1YRNB

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
b'TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
molecule tags Dna binding protein/dna
source organism Saccharomyces cerevisiae
publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnB00
3OIOA 4A3BJ 3BTJA 2CUFA 4V2FA 2DA2A 1ETOA 4X1EA 2GLOA 4IHWA 3BTIA 1UMQA 3IH2A 3MVPA 1VNDA 1PUFB 1WPKA 3LSGA 3MKLA 1TWCJ 5M5XJ 4JX6A 2R92J 2R7ZJ 4JX4A 1ETKA 3G1OA 3BTCA 1JJ6C 1IGNA 1QPIA 3I4NJ 2E1OA 5IP7J 3F0CA 1JKRC 2DMNA 2HOAA 3TP3A 3GTKJ 4A93J 4B4CA 5E3NA 4MLOA 3S1RJ 1VI0A 2NVYJ 3JRCA 4BY7J 1AHDP 2YS9A 1AKHB 3S17J 3BR3A 3B6CA 4BBRJ 5F0CA 3HOYJ 1FIAA 2R5ZA 5EG0B 2JA6J 1E3OC 3GTMJ 2FJ1A 2XGEA 2HOTA 2JA8J 1GVDA 1BW6A 5JLXA 1TWHJ 2WV1A 4M6VA 1W0UA 4LOCA 3TW7A 1IC8A 2PMZN 5FLMJ 2JMWA 1ZR4A 1JJ8C 3JRFA 2Y0SN 2XRLA 2DA6A 1JUPA 1D5YA 2EH3A 3BR0A 5M5YJ 1ZTRA 2K9SA 1MBKA 1T56A 5EZHA 5FKLA 1Z77A 1RPWA 3JRGA 1ZQ3P 2E2HJ 2AO9A 3GTQJ 1ETYA 4MO7A 2NVXJ 2Y9ZA 2JA5J 2FD5A 3C2BA 4C2MJ 1MNMC 1IRZA 2EQRA 5FJ8J 3JRBA 1JUMA 3BQZA 3OSFA 2MG4A 2ME6A 3DCFA 1ZKGA 3H0GJ 1UG2A 2LTPA 2HI3A 2WAQN 3B6AA 5K7ZA 1WCMJ 1K83J 4UUSB 3M4OJ 3RQIA 1U8BA 3H3VK 2X48A 2DA4A 3JR9A 2M8GX 2DTZA 5JLWA 1NK3P 1W0TA 3GTOJ 4I76A 2M34A 4D7NA 1DU0A 4BXXJ 5FLVA 3HDDA 1RKTA 5F27A 1LE8B 4XIDA 3Q0UA 3SJMA 2HXOA 2LK2A 4QIWN 1R9TJ 2D5VA 3S14J 4FCYA 4BBSJ 4W97A 5J1YA 2IEKA 3FK7A 3HOUJ 4S0HB 4M3BA 5DTDA 2E2IJ 3K2AA 4MIMA 4AYBN 2Y9YA 3K7AJ 4A3EJ 2ID3A 3S16J 2MGQA 3ZQCA 4DYRA 1X2MA 3G1LA 5EEAA 4A69C 4IHXA 3M3YJ 3FIWA 4XRSG 2HYJA 1RR7A 1TWAJ 2COBA 1Z0XA 1ETVA 2B63J 2NVTJ 1CQTA 2RAEA 4DYCA 1ETQA 5FKNA 1ITYA 4L5EA 4C3IJ 3BR6A 1GDTA 1BW5A 1ZR2A 1IV6A 3NAUA 3Q3SA 4D7MA 4MFEA 1ETWA 2E2JJ 3IH4A 2IAIA 3BT9A 5E3MA 4XICA 3BQYA 1AU7A 5F0FA 1ZK8A 3W6VA 4A3LJ 1OFCX 3HEFA 3VPRA 2TRTA 3FK6A 2DN0A 3S1QJ 1JKOC 4A3IJ 3TEDA 2CU7A 3HOWJ 3ZQGA 4B3AA 3JRIA 4EEFG 2EZLA 4D5FA 2QF7A 2CQQA 1QVTA 1U9NA 5E3OA 1MBJA 4FISA 2W48A 2MSYA 2DA7A 3QPSA 4XRSA 1FEXA 4M3DA 5BNGA 3PO3J 1XC5A 4I6ZA 1JT6A 4M3EA 4D5CA 4C3HJ 1BJZA 4A3MJ 2NS7A 2L9RA 2ECCA 1MBFA 3HBLA 2XGDA 4DYQA 2DA1A 4A3KJ 2R0QC 1OJLA 2DMTA 1JTYA 1HOMA 1RESA 1JGGA 4W1UA 1POGA 1MH4A 1BL0A 1MSEC 2XSDC 2I10A 4MFDA 2JJ7A 3PM1A 1A5JA 2ELKA 5C3EJ 4UUSA 2GBYA 1APLC 2O8KA 3ZQIA 2OPTA 4ABZA 1QRYA 3MN2A 2EZKA 2ZB9A 2CUEA 3JREA 1RKWA 1LFUP 1LE8A 1QVUA 2G0EA 1F43A 3OSGA 3UKGA 4JYKA 3LSJA 2LD5A 3OOUA 1Y1WJ 3Q0WA 1T33A 3ZQFA 4NDLA 1HF0A 1I6HJ 3QPLA 1A6IA 5IYCJ 3HM5A 2EBIA 1H8AC 3Q0VA 1S7EA 1MH3A 4RBOA 1ZGWA 2HDDA 4BKXA 1UHSA 2H8RA 1WH7A 3RZOJ 4M3FA 4HNVA 2R5ZB 5FKKA 5IOYA 1VFCA 1IJWC 4J19A 5GPAA 1IG7A 4QSHA 5EZGA 1IDYA 3ZQHA 5K7HA 5IP9J 3S15J 2K40A 4XK4A 2E19A 1JTXA 1O4XA 1FTZA 2DMQA 2O9LA 2LKXA 4V2GA 1OCTC 3IH3A 2VKVA 4AC0A 2JN6A 2L7MP 2LY9A 2DJNA 4QTRA 2JK3A 9ANTA 3HB9A 1ETXA 1RETA 2ME0A 2XB5A 5M3FJ 4X6AJ 1F36A 2L0KA 4C3JJ 4IHYA 1H88C 4IEJA 1U9OA 1WI3A 1BA5A 5J1RA 1XS9A 2H1KA 3O8GA 2L7ZA 5EYRA 3GTJJ 1JUSA 5F0HA 5GP9A 5FKOA 3LSPA 4CYCA 4B1RA 3JRAA 3LOCA 3JRHA 3CMYA 2R5YA 3HGYA 5EF6A 3NARA 1IUFA 1IDZA 2EZHA 1WGXA 5M3MJ 2YU9J 2JA7J 2NS8A 5IYDJ 3CCYA 2CQXA 3G1MA 3TW6A 3SDGA 1MBEA 3SFIA 3ZQLA 2EZIA 2LR8A 5C4JJ 3IV5A 3RZDJ 4DZPA 5C44J 2M2EA 5EGOA 2K9NA 3LNQA 4BY1J 3O8HA 2VPRA 2DA3A 5F1JA 1FJLA 1OCPA 1U78A 3HOVJ 5EG0A 2L7FP 1MBGA 1I3QJ 4RDUA 1DU6A 1AKHA 2CRGA 4FE7A 2O7OA 2YUSA 1MBHA 3HOXJ 3BR5A 2CJJA 1SANA 5EDNA 1HDDC 2WB1N 1P7IA 3CDLA 3BR2A 4IHVA 5E3LA 3S1MJ 2GM4A 4A3FJ 1XG1A 2LLKA 3E7LA 1X58A 4UUTA 1PUFA 4FTHA 3HOZJ 1YRNA 5IP6A 2Y2ZA 2FQ4A 1LFBA 1Y1VJ 3GTLJ 1X2NA 4M3GA 2K9QA 2IBDA 3FISA 2DA5A 3HKZN 2LFBA 1JKPC 2X9DA 3BG5A 2HOSA 4A3DJ 2XPWA 3L1PA 4DZJA 5GPCA 4G12A 3JRDA 2TCTA 4A3GJ 2VI6A 1SFOJ 3S1NJ 5IYBJ 3A01B 2KT0A 1B8IA 2JWTA 1HLVA 1K61A 3BG3A 2LP0A 2DMPA 1WH5A 1JT0A 1GV5A 1MSFC 3S2HJ 5J1UA 1NK2P 2XPVA 3PO2J 3GTPJ 1HCRA 2QCOA 2VKEA 4GFBA 1FTTA 2MW8A 3D1NI 2Y30A 4AUXA 2P81A 5J3LA 4DW6A 5DS9A 1B8IB 1TWGJ 3A01A 2VUMJ 1B72A 4A3JJ 5F08A 3BR1A 4FE4A 4JP0A 5IPAA 3S2DJ 5FKMA 3A03A 2KDZA 2R93J 4CYCB 3DEWA 3HGGA 4Y52J 1P7JA 1GT0C 2LVSA 1EF4A 1JKQC 1GV2A 3CQZJ 2Y31A 4XRMA 1B72B 2OF7A 1YRNB 1FIPA 2N8GA 3I4MJ 5M5WJ 1I50J 2XGCA 3ZOBA 5IOZA 2HXIA 5HODA 3BG9A 5EGOB 2ID6A 2NOGA 4JX5A 1TC3C 4A3CJ 2M9HA 3FKIJ 1HDPA 2X6OA 3TP0A 1VF9A 3LSRA 2HQ5A 2ECBA 3QQAA 2M0CA 3A02A 1G2HA 5C4XJ 1GUUA 2DMUA 2AHQA 1H89C 3GTGJ 2R5YB 3WHBA 2XPUA 1ENHA 5K7FA 1TWFJ 1NTCA 2FX0A 3BTLA 1Q1VA 2XB0X 3WHCA 5F04A 2NVQJ 4Y7NJ 1ORKA 3RKQA 3GBGA
chains in the Genus database with same CATH superfamily
3CCRI 3AL0B 2KDOA 2VBXA 4A3BJ 1Z9CA 4M74A 1R1UA 3M9AA 3IH2A 1UMQA 2COMA 1WPKA 3MKLA 2VJJA 5M5XJ 1RNLA 4F7ZA 2DQLA 3ROUA 1XGOA 4IO9F 3JTHA 4MTDA 5K5RA 1TL8A 2X51A 1N77A 1MGTA 3G1OA 3BTCA 4MHGA 2V1NA 3DWLE 5IP7J 5E1ZB 2KIFA 3IHUA 4A93J 2HOAA 1WJFA 4B4CA 3WE2A 2L3DA 4BY7J 1FBQA 5DM7F 1BI2A 1R5GA 3B6CA 3V7RA 5F0CA 4BBRJ 2R5ZA 1XCBA 1FBUA 3BROA 5JLXA 2V9PA 3DPTA 3TW7A 2ZFWA 1IC8A 4XN0A 1BR2A 1TBXA 2CW7A 2VQHA 5FLMJ 5FLXZ 2JMWA 1ZR4A 3PJRA 3T8TA 1R22A 4M6XA 5TISC 2P4WA 1SFUA 1JUPA 3OIPA 2FNPA 1WHUA 1WJAA 1FMWA 1WJ5A 1FNNA 1D5YA 5EZHA 2CG4A 5DDGA 1R1TA 2AO9A 2DFHA 3GTQJ 1FZPB 2VQCA 4BDYA 2YU3A 1U0JA 3HYIA 1EJ9A 4PDKA 4MO7A 2GXBA 1QZZA 1WSUA 5ICFA 3QU3A 4BL0B 2L2OA 3DTEA 2ZSHB 4UXNA 2DI3A 2X6XA 3BQZA 2L9SA 5DCFA 2HEOA 3ZGKA 2O0YA 4U7BA 2HNHA 2QWWA 3KIOA 4WF2A 1R6RA 2GWRA 1WCMJ 5IT9K 2L9NA 1FP1D 1V5FA 2W25A 3H3VK 3HPGA 1HSTA 3U1KA 4KIBA 1D8KA 5KNLA 2XV4S 2M8GX 2EIKH 2RGVA 5LEJA 1MMAA 3F72A 1W0TA 3K6GA 5GAHJ 4I76A 4MQ9F 1DU0A 4MNUA 5F27A 4XIDA 3SJMA 4RGSA 2HXOA 5ICEA 2LK2A 2DAOA 2DJIA 1ZYRF 3ZP5A 4O3MA 3G4SI 1R9TJ 3H5NA 2D5VA 2E7WA 5ILUA 1BBYA 3ZMVA 4BBSJ 2YR2A 3SQNA 1O7FA 3VYUB 2D1HA 2IEKA 3CCMI 3FXLA 4M3BA 3DP7A 1S9HA 4MIMA 1QZEA 5LEKA 4G6TB 3HRTA 1X19A 2DU9A 1XD7A 3GXOA 5IY5H 4HEA2 1I27A 1LVAA 4XKWA 2Y69H 4Z2YA 3CJQB 4EQQA 1GLNA 2M1BA 1KU3A 4DYRA 3ONQA 3OL4A 1O3TA 2VBWA 3G1LA 1N75A 2F5DA 4PK4A 3FZVA 2XGXA 4F92B 3PFYA 5CVRA 1IRGA 1U3EM 5E8IA 1USTA 1X3UA 2ADUA 5TGTA 3QU6A 1Z6TA 3JSOA 1ETVA 2B63J 2NVTJ 1CQTA 3KZIC 4C3IJ 2V1DA 2AXLA 2GA1A 4BQNA 1HA8A 3CC2I 4D7MA 5AIQA 4MFEA 3QP6A 2M7BA 3IAM2 5F0FA 1H9GA 2HPMA 3I54A 2E1NA 2XHKA 3O2PE 3TO9A 3FK6A 4G9YA 2DN0A 1JGSA 5DD4A 2EJRA 2F5VA 1ZG3A 4HAMA 4R79A 5ICGA 2B9SA 3GF2A 3TEDA 2CU7A 4DBQA 3AG4H 1V54H 3MKYB 3KYCB 3ZMTA 3JRIA 4EEFG 5HS7A 1XDSA 2WBMA 1QVTA 5DUKA 1U9NA 1I39A 4HPQA 2E1CA 2W48A 2WADA 1V55H 5BNGA 2HZDA 3PNTA 3VYTB 1Z3YA 4EJWA 1YJ9I 2LKPA 3HG9A 1HW2A 2NS7A 1Z3XA 2QM3A 1VQOI 1O7LA 2R7OA 4KUMA 4HRIA 2BW3B 2ZXIA 2XGDA 4JOMA 4DYQA 3V8JA 4A3KJ 2STWA 4IJAA 3F8NA 3K9TA 1OJLA 3CD6I 2DMTA 1JTYA 2VJIA 4BE2A 2W24A 2WB1A 3VDXA 2QQ8A 3FM5A 3P9KA 5ICCA 1MH4A 1P6RA 1IN4A 1WJCA 2XIGA 5FGMA 1F9NA 2XSDC 2OUMA 4N4NB 5HLIA 3E0JB 3CJTB 5GTHC 4XSZF 2NNYA 1HC8A 2V9VA 4L9VA 2ELKA 3C2GA 1B9MA 1IV8A 4OU0A 2KMUA 3HUGB 3MN2A 3CCEI 1K6OA 3OS1A 3ZN0A 2ELJA 1G8XA 3J80Z 1S6LA 1J9IA 1RC9A 3TQNA 1X1AA 3LSJA 4P5OA 4E7JA 3SZTA 3LA7A 5B5EC 2XC7A 3F21A 2IW5A 4KN7X 4NDLA 3NWTA 1HF0A 2DFEA 4ZH4F 3NEUA 1YS7A 5D5UB 1A6IA 2QQ9A 2IGMA 4YIFA 3FWEA 3RKYA 5BPIA 2BY2A 4D1QA 5J4VA 5H2FC 3K4KA 1BI1A 2XF5A 4RBOA 5J8CA 2HDDA 3OYLA 5GAEJ 1XB4A 4BKXA 3KYLA 1K6YA 1WH7A 2W82A 1TQMA 3LFUA 3IKVA 4HNVA 3QPHA 2R5ZB 1VFCA 1E3PA 4J19A 1U5TC 2Z5UA 4IZZA 2KIQA 3LFKA 5K7HA 1K4SA 4NC6A 4BE0A 4GCVA 4XK4A 4AM3A 1JI8A 4I99C 3JW4A 3RCOA 2DMQA 2O9LA 5TRDA 4CICA 4UNOA 4CCJA 1Z05A 1VQ7I 3CDHA 3GWZA 3FXQA 2ISZA 2DJNA 2HPIA 3BLYA 4QTRA 2X1EA 3V8KA 2XF6A 2ESHA 1RETA 2XB5A 2BGCA 2KHMA 3T0YA 3QRFF 3I56I 1FYMA 3O6BB 2ZJQF 3O3KA 2H1KA 4CO8A 1AWCA 2BHZA 2KRFA 5F0HA 3GTJJ 1BC7C 3TOBA 4NB5A 2A6TA 2M87A 3WU2C 3OY9A 3LSPA 4CYDA 4B1RA 3ELKA 4ZYHA 1KQ9A 3LOCA 1WJEA 1J0RA 5A2QK 3MKWB 3CMYA 1IUFA 2LY2A 1G6NA 2EZHA 4CDGA 1ZRDA 1ERDA 3GMEA 4U7DA 1T0FA 3TW6A 5LHHA 4YFKF 1MBEA 2K3PA 4OMZA 4XLNF 4BGDA 2EZIA 2CQNA 5C4JJ 3IV5A 1CF7A 4DZPA 3CCVI 1VQ4I 4M73A 2KJCA 4CH7A 3WODF 3TL4X 3I64A 3LNQA 4EJUA 1BJAA 4L5IA 1FJLA 2L7FP 1MBGA 1SC7A 1BIAA 3KP3A 3I59B 2FBHA 3KX2A 2CRGA 3RPUA 2QYOA 2CO5A 4FE7A 3GX4X 1T0FC 4ASNA 1MBHA 3SHFA 5J47A 2OV7A 4I02A 1HDDC 4WCGA 2VBYA 1D0ZA 2OQGA 4PJNA 1P7IA 2PMUA 3CDLA 3GLLA 2HGCA 2BV6A 2XSJC 4D0PA 4ZDPA 2HFHA 1OQYA 4A3FJ 2GM4A 3H9QA 2WWYA 4UUTA 2LSOA 2RVCA 1PUFA 4FTHA 1G59A 4OMYA 3K0LA 2Y0MA 2HOEA 2VXDA 1IRXA 3HPHA 1YFHA 4BJ5C 2HYFA 3LSTA 4KJZA 4XSXF 3RJPA 3HKZN 3VB2A 1JKPC 2HOSA 1C0WA 1RZ4A 2XPWA 3L1PA 4L9TA 4RMNA 1W5SA 3CLQA 2BHYA 5GPCA 2FXAA 2DT7B 2CW0F 2TCTA 4CCOA 1DP7P 1UFMA 3S1NJ 5IYBJ 1DPRA 4XLFA 1IN8A 2PMHA 2ZNYA 5LGTA 1RUNA 3GFMA 2JWTA 4ZC3A 1OCCH 1OPCA 3IUOA 2LP0A 3GEZA 2CV2A 2QBYA 1XGNA 2LREA 2QKMB 2GA2A 2XRNA 1KU7A 4BXUA 1MSFC 3S2HJ 3DXJF 3JSPA 4YG2F 1U5TA 2DK5A 2E1MB 3W6KB 5FRNA 1XSVA 3VYSB 3DF8A 2QCOA 4A0ZA 2K9LA 6PAXA 1VQPI 2ZC2A 2L01A 2Y30A 2IA2A 5J3LA 4DW6A 2W7NA 4RB0A 1PYVA 2I8DA 3A01A 2VUMJ 2JT1A 3BJ6A 2BE5F 2KIMA 2DK8A 2KRHA 4I2OA 3S2DJ 1MNEA 1XN7A 1R58A 2MD5A 2R93J 3HGGA 3VOEA 4G6DA 4PSWA 3DLAA 2MLKA 2NRAC 4Y52J 1GT0C 2LBFB 5CYVA 4RS8A 1JKQC 2PN6A 4UVBA 2DQRA 3MFKA 2UUZA 1D8JA 4EJOA 4KIFA 4XRMA 3KLOA 1B72B 1VQ8I 3LAJA 1EH8A 2JVHA 1YRNB 1FIPA 4HZFA 2JTVA 3IAS2 4LG0A 2XGCA 2HDWA 3ZOBA 1FOKA 3GW2A 2HXIA 3AFHA 2ETHA 1VTNC 1U5TB 5HS8A 4A3CJ 2QLZA 2G9WA 4F3QA 2X6OA 3TMOA 4B44A 2QBYB 2HQ5A 3ASNH 3F9KA 4QLCU 3HSEA 5LD2C 2EV6A 1GUUA 3KEQA 2NAZA 2KL4A 2CQ7A 2R5YB 3WHBA 5K5OA 4G7HF 2XB0X 3BTLA 2PX9A 4ZDOA 5TJJA 3VFZA 3WHCA 3KZZA 5F04A 2NVQJ 4MQVA 3KP7A 2DBBA 2VQLA 3D0SA 5IT9Z 4RM2A 1T08B 3BTJA 4V2FA 4YELA 5DM6F 3MZYA 2W85A 2R7UA 3CO7C 3OYEA 3K4MA 2DODA 3CCSI 1ZLKA 3CC4I 1L0OC 3TDZC 2R92J 2R7ZJ 3DBLB 1ETKA 2R7WA 1JJ6C 1IGNA 2E1OA 4E7ZA 3F0CA 2DFFA 5FD6A 3S1RJ 2IJLA 4FASD 2PI0A 1AKHB 4BACA 2L5QA 3CUQA 3K4NA 3HOYJ 5EG0B 2CSOA 1LEBA 2JA6J 1E3OC 2LNBA 3GTMJ 2XGEA 4ZDLA 2HOTA 2JA8J 1GVDA 1TWHJ 2JUGA 2VL8A 3RSNA 2RC4A 4LOCA 4HX4A 4AD9A 5HDKA 5F1RA 3MKZA 4OIPF 4DOZA 3HC7A 3JRFA 2GXGA 1H0MA 2H6CA 5L3EA 5M5YJ 4D9JA 3VSLA 4IKFA 4II2A 1RPWA 3VSKA 2WY8Q 4FQGA 4HQMA 3LL7A 1LFPA 3F22A 2JA5J 3C2BA 4HX7A 2JQ7A 3SFZA 3OYHA 4RB3C 1JUMA 2QSGX 5LGUA 3K10A 4HLXA 3DCFA 3D5RC 3PIOF 3PUFA 1SAXA 4ZTJA 3OS0A 3M07A 2LTPA 5CQGA 1QPMA 2BY3A 4UUSB 2Y0SA 2LY1A 3BY6A 2HR3A 2X48A 4B8XA 2P5VA 4ENNA 2DA4A 1KZHA 2BXYA 3ABKH 2UV1A 3GO5A 2M34A 4D7NA 2MFZA 4ENKA 1BR4A 3HDDA 5HLGA 2EIJH 1LE8B 1UG0A 1OCOH 3WTZA 2JRTA 3MEXA 2GXAA 3BZ6A 2DT6A 2JPBA 2GAUA 4FCYA 3ZMDA 2TDXA 3LQRA 1WVRA 3BC8A 4HX8A 2E2IJ 2KPMA 2QVOA 3K2AA 1QBJA 2OTLI 2IGNA 4IOAF 4XOTA 3CF2A 1UJ8A 5H6RA 3OIQA 4PFOA 3S16J 4L0YB 2CFOA 2KP6A 2JSPA 2DYSH 3ZQCA 2DT5A 4BJTA 1ZGJA 2L4AA 3LSIA 3GZ5A 4LG3A 2ELHA 4A69C 4FX4A 5GADJ 5BOXA 4OWRB 2DOFA 4XRSG 2OD5A 2HYJA 1ZN2A 1TWAJ 2COBA 3S32A 3HOTA 3KYDB 3RYPA 3CF5F 3WTSC 1J5YA 2RQPA 4DYCA 2ZXWH 3OL3A 3UNGC 1FC3A 4PGGA 1GDTA 3BR6A 1X1DA 1BW5A 4S04A 3D5LA 4HSTA 1IV6A 3HUGA 4RGXA 2M5WA 1ETWA 5K5QA 2E2JJ 3IH4A 2R7XA 2IAIA 3BT9A 4HW0A 2R7SA 3DEEA 4FHTA 1P4WA 3PNYA 1OFCX 4HBLA 2BVMA 1IUYA 4XKCA 4BQQA 3S1QJ 3L2UA 2CYYA 2IS4A 4XR6A 3C18A 5FFXA 3GCMA 5HLTA 1YW8A 3HOWJ 1X4PA 3V8LA 3ZQGA 3CJNA 1USSA 5EEHA 1BOAA 1A31A 2O5RA 3DBRB 2D1VA 5B3SH 2DW4A 3F23A 3F6OA 1YLFA 2E34A 5E3OA 3RQ4A 1NHAA 2UWMA 2ZNZA 5FRMA 3QPSA 5LFAA 4M3DA 2PJPA 4ETSA 2P7CB 2IP2A 5DCMB 3MD2A 3KCCA 5E1WA 1BJZA 3IWZA 4WXCA 5H20A 1TT0A 1MBFA 1XX5A 1XGMA 3AKZA 3H9GA 1D1BA 4IX7A 3CTAA 1LEAA 4LITA 2CV1A 3U21A 1YITI 1RESA 3EPZA 2UZKA 1R00A 1ZGAA 4IRHA 2F4OB 2EILH 1X1BA 5EJCA 3OYJA 1GHCA 5HLHA 4LLLA 4EJVA 2I10A 4MFDA 3JCUC 1FYLA 3PM1A 4GYIA 1A5JA 2LYCA 2GBYA 3T5XA 2IT0A 1HW1A 1APLC 1W5CC 4DJAA 2QQAA 3KZYA 2DCEA 2OPTA 5HOOA 3JTGA 2JUCA 3ZMSA 2FU4A 2ZB9A 1RKWA 1WJBA 2EK5A 5A2QZ 3HOSA 2G0EA 3IRRA 1SVLA 2VT3A 4OIRF 3OSGA 5D5XB 5FROA 2A07F 4JYKA 2RDPA 4A5NA 2LD5A 1Y1WJ 2BOLA 2XDVA 4PJ0C 1EA3A 4U0WA 4ZZDA 1T38A 1P92A 2KKOA 2W4SA 4B3XA 4PGHA 1QQIA 3IWFA 2M4KA 4ESJA 1I6HJ 2R7TA 5L3BA 4I01A 3LA3A 1VQLI 1EV7A 2A3SA 2XAJA 2FOKA 2FF4A 2LDUA 3P9IA 2LF8A 3Q9SA 2GZWA 3IL2A 3BJAA 3EUKL 4OAYA 2HTJA 4JBAA 3RTRA 1Z21A 1IG7A 2KQRA 5EZGA 4FETA 4O5VA 5AONA 3T1BA 2E35A 3G73A 4M9ZA 4JK1X 3H0DA 4H0EA 1K78B 3K69A 3QWLA 4L9NA 1YQAA 3PIPF 1FOYA 3L2WA 2LKXA 3WU0A 5ILVA 1TP4A 3FBIB 3MZ8A 1F5TA 1OCTC 1HKSA 4AC0A 3ISPA 3OYFA 3FHNA 3CMEI 3BJOA 3E5UA 2JK3A 9ANTA 1ON1A 3FF5A 3HB9A 5JHFA 1ETXA 3LSMA 4RGUA 1P4XA 2L0KA 4YEJA 1H88C 4AIDA 4UUVA 1WI3A 1HQCA 1XS9A 2KIUA 4NC7A 3O8GA 2L7ZA 1D5VA 5GP9A 2MC3A 1WRJA 3P5JA 2EFPA 3JRAA 1J2XA 2KISA 3JRHA 2OQRA 4BYYA 3E5QA 4FX0A 1R71A 3OMYA 4PCQA 4YFNF 3DFGA 3V4GA 2VODA 2E71A 2L9VA 4Q47A 4V19K 3ZQLA 1YYVA 3RZDJ 1I1GA 1ZRFA 5CVVA 4MGRA 3CCJI 2BZTA 5EGOA 2K9NA 2DFIA 3O8HA 2PEXA 2VPRA 3BZKA 3U1DA 4BEHA 3CMMA 1V3FA 5DYMA 1UHMA 2WTEA 2HQNA 2J5PA 3E6CC 4RDUA 4X0GA 1SMTA 2KZVA 4I98B 2VIXA 2F4MB 2PFBA 4Y17A 2O7OA 3HOXJ 1P2FA 2AS5F 2CJJA 5EDNA 5B1BH 3FDYA 1LPQA 2KZGA 1G3YA 3H92A 4DIQA 1J59A 4I0AA 1RIOH 4U0YA 3WTVC 3ABUA 3RKWA 1YI2I 4LG0B 2Q8KA 1XCVA 4BHBA 1YRNA 2A5WA 2FQ4A 3QYFA 1LFBA 3MMYB 1JE8A 4E6KG 2GOXB 3EETA 4C2UA 2KJBA 3K70D 2LFBA 2EINH 4FT8A 1XMKA 4G12A 3H3ZA 1OLTA 4A3GJ 3HHHA 2OA4A 2CH0A 2OU2A 2ZBKA 2LH9A 2VI6A 2XKOA 3I58A 3A01B 1SFOJ 2KT0A 1UAAA 4II3A 1B8IA 1HLVA 3VYRB 1R36A 3K70C 3ECOA 1X4OA 4ZJZA 3RI4A 2GOMA 4CSWA 2GQQA 4L0ZB 2QKLB 1MZBA 5J1UA 1NK2P 1X3ZB 2XPVA 3PO2J 4HG2A 3DU6A 3I9V2 3GFIA 4GFBA 1FTTA 2ICWG 3KEYA 2DOEA 2RV8A 3ZN1A 5F08A 2RN7A 3HHGA 4P96A 1TTYA 5IPAA 3A1YA 3ZMUA 2P7VB 3T8RA 3ABLH 2HKOA 2HKXA 2H6BA 3RKXA 1FOWA 2LVSA 1V5GA 1Z1DA 1UELB 4A12A 3DBHB 1R23A 3CP2A 1ON2A 2EV5A 3CP8A 2Y31A 3OR2C 2X85A 1FLIA 4F55A 4LMYA 2QQBA 2N8GA 2DO7A 2ZFUA 4MEYF 4ZTFA 3LSKA 3I5UA 5IOZA 5HODA 1XMAA 2WC2A 2NOGA 1BR1A 1LDKB 4JX5A 1V4RA 2W00A 1MJAA 2M9HA 3CJRB 1SVOA 4I09A 4XORA 3HRMA 1Z6RA 3J80K 3BPVA 3GFLA 3IKTA 1LUJB 3BP8A 1ZG1A 2OCEA 3LSRA 2XF7A 3QQAA 2XAFA 4BJ6C 1KYWA 2DMUA 2E5NA 4RAZA 2AHQA 3FMQA 3J7ZI 4IHTA 2XPUA 4YFXF 3DTKA 1NTCA 1SFEA 2FX0A 1Q1VA 3PSFA 4RGRA 4CZZA 2LMDA 4ENJA 4Y7NJ 4E7KA 4DQ2A 1W7PB 1W4MA 4CCNA 2MC4A 4MEXF 2DA2A 1ETOA 4X1EA 1TQIA 2GLOA 4AU7A 3K1NA 3LSGA 2ACJA 3I0TA 4F93B 4R1HA 1TWCJ 2KRCA 2FBKA 2C6YA 3OS2A 4BS9A 1FMVA 4JX6A 1PDNC 1K4TA 2EFQA 3CUQC 4JX4A 1AOYA 3C2HA 1QPIA 4NHJA 4CXFA 1JKRC 2DMNA 3GTKJ 1UZCA 5B66C 5E3NA 2O3FA 2LC2A 2NVYJ 2VBZA 3HSRA 3M8FA 2QGUA 2A69F 1FIAA 3R61A 1IN7A 4M9XA 2QA4I 2W57A 1BW6A 2WV1A 4M6VA 5CVJA 1OKRA 3LSHA 4KIGA 3B73A 3TKYA 3BG6A 3FXJA 2PMZN 2JA2A 2VKDA 1FSHA 3L2QA 1JJ8C 2FMLA 4YIIA 3OYAA 2BXZA 4NUBA 2XRLA 3RPQA 2FEZA 4XLHA 3KP2A 1REPC 2E5ZA 2OTJI 3HTSB 1ZTRA 5FKLA 1ZQ3P 2E2HJ 2O6GE 2GIVA 2ZSIB 3A2KA 2CS3A 2Z1DA 1TZLA 3MCZA 1J09A 2WA0A 2NVXJ 4Q5SF 1MMGA 2MA3A 2FD5A 1DP3A 3LWFA 1Y39A 3E3VA 4OIOF 4Z6YA 1FT9A 3DV8A 5FJ8J 1OR7A 3JRBA 3OSFA 1A36A 2ME6A 1WKMA 2L02A 5CJ9A 3L00A 2M0MA 1ZKGA 1W36D 3MAJA 3H0GJ 2O61A 1UG2A 2VC0A 2WAQN 3B6AA 1SFXA 1K83J 3KFWX 1E0EA 2BBYA 1D1CA 3HJEA 3RQIA 1U8BA 1W1WE 4EGYA 5CVIA 3JR9A 2PJRA 1SVMA 5JLWA 1NK3P 4XKBA 3F8CA 3L2CA 4XLAA 4EM2A 1HSJA 2MH9A 5J40A 3K4JA 1T39A 4BXXJ 1RKTA 1IXSB 1TNTA 5ILSA 3TGNA 3N05A 4CGZA 2JPCA 3AG2H 3VEPA 2MD0A 2BW3A 4QIWN 2IXSA 4XKVA 5K1YA 4W97A 5J1YA 2A68F 2XASA 4S0HB 1EH7A 3CZ6A 3GYHX 3S3OA 3HSFA 4IXAA 4RAGA 2DOAA 4IQ4A 1Y0NA 4JQFA 1B59A 3QAHA 3K7AJ 2ID3A 3HKZA 2H27A 2X1DA 1FY7A 3AL0C 2I5UA 1XSDA 3EQLF 4ESFA 2R7RA 1Y8RB 4PUSA 2CV0A 1IXRC 5E1XA 1IRFA 2VB6A 1Y56A 5EEAA 4Y15A 5HNFA 4WXDA 4IHXA 3WG7H 3K4BA 2F5EA 3I71A 3CDIA 2XAHA 5E79C 4A6EA 1ZG5A 3PQJA 2RAEA 2ESNA 2WV0A 2HZTA 3DPLC 4HDVA 3Q3SA 5L3DA 4BU2A 4E7IA 1QZYA 2QZ8A 1AU7A 3Q9VA 4KISA 3FX3A 4B09A 2R7DA 1W7PD 2WAEA 3G71I 3VPRA 1QNTA 1ONVA 4PJMA 2W1OA 4GXOA 4XNFA 1FBSA 2ZCWA 5BS6A 1JKOC 2K9MA 4A3IJ 2OC6A 3M8JA 2OZ6A 3CESA 2AXTC 1FYKA 2QSHX 4B3AA 5DEQA 1T95A 3H5AA 3GLXA 2NVUB 2FSWA 5KCMA 4KYWA 4D5FA 2HQRA 2CQQA 1TQPA 2K86A 3R60A 2V1XA 4FISA 3CCQI 4WX9A 3D5SC 2DA7A 3PO3J 1S7OA 1XC5A 4OINF 1KGSA 4I6ZA 4BDZA 4M3EA 2YX7A 3E6BA 4C3HJ 2IA1A 3L7WA 4A3MJ 2BY1A 3OOPA 2F5FA 4XMYA 4KDPA 3FMRA 3GZ6A 1Y6IA 2EFNA 1MDMA 3J81K 1SFKA 2EIMH 1S5LC 3BDDA 2R0QC 2VQGA 4XLPF 1MIJA 4ENMA 2Z2SB 2OZUA 4WWCA 1VQKI 2CGPA 4AIHA 4N9HA 4OOIA 4U87A 3SXYA 3TOAA 1P9QC 1VZ0A 2LRDA 4I0BA 1MMSA 3ZCOA 2K02A 2O8KA 1IN5A 3CUQB 4GDFA 4O6JA 2H94A 1QRYA 2DTRA 3H36A 2CUEA 3JREA 1QVUA 2A6HF 1D0YA 4XONA 1F43A 2V7FA 2QENA 2M3AA 3UKGA 1MW7A 2OCCH 3I4PA 4GGGA 2IRFG 1PVEA 1YG2A 2ZXJA 4BH9A 2PJRB 3K4LA 2F5CA 3Q0WA 3N97A 3ZQFA 4CUGA 2R7QA 3J7AY 5FLXK 3OYMA 4C9YA 4I7HA 2K3FA 2V6EA 5IYCJ 3E6MA 3SDBA 2Q0OA 4KA4A 2F2EA 1H8AC 2JZYA 1S7EA 1MH3A 3ZXSA 4IL6C 1ZGWA 3H1CA 4CZCA 2G7UA 3WGIA 2H8RA 4LD5A 3RZOJ 4M3FA 4ITVA 4QSHA 3BCAA 1IDYA 4LIVA 1S72I 1X1CA 1ZHFA 1Q1HA 2K40A 3H3UA 3S15J 5BQTA 1MMDA 3TDUC 1E3HA 1JTXA 1SD6A 3DTIA 4ZYEA 4CHUA 4XN3A 2VKVA 2JN6A 3A0HC 3G2BA 3HRUA 5F6FA 2L7MP 3LQQA 1BIBA 2LY9A 4RLFA 4ON0A 1J7KA 1MKMA 5M3FJ 2ME0A 1Y0UA 2VKHA 5DV5A 4C3JJ 1TT5B 2ZMEC 5JFRA 3GVAA 4B47A 1BA5A 4ESBA 5J1RA 4P1WA 4F91B 2DPUA 3BOQA 5EYRA 1WZ2A 3KETA 1JUSA 1ZELA 2YPRA 1YE9A 1BN5A 1YX3A 2P8TA 3HGYA 5EF6A 1I5ZA 3NARA 3PFIA 2ZMEA 2Z16A 1WGXA 5M3MJ 3M8EA 4UVCA 4A5MA 4YRVA 2YU9J 4AIJA 3I53A 3WTYC 3I55I 2CQXA 1PUEE 2PBIA 3G1MA 3WE3A 4TV7A 5KK1A 2IGOA 2V1UA 3SFIA 2IVMA 3E1SA 5L3GA 4UY8I 2FUG2 1R4MB 1KA8A 1AA7A 4EATA 4N4OB 3FMSA 4BY1J 2X4HA 3S2WA 4NQWB 1UCRA 5F1JA 5CQEA 1OCPA 1U6GA 4LIUA 3JAMK 5EG0A 1U78A 5HS9A 3WGHA 1I3QJ 3KLNA 2E36A 2DLLA 2F4IA 4BQOA 3ZMZA 2YSRA 1AKHA 3OYBA 1T6SA 2XROA 3QP5A 4G7OF 1VQ5I 3BR5A 3ERMA 1SANA 1I6XA 2VASA 2XKPA 4M72A 2MABA 2P6SA 4E7HA 1VQNI 2WB1N 1ZAOA 1YS6A 2KLOA 4NBQA 3BR2A 4IHVA 2JRMA 4LB6B 5E3LA 5LHGA 3S1MJ 1S8NA 2VXZA 1M1EB 1ODDA 4M6YA 1X58A 4L9JA 3TBIA 3HOZJ 4XL9A 2Q1ZB 3HXLA 5IP6A 2Y2ZA 4CCLA 4L5JA 4BUPA 4HDUA 1Y1VJ 1UHWA 2H8WA 2FRHA 2LOOA 4UVAA 3MZHA 1RR8C 5E8GA 4M3GA 2F48A 2L54A 1H9TA 2K9QA 1YJWI 3ML6A 1IO2A 3DKWA 5FO5A 4L18B 1R49A 3EUAA 3F3XA 2YX4A 1YW7A 3SEQA 1F4KA 5D5WB 1LQ1A 1S7AA 2EB7A 5LRRA 1YO5C 2K5CA 5CLSA 2QSFX 1D0XA 4N0BA 3G6EI 3ZRGA 2R7VA 2DMPA 4RLQA 1SEUA 4BAYA 1JT0A 2EV0A 5DD8A 1G3WA 3OYKA 4QPOA 2VJ4A 3C1DA 3K2ZA 4OIQF 3PUBA 1LB2A 2VKEA 3ESWB 2MW8A 1XGSA 3D1NI 4OAZA 1ZH5A 4AUXA 4HQEA 5HVQC 1B8IB 2Q2EB 4HYEA 3KP4A 4A3JJ 1B72A 2ZMEB 4JP0A 4IF4A 3A03A 2KDZA 2HDCA 3VODA 1TNSA 2QUFA 5JI6A 3COAC 3WG9A 4PJJA 4EVIA 5L3FA 5FB2A 2MLGA 1EF4A 2OBPA 3HRSA 2STTA 5J8FA 3M1EA 1GV2A 3CQZJ 3ERED 1N25A 1NG7A 2WAFA 2Q2EA 1QHGA 3W3CA 3AG3H 3OYCA 3JAMZ 4KMFA 1FSEA 3U2RA 1I50J 4BHPA 4C30A 2R3SA 1KYZA 4AIKA 4LB5A 4BEHB 2NS0A 1YTYA 3QYEA 5D6EA 3QPTA 3BG9A 5EGOB 2ID6A 3R0AA 1TC3C 3BWGA 1HW5A 1KU2A 1IW7F 1R4NB 4AVPA 3OR1C 4NC8A 4EMSA 2EFWA 3ECHA 1YIOA 1HDPA 4KFCA 1Y8QB 3TP0A 1VF9A 1I3AA 2RREA 2Z99A 1G2HA 1B4AA 1EKEA 4RB1A 3S3MA 4LGWA 2VOOA 5C4XJ 3J81Z 1G3SA 3L2RA 2X6WA 2EA4A 1ENHA 3M7GA 1O3QA 5IT3A 1OYWA 1U8RA 1G3TA 2HYGD 3A0BC 2MBFA 5D4RA 3WGGA 1VQMI 2M30A 5L3CA 3GBGA 2E60A 3KPHA 3OIOA 1GVJA 1Z7LA 2CUFA 2FMYA 4IHWA 4HOBA 4C2TA 3BTIA 3MVPA 3TO7A 1VNDA 3E5XA 1PUFB 3SZPA 3REOA 3FXOA 1JHFA 4PZJA 2IS2A 5AIPA 2HVQA 1VQ9I 1OCZH 3I4NJ 2A05A 3GUDA 1A04A 3TP3A 4G8XA 1XPXA 1BOBA 3DPUA 4MLOA 3S3NA 1X1PA 2VT2A 1VQ6I 1VI0A 3JRCA 1G4DA 1AHDP 1SMYF 1IAWA 2YS9A 4MTEA 3S17J 3BR3A 1OYIA 3I59A 2B0LA 3FBNB 1OYYA 2IS1A 4KN4X 3L2VA 3F6VA 3BCBA 2J5OA 2FJ1A 2CW8A 3DQVC 4NQWA 5D4SA 4ZYGA 3GZNB 1W0UA 4HF1A 1ZLJA 2RNJA 5JVTA 2V26A 3AAFA 1LDJA 1CF7B 4IHSA 2Y0SN 2CUZA 4J00A 2DA6A 3RYRA 1EH6A 2EH3A 1K78A 2O8XA 3BR0A 1WI9A 1PJRA 2K9SA 4KT5C 1MBKA 1T56A 4R8HA 3JRGA 1Z77A 3F8BA 1ETYA 3ZQQA 1STZA 3MWMA 3OV8A 5LLQA 2Z33A 2Y9ZA 4HNTA 4C2MJ 3QYBA 3S93A 1O3SA 1MNMC 1IRZA 2EQRA 4B48A 4LK0F 1DGRM 3BG7A 4XBFA 5J6XA 5KAFC 2ZJRF 2MG4A 3ZR8X 1BI0A 5CPRB 2HI3A 3ZPLA 5KHDA 1K79A 3K1PA 5K7ZA 4U88A 4IOCF 1NG6A 2V9KA 1TW2A 2HU9A 3M4OJ 3QOPA 3ZQ7A 4P55A 4F52A 3CCLI 1WFXA 2RKHA 2EWNA 3V42A 2DTZA 1RRJA 1IF1A 2F6CA 1MJBA 2IPQX 3GTOJ 3EUHA 2X1CA 1LJ9A 5FLVA 4PSXA 2EA2A 1DGWY 5F64A 2K85A 1YJNI 3Q0UA 4J01A 2X0LA 3CCUI 1B9NA 2DYRH 2ZXHA 1Z7UA 3S14J 4H4KC 1R1VA 3FK7A 5DCMA 3HOUJ 4KMUX 1FX7A 4NNJA 5DTDA 5FFZA 3DLLF 4XM3A 2PQ8A 4AYBN 2Y9YA 2Z9OA 2V4JC 5JVGF 1IXCA 4A3EJ 1QA6A 5ERIA 2MGQA 1GXQA 3DU5A 4WK8F 4GRIA 5LRSA 4E70A 3HL2A 1X2MA 2IGKA 3IRQA 3EDPA 3A4CA 4EV0A 1D3YA 1I1SA 4U0VA 3S8PA 2ZJ2A 3AG1H 5ED4A 1DDNA 1J75A 3W2AA 1A6QA 3M3YJ 3FIWA 4AWXB 1RR7A 2NOJB 1Z0XA 1ZRCA 1B6AA 1UB9A 2XAQA 1ETQA 2L7KA 5FKNA 4A0XA 4M9SA 4L5EA 1ITYA 1LKXA 1P4AA 2FA5A 2X6YA 1ZR2A 1WWXA 3NAUA 4BXFA 1HBXG 4RM3A 3E6DA 5D6FA 4LLNA 2CWEA 2EFOA 1HXDA 5E3MA 4XICA 3BQYA 5JHUA 1XMXA 4UV9A 1ZK8A 3W6VA 4XQFA 4A3LJ 4P9UA 3RPUD 2BY0A 2PMZA 2JVGA 3HEFA 5JR3A 1BI3A 1S29A 1YX5A 2TRTA 5GAGJ 3TO6A 2IS6A 4N9IA 5GTIC 4LFUA 2M4GA 1R7JA 1OCRH 4Q48A 5E17F 3EYYA 2VONA 2DPDA 2DXIA 3J7AO 4A6DA 1MDMB 1TLHB 1DPUA 1Z67A 5HNHA 3F8MA 2EZLA 2H1LA 1R5ID 2M45A 2QF7A 4LK1F 1RUOA 1MBJA 4G7ZF 4GYGA 3NWSA 3OYGA 4BE1A 4KITB 1FP2A 2MSYA 4XRSA 4KICA 1FEXA 1KU9A 2R4GA 1JT6A 2E1MC 1SD4A 4D5CA 3K1MA 5E20A 3FXRA 3FKJA 3P9CA 2L9RA 2ECCA 2AQFA 3VWBA 3HBLA 4WXHA 2DA1A 2CQKA 3KE2A 4Y13A 4IRIA 1SD5A 2UXXA 1TW3A 4CA0A 1FOXA 1FPQA 1ZARA 5D5VB 1HOMA 1JXSA 4HV5A 2EPFA 3MQ0A 1IN6A 1JGGA 4S05A 4W1UA 2XVCA 3FXKA 5LBQA 1POGA 4HF0A 4GO1A 4IRGA 1BL0A 5EEGA 1MSEC 4E4HA 3QODA 3PQKA 2HS5A 3L09A 2HTSA 1CGPA 2JJ7A 4RAYA 2G7HA 5KAIC 5C3EJ 4UUSA 2WY7Q 4HSRA 2H09A 1YW9A 4CCKA 3F8FA 2QEXI 2D45A 1K7AA 3ZQIA 4ABZA 4EGZA 4ZZLA 2EZKA 2FBIA 3DKXA 3GFJA 4RB2C 3X2QH 1LFUP 1LE8A 2B7EA 4HV6A 3M1CA 4PJLA 4XOPA 1ULYA 1BM9A 2O03A 1W5TA 3B02A 4ZYAA 1PP8F 3SYTA 3OOUA 1F1ZA 2MH2A 5KVRA 5B1AH 3HIFA 3C7JA 3W6JB 1T33A 3I3LA 3CMAI 2RNGA 2VN2A 4IPAA 2P5LC 1WJDA 1DQUA 2P0WA 3QPLA 2VE9A 2XUBA 3HM5A 1SAUA 4LLGF 2EBIA 4LJZF 1W7PA 1W36C 3KP5A 3IP4B 2BEOA 3Q0VA 1O57A 3ABTA 1U2WA 3OYDA 4UB6C 2JSCA 1KQ0A 3KP6A 1UHSA 1FWZA 2FOWA 4DNCA 2KFDA 1IJWC 2VC1A 3W2WA 2Z3YA 5FKKA 5IOYA 3WU1B 3WTXC 5GPAA 2A6EF 2GIZA 2M8EA 2K4BA 2NXNB 3ZQHA 1KONA 3J7YJ 5IP9J 1R5HA 4XLEA 2FNAA 1BC8C 3E97A 3NQOA 1N78A 2E19A 3H5RA 1O4XA 4EJTA 1FTZA 4K2EA 4V2GA 2P5KA 3IH3A 4EM1A 1QGPA 2DDAA 2DDBA 2M7AA 4ANJA 3H35A 2BYVE 4KNYA 4Y4RA 1QU3A 3HTUA 1QHHD 4G6QA 4G94A 4X6AJ 2UXNA 2XAGA 2VJ5A 1T8IA 1F36A 1ZREA 4UB8C 4IHYA 3OWTA 4IEJA 2AQEA 1JHHA 1U9OA 2R7FA 4EM0B 3CO6C 1ACIA 5H6QA 1L3LA 3L9FA 1XDUA 3HZJA 5FKOA 4CYCA 4DBRA 1LDDA 2BVLA 1NH3A 1XSXA 2R5YA 2HQAA 1IDZA 2JA7J 2NS8A 2VOPA 3LA2A 4BHCA 3CCYA 5IYDJ 3UR3C 3PL8A 1IZ1A 5CVUA 3SDGA 3P7NA 4YIRX 1YOVB 4ZYDA 2HWVA 2LR8A 3RDIA 1B1BA 5C44J 3WTUC 3ASOH 2HVRA 2M2EA 4UV8A 1E17A 1Z91A 4Y33A 2P6TA 2DA3A 2WAQA 2LF7A 1X3WB 3HOVJ 1RI7A 3NRVA 4HA8A 2LKSA 3DEUA 5J4YA 3WTWC 2FE3A 1DU6A 5HDGA 4KT6A 3FHZA 1KQ8A 2YUSA 3FXUA 1QO0D 2LBFA 2V6CA 3Q5FA 4HLYA 2FQ3A 1SD7A 5DUIA 3FM3A 4HF2A 4IQJA 1PP7U 2A5YB 3WTTC 3G3ZA 2NYXA 1XG1A 2LLKA 3EUHC 2MYSA 4RAFA 3DKYA 3E7LA 3LAPA 1OR7C 2IA0A 1E2XA 3U9GA 2VLAA 2Y48A 3GTLJ 2OJED 1X2NA 2Y75A 2IBDA 1MJ9A 2CFXA 3CUOA 3FISA 2DA5A 1GXPA 2ISYA 2X9DA 3C3WA 3BG5A 4Y3OA 2ZKZA 3PSIA 4A3DJ 3V7SA 1WQ2A 1HKQA 5E18F 4BNCA 4E7LA 4DZJA 3JRDA 2W84A 1YIJI 1K61A 1YHQI 5BMZA 3BG3A 2A61A 3H9JA 2OAZA 2L4MA 4DGWB 1LNWA 1WH5A 2K7LA 1LVKA 2VPLA 3SZGA 4CCMA 4AVZA 1GV5A 5D8LB 2VE8A 5HDNA 2XAUA 1MNDA 4XRFA 3GTPJ 4IVNA 2NNNA 2K27A 5BPDA 3LMMA 1HCRA 4RA2A 1OMIA 2HVSA 4PFPA 2P81A 3N4MA 3QOEA 5DS9A 1TWGJ 1HKTA 3BR1A 4FE4A 3FXMA 2PG4A 3SEZA 3R4KA 5FKMA 1OISA 4CYCB 3DEWA 3OYIA 1MMNA 4QWQA 4B43A 2E7XA 4UHTA 1P7JA 1T98A 3BPXA 3CLOA 3R0JA 2ZJPF 1A35A 4QPQA 3RIRA 5LHIA 1DUXC 1S3JA 3K4CA 3ULQB 4M71A 4XLCA 2OF7A 1T2KA 2LG4A 2K4JA 3ABMH 3I4MJ 5M5WJ 1D1AA 3OYNA 4AYBA 2ZO4A 5FD5A 3V7CA 4A2UA 4HNUA 3FKIJ 2V79A 4A0YA 3W2VA 2D2WA 2ECBA 5D8KB 2M0CA 3A02A 4P9FA 2CUJA 4Q4ZF 1H89C 3BZCA 3IC7A 3GTGJ 2RQQA 1XTAA 3PNVA 5K7FA 1TWFJ 1V5EA 2PLYA 2CMPA 4BQAA 1O3RA 5LGNA 3R6SA 4E7SA 3EYIA 1ORKA 3KEOA 3CC7I 5CKTA 3RKQA 1MD0A
chains in the Genus database with same CATH topology
3OIOA 4A3BJ 3BTJA 2CUFA 4V2FA 2DA2A 1ETOA 4X1EA 2GLOA 4IHWA 3BTIA 1UMQA 3IH2A 3MVPA 1VNDA 1PUFB 1WPKA 3LSGA 3MKLA 1TWCJ 5M5XJ 4JX6A 2R92J 2R7ZJ 4JX4A 1ETKA 3G1OA 3BTCA 1JJ6C 1IGNA 1QPIA 3I4NJ 2E1OA 5IP7J 3F0CA 1JKRC 2DMNA 2HOAA 3TP3A 3GTKJ 4A93J 4B4CA 5E3NA 4MLOA 3S1RJ 1VI0A 2NVYJ 3JRCA 4BY7J 1AHDP 2YS9A 1AKHB 3S17J 3BR3A 3B6CA 4BBRJ 5F0CA 3HOYJ 1FIAA 2R5ZA 5EG0B 2JA6J 1E3OC 3GTMJ 2FJ1A 2XGEA 2HOTA 2JA8J 1GVDA 1BW6A 5JLXA 1TWHJ 2WV1A 4M6VA 1W0UA 4LOCA 3TW7A 1IC8A 2PMZN 5FLMJ 2JMWA 1ZR4A 1JJ8C 3JRFA 2Y0SN 2XRLA 2DA6A 1JUPA 1D5YA 2EH3A 3BR0A 5M5YJ 1ZTRA 2K9SA 1MBKA 1T56A 5EZHA 5FKLA 1Z77A 1RPWA 3JRGA 1ZQ3P 2E2HJ 2AO9A 3GTQJ 1ETYA 4MO7A 2NVXJ 2Y9ZA 2JA5J 2FD5A 3C2BA 4C2MJ 1MNMC 1IRZA 2EQRA 5FJ8J 3JRBA 1JUMA 3BQZA 3OSFA 2MG4A 2ME6A 3DCFA 1ZKGA 3H0GJ 1UG2A 2LTPA 2HI3A 2WAQN 3B6AA 5K7ZA 1WCMJ 1K83J 4UUSB 3M4OJ 3RQIA 1U8BA 3H3VK 2X48A 2DA4A 3JR9A 2M8GX 2DTZA 5JLWA 1NK3P 1W0TA 3GTOJ 4I76A 2M34A 4D7NA 1DU0A 4BXXJ 5FLVA 3HDDA 1RKTA 5F27A 1LE8B 4XIDA 3Q0UA 3SJMA 2HXOA 2LK2A 4QIWN 1R9TJ 2D5VA 3S14J 4FCYA 4BBSJ 4W97A 5J1YA 2IEKA 3FK7A 3HOUJ 4S0HB 4M3BA 5DTDA 2E2IJ 3K2AA 4MIMA 4AYBN 2Y9YA 3K7AJ 4A3EJ 2ID3A 3S16J 2MGQA 3ZQCA 4DYRA 1X2MA 3G1LA 5EEAA 4A69C 4IHXA 3M3YJ 3FIWA 4XRSG 2HYJA 1RR7A 1TWAJ 2COBA 1Z0XA 1ETVA 2B63J 2NVTJ 1CQTA 2RAEA 4DYCA 1ETQA 5FKNA 1ITYA 4L5EA 4C3IJ 3BR6A 1GDTA 1BW5A 1ZR2A 1IV6A 3NAUA 3Q3SA 4D7MA 4MFEA 1ETWA 2E2JJ 3IH4A 2IAIA 3BT9A 5E3MA 4XICA 3BQYA 1AU7A 5F0FA 1ZK8A 3W6VA 4A3LJ 1OFCX 3HEFA 3VPRA 2TRTA 3FK6A 2DN0A 3S1QJ 1JKOC 4A3IJ 3TEDA 2CU7A 3HOWJ 3ZQGA 4B3AA 3JRIA 4EEFG 2EZLA 4D5FA 2QF7A 2CQQA 1QVTA 1U9NA 5E3OA 1MBJA 4FISA 2W48A 2MSYA 2DA7A 3QPSA 4XRSA 1FEXA 4M3DA 5BNGA 3PO3J 1XC5A 4I6ZA 1JT6A 4M3EA 4D5CA 4C3HJ 1BJZA 4A3MJ 2NS7A 2L9RA 2ECCA 1MBFA 3HBLA 2XGDA 4DYQA 2DA1A 4A3KJ 2R0QC 1OJLA 2DMTA 1JTYA 1HOMA 1RESA 1JGGA 4W1UA 1POGA 1MH4A 1BL0A 1MSEC 2XSDC 2I10A 4MFDA 2JJ7A 3PM1A 1A5JA 2ELKA 5C3EJ 4UUSA 2GBYA 1APLC 2O8KA 3ZQIA 2OPTA 4ABZA 1QRYA 3MN2A 2EZKA 2ZB9A 2CUEA 3JREA 1RKWA 1LFUP 1LE8A 1QVUA 2G0EA 1F43A 3OSGA 3UKGA 4JYKA 3LSJA 2LD5A 3OOUA 1Y1WJ 3Q0WA 1T33A 3ZQFA 4NDLA 1HF0A 1I6HJ 3QPLA 1A6IA 5IYCJ 3HM5A 2EBIA 1H8AC 3Q0VA 1S7EA 1MH3A 4RBOA 1ZGWA 2HDDA 4BKXA 1UHSA 2H8RA 1WH7A 3RZOJ 4M3FA 4HNVA 2R5ZB 5FKKA 5IOYA 1VFCA 1IJWC 4J19A 5GPAA 1IG7A 4QSHA 5EZGA 1IDYA 3ZQHA 5K7HA 5IP9J 3S15J 2K40A 4XK4A 2E19A 1JTXA 1O4XA 1FTZA 2DMQA 2O9LA 2LKXA 4V2GA 1OCTC 3IH3A 2VKVA 4AC0A 2JN6A 2L7MP 2LY9A 2DJNA 4QTRA 2JK3A 9ANTA 3HB9A 1ETXA 1RETA 2ME0A 2XB5A 5M3FJ 4X6AJ 1F36A 2L0KA 4C3JJ 4IHYA 1H88C 4IEJA 1U9OA 1WI3A 1BA5A 5J1RA 1XS9A 2H1KA 3O8GA 2L7ZA 5EYRA 3GTJJ 1JUSA 5F0HA 5GP9A 5FKOA 3LSPA 4CYCA 4B1RA 3JRAA 3LOCA 3JRHA 3CMYA 2R5YA 3HGYA 5EF6A 3NARA 1IUFA 1IDZA 2EZHA 1WGXA 5M3MJ 2YU9J 2JA7J 2NS8A 5IYDJ 3CCYA 2CQXA 3G1MA 3TW6A 3SDGA 1MBEA 3SFIA 3ZQLA 2EZIA 2LR8A 5C4JJ 3IV5A 3RZDJ 4DZPA 5C44J 2M2EA 5EGOA 2K9NA 3LNQA 4BY1J 3O8HA 2VPRA 2DA3A 5F1JA 1FJLA 1OCPA 1U78A 3HOVJ 5EG0A 2L7FP 1MBGA 1I3QJ 4RDUA 1DU6A 1AKHA 2CRGA 4FE7A 2O7OA 2YUSA 1MBHA 3HOXJ 3BR5A 2CJJA 1SANA 5EDNA 1HDDC 2WB1N 1P7IA 3CDLA 3BR2A 4IHVA 5E3LA 3S1MJ 2GM4A 4A3FJ 1XG1A 2LLKA 3E7LA 1X58A 4UUTA 1PUFA 4FTHA 3HOZJ 1YRNA 5IP6A 2Y2ZA 2FQ4A 1LFBA 1Y1VJ 3GTLJ 1X2NA 4M3GA 2K9QA 2IBDA 3FISA 2DA5A 3HKZN 2LFBA 1JKPC 2X9DA 3BG5A 2HOSA 4A3DJ 2XPWA 3L1PA 4DZJA 5GPCA 4G12A 3JRDA 2TCTA 4A3GJ 2VI6A 1SFOJ 3S1NJ 5IYBJ 3A01B 2KT0A 1B8IA 2JWTA 1HLVA 1K61A 3BG3A 2LP0A 2DMPA 1WH5A 1JT0A 1GV5A 1MSFC 3S2HJ 5J1UA 1NK2P 2XPVA 3PO2J 3GTPJ 1HCRA 2QCOA 2VKEA 4GFBA 1FTTA 2MW8A 3D1NI 2Y30A 4AUXA 2P81A 5J3LA 4DW6A 5DS9A 1B8IB 1TWGJ 3A01A 2VUMJ 1B72A 4A3JJ 5F08A 3BR1A 4FE4A 4JP0A 5IPAA 3S2DJ 5FKMA 3A03A 2KDZA 2R93J 4CYCB 3DEWA 3HGGA 4Y52J 1P7JA 1GT0C 2LVSA 1EF4A 1JKQC 1GV2A 3CQZJ 2Y31A 4XRMA 1B72B 2OF7A 1YRNB 1FIPA 2N8GA 3I4MJ 5M5WJ 1I50J 2XGCA 3ZOBA 5IOZA 2HXIA 5HODA 3BG9A 5EGOB 2ID6A 2NOGA 4JX5A 1TC3C 4A3CJ 2M9HA 3FKIJ 1HDPA 2X6OA 3TP0A 1VF9A 3LSRA 2HQ5A 2ECBA 3QQAA 2M0CA 3A02A 1G2HA 5C4XJ 1GUUA 2DMUA 2AHQA 1H89C 3GTGJ 2R5YB 3WHBA 2XPUA 1ENHA 5K7FA 1TWFJ 1NTCA 2FX0A 3BTLA 1Q1VA 2XB0X 3WHCA 5F04A 2NVQJ 4Y7NJ 1ORKA 3RKQA 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIO A;  4A3B J;  3BTJ A;  2CUF A;  4V2F A;  2DA2 A;  1ETO A;  4X1E A;  2GLO A;  4IHW A;  3BTI A;  1UMQ A;  3IH2 A;  3MVP A;  1VND A;  1PUF B;  1WPK A;  3LSG A;  3MKL A;  1TWC J;  5M5X J;  4JX6 A;  2R92 J;  2R7Z J;  4JX4 A;  1ETK A;  3G1O A;  3BTC A;  1JJ6 C;  1IGN A;  1QPI A;  3I4N J;  2E1O A;  5IP7 J;  3F0C A;  1JKR C;  2DMN A;  2HOA A;  3TP3 A;  3GTK J;  4A93 J;  4B4C A;  5E3N A;  4MLO A;  3S1R J;  1VI0 A;  2NVY J;  3JRC A;  4BY7 J;  1AHD P;  2YS9 A;  1AKH B;  3S17 J;  3BR3 A;  3B6C A;  4BBR J;  5F0C A;  3HOY J;  1FIA A;  2R5Z A;  5EG0 B;  2JA6 J;  1E3O C;  3GTM J;  2FJ1 A;  2XGE A;  2HOT A;  2JA8 J;  1GVD A;  1BW6 A;  5JLX A;  1TWH J;  2WV1 A;  4M6V A;  1W0U A;  4LOC A;  3TW7 A;  1IC8 A;  2PMZ N;  5FLM J;  2JMW A;  1ZR4 A;  1JJ8 C;  3JRF A;  2Y0S N;  2XRL A;  2DA6 A;  1JUP A;  1D5Y A;  2EH3 A;  3BR0 A;  5M5Y J;  1ZTR A;  2K9S A;  1MBK A;  1T56 A;  5EZH A;  5FKL A;  1Z77 A;  1RPW A;  3JRG A;  1ZQ3 P;  2E2H J;  2AO9 A;  3GTQ J;  1ETY A;  4MO7 A;  2NVX J;  2Y9Z A;  2JA5 J;  2FD5 A;  3C2B A;  4C2M J;  1MNM C;  1IRZ A;  2EQR A;  5FJ8 J;  3JRB A;  1JUM A;  3BQZ A;  3OSF A;  2MG4 A;  2ME6 A;  3DCF A;  1ZKG A;  3H0G J;  1UG2 A;  2LTP A;  2HI3 A;  2WAQ N;  3B6A A;  5K7Z A;  1WCM J;  1K83 J;  4UUS B;  3M4O J;  3RQI A;  1U8B A;  3H3V K;  2X48 A;  2DA4 A;  3JR9 A;  2M8G X;  2DTZ A;  5JLW A;  1NK3 P;  1W0T A;  3GTO J;  4I76 A;  2M34 A;  4D7N A;  1DU0 A;  4BXX J;  5FLV A;  3HDD A;  1RKT A;  5F27 A;  1LE8 B;  4XID A;  3Q0U A;  3SJM A;  2HXO A;  2LK2 A;  4QIW N;  1R9T J;  2D5V A;  3S14 J;  4FCY A;  4BBS J;  4W97 A;  5J1Y A;  2IEK A;  3FK7 A;  3HOU J;  4S0H B;  4M3B A;  5DTD A;  2E2I J;  3K2A A;  4MIM A;  4AYB N;  2Y9Y A;  3K7A J;  4A3E J;  2ID3 A;  3S16 J;  2MGQ A;  3ZQC A;  4DYR A;  1X2M A;  3G1L A;  5EEA A;  4A69 C;  4IHX A;  3M3Y J;  3FIW A;  4XRS G;  2HYJ A;  1RR7 A;  1TWA J;  2COB A;  1Z0X A;  1ETV A;  2B63 J;  2NVT J;  1CQT A;  2RAE A;  4DYC A;  1ETQ A;  5FKN A;  1ITY A;  4L5E A;  4C3I J;  3BR6 A;  1GDT A;  1BW5 A;  1ZR2 A;  1IV6 A;  3NAU A;  3Q3S A;  4D7M A;  4MFE A;  1ETW A;  2E2J J;  3IH4 A;  2IAI A;  3BT9 A;  5E3M A;  4XIC A;  3BQY A;  1AU7 A;  5F0F A;  1ZK8 A;  3W6V A;  4A3L J;  1OFC X;  3HEF A;  3VPR A;  2TRT A;  3FK6 A;  2DN0 A;  3S1Q J;  1JKO C;  4A3I J;  3TED A;  2CU7 A;  3HOW J;  3ZQG A;  4B3A A;  3JRI A;  4EEF G;  2EZL A;  4D5F A;  2QF7 A;  2CQQ A;  1QVT A;  1U9N A;  5E3O A;  1MBJ A;  4FIS A;  2W48 A;  2MSY A;  2DA7 A;  3QPS A;  4XRS A;  1FEX A;  4M3D A;  5BNG A;  3PO3 J;  1XC5 A;  4I6Z A;  1JT6 A;  4M3E A;  4D5C A;  4C3H J;  1BJZ A;  4A3M J;  2NS7 A;  2L9R A;  2ECC A;  1MBF A;  3HBL A;  2XGD A;  4DYQ A;  2DA1 A;  4A3K J;  2R0Q C;  1OJL A;  2DMT A;  1JTY A;  1HOM A;  1RES A;  1JGG A;  4W1U A;  1POG A;  1MH4 A;  1BL0 A;  1MSE C;  2XSD C;  2I10 A;  4MFD A;  2JJ7 A;  3PM1 A;  1A5J A;  2ELK A;  5C3E J;  4UUS A;  2GBY A;  1APL C;  2O8K A;  3ZQI A;  2OPT A;  4ABZ A;  1QRY A;  3MN2 A;  2EZK A;  2ZB9 A;  2CUE A;  3JRE A;  1RKW A;  1LFU P;  1LE8 A;  1QVU A;  2G0E A;  1F43 A;  3OSG A;  3UKG A;  4JYK A;  3LSJ A;  2LD5 A;  3OOU A;  1Y1W J;  3Q0W A;  1T33 A;  3ZQF A;  4NDL A;  1HF0 A;  1I6H J;  3QPL A;  1A6I A;  5IYC J;  3HM5 A;  2EBI A;  1H8A C;  3Q0V A;  1S7E A;  1MH3 A;  4RBO A;  1ZGW A;  2HDD A;  4BKX A;  1UHS A;  2H8R A;  1WH7 A;  3RZO J;  4M3F A;  4HNV A;  2R5Z B;  5FKK A;  5IOY A;  1VFC A;  1IJW C;  4J19 A;  5GPA A;  1IG7 A;  4QSH A;  5EZG A;  1IDY A;  3ZQH A;  5K7H A;  5IP9 J;  3S15 J;  2K40 A;  4XK4 A;  2E19 A;  1JTX A;  1O4X A;  1FTZ A;  2DMQ A;  2O9L A;  2LKX A;  4V2G A;  1OCT C;  3IH3 A;  2VKV A;  4AC0 A;  2JN6 A;  2L7M P;  2LY9 A;  2DJN A;  4QTR A;  2JK3 A;  9ANT A;  3HB9 A;  1ETX A;  1RET A;  2ME0 A;  2XB5 A;  5M3F J;  4X6A J;  1F36 A;  2L0K A;  4C3J J;  4IHY A;  1H88 C;  4IEJ A;  1U9O A;  1WI3 A;  1BA5 A;  5J1R A;  1XS9 A;  2H1K A;  3O8G A;  2L7Z A;  5EYR A;  3GTJ J;  1JUS A;  5F0H A;  5GP9 A;  5FKO A;  3LSP A;  4CYC A;  4B1R A;  3JRA A;  3LOC A;  3JRH A;  3CMY A;  2R5Y A;  3HGY A;  5EF6 A;  3NAR A;  1IUF A;  1IDZ A;  2EZH A;  1WGX A;  5M3M J;  2YU9 J;  2JA7 J;  2NS8 A;  5IYD J;  3CCY A;  2CQX A;  3G1M A;  3TW6 A;  3SDG A;  1MBE A;  3SFI A;  3ZQL A;  2EZI A;  2LR8 A;  5C4J J;  3IV5 A;  3RZD J;  4DZP A;  5C44 J;  2M2E A;  5EGO A;  2K9N A;  3LNQ A;  4BY1 J;  3O8H A;  2VPR A;  2DA3 A;  5F1J A;  1FJL A;  1OCP A;  1U78 A;  3HOV J;  5EG0 A;  2L7F P;  1MBG A;  1I3Q J;  4RDU A;  1DU6 A;  1AKH A;  2CRG A;  4FE7 A;  2O7O A;  2YUS A;  1MBH A;  3HOX J;  3BR5 A;  2CJJ A;  1SAN A;  5EDN A;  1HDD C;  2WB1 N;  1P7I A;  3CDL A;  3BR2 A;  4IHV A;  5E3L A;  3S1M J;  2GM4 A;  4A3F J;  1XG1 A;  2LLK A;  3E7L A;  1X58 A;  4UUT A;  1PUF A;  4FTH A;  3HOZ J;  1YRN A;  5IP6 A;  2Y2Z A;  2FQ4 A;  1LFB A;  1Y1V J;  3GTL J;  1X2N A;  4M3G A;  2K9Q A;  2IBD A;  3FIS A;  2DA5 A;  3HKZ N;  2LFB A;  1JKP C;  2X9D A;  3BG5 A;  2HOS A;  4A3D J;  2XPW A;  3L1P A;  4DZJ A;  5GPC A;  4G12 A;  3JRD A;  2TCT A;  4A3G J;  2VI6 A;  1SFO J;  3S1N J;  5IYB J;  3A01 B;  2KT0 A;  1B8I A;  2JWT A;  1HLV A;  1K61 A;  3BG3 A;  2LP0 A;  2DMP A;  1WH5 A;  1JT0 A;  1GV5 A;  1MSF C;  3S2H J;  5J1U A;  1NK2 P;  2XPV A;  3PO2 J;  3GTP J;  1HCR A;  2QCO A;  2VKE A;  4GFB A;  1FTT A;  2MW8 A;  3D1N I;  2Y30 A;  4AUX A;  2P81 A;  5J3L A;  4DW6 A;  5DS9 A;  1B8I B;  1TWG J;  3A01 A;  2VUM J;  1B72 A;  4A3J J;  5F08 A;  3BR1 A;  4FE4 A;  4JP0 A;  5IPA A;  3S2D J;  5FKM A;  3A03 A;  2KDZ A;  2R93 J;  4CYC B;  3DEW A;  3HGG A;  4Y52 J;  1P7J A;  1GT0 C;  2LVS A;  1EF4 A;  1JKQ C;  1GV2 A;  3CQZ J;  2Y31 A;  4XRM A;  1B72 B;  2OF7 A;  1YRN B;  1FIP A;  2N8G A;  3I4M J;  5M5W J;  1I50 J;  2XGC A;  3ZOB A;  5IOZ A;  2HXI A;  5HOD A;  3BG9 A;  5EGO B;  2ID6 A;  2NOG A;  4JX5 A;  1TC3 C;  4A3C J;  2M9H A;  3FKI J;  1HDP A;  2X6O A;  3TP0 A;  1VF9 A;  3LSR A;  2HQ5 A;  2ECB A;  3QQA A;  2M0C A;  3A02 A;  1G2H A;  5C4X J;  1GUU A;  2DMU A;  2AHQ A;  1H89 C;  3GTG J;  2R5Y B;  3WHB A;  2XPU A;  1ENH A;  5K7F A;  1TWF J;  1NTC A;  2FX0 A;  3BTL A;  1Q1V A;  2XB0 X;  3WHC A;  5F04 A;  2NVQ J;  4Y7N J;  1ORK A;  3RKQ A;  3GBG A; 
#chains in the Genus database with same CATH topology
 3CCR I;  3AL0 B;  2KDO A;  2VBX A;  4A3B J;  1Z9C A;  4M74 A;  1R1U A;  3M9A A;  3IH2 A;  1UMQ A;  2COM A;  1WPK A;  3MKL A;  2VJJ A;  5M5X J;  1RNL A;  4F7Z A;  2DQL A;  3ROU A;  1XGO A;  4IO9 F;  3JTH A;  4MTD A;  5K5R A;  1TL8 A;  2X51 A;  1N77 A;  1MGT A;  3G1O A;  3BTC A;  4MHG A;  2V1N A;  3DWL E;  5IP7 J;  5E1Z B;  2KIF A;  3IHU A;  4A93 J;  2HOA A;  1WJF A;  4B4C A;  3WE2 A;  2L3D A;  4BY7 J;  1FBQ A;  5DM7 F;  1BI2 A;  1R5G A;  3B6C A;  3V7R A;  5F0C A;  4BBR J;  2R5Z A;  1XCB A;  1FBU A;  3BRO A;  5JLX A;  2V9P A;  3DPT A;  3TW7 A;  2ZFW A;  1IC8 A;  4XN0 A;  1BR2 A;  1TBX A;  2CW7 A;  2VQH A;  5FLM J;  5FLX Z;  2JMW A;  1ZR4 A;  3PJR A;  3T8T A;  1R22 A;  4M6X A;  5TIS C;  2P4W A;  1SFU A;  1JUP A;  3OIP A;  2FNP A;  1WHU A;  1WJA A;  1FMW A;  1WJ5 A;  1FNN A;  1D5Y A;  5EZH A;  2CG4 A;  5DDG A;  1R1T A;  2AO9 A;  2DFH A;  3GTQ J;  1FZP B;  2VQC A;  4BDY A;  2YU3 A;  1U0J A;  3HYI A;  1EJ9 A;  4PDK A;  4MO7 A;  2GXB A;  1QZZ A;  1WSU A;  5ICF A;  3QU3 A;  4BL0 B;  2L2O A;  3DTE A;  2ZSH B;  4UXN A;  2DI3 A;  2X6X A;  3BQZ A;  2L9S A;  5DCF A;  2HEO A;  3ZGK A;  2O0Y A;  4U7B A;  2HNH A;  2QWW A;  3KIO A;  4WF2 A;  1R6R A;  2GWR A;  1WCM J;  5IT9 K;  2L9N A;  1FP1 D;  1V5F A;  2W25 A;  3H3V K;  3HPG A;  1HST A;  3U1K A;  4KIB A;  1D8K A;  5KNL A;  2XV4 S;  2M8G X;  2EIK H;  2RGV A;  5LEJ A;  1MMA A;  3F72 A;  1W0T A;  3K6G A;  5GAH J;  4I76 A;  4MQ9 F;  1DU0 A;  4MNU A;  5F27 A;  4XID A;  3SJM A;  4RGS A;  2HXO A;  5ICE A;  2LK2 A;  2DAO A;  2DJI A;  1ZYR F;  3ZP5 A;  4O3M A;  3G4S I;  1R9T J;  3H5N A;  2D5V A;  2E7W A;  5ILU A;  1BBY A;  3ZMV A;  4BBS J;  2YR2 A;  3SQN A;  1O7F A;  3VYU B;  2D1H A;  2IEK A;  3CCM I;  3FXL A;  4M3B A;  3DP7 A;  1S9H A;  4MIM A;  1QZE A;  5LEK A;  4G6T B;  3HRT A;  1X19 A;  2DU9 A;  1XD7 A;  3GXO A;  5IY5 H;  4HEA 2;  1I27 A;  1LVA A;  4XKW A;  2Y69 H;  4Z2Y A;  3CJQ B;  4EQQ A;  1GLN A;  2M1B A;  1KU3 A;  4DYR A;  3ONQ A;  3OL4 A;  1O3T A;  2VBW A;  3G1L A;  1N75 A;  2F5D A;  4PK4 A;  3FZV A;  2XGX A;  4F92 B;  3PFY A;  5CVR A;  1IRG A;  1U3E M;  5E8I A;  1UST A;  1X3U A;  2ADU A;  5TGT A;  3QU6 A;  1Z6T A;  3JSO A;  1ETV A;  2B63 J;  2NVT J;  1CQT A;  3KZI C;  4C3I J;  2V1D A;  2AXL A;  2GA1 A;  4BQN A;  1HA8 A;  3CC2 I;  4D7M A;  5AIQ A;  4MFE A;  3QP6 A;  2M7B A;  3IAM 2;  5F0F A;  1H9G A;  2HPM A;  3I54 A;  2E1N A;  2XHK A;  3O2P E;  3TO9 A;  3FK6 A;  4G9Y A;  2DN0 A;  1JGS A;  5DD4 A;  2EJR A;  2F5V A;  1ZG3 A;  4HAM A;  4R79 A;  5ICG A;  2B9S A;  3GF2 A;  3TED A;  2CU7 A;  4DBQ A;  3AG4 H;  1V54 H;  3MKY B;  3KYC B;  3ZMT A;  3JRI A;  4EEF G;  5HS7 A;  1XDS A;  2WBM A;  1QVT A;  5DUK A;  1U9N A;  1I39 A;  4HPQ A;  2E1C A;  2W48 A;  2WAD A;  1V55 H;  5BNG A;  2HZD A;  3PNT A;  3VYT B;  1Z3Y A;  4EJW A;  1YJ9 I;  2LKP A;  3HG9 A;  1HW2 A;  2NS7 A;  1Z3X A;  2QM3 A;  1VQO I;  1O7L A;  2R7O A;  4KUM A;  4HRI A;  2BW3 B;  2ZXI A;  2XGD A;  4JOM A;  4DYQ A;  3V8J A;  4A3K J;  2STW A;  4IJA A;  3F8N A;  3K9T A;  1OJL A;  3CD6 I;  2DMT A;  1JTY A;  2VJI A;  4BE2 A;  2W24 A;  2WB1 A;  3VDX A;  2QQ8 A;  3FM5 A;  3P9K A;  5ICC A;  1MH4 A;  1P6R A;  1IN4 A;  1WJC A;  2XIG A;  5FGM A;  1F9N A;  2XSD C;  2OUM A;  4N4N B;  5HLI A;  3E0J B;  3CJT B;  5GTH C;  4XSZ F;  2NNY A;  1HC8 A;  2V9V A;  4L9V A;  2ELK A;  3C2G A;  1B9M A;  1IV8 A;  4OU0 A;  2KMU A;  3HUG B;  3MN2 A;  3CCE I;  1K6O A;  3OS1 A;  3ZN0 A;  2ELJ A;  1G8X A;  3J80 Z;  1S6L A;  1J9I A;  1RC9 A;  3TQN A;  1X1A A;  3LSJ A;  4P5O A;  4E7J A;  3SZT A;  3LA7 A;  5B5E C;  2XC7 A;  3F21 A;  2IW5 A;  4KN7 X;  4NDL A;  3NWT A;  1HF0 A;  2DFE A;  4ZH4 F;  3NEU A;  1YS7 A;  5D5U B;  1A6I A;  2QQ9 A;  2IGM A;  4YIF A;  3FWE A;  3RKY A;  5BPI A;  2BY2 A;  4D1Q A;  5J4V A;  5H2F C;  3K4K A;  1BI1 A;  2XF5 A;  4RBO A;  5J8C A;  2HDD A;  3OYL A;  5GAE J;  1XB4 A;  4BKX A;  3KYL A;  1K6Y A;  1WH7 A;  2W82 A;  1TQM A;  3LFU A;  3IKV A;  4HNV A;  3QPH A;  2R5Z B;  1VFC A;  1E3P A;  4J19 A;  1U5T C;  2Z5U A;  4IZZ A;  2KIQ A;  3LFK A;  5K7H A;  1K4S A;  4NC6 A;  4BE0 A;  4GCV A;  4XK4 A;  4AM3 A;  1JI8 A;  4I99 C;  3JW4 A;  3RCO A;  2DMQ A;  2O9L A;  5TRD A;  4CIC A;  4UNO A;  4CCJ A;  1Z05 A;  1VQ7 I;  3CDH A;  3GWZ A;  3FXQ A;  2ISZ A;  2DJN A;  2HPI A;  3BLY A;  4QTR A;  2X1E A;  3V8K A;  2XF6 A;  2ESH A;  1RET A;  2XB5 A;  2BGC A;  2KHM A;  3T0Y A;  3QRF F;  3I56 I;  1FYM A;  3O6B B;  2ZJQ F;  3O3K A;  2H1K A;  4CO8 A;  1AWC A;  2BHZ A;  2KRF A;  5F0H A;  3GTJ J;  1BC7 C;  3TOB A;  4NB5 A;  2A6T A;  2M87 A;  3WU2 C;  3OY9 A;  3LSP A;  4CYD A;  4B1R A;  3ELK A;  4ZYH A;  1KQ9 A;  3LOC A;  1WJE A;  1J0R A;  5A2Q K;  3MKW B;  3CMY A;  1IUF A;  2LY2 A;  1G6N A;  2EZH A;  4CDG A;  1ZRD A;  1ERD A;  3GME A;  4U7D A;  1T0F A;  3TW6 A;  5LHH A;  4YFK F;  1MBE A;  2K3P A;  4OMZ A;  4XLN F;  4BGD A;  2EZI A;  2CQN A;  5C4J J;  3IV5 A;  1CF7 A;  4DZP A;  3CCV I;  1VQ4 I;  4M73 A;  2KJC A;  4CH7 A;  3WOD F;  3TL4 X;  3I64 A;  3LNQ A;  4EJU A;  1BJA A;  4L5I A;  1FJL A;  2L7F P;  1MBG A;  1SC7 A;  1BIA A;  3KP3 A;  3I59 B;  2FBH A;  3KX2 A;  2CRG A;  3RPU A;  2QYO A;  2CO5 A;  4FE7 A;  3GX4 X;  1T0F C;  4ASN A;  1MBH A;  3SHF A;  5J47 A;  2OV7 A;  4I02 A;  1HDD C;  4WCG A;  2VBY A;  1D0Z A;  2OQG A;  4PJN A;  1P7I A;  2PMU A;  3CDL A;  3GLL A;  2HGC A;  2BV6 A;  2XSJ C;  4D0P A;  4ZDP A;  2HFH A;  1OQY A;  4A3F J;  2GM4 A;  3H9Q A;  2WWY A;  4UUT A;  2LSO A;  2RVC A;  1PUF A;  4FTH A;  1G59 A;  4OMY A;  3K0L A;  2Y0M A;  2HOE A;  2VXD A;  1IRX A;  3HPH A;  1YFH A;  4BJ5 C;  2HYF A;  3LST A;  4KJZ A;  4XSX F;  3RJP A;  3HKZ N;  3VB2 A;  1JKP C;  2HOS A;  1C0W A;  1RZ4 A;  2XPW A;  3L1P A;  4L9T A;  4RMN A;  1W5S A;  3CLQ A;  2BHY A;  5GPC A;  2FXA A;  2DT7 B;  2CW0 F;  2TCT A;  4CCO A;  1DP7 P;  1UFM A;  3S1N J;  5IYB J;  1DPR A;  4XLF A;  1IN8 A;  2PMH A;  2ZNY A;  5LGT A;  1RUN A;  3GFM A;  2JWT A;  4ZC3 A;  1OCC H;  1OPC A;  3IUO A;  2LP0 A;  3GEZ A;  2CV2 A;  2QBY A;  1XGN A;  2LRE A;  2QKM B;  2GA2 A;  2XRN A;  1KU7 A;  4BXU A;  1MSF C;  3S2H J;  3DXJ F;  3JSP A;  4YG2 F;  1U5T A;  2DK5 A;  2E1M B;  3W6K B;  5FRN A;  1XSV A;  3VYS B;  3DF8 A;  2QCO A;  4A0Z A;  2K9L A;  6PAX A;  1VQP I;  2ZC2 A;  2L01 A;  2Y30 A;  2IA2 A;  5J3L A;  4DW6 A;  2W7N A;  4RB0 A;  1PYV A;  2I8D A;  3A01 A;  2VUM J;  2JT1 A;  3BJ6 A;  2BE5 F;  2KIM A;  2DK8 A;  2KRH A;  4I2O A;  3S2D J;  1MNE A;  1XN7 A;  1R58 A;  2MD5 A;  2R93 J;  3HGG A;  3VOE A;  4G6D A;  4PSW A;  3DLA A;  2MLK A;  2NRA C;  4Y52 J;  1GT0 C;  2LBF B;  5CYV A;  4RS8 A;  1JKQ C;  2PN6 A;  4UVB A;  2DQR A;  3MFK A;  2UUZ A;  1D8J A;  4EJO A;  4KIF A;  4XRM A;  3KLO A;  1B72 B;  1VQ8 I;  3LAJ A;  1EH8 A;  2JVH A;  1YRN B;  1FIP A;  4HZF A;  2JTV A;  3IAS 2;  4LG0 A;  2XGC A;  2HDW A;  3ZOB A;  1FOK A;  3GW2 A;  2HXI A;  3AFH A;  2ETH A;  1VTN C;  1U5T B;  5HS8 A;  4A3C J;  2QLZ A;  2G9W A;  4F3Q A;  2X6O A;  3TMO A;  4B44 A;  2QBY B;  2HQ5 A;  3ASN H;  3F9K A;  4QLC U;  3HSE A;  5LD2 C;  2EV6 A;  1GUU A;  3KEQ A;  2NAZ A;  2KL4 A;  2CQ7 A;  2R5Y B;  3WHB A;  5K5O A;  4G7H F;  2XB0 X;  3BTL A;  2PX9 A;  4ZDO A;  5TJJ A;  3VFZ A;  3WHC A;  3KZZ A;  5F04 A;  2NVQ J;  4MQV A;  3KP7 A;  2DBB A;  2VQL A;  3D0S A;  5IT9 Z;  4RM2 A;  1T08 B;  3BTJ A;  4V2F A;  4YEL A;  5DM6 F;  3MZY A;  2W85 A;  2R7U A;  3CO7 C;  3OYE A;  3K4M A;  2DOD A;  3CCS I;  1ZLK A;  3CC4 I;  1L0O C;  3TDZ C;  2R92 J;  2R7Z J;  3DBL B;  1ETK A;  2R7W A;  1JJ6 C;  1IGN A;  2E1O A;  4E7Z A;  3F0C A;  2DFF A;  5FD6 A;  3S1R J;  2IJL A;  4FAS D;  2PI0 A;  1AKH B;  4BAC A;  2L5Q A;  3CUQ A;  3K4N A;  3HOY J;  5EG0 B;  2CSO A;  1LEB A;  2JA6 J;  1E3O C;  2LNB A;  3GTM J;  2XGE A;  4ZDL A;  2HOT A;  2JA8 J;  1GVD A;  1TWH J;  2JUG A;  2VL8 A;  3RSN A;  2RC4 A;  4LOC A;  4HX4 A;  4AD9 A;  5HDK A;  5F1R A;  3MKZ A;  4OIP F;  4DOZ A;  3HC7 A;  3JRF A;  2GXG A;  1H0M A;  2H6C A;  5L3E A;  5M5Y J;  4D9J A;  3VSL A;  4IKF A;  4II2 A;  1RPW A;  3VSK A;  2WY8 Q;  4FQG A;  4HQM A;  3LL7 A;  1LFP A;  3F22 A;  2JA5 J;  3C2B A;  4HX7 A;  2JQ7 A;  3SFZ A;  3OYH A;  4RB3 C;  1JUM A;  2QSG X;  5LGU A;  3K10 A;  4HLX A;  3DCF A;  3D5R C;  3PIO F;  3PUF A;  1SAX A;  4ZTJ A;  3OS0 A;  3M07 A;  2LTP A;  5CQG A;  1QPM A;  2BY3 A;  4UUS B;  2Y0S A;  2LY1 A;  3BY6 A;  2HR3 A;  2X48 A;  4B8X A;  2P5V A;  4ENN A;  2DA4 A;  1KZH A;  2BXY A;  3ABK H;  2UV1 A;  3GO5 A;  2M34 A;  4D7N A;  2MFZ A;  4ENK A;  1BR4 A;  3HDD A;  5HLG A;  2EIJ H;  1LE8 B;  1UG0 A;  1OCO H;  3WTZ A;  2JRT A;  3MEX A;  2GXA A;  3BZ6 A;  2DT6 A;  2JPB A;  2GAU A;  4FCY A;  3ZMD A;  2TDX A;  3LQR A;  1WVR A;  3BC8 A;  4HX8 A;  2E2I J;  2KPM A;  2QVO A;  3K2A A;  1QBJ A;  2OTL I;  2IGN A;  4IOA F;  4XOT A;  3CF2 A;  1UJ8 A;  5H6R A;  3OIQ A;  4PFO A;  3S16 J;  4L0Y B;  2CFO A;  2KP6 A;  2JSP A;  2DYS H;  3ZQC A;  2DT5 A;  4BJT A;  1ZGJ A;  2L4A A;  3LSI A;  3GZ5 A;  4LG3 A;  2ELH A;  4A69 C;  4FX4 A;  5GAD J;  5BOX A;  4OWR B;  2DOF A;  4XRS G;  2OD5 A;  2HYJ A;  1ZN2 A;  1TWA J;  2COB A;  3S32 A;  3HOT A;  3KYD B;  3RYP A;  3CF5 F;  3WTS C;  1J5Y A;  2RQP A;  4DYC A;  2ZXW H;  3OL3 A;  3UNG C;  1FC3 A;  4PGG A;  1GDT A;  3BR6 A;  1X1D A;  1BW5 A;  4S04 A;  3D5L A;  4HST A;  1IV6 A;  3HUG A;  4RGX A;  2M5W A;  1ETW A;  5K5Q A;  2E2J J;  3IH4 A;  2R7X A;  2IAI A;  3BT9 A;  4HW0 A;  2R7S A;  3DEE A;  4FHT A;  1P4W A;  3PNY A;  1OFC X;  4HBL A;  2BVM A;  1IUY A;  4XKC A;  4BQQ A;  3S1Q J;  3L2U A;  2CYY A;  2IS4 A;  4XR6 A;  3C18 A;  5FFX A;  3GCM A;  5HLT A;  1YW8 A;  3HOW J;  1X4P A;  3V8L A;  3ZQG A;  3CJN A;  1USS A;  5EEH A;  1BOA A;  1A31 A;  2O5R A;  3DBR B;  2D1V A;  5B3S H;  2DW4 A;  3F23 A;  3F6O A;  1YLF A;  2E34 A;  5E3O A;  3RQ4 A;  1NHA A;  2UWM A;  2ZNZ A;  5FRM A;  3QPS A;  5LFA A;  4M3D A;  2PJP A;  4ETS A;  2P7C B;  2IP2 A;  5DCM B;  3MD2 A;  3KCC A;  5E1W A;  1BJZ A;  3IWZ A;  4WXC A;  5H20 A;  1TT0 A;  1MBF A;  1XX5 A;  1XGM A;  3AKZ A;  3H9G A;  1D1B A;  4IX7 A;  3CTA A;  1LEA A;  4LIT A;  2CV1 A;  3U21 A;  1YIT I;  1RES A;  3EPZ A;  2UZK A;  1R00 A;  1ZGA A;  4IRH A;  2F4O B;  2EIL H;  1X1B A;  5EJC A;  3OYJ A;  1GHC A;  5HLH A;  4LLL A;  4EJV A;  2I10 A;  4MFD A;  3JCU C;  1FYL A;  3PM1 A;  4GYI A;  1A5J A;  2LYC A;  2GBY A;  3T5X A;  2IT0 A;  1HW1 A;  1APL C;  1W5C C;  4DJA A;  2QQA A;  3KZY A;  2DCE A;  2OPT A;  5HOO A;  3JTG A;  2JUC A;  3ZMS A;  2FU4 A;  2ZB9 A;  1RKW A;  1WJB A;  2EK5 A;  5A2Q Z;  3HOS A;  2G0E A;  3IRR A;  1SVL A;  2VT3 A;  4OIR F;  3OSG A;  5D5X B;  5FRO A;  2A07 F;  4JYK A;  2RDP A;  4A5N A;  2LD5 A;  1Y1W J;  2BOL A;  2XDV A;  4PJ0 C;  1EA3 A;  4U0W A;  4ZZD A;  1T38 A;  1P92 A;  2KKO A;  2W4S A;  4B3X A;  4PGH A;  1QQI A;  3IWF A;  2M4K A;  4ESJ A;  1I6H J;  2R7T A;  5L3B A;  4I01 A;  3LA3 A;  1VQL I;  1EV7 A;  2A3S A;  2XAJ A;  2FOK A;  2FF4 A;  2LDU A;  3P9I A;  2LF8 A;  3Q9S A;  2GZW A;  3IL2 A;  3BJA A;  3EUK L;  4OAY A;  2HTJ A;  4JBA A;  3RTR A;  1Z21 A;  1IG7 A;  2KQR A;  5EZG A;  4FET A;  4O5V A;  5AON A;  3T1B A;  2E35 A;  3G73 A;  4M9Z A;  4JK1 X;  3H0D A;  4H0E A;  1K78 B;  3K69 A;  3QWL A;  4L9N A;  1YQA A;  3PIP F;  1FOY A;  3L2W A;  2LKX A;  3WU0 A;  5ILV A;  1TP4 A;  3FBI B;  3MZ8 A;  1F5T A;  1OCT C;  1HKS A;  4AC0 A;  3ISP A;  3OYF A;  3FHN A;  3CME I;  3BJO A;  3E5U A;  2JK3 A;  9ANT A;  1ON1 A;  3FF5 A;  3HB9 A;  5JHF A;  1ETX A;  3LSM A;  4RGU A;  1P4X A;  2L0K A;  4YEJ A;  1H88 C;  4AID A;  4UUV A;  1WI3 A;  1HQC A;  1XS9 A;  2KIU A;  4NC7 A;  3O8G A;  2L7Z A;  1D5V A;  5GP9 A;  2MC3 A;  1WRJ A;  3P5J A;  2EFP A;  3JRA A;  1J2X A;  2KIS A;  3JRH A;  2OQR A;  4BYY A;  3E5Q A;  4FX0 A;  1R71 A;  3OMY A;  4PCQ A;  4YFN F;  3DFG A;  3V4G A;  2VOD A;  2E71 A;  2L9V A;  4Q47 A;  4V19 K;  3ZQL A;  1YYV A;  3RZD J;  1I1G A;  1ZRF A;  5CVV A;  4MGR A;  3CCJ I;  2BZT A;  5EGO A;  2K9N A;  2DFI A;  3O8H A;  2PEX A;  2VPR A;  3BZK A;  3U1D A;  4BEH A;  3CMM A;  1V3F A;  5DYM A;  1UHM A;  2WTE A;  2HQN A;  2J5P A;  3E6C C;  4RDU A;  4X0G A;  1SMT A;  2KZV A;  4I98 B;  2VIX A;  2F4M B;  2PFB A;  4Y17 A;  2O7O A;  3HOX J;  1P2F A;  2AS5 F;  2CJJ A;  5EDN A;  5B1B H;  3FDY A;  1LPQ A;  2KZG A;  1G3Y A;  3H92 A;  4DIQ A;  1J59 A;  4I0A A;  1RIO H;  4U0Y A;  3WTV C;  3ABU A;  3RKW A;  1YI2 I;  4LG0 B;  2Q8K A;  1XCV A;  4BHB A;  1YRN A;  2A5W A;  2FQ4 A;  3QYF A;  1LFB A;  3MMY B;  1JE8 A;  4E6K G;  2GOX B;  3EET A;  4C2U A;  2KJB A;  3K70 D;  2LFB A;  2EIN H;  4FT8 A;  1XMK A;  4G12 A;  3H3Z A;  1OLT A;  4A3G J;  3HHH A;  2OA4 A;  2CH0 A;  2OU2 A;  2ZBK A;  2LH9 A;  2VI6 A;  2XKO A;  3I58 A;  3A01 B;  1SFO J;  2KT0 A;  1UAA A;  4II3 A;  1B8I A;  1HLV A;  3VYR B;  1R36 A;  3K70 C;  3ECO A;  1X4O A;  4ZJZ A;  3RI4 A;  2GOM A;  4CSW A;  2GQQ A;  4L0Z B;  2QKL B;  1MZB A;  5J1U A;  1NK2 P;  1X3Z B;  2XPV A;  3PO2 J;  4HG2 A;  3DU6 A;  3I9V 2;  3GFI A;  4GFB A;  1FTT A;  2ICW G;  3KEY A;  2DOE A;  2RV8 A;  3ZN1 A;  5F08 A;  2RN7 A;  3HHG A;  4P96 A;  1TTY A;  5IPA A;  3A1Y A;  3ZMU A;  2P7V B;  3T8R A;  3ABL H;  2HKO A;  2HKX A;  2H6B A;  3RKX A;  1FOW A;  2LVS A;  1V5G A;  1Z1D A;  1UEL B;  4A12 A;  3DBH B;  1R23 A;  3CP2 A;  1ON2 A;  2EV5 A;  3CP8 A;  2Y31 A;  3OR2 C;  2X85 A;  1FLI A;  4F55 A;  4LMY A;  2QQB A;  2N8G A;  2DO7 A;  2ZFU A;  4MEY F;  4ZTF A;  3LSK A;  3I5U A;  5IOZ A;  5HOD A;  1XMA A;  2WC2 A;  2NOG A;  1BR1 A;  1LDK B;  4JX5 A;  1V4R A;  2W00 A;  1MJA A;  2M9H A;  3CJR B;  1SVO A;  4I09 A;  4XOR A;  3HRM A;  1Z6R A;  3J80 K;  3BPV A;  3GFL A;  3IKT A;  1LUJ B;  3BP8 A;  1ZG1 A;  2OCE A;  3LSR A;  2XF7 A;  3QQA A;  2XAF A;  4BJ6 C;  1KYW A;  2DMU A;  2E5N A;  4RAZ A;  2AHQ A;  3FMQ A;  3J7Z I;  4IHT A;  2XPU A;  4YFX F;  3DTK A;  1NTC A;  1SFE A;  2FX0 A;  1Q1V A;  3PSF A;  4RGR A;  4CZZ A;  2LMD A;  4ENJ A;  4Y7N J;  4E7K A;  4DQ2 A;  1W7P B;  1W4M A;  4CCN A;  2MC4 A;  4MEX F;  2DA2 A;  1ETO A;  4X1E A;  1TQI A;  2GLO A;  4AU7 A;  3K1N A;  3LSG A;  2ACJ A;  3I0T A;  4F93 B;  4R1H A;  1TWC J;  2KRC A;  2FBK A;  2C6Y A;  3OS2 A;  4BS9 A;  1FMV A;  4JX6 A;  1PDN C;  1K4T A;  2EFQ A;  3CUQ C;  4JX4 A;  1AOY A;  3C2H A;  1QPI A;  4NHJ A;  4CXF A;  1JKR C;  2DMN A;  3GTK J;  1UZC A;  5B66 C;  5E3N A;  2O3F A;  2LC2 A;  2NVY J;  2VBZ A;  3HSR A;  3M8F A;  2QGU A;  2A69 F;  1FIA A;  3R61 A;  1IN7 A;  4M9X A;  2QA4 I;  2W57 A;  1BW6 A;  2WV1 A;  4M6V A;  5CVJ A;  1OKR A;  3LSH A;  4KIG A;  3B73 A;  3TKY A;  3BG6 A;  3FXJ A;  2PMZ N;  2JA2 A;  2VKD A;  1FSH A;  3L2Q A;  1JJ8 C;  2FML A;  4YII A;  3OYA A;  2BXZ A;  4NUB A;  2XRL A;  3RPQ A;  2FEZ A;  4XLH A;  3KP2 A;  1REP C;  2E5Z A;  2OTJ I;  3HTS B;  1ZTR A;  5FKL A;  1ZQ3 P;  2E2H J;  2O6G E;  2GIV A;  2ZSI B;  3A2K A;  2CS3 A;  2Z1D A;  1TZL A;  3MCZ A;  1J09 A;  2WA0 A;  2NVX J;  4Q5S F;  1MMG A;  2MA3 A;  2FD5 A;  1DP3 A;  3LWF A;  1Y39 A;  3E3V A;  4OIO F;  4Z6Y A;  1FT9 A;  3DV8 A;  5FJ8 J;  1OR7 A;  3JRB A;  3OSF A;  1A36 A;  2ME6 A;  1WKM A;  2L02 A;  5CJ9 A;  3L00 A;  2M0M A;  1ZKG A;  1W36 D;  3MAJ A;  3H0G J;  2O61 A;  1UG2 A;  2VC0 A;  2WAQ N;  3B6A A;  1SFX A;  1K83 J;  3KFW X;  1E0E A;  2BBY A;  1D1C A;  3HJE A;  3RQI A;  1U8B A;  1W1W E;  4EGY A;  5CVI A;  3JR9 A;  2PJR A;  1SVM A;  5JLW A;  1NK3 P;  4XKB A;  3F8C A;  3L2C A;  4XLA A;  4EM2 A;  1HSJ A;  2MH9 A;  5J40 A;  3K4J A;  1T39 A;  4BXX J;  1RKT A;  1IXS B;  1TNT A;  5ILS A;  3TGN A;  3N05 A;  4CGZ A;  2JPC A;  3AG2 H;  3VEP A;  2MD0 A;  2BW3 A;  4QIW N;  2IXS A;  4XKV A;  5K1Y A;  4W97 A;  5J1Y A;  2A68 F;  2XAS A;  4S0H B;  1EH7 A;  3CZ6 A;  3GYH X;  3S3O A;  3HSF A;  4IXA A;  4RAG A;  2DOA A;  4IQ4 A;  1Y0N A;  4JQF A;  1B59 A;  3QAH A;  3K7A J;  2ID3 A;  3HKZ A;  2H27 A;  2X1D A;  1FY7 A;  3AL0 C;  2I5U A;  1XSD A;  3EQL F;  4ESF A;  2R7R A;  1Y8R B;  4PUS A;  2CV0 A;  1IXR C;  5E1X A;  1IRF A;  2VB6 A;  1Y56 A;  5EEA A;  4Y15 A;  5HNF A;  4WXD A;  4IHX A;  3WG7 H;  3K4B A;  2F5E A;  3I71 A;  3CDI A;  2XAH A;  5E79 C;  4A6E A;  1ZG5 A;  3PQJ A;  2RAE A;  2ESN A;  2WV0 A;  2HZT A;  3DPL C;  4HDV A;  3Q3S A;  5L3D A;  4BU2 A;  4E7I A;  1QZY A;  2QZ8 A;  1AU7 A;  3Q9V A;  4KIS A;  3FX3 A;  4B09 A;  2R7D A;  1W7P D;  2WAE A;  3G71 I;  3VPR A;  1QNT A;  1ONV A;  4PJM A;  2W1O A;  4GXO A;  4XNF A;  1FBS A;  2ZCW A;  5BS6 A;  1JKO C;  2K9M A;  4A3I J;  2OC6 A;  3M8J A;  2OZ6 A;  3CES A;  2AXT C;  1FYK A;  2QSH X;  4B3A A;  5DEQ A;  1T95 A;  3H5A A;  3GLX A;  2NVU B;  2FSW A;  5KCM A;  4KYW A;  4D5F A;  2HQR A;  2CQQ A;  1TQP A;  2K86 A;  3R60 A;  2V1X A;  4FIS A;  3CCQ I;  4WX9 A;  3D5S C;  2DA7 A;  3PO3 J;  1S7O A;  1XC5 A;  4OIN F;  1KGS A;  4I6Z A;  4BDZ A;  4M3E A;  2YX7 A;  3E6B A;  4C3H J;  2IA1 A;  3L7W A;  4A3M J;  2BY1 A;  3OOP A;  2F5F A;  4XMY A;  4KDP A;  3FMR A;  3GZ6 A;  1Y6I A;  2EFN A;  1MDM A;  3J81 K;  1SFK A;  2EIM H;  1S5L C;  3BDD A;  2R0Q C;  2VQG A;  4XLP F;  1MIJ A;  4ENM A;  2Z2S B;  2OZU A;  4WWC A;  1VQK I;  2CGP A;  4AIH A;  4N9H A;  4OOI A;  4U87 A;  3SXY A;  3TOA A;  1P9Q C;  1VZ0 A;  2LRD A;  4I0B A;  1MMS A;  3ZCO A;  2K02 A;  2O8K A;  1IN5 A;  3CUQ B;  4GDF A;  4O6J A;  2H94 A;  1QRY A;  2DTR A;  3H36 A;  2CUE A;  3JRE A;  1QVU A;  2A6H F;  1D0Y A;  4XON A;  1F43 A;  2V7F A;  2QEN A;  2M3A A;  3UKG A;  1MW7 A;  2OCC H;  3I4P A;  4GGG A;  2IRF G;  1PVE A;  1YG2 A;  2ZXJ A;  4BH9 A;  2PJR B;  3K4L A;  2F5C A;  3Q0W A;  3N97 A;  3ZQF A;  4CUG A;  2R7Q A;  3J7A Y;  5FLX K;  3OYM A;  4C9Y A;  4I7H A;  2K3F A;  2V6E A;  5IYC J;  3E6M A;  3SDB A;  2Q0O A;  4KA4 A;  2F2E A;  1H8A C;  2JZY A;  1S7E A;  1MH3 A;  3ZXS A;  4IL6 C;  1ZGW A;  3H1C A;  4CZC A;  2G7U A;  3WGI A;  2H8R A;  4LD5 A;  3RZO J;  4M3F A;  4ITV A;  4QSH A;  3BCA A;  1IDY A;  4LIV A;  1S72 I;  1X1C A;  1ZHF A;  1Q1H A;  2K40 A;  3H3U A;  3S15 J;  5BQT A;  1MMD A;  3TDU C;  1E3H A;  1JTX A;  1SD6 A;  3DTI A;  4ZYE A;  4CHU A;  4XN3 A;  2VKV A;  2JN6 A;  3A0H C;  3G2B A;  3HRU A;  5F6F A;  2L7M P;  3LQQ A;  1BIB A;  2LY9 A;  4RLF A;  4ON0 A;  1J7K A;  1MKM A;  5M3F J;  2ME0 A;  1Y0U A;  2VKH A;  5DV5 A;  4C3J J;  1TT5 B;  2ZME C;  5JFR A;  3GVA A;  4B47 A;  1BA5 A;  4ESB A;  5J1R A;  4P1W A;  4F91 B;  2DPU A;  3BOQ A;  5EYR A;  1WZ2 A;  3KET A;  1JUS A;  1ZEL A;  2YPR A;  1YE9 A;  1BN5 A;  1YX3 A;  2P8T A;  3HGY A;  5EF6 A;  1I5Z A;  3NAR A;  3PFI A;  2ZME A;  2Z16 A;  1WGX A;  5M3M J;  3M8E A;  4UVC A;  4A5M A;  4YRV A;  2YU9 J;  4AIJ A;  3I53 A;  3WTY C;  3I55 I;  2CQX A;  1PUE E;  2PBI A;  3G1M A;  3WE3 A;  4TV7 A;  5KK1 A;  2IGO A;  2V1U A;  3SFI A;  2IVM A;  3E1S A;  5L3G A;  4UY8 I;  2FUG 2;  1R4M B;  1KA8 A;  1AA7 A;  4EAT A;  4N4O B;  3FMS A;  4BY1 J;  2X4H A;  3S2W A;  4NQW B;  1UCR A;  5F1J A;  5CQE A;  1OCP A;  1U6G A;  4LIU A;  3JAM K;  5EG0 A;  1U78 A;  5HS9 A;  3WGH A;  1I3Q J;  3KLN A;  2E36 A;  2DLL A;  2F4I A;  4BQO A;  3ZMZ A;  2YSR A;  1AKH A;  3OYB A;  1T6S A;  2XRO A;  3QP5 A;  4G7O F;  1VQ5 I;  3BR5 A;  3ERM A;  1SAN A;  1I6X A;  2VAS A;  2XKP A;  4M72 A;  2MAB A;  2P6S A;  4E7H A;  1VQN I;  2WB1 N;  1ZAO A;  1YS6 A;  2KLO A;  4NBQ A;  3BR2 A;  4IHV A;  2JRM A;  4LB6 B;  5E3L A;  5LHG A;  3S1M J;  1S8N A;  2VXZ A;  1M1E B;  1ODD A;  4M6Y A;  1X58 A;  4L9J A;  3TBI A;  3HOZ J;  4XL9 A;  2Q1Z B;  3HXL A;  5IP6 A;  2Y2Z A;  4CCL A;  4L5J A;  4BUP A;  4HDU A;  1Y1V J;  1UHW A;  2H8W A;  2FRH A;  2LOO A;  4UVA A;  3MZH A;  1RR8 C;  5E8G A;  4M3G A;  2F48 A;  2L54 A;  1H9T A;  2K9Q A;  1YJW I;  3ML6 A;  1IO2 A;  3DKW A;  5FO5 A;  4L18 B;  1R49 A;  3EUA A;  3F3X A;  2YX4 A;  1YW7 A;  3SEQ A;  1F4K A;  5D5W B;  1LQ1 A;  1S7A A;  2EB7 A;  5LRR A;  1YO5 C;  2K5C A;  5CLS A;  2QSF X;  1D0X A;  4N0B A;  3G6E I;  3ZRG A;  2R7V A;  2DMP A;  4RLQ A;  1SEU A;  4BAY A;  1JT0 A;  2EV0 A;  5DD8 A;  1G3W A;  3OYK A;  4QPO A;  2VJ4 A;  3C1D A;  3K2Z A;  4OIQ F;  3PUB A;  1LB2 A;  2VKE A;  3ESW B;  2MW8 A;  1XGS A;  3D1N I;  4OAZ A;  1ZH5 A;  4AUX A;  4HQE A;  5HVQ C;  1B8I B;  2Q2E B;  4HYE A;  3KP4 A;  4A3J J;  1B72 A;  2ZME B;  4JP0 A;  4IF4 A;  3A03 A;  2KDZ A;  2HDC A;  3VOD A;  1TNS A;  2QUF A;  5JI6 A;  3COA C;  3WG9 A;  4PJJ A;  4EVI A;  5L3F A;  5FB2 A;  2MLG A;  1EF4 A;  2OBP A;  3HRS A;  2STT A;  5J8F A;  3M1E A;  1GV2 A;  3CQZ J;  3ERE D;  1N25 A;  1NG7 A;  2WAF A;  2Q2E A;  1QHG A;  3W3C A;  3AG3 H;  3OYC A;  3JAM Z;  4KMF A;  1FSE A;  3U2R A;  1I50 J;  4BHP A;  4C30 A;  2R3S A;  1KYZ A;  4AIK A;  4LB5 A;  4BEH B;  2NS0 A;  1YTY A;  3QYE A;  5D6E A;  3QPT A;  3BG9 A;  5EGO B;  2ID6 A;  3R0A A;  1TC3 C;  3BWG A;  1HW5 A;  1KU2 A;  1IW7 F;  1R4N B;  4AVP A;  3OR1 C;  4NC8 A;  4EMS A;  2EFW A;  3ECH A;  1YIO A;  1HDP A;  4KFC A;  1Y8Q B;  3TP0 A;  1VF9 A;  1I3A A;  2RRE A;  2Z99 A;  1G2H A;  1B4A A;  1EKE A;  4RB1 A;  3S3M A;  4LGW A;  2VOO A;  5C4X J;  3J81 Z;  1G3S A;  3L2R A;  2X6W A;  2EA4 A;  1ENH A;  3M7G A;  1O3Q A;  5IT3 A;  1OYW A;  1U8R A;  1G3T A;  2HYG D;  3A0B C;  2MBF A;  5D4R A;  3WGG A;  1VQM I;  2M30 A;  5L3C A;  3GBG A;  2E60 A;  3KPH A;  3OIO A;  1GVJ A;  1Z7L A;  2CUF A;  2FMY A;  4IHW A;  4HOB A;  4C2T A;  3BTI A;  3MVP A;  3TO7 A;  1VND A;  3E5X A;  1PUF B;  3SZP A;  3REO A;  3FXO A;  1JHF A;  4PZJ A;  2IS2 A;  5AIP A;  2HVQ A;  1VQ9 I;  1OCZ H;  3I4N J;  2A05 A;  3GUD A;  1A04 A;  3TP3 A;  4G8X A;  1XPX A;  1BOB A;  3DPU A;  4MLO A;  3S3N A;  1X1P A;  2VT2 A;  1VQ6 I;  1VI0 A;  3JRC A;  1G4D A;  1AHD P;  1SMY F;  1IAW A;  2YS9 A;  4MTE A;  3S17 J;  3BR3 A;  1OYI A;  3I59 A;  2B0L A;  3FBN B;  1OYY A;  2IS1 A;  4KN4 X;  3L2V A;  3F6V A;  3BCB A;  2J5O A;  2FJ1 A;  2CW8 A;  3DQV C;  4NQW A;  5D4S A;  4ZYG A;  3GZN B;  1W0U A;  4HF1 A;  1ZLJ A;  2RNJ A;  5JVT A;  2V26 A;  3AAF A;  1LDJ A;  1CF7 B;  4IHS A;  2Y0S N;  2CUZ A;  4J00 A;  2DA6 A;  3RYR A;  1EH6 A;  2EH3 A;  1K78 A;  2O8X A;  3BR0 A;  1WI9 A;  1PJR A;  2K9S A;  4KT5 C;  1MBK A;  1T56 A;  4R8H A;  3JRG A;  1Z77 A;  3F8B A;  1ETY A;  3ZQQ A;  1STZ A;  3MWM A;  3OV8 A;  5LLQ A;  2Z33 A;  2Y9Z A;  4HNT A;  4C2M J;  3QYB A;  3S93 A;  1O3S A;  1MNM C;  1IRZ A;  2EQR A;  4B48 A;  4LK0 F;  1DGR M;  3BG7 A;  4XBF A;  5J6X A;  5KAF C;  2ZJR F;  2MG4 A;  3ZR8 X;  1BI0 A;  5CPR B;  2HI3 A;  3ZPL A;  5KHD A;  1K79 A;  3K1P A;  5K7Z A;  4U88 A;  4IOC F;  1NG6 A;  2V9K A;  1TW2 A;  2HU9 A;  3M4O J;  3QOP A;  3ZQ7 A;  4P55 A;  4F52 A;  3CCL I;  1WFX A;  2RKH A;  2EWN A;  3V42 A;  2DTZ A;  1RRJ A;  1IF1 A;  2F6C A;  1MJB A;  2IPQ X;  3GTO J;  3EUH A;  2X1C A;  1LJ9 A;  5FLV A;  4PSX A;  2EA2 A;  1DGW Y;  5F64 A;  2K85 A;  1YJN I;  3Q0U A;  4J01 A;  2X0L A;  3CCU I;  1B9N A;  2DYR H;  2ZXH A;  1Z7U A;  3S14 J;  4H4K C;  1R1V A;  3FK7 A;  5DCM A;  3HOU J;  4KMU X;  1FX7 A;  4NNJ A;  5DTD A;  5FFZ A;  3DLL F;  4XM3 A;  2PQ8 A;  4AYB N;  2Y9Y A;  2Z9O A;  2V4J C;  5JVG F;  1IXC A;  4A3E J;  1QA6 A;  5ERI A;  2MGQ A;  1GXQ A;  3DU5 A;  4WK8 F;  4GRI A;  5LRS A;  4E70 A;  3HL2 A;  1X2M A;  2IGK A;  3IRQ A;  3EDP A;  3A4C A;  4EV0 A;  1D3Y A;  1I1S A;  4U0V A;  3S8P A;  2ZJ2 A;  3AG1 H;  5ED4 A;  1DDN A;  1J75 A;  3W2A A;  1A6Q A;  3M3Y J;  3FIW A;  4AWX B;  1RR7 A;  2NOJ B;  1Z0X A;  1ZRC A;  1B6A A;  1UB9 A;  2XAQ A;  1ETQ A;  2L7K A;  5FKN A;  4A0X A;  4M9S A;  4L5E A;  1ITY A;  1LKX A;  1P4A A;  2FA5 A;  2X6Y A;  1ZR2 A;  1WWX A;  3NAU A;  4BXF A;  1HBX G;  4RM3 A;  3E6D A;  5D6F A;  4LLN A;  2CWE A;  2EFO A;  1HXD A;  5E3M A;  4XIC A;  3BQY A;  5JHU A;  1XMX A;  4UV9 A;  1ZK8 A;  3W6V A;  4XQF A;  4A3L J;  4P9U A;  3RPU D;  2BY0 A;  2PMZ A;  2JVG A;  3HEF A;  5JR3 A;  1BI3 A;  1S29 A;  1YX5 A;  2TRT A;  5GAG J;  3TO6 A;  2IS6 A;  4N9I A;  5GTI C;  4LFU A;  2M4G A;  1R7J A;  1OCR H;  4Q48 A;  5E17 F;  3EYY A;  2VON A;  2DPD A;  2DXI A;  3J7A O;  4A6D A;  1MDM B;  1TLH B;  1DPU A;  1Z67 A;  5HNH A;  3F8M A;  2EZL A;  2H1L A;  1R5I D;  2M45 A;  2QF7 A;  4LK1 F;  1RUO A;  1MBJ A;  4G7Z F;  4GYG A;  3NWS A;  3OYG A;  4BE1 A;  4KIT B;  1FP2 A;  2MSY A;  4XRS A;  4KIC A;  1FEX A;  1KU9 A;  2R4G A;  1JT6 A;  2E1M C;  1SD4 A;  4D5C A;  3K1M A;  5E20 A;  3FXR A;  3FKJ A;  3P9C A;  2L9R A;  2ECC A;  2AQF A;  3VWB A;  3HBL A;  4WXH A;  2DA1 A;  2CQK A;  3KE2 A;  4Y13 A;  4IRI A;  1SD5 A;  2UXX A;  1TW3 A;  4CA0 A;  1FOX A;  1FPQ A;  1ZAR A;  5D5V B;  1HOM A;  1JXS A;  4HV5 A;  2EPF A;  3MQ0 A;  1IN6 A;  1JGG A;  4S05 A;  4W1U A;  2XVC A;  3FXK A;  5LBQ A;  1POG A;  4HF0 A;  4GO1 A;  4IRG A;  1BL0 A;  5EEG A;  1MSE C;  4E4H A;  3QOD A;  3PQK A;  2HS5 A;  3L09 A;  2HTS A;  1CGP A;  2JJ7 A;  4RAY A;  2G7H A;  5KAI C;  5C3E J;  4UUS A;  2WY7 Q;  4HSR A;  2H09 A;  1YW9 A;  4CCK A;  3F8F A;  2QEX I;  2D45 A;  1K7A A;  3ZQI A;  4ABZ A;  4EGZ A;  4ZZL A;  2EZK A;  2FBI A;  3DKX A;  3GFJ A;  4RB2 C;  3X2Q H;  1LFU P;  1LE8 A;  2B7E A;  4HV6 A;  3M1C A;  4PJL A;  4XOP A;  1ULY A;  1BM9 A;  2O03 A;  1W5T A;  3B02 A;  4ZYA A;  1PP8 F;  3SYT A;  3OOU A;  1F1Z A;  2MH2 A;  5KVR A;  5B1A H;  3HIF A;  3C7J A;  3W6J B;  1T33 A;  3I3L A;  3CMA I;  2RNG A;  2VN2 A;  4IPA A;  2P5L C;  1WJD A;  1DQU A;  2P0W A;  3QPL A;  2VE9 A;  2XUB A;  3HM5 A;  1SAU A;  4LLG F;  2EBI A;  4LJZ F;  1W7P A;  1W36 C;  3KP5 A;  3IP4 B;  2BEO A;  3Q0V A;  1O57 A;  3ABT A;  1U2W A;  3OYD A;  4UB6 C;  2JSC A;  1KQ0 A;  3KP6 A;  1UHS A;  1FWZ A;  2FOW A;  4DNC A;  2KFD A;  1IJW C;  2VC1 A;  3W2W A;  2Z3Y A;  5FKK A;  5IOY A;  3WU1 B;  3WTX C;  5GPA A;  2A6E F;  2GIZ A;  2M8E A;  2K4B A;  2NXN B;  3ZQH A;  1KON A;  3J7Y J;  5IP9 J;  1R5H A;  4XLE A;  2FNA A;  1BC8 C;  3E97 A;  3NQO A;  1N78 A;  2E19 A;  3H5R A;  1O4X A;  4EJT A;  1FTZ A;  4K2E A;  4V2G A;  2P5K A;  3IH3 A;  4EM1 A;  1QGP A;  2DDA A;  2DDB A;  2M7A A;  4ANJ A;  3H35 A;  2BYV E;  4KNY A;  4Y4R A;  1QU3 A;  3HTU A;  1QHH D;  4G6Q A;  4G94 A;  4X6A J;  2UXN A;  2XAG A;  2VJ5 A;  1T8I A;  1F36 A;  1ZRE A;  4UB8 C;  4IHY A;  3OWT A;  4IEJ A;  2AQE A;  1JHH A;  1U9O A;  2R7F A;  4EM0 B;  3CO6 C;  1ACI A;  5H6Q A;  1L3L A;  3L9F A;  1XDU A;  3HZJ A;  5FKO A;  4CYC A;  4DBR A;  1LDD A;  2BVL A;  1NH3 A;  1XSX A;  2R5Y A;  2HQA A;  1IDZ A;  2JA7 J;  2NS8 A;  2VOP A;  3LA2 A;  4BHC A;  3CCY A;  5IYD J;  3UR3 C;  3PL8 A;  1IZ1 A;  5CVU A;  3SDG A;  3P7N A;  4YIR X;  1YOV B;  4ZYD A;  2HWV A;  2LR8 A;  3RDI A;  1B1B A;  5C44 J;  3WTU C;  3ASO H;  2HVR A;  2M2E A;  4UV8 A;  1E17 A;  1Z91 A;  4Y33 A;  2P6T A;  2DA3 A;  2WAQ A;  2LF7 A;  1X3W B;  3HOV J;  1RI7 A;  3NRV A;  4HA8 A;  2LKS A;  3DEU A;  5J4Y A;  3WTW C;  2FE3 A;  1DU6 A;  5HDG A;  4KT6 A;  3FHZ A;  1KQ8 A;  2YUS A;  3FXU A;  1QO0 D;  2LBF A;  2V6C A;  3Q5F A;  4HLY A;  2FQ3 A;  1SD7 A;  5DUI A;  3FM3 A;  4HF2 A;  4IQJ A;  1PP7 U;  2A5Y B;  3WTT C;  3G3Z A;  2NYX A;  1XG1 A;  2LLK A;  3EUH C;  2MYS A;  4RAF A;  3DKY A;  3E7L A;  3LAP A;  1OR7 C;  2IA0 A;  1E2X A;  3U9G A;  2VLA A;  2Y48 A;  3GTL J;  2OJE D;  1X2N A;  2Y75 A;  2IBD A;  1MJ9 A;  2CFX A;  3CUO A;  3FIS A;  2DA5 A;  1GXP A;  2ISY A;  2X9D A;  3C3W A;  3BG5 A;  4Y3O A;  2ZKZ A;  3PSI A;  4A3D J;  3V7S A;  1WQ2 A;  1HKQ A;  5E18 F;  4BNC A;  4E7L A;  4DZJ A;  3JRD A;  2W84 A;  1YIJ I;  1K61 A;  1YHQ I;  5BMZ A;  3BG3 A;  2A61 A;  3H9J A;  2OAZ A;  2L4M A;  4DGW B;  1LNW A;  1WH5 A;  2K7L A;  1LVK A;  2VPL A;  3SZG A;  4CCM A;  4AVZ A;  1GV5 A;  5D8L B;  2VE8 A;  5HDN A;  2XAU A;  1MND A;  4XRF A;  3GTP J;  4IVN A;  2NNN A;  2K27 A;  5BPD A;  3LMM A;  1HCR A;  4RA2 A;  1OMI A;  2HVS A;  4PFP A;  2P81 A;  3N4M A;  3QOE A;  5DS9 A;  1TWG J;  1HKT A;  3BR1 A;  4FE4 A;  3FXM A;  2PG4 A;  3SEZ A;  3R4K A;  5FKM A;  1OIS A;  4CYC B;  3DEW A;  3OYI A;  1MMN A;  4QWQ A;  4B43 A;  2E7X A;  4UHT A;  1P7J A;  1T98 A;  3BPX A;  3CLO A;  3R0J A;  2ZJP F;  1A35 A;  4QPQ A;  3RIR A;  5LHI A;  1DUX C;  1S3J A;  3K4C A;  3ULQ B;  4M71 A;  4XLC A;  2OF7 A;  1T2K A;  2LG4 A;  2K4J A;  3ABM H;  3I4M J;  5M5W J;  1D1A A;  3OYN A;  4AYB A;  2ZO4 A;  5FD5 A;  3V7C A;  4A2U A;  4HNU A;  3FKI J;  2V79 A;  4A0Y A;  3W2V A;  2D2W A;  2ECB A;  5D8K B;  2M0C A;  3A02 A;  4P9F A;  2CUJ A;  4Q4Z F;  1H89 C;  3BZC A;  3IC7 A;  3GTG J;  2RQQ A;  1XTA A;  3PNV A;  5K7F A;  1TWF J;  1V5E A;  2PLY A;  2CMP A;  4BQA A;  1O3R A;  5LGN A;  3R6S A;  4E7S A;  3EYI A;  1ORK A;  3KEO A;  3CC7 I;  5CKT A;  3RKQ A;  1MD0 A; 
#chains in the Genus database with same CATH homology
 3OIO A;  4A3B J;  3BTJ A;  2CUF A;  4V2F A;  2DA2 A;  1ETO A;  4X1E A;  2GLO A;  4IHW A;  3BTI A;  1UMQ A;  3IH2 A;  3MVP A;  1VND A;  1PUF B;  1WPK A;  3LSG A;  3MKL A;  1TWC J;  5M5X J;  4JX6 A;  2R92 J;  2R7Z J;  4JX4 A;  1ETK A;  3G1O A;  3BTC A;  1JJ6 C;  1IGN A;  1QPI A;  3I4N J;  2E1O A;  5IP7 J;  3F0C A;  1JKR C;  2DMN A;  2HOA A;  3TP3 A;  3GTK J;  4A93 J;  4B4C A;  5E3N A;  4MLO A;  3S1R J;  1VI0 A;  2NVY J;  3JRC A;  4BY7 J;  1AHD P;  2YS9 A;  1AKH B;  3S17 J;  3BR3 A;  3B6C A;  4BBR J;  5F0C A;  3HOY J;  1FIA A;  2R5Z A;  5EG0 B;  2JA6 J;  1E3O C;  3GTM J;  2FJ1 A;  2XGE A;  2HOT A;  2JA8 J;  1GVD A;  1BW6 A;  5JLX A;  1TWH J;  2WV1 A;  4M6V A;  1W0U A;  4LOC A;  3TW7 A;  1IC8 A;  2PMZ N;  5FLM J;  2JMW A;  1ZR4 A;  1JJ8 C;  3JRF A;  2Y0S N;  2XRL A;  2DA6 A;  1JUP A;  1D5Y A;  2EH3 A;  3BR0 A;  5M5Y J;  1ZTR A;  2K9S A;  1MBK A;  1T56 A;  5EZH A;  5FKL A;  1Z77 A;  1RPW A;  3JRG A;  1ZQ3 P;  2E2H J;  2AO9 A;  3GTQ J;  1ETY A;  4MO7 A;  2NVX J;  2Y9Z A;  2JA5 J;  2FD5 A;  3C2B A;  4C2M J;  1MNM C;  1IRZ A;  2EQR A;  5FJ8 J;  3JRB A;  1JUM A;  3BQZ A;  3OSF A;  2MG4 A;  2ME6 A;  3DCF A;  1ZKG A;  3H0G J;  1UG2 A;  2LTP A;  2HI3 A;  2WAQ N;  3B6A A;  5K7Z A;  1WCM J;  1K83 J;  4UUS B;  3M4O J;  3RQI A;  1U8B A;  3H3V K;  2X48 A;  2DA4 A;  3JR9 A;  2M8G X;  2DTZ A;  5JLW A;  1NK3 P;  1W0T A;  3GTO J;  4I76 A;  2M34 A;  4D7N A;  1DU0 A;  4BXX J;  5FLV A;  3HDD A;  1RKT A;  5F27 A;  1LE8 B;  4XID A;  3Q0U A;  3SJM A;  2HXO A;  2LK2 A;  4QIW N;  1R9T J;  2D5V A;  3S14 J;  4FCY A;  4BBS J;  4W97 A;  5J1Y A;  2IEK A;  3FK7 A;  3HOU J;  4S0H B;  4M3B A;  5DTD A;  2E2I J;  3K2A A;  4MIM A;  4AYB N;  2Y9Y A;  3K7A J;  4A3E J;  2ID3 A;  3S16 J;  2MGQ A;  3ZQC A;  4DYR A;  1X2M A;  3G1L A;  5EEA A;  4A69 C;  4IHX A;  3M3Y J;  3FIW A;  4XRS G;  2HYJ A;  1RR7 A;  1TWA J;  2COB A;  1Z0X A;  1ETV A;  2B63 J;  2NVT J;  1CQT A;  2RAE A;  4DYC A;  1ETQ A;  5FKN A;  1ITY A;  4L5E A;  4C3I J;  3BR6 A;  1GDT A;  1BW5 A;  1ZR2 A;  1IV6 A;  3NAU A;  3Q3S A;  4D7M A;  4MFE A;  1ETW A;  2E2J J;  3IH4 A;  2IAI A;  3BT9 A;  5E3M A;  4XIC A;  3BQY A;  1AU7 A;  5F0F A;  1ZK8 A;  3W6V A;  4A3L J;  1OFC X;  3HEF A;  3VPR A;  2TRT A;  3FK6 A;  2DN0 A;  3S1Q J;  1JKO C;  4A3I J;  3TED A;  2CU7 A;  3HOW J;  3ZQG A;  4B3A A;  3JRI A;  4EEF G;  2EZL A;  4D5F A;  2QF7 A;  2CQQ A;  1QVT A;  1U9N A;  5E3O A;  1MBJ A;  4FIS A;  2W48 A;  2MSY A;  2DA7 A;  3QPS A;  4XRS A;  1FEX A;  4M3D A;  5BNG A;  3PO3 J;  1XC5 A;  4I6Z A;  1JT6 A;  4M3E A;  4D5C A;  4C3H J;  1BJZ A;  4A3M J;  2NS7 A;  2L9R A;  2ECC A;  1MBF A;  3HBL A;  2XGD A;  4DYQ A;  2DA1 A;  4A3K J;  2R0Q C;  1OJL A;  2DMT A;  1JTY A;  1HOM A;  1RES A;  1JGG A;  4W1U A;  1POG A;  1MH4 A;  1BL0 A;  1MSE C;  2XSD C;  2I10 A;  4MFD A;  2JJ7 A;  3PM1 A;  1A5J A;  2ELK A;  5C3E J;  4UUS A;  2GBY A;  1APL C;  2O8K A;  3ZQI A;  2OPT A;  4ABZ A;  1QRY A;  3MN2 A;  2EZK A;  2ZB9 A;  2CUE A;  3JRE A;  1RKW A;  1LFU P;  1LE8 A;  1QVU A;  2G0E A;  1F43 A;  3OSG A;  3UKG A;  4JYK A;  3LSJ A;  2LD5 A;  3OOU A;  1Y1W J;  3Q0W A;  1T33 A;  3ZQF A;  4NDL A;  1HF0 A;  1I6H J;  3QPL A;  1A6I A;  5IYC J;  3HM5 A;  2EBI A;  1H8A C;  3Q0V A;  1S7E A;  1MH3 A;  4RBO A;  1ZGW A;  2HDD A;  4BKX A;  1UHS A;  2H8R A;  1WH7 A;  3RZO J;  4M3F A;  4HNV A;  2R5Z B;  5FKK A;  5IOY A;  1VFC A;  1IJW C;  4J19 A;  5GPA A;  1IG7 A;  4QSH A;  5EZG A;  1IDY A;  3ZQH A;  5K7H A;  5IP9 J;  3S15 J;  2K40 A;  4XK4 A;  2E19 A;  1JTX A;  1O4X A;  1FTZ A;  2DMQ A;  2O9L A;  2LKX A;  4V2G A;  1OCT C;  3IH3 A;  2VKV A;  4AC0 A;  2JN6 A;  2L7M P;  2LY9 A;  2DJN A;  4QTR A;  2JK3 A;  9ANT A;  3HB9 A;  1ETX A;  1RET A;  2ME0 A;  2XB5 A;  5M3F J;  4X6A J;  1F36 A;  2L0K A;  4C3J J;  4IHY A;  1H88 C;  4IEJ A;  1U9O A;  1WI3 A;  1BA5 A;  5J1R A;  1XS9 A;  2H1K A;  3O8G A;  2L7Z A;  5EYR A;  3GTJ J;  1JUS A;  5F0H A;  5GP9 A;  5FKO A;  3LSP A;  4CYC A;  4B1R A;  3JRA A;  3LOC A;  3JRH A;  3CMY A;  2R5Y A;  3HGY A;  5EF6 A;  3NAR A;  1IUF A;  1IDZ A;  2EZH A;  1WGX A;  5M3M J;  2YU9 J;  2JA7 J;  2NS8 A;  5IYD J;  3CCY A;  2CQX A;  3G1M A;  3TW6 A;  3SDG A;  1MBE A;  3SFI A;  3ZQL A;  2EZI A;  2LR8 A;  5C4J J;  3IV5 A;  3RZD J;  4DZP A;  5C44 J;  2M2E A;  5EGO A;  2K9N A;  3LNQ A;  4BY1 J;  3O8H A;  2VPR A;  2DA3 A;  5F1J A;  1FJL A;  1OCP A;  1U78 A;  3HOV J;  5EG0 A;  2L7F P;  1MBG A;  1I3Q J;  4RDU A;  1DU6 A;  1AKH A;  2CRG A;  4FE7 A;  2O7O A;  2YUS A;  1MBH A;  3HOX J;  3BR5 A;  2CJJ A;  1SAN A;  5EDN A;  1HDD C;  2WB1 N;  1P7I A;  3CDL A;  3BR2 A;  4IHV A;  5E3L A;  3S1M J;  2GM4 A;  4A3F J;  1XG1 A;  2LLK A;  3E7L A;  1X58 A;  4UUT A;  1PUF A;  4FTH A;  3HOZ J;  1YRN A;  5IP6 A;  2Y2Z A;  2FQ4 A;  1LFB A;  1Y1V J;  3GTL J;  1X2N A;  4M3G A;  2K9Q A;  2IBD A;  3FIS A;  2DA5 A;  3HKZ N;  2LFB A;  1JKP C;  2X9D A;  3BG5 A;  2HOS A;  4A3D J;  2XPW A;  3L1P A;  4DZJ A;  5GPC A;  4G12 A;  3JRD A;  2TCT A;  4A3G J;  2VI6 A;  1SFO J;  3S1N J;  5IYB J;  3A01 B;  2KT0 A;  1B8I A;  2JWT A;  1HLV A;  1K61 A;  3BG3 A;  2LP0 A;  2DMP A;  1WH5 A;  1JT0 A;  1GV5 A;  1MSF C;  3S2H J;  5J1U A;  1NK2 P;  2XPV A;  3PO2 J;  3GTP J;  1HCR A;  2QCO A;  2VKE A;  4GFB A;  1FTT A;  2MW8 A;  3D1N I;  2Y30 A;  4AUX A;  2P81 A;  5J3L A;  4DW6 A;  5DS9 A;  1B8I B;  1TWG J;  3A01 A;  2VUM J;  1B72 A;  4A3J J;  5F08 A;  3BR1 A;  4FE4 A;  4JP0 A;  5IPA A;  3S2D J;  5FKM A;  3A03 A;  2KDZ A;  2R93 J;  4CYC B;  3DEW A;  3HGG A;  4Y52 J;  1P7J A;  1GT0 C;  2LVS A;  1EF4 A;  1JKQ C;  1GV2 A;  3CQZ J;  2Y31 A;  4XRM A;  1B72 B;  2OF7 A;  1YRN B;  1FIP A;  2N8G A;  3I4M J;  5M5W J;  1I50 J;  2XGC A;  3ZOB A;  5IOZ A;  2HXI A;  5HOD A;  3BG9 A;  5EGO B;  2ID6 A;  2NOG A;  4JX5 A;  1TC3 C;  4A3C J;  2M9H A;  3FKI J;  1HDP A;  2X6O A;  3TP0 A;  1VF9 A;  3LSR A;  2HQ5 A;  2ECB A;  3QQA A;  2M0C A;  3A02 A;  1G2H A;  5C4X J;  1GUU A;  2DMU A;  2AHQ A;  1H89 C;  3GTG J;  2R5Y B;  3WHB A;  2XPU A;  1ENH A;  5K7F A;  1TWF J;  1NTC A;  2FX0 A;  3BTL A;  1Q1V A;  2XB0 X;  3WHC A;  5F04 A;  2NVQ J;  4Y7N J;  1ORK A;  3RKQ A;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...