RKH A;  2E1O A;  3TL4 X;  2OUM A;  2FNP A;  3L2R A;  4G7Z F;  4PDK A;  1D1B A;  1XX5 A;  2KRH A;  3HUG A;  2DQR A;  4HPQ A;  1IRX A;  3OS0 A;  4BNC A;  2ZJP F;  4BE0 A;  1T33 A;  2L9S A;  1F36 A;  2Y75 A;  4I98 B;  4BDY A;  4CUG A;  4XN3 A;  1MIJ A;  3KLN A;  1X3Z B;  2UWM A;  1WZ2 A;  4OAZ A;  1BJZ A;  1QZE A;  1JT0 A;  3HKZ N;  1S29 A;  2FRH A;  2HOT A;  4RB1 A;  2BHZ A;  2RGV A;  4AYB N;  1MDM A;  3DFG A;  1X58 A;  4IOA F;  1WJA A;  1T98 A;  2FSW A;  4C3H J;  1P6R A;  1ENH A;  1OR7 A;  4KMF A;  1FX7 A;  2W25 A;  3AFH A;  1SFK A;  1L0O C;  1JKP C;  1VQL I;  2GA2 A;  4NQW A;  1VQM I;  2VE8 A;  3VSK A;  3LSR A;  4G7O F;  1B6A A;  1MBE A;  3IH4 A;  4M73 A;  1YTY A;  3J7A O;  4L5J A;  2IGN A;  2M0C A;  1I6H J;  3BR2 A;  2HVQ A;  4QPO A;  5M5W J;  2H94 A;  4FIS A;  4CYC B;  4KIF A;  2QKM B;  5DM6 F;  1LVK A;  1OJL A;  2QF7 A;  5GTI C;  1A6Q A;  3CCE I;  2VB6 A;  3F21 A;  3IWF A;  4LB5 A;  2DQL A;  1JTX A;  3CUQ A;  3Q9S A;  2Y0S N;  5E3O A;  3DP7 A;  3QRF F;  1U8R A;  2GBY A;  4MLO A;  5F08 A;  2VKD A;  3KFW X;  3T8R A;  1FOW A;  1E3O C;  1RRJ A;  1TWH J;  4E7S A;  2BY2 A;  2Z33 A;  2Y0M A;  1ORK A;  2TDX A;  2JRT A;  3I56 I;  1WHU A;  4RM2 A;  5FFX A;  2LKX A;  4ZTJ A;  3JRA A;  4NC6 A;  2RN7 A;  3GWZ A;  4WXC A;  4D7M A;  2IGK A;  2HPM A;  1YRN A;  2HOE A;  1V5E A;  1PJR A;  1SFE A;  4G8X A;  3RQI A;  4LJZ F;  2K3F A;  2AQF A;  4CCM A;  2L0K A;  4I0B A;  1YJW I;  3BR0 A;  4L0Y B;  1FTZ A;  1YS7 A;  2FBI A;  4EM1 A;  3O3K A;  2IPQ X;  2FJ1 A;  2ZME A;  4L9J A;  5E3M A;  4ENJ A;  5IYC J;  4MHG A;  3R60 A;  3OV8 A;  1W5S A;  2ADU A;  4RM3 A;  3IHU A;  4HG2 A;  2JZY A;  1WI9 A;  3HUG B;  3F8F A;  2GOX B;  4NDL A;  2BV6 A;  3DBL B;  4GRI A;  1TWC J;  2DW4 A;  1LDJ A;  2WAD A;  2F5D A;  1C0W A;  1IXR C;  3EYY A;  4AU7 A;  4BQN A;  5ICG A;  3RYR A;  4IKF A;  4CCL A;  3BQY A;  2A5Y B;  2QM3 A;  1Z7L A;  3K2Z A;  4E6K G;  1MDM B;  1T56 A;  3DWL E;  3ZN0 A;  2CQN A;  4WX9 A;  2G7U A;  4YG2 F;  2Z5U A;  1GV5 A;  3JAM K;  5FLX Z;  1UB9 A;  4D0P A;  1BI0 A;  1G3W A;  4PUS A;  4EJW A;  3Q5F A;  9ANT A;  3H0D A;  1D8J A;  2DFH A;  4NQW B;  5HDK A;  1A31 A;  1MJB A;  3A0H C;  2MG4 A;  1Q1H A;  2VQC A;  4MTE A;  3ABK H;  3SYT A;  3VDX A;  2FBH A;  4XRM A;  3CDL A;  3DPL C;  3S32 A;  1E2X A;  1TQM A;  3DEW A;  3RKX A;  1VQP I;  2QWW A;  1OCR H;  3KLO A;  4A3G J;  1BBY A;  3VPR A;  5IT3 A;  2X9D A;  1TQP A;  2F4M B;  4G6Q A;  2JTV A;  3F9K A;  4II2 A;  2COM A;  2E1M C;  4IO9 F;  2ZB9 A;  1ZGW A;  2NS8 A;  4PJL A;  1IO2 A;  3OYG A;  4G7H F;  3S17 J;  1T0F A;  4LOC A;  3TW6 A;  2O61 A;  1Z0X A;  1K61 A;  5E18 F;  5GPA A;  1R00 A;  4XKV A;  2CO5 A;  2IT0 A;  1S7A A;  1YRN B;  3FMQ A;  1FJL A;  3BQZ A;  5CLS A;  1YW8 A;  2MC4 A;  2PMZ N;  2Z2S B;  2EIJ H;  2X51 A;  5FGM A;  5ILS A;  4AYB A;  3GFJ A;  4XKW A;  3L09 A;  2XGE A;  2JSP A;  2DAO A;  1BM9 A;  3WU1 B;  4ZZL A;  4DJA A;  4C3I J;  1SD5 A;  2GIZ A;  1K78 A;  2ZME B;  1KU3 A;  4BXU A;  1NHA A;  3I54 A;  3ML6 A;  1ZG5 A;  2WBM A;  1YX5 A;  5C4J J;  4ENK A;  1ZR2 A;  1JUS A;  3W6K B;  2VLA A;  2LNB A;  2DFE A;  1X1B A;  4WWC A;  3GTO J;  3SZG A;  3U1K A;  4KDP A;  5EZH A;  1N77 A;  1XMX A;  4H0E A;  3D5L A;  1S72 I;  4ESJ A;  2XAU A;  1F5T A;  3HC7 A;  1A36 A;  5A2Q Z;  3S1R J;  4X0G A;  3VYR B;  3DTI A;  2M4K A;  4BHB A;  2F5C A;  4CHU A;  3I3L A;  4NB5 A;  2B0L A;  1N75 A;  2KFD A;  3HTS B;  1XSD A;  3I9V 2;  2K4B A;  1TWF J;  4XRF A;  2CV2 A;  2CW7 A;  5A2Q K;  1J7K A;  3H9J A;  1WRJ A;  5L3F A;  2M8G X;  1JXS A;  2DOF A;  5J1R A;  4BGD A;  1FIA A;  2ID3 A;  3H3U A;  2AXT C;  3BG3 A;  2LKS A;  2NVY J;  3CP8 A;  4IVN A;  3MKW B;  1VQ6 I;  3FIS A;  3DQV C;  4G94 A;  2XC7 A;  2VQG A;  2G9W A;  2E2J J;  4ZYE A;  1R71 A;  1R4N B;  4PJ0 C;  2KJB A;  5M5Y J;  1XMK A;  2BHY A;  1VQ9 I;  4AC0 A;  1HW1 A;  4KNY A;  4DZP A;  3BC8 A;  3QPT A;  1ZK8 A;  1R5I D;  5B66 C;  5BS6 A;  4BXX J;  2IXS A;  1EKE A;  2L7Z A;  1YYV A;  2DK5 A;  2VI6 A;  1FOX A;  3K2A A;  2BW3 A;  3M8E A;  4Y33 A;  1JGS A;  4CIC A;  5ILV A;  3E7L A;  1MKM A;  1OYI A;  3CCV I;  2YPR A;  2DPU A;  3LQR A;  2R0Q C;  2VKH A;  3CCY A;  3FDY A;  3V8J A;  4KT6 A;  3MZH A;  1VQ5 I;  1G2H A;  2NXN B;  1I1S A;  2VT3 A;  3G4S I;  3IL2 A;  3FXM A;  1QPI A;  3RKQ A;  4FX4 A;  1BI3 A;  1IUY A;  2ECC A;  2X6W A;  4JYK A;  5D5U B;  1IG7 A;  1K78 B;  2FNA A;  3WGH A;  2IS2 A;  1OYY A;  2DOA A;  1B72 B;  4EGZ A;  1ETW A;  3LNQ A;  3IC7 A;  1IXC A;  1W0T A;  4HQM A;  5CVR A;  3HGY A;  4NC7 A;  3V8K A;  4YEL A;  4YFX F;  2R7O A;  5TGT A;  2ZXI A;  1X2N A;  4V2G A;  2KIQ A;  3ASN H;  3RKW A;  4BU2 A;  3D1N I;  4O6J A;  1J5Y A;  5EEG A;  4FQG A;  1T8I A;  1VQ7 I;  2ICW G;  3RPU D;  2PMU A;  4X6A J;  1YO5 C;  1P4W A;  4L9T A;  5EYR A;  3OYJ A;  3SDB A;  3WTV C;  2L2O A;  2K86 A;  2FOK A;  1X19 A;  2EZI A;  3H5R A;  4LIV A;  3OYB A;  1KON A;  1VTN C;  1IZ1 A;  1FT9 A;  2FE3 A;  1LFP A;  2YS9 A;  2PMZ A;  4C9Y A;  2E34 A;  5J8C A;  3ZPL A;  1GT0 C;  1PYV A;  2K3P A;  4RDU A;  3UNG C;  4E7Z A;  3JRE A;  2PX9 A;  3D0S A;  1XC5 A;  3W6J B;  3BLY A;  2WWY A;  5JVG F;  4BHC A;  4ZDP A;  1MJA A;  1UST A;  2KRF A;  2DMQ A;  2WV0 A;  1FPQ A;  1A04 A;  1AOY A;  1R22 A;  2LF7 A;  5CQE A;  1Y56 A;  3CJT B;  1ZAR A;  3HBL A;  2BW3 B;  4DZJ A;  3KEQ A;  1RR7 A;  4BHP A;  4HQE A;  2ZO4 A;  4XBF A;  3U21 A;  3CCQ I;  2UXN A;  4RMN A;  1Y1W J;  4WF2 A;  3T5X A;  3D5R C;  1HOM A;  5K5Q A;  4HV5 A;  1IRZ A;  1KZH A;  2R7T A;  5IP9 J;  3AG4 H;  3TP3 A;  4KJZ A;  2EZK A;  2X6Y A;  1W7P A;  1U5T A;  3BDD A;  2COB A;  2RQP A;  2O6G E;  1DUX C;  1YIT I;  2PJR A;  2IEK A;  5IOZ A;  4LG0 A;  4HX8 A;  3OYK A;  3FXL A;  1IN5 A;  2ZFW A;  3OIO A;  4EJU A;  2QYO A;  4O5V A;  3TO7 A;  2O9L A;  3H35 A;  1J9I A;  4I0A A;  1KU7 A;  4MEX F;  2DT7 B;  4IPA A;  3G2B A;  1ZG3 A;  2DA6 A;  4M3B A;  5C3E J;  2OPT A;  1D0Y A;  4CA0 A;  3EQL F;  1UHW A;  3J7A Y;  2QGU A;  2E1N A;  4Y17 A;  4A3I J;  1YS6 A;  1R23 A;  4ENM A;  1UFM A;  4I99 C;  3A2K A;  3FXK A;  2PJP A;  5LD2 C;  2ZJQ F;  1TQI A;  3CO7 C;  2LR8 A;  3A1Y A;  3I0T A;  2E2I J;  1R9T J;  4BDZ A;  4KIS A;  5LEJ A;  1E3H A;  3QOD A;  5LHG A;  3A01 A;  5ED4 A;  2M0M A;  3DCF A;  5FKO A;  5JHF A;  1VI0 A;  1Z91 A;  1IDZ A;  4FCY A;  3I59 B;  4PGG A;  1OCO H;  1O3S A;  4ESF A;  2CSO A;  1ZG1 A;  4HF1 A;  3CF2 A;  2XAF A;  5FJ8 J;  3Q3S A;  1SAN A;  3PQJ A;  2GLO A;  4QSH A;  2NVQ J;  1WSU A;  1O7L A;  4LIT A;  2JA5 J;  2QQ8 A;  1MJ9 A;  2J5O A;  1KA8 A;  5IOY A;  5CVV A;  1ZYR F;  2HTJ A;  3M3Y J;  2LOO A;  1JHH A;  3HTU A;  3OOP A;  3LSH A;  2HPI A;  2ME6 A;  4JK1 X;  1WQ2 A;  3FIW A;  2AHQ A;  2R5Y A;  1VQO I;  4PJJ A;  1T39 A;  4EAT A;  3CCL I;  2XHK A;  2O8K A;  4W1U A;  2JPC A;  2KLO A;  4OIN F;  3UKG A;  3A03 A;  4Z6Y A;  1X2M A;  2M7B A;  3JRG A;  2NS0 A;  3L9F A;  2M1B A;  3ZRG A;  2WB1 N;  3I58 A;  3RIR A;  3QPS A;  5DUK A;  1VND A;  4C3J J;  3TO6 A;  1W7P B;  2VBY A;  1U5T B;  3QYB A;  1CGP A;  5LEK A;  3HSR A;  3TDU C;  3JSP A;  2PJR B;  4LG0 B;  1BC8 C;  2B63 J;  3ABL H;  3IAS 2;  3T8T A;  2RAE A;  3KYD B;  3G3Z A;  2MD0 A;  2JUC A;  2DOE A;  1Z3Y A;  1YE9 A;  3GTJ J;  1JTY A;  2ZCW A;  5LHH A;  4GGG A;  4U87 A;  5E8I A;  4ZYH A;  2LP0 A;  1TT5 B;  2R92 J;  3KP6 A;  3A02 A;  2B7E A;  4PFP A;  2VT2 A;  3OYC A;  4JQF A;  5E1Z B;  3FZV A;  2ISZ A;  1LFB A;  4LK1 F;  4YIF A;  2KZV A;  5FFZ A;  3F0C A;  3CCU I;  3TBI A;  2AQE A;  3F22 A;  4LLL A;  4A5M A;  3ZXS A;  3AG3 H;  1OYW A;  2HQR A;  3A01 B;  3OIP A;  2VXD A;  3ABM H;  2DA1 A;  4M74 A;  3KIO A;  2R7S A;  3G71 I;  2JPB A;  3EUA A;  4A12 A;  5K5O A;  2HDC A;  2OTJ I;  2UUZ A;  3S2H J;  2CUE A;  4IQ4 A;  1HDD C;  3QPH A;  4DYC A;  2RRE A;  2XGC A;  1V3F A;  4HNU A;  4HW0 A;  1DDN A;  2XF7 A;  2MC3 A;  1MD0 A;  3MQ0 A;  2XGD A;  2EIL H;  3VYU B;  1J2X A;  3VSL A;  3QP6 A;  4MFD A;  1PDN C;  1OCZ H;  3BR5 A;  2HGC A;  3GUD A;  2R7V A;  5EGO A;  4OIQ F;  2DMT A;  3B02 A;  3HYI A;  1G3T A;  2Q2E A;  2QA4 I;  1IF1 A;  2PI0 A;  5FRO A;  3ULQ B;  4QLC U;  3TED A;  4UV9 A;  2F6C A;  1FEX A;  4BE2 A;  1LEB A;  1V54 H;  4F52 A;  2M2E A;  2HXI A;  3RPU A;  2HVR A;  1FP1 D;  2V6E A;  1LFU P;  1JGG A;  5LBQ A;  2XRO A;  4JX6 A;  4F93 B;  2QLZ A;  2ACJ A;  3FF5 A;  4JX4 A;  3A4C A;  4V2F A;  3OYN A;  2HFH A;  3HSE A;  4DIQ A;  4WXH A;  3OYD A;  3CLQ A;  4HNV A;  4IL6 C;  3ZQI A;  2P7C B;  1OFC X;  1BIA A;  2HDD A;  5LHI A;  4AWX B;  4YII A;  1A6I A;  3NEU A;  4A0Y A;  3AAF A;  2XAH A;  2FMY A;  4Y52 J;  1F4K A;  2YSR A;  2MH9 A;  3LOC A;  3NWS A;  4M9S A;  2JUG A;  4UY8 I;  3C2H A;  2R4G A;  4D7N A;  1X4P A;  4A3D J;  1U6G A;  4OWR B;  3M4O J;  2OV7 A;  3ZQH A;  2F2E A;  3E1S A;  1IRG A;  4FHT A;  4ENN A;  3I5U A;  3I64 A;  4F3Q A;  3RDI A;  3ECO A;  3W6V A;  3OYA A;  5D6F A;  1QNT A;  4HZF A;  4CYC A;  2JJ7 A;  2LD5 A;  4XLC A;  1XDU A;  1DP3 A;  5KVR A;  1JT6 A;  3GTM J;  3P9I A;  4XIC A;  1HXD A;  2VBW A;  3LST A;  1VQ4 I;  3GO5 A;  5EZG A;  3T0Y A;  2K9Q A;  2KZG A;  3WGG A;  2V7F A;  4IEJ A;  1Y8Q B;  1FIP A;  2GXA A;  3QPL A;  1XS9 A;  4KIG A;  2VC0 A;  3RYP A;  5K5R A;  2EA4 A;  5D5W B;  2JA2 A;  1XG1 A;  1IXS B;  1MSE C;  4IX7 A;  3CLO A;  2BXY A;  1ETK A;  1FMW A;  2FML A;  2EB7 A;  4XRS A;  3JTH A;  3DKW A;  1OR7 C;  3ZQG A;  5D6E A;  4BBS J;  4B09 A;  4D9J A;  1CQT A;  3LWF A;  1D5V A;  4J19 A;  1V5F A;  4QWQ A;  3QU6 A;  2JRM A;  1FOY A;  2Y30 A;  3L7W A;  4Y7N J;  1G59 A;  1HA8 A;  2OAZ A;  2RNJ A;  1JJ8 C;  3J80 Z;  1Z7U A;  3I55 I;  3W2A A;  1MNE A;  5AIP A;  1NG6 A;  1MSF C;  2K9M A;  2ZNY A;  3F6V A;  1I3A A;  1I5Z A;  3RSN A;  3C18 A;  3LFU A;  4C2T A;  2FU4 A;  3AKZ A;  3LA3 A;  2WA0 A;  1WVR A;  2XPW A;  3MCZ A;  2KL4 A;  2VC1 A;  2L9R A;  1PVE A;  3DKX A;  1XCV A;  4ETS A;  5FB2 A;  1TZL A;  3VYT B;  2FA5 A;  3J80 K;  2D1H A;  3LA2 A;  5JLX A;  1FZP B;  2HQA A;  4IRI A;  2ZSH B;  3CD6 I;  2DCE A;  2EIN H;  2MA3 A;  2IS6 A;  2FF4 A;  4ANJ A;  2L02 A;  3V7C A;  3R6S A;  4Q47 A;  1WH5 A;  1W36 D;  1V4R A;  4FT8 A;  4BUP A;  3FK7 A;  3ZQF A;  2ETH A;  5E79 C;  1D3Y A;  5L3E A;  1HBX G;  1I1G A;  1ZN2 A;  1OCP A;  1WJF A;  3KP4 A;  2CGP A;  3KP5 A;  3DLL F;  1W1W E;  3ZMS A;  3ZMV A;  3DBR B;  2M45 A;  2OTL I;  1RUO A;  2O3F A;  3HXL A;  2XAS A;  3I4P A;  3FMR A;  2VJJ A;  4EEF G;  5E8G A;  1BN5 A;  2V1N A;  3B6A A;  2CUZ A;  2A5W A;  3KZZ A;  2DO7 A;  2XPV A;  2FQ3 A;  3K0L A;  4G9Y A;  1BI2 A;  4S0H B;  3CZ6 A;  3IWZ A;  4OU0 A;  4ZC3 A;  3TO9 A;  1R1T A;  2OQG A;  3BJO A;  3S3O A;  2KKO A;  3H92 A;  1FOK A;  1B9N A;  2Z99 A;  1HCR A;  3OYI A;  4RAZ A;  4AM3 A;  2OD5 A;  2KDZ A;  2IW5 A;  1WJD A;  1WJB A;  4P5O A;  3PUB A;  1ZQ3 P;  5HNF A;  1ETV A;  1KGS A;  5L3C A;  1YIO A;  2F5E A;  1IDY A;  2A69 F;  1QVT A;  5HS8 A;  4DYR A;  2EFN A;  1J75 A;  1EJ9 A;  3EUH C;  3C2B A;  3H36 A;  3OL4 A;  2ZNZ A;  1OLT A;  2CQX A;  5LRS A;  3F72 A;  2Q0O A;  1YQA A;  2MFZ A;  3LSI A;  4UV8 A;  2Y9Y A;  5JLW A;  2DMU A;  3JAM Z;  3BJA A;  3FM3 A;  3KP7 A;  3LAJ A;  3L2V A;  2K7L A;  1IV6 A;  2XRN A;  4IHV A;  1V55 H;  3K1P A;  4ON0 A;  1I27 A;  1WJE A;  4RLF A;  3ZP5 A;  2NS7 A;  2VJ5 A;  2QEN A;  4A3M J;  2FQ4 A;  2LSO A;  4JOM A;  5FRM A;  3T1B A;  3KEO A;  4D5C A;  4ZH4 F;  3S93 A;  1DP7 P;  2JMW A;  2LKP A;  4IQJ A;  1W7P D;  1XTA A;  1U2W A;  1P4X A;  3GVA A;  5J4Y A;  5EF6 A;  3VOE A;  1X1P A;  3CMA I;  2BOL A;  1OIS A;  4ESB A;  3JTG A;  3BTC A;  4XKB A;  3ASO H;  3DBH B;  2W1O A;  3W3C A;  1ITY A;  2GXG A;  1TW2 A;  1F43 A;  2LC2 A;  2FD5 A;  3HEF A;  3WOD F;  2JA8 J;  3KEY A;  3TP0 A;  3HOZ J;  3TOA A;  3KCC A;  1IN4 A;  2ELH A;  4HBL A;  1GV2 A;  1RKW A;  5CPR B;  2EFO A;  2W48 A;  2HTS A;  2KP6 A;  3ROU A;  4XRS G;  2VOP A;  1QHG A;  1Y0U A;  3OYE A;  3FXO A;  4M72 A;  4HST A;  4EV0 A;  2EQR A;  5F64 A;  1W0U A;  4GO1 A;  3OYM A;  2NOJ B;  3E3V A;  4FE4 A;  5IP6 A;  5KHD A;  5ERI A;  2BEO A;  3IRR A;  2MYS A;  1LJ9 A;  4AIJ A;  3PSI A;  2V9P A;  5JI6 A;  3BZC A;  2HU9 A;  4UVA A;  4KIB A;  4HA8 A;  3E6C C;  1KQ8 A;  3BTI A;  3IKV A;  3HKZ A;  4MIM A;  3ZMU A;  2OCC H;  5GAG J;  2KIU A;  3ISP A;  3K69 A;  3NWT A;  4XOP A;  2L7K A;  2UZK A;  4GYI A;  2HS5 A;  4MQV A;  2F5F A;  1WFX A;  2R7D A;  1W4M A;  3M8J A;  2HEO A;  5D5V B;  1JJ6 C;  2DLL A;  2ZBK A;  1B72 A;  3GTQ J;  1FTT A;  5DD4 A;  3PNT A;  4GFB A;  1IV8 A;  1USS A;  3KYC B;  2DFF A;  1NG7 A;  2QEX I;  1P4A A;  1XGS A;  1AWC A;  3L2W A;  3BOQ A;  2NVU B;  4LLG F;  3LMM A;  3OYH A;  1MW7 A;  4M3G A;  1MBK A;  2ELJ A;  1K79 A;  4CGZ A;  1SMY F;  2VAS A;  3O2P E;  3WE2 A;  1QPM A;  5TRD A;  4L5E A;  1G8X A;  3F8B A;  2Y0S A;  1Z67 A;  2H8W A;  2HZT A;  5CVJ A;  4YRV A;  3Q0U A;  3S3M A;  3PO3 J;  5E1X A;  4IHY A;  3FXU A;  3FMS A;  1D0Z A;  1ETO A;  2DA4 A;  3KP3 A;  3IKT A;  2ISY A;  4D5F A;  4XLF A;  3GYH X;  5M3F J;  1D0X A;  4JX5 A;  4KN4 X;  2CFX A;  4M71 A;  4YEJ A;  2HOS A;  1S5L C;  2R7U A;  4F91 B;  5HDN A;  3HOS A;  5F0C A;  3M9A A;  1N25 A;  1RNL A;  1EH8 A;  4CZC A;  2R7Q A;  1RIO H;  2IP2 A;  4GXO A;  5BPD A;  3U9G A;  3QU3 A;  5K7Z A;  1IRF A;  5IY5 H;  1H0M A;  3JW4 A;  5H6R A;  1ZGJ A;  3F8M A;  1ZR4 A;  4MNU A;  4P96 A;  4HNT A;  1Z77 A;  1WGX A;  1WKM A;  2KJC A;  2Z9O A;  3BTL A;  3WTW C;  1F9N A;  2LLK A;  4A3K J;  2M8E A;  4M3E A;  5GAD J;  1O3Q A;  1FP2 A;  3WG7 H;  3BG7 A;  1BC7 C;  4RA2 A;  3A0B C;  3ABU A;  3BR1 A;  4B3A A;  3HOT A;  2K9N A;  1E3P A;  5FKL A;  1ZGA A;  3WTY C;  4EMS A;  5CYV A;  3NAR A;  3MKZ A;  1E0E A;  2X1E A;  3R61 A;  4IRG A;  1I3Q J;  2K85 A;  1O7F A;  1FYL A;  1HKQ A;  2DMN A;  1SVO A;  4HYE A;  5KAF C;  2ZJR F;  2P6T A;  4LIU A;  1MND A;  2HQ5 A;  1HKT A;  3GFL A;  1FBS A;  1MMA A;  1JUM A;  3HDD A;  2XF6 A;  2RC4 A;  1QGP A;  2DA5 A;  1MMS A;  3H9Q A;  1Z1D A;  3RZO J;  1ETX A;  1ULY A;  1ZEL A;  2EJR A;  2W82 A;  3P7N A;  2HKX A;  1KYW A;  3GBG A;  4P1W A;  1UG0 A;  4KFC A;  5DCM A;  2XKO A;  1PP7 U;  3PM1 A;  3JCU C;  3HOX J;  1K4T A;  2XSJ C;  4A3J J;  1S3J A;  2VQH A;  5EEA A;  2XB5 A;  1XPX A;  1FC3 A;  2IJL A;  1R1U A;  5TJJ A;  1LQ1 A;  2IVM A;  2XUB A;  4Y4R A;  2E1M B;  1OMI A;  1IAW A;  2FBK A;  2MBF A;  5JHU A;  2EH3 A;  1O3R A;  3GLX A;  3M1E A;  3I59 A;  4XLE A;  4A0X A;  1SFO J;  5K1Y A;  1R36 A;  1MBH A;  1LEA A;  2BGC A;  2ESN A;  5EG0 B;  2DOD A;  3FXR A;  4CZZ A;  1BW6 A;  3FK6 A;  1O3T A;  1TWG J;  3C3W A;  1X3W B;  3HOY J;  3CMM A;  3HSF A;  2XDV A;  4LG3 A;  4E7H A;  2D45 A;  2RVC A;  2CQK A;  4OOI A;  4EM2 A;  2RNG A;  5HOD A;  3VWB A; 
#chains in the Genus database with same CATH homology
 3JRI A;  1BJZ A;  1JT0 A;  3HKZ N;  3A01 B;  2HOT A;  2EBI A;  2WAQ N;  1QVU A;  2DA1 A;  4AYB N;  1DU6 A;  4A3L J;  1X58 A;  3S2D J;  1H89 C;  4C3H J;  1ENH A;  3IH3 A;  2CUE A;  1HDD C;  3S2H J;  4DYC A;  2XGC A;  3ZQL A;  3HGG A;  4A3E J;  1JKP C;  1UHS A;  3G1O A;  2NOG A;  2L7M P;  1RET A;  3LSR A;  2XGD A;  1H88 C;  3HM5 A;  1MBE A;  3IH4 A;  4DYQ A;  1BW5 A;  4MFD A;  3BR3 A;  1I6H J;  2M0C A;  3BR2 A;  5M5W J;  5DTD A;  3BR5 A;  2G0E A;  4FIS A;  4CYC B;  5EGO A;  2DMT A;  2P81 A;  1OJL A;  2QF7 A;  3ZOB A;  2E19 A;  1IJW C;  1U78 A;  5EG0 A;  1JTX A;  5E3O A;  2Y0S N;  3TED A;  1HF0 A;  1FEX A;  2GBY A;  4MLO A;  5F08 A;  1ZTR A;  2M2E A;  2XSD C;  1E3O C;  2XB0 X;  2HXI A;  1TWH J;  3JR9 A;  2K9S A;  3I4N J;  1LFU P;  1JGG A;  1ORK A;  1JKR C;  3O8H A;  4JX6 A;  3S1Q J;  2LKX A;  2CQQ A;  5FKN A;  1MBG A;  4JX4 A;  4V2F A;  2DJN A;  3JRA A;  2QCO A;  4D7M A;  1NK2 P;  1YRN A;  3GTK J;  2ID6 A;  4HNV A;  3ZQI A;  1EF4 A;  1OFC X;  3RQI A;  2HDD A;  4I6Z A;  2LTP A;  1A6I A;  2L0K A;  3G1L A;  3BR0 A;  2OF7 A;  2CJJ A;  4Y52 J;  1FTZ A;  5IPA A;  3LOC A;  2FJ1 A;  5E3M A;  5IYC J;  4D7N A;  4A3D J;  3H3V K;  3M4O J;  1PUF A;  4BKX A;  5F0F A;  3ZQH A;  4NDL A;  4XK4 A;  1TWC J;  3K7A J;  1MH3 A;  3S16 J;  1TC3 C;  3W6V A;  4CYC A;  2JJ7 A;  4M3F A;  2LD5 A;  1D5Y A;  1ETQ A;  4M3D A;  1JT6 A;  3GTM J;  3BQY A;  4XIC A;  3S1N J;  2VKE A;  1AU7 A;  5EZG A;  1T56 A;  2DA2 A;  3MKL A;  5M3M J;  2K9Q A;  5M5X J;  3OSF A;  4IEJ A;  1GV5 A;  1FIP A;  5F27 A;  3QPL A;  2XPU A;  1XS9 A;  9ANT A;  1GVD A;  1NK3 P;  3LSJ A;  5GPC A;  1XG1 A;  1MSE C;  4MFE A;  2JA7 J;  2MG4 A;  3LSG A;  1ETK A;  4XRS A;  5J3L A;  4DW6 A;  3ZQG A;  2N8G A;  4XRM A;  4BBS J;  3BR6 A;  3CDL A;  2O7O A;  1CQT A;  3DEW A;  4J19 A;  1RPW A;  4A3G J;  1WH7 A;  3VPR A;  2Y30 A;  2X9D A;  4Y7N J;  2ZB9 A;  1ZGW A;  2NS8 A;  4MO7 A;  1JJ8 C;  2R7Z J;  5BNG A;  3S17 J;  1MSF C;  4LOC A;  3TW6 A;  5FLV A;  1Z0X A;  1K61 A;  5GPA A;  1JKQ C;  5FKM A;  2XPW A;  3QQA A;  1YRN B;  2L9R A;  1FJL A;  2JN6 A;  3BQZ A;  2PMZ N;  5K7H A;  5JLX A;  1I50 J;  5C4X J;  2XGE A;  2VUM J;  3WHB A;  1GUU A;  4C3I J;  1K83 J;  1LE8 B;  1WH5 A;  5C4J J;  4QTR A;  2EZH A;  1ZR2 A;  1PUF B;  3BG5 A;  1JUS A;  2DN0 A;  3FK7 A;  1JUP A;  3ZQF A;  5EDN A;  1A5J A;  3GTO J;  1OCP A;  4QIW N;  3GTG J;  2FX0 A;  5EZH A;  1ETY A;  4UUT A;  2XRL A;  2VPR A;  3S1R J;  2IAI A;  4EEF G;  3GTL J;  3B6A A;  3JRF A;  3FKI J;  2XPV A;  3ZQC A;  2R5Z A;  4S0H B;  1B8I A;  1TWF J;  5C44 J;  1O4X A;  1HCR A;  2M8G X;  1MNM C;  2MW8 A;  5J1R A;  1FIA A;  2ID3 A;  4IHX A;  2KDZ A;  3BG3 A;  2NVY J;  3FIS A;  1WPK A;  2E2J J;  5F04 A;  1ZQ3 P;  2DA3 A;  2DMP A;  1ETV A;  5M5Y J;  4AC0 A;  1HLV A;  4A3C J;  3G1M A;  1IDY A;  1QVT A;  1LE8 A;  4DYR A;  2M34 A;  4DZP A;  1ZK8 A;  3B6C A;  3C2B A;  4BXX J;  2L7Z A;  2CRG A;  4A93 J;  2VI6 A;  2CQX A;  5E3L A;  3K2A A;  5IP7 J;  5IYD J;  2Y9Y A;  2K40 A;  5JLW A;  2DMU A;  1IV6 A;  3E7L A;  5J1Y A;  4IHV A;  2X6O A;  3L1P A;  2R0Q C;  2VKV A;  2NS7 A;  3BG9 A;  3CCY A;  4A3M J;  2FQ4 A;  1P7I A;  1G2H A;  3HOU J;  4D5C A;  2JMW A;  1QPI A;  3HB9 A;  3RKQ A;  2ECC A;  4UUS A;  2DA7 A;  4JYK A;  4M6V A;  1IG7 A;  5EF6 A;  2Y9Z A;  1B72 B;  2NVT J;  1ETW A;  1MBF A;  3BTC A;  3LNQ A;  1W0T A;  3JRH A;  4BY7 J;  2HOA A;  3HGY A;  1JKO C;  5FKK A;  1ITY A;  1F43 A;  3HEF A;  2FD5 A;  2JA8 J;  3TP0 A;  2TRT A;  3HOZ J;  1X2N A;  2CUF A;  2HI3 A;  4V2G A;  1POG A;  3S14 J;  1GV2 A;  1RKW A;  1S7E A;  3D1N I;  4A69 C;  4XRS G;  2W48 A;  1MBJ A;  4B4C A;  1IUF A;  2EQR A;  1W0U A;  5K7F A;  4XID A;  3Q0V A;  3SFI A;  3SJM A;  3HOV J;  4X6A J;  2JWT A;  4FE4 A;  5IP6 A;  2R5Z B;  5EYR A;  2GM4 A;  1B8I B;  3IH2 A;  1UMQ A;  2MSY A;  1RES A;  2KT0 A;  2EZI A;  1QRY A;  3TW7 A;  2M9H A;  3BTI A;  2YS9 A;  4X1E A;  4MIM A;  5IYB J;  3NAU A;  1AHD P;  1GT0 C;  3HOW J;  4RDU A;  3JRE A;  1XC5 A;  5J1U A;  3S1M J;  1JJ6 C;  2E2H J;  1B72 A;  3GTQ J;  1FTT A;  1MH4 A;  3H0G J;  5GP9 A;  4GFB A;  3OSG A;  2LVS A;  2DMQ A;  2IBD A;  4A3F J;  3JRD A;  3HBL A;  4DZJ A;  5FLM J;  3MN2 A;  1RR7 A;  3WHC A;  3MVP A;  4M3G A;  2HYJ A;  1MBK A;  1RKT A;  2ME0 A;  1Y1W J;  3LSP A;  1HOM A;  1IRZ A;  4L5E A;  1WCM J;  5IP9 J;  3TP3 A;  2EZK A;  3Q0U A;  1AKH A;  3PO3 J;  2COB A;  4IHY A;  2DTZ A;  2MGQ A;  4UUS B;  3GTP J;  2IEK A;  5IOZ A;  1BA5 A;  1Q1V A;  4ABZ A;  2NVX J;  1ETO A;  2DA4 A;  4W97 A;  3OIO A;  2L7F P;  2EZL A;  4D5F A;  2O9L A;  5M3F J;  2I10 A;  4JX5 A;  2R5Y B;  2DA6 A;  3OOU A;  4M3B A;  5C3E J;  3IV5 A;  2OPT A;  2HOS A;  2YUS A;  3I4M J;  4A3I J;  5F0C A;  1VF9 A;  2CU7 A;  3SDG A;  1ZKG A;  2Y2Z A;  2LK2 A;  2AO9 A;  5K7Z A;  2TCT A;  1IGN A;  2LR8 A;  2E2I J;  2HXO A;  1ZR4 A;  1R9T J;  1Z77 A;  1WGX A;  2LFB A;  1GDT A;  4FTH A;  3CQZ J;  1IC8 A;  3BTL A;  2LLK A;  4A3K J;  4M3E A;  3A01 A;  5E3N A;  2R93 J;  2LY9 A;  3DCF A;  5FKO A;  3BR1 A;  4B3A A;  2Y31 A;  3RZD J;  1VI0 A;  2K9N A;  1IDZ A;  5FKL A;  2JK3 A;  4FCY A;  3S15 J;  3NAR A;  3BTJ A;  2ELK A;  4G12 A;  5FJ8 J;  1I3Q J;  3Q3S A;  3PO2 J;  1SAN A;  2DMN A;  2GLO A;  4QSH A;  2NVQ J;  1UG2 A;  2YU9 J;  2JA5 J;  1BL0 A;  1P7J A;  4C2M J;  4FE7 A;  5IOY A;  3JRB A;  1OCT C;  2HQ5 A;  1Y1V J;  2ECB A;  3M3Y J;  1JUM A;  3BT9 A;  3HDD A;  3Q0W A;  4A3B J;  1VFC A;  2DA5 A;  2ME6 A;  3RZO J;  1ETX A;  3FIW A;  2AHQ A;  2R5Y A;  2O8K A;  4W1U A;  4AUX A;  3GBG A;  3UKG A;  3A03 A;  1X2M A;  3JRG A;  2H1K A;  4I76 A;  3PM1 A;  2H8R A;  2WB1 N;  4RBO A;  3HOX J;  3QPS A;  1VND A;  4C3J J;  4A3J J;  1AKH B;  2X48 A;  4B1R A;  5EEA A;  2XB5 A;  2JA6 J;  2B63 J;  2D5V A;  5F1J A;  2RAE A;  1HDP A;  4IHW A;  4BY1 J;  1WI3 A;  2EH3 A;  5EGO B;  1U8B A;  1DU0 A;  4JP0 A;  3GTJ J;  1SFO J;  1APL C;  1JTY A;  1MBH A;  5DS9 A;  2LP0 A;  2WV1 A;  2E1O A;  5EG0 B;  3JRC A;  2R92 J;  3O8G A;  1U9O A;  3A02 A;  1BW6 A;  3FK6 A;  1U9N A;  1TWG J;  3HOY J;  1T33 A;  1F36 A;  1H8A C;  1LFB A;  4BBR J;  1TWA J;  1NTC A;  3F0C A;  5F0H A;  5HOD A;  3CMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...