1YRNB

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnB00
1LFUP 4DZPA 4QTRA 4IHYA 2FD5A 3S1RJ 4BBRJ 2R5YA 2HI3A 4FISA 5J1UA 4ABZA 2M2EA 2DMQA 5K7ZA 2HOAA 3A01A 1I6HJ 3HDDA 5IP7J 5K7FA 4B3AA 4J19A 2PMZN 1RKWA 3L1PA 2FJ1A 4RDUA 2O9LA 1GV5A 4A69C 1XS9A 5IYDJ 2EZIA 4XRMA 2DA4A 2XGCA 1FTTA 3QQAA 2NVYJ 4FTHA 1CQTA 3NAUA 4I6ZA 3TP0A 3RQIA 2XPVA 3GTOJ 3CMYA 4XK4A 1X2MA 3BR2A 3OOUA 3Q0VA 2GBYA 3JR9A 2VKVA 4S0HB 1ZQ3P 2ME6A 3GTJJ 3S16J 3S15J 2N8GA 3LSJA 1JKPC 1WH7A 3FK6A 2RAEA 3IH4A 3HOYJ 4X1EA 1SANA 1U9NA 3HOUJ 3GBGA 2NVXJ 3HM5A 2DA5A 3CCYA 5M3FJ 4JX6A 2VUMJ 1I3QJ 3BTLA 4CYCB 2LKXA 3IV5A 3IH2A 1ITYA 3HOXJ 5GPAA 2DA1A 4D5CA 1APLC 3M4OJ 1JTXA 1IUFA 3H0GJ 1FJLA 3JRHA 3HOVJ 3ZQHA 2LLKA 4M6VA 3GTQJ 1JTYA 2CUFA 1X2NA 4LOCA 5FKNA 1ENHA 3FISA 5EDNA 1GDTA 3LNQA 5DS9A 4A3CJ 1B8IB 1X58A 2O7OA 5FKLA 1XC5A 3QPLA 1BJZA 3I4NJ 1FEXA 1B72A 1BW5A 1OJLA 4B1RA 5FLMJ 2DMTA 2DA6A 3BG9A 4JYKA 3TW7A 4M3GA 2DMPA 3A01B 1K83J 2ECBA 2M34A 2JA5J 3ZQFA 4QSHA 3S17J 2HYJA 1FIPA 3JRIA 2L7FP 1Q1VA 3JRFA 2XSDC 3GTGJ 3A03A 4HNVA 5FKOA 2GLOA 2O8KA 1NTCA 1ZR4A 1Z0XA 1W0TA 4JX4A 2VKEA 3VPRA 2Y9ZA 2OF7A 4W1UA 1UMQA 2NS8A 3ZQLA 1PUFB 1G2HA 4JP0A 2LY9A 4QIWN 2M0CA 1VNDA 1UG2A 2K9QA 2DN0A 3BTCA 4XIDA 3DEWA 4A3IJ 5C4XJ 1WPKA 2XPWA 3MVPA 4M3DA 5EGOA 4V2FA 2M9HA 2JK3A 3OIOA 2P81A 1HLVA 1MH4A 4MFDA 2Y9YA 3S1NJ 1MBGA 2E2IJ 4L5EA 2JA6J 5FLVA 1MBEA 3FIWA 1H88C 1T56A 1ZGWA 1K61A 2HQ5A 1FIAA 1DU0A 4A93J 1IRZA 2R7ZJ 5K7HA 2W48A 1ETXA 4M3BA 5EG0B 3E7LA 4B4CA 1ETVA 3PO3J 2QF7A 3K2AA 1ETOA 4EEFG 3LOCA 2AO9A 5IOZA 1JKOC 2WB1N 3ZOBA 4Y7NJ 2XRLA 1Y1WJ 3B6CA 2E19A 1TC3C 2HOTA 4A3DJ 3G1LA 5J1YA 2E1OA 2CJJA 3H3VK 2JWTA 1S7EA 2IEKA 1JUSA 3S1MJ 2DTZA 2GM4A 2R93J 3QPSA 1I50J 1E3OC 1AU7A 5F0FA 5EYRA 3LSPA 1ZR2A 5J3LA 5FJ8J 3S1QJ 2NS7A 5C44J 2IAIA 1U8BA 1R9TJ 1UHSA 2K40A 3Q0WA 2X6OA 3BTIA 2XGEA 3GTPJ 5EGOB 3BQYA 2CQXA 4XRSG 4C3HJ 1QVTA 3WHCA 1F43A 4MIMA 5BNGA 3BG5A 1HOMA 2MGQA 1RESA 1MSFC 5EF6A 1PUFA 1TWGJ 1JKQC 2JMWA 4AUXA 2R0QC 5J1RA 4AYBN 2WV1A 5JLXA 2CU7A 5JLWA 2X48A 5E3MA 4XRSA 3D1NI 1TWHJ 1GVDA 3Q3SA 4BY1J 3HKZN 4G12A 5IP9J 1JUMA 1IG7A 3TP3A 3HOZJ 1BA5A 4FE4A 5IPAA 2DJNA 2DMUA 5GP9A 1MBJA 2L9RA 3GTKJ 1OCPA 1MNMC 9ANTA 2AHQA 4IHWA 2LR8A 1HCRA 2Y0SN 5C3EJ 1NK3P 1IDZA 3B6AA 4MLOA 5EG0A 2EZKA 2ECCA 4MFEA 5F1JA 1RETA 1IJWC 2M8GX 3BT9A 3FK7A 1JGGA 3TW6A 3A02A 3BR5A 1QRYA 2EQRA 5EZGA 4A3EJ 3JRDA 3S2HJ 5F04A 1OFCX 2YS9A 4AC0A 1LE8A 5EZHA 3IH3A 2KT0A 2DA3A 2MW8A 4BKXA 3JRCA 2HDDA 1TWFJ 1POGA 3TEDA 1VF9A 2EH3A 5M3MJ 1AHDP 1H89C 4IHVA 2TCTA 2HOSA 5E3OA 1IV6A 1RR7A 2DMNA 4A3MJ 4BY7J 1WI3A 4BXXJ 4C3IJ 3RZDJ 1LE8B 4W97A 3SDGA 2XB0X 3SJMA 4DYCA 5M5XJ 2HXIA 3CDLA 2CUEA 1XG1A 3O8GA 5FKMA 3RZOJ 2DA2A 4RBOA 3BG3A 5GPCA 2MSYA 1JKRC 3BR0A 5IYCJ 3OSFA 3HB9A 1AKHA 2XGDA 3BQZA 4UUSB 2NVQJ 2IBDA 2CRGA 4A3KJ 2JN6A 2LVSA 3SFIA 2ID3A 2LTPA 1HDDC 2G0EA 2LFBA 3MN2A 2KDZA 3NARA 2XPUA 3S14J 4A3BJ 4GFBA 1YRNA 2H8RA 1A6IA 1HDPA 1ETYA 1WH5A 1B8IA 1OCTC 2LD5A 2MG4A 1VFCA 3I4MJ 3PM1A 2CQQA 5IP6A 1GUUA 5F08A 2JA7J 2OPTA 1YRNB 1MH3A 2DA7A 2R5ZB 3BR3A 2LK2A 1JJ8C 4DYRA 3JRBA 1HF0A 1ZKGA 3S2DJ 2R5ZA 3LSRA 4M3EA 2L7ZA 2R5YB 4Y52J 3F0CA 3O8HA 2JJ7A 2EBIA 5E3NA 5HODA 1O4XA 4D5FA 1H8AC 1QPIA 3ZQIA 2JA8J 1A5JA 5DTDA 3JRGA 4D7NA 3BR6A 3BTJA 4BBSJ 2TRTA 1IC8A 3UKGA 2E2JJ 3ZQCA 4A3JJ 3CQZJ 4A3GJ 1T33A 4UUSA 4CYCA 4A3LJ 2X9DA 1JT0A 1AKHB 3OSGA 2FQ4A 2L0KA 1BW6A 2E2HJ 4D7MA 1ETWA 3WHBA 3W6VA 1Y1VJ 5F0HA 3Q0UA 4DZJA 4M3FA 1LFBA 2Y30A 4C2MJ 2R92J 3K7AJ 1ZK8A 3HEFA 1GT0C 1WCMJ 3BR1A 2ZB9A 2QCOA 5C4JJ 3GTMJ 2YU9J 1F36A 1SFOJ 1TWCJ 4FE7A 4A3FJ 4I76A 3RKQA 1JT6A 3LSGA 4DYQA 4FCYA 1Z77A 1JJ6C 1U78A 2FX0A 1P7IA 1QVUA 2VI6A 3HBLA 5IYBJ 1TWAJ 5F0CA 1NK2P 1RKTA 2YUSA 2Y2ZA 3HGGA 4V2GA 2LP0A 1ORKA 3FKIJ 2NVTJ 2H1KA 5E3LA 1W0UA 3JREA 4JX5A 2I10A 1BL0A 1WGXA 1U9OA 2ME0A 3G1OA 3ZQGA 3MKLA 3HOWJ 2B63J 3JRAA 2K9SA 4MO7A 1JUPA 4IHXA 2ID6A 5EEAA 1FTZA 2HXOA 5FKKA 4IEJA 4DW6A 2ELKA 2EZLA 2VPRA 1MBHA 3C2BA 1D5YA 1RPWA 3DCFA 4C3JJ 3M3YJ 3HGYA 2XB5A 4UUTA 1ZTRA 1IGNA 4NDLA 1ETKA 3G1MA 1VI0A 5IOYA 2EZHA 1MSEC 2WAQN 3GTLJ 1MBFA 1P7JA 1ETQA 4XICA 5F27A 1IDYA 4X6AJ 1GV2A 1DU6A 2NOGA 2COBA 3PO2J 2D5VA 2K9NA 5M5YJ 2Y31A 5M5WJ 1EF4A 2L7MP 1B72B 1MBKA
chains in the Genus database with same CATH superfamily
4KISA 3H9JA 3CC4I 3TQNA 5H6RA 4QTRA 1HW5A 4NQWB 3S93A 2V7FA 2HI3A 3QYEA 3DBHB 1AWCA 4UVCA 2RREA 5J1UA 3G2BA 2M2EA 3DPTA 4ABZA 4Q4ZF 5LHIA 1DP3A 5DV5A 3WODF 1VQ5I 2ZMEC 5K7FA 2PN6A 3RTRA 5D5XB 4M71A 1MJBA 3L1PA 1MNDA 3ZXSA 4RDUA 2O9LA 1GV5A 4A69C 2CGPA 4BH9A 5KNLA 5IYDJ 3A1YA 2EZIA 1IZ1A 2MYSA 2HVQA 1V5FA 1O3QA 2EWNA 3K0LA 3RI4A 1CQTA 3I53A 4EJUA 3ZCOA 3HJEA 3PQJA 4AIKA 3RQIA 2HYGD 1Z3YA 4R79A 5LFAA 3GLLA 3WTVC 4BE2A 5L3CA 3BR2A 2DFHA 3AG1H 3OOUA 3ABKH 2ME6A 2G9WA 2N8GA 2IVMA 1DGRM 3LSJA 4XNFA 1JKPC 3X2QH 4CO8A 5HS7A 5B1AH 4BU2A 4X1EA 2DDBA 1ZG5A 3CP2A 4P55A 4BYYA 1V3FA 2DBBA 3KX2A 3HM5A 1W4MA 3KP3A 2AS5F 1U0JA 3ULQB 2R7DA 3R0JA 3TKYA 5M3FJ 4BXFA 4CYCB 1JHHA 2LKXA 1YLFA 3IH2A 3Q9VA 2W4SA 5GPAA 1IRFA 3TO7A 3HOXJ 2RNJA 1BI3A 5DCFA 4DBQA 4I98B 1SAXA 3H0GJ 2OTJI 1W36D 2WB1A 3CUQA 3KEOA 4M9XA 2W85A 4CCLA 2V1NA 1QPMA 3ML6A 2F2EA 1LJ9A 5B1BH 2A68F 4LOCA 3SZTA 1KQ9A 2VQHA 1NG7A 3EUAA 1X58A 4I02A 2O7OA 3EYIA 5FKLA 5ILSA 1ERDA 1HA8A 1B72A 1OR7A 2KMUA 3FDYA 5K1YA 5FLMJ 2V1XA 1UAAA 4JYKA 3TW7A 3ZMUA 4KT6A 1RUOA 3KEYA 4XLNF 4ZZLA 2EK5A 2M34A 2JA5J 3GFLA 4KICA 1VQ6I 3MFKA 3JRIA 2L7FP 2HDCA 3ONQA 2Z99A 1IXRC 4HNVA 1KZHA 2OBPA 4A0XA 4BGDA 3K70C 3HHHA 1ZR4A 1FPQA 3ECHA 4IQ4A 5JFRA 1W0TA 3I59B 2L9SA 4RGXA 3VPRA 2QEXI 4W1UA 2JPCA 4X0GA 2IGKA 1ZARA 2OA4A 3ZQLA 3DEUA 3BDDA 1G2HA 2HKOA 2FSWA 3RPUA 3AAFA 3LAJA 3A0BC 4BQAA 5FGMA 4WK8F 3F23A 5CVJA 4XLCA 4BE1A 4EJVA 4UB6C 3DEWA 3LSMA 1Z9CA 3AL0C 3N05A 3BLYA 3K1NA 4YFXF 5C4XJ 2H27A 4I09A 4V2FA 3QWLA 2LSOA 2FA5A 4HA8A 5L3FA 3OIOA 2W57A 2ZFWA 4XLPF 3F8FA 4UVAA 5GTHC 4GRIA 4UV9A 4L5EA 2WAQA 1MBEA 3FIWA 1FLIA 1USSA 1ZGWA 2X1EA 3EDPA 4D9JA 1FIAA 1DU0A 1IRZA 4RM3A 2W24A 4CUGA 4BJ5C 5EG0B 3RYRA 3E7LA 3PO3J 1ETVA 2QF7A 2WADA 3LOCA 4UVBA 5IOZA 1JKOC 4O5VA 2CUZA 4LMYA 2HEOA 1RNLA 3I3LA 2QBYA 2K3FA 2P8TA 5LLQA 3PNYA 1Y1WJ 4IF4A 2VPLA 4KIGA 4EV0A 2HOTA 2GQQA 3G1LA 4ESFA 5J1YA 1X1BA 3J7YJ 4CHUA 4A0YA 4E70A 2F5DA 5ICEA 1S7EA 1J2XA 1TW3A 2HPIA 1D0YA 3KEQA 2HOEA 3IP4B 3CCRI 2DTZA 4CZZA 1IF1A 3BP8A 1U5TC 3ABTA 3QPSA 4PZJA 4RGUA 5HDGA 1AU7A 5F0FA 2MLGA 3IUOA 5EYRA 4EGYA 1V5EA 1PP7U 3E6MA 1OMIA 5J3LA 1LVKA 2BHZA 3BPXA 4BEHB 3T8TA 4C2TA 1R9TJ 3S1QJ 4LLGF 2ZMEA 1XGNA 1T39A 1UHSA 1YW7A 4OWRB 3ZR8X 2BY3A 3Q0WA 2VJIA 2XGEA 3FXRA 2QYOA 1RIOH 3GTPJ 3A0HC 2CQXA 4XRSG 2K9MA 3FM5A 1T38A 4LG0B 4C3HJ 1MKMA 3RIRA 1QVTA 2NYXA 1F43A 4MIMA 3D5RC 3NEUA 4R1HA 3D0SA 3SEZA 2MGQA 4S04A 3VDXA 3U2RA 2E1CA 1MSFC 4H4KC 4TV7A 3K4LA 1TWGJ 2E71A 3JAMZ 3M07A 1BM9A 4ZDLA 3B02A 3KLNA 3OYMA 2KKOA 1TWHJ 1LDDA 2WTEA 3PL8A 2X85A 1FWZA 4CICA 3QRFF 5BOXA 1ACIA 3R6SA 5IP9J 3FXMA 1PYVA 3I55I 1IG7A 2A5WA 1BA5A 3KP6A 4IRGA 2DJNA 4XKWA 3VSLA 2V1UA 4NC8A 4L5JA 2L9RA 3E97A 1X4OA 2HQNA 4RM2A 3FHZA 2OV7A 3CLOA 3ZGKA 2FEZA 2PX9A 1K78A 2K27A 3OWTA 1IRGA 4Z2YA 3HZJA 2LR8A 2RN7A 2A6TA 1FP2A 3OV8A 4MLOA 4U7BA 3AL0B 3I9V2 1TT0A 1A31A 4Y13A 2VQCA 3VYRB 1IJWC 2VJJA 2DDAA 1K6YA 4XL9A 5D4RA 3ZQ7A 1JGGA 2A6HF 2OQRA 4LGWA 4PSWA 5GADJ 2EQRA 4A3EJ 4EM0B 3JRDA 1G8XA 4I0BA 4G7HF 3J7ZI 3OYJA 1XN7A 3IH3A 4CCJA 2Q0OA 1RC9A 2MW8A 4BKXA 4IKFA 4AIJA 5DUKA 3E5XA 3TEDA 1VF9A 2EH3A 2HKXA 3DKWA 2BYVE 4UY8I 1QNTA 4A6EA 1H89C 2CV2A 1OR7C 1S5LC 4AVZA 1WZ2A 4AWXB 1BR2A 3V7RA 4BY7J 3ZN0A 5HLTA 4RAFA 2LBFB 4BXXJ 4E4HA 4C3IJ 1DUXC 1T0FC 4HX8A 4IJAA 1WQ2A 2YX7A 4LFUA 4Q47A 1ZGJA 1KU2A 4YFKF 4B47A 5J8FA 3EQLF 3CP8A 5GPCA 2MSYA 4ANJA 4ZYDA 1SVMA 2FOWA 3TL4X 1AKHA 2XGDA 4KMUX 3BQZA 2F4IA 1ZRCA 1ZHFA 2XF6A 2QM3A 4HEA2 5DDGA 4XLHA 4A3KJ 1F5TA 3RKXA 2FBKA 2LVSA 2G0EA 3I71A 2DCEA 2ZXWH 5J4YA 5DYMA 4A3BJ 2X6YA 1DP7P 1ETYA 3A4CA 2JVHA 1X4PA 3ELKA 1I1GA 2LD5A 1G3YA 3HRMA 1TNTA 3I54A 5F08A 2OPTA 1YRNB 2DA7A 2F4MB 1BR1A 3BR3A 2ZCWA 5E8IA 2P5KA 3K70D 2K4JA 2MA3A 3M8FA 5CQEA 2K86A 4HPQA 3S2DJ 4FX4A 1T8IA 3LSKA 2DYSH 4Y52J 3M1EA 3F0CA 5IY5H 3KIOA 3WTXC 3DTKA 3CCJI 5LD2C 2EFWA 4ZC3A 2P5VA 2YX4A 4D5FA 3DBRB 1QU3A 4G7ZF 1A5JA 1IRXA 1QZZA 2JUCA 2E1MC 2X1DA 1WWXA 1TQPA 2GIVA 1HW2A 3KYCB 3ZQCA 3ECOA 2Y48A 2EILH 4OAYA 1BOAA 4A3LJ 4B09A 1R1UA 4IQJA 4PJLA 3OSGA 2JUGA 3R61A 3FXKA 1BW6A 2E2HJ 4EGZA 1Y1VJ 1U5TA 3S3MA 1PDNC 1H0MA 1TP4A 2DU9A 3D5LA 1ZK8A 2D45A 1UG0A 2IGNA 2V4JC 3ERED 3GZ6A 1ODDA 1WCMJ 2XAQA 4BHPA 2QCOA 5C4JJ 1SFOJ 1TWCJ 4BE0A 3TDUC 3J81Z 1SEUA 3O2PE 4I76A 5EEHA 2GXBA 1U78A 1P7IA 3HTSB 1GXQA 3DF8A 3K1MA 3F8CA 4HQMA 2YUSA 2Y2ZA 4UXNA 4YELA 3WU0A 4HBLA 5J8CA 2QSGX 4AIDA 2A69F 1TW2A 3FKIJ 1QHHD 2NVTJ 1U8RA 1GLNA 4JX5A 3WU2C 5EJCA 1WGXA 2RQQA 3WG7H 3PIPF 4IRIA 1U9OA 3GZ5A 5HS8A 3WG9A 1IN7A 2BVMA 1FOWA 2B63J 3JRAA 2K9SA 1FOYA 4DNCA 2ZXHA 2AXLA 3FHNA 3LA2A 3ZMDA 4HDVA 3S32A 2ZJRF 1K4SA 2ELKA 2VPRA 1YE9A 5D4SA 2QENA 4C3JJ 5AIQA 2QKLB 5F64A 3HGYA 2M30A 1ZTRA 1OQYA 4NDLA 1QZYA 1G3TA 3LAPA 1VI0A 2OUMA 2OZUA 2EZHA 3P7NA 4LG0A 3E5UA 1MBFA 4ZJZA 1ETQA 5LBQA 4XICA 1OCRH 3RDIA 3RKWA 2E5NA 2HVSA 5GAEJ 4P5OA 1SFKA 1O7FA 2Y0SA 4ZZDA 1BC8C 2M87A 3T1BA 3EETA 1OYYA 4HV5A 3MKYB 5E8GA 4KMFA 4IOAF 3ISPA 4E7KA 4HX4A 4QWQA 5CVUA 2R7VA 3OYFA 1LFUP 4RAYA 2X51A 3GLXA 4QPOA 3R4KA 2FD5A 2OU2A 1QO0D 3QP6A 2XDVA 4F52A 4II2A 4Q48A 4HAMA 2FNAA 1IN4A 1I27A 1T0FA 2JPBA 2EV0A 3J80K 1XSVA 2Z5UA 1IO2A 4B3AA 3PUBA 4P96A 5IT3A 1F1ZA 3MKZA 2PMZN 2WC2A 3K4BA 3SFZA 3H0DA 4BACA 3IHUA 4M9ZA 1FMVA 1BOBA 4KIFA 1YJWI 2AQFA 3W2VA 2DA4A 3QQAA 4MEXF 1QBJA 2X4HA 3TDZC 1IUYA 3NAUA 2OC6A 4XR6A 4ON0A 4CA0A 4WCGA 4XK4A 1KYWA 1WJBA 1X2MA 3GW2A 3JTHA 4J01A 4L18B 3Q0VA 2VKVA 4S0HB 1ZRFA 3S16J 3C18A 3S15J 2FQ3A 1P2FA 3I58A 2NAZA 1HW1A 1HBXG 3IH4A 4L0ZB 1U9NA 4Y33A 4PDKA 2BBYA 2NNNA 1CGPA 2KRCA 2YU3A 2KP6A 1WJDA 2GOXB 3S3NA 4KIBA 4AVPA 4UHTA 3QYBA 4JX6A 4ZTJA 1I3QJ 3HRTA 1IV8A 4ZYEA 1ITYA 1ZLJA 3HOSA 1N25A 2DA1A 4D5CA 2PMZA 2Y0MA 2BV6A 1JTXA 2DOFA 2DYRH 2VQGA 2EFOA 3RKYA 4L9TA 5HNHA 1S8NA 2LLKA 4HQEA 2RQPA 2P4WA 1DGWY 1RRJA 3GTQJ 4G8XA 1JTYA 5L3GA 2CUFA 1S3JA 1SVOA 1GDTA 1WRJA 3V7CA 5BQTA 1B8IB 1H9TA 1XC5A 2NXNB 3FX3A 4BDYA 2ZJ2A 1XMKA 3AG3H 4RB0A 2DA6A 1KONA 1V4RA 4M3GA 3K6GA 2DMPA 2EIMH 3G3ZA 5LHGA 2HZDA 2R7FA 1ZREA 1Z7LA 1TNSA 3ZQFA 2HYJA 1ON2A 2PFBA 3RYPA 5D5UB 2XSDC 2LOOA 3ZMTA 4UB8C 1E17A 2NVUB 1CF7A 2GLOA 2O8KA 4E7IA 1OCCH 4CCKA 3P9KA 1BR4A 1YHQI 1UFMA 1HC8A 1XGOA 3T8RA 3GTKJ 2UV1A 1UMQA 5E17F 3ZRGA 3QODA 3OIQA 1STZA 1VQLI 4ENMA 2G7HA 2LY9A 4HLXA 1SFUA 2M0CA 2ETHA 3CC7I 1UHWA 1VQKI 1AOYA 3QYFA 1UG2A 3S3OA 2DN0A 3BTCA 5JI6A 4XIDA 1I3AA 4RAZA 4OMYA 3PIOF 3MVPA 2XPWA 1YQAA 5ERIA 1P6RA 4YIIA 3CCQI 2M9HA 2GZWA 2JK3A 3FBNB 1XGMA 4FQGA 1MNEA 4MFDA 2O0YA 3S1NJ 1A6QA 4ZYGA 5D5VB 2JA6J 1H88C 1WJ5A 2KFDA 4XMYA 3WGGA 2R7ZJ 1Q1HA 1V54H 3K1PA 4M3BA 4B4CA 5CVRA 3BZCA 2C6YA 1T08B 3PUFA 5DD8A 4BS9A 2QA4I 5CJ9A 4HLYA 4A6DA 2PJRB 1TC3C 3FXQA 4A3DJ 2QQ9A 4U7DA 4PUSA 3CF5F 4BNCA 2FU4A 3GWZA 2E1OA 2UUZA 2WWYA 1IN6A 2IEKA 2XAFA 3CMEI 4N4OB 3S1MJ 5CKTA 1FZPB 2WAFA 3H5AA 2R93J 3G71I 3DU6A 3TOBA 3LSPA 1ZR2A 5LRSA 3KYLA 2NS7A 1OCZH 3GFJA 2XHKA 2KHMA 4ZYHA 2UWMA 2I5UA 4IOCF 1FBUA 2D1HA 5CLSA 3E6DA 3BQYA 3CC2I 4HW0A 3OYDA 2KZVA 2JTVA 3BG5A 2VB6A 2HS5A 3H35A 2H1LA 1PUFA 2JMWA 1K4TA 4N9IA 1JKQC 4NHJA 5F1RA 1XSXA 4AYBN 3D1NI 4XRSA 2A3SA 2X48A 5E3MA 2JSPA 2ZXJA 3I0TA 3Q3SA 3H92A 4BY1J 3DTEA 2IA0A 3GFMA 1RZ4A 1LEBA 1JI8A 4GXOA 2IGOA 4IHSA 1JUMA 2OJED 2L01A 3PQKA 1S7AA 3KP7A 3F22A 2J5OA 2DMUA 3Q9SA 1MIJA 4ASNA 4LD5A 3K4NA 2LDUA 1W1WE 2BY2A 9ANTA 3BPVA 4KN7X 1LPQA 2AHQA 5HS9A 4IHWA 1HCRA 2W25A 4KITB 1OKRA 4HX7A 4KT5C 3B6AA 4Y4RA 4H0EA 3IC7A 4WF2A 2IS2A 4MFEA 2ECCA 5F1JA 1K78B 2CW7A 1Z6RA 2M8GX 2GWRA 3BT9A 4A2UA 2W7NA 2M7AA 3TW6A 1WI9A 2LYCA 4CH7A 5EZGA 1YFHA 3S2HJ 1DQUA 1YYVA 1TBXA 2PMUA 4CYDA 3CUQB 5EZHA 4XKBA 4XLEA 3E6BA 2DA3A 1KQ0A 1TWFJ 2Q8KA 5L3EA 4QPQA 3M1CA 3FXUA 3OYBA 4P9FA 1B9NA 1S9HA 4IL6C 1TQMA 1YJ9I 5GAGJ 2QSHX 2LC2A 4N4NB 4IO9F 2E35A 2H8WA 5H6QA 3OS0A 5E3OA 2XVCA 3C1DA 2JRMA 3RZDJ 1O3SA 4PJNA 3K10A 3BZKA 4LK0F 1GXPA 2XRNA 3KE2A 1XG1A 1BI2A 2DA2A 2BY1A 2EV6A 1UELB 2JA2A 5IYCJ 2VKHA 3NRVA 2VONA 5ICGA 4UUSB 5HLGA 2NVQJ 3QOPA 3CD6I 3REOA 2IBDA 2BXZA 3LSIA 3KLOA 3SYTA 4CZCA 2JN6A 3KCCA 1HDDC 3MN2A 4XONA 2XASA 1R1VA 2IGMA 4FX0A 1O3RA 2AXTC 4A0ZA 3S14J 1XDSA 3SQNA 1OISA 4CXFA 3PJRA 1WH5A 1OCTC 1FYMA 4LIVA 4II3A 4IPAA 1J75A 1REPC 3ZMSA 2E60A 2IS1A 1PVEA 1YI2I 2P7VB 2P6SA 2LK2A 3OS2A 1VQ4I 2L02A 4DYRA 2K3PA 1HF0A 4DQ2A 1ON1A 4NUBA 1BC7C 5K5OA 3F9KA 2R3SA 4ITVA 3HC7A 3HUGA 2OQGA 2CQ7A 3K2ZA 1BN5A 3EUKL 2LF8A 2JJ7A 3RCOA 5B66C 4GYGA 2CMPA 3IKVA 3C7JA 2VBWA 1H8AC 4K2EA 1QPIA 5DTDA 1S72I 1U6GA 3JRGA 3TGNA 3BR6A 2XROA 2FMYA 4NBQA 5GTIC 3LL7A 4B8XA 3UKGA 1EA3A 4G6TB 4A3GJ 1T33A 1FT9A 4UUSA 2KL4A 4CYCA 2X9DA 3MEXA 1JT0A 2ZXIA 1RR8C 3DKYA 2K7LA 3SHFA 4I01A 1YIJI 2R7XA 2L0KA 4D7MA 2ISYA 3W6VA 4E7LA 1XDUA 3HKZA 4LLLA 4DZJA 2KLOA 1LFBA 2STWA 2Y30A 2RGVA 1FC3A 1SFEA 2Z3YA 3EUHC 4FT8A 1XMXA 3BR1A 5KCMA 1HQCA 1UHMA 1QZEA 2PG4A 2M5WA 2LRDA 2Z9OA 1P4AA 4FE7A 3KP2A 2M4KA 3K4JA 4Y15A 1JT6A 3LSGA 3LSTA 3DWLE 1Z77A 3COAC 3IWFA 2DPDA 4OIOF 3HBLA 2VI6A 1PP8F 1R49A 3IRRA 4IHTA 1HSTA 1YS7A 2B7EA 2ADUA 3HGGA 1D8JA 1LNWA 1KA8A 2MC3A 1ORKA 1S29A 1MMNA 5FD6A 5E3LA 5AONA 3JREA 3LFKA 3HPHA 2ZJPF 2LKPA 4EATA 1EV7A 3ZQGA 5ICCA 5A2QK 3HTUA 5KAIC 1YG2A 2PBIA 3HOWJ 4MO7A 5KHDA 1SMYF 3HPGA 3NWSA 3WTUC 1ZELA 1R71A 3VYUB 3KP4A 1V55H 1O57A 1IXCA 2EZLA 3HXLA 1RPWA 2XB5A 1YW9A 1EH8A 4U88A 3V7SA 1TL8A 3AFHA 1M1EB 4U0WA 1A36A 2XGXA 1P7JA 2H09A 1YX3A 1ZG3A 2M1BA 3CF2A 3IAS2 4KJZA 4ZYAA 3PSIA 2ZJQF 3WE3A 2NOGA 4PJMA 3F72A 4WXDA 5FB2A 1YTYA 5E20A 4Q5SF 4RLQA 5ICFA 1D0XA 1LDJA 2GA1A 1EF4A 3SDBA 2L7MP 1S7OA 2F48A 1ONVA 2KIFA 2XIGA 3H9GA 1B72B 3VFZA 4RAGA 4KYWA 2V9VA 3OYKA 2KJCA 2V9KA 4GYIA 1FX7A 1C0WA 4IHYA 3HL2A 3GEZA 4GO1A 2L9NA 1VQOI 3S1RJ 4BBRJ 2R5YA 2R7WA 1D1AA 2GAUA 4YFNF 2DOAA 4XBFA 2PJRA 2HOAA 2R7SA 3J80Z 1IN5A 3HDDA 5IP7J 2FXAA 3H5RA 1MMDA 2L7KA 2VXDA 2PI0A 3ZN1A 1Z21A 3WTSC 2HNHA 4B43A 4KUMA 3I64A 2EFNA 2QVOA 3KZYA 1FOXA 3PFIA 2IS6A 1UB9A 4NC7A 1FTTA 2I8DA 2W1OA 4I6ZA 5FO5A 3TP0A 2FRHA 3P5JA 3GTOJ 3CMYA 3DKXA 4IXAA 2GBYA 3JR9A 3KZZA 1ZQ3P 3VOEA 2EFQA 5H2FC 4MEYF 2A6EF 2CO5A 4RB3C 2B0LA 2IPQX 3ZQQA 1F4KA 3MKWB 1WH7A 3FK6A 3LA3A 2V79A 1SANA 3VB2A 1X1PA 3HOUJ 2QWWA 3JCUC 3HRUA 4IVNA 4YIRX 4OIPF 4LB5A 2RNGA 1BI0A 2VT3A 4ENNA 2DA5A 3H1CA 1MMGA 2ELHA 4G6DA 2VUMJ 4LIUA 2JSCA 3F8NA 4XM3A 2O3FA 1APLC 3M4OJ 4YG2F 4DJAA 1IUFA 2HQAA 3BOQA 3JRHA 3HOVJ 3ZQHA 1ZAOA 3ZPLA 5K5QA 4HDUA 4M6VA 4XKVA 2DFFA 2L3DA 2EIJH 1SD7A 2L5QA 3BG7A 3FMQA 5EDNA 1TTYA 1K79A 3LNQA 4A3CJ 3QPLA 3I4NJ 1FEXA 2KIUA 1BJAA 2K5CA 1FY7A 3EUHA 3IL2A 2DMTA 2ISZA 1VZ0A 2WA0A 3BG9A 4PJJA 1G4DA 5DCMA 3A01B 1K83J 2Z2SB 4IRHA 2ECBA 4MHGA 1Q1VA 3JRFA 5HDNA 3GTGJ 3M9AA 3GXOA 5FFXA 4F93B 3AKZA 4E6KG 3IKTA 3L09A 1ULYA 2XUBA 5D8LB 4I99C 5HDKA 1TT5B 2A5YB 2HGCA 2OF7A 2CYYA 1VQMI 3HHGA 2R4GA 2E7WA 3R60A 1MGTA 2E1MB 1B4AA 4I0AA 1E3PA 4JP0A 4BJ6C 4QIWN 3KETA 1D3YA 2V9PA 4EMSA 1VNDA 2DT5A 3JTGA 1I1SA 3FM3A 3BROA 3MCZA 2FBHA 2F6CA 2EFPA 2MABA 4Y17A 2CQNA 3U1KA 3LA7A 3F8BA 3H36A 3V8JA 1TQIA 2IA2A 2VKDA 1Z7UA 1HLVA 2DOEA 1MH4A 1Z1DA 3IRQA 2Y9YA 4HYEA 2QKMB 1MBGA 2E2IJ 3MZ8A 2IXSA 3CJTB 5BPDA 2DJIA 5FLVA 3FF5A 2M3AA 4OIRF 2L9VA 2MH9A 1OLTA 1WJCA 4A93J 2QQ8A 4F7ZA 5B3SH 1FBSA 5K7HA 2W48A 1ETXA 4XRFA 2CS3A 2AO9A 2BVLA 1KYZA 2WB1N 3WGHA 4Y7NJ 2CFOA 3FXLA 5CPRB 2XRLA 1TZLA 2KRHA 3BCAA 4XSXF 2CJJA 3H3VK 1XD7A 5LHHA 2GXAA 4GDFA 1JUSA 1X3ZB 2X0LA 3VSKA 2QGUA 1MMAA 4N0BA 3S8PA 3JSOA 2CV1A 5JR3A 4ZDOA 2Y69H 2BW3A 2GM4A 1J7KA 1D8KA 2L4AA 3GYHX 3CCSI 1J59A 3E5QA 3QU6A 2NS0A 2ZSIB 4LG3A 2Z33A 3DPLC 1E3HA 5C44J 1UCRA 2IAIA 1JXSA 1I6XA 3ZP5A 1VQ7I 1HKSA 3BTIA 2M7BA 1K7AA 1U5TB 5EGOB 2CV0A 2EINH 3BZ6A 1JGSA 3KFWX 1LUJB 4FASD 4U0YA 2RKHA 1FNNA 3WHCA 1WJFA 2Z16A 1HOMA 5J4VA 4QLCU 2XAHA 2IW5A 3G73A 2ZBKA 1MJ9A 2HPMA 2R0QC 1IW7F 2E7XA 1QGPA 5JLXA 2CU7A 3CCVI 1GVDA 2B9SA 3SZGA 1HSJA 4G12A 4E7HA 1MDMB 3KPHA 5HNFA 2ESNA 4HF1A 5D5WB 1XPXA 1QQIA 4HV6A 4F92B 2F5VA 1XMAA 2FUG2 1D0ZA 4FE4A 4FHTA 5IPAA 4L0YB 3ZMVA 5GP9A 1MBJA 1LQ1A 1OCPA 3DLAA 3MD2A 3RPUD 3WTYC 1DPUA 2BW3B 5JVGF 1HKQA 2Y0SN 3LSHA 3W6KB 3CDHA 1NK3P 1IDZA 2HZTA 2EPFA 4ESBA 3QPTA 4AM3A 3MZHA 1RETA 3FK7A 4BDZA 4B3XA 3A02A 4CGZA 3A2KA 3HSRA 4Z6YA 1Z05A 1Z67A 4AC0A 3ASOH 3VODA 3L9FA 2F5CA 2KT0A 4AIHA 3Q5FA 2WY8Q 3P9CA 4BHCA 3JRCA 1YO5C 2E5ZA 2HDDA 3E3VA 5J40A 3CMAI 2ZNYA 2LF7A 2DPUA 4BQQA 1J9IA 1D5VA 3D5SC 5M3MJ 3PNVA 1AHDP 4IHVA 5LRRA 2TCTA 3BCBA 3TMOA 1RR7A 2A05A 2DMNA 4A3MJ 2ZO4A 2V1DA 3U9GA 4HOBA 2LREA 4XLAA 3C3WA 4OMZA 1LE8B 3V8KA 1N78A 4AU7A 2VJ5A 2XF7A 3SJMA 5M5XJ 2HXIA 1HXDA 3CDLA 2XF5A 4ETSA 1OPCA 4AYBA 4RB2C 2UXXA 3BR0A 3G4SI 3CJRB 5EEGA 2OCCH 3DTIA 5E1WA 1W7PD 2IA1A 4XSZF 2A07F 1GHCA 3SFIA 3BJOA 3BJ6A 2DFEA 2P6TA 2LFBA 3BJAA 4JK1X 4M6XA 3V8LA 1UZCA 3NARA 5CVVA 1V5GA 3TOAA 1YRNA 2H8RA 3N4MA 1HDPA 2CUJA 2GIZA 1LFPA 1B8IA 2FF4A 2UZKA 2XAGA 1VFCA 3PM1A 2CQQA 1SAUA 1GUUA 2OZ6A 2PEXA 4FETA 5F6FA 2LG4A 3BWGA 1MH3A 2X6XA 5HOOA 5L3BA 2XV4S 2A61A 1JJ8C 3PSFA 1FP1D 3JRBA 2PMHA 1ZKGA 4XOTA 3OYAA 1IXSB 4YRVA 3OL4A 4M6YA 4M3EA 4LK1F 4PGGA 4G9YA 3BC8A 5IT9Z 2DT7B 4PCQA 2O5RA 5KAFC 1NH3A 2CW0F 1MDMA 5E3NA 4EM2A 3I5UA 2DW4A 1O4XA 5JVTA 1SMTA 5LGTA 2QBYB 2JA8J 3AG4H 2G7UA 3NWTA 2J5PA 3OYLA 2BY0A 2H6BA 2R7UA 2TRTA 2NOJB 3FMSA 1IC8A 2E2JJ 4A3JJ 3CQZJ 4CCOA 2JQ7A 3OOPA 1AKHB 1G59A 1BI1A 2UXNA 1YJNI 1YS6A 2H94A 4OAZA 5TISC 3SZPA 1ETWA 2YR2A 3ROUA 2QLZA 2CH0A 1KQ8A 3Q0UA 4M3FA 3DU5A 1LKXA 2QZ8A 4F3QA 2R92J 3K7AJ 2ZKZA 4U0VA 4G7OF 2ZB9A 3GTMJ 4F55A 3RSNA 1ZG1A 4CDGA 3L2WA 4PJ0C 4A3FJ 3TO9A 3RKQA 3DBLB 2DAOA 4DYQA 3KZIC 2VASA 3K4KA 3LWFA 1JJ6C 1SD6A 1XCVA 4HG2A 3K4MA 1QVUA 1NK2P 1TWAJ 2EA4A 5CQGA 5FD5A 3GCMA 4RMNA 1P4WA 3TBIA 2F4OB 5FLXZ 1W0UA 3HSEA 4MQVA 2I10A 1R7JA 3GVAA 3BY6A 1SVLA 1X1CA 3WTZA 5FRMA 3J7AY 3FKJA 3FZVA 4XQFA 3LMMA 3ABMH 1T6SA 4N9HA 3HOTA 1JUPA 2ID6A 3KYDB 1FTZA 3CCLI 5FKKA 4IEJA 3UR3C 2MBFA 4D0PA 1D5YA 4JQFA 1ZYRF 5GAHJ 2VBZA 1UJ8A 2L54A 2MD5A 1YITI 4HNUA 4HSTA 1J0RA 3VYTB 2MFZA 1IGNA 2KIMA 2LH9A 3G1MA 1USTA 4BUPA 1FMWA 3PNTA 5IOYA 2RC4A 2VXZA 1MSEC 2WAQN 3GTLJ 1FOKA 4KN4X 2K02A 4XN3A 4BAYA 2LMDA 3RPQA 2XAUA 1XCBA 1GV2A 1DU6A 5AIPA 2ICWG 3VEPA 1R4MB 1B1BA 4LLNA 2K85A 4NNJA 4DOZA 5ILVA 5M5YJ 1F9NA 3OYCA 2ZC2A 4L5IA 5M5WJ 1Y0UA 2VC0A 3ERMA 3E6CC 3WGIA 5E1XA 2TDXA 5DM6F 2Q1ZB 1WFXA 4EJTA 1HKTA 2E34A 4DZPA 3CDIA 3CCMI 4MNUA 1OYIA 4FISA 4RGSA 2VE8A 4GGGA 3JW4A 3W6JB 1JE8A 3HRSA 2DMQA 3FWEA 3NQOA 5K7ZA 3A01A 2E36A 4L9VA 1I6HJ 3O6BB 4XOPA 3U21A 3U1DA 4A12A 4J19A 3GF2A 3L2CA 3QOEA 5H20A 1BBYA 1RKWA 4YEJA 2FJ1A 3K9TA 2BE5F 1QHGA 2PQ8A 1G3SA 1KU3A 1XS9A 1X1AA 3SXYA 2FNPA 4WWCA 3C2HA 4XRMA 2XGCA 4C2UA 1XSDA 2NVYJ 3LQQA 3WE2A 3M8JA 4FTHA 1R58A 2H6CA 1FSEA 2RVCA 2XPVA 2OAZA 4LJZF 2EB7A 4HSRA 1R00A 4I7HA 3E0JB 4YIFA 2Q2EB 3OMYA 4IZZA 3DPUA 3DV8A 1N75A 4EQQA 3GTJJ 2W84A 3QP5A 3JAMK 5TRDA 2CQKA 2RAEA 3HOYJ 2NNYA 2DXIA 1G3WA 3ZMZA 5KK1A 2P0WA 3GBGA 2D1VA 4PGHA 2LBFA 1LEAA 2KZGA 3FBIB 4NB5A 3MWMA 3LFUA 2JT1A 2HU9A 2NVXJ 4V19K 1X1DA 2WV0A 1E0EA 3CCYA 1CF7B 3DQVC 2V6EA 4PFPA 3BTLA 3FMRA 2VBYA 3IV5A 3GMEA 3VYSB 3DLLF 1Z91A 2DLLA 2VJ4A 2WBMA 1VQPI 2M0MA 2OD5A 1FJLA 4B44A 1W7PB 4OOIA 1DPRA 3DEEA 2W00A 2DK5A 1BIBA 1RI7A 1S6LA 1MMSA 3OYIA 5BS6A 1X2NA 6PAXA 2CG4A 1ENHA 5FKNA 3FISA 4D1QA 3WTWC 3EPZA 5DS9A 2EV5A 2MH2A 5HLIA 2FMLA 2KISA 2O8XA 5LEJA 1DDNA 2FOKA 4BQNA 1BJZA 1BW5A 2CSOA 1OJLA 3WTTC 4B1RA 5DCMB 3K69A 1X19A 3L2UA 1W7PA 2ELJA 2BZTA 2BHYA 4EVIA 2ZNZA 2MD0A 4BXUA 4QSHA 4O6JA 3S17J 1FIPA 1WSUA 4MTEA 1MW7A 4HRIA 3T0YA 3A03A 5DEQA 1NHAA 1Z6TA 5FKOA 2DO7A 2R7QA 3MAJA 1NTCA 1TLHB 4RLFA 3H9QA 1Z0XA 5E1ZB 1Y39A 4JX4A 2VKEA 1J09A 1ZN2A 2Y9ZA 1YIOA 3CCUI 2NS8A 2STTA 3QU3A 1QA6A 4EJWA 1R4NB 3F6OA 1Z3XA 5KVRA 2DT6A 2EA2A 1R6RA 1WVRA 2DQRA 1WJEA 1KGSA 2K9QA 2Q2EA 4RS8A 1YW8A 5JHUA 5A2QZ 4A3IJ 5DUIA 1WPKA 5EGOA 4M3DA 1SFXA 2O03A 2Y75A 2P81A 4F91B 2ZMEB 1P4XA 2ESHA 1NG6A 1L3LA 4E7SA 1EH7A 3CZ6A 3VWBA 2CFXA 1ZLKA 3GZNB 2HWVA 1T56A 2VQLA 4MTDA 1K61A 2HQ5A 2VE9A 1OCOH 1I5ZA 2PLYA 1IAWA 4E7ZA 2XKPA 3K2AA 1ETOA 4EEFG 2IT0A 2KDOA 3DP7A 2JZYA 3OYGA 3JSPA 1D1BA 1B6AA 3ZOBA 1FYKA 3J7AO 2VT2A 4XLFA 1T2KA 2ZFUA 3L2RA 4HNTA 5E18F 3OS1A 2L2OA 3PFYA 3B6CA 3HSFA 2E19A 2JRTA 5E79C 1PUEE 5B5EC 2KJBA 1A04A 2E1NA 4UUVA 4XN0A 4S05A 1U3EM 3CMMA 1MD0A 5LGNA 1Y6IA 2JWTA 1G6NA 3T5XA 4B48A 5CVIA 1XB4A 5LEKA 2LNBA 1KU7A 1O3TA 2W82A 1I50J 1E3OC 4KA4A 2WY7Q 5FJ8J 2KRFA 1U8BA 2LY1A 1H9GA 3CUOA 5D8KB 1WKMA 4ZTFA 3CTAA 4L9NA 2X6WA 2K40A 4ENJA 1Y56A 2YSRA 2X6OA 2MC4A 4M72A 1FBQA 4LITA 4R8HA 1Y0NA 1XTAA 3FXJA 3F21A 3CJQB 5BNGA 2ACJA 3L2VA 2HYFA 4ESJA 1GVJA 1RESA 4A5MA 4BEHA 5EF6A 4G6QA 1JHFA 5FLXK 4U87A 4AUXA 3RJPA 5J1RA 2GOMA 4MQ9F 2DQLA 2WV1A 3OYNA 5JLWA 1X3UA 4C30A 4PFOA 2WAEA 3DXJF 3EYYA 3HKZN 1SC7A 2NRAC 4HZFA 2KIQA 2DI3A 1R1TA 2XKOA 1P9QC 2VL8A 4BQOA 1I39A 1N77A 1U2WA 2HVRA 1VQ9I 3FXOA 3L7WA 5DM7F 3E1SA 3TP3A 1RUNA 3I4PA 3RQ4A 3HOZJ 1E2XA 1BIAA 1R22A 4LB6B 2PJPA 1MJAA 5D6FA 2LKSA 4OIQF 1R23A 3C2GA 1MNMC 1EJ9A 2IP2A 2K4BA 4DBRA 2XSJC 2AQEA 2RDPA 5C3EJ 4CCNA 1B9MA 2V6CA 2V26A 5EG0A 2O61A 2EZKA 2VBXA 3HYIA 1XGSA 4KDPA 3UNGC 4Y3OA 2BOLA 4DGWB 5D6EA 5FFZA 3IWZA 3M7GA 3TO6A 3BR5A 1QRYA 1OYWA 5F04A 4RB1A 1OFCX 1P92A 2YS9A 1LE8A 4NC6A 2EIKH 3GUDA 2HFHA 3V42A 3LQRA 3OYEA 3S2WA 2VOPA 3ABUA 1POGA 3OR1C 3ASNH 2X1CA 4XKCA 1IN8A 1SD5A 2XAJA 3GFIA 4C9YA 1LVAA 3CESA 1IV6A 1R5GA 1X3WB 2HOSA 5IT9K 5HVQC 2KQRA 2VODA 2D2WA 3M8EA 1VQNI 1WI3A 4W97A 5CYVA 2VN2A 3SDGA 2JVGA 3I59A 2XB0X 1K6OA 5ED4A 4DYCA 3ESWB 2VIXA 1LDKB 2CUEA 2MLKA 2IRFG 2BXYA 3O8GA 5FKMA 3W3CA 4RBOA 3BG3A 1A35A 3RZOJ 5L3DA 1JKRC 3GX4X 1EKEA 2QQBA 2BEOA 3OSFA 2M45A 1AA7A 3HB9A 5TGTA 3HIFA 2CRGA 3BG6A 4DIQA 3OYHA 4G94A 2ID3A 2LTPA 3CCEI 2CW8A 3B73A 4BHBA 2KDZA 1ZH5A 2XPUA 2FE3A 3K4CA 5HLHA 4GFBA 1EH6A 1A6IA 3F6VA 2IS4A 3IAM2 2KPMA 4CSWA 2MG4A 2IJLA 4BL0B 2COMA 2VOOA 4P9UA 3I4MJ 2HTJA 5IP6A 3QAHA 1W36C 3WU1B 3V4GA 2JA7J 4J00A 1W5SA 3MZYA 1FSHA 2P7CB 2R5ZB 2F5FA 3OR2C 4PK4A 3F3XA 2VC1A 3N97A 2BGCA 2M8EA 2QUFA 3HG9A 3L00A 4M73A 4RA2A 4CCMA 2R5ZA 3LSRA 3H5NA 1R5HA 2L7ZA 2R5YB 1YOVB 4M9SA 3O8HA 3OL3A 2EBIA 5JHFA 1R5ID 3DFGA 3GO5A 4ENKA 4EJOA 3CO6C 3F8MA 5HODA 4HF2A 3ZQIA 4OU0A 2HTSA 2L4MA 4D7NA 3CUQC 3W2AA 3BTJA 5J6XA 4BBSJ 1Y8RB 3H3UA 4JBAA 3SEQA 4KNYA 5FROA 2F5EA 1PJRA 3OY9A 1W5TA 3CO7C 4XORA 2CWEA 4UNOA 5ILUA 4BJTA 2FQ4A 1ZRDA 3W2WA 4AD9A 2HR3A 3WHBA 1SD4A 2R7TA 5F0HA 3CLQA 4C2MJ 2GA2A 2Z1DA 1PUFB 3HEFA 1J5YA 1GT0C 1R36A 3CJNA 1VQ8I 2DODA 2YU9J 1F36A 3AG2H 2LY2A 1KU9A 4MGRA 1YX5A 2M4GA 2DFIA 2GXGA 1WJAA 3MQ0A 4FCYA 3HUGB 3MMYB 2FX0A 2HDWA 5IYBJ 3G6EI 5F0CA 2P5LC 4EM1A 1RKTA 3O3KA 2YPRA 2R7RA 4V2GA 1W5CC 1XX5A 2DTRA 5FRNA 2LP0A 2QQAA 2OTLI 5BMZA 3L2QA 2VLAA 1FYLA 5LGUA 2H1KA 1MZBA 2R7OA 3P9IA 4OINF 4NQWA 1BL0A 4IX7A 1O7LA 1B59A 4ZH4F 4WXCA 2ME0A 3G1OA 2EJRA 1T95A 1ZGAA 3MKLA 2ZSHB 2HQRA 4WXHA 4IHXA 4A5NA 5J47A 5EEAA 2HXOA 2OCEA 3ABLH 4DW6A 4P1WA 1L0OC 1WHUA 5TJJA 4RGRA 4E7JA 2RV8A 3C2BA 1MBHA 5BPIA 4ZDPA 3DCFA 1D1CA 3M3YJ 2QSFX 4UUTA 1T98A 4WX9A 2FBIA 2O6GE 1ETKA 5K5RA 4JOMA 2K9LA 3OIPA 4GCVA 3QPHA 1LB2A 4M74A 5F27A 1IDYA 4X6AJ 2XC7A 4HF0A 4KFCA 4UV8A 3J81K 3I56I 2COBA 3KP5A 3PO2J 4PSXA 3H3ZA 3R0AA 2D5VA 2DK8A 2K9NA 2Y31A 1VTNC 1Y8QB 4I2OA 4O3MA 5DD4A 4L9JA 1MBKA
chains in the Genus database with same CATH topology
1LFUP 4DZPA 4QTRA 4IHYA 2FD5A 3S1RJ 4BBRJ 2R5YA 2HI3A 4FISA 5J1UA 4ABZA 2M2EA 2DMQA 5K7ZA 2HOAA 3A01A 1I6HJ 3HDDA 5IP7J 5K7FA 4B3AA 4J19A 2PMZN 1RKWA 3L1PA 2FJ1A 4RDUA 2O9LA 1GV5A 4A69C 1XS9A 5IYDJ 2EZIA 4XRMA 2DA4A 2XGCA 1FTTA 3QQAA 2NVYJ 4FTHA 1CQTA 3NAUA 4I6ZA 3TP0A 3RQIA 2XPVA 3GTOJ 3CMYA 4XK4A 1X2MA 3BR2A 3OOUA 3Q0VA 2GBYA 3JR9A 2VKVA 4S0HB 1ZQ3P 2ME6A 3GTJJ 3S16J 3S15J 2N8GA 3LSJA 1JKPC 1WH7A 3FK6A 2RAEA 3IH4A 3HOYJ 4X1EA 1SANA 1U9NA 3HOUJ 3GBGA 2NVXJ 3HM5A 2DA5A 3CCYA 5M3FJ 4JX6A 2VUMJ 1I3QJ 3BTLA 4CYCB 2LKXA 3IV5A 3IH2A 1ITYA 3HOXJ 5GPAA 2DA1A 4D5CA 1APLC 3M4OJ 1JTXA 1IUFA 3H0GJ 1FJLA 3JRHA 3HOVJ 3ZQHA 2LLKA 4M6VA 3GTQJ 1JTYA 2CUFA 1X2NA 4LOCA 5FKNA 1ENHA 3FISA 5EDNA 1GDTA 3LNQA 5DS9A 4A3CJ 1B8IB 1X58A 2O7OA 5FKLA 1XC5A 3QPLA 1BJZA 3I4NJ 1FEXA 1B72A 1BW5A 1OJLA 4B1RA 5FLMJ 2DMTA 2DA6A 3BG9A 4JYKA 3TW7A 4M3GA 2DMPA 3A01B 1K83J 2ECBA 2M34A 2JA5J 3ZQFA 4QSHA 3S17J 2HYJA 1FIPA 3JRIA 2L7FP 1Q1VA 3JRFA 2XSDC 3GTGJ 3A03A 4HNVA 5FKOA 2GLOA 2O8KA 1NTCA 1ZR4A 1Z0XA 1W0TA 4JX4A 2VKEA 3VPRA 2Y9ZA 2OF7A 4W1UA 1UMQA 2NS8A 3ZQLA 1PUFB 1G2HA 4JP0A 2LY9A 4QIWN 2M0CA 1VNDA 1UG2A 2K9QA 2DN0A 3BTCA 4XIDA 3DEWA 4A3IJ 5C4XJ 1WPKA 2XPWA 3MVPA 4M3DA 5EGOA 4V2FA 2M9HA 2JK3A 3OIOA 2P81A 1HLVA 1MH4A 4MFDA 2Y9YA 3S1NJ 1MBGA 2E2IJ 4L5EA 2JA6J 5FLVA 1MBEA 3FIWA 1H88C 1T56A 1ZGWA 1K61A 2HQ5A 1FIAA 1DU0A 4A93J 1IRZA 2R7ZJ 5K7HA 2W48A 1ETXA 4M3BA 5EG0B 3E7LA 4B4CA 1ETVA 3PO3J 2QF7A 3K2AA 1ETOA 4EEFG 3LOCA 2AO9A 5IOZA 1JKOC 2WB1N 3ZOBA 4Y7NJ 2XRLA 1Y1WJ 3B6CA 2E19A 1TC3C 2HOTA 4A3DJ 3G1LA 5J1YA 2E1OA 2CJJA 3H3VK 2JWTA 1S7EA 2IEKA 1JUSA 3S1MJ 2DTZA 2GM4A 2R93J 3QPSA 1I50J 1E3OC 1AU7A 5F0FA 5EYRA 3LSPA 1ZR2A 5J3LA 5FJ8J 3S1QJ 2NS7A 5C44J 2IAIA 1U8BA 1R9TJ 1UHSA 2K40A 3Q0WA 2X6OA 3BTIA 2XGEA 3GTPJ 5EGOB 3BQYA 2CQXA 4XRSG 4C3HJ 1QVTA 3WHCA 1F43A 4MIMA 5BNGA 3BG5A 1HOMA 2MGQA 1RESA 1MSFC 5EF6A 1PUFA 1TWGJ 1JKQC 2JMWA 4AUXA 2R0QC 5J1RA 4AYBN 2WV1A 5JLXA 2CU7A 5JLWA 2X48A 5E3MA 4XRSA 3D1NI 1TWHJ 1GVDA 3Q3SA 4BY1J 3HKZN 4G12A 5IP9J 1JUMA 1IG7A 3TP3A 3HOZJ 1BA5A 4FE4A 5IPAA 2DJNA 2DMUA 5GP9A 1MBJA 2L9RA 3GTKJ 1OCPA 1MNMC 9ANTA 2AHQA 4IHWA 2LR8A 1HCRA 2Y0SN 5C3EJ 1NK3P 1IDZA 3B6AA 4MLOA 5EG0A 2EZKA 2ECCA 4MFEA 5F1JA 1RETA 1IJWC 2M8GX 3BT9A 3FK7A 1JGGA 3TW6A 3A02A 3BR5A 1QRYA 2EQRA 5EZGA 4A3EJ 3JRDA 3S2HJ 5F04A 1OFCX 2YS9A 4AC0A 1LE8A 5EZHA 3IH3A 2KT0A 2DA3A 2MW8A 4BKXA 3JRCA 2HDDA 1TWFJ 1POGA 3TEDA 1VF9A 2EH3A 5M3MJ 1AHDP 1H89C 4IHVA 2TCTA 2HOSA 5E3OA 1IV6A 1RR7A 2DMNA 4A3MJ 4BY7J 1WI3A 4BXXJ 4C3IJ 3RZDJ 1LE8B 4W97A 3SDGA 2XB0X 3SJMA 4DYCA 5M5XJ 2HXIA 3CDLA 2CUEA 1XG1A 3O8GA 5FKMA 3RZOJ 2DA2A 4RBOA 3BG3A 5GPCA 2MSYA 1JKRC 3BR0A 5IYCJ 3OSFA 3HB9A 1AKHA 2XGDA 3BQZA 4UUSB 2NVQJ 2IBDA 2CRGA 4A3KJ 2JN6A 2LVSA 3SFIA 2ID3A 2LTPA 1HDDC 2G0EA 2LFBA 3MN2A 2KDZA 3NARA 2XPUA 3S14J 4A3BJ 4GFBA 1YRNA 2H8RA 1A6IA 1HDPA 1ETYA 1WH5A 1B8IA 1OCTC 2LD5A 2MG4A 1VFCA 3I4MJ 3PM1A 2CQQA 5IP6A 1GUUA 5F08A 2JA7J 2OPTA 1YRNB 1MH3A 2DA7A 2R5ZB 3BR3A 2LK2A 1JJ8C 4DYRA 3JRBA 1HF0A 1ZKGA 3S2DJ 2R5ZA 3LSRA 4M3EA 2L7ZA 2R5YB 4Y52J 3F0CA 3O8HA 2JJ7A 2EBIA 5E3NA 5HODA 1O4XA 4D5FA 1H8AC 1QPIA 3ZQIA 2JA8J 1A5JA 5DTDA 3JRGA 4D7NA 3BR6A 3BTJA 4BBSJ 2TRTA 1IC8A 3UKGA 2E2JJ 3ZQCA 4A3JJ 3CQZJ 4A3GJ 1T33A 4UUSA 4CYCA 4A3LJ 2X9DA 1JT0A 1AKHB 3OSGA 2FQ4A 2L0KA 1BW6A 2E2HJ 4D7MA 1ETWA 3WHBA 3W6VA 1Y1VJ 5F0HA 3Q0UA 4DZJA 4M3FA 1LFBA 2Y30A 4C2MJ 2R92J 3K7AJ 1ZK8A 3HEFA 1GT0C 1WCMJ 3BR1A 2ZB9A 2QCOA 5C4JJ 3GTMJ 2YU9J 1F36A 1SFOJ 1TWCJ 4FE7A 4A3FJ 4I76A 3RKQA 1JT6A 3LSGA 4DYQA 4FCYA 1Z77A 1JJ6C 1U78A 2FX0A 1P7IA 1QVUA 2VI6A 3HBLA 5IYBJ 1TWAJ 5F0CA 1NK2P 1RKTA 2YUSA 2Y2ZA 3HGGA 4V2GA 2LP0A 1ORKA 3FKIJ 2NVTJ 2H1KA 5E3LA 1W0UA 3JREA 4JX5A 2I10A 1BL0A 1WGXA 1U9OA 2ME0A 3G1OA 3ZQGA 3MKLA 3HOWJ 2B63J 3JRAA 2K9SA 4MO7A 1JUPA 4IHXA 2ID6A 5EEAA 1FTZA 2HXOA 5FKKA 4IEJA 4DW6A 2ELKA 2EZLA 2VPRA 1MBHA 3C2BA 1D5YA 1RPWA 3DCFA 4C3JJ 3M3YJ 3HGYA 2XB5A 4UUTA 1ZTRA 1IGNA 4NDLA 1ETKA 3G1MA 1VI0A 5IOYA 2EZHA 1MSEC 2WAQN 3GTLJ 1MBFA 1P7JA 1ETQA 4XICA 5F27A 1IDYA 4X6AJ 1GV2A 1DU6A 2NOGA 2COBA 3PO2J 2D5VA 2K9NA 5M5YJ 2Y31A 5M5WJ 1EF4A 2L7MP 1B72B 1MBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFU P;  4DZP A;  4QTR A;  4IHY A;  2FD5 A;  3S1R J;  4BBR J;  2R5Y A;  2HI3 A;  4FIS A;  5J1U A;  4ABZ A;  2M2E A;  2DMQ A;  5K7Z A;  2HOA A;  3A01 A;  1I6H J;  3HDD A;  5IP7 J;  5K7F A;  4B3A A;  4J19 A;  2PMZ N;  1RKW A;  3L1P A;  2FJ1 A;  4RDU A;  2O9L A;  1GV5 A;  4A69 C;  1XS9 A;  5IYD J;  2EZI A;  4XRM A;  2DA4 A;  2XGC A;  1FTT A;  3QQA A;  2NVY J;  4FTH A;  1CQT A;  3NAU A;  4I6Z A;  3TP0 A;  3RQI A;  2XPV A;  3GTO J;  3CMY A;  4XK4 A;  1X2M A;  3BR2 A;  3OOU A;  3Q0V A;  2GBY A;  3JR9 A;  2VKV A;  4S0H B;  1ZQ3 P;  2ME6 A;  3GTJ J;  3S16 J;  3S15 J;  2N8G A;  3LSJ A;  1JKP C;  1WH7 A;  3FK6 A;  2RAE A;  3IH4 A;  3HOY J;  4X1E A;  1SAN A;  1U9N A;  3HOU J;  3GBG A;  2NVX J;  3HM5 A;  2DA5 A;  3CCY A;  5M3F J;  4JX6 A;  2VUM J;  1I3Q J;  3BTL A;  4CYC B;  2LKX A;  3IV5 A;  3IH2 A;  1ITY A;  3HOX J;  5GPA A;  2DA1 A;  4D5C A;  1APL C;  3M4O J;  1JTX A;  1IUF A;  3H0G J;  1FJL A;  3JRH A;  3HOV J;  3ZQH A;  2LLK A;  4M6V A;  3GTQ J;  1JTY A;  2CUF A;  1X2N A;  4LOC A;  5FKN A;  1ENH A;  3FIS A;  5EDN A;  1GDT A;  3LNQ A;  5DS9 A;  4A3C J;  1B8I B;  1X58 A;  2O7O A;  5FKL A;  1XC5 A;  3QPL A;  1BJZ A;  3I4N J;  1FEX A;  1B72 A;  1BW5 A;  1OJL A;  4B1R A;  5FLM J;  2DMT A;  2DA6 A;  3BG9 A;  4JYK A;  3TW7 A;  4M3G A;  2DMP A;  3A01 B;  1K83 J;  2ECB A;  2M34 A;  2JA5 J;  3ZQF A;  4QSH A;  3S17 J;  2HYJ A;  1FIP A;  3JRI A;  2L7F P;  1Q1V A;  3JRF A;  2XSD C;  3GTG J;  3A03 A;  4HNV A;  5FKO A;  2GLO A;  2O8K A;  1NTC A;  1ZR4 A;  1Z0X A;  1W0T A;  4JX4 A;  2VKE A;  3VPR A;  2Y9Z A;  2OF7 A;  4W1U A;  1UMQ A;  2NS8 A;  3ZQL A;  1PUF B;  1G2H A;  4JP0 A;  2LY9 A;  4QIW N;  2M0C A;  1VND A;  1UG2 A;  2K9Q A;  2DN0 A;  3BTC A;  4XID A;  3DEW A;  4A3I J;  5C4X J;  1WPK A;  2XPW A;  3MVP A;  4M3D A;  5EGO A;  4V2F A;  2M9H A;  2JK3 A;  3OIO A;  2P81 A;  1HLV A;  1MH4 A;  4MFD A;  2Y9Y A;  3S1N J;  1MBG A;  2E2I J;  4L5E A;  2JA6 J;  5FLV A;  1MBE A;  3FIW A;  1H88 C;  1T56 A;  1ZGW A;  1K61 A;  2HQ5 A;  1FIA A;  1DU0 A;  4A93 J;  1IRZ A;  2R7Z J;  5K7H A;  2W48 A;  1ETX A;  4M3B A;  5EG0 B;  3E7L A;  4B4C A;  1ETV A;  3PO3 J;  2QF7 A;  3K2A A;  1ETO A;  4EEF G;  3LOC A;  2AO9 A;  5IOZ A;  1JKO C;  2WB1 N;  3ZOB A;  4Y7N J;  2XRL A;  1Y1W J;  3B6C A;  2E19 A;  1TC3 C;  2HOT A;  4A3D J;  3G1L A;  5J1Y A;  2E1O A;  2CJJ A;  3H3V K;  2JWT A;  1S7E A;  2IEK A;  1JUS A;  3S1M J;  2DTZ A;  2GM4 A;  2R93 J;  3QPS A;  1I50 J;  1E3O C;  1AU7 A;  5F0F A;  5EYR A;  3LSP A;  1ZR2 A;  5J3L A;  5FJ8 J;  3S1Q J;  2NS7 A;  5C44 J;  2IAI A;  1U8B A;  1R9T J;  1UHS A;  2K40 A;  3Q0W A;  2X6O A;  3BTI A;  2XGE A;  3GTP J;  5EGO B;  3BQY A;  2CQX A;  4XRS G;  4C3H J;  1QVT A;  3WHC A;  1F43 A;  4MIM A;  5BNG A;  3BG5 A;  1HOM A;  2MGQ A;  1RES A;  1MSF C;  5EF6 A;  1PUF A;  1TWG J;  1JKQ C;  2JMW A;  4AUX A;  2R0Q C;  5J1R A;  4AYB N;  2WV1 A;  5JLX A;  2CU7 A;  5JLW A;  2X48 A;  5E3M A;  4XRS A;  3D1N I;  1TWH J;  1GVD A;  3Q3S A;  4BY1 J;  3HKZ N;  4G12 A;  5IP9 J;  1JUM A;  1IG7 A;  3TP3 A;  3HOZ J;  1BA5 A;  4FE4 A;  5IPA A;  2DJN A;  2DMU A;  5GP9 A;  1MBJ A;  2L9R A;  3GTK J;  1OCP A;  1MNM C;  9ANT A;  2AHQ A;  4IHW A;  2LR8 A;  1HCR A;  2Y0S N;  5C3E J;  1NK3 P;  1IDZ A;  3B6A A;  4MLO A;  5EG0 A;  2EZK A;  2ECC A;  4MFE A;  5F1J A;  1RET A;  1IJW C;  2M8G X;  3BT9 A;  3FK7 A;  1JGG A;  3TW6 A;  3A02 A;  3BR5 A;  1QRY A;  2EQR A;  5EZG A;  4A3E J;  3JRD A;  3S2H J;  5F04 A;  1OFC X;  2YS9 A;  4AC0 A;  1LE8 A;  5EZH A;  3IH3 A;  2KT0 A;  2DA3 A;  2MW8 A;  4BKX A;  3JRC A;  2HDD A;  1TWF J;  1POG A;  3TED A;  1VF9 A;  2EH3 A;  5M3M J;  1AHD P;  1H89 C;  4IHV A;  2TCT A;  2HOS A;  5E3O A;  1IV6 A;  1RR7 A;  2DMN A;  4A3M J;  4BY7 J;  1WI3 A;  4BXX J;  4C3I J;  3RZD J;  1LE8 B;  4W97 A;  3SDG A;  2XB0 X;  3SJM A;  4DYC A;  5M5X J;  2HXI A;  3CDL A;  2CUE A;  1XG1 A;  3O8G A;  5FKM A;  3RZO J;  2DA2 A;  4RBO A;  3BG3 A;  5GPC A;  2MSY A;  1JKR C;  3BR0 A;  5IYC J;  3OSF A;  3HB9 A;  1AKH A;  2XGD A;  3BQZ A;  4UUS B;  2NVQ J;  2IBD A;  2CRG A;  4A3K J;  2JN6 A;  2LVS A;  3SFI A;  2ID3 A;  2LTP A;  1HDD C;  2G0E A;  2LFB A;  3MN2 A;  2KDZ A;  3NAR A;  2XPU A;  3S14 J;  4A3B J;  4GFB A;  1YRN A;  2H8R A;  1A6I A;  1HDP A;  1ETY A;  1WH5 A;  1B8I A;  1OCT C;  2LD5 A;  2MG4 A;  1VFC A;  3I4M J;  3PM1 A;  2CQQ A;  5IP6 A;  1GUU A;  5F08 A;  2JA7 J;  2OPT A;  1YRN B;  1MH3 A;  2DA7 A;  2R5Z B;  3BR3 A;  2LK2 A;  1JJ8 C;  4DYR A;  3JRB A;  1HF0 A;  1ZKG A;  3S2D J;  2R5Z A;  3LSR A;  4M3E A;  2L7Z A;  2R5Y B;  4Y52 J;  3F0C A;  3O8H A;  2JJ7 A;  2EBI A;  5E3N A;  5HOD A;  1O4X A;  4D5F A;  1H8A C;  1QPI A;  3ZQI A;  2JA8 J;  1A5J A;  5DTD A;  3JRG A;  4D7N A;  3BR6 A;  3BTJ A;  4BBS J;  2TRT A;  1IC8 A;  3UKG A;  2E2J J;  3ZQC A;  4A3J J;  3CQZ J;  4A3G J;  1T33 A;  4UUS A;  4CYC A;  4A3L J;  2X9D A;  1JT0 A;  1AKH B;  3OSG A;  2FQ4 A;  2L0K A;  1BW6 A;  2E2H J;  4D7M A;  1ETW A;  3WHB A;  3W6V A;  1Y1V J;  5F0H A;  3Q0U A;  4DZJ A;  4M3F A;  1LFB A;  2Y30 A;  4C2M J;  2R92 J;  3K7A J;  1ZK8 A;  3HEF A;  1GT0 C;  1WCM J;  3BR1 A;  2ZB9 A;  2QCO A;  5C4J J;  3GTM J;  2YU9 J;  1F36 A;  1SFO J;  1TWC J;  4FE7 A;  4A3F J;  4I76 A;  3RKQ A;  1JT6 A;  3LSG A;  4DYQ A;  4FCY A;  1Z77 A;  1JJ6 C;  1U78 A;  2FX0 A;  1P7I A;  1QVU A;  2VI6 A;  3HBL A;  5IYB J;  1TWA J;  5F0C A;  1NK2 P;  1RKT A;  2YUS A;  2Y2Z A;  3HGG A;  4V2G A;  2LP0 A;  1ORK A;  3FKI J;  2NVT J;  2H1K A;  5E3L A;  1W0U A;  3JRE A;  4JX5 A;  2I10 A;  1BL0 A;  1WGX A;  1U9O A;  2ME0 A;  3G1O A;  3ZQG A;  3MKL A;  3HOW J;  2B63 J;  3JRA A;  2K9S A;  4MO7 A;  1JUP A;  4IHX A;  2ID6 A;  5EEA A;  1FTZ A;  2HXO A;  5FKK A;  4IEJ A;  4DW6 A;  2ELK A;  2EZL A;  2VPR A;  1MBH A;  3C2B A;  1D5Y A;  1RPW A;  3DCF A;  4C3J J;  3M3Y J;  3HGY A;  2XB5 A;  4UUT A;  1ZTR A;  1IGN A;  4NDL A;  1ETK A;  3G1M A;  1VI0 A;  5IOY A;  2EZH A;  1MSE C;  2WAQ N;  3GTL J;  1MBF A;  1P7J A;  1ETQ A;  4XIC A;  5F27 A;  1IDY A;  4X6A J;  1GV2 A;  1DU6 A;  2NOG A;  2COB A;  3PO2 J;  2D5V A;  2K9N A;  5M5Y J;  2Y31 A;  5M5W J;  1EF4 A;  2L7M P;  1B72 B;  1MBK A; 
#chains in the Genus database with same CATH topology
 4KIS A;  3H9J A;  3CC4 I;  3TQN A;  5H6R A;  4QTR A;  1HW5 A;  4NQW B;  3S93 A;  2V7F A;  2HI3 A;  3QYE A;  3DBH B;  1AWC A;  4UVC A;  2RRE A;  5J1U A;  3G2B A;  2M2E A;  3DPT A;  4ABZ A;  4Q4Z F;  5LHI A;  1DP3 A;  5DV5 A;  3WOD F;  1VQ5 I;  2ZME C;  5K7F A;  2PN6 A;  3RTR A;  5D5X B;  4M71 A;  1MJB A;  3L1P A;  1MND A;  3ZXS A;  4RDU A;  2O9L A;  1GV5 A;  4A69 C;  2CGP A;  4BH9 A;  5KNL A;  5IYD J;  3A1Y A;  2EZI A;  1IZ1 A;  2MYS A;  2HVQ A;  1V5F A;  1O3Q A;  2EWN A;  3K0L A;  3RI4 A;  1CQT A;  3I53 A;  4EJU A;  3ZCO A;  3HJE A;  3PQJ A;  4AIK A;  3RQI A;  2HYG D;  1Z3Y A;  4R79 A;  5LFA A;  3GLL A;  3WTV C;  4BE2 A;  5L3C A;  3BR2 A;  2DFH A;  3AG1 H;  3OOU A;  3ABK H;  2ME6 A;  2G9W A;  2N8G A;  2IVM A;  1DGR M;  3LSJ A;  4XNF A;  1JKP C;  3X2Q H;  4CO8 A;  5HS7 A;  5B1A H;  4BU2 A;  4X1E A;  2DDB A;  1ZG5 A;  3CP2 A;  4P55 A;  4BYY A;  1V3F A;  2DBB A;  3KX2 A;  3HM5 A;  1W4M A;  3KP3 A;  2AS5 F;  1U0J A;  3ULQ B;  2R7D A;  3R0J A;  3TKY A;  5M3F J;  4BXF A;  4CYC B;  1JHH A;  2LKX A;  1YLF A;  3IH2 A;  3Q9V A;  2W4S A;  5GPA A;  1IRF A;  3TO7 A;  3HOX J;  2RNJ A;  1BI3 A;  5DCF A;  4DBQ A;  4I98 B;  1SAX A;  3H0G J;  2OTJ I;  1W36 D;  2WB1 A;  3CUQ A;  3KEO A;  4M9X A;  2W85 A;  4CCL A;  2V1N A;  1QPM A;  3ML6 A;  2F2E A;  1LJ9 A;  5B1B H;  2A68 F;  4LOC A;  3SZT A;  1KQ9 A;  2VQH A;  1NG7 A;  3EUA A;  1X58 A;  4I02 A;  2O7O A;  3EYI A;  5FKL A;  5ILS A;  1ERD A;  1HA8 A;  1B72 A;  1OR7 A;  2KMU A;  3FDY A;  5K1Y A;  5FLM J;  2V1X A;  1UAA A;  4JYK A;  3TW7 A;  3ZMU A;  4KT6 A;  1RUO A;  3KEY A;  4XLN F;  4ZZL A;  2EK5 A;  2M34 A;  2JA5 J;  3GFL A;  4KIC A;  1VQ6 I;  3MFK A;  3JRI A;  2L7F P;  2HDC A;  3ONQ A;  2Z99 A;  1IXR C;  4HNV A;  1KZH A;  2OBP A;  4A0X A;  4BGD A;  3K70 C;  3HHH A;  1ZR4 A;  1FPQ A;  3ECH A;  4IQ4 A;  5JFR A;  1W0T A;  3I59 B;  2L9S A;  4RGX A;  3VPR A;  2QEX I;  4W1U A;  2JPC A;  4X0G A;  2IGK A;  1ZAR A;  2OA4 A;  3ZQL A;  3DEU A;  3BDD A;  1G2H A;  2HKO A;  2FSW A;  3RPU A;  3AAF A;  3LAJ A;  3A0B C;  4BQA A;  5FGM A;  4WK8 F;  3F23 A;  5CVJ A;  4XLC A;  4BE1 A;  4EJV A;  4UB6 C;  3DEW A;  3LSM A;  1Z9C A;  3AL0 C;  3N05 A;  3BLY A;  3K1N A;  4YFX F;  5C4X J;  2H27 A;  4I09 A;  4V2F A;  3QWL A;  2LSO A;  2FA5 A;  4HA8 A;  5L3F A;  3OIO A;  2W57 A;  2ZFW A;  4XLP F;  3F8F A;  4UVA A;  5GTH C;  4GRI A;  4UV9 A;  4L5E A;  2WAQ A;  1MBE A;  3FIW A;  1FLI A;  1USS A;  1ZGW A;  2X1E A;  3EDP A;  4D9J A;  1FIA A;  1DU0 A;  1IRZ A;  4RM3 A;  2W24 A;  4CUG A;  4BJ5 C;  5EG0 B;  3RYR A;  3E7L A;  3PO3 J;  1ETV A;  2QF7 A;  2WAD A;  3LOC A;  4UVB A;  5IOZ A;  1JKO C;  4O5V A;  2CUZ A;  4LMY A;  2HEO A;  1RNL A;  3I3L A;  2QBY A;  2K3F A;  2P8T A;  5LLQ A;  3PNY A;  1Y1W J;  4IF4 A;  2VPL A;  4KIG A;  4EV0 A;  2HOT A;  2GQQ A;  3G1L A;  4ESF A;  5J1Y A;  1X1B A;  3J7Y J;  4CHU A;  4A0Y A;  4E70 A;  2F5D A;  5ICE A;  1S7E A;  1J2X A;  1TW3 A;  2HPI A;  1D0Y A;  3KEQ A;  2HOE A;  3IP4 B;  3CCR I;  2DTZ A;  4CZZ A;  1IF1 A;  3BP8 A;  1U5T C;  3ABT A;  3QPS A;  4PZJ A;  4RGU A;  5HDG A;  1AU7 A;  5F0F A;  2MLG A;  3IUO A;  5EYR A;  4EGY A;  1V5E A;  1PP7 U;  3E6M A;  1OMI A;  5J3L A;  1LVK A;  2BHZ A;  3BPX A;  4BEH B;  3T8T A;  4C2T A;  1R9T J;  3S1Q J;  4LLG F;  2ZME A;  1XGN A;  1T39 A;  1UHS A;  1YW7 A;  4OWR B;  3ZR8 X;  2BY3 A;  3Q0W A;  2VJI A;  2XGE A;  3FXR A;  2QYO A;  1RIO H;  3GTP J;  3A0H C;  2CQX A;  4XRS G;  2K9M A;  3FM5 A;  1T38 A;  4LG0 B;  4C3H J;  1MKM A;  3RIR A;  1QVT A;  2NYX A;  1F43 A;  4MIM A;  3D5R C;  3NEU A;  4R1H A;  3D0S A;  3SEZ A;  2MGQ A;  4S04 A;  3VDX A;  3U2R A;  2E1C A;  1MSF C;  4H4K C;  4TV7 A;  3K4L A;  1TWG J;  2E71 A;  3JAM Z;  3M07 A;  1BM9 A;  4ZDL A;  3B02 A;  3KLN A;  3OYM A;  2KKO A;  1TWH J;  1LDD A;  2WTE A;  3PL8 A;  2X85 A;  1FWZ A;  4CIC A;  3QRF F;  5BOX A;  1ACI A;  3R6S A;  5IP9 J;  3FXM A;  1PYV A;  3I55 I;  1IG7 A;  2A5W A;  1BA5 A;  3KP6 A;  4IRG A;  2DJN A;  4XKW A;  3VSL A;  2V1U A;  4NC8 A;  4L5J A;  2L9R A;  3E97 A;  1X4O A;  2HQN A;  4RM2 A;  3FHZ A;  2OV7 A;  3CLO A;  3ZGK A;  2FEZ A;  2PX9 A;  1K78 A;  2K27 A;  3OWT A;  1IRG A;  4Z2Y A;  3HZJ A;  2LR8 A;  2RN7 A;  2A6T A;  1FP2 A;  3OV8 A;  4MLO A;  4U7B A;  3AL0 B;  3I9V 2;  1TT0 A;  1A31 A;  4Y13 A;  2VQC A;  3VYR B;  1IJW C;  2VJJ A;  2DDA A;  1K6Y A;  4XL9 A;  5D4R A;  3ZQ7 A;  1JGG A;  2A6H F;  2OQR A;  4LGW A;  4PSW A;  5GAD J;  2EQR A;  4A3E J;  4EM0 B;  3JRD A;  1G8X A;  4I0B A;  4G7H F;  3J7Z I;  3OYJ A;  1XN7 A;  3IH3 A;  4CCJ A;  2Q0O A;  1RC9 A;  2MW8 A;  4BKX A;  4IKF A;  4AIJ A;  5DUK A;  3E5X A;  3TED A;  1VF9 A;  2EH3 A;  2HKX A;  3DKW A;  2BYV E;  4UY8 I;  1QNT A;  4A6E A;  1H89 C;  2CV2 A;  1OR7 C;  1S5L C;  4AVZ A;  1WZ2 A;  4AWX B;  1BR2 A;  3V7R A;  4BY7 J;  3ZN0 A;  5HLT A;  4RAF A;  2LBF B;  4BXX J;  4E4H A;  4C3I J;  1DUX C;  1T0F C;  4HX8 A;  4IJA A;  1WQ2 A;  2YX7 A;  4LFU A;  4Q47 A;  1ZGJ A;  1KU2 A;  4YFK F;  4B47 A;  5J8F A;  3EQL F;  3CP8 A;  5GPC A;  2MSY A;  4ANJ A;  4ZYD A;  1SVM A;  2FOW A;  3TL4 X;  1AKH A;  2XGD A;  4KMU X;  3BQZ A;  2F4I A;  1ZRC A;  1ZHF A;  2XF6 A;  2QM3 A;  4HEA 2;  5DDG A;  4XLH A;  4A3K J;  1F5T A;  3RKX A;  2FBK A;  2LVS A;  2G0E A;  3I71 A;  2DCE A;  2ZXW H;  5J4Y A;  5DYM A;  4A3B J;  2X6Y A;  1DP7 P;  1ETY A;  3A4C A;  2JVH A;  1X4P A;  3ELK A;  1I1G A;  2LD5 A;  1G3Y A;  3HRM A;  1TNT A;  3I54 A;  5F08 A;  2OPT A;  1YRN B;  2DA7 A;  2F4M B;  1BR1 A;  3BR3 A;  2ZCW A;  5E8I A;  2P5K A;  3K70 D;  2K4J A;  2MA3 A;  3M8F A;  5CQE A;  2K86 A;  4HPQ A;  3S2D J;  4FX4 A;  1T8I A;  3LSK A;  2DYS H;  4Y52 J;  3M1E A;  3F0C A;  5IY5 H;  3KIO A;  3WTX C;  3DTK A;  3CCJ I;  5LD2 C;  2EFW A;  4ZC3 A;  2P5V A;  2YX4 A;  4D5F A;  3DBR B;  1QU3 A;  4G7Z F;  1A5J A;  1IRX A;  1QZZ A;  2JUC A;  2E1M C;  2X1D A;  1WWX A;  1TQP A;  2GIV A;  1HW2 A;  3KYC B;  3ZQC A;  3ECO A;  2Y48 A;  2EIL H;  4OAY A;  1BOA A;  4A3L J;  4B09 A;  1R1U A;  4IQJ A;  4PJL A;  3OSG A;  2JUG A;  3R61 A;  3FXK A;  1BW6 A;  2E2H J;  4EGZ A;  1Y1V J;  1U5T A;  3S3M A;  1PDN C;  1H0M A;  1TP4 A;  2DU9 A;  3D5L A;  1ZK8 A;  2D45 A;  1UG0 A;  2IGN A;  2V4J C;  3ERE D;  3GZ6 A;  1ODD A;  1WCM J;  2XAQ A;  4BHP A;  2QCO A;  5C4J J;  1SFO J;  1TWC J;  4BE0 A;  3TDU C;  3J81 Z;  1SEU A;  3O2P E;  4I76 A;  5EEH A;  2GXB A;  1U78 A;  1P7I A;  3HTS B;  1GXQ A;  3DF8 A;  3K1M A;  3F8C A;  4HQM A;  2YUS A;  2Y2Z A;  4UXN A;  4YEL A;  3WU0 A;  4HBL A;  5J8C A;  2QSG X;  4AID A;  2A69 F;  1TW2 A;  3FKI J;  1QHH D;  2NVT J;  1U8R A;  1GLN A;  4JX5 A;  3WU2 C;  5EJC A;  1WGX A;  2RQQ A;  3WG7 H;  3PIP F;  4IRI A;  1U9O A;  3GZ5 A;  5HS8 A;  3WG9 A;  1IN7 A;  2BVM A;  1FOW A;  2B63 J;  3JRA A;  2K9S A;  1FOY A;  4DNC A;  2ZXH A;  2AXL A;  3FHN A;  3LA2 A;  3ZMD A;  4HDV A;  3S32 A;  2ZJR F;  1K4S A;  2ELK A;  2VPR A;  1YE9 A;  5D4S A;  2QEN A;  4C3J J;  5AIQ A;  2QKL B;  5F64 A;  3HGY A;  2M30 A;  1ZTR A;  1OQY A;  4NDL A;  1QZY A;  1G3T A;  3LAP A;  1VI0 A;  2OUM A;  2OZU A;  2EZH A;  3P7N A;  4LG0 A;  3E5U A;  1MBF A;  4ZJZ A;  1ETQ A;  5LBQ A;  4XIC A;  1OCR H;  3RDI A;  3RKW A;  2E5N A;  2HVS A;  5GAE J;  4P5O A;  1SFK A;  1O7F A;  2Y0S A;  4ZZD A;  1BC8 C;  2M87 A;  3T1B A;  3EET A;  1OYY A;  4HV5 A;  3MKY B;  5E8G A;  4KMF A;  4IOA F;  3ISP A;  4E7K A;  4HX4 A;  4QWQ A;  5CVU A;  2R7V A;  3OYF A;  1LFU P;  4RAY A;  2X51 A;  3GLX A;  4QPO A;  3R4K A;  2FD5 A;  2OU2 A;  1QO0 D;  3QP6 A;  2XDV A;  4F52 A;  4II2 A;  4Q48 A;  4HAM A;  2FNA A;  1IN4 A;  1I27 A;  1T0F A;  2JPB A;  2EV0 A;  3J80 K;  1XSV A;  2Z5U A;  1IO2 A;  4B3A A;  3PUB A;  4P96 A;  5IT3 A;  1F1Z A;  3MKZ A;  2PMZ N;  2WC2 A;  3K4B A;  3SFZ A;  3H0D A;  4BAC A;  3IHU A;  4M9Z A;  1FMV A;  1BOB A;  4KIF A;  1YJW I;  2AQF A;  3W2V A;  2DA4 A;  3QQA A;  4MEX F;  1QBJ A;  2X4H A;  3TDZ C;  1IUY A;  3NAU A;  2OC6 A;  4XR6 A;  4ON0 A;  4CA0 A;  4WCG A;  4XK4 A;  1KYW A;  1WJB A;  1X2M A;  3GW2 A;  3JTH A;  4J01 A;  4L18 B;  3Q0V A;  2VKV A;  4S0H B;  1ZRF A;  3S16 J;  3C18 A;  3S15 J;  2FQ3 A;  1P2F A;  3I58 A;  2NAZ A;  1HW1 A;  1HBX G;  3IH4 A;  4L0Z B;  1U9N A;  4Y33 A;  4PDK A;  2BBY A;  2NNN A;  1CGP A;  2KRC A;  2YU3 A;  2KP6 A;  1WJD A;  2GOX B;  3S3N A;  4KIB A;  4AVP A;  4UHT A;  3QYB A;  4JX6 A;  4ZTJ A;  1I3Q J;  3HRT A;  1IV8 A;  4ZYE A;  1ITY A;  1ZLJ A;  3HOS A;  1N25 A;  2DA1 A;  4D5C A;  2PMZ A;  2Y0M A;  2BV6 A;  1JTX A;  2DOF A;  2DYR H;  2VQG A;  2EFO A;  3RKY A;  4L9T A;  5HNH A;  1S8N A;  2LLK A;  4HQE A;  2RQP A;  2P4W A;  1DGW Y;  1RRJ A;  3GTQ J;  4G8X A;  1JTY A;  5L3G A;  2CUF A;  1S3J A;  1SVO A;  1GDT A;  1WRJ A;  3V7C A;  5BQT A;  1B8I B;  1H9T A;  1XC5 A;  2NXN B;  3FX3 A;  4BDY A;  2ZJ2 A;  1XMK A;  3AG3 H;  4RB0 A;  2DA6 A;  1KON A;  1V4R A;  4M3G A;  3K6G A;  2DMP A;  2EIM H;  3G3Z A;  5LHG A;  2HZD A;  2R7F A;  1ZRE A;  1Z7L A;  1TNS A;  3ZQF A;  2HYJ A;  1ON2 A;  2PFB A;  3RYP A;  5D5U B;  2XSD C;  2LOO A;  3ZMT A;  4UB8 C;  1E17 A;  2NVU B;  1CF7 A;  2GLO A;  2O8K A;  4E7I A;  1OCC H;  4CCK A;  3P9K A;  1BR4 A;  1YHQ I;  1UFM A;  1HC8 A;  1XGO A;  3T8R A;  3GTK J;  2UV1 A;  1UMQ A;  5E17 F;  3ZRG A;  3QOD A;  3OIQ A;  1STZ A;  1VQL I;  4ENM A;  2G7H A;  2LY9 A;  4HLX A;  1SFU A;  2M0C A;  2ETH A;  3CC7 I;  1UHW A;  1VQK I;  1AOY A;  3QYF A;  1UG2 A;  3S3O A;  2DN0 A;  3BTC A;  5JI6 A;  4XID A;  1I3A A;  4RAZ A;  4OMY A;  3PIO F;  3MVP A;  2XPW A;  1YQA A;  5ERI A;  1P6R A;  4YII A;  3CCQ I;  2M9H A;  2GZW A;  2JK3 A;  3FBN B;  1XGM A;  4FQG A;  1MNE A;  4MFD A;  2O0Y A;  3S1N J;  1A6Q A;  4ZYG A;  5D5V B;  2JA6 J;  1H88 C;  1WJ5 A;  2KFD A;  4XMY A;  3WGG A;  2R7Z J;  1Q1H A;  1V54 H;  3K1P A;  4M3B A;  4B4C A;  5CVR A;  3BZC A;  2C6Y A;  1T08 B;  3PUF A;  5DD8 A;  4BS9 A;  2QA4 I;  5CJ9 A;  4HLY A;  4A6D A;  2PJR B;  1TC3 C;  3FXQ A;  4A3D J;  2QQ9 A;  4U7D A;  4PUS A;  3CF5 F;  4BNC A;  2FU4 A;  3GWZ A;  2E1O A;  2UUZ A;  2WWY A;  1IN6 A;  2IEK A;  2XAF A;  3CME I;  4N4O B;  3S1M J;  5CKT A;  1FZP B;  2WAF A;  3H5A A;  2R93 J;  3G71 I;  3DU6 A;  3TOB A;  3LSP A;  1ZR2 A;  5LRS A;  3KYL A;  2NS7 A;  1OCZ H;  3GFJ A;  2XHK A;  2KHM A;  4ZYH A;  2UWM A;  2I5U A;  4IOC F;  1FBU A;  2D1H A;  5CLS A;  3E6D A;  3BQY A;  3CC2 I;  4HW0 A;  3OYD A;  2KZV A;  2JTV A;  3BG5 A;  2VB6 A;  2HS5 A;  3H35 A;  2H1L A;  1PUF A;  2JMW A;  1K4T A;  4N9I A;  1JKQ C;  4NHJ A;  5F1R A;  1XSX A;  4AYB N;  3D1N I;  4XRS A;  2A3S A;  2X48 A;  5E3M A;  2JSP A;  2ZXJ A;  3I0T A;  3Q3S A;  3H92 A;  4BY1 J;  3DTE A;  2IA0 A;  3GFM A;  1RZ4 A;  1LEB A;  1JI8 A;  4GXO A;  2IGO A;  4IHS A;  1JUM A;  2OJE D;  2L01 A;  3PQK A;  1S7A A;  3KP7 A;  3F22 A;  2J5O A;  2DMU A;  3Q9S A;  1MIJ A;  4ASN A;  4LD5 A;  3K4N A;  2LDU A;  1W1W E;  2BY2 A;  9ANT A;  3BPV A;  4KN7 X;  1LPQ A;  2AHQ A;  5HS9 A;  4IHW A;  1HCR A;  2W25 A;  4KIT B;  1OKR A;  4HX7 A;  4KT5 C;  3B6A A;  4Y4R A;  4H0E A;  3IC7 A;  4WF2 A;  2IS2 A;  4MFE A;  2ECC A;  5F1J A;  1K78 B;  2CW7 A;  1Z6R A;  2M8G X;  2GWR A;  3BT9 A;  4A2U A;  2W7N A;  2M7A A;  3TW6 A;  1WI9 A;  2LYC A;  4CH7 A;  5EZG A;  1YFH A;  3S2H J;  1DQU A;  1YYV A;  1TBX A;  2PMU A;  4CYD A;  3CUQ B;  5EZH A;  4XKB A;  4XLE A;  3E6B A;  2DA3 A;  1KQ0 A;  1TWF J;  2Q8K A;  5L3E A;  4QPQ A;  3M1C A;  3FXU A;  3OYB A;  4P9F A;  1B9N A;  1S9H A;  4IL6 C;  1TQM A;  1YJ9 I;  5GAG J;  2QSH X;  2LC2 A;  4N4N B;  4IO9 F;  2E35 A;  2H8W A;  5H6Q A;  3OS0 A;  5E3O A;  2XVC A;  3C1D A;  2JRM A;  3RZD J;  1O3S A;  4PJN A;  3K10 A;  3BZK A;  4LK0 F;  1GXP A;  2XRN A;  3KE2 A;  1XG1 A;  1BI2 A;  2DA2 A;  2BY1 A;  2EV6 A;  1UEL B;  2JA2 A;  5IYC J;  2VKH A;  3NRV A;  2VON A;  5ICG A;  4UUS B;  5HLG A;  2NVQ J;  3QOP A;  3CD6 I;  3REO A;  2IBD A;  2BXZ A;  3LSI A;  3KLO A;  3SYT A;  4CZC A;  2JN6 A;  3KCC A;  1HDD C;  3MN2 A;  4XON A;  2XAS A;  1R1V A;  2IGM A;  4FX0 A;  1O3R A;  2AXT C;  4A0Z A;  3S14 J;  1XDS A;  3SQN A;  1OIS A;  4CXF A;  3PJR A;  1WH5 A;  1OCT C;  1FYM A;  4LIV A;  4II3 A;  4IPA A;  1J75 A;  1REP C;  3ZMS A;  2E60 A;  2IS1 A;  1PVE A;  1YI2 I;  2P7V B;  2P6S A;  2LK2 A;  3OS2 A;  1VQ4 I;  2L02 A;  4DYR A;  2K3P A;  1HF0 A;  4DQ2 A;  1ON1 A;  4NUB A;  1BC7 C;  5K5O A;  3F9K A;  2R3S A;  4ITV A;  3HC7 A;  3HUG A;  2OQG A;  2CQ7 A;  3K2Z A;  1BN5 A;  3EUK L;  2LF8 A;  2JJ7 A;  3RCO A;  5B66 C;  4GYG A;  2CMP A;  3IKV A;  3C7J A;  2VBW A;  1H8A C;  4K2E A;  1QPI A;  5DTD A;  1S72 I;  1U6G A;  3JRG A;  3TGN A;  3BR6 A;  2XRO A;  2FMY A;  4NBQ A;  5GTI C;  3LL7 A;  4B8X A;  3UKG A;  1EA3 A;  4G6T B;  4A3G J;  1T33 A;  1FT9 A;  4UUS A;  2KL4 A;  4CYC A;  2X9D A;  3MEX A;  1JT0 A;  2ZXI A;  1RR8 C;  3DKY A;  2K7L A;  3SHF A;  4I01 A;  1YIJ I;  2R7X A;  2L0K A;  4D7M A;  2ISY A;  3W6V A;  4E7L A;  1XDU A;  3HKZ A;  4LLL A;  4DZJ A;  2KLO A;  1LFB A;  2STW A;  2Y30 A;  2RGV A;  1FC3 A;  1SFE A;  2Z3Y A;  3EUH C;  4FT8 A;  1XMX A;  3BR1 A;  5KCM A;  1HQC A;  1UHM A;  1QZE A;  2PG4 A;  2M5W A;  2LRD A;  2Z9O A;  1P4A A;  4FE7 A;  3KP2 A;  2M4K A;  3K4J A;  4Y15 A;  1JT6 A;  3LSG A;  3LST A;  3DWL E;  1Z77 A;  3COA C;  3IWF A;  2DPD A;  4OIO F;  3HBL A;  2VI6 A;  1PP8 F;  1R49 A;  3IRR A;  4IHT A;  1HST A;  1YS7 A;  2B7E A;  2ADU A;  3HGG A;  1D8J A;  1LNW A;  1KA8 A;  2MC3 A;  1ORK A;  1S29 A;  1MMN A;  5FD6 A;  5E3L A;  5AON A;  3JRE A;  3LFK A;  3HPH A;  2ZJP F;  2LKP A;  4EAT A;  1EV7 A;  3ZQG A;  5ICC A;  5A2Q K;  3HTU A;  5KAI C;  1YG2 A;  2PBI A;  3HOW J;  4MO7 A;  5KHD A;  1SMY F;  3HPG A;  3NWS A;  3WTU C;  1ZEL A;  1R71 A;  3VYU B;  3KP4 A;  1V55 H;  1O57 A;  1IXC A;  2EZL A;  3HXL A;  1RPW A;  2XB5 A;  1YW9 A;  1EH8 A;  4U88 A;  3V7S A;  1TL8 A;  3AFH A;  1M1E B;  4U0W A;  1A36 A;  2XGX A;  1P7J A;  2H09 A;  1YX3 A;  1ZG3 A;  2M1B A;  3CF2 A;  3IAS 2;  4KJZ A;  4ZYA A;  3PSI A;  2ZJQ F;  3WE3 A;  2NOG A;  4PJM A;  3F72 A;  4WXD A;  5FB2 A;  1YTY A;  5E20 A;  4Q5S F;  4RLQ A;  5ICF A;  1D0X A;  1LDJ A;  2GA1 A;  1EF4 A;  3SDB A;  2L7M P;  1S7O A;  2F48 A;  1ONV A;  2KIF A;  2XIG A;  3H9G A;  1B72 B;  3VFZ A;  4RAG A;  4KYW A;  2V9V A;  3OYK A;  2KJC A;  2V9K A;  4GYI A;  1FX7 A;  1C0W A;  4IHY A;  3HL2 A;  3GEZ A;  4GO1 A;  2L9N A;  1VQO I;  3S1R J;  4BBR J;  2R5Y A;  2R7W A;  1D1A A;  2GAU A;  4YFN F;  2DOA A;  4XBF A;  2PJR A;  2HOA A;  2R7S A;  3J80 Z;  1IN5 A;  3HDD A;  5IP7 J;  2FXA A;  3H5R A;  1MMD A;  2L7K A;  2VXD A;  2PI0 A;  3ZN1 A;  1Z21 A;  3WTS C;  2HNH A;  4B43 A;  4KUM A;  3I64 A;  2EFN A;  2QVO A;  3KZY A;  1FOX A;  3PFI A;  2IS6 A;  1UB9 A;  4NC7 A;  1FTT A;  2I8D A;  2W1O A;  4I6Z A;  5FO5 A;  3TP0 A;  2FRH A;  3P5J A;  3GTO J;  3CMY A;  3DKX A;  4IXA A;  2GBY A;  3JR9 A;  3KZZ A;  1ZQ3 P;  3VOE A;  2EFQ A;  5H2F C;  4MEY F;  2A6E F;  2CO5 A;  4RB3 C;  2B0L A;  2IPQ X;  3ZQQ A;  1F4K A;  3MKW B;  1WH7 A;  3FK6 A;  3LA3 A;  2V79 A;  1SAN A;  3VB2 A;  1X1P A;  3HOU J;  2QWW A;  3JCU C;  3HRU A;  4IVN A;  4YIR X;  4OIP F;  4LB5 A;  2RNG A;  1BI0 A;  2VT3 A;  4ENN A;  2DA5 A;  3H1C A;  1MMG A;  2ELH A;  4G6D A;  2VUM J;  4LIU A;  2JSC A;  3F8N A;  4XM3 A;  2O3F A;  1APL C;  3M4O J;  4YG2 F;  4DJA A;  1IUF A;  2HQA A;  3BOQ A;  3JRH A;  3HOV J;  3ZQH A;  1ZAO A;  3ZPL A;  5K5Q A;  4HDU A;  4M6V A;  4XKV A;  2DFF A;  2L3D A;  2EIJ H;  1SD7 A;  2L5Q A;  3BG7 A;  3FMQ A;  5EDN A;  1TTY A;  1K79 A;  3LNQ A;  4A3C J;  3QPL A;  3I4N J;  1FEX A;  2KIU A;  1BJA A;  2K5C A;  1FY7 A;  3EUH A;  3IL2 A;  2DMT A;  2ISZ A;  1VZ0 A;  2WA0 A;  3BG9 A;  4PJJ A;  1G4D A;  5DCM A;  3A01 B;  1K83 J;  2Z2S B;  4IRH A;  2ECB A;  4MHG A;  1Q1V A;  3JRF A;  5HDN A;  3GTG J;  3M9A A;  3GXO A;  5FFX A;  4F93 B;  3AKZ A;  4E6K G;  3IKT A;  3L09 A;  1ULY A;  2XUB A;  5D8L B;  4I99 C;  5HDK A;  1TT5 B;  2A5Y B;  2HGC A;  2OF7 A;  2CYY A;  1VQM I;  3HHG A;  2R4G A;  2E7W A;  3R60 A;  1MGT A;  2E1M B;  1B4A A;  4I0A A;  1E3P A;  4JP0 A;  4BJ6 C;  4QIW N;  3KET A;  1D3Y A;  2V9P A;  4EMS A;  1VND A;  2DT5 A;  3JTG A;  1I1S A;  3FM3 A;  3BRO A;  3MCZ A;  2FBH A;  2F6C A;  2EFP A;  2MAB A;  4Y17 A;  2CQN A;  3U1K A;  3LA7 A;  3F8B A;  3H36 A;  3V8J A;  1TQI A;  2IA2 A;  2VKD A;  1Z7U A;  1HLV A;  2DOE A;  1MH4 A;  1Z1D A;  3IRQ A;  2Y9Y A;  4HYE A;  2QKM B;  1MBG A;  2E2I J;  3MZ8 A;  2IXS A;  3CJT B;  5BPD A;  2DJI A;  5FLV A;  3FF5 A;  2M3A A;  4OIR F;  2L9V A;  2MH9 A;  1OLT A;  1WJC A;  4A93 J;  2QQ8 A;  4F7Z A;  5B3S H;  1FBS A;  5K7H A;  2W48 A;  1ETX A;  4XRF A;  2CS3 A;  2AO9 A;  2BVL A;  1KYZ A;  2WB1 N;  3WGH A;  4Y7N J;  2CFO A;  3FXL A;  5CPR B;  2XRL A;  1TZL A;  2KRH A;  3BCA A;  4XSX F;  2CJJ A;  3H3V K;  1XD7 A;  5LHH A;  2GXA A;  4GDF A;  1JUS A;  1X3Z B;  2X0L A;  3VSK A;  2QGU A;  1MMA A;  4N0B A;  3S8P A;  3JSO A;  2CV1 A;  5JR3 A;  4ZDO A;  2Y69 H;  2BW3 A;  2GM4 A;  1J7K A;  1D8K A;  2L4A A;  3GYH X;  3CCS I;  1J59 A;  3E5Q A;  3QU6 A;  2NS0 A;  2ZSI B;  4LG3 A;  2Z33 A;  3DPL C;  1E3H A;  5C44 J;  1UCR A;  2IAI A;  1JXS A;  1I6X A;  3ZP5 A;  1VQ7 I;  1HKS A;  3BTI A;  2M7B A;  1K7A A;  1U5T B;  5EGO B;  2CV0 A;  2EIN H;  3BZ6 A;  1JGS A;  3KFW X;  1LUJ B;  4FAS D;  4U0Y A;  2RKH A;  1FNN A;  3WHC A;  1WJF A;  2Z16 A;  1HOM A;  5J4V A;  4QLC U;  2XAH A;  2IW5 A;  3G73 A;  2ZBK A;  1MJ9 A;  2HPM A;  2R0Q C;  1IW7 F;  2E7X A;  1QGP A;  5JLX A;  2CU7 A;  3CCV I;  1GVD A;  2B9S A;  3SZG A;  1HSJ A;  4G12 A;  4E7H A;  1MDM B;  3KPH A;  5HNF A;  2ESN A;  4HF1 A;  5D5W B;  1XPX A;  1QQI A;  4HV6 A;  4F92 B;  2F5V A;  1XMA A;  2FUG 2;  1D0Z A;  4FE4 A;  4FHT A;  5IPA A;  4L0Y B;  3ZMV A;  5GP9 A;  1MBJ A;  1LQ1 A;  1OCP A;  3DLA A;  3MD2 A;  3RPU D;  3WTY C;  1DPU A;  2BW3 B;  5JVG F;  1HKQ A;  2Y0S N;  3LSH A;  3W6K B;  3CDH A;  1NK3 P;  1IDZ A;  2HZT A;  2EPF A;  4ESB A;  3QPT A;  4AM3 A;  3MZH A;  1RET A;  3FK7 A;  4BDZ A;  4B3X A;  3A02 A;  4CGZ A;  3A2K A;  3HSR A;  4Z6Y A;  1Z05 A;  1Z67 A;  4AC0 A;  3ASO H;  3VOD A;  3L9F A;  2F5C A;  2KT0 A;  4AIH A;  3Q5F A;  2WY8 Q;  3P9C A;  4BHC A;  3JRC A;  1YO5 C;  2E5Z A;  2HDD A;  3E3V A;  5J40 A;  3CMA I;  2ZNY A;  2LF7 A;  2DPU A;  4BQQ A;  1J9I A;  1D5V A;  3D5S C;  5M3M J;  3PNV A;  1AHD P;  4IHV A;  5LRR A;  2TCT A;  3BCB A;  3TMO A;  1RR7 A;  2A05 A;  2DMN A;  4A3M J;  2ZO4 A;  2V1D A;  3U9G A;  4HOB A;  2LRE A;  4XLA A;  3C3W A;  4OMZ A;  1LE8 B;  3V8K A;  1N78 A;  4AU7 A;  2VJ5 A;  2XF7 A;  3SJM A;  5M5X J;  2HXI A;  1HXD A;  3CDL A;  2XF5 A;  4ETS A;  1OPC A;  4AYB A;  4RB2 C;  2UXX A;  3BR0 A;  3G4S I;  3CJR B;  5EEG A;  2OCC H;  3DTI A;  5E1W A;  1W7P D;  2IA1 A;  4XSZ F;  2A07 F;  1GHC A;  3SFI A;  3BJO A;  3BJ6 A;  2DFE A;  2P6T A;  2LFB A;  3BJA A;  4JK1 X;  4M6X A;  3V8L A;  1UZC A;  3NAR A;  5CVV A;  1V5G A;  3TOA A;  1YRN A;  2H8R A;  3N4M A;  1HDP A;  2CUJ A;  2GIZ A;  1LFP A;  1B8I A;  2FF4 A;  2UZK A;  2XAG A;  1VFC A;  3PM1 A;  2CQQ A;  1SAU A;  1GUU A;  2OZ6 A;  2PEX A;  4FET A;  5F6F A;  2LG4 A;  3BWG A;  1MH3 A;  2X6X A;  5HOO A;  5L3B A;  2XV4 S;  2A61 A;  1JJ8 C;  3PSF A;  1FP1 D;  3JRB A;  2PMH A;  1ZKG A;  4XOT A;  3OYA A;  1IXS B;  4YRV A;  3OL4 A;  4M6Y A;  4M3E A;  4LK1 F;  4PGG A;  4G9Y A;  3BC8 A;  5IT9 Z;  2DT7 B;  4PCQ A;  2O5R A;  5KAF C;  1NH3 A;  2CW0 F;  1MDM A;  5E3N A;  4EM2 A;  3I5U A;  2DW4 A;  1O4X A;  5JVT A;  1SMT A;  5LGT A;  2QBY B;  2JA8 J;  3AG4 H;  2G7U A;  3NWT A;  2J5P A;  3OYL A;  2BY0 A;  2H6B A;  2R7U A;  2TRT A;  2NOJ B;  3FMS A;  1IC8 A;  2E2J J;  4A3J J;  3CQZ J;  4CCO A;  2JQ7 A;  3OOP A;  1AKH B;  1G59 A;  1BI1 A;  2UXN A;  1YJN I;  1YS6 A;  2H94 A;  4OAZ A;  5TIS C;  3SZP A;  1ETW A;  2YR2 A;  3ROU A;  2QLZ A;  2CH0 A;  1KQ8 A;  3Q0U A;  4M3F A;  3DU5 A;  1LKX A;  2QZ8 A;  4F3Q A;  2R92 J;  3K7A J;  2ZKZ A;  4U0V A;  4G7O F;  2ZB9 A;  3GTM J;  4F55 A;  3RSN A;  1ZG1 A;  4CDG A;  3L2W A;  4PJ0 C;  4A3F J;  3TO9 A;  3RKQ A;  3DBL B;  2DAO A;  4DYQ A;  3KZI C;  2VAS A;  3K4K A;  3LWF A;  1JJ6 C;  1SD6 A;  1XCV A;  4HG2 A;  3K4M A;  1QVU A;  1NK2 P;  1TWA J;  2EA4 A;  5CQG A;  5FD5 A;  3GCM A;  4RMN A;  1P4W A;  3TBI A;  2F4O B;  5FLX Z;  1W0U A;  3HSE A;  4MQV A;  2I10 A;  1R7J A;  3GVA A;  3BY6 A;  1SVL A;  1X1C A;  3WTZ A;  5FRM A;  3J7A Y;  3FKJ A;  3FZV A;  4XQF A;  3LMM A;  3ABM H;  1T6S A;  4N9H A;  3HOT A;  1JUP A;  2ID6 A;  3KYD B;  1FTZ A;  3CCL I;  5FKK A;  4IEJ A;  3UR3 C;  2MBF A;  4D0P A;  1D5Y A;  4JQF A;  1ZYR F;  5GAH J;  2VBZ A;  1UJ8 A;  2L54 A;  2MD5 A;  1YIT I;  4HNU A;  4HST A;  1J0R A;  3VYT B;  2MFZ A;  1IGN A;  2KIM A;  2LH9 A;  3G1M A;  1UST A;  4BUP A;  1FMW A;  3PNT A;  5IOY A;  2RC4 A;  2VXZ A;  1MSE C;  2WAQ N;  3GTL J;  1FOK A;  4KN4 X;  2K02 A;  4XN3 A;  4BAY A;  2LMD A;  3RPQ A;  2XAU A;  1XCB A;  1GV2 A;  1DU6 A;  5AIP A;  2ICW G;  3VEP A;  1R4M B;  1B1B A;  4LLN A;  2K85 A;  4NNJ A;  4DOZ A;  5ILV A;  5M5Y J;  1F9N A;  3OYC A;  2ZC2 A;  4L5I A;  5M5W J;  1Y0U A;  2VC0 A;  3ERM A;  3E6C C;  3WGI A;  5E1X A;  2TDX A;  5DM6 F;  2Q1Z B;  1WFX A;  4EJT A;  1HKT A;  2E34 A;  4DZP A;  3CDI A;  3CCM I;  4MNU A;  1OYI A;  4FIS A;  4RGS A;  2VE8 A;  4GGG A;  3JW4 A;  3W6J B;  1JE8 A;  3HRS A;  2DMQ A;  3FWE A;  3NQO A;  5K7Z A;  3A01 A;  2E36 A;  4L9V A;  1I6H J;  3O6B B;  4XOP A;  3U21 A;  3U1D A;  4A12 A;  4J19 A;  3GF2 A;  3L2C A;  3QOE A;  5H20 A;  1BBY A;  1RKW A;  4YEJ A;  2FJ1 A;  3K9T A;  2BE5 F;  1QHG A;  2PQ8 A;  1G3S A;  1KU3 A;  1XS9 A;  1X1A A;  3SXY A;  2FNP A;  4WWC A;  3C2H A;  4XRM A;  2XGC A;  4C2U A;  1XSD A;  2NVY J;  3LQQ A;  3WE2 A;  3M8J A;  4FTH A;  1R58 A;  2H6C A;  1FSE A;  2RVC A;  2XPV A;  2OAZ A;  4LJZ F;  2EB7 A;  4HSR A;  1R00 A;  4I7H A;  3E0J B;  4YIF A;  2Q2E B;  3OMY A;  4IZZ A;  3DPU A;  3DV8 A;  1N75 A;  4EQQ A;  3GTJ J;  2W84 A;  3QP5 A;  3JAM K;  5TRD A;  2CQK A;  2RAE A;  3HOY J;  2NNY A;  2DXI A;  1G3W A;  3ZMZ A;  5KK1 A;  2P0W A;  3GBG A;  2D1V A;  4PGH A;  2LBF A;  1LEA A;  2KZG A;  3FBI B;  4NB5 A;  3MWM A;  3LFU A;  2JT1 A;  2HU9 A;  2NVX J;  4V19 K;  1X1D A;  2WV0 A;  1E0E A;  3CCY A;  1CF7 B;  3DQV C;  2V6E A;  4PFP A;  3BTL A;  3FMR A;  2VBY A;  3IV5 A;  3GME A;  3VYS B;  3DLL F;  1Z91 A;  2DLL A;  2VJ4 A;  2WBM A;  1VQP I;  2M0M A;  2OD5 A;  1FJL A;  4B44 A;  1W7P B;  4OOI A;  1DPR A;  3DEE A;  2W00 A;  2DK5 A;  1BIB A;  1RI7 A;  1S6L A;  1MMS A;  3OYI A;  5BS6 A;  1X2N A;  6PAX A;  2CG4 A;  1ENH A;  5FKN A;  3FIS A;  4D1Q A;  3WTW C;  3EPZ A;  5DS9 A;  2EV5 A;  2MH2 A;  5HLI A;  2FML A;  2KIS A;  2O8X A;  5LEJ A;  1DDN A;  2FOK A;  4BQN A;  1BJZ A;  1BW5 A;  2CSO A;  1OJL A;  3WTT C;  4B1R A;  5DCM B;  3K69 A;  1X19 A;  3L2U A;  1W7P A;  2ELJ A;  2BZT A;  2BHY A;  4EVI A;  2ZNZ A;  2MD0 A;  4BXU A;  4QSH A;  4O6J A;  3S17 J;  1FIP A;  1WSU A;  4MTE A;  1MW7 A;  4HRI A;  3T0Y A;  3A03 A;  5DEQ A;  1NHA A;  1Z6T A;  5FKO A;  2DO7 A;  2R7Q A;  3MAJ A;  1NTC A;  1TLH B;  4RLF A;  3H9Q A;  1Z0X A;  5E1Z B;  1Y39 A;  4JX4 A;  2VKE A;  1J09 A;  1ZN2 A;  2Y9Z A;  1YIO A;  3CCU I;  2NS8 A;  2STT A;  3QU3 A;  1QA6 A;  4EJW A;  1R4N B;  3F6O A;  1Z3X A;  5KVR A;  2DT6 A;  2EA2 A;  1R6R A;  1WVR A;  2DQR A;  1WJE A;  1KGS A;  2K9Q A;  2Q2E A;  4RS8 A;  1YW8 A;  5JHU A;  5A2Q Z;  4A3I J;  5DUI A;  1WPK A;  5EGO A;  4M3D A;  1SFX A;  2O03 A;  2Y75 A;  2P81 A;  4F91 B;  2ZME B;  1P4X A;  2ESH A;  1NG6 A;  1L3L A;  4E7S A;  1EH7 A;  3CZ6 A;  3VWB A;  2CFX A;  1ZLK A;  3GZN B;  2HWV A;  1T56 A;  2VQL A;  4MTD A;  1K61 A;  2HQ5 A;  2VE9 A;  1OCO H;  1I5Z A;  2PLY A;  1IAW A;  4E7Z A;  2XKP A;  3K2A A;  1ETO A;  4EEF G;  2IT0 A;  2KDO A;  3DP7 A;  2JZY A;  3OYG A;  3JSP A;  1D1B A;  1B6A A;  3ZOB A;  1FYK A;  3J7A O;  2VT2 A;  4XLF A;  1T2K A;  2ZFU A;  3L2R A;  4HNT A;  5E18 F;  3OS1 A;  2L2O A;  3PFY A;  3B6C A;  3HSF A;  2E19 A;  2JRT A;  5E79 C;  1PUE E;  5B5E C;  2KJB A;  1A04 A;  2E1N A;  4UUV A;  4XN0 A;  4S05 A;  1U3E M;  3CMM A;  1MD0 A;  5LGN A;  1Y6I A;  2JWT A;  1G6N A;  3T5X A;  4B48 A;  5CVI A;  1XB4 A;  5LEK A;  2LNB A;  1KU7 A;  1O3T A;  2W82 A;  1I50 J;  1E3O C;  4KA4 A;  2WY7 Q;  5FJ8 J;  2KRF A;  1U8B A;  2LY1 A;  1H9G A;  3CUO A;  5D8K B;  1WKM A;  4ZTF A;  3CTA A;  4L9N A;  2X6W A;  2K40 A;  4ENJ A;  1Y56 A;  2YSR A;  2X6O A;  2MC4 A;  4M72 A;  1FBQ A;  4LIT A;  4R8H A;  1Y0N A;  1XTA A;  3FXJ A;  3F21 A;  3CJQ B;  5BNG A;  2ACJ A;  3L2V A;  2HYF A;  4ESJ A;  1GVJ A;  1RES A;  4A5M A;  4BEH A;  5EF6 A;  4G6Q A;  1JHF A;  5FLX K;  4U87 A;  4AUX A;  3RJP A;  5J1R A;  2GOM A;  4MQ9 F;  2DQL A;  2WV1 A;  3OYN A;  5JLW A;  1X3U A;  4C30 A;  4PFO A;  2WAE A;  3DXJ F;  3EYY A;  3HKZ N;  1SC7 A;  2NRA C;  4HZF A;  2KIQ A;  2DI3 A;  1R1T A;  2XKO A;  1P9Q C;  2VL8 A;  4BQO A;  1I39 A;  1N77 A;  1U2W A;  2HVR A;  1VQ9 I;  3FXO A;  3L7W A;  5DM7 F;  3E1S A;  3TP3 A;  1RUN A;  3I4P A;  3RQ4 A;  3HOZ J;  1E2X A;  1BIA A;  1R22 A;  4LB6 B;  2PJP A;  1MJA A;  5D6F A;  2LKS A;  4OIQ F;  1R23 A;  3C2G A;  1MNM C;  1EJ9 A;  2IP2 A;  2K4B A;  4DBR A;  2XSJ C;  2AQE A;  2RDP A;  5C3E J;  4CCN A;  1B9M A;  2V6C A;  2V26 A;  5EG0 A;  2O61 A;  2EZK A;  2VBX A;  3HYI A;  1XGS A;  4KDP A;  3UNG C;  4Y3O A;  2BOL A;  4DGW B;  5D6E A;  5FFZ A;  3IWZ A;  3M7G A;  3TO6 A;  3BR5 A;  1QRY A;  1OYW A;  5F04 A;  4RB1 A;  1OFC X;  1P92 A;  2YS9 A;  1LE8 A;  4NC6 A;  2EIK H;  3GUD A;  2HFH A;  3V42 A;  3LQR A;  3OYE A;  3S2W A;  2VOP A;  3ABU A;  1POG A;  3OR1 C;  3ASN H;  2X1C A;  4XKC A;  1IN8 A;  1SD5 A;  2XAJ A;  3GFI A;  4C9Y A;  1LVA A;  3CES A;  1IV6 A;  1R5G A;  1X3W B;  2HOS A;  5IT9 K;  5HVQ C;  2KQR A;  2VOD A;  2D2W A;  3M8E A;  1VQN I;  1WI3 A;  4W97 A;  5CYV A;  2VN2 A;  3SDG A;  2JVG A;  3I59 A;  2XB0 X;  1K6O A;  5ED4 A;  4DYC A;  3ESW B;  2VIX A;  1LDK B;  2CUE A;  2MLK A;  2IRF G;  2BXY A;  3O8G A;  5FKM A;  3W3C A;  4RBO A;  3BG3 A;  1A35 A;  3RZO J;  5L3D A;  1JKR C;  3GX4 X;  1EKE A;  2QQB A;  2BEO A;  3OSF A;  2M45 A;  1AA7 A;  3HB9 A;  5TGT A;  3HIF A;  2CRG A;  3BG6 A;  4DIQ A;  3OYH A;  4G94 A;  2ID3 A;  2LTP A;  3CCE I;  2CW8 A;  3B73 A;  4BHB A;  2KDZ A;  1ZH5 A;  2XPU A;  2FE3 A;  3K4C A;  5HLH A;  4GFB A;  1EH6 A;  1A6I A;  3F6V A;  2IS4 A;  3IAM 2;  2KPM A;  4CSW A;  2MG4 A;  2IJL A;  4BL0 B;  2COM A;  2VOO A;  4P9U A;  3I4M J;  2HTJ A;  5IP6 A;  3QAH A;  1W36 C;  3WU1 B;  3V4G A;  2JA7 J;  4J00 A;  1W5S A;  3MZY A;  1FSH A;  2P7C B;  2R5Z B;  2F5F A;  3OR2 C;  4PK4 A;  3F3X A;  2VC1 A;  3N97 A;  2BGC A;  2M8E A;  2QUF A;  3HG9 A;  3L00 A;  4M73 A;  4RA2 A;  4CCM A;  2R5Z A;  3LSR A;  3H5N A;  1R5H A;  2L7Z A;  2R5Y B;  1YOV B;  4M9S A;  3O8H A;  3OL3 A;  2EBI A;  5JHF A;  1R5I D;  3DFG A;  3GO5 A;  4ENK A;  4EJO A;  3CO6 C;  3F8M A;  5HOD A;  4HF2 A;  3ZQI A;  4OU0 A;  2HTS A;  2L4M A;  4D7N A;  3CUQ C;  3W2A A;  3BTJ A;  5J6X A;  4BBS J;  1Y8R B;  3H3U A;  4JBA A;  3SEQ A;  4KNY A;  5FRO A;  2F5E A;  1PJR A;  3OY9 A;  1W5T A;  3CO7 C;  4XOR A;  2CWE A;  4UNO A;  5ILU A;  4BJT A;  2FQ4 A;  1ZRD A;  3W2W A;  4AD9 A;  2HR3 A;  3WHB A;  1SD4 A;  2R7T A;  5F0H A;  3CLQ A;  4C2M J;  2GA2 A;  2Z1D A;  1PUF B;  3HEF A;  1J5Y A;  1GT0 C;  1R36 A;  3CJN A;  1VQ8 I;  2DOD A;  2YU9 J;  1F36 A;  3AG2 H;  2LY2 A;  1KU9 A;  4MGR A;  1YX5 A;  2M4G A;  2DFI A;  2GXG A;  1WJA A;  3MQ0 A;  4FCY A;  3HUG B;  3MMY B;  2FX0 A;  2HDW A;  5IYB J;  3G6E I;  5F0C A;  2P5L C;  4EM1 A;  1RKT A;  3O3K A;  2YPR A;  2R7R A;  4V2G A;  1W5C C;  1XX5 A;  2DTR A;  5FRN A;  2LP0 A;  2QQA A;  2OTL I;  5BMZ A;  3L2Q A;  2VLA A;  1FYL A;  5LGU A;  2H1K A;  1MZB A;  2R7O A;  3P9I A;  4OIN F;  4NQW A;  1BL0 A;  4IX7 A;  1O7L A;  1B59 A;  4ZH4 F;  4WXC A;  2ME0 A;  3G1O A;  2EJR A;  1T95 A;  1ZGA A;  3MKL A;  2ZSH B;  2HQR A;  4WXH A;  4IHX A;  4A5N A;  5J47 A;  5EEA A;  2HXO A;  2OCE A;  3ABL H;  4DW6 A;  4P1W A;  1L0O C;  1WHU A;  5TJJ A;  4RGR A;  4E7J A;  2RV8 A;  3C2B A;  1MBH A;  5BPI A;  4ZDP A;  3DCF A;  1D1C A;  3M3Y J;  2QSF X;  4UUT A;  1T98 A;  4WX9 A;  2FBI A;  2O6G E;  1ETK A;  5K5R A;  4JOM A;  2K9L A;  3OIP A;  4GCV A;  3QPH A;  1LB2 A;  4M74 A;  5F27 A;  1IDY A;  4X6A J;  2XC7 A;  4HF0 A;  4KFC A;  4UV8 A;  3J81 K;  3I56 I;  2COB A;  3KP5 A;  3PO2 J;  4PSX A;  3H3Z A;  3R0A A;  2D5V A;  2DK8 A;  2K9N A;  2Y31 A;  1VTN C;  1Y8Q B;  4I2O A;  4O3M A;  5DD4 A;  4L9J A;  1MBK A; 
#chains in the Genus database with same CATH homology
 1LFU P;  4DZP A;  4QTR A;  4IHY A;  2FD5 A;  3S1R J;  4BBR J;  2R5Y A;  2HI3 A;  4FIS A;  5J1U A;  4ABZ A;  2M2E A;  2DMQ A;  5K7Z A;  2HOA A;  3A01 A;  1I6H J;  3HDD A;  5IP7 J;  5K7F A;  4B3A A;  4J19 A;  2PMZ N;  1RKW A;  3L1P A;  2FJ1 A;  4RDU A;  2O9L A;  1GV5 A;  4A69 C;  1XS9 A;  5IYD J;  2EZI A;  4XRM A;  2DA4 A;  2XGC A;  1FTT A;  3QQA A;  2NVY J;  4FTH A;  1CQT A;  3NAU A;  4I6Z A;  3TP0 A;  3RQI A;  2XPV A;  3GTO J;  3CMY A;  4XK4 A;  1X2M A;  3BR2 A;  3OOU A;  3Q0V A;  2GBY A;  3JR9 A;  2VKV A;  4S0H B;  1ZQ3 P;  2ME6 A;  3GTJ J;  3S16 J;  3S15 J;  2N8G A;  3LSJ A;  1JKP C;  1WH7 A;  3FK6 A;  2RAE A;  3IH4 A;  3HOY J;  4X1E A;  1SAN A;  1U9N A;  3HOU J;  3GBG A;  2NVX J;  3HM5 A;  2DA5 A;  3CCY A;  5M3F J;  4JX6 A;  2VUM J;  1I3Q J;  3BTL A;  4CYC B;  2LKX A;  3IV5 A;  3IH2 A;  1ITY A;  3HOX J;  5GPA A;  2DA1 A;  4D5C A;  1APL C;  3M4O J;  1JTX A;  1IUF A;  3H0G J;  1FJL A;  3JRH A;  3HOV J;  3ZQH A;  2LLK A;  4M6V A;  3GTQ J;  1JTY A;  2CUF A;  1X2N A;  4LOC A;  5FKN A;  1ENH A;  3FIS A;  5EDN A;  1GDT A;  3LNQ A;  5DS9 A;  4A3C J;  1B8I B;  1X58 A;  2O7O A;  5FKL A;  1XC5 A;  3QPL A;  1BJZ A;  3I4N J;  1FEX A;  1B72 A;  1BW5 A;  1OJL A;  4B1R A;  5FLM J;  2DMT A;  2DA6 A;  3BG9 A;  4JYK A;  3TW7 A;  4M3G A;  2DMP A;  3A01 B;  1K83 J;  2ECB A;  2M34 A;  2JA5 J;  3ZQF A;  4QSH A;  3S17 J;  2HYJ A;  1FIP A;  3JRI A;  2L7F P;  1Q1V A;  3JRF A;  2XSD C;  3GTG J;  3A03 A;  4HNV A;  5FKO A;  2GLO A;  2O8K A;  1NTC A;  1ZR4 A;  1Z0X A;  1W0T A;  4JX4 A;  2VKE A;  3VPR A;  2Y9Z A;  2OF7 A;  4W1U A;  1UMQ A;  2NS8 A;  3ZQL A;  1PUF B;  1G2H A;  4JP0 A;  2LY9 A;  4QIW N;  2M0C A;  1VND A;  1UG2 A;  2K9Q A;  2DN0 A;  3BTC A;  4XID A;  3DEW A;  4A3I J;  5C4X J;  1WPK A;  2XPW A;  3MVP A;  4M3D A;  5EGO A;  4V2F A;  2M9H A;  2JK3 A;  3OIO A;  2P81 A;  1HLV A;  1MH4 A;  4MFD A;  2Y9Y A;  3S1N J;  1MBG A;  2E2I J;  4L5E A;  2JA6 J;  5FLV A;  1MBE A;  3FIW A;  1H88 C;  1T56 A;  1ZGW A;  1K61 A;  2HQ5 A;  1FIA A;  1DU0 A;  4A93 J;  1IRZ A;  2R7Z J;  5K7H A;  2W48 A;  1ETX A;  4M3B A;  5EG0 B;  3E7L A;  4B4C A;  1ETV A;  3PO3 J;  2QF7 A;  3K2A A;  1ETO A;  4EEF G;  3LOC A;  2AO9 A;  5IOZ A;  1JKO C;  2WB1 N;  3ZOB A;  4Y7N J;  2XRL A;  1Y1W J;  3B6C A;  2E19 A;  1TC3 C;  2HOT A;  4A3D J;  3G1L A;  5J1Y A;  2E1O A;  2CJJ A;  3H3V K;  2JWT A;  1S7E A;  2IEK A;  1JUS A;  3S1M J;  2DTZ A;  2GM4 A;  2R93 J;  3QPS A;  1I50 J;  1E3O C;  1AU7 A;  5F0F A;  5EYR A;  3LSP A;  1ZR2 A;  5J3L A;  5FJ8 J;  3S1Q J;  2NS7 A;  5C44 J;  2IAI A;  1U8B A;  1R9T J;  1UHS A;  2K40 A;  3Q0W A;  2X6O A;  3BTI A;  2XGE A;  3GTP J;  5EGO B;  3BQY A;  2CQX A;  4XRS G;  4C3H J;  1QVT A;  3WHC A;  1F43 A;  4MIM A;  5BNG A;  3BG5 A;  1HOM A;  2MGQ A;  1RES A;  1MSF C;  5EF6 A;  1PUF A;  1TWG J;  1JKQ C;  2JMW A;  4AUX A;  2R0Q C;  5J1R A;  4AYB N;  2WV1 A;  5JLX A;  2CU7 A;  5JLW A;  2X48 A;  5E3M A;  4XRS A;  3D1N I;  1TWH J;  1GVD A;  3Q3S A;  4BY1 J;  3HKZ N;  4G12 A;  5IP9 J;  1JUM A;  1IG7 A;  3TP3 A;  3HOZ J;  1BA5 A;  4FE4 A;  5IPA A;  2DJN A;  2DMU A;  5GP9 A;  1MBJ A;  2L9R A;  3GTK J;  1OCP A;  1MNM C;  9ANT A;  2AHQ A;  4IHW A;  2LR8 A;  1HCR A;  2Y0S N;  5C3E J;  1NK3 P;  1IDZ A;  3B6A A;  4MLO A;  5EG0 A;  2EZK A;  2ECC A;  4MFE A;  5F1J A;  1RET A;  1IJW C;  2M8G X;  3BT9 A;  3FK7 A;  1JGG A;  3TW6 A;  3A02 A;  3BR5 A;  1QRY A;  2EQR A;  5EZG A;  4A3E J;  3JRD A;  3S2H J;  5F04 A;  1OFC X;  2YS9 A;  4AC0 A;  1LE8 A;  5EZH A;  3IH3 A;  2KT0 A;  2DA3 A;  2MW8 A;  4BKX A;  3JRC A;  2HDD A;  1TWF J;  1POG A;  3TED A;  1VF9 A;  2EH3 A;  5M3M J;  1AHD P;  1H89 C;  4IHV A;  2TCT A;  2HOS A;  5E3O A;  1IV6 A;  1RR7 A;  2DMN A;  4A3M J;  4BY7 J;  1WI3 A;  4BXX J;  4C3I J;  3RZD J;  1LE8 B;  4W97 A;  3SDG A;  2XB0 X;  3SJM A;  4DYC A;  5M5X J;  2HXI A;  3CDL A;  2CUE A;  1XG1 A;  3O8G A;  5FKM A;  3RZO J;  2DA2 A;  4RBO A;  3BG3 A;  5GPC A;  2MSY A;  1JKR C;  3BR0 A;  5IYC J;  3OSF A;  3HB9 A;  1AKH A;  2XGD A;  3BQZ A;  4UUS B;  2NVQ J;  2IBD A;  2CRG A;  4A3K J;  2JN6 A;  2LVS A;  3SFI A;  2ID3 A;  2LTP A;  1HDD C;  2G0E A;  2LFB A;  3MN2 A;  2KDZ A;  3NAR A;  2XPU A;  3S14 J;  4A3B J;  4GFB A;  1YRN A;  2H8R A;  1A6I A;  1HDP A;  1ETY A;  1WH5 A;  1B8I A;  1OCT C;  2LD5 A;  2MG4 A;  1VFC A;  3I4M J;  3PM1 A;  2CQQ A;  5IP6 A;  1GUU A;  5F08 A;  2JA7 J;  2OPT A;  1YRN B;  1MH3 A;  2DA7 A;  2R5Z B;  3BR3 A;  2LK2 A;  1JJ8 C;  4DYR A;  3JRB A;  1HF0 A;  1ZKG A;  3S2D J;  2R5Z A;  3LSR A;  4M3E A;  2L7Z A;  2R5Y B;  4Y52 J;  3F0C A;  3O8H A;  2JJ7 A;  2EBI A;  5E3N A;  5HOD A;  1O4X A;  4D5F A;  1H8A C;  1QPI A;  3ZQI A;  2JA8 J;  1A5J A;  5DTD A;  3JRG A;  4D7N A;  3BR6 A;  3BTJ A;  4BBS J;  2TRT A;  1IC8 A;  3UKG A;  2E2J J;  3ZQC A;  4A3J J;  3CQZ J;  4A3G J;  1T33 A;  4UUS A;  4CYC A;  4A3L J;  2X9D A;  1JT0 A;  1AKH B;  3OSG A;  2FQ4 A;  2L0K A;  1BW6 A;  2E2H J;  4D7M A;  1ETW A;  3WHB A;  3W6V A;  1Y1V J;  5F0H A;  3Q0U A;  4DZJ A;  4M3F A;  1LFB A;  2Y30 A;  4C2M J;  2R92 J;  3K7A J;  1ZK8 A;  3HEF A;  1GT0 C;  1WCM J;  3BR1 A;  2ZB9 A;  2QCO A;  5C4J J;  3GTM J;  2YU9 J;  1F36 A;  1SFO J;  1TWC J;  4FE7 A;  4A3F J;  4I76 A;  3RKQ A;  1JT6 A;  3LSG A;  4DYQ A;  4FCY A;  1Z77 A;  1JJ6 C;  1U78 A;  2FX0 A;  1P7I A;  1QVU A;  2VI6 A;  3HBL A;  5IYB J;  1TWA J;  5F0C A;  1NK2 P;  1RKT A;  2YUS A;  2Y2Z A;  3HGG A;  4V2G A;  2LP0 A;  1ORK A;  3FKI J;  2NVT J;  2H1K A;  5E3L A;  1W0U A;  3JRE A;  4JX5 A;  2I10 A;  1BL0 A;  1WGX A;  1U9O A;  2ME0 A;  3G1O A;  3ZQG A;  3MKL A;  3HOW J;  2B63 J;  3JRA A;  2K9S A;  4MO7 A;  1JUP A;  4IHX A;  2ID6 A;  5EEA A;  1FTZ A;  2HXO A;  5FKK A;  4IEJ A;  4DW6 A;  2ELK A;  2EZL A;  2VPR A;  1MBH A;  3C2B A;  1D5Y A;  1RPW A;  3DCF A;  4C3J J;  3M3Y J;  3HGY A;  2XB5 A;  4UUT A;  1ZTR A;  1IGN A;  4NDL A;  1ETK A;  3G1M A;  1VI0 A;  5IOY A;  2EZH A;  1MSE C;  2WAQ N;  3GTL J;  1MBF A;  1P7J A;  1ETQ A;  4XIC A;  5F27 A;  1IDY A;  4X6A J;  1GV2 A;  1DU6 A;  2NOG A;  2COB A;  3PO2 J;  2D5V A;  2K9N A;  5M5Y J;  2Y31 A;  5M5W J;  1EF4 A;  2L7M P;  1B72 B;  1MBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...