3A1YA

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
MEYVYAALLLHSVGKEINEENLKAVLQAAGVEPEEARIKALVAALEGVNIDEVIEKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein P1 (L12P)
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 20
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3a1yA00
2LBFB 2LBFA 4BEHA 4BEHB 2W1OA 3A1YA
chains in the Genus database with same CATH superfamily
2P5KA 3K9TA 4D5FA 4AM3A 1HW1A 1F36A 3PO3J 1YS6A 3BOQA 3Q3SA 2K85A 3RYPA 1VQOI 1TW3A 3BC8A 1QNTA 1EV7A 2VJJA 3DKYA 3Q0VA 3KP2A 1GT0C 3S3NA 3GTGJ 3C2HA 3IRQA 3TO6A 2OZUA 3DKXA 4HQMA 3FHNA 1YW9A 4MEXF 4IL6C 3K4KA 4I0BA 3JREA 4MQ9F 3OYIA 1E3PA 3G1OA 1KU7A 1CF7A 3MFKA 1T39A 2XC7A 5LLQA 2CW7A 5DCMA 4ZZDA 3DPTA 2JUGA 1K78B 4UY8I 3CCQI 2NS0A 3ZMZA 4OU0A 2XVCA 4OIPF 4FASD 3AL0B 4LG0B 2MLGA 5LHGA 2JPBA 2R7XA 2CV1A 2F4MB 1IN6A 2XGEA 3ABLH 3GLLA 2CW0F 5DD8A 4S04A 3JAMZ 1JJ8C 2XRLA 1RKTA 3OSGA 5GAGJ 1TW2A 2M4GA 2XF6A 3OS0A 2JVGA 4RAFA 1DQUA 1ZHFA 1FYMA 1PJRA 2JMWA 3E0JB 4UUSA 1R58A 4RGUA 1R00A 2K3FA 4GXOA 4IOCF 1DU0A 1HDDC 2DQLA 4M9ZA 4WX9A 4L5IA 4ESFA 3L2QA 2XV4S 1H89C 2V1NA 4EQQA 1QHGA 2VT2A 2PMZN 3V7CA 3M7GA 4ZYAA 2VBXA 2ELKA 2PJPA 2XKOA 3FWEA 5J1YA 5FKNA 3ABTA 3AG1H 4CYDA 3VODA 1VTNC 2VKVA 2KIQA 4Y4RA 4YELA 4BH9A 3WTWC 2EZKA 3IH2A 3PQJA 2WAQA 3K1PA 2LREA 2WY7Q 4P5OA 2A3SA 1X3UA 4G7ZF 2ISYA 3WG7H 3N97A 1F4KA 1JJ6C 2HDDA 1R5HA 4XLFA 3LSIA 2ISZA 2E5ZA 4AIJA 2QSFX 3ZQQA 1MBHA 3CCRI 2F6CA 2VLAA 2OA4A 4WCGA 3K1MA 5K5RA 2CQXA 2GZWA 4IRGA 4BQAA 1HA8A 1Y56A 1UJ8A 2RDPA 1VQKI 1UB9A 4PCQA 2VJ4A 3M8EA 3S14J 1TBXA 4XORA 1J09A 4IHSA 5EG0A 3S3OA 3OYBA 2GOMA 4PSWA 1LE8B 1I6XA 5HS7A 4MQVA 4QLCU 2O6GE 5CPRB 1OKRA 2STTA 2GBYA 3BPXA 2DO7A 5E8IA 4IHTA 3W6JB 2WV1A 4TV7A 2Y0MA 5EZGA 4PSXA 3M8JA 5E3OA 2FNPA 2HXOA 2YU3A 1WSUA 3JRHA 2DOAA 2E2IJ 3OIPA 4F93B 2CUJA 5EZHA 2Z9OA 1W5CC 1E0EA 1X2MA 2FUG2 3LFKA 4PK4A 5K7FA 4OIQF 3D1NI 2M87A 3RPUD 3SQNA 3GEZA 3TGNA 4E6KG 1O3TA 2EB7A 3R0JA 2HVRA 2V4JC 3GO5A 3GFJA 4EJOA 1ON2A 2R7FA 4A3JJ 3I3LA 3TMOA 3H3UA 2IGKA 4ZDOA 1S5LC 2M7BA 1FEXA 1SVLA 3HOZJ 1P7JA 3VYTB 3VWBA 2ZXIA 1JKOC 2H6BA 2V9PA 5A2QK 4IF4A 2W57A 1QPIA 2CV2A 3WGGA 3ZMDA 4HNTA 4KISA 4UNOA 4BS9A 3JW4A 2ZO4A 3MCZA 4HLXA 1WWXA 2MD5A 1KQ9A 3CF5F 3BTJA 4UHTA 3OYCA 1A5JA 5HLIA 3ML6A 5D6EA 1UFMA 2GIZA 3S8PA 4XR6A 4GYGA 2ME0A 5E3MA 2ELJA 1TWCJ 2JRMA 2L5QA 3HRTA 3WU2C 2CRGA 1TQIA 4XLNF 1XGOA 1YYVA 3FM5A 3H0GJ 4XRSA 4CCKA 1K6YA 1I39A 2CGPA 4IVNA 4L18B 1EA3A 2W85A 1IAWA 2DT6A 3MKWB 4B09A 2LVSA 2E1CA 2M0CA 2NRAC 2B9SA 2E35A 2W25A 2W82A 4Y3OA 2V6EA 1LKXA 1T0FA 2O3FA 3AG4H 4RMNA 5D4SA 1Y8QB 3BG6A 3I64A 2JA6J 2UV1A 1FTTA 3HSRA 1OYIA 3KIOA 4RB1A 3DBLB 1JGGA 1IRZA 2KIUA 1R1VA 2L7FP 1H9GA 3TO9A 1FZPB 3OOPA 1Z9CA 1MMNA 2M8EA 3QWLA 3U1KA 2V1UA 1MIJA 4A93J 3IUOA 5F64A 5D6FA 2BY2A 2E36A 2QKLB 4IHYA 4A3GJ 4FISA 1OYYA 1IUFA 2W24A 1YE9A 4O6JA 2H8RA 2XRNA 5J4VA 2LKXA 2IBDA 4PFPA 1P92A 3HOUJ 2CQ7A 1QPMA 5JLWA 3G73A 3KX2A 2X48A 4LB6B 4B4CA 3A01A 4KIBA 3L00A 2ZJRF 4ENMA 1QBJA 1VQPI 2E1MC 3Q9SA 4DQ2A 2TRTA 1OCZH 4D0PA 1XN7A 3HRSA 5J1RA 1ETXA 2DBBA 2HYFA 3GFMA 3IAS2 5FKMA 2Q2EB 2KJBA 3HKZA 2LR8A 4W97A 4XSZF 2CH0A 3LSTA 4XONA 4E4HA 3OYAA 2R7WA 1BL0A 1EH7A 1MNDA 2XPWA 3RKXA 4WWCA 2LF7A 2DYRH 3HIFA 1SFUA 3LSPA 2VOOA 1G6NA 3G1MA 3R61A 4CYCB 1O7LA 4CGZA 3CUQB 4UVBA 3G2BA 4FQGA 5TGTA 1CGPA 1IJWC 1X1BA 2A69F 5HNHA 3TEDA 4B1RA 4AYBA 4DOZA 5IYCJ 1Z7UA 1G8XA 3KEYA 1R1TA 1G3TA 2UUZA 4PJJA 4I99C 1S3JA 3JTHA 3CF2A 2IA0A 5E1WA 4KUMA 3VSLA 4HNVA 3CCMI 1FBUA 1V55H 1VQNI 4HV5A 3HGGA 2Y75A 5EEHA 5M3MJ 4E7JA 3WG9A 1QZYA 5CVUA 3G1LA 1R7JA 2F4IA 3K69A 4R79A 3I4PA 3H1CA 1S72I 3MEXA 2G7UA 1XB4A 2RQQA 1WGXA 1KU3A 4GGGA 1SFKA 3EDPA 3Q0WA 3AFHA 2IA2A 2LTPA 4X1EA 1BC8C 5IYDJ 3KP4A 4QSHA 2R92J 3SZPA 2IGOA 2XAJA 3I59A 1MNMC 1D1AA 3FKJA 1FX7A 2MC3A 4OIRF 4OIOF 2VPLA 2LP0A 4DNCA 3G3ZA 3M8FA 4RDUA 2F2EA 2ICWG 1LPQA 3S32A 2VPRA 1YTYA 3BR1A 3ZQIA 2A6EF 3ERED 4BQNA 5L3EA 4ESJA 3HOYJ 5HNFA 2B63J 1S8NA 2H6CA 4NB5A 1ZYRF 4HRIA 3RKWA 1O7FA 2W7NA 3WU1B 3J80K 2EA2A 2P4WA 1MDMA 5HLTA 2QENA 3DTIA 4QWQA 5FO5A 3S1QJ 2V6CA 3NAUA 1MMDA 2A6HF 3TW7A 2DPUA 4EVIA 4KDPA 2EA4A 4HSTA 2DMNA 4A3KJ 3DTKA 1G3SA 1QVUA 4V2GA 1NG6A 1HLVA 4XKWA 3FXUA 2H8WA 3BROA 2K3PA 4HF2A 3K4MA 5FRNA 1IV6A 2EBIA 1V3FA 3OYLA 3DP7A 2HWVA 4II3A 3RJPA 1U0JA 2NYXA 4A0XA 1MW7A 4HF1A 1JTXA 2ESNA 4G7OF 2LY9A 2I5UA 1OR7C 2LKPA 2YS9A 5ICGA 1U78A 4ENKA 1B8IB 4NNJA 4DGWB 3LA7A 1R9TJ 3C18A 3CP2A 4LK1F 5KAIC 2WV0A 2EWNA 2W84A 4ESBA 1O3SA 3OY9A 2H09A 3ISPA 5HLGA 3K4CA 3K70C 1BW6A 2KRFA 3RIRA 3JR9A 4NQWB 5K5OA 2QWWA 5EF6A 2QBYB 4G12A 1XCVA 1W5SA 3MZYA 3I9V2 3KYDB 2DK5A 1BIBA 4XLHA 5F0CA 3AKZA 4HX4A 2EFWA 1KA8A 4A3IJ 2K7LA 4BYYA 1MBEA 1T6SA 4QTRA 3PIOF 3HDDA 2ZJPF 3OS1A 2NNNA 4EMSA 4IQJA 4IPAA 2DAOA 5FFXA 2LF8A 1OYWA 2ZSHB 3S2HJ 4HAMA 5GP9A 2ZJ2A 2K02A 1MJ9A 4I2OA 2IGNA 4ITVA 1K4TA 3K70D 2R93J 3PJRA 3FXRA 3WGHA 1RNLA 1JUPA 3HUGA 2XUBA 3CCVI 1UHWA 3EUAA 1U8RA 3OV8A 2V26A 1Z7LA 2V79A 2X1CA 2NS7A 3ASOH 4JX6A 3LSGA 4BQOA 4D9JA 2A6TA 1V54H 2BE5F 3ECOA 3PIPF 3W2VA 2EILH 3PFIA 2B7EA 2VKHA 3ZR8X 3OYDA 1JT6A 4CO8A 2VUMJ 3FXOA 4M3DA 5JHFA 2ZFUA 3ZQHA 2QQ9A 1ETVA 5J40A 1XTAA 2L9RA 1BBYA 2M3AA 5B1BH 1ITYA 4XOTA 2HU9A 2RN7A 2XGDA 2L7KA 1N25A 1F9NA 2HOEA 4E7LA 3QYBA 2MD0A 4UV8A 3QODA 3FF5A 3LA2A 2PEXA 3S1RJ 2D5VA 5LHHA 3KETA 3HSFA 1PUFA 3J7AY 4KT6A 5LGTA 3IC7A 4EJUA 3MD2A 5LEKA 1O3QA 1H9TA 1XGMA 1QZZA 4G6DA 3BJ6A 1F5TA 4E7SA 4NBQA 5C4JJ 1UMQA 1A04A 2N8GA 3EETA 4LG3A 3RYRA 3I58A 3BTLA 4CCJA 4V2FA 2VC0A 4GRIA 3SDBA 2STWA 1R6RA 3S2WA 3W2AA 2JA7J 1FOWA 4HLYA 4DZPA 1N77A 4P9UA 2XIGA 3CUOA 1E2XA 4UUVA 1WFXA 3WTUC 1HOMA 3ULQB 4K2EA 4BDYA 4LLNA 1BM9A 2EJRA 4BL0B 1Z3XA 2ZBKA 1XSDA 1FYKA 3IKVA 3CZ6A 1Y0UA 1MNEA 3PUFA 3U2RA 3WTXC 1QU3A 3UR3C 2Z2SB 1JKQC 3ABKH 3K4JA 2JA5J 4M9SA 2LD5A 1X1CA 2ELHA 2W48A 2ZNZA 4IHWA 5E17F 2K40A 3ZGKA 3MKZA 3BG5A 2XB5A 1QVTA 2KZVA 2V7FA 3WGIA 2M45A 1ZELA 1DUXC 2LK2A 3ECHA 2VODA 1ETYA 3V8KA 2QLZA 4KT5C 1TWHJ 3F6OA 5C4XJ 3CJNA 1FSEA 5CQGA 1K7AA 2M8GX 4I76A 4ZYDA 4LMYA 3GTJJ 4ON0A 4IRIA 1DU6A 2FA5A 3GTOJ 3E1SA 3O8HA 1KZHA 4A69C 1ZRCA 2Z1DA 2UWMA 3GTPJ 3JSOA 2OAZA 2MG4A 4KJZA 1TT5B 2VKEA 3NRVA 3UKGA 3OYNA 2Q1ZB 1R36A 5ICFA 5HS9A 3JRGA 2DW4A 1IN8A 3QQAA 4A3CJ 3CC4I 2E60A 4ZC3A 1MSFC 3L2RA 2E19A 1I1GA 1Z6RA 1RKWA 4X0GA 3BJOA 1BOBA 3CO6C 3WE3A 3ELKA 2X4HA 3CMAI 2OQGA 2HZDA 2JA2A 3GZ6A 2P0WA 2OV7A 2X6OA 2ZXJA 2CUEA 1ZGAA 4D1QA 1YLFA 3VOEA 5E79C 1T0FC 1XS9A 1I27A 2WB1A 3BTIA 2L02A 1FY7A 2QQBA 1BR4A 4G8XA 1TP4A 3V4GA 5JFRA 3J81Z 5C44J 2GXGA 4A0YA 3R4KA 2AS5F 2FMYA 1J2XA 2FQ3A 4PJMA 3O2PE 5A2QZ 1JHFA 3CMMA 2CO5A 2ZCWA 5LGUA 4U0YA 3G4SI 1ETKA 1OR7A 1G3WA 5HDNA 5E18F 3RZDJ 1VQMI 3CJTB 2I8DA 4XL9A 1VF9A 1FOXA 3KP6A 3JTGA 4L5EA 5K5QA 1X1PA 2RKHA 1K78A 2TCTA 4G7HF 4L0YB 1IRXA 2LFBA 4XN0A 1I5ZA 2BHZA 4M6YA 1Z77A 1HKTA 3I5UA 3PNTA 3SEZA 4UUTA 4LG0A 1YIJI 2A68F 1DPUA 4ZYEA 1X19A 2VONA 2KPMA 4CUGA 2XB0X 3WTZA 4A3EJ 3ZXSA 3ZQGA 4A6EA 1MGTA 3BG7A 3H5AA 3NWTA 2JRTA 2L01A 1B72B 2H27A 2ZSIB 2L9SA 4PFOA 2C6YA 2Y9YA 1TZLA 1PP8F 1SVMA 3FXKA 3OL4A 4DBQA 4KN4X 5E8GA 4EM2A 4CA0A 4B3XA 2DJIA 2MH9A 3OWTA 4WXCA 2M7AA 2M0MA 1Z67A 3GZ5A 3FZVA 1DGRM 2HGCA 1X1DA 2IA1A 1X2NA 2A5YB 1U5TC 1ETQA 4M6VA 3BTCA 3MN2A 4ABZA 1Y0NA 2EFOA 2LG4A 2LSOA 3OYKA 2Y69H 3SYTA 3K1NA 4U0WA 3K2ZA 2RV8A 1F43A 4L9VA 1CF7B 4I7HA 3LA3A 3ASNH 3GW2A 3DEWA 3QPSA 1YX3A 2LRDA 5H6QA 3HHGA 1BOAA 2FF4A 3QP6A 1TQPA 3ERMA 4YFXF 3KEQA 1Y39A 1LUJB 1U9NA 4JYKA 1IC8A 2X0LA 2MGQA 1OFCX 1KONA 2VT3A 2WBMA 3FXJA 4YEJA 4AC0A 4BBRJ 1NK3P 3TOBA 1YS7A 3HZJA 3R6SA 2DMUA 2XGXA 1K83J 3HM5A 2Q8KA 2O5RA 3PM1A 4RGSA 5CVJA 1Y1VJ 5M5WJ 2AHQA 3O6BB 1TNSA 2JPCA 2MABA 3P5JA 3CJRB 4HSRA 2HZTA 4UUSB 3CDIA 1LDJA 4U88A 1LE8A 1AKHB 2HDCA 5LEJA 4CXFA 4FX4A 1RR7A 2LC2A 3GF2A 2YU9J 4AYBN 1W7PB 5J8FA 5D8LB 2MSYA 3DU5A 2ZKZA 1BR1A 4ZDLA 1R5ID 1ETOA 5M5YJ 4RBOA 3F23A 2F5EA 1G59A 1U6GA 3HGYA 1D0XA 3NQOA 2WC2A 2DT7B 2PJRA 2RC4A 4M3EA 2AO9A 3TP3A 1JKPC 1MMAA 4HBLA 2DPDA 3G6EI 4HZFA 1J0RA 4HNUA 5JR3A 5CKTA 2AQEA 3HPHA 1AHDP 3I4NJ 4XLPF 1LEBA 2HQ5A 3DQVC 1XDSA 3B73A 1IXCA 2YR2A 2WWYA 2DQRA 4IHXA 2K86A 1GDTA 1QO0D 5FB2A 1FPQA 3LOCA 3A02A 1RIOH 5FJ8J 1GV5A 2D1VA 5KCMA 1NG7A 5EG0B 4G6TB 5BQTA 1XGSA 3QYFA 4M3FA 1V4RA 4XLEA 1K6OA 3KYLA 4UVAA 5DYMA 1QZEA 3OYGA 3Q0UA 4QPQA 3J81K 1SMYF 2R7ZJ 4BJ6C 2GQQA 1ETWA 3BPVA 1JGSA 2EIKH 4U0VA 3J7YJ 1I6HJ 1R5GA 4M3BA 1Y6IA 1O3RA 2MA3A 3KLOA 4X6AJ 1MJBA 3F8CA 5L3FA 3J80Z 4B48A 1DDNA 2JSPA 4OMYA 3WTSC 2VBZA 2L4AA 5D5WB 2PMHA 3B6CA 3L1PA 5JVGF 1FLIA 4C3JJ 1M1EB 1O4XA 1YHQI 2ZMEC 3H9QA 4BE0A 1P4XA 2HKXA 2JN6A 3SZGA 4CCOA 1TL8A 1ODDA 3OYJA 3ZPLA 1V5GA 4KICA 5FKOA 2VIXA 3U21A 3OYFA 3B02A 3CCEI 5EJCA 4AU7A 2BY0A 3HTUA 4AIKA 2Z16A 2RNGA 4I6ZA 2GLOA 1YOVB 3DPUA 2VQHA 3FDYA 5F08A 1USTA 2COMA 2KRHA 1X3WB 4M72A 3QU6A 1WPKA 3RSNA 4E7HA 5EEAA 2XROA 3BG9A 3I0TA 5BPDA 1IGNA 4LOCA 2HNHA 2LYCA 3QOEA 2CQNA 2XAQA 3HRMA 1RC9A 4IO9F 1E17A 2XDVA 2OCEA 1VNDA 1A6IA 4RB2C 3CCYA 3A03A 3TOAA 3L2UA 1U2WA 2DJNA 3DKWA 3A0HC 1Z05A 3LSRA 4KIFA 1VQLI 4CCLA 2YX7A 3H5RA 2Y9ZA 2W1OA 4KITB 3CMEI 3MZ8A 3WHBA 2P6SA 2DFFA 2JZYA 4A3MJ 4DYCA 2HDWA 2DTZA 2H1LA 2P7VB 5AIPA 4M74A 2YSRA 3GLXA 2NVYJ 3LQRA 1BW5A 3EUHA 4F92B 3TKYA 2L9NA 3HL2A 1FP1D 2BW3A 4OOIA 2ETHA 1R71A 2D2WA 3T8TA 4B47A 4BEHB 4NC7A 3TDZC 2B0LA 1IV8A 3GWZA 2OTJI 2HR3A 2GM4A 1Z1DA 5E1XA 1NK2P 1AA7A 2R4GA 1KQ0A 1FJLA 5CQEA 3PSFA 3IH3A 2HQRA 2QUFA 1Y8RB 4Y33A 5DD4A 5HDGA 4BGDA 2MLKA 4XRMA 1NH3A 2GXBA 2R7VA 1LFPA 1SFXA 1QRYA 2KRCA 2VBWA 4FT8A 3ZMTA 3E7LA 4XRSG 4CDGA 1ULYA 1U3EM 2HKOA 4RS8A 5H2FC 2V9KA 2EH3A 1U5TA 4ASNA 1BI1A 4EGZA 2A05A 3HRUA 1JUMA 1E3HA 1LB2A 2L7ZA 3FHZA 1A6QA 1H0MA 4DZJA 3S93A 1R22A 3W6KB 2VI6A 2LY2A 3PNYA 3PUBA 2IJLA 2R5ZA 4C3IJ 3DFGA 2DYSH 4O5VA 4PJ0C 2Z99A 3TBIA 5FLVA 3LWFA 4AVPA 3JCUC 4IKFA 2DA2A 2Y48A 6PAXA 5E3NA 3ZN1A 4FTHA 5LRRA 2Y2ZA 3RQ4A 2JK3A 2LNBA 4OINF 4CH7A 2BVLA 3C3WA 3FK6A 3OR2C 1VQ4I 3FXLA 1WJBA 4OAZA 2RQPA 4B8XA 3QPLA 1A35A 2VQGA 2DA1A 3GTKJ 1TQMA 1WJ5A 3BR3A 4JX5A 2JWTA 2MYSA 1W5TA 2CFOA 3IL2A 4YIRX 4F91B 1EH6A 1N75A 2OQRA 2Z5UA 3CDHA 3I53A 4RAZA 3ZOBA 1R23A 2L3DA 3KFWX 1D8KA 5HS8A 1XMKA 3IAM2 1ZAOA 5D5UB 1UG2A 4L5JA 3EPZA 2M9HA 2P6TA 3S2DJ 1S9HA 5ILUA 3P7NA 3P9IA 3C2GA 1D5YA 2F5CA 2FJ1A 4BXXJ 3GFIA 2HXIA 3TL4X 5ERIA 3RQIA 1OCRH 1B1BA 3FMRA 4RGXA 5IYBJ 4XLAA 3CCUI 3JRBA 1PP7U 3BZ6A 1XGNA 2G0EA 3H92A 1A36A 2I10A 2DMTA 4L9NA 1BJZA 3S1MJ 1LFBA 3DLLF 4N9IA 4QIWN 1IDZA 2HPIA 2R5YA 4XBFA 3ZMUA 2IS6A 1HSTA 2FD5A 3DLAA 3I59B 5ICEA 5IT9K 3FBIB 1QQIA 3GFLA 5L3GA 3P9CA 4RAGA 1ZG5A 2NOGA 3H35A 2MC4A 2IVMA 3LSMA 5E1ZB 1FSHA 1ZRDA 1B8IA 5IOYA 2E2HJ 2JT1A 3QYEA 5JI6A 5AIQA 5F04A 4WF2A 4HYEA 3FM3A 3KZYA 1PUEE 5DDGA 1K61A 1RZ4A 1J9IA 4XOPA 4KMUX 2WTEA 1P4AA 2XKPA 4CZCA 1ZG3A 3BQZA 4NQWA 2KMUA 3BZKA 2MW8A 4JQFA 2M4KA 3BWGA 3HG9A 1UZCA 4F55A 1I50J 3LSHA 3CCLI 2O0YA 4F52A 2DFIA 2PG4A 3FMQA 2P5VA 3DV8A 3VDXA 3LNQA 4F3QA 1FNNA 2VE8A 3SXYA 1FWZA 1FMWA 2ZMEA 3HTSB 3L9FA 5IP7J 2XHKA 1BC7C 3AL0C 2DA6A 1WJFA 4EM0B 3CLQA 3F3XA 2WB1N 3FMSA 1I1SA 2HVSA 5K1YA 4BE2A 1FBQA 1GXQA 1RUOA 3OYHA 4V19K 1MBGA 2KKOA 1NTCA 2P8TA 2KDZA 1HC8A 2FBIA 2P7CB 2PQ8A 4NDLA 4RLFA 5GAHJ 5E3LA 2K9NA 2M30A 3IWFA 3WU0A 2YPRA 4LLLA 2EIJH 3E6CC 1D5VA 1WI9A 3K10A 3M1EA 1TC3C 1O57A 1S7EA 3VB2A 3T0YA 1YQAA 3LMMA 1Z91A 4BNCA 2OZ6A 4A12A 2GA1A 2A61A 3GZNB 4OWRB 3ESWB 2NVQJ 2K5CA 2X6XA 4BDZA 3NWSA 4P1WA 4Q48A 1X4PA 3F22A 3TP0A 2IAIA 4HX8A 5CYVA 5DV5A 3TDUC 3HOSA 1ZRFA 4PGHA 4MEYF 3E5XA 2LOOA 2WAEA 1WJCA 5HODA 4BAYA 4N0BA 5CJ9A 5HDKA 2MBFA 3BR6A 2ZC2A 1OCPA 1P9QC 2UXXA 2QSHX 5M3FJ 4DYRA 4ZTFA 2DLLA 1U9OA 5EEGA 4A5MA 2BHYA 2G7HA 1EJ9A 4JK1X 3EYYA 4XLCA 1HW5A 1JI8A 2X1EA 4OAYA 1RR8C 4UVCA 1HW2A 4PGGA 2VC1A 4B44A 4XKBA 4A2UA 3HUGB 2Q0OA 3LFUA 1YRNA 4NC6A 1TTYA 1GV2A 3ZQLA 1WRJA 5ILSA 5D8KB 5BMZA 1ZR2A 3R0AA 4PDKA 1JHHA 3MVPA 2ECCA 4M9XA 4YG2F 2DN0A 4RB3C 2BBYA 2DXIA 1W0UA 1WI3A 2OU2A 5B5EC 1YFHA 4G9YA 5FRMA 1MJAA 3H9GA 1S7OA 2YUSA 3A4CA 1JTYA 3F8MA 1V5FA 2CJJA 2COBA 4HG2A 4N4OB 4A6DA 2LBFA 4LD5A 1XMAA 4B43A 3GUDA 4XRFA 2K9LA 2BXZA 1SD4A 2WAQN 1AU7A 1VQ8I 2BXYA 4MTEA 4C3HJ 2QEXI 3COAC 1WJAA 5ILVA 1WJDA 2QYOA 3H0DA 1SFEA 2D45A 4HQEA 5JHUA 1TLHB 2E1MB 3HEFA 3S3MA 1Z6TA 3RDIA 2QM3A 5HLHA 1PUFB 4CSWA 4FHTA 2R7TA 1G3YA 1GVDA 2RGVA 3RZOJ 4HA8A 1D0YA 2AQFA 2BY3A 2HTSA 2VOPA 2LLKA 3HC7A 3QP5A 2QCOA 3J7AO 1IRFA 1T08B 2NVTJ 4E7IA 2KQRA 4GYIA 4CICA 2E71A 5CVIA 4RM2A 4D5CA 2K9QA 2XPVA 3M3YJ 5TISC 3JRAA 2ID3A 3SDGA 1KU9A 2FX0A 3JRIA 2DFHA 5LGNA 3BCBA 4M73A 3RKYA 3MQ0A 3DBRB 3QU3A 4GDFA 5KK1A 2FMLA 2XAGA 3VSKA 5KNLA 2ZNYA 3PQKA 4IX7A 2J5OA 4LB5A 2EZIA 3DU6A 1LVKA 2DU9A 3QPTA 3BP8A 2EFNA 2K4BA 5GADJ 1YJNI 2CFXA 4NHJA 5F1JA 1F1ZA 3SFZA 1OQYA 2XF5A 2R7RA 2DCEA 3HPGA 1ZKGA 3HSEA 4PUSA 5GTIC 3LQQA 4PJLA 3HHHA 3IH4A 2CUFA 4I02A 1XPXA 2OC6A 2HOAA 2EZHA 1WH7A 2GOXB 2HYGD 4Z2YA 5D4RA 3L2WA 4EEFG 1TWAJ 4C30A 1ZGJA 4P9FA 2BGCA 4I0AA 4I09A 2BZTA 1ERDA 3H9JA 3BDDA 3LAPA 1T56A 1I3AA 2F4OB 1MBKA 4L9TA 5F0FA 4BHBA 4RA2A 2IS1A 3HB9A 2E2JJ 3OMYA 4ZZLA 5HOOA 3ZQCA 1CQTA 3GTLJ 5EGOB 1P7IA 2WAFA 3FKIJ 1C0WA 3S16J 4LITA 4D7MA 3KZIC 1MBJA 3JSPA 2HEOA 2DI3A 3DPLC 1P6RA 1B9MA 3HXLA 1IXRC 4I98B 3OIQA 4ZH4F 3GTMJ 2X6YA 4BACA 1K79A 5M5XJ 2FXAA 3EUHC 2CQQA 3AAFA 4LFUA 2E1OA 2ZJQF 3CC7I 4IEJA 2DOFA 2VE9A 2O9LA 1FT9A 1KQ8A 1YG2A 2NVUB 4YFKF 2IEKA 3M9AA 5D5VB 2EPFA 2H1KA 4WXHA 2PFBA 5EYRA 3FISA 4YIIA 3UNGC 2X85A 4G94A 2HQNA 5TJJA 1APLC 3A0BC 1W1WE 3CD6I 1P4WA 1FYLA 1YI2I 3C1DA 3CUQC 1OCTC 5J1UA 2Y30A 5KAFC 2M5WA 3C7JA 5ICCA 4PZJA 3GTQJ 4XKCA 4BU2A 4RLQA 1SEUA 3DXJF 5DCFA 4P96A 4AVZA 2IT0A 2KDOA 3ABUA 1W0TA 2XAUA 3HOWJ 1YO5C 2F5FA 3WODF 4FCYA 1V5EA 2QSGX 1IO2A 3FXQA 4ETSA 5DCMB 3OS2A 1IZ1A 5IPAA 1SAXA 1WHUA 3J7ZI 5IP9J 3M1CA 3OOUA 5DUKA 3ZQFA 2NAZA 1UHSA 3E6MA 5D5XB 4AWXB 3FK7A 3HKZN 5B1AH 4JBAA 1AKHA 2FOKA 1WCMJ 3DWLE 2K9SA 3OYEA 2PX9A 3CCSI 3GMEA 1W7PA 2MH2A 3JRFA 1BIAA 3MKYB 1J75A 3A2KA 2CS3A 1YITI 5J3LA 1KYWA 3MWMA 1USSA 3IRRA 2OUMA 3IP4B 3CO7C 2RVCA 9ANTA 4DJAA 1XMXA 4R8HA 1WJEA 3LSJA 3ZRGA 2R0QC 4BBSJ 3CTAA 4M71A 4A0ZA 3IV5A 2KT0A 2V1DA 2FU4A 4BY7J 1IG7A 3F8FA 1B59A 1PYVA 1WKMA 3D5LA 4CHUA 4LK0F 2FBKA 3V42A 4XN3A 4F7ZA 2QA4I 2DT5A 2KL4A 5H20A 1ZLKA 2MFZA 2CYYA 1GVJA 2BYVE 2IP2A 2QF7A 2XAFA 3SJMA 5DM6F 4IHVA 3BR5A 4UXNA 5L3DA 2P5LC 1L0OC 1S29A 4EM1A 3H5NA 2L0KA 4U7BA 1WQ2A 2R7UA 2R7OA 3TW6A 2H94A 4UB6C 2CQKA 1E3OC 3K7AJ 2VJ5A 3F0CA 1OLTA 3WTYC 1ZH5A 5K7ZA 2A07F 1D1CA 1UELB 1XX5A 2XF7A 4HEA2 1UG0A 2ZB9A 2PBIA 2QZ8A 3H3VK 2FNAA 4EV0A 2K4JA 3F72A 4P55A 2NNYA 3EQLF 2X6WA 1RESA 2ZXHA 1YJWI 3I55I 3U1DA 1X1AA 3ROUA 3M07A 2FOWA 2JTVA 2JA8J 2JQ7A 1REPC 1XC5A 1R49A 3OR1C 5LFAA 2PJRB 4A3LJ 2L9VA 3VFZA 4XKVA 5BNGA 1SMTA 5C3EJ 2EFQA 5FKKA 1RPWA 2CUZA 3HJEA 4LJZF 4JOMA 2BEOA 4U87A 3BT9A 2EFPA 5J4YA 4R1HA 1IRGA 1J59A 4Y17A 1OCOH 1MSEC 4WK8F 4N4NB 1LFUP 2PLYA 4YIFA 3I71A 1KYZA 5F27A 3M4OJ 4ZJZA 5F6FA 3CCJI 1W4MA 1XSXA 5GTHC 4IJAA 1GUUA 3K2AA 2Y0SA 4FX0A 4H0EA 5LRSA 5DS9A 3HOXJ 4CCNA 5IT9Z 3K4NA 5B3SH 1R4NB 1HKQA 3X2QH 3BQYA 3F21A 4MGRA 3K4BA 1OMIA 2E1NA 2JVHA 4ENJA 3O3KA 2CSOA 2JUCA 4GFBA 2DMPA 2L54A 3I54A 4OMZA 2GA2A 3LSKA 1YIOA 4IQ4A 2M2EA 3ZN0A 4XICA 3SFIA 2R7QA 2HS5A 3W3CA 2LY1A 2P81A 3QPHA 4LIVA 2X51A 2EV5A 1LDDA 4BJ5C 1FTZA 1HXDA 3A1YA 5IP6A 3ONQA 1UHMA 1ZQ3P 2VXDA 1HKSA 4BEHA 1XG1A 1LNWA 4U7DA 3HOTA 2JSCA 3SEQA 4O3MA 2EV0A 3HBLA 4J01A 3JAMK 1RI7A 2J5PA 1XCBA 2KP6A 2M34A 1YJ9I 2IS4A 2K9MA 4CZZA 5LBQA 2Q2EA 4Y15A 1ZG1A 1SD5A 3PL8A 4N9HA 4C2UA 1POGA 5KVRA 2CU7A 3ZCOA 1XDUA 3F9KA 4BXUA 1T95A 5FD6A 1PVEA 3RPQA 4XIDA 2ME6A 4RAYA 1B9NA 3DCFA 5K7HA 5LD2C 4B3AA 3CESA 2DTRA 1ZGWA 1T2KA 2WADA 4CCMA 3V8LA 4L9JA 1EKEA 2E7WA 2OTLI 1LJ9A 2F5VA 4CYCA 3LAJA 2Y31A 2VXZA 4IZZA 1IXSB 4GCVA 3CUQA 4NUBA 5F1RA 3PSIA 3SZTA 4C2TA 5IT3A 2DA5A 2UZKA 1LDKB 4BQQA 2WA0A 2NVXJ 3SHFA 5B66C 1YX5A 2R7DA 1QA6A 3F6VA 1U8BA 2GXAA 4MO7A 2PMZA 2IXSA 3ZQ7A 2VJIA 3BG3A 1DGWY 3RI4A 2Z3YA 5J47A 2OCCH 2NS8A 3WTTC 2K27A 2VBYA 1SD6A 1T8IA 4D7NA 1R4MB 2BW3B 2KLOA 4ZYHA 1IF1A 3AG3H 2KIMA 2O8XA 3A01B 3LL7A 1MBFA 4JP0A 1FIAA 3W6VA 2XSDC 1T33A 2DDBA 1IN7A 4L0ZB 2VB6A 1MH3A 1X4OA 2A5WA 2TDXA 3CC2I 1HCRA 2HFHA 2OJED 4HW0A 3DTEA 3N4MA 1WVRA 3BCAA 4EATA 2DK8A 4AD9A 3W2WA 2M1BA 1ACIA 4MFDA 3BJAA 1VQ7I 4HX7A 1OPCA 1PDNC 3AG2H 3RKQA 1JE8A 1BI2A 1ENHA 3MAJA 4Q47A 1U5TB 1FP2A 1IN4A 5FROA 1VQ9I 1JXSA 3KYCB 1ZLJA 4JX4A 4ZYGA 1X3ZB 2VKDA 1TWFJ 4H4KC 1SFOJ 4XMYA 1WZ2A 2DDAA 3NARA 1TNTA 1Y1WJ 1BJAA 3E6DA 4AUXA 2CWEA 2R5ZB 4BHCA 4DBRA 3P9KA 4A5NA 1ZR4A 1OCCH 3BZCA 2XPUA 2AXTC 3ABMH 2WY8Q 3F8BA 1IN5A 4DIQA 1A31A 3CP8A 5FKLA 5ED4A 3U9GA 3L2VA 1ONVA 1K4SA 1H8AC 1ZK8A 2CV0A 2VN2A 1Q1HA 1WH5A 2OD5A 4AIHA 1HSJA 2PI0A 4J19A 3EYIA 2FRHA 3QRFF 4HDUA 1Z0XA 3KPHA 3S1NJ 1QHHD 5CLSA 3RPUA 1OISA 5JLXA 3Q5FA 4M6XA 1BN5A 5L3CA 1X58A 4RGRA 2OPTA 4HV6A 3MZHA 1BI0A 4HDVA 5IOZA 2NXNB 2HPMA 3PNVA 1D3YA 2E7XA 3CLOA 1NHAA 2V1XA 2BOLA 3REOA 1EF4A 3MKLA 3NEUA 3RCOA 4RM3A 1W36C 1Z21A 3H3ZA 5DM7F 2IGMA 3FIWA 4IXAA 3TO7A 3FXMA 1MZBA 2HOSA 4DW6A 1VQ5I 1FC3A 2FE3A 1DP7P 3OIOA 4MFEA 3K4LA 5CVRA 4RB0A 4BUPA 2XGCA 4XSXF 2QBYA 2RAEA 4W1UA 2IS2A 1J5YA 1MDMB 1MMGA 1Z3YA 3RTRA 5DEQA 3OL3A 5IY5H 3BR2A 3WE2A 1BI3A 1S7AA 2QQ8A 4KN7X 1FMVA 2FSWA 4FE7A 4MHGA 3HYIA 2F48A 2HQAA 3OYMA 4HOBA 3GCMA 4XQFA 2R5YB 4HPQA 2EIMH 4FE4A 4E7KA 1HF0A 1GHCA 4Q4ZF 4BJTA 1VI0A 1SD7A 1W36D 1TWGJ 1SANA 5BOXA 4Z6YA 4MLOA 3CMYA 3GX4X 1RRJA 2DA7A 1XD7A 2L2OA 4Q5SF 1XSVA 5FD5A 3KP7A 2L4MA 2DA4A 1FOKA 1IUYA 3D0SA 2X9DA 5FLMJ 2KZGA 2RREA 2W00A 2F5DA 4BKXA 1STZA 1MKMA 2PN6A 5EDNA 3VEPA 1LEAA 3JRDA 5F0HA 2D1HA 3Q9VA 4BE1A 5FLXZ 4C2MJ 3KCCA 3T1BA 1R1UA 4A3DJ 5HVQC 2HTJA 2ACJA 2VASA 3O8GA 3BLYA 3D5RC 3L09A 4GO1A 2ZMEB 3EUKL 3CDLA 4ZDPA 3KE2A 1D8JA 2EINH 4BXFA 1AOYA 2EZLA 1FIPA 3K6GA 3N05A 1OJLA 4EJWA 1G2HA 1I3QJ 2FQ4A 1BA5A 3WHCA 4A3BJ 1JUSA 5J8CA 3I4MJ 1BR2A 4EJVA 1QGPA 2HOTA 2EV6A 4UB8C 2JJ7A 2DA3A 4Y7NJ 5L3BA 2DFEA 2R3SA 2R7SA 4J00A 4HF0A 4Y52J 2XSJC 1JT0A 3OSFA 2G9WA 2EK5A 2HYJA 1D0ZA 2GAUA 1HQCA 1KU2A 1ON1A 3IWZA 4BHPA 2OBPA 4Y13A 5GPCA 4S05A 3DEEA 1T38A 4LLGF 3T8RA 4ENNA 2E34A 3IKTA 5J6XA 2ZFWA 3MMYB 1GLNA 1SAUA 2BY1A 2O03A 4UV9A 3KP3A 5FFZA 3GYHX 3E97A 1GXPA 4I01A 3CQZJ 3I56I 3DF8A 4YFNF 4KYWA 1MD0A 5LHIA 1AWCA 4KNYA 2ECBA 1W7PD 1S6LA 5H6RA 4IOAF 2LMDA 3E6BA 5DTDA 4E7ZA 4KMFA 1Q1VA 5E20A 2LKSA 3F8NA 1T98A 3L2CA 2FEZA 4PJNA 2W4SA 2CMPA 2E5NA 1FBSA 2BVMA 1LVAA 3D5SC 2VL8A 4FETA 4XK4A 3TQNA 3VYUB 1YRNB 3GBGA 2KJCA 1J7KA 3KEOA 1VQ6I 2X1DA 1N78A 2HVQA 3PO2J 1EH8A 2IPQX 1DP3A 2O8KA 2PMUA 1P2FA 1VZ0A 3BR0A 2CG4A 5DUIA 3FBNB 2GIVA 2NOJB 2QKMB 4QPOA 4XNFA 2OF7A 5BPIA 1RETA 3GXOA 2DOEA 3KZZA 5GAEJ 1D1BA 4ZTJA 3CJQB 1RUNA 3VYRB 2QGUA 2QVOA 2YX4A 2LBFB 1UAAA 2DODA 2L7MP 4S0HB 1HBXG 5GPAA 3K0LA 5FGMA 3V7SA 4AIDA 3DEUA 5KHDA 2RNJA 4XM3A 1JKRC 3JRCA 3V8JA 3QAHA 2ESHA 3R60A 4II2A 1L3LA 2LDUA 2VQLA 2DMQA 4MTDA 5TRDA 4E70A 2Z33A 4WXDA 1MH4A 2O7OA 1SC7A 1DPRA 2LH9A 1IDYA 2ZXWH 3L7WA 4IRHA 4C9YA 4DYQA 2CW8A 2FBHA 1LQ1A 2XAHA 3ZMVA 3VYSB 1B6AA 1H88C 4KA4A 2IRFG 1IW7F 1ZARA 2IW5A 3H36A 5AONA 2HI3A 2VQCA 5CVVA 4LGWA 5JVTA 2ADUA 2UXNA 3V7RA 5EGOA 3WTVC 1HDPA 1VFCA 4EJTA 4ANJA 3S15J 3BY6A 1ZN2A 2KFDA 1SVOA 3B6AA 4KIGA 1MMSA 4NC8A 5BS6A 2QQAA 4BY1J 3E5QA 3FX3A 2EQRA 2KISA 3HOVJ 3GVAA 2O61A 2AXLA 4LIUA 1ORKA 1YW7A 2BV6A 3KLNA 3E5UA 5FLXK 1YW8A 2KHMA 1UCRA 3ZP5A 3G71I 2KIFA 3T5XA 4A3FJ 3PFYA 2XASA 2Y0SN 3IHUA 4YRVA 1G4DA 3ZMSA 4KFCA 3DBHB 3QOPA 1ZREA 3KP5A 2ID6A 3E3VA 4M3GA 4MIMA 1TT0A 1ZTRA 1KGSA 3C2BA 4MNUA 2V9VA 1B72A 3S17J 4G6QA 3VPRA 1B4AA 1FOYA 4EGYA 2GWRA
chains in the Genus database with same CATH topology
4XKVA 3OR2C 1WJBA 2M3AA 4OAZA 2CUZA 4XOTA 2VQGA 4JOMA 4U87A 2HU9A 1WJ5A 3BC8A 2L7KA 2MYSA 2VJJA 2CFOA 3DKYA 4F91B 4E7LA 1N75A 2MD0A 3QYBA 3S3NA 4N4NB 3C2HA 3QODA 3DKXA 3IAM2 3FHNA 4ZJZA 3EPZA 2Y0SA 3J7AY 4KT6A 3K4KA 1S9HA 4CCNA 3OYIA 3MD2A 3C2GA 3K4NA 2XC7A 2CW7A 4E7SA 3DPTA 2JUGA 4LG3A 3TL4X 4CCJA 3K4BA 4GRIA 4XLAA 3SDBA 1R6RA 4FASD 3W2AA 2JVHA 3AL0B 2R7XA 2CV1A 3LSKA 1N77A 4IQ4A 2HPIA 2R7QA 2IS6A 3W3CA 1WFXA 2M4GA 2LY1A 3DLAA 3FBIB 2XF6A 3OS0A 2JVGA 4LIVA 4BDYA 2X51A 1DQUA 3H35A 2MC4A 3LSMA 1PJRA 4BL0B 3E0JB 1Z3XA 4BJ5C 3A1YA 3CZ6A 3QYEA 1MNEA 3ONQA 2VXDA 1QU3A 3UR3C 2Z2SB 4BEHA 3L2QA 3K4JA 2V1NA 4XOPA 1X1CA 3HOTA 3SEQA 1QHGA 4CZCA 3ZGKA 3MKZA 2KMUA 2KZVA 2V7FA 4J01A 4JQFA 2M4KA 4ZYAA 3HG9A 2KP6A 2IS4A 4F55A 2K9MA 1ZELA 3LSHA 4F52A 3PL8A 4C2UA 3VDXA 4F3QA 3ZCOA 4Y4RA 5CQGA 3F9KA 4YELA 1T95A 1FMWA 2WAQA 2LREA 2WY7Q 4P5OA 5LD2C 3AL0C 3CESA 3E1SA 1WJFA 2WADA 4CCMA 2F5VA 4XLFA 2Z1DA 2HVSA 3LSIA 2UWMA 4BE2A 2E5ZA 2VXZA 4IZZA 3ZQQA 2F6CA 4NUBA 3OYHA 3PSIA 2VLAA 4KJZA 4C2TA 1LDKB 4BQQA 2WA0A 3OYNA 2Q1ZB 1YX5A 1HA8A 1Y56A 4RLFA 2PMZA 2IXSA 2VJ4A 2E60A 2VJIA 4ZC3A 1DGWY 3L2RA 4XORA 1J09A 4X0GA 3S3OA 3OYBA 3K10A 2GOMA 4PSWA 2BW3B 2KLOA 1BOBA 5CPRB 3LMMA 2HZDA 3LL7A 4OWRB 2K5CA 2JA2A 2X6XA 4PSXA 4BDZA 2P0WA 3M8JA 2OV7A 3NWSA 1X4PA 4P1WA 4D1QA 2VB6A 1X4OA 1T0FC 2A5WA 2WB1A 2DOAA 1BR4A 3OIPA 3DTEA 2CUJA 4F93B 3HOSA 3BCAA 4EATA 2LOOA 2WAEA 1WJCA 1E0EA 2FUG2 3W2WA 4PJMA 4PK4A 3CMMA 3RPUD 1P9QC 4E6KG 4ZTFA 2I8DA 2V4JC 2HVRA 4XL9A 4XLCA 5FROA 1JI8A 2X1EA 3I3LA 4OAYA 3TMOA 2IGKA 4ZDOA 2M7BA 2VKDA 4H4KC 4B44A 4XKBA 3HUGB 4XMYA 3LFUA 1IRXA 4XN0A 3VYTB 4DBRA 3PNTA 3SEZA 3VWBA 2ZXIA 2CV2A 1X19A 4HNTA 4KISA 2KPMA 4CUGA 4BS9A 3ZXSA 2WY8Q 4DIQA 3NWTA 3BG7A 3CP8A 3H5AA 3L2VA 3OYCA 2CV0A 2DXIA 2ZSIB 2L9SA 4PFOA 3S8PA 4XR6A 5FRMA 1TZLA 2ELJA 3H9GA 2L5QA 3A4CA 1V5FA 4HG2A 1QHHD 3OL4A 4N4OB 4DBQA 2LBFA 4CA0A 4B3XA 4B43A 4CCKA 2DJIA 3OWTA 1K6YA 2M7AA 2K9LA 2M0MA 1EA3A 1DGRM 1WJAA 2DT6A 1X1DA 1WJDA 3MKWB 2HPMA 3PNVA 3H0DA 2E1MB 3S3MA 2W82A 2BOLA 4Y3OA 2V6EA 1LKXA 3RCOA 4CSWA 2LG4A 4RM3A 3OYKA 1W36C 4RMNA 2R7TA 3BG6A 1Z21A 3SYTA 1D0YA 2AQFA 2UV1A 2IGMA 3HC7A 3K4LA 1YX3A 4BUPA 2LRDA 2IS2A 1MMGA 1Z3YA 3RTRA 4E7IA 3OL3A 2KQRA 1KONA 2WBMA 4RM2A 4YEJA 1FMVA 1MMNA 2HQAA 3IUOA 3OYMA 4XQFA 2O5RA 4HPQA 4E7KA 2QKLB 3BCBA 4BJTA 1W36D 1YE9A 2MABA 4MLOA 4HSRA 3CJRB 4PFPA 3VSKA 5KNLA 4IX7A 2L2OA 3DU6A 1LVKA 3KX2A 2LC2A 2XF5A 2R7RA 2W00A 2RREA 2DCEA 3DU5A 3HPGA 1BR1A 4ZDLA 2E1MC 4PUSA 4PJLA 4BE1A 1G59A 2OC6A 3IAS2 1D0XA 2Q2EB 3HKZA 2DT7B 2PJRA 2GOXB 5HVQC 3L2WA 2CH0A 2VASA 4XONA 4C30A 3BLYA 3D5RC 4E4HA 1MMAA 3OYAA 2R7WA 3EUKL 1MNDA 4ZDPA 1ERDA 4BXFA 4HNUA 3H9JA 5CKTA 2AQEA 3HPHA 3K6GA 3N05A 3DQVC 1BR2A 3G2BA 5TGTA 1X1BA 5HNHA 2IS1A 4AYBA 4DOZA 3OMYA 5HOOA 1G8XA 3KEYA 2R7SA 2UUZA 4PJJA 2WAFA 3CF2A 4LITA 4J00A 3VSLA 2XSJC 5KCMA 1NG7A 4G6TB 1D0ZA 3QYFA 3DPLC 4XLEA 3HXLA 3KYLA 3OIQA 4E7JA 3OYGA 4QPQA 3DEEA 4BJ6C 2F4IA 4R79A 2X6YA 2RQQA 4BACA 1SFKA 1Y6IA 3EUHC 3AFHA 3MMYB 1GLNA 1SAUA 4B48A 2JSPA 2IGOA 1D1AA 3FKJA 3H9QA 2VPLA 3UNGC 2X85A 4BE0A 3SZGA 4CCOA 3OYJA 1V5GA 3S32A 2VIXA 3U21A 4E7ZA 3OYFA 4AU7A 4BQNA 2Z16A 2RNGA 5HNFA 4HRIA 3DPUA 2VQHA 3FDYA 2W7NA 4PJNA 2W4SA 4XKCA 2CMPA 2E5NA 4RLQA 2BVMA 2KRHA 3D5SC 4FETA 2VL8A 3RSNA 4BU2A 4E7HA 3VYUB 4AVZA 3GBGA 2KDOA 5HLTA 2XAUA 2HNHA 2X1DA 2LYCA 1N78A 2HVQA 3DTIA 3QOEA 1V5EA 1DP3A 1MMDA 2XDVA 1VZ0A 3OS2A 4HSTA 3DTKA 3FBNB 3M1CA 2NOJB 2QKMB 3L2UA 1NG6A 4QPOA 3OOUA 4XKWA 4XNFA 2K3PA 4CCLA 3K4MA 5FRNA 3H5RA 1D1BA 4ZTJA 2W1OA 3CJQB 3OYLA 4KITB 3DWLE 3VYRB 4II3A 3OYEA 2LBFB 1U0JA 3MKYB 1UAAA 2HDWA 3A2KA 1MW7A 2CS3A 2OUMA 3IP4B 1OR7C 4DJAA 1WJEA 4NNJA 3ZRGA 4F92B 4DGWB 2L9NA 5KHDA 3HL2A 2BW3A 4XM3A 3CP2A 4B47A 4BEHB 4NC7A 3OY9A 1PYVA 4II2A 3D5LA 2VQLA 3K4CA 3K70C 3V42A 4XN3A 4NQWB 1AA7A 2R4GA 2KL4A 2MFZA 3I9V2 3PSFA 5CQEA 2LH9A 4Y33A 4BGDA 4C9YA 2R7VA 4XLHA 3AKZA 2CW8A 1LFPA 3VYSB 2KRCA 3H5NA 4U7BA 3OS1A 4IQJA 2R7UA 2R7OA 2VQCA 2V9KA 2ZSHB 4ANJA 2VJ5A 1OLTA 2IGNA 4NC8A 4ITVA 3K70D 1D1CA 1UELB 2XF7A 4HEA2 3S93A 1UG0A 3PJRA 4LIUA 2LY2A 3PNYA 3PUBA 3EUAA 2KHMA 2V26A 3TBIA 1Z7LA 3PFYA 2X1CA 4YRVA 2X6WA 2ZXHA 3LSGA 4BQOA 4D9JA 2A6TA 1X1AA 4IKFA 3W2VA 3OYDA 2VKHA 3ZR8X 1TT0A 3OR1C 5LFAA 3RQ4A 2PJRB 5JHFA 2ZFUA 4CH7A 2BVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF B;  2LBF A;  4BEH A;  4BEH B;  2W1O A;  3A1Y A; 
#chains in the Genus database with same CATH topology
 2P5K A;  3K9T A;  4D5F A;  4AM3 A;  1HW1 A;  1F36 A;  3PO3 J;  1YS6 A;  3BOQ A;  3Q3S A;  2K85 A;  3RYP A;  1VQO I;  1TW3 A;  3BC8 A;  1QNT A;  1EV7 A;  2VJJ A;  3DKY A;  3Q0V A;  3KP2 A;  1GT0 C;  3S3N A;  3GTG J;  3C2H A;  3IRQ A;  3TO6 A;  2OZU A;  3DKX A;  4HQM A;  3FHN A;  1YW9 A;  4MEX F;  4IL6 C;  3K4K A;  4I0B A;  3JRE A;  4MQ9 F;  3OYI A;  1E3P A;  3G1O A;  1KU7 A;  1CF7 A;  3MFK A;  1T39 A;  2XC7 A;  5LLQ A;  2CW7 A;  5DCM A;  4ZZD A;  3DPT A;  2JUG A;  1K78 B;  4UY8 I;  3CCQ I;  2NS0 A;  3ZMZ A;  4OU0 A;  2XVC A;  4OIP F;  4FAS D;  3AL0 B;  4LG0 B;  2MLG A;  5LHG A;  2JPB A;  2R7X A;  2CV1 A;  2F4M B;  1IN6 A;  2XGE A;  3ABL H;  3GLL A;  2CW0 F;  5DD8 A;  4S04 A;  3JAM Z;  1JJ8 C;  2XRL A;  1RKT A;  3OSG A;  5GAG J;  1TW2 A;  2M4G A;  2XF6 A;  3OS0 A;  2JVG A;  4RAF A;  1DQU A;  1ZHF A;  1FYM A;  1PJR A;  2JMW A;  3E0J B;  4UUS A;  1R58 A;  4RGU A;  1R00 A;  2K3F A;  4GXO A;  4IOC F;  1DU0 A;  1HDD C;  2DQL A;  4M9Z A;  4WX9 A;  4L5I A;  4ESF A;  3L2Q A;  2XV4 S;  1H89 C;  2V1N A;  4EQQ A;  1QHG A;  2VT2 A;  2PMZ N;  3V7C A;  3M7G A;  4ZYA A;  2VBX A;  2ELK A;  2PJP A;  2XKO A;  3FWE A;  5J1Y A;  5FKN A;  3ABT A;  3AG1 H;  4CYD A;  3VOD A;  1VTN C;  2VKV A;  2KIQ A;  4Y4R A;  4YEL A;  4BH9 A;  3WTW C;  2EZK A;  3IH2 A;  3PQJ A;  2WAQ A;  3K1P A;  2LRE A;  2WY7 Q;  4P5O A;  2A3S A;  1X3U A;  4G7Z F;  2ISY A;  3WG7 H;  3N97 A;  1F4K A;  1JJ6 C;  2HDD A;  1R5H A;  4XLF A;  3LSI A;  2ISZ A;  2E5Z A;  4AIJ A;  2QSF X;  3ZQQ A;  1MBH A;  3CCR I;  2F6C A;  2VLA A;  2OA4 A;  4WCG A;  3K1M A;  5K5R A;  2CQX A;  2GZW A;  4IRG A;  4BQA A;  1HA8 A;  1Y56 A;  1UJ8 A;  2RDP A;  1VQK I;  1UB9 A;  4PCQ A;  2VJ4 A;  3M8E A;  3S14 J;  1TBX A;  4XOR A;  1J09 A;  4IHS A;  5EG0 A;  3S3O A;  3OYB A;  2GOM A;  4PSW A;  1LE8 B;  1I6X A;  5HS7 A;  4MQV A;  4QLC U;  2O6G E;  5CPR B;  1OKR A;  2STT A;  2GBY A;  3BPX A;  2DO7 A;  5E8I A;  4IHT A;  3W6J B;  2WV1 A;  4TV7 A;  2Y0M A;  5EZG A;  4PSX A;  3M8J A;  5E3O A;  2FNP A;  2HXO A;  2YU3 A;  1WSU A;  3JRH A;  2DOA A;  2E2I J;  3OIP A;  4F93 B;  2CUJ A;  5EZH A;  2Z9O A;  1W5C C;  1E0E A;  1X2M A;  2FUG 2;  3LFK A;  4PK4 A;  5K7F A;  4OIQ F;  3D1N I;  2M87 A;  3RPU D;  3SQN A;  3GEZ A;  3TGN A;  4E6K G;  1O3T A;  2EB7 A;  3R0J A;  2HVR A;  2V4J C;  3GO5 A;  3GFJ A;  4EJO A;  1ON2 A;  2R7F A;  4A3J J;  3I3L A;  3TMO A;  3H3U A;  2IGK A;  4ZDO A;  1S5L C;  2M7B A;  1FEX A;  1SVL A;  3HOZ J;  1P7J A;  3VYT B;  3VWB A;  2ZXI A;  1JKO C;  2H6B A;  2V9P A;  5A2Q K;  4IF4 A;  2W57 A;  1QPI A;  2CV2 A;  3WGG A;  3ZMD A;  4HNT A;  4KIS A;  4UNO A;  4BS9 A;  3JW4 A;  2ZO4 A;  3MCZ A;  4HLX A;  1WWX A;  2MD5 A;  1KQ9 A;  3CF5 F;  3BTJ A;  4UHT A;  3OYC A;  1A5J A;  5HLI A;  3ML6 A;  5D6E A;  1UFM A;  2GIZ A;  3S8P A;  4XR6 A;  4GYG A;  2ME0 A;  5E3M A;  2ELJ A;  1TWC J;  2JRM A;  2L5Q A;  3HRT A;  3WU2 C;  2CRG A;  1TQI A;  4XLN F;  1XGO A;  1YYV A;  3FM5 A;  3H0G J;  4XRS A;  4CCK A;  1K6Y A;  1I39 A;  2CGP A;  4IVN A;  4L18 B;  1EA3 A;  2W85 A;  1IAW A;  2DT6 A;  3MKW B;  4B09 A;  2LVS A;  2E1C A;  2M0C A;  2NRA C;  2B9S A;  2E35 A;  2W25 A;  2W82 A;  4Y3O A;  2V6E A;  1LKX A;  1T0F A;  2O3F A;  3AG4 H;  4RMN A;  5D4S A;  1Y8Q B;  3BG6 A;  3I64 A;  2JA6 J;  2UV1 A;  1FTT A;  3HSR A;  1OYI A;  3KIO A;  4RB1 A;  3DBL B;  1JGG A;  1IRZ A;  2KIU A;  1R1V A;  2L7F P;  1H9G A;  3TO9 A;  1FZP B;  3OOP A;  1Z9C A;  1MMN A;  2M8E A;  3QWL A;  3U1K A;  2V1U A;  1MIJ A;  4A93 J;  3IUO A;  5F64 A;  5D6F A;  2BY2 A;  2E36 A;  2QKL B;  4IHY A;  4A3G J;  4FIS A;  1OYY A;  1IUF A;  2W24 A;  1YE9 A;  4O6J A;  2H8R A;  2XRN A;  5J4V A;  2LKX A;  2IBD A;  4PFP A;  1P92 A;  3HOU J;  2CQ7 A;  1QPM A;  5JLW A;  3G73 A;  3KX2 A;  2X48 A;  4LB6 B;  4B4C A;  3A01 A;  4KIB A;  3L00 A;  2ZJR F;  4ENM A;  1QBJ A;  1VQP I;  2E1M C;  3Q9S A;  4DQ2 A;  2TRT A;  1OCZ H;  4D0P A;  1XN7 A;  3HRS A;  5J1R A;  1ETX A;  2DBB A;  2HYF A;  3GFM A;  3IAS 2;  5FKM A;  2Q2E B;  2KJB A;  3HKZ A;  2LR8 A;  4W97 A;  4XSZ F;  2CH0 A;  3LST A;  4XON A;  4E4H A;  3OYA A;  2R7W A;  1BL0 A;  1EH7 A;  1MND A;  2XPW A;  3RKX A;  4WWC A;  2LF7 A;  2DYR H;  3HIF A;  1SFU A;  3LSP A;  2VOO A;  1G6N A;  3G1M A;  3R61 A;  4CYC B;  1O7L A;  4CGZ A;  3CUQ B;  4UVB A;  3G2B A;  4FQG A;  5TGT A;  1CGP A;  1IJW C;  1X1B A;  2A69 F;  5HNH A;  3TED A;  4B1R A;  4AYB A;  4DOZ A;  5IYC J;  1Z7U A;  1G8X A;  3KEY A;  1R1T A;  1G3T A;  2UUZ A;  4PJJ A;  4I99 C;  1S3J A;  3JTH A;  3CF2 A;  2IA0 A;  5E1W A;  4KUM A;  3VSL A;  4HNV A;  3CCM I;  1FBU A;  1V55 H;  1VQN I;  4HV5 A;  3HGG A;  2Y75 A;  5EEH A;  5M3M J;  4E7J A;  3WG9 A;  1QZY A;  5CVU A;  3G1L A;  1R7J A;  2F4I A;  3K69 A;  4R79 A;  3I4P A;  3H1C A;  1S72 I;  3MEX A;  2G7U A;  1XB4 A;  2RQQ A;  1WGX A;  1KU3 A;  4GGG A;  1SFK A;  3EDP A;  3Q0W A;  3AFH A;  2IA2 A;  2LTP A;  4X1E A;  1BC8 C;  5IYD J;  3KP4 A;  4QSH A;  2R92 J;  3SZP A;  2IGO A;  2XAJ A;  3I59 A;  1MNM C;  1D1A A;  3FKJ A;  1FX7 A;  2MC3 A;  4OIR F;  4OIO F;  2VPL A;  2LP0 A;  4DNC A;  3G3Z A;  3M8F A;  4RDU A;  2F2E A;  2ICW G;  1LPQ A;  3S32 A;  2VPR A;  1YTY A;  3BR1 A;  3ZQI A;  2A6E F;  3ERE D;  4BQN A;  5L3E A;  4ESJ A;  3HOY J;  5HNF A;  2B63 J;  1S8N A;  2H6C A;  4NB5 A;  1ZYR F;  4HRI A;  3RKW A;  1O7F A;  2W7N A;  3WU1 B;  3J80 K;  2EA2 A;  2P4W A;  1MDM A;  5HLT A;  2QEN A;  3DTI A;  4QWQ A;  5FO5 A;  3S1Q J;  2V6C A;  3NAU A;  1MMD A;  2A6H F;  3TW7 A;  2DPU A;  4EVI A;  4KDP A;  2EA4 A;  4HST A;  2DMN A;  4A3K J;  3DTK A;  1G3S A;  1QVU A;  4V2G A;  1NG6 A;  1HLV A;  4XKW A;  3FXU A;  2H8W A;  3BRO A;  2K3P A;  4HF2 A;  3K4M A;  5FRN A;  1IV6 A;  2EBI A;  1V3F A;  3OYL A;  3DP7 A;  2HWV A;  4II3 A;  3RJP A;  1U0J A;  2NYX A;  4A0X A;  1MW7 A;  4HF1 A;  1JTX A;  2ESN A;  4G7O F;  2LY9 A;  2I5U A;  1OR7 C;  2LKP A;  2YS9 A;  5ICG A;  1U78 A;  4ENK A;  1B8I B;  4NNJ A;  4DGW B;  3LA7 A;  1R9T J;  3C18 A;  3CP2 A;  4LK1 F;  5KAI C;  2WV0 A;  2EWN A;  2W84 A;  4ESB A;  1O3S A;  3OY9 A;  2H09 A;  3ISP A;  5HLG A;  3K4C A;  3K70 C;  1BW6 A;  2KRF A;  3RIR A;  3JR9 A;  4NQW B;  5K5O A;  2QWW A;  5EF6 A;  2QBY B;  4G12 A;  1XCV A;  1W5S A;  3MZY A;  3I9V 2;  3KYD B;  2DK5 A;  1BIB A;  4XLH A;  5F0C A;  3AKZ A;  4HX4 A;  2EFW A;  1KA8 A;  4A3I J;  2K7L A;  4BYY A;  1MBE A;  1T6S A;  4QTR A;  3PIO F;  3HDD A;  2ZJP F;  3OS1 A;  2NNN A;  4EMS A;  4IQJ A;  4IPA A;  2DAO A;  5FFX A;  2LF8 A;  1OYW A;  2ZSH B;  3S2H J;  4HAM A;  5GP9 A;  2ZJ2 A;  2K02 A;  1MJ9 A;  4I2O A;  2IGN A;  4ITV A;  1K4T A;  3K70 D;  2R93 J;  3PJR A;  3FXR A;  3WGH A;  1RNL A;  1JUP A;  3HUG A;  2XUB A;  3CCV I;  1UHW A;  3EUA A;  1U8R A;  3OV8 A;  2V26 A;  1Z7L A;  2V79 A;  2X1C A;  2NS7 A;  3ASO H;  4JX6 A;  3LSG A;  4BQO A;  4D9J A;  2A6T A;  1V54 H;  2BE5 F;  3ECO A;  3PIP F;  3W2V A;  2EIL H;  3PFI A;  2B7E A;  2VKH A;  3ZR8 X;  3OYD A;  1JT6 A;  4CO8 A;  2VUM J;  3FXO A;  4M3D A;  5JHF A;  2ZFU A;  3ZQH A;  2QQ9 A;  1ETV A;  5J40 A;  1XTA A;  2L9R A;  1BBY A;  2M3A A;  5B1B H;  1ITY A;  4XOT A;  2HU9 A;  2RN7 A;  2XGD A;  2L7K A;  1N25 A;  1F9N A;  2HOE A;  4E7L A;  3QYB A;  2MD0 A;  4UV8 A;  3QOD A;  3FF5 A;  3LA2 A;  2PEX A;  3S1R J;  2D5V A;  5LHH A;  3KET A;  3HSF A;  1PUF A;  3J7A Y;  4KT6 A;  5LGT A;  3IC7 A;  4EJU A;  3MD2 A;  5LEK A;  1O3Q A;  1H9T A;  1XGM A;  1QZZ A;  4G6D A;  3BJ6 A;  1F5T A;  4E7S A;  4NBQ A;  5C4J J;  1UMQ A;  1A04 A;  2N8G A;  3EET A;  4LG3 A;  3RYR A;  3I58 A;  3BTL A;  4CCJ A;  4V2F A;  2VC0 A;  4GRI A;  3SDB A;  2STW A;  1R6R A;  3S2W A;  3W2A A;  2JA7 J;  1FOW A;  4HLY A;  4DZP A;  1N77 A;  4P9U A;  2XIG A;  3CUO A;  1E2X A;  4UUV A;  1WFX A;  3WTU C;  1HOM A;  3ULQ B;  4K2E A;  4BDY A;  4LLN A;  1BM9 A;  2EJR A;  4BL0 B;  1Z3X A;  2ZBK A;  1XSD A;  1FYK A;  3IKV A;  3CZ6 A;  1Y0U A;  1MNE A;  3PUF A;  3U2R A;  3WTX C;  1QU3 A;  3UR3 C;  2Z2S B;  1JKQ C;  3ABK H;  3K4J A;  2JA5 J;  4M9S A;  2LD5 A;  1X1C A;  2ELH A;  2W48 A;  2ZNZ A;  4IHW A;  5E17 F;  2K40 A;  3ZGK A;  3MKZ A;  3BG5 A;  2XB5 A;  1QVT A;  2KZV A;  2V7F A;  3WGI A;  2M45 A;  1ZEL A;  1DUX C;  2LK2 A;  3ECH A;  2VOD A;  1ETY A;  3V8K A;  2QLZ A;  4KT5 C;  1TWH J;  3F6O A;  5C4X J;  3CJN A;  1FSE A;  5CQG A;  1K7A A;  2M8G X;  4I76 A;  4ZYD A;  4LMY A;  3GTJ J;  4ON0 A;  4IRI A;  1DU6 A;  2FA5 A;  3GTO J;  3E1S A;  3O8H A;  1KZH A;  4A69 C;  1ZRC A;  2Z1D A;  2UWM A;  3GTP J;  3JSO A;  2OAZ A;  2MG4 A;  4KJZ A;  1TT5 B;  2VKE A;  3NRV A;  3UKG A;  3OYN A;  2Q1Z B;  1R36 A;  5ICF A;  5HS9 A;  3JRG A;  2DW4 A;  1IN8 A;  3QQA A;  4A3C J;  3CC4 I;  2E60 A;  4ZC3 A;  1MSF C;  3L2R A;  2E19 A;  1I1G A;  1Z6R A;  1RKW A;  4X0G A;  3BJO A;  1BOB A;  3CO6 C;  3WE3 A;  3ELK A;  2X4H A;  3CMA I;  2OQG A;  2HZD A;  2JA2 A;  3GZ6 A;  2P0W A;  2OV7 A;  2X6O A;  2ZXJ A;  2CUE A;  1ZGA A;  4D1Q A;  1YLF A;  3VOE A;  5E79 C;  1T0F C;  1XS9 A;  1I27 A;  2WB1 A;  3BTI A;  2L02 A;  1FY7 A;  2QQB A;  1BR4 A;  4G8X A;  1TP4 A;  3V4G A;  5JFR A;  3J81 Z;  5C44 J;  2GXG A;  4A0Y A;  3R4K A;  2AS5 F;  2FMY A;  1J2X A;  2FQ3 A;  4PJM A;  3O2P E;  5A2Q Z;  1JHF A;  3CMM A;  2CO5 A;  2ZCW A;  5LGU A;  4U0Y A;  3G4S I;  1ETK A;  1OR7 A;  1G3W A;  5HDN A;  5E18 F;  3RZD J;  1VQM I;  3CJT B;  2I8D A;  4XL9 A;  1VF9 A;  1FOX A;  3KP6 A;  3JTG A;  4L5E A;  5K5Q A;  1X1P A;  2RKH A;  1K78 A;  2TCT A;  4G7H F;  4L0Y B;  1IRX A;  2LFB A;  4XN0 A;  1I5Z A;  2BHZ A;  4M6Y A;  1Z77 A;  1HKT A;  3I5U A;  3PNT A;  3SEZ A;  4UUT A;  4LG0 A;  1YIJ I;  2A68 F;  1DPU A;  4ZYE A;  1X19 A;  2VON A;  2KPM A;  4CUG A;  2XB0 X;  3WTZ A;  4A3E J;  3ZXS A;  3ZQG A;  4A6E A;  1MGT A;  3BG7 A;  3H5A A;  3NWT A;  2JRT A;  2L01 A;  1B72 B;  2H27 A;  2ZSI B;  2L9S A;  4PFO A;  2C6Y A;  2Y9Y A;  1TZL A;  1PP8 F;  1SVM A;  3FXK A;  3OL4 A;  4DBQ A;  4KN4 X;  5E8G A;  4EM2 A;  4CA0 A;  4B3X A;  2DJI A;  2MH9 A;  3OWT A;  4WXC A;  2M7A A;  2M0M A;  1Z67 A;  3GZ5 A;  3FZV A;  1DGR M;  2HGC A;  1X1D A;  2IA1 A;  1X2N A;  2A5Y B;  1U5T C;  1ETQ A;  4M6V A;  3BTC A;  3MN2 A;  4ABZ A;  1Y0N A;  2EFO A;  2LG4 A;  2LSO A;  3OYK A;  2Y69 H;  3SYT A;  3K1N A;  4U0W A;  3K2Z A;  2RV8 A;  1F43 A;  4L9V A;  1CF7 B;  4I7H A;  3LA3 A;  3ASN H;  3GW2 A;  3DEW A;  3QPS A;  1YX3 A;  2LRD A;  5H6Q A;  3HHG A;  1BOA A;  2FF4 A;  3QP6 A;  1TQP A;  3ERM A;  4YFX F;  3KEQ A;  1Y39 A;  1LUJ B;  1U9N A;  4JYK A;  1IC8 A;  2X0L A;  2MGQ A;  1OFC X;  1KON A;  2VT3 A;  2WBM A;  3FXJ A;  4YEJ A;  4AC0 A;  4BBR J;  1NK3 P;  3TOB A;  1YS7 A;  3HZJ A;  3R6S A;  2DMU A;  2XGX A;  1K83 J;  3HM5 A;  2Q8K A;  2O5R A;  3PM1 A;  4RGS A;  5CVJ A;  1Y1V J;  5M5W J;  2AHQ A;  3O6B B;  1TNS A;  2JPC A;  2MAB A;  3P5J A;  3CJR B;  4HSR A;  2HZT A;  4UUS B;  3CDI A;  1LDJ A;  4U88 A;  1LE8 A;  1AKH B;  2HDC A;  5LEJ A;  4CXF A;  4FX4 A;  1RR7 A;  2LC2 A;  3GF2 A;  2YU9 J;  4AYB N;  1W7P B;  5J8F A;  5D8L B;  2MSY A;  3DU5 A;  2ZKZ A;  1BR1 A;  4ZDL A;  1R5I D;  1ETO A;  5M5Y J;  4RBO A;  3F23 A;  2F5E A;  1G59 A;  1U6G A;  3HGY A;  1D0X A;  3NQO A;  2WC2 A;  2DT7 B;  2PJR A;  2RC4 A;  4M3E A;  2AO9 A;  3TP3 A;  1JKP C;  1MMA A;  4HBL A;  2DPD A;  3G6E I;  4HZF A;  1J0R A;  4HNU A;  5JR3 A;  5CKT A;  2AQE A;  3HPH A;  1AHD P;  3I4N J;  4XLP F;  1LEB A;  2HQ5 A;  3DQV C;  1XDS A;  3B73 A;  1IXC A;  2YR2 A;  2WWY A;  2DQR A;  4IHX A;  2K86 A;  1GDT A;  1QO0 D;  5FB2 A;  1FPQ A;  3LOC A;  3A02 A;  1RIO H;  5FJ8 J;  1GV5 A;  2D1V A;  5KCM A;  1NG7 A;  5EG0 B;  4G6T B;  5BQT A;  1XGS A;  3QYF A;  4M3F A;  1V4R A;  4XLE A;  1K6O A;  3KYL A;  4UVA A;  5DYM A;  1QZE A;  3OYG A;  3Q0U A;  4QPQ A;  3J81 K;  1SMY F;  2R7Z J;  4BJ6 C;  2GQQ A;  1ETW A;  3BPV A;  1JGS A;  2EIK H;  4U0V A;  3J7Y J;  1I6H J;  1R5G A;  4M3B A;  1Y6I A;  1O3R A;  2MA3 A;  3KLO A;  4X6A J;  1MJB A;  3F8C A;  5L3F A;  3J80 Z;  4B48 A;  1DDN A;  2JSP A;  4OMY A;  3WTS C;  2VBZ A;  2L4A A;  5D5W B;  2PMH A;  3B6C A;  3L1P A;  5JVG F;  1FLI A;  4C3J J;  1M1E B;  1O4X A;  1YHQ I;  2ZME C;  3H9Q A;  4BE0 A;  1P4X A;  2HKX A;  2JN6 A;  3SZG A;  4CCO A;  1TL8 A;  1ODD A;  3OYJ A;  3ZPL A;  1V5G A;  4KIC A;  5FKO A;  2VIX A;  3U21 A;  3OYF A;  3B02 A;  3CCE I;  5EJC A;  4AU7 A;  2BY0 A;  3HTU A;  4AIK A;  2Z16 A;  2RNG A;  4I6Z A;  2GLO A;  1YOV B;  3DPU A;  2VQH A;  3FDY A;  5F08 A;  1UST A;  2COM A;  2KRH A;  1X3W B;  4M72 A;  3QU6 A;  1WPK A;  3RSN A;  4E7H A;  5EEA A;  2XRO A;  3BG9 A;  3I0T A;  5BPD A;  1IGN A;  4LOC A;  2HNH A;  2LYC A;  3QOE A;  2CQN A;  2XAQ A;  3HRM A;  1RC9 A;  4IO9 F;  1E17 A;  2XDV A;  2OCE A;  1VND A;  1A6I A;  4RB2 C;  3CCY A;  3A03 A;  3TOA A;  3L2U A;  1U2W A;  2DJN A;  3DKW A;  3A0H C;  1Z05 A;  3LSR A;  4KIF A;  1VQL I;  4CCL A;  2YX7 A;  3H5R A;  2Y9Z A;  2W1O A;  4KIT B;  3CME I;  3MZ8 A;  3WHB A;  2P6S A;  2DFF A;  2JZY A;  4A3M J;  4DYC A;  2HDW A;  2DTZ A;  2H1L A;  2P7V B;  5AIP A;  4M74 A;  2YSR A;  3GLX A;  2NVY J;  3LQR A;  1BW5 A;  3EUH A;  4F92 B;  3TKY A;  2L9N A;  3HL2 A;  1FP1 D;  2BW3 A;  4OOI A;  2ETH A;  1R71 A;  2D2W A;  3T8T A;  4B47 A;  4BEH B;  4NC7 A;  3TDZ C;  2B0L A;  1IV8 A;  3GWZ A;  2OTJ I;  2HR3 A;  2GM4 A;  1Z1D A;  5E1X A;  1NK2 P;  1AA7 A;  2R4G A;  1KQ0 A;  1FJL A;  5CQE A;  3PSF A;  3IH3 A;  2HQR A;  2QUF A;  1Y8R B;  4Y33 A;  5DD4 A;  5HDG A;  4BGD A;  2MLK A;  4XRM A;  1NH3 A;  2GXB A;  2R7V A;  1LFP A;  1SFX A;  1QRY A;  2KRC A;  2VBW A;  4FT8 A;  3ZMT A;  3E7L A;  4XRS G;  4CDG A;  1ULY A;  1U3E M;  2HKO A;  4RS8 A;  5H2F C;  2V9K A;  2EH3 A;  1U5T A;  4ASN A;  1BI1 A;  4EGZ A;  2A05 A;  3HRU A;  1JUM A;  1E3H A;  1LB2 A;  2L7Z A;  3FHZ A;  1A6Q A;  1H0M A;  4DZJ A;  3S93 A;  1R22 A;  3W6K B;  2VI6 A;  2LY2 A;  3PNY A;  3PUB A;  2IJL A;  2R5Z A;  4C3I J;  3DFG A;  2DYS H;  4O5V A;  4PJ0 C;  2Z99 A;  3TBI A;  5FLV A;  3LWF A;  4AVP A;  3JCU C;  4IKF A;  2DA2 A;  2Y48 A;  6PAX A;  5E3N A;  3ZN1 A;  4FTH A;  5LRR A;  2Y2Z A;  3RQ4 A;  2JK3 A;  2LNB A;  4OIN F;  4CH7 A;  2BVL A;  3C3W A;  3FK6 A;  3OR2 C;  1VQ4 I;  3FXL A;  1WJB A;  4OAZ A;  2RQP A;  4B8X A;  3QPL A;  1A35 A;  2VQG A;  2DA1 A;  3GTK J;  1TQM A;  1WJ5 A;  3BR3 A;  4JX5 A;  2JWT A;  2MYS A;  1W5T A;  2CFO A;  3IL2 A;  4YIR X;  4F91 B;  1EH6 A;  1N75 A;  2OQR A;  2Z5U A;  3CDH A;  3I53 A;  4RAZ A;  3ZOB A;  1R23 A;  2L3D A;  3KFW X;  1D8K A;  5HS8 A;  1XMK A;  3IAM 2;  1ZAO A;  5D5U B;  1UG2 A;  4L5J A;  3EPZ A;  2M9H A;  2P6T A;  3S2D J;  1S9H A;  5ILU A;  3P7N A;  3P9I A;  3C2G A;  1D5Y A;  2F5C A;  2FJ1 A;  4BXX J;  3GFI A;  2HXI A;  3TL4 X;  5ERI A;  3RQI A;  1OCR H;  1B1B A;  3FMR A;  4RGX A;  5IYB J;  4XLA A;  3CCU I;  3JRB A;  1PP7 U;  3BZ6 A;  1XGN A;  2G0E A;  3H92 A;  1A36 A;  2I10 A;  2DMT A;  4L9N A;  1BJZ A;  3S1M J;  1LFB A;  3DLL F;  4N9I A;  4QIW N;  1IDZ A;  2HPI A;  2R5Y A;  4XBF A;  3ZMU A;  2IS6 A;  1HST A;  2FD5 A;  3DLA A;  3I59 B;  5ICE A;  5IT9 K;  3FBI B;  1QQI A;  3GFL A;  5L3G A;  3P9C A;  4RAG A;  1ZG5 A;  2NOG A;  3H35 A;  2MC4 A;  2IVM A;  3LSM A;  5E1Z B;  1FSH A;  1ZRD A;  1B8I A;  5IOY A;  2E2H J;  2JT1 A;  3QYE A;  5JI6 A;  5AIQ A;  5F04 A;  4WF2 A;  4HYE A;  3FM3 A;  3KZY A;  1PUE E;  5DDG A;  1K61 A;  1RZ4 A;  1J9I A;  4XOP A;  4KMU X;  2WTE A;  1P4A A;  2XKP A;  4CZC A;  1ZG3 A;  3BQZ A;  4NQW A;  2KMU A;  3BZK A;  2MW8 A;  4JQF A;  2M4K A;  3BWG A;  3HG9 A;  1UZC A;  4F55 A;  1I50 J;  3LSH A;  3CCL I;  2O0Y A;  4F52 A;  2DFI A;  2PG4 A;  3FMQ A;  2P5V A;  3DV8 A;  3VDX A;  3LNQ A;  4F3Q A;  1FNN A;  2VE8 A;  3SXY A;  1FWZ A;  1FMW A;  2ZME A;  3HTS B;  3L9F A;  5IP7 J;  2XHK A;  1BC7 C;  3AL0 C;  2DA6 A;  1WJF A;  4EM0 B;  3CLQ A;  3F3X A;  2WB1 N;  3FMS A;  1I1S A;  2HVS A;  5K1Y A;  4BE2 A;  1FBQ A;  1GXQ A;  1RUO A;  3OYH A;  4V19 K;  1MBG A;  2KKO A;  1NTC A;  2P8T A;  2KDZ A;  1HC8 A;  2FBI A;  2P7C B;  2PQ8 A;  4NDL A;  4RLF A;  5GAH J;  5E3L A;  2K9N A;  2M30 A;  3IWF A;  3WU0 A;  2YPR A;  4LLL A;  2EIJ H;  3E6C C;  1D5V A;  1WI9 A;  3K10 A;  3M1E A;  1TC3 C;  1O57 A;  1S7E A;  3VB2 A;  3T0Y A;  1YQA A;  3LMM A;  1Z91 A;  4BNC A;  2OZ6 A;  4A12 A;  2GA1 A;  2A61 A;  3GZN B;  4OWR B;  3ESW B;  2NVQ J;  2K5C A;  2X6X A;  4BDZ A;  3NWS A;  4P1W A;  4Q48 A;  1X4P A;  3F22 A;  3TP0 A;  2IAI A;  4HX8 A;  5CYV A;  5DV5 A;  3TDU C;  3HOS A;  1ZRF A;  4PGH A;  4MEY F;  3E5X A;  2LOO A;  2WAE A;  1WJC A;  5HOD A;  4BAY A;  4N0B A;  5CJ9 A;  5HDK A;  2MBF A;  3BR6 A;  2ZC2 A;  1OCP A;  1P9Q C;  2UXX A;  2QSH X;  5M3F J;  4DYR A;  4ZTF A;  2DLL A;  1U9O A;  5EEG A;  4A5M A;  2BHY A;  2G7H A;  1EJ9 A;  4JK1 X;  3EYY A;  4XLC A;  1HW5 A;  1JI8 A;  2X1E A;  4OAY A;  1RR8 C;  4UVC A;  1HW2 A;  4PGG A;  2VC1 A;  4B44 A;  4XKB A;  4A2U A;  3HUG B;  2Q0O A;  3LFU A;  1YRN A;  4NC6 A;  1TTY A;  1GV2 A;  3ZQL A;  1WRJ A;  5ILS A;  5D8K B;  5BMZ A;  1ZR2 A;  3R0A A;  4PDK A;  1JHH A;  3MVP A;  2ECC A;  4M9X A;  4YG2 F;  2DN0 A;  4RB3 C;  2BBY A;  2DXI A;  1W0U A;  1WI3 A;  2OU2 A;  5B5E C;  1YFH A;  4G9Y A;  5FRM A;  1MJA A;  3H9G A;  1S7O A;  2YUS A;  3A4C A;  1JTY A;  3F8M A;  1V5F A;  2CJJ A;  2COB A;  4HG2 A;  4N4O B;  4A6D A;  2LBF A;  4LD5 A;  1XMA A;  4B43 A;  3GUD A;  4XRF A;  2K9L A;  2BXZ A;  1SD4 A;  2WAQ N;  1AU7 A;  1VQ8 I;  2BXY A;  4MTE A;  4C3H J;  2QEX I;  3COA C;  1WJA A;  5ILV A;  1WJD A;  2QYO A;  3H0D A;  1SFE A;  2D45 A;  4HQE A;  5JHU A;  1TLH B;  2E1M B;  3HEF A;  3S3M A;  1Z6T A;  3RDI A;  2QM3 A;  5HLH A;  1PUF B;  4CSW A;  4FHT A;  2R7T A;  1G3Y A;  1GVD A;  2RGV A;  3RZO J;  4HA8 A;  1D0Y A;  2AQF A;  2BY3 A;  2HTS A;  2VOP A;  2LLK A;  3HC7 A;  3QP5 A;  2QCO A;  3J7A O;  1IRF A;  1T08 B;  2NVT J;  4E7I A;  2KQR A;  4GYI A;  4CIC A;  2E71 A;  5CVI A;  4RM2 A;  4D5C A;  2K9Q A;  2XPV A;  3M3Y J;  5TIS C;  3JRA A;  2ID3 A;  3SDG A;  1KU9 A;  2FX0 A;  3JRI A;  2DFH A;  5LGN A;  3BCB A;  4M73 A;  3RKY A;  3MQ0 A;  3DBR B;  3QU3 A;  4GDF A;  5KK1 A;  2FML A;  2XAG A;  3VSK A;  5KNL A;  2ZNY A;  3PQK A;  4IX7 A;  2J5O A;  4LB5 A;  2EZI A;  3DU6 A;  1LVK A;  2DU9 A;  3QPT A;  3BP8 A;  2EFN A;  2K4B A;  5GAD J;  1YJN I;  2CFX A;  4NHJ A;  5F1J A;  1F1Z A;  3SFZ A;  1OQY A;  2XF5 A;  2R7R A;  2DCE A;  3HPG A;  1ZKG A;  3HSE A;  4PUS A;  5GTI C;  3LQQ A;  4PJL A;  3HHH A;  3IH4 A;  2CUF A;  4I02 A;  1XPX A;  2OC6 A;  2HOA A;  2EZH A;  1WH7 A;  2GOX B;  2HYG D;  4Z2Y A;  5D4R A;  3L2W A;  4EEF G;  1TWA J;  4C30 A;  1ZGJ A;  4P9F A;  2BGC A;  4I0A A;  4I09 A;  2BZT A;  1ERD A;  3H9J A;  3BDD A;  3LAP A;  1T56 A;  1I3A A;  2F4O B;  1MBK A;  4L9T A;  5F0F A;  4BHB A;  4RA2 A;  2IS1 A;  3HB9 A;  2E2J J;  3OMY A;  4ZZL A;  5HOO A;  3ZQC A;  1CQT A;  3GTL J;  5EGO B;  1P7I A;  2WAF A;  3FKI J;  1C0W A;  3S16 J;  4LIT A;  4D7M A;  3KZI C;  1MBJ A;  3JSP A;  2HEO A;  2DI3 A;  3DPL C;  1P6R A;  1B9M A;  3HXL A;  1IXR C;  4I98 B;  3OIQ A;  4ZH4 F;  3GTM J;  2X6Y A;  4BAC A;  1K79 A;  5M5X J;  2FXA A;  3EUH C;  2CQQ A;  3AAF A;  4LFU A;  2E1O A;  2ZJQ F;  3CC7 I;  4IEJ A;  2DOF A;  2VE9 A;  2O9L A;  1FT9 A;  1KQ8 A;  1YG2 A;  2NVU B;  4YFK F;  2IEK A;  3M9A A;  5D5V B;  2EPF A;  2H1K A;  4WXH A;  2PFB A;  5EYR A;  3FIS A;  4YII A;  3UNG C;  2X85 A;  4G94 A;  2HQN A;  5TJJ A;  1APL C;  3A0B C;  1W1W E;  3CD6 I;  1P4W A;  1FYL A;  1YI2 I;  3C1D A;  3CUQ C;  1OCT C;  5J1U A;  2Y30 A;  5KAF C;  2M5W A;  3C7J A;  5ICC A;  4PZJ A;  3GTQ J;  4XKC A;  4BU2 A;  4RLQ A;  1SEU A;  3DXJ F;  5DCF A;  4P96 A;  4AVZ A;  2IT0 A;  2KDO A;  3ABU A;  1W0T A;  2XAU A;  3HOW J;  1YO5 C;  2F5F A;  3WOD F;  4FCY A;  1V5E A;  2QSG X;  1IO2 A;  3FXQ A;  4ETS A;  5DCM B;  3OS2 A;  1IZ1 A;  5IPA A;  1SAX A;  1WHU A;  3J7Z I;  5IP9 J;  3M1C A;  3OOU A;  5DUK A;  3ZQF A;  2NAZ A;  1UHS A;  3E6M A;  5D5X B;  4AWX B;  3FK7 A;  3HKZ N;  5B1A H;  4JBA A;  1AKH A;  2FOK A;  1WCM J;  3DWL E;  2K9S A;  3OYE A;  2PX9 A;  3CCS I;  3GME A;  1W7P A;  2MH2 A;  3JRF A;  1BIA A;  3MKY B;  1J75 A;  3A2K A;  2CS3 A;  1YIT I;  5J3L A;  1KYW A;  3MWM A;  1USS A;  3IRR A;  2OUM A;  3IP4 B;  3CO7 C;  2RVC A;  9ANT A;  4DJA A;  1XMX A;  4R8H A;  1WJE A;  3LSJ A;  3ZRG A;  2R0Q C;  4BBS J;  3CTA A;  4M71 A;  4A0Z A;  3IV5 A;  2KT0 A;  2V1D A;  2FU4 A;  4BY7 J;  1IG7 A;  3F8F A;  1B59 A;  1PYV A;  1WKM A;  3D5L A;  4CHU A;  4LK0 F;  2FBK A;  3V42 A;  4XN3 A;  4F7Z A;  2QA4 I;  2DT5 A;  2KL4 A;  5H20 A;  1ZLK A;  2MFZ A;  2CYY A;  1GVJ A;  2BYV E;  2IP2 A;  2QF7 A;  2XAF A;  3SJM A;  5DM6 F;  4IHV A;  3BR5 A;  4UXN A;  5L3D A;  2P5L C;  1L0O C;  1S29 A;  4EM1 A;  3H5N A;  2L0K A;  4U7B A;  1WQ2 A;  2R7U A;  2R7O A;  3TW6 A;  2H94 A;  4UB6 C;  2CQK A;  1E3O C;  3K7A J;  2VJ5 A;  3F0C A;  1OLT A;  3WTY C;  1ZH5 A;  5K7Z A;  2A07 F;  1D1C A;  1UEL B;  1XX5 A;  2XF7 A;  4HEA 2;  1UG0 A;  2ZB9 A;  2PBI A;  2QZ8 A;  3H3V K;  2FNA A;  4EV0 A;  2K4J A;  3F72 A;  4P55 A;  2NNY A;  3EQL F;  2X6W A;  1RES A;  2ZXH A;  1YJW I;  3I55 I;  3U1D A;  1X1A A;  3ROU A;  3M07 A;  2FOW A;  2JTV A;  2JA8 J;  2JQ7 A;  1REP C;  1XC5 A;  1R49 A;  3OR1 C;  5LFA A;  2PJR B;  4A3L J;  2L9V A;  3VFZ A;  4XKV A;  5BNG A;  1SMT A;  5C3E J;  2EFQ A;  5FKK A;  1RPW A;  2CUZ A;  3HJE A;  4LJZ F;  4JOM A;  2BEO A;  4U87 A;  3BT9 A;  2EFP A;  5J4Y A;  4R1H A;  1IRG A;  1J59 A;  4Y17 A;  1OCO H;  1MSE C;  4WK8 F;  4N4N B;  1LFU P;  2PLY A;  4YIF A;  3I71 A;  1KYZ A;  5F27 A;  3M4O J;  4ZJZ A;  5F6F A;  3CCJ I;  1W4M A;  1XSX A;  5GTH C;  4IJA A;  1GUU A;  3K2A A;  2Y0S A;  4FX0 A;  4H0E A;  5LRS A;  5DS9 A;  3HOX J;  4CCN A;  5IT9 Z;  3K4N A;  5B3S H;  1R4N B;  1HKQ A;  3X2Q H;  3BQY A;  3F21 A;  4MGR A;  3K4B A;  1OMI A;  2E1N A;  2JVH A;  4ENJ A;  3O3K A;  2CSO A;  2JUC A;  4GFB A;  2DMP A;  2L54 A;  3I54 A;  4OMZ A;  2GA2 A;  3LSK A;  1YIO A;  4IQ4 A;  2M2E A;  3ZN0 A;  4XIC A;  3SFI A;  2R7Q A;  2HS5 A;  3W3C A;  2LY1 A;  2P81 A;  3QPH A;  4LIV A;  2X51 A;  2EV5 A;  1LDD A;  4BJ5 C;  1FTZ A;  1HXD A;  3A1Y A;  5IP6 A;  3ONQ A;  1UHM A;  1ZQ3 P;  2VXD A;  1HKS A;  4BEH A;  1XG1 A;  1LNW A;  4U7D A;  3HOT A;  2JSC A;  3SEQ A;  4O3M A;  2EV0 A;  3HBL A;  4J01 A;  3JAM K;  1RI7 A;  2J5P A;  1XCB A;  2KP6 A;  2M34 A;  1YJ9 I;  2IS4 A;  2K9M A;  4CZZ A;  5LBQ A;  2Q2E A;  4Y15 A;  1ZG1 A;  1SD5 A;  3PL8 A;  4N9H A;  4C2U A;  1POG A;  5KVR A;  2CU7 A;  3ZCO A;  1XDU A;  3F9K A;  4BXU A;  1T95 A;  5FD6 A;  1PVE A;  3RPQ A;  4XID A;  2ME6 A;  4RAY A;  1B9N A;  3DCF A;  5K7H A;  5LD2 C;  4B3A A;  3CES A;  2DTR A;  1ZGW A;  1T2K A;  2WAD A;  4CCM A;  3V8L A;  4L9J A;  1EKE A;  2E7W A;  2OTL I;  1LJ9 A;  2F5V A;  4CYC A;  3LAJ A;  2Y31 A;  2VXZ A;  4IZZ A;  1IXS B;  4GCV A;  3CUQ A;  4NUB A;  5F1R A;  3PSI A;  3SZT A;  4C2T A;  5IT3 A;  2DA5 A;  2UZK A;  1LDK B;  4BQQ A;  2WA0 A;  2NVX J;  3SHF A;  5B66 C;  1YX5 A;  2R7D A;  1QA6 A;  3F6V A;  1U8B A;  2GXA A;  4MO7 A;  2PMZ A;  2IXS A;  3ZQ7 A;  2VJI A;  3BG3 A;  1DGW Y;  3RI4 A;  2Z3Y A;  5J47 A;  2OCC H;  2NS8 A;  3WTT C;  2K27 A;  2VBY A;  1SD6 A;  1T8I A;  4D7N A;  1R4M B;  2BW3 B;  2KLO A;  4ZYH A;  1IF1 A;  3AG3 H;  2KIM A;  2O8X A;  3A01 B;  3LL7 A;  1MBF A;  4JP0 A;  1FIA A;  3W6V A;  2XSD C;  1T33 A;  2DDB A;  1IN7 A;  4L0Z B;  2VB6 A;  1MH3 A;  1X4O A;  2A5W A;  2TDX A;  3CC2 I;  1HCR A;  2HFH A;  2OJE D;  4HW0 A;  3DTE A;  3N4M A;  1WVR A;  3BCA A;  4EAT A;  2DK8 A;  4AD9 A;  3W2W A;  2M1B A;  1ACI A;  4MFD A;  3BJA A;  1VQ7 I;  4HX7 A;  1OPC A;  1PDN C;  3AG2 H;  3RKQ A;  1JE8 A;  1BI2 A;  1ENH A;  3MAJ A;  4Q47 A;  1U5T B;  1FP2 A;  1IN4 A;  5FRO A;  1VQ9 I;  1JXS A;  3KYC B;  1ZLJ A;  4JX4 A;  4ZYG A;  1X3Z B;  2VKD A;  1TWF J;  4H4K C;  1SFO J;  4XMY A;  1WZ2 A;  2DDA A;  3NAR A;  1TNT A;  1Y1W J;  1BJA A;  3E6D A;  4AUX A;  2CWE A;  2R5Z B;  4BHC A;  4DBR A;  3P9K A;  4A5N A;  1ZR4 A;  1OCC H;  3BZC A;  2XPU A;  2AXT C;  3ABM H;  2WY8 Q;  3F8B A;  1IN5 A;  4DIQ A;  1A31 A;  3CP8 A;  5FKL A;  5ED4 A;  3U9G A;  3L2V A;  1ONV A;  1K4S A;  1H8A C;  1ZK8 A;  2CV0 A;  2VN2 A;  1Q1H A;  1WH5 A;  2OD5 A;  4AIH A;  1HSJ A;  2PI0 A;  4J19 A;  3EYI A;  2FRH A;  3QRF F;  4HDU A;  1Z0X A;  3KPH A;  3S1N J;  1QHH D;  5CLS A;  3RPU A;  1OIS A;  5JLX A;  3Q5F A;  4M6X A;  1BN5 A;  5L3C A;  1X58 A;  4RGR A;  2OPT A;  4HV6 A;  3MZH A;  1BI0 A;  4HDV A;  5IOZ A;  2NXN B;  2HPM A;  3PNV A;  1D3Y A;  2E7X A;  3CLO A;  1NHA A;  2V1X A;  2BOL A;  3REO A;  1EF4 A;  3MKL A;  3NEU A;  3RCO A;  4RM3 A;  1W36 C;  1Z21 A;  3H3Z A;  5DM7 F;  2IGM A;  3FIW A;  4IXA A;  3TO7 A;  3FXM A;  1MZB A;  2HOS A;  4DW6 A;  1VQ5 I;  1FC3 A;  2FE3 A;  1DP7 P;  3OIO A;  4MFE A;  3K4L A;  5CVR A;  4RB0 A;  4BUP A;  2XGC A;  4XSX F;  2QBY A;  2RAE A;  4W1U A;  2IS2 A;  1J5Y A;  1MDM B;  1MMG A;  1Z3Y A;  3RTR A;  5DEQ A;  3OL3 A;  5IY5 H;  3BR2 A;  3WE2 A;  1BI3 A;  1S7A A;  2QQ8 A;  4KN7 X;  1FMV A;  2FSW A;  4FE7 A;  4MHG A;  3HYI A;  2F48 A;  2HQA A;  3OYM A;  4HOB A;  3GCM A;  4XQF A;  2R5Y B;  4HPQ A;  2EIM H;  4FE4 A;  4E7K A;  1HF0 A;  1GHC A;  4Q4Z F;  4BJT A;  1VI0 A;  1SD7 A;  1W36 D;  1TWG J;  1SAN A;  5BOX A;  4Z6Y A;  4MLO A;  3CMY A;  3GX4 X;  1RRJ A;  2DA7 A;  1XD7 A;  2L2O A;  4Q5S F;  1XSV A;  5FD5 A;  3KP7 A;  2L4M A;  2DA4 A;  1FOK A;  1IUY A;  3D0S A;  2X9D A;  5FLM J;  2KZG A;  2RRE A;  2W00 A;  2F5D A;  4BKX A;  1STZ A;  1MKM A;  2PN6 A;  5EDN A;  3VEP A;  1LEA A;  3JRD A;  5F0H A;  2D1H A;  3Q9V A;  4BE1 A;  5FLX Z;  4C2M J;  3KCC A;  3T1B A;  1R1U A;  4A3D J;  5HVQ C;  2HTJ A;  2ACJ A;  2VAS A;  3O8G A;  3BLY A;  3D5R C;  3L09 A;  4GO1 A;  2ZME B;  3EUK L;  3CDL A;  4ZDP A;  3KE2 A;  1D8J A;  2EIN H;  4BXF A;  1AOY A;  2EZL A;  1FIP A;  3K6G A;  3N05 A;  1OJL A;  4EJW A;  1G2H A;  1I3Q J;  2FQ4 A;  1BA5 A;  3WHC A;  4A3B J;  1JUS A;  5J8C A;  3I4M J;  1BR2 A;  4EJV A;  1QGP A;  2HOT A;  2EV6 A;  4UB8 C;  2JJ7 A;  2DA3 A;  4Y7N J;  5L3B A;  2DFE A;  2R3S A;  2R7S A;  4J00 A;  4HF0 A;  4Y52 J;  2XSJ C;  1JT0 A;  3OSF A;  2G9W A;  2EK5 A;  2HYJ A;  1D0Z A;  2GAU A;  1HQC A;  1KU2 A;  1ON1 A;  3IWZ A;  4BHP A;  2OBP A;  4Y13 A;  5GPC A;  4S05 A;  3DEE A;  1T38 A;  4LLG F;  3T8R A;  4ENN A;  2E34 A;  3IKT A;  5J6X A;  2ZFW A;  3MMY B;  1GLN A;  1SAU A;  2BY1 A;  2O03 A;  4UV9 A;  3KP3 A;  5FFZ A;  3GYH X;  3E97 A;  1GXP A;  4I01 A;  3CQZ J;  3I56 I;  3DF8 A;  4YFN F;  4KYW A;  1MD0 A;  5LHI A;  1AWC A;  4KNY A;  2ECB A;  1W7P D;  1S6L A;  5H6R A;  4IOA F;  2LMD A;  3E6B A;  5DTD A;  4E7Z A;  4KMF A;  1Q1V A;  5E20 A;  2LKS A;  3F8N A;  1T98 A;  3L2C A;  2FEZ A;  4PJN A;  2W4S A;  2CMP A;  2E5N A;  1FBS A;  2BVM A;  1LVA A;  3D5S C;  2VL8 A;  4FET A;  4XK4 A;  3TQN A;  3VYU B;  1YRN B;  3GBG A;  2KJC A;  1J7K A;  3KEO A;  1VQ6 I;  2X1D A;  1N78 A;  2HVQ A;  3PO2 J;  1EH8 A;  2IPQ X;  1DP3 A;  2O8K A;  2PMU A;  1P2F A;  1VZ0 A;  3BR0 A;  2CG4 A;  5DUI A;  3FBN B;  2GIV A;  2NOJ B;  2QKM B;  4QPO A;  4XNF A;  2OF7 A;  5BPI A;  1RET A;  3GXO A;  2DOE A;  3KZZ A;  5GAE J;  1D1B A;  4ZTJ A;  3CJQ B;  1RUN A;  3VYR B;  2QGU A;  2QVO A;  2YX4 A;  2LBF B;  1UAA A;  2DOD A;  2L7M P;  4S0H B;  1HBX G;  5GPA A;  3K0L A;  5FGM A;  3V7S A;  4AID A;  3DEU A;  5KHD A;  2RNJ A;  4XM3 A;  1JKR C;  3JRC A;  3V8J A;  3QAH A;  2ESH A;  3R60 A;  4II2 A;  1L3L A;  2LDU A;  2VQL A;  2DMQ A;  4MTD A;  5TRD A;  4E70 A;  2Z33 A;  4WXD A;  1MH4 A;  2O7O A;  1SC7 A;  1DPR A;  2LH9 A;  1IDY A;  2ZXW H;  3L7W A;  4IRH A;  4C9Y A;  4DYQ A;  2CW8 A;  2FBH A;  1LQ1 A;  2XAH A;  3ZMV A;  3VYS B;  1B6A A;  1H88 C;  4KA4 A;  2IRF G;  1IW7 F;  1ZAR A;  2IW5 A;  3H36 A;  5AON A;  2HI3 A;  2VQC A;  5CVV A;  4LGW A;  5JVT A;  2ADU A;  2UXN A;  3V7R A;  5EGO A;  3WTV C;  1HDP A;  1VFC A;  4EJT A;  4ANJ A;  3S15 J;  3BY6 A;  1ZN2 A;  2KFD A;  1SVO A;  3B6A A;  4KIG A;  1MMS A;  4NC8 A;  5BS6 A;  2QQA A;  4BY1 J;  3E5Q A;  3FX3 A;  2EQR A;  2KIS A;  3HOV J;  3GVA A;  2O61 A;  2AXL A;  4LIU A;  1ORK A;  1YW7 A;  2BV6 A;  3KLN A;  3E5U A;  5FLX K;  1YW8 A;  2KHM A;  1UCR A;  3ZP5 A;  3G71 I;  2KIF A;  3T5X A;  4A3F J;  3PFY A;  2XAS A;  2Y0S N;  3IHU A;  4YRV A;  1G4D A;  3ZMS A;  4KFC A;  3DBH B;  3QOP A;  1ZRE A;  3KP5 A;  2ID6 A;  3E3V A;  4M3G A;  4MIM A;  1TT0 A;  1ZTR A;  1KGS A;  3C2B A;  4MNU A;  2V9V A;  1B72 A;  3S17 J;  4G6Q A;  3VPR A;  1B4A A;  1FOY A;  4EGY A;  2GWR A; 
#chains in the Genus database with same CATH homology
 4XKV A;  3OR2 C;  1WJB A;  2M3A A;  4OAZ A;  2CUZ A;  4XOT A;  2VQG A;  4JOM A;  4U87 A;  2HU9 A;  1WJ5 A;  3BC8 A;  2L7K A;  2MYS A;  2VJJ A;  2CFO A;  3DKY A;  4F91 B;  4E7L A;  1N75 A;  2MD0 A;  3QYB A;  3S3N A;  4N4N B;  3C2H A;  3QOD A;  3DKX A;  3IAM 2;  3FHN A;  4ZJZ A;  3EPZ A;  2Y0S A;  3J7A Y;  4KT6 A;  3K4K A;  1S9H A;  4CCN A;  3OYI A;  3MD2 A;  3C2G A;  3K4N A;  2XC7 A;  2CW7 A;  4E7S A;  3DPT A;  2JUG A;  4LG3 A;  3TL4 X;  4CCJ A;  3K4B A;  4GRI A;  4XLA A;  3SDB A;  1R6R A;  4FAS D;  3W2A A;  2JVH A;  3AL0 B;  2R7X A;  2CV1 A;  3LSK A;  1N77 A;  4IQ4 A;  2HPI A;  2R7Q A;  2IS6 A;  3W3C A;  1WFX A;  2M4G A;  2LY1 A;  3DLA A;  3FBI B;  2XF6 A;  3OS0 A;  2JVG A;  4LIV A;  4BDY A;  2X51 A;  1DQU A;  3H35 A;  2MC4 A;  3LSM A;  1PJR A;  4BL0 B;  3E0J B;  1Z3X A;  4BJ5 C;  3A1Y A;  3CZ6 A;  3QYE A;  1MNE A;  3ONQ A;  2VXD A;  1QU3 A;  3UR3 C;  2Z2S B;  4BEH A;  3L2Q A;  3K4J A;  2V1N A;  4XOP A;  1X1C A;  3HOT A;  3SEQ A;  1QHG A;  4CZC A;  3ZGK A;  3MKZ A;  2KMU A;  2KZV A;  2V7F A;  4J01 A;  4JQF A;  2M4K A;  4ZYA A;  3HG9 A;  2KP6 A;  2IS4 A;  4F55 A;  2K9M A;  1ZEL A;  3LSH A;  4F52 A;  3PL8 A;  4C2U A;  3VDX A;  4F3Q A;  3ZCO A;  4Y4R A;  5CQG A;  3F9K A;  4YEL A;  1T95 A;  1FMW A;  2WAQ A;  2LRE A;  2WY7 Q;  4P5O A;  5LD2 C;  3AL0 C;  3CES A;  3E1S A;  1WJF A;  2WAD A;  4CCM A;  2F5V A;  4XLF A;  2Z1D A;  2HVS A;  3LSI A;  2UWM A;  4BE2 A;  2E5Z A;  2VXZ A;  4IZZ A;  3ZQQ A;  2F6C A;  4NUB A;  3OYH A;  3PSI A;  2VLA A;  4KJZ A;  4C2T A;  1LDK B;  4BQQ A;  2WA0 A;  3OYN A;  2Q1Z B;  1YX5 A;  1HA8 A;  1Y56 A;  4RLF A;  2PMZ A;  2IXS A;  2VJ4 A;  2E60 A;  2VJI A;  4ZC3 A;  1DGW Y;  3L2R A;  4XOR A;  1J09 A;  4X0G A;  3S3O A;  3OYB A;  3K10 A;  2GOM A;  4PSW A;  2BW3 B;  2KLO A;  1BOB A;  5CPR B;  3LMM A;  2HZD A;  3LL7 A;  4OWR B;  2K5C A;  2JA2 A;  2X6X A;  4PSX A;  4BDZ A;  2P0W A;  3M8J A;  2OV7 A;  3NWS A;  1X4P A;  4P1W A;  4D1Q A;  2VB6 A;  1X4O A;  1T0F C;  2A5W A;  2WB1 A;  2DOA A;  1BR4 A;  3OIP A;  3DTE A;  2CUJ A;  4F93 B;  3HOS A;  3BCA A;  4EAT A;  2LOO A;  2WAE A;  1WJC A;  1E0E A;  2FUG 2;  3W2W A;  4PJM A;  4PK4 A;  3CMM A;  3RPU D;  1P9Q C;  4E6K G;  4ZTF A;  2I8D A;  2V4J C;  2HVR A;  4XL9 A;  4XLC A;  5FRO A;  1JI8 A;  2X1E A;  3I3L A;  4OAY A;  3TMO A;  2IGK A;  4ZDO A;  2M7B A;  2VKD A;  4H4K C;  4B44 A;  4XKB A;  3HUG B;  4XMY A;  3LFU A;  1IRX A;  4XN0 A;  3VYT B;  4DBR A;  3PNT A;  3SEZ A;  3VWB A;  2ZXI A;  2CV2 A;  1X19 A;  4HNT A;  4KIS A;  2KPM A;  4CUG A;  4BS9 A;  3ZXS A;  2WY8 Q;  4DIQ A;  3NWT A;  3BG7 A;  3CP8 A;  3H5A A;  3L2V A;  3OYC A;  2CV0 A;  2DXI A;  2ZSI B;  2L9S A;  4PFO A;  3S8P A;  4XR6 A;  5FRM A;  1TZL A;  2ELJ A;  3H9G A;  2L5Q A;  3A4C A;  1V5F A;  4HG2 A;  1QHH D;  3OL4 A;  4N4O B;  4DBQ A;  2LBF A;  4CA0 A;  4B3X A;  4B43 A;  4CCK A;  2DJI A;  3OWT A;  1K6Y A;  2M7A A;  2K9L A;  2M0M A;  1EA3 A;  1DGR M;  1WJA A;  2DT6 A;  1X1D A;  1WJD A;  3MKW B;  2HPM A;  3PNV A;  3H0D A;  2E1M B;  3S3M A;  2W82 A;  2BOL A;  4Y3O A;  2V6E A;  1LKX A;  3RCO A;  4CSW A;  2LG4 A;  4RM3 A;  3OYK A;  1W36 C;  4RMN A;  2R7T A;  3BG6 A;  1Z21 A;  3SYT A;  1D0Y A;  2AQF A;  2UV1 A;  2IGM A;  3HC7 A;  3K4L A;  1YX3 A;  4BUP A;  2LRD A;  2IS2 A;  1MMG A;  1Z3Y A;  3RTR A;  4E7I A;  3OL3 A;  2KQR A;  1KON A;  2WBM A;  4RM2 A;  4YEJ A;  1FMV A;  1MMN A;  2HQA A;  3IUO A;  3OYM A;  4XQF A;  2O5R A;  4HPQ A;  4E7K A;  2QKL B;  3BCB A;  4BJT A;  1W36 D;  1YE9 A;  2MAB A;  4MLO A;  4HSR A;  3CJR B;  4PFP A;  3VSK A;  5KNL A;  4IX7 A;  2L2O A;  3DU6 A;  1LVK A;  3KX2 A;  2LC2 A;  2XF5 A;  2R7R A;  2W00 A;  2RRE A;  2DCE A;  3DU5 A;  3HPG A;  1BR1 A;  4ZDL A;  2E1M C;  4PUS A;  4PJL A;  4BE1 A;  1G59 A;  2OC6 A;  3IAS 2;  1D0X A;  2Q2E B;  3HKZ A;  2DT7 B;  2PJR A;  2GOX B;  5HVQ C;  3L2W A;  2CH0 A;  2VAS A;  4XON A;  4C30 A;  3BLY A;  3D5R C;  4E4H A;  1MMA A;  3OYA A;  2R7W A;  3EUK L;  1MND A;  4ZDP A;  1ERD A;  4BXF A;  4HNU A;  3H9J A;  5CKT A;  2AQE A;  3HPH A;  3K6G A;  3N05 A;  3DQV C;  1BR2 A;  3G2B A;  5TGT A;  1X1B A;  5HNH A;  2IS1 A;  4AYB A;  4DOZ A;  3OMY A;  5HOO A;  1G8X A;  3KEY A;  2R7S A;  2UUZ A;  4PJJ A;  2WAF A;  3CF2 A;  4LIT A;  4J00 A;  3VSL A;  2XSJ C;  5KCM A;  1NG7 A;  4G6T B;  1D0Z A;  3QYF A;  3DPL C;  4XLE A;  3HXL A;  3KYL A;  3OIQ A;  4E7J A;  3OYG A;  4QPQ A;  3DEE A;  4BJ6 C;  2F4I A;  4R79 A;  2X6Y A;  2RQQ A;  4BAC A;  1SFK A;  1Y6I A;  3EUH C;  3AFH A;  3MMY B;  1GLN A;  1SAU A;  4B48 A;  2JSP A;  2IGO A;  1D1A A;  3FKJ A;  3H9Q A;  2VPL A;  3UNG C;  2X85 A;  4BE0 A;  3SZG A;  4CCO A;  3OYJ A;  1V5G A;  3S32 A;  2VIX A;  3U21 A;  4E7Z A;  3OYF A;  4AU7 A;  4BQN A;  2Z16 A;  2RNG A;  5HNF A;  4HRI A;  3DPU A;  2VQH A;  3FDY A;  2W7N A;  4PJN A;  2W4S A;  4XKC A;  2CMP A;  2E5N A;  4RLQ A;  2BVM A;  2KRH A;  3D5S C;  4FET A;  2VL8 A;  3RSN A;  4BU2 A;  4E7H A;  3VYU B;  4AVZ A;  3GBG A;  2KDO A;  5HLT A;  2XAU A;  2HNH A;  2X1D A;  2LYC A;  1N78 A;  2HVQ A;  3DTI A;  3QOE A;  1V5E A;  1DP3 A;  1MMD A;  2XDV A;  1VZ0 A;  3OS2 A;  4HST A;  3DTK A;  3FBN B;  3M1C A;  2NOJ B;  2QKM B;  3L2U A;  1NG6 A;  4QPO A;  3OOU A;  4XKW A;  4XNF A;  2K3P A;  4CCL A;  3K4M A;  5FRN A;  3H5R A;  1D1B A;  4ZTJ A;  2W1O A;  3CJQ B;  3OYL A;  4KIT B;  3DWL E;  3VYR B;  4II3 A;  3OYE A;  2LBF B;  1U0J A;  3MKY B;  1UAA A;  2HDW A;  3A2K A;  1MW7 A;  2CS3 A;  2OUM A;  3IP4 B;  1OR7 C;  4DJA A;  1WJE A;  4NNJ A;  3ZRG A;  4F92 B;  4DGW B;  2L9N A;  5KHD A;  3HL2 A;  2BW3 A;  4XM3 A;  3CP2 A;  4B47 A;  4BEH B;  4NC7 A;  3OY9 A;  1PYV A;  4II2 A;  3D5L A;  2VQL A;  3K4C A;  3K70 C;  3V42 A;  4XN3 A;  4NQW B;  1AA7 A;  2R4G A;  2KL4 A;  2MFZ A;  3I9V 2;  3PSF A;  5CQE A;  2LH9 A;  4Y33 A;  4BGD A;  4C9Y A;  2R7V A;  4XLH A;  3AKZ A;  2CW8 A;  1LFP A;  3VYS B;  2KRC A;  3H5N A;  4U7B A;  3OS1 A;  4IQJ A;  2R7U A;  2R7O A;  2VQC A;  2V9K A;  2ZSH B;  4ANJ A;  2VJ5 A;  1OLT A;  2IGN A;  4NC8 A;  4ITV A;  3K70 D;  1D1C A;  1UEL B;  2XF7 A;  4HEA 2;  3S93 A;  1UG0 A;  3PJR A;  4LIU A;  2LY2 A;  3PNY A;  3PUB A;  3EUA A;  2KHM A;  2V26 A;  3TBI A;  1Z7L A;  3PFY A;  2X1C A;  4YRV A;  2X6W A;  2ZXH A;  3LSG A;  4BQO A;  4D9J A;  2A6T A;  1X1A A;  4IKF A;  3W2V A;  3OYD A;  2VKH A;  3ZR8 X;  1TT0 A;  3OR1 C;  5LFA A;  3RQ4 A;  2PJR B;  5JHF A;  2ZFU A;  4CH7 A;  2BVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...