1YRNB

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnB00
5F08A 3M3YJ 1WH7A 3QQAA 2XRLA 3FK7A 5IOZA 3JREA 3RKQA 1IC8A 2AHQA 3GTPJ 3QPSA 1ITYA 1POGA 5EYRA 5FKOA 1QVTA 4BKXA 5EDNA 5C4JJ 1QPIA 1B72A 3LSRA 1MSFC 1AKHA 3A02A 4JX4A 1JKOC 1JTYA 1TC3C 1MH4A 2G0EA 4A3BJ 1T56A 3GTLJ 2NVTJ 1X2MA 2TRTA 3W6VA 9ANTA 2M9HA 1PUFA 2HQ5A 4A3KJ 1FIAA 3HBLA 3O8HA 1P7IA 4FE7A 2HOSA 4JP0A 5FKLA 2DA7A 3TEDA 4UUSB 5F0HA 2CQQA 4MFDA 5GPAA 5E3MA 1ZR2A 1AHDP 1IJWC 1ETXA 3JRDA 3JRCA 3HOUJ 5K7HA 5IYCJ 5FLMJ 1IGNA 2YS9A 5DS9A 3ZQHA 2JMWA 1T33A 2CUFA 2AO9A 2OF7A 2JA8J 1P7JA 1XC5A 2VPRA 1ZGWA 3BR2A 2HXIA 5GP9A 2KDZA 1VFCA 2O8KA 3A03A 1NK2P 1TWCJ 2D5VA 2B63J 5JLWA 4IEJA 2YUSA 2W48A 1FIPA 3S1NJ 3WHCA 2ID3A 3K2AA 3HB9A 3PO3J 3GTMJ 3S2DJ 2MSYA 3ZQLA 2CU7A 4JX5A 3H3VK 4JX6A 1UG2A 2XSDC 1UHSA 3G1MA 3OSFA 3B6CA 3RQIA 2KT0A 2MG4A 3ZQGA 4FTHA 3PO2J 3IH3A 2LVSA 5FKKA 4Y52J 4XICA 3G1LA 2DA5A 1WH5A 1U78A 1MBKA 2M2EA 1WGXA 2CUEA 4GFBA 1JKQC 3GTQJ 5EGOA 5IP9J 2ECCA 2XPWA 2R92J 1FEXA 3ZQFA 1IV6A 3IH4A 2K40A 3BQYA 4JYKA 3ZOBA 3SJMA 1RKTA 3HEFA 2MGQA 3S15J 3PM1A 1JKPC 2E19A 1IRZA 4AUXA 2R5ZA 3BTCA 2GM4A 4BY1J 2LY9A 3ZQIA 4G12A 4FCYA 4XRMA 4J19A 2LFBA 4D7NA 1F43A 2LLKA 1JUMA 4RBOA 5J3LA 2CQXA 1W0TA 3HGYA 2JK3A 2L0KA 3CCYA 2EZIA 1OCTC 5EZHA 4A3JJ 1CQTA 3D1NI 1E3OC 1TWGJ 3S1QJ 4QSHA 2JJ7A 1X58A 4IHWA 1DU6A 1NK3P 2XGCA 2TCTA 1GVDA 3NAUA 1D5YA 2XGEA 2DJNA 2ME0A 3JRBA 1JUPA 1MBGA 1EF4A 2H8RA 3LOCA 5C44J 4D5CA 4C3JJ 3B6AA 4A3IJ 1YRNA 2NOGA 3HM5A 4D5FA 1FTTA 1HDPA 2DN0A 2LTPA 5J1UA 5JLXA 4A3LJ 3BR6A 5HODA 4C3IJ 1GDTA 2R7ZJ 4FE4A 4X6AJ 2IAIA 2HOTA 3M4OJ 5E3NA 2Y31A 5GPCA 3RZDJ 1APLC 4QIWN 2ECBA 1OJLA 2PMZN 4XRSA 1RETA 5EG0A 1I3QJ 1BW6A 3BG9A 3TP0A 3JRIA 1JJ6C 2E2HJ 2JN6A 1MBHA 2RAEA 2H1KA 1LFBA 1ENHA 4DYRA 2ME6A 5FJ8J 1Y1WJ 1QVUA 2DMTA 1ZKGA 3MVPA 1X2NA 1GV5A 5F0CA 1ZQ3P 1HF0A 1SANA 2LR8A 3CQZJ 3FKIJ 4M3FA 4M3EA 3SDGA 4CYCA 2K9NA 1HCRA 2N8GA 4B4CA 3LNQA 2OPTA 3HOVJ 5E3LA 2L9RA 3FISA 5IOYA 2DMQA 3C2BA 5M5XJ 3JRFA 1GUUA 1U8BA 1MBEA 2L7ZA 1B72B 3VPRA 1VI0A 4M6VA 1AKHB 2O9LA 3LSPA 2HI3A 3F0CA 2Y9ZA 2GBYA 2JA5J 1BW5A 4W1UA 1B8IA 4DZJA 2X48A 1PUFB 5M5WJ 5C4XJ 1ORKA 3BR5A 1BJZA 3GTKJ 2K9SA 4W97A 3HGGA 4I6ZA 2O7OA 1LE8A 4A3GJ 4L5EA 3S16J 3MKLA 3BTLA 3JRGA 1ETQA 4Y7NJ 5FKMA 3DEWA 1H89C 2DA6A 2E1OA 4DW6A 4HNVA 1BL0A 1OCPA 2EZKA 4MFEA 5C3EJ 2FX0A 3SFIA 2R5YA 2DMUA 1Z77A 5J1YA 1ETKA 3S1MJ 3IV5A 4QTRA 4AYBN 5M3FJ 2YU9J 1WPKA 2WAQN 3A01A 4XRSG 2P81A 1JJ8C 1A6IA 1ETOA 2WV1A 2R0QC 1DU0A 3G1OA 1H8AC 3BT9A 3HDDA 3DCFA 3H0GJ 1Z0XA 2JA6J 4IHVA 2JA7J 3LSJA 4DYQA 2WB1N 3GTGJ 2M34A 3BR1A 1SFOJ 5EGOB 4M3DA 4IHXA 3TP3A 4MLOA 4A3FJ 1ETWA 3Q0VA 4BBSJ 2DMPA 1ETYA 2R5ZB 3BG3A 2DA3A 1OFCX 1AU7A 3S17J 2FJ1A 2XB0X 4UUTA 2LKXA 3QPLA 5J1RA 5FKNA 2EBIA 1VNDA 4BBRJ 1I50J 3NARA 3OIOA 4M3BA 5F04A 1GV2A 3BR3A 4XK4A 4IHYA 1A5JA 3JRAA 4V2FA 1W0UA 3MN2A 1HOMA 3BR0A 2VI6A 4DZPA 4UUSA 1MNMC 1U9NA 3K7AJ 2MW8A 1TWAJ 1RR7A 2XGDA 1WCMJ 4C3HJ 4FISA 1WI3A 1UMQA 5F27A 5EZGA 5IYBJ 2NVQJ 5K7ZA 1JTXA 3GBGA 2L7MP 3FK6A 1BA5A 3HOWJ 4S0HB 1H88C 2ELKA 1LFUP 2LK2A 2NS8A 3TW7A 3ZQCA 3JR9A 1MBJA 2FQ4A 5M3MJ 5IP6A 1K61A 2GLOA 3HKZN 1YRNB 4ABZA 2Y9YA 5M5YJ 2X9DA 3S2HJ 1Y1VJ 4MO7A 3O8GA 2HDDA 2XB5A 4B3AA 2NVXJ 2HXOA 2VKVA 3BTJA 1MBFA 4AC0A 5F0FA 2ID6A 2E2IJ 1R9TJ 3LSGA 1RESA 4A3DJ 4C2MJ 4LOCA 5EG0B 1ZK8A 3BG5A 1TWHJ 4DYCA 3GTOJ 3E7LA 1IG7A 1I6HJ 2L7FP 3IH2A 2Y2ZA 4I76A 3S1RJ 2IEKA 1IDZA 1JT0A 3TW6A 2K9QA 3GTJJ 4A93J 1JGGA 1U9OA 1JKRC 1XG1A 4CYCB 3HOZJ 2DTZA 2NS7A 2I10A 3BQZA 4BY7J 3Q0WA 4A3MJ 1JT6A 2JWTA 4XIDA 3I4NJ 4A69C 4BXXJ 3JRHA 4A3EJ 2DA4A 5BNGA 2QF7A 1HLVA 5E3OA 2Y0SN 3OSGA 3S14J 1B8IB 1JUSA 2EQRA 4B1RA 1F36A 3CMYA 3UKGA 1VF9A 2X6OA 1LE8B 2M0CA 2DA2A 4NDLA 2E2JJ 2HYJA 3WHBA 4MIMA 3I4MJ 5FLVA 4RDUA 1MSEC 2M8GX 2VKEA 1HDDC 4A3CJ 3RZOJ 1TWFJ 4EEFG 4V2GA 3L1PA 2R5YB 5DTDA 2EZLA 3OOUA 1ZTRA 1RKWA 2Y30A 3HOYJ 2QCOA 5IPAA 2IBDA 2EH3A 1S7EA 1XS9A 1GT0C 5K7FA 3FIWA 1FJLA 4X1EA 1K83J 2VUMJ 5EF6A 2XPUA 3A01B 3CDLA 3Q0UA 5IP7J 2ZB9A 1NTCA 3Q3SA 1QRYA 1IUFA 2CJJA 2LD5A 1ZR4A 2HOAA 5EEAA 1ETVA 2COBA 2EZHA 4D7MA 1MH3A 1RPWA 2DA1A 1O4XA 2LP0A 2NVYJ 5F1JA 3HOXJ 2FD5A 2XPVA 5IYDJ 1G2HA 2R93J 2DMNA 1Q1VA 4M3GA 2CRGA 1IDYA 3BTIA 1FTZA
chains in the Genus database with same CATH superfamily
5F08A 3M3YJ 2NXNB 3QQAA 3KLNA 2HWVA 2WY7Q 1IC8A 4H0EA 3DPUA 3SXYA 4XL9A 4R8HA 1MMDA 4IVNA 5HLTA 3M07A 5C4JJ 2CQNA 5ILVA 4UVBA 3W2WA 3KEQA 1JKOC 1J0RA 4XLPF 5L3BA 1T2KA 4G6TB 2LBFB 3OYFA 3PIOF 2M7AA 2PJRA 2F4MB 1PP7U 1T56A 3GTLJ 9ANTA 2M9HA 3X2QH 1PUFA 2ZMEB 2OUMA 5CPRB 2L7KA 1P7IA 4JP0A 1IZ1A 2CG4A 2OC6A 5GPAA 4XLNF 1ZR2A 4BHPA 1IJWC 1ETXA 2JZYA 1XX5A 3UR3C 4CO8A 3HSFA 4RGRA 5FLMJ 3T5XA 2V4JC 2Q2EB 2X85A 5DS9A 1W1WE 1A36A 2V9KA 1ZLJA 2XDVA 2Z1DA 3F6OA 2KZVA 2OF7A 1SC7A 2VPRA 1ZGWA 3IL2A 2FOWA 3I58A 3OS1A 4PJMA 2TDXA 1FOKA 2DT7B 4Y33A 4GGGA 3FMRA 3NQOA 2DYSH 1P4XA 1SVMA 3J7AY 3HB9A 5LGNA 1WWXA 3PO3J 3GTMJ 1OCZH 2MSYA 3ZQLA 1WJEA 1UG2A 1KQ9A 1UHSA 2ESHA 2EB7A 1XDSA 3ZQGA 2CWEA 3JW4A 2VBWA 1TLHB 1Z6RA 5CVIA 3BWGA 2LVSA 4R79A 3G1LA 3T8TA 5D4SA 1ZREA 4II2A 3L2RA 3DU5A 1U78A 2F2EA 1JKQC 1PVEA 3GTQJ 2LC2A 1YW7A 2VKDA 2L01A 3V4GA 3ZXSA 4JBAA 4RM3A 4CGZA 3K0LA 5D5XB 3IH4A 2GQQA 3A0BC 3ERED 1YE9A 2ZXJA 3KP4A 3HEFA 3S15J 5DD8A 3OYKA 2DXIA 4IZZA 2P5VA 2E19A 4AUXA 4HX7A 3OYDA 1BR4A 4ANJA 3BG6A 4P55A 5CKTA 4CCKA 2ZCWA 2K85A 4G12A 2X1CA 3LSTA 3SDBA 4WX9A 3WGGA 2VPLA 4XRMA 4D7NA 2LLKA 1JUMA 2JTVA 2JT1A 1EH8A 4F7ZA 2CYYA 4LK1F 3SQNA 4Q4ZF 3GFLA 4ZTFA 3M8JA 2LSOA 4G94A 1OCTC 3EQLF 1G6NA 4YG2F 1TWGJ 1TW3A 4QSHA 4ZJZA 4IHWA 5HLHA 2XGCA 2IW5A 3ZN1A 2TCTA 5A2QK 2YX7A 1UFMA 5ERIA 1O3RA 3B73A 3OV8A 5D6FA 4XLEA 2CS3A 3PNTA 4MQ9F 5LFAA 2AQFA 2QKLB 1R58A 2CMPA 3JRBA 3GFMA 4I01A 4HG2A 5CJ9A 1YS7A 1QHGA 3LOCA 3W3CA 2HKXA 2NOGA 1SAXA 1FTTA 4HPQA 3SEZA 3KIOA 5IY5H 1YQAA 4A3LJ 3BR6A 3FWEA 1BC8C 1WZ2A 1S29A 4BEHA 4XONA 5H20A 3QODA 1A04A 4U0VA 4QPOA 5E3NA 3M4OJ 1D1CA 4YEJA 2PMZA 1APLC 4YIRX 3FM5A 4GYIA 2ECBA 2Z3YA 5FFZA 3AL0B 2PMZN 1MW7A 2HU9A 1BW6A 3ZMUA 3N4MA 4I0AA 1FBQA 3AL0C 2E2HJ 2XASA 2RAEA 2H8WA 3HC7A 3P5JA 4IHSA 3M9AA 1QA6A 3PJRA 1EV7A 5DD4A 2DMTA 4F92B 2E1CA 1J5YA 4I2OA 3CCJI 2KKOA 2W57A 1HF0A 3DQVC 4M3FA 3FKIJ 2MD5A 1SFKA 2N8GA 4XBFA 2M4GA 2KMUA 2WBMA 1YO5C 2FF4A 1R49A 1U8BA 5ILUA 3VPRA 1HW2A 2DFFA 2QBYA 3WODF 1J75A 1V5FA 2HI3A 1CF7B 1R71A 1W7PD 3CTAA 2F5EA 3DPTA 4PSXA 1RNLA 4DZJA 4A12A 2KJBA 3GFIA 5C4XJ 2QQAA 4E7SA 2LKPA 3H9QA 4A3GJ 3S16J 4LK0F 3OL3A 4RB3C 4HW0A 2IGMA 3H3ZA 5FKMA 1VQLI 3IAS2 3DPLC 2A3SA 1LVKA 2QGUA 2X1EA 2BEOA 3MKZA 1VTNC 1ERDA 5B66C 3SFIA 1R22A 2P8TA 2XHKA 3J7AO 1Z77A 3W6JB 1ETKA 5J1YA 2IS1A 1ZELA 4HF1A 3QYBA 1N78A 3BPVA 3IV5A 3QOPA 1SD7A 3MWMA 2ICWG 3PSFA 3TKYA 1WJFA 4ZYHA 1TQIA 3CCQI 3IWZA 2WAQN 3R61A 2PBIA 3BZKA 4OIRF 4TV7A 4EJVA 3AFHA 1W5TA 2Z5UA 1ETOA 2IS4A 5K5RA 3BT9A 3K2ZA 3H0GJ 4XKWA 1Z0XA 1SD4A 1WQ2A 4NBQA 2Y69H 4E4HA 4EM1A 4KN7X 3AKZA 2OQRA 1SFOJ 5J8FA 1SD5A 2QSFX 3BCAA 3VWBA 5EGOB 3FXOA 3U21A 2J5OA 2RV8A 2QYOA 3RYRA 3OY9A 4X0GA 2EWNA 2LG4A 4M3DA 4IHXA 2KP6A 3DEEA 4EJWA 2NYXA 4A3FJ 2O61A 4N9IA 2MC3A 2HTJA 4HF0A 1O3QA 2GA1A 1I1SA 2DA3A 4NB5A 1RUOA 4ITVA 2XGXA 4CICA 3QPLA 1RUNA 5E8IA 4PFOA 2LBFA 4LB6B 3ONQA 4WXHA 2ADUA 4KIGA 1GV2A 1V5GA 2ZMEA 1MMAA 5LHHA 3K4CA 2A61A 2Z33A 4L9JA 3IUOA 2ZJ2A 4YRVA 3EYIA 3T8RA 2ESNA 1OYYA 2VI6A 1LPQA 3FBNB 3R0AA 2WAEA 4Q47A 1Y0NA 3K7AJ 2MW8A 3OYBA 3VSKA 2Q2EA 2P5KA 1I27A 2XGDA 1XGSA 4FX0A 4M9XA 1VQ6I 1WI3A 5GAGJ 1YI2I 4BL0B 2E71A 3CESA 5IYBJ 3I0TA 4B8XA 4EVIA 2D45A 3GLLA 1AWCA 3WTSC 1UHWA 3GBGA 4G6QA 3K70C 2M1BA 1BA5A 1IXCA 2VT3A 3SHFA 3BPXA 2D1VA 2JRTA 3V8LA 4CCOA 1HSJA 1OCRH 1MJ9A 3TO9A 1BJAA 1Z05A 1OQYA 5FD5A 5M3MJ 5IP6A 3HKZA 2GLOA 2R7QA 2LF7A 1S7OA 3HKZN 5FB2A 2M45A 3OWTA 3I59B 3U1KA 2RC4A 1SMTA 2VQGA 3KETA 1Y1VJ 3LA3A 4NNJA 3FXLA 4XLCA 2K3FA 3OR1C 4FQGA 5CVRA 3AG1H 1WI9A 2DAOA 2P5LC 1MBFA 4M9SA 3BZCA 3KCCA 3PQJA 5CQGA 1G3WA 3BJOA 5F0FA 4F91B 3OYEA 1R9TJ 3LSGA 3WTXC 4MTDA 3IP4B 5EG0B 3E7LA 4IQ4A 4XRFA 4NC8A 1P9QC 2LY1A 3WE3A 3S1RJ 5FROA 3GVAA 2PMUA 2GZWA 1YTYA 2V6EA 3TW6A 2K9QA 3HRUA 4HV5A 1RRJA 5K5QA 2FOKA 1S5LC 1M1EB 3HOZJ 2QLZA 5J6XA 3E1SA 3KP6A 4IO9F 1P4WA 4CCMA 2E5ZA 4ESBA 2PI0A 3K4KA 1SMYF 4BXXJ 3JRHA 2COMA 3QYEA 3EPZA 1O3SA 3VFZA 1UAAA 1FBUA 3WG9A 1B8IB 4ZDOA 5HOOA 1P4AA 4KIBA 2X1DA 5LRSA 1XGMA 3CMYA 2Z99A 3UKGA 3CLOA 3QRFF 2BBYA 2E2JJ 1VQKI 2KJCA 5TGTA 1U6GA 1O57A 4EATA 3GX4X 3I4MJ 2QA4I 5FLVA 4DBRA 3TGNA 4LIVA 5DM7F 1GXPA 4M72A 1YG2A 2IVMA 4EGZA 1REPC 2OTLI 3RPUD 1TWFJ 3F6VA 4EEFG 2HQRA 1ULYA 4LITA 3CCUI 1ZG5A 2Y30A 2JQ7A 3MFKA 4D9JA 1DPRA 5IPAA 1WFXA 2E1MB 1FJLA 1K83J 5GTHC 2OA4A 5EF6A 2E35A 2XKOA 2XAQA 3LSMA 3WTWC 1KA8A 2XPUA 2FA5A 5IP7J 2ZB9A 2DOEA 3I9V2 2NRAC 1YW9A 3Q3SA 2CO5A 1IUFA 4BGDA 1D0ZA 2DI3A 2BW3B 3L2UA 1YFHA 1ZR4A 2NS0A 3K6GA 3HL2A 1IN5A 2XF5A 1LDKB 4Z6YA 1J7KA 1RPWA 2DA1A 2XRNA 2DT6A 3MAJA 4GCVA 5ED4A 1Z9CA 1O4XA 2JSCA 3S3OA 4DQ2A 1AA7A 4B44A 3MZ8A 1B9NA 3BTIA 2PX9A 4BE1A 5FRNA 2GIVA 2L5QA 4HEA2 4GXOA 1D1BA 5KK1A 2P7VB 2XRLA 3FK7A 5IOZA 2AHQA 1ITYA 1POGA 3BLYA 2XV4S 2MH2A 2ACJA 1QPIA 3A1YA 5BS6A 2A6HF 1MSFC 1QZYA 3KZYA 3A02A 4JX4A 4BE2A 1JTYA 1CF7A 1TC3C 4QWQA 4A3BJ 3GWZA 1FWZA 3DTEA 1VQMI 1Z7LA 4XLFA 2NVTJ 2TRTA 2M4KA 2K9MA 3H3UA 3VSLA 4CHUA 1TBXA 3H9GA 2HQ5A 2KIQA 4A3KJ 3ABMH 2FSWA 2X6YA 3HBLA 3O8HA 4FE7A 5FKLA 5A2QZ 2DA7A 3TEDA 4UUSB 5E3MA 4KITB 3CCEI 2ZJPF 3JRCA 5IYCJ 3LQQA 1BI3A 1IN4A 3CDHA 4RLFA 1O3TA 2JMWA 3TQNA 4ESJA 2CW8A 2K7LA 4A0ZA 2NAZA 3JSOA 4HLYA 1YHQI 2A07F 4LLNA 3ABLH 5DUKA 2HZDA 3BR2A 2DFHA 1IV8A 3P9KA 2BXYA 1BI0A 2O8KA 3A03A 3DKYA 2D5VA 3G4SI 4AVZA 1QU3A 4IEJA 2W48A 1WJBA 2W00A 4PJ0C 3K2AA 2GOMA 1O7FA 1QNTA 2FBIA 4JX6A 5E18F 4L9TA 3T0YA 2V9VA 3P7NA 2XSDC 4KICA 1S72I 2KRCA 2QM3A 3K9TA 1JHHA 2KT0A 2A68F 4LG0B 2MG4A 2O6GE 3OYLA 4U0WA 3ESWB 4Y52J 3MKYB 3D5RC 4RS8A 2NNNA 2CQKA 1WGXA 3FXUA 3OS2A 3I4PA 4AM3A 4UUVA 5EGOA 2Y0MA 5IP9J 5LD2C 2R7UA 3KZIC 1FEXA 2WTEA 1BR2A 3HZJA 1R6RA 3H9JA 5HNFA 1IV6A 4RB0A 2DDAA 3BQYA 1FYMA 3ZRGA 3ZOBA 5D5UB 2GXBA 2A05A 5B1BH 3KLOA 4I98B 2XAUA 1E2XA 3PM1A 1A35A 1XD7A 5GAEJ 2D1HA 5HS8A 1FMWA 1A31A 1IRXA 3CC2I 4HX4A 1U5TB 1JXSA 2GM4A 1I39A 1UCRA 3HPHA 3BOQA 4FCYA 4BAYA 4PUSA 5D5VB 4RBOA 3RJPA 3OYNA 1MNEA 2EPFA 4MNUA 5H2FC 1W0TA 2RREA 4XKBA 5DDGA 2L0KA 3VB2A 1VQ5I 3VDXA 2XSJC 2JUGA 4BDYA 3OYMA 1FP2A 2DQRA 2R3SA 1X58A 2C6YA 1DU6A 4N4NB 1KYWA 3REOA 5IT3A 4NQWB 3GYHX 1RIOH 1GVDA 4UVCA 1OMIA 1MDMB 2GIZA 1JHFA 4HBLA 4XNFA 4M73A 2BY3A 2DJNA 1FLIA 2VIXA 3SEQA 4JQFA 4ZYGA 1T39A 3I56I 1DUXC 1EF4A 1FYKA 1R4NB 2H8RA 1JGSA 2HVQA 3ZR8X 2F5CA 4KDPA 4A3IJ 1EKEA 3ASNH 1UELB 3I59A 1Y6IA 4BQNA 4K2EA 3F8NA 1V3FA 5J1UA 2XAGA 4ENMA 2KRHA 2LOOA 2ETHA 3F72A 4XOPA 2A6EF 4A5NA 5GAHJ 1GDTA 4HDVA 2R7ZJ 3DP7A 1F5TA 1XGOA 2Z2SB 4XM3A 3CO7C 4P5OA 3IRRA 2X6XA 2CGPA 2R7WA 2Q8KA 1RETA 5EG0A 4B09A 2QKMB 3ASOH 2R7OA 3BG9A 3TP0A 2M7BA 3JRIA 1ZG3A 4D0PA 1MBHA 2GXAA 2MD0A 4DYRA 2UXXA 2KL4A 3CF2A 5FJ8J 3OYGA 4F55A 2V1NA 2ZNZA 1ZAOA 3CO6C 2XIGA 1X2NA 1GV5A 4NC7A 5F0CA 4E7IA 3B02A 4OINF 4HSTA 2V1DA 3PIPF 5BMZA 2EFWA 1FSHA 2HOEA 1QBJA 3V7SA 1AOYA 2KHMA 1OR7A 4B4CA 1D5VA 3HOVJ 4UY8I 4PZJA 3COAC 3ECOA 1GUUA 3F8FA 2L7ZA 1VI0A 3PUFA 4M6VA 1AKHB 2VODA 4BXUA 3NWSA 3F0CA 3TMOA 1IN6A 1B6AA 1YOVB 3ZMZA 4W1UA 3M1CA 3H36A 5LBQA 1B8IA 4XMYA 2L4MA 1K7AA 4RMNA 1L3LA 1FPQA 3EETA 3BR5A 1DGWY 3HGGA 3D5SC 1EH7A 1L0OC 3FZVA 3JRGA 5LHGA 2PQ8A 1ETQA 2G7UA 3DEWA 2DA6A 2E1OA 3R0JA 4HNVA 2E34A 1OCPA 2EZKA 2FRHA 3HIFA 5C3EJ 4BJTA 2FX0A 1YJNI 4IQJA 1G4DA 1MD0A 2YR2A 1V5EA 1K79A 1OCOH 1UG0A 1OLTA 4LLGF 4RAZA 5M3FJ 5JI6A 2BHYA 5L3CA 2YU9J 2Q0OA 1WPKA 1VQPI 2MABA 3KEYA 4CCNA 1JE8A 3IC7A 2M3AA 3WU1B 3CC7I 1VQNI 2P81A 2BW3A 2IGNA 3KYDB 4BE0A 2MYSA 1DU0A 3G1OA 1H8AC 1XCVA 1W5CC 2JA6J 4HDUA 2X51A 3U1DA 2JVHA 1F4KA 4DYQA 3E6BA 1P2FA 2WB1N 2L9SA 3QU6A 4O6JA 3M7GA 1R23A 3VOEA 3A4CA 3W2VA 2K3PA 2LKSA 1QQIA 2VJ4A 3GXOA 3HRSA 4OMYA 4HA8A 2BVLA 3L2WA 3O2PE 3RDIA 2X6WA 3WTZA 2R5ZB 3S3MA 5LHIA 1OFCX 1AU7A 5J40A 4IL6C 3S17J 2XB0X 3F21A 4G7OF 5J1RA 5HS7A 3NARA 1G3SA 3TDUC 3MEXA 2XUBA 3IKVA 4BJ6C 1IN7A 2UZKA 3GO5A 2HZTA 2K4BA 2UXNA 1A5JA 5CVJA 1GXQA 3BR0A 5JHUA 4UUSA 3VODA 1BIAA 5DEQA 1K4SA 1RR7A 1ZRDA 4HNUA 2VKHA 1WCMJ 4FISA 1KQ8A 1MMGA 1T6SA 1K78B 1UMQA 2OAZA 5K7ZA 5FRMA 1ZRFA 3FK6A 3HOWJ 3TL4X 1LFUP 5HNHA 3DKXA 2LK2A 1T38A 2NOJB 5JFRA 2NS8A 1X3WB 4KYWA 1DQUA 1X3UA 2HR3A 5D4RA 5FLXK 2FQ4A 4XKVA 1BI1A 1PYVA 5B3SH 3DBRB 4E7JA 4ZYEA 3CCSI 1XB4A 1EA3A 2HTSA 4LG0A 1Y56A 3QU3A 4MO7A 4KNYA 3O8GA 2PEXA 1LUJB 1R36A 2IA1A 2HDDA 2XB5A 4B3AA 2VKVA 3HXLA 2HFHA 1MMNA 2V7FA 1V54H 3F3XA 1VQ7I 2ID6A 1Z91A 2QSGX 2L3DA 3S32A 2HQAA 4A3DJ 2DDBA 3QOEA 3ZQ7A 3HRTA 2H27A 3GTOJ 1G59A 2W1OA 1IG7A 2L7FP 3DEUA 3BCBA 2VN2A 3IH2A 2XVCA 3C7JA 4AD9A 4KFCA 1BN5A 3HJEA 1SAUA 2ZC2A 1BOBA 3L2QA 3GTJJ 1U5TA 3DFGA 2P4WA 5D6EA 1U9OA 2K86A 1TT0A 1XG1A 2VQCA 4RAFA 1FYLA 2DT5A 4BY7J 2G9WA 2A6TA 5K5OA 3Q0WA 1IW7F 3S8PA 4XOTA 2B9SA 4RGSA 4PSWA 4A3MJ 2JRMA 3R60A 2VBZA 4CXFA 3I4NJ 3KEOA 4A69C 2MC4A 2WAQA 1BM9A 3KZZA 4ZZLA 5BNGA 5E3OA 3TOAA 3OSGA 2E36A 3K1NA 1K4TA 3S14J 4P1WA 3OYAA 2KZGA 1I6XA 2EQRA 2QWWA 2KRFA 2B0LA 1F36A 3WGIA 1IXRC 3H5RA 4NQWA 3E5UA 3HPGA 1MDMA 2M8EA 4NDLA 5ICEA 2DO7A 2HYJA 3P9IA 2EK5A 3QAHA 3VEPA 1Z67A 4MIMA 3J80K 2IGKA 4RDUA 4GYGA 2EFNA 1FNNA 2MFZA 1N77A 3GZ5A 5EJCA 3RZOJ 2O03A 2DPUA 2W84A 3CUQB 4XR6A 2EZLA 1ZTRA 3NWTA 4YIFA 1RKWA 2IBDA 3CUQC 2O0YA 3GEZA 5K7FA 1DP7P 2VUMJ 2BE5F 4CZCA 5BQTA 3GCMA 2CUJA 3A01B 2BOLA 3Q0UA 1BIBA 5J47A 3R6SA 2ZFUA 3IWFA 2CV2A 1Y39A 1MMSA 4AIJA 4ON0A 3ULQB 5EEAA 1ETVA 1T08B 2A69F 5K1YA 3P9CA 4CCLA 4E7ZA 2LRDA 1HSTA 1MH3A 4OAZA 3WTUC 2UV1A 2LP0A 3GF2A 5CYVA 2L02A 2FD5A 3DBHB 3HOXJ 5IYDJ 1SVLA 4HV6A 4M3GA 4WWCA 1V4RA 3RKYA 5ICGA 3RKQA 1YYVA 4HOBA 3QPSA 5EYRA 1HXDA 5FKOA 2OZ6A 4EMSA 5EDNA 3LSRA 2E5NA 1XSXA 1AKHA 3PQKA 1F1ZA 3K1PA 4LB5A 1MH4A 2G0EA 1R5ID 2OJED 2CW0F 4MQVA 1QPMA 3W6VA 3Q9SA 1FOXA 1OPCA 2STTA 1FIAA 2HOSA 3MZYA 4E6KG 1QO0D 2V9PA 4YFXF 5CLSA 2GXGA 1I1GA 5EEHA 2EFQA 1P6RA 6PAXA 2YS9A 1XCBA 1Y8QB 2K4JA 4IRIA 3AG2H 4L5IA 2CUFA 1R7JA 4CUGA 3E5XA 3V42A 2JA8J 1P7JA 4IF4A 4DIQA 3A0HC 4BQQA 4FASD 1S3JA 4M9ZA 5GP9A 2XROA 2KDZA 1VFCA 2PMHA 1X4PA 2J5PA 2B63J 2BYVE 5JLWA 1X4OA 4DBQA 1HKSA 2KIMA 2OBPA 3IAM2 1HKQA 2ISYA 5F64A 1NHAA 2CU7A 2KLOA 4P9FA 1D3YA 2RNJA 3B6CA 4ZTJA 2RN7A 4FTHA 2MH9A 5AONA 3PO2J 4MHGA 3IKTA 1ZHFA 2VJIA 5FKKA 4XICA 4BUPA 2A5YB 4HAMA 3HG9A 2DA5A 4WXCA 1MBKA 2M2EA 4C30A 4J01A 2R7TA 2GOXB 3HSEA 4GFBA 1X1BA 5B1AH 2ECCA 2R92J 3V8KA 3C1DA 4RAGA 3OYJA 2AQEA 2K40A 1ZH5A 4U0YA 3PL8A 4OMZA 1RKTA 2HPIA 3E0JB 3PNYA 3JTGA 3F22A 3OYCA 1IRZA 2R5ZA 3DTKA 3BY6A 3ZP5A 1LKXA 3WU0A 1F9NA 3HOTA 3PUBA 4IRHA 1D0XA 2LY9A 3PFYA 1NH3A 3L00A 1FOWA 4AIKA 4J19A 1XSDA 2H1LA 4LD5A 5F6FA 2CQXA 1QZZA 1OISA 1WJ5A 3HGYA 4RB2C 3PNVA 3CMAI 2ZJQF 2L54A 3IRQA 2EZIA 3DF8A 2RQPA 4PFPA 2HDCA 3D1NI 1HC8A 2DYRH 2NNYA 4LIUA 2UUZA 2UWMA 1K78A 1XGNA 1XN7A 5AIPA 2R7DA 2JJ7A 5D5WB 3K4MA 4U7DA 3NAUA 3G6EI 3U2RA 3DBLB 1XMAA 4DGWB 4FX4A 1OYIA 2EA4A 4E7KA 4EJTA 4L5JA 2ME0A 4IJAA 3LAPA 2IA0A 2X4HA 2KIFA 1JUPA 2O3FA 2AXLA 4P9UA 1ZLKA 1Z7UA 1LEAA 3LFKA 1UZCA 2VASA 5C44J 2CV1A 4D5CA 3VYTB 3B6AA 5DCMB 3ISPA 4D5FA 1HDPA 1YS6A 2EINH 2DN0A 2LTPA 5JLXA 1T95A 3M1EA 5E1XA 5HODA 4EM2A 4EQQA 3I53A 4RA2A 2WADA 3ABUA 2QUFA 2A5WA 2IAIA 4IX7A 1T8IA 1USTA 2HOTA 1ZYRF 3E6DA 5GPCA 4S04A 4ZDLA 1YIJI 1TNSA 4QIWN 2ELHA 1OJLA 3K10A 4RLQA 1I3QJ 4Z2YA 3VYUB 1V55H 3LQRA 2ZXIA 4YFNF 3BROA 3IHUA 1YITI 2R7FA 4N9HA 1ENHA 1TNTA 3DXJF 1ON1A 5J4YA 2CQ7A 2DK5A 4L0ZB 4A0YA 1W36D 3MVPA 3CUOA 1SANA 3CQZJ 2R7RA 3MQ0A 3LAJA 2K9NA 1HCRA 4OOIA 3LNQA 3KPHA 5HS9A 2OPTA 2FMYA 5E3LA 2M5WA 1E3HA 2H6BA 2L9RA 2PFBA 2H09A 5IOYA 2DMQA 3C2BA 2MA3A 1B72B 1LDJA 1SD6A 3FDYA 3KP2A 4BNCA 2X0LA 3MD2A 2GBYA 2JA5J 1BW5A 3CC4I 1FZPB 1H0MA 3CMEI 2QQ9A 2K9SA 4W97A 3L2CA 1TTYA 4PGHA 4BXFA 1NG6A 2R7XA 3BTLA 2FQ3A 3KP7A 5GTIC 2R7VA 4Y7NJ 5FLXZ 1Z1DA 4UV9A 1NG7A 4HYEA 4DW6A 2ZO4A 1SFUA 1BL0A 5DYMA 3T1BA 1Q1HA 1A6QA 4CH7A 1Z21A 3CUQA 2EV5A 3OIPA 2EJRA 5TRDA 4AYBA 2VQLA 3FF5A 3S1MJ 4QTRA 2LNBA 4AYBN 1OCCH 2QVOA 4L18B 1S7AA 1FBSA 2Y48A 3A01A 2ZSHB 4XRSG 5CVUA 2DLLA 3DU6A 2EIKH 2XF6A 2EA2A 1R1VA 4I09A 1A6IA 1B1BA 2IJLA 2RKHA 4ETSA 1B4AA 3HDDA 2JSPA 4LG3A 2PN6A 3LA2A 4IHVA 3LSJA 5E79C 2QENA 1R4MB 1JI8A 2V1UA 3GTGJ 2IXSA 3FX3A 3BR1A 5DM6F 3DV8A 2K02A 1GVJA 5FO5A 2FNAA 2OTJI 3CJNA 5LRRA 2P6TA 3Q5FA 4AWXB 2QQ8A 3ZMTA 3FXKA 3TP3A 4MLOA 1XMKA 1RC9A 4XLAA 4PCQA 2BY0A 3Q0VA 3FKJA 2DMPA 4GO1A 1ETYA 3F8MA 3TO6A 3BG3A 4F52A 4KMFA 4XSXF 2PG4A 2AS5F 5L3EA 2FJ1A 2LKXA 2LDUA 2HDWA 2EBIA 5FKNA 2KFDA 3ZCOA 2VONA 3CLQA 2GA2A 3BDDA 4OIPF 4M3BA 5F04A 3BR3A 1C0WA 4P96A 5HVQC 4IHYA 2ZXWH 3JTHA 3L7WA 1LDDA 1TQPA 3JRAA 1HOMA 4DZPA 1QZEA 1HA8A 1MNMC 4KISA 5FD6A 4XORA 1U9NA 2RNGA 3J80Z 4C3HJ 1XSVA 4Y3OA 5KCMA 5KVRA 5EZGA 2E60A 3VYRB 3HUGB 3I5UA 4ENJA 2XAJA 1J9IA 3TW7A 2JVGA 2ZKZA 1RR8C 2W85A 1SFXA 4U7BA 2WWYA 3MMYB 1U2WA 4NC6A 2IP2A 3HTSB 3LWFA 1E3PA 2DTRA 2D2WA 4A0XA 1YRNB 3RIRA 3EDPA 2RVCA 2Y9YA 3HSRA 5M5YJ 3K1MA 3FHNA 3LFUA 1D0YA 3H1CA 5GADJ 2VL8A 3V7RA 1YIOA 2L4AA 1MJAA 2CH0A 2W7NA 2DFIA 2L9VA 2ZMEC 2HXOA 1KU3A 3BTJA 4KA4A 4LLLA 4AC0A 4G8XA 3FXRA 4XLHA 1MGTA 3K4NA 5BPDA 1RESA 3ZGKA 3OS0A 3NEUA 1YLFA 4M74A 4C2MJ 3ZN0A 1KGSA 1ZK8A 2OCCH 2HKOA 1Y8RB 2FEZA 1I6HJ 2DOFA 2VE9A 4Q5SF 1BOAA 3DLAA 4LMYA 4I76A 5ILSA 1W4MA 3QPTA 4L9VA 2IEKA 1IDZA 4G7ZF 1JT0A 3RYPA 3S93A 3HTUA 4A93J 2ZNYA 4WF2A 3ROUA 3CMMA 1RZ4A 1QGPA 3DLLF 3D5LA 3CCRI 2K27A 4CYCB 3E97A 1N25A 3EUKL 2NS7A 2I10A 3BQZA 1G8XA 1T98A 1WSUA 1JT6A 1Z6TA 2JWTA 2Y0SA 1WKMA 4DNCA 4A3EJ 1WVRA 5CQEA 2Y0SN 3RPUA 3CDIA 2B7EA 2CFOA 5ICFA 3FM3A 4YFKF 2F4OB 2FXAA 2WB1A 1LE8B 3WTTC 4RB1A 4C9YA 3FHZA 2HVRA 1TZLA 2L9NA 1MSEC 1R1UA 2V1XA 2M8GX 3FMQA 5E17F 3GUDA 2JA2A 2P0WA 5F1RA 3FBIB 1HDDC 2W82A 2VBXA 5DCMA 2R5YB 3L1PA 5DTDA 5J4VA 4B47A 5KNLA 2CSOA 3ELKA 3AG4H 3OOUA 4J00A 3HOYJ 1LB2A 3FXJA 5JVTA 3WTVC 4BHBA 1XS9A 3FIWA 3I3LA 4X1EA 3CCMI 4RGUA 3EUHC 1TP4A 3J81K 3JAMK 1KU2A 1HW1A 1FOYA 2ZSIB 1NTCA 1DPUA 1QRYA 2DK8A 2CJJA 2VE8A 5KHDA 1KU7A 2WV0A 1ZGAA 4F93B 2K5CA 1U3EM 4KT5C 4U88A 2EZHA 4HNTA 4LGWA 1ODDA 3CF5F 1B9MA 4UV8A 2HPMA 5KAFC 4XN0A 4BS9A 4M71A 2NVYJ 2P6SA 4YIIA 5F1JA 5E1ZB 4B43A 5FFXA 3KFWX 2XPVA 3PFIA 5TISC 1G2HA 1Q1VA 3ABKH 5CVVA 1FTZA 2ZXHA 3G71I 3TOBA 1WH7A 1IF1A 3JREA 2E1NA 1X1PA 3GTPJ 2W4SA 2WAFA 2E7XA 3RQ4A 1SEUA 1GLNA 1QVTA 4BKXA 3BJAA 1B72A 4IOAF 2OU2A 3HHGA 3RCOA 3ZQQA 1FMVA 3V7CA 2CFXA 1MNDA 2VOOA 1QHHD 1X2MA 1R5HA 3WE2A 3AAFA 4I02A 4KMUX 1YX3A 2HYGD 1P92A 4ZZDA 4HF2A 1VZ0A 4PDKA 1FY7A 3GZNB 4AU7A 3H92A 4BU2A 5F0HA 2CQQA 2ELJA 2LREA 3I64A 4MFDA 4OWRB 1AHDP 3R4KA 3JRDA 3QPHA 4I0BA 5K7HA 3HOUJ 1ZG1A 4AVPA 1IGNA 3ZQHA 3MCZA 4BHCA 1ONVA 4XKCA 5LGTA 2V6CA 1T33A 2QEXI 3LA7A 2AO9A 4HX8A 1HQCA 1K6YA 1XC5A 3CZ6A 3SZGA 2HS5A 4A5MA 2HXIA 2HEOA 5D8KB 1NK2P 1TWCJ 2M0MA 2YUSA 1FIPA 3GZ6A 3S1NJ 3WHCA 2ID3A 2IRFG 2AXTC 2M87A 1FT9A 5JVGF 1W7PB 2VB6A 2DJIA 2XKPA 3S2DJ 4NHJA 4JX5A 4DOZA 3H3VK 5L3FA 2STWA 5LGUA 4MEYF 1EJ9A 3G1MA 3OSFA 2BGCA 3RQIA 2BZTA 2LH9A 4DJAA 3IH3A 1FP1D 3H35A 1PP8F 4U87A 4AIDA 2Z9OA 3F23A 5HLIA 4HLXA 1WH5A 1Z3YA 1HKTA 2EFPA 2E7WA 2CUEA 2VT2A 1WJAA 3EUAA 4BYYA 2OV7A 3ERMA 3A2KA 1ACIA 2EFOA 2XPWA 1D8KA 1B59A 1XTAA 3ZQFA 2FU4A 2YSRA 1SFEA 3O6BB 4PJNA 3CCVI 3L09A 2FUG2 1VQ9I 4JYKA 3CP2A 3SJMA 2FNPA 4N4OB 1E17A 5BOXA 4RGXA 2MGQA 5E20A 5L3DA 3U9GA 2RGVA 1MKMA 2LYCA 1KQ0A 3JCUC 1JKPC 4UB8C 1KU9A 4ENNA 3HRMA 1R5GA 5D8LB 4KT6A 1LNWA 1BBYA 3BTCA 4BY1J 2DW4A 4CYDA 3ZQIA 1N75A 4CA0A 4KUMA 1K6OA 1PJRA 2F48A 3RKXA 2LFBA 2OZUA 2OQGA 2PJPA 4IXAA 1F43A 5J3LA 3V8JA 1G3YA 4FHTA 2VC0A 4HZFA 2XC7A 2JK3A 2IA2A 2VOPA 4C2TA 3CCYA 2VC1A 4JK1X 5EZHA 4A3JJ 2DFEA 4PK4A 5TJJA 1CQTA 3TO7A 1T0FC 1S9HA 1E3OC 3BG7A 3BZ6A 3S1QJ 3KE2A 3C2HA 1X3ZB 1NK3P 2FE3A 2H94A 2EV6A 3G3ZA 3HUGA 4O3MA 1XPXA 1X1CA 1D5YA 2L2OA 2XGEA 4BQOA 1VQ8I 4FETA 1H9TA 3K4JA 3ZMDA 1MBGA 4Y15A 3GFJA 4QPQA 4UVAA 4NUBA 3K70D 1TW2A 5E1WA 2VBYA 1Y0UA 2P7CB 1LFPA 3PSIA 4C3JJ 1I3AA 5JHFA 1YRNA 3HYIA 3HM5A 4IRGA 1XDUA 4N0BA 4S05A 2DPDA 1KYZA 2VJ5A 4GDFA 4C3IJ 3FXMA 5IT9Z 4I7HA 4X6AJ 4FE4A 2G7HA 4O5VA 1W5SA 3DKWA 3H0DA 3RKWA 4G6DA 2Y31A 2JPCA 3RZDJ 1YW8A 2R4GA 3WGHA 2O5RA 4HQMA 3HOSA 1IXSB 3ZMSA 4XRSA 4IHTA 4BQAA 2V26A 4A6DA 3QP6A 5ICCA 4A2UA 1J2XA 1BC7C 1SVOA 2Z16A 1JJ6C 3LSKA 2XF7A 2JN6A 4RAYA 3W2AA 2H1KA 1LFBA 5HDNA 2ME6A 2VQHA 2JUCA 1Y1WJ 4MEXF 3MZHA 1QVUA 4CZZA 1ZKGA 2VLAA 2VXZA 1BR1A 3G2BA 3F8BA 3N05A 4BACA 2WC2A 1ZQ3P 4H4KC 2LR8A 4M3EA 4CYCA 3SDGA 4BDZA 4CSWA 4IKFA 2CW7A 3D0SA 3K4BA 2QQBA 1MIJA 1LVAA 2XAFA 4CDGA 4EJUA 4M6YA 2ZJRF 3E6MA 3OIQA 3FISA 2KQRA 5M5XJ 3JRFA 3L9FA 2R7SA 1S8NA 1MBEA 1ZARA 2F4IA 3OOPA 4XN3A 2BV6A 3I55I 2O9LA 4RM2A 3LSPA 1X19A 2EV0A 3RPQA 2Y9ZA 2IT0A 2PJRB 1OYWA 3ML6A 3AG3H 2Q1ZB 1LJ9A 2X48A 4HRIA 1EH6A 1PUFB 5M5WJ 1ORKA 1BJZA 3QYFA 3GTKJ 4EV0A 4I6ZA 2O7OA 1LE8A 4L5EA 4L9NA 2FBHA 4BJ5C 3MKLA 4YELA 4ZDPA 2OCEA 1YJWI 2LY2A 3G73A 1PUEE 2IPQX 3KYLA 2EILH 2ZBKA 4A6EA 1H89C 4EM0B 2YX4A 4E70A 4EJOA 4MFEA 4ZC3A 2W24A 4KIFA 2R5YA 3M8FA 2DMUA 3KP3A 3QWLA 2HNHA 1MJBA 2QZ8A 4FT8A 5L3GA 3EUHA 1D8JA 1YX5A 4MGRA 3RSNA 3H5AA 3EYYA 1OR7C 1IRGA 1H9GA 2MLKA 2DCEA 2W25A 2ZFWA 1R00A 3BJ6A 3RI4A 1JJ8C 4OIQF 2BY2A 4UHTA 5DV5A 2WV1A 2R0QC 2RDPA 4UXNA 3DCFA 3E6CC 3DWLE 2YU3A 3ECHA 2HGCA 2BVMA 2JA7J 3FXQA 4MTEA 1RI7A 2M34A 4PJLA 1VQOI 4Y17A 1BI2A 2GAUA 3M8EA 1ZN2A 3CP8A 1J59A 1GHCA 3CJRB 4G9YA 2I8DA 3J7YJ 3WTYC 2NVUB 3I54A 2F6CA 1ETWA 5HDKA 4BBSJ 2RQQA 1KONA 1X1AA 3OYIA 1WJCA 5H6RA 4E7LA 1KZHA 1R1TA 2F5VA 3OMYA 1STZA 3LSIA 4UUTA 5H6QA 4HSRA 4ENKA 4ESFA 2BXZA 4PJJA 3S2WA 4CCJA 2E1MC 1VNDA 4BBRJ 1I50J 1E0EA 3OIOA 3SZPA 4XK4A 2DOAA 2F5FA 2QSHX 4LJZF 1OKRA 4V2FA 1W0UA 3MN2A 2KIUA 1IO2A 3I71A 3QP5A 1ZRCA 1ON2A 4M6XA 1FC3A 1I5ZA 3SZTA 1TWAJ 1CGPA 1LQ1A 4OIOF 3OL4A 3W6KB 4XSZF 1IAWA 5F27A 2NVQJ 3J7ZI 1JTXA 1MZBA 2L7MP 4D1QA 4S0HB 1H88C 2ELKA 3NRVA 4E7HA 5BPIA 1TT5B 1D1AA 2IGOA 3ZQCA 1WRJA 2Y75A 2PLYA 3JR9A 1MBJA 3BC8A 1W7PA 2XAHA 1TL8A 2GWRA 1K61A 3J81Z 3JAMZ 1DP3A 4KN4X 3C3WA 3F8CA 2WY8Q 4ABZA 4G7HF 1HW5A 3WG7H 4II3A 3ABTA 2X9DA 3S2HJ 3E3VA 4Y4RA 4PGGA 4I99C 4AIHA 2I5UA 4IPAA 1XMXA 4ZH4F 1WHUA 1UB9A 2BY1A 4BEHB 4BH9A 1X1DA 2H6CA 3OR2C 2DU9A 1DDNA 2NVXJ 3TBIA 2CV0A 2KISA 4ZYDA 3HHHA 2FMLA 2KPMA 2E2IJ 1TQMA 3KYCB 5DUIA 4JOMA 4LOCA 1UJ8A 3BG5A 1TWHJ 2WA0A 4DYCA 4HQEA 1W36C 4L0YB 2IS2A 2Y2ZA 3GMEA 5HDGA 2K9LA 2MLGA 5LEKA 1J09A 3RTRA 4OU0A 3CCLI 4C2UA 5LEJA 2DODA 2DQLA 3KX2A 1JGGA 4ZYAA 3VYSB 1HBXG 3FMSA 1S6LA 3CJTB 1PDNC 2DBBA 1JKRC 5B5EC 2KDOA 3GW2A 3N97A 2LF8A 2O8XA 2HYFA 2JPBA 2DTZA 3LMMA 2MBFA 1ZGJA 3S3NA 4V19K 2F5DA 5AIQA 1T0FA 1IRFA 3WU2C 3ZMVA 4XIDA 1YJ9I 2DA4A 3KP5A 2QF7A 4Q48A 5DCFA 1HLVA 2QBYB 3ZPLA 3UNGC 3K4LA 1JUSA 1UHMA 4WCGA 3LL7A 4B1RA 2EIJH 1FX7A 4OAYA 5J8CA 1FSEA 1WJDA 1VF9A 2X6OA 3O3KA 5IT9K 4GRIA 2V79A 4F3QA 2M0CA 2DA2A 2M30A 2ISZA 3WHBA 2VKEA 4A3CJ 3H5NA 4ASNA 2EIMH 5KAIC 3TDZC 2IS6A 4WK8F 4V2GA 1U0JA 1U5TC 2HQNA 4QLCU 4Y13A 5EEGA 3F9KA 3Q9VA 2QCOA 1VQ4I 2YPRA 4B48A 2BHZA 3E5QA 1IUYA 3CJQB 2EH3A 5JR3A 1S7EA 1GT0C 5FGMA 3JSPA 4XQFA 2FBKA 3C2GA 3CDLA 2CUZA 3GLXA 2HVSA 4UB6C 4UNOA 3C18A 1IN8A 3K69A 4B3XA 4EGYA 1U8RA 2LD5A 3OYHA 3BP8A 1DGRM 5LLQA 2HOAA 3CD6I 4IOCF 2LMDA 4LFUA 2VJJA 3L2VA 2OD5A 4R1HA 2COBA 3LSHA 3MKWB 1Z3XA 5HLGA 4KJZA 4D7MA 2VXDA 1LEBA 4WXDA 3SYTA 3DTIA 1O7LA 1G3TA 2R93J 2DMNA 2CRGA 1USSA 1IDYA 3SFZA 5E8GA
chains in the Genus database with same CATH topology
5F08A 3M3YJ 1WH7A 3QQAA 2XRLA 3FK7A 5IOZA 3JREA 3RKQA 1IC8A 2AHQA 3GTPJ 3QPSA 1ITYA 1POGA 5EYRA 5FKOA 1QVTA 4BKXA 5EDNA 5C4JJ 1QPIA 1B72A 3LSRA 1MSFC 1AKHA 3A02A 4JX4A 1JKOC 1JTYA 1TC3C 1MH4A 2G0EA 4A3BJ 1T56A 3GTLJ 2NVTJ 1X2MA 2TRTA 3W6VA 9ANTA 2M9HA 1PUFA 2HQ5A 4A3KJ 1FIAA 3HBLA 3O8HA 1P7IA 4FE7A 2HOSA 4JP0A 5FKLA 2DA7A 3TEDA 4UUSB 5F0HA 2CQQA 4MFDA 5GPAA 5E3MA 1ZR2A 1AHDP 1IJWC 1ETXA 3JRDA 3JRCA 3HOUJ 5K7HA 5IYCJ 5FLMJ 1IGNA 2YS9A 5DS9A 3ZQHA 2JMWA 1T33A 2CUFA 2AO9A 2OF7A 2JA8J 1P7JA 1XC5A 2VPRA 1ZGWA 3BR2A 2HXIA 5GP9A 2KDZA 1VFCA 2O8KA 3A03A 1NK2P 1TWCJ 2D5VA 2B63J 5JLWA 4IEJA 2YUSA 2W48A 1FIPA 3S1NJ 3WHCA 2ID3A 3K2AA 3HB9A 3PO3J 3GTMJ 3S2DJ 2MSYA 3ZQLA 2CU7A 4JX5A 3H3VK 4JX6A 1UG2A 2XSDC 1UHSA 3G1MA 3OSFA 3B6CA 3RQIA 2KT0A 2MG4A 3ZQGA 4FTHA 3PO2J 3IH3A 2LVSA 5FKKA 4Y52J 4XICA 3G1LA 2DA5A 1WH5A 1U78A 1MBKA 2M2EA 1WGXA 2CUEA 4GFBA 1JKQC 3GTQJ 5EGOA 5IP9J 2ECCA 2XPWA 2R92J 1FEXA 3ZQFA 1IV6A 3IH4A 2K40A 3BQYA 4JYKA 3ZOBA 3SJMA 1RKTA 3HEFA 2MGQA 3S15J 3PM1A 1JKPC 2E19A 1IRZA 4AUXA 2R5ZA 3BTCA 2GM4A 4BY1J 2LY9A 3ZQIA 4G12A 4FCYA 4XRMA 4J19A 2LFBA 4D7NA 1F43A 2LLKA 1JUMA 4RBOA 5J3LA 2CQXA 1W0TA 3HGYA 2JK3A 2L0KA 3CCYA 2EZIA 1OCTC 5EZHA 4A3JJ 1CQTA 3D1NI 1E3OC 1TWGJ 3S1QJ 4QSHA 2JJ7A 1X58A 4IHWA 1DU6A 1NK3P 2XGCA 2TCTA 1GVDA 3NAUA 1D5YA 2XGEA 2DJNA 2ME0A 3JRBA 1JUPA 1MBGA 1EF4A 2H8RA 3LOCA 5C44J 4D5CA 4C3JJ 3B6AA 4A3IJ 1YRNA 2NOGA 3HM5A 4D5FA 1FTTA 1HDPA 2DN0A 2LTPA 5J1UA 5JLXA 4A3LJ 3BR6A 5HODA 4C3IJ 1GDTA 2R7ZJ 4FE4A 4X6AJ 2IAIA 2HOTA 3M4OJ 5E3NA 2Y31A 5GPCA 3RZDJ 1APLC 4QIWN 2ECBA 1OJLA 2PMZN 4XRSA 1RETA 5EG0A 1I3QJ 1BW6A 3BG9A 3TP0A 3JRIA 1JJ6C 2E2HJ 2JN6A 1MBHA 2RAEA 2H1KA 1LFBA 1ENHA 4DYRA 2ME6A 5FJ8J 1Y1WJ 1QVUA 2DMTA 1ZKGA 3MVPA 1X2NA 1GV5A 5F0CA 1ZQ3P 1HF0A 1SANA 2LR8A 3CQZJ 3FKIJ 4M3FA 4M3EA 3SDGA 4CYCA 2K9NA 1HCRA 2N8GA 4B4CA 3LNQA 2OPTA 3HOVJ 5E3LA 2L9RA 3FISA 5IOYA 2DMQA 3C2BA 5M5XJ 3JRFA 1GUUA 1U8BA 1MBEA 2L7ZA 1B72B 3VPRA 1VI0A 4M6VA 1AKHB 2O9LA 3LSPA 2HI3A 3F0CA 2Y9ZA 2GBYA 2JA5J 1BW5A 4W1UA 1B8IA 4DZJA 2X48A 1PUFB 5M5WJ 5C4XJ 1ORKA 3BR5A 1BJZA 3GTKJ 2K9SA 4W97A 3HGGA 4I6ZA 2O7OA 1LE8A 4A3GJ 4L5EA 3S16J 3MKLA 3BTLA 3JRGA 1ETQA 4Y7NJ 5FKMA 3DEWA 1H89C 2DA6A 2E1OA 4DW6A 4HNVA 1BL0A 1OCPA 2EZKA 4MFEA 5C3EJ 2FX0A 3SFIA 2R5YA 2DMUA 1Z77A 5J1YA 1ETKA 3S1MJ 3IV5A 4QTRA 4AYBN 5M3FJ 2YU9J 1WPKA 2WAQN 3A01A 4XRSG 2P81A 1JJ8C 1A6IA 1ETOA 2WV1A 2R0QC 1DU0A 3G1OA 1H8AC 3BT9A 3HDDA 3DCFA 3H0GJ 1Z0XA 2JA6J 4IHVA 2JA7J 3LSJA 4DYQA 2WB1N 3GTGJ 2M34A 3BR1A 1SFOJ 5EGOB 4M3DA 4IHXA 3TP3A 4MLOA 4A3FJ 1ETWA 3Q0VA 4BBSJ 2DMPA 1ETYA 2R5ZB 3BG3A 2DA3A 1OFCX 1AU7A 3S17J 2FJ1A 2XB0X 4UUTA 2LKXA 3QPLA 5J1RA 5FKNA 2EBIA 1VNDA 4BBRJ 1I50J 3NARA 3OIOA 4M3BA 5F04A 1GV2A 3BR3A 4XK4A 4IHYA 1A5JA 3JRAA 4V2FA 1W0UA 3MN2A 1HOMA 3BR0A 2VI6A 4DZPA 4UUSA 1MNMC 1U9NA 3K7AJ 2MW8A 1TWAJ 1RR7A 2XGDA 1WCMJ 4C3HJ 4FISA 1WI3A 1UMQA 5F27A 5EZGA 5IYBJ 2NVQJ 5K7ZA 1JTXA 3GBGA 2L7MP 3FK6A 1BA5A 3HOWJ 4S0HB 1H88C 2ELKA 1LFUP 2LK2A 2NS8A 3TW7A 3ZQCA 3JR9A 1MBJA 2FQ4A 5M3MJ 5IP6A 1K61A 2GLOA 3HKZN 1YRNB 4ABZA 2Y9YA 5M5YJ 2X9DA 3S2HJ 1Y1VJ 4MO7A 3O8GA 2HDDA 2XB5A 4B3AA 2NVXJ 2HXOA 2VKVA 3BTJA 1MBFA 4AC0A 5F0FA 2ID6A 2E2IJ 1R9TJ 3LSGA 1RESA 4A3DJ 4C2MJ 4LOCA 5EG0B 1ZK8A 3BG5A 1TWHJ 4DYCA 3GTOJ 3E7LA 1IG7A 1I6HJ 2L7FP 3IH2A 2Y2ZA 4I76A 3S1RJ 2IEKA 1IDZA 1JT0A 3TW6A 2K9QA 3GTJJ 4A93J 1JGGA 1U9OA 1JKRC 1XG1A 4CYCB 3HOZJ 2DTZA 2NS7A 2I10A 3BQZA 4BY7J 3Q0WA 4A3MJ 1JT6A 2JWTA 4XIDA 3I4NJ 4A69C 4BXXJ 3JRHA 4A3EJ 2DA4A 5BNGA 2QF7A 1HLVA 5E3OA 2Y0SN 3OSGA 3S14J 1B8IB 1JUSA 2EQRA 4B1RA 1F36A 3CMYA 3UKGA 1VF9A 2X6OA 1LE8B 2M0CA 2DA2A 4NDLA 2E2JJ 2HYJA 3WHBA 4MIMA 3I4MJ 5FLVA 4RDUA 1MSEC 2M8GX 2VKEA 1HDDC 4A3CJ 3RZOJ 1TWFJ 4EEFG 4V2GA 3L1PA 2R5YB 5DTDA 2EZLA 3OOUA 1ZTRA 1RKWA 2Y30A 3HOYJ 2QCOA 5IPAA 2IBDA 2EH3A 1S7EA 1XS9A 1GT0C 5K7FA 3FIWA 1FJLA 4X1EA 1K83J 2VUMJ 5EF6A 2XPUA 3A01B 3CDLA 3Q0UA 5IP7J 2ZB9A 1NTCA 3Q3SA 1QRYA 1IUFA 2CJJA 2LD5A 1ZR4A 2HOAA 5EEAA 1ETVA 2COBA 2EZHA 4D7MA 1MH3A 1RPWA 2DA1A 1O4XA 2LP0A 2NVYJ 5F1JA 3HOXJ 2FD5A 2XPVA 5IYDJ 1G2HA 2R93J 2DMNA 1Q1VA 4M3GA 2CRGA 1IDYA 3BTIA 1FTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F08 A;  3M3Y J;  1WH7 A;  3QQA A;  2XRL A;  3FK7 A;  5IOZ A;  3JRE A;  3RKQ A;  1IC8 A;  2AHQ A;  3GTP J;  3QPS A;  1ITY A;  1POG A;  5EYR A;  5FKO A;  1QVT A;  4BKX A;  5EDN A;  5C4J J;  1QPI A;  1B72 A;  3LSR A;  1MSF C;  1AKH A;  3A02 A;  4JX4 A;  1JKO C;  1JTY A;  1TC3 C;  1MH4 A;  2G0E A;  4A3B J;  1T56 A;  3GTL J;  2NVT J;  1X2M A;  2TRT A;  3W6V A;  9ANT A;  2M9H A;  1PUF A;  2HQ5 A;  4A3K J;  1FIA A;  3HBL A;  3O8H A;  1P7I A;  4FE7 A;  2HOS A;  4JP0 A;  5FKL A;  2DA7 A;  3TED A;  4UUS B;  5F0H A;  2CQQ A;  4MFD A;  5GPA A;  5E3M A;  1ZR2 A;  1AHD P;  1IJW C;  1ETX A;  3JRD A;  3JRC A;  3HOU J;  5K7H A;  5IYC J;  5FLM J;  1IGN A;  2YS9 A;  5DS9 A;  3ZQH A;  2JMW A;  1T33 A;  2CUF A;  2AO9 A;  2OF7 A;  2JA8 J;  1P7J A;  1XC5 A;  2VPR A;  1ZGW A;  3BR2 A;  2HXI A;  5GP9 A;  2KDZ A;  1VFC A;  2O8K A;  3A03 A;  1NK2 P;  1TWC J;  2D5V A;  2B63 J;  5JLW A;  4IEJ A;  2YUS A;  2W48 A;  1FIP A;  3S1N J;  3WHC A;  2ID3 A;  3K2A A;  3HB9 A;  3PO3 J;  3GTM J;  3S2D J;  2MSY A;  3ZQL A;  2CU7 A;  4JX5 A;  3H3V K;  4JX6 A;  1UG2 A;  2XSD C;  1UHS A;  3G1M A;  3OSF A;  3B6C A;  3RQI A;  2KT0 A;  2MG4 A;  3ZQG A;  4FTH A;  3PO2 J;  3IH3 A;  2LVS A;  5FKK A;  4Y52 J;  4XIC A;  3G1L A;  2DA5 A;  1WH5 A;  1U78 A;  1MBK A;  2M2E A;  1WGX A;  2CUE A;  4GFB A;  1JKQ C;  3GTQ J;  5EGO A;  5IP9 J;  2ECC A;  2XPW A;  2R92 J;  1FEX A;  3ZQF A;  1IV6 A;  3IH4 A;  2K40 A;  3BQY A;  4JYK A;  3ZOB A;  3SJM A;  1RKT A;  3HEF A;  2MGQ A;  3S15 J;  3PM1 A;  1JKP C;  2E19 A;  1IRZ A;  4AUX A;  2R5Z A;  3BTC A;  2GM4 A;  4BY1 J;  2LY9 A;  3ZQI A;  4G12 A;  4FCY A;  4XRM A;  4J19 A;  2LFB A;  4D7N A;  1F43 A;  2LLK A;  1JUM A;  4RBO A;  5J3L A;  2CQX A;  1W0T A;  3HGY A;  2JK3 A;  2L0K A;  3CCY A;  2EZI A;  1OCT C;  5EZH A;  4A3J J;  1CQT A;  3D1N I;  1E3O C;  1TWG J;  3S1Q J;  4QSH A;  2JJ7 A;  1X58 A;  4IHW A;  1DU6 A;  1NK3 P;  2XGC A;  2TCT A;  1GVD A;  3NAU A;  1D5Y A;  2XGE A;  2DJN A;  2ME0 A;  3JRB A;  1JUP A;  1MBG A;  1EF4 A;  2H8R A;  3LOC A;  5C44 J;  4D5C A;  4C3J J;  3B6A A;  4A3I J;  1YRN A;  2NOG A;  3HM5 A;  4D5F A;  1FTT A;  1HDP A;  2DN0 A;  2LTP A;  5J1U A;  5JLX A;  4A3L J;  3BR6 A;  5HOD A;  4C3I J;  1GDT A;  2R7Z J;  4FE4 A;  4X6A J;  2IAI A;  2HOT A;  3M4O J;  5E3N A;  2Y31 A;  5GPC A;  3RZD J;  1APL C;  4QIW N;  2ECB A;  1OJL A;  2PMZ N;  4XRS A;  1RET A;  5EG0 A;  1I3Q J;  1BW6 A;  3BG9 A;  3TP0 A;  3JRI A;  1JJ6 C;  2E2H J;  2JN6 A;  1MBH A;  2RAE A;  2H1K A;  1LFB A;  1ENH A;  4DYR A;  2ME6 A;  5FJ8 J;  1Y1W J;  1QVU A;  2DMT A;  1ZKG A;  3MVP A;  1X2N A;  1GV5 A;  5F0C A;  1ZQ3 P;  1HF0 A;  1SAN A;  2LR8 A;  3CQZ J;  3FKI J;  4M3F A;  4M3E A;  3SDG A;  4CYC A;  2K9N A;  1HCR A;  2N8G A;  4B4C A;  3LNQ A;  2OPT A;  3HOV J;  5E3L A;  2L9R A;  3FIS A;  5IOY A;  2DMQ A;  3C2B A;  5M5X J;  3JRF A;  1GUU A;  1U8B A;  1MBE A;  2L7Z A;  1B72 B;  3VPR A;  1VI0 A;  4M6V A;  1AKH B;  2O9L A;  3LSP A;  2HI3 A;  3F0C A;  2Y9Z A;  2GBY A;  2JA5 J;  1BW5 A;  4W1U A;  1B8I A;  4DZJ A;  2X48 A;  1PUF B;  5M5W J;  5C4X J;  1ORK A;  3BR5 A;  1BJZ A;  3GTK J;  2K9S A;  4W97 A;  3HGG A;  4I6Z A;  2O7O A;  1LE8 A;  4A3G J;  4L5E A;  3S16 J;  3MKL A;  3BTL A;  3JRG A;  1ETQ A;  4Y7N J;  5FKM A;  3DEW A;  1H89 C;  2DA6 A;  2E1O A;  4DW6 A;  4HNV A;  1BL0 A;  1OCP A;  2EZK A;  4MFE A;  5C3E J;  2FX0 A;  3SFI A;  2R5Y A;  2DMU A;  1Z77 A;  5J1Y A;  1ETK A;  3S1M J;  3IV5 A;  4QTR A;  4AYB N;  5M3F J;  2YU9 J;  1WPK A;  2WAQ N;  3A01 A;  4XRS G;  2P81 A;  1JJ8 C;  1A6I A;  1ETO A;  2WV1 A;  2R0Q C;  1DU0 A;  3G1O A;  1H8A C;  3BT9 A;  3HDD A;  3DCF A;  3H0G J;  1Z0X A;  2JA6 J;  4IHV A;  2JA7 J;  3LSJ A;  4DYQ A;  2WB1 N;  3GTG J;  2M34 A;  3BR1 A;  1SFO J;  5EGO B;  4M3D A;  4IHX A;  3TP3 A;  4MLO A;  4A3F J;  1ETW A;  3Q0V A;  4BBS J;  2DMP A;  1ETY A;  2R5Z B;  3BG3 A;  2DA3 A;  1OFC X;  1AU7 A;  3S17 J;  2FJ1 A;  2XB0 X;  4UUT A;  2LKX A;  3QPL A;  5J1R A;  5FKN A;  2EBI A;  1VND A;  4BBR J;  1I50 J;  3NAR A;  3OIO A;  4M3B A;  5F04 A;  1GV2 A;  3BR3 A;  4XK4 A;  4IHY A;  1A5J A;  3JRA A;  4V2F A;  1W0U A;  3MN2 A;  1HOM A;  3BR0 A;  2VI6 A;  4DZP A;  4UUS A;  1MNM C;  1U9N A;  3K7A J;  2MW8 A;  1TWA J;  1RR7 A;  2XGD A;  1WCM J;  4C3H J;  4FIS A;  1WI3 A;  1UMQ A;  5F27 A;  5EZG A;  5IYB J;  2NVQ J;  5K7Z A;  1JTX A;  3GBG A;  2L7M P;  3FK6 A;  1BA5 A;  3HOW J;  4S0H B;  1H88 C;  2ELK A;  1LFU P;  2LK2 A;  2NS8 A;  3TW7 A;  3ZQC A;  3JR9 A;  1MBJ A;  2FQ4 A;  5M3M J;  5IP6 A;  1K61 A;  2GLO A;  3HKZ N;  1YRN B;  4ABZ A;  2Y9Y A;  5M5Y J;  2X9D A;  3S2H J;  1Y1V J;  4MO7 A;  3O8G A;  2HDD A;  2XB5 A;  4B3A A;  2NVX J;  2HXO A;  2VKV A;  3BTJ A;  1MBF A;  4AC0 A;  5F0F A;  2ID6 A;  2E2I J;  1R9T J;  3LSG A;  1RES A;  4A3D J;  4C2M J;  4LOC A;  5EG0 B;  1ZK8 A;  3BG5 A;  1TWH J;  4DYC A;  3GTO J;  3E7L A;  1IG7 A;  1I6H J;  2L7F P;  3IH2 A;  2Y2Z A;  4I76 A;  3S1R J;  2IEK A;  1IDZ A;  1JT0 A;  3TW6 A;  2K9Q A;  3GTJ J;  4A93 J;  1JGG A;  1U9O A;  1JKR C;  1XG1 A;  4CYC B;  3HOZ J;  2DTZ A;  2NS7 A;  2I10 A;  3BQZ A;  4BY7 J;  3Q0W A;  4A3M J;  1JT6 A;  2JWT A;  4XID A;  3I4N J;  4A69 C;  4BXX J;  3JRH A;  4A3E J;  2DA4 A;  5BNG A;  2QF7 A;  1HLV A;  5E3O A;  2Y0S N;  3OSG A;  3S14 J;  1B8I B;  1JUS A;  2EQR A;  4B1R A;  1F36 A;  3CMY A;  3UKG A;  1VF9 A;  2X6O A;  1LE8 B;  2M0C A;  2DA2 A;  4NDL A;  2E2J J;  2HYJ A;  3WHB A;  4MIM A;  3I4M J;  5FLV A;  4RDU A;  1MSE C;  2M8G X;  2VKE A;  1HDD C;  4A3C J;  3RZO J;  1TWF J;  4EEF G;  4V2G A;  3L1P A;  2R5Y B;  5DTD A;  2EZL A;  3OOU A;  1ZTR A;  1RKW A;  2Y30 A;  3HOY J;  2QCO A;  5IPA A;  2IBD A;  2EH3 A;  1S7E A;  1XS9 A;  1GT0 C;  5K7F A;  3FIW A;  1FJL A;  4X1E A;  1K83 J;  2VUM J;  5EF6 A;  2XPU A;  3A01 B;  3CDL A;  3Q0U A;  5IP7 J;  2ZB9 A;  1NTC A;  3Q3S A;  1QRY A;  1IUF A;  2CJJ A;  2LD5 A;  1ZR4 A;  2HOA A;  5EEA A;  1ETV A;  2COB A;  2EZH A;  4D7M A;  1MH3 A;  1RPW A;  2DA1 A;  1O4X A;  2LP0 A;  2NVY J;  5F1J A;  3HOX J;  2FD5 A;  2XPV A;  5IYD J;  1G2H A;  2R93 J;  2DMN A;  1Q1V A;  4M3G A;  2CRG A;  1IDY A;  3BTI A;  1FTZ A; 
#chains in the Genus database with same CATH topology
 5F08 A;  3M3Y J;  2NXN B;  3QQA A;  3KLN A;  2HWV A;  2WY7 Q;  1IC8 A;  4H0E A;  3DPU A;  3SXY A;  4XL9 A;  4R8H A;  1MMD A;  4IVN A;  5HLT A;  3M07 A;  5C4J J;  2CQN A;  5ILV A;  4UVB A;  3W2W A;  3KEQ A;  1JKO C;  1J0R A;  4XLP F;  5L3B A;  1T2K A;  4G6T B;  2LBF B;  3OYF A;  3PIO F;  2M7A A;  2PJR A;  2F4M B;  1PP7 U;  1T56 A;  3GTL J;  9ANT A;  2M9H A;  3X2Q H;  1PUF A;  2ZME B;  2OUM A;  5CPR B;  2L7K A;  1P7I A;  4JP0 A;  1IZ1 A;  2CG4 A;  2OC6 A;  5GPA A;  4XLN F;  1ZR2 A;  4BHP A;  1IJW C;  1ETX A;  2JZY A;  1XX5 A;  3UR3 C;  4CO8 A;  3HSF A;  4RGR A;  5FLM J;  3T5X A;  2V4J C;  2Q2E B;  2X85 A;  5DS9 A;  1W1W E;  1A36 A;  2V9K A;  1ZLJ A;  2XDV A;  2Z1D A;  3F6O A;  2KZV A;  2OF7 A;  1SC7 A;  2VPR A;  1ZGW A;  3IL2 A;  2FOW A;  3I58 A;  3OS1 A;  4PJM A;  2TDX A;  1FOK A;  2DT7 B;  4Y33 A;  4GGG A;  3FMR A;  3NQO A;  2DYS H;  1P4X A;  1SVM A;  3J7A Y;  3HB9 A;  5LGN A;  1WWX A;  3PO3 J;  3GTM J;  1OCZ H;  2MSY A;  3ZQL A;  1WJE A;  1UG2 A;  1KQ9 A;  1UHS A;  2ESH A;  2EB7 A;  1XDS A;  3ZQG A;  2CWE A;  3JW4 A;  2VBW A;  1TLH B;  1Z6R A;  5CVI A;  3BWG A;  2LVS A;  4R79 A;  3G1L A;  3T8T A;  5D4S A;  1ZRE A;  4II2 A;  3L2R A;  3DU5 A;  1U78 A;  2F2E A;  1JKQ C;  1PVE A;  3GTQ J;  2LC2 A;  1YW7 A;  2VKD A;  2L01 A;  3V4G A;  3ZXS A;  4JBA A;  4RM3 A;  4CGZ A;  3K0L A;  5D5X B;  3IH4 A;  2GQQ A;  3A0B C;  3ERE D;  1YE9 A;  2ZXJ A;  3KP4 A;  3HEF A;  3S15 J;  5DD8 A;  3OYK A;  2DXI A;  4IZZ A;  2P5V A;  2E19 A;  4AUX A;  4HX7 A;  3OYD A;  1BR4 A;  4ANJ A;  3BG6 A;  4P55 A;  5CKT A;  4CCK A;  2ZCW A;  2K85 A;  4G12 A;  2X1C A;  3LST A;  3SDB A;  4WX9 A;  3WGG A;  2VPL A;  4XRM A;  4D7N A;  2LLK A;  1JUM A;  2JTV A;  2JT1 A;  1EH8 A;  4F7Z A;  2CYY A;  4LK1 F;  3SQN A;  4Q4Z F;  3GFL A;  4ZTF A;  3M8J A;  2LSO A;  4G94 A;  1OCT C;  3EQL F;  1G6N A;  4YG2 F;  1TWG J;  1TW3 A;  4QSH A;  4ZJZ A;  4IHW A;  5HLH A;  2XGC A;  2IW5 A;  3ZN1 A;  2TCT A;  5A2Q K;  2YX7 A;  1UFM A;  5ERI A;  1O3R A;  3B73 A;  3OV8 A;  5D6F A;  4XLE A;  2CS3 A;  3PNT A;  4MQ9 F;  5LFA A;  2AQF A;  2QKL B;  1R58 A;  2CMP A;  3JRB A;  3GFM A;  4I01 A;  4HG2 A;  5CJ9 A;  1YS7 A;  1QHG A;  3LOC A;  3W3C A;  2HKX A;  2NOG A;  1SAX A;  1FTT A;  4HPQ A;  3SEZ A;  3KIO A;  5IY5 H;  1YQA A;  4A3L J;  3BR6 A;  3FWE A;  1BC8 C;  1WZ2 A;  1S29 A;  4BEH A;  4XON A;  5H20 A;  3QOD A;  1A04 A;  4U0V A;  4QPO A;  5E3N A;  3M4O J;  1D1C A;  4YEJ A;  2PMZ A;  1APL C;  4YIR X;  3FM5 A;  4GYI A;  2ECB A;  2Z3Y A;  5FFZ A;  3AL0 B;  2PMZ N;  1MW7 A;  2HU9 A;  1BW6 A;  3ZMU A;  3N4M A;  4I0A A;  1FBQ A;  3AL0 C;  2E2H J;  2XAS A;  2RAE A;  2H8W A;  3HC7 A;  3P5J A;  4IHS A;  3M9A A;  1QA6 A;  3PJR A;  1EV7 A;  5DD4 A;  2DMT A;  4F92 B;  2E1C A;  1J5Y A;  4I2O A;  3CCJ I;  2KKO A;  2W57 A;  1HF0 A;  3DQV C;  4M3F A;  3FKI J;  2MD5 A;  1SFK A;  2N8G A;  4XBF A;  2M4G A;  2KMU A;  2WBM A;  1YO5 C;  2FF4 A;  1R49 A;  1U8B A;  5ILU A;  3VPR A;  1HW2 A;  2DFF A;  2QBY A;  3WOD F;  1J75 A;  1V5F A;  2HI3 A;  1CF7 B;  1R71 A;  1W7P D;  3CTA A;  2F5E A;  3DPT A;  4PSX A;  1RNL A;  4DZJ A;  4A12 A;  2KJB A;  3GFI A;  5C4X J;  2QQA A;  4E7S A;  2LKP A;  3H9Q A;  4A3G J;  3S16 J;  4LK0 F;  3OL3 A;  4RB3 C;  4HW0 A;  2IGM A;  3H3Z A;  5FKM A;  1VQL I;  3IAS 2;  3DPL C;  2A3S A;  1LVK A;  2QGU A;  2X1E A;  2BEO A;  3MKZ A;  1VTN C;  1ERD A;  5B66 C;  3SFI A;  1R22 A;  2P8T A;  2XHK A;  3J7A O;  1Z77 A;  3W6J B;  1ETK A;  5J1Y A;  2IS1 A;  1ZEL A;  4HF1 A;  3QYB A;  1N78 A;  3BPV A;  3IV5 A;  3QOP A;  1SD7 A;  3MWM A;  2ICW G;  3PSF A;  3TKY A;  1WJF A;  4ZYH A;  1TQI A;  3CCQ I;  3IWZ A;  2WAQ N;  3R61 A;  2PBI A;  3BZK A;  4OIR F;  4TV7 A;  4EJV A;  3AFH A;  1W5T A;  2Z5U A;  1ETO A;  2IS4 A;  5K5R A;  3BT9 A;  3K2Z A;  3H0G J;  4XKW A;  1Z0X A;  1SD4 A;  1WQ2 A;  4NBQ A;  2Y69 H;  4E4H A;  4EM1 A;  4KN7 X;  3AKZ A;  2OQR A;  1SFO J;  5J8F A;  1SD5 A;  2QSF X;  3BCA A;  3VWB A;  5EGO B;  3FXO A;  3U21 A;  2J5O A;  2RV8 A;  2QYO A;  3RYR A;  3OY9 A;  4X0G A;  2EWN A;  2LG4 A;  4M3D A;  4IHX A;  2KP6 A;  3DEE A;  4EJW A;  2NYX A;  4A3F J;  2O61 A;  4N9I A;  2MC3 A;  2HTJ A;  4HF0 A;  1O3Q A;  2GA1 A;  1I1S A;  2DA3 A;  4NB5 A;  1RUO A;  4ITV A;  2XGX A;  4CIC A;  3QPL A;  1RUN A;  5E8I A;  4PFO A;  2LBF A;  4LB6 B;  3ONQ A;  4WXH A;  2ADU A;  4KIG A;  1GV2 A;  1V5G A;  2ZME A;  1MMA A;  5LHH A;  3K4C A;  2A61 A;  2Z33 A;  4L9J A;  3IUO A;  2ZJ2 A;  4YRV A;  3EYI A;  3T8R A;  2ESN A;  1OYY A;  2VI6 A;  1LPQ A;  3FBN B;  3R0A A;  2WAE A;  4Q47 A;  1Y0N A;  3K7A J;  2MW8 A;  3OYB A;  3VSK A;  2Q2E A;  2P5K A;  1I27 A;  2XGD A;  1XGS A;  4FX0 A;  4M9X A;  1VQ6 I;  1WI3 A;  5GAG J;  1YI2 I;  4BL0 B;  2E71 A;  3CES A;  5IYB J;  3I0T A;  4B8X A;  4EVI A;  2D45 A;  3GLL A;  1AWC A;  3WTS C;  1UHW A;  3GBG A;  4G6Q A;  3K70 C;  2M1B A;  1BA5 A;  1IXC A;  2VT3 A;  3SHF A;  3BPX A;  2D1V A;  2JRT A;  3V8L A;  4CCO A;  1HSJ A;  1OCR H;  1MJ9 A;  3TO9 A;  1BJA A;  1Z05 A;  1OQY A;  5FD5 A;  5M3M J;  5IP6 A;  3HKZ A;  2GLO A;  2R7Q A;  2LF7 A;  1S7O A;  3HKZ N;  5FB2 A;  2M45 A;  3OWT A;  3I59 B;  3U1K A;  2RC4 A;  1SMT A;  2VQG A;  3KET A;  1Y1V J;  3LA3 A;  4NNJ A;  3FXL A;  4XLC A;  2K3F A;  3OR1 C;  4FQG A;  5CVR A;  3AG1 H;  1WI9 A;  2DAO A;  2P5L C;  1MBF A;  4M9S A;  3BZC A;  3KCC A;  3PQJ A;  5CQG A;  1G3W A;  3BJO A;  5F0F A;  4F91 B;  3OYE A;  1R9T J;  3LSG A;  3WTX C;  4MTD A;  3IP4 B;  5EG0 B;  3E7L A;  4IQ4 A;  4XRF A;  4NC8 A;  1P9Q C;  2LY1 A;  3WE3 A;  3S1R J;  5FRO A;  3GVA A;  2PMU A;  2GZW A;  1YTY A;  2V6E A;  3TW6 A;  2K9Q A;  3HRU A;  4HV5 A;  1RRJ A;  5K5Q A;  2FOK A;  1S5L C;  1M1E B;  3HOZ J;  2QLZ A;  5J6X A;  3E1S A;  3KP6 A;  4IO9 F;  1P4W A;  4CCM A;  2E5Z A;  4ESB A;  2PI0 A;  3K4K A;  1SMY F;  4BXX J;  3JRH A;  2COM A;  3QYE A;  3EPZ A;  1O3S A;  3VFZ A;  1UAA A;  1FBU A;  3WG9 A;  1B8I B;  4ZDO A;  5HOO A;  1P4A A;  4KIB A;  2X1D A;  5LRS A;  1XGM A;  3CMY A;  2Z99 A;  3UKG A;  3CLO A;  3QRF F;  2BBY A;  2E2J J;  1VQK I;  2KJC A;  5TGT A;  1U6G A;  1O57 A;  4EAT A;  3GX4 X;  3I4M J;  2QA4 I;  5FLV A;  4DBR A;  3TGN A;  4LIV A;  5DM7 F;  1GXP A;  4M72 A;  1YG2 A;  2IVM A;  4EGZ A;  1REP C;  2OTL I;  3RPU D;  1TWF J;  3F6V A;  4EEF G;  2HQR A;  1ULY A;  4LIT A;  3CCU I;  1ZG5 A;  2Y30 A;  2JQ7 A;  3MFK A;  4D9J A;  1DPR A;  5IPA A;  1WFX A;  2E1M B;  1FJL A;  1K83 J;  5GTH C;  2OA4 A;  5EF6 A;  2E35 A;  2XKO A;  2XAQ A;  3LSM A;  3WTW C;  1KA8 A;  2XPU A;  2FA5 A;  5IP7 J;  2ZB9 A;  2DOE A;  3I9V 2;  2NRA C;  1YW9 A;  3Q3S A;  2CO5 A;  1IUF A;  4BGD A;  1D0Z A;  2DI3 A;  2BW3 B;  3L2U A;  1YFH A;  1ZR4 A;  2NS0 A;  3K6G A;  3HL2 A;  1IN5 A;  2XF5 A;  1LDK B;  4Z6Y A;  1J7K A;  1RPW A;  2DA1 A;  2XRN A;  2DT6 A;  3MAJ A;  4GCV A;  5ED4 A;  1Z9C A;  1O4X A;  2JSC A;  3S3O A;  4DQ2 A;  1AA7 A;  4B44 A;  3MZ8 A;  1B9N A;  3BTI A;  2PX9 A;  4BE1 A;  5FRN A;  2GIV A;  2L5Q A;  4HEA 2;  4GXO A;  1D1B A;  5KK1 A;  2P7V B;  2XRL A;  3FK7 A;  5IOZ A;  2AHQ A;  1ITY A;  1POG A;  3BLY A;  2XV4 S;  2MH2 A;  2ACJ A;  1QPI A;  3A1Y A;  5BS6 A;  2A6H F;  1MSF C;  1QZY A;  3KZY A;  3A02 A;  4JX4 A;  4BE2 A;  1JTY A;  1CF7 A;  1TC3 C;  4QWQ A;  4A3B J;  3GWZ A;  1FWZ A;  3DTE A;  1VQM I;  1Z7L A;  4XLF A;  2NVT J;  2TRT A;  2M4K A;  2K9M A;  3H3U A;  3VSL A;  4CHU A;  1TBX A;  3H9G A;  2HQ5 A;  2KIQ A;  4A3K J;  3ABM H;  2FSW A;  2X6Y A;  3HBL A;  3O8H A;  4FE7 A;  5FKL A;  5A2Q Z;  2DA7 A;  3TED A;  4UUS B;  5E3M A;  4KIT B;  3CCE I;  2ZJP F;  3JRC A;  5IYC J;  3LQQ A;  1BI3 A;  1IN4 A;  3CDH A;  4RLF A;  1O3T A;  2JMW A;  3TQN A;  4ESJ A;  2CW8 A;  2K7L A;  4A0Z A;  2NAZ A;  3JSO A;  4HLY A;  1YHQ I;  2A07 F;  4LLN A;  3ABL H;  5DUK A;  2HZD A;  3BR2 A;  2DFH A;  1IV8 A;  3P9K A;  2BXY A;  1BI0 A;  2O8K A;  3A03 A;  3DKY A;  2D5V A;  3G4S I;  4AVZ A;  1QU3 A;  4IEJ A;  2W48 A;  1WJB A;  2W00 A;  4PJ0 C;  3K2A A;  2GOM A;  1O7F A;  1QNT A;  2FBI A;  4JX6 A;  5E18 F;  4L9T A;  3T0Y A;  2V9V A;  3P7N A;  2XSD C;  4KIC A;  1S72 I;  2KRC A;  2QM3 A;  3K9T A;  1JHH A;  2KT0 A;  2A68 F;  4LG0 B;  2MG4 A;  2O6G E;  3OYL A;  4U0W A;  3ESW B;  4Y52 J;  3MKY B;  3D5R C;  4RS8 A;  2NNN A;  2CQK A;  1WGX A;  3FXU A;  3OS2 A;  3I4P A;  4AM3 A;  4UUV A;  5EGO A;  2Y0M A;  5IP9 J;  5LD2 C;  2R7U A;  3KZI C;  1FEX A;  2WTE A;  1BR2 A;  3HZJ A;  1R6R A;  3H9J A;  5HNF A;  1IV6 A;  4RB0 A;  2DDA A;  3BQY A;  1FYM A;  3ZRG A;  3ZOB A;  5D5U B;  2GXB A;  2A05 A;  5B1B H;  3KLO A;  4I98 B;  2XAU A;  1E2X A;  3PM1 A;  1A35 A;  1XD7 A;  5GAE J;  2D1H A;  5HS8 A;  1FMW A;  1A31 A;  1IRX A;  3CC2 I;  4HX4 A;  1U5T B;  1JXS A;  2GM4 A;  1I39 A;  1UCR A;  3HPH A;  3BOQ A;  4FCY A;  4BAY A;  4PUS A;  5D5V B;  4RBO A;  3RJP A;  3OYN A;  1MNE A;  2EPF A;  4MNU A;  5H2F C;  1W0T A;  2RRE A;  4XKB A;  5DDG A;  2L0K A;  3VB2 A;  1VQ5 I;  3VDX A;  2XSJ C;  2JUG A;  4BDY A;  3OYM A;  1FP2 A;  2DQR A;  2R3S A;  1X58 A;  2C6Y A;  1DU6 A;  4N4N B;  1KYW A;  3REO A;  5IT3 A;  4NQW B;  3GYH X;  1RIO H;  1GVD A;  4UVC A;  1OMI A;  1MDM B;  2GIZ A;  1JHF A;  4HBL A;  4XNF A;  4M73 A;  2BY3 A;  2DJN A;  1FLI A;  2VIX A;  3SEQ A;  4JQF A;  4ZYG A;  1T39 A;  3I56 I;  1DUX C;  1EF4 A;  1FYK A;  1R4N B;  2H8R A;  1JGS A;  2HVQ A;  3ZR8 X;  2F5C A;  4KDP A;  4A3I J;  1EKE A;  3ASN H;  1UEL B;  3I59 A;  1Y6I A;  4BQN A;  4K2E A;  3F8N A;  1V3F A;  5J1U A;  2XAG A;  4ENM A;  2KRH A;  2LOO A;  2ETH A;  3F72 A;  4XOP A;  2A6E F;  4A5N A;  5GAH J;  1GDT A;  4HDV A;  2R7Z J;  3DP7 A;  1F5T A;  1XGO A;  2Z2S B;  4XM3 A;  3CO7 C;  4P5O A;  3IRR A;  2X6X A;  2CGP A;  2R7W A;  2Q8K A;  1RET A;  5EG0 A;  4B09 A;  2QKM B;  3ASO H;  2R7O A;  3BG9 A;  3TP0 A;  2M7B A;  3JRI A;  1ZG3 A;  4D0P A;  1MBH A;  2GXA A;  2MD0 A;  4DYR A;  2UXX A;  2KL4 A;  3CF2 A;  5FJ8 J;  3OYG A;  4F55 A;  2V1N A;  2ZNZ A;  1ZAO A;  3CO6 C;  2XIG A;  1X2N A;  1GV5 A;  4NC7 A;  5F0C A;  4E7I A;  3B02 A;  4OIN F;  4HST A;  2V1D A;  3PIP F;  5BMZ A;  2EFW A;  1FSH A;  2HOE A;  1QBJ A;  3V7S A;  1AOY A;  2KHM A;  1OR7 A;  4B4C A;  1D5V A;  3HOV J;  4UY8 I;  4PZJ A;  3COA C;  3ECO A;  1GUU A;  3F8F A;  2L7Z A;  1VI0 A;  3PUF A;  4M6V A;  1AKH B;  2VOD A;  4BXU A;  3NWS A;  3F0C A;  3TMO A;  1IN6 A;  1B6A A;  1YOV B;  3ZMZ A;  4W1U A;  3M1C A;  3H36 A;  5LBQ A;  1B8I A;  4XMY A;  2L4M A;  1K7A A;  4RMN A;  1L3L A;  1FPQ A;  3EET A;  3BR5 A;  1DGW Y;  3HGG A;  3D5S C;  1EH7 A;  1L0O C;  3FZV A;  3JRG A;  5LHG A;  2PQ8 A;  1ETQ A;  2G7U A;  3DEW A;  2DA6 A;  2E1O A;  3R0J A;  4HNV A;  2E34 A;  1OCP A;  2EZK A;  2FRH A;  3HIF A;  5C3E J;  4BJT A;  2FX0 A;  1YJN I;  4IQJ A;  1G4D A;  1MD0 A;  2YR2 A;  1V5E A;  1K79 A;  1OCO H;  1UG0 A;  1OLT A;  4LLG F;  4RAZ A;  5M3F J;  5JI6 A;  2BHY A;  5L3C A;  2YU9 J;  2Q0O A;  1WPK A;  1VQP I;  2MAB A;  3KEY A;  4CCN A;  1JE8 A;  3IC7 A;  2M3A A;  3WU1 B;  3CC7 I;  1VQN I;  2P81 A;  2BW3 A;  2IGN A;  3KYD B;  4BE0 A;  2MYS A;  1DU0 A;  3G1O A;  1H8A C;  1XCV A;  1W5C C;  2JA6 J;  4HDU A;  2X51 A;  3U1D A;  2JVH A;  1F4K A;  4DYQ A;  3E6B A;  1P2F A;  2WB1 N;  2L9S A;  3QU6 A;  4O6J A;  3M7G A;  1R23 A;  3VOE A;  3A4C A;  3W2V A;  2K3P A;  2LKS A;  1QQI A;  2VJ4 A;  3GXO A;  3HRS A;  4OMY A;  4HA8 A;  2BVL A;  3L2W A;  3O2P E;  3RDI A;  2X6W A;  3WTZ A;  2R5Z B;  3S3M A;  5LHI A;  1OFC X;  1AU7 A;  5J40 A;  4IL6 C;  3S17 J;  2XB0 X;  3F21 A;  4G7O F;  5J1R A;  5HS7 A;  3NAR A;  1G3S A;  3TDU C;  3MEX A;  2XUB A;  3IKV A;  4BJ6 C;  1IN7 A;  2UZK A;  3GO5 A;  2HZT A;  2K4B A;  2UXN A;  1A5J A;  5CVJ A;  1GXQ A;  3BR0 A;  5JHU A;  4UUS A;  3VOD A;  1BIA A;  5DEQ A;  1K4S A;  1RR7 A;  1ZRD A;  4HNU A;  2VKH A;  1WCM J;  4FIS A;  1KQ8 A;  1MMG A;  1T6S A;  1K78 B;  1UMQ A;  2OAZ A;  5K7Z A;  5FRM A;  1ZRF A;  3FK6 A;  3HOW J;  3TL4 X;  1LFU P;  5HNH A;  3DKX A;  2LK2 A;  1T38 A;  2NOJ B;  5JFR A;  2NS8 A;  1X3W B;  4KYW A;  1DQU A;  1X3U A;  2HR3 A;  5D4R A;  5FLX K;  2FQ4 A;  4XKV A;  1BI1 A;  1PYV A;  5B3S H;  3DBR B;  4E7J A;  4ZYE A;  3CCS I;  1XB4 A;  1EA3 A;  2HTS A;  4LG0 A;  1Y56 A;  3QU3 A;  4MO7 A;  4KNY A;  3O8G A;  2PEX A;  1LUJ B;  1R36 A;  2IA1 A;  2HDD A;  2XB5 A;  4B3A A;  2VKV A;  3HXL A;  2HFH A;  1MMN A;  2V7F A;  1V54 H;  3F3X A;  1VQ7 I;  2ID6 A;  1Z91 A;  2QSG X;  2L3D A;  3S32 A;  2HQA A;  4A3D J;  2DDB A;  3QOE A;  3ZQ7 A;  3HRT A;  2H27 A;  3GTO J;  1G59 A;  2W1O A;  1IG7 A;  2L7F P;  3DEU A;  3BCB A;  2VN2 A;  3IH2 A;  2XVC A;  3C7J A;  4AD9 A;  4KFC A;  1BN5 A;  3HJE A;  1SAU A;  2ZC2 A;  1BOB A;  3L2Q A;  3GTJ J;  1U5T A;  3DFG A;  2P4W A;  5D6E A;  1U9O A;  2K86 A;  1TT0 A;  1XG1 A;  2VQC A;  4RAF A;  1FYL A;  2DT5 A;  4BY7 J;  2G9W A;  2A6T A;  5K5O A;  3Q0W A;  1IW7 F;  3S8P A;  4XOT A;  2B9S A;  4RGS A;  4PSW A;  4A3M J;  2JRM A;  3R60 A;  2VBZ A;  4CXF A;  3I4N J;  3KEO A;  4A69 C;  2MC4 A;  2WAQ A;  1BM9 A;  3KZZ A;  4ZZL A;  5BNG A;  5E3O A;  3TOA A;  3OSG A;  2E36 A;  3K1N A;  1K4T A;  3S14 J;  4P1W A;  3OYA A;  2KZG A;  1I6X A;  2EQR A;  2QWW A;  2KRF A;  2B0L A;  1F36 A;  3WGI A;  1IXR C;  3H5R A;  4NQW A;  3E5U A;  3HPG A;  1MDM A;  2M8E A;  4NDL A;  5ICE A;  2DO7 A;  2HYJ A;  3P9I A;  2EK5 A;  3QAH A;  3VEP A;  1Z67 A;  4MIM A;  3J80 K;  2IGK A;  4RDU A;  4GYG A;  2EFN A;  1FNN A;  2MFZ A;  1N77 A;  3GZ5 A;  5EJC A;  3RZO J;  2O03 A;  2DPU A;  2W84 A;  3CUQ B;  4XR6 A;  2EZL A;  1ZTR A;  3NWT A;  4YIF A;  1RKW A;  2IBD A;  3CUQ C;  2O0Y A;  3GEZ A;  5K7F A;  1DP7 P;  2VUM J;  2BE5 F;  4CZC A;  5BQT A;  3GCM A;  2CUJ A;  3A01 B;  2BOL A;  3Q0U A;  1BIB A;  5J47 A;  3R6S A;  2ZFU A;  3IWF A;  2CV2 A;  1Y39 A;  1MMS A;  4AIJ A;  4ON0 A;  3ULQ B;  5EEA A;  1ETV A;  1T08 B;  2A69 F;  5K1Y A;  3P9C A;  4CCL A;  4E7Z A;  2LRD A;  1HST A;  1MH3 A;  4OAZ A;  3WTU C;  2UV1 A;  2LP0 A;  3GF2 A;  5CYV A;  2L02 A;  2FD5 A;  3DBH B;  3HOX J;  5IYD J;  1SVL A;  4HV6 A;  4M3G A;  4WWC A;  1V4R A;  3RKY A;  5ICG A;  3RKQ A;  1YYV A;  4HOB A;  3QPS A;  5EYR A;  1HXD A;  5FKO A;  2OZ6 A;  4EMS A;  5EDN A;  3LSR A;  2E5N A;  1XSX A;  1AKH A;  3PQK A;  1F1Z A;  3K1P A;  4LB5 A;  1MH4 A;  2G0E A;  1R5I D;  2OJE D;  2CW0 F;  4MQV A;  1QPM A;  3W6V A;  3Q9S A;  1FOX A;  1OPC A;  2STT A;  1FIA A;  2HOS A;  3MZY A;  4E6K G;  1QO0 D;  2V9P A;  4YFX F;  5CLS A;  2GXG A;  1I1G A;  5EEH A;  2EFQ A;  1P6R A;  6PAX A;  2YS9 A;  1XCB A;  1Y8Q B;  2K4J A;  4IRI A;  3AG2 H;  4L5I A;  2CUF A;  1R7J A;  4CUG A;  3E5X A;  3V42 A;  2JA8 J;  1P7J A;  4IF4 A;  4DIQ A;  3A0H C;  4BQQ A;  4FAS D;  1S3J A;  4M9Z A;  5GP9 A;  2XRO A;  2KDZ A;  1VFC A;  2PMH A;  1X4P A;  2J5P A;  2B63 J;  2BYV E;  5JLW A;  1X4O A;  4DBQ A;  1HKS A;  2KIM A;  2OBP A;  3IAM 2;  1HKQ A;  2ISY A;  5F64 A;  1NHA A;  2CU7 A;  2KLO A;  4P9F A;  1D3Y A;  2RNJ A;  3B6C A;  4ZTJ A;  2RN7 A;  4FTH A;  2MH9 A;  5AON A;  3PO2 J;  4MHG A;  3IKT A;  1ZHF A;  2VJI A;  5FKK A;  4XIC A;  4BUP A;  2A5Y B;  4HAM A;  3HG9 A;  2DA5 A;  4WXC A;  1MBK A;  2M2E A;  4C30 A;  4J01 A;  2R7T A;  2GOX B;  3HSE A;  4GFB A;  1X1B A;  5B1A H;  2ECC A;  2R92 J;  3V8K A;  3C1D A;  4RAG A;  3OYJ A;  2AQE A;  2K40 A;  1ZH5 A;  4U0Y A;  3PL8 A;  4OMZ A;  1RKT A;  2HPI A;  3E0J B;  3PNY A;  3JTG A;  3F22 A;  3OYC A;  1IRZ A;  2R5Z A;  3DTK A;  3BY6 A;  3ZP5 A;  1LKX A;  3WU0 A;  1F9N A;  3HOT A;  3PUB A;  4IRH A;  1D0X A;  2LY9 A;  3PFY A;  1NH3 A;  3L00 A;  1FOW A;  4AIK A;  4J19 A;  1XSD A;  2H1L A;  4LD5 A;  5F6F A;  2CQX A;  1QZZ A;  1OIS A;  1WJ5 A;  3HGY A;  4RB2 C;  3PNV A;  3CMA I;  2ZJQ F;  2L54 A;  3IRQ A;  2EZI A;  3DF8 A;  2RQP A;  4PFP A;  2HDC A;  3D1N I;  1HC8 A;  2DYR H;  2NNY A;  4LIU A;  2UUZ A;  2UWM A;  1K78 A;  1XGN A;  1XN7 A;  5AIP A;  2R7D A;  2JJ7 A;  5D5W B;  3K4M A;  4U7D A;  3NAU A;  3G6E I;  3U2R A;  3DBL B;  1XMA A;  4DGW B;  4FX4 A;  1OYI A;  2EA4 A;  4E7K A;  4EJT A;  4L5J A;  2ME0 A;  4IJA A;  3LAP A;  2IA0 A;  2X4H A;  2KIF A;  1JUP A;  2O3F A;  2AXL A;  4P9U A;  1ZLK A;  1Z7U A;  1LEA A;  3LFK A;  1UZC A;  2VAS A;  5C44 J;  2CV1 A;  4D5C A;  3VYT B;  3B6A A;  5DCM B;  3ISP A;  4D5F A;  1HDP A;  1YS6 A;  2EIN H;  2DN0 A;  2LTP A;  5JLX A;  1T95 A;  3M1E A;  5E1X A;  5HOD A;  4EM2 A;  4EQQ A;  3I53 A;  4RA2 A;  2WAD A;  3ABU A;  2QUF A;  2A5W A;  2IAI A;  4IX7 A;  1T8I A;  1UST A;  2HOT A;  1ZYR F;  3E6D A;  5GPC A;  4S04 A;  4ZDL A;  1YIJ I;  1TNS A;  4QIW N;  2ELH A;  1OJL A;  3K10 A;  4RLQ A;  1I3Q J;  4Z2Y A;  3VYU B;  1V55 H;  3LQR A;  2ZXI A;  4YFN F;  3BRO A;  3IHU A;  1YIT I;  2R7F A;  4N9H A;  1ENH A;  1TNT A;  3DXJ F;  1ON1 A;  5J4Y A;  2CQ7 A;  2DK5 A;  4L0Z B;  4A0Y A;  1W36 D;  3MVP A;  3CUO A;  1SAN A;  3CQZ J;  2R7R A;  3MQ0 A;  3LAJ A;  2K9N A;  1HCR A;  4OOI A;  3LNQ A;  3KPH A;  5HS9 A;  2OPT A;  2FMY A;  5E3L A;  2M5W A;  1E3H A;  2H6B A;  2L9R A;  2PFB A;  2H09 A;  5IOY A;  2DMQ A;  3C2B A;  2MA3 A;  1B72 B;  1LDJ A;  1SD6 A;  3FDY A;  3KP2 A;  4BNC A;  2X0L A;  3MD2 A;  2GBY A;  2JA5 J;  1BW5 A;  3CC4 I;  1FZP B;  1H0M A;  3CME I;  2QQ9 A;  2K9S A;  4W97 A;  3L2C A;  1TTY A;  4PGH A;  4BXF A;  1NG6 A;  2R7X A;  3BTL A;  2FQ3 A;  3KP7 A;  5GTI C;  2R7V A;  4Y7N J;  5FLX Z;  1Z1D A;  4UV9 A;  1NG7 A;  4HYE A;  4DW6 A;  2ZO4 A;  1SFU A;  1BL0 A;  5DYM A;  3T1B A;  1Q1H A;  1A6Q A;  4CH7 A;  1Z21 A;  3CUQ A;  2EV5 A;  3OIP A;  2EJR A;  5TRD A;  4AYB A;  2VQL A;  3FF5 A;  3S1M J;  4QTR A;  2LNB A;  4AYB N;  1OCC H;  2QVO A;  4L18 B;  1S7A A;  1FBS A;  2Y48 A;  3A01 A;  2ZSH B;  4XRS G;  5CVU A;  2DLL A;  3DU6 A;  2EIK H;  2XF6 A;  2EA2 A;  1R1V A;  4I09 A;  1A6I A;  1B1B A;  2IJL A;  2RKH A;  4ETS A;  1B4A A;  3HDD A;  2JSP A;  4LG3 A;  2PN6 A;  3LA2 A;  4IHV A;  3LSJ A;  5E79 C;  2QEN A;  1R4M B;  1JI8 A;  2V1U A;  3GTG J;  2IXS A;  3FX3 A;  3BR1 A;  5DM6 F;  3DV8 A;  2K02 A;  1GVJ A;  5FO5 A;  2FNA A;  2OTJ I;  3CJN A;  5LRR A;  2P6T A;  3Q5F A;  4AWX B;  2QQ8 A;  3ZMT A;  3FXK A;  3TP3 A;  4MLO A;  1XMK A;  1RC9 A;  4XLA A;  4PCQ A;  2BY0 A;  3Q0V A;  3FKJ A;  2DMP A;  4GO1 A;  1ETY A;  3F8M A;  3TO6 A;  3BG3 A;  4F52 A;  4KMF A;  4XSX F;  2PG4 A;  2AS5 F;  5L3E A;  2FJ1 A;  2LKX A;  2LDU A;  2HDW A;  2EBI A;  5FKN A;  2KFD A;  3ZCO A;  2VON A;  3CLQ A;  2GA2 A;  3BDD A;  4OIP F;  4M3B A;  5F04 A;  3BR3 A;  1C0W A;  4P96 A;  5HVQ C;  4IHY A;  2ZXW H;  3JTH A;  3L7W A;  1LDD A;  1TQP A;  3JRA A;  1HOM A;  4DZP A;  1QZE A;  1HA8 A;  1MNM C;  4KIS A;  5FD6 A;  4XOR A;  1U9N A;  2RNG A;  3J80 Z;  4C3H J;  1XSV A;  4Y3O A;  5KCM A;  5KVR A;  5EZG A;  2E60 A;  3VYR B;  3HUG B;  3I5U A;  4ENJ A;  2XAJ A;  1J9I A;  3TW7 A;  2JVG A;  2ZKZ A;  1RR8 C;  2W85 A;  1SFX A;  4U7B A;  2WWY A;  3MMY B;  1U2W A;  4NC6 A;  2IP2 A;  3HTS B;  3LWF A;  1E3P A;  2DTR A;  2D2W A;  4A0X A;  1YRN B;  3RIR A;  3EDP A;  2RVC A;  2Y9Y A;  3HSR A;  5M5Y J;  3K1M A;  3FHN A;  3LFU A;  1D0Y A;  3H1C A;  5GAD J;  2VL8 A;  3V7R A;  1YIO A;  2L4A A;  1MJA A;  2CH0 A;  2W7N A;  2DFI A;  2L9V A;  2ZME C;  2HXO A;  1KU3 A;  3BTJ A;  4KA4 A;  4LLL A;  4AC0 A;  4G8X A;  3FXR A;  4XLH A;  1MGT A;  3K4N A;  5BPD A;  1RES A;  3ZGK A;  3OS0 A;  3NEU A;  1YLF A;  4M74 A;  4C2M J;  3ZN0 A;  1KGS A;  1ZK8 A;  2OCC H;  2HKO A;  1Y8R B;  2FEZ A;  1I6H J;  2DOF A;  2VE9 A;  4Q5S F;  1BOA A;  3DLA A;  4LMY A;  4I76 A;  5ILS A;  1W4M A;  3QPT A;  4L9V A;  2IEK A;  1IDZ A;  4G7Z F;  1JT0 A;  3RYP A;  3S93 A;  3HTU A;  4A93 J;  2ZNY A;  4WF2 A;  3ROU A;  3CMM A;  1RZ4 A;  1QGP A;  3DLL F;  3D5L A;  3CCR I;  2K27 A;  4CYC B;  3E97 A;  1N25 A;  3EUK L;  2NS7 A;  2I10 A;  3BQZ A;  1G8X A;  1T98 A;  1WSU A;  1JT6 A;  1Z6T A;  2JWT A;  2Y0S A;  1WKM A;  4DNC A;  4A3E J;  1WVR A;  5CQE A;  2Y0S N;  3RPU A;  3CDI A;  2B7E A;  2CFO A;  5ICF A;  3FM3 A;  4YFK F;  2F4O B;  2FXA A;  2WB1 A;  1LE8 B;  3WTT C;  4RB1 A;  4C9Y A;  3FHZ A;  2HVR A;  1TZL A;  2L9N A;  1MSE C;  1R1U A;  2V1X A;  2M8G X;  3FMQ A;  5E17 F;  3GUD A;  2JA2 A;  2P0W A;  5F1R A;  3FBI B;  1HDD C;  2W82 A;  2VBX A;  5DCM A;  2R5Y B;  3L1P A;  5DTD A;  5J4V A;  4B47 A;  5KNL A;  2CSO A;  3ELK A;  3AG4 H;  3OOU A;  4J00 A;  3HOY J;  1LB2 A;  3FXJ A;  5JVT A;  3WTV C;  4BHB A;  1XS9 A;  3FIW A;  3I3L A;  4X1E A;  3CCM I;  4RGU A;  3EUH C;  1TP4 A;  3J81 K;  3JAM K;  1KU2 A;  1HW1 A;  1FOY A;  2ZSI B;  1NTC A;  1DPU A;  1QRY A;  2DK8 A;  2CJJ A;  2VE8 A;  5KHD A;  1KU7 A;  2WV0 A;  1ZGA A;  4F93 B;  2K5C A;  1U3E M;  4KT5 C;  4U88 A;  2EZH A;  4HNT A;  4LGW A;  1ODD A;  3CF5 F;  1B9M A;  4UV8 A;  2HPM A;  5KAF C;  4XN0 A;  4BS9 A;  4M71 A;  2NVY J;  2P6S A;  4YII A;  5F1J A;  5E1Z B;  4B43 A;  5FFX A;  3KFW X;  2XPV A;  3PFI A;  5TIS C;  1G2H A;  1Q1V A;  3ABK H;  5CVV A;  1FTZ A;  2ZXH A;  3G71 I;  3TOB A;  1WH7 A;  1IF1 A;  3JRE A;  2E1N A;  1X1P A;  3GTP J;  2W4S A;  2WAF A;  2E7X A;  3RQ4 A;  1SEU A;  1GLN A;  1QVT A;  4BKX A;  3BJA A;  1B72 A;  4IOA F;  2OU2 A;  3HHG A;  3RCO A;  3ZQQ A;  1FMV A;  3V7C A;  2CFX A;  1MND A;  2VOO A;  1QHH D;  1X2M A;  1R5H A;  3WE2 A;  3AAF A;  4I02 A;  4KMU X;  1YX3 A;  2HYG D;  1P92 A;  4ZZD A;  4HF2 A;  1VZ0 A;  4PDK A;  1FY7 A;  3GZN B;  4AU7 A;  3H92 A;  4BU2 A;  5F0H A;  2CQQ A;  2ELJ A;  2LRE A;  3I64 A;  4MFD A;  4OWR B;  1AHD P;  3R4K A;  3JRD A;  3QPH A;  4I0B A;  5K7H A;  3HOU J;  1ZG1 A;  4AVP A;  1IGN A;  3ZQH A;  3MCZ A;  4BHC A;  1ONV A;  4XKC A;  5LGT A;  2V6C A;  1T33 A;  2QEX I;  3LA7 A;  2AO9 A;  4HX8 A;  1HQC A;  1K6Y A;  1XC5 A;  3CZ6 A;  3SZG A;  2HS5 A;  4A5M A;  2HXI A;  2HEO A;  5D8K B;  1NK2 P;  1TWC J;  2M0M A;  2YUS A;  1FIP A;  3GZ6 A;  3S1N J;  3WHC A;  2ID3 A;  2IRF G;  2AXT C;  2M87 A;  1FT9 A;  5JVG F;  1W7P B;  2VB6 A;  2DJI A;  2XKP A;  3S2D J;  4NHJ A;  4JX5 A;  4DOZ A;  3H3V K;  5L3F A;  2STW A;  5LGU A;  4MEY F;  1EJ9 A;  3G1M A;  3OSF A;  2BGC A;  3RQI A;  2BZT A;  2LH9 A;  4DJA A;  3IH3 A;  1FP1 D;  3H35 A;  1PP8 F;  4U87 A;  4AID A;  2Z9O A;  3F23 A;  5HLI A;  4HLX A;  1WH5 A;  1Z3Y A;  1HKT A;  2EFP A;  2E7W A;  2CUE A;  2VT2 A;  1WJA A;  3EUA A;  4BYY A;  2OV7 A;  3ERM A;  3A2K A;  1ACI A;  2EFO A;  2XPW A;  1D8K A;  1B59 A;  1XTA A;  3ZQF A;  2FU4 A;  2YSR A;  1SFE A;  3O6B B;  4PJN A;  3CCV I;  3L09 A;  2FUG 2;  1VQ9 I;  4JYK A;  3CP2 A;  3SJM A;  2FNP A;  4N4O B;  1E17 A;  5BOX A;  4RGX A;  2MGQ A;  5E20 A;  5L3D A;  3U9G A;  2RGV A;  1MKM A;  2LYC A;  1KQ0 A;  3JCU C;  1JKP C;  4UB8 C;  1KU9 A;  4ENN A;  3HRM A;  1R5G A;  5D8L B;  4KT6 A;  1LNW A;  1BBY A;  3BTC A;  4BY1 J;  2DW4 A;  4CYD A;  3ZQI A;  1N75 A;  4CA0 A;  4KUM A;  1K6O A;  1PJR A;  2F48 A;  3RKX A;  2LFB A;  2OZU A;  2OQG A;  2PJP A;  4IXA A;  1F43 A;  5J3L A;  3V8J A;  1G3Y A;  4FHT A;  2VC0 A;  4HZF A;  2XC7 A;  2JK3 A;  2IA2 A;  2VOP A;  4C2T A;  3CCY A;  2VC1 A;  4JK1 X;  5EZH A;  4A3J J;  2DFE A;  4PK4 A;  5TJJ A;  1CQT A;  3TO7 A;  1T0F C;  1S9H A;  1E3O C;  3BG7 A;  3BZ6 A;  3S1Q J;  3KE2 A;  3C2H A;  1X3Z B;  1NK3 P;  2FE3 A;  2H94 A;  2EV6 A;  3G3Z A;  3HUG A;  4O3M A;  1XPX A;  1X1C A;  1D5Y A;  2L2O A;  2XGE A;  4BQO A;  1VQ8 I;  4FET A;  1H9T A;  3K4J A;  3ZMD A;  1MBG A;  4Y15 A;  3GFJ A;  4QPQ A;  4UVA A;  4NUB A;  3K70 D;  1TW2 A;  5E1W A;  2VBY A;  1Y0U A;  2P7C B;  1LFP A;  3PSI A;  4C3J J;  1I3A A;  5JHF A;  1YRN A;  3HYI A;  3HM5 A;  4IRG A;  1XDU A;  4N0B A;  4S05 A;  2DPD A;  1KYZ A;  2VJ5 A;  4GDF A;  4C3I J;  3FXM A;  5IT9 Z;  4I7H A;  4X6A J;  4FE4 A;  2G7H A;  4O5V A;  1W5S A;  3DKW A;  3H0D A;  3RKW A;  4G6D A;  2Y31 A;  2JPC A;  3RZD J;  1YW8 A;  2R4G A;  3WGH A;  2O5R A;  4HQM A;  3HOS A;  1IXS B;  3ZMS A;  4XRS A;  4IHT A;  4BQA A;  2V26 A;  4A6D A;  3QP6 A;  5ICC A;  4A2U A;  1J2X A;  1BC7 C;  1SVO A;  2Z16 A;  1JJ6 C;  3LSK A;  2XF7 A;  2JN6 A;  4RAY A;  3W2A A;  2H1K A;  1LFB A;  5HDN A;  2ME6 A;  2VQH A;  2JUC A;  1Y1W J;  4MEX F;  3MZH A;  1QVU A;  4CZZ A;  1ZKG A;  2VLA A;  2VXZ A;  1BR1 A;  3G2B A;  3F8B A;  3N05 A;  4BAC A;  2WC2 A;  1ZQ3 P;  4H4K C;  2LR8 A;  4M3E A;  4CYC A;  3SDG A;  4BDZ A;  4CSW A;  4IKF A;  2CW7 A;  3D0S A;  3K4B A;  2QQB A;  1MIJ A;  1LVA A;  2XAF A;  4CDG A;  4EJU A;  4M6Y A;  2ZJR F;  3E6M A;  3OIQ A;  3FIS A;  2KQR A;  5M5X J;  3JRF A;  3L9F A;  2R7S A;  1S8N A;  1MBE A;  1ZAR A;  2F4I A;  3OOP A;  4XN3 A;  2BV6 A;  3I55 I;  2O9L A;  4RM2 A;  3LSP A;  1X19 A;  2EV0 A;  3RPQ A;  2Y9Z A;  2IT0 A;  2PJR B;  1OYW A;  3ML6 A;  3AG3 H;  2Q1Z B;  1LJ9 A;  2X48 A;  4HRI A;  1EH6 A;  1PUF B;  5M5W J;  1ORK A;  1BJZ A;  3QYF A;  3GTK J;  4EV0 A;  4I6Z A;  2O7O A;  1LE8 A;  4L5E A;  4L9N A;  2FBH A;  4BJ5 C;  3MKL A;  4YEL A;  4ZDP A;  2OCE A;  1YJW I;  2LY2 A;  3G73 A;  1PUE E;  2IPQ X;  3KYL A;  2EIL H;  2ZBK A;  4A6E A;  1H89 C;  4EM0 B;  2YX4 A;  4E70 A;  4EJO A;  4MFE A;  4ZC3 A;  2W24 A;  4KIF A;  2R5Y A;  3M8F A;  2DMU A;  3KP3 A;  3QWL A;  2HNH A;  1MJB A;  2QZ8 A;  4FT8 A;  5L3G A;  3EUH A;  1D8J A;  1YX5 A;  4MGR A;  3RSN A;  3H5A A;  3EYY A;  1OR7 C;  1IRG A;  1H9G A;  2MLK A;  2DCE A;  2W25 A;  2ZFW A;  1R00 A;  3BJ6 A;  3RI4 A;  1JJ8 C;  4OIQ F;  2BY2 A;  4UHT A;  5DV5 A;  2WV1 A;  2R0Q C;  2RDP A;  4UXN A;  3DCF A;  3E6C C;  3DWL E;  2YU3 A;  3ECH A;  2HGC A;  2BVM A;  2JA7 J;  3FXQ A;  4MTE A;  1RI7 A;  2M34 A;  4PJL A;  1VQO I;  4Y17 A;  1BI2 A;  2GAU A;  3M8E A;  1ZN2 A;  3CP8 A;  1J59 A;  1GHC A;  3CJR B;  4G9Y A;  2I8D A;  3J7Y J;  3WTY C;  2NVU B;  3I54 A;  2F6C A;  1ETW A;  5HDK A;  4BBS J;  2RQQ A;  1KON A;  1X1A A;  3OYI A;  1WJC A;  5H6R A;  4E7L A;  1KZH A;  1R1T A;  2F5V A;  3OMY A;  1STZ A;  3LSI A;  4UUT A;  5H6Q A;  4HSR A;  4ENK A;  4ESF A;  2BXZ A;  4PJJ A;  3S2W A;  4CCJ A;  2E1M C;  1VND A;  4BBR J;  1I50 J;  1E0E A;  3OIO A;  3SZP A;  4XK4 A;  2DOA A;  2F5F A;  2QSH X;  4LJZ F;  1OKR A;  4V2F A;  1W0U A;  3MN2 A;  2KIU A;  1IO2 A;  3I71 A;  3QP5 A;  1ZRC A;  1ON2 A;  4M6X A;  1FC3 A;  1I5Z A;  3SZT A;  1TWA J;  1CGP A;  1LQ1 A;  4OIO F;  3OL4 A;  3W6K B;  4XSZ F;  1IAW A;  5F27 A;  2NVQ J;  3J7Z I;  1JTX A;  1MZB A;  2L7M P;  4D1Q A;  4S0H B;  1H88 C;  2ELK A;  3NRV A;  4E7H A;  5BPI A;  1TT5 B;  1D1A A;  2IGO A;  3ZQC A;  1WRJ A;  2Y75 A;  2PLY A;  3JR9 A;  1MBJ A;  3BC8 A;  1W7P A;  2XAH A;  1TL8 A;  2GWR A;  1K61 A;  3J81 Z;  3JAM Z;  1DP3 A;  4KN4 X;  3C3W A;  3F8C A;  2WY8 Q;  4ABZ A;  4G7H F;  1HW5 A;  3WG7 H;  4II3 A;  3ABT A;  2X9D A;  3S2H J;  3E3V A;  4Y4R A;  4PGG A;  4I99 C;  4AIH A;  2I5U A;  4IPA A;  1XMX A;  4ZH4 F;  1WHU A;  1UB9 A;  2BY1 A;  4BEH B;  4BH9 A;  1X1D A;  2H6C A;  3OR2 C;  2DU9 A;  1DDN A;  2NVX J;  3TBI A;  2CV0 A;  2KIS A;  4ZYD A;  3HHH A;  2FML A;  2KPM A;  2E2I J;  1TQM A;  3KYC B;  5DUI A;  4JOM A;  4LOC A;  1UJ8 A;  3BG5 A;  1TWH J;  2WA0 A;  4DYC A;  4HQE A;  1W36 C;  4L0Y B;  2IS2 A;  2Y2Z A;  3GME A;  5HDG A;  2K9L A;  2MLG A;  5LEK A;  1J09 A;  3RTR A;  4OU0 A;  3CCL I;  4C2U A;  5LEJ A;  2DOD A;  2DQL A;  3KX2 A;  1JGG A;  4ZYA A;  3VYS B;  1HBX G;  3FMS A;  1S6L A;  3CJT B;  1PDN C;  2DBB A;  1JKR C;  5B5E C;  2KDO A;  3GW2 A;  3N97 A;  2LF8 A;  2O8X A;  2HYF A;  2JPB A;  2DTZ A;  3LMM A;  2MBF A;  1ZGJ A;  3S3N A;  4V19 K;  2F5D A;  5AIQ A;  1T0F A;  1IRF A;  3WU2 C;  3ZMV A;  4XID A;  1YJ9 I;  2DA4 A;  3KP5 A;  2QF7 A;  4Q48 A;  5DCF A;  1HLV A;  2QBY B;  3ZPL A;  3UNG C;  3K4L A;  1JUS A;  1UHM A;  4WCG A;  3LL7 A;  4B1R A;  2EIJ H;  1FX7 A;  4OAY A;  5J8C A;  1FSE A;  1WJD A;  1VF9 A;  2X6O A;  3O3K A;  5IT9 K;  4GRI A;  2V79 A;  4F3Q A;  2M0C A;  2DA2 A;  2M30 A;  2ISZ A;  3WHB A;  2VKE A;  4A3C J;  3H5N A;  4ASN A;  2EIM H;  5KAI C;  3TDZ C;  2IS6 A;  4WK8 F;  4V2G A;  1U0J A;  1U5T C;  2HQN A;  4QLC U;  4Y13 A;  5EEG A;  3F9K A;  3Q9V A;  2QCO A;  1VQ4 I;  2YPR A;  4B48 A;  2BHZ A;  3E5Q A;  1IUY A;  3CJQ B;  2EH3 A;  5JR3 A;  1S7E A;  1GT0 C;  5FGM A;  3JSP A;  4XQF A;  2FBK A;  3C2G A;  3CDL A;  2CUZ A;  3GLX A;  2HVS A;  4UB6 C;  4UNO A;  3C18 A;  1IN8 A;  3K69 A;  4B3X A;  4EGY A;  1U8R A;  2LD5 A;  3OYH A;  3BP8 A;  1DGR M;  5LLQ A;  2HOA A;  3CD6 I;  4IOC F;  2LMD A;  4LFU A;  2VJJ A;  3L2V A;  2OD5 A;  4R1H A;  2COB A;  3LSH A;  3MKW B;  1Z3X A;  5HLG A;  4KJZ A;  4D7M A;  2VXD A;  1LEB A;  4WXD A;  3SYT A;  3DTI A;  1O7L A;  1G3T A;  2R93 J;  2DMN A;  2CRG A;  1USS A;  1IDY A;  3SFZ A;  5E8G A; 
#chains in the Genus database with same CATH homology
 5F08 A;  3M3Y J;  1WH7 A;  3QQA A;  2XRL A;  3FK7 A;  5IOZ A;  3JRE A;  3RKQ A;  1IC8 A;  2AHQ A;  3GTP J;  3QPS A;  1ITY A;  1POG A;  5EYR A;  5FKO A;  1QVT A;  4BKX A;  5EDN A;  5C4J J;  1QPI A;  1B72 A;  3LSR A;  1MSF C;  1AKH A;  3A02 A;  4JX4 A;  1JKO C;  1JTY A;  1TC3 C;  1MH4 A;  2G0E A;  4A3B J;  1T56 A;  3GTL J;  2NVT J;  1X2M A;  2TRT A;  3W6V A;  9ANT A;  2M9H A;  1PUF A;  2HQ5 A;  4A3K J;  1FIA A;  3HBL A;  3O8H A;  1P7I A;  4FE7 A;  2HOS A;  4JP0 A;  5FKL A;  2DA7 A;  3TED A;  4UUS B;  5F0H A;  2CQQ A;  4MFD A;  5GPA A;  5E3M A;  1ZR2 A;  1AHD P;  1IJW C;  1ETX A;  3JRD A;  3JRC A;  3HOU J;  5K7H A;  5IYC J;  5FLM J;  1IGN A;  2YS9 A;  5DS9 A;  3ZQH A;  2JMW A;  1T33 A;  2CUF A;  2AO9 A;  2OF7 A;  2JA8 J;  1P7J A;  1XC5 A;  2VPR A;  1ZGW A;  3BR2 A;  2HXI A;  5GP9 A;  2KDZ A;  1VFC A;  2O8K A;  3A03 A;  1NK2 P;  1TWC J;  2D5V A;  2B63 J;  5JLW A;  4IEJ A;  2YUS A;  2W48 A;  1FIP A;  3S1N J;  3WHC A;  2ID3 A;  3K2A A;  3HB9 A;  3PO3 J;  3GTM J;  3S2D J;  2MSY A;  3ZQL A;  2CU7 A;  4JX5 A;  3H3V K;  4JX6 A;  1UG2 A;  2XSD C;  1UHS A;  3G1M A;  3OSF A;  3B6C A;  3RQI A;  2KT0 A;  2MG4 A;  3ZQG A;  4FTH A;  3PO2 J;  3IH3 A;  2LVS A;  5FKK A;  4Y52 J;  4XIC A;  3G1L A;  2DA5 A;  1WH5 A;  1U78 A;  1MBK A;  2M2E A;  1WGX A;  2CUE A;  4GFB A;  1JKQ C;  3GTQ J;  5EGO A;  5IP9 J;  2ECC A;  2XPW A;  2R92 J;  1FEX A;  3ZQF A;  1IV6 A;  3IH4 A;  2K40 A;  3BQY A;  4JYK A;  3ZOB A;  3SJM A;  1RKT A;  3HEF A;  2MGQ A;  3S15 J;  3PM1 A;  1JKP C;  2E19 A;  1IRZ A;  4AUX A;  2R5Z A;  3BTC A;  2GM4 A;  4BY1 J;  2LY9 A;  3ZQI A;  4G12 A;  4FCY A;  4XRM A;  4J19 A;  2LFB A;  4D7N A;  1F43 A;  2LLK A;  1JUM A;  4RBO A;  5J3L A;  2CQX A;  1W0T A;  3HGY A;  2JK3 A;  2L0K A;  3CCY A;  2EZI A;  1OCT C;  5EZH A;  4A3J J;  1CQT A;  3D1N I;  1E3O C;  1TWG J;  3S1Q J;  4QSH A;  2JJ7 A;  1X58 A;  4IHW A;  1DU6 A;  1NK3 P;  2XGC A;  2TCT A;  1GVD A;  3NAU A;  1D5Y A;  2XGE A;  2DJN A;  2ME0 A;  3JRB A;  1JUP A;  1MBG A;  1EF4 A;  2H8R A;  3LOC A;  5C44 J;  4D5C A;  4C3J J;  3B6A A;  4A3I J;  1YRN A;  2NOG A;  3HM5 A;  4D5F A;  1FTT A;  1HDP A;  2DN0 A;  2LTP A;  5J1U A;  5JLX A;  4A3L J;  3BR6 A;  5HOD A;  4C3I J;  1GDT A;  2R7Z J;  4FE4 A;  4X6A J;  2IAI A;  2HOT A;  3M4O J;  5E3N A;  2Y31 A;  5GPC A;  3RZD J;  1APL C;  4QIW N;  2ECB A;  1OJL A;  2PMZ N;  4XRS A;  1RET A;  5EG0 A;  1I3Q J;  1BW6 A;  3BG9 A;  3TP0 A;  3JRI A;  1JJ6 C;  2E2H J;  2JN6 A;  1MBH A;  2RAE A;  2H1K A;  1LFB A;  1ENH A;  4DYR A;  2ME6 A;  5FJ8 J;  1Y1W J;  1QVU A;  2DMT A;  1ZKG A;  3MVP A;  1X2N A;  1GV5 A;  5F0C A;  1ZQ3 P;  1HF0 A;  1SAN A;  2LR8 A;  3CQZ J;  3FKI J;  4M3F A;  4M3E A;  3SDG A;  4CYC A;  2K9N A;  1HCR A;  2N8G A;  4B4C A;  3LNQ A;  2OPT A;  3HOV J;  5E3L A;  2L9R A;  3FIS A;  5IOY A;  2DMQ A;  3C2B A;  5M5X J;  3JRF A;  1GUU A;  1U8B A;  1MBE A;  2L7Z A;  1B72 B;  3VPR A;  1VI0 A;  4M6V A;  1AKH B;  2O9L A;  3LSP A;  2HI3 A;  3F0C A;  2Y9Z A;  2GBY A;  2JA5 J;  1BW5 A;  4W1U A;  1B8I A;  4DZJ A;  2X48 A;  1PUF B;  5M5W J;  5C4X J;  1ORK A;  3BR5 A;  1BJZ A;  3GTK J;  2K9S A;  4W97 A;  3HGG A;  4I6Z A;  2O7O A;  1LE8 A;  4A3G J;  4L5E A;  3S16 J;  3MKL A;  3BTL A;  3JRG A;  1ETQ A;  4Y7N J;  5FKM A;  3DEW A;  1H89 C;  2DA6 A;  2E1O A;  4DW6 A;  4HNV A;  1BL0 A;  1OCP A;  2EZK A;  4MFE A;  5C3E J;  2FX0 A;  3SFI A;  2R5Y A;  2DMU A;  1Z77 A;  5J1Y A;  1ETK A;  3S1M J;  3IV5 A;  4QTR A;  4AYB N;  5M3F J;  2YU9 J;  1WPK A;  2WAQ N;  3A01 A;  4XRS G;  2P81 A;  1JJ8 C;  1A6I A;  1ETO A;  2WV1 A;  2R0Q C;  1DU0 A;  3G1O A;  1H8A C;  3BT9 A;  3HDD A;  3DCF A;  3H0G J;  1Z0X A;  2JA6 J;  4IHV A;  2JA7 J;  3LSJ A;  4DYQ A;  2WB1 N;  3GTG J;  2M34 A;  3BR1 A;  1SFO J;  5EGO B;  4M3D A;  4IHX A;  3TP3 A;  4MLO A;  4A3F J;  1ETW A;  3Q0V A;  4BBS J;  2DMP A;  1ETY A;  2R5Z B;  3BG3 A;  2DA3 A;  1OFC X;  1AU7 A;  3S17 J;  2FJ1 A;  2XB0 X;  4UUT A;  2LKX A;  3QPL A;  5J1R A;  5FKN A;  2EBI A;  1VND A;  4BBR J;  1I50 J;  3NAR A;  3OIO A;  4M3B A;  5F04 A;  1GV2 A;  3BR3 A;  4XK4 A;  4IHY A;  1A5J A;  3JRA A;  4V2F A;  1W0U A;  3MN2 A;  1HOM A;  3BR0 A;  2VI6 A;  4DZP A;  4UUS A;  1MNM C;  1U9N A;  3K7A J;  2MW8 A;  1TWA J;  1RR7 A;  2XGD A;  1WCM J;  4C3H J;  4FIS A;  1WI3 A;  1UMQ A;  5F27 A;  5EZG A;  5IYB J;  2NVQ J;  5K7Z A;  1JTX A;  3GBG A;  2L7M P;  3FK6 A;  1BA5 A;  3HOW J;  4S0H B;  1H88 C;  2ELK A;  1LFU P;  2LK2 A;  2NS8 A;  3TW7 A;  3ZQC A;  3JR9 A;  1MBJ A;  2FQ4 A;  5M3M J;  5IP6 A;  1K61 A;  2GLO A;  3HKZ N;  1YRN B;  4ABZ A;  2Y9Y A;  5M5Y J;  2X9D A;  3S2H J;  1Y1V J;  4MO7 A;  3O8G A;  2HDD A;  2XB5 A;  4B3A A;  2NVX J;  2HXO A;  2VKV A;  3BTJ A;  1MBF A;  4AC0 A;  5F0F A;  2ID6 A;  2E2I J;  1R9T J;  3LSG A;  1RES A;  4A3D J;  4C2M J;  4LOC A;  5EG0 B;  1ZK8 A;  3BG5 A;  1TWH J;  4DYC A;  3GTO J;  3E7L A;  1IG7 A;  1I6H J;  2L7F P;  3IH2 A;  2Y2Z A;  4I76 A;  3S1R J;  2IEK A;  1IDZ A;  1JT0 A;  3TW6 A;  2K9Q A;  3GTJ J;  4A93 J;  1JGG A;  1U9O A;  1JKR C;  1XG1 A;  4CYC B;  3HOZ J;  2DTZ A;  2NS7 A;  2I10 A;  3BQZ A;  4BY7 J;  3Q0W A;  4A3M J;  1JT6 A;  2JWT A;  4XID A;  3I4N J;  4A69 C;  4BXX J;  3JRH A;  4A3E J;  2DA4 A;  5BNG A;  2QF7 A;  1HLV A;  5E3O A;  2Y0S N;  3OSG A;  3S14 J;  1B8I B;  1JUS A;  2EQR A;  4B1R A;  1F36 A;  3CMY A;  3UKG A;  1VF9 A;  2X6O A;  1LE8 B;  2M0C A;  2DA2 A;  4NDL A;  2E2J J;  2HYJ A;  3WHB A;  4MIM A;  3I4M J;  5FLV A;  4RDU A;  1MSE C;  2M8G X;  2VKE A;  1HDD C;  4A3C J;  3RZO J;  1TWF J;  4EEF G;  4V2G A;  3L1P A;  2R5Y B;  5DTD A;  2EZL A;  3OOU A;  1ZTR A;  1RKW A;  2Y30 A;  3HOY J;  2QCO A;  5IPA A;  2IBD A;  2EH3 A;  1S7E A;  1XS9 A;  1GT0 C;  5K7F A;  3FIW A;  1FJL A;  4X1E A;  1K83 J;  2VUM J;  5EF6 A;  2XPU A;  3A01 B;  3CDL A;  3Q0U A;  5IP7 J;  2ZB9 A;  1NTC A;  3Q3S A;  1QRY A;  1IUF A;  2CJJ A;  2LD5 A;  1ZR4 A;  2HOA A;  5EEA A;  1ETV A;  2COB A;  2EZH A;  4D7M A;  1MH3 A;  1RPW A;  2DA1 A;  1O4X A;  2LP0 A;  2NVY J;  5F1J A;  3HOX J;  2FD5 A;  2XPV A;  5IYD J;  1G2H A;  2R93 J;  2DMN A;  1Q1V A;  4M3G A;  2CRG A;  1IDY A;  3BTI A;  1FTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...