4A3KJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3kJ00
1GVDA 2EQRA 3A03A 4C3IJ 3DEWA 1JUPA 4IHWA 1H8AC 2XRLA 5EGOA 3FK6A 3LSRA 1RETA 4DYRA 2E2IJ 5F0CA 3I4NJ 2VKEA 1ENHA 3WHCA 2HOAA 4FE4A 3RZOJ 5EGOB 1TC3C 3BT9A 4M3GA 1E3OC 4X1EA 1ETOA 1RESA 1NK2P 1JT0A 4B1RA 3BR5A 5F0HA 1HDPA 3GBGA 3A01A 3H0GJ 1B8IA 4MFDA 2E2HJ 3CCYA 2DMNA 3S1NJ 3LSPA 3BR0A 1B72B 5EG0A 2X6OA 3LNQA 3HM5A 3A01B 3RKQA 3BTJA 1ETXA 1I50J 2X9DA 5C4XJ 4D5CA 1ZK8A 1GDTA 3JRGA 1QPIA 5F08A 5EG0B 3C2BA 4C3JJ 4B3AA 1U9OA 1WGXA 2JA8J 1WH7A 1OCPA 2JA5J 2MW8A 2DA7A 4RBOA 5C4JJ 4RDUA 2Y9ZA 3SFIA 4C3HJ 5FJ8J 1QVUA 3LSGA 4QIWN 4FE7A 3MKLA 4NDLA 2COBA 2LVSA 1IJWC 1Z77A 1HCRA 3S17J 4L5EA 2XGDA 3RQIA 4BBSJ 1TWCJ 1Q1VA 1WCMJ 4V2FA 4M3BA 5M5WJ 5JLWA 1FJLA 2IAIA 2IBDA 2Y0SN 4D7MA 3PO3J 2O7OA 2ECCA 1T56A 1MH3A 2JN6A 5IYCJ 1CQTA 2L7FP 2NOGA 1MSEC 2XPUA 4XRSG 3FIWA 2AO9A 3HOYJ 2OF7A 3Q0VA 4AUXA 5C3EJ 2K40A 1VF9A 2LK2A 1FTTA 3HGYA 2CUFA 5EF6A 2HYJA 2L7MP 1GV5A 3DCFA 4BY1J 1OJLA 4A3GJ 3OSGA 4A3DJ 3O8HA 5FKOA 3TW7A 3CDLA 5J1RA 1ETKA 1VNDA 2M9HA 1QRYA 3JRHA 1OFCX 3HEFA 2LKXA 4A3IJ 2HOTA 4DZJA 1IV6A 2LP0A 3ZQHA 2DA2A 1XG1A 2MSYA 5GP9A 5IP9J 3OSFA 1AKHA 1IDYA 3IV5A 2K9NA 2DA6A 5E3NA 2R92J 1G2HA 4MFEA 5GPAA 4BY7J 3IH3A 1ETQA 2R0QC 1LE8B 2XB0X 1IUFA 5IPAA 3HBLA 4IHVA 1RKTA 3ZOBA 5J1YA 1AKHB 5FKNA 3BQZA 3QPSA 2GM4A 3M4OJ 2CRGA 2TRTA 1X2MA 2R5YA 4A3MJ 1UG2A 5F27A 2RAEA 2W48A 1YRNB 4QSHA 4IHYA 1X58A 1R9TJ 1XS9A 1ETVA 1FTZA 3LSJA 1TWAJ 9ANTA 5E3OA 4Y7NJ 4DYCA 4M3EA 5F1JA 2IEKA 2NVYJ 2MGQA 1JUSA 4QTRA 4FISA 5K7FA 3NAUA 2HXIA 2NVQJ 2VKVA 2R5ZA 2O8KA 1GT0C 2Y30A 2DA3A 3JR9A 2QCOA 1BW5A 4G12A 1BL0A 3FKIJ 1ZQ3P 3GTPJ 2L7ZA 1F43A 5BNGA 2R5ZB 3TEDA 2QF7A 3JREA 1HDDC 3M3YJ 2HI3A 4LOCA 1U78A 3JRAA 1GUUA 1JGGA 3JRFA 1T33A 4DYQA 3S2HJ 1ORKA 1D5YA 3BR6A 3S1MJ 1MBJA 1B8IB 2VPRA 2OPTA 3A02A 2M0CA 2E2JJ 5IOYA 2Y9YA 2JMWA 3QPLA 2VI6A 1APLC 1K61A 2LR8A 5M5XJ 1ETWA 1H89C 2HQ5A 3PO2J 4AC0A 1LFUP 5IYBJ 2I10A 4M3DA 4IEJA 1HOMA 4FCYA 1MBKA 1VFCA 1I6HJ 3MN2A 2VUMJ 5IYDJ 1WPKA 5C44J 2MG4A 1P7JA 3D1NI 2DMQA 2FQ4A 3S1RJ 2WV1A 4UUSA 3GTGJ 4BXXJ 1WI3A 2ELKA 1JJ6C 4FTHA 5FKMA 2TCTA 1UMQA 5K7ZA 3JRDA 2EZLA 3BR1A 4ABZA 3GTMJ 2DMTA 3B6CA 3SDGA 4J19A 3L1PA 2NVTJ 2EZHA 1FIAA 1BA5A 1X2NA 2FJ1A 4EEFG 1SFOJ 4JX5A 4CYCA 3TP0A 2R7ZJ 5JLXA 5F0FA 1QVTA 1JKOC 2DMUA 3RZDJ 4JP0A 3QQAA 1HLVA 2NS7A 2XB5A 3W6VA 4GFBA 1ZTRA 3E7LA 4JX6A 2H8RA 2K9SA 4CYCB 4JX4A 4W1UA 4XICA 1AU7A 1XC5A 2L0KA 4BBRJ 2D5VA 2XGEA 1PUFA 4XIDA 3BG9A 3HOWJ 3BG5A 3WHBA 2CUEA 4UUTA 2KDZA 1LFBA 2ECBA 2L9RA 5FKLA 4XRSA 2PMZN 3S2DJ 3H3VK 2EBIA 4MIMA 1TWGJ 2XSDC 3HDDA 1JTXA 1ETYA 1POGA 2M34A 1PUFB 4IHXA 3Q3SA 4BKXA 3LOCA 3VPRA 1Y1WJ 1ZKGA 5FKKA 1RPWA 4Y52J 4DZPA 1DU6A 1Y1VJ 4XK4A 3ZQIA 1U8BA 3JRBA 4I76A 4A3FJ 1MBHA 1IDZA 2DJNA 3G1OA 3JRIA 2JK3A 2DA4A 1BW6A 3K7AJ 4D5FA 2R5YB 1MBEA 5EYRA 1JUMA 2N8GA 3CQZJ 2JJ7A 5FLVA 3G1MA 1JJ8C 2JWTA 3BR3A 1GV2A 2G0EA 1A5JA 1SANA 1MBGA 3HB9A 1EF4A 2DTZA 3IH2A 2AHQA 2LTPA 1VI0A 5EZGA 4HNVA 2ID6A 4DW6A 2DA5A 1Z0XA 4A3JJ 4B4CA 5K7HA 2YU9J 3SJMA 1A6IA 2XPWA 4A69C 3BTLA 4AYBN 5M3MJ 2X48A 2DMPA 4I6ZA 1FIPA 2GLOA 3ZQCA 1IRZA 1F36A 2ID3A 2CQXA 1B72A 1NTCA 4M3FA 3HOUJ 2CQQA 1JKRC 3S1QJ 2XPVA 1I3QJ 3GTQJ 3S16J 2LLKA 1TWFJ 3TP3A 4C2MJ 2LFBA 3FISA 2B63J 3HGGA 2NS8A 1IG7A 1FEXA 2NVXJ 3I4MJ 3GTKJ 5E3LA 3F0CA 3BTCA 2YS9A 4X6AJ 2O9LA 2M8GX 2ZB9A 5EZHA 5DTDA 3CMYA 1MH4A 1AHDP 5J1UA 5M3FJ 2DA1A 1IC8A 3FK7A 4S0HB 2XGCA 3BR2A 3Q0UA 4MLOA 4MO7A 3IH4A 3PM1A 3HOZJ 1JTYA 4UUSB 5HODA 1IGNA 1ZGWA 1W0TA 4A3LJ 1S7EA 2DN0A 2FX0A 1ITYA 4V2GA 3HOXJ 2HDDA 2Y31A 1MBFA 3GTJJ 2P81A 2K9QA 5EDNA 2E19A 4A3CJ 3O8GA 2E1OA 2FD5A 2R93J 4M6VA 3OIOA 3ZQFA 1UHSA 2LD5A 2GBYA 2HOSA 3JRCA 3S15J 2EZKA 4A3EJ 2JA7J 3BG3A 3BTIA 2HXOA 4XRMA 3HOVJ 4JYKA 1O4XA 3G1LA 3UKGA 5DS9A 3OOUA 3K2AA 1P7IA 1WH5A 2LY9A 5E3MA 1K83J 2CU7A 2WB1N 4A93J 3GTLJ 2KT0A 2H1KA 1OCTC 2M2EA 1JT6A 5IP7J 3ZQGA 3B6AA 1RR7A 3HKZN 4A3BJ 1H88C 5GPCA 2Y2ZA 1JKPC 5IP6A 1LE8A 3TW6A 2EZIA 5J3LA 4A3KJ 1W0UA 1MNMC 5EEAA 5IOZA 1BJZA 2YUSA 1ZR2A 2EH3A 1ZR4A 1JKQC 5FLMJ 3BQYA 2WAQN 3MVPA 1YRNA 3NARA 1TWHJ 2ME0A 4W97A 4D7NA 1NK3P 3ZQLA 2JA6J 1HF0A 1RKWA 3Q0WA 1MSFC 5M5YJ 3S14J 5F04A 1U9NA 2ME6A 1DU0A 3GTOJ 2CJJA
chains in the Genus database with same CATH superfamily
2QSGX 2GQQA 1JUPA 1ULYA 3QRFF 2R7SA 1NG7A 2PG4A 5J40A 1FYLA 2GXAA 1WJFA 2KDOA 2YX7A 4HNTA 3HOTA 2Z16A 1SAUA 1X19A 3I0TA 3ZQQA 1IF1A 1IRFA 1CF7B 3QOEA 1LFPA 5F0CA 2WADA 3ASNH 3DU6A 3KZIC 2MBFA 1ZELA 3PUFA 3BZ6A 2IT0A 3U1DA 4RAYA 6PAXA 3ISPA 3I5UA 1WHUA 4CYDA 1E3OC 1LQ1A 3N05A 1NK2P 1HW5A 3OYHA 3BR5A 3W6KB 1HDPA 3K1PA 5F0HA 2EIMH 2HYFA 1U0JA 3H0GJ 2E2HJ 4ZZLA 5FLXZ 1R71A 3H35A 2RQPA 1B72B 1Z05A 3ABTA 3RKXA 3LNQA 3HM5A 2XROA 3PIPF 2L5QA 2EFOA 2KQRA 4LITA 2L02A 1TW2A 3MZHA 1I50J 1IAWA 3VFZA 5C4XJ 2CSOA 2L9NA 3CO6C 4CH7A 1R36A 1ZARA 5F08A 2DFIA 3R4KA 1HBXG 4CZCA 1U9OA 1WH7A 5JR3A 3VSKA 1U2WA 2MW8A 4XL9A 2IS4A 1FBSA 3C1DA 4RDUA 2FOWA 5L3CA 1Z1DA 4E70A 3SYTA 5TISC 3LSGA 2F5DA 1MKMA 4NDLA 1Y8RB 3CC4I 1FNNA 1XGMA 1T98A 4RS8A 2MLKA 4WXCA 2IBDA 2Y0SN 5AONA 2O7OA 2IS2A 1HW2A 3BLYA 2XDVA 4R8HA 3V8KA 4DQ2A 1G3TA 3M9AA 2AO9A 3HOYJ 3EQLF 3KYLA 2K40A 2LK2A 1AOYA 3I53A 1FTTA 3I64A 3HGYA 2FRHA 3DCFA 2FSWA 4BY1J 1XCVA 5AIPA 4BQOA 3DPUA 1K7AA 2V1DA 1LUJB 3O8HA 2LG4A 1T2KA 3RPUD 5HLTA 2BE5F 2QWWA 2WC2A 2VT2A 3CJTB 1F1ZA 1A35A 1D0YA 2QLZA 3I4PA 2R7FA 4P96A 2LP0A 5L3DA 4OINF 2CW0F 1FT9A 2NS0A 1AKHA 1IDYA 3IV5A 2K9NA 3K1NA 1HKTA 1O3SA 2DA6A 2VJ4A 2R92J 1R1UA 3I54A 4NQWA 2B0LA 2VB6A 2F4IA 4XLHA 5IPAA 2VBYA 3HBLA 4AVZA 4IHVA 1RKTA 2XAJA 3D5RC 2DPDA 4G94A 2HKOA 2E1CA 5GAHJ 4UVBA 2GM4A 4A3MJ 3KP5A 1Z91A 1UG2A 4IXAA 2W48A 1FOWA 3KLNA 4ENMA 2WTEA 3WGIA 1SC7A 4E7IA 4L0ZB 2PMZA 1XGNA 5GAEJ 3A1YA 4CDGA 4HDUA 3F23A 5E3OA 3U21A 4DYCA 3DPTA 3JTHA 1IUYA 2RV8A 3CF5F 4WXHA 1J75A 3K4LA 3DTKA 2RQQA 3PSIA 1JUSA 4HAMA 2HKXA 3NAUA 1BIBA 1MJAA 2K9LA 4PFOA 2O8KA 3CCLI 1GT0C 2KP6A 1R4NB 5FFXA 4LIVA 2H1LA 2LKSA 4G12A 4YRVA 2PQ8A 3OR2C 5HDNA 1ZQ3P 5E8GA 1F43A 3I71A 5BNGA 2PJPA 5H6QA 3BJOA 2QF7A 3SHFA 3Q9VA 2ZSHB 5DYMA 5J6XA 4LOCA 3J80Z 1O3TA 2VT3A 1T95A 1GUUA 5F1RA 1YG2A 2HQRA 3JRFA 2K7LA 2K4BA 1GVJA 2RREA 4N9HA 1JI8A 5TJJA 4HA8A 2HWVA 2OPTA 5LHGA 1TNSA 4BUPA 3M1EA 3BC8A 3QPLA 2VI6A 2W25A 2QBYA 2V6CA 2VPLA 3M1CA 3M07A 5F6FA 4OIRF 1B9MA 2P6TA 1H89C 3PO2J 5HVQC 1WJDA 2BXYA 3OMYA 4OOIA 1FBUA 2JUCA 3GW2A 3K4BA 1LFUP 2OU2A 4U0WA 1HOMA 5F64A 1E3HA 4A6EA 1DPUA 3MN2A 1QHGA 5LEKA 1YJNI 1WPKA 4F93B 3S1RJ 4IO9F 5DCMB 2AXTC 2D45A 3SDBA 4FTHA 3G3ZA 1AWCA 2GXGA 3JSPA 1UMQA 3IC7A 5K7ZA 2EZLA 3BR1A 3I9V2 1T0FC 1IRGA 2G7UA 1KQ8A 1HKQA 2MYSA 3ZMUA 3SDGA 4J19A 2A68F 2EZHA 1D8JA 2FJ1A 4EEFG 4JX5A 4ZDPA 3ROUA 2VJ5A 3C3WA 3BZCA 5ILUA 2M5WA 5F0FA 1VZ0A 4LG0B 5JFRA 4KYWA 4F52A 2HYGD 2XV4S 3HSEA 3QQAA 2BGCA 1E3PA 1BC7C 3W6VA 4JX6A 2PEXA 4CICA 1ACIA 1LJ9A 4A0XA 1OPCA 2LBFA 1XC5A 2L0KA 3HRUA 3MEXA 1I3AA 2P4WA 3BP8A 3BG9A 1XGSA 4ITVA 4UUTA 1LFBA 5CYVA 2ECBA 3H92A 2R7TA 2E5NA 5FKLA 3S3OA 2QZ8A 3LA7A 3H3VK 4UVCA 1BR1A 1ZH5A 3KIOA 2XSDC 1JTXA 3A4CA 4GDFA 4CUGA 3VPRA 3E6MA 1FSHA 2LH9A 2NNYA 2DK8A 1RPWA 3TDUC 1FOXA 5D5VB 4S04A 1X4OA 2V4JC 3MQ0A 5L3EA 4BDYA 1MMNA 3CCQI 1OCCH 3AL0C 5D6EA 1XSDA 2XASA 3ZQIA 3OYCA 3JRBA 1U8BA 2L3DA 3AG3H 2IJLA 3G1OA 4RGRA 4ZZDA 2JK3A 2DA4A 3COAC 2R5YB 2NYXA 1T38A 3ZP5A 1JUMA 1TP4A 4C2UA 4XBFA 3CQZJ 2JJ7A 5FLVA 3G1MA 3E6BA 4L9NA 2AQFA 1R7JA 2R7QA 3LFKA 2G0EA 1XN7A 4A5NA 4IQ4A 2DDBA 2O5RA 1A5JA 3NQOA 2LY2A 4LGWA 2DTZA 3IH2A 2OCCH 3RI4A 3AFHA 1VI0A 4IOAF 3KZYA 3ULQB 4HDVA 1YS6A 3F21A 2IS6A 1Y6IA 1VQ7I 5IT9Z 4A3JJ 2M3AA 4B4CA 2ADUA 3WTXC 3OL3A 3WTYC 2YU9J 1A6IA 4OAZA 3FWEA 1MNDA 1PP8F 5FGMA 4A69C 4AYBN 5M3MJ 2X48A 4DIQA 1IO2A 3KEYA 1V4RA 1P6RA 2EA2A 3WTSC 3GFMA 1B72A 3F22A 1NTCA 2ZXJA 4M3FA 2D2WA 5DM6F 2CQQA 4LMYA 2HVRA 1UFMA 2CQKA 2HVSA 3GTQJ 4AIJA 3S16J 2BXZA 2FA5A 3S32A 1GXQA 3BPXA 4XM3A 3SZTA 4RM3A 4EM0B 3HGGA 2WY8Q 3GVAA 1J09A 2NVXJ 3FMQA 3F3XA 5E3LA 2FMYA 3F0CA 3H3ZA 4I0AA 4X6AJ 5FD5A 3OYNA 4CA0A 4OU0A 1OYIA 4HRIA 3MKYB 1Q1HA 5FLXK 2BY1A 3HPHA 5J1UA 3W2AA 3J7ZI 3EUHA 1XCBA 3RTRA 4YG2F 3OYFA 2FUG2 2PLYA 1LEBA 4ENJA 3FK7A 4S0HB 5E79C 2DT6A 2YR2A 1U5TB 2JRMA 3BR2A 4BHBA 5FD6A 4RB0A 1JTYA 3FXOA 5HODA 1LKXA 1ZGWA 3P9IA 1IGNA 2O03A 5ERIA 1ITYA 4I99C 3DBRB 3WTVC 1MBFA 4HEA2 4A6DA 1S7OA 3AG2H 3FDYA 4L0YB 1J59A 2E1OA 2FD5A 2BVMA 4G8XA 2BHZA 2ISZA 2L9SA 2TDXA 2W00A 5FRNA 1VQKI 3MCZA 1XMXA 2DOEA 3GEZA 4YEJA 3KP3A 1YW8A 2MLGA 3WE3A 4H4KC 4XLPF 3OR1C 3RJPA 2CH0A 3T8RA 4GCVA 4BQNA 2JA7J 3GCMA 2E1MC 3J7YJ 1PP7U 3BTIA 1YW9A 1FYKA 2OJED 3G1LA 3UKGA 2KRFA 2X1CA 4HX8A 2WWYA 3JAMK 1K83J 3PIOF 4Y33A 3I58A 2CU7A 2Y0SA 3G71I 2VE9A 2CV2A 3GTLJ 2AXLA 2H1KA 3OS2A 3LSMA 1G59A 3PL8A 4HLYA 4BACA 4RB1A 4ZTJA 1LNWA 3B6AA 4XLEA 4OMZA 3SXYA 2IA2A 3DKYA 2STTA 2RGVA 5D8LB 2HTSA 4A3KJ 1W0UA 1V5GA 2JSPA 3HUGB 5IOZA 5LRSA 5EEAA 1QU3A 3WE2A 3WG7H 1ZR4A 2XKOA 3K10A 2WAQN 3MVPA 1NG6A 1W4MA 3K2ZA 3LWFA 3L2RA 2ZJPF 4XORA 4ZYEA 4NC8A 4KJZA 2HDCA 1L0OC 4HQMA 3ZQLA 3FZVA 1HF0A 3HKZA 3ZQ7A 1X1DA 3KYCB 1FZPB 3EYYA 4IJAA 1MSFC 1XDUA 2HOEA 4IPAA 2FMLA 1L3LA 1WJCA 1U9NA 2ME6A 3GTOJ 3FBIB 1IN7A 1GVDA 2EQRA 1USSA 3BG7A 5LD2C 4C3IJ 3DEWA 3KP6A 3TO7A 2XRLA 5KNLA 1EA3A 3CUQC 2F4OB 2EFNA 4LLGF 1PDNC 4DYRA 4I7HA 3P9CA 4XQFA 1ZREA 1D5VA 3BCAA 3DKXA 3BOQA 4CCOA 3RPUA 2QKLB 3H5RA 5K5OA 3A0BC 4AD9A 3MAJA 2HOAA 5D5WB 2PFBA 5EGOB 4HV6A 2MFZA 4ZDOA 4XMYA 1RESA 2M87A 4X0GA 2XAUA 2L7KA 5L3FA 1ZAOA 1JT0A 4B1RA 4IHTA 2CG4A 4EGZA 3DXJF 2ELJA 5FROA 4MEXF 1KU9A 3A01A 2CUJA 1DGRM 4LJZF 1R49A 4MFDA 2L2OA 2F5FA 2W1OA 3WTZA 3S1NJ 2X6XA 3HRMA 5AIQA 3LSPA 3AL0B 1IXRC 2OD5A 3BR0A 2X6OA 4OIPF 1RR8C 2V26A 3CCUI 2MC3A 3RKQA 3HRTA 3GUDA 2XUBA 2BOLA 3VYUB 2X9DA 1A6QA 3H0DA 2P7VB 1GDTA 3JRGA 5EG0B 3K70C 3FXMA 3AKZA 3G6EI 1O7FA 4YFNF 3R0AA 1WJ5A 2DA7A 5ED4A 2XAGA 4G7HF 3SFIA 2IGNA 1QVUA 2BZTA 5L3GA 1RC9A 3MKLA 4FE7A 2LVSA 3HSRA 1S72I 4BE1A 3S17J 4L5EA 2XGDA 3RQIA 2EIKH 1VQMI 2C6YA 4BBSJ 1WCMJ 1U6GA 3DTIA 1Z7UA 1DP3A 4M3BA 1V3FA 5M5WJ 3RKWA 1FJLA 3F8MA 1IXSB 3BJAA 1UB9A 2IW5A 1CQTA 3PO3J 4BJ5C 2K9MA 2DFFA 1MSEC 1MW7A 1V54H 3FIWA 2BEOA 3DLLF 3TGNA 2BY2A 2IXSA 2OF7A 3Q0VA 4CSWA 1X3ZB 1BIAA 4UUVA 2H94A 4PDKA 4NB5A 1M1EB 3MKWB 2V79A 5JVGF 1TW3A 1YLFA 2HVQA 3LAJA 1GV5A 2F48A 3QODA 2WA0A 1VQ9I 3SZPA 4MQ9F 3TW7A 2IRFG 5J1RA 1ETKA 4ZYAA 4XONA 5BOXA 3FHNA 3DWLE 4LG3A 2Z33A 2DI3A 3HEFA 2V9PA 3WTWC 1ONVA 4G7ZF 5ILSA 3FMRA 4IKFA 4ZJZA 4EGYA 1IV6A 3E5UA 1E2XA 3RYPA 1DP7P 1OQYA 5IP9J 1BC8C 5DM7F 1WZ2A 1R23A 3FM5A 2DQRA 1QBJA 2ZFUA 3IUOA 1BBYA 4EJOA 1OCRH 4JQFA 4MFEA 4Q47A 5D5XB 2R0QC 1LE8B 2LNBA 1IN6A 2Q2EA 3RDIA 2K5CA 3TBIA 2O8XA 1KQ0A 1A04A 3BROA 4AWXB 1TBXA 5FKNA 3B73A 1R1VA 2VXDA 3M4OJ 2R5YA 1WJBA 1X2MA 4BEHB 1KQ9A 2QSHX 2RAEA 2Q0OA 2QYOA 4IHYA 2DFEA 2OQGA 3ABMH 5CJ9A 3PQKA 4FX0A 2A05A 3I56I 1FTZA 1KYZA 4B43A 9ANTA 1TWAJ 2A6HF 1K78B 2OUMA 4NHJA 3RIRA 4Y7NJ 2KRCA 4M3EA 2IEKA 3ZMVA 2JPCA 3VDXA 5DUIA 1WJAA 2NVYJ 3CJRB 5EJCA 3QAHA 1R1TA 4YIIA 2E1MB 4FISA 3K4KA 3HTSB 5EEHA 2HXIA 3BZKA 2VKVA 4Q4ZF 1VQOI 2HDWA 2DA3A 3ONQA 3JR9A 1BW5A 3CLOA 3GTPJ 3C2HA 1J0RA 2L7ZA 4PSWA 5HDGA 5IY5H 2R5ZB 3MZ8A 3CCSI 4F91B 3TEDA 3JREA 1HDDC 1JXSA 3TO6A 3NRVA 2HI3A 2CFOA 1ZG3A 3K4NA 3V7SA 2OZ6A 3ABLH 2UV1A 3S2HJ 2CYYA 5BPIA 3S1MJ 4E7ZA 4LB5A 2F4MB 2VASA 3ML6A 4WK8F 2VPRA 3A02A 2M0CA 2E2JJ 4U0YA 2VIXA 2EK5A 2XRNA 2Y9YA 3K70D 2JMWA 3IL2A 5FO5A 4XLAA 5CVVA 4BNCA 4FASD 2ZMEB 5M5XJ 4EMSA 2ESNA 3U1KA 4AC0A 2HEOA 3T1BA 1MNEA 5IYBJ 2G9WA 3I59B 1TQPA 2VC1A 4UV9A 3VYSB 4FCYA 3IAM2 1VFCA 2H6CA 1SMTA 4N4NB 1V55H 2VUMJ 3FXLA 2LSOA 5LHIA 4RLFA 5IYDJ 3CUQB 2DOFA 3DV8A 1P7JA 3VYRB 1YI2I 4A0ZA 2WV1A 3GTGJ 1MMDA 1JJ6C 3WG9A 1U8RA 5FKMA 3VOEA 2HZTA 1FBQA 4KDPA 2X85A 2TCTA 3JRDA 3H36A 2DLLA 1MJBA 3B6CA 4BQQA 1IZ1A 4NC7A 1X1PA 5CLSA 2O3FA 4RAGA 1BA5A 3QP6A 1LVKA 4CYCA 3CCEI 3TP0A 2R7ZJ 1QVTA 1REPC 3IKTA 2ZNZA 3KFWX 4YIFA 1HLVA 2EJRA 2MD0A 2NS7A 2XB5A 3E97A 2HNHA 4GFBA 3T0YA 3WGGA 1ZTRA 3E7LA 4QPOA 3TQNA 1BI0A 1YIJI 4W1UA 2V1XA 2CMPA 3FX3A 1AU7A 4ZYHA 4BBRJ 3PFIA 2X51A 3E3VA 3IRRA 2XGEA 2D5VA 1PUFA 1SVMA 1W7PD 4C2TA 5A2QZ 3WHBA 1I39A 2L9RA 3GMEA 1FYMA 2LKPA 1VQLI 4IQJA 4XRSA 2VBZA 3P9KA 5BMZA 3D0SA 2EBIA 3GO5A 1J7KA 4MIMA 4AIDA 3SEQA 1ETYA 1ZN2A 3DLAA 4ESBA 4I01A 2E1NA 3HUGA 4ETSA 1QNTA 1ZKGA 5FKKA 1P4WA 3W3CA 4HNUA 4Y52J 3CESA 1T0FA 1VQ8I 4B09A 2JQ7A 1T39A 4OIQF 3O3KA 2BHYA 3V4GA 5CKTA 3J81Z 5BS6A 2ZBKA 3HIFA 1QZZA 3SQNA 1IDZA 3OOPA 2DJNA 5B1BH 3JRIA 4Y15A 5HS9A 2K3PA 4G9YA 4R79A 1MMAA 1MBEA 5EYRA 3WU1B 5CVJA 5D6FA 4BXFA 2OTJI 4ESFA 4BQAA 1FP2A 2B7EA 1JJ8C 2Q1ZB 2JWTA 3BR3A 4G6QA 3ERMA 5KAFC 1QHHD 2GOXB 3GLXA 5KHDA 1SANA 1TNTA 3VB2A 3HOSA 3W2VA 1EF4A 1U5TC 3O6BB 2VJIA 4EJTA 1IV8A 4HNVA 1WFXA 2RDPA 3L00A 4DW6A 3PQJA 3QU3A 2E60A 2WAQA 3OS0A 2Z5UA 3DPLC 2E36A 2QVOA 3OY9A 3SJMA 3NWTA 3CDHA 1W7PB 4CXFA 1YJ9I 3BTLA 1PVEA 3D5SC 3DFGA 2QSFX 4EJWA 2P5KA 1Y39A 3OYJA 4A2UA 2KIFA 5E17F 1IRZA 2ID3A 3V42A 1CGPA 3DTEA 2CUZA 4P1WA 4WX9A 2KRHA 2P7CB 2CWEA 4BDZA 2XAHA 3KP4A 1TWFJ 2DQLA 3HRSA 1W5SA 3K69A 4KT5C 2JVGA 2QM3A 1LDJA 2RVCA 3PNTA 3I4MJ 2IVMA 1DGWY 4YIRX 3IRQA 3GZ5A 4E7LA 3ZR8X 3F8FA 3K9TA 5EZHA 3ABUA 3JTGA 5DTDA 1MH4A 1AHDP 4RGXA 5M3FJ 4U7DA 4EM1A 5L3BA 4XSZF 4L18B 3F6OA 3HG9A 1SEUA 2PBIA 2FF4A 2XGCA 4MO7A 2XC7A 4A3LJ 1S7EA 2DN0A 4F7ZA 3E0JB 3HOXJ 2JA2A 3EUAA 5ICGA 1RUOA 2HR3A 2K9QA 4BGDA 5EDNA 5BPDA 2D1HA 1O3QA 1HQCA 4JBAA 4RGUA 1UELB 5HLGA 2R93J 4PJLA 1ZYRF 4M6VA 3T8TA 3WU2C 5GTHC 1SFUA 3JRCA 1J5YA 2QA4I 1V5FA 3GFIA 3KP7A 3W6JB 2MD5A 4PGHA 3BG3A 2JSCA 2HXOA 4JYKA 2DW4A 1MDMA 3HC7A 4UHTA 4U87A 5DS9A 4AIKA 1WH5A 3EYIA 1UCRA 4FQGA 2LY9A 5E3MA 3LSTA 4M74A 3UNGC 2WB1N 2NNNA 5IP7J 4LD5A 3ZQGA 2X1EA 1Z3YA 1DPRA 2UWMA 3E5XA 3SZGA 1RR7A 2GA2A 3EDPA 4WWCA 5GPCA 1LE8A 2EPFA 2KKOA 2EZIA 5J3LA 1DUXC 1W5TA 2KIQA 4XRFA 1G8XA 1FY7A 3CMMA 3G2BA 1RUNA 1F9NA 2LF8A 5DD8A 4L9JA 4XLCA 2BW3B 1BJZA 2YUSA 2PJRA 2EH3A 3BQYA 4M9XA 4M71A 4G6TB 1SD4A 2ME0A 2VE8A 4PSXA 3TL4X 2CV0A 3RKYA 4HLXA 3GXOA 2JA6J 1TLHB 1K78A 4RB2C 4NNJA 3MFKA 1FPQA 4LFUA 1OKRA 2ZC2A 5D4SA 1CF7A 4XLFA 2CJJA 3OYMA 2KISA 5DDGA 4KNYA 4FX4A 2YU3A 4PFPA 3U9GA 4A0YA 2V1UA 5LBQA 1P9QC 2L4AA 1YYVA 3LSRA 1YO5C 2IA0A 3N97A 3A2KA 2CV1A 3OIPA 4MTEA 2CQNA 4I02A 3LAPA 3I4NJ 2CS3A 1VQ4I 1XD7A 1OISA 3WHCA 4E7KA 2ICWG 2XF6A 2DPUA 2WY7Q 1K4SA 1UJ8A 1TC3C 3BT9A 3M8EA 2G7HA 3WGHA 2RNGA 1D8KA 3KEOA 2V9VA 3H9QA 3TOBA 4BHCA 4UB8C 2OC6A 1STZA 1WWXA 5H20A 5JHFA 3GBGA 4MGRA 1WQ2A 2JZYA 2WBMA 2ZCWA 5E1ZB 4KFCA 2EV6A 2M0MA 3L2CA 4EV0A 2H27A 1BOBA 3CCYA 2DMNA 3FXRA 2H6BA 1X3WB 3LL7A 5HS8A 2K86A 1ETXA 1MGTA 4CO8A 2F2EA 3I59A 4D5CA 1ZK8A 1KGSA 2OCEA 3C2BA 3DU5A 1WGXA 1OCPA 2JA5J 1R22A 2E7XA 3FF5A 1TT5B 2VC0A 4XOTA 2PMHA 3CP8A 3TOAA 2R7XA 4EM2A 2Y9ZA 5E1XA 4PJNA 4UXNA 3HZJA 4KT6A 5ICEA 1IJWC 3E6CC 1HCRA 2V6EA 1Q1VA 4UNOA 1SFKA 1HC8A 5JLWA 1MJ9A 4BU2A 3ZCOA 2KJBA 2ECCA 1T56A 1MH3A 2JN6A 3J7AY 2Y48A 1J9IA 2X6WA 3DP7A 3FMSA 4XR6A 2JPBA 3MD2A 2LY1A 3DEEA 5C3EJ 3ASOH 1BOAA 3OYLA 2VQHA 2HYJA 1XSXA 4A3GJ 2VQLA 3OSGA 4A3DJ 3WTTC 5FKOA 4BE0A 3CDLA 1LDKB 1VNDA 3QYEA 5HLIA 3GLLA 1QRYA 5LFAA 1XMAA 3JRHA 4QWQA 2HFHA 2KIUA 2F5VA 1HSJA 3U2RA 1YOVB 4Y4RA 4WCGA 4ZH4F 4IRIA 2M7AA 5HDKA 5GP9A 1XG1A 3MWMA 2OTLI 4MHGA 3S8PA 5E3NA 1G2HA 3GX4X 1YX3A 1ETQA 2NAZA 2A69F 2LC2A 4MQVA 3ZOBA 1AKHB 1HKSA 2ZMEC 4WF2A 1ZRFA 1IN8A 3EPZA 1R4MB 3GZNB 5F27A 1YRNB 4F3QA 4QSHA 3RCOA 3NWSA 2E35A 2HZDA 2OBPA 4RM2A 4U0VA 1X58A 1IN4A 1R9TJ 4DNCA 1MD0A 3IWZA 1ETVA 4Z6YA 2XIGA 4IHSA 2DK5A 1G6NA 2J5OA 2MH9A 1XGOA 1ZLJA 1FMVA 1N25A 1XDSA 4HSRA 3DQVC 4QTRA 2NXNB 3K4CA 3SEZA 2XAQA 3FBNB 1BI1A 1SVLA 1S5LC 3H1CA 1ODDA 4PJMA 5CPRB 3CO7C 2QCOA 1W7PA 2PMUA 1BN5A 5CVUA 3EUHC 1EH8A 3HHGA 4B44A 3ECOA 1T8IA 2MA3A 2E5ZA 3F72A 2ZJRF 5LEJA 1U78A 3CC7I 1OR7C 4BJTA 1HXDA 1D5YA 4PJJA 4FETA 1MBJA 2W4SA 1B8IB 3L2UA 1D0ZA 1YW7A 5DV5A 5KAIC 3I55I 2UZKA 3ABKH 3J80K 4ENNA 1APLC 5FB2A 2R7OA 4O5VA 1FMWA 2EWNA 2LR8A 1EH7A 3QOPA 2HTJA 1ETWA 3F6VA 2Z2SB 2HQ5A 4XNFA 2FNPA 3VSLA 5K5QA 1G3WA 1WSUA 2D1VA 2Z9OA 1MZBA 3C2GA 4N9IA 5DCMA 4RB3C 2HPMA 2I10A 4M3DA 5GAGJ 4E7HA 1D1CA 2RNJA 1I6HJ 1QQIA 1WRJA 3DF8A 2FQ3A 5CQEA 2LMDA 1FX7A 1XX5A 2MG4A 2WAFA 1FC3A 1MIJA 1B6AA 1W36C 4YFXF 2K85A 4O6JA 1WI3A 3AG1H 4M6XA 4PUSA 4Q5SF 2R3SA 3M8JA 2DOAA 5J4YA 2IPQX 3GF2A 4LG0A 4KMFA 3L1PA 1BR2A 1YHQI 2QQAA 1X2NA 3H9GA 2RC4A 5E8IA 2W85A 3GYHX 2XF5A 1FLIA 1S7AA 4CZZA 4CGZA 2I5UA 4I98B 3RZDJ 3CZ6A 2Q8KA 4KN4X 3VYTB 1RZ4A 3KE2A 2A3SA 2BY0A 2K9SA 3F8CA 3C18A 2QKMB 4XICA 1X1BA 1N78A 3OYKA 1WJEA 3LSIA 2F5CA 1ZRDA 1ERDA 3HOWJ 2CUEA 4ZDLA 4AVPA 2KDZA 1N77A 2FU4A 3HTUA 1R6RA 2XF7A 4C30A 3S2DJ 4PK4A 4I0BA 3HDDA 4P9FA 4A12A 4IHXA 2UUZA 3LOCA 3F8BA 2QQ9A 3CMEI 2O0YA 4DZPA 3HL2A 1UZCA 1V5EA 4IRHA 1B4AA 3ZMSA 4XK4A 3CLQA 3OYIA 4K2EA 4I76A 2ETHA 2Y0MA 1H9TA 4A3FJ 5KCMA 4EJVA 4WXDA 1R5HA 4XKCA 3J7AO 1JHFA 2P5LC 2WB1A 2M1BA 1BW6A 2ZXHA 1QPMA 2ZXIA 3H5NA 2N8GA 5IT3A 5KK1A 4OWRB 1YTYA 3E5QA 2UXXA 1GV2A 4KICA 2AQEA 1P92A 2RKHA 1UG0A 4XLNF 2XKPA 3QYBA 1EJ9A 1MBGA 4IVNA 1YS7A 3HB9A 3L7WA 4P55A 1IRXA 2VQGA 4HW0A 4GO1A 4EQQA 4OIOF 2LTPA 4C9YA 1KU7A 5EZGA 2L9VA 2I8DA 2IGMA 2DA5A 4CCNA 5D5UB 2P6SA 2PX9A 4RGSA 4NBQA 5K7HA 1XSVA 2X4HA 2EB7A 2KMUA 3D5LA 2YPRA 2R7UA 1XB4A 5DD4A 5GTIC 4R1HA 1QA6A 4I6ZA 1FIPA 2DO7A 4XN0A 5DEQA 3R61A 2VXZA 3CD6I 3ZXSA 5IT9K 4M9SA 2BYVE 3KCCA 3DEUA 3HOUJ 1SAXA 4U88A 1I6XA 2XPVA 1I3QJ 1B9NA 5BQTA 2LLKA 4LIUA 2BBYA 4C2MJ 4GXOA 4YFKF 1XTAA 2B63J 2DCEA 1LB2A 1HA8A 4AYBA 2NS8A 1X3UA 4UY8I 1FEXA 3CCJI 3M8FA 3GTKJ 4FT8A 3CJNA 1W36D 1U5TA 2ZJQF 4KUMA 2V7FA 4M72A 2ZB9A 2O9LA 3ZN0A 2X1DA 4N4OB 2A6TA 4ANJA 3G4SI 3CMYA 1G3SA 2DA1A 3EETA 4BAYA 2A07F 1D3YA 3IWFA 1ZGJA 2DXIA 3Q0UA 4XN3A 3PM1A 4PGGA 3HOZJ 3K1MA 2H09A 4UUSB 1W0TA 2UXNA 2FX0A 1LDDA 4V2GA 2HDDA 3GTJJ 2VKHA 2VKDA 2P81A 3ZMTA 1BJAA 4B3XA 3FHZA 1I5ZA 3C7JA 2A6EF 4PCQA 2JVHA 4HOBA 3KETA 3CJQB 3VODA 4D1QA 2GIVA 4I2OA 3PUBA 3ZQFA 3JAMZ 3KEQA 3ESWB 2DFHA 3CCVI 2EFQA 2BY3A 2E71A 2EZKA 1VQ6I 3V8JA 2CW8A 4D0PA 3ZMDA 1T6SA 2CW7A 5HNFA 4B47A 3ELKA 1U3EM 4XRMA 3HOVJ 2FEZA 2J5PA 1Z6TA 2BVLA 4HZFA 1OMIA 3K2AA 1ZLKA 1K6YA 2L54A 4A93J 2W57A 3H5AA 2K27A 5ICFA 1OCTC 2M2EA 1JT6A 3TMOA 3G73A 2R4GA 3AG4H 4N0BA 4AU7A 2EILH 1F4KA 3MMYB 5B66C 3HKZN 3ERED 1H88C 2Y2ZA 4IZZA 5IP6A 4UB6C 2VONA 3TW6A 2HGCA 2LRDA 1WKMA 2QENA 3FXQA 1ON1A 1Z6RA 3CP2A 4IOCF 4XOPA 4H0EA 1GXPA 5FLMJ 2KFDA 1VQ5I 1YRNA 1P4AA 5KVRA 1OYWA 3BG6A 3QYFA 4D7NA 1TL8A 1EKEA 1RKWA 3H9JA 3LQRA 3HPGA 3Q0WA 1ZRCA 2FBKA 4MEYF 1B59A 3S14J 3S3MA 2L01A 5LRRA 1VQPI 1QZEA 1SFXA 5F04A 4QPQA 5J47A 4CCLA 1DU0A 3BDDA 1R00A 3A03A 1QGPA 3K0LA 4D9JA 4IHWA 1H8AC 2EA4A 5EGOA 3FK6A 3L9FA 1RETA 2E2IJ 4LLNA 5JVTA 2O6GE 2VKEA 1W5CC 1BR4A 1ENHA 3KZZA 4FE4A 1ZG5A 3RZOJ 4IF4A 5HOOA 3F9KA 2COMA 2A5YB 1VQNI 2GZWA 4M3GA 3V7CA 4EATA 4RAZA 1ETOA 4X1EA 2GOMA 3X2QH 1X1AA 1YFHA 2MABA 3WU0A 2Z3YA 1B8IA 4KMUX 2QQ8A 4HBLA 3IAS2 2KL4A 4QLCU 1XMKA 2DDAA 5EG0A 2L4MA 3K4JA 2ZSIB 2A5WA 4OAYA 3A01B 3REOA 3BTJA 1JGSA 2R7RA 5LGUA 2NVUB 2VN2A 2DYRH 1FSEA 2FBHA 2HU9A 1UHWA 2FBIA 3T5XA 1QPIA 2W82A 4HX4A 4C3JJ 4B3AA 3MKZA 2JA8J 2LREA 4BS9A 2M4KA 3CCRI 4RBOA 5C4JJ 3OIQA 2M8EA 1Y8QB 4UV8A 1BI3A 1SFEA 4C3HJ 2XHKA 5FJ8J 5J4VA 4E4HA 4QIWN 5JI6A 1KYWA 2COBA 1Z77A 1RRJA 2W84A 2ZXWH 1TWCJ 1TT0A 4ZYDA 4V2FA 1DQUA 3OV8A 4HYEA 5LHHA 3HYIA 3JCUC 2IAIA 4D7MA 4ZYGA 4HF1A 5IYCJ 4P9UA 2EV0A 3QPTA 3ECHA 1USTA 2L7FP 2NOGA 2W7NA 3E6DA 2XPUA 4MNUA 4E6KG 4XRSG 1K4TA 4E7SA 3ZRGA 4AUXA 5E18F 2CQ7A 1FP1D 1VF9A 3BCBA 2K3FA 3P5JA 3B02A 1AA7A 1S8NA 4NC6A 3CUOA 1Y56A 2CUFA 2HQNA 4YELA 5EF6A 2L7MP 1IN5A 3GZ6A 2P0WA 1OJLA 3OYEA 5CVRA 3PSFA 1B1BA 3SFZA 2KLOA 5K1YA 4E7JA 3L2QA 2M9HA 2YSRA 2R7DA 1OFCX 1JHHA 2JT1A 4CCKA 2LKXA 4A3IJ 2HOTA 3FXJA 3EUKL 4DZJA 2ZJ2A 3K4MA 2V1NA 3ZQHA 2ZO4A 1Z7LA 2DA2A 2MSYA 3PNYA 4JOMA 4XKVA 3OSFA 1C0WA 3QPHA 4V19K 1T08B 4HX7A 1I27A 4BEHA 2LF7A 4JK1X 4PJ0C 2ZKZA 5GPAA 4BY7J 3IH3A 3MZYA 2XB0X 1YIOA 1IUFA 2CO5A 3Q5FA 1KU3A 4XKWA 1SMYF 2QEXI 3CC2I 4J01A 1OYYA 4LK0F 2KIMA 2X6YA 5J1YA 3BQZA 1SD7A 3QPSA 2CRGA 2TRTA 3E1SA 3HSFA 4Z2YA 5FRMA 2IS1A 3R6SA 3CTAA 1S3JA 1SD6A 2F5EA 2XVCA 2GXBA 2LOOA 2Q2EB 1XS9A 1K79A 2LDUA 3JSOA 3LSJA 3LQQA 4LK1F 1RI7A 2H8WA 5F1JA 4RAFA 2GA1A 2IGOA 4U7BA 3OS1A 2VOPA 1F5TA 4FHTA 2MGQA 1P4XA 2P8TA 2QUFA 4PZJA 3LFUA 1O3RA 5K7FA 3TKYA 3VWBA 2NVQJ 2DT7B 4ESJA 2R5ZA 4TV7A 3LSHA 1I1SA 1EH6A 1MMSA 2Y30A 5E1WA 2M7BA 3FXUA 2HS5A 1LVAA 3M7GA 3FM3A 3FKIJ 4J00A 1D1AA 1BL0A 1S9HA 5LLQA 5B5EC 2DTRA 3V7RA 4LLLA 3KYDB 3M3YJ 1BI2A 3S3NA 4HSTA 3VEPA 3JRAA 1JGGA 2OV7A 1T33A 3I3LA 2ELHA 4DYQA 2ESHA 2ZMEA 3F8NA 1ORKA 3WODF 3BR6A 3OYBA 1G4DA 3KX2A 2R7WA 1R5ID 3Q9SA 4A5MA 1D1BA 3PJRA 4M6YA 1IW7F 5D8KB 5IOYA 1KU2A 2MH2A 4EJUA 1OLTA 1O57A 1K61A 4Q48A 2M4GA 1PYVA 3CUQA 1A36A 3AAFA 1KZHA 3BWGA 2YX4A 4RLQA 4F55A 1N75A 2OA4A 4IEJA 2O61A 1G3YA 1MBKA 5CVIA 3BY6A 1FOYA 3GFLA 3R0JA 4Y13A 1A31A 5C44J 3D1NI 2DMQA 2FQ4A 2HQAA 1Z67A 4UUSA 2LYCA 1HW1A 4II2A 4BXXJ 2ELKA 1H0MA 4RMNA 4L9VA 1K6OA 2W24A 2CGPA 3NEUA 5LGTA 3GTMJ 2FXAA 3OL4A 3KPHA 4ABZA 2DMTA 4BYYA 2Z1DA 3LA2A 2GWRA 3PNVA 3R60A 2K4JA 1Y0UA 1JE8A 2NVTJ 1Z3XA 1FIAA 3CF2A 3OWTA 1SFOJ 4ASNA 3LMMA 4DOZA 1OR7A 1E0EA 5JLXA 3BJ6A 2ZNYA 2DYSH 1RNLA 2DMUA 3BPVA 1JKOC 2JRTA 4JP0A 2GAUA 4IX7A 5FFZA 2VL8A 4O3MA 1J2XA 5ICCA 2H8RA 3L09A 2FOKA 4CYCB 4I09A 4JX4A 3QWLA 2NOJB 3TDZC 2EFWA 4KIFA 4L5IA 4L9TA 4M73A 3W2WA 1H9GA 3OYDA 3IKVA 1LPQA 1ZGAA 4XIDA 1RIOH 3BG5A 4II3A 1R5GA 4DGWB 3V8LA 4DBQA 4GYIA 5CQGA 4KISA 2KZVA 2PMZN 1TQIA 4OMYA 2R7VA 4Y17A 2WAEA 3O2PE 1TWGJ 1X1CA 3ZPLA 1POGA 2M34A 1PUFB 4KN7X 3Q3SA 4BKXA 1WI9A 5HNHA 1NHAA 1X4PA 3L2WA 3CDIA 1Y1WJ 2OAZA 2XSJC 5A2QK 4NUBA 5H6RA 2EIJH 2P5VA 2JTVA 4NQWB 1PUEE 1DU6A 1SVOA 1YX5A 2DJIA 1Y1VJ 5E20A 1E17A 1ON2A 5HLHA 3IP4B 2DU9A 1P2FA 4HF0A 2STWA 4UVAA 1MBHA 2GIZA 2KZGA 3RQ4A 3K7AJ 2OQRA 4D5FA 4XKBA 4HQEA 3A0HC 3DBHB 4AIHA 1ZHFA 2XAFA 1SD5A 1ZG1A 4KIBA 1FWZA 2EV5A 2KHMA 4L5JA 5LGNA 3J81K 2AS5F 5EEGA 2JUGA 4LB6B 3ZN1A 2FE3A 4F92B 2AHQA 4GYGA 1Z9CA 2ID6A 3ZGKA 4G7OF 5J8CA 2M45A 1Z0XA 1OCOH 5TRDA 2FNAA 4IRGA 3HXLA 3ZMZA 1HSTA 1IXCA 1TTYA 3L2VA 2KPMA 2B9SA 2BV6A 2QQBA 2XPWA 2Y75A 1GHCA 3CCMI 1D0XA 4EVIA 5B3SH 2DODA 1GLNA 1Y0NA 2DMPA 3HHHA 2ISYA 2GLOA 4ENKA 4DJAA 3ZQCA 1F36A 2XGXA 2VBXA 3QP5A 2CQXA 1OCZH 3RSNA 2WV0A 2QGUA 1UHMA 1JKRC 2IGKA 2Y69H 3H3UA 3S1QJ 4HPQA 4BXUA 4S05A 3TO9A 1YITI 3TP3A 2VOOA 2LFBA 3FISA 5HS7A 3S2WA 3PFYA 2QBYB 3GWZA 1IG7A 4KITB 5ILVA 3OYGA 3BTCA 2YS9A 2VLAA 2M8GX 4CHUA 3CMAI 3N4MA 1WVRA 1IC8A 4Y3OA 2CFXA 4BL0B 2DBBA 4XSXF 3HJEA 4MLOA 1QZYA 2E34A 3OYAA 3IH4A 4G6DA 2EFPA 3K6GA 2NRAC 1O7LA 1BM9A 2Y31A 4KA4A 2RN7A 2E19A 2M30A 1TQMA 1YE9A 4BH9A 4A3CJ 1KA8A 3O8GA 3S93A 5TGTA 2PI0A 2X0LA 1UAAA 3OIOA 4DBRA 1UHSA 2OZUA 2LD5A 2V9KA 2GBYA 1FOKA 2HOSA 2MC4A 3KP2A 4RA2A 1XPXA 3S15J 3KLOA 4KIGA 4A3EJ 3DBLB 4BJ6C 3LA3A 1YJWI 2F6CA 4BE2A 4M9ZA 1O4XA 2K02A 1DDNA 4ON0A 3OOUA 2VODA 2LBFB 1P7IA 5DCFA 2Z99A 2IA1A 2KT0A 1MMGA 2DT5A 2VBWA 3FXKA 4BHPA 1W1WE 5D4RA 1EV7A 1KONA 4MTDA 2BW3A 1TZLA 3RPQA 1MDMB 2ZFWA 1S6LA 5B1AH 4IL6C 1NH3A 4B8XA 3QU6A 4A3BJ 2EINH 1PJRA 5DUKA 1JKPC 5J8FA 3LSKA 5JHUA 4HG2A 4B48A 2IP2A 4ZTFA 1YQAA 2VQCA 3FKJA 1MNMC 3DKWA 3WTUC 4P5OA 3UR3C 4HF2A 1ZR2A 1S29A 1JKQC 1QO0D 5GADJ 5H2FC 2VJJA 2PN6A 5K5RA 2HPIA 3NARA 2A61A 1TWHJ 4W97A 3JW4A 3GFJA 2ACJA 1VTNC 4AM3A 1Z21A 2KJCA 3IHUA 1NK3P 4GGGA 1LEAA 4GRIA 2PJRB 2DAOA 3P7NA 4ZC3A 3RYRA 5M5YJ 2E7WA 1I1GA 4HV5A 4CCJA 4CCMA 1R58A
chains in the Genus database with same CATH topology
1GVDA 2EQRA 3A03A 4C3IJ 3DEWA 1JUPA 4IHWA 1H8AC 2XRLA 5EGOA 3FK6A 3LSRA 1RETA 4DYRA 2E2IJ 5F0CA 3I4NJ 2VKEA 1ENHA 3WHCA 2HOAA 4FE4A 3RZOJ 5EGOB 1TC3C 3BT9A 4M3GA 1E3OC 4X1EA 1ETOA 1RESA 1NK2P 1JT0A 4B1RA 3BR5A 5F0HA 1HDPA 3GBGA 3A01A 3H0GJ 1B8IA 4MFDA 2E2HJ 3CCYA 2DMNA 3S1NJ 3LSPA 3BR0A 1B72B 5EG0A 2X6OA 3LNQA 3HM5A 3A01B 3RKQA 3BTJA 1ETXA 1I50J 2X9DA 5C4XJ 4D5CA 1ZK8A 1GDTA 3JRGA 1QPIA 5F08A 5EG0B 3C2BA 4C3JJ 4B3AA 1U9OA 1WGXA 2JA8J 1WH7A 1OCPA 2JA5J 2MW8A 2DA7A 4RBOA 5C4JJ 4RDUA 2Y9ZA 3SFIA 4C3HJ 5FJ8J 1QVUA 3LSGA 4QIWN 4FE7A 3MKLA 4NDLA 2COBA 2LVSA 1IJWC 1Z77A 1HCRA 3S17J 4L5EA 2XGDA 3RQIA 4BBSJ 1TWCJ 1Q1VA 1WCMJ 4V2FA 4M3BA 5M5WJ 5JLWA 1FJLA 2IAIA 2IBDA 2Y0SN 4D7MA 3PO3J 2O7OA 2ECCA 1T56A 1MH3A 2JN6A 5IYCJ 1CQTA 2L7FP 2NOGA 1MSEC 2XPUA 4XRSG 3FIWA 2AO9A 3HOYJ 2OF7A 3Q0VA 4AUXA 5C3EJ 2K40A 1VF9A 2LK2A 1FTTA 3HGYA 2CUFA 5EF6A 2HYJA 2L7MP 1GV5A 3DCFA 4BY1J 1OJLA 4A3GJ 3OSGA 4A3DJ 3O8HA 5FKOA 3TW7A 3CDLA 5J1RA 1ETKA 1VNDA 2M9HA 1QRYA 3JRHA 1OFCX 3HEFA 2LKXA 4A3IJ 2HOTA 4DZJA 1IV6A 2LP0A 3ZQHA 2DA2A 1XG1A 2MSYA 5GP9A 5IP9J 3OSFA 1AKHA 1IDYA 3IV5A 2K9NA 2DA6A 5E3NA 2R92J 1G2HA 4MFEA 5GPAA 4BY7J 3IH3A 1ETQA 2R0QC 1LE8B 2XB0X 1IUFA 5IPAA 3HBLA 4IHVA 1RKTA 3ZOBA 5J1YA 1AKHB 5FKNA 3BQZA 3QPSA 2GM4A 3M4OJ 2CRGA 2TRTA 1X2MA 2R5YA 4A3MJ 1UG2A 5F27A 2RAEA 2W48A 1YRNB 4QSHA 4IHYA 1X58A 1R9TJ 1XS9A 1ETVA 1FTZA 3LSJA 1TWAJ 9ANTA 5E3OA 4Y7NJ 4DYCA 4M3EA 5F1JA 2IEKA 2NVYJ 2MGQA 1JUSA 4QTRA 4FISA 5K7FA 3NAUA 2HXIA 2NVQJ 2VKVA 2R5ZA 2O8KA 1GT0C 2Y30A 2DA3A 3JR9A 2QCOA 1BW5A 4G12A 1BL0A 3FKIJ 1ZQ3P 3GTPJ 2L7ZA 1F43A 5BNGA 2R5ZB 3TEDA 2QF7A 3JREA 1HDDC 3M3YJ 2HI3A 4LOCA 1U78A 3JRAA 1GUUA 1JGGA 3JRFA 1T33A 4DYQA 3S2HJ 1ORKA 1D5YA 3BR6A 3S1MJ 1MBJA 1B8IB 2VPRA 2OPTA 3A02A 2M0CA 2E2JJ 5IOYA 2Y9YA 2JMWA 3QPLA 2VI6A 1APLC 1K61A 2LR8A 5M5XJ 1ETWA 1H89C 2HQ5A 3PO2J 4AC0A 1LFUP 5IYBJ 2I10A 4M3DA 4IEJA 1HOMA 4FCYA 1MBKA 1VFCA 1I6HJ 3MN2A 2VUMJ 5IYDJ 1WPKA 5C44J 2MG4A 1P7JA 3D1NI 2DMQA 2FQ4A 3S1RJ 2WV1A 4UUSA 3GTGJ 4BXXJ 1WI3A 2ELKA 1JJ6C 4FTHA 5FKMA 2TCTA 1UMQA 5K7ZA 3JRDA 2EZLA 3BR1A 4ABZA 3GTMJ 2DMTA 3B6CA 3SDGA 4J19A 3L1PA 2NVTJ 2EZHA 1FIAA 1BA5A 1X2NA 2FJ1A 4EEFG 1SFOJ 4JX5A 4CYCA 3TP0A 2R7ZJ 5JLXA 5F0FA 1QVTA 1JKOC 2DMUA 3RZDJ 4JP0A 3QQAA 1HLVA 2NS7A 2XB5A 3W6VA 4GFBA 1ZTRA 3E7LA 4JX6A 2H8RA 2K9SA 4CYCB 4JX4A 4W1UA 4XICA 1AU7A 1XC5A 2L0KA 4BBRJ 2D5VA 2XGEA 1PUFA 4XIDA 3BG9A 3HOWJ 3BG5A 3WHBA 2CUEA 4UUTA 2KDZA 1LFBA 2ECBA 2L9RA 5FKLA 4XRSA 2PMZN 3S2DJ 3H3VK 2EBIA 4MIMA 1TWGJ 2XSDC 3HDDA 1JTXA 1ETYA 1POGA 2M34A 1PUFB 4IHXA 3Q3SA 4BKXA 3LOCA 3VPRA 1Y1WJ 1ZKGA 5FKKA 1RPWA 4Y52J 4DZPA 1DU6A 1Y1VJ 4XK4A 3ZQIA 1U8BA 3JRBA 4I76A 4A3FJ 1MBHA 1IDZA 2DJNA 3G1OA 3JRIA 2JK3A 2DA4A 1BW6A 3K7AJ 4D5FA 2R5YB 1MBEA 5EYRA 1JUMA 2N8GA 3CQZJ 2JJ7A 5FLVA 3G1MA 1JJ8C 2JWTA 3BR3A 1GV2A 2G0EA 1A5JA 1SANA 1MBGA 3HB9A 1EF4A 2DTZA 3IH2A 2AHQA 2LTPA 1VI0A 5EZGA 4HNVA 2ID6A 4DW6A 2DA5A 1Z0XA 4A3JJ 4B4CA 5K7HA 2YU9J 3SJMA 1A6IA 2XPWA 4A69C 3BTLA 4AYBN 5M3MJ 2X48A 2DMPA 4I6ZA 1FIPA 2GLOA 3ZQCA 1IRZA 1F36A 2ID3A 2CQXA 1B72A 1NTCA 4M3FA 3HOUJ 2CQQA 1JKRC 3S1QJ 2XPVA 1I3QJ 3GTQJ 3S16J 2LLKA 1TWFJ 3TP3A 4C2MJ 2LFBA 3FISA 2B63J 3HGGA 2NS8A 1IG7A 1FEXA 2NVXJ 3I4MJ 3GTKJ 5E3LA 3F0CA 3BTCA 2YS9A 4X6AJ 2O9LA 2M8GX 2ZB9A 5EZHA 5DTDA 3CMYA 1MH4A 1AHDP 5J1UA 5M3FJ 2DA1A 1IC8A 3FK7A 4S0HB 2XGCA 3BR2A 3Q0UA 4MLOA 4MO7A 3IH4A 3PM1A 3HOZJ 1JTYA 4UUSB 5HODA 1IGNA 1ZGWA 1W0TA 4A3LJ 1S7EA 2DN0A 2FX0A 1ITYA 4V2GA 3HOXJ 2HDDA 2Y31A 1MBFA 3GTJJ 2P81A 2K9QA 5EDNA 2E19A 4A3CJ 3O8GA 2E1OA 2FD5A 2R93J 4M6VA 3OIOA 3ZQFA 1UHSA 2LD5A 2GBYA 2HOSA 3JRCA 3S15J 2EZKA 4A3EJ 2JA7J 3BG3A 3BTIA 2HXOA 4XRMA 3HOVJ 4JYKA 1O4XA 3G1LA 3UKGA 5DS9A 3OOUA 3K2AA 1P7IA 1WH5A 2LY9A 5E3MA 1K83J 2CU7A 2WB1N 4A93J 3GTLJ 2KT0A 2H1KA 1OCTC 2M2EA 1JT6A 5IP7J 3ZQGA 3B6AA 1RR7A 3HKZN 4A3BJ 1H88C 5GPCA 2Y2ZA 1JKPC 5IP6A 1LE8A 3TW6A 2EZIA 5J3LA 4A3KJ 1W0UA 1MNMC 5EEAA 5IOZA 1BJZA 2YUSA 1ZR2A 2EH3A 1ZR4A 1JKQC 5FLMJ 3BQYA 2WAQN 3MVPA 1YRNA 3NARA 1TWHJ 2ME0A 4W97A 4D7NA 1NK3P 3ZQLA 2JA6J 1HF0A 1RKWA 3Q0WA 1MSFC 5M5YJ 3S14J 5F04A 1U9NA 2ME6A 1DU0A 3GTOJ 2CJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVD A;  2EQR A;  3A03 A;  4C3I J;  3DEW A;  1JUP A;  4IHW A;  1H8A C;  2XRL A;  5EGO A;  3FK6 A;  3LSR A;  1RET A;  4DYR A;  2E2I J;  5F0C A;  3I4N J;  2VKE A;  1ENH A;  3WHC A;  2HOA A;  4FE4 A;  3RZO J;  5EGO B;  1TC3 C;  3BT9 A;  4M3G A;  1E3O C;  4X1E A;  1ETO A;  1RES A;  1NK2 P;  1JT0 A;  4B1R A;  3BR5 A;  5F0H A;  1HDP A;  3GBG A;  3A01 A;  3H0G J;  1B8I A;  4MFD A;  2E2H J;  3CCY A;  2DMN A;  3S1N J;  3LSP A;  3BR0 A;  1B72 B;  5EG0 A;  2X6O A;  3LNQ A;  3HM5 A;  3A01 B;  3RKQ A;  3BTJ A;  1ETX A;  1I50 J;  2X9D A;  5C4X J;  4D5C A;  1ZK8 A;  1GDT A;  3JRG A;  1QPI A;  5F08 A;  5EG0 B;  3C2B A;  4C3J J;  4B3A A;  1U9O A;  1WGX A;  2JA8 J;  1WH7 A;  1OCP A;  2JA5 J;  2MW8 A;  2DA7 A;  4RBO A;  5C4J J;  4RDU A;  2Y9Z A;  3SFI A;  4C3H J;  5FJ8 J;  1QVU A;  3LSG A;  4QIW N;  4FE7 A;  3MKL A;  4NDL A;  2COB A;  2LVS A;  1IJW C;  1Z77 A;  1HCR A;  3S17 J;  4L5E A;  2XGD A;  3RQI A;  4BBS J;  1TWC J;  1Q1V A;  1WCM J;  4V2F A;  4M3B A;  5M5W J;  5JLW A;  1FJL A;  2IAI A;  2IBD A;  2Y0S N;  4D7M A;  3PO3 J;  2O7O A;  2ECC A;  1T56 A;  1MH3 A;  2JN6 A;  5IYC J;  1CQT A;  2L7F P;  2NOG A;  1MSE C;  2XPU A;  4XRS G;  3FIW A;  2AO9 A;  3HOY J;  2OF7 A;  3Q0V A;  4AUX A;  5C3E J;  2K40 A;  1VF9 A;  2LK2 A;  1FTT A;  3HGY A;  2CUF A;  5EF6 A;  2HYJ A;  2L7M P;  1GV5 A;  3DCF A;  4BY1 J;  1OJL A;  4A3G J;  3OSG A;  4A3D J;  3O8H A;  5FKO A;  3TW7 A;  3CDL A;  5J1R A;  1ETK A;  1VND A;  2M9H A;  1QRY A;  3JRH A;  1OFC X;  3HEF A;  2LKX A;  4A3I J;  2HOT A;  4DZJ A;  1IV6 A;  2LP0 A;  3ZQH A;  2DA2 A;  1XG1 A;  2MSY A;  5GP9 A;  5IP9 J;  3OSF A;  1AKH A;  1IDY A;  3IV5 A;  2K9N A;  2DA6 A;  5E3N A;  2R92 J;  1G2H A;  4MFE A;  5GPA A;  4BY7 J;  3IH3 A;  1ETQ A;  2R0Q C;  1LE8 B;  2XB0 X;  1IUF A;  5IPA A;  3HBL A;  4IHV A;  1RKT A;  3ZOB A;  5J1Y A;  1AKH B;  5FKN A;  3BQZ A;  3QPS A;  2GM4 A;  3M4O J;  2CRG A;  2TRT A;  1X2M A;  2R5Y A;  4A3M J;  1UG2 A;  5F27 A;  2RAE A;  2W48 A;  1YRN B;  4QSH A;  4IHY A;  1X58 A;  1R9T J;  1XS9 A;  1ETV A;  1FTZ A;  3LSJ A;  1TWA J;  9ANT A;  5E3O A;  4Y7N J;  4DYC A;  4M3E A;  5F1J A;  2IEK A;  2NVY J;  2MGQ A;  1JUS A;  4QTR A;  4FIS A;  5K7F A;  3NAU A;  2HXI A;  2NVQ J;  2VKV A;  2R5Z A;  2O8K A;  1GT0 C;  2Y30 A;  2DA3 A;  3JR9 A;  2QCO A;  1BW5 A;  4G12 A;  1BL0 A;  3FKI J;  1ZQ3 P;  3GTP J;  2L7Z A;  1F43 A;  5BNG A;  2R5Z B;  3TED A;  2QF7 A;  3JRE A;  1HDD C;  3M3Y J;  2HI3 A;  4LOC A;  1U78 A;  3JRA A;  1GUU A;  1JGG A;  3JRF A;  1T33 A;  4DYQ A;  3S2H J;  1ORK A;  1D5Y A;  3BR6 A;  3S1M J;  1MBJ A;  1B8I B;  2VPR A;  2OPT A;  3A02 A;  2M0C A;  2E2J J;  5IOY A;  2Y9Y A;  2JMW A;  3QPL A;  2VI6 A;  1APL C;  1K61 A;  2LR8 A;  5M5X J;  1ETW A;  1H89 C;  2HQ5 A;  3PO2 J;  4AC0 A;  1LFU P;  5IYB J;  2I10 A;  4M3D A;  4IEJ A;  1HOM A;  4FCY A;  1MBK A;  1VFC A;  1I6H J;  3MN2 A;  2VUM J;  5IYD J;  1WPK A;  5C44 J;  2MG4 A;  1P7J A;  3D1N I;  2DMQ A;  2FQ4 A;  3S1R J;  2WV1 A;  4UUS A;  3GTG J;  4BXX J;  1WI3 A;  2ELK A;  1JJ6 C;  4FTH A;  5FKM A;  2TCT A;  1UMQ A;  5K7Z A;  3JRD A;  2EZL A;  3BR1 A;  4ABZ A;  3GTM J;  2DMT A;  3B6C A;  3SDG A;  4J19 A;  3L1P A;  2NVT J;  2EZH A;  1FIA A;  1BA5 A;  1X2N A;  2FJ1 A;  4EEF G;  1SFO J;  4JX5 A;  4CYC A;  3TP0 A;  2R7Z J;  5JLX A;  5F0F A;  1QVT A;  1JKO C;  2DMU A;  3RZD J;  4JP0 A;  3QQA A;  1HLV A;  2NS7 A;  2XB5 A;  3W6V A;  4GFB A;  1ZTR A;  3E7L A;  4JX6 A;  2H8R A;  2K9S A;  4CYC B;  4JX4 A;  4W1U A;  4XIC A;  1AU7 A;  1XC5 A;  2L0K A;  4BBR J;  2D5V A;  2XGE A;  1PUF A;  4XID A;  3BG9 A;  3HOW J;  3BG5 A;  3WHB A;  2CUE A;  4UUT A;  2KDZ A;  1LFB A;  2ECB A;  2L9R A;  5FKL A;  4XRS A;  2PMZ N;  3S2D J;  3H3V K;  2EBI A;  4MIM A;  1TWG J;  2XSD C;  3HDD A;  1JTX A;  1ETY A;  1POG A;  2M34 A;  1PUF B;  4IHX A;  3Q3S A;  4BKX A;  3LOC A;  3VPR A;  1Y1W J;  1ZKG A;  5FKK A;  1RPW A;  4Y52 J;  4DZP A;  1DU6 A;  1Y1V J;  4XK4 A;  3ZQI A;  1U8B A;  3JRB A;  4I76 A;  4A3F J;  1MBH A;  1IDZ A;  2DJN A;  3G1O A;  3JRI A;  2JK3 A;  2DA4 A;  1BW6 A;  3K7A J;  4D5F A;  2R5Y B;  1MBE A;  5EYR A;  1JUM A;  2N8G A;  3CQZ J;  2JJ7 A;  5FLV A;  3G1M A;  1JJ8 C;  2JWT A;  3BR3 A;  1GV2 A;  2G0E A;  1A5J A;  1SAN A;  1MBG A;  3HB9 A;  1EF4 A;  2DTZ A;  3IH2 A;  2AHQ A;  2LTP A;  1VI0 A;  5EZG A;  4HNV A;  2ID6 A;  4DW6 A;  2DA5 A;  1Z0X A;  4A3J J;  4B4C A;  5K7H A;  2YU9 J;  3SJM A;  1A6I A;  2XPW A;  4A69 C;  3BTL A;  4AYB N;  5M3M J;  2X48 A;  2DMP A;  4I6Z A;  1FIP A;  2GLO A;  3ZQC A;  1IRZ A;  1F36 A;  2ID3 A;  2CQX A;  1B72 A;  1NTC A;  4M3F A;  3HOU J;  2CQQ A;  1JKR C;  3S1Q J;  2XPV A;  1I3Q J;  3GTQ J;  3S16 J;  2LLK A;  1TWF J;  3TP3 A;  4C2M J;  2LFB A;  3FIS A;  2B63 J;  3HGG A;  2NS8 A;  1IG7 A;  1FEX A;  2NVX J;  3I4M J;  3GTK J;  5E3L A;  3F0C A;  3BTC A;  2YS9 A;  4X6A J;  2O9L A;  2M8G X;  2ZB9 A;  5EZH A;  5DTD A;  3CMY A;  1MH4 A;  1AHD P;  5J1U A;  5M3F J;  2DA1 A;  1IC8 A;  3FK7 A;  4S0H B;  2XGC A;  3BR2 A;  3Q0U A;  4MLO A;  4MO7 A;  3IH4 A;  3PM1 A;  3HOZ J;  1JTY A;  4UUS B;  5HOD A;  1IGN A;  1ZGW A;  1W0T A;  4A3L J;  1S7E A;  2DN0 A;  2FX0 A;  1ITY A;  4V2G A;  3HOX J;  2HDD A;  2Y31 A;  1MBF A;  3GTJ J;  2P81 A;  2K9Q A;  5EDN A;  2E19 A;  4A3C J;  3O8G A;  2E1O A;  2FD5 A;  2R93 J;  4M6V A;  3OIO A;  3ZQF A;  1UHS A;  2LD5 A;  2GBY A;  2HOS A;  3JRC A;  3S15 J;  2EZK A;  4A3E J;  2JA7 J;  3BG3 A;  3BTI A;  2HXO A;  4XRM A;  3HOV J;  4JYK A;  1O4X A;  3G1L A;  3UKG A;  5DS9 A;  3OOU A;  3K2A A;  1P7I A;  1WH5 A;  2LY9 A;  5E3M A;  1K83 J;  2CU7 A;  2WB1 N;  4A93 J;  3GTL J;  2KT0 A;  2H1K A;  1OCT C;  2M2E A;  1JT6 A;  5IP7 J;  3ZQG A;  3B6A A;  1RR7 A;  3HKZ N;  4A3B J;  1H88 C;  5GPC A;  2Y2Z A;  1JKP C;  5IP6 A;  1LE8 A;  3TW6 A;  2EZI A;  5J3L A;  4A3K J;  1W0U A;  1MNM C;  5EEA A;  5IOZ A;  1BJZ A;  2YUS A;  1ZR2 A;  2EH3 A;  1ZR4 A;  1JKQ C;  5FLM J;  3BQY A;  2WAQ N;  3MVP A;  1YRN A;  3NAR A;  1TWH J;  2ME0 A;  4W97 A;  4D7N A;  1NK3 P;  3ZQL A;  2JA6 J;  1HF0 A;  1RKW A;  3Q0W A;  1MSF C;  5M5Y J;  3S14 J;  5F04 A;  1U9N A;  2ME6 A;  1DU0 A;  3GTO J;  2CJJ A; 
#chains in the Genus database with same CATH topology
 2QSG X;  2GQQ A;  1JUP A;  1ULY A;  3QRF F;  2R7S A;  1NG7 A;  2PG4 A;  5J40 A;  1FYL A;  2GXA A;  1WJF A;  2KDO A;  2YX7 A;  4HNT A;  3HOT A;  2Z16 A;  1SAU A;  1X19 A;  3I0T A;  3ZQQ A;  1IF1 A;  1IRF A;  1CF7 B;  3QOE A;  1LFP A;  5F0C A;  2WAD A;  3ASN H;  3DU6 A;  3KZI C;  2MBF A;  1ZEL A;  3PUF A;  3BZ6 A;  2IT0 A;  3U1D A;  4RAY A;  6PAX A;  3ISP A;  3I5U A;  1WHU A;  4CYD A;  1E3O C;  1LQ1 A;  3N05 A;  1NK2 P;  1HW5 A;  3OYH A;  3BR5 A;  3W6K B;  1HDP A;  3K1P A;  5F0H A;  2EIM H;  2HYF A;  1U0J A;  3H0G J;  2E2H J;  4ZZL A;  5FLX Z;  1R71 A;  3H35 A;  2RQP A;  1B72 B;  1Z05 A;  3ABT A;  3RKX A;  3LNQ A;  3HM5 A;  2XRO A;  3PIP F;  2L5Q A;  2EFO A;  2KQR A;  4LIT A;  2L02 A;  1TW2 A;  3MZH A;  1I50 J;  1IAW A;  3VFZ A;  5C4X J;  2CSO A;  2L9N A;  3CO6 C;  4CH7 A;  1R36 A;  1ZAR A;  5F08 A;  2DFI A;  3R4K A;  1HBX G;  4CZC A;  1U9O A;  1WH7 A;  5JR3 A;  3VSK A;  1U2W A;  2MW8 A;  4XL9 A;  2IS4 A;  1FBS A;  3C1D A;  4RDU A;  2FOW A;  5L3C A;  1Z1D A;  4E70 A;  3SYT A;  5TIS C;  3LSG A;  2F5D A;  1MKM A;  4NDL A;  1Y8R B;  3CC4 I;  1FNN A;  1XGM A;  1T98 A;  4RS8 A;  2MLK A;  4WXC A;  2IBD A;  2Y0S N;  5AON A;  2O7O A;  2IS2 A;  1HW2 A;  3BLY A;  2XDV A;  4R8H A;  3V8K A;  4DQ2 A;  1G3T A;  3M9A A;  2AO9 A;  3HOY J;  3EQL F;  3KYL A;  2K40 A;  2LK2 A;  1AOY A;  3I53 A;  1FTT A;  3I64 A;  3HGY A;  2FRH A;  3DCF A;  2FSW A;  4BY1 J;  1XCV A;  5AIP A;  4BQO A;  3DPU A;  1K7A A;  2V1D A;  1LUJ B;  3O8H A;  2LG4 A;  1T2K A;  3RPU D;  5HLT A;  2BE5 F;  2QWW A;  2WC2 A;  2VT2 A;  3CJT B;  1F1Z A;  1A35 A;  1D0Y A;  2QLZ A;  3I4P A;  2R7F A;  4P96 A;  2LP0 A;  5L3D A;  4OIN F;  2CW0 F;  1FT9 A;  2NS0 A;  1AKH A;  1IDY A;  3IV5 A;  2K9N A;  3K1N A;  1HKT A;  1O3S A;  2DA6 A;  2VJ4 A;  2R92 J;  1R1U A;  3I54 A;  4NQW A;  2B0L A;  2VB6 A;  2F4I A;  4XLH A;  5IPA A;  2VBY A;  3HBL A;  4AVZ A;  4IHV A;  1RKT A;  2XAJ A;  3D5R C;  2DPD A;  4G94 A;  2HKO A;  2E1C A;  5GAH J;  4UVB A;  2GM4 A;  4A3M J;  3KP5 A;  1Z91 A;  1UG2 A;  4IXA A;  2W48 A;  1FOW A;  3KLN A;  4ENM A;  2WTE A;  3WGI A;  1SC7 A;  4E7I A;  4L0Z B;  2PMZ A;  1XGN A;  5GAE J;  3A1Y A;  4CDG A;  4HDU A;  3F23 A;  5E3O A;  3U21 A;  4DYC A;  3DPT A;  3JTH A;  1IUY A;  2RV8 A;  3CF5 F;  4WXH A;  1J75 A;  3K4L A;  3DTK A;  2RQQ A;  3PSI A;  1JUS A;  4HAM A;  2HKX A;  3NAU A;  1BIB A;  1MJA A;  2K9L A;  4PFO A;  2O8K A;  3CCL I;  1GT0 C;  2KP6 A;  1R4N B;  5FFX A;  4LIV A;  2H1L A;  2LKS A;  4G12 A;  4YRV A;  2PQ8 A;  3OR2 C;  5HDN A;  1ZQ3 P;  5E8G A;  1F43 A;  3I71 A;  5BNG A;  2PJP A;  5H6Q A;  3BJO A;  2QF7 A;  3SHF A;  3Q9V A;  2ZSH B;  5DYM A;  5J6X A;  4LOC A;  3J80 Z;  1O3T A;  2VT3 A;  1T95 A;  1GUU A;  5F1R A;  1YG2 A;  2HQR A;  3JRF A;  2K7L A;  2K4B A;  1GVJ A;  2RRE A;  4N9H A;  1JI8 A;  5TJJ A;  4HA8 A;  2HWV A;  2OPT A;  5LHG A;  1TNS A;  4BUP A;  3M1E A;  3BC8 A;  3QPL A;  2VI6 A;  2W25 A;  2QBY A;  2V6C A;  2VPL A;  3M1C A;  3M07 A;  5F6F A;  4OIR F;  1B9M A;  2P6T A;  1H89 C;  3PO2 J;  5HVQ C;  1WJD A;  2BXY A;  3OMY A;  4OOI A;  1FBU A;  2JUC A;  3GW2 A;  3K4B A;  1LFU P;  2OU2 A;  4U0W A;  1HOM A;  5F64 A;  1E3H A;  4A6E A;  1DPU A;  3MN2 A;  1QHG A;  5LEK A;  1YJN I;  1WPK A;  4F93 B;  3S1R J;  4IO9 F;  5DCM B;  2AXT C;  2D45 A;  3SDB A;  4FTH A;  3G3Z A;  1AWC A;  2GXG A;  3JSP A;  1UMQ A;  3IC7 A;  5K7Z A;  2EZL A;  3BR1 A;  3I9V 2;  1T0F C;  1IRG A;  2G7U A;  1KQ8 A;  1HKQ A;  2MYS A;  3ZMU A;  3SDG A;  4J19 A;  2A68 F;  2EZH A;  1D8J A;  2FJ1 A;  4EEF G;  4JX5 A;  4ZDP A;  3ROU A;  2VJ5 A;  3C3W A;  3BZC A;  5ILU A;  2M5W A;  5F0F A;  1VZ0 A;  4LG0 B;  5JFR A;  4KYW A;  4F52 A;  2HYG D;  2XV4 S;  3HSE A;  3QQA A;  2BGC A;  1E3P A;  1BC7 C;  3W6V A;  4JX6 A;  2PEX A;  4CIC A;  1ACI A;  1LJ9 A;  4A0X A;  1OPC A;  2LBF A;  1XC5 A;  2L0K A;  3HRU A;  3MEX A;  1I3A A;  2P4W A;  3BP8 A;  3BG9 A;  1XGS A;  4ITV A;  4UUT A;  1LFB A;  5CYV A;  2ECB A;  3H92 A;  2R7T A;  2E5N A;  5FKL A;  3S3O A;  2QZ8 A;  3LA7 A;  3H3V K;  4UVC A;  1BR1 A;  1ZH5 A;  3KIO A;  2XSD C;  1JTX A;  3A4C A;  4GDF A;  4CUG A;  3VPR A;  3E6M A;  1FSH A;  2LH9 A;  2NNY A;  2DK8 A;  1RPW A;  3TDU C;  1FOX A;  5D5V B;  4S04 A;  1X4O A;  2V4J C;  3MQ0 A;  5L3E A;  4BDY A;  1MMN A;  3CCQ I;  1OCC H;  3AL0 C;  5D6E A;  1XSD A;  2XAS A;  3ZQI A;  3OYC A;  3JRB A;  1U8B A;  2L3D A;  3AG3 H;  2IJL A;  3G1O A;  4RGR A;  4ZZD A;  2JK3 A;  2DA4 A;  3COA C;  2R5Y B;  2NYX A;  1T38 A;  3ZP5 A;  1JUM A;  1TP4 A;  4C2U A;  4XBF A;  3CQZ J;  2JJ7 A;  5FLV A;  3G1M A;  3E6B A;  4L9N A;  2AQF A;  1R7J A;  2R7Q A;  3LFK A;  2G0E A;  1XN7 A;  4A5N A;  4IQ4 A;  2DDB A;  2O5R A;  1A5J A;  3NQO A;  2LY2 A;  4LGW A;  2DTZ A;  3IH2 A;  2OCC H;  3RI4 A;  3AFH A;  1VI0 A;  4IOA F;  3KZY A;  3ULQ B;  4HDV A;  1YS6 A;  3F21 A;  2IS6 A;  1Y6I A;  1VQ7 I;  5IT9 Z;  4A3J J;  2M3A A;  4B4C A;  2ADU A;  3WTX C;  3OL3 A;  3WTY C;  2YU9 J;  1A6I A;  4OAZ A;  3FWE A;  1MND A;  1PP8 F;  5FGM A;  4A69 C;  4AYB N;  5M3M J;  2X48 A;  4DIQ A;  1IO2 A;  3KEY A;  1V4R A;  1P6R A;  2EA2 A;  3WTS C;  3GFM A;  1B72 A;  3F22 A;  1NTC A;  2ZXJ A;  4M3F A;  2D2W A;  5DM6 F;  2CQQ A;  4LMY A;  2HVR A;  1UFM A;  2CQK A;  2HVS A;  3GTQ J;  4AIJ A;  3S16 J;  2BXZ A;  2FA5 A;  3S32 A;  1GXQ A;  3BPX A;  4XM3 A;  3SZT A;  4RM3 A;  4EM0 B;  3HGG A;  2WY8 Q;  3GVA A;  1J09 A;  2NVX J;  3FMQ A;  3F3X A;  5E3L A;  2FMY A;  3F0C A;  3H3Z A;  4I0A A;  4X6A J;  5FD5 A;  3OYN A;  4CA0 A;  4OU0 A;  1OYI A;  4HRI A;  3MKY B;  1Q1H A;  5FLX K;  2BY1 A;  3HPH A;  5J1U A;  3W2A A;  3J7Z I;  3EUH A;  1XCB A;  3RTR A;  4YG2 F;  3OYF A;  2FUG 2;  2PLY A;  1LEB A;  4ENJ A;  3FK7 A;  4S0H B;  5E79 C;  2DT6 A;  2YR2 A;  1U5T B;  2JRM A;  3BR2 A;  4BHB A;  5FD6 A;  4RB0 A;  1JTY A;  3FXO A;  5HOD A;  1LKX A;  1ZGW A;  3P9I A;  1IGN A;  2O03 A;  5ERI A;  1ITY A;  4I99 C;  3DBR B;  3WTV C;  1MBF A;  4HEA 2;  4A6D A;  1S7O A;  3AG2 H;  3FDY A;  4L0Y B;  1J59 A;  2E1O A;  2FD5 A;  2BVM A;  4G8X A;  2BHZ A;  2ISZ A;  2L9S A;  2TDX A;  2W00 A;  5FRN A;  1VQK I;  3MCZ A;  1XMX A;  2DOE A;  3GEZ A;  4YEJ A;  3KP3 A;  1YW8 A;  2MLG A;  3WE3 A;  4H4K C;  4XLP F;  3OR1 C;  3RJP A;  2CH0 A;  3T8R A;  4GCV A;  4BQN A;  2JA7 J;  3GCM A;  2E1M C;  3J7Y J;  1PP7 U;  3BTI A;  1YW9 A;  1FYK A;  2OJE D;  3G1L A;  3UKG A;  2KRF A;  2X1C A;  4HX8 A;  2WWY A;  3JAM K;  1K83 J;  3PIO F;  4Y33 A;  3I58 A;  2CU7 A;  2Y0S A;  3G71 I;  2VE9 A;  2CV2 A;  3GTL J;  2AXL A;  2H1K A;  3OS2 A;  3LSM A;  1G59 A;  3PL8 A;  4HLY A;  4BAC A;  4RB1 A;  4ZTJ A;  1LNW A;  3B6A A;  4XLE A;  4OMZ A;  3SXY A;  2IA2 A;  3DKY A;  2STT A;  2RGV A;  5D8L B;  2HTS A;  4A3K J;  1W0U A;  1V5G A;  2JSP A;  3HUG B;  5IOZ A;  5LRS A;  5EEA A;  1QU3 A;  3WE2 A;  3WG7 H;  1ZR4 A;  2XKO A;  3K10 A;  2WAQ N;  3MVP A;  1NG6 A;  1W4M A;  3K2Z A;  3LWF A;  3L2R A;  2ZJP F;  4XOR A;  4ZYE A;  4NC8 A;  4KJZ A;  2HDC A;  1L0O C;  4HQM A;  3ZQL A;  3FZV A;  1HF0 A;  3HKZ A;  3ZQ7 A;  1X1D A;  3KYC B;  1FZP B;  3EYY A;  4IJA A;  1MSF C;  1XDU A;  2HOE A;  4IPA A;  2FML A;  1L3L A;  1WJC A;  1U9N A;  2ME6 A;  3GTO J;  3FBI B;  1IN7 A;  1GVD A;  2EQR A;  1USS A;  3BG7 A;  5LD2 C;  4C3I J;  3DEW A;  3KP6 A;  3TO7 A;  2XRL A;  5KNL A;  1EA3 A;  3CUQ C;  2F4O B;  2EFN A;  4LLG F;  1PDN C;  4DYR A;  4I7H A;  3P9C A;  4XQF A;  1ZRE A;  1D5V A;  3BCA A;  3DKX A;  3BOQ A;  4CCO A;  3RPU A;  2QKL B;  3H5R A;  5K5O A;  3A0B C;  4AD9 A;  3MAJ A;  2HOA A;  5D5W B;  2PFB A;  5EGO B;  4HV6 A;  2MFZ A;  4ZDO A;  4XMY A;  1RES A;  2M87 A;  4X0G A;  2XAU A;  2L7K A;  5L3F A;  1ZAO A;  1JT0 A;  4B1R A;  4IHT A;  2CG4 A;  4EGZ A;  3DXJ F;  2ELJ A;  5FRO A;  4MEX F;  1KU9 A;  3A01 A;  2CUJ A;  1DGR M;  4LJZ F;  1R49 A;  4MFD A;  2L2O A;  2F5F A;  2W1O A;  3WTZ A;  3S1N J;  2X6X A;  3HRM A;  5AIQ A;  3LSP A;  3AL0 B;  1IXR C;  2OD5 A;  3BR0 A;  2X6O A;  4OIP F;  1RR8 C;  2V26 A;  3CCU I;  2MC3 A;  3RKQ A;  3HRT A;  3GUD A;  2XUB A;  2BOL A;  3VYU B;  2X9D A;  1A6Q A;  3H0D A;  2P7V B;  1GDT A;  3JRG A;  5EG0 B;  3K70 C;  3FXM A;  3AKZ A;  3G6E I;  1O7F A;  4YFN F;  3R0A A;  1WJ5 A;  2DA7 A;  5ED4 A;  2XAG A;  4G7H F;  3SFI A;  2IGN A;  1QVU A;  2BZT A;  5L3G A;  1RC9 A;  3MKL A;  4FE7 A;  2LVS A;  3HSR A;  1S72 I;  4BE1 A;  3S17 J;  4L5E A;  2XGD A;  3RQI A;  2EIK H;  1VQM I;  2C6Y A;  4BBS J;  1WCM J;  1U6G A;  3DTI A;  1Z7U A;  1DP3 A;  4M3B A;  1V3F A;  5M5W J;  3RKW A;  1FJL A;  3F8M A;  1IXS B;  3BJA A;  1UB9 A;  2IW5 A;  1CQT A;  3PO3 J;  4BJ5 C;  2K9M A;  2DFF A;  1MSE C;  1MW7 A;  1V54 H;  3FIW A;  2BEO A;  3DLL F;  3TGN A;  2BY2 A;  2IXS A;  2OF7 A;  3Q0V A;  4CSW A;  1X3Z B;  1BIA A;  4UUV A;  2H94 A;  4PDK A;  4NB5 A;  1M1E B;  3MKW B;  2V79 A;  5JVG F;  1TW3 A;  1YLF A;  2HVQ A;  3LAJ A;  1GV5 A;  2F48 A;  3QOD A;  2WA0 A;  1VQ9 I;  3SZP A;  4MQ9 F;  3TW7 A;  2IRF G;  5J1R A;  1ETK A;  4ZYA A;  4XON A;  5BOX A;  3FHN A;  3DWL E;  4LG3 A;  2Z33 A;  2DI3 A;  3HEF A;  2V9P A;  3WTW C;  1ONV A;  4G7Z F;  5ILS A;  3FMR A;  4IKF A;  4ZJZ A;  4EGY A;  1IV6 A;  3E5U A;  1E2X A;  3RYP A;  1DP7 P;  1OQY A;  5IP9 J;  1BC8 C;  5DM7 F;  1WZ2 A;  1R23 A;  3FM5 A;  2DQR A;  1QBJ A;  2ZFU A;  3IUO A;  1BBY A;  4EJO A;  1OCR H;  4JQF A;  4MFE A;  4Q47 A;  5D5X B;  2R0Q C;  1LE8 B;  2LNB A;  1IN6 A;  2Q2E A;  3RDI A;  2K5C A;  3TBI A;  2O8X A;  1KQ0 A;  1A04 A;  3BRO A;  4AWX B;  1TBX A;  5FKN A;  3B73 A;  1R1V A;  2VXD A;  3M4O J;  2R5Y A;  1WJB A;  1X2M A;  4BEH B;  1KQ9 A;  2QSH X;  2RAE A;  2Q0O A;  2QYO A;  4IHY A;  2DFE A;  2OQG A;  3ABM H;  5CJ9 A;  3PQK A;  4FX0 A;  2A05 A;  3I56 I;  1FTZ A;  1KYZ A;  4B43 A;  9ANT A;  1TWA J;  2A6H F;  1K78 B;  2OUM A;  4NHJ A;  3RIR A;  4Y7N J;  2KRC A;  4M3E A;  2IEK A;  3ZMV A;  2JPC A;  3VDX A;  5DUI A;  1WJA A;  2NVY J;  3CJR B;  5EJC A;  3QAH A;  1R1T A;  4YII A;  2E1M B;  4FIS A;  3K4K A;  3HTS B;  5EEH A;  2HXI A;  3BZK A;  2VKV A;  4Q4Z F;  1VQO I;  2HDW A;  2DA3 A;  3ONQ A;  3JR9 A;  1BW5 A;  3CLO A;  3GTP J;  3C2H A;  1J0R A;  2L7Z A;  4PSW A;  5HDG A;  5IY5 H;  2R5Z B;  3MZ8 A;  3CCS I;  4F91 B;  3TED A;  3JRE A;  1HDD C;  1JXS A;  3TO6 A;  3NRV A;  2HI3 A;  2CFO A;  1ZG3 A;  3K4N A;  3V7S A;  2OZ6 A;  3ABL H;  2UV1 A;  3S2H J;  2CYY A;  5BPI A;  3S1M J;  4E7Z A;  4LB5 A;  2F4M B;  2VAS A;  3ML6 A;  4WK8 F;  2VPR A;  3A02 A;  2M0C A;  2E2J J;  4U0Y A;  2VIX A;  2EK5 A;  2XRN A;  2Y9Y A;  3K70 D;  2JMW A;  3IL2 A;  5FO5 A;  4XLA A;  5CVV A;  4BNC A;  4FAS D;  2ZME B;  5M5X J;  4EMS A;  2ESN A;  3U1K A;  4AC0 A;  2HEO A;  3T1B A;  1MNE A;  5IYB J;  2G9W A;  3I59 B;  1TQP A;  2VC1 A;  4UV9 A;  3VYS B;  4FCY A;  3IAM 2;  1VFC A;  2H6C A;  1SMT A;  4N4N B;  1V55 H;  2VUM J;  3FXL A;  2LSO A;  5LHI A;  4RLF A;  5IYD J;  3CUQ B;  2DOF A;  3DV8 A;  1P7J A;  3VYR B;  1YI2 I;  4A0Z A;  2WV1 A;  3GTG J;  1MMD A;  1JJ6 C;  3WG9 A;  1U8R A;  5FKM A;  3VOE A;  2HZT A;  1FBQ A;  4KDP A;  2X85 A;  2TCT A;  3JRD A;  3H36 A;  2DLL A;  1MJB A;  3B6C A;  4BQQ A;  1IZ1 A;  4NC7 A;  1X1P A;  5CLS A;  2O3F A;  4RAG A;  1BA5 A;  3QP6 A;  1LVK A;  4CYC A;  3CCE I;  3TP0 A;  2R7Z J;  1QVT A;  1REP C;  3IKT A;  2ZNZ A;  3KFW X;  4YIF A;  1HLV A;  2EJR A;  2MD0 A;  2NS7 A;  2XB5 A;  3E97 A;  2HNH A;  4GFB A;  3T0Y A;  3WGG A;  1ZTR A;  3E7L A;  4QPO A;  3TQN A;  1BI0 A;  1YIJ I;  4W1U A;  2V1X A;  2CMP A;  3FX3 A;  1AU7 A;  4ZYH A;  4BBR J;  3PFI A;  2X51 A;  3E3V A;  3IRR A;  2XGE A;  2D5V A;  1PUF A;  1SVM A;  1W7P D;  4C2T A;  5A2Q Z;  3WHB A;  1I39 A;  2L9R A;  3GME A;  1FYM A;  2LKP A;  1VQL I;  4IQJ A;  4XRS A;  2VBZ A;  3P9K A;  5BMZ A;  3D0S A;  2EBI A;  3GO5 A;  1J7K A;  4MIM A;  4AID A;  3SEQ A;  1ETY A;  1ZN2 A;  3DLA A;  4ESB A;  4I01 A;  2E1N A;  3HUG A;  4ETS A;  1QNT A;  1ZKG A;  5FKK A;  1P4W A;  3W3C A;  4HNU A;  4Y52 J;  3CES A;  1T0F A;  1VQ8 I;  4B09 A;  2JQ7 A;  1T39 A;  4OIQ F;  3O3K A;  2BHY A;  3V4G A;  5CKT A;  3J81 Z;  5BS6 A;  2ZBK A;  3HIF A;  1QZZ A;  3SQN A;  1IDZ A;  3OOP A;  2DJN A;  5B1B H;  3JRI A;  4Y15 A;  5HS9 A;  2K3P A;  4G9Y A;  4R79 A;  1MMA A;  1MBE A;  5EYR A;  3WU1 B;  5CVJ A;  5D6F A;  4BXF A;  2OTJ I;  4ESF A;  4BQA A;  1FP2 A;  2B7E A;  1JJ8 C;  2Q1Z B;  2JWT A;  3BR3 A;  4G6Q A;  3ERM A;  5KAF C;  1QHH D;  2GOX B;  3GLX A;  5KHD A;  1SAN A;  1TNT A;  3VB2 A;  3HOS A;  3W2V A;  1EF4 A;  1U5T C;  3O6B B;  2VJI A;  4EJT A;  1IV8 A;  4HNV A;  1WFX A;  2RDP A;  3L00 A;  4DW6 A;  3PQJ A;  3QU3 A;  2E60 A;  2WAQ A;  3OS0 A;  2Z5U A;  3DPL C;  2E36 A;  2QVO A;  3OY9 A;  3SJM A;  3NWT A;  3CDH A;  1W7P B;  4CXF A;  1YJ9 I;  3BTL A;  1PVE A;  3D5S C;  3DFG A;  2QSF X;  4EJW A;  2P5K A;  1Y39 A;  3OYJ A;  4A2U A;  2KIF A;  5E17 F;  1IRZ A;  2ID3 A;  3V42 A;  1CGP A;  3DTE A;  2CUZ A;  4P1W A;  4WX9 A;  2KRH A;  2P7C B;  2CWE A;  4BDZ A;  2XAH A;  3KP4 A;  1TWF J;  2DQL A;  3HRS A;  1W5S A;  3K69 A;  4KT5 C;  2JVG A;  2QM3 A;  1LDJ A;  2RVC A;  3PNT A;  3I4M J;  2IVM A;  1DGW Y;  4YIR X;  3IRQ A;  3GZ5 A;  4E7L A;  3ZR8 X;  3F8F A;  3K9T A;  5EZH A;  3ABU A;  3JTG A;  5DTD A;  1MH4 A;  1AHD P;  4RGX A;  5M3F J;  4U7D A;  4EM1 A;  5L3B A;  4XSZ F;  4L18 B;  3F6O A;  3HG9 A;  1SEU A;  2PBI A;  2FF4 A;  2XGC A;  4MO7 A;  2XC7 A;  4A3L J;  1S7E A;  2DN0 A;  4F7Z A;  3E0J B;  3HOX J;  2JA2 A;  3EUA A;  5ICG A;  1RUO A;  2HR3 A;  2K9Q A;  4BGD A;  5EDN A;  5BPD A;  2D1H A;  1O3Q A;  1HQC A;  4JBA A;  4RGU A;  1UEL B;  5HLG A;  2R93 J;  4PJL A;  1ZYR F;  4M6V A;  3T8T A;  3WU2 C;  5GTH C;  1SFU A;  3JRC A;  1J5Y A;  2QA4 I;  1V5F A;  3GFI A;  3KP7 A;  3W6J B;  2MD5 A;  4PGH A;  3BG3 A;  2JSC A;  2HXO A;  4JYK A;  2DW4 A;  1MDM A;  3HC7 A;  4UHT A;  4U87 A;  5DS9 A;  4AIK A;  1WH5 A;  3EYI A;  1UCR A;  4FQG A;  2LY9 A;  5E3M A;  3LST A;  4M74 A;  3UNG C;  2WB1 N;  2NNN A;  5IP7 J;  4LD5 A;  3ZQG A;  2X1E A;  1Z3Y A;  1DPR A;  2UWM A;  3E5X A;  3SZG A;  1RR7 A;  2GA2 A;  3EDP A;  4WWC A;  5GPC A;  1LE8 A;  2EPF A;  2KKO A;  2EZI A;  5J3L A;  1DUX C;  1W5T A;  2KIQ A;  4XRF A;  1G8X A;  1FY7 A;  3CMM A;  3G2B A;  1RUN A;  1F9N A;  2LF8 A;  5DD8 A;  4L9J A;  4XLC A;  2BW3 B;  1BJZ A;  2YUS A;  2PJR A;  2EH3 A;  3BQY A;  4M9X A;  4M71 A;  4G6T B;  1SD4 A;  2ME0 A;  2VE8 A;  4PSX A;  3TL4 X;  2CV0 A;  3RKY A;  4HLX A;  3GXO A;  2JA6 J;  1TLH B;  1K78 A;  4RB2 C;  4NNJ A;  3MFK A;  1FPQ A;  4LFU A;  1OKR A;  2ZC2 A;  5D4S A;  1CF7 A;  4XLF A;  2CJJ A;  3OYM A;  2KIS A;  5DDG A;  4KNY A;  4FX4 A;  2YU3 A;  4PFP A;  3U9G A;  4A0Y A;  2V1U A;  5LBQ A;  1P9Q C;  2L4A A;  1YYV A;  3LSR A;  1YO5 C;  2IA0 A;  3N97 A;  3A2K A;  2CV1 A;  3OIP A;  4MTE A;  2CQN A;  4I02 A;  3LAP A;  3I4N J;  2CS3 A;  1VQ4 I;  1XD7 A;  1OIS A;  3WHC A;  4E7K A;  2ICW G;  2XF6 A;  2DPU A;  2WY7 Q;  1K4S A;  1UJ8 A;  1TC3 C;  3BT9 A;  3M8E A;  2G7H A;  3WGH A;  2RNG A;  1D8K A;  3KEO A;  2V9V A;  3H9Q A;  3TOB A;  4BHC A;  4UB8 C;  2OC6 A;  1STZ A;  1WWX A;  5H20 A;  5JHF A;  3GBG A;  4MGR A;  1WQ2 A;  2JZY A;  2WBM A;  2ZCW A;  5E1Z B;  4KFC A;  2EV6 A;  2M0M A;  3L2C A;  4EV0 A;  2H27 A;  1BOB A;  3CCY A;  2DMN A;  3FXR A;  2H6B A;  1X3W B;  3LL7 A;  5HS8 A;  2K86 A;  1ETX A;  1MGT A;  4CO8 A;  2F2E A;  3I59 A;  4D5C A;  1ZK8 A;  1KGS A;  2OCE A;  3C2B A;  3DU5 A;  1WGX A;  1OCP A;  2JA5 J;  1R22 A;  2E7X A;  3FF5 A;  1TT5 B;  2VC0 A;  4XOT A;  2PMH A;  3CP8 A;  3TOA A;  2R7X A;  4EM2 A;  2Y9Z A;  5E1X A;  4PJN A;  4UXN A;  3HZJ A;  4KT6 A;  5ICE A;  1IJW C;  3E6C C;  1HCR A;  2V6E A;  1Q1V A;  4UNO A;  1SFK A;  1HC8 A;  5JLW A;  1MJ9 A;  4BU2 A;  3ZCO A;  2KJB A;  2ECC A;  1T56 A;  1MH3 A;  2JN6 A;  3J7A Y;  2Y48 A;  1J9I A;  2X6W A;  3DP7 A;  3FMS A;  4XR6 A;  2JPB A;  3MD2 A;  2LY1 A;  3DEE A;  5C3E J;  3ASO H;  1BOA A;  3OYL A;  2VQH A;  2HYJ A;  1XSX A;  4A3G J;  2VQL A;  3OSG A;  4A3D J;  3WTT C;  5FKO A;  4BE0 A;  3CDL A;  1LDK B;  1VND A;  3QYE A;  5HLI A;  3GLL A;  1QRY A;  5LFA A;  1XMA A;  3JRH A;  4QWQ A;  2HFH A;  2KIU A;  2F5V A;  1HSJ A;  3U2R A;  1YOV B;  4Y4R A;  4WCG A;  4ZH4 F;  4IRI A;  2M7A A;  5HDK A;  5GP9 A;  1XG1 A;  3MWM A;  2OTL I;  4MHG A;  3S8P A;  5E3N A;  1G2H A;  3GX4 X;  1YX3 A;  1ETQ A;  2NAZ A;  2A69 F;  2LC2 A;  4MQV A;  3ZOB A;  1AKH B;  1HKS A;  2ZME C;  4WF2 A;  1ZRF A;  1IN8 A;  3EPZ A;  1R4M B;  3GZN B;  5F27 A;  1YRN B;  4F3Q A;  4QSH A;  3RCO A;  3NWS A;  2E35 A;  2HZD A;  2OBP A;  4RM2 A;  4U0V A;  1X58 A;  1IN4 A;  1R9T J;  4DNC A;  1MD0 A;  3IWZ A;  1ETV A;  4Z6Y A;  2XIG A;  4IHS A;  2DK5 A;  1G6N A;  2J5O A;  2MH9 A;  1XGO A;  1ZLJ A;  1FMV A;  1N25 A;  1XDS A;  4HSR A;  3DQV C;  4QTR A;  2NXN B;  3K4C A;  3SEZ A;  2XAQ A;  3FBN B;  1BI1 A;  1SVL A;  1S5L C;  3H1C A;  1ODD A;  4PJM A;  5CPR B;  3CO7 C;  2QCO A;  1W7P A;  2PMU A;  1BN5 A;  5CVU A;  3EUH C;  1EH8 A;  3HHG A;  4B44 A;  3ECO A;  1T8I A;  2MA3 A;  2E5Z A;  3F72 A;  2ZJR F;  5LEJ A;  1U78 A;  3CC7 I;  1OR7 C;  4BJT A;  1HXD A;  1D5Y A;  4PJJ A;  4FET A;  1MBJ A;  2W4S A;  1B8I B;  3L2U A;  1D0Z A;  1YW7 A;  5DV5 A;  5KAI C;  3I55 I;  2UZK A;  3ABK H;  3J80 K;  4ENN A;  1APL C;  5FB2 A;  2R7O A;  4O5V A;  1FMW A;  2EWN A;  2LR8 A;  1EH7 A;  3QOP A;  2HTJ A;  1ETW A;  3F6V A;  2Z2S B;  2HQ5 A;  4XNF A;  2FNP A;  3VSL A;  5K5Q A;  1G3W A;  1WSU A;  2D1V A;  2Z9O A;  1MZB A;  3C2G A;  4N9I A;  5DCM A;  4RB3 C;  2HPM A;  2I10 A;  4M3D A;  5GAG J;  4E7H A;  1D1C A;  2RNJ A;  1I6H J;  1QQI A;  1WRJ A;  3DF8 A;  2FQ3 A;  5CQE A;  2LMD A;  1FX7 A;  1XX5 A;  2MG4 A;  2WAF A;  1FC3 A;  1MIJ A;  1B6A A;  1W36 C;  4YFX F;  2K85 A;  4O6J A;  1WI3 A;  3AG1 H;  4M6X A;  4PUS A;  4Q5S F;  2R3S A;  3M8J A;  2DOA A;  5J4Y A;  2IPQ X;  3GF2 A;  4LG0 A;  4KMF A;  3L1P A;  1BR2 A;  1YHQ I;  2QQA A;  1X2N A;  3H9G A;  2RC4 A;  5E8I A;  2W85 A;  3GYH X;  2XF5 A;  1FLI A;  1S7A A;  4CZZ A;  4CGZ A;  2I5U A;  4I98 B;  3RZD J;  3CZ6 A;  2Q8K A;  4KN4 X;  3VYT B;  1RZ4 A;  3KE2 A;  2A3S A;  2BY0 A;  2K9S A;  3F8C A;  3C18 A;  2QKM B;  4XIC A;  1X1B A;  1N78 A;  3OYK A;  1WJE A;  3LSI A;  2F5C A;  1ZRD A;  1ERD A;  3HOW J;  2CUE A;  4ZDL A;  4AVP A;  2KDZ A;  1N77 A;  2FU4 A;  3HTU A;  1R6R A;  2XF7 A;  4C30 A;  3S2D J;  4PK4 A;  4I0B A;  3HDD A;  4P9F A;  4A12 A;  4IHX A;  2UUZ A;  3LOC A;  3F8B A;  2QQ9 A;  3CME I;  2O0Y A;  4DZP A;  3HL2 A;  1UZC A;  1V5E A;  4IRH A;  1B4A A;  3ZMS A;  4XK4 A;  3CLQ A;  3OYI A;  4K2E A;  4I76 A;  2ETH A;  2Y0M A;  1H9T A;  4A3F J;  5KCM A;  4EJV A;  4WXD A;  1R5H A;  4XKC A;  3J7A O;  1JHF A;  2P5L C;  2WB1 A;  2M1B A;  1BW6 A;  2ZXH A;  1QPM A;  2ZXI A;  3H5N A;  2N8G A;  5IT3 A;  5KK1 A;  4OWR B;  1YTY A;  3E5Q A;  2UXX A;  1GV2 A;  4KIC A;  2AQE A;  1P92 A;  2RKH A;  1UG0 A;  4XLN F;  2XKP A;  3QYB A;  1EJ9 A;  1MBG A;  4IVN A;  1YS7 A;  3HB9 A;  3L7W A;  4P55 A;  1IRX A;  2VQG A;  4HW0 A;  4GO1 A;  4EQQ A;  4OIO F;  2LTP A;  4C9Y A;  1KU7 A;  5EZG A;  2L9V A;  2I8D A;  2IGM A;  2DA5 A;  4CCN A;  5D5U B;  2P6S A;  2PX9 A;  4RGS A;  4NBQ A;  5K7H A;  1XSV A;  2X4H A;  2EB7 A;  2KMU A;  3D5L A;  2YPR A;  2R7U A;  1XB4 A;  5DD4 A;  5GTI C;  4R1H A;  1QA6 A;  4I6Z A;  1FIP A;  2DO7 A;  4XN0 A;  5DEQ A;  3R61 A;  2VXZ A;  3CD6 I;  3ZXS A;  5IT9 K;  4M9S A;  2BYV E;  3KCC A;  3DEU A;  3HOU J;  1SAX A;  4U88 A;  1I6X A;  2XPV A;  1I3Q J;  1B9N A;  5BQT A;  2LLK A;  4LIU A;  2BBY A;  4C2M J;  4GXO A;  4YFK F;  1XTA A;  2B63 J;  2DCE A;  1LB2 A;  1HA8 A;  4AYB A;  2NS8 A;  1X3U A;  4UY8 I;  1FEX A;  3CCJ I;  3M8F A;  3GTK J;  4FT8 A;  3CJN A;  1W36 D;  1U5T A;  2ZJQ F;  4KUM A;  2V7F A;  4M72 A;  2ZB9 A;  2O9L A;  3ZN0 A;  2X1D A;  4N4O B;  2A6T A;  4ANJ A;  3G4S I;  3CMY A;  1G3S A;  2DA1 A;  3EET A;  4BAY A;  2A07 F;  1D3Y A;  3IWF A;  1ZGJ A;  2DXI A;  3Q0U A;  4XN3 A;  3PM1 A;  4PGG A;  3HOZ J;  3K1M A;  2H09 A;  4UUS B;  1W0T A;  2UXN A;  2FX0 A;  1LDD A;  4V2G A;  2HDD A;  3GTJ J;  2VKH A;  2VKD A;  2P81 A;  3ZMT A;  1BJA A;  4B3X A;  3FHZ A;  1I5Z A;  3C7J A;  2A6E F;  4PCQ A;  2JVH A;  4HOB A;  3KET A;  3CJQ B;  3VOD A;  4D1Q A;  2GIV A;  4I2O A;  3PUB A;  3ZQF A;  3JAM Z;  3KEQ A;  3ESW B;  2DFH A;  3CCV I;  2EFQ A;  2BY3 A;  2E71 A;  2EZK A;  1VQ6 I;  3V8J A;  2CW8 A;  4D0P A;  3ZMD A;  1T6S A;  2CW7 A;  5HNF A;  4B47 A;  3ELK A;  1U3E M;  4XRM A;  3HOV J;  2FEZ A;  2J5P A;  1Z6T A;  2BVL A;  4HZF A;  1OMI A;  3K2A A;  1ZLK A;  1K6Y A;  2L54 A;  4A93 J;  2W57 A;  3H5A A;  2K27 A;  5ICF A;  1OCT C;  2M2E A;  1JT6 A;  3TMO A;  3G73 A;  2R4G A;  3AG4 H;  4N0B A;  4AU7 A;  2EIL H;  1F4K A;  3MMY B;  5B66 C;  3HKZ N;  3ERE D;  1H88 C;  2Y2Z A;  4IZZ A;  5IP6 A;  4UB6 C;  2VON A;  3TW6 A;  2HGC A;  2LRD A;  1WKM A;  2QEN A;  3FXQ A;  1ON1 A;  1Z6R A;  3CP2 A;  4IOC F;  4XOP A;  4H0E A;  1GXP A;  5FLM J;  2KFD A;  1VQ5 I;  1YRN A;  1P4A A;  5KVR A;  1OYW A;  3BG6 A;  3QYF A;  4D7N A;  1TL8 A;  1EKE A;  1RKW A;  3H9J A;  3LQR A;  3HPG A;  3Q0W A;  1ZRC A;  2FBK A;  4MEY F;  1B59 A;  3S14 J;  3S3M A;  2L01 A;  5LRR A;  1VQP I;  1QZE A;  1SFX A;  5F04 A;  4QPQ A;  5J47 A;  4CCL A;  1DU0 A;  3BDD A;  1R00 A;  3A03 A;  1QGP A;  3K0L A;  4D9J A;  4IHW A;  1H8A C;  2EA4 A;  5EGO A;  3FK6 A;  3L9F A;  1RET A;  2E2I J;  4LLN A;  5JVT A;  2O6G E;  2VKE A;  1W5C C;  1BR4 A;  1ENH A;  3KZZ A;  4FE4 A;  1ZG5 A;  3RZO J;  4IF4 A;  5HOO A;  3F9K A;  2COM A;  2A5Y B;  1VQN I;  2GZW A;  4M3G A;  3V7C A;  4EAT A;  4RAZ A;  1ETO A;  4X1E A;  2GOM A;  3X2Q H;  1X1A A;  1YFH A;  2MAB A;  3WU0 A;  2Z3Y A;  1B8I A;  4KMU X;  2QQ8 A;  4HBL A;  3IAS 2;  2KL4 A;  4QLC U;  1XMK A;  2DDA A;  5EG0 A;  2L4M A;  3K4J A;  2ZSI B;  2A5W A;  4OAY A;  3A01 B;  3REO A;  3BTJ A;  1JGS A;  2R7R A;  5LGU A;  2NVU B;  2VN2 A;  2DYR H;  1FSE A;  2FBH A;  2HU9 A;  1UHW A;  2FBI A;  3T5X A;  1QPI A;  2W82 A;  4HX4 A;  4C3J J;  4B3A A;  3MKZ A;  2JA8 J;  2LRE A;  4BS9 A;  2M4K A;  3CCR I;  4RBO A;  5C4J J;  3OIQ A;  2M8E A;  1Y8Q B;  4UV8 A;  1BI3 A;  1SFE A;  4C3H J;  2XHK A;  5FJ8 J;  5J4V A;  4E4H A;  4QIW N;  5JI6 A;  1KYW A;  2COB A;  1Z77 A;  1RRJ A;  2W84 A;  2ZXW H;  1TWC J;  1TT0 A;  4ZYD A;  4V2F A;  1DQU A;  3OV8 A;  4HYE A;  5LHH A;  3HYI A;  3JCU C;  2IAI A;  4D7M A;  4ZYG A;  4HF1 A;  5IYC J;  4P9U A;  2EV0 A;  3QPT A;  3ECH A;  1UST A;  2L7F P;  2NOG A;  2W7N A;  3E6D A;  2XPU A;  4MNU A;  4E6K G;  4XRS G;  1K4T A;  4E7S A;  3ZRG A;  4AUX A;  5E18 F;  2CQ7 A;  1FP1 D;  1VF9 A;  3BCB A;  2K3F A;  3P5J A;  3B02 A;  1AA7 A;  1S8N A;  4NC6 A;  3CUO A;  1Y56 A;  2CUF A;  2HQN A;  4YEL A;  5EF6 A;  2L7M P;  1IN5 A;  3GZ6 A;  2P0W A;  1OJL A;  3OYE A;  5CVR A;  3PSF A;  1B1B A;  3SFZ A;  2KLO A;  5K1Y A;  4E7J A;  3L2Q A;  2M9H A;  2YSR A;  2R7D A;  1OFC X;  1JHH A;  2JT1 A;  4CCK A;  2LKX A;  4A3I J;  2HOT A;  3FXJ A;  3EUK L;  4DZJ A;  2ZJ2 A;  3K4M A;  2V1N A;  3ZQH A;  2ZO4 A;  1Z7L A;  2DA2 A;  2MSY A;  3PNY A;  4JOM A;  4XKV A;  3OSF A;  1C0W A;  3QPH A;  4V19 K;  1T08 B;  4HX7 A;  1I27 A;  4BEH A;  2LF7 A;  4JK1 X;  4PJ0 C;  2ZKZ A;  5GPA A;  4BY7 J;  3IH3 A;  3MZY A;  2XB0 X;  1YIO A;  1IUF A;  2CO5 A;  3Q5F A;  1KU3 A;  4XKW A;  1SMY F;  2QEX I;  3CC2 I;  4J01 A;  1OYY A;  4LK0 F;  2KIM A;  2X6Y A;  5J1Y A;  3BQZ A;  1SD7 A;  3QPS A;  2CRG A;  2TRT A;  3E1S A;  3HSF A;  4Z2Y A;  5FRM A;  2IS1 A;  3R6S A;  3CTA A;  1S3J A;  1SD6 A;  2F5E A;  2XVC A;  2GXB A;  2LOO A;  2Q2E B;  1XS9 A;  1K79 A;  2LDU A;  3JSO A;  3LSJ A;  3LQQ A;  4LK1 F;  1RI7 A;  2H8W A;  5F1J A;  4RAF A;  2GA1 A;  2IGO A;  4U7B A;  3OS1 A;  2VOP A;  1F5T A;  4FHT A;  2MGQ A;  1P4X A;  2P8T A;  2QUF A;  4PZJ A;  3LFU A;  1O3R A;  5K7F A;  3TKY A;  3VWB A;  2NVQ J;  2DT7 B;  4ESJ A;  2R5Z A;  4TV7 A;  3LSH A;  1I1S A;  1EH6 A;  1MMS A;  2Y30 A;  5E1W A;  2M7B A;  3FXU A;  2HS5 A;  1LVA A;  3M7G A;  3FM3 A;  3FKI J;  4J00 A;  1D1A A;  1BL0 A;  1S9H A;  5LLQ A;  5B5E C;  2DTR A;  3V7R A;  4LLL A;  3KYD B;  3M3Y J;  1BI2 A;  3S3N A;  4HST A;  3VEP A;  3JRA A;  1JGG A;  2OV7 A;  1T33 A;  3I3L A;  2ELH A;  4DYQ A;  2ESH A;  2ZME A;  3F8N A;  1ORK A;  3WOD F;  3BR6 A;  3OYB A;  1G4D A;  3KX2 A;  2R7W A;  1R5I D;  3Q9S A;  4A5M A;  1D1B A;  3PJR A;  4M6Y A;  1IW7 F;  5D8K B;  5IOY A;  1KU2 A;  2MH2 A;  4EJU A;  1OLT A;  1O57 A;  1K61 A;  4Q48 A;  2M4G A;  1PYV A;  3CUQ A;  1A36 A;  3AAF A;  1KZH A;  3BWG A;  2YX4 A;  4RLQ A;  4F55 A;  1N75 A;  2OA4 A;  4IEJ A;  2O61 A;  1G3Y A;  1MBK A;  5CVI A;  3BY6 A;  1FOY A;  3GFL A;  3R0J A;  4Y13 A;  1A31 A;  5C44 J;  3D1N I;  2DMQ A;  2FQ4 A;  2HQA A;  1Z67 A;  4UUS A;  2LYC A;  1HW1 A;  4II2 A;  4BXX J;  2ELK A;  1H0M A;  4RMN A;  4L9V A;  1K6O A;  2W24 A;  2CGP A;  3NEU A;  5LGT A;  3GTM J;  2FXA A;  3OL4 A;  3KPH A;  4ABZ A;  2DMT A;  4BYY A;  2Z1D A;  3LA2 A;  2GWR A;  3PNV A;  3R60 A;  2K4J A;  1Y0U A;  1JE8 A;  2NVT J;  1Z3X A;  1FIA A;  3CF2 A;  3OWT A;  1SFO J;  4ASN A;  3LMM A;  4DOZ A;  1OR7 A;  1E0E A;  5JLX A;  3BJ6 A;  2ZNY A;  2DYS H;  1RNL A;  2DMU A;  3BPV A;  1JKO C;  2JRT A;  4JP0 A;  2GAU A;  4IX7 A;  5FFZ A;  2VL8 A;  4O3M A;  1J2X A;  5ICC A;  2H8R A;  3L09 A;  2FOK A;  4CYC B;  4I09 A;  4JX4 A;  3QWL A;  2NOJ B;  3TDZ C;  2EFW A;  4KIF A;  4L5I A;  4L9T A;  4M73 A;  3W2W A;  1H9G A;  3OYD A;  3IKV A;  1LPQ A;  1ZGA A;  4XID A;  1RIO H;  3BG5 A;  4II3 A;  1R5G A;  4DGW B;  3V8L A;  4DBQ A;  4GYI A;  5CQG A;  4KIS A;  2KZV A;  2PMZ N;  1TQI A;  4OMY A;  2R7V A;  4Y17 A;  2WAE A;  3O2P E;  1TWG J;  1X1C A;  3ZPL A;  1POG A;  2M34 A;  1PUF B;  4KN7 X;  3Q3S A;  4BKX A;  1WI9 A;  5HNH A;  1NHA A;  1X4P A;  3L2W A;  3CDI A;  1Y1W J;  2OAZ A;  2XSJ C;  5A2Q K;  4NUB A;  5H6R A;  2EIJ H;  2P5V A;  2JTV A;  4NQW B;  1PUE E;  1DU6 A;  1SVO A;  1YX5 A;  2DJI A;  1Y1V J;  5E20 A;  1E17 A;  1ON2 A;  5HLH A;  3IP4 B;  2DU9 A;  1P2F A;  4HF0 A;  2STW A;  4UVA A;  1MBH A;  2GIZ A;  2KZG A;  3RQ4 A;  3K7A J;  2OQR A;  4D5F A;  4XKB A;  4HQE A;  3A0H C;  3DBH B;  4AIH A;  1ZHF A;  2XAF A;  1SD5 A;  1ZG1 A;  4KIB A;  1FWZ A;  2EV5 A;  2KHM A;  4L5J A;  5LGN A;  3J81 K;  2AS5 F;  5EEG A;  2JUG A;  4LB6 B;  3ZN1 A;  2FE3 A;  4F92 B;  2AHQ A;  4GYG A;  1Z9C A;  2ID6 A;  3ZGK A;  4G7O F;  5J8C A;  2M45 A;  1Z0X A;  1OCO H;  5TRD A;  2FNA A;  4IRG A;  3HXL A;  3ZMZ A;  1HST A;  1IXC A;  1TTY A;  3L2V A;  2KPM A;  2B9S A;  2BV6 A;  2QQB A;  2XPW A;  2Y75 A;  1GHC A;  3CCM I;  1D0X A;  4EVI A;  5B3S H;  2DOD A;  1GLN A;  1Y0N A;  2DMP A;  3HHH A;  2ISY A;  2GLO A;  4ENK A;  4DJA A;  3ZQC A;  1F36 A;  2XGX A;  2VBX A;  3QP5 A;  2CQX A;  1OCZ H;  3RSN A;  2WV0 A;  2QGU A;  1UHM A;  1JKR C;  2IGK A;  2Y69 H;  3H3U A;  3S1Q J;  4HPQ A;  4BXU A;  4S05 A;  3TO9 A;  1YIT I;  3TP3 A;  2VOO A;  2LFB A;  3FIS A;  5HS7 A;  3S2W A;  3PFY A;  2QBY B;  3GWZ A;  1IG7 A;  4KIT B;  5ILV A;  3OYG A;  3BTC A;  2YS9 A;  2VLA A;  2M8G X;  4CHU A;  3CMA I;  3N4M A;  1WVR A;  1IC8 A;  4Y3O A;  2CFX A;  4BL0 B;  2DBB A;  4XSX F;  3HJE A;  4MLO A;  1QZY A;  2E34 A;  3OYA A;  3IH4 A;  4G6D A;  2EFP A;  3K6G A;  2NRA C;  1O7L A;  1BM9 A;  2Y31 A;  4KA4 A;  2RN7 A;  2E19 A;  2M30 A;  1TQM A;  1YE9 A;  4BH9 A;  4A3C J;  1KA8 A;  3O8G A;  3S93 A;  5TGT A;  2PI0 A;  2X0L A;  1UAA A;  3OIO A;  4DBR A;  1UHS A;  2OZU A;  2LD5 A;  2V9K A;  2GBY A;  1FOK A;  2HOS A;  2MC4 A;  3KP2 A;  4RA2 A;  1XPX A;  3S15 J;  3KLO A;  4KIG A;  4A3E J;  3DBL B;  4BJ6 C;  3LA3 A;  1YJW I;  2F6C A;  4BE2 A;  4M9Z A;  1O4X A;  2K02 A;  1DDN A;  4ON0 A;  3OOU A;  2VOD A;  2LBF B;  1P7I A;  5DCF A;  2Z99 A;  2IA1 A;  2KT0 A;  1MMG A;  2DT5 A;  2VBW A;  3FXK A;  4BHP A;  1W1W E;  5D4R A;  1EV7 A;  1KON A;  4MTD A;  2BW3 A;  1TZL A;  3RPQ A;  1MDM B;  2ZFW A;  1S6L A;  5B1A H;  4IL6 C;  1NH3 A;  4B8X A;  3QU6 A;  4A3B J;  2EIN H;  1PJR A;  5DUK A;  1JKP C;  5J8F A;  3LSK A;  5JHU A;  4HG2 A;  4B48 A;  2IP2 A;  4ZTF A;  1YQA A;  2VQC A;  3FKJ A;  1MNM C;  3DKW A;  3WTU C;  4P5O A;  3UR3 C;  4HF2 A;  1ZR2 A;  1S29 A;  1JKQ C;  1QO0 D;  5GAD J;  5H2F C;  2VJJ A;  2PN6 A;  5K5R A;  2HPI A;  3NAR A;  2A61 A;  1TWH J;  4W97 A;  3JW4 A;  3GFJ A;  2ACJ A;  1VTN C;  4AM3 A;  1Z21 A;  2KJC A;  3IHU A;  1NK3 P;  4GGG A;  1LEA A;  4GRI A;  2PJR B;  2DAO A;  3P7N A;  4ZC3 A;  3RYR A;  5M5Y J;  2E7W A;  1I1G A;  4HV5 A;  4CCJ A;  4CCM A;  1R58 A; 
#chains in the Genus database with same CATH homology
 1GVD A;  2EQR A;  3A03 A;  4C3I J;  3DEW A;  1JUP A;  4IHW A;  1H8A C;  2XRL A;  5EGO A;  3FK6 A;  3LSR A;  1RET A;  4DYR A;  2E2I J;  5F0C A;  3I4N J;  2VKE A;  1ENH A;  3WHC A;  2HOA A;  4FE4 A;  3RZO J;  5EGO B;  1TC3 C;  3BT9 A;  4M3G A;  1E3O C;  4X1E A;  1ETO A;  1RES A;  1NK2 P;  1JT0 A;  4B1R A;  3BR5 A;  5F0H A;  1HDP A;  3GBG A;  3A01 A;  3H0G J;  1B8I A;  4MFD A;  2E2H J;  3CCY A;  2DMN A;  3S1N J;  3LSP A;  3BR0 A;  1B72 B;  5EG0 A;  2X6O A;  3LNQ A;  3HM5 A;  3A01 B;  3RKQ A;  3BTJ A;  1ETX A;  1I50 J;  2X9D A;  5C4X J;  4D5C A;  1ZK8 A;  1GDT A;  3JRG A;  1QPI A;  5F08 A;  5EG0 B;  3C2B A;  4C3J J;  4B3A A;  1U9O A;  1WGX A;  2JA8 J;  1WH7 A;  1OCP A;  2JA5 J;  2MW8 A;  2DA7 A;  4RBO A;  5C4J J;  4RDU A;  2Y9Z A;  3SFI A;  4C3H J;  5FJ8 J;  1QVU A;  3LSG A;  4QIW N;  4FE7 A;  3MKL A;  4NDL A;  2COB A;  2LVS A;  1IJW C;  1Z77 A;  1HCR A;  3S17 J;  4L5E A;  2XGD A;  3RQI A;  4BBS J;  1TWC J;  1Q1V A;  1WCM J;  4V2F A;  4M3B A;  5M5W J;  5JLW A;  1FJL A;  2IAI A;  2IBD A;  2Y0S N;  4D7M A;  3PO3 J;  2O7O A;  2ECC A;  1T56 A;  1MH3 A;  2JN6 A;  5IYC J;  1CQT A;  2L7F P;  2NOG A;  1MSE C;  2XPU A;  4XRS G;  3FIW A;  2AO9 A;  3HOY J;  2OF7 A;  3Q0V A;  4AUX A;  5C3E J;  2K40 A;  1VF9 A;  2LK2 A;  1FTT A;  3HGY A;  2CUF A;  5EF6 A;  2HYJ A;  2L7M P;  1GV5 A;  3DCF A;  4BY1 J;  1OJL A;  4A3G J;  3OSG A;  4A3D J;  3O8H A;  5FKO A;  3TW7 A;  3CDL A;  5J1R A;  1ETK A;  1VND A;  2M9H A;  1QRY A;  3JRH A;  1OFC X;  3HEF A;  2LKX A;  4A3I J;  2HOT A;  4DZJ A;  1IV6 A;  2LP0 A;  3ZQH A;  2DA2 A;  1XG1 A;  2MSY A;  5GP9 A;  5IP9 J;  3OSF A;  1AKH A;  1IDY A;  3IV5 A;  2K9N A;  2DA6 A;  5E3N A;  2R92 J;  1G2H A;  4MFE A;  5GPA A;  4BY7 J;  3IH3 A;  1ETQ A;  2R0Q C;  1LE8 B;  2XB0 X;  1IUF A;  5IPA A;  3HBL A;  4IHV A;  1RKT A;  3ZOB A;  5J1Y A;  1AKH B;  5FKN A;  3BQZ A;  3QPS A;  2GM4 A;  3M4O J;  2CRG A;  2TRT A;  1X2M A;  2R5Y A;  4A3M J;  1UG2 A;  5F27 A;  2RAE A;  2W48 A;  1YRN B;  4QSH A;  4IHY A;  1X58 A;  1R9T J;  1XS9 A;  1ETV A;  1FTZ A;  3LSJ A;  1TWA J;  9ANT A;  5E3O A;  4Y7N J;  4DYC A;  4M3E A;  5F1J A;  2IEK A;  2NVY J;  2MGQ A;  1JUS A;  4QTR A;  4FIS A;  5K7F A;  3NAU A;  2HXI A;  2NVQ J;  2VKV A;  2R5Z A;  2O8K A;  1GT0 C;  2Y30 A;  2DA3 A;  3JR9 A;  2QCO A;  1BW5 A;  4G12 A;  1BL0 A;  3FKI J;  1ZQ3 P;  3GTP J;  2L7Z A;  1F43 A;  5BNG A;  2R5Z B;  3TED A;  2QF7 A;  3JRE A;  1HDD C;  3M3Y J;  2HI3 A;  4LOC A;  1U78 A;  3JRA A;  1GUU A;  1JGG A;  3JRF A;  1T33 A;  4DYQ A;  3S2H J;  1ORK A;  1D5Y A;  3BR6 A;  3S1M J;  1MBJ A;  1B8I B;  2VPR A;  2OPT A;  3A02 A;  2M0C A;  2E2J J;  5IOY A;  2Y9Y A;  2JMW A;  3QPL A;  2VI6 A;  1APL C;  1K61 A;  2LR8 A;  5M5X J;  1ETW A;  1H89 C;  2HQ5 A;  3PO2 J;  4AC0 A;  1LFU P;  5IYB J;  2I10 A;  4M3D A;  4IEJ A;  1HOM A;  4FCY A;  1MBK A;  1VFC A;  1I6H J;  3MN2 A;  2VUM J;  5IYD J;  1WPK A;  5C44 J;  2MG4 A;  1P7J A;  3D1N I;  2DMQ A;  2FQ4 A;  3S1R J;  2WV1 A;  4UUS A;  3GTG J;  4BXX J;  1WI3 A;  2ELK A;  1JJ6 C;  4FTH A;  5FKM A;  2TCT A;  1UMQ A;  5K7Z A;  3JRD A;  2EZL A;  3BR1 A;  4ABZ A;  3GTM J;  2DMT A;  3B6C A;  3SDG A;  4J19 A;  3L1P A;  2NVT J;  2EZH A;  1FIA A;  1BA5 A;  1X2N A;  2FJ1 A;  4EEF G;  1SFO J;  4JX5 A;  4CYC A;  3TP0 A;  2R7Z J;  5JLX A;  5F0F A;  1QVT A;  1JKO C;  2DMU A;  3RZD J;  4JP0 A;  3QQA A;  1HLV A;  2NS7 A;  2XB5 A;  3W6V A;  4GFB A;  1ZTR A;  3E7L A;  4JX6 A;  2H8R A;  2K9S A;  4CYC B;  4JX4 A;  4W1U A;  4XIC A;  1AU7 A;  1XC5 A;  2L0K A;  4BBR J;  2D5V A;  2XGE A;  1PUF A;  4XID A;  3BG9 A;  3HOW J;  3BG5 A;  3WHB A;  2CUE A;  4UUT A;  2KDZ A;  1LFB A;  2ECB A;  2L9R A;  5FKL A;  4XRS A;  2PMZ N;  3S2D J;  3H3V K;  2EBI A;  4MIM A;  1TWG J;  2XSD C;  3HDD A;  1JTX A;  1ETY A;  1POG A;  2M34 A;  1PUF B;  4IHX A;  3Q3S A;  4BKX A;  3LOC A;  3VPR A;  1Y1W J;  1ZKG A;  5FKK A;  1RPW A;  4Y52 J;  4DZP A;  1DU6 A;  1Y1V J;  4XK4 A;  3ZQI A;  1U8B A;  3JRB A;  4I76 A;  4A3F J;  1MBH A;  1IDZ A;  2DJN A;  3G1O A;  3JRI A;  2JK3 A;  2DA4 A;  1BW6 A;  3K7A J;  4D5F A;  2R5Y B;  1MBE A;  5EYR A;  1JUM A;  2N8G A;  3CQZ J;  2JJ7 A;  5FLV A;  3G1M A;  1JJ8 C;  2JWT A;  3BR3 A;  1GV2 A;  2G0E A;  1A5J A;  1SAN A;  1MBG A;  3HB9 A;  1EF4 A;  2DTZ A;  3IH2 A;  2AHQ A;  2LTP A;  1VI0 A;  5EZG A;  4HNV A;  2ID6 A;  4DW6 A;  2DA5 A;  1Z0X A;  4A3J J;  4B4C A;  5K7H A;  2YU9 J;  3SJM A;  1A6I A;  2XPW A;  4A69 C;  3BTL A;  4AYB N;  5M3M J;  2X48 A;  2DMP A;  4I6Z A;  1FIP A;  2GLO A;  3ZQC A;  1IRZ A;  1F36 A;  2ID3 A;  2CQX A;  1B72 A;  1NTC A;  4M3F A;  3HOU J;  2CQQ A;  1JKR C;  3S1Q J;  2XPV A;  1I3Q J;  3GTQ J;  3S16 J;  2LLK A;  1TWF J;  3TP3 A;  4C2M J;  2LFB A;  3FIS A;  2B63 J;  3HGG A;  2NS8 A;  1IG7 A;  1FEX A;  2NVX J;  3I4M J;  3GTK J;  5E3L A;  3F0C A;  3BTC A;  2YS9 A;  4X6A J;  2O9L A;  2M8G X;  2ZB9 A;  5EZH A;  5DTD A;  3CMY A;  1MH4 A;  1AHD P;  5J1U A;  5M3F J;  2DA1 A;  1IC8 A;  3FK7 A;  4S0H B;  2XGC A;  3BR2 A;  3Q0U A;  4MLO A;  4MO7 A;  3IH4 A;  3PM1 A;  3HOZ J;  1JTY A;  4UUS B;  5HOD A;  1IGN A;  1ZGW A;  1W0T A;  4A3L J;  1S7E A;  2DN0 A;  2FX0 A;  1ITY A;  4V2G A;  3HOX J;  2HDD A;  2Y31 A;  1MBF A;  3GTJ J;  2P81 A;  2K9Q A;  5EDN A;  2E19 A;  4A3C J;  3O8G A;  2E1O A;  2FD5 A;  2R93 J;  4M6V A;  3OIO A;  3ZQF A;  1UHS A;  2LD5 A;  2GBY A;  2HOS A;  3JRC A;  3S15 J;  2EZK A;  4A3E J;  2JA7 J;  3BG3 A;  3BTI A;  2HXO A;  4XRM A;  3HOV J;  4JYK A;  1O4X A;  3G1L A;  3UKG A;  5DS9 A;  3OOU A;  3K2A A;  1P7I A;  1WH5 A;  2LY9 A;  5E3M A;  1K83 J;  2CU7 A;  2WB1 N;  4A93 J;  3GTL J;  2KT0 A;  2H1K A;  1OCT C;  2M2E A;  1JT6 A;  5IP7 J;  3ZQG A;  3B6A A;  1RR7 A;  3HKZ N;  4A3B J;  1H88 C;  5GPC A;  2Y2Z A;  1JKP C;  5IP6 A;  1LE8 A;  3TW6 A;  2EZI A;  5J3L A;  4A3K J;  1W0U A;  1MNM C;  5EEA A;  5IOZ A;  1BJZ A;  2YUS A;  1ZR2 A;  2EH3 A;  1ZR4 A;  1JKQ C;  5FLM J;  3BQY A;  2WAQ N;  3MVP A;  1YRN A;  3NAR A;  1TWH J;  2ME0 A;  4W97 A;  4D7N A;  1NK3 P;  3ZQL A;  2JA6 J;  1HF0 A;  1RKW A;  3Q0W A;  1MSF C;  5M5Y J;  3S14 J;  5F04 A;  1U9N A;  2ME6 A;  1DU0 A;  3GTO J;  2CJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...