1YRNB

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnB00
2ID3A 3S2DJ 5IPAA 1FIPA 4UUTA 4XICA 3B6AA 4AC0A 5F04A 3Q0VA 2MW8A 1F36A 3H3VK 1GDTA 3LSGA 2HOSA 1FTZA 3BTJA 4DW6A 1I3QJ 3Q3SA 2VKVA 2LKXA 2L7MP 4NDLA 2R5YB 2LLKA 4DYRA 2L7FP 3I4NJ 1IRZA 2H8RA 4MIMA 1ETQA 3GTQJ 2X48A 2ELKA 1LFBA 5E3LA 2QF7A 2YS9A 4D7NA 1MNMC 5E3OA 4IHXA 2N8GA 5JLXA 4CYCA 2MG4A 2DA6A 5DTDA 3ZQIA 1WI3A 1F43A 3F0CA 3O8HA 4W1UA 1Z0XA 2O9LA 2P81A 2EZKA 1U9NA 3PO3J 1UMQA 1P7IA 1IDZA 2GBYA 2NVTJ 3HOVJ 3BG3A 2JA8J 2PMZN 1TWAJ 2RAEA 2R5ZB 1OJLA 4W97A 4A3GJ 1HLVA 1ZQ3P 1LE8B 5FLVA 1EF4A 2IBDA 3IH3A 2CQXA 2OF7A 3OIOA 3A03A 5GPCA 1YRNA 2YU9J 4IHWA 4M6VA 2XPVA 4J19A 3GTKJ 3TEDA 4BBSJ 5EG0B 4JX4A 2KDZA 5FKKA 2DMUA 2TRTA 3JRGA 3S17J 1XS9A 1BW6A 2XB0X 2WB1N 1MH4A 3QQAA 2JA6J 1WCMJ 1XG1A 1FTTA 1AKHA 3SDGA 1X58A 5M5XJ 3PO2J 2DMNA 2DJNA 2VKEA 3BQYA 3BR1A 5IYCJ 4A93J 4A69C 1JKOC 4M3FA 1MSEC 1HF0A 1MBJA 2JK3A 2Y31A 2R5YA 5FKNA 4MO7A 4QSHA 2HXIA 2HXOA 4JX5A 1U8BA 1JUMA 2Y9YA 5K7HA 5F0HA 2Y2ZA 2R5ZA 1XC5A 2DA1A 2GLOA 1RETA 4QTRA 1JT6A 3JRIA 2YUSA 1AKHB 1IV6A 1ITYA 1TWHJ 2ZB9A 1OCPA 3ZQFA 1I6HJ 2DMTA 2EQRA 1MH3A 5J3LA 1QVTA 2EZHA 3S1RJ 1VNDA 4FE4A 3BTCA 5FJ8J 1Y1WJ 1ETYA 1SANA 3HB9A 3S14J 1IUFA 3RQIA 3Q0WA 1PUFA 3C2BA 3HM5A 2HOTA 3G1LA 3ZOBA 4A3JJ 3GTMJ 2M8GX 5J1RA 4I6ZA 5J1YA 2EZLA 2XGCA 2LFBA 2Y30A 5EEAA 5BNGA 4D7MA 3ZQLA 2FJ1A 1BA5A 1FEXA 1NK2P 4S0HB 4A3MJ 1IC8A 4UUSA 2ECBA 2DMQA 2XPWA 2M9HA 2M34A 3Q0UA 2DMPA 3JR9A 1NK3P 4D5FA 1ENHA 1QPIA 2DA7A 3JRHA 3HOXJ 4C3HJ 4M3GA 1QVUA 1JGGA 1B72B 1BW5A 5GP9A 3K2AA 3CMYA 4X1EA 5F0FA 5EGOA 1DU0A 2K40A 1ETWA 2HI3A 2CUEA 5F1JA 3LSPA 1HDDC 2NS7A 2VI6A 3JRCA 1JJ6C 4A3DJ 2E1OA 3NAUA 1ETKA 1A5JA 1BL0A 1B8IB 3WHBA 3MKLA 4G12A 1ZTRA 1ZR4A 4BY7J 5IP7J 2Y9ZA 2JA5J 4A3EJ 1ZGWA 1TWGJ 3OSGA 1OFCX 2X9DA 2HQ5A 5IYBJ 3HGGA 1JKPC 3IV5A 3FK7A 2L0KA 3K7AJ 2X6OA 5IOZA 1GUUA 2E19A 4V2FA 2FX0A 5IOYA 4RDUA 4BXXJ 4A3BJ 4JP0A 4MLOA 3TP3A 1X2NA 3BR6A 3BTLA 1G2HA 1A6IA 2VPRA 5IP9J 2FD5A 1WH7A 1HOMA 3GTOJ 3M4OJ 4FISA 4I76A 5E3MA 3ZQCA 5EF6A 2LR8A 2XPUA 1RR7A 3QPSA 4DZJA 1ETVA 1RKTA 2KT0A 4AYBN 2IEKA 2XSDC 2EZIA 1H8AC 2LVSA 2ID6A 5IP6A 1TWFJ 3IH4A 2ECCA 2L7ZA 4XRSG 5EGOB 1TWCJ 5J1UA 3MN2A 3S2HJ 4DYQA 2K9SA 3VPRA 1JKRC 1GVDA 3G1MA 1D5YA 3BQZA 5C4XJ 1LE8A 2G0EA 2WV1A 3HOWJ 3SJMA 5C44J 1POGA 5DS9A 5K7ZA 4GFBA 1RPWA 3G1OA 1T56A 1WPKA 3BT9A 1X2MA 3E7LA 2CUFA 2HOAA 1B8IA 2CJJA 5K7FA 5JLWA 2JJ7A 3HOZJ 3FK6A 3DCFA 3HDDA 2CRGA 4C3IJ 3GTJJ 4HNVA 2DA4A 2IAIA 4BY1J 4M3BA 2NS8A 9ANTA 4IHYA 1JTYA 1PUFB 2JWTA 3JRAA 4MFEA 4X6AJ 2DN0A 3S16J 1ETXA 3CCYA 3RZDJ 4M3DA 5F27A 2O8KA 2XB5A 3UKGA 3GBGA 5F0CA 1H89C 1B72A 4ABZA 3BR2A 4MFDA 1UG2A 1VF9A 4RBOA 2HYJA 4IHVA 4DZPA 3BR3A 1H88C 4C3JJ 1NTCA 4V2GA 4XIDA 3RZOJ 3IH2A 2R93J 2E2HJ 2LP0A 2JN6A 3JRFA 2L9RA 2HDDA 1Z77A 2OPTA 2CQQA 4Y7NJ 4A3IJ 3BR0A 1K83J 3JRBA 2DTZA 3JREA 3HBLA 1Q1VA 5FKLA 1E3OC 1TC3C 1LFUP 1AHDP 1ORKA 3B6CA 1SFOJ 3HGYA 2MSYA 4A3KJ 1HCRA 1VI0A 2EH3A 3HEFA 2NVYJ 4IEJA 2VUMJ 3BG9A 3GTGJ 2R92J 2LD5A 1OCTC 3BR5A 4A3CJ 1WGXA 1IGNA 3HOYJ 5M3FJ 2CU7A 2WAQN 4L5EA 1JUPA 2K9NA 4XK4A 4A3FJ 5C4JJ 3D1NI 1DU6A 1GT0C 2D5VA 1WH5A 3FISA 4C2MJ 2TCTA 2M2EA 2XGDA 1QRYA 1IJWC 3S1QJ 3SFIA 3L1PA 3FKIJ 5EZGA 3ZQGA 5M5YJ 5M3MJ 2E2JJ 1MSFC 1GV2A 1JT0A 2COBA 4B1RA 1FJLA 4A3LJ 4DYCA 3FIWA 3OOUA 5E3NA 4EEFG 5FLMJ 4FTHA 1K61A 2O7OA 1IG7A 2NVQJ 2AO9A 3O8GA 3CDLA 2LK2A 1AU7A 4B3AA 3A01A 1HDPA 2NOGA 1CQTA 2FQ4A 1R9TJ 3QPLA 1MBEA 3GTPJ 3NARA 1VFCA 1YRNB 5EDNA 3TP0A 1S7EA 3I4MJ 1JTXA 1GV5A 1U78A 3JRDA 1U9OA 1ZK8A 1BJZA 4BKXA 3S15J 5M5WJ 2ME6A 3LSRA 1O4XA 4M3EA 4BBRJ 3LNQA 1JUSA 3LOCA 5C3EJ 1Y1VJ 4AUXA 1JJ8C 2EBIA 5EZHA 3OSFA 3A01B 2H1KA 2W48A 1W0UA 5IYDJ 5F08A 5HODA 5EG0A 4LOCA 3ZQHA 2GM4A 3S1MJ 4Y52J 3CQZJ 2B63J 3DEWA 4CYCB 1FIAA 2R7ZJ 1ZR2A 1P7JA 3LSJA 3HOUJ 3BG5A 4JX6A 3TW7A 3HKZN 2AHQA 1ETOA 2K9QA 2MGQA 2ME0A 4UUSB 2LY9A 3GTLJ 3A02A 4D5CA 3RKQA 2DA5A 1I50J 1MBFA 3H0GJ 3PM1A 1MBHA 3BTIA 3TW6A 1RKWA 5FKOA 1APLC 2QCOA 1MBKA 1W0TA 1UHSA 5GPAA 4QIWN 4XRSA 2JA7J 1T33A 5FKMA 4JYKA 2R0QC 4FCYA 2M0CA 2E2IJ 2LTPA 1RESA 2XRLA 3MVPA 3S1NJ 2XGEA 2Y0SN 2JMWA 2I10A 3M3YJ 2DA3A 1IDYA 3WHCA 4B4CA 2DA2A 4FE7A 1MBGA 4XRMA 1JKQC 2NVXJ 1ZKGA 5EYRA 3W6VA
chains in the Genus database with same CATH superfamily
4AIJA 3QYEA 5IT3A 3PQKA 2WB1A 1TQMA 5E18F 4CZZA 5DM6F 1FYKA 2V9KA 4LG0B 1BOBA 4A6DA 2W24A 2DO7A 4WX9A 1F36A 1H0MA 5HLIA 3H3VK 2VQCA 1KU3A 4N4NB 3V8LA 2E7WA 5LD2C 2LBFA 4NC6A 2STTA 4WCGA 2VJJA 4PSWA 4X0GA 2ELHA 4XLEA 1D0YA 1T38A 2C6YA 3VEPA 1YX3A 2VKVA 2XROA 4MQ9F 3H35A 2H8RA 2CMPA 3PIOF 4HA8A 3KEOA 4HF0A 4PJ0C 1LVKA 1NHAA 1YQAA 3ZMUA 2CQ7A 5E3OA 2LYCA 2R7QA 1V4RA 2FSWA 2WY8Q 1WI3A 1F43A 4W1UA 3OYKA 4BH9A 3S32A 3K1MA 1JE8A 2H6BA 2P81A 3JSPA 4G7OF 1IXCA 2BGCA 2DOEA 2EZKA 1U9NA 5L3FA 4F92B 1UMQA 2ZMEC 2NVTJ 4HPQA 3FXRA 2F5FA 2BY0A 4CA0A 1A04A 1X3UA 1O3QA 1WJCA 3ABTA 1TLHB 2RAEA 4LG3A 2PI0A 4I99C 2BBYA 4H0EA 4W97A 1OQYA 1HLVA 2V1DA 5ILSA 1LE8B 5DD4A 2IBDA 3IH3A 3OIOA 2OF7A 1R49A 3A03A 5GPCA 4D9JA 4I0AA 2E60A 3BROA 3M7GA 3BDDA 4IHSA 1WJEA 1L3LA 3N97A 3GYHX 1J75A 3COAC 2TRTA 3JRGA 3FMRA 2EB7A 1WJ5A 2WBMA 2WWYA 1S7AA 3I58A 3A1YA 1BW6A 2XB0X 3CP8A 1XCVA 2L9VA 4A5MA 3DPUA 4LG0A 1LQ1A 2F4MB 1AKHA 1LDKB 2OUMA 3DXJF 1HKTA 3L2UA 1Y0NA 3DEUA 3OYMA 4A0YA 1MSEC 2P5VA 3BJOA 1HF0A 1LEBA 2JK3A 2W4SA 2Y31A 4NUBA 4MO7A 4ZYAA 2ZXJA 1U8BA 2L54A 3M1CA 3CCRI 2V9PA 2JRTA 3W6JB 4LK0F 1XC5A 1LKXA 3DPTA 3J7YJ 3T5XA 5E79C 2L4AA 3IUOA 3AG2H 4IF4A 1G8XA 1KYZA 5E8IA 4BS9A 1V5GA 4L5IA 5D5WB 5ED4A 3H1CA 4Y33A 2XAJA 1PJRA 4J01A 2XHKA 4OIRF 3IRRA 1QVTA 4RGRA 4F93B 4NB5A 5ICCA 3SDBA 5FJ8J 1S9HA 2HS5A 1IV8A 1D1BA 4EM2A 1REPC 2VLAA 1SANA 3V7CA 3Q5FA 1IF1A 1QU3A 5CPRB 1R5HA 5IT9K 4HSRA 3G1LA 3FXMA 4ESBA 4HNUA 3CCLI 3U21A 3TDUC 1V3FA 4I6ZA 2ZMEB 5J1YA 3VWBA 1UB9A 3OIQA 2LFBA 3DLLF 5EEAA 4D7MA 3AL0C 2ZMEA 1Z91A 2ECBA 4KFCA 3LA2A 2M9HA 3Q0UA 4UV9A 4QWQA 5J8CA 1ENHA 3QAHA 1QPIA 1V5EA 1XGSA 3FXOA 3HOXJ 2ZC2A 1SD5A 3HOTA 2NRAC 4UUVA 3P9IA 1B72B 2O03A 1XN7A 1TNSA 2L3DA 1Y8RB 4HSTA 1I5ZA 3CMYA 4EGZA 2X6YA 2XDVA 2HI3A 3AFHA 3SEQA 4EJUA 2JRMA 4JBAA 4YFXF 4Y3OA 4BHBA 4BYYA 3VYTB 2VI6A 2XC7A 4OIPF 4AIDA 4AIHA 1ZH5A 2E1OA 4MGRA 4NHJA 2HTSA 3WHBA 3WTTC 5DD8A 1R4MB 5LFAA 3AG4H 4RGXA 3I59A 3KYLA 2JA5J 4ENKA 1TWGJ 4RA2A 3K70D 3CF2A 1X4PA 2V26A 3K9TA 1F1ZA 4KIBA 3FXKA 2HQ5A 3HSFA 2KRHA 1VQ5I 1JKPC 1BC8C 3BZKA 3FK7A 3GFMA 3CMMA 2FX0A 3LSTA 4FASD 4A3BJ 3TP3A 1FWZA 1X2NA 4IX7A 1G2HA 4CO8A 2A5YB 3CJQB 1ERDA 1WH7A 4FISA 4UVBA 4I76A 1MNEA 2PFBA 5E3MA 4AD9A 5EF6A 1DPRA 2LR8A 3QPSA 4GCVA 4DZJA 4BDZA 3E5QA 4E7LA 4BL0B 3C3WA 2JPCA 2BEOA 4IO9F 1BR1A 4I2OA 1SD7A 2ID6A 1OKRA 2GIVA 2L7ZA 3K10A 3ZQQA 5EGOB 5E1ZB 5D8LB 1BI0A 3MMYB 1GVDA 4BDYA 2FBIA 1Y39A 4DQ2A 1F4KA 1XSDA 1LE8A 1FNNA 3CJRB 2WV1A 3HOWJ 1GXQA 3E97A 1I1GA 4QPOA 4G6DA 4GFBA 2COMA 4RGUA 1O57A 4AIKA 1Z7UA 3TBIA 3G1OA 2O61A 2VBWA 3P7NA 5HS8A 1AA7A 2FBKA 2CUFA 2RDPA 4KDPA 2CJJA 2GOMA 5JLWA 1UG0A 5D5XB 2JJ7A 1B1BA 5E17F 4KT6A 2EILH 3LA3A 1YJ9I 2E1MB 2XAFA 2RNGA 1BIAA 2CSOA 4MFEA 4OMYA 1QZEA 4YG2F 2Y48A 2M1BA 1OYWA 5ERIA 1ETXA 3CCYA 4FQGA 2RREA 4M9XA 1XDSA 1FPQA 3WTWC 1U3EM 2XB5A 3HHGA 2ISYA 1H89C 3VODA 3H92A 2KIFA 1NH3A 4ABZA 2LMDA 2LOOA 4XOTA 3KZIC 1SAUA 1H88C 3FM5A 3ELKA 4C3JJ 1WJFA 4V2GA 2R93J 1YYVA 2AXLA 4HRIA 2KJCA 3KETA 3DBLB 5LEJA 3T8RA 4XSZF 2A6EF 3OV8A 4CSWA 3LSHA 3GZ5A 4BU2A 2OPTA 3EDPA 2CQQA 2VJ5A 1BN5A 1ONVA 2NAZA 2ZNZA 3ABMH 4Y7NJ 3J7AY 4HLYA 3O3KA 5DYMA 1K83J 1IXRC 2DTZA 1Q1VA 2BHZA 2AXTC 3V8JA 1HA8A 2OBPA 5CYVA 1LFUP 1ORKA 2FRHA 3B6CA 4N9IA 2Z5UA 1SFXA 3MCZA 2MSYA 1VI0A 2EH3A 4IEJA 5AIPA 3BJAA 1K78B 2VUMJ 1XGNA 2HDWA 3DTEA 2VKDA 4UB6C 2LD5A 2Y0SA 1ZG5A 1AOYA 3HOYJ 5DM7F 1XMXA 4E7KA 4L5EA 4B44A 3R0AA 1W4MA 3GMEA 2ISZA 5BPDA 1PP7U 2DJIA 4XK4A 2BY2A 1LDJA 4A3FJ 3D1NI 1ULYA 3GO5A 1TQIA 3WGGA 5DCMA 4KNYA 4Y17A 2EIMH 2KPMA 3ZGKA 3EQLF 4WXHA 2IGKA 3MKWB 2ZJQF 1UJ8A 5HS7A 2PMZA 3F8NA 2L2OA 4CCLA 3Q9VA 2E2JJ 2COBA 1P4WA 1MMGA 4PK4A 1Z6RA 4KIGA 1VQOI 1DP7P 1YFHA 1QA6A 5TISC 4EEFG 2OC6A 3VYRB 4U0VA 5CLSA 1S29A 3IAM2 1MMDA 3HOSA 1ZAOA 2CFOA 2EV6A 1BI1A 3O8GA 1Q1HA 3CDLA 3OYEA 3TKYA 1AU7A 3ECHA 1G3TA 2DW4A 3JW4A 2IS6A 1EA3A 1W5SA 1BC7C 4BE2A 4LFUA 2FQ4A 3BP8A 2KKOA 3QPLA 4ZYGA 1N77A 1X1DA 2PJRA 2VXDA 5EDNA 4E6KG 3I4MJ 1UHWA 3HG9A 4CCKA 4DBRA 1U9OA 2DFIA 3DKYA 2DK5A 2IPQX 5M5WJ 3LSRA 4ETSA 3RKWA 1JUSA 5DV5A 2WTEA 5C3EJ 2X1EA 2VE9A 5BPIA 4U0WA 1PVEA 1VTNC 1SD6A 3WG7H 1BJAA 1OMIA 3M8FA 1SVOA 2XKPA 1D8JA 3HRSA 1WVRA 2J5PA 2H1KA 2W48A 2VC1A 1W0UA 2FNAA 5F08A 4E7HA 2GM4A 3S1MJ 3T1BA 2ZXIA 1ZLKA 3HL2A 3CQZJ 2B63J 3QP5A 3L2WA 2QSGX 4G6TB 4BQNA 5BMZA 1ZR2A 5HDNA 4FX0A 5LLQA 4BHPA 2P7CB 3M8JA 2KFDA 2MD5A 4U88A 2RQPA 3H9QA 3FWEA 4UUSB 5JR3A 2KZVA 2EFPA 3ZCOA 1RIOH 1FBUA 2X6XA 1I50J 1RZ4A 3DP7A 2W85A 3NEUA 3VYSB 3PM1A 4RGSA 4P55A 3BG6A 4H4KC 3TW6A 4YIIA 2QENA 2W1OA 2QQ9A 1YHQI 4DGWB 1W0TA 5GPAA 4XRSA 4XKBA 2G9WA 4F3QA 4II2A 2HQAA 4QPQA 3OYBA 3S1NJ 1OCZH 2XAGA 3QWLA 4EVIA 1HQCA 3BCAA 2DA3A 1Z7LA 3FBIB 2K86A 1IDYA 2XKOA 1MBGA 2VC0A 2NVXJ 2Z33A 5FD6A 3W6VA 3MWMA 2QM3A 3FXJA 1O3RA 1VQPI 1GLNA 2F48A 4UUTA 3FXQA 3IKVA 3OYNA 4XICA 3DV8A 1ZRDA 3Q0VA 1EH6A 4M71A 3HYIA 2DLLA 2Q2EA 3HRTA 5KHDA 1ZHFA 2HOSA 4HQMA 2BZTA 5D5VB 2MYSA 1MMSA 1WJBA 4JQFA 2KP6A 1I3QJ 1FMVA 3Q3SA 2ZJRF 4PSXA 2QWWA 4NDLA 3LAJA 2R5YB 1A36A 4DYRA 3EUKL 3ZMSA 4LK1F 1E0EA 2R7RA 2YS9A 1JHFA 2YSRA 4D7NA 4F52A 3Q9SA 5A2QK 4PJMA 2B9SA 4ZZDA 2AQEA 2MG4A 2DYSH 2DA6A 5LEKA 5D4RA 2EWNA 3ZQIA 4XLPF 2H27A 1DDNA 2R7UA 4C30A 2LSOA 4CXFA 1OCRH 3KX2A 3RIRA 3W2AA 4ZZLA 1P7IA 1RUNA 2GBYA 1IDZA 2IS4A 1ZN2A 2V1NA 3GF2A 3HOVJ 3F72A 5E20A 2PMZN 1TWAJ 1S3JA 2DFFA 1YX5A 3OYLA 1LB2A 2ZNYA 2IP2A 4RB3C 3V8KA 1QHHD 1ZQ3P 5FLVA 5FD5A 2DT6A 1DP3A 4ZTFA 1YRNA 2UUZA 2YU9J 3SQNA 4IHWA 4M6VA 1TW2A 4IL6C 5KNLA 2IVMA 4BBSJ 4MTEA 4I09A 5EG0B 2O6GE 3HSRA 3OYFA 4HX8A 3P5JA 2GA2A 3L09A 2V79A 1ODDA 1F9NA 4U7BA 5JHFA 1XS9A 5FFXA 4F55A 1ZRFA 1MH4A 3QQAA 2IA2A 2NOJB 5LGTA 1FOWA 3GX4X 1XG1A 3QP6A 4XSXF 1X58A 3G6EI 2AS5F 4E7JA 1KU2A 1X1AA 2DJNA 2VKEA 3KYDB 3C2GA 1MMAA 3BQYA 2BHYA 2ETHA 3BR1A 5IYCJ 3CCEI 1JKOC 5JVGF 3I53A 3CCQI 2R5YA 5LHIA 3CZ6A 2HXOA 1JUMA 2XF6A 4KJZA 4AM3A 2BE5F 2JVHA 2Y2ZA 3ROUA 2GLOA 3LQQA 1W7PD 2JVGA 1JT6A 3JRIA 1IUYA 3H36A 4BJ5C 2OCEA 2YUSA 1E3PA 2Q8KA 5H20A 1FYMA 1KYWA 2V4JC 4L9TA 1EKEA 4Q5SF 2F4IA 2K4BA 1I6HJ 2FE3A 1XB4A 2F5EA 3S1RJ 2IT0A 3HXLA 4M9SA 3BTCA 2OQRA 3F8MA 1IW7F 4D0PA 1U6GA 1ETYA 1X19A 3HB9A 4ENNA 4IRHA 2WC2A 1AWCA 1IUFA 2M45A 4LB6B 2QBYB 1PUFA 3C2BA 1HKSA 2R7VA 4A3JJ 3ZOBA 4ZTJA 4M72A 3JTHA 1S7OA 3WGIA 2R7WA 4BJ6C 4YIRX 4NBQA 3LA7A 4LLNA 3FHZA 1O3TA 3RJPA 2FJ1A 1LDDA 2QQAA 1X1BA 1N25A 3CCJI 1R5GA 4A3MJ 1R36A 2KLOA 1WJAA 1D0ZA 3FZVA 2XPWA 3JR9A 1SEUA 4BNCA 3KP7A 2DA7A 4I98B 1K78A 3CD6I 3MQ0A 1V55H 1TT0A 4BEHB 1IZ1A 3H3ZA 3BPXA 4OWRB 4X1EA 5EGOA 1Z9CA 2Z3YA 2CWEA 2IJLA 3R6SA 2K3PA 1DU0A 2CUEA 3EYIA 4OOIA 3P9CA 4AVZA 3H5RA 3QOPA 3KYCB 3LSPA 4UXNA 3QOEA 2W57A 1JJ6C 1VQMI 2WAFA 3I0TA 4CUGA 4RAZA 1ETKA 1FX7A 4G6QA 2BY3A 3DBHB 1ZTRA 1ZR4A 2M3AA 4BQAA 2DI3A 4BY7J 2Y9ZA 4LLLA 4A3EJ 1Y0UA 2VBYA 4BQOA 3OSGA 2F5DA 1OR7C 2X9DA 2EFWA 4YFKF 2NYXA 3HGGA 4ZYDA 3A2KA 3IV5A 3WU1B 4XNFA 2O0YA 2X6OA 2HWVA 1GUUA 2CV1A 2P5KA 4V2FA 1FT9A 3VYUB 4HDUA 3QU3A 3QPHA 4BXXJ 4JP0A 2Z9OA 2R7FA 2Y0MA 1A6IA 4E4HA 1HOMA 4XKVA 2EJRA 2EPFA 3OYCA 3GW2A 3IRQA 1STZA 1ETVA 4IHTA 2KT0A 3M9AA 5K5OA 3S3MA 4P96A 1E2XA 4AYBN 1H8AC 2HDCA 1L0OC 4G9YA 3SZGA 1YO5C 5J40A 1Z67A 4EM0B 3IH4A 1FMWA 4OMZA 4ZYHA 1TWCJ 2FU4A 2RKHA 5J1UA 4ZYEA 5B5EC 3S2HJ 2K9SA 1WKMA 2Q0OA 5FROA 3BCBA 1JKRC 1BI3A 4XN0A 5HVQC 4G94A 4KMUX 1N75A 1HXDA 5EJCA 4RM3A 3CC7I 4NNJA 2DDBA 2E34A 2CO5A 1T56A 1R22A 1WPKA 3BT9A 1X2MA 1B8IA 2ADUA 4Q47A 1IN6A 4E7SA 4PFPA 2VQLA 1P92A 3HDDA 2CRGA 2OZUA 3GTJJ 4HNVA 2DA4A 4BY1J 3BZ6A 1WHUA 2E7XA 4M3BA 3CDHA 1T39A 2NS8A 3VSKA 2HEOA 4LMYA 4KMFA 3FM3A 3LFKA 1JTYA 1PUFB 2A61A 4HZFA 5L3BA 4GXOA 1H9TA 3H9JA 1W7PA 2DN0A 2F4OB 2GAUA 1UELB 1A6QA 1EH7A 4M3DA 1R58A 3OMYA 5F27A 3E5UA 2GA1A 5F0CA 3ZMTA 1B72A 3UR3C 1YS6A 4MFDA 3ABLH 4YIFA 2HVQA 1UG2A 2HYJA 2LKSA 4HYEA 4I0BA 3BR3A 1RI7A 3RKXA 1ACIA 1NTCA 2PLYA 5DEQA 4XIDA 3HTSB 3JTGA 2X1CA 1HKQA 4S04A 2BW3A 2LDUA 1T08B 2HYFA 2RQQA 3ASOH 2JN6A 5F1RA 3JRFA 2R7SA 1D1CA 2OZ6A 3RCOA 1YI2I 1BR2A 4L9JA 2DBBA 4IOAF 5JHUA 2GXBA 5B66C 2MA3A 1SC7A 1WJDA 2L9SA 2O8XA 2K5CA 2RGVA 3HPHA 3ISPA 5FKLA 1E3OC 2R4GA 1W36C 5CVIA 3N05A 2PBIA 3HEFA 3OIPA 4AU7A 1G59A 3GTGJ 3IP4B 3MZ8A 1OYIA 4EJVA 1R1VA 2L7KA 1YITI 3KP3A 4V19K 1MDMA 3RPUA 2YU3A 2CQKA 1B6AA 4B47A 4EJTA 2DPUA 3CCSI 3LAPA 2IXSA 2FEZA 4XN3A 1GT0C 2D5VA 3PQJA 3WU2C 1LFPA 3G4SI 3HSEA 3TO7A 3DU6A 4CYDA 2EFQA 4ZJZA 1QRYA 3SFIA 2TDXA 5EZGA 3U9GA 3ZQGA 5M5YJ 3K0LA 3ULQB 1GXPA 3K1NA 1D8KA 5J8FA 3CLQA 6PAXA 4A3LJ 2DXIA 3MKYB 3M1EA 3FIWA 3LWFA 1XPXA 3GZNB 5LGUA 2A05A 2O7OA 4WXCA 3QRFF 1MJBA 2NVQJ 2AO9A 2LK2A 2Y69H 4B3AA 2I5UA 4WWCA 4O6JA 1CQTA 2KIMA 3FX3A 4JK1X 2JTVA 4ENMA 1R9TJ 1MBEA 4B48A 4L18B 3CLOA 1VFCA 3I71A 4OINF 2LG4A 2XIGA 1YRNB 4Y13A 3TP0A 1FLIA 1S7EA 2V7FA 1JTXA 3FMQA 1SD4A 1U78A 3J81K 1LJ9A 1ZK8A 1KGSA 3LL7A 2WADA 2X85A 3PL8A 3GUDA 4IQJA 1TNTA 1SFUA 5B3SH 2JSCA 1XCBA 3FHNA 4M3EA 4BBRJ 2MLGA 4L5JA 2JA2A 3BC8A 4FX4A 3LOCA 3WTVC 1XSVA 1Y1VJ 1MW7A 1BI2A 3K4NA 3QODA 2XF7A 5JVTA 4BUPA 1JJ8C 1XMAA 2BVLA 2HQNA 2J5OA 3HJEA 4PUSA 2EBIA 5EZHA 1MJ9A 4ESJA 2E1CA 5IYDJ 4IQ4A 3F8BA 5HLGA 1EV7A 4HDVA 4P1WA 4MHGA 3WTSC 5FLXK 2WA0A 5KAFC 1Z05A 3CUQA 4M9ZA 3I64A 3KLNA 3E6DA 3TW7A 2AHQA 1ETOA 4XKWA 4BGDA 3CJTB 2HFHA 2IGOA 2LY9A 3GTLJ 3EETA 1YJNI 4GDFA 3G71I 4EM1A 3QYFA 3BZCA 3I59B 2M87A 4EATA 2VB6A 3FDYA 1R1TA 4UY8I 1RKWA 3TOAA 3ZQ7A 1I1SA 4RB1A 1EH8A 3NQOA 2LBFB 2ZFWA 5D6EA 4DNCA 2JSPA 2R7OA 4JYKA 4AYBA 2R0QC 4FCYA 3BJ6A 2Y0SN 2I10A 2HNHA 2XVCA 2W00A 3PSFA 3ESWB 5EEGA 2XGXA 1ZLJA 1TQPA 2MH2A 2DA2A 4FE7A 2CFXA 1G4DA 3CMEI 1QZZA 5EYRA 2ELJA 3S2DJ 3F6OA 3J80K 2HU9A 1VQ6I 1YIOA 3B6AA 3SZTA 4AC0A 3LSIA 2IW5A 2CH0A 2MW8A 2D1HA 2LRDA 3IWZA 4KUMA 4M74A 5F04A 4Z2YA 4IPAA 3UNGC 3OY9A 1GDTA 4RLQA 3KP5A 2L01A 2RVCA 1FTZA 5CVJA 3GXOA 4DW6A 2FMLA 2WV0A 4EJOA 2ZJPF 1CGPA 2KIUA 2ICWG 2LLKA 2L7FP 2P7VB 2A3SA 3VB2A 3W6KB 4N9HA 2LF8A 2X48A 2ELKA 5E3LA 2VL8A 2QF7A 3HZJA 3LSMA 4TV7A 3IHUA 1X3WB 2JZYA 3AG3H 2IA1A 1ZRCA 3RTRA 5E1XA 3ONQA 4RLFA 4RB0A 2K85A 1R1UA 5DTDA 1OR7A 1S6LA 2DT7B 1R5ID 5CVRA 1Z0XA 1VQ9I 2GXAA 2PJPA 3WTUC 4HV6A 2P5LC 3IKTA 3K4LA 3KIOA 1ZGJA 3ABUA 3S93A 1R4NB 3KCCA 2E5ZA 1KU9A 1YW8A 2NNNA 4Y4RA 2R5ZB 1KQ0A 2XUBA 1RRJA 4QLCU 1OJLA 2HOEA 4A3GJ 3D5LA 2G7HA 2QA4I 2CUZA 1EF4A 3HC7A 1FY7A 2DYRH 2KDOA 3ASNH 4B8XA 3CF5F 4PDKA 5DDGA 3ZN0A 1MKMA 2WAQA 4XONA 3CUQC 4ESFA 4J19A 3TEDA 1UHMA 4LLGF 5JI6A 4JX4A 2HVSA 2KDZA 2EV5A 1WQ2A 2DMUA 2RNJA 3H5AA 2KQRA 2PQ8A 4P5OA 2WB1N 1VQKI 2JA6J 3JSOA 3OL3A 2CYYA 1MD0A 3EUHA 1MIJA 1KQ8A 3PO2J 2QLZA 4BJTA 1Z21A 2DMNA 2E1MC 4EQQA 1ZREA 3OS1A 1D1AA 4A69C 4M3FA 1TZLA 1YS7A 3LMMA 4KT5C 2CW0F 5D6FA 4JOMA 1G3YA 4EMSA 4IRIA 4GYIA 4F7ZA 3K2ZA 2W84A 4C2UA 5K7HA 5F0HA 2DFEA 2VJ4A 3E5XA 4CCMA 5ICEA 1K7AA 4CDGA 1QQIA 1RETA 4I02A 2KL4A 1ZARA 1OPCA 2VJIA 1AKHB 1MZBA 2W25A 4KN7X 3DFGA 3HIFA 2ZB9A 4BXUA 5TRDA 4A6EA 4Q48A 1T98A 5DUKA 4ASNA 2DMTA 1MH3A 5J3LA 1ON1A 4ZDLA 4FE4A 1JXSA 3WTYC 5F6FA 3OYGA 5HDGA 2HZDA 3S14J 3TQNA 1FZPB 2OAZA 2JUGA 4ZDOA 2A68F 3Q0WA 4DOZA 3CCVI 3EPZA 3HM5A 1Y56A 5GAGJ 3GTMJ 3CO6C 2M8GX 1UAAA 3DKWA 2HKOA 2CW7A 3BPVA 2FF4A 1YW9A 2DAOA 2EZLA 1C0WA 1S8NA 3CO7C 3WE3A 5BNGA 3ZQLA 1FEXA 2PEXA 2VONA 1RUOA 4R8HA 4UUSA 2M7AA 2V6EA 3I3LA 2R7XA 2OQGA 2PX9A 2DMPA 2VIXA 5J4YA 3K70C 3HUGA 2A6HF 2W82A 1UCRA 5EEHA 1D0XA 2P4WA 5D8KB 2ESHA 5D5UB 1JGGA 4BAYA 4UHTA 1ZYRF 1BW5A 1TP4A 3ABKH 5GP9A 3K2AA 1QHGA 1W5CC 2QVOA 5F0FA 2F2EA 2PG4A 5ILVA 5GAHJ 2K40A 4U87A 2M8EA 5F1JA 3GCMA 1J09A 2YPRA 4HLXA 3RDIA 4CZCA 1HDDC 2P6SA 3D5RC 2M4GA 3GEZA 4FT8A 3JRCA 2X51A 4A3DJ 1P6RA 1FOXA 2F5VA 3NAUA 4XL9A 4A0XA 4F91B 2BXZA 1B8IB 1A5JA 1HSJA 2CS3A 1WSUA 1USTA 1E17A 1ZGWA 2FXAA 2M5WA 4UVCA 3AL0B 1R7JA 2QKMB 4KICA 5IYBJ 3ZRGA 3H9GA 4A0ZA 1E3HA 2L0KA 4CICA 2MABA 1K79A 3I4PA 3CCUI 3GFJA 3JCUC 4KN4X 5IOYA 1U5TB 2ZO4A 4MLOA 3V7SA 2KZGA 3AG1H 3BR6A 2VPRA 5IP9J 3IWFA 2M30A 2FD5A 3DU5A 3T8TA 3M4OJ 2H09A 1SMTA 3A0BC 3ZQCA 1EJ9A 3MAJA 4ZDPA 5GAEJ 1QZYA 1CF7A 2IEKA 2XSDC 5J4VA 3KZZA 2NS0A 3TDZC 3RPQA 2XAUA 1OLTA 4I7HA 2XAHA 2ECCA 4RB2C 4DYQA 1I27A 3R61A 4BACA 3G1MA 2KHMA 1I6XA 3SZPA 2D45A 4ITVA 3SJMA 1POGA 5DS9A 3FMSA 1BR4A 3FKJA 2K3FA 3H5NA 4UV8A 1SMYF 1X4OA 1D5VA 4A2UA 1B4AA 2HOAA 5FGMA 4PZJA 1SVLA 5CQEA 3CESA 1K4TA 4FHTA 4P9FA 3HOZJ 3FK6A 2KRCA 2RV8A 2K27A 3D0SA 4C3IJ 4HQEA 1G3WA 5LHGA 2K7LA 3V42A 4K2EA 3MEXA 3E3VA 2B0LA 4IHYA 3F21A 2YR2A 2JWTA 4X6AJ 4D1QA 2AQFA 4BEHA 1I3AA 2P0WA 3REOA 3B02A 3OYDA 3RZDJ 4BQQA 1LUJB 1Z3XA 1WWXA 2XRNA 4P9UA 2O8KA 2H6CA 3CJNA 2KRFA 2UWMA 2WY7Q 4PCQA 3ZXSA 2LH9A 3K4BA 2CV0A 4I01A 4LJZF 1VF9A 3HHHA 4RBOA 4DZPA 2DQRA 2ZFUA 2UZKA 5B1AH 3KP6A 2E36A 3IH2A 5L3GA 3ZN1A 4UB8C 1BOAA 3ZP5A 2Z99A 2H8WA 3WODF 1N78A 2ZBKA 1P4AA 4YELA 3ML6A 4YEJA 2DOFA 2A6TA 3BOQA 4A3IJ 1FYLA 2DOAA 3HBLA 2STWA 3F8CA 1ZGAA 1KONA 4MEXF 2DK8A 4ZH4F 1ON2A 2F6CA 4A3KJ 1HCRA 1LEAA 2DTRA 4FETA 5GTIC 2BXYA 3E6BA 2NVYJ 2W7NA 1RR8C 4MEYF 1BIBA 1LVAA 2PMHA 3I9V2 2EV0A 4A3CJ 3WE2A 2V1UA 3OR2C 2MFZA 4LIVA 2VPLA 2QQ8A 2VQGA 3TO6A 1JUPA 2QEXI 2GZWA 3J7AO 1DU6A 3KLOA 3L00A 1WH5A 2MC4A 2QQBA 3WGHA 3DKXA 1MMNA 3RYRA 4C2MJ 1J5YA 2M2EA 5IT9Z 2QZ8A 3S1QJ 3K4KA 4PJLA 4XQFA 3FF5A 2HR3A 5M3MJ 1MSFC 1SFEA 5DUIA 4KYWA 4B1RA 1LNWA 1FJLA 4OIOF 4DYCA 1K61A 3OOUA 5FLMJ 3J81Z 1IN7A 3WG9A 4FTHA 3PJRA 1KA8A 2OCCH 4G7HF 2EINH 4YRVA 1YE9A 3DF8A 3GWZA 2QKLB 1R23A 2BVMA 2HYGD 4IKFA 3OS2A 1HDPA 4L0YB 2DPDA 1K6OA 5TGTA 1DGWY 1XD7A 5E1WA 1S72I 3RPUD 3PNTA 5K5QA 1K6YA 1MJAA 5ICGA 1F5TA 1GHCA 3O6BB 3JRDA 4HF1A 3G3ZA 1HW1A 3OYAA 3S15J 5FLXZ 2E35A 4NC7A 1HC8A 4ANJA 2ME6A 1MGTA 4N0BA 1O4XA 1WZ2A 2UXXA 3T0YA 1QPMA 3LNQA 2YX4A 4GYGA 5BOXA 1ZG1A 1T8IA 2FA5A 3HRMA 1Y6IA 1HSTA 2FQ3A 3C18A 4U0YA 5FFZA 1W1WE 2VBXA 3ERMA 1WRJA 3L2CA 4L9VA 2CG4A 5HODA 1IXSB 4G8XA 4LOCA 4BE1A 1U2WA 3ZQHA 3OL4A 3K4CA 3LQRA 2MC3A 3RSNA 2HVRA 3DEWA 2OA4A 4NC8A 1OYYA 4CHUA 1S5LC 1U5TA 2FOKA 4MTDA 2R7ZJ 1P7JA 2O5RA 3BG5A 4JX6A 1LPQA 1Z3YA 2CGPA 2ESNA 1FP1D 5LBQA 2MGQA 1PYVA 3A02A 2EA2A 1X1CA 1O7LA 1QBJA 2MLKA 1PDNC 2DA5A 4B3XA 1YTYA 1O3SA 1MBHA 2JT1A 3BTIA 1FOKA 3J80Z 1U8RA 1MBKA 1UHSA 2LY1A 1B59A 2JA7J 1T33A 5FKMA 3DEEA 2GOXB 2M0CA 1GVJA 1G6NA 1V5FA 4HBLA 4HX7A 1USSA 2YX7A 3FXLA 3HPGA 3MVPA 3JAMZ 4HNTA 5DCFA 4EJWA 2JMWA 1XGOA 2H1LA 2ZXWH 2GIZA 2A07F 2M7BA 4R79A 4GRIA 4XRFA 3S8PA 4S05A 3WHCA 1UFMA 3NWTA 3P9KA 1JKQC 1ZKGA 3M8EA 4RAGA 2ID3A 5IPAA 1FIPA 3TO9A 5K5RA 1H9GA 1K4SA 5BS6A 5LRSA 3WTXC 1VQ8I 3CDIA 3LSGA 4PJNA 2HPIA 3BTJA 2GXGA 2ZCWA 3OWTA 2LKXA 1MDMB 2L7MP 5E8GA 3W2VA 1IO2A 1XMKA 2IGNA 4HF2A 3I4NJ 1IRZA 4MIMA 1DGRM 3MZHA 1ETQA 3GTQJ 1LFBA 2V1XA 3F8FA 3ZPLA 1MNMC 4E7ZA 4IHXA 2EK5A 4M6YA 1Z1DA 2N8GA 2DFHA 5H6QA 5JLXA 4CYCA 2XSJC 2DQLA 3CCMI 2A69F 4XBFA 3F0CA 3O8HA 3IC7A 5CJ9A 3R0JA 2O9LA 4IJAA 2JPBA 1IN4A 3U1DA 3VOEA 5L3EA 2VXZA 3PO3J 1W36D 1KU7A 4PJJA 4RM2A 2HGCA 2Y75A 3BG3A 3NRVA 1YJWI 3E1SA 5FRNA 2JA8J 4WF2A 3FBNB 3MFKA 4R1HA 2KIQA 1SFKA 5L3CA 2IS1A 1P9QC 2G7UA 2LC2A 4CCJA 2CQXA 4B43A 1VQLI 5A2QZ 5BQTA 3GZ6A 4MQVA 2DDAA 2Z2SB 3W2WA 4BHCA 4IRGA 4WXDA 2XPVA 3OYHA 4XLNF 2VOPA 1U5TC 5TJJA 4MNUA 3GTKJ 2FNPA 2XASA 3SYTA 5HLHA 5FKKA 4EV0A 2QUFA 2HKXA 2V9VA 3S17J 4AVPA 5J6XA 5FO5A 1CF7B 1WCMJ 1DPUA 2E71A 5FB2A 2LF7A 1IN5A 1FTTA 4LITA 2MD0A 3SDGA 2VT3A 3F23A 5M5XJ 1V54H 3KEQA 4HG2A 1G3SA 2V6CA 4PGHA 3U1KA 3KPHA 2ZKZA 4A93J 2XAQA 1FSHA 1YOVB 1MBJA 1R6RA 5K1YA 3F3XA 5FKNA 4QSHA 2HXIA 2PMUA 4JX5A 3R4KA 2Y9YA 1TBXA 2EA4A 3DTKA 2R5ZA 3SFZA 2DA1A 4ENJA 1J9IA 2VQHA 1I39A 4QTRA 2EFOA 3K1PA 4IZZA 4LB5A 4UNOA 3OS0A 2O3FA 4J00A 1IV6A 4WK8F 4A5NA 1ITYA 4XLFA 1TWHJ 4O5VA 3KEYA 4CCNA 1R71A 2QBYA 1OCPA 1QO0D 2MBFA 3ZQFA 2EQRA 2OTLI 1T6SA 2D1VA 2EZHA 1R00A 4IXAA 1XTAA 3ZMVA 1VNDA 1T2KA 1FOYA 1A35A 5H6RA 2LNBA 3D5SC 1Y1WJ 3RQ4A 3V7RA 3R60A 2FMYA 2M0MA 3RQIA 2JQ7A 2R3SA 1XGMA 2WAEA 3OYIA 5LGNA 2HOTA 2PJRB 2KISA 1PUEE 3MKZA 5J1RA 2IS2A 1FBQA 1B9MA 2DT5A 3DWLE 1BBYA 2XGCA 2HPMA 4LIUA 2BV6A 2Y30A 2NXNB 1X3ZB 2ZSHB 5LHHA 4E7IA 1BA5A 2RN7A 1KZHA 1NK2P 4S0HB 2RC4A 1YIJI 1IC8A 2DMQA 4XOPA 4E70A 3L9FA 5HLTA 2M34A 4D5FA 4KIFA 4KITB 3OOPA 4XLHA 3JRHA 4GGGA 4C3HJ 5J47A 1RC9A 4M3GA 5HNHA 1HW2A 1QVUA 3KFWX 4BE0A 2E5NA 4UVAA 4ZC3A 2I8DA 4M6XA 1NG6A 3BLYA 2B7EA 2DODA 4XM3A 1ETWA 2L5QA 1TT5B 4C2TA 3H0DA 1Z6TA 5KVRA 1XSXA 1X1PA 3CP2A 3S3NA 3EUAA 2NS7A 1T0FC 1B9NA 3CTAA 3SHFA 5HDKA 3HTUA 1BL0A 2OTJI 1OISA 2CUJA 3MKLA 4G12A 3PSIA 2OJED 4PFOA 3AKZA 3RI4A 4HOBA 4YFNF 5IP7J 1DQUA 1FBSA 3BWGA 2R7DA 3DTIA 5ILUA 4L0ZB 1OFCX 5KCMA 3RYPA 3F22A 3K4JA 5FRMA 1D3YA 3KP4A 1U0JA 3K7AJ 2EFNA 2BOLA 5IOZA 2E19A 1Y8QB 2FOWA 2DU9A 4RDUA 3CC2I 3PNVA 3CUQB 1VZ0A 2F5CA 3F6VA 3BTLA 3DPLC 2D2WA 4C9YA 3GTOJ 5IY5H 2Z16A 3QU6A 5GTHC 3I5UA 2XPUA 4RMNA 1RR7A 2X0LA 1RKTA 3ERED 2EZIA 4AWXB 2LVSA 3IAS2 5KK1A 2VE8A 3PFIA 5IP6A 3L2VA 1TWFJ 5GADJ 1DUXC 4XRSG 2BYVE 5LRRA 3MN2A 3VPRA 4L9NA 2QSFX 4CH7A 2Z1DA 2ZXHA 1D5YA 3BQZA 5C4XJ 2G0EA 4KISA 3G2BA 3VSLA 5C44J 3K69A 5K7ZA 1BM9A 3GFIA 1RPWA 3NWSA 3HKZA 2L02A 2OD5A 4RS8A 2QSHX 2P6TA 3E7LA 4XKCA 3S3OA 4RAFA 2EIJH 4II3A 5K7FA 3IL2A 2K4JA 3DCFA 1J2XA 1O7FA 2IAIA 3VDXA 3U2RA 4KA4A 4IOCF 1FC3A 2X6WA 9ANTA 5KAIC 2LREA 1MNDA 1SAXA 3JRAA 1J59A 3A4CA 4HEA2 3PUBA 2H94A 2KJBA 2K02A 1JI8A 3S16J 2FUG2 2X4HA 3CMAI 1TTYA 4O3MA 3UKGA 3GBGA 1VQ4I 3SXYA 4NQWA 2OU2A 4CGZA 3TOBA 3PNYA 3BR2A 2VOOA 4IHVA 4LD5A 3L2QA 2HQRA 1M1EB 3DLAA 2K9LA 3RZOJ 1RNLA 3CC4I 1HW5A 4B09A 2Q2EB 4DBQA 2E2HJ 5CVVA 3E0JB 3MZYA 1XX5A 2CQNA 2LP0A 4NQWB 3J7ZI 2L9RA 2HDDA 1Z77A 1WFXA 3GFLA 4OAYA 1VQNI 1T0FA 3SEZA 3KZYA 3BR0A 5CKTA 2QYOA 2E1NA 3JRBA 1XDUA 3JREA 3W3CA 3OYJA 2VKHA 1TC3C 1IAWA 3FXUA 2Q1ZB 3HUGB 5L3DA 1AHDP 4U7DA 3EYYA 1ZELA 2K9MA 1SFOJ 3HGYA 4LGWA 4DJAA 4RAYA 3BG9A 5CVUA 3VFZA 3G73A 2R92J 3GLXA 3GLLA 1SVMA 1OCTC 2MH9A 3BR5A 1KQ9A 1WGXA 1IGNA 3WU0A 2FBHA 5M3FJ 4OIQF 2CU7A 2BW3B 2WAQN 3BY6A 2M4KA 1NG7A 1VQ7I 4N4OB 3TL4X 4HW0A 2K9NA 3K6GA 5B1BH 5C4JJ 2QGUA 4XMYA 1ZG3A 1J0RA 1P2FA 2L9NA 2NVUB 1IRGA 3FISA 2L4MA 3E6MA 2TCTA 2XGDA 3BG7A 1IJWC 4OU0A 3L1PA 3FKIJ 3HRUA 2VT2A 2CV2A 2VASA 3OR1C 3C1DA 5AIQA 4XLCA 2LY2A 3E6CC 1W7PB 1GV2A 5JFRA 1JT0A 3PFYA 2VODA 1FP2A 5E3NA 1J7KA 4EGYA 1JGSA 3L7WA 3QYBA 3RKYA 3CUOA 3ZMDA 3H3UA 1IG7A 3ZR8X 2GQQA 3MD2A 1WI9A 3A01A 3M07A 2NOGA 1FSEA 2GWRA 5H2FC 1IN8A 2LKPA 1YLFA 5HOOA 5CQGA 3GTPJ 1YG2A 3NARA 3S2WA 4M73A 3WTZA 2HZTA 4IVNA 2R7TA 2IGMA 3F9KA 1GV5A 3PUFA 4Y15A 1QNTA 2KMUA 1BJZA 3V4GA 4ON0A 4BKXA 5F64A 3C7JA 3I55I 3X2QH 2ZSIB 3KE2A 3KP2A 1IRFA 2ACJA 2PN6A 5ICFA 4AUXA 2HTJA 3B73A 4XLAA 3EUHC 5AONA 3OSFA 3A01B 1TW3A 3TMOA 2VBZA 4OAZA 5EG0A 3ZMZA 3O2PE 4XORA 1A31A 2P8TA 4Y52J 4CYCB 4A12A 2A5WA 1FIAA 3I54A 1OCCH 3LFUA 3LSJA 3HOUJ 1YW7A 3LSKA 3N4MA 1JHHA 2EIKH 3HKZN 3GVAA 3QPTA 3ECOA 1TL8A 1PP8F 3C2HA 3A0HC 1UZCA 3K4MA 2K9QA 3TGNA 3JAMK 1P4XA 2ME0A 4D5CA 3RKQA 5DCMB 4HAMA 4GO1A 2VN2A 3PIPF 2JUCA 2XV4S 5D4SA 1MBFA 4DIQA 3DBRB 3H0GJ 2ZJ2A 4XR6A 5HNFA 3I56I 3L2RA 3DQVC 2OV7A 2NNYA 2X1DA 5FKOA 1OCOH 2XF5A 2CW8A 3AAFA 1APLC 2QCOA 2IRFG 4QIWN 2IA0A 1HBXG 2BY1A 4PGGA 4Q4ZF 2E2IJ 1QGPA 2LTPA 4G7ZF 1RESA 2UV1A 2XRLA 2DCEA 2XGEA 4CCOA 4HX4A 3M3YJ 1IRXA 4Z6YA 5HS9A 4B4CA 4XRMA 1W5TA 2UXNA 4HV5A 1NK3P 1T95A 4BXFA
chains in the Genus database with same CATH topology
2ID3A 3S2DJ 5IPAA 1FIPA 4UUTA 4XICA 3B6AA 4AC0A 5F04A 3Q0VA 2MW8A 1F36A 3H3VK 1GDTA 3LSGA 2HOSA 1FTZA 3BTJA 4DW6A 1I3QJ 3Q3SA 2VKVA 2LKXA 2L7MP 4NDLA 2R5YB 2LLKA 4DYRA 2L7FP 3I4NJ 1IRZA 2H8RA 4MIMA 1ETQA 3GTQJ 2X48A 2ELKA 1LFBA 5E3LA 2QF7A 2YS9A 4D7NA 1MNMC 5E3OA 4IHXA 2N8GA 5JLXA 4CYCA 2MG4A 2DA6A 5DTDA 3ZQIA 1WI3A 1F43A 3F0CA 3O8HA 4W1UA 1Z0XA 2O9LA 2P81A 2EZKA 1U9NA 3PO3J 1UMQA 1P7IA 1IDZA 2GBYA 2NVTJ 3HOVJ 3BG3A 2JA8J 2PMZN 1TWAJ 2RAEA 2R5ZB 1OJLA 4W97A 4A3GJ 1HLVA 1ZQ3P 1LE8B 5FLVA 1EF4A 2IBDA 3IH3A 2CQXA 2OF7A 3OIOA 3A03A 5GPCA 1YRNA 2YU9J 4IHWA 4M6VA 2XPVA 4J19A 3GTKJ 3TEDA 4BBSJ 5EG0B 4JX4A 2KDZA 5FKKA 2DMUA 2TRTA 3JRGA 3S17J 1XS9A 1BW6A 2XB0X 2WB1N 1MH4A 3QQAA 2JA6J 1WCMJ 1XG1A 1FTTA 1AKHA 3SDGA 1X58A 5M5XJ 3PO2J 2DMNA 2DJNA 2VKEA 3BQYA 3BR1A 5IYCJ 4A93J 4A69C 1JKOC 4M3FA 1MSEC 1HF0A 1MBJA 2JK3A 2Y31A 2R5YA 5FKNA 4MO7A 4QSHA 2HXIA 2HXOA 4JX5A 1U8BA 1JUMA 2Y9YA 5K7HA 5F0HA 2Y2ZA 2R5ZA 1XC5A 2DA1A 2GLOA 1RETA 4QTRA 1JT6A 3JRIA 2YUSA 1AKHB 1IV6A 1ITYA 1TWHJ 2ZB9A 1OCPA 3ZQFA 1I6HJ 2DMTA 2EQRA 1MH3A 5J3LA 1QVTA 2EZHA 3S1RJ 1VNDA 4FE4A 3BTCA 5FJ8J 1Y1WJ 1ETYA 1SANA 3HB9A 3S14J 1IUFA 3RQIA 3Q0WA 1PUFA 3C2BA 3HM5A 2HOTA 3G1LA 3ZOBA 4A3JJ 3GTMJ 2M8GX 5J1RA 4I6ZA 5J1YA 2EZLA 2XGCA 2LFBA 2Y30A 5EEAA 5BNGA 4D7MA 3ZQLA 2FJ1A 1BA5A 1FEXA 1NK2P 4S0HB 4A3MJ 1IC8A 4UUSA 2ECBA 2DMQA 2XPWA 2M9HA 2M34A 3Q0UA 2DMPA 3JR9A 1NK3P 4D5FA 1ENHA 1QPIA 2DA7A 3JRHA 3HOXJ 4C3HJ 4M3GA 1QVUA 1JGGA 1B72B 1BW5A 5GP9A 3K2AA 3CMYA 4X1EA 5F0FA 5EGOA 1DU0A 2K40A 1ETWA 2HI3A 2CUEA 5F1JA 3LSPA 1HDDC 2NS7A 2VI6A 3JRCA 1JJ6C 4A3DJ 2E1OA 3NAUA 1ETKA 1A5JA 1BL0A 1B8IB 3WHBA 3MKLA 4G12A 1ZTRA 1ZR4A 4BY7J 5IP7J 2Y9ZA 2JA5J 4A3EJ 1ZGWA 1TWGJ 3OSGA 1OFCX 2X9DA 2HQ5A 5IYBJ 3HGGA 1JKPC 3IV5A 3FK7A 2L0KA 3K7AJ 2X6OA 5IOZA 1GUUA 2E19A 4V2FA 2FX0A 5IOYA 4RDUA 4BXXJ 4A3BJ 4JP0A 4MLOA 3TP3A 1X2NA 3BR6A 3BTLA 1G2HA 1A6IA 2VPRA 5IP9J 2FD5A 1WH7A 1HOMA 3GTOJ 3M4OJ 4FISA 4I76A 5E3MA 3ZQCA 5EF6A 2LR8A 2XPUA 1RR7A 3QPSA 4DZJA 1ETVA 1RKTA 2KT0A 4AYBN 2IEKA 2XSDC 2EZIA 1H8AC 2LVSA 2ID6A 5IP6A 1TWFJ 3IH4A 2ECCA 2L7ZA 4XRSG 5EGOB 1TWCJ 5J1UA 3MN2A 3S2HJ 4DYQA 2K9SA 3VPRA 1JKRC 1GVDA 3G1MA 1D5YA 3BQZA 5C4XJ 1LE8A 2G0EA 2WV1A 3HOWJ 3SJMA 5C44J 1POGA 5DS9A 5K7ZA 4GFBA 1RPWA 3G1OA 1T56A 1WPKA 3BT9A 1X2MA 3E7LA 2CUFA 2HOAA 1B8IA 2CJJA 5K7FA 5JLWA 2JJ7A 3HOZJ 3FK6A 3DCFA 3HDDA 2CRGA 4C3IJ 3GTJJ 4HNVA 2DA4A 2IAIA 4BY1J 4M3BA 2NS8A 9ANTA 4IHYA 1JTYA 1PUFB 2JWTA 3JRAA 4MFEA 4X6AJ 2DN0A 3S16J 1ETXA 3CCYA 3RZDJ 4M3DA 5F27A 2O8KA 2XB5A 3UKGA 3GBGA 5F0CA 1H89C 1B72A 4ABZA 3BR2A 4MFDA 1UG2A 1VF9A 4RBOA 2HYJA 4IHVA 4DZPA 3BR3A 1H88C 4C3JJ 1NTCA 4V2GA 4XIDA 3RZOJ 3IH2A 2R93J 2E2HJ 2LP0A 2JN6A 3JRFA 2L9RA 2HDDA 1Z77A 2OPTA 2CQQA 4Y7NJ 4A3IJ 3BR0A 1K83J 3JRBA 2DTZA 3JREA 3HBLA 1Q1VA 5FKLA 1E3OC 1TC3C 1LFUP 1AHDP 1ORKA 3B6CA 1SFOJ 3HGYA 2MSYA 4A3KJ 1HCRA 1VI0A 2EH3A 3HEFA 2NVYJ 4IEJA 2VUMJ 3BG9A 3GTGJ 2R92J 2LD5A 1OCTC 3BR5A 4A3CJ 1WGXA 1IGNA 3HOYJ 5M3FJ 2CU7A 2WAQN 4L5EA 1JUPA 2K9NA 4XK4A 4A3FJ 5C4JJ 3D1NI 1DU6A 1GT0C 2D5VA 1WH5A 3FISA 4C2MJ 2TCTA 2M2EA 2XGDA 1QRYA 1IJWC 3S1QJ 3SFIA 3L1PA 3FKIJ 5EZGA 3ZQGA 5M5YJ 5M3MJ 2E2JJ 1MSFC 1GV2A 1JT0A 2COBA 4B1RA 1FJLA 4A3LJ 4DYCA 3FIWA 3OOUA 5E3NA 4EEFG 5FLMJ 4FTHA 1K61A 2O7OA 1IG7A 2NVQJ 2AO9A 3O8GA 3CDLA 2LK2A 1AU7A 4B3AA 3A01A 1HDPA 2NOGA 1CQTA 2FQ4A 1R9TJ 3QPLA 1MBEA 3GTPJ 3NARA 1VFCA 1YRNB 5EDNA 3TP0A 1S7EA 3I4MJ 1JTXA 1GV5A 1U78A 3JRDA 1U9OA 1ZK8A 1BJZA 4BKXA 3S15J 5M5WJ 2ME6A 3LSRA 1O4XA 4M3EA 4BBRJ 3LNQA 1JUSA 3LOCA 5C3EJ 1Y1VJ 4AUXA 1JJ8C 2EBIA 5EZHA 3OSFA 3A01B 2H1KA 2W48A 1W0UA 5IYDJ 5F08A 5HODA 5EG0A 4LOCA 3ZQHA 2GM4A 3S1MJ 4Y52J 3CQZJ 2B63J 3DEWA 4CYCB 1FIAA 2R7ZJ 1ZR2A 1P7JA 3LSJA 3HOUJ 3BG5A 4JX6A 3TW7A 3HKZN 2AHQA 1ETOA 2K9QA 2MGQA 2ME0A 4UUSB 2LY9A 3GTLJ 3A02A 4D5CA 3RKQA 2DA5A 1I50J 1MBFA 3H0GJ 3PM1A 1MBHA 3BTIA 3TW6A 1RKWA 5FKOA 1APLC 2QCOA 1MBKA 1W0TA 1UHSA 5GPAA 4QIWN 4XRSA 2JA7J 1T33A 5FKMA 4JYKA 2R0QC 4FCYA 2M0CA 2E2IJ 2LTPA 1RESA 2XRLA 3MVPA 3S1NJ 2XGEA 2Y0SN 2JMWA 2I10A 3M3YJ 2DA3A 1IDYA 3WHCA 4B4CA 2DA2A 4FE7A 1MBGA 4XRMA 1JKQC 2NVXJ 1ZKGA 5EYRA 3W6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID3 A;  3S2D J;  5IPA A;  1FIP A;  4UUT A;  4XIC A;  3B6A A;  4AC0 A;  5F04 A;  3Q0V A;  2MW8 A;  1F36 A;  3H3V K;  1GDT A;  3LSG A;  2HOS A;  1FTZ A;  3BTJ A;  4DW6 A;  1I3Q J;  3Q3S A;  2VKV A;  2LKX A;  2L7M P;  4NDL A;  2R5Y B;  2LLK A;  4DYR A;  2L7F P;  3I4N J;  1IRZ A;  2H8R A;  4MIM A;  1ETQ A;  3GTQ J;  2X48 A;  2ELK A;  1LFB A;  5E3L A;  2QF7 A;  2YS9 A;  4D7N A;  1MNM C;  5E3O A;  4IHX A;  2N8G A;  5JLX A;  4CYC A;  2MG4 A;  2DA6 A;  5DTD A;  3ZQI A;  1WI3 A;  1F43 A;  3F0C A;  3O8H A;  4W1U A;  1Z0X A;  2O9L A;  2P81 A;  2EZK A;  1U9N A;  3PO3 J;  1UMQ A;  1P7I A;  1IDZ A;  2GBY A;  2NVT J;  3HOV J;  3BG3 A;  2JA8 J;  2PMZ N;  1TWA J;  2RAE A;  2R5Z B;  1OJL A;  4W97 A;  4A3G J;  1HLV A;  1ZQ3 P;  1LE8 B;  5FLV A;  1EF4 A;  2IBD A;  3IH3 A;  2CQX A;  2OF7 A;  3OIO A;  3A03 A;  5GPC A;  1YRN A;  2YU9 J;  4IHW A;  4M6V A;  2XPV A;  4J19 A;  3GTK J;  3TED A;  4BBS J;  5EG0 B;  4JX4 A;  2KDZ A;  5FKK A;  2DMU A;  2TRT A;  3JRG A;  3S17 J;  1XS9 A;  1BW6 A;  2XB0 X;  2WB1 N;  1MH4 A;  3QQA A;  2JA6 J;  1WCM J;  1XG1 A;  1FTT A;  1AKH A;  3SDG A;  1X58 A;  5M5X J;  3PO2 J;  2DMN A;  2DJN A;  2VKE A;  3BQY A;  3BR1 A;  5IYC J;  4A93 J;  4A69 C;  1JKO C;  4M3F A;  1MSE C;  1HF0 A;  1MBJ A;  2JK3 A;  2Y31 A;  2R5Y A;  5FKN A;  4MO7 A;  4QSH A;  2HXI A;  2HXO A;  4JX5 A;  1U8B A;  1JUM A;  2Y9Y A;  5K7H A;  5F0H A;  2Y2Z A;  2R5Z A;  1XC5 A;  2DA1 A;  2GLO A;  1RET A;  4QTR A;  1JT6 A;  3JRI A;  2YUS A;  1AKH B;  1IV6 A;  1ITY A;  1TWH J;  2ZB9 A;  1OCP A;  3ZQF A;  1I6H J;  2DMT A;  2EQR A;  1MH3 A;  5J3L A;  1QVT A;  2EZH A;  3S1R J;  1VND A;  4FE4 A;  3BTC A;  5FJ8 J;  1Y1W J;  1ETY A;  1SAN A;  3HB9 A;  3S14 J;  1IUF A;  3RQI A;  3Q0W A;  1PUF A;  3C2B A;  3HM5 A;  2HOT A;  3G1L A;  3ZOB A;  4A3J J;  3GTM J;  2M8G X;  5J1R A;  4I6Z A;  5J1Y A;  2EZL A;  2XGC A;  2LFB A;  2Y30 A;  5EEA A;  5BNG A;  4D7M A;  3ZQL A;  2FJ1 A;  1BA5 A;  1FEX A;  1NK2 P;  4S0H B;  4A3M J;  1IC8 A;  4UUS A;  2ECB A;  2DMQ A;  2XPW A;  2M9H A;  2M34 A;  3Q0U A;  2DMP A;  3JR9 A;  1NK3 P;  4D5F A;  1ENH A;  1QPI A;  2DA7 A;  3JRH A;  3HOX J;  4C3H J;  4M3G A;  1QVU A;  1JGG A;  1B72 B;  1BW5 A;  5GP9 A;  3K2A A;  3CMY A;  4X1E A;  5F0F A;  5EGO A;  1DU0 A;  2K40 A;  1ETW A;  2HI3 A;  2CUE A;  5F1J A;  3LSP A;  1HDD C;  2NS7 A;  2VI6 A;  3JRC A;  1JJ6 C;  4A3D J;  2E1O A;  3NAU A;  1ETK A;  1A5J A;  1BL0 A;  1B8I B;  3WHB A;  3MKL A;  4G12 A;  1ZTR A;  1ZR4 A;  4BY7 J;  5IP7 J;  2Y9Z A;  2JA5 J;  4A3E J;  1ZGW A;  1TWG J;  3OSG A;  1OFC X;  2X9D A;  2HQ5 A;  5IYB J;  3HGG A;  1JKP C;  3IV5 A;  3FK7 A;  2L0K A;  3K7A J;  2X6O A;  5IOZ A;  1GUU A;  2E19 A;  4V2F A;  2FX0 A;  5IOY A;  4RDU A;  4BXX J;  4A3B J;  4JP0 A;  4MLO A;  3TP3 A;  1X2N A;  3BR6 A;  3BTL A;  1G2H A;  1A6I A;  2VPR A;  5IP9 J;  2FD5 A;  1WH7 A;  1HOM A;  3GTO J;  3M4O J;  4FIS A;  4I76 A;  5E3M A;  3ZQC A;  5EF6 A;  2LR8 A;  2XPU A;  1RR7 A;  3QPS A;  4DZJ A;  1ETV A;  1RKT A;  2KT0 A;  4AYB N;  2IEK A;  2XSD C;  2EZI A;  1H8A C;  2LVS A;  2ID6 A;  5IP6 A;  1TWF J;  3IH4 A;  2ECC A;  2L7Z A;  4XRS G;  5EGO B;  1TWC J;  5J1U A;  3MN2 A;  3S2H J;  4DYQ A;  2K9S A;  3VPR A;  1JKR C;  1GVD A;  3G1M A;  1D5Y A;  3BQZ A;  5C4X J;  1LE8 A;  2G0E A;  2WV1 A;  3HOW J;  3SJM A;  5C44 J;  1POG A;  5DS9 A;  5K7Z A;  4GFB A;  1RPW A;  3G1O A;  1T56 A;  1WPK A;  3BT9 A;  1X2M A;  3E7L A;  2CUF A;  2HOA A;  1B8I A;  2CJJ A;  5K7F A;  5JLW A;  2JJ7 A;  3HOZ J;  3FK6 A;  3DCF A;  3HDD A;  2CRG A;  4C3I J;  3GTJ J;  4HNV A;  2DA4 A;  2IAI A;  4BY1 J;  4M3B A;  2NS8 A;  9ANT A;  4IHY A;  1JTY A;  1PUF B;  2JWT A;  3JRA A;  4MFE A;  4X6A J;  2DN0 A;  3S16 J;  1ETX A;  3CCY A;  3RZD J;  4M3D A;  5F27 A;  2O8K A;  2XB5 A;  3UKG A;  3GBG A;  5F0C A;  1H89 C;  1B72 A;  4ABZ A;  3BR2 A;  4MFD A;  1UG2 A;  1VF9 A;  4RBO A;  2HYJ A;  4IHV A;  4DZP A;  3BR3 A;  1H88 C;  4C3J J;  1NTC A;  4V2G A;  4XID A;  3RZO J;  3IH2 A;  2R93 J;  2E2H J;  2LP0 A;  2JN6 A;  3JRF A;  2L9R A;  2HDD A;  1Z77 A;  2OPT A;  2CQQ A;  4Y7N J;  4A3I J;  3BR0 A;  1K83 J;  3JRB A;  2DTZ A;  3JRE A;  3HBL A;  1Q1V A;  5FKL A;  1E3O C;  1TC3 C;  1LFU P;  1AHD P;  1ORK A;  3B6C A;  1SFO J;  3HGY A;  2MSY A;  4A3K J;  1HCR A;  1VI0 A;  2EH3 A;  3HEF A;  2NVY J;  4IEJ A;  2VUM J;  3BG9 A;  3GTG J;  2R92 J;  2LD5 A;  1OCT C;  3BR5 A;  4A3C J;  1WGX A;  1IGN A;  3HOY J;  5M3F J;  2CU7 A;  2WAQ N;  4L5E A;  1JUP A;  2K9N A;  4XK4 A;  4A3F J;  5C4J J;  3D1N I;  1DU6 A;  1GT0 C;  2D5V A;  1WH5 A;  3FIS A;  4C2M J;  2TCT A;  2M2E A;  2XGD A;  1QRY A;  1IJW C;  3S1Q J;  3SFI A;  3L1P A;  3FKI J;  5EZG A;  3ZQG A;  5M5Y J;  5M3M J;  2E2J J;  1MSF C;  1GV2 A;  1JT0 A;  2COB A;  4B1R A;  1FJL A;  4A3L J;  4DYC A;  3FIW A;  3OOU A;  5E3N A;  4EEF G;  5FLM J;  4FTH A;  1K61 A;  2O7O A;  1IG7 A;  2NVQ J;  2AO9 A;  3O8G A;  3CDL A;  2LK2 A;  1AU7 A;  4B3A A;  3A01 A;  1HDP A;  2NOG A;  1CQT A;  2FQ4 A;  1R9T J;  3QPL A;  1MBE A;  3GTP J;  3NAR A;  1VFC A;  1YRN B;  5EDN A;  3TP0 A;  1S7E A;  3I4M J;  1JTX A;  1GV5 A;  1U78 A;  3JRD A;  1U9O A;  1ZK8 A;  1BJZ A;  4BKX A;  3S15 J;  5M5W J;  2ME6 A;  3LSR A;  1O4X A;  4M3E A;  4BBR J;  3LNQ A;  1JUS A;  3LOC A;  5C3E J;  1Y1V J;  4AUX A;  1JJ8 C;  2EBI A;  5EZH A;  3OSF A;  3A01 B;  2H1K A;  2W48 A;  1W0U A;  5IYD J;  5F08 A;  5HOD A;  5EG0 A;  4LOC A;  3ZQH A;  2GM4 A;  3S1M J;  4Y52 J;  3CQZ J;  2B63 J;  3DEW A;  4CYC B;  1FIA A;  2R7Z J;  1ZR2 A;  1P7J A;  3LSJ A;  3HOU J;  3BG5 A;  4JX6 A;  3TW7 A;  3HKZ N;  2AHQ A;  1ETO A;  2K9Q A;  2MGQ A;  2ME0 A;  4UUS B;  2LY9 A;  3GTL J;  3A02 A;  4D5C A;  3RKQ A;  2DA5 A;  1I50 J;  1MBF A;  3H0G J;  3PM1 A;  1MBH A;  3BTI A;  3TW6 A;  1RKW A;  5FKO A;  1APL C;  2QCO A;  1MBK A;  1W0T A;  1UHS A;  5GPA A;  4QIW N;  4XRS A;  2JA7 J;  1T33 A;  5FKM A;  4JYK A;  2R0Q C;  4FCY A;  2M0C A;  2E2I J;  2LTP A;  1RES A;  2XRL A;  3MVP A;  3S1N J;  2XGE A;  2Y0S N;  2JMW A;  2I10 A;  3M3Y J;  2DA3 A;  1IDY A;  3WHC A;  4B4C A;  2DA2 A;  4FE7 A;  1MBG A;  4XRM A;  1JKQ C;  2NVX J;  1ZKG A;  5EYR A;  3W6V A; 
#chains in the Genus database with same CATH topology
 4AIJ A;  3QYE A;  5IT3 A;  3PQK A;  2WB1 A;  1TQM A;  5E18 F;  4CZZ A;  5DM6 F;  1FYK A;  2V9K A;  4LG0 B;  1BOB A;  4A6D A;  2W24 A;  2DO7 A;  4WX9 A;  1F36 A;  1H0M A;  5HLI A;  3H3V K;  2VQC A;  1KU3 A;  4N4N B;  3V8L A;  2E7W A;  5LD2 C;  2LBF A;  4NC6 A;  2STT A;  4WCG A;  2VJJ A;  4PSW A;  4X0G A;  2ELH A;  4XLE A;  1D0Y A;  1T38 A;  2C6Y A;  3VEP A;  1YX3 A;  2VKV A;  2XRO A;  4MQ9 F;  3H35 A;  2H8R A;  2CMP A;  3PIO F;  4HA8 A;  3KEO A;  4HF0 A;  4PJ0 C;  1LVK A;  1NHA A;  1YQA A;  3ZMU A;  2CQ7 A;  5E3O A;  2LYC A;  2R7Q A;  1V4R A;  2FSW A;  2WY8 Q;  1WI3 A;  1F43 A;  4W1U A;  3OYK A;  4BH9 A;  3S32 A;  3K1M A;  1JE8 A;  2H6B A;  2P81 A;  3JSP A;  4G7O F;  1IXC A;  2BGC A;  2DOE A;  2EZK A;  1U9N A;  5L3F A;  4F92 B;  1UMQ A;  2ZME C;  2NVT J;  4HPQ A;  3FXR A;  2F5F A;  2BY0 A;  4CA0 A;  1A04 A;  1X3U A;  1O3Q A;  1WJC A;  3ABT A;  1TLH B;  2RAE A;  4LG3 A;  2PI0 A;  4I99 C;  2BBY A;  4H0E A;  4W97 A;  1OQY A;  1HLV A;  2V1D A;  5ILS A;  1LE8 B;  5DD4 A;  2IBD A;  3IH3 A;  3OIO A;  2OF7 A;  1R49 A;  3A03 A;  5GPC A;  4D9J A;  4I0A A;  2E60 A;  3BRO A;  3M7G A;  3BDD A;  4IHS A;  1WJE A;  1L3L A;  3N97 A;  3GYH X;  1J75 A;  3COA C;  2TRT A;  3JRG A;  3FMR A;  2EB7 A;  1WJ5 A;  2WBM A;  2WWY A;  1S7A A;  3I58 A;  3A1Y A;  1BW6 A;  2XB0 X;  3CP8 A;  1XCV A;  2L9V A;  4A5M A;  3DPU A;  4LG0 A;  1LQ1 A;  2F4M B;  1AKH A;  1LDK B;  2OUM A;  3DXJ F;  1HKT A;  3L2U A;  1Y0N A;  3DEU A;  3OYM A;  4A0Y A;  1MSE C;  2P5V A;  3BJO A;  1HF0 A;  1LEB A;  2JK3 A;  2W4S A;  2Y31 A;  4NUB A;  4MO7 A;  4ZYA A;  2ZXJ A;  1U8B A;  2L54 A;  3M1C A;  3CCR I;  2V9P A;  2JRT A;  3W6J B;  4LK0 F;  1XC5 A;  1LKX A;  3DPT A;  3J7Y J;  3T5X A;  5E79 C;  2L4A A;  3IUO A;  3AG2 H;  4IF4 A;  1G8X A;  1KYZ A;  5E8I A;  4BS9 A;  1V5G A;  4L5I A;  5D5W B;  5ED4 A;  3H1C A;  4Y33 A;  2XAJ A;  1PJR A;  4J01 A;  2XHK A;  4OIR F;  3IRR A;  1QVT A;  4RGR A;  4F93 B;  4NB5 A;  5ICC A;  3SDB A;  5FJ8 J;  1S9H A;  2HS5 A;  1IV8 A;  1D1B A;  4EM2 A;  1REP C;  2VLA A;  1SAN A;  3V7C A;  3Q5F A;  1IF1 A;  1QU3 A;  5CPR B;  1R5H A;  5IT9 K;  4HSR A;  3G1L A;  3FXM A;  4ESB A;  4HNU A;  3CCL I;  3U21 A;  3TDU C;  1V3F A;  4I6Z A;  2ZME B;  5J1Y A;  3VWB A;  1UB9 A;  3OIQ A;  2LFB A;  3DLL F;  5EEA A;  4D7M A;  3AL0 C;  2ZME A;  1Z91 A;  2ECB A;  4KFC A;  3LA2 A;  2M9H A;  3Q0U A;  4UV9 A;  4QWQ A;  5J8C A;  1ENH A;  3QAH A;  1QPI A;  1V5E A;  1XGS A;  3FXO A;  3HOX J;  2ZC2 A;  1SD5 A;  3HOT A;  2NRA C;  4UUV A;  3P9I A;  1B72 B;  2O03 A;  1XN7 A;  1TNS A;  2L3D A;  1Y8R B;  4HST A;  1I5Z A;  3CMY A;  4EGZ A;  2X6Y A;  2XDV A;  2HI3 A;  3AFH A;  3SEQ A;  4EJU A;  2JRM A;  4JBA A;  4YFX F;  4Y3O A;  4BHB A;  4BYY A;  3VYT B;  2VI6 A;  2XC7 A;  4OIP F;  4AID A;  4AIH A;  1ZH5 A;  2E1O A;  4MGR A;  4NHJ A;  2HTS A;  3WHB A;  3WTT C;  5DD8 A;  1R4M B;  5LFA A;  3AG4 H;  4RGX A;  3I59 A;  3KYL A;  2JA5 J;  4ENK A;  1TWG J;  4RA2 A;  3K70 D;  3CF2 A;  1X4P A;  2V26 A;  3K9T A;  1F1Z A;  4KIB A;  3FXK A;  2HQ5 A;  3HSF A;  2KRH A;  1VQ5 I;  1JKP C;  1BC8 C;  3BZK A;  3FK7 A;  3GFM A;  3CMM A;  2FX0 A;  3LST A;  4FAS D;  4A3B J;  3TP3 A;  1FWZ A;  1X2N A;  4IX7 A;  1G2H A;  4CO8 A;  2A5Y B;  3CJQ B;  1ERD A;  1WH7 A;  4FIS A;  4UVB A;  4I76 A;  1MNE A;  2PFB A;  5E3M A;  4AD9 A;  5EF6 A;  1DPR A;  2LR8 A;  3QPS A;  4GCV A;  4DZJ A;  4BDZ A;  3E5Q A;  4E7L A;  4BL0 B;  3C3W A;  2JPC A;  2BEO A;  4IO9 F;  1BR1 A;  4I2O A;  1SD7 A;  2ID6 A;  1OKR A;  2GIV A;  2L7Z A;  3K10 A;  3ZQQ A;  5EGO B;  5E1Z B;  5D8L B;  1BI0 A;  3MMY B;  1GVD A;  4BDY A;  2FBI A;  1Y39 A;  4DQ2 A;  1F4K A;  1XSD A;  1LE8 A;  1FNN A;  3CJR B;  2WV1 A;  3HOW J;  1GXQ A;  3E97 A;  1I1G A;  4QPO A;  4G6D A;  4GFB A;  2COM A;  4RGU A;  1O57 A;  4AIK A;  1Z7U A;  3TBI A;  3G1O A;  2O61 A;  2VBW A;  3P7N A;  5HS8 A;  1AA7 A;  2FBK A;  2CUF A;  2RDP A;  4KDP A;  2CJJ A;  2GOM A;  5JLW A;  1UG0 A;  5D5X B;  2JJ7 A;  1B1B A;  5E17 F;  4KT6 A;  2EIL H;  3LA3 A;  1YJ9 I;  2E1M B;  2XAF A;  2RNG A;  1BIA A;  2CSO A;  4MFE A;  4OMY A;  1QZE A;  4YG2 F;  2Y48 A;  2M1B A;  1OYW A;  5ERI A;  1ETX A;  3CCY A;  4FQG A;  2RRE A;  4M9X A;  1XDS A;  1FPQ A;  3WTW C;  1U3E M;  2XB5 A;  3HHG A;  2ISY A;  1H89 C;  3VOD A;  3H92 A;  2KIF A;  1NH3 A;  4ABZ A;  2LMD A;  2LOO A;  4XOT A;  3KZI C;  1SAU A;  1H88 C;  3FM5 A;  3ELK A;  4C3J J;  1WJF A;  4V2G A;  2R93 J;  1YYV A;  2AXL A;  4HRI A;  2KJC A;  3KET A;  3DBL B;  5LEJ A;  3T8R A;  4XSZ F;  2A6E F;  3OV8 A;  4CSW A;  3LSH A;  3GZ5 A;  4BU2 A;  2OPT A;  3EDP A;  2CQQ A;  2VJ5 A;  1BN5 A;  1ONV A;  2NAZ A;  2ZNZ A;  3ABM H;  4Y7N J;  3J7A Y;  4HLY A;  3O3K A;  5DYM A;  1K83 J;  1IXR C;  2DTZ A;  1Q1V A;  2BHZ A;  2AXT C;  3V8J A;  1HA8 A;  2OBP A;  5CYV A;  1LFU P;  1ORK A;  2FRH A;  3B6C A;  4N9I A;  2Z5U A;  1SFX A;  3MCZ A;  2MSY A;  1VI0 A;  2EH3 A;  4IEJ A;  5AIP A;  3BJA A;  1K78 B;  2VUM J;  1XGN A;  2HDW A;  3DTE A;  2VKD A;  4UB6 C;  2LD5 A;  2Y0S A;  1ZG5 A;  1AOY A;  3HOY J;  5DM7 F;  1XMX A;  4E7K A;  4L5E A;  4B44 A;  3R0A A;  1W4M A;  3GME A;  2ISZ A;  5BPD A;  1PP7 U;  2DJI A;  4XK4 A;  2BY2 A;  1LDJ A;  4A3F J;  3D1N I;  1ULY A;  3GO5 A;  1TQI A;  3WGG A;  5DCM A;  4KNY A;  4Y17 A;  2EIM H;  2KPM A;  3ZGK A;  3EQL F;  4WXH A;  2IGK A;  3MKW B;  2ZJQ F;  1UJ8 A;  5HS7 A;  2PMZ A;  3F8N A;  2L2O A;  4CCL A;  3Q9V A;  2E2J J;  2COB A;  1P4W A;  1MMG A;  4PK4 A;  1Z6R A;  4KIG A;  1VQO I;  1DP7 P;  1YFH A;  1QA6 A;  5TIS C;  4EEF G;  2OC6 A;  3VYR B;  4U0V A;  5CLS A;  1S29 A;  3IAM 2;  1MMD A;  3HOS A;  1ZAO A;  2CFO A;  2EV6 A;  1BI1 A;  3O8G A;  1Q1H A;  3CDL A;  3OYE A;  3TKY A;  1AU7 A;  3ECH A;  1G3T A;  2DW4 A;  3JW4 A;  2IS6 A;  1EA3 A;  1W5S A;  1BC7 C;  4BE2 A;  4LFU A;  2FQ4 A;  3BP8 A;  2KKO A;  3QPL A;  4ZYG A;  1N77 A;  1X1D A;  2PJR A;  2VXD A;  5EDN A;  4E6K G;  3I4M J;  1UHW A;  3HG9 A;  4CCK A;  4DBR A;  1U9O A;  2DFI A;  3DKY A;  2DK5 A;  2IPQ X;  5M5W J;  3LSR A;  4ETS A;  3RKW A;  1JUS A;  5DV5 A;  2WTE A;  5C3E J;  2X1E A;  2VE9 A;  5BPI A;  4U0W A;  1PVE A;  1VTN C;  1SD6 A;  3WG7 H;  1BJA A;  1OMI A;  3M8F A;  1SVO A;  2XKP A;  1D8J A;  3HRS A;  1WVR A;  2J5P A;  2H1K A;  2W48 A;  2VC1 A;  1W0U A;  2FNA A;  5F08 A;  4E7H A;  2GM4 A;  3S1M J;  3T1B A;  2ZXI A;  1ZLK A;  3HL2 A;  3CQZ J;  2B63 J;  3QP5 A;  3L2W A;  2QSG X;  4G6T B;  4BQN A;  5BMZ A;  1ZR2 A;  5HDN A;  4FX0 A;  5LLQ A;  4BHP A;  2P7C B;  3M8J A;  2KFD A;  2MD5 A;  4U88 A;  2RQP A;  3H9Q A;  3FWE A;  4UUS B;  5JR3 A;  2KZV A;  2EFP A;  3ZCO A;  1RIO H;  1FBU A;  2X6X A;  1I50 J;  1RZ4 A;  3DP7 A;  2W85 A;  3NEU A;  3VYS B;  3PM1 A;  4RGS A;  4P55 A;  3BG6 A;  4H4K C;  3TW6 A;  4YII A;  2QEN A;  2W1O A;  2QQ9 A;  1YHQ I;  4DGW B;  1W0T A;  5GPA A;  4XRS A;  4XKB A;  2G9W A;  4F3Q A;  4II2 A;  2HQA A;  4QPQ A;  3OYB A;  3S1N J;  1OCZ H;  2XAG A;  3QWL A;  4EVI A;  1HQC A;  3BCA A;  2DA3 A;  1Z7L A;  3FBI B;  2K86 A;  1IDY A;  2XKO A;  1MBG A;  2VC0 A;  2NVX J;  2Z33 A;  5FD6 A;  3W6V A;  3MWM A;  2QM3 A;  3FXJ A;  1O3R A;  1VQP I;  1GLN A;  2F48 A;  4UUT A;  3FXQ A;  3IKV A;  3OYN A;  4XIC A;  3DV8 A;  1ZRD A;  3Q0V A;  1EH6 A;  4M71 A;  3HYI A;  2DLL A;  2Q2E A;  3HRT A;  5KHD A;  1ZHF A;  2HOS A;  4HQM A;  2BZT A;  5D5V B;  2MYS A;  1MMS A;  1WJB A;  4JQF A;  2KP6 A;  1I3Q J;  1FMV A;  3Q3S A;  2ZJR F;  4PSX A;  2QWW A;  4NDL A;  3LAJ A;  2R5Y B;  1A36 A;  4DYR A;  3EUK L;  3ZMS A;  4LK1 F;  1E0E A;  2R7R A;  2YS9 A;  1JHF A;  2YSR A;  4D7N A;  4F52 A;  3Q9S A;  5A2Q K;  4PJM A;  2B9S A;  4ZZD A;  2AQE A;  2MG4 A;  2DYS H;  2DA6 A;  5LEK A;  5D4R A;  2EWN A;  3ZQI A;  4XLP F;  2H27 A;  1DDN A;  2R7U A;  4C30 A;  2LSO A;  4CXF A;  1OCR H;  3KX2 A;  3RIR A;  3W2A A;  4ZZL A;  1P7I A;  1RUN A;  2GBY A;  1IDZ A;  2IS4 A;  1ZN2 A;  2V1N A;  3GF2 A;  3HOV J;  3F72 A;  5E20 A;  2PMZ N;  1TWA J;  1S3J A;  2DFF A;  1YX5 A;  3OYL A;  1LB2 A;  2ZNY A;  2IP2 A;  4RB3 C;  3V8K A;  1QHH D;  1ZQ3 P;  5FLV A;  5FD5 A;  2DT6 A;  1DP3 A;  4ZTF A;  1YRN A;  2UUZ A;  2YU9 J;  3SQN A;  4IHW A;  4M6V A;  1TW2 A;  4IL6 C;  5KNL A;  2IVM A;  4BBS J;  4MTE A;  4I09 A;  5EG0 B;  2O6G E;  3HSR A;  3OYF A;  4HX8 A;  3P5J A;  2GA2 A;  3L09 A;  2V79 A;  1ODD A;  1F9N A;  4U7B A;  5JHF A;  1XS9 A;  5FFX A;  4F55 A;  1ZRF A;  1MH4 A;  3QQA A;  2IA2 A;  2NOJ B;  5LGT A;  1FOW A;  3GX4 X;  1XG1 A;  3QP6 A;  4XSX F;  1X58 A;  3G6E I;  2AS5 F;  4E7J A;  1KU2 A;  1X1A A;  2DJN A;  2VKE A;  3KYD B;  3C2G A;  1MMA A;  3BQY A;  2BHY A;  2ETH A;  3BR1 A;  5IYC J;  3CCE I;  1JKO C;  5JVG F;  3I53 A;  3CCQ I;  2R5Y A;  5LHI A;  3CZ6 A;  2HXO A;  1JUM A;  2XF6 A;  4KJZ A;  4AM3 A;  2BE5 F;  2JVH A;  2Y2Z A;  3ROU A;  2GLO A;  3LQQ A;  1W7P D;  2JVG A;  1JT6 A;  3JRI A;  1IUY A;  3H36 A;  4BJ5 C;  2OCE A;  2YUS A;  1E3P A;  2Q8K A;  5H20 A;  1FYM A;  1KYW A;  2V4J C;  4L9T A;  1EKE A;  4Q5S F;  2F4I A;  2K4B A;  1I6H J;  2FE3 A;  1XB4 A;  2F5E A;  3S1R J;  2IT0 A;  3HXL A;  4M9S A;  3BTC A;  2OQR A;  3F8M A;  1IW7 F;  4D0P A;  1U6G A;  1ETY A;  1X19 A;  3HB9 A;  4ENN A;  4IRH A;  2WC2 A;  1AWC A;  1IUF A;  2M45 A;  4LB6 B;  2QBY B;  1PUF A;  3C2B A;  1HKS A;  2R7V A;  4A3J J;  3ZOB A;  4ZTJ A;  4M72 A;  3JTH A;  1S7O A;  3WGI A;  2R7W A;  4BJ6 C;  4YIR X;  4NBQ A;  3LA7 A;  4LLN A;  3FHZ A;  1O3T A;  3RJP A;  2FJ1 A;  1LDD A;  2QQA A;  1X1B A;  1N25 A;  3CCJ I;  1R5G A;  4A3M J;  1R36 A;  2KLO A;  1WJA A;  1D0Z A;  3FZV A;  2XPW A;  3JR9 A;  1SEU A;  4BNC A;  3KP7 A;  2DA7 A;  4I98 B;  1K78 A;  3CD6 I;  3MQ0 A;  1V55 H;  1TT0 A;  4BEH B;  1IZ1 A;  3H3Z A;  3BPX A;  4OWR B;  4X1E A;  5EGO A;  1Z9C A;  2Z3Y A;  2CWE A;  2IJL A;  3R6S A;  2K3P A;  1DU0 A;  2CUE A;  3EYI A;  4OOI A;  3P9C A;  4AVZ A;  3H5R A;  3QOP A;  3KYC B;  3LSP A;  4UXN A;  3QOE A;  2W57 A;  1JJ6 C;  1VQM I;  2WAF A;  3I0T A;  4CUG A;  4RAZ A;  1ETK A;  1FX7 A;  4G6Q A;  2BY3 A;  3DBH B;  1ZTR A;  1ZR4 A;  2M3A A;  4BQA A;  2DI3 A;  4BY7 J;  2Y9Z A;  4LLL A;  4A3E J;  1Y0U A;  2VBY A;  4BQO A;  3OSG A;  2F5D A;  1OR7 C;  2X9D A;  2EFW A;  4YFK F;  2NYX A;  3HGG A;  4ZYD A;  3A2K A;  3IV5 A;  3WU1 B;  4XNF A;  2O0Y A;  2X6O A;  2HWV A;  1GUU A;  2CV1 A;  2P5K A;  4V2F A;  1FT9 A;  3VYU B;  4HDU A;  3QU3 A;  3QPH A;  4BXX J;  4JP0 A;  2Z9O A;  2R7F A;  2Y0M A;  1A6I A;  4E4H A;  1HOM A;  4XKV A;  2EJR A;  2EPF A;  3OYC A;  3GW2 A;  3IRQ A;  1STZ A;  1ETV A;  4IHT A;  2KT0 A;  3M9A A;  5K5O A;  3S3M A;  4P96 A;  1E2X A;  4AYB N;  1H8A C;  2HDC A;  1L0O C;  4G9Y A;  3SZG A;  1YO5 C;  5J40 A;  1Z67 A;  4EM0 B;  3IH4 A;  1FMW A;  4OMZ A;  4ZYH A;  1TWC J;  2FU4 A;  2RKH A;  5J1U A;  4ZYE A;  5B5E C;  3S2H J;  2K9S A;  1WKM A;  2Q0O A;  5FRO A;  3BCB A;  1JKR C;  1BI3 A;  4XN0 A;  5HVQ C;  4G94 A;  4KMU X;  1N75 A;  1HXD A;  5EJC A;  4RM3 A;  3CC7 I;  4NNJ A;  2DDB A;  2E34 A;  2CO5 A;  1T56 A;  1R22 A;  1WPK A;  3BT9 A;  1X2M A;  1B8I A;  2ADU A;  4Q47 A;  1IN6 A;  4E7S A;  4PFP A;  2VQL A;  1P92 A;  3HDD A;  2CRG A;  2OZU A;  3GTJ J;  4HNV A;  2DA4 A;  4BY1 J;  3BZ6 A;  1WHU A;  2E7X A;  4M3B A;  3CDH A;  1T39 A;  2NS8 A;  3VSK A;  2HEO A;  4LMY A;  4KMF A;  3FM3 A;  3LFK A;  1JTY A;  1PUF B;  2A61 A;  4HZF A;  5L3B A;  4GXO A;  1H9T A;  3H9J A;  1W7P A;  2DN0 A;  2F4O B;  2GAU A;  1UEL B;  1A6Q A;  1EH7 A;  4M3D A;  1R58 A;  3OMY A;  5F27 A;  3E5U A;  2GA1 A;  5F0C A;  3ZMT A;  1B72 A;  3UR3 C;  1YS6 A;  4MFD A;  3ABL H;  4YIF A;  2HVQ A;  1UG2 A;  2HYJ A;  2LKS A;  4HYE A;  4I0B A;  3BR3 A;  1RI7 A;  3RKX A;  1ACI A;  1NTC A;  2PLY A;  5DEQ A;  4XID A;  3HTS B;  3JTG A;  2X1C A;  1HKQ A;  4S04 A;  2BW3 A;  2LDU A;  1T08 B;  2HYF A;  2RQQ A;  3ASO H;  2JN6 A;  5F1R A;  3JRF A;  2R7S A;  1D1C A;  2OZ6 A;  3RCO A;  1YI2 I;  1BR2 A;  4L9J A;  2DBB A;  4IOA F;  5JHU A;  2GXB A;  5B66 C;  2MA3 A;  1SC7 A;  1WJD A;  2L9S A;  2O8X A;  2K5C A;  2RGV A;  3HPH A;  3ISP A;  5FKL A;  1E3O C;  2R4G A;  1W36 C;  5CVI A;  3N05 A;  2PBI A;  3HEF A;  3OIP A;  4AU7 A;  1G59 A;  3GTG J;  3IP4 B;  3MZ8 A;  1OYI A;  4EJV A;  1R1V A;  2L7K A;  1YIT I;  3KP3 A;  4V19 K;  1MDM A;  3RPU A;  2YU3 A;  2CQK A;  1B6A A;  4B47 A;  4EJT A;  2DPU A;  3CCS I;  3LAP A;  2IXS A;  2FEZ A;  4XN3 A;  1GT0 C;  2D5V A;  3PQJ A;  3WU2 C;  1LFP A;  3G4S I;  3HSE A;  3TO7 A;  3DU6 A;  4CYD A;  2EFQ A;  4ZJZ A;  1QRY A;  3SFI A;  2TDX A;  5EZG A;  3U9G A;  3ZQG A;  5M5Y J;  3K0L A;  3ULQ B;  1GXP A;  3K1N A;  1D8K A;  5J8F A;  3CLQ A;  6PAX A;  4A3L J;  2DXI A;  3MKY B;  3M1E A;  3FIW A;  3LWF A;  1XPX A;  3GZN B;  5LGU A;  2A05 A;  2O7O A;  4WXC A;  3QRF F;  1MJB A;  2NVQ J;  2AO9 A;  2LK2 A;  2Y69 H;  4B3A A;  2I5U A;  4WWC A;  4O6J A;  1CQT A;  2KIM A;  3FX3 A;  4JK1 X;  2JTV A;  4ENM A;  1R9T J;  1MBE A;  4B48 A;  4L18 B;  3CLO A;  1VFC A;  3I71 A;  4OIN F;  2LG4 A;  2XIG A;  1YRN B;  4Y13 A;  3TP0 A;  1FLI A;  1S7E A;  2V7F A;  1JTX A;  3FMQ A;  1SD4 A;  1U78 A;  3J81 K;  1LJ9 A;  1ZK8 A;  1KGS A;  3LL7 A;  2WAD A;  2X85 A;  3PL8 A;  3GUD A;  4IQJ A;  1TNT A;  1SFU A;  5B3S H;  2JSC A;  1XCB A;  3FHN A;  4M3E A;  4BBR J;  2MLG A;  4L5J A;  2JA2 A;  3BC8 A;  4FX4 A;  3LOC A;  3WTV C;  1XSV A;  1Y1V J;  1MW7 A;  1BI2 A;  3K4N A;  3QOD A;  2XF7 A;  5JVT A;  4BUP A;  1JJ8 C;  1XMA A;  2BVL A;  2HQN A;  2J5O A;  3HJE A;  4PUS A;  2EBI A;  5EZH A;  1MJ9 A;  4ESJ A;  2E1C A;  5IYD J;  4IQ4 A;  3F8B A;  5HLG A;  1EV7 A;  4HDV A;  4P1W A;  4MHG A;  3WTS C;  5FLX K;  2WA0 A;  5KAF C;  1Z05 A;  3CUQ A;  4M9Z A;  3I64 A;  3KLN A;  3E6D A;  3TW7 A;  2AHQ A;  1ETO A;  4XKW A;  4BGD A;  3CJT B;  2HFH A;  2IGO A;  2LY9 A;  3GTL J;  3EET A;  1YJN I;  4GDF A;  3G71 I;  4EM1 A;  3QYF A;  3BZC A;  3I59 B;  2M87 A;  4EAT A;  2VB6 A;  3FDY A;  1R1T A;  4UY8 I;  1RKW A;  3TOA A;  3ZQ7 A;  1I1S A;  4RB1 A;  1EH8 A;  3NQO A;  2LBF B;  2ZFW A;  5D6E A;  4DNC A;  2JSP A;  2R7O A;  4JYK A;  4AYB A;  2R0Q C;  4FCY A;  3BJ6 A;  2Y0S N;  2I10 A;  2HNH A;  2XVC A;  2W00 A;  3PSF A;  3ESW B;  5EEG A;  2XGX A;  1ZLJ A;  1TQP A;  2MH2 A;  2DA2 A;  4FE7 A;  2CFX A;  1G4D A;  3CME I;  1QZZ A;  5EYR A;  2ELJ A;  3S2D J;  3F6O A;  3J80 K;  2HU9 A;  1VQ6 I;  1YIO A;  3B6A A;  3SZT A;  4AC0 A;  3LSI A;  2IW5 A;  2CH0 A;  2MW8 A;  2D1H A;  2LRD A;  3IWZ A;  4KUM A;  4M74 A;  5F04 A;  4Z2Y A;  4IPA A;  3UNG C;  3OY9 A;  1GDT A;  4RLQ A;  3KP5 A;  2L01 A;  2RVC A;  1FTZ A;  5CVJ A;  3GXO A;  4DW6 A;  2FML A;  2WV0 A;  4EJO A;  2ZJP F;  1CGP A;  2KIU A;  2ICW G;  2LLK A;  2L7F P;  2P7V B;  2A3S A;  3VB2 A;  3W6K B;  4N9H A;  2LF8 A;  2X48 A;  2ELK A;  5E3L A;  2VL8 A;  2QF7 A;  3HZJ A;  3LSM A;  4TV7 A;  3IHU A;  1X3W B;  2JZY A;  3AG3 H;  2IA1 A;  1ZRC A;  3RTR A;  5E1X A;  3ONQ A;  4RLF A;  4RB0 A;  2K85 A;  1R1U A;  5DTD A;  1OR7 A;  1S6L A;  2DT7 B;  1R5I D;  5CVR A;  1Z0X A;  1VQ9 I;  2GXA A;  2PJP A;  3WTU C;  4HV6 A;  2P5L C;  3IKT A;  3K4L A;  3KIO A;  1ZGJ A;  3ABU A;  3S93 A;  1R4N B;  3KCC A;  2E5Z A;  1KU9 A;  1YW8 A;  2NNN A;  4Y4R A;  2R5Z B;  1KQ0 A;  2XUB A;  1RRJ A;  4QLC U;  1OJL A;  2HOE A;  4A3G J;  3D5L A;  2G7H A;  2QA4 I;  2CUZ A;  1EF4 A;  3HC7 A;  1FY7 A;  2DYR H;  2KDO A;  3ASN H;  4B8X A;  3CF5 F;  4PDK A;  5DDG A;  3ZN0 A;  1MKM A;  2WAQ A;  4XON A;  3CUQ C;  4ESF A;  4J19 A;  3TED A;  1UHM A;  4LLG F;  5JI6 A;  4JX4 A;  2HVS A;  2KDZ A;  2EV5 A;  1WQ2 A;  2DMU A;  2RNJ A;  3H5A A;  2KQR A;  2PQ8 A;  4P5O A;  2WB1 N;  1VQK I;  2JA6 J;  3JSO A;  3OL3 A;  2CYY A;  1MD0 A;  3EUH A;  1MIJ A;  1KQ8 A;  3PO2 J;  2QLZ A;  4BJT A;  1Z21 A;  2DMN A;  2E1M C;  4EQQ A;  1ZRE A;  3OS1 A;  1D1A A;  4A69 C;  4M3F A;  1TZL A;  1YS7 A;  3LMM A;  4KT5 C;  2CW0 F;  5D6F A;  4JOM A;  1G3Y A;  4EMS A;  4IRI A;  4GYI A;  4F7Z A;  3K2Z A;  2W84 A;  4C2U A;  5K7H A;  5F0H A;  2DFE A;  2VJ4 A;  3E5X A;  4CCM A;  5ICE A;  1K7A A;  4CDG A;  1QQI A;  1RET A;  4I02 A;  2KL4 A;  1ZAR A;  1OPC A;  2VJI A;  1AKH B;  1MZB A;  2W25 A;  4KN7 X;  3DFG A;  3HIF A;  2ZB9 A;  4BXU A;  5TRD A;  4A6E A;  4Q48 A;  1T98 A;  5DUK A;  4ASN A;  2DMT A;  1MH3 A;  5J3L A;  1ON1 A;  4ZDL A;  4FE4 A;  1JXS A;  3WTY C;  5F6F A;  3OYG A;  5HDG A;  2HZD A;  3S14 J;  3TQN A;  1FZP B;  2OAZ A;  2JUG A;  4ZDO A;  2A68 F;  3Q0W A;  4DOZ A;  3CCV I;  3EPZ A;  3HM5 A;  1Y56 A;  5GAG J;  3GTM J;  3CO6 C;  2M8G X;  1UAA A;  3DKW A;  2HKO A;  2CW7 A;  3BPV A;  2FF4 A;  1YW9 A;  2DAO A;  2EZL A;  1C0W A;  1S8N A;  3CO7 C;  3WE3 A;  5BNG A;  3ZQL A;  1FEX A;  2PEX A;  2VON A;  1RUO A;  4R8H A;  4UUS A;  2M7A A;  2V6E A;  3I3L A;  2R7X A;  2OQG A;  2PX9 A;  2DMP A;  2VIX A;  5J4Y A;  3K70 C;  3HUG A;  2A6H F;  2W82 A;  1UCR A;  5EEH A;  1D0X A;  2P4W A;  5D8K B;  2ESH A;  5D5U B;  1JGG A;  4BAY A;  4UHT A;  1ZYR F;  1BW5 A;  1TP4 A;  3ABK H;  5GP9 A;  3K2A A;  1QHG A;  1W5C C;  2QVO A;  5F0F A;  2F2E A;  2PG4 A;  5ILV A;  5GAH J;  2K40 A;  4U87 A;  2M8E A;  5F1J A;  3GCM A;  1J09 A;  2YPR A;  4HLX A;  3RDI A;  4CZC A;  1HDD C;  2P6S A;  3D5R C;  2M4G A;  3GEZ A;  4FT8 A;  3JRC A;  2X51 A;  4A3D J;  1P6R A;  1FOX A;  2F5V A;  3NAU A;  4XL9 A;  4A0X A;  4F91 B;  2BXZ A;  1B8I B;  1A5J A;  1HSJ A;  2CS3 A;  1WSU A;  1UST A;  1E17 A;  1ZGW A;  2FXA A;  2M5W A;  4UVC A;  3AL0 B;  1R7J A;  2QKM B;  4KIC A;  5IYB J;  3ZRG A;  3H9G A;  4A0Z A;  1E3H A;  2L0K A;  4CIC A;  2MAB A;  1K79 A;  3I4P A;  3CCU I;  3GFJ A;  3JCU C;  4KN4 X;  5IOY A;  1U5T B;  2ZO4 A;  4MLO A;  3V7S A;  2KZG A;  3AG1 H;  3BR6 A;  2VPR A;  5IP9 J;  3IWF A;  2M30 A;  2FD5 A;  3DU5 A;  3T8T A;  3M4O J;  2H09 A;  1SMT A;  3A0B C;  3ZQC A;  1EJ9 A;  3MAJ A;  4ZDP A;  5GAE J;  1QZY A;  1CF7 A;  2IEK A;  2XSD C;  5J4V A;  3KZZ A;  2NS0 A;  3TDZ C;  3RPQ A;  2XAU A;  1OLT A;  4I7H A;  2XAH A;  2ECC A;  4RB2 C;  4DYQ A;  1I27 A;  3R61 A;  4BAC A;  3G1M A;  2KHM A;  1I6X A;  3SZP A;  2D45 A;  4ITV A;  3SJM A;  1POG A;  5DS9 A;  3FMS A;  1BR4 A;  3FKJ A;  2K3F A;  3H5N A;  4UV8 A;  1SMY F;  1X4O A;  1D5V A;  4A2U A;  1B4A A;  2HOA A;  5FGM A;  4PZJ A;  1SVL A;  5CQE A;  3CES A;  1K4T A;  4FHT A;  4P9F A;  3HOZ J;  3FK6 A;  2KRC A;  2RV8 A;  2K27 A;  3D0S A;  4C3I J;  4HQE A;  1G3W A;  5LHG A;  2K7L A;  3V42 A;  4K2E A;  3MEX A;  3E3V A;  2B0L A;  4IHY A;  3F21 A;  2YR2 A;  2JWT A;  4X6A J;  4D1Q A;  2AQF A;  4BEH A;  1I3A A;  2P0W A;  3REO A;  3B02 A;  3OYD A;  3RZD J;  4BQQ A;  1LUJ B;  1Z3X A;  1WWX A;  2XRN A;  4P9U A;  2O8K A;  2H6C A;  3CJN A;  2KRF A;  2UWM A;  2WY7 Q;  4PCQ A;  3ZXS A;  2LH9 A;  3K4B A;  2CV0 A;  4I01 A;  4LJZ F;  1VF9 A;  3HHH A;  4RBO A;  4DZP A;  2DQR A;  2ZFU A;  2UZK A;  5B1A H;  3KP6 A;  2E36 A;  3IH2 A;  5L3G A;  3ZN1 A;  4UB8 C;  1BOA A;  3ZP5 A;  2Z99 A;  2H8W A;  3WOD F;  1N78 A;  2ZBK A;  1P4A A;  4YEL A;  3ML6 A;  4YEJ A;  2DOF A;  2A6T A;  3BOQ A;  4A3I J;  1FYL A;  2DOA A;  3HBL A;  2STW A;  3F8C A;  1ZGA A;  1KON A;  4MEX F;  2DK8 A;  4ZH4 F;  1ON2 A;  2F6C A;  4A3K J;  1HCR A;  1LEA A;  2DTR A;  4FET A;  5GTI C;  2BXY A;  3E6B A;  2NVY J;  2W7N A;  1RR8 C;  4MEY F;  1BIB A;  1LVA A;  2PMH A;  3I9V 2;  2EV0 A;  4A3C J;  3WE2 A;  2V1U A;  3OR2 C;  2MFZ A;  4LIV A;  2VPL A;  2QQ8 A;  2VQG A;  3TO6 A;  1JUP A;  2QEX I;  2GZW A;  3J7A O;  1DU6 A;  3KLO A;  3L00 A;  1WH5 A;  2MC4 A;  2QQB A;  3WGH A;  3DKX A;  1MMN A;  3RYR A;  4C2M J;  1J5Y A;  2M2E A;  5IT9 Z;  2QZ8 A;  3S1Q J;  3K4K A;  4PJL A;  4XQF A;  3FF5 A;  2HR3 A;  5M3M J;  1MSF C;  1SFE A;  5DUI A;  4KYW A;  4B1R A;  1LNW A;  1FJL A;  4OIO F;  4DYC A;  1K61 A;  3OOU A;  5FLM J;  3J81 Z;  1IN7 A;  3WG9 A;  4FTH A;  3PJR A;  1KA8 A;  2OCC H;  4G7H F;  2EIN H;  4YRV A;  1YE9 A;  3DF8 A;  3GWZ A;  2QKL B;  1R23 A;  2BVM A;  2HYG D;  4IKF A;  3OS2 A;  1HDP A;  4L0Y B;  2DPD A;  1K6O A;  5TGT A;  1DGW Y;  1XD7 A;  5E1W A;  1S72 I;  3RPU D;  3PNT A;  5K5Q A;  1K6Y A;  1MJA A;  5ICG A;  1F5T A;  1GHC A;  3O6B B;  3JRD A;  4HF1 A;  3G3Z A;  1HW1 A;  3OYA A;  3S15 J;  5FLX Z;  2E35 A;  4NC7 A;  1HC8 A;  4ANJ A;  2ME6 A;  1MGT A;  4N0B A;  1O4X A;  1WZ2 A;  2UXX A;  3T0Y A;  1QPM A;  3LNQ A;  2YX4 A;  4GYG A;  5BOX A;  1ZG1 A;  1T8I A;  2FA5 A;  3HRM A;  1Y6I A;  1HST A;  2FQ3 A;  3C18 A;  4U0Y A;  5FFZ A;  1W1W E;  2VBX A;  3ERM A;  1WRJ A;  3L2C A;  4L9V A;  2CG4 A;  5HOD A;  1IXS B;  4G8X A;  4LOC A;  4BE1 A;  1U2W A;  3ZQH A;  3OL4 A;  3K4C A;  3LQR A;  2MC3 A;  3RSN A;  2HVR A;  3DEW A;  2OA4 A;  4NC8 A;  1OYY A;  4CHU A;  1S5L C;  1U5T A;  2FOK A;  4MTD A;  2R7Z J;  1P7J A;  2O5R A;  3BG5 A;  4JX6 A;  1LPQ A;  1Z3Y A;  2CGP A;  2ESN A;  1FP1 D;  5LBQ A;  2MGQ A;  1PYV A;  3A02 A;  2EA2 A;  1X1C A;  1O7L A;  1QBJ A;  2MLK A;  1PDN C;  2DA5 A;  4B3X A;  1YTY A;  1O3S A;  1MBH A;  2JT1 A;  3BTI A;  1FOK A;  3J80 Z;  1U8R A;  1MBK A;  1UHS A;  2LY1 A;  1B59 A;  2JA7 J;  1T33 A;  5FKM A;  3DEE A;  2GOX B;  2M0C A;  1GVJ A;  1G6N A;  1V5F A;  4HBL A;  4HX7 A;  1USS A;  2YX7 A;  3FXL A;  3HPG A;  3MVP A;  3JAM Z;  4HNT A;  5DCF A;  4EJW A;  2JMW A;  1XGO A;  2H1L A;  2ZXW H;  2GIZ A;  2A07 F;  2M7B A;  4R79 A;  4GRI A;  4XRF A;  3S8P A;  4S05 A;  3WHC A;  1UFM A;  3NWT A;  3P9K A;  1JKQ C;  1ZKG A;  3M8E A;  4RAG A;  2ID3 A;  5IPA A;  1FIP A;  3TO9 A;  5K5R A;  1H9G A;  1K4S A;  5BS6 A;  5LRS A;  3WTX C;  1VQ8 I;  3CDI A;  3LSG A;  4PJN A;  2HPI A;  3BTJ A;  2GXG A;  2ZCW A;  3OWT A;  2LKX A;  1MDM B;  2L7M P;  5E8G A;  3W2V A;  1IO2 A;  1XMK A;  2IGN A;  4HF2 A;  3I4N J;  1IRZ A;  4MIM A;  1DGR M;  3MZH A;  1ETQ A;  3GTQ J;  1LFB A;  2V1X A;  3F8F A;  3ZPL A;  1MNM C;  4E7Z A;  4IHX A;  2EK5 A;  4M6Y A;  1Z1D A;  2N8G A;  2DFH A;  5H6Q A;  5JLX A;  4CYC A;  2XSJ C;  2DQL A;  3CCM I;  2A69 F;  4XBF A;  3F0C A;  3O8H A;  3IC7 A;  5CJ9 A;  3R0J A;  2O9L A;  4IJA A;  2JPB A;  1IN4 A;  3U1D A;  3VOE A;  5L3E A;  2VXZ A;  3PO3 J;  1W36 D;  1KU7 A;  4PJJ A;  4RM2 A;  2HGC A;  2Y75 A;  3BG3 A;  3NRV A;  1YJW I;  3E1S A;  5FRN A;  2JA8 J;  4WF2 A;  3FBN B;  3MFK A;  4R1H A;  2KIQ A;  1SFK A;  5L3C A;  2IS1 A;  1P9Q C;  2G7U A;  2LC2 A;  4CCJ A;  2CQX A;  4B43 A;  1VQL I;  5A2Q Z;  5BQT A;  3GZ6 A;  4MQV A;  2DDA A;  2Z2S B;  3W2W A;  4BHC A;  4IRG A;  4WXD A;  2XPV A;  3OYH A;  4XLN F;  2VOP A;  1U5T C;  5TJJ A;  4MNU A;  3GTK J;  2FNP A;  2XAS A;  3SYT A;  5HLH A;  5FKK A;  4EV0 A;  2QUF A;  2HKX A;  2V9V A;  3S17 J;  4AVP A;  5J6X A;  5FO5 A;  1CF7 B;  1WCM J;  1DPU A;  2E71 A;  5FB2 A;  2LF7 A;  1IN5 A;  1FTT A;  4LIT A;  2MD0 A;  3SDG A;  2VT3 A;  3F23 A;  5M5X J;  1V54 H;  3KEQ A;  4HG2 A;  1G3S A;  2V6C A;  4PGH A;  3U1K A;  3KPH A;  2ZKZ A;  4A93 J;  2XAQ A;  1FSH A;  1YOV B;  1MBJ A;  1R6R A;  5K1Y A;  3F3X A;  5FKN A;  4QSH A;  2HXI A;  2PMU A;  4JX5 A;  3R4K A;  2Y9Y A;  1TBX A;  2EA4 A;  3DTK A;  2R5Z A;  3SFZ A;  2DA1 A;  4ENJ A;  1J9I A;  2VQH A;  1I39 A;  4QTR A;  2EFO A;  3K1P A;  4IZZ A;  4LB5 A;  4UNO A;  3OS0 A;  2O3F A;  4J00 A;  1IV6 A;  4WK8 F;  4A5N A;  1ITY A;  4XLF A;  1TWH J;  4O5V A;  3KEY A;  4CCN A;  1R71 A;  2QBY A;  1OCP A;  1QO0 D;  2MBF A;  3ZQF A;  2EQR A;  2OTL I;  1T6S A;  2D1V A;  2EZH A;  1R00 A;  4IXA A;  1XTA A;  3ZMV A;  1VND A;  1T2K A;  1FOY A;  1A35 A;  5H6R A;  2LNB A;  3D5S C;  1Y1W J;  3RQ4 A;  3V7R A;  3R60 A;  2FMY A;  2M0M A;  3RQI A;  2JQ7 A;  2R3S A;  1XGM A;  2WAE A;  3OYI A;  5LGN A;  2HOT A;  2PJR B;  2KIS A;  1PUE E;  3MKZ A;  5J1R A;  2IS2 A;  1FBQ A;  1B9M A;  2DT5 A;  3DWL E;  1BBY A;  2XGC A;  2HPM A;  4LIU A;  2BV6 A;  2Y30 A;  2NXN B;  1X3Z B;  2ZSH B;  5LHH A;  4E7I A;  1BA5 A;  2RN7 A;  1KZH A;  1NK2 P;  4S0H B;  2RC4 A;  1YIJ I;  1IC8 A;  2DMQ A;  4XOP A;  4E70 A;  3L9F A;  5HLT A;  2M34 A;  4D5F A;  4KIF A;  4KIT B;  3OOP A;  4XLH A;  3JRH A;  4GGG A;  4C3H J;  5J47 A;  1RC9 A;  4M3G A;  5HNH A;  1HW2 A;  1QVU A;  3KFW X;  4BE0 A;  2E5N A;  4UVA A;  4ZC3 A;  2I8D A;  4M6X A;  1NG6 A;  3BLY A;  2B7E A;  2DOD A;  4XM3 A;  1ETW A;  2L5Q A;  1TT5 B;  4C2T A;  3H0D A;  1Z6T A;  5KVR A;  1XSX A;  1X1P A;  3CP2 A;  3S3N A;  3EUA A;  2NS7 A;  1T0F C;  1B9N A;  3CTA A;  3SHF A;  5HDK A;  3HTU A;  1BL0 A;  2OTJ I;  1OIS A;  2CUJ A;  3MKL A;  4G12 A;  3PSI A;  2OJE D;  4PFO A;  3AKZ A;  3RI4 A;  4HOB A;  4YFN F;  5IP7 J;  1DQU A;  1FBS A;  3BWG A;  2R7D A;  3DTI A;  5ILU A;  4L0Z B;  1OFC X;  5KCM A;  3RYP A;  3F22 A;  3K4J A;  5FRM A;  1D3Y A;  3KP4 A;  1U0J A;  3K7A J;  2EFN A;  2BOL A;  5IOZ A;  2E19 A;  1Y8Q B;  2FOW A;  2DU9 A;  4RDU A;  3CC2 I;  3PNV A;  3CUQ B;  1VZ0 A;  2F5C A;  3F6V A;  3BTL A;  3DPL C;  2D2W A;  4C9Y A;  3GTO J;  5IY5 H;  2Z16 A;  3QU6 A;  5GTH C;  3I5U A;  2XPU A;  4RMN A;  1RR7 A;  2X0L A;  1RKT A;  3ERE D;  2EZI A;  4AWX B;  2LVS A;  3IAS 2;  5KK1 A;  2VE8 A;  3PFI A;  5IP6 A;  3L2V A;  1TWF J;  5GAD J;  1DUX C;  4XRS G;  2BYV E;  5LRR A;  3MN2 A;  3VPR A;  4L9N A;  2QSF X;  4CH7 A;  2Z1D A;  2ZXH A;  1D5Y A;  3BQZ A;  5C4X J;  2G0E A;  4KIS A;  3G2B A;  3VSL A;  5C44 J;  3K69 A;  5K7Z A;  1BM9 A;  3GFI A;  1RPW A;  3NWS A;  3HKZ A;  2L02 A;  2OD5 A;  4RS8 A;  2QSH X;  2P6T A;  3E7L A;  4XKC A;  3S3O A;  4RAF A;  2EIJ H;  4II3 A;  5K7F A;  3IL2 A;  2K4J A;  3DCF A;  1J2X A;  1O7F A;  2IAI A;  3VDX A;  3U2R A;  4KA4 A;  4IOC F;  1FC3 A;  2X6W A;  9ANT A;  5KAI C;  2LRE A;  1MND A;  1SAX A;  3JRA A;  1J59 A;  3A4C A;  4HEA 2;  3PUB A;  2H94 A;  2KJB A;  2K02 A;  1JI8 A;  3S16 J;  2FUG 2;  2X4H A;  3CMA I;  1TTY A;  4O3M A;  3UKG A;  3GBG A;  1VQ4 I;  3SXY A;  4NQW A;  2OU2 A;  4CGZ A;  3TOB A;  3PNY A;  3BR2 A;  2VOO A;  4IHV A;  4LD5 A;  3L2Q A;  2HQR A;  1M1E B;  3DLA A;  2K9L A;  3RZO J;  1RNL A;  3CC4 I;  1HW5 A;  4B09 A;  2Q2E B;  4DBQ A;  2E2H J;  5CVV A;  3E0J B;  3MZY A;  1XX5 A;  2CQN A;  2LP0 A;  4NQW B;  3J7Z I;  2L9R A;  2HDD A;  1Z77 A;  1WFX A;  3GFL A;  4OAY A;  1VQN I;  1T0F A;  3SEZ A;  3KZY A;  3BR0 A;  5CKT A;  2QYO A;  2E1N A;  3JRB A;  1XDU A;  3JRE A;  3W3C A;  3OYJ A;  2VKH A;  1TC3 C;  1IAW A;  3FXU A;  2Q1Z B;  3HUG B;  5L3D A;  1AHD P;  4U7D A;  3EYY A;  1ZEL A;  2K9M A;  1SFO J;  3HGY A;  4LGW A;  4DJA A;  4RAY A;  3BG9 A;  5CVU A;  3VFZ A;  3G73 A;  2R92 J;  3GLX A;  3GLL A;  1SVM A;  1OCT C;  2MH9 A;  3BR5 A;  1KQ9 A;  1WGX A;  1IGN A;  3WU0 A;  2FBH A;  5M3F J;  4OIQ F;  2CU7 A;  2BW3 B;  2WAQ N;  3BY6 A;  2M4K A;  1NG7 A;  1VQ7 I;  4N4O B;  3TL4 X;  4HW0 A;  2K9N A;  3K6G A;  5B1B H;  5C4J J;  2QGU A;  4XMY A;  1ZG3 A;  1J0R A;  1P2F A;  2L9N A;  2NVU B;  1IRG A;  3FIS A;  2L4M A;  3E6M A;  2TCT A;  2XGD A;  3BG7 A;  1IJW C;  4OU0 A;  3L1P A;  3FKI J;  3HRU A;  2VT2 A;  2CV2 A;  2VAS A;  3OR1 C;  3C1D A;  5AIQ A;  4XLC A;  2LY2 A;  3E6C C;  1W7P B;  1GV2 A;  5JFR A;  1JT0 A;  3PFY A;  2VOD A;  1FP2 A;  5E3N A;  1J7K A;  4EGY A;  1JGS A;  3L7W A;  3QYB A;  3RKY A;  3CUO A;  3ZMD A;  3H3U A;  1IG7 A;  3ZR8 X;  2GQQ A;  3MD2 A;  1WI9 A;  3A01 A;  3M07 A;  2NOG A;  1FSE A;  2GWR A;  5H2F C;  1IN8 A;  2LKP A;  1YLF A;  5HOO A;  5CQG A;  3GTP J;  1YG2 A;  3NAR A;  3S2W A;  4M73 A;  3WTZ A;  2HZT A;  4IVN A;  2R7T A;  2IGM A;  3F9K A;  1GV5 A;  3PUF A;  4Y15 A;  1QNT A;  2KMU A;  1BJZ A;  3V4G A;  4ON0 A;  4BKX A;  5F64 A;  3C7J A;  3I55 I;  3X2Q H;  2ZSI B;  3KE2 A;  3KP2 A;  1IRF A;  2ACJ A;  2PN6 A;  5ICF A;  4AUX A;  2HTJ A;  3B73 A;  4XLA A;  3EUH C;  5AON A;  3OSF A;  3A01 B;  1TW3 A;  3TMO A;  2VBZ A;  4OAZ A;  5EG0 A;  3ZMZ A;  3O2P E;  4XOR A;  1A31 A;  2P8T A;  4Y52 J;  4CYC B;  4A12 A;  2A5W A;  1FIA A;  3I54 A;  1OCC H;  3LFU A;  3LSJ A;  3HOU J;  1YW7 A;  3LSK A;  3N4M A;  1JHH A;  2EIK H;  3HKZ N;  3GVA A;  3QPT A;  3ECO A;  1TL8 A;  1PP8 F;  3C2H A;  3A0H C;  1UZC A;  3K4M A;  2K9Q A;  3TGN A;  3JAM K;  1P4X A;  2ME0 A;  4D5C A;  3RKQ A;  5DCM B;  4HAM A;  4GO1 A;  2VN2 A;  3PIP F;  2JUC A;  2XV4 S;  5D4S A;  1MBF A;  4DIQ A;  3DBR B;  3H0G J;  2ZJ2 A;  4XR6 A;  5HNF A;  3I56 I;  3L2R A;  3DQV C;  2OV7 A;  2NNY A;  2X1D A;  5FKO A;  1OCO H;  2XF5 A;  2CW8 A;  3AAF A;  1APL C;  2QCO A;  2IRF G;  4QIW N;  2IA0 A;  1HBX G;  2BY1 A;  4PGG A;  4Q4Z F;  2E2I J;  1QGP A;  2LTP A;  4G7Z F;  1RES A;  2UV1 A;  2XRL A;  2DCE A;  2XGE A;  4CCO A;  4HX4 A;  3M3Y J;  1IRX A;  4Z6Y A;  5HS9 A;  4B4C A;  4XRM A;  1W5T A;  2UXN A;  4HV5 A;  1NK3 P;  1T95 A;  4BXF A; 
#chains in the Genus database with same CATH homology
 2ID3 A;  3S2D J;  5IPA A;  1FIP A;  4UUT A;  4XIC A;  3B6A A;  4AC0 A;  5F04 A;  3Q0V A;  2MW8 A;  1F36 A;  3H3V K;  1GDT A;  3LSG A;  2HOS A;  1FTZ A;  3BTJ A;  4DW6 A;  1I3Q J;  3Q3S A;  2VKV A;  2LKX A;  2L7M P;  4NDL A;  2R5Y B;  2LLK A;  4DYR A;  2L7F P;  3I4N J;  1IRZ A;  2H8R A;  4MIM A;  1ETQ A;  3GTQ J;  2X48 A;  2ELK A;  1LFB A;  5E3L A;  2QF7 A;  2YS9 A;  4D7N A;  1MNM C;  5E3O A;  4IHX A;  2N8G A;  5JLX A;  4CYC A;  2MG4 A;  2DA6 A;  5DTD A;  3ZQI A;  1WI3 A;  1F43 A;  3F0C A;  3O8H A;  4W1U A;  1Z0X A;  2O9L A;  2P81 A;  2EZK A;  1U9N A;  3PO3 J;  1UMQ A;  1P7I A;  1IDZ A;  2GBY A;  2NVT J;  3HOV J;  3BG3 A;  2JA8 J;  2PMZ N;  1TWA J;  2RAE A;  2R5Z B;  1OJL A;  4W97 A;  4A3G J;  1HLV A;  1ZQ3 P;  1LE8 B;  5FLV A;  1EF4 A;  2IBD A;  3IH3 A;  2CQX A;  2OF7 A;  3OIO A;  3A03 A;  5GPC A;  1YRN A;  2YU9 J;  4IHW A;  4M6V A;  2XPV A;  4J19 A;  3GTK J;  3TED A;  4BBS J;  5EG0 B;  4JX4 A;  2KDZ A;  5FKK A;  2DMU A;  2TRT A;  3JRG A;  3S17 J;  1XS9 A;  1BW6 A;  2XB0 X;  2WB1 N;  1MH4 A;  3QQA A;  2JA6 J;  1WCM J;  1XG1 A;  1FTT A;  1AKH A;  3SDG A;  1X58 A;  5M5X J;  3PO2 J;  2DMN A;  2DJN A;  2VKE A;  3BQY A;  3BR1 A;  5IYC J;  4A93 J;  4A69 C;  1JKO C;  4M3F A;  1MSE C;  1HF0 A;  1MBJ A;  2JK3 A;  2Y31 A;  2R5Y A;  5FKN A;  4MO7 A;  4QSH A;  2HXI A;  2HXO A;  4JX5 A;  1U8B A;  1JUM A;  2Y9Y A;  5K7H A;  5F0H A;  2Y2Z A;  2R5Z A;  1XC5 A;  2DA1 A;  2GLO A;  1RET A;  4QTR A;  1JT6 A;  3JRI A;  2YUS A;  1AKH B;  1IV6 A;  1ITY A;  1TWH J;  2ZB9 A;  1OCP A;  3ZQF A;  1I6H J;  2DMT A;  2EQR A;  1MH3 A;  5J3L A;  1QVT A;  2EZH A;  3S1R J;  1VND A;  4FE4 A;  3BTC A;  5FJ8 J;  1Y1W J;  1ETY A;  1SAN A;  3HB9 A;  3S14 J;  1IUF A;  3RQI A;  3Q0W A;  1PUF A;  3C2B A;  3HM5 A;  2HOT A;  3G1L A;  3ZOB A;  4A3J J;  3GTM J;  2M8G X;  5J1R A;  4I6Z A;  5J1Y A;  2EZL A;  2XGC A;  2LFB A;  2Y30 A;  5EEA A;  5BNG A;  4D7M A;  3ZQL A;  2FJ1 A;  1BA5 A;  1FEX A;  1NK2 P;  4S0H B;  4A3M J;  1IC8 A;  4UUS A;  2ECB A;  2DMQ A;  2XPW A;  2M9H A;  2M34 A;  3Q0U A;  2DMP A;  3JR9 A;  1NK3 P;  4D5F A;  1ENH A;  1QPI A;  2DA7 A;  3JRH A;  3HOX J;  4C3H J;  4M3G A;  1QVU A;  1JGG A;  1B72 B;  1BW5 A;  5GP9 A;  3K2A A;  3CMY A;  4X1E A;  5F0F A;  5EGO A;  1DU0 A;  2K40 A;  1ETW A;  2HI3 A;  2CUE A;  5F1J A;  3LSP A;  1HDD C;  2NS7 A;  2VI6 A;  3JRC A;  1JJ6 C;  4A3D J;  2E1O A;  3NAU A;  1ETK A;  1A5J A;  1BL0 A;  1B8I B;  3WHB A;  3MKL A;  4G12 A;  1ZTR A;  1ZR4 A;  4BY7 J;  5IP7 J;  2Y9Z A;  2JA5 J;  4A3E J;  1ZGW A;  1TWG J;  3OSG A;  1OFC X;  2X9D A;  2HQ5 A;  5IYB J;  3HGG A;  1JKP C;  3IV5 A;  3FK7 A;  2L0K A;  3K7A J;  2X6O A;  5IOZ A;  1GUU A;  2E19 A;  4V2F A;  2FX0 A;  5IOY A;  4RDU A;  4BXX J;  4A3B J;  4JP0 A;  4MLO A;  3TP3 A;  1X2N A;  3BR6 A;  3BTL A;  1G2H A;  1A6I A;  2VPR A;  5IP9 J;  2FD5 A;  1WH7 A;  1HOM A;  3GTO J;  3M4O J;  4FIS A;  4I76 A;  5E3M A;  3ZQC A;  5EF6 A;  2LR8 A;  2XPU A;  1RR7 A;  3QPS A;  4DZJ A;  1ETV A;  1RKT A;  2KT0 A;  4AYB N;  2IEK A;  2XSD C;  2EZI A;  1H8A C;  2LVS A;  2ID6 A;  5IP6 A;  1TWF J;  3IH4 A;  2ECC A;  2L7Z A;  4XRS G;  5EGO B;  1TWC J;  5J1U A;  3MN2 A;  3S2H J;  4DYQ A;  2K9S A;  3VPR A;  1JKR C;  1GVD A;  3G1M A;  1D5Y A;  3BQZ A;  5C4X J;  1LE8 A;  2G0E A;  2WV1 A;  3HOW J;  3SJM A;  5C44 J;  1POG A;  5DS9 A;  5K7Z A;  4GFB A;  1RPW A;  3G1O A;  1T56 A;  1WPK A;  3BT9 A;  1X2M A;  3E7L A;  2CUF A;  2HOA A;  1B8I A;  2CJJ A;  5K7F A;  5JLW A;  2JJ7 A;  3HOZ J;  3FK6 A;  3DCF A;  3HDD A;  2CRG A;  4C3I J;  3GTJ J;  4HNV A;  2DA4 A;  2IAI A;  4BY1 J;  4M3B A;  2NS8 A;  9ANT A;  4IHY A;  1JTY A;  1PUF B;  2JWT A;  3JRA A;  4MFE A;  4X6A J;  2DN0 A;  3S16 J;  1ETX A;  3CCY A;  3RZD J;  4M3D A;  5F27 A;  2O8K A;  2XB5 A;  3UKG A;  3GBG A;  5F0C A;  1H89 C;  1B72 A;  4ABZ A;  3BR2 A;  4MFD A;  1UG2 A;  1VF9 A;  4RBO A;  2HYJ A;  4IHV A;  4DZP A;  3BR3 A;  1H88 C;  4C3J J;  1NTC A;  4V2G A;  4XID A;  3RZO J;  3IH2 A;  2R93 J;  2E2H J;  2LP0 A;  2JN6 A;  3JRF A;  2L9R A;  2HDD A;  1Z77 A;  2OPT A;  2CQQ A;  4Y7N J;  4A3I J;  3BR0 A;  1K83 J;  3JRB A;  2DTZ A;  3JRE A;  3HBL A;  1Q1V A;  5FKL A;  1E3O C;  1TC3 C;  1LFU P;  1AHD P;  1ORK A;  3B6C A;  1SFO J;  3HGY A;  2MSY A;  4A3K J;  1HCR A;  1VI0 A;  2EH3 A;  3HEF A;  2NVY J;  4IEJ A;  2VUM J;  3BG9 A;  3GTG J;  2R92 J;  2LD5 A;  1OCT C;  3BR5 A;  4A3C J;  1WGX A;  1IGN A;  3HOY J;  5M3F J;  2CU7 A;  2WAQ N;  4L5E A;  1JUP A;  2K9N A;  4XK4 A;  4A3F J;  5C4J J;  3D1N I;  1DU6 A;  1GT0 C;  2D5V A;  1WH5 A;  3FIS A;  4C2M J;  2TCT A;  2M2E A;  2XGD A;  1QRY A;  1IJW C;  3S1Q J;  3SFI A;  3L1P A;  3FKI J;  5EZG A;  3ZQG A;  5M5Y J;  5M3M J;  2E2J J;  1MSF C;  1GV2 A;  1JT0 A;  2COB A;  4B1R A;  1FJL A;  4A3L J;  4DYC A;  3FIW A;  3OOU A;  5E3N A;  4EEF G;  5FLM J;  4FTH A;  1K61 A;  2O7O A;  1IG7 A;  2NVQ J;  2AO9 A;  3O8G A;  3CDL A;  2LK2 A;  1AU7 A;  4B3A A;  3A01 A;  1HDP A;  2NOG A;  1CQT A;  2FQ4 A;  1R9T J;  3QPL A;  1MBE A;  3GTP J;  3NAR A;  1VFC A;  1YRN B;  5EDN A;  3TP0 A;  1S7E A;  3I4M J;  1JTX A;  1GV5 A;  1U78 A;  3JRD A;  1U9O A;  1ZK8 A;  1BJZ A;  4BKX A;  3S15 J;  5M5W J;  2ME6 A;  3LSR A;  1O4X A;  4M3E A;  4BBR J;  3LNQ A;  1JUS A;  3LOC A;  5C3E J;  1Y1V J;  4AUX A;  1JJ8 C;  2EBI A;  5EZH A;  3OSF A;  3A01 B;  2H1K A;  2W48 A;  1W0U A;  5IYD J;  5F08 A;  5HOD A;  5EG0 A;  4LOC A;  3ZQH A;  2GM4 A;  3S1M J;  4Y52 J;  3CQZ J;  2B63 J;  3DEW A;  4CYC B;  1FIA A;  2R7Z J;  1ZR2 A;  1P7J A;  3LSJ A;  3HOU J;  3BG5 A;  4JX6 A;  3TW7 A;  3HKZ N;  2AHQ A;  1ETO A;  2K9Q A;  2MGQ A;  2ME0 A;  4UUS B;  2LY9 A;  3GTL J;  3A02 A;  4D5C A;  3RKQ A;  2DA5 A;  1I50 J;  1MBF A;  3H0G J;  3PM1 A;  1MBH A;  3BTI A;  3TW6 A;  1RKW A;  5FKO A;  1APL C;  2QCO A;  1MBK A;  1W0T A;  1UHS A;  5GPA A;  4QIW N;  4XRS A;  2JA7 J;  1T33 A;  5FKM A;  4JYK A;  2R0Q C;  4FCY A;  2M0C A;  2E2I J;  2LTP A;  1RES A;  2XRL A;  3MVP A;  3S1N J;  2XGE A;  2Y0S N;  2JMW A;  2I10 A;  3M3Y J;  2DA3 A;  1IDY A;  3WHC A;  4B4C A;  2DA2 A;  4FE7 A;  1MBG A;  4XRM A;  1JKQ C;  2NVX J;  1ZKG A;  5EYR A;  3W6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...