3A1YA

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
b'MEYVYAALLLHSVGKEINEENLKAVLQAAGVEPEEARIKALVAALEGVNIDEVIEKAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein P1 (L12P)
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosomal protein
total genus 20
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3a1yA00
3A1YA 2W1OA 2LBFB 4BEHB 2LBFA 4BEHA
chains in the Genus database with same CATH superfamily
4UHTA 3RPUD 4HDUA 2L7KA 3SYTA 3VPRA 2MG4A 2KJBA 3REOA 3CCQI 3ZGKA 1FBUA 2V6CA 2DCEA 3LSJA 4CYCB 1TLHB 3GZNB 1G3TA 1X19A 4M9SA 1C0WA 3F8BA 5FLMJ 3JRBA 3FK6A 4JX4A 2A6EF 1YO5C 1TWCJ 1B72B 1ZG3A 3BZ6A 3G2BA 3DP7A 4XLAA 1VQ4I 4BY7J 4WWCA 1YE9A 4PJ0C 3G73A 2R4GA 1LEAA 2L4AA 2G7HA 3S2DJ 3KIOA 1T33A 2VKVA 3HJEA 4BBRJ 2ZSIB 3IV5A 1FIPA 2H8WA 3CJNA 1NK2P 1OR7A 2R3SA 2EV6A 5HS7A 2QCOA 4A0XA 2XV4S 1M1EB 3K70C 4U0YA 4P5OA 3JRGA 3WGGA 3GTKJ 4M6VA 4UXNA 3L2CA 4KITB 4MFEA 2ZFWA 5E3OA 1Z67A 1IC8A 2CRGA 5E79C 2QF7A 1VZ0A 3ABLH 2OA4A 3J80K 3CCYA 3HOYJ 1OJLA 4TV7A 5D6EA 2IW5A 4XLCA 2XF7A 5KHDA 1IF1A 4LK0F 2VOPA 5D8LB 2E1CA 3P9KA 3K1MA 1LDKB 1SVMA 4X6AJ 3ZRGA 1H0MA 1ODDA 2ZKZA 3PSFA 5J8CA 4HW0A 1USTA 4IXAA 1GV2A 2DFFA 3BG9A 3BR0A 3MQ0A 3CMYA 3RDIA 3MZ8A 4DW6A 1DGWY 1GT0C 4I2OA 1F4KA 1VF9A 1POGA 1XS9A 1IG7A 4BL0B 3HGGA 3IH3A 1K78B 1AU7A 5EJCA 2HOAA 3IAM2 3OL3A 4BS9A 1ORKA 5DCMA 5EG0B 1RIOH 2ZMEB 3WODF 3NQOA 2K85A 5D8KB 4A93J 2DAOA 1G3SA 4BE0A 1RI7A 3AKZA 1T8IA 2X6YA 1EH7A 2LH9A 3GYHX 3PL8A 3ZPLA 2BV6A 4IHWA 1FMWA 2RVCA 4R1HA 4XOTA 2XGEA 3I53A 2XDVA 4HNVA 5D5WB 1SD4A 3QOPA 2PJRA 1Y56A 1T0FC 2VN2A 2VASA 5FB2A 1BA5A 4RGUA 3MKYB 4KDPA 5KK1A 2CV1A 5M3FJ 3BC8A 2O3FA 2YX4A 2W82A 3TDUC 4C2TA 4JBAA 1PUEE 1EKEA 2CYYA 2E71A 2P5VA 3LSRA 4IHYA 3QPSA 2BHZA 3U1DA 4R79A 2FBKA 3S2HJ 4IQJA 1KU9A 2VT3A 1R4MB 2COBA 5ERIA 3IWFA 3HHHA 1MJ9A 2J5PA 2WA0A 4B47A 1FOXA 4EQQA 2IXSA 2K4JA 2VC1A 1WJAA 3LQRA 3OIQA 3H36A 2PMZA 2Y48A 2BY1A 4RM3A 3DQVC 3JRCA 1DUXC 3B6AA 2KRFA 2M30A 5DS9A 1GDTA 3C2BA 2OV7A 4A0ZA 1LFPA 3AAFA 2IGOA 3EUHC 4XRSG 2EFWA 4D0PA 2HPMA 3OL4A 2GXBA 4UVAA 1FPQA 1BC8C 3ZN0A 1MBKA 4E7JA 2VJ4A 4ENKA 2K9SA 1ETYA 2M0CA 5E17F 4Y33A 2G9WA 3CQZJ 1T08B 2X48A 2ESNA 3AL0B 2P5KA 1TT5B 1F36A 3EYYA 4RS8A 2HOSA 4B43A 3ZQFA 1EH6A 2RN7A 3IWZA 4RDUA 3AG3H 2XUBA 1P4XA 1DP7P 2FEZA 4N4OB 5CKTA 5L3GA 3GTJJ 4ON0A 2BE5F 2Z16A 3LA3A 1P6RA 3BR5A 2FU4A 3FXJA 1A36A 5HLHA 1T0FA 2BYVE 2ZNZA 1YFHA 3WG7H 4ITVA 1APLC 3VOEA 1D0YA 2HQAA 2DA6A 3F8CA 1P4WA 5TJJA 4GCVA 3L00A 4A69C 2FNAA 1QA6A 1ACIA 3J80Z 2EFNA 2A07F 2QKLB 2NAZA 1ZG5A 2QUFA 2JPCA 2QYOA 3DBRB 3E5QA 4S04A 3DBLB 2EIJH 1HBXG 1FOYA 2MSYA 4JX6A 1TNTA 2WY7Q 3PIOF 2HVQA 1V4RA 2L54A 5F0FA 5J47A 2RNJA 2WAQA 4CHUA 2LKXA 1OYYA 3R61A 2TCTA 4IJAA 3OYAA 4BEHA 3WTSC 2HPIA 1X2NA 2XSDC 1UHMA 2R5YB 1E3PA 5F1JA 2CUEA 4M3DA 2F5VA 3S1MJ 4BDZA 1ETKA 1YQAA 2QQAA 1R4NB 4ZTFA 1ZARA 3K2AA 2DW4A 4W1UA 3H9JA 2VBXA 1S8NA 3H3VK 2QEXI 3RKXA 2O61A 1SANA 2ZSHB 2LK2A 1MIJA 2KLOA 3ASNH 2QBYB 2VJ5A 3OY9A 1BM9A 2DK8A 3BCAA 4PJMA 3BTLA 3F6VA 3HOSA 1E17A 1GUUA 1U6GA 3QWLA 5L3DA 1J09A 1NHAA 2ICWG 4ZTJA 3K9TA 3JTHA 3BR6A 2QWWA 1YRNA 2ECBA 3AG2H 2R7TA 2DT7B 1O4XA 4M72A 4B3AA 2LNBA 2X6WA 4LG3A 2KDZA 4PSWA 3VEPA 4RM2A 5F27A 1Q1VA 2DFEA 1G59A 3I64A 3K4CA 4QWQA 2RKHA 4RA2A 4NC7A 1MSEC 5J3LA 1WWXA 1MBFA 1J7KA 2OD5A 1E2XA 5IP6A 3WTVC 1I3AA 1UG0A 4D5CA 3BOQA 5M3MJ 1FP1D 3SZGA 3ZMTA 1JE8A 4HPQA 1X3UA 1UG2A 2YR2A 3NAUA 4B1RA 4MGRA 1E3OC 4ENJA 1UB9A 2HDWA 1WJBA 2K02A 4HQEA 2V9VA 3SQNA 1XMXA 4A3CJ 2OCEA 1JT6A 2OZUA 3U9GA 4E7KA 4WXHA 3MD2A 3ERED 1ZG1A 2GQQA 1W4MA 2ZJPF 2L9NA 5FFXA 1IDZA 1B1BA 2NNYA 3A02A 2OCCH 4II2A 2Z2SB 1BW6A 3I3LA 1MBJA 3FXRA 4BHPA 3WTXC 5EEAA 1VNDA 3LQQA 2JSPA 3MN2A 4LOCA 3W6KB 2ZO4A 5E8IA 4UUSB 2R7DA 2GA1A 3V8KA 1Z1DA 1DGRM 2LY2A 2PX9A 2NRAC 2XAJA 2CW7A 5J6XA 2MLKA 3OWTA 5FRNA 2DJNA 2EFQA 3AFHA 2JUCA 4KT6A 2HEOA 1TBXA 3LSHA 1OPCA 3MCZA 4A5NA 3JRIA 5FRMA 4IX7A 2E7WA 2MH2A 3HDDA 1F9NA 2ZBKA 6PAXA 2DMPA 4ZYHA 1IUYA 2RV8A 2QZ8A 3W2VA 2O0YA 2KMUA 3L2QA 2KZVA 4XK4A 1R5GA 1Z9CA 3FXUA 4YEJA 4C3IJ 3E3VA 1YLFA 2HU9A 5FLXK 3BQZA 3CTAA 3H9QA 4QLCU 3K4BA 2O8KA 1LKXA 5ILSA 2JQ7A 1R71A 2EA4A 3ABUA 5K5QA 3SJMA 3I9V2 5KAFC 4EJWA 2NVTJ 5E1WA 5L3EA 3Q0VA 2HYJA 1L0OC 1JHFA 4JP0A 2WY8Q 5CPRB 3HYIA 1LE8A 4YFXF 3A01B 4JOMA 3W3CA 3TOBA 1HC8A 3JAMZ 3D5LA 2RREA 4LIUA 1KQ9A 2DI3A 2V9PA 3PSIA 4WXCA 2BY3A 3CDLA 4M74A 4RB1A 3I56I 4A3FJ 2ZFUA 4N4NB 2Z3YA 3B73A 1IN6A 3SHFA 3RYRA 1TWFJ 2KZGA 3BTIA 1MH3A 1IXRC 3RQ4A 3OYNA 2BY0A 3L2RA 4RAGA 1W5TA 2A3SA 3FXLA 3NARA 2DMQA 1SD7A 1MJAA 5LRRA 2DOAA 1FOWA 2Y9ZA 1BOBA 1P7JA 3HL2A 4D7MA 2KJCA 4F52A 2NYXA 4RAYA 2XC7A 3FDYA 1ENHA 1ITYA 1XGOA 1SAUA 2ZCWA 2KRCA 2E1MB 1JI8A 4MIMA 5CQGA 1WFXA 2P0WA 3WGHA 3ZQIA 3HOTA 1SFUA 1IUFA 2BW3A 3GFJA 2BEOA 1HW1A 2I8DA 3TP0A 2CMPA 1R1TA 2KPMA 1D8JA 2R7ZJ 3M07A 1IAWA 1G8XA 4IOAF 5AONA 3A0BC 2OQGA 2LOOA 3CMMA 3IH4A 4L9NA 4HNTA 1GXPA 1TL8A 1UELB 4I09A 2XHKA 4IRHA 4NC8A 3HOUJ 4M3EA 1YX5A 2NVQJ 2X9DA 4RLQA 3VSKA 4MNUA 3OYGA 4MEXF 2PBIA 1SFEA 1IXSB 1U0JA 3SXYA 3KYCB 1FTZA 5LHGA 3OYDA 4AM3A 1HXDA 1WRJA 2JA5J 3Q9VA 3PQJA 1TTYA 3CF2A 4HG2A 4O3MA 3DBHB 2Y31A 3K4KA 3KX2A 4I02A 2K5CA 2Y9YA 1MNEA 3KP5A 5K7FA 1T2KA 1DPUA 5DDGA 4BJ6C 4CICA 2M9HA 3VYSB 5DYMA 2Q2EA 2JWTA 4XKWA 1YHQI 1RETA 4CCKA 2OUMA 4ETSA 3RYPA 4I6ZA 4ESJA 2LBFB 1MBEA 1MNMC 1LVKA 1SMYF 2WAQN 1E0EA 4KA4A 1TQPA 2HFHA 1E3HA 2OJED 4CA0A 5FLXZ 1SEUA 3BCBA 2DOEA 5HDNA 4FT8A 5TGTA 3LSIA 3HXLA 3CC7I 4EMSA 2ELHA 3HUGB 2CUFA 1BC7C 1JUMA 4IHXA 1LVAA 2DA2A 2RC4A 3DPTA 5F0CA 2EFPA 4XKVA 3I4MJ 2PJPA 4RB0A 3KZIC 4CGZA 1X1AA 1HDDC 2WV0A 3MZYA 4OAZA 2XKPA 1YG2A 1EV7A 2RDPA 3RPQA 1N78A 1D1BA 2JN6A 1YYVA 3OSGA 2W00A 4V2GA 1W5SA 1U9NA 4J19A 1WHUA 2B0LA 2DOFA 3FXKA 4Q47A 1HSJA 1LDDA 2OC6A 3M4OJ 4XM3A 3M8FA 4A3EJ 2HXOA 2JJ7A 3OYJA 2DO7A 3KP6A 3S3MA 3WG9A 2VBWA 2ADUA 2KFDA 1ZYRF 4AUXA 1WJ5A 2YX7A 2L02A 3QPHA 3QU6A 3LSMA 3RIRA 3WU1B 3L2WA 1HW2A 1G6NA 3VWBA 1J75A 2VOOA 1GLNA 2DDAA 4EJUA 5J1UA 2CV0A 1MBGA 2CUZA 4DBQA 3TP3A 3IKVA 3GLXA 3HB9A 5TISC 1QQIA 1JUSA 2DA5A 2H1LA 4N0BA 4ZDLA 1DPRA 2VB6A 3RKWA 3G71I 2WC2A 2AO9A 1EA3A 2LREA 2HOTA 2CWEA 5JVTA 4XSXF 1WH5A 4IOCF 2KIUA 3ML6A 4G7OF 1XMAA 5FJ8J 5C4JJ 5HODA 2R92J 4JK1X 4CYDA 2O6GE 4Y3OA 4CYCA 4UUVA 3K1PA 3MWMA 4WX9A 2W1OA 4FE7A 1B72A 2A68F 3V8JA 1DP3A 1DU0A 3X2QH 5B5EC 3WTWC 2KIQA 1PVEA 3CLOA 4MO7A 5M5XJ 5M5WJ 2M7AA 1O57A 5HLTA 5B3SH 3VODA 4BXUA 2NS7A 4MFDA 4IPAA 4KYWA 2EZKA 2V1DA 5K5OA 1KQ0A 2HVRA 4CO8A 2HVSA 2DT5A 2DFIA 3GTGJ 1X3ZB 5CYVA 4FHTA 4AIKA 3J81K 4HSTA 4QPOA 1JKRC 1SC7A 4HZFA 5DEQA 4Z6YA 3WGIA 3LSGA 1K61A 3QU3A 2MGQA 1J2XA 2VJIA 3A0HC 4HQMA 4YELA 4MTEA 3BZKA 1V5GA 4K2EA 4RAZA 1BIAA 1LFUP 2PI0A 3T8TA 4PUSA 3PNYA 2PQ8A 2K7LA 2R5ZA 1U78A 3R60A 2JVGA 1X3WB 1IN7A 2LP0A 2ZJQF 3MKZA 1MMSA 3OYEA 2HR3A 2MFZA 4RMNA 3ZMSA 3HTUA 3OYFA 3QYBA 5CJ9A 4L0YB 1K6OA 3BROA 4WCGA 2JA8J 3E6BA 1K78A 2FUG2 3HKZA 2JPBA 4CZZA 1ON2A 1R23A 2LG4A 5EG0A 3VSLA 2ZMEA 2DA4A 4O6JA 5HDGA 2UXXA 2IS6A 3ZXSA 9ANTA 2P6SA 2Z99A 4RGRA 3ZMUA 3BG7A 3BLYA 1QHGA 4G12A 1VQMI 3HOZJ 4HX8A 3PIPF 4E4HA 1U9OA 2N8GA 1J0RA 2IJLA 2KDOA 3MVPA 3BG3A 1MMDA 4U0WA 4ZH4F 4YFKF 2HTJA 1XSVA 2FSWA 1FX7A 1SVLA 5GTIC 4RBOA 4G94A 4C2MJ 3KCCA 1I1SA 2F4MB 2YSRA 2EZLA 2RNGA 1W36C 1BI3A 5ICGA 4DBRA 5C4XJ 1B8IB 2PMHA 4Q4ZF 2DBBA 2DJIA 3S14J 2W48A 1U5TB 2WB1A 4DGWB 4HOBA 4ZYDA 2BOLA 1W7PB 1WI9A 4DNCA 2IS2A 1I6XA 2DYRH 2ELJA 3QPLA 1CGPA 2Q8KA 2W84A 3SFIA 5F6FA 5LGTA 3CCUI 4Q48A 2CG4A 4XLPF 2DDBA 2HYFA 2LVSA 5CVVA 2DMUA 2JA6J 2VXDA 1F5TA 4KIFA 2JK3A 2RGVA 2LYCA 4R8HA 2UXNA 3CJTB 2X1DA 5E8GA 3HOWJ 1QZZA 3SDBA 3F21A 1VQ7I 1STZA 4OOIA 2ISYA 2JA7J 2FBHA 4IHTA 1N75A 3H0GJ 4J00A 4BACA 1XX5A 2JSCA 5EEGA 3TEDA 2VQHA 2M34A 5EF6A 2Y0MA 5ICEA 2VI6A 1MD0A 4KIBA 1VQKI 3C1DA 4IVNA 3ZMVA 1FWZA 4BJ5C 4UB6C 1GVJA 2FF4A 2CV2A 2Q1ZB 1XTAA 1T6SA 4BQQA 3T1BA 2H27A 5DD8A 2LKPA 2VKHA 1TC3C 2MC4A 1GVDA 1VQ6I 1KA8A 2FQ4A 2IA2A 2K27A 3KP7A 3IKTA 3E97A 2F4IA 5K5RA 1A6IA 1CF7B 1SAXA 3LNQA 1OKRA 2EWNA 2QQ9A 3DKXA 4G6TB 3JRDA 1QZYA 4LGWA 3QP6A 3GXOA 1V5FA 3OOUA 2JVHA 5J1RA 5M5YJ 3J81Z 4CCOA 1ZRCA 5K7HA 2M7BA 4KISA 2GXAA 1USSA 1KQ8A 4QTRA 4L18B 3HIFA 1Z6RA 3CDIA 5BPIA 1XSDA 3Q9SA 1FYLA 5JI6A 4D9JA 1J9IA 1ZLJA 4EATA 5JHFA 3E6CC 3GZ5A 3LSPA 5D6FA 4QSHA 1MW7A 2HQNA 3E0JB 3PUBA 4B4CA 3GX4X 5ILUA 2COMA 2VQGA 3HRTA 1IRGA 1GXQA 3CF5F 4BY1J 3DEWA 4DIQA 1XPXA 2XAQA 3S93A 1ZKGA 4PDKA 2IT0A 3QPTA 4CH7A 3DKWA 3FKJA 4OIRF 4LG0B 2X4HA 1OCZH 2F5DA 3WE2A 2DA7A 3UKGA 3KP4A 1OLTA 1IO2A 1MDMB 3BTJA 1OYWA 2ZXIA 2VJJA 1IRZA 4OINF 2GIVA 2NOGA 5F04A 2FA5A 3WU0A 2QBYA 1ZGWA 5IOYA 2HTSA 4KN4X 4P9FA 5DUIA 3MMYB 3GF2A 2GXGA 4HSRA 3G4SI 1VQLI 4M6XA 1P2FA 4KN7X 1B59A 2Z1DA 2UUZA 3HC7A 5C3EJ 2H1KA 1R1VA 5L3FA 5BOXA 2B9SA 1EF4A 3JRFA 1VQPI 2FJ1A 4RGXA 3FXOA 4U7BA 3HPGA 2L7ZA 4Y15A 1HF0A 2F5CA 1RKTA 2VQCA 3E1SA 3O8HA 2I10A 2E60A 1FNNA 3BWGA 1MKMA 2DPDA 4XONA 3OR2C 1ERDA 1G4DA 1LEBA 1FY7A 4M73A 2Y30A 1AKHB 3E6MA 4M3BA 5CVIA 1BIBA 3P9CA 1H89C 1LPQA 5CLSA 4EJTA 2AXLA 2R93J 3GFMA 2EB7A 3CD6I 4QIWN 4EGZA 3K7AJ 5B66C 2OU2A 3KYLA 1I39A 4CSWA 1A5JA 4P55A 4DQ2A 2WBMA 2DA1A 3HBLA 4IO9F 4F55A 3H5AA 4CCLA 2WADA 2DLLA 3IP4B 4GYIA 5LHIA 3P9IA 4GDFA 5HS9A 2O03A 3MKLA 1ETXA 4IRGA 5FD5A 4U87A 5B1AH 2Y0SA 1W7PD 2CU7A 4EEFG 2IVMA 4W97A 4UNOA 1XN7A 3F23A 3TMOA 4GRIA 3JAMK 3DTIA 4XNFA 1YJ9I 3OYMA 2R7QA 3H3ZA 4L9JA 5FKMA 2ME6A 2TRTA 5D4SA 3HOXJ 2FOWA 1D0XA 3HPHA 5FKLA 1PUFB 5EGOA 3SDGA 4XLEA 5JFRA 5H2FC 3NRVA 2D45A 1F43A 1MMGA 5GTHC 2V7FA 2V4JC 3OOPA 3ABTA 2HKXA 3WE3A 3QRFF 3ABMH 1X4PA 4HYEA 3TO9A 3WHCA 2Z5UA 1WQ2A 1R1UA 1R6RA 1QVTA 4CCNA 4G7ZF 3S17J 3LFKA 4P96A 3JSPA 1JXSA 2GIZA 4KICA 3OV8A 2H6CA 4E7ZA 1WH7A 1BI0A 2KKOA 5FKKA 4B8XA 1S3JA 3FF5A 4EM2A 1J5YA 1MBHA 2CH0A 5LBQA 3IHUA 1BL0A 2QENA 3OR1C 1IN8A 4NUBA 4LMYA 4OAYA 2W24A 2DXIA 2L7FP 2XF6A 4DZPA 2VKEA 3BR3A 1ZAOA 1Z21A 2ACJA 2E1MC 1BI1A 2M4KA 2OZ6A 5F1RA 4BYYA 1FTTA 1ZELA 2E1OA 2GBYA 2HYGD 2KISA 4I99C 4Y13A 2IPQX 1FMVA 1Z77A 1QZEA 3HKZN 3VYTB 3M1CA 4PJJA 2YUSA 2K9LA 4EM0B 1KU3A 2M87A 5BMZA 4JQFA 2JRMA 4I0BA 1SFOJ 2BXYA 3A01A 3GTMJ 4OIPF 2E2HJ 1WJDA 2X1EA 4FISA 1IDYA 1JT0A 1ZLKA 1TWHJ 2E7XA 3RI4A 2L9VA 2LD5A 1D1AA 2M2EA 3GMEA 3V7RA 2E1NA 3T5XA 5LGNA 1AHDP 3QYFA 2V1UA 3DU5A 4LD5A 3DU6A 3CO6C 1Y39A 1MSFC 3VYRB 1ZR2A 3J7AY 1MGTA 3Q0WA 3ZR8X 4HF1A 4L9TA 4F3QA 3E5XA 3MFKA 2WB1N 4PSXA 4XOPA 4IF4A 1U8RA 5HNHA 3PNTA 1Y8RB 1U2WA 4XL9A 3DCFA 5KVRA 4AIHA 4F92B 4BAYA 1OCTC 4X0GA 1W0TA 4MQVA 3C2GA 2XASA 2XSJC 2XPVA 3CUQB 5JLXA 5EEHA 1TT0A 3J7ZI 1OCOH 4NC6A 5LLQA 4UV9A 5GPCA 1KYZA 2ID3A 2LRDA 5J40A 1LQ1A 3KP2A 4AVZA 4BQOA 5GAHJ 3KEQA 4P1WA 4XLFA 5HLIA 3NWTA 1LDJA 2P4WA 2STTA 3A2KA 1NK3P 1HQCA 1BN5A 2MC3A 1IV6A 5AIPA 3K70D 2P7CB 4LFUA 4XLHA 3BY6A 3I4PA 4XRSA 2M5WA 3HGYA 3LOCA 3VFZA 4OWRB 3RPUA 2I5UA 3F8FA 4A3BJ 2L2OA 1WVRA 2EQRA 4N9IA 1EH8A 1F1ZA 3IRRA 3D1NI 3M9AA 2ZXHA 2M8EA 1WSUA 4RB3C 4FCYA 2HZDA 2QQ8A 3E7LA 1YI2I 4FTHA 2QVOA 3KZYA 2R7OA 1O3RA 1R7JA 1J59A 3OYHA 4RGSA 3S1NJ 3JW4A 3BPXA 3ZQGA 4BDYA 3COAC 3FXMA 2G7UA 2V26A 2Z9OA 4IL6C 1D5YA 1N25A 2FMYA 1NG7A 2P81A 3MAJA 3MKWB 3C3WA 2MLGA 2LBFA 1UJ8A 2E36A 4U7DA 4ZC3A 2LY1A 3F22A 3SEZA 2XB5A 2EIMH 4BQAA 3BQYA 1ZTRA 4ZYAA 4E7LA 2QM3A 3A4CA 1K4SA 2NVYJ 3JSOA 3HUGA 2R7FA 2CGPA 3B02A 2KP6A 4KIGA 5LEJA 4WK8F 3ZQ7A 3ASOH 3I58A 3CLQA 4J01A 1H8AC 3HOVJ 2EINH 3I54A 5FGMA 2R7RA 3N97A 1JUPA 3I71A 3JR9A 5HOOA 3OS1A 1ETQA 2W25A 2R7VA 4OU0A 2BGCA 5H6QA 1U8BA 2HS5A 5DCFA 1FZPB 3H5NA 1VFCA 3T8RA 3FM5A 4AC0A 1XGNA 4ESBA 2DYSH 3BJ6A 2DMTA 1ON1A 1WCMJ 3ZMZA 1K79A 1FSHA 3QP5A 1VQOI 3OYIA 1PP7U 5LRSA 2PG4A 2F6CA 2M0MA 1WJCA 4ZYEA 2HOEA 3K69A 2K86A 4IKFA 5GPAA 4PFOA 1FYMA 3FBIB 1ONVA 2DMNA 1W1WE 2FBIA 1R5ID 3CCJI 2FX0A 4M9XA 3FZVA 3JRHA 2Y75A 3TO6A 1PYVA 2OTLI 1BR2A 1TZLA 3S3NA 5KNLA 2F5FA 2DPUA 2L4MA 4XKCA 4ZDOA 3L09A 4M3GA 3WTZA 3GFLA 2XAHA 1T38A 4DJAA 1IW7F 1K83J 3I5UA 2MD5A 3LSKA 2AQFA 3QQAA 3V42A 4BH9A 1TP4A 3J7YJ 4OMZA 2X6OA 5F08A 1I3QJ 4E6KG 1IRFA 1D8KA 2OBPA 2ZB9A 1LFBA 3GLLA 3O8GA 3V7CA 2M3AA 4CXFA 3H0DA 3HHGA 4NQWB 2AHQA 1ETOA 3W2WA 1X4OA 2Y0SN 2YS9A 2HZTA 5GP9A 4BGDA 5GAGJ 1KYWA 1UMQA 1K7AA 2A6HF 3TKYA 2IAIA 3H35A 1RR7A 5EZGA 3T0YA 4I98B 5AIQA 1Z05A 5HDKA 2VODA 2J5OA 1U5TC 2IP2A 2V1XA 2LLKA 3KYDB 3TGNA 2XAUA 2L5QA 5EDNA 3OYCA 1IN4A 5CVJA 1FYKA 3ZQLA 3N4MA 2JTVA 5JR3A 1OCRH 3HG9A 4UVCA 1DU6A 2VL8A 4F91B 2QSHX 2OPTA 4MEYF 3HEFA 3WTYC 1RR8C 3CESA 1JHHA 1SMTA 3GFIA 3AG4H 1O7LA 2FRHA 1R36A 2XRLA 1HCRA 1SFXA 4U0VA 4C3HJ 1HKQA 1Z3XA 3KPHA 4L5EA 4HLYA 3PFYA 3HM5A 2ZMEC 2NOJB 1UZCA 4PK4A 1X1CA 2YU9J 2XIGA 3GWZA 3F72A 4YFNF 3R0AA 4EJOA 2XPWA 2EFOA 3MZHA 2EIKH 1JJ8C 1UFMA 5L3CA 3PM1A 3R4KA 2B7EA 1RC9A 1ZRDA 1BW5A 2DTRA 2LDUA 2MA3A 4P9UA 3I59B 1V54H 5ICCA 2LSOA 1D3YA 2FOKA 1I6HJ 4G8XA 1TQMA 4A6EA 3CUOA 3M1EA 4G7HF 2E2IJ 4FETA 4B48A 1ZGJA 2VBYA 4PZJA 3RKQA 1UCRA 4Q5SF 3RCOA 4XMYA 1SD5A 2C6YA 3EYIA 3HSEA 3R0JA 2CJJA 2W57A 3Q0UA 4IZZA 5LD2C 2LKSA 2R7SA 2ETHA 1P9QC 1Y0UA 1ETWA 1SD6A 3IH2A 4UB8C 2K9MA 2CW0F 3HZJA 1BR4A 5IYCJ 3PO2J 2L9RA 3EPZA 3GZ6A 1XGMA 1V5EA 2O9LA 3G6EI 5K7ZA 4BUPA 3FISA 1U5TA 4NBQA 1WKMA 1HKTA 3I0TA 2EV5A 1W7PA 4A3DJ 1IV8A 2VXZA 3S1RJ 2CW8A 3JREA 1IJWC 3FHNA 4S05A 1BJAA 3DPUA 3PFIA 2PEXA 4LJZF 4X1EA 5E3LA 4DYQA 2UZKA 2XROA 4A3GJ 3FKIJ 2D5VA 1Z0XA 4XSZF 3QODA 4Y7NJ 4A3LJ 2IGMA 2K40A 3LMMA 1YITI 3HRSA 3PO3J 4D1QA 4FE4A 1TW2A 5IYBJ 5J4YA 1TNSA 5DV5A 2ISZA 2HDCA 1S7AA 3LFUA 2XF5A 1YS7A 3DXJF 4AIDA 1XGSA 3WU2C 2K9QA 3KETA 3AL0C 3K2ZA 1HDPA 1ZQ3P 4LIVA 3FMSA 1ETVA 5D4RA 2CQXA 3E5UA 1H9TA 2PFBA 3K4NA 4BBSJ 2VT2A 2A5YB 2DODA 4XN0A 3OS0A 2GLOA 4Z2YA 2B63J 2QGUA 4BU2A 1JKOC 1OCPA 2CO5A 1Y1VJ 1HSTA 1VI0A 3TOAA 3DTEA 5JVGF 1SFKA 2RQQA 1G3WA 1CF7A 1S29A 2NS8A 3QOEA 1I27A 3F0CA 1W0UA 3K10A 1ULYA 2WV1A 2STWA 2WAFA 1XD7A 4UVBA 4MTDA 3DTKA 5EYRA 2DN0A 1U3EM 1RZ4A 2QQBA 3G1OA 3C18A 2DTZA 1RRJA 2GZWA 4NNJA 1UAAA 5K1YA 1YJWI 2VKDA 3RSNA 1TWGJ 5E3NA 3JCUC 5CQEA 2XGCA 1P7IA 3M8EA 5IOZA 3HRMA 4GYGA 1QO0D 4IHSA 5E1XA 2R5ZB 1X1BA 4KT5C 1Y0NA 2IA1A 3JTGA 2M1BA 3ESWB 3H1CA 1KU7A 1YW9A 3P5JA 4RAFA 4ASNA 2Y2ZA 2P6TA 3DV8A 1B4AA 1KGSA 4M3FA 2GAUA 5FO5A 2FE3A 5KCMA 1HKSA 2ZXWH 4LG0A 2L3DA 3FBNB 5IP7J 3F9KA 4DYCA 3K0LA 2CFXA 1MDMA 3K1NA 2EK5A 2G0EA 5HVQC 3SZPA 1S5LC 2KIMA 4RB2C 2QA4I 2XB0X 3ECOA 3L9FA 2HQRA 2AQEA 5LHHA 4HEA2 1R5HA 4IQ4A 4ZDPA 1JTYA 2TDXA 3FMQA 5D5UB 2E5ZA 2VBZA 1QGPA 4KNYA 3ONQA 1Z91A 1YX3A 1O7FA 3L1PA 3OSFA 4LK1F 4XLNF 2YU3A 3K6GA 4DZJA 2QKMB 2EV0A 3WTTC 4HV5A 2ELKA 4WF2A 4EV0A 3BJOA 1AKHA 1MNDA 5E3MA 3FMRA 1RPWA 3CO7C 3ZCOA 5C44J 4IRIA 3C7JA 3BPVA 3R6SA 2XGDA 2DQLA 2R5YA 1UHWA 4HF0A 4FX0A 3M8JA 3DF8A 1YOVB 1YTYA 3RZOJ 3M7GA 4HBLA 3EQLF 1FP2A 3F6OA 5FKOA 2BZTA 2L9SA 1HA8A 1XCVA 2XGXA 5DCMB 3F8MA 4A3MJ 1GV5A 1I5ZA 2FD5A 1XDSA 2X85A 2HDDA 1RESA 2F2EA 1IXCA 4BHCA 1IGNA 2LR8A 2MH9A 4KUMA 1ZH5A 4XKBA 4QPQA 1RNLA 1VTNC 1PUFA 3ISPA 1IRXA 4E70A 5IT9K 1MH4A 2EJRA 1R00A 2PJRB 3VYUB 1MJBA 2CQ7A 3BT9A 5A2QK 2M8GX 1KONA 1IZ1A 3L7WA 3OIPA 3D5RC 3PNVA 3DFGA 4DOZA 1FC3A 2NVUB 2H6BA 3RZDJ 4PFPA 2HGCA 4G9YA 3DEEA 4EJVA 1NG6A 4G6DA 1HW5A 4L5IA 2CUJA 2EPFA 5J8FA 2R7UA 1AWCA 1DQUA 3S32A 4XICA 1FJLA 4MLOA 2OQRA 4CCJA 2V1NA 1QPMA 3GW2A 5ED4A 3VDXA 2QSGX 5DM6F 1WI3A 4XBFA 1WPKA 3BZCA 5L3BA 1H9GA 3GUDA 2IS1A 3GTOJ 3CUQC 1BI2A 2XRNA 2AS5F 1Z7LA 2JA2A 2VONA 3EDPA 3RQIA 4G6QA 3G3ZA 4U88A 2VIXA 4V19K 3UNGC 2VQLA 5BS6A 4XQFA 2R7XA 2BBYA 4JYKA 3GVAA 2HWVA 2DQRA 1D1CA 1XCBA 5E1ZB 2DU9A 5DTDA 3H3UA 3DEUA 1IN5A 2EZIA 3IL2A 2E34A 1ZGAA 1LNWA 3LAPA 2GOMA 5EZHA 2NS0A 2ESHA 3EUHA 4M9ZA 3ROUA 1W5CC 1H88C 2P5LC 2P7VB 2V79A 4F7ZA 5JHUA 2LTPA 1S7EA 2LFBA 3HSFA 3GCMA 3CCSI 2E5NA 2HQ5A 4PGGA 2E35A 3TL4X 4KJZA 4GGGA 1B6AA 2EH3A 4BJTA 4UUSA 1R49A 2BVLA 3GEZA 2F48A 1V55H 1FBQA 1ZR4A 5IP9J 2NNNA 4LB5A 4NB5A 4NHJA 1PJRA 1Z7UA 2D1HA 2Y69H 3BG5A 3BR2A 4N9HA 4UV8A 2AXTC 3S15J 4PJNA 3A03A 2K3PA 1X58A 2NVXJ 1N77A 1OQYA 4S0HB 4OIOF 3F3XA 3ZOBA 2ME0A 2D2WA 4C2UA 4Y52J 1WJFA 3FWEA 1A04A 5E18F 2A6TA 4ENMA 4CDGA 2E2JJ 3LSTA 3W6JB 1D0ZA 4HA8A 4B09A 1D5VA 3KEYA 4V2FA 4AYBN 1MMAA 2R0QC 2CQQA 1S6LA 1A35A 3CUQA 3CC2I 3CCEI 2VC0A 1B9MA 5F64A 1Y1WJ 2LC2A 3ZQQA 3OYBA 3IAS2 4BEHB 3ZQHA 3W2AA 3BP8A 2YPRA 1R58A 3B6CA 4KFCA 2ECCA 4ESFA 3L2UA 2O8XA 5ICFA 1XC5A 1YS6A 2KIFA 3HSRA 2KRHA 3BJAA 3EETA 4BXXJ 2IS4A 3KP3A 1JGSA 3ZQCA 3FK7A 3IC7A 1FIAA 1JKPC 5BNGA 3G1LA 4M71A 4GXOA 2WWYA 5FFZA 2VE9A 5BPDA 5LFAA 1TWAJ 2EBIA 2IRFG 1NTCA 3ZN1A 1X1PA 4YG2F 4D7NA 1Z3YA 2KQRA 2DK5A 1K6YA 5IT9Z 2H94A 1YRNB 3OMYA 3BG6A 4B44A 5EGOB 3J7AO 2UWMA 2XAFA 5A2QZ 5GAEJ 3D5SC 3K4JA 4YIRX 2OTJI 2KL4A 4HX4A 4I01A 3CJRB 2PN6A 5IT3A 3QAHA 1O3SA 3TO7A 4D5FA 2ZJRF 4HRIA 1AOYA 5DM7F 3FXQA 1Y6IA 2LMDA 3AG1H 1YJNI 1ZK8A 1QBJA 2DFHA 4GO1A 1VQ9I 4BE1A 5GADJ 1DDNA 1REPC 3GTPJ 5IYDJ 3U1KA 2X6XA 2MBFA 4UY8I 2D1VA 2EA2A 2ZXJA 3G1MA 3CCRI 4BHBA 5E20A 3FM3A 2NXNB 1TQIA 3GBGA 4RLFA 2OAZA 3C2HA 3N05A 2IEKA 5ILVA 2X0LA 3BR1A 2VPRA 1R9TJ 2O7OA 4I76A 3KE2A 1OMIA 1T98A 4XIDA 3LA2A 1GHCA 4HAMA 2O5RA 4CUGA 4H4KC 4BXFA 4HDVA 1O3QA 2FNPA 3U21A 1Q1HA 1WZ2A 2QLZA 1W36D 3NEUA 5BQTA 3CP8A 4ENNA 1G3YA 1MMNA 5KAIC 2K4BA 2HXIA 4F93B 4I0AA 5CVRA 1RUOA 1LJ9A 4LB6B 3DLAA 4IEJA 3V4GA 5D5VB 5LGUA 2JMWA 3Q5FA 2GM4A 3S1QJ 5IY5H 3ECHA 3SZTA 1QHHD 3TQNA 4ANJA 1JGGA 3S16J 3KLNA 2WAEA 4AIJA 2V9KA 3KEOA 2ZNYA 4EM1A 4A3JJ 2W4SA 3W6VA 5HLGA 2IA0A 1OISA 3H92A 2DT6A 1XDUA 2X1CA 1OYIA 2GOXB 5H20A 3QYEA 1BJZA 2MABA 4HLXA 4ABZA 2BY2A 5DUKA 2BXZA 4BNCA 3K4MA 3SEQA 4C9YA 5JLWA 4DYRA 2VUMJ 3O2PE 1PDNC 1QU3A 3KZZA 1S9HA 4A6DA 3LL7A 4UUTA 3CCVI 1O3TA 2MW8A 5CVUA 2A05A 2XVCA 4NDLA 3IUOA 1OCCH 3E6DA 2VE8A 3NWSA 5F0HA 2L7MP 3BTCA 2PMZN 1S7OA 4XR6A 4CZCA 3MEXA 4XRMA 3GTLJ 3HRUA 2IGNA 4ZYGA 4HNUA 2EILH 2KT0A 4NQWA 1YIOA 1LE8B 4E7IA 2XKOA 3O3KA 4FQGA 3ZP5A 2CSOA 2Z33A 2HNHA 1PP8F 1XMKA 1QPIA 3UR3C 2K9NA 2LF8A 4BKXA 1TW3A 3ULQB 2ZJ2A 1EJ9A 2M4GA 3Q3SA 1Y8QB 3L2VA 2X51A 1YIJI 3S2WA 2LY9A 4Y4RA 5J1YA 2EZHA 5FROA 1LUJB 4C30A 2W85A 1NH3A 3OIOA 4A5MA 4XN3A 2CQKA 3FIWA 4AWXB 1XSXA 2FXAA 2JT1A 3BDDA 2IGKA 2PMUA 1QVUA 3GTQJ 2XAGA 1JKQC 3F8NA 1T56A 4A2UA 1I1GA 3OS2A 1FOKA 5J4VA 2W7NA 4LLGF 3OYLA 2A69F 2P8TA 2RAEA 3DKYA 2Q0OA 1T95A 1XB4A 3ERMA 1VQ5I 2E19A 4E7SA 2CFOA 3H5RA 5B1BH 4II3A 2BW3B 1X1DA 4M6YA 4ZZLA 1QNTA 3KLOA 2GWRA 3RKYA 4O5VA 4YIIA 4C3JJ 4Y17A 2VLAA 4IHVA 3WTUC 3I59A 2FMLA 4L9VA 3ELKA 2JZYA 2FQ3A 4I7HA 3S8PA 3CMAI 2CS3A 2H09A 1YW8A 3DLLF 3CZ6A 3O6BB 1BOAA 2GA2A 4MQ9F 4XRFA 3DPLC 1FT9A 3GO5A 4PGHA 4BQNA 1OFCX 1HLVA 4A3IJ 3S3OA 3TDZC 5FKNA 4E7HA 1ZHFA 3LA7A 4LLNA 2JRTA 4ZZDA 5IPAA 3KFWX 2H8RA 2UV1A 3A1YA 3DWLE 1FEXA 1XG1A 4A3KJ 3I4NJ 1S72I 1KU2A 3ABKH 1FBSA 1B9NA 5DD4A 2MD0A 2DA3A 3FHZA 1ZN2A 4XORA 2LF7A 3CJQB 5LEKA 5HS8A 1CQTA 5H6RA 4ZJZA 1AA7A 5FD6A 3TW6A 3RTRA 1V3FA 4AVPA 2Q2EB 2MYSA 1ZRFA 5D5XB 1FLIA 4EVIA 3U2RA 2CQNA 1VQNI 4L5JA 1A31A 3CCMI 1WJEA 4LITA 4GFBA 3TBIA 4A0YA 1MZBA 3FX3A 3PQKA 3TW7A 1ZREA 4L0ZB 4CCMA 3PUFA 4WXDA 1L3LA 4YIFA 2A61A 1T39A 4JX5A 3LWFA 4PCQA 3SFZA 3V8LA 1SVOA 5TRDA 2PLYA 3HTSB 4OIQF 5FLVA 4B3XA 3IRQA 1BR1A 1JJ6C 4EGYA 1JTXA 1Z6TA 2HKOA 1G2HA 3RJPA 1KZHA 3CCLI 1YW7A 2QSFX 3CDHA 3H9GA 3PJRA 3JRAA 4A12A 2IBDA 3OYKA 4OMYA 1OR7C 1UHSA 3K4LA 4HX7A 3VB2A 3WHBA 1R22A 3CC4I 5HNFA 3EUAA 2F4OB 1P4AA 1WGXA 4YRVA 4AU7A 1B8IA 2WTEA 1QRYA 2F5EA 2M45A 2XPUA 1FSEA 2HI3A 2A5WA 2L0KA 2RQPA 1VQ8I 3ZMDA 2V6EA 4FASD 4BE2A 3I55I 4KMUX 4MHGA 1LB2A 2BVMA 1RKWA 2R7WA 4FX4A 1I50J 3LAJA 1X2MA 3EUKL 4AYBA 1K4TA 4LLLA 2BHYA 1RUNA 2VPLA 2ID6A 3CMEI 2KHMA 2ZC2A 1A6QA 2OF7A 3D0SA 3P7NA 3M3YJ 2JUGA 2K3FA 1HOMA 4KMFA 4HV6A 1BBYA 1P92A 3V7SA 4PJLA 3CP2A 4H0EA 4AD9A 4HF2A 2L01A
chains in the Genus database with same CATH topology
3RPUD 2L7KA 3QYFA 3VYSB 3SYTA 3DU5A 4XKBA 3DU6A 4QPQA 4XKWA 3VYRB 3ZGKA 4CCKA 2DCEA 2OUMA 3J7AY 3ZR8X 1X19A 1IRXA 2LBFB 4F3QA 1LVKA 4PSXA 4XOPA 2PJRB 1E0EA 3VYUB 5HNHA 3G2BA 3PNTA 4XLAA 4CA0A 4XL9A 3BCBA 4F92B 1KONA 1YE9A 3OIPA 5TGTA 2R4GA 3D5RC 3HXLA 3LSIA 3PNVA 4DOZA 4X0GA 3HUGB 3C2GA 4PFPA 3DEEA 1NG6A 3DPTA 2CUJA 4XKVA 2XSJC 2R7UA 1TT0A 2ZSIB 1DQUA 3S32A 4MLOA 4CCJA 2V1NA 1X1AA 3VDXA 2LRDA 3K70C 4OAZA 4P5OA 4AVZA 2IS1A 1N78A 1D1BA 4KITB 4BQOA 4P1WA 4XLFA 2W00A 3NWTA 1VZ0A 1Z7LA 2JA2A 3A2KA 2VIXA 3K70D 3UNGC 2VQLA 4XLHA 4XQFA 2R7XA 2OC6A 4XLCA 4XM3A 2XF7A 5KHDA 1D1CA 4OWRB 3OYJA 3S3MA 1LDKB 2L2OA 3ZRGA 1WJ5A 3L2WA 3LSMA 2GOMA 3PSFA 3VWBA 2ZXHA 1GLNA 1DGWY 2CV0A 2HZDA 4BL0B 2CUZA 4DBQA 2R7OA 3IAM2 3OL3A 3OYHA 4ZDLA 4BS9A 2VB6A 2E5NA 1EA3A 2LREA 3TL4X 4KJZA 4BDYA 4BJTA 2BVLA 4BE0A 2V26A 3AKZA 2X6YA 2LH9A 3PL8A 1PJRA 1NG7A 1FMWA 4PJNA 4XOTA 3MKWB 4Y3OA 2K3PA 2LBFA 2XDVA 1N77A 4ZC3A 2LY1A 2PJRA 3SEZA 1Y56A 1T0FC 2W1OA 2VASA 4C2UA 1WJFA 1DP3A 3MKYB 2CV1A 4ZYAA 4E7LA 2A6TA 3BC8A 3A4CA 2W82A 4C2TA 1D0ZA 2KP6A 3KEYA 2M7AA 1MMAA 4J01A 4R79A 5HLTA 4IQJA 2LC2A 3ZQQA 3OYBA 2R7RA 3IAS2 4BEHB 3W2AA 4B47A 2HVRA 2WA0A 5HOOA 3OS1A 2IXSA 3L2UA 2HVSA 2R7VA 1WJAA 2IS4A 2KRHA 3OIQA 3H5NA 2PMZA 4HSTA 4QPOA 4RM3A 3DQVC 3LSGA 2VJIA 4YELA 3OYIA 2F6CA 1V5GA 2OV7A 1LFPA 2IGOA 3EUHC 4PUSA 5LFAA 2M0MA 3PNYA 1WJCA 2HPMA 3OL4A 2JVGA 4IKFA 1Z3YA 2KQRA 4PFOA 1K6YA 2VJ4A 4E7JA 3FBIB 3MKZA 3OYEA 3OMYA 3BG6A 4B44A 3OYFA 2MFZA 4RMNA 2UWMA 3D5SC 3QYBA 4Y33A 3K4JA 3AL0B 2KL4A 3CJRB 1PYVA 1BR2A 1TZLA 2FUG2 3HKZA 5KNLA 3S3NA 4HRIA 4B43A 2LG4A 1Y6IA 3VSLA 4XKCA 4ZDOA 4N4OB 5CKTA 4BE1A 4DJAA 2IS6A 3ZXSA 2X6XA 2Z16A 3BG7A 3BLYA 1QHGA 2AQFA 3LSKA 3V42A 4E4HA 4ITVA 4E6KG 1D0YA 2KDOA 2HQAA 1MMDA 2M3AA 3GBGA 4RLFA 3H0DA 2QKLB 3C2HA 4NQWB 3N05A 2RNGA 1W36C 3W2WA 1X4OA 4DBRA 2WY7Q 2HVQA 2DJIA 2WB1A 2WAQA 4DGWB 4BGDA 2BOLA 2IS2A 2ELJA 3H35A 2O5RA 4CUGA 4H4KC 4BXFA 3U21A 3OYAA 1W36D 4BEHA 2HPIA 3CP8A 1MMNA 2F5VA 4BDZA 2XAUA 2L5QA 3OYCA 2VXDA 4F93B 4ZTFA 2LYCA 2X1DA 3DLAA 3H9JA 3SDBA 3HG9A 2VL8A 4F91B 1QHHD 4ANJA 2ZSHB 2WAEA 2V9KA 2KLOA 1N75A 3CESA 2VJ5A 3OY9A 4J00A 4BACA 3BCAA 3HOSA 4PJMA 2W4SA 2VQHA 2DT6A 1J09A 4ZTJA 1Z3XA 2X1CA 3PFYA 2GOXB 2NOJB 4PK4A 3QYEA 1X1CA 2MABA 4BJ5C 2R7TA 2DT7B 2CV2A 2Q1ZB 3K4MA 2X6WA 4BQQA 4LG3A 3SEQA 4PSWA 4C9YA 2VKHA 4RM2A 2MC4A 1QU3A 1S9HA 1G59A 3LL7A 3K4CA 2F4IA 3IUOA 4NC7A 3NWSA 4G6TB 3DKXA 4FETA 4B48A 1V5FA 4XR6A 4XMYA 3OOUA 2JVHA 1UG0A 3RCOA 4CCOA 3SZGA 4CZCA 2M7BA 4IZZA 4HPQA 4KISA 2IGNA 5LD2C 2R7SA 4HNUA 1P9QC 2HDWA 1WJBA 2K9MA 4E7IA 1BR4A 3EPZA 1V5EA 4D9JA 2HNHA 4BUPA 4EATA 5JHFA 3UR3C 4E7KA 1MW7A 3E0JB 3PUBA 2VXZA 2M4GA 3MD2A 2CW8A 2VQGA 3FHNA 3DPUA 4DIQA 3L2VA 2X51A 3S93A 2L9NA 4Y4RA 5FROA 3QODA 4CH7A 4C30A 2IGMA 3LMMA 4II2A 4XN3A 3FKJA 2Z2SB 4D1QA 3I3LA 2IGKA 3LFUA 2XF5A 2JSPA 1OLTA 2ZXIA 2VJJA 3OS2A 3AL0C 2W7NA 1DGRM 2LY2A 4LIVA 3OYLA 3MMYB 3DKYA 4HSRA 2CW7A 1T95A 2Z1DA 3OWTA 5FRNA 2UUZA 3AFHA 3HC7A 4KT6A 5FRMA 3LSHA 3K4NA 4E7SA 4IX7A 4U7BA 3HPGA 2CFOA 4XN0A 3OS0A 3H5RA 4II3A 2BW3B 1X1DA 2VQCA 3E1SA 4BU2A 3W2VA 2E60A 2KMUA 3L2QA 2KZVA 2VLAA 4XONA 3OR2C 1ERDA 3DTEA 4YEJA 2HU9A 1SFKA 2RQQA 3H9QA 3K4BA 3S8PA 2CS3A 1LKXA 3QOEA 3CZ6A 3K10A 2WAFA 3DPLC 3I9V2 3DTKA 4BQNA 3S3OA 4E7HA 3KYLA 4NNJA 1UAAA 2UV1A 3A1YA 4CSWA 3DWLE 2VKDA 2WY8Q 5CPRB 2WBMA 3RSNA 5CQEA 4F55A 4JOMA 3H5AA 3W3CA 2MD0A 2WADA 4CCLA 3D5LA 4XORA 2RREA 3CJQB 3IP4B 4LIUA 1X1BA 3PSIA 4U87A 4ZJZA 1AA7A 2Y0SA 3RTRA 3TMOA 4GRIA 2Q2EB 2MYSA 3DTIA 4XNFA 3OYMA 2R7QA 2ZFUA 1D0XA 3HPHA 4N4NB 4XLEA 1WJEA 4LITA 1MMGA 5KCMA 2V7FA 3RQ4A 3TBIA 2V4JC 3OYNA 3FBNB 3L2RA 3F9KA 4CCMA 1X4PA 5HVQC 1R6RA 2DOAA 4CCNA 1BOBA 4B3XA 1BR1A 3HL2A 4F52A 2AQEA 4HEA2 4E7ZA 2XC7A 4IQ4A 3FDYA 4ZDPA 1SAUA 2KRCA 2E1MB 1JI8A 2E5ZA 5CQGA 3H9GA 1WFXA 2P0WA 3PJRA 3HOTA 2CH0A 2BW3A 3OYKA 3ONQA 2I8DA 1YX3A 3OR1C 1OR7C 2CMPA 3K4LA 2KPMA 4NUBA 4OAYA 2DXIA 2XF6A 5HNFA 3EUAA 4YRVA 4AU7A 1G8XA 3K6GA 1Z21A 2E1MC 2QKMB 2LOOA 3CMMA 2M4KA 4HNTA 1MNDA 1ZELA 1UELB 4NC8A 2A5WA 3ZCOA 2V6EA 1YX5A 4FASD 4BE2A 2BVMA 2R7WA 4RLQA 1FMVA 3VSKA 3OYGA 3VYTB 3M1CA 4PJJA 3EUKL 4AYBA 3M8JA 2K9LA 1U0JA 2VPLA 4JQFA 3OYDA 2KHMA 2JUGA 2L9SA 1HA8A 3CF2A 4HG2A 1WJDA 2X1EA 3K4KA 3KX2A 2K5CA 1MNEA 4PJLA 3CP2A 2X85A 1D1AA 4BJ6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Y A;  2W1O A;  2LBF B;  4BEH B;  2LBF A;  4BEH A; 
#chains in the Genus database with same CATH topology
 4UHT A;  3RPU D;  4HDU A;  2L7K A;  3SYT A;  3VPR A;  2MG4 A;  2KJB A;  3REO A;  3CCQ I;  3ZGK A;  1FBU A;  2V6C A;  2DCE A;  3LSJ A;  4CYC B;  1TLH B;  3GZN B;  1G3T A;  1X19 A;  4M9S A;  1C0W A;  3F8B A;  5FLM J;  3JRB A;  3FK6 A;  4JX4 A;  2A6E F;  1YO5 C;  1TWC J;  1B72 B;  1ZG3 A;  3BZ6 A;  3G2B A;  3DP7 A;  4XLA A;  1VQ4 I;  4BY7 J;  4WWC A;  1YE9 A;  4PJ0 C;  3G73 A;  2R4G A;  1LEA A;  2L4A A;  2G7H A;  3S2D J;  3KIO A;  1T33 A;  2VKV A;  3HJE A;  4BBR J;  2ZSI B;  3IV5 A;  1FIP A;  2H8W A;  3CJN A;  1NK2 P;  1OR7 A;  2R3S A;  2EV6 A;  5HS7 A;  2QCO A;  4A0X A;  2XV4 S;  1M1E B;  3K70 C;  4U0Y A;  4P5O A;  3JRG A;  3WGG A;  3GTK J;  4M6V A;  4UXN A;  3L2C A;  4KIT B;  4MFE A;  2ZFW A;  5E3O A;  1Z67 A;  1IC8 A;  2CRG A;  5E79 C;  2QF7 A;  1VZ0 A;  3ABL H;  2OA4 A;  3J80 K;  3CCY A;  3HOY J;  1OJL A;  4TV7 A;  5D6E A;  2IW5 A;  4XLC A;  2XF7 A;  5KHD A;  1IF1 A;  4LK0 F;  2VOP A;  5D8L B;  2E1C A;  3P9K A;  3K1M A;  1LDK B;  1SVM A;  4X6A J;  3ZRG A;  1H0M A;  1ODD A;  2ZKZ A;  3PSF A;  5J8C A;  4HW0 A;  1UST A;  4IXA A;  1GV2 A;  2DFF A;  3BG9 A;  3BR0 A;  3MQ0 A;  3CMY A;  3RDI A;  3MZ8 A;  4DW6 A;  1DGW Y;  1GT0 C;  4I2O A;  1F4K A;  1VF9 A;  1POG A;  1XS9 A;  1IG7 A;  4BL0 B;  3HGG A;  3IH3 A;  1K78 B;  1AU7 A;  5EJC A;  2HOA A;  3IAM 2;  3OL3 A;  4BS9 A;  1ORK A;  5DCM A;  5EG0 B;  1RIO H;  2ZME B;  3WOD F;  3NQO A;  2K85 A;  5D8K B;  4A93 J;  2DAO A;  1G3S A;  4BE0 A;  1RI7 A;  3AKZ A;  1T8I A;  2X6Y A;  1EH7 A;  2LH9 A;  3GYH X;  3PL8 A;  3ZPL A;  2BV6 A;  4IHW A;  1FMW A;  2RVC A;  4R1H A;  4XOT A;  2XGE A;  3I53 A;  2XDV A;  4HNV A;  5D5W B;  1SD4 A;  3QOP A;  2PJR A;  1Y56 A;  1T0F C;  2VN2 A;  2VAS A;  5FB2 A;  1BA5 A;  4RGU A;  3MKY B;  4KDP A;  5KK1 A;  2CV1 A;  5M3F J;  3BC8 A;  2O3F A;  2YX4 A;  2W82 A;  3TDU C;  4C2T A;  4JBA A;  1PUE E;  1EKE A;  2CYY A;  2E71 A;  2P5V A;  3LSR A;  4IHY A;  3QPS A;  2BHZ A;  3U1D A;  4R79 A;  2FBK A;  3S2H J;  4IQJ A;  1KU9 A;  2VT3 A;  1R4M B;  2COB A;  5ERI A;  3IWF A;  3HHH A;  1MJ9 A;  2J5P A;  2WA0 A;  4B47 A;  1FOX A;  4EQQ A;  2IXS A;  2K4J A;  2VC1 A;  1WJA A;  3LQR A;  3OIQ A;  3H36 A;  2PMZ A;  2Y48 A;  2BY1 A;  4RM3 A;  3DQV C;  3JRC A;  1DUX C;  3B6A A;  2KRF A;  2M30 A;  5DS9 A;  1GDT A;  3C2B A;  2OV7 A;  4A0Z A;  1LFP A;  3AAF A;  2IGO A;  3EUH C;  4XRS G;  2EFW A;  4D0P A;  2HPM A;  3OL4 A;  2GXB A;  4UVA A;  1FPQ A;  1BC8 C;  3ZN0 A;  1MBK A;  4E7J A;  2VJ4 A;  4ENK A;  2K9S A;  1ETY A;  2M0C A;  5E17 F;  4Y33 A;  2G9W A;  3CQZ J;  1T08 B;  2X48 A;  2ESN A;  3AL0 B;  2P5K A;  1TT5 B;  1F36 A;  3EYY A;  4RS8 A;  2HOS A;  4B43 A;  3ZQF A;  1EH6 A;  2RN7 A;  3IWZ A;  4RDU A;  3AG3 H;  2XUB A;  1P4X A;  1DP7 P;  2FEZ A;  4N4O B;  5CKT A;  5L3G A;  3GTJ J;  4ON0 A;  2BE5 F;  2Z16 A;  3LA3 A;  1P6R A;  3BR5 A;  2FU4 A;  3FXJ A;  1A36 A;  5HLH A;  1T0F A;  2BYV E;  2ZNZ A;  1YFH A;  3WG7 H;  4ITV A;  1APL C;  3VOE A;  1D0Y A;  2HQA A;  2DA6 A;  3F8C A;  1P4W A;  5TJJ A;  4GCV A;  3L00 A;  4A69 C;  2FNA A;  1QA6 A;  1ACI A;  3J80 Z;  2EFN A;  2A07 F;  2QKL B;  2NAZ A;  1ZG5 A;  2QUF A;  2JPC A;  2QYO A;  3DBR B;  3E5Q A;  4S04 A;  3DBL B;  2EIJ H;  1HBX G;  1FOY A;  2MSY A;  4JX6 A;  1TNT A;  2WY7 Q;  3PIO F;  2HVQ A;  1V4R A;  2L54 A;  5F0F A;  5J47 A;  2RNJ A;  2WAQ A;  4CHU A;  2LKX A;  1OYY A;  3R61 A;  2TCT A;  4IJA A;  3OYA A;  4BEH A;  3WTS C;  2HPI A;  1X2N A;  2XSD C;  1UHM A;  2R5Y B;  1E3P A;  5F1J A;  2CUE A;  4M3D A;  2F5V A;  3S1M J;  4BDZ A;  1ETK A;  1YQA A;  2QQA A;  1R4N B;  4ZTF A;  1ZAR A;  3K2A A;  2DW4 A;  4W1U A;  3H9J A;  2VBX A;  1S8N A;  3H3V K;  2QEX I;  3RKX A;  2O61 A;  1SAN A;  2ZSH B;  2LK2 A;  1MIJ A;  2KLO A;  3ASN H;  2QBY B;  2VJ5 A;  3OY9 A;  1BM9 A;  2DK8 A;  3BCA A;  4PJM A;  3BTL A;  3F6V A;  3HOS A;  1E17 A;  1GUU A;  1U6G A;  3QWL A;  5L3D A;  1J09 A;  1NHA A;  2ICW G;  4ZTJ A;  3K9T A;  3JTH A;  3BR6 A;  2QWW A;  1YRN A;  2ECB A;  3AG2 H;  2R7T A;  2DT7 B;  1O4X A;  4M72 A;  4B3A A;  2LNB A;  2X6W A;  4LG3 A;  2KDZ A;  4PSW A;  3VEP A;  4RM2 A;  5F27 A;  1Q1V A;  2DFE A;  1G59 A;  3I64 A;  3K4C A;  4QWQ A;  2RKH A;  4RA2 A;  4NC7 A;  1MSE C;  5J3L A;  1WWX A;  1MBF A;  1J7K A;  2OD5 A;  1E2X A;  5IP6 A;  3WTV C;  1I3A A;  1UG0 A;  4D5C A;  3BOQ A;  5M3M J;  1FP1 D;  3SZG A;  3ZMT A;  1JE8 A;  4HPQ A;  1X3U A;  1UG2 A;  2YR2 A;  3NAU A;  4B1R A;  4MGR A;  1E3O C;  4ENJ A;  1UB9 A;  2HDW A;  1WJB A;  2K02 A;  4HQE A;  2V9V A;  3SQN A;  1XMX A;  4A3C J;  2OCE A;  1JT6 A;  2OZU A;  3U9G A;  4E7K A;  4WXH A;  3MD2 A;  3ERE D;  1ZG1 A;  2GQQ A;  1W4M A;  2ZJP F;  2L9N A;  5FFX A;  1IDZ A;  1B1B A;  2NNY A;  3A02 A;  2OCC H;  4II2 A;  2Z2S B;  1BW6 A;  3I3L A;  1MBJ A;  3FXR A;  4BHP A;  3WTX C;  5EEA A;  1VND A;  3LQQ A;  2JSP A;  3MN2 A;  4LOC A;  3W6K B;  2ZO4 A;  5E8I A;  4UUS B;  2R7D A;  2GA1 A;  3V8K A;  1Z1D A;  1DGR M;  2LY2 A;  2PX9 A;  2NRA C;  2XAJ A;  2CW7 A;  5J6X A;  2MLK A;  3OWT A;  5FRN A;  2DJN A;  2EFQ A;  3AFH A;  2JUC A;  4KT6 A;  2HEO A;  1TBX A;  3LSH A;  1OPC A;  3MCZ A;  4A5N A;  3JRI A;  5FRM A;  4IX7 A;  2E7W A;  2MH2 A;  3HDD A;  1F9N A;  2ZBK A;  6PAX A;  2DMP A;  4ZYH A;  1IUY A;  2RV8 A;  2QZ8 A;  3W2V A;  2O0Y A;  2KMU A;  3L2Q A;  2KZV A;  4XK4 A;  1R5G A;  1Z9C A;  3FXU A;  4YEJ A;  4C3I J;  3E3V A;  1YLF A;  2HU9 A;  5FLX K;  3BQZ A;  3CTA A;  3H9Q A;  4QLC U;  3K4B A;  2O8K A;  1LKX A;  5ILS A;  2JQ7 A;  1R71 A;  2EA4 A;  3ABU A;  5K5Q A;  3SJM A;  3I9V 2;  5KAF C;  4EJW A;  2NVT J;  5E1W A;  5L3E A;  3Q0V A;  2HYJ A;  1L0O C;  1JHF A;  4JP0 A;  2WY8 Q;  5CPR B;  3HYI A;  1LE8 A;  4YFX F;  3A01 B;  4JOM A;  3W3C A;  3TOB A;  1HC8 A;  3JAM Z;  3D5L A;  2RRE A;  4LIU A;  1KQ9 A;  2DI3 A;  2V9P A;  3PSI A;  4WXC A;  2BY3 A;  3CDL A;  4M74 A;  4RB1 A;  3I56 I;  4A3F J;  2ZFU A;  4N4N B;  2Z3Y A;  3B73 A;  1IN6 A;  3SHF A;  3RYR A;  1TWF J;  2KZG A;  3BTI A;  1MH3 A;  1IXR C;  3RQ4 A;  3OYN A;  2BY0 A;  3L2R A;  4RAG A;  1W5T A;  2A3S A;  3FXL A;  3NAR A;  2DMQ A;  1SD7 A;  1MJA A;  5LRR A;  2DOA A;  1FOW A;  2Y9Z A;  1BOB A;  1P7J A;  3HL2 A;  4D7M A;  2KJC A;  4F52 A;  2NYX A;  4RAY A;  2XC7 A;  3FDY A;  1ENH A;  1ITY A;  1XGO A;  1SAU A;  2ZCW A;  2KRC A;  2E1M B;  1JI8 A;  4MIM A;  5CQG A;  1WFX A;  2P0W A;  3WGH A;  3ZQI A;  3HOT A;  1SFU A;  1IUF A;  2BW3 A;  3GFJ A;  2BEO A;  1HW1 A;  2I8D A;  3TP0 A;  2CMP A;  1R1T A;  2KPM A;  1D8J A;  2R7Z J;  3M07 A;  1IAW A;  1G8X A;  4IOA F;  5AON A;  3A0B C;  2OQG A;  2LOO A;  3CMM A;  3IH4 A;  4L9N A;  4HNT A;  1GXP A;  1TL8 A;  1UEL B;  4I09 A;  2XHK A;  4IRH A;  4NC8 A;  3HOU J;  4M3E A;  1YX5 A;  2NVQ J;  2X9D A;  4RLQ A;  3VSK A;  4MNU A;  3OYG A;  4MEX F;  2PBI A;  1SFE A;  1IXS B;  1U0J A;  3SXY A;  3KYC B;  1FTZ A;  5LHG A;  3OYD A;  4AM3 A;  1HXD A;  1WRJ A;  2JA5 J;  3Q9V A;  3PQJ A;  1TTY A;  3CF2 A;  4HG2 A;  4O3M A;  3DBH B;  2Y31 A;  3K4K A;  3KX2 A;  4I02 A;  2K5C A;  2Y9Y A;  1MNE A;  3KP5 A;  5K7F A;  1T2K A;  1DPU A;  5DDG A;  4BJ6 C;  4CIC A;  2M9H A;  3VYS B;  5DYM A;  2Q2E A;  2JWT A;  4XKW A;  1YHQ I;  1RET A;  4CCK A;  2OUM A;  4ETS A;  3RYP A;  4I6Z A;  4ESJ A;  2LBF B;  1MBE A;  1MNM C;  1LVK A;  1SMY F;  2WAQ N;  1E0E A;  4KA4 A;  1TQP A;  2HFH A;  1E3H A;  2OJE D;  4CA0 A;  5FLX Z;  1SEU A;  3BCB A;  2DOE A;  5HDN A;  4FT8 A;  5TGT A;  3LSI A;  3HXL A;  3CC7 I;  4EMS A;  2ELH A;  3HUG B;  2CUF A;  1BC7 C;  1JUM A;  4IHX A;  1LVA A;  2DA2 A;  2RC4 A;  3DPT A;  5F0C A;  2EFP A;  4XKV A;  3I4M J;  2PJP A;  4RB0 A;  3KZI C;  4CGZ A;  1X1A A;  1HDD C;  2WV0 A;  3MZY A;  4OAZ A;  2XKP A;  1YG2 A;  1EV7 A;  2RDP A;  3RPQ A;  1N78 A;  1D1B A;  2JN6 A;  1YYV A;  3OSG A;  2W00 A;  4V2G A;  1W5S A;  1U9N A;  4J19 A;  1WHU A;  2B0L A;  2DOF A;  3FXK A;  4Q47 A;  1HSJ A;  1LDD A;  2OC6 A;  3M4O J;  4XM3 A;  3M8F A;  4A3E J;  2HXO A;  2JJ7 A;  3OYJ A;  2DO7 A;  3KP6 A;  3S3M A;  3WG9 A;  2VBW A;  2ADU A;  2KFD A;  1ZYR F;  4AUX A;  1WJ5 A;  2YX7 A;  2L02 A;  3QPH A;  3QU6 A;  3LSM A;  3RIR A;  3WU1 B;  3L2W A;  1HW2 A;  1G6N A;  3VWB A;  1J75 A;  2VOO A;  1GLN A;  2DDA A;  4EJU A;  5J1U A;  2CV0 A;  1MBG A;  2CUZ A;  4DBQ A;  3TP3 A;  3IKV A;  3GLX A;  3HB9 A;  5TIS C;  1QQI A;  1JUS A;  2DA5 A;  2H1L A;  4N0B A;  4ZDL A;  1DPR A;  2VB6 A;  3RKW A;  3G71 I;  2WC2 A;  2AO9 A;  1EA3 A;  2LRE A;  2HOT A;  2CWE A;  5JVT A;  4XSX F;  1WH5 A;  4IOC F;  2KIU A;  3ML6 A;  4G7O F;  1XMA A;  5FJ8 J;  5C4J J;  5HOD A;  2R92 J;  4JK1 X;  4CYD A;  2O6G E;  4Y3O A;  4CYC A;  4UUV A;  3K1P A;  3MWM A;  4WX9 A;  2W1O A;  4FE7 A;  1B72 A;  2A68 F;  3V8J A;  1DP3 A;  1DU0 A;  3X2Q H;  5B5E C;  3WTW C;  2KIQ A;  1PVE A;  3CLO A;  4MO7 A;  5M5X J;  5M5W J;  2M7A A;  1O57 A;  5HLT A;  5B3S H;  3VOD A;  4BXU A;  2NS7 A;  4MFD A;  4IPA A;  4KYW A;  2EZK A;  2V1D A;  5K5O A;  1KQ0 A;  2HVR A;  4CO8 A;  2HVS A;  2DT5 A;  2DFI A;  3GTG J;  1X3Z B;  5CYV A;  4FHT A;  4AIK A;  3J81 K;  4HST A;  4QPO A;  1JKR C;  1SC7 A;  4HZF A;  5DEQ A;  4Z6Y A;  3WGI A;  3LSG A;  1K61 A;  3QU3 A;  2MGQ A;  1J2X A;  2VJI A;  3A0H C;  4HQM A;  4YEL A;  4MTE A;  3BZK A;  1V5G A;  4K2E A;  4RAZ A;  1BIA A;  1LFU P;  2PI0 A;  3T8T A;  4PUS A;  3PNY A;  2PQ8 A;  2K7L A;  2R5Z A;  1U78 A;  3R60 A;  2JVG A;  1X3W B;  1IN7 A;  2LP0 A;  2ZJQ F;  3MKZ A;  1MMS A;  3OYE A;  2HR3 A;  2MFZ A;  4RMN A;  3ZMS A;  3HTU A;  3OYF A;  3QYB A;  5CJ9 A;  4L0Y B;  1K6O A;  3BRO A;  4WCG A;  2JA8 J;  3E6B A;  1K78 A;  2FUG 2;  3HKZ A;  2JPB A;  4CZZ A;  1ON2 A;  1R23 A;  2LG4 A;  5EG0 A;  3VSL A;  2ZME A;  2DA4 A;  4O6J A;  5HDG A;  2UXX A;  2IS6 A;  3ZXS A;  9ANT A;  2P6S A;  2Z99 A;  4RGR A;  3ZMU A;  3BG7 A;  3BLY A;  1QHG A;  4G12 A;  1VQM I;  3HOZ J;  4HX8 A;  3PIP F;  4E4H A;  1U9O A;  2N8G A;  1J0R A;  2IJL A;  2KDO A;  3MVP A;  3BG3 A;  1MMD A;  4U0W A;  4ZH4 F;  4YFK F;  2HTJ A;  1XSV A;  2FSW A;  1FX7 A;  1SVL A;  5GTI C;  4RBO A;  4G94 A;  4C2M J;  3KCC A;  1I1S A;  2F4M B;  2YSR A;  2EZL A;  2RNG A;  1W36 C;  1BI3 A;  5ICG A;  4DBR A;  5C4X J;  1B8I B;  2PMH A;  4Q4Z F;  2DBB A;  2DJI A;  3S14 J;  2W48 A;  1U5T B;  2WB1 A;  4DGW B;  4HOB A;  4ZYD A;  2BOL A;  1W7P B;  1WI9 A;  4DNC A;  2IS2 A;  1I6X A;  2DYR H;  2ELJ A;  3QPL A;  1CGP A;  2Q8K A;  2W84 A;  3SFI A;  5F6F A;  5LGT A;  3CCU I;  4Q48 A;  2CG4 A;  4XLP F;  2DDB A;  2HYF A;  2LVS A;  5CVV A;  2DMU A;  2JA6 J;  2VXD A;  1F5T A;  4KIF A;  2JK3 A;  2RGV A;  2LYC A;  4R8H A;  2UXN A;  3CJT B;  2X1D A;  5E8G A;  3HOW J;  1QZZ A;  3SDB A;  3F21 A;  1VQ7 I;  1STZ A;  4OOI A;  2ISY A;  2JA7 J;  2FBH A;  4IHT A;  1N75 A;  3H0G J;  4J00 A;  4BAC A;  1XX5 A;  2JSC A;  5EEG A;  3TED A;  2VQH A;  2M34 A;  5EF6 A;  2Y0M A;  5ICE A;  2VI6 A;  1MD0 A;  4KIB A;  1VQK I;  3C1D A;  4IVN A;  3ZMV A;  1FWZ A;  4BJ5 C;  4UB6 C;  1GVJ A;  2FF4 A;  2CV2 A;  2Q1Z B;  1XTA A;  1T6S A;  4BQQ A;  3T1B A;  2H27 A;  5DD8 A;  2LKP A;  2VKH A;  1TC3 C;  2MC4 A;  1GVD A;  1VQ6 I;  1KA8 A;  2FQ4 A;  2IA2 A;  2K27 A;  3KP7 A;  3IKT A;  3E97 A;  2F4I A;  5K5R A;  1A6I A;  1CF7 B;  1SAX A;  3LNQ A;  1OKR A;  2EWN A;  2QQ9 A;  3DKX A;  4G6T B;  3JRD A;  1QZY A;  4LGW A;  3QP6 A;  3GXO A;  1V5F A;  3OOU A;  2JVH A;  5J1R A;  5M5Y J;  3J81 Z;  4CCO A;  1ZRC A;  5K7H A;  2M7B A;  4KIS A;  2GXA A;  1USS A;  1KQ8 A;  4QTR A;  4L18 B;  3HIF A;  1Z6R A;  3CDI A;  5BPI A;  1XSD A;  3Q9S A;  1FYL A;  5JI6 A;  4D9J A;  1J9I A;  1ZLJ A;  4EAT A;  5JHF A;  3E6C C;  3GZ5 A;  3LSP A;  5D6F A;  4QSH A;  1MW7 A;  2HQN A;  3E0J B;  3PUB A;  4B4C A;  3GX4 X;  5ILU A;  2COM A;  2VQG A;  3HRT A;  1IRG A;  1GXQ A;  3CF5 F;  4BY1 J;  3DEW A;  4DIQ A;  1XPX A;  2XAQ A;  3S93 A;  1ZKG A;  4PDK A;  2IT0 A;  3QPT A;  4CH7 A;  3DKW A;  3FKJ A;  4OIR F;  4LG0 B;  2X4H A;  1OCZ H;  2F5D A;  3WE2 A;  2DA7 A;  3UKG A;  3KP4 A;  1OLT A;  1IO2 A;  1MDM B;  3BTJ A;  1OYW A;  2ZXI A;  2VJJ A;  1IRZ A;  4OIN F;  2GIV A;  2NOG A;  5F04 A;  2FA5 A;  3WU0 A;  2QBY A;  1ZGW A;  5IOY A;  2HTS A;  4KN4 X;  4P9F A;  5DUI A;  3MMY B;  3GF2 A;  2GXG A;  4HSR A;  3G4S I;  1VQL I;  4M6X A;  1P2F A;  4KN7 X;  1B59 A;  2Z1D A;  2UUZ A;  3HC7 A;  5C3E J;  2H1K A;  1R1V A;  5L3F A;  5BOX A;  2B9S A;  1EF4 A;  3JRF A;  1VQP I;  2FJ1 A;  4RGX A;  3FXO A;  4U7B A;  3HPG A;  2L7Z A;  4Y15 A;  1HF0 A;  2F5C A;  1RKT A;  2VQC A;  3E1S A;  3O8H A;  2I10 A;  2E60 A;  1FNN A;  3BWG A;  1MKM A;  2DPD A;  4XON A;  3OR2 C;  1ERD A;  1G4D A;  1LEB A;  1FY7 A;  4M73 A;  2Y30 A;  1AKH B;  3E6M A;  4M3B A;  5CVI A;  1BIB A;  3P9C A;  1H89 C;  1LPQ A;  5CLS A;  4EJT A;  2AXL A;  2R93 J;  3GFM A;  2EB7 A;  3CD6 I;  4QIW N;  4EGZ A;  3K7A J;  5B66 C;  2OU2 A;  3KYL A;  1I39 A;  4CSW A;  1A5J A;  4P55 A;  4DQ2 A;  2WBM A;  2DA1 A;  3HBL A;  4IO9 F;  4F55 A;  3H5A A;  4CCL A;  2WAD A;  2DLL A;  3IP4 B;  4GYI A;  5LHI A;  3P9I A;  4GDF A;  5HS9 A;  2O03 A;  3MKL A;  1ETX A;  4IRG A;  5FD5 A;  4U87 A;  5B1A H;  2Y0S A;  1W7P D;  2CU7 A;  4EEF G;  2IVM A;  4W97 A;  4UNO A;  1XN7 A;  3F23 A;  3TMO A;  4GRI A;  3JAM K;  3DTI A;  4XNF A;  1YJ9 I;  3OYM A;  2R7Q A;  3H3Z A;  4L9J A;  5FKM A;  2ME6 A;  2TRT A;  5D4S A;  3HOX J;  2FOW A;  1D0X A;  3HPH A;  5FKL A;  1PUF B;  5EGO A;  3SDG A;  4XLE A;  5JFR A;  5H2F C;  3NRV A;  2D45 A;  1F43 A;  1MMG A;  5GTH C;  2V7F A;  2V4J C;  3OOP A;  3ABT A;  2HKX A;  3WE3 A;  3QRF F;  3ABM H;  1X4P A;  4HYE A;  3TO9 A;  3WHC A;  2Z5U A;  1WQ2 A;  1R1U A;  1R6R A;  1QVT A;  4CCN A;  4G7Z F;  3S17 J;  3LFK A;  4P96 A;  3JSP A;  1JXS A;  2GIZ A;  4KIC A;  3OV8 A;  2H6C A;  4E7Z A;  1WH7 A;  1BI0 A;  2KKO A;  5FKK A;  4B8X A;  1S3J A;  3FF5 A;  4EM2 A;  1J5Y A;  1MBH A;  2CH0 A;  5LBQ A;  3IHU A;  1BL0 A;  2QEN A;  3OR1 C;  1IN8 A;  4NUB A;  4LMY A;  4OAY A;  2W24 A;  2DXI A;  2L7F P;  2XF6 A;  4DZP A;  2VKE A;  3BR3 A;  1ZAO A;  1Z21 A;  2ACJ A;  2E1M C;  1BI1 A;  2M4K A;  2OZ6 A;  5F1R A;  4BYY A;  1FTT A;  1ZEL A;  2E1O A;  2GBY A;  2HYG D;  2KIS A;  4I99 C;  4Y13 A;  2IPQ X;  1FMV A;  1Z77 A;  1QZE A;  3HKZ N;  3VYT B;  3M1C A;  4PJJ A;  2YUS A;  2K9L A;  4EM0 B;  1KU3 A;  2M87 A;  5BMZ A;  4JQF A;  2JRM A;  4I0B A;  1SFO J;  2BXY A;  3A01 A;  3GTM J;  4OIP F;  2E2H J;  1WJD A;  2X1E A;  4FIS A;  1IDY A;  1JT0 A;  1ZLK A;  1TWH J;  2E7X A;  3RI4 A;  2L9V A;  2LD5 A;  1D1A A;  2M2E A;  3GME A;  3V7R A;  2E1N A;  3T5X A;  5LGN A;  1AHD P;  3QYF A;  2V1U A;  3DU5 A;  4LD5 A;  3DU6 A;  3CO6 C;  1Y39 A;  1MSF C;  3VYR B;  1ZR2 A;  3J7A Y;  1MGT A;  3Q0W A;  3ZR8 X;  4HF1 A;  4L9T A;  4F3Q A;  3E5X A;  3MFK A;  2WB1 N;  4PSX A;  4XOP A;  4IF4 A;  1U8R A;  5HNH A;  3PNT A;  1Y8R B;  1U2W A;  4XL9 A;  3DCF A;  5KVR A;  4AIH A;  4F92 B;  4BAY A;  1OCT C;  4X0G A;  1W0T A;  4MQV A;  3C2G A;  2XAS A;  2XSJ C;  2XPV A;  3CUQ B;  5JLX A;  5EEH A;  1TT0 A;  3J7Z I;  1OCO H;  4NC6 A;  5LLQ A;  4UV9 A;  5GPC A;  1KYZ A;  2ID3 A;  2LRD A;  5J40 A;  1LQ1 A;  3KP2 A;  4AVZ A;  4BQO A;  5GAH J;  3KEQ A;  4P1W A;  4XLF A;  5HLI A;  3NWT A;  1LDJ A;  2P4W A;  2STT A;  3A2K A;  1NK3 P;  1HQC A;  1BN5 A;  2MC3 A;  1IV6 A;  5AIP A;  3K70 D;  2P7C B;  4LFU A;  4XLH A;  3BY6 A;  3I4P A;  4XRS A;  2M5W A;  3HGY A;  3LOC A;  3VFZ A;  4OWR B;  3RPU A;  2I5U A;  3F8F A;  4A3B J;  2L2O A;  1WVR A;  2EQR A;  4N9I A;  1EH8 A;  1F1Z A;  3IRR A;  3D1N I;  3M9A A;  2ZXH A;  2M8E A;  1WSU A;  4RB3 C;  4FCY A;  2HZD A;  2QQ8 A;  3E7L A;  1YI2 I;  4FTH A;  2QVO A;  3KZY A;  2R7O A;  1O3R A;  1R7J A;  1J59 A;  3OYH A;  4RGS A;  3S1N J;  3JW4 A;  3BPX A;  3ZQG A;  4BDY A;  3COA C;  3FXM A;  2G7U A;  2V26 A;  2Z9O A;  4IL6 C;  1D5Y A;  1N25 A;  2FMY A;  1NG7 A;  2P81 A;  3MAJ A;  3MKW B;  3C3W A;  2MLG A;  2LBF A;  1UJ8 A;  2E36 A;  4U7D A;  4ZC3 A;  2LY1 A;  3F22 A;  3SEZ A;  2XB5 A;  2EIM H;  4BQA A;  3BQY A;  1ZTR A;  4ZYA A;  4E7L A;  2QM3 A;  3A4C A;  1K4S A;  2NVY J;  3JSO A;  3HUG A;  2R7F A;  2CGP A;  3B02 A;  2KP6 A;  4KIG A;  5LEJ A;  4WK8 F;  3ZQ7 A;  3ASO H;  3I58 A;  3CLQ A;  4J01 A;  1H8A C;  3HOV J;  2EIN H;  3I54 A;  5FGM A;  2R7R A;  3N97 A;  1JUP A;  3I71 A;  3JR9 A;  5HOO A;  3OS1 A;  1ETQ A;  2W25 A;  2R7V A;  4OU0 A;  2BGC A;  5H6Q A;  1U8B A;  2HS5 A;  5DCF A;  1FZP B;  3H5N A;  1VFC A;  3T8R A;  3FM5 A;  4AC0 A;  1XGN A;  4ESB A;  2DYS H;  3BJ6 A;  2DMT A;  1ON1 A;  1WCM J;  3ZMZ A;  1K79 A;  1FSH A;  3QP5 A;  1VQO I;  3OYI A;  1PP7 U;  5LRS A;  2PG4 A;  2F6C A;  2M0M A;  1WJC A;  4ZYE A;  2HOE A;  3K69 A;  2K86 A;  4IKF A;  5GPA A;  4PFO A;  1FYM A;  3FBI B;  1ONV A;  2DMN A;  1W1W E;  2FBI A;  1R5I D;  3CCJ I;  2FX0 A;  4M9X A;  3FZV A;  3JRH A;  2Y75 A;  3TO6 A;  1PYV A;  2OTL I;  1BR2 A;  1TZL A;  3S3N A;  5KNL A;  2F5F A;  2DPU A;  2L4M A;  4XKC A;  4ZDO A;  3L09 A;  4M3G A;  3WTZ A;  3GFL A;  2XAH A;  1T38 A;  4DJA A;  1IW7 F;  1K83 J;  3I5U A;  2MD5 A;  3LSK A;  2AQF A;  3QQA A;  3V42 A;  4BH9 A;  1TP4 A;  3J7Y J;  4OMZ A;  2X6O A;  5F08 A;  1I3Q J;  4E6K G;  1IRF A;  1D8K A;  2OBP A;  2ZB9 A;  1LFB A;  3GLL A;  3O8G A;  3V7C A;  2M3A A;  4CXF A;  3H0D A;  3HHG A;  4NQW B;  2AHQ A;  1ETO A;  3W2W A;  1X4O A;  2Y0S N;  2YS9 A;  2HZT A;  5GP9 A;  4BGD A;  5GAG J;  1KYW A;  1UMQ A;  1K7A A;  2A6H F;  3TKY A;  2IAI A;  3H35 A;  1RR7 A;  5EZG A;  3T0Y A;  4I98 B;  5AIQ A;  1Z05 A;  5HDK A;  2VOD A;  2J5O A;  1U5T C;  2IP2 A;  2V1X A;  2LLK A;  3KYD B;  3TGN A;  2XAU A;  2L5Q A;  5EDN A;  3OYC A;  1IN4 A;  5CVJ A;  1FYK A;  3ZQL A;  3N4M A;  2JTV A;  5JR3 A;  1OCR H;  3HG9 A;  4UVC A;  1DU6 A;  2VL8 A;  4F91 B;  2QSH X;  2OPT A;  4MEY F;  3HEF A;  3WTY C;  1RR8 C;  3CES A;  1JHH A;  1SMT A;  3GFI A;  3AG4 H;  1O7L A;  2FRH A;  1R36 A;  2XRL A;  1HCR A;  1SFX A;  4U0V A;  4C3H J;  1HKQ A;  1Z3X A;  3KPH A;  4L5E A;  4HLY A;  3PFY A;  3HM5 A;  2ZME C;  2NOJ B;  1UZC A;  4PK4 A;  1X1C A;  2YU9 J;  2XIG A;  3GWZ A;  3F72 A;  4YFN F;  3R0A A;  4EJO A;  2XPW A;  2EFO A;  3MZH A;  2EIK H;  1JJ8 C;  1UFM A;  5L3C A;  3PM1 A;  3R4K A;  2B7E A;  1RC9 A;  1ZRD A;  1BW5 A;  2DTR A;  2LDU A;  2MA3 A;  4P9U A;  3I59 B;  1V54 H;  5ICC A;  2LSO A;  1D3Y A;  2FOK A;  1I6H J;  4G8X A;  1TQM A;  4A6E A;  3CUO A;  3M1E A;  4G7H F;  2E2I J;  4FET A;  4B48 A;  1ZGJ A;  2VBY A;  4PZJ A;  3RKQ A;  1UCR A;  4Q5S F;  3RCO A;  4XMY A;  1SD5 A;  2C6Y A;  3EYI A;  3HSE A;  3R0J A;  2CJJ A;  2W57 A;  3Q0U A;  4IZZ A;  5LD2 C;  2LKS A;  2R7S A;  2ETH A;  1P9Q C;  1Y0U A;  1ETW A;  1SD6 A;  3IH2 A;  4UB8 C;  2K9M A;  2CW0 F;  3HZJ A;  1BR4 A;  5IYC J;  3PO2 J;  2L9R A;  3EPZ A;  3GZ6 A;  1XGM A;  1V5E A;  2O9L A;  3G6E I;  5K7Z A;  4BUP A;  3FIS A;  1U5T A;  4NBQ A;  1WKM A;  1HKT A;  3I0T A;  2EV5 A;  1W7P A;  4A3D J;  1IV8 A;  2VXZ A;  3S1R J;  2CW8 A;  3JRE A;  1IJW C;  3FHN A;  4S05 A;  1BJA A;  3DPU A;  3PFI A;  2PEX A;  4LJZ F;  4X1E A;  5E3L A;  4DYQ A;  2UZK A;  2XRO A;  4A3G J;  3FKI J;  2D5V A;  1Z0X A;  4XSZ F;  3QOD A;  4Y7N J;  4A3L J;  2IGM A;  2K40 A;  3LMM A;  1YIT I;  3HRS A;  3PO3 J;  4D1Q A;  4FE4 A;  1TW2 A;  5IYB J;  5J4Y A;  1TNS A;  5DV5 A;  2ISZ A;  2HDC A;  1S7A A;  3LFU A;  2XF5 A;  1YS7 A;  3DXJ F;  4AID A;  1XGS A;  3WU2 C;  2K9Q A;  3KET A;  3AL0 C;  3K2Z A;  1HDP A;  1ZQ3 P;  4LIV A;  3FMS A;  1ETV A;  5D4R A;  2CQX A;  3E5U A;  1H9T A;  2PFB A;  3K4N A;  4BBS J;  2VT2 A;  2A5Y B;  2DOD A;  4XN0 A;  3OS0 A;  2GLO A;  4Z2Y A;  2B63 J;  2QGU A;  4BU2 A;  1JKO C;  1OCP A;  2CO5 A;  1Y1V J;  1HST A;  1VI0 A;  3TOA A;  3DTE A;  5JVG F;  1SFK A;  2RQQ A;  1G3W A;  1CF7 A;  1S29 A;  2NS8 A;  3QOE A;  1I27 A;  3F0C A;  1W0U A;  3K10 A;  1ULY A;  2WV1 A;  2STW A;  2WAF A;  1XD7 A;  4UVB A;  4MTD A;  3DTK A;  5EYR A;  2DN0 A;  1U3E M;  1RZ4 A;  2QQB A;  3G1O A;  3C18 A;  2DTZ A;  1RRJ A;  2GZW A;  4NNJ A;  1UAA A;  5K1Y A;  1YJW I;  2VKD A;  3RSN A;  1TWG J;  5E3N A;  3JCU C;  5CQE A;  2XGC A;  1P7I A;  3M8E A;  5IOZ A;  3HRM A;  4GYG A;  1QO0 D;  4IHS A;  5E1X A;  2R5Z B;  1X1B A;  4KT5 C;  1Y0N A;  2IA1 A;  3JTG A;  2M1B A;  3ESW B;  3H1C A;  1KU7 A;  1YW9 A;  3P5J A;  4RAF A;  4ASN A;  2Y2Z A;  2P6T A;  3DV8 A;  1B4A A;  1KGS A;  4M3F A;  2GAU A;  5FO5 A;  2FE3 A;  5KCM A;  1HKS A;  2ZXW H;  4LG0 A;  2L3D A;  3FBN B;  5IP7 J;  3F9K A;  4DYC A;  3K0L A;  2CFX A;  1MDM A;  3K1N A;  2EK5 A;  2G0E A;  5HVQ C;  3SZP A;  1S5L C;  2KIM A;  4RB2 C;  2QA4 I;  2XB0 X;  3ECO A;  3L9F A;  2HQR A;  2AQE A;  5LHH A;  4HEA 2;  1R5H A;  4IQ4 A;  4ZDP A;  1JTY A;  2TDX A;  3FMQ A;  5D5U B;  2E5Z A;  2VBZ A;  1QGP A;  4KNY A;  3ONQ A;  1Z91 A;  1YX3 A;  1O7F A;  3L1P A;  3OSF A;  4LK1 F;  4XLN F;  2YU3 A;  3K6G A;  4DZJ A;  2QKM B;  2EV0 A;  3WTT C;  4HV5 A;  2ELK A;  4WF2 A;  4EV0 A;  3BJO A;  1AKH A;  1MND A;  5E3M A;  3FMR A;  1RPW A;  3CO7 C;  3ZCO A;  5C44 J;  4IRI A;  3C7J A;  3BPV A;  3R6S A;  2XGD A;  2DQL A;  2R5Y A;  1UHW A;  4HF0 A;  4FX0 A;  3M8J A;  3DF8 A;  1YOV B;  1YTY A;  3RZO J;  3M7G A;  4HBL A;  3EQL F;  1FP2 A;  3F6O A;  5FKO A;  2BZT A;  2L9S A;  1HA8 A;  1XCV A;  2XGX A;  5DCM B;  3F8M A;  4A3M J;  1GV5 A;  1I5Z A;  2FD5 A;  1XDS A;  2X85 A;  2HDD A;  1RES A;  2F2E A;  1IXC A;  4BHC A;  1IGN A;  2LR8 A;  2MH9 A;  4KUM A;  1ZH5 A;  4XKB A;  4QPQ A;  1RNL A;  1VTN C;  1PUF A;  3ISP A;  1IRX A;  4E70 A;  5IT9 K;  1MH4 A;  2EJR A;  1R00 A;  2PJR B;  3VYU B;  1MJB A;  2CQ7 A;  3BT9 A;  5A2Q K;  2M8G X;  1KON A;  1IZ1 A;  3L7W A;  3OIP A;  3D5R C;  3PNV A;  3DFG A;  4DOZ A;  1FC3 A;  2NVU B;  2H6B A;  3RZD J;  4PFP A;  2HGC A;  4G9Y A;  3DEE A;  4EJV A;  1NG6 A;  4G6D A;  1HW5 A;  4L5I A;  2CUJ A;  2EPF A;  5J8F A;  2R7U A;  1AWC A;  1DQU A;  3S32 A;  4XIC A;  1FJL A;  4MLO A;  2OQR A;  4CCJ A;  2V1N A;  1QPM A;  3GW2 A;  5ED4 A;  3VDX A;  2QSG X;  5DM6 F;  1WI3 A;  4XBF A;  1WPK A;  3BZC A;  5L3B A;  1H9G A;  3GUD A;  2IS1 A;  3GTO J;  3CUQ C;  1BI2 A;  2XRN A;  2AS5 F;  1Z7L A;  2JA2 A;  2VON A;  3EDP A;  3RQI A;  4G6Q A;  3G3Z A;  4U88 A;  2VIX A;  4V19 K;  3UNG C;  2VQL A;  5BS6 A;  4XQF A;  2R7X A;  2BBY A;  4JYK A;  3GVA A;  2HWV A;  2DQR A;  1D1C A;  1XCB A;  5E1Z B;  2DU9 A;  5DTD A;  3H3U A;  3DEU A;  1IN5 A;  2EZI A;  3IL2 A;  2E34 A;  1ZGA A;  1LNW A;  3LAP A;  2GOM A;  5EZH A;  2NS0 A;  2ESH A;  3EUH A;  4M9Z A;  3ROU A;  1W5C C;  1H88 C;  2P5L C;  2P7V B;  2V79 A;  4F7Z A;  5JHU A;  2LTP A;  1S7E A;  2LFB A;  3HSF A;  3GCM A;  3CCS I;  2E5N A;  2HQ5 A;  4PGG A;  2E35 A;  3TL4 X;  4KJZ A;  4GGG A;  1B6A A;  2EH3 A;  4BJT A;  4UUS A;  1R49 A;  2BVL A;  3GEZ A;  2F48 A;  1V55 H;  1FBQ A;  1ZR4 A;  5IP9 J;  2NNN A;  4LB5 A;  4NB5 A;  4NHJ A;  1PJR A;  1Z7U A;  2D1H A;  2Y69 H;  3BG5 A;  3BR2 A;  4N9H A;  4UV8 A;  2AXT C;  3S15 J;  4PJN A;  3A03 A;  2K3P A;  1X58 A;  2NVX J;  1N77 A;  1OQY A;  4S0H B;  4OIO F;  3F3X A;  3ZOB A;  2ME0 A;  2D2W A;  4C2U A;  4Y52 J;  1WJF A;  3FWE A;  1A04 A;  5E18 F;  2A6T A;  4ENM A;  4CDG A;  2E2J J;  3LST A;  3W6J B;  1D0Z A;  4HA8 A;  4B09 A;  1D5V A;  3KEY A;  4V2F A;  4AYB N;  1MMA A;  2R0Q C;  2CQQ A;  1S6L A;  1A35 A;  3CUQ A;  3CC2 I;  3CCE I;  2VC0 A;  1B9M A;  5F64 A;  1Y1W J;  2LC2 A;  3ZQQ A;  3OYB A;  3IAS 2;  4BEH B;  3ZQH A;  3W2A A;  3BP8 A;  2YPR A;  1R58 A;  3B6C A;  4KFC A;  2ECC A;  4ESF A;  3L2U A;  2O8X A;  5ICF A;  1XC5 A;  1YS6 A;  2KIF A;  3HSR A;  2KRH A;  3BJA A;  3EET A;  4BXX J;  2IS4 A;  3KP3 A;  1JGS A;  3ZQC A;  3FK7 A;  3IC7 A;  1FIA A;  1JKP C;  5BNG A;  3G1L A;  4M71 A;  4GXO A;  2WWY A;  5FFZ A;  2VE9 A;  5BPD A;  5LFA A;  1TWA J;  2EBI A;  2IRF G;  1NTC A;  3ZN1 A;  1X1P A;  4YG2 F;  4D7N A;  1Z3Y A;  2KQR A;  2DK5 A;  1K6Y A;  5IT9 Z;  2H94 A;  1YRN B;  3OMY A;  3BG6 A;  4B44 A;  5EGO B;  3J7A O;  2UWM A;  2XAF A;  5A2Q Z;  5GAE J;  3D5S C;  3K4J A;  4YIR X;  2OTJ I;  2KL4 A;  4HX4 A;  4I01 A;  3CJR B;  2PN6 A;  5IT3 A;  3QAH A;  1O3S A;  3TO7 A;  4D5F A;  2ZJR F;  4HRI A;  1AOY A;  5DM7 F;  3FXQ A;  1Y6I A;  2LMD A;  3AG1 H;  1YJN I;  1ZK8 A;  1QBJ A;  2DFH A;  4GO1 A;  1VQ9 I;  4BE1 A;  5GAD J;  1DDN A;  1REP C;  3GTP J;  5IYD J;  3U1K A;  2X6X A;  2MBF A;  4UY8 I;  2D1V A;  2EA2 A;  2ZXJ A;  3G1M A;  3CCR I;  4BHB A;  5E20 A;  3FM3 A;  2NXN B;  1TQI A;  3GBG A;  4RLF A;  2OAZ A;  3C2H A;  3N05 A;  2IEK A;  5ILV A;  2X0L A;  3BR1 A;  2VPR A;  1R9T J;  2O7O A;  4I76 A;  3KE2 A;  1OMI A;  1T98 A;  4XID A;  3LA2 A;  1GHC A;  4HAM A;  2O5R A;  4CUG A;  4H4K C;  4BXF A;  4HDV A;  1O3Q A;  2FNP A;  3U21 A;  1Q1H A;  1WZ2 A;  2QLZ A;  1W36 D;  3NEU A;  5BQT A;  3CP8 A;  4ENN A;  1G3Y A;  1MMN A;  5KAI C;  2K4B A;  2HXI A;  4F93 B;  4I0A A;  5CVR A;  1RUO A;  1LJ9 A;  4LB6 B;  3DLA A;  4IEJ A;  3V4G A;  5D5V B;  5LGU A;  2JMW A;  3Q5F A;  2GM4 A;  3S1Q J;  5IY5 H;  3ECH A;  3SZT A;  1QHH D;  3TQN A;  4ANJ A;  1JGG A;  3S16 J;  3KLN A;  2WAE A;  4AIJ A;  2V9K A;  3KEO A;  2ZNY A;  4EM1 A;  4A3J J;  2W4S A;  3W6V A;  5HLG A;  2IA0 A;  1OIS A;  3H92 A;  2DT6 A;  1XDU A;  2X1C A;  1OYI A;  2GOX B;  5H20 A;  3QYE A;  1BJZ A;  2MAB A;  4HLX A;  4ABZ A;  2BY2 A;  5DUK A;  2BXZ A;  4BNC A;  3K4M A;  3SEQ A;  4C9Y A;  5JLW A;  4DYR A;  2VUM J;  3O2P E;  1PDN C;  1QU3 A;  3KZZ A;  1S9H A;  4A6D A;  3LL7 A;  4UUT A;  3CCV I;  1O3T A;  2MW8 A;  5CVU A;  2A05 A;  2XVC A;  4NDL A;  3IUO A;  1OCC H;  3E6D A;  2VE8 A;  3NWS A;  5F0H A;  2L7M P;  3BTC A;  2PMZ N;  1S7O A;  4XR6 A;  4CZC A;  3MEX A;  4XRM A;  3GTL J;  3HRU A;  2IGN A;  4ZYG A;  4HNU A;  2EIL H;  2KT0 A;  4NQW A;  1YIO A;  1LE8 B;  4E7I A;  2XKO A;  3O3K A;  4FQG A;  3ZP5 A;  2CSO A;  2Z33 A;  2HNH A;  1PP8 F;  1XMK A;  1QPI A;  3UR3 C;  2K9N A;  2LF8 A;  4BKX A;  1TW3 A;  3ULQ B;  2ZJ2 A;  1EJ9 A;  2M4G A;  3Q3S A;  1Y8Q B;  3L2V A;  2X51 A;  1YIJ I;  3S2W A;  2LY9 A;  4Y4R A;  5J1Y A;  2EZH A;  5FRO A;  1LUJ B;  4C30 A;  2W85 A;  1NH3 A;  3OIO A;  4A5M A;  4XN3 A;  2CQK A;  3FIW A;  4AWX B;  1XSX A;  2FXA A;  2JT1 A;  3BDD A;  2IGK A;  2PMU A;  1QVU A;  3GTQ J;  2XAG A;  1JKQ C;  3F8N A;  1T56 A;  4A2U A;  1I1G A;  3OS2 A;  1FOK A;  5J4V A;  2W7N A;  4LLG F;  3OYL A;  2A69 F;  2P8T A;  2RAE A;  3DKY A;  2Q0O A;  1T95 A;  1XB4 A;  3ERM A;  1VQ5 I;  2E19 A;  4E7S A;  2CFO A;  3H5R A;  5B1B H;  4II3 A;  2BW3 B;  1X1D A;  4M6Y A;  4ZZL A;  1QNT A;  3KLO A;  2GWR A;  3RKY A;  4O5V A;  4YII A;  4C3J J;  4Y17 A;  2VLA A;  4IHV A;  3WTU C;  3I59 A;  2FML A;  4L9V A;  3ELK A;  2JZY A;  2FQ3 A;  4I7H A;  3S8P A;  3CMA I;  2CS3 A;  2H09 A;  1YW8 A;  3DLL F;  3CZ6 A;  3O6B B;  1BOA A;  2GA2 A;  4MQ9 F;  4XRF A;  3DPL C;  1FT9 A;  3GO5 A;  4PGH A;  4BQN A;  1OFC X;  1HLV A;  4A3I J;  3S3O A;  3TDZ C;  5FKN A;  4E7H A;  1ZHF A;  3LA7 A;  4LLN A;  2JRT A;  4ZZD A;  5IPA A;  3KFW X;  2H8R A;  2UV1 A;  3A1Y A;  3DWL E;  1FEX A;  1XG1 A;  4A3K J;  3I4N J;  1S72 I;  1KU2 A;  3ABK H;  1FBS A;  1B9N A;  5DD4 A;  2MD0 A;  2DA3 A;  3FHZ A;  1ZN2 A;  4XOR A;  2LF7 A;  3CJQ B;  5LEK A;  5HS8 A;  1CQT A;  5H6R A;  4ZJZ A;  1AA7 A;  5FD6 A;  3TW6 A;  3RTR A;  1V3F A;  4AVP A;  2Q2E B;  2MYS A;  1ZRF A;  5D5X B;  1FLI A;  4EVI A;  3U2R A;  2CQN A;  1VQN I;  4L5J A;  1A31 A;  3CCM I;  1WJE A;  4LIT A;  4GFB A;  3TBI A;  4A0Y A;  1MZB A;  3FX3 A;  3PQK A;  3TW7 A;  1ZRE A;  4L0Z B;  4CCM A;  3PUF A;  4WXD A;  1L3L A;  4YIF A;  2A61 A;  1T39 A;  4JX5 A;  3LWF A;  4PCQ A;  3SFZ A;  3V8L A;  1SVO A;  5TRD A;  2PLY A;  3HTS B;  4OIQ F;  5FLV A;  4B3X A;  3IRQ A;  1BR1 A;  1JJ6 C;  4EGY A;  1JTX A;  1Z6T A;  2HKO A;  1G2H A;  3RJP A;  1KZH A;  3CCL I;  1YW7 A;  2QSF X;  3CDH A;  3H9G A;  3PJR A;  3JRA A;  4A12 A;  2IBD A;  3OYK A;  4OMY A;  1OR7 C;  1UHS A;  3K4L A;  4HX7 A;  3VB2 A;  3WHB A;  1R22 A;  3CC4 I;  5HNF A;  3EUA A;  2F4O B;  1P4A A;  1WGX A;  4YRV A;  4AU7 A;  1B8I A;  2WTE A;  1QRY A;  2F5E A;  2M45 A;  2XPU A;  1FSE A;  2HI3 A;  2A5W A;  2L0K A;  2RQP A;  1VQ8 I;  3ZMD A;  2V6E A;  4FAS D;  4BE2 A;  3I55 I;  4KMU X;  4MHG A;  1LB2 A;  2BVM A;  1RKW A;  2R7W A;  4FX4 A;  1I50 J;  3LAJ A;  1X2M A;  3EUK L;  4AYB A;  1K4T A;  4LLL A;  2BHY A;  1RUN A;  2VPL A;  2ID6 A;  3CME I;  2KHM A;  2ZC2 A;  1A6Q A;  2OF7 A;  3D0S A;  3P7N A;  3M3Y J;  2JUG A;  2K3F A;  1HOM A;  4KMF A;  4HV6 A;  1BBY A;  1P92 A;  3V7S A;  4PJL A;  3CP2 A;  4H0E A;  4AD9 A;  4HF2 A;  2L01 A; 
#chains in the Genus database with same CATH homology
 3RPU D;  2L7K A;  3QYF A;  3VYS B;  3SYT A;  3DU5 A;  4XKB A;  3DU6 A;  4QPQ A;  4XKW A;  3VYR B;  3ZGK A;  4CCK A;  2DCE A;  2OUM A;  3J7A Y;  3ZR8 X;  1X19 A;  1IRX A;  2LBF B;  4F3Q A;  1LVK A;  4PSX A;  4XOP A;  2PJR B;  1E0E A;  3VYU B;  5HNH A;  3G2B A;  3PNT A;  4XLA A;  4CA0 A;  4XL9 A;  3BCB A;  4F92 B;  1KON A;  1YE9 A;  3OIP A;  5TGT A;  2R4G A;  3D5R C;  3HXL A;  3LSI A;  3PNV A;  4DOZ A;  4X0G A;  3HUG B;  3C2G A;  4PFP A;  3DEE A;  1NG6 A;  3DPT A;  2CUJ A;  4XKV A;  2XSJ C;  2R7U A;  1TT0 A;  2ZSI B;  1DQU A;  3S32 A;  4MLO A;  4CCJ A;  2V1N A;  1X1A A;  3VDX A;  2LRD A;  3K70 C;  4OAZ A;  4P5O A;  4AVZ A;  2IS1 A;  1N78 A;  1D1B A;  4KIT B;  4BQO A;  4P1W A;  4XLF A;  2W00 A;  3NWT A;  1VZ0 A;  1Z7L A;  2JA2 A;  3A2K A;  2VIX A;  3K70 D;  3UNG C;  2VQL A;  4XLH A;  4XQF A;  2R7X A;  2OC6 A;  4XLC A;  4XM3 A;  2XF7 A;  5KHD A;  1D1C A;  4OWR B;  3OYJ A;  3S3M A;  1LDK B;  2L2O A;  3ZRG A;  1WJ5 A;  3L2W A;  3LSM A;  2GOM A;  3PSF A;  3VWB A;  2ZXH A;  1GLN A;  1DGW Y;  2CV0 A;  2HZD A;  4BL0 B;  2CUZ A;  4DBQ A;  2R7O A;  3IAM 2;  3OL3 A;  3OYH A;  4ZDL A;  4BS9 A;  2VB6 A;  2E5N A;  1EA3 A;  2LRE A;  3TL4 X;  4KJZ A;  4BDY A;  4BJT A;  2BVL A;  4BE0 A;  2V26 A;  3AKZ A;  2X6Y A;  2LH9 A;  3PL8 A;  1PJR A;  1NG7 A;  1FMW A;  4PJN A;  4XOT A;  3MKW B;  4Y3O A;  2K3P A;  2LBF A;  2XDV A;  1N77 A;  4ZC3 A;  2LY1 A;  2PJR A;  3SEZ A;  1Y56 A;  1T0F C;  2W1O A;  2VAS A;  4C2U A;  1WJF A;  1DP3 A;  3MKY B;  2CV1 A;  4ZYA A;  4E7L A;  2A6T A;  3BC8 A;  3A4C A;  2W82 A;  4C2T A;  1D0Z A;  2KP6 A;  3KEY A;  2M7A A;  1MMA A;  4J01 A;  4R79 A;  5HLT A;  4IQJ A;  2LC2 A;  3ZQQ A;  3OYB A;  2R7R A;  3IAS 2;  4BEH B;  3W2A A;  4B47 A;  2HVR A;  2WA0 A;  5HOO A;  3OS1 A;  2IXS A;  3L2U A;  2HVS A;  2R7V A;  1WJA A;  2IS4 A;  2KRH A;  3OIQ A;  3H5N A;  2PMZ A;  4HST A;  4QPO A;  4RM3 A;  3DQV C;  3LSG A;  2VJI A;  4YEL A;  3OYI A;  2F6C A;  1V5G A;  2OV7 A;  1LFP A;  2IGO A;  3EUH C;  4PUS A;  5LFA A;  2M0M A;  3PNY A;  1WJC A;  2HPM A;  3OL4 A;  2JVG A;  4IKF A;  1Z3Y A;  2KQR A;  4PFO A;  1K6Y A;  2VJ4 A;  4E7J A;  3FBI B;  3MKZ A;  3OYE A;  3OMY A;  3BG6 A;  4B44 A;  3OYF A;  2MFZ A;  4RMN A;  2UWM A;  3D5S C;  3QYB A;  4Y33 A;  3K4J A;  3AL0 B;  2KL4 A;  3CJR B;  1PYV A;  1BR2 A;  1TZL A;  2FUG 2;  3HKZ A;  5KNL A;  3S3N A;  4HRI A;  4B43 A;  2LG4 A;  1Y6I A;  3VSL A;  4XKC A;  4ZDO A;  4N4O B;  5CKT A;  4BE1 A;  4DJA A;  2IS6 A;  3ZXS A;  2X6X A;  2Z16 A;  3BG7 A;  3BLY A;  1QHG A;  2AQF A;  3LSK A;  3V42 A;  4E4H A;  4ITV A;  4E6K G;  1D0Y A;  2KDO A;  2HQA A;  1MMD A;  2M3A A;  3GBG A;  4RLF A;  3H0D A;  2QKL B;  3C2H A;  4NQW B;  3N05 A;  2RNG A;  1W36 C;  3W2W A;  1X4O A;  4DBR A;  2WY7 Q;  2HVQ A;  2DJI A;  2WB1 A;  2WAQ A;  4DGW B;  4BGD A;  2BOL A;  2IS2 A;  2ELJ A;  3H35 A;  2O5R A;  4CUG A;  4H4K C;  4BXF A;  3U21 A;  3OYA A;  1W36 D;  4BEH A;  2HPI A;  3CP8 A;  1MMN A;  2F5V A;  4BDZ A;  2XAU A;  2L5Q A;  3OYC A;  2VXD A;  4F93 B;  4ZTF A;  2LYC A;  2X1D A;  3DLA A;  3H9J A;  3SDB A;  3HG9 A;  2VL8 A;  4F91 B;  1QHH D;  4ANJ A;  2ZSH B;  2WAE A;  2V9K A;  2KLO A;  1N75 A;  3CES A;  2VJ5 A;  3OY9 A;  4J00 A;  4BAC A;  3BCA A;  3HOS A;  4PJM A;  2W4S A;  2VQH A;  2DT6 A;  1J09 A;  4ZTJ A;  1Z3X A;  2X1C A;  3PFY A;  2GOX B;  2NOJ B;  4PK4 A;  3QYE A;  1X1C A;  2MAB A;  4BJ5 C;  2R7T A;  2DT7 B;  2CV2 A;  2Q1Z B;  3K4M A;  2X6W A;  4BQQ A;  4LG3 A;  3SEQ A;  4PSW A;  4C9Y A;  2VKH A;  4RM2 A;  2MC4 A;  1QU3 A;  1S9H A;  1G59 A;  3LL7 A;  3K4C A;  2F4I A;  3IUO A;  4NC7 A;  3NWS A;  4G6T B;  3DKX A;  4FET A;  4B48 A;  1V5F A;  4XR6 A;  4XMY A;  3OOU A;  2JVH A;  1UG0 A;  3RCO A;  4CCO A;  3SZG A;  4CZC A;  2M7B A;  4IZZ A;  4HPQ A;  4KIS A;  2IGN A;  5LD2 C;  2R7S A;  4HNU A;  1P9Q C;  2HDW A;  1WJB A;  2K9M A;  4E7I A;  1BR4 A;  3EPZ A;  1V5E A;  4D9J A;  2HNH A;  4BUP A;  4EAT A;  5JHF A;  3UR3 C;  4E7K A;  1MW7 A;  3E0J B;  3PUB A;  2VXZ A;  2M4G A;  3MD2 A;  2CW8 A;  2VQG A;  3FHN A;  3DPU A;  4DIQ A;  3L2V A;  2X51 A;  3S93 A;  2L9N A;  4Y4R A;  5FRO A;  3QOD A;  4CH7 A;  4C30 A;  2IGM A;  3LMM A;  4II2 A;  4XN3 A;  3FKJ A;  2Z2S B;  4D1Q A;  3I3L A;  2IGK A;  3LFU A;  2XF5 A;  2JSP A;  1OLT A;  2ZXI A;  2VJJ A;  3OS2 A;  3AL0 C;  2W7N A;  1DGR M;  2LY2 A;  4LIV A;  3OYL A;  3MMY B;  3DKY A;  4HSR A;  2CW7 A;  1T95 A;  2Z1D A;  3OWT A;  5FRN A;  2UUZ A;  3AFH A;  3HC7 A;  4KT6 A;  5FRM A;  3LSH A;  3K4N A;  4E7S A;  4IX7 A;  4U7B A;  3HPG A;  2CFO A;  4XN0 A;  3OS0 A;  3H5R A;  4II3 A;  2BW3 B;  1X1D A;  2VQC A;  3E1S A;  4BU2 A;  3W2V A;  2E60 A;  2KMU A;  3L2Q A;  2KZV A;  2VLA A;  4XON A;  3OR2 C;  1ERD A;  3DTE A;  4YEJ A;  2HU9 A;  1SFK A;  2RQQ A;  3H9Q A;  3K4B A;  3S8P A;  2CS3 A;  1LKX A;  3QOE A;  3CZ6 A;  3K10 A;  2WAF A;  3DPL C;  3I9V 2;  3DTK A;  4BQN A;  3S3O A;  4E7H A;  3KYL A;  4NNJ A;  1UAA A;  2UV1 A;  3A1Y A;  4CSW A;  3DWL E;  2VKD A;  2WY8 Q;  5CPR B;  2WBM A;  3RSN A;  5CQE A;  4F55 A;  4JOM A;  3H5A A;  3W3C A;  2MD0 A;  2WAD A;  4CCL A;  3D5L A;  4XOR A;  2RRE A;  3CJQ B;  3IP4 B;  4LIU A;  1X1B A;  3PSI A;  4U87 A;  4ZJZ A;  1AA7 A;  2Y0S A;  3RTR A;  3TMO A;  4GRI A;  2Q2E B;  2MYS A;  3DTI A;  4XNF A;  3OYM A;  2R7Q A;  2ZFU A;  1D0X A;  3HPH A;  4N4N B;  4XLE A;  1WJE A;  4LIT A;  1MMG A;  5KCM A;  2V7F A;  3RQ4 A;  3TBI A;  2V4J C;  3OYN A;  3FBN B;  3L2R A;  3F9K A;  4CCM A;  1X4P A;  5HVQ C;  1R6R A;  2DOA A;  4CCN A;  1BOB A;  4B3X A;  1BR1 A;  3HL2 A;  4F52 A;  2AQE A;  4HEA 2;  4E7Z A;  2XC7 A;  4IQ4 A;  3FDY A;  4ZDP A;  1SAU A;  2KRC A;  2E1M B;  1JI8 A;  2E5Z A;  5CQG A;  3H9G A;  1WFX A;  2P0W A;  3PJR A;  3HOT A;  2CH0 A;  2BW3 A;  3OYK A;  3ONQ A;  2I8D A;  1YX3 A;  3OR1 C;  1OR7 C;  2CMP A;  3K4L A;  2KPM A;  4NUB A;  4OAY A;  2DXI A;  2XF6 A;  5HNF A;  3EUA A;  4YRV A;  4AU7 A;  1G8X A;  3K6G A;  1Z21 A;  2E1M C;  2QKM B;  2LOO A;  3CMM A;  2M4K A;  4HNT A;  1MND A;  1ZEL A;  1UEL B;  4NC8 A;  2A5W A;  3ZCO A;  2V6E A;  1YX5 A;  4FAS D;  4BE2 A;  2BVM A;  2R7W A;  4RLQ A;  1FMV A;  3VSK A;  3OYG A;  3VYT B;  3M1C A;  4PJJ A;  3EUK L;  4AYB A;  3M8J A;  2K9L A;  1U0J A;  2VPL A;  4JQF A;  3OYD A;  2KHM A;  2JUG A;  2L9S A;  1HA8 A;  3CF2 A;  4HG2 A;  1WJD A;  2X1E A;  3K4K A;  3KX2 A;  2K5C A;  1MNE A;  4PJL A;  3CP2 A;  2X85 A;  1D1A A;  4BJ6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...