1OCCH

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
b'YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
total genus 22
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1occH00
2OCCH 2EIMH 2Y69H 5B1AH 3WG7H 1OCRH 1OCZH 5IY5H 2DYSH 2DYRH 3ASOH 1V54H 5B1BH 2EILH 2EIJH 3ABKH 1V55H 2EINH 3AG2H 3ABMH 2EIKH 3X2QH 2ZXWH 3AG1H 5B3SH 3AG3H 1OCCH 1OCOH 3ABLH 3AG4H 3ASNH
chains in the Genus database with same CATH superfamily
3O6BB 4N9HA 1FX7A 2E36A 3MKLA 1MDMA 1R00A 4RA2A 1XC5A 2ZCWA 1TQMA 4CUGA 1J9IA 4BDYA 4YFXF 1VFCA 2QGUA 1BI1A 3ZQQA 2IS4A 3ROUA 1QHHD 1PJRA 3PSIA 1Z9CA 1TT0A 1W5SA 3CUOA 2ZO4A 4IHXA 4LG0A 4XIDA 5L3CA 4BEHA 5HDKA 4KICA 1RIOH 2BVMA 3H0DA 4LLNA 3F6OA 4CO8A 5LRRA 2RC4A 1YX5A 3ZGKA 3DPUA 1ODDA 4Q48A 2BHYA 2DMNA 3CCSI 5JVGF 1WI3A 3S17J 4B3AA 2PJRB 1QVTA 2LDUA 5D6FA 4E7IA 1YFHA 4BNCA 2O7OA 3K1NA 1IGNA 5F08A 3F6VA 3ABUA 1WJBA 2NS7A 4LIUA 1MBJA 5DD4A 2GXAA 1I1GA 3FBNB 2W48A 4HBLA 4EEFG 3GTJJ 5E17F 1LFPA 1WWXA 2XAHA 2QSGX 4ZYDA 3F3XA 4HOBA 4CCJA 2L9RA 3OYFA 5FLVA 1RC9A 2Y0SN 3HPGA 1IV8A 3HTSB 3FM5A 4HX7A 4MFEA 2R5YB 2HU9A 1G6NA 3QQAA 4IL6C 2L4AA 3DWLE 1K6YA 1YQAA 2FMLA 2NVYJ 5AIQA 1RNLA 4FETA 5IOYA 3JTHA 1ERDA 3M9AA 4BJ6C 3QYEA 2IGKA 3F23A 4BACA 2HEOA 2X6OA 4X6AJ 1EKEA 1TC3C 1MW7A 4XK4A 3R6SA 1R5GA 2CGPA 1KU3A 1P7IA 1KGSA 5KAIC 4A0YA 3O3KA 5FRNA 2WAQA 1FC3A 1ON1A 4MTEA 1JGGA 1RPWA 1WGXA 1ZARA 3ZPLA 2E60A 2CJJA 1IDYA 5EGOB 1IRFA 1A35A 1G2HA 2E71A 2ID3A 4KISA 4LJZF 3J7AY 2QM3A 2XAJA 2L7MP 1DU6A 3BP8A 3MAJA 3MN2A 3H35A 1WCMJ 2Z2SB 1DP7P 2MD5A 3EUKL 3CLQA 1J2XA 2FQ3A 1STZA 2XSDC 5E1XA 4YG2F 1OJLA 1WJCA 3C3WA 2OCCH 3S1NJ 1R1VA 5J6XA 3VYUB 4D7NA 3S8PA 3WE3A 4ZYHA 3GCMA 2EIJH 3KPHA 4AD9A 2XGDA 5ERIA 3V8LA 5K7HA 2HVRA 2KIMA 1TW3A 1WJDA 1BI3A 2P6SA 3DLLF 3CCLI 3JSPA 3OYMA 2X6WA 1Z77A 4Y3OA 3W6KB 4PJJA 1P6RA 5JLXA 2M1BA 3R61A 3BR3A 4GDFA 2DW4A 2ESNA 2ISZA 1XSVA 2ECBA 2DCEA 1YX3A 2VKHA 4EJUA 3SQNA 4F7ZA 2R5YA 4EMSA 3FKIJ 4ETSA 4ASNA 5ICCA 2MLGA 2M30A 3HGYA 3ZRGA 2LNBA 2GA1A 2STWA 1Y6IA 4IHWA 1BW5A 1APLC 2GOMA 3W6VA 5GPAA 2IEKA 2E5NA 2G0EA 3OL3A 1YHQI 3S14J 1TZLA 2LF7A 3BPXA 2ISYA 4MFDA 3HHGA 1OISA 3MKWB 3K2ZA 5EGOA 5JHFA 2VQLA 2VLAA 3LSMA 2HYGD 2KQRA 2X1DA 4JQFA 2VQGA 2XUBA 2V6CA 5DM6F 2QWWA 4ZZDA 1ETKA 3HOUJ 1BJZA 4IPAA 4R8HA 1ZQ3P 4AIHA 1IRGA 3GFMA 2E7WA 3CP2A 3S1MJ 4JYKA 2KMUA 2EZHA 3I3LA 2QBYB 1LQ1A 1DQUA 4WX9A 5HDNA 4NC6A 1L0OC 1ZGJA 1OQYA 1E3HA 3GLXA 1J75A 2F5CA 3FISA 1F1ZA 2XAQA 3CTAA 1E2XA 3OYAA 1NG6A 3BCAA 4Q5SF 3C7JA 3J81Z 2LKPA 3FMRA 2ADUA 2P7VB 4KA4A 3W3CA 4HYEA 2Q1ZB 1U5TB 2RNJA 2OTJI 3ZMSA 4OAYA 1H88C 1QZZA 2ZKZA 4ZYAA 3LSGA 2FMYA 4RB3C 2UXXA 3E0JB 2GBYA 4B47A 2DOEA 4D7MA 1SC7A 3CMMA 3HRTA 1ZHFA 4O5VA 3ZMDA 3ZQLA 1U9NA 2K9LA 1T95A 1A6QA 2V26A 4HNUA 4V19K 1BR4A 2VPLA 2BE5F 5HLIA 2VXZA 4KN4X 1BL0A 3NAUA 4E7KA 4BAYA 2LTPA 3HG9A 3H9GA 1Z3YA 4F92B 4CSWA 3J80K 3D5LA 3BROA 1D5YA 4EM1A 4WF2A 4OIOF 4S05A 3WTXC 1ON2A 4LD5A 4N4NB 3WTYC 4QLCU 1YITI 1FYLA 3F22A 3QP5A 3I55I 1OR7C 2F4OB 2LK2A 4BXFA 5B5EC 2HWVA 4AVPA 5J4YA 4XORA 3LMMA 3AL0B 2GLOA 2W4SA 3L2QA 2XKOA 2L7KA 1Y1WJ 4M6VA 1JHFA 3DTEA 3KIOA 4LMYA 2LY2A 4XOPA 2L0KA 2JUCA 4BL0B 4V2FA 3DXJF 2HNHA 2G7HA 5E3NA 2QBYA 1FNNA 1XS9A 4A3IJ 3FIWA 3MWMA 2FOKA 2BHZA 1XDUA 2XB0X 2OV7A 3CMAI 2ID6A 3DKYA 3CCYA 5KVRA 4RGXA 5DUKA 3OYDA 3CCEI 2L4MA 2JQ7A 2LD5A 2E2IJ 2BY3A 2CU7A 3Q0VA 4DBQA 1UG2A 5LRSA 1USSA 5FGMA 2CQNA 3HZJA 3WG9A 1J09A 1WPKA 1U5TA 1RKWA 2A69F 1R5HA 2XGCA 2JA5J 4CHUA 3TO7A 4EQQA 3BR1A 5K5QA 3UKGA 5EEHA 4C2UA 3J80Z 2O8XA 1CF7B 1U2WA 4IVNA 2E35A 5HVQC 1U8BA 2D5VA 2NS8A 3R0JA 5D4RA 2JSPA 3AFHA 1FJLA 2WAQN 3JRGA 3OS2A 3FXRA 2VJIA 1T08B 3E5UA 2NRAC 3CC7I 3OS1A 5D8LB 2D1VA 2XV4S 2ZMEC 3OSFA 3FK6A 4FISA 4C2MJ 1QBJA 2WY7Q 3DEWA 1IV6A 2DOFA 4I7HA 1LFUP 4IHSA 2B7EA 1XGNA 4CH7A 2F5EA 5D5UB 1BBYA 5FB2A 1Z7UA 5ICGA 3LSKA 4A2UA 5LLQA 5LGTA 2HOTA 1FTZA 1D3YA 1KU9A 4HRIA 2EFOA 2PMHA 2LREA 5HLTA 4A0ZA 3TP3A 3R60A 2HVSA 2HPIA 1Z6RA 1B9MA 1BC7C 3PUBA 2EPFA 3RZOJ 3NRVA 3ZQ7A 2P6TA 3S2DJ 3WHCA 3ABMH 3OV8A 1U8RA 2VPRA 2OQGA 4DZJA 4ZH4F 4ENJA 4U0VA 2Y0MA 4DYQA 2DBBA 4J01A 2R7VA 1SD5A 1ETOA 3RPUD 4E70A 2RGVA 1X4PA 1YE9A 4C30A 4RS8A 2DK5A 2N8GA 1BM9A 1IO2A 1GXQA 1MGTA 1XDSA 2Y75A 5FD5A 2Z33A 1Y1VJ 3KEYA 3BTCA 3L2RA 2M4GA 4BHPA 2DMPA 1HDDC 3IH4A 3IUOA 2ETHA 4PDKA 1XPXA 2DO7A 1IXRC 2JVHA 3A0BC 2HZDA 1IN6A 4XLPF 3TEDA 3T1BA 1N77A 3W2VA 2F48A 1VQLI 1BA5A 3D5RC 5K1YA 1JKQC 3MKZA 3JRFA 2R7ZJ 4A5MA 5BPIA 2XROA 1I27A 1X3WB 3WTTC 3LSJA 1CF7A 2WA0A 1YI2I 3GTPJ 1W0UA 3GTMJ 1XGMA 3ML6A 2ZFUA 4PSWA 1UCRA 2OZ6A 1FT9A 1ZRCA 2MFZA 4JX4A 3H0GJ 2CMPA 3IH2A 3V4GA 1WHUA 2EV6A 2K02A 3DTIA 3ZOBA 1TL8A 1K83J 1SAXA 4RGSA 2EWNA 2CYYA 5J1YA 2QF7A 1WFXA 5GAGJ 4DOZA 4N0BA 5HLGA 3OYLA 2V9VA 5C4JJ 2R93J 2R7XA 4A12A 1IW7F 1TTYA 4U7DA 1IZ1A 2KIQA 1LB2A 5JFRA 5F64A 2XF5A 2LMDA 4G7ZF 3JRIA 1ZRFA 3LSRA 1WKMA 2M0CA 3KLOA 3LSHA 5AIPA 4UB6C 5EYRA 3S2WA 3HOZJ 2HOSA 1P2FA 2ZXIA 1ONVA 1D5VA 3WU0A 2V9PA 5CLSA 4E7ZA 5HNFA 1IJWC 1A36A 1ORKA 4O3MA 2DK8A 1JKOC 2W57A 1MBGA 4BUPA 2VC1A 3TMOA 1NHAA 2HFHA 3Q9VA 3ERED 2FXAA 4ENNA 2HPMA 3QP6A 4XL9A 1OKRA 2GAUA 2L3DA 3OL4A 2XAUA 1Z3XA 2MYSA 1X19A 1HCRA 2LY1A 3L9FA 1TT5B 4ZZLA 3DPTA 3G1MA 2QEXI 2HDCA 4G6DA 4BJ5C 4YRVA 2R92J 2QVOA 3LNQA 1R1TA 3BZKA 4G7OF 3GX4X 2CFOA 4OU0A 4PFPA 3OIQA 4B4CA 4CYDA 1S5LC 4MNUA 3RIRA 2D2WA 2E1CA 3FM3A 1LUJB 3JRDA 1Z1DA 4NQWA 1AHDP 2UWMA 3DP7A 4Q4ZF 2OU2A 4A3JJ 3I4NJ 1LVKA 3NWSA 2CFXA 2JN6A 3KCCA 3WTUC 5FLXK 3QAHA 1P92A 2FE3A 3U21A 1QO0D 1JKRC 1ZN2A 1TWHJ 2V1XA 2BW3B 4QTRA 2EFNA 2VN2A 5HS9A 3E6MA 4XSZF 2E1NA 2IGMA 2PMZA 1RI7A 3RPQA 1B1BA 1LEAA 1O3RA 1U6GA 5DDGA 3HKZA 2W82A 2JUGA 2UXNA 1LDDA 5CKTA 5M3FJ 1USTA 1BIBA 2D1HA 4X1EA 3M1EA 2CRGA 1BR2A 2DLLA 2J5PA 3IKVA 3EETA 2ZMEB 2LFBA 2WC2A 3V7RA 2FBKA 4FASD 4M3FA 1MMAA 1FWZA 4GGGA 3CUQB 3VFZA 1EV7A 3H3UA 2CW0F 4BDZA 1Z7LA 4XICA 2CV1A 2B63J 2UZKA 2IS2A 4P9FA 3OR2C 3WHBA 4ZYGA 3LA3A 5J47A 2Q2EB 4BQAA 1Z67A 4A3CJ 1YS6A 2HKXA 2DTZA 4NB5A 4AYBA 2LYCA 2P5VA 3RKYA 1IN5A 3DBHB 4MLOA 4IJAA 3CCRI 2XGEA 3CJRB 1RRJA 4P55A 2Q0OA 4YIRX 5LHHA 2L2OA 1D0YA 2EA2A 2PBIA 4CCKA 1XMAA 3BR6A 5J8FA 2XC7A 4XMYA 1TNTA 5CVJA 4ON0A 2DPDA 4OWRB 4YFKF 3S93A 2PFBA 5FKMA 2AS5F 1FMVA 2YR2A 2H09A 3BG7A 3FXUA 3K2AA 3OS0A 1HKSA 5LEKA 3VB2A 1S8NA 4BBRJ 2V6EA 2R7SA 5EZHA 1JT0A 3GBGA 3LA7A 3ZQFA 1S7OA 1TWGJ 3T8RA 4BGDA 4U0YA 3M3YJ 3QYBA 1I39A 4G7HF 2MW8A 2RN7A 3ZMUA 3PIPF 1CQTA 4RGUA 1RZ4A 1WH7A 2E34A 2BW3A 2DA6A 2CQXA 3ZP5A 4AIKA 3E97A 1Y56A 1X4OA 1FSEA 2BY0A 1FYKA 2DXIA 4A5NA 2VUMJ 2ELJA 4PCQA 2ZXJA 1RUOA 2ZJRF 3E6BA 4RAGA 1ZLJA 3HOWJ 5F0HA 2DU9A 3VYSB 2JPCA 2FU4A 2EV0A 2BGCA 3Q5FA 4M9SA 2FRHA 5GAHJ 1G3SA 3CUQA 1V55H 3ELKA 1Z05A 4B44A 2O03A 3VOEA 2P81A 3G73A 4LOCA 4IF4A 3VWBA 5CVVA 1FSHA 4IRHA 2P8TA 1MBHA 4XR6A 2Q2EA 1KYWA 2QKMB 5FROA 4DW6A 5JLWA 3OSGA 5J4VA 5LFAA 3OIPA 2PN6A 3C2HA 4V2GA 4I99C 1YYVA 3G1OA 3HRUA 4W1UA 3GFJA 5FKOA 4CYCB 2QUFA 5F0FA 3HSFA 1MKMA 1T0FC 3HL2A 5KNLA 2COBA 1QU3A 5F27A 2ZFWA 4EV0A 1PDNC 1MNDA 4XM3A 1B6AA 4CCMA 2VE8A 2Z5UA 5D4SA 3FXKA 2M0MA 4RAYA 4IRGA 4EM0B 1POGA 4RLQA 5H6RA 3PQJA 1P4WA 1OFCX 1MH4A 3EUHA 4NBQA 1XTAA 2KP6A 2LKXA 2DFFA 1U9OA 3OYKA 4FE7A 4ZDPA 4AC0A 5CYVA 2DYSH 2NS0A 3U1DA 5K5OA 3MKYB 5ILUA 4QIWN 5TGTA 2KZVA 1LDKB 4C9YA 1YJWI 3DFGA 3PNTA 2LKSA 4Y15A 2YU3A 2TRTA 2A68F 1GV5A 3PM1A 1N25A 3MMYB 3V42A 4G94A 3P5JA 2RAEA 3KP2A 3CMEI 2ESHA 4L18B 1JE8A 1HW1A 3K69A 2LG4A 1HDPA 2JZYA 1UELB 4HLYA 1E17A 2QA4I 3TL4X 3PNVA 1H9TA 2E5ZA 3GW2A 3EUAA 2EIMH 4JOMA 1V3FA 5CQGA 1DDNA 2HOEA 3CLOA 4GYIA 2A61A 1MMNA 3QOEA 3LOCA 3Q0UA 2HS5A 3K6GA 1Q1VA 3D5SC 2IJLA 5JVTA 1GHCA 4YIFA 5DM7F 3IV5A 3AG2H 2K40A 1TWAJ 2OZUA 3BG6A 1TBXA 1NG7A 3BZ6A 3RJPA 3HDDA 2X6YA 2A6TA 2IA1A 2JWTA 3I53A 1G4DA 3D0SA 4AVZA 1O7LA 5C3EJ 2VBWA 2K7LA 1OYWA 5IOZA 1MJBA 2QCOA 2IS1A 3BR0A 1VF9A 2A05A 2YUSA 3ASOH 2XAGA 4RM3A 2O8KA 4NC8A 2PJRA 2GM4A 4CYCA 2LOOA 1MMSA 3G6EI 3ONQA 3KETA 4RB1A 2FD5A 1NK2P 1WJAA 2M2EA 4XSXF 5EEGA 2OUMA 2QQAA 3B6CA 3OOUA 4MQ9F 3I56I 2ZXWH 5M3MJ 4A3BJ 1HKQA 1Q1HA 2AO9A 4ENMA 4FHTA 4QWQA 2LVSA 1D8KA 1MMGA 2VBYA 3HKZN 5BPDA 1JJ6C 3GZ5A 5ICEA 2BZTA 2LR8A 2FBIA 3BLYA 1X2NA 1P7JA 4YIIA 5LGNA 5DYMA 3ZQHA 4B09A 5IPAA 2GIZA 1FIPA 3SJMA 3UNGC 5D5WB 4FX4A 4AM3A 1FOXA 2E1MB 2H27A 4MIMA 1IRXA 2JTVA 4M6YA 3NWTA 2EIKH 1OYIA 2L7ZA 4ZC3A 3C18A 3SEQA 1J5YA 1YJ9I 1R22A 2DMUA 2KRCA 1W36D 4R1HA 3GUDA 1G3YA 1OCRH 4P5OA 2RV8A 4AYBN 4HG2A 3S1RJ 3S3MA 1HA8A 2R4GA 3W2WA 1WJ5A 2CH0A 4FT8A 1FLIA 5E1WA 4U87A 3HHHA 1JUPA 2I10A 2QENA 3HOVJ 4MEXF 1RR7A 3GTOJ 3FMQA 2M87A 3REOA 1JUMA 1K79A 3F8NA 4GRIA 3RKXA 3BQYA 2XPWA 3DLAA 4II3A 4WWCA 3JRHA 1IRZA 2RKHA 3GEZA 3E1SA 1ZR4A 1QGPA 2IGNA 3S16J 3DCFA 2FQ4A 5CQEA 3G4SI 2R7OA 3RDIA 2XIGA 5EF6A 1F43A 3H92A 3RQIA 5B66C 3GTGJ 2L7FP 2V79A 1BJAA 3VYRB 5H2FC 3OIOA 2MH2A 4E4HA 3ESWB 1K6OA 1QA6A 3MVPA 1MH3A 5M5XJ 3BG3A 1FTTA 1RR8C 2F5VA 3PSFA 1F4KA 2EJRA 1YS7A 1G3WA 5FKNA 4HX4A 4B8XA 1MIJA 3JW4A 1X3UA 1MNEA 1Z0XA 1LDJA 2K9QA 1YW7A 3F9KA 4F3QA 2KFDA 4NC7A 1W1WE 4IHVA 1LFBA 2L01A 3LSIA 1YRNB 4EJOA 3ERMA 3IRQA 3GLLA 3KLNA 3JCUC 5L3DA 5LEJA 3MEXA 3K10A 5GTHC 2K86A 1A6IA 4MEYF 1YJNI 3RSNA 1VQKI 1H0MA 5F0CA 1IG7A 1OCOH 1HSTA 2L9NA 4UNOA 2M4KA 1D0XA 1MMDA 4UUTA 2M34A 2R7FA 2WV1A 3VYTB 5BNGA 3GXOA 3IRRA 1TLHB 4A6EA 1PP8F 1N75A 3CO6C 5FKLA 3BOQA 3E6CC 3RKQA 2OAZA 4W97A 4L0ZB 1PVEA 3MZYA 1J7KA 4NDLA 1RKTA 1I3AA 4CZZA 3PUFA 2A6HF 4F55A 2IPQX 3COAC 1YIJI 1MNMC 1HF0A 3LA2A 1VQPI 3BJ6A 1OCPA 3RKWA 1R5ID 2XKPA 4L9NA 1I50J 2ZSIB 3CC2I 1O3TA 3HPHA 4XN0A 1XGOA 5HLHA 3GF2A 4XBFA 3GMEA 4DZPA 1GT0C 2M3AA 3K4LA 1SFUA 4IEJA 4Y13A 1H89C 2EFPA 1KU2A 4PJNA 2L5QA 3K70D 1VNDA 4UV8A 2XRLA 4IRIA 3WTSC 4XLCA 4LGWA 2STTA 3VDXA 1MJ9A 2W85A 2W84A 2LBFB 4CCLA 1LKXA 1YIOA 1SD6A 1BIAA 1MD0A 5K7FA 4IZZA 4D9JA 2OA4A 2OQRA 2RQPA 4EM2A 1W7PB 2LLKA 3SDBA 4ANJA 2H8RA 3HBLA 2VB6A 2F4IA 2W00A 4ZJZA 2JMWA 3DKWA 4PJMA 3CCVI 1YRNA 5BQTA 5FJ8J 1BC8C 6PAXA 1S72I 2PMUA 4G12A 1KQ8A 1P4AA 2F4MB 2Z3YA 4U7BA 2VQCA 4D5CA 4A3MJ 3MCZA 4FX0A 3F0CA 3ASNH 4II2A 3ZQGA 2ZNYA 3DV8A 3UR3C 1AWCA 3T8TA 2E2HJ 3CO7C 2NVXJ 4HLXA 4DNCA 3TDUC 4AWXB 2EBIA 3DBLB 4D0PA 4EJWA 3KE2A 3HM5A 1PUEE 1ZGAA 1R71A 1R1UA 4HSTA 1TWFJ 1UJ8A 5IT3A 2JA2A 3V8JA 4Y52J 2ZJQF 1B4AA 4IXAA 1BW6A 3FXOA 2QKLB 2NOGA 1EJ9A 1VQ7I 2HXIA 2QQBA 4UVAA 2LH9A 3PJRA 1DGRM 3L2VA 1UB9A 2L02A 2MLKA 4RBOA 1SVMA 2ZXHA 1ZR2A 1T33A 3RI4A 2A5WA 2WBMA 4IQ4A 3H5RA 4Y17A 4ZTJA 3QU3A 1ETQA 3TOAA 4CXFA 2M8EA 3K4MA 1RETA 1X1BA 2XF7A 2DQLA 3KP3A 2DJNA 3MFKA 2MGQA 3QU6A 4S04A 2V1DA 3WTWC 4I6ZA 1V54H 2VL8A 2RVCA 2MC3A 2ZB9A 2O6GE 4L0YB 2WTEA 5E18F 3L2CA 1QQIA 3LFUA 1IC8A 1JHHA 2FF4A 5HDGA 2PLYA 2DMQA 4M9XA 1XCBA 4DGWB 3GFIA 1ULYA 3OOPA 3G71I 2LF8A 2KDZA 2VE9A 2LBFA 2W1OA 1LNWA 3GO5A 4XLEA 2OPTA 1WRJA 2EZLA 2OTLI 3K0LA 2HQNA 2XPVA 4XRFA 4RLFA 1O3SA 2WB1A 1SFOJ 5B1AH 2FNAA 4G9YA 1A04A 1OCZH 2JVGA 2DT5A 3V7SA 3KYLA 1W7PA 2HGCA 1YO5C 2DT6A 3DBRB 4YFNF 2VBXA 3MZHA 2BBYA 3MZ8A 3CCMI 3WTVC 2KDOA 3HUGB 4M3EA 2KPMA 3F8FA 3X2QH 4Z6YA 3ZR8X 1N78A 1S7EA 3K4NA 1D0ZA 3ZMZA 1LJ9A 1YOVB 1OLTA 1KYZA 4BE1A 2NAZA 4EGZA 3QODA 3KP7A 4RAZA 4YELA 2Y69H 5IYDJ 3KP5A 5DV5A 2KIUA 1ZYRF 1VQMI 3H9JA 3TQNA 1EH7A 1O7FA 4HF1A 1R9TJ 3H9QA 4L5IA 3G2BA 3T0YA 2KJCA 4QSHA 2X6XA 3SZPA 1MJAA 3D1NI 2R7WA 1CGPA 3O2PE 3IWFA 4E7HA 2PQ8A 4BQOA 2F6CA 2DFHA 1JGSA 2EB7A 1FOWA 1VZ0A 2WADA 1JT6A 2P5KA 4KT5C 1AKHB 3PO3J 1F5TA 2O9LA 4KJZA 1IN7A 4HF2A 4XKCA 1FBQA 3BJOA 1SFKA 5J3LA 3QPSA 5E3OA 1TQIA 2H6BA 3I64A 4E7LA 4HAMA 4M3BA 1SVLA 2AXTC 2XAFA 2EH3A 3DU5A 2MABA 2JK3A 4XLNF 2VT3A 4KNYA 5HS8A 2R7RA 4LFUA 3PL8A 3H3VK 3AG1H 3WGHA 1KA8A 3ABLH 3IL2A 1Y0UA 4FCYA 3OWTA 5GTIC 1B59A 4EATA 1FY7A 4BJTA 1R23A 5L3GA 5E1ZB 2DN0A 2Q8KA 3ABTA 4XNFA 2K27A 4HPQA 4HV6A 3IKTA 2IRFG 2OF7A 5B1BH 4EVIA 2IA0A 4UUSB 2FEZA 1WI9A 3J7YJ 2EINH 3JRCA 3BJAA 4TV7A 2BY2A 2EK5A 3O8HA 2CUZA 4HQEA 2XF6A 3LSTA 3LQRA 1F36A 2HQAA 2VKVA 2WAEA 4MHGA 4RDUA 5DD8A 3RZDJ 2JT1A 4UB8C 1V4RA 3CJQB 3I9V2 4YEJA 3GZNB 3OYCA 3AG4H 3L2WA 3TW7A 4WXCA 2V1NA 3H5AA 1DPRA 2RDPA 4LB6B 3WG7H 3K1MA 3FF5A 4A3EJ 3HYIA 3JSOA 4HQMA 4XN3A 1T98A 1O57A 1WH5A 1U0JA 3CJTB 4E6KG 2HOAA 3E3VA 5IYBJ 3DKXA 2CV2A 2JA6J 2C6YA 4DIQA 3C2GA 5IP9J 3B02A 3QYFA 1JXSA 2Y48A 4D1QA 1OR7A 3P7NA 5FFXA 1ENHA 4A0XA 4C2TA 2DA5A 3K7AJ 5M5WJ 3LSPA 4UVBA 2KISA 3M7GA 1ZGWA 3DQVC 3FMSA 3R4KA 3HJEA 5ED4A 3WU1B 4X0GA 3LL7A 4C3HJ 1DU0A 4A3KJ 2L54A 1AKHA 2Y30A 1R4MB 1X1AA 2UUZA 2PEXA 5FLXZ 5A2QK 2DDBA 3IH3A 3M1CA 1FZPB 4CICA 1FBUA 1UHSA 3BPVA 2CWEA 1P4XA 1GVJA 4S0HB 2VKDA 1IAWA 4LK1F 5TJJA 5F6FA 2CO5A 2YPRA 1VQ9I 1RUNA 2X9DA 4LITA 5DCMB 2M9HA 2Z9OA 2DA4A 2PI0A 3K1PA 5E8GA 3H3ZA 4M73A 1JKPC 4LK0F 1VQOI 2AQFA 3N4MA 2LRDA 4BHBA 3WTZA 2MD0A 3F8BA 3I71A 4XLFA 1FPQA 2XASA 3OYGA 4UUSA 3HOSA 3JRBA 2P4WA 4DQ2A 1E3PA 4L9TA 3GWZA 3FXLA 4MGRA 5ICFA 1PYVA 1SVOA 4KN7X 2ZNZA 4K2EA 4D5FA 4XRSG 4ABZA 4FE4A 3TP0A 4G6QA 2K4JA 1XSXA 4BXUA 3FWEA 4M3DA 3RQ4A 3I4PA 4OOIA 4I01A 3T5XA 4L9VA 2KZGA 4G8XA 4KYWA 2ACJA 3EPZA 3I5UA 3SDGA 1BI0A 2ZMEA 4HW0A 1G8XA 2X85A 3SZTA 2D45A 1V5FA 3CQZJ 4HZFA 5LHGA 1B72B 2A6EF 1AA7A 2ZJPF 5A2QZ 1EH6A 3E6DA 2IP2A 3U9GA 3VPRA 1OCTC 3VODA 1W5TA 1S3JA 3Q0WA 2KRFA 1KZHA 1F9NA 4F91B 1HLVA 3S32A 9ANTA 1QNTA 2M8GX 3F8MA 3WODF 1S6LA 4GFBA 5K5RA 3QWLA 2V1UA 2FJ1A 3L2UA 5CVUA 5E3MA 3FHZA 1YLFA 3K4KA 3IAS2 1T8IA 3RCOA 4Y7NJ 1SD4A 5F1JA 1ZG5A 3LWFA 2WB1N 3FK7A 3HOTA 3KP4A 1UG0A 4L5EA 3HRSA 2H8WA 1LE8B 3BR5A 3CDIA 1TWCJ 4R79A 2CQ7A 2QLZA 5L3BA 2EFWA 4G6TB 3N05A 3BR2A 5B3SH 4DBRA 4H0EA 4NHJA 4M9ZA 3CF2A 3A02A 4BE0A 2Y31A 3DPLC 3F8CA 5DCMA 1UFMA 5LBQA 1V5EA 1I6HJ 3KEOA 1U5TC 2VODA 1XN7A 3QOPA 2LC2A 2R5ZB 3GFLA 1XSDA 2KRHA 2VONA 2XPUA 2WWYA 1EF4A 4HNVA 1XCVA 4OMYA 2TCTA 4I09A 1JI8A 1D1BA 5GP9A 3HB9A 1X1PA 4UHTA 2HKOA 2AXLA 2FSWA 4LB5A 5DCFA 3ULQB 2XRNA 2HXOA 1HW2A 4IQJA 3M8JA 3B6AA 2VASA 3A01B 1OPCA 1GLNA 3E5QA 4XKVA 2DQRA 2O61A 3TOBA 2YU9J 1EA3A 2DFIA 3A1YA 2O3FA 4U88A 3J7AO 2W7NA 2P0WA 4A3DJ 2B9SA 3BC8A 5AONA 1XGSA 3P9IA 2BXZA 2VQHA 1B72A 4BY1J 1K4TA 2VJ4A 3HOXJ 1PUFB 1W4MA 1JTXA 3I59B 1TQPA 1ZG1A 3FZVA 4A69C 5D8KB 1SEUA 1PP7U 3AL0C 1ZTRA 4EGYA 3RYPA 5EZGA 1T38A 4KIBA 2EA4A 2DTRA 4I2OA 4KDPA 3CESA 3MD2A 1JJ8C 3G3ZA 1BOBA 1S29A 4LLLA 5J8CA 5GAEJ 3ZMVA 2R7UA 2DMTA 3DU6A 1LE8A 4KMUX 1V5GA 2RNGA 3GZ6A 4ZTFA 2J5OA 1HQCA 1OYYA 2GWRA 2YX7A 2KLOA 3FX3A 2WV0A 3KYCB 5KAFC 1S7AA 2PMZN 2ZSHB 4P9UA 4XLHA 3SYTA 3ZMTA 1I3QJ 3VSKA 2ZC2A 2GOXB 3NQOA 2OJED 3GTLJ 2OCEA 2IS6A 4E7SA 1W36C 4M6XA 3QPHA 2R5ZA 1QZEA 4U0WA 4ESBA 4L9JA 2VBZA 3IAM2 3SEZA 2VOOA 1QHGA 5ILSA 3PIOF 1R4NB 1SD7A 4BYYA 2MA3A 3PO2J 1ETVA 5DEQA 2Y2ZA 1QVUA 5E8IA 2A07F 1IN4A 2GXBA 1B9NA 5EG0B 2HYJA 2AQEA 2EZKA 4HF0A 2IW5A 1SANA 2CUEA 2O0YA 3HSRA 4M72A 2M7AA 4UUVA 2CG4A 1FIAA 2MBFA 3Q3SA 2BVLA 2NVUB 3A01A 2ECCA 2QYOA 2Z1DA 3BT9A 3GVAA 2CQKA 3EQLF 3J81K 4IX7A 3KP6A 2ME6A 4IKFA 4HSRA 1WSUA 1W7PD 1WJFA 4PUSA 2NVQJ 3S2HJ 2VC0A 1HXDA 3ABKH 1FP2A 2HTSA 3C2BA 1YTYA 2F5FA 4CCNA 1XD7A 4XQFA 1T39A 2Y9ZA 4XRSA 1PUFA 3OR1C 3M4OJ 3I59A 4AIJA 2K5CA 1NH3A 1HOMA 4WCGA 2UV1A 4HX8A 4XRMA 2VI6A 3IP4B 2PJPA 4QPQA 3QPTA 3VSLA 1NK3P 2DPUA 1D1AA 2QQ9A 5CPRB 4PGGA 1ZLKA 2HZTA 1R36A 2XVCA 4OIRF 2NYXA 4LLGF 1R7JA 3IC7A 4Y33A 3KX2A 4M3GA 2BXYA 5JI6A 1VTNC 1AOYA 1FOYA 4MO7A 2VJJA 4JBAA 4C3IJ 4BKXA 1D8JA 2X48A 2OC6A 3L00A 1FEXA 4UV9A 2GXGA 3KZIC 2V7FA 2E1OA 3CC4I 5H6QA 3J7ZI 2ELKA 3OYHA 3QPLA 1LEBA 2VKEA 3DEEA 5HODA 1IDZA 3NARA 5IP7J 2CW7A 3C1DA 3FXMA 2W25A 3RYRA 3JAMK 1G3TA 4C3JJ 5LHIA 3JTGA 1VQ4I 2K9MA 4JX6A 1FBSA 3OMYA 5L3EA 3ZCOA 4OIQF 5D5VB 4JP0A 2I8DA 3AG3H 5EG0A 3ZQCA 2DFEA 1SFEA 3DTKA 5IT9K 1RESA 2LP0A 3ECOA 4LG3A 2V9KA 4XLAA 2A3SA 3ZXSA 2KHMA 4BH9A 5DTDA 3OYEA 4OINF 4BXXJ 4KIFA 3N97A 3PFYA 2MC4A 4DJAA 3BTLA 4RM2A 2MH9A 1ETYA 2OBPA 3IHUA 1K78B 5K7ZA 2HYFA 4PJLA 1W5CC 2G9WA 5FLMJ 3ZN1A 3BG9A 4N4OB 3VEPA 1A31A 2VOPA 3H36A 4Y4RA 5F04A 5TRDA 4MQVA 4GCVA 3SHFA 3GTQJ 2R7QA 5GPCA 2EV5A 4FQGA 1ETWA 1NTCA 1ETXA 2M45A 3AKZA 3K70C 3HXLA 4GO1A 1YW8A 5FFZA 1Y0NA 1QZYA 3GYHX 4GXOA 5ILVA 2K85A 1TNSA 1X3ZB 1REPC 1R6RA 5FD6A 2P5LC 5F1RA 2K4BA 2QQ8A 2GA2A 1K4SA 2GIVA 1MBEA 1WJEA 1ZELA 2EILH 4B48A 4EJTA 4I02A 2HDWA 3CCJI 5FO5A 4KMFA 2IA2A 1JTYA 2JRTA 1HKTA 2F5DA 3CMYA 1IF1A 3B73A 2CS3A 3JAMZ 2KT0A 3EDPA 4HEA2 1UHMA 1U3EM 1FP1D 4IHYA 1UAAA 1T0FA 1XMKA 1VI0A 1X1CA 1ZAOA 4P1WA 1K7AA 1I6XA 2EZIA 2X1EA 3TW6A 5IT9Z 1YW9A 2NNNA 4AUXA 1OMIA 2JRMA 4M71A 3F21A 2ELHA 1BR1A 4JK1X 3RTRA 4HNTA 3ZN0A 2XB5A 1H8AC 1VQNI 4AIDA 3CCUI 4PJ0C 3TGNA 4IHTA 2DA7A 3TKYA 3SFIA 3PNYA 4I98B 2HQ5A 4CA0A 1T56A 2P7CB 3NEUA 3FHNA 5DS9A 2DJIA 3HIFA 4BBSJ 2IXSA 4B1RA 5HNHA 1HSJA 2CUFA 3PFIA 2VJ5A 2X0LA 4CZCA 1IN8A 4A6DA 3S3NA 2LY9A 1J59A 1VQ6I 5KHDA 5CJ9A 1XB4A 2JA7J 1ACIA 4PFOA 3P9KA 4E7JA 3BQZA 2OD5A 2PG4A 3BDDA 1K78A 1IUYA 4ZDLA 2M5WA 4PGHA 3BZCA 3L1PA 1FMWA 3LFKA 2HI3A 2K9SA 3FBIB 3CCQI 3S15J 5E3LA 4H4KC 1QPMA 4ITVA 1C0WA 1H9GA 5KCMA 3CUQC 4RAFA 5KK1A 3QRFF 2CQQA 1Z21A 1UZCA 3P9CA 3A0HC 2VXDA 1XX5A 1MSFC 5BOXA 3BG5A 3K9TA 3L09A 4KIGA 2A5YB 2MSYA 1WQ2A 2CV0A 5IY5H 4UVCA 5E20A 2X4HA 3BCBA 3AAFA 2FNPA 3BTJA 4XKWA 4XKBA 1DPUA 1Z6TA 4XONA 3GTKJ 1IXSB 2NNYA 5D5XB 3CD6I 3SXYA 4HV5A 2KKOA 3OYNA 5IP6A 4Q47A 2EQRA 1AU7A 2QSFX 5J1UA 1ZREA 2E2JJ 3H1CA 2XHKA 1EH8A 2Z16A 1UHWA 1DGWY 1LPQA 1E0EA 2H94A 2DYRH 5C44J 3EUHC 3Q9SA 2QZ8A 3M07A 2NVTJ 5IYCJ 3U1KA 4UXNA 2KJBA 3E7LA 3FDYA 4O6JA 1KONA 2ZBKA 4DYRA 1BOAA 3S1QJ 3LQQA 4B43A 1Y39A 4BU2A 3OYIA 2QSHX 2E7XA 3HC7A 1W0TA 5EDNA 1GDTA 3G1LA 2H1LA 3KEQA 3SZGA 1P9QC 3L7WA 1X2MA 4NQWB 1B8IB 4B3XA 1OCCH 2B0LA 2CUJA 1KQ0A 3KZZA 2K3PA 2R3SA 2L9VA 3EYYA 3M8EA 1O3QA 3A2KA 2DI3A 3CF5F 2RQQA 3FKJA 2Y9YA 1GVDA 1ZK8A 2XSJC 2H1KA 3V7CA 1SMTA 2YX4A 3CP8A 1LVAA 4XOTA 3BTIA 4Z2YA 4PK4A 1T6SA 3W6JB 1HBXG 1Y8QB 1HW5A 4J00A 5DUIA 2GQQA 3OYBA 2DDAA 2WY8Q 1SMYF 3HRMA 3V8KA 4I0AA 5BS6A 3JRAA 2XDVA 1MSEC 2MG4A 1R58A 3DF8A 4ESJA 2Y0SA 1IXCA 1Z91A 2DA2A 4ENKA 4N9IA 2JJ7A 4BQQA 1KQ9A 2CSOA 3KZYA 2X1CA 3SFZA 2R7TA 3FXQA 4GYGA 4BY7J 3TO9A 4RB0A 4HA8A 3S3OA 5FRMA 5EEAA 4OAZA 4HDUA 2K3FA 3OYJA 3MQ0A 2R7DA 3M8FA 1MZBA 2X51A 3HGGA 4FTHA 2IGOA 2JPBA 4RB2C 2FX0A 4A3LJ 2BOLA 3A4CA 3WGIA 4AU7A 5LGUA 3JREA 5GADJ 1QPIA 2H6CA 5CVIA 2HDDA 4F93B 4KUMA 3ZQIA 4A93J 3I0TA 2BY1A 2M7BA 4IOCF 5D6EA 3HTUA 4IOAF 5CVRA 2FBHA 3H5NA 2HVQA 1L3LA 4BS9A 4OMZA 2AHQA 1U78A 4HDVA 2HQRA 2V4JC 2XGXA 4QPOA 2KL4A 1GXPA 3FXJA 3HUGA 2JA8J 2CW8A 1B8IA 2DOAA 3WU2C 5JHUA 1BI2A 2DA3A 1G59A 4OIPF 1J0RA 2PX9A 1X58A 1SFXA 4ESFA 4J19A 2ME0A 2BV6A 3IWZA 4I76A 2GZWA 1I5ZA 4ZYEA 2FA5A 3K4CA 2HR3A 1FYMA 2FOWA 3JR9A 2IT0A 1HC8A 5TISC 4LIVA 2LSOA 3F72A 1Y8RB 4M74A 3U2RA 2BYVE 4CGZA 4WXDA 3KYDB 2ICWG 3BY6A 3WE2A 5JR3A 1ZRDA 4PZJA 4BQNA 3R0AA 2YS9A 3K4JA 5BMZA 1XMXA 4F52A 1MDMB 4DYCA 3OY9A 3TDZC 3CDLA 3CDHA 3HOYJ 3O8GA 2FUG2 4NUBA 1GUUA 1FOKA 5FKKA 5HS7A 3ECHA 5C4XJ 2DAOA 1IUFA 4NNJA 3LAPA 3CJNA 4P96A 4PSXA 3I4MJ 4LG0B 3PQKA 4BEHB 3ISPA 1ITYA 5M5YJ 4EJVA 1ZKGA 3I54A 4A3GJ 1WVRA 1DP3A 4MTDA 1QRYA 2VIXA 1E3OC 5J40A 4KFCA 1D1CA 1GV2A 1XG1A 4A3FJ 3LAJA 1ZH5A 4L5JA 2R0QC 1BN5A 2COMA 2W24A 2Z99A 3W2AA 2JSCA 4KITB 1YG2A 2RREA 2DA1A 2DT7B 1R49A 5H20A 1KU7A 1JUSA 2HTJA 2IVMA 3E5XA 4WK8F 4BHCA 2F2EA 3I58A 2DODA 3WGGA 4I0BA 4CDGA 1I1SA 1MBFA 5LD2C 5J1RA 1ZG3A 1SAUA 1DUXC 1X1DA 3KFWX 4UY8I 2G7UA 1UMQA 3TBIA 4WXHA 1A5JA 3A03A 4BE2A 2E1MC 2E19A 1TW2A 5EJCA 4RGRA 5L3FA 2BEOA 1TP4A 2IAIA 4JX5A 5E79C 2YSRA 4RMNA 4CCOA 2KIFA 2WAFA 3CZ6A 4IO9F 2ZJ2A 4ZDOA 2EFQA 3EYIA 2L9SA 4KT6A 2NXNB 2IBDA 3K4BA 1WZ2A 1T2KA 2VT2A 1VQ8I 1VQ5I 1K61A 1MBKA 2NOJB 2O5RA 1O4XA 3HSEA 5HOOA 2TDXA 3RPUA 1M1EB 2K9NA 3DEUA 3HEFA 1S9HA 3BWGA 3TO6A 2I5UA
chains in the Genus database with same CATH topology
2OCCH 2EIMH 2Y69H 5B1AH 3WG7H 1OCRH 1OCZH 5IY5H 2DYSH 2DYRH 3ASOH 1V54H 5B1BH 2EILH 2EIJH 3ABKH 1V55H 2EINH 3AG2H 3ABMH 2EIKH 3X2QH 2ZXWH 3AG1H 5B3SH 3AG3H 1OCCH 1OCOH 3ABLH 3AG4H 3ASNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC H;  2EIM H;  2Y69 H;  5B1A H;  3WG7 H;  1OCR H;  1OCZ H;  5IY5 H;  2DYS H;  2DYR H;  3ASO H;  1V54 H;  5B1B H;  2EIL H;  2EIJ H;  3ABK H;  1V55 H;  2EIN H;  3AG2 H;  3ABM H;  2EIK H;  3X2Q H;  2ZXW H;  3AG1 H;  5B3S H;  3AG3 H;  1OCC H;  1OCO H;  3ABL H;  3AG4 H;  3ASN H; 
#chains in the Genus database with same CATH topology
 3O6B B;  4N9H A;  1FX7 A;  2E36 A;  3MKL A;  1MDM A;  1R00 A;  4RA2 A;  1XC5 A;  2ZCW A;  1TQM A;  4CUG A;  1J9I A;  4BDY A;  4YFX F;  1VFC A;  2QGU A;  1BI1 A;  3ZQQ A;  2IS4 A;  3ROU A;  1QHH D;  1PJR A;  3PSI A;  1Z9C A;  1TT0 A;  1W5S A;  3CUO A;  2ZO4 A;  4IHX A;  4LG0 A;  4XID A;  5L3C A;  4BEH A;  5HDK A;  4KIC A;  1RIO H;  2BVM A;  3H0D A;  4LLN A;  3F6O A;  4CO8 A;  5LRR A;  2RC4 A;  1YX5 A;  3ZGK A;  3DPU A;  1ODD A;  4Q48 A;  2BHY A;  2DMN A;  3CCS I;  5JVG F;  1WI3 A;  3S17 J;  4B3A A;  2PJR B;  1QVT A;  2LDU A;  5D6F A;  4E7I A;  1YFH A;  4BNC A;  2O7O A;  3K1N A;  1IGN A;  5F08 A;  3F6V A;  3ABU A;  1WJB A;  2NS7 A;  4LIU A;  1MBJ A;  5DD4 A;  2GXA A;  1I1G A;  3FBN B;  2W48 A;  4HBL A;  4EEF G;  3GTJ J;  5E17 F;  1LFP A;  1WWX A;  2XAH A;  2QSG X;  4ZYD A;  3F3X A;  4HOB A;  4CCJ A;  2L9R A;  3OYF A;  5FLV A;  1RC9 A;  2Y0S N;  3HPG A;  1IV8 A;  3HTS B;  3FM5 A;  4HX7 A;  4MFE A;  2R5Y B;  2HU9 A;  1G6N A;  3QQA A;  4IL6 C;  2L4A A;  3DWL E;  1K6Y A;  1YQA A;  2FML A;  2NVY J;  5AIQ A;  1RNL A;  4FET A;  5IOY A;  3JTH A;  1ERD A;  3M9A A;  4BJ6 C;  3QYE A;  2IGK A;  3F23 A;  4BAC A;  2HEO A;  2X6O A;  4X6A J;  1EKE A;  1TC3 C;  1MW7 A;  4XK4 A;  3R6S A;  1R5G A;  2CGP A;  1KU3 A;  1P7I A;  1KGS A;  5KAI C;  4A0Y A;  3O3K A;  5FRN A;  2WAQ A;  1FC3 A;  1ON1 A;  4MTE A;  1JGG A;  1RPW A;  1WGX A;  1ZAR A;  3ZPL A;  2E60 A;  2CJJ A;  1IDY A;  5EGO B;  1IRF A;  1A35 A;  1G2H A;  2E71 A;  2ID3 A;  4KIS A;  4LJZ F;  3J7A Y;  2QM3 A;  2XAJ A;  2L7M P;  1DU6 A;  3BP8 A;  3MAJ A;  3MN2 A;  3H35 A;  1WCM J;  2Z2S B;  1DP7 P;  2MD5 A;  3EUK L;  3CLQ A;  1J2X A;  2FQ3 A;  1STZ A;  2XSD C;  5E1X A;  4YG2 F;  1OJL A;  1WJC A;  3C3W A;  2OCC H;  3S1N J;  1R1V A;  5J6X A;  3VYU B;  4D7N A;  3S8P A;  3WE3 A;  4ZYH A;  3GCM A;  2EIJ H;  3KPH A;  4AD9 A;  2XGD A;  5ERI A;  3V8L A;  5K7H A;  2HVR A;  2KIM A;  1TW3 A;  1WJD A;  1BI3 A;  2P6S A;  3DLL F;  3CCL I;  3JSP A;  3OYM A;  2X6W A;  1Z77 A;  4Y3O A;  3W6K B;  4PJJ A;  1P6R A;  5JLX A;  2M1B A;  3R61 A;  3BR3 A;  4GDF A;  2DW4 A;  2ESN A;  2ISZ A;  1XSV A;  2ECB A;  2DCE A;  1YX3 A;  2VKH A;  4EJU A;  3SQN A;  4F7Z A;  2R5Y A;  4EMS A;  3FKI J;  4ETS A;  4ASN A;  5ICC A;  2MLG A;  2M30 A;  3HGY A;  3ZRG A;  2LNB A;  2GA1 A;  2STW A;  1Y6I A;  4IHW A;  1BW5 A;  1APL C;  2GOM A;  3W6V A;  5GPA A;  2IEK A;  2E5N A;  2G0E A;  3OL3 A;  1YHQ I;  3S14 J;  1TZL A;  2LF7 A;  3BPX A;  2ISY A;  4MFD A;  3HHG A;  1OIS A;  3MKW B;  3K2Z A;  5EGO A;  5JHF A;  2VQL A;  2VLA A;  3LSM A;  2HYG D;  2KQR A;  2X1D A;  4JQF A;  2VQG A;  2XUB A;  2V6C A;  5DM6 F;  2QWW A;  4ZZD A;  1ETK A;  3HOU J;  1BJZ A;  4IPA A;  4R8H A;  1ZQ3 P;  4AIH A;  1IRG A;  3GFM A;  2E7W A;  3CP2 A;  3S1M J;  4JYK A;  2KMU A;  2EZH A;  3I3L A;  2QBY B;  1LQ1 A;  1DQU A;  4WX9 A;  5HDN A;  4NC6 A;  1L0O C;  1ZGJ A;  1OQY A;  1E3H A;  3GLX A;  1J75 A;  2F5C A;  3FIS A;  1F1Z A;  2XAQ A;  3CTA A;  1E2X A;  3OYA A;  1NG6 A;  3BCA A;  4Q5S F;  3C7J A;  3J81 Z;  2LKP A;  3FMR A;  2ADU A;  2P7V B;  4KA4 A;  3W3C A;  4HYE A;  2Q1Z B;  1U5T B;  2RNJ A;  2OTJ I;  3ZMS A;  4OAY A;  1H88 C;  1QZZ A;  2ZKZ A;  4ZYA A;  3LSG A;  2FMY A;  4RB3 C;  2UXX A;  3E0J B;  2GBY A;  4B47 A;  2DOE A;  4D7M A;  1SC7 A;  3CMM A;  3HRT A;  1ZHF A;  4O5V A;  3ZMD A;  3ZQL A;  1U9N A;  2K9L A;  1T95 A;  1A6Q A;  2V26 A;  4HNU A;  4V19 K;  1BR4 A;  2VPL A;  2BE5 F;  5HLI A;  2VXZ A;  4KN4 X;  1BL0 A;  3NAU A;  4E7K A;  4BAY A;  2LTP A;  3HG9 A;  3H9G A;  1Z3Y A;  4F92 B;  4CSW A;  3J80 K;  3D5L A;  3BRO A;  1D5Y A;  4EM1 A;  4WF2 A;  4OIO F;  4S05 A;  3WTX C;  1ON2 A;  4LD5 A;  4N4N B;  3WTY C;  4QLC U;  1YIT I;  1FYL A;  3F22 A;  3QP5 A;  3I55 I;  1OR7 C;  2F4O B;  2LK2 A;  4BXF A;  5B5E C;  2HWV A;  4AVP A;  5J4Y A;  4XOR A;  3LMM A;  3AL0 B;  2GLO A;  2W4S A;  3L2Q A;  2XKO A;  2L7K A;  1Y1W J;  4M6V A;  1JHF A;  3DTE A;  3KIO A;  4LMY A;  2LY2 A;  4XOP A;  2L0K A;  2JUC A;  4BL0 B;  4V2F A;  3DXJ F;  2HNH A;  2G7H A;  5E3N A;  2QBY A;  1FNN A;  1XS9 A;  4A3I J;  3FIW A;  3MWM A;  2FOK A;  2BHZ A;  1XDU A;  2XB0 X;  2OV7 A;  3CMA I;  2ID6 A;  3DKY A;  3CCY A;  5KVR A;  4RGX A;  5DUK A;  3OYD A;  3CCE I;  2L4M A;  2JQ7 A;  2LD5 A;  2E2I J;  2BY3 A;  2CU7 A;  3Q0V A;  4DBQ A;  1UG2 A;  5LRS A;  1USS A;  5FGM A;  2CQN A;  3HZJ A;  3WG9 A;  1J09 A;  1WPK A;  1U5T A;  1RKW A;  2A69 F;  1R5H A;  2XGC A;  2JA5 J;  4CHU A;  3TO7 A;  4EQQ A;  3BR1 A;  5K5Q A;  3UKG A;  5EEH A;  4C2U A;  3J80 Z;  2O8X A;  1CF7 B;  1U2W A;  4IVN A;  2E35 A;  5HVQ C;  1U8B A;  2D5V A;  2NS8 A;  3R0J A;  5D4R A;  2JSP A;  3AFH A;  1FJL A;  2WAQ N;  3JRG A;  3OS2 A;  3FXR A;  2VJI A;  1T08 B;  3E5U A;  2NRA C;  3CC7 I;  3OS1 A;  5D8L B;  2D1V A;  2XV4 S;  2ZME C;  3OSF A;  3FK6 A;  4FIS A;  4C2M J;  1QBJ A;  2WY7 Q;  3DEW A;  1IV6 A;  2DOF A;  4I7H A;  1LFU P;  4IHS A;  2B7E A;  1XGN A;  4CH7 A;  2F5E A;  5D5U B;  1BBY A;  5FB2 A;  1Z7U A;  5ICG A;  3LSK A;  4A2U A;  5LLQ A;  5LGT A;  2HOT A;  1FTZ A;  1D3Y A;  1KU9 A;  4HRI A;  2EFO A;  2PMH A;  2LRE A;  5HLT A;  4A0Z A;  3TP3 A;  3R60 A;  2HVS A;  2HPI A;  1Z6R A;  1B9M A;  1BC7 C;  3PUB A;  2EPF A;  3RZO J;  3NRV A;  3ZQ7 A;  2P6T A;  3S2D J;  3WHC A;  3ABM H;  3OV8 A;  1U8R A;  2VPR A;  2OQG A;  4DZJ A;  4ZH4 F;  4ENJ A;  4U0V A;  2Y0M A;  4DYQ A;  2DBB A;  4J01 A;  2R7V A;  1SD5 A;  1ETO A;  3RPU D;  4E70 A;  2RGV A;  1X4P A;  1YE9 A;  4C30 A;  4RS8 A;  2DK5 A;  2N8G A;  1BM9 A;  1IO2 A;  1GXQ A;  1MGT A;  1XDS A;  2Y75 A;  5FD5 A;  2Z33 A;  1Y1V J;  3KEY A;  3BTC A;  3L2R A;  2M4G A;  4BHP A;  2DMP A;  1HDD C;  3IH4 A;  3IUO A;  2ETH A;  4PDK A;  1XPX A;  2DO7 A;  1IXR C;  2JVH A;  3A0B C;  2HZD A;  1IN6 A;  4XLP F;  3TED A;  3T1B A;  1N77 A;  3W2V A;  2F48 A;  1VQL I;  1BA5 A;  3D5R C;  5K1Y A;  1JKQ C;  3MKZ A;  3JRF A;  2R7Z J;  4A5M A;  5BPI A;  2XRO A;  1I27 A;  1X3W B;  3WTT C;  3LSJ A;  1CF7 A;  2WA0 A;  1YI2 I;  3GTP J;  1W0U A;  3GTM J;  1XGM A;  3ML6 A;  2ZFU A;  4PSW A;  1UCR A;  2OZ6 A;  1FT9 A;  1ZRC A;  2MFZ A;  4JX4 A;  3H0G J;  2CMP A;  3IH2 A;  3V4G A;  1WHU A;  2EV6 A;  2K02 A;  3DTI A;  3ZOB A;  1TL8 A;  1K83 J;  1SAX A;  4RGS A;  2EWN A;  2CYY A;  5J1Y A;  2QF7 A;  1WFX A;  5GAG J;  4DOZ A;  4N0B A;  5HLG A;  3OYL A;  2V9V A;  5C4J J;  2R93 J;  2R7X A;  4A12 A;  1IW7 F;  1TTY A;  4U7D A;  1IZ1 A;  2KIQ A;  1LB2 A;  5JFR A;  5F64 A;  2XF5 A;  2LMD A;  4G7Z F;  3JRI A;  1ZRF A;  3LSR A;  1WKM A;  2M0C A;  3KLO A;  3LSH A;  5AIP A;  4UB6 C;  5EYR A;  3S2W A;  3HOZ J;  2HOS A;  1P2F A;  2ZXI A;  1ONV A;  1D5V A;  3WU0 A;  2V9P A;  5CLS A;  4E7Z A;  5HNF A;  1IJW C;  1A36 A;  1ORK A;  4O3M A;  2DK8 A;  1JKO C;  2W57 A;  1MBG A;  4BUP A;  2VC1 A;  3TMO A;  1NHA A;  2HFH A;  3Q9V A;  3ERE D;  2FXA A;  4ENN A;  2HPM A;  3QP6 A;  4XL9 A;  1OKR A;  2GAU A;  2L3D A;  3OL4 A;  2XAU A;  1Z3X A;  2MYS A;  1X19 A;  1HCR A;  2LY1 A;  3L9F A;  1TT5 B;  4ZZL A;  3DPT A;  3G1M A;  2QEX I;  2HDC A;  4G6D A;  4BJ5 C;  4YRV A;  2R92 J;  2QVO A;  3LNQ A;  1R1T A;  3BZK A;  4G7O F;  3GX4 X;  2CFO A;  4OU0 A;  4PFP A;  3OIQ A;  4B4C A;  4CYD A;  1S5L C;  4MNU A;  3RIR A;  2D2W A;  2E1C A;  3FM3 A;  1LUJ B;  3JRD A;  1Z1D A;  4NQW A;  1AHD P;  2UWM A;  3DP7 A;  4Q4Z F;  2OU2 A;  4A3J J;  3I4N J;  1LVK A;  3NWS A;  2CFX A;  2JN6 A;  3KCC A;  3WTU C;  5FLX K;  3QAH A;  1P92 A;  2FE3 A;  3U21 A;  1QO0 D;  1JKR C;  1ZN2 A;  1TWH J;  2V1X A;  2BW3 B;  4QTR A;  2EFN A;  2VN2 A;  5HS9 A;  3E6M A;  4XSZ F;  2E1N A;  2IGM A;  2PMZ A;  1RI7 A;  3RPQ A;  1B1B A;  1LEA A;  1O3R A;  1U6G A;  5DDG A;  3HKZ A;  2W82 A;  2JUG A;  2UXN A;  1LDD A;  5CKT A;  5M3F J;  1UST A;  1BIB A;  2D1H A;  4X1E A;  3M1E A;  2CRG A;  1BR2 A;  2DLL A;  2J5P A;  3IKV A;  3EET A;  2ZME B;  2LFB A;  2WC2 A;  3V7R A;  2FBK A;  4FAS D;  4M3F A;  1MMA A;  1FWZ A;  4GGG A;  3CUQ B;  3VFZ A;  1EV7 A;  3H3U A;  2CW0 F;  4BDZ A;  1Z7L A;  4XIC A;  2CV1 A;  2B63 J;  2UZK A;  2IS2 A;  4P9F A;  3OR2 C;  3WHB A;  4ZYG A;  3LA3 A;  5J47 A;  2Q2E B;  4BQA A;  1Z67 A;  4A3C J;  1YS6 A;  2HKX A;  2DTZ A;  4NB5 A;  4AYB A;  2LYC A;  2P5V A;  3RKY A;  1IN5 A;  3DBH B;  4MLO A;  4IJA A;  3CCR I;  2XGE A;  3CJR B;  1RRJ A;  4P55 A;  2Q0O A;  4YIR X;  5LHH A;  2L2O A;  1D0Y A;  2EA2 A;  2PBI A;  4CCK A;  1XMA A;  3BR6 A;  5J8F A;  2XC7 A;  4XMY A;  1TNT A;  5CVJ A;  4ON0 A;  2DPD A;  4OWR B;  4YFK F;  3S93 A;  2PFB A;  5FKM A;  2AS5 F;  1FMV A;  2YR2 A;  2H09 A;  3BG7 A;  3FXU A;  3K2A A;  3OS0 A;  1HKS A;  5LEK A;  3VB2 A;  1S8N A;  4BBR J;  2V6E A;  2R7S A;  5EZH A;  1JT0 A;  3GBG A;  3LA7 A;  3ZQF A;  1S7O A;  1TWG J;  3T8R A;  4BGD A;  4U0Y A;  3M3Y J;  3QYB A;  1I39 A;  4G7H F;  2MW8 A;  2RN7 A;  3ZMU A;  3PIP F;  1CQT A;  4RGU A;  1RZ4 A;  1WH7 A;  2E34 A;  2BW3 A;  2DA6 A;  2CQX A;  3ZP5 A;  4AIK A;  3E97 A;  1Y56 A;  1X4O A;  1FSE A;  2BY0 A;  1FYK A;  2DXI A;  4A5N A;  2VUM J;  2ELJ A;  4PCQ A;  2ZXJ A;  1RUO A;  2ZJR F;  3E6B A;  4RAG A;  1ZLJ A;  3HOW J;  5F0H A;  2DU9 A;  3VYS B;  2JPC A;  2FU4 A;  2EV0 A;  2BGC A;  3Q5F A;  4M9S A;  2FRH A;  5GAH J;  1G3S A;  3CUQ A;  1V55 H;  3ELK A;  1Z05 A;  4B44 A;  2O03 A;  3VOE A;  2P81 A;  3G73 A;  4LOC A;  4IF4 A;  3VWB A;  5CVV A;  1FSH A;  4IRH A;  2P8T A;  1MBH A;  4XR6 A;  2Q2E A;  1KYW A;  2QKM B;  5FRO A;  4DW6 A;  5JLW A;  3OSG A;  5J4V A;  5LFA A;  3OIP A;  2PN6 A;  3C2H A;  4V2G A;  4I99 C;  1YYV A;  3G1O A;  3HRU A;  4W1U A;  3GFJ A;  5FKO A;  4CYC B;  2QUF A;  5F0F A;  3HSF A;  1MKM A;  1T0F C;  3HL2 A;  5KNL A;  2COB A;  1QU3 A;  5F27 A;  2ZFW A;  4EV0 A;  1PDN C;  1MND A;  4XM3 A;  1B6A A;  4CCM A;  2VE8 A;  2Z5U A;  5D4S A;  3FXK A;  2M0M A;  4RAY A;  4IRG A;  4EM0 B;  1POG A;  4RLQ A;  5H6R A;  3PQJ A;  1P4W A;  1OFC X;  1MH4 A;  3EUH A;  4NBQ A;  1XTA A;  2KP6 A;  2LKX A;  2DFF A;  1U9O A;  3OYK A;  4FE7 A;  4ZDP A;  4AC0 A;  5CYV A;  2DYS H;  2NS0 A;  3U1D A;  5K5O A;  3MKY B;  5ILU A;  4QIW N;  5TGT A;  2KZV A;  1LDK B;  4C9Y A;  1YJW I;  3DFG A;  3PNT A;  2LKS A;  4Y15 A;  2YU3 A;  2TRT A;  2A68 F;  1GV5 A;  3PM1 A;  1N25 A;  3MMY B;  3V42 A;  4G94 A;  3P5J A;  2RAE A;  3KP2 A;  3CME I;  2ESH A;  4L18 B;  1JE8 A;  1HW1 A;  3K69 A;  2LG4 A;  1HDP A;  2JZY A;  1UEL B;  4HLY A;  1E17 A;  2QA4 I;  3TL4 X;  3PNV A;  1H9T A;  2E5Z A;  3GW2 A;  3EUA A;  2EIM H;  4JOM A;  1V3F A;  5CQG A;  1DDN A;  2HOE A;  3CLO A;  4GYI A;  2A61 A;  1MMN A;  3QOE A;  3LOC A;  3Q0U A;  2HS5 A;  3K6G A;  1Q1V A;  3D5S C;  2IJL A;  5JVT A;  1GHC A;  4YIF A;  5DM7 F;  3IV5 A;  3AG2 H;  2K40 A;  1TWA J;  2OZU A;  3BG6 A;  1TBX A;  1NG7 A;  3BZ6 A;  3RJP A;  3HDD A;  2X6Y A;  2A6T A;  2IA1 A;  2JWT A;  3I53 A;  1G4D A;  3D0S A;  4AVZ A;  1O7L A;  5C3E J;  2VBW A;  2K7L A;  1OYW A;  5IOZ A;  1MJB A;  2QCO A;  2IS1 A;  3BR0 A;  1VF9 A;  2A05 A;  2YUS A;  3ASO H;  2XAG A;  4RM3 A;  2O8K A;  4NC8 A;  2PJR A;  2GM4 A;  4CYC A;  2LOO A;  1MMS A;  3G6E I;  3ONQ A;  3KET A;  4RB1 A;  2FD5 A;  1NK2 P;  1WJA A;  2M2E A;  4XSX F;  5EEG A;  2OUM A;  2QQA A;  3B6C A;  3OOU A;  4MQ9 F;  3I56 I;  2ZXW H;  5M3M J;  4A3B J;  1HKQ A;  1Q1H A;  2AO9 A;  4ENM A;  4FHT A;  4QWQ A;  2LVS A;  1D8K A;  1MMG A;  2VBY A;  3HKZ N;  5BPD A;  1JJ6 C;  3GZ5 A;  5ICE A;  2BZT A;  2LR8 A;  2FBI A;  3BLY A;  1X2N A;  1P7J A;  4YII A;  5LGN A;  5DYM A;  3ZQH A;  4B09 A;  5IPA A;  2GIZ A;  1FIP A;  3SJM A;  3UNG C;  5D5W B;  4FX4 A;  4AM3 A;  1FOX A;  2E1M B;  2H27 A;  4MIM A;  1IRX A;  2JTV A;  4M6Y A;  3NWT A;  2EIK H;  1OYI A;  2L7Z A;  4ZC3 A;  3C18 A;  3SEQ A;  1J5Y A;  1YJ9 I;  1R22 A;  2DMU A;  2KRC A;  1W36 D;  4R1H A;  3GUD A;  1G3Y A;  1OCR H;  4P5O A;  2RV8 A;  4AYB N;  4HG2 A;  3S1R J;  3S3M A;  1HA8 A;  2R4G A;  3W2W A;  1WJ5 A;  2CH0 A;  4FT8 A;  1FLI A;  5E1W A;  4U87 A;  3HHH A;  1JUP A;  2I10 A;  2QEN A;  3HOV J;  4MEX F;  1RR7 A;  3GTO J;  3FMQ A;  2M87 A;  3REO A;  1JUM A;  1K79 A;  3F8N A;  4GRI A;  3RKX A;  3BQY A;  2XPW A;  3DLA A;  4II3 A;  4WWC A;  3JRH A;  1IRZ A;  2RKH A;  3GEZ A;  3E1S A;  1ZR4 A;  1QGP A;  2IGN A;  3S16 J;  3DCF A;  2FQ4 A;  5CQE A;  3G4S I;  2R7O A;  3RDI A;  2XIG A;  5EF6 A;  1F43 A;  3H92 A;  3RQI A;  5B66 C;  3GTG J;  2L7F P;  2V79 A;  1BJA A;  3VYR B;  5H2F C;  3OIO A;  2MH2 A;  4E4H A;  3ESW B;  1K6O A;  1QA6 A;  3MVP A;  1MH3 A;  5M5X J;  3BG3 A;  1FTT A;  1RR8 C;  2F5V A;  3PSF A;  1F4K A;  2EJR A;  1YS7 A;  1G3W A;  5FKN A;  4HX4 A;  4B8X A;  1MIJ A;  3JW4 A;  1X3U A;  1MNE A;  1Z0X A;  1LDJ A;  2K9Q A;  1YW7 A;  3F9K A;  4F3Q A;  2KFD A;  4NC7 A;  1W1W E;  4IHV A;  1LFB A;  2L01 A;  3LSI A;  1YRN B;  4EJO A;  3ERM A;  3IRQ A;  3GLL A;  3KLN A;  3JCU C;  5L3D A;  5LEJ A;  3MEX A;  3K10 A;  5GTH C;  2K86 A;  1A6I A;  4MEY F;  1YJN I;  3RSN A;  1VQK I;  1H0M A;  5F0C A;  1IG7 A;  1OCO H;  1HST A;  2L9N A;  4UNO A;  2M4K A;  1D0X A;  1MMD A;  4UUT A;  2M34 A;  2R7F A;  2WV1 A;  3VYT B;  5BNG A;  3GXO A;  3IRR A;  1TLH B;  4A6E A;  1PP8 F;  1N75 A;  3CO6 C;  5FKL A;  3BOQ A;  3E6C C;  3RKQ A;  2OAZ A;  4W97 A;  4L0Z B;  1PVE A;  3MZY A;  1J7K A;  4NDL A;  1RKT A;  1I3A A;  4CZZ A;  3PUF A;  2A6H F;  4F55 A;  2IPQ X;  3COA C;  1YIJ I;  1MNM C;  1HF0 A;  3LA2 A;  1VQP I;  3BJ6 A;  1OCP A;  3RKW A;  1R5I D;  2XKP A;  4L9N A;  1I50 J;  2ZSI B;  3CC2 I;  1O3T A;  3HPH A;  4XN0 A;  1XGO A;  5HLH A;  3GF2 A;  4XBF A;  3GME A;  4DZP A;  1GT0 C;  2M3A A;  3K4L A;  1SFU A;  4IEJ A;  4Y13 A;  1H89 C;  2EFP A;  1KU2 A;  4PJN A;  2L5Q A;  3K70 D;  1VND A;  4UV8 A;  2XRL A;  4IRI A;  3WTS C;  4XLC A;  4LGW A;  2STT A;  3VDX A;  1MJ9 A;  2W85 A;  2W84 A;  2LBF B;  4CCL A;  1LKX A;  1YIO A;  1SD6 A;  1BIA A;  1MD0 A;  5K7F A;  4IZZ A;  4D9J A;  2OA4 A;  2OQR A;  2RQP A;  4EM2 A;  1W7P B;  2LLK A;  3SDB A;  4ANJ A;  2H8R A;  3HBL A;  2VB6 A;  2F4I A;  2W00 A;  4ZJZ A;  2JMW A;  3DKW A;  4PJM A;  3CCV I;  1YRN A;  5BQT A;  5FJ8 J;  1BC8 C;  6PAX A;  1S72 I;  2PMU A;  4G12 A;  1KQ8 A;  1P4A A;  2F4M B;  2Z3Y A;  4U7B A;  2VQC A;  4D5C A;  4A3M J;  3MCZ A;  4FX0 A;  3F0C A;  3ASN H;  4II2 A;  3ZQG A;  2ZNY A;  3DV8 A;  3UR3 C;  1AWC A;  3T8T A;  2E2H J;  3CO7 C;  2NVX J;  4HLX A;  4DNC A;  3TDU C;  4AWX B;  2EBI A;  3DBL B;  4D0P A;  4EJW A;  3KE2 A;  3HM5 A;  1PUE E;  1ZGA A;  1R71 A;  1R1U A;  4HST A;  1TWF J;  1UJ8 A;  5IT3 A;  2JA2 A;  3V8J A;  4Y52 J;  2ZJQ F;  1B4A A;  4IXA A;  1BW6 A;  3FXO A;  2QKL B;  2NOG A;  1EJ9 A;  1VQ7 I;  2HXI A;  2QQB A;  4UVA A;  2LH9 A;  3PJR A;  1DGR M;  3L2V A;  1UB9 A;  2L02 A;  2MLK A;  4RBO A;  1SVM A;  2ZXH A;  1ZR2 A;  1T33 A;  3RI4 A;  2A5W A;  2WBM A;  4IQ4 A;  3H5R A;  4Y17 A;  4ZTJ A;  3QU3 A;  1ETQ A;  3TOA A;  4CXF A;  2M8E A;  3K4M A;  1RET A;  1X1B A;  2XF7 A;  2DQL A;  3KP3 A;  2DJN A;  3MFK A;  2MGQ A;  3QU6 A;  4S04 A;  2V1D A;  3WTW C;  4I6Z A;  1V54 H;  2VL8 A;  2RVC A;  2MC3 A;  2ZB9 A;  2O6G E;  4L0Y B;  2WTE A;  5E18 F;  3L2C A;  1QQI A;  3LFU A;  1IC8 A;  1JHH A;  2FF4 A;  5HDG A;  2PLY A;  2DMQ A;  4M9X A;  1XCB A;  4DGW B;  3GFI A;  1ULY A;  3OOP A;  3G71 I;  2LF8 A;  2KDZ A;  2VE9 A;  2LBF A;  2W1O A;  1LNW A;  3GO5 A;  4XLE A;  2OPT A;  1WRJ A;  2EZL A;  2OTL I;  3K0L A;  2HQN A;  2XPV A;  4XRF A;  4RLF A;  1O3S A;  2WB1 A;  1SFO J;  5B1A H;  2FNA A;  4G9Y A;  1A04 A;  1OCZ H;  2JVG A;  2DT5 A;  3V7S A;  3KYL A;  1W7P A;  2HGC A;  1YO5 C;  2DT6 A;  3DBR B;  4YFN F;  2VBX A;  3MZH A;  2BBY A;  3MZ8 A;  3CCM I;  3WTV C;  2KDO A;  3HUG B;  4M3E A;  2KPM A;  3F8F A;  3X2Q H;  4Z6Y A;  3ZR8 X;  1N78 A;  1S7E A;  3K4N A;  1D0Z A;  3ZMZ A;  1LJ9 A;  1YOV B;  1OLT A;  1KYZ A;  4BE1 A;  2NAZ A;  4EGZ A;  3QOD A;  3KP7 A;  4RAZ A;  4YEL A;  2Y69 H;  5IYD J;  3KP5 A;  5DV5 A;  2KIU A;  1ZYR F;  1VQM I;  3H9J A;  3TQN A;  1EH7 A;  1O7F A;  4HF1 A;  1R9T J;  3H9Q A;  4L5I A;  3G2B A;  3T0Y A;  2KJC A;  4QSH A;  2X6X A;  3SZP A;  1MJA A;  3D1N I;  2R7W A;  1CGP A;  3O2P E;  3IWF A;  4E7H A;  2PQ8 A;  4BQO A;  2F6C A;  2DFH A;  1JGS A;  2EB7 A;  1FOW A;  1VZ0 A;  2WAD A;  1JT6 A;  2P5K A;  4KT5 C;  1AKH B;  3PO3 J;  1F5T A;  2O9L A;  4KJZ A;  1IN7 A;  4HF2 A;  4XKC A;  1FBQ A;  3BJO A;  1SFK A;  5J3L A;  3QPS A;  5E3O A;  1TQI A;  2H6B A;  3I64 A;  4E7L A;  4HAM A;  4M3B A;  1SVL A;  2AXT C;  2XAF A;  2EH3 A;  3DU5 A;  2MAB A;  2JK3 A;  4XLN F;  2VT3 A;  4KNY A;  5HS8 A;  2R7R A;  4LFU A;  3PL8 A;  3H3V K;  3AG1 H;  3WGH A;  1KA8 A;  3ABL H;  3IL2 A;  1Y0U A;  4FCY A;  3OWT A;  5GTI C;  1B59 A;  4EAT A;  1FY7 A;  4BJT A;  1R23 A;  5L3G A;  5E1Z B;  2DN0 A;  2Q8K A;  3ABT A;  4XNF A;  2K27 A;  4HPQ A;  4HV6 A;  3IKT A;  2IRF G;  2OF7 A;  5B1B H;  4EVI A;  2IA0 A;  4UUS B;  2FEZ A;  1WI9 A;  3J7Y J;  2EIN H;  3JRC A;  3BJA A;  4TV7 A;  2BY2 A;  2EK5 A;  3O8H A;  2CUZ A;  4HQE A;  2XF6 A;  3LST A;  3LQR A;  1F36 A;  2HQA A;  2VKV A;  2WAE A;  4MHG A;  4RDU A;  5DD8 A;  3RZD J;  2JT1 A;  4UB8 C;  1V4R A;  3CJQ B;  3I9V 2;  4YEJ A;  3GZN B;  3OYC A;  3AG4 H;  3L2W A;  3TW7 A;  4WXC A;  2V1N A;  3H5A A;  1DPR A;  2RDP A;  4LB6 B;  3WG7 H;  3K1M A;  3FF5 A;  4A3E J;  3HYI A;  3JSO A;  4HQM A;  4XN3 A;  1T98 A;  1O57 A;  1WH5 A;  1U0J A;  3CJT B;  4E6K G;  2HOA A;  3E3V A;  5IYB J;  3DKX A;  2CV2 A;  2JA6 J;  2C6Y A;  4DIQ A;  3C2G A;  5IP9 J;  3B02 A;  3QYF A;  1JXS A;  2Y48 A;  4D1Q A;  1OR7 A;  3P7N A;  5FFX A;  1ENH A;  4A0X A;  4C2T A;  2DA5 A;  3K7A J;  5M5W J;  3LSP A;  4UVB A;  2KIS A;  3M7G A;  1ZGW A;  3DQV C;  3FMS A;  3R4K A;  3HJE A;  5ED4 A;  3WU1 B;  4X0G A;  3LL7 A;  4C3H J;  1DU0 A;  4A3K J;  2L54 A;  1AKH A;  2Y30 A;  1R4M B;  1X1A A;  2UUZ A;  2PEX A;  5FLX Z;  5A2Q K;  2DDB A;  3IH3 A;  3M1C A;  1FZP B;  4CIC A;  1FBU A;  1UHS A;  3BPV A;  2CWE A;  1P4X A;  1GVJ A;  4S0H B;  2VKD A;  1IAW A;  4LK1 F;  5TJJ A;  5F6F A;  2CO5 A;  2YPR A;  1VQ9 I;  1RUN A;  2X9D A;  4LIT A;  5DCM B;  2M9H A;  2Z9O A;  2DA4 A;  2PI0 A;  3K1P A;  5E8G A;  3H3Z A;  4M73 A;  1JKP C;  4LK0 F;  1VQO I;  2AQF A;  3N4M A;  2LRD A;  4BHB A;  3WTZ A;  2MD0 A;  3F8B A;  3I71 A;  4XLF A;  1FPQ A;  2XAS A;  3OYG A;  4UUS A;  3HOS A;  3JRB A;  2P4W A;  4DQ2 A;  1E3P A;  4L9T A;  3GWZ A;  3FXL A;  4MGR A;  5ICF A;  1PYV A;  1SVO A;  4KN7 X;  2ZNZ A;  4K2E A;  4D5F A;  4XRS G;  4ABZ A;  4FE4 A;  3TP0 A;  4G6Q A;  2K4J A;  1XSX A;  4BXU A;  3FWE A;  4M3D A;  3RQ4 A;  3I4P A;  4OOI A;  4I01 A;  3T5X A;  4L9V A;  2KZG A;  4G8X A;  4KYW A;  2ACJ A;  3EPZ A;  3I5U A;  3SDG A;  1BI0 A;  2ZME A;  4HW0 A;  1G8X A;  2X85 A;  3SZT A;  2D45 A;  1V5F A;  3CQZ J;  4HZF A;  5LHG A;  1B72 B;  2A6E F;  1AA7 A;  2ZJP F;  5A2Q Z;  1EH6 A;  3E6D A;  2IP2 A;  3U9G A;  3VPR A;  1OCT C;  3VOD A;  1W5T A;  1S3J A;  3Q0W A;  2KRF A;  1KZH A;  1F9N A;  4F91 B;  1HLV A;  3S32 A;  9ANT A;  1QNT A;  2M8G X;  3F8M A;  3WOD F;  1S6L A;  4GFB A;  5K5R A;  3QWL A;  2V1U A;  2FJ1 A;  3L2U A;  5CVU A;  5E3M A;  3FHZ A;  1YLF A;  3K4K A;  3IAS 2;  1T8I A;  3RCO A;  4Y7N J;  1SD4 A;  5F1J A;  1ZG5 A;  3LWF A;  2WB1 N;  3FK7 A;  3HOT A;  3KP4 A;  1UG0 A;  4L5E A;  3HRS A;  2H8W A;  1LE8 B;  3BR5 A;  3CDI A;  1TWC J;  4R79 A;  2CQ7 A;  2QLZ A;  5L3B A;  2EFW A;  4G6T B;  3N05 A;  3BR2 A;  5B3S H;  4DBR A;  4H0E A;  4NHJ A;  4M9Z A;  3CF2 A;  3A02 A;  4BE0 A;  2Y31 A;  3DPL C;  3F8C A;  5DCM A;  1UFM A;  5LBQ A;  1V5E A;  1I6H J;  3KEO A;  1U5T C;  2VOD A;  1XN7 A;  3QOP A;  2LC2 A;  2R5Z B;  3GFL A;  1XSD A;  2KRH A;  2VON A;  2XPU A;  2WWY A;  1EF4 A;  4HNV A;  1XCV A;  4OMY A;  2TCT A;  4I09 A;  1JI8 A;  1D1B A;  5GP9 A;  3HB9 A;  1X1P A;  4UHT A;  2HKO A;  2AXL A;  2FSW A;  4LB5 A;  5DCF A;  3ULQ B;  2XRN A;  2HXO A;  1HW2 A;  4IQJ A;  3M8J A;  3B6A A;  2VAS A;  3A01 B;  1OPC A;  1GLN A;  3E5Q A;  4XKV A;  2DQR A;  2O61 A;  3TOB A;  2YU9 J;  1EA3 A;  2DFI A;  3A1Y A;  2O3F A;  4U88 A;  3J7A O;  2W7N A;  2P0W A;  4A3D J;  2B9S A;  3BC8 A;  5AON A;  1XGS A;  3P9I A;  2BXZ A;  2VQH A;  1B72 A;  4BY1 J;  1K4T A;  2VJ4 A;  3HOX J;  1PUF B;  1W4M A;  1JTX A;  3I59 B;  1TQP A;  1ZG1 A;  3FZV A;  4A69 C;  5D8K B;  1SEU A;  1PP7 U;  3AL0 C;  1ZTR A;  4EGY A;  3RYP A;  5EZG A;  1T38 A;  4KIB A;  2EA4 A;  2DTR A;  4I2O A;  4KDP A;  3CES A;  3MD2 A;  1JJ8 C;  3G3Z A;  1BOB A;  1S29 A;  4LLL A;  5J8C A;  5GAE J;  3ZMV A;  2R7U A;  2DMT A;  3DU6 A;  1LE8 A;  4KMU X;  1V5G A;  2RNG A;  3GZ6 A;  4ZTF A;  2J5O A;  1HQC A;  1OYY A;  2GWR A;  2YX7 A;  2KLO A;  3FX3 A;  2WV0 A;  3KYC B;  5KAF C;  1S7A A;  2PMZ N;  2ZSH B;  4P9U A;  4XLH A;  3SYT A;  3ZMT A;  1I3Q J;  3VSK A;  2ZC2 A;  2GOX B;  3NQO A;  2OJE D;  3GTL J;  2OCE A;  2IS6 A;  4E7S A;  1W36 C;  4M6X A;  3QPH A;  2R5Z A;  1QZE A;  4U0W A;  4ESB A;  4L9J A;  2VBZ A;  3IAM 2;  3SEZ A;  2VOO A;  1QHG A;  5ILS A;  3PIO F;  1R4N B;  1SD7 A;  4BYY A;  2MA3 A;  3PO2 J;  1ETV A;  5DEQ A;  2Y2Z A;  1QVU A;  5E8I A;  2A07 F;  1IN4 A;  2GXB A;  1B9N A;  5EG0 B;  2HYJ A;  2AQE A;  2EZK A;  4HF0 A;  2IW5 A;  1SAN A;  2CUE A;  2O0Y A;  3HSR A;  4M72 A;  2M7A A;  4UUV A;  2CG4 A;  1FIA A;  2MBF A;  3Q3S A;  2BVL A;  2NVU B;  3A01 A;  2ECC A;  2QYO A;  2Z1D A;  3BT9 A;  3GVA A;  2CQK A;  3EQL F;  3J81 K;  4IX7 A;  3KP6 A;  2ME6 A;  4IKF A;  4HSR A;  1WSU A;  1W7P D;  1WJF A;  4PUS A;  2NVQ J;  3S2H J;  2VC0 A;  1HXD A;  3ABK H;  1FP2 A;  2HTS A;  3C2B A;  1YTY A;  2F5F A;  4CCN A;  1XD7 A;  4XQF A;  1T39 A;  2Y9Z A;  4XRS A;  1PUF A;  3OR1 C;  3M4O J;  3I59 A;  4AIJ A;  2K5C A;  1NH3 A;  1HOM A;  4WCG A;  2UV1 A;  4HX8 A;  4XRM A;  2VI6 A;  3IP4 B;  2PJP A;  4QPQ A;  3QPT A;  3VSL A;  1NK3 P;  2DPU A;  1D1A A;  2QQ9 A;  5CPR B;  4PGG A;  1ZLK A;  2HZT A;  1R36 A;  2XVC A;  4OIR F;  2NYX A;  4LLG F;  1R7J A;  3IC7 A;  4Y33 A;  3KX2 A;  4M3G A;  2BXY A;  5JI6 A;  1VTN C;  1AOY A;  1FOY A;  4MO7 A;  2VJJ A;  4JBA A;  4C3I J;  4BKX A;  1D8J A;  2X48 A;  2OC6 A;  3L00 A;  1FEX A;  4UV9 A;  2GXG A;  3KZI C;  2V7F A;  2E1O A;  3CC4 I;  5H6Q A;  3J7Z I;  2ELK A;  3OYH A;  3QPL A;  1LEB A;  2VKE A;  3DEE A;  5HOD A;  1IDZ A;  3NAR A;  5IP7 J;  2CW7 A;  3C1D A;  3FXM A;  2W25 A;  3RYR A;  3JAM K;  1G3T A;  4C3J J;  5LHI A;  3JTG A;  1VQ4 I;  2K9M A;  4JX6 A;  1FBS A;  3OMY A;  5L3E A;  3ZCO A;  4OIQ F;  5D5V B;  4JP0 A;  2I8D A;  3AG3 H;  5EG0 A;  3ZQC A;  2DFE A;  1SFE A;  3DTK A;  5IT9 K;  1RES A;  2LP0 A;  3ECO A;  4LG3 A;  2V9K A;  4XLA A;  2A3S A;  3ZXS A;  2KHM A;  4BH9 A;  5DTD A;  3OYE A;  4OIN F;  4BXX J;  4KIF A;  3N97 A;  3PFY A;  2MC4 A;  4DJA A;  3BTL A;  4RM2 A;  2MH9 A;  1ETY A;  2OBP A;  3IHU A;  1K78 B;  5K7Z A;  2HYF A;  4PJL A;  1W5C C;  2G9W A;  5FLM J;  3ZN1 A;  3BG9 A;  4N4O B;  3VEP A;  1A31 A;  2VOP A;  3H36 A;  4Y4R A;  5F04 A;  5TRD A;  4MQV A;  4GCV A;  3SHF A;  3GTQ J;  2R7Q A;  5GPC A;  2EV5 A;  4FQG A;  1ETW A;  1NTC A;  1ETX A;  2M45 A;  3AKZ A;  3K70 C;  3HXL A;  4GO1 A;  1YW8 A;  5FFZ A;  1Y0N A;  1QZY A;  3GYH X;  4GXO A;  5ILV A;  2K85 A;  1TNS A;  1X3Z B;  1REP C;  1R6R A;  5FD6 A;  2P5L C;  5F1R A;  2K4B A;  2QQ8 A;  2GA2 A;  1K4S A;  2GIV A;  1MBE A;  1WJE A;  1ZEL A;  2EIL H;  4B48 A;  4EJT A;  4I02 A;  2HDW A;  3CCJ I;  5FO5 A;  4KMF A;  2IA2 A;  1JTY A;  2JRT A;  1HKT A;  2F5D A;  3CMY A;  1IF1 A;  3B73 A;  2CS3 A;  3JAM Z;  2KT0 A;  3EDP A;  4HEA 2;  1UHM A;  1U3E M;  1FP1 D;  4IHY A;  1UAA A;  1T0F A;  1XMK A;  1VI0 A;  1X1C A;  1ZAO A;  4P1W A;  1K7A A;  1I6X A;  2EZI A;  2X1E A;  3TW6 A;  5IT9 Z;  1YW9 A;  2NNN A;  4AUX A;  1OMI A;  2JRM A;  4M71 A;  3F21 A;  2ELH A;  1BR1 A;  4JK1 X;  3RTR A;  4HNT A;  3ZN0 A;  2XB5 A;  1H8A C;  1VQN I;  4AID A;  3CCU I;  4PJ0 C;  3TGN A;  4IHT A;  2DA7 A;  3TKY A;  3SFI A;  3PNY A;  4I98 B;  2HQ5 A;  4CA0 A;  1T56 A;  2P7C B;  3NEU A;  3FHN A;  5DS9 A;  2DJI A;  3HIF A;  4BBS J;  2IXS A;  4B1R A;  5HNH A;  1HSJ A;  2CUF A;  3PFI A;  2VJ5 A;  2X0L A;  4CZC A;  1IN8 A;  4A6D A;  3S3N A;  2LY9 A;  1J59 A;  1VQ6 I;  5KHD A;  5CJ9 A;  1XB4 A;  2JA7 J;  1ACI A;  4PFO A;  3P9K A;  4E7J A;  3BQZ A;  2OD5 A;  2PG4 A;  3BDD A;  1K78 A;  1IUY A;  4ZDL A;  2M5W A;  4PGH A;  3BZC A;  3L1P A;  1FMW A;  3LFK A;  2HI3 A;  2K9S A;  3FBI B;  3CCQ I;  3S15 J;  5E3L A;  4H4K C;  1QPM A;  4ITV A;  1C0W A;  1H9G A;  5KCM A;  3CUQ C;  4RAF A;  5KK1 A;  3QRF F;  2CQQ A;  1Z21 A;  1UZC A;  3P9C A;  3A0H C;  2VXD A;  1XX5 A;  1MSF C;  5BOX A;  3BG5 A;  3K9T A;  3L09 A;  4KIG A;  2A5Y B;  2MSY A;  1WQ2 A;  2CV0 A;  5IY5 H;  4UVC A;  5E20 A;  2X4H A;  3BCB A;  3AAF A;  2FNP A;  3BTJ A;  4XKW A;  4XKB A;  1DPU A;  1Z6T A;  4XON A;  3GTK J;  1IXS B;  2NNY A;  5D5X B;  3CD6 I;  3SXY A;  4HV5 A;  2KKO A;  3OYN A;  5IP6 A;  4Q47 A;  2EQR A;  1AU7 A;  2QSF X;  5J1U A;  1ZRE A;  2E2J J;  3H1C A;  2XHK A;  1EH8 A;  2Z16 A;  1UHW A;  1DGW Y;  1LPQ A;  1E0E A;  2H94 A;  2DYR H;  5C44 J;  3EUH C;  3Q9S A;  2QZ8 A;  3M07 A;  2NVT J;  5IYC J;  3U1K A;  4UXN A;  2KJB A;  3E7L A;  3FDY A;  4O6J A;  1KON A;  2ZBK A;  4DYR A;  1BOA A;  3S1Q J;  3LQQ A;  4B43 A;  1Y39 A;  4BU2 A;  3OYI A;  2QSH X;  2E7X A;  3HC7 A;  1W0T A;  5EDN A;  1GDT A;  3G1L A;  2H1L A;  3KEQ A;  3SZG A;  1P9Q C;  3L7W A;  1X2M A;  4NQW B;  1B8I B;  4B3X A;  1OCC H;  2B0L A;  2CUJ A;  1KQ0 A;  3KZZ A;  2K3P A;  2R3S A;  2L9V A;  3EYY A;  3M8E A;  1O3Q A;  3A2K A;  2DI3 A;  3CF5 F;  2RQQ A;  3FKJ A;  2Y9Y A;  1GVD A;  1ZK8 A;  2XSJ C;  2H1K A;  3V7C A;  1SMT A;  2YX4 A;  3CP8 A;  1LVA A;  4XOT A;  3BTI A;  4Z2Y A;  4PK4 A;  1T6S A;  3W6J B;  1HBX G;  1Y8Q B;  1HW5 A;  4J00 A;  5DUI A;  2GQQ A;  3OYB A;  2DDA A;  2WY8 Q;  1SMY F;  3HRM A;  3V8K A;  4I0A A;  5BS6 A;  3JRA A;  2XDV A;  1MSE C;  2MG4 A;  1R58 A;  3DF8 A;  4ESJ A;  2Y0S A;  1IXC A;  1Z91 A;  2DA2 A;  4ENK A;  4N9I A;  2JJ7 A;  4BQQ A;  1KQ9 A;  2CSO A;  3KZY A;  2X1C A;  3SFZ A;  2R7T A;  3FXQ A;  4GYG A;  4BY7 J;  3TO9 A;  4RB0 A;  4HA8 A;  3S3O A;  5FRM A;  5EEA A;  4OAZ A;  4HDU A;  2K3F A;  3OYJ A;  3MQ0 A;  2R7D A;  3M8F A;  1MZB A;  2X51 A;  3HGG A;  4FTH A;  2IGO A;  2JPB A;  4RB2 C;  2FX0 A;  4A3L J;  2BOL A;  3A4C A;  3WGI A;  4AU7 A;  5LGU A;  3JRE A;  5GAD J;  1QPI A;  2H6C A;  5CVI A;  2HDD A;  4F93 B;  4KUM A;  3ZQI A;  4A93 J;  3I0T A;  2BY1 A;  2M7B A;  4IOC F;  5D6E A;  3HTU A;  4IOA F;  5CVR A;  2FBH A;  3H5N A;  2HVQ A;  1L3L A;  4BS9 A;  4OMZ A;  2AHQ A;  1U78 A;  4HDV A;  2HQR A;  2V4J C;  2XGX A;  4QPO A;  2KL4 A;  1GXP A;  3FXJ A;  3HUG A;  2JA8 J;  2CW8 A;  1B8I A;  2DOA A;  3WU2 C;  5JHU A;  1BI2 A;  2DA3 A;  1G59 A;  4OIP F;  1J0R A;  2PX9 A;  1X58 A;  1SFX A;  4ESF A;  4J19 A;  2ME0 A;  2BV6 A;  3IWZ A;  4I76 A;  2GZW A;  1I5Z A;  4ZYE A;  2FA5 A;  3K4C A;  2HR3 A;  1FYM A;  2FOW A;  3JR9 A;  2IT0 A;  1HC8 A;  5TIS C;  4LIV A;  2LSO A;  3F72 A;  1Y8R B;  4M74 A;  3U2R A;  2BYV E;  4CGZ A;  4WXD A;  3KYD B;  2ICW G;  3BY6 A;  3WE2 A;  5JR3 A;  1ZRD A;  4PZJ A;  4BQN A;  3R0A A;  2YS9 A;  3K4J A;  5BMZ A;  1XMX A;  4F52 A;  1MDM B;  4DYC A;  3OY9 A;  3TDZ C;  3CDL A;  3CDH A;  3HOY J;  3O8G A;  2FUG 2;  4NUB A;  1GUU A;  1FOK A;  5FKK A;  5HS7 A;  3ECH A;  5C4X J;  2DAO A;  1IUF A;  4NNJ A;  3LAP A;  3CJN A;  4P96 A;  4PSX A;  3I4M J;  4LG0 B;  3PQK A;  4BEH B;  3ISP A;  1ITY A;  5M5Y J;  4EJV A;  1ZKG A;  3I54 A;  4A3G J;  1WVR A;  1DP3 A;  4MTD A;  1QRY A;  2VIX A;  1E3O C;  5J40 A;  4KFC A;  1D1C A;  1GV2 A;  1XG1 A;  4A3F J;  3LAJ A;  1ZH5 A;  4L5J A;  2R0Q C;  1BN5 A;  2COM A;  2W24 A;  2Z99 A;  3W2A A;  2JSC A;  4KIT B;  1YG2 A;  2RRE A;  2DA1 A;  2DT7 B;  1R49 A;  5H20 A;  1KU7 A;  1JUS A;  2HTJ A;  2IVM A;  3E5X A;  4WK8 F;  4BHC A;  2F2E A;  3I58 A;  2DOD A;  3WGG A;  4I0B A;  4CDG A;  1I1S A;  1MBF A;  5LD2 C;  5J1R A;  1ZG3 A;  1SAU A;  1DUX C;  1X1D A;  3KFW X;  4UY8 I;  2G7U A;  1UMQ A;  3TBI A;  4WXH A;  1A5J A;  3A03 A;  4BE2 A;  2E1M C;  2E19 A;  1TW2 A;  5EJC A;  4RGR A;  5L3F A;  2BEO A;  1TP4 A;  2IAI A;  4JX5 A;  5E79 C;  2YSR A;  4RMN A;  4CCO A;  2KIF A;  2WAF A;  3CZ6 A;  4IO9 F;  2ZJ2 A;  4ZDO A;  2EFQ A;  3EYI A;  2L9S A;  4KT6 A;  2NXN B;  2IBD A;  3K4B A;  1WZ2 A;  1T2K A;  2VT2 A;  1VQ8 I;  1VQ5 I;  1K61 A;  1MBK A;  2NOJ B;  2O5R A;  1O4X A;  3HSE A;  5HOO A;  2TDX A;  3RPU A;  1M1E B;  2K9N A;  3DEU A;  3HEF A;  1S9H A;  3BWG A;  3TO6 A;  2I5U A; 
#chains in the Genus database with same CATH homology
 2OCC H;  2EIM H;  2Y69 H;  5B1A H;  3WG7 H;  1OCR H;  1OCZ H;  5IY5 H;  2DYS H;  2DYR H;  3ASO H;  1V54 H;  5B1B H;  2EIL H;  2EIJ H;  3ABK H;  1V55 H;  2EIN H;  3AG2 H;  3ABM H;  2EIK H;  3X2Q H;  2ZXW H;  3AG1 H;  5B3S H;  3AG3 H;  1OCC H;  1OCO H;  3ABL H;  3AG4 H;  3ASN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...