4A3KJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3kJ00
2OPTA 1GT0C 1U78A 1IDYA 4A3EJ 1MBEA 3BT9A 2IEKA 3BG5A 4JP0A 3BTIA 4BY1J 4M6VA 3BTLA 2DN0A 1WGXA 1H88C 3GTPJ 3MVPA 1GVDA 1ETKA 4BY7J 1GV5A 5J3LA 5IP6A 1T33A 4QTRA 4B3AA 1JJ6C 1QPIA 4MIMA 2E2JJ 1X2NA 4RBOA 3I4MJ 2Y9YA 2CRGA 2Y2ZA 5IOZA 4BKXA 2K9SA 1F43A 2LVSA 4JX5A 4IHYA 1RESA 1DU6A 1MH4A 4C3JJ 3GTLJ 4AUXA 3BG9A 2HXOA 1JUSA 4C2MJ 3D1NI 1MNMC 3LNQA 5IOYA 1FJLA 2VKVA 2JJ7A 1A5JA 2P81A 2D5VA 1RETA 4I76A 5F08A 2HYJA 4Y52J 3O8HA 4B1RA 1F36A 4B4CA 2ECCA 4FE7A 1ETOA 2ID3A 2JA7J 3GTKJ 1PUFB 4FE4A 5EG0A 1MH3A 1ETQA 2FQ4A 3SFIA 2M0CA 3HOUJ 4MLOA 3WHCA 1VFCA 3QQAA 3SDGA 5GP9A 1VI0A 4M3GA 2TRTA 4A3BJ 2XPWA 2WAQN 2GM4A 1JGGA 2E2IJ 4A3MJ 5FLVA 2HXIA 5IP7J 4XRSG 1IG7A 4V2GA 1WPKA 5BNGA 1OFCX 2JN6A 4D5FA 5EYRA 4V2FA 3A01A 4D5CA 5K7ZA 3IV5A 2KT0A 3LSGA 5HODA 1HCRA 1WH7A 1MBHA 1ZKGA 2JWTA 5EDNA 4XIDA 1UG2A 2XRLA 2Y9ZA 3B6CA 3C2BA 1QVTA 1JKQC 2L9RA 3A01B 3TEDA 3M4OJ 4W1UA 1JUPA 3PO2J 2L0KA 4QSHA 1JT0A 4A69C 4A3CJ 1TWGJ 3F0CA 3GTGJ 4CYCA 1WI3A 5IYDJ 5E3OA 4HNVA 3OSGA 1E3OC 2NS7A 1QVUA 5EZHA 3Q0WA 5C4XJ 2NVTJ 3RQIA 2FX0A 1ZR2A 3HOYJ 1TWAJ 2I10A 4A3GJ 1TWFJ 3JRBA 3TP0A 2EQRA 2K9QA 3MKLA 1UMQA 4NDLA 4CYCB 2RAEA 3HOZJ 3I4NJ 1HF0A 2ME0A 4J19A 2LFBA 1JKPC 1BW6A 3BTCA 3BR6A 2DMTA 2ECBA 1NTCA 3ZQCA 1IC8A 1U9OA 4M3BA 5EZGA 1RKWA 2MGQA 1JTXA 3O8GA 3A03A 5J1YA 2HOSA 1T56A 1TWHJ 3ZQFA 1RPWA 1S7EA 2VI6A 2IBDA 5F0FA 2HDDA 2EBIA 2B63J 3S1MJ 3BR5A 3DEWA 5JLXA 5E3MA 5M3FJ 2LR8A 3QPSA 5J1RA 2E1OA 1LE8A 4DYRA 3S1NJ 4UUTA 3FKIJ 2AHQA 4DW6A 2JMWA 4G12A 5C44J 3UKGA 2DA6A 1G2HA 1MBKA 3TW7A 1PUFA 3NARA 2Y30A 1IUFA 4M3DA 3IH3A 4IHXA 1OCPA 1OCTC 3ZQIA 3HGGA 4LOCA 4X6AJ 1LE8B 2LY9A 5EGOA 9ANTA 2FJ1A 1R9TJ 2K9NA 5FKOA 4Y7NJ 4MO7A 5GPAA 5K7FA 3FIWA 1FIAA 4DZPA 3MN2A 1JT6A 5J1UA 2EZIA 2HI3A 3IH2A 1ETWA 2X9DA 3JRCA 2KDZA 2VUMJ 5EEAA 1X58A 1ORKA 3HB9A 5EGOB 2M8GX 2YUSA 4JX4A 2XPVA 1UHSA 4IHWA 3H0GJ 4A93J 2XSDC 4QIWN 2CU7A 1MSEC 2EZKA 4FTHA 4IHVA 2DMNA 3G1LA 1HLVA 2MSYA 1WCMJ 4D7NA 2W48A 4MFDA 4A3IJ 3HDDA 5F1JA 1K61A 2DA3A 2R5YA 3L1PA 3GTQJ 1P7IA 1B8IA 1XG1A 3S17J 2IAIA 2QF7A 4DYCA 2NVXJ 2LLKA 3RKQA 3FISA 1JTYA 1YRNA 3JREA 1MBJA 1JJ8C 3ZOBA 4X1EA 5M5XJ 5F0HA 3G1MA 5FLMJ 2DA4A 4EEFG 3LSJA 4AC0A 2DMUA 1Z77A 2ZB9A 1BL0A 2M2EA 3FK7A 3HBLA 3VPRA 2R5YB 5E3NA 3CQZJ 2LD5A 1B8IB 2X6OA 2DA2A 2L7FP 1H8AC 2JA8J 3K2AA 5FKNA 1JUMA 2OF7A 5FKKA 4C3IJ 2M34A 1QRYA 3JRIA 1YRNB 1ZTRA 2XPUA 2E19A 3TP3A 1FTTA 1MBFA 2ID6A 4MFEA 1HDDC 1TWCJ 2TCTA 5M5WJ 1VF9A 1Z0XA 4BBSJ 4D7MA 4GFBA 4I6ZA 2CQQA 1IDZA 1FIPA 3ZQHA 3OOUA 4JX6A 3JRGA 1ZGWA 4A3JJ 2HOTA 2XGCA 2DA7A 3GTOJ 3GTMJ 2LP0A 2CUEA 2XB5A 1AU7A 3LOCA 4XICA 2MG4A 3GTJJ 2Y31A 1X2MA 1CQTA 2CUFA 1MBGA 1A6IA 1AKHA 3HOVJ 2PMZN 2O9LA 3RZDJ 1ZR4A 1AHDP 2NVQJ 2NVYJ 3S1QJ 2QCOA 2G0EA 3S15J 5DS9A 5IP9J 4A3KJ 3BR3A 5GPCA 3IH4A 4XK4A 2DMQA 2DTZA 4XRMA 2N8GA 2NS8A 4RDUA 1AKHB 3E7LA 1I50J 2EZHA 4M3FA 1ETYA 4L5EA 3HOXJ 4S0HB 3SJMA 2GBYA 3JRFA 3BTJA 3HOWJ 1XC5A 1ZK8A 3S16J 1Y1VJ 3BQYA 2EH3A 2R5ZA 1NK2P 1FEXA 1W0TA 5F04A 3JR9A 3HGYA 2R0QC 3GBGA 1APLC 2FD5A 1DU0A 2DA5A 1BJZA 1JKRC 3BG3A 2MW8A 3BR0A 1ETXA 2LKXA 1BA5A 3CCYA 5K7HA 1IRZA 5C4JJ 4BBRJ 2CQXA 2L7MP 4C3HJ 1U8BA 2WV1A 1Q1VA 3CMYA 5M3MJ 2R5ZB 3BQZA 1GDTA 3S14J 3HEFA 1EF4A 2COBA 2WB1N 3WHBA 4DYQA 2E2HJ 2DMPA 3A02A 2M9HA 3M3YJ 5DTDA 1MSFC 3HKZN 3PO3J 3BR1A 3Q3SA 2O7OA 2X48A 2L7ZA 5JLWA 1ZQ3P 1FTZA 1ETVA 1OJLA 1POGA 1U9NA 1Y1WJ 5EF6A 3OSFA 2YU9J 1TC3C 1HDPA 3OIOA 4IEJA 1I3QJ 5FJ8J 1ITYA 2VKEA 3S2DJ 1P7JA 2HOAA 3LSRA 2EZLA 3BR2A 2YS9A 2XB0X 4UUSA 1GUUA 2LK2A 5EG0B 3HM5A 2R93J 3JRAA 3K7AJ 2O8KA 1BW5A 3RZOJ 5FKLA 2HQ5A 4JYKA 1XS9A 3W6VA 5F27A 5IYBJ 2H1KA 3G1OA 1B72A 2DJNA 3JRHA 1HOMA 2AO9A 1SANA 3LSPA 1ENHA 4AYBN 4BXXJ 4W97A 4UUSB 2LTPA 2K40A 2CJJA 3QPLA 4FISA 5M5YJ 5IYCJ 2R7ZJ 1D5YA 3Q0VA 2R92J 1O4XA 2NOGA 4ABZA 1W0UA 1B72B 5IPAA 1IV6A 2JA5J 2H8RA 3NAUA 1H89C 3H3VK 1NK3P 3JRDA 5F0CA 4A3LJ 3ZQGA 1RKTA 1SFOJ 5C3EJ 3S2HJ 2JA6J 3PM1A 4M3EA 5FKMA 2GLOA 2JK3A 1K83J 1JKOC 1WH5A 2ME6A 3Q0UA 3DCFA 1I6HJ 4A3FJ 2XGDA 2ELKA 5E3LA 2XGEA 3B6AA 1LFUP 3FK6A 1VNDA 1IJWC 4XRSA 4DZJA 1LFBA 3S1RJ 4FCYA 3CDLA 4A3DJ 2VPRA 1IGNA 3TW6A 2Y0SN 1RR7A 2DA1A 3ZQLA 1GV2A
chains in the Genus database with same CATH superfamily
2OPTA 1IF1A 3BZCA 2CG4A 3BT9A 4RLFA 4JP0A 5HNFA 4HV5A 3EYYA 1BOBA 3AG4H 3BTLA 2DN0A 2VN2A 1FYKA 4GO1A 1G3SA 1W1WE 5IP6A 1T33A 2K4JA 4PGHA 3A1YA 1JJ6C 4HZFA 1JI8A 4RBOA 3V8JA 4V19K 4A12A 5IOZA 4BKXA 1F43A 2LVSA 1XD7A 2LY2A 4RAGA 4IHYA 1ACIA 1W5CC 4C3JJ 1YW7A 1WJ5A 2OC6A 3KCCA 4C2MJ 1MNMC 2NAZA 4CCJA 1FJLA 4A6DA 2VKVA 1XMKA 3EPZA 4BJ5C 3F8FA 1QPMA 2HPMA 1B4AA 1VQLI 2D5VA 2HVRA 3G2BA 1PVEA 2X6WA 1D8KA 1HW5A 3IKVA 1SEUA 4FE7A 1ETOA 2KISA 1ZG3A 3QOPA 1YITI 1T0FA 2ID3A 5K5OA 3SFIA 3QRFF 1QQIA 4MLOA 2R7DA 1UJ8A 2P0WA 5E8GA 2A05A 4BE1A 1BJAA 4E7JA 3L2VA 1IN6A 1K79A 1JGGA 4J01A 1UB9A 3S8PA 2E2IJ 5HLIA 1J09A 2WADA 4RMNA 4AVZA 3S3MA 4GGGA 4I0BA 4V2GA 1WPKA 2EPFA 1OFCX 2JN6A 4OU0A 4RLQA 5CQEA 3E6CC 2WB1A 4K2EA 4YFNF 5D5WB 3L2QA 1WI9A 1ZLKA 3P9KA 3V8KA 1U6GA 2DBBA 2DDBA 5K7ZA 4CUGA 5DM6F 4BL0B 1T8IA 4BDZA 4G7OF 3DPTA 1G3WA 1I39A 4Q47A 4OINF 1WH7A 4D9JA 3RPQA 5A2QK 4G6TB 1FOWA 4I99C 2VBYA 4LK0F 1IXCA 1O57A 3KP6A 4E7LA 2PJPA 3B6CA 4F93B 4E7SA 2IS6A 5BPIA 5DD4A 2OTLI 3TEDA 3GZNB 3PO2J 4HSTA 2LSOA 4XQFA 2L2OA 2X6YA 2PQ8A 4A69C 1P4AA 5IYDJ 1ZN2A 1P9QC 5D5UB 1E3OC 5EZHA 2KP6A 2W57A 2I5UA 2FX0A 1ZR2A 3H0DA 3E97A 4KUMA 4HNTA 2HU9A 3JRBA 3PNTA 3M7GA 4MHGA 2IGMA 1S7OA 4S05A 3OYEA 1BI0A 1FX7A 2RAEA 3HOZJ 3I4NJ 3CESA 2BYVE 1VZ0A 2FF4A 2JPBA 1A36A 4ENMA 3S32A 2OU2A 4DBQA 1JHHA 1YIJI 2ETHA 3PFYA 1IC8A 2CV2A 1EJ9A 1IXRC 1FBQA 2MGQA 1YJ9I 2IRFG 4HG2A 3A4CA 4P96A 4NQWA 1Y0UA 3CDHA 4LIUA 2HOSA 2VOPA 1TWHJ 2CS3A 2HOEA 3ZQFA 3OYNA 2XAQA 1SVMA 1A6QA 3DPUA 4IOCF 3ASNH 4QWQA 1WJAA 3HRTA 2H8WA 5F0FA 2HDDA 3E1SA 2LOOA 3T1BA 2KQRA 3D5LA 1DGWY 1R5GA 3TL4X 5J1RA 2PLYA 2F5FA 4XRFA 4YIIA 3S1NJ 4AIHA 3DKYA 4FETA 5IT3A 2B9SA 4G12A 1MZBA 3CMMA 1SFUA 1HSJA 3J80Z 2XC7A 3H5AA 3TW7A 1PUFA 2Y30A 3F23A 1IUFA 3CUQA 3LFUA 4B47A 2JRTA 5CPRB 1LNWA 2FOWA 4LOCA 4IRGA 1V55H 4X6AJ 2W85A 1N75A 1S6LA 2LH9A 2EIJH 4PUSA 3GYHX 3I4PA 2AS5F 3DLLF 3HOSA 2R7UA 3M9AA 4DZPA 1JE8A 2DK8A 3TGNA 4F55A 2DXIA 1JT6A 5J1UA 1UHWA 3I55I 2A6HF 5L3BA 3GFJA 3CUQB 1DDNA 4KYWA 3OMYA 5ICEA 1ETWA 2KZVA 1TT0A 1LKXA 4MQ9F 2X9DA 3VYUB 5BQTA 3JRCA 4NB5A 1YFHA 2FNAA 2DCEA 2XPVA 2XASA 2E1MC 1YI2I 4A93J 3MZHA 1Z91A 4FTHA 2EA4A 1HLVA 4HF1A 1KU7A 1DPUA 4R1HA 2P5VA 5EEHA 4UNOA 4D7NA 3U21A 3HKZA 4PJJA 4MFDA 1AA7A 1T98A 3H3UA 5F1JA 5FRMA 4HX7A 3DU5A 2HVSA 1FSEA 2BY3A 4P55A 4EGZA 3HXLA 5CVJA 1UAAA 3HZJA 4MGRA 1R5HA 3FISA 1YRNA 2DFFA 1JJ8C 4X1EA 5M5XJ 5FLMJ 4EEFG 4I01A 3LSJA 3SDBA 4AC0A 3OYHA 2ZB9A 1X1CA 1TW3A 3FK7A 3CUOA 3OV8A 4Q5SF 2LD5A 4AIKA 3L9FA 3BLYA 4C2TA 2DPUA 4RM2A 4JBAA 3AAFA 4H0EA 3QPHA 1YRNB 3WU0A 2MA3A 2XPUA 2E19A 3TP3A 3BY6A 2VQLA 2W7NA 2ID6A 2KDOA 1HDDC 2TCTA 1TNSA 3F6OA 5DCFA 4ZYHA 3QU6A 3MKYB 2X0LA 4PJ0C 5H2FC 2E7WA 4GCVA 1B9NA 3H9GA 1YX5A 4JX6A 2KMUA 3OYDA 4A3JJ 2XGCA 3FWEA 2DA7A 5D5VB 3MFKA 2P5LC 3GTMJ 3DTIA 5H6RA 3A0BC 5FD6A 2CUEA 2XB5A 3J7AO 2PMUA 2K3FA 3CLQA 3OWTA 3LSMA 1X2MA 4N4OB 1CQTA 3ABUA 3ESWB 2E1NA 5KNLA 2PMZN 2HKXA 2WY8Q 1K4SA 1AHDP 4TV7A 1V5EA 1G3TA 3VODA 2RREA 1T2KA 2VL8A 3DQVC 2ISZA 4CA0A 4XRMA 4YFKF 5JFRA 3U1KA 1ULYA 1P2FA 2JA2A 2KRCA 4M74A 4RDUA 1E17A 3LMMA 3WTVC 3E7LA 2Z3YA 2A5WA 4M3FA 1HW1A 5J40A 2G7UA 3DEEA 5FROA 1OCRH 2ZXHA 4WX9A 1VQOI 4S0HB 3KZYA 1X4OA 4UVCA 2UZKA 4IOAF 4BE0A 2V26A 1XC5A 2H09A 3S16J 3GMEA 2WWYA 1TT5B 2EH3A 2YPRA 1ZHFA 1NK2P 4BYYA 1ZAOA 2Y69H 3CTAA 5F04A 2HDCA 3HGYA 5F64A 4BUPA 2R0QC 1X1AA 3GBGA 2FD5A 1R7JA 3BG3A 4BDYA 1VQKI 1ETXA 1GVJA 4LK1F 3DXJF 4ZH4F 1XN7A 2VKDA 4LMYA 3CMYA 3S14J 2A61A 1G4DA 3W2AA 4DYQA 4HF0A 1D0ZA 3CJTB 1ZLJA 4C2UA 1Z67A 2M9HA 3CO7C 3LL7A 1E0EA 3PO3J 3ZQ7A 1TZLA 2WBMA 1YE9A 1O3QA 4WCGA 1XCBA 1YX3A 3K0LA 3CCLI 1CF7B 3WGHA 2RV8A 3V4GA 4OIQF 5AIPA 1ZRDA 1D3YA 1ETVA 5TGTA 1WVRA 4KN4X 4XLNF 1POGA 3W2WA 4XKCA 2RVCA 5L3EA 1Z7UA 2R7SA 2NNYA 1LPQA 2MABA 1FYLA 2YU9J 3W6KB 2VBZA 2VKEA 5KVRA 4BXFA 4G7ZF 1P7JA 1NHAA 1OPCA 2BVMA 1HC8A 2KFDA 2YS9A 2E5NA 5ICFA 2JT1A 2XB0X 4UUSA 2LK2A 1MJ9A 4EJWA 5EG0B 2R7WA 3HM5A 1R1UA 2DOFA 3QP5A 3JRAA 2X51A 3K7AJ 3PSFA 4A5NA 1P92A 5FKLA 4JYKA 2X1EA 2XRNA 3QYFA 1I6XA 1FMWA 3VFZA 2H1KA 4Y4RA 5E1ZB 3IC7A 1EH8A 2K3PA 3CMEI 1W36C 1F5TA 2DJNA 3JRHA 1HOMA 3K4MA 4E7HA 5L3GA 1ON2A 1WWXA 2UV1A 4BQAA 4BAYA 3WG7H 3BG7A 3L2CA 4UUSB 2QSHX 1DP7P 3ZMDA 3D0SA 2K40A 4WK8F 4FISA 5M5YJ 4I0AA 1FMVA 2PBIA 2R92J 2OAZA 4M6XA 1A31A 5IPAA 4U0WA 2ELJA 3NAUA 1YW9A 2NS0A 2LREA 4WXCA 1I1SA 4LGWA 5F0CA 4IZZA 4ON0A 1IRFA 2MH2A 3P9CA 3S2HJ 4BJ6C 1JGSA 5HLTA 1FOKA 4DBRA 2LKSA 4FX4A 3GO5A 2NVUB 5FKMA 1MNDA 2GLOA 4L0ZB 4CZCA 2JTVA 1JKOC 4PFOA 3WTYC 3K4NA 3WTUC 3Q0UA 2GA1A 1A04A 3H35A 3ABTA 4L9JA 3FK6A 3QU3A 3TQNA 1B59A 3IP4B 4XRSA 5JVGF 2F5VA 3S1RJ 2XF5A 3CDLA 4DQ2A 4FCYA 1FBSA 4IVNA 4ZYEA 2GAUA 2DA1A 3K2ZA 4BJTA 2CMPA 2MH9A 2IP2A 3DPLC 1IDYA 3GUDA 3MZ8A 1BOAA 2XAHA 5KAIC 5TRDA 2XAGA 2P6TA 2B0LA 3CMAI 5DEQA 5K5RA 3FXKA 4PJNA 3ZGKA 5B1BH 1H88C 1J2XA 3PSIA 3GTPJ 4RGRA 4E6KG 3H1CA 3ONQA 4B3AA 4MIMA 1LVKA 2J5OA 1X2NA 2K02A 3CCSI 2Y9YA 2CRGA 3BJ6A 3KE2A 3GCMA 5GAHJ 3CCVI 1RIOH 4MEXF 3J81Z 2IGKA 2GXBA 1UFMA 3BG9A 1FLIA 1JUSA 2JSPA 4A0XA 3D1NI 3LNQA 5B66C 2ESNA 3AG1H 2OV7A 2RQPA 3BDDA 2L3DA 2JVGA 1A5JA 2BHYA 1MKMA 3CC7I 5F08A 4I76A 1HKQA 1ON1A 2HYJA 5E1WA 3SEZA 3O8HA 2LDUA 3WTTC 3I59A 3HG9A 5HNHA 2BGCA 1KU2A 4EVIA 4FE4A 3WGIA 3HOUJ 1ETQA 1OLTA 2QQBA 5D8LB 3IAM2 2K7LA 3WHCA 3QQAA 3Q9SA 2IXSA 3IAS2 3ZPLA 1VI0A 1T38A 2CQNA 2BW3A 2WAQN 2RC4A 3EUKL 2ZSHB 3ZQQA 4A3MJ 5CLSA 5IP7J 1K6OA 5BNGA 3FXQA 3C2GA 2FSWA 2XF6A 3V7SA 4D5FA 5EYRA 4V2FA 5LBQA 3A01A 1Z05A 1WRJA 4UB6C 1ODDA 2LBFB 2GQQA 1W7PB 3KEOA 2QGUA 1QHGA 5HODA 1ZRCA 1ZKGA 2JWTA 5EDNA 1QNTA 4M73A 4CGZA 4RA2A 3HHHA 1SAXA 1RUOA 1YQAA 3C2BA 1QVTA 1OCCH 3EUAA 5DCMA 1VTNC 4HRIA 3A01B 2V1UA 1S7AA 3RKWA 1W4MA 2L0KA 1Z6TA 1IUYA 2QKMB 2H27A 1GXQA 2RGVA 1TWGJ 4CZZA 3RKYA 5B1AH 2W25A 5JI6A 4CYCA 4HDVA 2ADUA 4EM2A 5E3OA 1OISA 4HNVA 4II3A 4B48A 5C4XJ 1OYIA 3LA7A 1KQ8A 2CYYA 4C30A 3L09A 3KETA 3E0JB 2XAFA 2LY1A 5DCMB 3HOYJ 1PDNC 3ZP5A 1TWFJ 2KIQA 2QENA 4OIRF 3OS0A 3ZXSA 3L2WA 1UG0A 5LEJA 3TP0A 2ZNYA 2FE3A 4UVAA 1FSHA 2K9QA 2F5CA 2R7FA 1UMQA 2W84A 3MKLA 4ESFA 4CYCB 2KIUA 2EB7A 4HOBA 1HF0A 4RGSA 1IN4A 2ME0A 1BN5A 1SFKA 3RQ4A 4CCOA 4J19A 4BU2A 2LFBA 5D6EA 1BW6A 2FMLA 1EKEA 1XSVA 3ZMTA 4M3BA 5EZGA 1EV7A 3TBIA 1YLFA 3A03A 3CC4I 4UV9A 5ERIA 1MJBA 2H6BA 3I64A 1Y56A 1VQ5I 4OMZA 4HF2A 2QWWA 2CFXA 3K4CA 1RRJA 4ANJA 3OYCA 2RNJA 4LITA 1RI7A 2IBDA 1IRXA 4HLYA 3OYGA 3TO7A 1U2WA 2B63J 3S1MJ 3BR5A 5M3FJ 1MJAA 2E1OA 2BV6A 1LE8A 1D1AA 2OJED 2DPDA 4UUTA 2DI3A 4EJOA 2AHQA 4DW6A 2A6TA 2JMWA 3UKGA 3EYIA 2ZFWA 1G2HA 3H9JA 1MBKA 5H20A 4XSXF 1LDJA 3CJQB 5E20A 4M3DA 2HQRA 1MNEA 3BROA 2P4WA 4HW0A 3H5NA 2Y48A 1OCTC 2CFOA 3HGGA 1LE8B 2LY9A 3AFHA 2E36A 3LA2A 4KICA 4OAZA 3Q5FA 2FJ1A 9ANTA 1IN8A 3F22A 2CSOA 5FKOA 1I5ZA 1BBYA 2FNPA 5GPAA 5K7FA 2IVMA 2EINH 4G6DA 5KK1A 2QA4I 2L4AA 2CW7A 2OZ6A 2HI3A 3IH2A 2VXDA 4HBLA 3VOEA 2OCEA 3CUQC 2QQAA 3ABMH 3F21A 2G9WA 2V7FA 1U8RA 2M8GX 3E5XA 1Z3YA 2DOAA 3D5SC 4HPQA 2K27A 3NWTA 4IHWA 2IPQX 2KKOA 5EJCA 2XSDC 4QIWN 1MSEC 1K78A 2X85A 2DMNA 1F9NA 2V1XA 3FZVA 2UXXA 2KLOA 3MD2A 4F91B 2W48A 3I0TA 4PSXA 3LQQA 4UXNA 2OBPA 1R5ID 2DA3A 3DLAA 4KFCA 2VQGA 2DT5A 1BR4A 2DO7A 2V9VA 4YFXF 2XF7A 2GA2A 1K78B 4PJLA 3COAC 2JUGA 1Y8QB 3RKQA 1JTYA 1VQ4I 3WTZA 3JREA 3LSKA 1MBJA 1KGSA 2EV0A 3G1MA 2ZXIA 3F8NA 5JHFA 3KP2A 2GXAA 1FT9A 1QO0D 2DQRA 1ZH5A 4O6JA 5GAEJ 4NC7A 2X6OA 2L7FP 3I56I 3NQOA 3E3VA 3QYBA 4C3IJ 2M34A 3DBRB 3KYDB 1QRYA 3JRIA 1ZTRA 4AU7A 4YIRX 1WJEA 1YS6A 2V6CA 5M5WJ 3KLOA 1VF9A 1OMIA 3DBHB 2IGOA 3E6BA 2M45A 1K4TA 1R58A 1IZ1A 2MFZA 3K6GA 5B5EC 2EFOA 1B6AA 2ZNZA 1Z9CA 3ZQHA 3JRGA 4J00A 3W6JB 4AYBA 3IKTA 2VBXA 1W5TA 1R1VA 3GTOJ 1YG2A 3BJAA 4WWCA 2LP0A 4MTDA 3GTJJ 2M5WA 2VB6A 4Q48A 4KNYA 1AKHA 1A6IA 3GZ5A 3RIRA 2FBIA 2O9LA 4E70A 4CDGA 4WXDA 2M4KA 2QYOA 4IKFA 5LGNA 1SAUA 1ZR4A 2NVQJ 2NVYJ 3S1QJ 3KYLA 3JCUC 1SVLA 3HSRA 1Q1HA 5IP9J 2HZDA 2VC0A 4IXAA 3BR3A 5GPCA 3FX3A 5TISC 2VXZA 2RDPA 2DTZA 3MAJA 3N97A 2N8GA 2OQRA 2ZXWH 2LF7A 1KU9A 1X1BA 1AKHB 2L9SA 2XKOA 2DT6A 3ZRGA 2OTJI 4G6QA 2Y0MA 3SJMA 3T0YA 2WAFA 3JRFA 3BTJA 3I9V2 2BZTA 3M1EA 2JUCA 3BQYA 4YEJA 2IT0A 1OYWA 4IRHA 2O3FA 5JHUA 4JOMA 1FEXA 1W0TA 4NNJA 2LKPA 4LLGF 2E5ZA 4CCKA 5HDNA 3WU1B 1Y8RB 2ZSIB 1APLC 2FU4A 1JKRC 5A2QZ 2VQCA 3TO9A 2EIMH 2VJ4A 1BA5A 1YIOA 5K7HA 1IRZA 3DBLB 5C4JJ 1WFXA 4BBRJ 1T39A 1LQ1A 2L7MP 4C3HJ 3P7NA 1SFXA 3TMOA 1U8BA 1H9TA 3HHGA 4ITVA 5JVTA 5M3MJ 3OOPA 1T08B 1EF4A 2COBA 3WHBA 1PP7U 2DDAA 3HYIA 2E2HJ 2BY1A 1XPXA 2DMPA 3A02A 4GDFA 5CVIA 3M3YJ 4HQMA 4ZDPA 2QZ8A 3HSFA 3NWSA 2EFPA 3HKZN 5DTDA 1HBXG 4CHUA 1O7FA 1HSTA 3JAMK 5LD2C 3P5JA 1J5YA 2R7QA 2GIVA 5F6FA 2QBYB 1U9NA 2MD5A 2CQ7A 4XOPA 2Q0OA 4KITB 5EF6A 3OYFA 2Q8KA 1SMYF 3K69A 1XMAA 5J8FA 1TC3C 1HDPA 1I3QJ 3HTSB 1ITYA 3M1CA 3SXYA 2ZMEA 4BS9A 2HOAA 3KEQA 4B3XA 2A5YB 4A5MA 2A07F 1Y0NA 4ZTFA 1SMTA 3HOTA 4YG2F 3S93A 3OL4A 5HDKA 3OYAA 5HOOA 3K4BA 2BXZA 2CW0F 2HEOA 2HQ5A 3AG2H 2ESHA 3G1OA 3KP3A 5FFZA 3WODF 2P7VB 2W00A 2HYGD 1OCZH 4L5JA 3CDIA 1REPC 2ZMEB 4KMUX 3LSPA 2K85A 1UZCA 4W97A 4YELA 4M72A 4QPOA 4B44A 1R4NB 3AKZA 2CJJA 3OS1A 1QGPA 1X3WB 2ZJQF 1D5YA 1O4XA 2NOGA 1BI3A 4Y3OA 1IV6A 2H8RA 3R61A 1R4MB 2XGXA 4LJZF 3H3VK 1NK3P 3HSEA 3JRDA 4A3LJ 4ASNA 2O0YA 4I7HA 1RKTA 1SFOJ 3VWBA 4GXOA 2BY2A 4U87A 3CCMI 2JA6J 2HTJA 4LB6B 2GWRA 1LUJB 2JK3A 3TDZC 4AVPA 1WH5A 2ME6A 1Z3XA 4AM3A 2Q2EA 2XGDA 4HX8A 2ELKA 2CQKA 5CVRA 2XGEA 5FLXK 3B6AA 1LFUP 1UHMA 4HNUA 3ZN1A 1IJWC 2ZJ2A 4RB1A 2KL4A 1S29A 4JK1X 1XB4A 3DTKA 1KZHA 4A3DJ 3G3ZA 4I98B 5DUKA 1RR7A 1HW2A 1Z21A 3ZQLA 2ZO4A 1SVOA 1P4XA 2Q2EB 2V1NA 5L3FA 4HEA2 4MEYF 4BY1J 2VBWA 2EFNA 4FHTA 3AG3H 2F2EA 5LEKA 1WGXA 1D8JA 4KJZA 3FM3A 3MVPA 4IRIA 1ETKA 1GV5A 3CP2A 5J3LA 4EJUA 1PUEE 1R36A 1CF7A 2CV1A 4EJTA 2E2JJ 1FY7A 3F6VA 1J0RA 5GAGJ 2K9SA 4ESBA 2E1CA 3GLLA 4NUBA 3L00A 4JX5A 3BCBA 2NXNB 1MH4A 4G94A 3GTLJ 3E5QA 4AUXA 2KRFA 1G8XA 1TTYA 4EMSA 2Z9OA 2XDVA 3VYTB 4XKBA 3UR3C 2XROA 1XX5A 5BPDA 1P4WA 3JW4A 1QA6A 1QZEA 1B1BA 2D1HA 1RETA 1ZRFA 3EQLF 2PI0A 2WTEA 4UHTA 3GFMA 4Y52J 4PK4A 3HIFA 1L3LA 4I02A 4F52A 1VQ9I 1I3AA 2CW8A 3VSLA 3GTKJ 1XSXA 5EG0A 1MH3A 2FQ4A 2M0CA 5E8IA 4WF2A 5AONA 3MZYA 5D8KB 2YX7A 3IL2A 3SEQA 5D5XB 3LSHA 4P5OA 1SD6A 5GP9A 2X1CA 3X2QH 2TRTA 5HLHA 4AIJA 5FD5A 2ACJA 4EM1A 1DP3A 3TOAA 4XSZF 4OAYA 1EH7A 2E7XA 1UCRA 1MMNA 2P6SA 5FLVA 2O03A 3SFZA 3CP8A 1EA3A 4KN7X 1YYVA 2RN7A 3DP7A 3LAJA 2VOOA 4O3MA 5HS8A 1MMDA 4LG3A 1IV8A 5KHDA 3LSGA 2NNNA 4HYEA 1YJNI 1HCRA 5CJ9A 4XIDA 2L02A 1UG2A 2XRLA 2X4HA 2L9RA 4HAMA 4XM3A 4DJAA 1HKSA 3VB2A 3DWLE 4W1UA 1JUPA 4LFUA 3K1NA 3F8CA 4QSHA 2DYRH 4A3CJ 3F0CA 3IUOA 3BP8A 4EATA 4IHSA 1WI3A 2FBHA 3TDUC 1QVUA 1SFEA 3PL8A 3DEUA 3ULQB 4EJVA 2JVHA 4M9SA 1W7PD 1DGRM 4A2UA 2ZJPF 2HWVA 1U0JA 1TWAJ 3I3LA 3H3ZA 3MQ0A 2EQRA 4IQJA 1XGSA 2A3SA 4EQQA 5BOXA 4L9VA 3N4MA 1MMSA 2D45A 1JKPC 4KT6A 5BS6A 3J7YJ 2BHZA 3HUGB 3BTCA 4L9NA 2WA0A 1FP1D 3I58A 2ECBA 3I5UA 1NTCA 1RNLA 3HL2A 4P1WA 1ZREA 1RKWA 1XGOA 3FXRA 1JTXA 1AOYA 4U0YA 5IT9K 3G71I 5K1YA 4CICA 2HDWA 1WQ2A 1T56A 2HTSA 3HRUA 1JXSA 1GHCA 1S7EA 2VI6A 3VDXA 1RZ4A 4OWRB 2BXYA 5FB2A 2XAJA 2XV4S 3DEWA 3BPVA 5JLXA 5E3MA 3R4KA 3LAPA 1ZG1A 1YOVB 1H0MA 4ZDOA 3QPSA 4S04A 1FZPB 4JQFA 4DYRA 1BI2A 1YO5C 1U5TA 2IS1A 1B9MA 3FKIJ 4U0VA 3BOQA 3D5RC 2M7AA 3VYRB 2DA6A 3DKXA 2E60A 4HSRA 4BNCA 3WTWC 3NARA 4E7IA 3LA3A 3S2WA 2VJ5A 5LGTA 2L9VA 4OOIA 5HLGA 4IHXA 1OCPA 2EFWA 1UELB 1ZELA 5EGOA 1U5TB 4M71A 3HTUA 1R9TJ 3JSOA 4BE2A 2K9NA 1AWCA 4Y7NJ 4MO7A 3BZKA 1FIAA 2OQGA 2ZXJA 3MN2A 4MNUA 2Z1DA 3FHZA 2JRMA 3C18A 2EZIA 4KIGA 3PNVA 1OR7C 1TNTA 2FBKA 5CVUA 1X19A 3TO6A 2L01A 2LBFA 2D2WA 2VUMJ 5EEAA 1W7PA 1MMGA 2OUMA 4CO8A 3HB9A 2M4GA 5EGOB 1SD5A 4JX4A 4M6YA 2PN6A 1LJ9A 1QZZA 3VSKA 2CWEA 2R4GA 1UHSA 2I8DA 3H0GJ 4IX7A 2QM3A 2EZKA 1TQPA 4YRVA 3F8BA 1GLNA 3RYPA 5ILSA 3OYMA 3PQJA 4A3IJ 4KT5C 3JSPA 1MMAA 2B7EA 4PZJA 3WG9A 3V8LA 3BJOA 3FXJA 1PP8F 1XG1A 3S17J 2IAIA 1KA8A 1NG6A 2QF7A 4DYCA 4XKVA 2M1BA 2GOMA 2LLKA 3BC8A 2VT3A 3V7RA 3ZOBA 2JPCA 1RUNA 5F0HA 3CCEI 2F4MB 2VLAA 4II2A 4XN3A 2MD0A 1OKRA 5J4VA 4YIFA 3K70C 1Z77A 2L4MA 3KEYA 2X1DA 5E3NA 4Y15A 2DA2A 2JA8J 4CXFA 3KYCB 3LQRA 3K2AA 3FXLA 1JUMA 3S3NA 5FKKA 4RB3C 2DFIA 4F7ZA 1FTTA 1MBFA 4OIPF 3FKJA 1L0OC 4BBSJ 4D7MA 4GFBA 4I6ZA 3K70D 2W1OA 4KISA 1IDZA 1USSA 3C2HA 1ZGWA 3WTXC 3I54A 4BACA 1OYYA 2ZC2A 6PAXA 4ZDLA 5LHIA 2LNBA 4LG0B 4FT8A 1AU7A 4XICA 2VPLA 2Y31A 2VE8A 1M1EB 2CUFA 1KU3A 1MBGA 3HOVJ 3OY9A 3ELKA 4PDKA 2H94A 4IL6C 3MMYB 5IY5H 3DU6A 2QCOA 2G0EA 4B8XA 5ED4A 2AXLA 2W82A 3S15J 5DS9A 1SC7A 4A3KJ 3MKZA 4BEHA 3DKWA 2F5DA 3CF2A 3ZCOA 2IJLA 3IH4A 4XK4A 2DOEA 3GVAA 5DYMA 4LLLA 2Z33A 4NBQA 2DJIA 1D0XA 1E2XA 4P9FA 4PJMA 3OS2A 3OYLA 3PFIA 3KFWX 3AL0B 4Y33A 4R8HA 1V54H 3K4KA 4EM0B 4L5EA 4Y17A 3R0AA 3CJNA 2DLLA 2GBYA 4L5IA 1OR7A 2HVQA 4BEHB 4L0YB 1ZK8A 1Y1VJ 4I09A 5GADJ 5FRNA 1STZA 2ZFUA 2R5ZA 2AXTC 3A0HC 2BE5F 3CCJI 4XN0A 3JR9A 3F72A 2H1LA 2Y0SA 2COMA 1DU0A 2DA5A 1BJZA 2NYXA 4XLAA 3OYIA 1N78A 1O7LA 2DU9A 3QYEA 3WE2A 4AD9A 1IAWA 4XBFA 2MW8A 3BR0A 3DV8A 3QPTA 1LEAA 4OIOF 3R60A 4HLXA 2CQXA 3BG6A 3GZ6A 3FXMA 3CC2I 4RM3A 2R5ZB 3BQZA 1FC3A 3HEFA 3CCRI 2WB1N 2EA2A 3E6MA 2F4IA 3SQNA 3DF8A 2K5CA 2M0MA 1MSFC 3BR1A 2O7OA 2HZTA 3GX4X 2MC4A 3SZTA 3ISPA 3ABKH 1WJDA 2CUZA 2XKPA 2Z16A 5J8CA 1OJLA 2K86A 2VE9A 1MW7A 5LHGA 1G3YA 3QODA 4B09A 1BR1A 3WU2C 4CH7A 1X4PA 2O61A 3BWGA 2O5RA 5TJJA 3S3OA 3OIOA 3KZIC 2LRDA 5CYVA 4IEJA 2EV6A 2FOKA 3FMRA 1VQMI 2P7CB 2ZCWA 1TQIA 2G7HA 2LG4A 3K1PA 3S2DJ 3KZZA 5JR3A 3LSRA 1TQMA 2ICWG 5LHHA 3FF5A 3EETA 3HRMA 1GUUA 3J80K 1MGTA 4PGGA 4RS8A 4UUVA 2QSFX 3JTGA 1BC8C 1BR2A 2O8KA 1BW5A 3RZOJ 3KP7A 3BPXA 3K4JA 2HKOA 4R79A 3W6VA 5F27A 1F1ZA 2D1VA 3MKWB 2OCCH 1V5FA 2DFHA 1R23A 1TP4A 3NRVA 1XMXA 2AO9A 3KIOA 2UWMA 1SANA 1D5VA 1WZ2A 2BEOA 1ENHA 4E4HA 4AYBN 5LRRA 2FQ3A 2HS5A 1Z6RA 2KRHA 4CSWA 2PX9A 3M8JA 4XNFA 2QQ9A 2ZMEC 2LTPA 3ASOH 1TW2A 3QPLA 3TKYA 3G4SI 3G73A 2X6XA 5D6FA 2MYSA 4XL9A 3LSIA 4O5VA 4ABZA 1W0UA 1H89C 4CCMA 1BIAA 4Q4ZF 1XDUA 4IHTA 1FPQA 2KIMA 4RAZA 3FMQA 3ZQGA 4F92B 3ZMUA 4DGWB 1V3FA 3OYKA 1TL8A 5LLQA 4IQ4A 3O2PE 3PM1A 2O6GE 4M3EA 1WKMA 3HPHA 4ZJZA 4OMYA 1K83J 2P8TA 2OA4A 3IRRA 3DCFA 4UY8I 3SYTA 1DUXC 4XOTA 3CJRB 4WXHA 5B3SH 5BMZA 4GRIA 2WC2A 2IS4A 3DTEA 4G8XA 4DZJA 2PJRA 3K4LA 3W3CA 3IWFA 4LD5A 1J75A 4KDPA 1IGNA 3KP5A 1QBJA 1J59A 3PIPF 1GXPA 1R00A 5CKTA 1GT0C 1U78A 4A3EJ 1MBEA 2IW5A 1XDSA 2IEKA 3BG5A 3BTIA 3B73A 4HA8A 4FQGA 1RC9A 3GW2A 2BY0A 2R3SA 3W2VA 2PJRB 4M6VA 2KJBA 4MQVA 3NEUA 1X1DA 1XGMA 1GVDA 2K4BA 4L18B 4BY7J 2BVLA 2L7KA 3K9TA 4RB2C 4QTRA 3FHNA 4M9XA 4NQWB 1QPIA 3R6SA 3I4MJ 4ENKA 2M7BA 2Y2ZA 4IF4A 2Z5UA 2QBYA 5DUIA 1RESA 1LDKB 1G6NA 3CCQI 1Y39A 2C6YA 1LVAA 2EV5A 2ZKZA 4ZZLA 3ERED 1DU6A 2HXOA 5IOYA 5E18F 2JJ7A 2IA2A 3QOEA 2DK5A 2P81A 4CCNA 2VC1A 3ECOA 4BQQA 2XAUA 5D4SA 2HFHA 1D1CA 1YHQI 1QHHD 1G59A 4B1RA 1F36A 2QVOA 4B4CA 1XSDA 2ECCA 1J7KA 3MCZA 1BC7C 3H5RA 1R1TA 1PUFB 2JA7J 2YR2A 3FXOA 1O3RA 1IN7A 1FYMA 2IS2A 5GTHC 2YX4A 1JHFA 4MTEA 2DYSH 1VFCA 3SDGA 4ZC3A 2AQEA 2NOJB 1Z7LA 4M3GA 4DOZA 3LSTA 4A3BJ 2XPWA 2V4JC 3GFLA 4A6EA 4N4NB 2R7XA 2WAEA 1XCVA 2DFEA 2GM4A 1TBXA 1ONVA 2IA1A 1O3TA 2HXIA 3U1DA 1IG7A 4XRSG 5FO5A 1V5GA 2VASA 3RDIA 2XHKA 2M8EA 4D5CA 2F4OB 2M3AA 3IV5A 2R7VA 4NC6A 2A69F 3V42A 1IW7F 1D1BA 1OQYA 2KT0A 3RPUD 4L9TA 1MBHA 4N9HA 2PG4A 2CV0A 5DV5A 2AQFA 3F3XA 2XUBA 2Y9ZA 1ZGAA 5ILUA 4PFPA 4FASD 4QLCU 1JKQC 3IWZA 1SD7A 4BQNA 3M4OJ 3WTSC 2WV0A 2EILH 2P5KA 2Z99A 3N05A 4BH9A 1JT0A 2FA5A 4N0BA 4UV8A 2VODA 3GTGJ 1NH3A 5KCMA 1XGNA 3OSGA 4Y13A 1LFPA 2A6EF 2NS7A 3Q0WA 2GZWA 2NVTJ 3I53A 2GOXB 1LDDA 1KQ9A 3RQIA 3MWMA 5F1RA 2HGCA 1FNNA 5ILVA 5AIQA 2I10A 4A3GJ 3E6DA 3FDYA 3HJEA 3C7JA 3T8RA 4D0PA 1E3PA 1R22A 2BOLA 2F5EA 2Z2SB 5HDGA 3OYJA 2L54A 2JQ7A 4HX4A 2HNHA 4NDLA 2L5QA 2DT7B 2VIXA 3F8MA 1MDMA 3RYRA 3REOA 2K9MA 3PIOF 1R6RA 3KX2A 3PJRA 3LWFA 2HYFA 2F6CA 4ESJA 3BR6A 2DMTA 3ZQCA 1U9OA 2PEXA 3JAMZ 1PJRA 3O8GA 5J1YA 1LB2A 1X3UA 4HDUA 2E35A 2EIKH 4P9UA 2LF8A 2VJJA 1KQ0A 1RPWA 1W5SA 2QEXI 1MDMB 2HQNA 2O8XA 1IRGA 2CO5A 4BXUA 3TOBA 2ELHA 2PMHA 2CUJA 2EBIA 2LR8A 2EJRA 2PMZA 1VQ7I 3GXOA 3OR1C 5D4RA 1K7AA 4X0GA 1I27A 3GF2A 3FBNB 4ZYAA 5CQGA 3QP6A 1E3HA 3H9QA 5C44J 3O6BB 4U7BA 1S3JA 2MBFA 1T95A 2KZGA 2QQ8A 4ZYGA 1ZARA 3RPUA 2K9LA 1K6YA 2FRHA 3KP4A 4ZTJA 1O3SA 3IH3A 4RGUA 2ISYA 2HQAA 1FBUA 3OL3A 3ZQIA 3G6EI 3O3KA 5LRSA 4ZYDA 3FM5A 1XTAA 2YU3A 3CO6C 3T8TA 1OCOH 2HR3A 5K5QA 1WJCA 1EH6A 1IXSB 3ZR8X 3H92A 3FIWA 1U5TC 1USTA 3FXUA 1BI1A 3H36A 3J7ZI 1F4KA 2KJCA 2EFQA 1KONA 3ZN0A 1WJBA 3I71A 4GYGA 2E1MB 2KDZA 1Y6IA 1X58A 5DM7F 1ORKA 2RNGA 2YUSA 4ENNA 4IO9F 3GEZA 2CU7A 2STTA 2HPIA 4G9YA 4IHVA 2VONA 3G1LA 3RJPA 2DQLA 2MSYA 2BBYA 4Z6YA 1ERDA 2ZBKA 4G7HF 1RR8C 1WCMJ 4ETSA 3P9IA 1YTYA 3HDDA 1K61A 2R5YA 2QLZA 1FP2A 4BHBA 3L1PA 3GTQJ 1MIJA 1P7IA 3BZ6A 3C3WA 2M87A 1B8IA 5FLXZ 2RKHA 3F9KA 3K10A 2NVXJ 4XORA 2VKHA 1HA8A 1ZYRF 4ENJA 3J81K 4F3QA 4XR6A 2V9KA 2V6EA 5L3DA 2DA4A 1KYWA 1QZYA 3V7CA 4U7DA 2DMUA 1HXDA 4IJAA 4E7KA 5FGMA 1BL0A 2M2EA 3HBLA 2R5YB 3VPRA 1P6RA 3Q9VA 3CQZJ 1B8IB 2MC3A 3HC7A 1H8AC 5FKNA 2OF7A 2Y75A 5J47A 4XONA 3HUGA 1KYZA 4A0YA 3OYBA 4MFEA 1TWCJ 3L7WA 1N77A 1HQCA 3M8EA 1Z0XA 4BHPA 3DFGA 1YW8A 2CQQA 2OZUA 4E7ZA 1FIPA 3OOUA 3MEXA 1W36D 3EUHC 2GXGA 2HOTA 4DIQA 5E17F 2TDXA 1J9IA 4QPQA 5GTIC 1Z1DA 2KPMA 3BCAA 3LOCA 2MG4A 3WE3A 3J7AY 2F48A 4AWXB 1C0WA 1V4RA 1VQ8I 5CVVA 1VQNI 1IN5A 3PUBA 1X1PA 2XIGA 3RZDJ 3ZMVA 1BM9A 3FMSA 1WHUA 5L3CA 3CCUI 1BIBA 4XKWA 3OIQA 5EEGA 2XVCA 3RSNA 3K1MA 2DMQA 2OD5A 1T6SA 3VEPA 4LB5A 4PCQA 2NS8A 2VT2A 2LC2A 3PNYA 3FBIB 1I50J 2EZHA 3OIPA 2JSCA 3ML6A 1ETYA 3ECHA 4RAFA 3U2RA 3HOXJ 2FEZA 4RAYA 2FXAA 4U88A 3PUFA 3EDPA 3AL0C 3RTRA 3HOWJ 4AIDA 3QAHA 2R7RA 2R7OA 5J6XA 1FOXA 2EK5A 1MD0A 5DD8A 3B02A 2V9PA 3ABLH 2YSRA 3ERMA 1X3ZB 2L9NA 3U9GA 4XMYA 2LKXA 4UVBA 3CCYA 4N9IA 1YJWI 1R71A 2DAOA 2W24A 4XLEA 2WV1A 4GYIA 3VYSB 1Q1VA 3M8FA 1GDTA 2V79A 4KIBA 1PYVA 3WGGA 5E79C 3Q3SA 1S72I 2A68F 2X48A 3CLOA 2L7ZA 4HV6A 3CD6I 3GWZA 2QKLB 5J4YA 5LGUA 5JLWA 1ZQ3P 3R0JA 1DQUA 1FTZA 2UXNA 2QSGX 2DW4A 1Y1WJ 1QU3A 3CZ6A 4RGXA 3RKXA 2PFBA 2V1DA 4XLPF 3RCOA 3OSFA 4PSWA 5LFAA 4LIVA 5HS9A 5FJ8J 2M30A 1N25A 4XLHA 4BGDA 1NG7A 2DTRA 4IPAA 5HS7A 2QUFA 3SZGA 2FUG2 3I59B 3PQKA 3BR2A 2EZLA 2W4SA 1IO2A 2UUZA 4XLFA 5FFXA 5ICGA 3SZPA 3L2UA 1S8NA 3OR2C 4BQOA 2J5PA 2R93J 4C9YA 2XSJC 1A35A 2VQHA 4XLCA 1XS9A 1T0FC 2FMYA 2KIFA 3EUHA 2GIZA 4UB8C 5IYBJ 1ZG5A 5IT9Z 2WAQA 1B72A 3SHFA 1H9GA 2DODA 2BW3B 2MLGA 4CCLA 2R7TA 4M9ZA 2IA0A 2MLKA 2STWA 4BXXJ 4A0ZA 1SD4A 3A2KA 2EWNA 3M07A 3C1DA 4HQEA 4LG0A 3IRQA 3ZMSA 1CGPA 4D1QA 1WSUA 2CH0A 5IYCJ 2R7ZJ 2LMDA 3Q0VA 4B43A 3GFIA 3T5XA 1B72B 1FOYA 2JZYA 2JA5J 1WJFA 2WY7Q 4H4KC 1LEBA 3JTHA 5H6QA 2RQQA 4NHJA 3KPHA 4FX0A 4NC8A 1I1GA 3ZMZA 5KAFC 1S5LC 1VQPI 1U3EM 2E71A 4I2OA 2H6CA 4ZZDA 3RI4A 3ROUA 1YS7A 2KHMA 3GLXA 5C3EJ 3LFKA 4CYDA 3CF5F 1VQ6I 2IGNA 3IHUA 2ZJRF 2NRAC 4EV0A 2VJIA 4Z2YA 1DPRA 3HPGA 4BHCA 5DDGA 2LYCA 3L2RA 1I6HJ 1S9HA 4A3FJ 4KA4A 4RB0A 4KIFA 5E3LA 5E1XA 1VNDA 2CGPA 1D0YA 3E5UA 1LFBA 5ICCA 3HRSA 1HKTA 1ZGJA 2Q1ZB 5HVQC 2E34A 2VPRA 1R49A 3KLNA 3TW6A 1TLHB 2Y0SN 3QWLA 4KMFA 1FWZA 3UNGC 4LLNA 4EGYA 4DNCA 1GV2A
chains in the Genus database with same CATH topology
2OPTA 1GT0C 1U78A 1IDYA 4A3EJ 1MBEA 3BT9A 2IEKA 3BG5A 4JP0A 3BTIA 4BY1J 4M6VA 3BTLA 2DN0A 1WGXA 1H88C 3GTPJ 3MVPA 1GVDA 1ETKA 4BY7J 1GV5A 5J3LA 5IP6A 1T33A 4QTRA 4B3AA 1JJ6C 1QPIA 4MIMA 2E2JJ 1X2NA 4RBOA 3I4MJ 2Y9YA 2CRGA 2Y2ZA 5IOZA 4BKXA 2K9SA 1F43A 2LVSA 4JX5A 4IHYA 1RESA 1DU6A 1MH4A 4C3JJ 3GTLJ 4AUXA 3BG9A 2HXOA 1JUSA 4C2MJ 3D1NI 1MNMC 3LNQA 5IOYA 1FJLA 2VKVA 2JJ7A 1A5JA 2P81A 2D5VA 1RETA 4I76A 5F08A 2HYJA 4Y52J 3O8HA 4B1RA 1F36A 4B4CA 2ECCA 4FE7A 1ETOA 2ID3A 2JA7J 3GTKJ 1PUFB 4FE4A 5EG0A 1MH3A 1ETQA 2FQ4A 3SFIA 2M0CA 3HOUJ 4MLOA 3WHCA 1VFCA 3QQAA 3SDGA 5GP9A 1VI0A 4M3GA 2TRTA 4A3BJ 2XPWA 2WAQN 2GM4A 1JGGA 2E2IJ 4A3MJ 5FLVA 2HXIA 5IP7J 4XRSG 1IG7A 4V2GA 1WPKA 5BNGA 1OFCX 2JN6A 4D5FA 5EYRA 4V2FA 3A01A 4D5CA 5K7ZA 3IV5A 2KT0A 3LSGA 5HODA 1HCRA 1WH7A 1MBHA 1ZKGA 2JWTA 5EDNA 4XIDA 1UG2A 2XRLA 2Y9ZA 3B6CA 3C2BA 1QVTA 1JKQC 2L9RA 3A01B 3TEDA 3M4OJ 4W1UA 1JUPA 3PO2J 2L0KA 4QSHA 1JT0A 4A69C 4A3CJ 1TWGJ 3F0CA 3GTGJ 4CYCA 1WI3A 5IYDJ 5E3OA 4HNVA 3OSGA 1E3OC 2NS7A 1QVUA 5EZHA 3Q0WA 5C4XJ 2NVTJ 3RQIA 2FX0A 1ZR2A 3HOYJ 1TWAJ 2I10A 4A3GJ 1TWFJ 3JRBA 3TP0A 2EQRA 2K9QA 3MKLA 1UMQA 4NDLA 4CYCB 2RAEA 3HOZJ 3I4NJ 1HF0A 2ME0A 4J19A 2LFBA 1JKPC 1BW6A 3BTCA 3BR6A 2DMTA 2ECBA 1NTCA 3ZQCA 1IC8A 1U9OA 4M3BA 5EZGA 1RKWA 2MGQA 1JTXA 3O8GA 3A03A 5J1YA 2HOSA 1T56A 1TWHJ 3ZQFA 1RPWA 1S7EA 2VI6A 2IBDA 5F0FA 2HDDA 2EBIA 2B63J 3S1MJ 3BR5A 3DEWA 5JLXA 5E3MA 5M3FJ 2LR8A 3QPSA 5J1RA 2E1OA 1LE8A 4DYRA 3S1NJ 4UUTA 3FKIJ 2AHQA 4DW6A 2JMWA 4G12A 5C44J 3UKGA 2DA6A 1G2HA 1MBKA 3TW7A 1PUFA 3NARA 2Y30A 1IUFA 4M3DA 3IH3A 4IHXA 1OCPA 1OCTC 3ZQIA 3HGGA 4LOCA 4X6AJ 1LE8B 2LY9A 5EGOA 9ANTA 2FJ1A 1R9TJ 2K9NA 5FKOA 4Y7NJ 4MO7A 5GPAA 5K7FA 3FIWA 1FIAA 4DZPA 3MN2A 1JT6A 5J1UA 2EZIA 2HI3A 3IH2A 1ETWA 2X9DA 3JRCA 2KDZA 2VUMJ 5EEAA 1X58A 1ORKA 3HB9A 5EGOB 2M8GX 2YUSA 4JX4A 2XPVA 1UHSA 4IHWA 3H0GJ 4A93J 2XSDC 4QIWN 2CU7A 1MSEC 2EZKA 4FTHA 4IHVA 2DMNA 3G1LA 1HLVA 2MSYA 1WCMJ 4D7NA 2W48A 4MFDA 4A3IJ 3HDDA 5F1JA 1K61A 2DA3A 2R5YA 3L1PA 3GTQJ 1P7IA 1B8IA 1XG1A 3S17J 2IAIA 2QF7A 4DYCA 2NVXJ 2LLKA 3RKQA 3FISA 1JTYA 1YRNA 3JREA 1MBJA 1JJ8C 3ZOBA 4X1EA 5M5XJ 5F0HA 3G1MA 5FLMJ 2DA4A 4EEFG 3LSJA 4AC0A 2DMUA 1Z77A 2ZB9A 1BL0A 2M2EA 3FK7A 3HBLA 3VPRA 2R5YB 5E3NA 3CQZJ 2LD5A 1B8IB 2X6OA 2DA2A 2L7FP 1H8AC 2JA8J 3K2AA 5FKNA 1JUMA 2OF7A 5FKKA 4C3IJ 2M34A 1QRYA 3JRIA 1YRNB 1ZTRA 2XPUA 2E19A 3TP3A 1FTTA 1MBFA 2ID6A 4MFEA 1HDDC 1TWCJ 2TCTA 5M5WJ 1VF9A 1Z0XA 4BBSJ 4D7MA 4GFBA 4I6ZA 2CQQA 1IDZA 1FIPA 3ZQHA 3OOUA 4JX6A 3JRGA 1ZGWA 4A3JJ 2HOTA 2XGCA 2DA7A 3GTOJ 3GTMJ 2LP0A 2CUEA 2XB5A 1AU7A 3LOCA 4XICA 2MG4A 3GTJJ 2Y31A 1X2MA 1CQTA 2CUFA 1MBGA 1A6IA 1AKHA 3HOVJ 2PMZN 2O9LA 3RZDJ 1ZR4A 1AHDP 2NVQJ 2NVYJ 3S1QJ 2QCOA 2G0EA 3S15J 5DS9A 5IP9J 4A3KJ 3BR3A 5GPCA 3IH4A 4XK4A 2DMQA 2DTZA 4XRMA 2N8GA 2NS8A 4RDUA 1AKHB 3E7LA 1I50J 2EZHA 4M3FA 1ETYA 4L5EA 3HOXJ 4S0HB 3SJMA 2GBYA 3JRFA 3BTJA 3HOWJ 1XC5A 1ZK8A 3S16J 1Y1VJ 3BQYA 2EH3A 2R5ZA 1NK2P 1FEXA 1W0TA 5F04A 3JR9A 3HGYA 2R0QC 3GBGA 1APLC 2FD5A 1DU0A 2DA5A 1BJZA 1JKRC 3BG3A 2MW8A 3BR0A 1ETXA 2LKXA 1BA5A 3CCYA 5K7HA 1IRZA 5C4JJ 4BBRJ 2CQXA 2L7MP 4C3HJ 1U8BA 2WV1A 1Q1VA 3CMYA 5M3MJ 2R5ZB 3BQZA 1GDTA 3S14J 3HEFA 1EF4A 2COBA 2WB1N 3WHBA 4DYQA 2E2HJ 2DMPA 3A02A 2M9HA 3M3YJ 5DTDA 1MSFC 3HKZN 3PO3J 3BR1A 3Q3SA 2O7OA 2X48A 2L7ZA 5JLWA 1ZQ3P 1FTZA 1ETVA 1OJLA 1POGA 1U9NA 1Y1WJ 5EF6A 3OSFA 2YU9J 1TC3C 1HDPA 3OIOA 4IEJA 1I3QJ 5FJ8J 1ITYA 2VKEA 3S2DJ 1P7JA 2HOAA 3LSRA 2EZLA 3BR2A 2YS9A 2XB0X 4UUSA 1GUUA 2LK2A 5EG0B 3HM5A 2R93J 3JRAA 3K7AJ 2O8KA 1BW5A 3RZOJ 5FKLA 2HQ5A 4JYKA 1XS9A 3W6VA 5F27A 5IYBJ 2H1KA 3G1OA 1B72A 2DJNA 3JRHA 1HOMA 2AO9A 1SANA 3LSPA 1ENHA 4AYBN 4BXXJ 4W97A 4UUSB 2LTPA 2K40A 2CJJA 3QPLA 4FISA 5M5YJ 5IYCJ 2R7ZJ 1D5YA 3Q0VA 2R92J 1O4XA 2NOGA 4ABZA 1W0UA 1B72B 5IPAA 1IV6A 2JA5J 2H8RA 3NAUA 1H89C 3H3VK 1NK3P 3JRDA 5F0CA 4A3LJ 3ZQGA 1RKTA 1SFOJ 5C3EJ 3S2HJ 2JA6J 3PM1A 4M3EA 5FKMA 2GLOA 2JK3A 1K83J 1JKOC 1WH5A 2ME6A 3Q0UA 3DCFA 1I6HJ 4A3FJ 2XGDA 2ELKA 5E3LA 2XGEA 3B6AA 1LFUP 3FK6A 1VNDA 1IJWC 4XRSA 4DZJA 1LFBA 3S1RJ 4FCYA 3CDLA 4A3DJ 2VPRA 1IGNA 3TW6A 2Y0SN 1RR7A 2DA1A 3ZQLA 1GV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  1GT0 C;  1U78 A;  1IDY A;  4A3E J;  1MBE A;  3BT9 A;  2IEK A;  3BG5 A;  4JP0 A;  3BTI A;  4BY1 J;  4M6V A;  3BTL A;  2DN0 A;  1WGX A;  1H88 C;  3GTP J;  3MVP A;  1GVD A;  1ETK A;  4BY7 J;  1GV5 A;  5J3L A;  5IP6 A;  1T33 A;  4QTR A;  4B3A A;  1JJ6 C;  1QPI A;  4MIM A;  2E2J J;  1X2N A;  4RBO A;  3I4M J;  2Y9Y A;  2CRG A;  2Y2Z A;  5IOZ A;  4BKX A;  2K9S A;  1F43 A;  2LVS A;  4JX5 A;  4IHY A;  1RES A;  1DU6 A;  1MH4 A;  4C3J J;  3GTL J;  4AUX A;  3BG9 A;  2HXO A;  1JUS A;  4C2M J;  3D1N I;  1MNM C;  3LNQ A;  5IOY A;  1FJL A;  2VKV A;  2JJ7 A;  1A5J A;  2P81 A;  2D5V A;  1RET A;  4I76 A;  5F08 A;  2HYJ A;  4Y52 J;  3O8H A;  4B1R A;  1F36 A;  4B4C A;  2ECC A;  4FE7 A;  1ETO A;  2ID3 A;  2JA7 J;  3GTK J;  1PUF B;  4FE4 A;  5EG0 A;  1MH3 A;  1ETQ A;  2FQ4 A;  3SFI A;  2M0C A;  3HOU J;  4MLO A;  3WHC A;  1VFC A;  3QQA A;  3SDG A;  5GP9 A;  1VI0 A;  4M3G A;  2TRT A;  4A3B J;  2XPW A;  2WAQ N;  2GM4 A;  1JGG A;  2E2I J;  4A3M J;  5FLV A;  2HXI A;  5IP7 J;  4XRS G;  1IG7 A;  4V2G A;  1WPK A;  5BNG A;  1OFC X;  2JN6 A;  4D5F A;  5EYR A;  4V2F A;  3A01 A;  4D5C A;  5K7Z A;  3IV5 A;  2KT0 A;  3LSG A;  5HOD A;  1HCR A;  1WH7 A;  1MBH A;  1ZKG A;  2JWT A;  5EDN A;  4XID A;  1UG2 A;  2XRL A;  2Y9Z A;  3B6C A;  3C2B A;  1QVT A;  1JKQ C;  2L9R A;  3A01 B;  3TED A;  3M4O J;  4W1U A;  1JUP A;  3PO2 J;  2L0K A;  4QSH A;  1JT0 A;  4A69 C;  4A3C J;  1TWG J;  3F0C A;  3GTG J;  4CYC A;  1WI3 A;  5IYD J;  5E3O A;  4HNV A;  3OSG A;  1E3O C;  2NS7 A;  1QVU A;  5EZH A;  3Q0W A;  5C4X J;  2NVT J;  3RQI A;  2FX0 A;  1ZR2 A;  3HOY J;  1TWA J;  2I10 A;  4A3G J;  1TWF J;  3JRB A;  3TP0 A;  2EQR A;  2K9Q A;  3MKL A;  1UMQ A;  4NDL A;  4CYC B;  2RAE A;  3HOZ J;  3I4N J;  1HF0 A;  2ME0 A;  4J19 A;  2LFB A;  1JKP C;  1BW6 A;  3BTC A;  3BR6 A;  2DMT A;  2ECB A;  1NTC A;  3ZQC A;  1IC8 A;  1U9O A;  4M3B A;  5EZG A;  1RKW A;  2MGQ A;  1JTX A;  3O8G A;  3A03 A;  5J1Y A;  2HOS A;  1T56 A;  1TWH J;  3ZQF A;  1RPW A;  1S7E A;  2VI6 A;  2IBD A;  5F0F A;  2HDD A;  2EBI A;  2B63 J;  3S1M J;  3BR5 A;  3DEW A;  5JLX A;  5E3M A;  5M3F J;  2LR8 A;  3QPS A;  5J1R A;  2E1O A;  1LE8 A;  4DYR A;  3S1N J;  4UUT A;  3FKI J;  2AHQ A;  4DW6 A;  2JMW A;  4G12 A;  5C44 J;  3UKG A;  2DA6 A;  1G2H A;  1MBK A;  3TW7 A;  1PUF A;  3NAR A;  2Y30 A;  1IUF A;  4M3D A;  3IH3 A;  4IHX A;  1OCP A;  1OCT C;  3ZQI A;  3HGG A;  4LOC A;  4X6A J;  1LE8 B;  2LY9 A;  5EGO A;  9ANT A;  2FJ1 A;  1R9T J;  2K9N A;  5FKO A;  4Y7N J;  4MO7 A;  5GPA A;  5K7F A;  3FIW A;  1FIA A;  4DZP A;  3MN2 A;  1JT6 A;  5J1U A;  2EZI A;  2HI3 A;  3IH2 A;  1ETW A;  2X9D A;  3JRC A;  2KDZ A;  2VUM J;  5EEA A;  1X58 A;  1ORK A;  3HB9 A;  5EGO B;  2M8G X;  2YUS A;  4JX4 A;  2XPV A;  1UHS A;  4IHW A;  3H0G J;  4A93 J;  2XSD C;  4QIW N;  2CU7 A;  1MSE C;  2EZK A;  4FTH A;  4IHV A;  2DMN A;  3G1L A;  1HLV A;  2MSY A;  1WCM J;  4D7N A;  2W48 A;  4MFD A;  4A3I J;  3HDD A;  5F1J A;  1K61 A;  2DA3 A;  2R5Y A;  3L1P A;  3GTQ J;  1P7I A;  1B8I A;  1XG1 A;  3S17 J;  2IAI A;  2QF7 A;  4DYC A;  2NVX J;  2LLK A;  3RKQ A;  3FIS A;  1JTY A;  1YRN A;  3JRE A;  1MBJ A;  1JJ8 C;  3ZOB A;  4X1E A;  5M5X J;  5F0H A;  3G1M A;  5FLM J;  2DA4 A;  4EEF G;  3LSJ A;  4AC0 A;  2DMU A;  1Z77 A;  2ZB9 A;  1BL0 A;  2M2E A;  3FK7 A;  3HBL A;  3VPR A;  2R5Y B;  5E3N A;  3CQZ J;  2LD5 A;  1B8I B;  2X6O A;  2DA2 A;  2L7F P;  1H8A C;  2JA8 J;  3K2A A;  5FKN A;  1JUM A;  2OF7 A;  5FKK A;  4C3I J;  2M34 A;  1QRY A;  3JRI A;  1YRN B;  1ZTR A;  2XPU A;  2E19 A;  3TP3 A;  1FTT A;  1MBF A;  2ID6 A;  4MFE A;  1HDD C;  1TWC J;  2TCT A;  5M5W J;  1VF9 A;  1Z0X A;  4BBS J;  4D7M A;  4GFB A;  4I6Z A;  2CQQ A;  1IDZ A;  1FIP A;  3ZQH A;  3OOU A;  4JX6 A;  3JRG A;  1ZGW A;  4A3J J;  2HOT A;  2XGC A;  2DA7 A;  3GTO J;  3GTM J;  2LP0 A;  2CUE A;  2XB5 A;  1AU7 A;  3LOC A;  4XIC A;  2MG4 A;  3GTJ J;  2Y31 A;  1X2M A;  1CQT A;  2CUF A;  1MBG A;  1A6I A;  1AKH A;  3HOV J;  2PMZ N;  2O9L A;  3RZD J;  1ZR4 A;  1AHD P;  2NVQ J;  2NVY J;  3S1Q J;  2QCO A;  2G0E A;  3S15 J;  5DS9 A;  5IP9 J;  4A3K J;  3BR3 A;  5GPC A;  3IH4 A;  4XK4 A;  2DMQ A;  2DTZ A;  4XRM A;  2N8G A;  2NS8 A;  4RDU A;  1AKH B;  3E7L A;  1I50 J;  2EZH A;  4M3F A;  1ETY A;  4L5E A;  3HOX J;  4S0H B;  3SJM A;  2GBY A;  3JRF A;  3BTJ A;  3HOW J;  1XC5 A;  1ZK8 A;  3S16 J;  1Y1V J;  3BQY A;  2EH3 A;  2R5Z A;  1NK2 P;  1FEX A;  1W0T A;  5F04 A;  3JR9 A;  3HGY A;  2R0Q C;  3GBG A;  1APL C;  2FD5 A;  1DU0 A;  2DA5 A;  1BJZ A;  1JKR C;  3BG3 A;  2MW8 A;  3BR0 A;  1ETX A;  2LKX A;  1BA5 A;  3CCY A;  5K7H A;  1IRZ A;  5C4J J;  4BBR J;  2CQX A;  2L7M P;  4C3H J;  1U8B A;  2WV1 A;  1Q1V A;  3CMY A;  5M3M J;  2R5Z B;  3BQZ A;  1GDT A;  3S14 J;  3HEF A;  1EF4 A;  2COB A;  2WB1 N;  3WHB A;  4DYQ A;  2E2H J;  2DMP A;  3A02 A;  2M9H A;  3M3Y J;  5DTD A;  1MSF C;  3HKZ N;  3PO3 J;  3BR1 A;  3Q3S A;  2O7O A;  2X48 A;  2L7Z A;  5JLW A;  1ZQ3 P;  1FTZ A;  1ETV A;  1OJL A;  1POG A;  1U9N A;  1Y1W J;  5EF6 A;  3OSF A;  2YU9 J;  1TC3 C;  1HDP A;  3OIO A;  4IEJ A;  1I3Q J;  5FJ8 J;  1ITY A;  2VKE A;  3S2D J;  1P7J A;  2HOA A;  3LSR A;  2EZL A;  3BR2 A;  2YS9 A;  2XB0 X;  4UUS A;  1GUU A;  2LK2 A;  5EG0 B;  3HM5 A;  2R93 J;  3JRA A;  3K7A J;  2O8K A;  1BW5 A;  3RZO J;  5FKL A;  2HQ5 A;  4JYK A;  1XS9 A;  3W6V A;  5F27 A;  5IYB J;  2H1K A;  3G1O A;  1B72 A;  2DJN A;  3JRH A;  1HOM A;  2AO9 A;  1SAN A;  3LSP A;  1ENH A;  4AYB N;  4BXX J;  4W97 A;  4UUS B;  2LTP A;  2K40 A;  2CJJ A;  3QPL A;  4FIS A;  5M5Y J;  5IYC J;  2R7Z J;  1D5Y A;  3Q0V A;  2R92 J;  1O4X A;  2NOG A;  4ABZ A;  1W0U A;  1B72 B;  5IPA A;  1IV6 A;  2JA5 J;  2H8R A;  3NAU A;  1H89 C;  3H3V K;  1NK3 P;  3JRD A;  5F0C A;  4A3L J;  3ZQG A;  1RKT A;  1SFO J;  5C3E J;  3S2H J;  2JA6 J;  3PM1 A;  4M3E A;  5FKM A;  2GLO A;  2JK3 A;  1K83 J;  1JKO C;  1WH5 A;  2ME6 A;  3Q0U A;  3DCF A;  1I6H J;  4A3F J;  2XGD A;  2ELK A;  5E3L A;  2XGE A;  3B6A A;  1LFU P;  3FK6 A;  1VND A;  1IJW C;  4XRS A;  4DZJ A;  1LFB A;  3S1R J;  4FCY A;  3CDL A;  4A3D J;  2VPR A;  1IGN A;  3TW6 A;  2Y0S N;  1RR7 A;  2DA1 A;  3ZQL A;  1GV2 A; 
#chains in the Genus database with same CATH topology
 2OPT A;  1IF1 A;  3BZC A;  2CG4 A;  3BT9 A;  4RLF A;  4JP0 A;  5HNF A;  4HV5 A;  3EYY A;  1BOB A;  3AG4 H;  3BTL A;  2DN0 A;  2VN2 A;  1FYK A;  4GO1 A;  1G3S A;  1W1W E;  5IP6 A;  1T33 A;  2K4J A;  4PGH A;  3A1Y A;  1JJ6 C;  4HZF A;  1JI8 A;  4RBO A;  3V8J A;  4V19 K;  4A12 A;  5IOZ A;  4BKX A;  1F43 A;  2LVS A;  1XD7 A;  2LY2 A;  4RAG A;  4IHY A;  1ACI A;  1W5C C;  4C3J J;  1YW7 A;  1WJ5 A;  2OC6 A;  3KCC A;  4C2M J;  1MNM C;  2NAZ A;  4CCJ A;  1FJL A;  4A6D A;  2VKV A;  1XMK A;  3EPZ A;  4BJ5 C;  3F8F A;  1QPM A;  2HPM A;  1B4A A;  1VQL I;  2D5V A;  2HVR A;  3G2B A;  1PVE A;  2X6W A;  1D8K A;  1HW5 A;  3IKV A;  1SEU A;  4FE7 A;  1ETO A;  2KIS A;  1ZG3 A;  3QOP A;  1YIT I;  1T0F A;  2ID3 A;  5K5O A;  3SFI A;  3QRF F;  1QQI A;  4MLO A;  2R7D A;  1UJ8 A;  2P0W A;  5E8G A;  2A05 A;  4BE1 A;  1BJA A;  4E7J A;  3L2V A;  1IN6 A;  1K79 A;  1JGG A;  4J01 A;  1UB9 A;  3S8P A;  2E2I J;  5HLI A;  1J09 A;  2WAD A;  4RMN A;  4AVZ A;  3S3M A;  4GGG A;  4I0B A;  4V2G A;  1WPK A;  2EPF A;  1OFC X;  2JN6 A;  4OU0 A;  4RLQ A;  5CQE A;  3E6C C;  2WB1 A;  4K2E A;  4YFN F;  5D5W B;  3L2Q A;  1WI9 A;  1ZLK A;  3P9K A;  3V8K A;  1U6G A;  2DBB A;  2DDB A;  5K7Z A;  4CUG A;  5DM6 F;  4BL0 B;  1T8I A;  4BDZ A;  4G7O F;  3DPT A;  1G3W A;  1I39 A;  4Q47 A;  4OIN F;  1WH7 A;  4D9J A;  3RPQ A;  5A2Q K;  4G6T B;  1FOW A;  4I99 C;  2VBY A;  4LK0 F;  1IXC A;  1O57 A;  3KP6 A;  4E7L A;  2PJP A;  3B6C A;  4F93 B;  4E7S A;  2IS6 A;  5BPI A;  5DD4 A;  2OTL I;  3TED A;  3GZN B;  3PO2 J;  4HST A;  2LSO A;  4XQF A;  2L2O A;  2X6Y A;  2PQ8 A;  4A69 C;  1P4A A;  5IYD J;  1ZN2 A;  1P9Q C;  5D5U B;  1E3O C;  5EZH A;  2KP6 A;  2W57 A;  2I5U A;  2FX0 A;  1ZR2 A;  3H0D A;  3E97 A;  4KUM A;  4HNT A;  2HU9 A;  3JRB A;  3PNT A;  3M7G A;  4MHG A;  2IGM A;  1S7O A;  4S05 A;  3OYE A;  1BI0 A;  1FX7 A;  2RAE A;  3HOZ J;  3I4N J;  3CES A;  2BYV E;  1VZ0 A;  2FF4 A;  2JPB A;  1A36 A;  4ENM A;  3S32 A;  2OU2 A;  4DBQ A;  1JHH A;  1YIJ I;  2ETH A;  3PFY A;  1IC8 A;  2CV2 A;  1EJ9 A;  1IXR C;  1FBQ A;  2MGQ A;  1YJ9 I;  2IRF G;  4HG2 A;  3A4C A;  4P96 A;  4NQW A;  1Y0U A;  3CDH A;  4LIU A;  2HOS A;  2VOP A;  1TWH J;  2CS3 A;  2HOE A;  3ZQF A;  3OYN A;  2XAQ A;  1SVM A;  1A6Q A;  3DPU A;  4IOC F;  3ASN H;  4QWQ A;  1WJA A;  3HRT A;  2H8W A;  5F0F A;  2HDD A;  3E1S A;  2LOO A;  3T1B A;  2KQR A;  3D5L A;  1DGW Y;  1R5G A;  3TL4 X;  5J1R A;  2PLY A;  2F5F A;  4XRF A;  4YII A;  3S1N J;  4AIH A;  3DKY A;  4FET A;  5IT3 A;  2B9S A;  4G12 A;  1MZB A;  3CMM A;  1SFU A;  1HSJ A;  3J80 Z;  2XC7 A;  3H5A A;  3TW7 A;  1PUF A;  2Y30 A;  3F23 A;  1IUF A;  3CUQ A;  3LFU A;  4B47 A;  2JRT A;  5CPR B;  1LNW A;  2FOW A;  4LOC A;  4IRG A;  1V55 H;  4X6A J;  2W85 A;  1N75 A;  1S6L A;  2LH9 A;  2EIJ H;  4PUS A;  3GYH X;  3I4P A;  2AS5 F;  3DLL F;  3HOS A;  2R7U A;  3M9A A;  4DZP A;  1JE8 A;  2DK8 A;  3TGN A;  4F55 A;  2DXI A;  1JT6 A;  5J1U A;  1UHW A;  3I55 I;  2A6H F;  5L3B A;  3GFJ A;  3CUQ B;  1DDN A;  4KYW A;  3OMY A;  5ICE A;  1ETW A;  2KZV A;  1TT0 A;  1LKX A;  4MQ9 F;  2X9D A;  3VYU B;  5BQT A;  3JRC A;  4NB5 A;  1YFH A;  2FNA A;  2DCE A;  2XPV A;  2XAS A;  2E1M C;  1YI2 I;  4A93 J;  3MZH A;  1Z91 A;  4FTH A;  2EA4 A;  1HLV A;  4HF1 A;  1KU7 A;  1DPU A;  4R1H A;  2P5V A;  5EEH A;  4UNO A;  4D7N A;  3U21 A;  3HKZ A;  4PJJ A;  4MFD A;  1AA7 A;  1T98 A;  3H3U A;  5F1J A;  5FRM A;  4HX7 A;  3DU5 A;  2HVS A;  1FSE A;  2BY3 A;  4P55 A;  4EGZ A;  3HXL A;  5CVJ A;  1UAA A;  3HZJ A;  4MGR A;  1R5H A;  3FIS A;  1YRN A;  2DFF A;  1JJ8 C;  4X1E A;  5M5X J;  5FLM J;  4EEF G;  4I01 A;  3LSJ A;  3SDB A;  4AC0 A;  3OYH A;  2ZB9 A;  1X1C A;  1TW3 A;  3FK7 A;  3CUO A;  3OV8 A;  4Q5S F;  2LD5 A;  4AIK A;  3L9F A;  3BLY A;  4C2T A;  2DPU A;  4RM2 A;  4JBA A;  3AAF A;  4H0E A;  3QPH A;  1YRN B;  3WU0 A;  2MA3 A;  2XPU A;  2E19 A;  3TP3 A;  3BY6 A;  2VQL A;  2W7N A;  2ID6 A;  2KDO A;  1HDD C;  2TCT A;  1TNS A;  3F6O A;  5DCF A;  4ZYH A;  3QU6 A;  3MKY B;  2X0L A;  4PJ0 C;  5H2F C;  2E7W A;  4GCV A;  1B9N A;  3H9G A;  1YX5 A;  4JX6 A;  2KMU A;  3OYD A;  4A3J J;  2XGC A;  3FWE A;  2DA7 A;  5D5V B;  3MFK A;  2P5L C;  3GTM J;  3DTI A;  5H6R A;  3A0B C;  5FD6 A;  2CUE A;  2XB5 A;  3J7A O;  2PMU A;  2K3F A;  3CLQ A;  3OWT A;  3LSM A;  1X2M A;  4N4O B;  1CQT A;  3ABU A;  3ESW B;  2E1N A;  5KNL A;  2PMZ N;  2HKX A;  2WY8 Q;  1K4S A;  1AHD P;  4TV7 A;  1V5E A;  1G3T A;  3VOD A;  2RRE A;  1T2K A;  2VL8 A;  3DQV C;  2ISZ A;  4CA0 A;  4XRM A;  4YFK F;  5JFR A;  3U1K A;  1ULY A;  1P2F A;  2JA2 A;  2KRC A;  4M74 A;  4RDU A;  1E17 A;  3LMM A;  3WTV C;  3E7L A;  2Z3Y A;  2A5W A;  4M3F A;  1HW1 A;  5J40 A;  2G7U A;  3DEE A;  5FRO A;  1OCR H;  2ZXH A;  4WX9 A;  1VQO I;  4S0H B;  3KZY A;  1X4O A;  4UVC A;  2UZK A;  4IOA F;  4BE0 A;  2V26 A;  1XC5 A;  2H09 A;  3S16 J;  3GME A;  2WWY A;  1TT5 B;  2EH3 A;  2YPR A;  1ZHF A;  1NK2 P;  4BYY A;  1ZAO A;  2Y69 H;  3CTA A;  5F04 A;  2HDC A;  3HGY A;  5F64 A;  4BUP A;  2R0Q C;  1X1A A;  3GBG A;  2FD5 A;  1R7J A;  3BG3 A;  4BDY A;  1VQK I;  1ETX A;  1GVJ A;  4LK1 F;  3DXJ F;  4ZH4 F;  1XN7 A;  2VKD A;  4LMY A;  3CMY A;  3S14 J;  2A61 A;  1G4D A;  3W2A A;  4DYQ A;  4HF0 A;  1D0Z A;  3CJT B;  1ZLJ A;  4C2U A;  1Z67 A;  2M9H A;  3CO7 C;  3LL7 A;  1E0E A;  3PO3 J;  3ZQ7 A;  1TZL A;  2WBM A;  1YE9 A;  1O3Q A;  4WCG A;  1XCB A;  1YX3 A;  3K0L A;  3CCL I;  1CF7 B;  3WGH A;  2RV8 A;  3V4G A;  4OIQ F;  5AIP A;  1ZRD A;  1D3Y A;  1ETV A;  5TGT A;  1WVR A;  4KN4 X;  4XLN F;  1POG A;  3W2W A;  4XKC A;  2RVC A;  5L3E A;  1Z7U A;  2R7S A;  2NNY A;  1LPQ A;  2MAB A;  1FYL A;  2YU9 J;  3W6K B;  2VBZ A;  2VKE A;  5KVR A;  4BXF A;  4G7Z F;  1P7J A;  1NHA A;  1OPC A;  2BVM A;  1HC8 A;  2KFD A;  2YS9 A;  2E5N A;  5ICF A;  2JT1 A;  2XB0 X;  4UUS A;  2LK2 A;  1MJ9 A;  4EJW A;  5EG0 B;  2R7W A;  3HM5 A;  1R1U A;  2DOF A;  3QP5 A;  3JRA A;  2X51 A;  3K7A J;  3PSF A;  4A5N A;  1P92 A;  5FKL A;  4JYK A;  2X1E A;  2XRN A;  3QYF A;  1I6X A;  1FMW A;  3VFZ A;  2H1K A;  4Y4R A;  5E1Z B;  3IC7 A;  1EH8 A;  2K3P A;  3CME I;  1W36 C;  1F5T A;  2DJN A;  3JRH A;  1HOM A;  3K4M A;  4E7H A;  5L3G A;  1ON2 A;  1WWX A;  2UV1 A;  4BQA A;  4BAY A;  3WG7 H;  3BG7 A;  3L2C A;  4UUS B;  2QSH X;  1DP7 P;  3ZMD A;  3D0S A;  2K40 A;  4WK8 F;  4FIS A;  5M5Y J;  4I0A A;  1FMV A;  2PBI A;  2R92 J;  2OAZ A;  4M6X A;  1A31 A;  5IPA A;  4U0W A;  2ELJ A;  3NAU A;  1YW9 A;  2NS0 A;  2LRE A;  4WXC A;  1I1S A;  4LGW A;  5F0C A;  4IZZ A;  4ON0 A;  1IRF A;  2MH2 A;  3P9C A;  3S2H J;  4BJ6 C;  1JGS A;  5HLT A;  1FOK A;  4DBR A;  2LKS A;  4FX4 A;  3GO5 A;  2NVU B;  5FKM A;  1MND A;  2GLO A;  4L0Z B;  4CZC A;  2JTV A;  1JKO C;  4PFO A;  3WTY C;  3K4N A;  3WTU C;  3Q0U A;  2GA1 A;  1A04 A;  3H35 A;  3ABT A;  4L9J A;  3FK6 A;  3QU3 A;  3TQN A;  1B59 A;  3IP4 B;  4XRS A;  5JVG F;  2F5V A;  3S1R J;  2XF5 A;  3CDL A;  4DQ2 A;  4FCY A;  1FBS A;  4IVN A;  4ZYE A;  2GAU A;  2DA1 A;  3K2Z A;  4BJT A;  2CMP A;  2MH9 A;  2IP2 A;  3DPL C;  1IDY A;  3GUD A;  3MZ8 A;  1BOA A;  2XAH A;  5KAI C;  5TRD A;  2XAG A;  2P6T A;  2B0L A;  3CMA I;  5DEQ A;  5K5R A;  3FXK A;  4PJN A;  3ZGK A;  5B1B H;  1H88 C;  1J2X A;  3PSI A;  3GTP J;  4RGR A;  4E6K G;  3H1C A;  3ONQ A;  4B3A A;  4MIM A;  1LVK A;  2J5O A;  1X2N A;  2K02 A;  3CCS I;  2Y9Y A;  2CRG A;  3BJ6 A;  3KE2 A;  3GCM A;  5GAH J;  3CCV I;  1RIO H;  4MEX F;  3J81 Z;  2IGK A;  2GXB A;  1UFM A;  3BG9 A;  1FLI A;  1JUS A;  2JSP A;  4A0X A;  3D1N I;  3LNQ A;  5B66 C;  2ESN A;  3AG1 H;  2OV7 A;  2RQP A;  3BDD A;  2L3D A;  2JVG A;  1A5J A;  2BHY A;  1MKM A;  3CC7 I;  5F08 A;  4I76 A;  1HKQ A;  1ON1 A;  2HYJ A;  5E1W A;  3SEZ A;  3O8H A;  2LDU A;  3WTT C;  3I59 A;  3HG9 A;  5HNH A;  2BGC A;  1KU2 A;  4EVI A;  4FE4 A;  3WGI A;  3HOU J;  1ETQ A;  1OLT A;  2QQB A;  5D8L B;  3IAM 2;  2K7L A;  3WHC A;  3QQA A;  3Q9S A;  2IXS A;  3IAS 2;  3ZPL A;  1VI0 A;  1T38 A;  2CQN A;  2BW3 A;  2WAQ N;  2RC4 A;  3EUK L;  2ZSH B;  3ZQQ A;  4A3M J;  5CLS A;  5IP7 J;  1K6O A;  5BNG A;  3FXQ A;  3C2G A;  2FSW A;  2XF6 A;  3V7S A;  4D5F A;  5EYR A;  4V2F A;  5LBQ A;  3A01 A;  1Z05 A;  1WRJ A;  4UB6 C;  1ODD A;  2LBF B;  2GQQ A;  1W7P B;  3KEO A;  2QGU A;  1QHG A;  5HOD A;  1ZRC A;  1ZKG A;  2JWT A;  5EDN A;  1QNT A;  4M73 A;  4CGZ A;  4RA2 A;  3HHH A;  1SAX A;  1RUO A;  1YQA A;  3C2B A;  1QVT A;  1OCC H;  3EUA A;  5DCM A;  1VTN C;  4HRI A;  3A01 B;  2V1U A;  1S7A A;  3RKW A;  1W4M A;  2L0K A;  1Z6T A;  1IUY A;  2QKM B;  2H27 A;  1GXQ A;  2RGV A;  1TWG J;  4CZZ A;  3RKY A;  5B1A H;  2W25 A;  5JI6 A;  4CYC A;  4HDV A;  2ADU A;  4EM2 A;  5E3O A;  1OIS A;  4HNV A;  4II3 A;  4B48 A;  5C4X J;  1OYI A;  3LA7 A;  1KQ8 A;  2CYY A;  4C30 A;  3L09 A;  3KET A;  3E0J B;  2XAF A;  2LY1 A;  5DCM B;  3HOY J;  1PDN C;  3ZP5 A;  1TWF J;  2KIQ A;  2QEN A;  4OIR F;  3OS0 A;  3ZXS A;  3L2W A;  1UG0 A;  5LEJ A;  3TP0 A;  2ZNY A;  2FE3 A;  4UVA A;  1FSH A;  2K9Q A;  2F5C A;  2R7F A;  1UMQ A;  2W84 A;  3MKL A;  4ESF A;  4CYC B;  2KIU A;  2EB7 A;  4HOB A;  1HF0 A;  4RGS A;  1IN4 A;  2ME0 A;  1BN5 A;  1SFK A;  3RQ4 A;  4CCO A;  4J19 A;  4BU2 A;  2LFB A;  5D6E A;  1BW6 A;  2FML A;  1EKE A;  1XSV A;  3ZMT A;  4M3B A;  5EZG A;  1EV7 A;  3TBI A;  1YLF A;  3A03 A;  3CC4 I;  4UV9 A;  5ERI A;  1MJB A;  2H6B A;  3I64 A;  1Y56 A;  1VQ5 I;  4OMZ A;  4HF2 A;  2QWW A;  2CFX A;  3K4C A;  1RRJ A;  4ANJ A;  3OYC A;  2RNJ A;  4LIT A;  1RI7 A;  2IBD A;  1IRX A;  4HLY A;  3OYG A;  3TO7 A;  1U2W A;  2B63 J;  3S1M J;  3BR5 A;  5M3F J;  1MJA A;  2E1O A;  2BV6 A;  1LE8 A;  1D1A A;  2OJE D;  2DPD A;  4UUT A;  2DI3 A;  4EJO A;  2AHQ A;  4DW6 A;  2A6T A;  2JMW A;  3UKG A;  3EYI A;  2ZFW A;  1G2H A;  3H9J A;  1MBK A;  5H20 A;  4XSX F;  1LDJ A;  3CJQ B;  5E20 A;  4M3D A;  2HQR A;  1MNE A;  3BRO A;  2P4W A;  4HW0 A;  3H5N A;  2Y48 A;  1OCT C;  2CFO A;  3HGG A;  1LE8 B;  2LY9 A;  3AFH A;  2E36 A;  3LA2 A;  4KIC A;  4OAZ A;  3Q5F A;  2FJ1 A;  9ANT A;  1IN8 A;  3F22 A;  2CSO A;  5FKO A;  1I5Z A;  1BBY A;  2FNP A;  5GPA A;  5K7F A;  2IVM A;  2EIN H;  4G6D A;  5KK1 A;  2QA4 I;  2L4A A;  2CW7 A;  2OZ6 A;  2HI3 A;  3IH2 A;  2VXD A;  4HBL A;  3VOE A;  2OCE A;  3CUQ C;  2QQA A;  3ABM H;  3F21 A;  2G9W A;  2V7F A;  1U8R A;  2M8G X;  3E5X A;  1Z3Y A;  2DOA A;  3D5S C;  4HPQ A;  2K27 A;  3NWT A;  4IHW A;  2IPQ X;  2KKO A;  5EJC A;  2XSD C;  4QIW N;  1MSE C;  1K78 A;  2X85 A;  2DMN A;  1F9N A;  2V1X A;  3FZV A;  2UXX A;  2KLO A;  3MD2 A;  4F91 B;  2W48 A;  3I0T A;  4PSX A;  3LQQ A;  4UXN A;  2OBP A;  1R5I D;  2DA3 A;  3DLA A;  4KFC A;  2VQG A;  2DT5 A;  1BR4 A;  2DO7 A;  2V9V A;  4YFX F;  2XF7 A;  2GA2 A;  1K78 B;  4PJL A;  3COA C;  2JUG A;  1Y8Q B;  3RKQ A;  1JTY A;  1VQ4 I;  3WTZ A;  3JRE A;  3LSK A;  1MBJ A;  1KGS A;  2EV0 A;  3G1M A;  2ZXI A;  3F8N A;  5JHF A;  3KP2 A;  2GXA A;  1FT9 A;  1QO0 D;  2DQR A;  1ZH5 A;  4O6J A;  5GAE J;  4NC7 A;  2X6O A;  2L7F P;  3I56 I;  3NQO A;  3E3V A;  3QYB A;  4C3I J;  2M34 A;  3DBR B;  3KYD B;  1QRY A;  3JRI A;  1ZTR A;  4AU7 A;  4YIR X;  1WJE A;  1YS6 A;  2V6C A;  5M5W J;  3KLO A;  1VF9 A;  1OMI A;  3DBH B;  2IGO A;  3E6B A;  2M45 A;  1K4T A;  1R58 A;  1IZ1 A;  2MFZ A;  3K6G A;  5B5E C;  2EFO A;  1B6A A;  2ZNZ A;  1Z9C A;  3ZQH A;  3JRG A;  4J00 A;  3W6J B;  4AYB A;  3IKT A;  2VBX A;  1W5T A;  1R1V A;  3GTO J;  1YG2 A;  3BJA A;  4WWC A;  2LP0 A;  4MTD A;  3GTJ J;  2M5W A;  2VB6 A;  4Q48 A;  4KNY A;  1AKH A;  1A6I A;  3GZ5 A;  3RIR A;  2FBI A;  2O9L A;  4E70 A;  4CDG A;  4WXD A;  2M4K A;  2QYO A;  4IKF A;  5LGN A;  1SAU A;  1ZR4 A;  2NVQ J;  2NVY J;  3S1Q J;  3KYL A;  3JCU C;  1SVL A;  3HSR A;  1Q1H A;  5IP9 J;  2HZD A;  2VC0 A;  4IXA A;  3BR3 A;  5GPC A;  3FX3 A;  5TIS C;  2VXZ A;  2RDP A;  2DTZ A;  3MAJ A;  3N97 A;  2N8G A;  2OQR A;  2ZXW H;  2LF7 A;  1KU9 A;  1X1B A;  1AKH B;  2L9S A;  2XKO A;  2DT6 A;  3ZRG A;  2OTJ I;  4G6Q A;  2Y0M A;  3SJM A;  3T0Y A;  2WAF A;  3JRF A;  3BTJ A;  3I9V 2;  2BZT A;  3M1E A;  2JUC A;  3BQY A;  4YEJ A;  2IT0 A;  1OYW A;  4IRH A;  2O3F A;  5JHU A;  4JOM A;  1FEX A;  1W0T A;  4NNJ A;  2LKP A;  4LLG F;  2E5Z A;  4CCK A;  5HDN A;  3WU1 B;  1Y8R B;  2ZSI B;  1APL C;  2FU4 A;  1JKR C;  5A2Q Z;  2VQC A;  3TO9 A;  2EIM H;  2VJ4 A;  1BA5 A;  1YIO A;  5K7H A;  1IRZ A;  3DBL B;  5C4J J;  1WFX A;  4BBR J;  1T39 A;  1LQ1 A;  2L7M P;  4C3H J;  3P7N A;  1SFX A;  3TMO A;  1U8B A;  1H9T A;  3HHG A;  4ITV A;  5JVT A;  5M3M J;  3OOP A;  1T08 B;  1EF4 A;  2COB A;  3WHB A;  1PP7 U;  2DDA A;  3HYI A;  2E2H J;  2BY1 A;  1XPX A;  2DMP A;  3A02 A;  4GDF A;  5CVI A;  3M3Y J;  4HQM A;  4ZDP A;  2QZ8 A;  3HSF A;  3NWS A;  2EFP A;  3HKZ N;  5DTD A;  1HBX G;  4CHU A;  1O7F A;  1HST A;  3JAM K;  5LD2 C;  3P5J A;  1J5Y A;  2R7Q A;  2GIV A;  5F6F A;  2QBY B;  1U9N A;  2MD5 A;  2CQ7 A;  4XOP A;  2Q0O A;  4KIT B;  5EF6 A;  3OYF A;  2Q8K A;  1SMY F;  3K69 A;  1XMA A;  5J8F A;  1TC3 C;  1HDP A;  1I3Q J;  3HTS B;  1ITY A;  3M1C A;  3SXY A;  2ZME A;  4BS9 A;  2HOA A;  3KEQ A;  4B3X A;  2A5Y B;  4A5M A;  2A07 F;  1Y0N A;  4ZTF A;  1SMT A;  3HOT A;  4YG2 F;  3S93 A;  3OL4 A;  5HDK A;  3OYA A;  5HOO A;  3K4B A;  2BXZ A;  2CW0 F;  2HEO A;  2HQ5 A;  3AG2 H;  2ESH A;  3G1O A;  3KP3 A;  5FFZ A;  3WOD F;  2P7V B;  2W00 A;  2HYG D;  1OCZ H;  4L5J A;  3CDI A;  1REP C;  2ZME B;  4KMU X;  3LSP A;  2K85 A;  1UZC A;  4W97 A;  4YEL A;  4M72 A;  4QPO A;  4B44 A;  1R4N B;  3AKZ A;  2CJJ A;  3OS1 A;  1QGP A;  1X3W B;  2ZJQ F;  1D5Y A;  1O4X A;  2NOG A;  1BI3 A;  4Y3O A;  1IV6 A;  2H8R A;  3R61 A;  1R4M B;  2XGX A;  4LJZ F;  3H3V K;  1NK3 P;  3HSE A;  3JRD A;  4A3L J;  4ASN A;  2O0Y A;  4I7H A;  1RKT A;  1SFO J;  3VWB A;  4GXO A;  2BY2 A;  4U87 A;  3CCM I;  2JA6 J;  2HTJ A;  4LB6 B;  2GWR A;  1LUJ B;  2JK3 A;  3TDZ C;  4AVP A;  1WH5 A;  2ME6 A;  1Z3X A;  4AM3 A;  2Q2E A;  2XGD A;  4HX8 A;  2ELK A;  2CQK A;  5CVR A;  2XGE A;  5FLX K;  3B6A A;  1LFU P;  1UHM A;  4HNU A;  3ZN1 A;  1IJW C;  2ZJ2 A;  4RB1 A;  2KL4 A;  1S29 A;  4JK1 X;  1XB4 A;  3DTK A;  1KZH A;  4A3D J;  3G3Z A;  4I98 B;  5DUK A;  1RR7 A;  1HW2 A;  1Z21 A;  3ZQL A;  2ZO4 A;  1SVO A;  1P4X A;  2Q2E B;  2V1N A;  5L3F A;  4HEA 2;  4MEY F;  4BY1 J;  2VBW A;  2EFN A;  4FHT A;  3AG3 H;  2F2E A;  5LEK A;  1WGX A;  1D8J A;  4KJZ A;  3FM3 A;  3MVP A;  4IRI A;  1ETK A;  1GV5 A;  3CP2 A;  5J3L A;  4EJU A;  1PUE E;  1R36 A;  1CF7 A;  2CV1 A;  4EJT A;  2E2J J;  1FY7 A;  3F6V A;  1J0R A;  5GAG J;  2K9S A;  4ESB A;  2E1C A;  3GLL A;  4NUB A;  3L00 A;  4JX5 A;  3BCB A;  2NXN B;  1MH4 A;  4G94 A;  3GTL J;  3E5Q A;  4AUX A;  2KRF A;  1G8X A;  1TTY A;  4EMS A;  2Z9O A;  2XDV A;  3VYT B;  4XKB A;  3UR3 C;  2XRO A;  1XX5 A;  5BPD A;  1P4W A;  3JW4 A;  1QA6 A;  1QZE A;  1B1B A;  2D1H A;  1RET A;  1ZRF A;  3EQL F;  2PI0 A;  2WTE A;  4UHT A;  3GFM A;  4Y52 J;  4PK4 A;  3HIF A;  1L3L A;  4I02 A;  4F52 A;  1VQ9 I;  1I3A A;  2CW8 A;  3VSL A;  3GTK J;  1XSX A;  5EG0 A;  1MH3 A;  2FQ4 A;  2M0C A;  5E8I A;  4WF2 A;  5AON A;  3MZY A;  5D8K B;  2YX7 A;  3IL2 A;  3SEQ A;  5D5X B;  3LSH A;  4P5O A;  1SD6 A;  5GP9 A;  2X1C A;  3X2Q H;  2TRT A;  5HLH A;  4AIJ A;  5FD5 A;  2ACJ A;  4EM1 A;  1DP3 A;  3TOA A;  4XSZ F;  4OAY A;  1EH7 A;  2E7X A;  1UCR A;  1MMN A;  2P6S A;  5FLV A;  2O03 A;  3SFZ A;  3CP8 A;  1EA3 A;  4KN7 X;  1YYV A;  2RN7 A;  3DP7 A;  3LAJ A;  2VOO A;  4O3M A;  5HS8 A;  1MMD A;  4LG3 A;  1IV8 A;  5KHD A;  3LSG A;  2NNN A;  4HYE A;  1YJN I;  1HCR A;  5CJ9 A;  4XID A;  2L02 A;  1UG2 A;  2XRL A;  2X4H A;  2L9R A;  4HAM A;  4XM3 A;  4DJA A;  1HKS A;  3VB2 A;  3DWL E;  4W1U A;  1JUP A;  4LFU A;  3K1N A;  3F8C A;  4QSH A;  2DYR H;  4A3C J;  3F0C A;  3IUO A;  3BP8 A;  4EAT A;  4IHS A;  1WI3 A;  2FBH A;  3TDU C;  1QVU A;  1SFE A;  3PL8 A;  3DEU A;  3ULQ B;  4EJV A;  2JVH A;  4M9S A;  1W7P D;  1DGR M;  4A2U A;  2ZJP F;  2HWV A;  1U0J A;  1TWA J;  3I3L A;  3H3Z A;  3MQ0 A;  2EQR A;  4IQJ A;  1XGS A;  2A3S A;  4EQQ A;  5BOX A;  4L9V A;  3N4M A;  1MMS A;  2D45 A;  1JKP C;  4KT6 A;  5BS6 A;  3J7Y J;  2BHZ A;  3HUG B;  3BTC A;  4L9N A;  2WA0 A;  1FP1 D;  3I58 A;  2ECB A;  3I5U A;  1NTC A;  1RNL A;  3HL2 A;  4P1W A;  1ZRE A;  1RKW A;  1XGO A;  3FXR A;  1JTX A;  1AOY A;  4U0Y A;  5IT9 K;  3G71 I;  5K1Y A;  4CIC A;  2HDW A;  1WQ2 A;  1T56 A;  2HTS A;  3HRU A;  1JXS A;  1GHC A;  1S7E A;  2VI6 A;  3VDX A;  1RZ4 A;  4OWR B;  2BXY A;  5FB2 A;  2XAJ A;  2XV4 S;  3DEW A;  3BPV A;  5JLX A;  5E3M A;  3R4K A;  3LAP A;  1ZG1 A;  1YOV B;  1H0M A;  4ZDO A;  3QPS A;  4S04 A;  1FZP B;  4JQF A;  4DYR A;  1BI2 A;  1YO5 C;  1U5T A;  2IS1 A;  1B9M A;  3FKI J;  4U0V A;  3BOQ A;  3D5R C;  2M7A A;  3VYR B;  2DA6 A;  3DKX A;  2E60 A;  4HSR A;  4BNC A;  3WTW C;  3NAR A;  4E7I A;  3LA3 A;  3S2W A;  2VJ5 A;  5LGT A;  2L9V A;  4OOI A;  5HLG A;  4IHX A;  1OCP A;  2EFW A;  1UEL B;  1ZEL A;  5EGO A;  1U5T B;  4M71 A;  3HTU A;  1R9T J;  3JSO A;  4BE2 A;  2K9N A;  1AWC A;  4Y7N J;  4MO7 A;  3BZK A;  1FIA A;  2OQG A;  2ZXJ A;  3MN2 A;  4MNU A;  2Z1D A;  3FHZ A;  2JRM A;  3C18 A;  2EZI A;  4KIG A;  3PNV A;  1OR7 C;  1TNT A;  2FBK A;  5CVU A;  1X19 A;  3TO6 A;  2L01 A;  2LBF A;  2D2W A;  2VUM J;  5EEA A;  1W7P A;  1MMG A;  2OUM A;  4CO8 A;  3HB9 A;  2M4G A;  5EGO B;  1SD5 A;  4JX4 A;  4M6Y A;  2PN6 A;  1LJ9 A;  1QZZ A;  3VSK A;  2CWE A;  2R4G A;  1UHS A;  2I8D A;  3H0G J;  4IX7 A;  2QM3 A;  2EZK A;  1TQP A;  4YRV A;  3F8B A;  1GLN A;  3RYP A;  5ILS A;  3OYM A;  3PQJ A;  4A3I J;  4KT5 C;  3JSP A;  1MMA A;  2B7E A;  4PZJ A;  3WG9 A;  3V8L A;  3BJO A;  3FXJ A;  1PP8 F;  1XG1 A;  3S17 J;  2IAI A;  1KA8 A;  1NG6 A;  2QF7 A;  4DYC A;  4XKV A;  2M1B A;  2GOM A;  2LLK A;  3BC8 A;  2VT3 A;  3V7R A;  3ZOB A;  2JPC A;  1RUN A;  5F0H A;  3CCE I;  2F4M B;  2VLA A;  4II2 A;  4XN3 A;  2MD0 A;  1OKR A;  5J4V A;  4YIF A;  3K70 C;  1Z77 A;  2L4M A;  3KEY A;  2X1D A;  5E3N A;  4Y15 A;  2DA2 A;  2JA8 J;  4CXF A;  3KYC B;  3LQR A;  3K2A A;  3FXL A;  1JUM A;  3S3N A;  5FKK A;  4RB3 C;  2DFI A;  4F7Z A;  1FTT A;  1MBF A;  4OIP F;  3FKJ A;  1L0O C;  4BBS J;  4D7M A;  4GFB A;  4I6Z A;  3K70 D;  2W1O A;  4KIS A;  1IDZ A;  1USS A;  3C2H A;  1ZGW A;  3WTX C;  3I54 A;  4BAC A;  1OYY A;  2ZC2 A;  6PAX A;  4ZDL A;  5LHI A;  2LNB A;  4LG0 B;  4FT8 A;  1AU7 A;  4XIC A;  2VPL A;  2Y31 A;  2VE8 A;  1M1E B;  2CUF A;  1KU3 A;  1MBG A;  3HOV J;  3OY9 A;  3ELK A;  4PDK A;  2H94 A;  4IL6 C;  3MMY B;  5IY5 H;  3DU6 A;  2QCO A;  2G0E A;  4B8X A;  5ED4 A;  2AXL A;  2W82 A;  3S15 J;  5DS9 A;  1SC7 A;  4A3K J;  3MKZ A;  4BEH A;  3DKW A;  2F5D A;  3CF2 A;  3ZCO A;  2IJL A;  3IH4 A;  4XK4 A;  2DOE A;  3GVA A;  5DYM A;  4LLL A;  2Z33 A;  4NBQ A;  2DJI A;  1D0X A;  1E2X A;  4P9F A;  4PJM A;  3OS2 A;  3OYL A;  3PFI A;  3KFW X;  3AL0 B;  4Y33 A;  4R8H A;  1V54 H;  3K4K A;  4EM0 B;  4L5E A;  4Y17 A;  3R0A A;  3CJN A;  2DLL A;  2GBY A;  4L5I A;  1OR7 A;  2HVQ A;  4BEH B;  4L0Y B;  1ZK8 A;  1Y1V J;  4I09 A;  5GAD J;  5FRN A;  1STZ A;  2ZFU A;  2R5Z A;  2AXT C;  3A0H C;  2BE5 F;  3CCJ I;  4XN0 A;  3JR9 A;  3F72 A;  2H1L A;  2Y0S A;  2COM A;  1DU0 A;  2DA5 A;  1BJZ A;  2NYX A;  4XLA A;  3OYI A;  1N78 A;  1O7L A;  2DU9 A;  3QYE A;  3WE2 A;  4AD9 A;  1IAW A;  4XBF A;  2MW8 A;  3BR0 A;  3DV8 A;  3QPT A;  1LEA A;  4OIO F;  3R60 A;  4HLX A;  2CQX A;  3BG6 A;  3GZ6 A;  3FXM A;  3CC2 I;  4RM3 A;  2R5Z B;  3BQZ A;  1FC3 A;  3HEF A;  3CCR I;  2WB1 N;  2EA2 A;  3E6M A;  2F4I A;  3SQN A;  3DF8 A;  2K5C A;  2M0M A;  1MSF C;  3BR1 A;  2O7O A;  2HZT A;  3GX4 X;  2MC4 A;  3SZT A;  3ISP A;  3ABK H;  1WJD A;  2CUZ A;  2XKP A;  2Z16 A;  5J8C A;  1OJL A;  2K86 A;  2VE9 A;  1MW7 A;  5LHG A;  1G3Y A;  3QOD A;  4B09 A;  1BR1 A;  3WU2 C;  4CH7 A;  1X4P A;  2O61 A;  3BWG A;  2O5R A;  5TJJ A;  3S3O A;  3OIO A;  3KZI C;  2LRD A;  5CYV A;  4IEJ A;  2EV6 A;  2FOK A;  3FMR A;  1VQM I;  2P7C B;  2ZCW A;  1TQI A;  2G7H A;  2LG4 A;  3K1P A;  3S2D J;  3KZZ A;  5JR3 A;  3LSR A;  1TQM A;  2ICW G;  5LHH A;  3FF5 A;  3EET A;  3HRM A;  1GUU A;  3J80 K;  1MGT A;  4PGG A;  4RS8 A;  4UUV A;  2QSF X;  3JTG A;  1BC8 C;  1BR2 A;  2O8K A;  1BW5 A;  3RZO J;  3KP7 A;  3BPX A;  3K4J A;  2HKO A;  4R79 A;  3W6V A;  5F27 A;  1F1Z A;  2D1V A;  3MKW B;  2OCC H;  1V5F A;  2DFH A;  1R23 A;  1TP4 A;  3NRV A;  1XMX A;  2AO9 A;  3KIO A;  2UWM A;  1SAN A;  1D5V A;  1WZ2 A;  2BEO A;  1ENH A;  4E4H A;  4AYB N;  5LRR A;  2FQ3 A;  2HS5 A;  1Z6R A;  2KRH A;  4CSW A;  2PX9 A;  3M8J A;  4XNF A;  2QQ9 A;  2ZME C;  2LTP A;  3ASO H;  1TW2 A;  3QPL A;  3TKY A;  3G4S I;  3G73 A;  2X6X A;  5D6F A;  2MYS A;  4XL9 A;  3LSI A;  4O5V A;  4ABZ A;  1W0U A;  1H89 C;  4CCM A;  1BIA A;  4Q4Z F;  1XDU A;  4IHT A;  1FPQ A;  2KIM A;  4RAZ A;  3FMQ A;  3ZQG A;  4F92 B;  3ZMU A;  4DGW B;  1V3F A;  3OYK A;  1TL8 A;  5LLQ A;  4IQ4 A;  3O2P E;  3PM1 A;  2O6G E;  4M3E A;  1WKM A;  3HPH A;  4ZJZ A;  4OMY A;  1K83 J;  2P8T A;  2OA4 A;  3IRR A;  3DCF A;  4UY8 I;  3SYT A;  1DUX C;  4XOT A;  3CJR B;  4WXH A;  5B3S H;  5BMZ A;  4GRI A;  2WC2 A;  2IS4 A;  3DTE A;  4G8X A;  4DZJ A;  2PJR A;  3K4L A;  3W3C A;  3IWF A;  4LD5 A;  1J75 A;  4KDP A;  1IGN A;  3KP5 A;  1QBJ A;  1J59 A;  3PIP F;  1GXP A;  1R00 A;  5CKT A;  1GT0 C;  1U78 A;  4A3E J;  1MBE A;  2IW5 A;  1XDS A;  2IEK A;  3BG5 A;  3BTI A;  3B73 A;  4HA8 A;  4FQG A;  1RC9 A;  3GW2 A;  2BY0 A;  2R3S A;  3W2V A;  2PJR B;  4M6V A;  2KJB A;  4MQV A;  3NEU A;  1X1D A;  1XGM A;  1GVD A;  2K4B A;  4L18 B;  4BY7 J;  2BVL A;  2L7K A;  3K9T A;  4RB2 C;  4QTR A;  3FHN A;  4M9X A;  4NQW B;  1QPI A;  3R6S A;  3I4M J;  4ENK A;  2M7B A;  2Y2Z A;  4IF4 A;  2Z5U A;  2QBY A;  5DUI A;  1RES A;  1LDK B;  1G6N A;  3CCQ I;  1Y39 A;  2C6Y A;  1LVA A;  2EV5 A;  2ZKZ A;  4ZZL A;  3ERE D;  1DU6 A;  2HXO A;  5IOY A;  5E18 F;  2JJ7 A;  2IA2 A;  3QOE A;  2DK5 A;  2P81 A;  4CCN A;  2VC1 A;  3ECO A;  4BQQ A;  2XAU A;  5D4S A;  2HFH A;  1D1C A;  1YHQ I;  1QHH D;  1G59 A;  4B1R A;  1F36 A;  2QVO A;  4B4C A;  1XSD A;  2ECC A;  1J7K A;  3MCZ A;  1BC7 C;  3H5R A;  1R1T A;  1PUF B;  2JA7 J;  2YR2 A;  3FXO A;  1O3R A;  1IN7 A;  1FYM A;  2IS2 A;  5GTH C;  2YX4 A;  1JHF A;  4MTE A;  2DYS H;  1VFC A;  3SDG A;  4ZC3 A;  2AQE A;  2NOJ B;  1Z7L A;  4M3G A;  4DOZ A;  3LST A;  4A3B J;  2XPW A;  2V4J C;  3GFL A;  4A6E A;  4N4N B;  2R7X A;  2WAE A;  1XCV A;  2DFE A;  2GM4 A;  1TBX A;  1ONV A;  2IA1 A;  1O3T A;  2HXI A;  3U1D A;  1IG7 A;  4XRS G;  5FO5 A;  1V5G A;  2VAS A;  3RDI A;  2XHK A;  2M8E A;  4D5C A;  2F4O B;  2M3A A;  3IV5 A;  2R7V A;  4NC6 A;  2A69 F;  3V42 A;  1IW7 F;  1D1B A;  1OQY A;  2KT0 A;  3RPU D;  4L9T A;  1MBH A;  4N9H A;  2PG4 A;  2CV0 A;  5DV5 A;  2AQF A;  3F3X A;  2XUB A;  2Y9Z A;  1ZGA A;  5ILU A;  4PFP A;  4FAS D;  4QLC U;  1JKQ C;  3IWZ A;  1SD7 A;  4BQN A;  3M4O J;  3WTS C;  2WV0 A;  2EIL H;  2P5K A;  2Z99 A;  3N05 A;  4BH9 A;  1JT0 A;  2FA5 A;  4N0B A;  4UV8 A;  2VOD A;  3GTG J;  1NH3 A;  5KCM A;  1XGN A;  3OSG A;  4Y13 A;  1LFP A;  2A6E F;  2NS7 A;  3Q0W A;  2GZW A;  2NVT J;  3I53 A;  2GOX B;  1LDD A;  1KQ9 A;  3RQI A;  3MWM A;  5F1R A;  2HGC A;  1FNN A;  5ILV A;  5AIQ A;  2I10 A;  4A3G J;  3E6D A;  3FDY A;  3HJE A;  3C7J A;  3T8R A;  4D0P A;  1E3P A;  1R22 A;  2BOL A;  2F5E A;  2Z2S B;  5HDG A;  3OYJ A;  2L54 A;  2JQ7 A;  4HX4 A;  2HNH A;  4NDL A;  2L5Q A;  2DT7 B;  2VIX A;  3F8M A;  1MDM A;  3RYR A;  3REO A;  2K9M A;  3PIO F;  1R6R A;  3KX2 A;  3PJR A;  3LWF A;  2HYF A;  2F6C A;  4ESJ A;  3BR6 A;  2DMT A;  3ZQC A;  1U9O A;  2PEX A;  3JAM Z;  1PJR A;  3O8G A;  5J1Y A;  1LB2 A;  1X3U A;  4HDU A;  2E35 A;  2EIK H;  4P9U A;  2LF8 A;  2VJJ A;  1KQ0 A;  1RPW A;  1W5S A;  2QEX I;  1MDM B;  2HQN A;  2O8X A;  1IRG A;  2CO5 A;  4BXU A;  3TOB A;  2ELH A;  2PMH A;  2CUJ A;  2EBI A;  2LR8 A;  2EJR A;  2PMZ A;  1VQ7 I;  3GXO A;  3OR1 C;  5D4R A;  1K7A A;  4X0G A;  1I27 A;  3GF2 A;  3FBN B;  4ZYA A;  5CQG A;  3QP6 A;  1E3H A;  3H9Q A;  5C44 J;  3O6B B;  4U7B A;  1S3J A;  2MBF A;  1T95 A;  2KZG A;  2QQ8 A;  4ZYG A;  1ZAR A;  3RPU A;  2K9L A;  1K6Y A;  2FRH A;  3KP4 A;  4ZTJ A;  1O3S A;  3IH3 A;  4RGU A;  2ISY A;  2HQA A;  1FBU A;  3OL3 A;  3ZQI A;  3G6E I;  3O3K A;  5LRS A;  4ZYD A;  3FM5 A;  1XTA A;  2YU3 A;  3CO6 C;  3T8T A;  1OCO H;  2HR3 A;  5K5Q A;  1WJC A;  1EH6 A;  1IXS B;  3ZR8 X;  3H92 A;  3FIW A;  1U5T C;  1UST A;  3FXU A;  1BI1 A;  3H36 A;  3J7Z I;  1F4K A;  2KJC A;  2EFQ A;  1KON A;  3ZN0 A;  1WJB A;  3I71 A;  4GYG A;  2E1M B;  2KDZ A;  1Y6I A;  1X58 A;  5DM7 F;  1ORK A;  2RNG A;  2YUS A;  4ENN A;  4IO9 F;  3GEZ A;  2CU7 A;  2STT A;  2HPI A;  4G9Y A;  4IHV A;  2VON A;  3G1L A;  3RJP A;  2DQL A;  2MSY A;  2BBY A;  4Z6Y A;  1ERD A;  2ZBK A;  4G7H F;  1RR8 C;  1WCM J;  4ETS A;  3P9I A;  1YTY A;  3HDD A;  1K61 A;  2R5Y A;  2QLZ A;  1FP2 A;  4BHB A;  3L1P A;  3GTQ J;  1MIJ A;  1P7I A;  3BZ6 A;  3C3W A;  2M87 A;  1B8I A;  5FLX Z;  2RKH A;  3F9K A;  3K10 A;  2NVX J;  4XOR A;  2VKH A;  1HA8 A;  1ZYR F;  4ENJ A;  3J81 K;  4F3Q A;  4XR6 A;  2V9K A;  2V6E A;  5L3D A;  2DA4 A;  1KYW A;  1QZY A;  3V7C A;  4U7D A;  2DMU A;  1HXD A;  4IJA A;  4E7K A;  5FGM A;  1BL0 A;  2M2E A;  3HBL A;  2R5Y B;  3VPR A;  1P6R A;  3Q9V A;  3CQZ J;  1B8I B;  2MC3 A;  3HC7 A;  1H8A C;  5FKN A;  2OF7 A;  2Y75 A;  5J47 A;  4XON A;  3HUG A;  1KYZ A;  4A0Y A;  3OYB A;  4MFE A;  1TWC J;  3L7W A;  1N77 A;  1HQC A;  3M8E A;  1Z0X A;  4BHP A;  3DFG A;  1YW8 A;  2CQQ A;  2OZU A;  4E7Z A;  1FIP A;  3OOU A;  3MEX A;  1W36 D;  3EUH C;  2GXG A;  2HOT A;  4DIQ A;  5E17 F;  2TDX A;  1J9I A;  4QPQ A;  5GTI C;  1Z1D A;  2KPM A;  3BCA A;  3LOC A;  2MG4 A;  3WE3 A;  3J7A Y;  2F48 A;  4AWX B;  1C0W A;  1V4R A;  1VQ8 I;  5CVV A;  1VQN I;  1IN5 A;  3PUB A;  1X1P A;  2XIG A;  3RZD J;  3ZMV A;  1BM9 A;  3FMS A;  1WHU A;  5L3C A;  3CCU I;  1BIB A;  4XKW A;  3OIQ A;  5EEG A;  2XVC A;  3RSN A;  3K1M A;  2DMQ A;  2OD5 A;  1T6S A;  3VEP A;  4LB5 A;  4PCQ A;  2NS8 A;  2VT2 A;  2LC2 A;  3PNY A;  3FBI B;  1I50 J;  2EZH A;  3OIP A;  2JSC A;  3ML6 A;  1ETY A;  3ECH A;  4RAF A;  3U2R A;  3HOX J;  2FEZ A;  4RAY A;  2FXA A;  4U88 A;  3PUF A;  3EDP A;  3AL0 C;  3RTR A;  3HOW J;  4AID A;  3QAH A;  2R7R A;  2R7O A;  5J6X A;  1FOX A;  2EK5 A;  1MD0 A;  5DD8 A;  3B02 A;  2V9P A;  3ABL H;  2YSR A;  3ERM A;  1X3Z B;  2L9N A;  3U9G A;  4XMY A;  2LKX A;  4UVB A;  3CCY A;  4N9I A;  1YJW I;  1R71 A;  2DAO A;  2W24 A;  4XLE A;  2WV1 A;  4GYI A;  3VYS B;  1Q1V A;  3M8F A;  1GDT A;  2V79 A;  4KIB A;  1PYV A;  3WGG A;  5E79 C;  3Q3S A;  1S72 I;  2A68 F;  2X48 A;  3CLO A;  2L7Z A;  4HV6 A;  3CD6 I;  3GWZ A;  2QKL B;  5J4Y A;  5LGU A;  5JLW A;  1ZQ3 P;  3R0J A;  1DQU A;  1FTZ A;  2UXN A;  2QSG X;  2DW4 A;  1Y1W J;  1QU3 A;  3CZ6 A;  4RGX A;  3RKX A;  2PFB A;  2V1D A;  4XLP F;  3RCO A;  3OSF A;  4PSW A;  5LFA A;  4LIV A;  5HS9 A;  5FJ8 J;  2M30 A;  1N25 A;  4XLH A;  4BGD A;  1NG7 A;  2DTR A;  4IPA A;  5HS7 A;  2QUF A;  3SZG A;  2FUG 2;  3I59 B;  3PQK A;  3BR2 A;  2EZL A;  2W4S A;  1IO2 A;  2UUZ A;  4XLF A;  5FFX A;  5ICG A;  3SZP A;  3L2U A;  1S8N A;  3OR2 C;  4BQO A;  2J5P A;  2R93 J;  4C9Y A;  2XSJ C;  1A35 A;  2VQH A;  4XLC A;  1XS9 A;  1T0F C;  2FMY A;  2KIF A;  3EUH A;  2GIZ A;  4UB8 C;  5IYB J;  1ZG5 A;  5IT9 Z;  2WAQ A;  1B72 A;  3SHF A;  1H9G A;  2DOD A;  2BW3 B;  2MLG A;  4CCL A;  2R7T A;  4M9Z A;  2IA0 A;  2MLK A;  2STW A;  4BXX J;  4A0Z A;  1SD4 A;  3A2K A;  2EWN A;  3M07 A;  3C1D A;  4HQE A;  4LG0 A;  3IRQ A;  3ZMS A;  1CGP A;  4D1Q A;  1WSU A;  2CH0 A;  5IYC J;  2R7Z J;  2LMD A;  3Q0V A;  4B43 A;  3GFI A;  3T5X A;  1B72 B;  1FOY A;  2JZY A;  2JA5 J;  1WJF A;  2WY7 Q;  4H4K C;  1LEB A;  3JTH A;  5H6Q A;  2RQQ A;  4NHJ A;  3KPH A;  4FX0 A;  4NC8 A;  1I1G A;  3ZMZ A;  5KAF C;  1S5L C;  1VQP I;  1U3E M;  2E71 A;  4I2O A;  2H6C A;  4ZZD A;  3RI4 A;  3ROU A;  1YS7 A;  2KHM A;  3GLX A;  5C3E J;  3LFK A;  4CYD A;  3CF5 F;  1VQ6 I;  2IGN A;  3IHU A;  2ZJR F;  2NRA C;  4EV0 A;  2VJI A;  4Z2Y A;  1DPR A;  3HPG A;  4BHC A;  5DDG A;  2LYC A;  3L2R A;  1I6H J;  1S9H A;  4A3F J;  4KA4 A;  4RB0 A;  4KIF A;  5E3L A;  5E1X A;  1VND A;  2CGP A;  1D0Y A;  3E5U A;  1LFB A;  5ICC A;  3HRS A;  1HKT A;  1ZGJ A;  2Q1Z B;  5HVQ C;  2E34 A;  2VPR A;  1R49 A;  3KLN A;  3TW6 A;  1TLH B;  2Y0S N;  3QWL A;  4KMF A;  1FWZ A;  3UNG C;  4LLN A;  4EGY A;  4DNC A;  1GV2 A; 
#chains in the Genus database with same CATH homology
 2OPT A;  1GT0 C;  1U78 A;  1IDY A;  4A3E J;  1MBE A;  3BT9 A;  2IEK A;  3BG5 A;  4JP0 A;  3BTI A;  4BY1 J;  4M6V A;  3BTL A;  2DN0 A;  1WGX A;  1H88 C;  3GTP J;  3MVP A;  1GVD A;  1ETK A;  4BY7 J;  1GV5 A;  5J3L A;  5IP6 A;  1T33 A;  4QTR A;  4B3A A;  1JJ6 C;  1QPI A;  4MIM A;  2E2J J;  1X2N A;  4RBO A;  3I4M J;  2Y9Y A;  2CRG A;  2Y2Z A;  5IOZ A;  4BKX A;  2K9S A;  1F43 A;  2LVS A;  4JX5 A;  4IHY A;  1RES A;  1DU6 A;  1MH4 A;  4C3J J;  3GTL J;  4AUX A;  3BG9 A;  2HXO A;  1JUS A;  4C2M J;  3D1N I;  1MNM C;  3LNQ A;  5IOY A;  1FJL A;  2VKV A;  2JJ7 A;  1A5J A;  2P81 A;  2D5V A;  1RET A;  4I76 A;  5F08 A;  2HYJ A;  4Y52 J;  3O8H A;  4B1R A;  1F36 A;  4B4C A;  2ECC A;  4FE7 A;  1ETO A;  2ID3 A;  2JA7 J;  3GTK J;  1PUF B;  4FE4 A;  5EG0 A;  1MH3 A;  1ETQ A;  2FQ4 A;  3SFI A;  2M0C A;  3HOU J;  4MLO A;  3WHC A;  1VFC A;  3QQA A;  3SDG A;  5GP9 A;  1VI0 A;  4M3G A;  2TRT A;  4A3B J;  2XPW A;  2WAQ N;  2GM4 A;  1JGG A;  2E2I J;  4A3M J;  5FLV A;  2HXI A;  5IP7 J;  4XRS G;  1IG7 A;  4V2G A;  1WPK A;  5BNG A;  1OFC X;  2JN6 A;  4D5F A;  5EYR A;  4V2F A;  3A01 A;  4D5C A;  5K7Z A;  3IV5 A;  2KT0 A;  3LSG A;  5HOD A;  1HCR A;  1WH7 A;  1MBH A;  1ZKG A;  2JWT A;  5EDN A;  4XID A;  1UG2 A;  2XRL A;  2Y9Z A;  3B6C A;  3C2B A;  1QVT A;  1JKQ C;  2L9R A;  3A01 B;  3TED A;  3M4O J;  4W1U A;  1JUP A;  3PO2 J;  2L0K A;  4QSH A;  1JT0 A;  4A69 C;  4A3C J;  1TWG J;  3F0C A;  3GTG J;  4CYC A;  1WI3 A;  5IYD J;  5E3O A;  4HNV A;  3OSG A;  1E3O C;  2NS7 A;  1QVU A;  5EZH A;  3Q0W A;  5C4X J;  2NVT J;  3RQI A;  2FX0 A;  1ZR2 A;  3HOY J;  1TWA J;  2I10 A;  4A3G J;  1TWF J;  3JRB A;  3TP0 A;  2EQR A;  2K9Q A;  3MKL A;  1UMQ A;  4NDL A;  4CYC B;  2RAE A;  3HOZ J;  3I4N J;  1HF0 A;  2ME0 A;  4J19 A;  2LFB A;  1JKP C;  1BW6 A;  3BTC A;  3BR6 A;  2DMT A;  2ECB A;  1NTC A;  3ZQC A;  1IC8 A;  1U9O A;  4M3B A;  5EZG A;  1RKW A;  2MGQ A;  1JTX A;  3O8G A;  3A03 A;  5J1Y A;  2HOS A;  1T56 A;  1TWH J;  3ZQF A;  1RPW A;  1S7E A;  2VI6 A;  2IBD A;  5F0F A;  2HDD A;  2EBI A;  2B63 J;  3S1M J;  3BR5 A;  3DEW A;  5JLX A;  5E3M A;  5M3F J;  2LR8 A;  3QPS A;  5J1R A;  2E1O A;  1LE8 A;  4DYR A;  3S1N J;  4UUT A;  3FKI J;  2AHQ A;  4DW6 A;  2JMW A;  4G12 A;  5C44 J;  3UKG A;  2DA6 A;  1G2H A;  1MBK A;  3TW7 A;  1PUF A;  3NAR A;  2Y30 A;  1IUF A;  4M3D A;  3IH3 A;  4IHX A;  1OCP A;  1OCT C;  3ZQI A;  3HGG A;  4LOC A;  4X6A J;  1LE8 B;  2LY9 A;  5EGO A;  9ANT A;  2FJ1 A;  1R9T J;  2K9N A;  5FKO A;  4Y7N J;  4MO7 A;  5GPA A;  5K7F A;  3FIW A;  1FIA A;  4DZP A;  3MN2 A;  1JT6 A;  5J1U A;  2EZI A;  2HI3 A;  3IH2 A;  1ETW A;  2X9D A;  3JRC A;  2KDZ A;  2VUM J;  5EEA A;  1X58 A;  1ORK A;  3HB9 A;  5EGO B;  2M8G X;  2YUS A;  4JX4 A;  2XPV A;  1UHS A;  4IHW A;  3H0G J;  4A93 J;  2XSD C;  4QIW N;  2CU7 A;  1MSE C;  2EZK A;  4FTH A;  4IHV A;  2DMN A;  3G1L A;  1HLV A;  2MSY A;  1WCM J;  4D7N A;  2W48 A;  4MFD A;  4A3I J;  3HDD A;  5F1J A;  1K61 A;  2DA3 A;  2R5Y A;  3L1P A;  3GTQ J;  1P7I A;  1B8I A;  1XG1 A;  3S17 J;  2IAI A;  2QF7 A;  4DYC A;  2NVX J;  2LLK A;  3RKQ A;  3FIS A;  1JTY A;  1YRN A;  3JRE A;  1MBJ A;  1JJ8 C;  3ZOB A;  4X1E A;  5M5X J;  5F0H A;  3G1M A;  5FLM J;  2DA4 A;  4EEF G;  3LSJ A;  4AC0 A;  2DMU A;  1Z77 A;  2ZB9 A;  1BL0 A;  2M2E A;  3FK7 A;  3HBL A;  3VPR A;  2R5Y B;  5E3N A;  3CQZ J;  2LD5 A;  1B8I B;  2X6O A;  2DA2 A;  2L7F P;  1H8A C;  2JA8 J;  3K2A A;  5FKN A;  1JUM A;  2OF7 A;  5FKK A;  4C3I J;  2M34 A;  1QRY A;  3JRI A;  1YRN B;  1ZTR A;  2XPU A;  2E19 A;  3TP3 A;  1FTT A;  1MBF A;  2ID6 A;  4MFE A;  1HDD C;  1TWC J;  2TCT A;  5M5W J;  1VF9 A;  1Z0X A;  4BBS J;  4D7M A;  4GFB A;  4I6Z A;  2CQQ A;  1IDZ A;  1FIP A;  3ZQH A;  3OOU A;  4JX6 A;  3JRG A;  1ZGW A;  4A3J J;  2HOT A;  2XGC A;  2DA7 A;  3GTO J;  3GTM J;  2LP0 A;  2CUE A;  2XB5 A;  1AU7 A;  3LOC A;  4XIC A;  2MG4 A;  3GTJ J;  2Y31 A;  1X2M A;  1CQT A;  2CUF A;  1MBG A;  1A6I A;  1AKH A;  3HOV J;  2PMZ N;  2O9L A;  3RZD J;  1ZR4 A;  1AHD P;  2NVQ J;  2NVY J;  3S1Q J;  2QCO A;  2G0E A;  3S15 J;  5DS9 A;  5IP9 J;  4A3K J;  3BR3 A;  5GPC A;  3IH4 A;  4XK4 A;  2DMQ A;  2DTZ A;  4XRM A;  2N8G A;  2NS8 A;  4RDU A;  1AKH B;  3E7L A;  1I50 J;  2EZH A;  4M3F A;  1ETY A;  4L5E A;  3HOX J;  4S0H B;  3SJM A;  2GBY A;  3JRF A;  3BTJ A;  3HOW J;  1XC5 A;  1ZK8 A;  3S16 J;  1Y1V J;  3BQY A;  2EH3 A;  2R5Z A;  1NK2 P;  1FEX A;  1W0T A;  5F04 A;  3JR9 A;  3HGY A;  2R0Q C;  3GBG A;  1APL C;  2FD5 A;  1DU0 A;  2DA5 A;  1BJZ A;  1JKR C;  3BG3 A;  2MW8 A;  3BR0 A;  1ETX A;  2LKX A;  1BA5 A;  3CCY A;  5K7H A;  1IRZ A;  5C4J J;  4BBR J;  2CQX A;  2L7M P;  4C3H J;  1U8B A;  2WV1 A;  1Q1V A;  3CMY A;  5M3M J;  2R5Z B;  3BQZ A;  1GDT A;  3S14 J;  3HEF A;  1EF4 A;  2COB A;  2WB1 N;  3WHB A;  4DYQ A;  2E2H J;  2DMP A;  3A02 A;  2M9H A;  3M3Y J;  5DTD A;  1MSF C;  3HKZ N;  3PO3 J;  3BR1 A;  3Q3S A;  2O7O A;  2X48 A;  2L7Z A;  5JLW A;  1ZQ3 P;  1FTZ A;  1ETV A;  1OJL A;  1POG A;  1U9N A;  1Y1W J;  5EF6 A;  3OSF A;  2YU9 J;  1TC3 C;  1HDP A;  3OIO A;  4IEJ A;  1I3Q J;  5FJ8 J;  1ITY A;  2VKE A;  3S2D J;  1P7J A;  2HOA A;  3LSR A;  2EZL A;  3BR2 A;  2YS9 A;  2XB0 X;  4UUS A;  1GUU A;  2LK2 A;  5EG0 B;  3HM5 A;  2R93 J;  3JRA A;  3K7A J;  2O8K A;  1BW5 A;  3RZO J;  5FKL A;  2HQ5 A;  4JYK A;  1XS9 A;  3W6V A;  5F27 A;  5IYB J;  2H1K A;  3G1O A;  1B72 A;  2DJN A;  3JRH A;  1HOM A;  2AO9 A;  1SAN A;  3LSP A;  1ENH A;  4AYB N;  4BXX J;  4W97 A;  4UUS B;  2LTP A;  2K40 A;  2CJJ A;  3QPL A;  4FIS A;  5M5Y J;  5IYC J;  2R7Z J;  1D5Y A;  3Q0V A;  2R92 J;  1O4X A;  2NOG A;  4ABZ A;  1W0U A;  1B72 B;  5IPA A;  1IV6 A;  2JA5 J;  2H8R A;  3NAU A;  1H89 C;  3H3V K;  1NK3 P;  3JRD A;  5F0C A;  4A3L J;  3ZQG A;  1RKT A;  1SFO J;  5C3E J;  3S2H J;  2JA6 J;  3PM1 A;  4M3E A;  5FKM A;  2GLO A;  2JK3 A;  1K83 J;  1JKO C;  1WH5 A;  2ME6 A;  3Q0U A;  3DCF A;  1I6H J;  4A3F J;  2XGD A;  2ELK A;  5E3L A;  2XGE A;  3B6A A;  1LFU P;  3FK6 A;  1VND A;  1IJW C;  4XRS A;  4DZJ A;  1LFB A;  3S1R J;  4FCY A;  3CDL A;  4A3D J;  2VPR A;  1IGN A;  3TW6 A;  2Y0S N;  1RR7 A;  2DA1 A;  3ZQL A;  1GV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...