4QIWN

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLLSHVELIDQVMVYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 63
sequence length 63
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4qiwN00
1IJWC 3BG3A 3A02A 3BR1A 4XRMA 3S17J 3JRAA 2Y9ZA 4FCYA 2I10A 1BW5A 5HODA 2AHQA 3BR3A 2XPUA 5K7FA 2XB0X 5EZHA 1E3OC 1UHSA 4JX4A 4FISA 1RESA 1LE8A 3GTGJ 5M3MJ 1MBJA 3E7LA 4DYQA 3FIWA 2R7ZJ 1MBFA 1Y1VJ 1WCMJ 3GTJJ 4M3BA 4EEFG 4D5CA 4BXXJ 3G1LA 2HI3A 3LSJA 9ANTA 3S15J 1TWCJ 3JRHA 1JKRC 3IH3A 1RR7A 1SFOJ 2OF7A 3F0CA 3O8GA 2MGQA 2RAEA 3BG9A 3TW7A 5GP9A 3IV5A 5IP6A 2XB5A 4BY1J 1ZR4A 2VUMJ 4FE4A 2PMZN 2EZKA 1JJ6C 4BBSJ 4AC0A 2WB1N 1IRZA 5EYRA 4JX6A 1NTCA 1Q1VA 3CDLA 5F27A 2M8GX 1U8BA 1MBEA 1FTTA 3L1PA 2B63J 4HNVA 1GDTA 1FTZA 2LLKA 1MNMC 3HM5A 1B8IB 2HDDA 3D1NI 5F0FA 4RBOA 2CUFA 3DCFA 2LTPA 4M3FA 4A3JJ 3JR9A 2HOTA 2DMNA 1ZQ3P 2XSDC 2JMWA 2XPWA 1JTXA 1OJLA 2KT0A 4A3KJ 2FQ4A 2QF7A 2HOSA 3ZQFA 4UUSB 1P7JA 1X58A 4FTHA 5IP7J 2L0KA 3JRDA 2R5ZB 4X6AJ 3OIOA 2K9QA 1HDPA 5FKKA 2L9RA 3GTQJ 2XPVA 1JUSA 2FD5A 3LSPA 1B8IA 5E3NA 2HXOA 2LK2A 3QQAA 3SDGA 2EBIA 5IYCJ 2EQRA 2XRLA 4UUTA 3JRGA 2W48A 3QPLA 1ITYA 3G1MA 1Z0XA 2JA6J 3A01B 1ENHA 2DN0A 3GBGA 3CQZJ 1QPIA 5E3MA 4UUSA 5IOYA 3IH4A 1VNDA 4W1UA 5EDNA 1W0UA 3C2BA 3S1QJ 1Y1WJ 3HOYJ 4IHYA 5F0HA 2CJJA 2CU7A 1G2HA 4QTRA 1MH4A 1AU7A 5FJ8J 4D7NA 2DA1A 1W0TA 1U9NA 1WI3A 2GBYA 1RKWA 2L7FP 1TC3C 5M3FJ 4Y52J 1BA5A 2JN6A 4LOCA 5IYDJ 3A01A 3TP3A 1IGNA 3FK6A 5GPCA 3K2AA 5EGOA 4A3FJ 1P7IA 4A3BJ 1JGGA 5K7HA 1ETYA 4IHXA 2D5VA 1AHDP 3GTKJ 4J19A 1QRYA 2L7MP 2NS8A 2X48A 4B3AA 3Q0WA 2LVSA 3BT9A 2MG4A 5EG0A 3MKLA 3ZQCA 4M6VA 3JRFA 1S7EA 5EEAA 2DMTA 4BY7J 3HGYA 5IP9J 3HOZJ 1HDDC 3S16J 1MBHA 1BL0A 5JLWA 3HOVJ 1T56A 3VPRA 3ZQLA 2COBA 4NDLA 2IBDA 1OCPA 2DA4A 2R92J 4AUXA 2E2IJ 2NVXJ 3TW6A 3RKQA 4M3EA 2Y2ZA 3BQYA 4A3IJ 2Y0SN 2ECCA 2JJ7A 3S14J 3NAUA 3S2DJ 1QVTA 1ZGWA 4XK4A 4BKXA 2TCTA 3Q3SA 4ABZA 2R0QC 4CYCB 1GUUA 4G12A 3LSGA 5E3LA 3S1MJ 3DEWA 5GPAA 2ME0A 2JWTA 1HOMA 3JRIA 2M2EA 3BQZA 2JA7J 2CQQA 4A3LJ 4B1RA 1MBGA 2O9LA 2JK3A 3BTIA 3LSRA 1RKTA 2HXIA 2FX0A 2VKVA 1HF0A 1ETKA 4AYBN 2HQ5A 2VKEA 3HOWJ 2R5YA 3MVPA 2M0CA 1F36A 2M9HA 3SFIA 1GV5A 2E1OA 1OCTC 5IPAA 4CYCA 1UMQA 1O4XA 3GTMJ 5C44J 1UG2A 4A3MJ 2IEKA 4Y7NJ 4A93J 4IHWA 3CMYA 1WPKA 3A03A 4W97A 1JTYA 3HOXJ 1K83J 2E19A 1H89C 4IHVA 2CRGA 2HOAA 1ZTRA 2EZHA 2DA2A 4A69C 1IUFA 1Z77A 2ECBA 2X9DA 1XS9A 1ORKA 3W6VA 5F0CA 1IV6A 5M5YJ 3ZQHA 4D5FA 2ID6A 2HYJA 2DMQA 5FKNA 2M34A 5EGOB 3NARA 4V2GA 3JRCA 3FK7A 2TRTA 2XGCA 2DMUA 1NK2P 5DS9A 2YU9J 1TWHJ 5F1JA 1JKQC 3PO2J 2XGDA 1HLVA 3Q0VA 1LFUP 3PM1A 2DMPA 1YRNA 4M3GA 2ZB9A 1K61A 2YS9A 1DU0A 5EG0B 3H0GJ 5FKLA 4MFDA 3HKZN 1DU6A 1BW6A 3JRBA 2WV1A 1B72A 2N8GA 1EF4A 2Y31A 1ETXA 1MSEC 2H8RA 2ID3A 1WH7A 4B4CA 2K9NA 3BR0A 3OOUA 2VI6A 2LFBA 4MLOA 4L5EA 1A6IA 1TWAJ 1APLC 1NK3P 3PO3J 3OSGA 4M3DA 3WHCA 1ZK8A 1U78A 5E3OA 4QIWN 2H1KA 3I4MJ 4A3DJ 1OFCX 2DA7A 2MW8A 3BR2A 3ZOBA 5FKOA 4FE7A 4C2MJ 1PUFB 1F43A 5C3EJ 3S2HJ 4GFBA 1FIAA 3BTLA 5F08A 1AKHB 1TWGJ 1TWFJ 1VFCA 2ELKA 2CQXA 5F04A 1GVDA 2NS7A 1XC5A 2K9SA 2GLOA 4A3CJ 3G1OA 2E2JJ 3K7AJ 1WGXA 5J1YA 2GM4A 3HB9A 2XGEA 1I6HJ 1PUFA 2R5YB 2DA5A 4I76A 5M5WJ 1BJZA 2QCOA 1FEXA 3BR5A 3CCYA 3S1RJ 4A3EJ 3TP0A 1AKHA 2DA3A 1POGA 3I4NJ 1IDZA 4IEJA 2Y30A 5C4XJ 4V2FA 3HGGA 1U9OA 2X6OA 3MN2A 5FLVA 2R93J 5JLXA 1MH3A 3QPSA 3HOUJ 3LNQA 2OPTA 1A5JA 4XRSG 1MBKA 4I6ZA 4JP0A 1VF9A 1I3QJ 2NVTJ 4XICA 2E2HJ 4DZJA 2O8KA 2IAIA 1ZKGA 2LR8A 1D5YA 4C3HJ 1GV2A 1X2NA 5EF6A 1T33A 1I50J 2Y9YA 4D7MA 3RQIA 3M3YJ 2LY9A 3IH2A 2JA8J 3HDDA 1JT0A 5FLMJ 2CUEA 5M5XJ 3BTJA 3WHBA 4JYKA 3GTPJ 1SANA 4MIMA 4DW6A 2O7OA 3BG5A 2K40A 4MFEA 1YRNB 1ETVA 3GTOJ 2NOGA 1JUPA 3HEFA 4C3JJ 4S0HB 3H3VK 2EH3A 5IOZA 4XRSA 2DTZA 2P81A 3ZQGA 5EZGA 1B72B 1JKOC 5FKMA 2VPRA 2DA6A 1R9TJ 2MSYA 2JA5J 1H88C 4A3GJ 2EZLA 1H8AC 5C4JJ 1JUMA 3FKIJ 2EZIA 2ME6A 4BBRJ 3RZOJ 1XG1A 3HBLA 2L7ZA 2AO9A 3BR6A 1ETQA 1IC8A 2FJ1A 4DZPA 2LKXA 4JX5A 1MSFC 1X2MA 1LFBA 1ZR2A 2LD5A 2YUSA 1RPWA 3UKGA 1FJLA 5IYBJ 1ETOA 3B6AA 2NVQJ 5J1RA 2NVYJ 2DJNA 3BTCA 1CQTA 1VI0A 2G0EA 1QVUA 2R5ZA 1RETA 3Q0UA 1HCRA 3M4OJ 2KDZA 3SJMA 2WAQN 5J1UA 5BNGA 3TEDA 1GT0C 4C3IJ 1JT6A 4X1EA 4MO7A 5J3LA 5DTDA 4RDUA 1FIPA 3B6CA 1JKPC 4DYCA 3LOCA 1LE8B 2LP0A 1JJ8C 3RZDJ 3JREA 1IG7A 1WH5A 3O8HA 3FISA 1ETWA 4DYRA 4XIDA 3ZQIA 5K7ZA 3OSFA 3S1NJ 3GTLJ 1IDYA 4QSHA
chains in the Genus database with same CATH superfamily
4A0XA 3CC4I 1S3JA 1KQ8A 3ABLH 5AIPA 3S17J 5A2QZ 2OCCH 3VYTB 3KX2A 2E36A 4Y17A 1LB2A 1UHSA 3QOPA 4BQNA 3ZP5A 2MBFA 1FX7A 4GYIA 4DYQA 2WY8Q 3FIWA 1MBFA 1Y1VJ 1TTYA 4RLQA 4E7HA 4LIUA 5HDKA 1ZARA 2M0MA 4E7SA 2HI3A 3LSJA 1ERDA 2HTSA 1TWCJ 2WC2A 2ISZA 3FXOA 1IXRC 2OF7A 1BIBA 2MC3A 3H1CA 2GA1A 4BL0B 4A5MA 2OU2A 1X19A 2MH9A 2H27A 2MGQA 1S7AA 2CMPA 2RAEA 3IV5A 3TDUC 4N4OB 4LB6B 1X1CA 3P9CA 3FXMA 1KU9A 3QYEA 4F52A 4RB3C 2XAHA 3EYIA 1WFXA 1SEUA 2HR3A 1TQMA 3GVAA 4ITVA 1TT5B 1CF7B 3QU6A 3Q9SA 3F3XA 4XLNF 5F27A 1L0OC 1FMWA 3A0BC 3OR1C 3QYBA 3H9QA 1MBEA 1RZ4A 3HRMA 1FTTA 3ABMH 4UV9A 2CS3A 3G4SI 3E6BA 1MNMC 3HM5A 2IGNA 1SMTA 1W5TA 3KP4A 4A3JJ 3JR9A 1S5LC 3HPHA 1K6OA 1JTXA 1OJLA 5ED4A 1FMVA 3ZXSA 4A3KJ 3GXOA 3HIFA 2HOSA 1W36D 4XBFA 3ZQFA 4ETSA 4FETA 1UFMA 1B59A 2PBIA 3OIQA 5IP7J 3DP7A 4X6AJ 4RAFA 3OIOA 1IRGA 1HDPA 3QODA 1N77A 2E5ZA 2XPVA 4M73A 2XROA 1MDMB 4ZDOA 3IAM2 2D2WA 4XLPF 1QO0D 4U0VA 2OA4A 3K0LA 4G6TB 2R3SA 2Y69H 1VZ0A 2VBZA 2LRDA 4IX7A 3QPTA 3DLLF 3FM5A 2DW4A 1R71A 2EQRA 3M1CA 5ILVA 1SMYF 3QPLA 1DGRM 1O7FA 4I99C 4AVZA 2PMHA 3OS2A 4WXCA 4G94A 3A01B 1ENHA 5DV5A 4OMZA 1R7JA 2RNJA 3IH4A 4W1UA 1SFXA 1XMAA 3C2BA 2MD0A 3I56I 1BI1A 2DAOA 5F0HA 2OQRA 4KIGA 1HA8A 2Z3YA 3OL4A 4KMUX 2KPMA 4QTRA 1AU7A 1R36A 2LC2A 4E4HA 3ABTA 1D8KA 1ODDA 3E6DA 2IRFG 2FU4A 4I7HA 3AG2H 3COAC 1RKWA 2E5NA 5K5QA 1KA8A 2CH0A 2JN6A 3J80K 3H5RA 2BEOA 2DYRH 2ZSHB 3I71A 3MCZA 3OY9A 3A01A 3TP3A 2I8DA 4OWRB 4EV0A 2X1DA 3K2AA 2OUMA 5GPCA 1P7IA 2K9LA 4E7KA 3CUQC 2ZXJA 2QVOA 3N4MA 4CZZA 1JGGA 1FOKA 1ETYA 4IHXA 3RSNA 3VYSB 3Q0WA 5CVJA 4CXFA 1J7KA 3DBRB 3J81K 1P4XA 1YX5A 2VPLA 1OMIA 4E7ZA 4M6VA 2B9SA 5LEJA 2I5UA 4LK1F 2F48A 4BS9A 1Y0UA 5IP9J 3V42A 1OYWA 2IA2A 4KIBA 3SXYA 1BL0A 3I59A 5JHFA 3HPGA 1MNDA 3HOVJ 3TGNA 4RGXA 4LG3A 4GDFA 5K5RA 3K4LA 2XRNA 3VPRA 2E1MC 4ESBA 1FNNA 3PFYA 2COBA 2DQRA 3VFZA 1H9TA 4F55A 5HS8A 2W00A 2DA4A 3L2VA 1MMDA 4BDZA 2LBFA 1D0ZA 2F5EA 4EGYA 1A04A 3RKQA 4A3IJ 2OCEA 3BQYA 4A12A 1D0YA 5JFRA 4OIQF 5L3FA 2ESNA 2V1XA 2JJ7A 1LFPA 3S2DJ 2JSCA 3Q3SA 2PG4A 2EIKH 3IWZA 4G12A 4KN4X 1S6LA 3LSGA 2R7XA 4CICA 5GPAA 3W3CA 2ME0A 4Y13A 2M2EA 2V4JC 4F91B 1EJ9A 1FOYA 2VL8A 5J47A 5CVVA 3JSOA 1FLIA 2XHKA 4HA8A 1OPCA 4IJAA 4NUBA 3BTIA 3ERED 1P4WA 3KIOA 1HF0A 1FBSA 1D1CA 2VKEA 3BCAA 2LYCA 3I0TA 4CCKA 3KZZA 3MVPA 3VSKA 1GV5A 2E1OA 2W25A 3EQLF 4BU2A 1R1TA 1GXQA 2A61A 4B09A 4H0EA 3K10A 3TOAA 3U1DA 2Q8KA 2Z5UA 1O3QA 3CJQB 2YX7A 4MQVA 3GO5A 1K83J 3GZNB 3LFUA 3WGHA 4YFKF 1VQMI 1ZTRA 1V5FA 2DK5A 2PN6A 4MQ9F 1Z77A 3E0JB 4S04A 2ECBA 1Z7UA 3BLYA 4PSWA 5EJCA 3WGGA 1MD0A 2VJ4A 1ZGAA 3KE2A 5J4YA 2DMQA 3KYDB 4BUPA 1FYLA 2JA2A 4P9UA 4CCMA 2B0LA 3DV8A 1OCRH 2M34A 3BPXA 3ROUA 3JRCA 2IGMA 4XKWA 2EFOA 5DS9A 2VXDA 2YU9J 3CMEI 5F1JA 3ABKH 2IW5A 3LA7A 2MLKA 2E1CA 1IW7F 3D5RC 3R4KA 1S9HA 3G71I 1BI3A 1O57A 2YS9A 5FLXZ 2QLZA 2M30A 2NXNB 5H6QA 3S93A 3U2RA 1R4NB 4EJOA 3I55I 3FBNB 3JRBA 4J01A 3EETA 2Y31A 4LITA 1D3YA 1ETXA 5HDNA 2IS4A 4L9VA 2VOPA 1WH7A 1ZG1A 1F5TA 2BHYA 3L00A 4M9SA 1T0FC 3FX3A 3FXKA 3K69A 3ZRGA 2FQ3A 4L5EA 1HW5A 4EM0B 4XM3A 1L3LA 1APLC 2E35A 3QP5A 4QIWN 3HUGB 4U87A 1KZHA 2H1KA 2DA7A 2HZTA 4XN3A 3ZOBA 4FE7A 1R1UA 1HXDA 3S2HJ 3I64A 5KHDA 2E34A 2L4MA 3CTAA 4II3A 1IAWA 2L9VA 5KK1A 2ELKA 3OYNA 2A68F 3GWZA 1PJRA 2K9SA 2FNPA 2KMUA 4P5OA 2RC4A 5D4SA 1OKRA 3GMEA 5J1YA 1T38A 3AL0B 3BDDA 2K4JA 1YS7A 2WB1A 4I0BA 2VJIA 2FOKA 3K4MA 5EEGA 4F92B 3V4GA 5M5WJ 3UNGC 1BJZA 2DDBA 1HQCA 1SFEA 1K7AA 3CCYA 3S1RJ 3KZIC 2LF8A 4ENNA 4U88A 4YEJA 1WJFA 1XSVA 2L4AA 1HW1A 3V8KA 3TMOA 4Y15A 3CF5F 5BOXA 3HGGA 4RGUA 3JTGA 2FMYA 2R93J 5JLXA 1MH3A 2V9VA 1B9NA 1WJBA 4B47A 3CDHA 3PQJA 2OPTA 3CCSI 1A5JA 3L9FA 5D4RA 3V7SA 1ZHFA 1A36A 4JP0A 2L9NA 4A6EA 4WX9A 2LNBA 2WY7Q 4AM3A 1ZAOA 3C7JA 5CYVA 5JVGF 2F5FA 2IAIA 2Z33A 2IS6A 2LR8A 1W5SA 3FXLA 3BJ6A 1FC3A 2CV2A 3FXUA 2VJJA 4D7MA 3RQIA 4ENMA 1NHAA 2LY9A 5TRDA 3HDDA 2CUEA 2WAEA 5M5XJ 3BTJA 2FOWA 3GTPJ 2ADUA 5GTIC 4IXAA 3IRQA 2ISYA 3E6MA 5TGTA 4GO1A 1YLFA 2K40A 4MFEA 1YRNB 3DKXA 4OMYA 3HEFA 1UJ8A 2F5DA 1YX3A 5FB2A 2EH3A 2V6EA 3ZQGA 2DPDA 3ZMZA 1ON1A 3LFKA 5FKMA 2VPRA 3L2QA 1T08B 1IRXA 2O0YA 3RDIA 2HPIA 1I39A 3IAS2 1D0XA 5C4JJ 2ME6A 1VQ6I 2H8WA 2FMLA 1PYVA 1XCBA 3F6OA 3CCLI 2NOJB 2XIGA 5ICGA 3HBLA 1HSJA 2Y0MA 3RKYA 2LKXA 2MFZA 1LFBA 2JVHA 2ZMEA 4AIJA 1KQ9A 3D0SA 3NEUA 1V54H 4DNCA 4KA4A 2DXIA 1IRFA 2V1DA 2BXZA 5IYBJ 5D6FA 2NVYJ 3OYCA 3WE2A 1VI0A 1OISA 3KFWX 3WU0A 1QVUA 4I09A 1RETA 5L3EA 4L5IA 2WAQN 3JSPA 2KZGA 4Z2YA 4C3IJ 4OU0A 1YJ9I 1T6SA 2X4HA 5DTDA 1TNSA 3D5LA 3HSRA 2FXAA 2W4SA 3WTUC 1UG0A 1A31A 4HG2A 2BOLA 1ZELA 3KEQA 3HRUA 1QZEA 2RNGA 4LGWA 3FISA 4AIKA 3U1KA 1K4SA 4HDUA 3ZQIA 1WZ2A 1XN7A 3EYYA 4HPQA 1R5ID 3HHGA 4RMNA 2KL4A 1OLTA 2LH9A 2WTEA 1VQLI 2NRAC 3L2CA 3TL4X 2UUZA 5HDGA 1P9QC 3K4CA 3JRAA 5BPIA 4E6KG 3DLAA 2EB7A 4YIIA 2OTLI 1FBUA 3QP6A 3WU2C 2I10A 4P96A 3BCBA 1TQIA 5K7FA 1E3OC 1G3TA 3J80Z 3L2RA 1ON2A 4ZYAA 2EJRA 4M71A 5HVQC 2LY1A 5DM7F 3K4NA 5J8CA 4M3BA 3QYFA 4BXXJ 2DFIA 3G1LA 4ENKA 2CW8A 9ANTA 2M45A 3JRHA 2W1OA 3C2HA 4I2OA 1K78B 3DKWA 1RR7A 3H5AA 3LA3A 1SFOJ 3J81Z 1ZH5A 2O8XA 3CLQA 3F0CA 3ASNH 4N0BA 4LD5A 5GP9A 2HVQA 5DCMA 3J7ZI 3PQKA 3FBIB 2V9KA 2ZJPF 4LLLA 2EZKA 1JJ6C 4BBSJ 3EPZA 1WRJA 1F1ZA 2WB1N 5CVRA 1IRZA 2GOMA 3HG9A 5ICCA 5B1AH 1YJWI 2CW7A 4UB6C 5EYRA 1SAXA 5L3GA 4UVAA 3H5NA 2X51A 4MHGA 1DPUA 2LREA 1K78A 3M8JA 1Z05A 3L1PA 4HYEA 2GXAA 3W6KB 1RNLA 1FTZA 4HX8A 2K4BA 2R7WA 2PFBA 2HDDA 2QGUA 1Y56A 4M3FA 2HOTA 1ZQ3P 1A6QA 4HV6A 2X85A 2XPWA 4LB5A 3LQRA 2DLLA 1W7PB 5H6RA 1WQ2A 1P7JA 4UUSB 1MJBA 1VQ5I 2L0KA 5LRRA 4F93B 3JRDA 4IRIA 3CDIA 2K9QA 2ZXIA 4B43A 4M9XA 4WCGA 3PIPF 3GZ6A 1QHGA 4I98B 2HGCA 1G6NA 2TDXA 2IP2A 2KHMA 5E3NA 1ZG5A 3RPUD 2LK2A 2NNYA 3ERMA 2O3FA 4UUTA 1B9MA 1FBQA 2W48A 4OAYA 1Z0XA 4RAGA 4BYYA 3K70C 3FHZA 2DN0A 1G3WA 3CQZJ 3DBHB 3T8RA 4UUSA 5IOYA 4PFOA 2CFXA 1VNDA 4II2A 1W0UA 4QWQA 4UV8A 1Y1WJ 2OD5A 2ZBKA 3HOYJ 3O2PE 4M6XA 1J09A 2A6EF 3F8FA 4CGZA 1QGPA 1V5EA 2BBYA 3E6CC 3KLOA 3CJTB 2P5KA 3E5XA 5FJ8J 2DA1A 1FT9A 2QSHX 4XR6A 2KFDA 1U9NA 4C2UA 3I54A 3MFKA 3K1NA 3FF5A 4LLGF 1UZCA 3ZPLA 2PEXA 4XORA 2GXBA 3P5JA 2RKHA 4LJZF 3OYFA 3HSEA 2AXTC 5FROA 3OYKA 5EGOA 1E2XA 2GOXB 2HYGD 2KQRA 3WTVC 1HKQA 2L02A 3CCVI 4KT5C 4DBQA 5HLHA 4XLFA 1QRYA 2NS8A 4B3AA 4A0ZA 1E3HA 3CMAI 4IOAF 2FBIA 2QQ8A 3JRFA 1S7EA 5EEAA 2DMTA 3DTEA 2R7SA 2IPQX 1R49A 4UHTA 2KDOA 4A2UA 4LFUA 3MKZA 4J00A 1MBHA 1WI9A 4PDKA 5JLWA 3HTUA 3CO7C 3ZQLA 3LSKA 2VLAA 1OCPA 2VT3A 4AUXA 3FXQA 3HRSA 3LA2A 3LAPA 4PCQA 1BC7C 5LHGA 2PMZA 1JHHA 3TW6A 1MMGA 5DEQA 3W2VA 1IF1A 4L18B 4M3EA 2FSWA 2Y0SN 3HTSB 3NWTA 3NAUA 3W2WA 1GHCA 1X1AA 2OQGA 4BKXA 5E17F 1AOYA 3MZHA 1Z3YA 1D5VA 2CG4A 1GUUA 1PVEA 3GYHX 1W5CC 3PNYA 3HZJA 3DEWA 3QAHA 1R22A 2JWTA 4AIDA 4HLYA 2FRHA 3BQZA 2CQQA 1WWXA 2HOEA 3BZ6A 4A3LJ 2VQGA 3LSTA 2G7UA 2DFFA 4M9ZA 3RYPA 2V26A 4IRGA 2IS2A 4HF0A 1RKTA 1I27A 2HXIA 1ZREA 2STWA 3Q9VA 4AYBN 1YW8A 3DF8A 3O3KA 4PK4A 2F5VA 2R5YA 3BZKA 1KGSA 3V7CA 4E70A 3DBLB 1F36A 1TLHB 3KZYA 2IT0A 3G6EI 2EV6A 3AG3H 3GTMJ 3RYRA 2HVRA 4Y7NJ 1YE9A 3I9V2 4BAYA 4A93J 4IHWA 2QZ8A 5K5OA 3BZCA 4W97A 2E19A 1H89C 4OAZA 2PI0A 2A5WA 2ICWG 4A69C 2IGKA 1RC9A 2X9DA 1SD5A 1ORKA 5M5YJ 3PNTA 2JT1A 3ZQHA 3RKWA 1FP2A 1ZG3A 3WGIA 1DQUA 1O3RA 2E7WA 4N4NB 2VKDA 4M74A 2V6CA 2HEOA 2VJ5A 2DMUA 5DD4A 1RUNA 1EH7A 1TWHJ 3PUFA 1J0RA 1JKQC 1XPXA 1O7LA 4N9HA 2DBBA 1LFUP 3TQNA 1MMAA 4K2EA 1BR1A 2GIZA 2DMPA 1FPQA 2FUG2 4HX7A 3AG4H 2M5WA 1K61A 2HPMA 4LMYA 2YSRA 4MFDA 3HKZN 4DJAA 1TQPA 1B72A 2N8GA 1Q1HA 3ZN1A 5FRMA 3MZYA 1J2XA 4FHTA 3I59B 5F1RA 3OOUA 2EFWA 4ZZDA 1M1EB 3I4PA 1NG6A 1SVMA 4GCVA 3PO3J 4CA0A 3OSGA 2VE8A 5E1WA 4CH7A 2F4OB 2BGCA 3IHUA 3FZVA 1XTAA 2DT5A 3ZN0A 2LBFB 2P0WA 3I4MJ 1OFCX 1ZN2A 2MW8A 2MYSA 3BR2A 2AS5F 3C18A 5FKOA 2FBHA 5C3EJ 2QQBA 2DODA 2VBWA 1JE8A 3ULQB 3H3UA 4ASNA 3WTTC 1X3WB 1R6RA 1TWGJ 1P6RA 2M4GA 4Q4ZF 2V79A 2KP6A 4RGSA 2PQ8A 2BVMA 1R4MB 2DFEA 4G8XA 2MABA 1VQ9I 4HSTA 3BP8A 1KONA 3CCUI 2NS7A 1XC5A 2GLOA 2E1NA 3K6GA 1O3SA 1WGXA 1I1GA 3UR3C 4B8XA 3HB9A 4O3MA 2XGEA 1I6HJ 3K4BA 2ZJ2A 4XSXF 4I0AA 4O5VA 1YIJI 1Z91A 4A0YA 3S32A 2HU9A 3MWMA 4QLCU 5TJJA 3BR5A 4KUMA 1ZLKA 4BGDA 5B5EC 3D5SC 3TP0A 1WKMA 3REOA 1POGA 4BXUA 4EJTA 1IDZA 4NNJA 1YI2I 2UWMA 3DEEA 4U7DA 2HWVA 1B1BA 4LIVA 2XASA 2X6OA 1I3AA 1S7OA 2VXZA 2KLOA 2NYXA 1MJAA 2VC0A 3QPSA 3LSHA 1LVKA 4BHPA 3KETA 3AL0C 4XRSG 2GQQA 4F7ZA 1CGPA 1VF9A 2NVTJ 1I6XA 4HSRA 4PJ0C 4DZJA 3PNVA 3PL8A 1BI0A 1LVAA 3GFMA 1ZKGA 4C3HJ 1GV2A 1X2NA 2K5CA 2A05A 1SD6A 3IUOA 3GF2A 3M3YJ 1KYWA 2ESHA 2KRFA 3IH2A 3RPQA 2M1BA 5FLMJ 1QHHD 3OMYA 1X1PA 4IL6C 3WHBA 4JYKA 2H6CA 3FXRA 2CV0A 4DQ2A 3WTSC 3B73A 1QU3A 4GGGA 1SVLA 3BG5A 4NHJA 3VYRB 1N78A 2NOGA 1JUPA 5KAIC 3S2WA 2A5YB 4S0HB 2BVLA 2P81A 4L9TA 1W36C 4ZDLA 5J4VA 1MMSA 2EK5A 5FGMA 2J5PA 2LSOA 3ZMTA 2HVSA 3QRFF 2MSYA 2Q1ZB 3QPHA 3OS1A 2M7BA 1U3EM 4PSXA 3AFHA 1H8AC 1JUMA 2LF7A 1V3FA 3FKIJ 4KIFA 2EZIA 2XAJA 1SC7A 4UB8C 4BBRJ 4FT8A 4XNFA 3C3WA 1DP7P 4FX4A 4EATA 2F5CA 2L7ZA 4HDVA 5GAHJ 1IC8A 2FJ1A 2RREA 2ZMEC 4JX5A 4DZPA 4UNOA 5D5UB 3RPUA 4BXFA 3CP2A 3MKYB 1W7PD 1RPWA 2HQNA 2YUSA 1FJLA 5LFAA 4G7ZF 3W6JB 2CQKA 3TO7A 5J1RA 5LRSA 2NVQJ 3BTCA 4N9IA 2LKSA 3IWFA 4A6DA 2R5ZA 1JXSA 1W4MA 2LMDA 2A69F 1HCRA 2KDZA 2GAUA 4KN7X 3LQQA 3ML6A 2K9MA 3E5UA 2LY2A 2KZVA 5LD2C 4Z6YA 1LKXA 1JKPC 4DYCA 5IT9K 2LP0A 3ESWB 1FP1D 2E60A 5F6FA 2NAZA 3WG7H 3RZDJ 2HKOA 4MTDA 1T39A 1WH5A 1OCZH 4DOZA 3OV8A 4BQAA 1ETWA 1UHMA 2DQLA 2L2OA 4PJMA 2DT7B 3EUAA 1K6YA 2IJLA 3FMQA 4HX4A 2V9PA 1IJWC 2P4WA 2XAQA 3A02A 3BR1A 4XRMA 1YS6A 2RV8A 4YIRX 2R7OA 5FFXA 4HW0A 4RB0A 5FD6A 4FCYA 2CUJA 4RS8A 5HODA 2AHQA 3J7AO 3ZQQA 4IHTA 3ECOA 4M6YA 3GTGJ 1HKSA 5M3MJ 3OYDA 3LAJA 2EA4A 3J7YJ 2R7ZJ 2MH2A 4PGGA 3E97A 2KIMA 2MC4A 3GCMA 4UVCA 3CJRB 4RA2A 1MJ9A 3IH3A 3E5QA 2IA0A 1LQ1A 3CCRI 1YIOA 3A0HC 5LBQA 2O5RA 3H35A 3O8GA 3EUKL 4U0WA 3WTZA 1ACIA 3BG9A 1DGWY 3TW7A 4FASD 1AWCA 2H09A 5IP6A 1H9GA 2X6YA 1BC8C 3MAJA 3OOPA 4BY1J 2R7RA 5FD5A 1ZR4A 4AC0A 2GA2A 3DU5A 3AKZA 1BOBA 3H9GA 4JX6A 1XSXA 3CCJI 1NTCA 4Y3OA 5CQGA 1YFHA 4KNYA 3CDLA 2LDUA 3RJPA 2M8GX 1U8BA 2C6YA 2K3PA 1S8NA 5B3SH 2EFNA 3FXJA 1GDTA 4TV7A 4U7BA 1B8IB 1X3UA 4XSZF 4OINF 3D1NI 1PUEE 5F0FA 4RBOA 5J8FA 2XV4S 5CPRB 3L09A 4EM1A 3CMMA 2ZMEB 4HRIA 4KICA 2FQ4A 2VOOA 2QF7A 2VODA 1C0WA 3H9JA 1S29A 1X58A 4FTHA 4BH9A 3PIOF 2IGOA 1P4AA 2JPBA 2QA4I 4S05A 3KP3A 3G3ZA 4WK8F 2KISA 3BOQA 1QNTA 1VQ8I 3ZMVA 5HOOA 1ZRFA 5L3DA 2FD5A 4H4KC 3TO6A 3R6SA 1KYZA 3LSPA 4Q5SF 1B8IA 3WODF 1J75A 5KVRA 4XOTA 2DK8A 5IYCJ 3QQAA 2XRLA 3JRGA 3TKYA 4OIPF 4RLFA 1ITYA 2JA6J 2H94A 3MMYB 4HBLA 4L9NA 2IVMA 5E3MA 2R7TA 2CWEA 4D1QA 3M07A 2BZTA 2ZFUA 2JRTA 5E79C 4KITB 1TP4A 4G7HF 2CJJA 1G2HA 5GAGJ 1WVRA 2VQCA 5H20A 2UXNA 4BEHA 4D7NA 1EH6A 4BHCA 2GIVA 3RI4A 5LGUA 1K4TA 1TC3C 2L7FP 1FWZA 5M3FJ 1H0MA 4G7OF 4Y52J 1DP3A 4LOCA 4AWXB 4LG0A 3GFIA 1R1VA 2CUZA 5IYDJ 1LDKB 3ZMSA 4Y4RA 5E8IA 1Y39A 2JSPA 5ILSA 4CUGA 3V8JA 4DGWB 2P7CB 4AVPA 4IO9F 2JTVA 4A3BJ 4KT6A 3O6BB 5K7HA 3N97A 3GTKJ 4J19A 4XL9A 5LGTA 2X48A 3FWEA 4QPQA 1QZZA 5BMZA 2LVSA 2COMA 3K1PA 4HQMA 3RQ4A 1TL8A 3BT9A 2MG4A 2F4MB 2A6TA 2WADA 5DCMB 2NVUB 5EG0A 1YITI 3BY6A 1ULYA 4CHUA 2FBKA 2JUGA 2A07F 3HC7A 3HGYA 4BJTA 1HDDC 2H6BA 1BN5A 3N05A 1T56A 2KIQA 1UB9A 3I53A 1VQOI 1ZLJA 4I01A 2M7AA 4HNTA 4KDPA 3KEYA 3SZGA 3CC7I 2IBDA 3T0YA 2R92J 3IKVA 3CCMI 3U9GA 2DOAA 4BE1A 1I1SA 1NH3A 3QU3A 2NVXJ 1IN4A 3H92A 2Y2ZA 3VSLA 1LEBA 3C2GA 1BJAA 1EA3A 1Z9CA 3S14J 4WF2A 2XDVA 2ZKZA 4NQWB 2VC1A 4KJZA 1ZGWA 1TZLA 4U0YA 3GLXA 4ABZA 4CYCB 3A2KA 5E3LA 4IOCF 3SQNA 3S1MJ 1T2KA 2EINH 3JRIA 2LKPA 2YR2A 3ECHA 1MZBA 4L9JA 4IVNA 2CQ7A 2BV6A 3F8MA 1DUXC 1DPRA 4B1RA 4ZYEA 2JK3A 5J40A 2ZC2A 1ZRDA 3H36A 2VKVA 5D8KB 1IO2A 1DDNA 4EMSA 2BE5F 3WE3A 2HQ5A 2X1CA 2W7NA 4NQWA 2WWYA 3AAFA 2UZKA 2ACJA 2PLYA 5HLGA 1OCTC 3M9AA 5IPAA 3OYIA 4CYCA 2JRMA 5D5WB 1O4XA 5EF6A 5C44J 1UG2A 4A3MJ 2ZXWH 2IEKA 1RI7A 2VN2A 4RM2A 3CMYA 1E17A 5CKTA 1YW9A 4AD9A 1V5GA 1FY7A 4IHVA 2CRGA 2HOAA 4CO8A 3TOBA 2EZHA 2JVGA 2K86A 4XKCA 1SFUA 1IUFA 1FSEA 5GADJ 2HTJA 3HOSA 4ZTFA 3OYHA 3DKYA 1XS9A 3W6VA 5F0CA 4AU7A 1IV6A 2QM3A 3ABUA 2DDAA 3FHNA 1VQNI 4KFCA 3M8FA 3RKXA 4EVIA 5EGOB 2XAGA 3FK7A 2TRTA 2XGCA 4IQ4A 1KU3A 4BJ5C 1NK2P 5CLSA 3VB2A 5DCFA 3PO2J 5L3BA 1HLVA 3Q0VA 2L54A 1TNTA 4LLNA 1XMXA 2R7UA 3PM1A 4Y33A 4ESFA 4M3GA 1DU0A 3FM3A 2Q2EA 5CVIA 1DU6A 2WV1A 1MSEC 2H8RA 4JK1X 1Y6IA 2EILH 2FE3A 4B4CA 2K9NA 5BPDA 1OCOH 1XDSA 3RIRA 4ON0A 2CGPA 2LFBA 1KU7A 1JGSA 2OZUA 1MNEA 1TWAJ 4MNUA 1USSA 2BHZA 1NK3P 1E3PA 4M3DA 3ZCOA 3WHCA 1ZK8A 2L5QA 3OYEA 2PX9A 3NRVA 3CCQI 2EFPA 2VASA 4KYWA 3S3MA 3KYCB 1ZRCA 3BPVA 2XGXA 3KPHA 3MD2A 3QWLA 2BYVE 1F43A 3A1YA 3BTLA 3S3NA 4L0ZB 2EIJH 1R58A 1SAUA 3OWTA 2QSFX 2L01A 2J5OA 1VQKI 1GXPA 1TWFJ 4I02A 2X6XA 3RTRA 3OYBA 1VFCA 3R0AA 2V1NA 2ETHA 2HFHA 2CQXA 2OZ6A 1V4RA 3B02A 5F04A 3VDXA 4HQEA 1PP7U 5IT9Z 3PFIA 3ZQ7A 3FDYA 3W2AA 3F9KA 3G1OA 2V7FA 3BC8A 4BACA 3BROA 1TT0A 2ZO4A 2CO5A 2CFOA 6PAXA 5B1BH 3E3VA 2QUFA 1XCVA 2R5YB 2A3SA 3DTIA 4I76A 2XF6A 2EV5A 4EGZA 3GX4X 1LEAA 2XKPA 4A3EJ 3KP6A 3WTYC 1OYYA 1X1DA 5AONA 2Y30A 5C4XJ 3E1SA 2RQQA 1IXSB 4B3XA 3KP5A 1KU2A 2OJED 2OC6A 4WWCA 3OYJA 2WBMA 4QPOA 4GYGA 5H2FC 3ZGKA 4R8HA 2XVCA 1I3QJ 1UELB 1WJEA 4XICA 2E2HJ 1B4AA 2BY2A 5LGNA 3T5XA 2F2EA 3DTKA 1D5YA 3HSFA 1Z1DA 4EJVA 4E7LA 2Q0OA 3GUDA 1I50J 1T33A 2Y9YA 5HS9A 4YFNF 2DFHA 3DU6A 4EQQA 4YIFA 1TW3A 2O03A 3R61A 3LWFA 5ICFA 1R00A 4PUSA 3OS0A 4PJLA 3T8TA 5D5VB 2DI3A 4XLCA 1BIAA 4NC7A 4OOIA 4M72A 4MIMA 3DPTA 1HC8A 2O7OA 2FEZA 1ETVA 1Z21A 5HLIA 2A6HF 2O6GE 5IOZA 4XRSA 2KKOA 2DTZA 5EZGA 5IT3A 1UCRA 1B72B 4O6JA 1N25A 1CF7A 2Z16A 3SEZA 1MGTA 1OR7C 4E7IA 2JA5J 4A5NA 4A3GJ 2L9SA 3ZMUA 3CCEI 1BBYA 3F72A 1R5HA 3VYUB 2LOOA 3RZOJ 5B66C 1IV8A 4X0GA 1ETQA 3J7AY 3SZTA 4XLEA 2VONA 1ZR2A 4IZZA 5LHHA 5DUIA 2L7KA 4F3QA 2QEXI 2K7LA 4CCNA 3UKGA 3GZ5A 4UY8I 2VBXA 1X3ZB 5DDGA 4PJNA 3B6AA 5CJ9A 2DJNA 1SVOA 4XKVA 3R0JA 4Q47A 1IN5A 3ZR8X 1CQTA 3EUHA 2G0EA 4XLAA 3M4OJ 3ELKA 4XLHA 5BNGA 3TEDA 1MIJA 3M8EA 1GT0C 1MDMA 5KNLA 4MO7A 5DD8A 5J3LA 3PSIA 1LE8B 1JJ8C 1NG7A 2KJCA 1IG7A 3CUOA 2W82A 1QA6A 3O8HA 2Z99A 2B7EA 2M3AA 1W1WE 4XIDA 1KQ0A 1WHUA 5E18F 4MTEA 2K02A 2Y75A 3GTLJ 4QSHA 3OL3A 3BG3A 5CQEA 2D1HA 3SHFA 4IRHA 1D8JA 2Y9ZA 5BQTA 1BW5A 3BR3A 2RN7A 2XPUA 1XGOA 2XB0X 5EZHA 4JX4A 1USTA 3CF2A 4FISA 1RESA 1LE8A 1IN7A 1MBJA 3E7LA 2MD5A 3M7GA 3JAMZ 1WCMJ 3GTJJ 4EEFG 5E1ZB 2DT6A 1Z67A 4D5CA 3S15J 3I5UA 1TBXA 2DO7A 3DXJF 1J9IA 1JKRC 1MKMA 4DIQA 1HSTA 1YG2A 4CSWA 3Q5FA 2VKHA 1YJNI 2ZNZA 4L0YB 3IRRA 5TISC 1V55H 1REPC 1LUJB 2P8TA 3VODA 4HF1A 1FOXA 1A35A 3GFLA 1J59A 2QYOA 2XB5A 2VUMJ 4FE4A 2PMZN 2DPUA 3FMSA 3I3LA 1HKTA 4Q48A 4PFPA 2P5LC 2YX4A 3BWGA 1B6AA 2HKXA 3F8NA 2E71A 1VQ7I 1Q1VA 3PJRA 1XB4A 5K1YA 1GLNA 4PGHA 4YFXF 2B63J 4HNVA 3FKJA 4BE2A 1X4OA 2FA5A 2QQ9A 1MMNA 2LLKA 4IHSA 2R7QA 2KIUA 2HDCA 3IKTA 3PUBA 1FZPB 2CUFA 2DOFA 3DCFA 2LTPA 2ZCWA 2DMNA 5JHUA 2XSDC 2JMWA 2DCEA 3HYIA 4RM3A 2KT0A 3F21A 2ELJA 4CCOA 5LHIA 1BI2A 3WG9A 2X0LA 2L3DA 3AG1H 2ZXHA 2VB6A 1WJAA 3OYGA 1XGNA 3KLNA 4HLXA 2M8EA 2R5ZB 3MZ8A 3TBIA 2UV1A 1OR7A 5FKKA 2L9RA 3GTQJ 3BJOA 1HW2A 1JUSA 2QQAA 1ZYRF 1IZ1A 2KRHA 3L7WA 1VQPI 4R79A 3S8PA 2BY3A 1SD4A 4LK0F 1FSHA 2XF5A 5FRNA 3K2ZA 2HXOA 3SDGA 2PJPA 2EBIA 4FX0A 4G9YA 3G1MA 4BQQA 5E1XA 3K4KA 3GBGA 1QPIA 2G7HA 1FYMA 2ZJRF 3EDPA 2WAQA 3SDBA 4IPAA 1QQIA 1XGSA 5EDNA 2X1EA 3S1QJ 2XAUA 5JVTA 1YO5C 3CUQB 2IA1A 3R60A 4IHYA 2HYFA 2CU7A 1O3TA 3WTXC 2Z2SB 1U2WA 4PZJA 1MH4A 2H1LA 5FO5A 1BOAA 4G6DA 5A2QK 1Y0NA 1W0TA 5BS6A 2YU3A 1JHFA 1WI3A 3MEXA 3G73A 2GBYA 3ZMDA 1BA5A 1XMKA 5HS7A 2EFQA 3LSIA 3LL7A 4HAMA 4MEYF 3A4CA 2KJBA 2RQPA 4P55A 1FOWA 5E8GA 2QSGX 2WA0A 2BXYA 1IGNA 3FK6A 4A3FJ 2FF4A 2D1VA 2Y48A 2AQFA 2E1MB 3BG6A 3CUQA 1HBXG 2D5VA 2M87A 1AHDP 2L7MP 4GXOA 2EV0A 2VBYA 4CCJA 4KISA 3CO6C 5J6XA 5HNHA 1U8RA 1S72I 2FNAA 1T95A 2X6WA 3MKLA 3ZQCA 3JCUC 2D45A 1SD7A 2EA2A 2QWWA 4BY7J 3HOZJ 3H3ZA 3K4JA 4ZTJA 1G59A 3CC2I 3S16J 4NBQA 4CCLA 1R5GA 2P5VA 4KMFA 2QKLB 4XN0A 3GEZA 3HRTA 1Z3XA 2R7FA 1PDNC 3RCOA 4HEA2 4G6QA 4C30A 3GLLA 2NNNA 4NDLA 2BY0A 1R23A 2W57A 3CD6I 3HUGA 3LMMA 1WJ5A 3KP2A 2E2IJ 1PP8F 3HHHA 3KEOA 2CQNA 3ASOH 4ZJZA 2ECCA 2OV7A 4BHBA 2BY1A 4ZH4F 1QVTA 4XRFA 2HS5A 4XK4A 2TCTA 1P92A 2EPFA 3IC7A 2R0QC 3P7NA 3OYAA 2OAZA 1YOVB 5L3CA 1YW7A 2VT2A 1HOMA 2XF7A 1UAAA 1IUYA 2JA7J 3M1EA 2IXSA 5KCMA 1MBGA 1D1BA 1QPMA 4E7JA 2O9LA 2JQ7A 5CVUA 2G9WA 3LSRA 2FX0A 4MGRA 5ERIA 1T8IA 1ETKA 1EV7A 4L5JA 4DBRA 3HOWJ 3KCCA 2M0CA 4IF4A 1YHQI 1LDDA 2PJRB 2M9HA 1ZGJA 3LSMA 4GRIA 1VTNC 1UMQA 1EH8A 2RGVA 4YG2F 3VEPA 3TO9A 1WPKA 3A03A 1FYKA 3C1DA 1JTYA 1WJCA 4OIRF 3HOXJ 2QKMB 1XX5A 1D1AA 3DFGA 4BEHB 2VQLA 2DA2A 4FQGA 4PJJA 1IN6A 4HNUA 4MEXF 2P6TA 3SFZA 3DWLE 2VIXA 1UHWA 4JBAA 4D5FA 2ID6A 1U6GA 3H0DA 4LG0B 1Y8RB 1BR2A 2HYJA 1RR8C 2PJRA 4ZDPA 5FKNA 3NQOA 2K27A 2LG4A 5DM6F 3K70D 2ZJQF 4CZCA 4RAYA 2HQAA 2PMUA 4AIHA 3F23A 3NARA 2UXXA 4V2GA 1RRJA 5E20A 4NB5A 1N75A 4V19K 2XGDA 2AXLA 4BE0A 1J5YA 1G3YA 4RB1A 2HDWA 3L2UA 3ISPA 2W84A 1YRNA 2ZB9A 3CLOA 1LNWA 1X1BA 5EG0B 4ZYDA 3H0GJ 1Z6TA 3WTWC 5FKLA 1Z7LA 1EF4A 1BW6A 4ESJA 1MW7A 4XOPA 1EKEA 2ID3A 2KRCA 4P9FA 3WU1B 3MKWB 3BR0A 5ILUA 2STTA 1F9NA 2VI6A 2XAFA 4MLOA 3JAMK 1T0FA 1A6IA 2DJIA 2QENA 3F22A 3V7RA 1U5TC 5AIQA 1QZYA 2QBYB 1U78A 5E3OA 5IY5H 2GXGA 3P9KA 3DPUA 4A3DJ 4C2MJ 1SFKA 1OQYA 1PUFB 4GFBA 1FIAA 5F08A 3VWBA 4RAZA 4NC8A 4WXDA 3L2WA 4CYDA 1AKHB 1P2FA 4IKFA 4RGRA 2BW3B 4P1WA 2XSJC 2NS0A 4UVBA 2WAFA 4WXHA 3JTHA 1BR4A 3OYLA 1F4KA 1GVDA 3K9TA 4C9YA 2KIFA 4A3CJ 1OCCH 2QBYA 2E2JJ 1LDJA 2P7VB 3JW4A 3F8BA 3K7AJ 4EJWA 1JI8A 2GM4A 2Y0SA 2RDPA 2CYYA 4IQJA 2O61A 5ICEA 2WV0A 1TW2A 3P9IA 3IL2A 3CP8A 3DPLC 2DOEA 2RVCA 1PUFA 2HQRA 1IN8A 2DA5A 2ZSIB 3DQVC 1GVJA 2QCOA 1FEXA 5F64A 4EJUA 1OYIA 4C2TA 1T98A 2AQEA 1AKHA 1G4DA 2DA3A 2W85A 3HXLA 5D5XB 3KYLA 2W24A 3OIPA 3V8LA 2BW3A 3I4NJ 4IEJA 1AA7A 3NWSA 4V2FA 1U9OA 3MN2A 2ZFWA 4B44A 5FLVA 3HOUJ 1WJDA 3LNQA 3HOTA 2IS1A 1X4PA 3X2QH 4AYBA 3GW2A 2ZNYA 4CDGA 3CESA 3BJAA 3HJEA 2F6CA 2JZYA 1IXCA 1MBKA 2DYSH 2M4KA 2YPRA 5DYMA 4JOMA 1G3SA 3OYMA 4I6ZA 3S3OA 2O8KA 3CZ6A 2DTRA 2Z9OA 1LJ9A 3DEUA 3CJNA 5FFZA 1RUOA 3U21A 3HL2A 5DUKA 4JQFA 2MA3A 2V1UA 5GAEJ 1WSUA 2JA8J 3VOEA 2F4IA 3GFJA 4HV5A 1JT0A 1G8XA 4YRVA 1XDUA 2R4GA 1XGMA 3SZPA 2Z1DA 1SANA 4DW6A 4BNCA 1VQ4I 3GTOJ 1BM9A 3F8CA 2Q2EB 1U0JA 4C3JJ 4XQFA 2K85A 3I58A 3QOEA 5LLQA 4BDYA 3H3VK 2OTJI 3MQ0A 1JKOC 3KP7A 4BJ6C 3TDZC 5FLXK 2DU9A 1E0EA 2K3FA 2DA6A 4HOBA 1STZA 1R9TJ 2XUBA 3FMRA 3ONQA 4ZYGA 4XMYA 5JR3A 4RB2C 2XC7A 1H88C 4ZZLA 2EZLA 2VE9A 2EWNA 2JUCA 2XKOA 4ANJA 1LPQA 4D0PA 1Z6RA 3SEQA 4UUVA 2R7DA 1U5TB 4OIOF 1XG1A 2AO9A 2VQHA 3BR6A 5JI6A 4ENJA 4HZFA 1MSFC 3T1BA 1X2MA 3HKZA 4B48A 2ELHA 1K79A 3PSFA 4YELA 2GZWA 2LD5A 4BQOA 5LEKA 2CW0F 2CV1A 1W7PA 2EIMH 3K1MA 4ZYHA 4XKBA 3G2BA 1ETOA 1Y8QB 2JPCA 3EUHC 5KAFC 2R7VA 1RIOH 4HF2A 1YQAA 5HLTA 5HNFA 1YYVA 2GWRA 3Q0UA 5D6EA 2HNHA 3SJMA 5J1UA 2MLGA 5GTHC 5EEHA 1QBJA 1JT6A 1XSDA 4X1EA 1U5TA 4RDUA 2HZDA 1FIPA 3B6CA 3OR2C 4NC6A 3IP4B 3LOCA 3JREA 2P6SA 3F6VA 5D8LB 1I5ZA 4DYRA 4XONA 1YTYA 1ONVA 2OBPA 4D9JA 4EM2A 4R1HA 1XD7A 3SYTA 2E7XA 4ZC3A 2CSOA 3BG7A 5K7ZA 3OSFA 3S1NJ 4UXNA 1IDYA 3SFIA
chains in the Genus database with same CATH topology
1IJWC 3BG3A 3A02A 3BR1A 4XRMA 3S17J 3JRAA 2Y9ZA 4FCYA 2I10A 1BW5A 5HODA 2AHQA 3BR3A 2XPUA 5K7FA 2XB0X 5EZHA 1E3OC 1UHSA 4JX4A 4FISA 1RESA 1LE8A 3GTGJ 5M3MJ 1MBJA 3E7LA 4DYQA 3FIWA 2R7ZJ 1MBFA 1Y1VJ 1WCMJ 3GTJJ 4M3BA 4EEFG 4D5CA 4BXXJ 3G1LA 2HI3A 3LSJA 9ANTA 3S15J 1TWCJ 3JRHA 1JKRC 3IH3A 1RR7A 1SFOJ 2OF7A 3F0CA 3O8GA 2MGQA 2RAEA 3BG9A 3TW7A 5GP9A 3IV5A 5IP6A 2XB5A 4BY1J 1ZR4A 2VUMJ 4FE4A 2PMZN 2EZKA 1JJ6C 4BBSJ 4AC0A 2WB1N 1IRZA 5EYRA 4JX6A 1NTCA 1Q1VA 3CDLA 5F27A 2M8GX 1U8BA 1MBEA 1FTTA 3L1PA 2B63J 4HNVA 1GDTA 1FTZA 2LLKA 1MNMC 3HM5A 1B8IB 2HDDA 3D1NI 5F0FA 4RBOA 2CUFA 3DCFA 2LTPA 4M3FA 4A3JJ 3JR9A 2HOTA 2DMNA 1ZQ3P 2XSDC 2JMWA 2XPWA 1JTXA 1OJLA 2KT0A 4A3KJ 2FQ4A 2QF7A 2HOSA 3ZQFA 4UUSB 1P7JA 1X58A 4FTHA 5IP7J 2L0KA 3JRDA 2R5ZB 4X6AJ 3OIOA 2K9QA 1HDPA 5FKKA 2L9RA 3GTQJ 2XPVA 1JUSA 2FD5A 3LSPA 1B8IA 5E3NA 2HXOA 2LK2A 3QQAA 3SDGA 2EBIA 5IYCJ 2EQRA 2XRLA 4UUTA 3JRGA 2W48A 3QPLA 1ITYA 3G1MA 1Z0XA 2JA6J 3A01B 1ENHA 2DN0A 3GBGA 3CQZJ 1QPIA 5E3MA 4UUSA 5IOYA 3IH4A 1VNDA 4W1UA 5EDNA 1W0UA 3C2BA 3S1QJ 1Y1WJ 3HOYJ 4IHYA 5F0HA 2CJJA 2CU7A 1G2HA 4QTRA 1MH4A 1AU7A 5FJ8J 4D7NA 2DA1A 1W0TA 1U9NA 1WI3A 2GBYA 1RKWA 2L7FP 1TC3C 5M3FJ 4Y52J 1BA5A 2JN6A 4LOCA 5IYDJ 3A01A 3TP3A 1IGNA 3FK6A 5GPCA 3K2AA 5EGOA 4A3FJ 1P7IA 4A3BJ 1JGGA 5K7HA 1ETYA 4IHXA 2D5VA 1AHDP 3GTKJ 4J19A 1QRYA 2L7MP 2NS8A 2X48A 4B3AA 3Q0WA 2LVSA 3BT9A 2MG4A 5EG0A 3MKLA 3ZQCA 4M6VA 3JRFA 1S7EA 5EEAA 2DMTA 4BY7J 3HGYA 5IP9J 3HOZJ 1HDDC 3S16J 1MBHA 1BL0A 5JLWA 3HOVJ 1T56A 3VPRA 3ZQLA 2COBA 4NDLA 2IBDA 1OCPA 2DA4A 2R92J 4AUXA 2E2IJ 2NVXJ 3TW6A 3RKQA 4M3EA 2Y2ZA 3BQYA 4A3IJ 2Y0SN 2ECCA 2JJ7A 3S14J 3NAUA 3S2DJ 1QVTA 1ZGWA 4XK4A 4BKXA 2TCTA 3Q3SA 4ABZA 2R0QC 4CYCB 1GUUA 4G12A 3LSGA 5E3LA 3S1MJ 3DEWA 5GPAA 2ME0A 2JWTA 1HOMA 3JRIA 2M2EA 3BQZA 2JA7J 2CQQA 4A3LJ 4B1RA 1MBGA 2O9LA 2JK3A 3BTIA 3LSRA 1RKTA 2HXIA 2FX0A 2VKVA 1HF0A 1ETKA 4AYBN 2HQ5A 2VKEA 3HOWJ 2R5YA 3MVPA 2M0CA 1F36A 2M9HA 3SFIA 1GV5A 2E1OA 1OCTC 5IPAA 4CYCA 1UMQA 1O4XA 3GTMJ 5C44J 1UG2A 4A3MJ 2IEKA 4Y7NJ 4A93J 4IHWA 3CMYA 1WPKA 3A03A 4W97A 1JTYA 3HOXJ 1K83J 2E19A 1H89C 4IHVA 2CRGA 2HOAA 1ZTRA 2EZHA 2DA2A 4A69C 1IUFA 1Z77A 2ECBA 2X9DA 1XS9A 1ORKA 3W6VA 5F0CA 1IV6A 5M5YJ 3ZQHA 4D5FA 2ID6A 2HYJA 2DMQA 5FKNA 2M34A 5EGOB 3NARA 4V2GA 3JRCA 3FK7A 2TRTA 2XGCA 2DMUA 1NK2P 5DS9A 2YU9J 1TWHJ 5F1JA 1JKQC 3PO2J 2XGDA 1HLVA 3Q0VA 1LFUP 3PM1A 2DMPA 1YRNA 4M3GA 2ZB9A 1K61A 2YS9A 1DU0A 5EG0B 3H0GJ 5FKLA 4MFDA 3HKZN 1DU6A 1BW6A 3JRBA 2WV1A 1B72A 2N8GA 1EF4A 2Y31A 1ETXA 1MSEC 2H8RA 2ID3A 1WH7A 4B4CA 2K9NA 3BR0A 3OOUA 2VI6A 2LFBA 4MLOA 4L5EA 1A6IA 1TWAJ 1APLC 1NK3P 3PO3J 3OSGA 4M3DA 3WHCA 1ZK8A 1U78A 5E3OA 4QIWN 2H1KA 3I4MJ 4A3DJ 1OFCX 2DA7A 2MW8A 3BR2A 3ZOBA 5FKOA 4FE7A 4C2MJ 1PUFB 1F43A 5C3EJ 3S2HJ 4GFBA 1FIAA 3BTLA 5F08A 1AKHB 1TWGJ 1TWFJ 1VFCA 2ELKA 2CQXA 5F04A 1GVDA 2NS7A 1XC5A 2K9SA 2GLOA 4A3CJ 3G1OA 2E2JJ 3K7AJ 1WGXA 5J1YA 2GM4A 3HB9A 2XGEA 1I6HJ 1PUFA 2R5YB 2DA5A 4I76A 5M5WJ 1BJZA 2QCOA 1FEXA 3BR5A 3CCYA 3S1RJ 4A3EJ 3TP0A 1AKHA 2DA3A 1POGA 3I4NJ 1IDZA 4IEJA 2Y30A 5C4XJ 4V2FA 3HGGA 1U9OA 2X6OA 3MN2A 5FLVA 2R93J 5JLXA 1MH3A 3QPSA 3HOUJ 3LNQA 2OPTA 1A5JA 4XRSG 1MBKA 4I6ZA 4JP0A 1VF9A 1I3QJ 2NVTJ 4XICA 2E2HJ 4DZJA 2O8KA 2IAIA 1ZKGA 2LR8A 1D5YA 4C3HJ 1GV2A 1X2NA 5EF6A 1T33A 1I50J 2Y9YA 4D7MA 3RQIA 3M3YJ 2LY9A 3IH2A 2JA8J 3HDDA 1JT0A 5FLMJ 2CUEA 5M5XJ 3BTJA 3WHBA 4JYKA 3GTPJ 1SANA 4MIMA 4DW6A 2O7OA 3BG5A 2K40A 4MFEA 1YRNB 1ETVA 3GTOJ 2NOGA 1JUPA 3HEFA 4C3JJ 4S0HB 3H3VK 2EH3A 5IOZA 4XRSA 2DTZA 2P81A 3ZQGA 5EZGA 1B72B 1JKOC 5FKMA 2VPRA 2DA6A 1R9TJ 2MSYA 2JA5J 1H88C 4A3GJ 2EZLA 1H8AC 5C4JJ 1JUMA 3FKIJ 2EZIA 2ME6A 4BBRJ 3RZOJ 1XG1A 3HBLA 2L7ZA 2AO9A 3BR6A 1ETQA 1IC8A 2FJ1A 4DZPA 2LKXA 4JX5A 1MSFC 1X2MA 1LFBA 1ZR2A 2LD5A 2YUSA 1RPWA 3UKGA 1FJLA 5IYBJ 1ETOA 3B6AA 2NVQJ 5J1RA 2NVYJ 2DJNA 3BTCA 1CQTA 1VI0A 2G0EA 1QVUA 2R5ZA 1RETA 3Q0UA 1HCRA 3M4OJ 2KDZA 3SJMA 2WAQN 5J1UA 5BNGA 3TEDA 1GT0C 4C3IJ 1JT6A 4X1EA 4MO7A 5J3LA 5DTDA 4RDUA 1FIPA 3B6CA 1JKPC 4DYCA 3LOCA 1LE8B 2LP0A 1JJ8C 3RZDJ 3JREA 1IG7A 1WH5A 3O8HA 3FISA 1ETWA 4DYRA 4XIDA 3ZQIA 5K7ZA 3OSFA 3S1NJ 3GTLJ 1IDYA 4QSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJW C;  3BG3 A;  3A02 A;  3BR1 A;  4XRM A;  3S17 J;  3JRA A;  2Y9Z A;  4FCY A;  2I10 A;  1BW5 A;  5HOD A;  2AHQ A;  3BR3 A;  2XPU A;  5K7F A;  2XB0 X;  5EZH A;  1E3O C;  1UHS A;  4JX4 A;  4FIS A;  1RES A;  1LE8 A;  3GTG J;  5M3M J;  1MBJ A;  3E7L A;  4DYQ A;  3FIW A;  2R7Z J;  1MBF A;  1Y1V J;  1WCM J;  3GTJ J;  4M3B A;  4EEF G;  4D5C A;  4BXX J;  3G1L A;  2HI3 A;  3LSJ A;  9ANT A;  3S15 J;  1TWC J;  3JRH A;  1JKR C;  3IH3 A;  1RR7 A;  1SFO J;  2OF7 A;  3F0C A;  3O8G A;  2MGQ A;  2RAE A;  3BG9 A;  3TW7 A;  5GP9 A;  3IV5 A;  5IP6 A;  2XB5 A;  4BY1 J;  1ZR4 A;  2VUM J;  4FE4 A;  2PMZ N;  2EZK A;  1JJ6 C;  4BBS J;  4AC0 A;  2WB1 N;  1IRZ A;  5EYR A;  4JX6 A;  1NTC A;  1Q1V A;  3CDL A;  5F27 A;  2M8G X;  1U8B A;  1MBE A;  1FTT A;  3L1P A;  2B63 J;  4HNV A;  1GDT A;  1FTZ A;  2LLK A;  1MNM C;  3HM5 A;  1B8I B;  2HDD A;  3D1N I;  5F0F A;  4RBO A;  2CUF A;  3DCF A;  2LTP A;  4M3F A;  4A3J J;  3JR9 A;  2HOT A;  2DMN A;  1ZQ3 P;  2XSD C;  2JMW A;  2XPW A;  1JTX A;  1OJL A;  2KT0 A;  4A3K J;  2FQ4 A;  2QF7 A;  2HOS A;  3ZQF A;  4UUS B;  1P7J A;  1X58 A;  4FTH A;  5IP7 J;  2L0K A;  3JRD A;  2R5Z B;  4X6A J;  3OIO A;  2K9Q A;  1HDP A;  5FKK A;  2L9R A;  3GTQ J;  2XPV A;  1JUS A;  2FD5 A;  3LSP A;  1B8I A;  5E3N A;  2HXO A;  2LK2 A;  3QQA A;  3SDG A;  2EBI A;  5IYC J;  2EQR A;  2XRL A;  4UUT A;  3JRG A;  2W48 A;  3QPL A;  1ITY A;  3G1M A;  1Z0X A;  2JA6 J;  3A01 B;  1ENH A;  2DN0 A;  3GBG A;  3CQZ J;  1QPI A;  5E3M A;  4UUS A;  5IOY A;  3IH4 A;  1VND A;  4W1U A;  5EDN A;  1W0U A;  3C2B A;  3S1Q J;  1Y1W J;  3HOY J;  4IHY A;  5F0H A;  2CJJ A;  2CU7 A;  1G2H A;  4QTR A;  1MH4 A;  1AU7 A;  5FJ8 J;  4D7N A;  2DA1 A;  1W0T A;  1U9N A;  1WI3 A;  2GBY A;  1RKW A;  2L7F P;  1TC3 C;  5M3F J;  4Y52 J;  1BA5 A;  2JN6 A;  4LOC A;  5IYD J;  3A01 A;  3TP3 A;  1IGN A;  3FK6 A;  5GPC A;  3K2A A;  5EGO A;  4A3F J;  1P7I A;  4A3B J;  1JGG A;  5K7H A;  1ETY A;  4IHX A;  2D5V A;  1AHD P;  3GTK J;  4J19 A;  1QRY A;  2L7M P;  2NS8 A;  2X48 A;  4B3A A;  3Q0W A;  2LVS A;  3BT9 A;  2MG4 A;  5EG0 A;  3MKL A;  3ZQC A;  4M6V A;  3JRF A;  1S7E A;  5EEA A;  2DMT A;  4BY7 J;  3HGY A;  5IP9 J;  3HOZ J;  1HDD C;  3S16 J;  1MBH A;  1BL0 A;  5JLW A;  3HOV J;  1T56 A;  3VPR A;  3ZQL A;  2COB A;  4NDL A;  2IBD A;  1OCP A;  2DA4 A;  2R92 J;  4AUX A;  2E2I J;  2NVX J;  3TW6 A;  3RKQ A;  4M3E A;  2Y2Z A;  3BQY A;  4A3I J;  2Y0S N;  2ECC A;  2JJ7 A;  3S14 J;  3NAU A;  3S2D J;  1QVT A;  1ZGW A;  4XK4 A;  4BKX A;  2TCT A;  3Q3S A;  4ABZ A;  2R0Q C;  4CYC B;  1GUU A;  4G12 A;  3LSG A;  5E3L A;  3S1M J;  3DEW A;  5GPA A;  2ME0 A;  2JWT A;  1HOM A;  3JRI A;  2M2E A;  3BQZ A;  2JA7 J;  2CQQ A;  4A3L J;  4B1R A;  1MBG A;  2O9L A;  2JK3 A;  3BTI A;  3LSR A;  1RKT A;  2HXI A;  2FX0 A;  2VKV A;  1HF0 A;  1ETK A;  4AYB N;  2HQ5 A;  2VKE A;  3HOW J;  2R5Y A;  3MVP A;  2M0C A;  1F36 A;  2M9H A;  3SFI A;  1GV5 A;  2E1O A;  1OCT C;  5IPA A;  4CYC A;  1UMQ A;  1O4X A;  3GTM J;  5C44 J;  1UG2 A;  4A3M J;  2IEK A;  4Y7N J;  4A93 J;  4IHW A;  3CMY A;  1WPK A;  3A03 A;  4W97 A;  1JTY A;  3HOX J;  1K83 J;  2E19 A;  1H89 C;  4IHV A;  2CRG A;  2HOA A;  1ZTR A;  2EZH A;  2DA2 A;  4A69 C;  1IUF A;  1Z77 A;  2ECB A;  2X9D A;  1XS9 A;  1ORK A;  3W6V A;  5F0C A;  1IV6 A;  5M5Y J;  3ZQH A;  4D5F A;  2ID6 A;  2HYJ A;  2DMQ A;  5FKN A;  2M34 A;  5EGO B;  3NAR A;  4V2G A;  3JRC A;  3FK7 A;  2TRT A;  2XGC A;  2DMU A;  1NK2 P;  5DS9 A;  2YU9 J;  1TWH J;  5F1J A;  1JKQ C;  3PO2 J;  2XGD A;  1HLV A;  3Q0V A;  1LFU P;  3PM1 A;  2DMP A;  1YRN A;  4M3G A;  2ZB9 A;  1K61 A;  2YS9 A;  1DU0 A;  5EG0 B;  3H0G J;  5FKL A;  4MFD A;  3HKZ N;  1DU6 A;  1BW6 A;  3JRB A;  2WV1 A;  1B72 A;  2N8G A;  1EF4 A;  2Y31 A;  1ETX A;  1MSE C;  2H8R A;  2ID3 A;  1WH7 A;  4B4C A;  2K9N A;  3BR0 A;  3OOU A;  2VI6 A;  2LFB A;  4MLO A;  4L5E A;  1A6I A;  1TWA J;  1APL C;  1NK3 P;  3PO3 J;  3OSG A;  4M3D A;  3WHC A;  1ZK8 A;  1U78 A;  5E3O A;  4QIW N;  2H1K A;  3I4M J;  4A3D J;  1OFC X;  2DA7 A;  2MW8 A;  3BR2 A;  3ZOB A;  5FKO A;  4FE7 A;  4C2M J;  1PUF B;  1F43 A;  5C3E J;  3S2H J;  4GFB A;  1FIA A;  3BTL A;  5F08 A;  1AKH B;  1TWG J;  1TWF J;  1VFC A;  2ELK A;  2CQX A;  5F04 A;  1GVD A;  2NS7 A;  1XC5 A;  2K9S A;  2GLO A;  4A3C J;  3G1O A;  2E2J J;  3K7A J;  1WGX A;  5J1Y A;  2GM4 A;  3HB9 A;  2XGE A;  1I6H J;  1PUF A;  2R5Y B;  2DA5 A;  4I76 A;  5M5W J;  1BJZ A;  2QCO A;  1FEX A;  3BR5 A;  3CCY A;  3S1R J;  4A3E J;  3TP0 A;  1AKH A;  2DA3 A;  1POG A;  3I4N J;  1IDZ A;  4IEJ A;  2Y30 A;  5C4X J;  4V2F A;  3HGG A;  1U9O A;  2X6O A;  3MN2 A;  5FLV A;  2R93 J;  5JLX A;  1MH3 A;  3QPS A;  3HOU J;  3LNQ A;  2OPT A;  1A5J A;  4XRS G;  1MBK A;  4I6Z A;  4JP0 A;  1VF9 A;  1I3Q J;  2NVT J;  4XIC A;  2E2H J;  4DZJ A;  2O8K A;  2IAI A;  1ZKG A;  2LR8 A;  1D5Y A;  4C3H J;  1GV2 A;  1X2N A;  5EF6 A;  1T33 A;  1I50 J;  2Y9Y A;  4D7M A;  3RQI A;  3M3Y J;  2LY9 A;  3IH2 A;  2JA8 J;  3HDD A;  1JT0 A;  5FLM J;  2CUE A;  5M5X J;  3BTJ A;  3WHB A;  4JYK A;  3GTP J;  1SAN A;  4MIM A;  4DW6 A;  2O7O A;  3BG5 A;  2K40 A;  4MFE A;  1YRN B;  1ETV A;  3GTO J;  2NOG A;  1JUP A;  3HEF A;  4C3J J;  4S0H B;  3H3V K;  2EH3 A;  5IOZ A;  4XRS A;  2DTZ A;  2P81 A;  3ZQG A;  5EZG A;  1B72 B;  1JKO C;  5FKM A;  2VPR A;  2DA6 A;  1R9T J;  2MSY A;  2JA5 J;  1H88 C;  4A3G J;  2EZL A;  1H8A C;  5C4J J;  1JUM A;  3FKI J;  2EZI A;  2ME6 A;  4BBR J;  3RZO J;  1XG1 A;  3HBL A;  2L7Z A;  2AO9 A;  3BR6 A;  1ETQ A;  1IC8 A;  2FJ1 A;  4DZP A;  2LKX A;  4JX5 A;  1MSF C;  1X2M A;  1LFB A;  1ZR2 A;  2LD5 A;  2YUS A;  1RPW A;  3UKG A;  1FJL A;  5IYB J;  1ETO A;  3B6A A;  2NVQ J;  5J1R A;  2NVY J;  2DJN A;  3BTC A;  1CQT A;  1VI0 A;  2G0E A;  1QVU A;  2R5Z A;  1RET A;  3Q0U A;  1HCR A;  3M4O J;  2KDZ A;  3SJM A;  2WAQ N;  5J1U A;  5BNG A;  3TED A;  1GT0 C;  4C3I J;  1JT6 A;  4X1E A;  4MO7 A;  5J3L A;  5DTD A;  4RDU A;  1FIP A;  3B6C A;  1JKP C;  4DYC A;  3LOC A;  1LE8 B;  2LP0 A;  1JJ8 C;  3RZD J;  3JRE A;  1IG7 A;  1WH5 A;  3O8H A;  3FIS A;  1ETW A;  4DYR A;  4XID A;  3ZQI A;  5K7Z A;  3OSF A;  3S1N J;  3GTL J;  1IDY A;  4QSH A; 
#chains in the Genus database with same CATH topology
 4A0X A;  3CC4 I;  1S3J A;  1KQ8 A;  3ABL H;  5AIP A;  3S17 J;  5A2Q Z;  2OCC H;  3VYT B;  3KX2 A;  2E36 A;  4Y17 A;  1LB2 A;  1UHS A;  3QOP A;  4BQN A;  3ZP5 A;  2MBF A;  1FX7 A;  4GYI A;  4DYQ A;  2WY8 Q;  3FIW A;  1MBF A;  1Y1V J;  1TTY A;  4RLQ A;  4E7H A;  4LIU A;  5HDK A;  1ZAR A;  2M0M A;  4E7S A;  2HI3 A;  3LSJ A;  1ERD A;  2HTS A;  1TWC J;  2WC2 A;  2ISZ A;  3FXO A;  1IXR C;  2OF7 A;  1BIB A;  2MC3 A;  3H1C A;  2GA1 A;  4BL0 B;  4A5M A;  2OU2 A;  1X19 A;  2MH9 A;  2H27 A;  2MGQ A;  1S7A A;  2CMP A;  2RAE A;  3IV5 A;  3TDU C;  4N4O B;  4LB6 B;  1X1C A;  3P9C A;  3FXM A;  1KU9 A;  3QYE A;  4F52 A;  4RB3 C;  2XAH A;  3EYI A;  1WFX A;  1SEU A;  2HR3 A;  1TQM A;  3GVA A;  4ITV A;  1TT5 B;  1CF7 B;  3QU6 A;  3Q9S A;  3F3X A;  4XLN F;  5F27 A;  1L0O C;  1FMW A;  3A0B C;  3OR1 C;  3QYB A;  3H9Q A;  1MBE A;  1RZ4 A;  3HRM A;  1FTT A;  3ABM H;  4UV9 A;  2CS3 A;  3G4S I;  3E6B A;  1MNM C;  3HM5 A;  2IGN A;  1SMT A;  1W5T A;  3KP4 A;  4A3J J;  3JR9 A;  1S5L C;  3HPH A;  1K6O A;  1JTX A;  1OJL A;  5ED4 A;  1FMV A;  3ZXS A;  4A3K J;  3GXO A;  3HIF A;  2HOS A;  1W36 D;  4XBF A;  3ZQF A;  4ETS A;  4FET A;  1UFM A;  1B59 A;  2PBI A;  3OIQ A;  5IP7 J;  3DP7 A;  4X6A J;  4RAF A;  3OIO A;  1IRG A;  1HDP A;  3QOD A;  1N77 A;  2E5Z A;  2XPV A;  4M73 A;  2XRO A;  1MDM B;  4ZDO A;  3IAM 2;  2D2W A;  4XLP F;  1QO0 D;  4U0V A;  2OA4 A;  3K0L A;  4G6T B;  2R3S A;  2Y69 H;  1VZ0 A;  2VBZ A;  2LRD A;  4IX7 A;  3QPT A;  3DLL F;  3FM5 A;  2DW4 A;  1R71 A;  2EQR A;  3M1C A;  5ILV A;  1SMY F;  3QPL A;  1DGR M;  1O7F A;  4I99 C;  4AVZ A;  2PMH A;  3OS2 A;  4WXC A;  4G94 A;  3A01 B;  1ENH A;  5DV5 A;  4OMZ A;  1R7J A;  2RNJ A;  3IH4 A;  4W1U A;  1SFX A;  1XMA A;  3C2B A;  2MD0 A;  3I56 I;  1BI1 A;  2DAO A;  5F0H A;  2OQR A;  4KIG A;  1HA8 A;  2Z3Y A;  3OL4 A;  4KMU X;  2KPM A;  4QTR A;  1AU7 A;  1R36 A;  2LC2 A;  4E4H A;  3ABT A;  1D8K A;  1ODD A;  3E6D A;  2IRF G;  2FU4 A;  4I7H A;  3AG2 H;  3COA C;  1RKW A;  2E5N A;  5K5Q A;  1KA8 A;  2CH0 A;  2JN6 A;  3J80 K;  3H5R A;  2BEO A;  2DYR H;  2ZSH B;  3I71 A;  3MCZ A;  3OY9 A;  3A01 A;  3TP3 A;  2I8D A;  4OWR B;  4EV0 A;  2X1D A;  3K2A A;  2OUM A;  5GPC A;  1P7I A;  2K9L A;  4E7K A;  3CUQ C;  2ZXJ A;  2QVO A;  3N4M A;  4CZZ A;  1JGG A;  1FOK A;  1ETY A;  4IHX A;  3RSN A;  3VYS B;  3Q0W A;  5CVJ A;  4CXF A;  1J7K A;  3DBR B;  3J81 K;  1P4X A;  1YX5 A;  2VPL A;  1OMI A;  4E7Z A;  4M6V A;  2B9S A;  5LEJ A;  2I5U A;  4LK1 F;  2F48 A;  4BS9 A;  1Y0U A;  5IP9 J;  3V42 A;  1OYW A;  2IA2 A;  4KIB A;  3SXY A;  1BL0 A;  3I59 A;  5JHF A;  3HPG A;  1MND A;  3HOV J;  3TGN A;  4RGX A;  4LG3 A;  4GDF A;  5K5R A;  3K4L A;  2XRN A;  3VPR A;  2E1M C;  4ESB A;  1FNN A;  3PFY A;  2COB A;  2DQR A;  3VFZ A;  1H9T A;  4F55 A;  5HS8 A;  2W00 A;  2DA4 A;  3L2V A;  1MMD A;  4BDZ A;  2LBF A;  1D0Z A;  2F5E A;  4EGY A;  1A04 A;  3RKQ A;  4A3I J;  2OCE A;  3BQY A;  4A12 A;  1D0Y A;  5JFR A;  4OIQ F;  5L3F A;  2ESN A;  2V1X A;  2JJ7 A;  1LFP A;  3S2D J;  2JSC A;  3Q3S A;  2PG4 A;  2EIK H;  3IWZ A;  4G12 A;  4KN4 X;  1S6L A;  3LSG A;  2R7X A;  4CIC A;  5GPA A;  3W3C A;  2ME0 A;  4Y13 A;  2M2E A;  2V4J C;  4F91 B;  1EJ9 A;  1FOY A;  2VL8 A;  5J47 A;  5CVV A;  3JSO A;  1FLI A;  2XHK A;  4HA8 A;  1OPC A;  4IJA A;  4NUB A;  3BTI A;  3ERE D;  1P4W A;  3KIO A;  1HF0 A;  1FBS A;  1D1C A;  2VKE A;  3BCA A;  2LYC A;  3I0T A;  4CCK A;  3KZZ A;  3MVP A;  3VSK A;  1GV5 A;  2E1O A;  2W25 A;  3EQL F;  4BU2 A;  1R1T A;  1GXQ A;  2A61 A;  4B09 A;  4H0E A;  3K10 A;  3TOA A;  3U1D A;  2Q8K A;  2Z5U A;  1O3Q A;  3CJQ B;  2YX7 A;  4MQV A;  3GO5 A;  1K83 J;  3GZN B;  3LFU A;  3WGH A;  4YFK F;  1VQM I;  1ZTR A;  1V5F A;  2DK5 A;  2PN6 A;  4MQ9 F;  1Z77 A;  3E0J B;  4S04 A;  2ECB A;  1Z7U A;  3BLY A;  4PSW A;  5EJC A;  3WGG A;  1MD0 A;  2VJ4 A;  1ZGA A;  3KE2 A;  5J4Y A;  2DMQ A;  3KYD B;  4BUP A;  1FYL A;  2JA2 A;  4P9U A;  4CCM A;  2B0L A;  3DV8 A;  1OCR H;  2M34 A;  3BPX A;  3ROU A;  3JRC A;  2IGM A;  4XKW A;  2EFO A;  5DS9 A;  2VXD A;  2YU9 J;  3CME I;  5F1J A;  3ABK H;  2IW5 A;  3LA7 A;  2MLK A;  2E1C A;  1IW7 F;  3D5R C;  3R4K A;  1S9H A;  3G71 I;  1BI3 A;  1O57 A;  2YS9 A;  5FLX Z;  2QLZ A;  2M30 A;  2NXN B;  5H6Q A;  3S93 A;  3U2R A;  1R4N B;  4EJO A;  3I55 I;  3FBN B;  3JRB A;  4J01 A;  3EET A;  2Y31 A;  4LIT A;  1D3Y A;  1ETX A;  5HDN A;  2IS4 A;  4L9V A;  2VOP A;  1WH7 A;  1ZG1 A;  1F5T A;  2BHY A;  3L00 A;  4M9S A;  1T0F C;  3FX3 A;  3FXK A;  3K69 A;  3ZRG A;  2FQ3 A;  4L5E A;  1HW5 A;  4EM0 B;  4XM3 A;  1L3L A;  1APL C;  2E35 A;  3QP5 A;  4QIW N;  3HUG B;  4U87 A;  1KZH A;  2H1K A;  2DA7 A;  2HZT A;  4XN3 A;  3ZOB A;  4FE7 A;  1R1U A;  1HXD A;  3S2H J;  3I64 A;  5KHD A;  2E34 A;  2L4M A;  3CTA A;  4II3 A;  1IAW A;  2L9V A;  5KK1 A;  2ELK A;  3OYN A;  2A68 F;  3GWZ A;  1PJR A;  2K9S A;  2FNP A;  2KMU A;  4P5O A;  2RC4 A;  5D4S A;  1OKR A;  3GME A;  5J1Y A;  1T38 A;  3AL0 B;  3BDD A;  2K4J A;  1YS7 A;  2WB1 A;  4I0B A;  2VJI A;  2FOK A;  3K4M A;  5EEG A;  4F92 B;  3V4G A;  5M5W J;  3UNG C;  1BJZ A;  2DDB A;  1HQC A;  1SFE A;  1K7A A;  3CCY A;  3S1R J;  3KZI C;  2LF8 A;  4ENN A;  4U88 A;  4YEJ A;  1WJF A;  1XSV A;  2L4A A;  1HW1 A;  3V8K A;  3TMO A;  4Y15 A;  3CF5 F;  5BOX A;  3HGG A;  4RGU A;  3JTG A;  2FMY A;  2R93 J;  5JLX A;  1MH3 A;  2V9V A;  1B9N A;  1WJB A;  4B47 A;  3CDH A;  3PQJ A;  2OPT A;  3CCS I;  1A5J A;  3L9F A;  5D4R A;  3V7S A;  1ZHF A;  1A36 A;  4JP0 A;  2L9N A;  4A6E A;  4WX9 A;  2LNB A;  2WY7 Q;  4AM3 A;  1ZAO A;  3C7J A;  5CYV A;  5JVG F;  2F5F A;  2IAI A;  2Z33 A;  2IS6 A;  2LR8 A;  1W5S A;  3FXL A;  3BJ6 A;  1FC3 A;  2CV2 A;  3FXU A;  2VJJ A;  4D7M A;  3RQI A;  4ENM A;  1NHA A;  2LY9 A;  5TRD A;  3HDD A;  2CUE A;  2WAE A;  5M5X J;  3BTJ A;  2FOW A;  3GTP J;  2ADU A;  5GTI C;  4IXA A;  3IRQ A;  2ISY A;  3E6M A;  5TGT A;  4GO1 A;  1YLF A;  2K40 A;  4MFE A;  1YRN B;  3DKX A;  4OMY A;  3HEF A;  1UJ8 A;  2F5D A;  1YX3 A;  5FB2 A;  2EH3 A;  2V6E A;  3ZQG A;  2DPD A;  3ZMZ A;  1ON1 A;  3LFK A;  5FKM A;  2VPR A;  3L2Q A;  1T08 B;  1IRX A;  2O0Y A;  3RDI A;  2HPI A;  1I39 A;  3IAS 2;  1D0X A;  5C4J J;  2ME6 A;  1VQ6 I;  2H8W A;  2FML A;  1PYV A;  1XCB A;  3F6O A;  3CCL I;  2NOJ B;  2XIG A;  5ICG A;  3HBL A;  1HSJ A;  2Y0M A;  3RKY A;  2LKX A;  2MFZ A;  1LFB A;  2JVH A;  2ZME A;  4AIJ A;  1KQ9 A;  3D0S A;  3NEU A;  1V54 H;  4DNC A;  4KA4 A;  2DXI A;  1IRF A;  2V1D A;  2BXZ A;  5IYB J;  5D6F A;  2NVY J;  3OYC A;  3WE2 A;  1VI0 A;  1OIS A;  3KFW X;  3WU0 A;  1QVU A;  4I09 A;  1RET A;  5L3E A;  4L5I A;  2WAQ N;  3JSP A;  2KZG A;  4Z2Y A;  4C3I J;  4OU0 A;  1YJ9 I;  1T6S A;  2X4H A;  5DTD A;  1TNS A;  3D5L A;  3HSR A;  2FXA A;  2W4S A;  3WTU C;  1UG0 A;  1A31 A;  4HG2 A;  2BOL A;  1ZEL A;  3KEQ A;  3HRU A;  1QZE A;  2RNG A;  4LGW A;  3FIS A;  4AIK A;  3U1K A;  1K4S A;  4HDU A;  3ZQI A;  1WZ2 A;  1XN7 A;  3EYY A;  4HPQ A;  1R5I D;  3HHG A;  4RMN A;  2KL4 A;  1OLT A;  2LH9 A;  2WTE A;  1VQL I;  2NRA C;  3L2C A;  3TL4 X;  2UUZ A;  5HDG A;  1P9Q C;  3K4C A;  3JRA A;  5BPI A;  4E6K G;  3DLA A;  2EB7 A;  4YII A;  2OTL I;  1FBU A;  3QP6 A;  3WU2 C;  2I10 A;  4P96 A;  3BCB A;  1TQI A;  5K7F A;  1E3O C;  1G3T A;  3J80 Z;  3L2R A;  1ON2 A;  4ZYA A;  2EJR A;  4M71 A;  5HVQ C;  2LY1 A;  5DM7 F;  3K4N A;  5J8C A;  4M3B A;  3QYF A;  4BXX J;  2DFI A;  3G1L A;  4ENK A;  2CW8 A;  9ANT A;  2M45 A;  3JRH A;  2W1O A;  3C2H A;  4I2O A;  1K78 B;  3DKW A;  1RR7 A;  3H5A A;  3LA3 A;  1SFO J;  3J81 Z;  1ZH5 A;  2O8X A;  3CLQ A;  3F0C A;  3ASN H;  4N0B A;  4LD5 A;  5GP9 A;  2HVQ A;  5DCM A;  3J7Z I;  3PQK A;  3FBI B;  2V9K A;  2ZJP F;  4LLL A;  2EZK A;  1JJ6 C;  4BBS J;  3EPZ A;  1WRJ A;  1F1Z A;  2WB1 N;  5CVR A;  1IRZ A;  2GOM A;  3HG9 A;  5ICC A;  5B1A H;  1YJW I;  2CW7 A;  4UB6 C;  5EYR A;  1SAX A;  5L3G A;  4UVA A;  3H5N A;  2X51 A;  4MHG A;  1DPU A;  2LRE A;  1K78 A;  3M8J A;  1Z05 A;  3L1P A;  4HYE A;  2GXA A;  3W6K B;  1RNL A;  1FTZ A;  4HX8 A;  2K4B A;  2R7W A;  2PFB A;  2HDD A;  2QGU A;  1Y56 A;  4M3F A;  2HOT A;  1ZQ3 P;  1A6Q A;  4HV6 A;  2X85 A;  2XPW A;  4LB5 A;  3LQR A;  2DLL A;  1W7P B;  5H6R A;  1WQ2 A;  1P7J A;  4UUS B;  1MJB A;  1VQ5 I;  2L0K A;  5LRR A;  4F93 B;  3JRD A;  4IRI A;  3CDI A;  2K9Q A;  2ZXI A;  4B43 A;  4M9X A;  4WCG A;  3PIP F;  3GZ6 A;  1QHG A;  4I98 B;  2HGC A;  1G6N A;  2TDX A;  2IP2 A;  2KHM A;  5E3N A;  1ZG5 A;  3RPU D;  2LK2 A;  2NNY A;  3ERM A;  2O3F A;  4UUT A;  1B9M A;  1FBQ A;  2W48 A;  4OAY A;  1Z0X A;  4RAG A;  4BYY A;  3K70 C;  3FHZ A;  2DN0 A;  1G3W A;  3CQZ J;  3DBH B;  3T8R A;  4UUS A;  5IOY A;  4PFO A;  2CFX A;  1VND A;  4II2 A;  1W0U A;  4QWQ A;  4UV8 A;  1Y1W J;  2OD5 A;  2ZBK A;  3HOY J;  3O2P E;  4M6X A;  1J09 A;  2A6E F;  3F8F A;  4CGZ A;  1QGP A;  1V5E A;  2BBY A;  3E6C C;  3KLO A;  3CJT B;  2P5K A;  3E5X A;  5FJ8 J;  2DA1 A;  1FT9 A;  2QSH X;  4XR6 A;  2KFD A;  1U9N A;  4C2U A;  3I54 A;  3MFK A;  3K1N A;  3FF5 A;  4LLG F;  1UZC A;  3ZPL A;  2PEX A;  4XOR A;  2GXB A;  3P5J A;  2RKH A;  4LJZ F;  3OYF A;  3HSE A;  2AXT C;  5FRO A;  3OYK A;  5EGO A;  1E2X A;  2GOX B;  2HYG D;  2KQR A;  3WTV C;  1HKQ A;  2L02 A;  3CCV I;  4KT5 C;  4DBQ A;  5HLH A;  4XLF A;  1QRY A;  2NS8 A;  4B3A A;  4A0Z A;  1E3H A;  3CMA I;  4IOA F;  2FBI A;  2QQ8 A;  3JRF A;  1S7E A;  5EEA A;  2DMT A;  3DTE A;  2R7S A;  2IPQ X;  1R49 A;  4UHT A;  2KDO A;  4A2U A;  4LFU A;  3MKZ A;  4J00 A;  1MBH A;  1WI9 A;  4PDK A;  5JLW A;  3HTU A;  3CO7 C;  3ZQL A;  3LSK A;  2VLA A;  1OCP A;  2VT3 A;  4AUX A;  3FXQ A;  3HRS A;  3LA2 A;  3LAP A;  4PCQ A;  1BC7 C;  5LHG A;  2PMZ A;  1JHH A;  3TW6 A;  1MMG A;  5DEQ A;  3W2V A;  1IF1 A;  4L18 B;  4M3E A;  2FSW A;  2Y0S N;  3HTS B;  3NWT A;  3NAU A;  3W2W A;  1GHC A;  1X1A A;  2OQG A;  4BKX A;  5E17 F;  1AOY A;  3MZH A;  1Z3Y A;  1D5V A;  2CG4 A;  1GUU A;  1PVE A;  3GYH X;  1W5C C;  3PNY A;  3HZJ A;  3DEW A;  3QAH A;  1R22 A;  2JWT A;  4AID A;  4HLY A;  2FRH A;  3BQZ A;  2CQQ A;  1WWX A;  2HOE A;  3BZ6 A;  4A3L J;  2VQG A;  3LST A;  2G7U A;  2DFF A;  4M9Z A;  3RYP A;  2V26 A;  4IRG A;  2IS2 A;  4HF0 A;  1RKT A;  1I27 A;  2HXI A;  1ZRE A;  2STW A;  3Q9V A;  4AYB N;  1YW8 A;  3DF8 A;  3O3K A;  4PK4 A;  2F5V A;  2R5Y A;  3BZK A;  1KGS A;  3V7C A;  4E70 A;  3DBL B;  1F36 A;  1TLH B;  3KZY A;  2IT0 A;  3G6E I;  2EV6 A;  3AG3 H;  3GTM J;  3RYR A;  2HVR A;  4Y7N J;  1YE9 A;  3I9V 2;  4BAY A;  4A93 J;  4IHW A;  2QZ8 A;  5K5O A;  3BZC A;  4W97 A;  2E19 A;  1H89 C;  4OAZ A;  2PI0 A;  2A5W A;  2ICW G;  4A69 C;  2IGK A;  1RC9 A;  2X9D A;  1SD5 A;  1ORK A;  5M5Y J;  3PNT A;  2JT1 A;  3ZQH A;  3RKW A;  1FP2 A;  1ZG3 A;  3WGI A;  1DQU A;  1O3R A;  2E7W A;  4N4N B;  2VKD A;  4M74 A;  2V6C A;  2HEO A;  2VJ5 A;  2DMU A;  5DD4 A;  1RUN A;  1EH7 A;  1TWH J;  3PUF A;  1J0R A;  1JKQ C;  1XPX A;  1O7L A;  4N9H A;  2DBB A;  1LFU P;  3TQN A;  1MMA A;  4K2E A;  1BR1 A;  2GIZ A;  2DMP A;  1FPQ A;  2FUG 2;  4HX7 A;  3AG4 H;  2M5W A;  1K61 A;  2HPM A;  4LMY A;  2YSR A;  4MFD A;  3HKZ N;  4DJA A;  1TQP A;  1B72 A;  2N8G A;  1Q1H A;  3ZN1 A;  5FRM A;  3MZY A;  1J2X A;  4FHT A;  3I59 B;  5F1R A;  3OOU A;  2EFW A;  4ZZD A;  1M1E B;  3I4P A;  1NG6 A;  1SVM A;  4GCV A;  3PO3 J;  4CA0 A;  3OSG A;  2VE8 A;  5E1W A;  4CH7 A;  2F4O B;  2BGC A;  3IHU A;  3FZV A;  1XTA A;  2DT5 A;  3ZN0 A;  2LBF B;  2P0W A;  3I4M J;  1OFC X;  1ZN2 A;  2MW8 A;  2MYS A;  3BR2 A;  2AS5 F;  3C18 A;  5FKO A;  2FBH A;  5C3E J;  2QQB A;  2DOD A;  2VBW A;  1JE8 A;  3ULQ B;  3H3U A;  4ASN A;  3WTT C;  1X3W B;  1R6R A;  1TWG J;  1P6R A;  2M4G A;  4Q4Z F;  2V79 A;  2KP6 A;  4RGS A;  2PQ8 A;  2BVM A;  1R4M B;  2DFE A;  4G8X A;  2MAB A;  1VQ9 I;  4HST A;  3BP8 A;  1KON A;  3CCU I;  2NS7 A;  1XC5 A;  2GLO A;  2E1N A;  3K6G A;  1O3S A;  1WGX A;  1I1G A;  3UR3 C;  4B8X A;  3HB9 A;  4O3M A;  2XGE A;  1I6H J;  3K4B A;  2ZJ2 A;  4XSX F;  4I0A A;  4O5V A;  1YIJ I;  1Z91 A;  4A0Y A;  3S32 A;  2HU9 A;  3MWM A;  4QLC U;  5TJJ A;  3BR5 A;  4KUM A;  1ZLK A;  4BGD A;  5B5E C;  3D5S C;  3TP0 A;  1WKM A;  3REO A;  1POG A;  4BXU A;  4EJT A;  1IDZ A;  4NNJ A;  1YI2 I;  2UWM A;  3DEE A;  4U7D A;  2HWV A;  1B1B A;  4LIV A;  2XAS A;  2X6O A;  1I3A A;  1S7O A;  2VXZ A;  2KLO A;  2NYX A;  1MJA A;  2VC0 A;  3QPS A;  3LSH A;  1LVK A;  4BHP A;  3KET A;  3AL0 C;  4XRS G;  2GQQ A;  4F7Z A;  1CGP A;  1VF9 A;  2NVT J;  1I6X A;  4HSR A;  4PJ0 C;  4DZJ A;  3PNV A;  3PL8 A;  1BI0 A;  1LVA A;  3GFM A;  1ZKG A;  4C3H J;  1GV2 A;  1X2N A;  2K5C A;  2A05 A;  1SD6 A;  3IUO A;  3GF2 A;  3M3Y J;  1KYW A;  2ESH A;  2KRF A;  3IH2 A;  3RPQ A;  2M1B A;  5FLM J;  1QHH D;  3OMY A;  1X1P A;  4IL6 C;  3WHB A;  4JYK A;  2H6C A;  3FXR A;  2CV0 A;  4DQ2 A;  3WTS C;  3B73 A;  1QU3 A;  4GGG A;  1SVL A;  3BG5 A;  4NHJ A;  3VYR B;  1N78 A;  2NOG A;  1JUP A;  5KAI C;  3S2W A;  2A5Y B;  4S0H B;  2BVL A;  2P81 A;  4L9T A;  1W36 C;  4ZDL A;  5J4V A;  1MMS A;  2EK5 A;  5FGM A;  2J5P A;  2LSO A;  3ZMT A;  2HVS A;  3QRF F;  2MSY A;  2Q1Z B;  3QPH A;  3OS1 A;  2M7B A;  1U3E M;  4PSX A;  3AFH A;  1H8A C;  1JUM A;  2LF7 A;  1V3F A;  3FKI J;  4KIF A;  2EZI A;  2XAJ A;  1SC7 A;  4UB8 C;  4BBR J;  4FT8 A;  4XNF A;  3C3W A;  1DP7 P;  4FX4 A;  4EAT A;  2F5C A;  2L7Z A;  4HDV A;  5GAH J;  1IC8 A;  2FJ1 A;  2RRE A;  2ZME C;  4JX5 A;  4DZP A;  4UNO A;  5D5U B;  3RPU A;  4BXF A;  3CP2 A;  3MKY B;  1W7P D;  1RPW A;  2HQN A;  2YUS A;  1FJL A;  5LFA A;  4G7Z F;  3W6J B;  2CQK A;  3TO7 A;  5J1R A;  5LRS A;  2NVQ J;  3BTC A;  4N9I A;  2LKS A;  3IWF A;  4A6D A;  2R5Z A;  1JXS A;  1W4M A;  2LMD A;  2A69 F;  1HCR A;  2KDZ A;  2GAU A;  4KN7 X;  3LQQ A;  3ML6 A;  2K9M A;  3E5U A;  2LY2 A;  2KZV A;  5LD2 C;  4Z6Y A;  1LKX A;  1JKP C;  4DYC A;  5IT9 K;  2LP0 A;  3ESW B;  1FP1 D;  2E60 A;  5F6F A;  2NAZ A;  3WG7 H;  3RZD J;  2HKO A;  4MTD A;  1T39 A;  1WH5 A;  1OCZ H;  4DOZ A;  3OV8 A;  4BQA A;  1ETW A;  1UHM A;  2DQL A;  2L2O A;  4PJM A;  2DT7 B;  3EUA A;  1K6Y A;  2IJL A;  3FMQ A;  4HX4 A;  2V9P A;  1IJW C;  2P4W A;  2XAQ A;  3A02 A;  3BR1 A;  4XRM A;  1YS6 A;  2RV8 A;  4YIR X;  2R7O A;  5FFX A;  4HW0 A;  4RB0 A;  5FD6 A;  4FCY A;  2CUJ A;  4RS8 A;  5HOD A;  2AHQ A;  3J7A O;  3ZQQ A;  4IHT A;  3ECO A;  4M6Y A;  3GTG J;  1HKS A;  5M3M J;  3OYD A;  3LAJ A;  2EA4 A;  3J7Y J;  2R7Z J;  2MH2 A;  4PGG A;  3E97 A;  2KIM A;  2MC4 A;  3GCM A;  4UVC A;  3CJR B;  4RA2 A;  1MJ9 A;  3IH3 A;  3E5Q A;  2IA0 A;  1LQ1 A;  3CCR I;  1YIO A;  3A0H C;  5LBQ A;  2O5R A;  3H35 A;  3O8G A;  3EUK L;  4U0W A;  3WTZ A;  1ACI A;  3BG9 A;  1DGW Y;  3TW7 A;  4FAS D;  1AWC A;  2H09 A;  5IP6 A;  1H9G A;  2X6Y A;  1BC8 C;  3MAJ A;  3OOP A;  4BY1 J;  2R7R A;  5FD5 A;  1ZR4 A;  4AC0 A;  2GA2 A;  3DU5 A;  3AKZ A;  1BOB A;  3H9G A;  4JX6 A;  1XSX A;  3CCJ I;  1NTC A;  4Y3O A;  5CQG A;  1YFH A;  4KNY A;  3CDL A;  2LDU A;  3RJP A;  2M8G X;  1U8B A;  2C6Y A;  2K3P A;  1S8N A;  5B3S H;  2EFN A;  3FXJ A;  1GDT A;  4TV7 A;  4U7B A;  1B8I B;  1X3U A;  4XSZ F;  4OIN F;  3D1N I;  1PUE E;  5F0F A;  4RBO A;  5J8F A;  2XV4 S;  5CPR B;  3L09 A;  4EM1 A;  3CMM A;  2ZME B;  4HRI A;  4KIC A;  2FQ4 A;  2VOO A;  2QF7 A;  2VOD A;  1C0W A;  3H9J A;  1S29 A;  1X58 A;  4FTH A;  4BH9 A;  3PIO F;  2IGO A;  1P4A A;  2JPB A;  2QA4 I;  4S05 A;  3KP3 A;  3G3Z A;  4WK8 F;  2KIS A;  3BOQ A;  1QNT A;  1VQ8 I;  3ZMV A;  5HOO A;  1ZRF A;  5L3D A;  2FD5 A;  4H4K C;  3TO6 A;  3R6S A;  1KYZ A;  3LSP A;  4Q5S F;  1B8I A;  3WOD F;  1J75 A;  5KVR A;  4XOT A;  2DK8 A;  5IYC J;  3QQA A;  2XRL A;  3JRG A;  3TKY A;  4OIP F;  4RLF A;  1ITY A;  2JA6 J;  2H94 A;  3MMY B;  4HBL A;  4L9N A;  2IVM A;  5E3M A;  2R7T A;  2CWE A;  4D1Q A;  3M07 A;  2BZT A;  2ZFU A;  2JRT A;  5E79 C;  4KIT B;  1TP4 A;  4G7H F;  2CJJ A;  1G2H A;  5GAG J;  1WVR A;  2VQC A;  5H20 A;  2UXN A;  4BEH A;  4D7N A;  1EH6 A;  4BHC A;  2GIV A;  3RI4 A;  5LGU A;  1K4T A;  1TC3 C;  2L7F P;  1FWZ A;  5M3F J;  1H0M A;  4G7O F;  4Y52 J;  1DP3 A;  4LOC A;  4AWX B;  4LG0 A;  3GFI A;  1R1V A;  2CUZ A;  5IYD J;  1LDK B;  3ZMS A;  4Y4R A;  5E8I A;  1Y39 A;  2JSP A;  5ILS A;  4CUG A;  3V8J A;  4DGW B;  2P7C B;  4AVP A;  4IO9 F;  2JTV A;  4A3B J;  4KT6 A;  3O6B B;  5K7H A;  3N97 A;  3GTK J;  4J19 A;  4XL9 A;  5LGT A;  2X48 A;  3FWE A;  4QPQ A;  1QZZ A;  5BMZ A;  2LVS A;  2COM A;  3K1P A;  4HQM A;  3RQ4 A;  1TL8 A;  3BT9 A;  2MG4 A;  2F4M B;  2A6T A;  2WAD A;  5DCM B;  2NVU B;  5EG0 A;  1YIT I;  3BY6 A;  1ULY A;  4CHU A;  2FBK A;  2JUG A;  2A07 F;  3HC7 A;  3HGY A;  4BJT A;  1HDD C;  2H6B A;  1BN5 A;  3N05 A;  1T56 A;  2KIQ A;  1UB9 A;  3I53 A;  1VQO I;  1ZLJ A;  4I01 A;  2M7A A;  4HNT A;  4KDP A;  3KEY A;  3SZG A;  3CC7 I;  2IBD A;  3T0Y A;  2R92 J;  3IKV A;  3CCM I;  3U9G A;  2DOA A;  4BE1 A;  1I1S A;  1NH3 A;  3QU3 A;  2NVX J;  1IN4 A;  3H92 A;  2Y2Z A;  3VSL A;  1LEB A;  3C2G A;  1BJA A;  1EA3 A;  1Z9C A;  3S14 J;  4WF2 A;  2XDV A;  2ZKZ A;  4NQW B;  2VC1 A;  4KJZ A;  1ZGW A;  1TZL A;  4U0Y A;  3GLX A;  4ABZ A;  4CYC B;  3A2K A;  5E3L A;  4IOC F;  3SQN A;  3S1M J;  1T2K A;  2EIN H;  3JRI A;  2LKP A;  2YR2 A;  3ECH A;  1MZB A;  4L9J A;  4IVN A;  2CQ7 A;  2BV6 A;  3F8M A;  1DUX C;  1DPR A;  4B1R A;  4ZYE A;  2JK3 A;  5J40 A;  2ZC2 A;  1ZRD A;  3H36 A;  2VKV A;  5D8K B;  1IO2 A;  1DDN A;  4EMS A;  2BE5 F;  3WE3 A;  2HQ5 A;  2X1C A;  2W7N A;  4NQW A;  2WWY A;  3AAF A;  2UZK A;  2ACJ A;  2PLY A;  5HLG A;  1OCT C;  3M9A A;  5IPA A;  3OYI A;  4CYC A;  2JRM A;  5D5W B;  1O4X A;  5EF6 A;  5C44 J;  1UG2 A;  4A3M J;  2ZXW H;  2IEK A;  1RI7 A;  2VN2 A;  4RM2 A;  3CMY A;  1E17 A;  5CKT A;  1YW9 A;  4AD9 A;  1V5G A;  1FY7 A;  4IHV A;  2CRG A;  2HOA A;  4CO8 A;  3TOB A;  2EZH A;  2JVG A;  2K86 A;  4XKC A;  1SFU A;  1IUF A;  1FSE A;  5GAD J;  2HTJ A;  3HOS A;  4ZTF A;  3OYH A;  3DKY A;  1XS9 A;  3W6V A;  5F0C A;  4AU7 A;  1IV6 A;  2QM3 A;  3ABU A;  2DDA A;  3FHN A;  1VQN I;  4KFC A;  3M8F A;  3RKX A;  4EVI A;  5EGO B;  2XAG A;  3FK7 A;  2TRT A;  2XGC A;  4IQ4 A;  1KU3 A;  4BJ5 C;  1NK2 P;  5CLS A;  3VB2 A;  5DCF A;  3PO2 J;  5L3B A;  1HLV A;  3Q0V A;  2L54 A;  1TNT A;  4LLN A;  1XMX A;  2R7U A;  3PM1 A;  4Y33 A;  4ESF A;  4M3G A;  1DU0 A;  3FM3 A;  2Q2E A;  5CVI A;  1DU6 A;  2WV1 A;  1MSE C;  2H8R A;  4JK1 X;  1Y6I A;  2EIL H;  2FE3 A;  4B4C A;  2K9N A;  5BPD A;  1OCO H;  1XDS A;  3RIR A;  4ON0 A;  2CGP A;  2LFB A;  1KU7 A;  1JGS A;  2OZU A;  1MNE A;  1TWA J;  4MNU A;  1USS A;  2BHZ A;  1NK3 P;  1E3P A;  4M3D A;  3ZCO A;  3WHC A;  1ZK8 A;  2L5Q A;  3OYE A;  2PX9 A;  3NRV A;  3CCQ I;  2EFP A;  2VAS A;  4KYW A;  3S3M A;  3KYC B;  1ZRC A;  3BPV A;  2XGX A;  3KPH A;  3MD2 A;  3QWL A;  2BYV E;  1F43 A;  3A1Y A;  3BTL A;  3S3N A;  4L0Z B;  2EIJ H;  1R58 A;  1SAU A;  3OWT A;  2QSF X;  2L01 A;  2J5O A;  1VQK I;  1GXP A;  1TWF J;  4I02 A;  2X6X A;  3RTR A;  3OYB A;  1VFC A;  3R0A A;  2V1N A;  2ETH A;  2HFH A;  2CQX A;  2OZ6 A;  1V4R A;  3B02 A;  5F04 A;  3VDX A;  4HQE A;  1PP7 U;  5IT9 Z;  3PFI A;  3ZQ7 A;  3FDY A;  3W2A A;  3F9K A;  3G1O A;  2V7F A;  3BC8 A;  4BAC A;  3BRO A;  1TT0 A;  2ZO4 A;  2CO5 A;  2CFO A;  6PAX A;  5B1B H;  3E3V A;  2QUF A;  1XCV A;  2R5Y B;  2A3S A;  3DTI A;  4I76 A;  2XF6 A;  2EV5 A;  4EGZ A;  3GX4 X;  1LEA A;  2XKP A;  4A3E J;  3KP6 A;  3WTY C;  1OYY A;  1X1D A;  5AON A;  2Y30 A;  5C4X J;  3E1S A;  2RQQ A;  1IXS B;  4B3X A;  3KP5 A;  1KU2 A;  2OJE D;  2OC6 A;  4WWC A;  3OYJ A;  2WBM A;  4QPO A;  4GYG A;  5H2F C;  3ZGK A;  4R8H A;  2XVC A;  1I3Q J;  1UEL B;  1WJE A;  4XIC A;  2E2H J;  1B4A A;  2BY2 A;  5LGN A;  3T5X A;  2F2E A;  3DTK A;  1D5Y A;  3HSF A;  1Z1D A;  4EJV A;  4E7L A;  2Q0O A;  3GUD A;  1I50 J;  1T33 A;  2Y9Y A;  5HS9 A;  4YFN F;  2DFH A;  3DU6 A;  4EQQ A;  4YIF A;  1TW3 A;  2O03 A;  3R61 A;  3LWF A;  5ICF A;  1R00 A;  4PUS A;  3OS0 A;  4PJL A;  3T8T A;  5D5V B;  2DI3 A;  4XLC A;  1BIA A;  4NC7 A;  4OOI A;  4M72 A;  4MIM A;  3DPT A;  1HC8 A;  2O7O A;  2FEZ A;  1ETV A;  1Z21 A;  5HLI A;  2A6H F;  2O6G E;  5IOZ A;  4XRS A;  2KKO A;  2DTZ A;  5EZG A;  5IT3 A;  1UCR A;  1B72 B;  4O6J A;  1N25 A;  1CF7 A;  2Z16 A;  3SEZ A;  1MGT A;  1OR7 C;  4E7I A;  2JA5 J;  4A5N A;  4A3G J;  2L9S A;  3ZMU A;  3CCE I;  1BBY A;  3F72 A;  1R5H A;  3VYU B;  2LOO A;  3RZO J;  5B66 C;  1IV8 A;  4X0G A;  1ETQ A;  3J7A Y;  3SZT A;  4XLE A;  2VON A;  1ZR2 A;  4IZZ A;  5LHH A;  5DUI A;  2L7K A;  4F3Q A;  2QEX I;  2K7L A;  4CCN A;  3UKG A;  3GZ5 A;  4UY8 I;  2VBX A;  1X3Z B;  5DDG A;  4PJN A;  3B6A A;  5CJ9 A;  2DJN A;  1SVO A;  4XKV A;  3R0J A;  4Q47 A;  1IN5 A;  3ZR8 X;  1CQT A;  3EUH A;  2G0E A;  4XLA A;  3M4O J;  3ELK A;  4XLH A;  5BNG A;  3TED A;  1MIJ A;  3M8E A;  1GT0 C;  1MDM A;  5KNL A;  4MO7 A;  5DD8 A;  5J3L A;  3PSI A;  1LE8 B;  1JJ8 C;  1NG7 A;  2KJC A;  1IG7 A;  3CUO A;  2W82 A;  1QA6 A;  3O8H A;  2Z99 A;  2B7E A;  2M3A A;  1W1W E;  4XID A;  1KQ0 A;  1WHU A;  5E18 F;  4MTE A;  2K02 A;  2Y75 A;  3GTL J;  4QSH A;  3OL3 A;  3BG3 A;  5CQE A;  2D1H A;  3SHF A;  4IRH A;  1D8J A;  2Y9Z A;  5BQT A;  1BW5 A;  3BR3 A;  2RN7 A;  2XPU A;  1XGO A;  2XB0 X;  5EZH A;  4JX4 A;  1UST A;  3CF2 A;  4FIS A;  1RES A;  1LE8 A;  1IN7 A;  1MBJ A;  3E7L A;  2MD5 A;  3M7G A;  3JAM Z;  1WCM J;  3GTJ J;  4EEF G;  5E1Z B;  2DT6 A;  1Z67 A;  4D5C A;  3S15 J;  3I5U A;  1TBX A;  2DO7 A;  3DXJ F;  1J9I A;  1JKR C;  1MKM A;  4DIQ A;  1HST A;  1YG2 A;  4CSW A;  3Q5F A;  2VKH A;  1YJN I;  2ZNZ A;  4L0Y B;  3IRR A;  5TIS C;  1V55 H;  1REP C;  1LUJ B;  2P8T A;  3VOD A;  4HF1 A;  1FOX A;  1A35 A;  3GFL A;  1J59 A;  2QYO A;  2XB5 A;  2VUM J;  4FE4 A;  2PMZ N;  2DPU A;  3FMS A;  3I3L A;  1HKT A;  4Q48 A;  4PFP A;  2P5L C;  2YX4 A;  3BWG A;  1B6A A;  2HKX A;  3F8N A;  2E71 A;  1VQ7 I;  1Q1V A;  3PJR A;  1XB4 A;  5K1Y A;  1GLN A;  4PGH A;  4YFX F;  2B63 J;  4HNV A;  3FKJ A;  4BE2 A;  1X4O A;  2FA5 A;  2QQ9 A;  1MMN A;  2LLK A;  4IHS A;  2R7Q A;  2KIU A;  2HDC A;  3IKT A;  3PUB A;  1FZP B;  2CUF A;  2DOF A;  3DCF A;  2LTP A;  2ZCW A;  2DMN A;  5JHU A;  2XSD C;  2JMW A;  2DCE A;  3HYI A;  4RM3 A;  2KT0 A;  3F21 A;  2ELJ A;  4CCO A;  5LHI A;  1BI2 A;  3WG9 A;  2X0L A;  2L3D A;  3AG1 H;  2ZXH A;  2VB6 A;  1WJA A;  3OYG A;  1XGN A;  3KLN A;  4HLX A;  2M8E A;  2R5Z B;  3MZ8 A;  3TBI A;  2UV1 A;  1OR7 A;  5FKK A;  2L9R A;  3GTQ J;  3BJO A;  1HW2 A;  1JUS A;  2QQA A;  1ZYR F;  1IZ1 A;  2KRH A;  3L7W A;  1VQP I;  4R79 A;  3S8P A;  2BY3 A;  1SD4 A;  4LK0 F;  1FSH A;  2XF5 A;  5FRN A;  3K2Z A;  2HXO A;  3SDG A;  2PJP A;  2EBI A;  4FX0 A;  4G9Y A;  3G1M A;  4BQQ A;  5E1X A;  3K4K A;  3GBG A;  1QPI A;  2G7H A;  1FYM A;  2ZJR F;  3EDP A;  2WAQ A;  3SDB A;  4IPA A;  1QQI A;  1XGS A;  5EDN A;  2X1E A;  3S1Q J;  2XAU A;  5JVT A;  1YO5 C;  3CUQ B;  2IA1 A;  3R60 A;  4IHY A;  2HYF A;  2CU7 A;  1O3T A;  3WTX C;  2Z2S B;  1U2W A;  4PZJ A;  1MH4 A;  2H1L A;  5FO5 A;  1BOA A;  4G6D A;  5A2Q K;  1Y0N A;  1W0T A;  5BS6 A;  2YU3 A;  1JHF A;  1WI3 A;  3MEX A;  3G73 A;  2GBY A;  3ZMD A;  1BA5 A;  1XMK A;  5HS7 A;  2EFQ A;  3LSI A;  3LL7 A;  4HAM A;  4MEY F;  3A4C A;  2KJB A;  2RQP A;  4P55 A;  1FOW A;  5E8G A;  2QSG X;  2WA0 A;  2BXY A;  1IGN A;  3FK6 A;  4A3F J;  2FF4 A;  2D1V A;  2Y48 A;  2AQF A;  2E1M B;  3BG6 A;  3CUQ A;  1HBX G;  2D5V A;  2M87 A;  1AHD P;  2L7M P;  4GXO A;  2EV0 A;  2VBY A;  4CCJ A;  4KIS A;  3CO6 C;  5J6X A;  5HNH A;  1U8R A;  1S72 I;  2FNA A;  1T95 A;  2X6W A;  3MKL A;  3ZQC A;  3JCU C;  2D45 A;  1SD7 A;  2EA2 A;  2QWW A;  4BY7 J;  3HOZ J;  3H3Z A;  3K4J A;  4ZTJ A;  1G59 A;  3CC2 I;  3S16 J;  4NBQ A;  4CCL A;  1R5G A;  2P5V A;  4KMF A;  2QKL B;  4XN0 A;  3GEZ A;  3HRT A;  1Z3X A;  2R7F A;  1PDN C;  3RCO A;  4HEA 2;  4G6Q A;  4C30 A;  3GLL A;  2NNN A;  4NDL A;  2BY0 A;  1R23 A;  2W57 A;  3CD6 I;  3HUG A;  3LMM A;  1WJ5 A;  3KP2 A;  2E2I J;  1PP8 F;  3HHH A;  3KEO A;  2CQN A;  3ASO H;  4ZJZ A;  2ECC A;  2OV7 A;  4BHB A;  2BY1 A;  4ZH4 F;  1QVT A;  4XRF A;  2HS5 A;  4XK4 A;  2TCT A;  1P92 A;  2EPF A;  3IC7 A;  2R0Q C;  3P7N A;  3OYA A;  2OAZ A;  1YOV B;  5L3C A;  1YW7 A;  2VT2 A;  1HOM A;  2XF7 A;  1UAA A;  1IUY A;  2JA7 J;  3M1E A;  2IXS A;  5KCM A;  1MBG A;  1D1B A;  1QPM A;  4E7J A;  2O9L A;  2JQ7 A;  5CVU A;  2G9W A;  3LSR A;  2FX0 A;  4MGR A;  5ERI A;  1T8I A;  1ETK A;  1EV7 A;  4L5J A;  4DBR A;  3HOW J;  3KCC A;  2M0C A;  4IF4 A;  1YHQ I;  1LDD A;  2PJR B;  2M9H A;  1ZGJ A;  3LSM A;  4GRI A;  1VTN C;  1UMQ A;  1EH8 A;  2RGV A;  4YG2 F;  3VEP A;  3TO9 A;  1WPK A;  3A03 A;  1FYK A;  3C1D A;  1JTY A;  1WJC A;  4OIR F;  3HOX J;  2QKM B;  1XX5 A;  1D1A A;  3DFG A;  4BEH B;  2VQL A;  2DA2 A;  4FQG A;  4PJJ A;  1IN6 A;  4HNU A;  4MEX F;  2P6T A;  3SFZ A;  3DWL E;  2VIX A;  1UHW A;  4JBA A;  4D5F A;  2ID6 A;  1U6G A;  3H0D A;  4LG0 B;  1Y8R B;  1BR2 A;  2HYJ A;  1RR8 C;  2PJR A;  4ZDP A;  5FKN A;  3NQO A;  2K27 A;  2LG4 A;  5DM6 F;  3K70 D;  2ZJQ F;  4CZC A;  4RAY A;  2HQA A;  2PMU A;  4AIH A;  3F23 A;  3NAR A;  2UXX A;  4V2G A;  1RRJ A;  5E20 A;  4NB5 A;  1N75 A;  4V19 K;  2XGD A;  2AXL A;  4BE0 A;  1J5Y A;  1G3Y A;  4RB1 A;  2HDW A;  3L2U A;  3ISP A;  2W84 A;  1YRN A;  2ZB9 A;  3CLO A;  1LNW A;  1X1B A;  5EG0 B;  4ZYD A;  3H0G J;  1Z6T A;  3WTW C;  5FKL A;  1Z7L A;  1EF4 A;  1BW6 A;  4ESJ A;  1MW7 A;  4XOP A;  1EKE A;  2ID3 A;  2KRC A;  4P9F A;  3WU1 B;  3MKW B;  3BR0 A;  5ILU A;  2STT A;  1F9N A;  2VI6 A;  2XAF A;  4MLO A;  3JAM K;  1T0F A;  1A6I A;  2DJI A;  2QEN A;  3F22 A;  3V7R A;  1U5T C;  5AIQ A;  1QZY A;  2QBY B;  1U78 A;  5E3O A;  5IY5 H;  2GXG A;  3P9K A;  3DPU A;  4A3D J;  4C2M J;  1SFK A;  1OQY A;  1PUF B;  4GFB A;  1FIA A;  5F08 A;  3VWB A;  4RAZ A;  4NC8 A;  4WXD A;  3L2W A;  4CYD A;  1AKH B;  1P2F A;  4IKF A;  4RGR A;  2BW3 B;  4P1W A;  2XSJ C;  2NS0 A;  4UVB A;  2WAF A;  4WXH A;  3JTH A;  1BR4 A;  3OYL A;  1F4K A;  1GVD A;  3K9T A;  4C9Y A;  2KIF A;  4A3C J;  1OCC H;  2QBY A;  2E2J J;  1LDJ A;  2P7V B;  3JW4 A;  3F8B A;  3K7A J;  4EJW A;  1JI8 A;  2GM4 A;  2Y0S A;  2RDP A;  2CYY A;  4IQJ A;  2O61 A;  5ICE A;  2WV0 A;  1TW2 A;  3P9I A;  3IL2 A;  3CP8 A;  3DPL C;  2DOE A;  2RVC A;  1PUF A;  2HQR A;  1IN8 A;  2DA5 A;  2ZSI B;  3DQV C;  1GVJ A;  2QCO A;  1FEX A;  5F64 A;  4EJU A;  1OYI A;  4C2T A;  1T98 A;  2AQE A;  1AKH A;  1G4D A;  2DA3 A;  2W85 A;  3HXL A;  5D5X B;  3KYL A;  2W24 A;  3OIP A;  3V8L A;  2BW3 A;  3I4N J;  4IEJ A;  1AA7 A;  3NWS A;  4V2F A;  1U9O A;  3MN2 A;  2ZFW A;  4B44 A;  5FLV A;  3HOU J;  1WJD A;  3LNQ A;  3HOT A;  2IS1 A;  1X4P A;  3X2Q H;  4AYB A;  3GW2 A;  2ZNY A;  4CDG A;  3CES A;  3BJA A;  3HJE A;  2F6C A;  2JZY A;  1IXC A;  1MBK A;  2DYS H;  2M4K A;  2YPR A;  5DYM A;  4JOM A;  1G3S A;  3OYM A;  4I6Z A;  3S3O A;  2O8K A;  3CZ6 A;  2DTR A;  2Z9O A;  1LJ9 A;  3DEU A;  3CJN A;  5FFZ A;  1RUO A;  3U21 A;  3HL2 A;  5DUK A;  4JQF A;  2MA3 A;  2V1U A;  5GAE J;  1WSU A;  2JA8 J;  3VOE A;  2F4I A;  3GFJ A;  4HV5 A;  1JT0 A;  1G8X A;  4YRV A;  1XDU A;  2R4G A;  1XGM A;  3SZP A;  2Z1D A;  1SAN A;  4DW6 A;  4BNC A;  1VQ4 I;  3GTO J;  1BM9 A;  3F8C A;  2Q2E B;  1U0J A;  4C3J J;  4XQF A;  2K85 A;  3I58 A;  3QOE A;  5LLQ A;  4BDY A;  3H3V K;  2OTJ I;  3MQ0 A;  1JKO C;  3KP7 A;  4BJ6 C;  3TDZ C;  5FLX K;  2DU9 A;  1E0E A;  2K3F A;  2DA6 A;  4HOB A;  1STZ A;  1R9T J;  2XUB A;  3FMR A;  3ONQ A;  4ZYG A;  4XMY A;  5JR3 A;  4RB2 C;  2XC7 A;  1H88 C;  4ZZL A;  2EZL A;  2VE9 A;  2EWN A;  2JUC A;  2XKO A;  4ANJ A;  1LPQ A;  4D0P A;  1Z6R A;  3SEQ A;  4UUV A;  2R7D A;  1U5T B;  4OIO F;  1XG1 A;  2AO9 A;  2VQH A;  3BR6 A;  5JI6 A;  4ENJ A;  4HZF A;  1MSF C;  3T1B A;  1X2M A;  3HKZ A;  4B48 A;  2ELH A;  1K79 A;  3PSF A;  4YEL A;  2GZW A;  2LD5 A;  4BQO A;  5LEK A;  2CW0 F;  2CV1 A;  1W7P A;  2EIM H;  3K1M A;  4ZYH A;  4XKB A;  3G2B A;  1ETO A;  1Y8Q B;  2JPC A;  3EUH C;  5KAF C;  2R7V A;  1RIO H;  4HF2 A;  1YQA A;  5HLT A;  5HNF A;  1YYV A;  2GWR A;  3Q0U A;  5D6E A;  2HNH A;  3SJM A;  5J1U A;  2MLG A;  5GTH C;  5EEH A;  1QBJ A;  1JT6 A;  1XSD A;  4X1E A;  1U5T A;  4RDU A;  2HZD A;  1FIP A;  3B6C A;  3OR2 C;  4NC6 A;  3IP4 B;  3LOC A;  3JRE A;  2P6S A;  3F6V A;  5D8L B;  1I5Z A;  4DYR A;  4XON A;  1YTY A;  1ONV A;  2OBP A;  4D9J A;  4EM2 A;  4R1H A;  1XD7 A;  3SYT A;  2E7X A;  4ZC3 A;  2CSO A;  3BG7 A;  5K7Z A;  3OSF A;  3S1N J;  4UXN A;  1IDY A;  3SFI A; 
#chains in the Genus database with same CATH homology
 1IJW C;  3BG3 A;  3A02 A;  3BR1 A;  4XRM A;  3S17 J;  3JRA A;  2Y9Z A;  4FCY A;  2I10 A;  1BW5 A;  5HOD A;  2AHQ A;  3BR3 A;  2XPU A;  5K7F A;  2XB0 X;  5EZH A;  1E3O C;  1UHS A;  4JX4 A;  4FIS A;  1RES A;  1LE8 A;  3GTG J;  5M3M J;  1MBJ A;  3E7L A;  4DYQ A;  3FIW A;  2R7Z J;  1MBF A;  1Y1V J;  1WCM J;  3GTJ J;  4M3B A;  4EEF G;  4D5C A;  4BXX J;  3G1L A;  2HI3 A;  3LSJ A;  9ANT A;  3S15 J;  1TWC J;  3JRH A;  1JKR C;  3IH3 A;  1RR7 A;  1SFO J;  2OF7 A;  3F0C A;  3O8G A;  2MGQ A;  2RAE A;  3BG9 A;  3TW7 A;  5GP9 A;  3IV5 A;  5IP6 A;  2XB5 A;  4BY1 J;  1ZR4 A;  2VUM J;  4FE4 A;  2PMZ N;  2EZK A;  1JJ6 C;  4BBS J;  4AC0 A;  2WB1 N;  1IRZ A;  5EYR A;  4JX6 A;  1NTC A;  1Q1V A;  3CDL A;  5F27 A;  2M8G X;  1U8B A;  1MBE A;  1FTT A;  3L1P A;  2B63 J;  4HNV A;  1GDT A;  1FTZ A;  2LLK A;  1MNM C;  3HM5 A;  1B8I B;  2HDD A;  3D1N I;  5F0F A;  4RBO A;  2CUF A;  3DCF A;  2LTP A;  4M3F A;  4A3J J;  3JR9 A;  2HOT A;  2DMN A;  1ZQ3 P;  2XSD C;  2JMW A;  2XPW A;  1JTX A;  1OJL A;  2KT0 A;  4A3K J;  2FQ4 A;  2QF7 A;  2HOS A;  3ZQF A;  4UUS B;  1P7J A;  1X58 A;  4FTH A;  5IP7 J;  2L0K A;  3JRD A;  2R5Z B;  4X6A J;  3OIO A;  2K9Q A;  1HDP A;  5FKK A;  2L9R A;  3GTQ J;  2XPV A;  1JUS A;  2FD5 A;  3LSP A;  1B8I A;  5E3N A;  2HXO A;  2LK2 A;  3QQA A;  3SDG A;  2EBI A;  5IYC J;  2EQR A;  2XRL A;  4UUT A;  3JRG A;  2W48 A;  3QPL A;  1ITY A;  3G1M A;  1Z0X A;  2JA6 J;  3A01 B;  1ENH A;  2DN0 A;  3GBG A;  3CQZ J;  1QPI A;  5E3M A;  4UUS A;  5IOY A;  3IH4 A;  1VND A;  4W1U A;  5EDN A;  1W0U A;  3C2B A;  3S1Q J;  1Y1W J;  3HOY J;  4IHY A;  5F0H A;  2CJJ A;  2CU7 A;  1G2H A;  4QTR A;  1MH4 A;  1AU7 A;  5FJ8 J;  4D7N A;  2DA1 A;  1W0T A;  1U9N A;  1WI3 A;  2GBY A;  1RKW A;  2L7F P;  1TC3 C;  5M3F J;  4Y52 J;  1BA5 A;  2JN6 A;  4LOC A;  5IYD J;  3A01 A;  3TP3 A;  1IGN A;  3FK6 A;  5GPC A;  3K2A A;  5EGO A;  4A3F J;  1P7I A;  4A3B J;  1JGG A;  5K7H A;  1ETY A;  4IHX A;  2D5V A;  1AHD P;  3GTK J;  4J19 A;  1QRY A;  2L7M P;  2NS8 A;  2X48 A;  4B3A A;  3Q0W A;  2LVS A;  3BT9 A;  2MG4 A;  5EG0 A;  3MKL A;  3ZQC A;  4M6V A;  3JRF A;  1S7E A;  5EEA A;  2DMT A;  4BY7 J;  3HGY A;  5IP9 J;  3HOZ J;  1HDD C;  3S16 J;  1MBH A;  1BL0 A;  5JLW A;  3HOV J;  1T56 A;  3VPR A;  3ZQL A;  2COB A;  4NDL A;  2IBD A;  1OCP A;  2DA4 A;  2R92 J;  4AUX A;  2E2I J;  2NVX J;  3TW6 A;  3RKQ A;  4M3E A;  2Y2Z A;  3BQY A;  4A3I J;  2Y0S N;  2ECC A;  2JJ7 A;  3S14 J;  3NAU A;  3S2D J;  1QVT A;  1ZGW A;  4XK4 A;  4BKX A;  2TCT A;  3Q3S A;  4ABZ A;  2R0Q C;  4CYC B;  1GUU A;  4G12 A;  3LSG A;  5E3L A;  3S1M J;  3DEW A;  5GPA A;  2ME0 A;  2JWT A;  1HOM A;  3JRI A;  2M2E A;  3BQZ A;  2JA7 J;  2CQQ A;  4A3L J;  4B1R A;  1MBG A;  2O9L A;  2JK3 A;  3BTI A;  3LSR A;  1RKT A;  2HXI A;  2FX0 A;  2VKV A;  1HF0 A;  1ETK A;  4AYB N;  2HQ5 A;  2VKE A;  3HOW J;  2R5Y A;  3MVP A;  2M0C A;  1F36 A;  2M9H A;  3SFI A;  1GV5 A;  2E1O A;  1OCT C;  5IPA A;  4CYC A;  1UMQ A;  1O4X A;  3GTM J;  5C44 J;  1UG2 A;  4A3M J;  2IEK A;  4Y7N J;  4A93 J;  4IHW A;  3CMY A;  1WPK A;  3A03 A;  4W97 A;  1JTY A;  3HOX J;  1K83 J;  2E19 A;  1H89 C;  4IHV A;  2CRG A;  2HOA A;  1ZTR A;  2EZH A;  2DA2 A;  4A69 C;  1IUF A;  1Z77 A;  2ECB A;  2X9D A;  1XS9 A;  1ORK A;  3W6V A;  5F0C A;  1IV6 A;  5M5Y J;  3ZQH A;  4D5F A;  2ID6 A;  2HYJ A;  2DMQ A;  5FKN A;  2M34 A;  5EGO B;  3NAR A;  4V2G A;  3JRC A;  3FK7 A;  2TRT A;  2XGC A;  2DMU A;  1NK2 P;  5DS9 A;  2YU9 J;  1TWH J;  5F1J A;  1JKQ C;  3PO2 J;  2XGD A;  1HLV A;  3Q0V A;  1LFU P;  3PM1 A;  2DMP A;  1YRN A;  4M3G A;  2ZB9 A;  1K61 A;  2YS9 A;  1DU0 A;  5EG0 B;  3H0G J;  5FKL A;  4MFD A;  3HKZ N;  1DU6 A;  1BW6 A;  3JRB A;  2WV1 A;  1B72 A;  2N8G A;  1EF4 A;  2Y31 A;  1ETX A;  1MSE C;  2H8R A;  2ID3 A;  1WH7 A;  4B4C A;  2K9N A;  3BR0 A;  3OOU A;  2VI6 A;  2LFB A;  4MLO A;  4L5E A;  1A6I A;  1TWA J;  1APL C;  1NK3 P;  3PO3 J;  3OSG A;  4M3D A;  3WHC A;  1ZK8 A;  1U78 A;  5E3O A;  4QIW N;  2H1K A;  3I4M J;  4A3D J;  1OFC X;  2DA7 A;  2MW8 A;  3BR2 A;  3ZOB A;  5FKO A;  4FE7 A;  4C2M J;  1PUF B;  1F43 A;  5C3E J;  3S2H J;  4GFB A;  1FIA A;  3BTL A;  5F08 A;  1AKH B;  1TWG J;  1TWF J;  1VFC A;  2ELK A;  2CQX A;  5F04 A;  1GVD A;  2NS7 A;  1XC5 A;  2K9S A;  2GLO A;  4A3C J;  3G1O A;  2E2J J;  3K7A J;  1WGX A;  5J1Y A;  2GM4 A;  3HB9 A;  2XGE A;  1I6H J;  1PUF A;  2R5Y B;  2DA5 A;  4I76 A;  5M5W J;  1BJZ A;  2QCO A;  1FEX A;  3BR5 A;  3CCY A;  3S1R J;  4A3E J;  3TP0 A;  1AKH A;  2DA3 A;  1POG A;  3I4N J;  1IDZ A;  4IEJ A;  2Y30 A;  5C4X J;  4V2F A;  3HGG A;  1U9O A;  2X6O A;  3MN2 A;  5FLV A;  2R93 J;  5JLX A;  1MH3 A;  3QPS A;  3HOU J;  3LNQ A;  2OPT A;  1A5J A;  4XRS G;  1MBK A;  4I6Z A;  4JP0 A;  1VF9 A;  1I3Q J;  2NVT J;  4XIC A;  2E2H J;  4DZJ A;  2O8K A;  2IAI A;  1ZKG A;  2LR8 A;  1D5Y A;  4C3H J;  1GV2 A;  1X2N A;  5EF6 A;  1T33 A;  1I50 J;  2Y9Y A;  4D7M A;  3RQI A;  3M3Y J;  2LY9 A;  3IH2 A;  2JA8 J;  3HDD A;  1JT0 A;  5FLM J;  2CUE A;  5M5X J;  3BTJ A;  3WHB A;  4JYK A;  3GTP J;  1SAN A;  4MIM A;  4DW6 A;  2O7O A;  3BG5 A;  2K40 A;  4MFE A;  1YRN B;  1ETV A;  3GTO J;  2NOG A;  1JUP A;  3HEF A;  4C3J J;  4S0H B;  3H3V K;  2EH3 A;  5IOZ A;  4XRS A;  2DTZ A;  2P81 A;  3ZQG A;  5EZG A;  1B72 B;  1JKO C;  5FKM A;  2VPR A;  2DA6 A;  1R9T J;  2MSY A;  2JA5 J;  1H88 C;  4A3G J;  2EZL A;  1H8A C;  5C4J J;  1JUM A;  3FKI J;  2EZI A;  2ME6 A;  4BBR J;  3RZO J;  1XG1 A;  3HBL A;  2L7Z A;  2AO9 A;  3BR6 A;  1ETQ A;  1IC8 A;  2FJ1 A;  4DZP A;  2LKX A;  4JX5 A;  1MSF C;  1X2M A;  1LFB A;  1ZR2 A;  2LD5 A;  2YUS A;  1RPW A;  3UKG A;  1FJL A;  5IYB J;  1ETO A;  3B6A A;  2NVQ J;  5J1R A;  2NVY J;  2DJN A;  3BTC A;  1CQT A;  1VI0 A;  2G0E A;  1QVU A;  2R5Z A;  1RET A;  3Q0U A;  1HCR A;  3M4O J;  2KDZ A;  3SJM A;  2WAQ N;  5J1U A;  5BNG A;  3TED A;  1GT0 C;  4C3I J;  1JT6 A;  4X1E A;  4MO7 A;  5J3L A;  5DTD A;  4RDU A;  1FIP A;  3B6C A;  1JKP C;  4DYC A;  3LOC A;  1LE8 B;  2LP0 A;  1JJ8 C;  3RZD J;  3JRE A;  1IG7 A;  1WH5 A;  3O8H A;  3FIS A;  1ETW A;  4DYR A;  4XID A;  3ZQI A;  5K7Z A;  3OSF A;  3S1N J;  3GTL J;  1IDY A;  4QSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...