4QIWN

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLLSHVELIDQVMVYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 63
sequence length 63
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4qiwN00
4MFDA 1TWHJ 2Y9ZA 4BBRJ 5F08A 5EEAA 4MLOA 4J19A 2MGQA 1HDPA 4M3BA 2ID6A 2EQRA 3OSGA 2WAQN 3B6AA 3BR3A 2LLKA 2R5ZA 2DMNA 4DYRA 3WHBA 1JKOC 1H88C 5EGOA 1IJWC 2JWTA 2HXOA 4UUSB 4X1EA 2G0EA 3Q0WA 2AHQA 2ECCA 2R93J 5FKKA 5M3FJ 2M2EA 2H1KA 2JK3A 3HM5A 4A3BJ 3HB9A 1GVDA 5IYCJ 2QCOA 2CJJA 2DA7A 2M0CA 3JRDA 4A3JJ 2GBYA 4C3JJ 2HXIA 4AC0A 2R7ZJ 1JTXA 4BKXA 3FIWA 3ZQIA 3FK6A 1U78A 2GLOA 4A3LJ 2LY9A 1U9OA 3HGYA 5JLXA 5FKMA 2Y0SN 4XRSA 4AUXA 3JREA 2LFBA 2R5YB 5F0HA 3ZQLA 1B8IA 3JRIA 3HOXJ 2NVXJ 4UUTA 1JJ6C 1I6HJ 1RKWA 4IHYA 5M5XJ 1TWFJ 1MH4A 2Y31A 3CCYA 1LE8A 3H3VK 1F36A 5M5YJ 3VPRA 2JA8J 2MG4A 5JLWA 2E19A 3A01B 1ORKA 3DCFA 3TEDA 3RZDJ 3I4NJ 3S2HJ 1IGNA 3BQYA 1T33A 1X2MA 5EYRA 2OF7A 2O9LA 1BL0A 1XC5A 2M9HA 1JT0A 1IV6A 1JUPA 1QVTA 3W6VA 4FE4A 4A3KJ 4XIDA 4A3CJ 1UMQA 1X2NA 4DZPA 1BW5A 3A01A 1P7JA 3ZQHA 2HYJA 5GPAA 2K9SA 1POGA 2EZLA 3HOWJ 1I3QJ 1AKHB 2ME6A 1JUMA 2DMPA 3QPLA 4A3IJ 2HOSA 3M4OJ 2XRLA 4A69C 2XGCA 4I6ZA 2COBA 3G1LA 1IG7A 5HODA 3G1MA 2ID3A 4C3IJ 3K2AA 2DA6A 2MSYA 3HOVJ 1IRZA 1B72B 2CQQA 1XG1A 3MKLA 4BXXJ 4CYCB 1WI3A 3GTMJ 2LTPA 3BG3A 1ITYA 1ZR2A 3S14J 5F0CA 4JX6A 1Z0XA 2DJNA 2WV1A 3NAUA 4V2GA 5DTDA 2DMQA 1ZR4A 1O4XA 2W48A 4XK4A 2VUMJ 3CDLA 5M3MJ 2JA7J 1HCRA 5F0FA 3GTJJ 4S0HB 1DU6A 3JRBA 1WGXA 3WHCA 2R5ZB 4BBSJ 3SJMA 2CUFA 3SDGA 3HDDA 1TWGJ 3JRFA 5FLVA 3JRCA 4DYCA 5EGOB 1GDTA 4NDLA 3FKIJ 3SFIA 5F04A 2XGDA 2VI6A 2HDDA 1ZQ3P 3LOCA 1SFOJ 3I4MJ 1MSFC 1JT6A 2HOTA 1APLC 2YS9A 5C44J 2DTZA 2NVTJ 1ZTRA 3JRGA 4B4CA 1JKPC 4JX4A 3BR6A 1ETXA 4Y7NJ 2O7OA 1WH5A 4XRMA 3LSRA 5K7HA 3GTGJ 2R0QC 3ZQGA 4L5EA 1I50J 4B3AA 4RBOA 3BTCA 1BA5A 1B8IB 3JRAA 3OOUA 5IP6A 2JMWA 3OIOA 2B63J 2IEKA 1HF0A 2DN0A 2P81A 1LE8B 1A6IA 2JJ7A 3NARA 5EF6A 2DMUA 2NVYJ 3PM1A 3S17J 3GTPJ 1VNDA 1IUFA 2CU7A 1GV5A 5E3LA 3LNQA 1QRYA 1R9TJ 4V2FA 1FIPA 4JX5A 2O8KA 4D5CA 3PO3J 2M34A 2ZB9A 5EZHA 2KT0A 2DA2A 1OCTC 4XRSG 3JRHA 3TP0A 3D1NI 1NK3P 3E7LA 3QQAA 1W0TA 2EBIA 5EG0A 3GTKJ 4C2MJ 1RETA 2XSDC 1P7IA 3S16J 4BY7J 2LKXA 1NK2P 1H8AC 1K61A 1MBHA 5IOZA 5BNGA 2MW8A 3S1RJ 2H8RA 1GT0C 3BQZA 4I76A 4DZJA 5F1JA 3S15J 2Y2ZA 3A02A 4M3FA 1XS9A 4A3GJ 3L1PA 1PUFA 2E2JJ 2YUSA 4A3EJ 4M3DA 3O8GA 3FK7A 2L7FP 1OFCX 4B1RA 4D5FA 5E3NA 3H0GJ 5FJ8J 1YRNA 2NOGA 2Y9YA 3ZQFA 3LSPA 1WCMJ 3HOZJ 3G1OA 3HGGA 1TWCJ 1OJLA 2XPWA 3M3YJ 1ZKGA 2DMTA 2LP0A 1AHDP 2JA6J 2ELKA 1ETQA 3IV5A 5IYDJ 3IH4A 4RDUA 2CQXA 2VPRA 2KDZA 5J3LA 3MVPA 1MSEC 9ANTA 3CMYA 3Q0VA 2CUEA 1MBKA 4MIMA 4DW6A 1MNMC 4FCYA 1JKQC 3HKZN 3FISA 2NS8A 1ETOA 1U8BA 1FTTA 1MBJA 5IOYA 3GTQJ 5EZGA 2IBDA 4W1UA 2DA3A 3TW7A 3LSJA 4M3GA 4M3EA 5J1RA 4MO7A 3K7AJ 3JR9A 2FX0A 1Q1VA 3BTIA 4X6AJ 4MFEA 4EEFG 2L7ZA 1TC3C 1ETWA 3HEFA 3RQIA 1U9NA 1JTYA 4QIWN 3Q3SA 3GTOJ 3A03A 2QF7A 3LSGA 3ZQCA 1WPKA 2RAEA 3Q0UA 4A93J 1GV2A 2E1OA 3MN2A 1W0UA 1WH7A 4D7MA 4M6VA 1MH3A 5C4XJ 2HI3A 1TWAJ 2L9RA 1DU0A 1JUSA 5C3EJ 3O8HA 1IDYA 1Y1VJ 4IEJA 3BT9A 4LOCA 2TCTA 4QTRA 3B6CA 1MBFA 1UG2A 4FTHA 3F0CA 5FKOA 2FD5A 1QPIA 4HNVA 1RPWA 1CQTA 3RZOJ 2XB0X 1ETVA 4DYQA 2E2HJ 3UKGA 2M8GX 1LFBA 2AO9A 1H89C 1IC8A 1RESA 3TW6A 3BTJA 1OCPA 2EZKA 2OPTA 2VKEA 3BR5A 2EZHA 1G2HA 1IDZA 1RR7A 5EG0B 3HOUJ 5E3MA 1RKTA 2ME0A 4FISA 1LFUP 2TRTA 5F27A 1BW6A 2XGEA 4UUSA 2LD5A 2PMZN 2DA5A 4G12A 1AU7A 1T56A 4A3DJ 2K40A 1VF9A 5GPCA 3OSFA 4W97A 2X9DA 2L7MP 1Y1WJ 2R92J 1JJ8C 5IPAA 1PUFB 1EF4A 5DS9A 2LVSA 1HLVA 1VI0A 3BG9A 2X48A 2FQ4A 4A3FJ 1ETYA 5GP9A 3S2DJ 1NTCA 2K9NA 2LK2A 3BR2A 1S7EA 3BR1A 1YRNB 3GBGA 2CRGA 3BTLA 4Y52J 3PO2J 1X58A 2NVQJ 2R5YA 4ABZA 5IP7J 5FLMJ 2GM4A 1D5YA 2X6OA 1HDDC 3S1MJ 1HOMA 5K7FA 3QPSA 4QSHA 3S1NJ 3HBLA 5C4JJ 1JGGA 5K7ZA 1UHSA 1SANA 2IAIA 4IHXA 4A3MJ 1QVUA 5E3OA 5FKNA 1ZGWA 3DEWA 2E2IJ 2K9QA 2JA5J 2ECBA 4FE7A 3ZOBA 5FKLA 4AYBN 3BR0A 2VKVA 3RKQA 3CQZJ 4GFBA 1GUUA 2DA1A 4IHVA 4IHWA 2I10A 2XB5A 2L0KA 2N8GA 3HOYJ 1F43A 1K83J 3S1QJ 2JN6A 2FJ1A 1ZK8A 1MBEA 1FEXA 3TP3A 1Z77A 1JKRC 2NS7A 1FTZA 5J1YA 1VFCA 1E3OC 2XPUA 1A5JA 1MBGA 1ENHA 2Y30A 3IH3A 2LR8A 1AKHA 4JP0A 1ETKA 3C2BA 3IH2A 5IP9J 2HQ5A 5IYBJ 2DA4A 2D5VA 2EH3A 5EDNA 1FJLA 3GTLJ 4D7NA 5M5WJ 4JYKA 4XICA 1B72A 4BY1J 2WB1N 5J1UA 4C3HJ 2YU9J 3BG5A 4CYCA 2XPVA 1BJZA 1FIAA 2HOAA 2EZIA
chains in the Genus database with same CATH superfamily
2CG4A 4MFDA 3T8TA 3I0TA 2FMLA 4YFNF 2Z5UA 2QQBA 4ANJA 1SAXA 1WJDA 3ZMSA 4ZYGA 2YX7A 2KIQA 2PBIA 4NUBA 1FNNA 2VKHA 1IRFA 3W2WA 2R7OA 3OSGA 4XMYA 1STZA 1FYKA 2XKOA 3R60A 4LIUA 4KNYA 1USTA 2LLKA 1LEAA 2R5ZA 2EA4A 3WE3A 1BOBA 1ZG1A 3UR3C 3I59A 1H88C 5DDGA 1IJWC 3OV8A 4DNCA 3OYNA 1FP2A 3CZ6A 1LEBA 5FKKA 1IN5A 3KEYA 2M2EA 2H1KA 2G7UA 1OCRH 3CLOA 2QCOA 1N78A 1BR4A 3FXJA 4NC6A 1BIBA 4O6JA 5D6EA 1MGTA 4YFXF 2P6TA 4BKXA 1ZAOA 2DQRA 2CYYA 2O3FA 5ICEA 4HNTA 3HGYA 3P7NA 5JLXA 2Y0SN 4G6QA 4IPAA 2RNGA 4XRSA 2A5WA 5A2QK 3ESWB 5E1WA 4MEXF 1WWXA 2QYOA 3ASNH 2EV5A 3OYAA 2DT6A 1R4NB 3CMAI 3OS2A 5DM6F 2W57A 2NVUB 3HOXJ 2FBIA 3KCCA 1ERDA 4KUMA 2Q8KA 2IGMA 1FT9A 3MCZA 3OOPA 3E0JB 1JJ6C 2GXGA 1MMGA 1ZG5A 1I6HJ 2WWYA 3CMEI 2B7EA 1MH4A 3CCYA 3QU3A 2P5LC 3HZJA 2GZWA 4PZJA 1KQ0A 2MG4A 3S3NA 2DJIA 4Q5SF 3DCFA 1F5TA 4IRHA 3KEOA 4ESJA 1IN7A 3WGHA 2LREA 3BQYA 3PQJA 3LA7A 2IPQX 2OF7A 3PNYA 4N4OB 2O9LA 1IN6A 3U2RA 2YR2A 1IV6A 3C2HA 3R61A 2JTVA 1YJNI 3I3LA 4A3KJ 4HNUA 3LSKA 2GQQA 1LKXA 4M9ZA 4XR6A 1X2NA 1X19A 2VBZA 2W25A 4BQNA 2NRAC 1U8RA 2JRTA 3FMQA 2QKMB 1WJEA 4ESFA 3ZQHA 1ZRDA 3OYHA 1JUMA 4GGGA 3HSRA 5E8GA 2JVGA 3WTZA 2CW7A 4GYGA 3RPUD 4A6EA 4A69C 1C0WA 4I6ZA 3LQQA 3K70C 4C3IJ 2E34A 4M72A 4FQGA 1IRZA 3O3KA 3O6BB 2CQQA 4CCMA 1Z3XA 3FXUA 2RREA 2XASA 2JPBA 5HS8A 1ITYA 4LG0B 3KLNA 5F0CA 2Q2EA 4ZYAA 2UXXA 2NS0A 2BBYA 2WV1A 1ZR4A 1O4XA 3FDYA 2UUZA 4QPOA 4IOCF 3VFZA 4HEA2 2VUMJ 3M07A 1D1AA 2XAFA 3CDLA 4L9JA 1D5VA 4AWXB 1HCRA 2L7KA 4HX8A 1QO0D 4S0HB 3OS1A 3GTJJ 1DU6A 1P4AA 1WGXA 3AG3H 3WHCA 2KJCA 3HKZA 3CDIA 3ECHA 1FOWA 3RKXA 4ITVA 3I55I 1TWGJ 3HDDA 3JRFA 2DXIA 4DYCA 1W7PA 1Z21A 4NDLA 1I1GA 2K5CA 3H5AA 3E3VA 4LGWA 2E36A 5F04A 2HDDA 1HSJA 2VI6A 4U0VA 3S3OA 3I4MJ 1K7AA 1JT6A 2EIKH 2A6EF 3QYBA 1APLC 2HVRA 2M5WA 3J7YJ 2V1XA 2DTZA 2PMHA 1FSEA 3DTEA 2P8TA 3DLLF 3TDZC 3X2QH 4HQEA 1FSHA 4E7SA 1JKPC 4DJAA 2IA0A 4JX4A 3DTIA 3BR6A 1ETXA 1V5GA 4Y7NJ 4P9FA 3I56I 1WH5A 2XF5A 3EPZA 3O2PE 4R1HA 3ZQQA 1UFMA 4XLCA 4F93B 4LITA 2FNPA 3M8FA 4L5EA 5CLSA 3ZQGA 3E5QA 4RBOA 3WTTC 1BA5A 3EUAA 4CYDA 4RB3C 1B8IB 4AIHA 5DCMB 1FY7A 3KYLA 2L4AA 2ZO4A 3LFKA 2M1BA 1V5EA 2QGUA 2IEKA 4BJ6C 3CCMI 5FD5A 4IQ4A 5E8IA 2XVCA 3D5LA 3MEXA 1UZCA 2P81A 2JZYA 2NXNB 2ETHA 4BXUA 5CYVA 1X3WB 3C18A 4IX7A 4XOTA 1D0YA 3GTPJ 1YS7A 1GV5A 3BZ6A 1EA3A 5E3LA 5IT3A 3LNQA 4HX4A 1P92A 1XB4A 2KQRA 3ERMA 5J6XA 3CCRI 1M1EB 1FIPA 4AD9A 5D5XB 4P1WA 1EV7A 3FHNA 2M34A 2ZBKA 3K1MA 4EVIA 5KHDA 4PJ0C 4LD5A 2ACJA 1HW5A 3SYTA 3QQAA 5LEJA 1XPXA 3GCMA 1W0TA 2MD0A 5EG0A 1O3RA 5BPIA 4CZCA 3S16J 4BY7J 2LKXA 3HTSB 1K61A 1XTAA 3L2WA 2MW8A 1BBYA 3WGIA 3MZ8A 4B09A 4I76A 1ON2A 1T38A 2KZGA 1ZARA 1IW7F 2Y2ZA 3E97A 4FX0A 2VASA 3NRVA 4YEJA 2Y75A 3BPVA 2M4GA 1BM9A 1P2FA 2P4WA 1YX3A 1GHCA 5L3DA 1DPRA 3H0GJ 2HKOA 1K78A 2V26A 3G1OA 1Z7UA 2LYCA 2XPWA 2HPMA 4E6KG 4PJJA 1AHDP 2JA6J 3DKWA 5LGTA 3OYJA 3S3MA 1SAUA 3IV5A 5IYDJ 4RDUA 1X1DA 1TQPA 5HDGA 4C30A 2V9PA 3I71A 1OISA 9ANTA 5TISC 4ESBA 4E7JA 4G8XA 1AA7A 1PP8F 2CUEA 2BXYA 4I0AA 2VONA 4G94A 4DW6A 3AAFA 1XSDA 2H1LA 2CGPA 3T0YA 4KA4A 2XAGA 2K3PA 2IXSA 4MTDA 5B3SH 3GX4X 3DEUA 1R1TA 2IBDA 2YPRA 2LKPA 1XDSA 3HUGB 1YYVA 4AIJA 1YE9A 2EJRA 3W6KB 4P5OA 4EEFG 5HS9A 1TC3C 2F5EA 2PQ8A 1VQKI 4BHPA 1IAWA 3C2GA 2GWRA 5LEKA 4ZC3A 3ML6A 1JE8A 4ZTFA 2KIUA 3ONQA 4FT8A 2E1MB 2TDXA 1GLNA 1WPKA 5DV5A 3Q0UA 4BXFA 1W4MA 2M8EA 5H20A 4IRIA 4LMYA 3K9TA 4ENJA 2GIVA 3CUQC 4M6VA 1MH3A 2ZJPF 5FRMA 2HI3A 3RKYA 3F8BA 1TWAJ 1T8IA 3PFIA 4RAFA 1R23A 4NC7A 4IOAF 3EYYA 3B6CA 4QTRA 3FXQA 4ENKA 1MBFA 2OA4A 2OZ6A 2VE8A 3HHGA 3SHFA 1QPIA 2CQKA 2E2HJ 1ETVA 3PJRA 3K4LA 2EK5A 2DI3A 1LFBA 1H89C 4MTEA 3TW6A 3ZGKA 3KIOA 2EZKA 3BR5A 1G2HA 2Z2SB 4HV6A 4PCQA 1IDZA 3HPHA 4E7ZA 2TRTA 1KGSA 4UUSA 3IL2A 2X1DA 3QU6A 2EPFA 3BWGA 3OR1C 1SFKA 1R1VA 3HXLA 1X3ZB 3S2WA 1DP7P 1PUEE 4A3DJ 4HPQA 1O7LA 5GPCA 3DU5A 3QPHA 1KZHA 4W97A 2X9DA 2VB6A 3KP3A 2L7MP 2W4SA 3BG7A 4ZYEA 2W82A 5IPAA 1EF4A 5DS9A 4PUSA 3R6SA 2LVSA 3BG9A 5IY5H 1NG6A 4XLNF 4RGXA 1J59A 1QZEA 2RQPA 2ADUA 3H9JA 2K9NA 2OQRA 1S7EA 3GBGA 2LC2A 2BY3A 3GFMA 4YIIA 1IXRC 1HW1A 2CRGA 3BTLA 4HF2A 2H8WA 5LLQA 2P7CB 2R5YA 4RGRA 4CDGA 3F8FA 1PDNC 1YI2I 3Q9VA 4KJZA 3LSMA 2EFPA 1HOMA 5HLHA 4CCNA 4LIVA 4FASD 4BL0B 3HBLA 2V1DA 2RGVA 2GIZA 5K7ZA 2EFWA 2M7BA 4ZYHA 3B73A 1YO5C 1BI3A 5LGNA 5E3OA 2K02A 3KETA 2DU9A 2IS6A 1LPQA 3DBHB 3JW4A 3E6DA 2DT7B 1ZGWA 2V1NA 3DEWA 2E2IJ 2V1UA 3LWFA 2JA5J 3J80K 3VSLA 4AYBN 2OBPA 4CZZA 4YIRX 3RKQA 3TO7A 2GOXB 2A6TA 3CQZJ 4XONA 4RS8A 2DA1A 1ZYRF 2V9KA 3L2UA 2L0KA 3HOYJ 3F22A 5FROA 4PDKA 1K83J 1UAAA 3HRSA 3S1QJ 3HG9A 2M7AA 1ZK8A 3IAS2 3ZXSA 2K85A 3BP8A 1RNLA 2EILH 1G3YA 3FBIB 4DOZA 2CW8A 1FYLA 3SZTA 1JXSA 1MBGA 2Y30A 3SQNA 2LDUA 4XLAA 3UNGC 4JP0A 2CO5A 3C2BA 5GTIC 5IP9J 4M9XA 1ACIA 3ABKH 2D5VA 2EH3A 2KIMA 2E5NA 2IGNA 2QA4I 3Q9SA 2QENA 2LY1A 2OTLI 3CLQA 5D6FA 2V6EA 2WB1N 4C3HJ 5GADJ 2ISZA 4HA8A 1JI8A 2AS5F 1GXQA 1I3AA 1FIAA 1U0JA 3I59B 2X1CA 4NNJA 1W36C 1TWHJ 4U7BA 5F08A 5EEAA 3CF2A 4J19A 2L4MA 4M3BA 4DIQA 1UB9A 2VQGA 2KKOA 4RM2A 1IO2A 2W00A 3EUHC 4PK4A 3AL0B 2DMNA 1VQMI 1IXSB 4KMUX 1XD7A 3WHBA 3I54A 2DTRA 3KZZA 2A5YB 3OR2C 4YRVA 5EGOA 2X6WA 4ZDOA 2JWTA 4RMNA 2HXOA 4OINF 3U1DA 4OOIA 4X1EA 1OMIA 2AHQA 2HQRA 3G4SI 4BGDA 2PJRB 2VIXA 1GVDA 3EUKL 2ZMEB 2UWMA 2LMDA 4EGYA 1MMSA 3RYPA 3JRDA 4A3JJ 2HXIA 3WODF 3G73A 3FIWA 2IS1A 3FK6A 2ZCWA 2GLOA 3IWFA 4ASNA 2VOPA 1XSVA 3K4MA 3GVAA 1T95A 1HXDA 1NHAA 5F0HA 4UB8C 3TKYA 4FETA 5J4VA 2XAQA 5JHUA 2A61A 2WY8Q 3E6MA 4RGUA 2JSPA 3JRIA 3L09A 4IRGA 3REOA 3PNVA 1XCVA 2BOLA 3HRUA 2ZXHA 3S32A 3RIRA 2D1HA 5L3FA 2GA1A 2MYSA 2QBYB 2A69F 3ECOA 4G7ZF 2Y31A 1LE8A 1MDMA 4E4HA 2FBHA 2F5VA 4IF4A 5M5YJ 2JA8J 3J81Z 3VWBA 2MH9A 3MFKA 4L9TA 4Z2YA 4R79A 1IGNA 3I5UA 1VQ7I 1UCRA 3DQVC 2M9HA 3RKWA 1JUPA 5DUKA 3ABMH 4RB0A 2NNNA 1U5TA 4XIDA 4S05A 2BEOA 3I64A 4DZPA 2BW3A 1WI9A 5FD6A 1W7PD 1RUNA 1P7JA 4N4NB 2HYJA 2QVOA 2STTA 2EZLA 3HOWJ 1Z67A 2DMPA 3CDHA 4UXNA 3K4NA 2HOSA 3JAMZ 4PJNA 3G1LA 1MNDA 3K2AA 1PP7U 4U7DA 3SZGA 1RUOA 4IKFA 3BJ6A 3KP6A 1B72B 1MMDA 5E1XA 2ZJ2A 2CV1A 4BXXJ 4CYCB 1ZG3A 1YS6A 3G3ZA 2EFOA 2LTPA 3P5JA 3S14J 1W7PB 5B1AH 1F1ZA 4BQOA 4UVBA 3JSOA 2CFXA 1Z0XA 4V2GA 5DTDA 3WTWC 3LAJA 1YJ9I 2DMQA 1ZGJA 1O3SA 1E2XA 5FRNA 1ZHFA 2X85A 2ISYA 1Z6TA 3AFHA 5M3MJ 2JA7J 5AIQA 3JRBA 2QWWA 2CUFA 3SDGA 3DV8A 4R8HA 3DLAA 3H9QA 4L5IA 1JHFA 3CCSI 5ILSA 2ESHA 4HYEA 4XLHA 4E7IA 3FKIJ 3R4KA 1CF7A 2Q0OA 3LOCA 1VQOI 2HOTA 2P7VB 1G59A 3CO7C 1LNWA 1E0EA 5C44J 4QWQA 4LB6B 2LF8A 4EQQA 2O6GE 4OU0A 1DDNA 1TT5B 1ZLJA 3M9AA 2BGCA 2P0WA 5J8CA 4M71A 2CW0F 5KNLA 2DOFA 2R0QC 1JGSA 1R4MB 2BHZA 4B3AA 4MQVA 5EEGA 4BS9A 1DQUA 4I2OA 2OUMA 5IT9K 3OYCA 4B3XA 4II3A 1VQLI 3JRAA 3OOUA 4GDFA 4BJ5C 1VTNC 4E70A 2B63J 2R7TA 3F72A 4HF1A 1QBJA 2CH0A 3CF5F 3D5SC 1MD0A 4ZJZA 2JJ7A 1OLTA 4WXDA 4TV7A 3F23A 3TL4X 1VNDA 3DF8A 3LA2A 2DCEA 2Q1ZB 2H27A 2BY2A 2XROA 2Z1DA 1R9TJ 3VDXA 4JX5A 1EH8A 3OYLA 5BPDA 2V4JC 2Y0SA 2Y48A 2ZB9A 1OCTC 1D1CA 2DT5A 2F4OB 4PFOA 3CUQA 4XRSG 3JRHA 3KP4A 2E71A 3OS0A 2RKHA 3GTKJ 3N97A 4U87A 4C2MJ 1Z7LA 2OCEA 1SFEA 1RETA 2XSDC 1P7IA 1YIOA 3GLLA 1MBHA 3B02A 3L9FA 5IOZA 5BQTA 1TZLA 3COAC 2DQLA 3OIPA 3LAPA 2L2OA 1GT0C 3BQZA 5F1JA 2KISA 1VQ4I 4RAYA 1FBSA 1WJCA 2HR3A 2QUFA 4M3FA 1XS9A 3L1PA 1P9QC 3BLYA 3DEEA 2YUSA 3CTAA 2Z16A 2DAOA 2E2JJ 2L7FP 2F48A 3EETA 4F3QA 3WTSC 5LGUA 4BQQA 3PIOF 1WCMJ 3HOZJ 2M4KA 2OTJI 2DMTA 5K1YA 2LP0A 5FFZA 2A3SA 4A0ZA 4XNFA 3Q5FA 2CFOA 3MQ0A 4D9JA 2R7SA 2DFIA 2LBFA 3KP5A 4I02A 1XMAA 2HTJA 2WTEA 3IH4A 4MQ9F 3JTGA 2GOMA 2XHKA 4XKBA 5J3LA 3MVPA 2P5VA 4B43A 3D5RC 3CMYA 2IVMA 1BC8C 3MWMA 3QAHA 3G2BA 1V54H 4MIMA 4HBLA 1MNMC 1ZGAA 4FCYA 3GMEA 3HKZN 1PYVA 4ENNA 2DFHA 2V9VA 5D4SA 1U8BA 2OQGA 3CC7I 5BMZA 4J00A 3WGGA 5A2QZ 5K5RA 4AU7A 5ERIA 2E60A 4MHGA 4XM3A 2E1MC 1TLHB 2DA3A 1D1BA 3TW7A 1K79A 1S29A 3FMSA 3K7AJ 1G4DA 2FX0A 1Q1VA 1I39A 2O03A 3QODA 1OR7C 2L7ZA 2BYVE 1U9NA 4BEHA 1UELB 1D3YA 1T08B 3H5NA 3MKYB 1BN5A 3H36A 4GRIA 4NHJA 5HNHA 2QF7A 3GXOA 4A2UA 3ZQCA 3DPLC 5H6RA 2RDPA 5BS6A 4A93J 4PGGA 2HDWA 1UHMA 4NQWA 2CQ7A 2E1OA 2WAQA 1UHWA 1SFXA 4U0WA 5JI6A 2FSWA 5DD8A 5EJCA 1DU0A 4G6TB 3OYIA 1JUSA 5D5UB 1TNSA 1R5HA 3OYEA 1RZ4A 4LOCA 2TCTA 1UG2A 3DPUA 3SFZA 3FXMA 3RZOJ 3PFYA 2XAHA 1LVKA 4BUPA 2AQFA 2A6HF 2WY7Q 2L54A 1RESA 1Z1DA 3CP8A 2EWNA 3BTJA 3CCLI 1OCPA 3CJQB 2VKEA 3IKTA 1RR7A 3F6OA 4LB5A 3HOUJ 4UB6C 2GXBA 1RKTA 3A0BC 4OIPF 3TMOA 2IGKA 3ZMDA 1SD5A 4M6XA 1ZREA 2XGEA 1IRGA 3GZ6A 3JCUC 4XN0A 2LD5A 1RI7A 1DPUA 1FBUA 4A6DA 2PMZN 4G12A 1TP4A 2E7WA 2DFEA 1G3SA 5B66C 2K40A 4CCKA 2YSRA 2J5PA 1Y1WJ 4IJAA 1JJ8C 1J7KA 4A5NA 3ELKA 1PUFB 1XMKA 3N05A 2CS3A 2VBXA 1VI0A 3PNTA 2Z3YA 2HPIA 1YRNB 2LK2A 3RSNA 5HDKA 3K1NA 3KX2A 4I01A 5H2FC 2HZDA 3IHUA 4XL9A 3PO2J 3SEQA 2HVQA 2NVQJ 2BVLA 4ABZA 3E6CC 4J01A 1D5YA 2X6OA 1HDDC 2GM4A 3S1MJ 2DK8A 4EJTA 4KYWA 2W85A 1TQMA 1P4XA 4Y33A 5KAFC 2X0LA 3F3XA 1UHSA 1SANA 2XF7A 4IHXA 4JQFA 2MLKA 3ISPA 3LSHA 4N0BA 1F4KA 3KZIC 5L3EA 1KU2A 2EV6A 3P9CA 2AQEA 2VJJA 1W5SA 3VOEA 2IJLA 4FE7A 5FKLA 4A0YA 3BR0A 4BHBA 2VKVA 2VKDA 3KLOA 4ZTJA 1O3TA 1QU3A 2B0LA 1BR2A 3LSTA 1MW7A 4IHVA 5TRDA 1JHHA 3M1CA 2P6SA 3PUFA 2N8GA 4KICA 3I4PA 4GO1A 5CQEA 4NC8A 4LLNA 1KQ9A 5K5OA 2VJ4A 3TP3A 1JKRC 3FZVA 3QPTA 1FTZA 2E7XA 2XPUA 3K69A 3IH3A 2LR8A 3ZMTA 3DFGA 1VQ9I 1EKEA 2HQ5A 2LF7A 1KA8A 3P9IA 3DKXA 2CSOA 2R7VA 5EDNA 4EGZA 3GTLJ 4HW0A 4D7NA 4JK1X 1HKSA 2HGCA 3T5XA 3K0LA 1FX7A 1XDUA 5HLIA 4XICA 3LSIA 3U9GA 2FF4A 2V7FA 4XSXF 3K4KA 3AL0C 3MKZA 5EEHA 4F55A 1YFHA 4LG0A 3JTHA 4E7HA 5LFAA 3BPXA 4B48A 3QOEA 1RC9A 4L0YB 2BY0A 1DGWY 2Y0MA 4MLOA 2MGQA 1HDPA 1A6QA 2ID6A 2EQRA 2FMYA 2XAUA 4Y15A 3B6AA 4KN4X 2ZMEC 4P96A 2HFHA 5J8FA 1YX5A 3WU1B 1WJBA 1OYIA 4XKCA 2ZC2A 2R7DA 3M7GA 2G0EA 2FOKA 3BOQA 3FXOA 3WTXC 2ECCA 4BE0A 2O8XA 2IS4A 4RM3A 4UHTA 5ILUA 1FYMA 4KITB 2IA2A 2HNHA 3K4BA 2JK3A 2XSJC 3HPGA 1J9IA 5IYCJ 4OAYA 3R0JA 4EJUA 2CJJA 3LQRA 5DYMA 1VZ0A 1O3QA 3QP6A 1H0MA 4HF0A 3E5XA 1WQ2A 4AC0A 5FLXK 1TNTA 2PMUA 4DQ2A 4ZYDA 3ZQIA 5D5WB 4HSRA 4A3LJ 5HLTA 4M74A 1U9OA 2PI0A 5J4YA 1HQCA 1Y56A 2RVCA 1Z05A 3KEQA 4AUXA 1SMTA 2JPCA 2LFBA 3JREA 5GTHC 4PJLA 4KIGA 5CVJA 3TO9A 4A12A 3ZQLA 1B8IA 2EFQA 3LFUA 4WK8F 2E35A 3CCJI 5CVIA 1RKWA 3T1BA 4IHYA 2MBFA 3CUOA 1P6RA 2QQAA 1F36A 2RNJA 2E19A 2CUJA 1ORKA 2ZSHB 3TEDA 4EM2A 5L3BA 3I4NJ 1FWZA 3IRQA 3QOPA 1N75A 1T33A 2HOEA 5EYRA 5GAGJ 3DBLB 2XC7A 1JT0A 4BDZA 4EV0A 1QVTA 1ZELA 3M8JA 2IP2A 3W6VA 2W24A 4F7ZA 3OYDA 1S5LC 2Z9OA 4A3CJ 1UMQA 6PAXA 2PEXA 3A01A 1BW5A 2LNBA 5JFRA 3KP2A 4E7KA 2R7UA 2OV7A 1FOYA 2XIGA 2LH9A 5GPAA 2K9SA 2G9WA 1I3QJ 1AKHB 2QZ8A 3V4GA 2BHYA 1CGPA 5LHIA 2QKLB 1YQAA 3M4OJ 2NYXA 2XGCA 3L2CA 3FM3A 2COBA 1IG7A 5HODA 2ID3A 3HRMA 2DA6A 1D8KA 3HOVJ 1KU9A 2OJED 1EJ9A 5HDNA 5DUIA 1X1AA 1SFUA 3C7JA 1WI3A 2C6YA 2MLGA 3ASOH 4XORA 3RTRA 4AYBA 1R00A 3ZP5A 1ZR2A 3RDIA 5J40A 2G7HA 4JX6A 3ABUA 4PSXA 3GZ5A 3NAUA 4WXCA 2UZKA 1MJ9A 2CQNA 4ZZLA 4XK4A 4RB2C 1E3HA 2F4MB 2OC6A 2JUCA 2R5ZB 5TJJA 4C2TA 1OQYA 1YW8A 1E17A 3JRCA 4XBFA 1GDTA 1PVEA 1YTYA 3ZRGA 4KDPA 1A04A 3SFIA 2VODA 2ZNZA 1SFOJ 4YG2F 4KT5C 2VBWA 2O5RA 2YX4A 4WCGA 2YS9A 1I6XA 2HYGD 1ZN2A 2F5FA 2GAUA 3M8EA 1UG0A 1AOYA 1A36A 4BHCA 4UV9A 4ZDLA 2RV8A 2XGXA 4IO9F 2NVTJ 2FNAA 1KQ8A 2PLYA 4B4CA 4I98B 3FWEA 3AKZA 2HDCA 1J09A 2IS2A 2LG4A 2EB7A 2O7OA 2CV0A 1KONA 3FBNB 3I58A 3OL3A 3HUGA 1I50J 5FB2A 2MD5A 2STWA 3VYTB 2BV6A 1RR8C 3WU2C 3VYRB 3OYGA 4BJTA 4RGSA 2JMWA 1G3TA 3DBRB 4HDUA 5J47A 1HF0A 4UUVA 3PL8A 3J80Z 2OD5A 1EH6A 2HU9A 1FOXA 4BH9A 2A05A 4L5JA 1OR7A 4ENMA 1QHGA 2CU7A 3V8KA 2KJBA 3GFLA 4B8XA 3TBIA 5JVTA 1DP3A 3DXJF 2WBMA 4N9HA 1W1WE 2JRMA 4EM1A 1ZLKA 1A35A 4OIOF 1L0OC 4D5CA 2V79A 3PO3J 1QGPA 4CHUA 2QQ8A 1QZZA 4BDYA 2O61A 1GVJA 2XKPA 5DM7F 2M45A 1SD7A 1Z3YA 5FO5A 3D1NI 1LDJA 3E7LA 2I8DA 5E17F 2EBIA 2VPLA 4OIQF 2VT3A 3OMYA 2ICWG 4XQFA 4E7LA 1T98A 3GFJA 4KIFA 3ZMZA 5LRSA 1NK2P 4BNCA 5BNGA 3KPHA 2K7LA 2A68F 4Z6YA 2H8RA 4HSTA 1OCOH 2HEOA 3K4CA 4BQAA 3IC7A 2D1VA 3A02A 5JVGF 3F8MA 1IXCA 2NAZA 2Q2EB 3KYDB 2LSOA 4M3DA 3O8GA 2H09A 3HYIA 1OFCX 1VQ5I 4B1RA 4D5FA 5GAHJ 5ILVA 4UY8I 1FC3A 3AG1H 2NOGA 3ZQFA 3OL4A 3P9KA 3LSPA 2ZJRF 1T0FC 3ZR8X 3HTUA 2F5CA 4IVNA 1KYZA 3M3YJ 5F6FA 3OYKA 3A0HC 1X1BA 1WVRA 5AONA 1HBXG 1G6NA 3OYBA 1NH3A 4O3MA 1YG2A 1IUYA 2CQXA 2VPRA 3ZMVA 2X1EA 1V4RA 3I53A 3FM5A 4GYIA 3V8JA 2XAJA 4HV5A 4WF2A 3ERED 1W5TA 2YU3A 3Q0VA 3DKYA 3QYEA 2L9SA 1JKQC 4Y4RA 3WE2A 2OZUA 1HKTA 4EJOA 3GO5A 1SEUA 1L3LA 1Z6RA 5CVVA 1WJ5A 4GCVA 4HQMA 3QRFF 3HOSA 1QQIA 5EZGA 1S7AA 4W1UA 2PX9A 1IN8A 3BROA 4HLYA 1YITI 1HKQA 3F9KA 4N9IA 3LSJA 1G3WA 4M3GA 2XDVA 4NQWB 1ODDA 2LOOA 4KMFA 3QYFA 1U3EM 2VN2A 4V19K 3TQNA 3EYIA 1S3JA 3Q3SA 3WG9A 2PG4A 5DD4A 2KRCA 1QHHD 2RAEA 5FFXA 1YW7A 3MN2A 3LMMA 1BOAA 1W0UA 1OCCH 4D7MA 4EM0B 4CO8A 2KFDA 3LL7A 4OMZA 1WZ2A 1QPMA 2L9RA 2CV2A 3O8HA 1IDYA 2K3FA 2K4JA 3IRRA 1XN7A 3L2RA 3BT9A 4XN3A 2MFZA 3ROUA 2NNYA 4M73A 3PSFA 1TQIA 3F0CA 3I9V2 4LLGF 3HL2A 3ZMUA 1CQTA 3H3ZA 2VXDA 2XB0X 4DYQA 5TGTA 3H5RA 3UKGA 4EMSA 2M8GX 2ZKZA 5JHFA 4UVCA 5E20A 4A5MA 2UV1A 2ZJQF 2QQ9A 3QP5A 2OPTA 4CCLA 3BC8A 2EZHA 4Q47A 2RN7A 4YELA 5EG0B 1QNTA 5E3MA 1RRJA 2ME0A 2WC2A 1P4WA 2MH2A 3CJNA 4HZFA 3MZHA 2VT2A 1MJBA 2DA5A 2KDOA 1YJWI 3IP4B 2PJRA 2DDAA 1VF9A 3KP7A 4Q4ZF 2ZMEA 1Y0UA 4QPQA 1KU7A 2DPDA 4IXAA 1HLVA 2EV0A 3FMRA 4AVZA 3PQKA 2KIFA 2FQ4A 2KRHA 1ETYA 3BZCA 4A3FJ 3R0AA 4RB1A 5GP9A 1Q1HA 1Y0NA 3M1EA 4JOMA 1HW2A 1K78B 2MA3A 5HOOA 3RQ4A 4Y52J 1SC7A 2L5QA 4Y13A 2IRFG 5F1RA 1LDDA 3AG2H 5IP7J 4QLCU 5FLMJ 1H9GA 3L2VA 4OIRF 3HHHA 5K7FA 1H9TA 1E3PA 3QPSA 1Y6IA 3S1NJ 1OPCA 4PSWA 5C4JJ 1RIOH 1B9NA 2IAIA 1HC8A 4ETSA 1D8JA 1QVUA 4LG3A 2QBYA 2W1OA 2BVMA 2VC1A 3VODA 4AM3A 5FKNA 3KFWX 1DUXC 2BY1A 2K9QA 3WU0A 3ZOBA 4ON0A 1B9MA 1VQ6I 4GFBA 1GUUA 5LHHA 3TDUC 2HVSA 2I10A 2K9MA 2R4GA 2XB5A 5D8KB 3AG4H 3HRTA 5CPRB 3BY6A 1FOKA 5IT9Z 4YFKF 3RPQA 4BE1A 3J7AO 2IA1A 3CESA 4PGHA 2K27A 1WRJA 1MBEA 1FEXA 4K2EA 4XKWA 3FXRA 2ELHA 4RLFA 1E3OC 3OWTA 2VE9A 1A5JA 2X4HA 2WAEA 4X0GA 2VQHA 3IH2A 3ZCOA 2DA4A 5L3CA 1K6OA 3V7CA 4Q48A 1YIJI 1FJLA 1LUJB 5E18F 4OAZA 2X6YA 3PUBA 4HOBA 3WTUC 5M5WJ 4JYKA 1B72A 4KISA 3A4CA 5J1UA 5CJ9A 3BG5A 4CYCA 4ZH4F 1BJZA 3D0SA 1ZRCA 2QSHX 1XGNA 2HOAA 1AWCA 2VC0A 4M9SA 4LJZF 2Y9ZA 1Y8QB 4BBRJ 5KK1A 2D2WA 5CKTA 4AVPA 5E79C 1BC7C 4G7OF 3IWZA 3BJOA 2JVHA 2I5UA 2Z33A 2WAQN 4F52A 3VYUB 1R5GA 3BR3A 1IZ1A 4RAGA 4DYRA 4MGRA 4AIDA 1JKOC 2OCCH 2GXAA 1HA8A 1LJ9A 2KMUA 3HSFA 3F21A 2VBYA 1X1CA 3GLXA 2ZSIB 4UUSB 2DFFA 2VL8A 3Q0WA 1Y39A 2R93J 4RLQA 2R7XA 2K9LA 2K86A 1ZRFA 5M3FJ 1I5ZA 2JQ7A 1R36A 3HM5A 4A3BJ 2HKXA 3HB9A 1R7JA 3K4JA 2K4BA 3K1PA 2GA2A 4G7HF 3HOTA 2FXAA 1XX5A 1S6LA 2DA7A 2E5ZA 3TOAA 4RA2A 4HDVA 2M0CA 2GBYA 2M30A 4C3JJ 2DDBA 3RJPA 2R7ZJ 1JTXA 2KRFA 2LKSA 3J7AY 1TL8A 1XGMA 2H6CA 2W7NA 1I27A 3MAJA 4CICA 1U78A 2L3DA 1G8XA 2LY9A 3OIQA 5FKMA 3S8PA 1J0RA 1XCBA 4HRIA 1TT0A 1U5TC 2M3AA 3RYRA 3EUHA 4D1QA 2R5YB 2RQQA 3V7RA 1WFXA 2H94A 3K6GA 3PIPF 4I7HA 2O0YA 5LD2C 2NVXJ 1N25A 1Z91A 4UUTA 3L7WA 2ZXWH 5M5XJ 3DWLE 2WADA 2MC3A 1TWFJ 1S7OA 2PMZA 4GXOA 4FX4A 5DEQA 2CWEA 5GAEJ 3H0DA 2B9SA 3H3VK 3VPRA 5JLWA 5CVRA 1WJAA 4O5VA 4DBQA 3A01B 3RZDJ 3JSPA 5FGMA 2DODA 4CUGA 2E1CA 4PJMA 4L0ZB 3S2HJ 1X2MA 4UVAA 5AIPA 2D45A 4H0EA 2FBKA 4WXHA 1W5CC 4I09A 3PSIA 1XC5A 4MNUA 4BAYA 1BL0A 1J5YA 1A31A 4XRFA 4JBAA 1MZBA 2FOWA 3OYMA 2L9VA 4FE4A 1B6AA 1OYWA 3CC4I 2WV0A 5LHGA 1LB2A 3VSKA 1LDKB 5BOXA 2DYRH 5DCFA 2VXZA 3H3UA 5KAIC 4LLLA 1POGA 2R3SA 2VOOA 1SVLA 2ME6A 3K70D 2LY2A 2QM3A 3QPLA 1GXPA 4A3IJ 4LK0F 2IGOA 2XRLA 4NBQA 3GFIA 1R22A 4D0PA 2F2EA 5CVUA 3G1MA 2MSYA 3FKJA 4S04A 3NWTA 1XG1A 3MKLA 2QLZA 1BI0A 3GTMJ 4FHTA 1TW3A 2VQCA 3BG3A 3GF2A 2XF6A 4EATA 4L18B 2VQLA 2DJNA 2DBBA 1OCZH 4DGWB 1LFPA 4P9UA 2W48A 1U6GA 1MMAA 2A07F 1FMVA 4XOPA 4G9YA 1BIAA 2DLLA 4B44A 3K10A 5F0FA 4IHTA 2HZTA 4BBSJ 1I1SA 1WJFA 4EJVA 3SJMA 4KFCA 2DOAA 3GYHX 5FLVA 5EGOB 3IAM2 1D0XA 2OAZA 3TO6A 2XGDA 3E5UA 5H6QA 2R7FA 1ZQ3P 3BZKA 3FXKA 1MSFC 5ICGA 3F8CA 3RPUA 3A1YA 2KL4A 3WG7H 3V8LA 4RAZA 1T0FA 2BXZA 1SMYF 2ZXJA 3CO6C 1S9HA 3L2QA 3FF5A 3L00A 1ZTRA 2AXTC 1J75A 2ZNYA 3JRGA 2HWVA 2JA2A 2L9NA 4XSZF 1NG7A 3BDDA 3HJEA 2FU4A 1X1PA 4XRMA 2FE3A 2UXNA 1Y8RB 5K7HA 3LSRA 3GTGJ 4ZDPA 1D0ZA 3GUDA 3SDBA 2M87A 1SD4A 2F6CA 3BTCA 2F4IA 1SD6A 1KYWA 1BJAA 4CH7A 5K5QA 2CUZA 3CCEI 1B59A 5IP6A 4UV8A 4LFUA 1V3FA 2DW4A 3OIOA 2PFBA 4HX7A 3SEZA 1S8NA 1ULYA 5HVQC 3IKVA 2DN0A 2EIJH 1LE8B 1A6IA 1MDMB 3NARA 3RCOA 5EF6A 5ED4A 3W3CA 2DMUA 2NVYJ 3PM1A 2KPMA 2XUBA 1O7FA 3DU6A 1TBXA 3S17J 1O57A 5DCMA 3NEUA 1IUFA 1IN4A 3J7ZI 2JUGA 1QRYA 1ON1A 3CCUI 2MC4A 2DOEA 2ELJA 4V2FA 3H92A 4IZZA 5JR3A 3GWZA 2KP6A 2O8KA 5E1ZB 3G71I 3EQLF 1U5TB 1X4OA 1ZH5A 1FLIA 5EZHA 1TTYA 1U2WA 2DA2A 2KT0A 2BW3B 2DO7A 2QSFX 3IUOA 4XLPF 1USSA 5ICFA 3TP0A 2ZFWA 3ZN0A 2DPUA 2E1NA 3E1SA 4OWRB 1NK3P 4BYYA 1R6RA 2HYFA 4KT6A 2EIMH 1VQ8I 4ZZDA 1XGSA 2VJIA 1H8AC 2AXLA 4CCOA 3WTVC 3FXLA 2VJ5A 3S1RJ 4DZJA 3W2AA 1N77A 1VQNI 1LVAA 4L9NA 3S15J 2M0MA 3W6JB 1FMWA 3MMYB 1FPQA 4HAMA 1XGOA 3T8RA 4A3GJ 3VEPA 1PUFA 4HG2A 4A3EJ 3ABTA 3SXYA 1IV8A 3ABLH 3FK7A 2VLAA 5E3NA 5FJ8J 3BG6A 1YRNA 2HQNA 2KLOA 2Y9YA 4AIKA 4HLXA 3HC7A 4OMYA 3HGGA 1TWCJ 1OJLA 4XLEA 1ZKGA 1IRXA 2ZFUA 5D5VB 5KCMA 2ELKA 2IW5A 3MZYA 2IT0A 5HLGA 1WSUA 1ETQA 4BACA 5HS7A 1Z9CA 2RC4A 1YLFA 3MKWB 4YIFA 2F5DA 3HSEA 1CF7B 4UNOA 5B5EC 1OKRA 2KDZA 3F8NA 3G6EI 1MSEC 2R7RA 2FQ3A 3FHZA 1MBKA 5FLXZ 1YHQI 1T39A 3GEZA 2NOJB 2XRNA 1R1UA 4WX9A 3FISA 2OU2A 3H1CA 1QA6A 2NS8A 1ETOA 1FTTA 1MBJA 5IOYA 3GTQJ 3K2ZA 3MD2A 3ULQB 3J81K 1VQPI 1T2KA 1XSXA 1PJRA 1SVOA 1J2XA 2EA2A 3CP2A 4M3EA 5J1RA 3KYCB 1DGRM 4MO7A 4I99C 3VB2A 3JR9A 3BTIA 4X6AJ 4MFEA 1R5ID 4G6DA 2KZVA 2WB1A 1K6YA 1ETWA 3HEFA 3RQIA 3OYFA 2HTSA 1JTYA 4QIWN 4U88A 3GTOJ 2X6XA 3A03A 3H35A 2XV4S 3S93A 2LRDA 3LSGA 4II2A 1F9NA 2EFNA 2DYSH 4CCJA 3WTYC 2WA0A 3FX3A 4F91B 2FEZA 1R71A 1GV2A 1WHUA 3DPTA 3SZPA 2HS5A 3C1DA 1WH7A 3U21A 3JAMK 1R58A 2MABA 1LQ1A 1HSTA 1X4PA 4XKVA 5C4XJ 1KU3A 5C3EJ 4XLFA 4IEJA 1Y1VJ 2QSGX 2R7WA 3U1KA 1YOVB 3ZQ7A 4NB5A 2V6CA 1B1BA 4FTHA 2WAFA 5FKOA 4CXFA 2FD5A 1V55H 4HNVA 1RPWA 3OY9A 1REPC 2QEXI 2W84A 1WKMA 2AO9A 1IC8A 4P55A 3CUQB 1BI2A 5LBQA 3GZNB 1YW9A 4I0BA 4C9YA 2PN6A 4B47A 5B1BH 4MEYF 4FISA 1LFUP 1OYYA 2DK5A 3CJTB 3F6VA 1S72I 5F27A 1BW6A 3NWSA 3VYSB 4DBRA 4LK1F 3RI4A 1MJAA 1X3UA 1MMNA 1FZPB 4IQJA 2Y69H 3KE2A 1AU7A 4BU2A 1R49A 1T56A 4CSWA 5F64A 1MNEA 1ONVA 1XMXA 3OSFA 4EJWA 2P5KA 2R92J 3QWLA 5LRRA 3CCQI 3DP7A 4A0XA 2X48A 4U0YA 4F92B 1B4AA 3S2DJ 1NTCA 3H9GA 3BR1A 3BR2A 2CMPA 2JSCA 2Z99A 4WWCA 1FP1D 1T6SA 3GW2A 5KVRA 2ESNA 3ZN1A 2JT1A 1BI1A 1X58A 5L3GA 3BJAA 2COMA 4IL6C 3BCBA 4C2UA 1IF1A 2LBFB 1UJ8A 2ZXIA 3CCVI 4QSHA 3W2VA 2R7QA 1TW2A 1JGGA 3BCAA 3CMMA 2J5OA 3N4MA 4A3MJ 1SVMA 3LA3A 3CC2I 3TGNA 3A2KA 2FA5A 2ECBA 2EINH 1K4TA 3DTKA 3TOBA 2FUG2 3E6BA 3EDPA 2FRHA 1MIJA 4L9VA 2BZTA 4CA0A 4IHWA 4KN7X 1F43A 4PFPA 2JN6A 2FJ1A 1BR1A 4CGZA 3V42A 4BE2A 4H4KC 1Z77A 4BEHB 2NS7A 1K4SA 5J1YA 2X51A 1V5FA 3NQOA 1VFCA 5D8LB 2L02A 4IHSA 5CQGA 1ENHA 1AKHA 3ZPLA 1ETKA 4Y3OA 2PJPA 2L01A 4KIBA 5IYBJ 1QZYA 5HNFA 3C3WA 3HIFA 2HQAA 2KHMA 1MKMA 3V7SA 5D4RA 1FBQA 5ICCA 4Y17A 2BE5F 4M6YA 3CD6I 4BY1J 1W36D 2YU9J 2XPVA 3KZYA 1EH7A 3CJRB 2EZIA 2H6BA
chains in the Genus database with same CATH topology
4MFDA 1TWHJ 2Y9ZA 4BBRJ 5F08A 5EEAA 4MLOA 4J19A 2MGQA 1HDPA 4M3BA 2ID6A 2EQRA 3OSGA 2WAQN 3B6AA 3BR3A 2LLKA 2R5ZA 2DMNA 4DYRA 3WHBA 1JKOC 1H88C 5EGOA 1IJWC 2JWTA 2HXOA 4UUSB 4X1EA 2G0EA 3Q0WA 2AHQA 2ECCA 2R93J 5FKKA 5M3FJ 2M2EA 2H1KA 2JK3A 3HM5A 4A3BJ 3HB9A 1GVDA 5IYCJ 2QCOA 2CJJA 2DA7A 2M0CA 3JRDA 4A3JJ 2GBYA 4C3JJ 2HXIA 4AC0A 2R7ZJ 1JTXA 4BKXA 3FIWA 3ZQIA 3FK6A 1U78A 2GLOA 4A3LJ 2LY9A 1U9OA 3HGYA 5JLXA 5FKMA 2Y0SN 4XRSA 4AUXA 3JREA 2LFBA 2R5YB 5F0HA 3ZQLA 1B8IA 3JRIA 3HOXJ 2NVXJ 4UUTA 1JJ6C 1I6HJ 1RKWA 4IHYA 5M5XJ 1TWFJ 1MH4A 2Y31A 3CCYA 1LE8A 3H3VK 1F36A 5M5YJ 3VPRA 2JA8J 2MG4A 5JLWA 2E19A 3A01B 1ORKA 3DCFA 3TEDA 3RZDJ 3I4NJ 3S2HJ 1IGNA 3BQYA 1T33A 1X2MA 5EYRA 2OF7A 2O9LA 1BL0A 1XC5A 2M9HA 1JT0A 1IV6A 1JUPA 1QVTA 3W6VA 4FE4A 4A3KJ 4XIDA 4A3CJ 1UMQA 1X2NA 4DZPA 1BW5A 3A01A 1P7JA 3ZQHA 2HYJA 5GPAA 2K9SA 1POGA 2EZLA 3HOWJ 1I3QJ 1AKHB 2ME6A 1JUMA 2DMPA 3QPLA 4A3IJ 2HOSA 3M4OJ 2XRLA 4A69C 2XGCA 4I6ZA 2COBA 3G1LA 1IG7A 5HODA 3G1MA 2ID3A 4C3IJ 3K2AA 2DA6A 2MSYA 3HOVJ 1IRZA 1B72B 2CQQA 1XG1A 3MKLA 4BXXJ 4CYCB 1WI3A 3GTMJ 2LTPA 3BG3A 1ITYA 1ZR2A 3S14J 5F0CA 4JX6A 1Z0XA 2DJNA 2WV1A 3NAUA 4V2GA 5DTDA 2DMQA 1ZR4A 1O4XA 2W48A 4XK4A 2VUMJ 3CDLA 5M3MJ 2JA7J 1HCRA 5F0FA 3GTJJ 4S0HB 1DU6A 3JRBA 1WGXA 3WHCA 2R5ZB 4BBSJ 3SJMA 2CUFA 3SDGA 3HDDA 1TWGJ 3JRFA 5FLVA 3JRCA 4DYCA 5EGOB 1GDTA 4NDLA 3FKIJ 3SFIA 5F04A 2XGDA 2VI6A 2HDDA 1ZQ3P 3LOCA 1SFOJ 3I4MJ 1MSFC 1JT6A 2HOTA 1APLC 2YS9A 5C44J 2DTZA 2NVTJ 1ZTRA 3JRGA 4B4CA 1JKPC 4JX4A 3BR6A 1ETXA 4Y7NJ 2O7OA 1WH5A 4XRMA 3LSRA 5K7HA 3GTGJ 2R0QC 3ZQGA 4L5EA 1I50J 4B3AA 4RBOA 3BTCA 1BA5A 1B8IB 3JRAA 3OOUA 5IP6A 2JMWA 3OIOA 2B63J 2IEKA 1HF0A 2DN0A 2P81A 1LE8B 1A6IA 2JJ7A 3NARA 5EF6A 2DMUA 2NVYJ 3PM1A 3S17J 3GTPJ 1VNDA 1IUFA 2CU7A 1GV5A 5E3LA 3LNQA 1QRYA 1R9TJ 4V2FA 1FIPA 4JX5A 2O8KA 4D5CA 3PO3J 2M34A 2ZB9A 5EZHA 2KT0A 2DA2A 1OCTC 4XRSG 3JRHA 3TP0A 3D1NI 1NK3P 3E7LA 3QQAA 1W0TA 2EBIA 5EG0A 3GTKJ 4C2MJ 1RETA 2XSDC 1P7IA 3S16J 4BY7J 2LKXA 1NK2P 1H8AC 1K61A 1MBHA 5IOZA 5BNGA 2MW8A 3S1RJ 2H8RA 1GT0C 3BQZA 4I76A 4DZJA 5F1JA 3S15J 2Y2ZA 3A02A 4M3FA 1XS9A 4A3GJ 3L1PA 1PUFA 2E2JJ 2YUSA 4A3EJ 4M3DA 3O8GA 3FK7A 2L7FP 1OFCX 4B1RA 4D5FA 5E3NA 3H0GJ 5FJ8J 1YRNA 2NOGA 2Y9YA 3ZQFA 3LSPA 1WCMJ 3HOZJ 3G1OA 3HGGA 1TWCJ 1OJLA 2XPWA 3M3YJ 1ZKGA 2DMTA 2LP0A 1AHDP 2JA6J 2ELKA 1ETQA 3IV5A 5IYDJ 3IH4A 4RDUA 2CQXA 2VPRA 2KDZA 5J3LA 3MVPA 1MSEC 9ANTA 3CMYA 3Q0VA 2CUEA 1MBKA 4MIMA 4DW6A 1MNMC 4FCYA 1JKQC 3HKZN 3FISA 2NS8A 1ETOA 1U8BA 1FTTA 1MBJA 5IOYA 3GTQJ 5EZGA 2IBDA 4W1UA 2DA3A 3TW7A 3LSJA 4M3GA 4M3EA 5J1RA 4MO7A 3K7AJ 3JR9A 2FX0A 1Q1VA 3BTIA 4X6AJ 4MFEA 4EEFG 2L7ZA 1TC3C 1ETWA 3HEFA 3RQIA 1U9NA 1JTYA 4QIWN 3Q3SA 3GTOJ 3A03A 2QF7A 3LSGA 3ZQCA 1WPKA 2RAEA 3Q0UA 4A93J 1GV2A 2E1OA 3MN2A 1W0UA 1WH7A 4D7MA 4M6VA 1MH3A 5C4XJ 2HI3A 1TWAJ 2L9RA 1DU0A 1JUSA 5C3EJ 3O8HA 1IDYA 1Y1VJ 4IEJA 3BT9A 4LOCA 2TCTA 4QTRA 3B6CA 1MBFA 1UG2A 4FTHA 3F0CA 5FKOA 2FD5A 1QPIA 4HNVA 1RPWA 1CQTA 3RZOJ 2XB0X 1ETVA 4DYQA 2E2HJ 3UKGA 2M8GX 1LFBA 2AO9A 1H89C 1IC8A 1RESA 3TW6A 3BTJA 1OCPA 2EZKA 2OPTA 2VKEA 3BR5A 2EZHA 1G2HA 1IDZA 1RR7A 5EG0B 3HOUJ 5E3MA 1RKTA 2ME0A 4FISA 1LFUP 2TRTA 5F27A 1BW6A 2XGEA 4UUSA 2LD5A 2PMZN 2DA5A 4G12A 1AU7A 1T56A 4A3DJ 2K40A 1VF9A 5GPCA 3OSFA 4W97A 2X9DA 2L7MP 1Y1WJ 2R92J 1JJ8C 5IPAA 1PUFB 1EF4A 5DS9A 2LVSA 1HLVA 1VI0A 3BG9A 2X48A 2FQ4A 4A3FJ 1ETYA 5GP9A 3S2DJ 1NTCA 2K9NA 2LK2A 3BR2A 1S7EA 3BR1A 1YRNB 3GBGA 2CRGA 3BTLA 4Y52J 3PO2J 1X58A 2NVQJ 2R5YA 4ABZA 5IP7J 5FLMJ 2GM4A 1D5YA 2X6OA 1HDDC 3S1MJ 1HOMA 5K7FA 3QPSA 4QSHA 3S1NJ 3HBLA 5C4JJ 1JGGA 5K7ZA 1UHSA 1SANA 2IAIA 4IHXA 4A3MJ 1QVUA 5E3OA 5FKNA 1ZGWA 3DEWA 2E2IJ 2K9QA 2JA5J 2ECBA 4FE7A 3ZOBA 5FKLA 4AYBN 3BR0A 2VKVA 3RKQA 3CQZJ 4GFBA 1GUUA 2DA1A 4IHVA 4IHWA 2I10A 2XB5A 2L0KA 2N8GA 3HOYJ 1F43A 1K83J 3S1QJ 2JN6A 2FJ1A 1ZK8A 1MBEA 1FEXA 3TP3A 1Z77A 1JKRC 2NS7A 1FTZA 5J1YA 1VFCA 1E3OC 2XPUA 1A5JA 1MBGA 1ENHA 2Y30A 3IH3A 2LR8A 1AKHA 4JP0A 1ETKA 3C2BA 3IH2A 5IP9J 2HQ5A 5IYBJ 2DA4A 2D5VA 2EH3A 5EDNA 1FJLA 3GTLJ 4D7NA 5M5WJ 4JYKA 4XICA 1B72A 4BY1J 2WB1N 5J1UA 4C3HJ 2YU9J 3BG5A 4CYCA 2XPVA 1BJZA 1FIAA 2HOAA 2EZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFD A;  1TWH J;  2Y9Z A;  4BBR J;  5F08 A;  5EEA A;  4MLO A;  4J19 A;  2MGQ A;  1HDP A;  4M3B A;  2ID6 A;  2EQR A;  3OSG A;  2WAQ N;  3B6A A;  3BR3 A;  2LLK A;  2R5Z A;  2DMN A;  4DYR A;  3WHB A;  1JKO C;  1H88 C;  5EGO A;  1IJW C;  2JWT A;  2HXO A;  4UUS B;  4X1E A;  2G0E A;  3Q0W A;  2AHQ A;  2ECC A;  2R93 J;  5FKK A;  5M3F J;  2M2E A;  2H1K A;  2JK3 A;  3HM5 A;  4A3B J;  3HB9 A;  1GVD A;  5IYC J;  2QCO A;  2CJJ A;  2DA7 A;  2M0C A;  3JRD A;  4A3J J;  2GBY A;  4C3J J;  2HXI A;  4AC0 A;  2R7Z J;  1JTX A;  4BKX A;  3FIW A;  3ZQI A;  3FK6 A;  1U78 A;  2GLO A;  4A3L J;  2LY9 A;  1U9O A;  3HGY A;  5JLX A;  5FKM A;  2Y0S N;  4XRS A;  4AUX A;  3JRE A;  2LFB A;  2R5Y B;  5F0H A;  3ZQL A;  1B8I A;  3JRI A;  3HOX J;  2NVX J;  4UUT A;  1JJ6 C;  1I6H J;  1RKW A;  4IHY A;  5M5X J;  1TWF J;  1MH4 A;  2Y31 A;  3CCY A;  1LE8 A;  3H3V K;  1F36 A;  5M5Y J;  3VPR A;  2JA8 J;  2MG4 A;  5JLW A;  2E19 A;  3A01 B;  1ORK A;  3DCF A;  3TED A;  3RZD J;  3I4N J;  3S2H J;  1IGN A;  3BQY A;  1T33 A;  1X2M A;  5EYR A;  2OF7 A;  2O9L A;  1BL0 A;  1XC5 A;  2M9H A;  1JT0 A;  1IV6 A;  1JUP A;  1QVT A;  3W6V A;  4FE4 A;  4A3K J;  4XID A;  4A3C J;  1UMQ A;  1X2N A;  4DZP A;  1BW5 A;  3A01 A;  1P7J A;  3ZQH A;  2HYJ A;  5GPA A;  2K9S A;  1POG A;  2EZL A;  3HOW J;  1I3Q J;  1AKH B;  2ME6 A;  1JUM A;  2DMP A;  3QPL A;  4A3I J;  2HOS A;  3M4O J;  2XRL A;  4A69 C;  2XGC A;  4I6Z A;  2COB A;  3G1L A;  1IG7 A;  5HOD A;  3G1M A;  2ID3 A;  4C3I J;  3K2A A;  2DA6 A;  2MSY A;  3HOV J;  1IRZ A;  1B72 B;  2CQQ A;  1XG1 A;  3MKL A;  4BXX J;  4CYC B;  1WI3 A;  3GTM J;  2LTP A;  3BG3 A;  1ITY A;  1ZR2 A;  3S14 J;  5F0C A;  4JX6 A;  1Z0X A;  2DJN A;  2WV1 A;  3NAU A;  4V2G A;  5DTD A;  2DMQ A;  1ZR4 A;  1O4X A;  2W48 A;  4XK4 A;  2VUM J;  3CDL A;  5M3M J;  2JA7 J;  1HCR A;  5F0F A;  3GTJ J;  4S0H B;  1DU6 A;  3JRB A;  1WGX A;  3WHC A;  2R5Z B;  4BBS J;  3SJM A;  2CUF A;  3SDG A;  3HDD A;  1TWG J;  3JRF A;  5FLV A;  3JRC A;  4DYC A;  5EGO B;  1GDT A;  4NDL A;  3FKI J;  3SFI A;  5F04 A;  2XGD A;  2VI6 A;  2HDD A;  1ZQ3 P;  3LOC A;  1SFO J;  3I4M J;  1MSF C;  1JT6 A;  2HOT A;  1APL C;  2YS9 A;  5C44 J;  2DTZ A;  2NVT J;  1ZTR A;  3JRG A;  4B4C A;  1JKP C;  4JX4 A;  3BR6 A;  1ETX A;  4Y7N J;  2O7O A;  1WH5 A;  4XRM A;  3LSR A;  5K7H A;  3GTG J;  2R0Q C;  3ZQG A;  4L5E A;  1I50 J;  4B3A A;  4RBO A;  3BTC A;  1BA5 A;  1B8I B;  3JRA A;  3OOU A;  5IP6 A;  2JMW A;  3OIO A;  2B63 J;  2IEK A;  1HF0 A;  2DN0 A;  2P81 A;  1LE8 B;  1A6I A;  2JJ7 A;  3NAR A;  5EF6 A;  2DMU A;  2NVY J;  3PM1 A;  3S17 J;  3GTP J;  1VND A;  1IUF A;  2CU7 A;  1GV5 A;  5E3L A;  3LNQ A;  1QRY A;  1R9T J;  4V2F A;  1FIP A;  4JX5 A;  2O8K A;  4D5C A;  3PO3 J;  2M34 A;  2ZB9 A;  5EZH A;  2KT0 A;  2DA2 A;  1OCT C;  4XRS G;  3JRH A;  3TP0 A;  3D1N I;  1NK3 P;  3E7L A;  3QQA A;  1W0T A;  2EBI A;  5EG0 A;  3GTK J;  4C2M J;  1RET A;  2XSD C;  1P7I A;  3S16 J;  4BY7 J;  2LKX A;  1NK2 P;  1H8A C;  1K61 A;  1MBH A;  5IOZ A;  5BNG A;  2MW8 A;  3S1R J;  2H8R A;  1GT0 C;  3BQZ A;  4I76 A;  4DZJ A;  5F1J A;  3S15 J;  2Y2Z A;  3A02 A;  4M3F A;  1XS9 A;  4A3G J;  3L1P A;  1PUF A;  2E2J J;  2YUS A;  4A3E J;  4M3D A;  3O8G A;  3FK7 A;  2L7F P;  1OFC X;  4B1R A;  4D5F A;  5E3N A;  3H0G J;  5FJ8 J;  1YRN A;  2NOG A;  2Y9Y A;  3ZQF A;  3LSP A;  1WCM J;  3HOZ J;  3G1O A;  3HGG A;  1TWC J;  1OJL A;  2XPW A;  3M3Y J;  1ZKG A;  2DMT A;  2LP0 A;  1AHD P;  2JA6 J;  2ELK A;  1ETQ A;  3IV5 A;  5IYD J;  3IH4 A;  4RDU A;  2CQX A;  2VPR A;  2KDZ A;  5J3L A;  3MVP A;  1MSE C;  9ANT A;  3CMY A;  3Q0V A;  2CUE A;  1MBK A;  4MIM A;  4DW6 A;  1MNM C;  4FCY A;  1JKQ C;  3HKZ N;  3FIS A;  2NS8 A;  1ETO A;  1U8B A;  1FTT A;  1MBJ A;  5IOY A;  3GTQ J;  5EZG A;  2IBD A;  4W1U A;  2DA3 A;  3TW7 A;  3LSJ A;  4M3G A;  4M3E A;  5J1R A;  4MO7 A;  3K7A J;  3JR9 A;  2FX0 A;  1Q1V A;  3BTI A;  4X6A J;  4MFE A;  4EEF G;  2L7Z A;  1TC3 C;  1ETW A;  3HEF A;  3RQI A;  1U9N A;  1JTY A;  4QIW N;  3Q3S A;  3GTO J;  3A03 A;  2QF7 A;  3LSG A;  3ZQC A;  1WPK A;  2RAE A;  3Q0U A;  4A93 J;  1GV2 A;  2E1O A;  3MN2 A;  1W0U A;  1WH7 A;  4D7M A;  4M6V A;  1MH3 A;  5C4X J;  2HI3 A;  1TWA J;  2L9R A;  1DU0 A;  1JUS A;  5C3E J;  3O8H A;  1IDY A;  1Y1V J;  4IEJ A;  3BT9 A;  4LOC A;  2TCT A;  4QTR A;  3B6C A;  1MBF A;  1UG2 A;  4FTH A;  3F0C A;  5FKO A;  2FD5 A;  1QPI A;  4HNV A;  1RPW A;  1CQT A;  3RZO J;  2XB0 X;  1ETV A;  4DYQ A;  2E2H J;  3UKG A;  2M8G X;  1LFB A;  2AO9 A;  1H89 C;  1IC8 A;  1RES A;  3TW6 A;  3BTJ A;  1OCP A;  2EZK A;  2OPT A;  2VKE A;  3BR5 A;  2EZH A;  1G2H A;  1IDZ A;  1RR7 A;  5EG0 B;  3HOU J;  5E3M A;  1RKT A;  2ME0 A;  4FIS A;  1LFU P;  2TRT A;  5F27 A;  1BW6 A;  2XGE A;  4UUS A;  2LD5 A;  2PMZ N;  2DA5 A;  4G12 A;  1AU7 A;  1T56 A;  4A3D J;  2K40 A;  1VF9 A;  5GPC A;  3OSF A;  4W97 A;  2X9D A;  2L7M P;  1Y1W J;  2R92 J;  1JJ8 C;  5IPA A;  1PUF B;  1EF4 A;  5DS9 A;  2LVS A;  1HLV A;  1VI0 A;  3BG9 A;  2X48 A;  2FQ4 A;  4A3F J;  1ETY A;  5GP9 A;  3S2D J;  1NTC A;  2K9N A;  2LK2 A;  3BR2 A;  1S7E A;  3BR1 A;  1YRN B;  3GBG A;  2CRG A;  3BTL A;  4Y52 J;  3PO2 J;  1X58 A;  2NVQ J;  2R5Y A;  4ABZ A;  5IP7 J;  5FLM J;  2GM4 A;  1D5Y A;  2X6O A;  1HDD C;  3S1M J;  1HOM A;  5K7F A;  3QPS A;  4QSH A;  3S1N J;  3HBL A;  5C4J J;  1JGG A;  5K7Z A;  1UHS A;  1SAN A;  2IAI A;  4IHX A;  4A3M J;  1QVU A;  5E3O A;  5FKN A;  1ZGW A;  3DEW A;  2E2I J;  2K9Q A;  2JA5 J;  2ECB A;  4FE7 A;  3ZOB A;  5FKL A;  4AYB N;  3BR0 A;  2VKV A;  3RKQ A;  3CQZ J;  4GFB A;  1GUU A;  2DA1 A;  4IHV A;  4IHW A;  2I10 A;  2XB5 A;  2L0K A;  2N8G A;  3HOY J;  1F43 A;  1K83 J;  3S1Q J;  2JN6 A;  2FJ1 A;  1ZK8 A;  1MBE A;  1FEX A;  3TP3 A;  1Z77 A;  1JKR C;  2NS7 A;  1FTZ A;  5J1Y A;  1VFC A;  1E3O C;  2XPU A;  1A5J A;  1MBG A;  1ENH A;  2Y30 A;  3IH3 A;  2LR8 A;  1AKH A;  4JP0 A;  1ETK A;  3C2B A;  3IH2 A;  5IP9 J;  2HQ5 A;  5IYB J;  2DA4 A;  2D5V A;  2EH3 A;  5EDN A;  1FJL A;  3GTL J;  4D7N A;  5M5W J;  4JYK A;  4XIC A;  1B72 A;  4BY1 J;  2WB1 N;  5J1U A;  4C3H J;  2YU9 J;  3BG5 A;  4CYC A;  2XPV A;  1BJZ A;  1FIA A;  2HOA A;  2EZI A; 
#chains in the Genus database with same CATH topology
 2CG4 A;  4MFD A;  3T8T A;  3I0T A;  2FML A;  4YFN F;  2Z5U A;  2QQB A;  4ANJ A;  1SAX A;  1WJD A;  3ZMS A;  4ZYG A;  2YX7 A;  2KIQ A;  2PBI A;  4NUB A;  1FNN A;  2VKH A;  1IRF A;  3W2W A;  2R7O A;  3OSG A;  4XMY A;  1STZ A;  1FYK A;  2XKO A;  3R60 A;  4LIU A;  4KNY A;  1UST A;  2LLK A;  1LEA A;  2R5Z A;  2EA4 A;  3WE3 A;  1BOB A;  1ZG1 A;  3UR3 C;  3I59 A;  1H88 C;  5DDG A;  1IJW C;  3OV8 A;  4DNC A;  3OYN A;  1FP2 A;  3CZ6 A;  1LEB A;  5FKK A;  1IN5 A;  3KEY A;  2M2E A;  2H1K A;  2G7U A;  1OCR H;  3CLO A;  2QCO A;  1N78 A;  1BR4 A;  3FXJ A;  4NC6 A;  1BIB A;  4O6J A;  5D6E A;  1MGT A;  4YFX F;  2P6T A;  4BKX A;  1ZAO A;  2DQR A;  2CYY A;  2O3F A;  5ICE A;  4HNT A;  3HGY A;  3P7N A;  5JLX A;  2Y0S N;  4G6Q A;  4IPA A;  2RNG A;  4XRS A;  2A5W A;  5A2Q K;  3ESW B;  5E1W A;  4MEX F;  1WWX A;  2QYO A;  3ASN H;  2EV5 A;  3OYA A;  2DT6 A;  1R4N B;  3CMA I;  3OS2 A;  5DM6 F;  2W57 A;  2NVU B;  3HOX J;  2FBI A;  3KCC A;  1ERD A;  4KUM A;  2Q8K A;  2IGM A;  1FT9 A;  3MCZ A;  3OOP A;  3E0J B;  1JJ6 C;  2GXG A;  1MMG A;  1ZG5 A;  1I6H J;  2WWY A;  3CME I;  2B7E A;  1MH4 A;  3CCY A;  3QU3 A;  2P5L C;  3HZJ A;  2GZW A;  4PZJ A;  1KQ0 A;  2MG4 A;  3S3N A;  2DJI A;  4Q5S F;  3DCF A;  1F5T A;  4IRH A;  3KEO A;  4ESJ A;  1IN7 A;  3WGH A;  2LRE A;  3BQY A;  3PQJ A;  3LA7 A;  2IPQ X;  2OF7 A;  3PNY A;  4N4O B;  2O9L A;  1IN6 A;  3U2R A;  2YR2 A;  1IV6 A;  3C2H A;  3R61 A;  2JTV A;  1YJN I;  3I3L A;  4A3K J;  4HNU A;  3LSK A;  2GQQ A;  1LKX A;  4M9Z A;  4XR6 A;  1X2N A;  1X19 A;  2VBZ A;  2W25 A;  4BQN A;  2NRA C;  1U8R A;  2JRT A;  3FMQ A;  2QKM B;  1WJE A;  4ESF A;  3ZQH A;  1ZRD A;  3OYH A;  1JUM A;  4GGG A;  3HSR A;  5E8G A;  2JVG A;  3WTZ A;  2CW7 A;  4GYG A;  3RPU D;  4A6E A;  4A69 C;  1C0W A;  4I6Z A;  3LQQ A;  3K70 C;  4C3I J;  2E34 A;  4M72 A;  4FQG A;  1IRZ A;  3O3K A;  3O6B B;  2CQQ A;  4CCM A;  1Z3X A;  3FXU A;  2RRE A;  2XAS A;  2JPB A;  5HS8 A;  1ITY A;  4LG0 B;  3KLN A;  5F0C A;  2Q2E A;  4ZYA A;  2UXX A;  2NS0 A;  2BBY A;  2WV1 A;  1ZR4 A;  1O4X A;  3FDY A;  2UUZ A;  4QPO A;  4IOC F;  3VFZ A;  4HEA 2;  2VUM J;  3M07 A;  1D1A A;  2XAF A;  3CDL A;  4L9J A;  1D5V A;  4AWX B;  1HCR A;  2L7K A;  4HX8 A;  1QO0 D;  4S0H B;  3OS1 A;  3GTJ J;  1DU6 A;  1P4A A;  1WGX A;  3AG3 H;  3WHC A;  2KJC A;  3HKZ A;  3CDI A;  3ECH A;  1FOW A;  3RKX A;  4ITV A;  3I55 I;  1TWG J;  3HDD A;  3JRF A;  2DXI A;  4DYC A;  1W7P A;  1Z21 A;  4NDL A;  1I1G A;  2K5C A;  3H5A A;  3E3V A;  4LGW A;  2E36 A;  5F04 A;  2HDD A;  1HSJ A;  2VI6 A;  4U0V A;  3S3O A;  3I4M J;  1K7A A;  1JT6 A;  2EIK H;  2A6E F;  3QYB A;  1APL C;  2HVR A;  2M5W A;  3J7Y J;  2V1X A;  2DTZ A;  2PMH A;  1FSE A;  3DTE A;  2P8T A;  3DLL F;  3TDZ C;  3X2Q H;  4HQE A;  1FSH A;  4E7S A;  1JKP C;  4DJA A;  2IA0 A;  4JX4 A;  3DTI A;  3BR6 A;  1ETX A;  1V5G A;  4Y7N J;  4P9F A;  3I56 I;  1WH5 A;  2XF5 A;  3EPZ A;  3O2P E;  4R1H A;  3ZQQ A;  1UFM A;  4XLC A;  4F93 B;  4LIT A;  2FNP A;  3M8F A;  4L5E A;  5CLS A;  3ZQG A;  3E5Q A;  4RBO A;  3WTT C;  1BA5 A;  3EUA A;  4CYD A;  4RB3 C;  1B8I B;  4AIH A;  5DCM B;  1FY7 A;  3KYL A;  2L4A A;  2ZO4 A;  3LFK A;  2M1B A;  1V5E A;  2QGU A;  2IEK A;  4BJ6 C;  3CCM I;  5FD5 A;  4IQ4 A;  5E8I A;  2XVC A;  3D5L A;  3MEX A;  1UZC A;  2P81 A;  2JZY A;  2NXN B;  2ETH A;  4BXU A;  5CYV A;  1X3W B;  3C18 A;  4IX7 A;  4XOT A;  1D0Y A;  3GTP J;  1YS7 A;  1GV5 A;  3BZ6 A;  1EA3 A;  5E3L A;  5IT3 A;  3LNQ A;  4HX4 A;  1P92 A;  1XB4 A;  2KQR A;  3ERM A;  5J6X A;  3CCR I;  1M1E B;  1FIP A;  4AD9 A;  5D5X B;  4P1W A;  1EV7 A;  3FHN A;  2M34 A;  2ZBK A;  3K1M A;  4EVI A;  5KHD A;  4PJ0 C;  4LD5 A;  2ACJ A;  1HW5 A;  3SYT A;  3QQA A;  5LEJ A;  1XPX A;  3GCM A;  1W0T A;  2MD0 A;  5EG0 A;  1O3R A;  5BPI A;  4CZC A;  3S16 J;  4BY7 J;  2LKX A;  3HTS B;  1K61 A;  1XTA A;  3L2W A;  2MW8 A;  1BBY A;  3WGI A;  3MZ8 A;  4B09 A;  4I76 A;  1ON2 A;  1T38 A;  2KZG A;  1ZAR A;  1IW7 F;  2Y2Z A;  3E97 A;  4FX0 A;  2VAS A;  3NRV A;  4YEJ A;  2Y75 A;  3BPV A;  2M4G A;  1BM9 A;  1P2F A;  2P4W A;  1YX3 A;  1GHC A;  5L3D A;  1DPR A;  3H0G J;  2HKO A;  1K78 A;  2V26 A;  3G1O A;  1Z7U A;  2LYC A;  2XPW A;  2HPM A;  4E6K G;  4PJJ A;  1AHD P;  2JA6 J;  3DKW A;  5LGT A;  3OYJ A;  3S3M A;  1SAU A;  3IV5 A;  5IYD J;  4RDU A;  1X1D A;  1TQP A;  5HDG A;  4C30 A;  2V9P A;  3I71 A;  1OIS A;  9ANT A;  5TIS C;  4ESB A;  4E7J A;  4G8X A;  1AA7 A;  1PP8 F;  2CUE A;  2BXY A;  4I0A A;  2VON A;  4G94 A;  4DW6 A;  3AAF A;  1XSD A;  2H1L A;  2CGP A;  3T0Y A;  4KA4 A;  2XAG A;  2K3P A;  2IXS A;  4MTD A;  5B3S H;  3GX4 X;  3DEU A;  1R1T A;  2IBD A;  2YPR A;  2LKP A;  1XDS A;  3HUG B;  1YYV A;  4AIJ A;  1YE9 A;  2EJR A;  3W6K B;  4P5O A;  4EEF G;  5HS9 A;  1TC3 C;  2F5E A;  2PQ8 A;  1VQK I;  4BHP A;  1IAW A;  3C2G A;  2GWR A;  5LEK A;  4ZC3 A;  3ML6 A;  1JE8 A;  4ZTF A;  2KIU A;  3ONQ A;  4FT8 A;  2E1M B;  2TDX A;  1GLN A;  1WPK A;  5DV5 A;  3Q0U A;  4BXF A;  1W4M A;  2M8E A;  5H20 A;  4IRI A;  4LMY A;  3K9T A;  4ENJ A;  2GIV A;  3CUQ C;  4M6V A;  1MH3 A;  2ZJP F;  5FRM A;  2HI3 A;  3RKY A;  3F8B A;  1TWA J;  1T8I A;  3PFI A;  4RAF A;  1R23 A;  4NC7 A;  4IOA F;  3EYY A;  3B6C A;  4QTR A;  3FXQ A;  4ENK A;  1MBF A;  2OA4 A;  2OZ6 A;  2VE8 A;  3HHG A;  3SHF A;  1QPI A;  2CQK A;  2E2H J;  1ETV A;  3PJR A;  3K4L A;  2EK5 A;  2DI3 A;  1LFB A;  1H89 C;  4MTE A;  3TW6 A;  3ZGK A;  3KIO A;  2EZK A;  3BR5 A;  1G2H A;  2Z2S B;  4HV6 A;  4PCQ A;  1IDZ A;  3HPH A;  4E7Z A;  2TRT A;  1KGS A;  4UUS A;  3IL2 A;  2X1D A;  3QU6 A;  2EPF A;  3BWG A;  3OR1 C;  1SFK A;  1R1V A;  3HXL A;  1X3Z B;  3S2W A;  1DP7 P;  1PUE E;  4A3D J;  4HPQ A;  1O7L A;  5GPC A;  3DU5 A;  3QPH A;  1KZH A;  4W97 A;  2X9D A;  2VB6 A;  3KP3 A;  2L7M P;  2W4S A;  3BG7 A;  4ZYE A;  2W82 A;  5IPA A;  1EF4 A;  5DS9 A;  4PUS A;  3R6S A;  2LVS A;  3BG9 A;  5IY5 H;  1NG6 A;  4XLN F;  4RGX A;  1J59 A;  1QZE A;  2RQP A;  2ADU A;  3H9J A;  2K9N A;  2OQR A;  1S7E A;  3GBG A;  2LC2 A;  2BY3 A;  3GFM A;  4YII A;  1IXR C;  1HW1 A;  2CRG A;  3BTL A;  4HF2 A;  2H8W A;  5LLQ A;  2P7C B;  2R5Y A;  4RGR A;  4CDG A;  3F8F A;  1PDN C;  1YI2 I;  3Q9V A;  4KJZ A;  3LSM A;  2EFP A;  1HOM A;  5HLH A;  4CCN A;  4LIV A;  4FAS D;  4BL0 B;  3HBL A;  2V1D A;  2RGV A;  2GIZ A;  5K7Z A;  2EFW A;  2M7B A;  4ZYH A;  3B73 A;  1YO5 C;  1BI3 A;  5LGN A;  5E3O A;  2K02 A;  3KET A;  2DU9 A;  2IS6 A;  1LPQ A;  3DBH B;  3JW4 A;  3E6D A;  2DT7 B;  1ZGW A;  2V1N A;  3DEW A;  2E2I J;  2V1U A;  3LWF A;  2JA5 J;  3J80 K;  3VSL A;  4AYB N;  2OBP A;  4CZZ A;  4YIR X;  3RKQ A;  3TO7 A;  2GOX B;  2A6T A;  3CQZ J;  4XON A;  4RS8 A;  2DA1 A;  1ZYR F;  2V9K A;  3L2U A;  2L0K A;  3HOY J;  3F22 A;  5FRO A;  4PDK A;  1K83 J;  1UAA A;  3HRS A;  3S1Q J;  3HG9 A;  2M7A A;  1ZK8 A;  3IAS 2;  3ZXS A;  2K85 A;  3BP8 A;  1RNL A;  2EIL H;  1G3Y A;  3FBI B;  4DOZ A;  2CW8 A;  1FYL A;  3SZT A;  1JXS A;  1MBG A;  2Y30 A;  3SQN A;  2LDU A;  4XLA A;  3UNG C;  4JP0 A;  2CO5 A;  3C2B A;  5GTI C;  5IP9 J;  4M9X A;  1ACI A;  3ABK H;  2D5V A;  2EH3 A;  2KIM A;  2E5N A;  2IGN A;  2QA4 I;  3Q9S A;  2QEN A;  2LY1 A;  2OTL I;  3CLQ A;  5D6F A;  2V6E A;  2WB1 N;  4C3H J;  5GAD J;  2ISZ A;  4HA8 A;  1JI8 A;  2AS5 F;  1GXQ A;  1I3A A;  1FIA A;  1U0J A;  3I59 B;  2X1C A;  4NNJ A;  1W36 C;  1TWH J;  4U7B A;  5F08 A;  5EEA A;  3CF2 A;  4J19 A;  2L4M A;  4M3B A;  4DIQ A;  1UB9 A;  2VQG A;  2KKO A;  4RM2 A;  1IO2 A;  2W00 A;  3EUH C;  4PK4 A;  3AL0 B;  2DMN A;  1VQM I;  1IXS B;  4KMU X;  1XD7 A;  3WHB A;  3I54 A;  2DTR A;  3KZZ A;  2A5Y B;  3OR2 C;  4YRV A;  5EGO A;  2X6W A;  4ZDO A;  2JWT A;  4RMN A;  2HXO A;  4OIN F;  3U1D A;  4OOI A;  4X1E A;  1OMI A;  2AHQ A;  2HQR A;  3G4S I;  4BGD A;  2PJR B;  2VIX A;  1GVD A;  3EUK L;  2ZME B;  2UWM A;  2LMD A;  4EGY A;  1MMS A;  3RYP A;  3JRD A;  4A3J J;  2HXI A;  3WOD F;  3G73 A;  3FIW A;  2IS1 A;  3FK6 A;  2ZCW A;  2GLO A;  3IWF A;  4ASN A;  2VOP A;  1XSV A;  3K4M A;  3GVA A;  1T95 A;  1HXD A;  1NHA A;  5F0H A;  4UB8 C;  3TKY A;  4FET A;  5J4V A;  2XAQ A;  5JHU A;  2A61 A;  2WY8 Q;  3E6M A;  4RGU A;  2JSP A;  3JRI A;  3L09 A;  4IRG A;  3REO A;  3PNV A;  1XCV A;  2BOL A;  3HRU A;  2ZXH A;  3S32 A;  3RIR A;  2D1H A;  5L3F A;  2GA1 A;  2MYS A;  2QBY B;  2A69 F;  3ECO A;  4G7Z F;  2Y31 A;  1LE8 A;  1MDM A;  4E4H A;  2FBH A;  2F5V A;  4IF4 A;  5M5Y J;  2JA8 J;  3J81 Z;  3VWB A;  2MH9 A;  3MFK A;  4L9T A;  4Z2Y A;  4R79 A;  1IGN A;  3I5U A;  1VQ7 I;  1UCR A;  3DQV C;  2M9H A;  3RKW A;  1JUP A;  5DUK A;  3ABM H;  4RB0 A;  2NNN A;  1U5T A;  4XID A;  4S05 A;  2BEO A;  3I64 A;  4DZP A;  2BW3 A;  1WI9 A;  5FD6 A;  1W7P D;  1RUN A;  1P7J A;  4N4N B;  2HYJ A;  2QVO A;  2STT A;  2EZL A;  3HOW J;  1Z67 A;  2DMP A;  3CDH A;  4UXN A;  3K4N A;  2HOS A;  3JAM Z;  4PJN A;  3G1L A;  1MND A;  3K2A A;  1PP7 U;  4U7D A;  3SZG A;  1RUO A;  4IKF A;  3BJ6 A;  3KP6 A;  1B72 B;  1MMD A;  5E1X A;  2ZJ2 A;  2CV1 A;  4BXX J;  4CYC B;  1ZG3 A;  1YS6 A;  3G3Z A;  2EFO A;  2LTP A;  3P5J A;  3S14 J;  1W7P B;  5B1A H;  1F1Z A;  4BQO A;  4UVB A;  3JSO A;  2CFX A;  1Z0X A;  4V2G A;  5DTD A;  3WTW C;  3LAJ A;  1YJ9 I;  2DMQ A;  1ZGJ A;  1O3S A;  1E2X A;  5FRN A;  1ZHF A;  2X85 A;  2ISY A;  1Z6T A;  3AFH A;  5M3M J;  2JA7 J;  5AIQ A;  3JRB A;  2QWW A;  2CUF A;  3SDG A;  3DV8 A;  4R8H A;  3DLA A;  3H9Q A;  4L5I A;  1JHF A;  3CCS I;  5ILS A;  2ESH A;  4HYE A;  4XLH A;  4E7I A;  3FKI J;  3R4K A;  1CF7 A;  2Q0O A;  3LOC A;  1VQO I;  2HOT A;  2P7V B;  1G59 A;  3CO7 C;  1LNW A;  1E0E A;  5C44 J;  4QWQ A;  4LB6 B;  2LF8 A;  4EQQ A;  2O6G E;  4OU0 A;  1DDN A;  1TT5 B;  1ZLJ A;  3M9A A;  2BGC A;  2P0W A;  5J8C A;  4M71 A;  2CW0 F;  5KNL A;  2DOF A;  2R0Q C;  1JGS A;  1R4M B;  2BHZ A;  4B3A A;  4MQV A;  5EEG A;  4BS9 A;  1DQU A;  4I2O A;  2OUM A;  5IT9 K;  3OYC A;  4B3X A;  4II3 A;  1VQL I;  3JRA A;  3OOU A;  4GDF A;  4BJ5 C;  1VTN C;  4E70 A;  2B63 J;  2R7T A;  3F72 A;  4HF1 A;  1QBJ A;  2CH0 A;  3CF5 F;  3D5S C;  1MD0 A;  4ZJZ A;  2JJ7 A;  1OLT A;  4WXD A;  4TV7 A;  3F23 A;  3TL4 X;  1VND A;  3DF8 A;  3LA2 A;  2DCE A;  2Q1Z B;  2H27 A;  2BY2 A;  2XRO A;  2Z1D A;  1R9T J;  3VDX A;  4JX5 A;  1EH8 A;  3OYL A;  5BPD A;  2V4J C;  2Y0S A;  2Y48 A;  2ZB9 A;  1OCT C;  1D1C A;  2DT5 A;  2F4O B;  4PFO A;  3CUQ A;  4XRS G;  3JRH A;  3KP4 A;  2E71 A;  3OS0 A;  2RKH A;  3GTK J;  3N97 A;  4U87 A;  4C2M J;  1Z7L A;  2OCE A;  1SFE A;  1RET A;  2XSD C;  1P7I A;  1YIO A;  3GLL A;  1MBH A;  3B02 A;  3L9F A;  5IOZ A;  5BQT A;  1TZL A;  3COA C;  2DQL A;  3OIP A;  3LAP A;  2L2O A;  1GT0 C;  3BQZ A;  5F1J A;  2KIS A;  1VQ4 I;  4RAY A;  1FBS A;  1WJC A;  2HR3 A;  2QUF A;  4M3F A;  1XS9 A;  3L1P A;  1P9Q C;  3BLY A;  3DEE A;  2YUS A;  3CTA A;  2Z16 A;  2DAO A;  2E2J J;  2L7F P;  2F48 A;  3EET A;  4F3Q A;  3WTS C;  5LGU A;  4BQQ A;  3PIO F;  1WCM J;  3HOZ J;  2M4K A;  2OTJ I;  2DMT A;  5K1Y A;  2LP0 A;  5FFZ A;  2A3S A;  4A0Z A;  4XNF A;  3Q5F A;  2CFO A;  3MQ0 A;  4D9J A;  2R7S A;  2DFI A;  2LBF A;  3KP5 A;  4I02 A;  1XMA A;  2HTJ A;  2WTE A;  3IH4 A;  4MQ9 F;  3JTG A;  2GOM A;  2XHK A;  4XKB A;  5J3L A;  3MVP A;  2P5V A;  4B43 A;  3D5R C;  3CMY A;  2IVM A;  1BC8 C;  3MWM A;  3QAH A;  3G2B A;  1V54 H;  4MIM A;  4HBL A;  1MNM C;  1ZGA A;  4FCY A;  3GME A;  3HKZ N;  1PYV A;  4ENN A;  2DFH A;  2V9V A;  5D4S A;  1U8B A;  2OQG A;  3CC7 I;  5BMZ A;  4J00 A;  3WGG A;  5A2Q Z;  5K5R A;  4AU7 A;  5ERI A;  2E60 A;  4MHG A;  4XM3 A;  2E1M C;  1TLH B;  2DA3 A;  1D1B A;  3TW7 A;  1K79 A;  1S29 A;  3FMS A;  3K7A J;  1G4D A;  2FX0 A;  1Q1V A;  1I39 A;  2O03 A;  3QOD A;  1OR7 C;  2L7Z A;  2BYV E;  1U9N A;  4BEH A;  1UEL B;  1D3Y A;  1T08 B;  3H5N A;  3MKY B;  1BN5 A;  3H36 A;  4GRI A;  4NHJ A;  5HNH A;  2QF7 A;  3GXO A;  4A2U A;  3ZQC A;  3DPL C;  5H6R A;  2RDP A;  5BS6 A;  4A93 J;  4PGG A;  2HDW A;  1UHM A;  4NQW A;  2CQ7 A;  2E1O A;  2WAQ A;  1UHW A;  1SFX A;  4U0W A;  5JI6 A;  2FSW A;  5DD8 A;  5EJC A;  1DU0 A;  4G6T B;  3OYI A;  1JUS A;  5D5U B;  1TNS A;  1R5H A;  3OYE A;  1RZ4 A;  4LOC A;  2TCT A;  1UG2 A;  3DPU A;  3SFZ A;  3FXM A;  3RZO J;  3PFY A;  2XAH A;  1LVK A;  4BUP A;  2AQF A;  2A6H F;  2WY7 Q;  2L54 A;  1RES A;  1Z1D A;  3CP8 A;  2EWN A;  3BTJ A;  3CCL I;  1OCP A;  3CJQ B;  2VKE A;  3IKT A;  1RR7 A;  3F6O A;  4LB5 A;  3HOU J;  4UB6 C;  2GXB A;  1RKT A;  3A0B C;  4OIP F;  3TMO A;  2IGK A;  3ZMD A;  1SD5 A;  4M6X A;  1ZRE A;  2XGE A;  1IRG A;  3GZ6 A;  3JCU C;  4XN0 A;  2LD5 A;  1RI7 A;  1DPU A;  1FBU A;  4A6D A;  2PMZ N;  4G12 A;  1TP4 A;  2E7W A;  2DFE A;  1G3S A;  5B66 C;  2K40 A;  4CCK A;  2YSR A;  2J5P A;  1Y1W J;  4IJA A;  1JJ8 C;  1J7K A;  4A5N A;  3ELK A;  1PUF B;  1XMK A;  3N05 A;  2CS3 A;  2VBX A;  1VI0 A;  3PNT A;  2Z3Y A;  2HPI A;  1YRN B;  2LK2 A;  3RSN A;  5HDK A;  3K1N A;  3KX2 A;  4I01 A;  5H2F C;  2HZD A;  3IHU A;  4XL9 A;  3PO2 J;  3SEQ A;  2HVQ A;  2NVQ J;  2BVL A;  4ABZ A;  3E6C C;  4J01 A;  1D5Y A;  2X6O A;  1HDD C;  2GM4 A;  3S1M J;  2DK8 A;  4EJT A;  4KYW A;  2W85 A;  1TQM A;  1P4X A;  4Y33 A;  5KAF C;  2X0L A;  3F3X A;  1UHS A;  1SAN A;  2XF7 A;  4IHX A;  4JQF A;  2MLK A;  3ISP A;  3LSH A;  4N0B A;  1F4K A;  3KZI C;  5L3E A;  1KU2 A;  2EV6 A;  3P9C A;  2AQE A;  2VJJ A;  1W5S A;  3VOE A;  2IJL A;  4FE7 A;  5FKL A;  4A0Y A;  3BR0 A;  4BHB A;  2VKV A;  2VKD A;  3KLO A;  4ZTJ A;  1O3T A;  1QU3 A;  2B0L A;  1BR2 A;  3LST A;  1MW7 A;  4IHV A;  5TRD A;  1JHH A;  3M1C A;  2P6S A;  3PUF A;  2N8G A;  4KIC A;  3I4P A;  4GO1 A;  5CQE A;  4NC8 A;  4LLN A;  1KQ9 A;  5K5O A;  2VJ4 A;  3TP3 A;  1JKR C;  3FZV A;  3QPT A;  1FTZ A;  2E7X A;  2XPU A;  3K69 A;  3IH3 A;  2LR8 A;  3ZMT A;  3DFG A;  1VQ9 I;  1EKE A;  2HQ5 A;  2LF7 A;  1KA8 A;  3P9I A;  3DKX A;  2CSO A;  2R7V A;  5EDN A;  4EGZ A;  3GTL J;  4HW0 A;  4D7N A;  4JK1 X;  1HKS A;  2HGC A;  3T5X A;  3K0L A;  1FX7 A;  1XDU A;  5HLI A;  4XIC A;  3LSI A;  3U9G A;  2FF4 A;  2V7F A;  4XSX F;  3K4K A;  3AL0 C;  3MKZ A;  5EEH A;  4F55 A;  1YFH A;  4LG0 A;  3JTH A;  4E7H A;  5LFA A;  3BPX A;  4B48 A;  3QOE A;  1RC9 A;  4L0Y B;  2BY0 A;  1DGW Y;  2Y0M A;  4MLO A;  2MGQ A;  1HDP A;  1A6Q A;  2ID6 A;  2EQR A;  2FMY A;  2XAU A;  4Y15 A;  3B6A A;  4KN4 X;  2ZME C;  4P96 A;  2HFH A;  5J8F A;  1YX5 A;  3WU1 B;  1WJB A;  1OYI A;  4XKC A;  2ZC2 A;  2R7D A;  3M7G A;  2G0E A;  2FOK A;  3BOQ A;  3FXO A;  3WTX C;  2ECC A;  4BE0 A;  2O8X A;  2IS4 A;  4RM3 A;  4UHT A;  5ILU A;  1FYM A;  4KIT B;  2IA2 A;  2HNH A;  3K4B A;  2JK3 A;  2XSJ C;  3HPG A;  1J9I A;  5IYC J;  4OAY A;  3R0J A;  4EJU A;  2CJJ A;  3LQR A;  5DYM A;  1VZ0 A;  1O3Q A;  3QP6 A;  1H0M A;  4HF0 A;  3E5X A;  1WQ2 A;  4AC0 A;  5FLX K;  1TNT A;  2PMU A;  4DQ2 A;  4ZYD A;  3ZQI A;  5D5W B;  4HSR A;  4A3L J;  5HLT A;  4M74 A;  1U9O A;  2PI0 A;  5J4Y A;  1HQC A;  1Y56 A;  2RVC A;  1Z05 A;  3KEQ A;  4AUX A;  1SMT A;  2JPC A;  2LFB A;  3JRE A;  5GTH C;  4PJL A;  4KIG A;  5CVJ A;  3TO9 A;  4A12 A;  3ZQL A;  1B8I A;  2EFQ A;  3LFU A;  4WK8 F;  2E35 A;  3CCJ I;  5CVI A;  1RKW A;  3T1B A;  4IHY A;  2MBF A;  3CUO A;  1P6R A;  2QQA A;  1F36 A;  2RNJ A;  2E19 A;  2CUJ A;  1ORK A;  2ZSH B;  3TED A;  4EM2 A;  5L3B A;  3I4N J;  1FWZ A;  3IRQ A;  3QOP A;  1N75 A;  1T33 A;  2HOE A;  5EYR A;  5GAG J;  3DBL B;  2XC7 A;  1JT0 A;  4BDZ A;  4EV0 A;  1QVT A;  1ZEL A;  3M8J A;  2IP2 A;  3W6V A;  2W24 A;  4F7Z A;  3OYD A;  1S5L C;  2Z9O A;  4A3C J;  1UMQ A;  6PAX A;  2PEX A;  3A01 A;  1BW5 A;  2LNB A;  5JFR A;  3KP2 A;  4E7K A;  2R7U A;  2OV7 A;  1FOY A;  2XIG A;  2LH9 A;  5GPA A;  2K9S A;  2G9W A;  1I3Q J;  1AKH B;  2QZ8 A;  3V4G A;  2BHY A;  1CGP A;  5LHI A;  2QKL B;  1YQA A;  3M4O J;  2NYX A;  2XGC A;  3L2C A;  3FM3 A;  2COB A;  1IG7 A;  5HOD A;  2ID3 A;  3HRM A;  2DA6 A;  1D8K A;  3HOV J;  1KU9 A;  2OJE D;  1EJ9 A;  5HDN A;  5DUI A;  1X1A A;  1SFU A;  3C7J A;  1WI3 A;  2C6Y A;  2MLG A;  3ASO H;  4XOR A;  3RTR A;  4AYB A;  1R00 A;  3ZP5 A;  1ZR2 A;  3RDI A;  5J40 A;  2G7H A;  4JX6 A;  3ABU A;  4PSX A;  3GZ5 A;  3NAU A;  4WXC A;  2UZK A;  1MJ9 A;  2CQN A;  4ZZL A;  4XK4 A;  4RB2 C;  1E3H A;  2F4M B;  2OC6 A;  2JUC A;  2R5Z B;  5TJJ A;  4C2T A;  1OQY A;  1YW8 A;  1E17 A;  3JRC A;  4XBF A;  1GDT A;  1PVE A;  1YTY A;  3ZRG A;  4KDP A;  1A04 A;  3SFI A;  2VOD A;  2ZNZ A;  1SFO J;  4YG2 F;  4KT5 C;  2VBW A;  2O5R A;  2YX4 A;  4WCG A;  2YS9 A;  1I6X A;  2HYG D;  1ZN2 A;  2F5F A;  2GAU A;  3M8E A;  1UG0 A;  1AOY A;  1A36 A;  4BHC A;  4UV9 A;  4ZDL A;  2RV8 A;  2XGX A;  4IO9 F;  2NVT J;  2FNA A;  1KQ8 A;  2PLY A;  4B4C A;  4I98 B;  3FWE A;  3AKZ A;  2HDC A;  1J09 A;  2IS2 A;  2LG4 A;  2EB7 A;  2O7O A;  2CV0 A;  1KON A;  3FBN B;  3I58 A;  3OL3 A;  3HUG A;  1I50 J;  5FB2 A;  2MD5 A;  2STW A;  3VYT B;  2BV6 A;  1RR8 C;  3WU2 C;  3VYR B;  3OYG A;  4BJT A;  4RGS A;  2JMW A;  1G3T A;  3DBR B;  4HDU A;  5J47 A;  1HF0 A;  4UUV A;  3PL8 A;  3J80 Z;  2OD5 A;  1EH6 A;  2HU9 A;  1FOX A;  4BH9 A;  2A05 A;  4L5J A;  1OR7 A;  4ENM A;  1QHG A;  2CU7 A;  3V8K A;  2KJB A;  3GFL A;  4B8X A;  3TBI A;  5JVT A;  1DP3 A;  3DXJ F;  2WBM A;  4N9H A;  1W1W E;  2JRM A;  4EM1 A;  1ZLK A;  1A35 A;  4OIO F;  1L0O C;  4D5C A;  2V79 A;  3PO3 J;  1QGP A;  4CHU A;  2QQ8 A;  1QZZ A;  4BDY A;  2O61 A;  1GVJ A;  2XKP A;  5DM7 F;  2M45 A;  1SD7 A;  1Z3Y A;  5FO5 A;  3D1N I;  1LDJ A;  3E7L A;  2I8D A;  5E17 F;  2EBI A;  2VPL A;  4OIQ F;  2VT3 A;  3OMY A;  2ICW G;  4XQF A;  4E7L A;  1T98 A;  3GFJ A;  4KIF A;  3ZMZ A;  5LRS A;  1NK2 P;  4BNC A;  5BNG A;  3KPH A;  2K7L A;  2A68 F;  4Z6Y A;  2H8R A;  4HST A;  1OCO H;  2HEO A;  3K4C A;  4BQA A;  3IC7 A;  2D1V A;  3A02 A;  5JVG F;  3F8M A;  1IXC A;  2NAZ A;  2Q2E B;  3KYD B;  2LSO A;  4M3D A;  3O8G A;  2H09 A;  3HYI A;  1OFC X;  1VQ5 I;  4B1R A;  4D5F A;  5GAH J;  5ILV A;  4UY8 I;  1FC3 A;  3AG1 H;  2NOG A;  3ZQF A;  3OL4 A;  3P9K A;  3LSP A;  2ZJR F;  1T0F C;  3ZR8 X;  3HTU A;  2F5C A;  4IVN A;  1KYZ A;  3M3Y J;  5F6F A;  3OYK A;  3A0H C;  1X1B A;  1WVR A;  5AON A;  1HBX G;  1G6N A;  3OYB A;  1NH3 A;  4O3M A;  1YG2 A;  1IUY A;  2CQX A;  2VPR A;  3ZMV A;  2X1E A;  1V4R A;  3I53 A;  3FM5 A;  4GYI A;  3V8J A;  2XAJ A;  4HV5 A;  4WF2 A;  3ERE D;  1W5T A;  2YU3 A;  3Q0V A;  3DKY A;  3QYE A;  2L9S A;  1JKQ C;  4Y4R A;  3WE2 A;  2OZU A;  1HKT A;  4EJO A;  3GO5 A;  1SEU A;  1L3L A;  1Z6R A;  5CVV A;  1WJ5 A;  4GCV A;  4HQM A;  3QRF F;  3HOS A;  1QQI A;  5EZG A;  1S7A A;  4W1U A;  2PX9 A;  1IN8 A;  3BRO A;  4HLY A;  1YIT I;  1HKQ A;  3F9K A;  4N9I A;  3LSJ A;  1G3W A;  4M3G A;  2XDV A;  4NQW B;  1ODD A;  2LOO A;  4KMF A;  3QYF A;  1U3E M;  2VN2 A;  4V19 K;  3TQN A;  3EYI A;  1S3J A;  3Q3S A;  3WG9 A;  2PG4 A;  5DD4 A;  2KRC A;  1QHH D;  2RAE A;  5FFX A;  1YW7 A;  3MN2 A;  3LMM A;  1BOA A;  1W0U A;  1OCC H;  4D7M A;  4EM0 B;  4CO8 A;  2KFD A;  3LL7 A;  4OMZ A;  1WZ2 A;  1QPM A;  2L9R A;  2CV2 A;  3O8H A;  1IDY A;  2K3F A;  2K4J A;  3IRR A;  1XN7 A;  3L2R A;  3BT9 A;  4XN3 A;  2MFZ A;  3ROU A;  2NNY A;  4M73 A;  3PSF A;  1TQI A;  3F0C A;  3I9V 2;  4LLG F;  3HL2 A;  3ZMU A;  1CQT A;  3H3Z A;  2VXD A;  2XB0 X;  4DYQ A;  5TGT A;  3H5R A;  3UKG A;  4EMS A;  2M8G X;  2ZKZ A;  5JHF A;  4UVC A;  5E20 A;  4A5M A;  2UV1 A;  2ZJQ F;  2QQ9 A;  3QP5 A;  2OPT A;  4CCL A;  3BC8 A;  2EZH A;  4Q47 A;  2RN7 A;  4YEL A;  5EG0 B;  1QNT A;  5E3M A;  1RRJ A;  2ME0 A;  2WC2 A;  1P4W A;  2MH2 A;  3CJN A;  4HZF A;  3MZH A;  2VT2 A;  1MJB A;  2DA5 A;  2KDO A;  1YJW I;  3IP4 B;  2PJR A;  2DDA A;  1VF9 A;  3KP7 A;  4Q4Z F;  2ZME A;  1Y0U A;  4QPQ A;  1KU7 A;  2DPD A;  4IXA A;  1HLV A;  2EV0 A;  3FMR A;  4AVZ A;  3PQK A;  2KIF A;  2FQ4 A;  2KRH A;  1ETY A;  3BZC A;  4A3F J;  3R0A A;  4RB1 A;  5GP9 A;  1Q1H A;  1Y0N A;  3M1E A;  4JOM A;  1HW2 A;  1K78 B;  2MA3 A;  5HOO A;  3RQ4 A;  4Y52 J;  1SC7 A;  2L5Q A;  4Y13 A;  2IRF G;  5F1R A;  1LDD A;  3AG2 H;  5IP7 J;  4QLC U;  5FLM J;  1H9G A;  3L2V A;  4OIR F;  3HHH A;  5K7F A;  1H9T A;  1E3P A;  3QPS A;  1Y6I A;  3S1N J;  1OPC A;  4PSW A;  5C4J J;  1RIO H;  1B9N A;  2IAI A;  1HC8 A;  4ETS A;  1D8J A;  1QVU A;  4LG3 A;  2QBY A;  2W1O A;  2BVM A;  2VC1 A;  3VOD A;  4AM3 A;  5FKN A;  3KFW X;  1DUX C;  2BY1 A;  2K9Q A;  3WU0 A;  3ZOB A;  4ON0 A;  1B9M A;  1VQ6 I;  4GFB A;  1GUU A;  5LHH A;  3TDU C;  2HVS A;  2I10 A;  2K9M A;  2R4G A;  2XB5 A;  5D8K B;  3AG4 H;  3HRT A;  5CPR B;  3BY6 A;  1FOK A;  5IT9 Z;  4YFK F;  3RPQ A;  4BE1 A;  3J7A O;  2IA1 A;  3CES A;  4PGH A;  2K27 A;  1WRJ A;  1MBE A;  1FEX A;  4K2E A;  4XKW A;  3FXR A;  2ELH A;  4RLF A;  1E3O C;  3OWT A;  2VE9 A;  1A5J A;  2X4H A;  2WAE A;  4X0G A;  2VQH A;  3IH2 A;  3ZCO A;  2DA4 A;  5L3C A;  1K6O A;  3V7C A;  4Q48 A;  1YIJ I;  1FJL A;  1LUJ B;  5E18 F;  4OAZ A;  2X6Y A;  3PUB A;  4HOB A;  3WTU C;  5M5W J;  4JYK A;  1B72 A;  4KIS A;  3A4C A;  5J1U A;  5CJ9 A;  3BG5 A;  4CYC A;  4ZH4 F;  1BJZ A;  3D0S A;  1ZRC A;  2QSH X;  1XGN A;  2HOA A;  1AWC A;  2VC0 A;  4M9S A;  4LJZ F;  2Y9Z A;  1Y8Q B;  4BBR J;  5KK1 A;  2D2W A;  5CKT A;  4AVP A;  5E79 C;  1BC7 C;  4G7O F;  3IWZ A;  3BJO A;  2JVH A;  2I5U A;  2Z33 A;  2WAQ N;  4F52 A;  3VYU B;  1R5G A;  3BR3 A;  1IZ1 A;  4RAG A;  4DYR A;  4MGR A;  4AID A;  1JKO C;  2OCC H;  2GXA A;  1HA8 A;  1LJ9 A;  2KMU A;  3HSF A;  3F21 A;  2VBY A;  1X1C A;  3GLX A;  2ZSI B;  4UUS B;  2DFF A;  2VL8 A;  3Q0W A;  1Y39 A;  2R93 J;  4RLQ A;  2R7X A;  2K9L A;  2K86 A;  1ZRF A;  5M3F J;  1I5Z A;  2JQ7 A;  1R36 A;  3HM5 A;  4A3B J;  2HKX A;  3HB9 A;  1R7J A;  3K4J A;  2K4B A;  3K1P A;  2GA2 A;  4G7H F;  3HOT A;  2FXA A;  1XX5 A;  1S6L A;  2DA7 A;  2E5Z A;  3TOA A;  4RA2 A;  4HDV A;  2M0C A;  2GBY A;  2M30 A;  4C3J J;  2DDB A;  3RJP A;  2R7Z J;  1JTX A;  2KRF A;  2LKS A;  3J7A Y;  1TL8 A;  1XGM A;  2H6C A;  2W7N A;  1I27 A;  3MAJ A;  4CIC A;  1U78 A;  2L3D A;  1G8X A;  2LY9 A;  3OIQ A;  5FKM A;  3S8P A;  1J0R A;  1XCB A;  4HRI A;  1TT0 A;  1U5T C;  2M3A A;  3RYR A;  3EUH A;  4D1Q A;  2R5Y B;  2RQQ A;  3V7R A;  1WFX A;  2H94 A;  3K6G A;  3PIP F;  4I7H A;  2O0Y A;  5LD2 C;  2NVX J;  1N25 A;  1Z91 A;  4UUT A;  3L7W A;  2ZXW H;  5M5X J;  3DWL E;  2WAD A;  2MC3 A;  1TWF J;  1S7O A;  2PMZ A;  4GXO A;  4FX4 A;  5DEQ A;  2CWE A;  5GAE J;  3H0D A;  2B9S A;  3H3V K;  3VPR A;  5JLW A;  5CVR A;  1WJA A;  4O5V A;  4DBQ A;  3A01 B;  3RZD J;  3JSP A;  5FGM A;  2DOD A;  4CUG A;  2E1C A;  4PJM A;  4L0Z B;  3S2H J;  1X2M A;  4UVA A;  5AIP A;  2D45 A;  4H0E A;  2FBK A;  4WXH A;  1W5C C;  4I09 A;  3PSI A;  1XC5 A;  4MNU A;  4BAY A;  1BL0 A;  1J5Y A;  1A31 A;  4XRF A;  4JBA A;  1MZB A;  2FOW A;  3OYM A;  2L9V A;  4FE4 A;  1B6A A;  1OYW A;  3CC4 I;  2WV0 A;  5LHG A;  1LB2 A;  3VSK A;  1LDK B;  5BOX A;  2DYR H;  5DCF A;  2VXZ A;  3H3U A;  5KAI C;  4LLL A;  1POG A;  2R3S A;  2VOO A;  1SVL A;  2ME6 A;  3K70 D;  2LY2 A;  2QM3 A;  3QPL A;  1GXP A;  4A3I J;  4LK0 F;  2IGO A;  2XRL A;  4NBQ A;  3GFI A;  1R22 A;  4D0P A;  2F2E A;  5CVU A;  3G1M A;  2MSY A;  3FKJ A;  4S04 A;  3NWT A;  1XG1 A;  3MKL A;  2QLZ A;  1BI0 A;  3GTM J;  4FHT A;  1TW3 A;  2VQC A;  3BG3 A;  3GF2 A;  2XF6 A;  4EAT A;  4L18 B;  2VQL A;  2DJN A;  2DBB A;  1OCZ H;  4DGW B;  1LFP A;  4P9U A;  2W48 A;  1U6G A;  1MMA A;  2A07 F;  1FMV A;  4XOP A;  4G9Y A;  1BIA A;  2DLL A;  4B44 A;  3K10 A;  5F0F A;  4IHT A;  2HZT A;  4BBS J;  1I1S A;  1WJF A;  4EJV A;  3SJM A;  4KFC A;  2DOA A;  3GYH X;  5FLV A;  5EGO B;  3IAM 2;  1D0X A;  2OAZ A;  3TO6 A;  2XGD A;  3E5U A;  5H6Q A;  2R7F A;  1ZQ3 P;  3BZK A;  3FXK A;  1MSF C;  5ICG A;  3F8C A;  3RPU A;  3A1Y A;  2KL4 A;  3WG7 H;  3V8L A;  4RAZ A;  1T0F A;  2BXZ A;  1SMY F;  2ZXJ A;  3CO6 C;  1S9H A;  3L2Q A;  3FF5 A;  3L00 A;  1ZTR A;  2AXT C;  1J75 A;  2ZNY A;  3JRG A;  2HWV A;  2JA2 A;  2L9N A;  4XSZ F;  1NG7 A;  3BDD A;  3HJE A;  2FU4 A;  1X1P A;  4XRM A;  2FE3 A;  2UXN A;  1Y8R B;  5K7H A;  3LSR A;  3GTG J;  4ZDP A;  1D0Z A;  3GUD A;  3SDB A;  2M87 A;  1SD4 A;  2F6C A;  3BTC A;  2F4I A;  1SD6 A;  1KYW A;  1BJA A;  4CH7 A;  5K5Q A;  2CUZ A;  3CCE I;  1B59 A;  5IP6 A;  4UV8 A;  4LFU A;  1V3F A;  2DW4 A;  3OIO A;  2PFB A;  4HX7 A;  3SEZ A;  1S8N A;  1ULY A;  5HVQ C;  3IKV A;  2DN0 A;  2EIJ H;  1LE8 B;  1A6I A;  1MDM B;  3NAR A;  3RCO A;  5EF6 A;  5ED4 A;  3W3C A;  2DMU A;  2NVY J;  3PM1 A;  2KPM A;  2XUB A;  1O7F A;  3DU6 A;  1TBX A;  3S17 J;  1O57 A;  5DCM A;  3NEU A;  1IUF A;  1IN4 A;  3J7Z I;  2JUG A;  1QRY A;  1ON1 A;  3CCU I;  2MC4 A;  2DOE A;  2ELJ A;  4V2F A;  3H92 A;  4IZZ A;  5JR3 A;  3GWZ A;  2KP6 A;  2O8K A;  5E1Z B;  3G71 I;  3EQL F;  1U5T B;  1X4O A;  1ZH5 A;  1FLI A;  5EZH A;  1TTY A;  1U2W A;  2DA2 A;  2KT0 A;  2BW3 B;  2DO7 A;  2QSF X;  3IUO A;  4XLP F;  1USS A;  5ICF A;  3TP0 A;  2ZFW A;  3ZN0 A;  2DPU A;  2E1N A;  3E1S A;  4OWR B;  1NK3 P;  4BYY A;  1R6R A;  2HYF A;  4KT6 A;  2EIM H;  1VQ8 I;  4ZZD A;  1XGS A;  2VJI A;  1H8A C;  2AXL A;  4CCO A;  3WTV C;  3FXL A;  2VJ5 A;  3S1R J;  4DZJ A;  3W2A A;  1N77 A;  1VQN I;  1LVA A;  4L9N A;  3S15 J;  2M0M A;  3W6J B;  1FMW A;  3MMY B;  1FPQ A;  4HAM A;  1XGO A;  3T8R A;  4A3G J;  3VEP A;  1PUF A;  4HG2 A;  4A3E J;  3ABT A;  3SXY A;  1IV8 A;  3ABL H;  3FK7 A;  2VLA A;  5E3N A;  5FJ8 J;  3BG6 A;  1YRN A;  2HQN A;  2KLO A;  2Y9Y A;  4AIK A;  4HLX A;  3HC7 A;  4OMY A;  3HGG A;  1TWC J;  1OJL A;  4XLE A;  1ZKG A;  1IRX A;  2ZFU A;  5D5V B;  5KCM A;  2ELK A;  2IW5 A;  3MZY A;  2IT0 A;  5HLG A;  1WSU A;  1ETQ A;  4BAC A;  5HS7 A;  1Z9C A;  2RC4 A;  1YLF A;  3MKW B;  4YIF A;  2F5D A;  3HSE A;  1CF7 B;  4UNO A;  5B5E C;  1OKR A;  2KDZ A;  3F8N A;  3G6E I;  1MSE C;  2R7R A;  2FQ3 A;  3FHZ A;  1MBK A;  5FLX Z;  1YHQ I;  1T39 A;  3GEZ A;  2NOJ B;  2XRN A;  1R1U A;  4WX9 A;  3FIS A;  2OU2 A;  3H1C A;  1QA6 A;  2NS8 A;  1ETO A;  1FTT A;  1MBJ A;  5IOY A;  3GTQ J;  3K2Z A;  3MD2 A;  3ULQ B;  3J81 K;  1VQP I;  1T2K A;  1XSX A;  1PJR A;  1SVO A;  1J2X A;  2EA2 A;  3CP2 A;  4M3E A;  5J1R A;  3KYC B;  1DGR M;  4MO7 A;  4I99 C;  3VB2 A;  3JR9 A;  3BTI A;  4X6A J;  4MFE A;  1R5I D;  4G6D A;  2KZV A;  2WB1 A;  1K6Y A;  1ETW A;  3HEF A;  3RQI A;  3OYF A;  2HTS A;  1JTY A;  4QIW N;  4U88 A;  3GTO J;  2X6X A;  3A03 A;  3H35 A;  2XV4 S;  3S93 A;  2LRD A;  3LSG A;  4II2 A;  1F9N A;  2EFN A;  2DYS H;  4CCJ A;  3WTY C;  2WA0 A;  3FX3 A;  4F91 B;  2FEZ A;  1R71 A;  1GV2 A;  1WHU A;  3DPT A;  3SZP A;  2HS5 A;  3C1D A;  1WH7 A;  3U21 A;  3JAM K;  1R58 A;  2MAB A;  1LQ1 A;  1HST A;  1X4P A;  4XKV A;  5C4X J;  1KU3 A;  5C3E J;  4XLF A;  4IEJ A;  1Y1V J;  2QSG X;  2R7W A;  3U1K A;  1YOV B;  3ZQ7 A;  4NB5 A;  2V6C A;  1B1B A;  4FTH A;  2WAF A;  5FKO A;  4CXF A;  2FD5 A;  1V55 H;  4HNV A;  1RPW A;  3OY9 A;  1REP C;  2QEX I;  2W84 A;  1WKM A;  2AO9 A;  1IC8 A;  4P55 A;  3CUQ B;  1BI2 A;  5LBQ A;  3GZN B;  1YW9 A;  4I0B A;  4C9Y A;  2PN6 A;  4B47 A;  5B1B H;  4MEY F;  4FIS A;  1LFU P;  1OYY A;  2DK5 A;  3CJT B;  3F6V A;  1S72 I;  5F27 A;  1BW6 A;  3NWS A;  3VYS B;  4DBR A;  4LK1 F;  3RI4 A;  1MJA A;  1X3U A;  1MMN A;  1FZP B;  4IQJ A;  2Y69 H;  3KE2 A;  1AU7 A;  4BU2 A;  1R49 A;  1T56 A;  4CSW A;  5F64 A;  1MNE A;  1ONV A;  1XMX A;  3OSF A;  4EJW A;  2P5K A;  2R92 J;  3QWL A;  5LRR A;  3CCQ I;  3DP7 A;  4A0X A;  2X48 A;  4U0Y A;  4F92 B;  1B4A A;  3S2D J;  1NTC A;  3H9G A;  3BR1 A;  3BR2 A;  2CMP A;  2JSC A;  2Z99 A;  4WWC A;  1FP1 D;  1T6S A;  3GW2 A;  5KVR A;  2ESN A;  3ZN1 A;  2JT1 A;  1BI1 A;  1X58 A;  5L3G A;  3BJA A;  2COM A;  4IL6 C;  3BCB A;  4C2U A;  1IF1 A;  2LBF B;  1UJ8 A;  2ZXI A;  3CCV I;  4QSH A;  3W2V A;  2R7Q A;  1TW2 A;  1JGG A;  3BCA A;  3CMM A;  2J5O A;  3N4M A;  4A3M J;  1SVM A;  3LA3 A;  3CC2 I;  3TGN A;  3A2K A;  2FA5 A;  2ECB A;  2EIN H;  1K4T A;  3DTK A;  3TOB A;  2FUG 2;  3E6B A;  3EDP A;  2FRH A;  1MIJ A;  4L9V A;  2BZT A;  4CA0 A;  4IHW A;  4KN7 X;  1F43 A;  4PFP A;  2JN6 A;  2FJ1 A;  1BR1 A;  4CGZ A;  3V42 A;  4BE2 A;  4H4K C;  1Z77 A;  4BEH B;  2NS7 A;  1K4S A;  5J1Y A;  2X51 A;  1V5F A;  3NQO A;  1VFC A;  5D8L B;  2L02 A;  4IHS A;  5CQG A;  1ENH A;  1AKH A;  3ZPL A;  1ETK A;  4Y3O A;  2PJP A;  2L01 A;  4KIB A;  5IYB J;  1QZY A;  5HNF A;  3C3W A;  3HIF A;  2HQA A;  2KHM A;  1MKM A;  3V7S A;  5D4R A;  1FBQ A;  5ICC A;  4Y17 A;  2BE5 F;  4M6Y A;  3CD6 I;  4BY1 J;  1W36 D;  2YU9 J;  2XPV A;  3KZY A;  1EH7 A;  3CJR B;  2EZI A;  2H6B A; 
#chains in the Genus database with same CATH homology
 4MFD A;  1TWH J;  2Y9Z A;  4BBR J;  5F08 A;  5EEA A;  4MLO A;  4J19 A;  2MGQ A;  1HDP A;  4M3B A;  2ID6 A;  2EQR A;  3OSG A;  2WAQ N;  3B6A A;  3BR3 A;  2LLK A;  2R5Z A;  2DMN A;  4DYR A;  3WHB A;  1JKO C;  1H88 C;  5EGO A;  1IJW C;  2JWT A;  2HXO A;  4UUS B;  4X1E A;  2G0E A;  3Q0W A;  2AHQ A;  2ECC A;  2R93 J;  5FKK A;  5M3F J;  2M2E A;  2H1K A;  2JK3 A;  3HM5 A;  4A3B J;  3HB9 A;  1GVD A;  5IYC J;  2QCO A;  2CJJ A;  2DA7 A;  2M0C A;  3JRD A;  4A3J J;  2GBY A;  4C3J J;  2HXI A;  4AC0 A;  2R7Z J;  1JTX A;  4BKX A;  3FIW A;  3ZQI A;  3FK6 A;  1U78 A;  2GLO A;  4A3L J;  2LY9 A;  1U9O A;  3HGY A;  5JLX A;  5FKM A;  2Y0S N;  4XRS A;  4AUX A;  3JRE A;  2LFB A;  2R5Y B;  5F0H A;  3ZQL A;  1B8I A;  3JRI A;  3HOX J;  2NVX J;  4UUT A;  1JJ6 C;  1I6H J;  1RKW A;  4IHY A;  5M5X J;  1TWF J;  1MH4 A;  2Y31 A;  3CCY A;  1LE8 A;  3H3V K;  1F36 A;  5M5Y J;  3VPR A;  2JA8 J;  2MG4 A;  5JLW A;  2E19 A;  3A01 B;  1ORK A;  3DCF A;  3TED A;  3RZD J;  3I4N J;  3S2H J;  1IGN A;  3BQY A;  1T33 A;  1X2M A;  5EYR A;  2OF7 A;  2O9L A;  1BL0 A;  1XC5 A;  2M9H A;  1JT0 A;  1IV6 A;  1JUP A;  1QVT A;  3W6V A;  4FE4 A;  4A3K J;  4XID A;  4A3C J;  1UMQ A;  1X2N A;  4DZP A;  1BW5 A;  3A01 A;  1P7J A;  3ZQH A;  2HYJ A;  5GPA A;  2K9S A;  1POG A;  2EZL A;  3HOW J;  1I3Q J;  1AKH B;  2ME6 A;  1JUM A;  2DMP A;  3QPL A;  4A3I J;  2HOS A;  3M4O J;  2XRL A;  4A69 C;  2XGC A;  4I6Z A;  2COB A;  3G1L A;  1IG7 A;  5HOD A;  3G1M A;  2ID3 A;  4C3I J;  3K2A A;  2DA6 A;  2MSY A;  3HOV J;  1IRZ A;  1B72 B;  2CQQ A;  1XG1 A;  3MKL A;  4BXX J;  4CYC B;  1WI3 A;  3GTM J;  2LTP A;  3BG3 A;  1ITY A;  1ZR2 A;  3S14 J;  5F0C A;  4JX6 A;  1Z0X A;  2DJN A;  2WV1 A;  3NAU A;  4V2G A;  5DTD A;  2DMQ A;  1ZR4 A;  1O4X A;  2W48 A;  4XK4 A;  2VUM J;  3CDL A;  5M3M J;  2JA7 J;  1HCR A;  5F0F A;  3GTJ J;  4S0H B;  1DU6 A;  3JRB A;  1WGX A;  3WHC A;  2R5Z B;  4BBS J;  3SJM A;  2CUF A;  3SDG A;  3HDD A;  1TWG J;  3JRF A;  5FLV A;  3JRC A;  4DYC A;  5EGO B;  1GDT A;  4NDL A;  3FKI J;  3SFI A;  5F04 A;  2XGD A;  2VI6 A;  2HDD A;  1ZQ3 P;  3LOC A;  1SFO J;  3I4M J;  1MSF C;  1JT6 A;  2HOT A;  1APL C;  2YS9 A;  5C44 J;  2DTZ A;  2NVT J;  1ZTR A;  3JRG A;  4B4C A;  1JKP C;  4JX4 A;  3BR6 A;  1ETX A;  4Y7N J;  2O7O A;  1WH5 A;  4XRM A;  3LSR A;  5K7H A;  3GTG J;  2R0Q C;  3ZQG A;  4L5E A;  1I50 J;  4B3A A;  4RBO A;  3BTC A;  1BA5 A;  1B8I B;  3JRA A;  3OOU A;  5IP6 A;  2JMW A;  3OIO A;  2B63 J;  2IEK A;  1HF0 A;  2DN0 A;  2P81 A;  1LE8 B;  1A6I A;  2JJ7 A;  3NAR A;  5EF6 A;  2DMU A;  2NVY J;  3PM1 A;  3S17 J;  3GTP J;  1VND A;  1IUF A;  2CU7 A;  1GV5 A;  5E3L A;  3LNQ A;  1QRY A;  1R9T J;  4V2F A;  1FIP A;  4JX5 A;  2O8K A;  4D5C A;  3PO3 J;  2M34 A;  2ZB9 A;  5EZH A;  2KT0 A;  2DA2 A;  1OCT C;  4XRS G;  3JRH A;  3TP0 A;  3D1N I;  1NK3 P;  3E7L A;  3QQA A;  1W0T A;  2EBI A;  5EG0 A;  3GTK J;  4C2M J;  1RET A;  2XSD C;  1P7I A;  3S16 J;  4BY7 J;  2LKX A;  1NK2 P;  1H8A C;  1K61 A;  1MBH A;  5IOZ A;  5BNG A;  2MW8 A;  3S1R J;  2H8R A;  1GT0 C;  3BQZ A;  4I76 A;  4DZJ A;  5F1J A;  3S15 J;  2Y2Z A;  3A02 A;  4M3F A;  1XS9 A;  4A3G J;  3L1P A;  1PUF A;  2E2J J;  2YUS A;  4A3E J;  4M3D A;  3O8G A;  3FK7 A;  2L7F P;  1OFC X;  4B1R A;  4D5F A;  5E3N A;  3H0G J;  5FJ8 J;  1YRN A;  2NOG A;  2Y9Y A;  3ZQF A;  3LSP A;  1WCM J;  3HOZ J;  3G1O A;  3HGG A;  1TWC J;  1OJL A;  2XPW A;  3M3Y J;  1ZKG A;  2DMT A;  2LP0 A;  1AHD P;  2JA6 J;  2ELK A;  1ETQ A;  3IV5 A;  5IYD J;  3IH4 A;  4RDU A;  2CQX A;  2VPR A;  2KDZ A;  5J3L A;  3MVP A;  1MSE C;  9ANT A;  3CMY A;  3Q0V A;  2CUE A;  1MBK A;  4MIM A;  4DW6 A;  1MNM C;  4FCY A;  1JKQ C;  3HKZ N;  3FIS A;  2NS8 A;  1ETO A;  1U8B A;  1FTT A;  1MBJ A;  5IOY A;  3GTQ J;  5EZG A;  2IBD A;  4W1U A;  2DA3 A;  3TW7 A;  3LSJ A;  4M3G A;  4M3E A;  5J1R A;  4MO7 A;  3K7A J;  3JR9 A;  2FX0 A;  1Q1V A;  3BTI A;  4X6A J;  4MFE A;  4EEF G;  2L7Z A;  1TC3 C;  1ETW A;  3HEF A;  3RQI A;  1U9N A;  1JTY A;  4QIW N;  3Q3S A;  3GTO J;  3A03 A;  2QF7 A;  3LSG A;  3ZQC A;  1WPK A;  2RAE A;  3Q0U A;  4A93 J;  1GV2 A;  2E1O A;  3MN2 A;  1W0U A;  1WH7 A;  4D7M A;  4M6V A;  1MH3 A;  5C4X J;  2HI3 A;  1TWA J;  2L9R A;  1DU0 A;  1JUS A;  5C3E J;  3O8H A;  1IDY A;  1Y1V J;  4IEJ A;  3BT9 A;  4LOC A;  2TCT A;  4QTR A;  3B6C A;  1MBF A;  1UG2 A;  4FTH A;  3F0C A;  5FKO A;  2FD5 A;  1QPI A;  4HNV A;  1RPW A;  1CQT A;  3RZO J;  2XB0 X;  1ETV A;  4DYQ A;  2E2H J;  3UKG A;  2M8G X;  1LFB A;  2AO9 A;  1H89 C;  1IC8 A;  1RES A;  3TW6 A;  3BTJ A;  1OCP A;  2EZK A;  2OPT A;  2VKE A;  3BR5 A;  2EZH A;  1G2H A;  1IDZ A;  1RR7 A;  5EG0 B;  3HOU J;  5E3M A;  1RKT A;  2ME0 A;  4FIS A;  1LFU P;  2TRT A;  5F27 A;  1BW6 A;  2XGE A;  4UUS A;  2LD5 A;  2PMZ N;  2DA5 A;  4G12 A;  1AU7 A;  1T56 A;  4A3D J;  2K40 A;  1VF9 A;  5GPC A;  3OSF A;  4W97 A;  2X9D A;  2L7M P;  1Y1W J;  2R92 J;  1JJ8 C;  5IPA A;  1PUF B;  1EF4 A;  5DS9 A;  2LVS A;  1HLV A;  1VI0 A;  3BG9 A;  2X48 A;  2FQ4 A;  4A3F J;  1ETY A;  5GP9 A;  3S2D J;  1NTC A;  2K9N A;  2LK2 A;  3BR2 A;  1S7E A;  3BR1 A;  1YRN B;  3GBG A;  2CRG A;  3BTL A;  4Y52 J;  3PO2 J;  1X58 A;  2NVQ J;  2R5Y A;  4ABZ A;  5IP7 J;  5FLM J;  2GM4 A;  1D5Y A;  2X6O A;  1HDD C;  3S1M J;  1HOM A;  5K7F A;  3QPS A;  4QSH A;  3S1N J;  3HBL A;  5C4J J;  1JGG A;  5K7Z A;  1UHS A;  1SAN A;  2IAI A;  4IHX A;  4A3M J;  1QVU A;  5E3O A;  5FKN A;  1ZGW A;  3DEW A;  2E2I J;  2K9Q A;  2JA5 J;  2ECB A;  4FE7 A;  3ZOB A;  5FKL A;  4AYB N;  3BR0 A;  2VKV A;  3RKQ A;  3CQZ J;  4GFB A;  1GUU A;  2DA1 A;  4IHV A;  4IHW A;  2I10 A;  2XB5 A;  2L0K A;  2N8G A;  3HOY J;  1F43 A;  1K83 J;  3S1Q J;  2JN6 A;  2FJ1 A;  1ZK8 A;  1MBE A;  1FEX A;  3TP3 A;  1Z77 A;  1JKR C;  2NS7 A;  1FTZ A;  5J1Y A;  1VFC A;  1E3O C;  2XPU A;  1A5J A;  1MBG A;  1ENH A;  2Y30 A;  3IH3 A;  2LR8 A;  1AKH A;  4JP0 A;  1ETK A;  3C2B A;  3IH2 A;  5IP9 J;  2HQ5 A;  5IYB J;  2DA4 A;  2D5V A;  2EH3 A;  5EDN A;  1FJL A;  3GTL J;  4D7N A;  5M5W J;  4JYK A;  4XIC A;  1B72 A;  4BY1 J;  2WB1 N;  5J1U A;  4C3H J;  2YU9 J;  3BG5 A;  4CYC A;  2XPV A;  1BJZ A;  1FIA A;  2HOA A;  2EZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...