1YRNB

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnB00
3JR9A 3CMYA 2ECBA 1WI3A 1T56A 2WAQN 1Q1VA 4W1UA 2N8GA 3BG5A 3JRGA 2DMPA 3Q0UA 2E19A 4AUXA 2DMTA 3S1RJ 3GTOJ 2NOGA 5FKKA 2I10A 1ORKA 1VI0A 3RQIA 1FEXA 2YU9J 2LY9A 3GTLJ 3BR6A 1BL0A 3BQZA 2JN6A 2DMQA 1X58A 3BR0A 3D1NI 1VF9A 1IJWC 2WB1N 2X48A 2VKVA 1OCPA 3LOCA 1I6HJ 3A01A 4QSHA 5GP9A 5IPAA 4UUTA 2NS7A 3OOUA 5K7HA 3CDLA 2R93J 1ZQ3P 1JTYA 5EYRA 4L5EA 3NARA 3BQYA 3I4NJ 2HXIA 1GDTA 1JKRC 4DZPA 1MBJA 5EZHA 2R5ZB 3S2DJ 4MO7A 4JX6A 1RPWA 4ABZA 4FCYA 4Y7NJ 5DS9A 3S1QJ 1B8IB 5FKLA 4B1RA 2ZB9A 2EZHA 1JJ8C 1F36A 2WV1A 9ANTA 3HOZJ 1ZGWA 3GTGJ 3O8GA 3Q0WA 1RR7A 1Y1WJ 1MH4A 2Y9YA 1ETKA 1IDYA 2JA6J 1PUFA 1MBGA 1ZKGA 4UUSA 2DMNA 4D7MA 3DEWA 3LSJA 4EEFG 1H89C 3GTQJ 2JWTA 2D5VA 4IHVA 1OFCX 3S15J 3Q3SA 4BKXA 2QF7A 1VNDA 4LOCA 2E2JJ 2XRLA 5C3EJ 1MH3A 4M6VA 1JUSA 3O8HA 3JRCA 4DZJA 3WHCA 2GBYA 3B6CA 3M3YJ 2XB5A 1TWGJ 1TWAJ 1JGGA 3OIOA 1T33A 2LK2A 1PUFB 5M5YJ 4BY7J 3H0GJ 2QCOA 3JRIA 2AO9A 5M3FJ 2VKEA 2IBDA 4A3KJ 1WPKA 4J19A 2NVQJ 4A3CJ 2K40A 1IG7A 4A3BJ 2B63J 3VPRA 2JK3A 3WHBA 2JJ7A 2R5YA 2JA7J 2HI3A 5J1RA 2VPRA 1CQTA 2IAIA 5EG0B 1D5YA 2DA7A 3TW7A 3OSGA 4XRMA 2X6OA 1TWCJ 3S17J 2NVYJ 3HBLA 2CUFA 2JA8J 4JYKA 2XB0X 2HOTA 4M3FA 1FIPA 4A3DJ 2CRGA 5IYCJ 1G2HA 3LNQA 3ZQLA 2TCTA 3BTLA 4DYCA 3HOXJ 4B4CA 1U9NA 2R5YB 5K7ZA 1MSEC 5E3MA 3FIWA 3RKQA 2G0EA 2LVSA 4A3FJ 3G1LA 4FE4A 5F08A 3S1NJ 2Y9ZA 1K61A 1Z0XA 3BR2A 3E7LA 3QPSA 3HOYJ 4C3IJ 3LSGA 3Q0VA 2X9DA 1P7JA 1TWHJ 4FE7A 4V2GA 5EGOB 1RETA 4BBSJ 5F27A 3JRAA 3W6VA 1B72B 2DJNA 1H8AC 1VFCA 5F0HA 4M3DA 2FQ4A 4X1EA 1IV6A 4CYCB 4B3AA 1W0UA 1WCMJ 3GTPJ 4IHWA 1LE8B 4DW6A 4BXXJ 4A3MJ 2R5ZA 2LLKA 5E3NA 4XIDA 2EH3A 1R9TJ 2YUSA 3MKLA 2ID3A 4C3HJ 1SFOJ 3BT9A 1APLC 1OCTC 4AC0A 2NVXJ 4X6AJ 2M9HA 1B8IA 3FKIJ 3HKZN 2LD5A 3BG3A 4M3BA 3F0CA 3JREA 4S0HB 2ID6A 3HGYA 4W97A 5J1YA 2COBA 3UKGA 3G1OA 2JMWA 5DTDA 4A3EJ 3ZQIA 5E3LA 4AYBN 5GPAA 2RAEA 2DA4A 1SANA 2OPTA 3BTIA 3K2AA 1A6IA 3MVPA 2H8RA 3K7AJ 2L9RA 2LKXA 5EF6A 4JX5A 2O8KA 2R92J 2DTZA 4MFDA 1HF0A 2EBIA 1YRNB 3BR1A 1FTZA 2XSDC 3ZQFA 3PO2J 4FTHA 3GTMJ 3H3VK 1IDZA 1RKWA 2DA3A 3GBGA 2XGEA 2K9SA 4MFEA 2EZIA 1ITYA 1HDDC 5EEAA 3IH3A 1X2MA 1K83J 2JA5J 5FJ8J 1ZTRA 5F1JA 5EG0A 3BTCA 2K9QA 1NK2P 2TRTA 2M8GX 4A93J 1FTTA 2XPWA 1HOMA 2EZKA 5F04A 1ETYA 3IH2A 3HOWJ 1DU6A 1RKTA 1TC3C 3PM1A 1Z77A 2Y30A 3FK7A 4FISA 4Y52J 4QIWN 1ZK8A 2H1KA 3B6AA 1JT0A 3ZQGA 5M5WJ 2YS9A 5JLXA 4JX4A 3TW6A 1BW5A 5JLWA 3CCYA 2MG4A 1POGA 5IP6A 5M3MJ 1H88C 4A3IJ 1HCRA 4DYQA 5C4XJ 1JT6A 3HOVJ 5IOZA 5EGOA 2L7FP 3QQAA 5IYBJ 4JP0A 4M3EA 2R0QC 1B72A 1U78A 1AKHB 1ETQA 1IC8A 2LR8A 2M2EA 4CYCA 2E2HJ 3JRBA 2VUMJ 3HM5A 1LE8A 3L1PA 2EZLA 5IP9J 1BW6A 2FX0A 4RDUA 1QRYA 5F0CA 5IOYA 2K9NA 4BBRJ 3LSPA 1GV5A 1XG1A 2FJ1A 3BTJA 2ME0A 5FKNA 1I3QJ 1HDPA 3TEDA 2LFBA 2CU7A 4I6ZA 1NK3P 2DA1A 1AHDP 5HODA 1O4XA 2M0CA 2Y31A 4D7NA 1I50J 4V2FA 5FKMA 3M4OJ 1GUUA 2IEKA 3JRDA 2HOAA 1UG2A 3BG9A 2CUEA 3DCFA 1A5JA 3I4MJ 4IHYA 3HOUJ 3IH4A 1QVUA 5J3LA 2PMZN 1UMQA 4MIMA 1U9OA 1Y1VJ 2E2IJ 2MW8A 3GTKJ 2NS8A 1LFUP 1YRNA 3SJMA 1JTXA 1WH5A 2ECCA 2HYJA 3LSRA 1X2NA 2LTPA 1MBFA 2W48A 2HXOA 2DMUA 1WH7A 1FJLA 3CQZJ 4D5CA 3JRFA 3BR5A 4GFBA 1IGNA 5FLMJ 4IHXA 1UHSA 3C2BA 3SFIA 1MBKA 1IUFA 1MSFC 2P81A 3OSFA 5F0FA 4A3LJ 1JKPC 4I76A 1FIAA 3MN2A 4QTRA 2CQQA 2HQ5A 2R7ZJ 5FKOA 2GLOA 4BY1J 4D5FA 2L7ZA 2CQXA 1NTCA 2DA2A 2O7OA 3A02A 3TP3A 3RZOJ 1BJZA 4NDLA 4A69C 2FD5A 5C44J 1MBEA 1JKQC 1ETXA 1QPIA 1IRZA 1EF4A 2EQRA 3A01B 4HNVA 2E1OA 3FK6A 4A3JJ 3SDGA 2MSYA 1WGXA 3HDDA 2M34A 5M5XJ 5C4JJ 2ME6A 5IP7J 5IYDJ 3GTJJ 4XK4A 4M3GA 1QVTA 1AKHA 2LP0A 1BA5A 2ELKA 3HB9A 1AU7A 1MNMC 5BNGA 1JKOC 1GVDA 4XRSG 2XPUA 5J1UA 2Y0SN 1U8BA 2CJJA 3NAUA 1MBHA 4RBOA 3IV5A 1ZR4A 3FISA 5E3OA 4IEJA 2DA6A 1E3OC 4UUSB 2HOSA 3HGGA 4DYRA 2AHQA 4A3GJ 1ETOA 3JRHA 2MGQA 1ETWA 1GT0C 5GPCA 2L0KA 2L7MP 2HDDA 2XGDA 2XPVA 3ZQCA 1F43A 1W0TA 1JUMA 1JJ6C 5EDNA 3S14J 3RZDJ 1HLVA 1XS9A 2OF7A 3S1MJ 4G12A 1OJLA 4C2MJ 2GM4A 1TWFJ 4XICA 1ENHA 3HEFA 3S16J 3TP0A 5K7FA 1DU0A 1LFBA 2KDZA 3G1MA 4C3JJ 2VI6A 2NVTJ 5FLVA 1P7IA 3A03A 2Y2ZA 2DN0A 4MLOA 3ZOBA 3PO3J 1S7EA 1ZR2A 3QPLA 1ETVA 3S2HJ 1RESA 1XC5A 1GV2A 2KT0A 1JUPA 2XGCA 2DA5A 3BR3A 2O9LA 5EZGA 4XRSA 3ZQHA
chains in the Genus database with same CATH superfamily
3JR9A 3V7CA 2CW8A 5E18F 1Q1VA 3J81K 2N8GA 2DMPA 1ZHFA 3Q0UA 2NOJB 4AUXA 4CGZA 4YFNF 4I0AA 4MQVA 1I5ZA 4F91B 1YW7A 2HNHA 4BHBA 4HV5A 1YO5C 2QQ8A 1FEXA 2X85A 2YU9J 2LY9A 3GTLJ 4QPOA 3KETA 1UFMA 3BDDA 2E60A 2F5VA 3BR0A 2LDUA 1J0RA 1VQPI 4EM0B 1SVOA 2UXNA 2WB1N 4L5JA 1O3QA 3VYUB 2BXYA 2RQQA 2VQLA 2LRDA 3ZRGA 2XRNA 2R93J 3CESA 1SC7A 3GUDA 2CW7A 4OAZA 1J9IA 2PMZA 2HU9A 2R5ZB 3S2DJ 4MO7A 4HLXA 4Y7NJ 1U6GA 4Y4RA 1V5EA 5GTIC 3NRVA 2ZB9A 2JPBA 1FSEA 1F36A 1MZBA 1RRJA 2OJED 3HOZJ 2CV1A 1HC8A 1WVRA 3GFLA 4LIUA 1ZKGA 2J5OA 4UUSA 1D5VA 5B66C 2LY1A 1S29A 4XLFA 3OYNA 4IOCF 3KX2A 2IS1A 3OS2A 2ZJPF 4BKXA 5DEQA 2QF7A 1R6RA 3HHHA 3M9AA 4LOCA 5E8IA 2XRLA 4MTDA 2PLYA 3O8HA 3EDPA 4IPAA 3EUHC 4HPQA 1WJEA 5FFXA 1G4DA 2Y69H 4WWCA 4DZJA 2VT3A 2XB5A 1KZHA 1TWGJ 1ZG3A 4LLNA 3PIPF 3AL0C 4E6KG 4E7LA 2V1XA 2NS0A 1BI2A 2CUJA 3JAMZ 1PUFB 2QVOA 3HRSA 4UY8I 2IRFG 2DT5A 2ESHA 2KIMA 4ENNA 5M3FJ 2R7QA 2VKEA 2WWYA 5ED4A 2TDXA 3S32A 4A3KJ 2KDOA 2NVQJ 2K40A 4A3BJ 1L3LA 1YJNI 1XDSA 3L2CA 2R5YA 2FBHA 1FBQA 2HI3A 1O3TA 1HKTA 2H6BA 2L3DA 3FKJA 2F5FA 3TW7A 1K78B 1WJ5A 2X6OA 1FY7A 5DM6F 3FXMA 2XB0X 3ZMUA 2DK8A 4ENKA 3I59A 2HOTA 3H9JA 5ERIA 1LNWA 2DFIA 1CF7A 1T0FA 3DBLB 1T98A 4G8XA 1TQIA 2KRCA 2K5CA 3PUBA 2BY1A 4HF0A 1T39A 4B4CA 1Y0NA 2Y0SA 2X6YA 2PMHA 1X1AA 3H1CA 5K5RA 3JCUC 4XKCA 3ERED 5E3MA 3ZCOA 3ZMTA 3RPUA 2G0EA 3L2WA 3SXYA 2DDBA 4G7HF 3SFZA 2V79A 1MMNA 4XM3A 1K61A 3HOYJ 5D8LB 1MGTA 1IN8A 2WA0A 2ZXHA 5ICGA 1WQ2A 3GZNB 4A0YA 4AD9A 1FSHA 4FE7A 2BY2A 3IWFA 2MLKA 3HC7A 5F27A 2DJNA 1O57A 2P4WA 1VFCA 1HBXG 2JTVA 4F93B 4X1EA 2FQ4A 3R60A 1IV6A 4CYCB 1MDMB 3GTPJ 1G59A 4DW6A 4G94A 5H2FC 4L0ZB 4LFUA 3SEZA 3SZPA 2LKPA 3MKLA 1SD4A 3N05A 3A1YA 4XN3A 2JUCA 3QOEA 4DBQA 1OCTC 2NVXJ 1BC8C 2X0LA 1B8IA 1OLTA 1R49A 2RC4A 4M3BA 1DUXC 3MAJA 2ZSIB 4S0HB 2K9LA 1STZA 4N4NB 3V42A 1FNNA 2WY8Q 4LG0A 2ID6A 1VQ8I 1SAXA 2VN2A 1LEAA 2X6WA 3HIFA 2JMWA 2NXNB 5DTDA 2ZJQF 4A3EJ 1FYLA 3REOA 3ZQIA 3K69A 2GWRA 1XGSA 3IAS2 5BMZA 3FHNA 2DA4A 1SANA 2OPTA 3FXUA 2ICWG 3DF8A 5CQEA 3BOQA 3VDXA 2VQHA 2H8RA 2CUZA 3K7AJ 2L9RA 3QYFA 5HS9A 4WXHA 2DTZA 3B73A 1HF0A 2EBIA 4CCOA 4KDPA 2QSGX 1G3SA 4RGUA 1VQ9I 3P9KA 2XASA 3OY9A 4FTHA 1IN4A 1ON1A 3ZGKA 3L00A 2DT7B 5HNHA 1RKWA 2E1MC 2EZIA 2QBYA 3IH3A 3V8KA 3DKXA 5ILSA 1X1PA 1LUJB 2QLZA 5FJ8J 4RGRA 1W36D 1N75A 5BS6A 4IZZA 2OQRA 1I6XA 3R0AA 2E5NA 5HS7A 4ETSA 1LEBA 1R4NB 2M8GX 4HA8A 2DK5A 1HOMA 5F04A 2FOKA 2OZUA 4YIIA 3TOBA 2D2WA 4EGZA 2BY3A 1RKTA 2G7UA 4ZYAA 4MQ9F 1VTNC 2KFDA 3ONQA 1EV7A 2ESNA 1S72I 2V1UA 5JR3A 2NRAC 3WTWC 3DPTA 3L09A 4LITA 3CJTB 1UB9A 3ZQGA 1X4OA 4UV9A 5AIPA 3CMEI 1BW5A 5JLWA 3GWZA 3HUGB 3CCYA 3V8LA 2CYYA 4L9JA 1PJRA 2OCCH 4Y13A 2DYRH 2WAFA 2EIMH 2A6EF 3OIPA 2E34A 2A5YB 4MNUA 2BEOA 4DYQA 3E0JB 5J40A 2VKHA 2W00A 3QQAA 4QLCU 1AKHB 3I54A 4ZYDA 3DPLC 1DDNA 1O3SA 2M2EA 3ZN0A 2K27A 2E2HJ 3L1PA 1BW6A 2CFOA 3ROUA 1MW7A 2ADUA 1XG1A 3HOSA 3BTJA 3QOPA 2QQAA 4YEJA 2XSJC 4FT8A 1IRGA 1W5SA 2PFBA 2RV8A 2RVCA 3LSTA 2O8XA 4H4KC 5KK1A 3VYTB 2M0CA 4D7NA 2QZ8A 3G4SI 1I50J 2HQAA 3DQVC 5FKMA 5K5QA 1EH6A 1PP8F 3DTEA 1GUUA 2IEKA 3DTKA 2HOAA 1IRXA 4IHYA 3IUOA 3VEPA 3F22A 3HOUJ 4U0VA 4AM3A 3NWTA 1U9OA 2MFZA 2E2IJ 2RNGA 4BDYA 5JFRA 4E7JA 1WFXA 1SVLA 2NS8A 2Z3YA 1LFUP 1OISA 1BJAA 3QAHA 1A36A 3ABKH 2COMA 3SJMA 2LKSA 1JTXA 2ECCA 4PGGA 4Y15A 3CD6I 4IL6C 2KRFA 1ACIA 2HXOA 2P5VA 3E6MA 1WH7A 1R36A 1D8KA 3ESWB 3TKYA 1JHFA 4I7HA 3U9GA 2GAUA 3BG7A 3BR5A 1IGNA 2XDVA 1MBKA 1IF1A 1D0YA 3WU0A 2A61A 1JKPC 3MN2A 4FETA 2IGOA 4QTRA 2OQGA 1YG2A 1C0WA 2ZC2A 4PK4A 3ABUA 4D5FA 5EEHA 4IQJA 1YHQI 3COAC 5ICFA 3RKWA 5HLTA 4A69C 2VLAA 2OCEA 1I27A 5FGMA 2OA4A 1ETXA 2ZXIA 3KCCA 4Y3OA 1W7PD 1E3HA 2QUFA 3E1SA 2K4BA 4C9YA 5DV5A 2FE3A 3H3ZA 2O6GE 3SDGA 2BVMA 1WGXA 5EEGA 3AG4H 2NVUB 4AYBA 4EJOA 1MD0A 2Y48A 1NG7A 4I99C 3TMOA 4B48A 1KU3A 5M5XJ 3K10A 2EV0A 1YOVB 1BI0A 3S3MA 2OBPA 1YTYA 3HZJA 3I4PA 4U0YA 3F3XA 5E1WA 4UNOA 1S3JA 2B0LA 1AU7A 2LSOA 5BNGA 4IJAA 4ZDPA 1XCBA 1GVDA 5B5EC 4RB3C 2XPUA 4HZFA 5J1UA 1D0XA 2XAJA 2M7BA 4Y17A 4RBOA 5DYMA 1ZR4A 2IGNA 4IEJA 4UUSB 3HJEA 4BE1A 3HGGA 4DYRA 2WC2A 3OYLA 2LMDA 1GT0C 2VBZA 3JW4A 2XC7A 2M4GA 3HRMA 2HDDA 2QQBA 1W0TA 3S14J 2YPRA 4HG2A 3C2GA 3CTAA 5BOXA 3FMRA 1BBYA 2ISYA 1X4PA 3QYBA 1HLVA 1XS9A 2OF7A 4G12A 2HFHA 1FBUA 4P1WA 4XICA 3FXRA 4CSWA 5KHDA 1OR7A 2R7SA 1Z67A 3BZKA 4F3QA 5K7FA 3BCBA 2ZMEC 4WXDA 3F9KA 5H6RA 1DU0A 4PGHA 3W6JB 2F5CA 4ZDOA 3WTVC 2VI6A 5FLVA 5HNFA 3KP6A 3PO3J 1LVKA 1KU2A 1ZN2A 2XROA 4RA2A 3PFIA 5F1RA 2CGPA 4BQOA 3DEEA 3S2HJ 3K2ZA 2L02A 4RM3A 1LPQA 1REPC 2DQRA 2IVMA 2EFWA 2HEOA 3I59B 3OYHA 2FSWA 1UCRA 3SZGA 4ON0A 2O9LA 1R1TA 1CF7B 4XLEA 2DAOA 4XSZF 1EKEA 4M6YA 4UXNA 1SFEA 2ECBA 1WI3A 4HF1A 1X3UA 3KE2A 4L5IA 2I5UA 4A6EA 4E7KA 2FBKA 1BR4A 1B9NA 2E19A 2DMTA 3HL2A 3S1RJ 2DTRA 2VXZA 2I10A 3DV8A 1ORKA 3ISPA 2VJ5A 1VZ0A 1W5CC 1YX5A 2A68F 4RB0A 4HRIA 3HHGA 1YS6A 2BBYA 5ILUA 5CPRB 1BL0A 5BQTA 3T8TA 4BE0A 3LSKA 1VQ7I 2VQCA 3IHUA 1I3AA 1Y56A 2MC3A 1I6HJ 2A5WA 1TW2A 2GOXB 4J01A 4EVIA 1P4WA 1X19A 2YX4A 2Q1ZB 4N0BA 1ZQ3P 3O3KA 3KEQA 1JTYA 4KMUX 1FMWA 5EYRA 3NARA 3CCJI 2AS5F 4KMFA 2DOAA 3OYDA 3F6VA 4XMYA 4YFKF 1MBJA 1OYYA 3BP8A 4AVPA 2EPFA 4BJ6C 1SFXA 2EFNA 1G3WA 4EATA 2A05A 4JQFA 4RB2C 2ZFUA 5DS9A 3S1QJ 4G6DA 1T38A 2K7LA 1B8IB 1UELB 1QNTA 4BQNA 1R71A 2HZDA 2EZHA 3TGNA 4ZJZA 2WV1A 3O8GA 4G9YA 4CCMA 1XGMA 2R7XA 1RC9A 3A0BC 1E3PA 4LG0B 1MH4A 4RGXA 4FX4A 4AU7A 1IDYA 2JA6J 1B59A 4NC6A 2DMNA 4D7MA 2WB1A 4M74A 2EILH 4B8XA 4EEFG 1XPXA 2JWTA 2D5VA 1LQ1A 4NNJA 2VC0A 3S15J 3R61A 2XF6A 2E35A 4U88A 3FXKA 2E2JJ 5GAEJ 1MH3A 4M6VA 3HTSB 1JUSA 5JVTA 4D0PA 2AXLA 2EB7A 5LGUA 2EV6A 3QYEA 4B44A 3BJOA 1LVAA 2EJRA 3HSRA 2MA3A 2LK2A 3K4MA 2VBXA 3H0GJ 2QCOA 5ICEA 5KNLA 2AO9A 3F21A 2QBYB 1TQMA 2L2OA 1T95A 5A2QK 4A3CJ 4LD5A 2FRHA 1QBJA 4HOBA 3VPRA 3W2VA 5FD5A 2JA7J 3OYJA 1QO0D 1CQTA 4XOTA 2EWNA 2OU2A 4BL0B 1TWCJ 3P7NA 3S17J 2BW3B 4JYKA 3BPXA 1KQ9A 2O5RA 1ERDA 1F1ZA 2L54A 5FB2A 3S8PA 4IOAF 3I53A 2BXZA 5IYCJ 5TRDA 3WU2C 2TCTA 2ZXJA 2IS2A 2KJCA 1MJ9A 4IRIA 2DOEA 4PJMA 2OTLI 1IN5A 3FIWA 2AQEA 4HQMA 4ANJA 2MYSA 2LVSA 5D4SA 1FOYA 3G1LA 1GLNA 4HEA2 3W6KB 4XKVA 2BGCA 4GCVA 3S1NJ 4L9NA 2R7RA 2DFEA 4C3IJ 2W25A 4BQQA 2WTEA 3EYYA 3OYKA 3AG3H 4ZH4F 4BNCA 3W6VA 2F4OB 3ABMH 2ZKZA 4WK8F 5F0HA 4E7SA 2Q0OA 2B9SA 3S3NA 1MNDA 3GEZA 1TNTA 1TLHB 1PYVA 1IXRC 2L4AA 3N4MA 4EJUA 2LLKA 1MNEA 4ZZDA 4XIDA 3GX4X 4G6TB 1YJ9I 4XLPF 1APLC 3WGHA 2OD5A 4XN0A 2HKOA 1Z7LA 2FQ3A 4I98B 1SMYF 3HKZN 4KJZA 2NAZA 3BG3A 3JTGA 2R3SA 4YG2F 2O0YA 3EUHA 4C2UA 2IT0A 1YLFA 4ESFA 3HGYA 4BDZA 3ASNH 5J1YA 2GA2A 3UKGA 1ZLJA 1V4RA 3G1OA 3JSOA 3CC4I 1H9TA 1H0MA 3MQ0A 1BR2A 2WAQA 1YW8A 4AIJA 3LSIA 5GPAA 2DT6A 2W4SA 4J00A 1OCZH 3V7SA 2KPMA 1O7LA 4KICA 2R92J 5FFZA 4JX5A 2O8KA 2MBFA 2PN6A 3BR1A 3VODA 1G3TA 2DFHA 2R7FA 3OYMA 2HWVA 4PSWA 4P96A 4OIQF 3GTMJ 1YX3A 2IW5A 3W2WA 3N97A 3OS0A 2DA3A 3GBGA 3KPHA 2QGUA 3CCEI 3D5RC 3LWFA 3GCMA 1K4SA 1GVJA 2HTSA 2JVGA 1IXCA 1K83J 1WJBA 2ISZA 3T8RA 3HYIA 5F1JA 4LG3A 1Y6IA 2K9QA 4IX7A 1FOKA 2E1NA 1UAAA 2TRTA 2FOWA 1R1VA 2AQFA 1FTTA 2ELHA 1W5TA 3MMYB 3IH2A 4GRIA 4N9IA 5JI6A 3HOWJ 3I71A 4BEHA 4KNYA 1DU6A 5CKTA 5GTHC 1TZLA 3WE2A 3F72A 2KJBA 1MJBA 3GFJA 3PM1A 1GHCA 1D8JA 1Z77A 2Y30A 1WRJA 3FK7A 2QKLB 4FISA 2B7EA 4QIWN 1ZK8A 2H1KA 1V54H 2G7HA 4ZTJA 2OUMA 5D6EA 4QPQA 4G6QA 3TW6A 4I2OA 1TL8A 2CQNA 1W1WE 3PIOF 3MKZA 3CCUI 2VQGA 1J75A 3L2QA 2XAHA 2CWEA 3H5NA 3H35A 2LC2A 5D5VB 3GYHX 3KP2A 3HOVJ 1J7KA 5IYBJ 4JP0A 4M3EA 2R0QC 4G7ZF 1U78A 1IC8A 4LB6B 3MEXA 2ACJA 2VUMJ 3JRBA 3HM5A 3DBHB 4DIQA 2VJJA 3DU6A 4M73A 2EZLA 3CP8A 1FOXA 3BPVA 3ZP5A 2L9NA 5IOYA 3TDZC 2QSFX 4X0GA 4CHUA 1GV5A 3FXOA 4F92B 4P5OA 3CUQB 3TL4X 5L3GA 3CCMI 1HDPA 3TEDA 4LB5A 4IHTA 2LFBA 3CDHA 1QGPA 3G6EI 1FP1D 1O4XA 5TJJA 4V2FA 1OCOH 3M4OJ 4M71A 2X1DA 1Y39A 1R22A 3GFMA 3EETA 2CUEA 2P5LC 1F5TA 5KAIC 3ASOH 3GXOA 1TT0A 3I4MJ 2LY2A 3ZXSA 1YQAA 1G3YA 2EV5A 1QVUA 2OAZA 2PMZN 2YX7A 1XSXA 2MW8A 4KIGA 3ECOA 3GTKJ 4S04A 3KP5A 2GXAA 1UJ8A 2HYJA 3LSRA 1PDNC 3BZCA 1T8IA 1MBFA 4L9TA 3CJRB 2V4JC 2DMUA 1KYZA 3K6GA 3OR1C 1ZG1A 2A3SA 2LF7A 4CYDA 4D5CA 3RCOA 1BOBA 3E6CC 3CJNA 5HOOA 1DPUA 2CQKA 1USSA 1FZPB 4GFBA 2QYOA 1MKMA 4IHXA 1UHSA 2CSOA 2JQ7A 1JXSA 5CVRA 3OYGA 1IUFA 1WJFA 3IL2A 3CLQA 3P9IA 4M6XA 2UV1A 3OSFA 2ZXWH 4I76A 3AAFA 2K85A 3EUAA 3T5XA 3MKWB 4NHJA 1YS7A 2CQQA 2HQ5A 3DKWA 2R7ZJ 1Z6RA 5LGTA 4CCNA 1ODDA 2GLOA 5K5OA 4GO1A 2CQXA 3TP3A 3V7RA 3FMSA 1BJZA 2ZCWA 2FMLA 2M4KA 2WBMA 5C44J 3FX3A 4EM1A 5FLXK 2M1BA 2XUBA 2HVQA 4LMYA 5FRMA 3E5UA 4ESBA 3C2HA 3CO7C 2FF4A 3DP7A 3HSFA 4I0BA 2EQRA 3I58A 4HNVA 4NUBA 3WTYC 3FK6A 3H0DA 4H0EA 3DKYA 4BUPA 1OYIA 1D1BA 2JPCA 2GIVA 2DOFA 4BXFA 2V1NA 2FUG2 2D1VA 3RTRA 1K7AA 2VOPA 2M34A 4KA4A 2CW0F 3D5SC 3K4CA 3PUFA 3K9TA 4EJWA 1ZREA 4AIDA 1ZRDA 2CS3A 1QZZA 1U5TB 2XKPA 2CG4A 4M3GA 1QA6A 5AIQA 1BA5A 5AONA 2V9VA 4KITB 2ZBKA 1EJ9A 3WTTC 4XRSG 3PSFA 3C18A 4ZDLA 2Y0SN 1IO2A 4ZYEA 5DDGA 1MBHA 4FQGA 2JVHA 3FISA 4XBFA 2JUGA 2DA6A 1E3OC 2V1DA 2CV2A 2VE8A 1Z3XA 4A3GJ 4E4HA 4UUVA 1ETOA 4LLGF 4BQAA 1ETWA 2XF5A 1XN7A 1BM9A 4E70A 2XPVA 4RGSA 4XONA 1JUMA 5EDNA 5D8KB 3H9GA 2QM3A 3GVAA 2GA1A 1IXSB 1OJLA 5HS8A 3S1MJ 1A6QA 3KLNA 3ZMDA 2E71A 2STTA 4A2UA 3WTUC 3TOAA 4U7DA 4UB6C 1E17A 1LFBA 1ZAOA 4A6DA 2KDZA 1J59A 2XV4S 2DCEA 2IA0A 3SQNA 2NVTJ 2H94A 1PVEA 2Y2ZA 2DN0A 1B1BA 4LK0F 4MLOA 3IRQA 4E7HA 1FLIA 4AIKA 5D4RA 1ZR2A 3BJAA 3ZN1A 3FXJA 5L3CA 2VODA 3HSEA 5IT3A 1RESA 2HOEA 1RNLA 1N25A 2E5ZA 2XGCA 1V55H 4BGDA 2DA5A 4KUMA 1U3EM 4ZZLA 5EZGA 3OS1A 2KIUA 2XIGA 4YFXF 1Z91A 2Z16A 3ZQ7A 3K4JA 3K4LA 3KLOA 4Z6YA 2P8TA 3BG5A 3FHZA 3MFKA 1E0EA 2DO7A 3J7AO 3GTOJ 2HZTA 1VI0A 1YJWI 3MCZA 3RQIA 4B47A 4IHSA 3M1EA 4XLHA 3JAMK 4PJLA 2L5QA 1W4MA 4DBRA 3BR6A 1R00A 5DCFA 5D5WB 2DMQA 1IJWC 3NEUA 3DWLE 3I3LA 2VKDA 3VSKA 1UZCA 1OCPA 2VKVA 4M9XA 3M8JA 4QSHA 4UUTA 3PQKA 2XVCA 4RAYA 5JHFA 3LMMA 3OYFA 2BHYA 2NS7A 3OOUA 5K7HA 4OWRB 4L5EA 4AWXB 3I4NJ 3T1BA 4PSXA 2FXAA 4DZPA 3GMEA 4IRHA 4JX6A 1RPWA 4FCYA 1TNSA 4NBQA 2HS5A 1QQIA 2W57A 3A0HC 3CCVI 4EM2A 5JVGF 2Z2SB 1XDUA 5J47A 2IP2A 4FHTA 5E79C 3KFWX 3K4KA 1XCVA 3WTXC 1JJ8C 1GXQA 2VL8A 5GAGJ 1ZGWA 1RR7A 3ZMVA 3QPHA 2Y9YA 1ETKA 1PUFA 2CMPA 2L01A 3KP7A 4P9FA 2CQ7A 4HDVA 1DP7P 3E97A 3DEWA 3LSJA 4HAMA 3DFGA 1H89C 3H5RA 3AL0B 4IHVA 2ZMEA 3CO6C 1OFCX 3ZMSA 5C3EJ 1YYVA 2QKMB 2R4GA 2WY7Q 3K1PA 2A69F 1X3WB 3J81Z 3OYAA 1D1CA 1WJCA 3AFHA 3B6CA 2Y75A 4CZCA 4NQWA 1TWAJ 1BC7C 1BOAA 3OIOA 4V19K 4KFCA 1W36C 5M5YJ 1NH3A 2HTJA 2V6CA 3HXLA 5KCMA 3JRIA 1XMKA 1T2KA 2E36A 1FWZA 4K2EA 1IG7A 4KISA 1G6NA 2JJ7A 1WZ2A 5J1RA 4CCJA 2VPRA 5H6QA 2ZO4A 3O2PE 3OSGA 4XRMA 2VASA 2NVYJ 3HBLA 1XGNA 4LJZF 2F6CA 2M0MA 3F8CA 3GO5A 4E7IA 3LSMA 3MD2A 1SD6A 1TW3A 4BEHB 4A3DJ 3E3VA 1J09A 1G2HA 4EV0A 1KU7A 1ULYA 2MH9A 2P6SA 3LNQA 1BI1A 3BTLA 3HOXJ 1IZ1A 2G9WA 1BR1A 5BPIA 1VQOI 2A6HF 4MEYF 2Q2EA 1HSTA 1Q1HA 2R5YB 5K7ZA 1FPQA 2DI3A 1MDMA 1ZRCA 2LOOA 3BLYA 2F2EA 3RKQA 5LEJA 4A3FJ 5F08A 2M5WA 4FE4A 2X4HA 3AG1H 4UVBA 2Y9ZA 3FZVA 4KN4X 1Z0XA 3E7LA 3WGIA 4XNFA 1R1UA 3PL8A 1P7JA 2KL4A 5LHGA 1TWHJ 3CUOA 4CXFA 3FF5A 4V2GA 4DNCA 4BBSJ 3HRUA 1XB4A 4GXOA 5CYVA 4CICA 4KT5C 4M3DA 1BIAA 2IGKA 1WCMJ 4S05A 2IXSA 3QWLA 3AKZA 4IHWA 5ICCA 3VSLA 4A3MJ 3IWZA 3WU1B 4BJTA 3CUQC 2Z5UA 2ID3A 4C3HJ 1TBXA 3AG2H 3BT9A 2BY0A 4AC0A 3W3CA 2UZKA 2GZWA 2LD5A 3RKXA 3JTHA 4RMNA 3F0CA 5E20A 3KIOA 5DCMA 2R7UA 2XAUA 1S9HA 4W97A 1RUNA 2DXIA 2COBA 1QZEA 5CVVA 4HNUA 5J8FA 4YIFA 4M72A 1W7PA 1Y8RB 3CF5F 3QP5A 2X6XA 5E3LA 3MZHA 4AYBN 5IT9Z 5HLHA 2QWWA 2RAEA 3BTIA 5FROA 3A2KA 2BZTA 2VJ4A 4F52A 5HLIA 4IXAA 3UNGC 5EF6A 2VE9A 5CLSA 1HQCA 3QU3A 2W84A 3H5AA 3D0SA 2MD5A 1MMSA 4BAYA 4Q5SF 4CUGA 1E2XA 4R8HA 3H3VK 1R5HA 1JI8A 4RS8A 1LFPA 2WADA 3QPTA 1UG0A 4MFEA 1ITYA 3M07A 3RDIA 4ZTFA 5EEAA 1LJ9A 1X2MA 3HG9A 3LL7A 3IKTA 2VIXA 4IQ4A 4HLYA 3KZZA 2OV7A 1T6SA 1J2XA 5EG0A 3DTIA 1N77A 4BS9A 2EFQA 5EJCA 3HUGA 3OV8A 1V3FA 4A93J 2HDWA 3KZYA 2XPWA 4EJTA 3F8NA 2EZKA 4ESJA 3FXQA 4L18B 2O3FA 1VQ6I 3RQ4A 3MWMA 3L7WA 1TC3C 1WWXA 4B09A 4RB1A 4FX0A 1YW9A 5DD4A 2OC6A 1XSVA 3BG6A 4Y52J 2GIZA 4RAGA 2LYCA 3R0JA 2XF7A 3B6AA 3K0LA 2VONA 5M5WJ 1QHGA 3TDUC 4O3MA 3VFZA 2YS9A 5JLXA 4JX4A 4P55A 2H8WA 4UB8C 2HVSA 2DW4A 1J5YA 4OIPF 4A12A 2F5EA 5M3MJ 1OMIA 4AIHA 1S5LC 2L9VA 3K1MA 1U5TC 2R7WA 5TISC 4A3IJ 1BIBA 1JT6A 5DM7F 5DUIA 5IOZA 1SAUA 5EGOA 2L7FP 4LLLA 4EJVA 5E1ZB 1B72A 2W1OA 2LR8A 1RI7A 5TGTA 2D1HA 2MABA 2ZJ2A 4XLCA 1NG6A 1VQMI 2V26A 1LE8A 5H20A 2FX0A 3M8FA 2Z9OA 1QRYA 5F0CA 3L2RA 4BU2A 1S7AA 4BHCA 3D5LA 3LSPA 2FJ1A 3M7GA 5F6FA 2K3FA 1F4KA 3HOTA 5FKNA 1I3QJ 4LK1F 2VOOA 2ELJA 4F7ZA 1VQNI 2CU7A 3OR2C 2STWA 4I6ZA 1NK3P 1ON2A 1P2FA 2DA1A 2DODA 2EIKH 1AHDP 2Y31A 2F4IA 1HW5A 4OAYA 1IRFA 2GXGA 2EIJH 2HGCA 4JOMA 4N4OB 2FNAA 1UG2A 1KU9A 2BOLA 4ENJA 3ZPLA 1R4MB 3B02A 5FD6A 3E6BA 3RPUD 5J3LA 4XKBA 1Y1VJ 3KEYA 4PJ0C 1YRNA 3DLAA 4CCLA 3KZIC 2VC1A 1WH5A 2OZ6A 3FBNB 1R23A 1V5GA 1Y8QB 2XAQA 3TBIA 1X2NA 1HW2A 2LTPA 1K6OA 1FJLA 2NYXA 2M87A 1D3YA 3JRFA 2KMUA 1O3RA 1SD7A 2KHMA 2DLLA 3J7AY 1USTA 1F9NA 3FM3A 1P6RA 3IRRA 4UVAA 3NWSA 4PZJA 3LAPA 2P81A 4FASD 4YRVA 4UHTA 5F0FA 2KQRA 1P4XA 1HKQA 3M8EA 2MH2A 1TT5B 2IGMA 2DQLA 3O6BB 4PJJA 4XOPA 2ZSHB 5E8GA 1WJDA 2L7ZA 1Z3YA 2DFFA 4PDKA 4OOIA 4HX8A 4NDLA 2HPMA 2R7VA 2QQ9A 4Q4ZF 1MBEA 1IN6A 1JKQC 1QPIA 3I0TA 4XLAA 1IRZA 1EF4A 4JBAA 4MEXF 4A3JJ 2I8DA 2KIQA 2KIFA 2MSYA 1YFHA 4YIRX 2V7FA 1O7FA 3HDDA 1EH8A 4CO8A 2VT2A 3G73A 1G8XA 1M1EB 5IP7J 3PSIA 5IYDJ 2FA5A 5LHIA 3C7JA 1U2WA 2MLGA 4BACA 4RAFA 2LP0A 3RYRA 2ELKA 2HYFA 1R5GA 1MNMC 4Y33A 3ABLH 4UVCA 4XKWA 2KRHA 3H36A 2XKOA 2GOMA 2DBBA 2CJJA 1KQ0A 3NAUA 4NC8A 1U8BA 4P9UA 2Z33A 1RIOH 2R7TA 1SVMA 3K70D 4TV7A 1SD5A 5LRSA 1DQUA 4LGWA 2HOSA 3CJQB 2AHQA 3ECHA 4MTEA 2ZMEB 5GPCA 1OYWA 2A07F 1OKRA 2AXTC 1OCCH 2L7MP 3FMQA 1P4AA 4U0WA 2HYGD 1IV8A 3LA3A 4KN7X 4CA0A 2PJRA 4GYIA 3BZ6A 4A0ZA 2Q8KA 2JZYA 2GM4A 1FX7A 2KISA 2ZJRF 4NQWB 1ENHA 3BWGA 3HEFA 4XQFA 2PMUA 2W85A 3S16J 2PJPA 5CVIA 3CC2I 5IT9K 4HYEA 5FO5A 3G1MA 1K79A 4C3JJ 5JHUA 3H9QA 3C1DA 1P7IA 4HV6A 3ZOBA 1S7EA 3DBRB 3U21A 1HKSA 1ETVA 4HW0A 2LBFA 1Z05A 1XC5A 1VQLI 1GV2A 1ZGJA 2KT0A 1AA7A 4OINF 4WXCA 5L3BA 1KONA 2BHZA 3BC8A 5D5UB 3CCQI 3FM5A 2KP6A 3ML6A 1ZLKA 2YR2A 1QHHD 2W7NA 3CC7I 4XRSA 3ZQHA 2E7WA 1T08B 2RREA 4IO9F 3CMYA 2WAQN 3J80Z 1T56A 4IF4A 1BI3A 4W1UA 3SEQA 3PQJA 2FU4A 3WODF 3JRGA 3S93A 4IVNA 2Q2EB 2NOGA 2W24A 3T0YA 5FKKA 4A5MA 5L3EA 1PUEE 3VYSB 4DQ2A 5LLQA 3OWTA 3F6OA 3ULQB 3G71I 3SYTA 3LA2A 4I09A 1YE9A 5CJ9A 1T0FC 3BQZA 1MJAA 3EQLF 3F8BA 2JN6A 3D1NI 1X58A 1VF9A 3OIQA 4HQEA 1JHHA 2X48A 3LOCA 2DU9A 3TQNA 3CF2A 5L3FA 3A01A 5GP9A 5IPAA 4HF2A 3EPZA 1YIJI 3U2RA 4IKFA 3CDLA 3OOPA 2IA2A 1FYKA 4II2A 2QEXI 3BQYA 4RM2A 5GADJ 2HXIA 4O5VA 1ZG5A 1GDTA 4QWQA 1JKRC 3J7ZI 1RR8C 2Z1DA 3FWEA 5EZHA 2X1CA 1VQ4I 4ABZA 3CLOA 4IRGA 2WAEA 3QODA 5FKLA 2RNJA 3KP3A 3P5JA 4B1RA 5LD2C 2FMYA 1LKXA 4XR6A 2Z99A 3Q9SA 9ANTA 3DXJF 2L7KA 3GTGJ 2JA2A 3Q0WA 4OIRF 2EINH 3DEUA 3VOEA 5DCMB 2HPIA 2W82A 1SFKA 2LG4A 4C30A 3R6SA 1Y1WJ 4KYWA 1FBSA 1HXDA 1MBGA 4LIVA 1W7PB 2XGXA 1MMAA 3GTQJ 4OMYA 3U1DA 1HW1A 1S8NA 2XAFA 2HVRA 4O6JA 2IS6A 2PX9A 3Q3SA 1DGWY 1VNDA 2V9PA 1QU3A 3MKYB 5HVQC 2QSHX 3WTSC 2RDPA 1A35A 4D1QA 3JRCA 3L2UA 3WHCA 2GBYA 3CCRI 2BW3A 3M3YJ 1DGRM 1BN5A 2KZVA 1JGGA 2YU3A 1T33A 3E6DA 1N78A 4U87A 3ZR8X 1K4TA 2HDCA 4OMZA 4BY7J 3ELKA 2DYSH 2L4MA 4ENMA 1CGPA 4HSTA 3LA7A 3H92A 2IBDA 1WPKA 4E7ZA 4J19A 1XMAA 3K1NA 2B63J 1KGSA 1IN7A 2JK3A 3IP4B 3WHBA 4BH9A 2M45A 3CMAI 2IS4A 1I39A 3TO6A 1SEUA 2IAIA 5EG0B 1D5YA 1R5ID 2DA7A 2HR3A 4Q47A 2UWMA 2CUFA 3OYIA 2VXDA 2JA8J 4RLQA 2UUZA 3IAM2 5HDKA 2CFXA 2NNNA 4PCQA 5D5XB 3RI4A 2VBWA 2P7VB 4EGYA 4M3FA 1FIPA 3S3OA 2CRGA 2M3AA 3F23A 2H6CA 3KYLA 4I01A 4NC7A 3K70C 4DYCA 3WE3A 3ZQLA 1U9NA 3SHFA 3IKVA 3WGGA 2VBYA 5K1YA 1S6LA 1MSEC 6PAXA 3QU6A 1ONVA 1YI2I 2E1CA 1TP4A 5J4YA 4XLNF 2BE5F 3OMYA 3LFUA 4L0YB 3BR2A 1UHWA 3QPSA 3FBIB 4HSRA 2A6TA 3LSGA 4ITVA 4BXUA 3Q0VA 2X9DA 5LEKA 2X51A 1WHUA 5CVJA 4PJNA 3GLXA 5EGOB 1RETA 3JRAA 4BJ5C 1B72B 1OPCA 1QZYA 2K9MA 1H8AC 2KZGA 1MMDA 4XL9A 3RYPA 4B3AA 1W0UA 1A04A 1K6YA 1LE8B 3DLLF 2LREA 4BXXJ 2P5KA 2PQ8A 2R5ZA 1SFUA 2FNPA 5E3NA 1X1DA 3GLLA 2EH3A 1R9TJ 2YUSA 3LQRA 1SFOJ 1V5FA 2FEZA 3J7YJ 4X6AJ 2M9HA 3E5QA 3FKIJ 2IA1A 5A2QZ 4PFOA 2ZNZA 3VB2A 4OU0A 1OCRH 3JREA 2DPDA 1DPRA 5HLGA 4G7OF 4YELA 2PG4A 1Z7UA 4CZZA 5CVUA 1ZH5A 4DOZA 3HPGA 2P0WA 3CCSI 4A0XA 1FMVA 1UHMA 3BROA 3KEOA 4D9JA 3RKYA 3Q5FA 2JT1A 1D1AA 2JRMA 2CV0A 1H9GA 2RGVA 1B6AA 5ILVA 3K2AA 3QP6A 2CO5A 1A6IA 3MVPA 3OL4A 1A31A 2LKXA 4JK1X 4MFDA 1L0OC 2EA2A 1LDKB 3I9V2 3RSNA 1YRNB 1FTZA 4AVZA 2XSDC 3ZQFA 3PO2J 1KYWA 2K02A 4R79A 1IDZA 2X1EA 3IC7A 1VQKI 2XGEA 3ZQQA 3PJRA 2K9SA 2LF8A 2RQPA 1HDDC 1DP3A 2P6TA 5L3DA 5DD8A 4WCGA 2JA5J 1ZTRA 4Q48A 1S7OA 1MMGA 2HKXA 2RN7A 5KVRA 2H09A 3BTCA 1FP2A 4ZYHA 1K78A 1NK2P 4HBLA 4PUSA 4WF2A 3VWBA 1ETYA 2GXBA 3P9CA 1NHAA 1HSJA 4KT6A 3CCLI 3PNVA 2MD0A 1PP7U 2PBIA 3G2BA 1RUOA 2ETHA 3G3ZA 3J80K 3I5UA 1FT9A 2OTJI 2R7DA 4HDUA 1YITI 4GGGA 1I1GA 5KAFC 3MZ8A 3W2AA 3L2VA 1SMTA 1JT0A 2HQRA 4DGWB 3SZTA 3C3WA 2MG4A 4HNTA 1POGA 2H1LA 4BHPA 5IP6A 3U1KA 1ZELA 3FDYA 1LDJA 3JSPA 1H88C 3CUQA 1HCRA 4MGRA 3BY6A 1FC3A 1EA3A 2LH9A 2EK5A 2XHKA 5C4XJ 4M9SA 4XSXF 5J6XA 3WG9A 5LBQA 2V6EA 1AOYA 2DPUA 1ETQA 2BVLA 4RLFA 4EMSA 3CP2A 1HA8A 4CYCA 5D6FA 1B9MA 2V9KA 2MC4A 5LRRA 4MHGA 1KQ8A 1FYMA 5IP9J 4BYYA 4RDUA 3PNYA 2K9NA 2J5PA 3RJPA 3LSHA 4BBRJ 2K86A 3OYBA 2WV0A 3GZ5A 4CCKA 1AWCA 2ME0A 2KKOA 2O61A 2PEXA 3QRFF 2IJLA 2M7AA 1VQ5I 1LB2A 3MZYA 5HODA 2E7XA 3GW2A 2XAGA 1KA8A 2EA4A 2PJRB 2ZNYA 2UXXA 3HPHA 4GYGA 3OYCA 2KLOA 2JSPA 4II3A 1WSUA 2H27A 3I64A 3JRDA 3GF2A 4L9VA 3BG9A 3DCFA 3HRTA 1ZYRF 4HX7A 1A5JA 3DU5A 4C2TA 2K4JA 4R1HA 5IY5H 4CDGA 4EQQA 2DDAA 3PFYA 3EUKL 3BCAA 3IH4A 5E1XA 1UMQA 5B3SH 3GFIA 1B4AA 4MIMA 1U0JA 5F64A 3ABTA 1YIOA 3M1CA 1X1CA 1D0ZA 2C6YA 2W48A 3Q9VA 4BE2A 1OR7C 2BV6A 1JGSA 2O03A 3CQZJ 2LBFB 3SDBA 2L9SA 3X2QH 3FXLA 2QENA 5FLMJ 2M30A 3TO7A 3C2BA 1P92A 2F48A 3SFIA 3LFKA 3A4CA 5FRNA 2E1MB 1MSFC 4ZYGA 4A3LJ 1TTYA 1FIAA 5J4VA 2ZFWA 1GXPA 3H3UA 5FKOA 4BY1J 3TO9A 2YSRA 4GDFA 1NTCA 2DA2A 2O7OA 3A02A 3KYDB 5DUKA 4KIBA 3V8JA 5LHHA 3RZOJ 3DPUA 3HKZA 2VJIA 2FD5A 3LAJA 2M8EA 4ASNA 1P9QC 1U5TA 1RZ4A 1LDDA 3BJ6A 2D45A 1IAWA 2P7CB 5LGNA 2VPLA 3K4BA 2NNYA 2F4MB 2BYVE 3VYRB 3A01B 4Z2YA 5CQGA 4KIFA 1Z6TA 2E1OA 5BPDA 3GZ6A 4F55A 3KYCB 3ZMZA 3EYIA 3NQOA 1X3ZB 3K4NA 1R7JA 5B1AH 3CMMA 5HDNA 1XMXA 5C4JJ 2ME6A 2HQNA 3LQQA 3GTJJ 3L9FA 4XK4A 3WTZA 1I1SA 2F5DA 1QVTA 1AKHA 1WJAA 4XRFA 3HB9A 1TQPA 1IW7F 2QA4I 4WX9A 2CH0A 1JKOC 3KP4A 4UV8A 1X1BA 1IUYA 1XD7A 4B43A 1QPMA 1JE8A 3R4KA 1Z21A 3IV5A 3OL3A 4HX4A 5E3OA 2VB6A 4ZC3A 3V4GA 1WI9A 2Y0MA 3PNTA 3OYEA 1EH7A 3JRHA 2MGQA 1ZARA 3I55I 4DJAA 3I56I 1Z9CA 2EFPA 2L0KA 1MIJA 2XGDA 3ZQCA 1XSDA 4NB5A 1F43A 3CZ6A 4N9HA 2K3PA 3WG7H 1JJ6C 2IPQX 2R7OA 4M9ZA 1OQYA 3ERMA 3RZDJ 1XGOA 1XX5A 5LFAA 1U8RA 3UR3C 4A5NA 4C2MJ 1TWFJ 2GQQA 1Z1DA 3TP0A 4XORA 2LNBA 2DJIA 2FBIA 3F8FA 4RAZA 1Y0UA 1XTAA 5FLXZ 1ZGAA 3A03A 1ZRFA 2RKHA 4OIOF 2JSCA 5E17F 3HTUA 3QPLA 3F8MA 3RPQA 4CH7A 1FOWA 1R58A 1WKMA 5B1BH 1JUPA 4B3XA 4I02A 5GAHJ 5J8CA 3E5XA 2EFOA 2JRTA 4U7BA 3BR3A 4PFPA 3CDIA 5HDGA 3RIRA 3S2WA 2PI0A
chains in the Genus database with same CATH topology
3JR9A 3CMYA 2ECBA 1WI3A 1T56A 2WAQN 1Q1VA 4W1UA 2N8GA 3BG5A 3JRGA 2DMPA 3Q0UA 2E19A 4AUXA 2DMTA 3S1RJ 3GTOJ 2NOGA 5FKKA 2I10A 1ORKA 1VI0A 3RQIA 1FEXA 2YU9J 2LY9A 3GTLJ 3BR6A 1BL0A 3BQZA 2JN6A 2DMQA 1X58A 3BR0A 3D1NI 1VF9A 1IJWC 2WB1N 2X48A 2VKVA 1OCPA 3LOCA 1I6HJ 3A01A 4QSHA 5GP9A 5IPAA 4UUTA 2NS7A 3OOUA 5K7HA 3CDLA 2R93J 1ZQ3P 1JTYA 5EYRA 4L5EA 3NARA 3BQYA 3I4NJ 2HXIA 1GDTA 1JKRC 4DZPA 1MBJA 5EZHA 2R5ZB 3S2DJ 4MO7A 4JX6A 1RPWA 4ABZA 4FCYA 4Y7NJ 5DS9A 3S1QJ 1B8IB 5FKLA 4B1RA 2ZB9A 2EZHA 1JJ8C 1F36A 2WV1A 9ANTA 3HOZJ 1ZGWA 3GTGJ 3O8GA 3Q0WA 1RR7A 1Y1WJ 1MH4A 2Y9YA 1ETKA 1IDYA 2JA6J 1PUFA 1MBGA 1ZKGA 4UUSA 2DMNA 4D7MA 3DEWA 3LSJA 4EEFG 1H89C 3GTQJ 2JWTA 2D5VA 4IHVA 1OFCX 3S15J 3Q3SA 4BKXA 2QF7A 1VNDA 4LOCA 2E2JJ 2XRLA 5C3EJ 1MH3A 4M6VA 1JUSA 3O8HA 3JRCA 4DZJA 3WHCA 2GBYA 3B6CA 3M3YJ 2XB5A 1TWGJ 1TWAJ 1JGGA 3OIOA 1T33A 2LK2A 1PUFB 5M5YJ 4BY7J 3H0GJ 2QCOA 3JRIA 2AO9A 5M3FJ 2VKEA 2IBDA 4A3KJ 1WPKA 4J19A 2NVQJ 4A3CJ 2K40A 1IG7A 4A3BJ 2B63J 3VPRA 2JK3A 3WHBA 2JJ7A 2R5YA 2JA7J 2HI3A 5J1RA 2VPRA 1CQTA 2IAIA 5EG0B 1D5YA 2DA7A 3TW7A 3OSGA 4XRMA 2X6OA 1TWCJ 3S17J 2NVYJ 3HBLA 2CUFA 2JA8J 4JYKA 2XB0X 2HOTA 4M3FA 1FIPA 4A3DJ 2CRGA 5IYCJ 1G2HA 3LNQA 3ZQLA 2TCTA 3BTLA 4DYCA 3HOXJ 4B4CA 1U9NA 2R5YB 5K7ZA 1MSEC 5E3MA 3FIWA 3RKQA 2G0EA 2LVSA 4A3FJ 3G1LA 4FE4A 5F08A 3S1NJ 2Y9ZA 1K61A 1Z0XA 3BR2A 3E7LA 3QPSA 3HOYJ 4C3IJ 3LSGA 3Q0VA 2X9DA 1P7JA 1TWHJ 4FE7A 4V2GA 5EGOB 1RETA 4BBSJ 5F27A 3JRAA 3W6VA 1B72B 2DJNA 1H8AC 1VFCA 5F0HA 4M3DA 2FQ4A 4X1EA 1IV6A 4CYCB 4B3AA 1W0UA 1WCMJ 3GTPJ 4IHWA 1LE8B 4DW6A 4BXXJ 4A3MJ 2R5ZA 2LLKA 5E3NA 4XIDA 2EH3A 1R9TJ 2YUSA 3MKLA 2ID3A 4C3HJ 1SFOJ 3BT9A 1APLC 1OCTC 4AC0A 2NVXJ 4X6AJ 2M9HA 1B8IA 3FKIJ 3HKZN 2LD5A 3BG3A 4M3BA 3F0CA 3JREA 4S0HB 2ID6A 3HGYA 4W97A 5J1YA 2COBA 3UKGA 3G1OA 2JMWA 5DTDA 4A3EJ 3ZQIA 5E3LA 4AYBN 5GPAA 2RAEA 2DA4A 1SANA 2OPTA 3BTIA 3K2AA 1A6IA 3MVPA 2H8RA 3K7AJ 2L9RA 2LKXA 5EF6A 4JX5A 2O8KA 2R92J 2DTZA 4MFDA 1HF0A 2EBIA 1YRNB 3BR1A 1FTZA 2XSDC 3ZQFA 3PO2J 4FTHA 3GTMJ 3H3VK 1IDZA 1RKWA 2DA3A 3GBGA 2XGEA 2K9SA 4MFEA 2EZIA 1ITYA 1HDDC 5EEAA 3IH3A 1X2MA 1K83J 2JA5J 5FJ8J 1ZTRA 5F1JA 5EG0A 3BTCA 2K9QA 1NK2P 2TRTA 2M8GX 4A93J 1FTTA 2XPWA 1HOMA 2EZKA 5F04A 1ETYA 3IH2A 3HOWJ 1DU6A 1RKTA 1TC3C 3PM1A 1Z77A 2Y30A 3FK7A 4FISA 4Y52J 4QIWN 1ZK8A 2H1KA 3B6AA 1JT0A 3ZQGA 5M5WJ 2YS9A 5JLXA 4JX4A 3TW6A 1BW5A 5JLWA 3CCYA 2MG4A 1POGA 5IP6A 5M3MJ 1H88C 4A3IJ 1HCRA 4DYQA 5C4XJ 1JT6A 3HOVJ 5IOZA 5EGOA 2L7FP 3QQAA 5IYBJ 4JP0A 4M3EA 2R0QC 1B72A 1U78A 1AKHB 1ETQA 1IC8A 2LR8A 2M2EA 4CYCA 2E2HJ 3JRBA 2VUMJ 3HM5A 1LE8A 3L1PA 2EZLA 5IP9J 1BW6A 2FX0A 4RDUA 1QRYA 5F0CA 5IOYA 2K9NA 4BBRJ 3LSPA 1GV5A 1XG1A 2FJ1A 3BTJA 2ME0A 5FKNA 1I3QJ 1HDPA 3TEDA 2LFBA 2CU7A 4I6ZA 1NK3P 2DA1A 1AHDP 5HODA 1O4XA 2M0CA 2Y31A 4D7NA 1I50J 4V2FA 5FKMA 3M4OJ 1GUUA 2IEKA 3JRDA 2HOAA 1UG2A 3BG9A 2CUEA 3DCFA 1A5JA 3I4MJ 4IHYA 3HOUJ 3IH4A 1QVUA 5J3LA 2PMZN 1UMQA 4MIMA 1U9OA 1Y1VJ 2E2IJ 2MW8A 3GTKJ 2NS8A 1LFUP 1YRNA 3SJMA 1JTXA 1WH5A 2ECCA 2HYJA 3LSRA 1X2NA 2LTPA 1MBFA 2W48A 2HXOA 2DMUA 1WH7A 1FJLA 3CQZJ 4D5CA 3JRFA 3BR5A 4GFBA 1IGNA 5FLMJ 4IHXA 1UHSA 3C2BA 3SFIA 1MBKA 1IUFA 1MSFC 2P81A 3OSFA 5F0FA 4A3LJ 1JKPC 4I76A 1FIAA 3MN2A 4QTRA 2CQQA 2HQ5A 2R7ZJ 5FKOA 2GLOA 4BY1J 4D5FA 2L7ZA 2CQXA 1NTCA 2DA2A 2O7OA 3A02A 3TP3A 3RZOJ 1BJZA 4NDLA 4A69C 2FD5A 5C44J 1MBEA 1JKQC 1ETXA 1QPIA 1IRZA 1EF4A 2EQRA 3A01B 4HNVA 2E1OA 3FK6A 4A3JJ 3SDGA 2MSYA 1WGXA 3HDDA 2M34A 5M5XJ 5C4JJ 2ME6A 5IP7J 5IYDJ 3GTJJ 4XK4A 4M3GA 1QVTA 1AKHA 2LP0A 1BA5A 2ELKA 3HB9A 1AU7A 1MNMC 5BNGA 1JKOC 1GVDA 4XRSG 2XPUA 5J1UA 2Y0SN 1U8BA 2CJJA 3NAUA 1MBHA 4RBOA 3IV5A 1ZR4A 3FISA 5E3OA 4IEJA 2DA6A 1E3OC 4UUSB 2HOSA 3HGGA 4DYRA 2AHQA 4A3GJ 1ETOA 3JRHA 2MGQA 1ETWA 1GT0C 5GPCA 2L0KA 2L7MP 2HDDA 2XGDA 2XPVA 3ZQCA 1F43A 1W0TA 1JUMA 1JJ6C 5EDNA 3S14J 3RZDJ 1HLVA 1XS9A 2OF7A 3S1MJ 4G12A 1OJLA 4C2MJ 2GM4A 1TWFJ 4XICA 1ENHA 3HEFA 3S16J 3TP0A 5K7FA 1DU0A 1LFBA 2KDZA 3G1MA 4C3JJ 2VI6A 2NVTJ 5FLVA 1P7IA 3A03A 2Y2ZA 2DN0A 4MLOA 3ZOBA 3PO3J 1S7EA 1ZR2A 3QPLA 1ETVA 3S2HJ 1RESA 1XC5A 1GV2A 2KT0A 1JUPA 2XGCA 2DA5A 3BR3A 2O9LA 5EZGA 4XRSA 3ZQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR9 A;  3CMY A;  2ECB A;  1WI3 A;  1T56 A;  2WAQ N;  1Q1V A;  4W1U A;  2N8G A;  3BG5 A;  3JRG A;  2DMP A;  3Q0U A;  2E19 A;  4AUX A;  2DMT A;  3S1R J;  3GTO J;  2NOG A;  5FKK A;  2I10 A;  1ORK A;  1VI0 A;  3RQI A;  1FEX A;  2YU9 J;  2LY9 A;  3GTL J;  3BR6 A;  1BL0 A;  3BQZ A;  2JN6 A;  2DMQ A;  1X58 A;  3BR0 A;  3D1N I;  1VF9 A;  1IJW C;  2WB1 N;  2X48 A;  2VKV A;  1OCP A;  3LOC A;  1I6H J;  3A01 A;  4QSH A;  5GP9 A;  5IPA A;  4UUT A;  2NS7 A;  3OOU A;  5K7H A;  3CDL A;  2R93 J;  1ZQ3 P;  1JTY A;  5EYR A;  4L5E A;  3NAR A;  3BQY A;  3I4N J;  2HXI A;  1GDT A;  1JKR C;  4DZP A;  1MBJ A;  5EZH A;  2R5Z B;  3S2D J;  4MO7 A;  4JX6 A;  1RPW A;  4ABZ A;  4FCY A;  4Y7N J;  5DS9 A;  3S1Q J;  1B8I B;  5FKL A;  4B1R A;  2ZB9 A;  2EZH A;  1JJ8 C;  1F36 A;  2WV1 A;  9ANT A;  3HOZ J;  1ZGW A;  3GTG J;  3O8G A;  3Q0W A;  1RR7 A;  1Y1W J;  1MH4 A;  2Y9Y A;  1ETK A;  1IDY A;  2JA6 J;  1PUF A;  1MBG A;  1ZKG A;  4UUS A;  2DMN A;  4D7M A;  3DEW A;  3LSJ A;  4EEF G;  1H89 C;  3GTQ J;  2JWT A;  2D5V A;  4IHV A;  1OFC X;  3S15 J;  3Q3S A;  4BKX A;  2QF7 A;  1VND A;  4LOC A;  2E2J J;  2XRL A;  5C3E J;  1MH3 A;  4M6V A;  1JUS A;  3O8H A;  3JRC A;  4DZJ A;  3WHC A;  2GBY A;  3B6C A;  3M3Y J;  2XB5 A;  1TWG J;  1TWA J;  1JGG A;  3OIO A;  1T33 A;  2LK2 A;  1PUF B;  5M5Y J;  4BY7 J;  3H0G J;  2QCO A;  3JRI A;  2AO9 A;  5M3F J;  2VKE A;  2IBD A;  4A3K J;  1WPK A;  4J19 A;  2NVQ J;  4A3C J;  2K40 A;  1IG7 A;  4A3B J;  2B63 J;  3VPR A;  2JK3 A;  3WHB A;  2JJ7 A;  2R5Y A;  2JA7 J;  2HI3 A;  5J1R A;  2VPR A;  1CQT A;  2IAI A;  5EG0 B;  1D5Y A;  2DA7 A;  3TW7 A;  3OSG A;  4XRM A;  2X6O A;  1TWC J;  3S17 J;  2NVY J;  3HBL A;  2CUF A;  2JA8 J;  4JYK A;  2XB0 X;  2HOT A;  4M3F A;  1FIP A;  4A3D J;  2CRG A;  5IYC J;  1G2H A;  3LNQ A;  3ZQL A;  2TCT A;  3BTL A;  4DYC A;  3HOX J;  4B4C A;  1U9N A;  2R5Y B;  5K7Z A;  1MSE C;  5E3M A;  3FIW A;  3RKQ A;  2G0E A;  2LVS A;  4A3F J;  3G1L A;  4FE4 A;  5F08 A;  3S1N J;  2Y9Z A;  1K61 A;  1Z0X A;  3BR2 A;  3E7L A;  3QPS A;  3HOY J;  4C3I J;  3LSG A;  3Q0V A;  2X9D A;  1P7J A;  1TWH J;  4FE7 A;  4V2G A;  5EGO B;  1RET A;  4BBS J;  5F27 A;  3JRA A;  3W6V A;  1B72 B;  2DJN A;  1H8A C;  1VFC A;  5F0H A;  4M3D A;  2FQ4 A;  4X1E A;  1IV6 A;  4CYC B;  4B3A A;  1W0U A;  1WCM J;  3GTP J;  4IHW A;  1LE8 B;  4DW6 A;  4BXX J;  4A3M J;  2R5Z A;  2LLK A;  5E3N A;  4XID A;  2EH3 A;  1R9T J;  2YUS A;  3MKL A;  2ID3 A;  4C3H J;  1SFO J;  3BT9 A;  1APL C;  1OCT C;  4AC0 A;  2NVX J;  4X6A J;  2M9H A;  1B8I A;  3FKI J;  3HKZ N;  2LD5 A;  3BG3 A;  4M3B A;  3F0C A;  3JRE A;  4S0H B;  2ID6 A;  3HGY A;  4W97 A;  5J1Y A;  2COB A;  3UKG A;  3G1O A;  2JMW A;  5DTD A;  4A3E J;  3ZQI A;  5E3L A;  4AYB N;  5GPA A;  2RAE A;  2DA4 A;  1SAN A;  2OPT A;  3BTI A;  3K2A A;  1A6I A;  3MVP A;  2H8R A;  3K7A J;  2L9R A;  2LKX A;  5EF6 A;  4JX5 A;  2O8K A;  2R92 J;  2DTZ A;  4MFD A;  1HF0 A;  2EBI A;  1YRN B;  3BR1 A;  1FTZ A;  2XSD C;  3ZQF A;  3PO2 J;  4FTH A;  3GTM J;  3H3V K;  1IDZ A;  1RKW A;  2DA3 A;  3GBG A;  2XGE A;  2K9S A;  4MFE A;  2EZI A;  1ITY A;  1HDD C;  5EEA A;  3IH3 A;  1X2M A;  1K83 J;  2JA5 J;  5FJ8 J;  1ZTR A;  5F1J A;  5EG0 A;  3BTC A;  2K9Q A;  1NK2 P;  2TRT A;  2M8G X;  4A93 J;  1FTT A;  2XPW A;  1HOM A;  2EZK A;  5F04 A;  1ETY A;  3IH2 A;  3HOW J;  1DU6 A;  1RKT A;  1TC3 C;  3PM1 A;  1Z77 A;  2Y30 A;  3FK7 A;  4FIS A;  4Y52 J;  4QIW N;  1ZK8 A;  2H1K A;  3B6A A;  1JT0 A;  3ZQG A;  5M5W J;  2YS9 A;  5JLX A;  4JX4 A;  3TW6 A;  1BW5 A;  5JLW A;  3CCY A;  2MG4 A;  1POG A;  5IP6 A;  5M3M J;  1H88 C;  4A3I J;  1HCR A;  4DYQ A;  5C4X J;  1JT6 A;  3HOV J;  5IOZ A;  5EGO A;  2L7F P;  3QQA A;  5IYB J;  4JP0 A;  4M3E A;  2R0Q C;  1B72 A;  1U78 A;  1AKH B;  1ETQ A;  1IC8 A;  2LR8 A;  2M2E A;  4CYC A;  2E2H J;  3JRB A;  2VUM J;  3HM5 A;  1LE8 A;  3L1P A;  2EZL A;  5IP9 J;  1BW6 A;  2FX0 A;  4RDU A;  1QRY A;  5F0C A;  5IOY A;  2K9N A;  4BBR J;  3LSP A;  1GV5 A;  1XG1 A;  2FJ1 A;  3BTJ A;  2ME0 A;  5FKN A;  1I3Q J;  1HDP A;  3TED A;  2LFB A;  2CU7 A;  4I6Z A;  1NK3 P;  2DA1 A;  1AHD P;  5HOD A;  1O4X A;  2M0C A;  2Y31 A;  4D7N A;  1I50 J;  4V2F A;  5FKM A;  3M4O J;  1GUU A;  2IEK A;  3JRD A;  2HOA A;  1UG2 A;  3BG9 A;  2CUE A;  3DCF A;  1A5J A;  3I4M J;  4IHY A;  3HOU J;  3IH4 A;  1QVU A;  5J3L A;  2PMZ N;  1UMQ A;  4MIM A;  1U9O A;  1Y1V J;  2E2I J;  2MW8 A;  3GTK J;  2NS8 A;  1LFU P;  1YRN A;  3SJM A;  1JTX A;  1WH5 A;  2ECC A;  2HYJ A;  3LSR A;  1X2N A;  2LTP A;  1MBF A;  2W48 A;  2HXO A;  2DMU A;  1WH7 A;  1FJL A;  3CQZ J;  4D5C A;  3JRF A;  3BR5 A;  4GFB A;  1IGN A;  5FLM J;  4IHX A;  1UHS A;  3C2B A;  3SFI A;  1MBK A;  1IUF A;  1MSF C;  2P81 A;  3OSF A;  5F0F A;  4A3L J;  1JKP C;  4I76 A;  1FIA A;  3MN2 A;  4QTR A;  2CQQ A;  2HQ5 A;  2R7Z J;  5FKO A;  2GLO A;  4BY1 J;  4D5F A;  2L7Z A;  2CQX A;  1NTC A;  2DA2 A;  2O7O A;  3A02 A;  3TP3 A;  3RZO J;  1BJZ A;  4NDL A;  4A69 C;  2FD5 A;  5C44 J;  1MBE A;  1JKQ C;  1ETX A;  1QPI A;  1IRZ A;  1EF4 A;  2EQR A;  3A01 B;  4HNV A;  2E1O A;  3FK6 A;  4A3J J;  3SDG A;  2MSY A;  1WGX A;  3HDD A;  2M34 A;  5M5X J;  5C4J J;  2ME6 A;  5IP7 J;  5IYD J;  3GTJ J;  4XK4 A;  4M3G A;  1QVT A;  1AKH A;  2LP0 A;  1BA5 A;  2ELK A;  3HB9 A;  1AU7 A;  1MNM C;  5BNG A;  1JKO C;  1GVD A;  4XRS G;  2XPU A;  5J1U A;  2Y0S N;  1U8B A;  2CJJ A;  3NAU A;  1MBH A;  4RBO A;  3IV5 A;  1ZR4 A;  3FIS A;  5E3O A;  4IEJ A;  2DA6 A;  1E3O C;  4UUS B;  2HOS A;  3HGG A;  4DYR A;  2AHQ A;  4A3G J;  1ETO A;  3JRH A;  2MGQ A;  1ETW A;  1GT0 C;  5GPC A;  2L0K A;  2L7M P;  2HDD A;  2XGD A;  2XPV A;  3ZQC A;  1F43 A;  1W0T A;  1JUM A;  1JJ6 C;  5EDN A;  3S14 J;  3RZD J;  1HLV A;  1XS9 A;  2OF7 A;  3S1M J;  4G12 A;  1OJL A;  4C2M J;  2GM4 A;  1TWF J;  4XIC A;  1ENH A;  3HEF A;  3S16 J;  3TP0 A;  5K7F A;  1DU0 A;  1LFB A;  2KDZ A;  3G1M A;  4C3J J;  2VI6 A;  2NVT J;  5FLV A;  1P7I A;  3A03 A;  2Y2Z A;  2DN0 A;  4MLO A;  3ZOB A;  3PO3 J;  1S7E A;  1ZR2 A;  3QPL A;  1ETV A;  3S2H J;  1RES A;  1XC5 A;  1GV2 A;  2KT0 A;  1JUP A;  2XGC A;  2DA5 A;  3BR3 A;  2O9L A;  5EZG A;  4XRS A;  3ZQH A; 
#chains in the Genus database with same CATH topology
 3JR9 A;  3V7C A;  2CW8 A;  5E18 F;  1Q1V A;  3J81 K;  2N8G A;  2DMP A;  1ZHF A;  3Q0U A;  2NOJ B;  4AUX A;  4CGZ A;  4YFN F;  4I0A A;  4MQV A;  1I5Z A;  4F91 B;  1YW7 A;  2HNH A;  4BHB A;  4HV5 A;  1YO5 C;  2QQ8 A;  1FEX A;  2X85 A;  2YU9 J;  2LY9 A;  3GTL J;  4QPO A;  3KET A;  1UFM A;  3BDD A;  2E60 A;  2F5V A;  3BR0 A;  2LDU A;  1J0R A;  1VQP I;  4EM0 B;  1SVO A;  2UXN A;  2WB1 N;  4L5J A;  1O3Q A;  3VYU B;  2BXY A;  2RQQ A;  2VQL A;  2LRD A;  3ZRG A;  2XRN A;  2R93 J;  3CES A;  1SC7 A;  3GUD A;  2CW7 A;  4OAZ A;  1J9I A;  2PMZ A;  2HU9 A;  2R5Z B;  3S2D J;  4MO7 A;  4HLX A;  4Y7N J;  1U6G A;  4Y4R A;  1V5E A;  5GTI C;  3NRV A;  2ZB9 A;  2JPB A;  1FSE A;  1F36 A;  1MZB A;  1RRJ A;  2OJE D;  3HOZ J;  2CV1 A;  1HC8 A;  1WVR A;  3GFL A;  4LIU A;  1ZKG A;  2J5O A;  4UUS A;  1D5V A;  5B66 C;  2LY1 A;  1S29 A;  4XLF A;  3OYN A;  4IOC F;  3KX2 A;  2IS1 A;  3OS2 A;  2ZJP F;  4BKX A;  5DEQ A;  2QF7 A;  1R6R A;  3HHH A;  3M9A A;  4LOC A;  5E8I A;  2XRL A;  4MTD A;  2PLY A;  3O8H A;  3EDP A;  4IPA A;  3EUH C;  4HPQ A;  1WJE A;  5FFX A;  1G4D A;  2Y69 H;  4WWC A;  4DZJ A;  2VT3 A;  2XB5 A;  1KZH A;  1TWG J;  1ZG3 A;  4LLN A;  3PIP F;  3AL0 C;  4E6K G;  4E7L A;  2V1X A;  2NS0 A;  1BI2 A;  2CUJ A;  3JAM Z;  1PUF B;  2QVO A;  3HRS A;  4UY8 I;  2IRF G;  2DT5 A;  2ESH A;  2KIM A;  4ENN A;  5M3F J;  2R7Q A;  2VKE A;  2WWY A;  5ED4 A;  2TDX A;  3S32 A;  4A3K J;  2KDO A;  2NVQ J;  2K40 A;  4A3B J;  1L3L A;  1YJN I;  1XDS A;  3L2C A;  2R5Y A;  2FBH A;  1FBQ A;  2HI3 A;  1O3T A;  1HKT A;  2H6B A;  2L3D A;  3FKJ A;  2F5F A;  3TW7 A;  1K78 B;  1WJ5 A;  2X6O A;  1FY7 A;  5DM6 F;  3FXM A;  2XB0 X;  3ZMU A;  2DK8 A;  4ENK A;  3I59 A;  2HOT A;  3H9J A;  5ERI A;  1LNW A;  2DFI A;  1CF7 A;  1T0F A;  3DBL B;  1T98 A;  4G8X A;  1TQI A;  2KRC A;  2K5C A;  3PUB A;  2BY1 A;  4HF0 A;  1T39 A;  4B4C A;  1Y0N A;  2Y0S A;  2X6Y A;  2PMH A;  1X1A A;  3H1C A;  5K5R A;  3JCU C;  4XKC A;  3ERE D;  5E3M A;  3ZCO A;  3ZMT A;  3RPU A;  2G0E A;  3L2W A;  3SXY A;  2DDB A;  4G7H F;  3SFZ A;  2V79 A;  1MMN A;  4XM3 A;  1K61 A;  3HOY J;  5D8L B;  1MGT A;  1IN8 A;  2WA0 A;  2ZXH A;  5ICG A;  1WQ2 A;  3GZN B;  4A0Y A;  4AD9 A;  1FSH A;  4FE7 A;  2BY2 A;  3IWF A;  2MLK A;  3HC7 A;  5F27 A;  2DJN A;  1O57 A;  2P4W A;  1VFC A;  1HBX G;  2JTV A;  4F93 B;  4X1E A;  2FQ4 A;  3R60 A;  1IV6 A;  4CYC B;  1MDM B;  3GTP J;  1G59 A;  4DW6 A;  4G94 A;  5H2F C;  4L0Z B;  4LFU A;  3SEZ A;  3SZP A;  2LKP A;  3MKL A;  1SD4 A;  3N05 A;  3A1Y A;  4XN3 A;  2JUC A;  3QOE A;  4DBQ A;  1OCT C;  2NVX J;  1BC8 C;  2X0L A;  1B8I A;  1OLT A;  1R49 A;  2RC4 A;  4M3B A;  1DUX C;  3MAJ A;  2ZSI B;  4S0H B;  2K9L A;  1STZ A;  4N4N B;  3V42 A;  1FNN A;  2WY8 Q;  4LG0 A;  2ID6 A;  1VQ8 I;  1SAX A;  2VN2 A;  1LEA A;  2X6W A;  3HIF A;  2JMW A;  2NXN B;  5DTD A;  2ZJQ F;  4A3E J;  1FYL A;  3REO A;  3ZQI A;  3K69 A;  2GWR A;  1XGS A;  3IAS 2;  5BMZ A;  3FHN A;  2DA4 A;  1SAN A;  2OPT A;  3FXU A;  2ICW G;  3DF8 A;  5CQE A;  3BOQ A;  3VDX A;  2VQH A;  2H8R A;  2CUZ A;  3K7A J;  2L9R A;  3QYF A;  5HS9 A;  4WXH A;  2DTZ A;  3B73 A;  1HF0 A;  2EBI A;  4CCO A;  4KDP A;  2QSG X;  1G3S A;  4RGU A;  1VQ9 I;  3P9K A;  2XAS A;  3OY9 A;  4FTH A;  1IN4 A;  1ON1 A;  3ZGK A;  3L00 A;  2DT7 B;  5HNH A;  1RKW A;  2E1M C;  2EZI A;  2QBY A;  3IH3 A;  3V8K A;  3DKX A;  5ILS A;  1X1P A;  1LUJ B;  2QLZ A;  5FJ8 J;  4RGR A;  1W36 D;  1N75 A;  5BS6 A;  4IZZ A;  2OQR A;  1I6X A;  3R0A A;  2E5N A;  5HS7 A;  4ETS A;  1LEB A;  1R4N B;  2M8G X;  4HA8 A;  2DK5 A;  1HOM A;  5F04 A;  2FOK A;  2OZU A;  4YII A;  3TOB A;  2D2W A;  4EGZ A;  2BY3 A;  1RKT A;  2G7U A;  4ZYA A;  4MQ9 F;  1VTN C;  2KFD A;  3ONQ A;  1EV7 A;  2ESN A;  1S72 I;  2V1U A;  5JR3 A;  2NRA C;  3WTW C;  3DPT A;  3L09 A;  4LIT A;  3CJT B;  1UB9 A;  3ZQG A;  1X4O A;  4UV9 A;  5AIP A;  3CME I;  1BW5 A;  5JLW A;  3GWZ A;  3HUG B;  3CCY A;  3V8L A;  2CYY A;  4L9J A;  1PJR A;  2OCC H;  4Y13 A;  2DYR H;  2WAF A;  2EIM H;  2A6E F;  3OIP A;  2E34 A;  2A5Y B;  4MNU A;  2BEO A;  4DYQ A;  3E0J B;  5J40 A;  2VKH A;  2W00 A;  3QQA A;  4QLC U;  1AKH B;  3I54 A;  4ZYD A;  3DPL C;  1DDN A;  1O3S A;  2M2E A;  3ZN0 A;  2K27 A;  2E2H J;  3L1P A;  1BW6 A;  2CFO A;  3ROU A;  1MW7 A;  2ADU A;  1XG1 A;  3HOS A;  3BTJ A;  3QOP A;  2QQA A;  4YEJ A;  2XSJ C;  4FT8 A;  1IRG A;  1W5S A;  2PFB A;  2RV8 A;  2RVC A;  3LST A;  2O8X A;  4H4K C;  5KK1 A;  3VYT B;  2M0C A;  4D7N A;  2QZ8 A;  3G4S I;  1I50 J;  2HQA A;  3DQV C;  5FKM A;  5K5Q A;  1EH6 A;  1PP8 F;  3DTE A;  1GUU A;  2IEK A;  3DTK A;  2HOA A;  1IRX A;  4IHY A;  3IUO A;  3VEP A;  3F22 A;  3HOU J;  4U0V A;  4AM3 A;  3NWT A;  1U9O A;  2MFZ A;  2E2I J;  2RNG A;  4BDY A;  5JFR A;  4E7J A;  1WFX A;  1SVL A;  2NS8 A;  2Z3Y A;  1LFU P;  1OIS A;  1BJA A;  3QAH A;  1A36 A;  3ABK H;  2COM A;  3SJM A;  2LKS A;  1JTX A;  2ECC A;  4PGG A;  4Y15 A;  3CD6 I;  4IL6 C;  2KRF A;  1ACI A;  2HXO A;  2P5V A;  3E6M A;  1WH7 A;  1R36 A;  1D8K A;  3ESW B;  3TKY A;  1JHF A;  4I7H A;  3U9G A;  2GAU A;  3BG7 A;  3BR5 A;  1IGN A;  2XDV A;  1MBK A;  1IF1 A;  1D0Y A;  3WU0 A;  2A61 A;  1JKP C;  3MN2 A;  4FET A;  2IGO A;  4QTR A;  2OQG A;  1YG2 A;  1C0W A;  2ZC2 A;  4PK4 A;  3ABU A;  4D5F A;  5EEH A;  4IQJ A;  1YHQ I;  3COA C;  5ICF A;  3RKW A;  5HLT A;  4A69 C;  2VLA A;  2OCE A;  1I27 A;  5FGM A;  2OA4 A;  1ETX A;  2ZXI A;  3KCC A;  4Y3O A;  1W7P D;  1E3H A;  2QUF A;  3E1S A;  2K4B A;  4C9Y A;  5DV5 A;  2FE3 A;  3H3Z A;  2O6G E;  3SDG A;  2BVM A;  1WGX A;  5EEG A;  3AG4 H;  2NVU B;  4AYB A;  4EJO A;  1MD0 A;  2Y48 A;  1NG7 A;  4I99 C;  3TMO A;  4B48 A;  1KU3 A;  5M5X J;  3K10 A;  2EV0 A;  1YOV B;  1BI0 A;  3S3M A;  2OBP A;  1YTY A;  3HZJ A;  3I4P A;  4U0Y A;  3F3X A;  5E1W A;  4UNO A;  1S3J A;  2B0L A;  1AU7 A;  2LSO A;  5BNG A;  4IJA A;  4ZDP A;  1XCB A;  1GVD A;  5B5E C;  4RB3 C;  2XPU A;  4HZF A;  5J1U A;  1D0X A;  2XAJ A;  2M7B A;  4Y17 A;  4RBO A;  5DYM A;  1ZR4 A;  2IGN A;  4IEJ A;  4UUS B;  3HJE A;  4BE1 A;  3HGG A;  4DYR A;  2WC2 A;  3OYL A;  2LMD A;  1GT0 C;  2VBZ A;  3JW4 A;  2XC7 A;  2M4G A;  3HRM A;  2HDD A;  2QQB A;  1W0T A;  3S14 J;  2YPR A;  4HG2 A;  3C2G A;  3CTA A;  5BOX A;  3FMR A;  1BBY A;  2ISY A;  1X4P A;  3QYB A;  1HLV A;  1XS9 A;  2OF7 A;  4G12 A;  2HFH A;  1FBU A;  4P1W A;  4XIC A;  3FXR A;  4CSW A;  5KHD A;  1OR7 A;  2R7S A;  1Z67 A;  3BZK A;  4F3Q A;  5K7F A;  3BCB A;  2ZME C;  4WXD A;  3F9K A;  5H6R A;  1DU0 A;  4PGH A;  3W6J B;  2F5C A;  4ZDO A;  3WTV C;  2VI6 A;  5FLV A;  5HNF A;  3KP6 A;  3PO3 J;  1LVK A;  1KU2 A;  1ZN2 A;  2XRO A;  4RA2 A;  3PFI A;  5F1R A;  2CGP A;  4BQO A;  3DEE A;  3S2H J;  3K2Z A;  2L02 A;  4RM3 A;  1LPQ A;  1REP C;  2DQR A;  2IVM A;  2EFW A;  2HEO A;  3I59 B;  3OYH A;  2FSW A;  1UCR A;  3SZG A;  4ON0 A;  2O9L A;  1R1T A;  1CF7 B;  4XLE A;  2DAO A;  4XSZ F;  1EKE A;  4M6Y A;  4UXN A;  1SFE A;  2ECB A;  1WI3 A;  4HF1 A;  1X3U A;  3KE2 A;  4L5I A;  2I5U A;  4A6E A;  4E7K A;  2FBK A;  1BR4 A;  1B9N A;  2E19 A;  2DMT A;  3HL2 A;  3S1R J;  2DTR A;  2VXZ A;  2I10 A;  3DV8 A;  1ORK A;  3ISP A;  2VJ5 A;  1VZ0 A;  1W5C C;  1YX5 A;  2A68 F;  4RB0 A;  4HRI A;  3HHG A;  1YS6 A;  2BBY A;  5ILU A;  5CPR B;  1BL0 A;  5BQT A;  3T8T A;  4BE0 A;  3LSK A;  1VQ7 I;  2VQC A;  3IHU A;  1I3A A;  1Y56 A;  2MC3 A;  1I6H J;  2A5W A;  1TW2 A;  2GOX B;  4J01 A;  4EVI A;  1P4W A;  1X19 A;  2YX4 A;  2Q1Z B;  4N0B A;  1ZQ3 P;  3O3K A;  3KEQ A;  1JTY A;  4KMU X;  1FMW A;  5EYR A;  3NAR A;  3CCJ I;  2AS5 F;  4KMF A;  2DOA A;  3OYD A;  3F6V A;  4XMY A;  4YFK F;  1MBJ A;  1OYY A;  3BP8 A;  4AVP A;  2EPF A;  4BJ6 C;  1SFX A;  2EFN A;  1G3W A;  4EAT A;  2A05 A;  4JQF A;  4RB2 C;  2ZFU A;  5DS9 A;  3S1Q J;  4G6D A;  1T38 A;  2K7L A;  1B8I B;  1UEL B;  1QNT A;  4BQN A;  1R71 A;  2HZD A;  2EZH A;  3TGN A;  4ZJZ A;  2WV1 A;  3O8G A;  4G9Y A;  4CCM A;  1XGM A;  2R7X A;  1RC9 A;  3A0B C;  1E3P A;  4LG0 B;  1MH4 A;  4RGX A;  4FX4 A;  4AU7 A;  1IDY A;  2JA6 J;  1B59 A;  4NC6 A;  2DMN A;  4D7M A;  2WB1 A;  4M74 A;  2EIL H;  4B8X A;  4EEF G;  1XPX A;  2JWT A;  2D5V A;  1LQ1 A;  4NNJ A;  2VC0 A;  3S15 J;  3R61 A;  2XF6 A;  2E35 A;  4U88 A;  3FXK A;  2E2J J;  5GAE J;  1MH3 A;  4M6V A;  3HTS B;  1JUS A;  5JVT A;  4D0P A;  2AXL A;  2EB7 A;  5LGU A;  2EV6 A;  3QYE A;  4B44 A;  3BJO A;  1LVA A;  2EJR A;  3HSR A;  2MA3 A;  2LK2 A;  3K4M A;  2VBX A;  3H0G J;  2QCO A;  5ICE A;  5KNL A;  2AO9 A;  3F21 A;  2QBY B;  1TQM A;  2L2O A;  1T95 A;  5A2Q K;  4A3C J;  4LD5 A;  2FRH A;  1QBJ A;  4HOB A;  3VPR A;  3W2V A;  5FD5 A;  2JA7 J;  3OYJ A;  1QO0 D;  1CQT A;  4XOT A;  2EWN A;  2OU2 A;  4BL0 B;  1TWC J;  3P7N A;  3S17 J;  2BW3 B;  4JYK A;  3BPX A;  1KQ9 A;  2O5R A;  1ERD A;  1F1Z A;  2L54 A;  5FB2 A;  3S8P A;  4IOA F;  3I53 A;  2BXZ A;  5IYC J;  5TRD A;  3WU2 C;  2TCT A;  2ZXJ A;  2IS2 A;  2KJC A;  1MJ9 A;  4IRI A;  2DOE A;  4PJM A;  2OTL I;  1IN5 A;  3FIW A;  2AQE A;  4HQM A;  4ANJ A;  2MYS A;  2LVS A;  5D4S A;  1FOY A;  3G1L A;  1GLN A;  4HEA 2;  3W6K B;  4XKV A;  2BGC A;  4GCV A;  3S1N J;  4L9N A;  2R7R A;  2DFE A;  4C3I J;  2W25 A;  4BQQ A;  2WTE A;  3EYY A;  3OYK A;  3AG3 H;  4ZH4 F;  4BNC A;  3W6V A;  2F4O B;  3ABM H;  2ZKZ A;  4WK8 F;  5F0H A;  4E7S A;  2Q0O A;  2B9S A;  3S3N A;  1MND A;  3GEZ A;  1TNT A;  1TLH B;  1PYV A;  1IXR C;  2L4A A;  3N4M A;  4EJU A;  2LLK A;  1MNE A;  4ZZD A;  4XID A;  3GX4 X;  4G6T B;  1YJ9 I;  4XLP F;  1APL C;  3WGH A;  2OD5 A;  4XN0 A;  2HKO A;  1Z7L A;  2FQ3 A;  4I98 B;  1SMY F;  3HKZ N;  4KJZ A;  2NAZ A;  3BG3 A;  3JTG A;  2R3S A;  4YG2 F;  2O0Y A;  3EUH A;  4C2U A;  2IT0 A;  1YLF A;  4ESF A;  3HGY A;  4BDZ A;  3ASN H;  5J1Y A;  2GA2 A;  3UKG A;  1ZLJ A;  1V4R A;  3G1O A;  3JSO A;  3CC4 I;  1H9T A;  1H0M A;  3MQ0 A;  1BR2 A;  2WAQ A;  1YW8 A;  4AIJ A;  3LSI A;  5GPA A;  2DT6 A;  2W4S A;  4J00 A;  1OCZ H;  3V7S A;  2KPM A;  1O7L A;  4KIC A;  2R92 J;  5FFZ A;  4JX5 A;  2O8K A;  2MBF A;  2PN6 A;  3BR1 A;  3VOD A;  1G3T A;  2DFH A;  2R7F A;  3OYM A;  2HWV A;  4PSW A;  4P96 A;  4OIQ F;  3GTM J;  1YX3 A;  2IW5 A;  3W2W A;  3N97 A;  3OS0 A;  2DA3 A;  3GBG A;  3KPH A;  2QGU A;  3CCE I;  3D5R C;  3LWF A;  3GCM A;  1K4S A;  1GVJ A;  2HTS A;  2JVG A;  1IXC A;  1K83 J;  1WJB A;  2ISZ A;  3T8R A;  3HYI A;  5F1J A;  4LG3 A;  1Y6I A;  2K9Q A;  4IX7 A;  1FOK A;  2E1N A;  1UAA A;  2TRT A;  2FOW A;  1R1V A;  2AQF A;  1FTT A;  2ELH A;  1W5T A;  3MMY B;  3IH2 A;  4GRI A;  4N9I A;  5JI6 A;  3HOW J;  3I71 A;  4BEH A;  4KNY A;  1DU6 A;  5CKT A;  5GTH C;  1TZL A;  3WE2 A;  3F72 A;  2KJB A;  1MJB A;  3GFJ A;  3PM1 A;  1GHC A;  1D8J A;  1Z77 A;  2Y30 A;  1WRJ A;  3FK7 A;  2QKL B;  4FIS A;  2B7E A;  4QIW N;  1ZK8 A;  2H1K A;  1V54 H;  2G7H A;  4ZTJ A;  2OUM A;  5D6E A;  4QPQ A;  4G6Q A;  3TW6 A;  4I2O A;  1TL8 A;  2CQN A;  1W1W E;  3PIO F;  3MKZ A;  3CCU I;  2VQG A;  1J75 A;  3L2Q A;  2XAH A;  2CWE A;  3H5N A;  3H35 A;  2LC2 A;  5D5V B;  3GYH X;  3KP2 A;  3HOV J;  1J7K A;  5IYB J;  4JP0 A;  4M3E A;  2R0Q C;  4G7Z F;  1U78 A;  1IC8 A;  4LB6 B;  3MEX A;  2ACJ A;  2VUM J;  3JRB A;  3HM5 A;  3DBH B;  4DIQ A;  2VJJ A;  3DU6 A;  4M73 A;  2EZL A;  3CP8 A;  1FOX A;  3BPV A;  3ZP5 A;  2L9N A;  5IOY A;  3TDZ C;  2QSF X;  4X0G A;  4CHU A;  1GV5 A;  3FXO A;  4F92 B;  4P5O A;  3CUQ B;  3TL4 X;  5L3G A;  3CCM I;  1HDP A;  3TED A;  4LB5 A;  4IHT A;  2LFB A;  3CDH A;  1QGP A;  3G6E I;  1FP1 D;  1O4X A;  5TJJ A;  4V2F A;  1OCO H;  3M4O J;  4M71 A;  2X1D A;  1Y39 A;  1R22 A;  3GFM A;  3EET A;  2CUE A;  2P5L C;  1F5T A;  5KAI C;  3ASO H;  3GXO A;  1TT0 A;  3I4M J;  2LY2 A;  3ZXS A;  1YQA A;  1G3Y A;  2EV5 A;  1QVU A;  2OAZ A;  2PMZ N;  2YX7 A;  1XSX A;  2MW8 A;  4KIG A;  3ECO A;  3GTK J;  4S04 A;  3KP5 A;  2GXA A;  1UJ8 A;  2HYJ A;  3LSR A;  1PDN C;  3BZC A;  1T8I A;  1MBF A;  4L9T A;  3CJR B;  2V4J C;  2DMU A;  1KYZ A;  3K6G A;  3OR1 C;  1ZG1 A;  2A3S A;  2LF7 A;  4CYD A;  4D5C A;  3RCO A;  1BOB A;  3E6C C;  3CJN A;  5HOO A;  1DPU A;  2CQK A;  1USS A;  1FZP B;  4GFB A;  2QYO A;  1MKM A;  4IHX A;  1UHS A;  2CSO A;  2JQ7 A;  1JXS A;  5CVR A;  3OYG A;  1IUF A;  1WJF A;  3IL2 A;  3CLQ A;  3P9I A;  4M6X A;  2UV1 A;  3OSF A;  2ZXW H;  4I76 A;  3AAF A;  2K85 A;  3EUA A;  3T5X A;  3MKW B;  4NHJ A;  1YS7 A;  2CQQ A;  2HQ5 A;  3DKW A;  2R7Z J;  1Z6R A;  5LGT A;  4CCN A;  1ODD A;  2GLO A;  5K5O A;  4GO1 A;  2CQX A;  3TP3 A;  3V7R A;  3FMS A;  1BJZ A;  2ZCW A;  2FML A;  2M4K A;  2WBM A;  5C44 J;  3FX3 A;  4EM1 A;  5FLX K;  2M1B A;  2XUB A;  2HVQ A;  4LMY A;  5FRM A;  3E5U A;  4ESB A;  3C2H A;  3CO7 C;  2FF4 A;  3DP7 A;  3HSF A;  4I0B A;  2EQR A;  3I58 A;  4HNV A;  4NUB A;  3WTY C;  3FK6 A;  3H0D A;  4H0E A;  3DKY A;  4BUP A;  1OYI A;  1D1B A;  2JPC A;  2GIV A;  2DOF A;  4BXF A;  2V1N A;  2FUG 2;  2D1V A;  3RTR A;  1K7A A;  2VOP A;  2M34 A;  4KA4 A;  2CW0 F;  3D5S C;  3K4C A;  3PUF A;  3K9T A;  4EJW A;  1ZRE A;  4AID A;  1ZRD A;  2CS3 A;  1QZZ A;  1U5T B;  2XKP A;  2CG4 A;  4M3G A;  1QA6 A;  5AIQ A;  1BA5 A;  5AON A;  2V9V A;  4KIT B;  2ZBK A;  1EJ9 A;  3WTT C;  4XRS G;  3PSF A;  3C18 A;  4ZDL A;  2Y0S N;  1IO2 A;  4ZYE A;  5DDG A;  1MBH A;  4FQG A;  2JVH A;  3FIS A;  4XBF A;  2JUG A;  2DA6 A;  1E3O C;  2V1D A;  2CV2 A;  2VE8 A;  1Z3X A;  4A3G J;  4E4H A;  4UUV A;  1ETO A;  4LLG F;  4BQA A;  1ETW A;  2XF5 A;  1XN7 A;  1BM9 A;  4E70 A;  2XPV A;  4RGS A;  4XON A;  1JUM A;  5EDN A;  5D8K B;  3H9G A;  2QM3 A;  3GVA A;  2GA1 A;  1IXS B;  1OJL A;  5HS8 A;  3S1M J;  1A6Q A;  3KLN A;  3ZMD A;  2E71 A;  2STT A;  4A2U A;  3WTU C;  3TOA A;  4U7D A;  4UB6 C;  1E17 A;  1LFB A;  1ZAO A;  4A6D A;  2KDZ A;  1J59 A;  2XV4 S;  2DCE A;  2IA0 A;  3SQN A;  2NVT J;  2H94 A;  1PVE A;  2Y2Z A;  2DN0 A;  1B1B A;  4LK0 F;  4MLO A;  3IRQ A;  4E7H A;  1FLI A;  4AIK A;  5D4R A;  1ZR2 A;  3BJA A;  3ZN1 A;  3FXJ A;  5L3C A;  2VOD A;  3HSE A;  5IT3 A;  1RES A;  2HOE A;  1RNL A;  1N25 A;  2E5Z A;  2XGC A;  1V55 H;  4BGD A;  2DA5 A;  4KUM A;  1U3E M;  4ZZL A;  5EZG A;  3OS1 A;  2KIU A;  2XIG A;  4YFX F;  1Z91 A;  2Z16 A;  3ZQ7 A;  3K4J A;  3K4L A;  3KLO A;  4Z6Y A;  2P8T A;  3BG5 A;  3FHZ A;  3MFK A;  1E0E A;  2DO7 A;  3J7A O;  3GTO J;  2HZT A;  1VI0 A;  1YJW I;  3MCZ A;  3RQI A;  4B47 A;  4IHS A;  3M1E A;  4XLH A;  3JAM K;  4PJL A;  2L5Q A;  1W4M A;  4DBR A;  3BR6 A;  1R00 A;  5DCF A;  5D5W B;  2DMQ A;  1IJW C;  3NEU A;  3DWL E;  3I3L A;  2VKD A;  3VSK A;  1UZC A;  1OCP A;  2VKV A;  4M9X A;  3M8J A;  4QSH A;  4UUT A;  3PQK A;  2XVC A;  4RAY A;  5JHF A;  3LMM A;  3OYF A;  2BHY A;  2NS7 A;  3OOU A;  5K7H A;  4OWR B;  4L5E A;  4AWX B;  3I4N J;  3T1B A;  4PSX A;  2FXA A;  4DZP A;  3GME A;  4IRH A;  4JX6 A;  1RPW A;  4FCY A;  1TNS A;  4NBQ A;  2HS5 A;  1QQI A;  2W57 A;  3A0H C;  3CCV I;  4EM2 A;  5JVG F;  2Z2S B;  1XDU A;  5J47 A;  2IP2 A;  4FHT A;  5E79 C;  3KFW X;  3K4K A;  1XCV A;  3WTX C;  1JJ8 C;  1GXQ A;  2VL8 A;  5GAG J;  1ZGW A;  1RR7 A;  3ZMV A;  3QPH A;  2Y9Y A;  1ETK A;  1PUF A;  2CMP A;  2L01 A;  3KP7 A;  4P9F A;  2CQ7 A;  4HDV A;  1DP7 P;  3E97 A;  3DEW A;  3LSJ A;  4HAM A;  3DFG A;  1H89 C;  3H5R A;  3AL0 B;  4IHV A;  2ZME A;  3CO6 C;  1OFC X;  3ZMS A;  5C3E J;  1YYV A;  2QKM B;  2R4G A;  2WY7 Q;  3K1P A;  2A69 F;  1X3W B;  3J81 Z;  3OYA A;  1D1C A;  1WJC A;  3AFH A;  3B6C A;  2Y75 A;  4CZC A;  4NQW A;  1TWA J;  1BC7 C;  1BOA A;  3OIO A;  4V19 K;  4KFC A;  1W36 C;  5M5Y J;  1NH3 A;  2HTJ A;  2V6C A;  3HXL A;  5KCM A;  3JRI A;  1XMK A;  1T2K A;  2E36 A;  1FWZ A;  4K2E A;  1IG7 A;  4KIS A;  1G6N A;  2JJ7 A;  1WZ2 A;  5J1R A;  4CCJ A;  2VPR A;  5H6Q A;  2ZO4 A;  3O2P E;  3OSG A;  4XRM A;  2VAS A;  2NVY J;  3HBL A;  1XGN A;  4LJZ F;  2F6C A;  2M0M A;  3F8C A;  3GO5 A;  4E7I A;  3LSM A;  3MD2 A;  1SD6 A;  1TW3 A;  4BEH B;  4A3D J;  3E3V A;  1J09 A;  1G2H A;  4EV0 A;  1KU7 A;  1ULY A;  2MH9 A;  2P6S A;  3LNQ A;  1BI1 A;  3BTL A;  3HOX J;  1IZ1 A;  2G9W A;  1BR1 A;  5BPI A;  1VQO I;  2A6H F;  4MEY F;  2Q2E A;  1HST A;  1Q1H A;  2R5Y B;  5K7Z A;  1FPQ A;  2DI3 A;  1MDM A;  1ZRC A;  2LOO A;  3BLY A;  2F2E A;  3RKQ A;  5LEJ A;  4A3F J;  5F08 A;  2M5W A;  4FE4 A;  2X4H A;  3AG1 H;  4UVB A;  2Y9Z A;  3FZV A;  4KN4 X;  1Z0X A;  3E7L A;  3WGI A;  4XNF A;  1R1U A;  3PL8 A;  1P7J A;  2KL4 A;  5LHG A;  1TWH J;  3CUO A;  4CXF A;  3FF5 A;  4V2G A;  4DNC A;  4BBS J;  3HRU A;  1XB4 A;  4GXO A;  5CYV A;  4CIC A;  4KT5 C;  4M3D A;  1BIA A;  2IGK A;  1WCM J;  4S05 A;  2IXS A;  3QWL A;  3AKZ A;  4IHW A;  5ICC A;  3VSL A;  4A3M J;  3IWZ A;  3WU1 B;  4BJT A;  3CUQ C;  2Z5U A;  2ID3 A;  4C3H J;  1TBX A;  3AG2 H;  3BT9 A;  2BY0 A;  4AC0 A;  3W3C A;  2UZK A;  2GZW A;  2LD5 A;  3RKX A;  3JTH A;  4RMN A;  3F0C A;  5E20 A;  3KIO A;  5DCM A;  2R7U A;  2XAU A;  1S9H A;  4W97 A;  1RUN A;  2DXI A;  2COB A;  1QZE A;  5CVV A;  4HNU A;  5J8F A;  4YIF A;  4M72 A;  1W7P A;  1Y8R B;  3CF5 F;  3QP5 A;  2X6X A;  5E3L A;  3MZH A;  4AYB N;  5IT9 Z;  5HLH A;  2QWW A;  2RAE A;  3BTI A;  5FRO A;  3A2K A;  2BZT A;  2VJ4 A;  4F52 A;  5HLI A;  4IXA A;  3UNG C;  5EF6 A;  2VE9 A;  5CLS A;  1HQC A;  3QU3 A;  2W84 A;  3H5A A;  3D0S A;  2MD5 A;  1MMS A;  4BAY A;  4Q5S F;  4CUG A;  1E2X A;  4R8H A;  3H3V K;  1R5H A;  1JI8 A;  4RS8 A;  1LFP A;  2WAD A;  3QPT A;  1UG0 A;  4MFE A;  1ITY A;  3M07 A;  3RDI A;  4ZTF A;  5EEA A;  1LJ9 A;  1X2M A;  3HG9 A;  3LL7 A;  3IKT A;  2VIX A;  4IQ4 A;  4HLY A;  3KZZ A;  2OV7 A;  1T6S A;  1J2X A;  5EG0 A;  3DTI A;  1N77 A;  4BS9 A;  2EFQ A;  5EJC A;  3HUG A;  3OV8 A;  1V3F A;  4A93 J;  2HDW A;  3KZY A;  2XPW A;  4EJT A;  3F8N A;  2EZK A;  4ESJ A;  3FXQ A;  4L18 B;  2O3F A;  1VQ6 I;  3RQ4 A;  3MWM A;  3L7W A;  1TC3 C;  1WWX A;  4B09 A;  4RB1 A;  4FX0 A;  1YW9 A;  5DD4 A;  2OC6 A;  1XSV A;  3BG6 A;  4Y52 J;  2GIZ A;  4RAG A;  2LYC A;  3R0J A;  2XF7 A;  3B6A A;  3K0L A;  2VON A;  5M5W J;  1QHG A;  3TDU C;  4O3M A;  3VFZ A;  2YS9 A;  5JLX A;  4JX4 A;  4P55 A;  2H8W A;  4UB8 C;  2HVS A;  2DW4 A;  1J5Y A;  4OIP F;  4A12 A;  2F5E A;  5M3M J;  1OMI A;  4AIH A;  1S5L C;  2L9V A;  3K1M A;  1U5T C;  2R7W A;  5TIS C;  4A3I J;  1BIB A;  1JT6 A;  5DM7 F;  5DUI A;  5IOZ A;  1SAU A;  5EGO A;  2L7F P;  4LLL A;  4EJV A;  5E1Z B;  1B72 A;  2W1O A;  2LR8 A;  1RI7 A;  5TGT A;  2D1H A;  2MAB A;  2ZJ2 A;  4XLC A;  1NG6 A;  1VQM I;  2V26 A;  1LE8 A;  5H20 A;  2FX0 A;  3M8F A;  2Z9O A;  1QRY A;  5F0C A;  3L2R A;  4BU2 A;  1S7A A;  4BHC A;  3D5L A;  3LSP A;  2FJ1 A;  3M7G A;  5F6F A;  2K3F A;  1F4K A;  3HOT A;  5FKN A;  1I3Q J;  4LK1 F;  2VOO A;  2ELJ A;  4F7Z A;  1VQN I;  2CU7 A;  3OR2 C;  2STW A;  4I6Z A;  1NK3 P;  1ON2 A;  1P2F A;  2DA1 A;  2DOD A;  2EIK H;  1AHD P;  2Y31 A;  2F4I A;  1HW5 A;  4OAY A;  1IRF A;  2GXG A;  2EIJ H;  2HGC A;  4JOM A;  4N4O B;  2FNA A;  1UG2 A;  1KU9 A;  2BOL A;  4ENJ A;  3ZPL A;  1R4M B;  3B02 A;  5FD6 A;  3E6B A;  3RPU D;  5J3L A;  4XKB A;  1Y1V J;  3KEY A;  4PJ0 C;  1YRN A;  3DLA A;  4CCL A;  3KZI C;  2VC1 A;  1WH5 A;  2OZ6 A;  3FBN B;  1R23 A;  1V5G A;  1Y8Q B;  2XAQ A;  3TBI A;  1X2N A;  1HW2 A;  2LTP A;  1K6O A;  1FJL A;  2NYX A;  2M87 A;  1D3Y A;  3JRF A;  2KMU A;  1O3R A;  1SD7 A;  2KHM A;  2DLL A;  3J7A Y;  1UST A;  1F9N A;  3FM3 A;  1P6R A;  3IRR A;  4UVA A;  3NWS A;  4PZJ A;  3LAP A;  2P81 A;  4FAS D;  4YRV A;  4UHT A;  5F0F A;  2KQR A;  1P4X A;  1HKQ A;  3M8E A;  2MH2 A;  1TT5 B;  2IGM A;  2DQL A;  3O6B B;  4PJJ A;  4XOP A;  2ZSH B;  5E8G A;  1WJD A;  2L7Z A;  1Z3Y A;  2DFF A;  4PDK A;  4OOI A;  4HX8 A;  4NDL A;  2HPM A;  2R7V A;  2QQ9 A;  4Q4Z F;  1MBE A;  1IN6 A;  1JKQ C;  1QPI A;  3I0T A;  4XLA A;  1IRZ A;  1EF4 A;  4JBA A;  4MEX F;  4A3J J;  2I8D A;  2KIQ A;  2KIF A;  2MSY A;  1YFH A;  4YIR X;  2V7F A;  1O7F A;  3HDD A;  1EH8 A;  4CO8 A;  2VT2 A;  3G73 A;  1G8X A;  1M1E B;  5IP7 J;  3PSI A;  5IYD J;  2FA5 A;  5LHI A;  3C7J A;  1U2W A;  2MLG A;  4BAC A;  4RAF A;  2LP0 A;  3RYR A;  2ELK A;  2HYF A;  1R5G A;  1MNM C;  4Y33 A;  3ABL H;  4UVC A;  4XKW A;  2KRH A;  3H36 A;  2XKO A;  2GOM A;  2DBB A;  2CJJ A;  1KQ0 A;  3NAU A;  4NC8 A;  1U8B A;  4P9U A;  2Z33 A;  1RIO H;  2R7T A;  1SVM A;  3K70 D;  4TV7 A;  1SD5 A;  5LRS A;  1DQU A;  4LGW A;  2HOS A;  3CJQ B;  2AHQ A;  3ECH A;  4MTE A;  2ZME B;  5GPC A;  1OYW A;  2A07 F;  1OKR A;  2AXT C;  1OCC H;  2L7M P;  3FMQ A;  1P4A A;  4U0W A;  2HYG D;  1IV8 A;  3LA3 A;  4KN7 X;  4CA0 A;  2PJR A;  4GYI A;  3BZ6 A;  4A0Z A;  2Q8K A;  2JZY A;  2GM4 A;  1FX7 A;  2KIS A;  2ZJR F;  4NQW B;  1ENH A;  3BWG A;  3HEF A;  4XQF A;  2PMU A;  2W85 A;  3S16 J;  2PJP A;  5CVI A;  3CC2 I;  5IT9 K;  4HYE A;  5FO5 A;  3G1M A;  1K79 A;  4C3J J;  5JHU A;  3H9Q A;  3C1D A;  1P7I A;  4HV6 A;  3ZOB A;  1S7E A;  3DBR B;  3U21 A;  1HKS A;  1ETV A;  4HW0 A;  2LBF A;  1Z05 A;  1XC5 A;  1VQL I;  1GV2 A;  1ZGJ A;  2KT0 A;  1AA7 A;  4OIN F;  4WXC A;  5L3B A;  1KON A;  2BHZ A;  3BC8 A;  5D5U B;  3CCQ I;  3FM5 A;  2KP6 A;  3ML6 A;  1ZLK A;  2YR2 A;  1QHH D;  2W7N A;  3CC7 I;  4XRS A;  3ZQH A;  2E7W A;  1T08 B;  2RRE A;  4IO9 F;  3CMY A;  2WAQ N;  3J80 Z;  1T56 A;  4IF4 A;  1BI3 A;  4W1U A;  3SEQ A;  3PQJ A;  2FU4 A;  3WOD F;  3JRG A;  3S93 A;  4IVN A;  2Q2E B;  2NOG A;  2W24 A;  3T0Y A;  5FKK A;  4A5M A;  5L3E A;  1PUE E;  3VYS B;  4DQ2 A;  5LLQ A;  3OWT A;  3F6O A;  3ULQ B;  3G71 I;  3SYT A;  3LA2 A;  4I09 A;  1YE9 A;  5CJ9 A;  1T0F C;  3BQZ A;  1MJA A;  3EQL F;  3F8B A;  2JN6 A;  3D1N I;  1X58 A;  1VF9 A;  3OIQ A;  4HQE A;  1JHH A;  2X48 A;  3LOC A;  2DU9 A;  3TQN A;  3CF2 A;  5L3F A;  3A01 A;  5GP9 A;  5IPA A;  4HF2 A;  3EPZ A;  1YIJ I;  3U2R A;  4IKF A;  3CDL A;  3OOP A;  2IA2 A;  1FYK A;  4II2 A;  2QEX I;  3BQY A;  4RM2 A;  5GAD J;  2HXI A;  4O5V A;  1ZG5 A;  1GDT A;  4QWQ A;  1JKR C;  3J7Z I;  1RR8 C;  2Z1D A;  3FWE A;  5EZH A;  2X1C A;  1VQ4 I;  4ABZ A;  3CLO A;  4IRG A;  2WAE A;  3QOD A;  5FKL A;  2RNJ A;  3KP3 A;  3P5J A;  4B1R A;  5LD2 C;  2FMY A;  1LKX A;  4XR6 A;  2Z99 A;  3Q9S A;  9ANT A;  3DXJ F;  2L7K A;  3GTG J;  2JA2 A;  3Q0W A;  4OIR F;  2EIN H;  3DEU A;  3VOE A;  5DCM B;  2HPI A;  2W82 A;  1SFK A;  2LG4 A;  4C30 A;  3R6S A;  1Y1W J;  4KYW A;  1FBS A;  1HXD A;  1MBG A;  4LIV A;  1W7P B;  2XGX A;  1MMA A;  3GTQ J;  4OMY A;  3U1D A;  1HW1 A;  1S8N A;  2XAF A;  2HVR A;  4O6J A;  2IS6 A;  2PX9 A;  3Q3S A;  1DGW Y;  1VND A;  2V9P A;  1QU3 A;  3MKY B;  5HVQ C;  2QSH X;  3WTS C;  2RDP A;  1A35 A;  4D1Q A;  3JRC A;  3L2U A;  3WHC A;  2GBY A;  3CCR I;  2BW3 A;  3M3Y J;  1DGR M;  1BN5 A;  2KZV A;  1JGG A;  2YU3 A;  1T33 A;  3E6D A;  1N78 A;  4U87 A;  3ZR8 X;  1K4T A;  2HDC A;  4OMZ A;  4BY7 J;  3ELK A;  2DYS H;  2L4M A;  4ENM A;  1CGP A;  4HST A;  3LA7 A;  3H92 A;  2IBD A;  1WPK A;  4E7Z A;  4J19 A;  1XMA A;  3K1N A;  2B63 J;  1KGS A;  1IN7 A;  2JK3 A;  3IP4 B;  3WHB A;  4BH9 A;  2M45 A;  3CMA I;  2IS4 A;  1I39 A;  3TO6 A;  1SEU A;  2IAI A;  5EG0 B;  1D5Y A;  1R5I D;  2DA7 A;  2HR3 A;  4Q47 A;  2UWM A;  2CUF A;  3OYI A;  2VXD A;  2JA8 J;  4RLQ A;  2UUZ A;  3IAM 2;  5HDK A;  2CFX A;  2NNN A;  4PCQ A;  5D5X B;  3RI4 A;  2VBW A;  2P7V B;  4EGY A;  4M3F A;  1FIP A;  3S3O A;  2CRG A;  2M3A A;  3F23 A;  2H6C A;  3KYL A;  4I01 A;  4NC7 A;  3K70 C;  4DYC A;  3WE3 A;  3ZQL A;  1U9N A;  3SHF A;  3IKV A;  3WGG A;  2VBY A;  5K1Y A;  1S6L A;  1MSE C;  6PAX A;  3QU6 A;  1ONV A;  1YI2 I;  2E1C A;  1TP4 A;  5J4Y A;  4XLN F;  2BE5 F;  3OMY A;  3LFU A;  4L0Y B;  3BR2 A;  1UHW A;  3QPS A;  3FBI B;  4HSR A;  2A6T A;  3LSG A;  4ITV A;  4BXU A;  3Q0V A;  2X9D A;  5LEK A;  2X51 A;  1WHU A;  5CVJ A;  4PJN A;  3GLX A;  5EGO B;  1RET A;  3JRA A;  4BJ5 C;  1B72 B;  1OPC A;  1QZY A;  2K9M A;  1H8A C;  2KZG A;  1MMD A;  4XL9 A;  3RYP A;  4B3A A;  1W0U A;  1A04 A;  1K6Y A;  1LE8 B;  3DLL F;  2LRE A;  4BXX J;  2P5K A;  2PQ8 A;  2R5Z A;  1SFU A;  2FNP A;  5E3N A;  1X1D A;  3GLL A;  2EH3 A;  1R9T J;  2YUS A;  3LQR A;  1SFO J;  1V5F A;  2FEZ A;  3J7Y J;  4X6A J;  2M9H A;  3E5Q A;  3FKI J;  2IA1 A;  5A2Q Z;  4PFO A;  2ZNZ A;  3VB2 A;  4OU0 A;  1OCR H;  3JRE A;  2DPD A;  1DPR A;  5HLG A;  4G7O F;  4YEL A;  2PG4 A;  1Z7U A;  4CZZ A;  5CVU A;  1ZH5 A;  4DOZ A;  3HPG A;  2P0W A;  3CCS I;  4A0X A;  1FMV A;  1UHM A;  3BRO A;  3KEO A;  4D9J A;  3RKY A;  3Q5F A;  2JT1 A;  1D1A A;  2JRM A;  2CV0 A;  1H9G A;  2RGV A;  1B6A A;  5ILV A;  3K2A A;  3QP6 A;  2CO5 A;  1A6I A;  3MVP A;  3OL4 A;  1A31 A;  2LKX A;  4JK1 X;  4MFD A;  1L0O C;  2EA2 A;  1LDK B;  3I9V 2;  3RSN A;  1YRN B;  1FTZ A;  4AVZ A;  2XSD C;  3ZQF A;  3PO2 J;  1KYW A;  2K02 A;  4R79 A;  1IDZ A;  2X1E A;  3IC7 A;  1VQK I;  2XGE A;  3ZQQ A;  3PJR A;  2K9S A;  2LF8 A;  2RQP A;  1HDD C;  1DP3 A;  2P6T A;  5L3D A;  5DD8 A;  4WCG A;  2JA5 J;  1ZTR A;  4Q48 A;  1S7O A;  1MMG A;  2HKX A;  2RN7 A;  5KVR A;  2H09 A;  3BTC A;  1FP2 A;  4ZYH A;  1K78 A;  1NK2 P;  4HBL A;  4PUS A;  4WF2 A;  3VWB A;  1ETY A;  2GXB A;  3P9C A;  1NHA A;  1HSJ A;  4KT6 A;  3CCL I;  3PNV A;  2MD0 A;  1PP7 U;  2PBI A;  3G2B A;  1RUO A;  2ETH A;  3G3Z A;  3J80 K;  3I5U A;  1FT9 A;  2OTJ I;  2R7D A;  4HDU A;  1YIT I;  4GGG A;  1I1G A;  5KAF C;  3MZ8 A;  3W2A A;  3L2V A;  1SMT A;  1JT0 A;  2HQR A;  4DGW B;  3SZT A;  3C3W A;  2MG4 A;  4HNT A;  1POG A;  2H1L A;  4BHP A;  5IP6 A;  3U1K A;  1ZEL A;  3FDY A;  1LDJ A;  3JSP A;  1H88 C;  3CUQ A;  1HCR A;  4MGR A;  3BY6 A;  1FC3 A;  1EA3 A;  2LH9 A;  2EK5 A;  2XHK A;  5C4X J;  4M9S A;  4XSX F;  5J6X A;  3WG9 A;  5LBQ A;  2V6E A;  1AOY A;  2DPU A;  1ETQ A;  2BVL A;  4RLF A;  4EMS A;  3CP2 A;  1HA8 A;  4CYC A;  5D6F A;  1B9M A;  2V9K A;  2MC4 A;  5LRR A;  4MHG A;  1KQ8 A;  1FYM A;  5IP9 J;  4BYY A;  4RDU A;  3PNY A;  2K9N A;  2J5P A;  3RJP A;  3LSH A;  4BBR J;  2K86 A;  3OYB A;  2WV0 A;  3GZ5 A;  4CCK A;  1AWC A;  2ME0 A;  2KKO A;  2O61 A;  2PEX A;  3QRF F;  2IJL A;  2M7A A;  1VQ5 I;  1LB2 A;  3MZY A;  5HOD A;  2E7X A;  3GW2 A;  2XAG A;  1KA8 A;  2EA4 A;  2PJR B;  2ZNY A;  2UXX A;  3HPH A;  4GYG A;  3OYC A;  2KLO A;  2JSP A;  4II3 A;  1WSU A;  2H27 A;  3I64 A;  3JRD A;  3GF2 A;  4L9V A;  3BG9 A;  3DCF A;  3HRT A;  1ZYR F;  4HX7 A;  1A5J A;  3DU5 A;  4C2T A;  2K4J A;  4R1H A;  5IY5 H;  4CDG A;  4EQQ A;  2DDA A;  3PFY A;  3EUK L;  3BCA A;  3IH4 A;  5E1X A;  1UMQ A;  5B3S H;  3GFI A;  1B4A A;  4MIM A;  1U0J A;  5F64 A;  3ABT A;  1YIO A;  3M1C A;  1X1C A;  1D0Z A;  2C6Y A;  2W48 A;  3Q9V A;  4BE2 A;  1OR7 C;  2BV6 A;  1JGS A;  2O03 A;  3CQZ J;  2LBF B;  3SDB A;  2L9S A;  3X2Q H;  3FXL A;  2QEN A;  5FLM J;  2M30 A;  3TO7 A;  3C2B A;  1P92 A;  2F48 A;  3SFI A;  3LFK A;  3A4C A;  5FRN A;  2E1M B;  1MSF C;  4ZYG A;  4A3L J;  1TTY A;  1FIA A;  5J4V A;  2ZFW A;  1GXP A;  3H3U A;  5FKO A;  4BY1 J;  3TO9 A;  2YSR A;  4GDF A;  1NTC A;  2DA2 A;  2O7O A;  3A02 A;  3KYD B;  5DUK A;  4KIB A;  3V8J A;  5LHH A;  3RZO J;  3DPU A;  3HKZ A;  2VJI A;  2FD5 A;  3LAJ A;  2M8E A;  4ASN A;  1P9Q C;  1U5T A;  1RZ4 A;  1LDD A;  3BJ6 A;  2D45 A;  1IAW A;  2P7C B;  5LGN A;  2VPL A;  3K4B A;  2NNY A;  2F4M B;  2BYV E;  3VYR B;  3A01 B;  4Z2Y A;  5CQG A;  4KIF A;  1Z6T A;  2E1O A;  5BPD A;  3GZ6 A;  4F55 A;  3KYC B;  3ZMZ A;  3EYI A;  3NQO A;  1X3Z B;  3K4N A;  1R7J A;  5B1A H;  3CMM A;  5HDN A;  1XMX A;  5C4J J;  2ME6 A;  2HQN A;  3LQQ A;  3GTJ J;  3L9F A;  4XK4 A;  3WTZ A;  1I1S A;  2F5D A;  1QVT A;  1AKH A;  1WJA A;  4XRF A;  3HB9 A;  1TQP A;  1IW7 F;  2QA4 I;  4WX9 A;  2CH0 A;  1JKO C;  3KP4 A;  4UV8 A;  1X1B A;  1IUY A;  1XD7 A;  4B43 A;  1QPM A;  1JE8 A;  3R4K A;  1Z21 A;  3IV5 A;  3OL3 A;  4HX4 A;  5E3O A;  2VB6 A;  4ZC3 A;  3V4G A;  1WI9 A;  2Y0M A;  3PNT A;  3OYE A;  1EH7 A;  3JRH A;  2MGQ A;  1ZAR A;  3I55 I;  4DJA A;  3I56 I;  1Z9C A;  2EFP A;  2L0K A;  1MIJ A;  2XGD A;  3ZQC A;  1XSD A;  4NB5 A;  1F43 A;  3CZ6 A;  4N9H A;  2K3P A;  3WG7 H;  1JJ6 C;  2IPQ X;  2R7O A;  4M9Z A;  1OQY A;  3ERM A;  3RZD J;  1XGO A;  1XX5 A;  5LFA A;  1U8R A;  3UR3 C;  4A5N A;  4C2M J;  1TWF J;  2GQQ A;  1Z1D A;  3TP0 A;  4XOR A;  2LNB A;  2DJI A;  2FBI A;  3F8F A;  4RAZ A;  1Y0U A;  1XTA A;  5FLX Z;  1ZGA A;  3A03 A;  1ZRF A;  2RKH A;  4OIO F;  2JSC A;  5E17 F;  3HTU A;  3QPL A;  3F8M A;  3RPQ A;  4CH7 A;  1FOW A;  1R58 A;  1WKM A;  5B1B H;  1JUP A;  4B3X A;  4I02 A;  5GAH J;  5J8C A;  3E5X A;  2EFO A;  2JRT A;  4U7B A;  3BR3 A;  4PFP A;  3CDI A;  5HDG A;  3RIR A;  3S2W A;  2PI0 A; 
#chains in the Genus database with same CATH homology
 3JR9 A;  3CMY A;  2ECB A;  1WI3 A;  1T56 A;  2WAQ N;  1Q1V A;  4W1U A;  2N8G A;  3BG5 A;  3JRG A;  2DMP A;  3Q0U A;  2E19 A;  4AUX A;  2DMT A;  3S1R J;  3GTO J;  2NOG A;  5FKK A;  2I10 A;  1ORK A;  1VI0 A;  3RQI A;  1FEX A;  2YU9 J;  2LY9 A;  3GTL J;  3BR6 A;  1BL0 A;  3BQZ A;  2JN6 A;  2DMQ A;  1X58 A;  3BR0 A;  3D1N I;  1VF9 A;  1IJW C;  2WB1 N;  2X48 A;  2VKV A;  1OCP A;  3LOC A;  1I6H J;  3A01 A;  4QSH A;  5GP9 A;  5IPA A;  4UUT A;  2NS7 A;  3OOU A;  5K7H A;  3CDL A;  2R93 J;  1ZQ3 P;  1JTY A;  5EYR A;  4L5E A;  3NAR A;  3BQY A;  3I4N J;  2HXI A;  1GDT A;  1JKR C;  4DZP A;  1MBJ A;  5EZH A;  2R5Z B;  3S2D J;  4MO7 A;  4JX6 A;  1RPW A;  4ABZ A;  4FCY A;  4Y7N J;  5DS9 A;  3S1Q J;  1B8I B;  5FKL A;  4B1R A;  2ZB9 A;  2EZH A;  1JJ8 C;  1F36 A;  2WV1 A;  9ANT A;  3HOZ J;  1ZGW A;  3GTG J;  3O8G A;  3Q0W A;  1RR7 A;  1Y1W J;  1MH4 A;  2Y9Y A;  1ETK A;  1IDY A;  2JA6 J;  1PUF A;  1MBG A;  1ZKG A;  4UUS A;  2DMN A;  4D7M A;  3DEW A;  3LSJ A;  4EEF G;  1H89 C;  3GTQ J;  2JWT A;  2D5V A;  4IHV A;  1OFC X;  3S15 J;  3Q3S A;  4BKX A;  2QF7 A;  1VND A;  4LOC A;  2E2J J;  2XRL A;  5C3E J;  1MH3 A;  4M6V A;  1JUS A;  3O8H A;  3JRC A;  4DZJ A;  3WHC A;  2GBY A;  3B6C A;  3M3Y J;  2XB5 A;  1TWG J;  1TWA J;  1JGG A;  3OIO A;  1T33 A;  2LK2 A;  1PUF B;  5M5Y J;  4BY7 J;  3H0G J;  2QCO A;  3JRI A;  2AO9 A;  5M3F J;  2VKE A;  2IBD A;  4A3K J;  1WPK A;  4J19 A;  2NVQ J;  4A3C J;  2K40 A;  1IG7 A;  4A3B J;  2B63 J;  3VPR A;  2JK3 A;  3WHB A;  2JJ7 A;  2R5Y A;  2JA7 J;  2HI3 A;  5J1R A;  2VPR A;  1CQT A;  2IAI A;  5EG0 B;  1D5Y A;  2DA7 A;  3TW7 A;  3OSG A;  4XRM A;  2X6O A;  1TWC J;  3S17 J;  2NVY J;  3HBL A;  2CUF A;  2JA8 J;  4JYK A;  2XB0 X;  2HOT A;  4M3F A;  1FIP A;  4A3D J;  2CRG A;  5IYC J;  1G2H A;  3LNQ A;  3ZQL A;  2TCT A;  3BTL A;  4DYC A;  3HOX J;  4B4C A;  1U9N A;  2R5Y B;  5K7Z A;  1MSE C;  5E3M A;  3FIW A;  3RKQ A;  2G0E A;  2LVS A;  4A3F J;  3G1L A;  4FE4 A;  5F08 A;  3S1N J;  2Y9Z A;  1K61 A;  1Z0X A;  3BR2 A;  3E7L A;  3QPS A;  3HOY J;  4C3I J;  3LSG A;  3Q0V A;  2X9D A;  1P7J A;  1TWH J;  4FE7 A;  4V2G A;  5EGO B;  1RET A;  4BBS J;  5F27 A;  3JRA A;  3W6V A;  1B72 B;  2DJN A;  1H8A C;  1VFC A;  5F0H A;  4M3D A;  2FQ4 A;  4X1E A;  1IV6 A;  4CYC B;  4B3A A;  1W0U A;  1WCM J;  3GTP J;  4IHW A;  1LE8 B;  4DW6 A;  4BXX J;  4A3M J;  2R5Z A;  2LLK A;  5E3N A;  4XID A;  2EH3 A;  1R9T J;  2YUS A;  3MKL A;  2ID3 A;  4C3H J;  1SFO J;  3BT9 A;  1APL C;  1OCT C;  4AC0 A;  2NVX J;  4X6A J;  2M9H A;  1B8I A;  3FKI J;  3HKZ N;  2LD5 A;  3BG3 A;  4M3B A;  3F0C A;  3JRE A;  4S0H B;  2ID6 A;  3HGY A;  4W97 A;  5J1Y A;  2COB A;  3UKG A;  3G1O A;  2JMW A;  5DTD A;  4A3E J;  3ZQI A;  5E3L A;  4AYB N;  5GPA A;  2RAE A;  2DA4 A;  1SAN A;  2OPT A;  3BTI A;  3K2A A;  1A6I A;  3MVP A;  2H8R A;  3K7A J;  2L9R A;  2LKX A;  5EF6 A;  4JX5 A;  2O8K A;  2R92 J;  2DTZ A;  4MFD A;  1HF0 A;  2EBI A;  1YRN B;  3BR1 A;  1FTZ A;  2XSD C;  3ZQF A;  3PO2 J;  4FTH A;  3GTM J;  3H3V K;  1IDZ A;  1RKW A;  2DA3 A;  3GBG A;  2XGE A;  2K9S A;  4MFE A;  2EZI A;  1ITY A;  1HDD C;  5EEA A;  3IH3 A;  1X2M A;  1K83 J;  2JA5 J;  5FJ8 J;  1ZTR A;  5F1J A;  5EG0 A;  3BTC A;  2K9Q A;  1NK2 P;  2TRT A;  2M8G X;  4A93 J;  1FTT A;  2XPW A;  1HOM A;  2EZK A;  5F04 A;  1ETY A;  3IH2 A;  3HOW J;  1DU6 A;  1RKT A;  1TC3 C;  3PM1 A;  1Z77 A;  2Y30 A;  3FK7 A;  4FIS A;  4Y52 J;  4QIW N;  1ZK8 A;  2H1K A;  3B6A A;  1JT0 A;  3ZQG A;  5M5W J;  2YS9 A;  5JLX A;  4JX4 A;  3TW6 A;  1BW5 A;  5JLW A;  3CCY A;  2MG4 A;  1POG A;  5IP6 A;  5M3M J;  1H88 C;  4A3I J;  1HCR A;  4DYQ A;  5C4X J;  1JT6 A;  3HOV J;  5IOZ A;  5EGO A;  2L7F P;  3QQA A;  5IYB J;  4JP0 A;  4M3E A;  2R0Q C;  1B72 A;  1U78 A;  1AKH B;  1ETQ A;  1IC8 A;  2LR8 A;  2M2E A;  4CYC A;  2E2H J;  3JRB A;  2VUM J;  3HM5 A;  1LE8 A;  3L1P A;  2EZL A;  5IP9 J;  1BW6 A;  2FX0 A;  4RDU A;  1QRY A;  5F0C A;  5IOY A;  2K9N A;  4BBR J;  3LSP A;  1GV5 A;  1XG1 A;  2FJ1 A;  3BTJ A;  2ME0 A;  5FKN A;  1I3Q J;  1HDP A;  3TED A;  2LFB A;  2CU7 A;  4I6Z A;  1NK3 P;  2DA1 A;  1AHD P;  5HOD A;  1O4X A;  2M0C A;  2Y31 A;  4D7N A;  1I50 J;  4V2F A;  5FKM A;  3M4O J;  1GUU A;  2IEK A;  3JRD A;  2HOA A;  1UG2 A;  3BG9 A;  2CUE A;  3DCF A;  1A5J A;  3I4M J;  4IHY A;  3HOU J;  3IH4 A;  1QVU A;  5J3L A;  2PMZ N;  1UMQ A;  4MIM A;  1U9O A;  1Y1V J;  2E2I J;  2MW8 A;  3GTK J;  2NS8 A;  1LFU P;  1YRN A;  3SJM A;  1JTX A;  1WH5 A;  2ECC A;  2HYJ A;  3LSR A;  1X2N A;  2LTP A;  1MBF A;  2W48 A;  2HXO A;  2DMU A;  1WH7 A;  1FJL A;  3CQZ J;  4D5C A;  3JRF A;  3BR5 A;  4GFB A;  1IGN A;  5FLM J;  4IHX A;  1UHS A;  3C2B A;  3SFI A;  1MBK A;  1IUF A;  1MSF C;  2P81 A;  3OSF A;  5F0F A;  4A3L J;  1JKP C;  4I76 A;  1FIA A;  3MN2 A;  4QTR A;  2CQQ A;  2HQ5 A;  2R7Z J;  5FKO A;  2GLO A;  4BY1 J;  4D5F A;  2L7Z A;  2CQX A;  1NTC A;  2DA2 A;  2O7O A;  3A02 A;  3TP3 A;  3RZO J;  1BJZ A;  4NDL A;  4A69 C;  2FD5 A;  5C44 J;  1MBE A;  1JKQ C;  1ETX A;  1QPI A;  1IRZ A;  1EF4 A;  2EQR A;  3A01 B;  4HNV A;  2E1O A;  3FK6 A;  4A3J J;  3SDG A;  2MSY A;  1WGX A;  3HDD A;  2M34 A;  5M5X J;  5C4J J;  2ME6 A;  5IP7 J;  5IYD J;  3GTJ J;  4XK4 A;  4M3G A;  1QVT A;  1AKH A;  2LP0 A;  1BA5 A;  2ELK A;  3HB9 A;  1AU7 A;  1MNM C;  5BNG A;  1JKO C;  1GVD A;  4XRS G;  2XPU A;  5J1U A;  2Y0S N;  1U8B A;  2CJJ A;  3NAU A;  1MBH A;  4RBO A;  3IV5 A;  1ZR4 A;  3FIS A;  5E3O A;  4IEJ A;  2DA6 A;  1E3O C;  4UUS B;  2HOS A;  3HGG A;  4DYR A;  2AHQ A;  4A3G J;  1ETO A;  3JRH A;  2MGQ A;  1ETW A;  1GT0 C;  5GPC A;  2L0K A;  2L7M P;  2HDD A;  2XGD A;  2XPV A;  3ZQC A;  1F43 A;  1W0T A;  1JUM A;  1JJ6 C;  5EDN A;  3S14 J;  3RZD J;  1HLV A;  1XS9 A;  2OF7 A;  3S1M J;  4G12 A;  1OJL A;  4C2M J;  2GM4 A;  1TWF J;  4XIC A;  1ENH A;  3HEF A;  3S16 J;  3TP0 A;  5K7F A;  1DU0 A;  1LFB A;  2KDZ A;  3G1M A;  4C3J J;  2VI6 A;  2NVT J;  5FLV A;  1P7I A;  3A03 A;  2Y2Z A;  2DN0 A;  4MLO A;  3ZOB A;  3PO3 J;  1S7E A;  1ZR2 A;  3QPL A;  1ETV A;  3S2H J;  1RES A;  1XC5 A;  1GV2 A;  2KT0 A;  1JUP A;  2XGC A;  2DA5 A;  3BR3 A;  2O9L A;  5EZG A;  4XRS A;  3ZQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...