3A1YA

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
MEYVYAALLLHSVGKEINEENLKAVLQAAGVEPEEARIKALVAALEGVNIDEVIEKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein P1 (L12P)
total genus 20
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3a1yA00
2LBFA 4BEHA 2LBFB 4BEHB 3A1YA 2W1OA
chains in the Genus database with same CATH superfamily
3SQNA 1N25A 1V55H 5F6FA 4LG0B 4A3GJ 2IRFG 5AIQA 3I55I 5J3LA 4NQWB 4HNVA 3TKYA 1YRNA 3E3VA 2VT3A 1Z05A 2L0KA 4AWXB 1EA3A 3HG9A 3VYTB 4D1QA 1NHAA 5LGTA 4KT6A 2H8WA 2DI3A 1OCZH 1BIBA 2DCEA 2EA4A 3GO5A 3W6VA 3OSFA 2QENA 2P5KA 2RNGA 3F72A 3G2BA 2EFNA 3LSGA 2JA5J 3RPUD 4IRIA 1BBYA 4HBLA 1R23A 4EJWA 3K6GA 2DJNA 1IC8A 1JKOC 2R7FA 5H2FC 3DKXA 2IPQX 1OCPA 4CCJA 3OYCA 1XG1A 2XPWA 2QM3A 2P7VB 4A2UA 4I09A 4WK8F 2AXLA 3EPZA 2M8EA 3PIPF 1P9QC 3GLXA 3QPTA 4MLOA 4CCOA 5LGUA 4A5MA 3JRAA 4D5FA 1GV2A 5IYBJ 3OMYA 1A04A 2FOKA 3FIWA 3MKWB 5FRNA 3CC2I 2K40A 1KGSA 1G8XA 3DPTA 1XDUA 1BM9A 2CUZA 3FBNB 3FZVA 3GMEA 2TRTA 1YYVA 5JHFA 5M3FJ 3KP6A 2R7TA 1MMDA 2O3FA 1NTCA 3CC7I 4A3KJ 2OCEA 1M1EB 2CUJA 1QGPA 2HQAA 2FQ4A 1JGSA 5BQTA 1UMQA 1R49A 2HVSA 3C2HA 4E70A 1X3ZB 3BROA 2DTRA 3RSNA 3M07A 4LG3A 2EK5A 3H9QA 4G6QA 4FT8A 1LPQA 3KFWX 3JW4A 1XS9A 1UFMA 3EUKL 1XSVA 2EFPA 4FTHA 4EGYA 3TW7A 1XGOA 1TT5B 1YLFA 2RREA 3ZQIA 2FNAA 2MA3A 4DBQA 3CCEI 4EM0B 1OR7C 3GWZA 1CF7A 3DBHB 5L3EA 1KYWA 3E0JB 5CVIA 4CZZA 2CW0F 3JRCA 3BG9A 4A69C 2KHMA 4BJ5C 3GFIA 2JA6J 4NDLA 2XIGA 3HOUJ 4X6AJ 3DCFA 4CGZA 3ZQLA 5KCMA 4ANJA 3BY6A 4ASNA 2ECBA 2Y0SA 1J7KA 2CSOA 1GV5A 2X6OA 3OR1C 3G73A 2RNJA 3IAS2 1FYKA 1RC9A 3BG5A 4N4NB 3TDUC 1B8IA 1ETYA 3CUQB 4ZZLA 3LAPA 1YW8A 4BE2A 2LLKA 2NXNB 2V9VA 2V6EA 3ERMA 3FXKA 2ETHA 3V42A 4ON0A 4HF1A 2QKLB 4A0XA 2JN6A 3UR3C 3H3VK 3ABKH 1R58A 2VBXA 1JT6A 1ETOA 1J59A 4MTEA 3HPHA 1MDMB 4JYKA 4FETA 2XVCA 2HXOA 3B02A 2HYJA 2XAUA 1O3TA 1TNSA 4OWRB 2ID6A 4I0BA 3GTOJ 1J2XA 3SJMA 3QRFF 2KFDA 3PJRA 4OIQF 2CW7A 3ONQA 1WRJA 4BNCA 2HQNA 1Z0XA 2WBMA 3KP3A 1W7PD 2EJRA 1RR8C 1WJEA 2YSRA 3I71A 2RKHA 3U9GA 3V4GA 3WTYC 3FISA 1ON2A 2F5EA 3BQZA 3ZMTA 1SVMA 2JT1A 2F2EA 4UHTA 3TOAA 1JHHA 3Q9VA 3MZHA 1F4KA 4A3CJ 1U5TC 5DUIA 2CUEA 1FBSA 4NNJA 2ELJA 2HKOA 2GAUA 3Q3SA 1TWAJ 4OIOF 1JUMA 4XKVA 2GQQA 3JSPA 4KA4A 2XRNA 3CO6C 4L5EA 2RN7A 2B9SA 2E71A 2BXZA 3H9GA 2OJED 3LMMA 2HI3A 1RRJA 2ESNA 3E7LA 3DLLF 2DT5A 2KRHA 5DS9A 3P7NA 3ULQB 1CGPA 1MJBA 2BHZA 3K70D 1YS6A 1XMAA 2VKVA 3OL4A 3W2WA 1YRNB 4A3LJ 5EEAA 1FY7A 3HRTA 1Z3YA 3MKZA 4IHYA 2CQQA 1IZ1A 2PQ8A 5FFXA 4RM3A 3HUGB 2KPMA 4RAGA 1JKPC 3KPHA 1X1PA 2QEXI 1JUPA 1HLVA 1S6LA 3KZIC 3O2PE 5CQEA 2Y2ZA 5TJJA 2BW3A 2PFBA 1AU7A 2MH9A 3BR5A 3FXMA 3M1EA 5DYMA 1ACIA 2HZDA 4HOBA 2ZNZA 1SVOA 4AD9A 1K83J 5GAGJ 1MH3A 1YS7A 3BJOA 2WAFA 1OYYA 1FT9A 2I10A 2XB0X 4BKXA 2WV1A 3SEZA 1VFCA 1JTXA 2IA2A 2G7HA 3GUDA 3S2HJ 3C2BA 2F4MB 4BQQA 2HQRA 4HEA2 1LVAA 3PO2J 1S8NA 2VUMJ 1F43A 1T38A 1W0UA 3H1CA 1IRXA 2GOMA 2UXNA 3CTAA 3JCUC 1DGWY 3S3MA 2IT0A 3K4MA 2OV7A 2JJ7A 3CP8A 3Q9SA 4QIWN 2GOXB 2ACJA 4WWCA 1NG6A 4DYQA 3EUHA 4XRFA 2JA7J 2NYXA 5EDNA 1FYLA 3JR9A 4RAFA 2XDVA 2DA2A 3MZ8A 2IXSA 4U88A 4XKCA 2WWYA 2FMYA 4ESBA 5LHHA 2BXYA 3E1SA 2PMZA 4GFBA 4LFUA 2M34A 5IPAA 2PLYA 5DTDA 1LJ9A 2BEOA 4ETSA 3S15J 4MQ9F 3UNGC 4HLXA 1HW5A 4UVAA 2K4BA 3U1DA 3LFUA 4QLCU 5DCFA 3MAJA 4XN3A 2EV5A 3VYSB 1YOVB 4UVBA 4PFOA 5M3MJ 2VJ4A 4AVPA 1FEXA 5D5VB 2VIXA 3SZGA 4GRIA 4P1WA 3CCMI 1HBXG 2QSHX 4M9ZA 3TO7A 5D5XB 1OYIA 4WF2A 4L9VA 4BDYA 4LITA 2RDPA 1R9TJ 1GXPA 1W5SA 2E5NA 1QNTA 1UG2A 2F5DA 1ZHFA 3VWBA 4M6VA 1BOBA 4M9SA 1LFBA 2VKHA 3LWFA 2LF7A 3V8LA 3MD2A 2WAEA 3F8MA 4E7LA 1ETKA 2M3AA 1E17A 5E8GA 3QODA 3OOPA 1EH7A 2KISA 2E19A 4I0AA 3G71I 3CO7C 1MDMA 3LSPA 1KU9A 2CFXA 1RETA 2DMPA 4Y33A 1VQPI 1QZZA 3CCLI 4C3JJ 2Q1ZB 1V5FA 2HFHA 3CF5F 1ZH5A 1O7FA 4I76A 2EINH 2M0MA 1HC8A 2M5WA 2CV0A 2VKDA 4ITVA 4UUSB 1P7IA 4CYDA 3RKYA 3W2AA 1UHWA 1FSEA 1DUXC 1VQOI 1AKHB 1D5YA 3SDBA 2DQRA 4A3EJ 3A4CA 4JBAA 3FF5A 3HGGA 1W36C 3WTTC 2BY3A 2OC6A 2EZLA 2I8DA 4U0YA 4XKWA 2HDWA 4GDFA 3T8TA 3CC4I 3LQQA 2ADUA 2TDXA 4P9UA 3O8GA 3TO9A 4RB0A 4BEHB 3WODF 3GTMJ 2XASA 1WJ5A 4BQNA 4E7SA 4QTRA 1FBQA 1T08B 3I0TA 5LHIA 2ZBKA 4RS8A 3I59B 2V7FA 2X1DA 3TMOA 3L2WA 3J81Z 1KONA 3RYPA 3VYUB 5BOXA 5J4VA 2O03A 3IUOA 1OCOH 2QA4I 2Q2EB 4EGZA 1LQ1A 3CCYA 2PJPA 5E18F 5K1YA 2WAQA 3R0JA 1IRFA 1XX5A 3GTGJ 1VQ5I 3PUFA 4V2FA 3K7AJ 2VLAA 5LLQA 4XIDA 1ZG5A 1APLC 5L3GA 1HDDC 4XKBA 3RDIA 1K4TA 3G3ZA 3E6BA 3TO6A 1I50J 2Z16A 3ZN0A 2FMLA 3LSTA 2CJJA 2GA2A 2IP2A 2FU4A 1ZELA 3BOQA 2QKMB 2K4JA 4Y52J 2GLOA 4UVCA 2ZFUA 4HAMA 4PUSA 4D7MA 4KIFA 3IWZA 4M3GA 4AYBN 1OCRH 4QWQA 5E3NA 1BI3A 2BVLA 2EFWA 1WH7A 3TP3A 1UG0A 1WH5A 1V54H 1WQ2A 1OR7A 3F0CA 4XN0A 3SYTA 4A0ZA 5IP6A 4J19A 2O8KA 3AL0B 1SC7A 1RI7A 2IJLA 4BL0B 3FXRA 4BY7J 2B7EA 2W82A 4OINF 4G8XA 2CQKA 1ODDA 4G12A 3J80K 1P92A 1S29A 2P5VA 3ECOA 3TEDA 4PK4A 4ZDPA 1I27A 5D5UB 1ETWA 4UXNA 3K2AA 2YS9A 2JUCA 1VI0A 4E6KG 2V26A 3ZCOA 1SFEA 2EV0A 2P8TA 2X85A 4DQ2A 2P6SA 1LFPA 4Y3OA 4HX4A 2NRAC 3FBIB 1VZ0A 4MFEA 2FXAA 3PM1A 3CCQI 4CYCA 5J40A 3OWTA 4YELA 4YIFA 2HTSA 3FKIJ 3WTXC 1S3JA 3DTEA 2MGQA 3AKZA 5HLIA 2HOTA 3K4JA 5CKTA 4KIGA 3PNVA 1R7JA 4GCVA 4C30A 4OAYA 3C7JA 4DOZA 4OIRF 3ROUA 5F04A 2FUG2 1VQMI 1V3FA 4PGGA 3HYIA 2Z33A 1PUEE 1QA6A 3JRFA 2PEXA 1SFUA 2OTJI 2HNHA 4DBRA 5D4RA 1G3WA 1USTA 2RV8A 3IP4B 2EIJH 2A6EF 1HF0A 1JKQC 2O6GE 2WY8Q 4BAYA 3BJAA 1K7AA 1IV6A 4RGSA 3MVPA 1FP2A 1IN7A 3BZ6A 2HS5A 2E7XA 2IS4A 3BWGA 4BGDA 3DTIA 4W97A 4I6ZA 3T1BA 4IQ4A 1J9IA 3M9AA 5CVUA 4LD5A 3FM3A 5D8KB 3S32A 2R5YA 4BS9A 1S72I 3X2QH 4A12A 2E2HJ 4IZZA 2H27A 3CMEI 4IXAA 1HXDA 2AQEA 2LD5A 1Y8QB 3C18A 3CD6I 4L0ZB 3E97A 5J6XA 4PGHA 2E7WA 1VQ9I 4G6DA 1IF1A 4RA2A 3W6KB 1ZRCA 2ZSHB 5M5WJ 4B44A 5IY5H 1ZG3A 2CRGA 3GX4X 2DK8A 4XQFA 2QCOA 3QOPA 3K69A 3H3UA 5BS6A 4IJAA 3W6JB 1FTZA 1A35A 1H88C 2D1HA 1Z6TA 4N4OB 1ZTRA 1MD0A 3HSEA 2JZYA 2KRFA 1YJNI 3VB2A 4EV0A 1PUFA 1VQLI 2HVQA 4ENMA 1I39A 3COAC 1WKMA 4Y7NJ 4C2UA 1OKRA 1FIAA 2BZTA 2CQNA 3MN2A 4QPQA 1RUNA 5J1YA 1ZGAA 4Y17A 2R7UA 2CGPA 2ZB9A 3NAUA 1P4XA 4A93J 3CMAI 1HQCA 2STTA 1XPXA 2EA2A 2QQ9A 1DDNA 1QVTA 5EGOA 5FRMA 4A3DJ 2KLOA 3FMSA 1KU2A 4RM2A 1P6RA 4EM1A 3BDDA 5JR3A 3KYLA 1BI1A 3CZ6A 2MABA 2QBYB 1SVLA 3FXUA 2OPTA 2Y0MA 4YFXF 3IRQA 2NOGA 1BW5A 2OD5A 1X3WB 4RGUA 4PCQA 1Y8RB 1ZG1A 2LC2A 3LA7A 3JAMZ 2L02A 1JI8A 4PJNA 2TCTA 3HIFA 2QLZA 3QYEA 2DA3A 3KZZA 5F0HA 2XAHA 3AAFA 5LHGA 3HKZN 1MZBA 5JI6A 3A0HC 5M5XJ 5KAFC 3VODA 3L2RA 2PBIA 3P9KA 1IW7F 2DFIA 2KDZA 2QSFX 5L3DA 3DU5A 1DPRA 2ZJRF 1Z77A 1T8IA 4KMFA 1U0JA 1XDSA 4CCLA 2H1KA 4HG2A 2HPIA 1QO0D 1F5TA 1ZYRF 1N75A 2MC4A 2XF7A 4IEJA 4QSHA 4B8XA 3RTRA 4CCKA 3GTJJ 4XRSA 3K0LA 1DPUA 1BIAA 2MD0A 4DJAA 5KHDA 3WTWC 1MNMC 3H92A 4CSWA 3PNTA 4P9FA 4M3DA 2HKXA 3NQOA 3L09A 4EVIA 3OS1A 5GADJ 2Z9OA 1YE9A 3EQLF 5IOZA 2IGMA 2N8GA 4HX8A 2QWWA 4IHWA 2DYSH 1W7PA 1QHHD 2EZKA 4RLFA 3AL0C 3CDIA 2XGEA 1ZAOA 4X0GA 1FX7A 2AXTC 2XRLA 4PJLA 4D0PA 5ICGA 5DV5A 4L5IA 1FOKA 2BVMA 1I6HJ 3FXQA 3PSFA 1SFXA 3OSGA 1D1AA 3J7ZI 5CLSA 2PJRB 3LL7A 4EJUA 4YIIA 5JLXA 1IRGA 3HRUA 4P5OA 3TGNA 3HM5A 1IDYA 2COMA 4MIMA 3ERED 5C4XJ 2CV2A 3CQZJ 5EZGA 4LK1F 4U0VA 1YW7A 3L2QA 3T0YA 3QOEA 2ZFWA 5ILVA 1UHMA 2ELHA 1D8JA 1OQYA 5DEQA 1AKHA 1T2KA 1B59A 2HOEA 2HGCA 1RKTA 1VNDA 3H5NA 3S1QJ 3RYRA 3HC7A 4M73A 2PMZN 1X2NA 5IYDJ 3CUOA 3KLNA 4FE7A 4E7ZA 2A68F 2NS7A 2NS0A 4BHPA 3BG3A 1WGXA 2ZJQF 3GTKJ 3ML6A 2K7LA 1MMNA 4FCYA 2QQAA 1OMIA 3L2VA 2FF4A 3NARA 1Z9CA 1O3SA 2Z3YA 2VOPA 3PQKA 3BT9A 3KCCA 2RC4A 2DA5A 5E3OA 4NQWA 4S04A 3BTJA 1XB4A 2R7OA 5B1BH 1GLNA 3IL2A 1O3QA 4M72A 2JPBA 2GXAA 3D5RC 4XK4A 3K4KA 3FKJA 5GTHC 5EZHA 3NWSA 3TQNA 2KJCA 1UJ8A 4HV6A 5HS9A 3M8EA 3SEQA 3I64A 3MKLA 3QAHA 2FBIA 2JA8J 4U7BA 2HU9A 4YFKF 1X3UA 1KYZA 1U5TA 2A3SA 3I9V2 5FROA 3CMMA 3S3OA 1U8RA 3A2KA 1D5VA 1POGA 5F1JA 3VYRB 4AVZA 1K78B 3PSIA 4A6DA 5CJ9A 1T39A 3H0GJ 3R4KA 2ZKZA 2K02A 2XC7A 3OS2A 5K5OA 5D6EA 4BXFA 3OYLA 5TRDA 3DP7A 3HPGA 3A02A 1GHCA 1SD7A 2VN2A 3F22A 4CCNA 1Y39A 1V5EA 3HSFA 4HZFA 3BLYA 3I4MJ 2UWMA 2Y0SN 1FNNA 3GZ5A 4OAZA 2VBWA 1P4AA 1W5CC 3RI4A 1QZEA 3K1PA 2WY7Q 4CH7A 3L00A 2VASA 3P9IA 1FOXA 2XPVA 3H36A 2LOOA 1SD6A 2DFEA 3ZRGA 4R1HA 3K4NA 2E34A 3ZQFA 5A2QK 3AG3H 1IN5A 1BA5A 2KIQA 2DOEA 4HLYA 2LBFA 5LBQA 2ZMEA 2HQ5A 2ME6A 2Q2EA 4F92B 1LDKB 3HB9A 4FX4A 3LFKA 2DJIA 4AIJA 2FE3A 3I4PA 4B48A 2OU2A 2R7DA 3K4CA 4II2A 3OYKA 2EFOA 3H5RA 3W3CA 2M2EA 2R3SA 2R7XA 4MEYF 1OJLA 3RCOA 5F08A 2EB7A 3J81K 4ENJA 5DCMA 3S1RJ 3F21A 2L4MA 2H8RA 3AG1H 1TWHJ 1PUFB 1X1CA 3FXJA 1I3AA 3DPLC 1S7EA 2O0YA 3KLOA 3S2WA 2IS2A 1SD5A 1TL8A 1O3RA 3HGYA 1ON1A 4M74A 2OUMA 2LR8A 2AHQA 1I6XA 2Y48A 2IGOA 4L9JA 3ZOBA 2A61A 4GXOA 1JT0A 4HQEA 3H0DA 2HVRA 2XF5A 1R6RA 3DLAA 1L3LA 2NVTJ 2HOAA 4A0YA 1LVKA 4YIRX 1ITYA 1FC3A 3H3ZA 2YX4A 4NBQA 1SANA 3ZQQA 2M30A 2YPRA 2E1OA 2V1UA 5LEKA 4BE1A 1JJ8C 2BHYA 1EH6A 1XGSA 2E5ZA 2R5YB 5JVGF 2UV1A 1D0ZA 2NAZA 2P7CB 4Y13A 4L0YB 2EIKH 1VTNC 2GXGA 2VC1A 1OCTC 2DA6A 2M9HA 3JTHA 3RIRA 4D5CA 2QZ8A 2AO9A 4HW0A 1SD4A 1RESA 2CG4A 4RGRA 2W7NA 1EKEA 1G3YA 4R8HA 3S8PA 2LH9A 3QYBA 4KNYA 2KZVA 1T95A 3BR0A 2RQPA 3S17J 4FQGA 3TL4X 2FQ3A 4U0WA 3WGGA 1ZGWA 1OFCX 2KMUA 3CJNA 2EBIA 1SAXA 2ZXHA 4ESJA 1IN8A 1TLHB 3G1LA 4FISA 4HDVA 3HTSB 5LGNA 2V1XA 3ZMDA 2W85A 1WPKA 1TWGJ 1R5GA 2GIZA 4IRHA 4PSXA 2UZKA 1RUOA 1DP3A 4E4HA 3IRRA 1Z7LA 4UV9A 4M6XA 3OS0A 1U8BA 1BI2A 3KP7A 2PMHA 1YIJI 5B1AH 4Z2YA 4LK0F 4KMUX 2L01A 3MZYA 1YO5C 2KIMA 3L2CA 4CO8A 4WX9A 1OISA 1YW9A 3F8NA 2LY2A 2LY9A 1WCMJ 2H94A 2FA5A 2F5CA 2Q0OA 5L3CA 3HXLA 5FKLA 1IN6A 2Z1DA 3WTZA 2E1NA 4B3XA 4E7JA 3MEXA 3BG6A 1BC7C 2KQRA 3I53A 1QU3A 5JFRA 3KP4A 3N4MA 3ZP5A 3IV5A 4QPOA 2EZIA 3QPLA 3LSMA 1Q1VA 4OOIA 1U2WA 4CXFA 4ZYAA 2DQLA 3OY9A 3L2UA 4UNOA 4L9TA 1ZGJA 1A31A 2NVUB 2BBYA 4EEFG 1MIJA 2DT7B 3A1YA 3LSJA 3IH2A 1R36A 4ZDLA 3CCJI 2W24A 1X4PA 3CCVI 4IHSA 3K2ZA 5FKMA 1U78A 3ZQ7A 2G7UA 3OIOA 5E20A 3G1MA 1JKRC 5KVRA 2V4JC 2Y9YA 4U87A 2X51A 4I02A 2M7AA 2CS3A 2RQQA 4XLFA 1BC8C 3K4BA 1MSEC 3S3NA 1UAAA 2OA4A 2AS5F 2KZGA 2LRDA 5EJCA 3DF8A 4JOMA 4BDZA 1LE8A 1NG7A 2JK3A 3OR2C 3VSKA 5JHUA 1RKWA 1QHGA 3LQRA 2ZMEB 2W1OA 4TV7A 3VSLA 1X4OA 3LSIA 2E60A 2XSJC 5ILSA 1MW7A 5KNLA 4XRSG 2EH3A 4B47A 1Y0NA 2R93J 1J5YA 5DM6F 3CDHA 1A5JA 2VB6A 4ZC3A 2FD5A 3KIOA 1DU0A 1BR2A 1LKXA 3GTQJ 3RQIA 2NVXJ 3MQ0A 4XLNF 2J5OA 3BTLA 3HBLA 1IJWC 3JTGA 1D3YA 3MKYB 3RJPA 2KKOA 3DEUA 5EGOB 2R7RA 3S2DJ 4RAYA 1OCCH 2IW5A 3I3LA 1MMSA 4KIBA 3SFIA 2XGCA 2E1CA 2ZXWH 3JRIA 3GFJA 2B63J 4IQJA 5GTIC 1EV7A 2BY1A 1IN4A 3IHUA 2K9SA 1DGRM 1TQMA 2B0LA 4AIHA 2DPDA 4J01A 1LNWA 2FRHA 3L9FA 3BJ6A 1WSUA 5B5EC 4IKFA 5B3SH 2WADA 5F27A 4OU0A 3NRVA 1O7LA 3I54A 3O6BB 4JX4A 1FSHA 3OYFA 2DLLA 3HOTA 2M1BA 1DP7P 3KEQA 2X6YA 3BG7A 1HSTA 2NNYA 4D7NA 4Z6YA 2Q8KA 2JRMA 3BTIA 4CCMA 1J09A 1HW2A 3EETA 4DYRA 2P4WA 4RBOA 1IRZA 2MLGA 1XSDA 4AIKA 3RZOJ 1MBGA 2ZCWA 4LLGF 2QVOA 2LTPA 4NC6A 1HKQA 1ULYA 2H6CA 2IA1A 5EF6A 3ZGKA 2FEZA 4LMYA 4UUVA 1HKTA 5BPDA 2IVMA 3AG2H 2DPUA 1P7JA 2HYFA 4IHXA 2MG4A 5K5QA 4MFDA 2QSGX 3A01A 5ERIA 2V1DA 4ZYEA 2JVHA 3EUAA 4YRVA 2DXIA 3T8RA 2FX0A 4M71A 1S7AA 4L9NA 1MNDA 5HLHA 2LFBA 4ZTFA 3R6SA 3FM5A 3FK6A 4XLHA 3G6EI 2A69F 1QBJA 1ONVA 2ELKA 3E5XA 4R79A 1AHDP 1PYVA 3OV8A 1EF4A 1VQKI 3IWFA 2E2IJ 3FX3A 1RIOH 5HVQC 1GVDA 5LD2C 5L3BA 4M6YA 6PAXA 4I7HA 5KK1A 4P96A 4WCGA 1TW2A 1MBKA 2DODA 3A03A 3E6MA 1T33A 3FMRA 1A6QA 1XMXA 2WB1A 1W36D 4IOAF 5FD6A 2VKEA 3FHZA 4UB8C 2FOWA 4I01A 1N77A 2XUBA 3Q0UA 4JK1X 2P5LC 2R7VA 2XV4S 2BYVE 3M3YJ 4IRGA 5ICFA 3ASNH 4PZJA 2GXBA 4BE0A 4HNUA 3OYDA 2Y9ZA 1YTYA 2VJIA 1VQ8I 4I98B 4A6EA 1LEBA 5ED4A 2YX7A 2X1CA 2JUGA 3ZR8X 2VBZA 2CWEA 1XCBA 2OBPA 2O9LA 3I4NJ 1ETQA 1SAUA 2KIUA 4ZTJA 3HKZA 5CQGA 2L7ZA 3CCSI 4G6TB 4DIQA 1YJ9I 2CO5A 3PIOF 2DYRH 4PJJA 1F1ZA 2XSDC 1PP8F 3BR2A 9ANTA 3VPRA 3N05A 2LNBA 2R7QA 1I3QJ 5DDGA 4B4CA 1JTYA 1OYWA 1A6IA 1DU6A 3GEZA 3HOZJ 1Z67A 2WA0A 4JP0A 1Z6RA 2MLKA 3IAM2 4AM3A 3F8FA 5AIPA 1IG7A 4G7ZF 3BPVA 3WG9A 1V5GA 2Z99A 4MGRA 3OYHA 1JXSA 4CICA 2QUFA 1OLTA 1HOMA 1G6NA 3HJEA 3M1CA 2COBA 2XAQA 1WHUA 3U1KA 2ZJPF 3BR3A 2LYCA 3SDGA 5EG0B 3REOA 1UCRA 1TNTA 1X1BA 3FXOA 3HZJA 3BCBA 5FKNA 3F3XA 2W00A 4N9HA 5J1UA 2Y75A 4UB6C 4G94A 1BI0A 3DKYA 3TW6A 1JE8A 2IAIA 3ZQCA 1GDTA 1ERDA 4Q5SF 3QWLA 2R0QC 2OQRA 3JRGA 2WV0A 4XR6A 3GZNB 4G7OF 2XHKA 5EG0A 2ZJ2A 1WJBA 5FLMJ 3PFIA 4B1RA 4OMYA 1KU3A 2L9VA 3QU6A 2G9WA 1S7OA 3HOYJ 1R22A 1R1TA 3R60A 1TQPA 2ZNYA 4KUMA 4A3JJ 2LKSA 5BPIA 2ZO4A 5FKOA 2ME0A 1W7PB 1HKSA 2VXZA 5J8FA 4M3BA 3QP5A 2OF7A 4IHTA 2JRTA 4X1EA 2ISZA 2LBFB 3QPSA 3JRHA 4GO1A 2XF6A 2R5ZB 3CDLA 2LDUA 4WXCA 2ZMEC 4KN4X 5HLGA 3Q0VA 2QBYA 2M4GA 5J4YA 1TTYA 1Y1WJ 2BW3B 2CYYA 3ZMSA 2R7SA 5HDKA 3H5AA 1WI3A 2UUZA 2EQRA 3RQ4A 5DCMB 2Z5UA 1GXQA 3C2GA 3HRSA 1T0FA 1QQIA 3DFGA 2XGXA 1R4MB 4HX7A 1ZRFA 2O8XA 3DEEA 4NHJA 2HWVA 5K7HA 4ESFA 2L9RA 3BP8A 1ETXA 5AONA 2K9LA 1R4NB 2MFZA 3CCUI 1YG2A 1MMAA 5E17F 1UHSA 3TOBA 4O6JA 2R4GA 5C44J 4ZYDA 1JGGA 2PJRA 1Y56A 3A01B 1S9HA 4MNUA 1D1BA 3CESA 2E2JJ 3QU3A 1W4MA 1XGMA 3I58A 2CUFA 3DPUA 4GGGA 1T6SA 3KX2A 1I1GA 4YEJA 3BQYA 3AG4H 1D0YA 2FSWA 1IGNA 1MMGA 1USSA 3E6CC 5HDNA 3QQAA 4EJTA 2XKOA 3BR6A 5HNFA 3S1NJ 1XTAA 1XC5A 3HOVJ 3DV8A 2MH2A 4ABZA 2V1NA 2L3DA 1E3PA 3LSRA 1AOYA 1B9MA 2X1EA 3WU1B 1UELB 1UB9A 2VE9A 2HZTA 1R5HA 2ZXJA 2M87A 3OYEA 1BJAA 4P55A 3U21A 4O5VA 3V7RA 3CJTB 2A6TA 1LE8B 2IGKA 1IDZA 5H20A 5TGTA 1WZ2A 1KQ8A 3RPQA 2A6HF 1Z1DA 2LKXA 2L7MP 3OL3A 4XMYA 3V8JA 2HOSA 2A05A 2F6CA 4IO9F 3F9KA 3HSRA 3ABUA 4HPQA 3GFLA 4EM2A 2VODA 4Y4RA 5K7ZA 3I59A 3P5JA 1WJFA 2VPRA 3DXJF 4XORA 5LFAA 3HRMA 2V9PA 1P2FA 5FGMA 3OYIA 2KP6A 2DMUA 2RGVA 1EJ9A 2JPCA 3E5QA 3L1PA 1BL0A 4MEXF 1G3TA 2WC2A 3LA3A 3K4LA 3FHNA 3B6AA 3GFMA 4CZCA 5HOOA 1KZHA 1ZQ3P 3GW2A 2V6CA 2V79A 2X0LA 4LGWA 4BJTA 1YI2I 3BZCA 5HS7A 3J7YJ 3DU6A 4DYCA 1PJRA 4BYYA 1BR1A 1WJAA 1YX5A 3D1NI 1TZLA 1WVRA 4FHTA 4G9YA 1U9OA 2MW8A 4BXUA 4PSWA 2KRCA 2DK5A 3ASOH 3HTUA 5FO5A 5F0CA 1LFUP 3HOXJ 1BOAA 5CVVA 2DMNA 3OOUA 2F48A 4XONA 1TBXA 4ZJZA 4DZPA 4L5JA 5E1XA 1ZLKA 1Z21A 2WAQN 5EEGA 3ZMVA 3H35A 2Z2SB 3VEPA 3B73A 1MGTA 4HYEA 4ZH4F 3P9CA 4XSZF 2HEOA 2W57A 1ZRDA 3Q5FA 1PP7U 5IP7J 2KIFA 3PQJA 1R71A 2GBYA 4RDUA 5FLVA 4HRIA 3D0SA 3I5UA 3HOSA 1IXCA 2DN0A 2HTJA 3G4SI 1G2HA 5IOYA 2LMDA 4A3IJ 5D6FA 3O3KA 1IUYA 4RAZA 2QQ8A 5L3FA 2R5ZA 4M3FA 2VPLA 1X1AA 1Y6IA 3OYJA 1H9TA 2M7BA 2KL4A 4BH9A 2P0WA 3IKVA 2EZHA 4UV8A 5BNGA 4Q48A 3CJQB 1E3HA 3WGHA 2L4AA 2MC3A 2K5CA 1BR4A 4CA0A 4MQVA 4HF2A 4KISA 1TQIA 1X58A 2Y69H 1R1UA 1Z7UA 2M8GX 3HHGA 1ORKA 2K27A 2P81A 3M8JA 2H1LA 1R00A 2O5RA 4K2EA 1K4SA 5FLXK 2LVSA 1HSJA 2DO7A 2DFFA 3EUHC 5GAEJ 5E3MA 1G59A 2H09A 2DTZA 4HNTA 2L5QA 4DZJA 3CF2A 2PI0A 1ETVA 1X2MA 5LEJA 1ZK8A 4FE4A 2Y31A 4EJVA 2XGDA 5CVJA 2VT2A 3DTKA 3S93A 4OIPF 3CCRI 3SZTA 5EYRA 1IV8A 4EQQA 1AWCA 3LAJA 1MBFA 2VJJA 4XOPA 3ECHA 3CLQA 2XROA 4BXXJ 4IF4A 5E1WA 3ZMUA 5B66C 2MBFA 4IX7A 1UZCA 1XD7A 3HOWJ 4NUBA 1D8KA 3ZQHA 2K3FA 3K70C 3JRDA 4F91B 3LSKA 3RZDJ 5JVTA 1Q1HA 3WHCA 3C3WA 4BQAA 4MTDA 4IVNA 2HDCA 1ZKGA 2LKPA 2DA1A 4ZYHA 3OYBA 2O7OA 4F93B 3K1NA 3J80Z 1HDPA 5IYCJ 5FLXZ 4ZDOA 2R92J 4RLQA 4CYCB 3A0BC 4XNFA 4XBFA 1N78A 3TBIA 4PFPA 2ECCA 3H9JA 4BJ6C 3GVAA 2K9NA 1K79A 1KQ9A 3L7WA 4AUXA 2HXIA 4L18B 3ELKA 3NEUA 2J5PA 2MSYA 1RR7A 5C4JJ 4EJOA 1JUSA 1G3SA 4ZZDA 4LJZF 2DT6A 1IXRC 2D5VA 2GA1A 3SZPA 2W4SA 5F64A 4LIVA 4M3EA 2W84A 3W2VA 1B4AA 3Q0WA 3OIQA 1K78A 3PO3J 4DW6A 2BE5F 5ILUA 5J1RA 4MHGA 2QF7A 3ZXSA 3GF2A 2VI6A 4UUSA 2K3PA 1Z91A 3J7AO 1B8IB 4LIUA 5HDGA 3BTCA 3K1MA 2CW8A 2LG4A 2ID3A 2YU3A 4C9YA 3UKGA 1T56A 2EV6A 2HYGD 4A5NA 2L2OA 2DMTA 5CYVA 3M8FA 3DBRB 2YUSA 3U2RA 1HA8A 1H8AC 3HDDA 1U9NA 2JSPA 2VC0A 3OIPA 4XICA 1BN5A 4RB2C 3BCAA 3WG7H 3KETA 4B3AA 3R61A 2EIMH 1SMYF 3MFKA 1ZARA 3LA2A 1FMVA 5IT9Z 2ZC2A 1MJ9A 2NOJB 1JJ6C 4V2GA 2DBBA 3B6CA 3K9TA 2HPMA 4FASD 1XMKA 2VL8A 5FD5A 3JSOA 1LUJB 2CMPA 2ISYA 1FP1D 2XAFA 3F23A 1FLIA 1MBJA 4HQMA 2F4IA 2WTEA 1YX3A 4YG2F 1Y0UA 3OYMA 2NNNA 2IS1A 3KP2A 3T5XA 1GT0C 2A07F 1FBUA 2L7KA 4XLEA 3D5SC 3WHBA 2QYOA 2QGUA 1IAWA 3ZPLA 1WJCA 2E1MC 2O61A 4XRMA 3I56I 1T98A 3V8KA 1LEAA 2M4KA 5LRSA 4I2OA 3BPXA 5ICEA 3JRBA 2JMWA 4LB5A 3SXYA 3KEYA 1WWXA 3KP5A 2BOLA 3M4OJ 5TISC 3VOEA 2PMUA 1U3EM 2JSCA 5GAHJ 1BJZA 1FJLA 3G1OA 1VQ6I 2L7FP 2W25A 3ABTA 4KT5C 4A3BJ 3JREA 3OYGA 3FMQA 1K6OA 2XKPA 2M45A 4PDKA 1WFXA 3GTPJ 4HV5A 4F55A 1JHFA 3PNYA 3CMYA 1NH3A 2VQLA 2FBKA 2OAZA 5F1RA 4KN7X 5F0FA 4BHCA 1MJAA 1NK3P 3WE2A 2IBDA 2DDBA 1BW6A 1IUFA 4E7KA 5KAIC 1TC3C 5A2QZ 3ISPA 3MMYB 1RPWA 1XGNA 3S1MJ 3LSHA 3EYIA 1CF7B 3CUQC 3FDYA 1GUUA 2LF8A 4PJ0C 4KDPA 1TWCJ 2CV1A 2IS6A 2CFOA 2GWRA 3RPUA 2V9KA 1XSXA 2K9MA 5J8CA 2GIVA 1FOYA 2E1MB 2W48A 3S16J 2Y30A 1E0EA 4U7DA 1OPCA 1W5TA 4JX6A 1YFHA 3DEWA 1VQ4I 3ABMH 1LDJA 2XAJA 2X6XA 1T0FC 3VFZA 2DU9A 4BUPA 1ZREA 1PDNC 4KICA 5DM7F 1TT0A 4AIDA 3V7CA 2G0EA 1X19A 2LREA 4HSTA 4HF0A 3IH4A 4RB3C 3N97A 4XOTA 3F8BA 4KFCA 4H0EA 2D45A 2DA7A 2F5FA 5H6RA 4B43A 3WTVC 3ABLH 2PG4A 1J0RA 4Y15A 1FYMA 2CQ7A 2K85A 3KE2A 5LRRA 1B6AA 2EFQA 3WE3A 3WTSC 3ZMZA 2L9SA 3HEFA 1C0WA 3MWMA 1PVEA 2NVYJ 5FKKA 4LG0A 1MSFC 4F52A 1TWFJ 3DWLE 4HA8A 5DD4A 2C6YA 4YFNF 5GPAA 2A5YB 2JWTA 1F36A 2EWNA 4UUTA 1FOWA 3GTLJ 5FFZA 2HR3A 5CVRA 1VF9A 2VQGA 3E6DA 1SMTA 2MD5A 3GLLA 1O4XA 1SFKA 1W1WE 2KT0A 2EPFA 1MH4A 1HCRA 3TDZC 4MO7A 4H4KC 5GP9A 1YJWI 3BC8A 3LOCA 4N9IA 4XLAA 4Q4ZF 1VQ7I 3OYNA 2VOOA 4CUGA 2JA2A 3EYYA 1E3OC 1XN7A 4C3IJ 4KYWA 3BZKA 1MBHA 3FXLA 2E35A 5E8IA 4E7IA 1ENHA 4PJMA 2R7WA 1YITI 3WGIA 5C3EJ 2OQGA 3KYCB 2RAEA 5M5YJ 3KYDB 5DUKA 1FMWA 4II3A 3FK7A 3O8HA 3K10A 1J75A 4NB5A 1MKMA 1U6GA 3RKWA 4ZYGA 3M7GA 1IXSB 2RVCA 1I1SA 3S14J 4NC7A 1LB2A 2VQHA 4OMZA 4AYBA 1B72B 2JQ7A 4BQOA 4KJZA 3ZN1A 3SHFA 1NK2P 1LDDA 4IPAA 2OTLI 2M0CA 3CJRB 4NC8A 1R1VA 5IT9K 4XSXF 3PFYA 2UXXA 1R5ID 3BR1A 4RGXA 5E79C 4AC0A 1STZA 2LY1A 2PN6A 2DW4A 2EILH 3PUBA 3LNQA 1ZR4A 1ZR2A 4CHUA 2H6BA 4FX0A 2VBYA 1A36A 1F9NA 1SFOJ 5K5RA 2XB5A 3DKWA 4B09A 2VJ5A 3QP6A 2KJBA 4LLLA 5JLWA 3DQVC 2KDOA 2AQFA 2X6WA 5BMZA 3RKXA 4DGWB 3VDXA 2CQXA 4F3QA 3F6OA 2YR2A 3R0AA 1YHQI 1SEUA 1FZPB 2VQCA 4UY8I 4I99C 2BY2A 3GYHX 2CU7A 1QRYA 2BY0A 1TW3A 1RZ4A 4JQFA 3HL2A 4Q47A 2A5WA 2DOFA 2LSOA 1W0TA 1ZN2A 1CQTA 2K9QA 4S05A 4BU2A 4E7HA 4LB6B 1KA8A 3GBGA 3TP0A 4IHVA 3ZQGA 5D5WB 2DMQA 5CPRB 3IH3A 4XLCA 2R7ZJ 1H9GA 3CP2A 3CUQA 3KEOA 4RMNA 2STWA 1RNLA 4BACA 3SFZA 1H0MA 4RB1A 2XAGA 1REPC 1FWZA 1AA7A 4A3MJ 2E36A 2XPUA 4HDUA 4N0BA 1FTTA 4IOCF 2NVQJ 1B1BA 1DQUA 1O57A 1QZYA 3HUGA 5FJ8J 3JAMK 4J00A 2FJ1A 3C1DA 1I5ZA 5HNHA 3E5UA 1D0XA 1B9NA 2JTVA 1GVJA 4ENKA 2VXDA 3D5LA 2L54A 2ZXIA 2WB1N 3QPHA 1Y1VJ 2DFHA 2OCCH 4EATA 2I5UA 1E2XA 1XCVA 1V4RA 1K61A 2BGCA 5GPCA 4O3MA 4CDGA 2X4HA 1WI9A 1ZLJA 5E1ZB 2L9NA 5H6QA 4LLNA 1P4WA 3EDPA 3NWTA 1D1CA 2OZ6A 1WJDA 1FPQA 3QYFA 1G4DA 3CLOA 5IT3A 2IEKA 2MYSA 4V19K 4XM3A 2BV6A 4C3HJ 1L0OC 2FBHA 2CH0A 4M9XA 2ZSIB 3IC7A 2HDDA 3IKTA 2FNPA 1IO2A 4KITB 5K7FA 4HSRA 2QQBA 2DAOA 3KZYA 3GXOA 2LK2A 3F8CA 4ENNA 5HS8A 1H89C 4BBSJ 3V7SA 2ICWG 1U5TB 3PL8A 5EEHA 2F4OB 4BBRJ 5FB2A 4D9JA 2LP0A 4JX5A 1YQAA 2VONA 3RKQA 1FIPA 2X9DA 2F5VA 4GYGA 5ICCA 4IL6C 4EMSA 1TP4A 2X48A 2D1VA 2GM4A 1VQNI 5HLTA 2DDAA 4C2TA 4F7ZA 3DBLB 4WXDA 2NS8A 3OYAA 2OZUA 2DOAA 4LOCA 2P6TA 2IGNA 4WXHA 1S5LC 3MCZA 3GCMA 2K86A 1YIOA 3J7AY 1MNEA 5J47A 4XLPF 5HODA 1X1DA 4XL9A 3GZ6A 4G7HF 1HW1A 1QPMA 3ESWB 4AU7A 4BHBA 1QPIA 4W1UA 5D4SA 4BEHA 2YU9J 3HHHA 3FWEA 1QVUA 2DA4A 4DNCA 2GZWA 1B72A 2D2WA 5E3LA 4C2MJ 3F6VA 5IP9J 5D8LB 3WTUC 1K6YA 2ESHA 1KU7A 3AFHA 2PX9A 1Z3XA 2JVGA 5DD8A 2VE8A 1KQ0A 3WU2C 3WU0A 1MBEA 4A3FJ 1EH8A 2IA0A 4S0HB 4BY1J 4GYIA
chains in the Genus database with same CATH topology
2HNHA 2VB6A 4DBRA 4ZC3A 1BR2A 3IP4B 4F91B 1LKXA 3LSKA 4NQWB 2WY8Q 3MKYB 3OYBA 2R7RA 4F93B 1EA3A 3I3LA 3HG9A 2IS4A 3VYTB 4D1QA 4BGDA 4ZDOA 3DTIA 4KT6A 4IQJA 4RLQA 4IQ4A 2DCEA 1DGRM 4XNFA 4J01A 3S32A 2RNGA 3G2BA 3TBIA 4BS9A 1N78A 4PFPA 3LSGA 4IKFA 3H9JA 4IZZA 2WADA 4BJ6C 2AQEA 3RPUD 3K6GA 3OYFA 3DKXA 3HOTA 4CCJA 2X6YA 3OYCA 3BG7A 2ZSHB 4B44A 2DT6A 3EPZA 4XQFA 4CCMA 2W4SA 1J09A 1P9QC 4MLOA 4LIVA 4CCOA 3W2VA 3OIQA 3OMYA 5FRNA 3MKWB 4N4OB 3ZXSA 3DPTA 1G8XA 2CUZA 2K3PA 3FBNB 2HVQA 3ZGKA 4LIUA 4C2UA 2CW8A 2LG4A 4QPQA 5JHFA 2R7UA 4C9YA 2R7TA 1MMDA 2CUJA 2L2OA 2HQAA 2JVHA 2HVSA 3EUAA 4YRVA 2DXIA 3C2HA 5FRMA 1HA8A 1MNDA 4ZTFA 2KLOA 2JSPA 3OIPA 3RSNA 4RM2A 4LG3A 3H9QA 3BCAA 4XLHA 3KYLA 1FMVA 3CZ6A 2MABA 2NOJB 3EUKL 2HPMA 4FASD 4R79A 2VL8A 1PYVA 2CMPA 2RREA 4DBQA 5HVQC 5LD2C 2F4IA 1YX3A 1OR7C 2LC2A 3OYMA 1JI8A 4PJNA 2IS1A 3E0JB 3QYEA 2L7KA 4XLEA 4BJ5C 2KHMA 3D5SC 2WB1A 1W36D 3L2RA 1N77A 5KCMA 4ANJA 2E1MC 1WJCA 2R7VA 2Y0SA 3DU5A 2M4KA 1U0JA 3OR1C 4BE0A 4CCLA 3IAS2 4HG2A 4HNUA 4N4NB 3KEYA 2HPIA 3OYDA 2VJIA 2MC4A 1N75A 2XF7A 2BOLA 4CCKA 3RTRA 4BE2A 2X1CA 2JUGA 3ZR8X 2MD0A 4DJAA 5KHDA 2V6EA 3V42A 1SAUA 4ZTJA 4CSWA 3HKZA 3PNTA 5CQGA 4G6TB 2QKLB 4DIQA 3UR3C 4PJJA 3OYGA 3OS1A 1YE9A 3HPHA 4FETA 3N05A 1WFXA 4F55A 2XAUA 3PNYA 2IGMA 2R7QA 2VQLA 4OWRB 1QHHD 3PJRA 2CW7A 3ONQA 2WA0A 4E7KA 4RLFA 3AL0C 2WBMA 3MMYB 3IAM2 3LSHA 1WJEA 4X0GA 3FDYA 1V5GA 4PJLA 3OYHA 2CV1A 2IS6A 2CFOA 2BVMA 2V9KA 3PSFA 2K9MA 1OLTA 1D1AA 2E1MB 2PJRB 3LL7A 3M1CA 1E0EA 4NNJA 2ELJA 4P5OA 2LYCA 2X6XA 1T0FC 4XKVA 2CV2A 4BUPA 1X1BA 3BCBA 1TT0A 3L2QA 2W00A 3QOEA 1X19A 3H9GA 2LREA 4HSTA 3DKYA 4XOTA 3LMMA 1ERDA 2KRHA 3H5NA 4B43A 3HC7A 3K70D 3OL4A 4XR6A 3W2WA 4E7ZA 3MKZA 1Z3YA 1WJBA 4RM3A 3HUGB 1MMNA 2KPMA 2L9SA 3L2VA 5CQEA 2BW3A 4F52A 2VXZA 3DWLE 2HZDA 2R7OA 2LBFB 1GLNA 3D5RC 2XF6A 3K4KA 3FKJA 2WAFA 3NWSA 3SEQA 2VQGA 3SEZA 2M4GA 1SFKA 4U7BA 2HU9A 2BW3B 2R7SA 3I9V2 3H5AA 3CMMA 5FROA 3S3OA 3A2KA 4H4KC 2UUZA 3BC8A 4XLAA 3VYRB 4BQQA 3RQ4A 4AVZA 3PSIA 3OYNA 4HEA2 4CUGA 2JA2A 3C2GA 2XC7A 3OS2A 3DEEA 4BXFA 3OYLA 4E7IA 3HPGA 1IRXA 2GOMA 4PJMA 2R7WA 2K9LA 4CCNA 1V5EA 2MFZA 3S3MA 1DGWY 1MMAA 3BLYA 2UWMA 2R4GA 3K4MA 2OV7A 3CP8A 2PJRA 1Y56A 1S9HA 2GOXB 1D1BA 3CESA 1NG6A 1FMWA 4II3A 4OAZA 3K10A 2XDVA 3DPUA 4XKCA 2IXSA 2WY7Q 4CH7A 3KX2A 2VASA 4YEJA 1D0YA 4NC7A 3E1SA 2PMZA 2VQHA 2LOOA 1MMGA 4AYBA 3ZRGA 4BQOA 3K4NA 4KJZA 3UNGC 5HNFA 3LFUA 3CJRB 4NC8A 4XN3A 3VYSB 2LBFA 4PFOA 2VJ4A 2VIXA 2V1NA 3PFYA 4GRIA 4P1WA 3SZGA 4F92B 2X1EA 1LDKB 2LY1A 3PUBA 1UELB 4BDYA 4LITA 2DJIA 4B48A 2E5NA 3K4CA 4II2A 3OYKA 3H5RA 3W3CA 3OYEA 3VWBA 3U21A 1BOBA 2R7XA 2VJ5A 3RCOA 2A6TA 2VKHA 2IGKA 5TGTA 3DQVC 3MD2A 2KDOA 2AQFA 2WAEA 2X6WA 4DGWB 3VDXA 4E7LA 2M3AA 4F3QA 3OL3A 4XMYA 1X1CA 2VQCA 3QODA 2F6CA 3DPLC 3F9KA 2IS2A 4HPQA 4Y33A 4JQFA 3HL2A 4Y4RA 2A5WA 2Q1ZB 2OUMA 1WJFA 2IGOA 5LFAA 4XORA 1V5FA 3H0DA 2HVRA 2XF5A 1R6RA 3OYIA 2M0MA 3DLAA 2KP6A 2CV0A 2VKDA 4ITVA 4BU2A 1LVKA 4E7HA 3GBGA 3W2AA 3K4LA 5CPRB 3FHNA 4XLCA 3CP2A 4RMNA 3SDBA 3ZQQA 4BACA 3A4CA 4CZCA 1W36C 4BE1A 5HOOA 2E5ZA 1AA7A 2OC6A 2I8DA 4BJTA 4XKWA 2UV1A 2HDWA 1D0ZA 3DU6A 1PJRA 1BR1A 1WJAA 1YX5A 1DQUA 1TZLA 4BEHB 4E7SA 1WJ5A 4BQNA 4J00A 4PSWA 2KRCA 5HNHA 3S8PA 2W7NA 1D0XA 2LH9A 3QYBA 2VXDA 2KZVA 3D5LA 1T95A 3OOUA 2V7FA 2X1DA 3TMOA 2ZXIA 3TL4X 4XONA 3L2WA 4EATA 1KONA 3VYUB 2KMUA 4ZJZA 3IUOA 2ZXHA 2Q2EB 2L9NA 1Z21A 2WAQA 3NWTA 1D1CA 1WJDA 3H35A 2Z2SB 3QYFA 4PSXA 2MYSA 1DP3A 4E4HA 4XM3A 1Z7LA 3OS0A 2CH0A 2ZSIB 2VLAA 4KITB 4XKBA 4HSRA 2Z16A 2LY2A 1ZELA 3HXLA 4HRIA 2QKMB 3HOSA 3PL8A 2ZFUA 4PUSA 2Z1DA 4B3XA 4E7JA 4D9JA 3BG6A 2KQRA 1QU3A 2BVLA 4QPOA 2F5VA 1UG0A 3LSMA 3SYTA 4XN0A 3AL0B 1X1AA 1Y6IA 4ZYAA 3OYJA 2M7BA 2KL4A 2VPLA 4BL0B 2P0WA 5HLTA 3OY9A 3L2UA 2W82A 4C2TA 3CJQB 3OYAA 2K5CA 1BR4A 2DOAA 2DT7B 3A1YA 4PK4A 4ZDPA 4CA0A 4KISA 4ZDLA 2IGNA 1X4PA 4E6KG 2V26A 3ZCOA 3J7AY 1MNEA 1X1DA 3M8JA 2O5RA 2X85A 4XL9A 4AU7A 1LFPA 2V4JC 4U87A 4Y3OA 2X51A 3EUHC 4BEHA 2M7AA 2CS3A 2RQQA 4XLFA 1G59A 3K4BA 4HNTA 3S3NA 2L5QA 3FBIB 1UAAA 1VZ0A 3CF2A 2LRDA 3OWTA 4YELA 4JOMA 4BDZA 3DTEA 1K6YA 3AKZA 3S93A 3DTKA 3K4JA 3AFHA 5CKTA 1NG7A 3OR2C 3VSKA 3PNVA 4C30A 1QHGA 1Z3XA 2JVGA 4OAYA 2VJJA 2W1OA 4XOPA 4DOZA 3VSLA 1X4OA 3LSIA 2FUG2 2E60A 2XSJC 1MW7A 5KNLA 4IX7A 4NUBA 3K70C 4B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF A;  4BEH A;  2LBF B;  4BEH B;  3A1Y A;  2W1O A; 
#chains in the Genus database with same CATH topology
 3SQN A;  1N25 A;  1V55 H;  5F6F A;  4LG0 B;  4A3G J;  2IRF G;  5AIQ A;  3I55 I;  5J3L A;  4NQW B;  4HNV A;  3TKY A;  1YRN A;  3E3V A;  2VT3 A;  1Z05 A;  2L0K A;  4AWX B;  1EA3 A;  3HG9 A;  3VYT B;  4D1Q A;  1NHA A;  5LGT A;  4KT6 A;  2H8W A;  2DI3 A;  1OCZ H;  1BIB A;  2DCE A;  2EA4 A;  3GO5 A;  3W6V A;  3OSF A;  2QEN A;  2P5K A;  2RNG A;  3F72 A;  3G2B A;  2EFN A;  3LSG A;  2JA5 J;  3RPU D;  4IRI A;  1BBY A;  4HBL A;  1R23 A;  4EJW A;  3K6G A;  2DJN A;  1IC8 A;  1JKO C;  2R7F A;  5H2F C;  3DKX A;  2IPQ X;  1OCP A;  4CCJ A;  3OYC A;  1XG1 A;  2XPW A;  2QM3 A;  2P7V B;  4A2U A;  4I09 A;  4WK8 F;  2AXL A;  3EPZ A;  2M8E A;  3PIP F;  1P9Q C;  3GLX A;  3QPT A;  4MLO A;  4CCO A;  5LGU A;  4A5M A;  3JRA A;  4D5F A;  1GV2 A;  5IYB J;  3OMY A;  1A04 A;  2FOK A;  3FIW A;  3MKW B;  5FRN A;  3CC2 I;  2K40 A;  1KGS A;  1G8X A;  3DPT A;  1XDU A;  1BM9 A;  2CUZ A;  3FBN B;  3FZV A;  3GME A;  2TRT A;  1YYV A;  5JHF A;  5M3F J;  3KP6 A;  2R7T A;  1MMD A;  2O3F A;  1NTC A;  3CC7 I;  4A3K J;  2OCE A;  1M1E B;  2CUJ A;  1QGP A;  2HQA A;  2FQ4 A;  1JGS A;  5BQT A;  1UMQ A;  1R49 A;  2HVS A;  3C2H A;  4E70 A;  1X3Z B;  3BRO A;  2DTR A;  3RSN A;  3M07 A;  4LG3 A;  2EK5 A;  3H9Q A;  4G6Q A;  4FT8 A;  1LPQ A;  3KFW X;  3JW4 A;  1XS9 A;  1UFM A;  3EUK L;  1XSV A;  2EFP A;  4FTH A;  4EGY A;  3TW7 A;  1XGO A;  1TT5 B;  1YLF A;  2RRE A;  3ZQI A;  2FNA A;  2MA3 A;  4DBQ A;  3CCE I;  4EM0 B;  1OR7 C;  3GWZ A;  1CF7 A;  3DBH B;  5L3E A;  1KYW A;  3E0J B;  5CVI A;  4CZZ A;  2CW0 F;  3JRC A;  3BG9 A;  4A69 C;  2KHM A;  4BJ5 C;  3GFI A;  2JA6 J;  4NDL A;  2XIG A;  3HOU J;  4X6A J;  3DCF A;  4CGZ A;  3ZQL A;  5KCM A;  4ANJ A;  3BY6 A;  4ASN A;  2ECB A;  2Y0S A;  1J7K A;  2CSO A;  1GV5 A;  2X6O A;  3OR1 C;  3G73 A;  2RNJ A;  3IAS 2;  1FYK A;  1RC9 A;  3BG5 A;  4N4N B;  3TDU C;  1B8I A;  1ETY A;  3CUQ B;  4ZZL A;  3LAP A;  1YW8 A;  4BE2 A;  2LLK A;  2NXN B;  2V9V A;  2V6E A;  3ERM A;  3FXK A;  2ETH A;  3V42 A;  4ON0 A;  4HF1 A;  2QKL B;  4A0X A;  2JN6 A;  3UR3 C;  3H3V K;  3ABK H;  1R58 A;  2VBX A;  1JT6 A;  1ETO A;  1J59 A;  4MTE A;  3HPH A;  1MDM B;  4JYK A;  4FET A;  2XVC A;  2HXO A;  3B02 A;  2HYJ A;  2XAU A;  1O3T A;  1TNS A;  4OWR B;  2ID6 A;  4I0B A;  3GTO J;  1J2X A;  3SJM A;  3QRF F;  2KFD A;  3PJR A;  4OIQ F;  2CW7 A;  3ONQ A;  1WRJ A;  4BNC A;  2HQN A;  1Z0X A;  2WBM A;  3KP3 A;  1W7P D;  2EJR A;  1RR8 C;  1WJE A;  2YSR A;  3I71 A;  2RKH A;  3U9G A;  3V4G A;  3WTY C;  3FIS A;  1ON2 A;  2F5E A;  3BQZ A;  3ZMT A;  1SVM A;  2JT1 A;  2F2E A;  4UHT A;  3TOA A;  1JHH A;  3Q9V A;  3MZH A;  1F4K A;  4A3C J;  1U5T C;  5DUI A;  2CUE A;  1FBS A;  4NNJ A;  2ELJ A;  2HKO A;  2GAU A;  3Q3S A;  1TWA J;  4OIO F;  1JUM A;  4XKV A;  2GQQ A;  3JSP A;  4KA4 A;  2XRN A;  3CO6 C;  4L5E A;  2RN7 A;  2B9S A;  2E71 A;  2BXZ A;  3H9G A;  2OJE D;  3LMM A;  2HI3 A;  1RRJ A;  2ESN A;  3E7L A;  3DLL F;  2DT5 A;  2KRH A;  5DS9 A;  3P7N A;  3ULQ B;  1CGP A;  1MJB A;  2BHZ A;  3K70 D;  1YS6 A;  1XMA A;  2VKV A;  3OL4 A;  3W2W A;  1YRN B;  4A3L J;  5EEA A;  1FY7 A;  3HRT A;  1Z3Y A;  3MKZ A;  4IHY A;  2CQQ A;  1IZ1 A;  2PQ8 A;  5FFX A;  4RM3 A;  3HUG B;  2KPM A;  4RAG A;  1JKP C;  3KPH A;  1X1P A;  2QEX I;  1JUP A;  1HLV A;  1S6L A;  3KZI C;  3O2P E;  5CQE A;  2Y2Z A;  5TJJ A;  2BW3 A;  2PFB A;  1AU7 A;  2MH9 A;  3BR5 A;  3FXM A;  3M1E A;  5DYM A;  1ACI A;  2HZD A;  4HOB A;  2ZNZ A;  1SVO A;  4AD9 A;  1K83 J;  5GAG J;  1MH3 A;  1YS7 A;  3BJO A;  2WAF A;  1OYY A;  1FT9 A;  2I10 A;  2XB0 X;  4BKX A;  2WV1 A;  3SEZ A;  1VFC A;  1JTX A;  2IA2 A;  2G7H A;  3GUD A;  3S2H J;  3C2B A;  2F4M B;  4BQQ A;  2HQR A;  4HEA 2;  1LVA A;  3PO2 J;  1S8N A;  2VUM J;  1F43 A;  1T38 A;  1W0U A;  3H1C A;  1IRX A;  2GOM A;  2UXN A;  3CTA A;  3JCU C;  1DGW Y;  3S3M A;  2IT0 A;  3K4M A;  2OV7 A;  2JJ7 A;  3CP8 A;  3Q9S A;  4QIW N;  2GOX B;  2ACJ A;  4WWC A;  1NG6 A;  4DYQ A;  3EUH A;  4XRF A;  2JA7 J;  2NYX A;  5EDN A;  1FYL A;  3JR9 A;  4RAF A;  2XDV A;  2DA2 A;  3MZ8 A;  2IXS A;  4U88 A;  4XKC A;  2WWY A;  2FMY A;  4ESB A;  5LHH A;  2BXY A;  3E1S A;  2PMZ A;  4GFB A;  4LFU A;  2M34 A;  5IPA A;  2PLY A;  5DTD A;  1LJ9 A;  2BEO A;  4ETS A;  3S15 J;  4MQ9 F;  3UNG C;  4HLX A;  1HW5 A;  4UVA A;  2K4B A;  3U1D A;  3LFU A;  4QLC U;  5DCF A;  3MAJ A;  4XN3 A;  2EV5 A;  3VYS B;  1YOV B;  4UVB A;  4PFO A;  5M3M J;  2VJ4 A;  4AVP A;  1FEX A;  5D5V B;  2VIX A;  3SZG A;  4GRI A;  4P1W A;  3CCM I;  1HBX G;  2QSH X;  4M9Z A;  3TO7 A;  5D5X B;  1OYI A;  4WF2 A;  4L9V A;  4BDY A;  4LIT A;  2RDP A;  1R9T J;  1GXP A;  1W5S A;  2E5N A;  1QNT A;  1UG2 A;  2F5D A;  1ZHF A;  3VWB A;  4M6V A;  1BOB A;  4M9S A;  1LFB A;  2VKH A;  3LWF A;  2LF7 A;  3V8L A;  3MD2 A;  2WAE A;  3F8M A;  4E7L A;  1ETK A;  2M3A A;  1E17 A;  5E8G A;  3QOD A;  3OOP A;  1EH7 A;  2KIS A;  2E19 A;  4I0A A;  3G71 I;  3CO7 C;  1MDM A;  3LSP A;  1KU9 A;  2CFX A;  1RET A;  2DMP A;  4Y33 A;  1VQP I;  1QZZ A;  3CCL I;  4C3J J;  2Q1Z B;  1V5F A;  2HFH A;  3CF5 F;  1ZH5 A;  1O7F A;  4I76 A;  2EIN H;  2M0M A;  1HC8 A;  2M5W A;  2CV0 A;  2VKD A;  4ITV A;  4UUS B;  1P7I A;  4CYD A;  3RKY A;  3W2A A;  1UHW A;  1FSE A;  1DUX C;  1VQO I;  1AKH B;  1D5Y A;  3SDB A;  2DQR A;  4A3E J;  3A4C A;  4JBA A;  3FF5 A;  3HGG A;  1W36 C;  3WTT C;  2BY3 A;  2OC6 A;  2EZL A;  2I8D A;  4U0Y A;  4XKW A;  2HDW A;  4GDF A;  3T8T A;  3CC4 I;  3LQQ A;  2ADU A;  2TDX A;  4P9U A;  3O8G A;  3TO9 A;  4RB0 A;  4BEH B;  3WOD F;  3GTM J;  2XAS A;  1WJ5 A;  4BQN A;  4E7S A;  4QTR A;  1FBQ A;  1T08 B;  3I0T A;  5LHI A;  2ZBK A;  4RS8 A;  3I59 B;  2V7F A;  2X1D A;  3TMO A;  3L2W A;  3J81 Z;  1KON A;  3RYP A;  3VYU B;  5BOX A;  5J4V A;  2O03 A;  3IUO A;  1OCO H;  2QA4 I;  2Q2E B;  4EGZ A;  1LQ1 A;  3CCY A;  2PJP A;  5E18 F;  5K1Y A;  2WAQ A;  3R0J A;  1IRF A;  1XX5 A;  3GTG J;  1VQ5 I;  3PUF A;  4V2F A;  3K7A J;  2VLA A;  5LLQ A;  4XID A;  1ZG5 A;  1APL C;  5L3G A;  1HDD C;  4XKB A;  3RDI A;  1K4T A;  3G3Z A;  3E6B A;  3TO6 A;  1I50 J;  2Z16 A;  3ZN0 A;  2FML A;  3LST A;  2CJJ A;  2GA2 A;  2IP2 A;  2FU4 A;  1ZEL A;  3BOQ A;  2QKM B;  2K4J A;  4Y52 J;  2GLO A;  4UVC A;  2ZFU A;  4HAM A;  4PUS A;  4D7M A;  4KIF A;  3IWZ A;  4M3G A;  4AYB N;  1OCR H;  4QWQ A;  5E3N A;  1BI3 A;  2BVL A;  2EFW A;  1WH7 A;  3TP3 A;  1UG0 A;  1WH5 A;  1V54 H;  1WQ2 A;  1OR7 A;  3F0C A;  4XN0 A;  3SYT A;  4A0Z A;  5IP6 A;  4J19 A;  2O8K A;  3AL0 B;  1SC7 A;  1RI7 A;  2IJL A;  4BL0 B;  3FXR A;  4BY7 J;  2B7E A;  2W82 A;  4OIN F;  4G8X A;  2CQK A;  1ODD A;  4G12 A;  3J80 K;  1P92 A;  1S29 A;  2P5V A;  3ECO A;  3TED A;  4PK4 A;  4ZDP A;  1I27 A;  5D5U B;  1ETW A;  4UXN A;  3K2A A;  2YS9 A;  2JUC A;  1VI0 A;  4E6K G;  2V26 A;  3ZCO A;  1SFE A;  2EV0 A;  2P8T A;  2X85 A;  4DQ2 A;  2P6S A;  1LFP A;  4Y3O A;  4HX4 A;  2NRA C;  3FBI B;  1VZ0 A;  4MFE A;  2FXA A;  3PM1 A;  3CCQ I;  4CYC A;  5J40 A;  3OWT A;  4YEL A;  4YIF A;  2HTS A;  3FKI J;  3WTX C;  1S3J A;  3DTE A;  2MGQ A;  3AKZ A;  5HLI A;  2HOT A;  3K4J A;  5CKT A;  4KIG A;  3PNV A;  1R7J A;  4GCV A;  4C30 A;  4OAY A;  3C7J A;  4DOZ A;  4OIR F;  3ROU A;  5F04 A;  2FUG 2;  1VQM I;  1V3F A;  4PGG A;  3HYI A;  2Z33 A;  1PUE E;  1QA6 A;  3JRF A;  2PEX A;  1SFU A;  2OTJ I;  2HNH A;  4DBR A;  5D4R A;  1G3W A;  1UST A;  2RV8 A;  3IP4 B;  2EIJ H;  2A6E F;  1HF0 A;  1JKQ C;  2O6G E;  2WY8 Q;  4BAY A;  3BJA A;  1K7A A;  1IV6 A;  4RGS A;  3MVP A;  1FP2 A;  1IN7 A;  3BZ6 A;  2HS5 A;  2E7X A;  2IS4 A;  3BWG A;  4BGD A;  3DTI A;  4W97 A;  4I6Z A;  3T1B A;  4IQ4 A;  1J9I A;  3M9A A;  5CVU A;  4LD5 A;  3FM3 A;  5D8K B;  3S32 A;  2R5Y A;  4BS9 A;  1S72 I;  3X2Q H;  4A12 A;  2E2H J;  4IZZ A;  2H27 A;  3CME I;  4IXA A;  1HXD A;  2AQE A;  2LD5 A;  1Y8Q B;  3C18 A;  3CD6 I;  4L0Z B;  3E97 A;  5J6X A;  4PGH A;  2E7W A;  1VQ9 I;  4G6D A;  1IF1 A;  4RA2 A;  3W6K B;  1ZRC A;  2ZSH B;  5M5W J;  4B44 A;  5IY5 H;  1ZG3 A;  2CRG A;  3GX4 X;  2DK8 A;  4XQF A;  2QCO A;  3QOP A;  3K69 A;  3H3U A;  5BS6 A;  4IJA A;  3W6J B;  1FTZ A;  1A35 A;  1H88 C;  2D1H A;  1Z6T A;  4N4O B;  1ZTR A;  1MD0 A;  3HSE A;  2JZY A;  2KRF A;  1YJN I;  3VB2 A;  4EV0 A;  1PUF A;  1VQL I;  2HVQ A;  4ENM A;  1I39 A;  3COA C;  1WKM A;  4Y7N J;  4C2U A;  1OKR A;  1FIA A;  2BZT A;  2CQN A;  3MN2 A;  4QPQ A;  1RUN A;  5J1Y A;  1ZGA A;  4Y17 A;  2R7U A;  2CGP A;  2ZB9 A;  3NAU A;  1P4X A;  4A93 J;  3CMA I;  1HQC A;  2STT A;  1XPX A;  2EA2 A;  2QQ9 A;  1DDN A;  1QVT A;  5EGO A;  5FRM A;  4A3D J;  2KLO A;  3FMS A;  1KU2 A;  4RM2 A;  1P6R A;  4EM1 A;  3BDD A;  5JR3 A;  3KYL A;  1BI1 A;  3CZ6 A;  2MAB A;  2QBY B;  1SVL A;  3FXU A;  2OPT A;  2Y0M A;  4YFX F;  3IRQ A;  2NOG A;  1BW5 A;  2OD5 A;  1X3W B;  4RGU A;  4PCQ A;  1Y8R B;  1ZG1 A;  2LC2 A;  3LA7 A;  3JAM Z;  2L02 A;  1JI8 A;  4PJN A;  2TCT A;  3HIF A;  2QLZ A;  3QYE A;  2DA3 A;  3KZZ A;  5F0H A;  2XAH A;  3AAF A;  5LHG A;  3HKZ N;  1MZB A;  5JI6 A;  3A0H C;  5M5X J;  5KAF C;  3VOD A;  3L2R A;  2PBI A;  3P9K A;  1IW7 F;  2DFI A;  2KDZ A;  2QSF X;  5L3D A;  3DU5 A;  1DPR A;  2ZJR F;  1Z77 A;  1T8I A;  4KMF A;  1U0J A;  1XDS A;  4CCL A;  2H1K A;  4HG2 A;  2HPI A;  1QO0 D;  1F5T A;  1ZYR F;  1N75 A;  2MC4 A;  2XF7 A;  4IEJ A;  4QSH A;  4B8X A;  3RTR A;  4CCK A;  3GTJ J;  4XRS A;  3K0L A;  1DPU A;  1BIA A;  2MD0 A;  4DJA A;  5KHD A;  3WTW C;  1MNM C;  3H92 A;  4CSW A;  3PNT A;  4P9F A;  4M3D A;  2HKX A;  3NQO A;  3L09 A;  4EVI A;  3OS1 A;  5GAD J;  2Z9O A;  1YE9 A;  3EQL F;  5IOZ A;  2IGM A;  2N8G A;  4HX8 A;  2QWW A;  4IHW A;  2DYS H;  1W7P A;  1QHH D;  2EZK A;  4RLF A;  3AL0 C;  3CDI A;  2XGE A;  1ZAO A;  4X0G A;  1FX7 A;  2AXT C;  2XRL A;  4PJL A;  4D0P A;  5ICG A;  5DV5 A;  4L5I A;  1FOK A;  2BVM A;  1I6H J;  3FXQ A;  3PSF A;  1SFX A;  3OSG A;  1D1A A;  3J7Z I;  5CLS A;  2PJR B;  3LL7 A;  4EJU A;  4YII A;  5JLX A;  1IRG A;  3HRU A;  4P5O A;  3TGN A;  3HM5 A;  1IDY A;  2COM A;  4MIM A;  3ERE D;  5C4X J;  2CV2 A;  3CQZ J;  5EZG A;  4LK1 F;  4U0V A;  1YW7 A;  3L2Q A;  3T0Y A;  3QOE A;  2ZFW A;  5ILV A;  1UHM A;  2ELH A;  1D8J A;  1OQY A;  5DEQ A;  1AKH A;  1T2K A;  1B59 A;  2HOE A;  2HGC A;  1RKT A;  1VND A;  3H5N A;  3S1Q J;  3RYR A;  3HC7 A;  4M73 A;  2PMZ N;  1X2N A;  5IYD J;  3CUO A;  3KLN A;  4FE7 A;  4E7Z A;  2A68 F;  2NS7 A;  2NS0 A;  4BHP A;  3BG3 A;  1WGX A;  2ZJQ F;  3GTK J;  3ML6 A;  2K7L A;  1MMN A;  4FCY A;  2QQA A;  1OMI A;  3L2V A;  2FF4 A;  3NAR A;  1Z9C A;  1O3S A;  2Z3Y A;  2VOP A;  3PQK A;  3BT9 A;  3KCC A;  2RC4 A;  2DA5 A;  5E3O A;  4NQW A;  4S04 A;  3BTJ A;  1XB4 A;  2R7O A;  5B1B H;  1GLN A;  3IL2 A;  1O3Q A;  4M72 A;  2JPB A;  2GXA A;  3D5R C;  4XK4 A;  3K4K A;  3FKJ A;  5GTH C;  5EZH A;  3NWS A;  3TQN A;  2KJC A;  1UJ8 A;  4HV6 A;  5HS9 A;  3M8E A;  3SEQ A;  3I64 A;  3MKL A;  3QAH A;  2FBI A;  2JA8 J;  4U7B A;  2HU9 A;  4YFK F;  1X3U A;  1KYZ A;  1U5T A;  2A3S A;  3I9V 2;  5FRO A;  3CMM A;  3S3O A;  1U8R A;  3A2K A;  1D5V A;  1POG A;  5F1J A;  3VYR B;  4AVZ A;  1K78 B;  3PSI A;  4A6D A;  5CJ9 A;  1T39 A;  3H0G J;  3R4K A;  2ZKZ A;  2K02 A;  2XC7 A;  3OS2 A;  5K5O A;  5D6E A;  4BXF A;  3OYL A;  5TRD A;  3DP7 A;  3HPG A;  3A02 A;  1GHC A;  1SD7 A;  2VN2 A;  3F22 A;  4CCN A;  1Y39 A;  1V5E A;  3HSF A;  4HZF A;  3BLY A;  3I4M J;  2UWM A;  2Y0S N;  1FNN A;  3GZ5 A;  4OAZ A;  2VBW A;  1P4A A;  1W5C C;  3RI4 A;  1QZE A;  3K1P A;  2WY7 Q;  4CH7 A;  3L00 A;  2VAS A;  3P9I A;  1FOX A;  2XPV A;  3H36 A;  2LOO A;  1SD6 A;  2DFE A;  3ZRG A;  4R1H A;  3K4N A;  2E34 A;  3ZQF A;  5A2Q K;  3AG3 H;  1IN5 A;  1BA5 A;  2KIQ A;  2DOE A;  4HLY A;  2LBF A;  5LBQ A;  2ZME A;  2HQ5 A;  2ME6 A;  2Q2E A;  4F92 B;  1LDK B;  3HB9 A;  4FX4 A;  3LFK A;  2DJI A;  4AIJ A;  2FE3 A;  3I4P A;  4B48 A;  2OU2 A;  2R7D A;  3K4C A;  4II2 A;  3OYK A;  2EFO A;  3H5R A;  3W3C A;  2M2E A;  2R3S A;  2R7X A;  4MEY F;  1OJL A;  3RCO A;  5F08 A;  2EB7 A;  3J81 K;  4ENJ A;  5DCM A;  3S1R J;  3F21 A;  2L4M A;  2H8R A;  3AG1 H;  1TWH J;  1PUF B;  1X1C A;  3FXJ A;  1I3A A;  3DPL C;  1S7E A;  2O0Y A;  3KLO A;  3S2W A;  2IS2 A;  1SD5 A;  1TL8 A;  1O3R A;  3HGY A;  1ON1 A;  4M74 A;  2OUM A;  2LR8 A;  2AHQ A;  1I6X A;  2Y48 A;  2IGO A;  4L9J A;  3ZOB A;  2A61 A;  4GXO A;  1JT0 A;  4HQE A;  3H0D A;  2HVR A;  2XF5 A;  1R6R A;  3DLA A;  1L3L A;  2NVT J;  2HOA A;  4A0Y A;  1LVK A;  4YIR X;  1ITY A;  1FC3 A;  3H3Z A;  2YX4 A;  4NBQ A;  1SAN A;  3ZQQ A;  2M30 A;  2YPR A;  2E1O A;  2V1U A;  5LEK A;  4BE1 A;  1JJ8 C;  2BHY A;  1EH6 A;  1XGS A;  2E5Z A;  2R5Y B;  5JVG F;  2UV1 A;  1D0Z A;  2NAZ A;  2P7C B;  4Y13 A;  4L0Y B;  2EIK H;  1VTN C;  2GXG A;  2VC1 A;  1OCT C;  2DA6 A;  2M9H A;  3JTH A;  3RIR A;  4D5C A;  2QZ8 A;  2AO9 A;  4HW0 A;  1SD4 A;  1RES A;  2CG4 A;  4RGR A;  2W7N A;  1EKE A;  1G3Y A;  4R8H A;  3S8P A;  2LH9 A;  3QYB A;  4KNY A;  2KZV A;  1T95 A;  3BR0 A;  2RQP A;  3S17 J;  4FQG A;  3TL4 X;  2FQ3 A;  4U0W A;  3WGG A;  1ZGW A;  1OFC X;  2KMU A;  3CJN A;  2EBI A;  1SAX A;  2ZXH A;  4ESJ A;  1IN8 A;  1TLH B;  3G1L A;  4FIS A;  4HDV A;  3HTS B;  5LGN A;  2V1X A;  3ZMD A;  2W85 A;  1WPK A;  1TWG J;  1R5G A;  2GIZ A;  4IRH A;  4PSX A;  2UZK A;  1RUO A;  1DP3 A;  4E4H A;  3IRR A;  1Z7L A;  4UV9 A;  4M6X A;  3OS0 A;  1U8B A;  1BI2 A;  3KP7 A;  2PMH A;  1YIJ I;  5B1A H;  4Z2Y A;  4LK0 F;  4KMU X;  2L01 A;  3MZY A;  1YO5 C;  2KIM A;  3L2C A;  4CO8 A;  4WX9 A;  1OIS A;  1YW9 A;  3F8N A;  2LY2 A;  2LY9 A;  1WCM J;  2H94 A;  2FA5 A;  2F5C A;  2Q0O A;  5L3C A;  3HXL A;  5FKL A;  1IN6 A;  2Z1D A;  3WTZ A;  2E1N A;  4B3X A;  4E7J A;  3MEX A;  3BG6 A;  1BC7 C;  2KQR A;  3I53 A;  1QU3 A;  5JFR A;  3KP4 A;  3N4M A;  3ZP5 A;  3IV5 A;  4QPO A;  2EZI A;  3QPL A;  3LSM A;  1Q1V A;  4OOI A;  1U2W A;  4CXF A;  4ZYA A;  2DQL A;  3OY9 A;  3L2U A;  4UNO A;  4L9T A;  1ZGJ A;  1A31 A;  2NVU B;  2BBY A;  4EEF G;  1MIJ A;  2DT7 B;  3A1Y A;  3LSJ A;  3IH2 A;  1R36 A;  4ZDL A;  3CCJ I;  2W24 A;  1X4P A;  3CCV I;  4IHS A;  3K2Z A;  5FKM A;  1U78 A;  3ZQ7 A;  2G7U A;  3OIO A;  5E20 A;  3G1M A;  1JKR C;  5KVR A;  2V4J C;  2Y9Y A;  4U87 A;  2X51 A;  4I02 A;  2M7A A;  2CS3 A;  2RQQ A;  4XLF A;  1BC8 C;  3K4B A;  1MSE C;  3S3N A;  1UAA A;  2OA4 A;  2AS5 F;  2KZG A;  2LRD A;  5EJC A;  3DF8 A;  4JOM A;  4BDZ A;  1LE8 A;  1NG7 A;  2JK3 A;  3OR2 C;  3VSK A;  5JHU A;  1RKW A;  1QHG A;  3LQR A;  2ZME B;  2W1O A;  4TV7 A;  3VSL A;  1X4O A;  3LSI A;  2E60 A;  2XSJ C;  5ILS A;  1MW7 A;  5KNL A;  4XRS G;  2EH3 A;  4B47 A;  1Y0N A;  2R93 J;  1J5Y A;  5DM6 F;  3CDH A;  1A5J A;  2VB6 A;  4ZC3 A;  2FD5 A;  3KIO A;  1DU0 A;  1BR2 A;  1LKX A;  3GTQ J;  3RQI A;  2NVX J;  3MQ0 A;  4XLN F;  2J5O A;  3BTL A;  3HBL A;  1IJW C;  3JTG A;  1D3Y A;  3MKY B;  3RJP A;  2KKO A;  3DEU A;  5EGO B;  2R7R A;  3S2D J;  4RAY A;  1OCC H;  2IW5 A;  3I3L A;  1MMS A;  4KIB A;  3SFI A;  2XGC A;  2E1C A;  2ZXW H;  3JRI A;  3GFJ A;  2B63 J;  4IQJ A;  5GTI C;  1EV7 A;  2BY1 A;  1IN4 A;  3IHU A;  2K9S A;  1DGR M;  1TQM A;  2B0L A;  4AIH A;  2DPD A;  4J01 A;  1LNW A;  2FRH A;  3L9F A;  3BJ6 A;  1WSU A;  5B5E C;  4IKF A;  5B3S H;  2WAD A;  5F27 A;  4OU0 A;  3NRV A;  1O7L A;  3I54 A;  3O6B B;  4JX4 A;  1FSH A;  3OYF A;  2DLL A;  3HOT A;  2M1B A;  1DP7 P;  3KEQ A;  2X6Y A;  3BG7 A;  1HST A;  2NNY A;  4D7N A;  4Z6Y A;  2Q8K A;  2JRM A;  3BTI A;  4CCM A;  1J09 A;  1HW2 A;  3EET A;  4DYR A;  2P4W A;  4RBO A;  1IRZ A;  2MLG A;  1XSD A;  4AIK A;  3RZO J;  1MBG A;  2ZCW A;  4LLG F;  2QVO A;  2LTP A;  4NC6 A;  1HKQ A;  1ULY A;  2H6C A;  2IA1 A;  5EF6 A;  3ZGK A;  2FEZ A;  4LMY A;  4UUV A;  1HKT A;  5BPD A;  2IVM A;  3AG2 H;  2DPU A;  1P7J A;  2HYF A;  4IHX A;  2MG4 A;  5K5Q A;  4MFD A;  2QSG X;  3A01 A;  5ERI A;  2V1D A;  4ZYE A;  2JVH A;  3EUA A;  4YRV A;  2DXI A;  3T8R A;  2FX0 A;  4M71 A;  1S7A A;  4L9N A;  1MND A;  5HLH A;  2LFB A;  4ZTF A;  3R6S A;  3FM5 A;  3FK6 A;  4XLH A;  3G6E I;  2A69 F;  1QBJ A;  1ONV A;  2ELK A;  3E5X A;  4R79 A;  1AHD P;  1PYV A;  3OV8 A;  1EF4 A;  1VQK I;  3IWF A;  2E2I J;  3FX3 A;  1RIO H;  5HVQ C;  1GVD A;  5LD2 C;  5L3B A;  4M6Y A;  6PAX A;  4I7H A;  5KK1 A;  4P96 A;  4WCG A;  1TW2 A;  1MBK A;  2DOD A;  3A03 A;  3E6M A;  1T33 A;  3FMR A;  1A6Q A;  1XMX A;  2WB1 A;  1W36 D;  4IOA F;  5FD6 A;  2VKE A;  3FHZ A;  4UB8 C;  2FOW A;  4I01 A;  1N77 A;  2XUB A;  3Q0U A;  4JK1 X;  2P5L C;  2R7V A;  2XV4 S;  2BYV E;  3M3Y J;  4IRG A;  5ICF A;  3ASN H;  4PZJ A;  2GXB A;  4BE0 A;  4HNU A;  3OYD A;  2Y9Z A;  1YTY A;  2VJI A;  1VQ8 I;  4I98 B;  4A6E A;  1LEB A;  5ED4 A;  2YX7 A;  2X1C A;  2JUG A;  3ZR8 X;  2VBZ A;  2CWE A;  1XCB A;  2OBP A;  2O9L A;  3I4N J;  1ETQ A;  1SAU A;  2KIU A;  4ZTJ A;  3HKZ A;  5CQG A;  2L7Z A;  3CCS I;  4G6T B;  4DIQ A;  1YJ9 I;  2CO5 A;  3PIO F;  2DYR H;  4PJJ A;  1F1Z A;  2XSD C;  1PP8 F;  3BR2 A;  9ANT A;  3VPR A;  3N05 A;  2LNB A;  2R7Q A;  1I3Q J;  5DDG A;  4B4C A;  1JTY A;  1OYW A;  1A6I A;  1DU6 A;  3GEZ A;  3HOZ J;  1Z67 A;  2WA0 A;  4JP0 A;  1Z6R A;  2MLK A;  3IAM 2;  4AM3 A;  3F8F A;  5AIP A;  1IG7 A;  4G7Z F;  3BPV A;  3WG9 A;  1V5G A;  2Z99 A;  4MGR A;  3OYH A;  1JXS A;  4CIC A;  2QUF A;  1OLT A;  1HOM A;  1G6N A;  3HJE A;  3M1C A;  2COB A;  2XAQ A;  1WHU A;  3U1K A;  2ZJP F;  3BR3 A;  2LYC A;  3SDG A;  5EG0 B;  3REO A;  1UCR A;  1TNT A;  1X1B A;  3FXO A;  3HZJ A;  3BCB A;  5FKN A;  3F3X A;  2W00 A;  4N9H A;  5J1U A;  2Y75 A;  4UB6 C;  4G94 A;  1BI0 A;  3DKY A;  3TW6 A;  1JE8 A;  2IAI A;  3ZQC A;  1GDT A;  1ERD A;  4Q5S F;  3QWL A;  2R0Q C;  2OQR A;  3JRG A;  2WV0 A;  4XR6 A;  3GZN B;  4G7O F;  2XHK A;  5EG0 A;  2ZJ2 A;  1WJB A;  5FLM J;  3PFI A;  4B1R A;  4OMY A;  1KU3 A;  2L9V A;  3QU6 A;  2G9W A;  1S7O A;  3HOY J;  1R22 A;  1R1T A;  3R60 A;  1TQP A;  2ZNY A;  4KUM A;  4A3J J;  2LKS A;  5BPI A;  2ZO4 A;  5FKO A;  2ME0 A;  1W7P B;  1HKS A;  2VXZ A;  5J8F A;  4M3B A;  3QP5 A;  2OF7 A;  4IHT A;  2JRT A;  4X1E A;  2ISZ A;  2LBF B;  3QPS A;  3JRH A;  4GO1 A;  2XF6 A;  2R5Z B;  3CDL A;  2LDU A;  4WXC A;  2ZME C;  4KN4 X;  5HLG A;  3Q0V A;  2QBY A;  2M4G A;  5J4Y A;  1TTY A;  1Y1W J;  2BW3 B;  2CYY A;  3ZMS A;  2R7S A;  5HDK A;  3H5A A;  1WI3 A;  2UUZ A;  2EQR A;  3RQ4 A;  5DCM B;  2Z5U A;  1GXQ A;  3C2G A;  3HRS A;  1T0F A;  1QQI A;  3DFG A;  2XGX A;  1R4M B;  4HX7 A;  1ZRF A;  2O8X A;  3DEE A;  4NHJ A;  2HWV A;  5K7H A;  4ESF A;  2L9R A;  3BP8 A;  1ETX A;  5AON A;  2K9L A;  1R4N B;  2MFZ A;  3CCU I;  1YG2 A;  1MMA A;  5E17 F;  1UHS A;  3TOB A;  4O6J A;  2R4G A;  5C44 J;  4ZYD A;  1JGG A;  2PJR A;  1Y56 A;  3A01 B;  1S9H A;  4MNU A;  1D1B A;  3CES A;  2E2J J;  3QU3 A;  1W4M A;  1XGM A;  3I58 A;  2CUF A;  3DPU A;  4GGG A;  1T6S A;  3KX2 A;  1I1G A;  4YEJ A;  3BQY A;  3AG4 H;  1D0Y A;  2FSW A;  1IGN A;  1MMG A;  1USS A;  3E6C C;  5HDN A;  3QQA A;  4EJT A;  2XKO A;  3BR6 A;  5HNF A;  3S1N J;  1XTA A;  1XC5 A;  3HOV J;  3DV8 A;  2MH2 A;  4ABZ A;  2V1N A;  2L3D A;  1E3P A;  3LSR A;  1AOY A;  1B9M A;  2X1E A;  3WU1 B;  1UEL B;  1UB9 A;  2VE9 A;  2HZT A;  1R5H A;  2ZXJ A;  2M87 A;  3OYE A;  1BJA A;  4P55 A;  3U21 A;  4O5V A;  3V7R A;  3CJT B;  2A6T A;  1LE8 B;  2IGK A;  1IDZ A;  5H20 A;  5TGT A;  1WZ2 A;  1KQ8 A;  3RPQ A;  2A6H F;  1Z1D A;  2LKX A;  2L7M P;  3OL3 A;  4XMY A;  3V8J A;  2HOS A;  2A05 A;  2F6C A;  4IO9 F;  3F9K A;  3HSR A;  3ABU A;  4HPQ A;  3GFL A;  4EM2 A;  2VOD A;  4Y4R A;  5K7Z A;  3I59 A;  3P5J A;  1WJF A;  2VPR A;  3DXJ F;  4XOR A;  5LFA A;  3HRM A;  2V9P A;  1P2F A;  5FGM A;  3OYI A;  2KP6 A;  2DMU A;  2RGV A;  1EJ9 A;  2JPC A;  3E5Q A;  3L1P A;  1BL0 A;  4MEX F;  1G3T A;  2WC2 A;  3LA3 A;  3K4L A;  3FHN A;  3B6A A;  3GFM A;  4CZC A;  5HOO A;  1KZH A;  1ZQ3 P;  3GW2 A;  2V6C A;  2V79 A;  2X0L A;  4LGW A;  4BJT A;  1YI2 I;  3BZC A;  5HS7 A;  3J7Y J;  3DU6 A;  4DYC A;  1PJR A;  4BYY A;  1BR1 A;  1WJA A;  1YX5 A;  3D1N I;  1TZL A;  1WVR A;  4FHT A;  4G9Y A;  1U9O A;  2MW8 A;  4BXU A;  4PSW A;  2KRC A;  2DK5 A;  3ASO H;  3HTU A;  5FO5 A;  5F0C A;  1LFU P;  3HOX J;  1BOA A;  5CVV A;  2DMN A;  3OOU A;  2F48 A;  4XON A;  1TBX A;  4ZJZ A;  4DZP A;  4L5J A;  5E1X A;  1ZLK A;  1Z21 A;  2WAQ N;  5EEG A;  3ZMV A;  3H35 A;  2Z2S B;  3VEP A;  3B73 A;  1MGT A;  4HYE A;  4ZH4 F;  3P9C A;  4XSZ F;  2HEO A;  2W57 A;  1ZRD A;  3Q5F A;  1PP7 U;  5IP7 J;  2KIF A;  3PQJ A;  1R71 A;  2GBY A;  4RDU A;  5FLV A;  4HRI A;  3D0S A;  3I5U A;  3HOS A;  1IXC A;  2DN0 A;  2HTJ A;  3G4S I;  1G2H A;  5IOY A;  2LMD A;  4A3I J;  5D6F A;  3O3K A;  1IUY A;  4RAZ A;  2QQ8 A;  5L3F A;  2R5Z A;  4M3F A;  2VPL A;  1X1A A;  1Y6I A;  3OYJ A;  1H9T A;  2M7B A;  2KL4 A;  4BH9 A;  2P0W A;  3IKV A;  2EZH A;  4UV8 A;  5BNG A;  4Q48 A;  3CJQ B;  1E3H A;  3WGH A;  2L4A A;  2MC3 A;  2K5C A;  1BR4 A;  4CA0 A;  4MQV A;  4HF2 A;  4KIS A;  1TQI A;  1X58 A;  2Y69 H;  1R1U A;  1Z7U A;  2M8G X;  3HHG A;  1ORK A;  2K27 A;  2P81 A;  3M8J A;  2H1L A;  1R00 A;  2O5R A;  4K2E A;  1K4S A;  5FLX K;  2LVS A;  1HSJ A;  2DO7 A;  2DFF A;  3EUH C;  5GAE J;  5E3M A;  1G59 A;  2H09 A;  2DTZ A;  4HNT A;  2L5Q A;  4DZJ A;  3CF2 A;  2PI0 A;  1ETV A;  1X2M A;  5LEJ A;  1ZK8 A;  4FE4 A;  2Y31 A;  4EJV A;  2XGD A;  5CVJ A;  2VT2 A;  3DTK A;  3S93 A;  4OIP F;  3CCR I;  3SZT A;  5EYR A;  1IV8 A;  4EQQ A;  1AWC A;  3LAJ A;  1MBF A;  2VJJ A;  4XOP A;  3ECH A;  3CLQ A;  2XRO A;  4BXX J;  4IF4 A;  5E1W A;  3ZMU A;  5B66 C;  2MBF A;  4IX7 A;  1UZC A;  1XD7 A;  3HOW J;  4NUB A;  1D8K A;  3ZQH A;  2K3F A;  3K70 C;  3JRD A;  4F91 B;  3LSK A;  3RZD J;  5JVT A;  1Q1H A;  3WHC A;  3C3W A;  4BQA A;  4MTD A;  4IVN A;  2HDC A;  1ZKG A;  2LKP A;  2DA1 A;  4ZYH A;  3OYB A;  2O7O A;  4F93 B;  3K1N A;  3J80 Z;  1HDP A;  5IYC J;  5FLX Z;  4ZDO A;  2R92 J;  4RLQ A;  4CYC B;  3A0B C;  4XNF A;  4XBF A;  1N78 A;  3TBI A;  4PFP A;  2ECC A;  3H9J A;  4BJ6 C;  3GVA A;  2K9N A;  1K79 A;  1KQ9 A;  3L7W A;  4AUX A;  2HXI A;  4L18 B;  3ELK A;  3NEU A;  2J5P A;  2MSY A;  1RR7 A;  5C4J J;  4EJO A;  1JUS A;  1G3S A;  4ZZD A;  4LJZ F;  2DT6 A;  1IXR C;  2D5V A;  2GA1 A;  3SZP A;  2W4S A;  5F64 A;  4LIV A;  4M3E A;  2W84 A;  3W2V A;  1B4A A;  3Q0W A;  3OIQ A;  1K78 A;  3PO3 J;  4DW6 A;  2BE5 F;  5ILU A;  5J1R A;  4MHG A;  2QF7 A;  3ZXS A;  3GF2 A;  2VI6 A;  4UUS A;  2K3P A;  1Z91 A;  3J7A O;  1B8I B;  4LIU A;  5HDG A;  3BTC A;  3K1M A;  2CW8 A;  2LG4 A;  2ID3 A;  2YU3 A;  4C9Y A;  3UKG A;  1T56 A;  2EV6 A;  2HYG D;  4A5N A;  2L2O A;  2DMT A;  5CYV A;  3M8F A;  3DBR B;  2YUS A;  3U2R A;  1HA8 A;  1H8A C;  3HDD A;  1U9N A;  2JSP A;  2VC0 A;  3OIP A;  4XIC A;  1BN5 A;  4RB2 C;  3BCA A;  3WG7 H;  3KET A;  4B3A A;  3R61 A;  2EIM H;  1SMY F;  3MFK A;  1ZAR A;  3LA2 A;  1FMV A;  5IT9 Z;  2ZC2 A;  1MJ9 A;  2NOJ B;  1JJ6 C;  4V2G A;  2DBB A;  3B6C A;  3K9T A;  2HPM A;  4FAS D;  1XMK A;  2VL8 A;  5FD5 A;  3JSO A;  1LUJ B;  2CMP A;  2ISY A;  1FP1 D;  2XAF A;  3F23 A;  1FLI A;  1MBJ A;  4HQM A;  2F4I A;  2WTE A;  1YX3 A;  4YG2 F;  1Y0U A;  3OYM A;  2NNN A;  2IS1 A;  3KP2 A;  3T5X A;  1GT0 C;  2A07 F;  1FBU A;  2L7K A;  4XLE A;  3D5S C;  3WHB A;  2QYO A;  2QGU A;  1IAW A;  3ZPL A;  1WJC A;  2E1M C;  2O61 A;  4XRM A;  3I56 I;  1T98 A;  3V8K A;  1LEA A;  2M4K A;  5LRS A;  4I2O A;  3BPX A;  5ICE A;  3JRB A;  2JMW A;  4LB5 A;  3SXY A;  3KEY A;  1WWX A;  3KP5 A;  2BOL A;  3M4O J;  5TIS C;  3VOE A;  2PMU A;  1U3E M;  2JSC A;  5GAH J;  1BJZ A;  1FJL A;  3G1O A;  1VQ6 I;  2L7F P;  2W25 A;  3ABT A;  4KT5 C;  4A3B J;  3JRE A;  3OYG A;  3FMQ A;  1K6O A;  2XKP A;  2M45 A;  4PDK A;  1WFX A;  3GTP J;  4HV5 A;  4F55 A;  1JHF A;  3PNY A;  3CMY A;  1NH3 A;  2VQL A;  2FBK A;  2OAZ A;  5F1R A;  4KN7 X;  5F0F A;  4BHC A;  1MJA A;  1NK3 P;  3WE2 A;  2IBD A;  2DDB A;  1BW6 A;  1IUF A;  4E7K A;  5KAI C;  1TC3 C;  5A2Q Z;  3ISP A;  3MMY B;  1RPW A;  1XGN A;  3S1M J;  3LSH A;  3EYI A;  1CF7 B;  3CUQ C;  3FDY A;  1GUU A;  2LF8 A;  4PJ0 C;  4KDP A;  1TWC J;  2CV1 A;  2IS6 A;  2CFO A;  2GWR A;  3RPU A;  2V9K A;  1XSX A;  2K9M A;  5J8C A;  2GIV A;  1FOY A;  2E1M B;  2W48 A;  3S16 J;  2Y30 A;  1E0E A;  4U7D A;  1OPC A;  1W5T A;  4JX6 A;  1YFH A;  3DEW A;  1VQ4 I;  3ABM H;  1LDJ A;  2XAJ A;  2X6X A;  1T0F C;  3VFZ A;  2DU9 A;  4BUP A;  1ZRE A;  1PDN C;  4KIC A;  5DM7 F;  1TT0 A;  4AID A;  3V7C A;  2G0E A;  1X19 A;  2LRE A;  4HST A;  4HF0 A;  3IH4 A;  4RB3 C;  3N97 A;  4XOT A;  3F8B A;  4KFC A;  4H0E A;  2D45 A;  2DA7 A;  2F5F A;  5H6R A;  4B43 A;  3WTV C;  3ABL H;  2PG4 A;  1J0R A;  4Y15 A;  1FYM A;  2CQ7 A;  2K85 A;  3KE2 A;  5LRR A;  1B6A A;  2EFQ A;  3WE3 A;  3WTS C;  3ZMZ A;  2L9S A;  3HEF A;  1C0W A;  3MWM A;  1PVE A;  2NVY J;  5FKK A;  4LG0 A;  1MSF C;  4F52 A;  1TWF J;  3DWL E;  4HA8 A;  5DD4 A;  2C6Y A;  4YFN F;  5GPA A;  2A5Y B;  2JWT A;  1F36 A;  2EWN A;  4UUT A;  1FOW A;  3GTL J;  5FFZ A;  2HR3 A;  5CVR A;  1VF9 A;  2VQG A;  3E6D A;  1SMT A;  2MD5 A;  3GLL A;  1O4X A;  1SFK A;  1W1W E;  2KT0 A;  2EPF A;  1MH4 A;  1HCR A;  3TDZ C;  4MO7 A;  4H4K C;  5GP9 A;  1YJW I;  3BC8 A;  3LOC A;  4N9I A;  4XLA A;  4Q4Z F;  1VQ7 I;  3OYN A;  2VOO A;  4CUG A;  2JA2 A;  3EYY A;  1E3O C;  1XN7 A;  4C3I J;  4KYW A;  3BZK A;  1MBH A;  3FXL A;  2E35 A;  5E8I A;  4E7I A;  1ENH A;  4PJM A;  2R7W A;  1YIT I;  3WGI A;  5C3E J;  2OQG A;  3KYC B;  2RAE A;  5M5Y J;  3KYD B;  5DUK A;  1FMW A;  4II3 A;  3FK7 A;  3O8H A;  3K10 A;  1J75 A;  4NB5 A;  1MKM A;  1U6G A;  3RKW A;  4ZYG A;  3M7G A;  1IXS B;  2RVC A;  1I1S A;  3S14 J;  4NC7 A;  1LB2 A;  2VQH A;  4OMZ A;  4AYB A;  1B72 B;  2JQ7 A;  4BQO A;  4KJZ A;  3ZN1 A;  3SHF A;  1NK2 P;  1LDD A;  4IPA A;  2OTL I;  2M0C A;  3CJR B;  4NC8 A;  1R1V A;  5IT9 K;  4XSX F;  3PFY A;  2UXX A;  1R5I D;  3BR1 A;  4RGX A;  5E79 C;  4AC0 A;  1STZ A;  2LY1 A;  2PN6 A;  2DW4 A;  2EIL H;  3PUB A;  3LNQ A;  1ZR4 A;  1ZR2 A;  4CHU A;  2H6B A;  4FX0 A;  2VBY A;  1A36 A;  1F9N A;  1SFO J;  5K5R A;  2XB5 A;  3DKW A;  4B09 A;  2VJ5 A;  3QP6 A;  2KJB A;  4LLL A;  5JLW A;  3DQV C;  2KDO A;  2AQF A;  2X6W A;  5BMZ A;  3RKX A;  4DGW B;  3VDX A;  2CQX A;  4F3Q A;  3F6O A;  2YR2 A;  3R0A A;  1YHQ I;  1SEU A;  1FZP B;  2VQC A;  4UY8 I;  4I99 C;  2BY2 A;  3GYH X;  2CU7 A;  1QRY A;  2BY0 A;  1TW3 A;  1RZ4 A;  4JQF A;  3HL2 A;  4Q47 A;  2A5W A;  2DOF A;  2LSO A;  1W0T A;  1ZN2 A;  1CQT A;  2K9Q A;  4S05 A;  4BU2 A;  4E7H A;  4LB6 B;  1KA8 A;  3GBG A;  3TP0 A;  4IHV A;  3ZQG A;  5D5W B;  2DMQ A;  5CPR B;  3IH3 A;  4XLC A;  2R7Z J;  1H9G A;  3CP2 A;  3CUQ A;  3KEO A;  4RMN A;  2STW A;  1RNL A;  4BAC A;  3SFZ A;  1H0M A;  4RB1 A;  2XAG A;  1REP C;  1FWZ A;  1AA7 A;  4A3M J;  2E36 A;  2XPU A;  4HDU A;  4N0B A;  1FTT A;  4IOC F;  2NVQ J;  1B1B A;  1DQU A;  1O57 A;  1QZY A;  3HUG A;  5FJ8 J;  3JAM K;  4J00 A;  2FJ1 A;  3C1D A;  1I5Z A;  5HNH A;  3E5U A;  1D0X A;  1B9N A;  2JTV A;  1GVJ A;  4ENK A;  2VXD A;  3D5L A;  2L54 A;  2ZXI A;  2WB1 N;  3QPH A;  1Y1V J;  2DFH A;  2OCC H;  4EAT A;  2I5U A;  1E2X A;  1XCV A;  1V4R A;  1K61 A;  2BGC A;  5GPC A;  4O3M A;  4CDG A;  2X4H A;  1WI9 A;  1ZLJ A;  5E1Z B;  2L9N A;  5H6Q A;  4LLN A;  1P4W A;  3EDP A;  3NWT A;  1D1C A;  2OZ6 A;  1WJD A;  1FPQ A;  3QYF A;  1G4D A;  3CLO A;  5IT3 A;  2IEK A;  2MYS A;  4V19 K;  4XM3 A;  2BV6 A;  4C3H J;  1L0O C;  2FBH A;  2CH0 A;  4M9X A;  2ZSI B;  3IC7 A;  2HDD A;  3IKT A;  2FNP A;  1IO2 A;  4KIT B;  5K7F A;  4HSR A;  2QQB A;  2DAO A;  3KZY A;  3GXO A;  2LK2 A;  3F8C A;  4ENN A;  5HS8 A;  1H89 C;  4BBS J;  3V7S A;  2ICW G;  1U5T B;  3PL8 A;  5EEH A;  2F4O B;  4BBR J;  5FB2 A;  4D9J A;  2LP0 A;  4JX5 A;  1YQA A;  2VON A;  3RKQ A;  1FIP A;  2X9D A;  2F5V A;  4GYG A;  5ICC A;  4IL6 C;  4EMS A;  1TP4 A;  2X48 A;  2D1V A;  2GM4 A;  1VQN I;  5HLT A;  2DDA A;  4C2T A;  4F7Z A;  3DBL B;  4WXD A;  2NS8 A;  3OYA A;  2OZU A;  2DOA A;  4LOC A;  2P6T A;  2IGN A;  4WXH A;  1S5L C;  3MCZ A;  3GCM A;  2K86 A;  1YIO A;  3J7A Y;  1MNE A;  5J47 A;  4XLP F;  5HOD A;  1X1D A;  4XL9 A;  3GZ6 A;  4G7H F;  1HW1 A;  1QPM A;  3ESW B;  4AU7 A;  4BHB A;  1QPI A;  4W1U A;  5D4S A;  4BEH A;  2YU9 J;  3HHH A;  3FWE A;  1QVU A;  2DA4 A;  4DNC A;  2GZW A;  1B72 A;  2D2W A;  5E3L A;  4C2M J;  3F6V A;  5IP9 J;  5D8L B;  3WTU C;  1K6Y A;  2ESH A;  1KU7 A;  3AFH A;  2PX9 A;  1Z3X A;  2JVG A;  5DD8 A;  2VE8 A;  1KQ0 A;  3WU2 C;  3WU0 A;  1MBE A;  4A3F J;  1EH8 A;  2IA0 A;  4S0H B;  4BY1 J;  4GYI A; 
#chains in the Genus database with same CATH homology
 2HNH A;  2VB6 A;  4DBR A;  4ZC3 A;  1BR2 A;  3IP4 B;  4F91 B;  1LKX A;  3LSK A;  4NQW B;  2WY8 Q;  3MKY B;  3OYB A;  2R7R A;  4F93 B;  1EA3 A;  3I3L A;  3HG9 A;  2IS4 A;  3VYT B;  4D1Q A;  4BGD A;  4ZDO A;  3DTI A;  4KT6 A;  4IQJ A;  4RLQ A;  4IQ4 A;  2DCE A;  1DGR M;  4XNF A;  4J01 A;  3S32 A;  2RNG A;  3G2B A;  3TBI A;  4BS9 A;  1N78 A;  4PFP A;  3LSG A;  4IKF A;  3H9J A;  4IZZ A;  2WAD A;  4BJ6 C;  2AQE A;  3RPU D;  3K6G A;  3OYF A;  3DKX A;  3HOT A;  4CCJ A;  2X6Y A;  3OYC A;  3BG7 A;  2ZSH B;  4B44 A;  2DT6 A;  3EPZ A;  4XQF A;  4CCM A;  2W4S A;  1J09 A;  1P9Q C;  4MLO A;  4LIV A;  4CCO A;  3W2V A;  3OIQ A;  3OMY A;  5FRN A;  3MKW B;  4N4O B;  3ZXS A;  3DPT A;  1G8X A;  2CUZ A;  2K3P A;  3FBN B;  2HVQ A;  3ZGK A;  4LIU A;  4C2U A;  2CW8 A;  2LG4 A;  4QPQ A;  5JHF A;  2R7U A;  4C9Y A;  2R7T A;  1MMD A;  2CUJ A;  2L2O A;  2HQA A;  2JVH A;  2HVS A;  3EUA A;  4YRV A;  2DXI A;  3C2H A;  5FRM A;  1HA8 A;  1MND A;  4ZTF A;  2KLO A;  2JSP A;  3OIP A;  3RSN A;  4RM2 A;  4LG3 A;  3H9Q A;  3BCA A;  4XLH A;  3KYL A;  1FMV A;  3CZ6 A;  2MAB A;  2NOJ B;  3EUK L;  2HPM A;  4FAS D;  4R79 A;  2VL8 A;  1PYV A;  2CMP A;  2RRE A;  4DBQ A;  5HVQ C;  5LD2 C;  2F4I A;  1YX3 A;  1OR7 C;  2LC2 A;  3OYM A;  1JI8 A;  4PJN A;  2IS1 A;  3E0J B;  3QYE A;  2L7K A;  4XLE A;  4BJ5 C;  2KHM A;  3D5S C;  2WB1 A;  1W36 D;  3L2R A;  1N77 A;  5KCM A;  4ANJ A;  2E1M C;  1WJC A;  2R7V A;  2Y0S A;  3DU5 A;  2M4K A;  1U0J A;  3OR1 C;  4BE0 A;  4CCL A;  3IAS 2;  4HG2 A;  4HNU A;  4N4N B;  3KEY A;  2HPI A;  3OYD A;  2VJI A;  2MC4 A;  1N75 A;  2XF7 A;  2BOL A;  4CCK A;  3RTR A;  4BE2 A;  2X1C A;  2JUG A;  3ZR8 X;  2MD0 A;  4DJA A;  5KHD A;  2V6E A;  3V42 A;  1SAU A;  4ZTJ A;  4CSW A;  3HKZ A;  3PNT A;  5CQG A;  4G6T B;  2QKL B;  4DIQ A;  3UR3 C;  4PJJ A;  3OYG A;  3OS1 A;  1YE9 A;  3HPH A;  4FET A;  3N05 A;  1WFX A;  4F55 A;  2XAU A;  3PNY A;  2IGM A;  2R7Q A;  2VQL A;  4OWR B;  1QHH D;  3PJR A;  2CW7 A;  3ONQ A;  2WA0 A;  4E7K A;  4RLF A;  3AL0 C;  2WBM A;  3MMY B;  3IAM 2;  3LSH A;  1WJE A;  4X0G A;  3FDY A;  1V5G A;  4PJL A;  3OYH A;  2CV1 A;  2IS6 A;  2CFO A;  2BVM A;  2V9K A;  3PSF A;  2K9M A;  1OLT A;  1D1A A;  2E1M B;  2PJR B;  3LL7 A;  3M1C A;  1E0E A;  4NNJ A;  2ELJ A;  4P5O A;  2LYC A;  2X6X A;  1T0F C;  4XKV A;  2CV2 A;  4BUP A;  1X1B A;  3BCB A;  1TT0 A;  3L2Q A;  2W00 A;  3QOE A;  1X19 A;  3H9G A;  2LRE A;  4HST A;  3DKY A;  4XOT A;  3LMM A;  1ERD A;  2KRH A;  3H5N A;  4B43 A;  3HC7 A;  3K70 D;  3OL4 A;  4XR6 A;  3W2W A;  4E7Z A;  3MKZ A;  1Z3Y A;  1WJB A;  4RM3 A;  3HUG B;  1MMN A;  2KPM A;  2L9S A;  3L2V A;  5CQE A;  2BW3 A;  4F52 A;  2VXZ A;  3DWL E;  2HZD A;  2R7O A;  2LBF B;  1GLN A;  3D5R C;  2XF6 A;  3K4K A;  3FKJ A;  2WAF A;  3NWS A;  3SEQ A;  2VQG A;  3SEZ A;  2M4G A;  1SFK A;  4U7B A;  2HU9 A;  2BW3 B;  2R7S A;  3I9V 2;  3H5A A;  3CMM A;  5FRO A;  3S3O A;  3A2K A;  4H4K C;  2UUZ A;  3BC8 A;  4XLA A;  3VYR B;  4BQQ A;  3RQ4 A;  4AVZ A;  3PSI A;  3OYN A;  4HEA 2;  4CUG A;  2JA2 A;  3C2G A;  2XC7 A;  3OS2 A;  3DEE A;  4BXF A;  3OYL A;  4E7I A;  3HPG A;  1IRX A;  2GOM A;  4PJM A;  2R7W A;  2K9L A;  4CCN A;  1V5E A;  2MFZ A;  3S3M A;  1DGW Y;  1MMA A;  3BLY A;  2UWM A;  2R4G A;  3K4M A;  2OV7 A;  3CP8 A;  2PJR A;  1Y56 A;  1S9H A;  2GOX B;  1D1B A;  3CES A;  1NG6 A;  1FMW A;  4II3 A;  4OAZ A;  3K10 A;  2XDV A;  3DPU A;  4XKC A;  2IXS A;  2WY7 Q;  4CH7 A;  3KX2 A;  2VAS A;  4YEJ A;  1D0Y A;  4NC7 A;  3E1S A;  2PMZ A;  2VQH A;  2LOO A;  1MMG A;  4AYB A;  3ZRG A;  4BQO A;  3K4N A;  4KJZ A;  3UNG C;  5HNF A;  3LFU A;  3CJR B;  4NC8 A;  4XN3 A;  3VYS B;  2LBF A;  4PFO A;  2VJ4 A;  2VIX A;  2V1N A;  3PFY A;  4GRI A;  4P1W A;  3SZG A;  4F92 B;  2X1E A;  1LDK B;  2LY1 A;  3PUB A;  1UEL B;  4BDY A;  4LIT A;  2DJI A;  4B48 A;  2E5N A;  3K4C A;  4II2 A;  3OYK A;  3H5R A;  3W3C A;  3OYE A;  3VWB A;  3U21 A;  1BOB A;  2R7X A;  2VJ5 A;  3RCO A;  2A6T A;  2VKH A;  2IGK A;  5TGT A;  3DQV C;  3MD2 A;  2KDO A;  2AQF A;  2WAE A;  2X6W A;  4DGW B;  3VDX A;  4E7L A;  2M3A A;  4F3Q A;  3OL3 A;  4XMY A;  1X1C A;  2VQC A;  3QOD A;  2F6C A;  3DPL C;  3F9K A;  2IS2 A;  4HPQ A;  4Y33 A;  4JQF A;  3HL2 A;  4Y4R A;  2A5W A;  2Q1Z B;  2OUM A;  1WJF A;  2IGO A;  5LFA A;  4XOR A;  1V5F A;  3H0D A;  2HVR A;  2XF5 A;  1R6R A;  3OYI A;  2M0M A;  3DLA A;  2KP6 A;  2CV0 A;  2VKD A;  4ITV A;  4BU2 A;  1LVK A;  4E7H A;  3GBG A;  3W2A A;  3K4L A;  5CPR B;  3FHN A;  4XLC A;  3CP2 A;  4RMN A;  3SDB A;  3ZQQ A;  4BAC A;  3A4C A;  4CZC A;  1W36 C;  4BE1 A;  5HOO A;  2E5Z A;  1AA7 A;  2OC6 A;  2I8D A;  4BJT A;  4XKW A;  2UV1 A;  2HDW A;  1D0Z A;  3DU6 A;  1PJR A;  1BR1 A;  1WJA A;  1YX5 A;  1DQU A;  1TZL A;  4BEH B;  4E7S A;  1WJ5 A;  4BQN A;  4J00 A;  4PSW A;  2KRC A;  5HNH A;  3S8P A;  2W7N A;  1D0X A;  2LH9 A;  3QYB A;  2VXD A;  2KZV A;  3D5L A;  1T95 A;  3OOU A;  2V7F A;  2X1D A;  3TMO A;  2ZXI A;  3TL4 X;  4XON A;  3L2W A;  4EAT A;  1KON A;  3VYU B;  2KMU A;  4ZJZ A;  3IUO A;  2ZXH A;  2Q2E B;  2L9N A;  1Z21 A;  2WAQ A;  3NWT A;  1D1C A;  1WJD A;  3H35 A;  2Z2S B;  3QYF A;  4PSX A;  2MYS A;  1DP3 A;  4E4H A;  4XM3 A;  1Z7L A;  3OS0 A;  2CH0 A;  2ZSI B;  2VLA A;  4KIT B;  4XKB A;  4HSR A;  2Z16 A;  2LY2 A;  1ZEL A;  3HXL A;  4HRI A;  2QKM B;  3HOS A;  3PL8 A;  2ZFU A;  4PUS A;  2Z1D A;  4B3X A;  4E7J A;  4D9J A;  3BG6 A;  2KQR A;  1QU3 A;  2BVL A;  4QPO A;  2F5V A;  1UG0 A;  3LSM A;  3SYT A;  4XN0 A;  3AL0 B;  1X1A A;  1Y6I A;  4ZYA A;  3OYJ A;  2M7B A;  2KL4 A;  2VPL A;  4BL0 B;  2P0W A;  5HLT A;  3OY9 A;  3L2U A;  2W82 A;  4C2T A;  3CJQ B;  3OYA A;  2K5C A;  1BR4 A;  2DOA A;  2DT7 B;  3A1Y A;  4PK4 A;  4ZDP A;  4CA0 A;  4KIS A;  4ZDL A;  2IGN A;  1X4P A;  4E6K G;  2V26 A;  3ZCO A;  3J7A Y;  1MNE A;  1X1D A;  3M8J A;  2O5R A;  2X85 A;  4XL9 A;  4AU7 A;  1LFP A;  2V4J C;  4U87 A;  4Y3O A;  2X51 A;  3EUH C;  4BEH A;  2M7A A;  2CS3 A;  2RQQ A;  4XLF A;  1G59 A;  3K4B A;  4HNT A;  3S3N A;  2L5Q A;  3FBI B;  1UAA A;  1VZ0 A;  3CF2 A;  2LRD A;  3OWT A;  4YEL A;  4JOM A;  4BDZ A;  3DTE A;  1K6Y A;  3AKZ A;  3S93 A;  3DTK A;  3K4J A;  3AFH A;  5CKT A;  1NG7 A;  3OR2 C;  3VSK A;  3PNV A;  4C30 A;  1QHG A;  1Z3X A;  2JVG A;  4OAY A;  2VJJ A;  2W1O A;  4XOP A;  4DOZ A;  3VSL A;  1X4O A;  3LSI A;  2FUG 2;  2E60 A;  2XSJ C;  1MW7 A;  5KNL A;  4IX7 A;  4NUB A;  3K70 C;  4B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...