4QIWN

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLLSHVELIDQVMVYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 10
structure length 63
sequence length 63
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4qiwN00
2I10A 2HXOA 2CQXA 3HOVJ 2IBDA 1ZK8A 3GTQJ 2DMPA 1JKPC 2P81A 5EZGA 5E3OA 2M0CA 2E2IJ 3FISA 3BQZA 3O8GA 3ZQIA 3RQIA 4GFBA 3HOXJ 2K9QA 3M3YJ 2JA8J 4DW6A 3JRHA 1UG2A 1NK2P 1MBGA 5EZHA 3CMYA 1ZTRA 2XPVA 5E3LA 2R92J 4QIWN 2M8GX 4X6AJ 1AKHA 2EZLA 1WI3A 2JMWA 4M3DA 4MIMA 3HBLA 5E3MA 2X9DA 3IH3A 1RPWA 5F0HA 1GDTA 4BBRJ 2LK2A 1FTZA 2XB5A 2XPUA 5IOZA 1ZGWA 2R5YB 2L7FP 2XGEA 2MGQA 2X48A 1Z0XA 2NVYJ 2QCOA 3BG9A 3UKGA 1HLVA 4A3LJ 5F04A 4BXXJ 4XRSA 1AHDP 4D5CA 1PUFB 5J1UA 3RZDJ 2LD5A 3Q0UA 1HOMA 1TC3C 4XRSG 5DS9A 2KDZA 4DYQA 4G12A 5J1RA 3GTPJ 2JA7J 3HGYA 4UUSA 1NK3P 5F08A 3S1RJ 3TW7A 5M3MJ 1F36A 5JLWA 1H89C 3GBGA 3BR0A 3S17J 2DA4A 2HXIA 1R9TJ 1OFCX 4BY7J 2M34A 2FX0A 2R93J 2DA1A 2AO9A 2OF7A 2O9LA 5M3FJ 4I6ZA 3BT9A 3MKLA 3I4MJ 1UMQA 1GV2A 2NVQJ 3JRIA 4J19A 3S1QJ 5C44J 2JWTA 3G1MA 3Q0VA 3MN2A 3LSJA 2ELKA 5IPAA 1I3QJ 2Y9YA 3NARA 3W6VA 2JA6J 1I50J 4IEJA 4UUSB 2X6OA 4S0HB 2DA5A 5EG0A 3BR6A 2EQRA 1X58A 1RKWA 2MSYA 1JTYA 3FK6A 1B72B 1AU7A 2L7MP 2R7ZJ 4A3IJ 3TEDA 3CDLA 3ZQCA 2HI3A 4B1RA 1PUFA 2XSDC 2NS7A 2VI6A 4FISA 2ME0A 2LP0A 1ITYA 4IHVA 4MFEA 2L9RA 4XK4A 3Q3SA 3SJMA 2EZIA 1ZR2A 1Q1VA 1XG1A 3BG5A 1JKOC 4I76A 3GTMJ 1VF9A 4DZJA 2DA2A 4DYRA 3WHBA 4EEFG 3JRAA 2R0QC 1AKHB 1TWFJ 1TWGJ 3E7LA 1IRZA 3F0CA 1IG7A 2XGCA 5C4JJ 5F0FA 3OOUA 4JYKA 1ZKGA 4RBOA 2NOGA 5FKLA 5HODA 1HCRA 2L0KA 1LFBA 1IUFA 1H88C 4IHWA 3ZQGA 2FD5A 4M6VA 3O8HA 2H8RA 4L5EA 1W0UA 5FKOA 2E2JJ 4NDLA 2MG4A 3FK7A 1DU0A 3DCFA 2K9NA 1QVUA 5F1JA 2VKEA 2EZHA 5GPAA 3HOWJ 2R5YA 4MFDA 2K9SA 3DEWA 3G1LA 2XRLA 5IP6A 4HNVA 4M3EA 5FLMJ 3GTOJ 4A3FJ 2Y9ZA 5J3LA 1I6HJ 1F43A 1MBHA 4XRMA 1QVTA 2W48A 3GTGJ 5IYDJ 4CYCA 2B63J 1POGA 2O7OA 3PO2J 1GVDA 4A3EJ 3RZOJ 2H1KA 3HM5A 2AHQA 2DMQA 3A03A 1TWCJ 4JX6A 1FJLA 1APLC 3Q0WA 1JKQC 1VNDA 2DTZA 4C3JJ 3A01A 3ZOBA 3M4OJ 4A3GJ 2PMZN 2CJJA 2G0EA 1Z77A 3HB9A 3OIOA 3JRFA 2ECBA 2JJ7A 1ETYA 2HOSA 3FIWA 1EF4A 1BJZA 2N8GA 2COBA 1LFUP 3BQYA 3TW6A 4XICA 2FQ4A 1H8AC 5EF6A 3HDDA 4QSHA 3BR5A 3K2AA 5GPCA 1OCTC 3BR1A 2YS9A 1D5YA 2GBYA 4AC0A 5F0CA 5IYBJ 1X2MA 4JP0A 1O4XA 1FTTA 1A5JA 5FKNA 2Y30A 2FJ1A 1GV5A 1K83J 2TRTA 2E2HJ 2HOAA 1WH7A 3IV5A 2LFBA 1ETVA 1YRNA 1ETOA 4JX5A 1A6IA 4A93J 1ZQ3P 5FKKA 2HYJA 1GUUA 2DMTA 3FKIJ 3H3VK 2CUFA 2DA3A 2DJNA 2XB0X 1BW6A 1TWAJ 2WB1N 1MBEA 1MSEC 4FCYA 1B8IA 3JRDA 3GTLJ 3BTJA 1VI0A 3JR9A 1IC8A 2LY9A 5JLXA 5EGOB 3BTLA 2GLOA 2JN6A 1U78A 3H0GJ 2D5VA 2EZKA 1MBFA 1Y1WJ 3BTCA 2DMUA 1NTCA 2M9HA 2TCTA 2YU9J 3A02A 3S1NJ 1LE8B 2R5ZB 4ABZA 1T33A 2LTPA 5IP9J 2ID6A 1JKRC 3CCYA 2DA7A 2O8KA 2XPWA 3QQAA 1ZR4A 1IDZA 4QTRA 1HDPA 2ME6A 1UHSA 4W97A 3BR3A 1T56A 2WV1A 2OPTA 4C2MJ 3BTIA 4D5FA 1VFCA 9ANTA 5J1YA 2Y2ZA 1G2HA 2NVXJ 3S16J 5K7FA 3PM1A 4AYBN 3B6CA 4IHYA 2CRGA 3I4NJ 1FEXA 3G1OA 4M3BA 4BKXA 1MBKA 4C3IJ 3HOYJ 1XS9A 4BBSJ 1JUPA 4A3MJ 3VPRA 2KT0A 2VKVA 2Y31A 3QPSA 1RR7A 1JTXA 4FTHA 1BL0A 1IV6A 4FE4A 1WH5A 1ORKA 1WCMJ 1TWHJ 1ETXA 3K7AJ 3JREA 5C3EJ 3QPLA 1FIPA 2E19A 3GTJJ 1HF0A 4B3AA 2CUEA 1ETKA 5M5YJ 3GTKJ 3L1PA 1CQTA 2HOTA 3BR2A 3HOUJ 2VUMJ 2JK3A 1YRNB 1FIAA 3OSGA 1DU6A 1OCPA 3WHCA 1HDDC 3ZQLA 2R5ZA 3S2HJ 2YUSA 3TP0A 4CYCB 1W0TA 4A69C 5FJ8J 1WPKA 3JRBA 2HDDA 1GT0C 5EDNA 1JUMA 3S1MJ 4Y52J 5K7HA 4IHXA 4A3CJ 4XIDA 4X1EA 3LNQA 1JGGA 4FE7A 4M3GA 5EGOA 2CQQA 2NS8A 2XGDA 1RESA 1WGXA 1MH4A 4JX4A 4BY1J 3IH4A 1IDYA 3B6AA 2JA5J 2LR8A 3BG3A 1MH3A 1ENHA 3LSPA 5F27A 1P7IA 2VPRA 3S2DJ 3TP3A 2LKXA 5C4XJ 1B72A 1X2NA 2L7ZA 2QF7A 1K61A 1BW5A 1MBJA 2EH3A 5EG0B 1IJWC 2LVSA 1ETWA 1JT6A 1U8BA 2IAIA 5GP9A 4DZPA 2DMNA 1U9OA 1JT0A 3OSFA 4D7MA 2LLKA 2RAEA 3LSGA 4B4CA 1RKTA 5EEAA 2HQ5A 4UUTA 4A3BJ 2CU7A 2Y0SN 5E3NA 1S7EA 3SDGA 1MNMC 1B8IB 3D1NI 5M5XJ 5IP7J 2DA6A 4C3HJ 3NAUA 1QPIA 2EBIA 3ZQFA 4V2GA 4A3JJ 2M2EA 4W1UA 4D7NA 4RDUA 1Y1VJ 2K40A 3JRGA 1E3OC 1MSFC 1RETA 3A01B 2ID3A 1P7JA 3CQZJ 2ZB9A 1SFOJ 3S14J 3SFIA 1LE8A 1QRYA 5K7ZA 4M3FA 2E1OA 3IH2A 5BNGA 1JJ6C 5FLVA 4DYCA 5FKMA 1BA5A 1ETQA 3HKZN 3HOZJ 3JRCA 1JUSA 1U9NA 3HGGA 5IOYA 3LOCA 3LSRA 1SANA 4A3KJ 4AUXA 1IGNA 3RKQA 4LOCA 5M5WJ 2IEKA 3S15J 2NVTJ 2ECCA 3ZQHA 1XC5A 2WAQN 4V2FA 2GM4A 2DN0A 1OJLA 4A3DJ 4MLOA 3HEFA 3PO3J 1JJ8C 3MVPA 5DTDA 3C2BA 4MO7A 4Y7NJ 5EYRA 2MW8A 5IYCJ
chains in the Genus database with same CATH superfamily
3ESWB 2HXOA 4C2TA 3HOVJ 3GTQJ 1A04A 2DMPA 4P96A 1JKPC 5EEGA 4BJ5C 1QU3A 3WGGA 2E2IJ 3FISA 2EV0A 2B7EA 4EQQA 2ZC2A 5ERIA 3CJRB 3HOXJ 2CW7A 3BP8A 2JA8J 3FMQA 4QLCU 1FT9A 1KYWA 4FQGA 2KRFA 3CMYA 5E3LA 4KICA 3FXJA 3H5NA 3LSIA 4N9IA 1YJWI 2EZLA 4MIMA 2DFHA 3HBLA 5E79C 2ZXWH 3IH3A 4N9HA 4IKFA 2HGCA 2GIZA 4YEJA 2LK2A 4U7DA 3GMEA 3V7SA 5IY5H 3ZN1A 3OYJA 3L2UA 2R5YB 4KT5C 3BG9A 3BWGA 4AIHA 4IPAA 3K4KA 1AHDP 4D5CA 1K78B 1SAXA 2LD5A 3V42A 3I53A 3Q0UA 3H1CA 3IRQA 1HOMA 3U2RA 3RI4A 4XRSG 3E0JB 1U6GA 5FGMA 4G12A 1WJ5A 4C30A 3GTPJ 1BR2A 1R5ID 3BZCA 3KE2A 2DCEA 2M87A 2NNNA 3I55I 2RREA 1FSHA 1FY7A 3S1RJ 2KFDA 5M3MJ 4UVAA 1YHQI 1H89C 1FYLA 3GBGA 2DU9A 1R9TJ 3M07A 3OYGA 2VJ5A 1OFCX 4EM2A 4BY7J 4LK0F 1OR7A 2R93J 1S7AA 5CQGA 3KCCA 3J7YJ 2XAHA 2X4HA 2CFXA 2OD5A 5JI6A 3KETA 3DWLE 1FNNA 2W00A 4LD5A 3QAHA 2AS5F 2X6YA 3BT9A 4IXAA 4AU7A 1ZYRF 1VQ6I 3ONQA 5H6RA 5TGTA 5D5VB 4BS9A 2ZFWA 3W3CA 3LSJA 3RSNA 3VYTB 3WU1B 2R3SA 3W6VA 2DW4A 1E3HA 1I50J 1UZCA 2X6OA 4UNOA 4BACA 4EGYA 3F6OA 1QA6A 3FDYA 2EQRA 3AFHA 3CMEI 3GFLA 2MSYA 4DNCA 2FNPA 1QQIA 3K2ZA 1U5TB 3AG2H 3W6JB 3OYMA 1PP7U 1AU7A 4A2UA 4XSZF 3K4JA 2DT7B 3CDLA 4KIGA 2QKMB 3SYTA 3SZGA 2JTVA 2VI6A 2VIXA 4FISA 1HKQA 1LDJA 1X3UA 4XLFA 2LP0A 4M9XA 2A69F 5HS9A 4LG3A 3DP7A 3IRRA 4PUSA 5L3DA 2L9RA 4B47A 1R22A 4FETA 4NUBA 4HNTA 4KUMA 2CQKA 3BG5A 1BIBA 3TO6A 3GTMJ 2R0QC 2DA2A 2MH2A 4DYRA 2DK5A 1K6OA 5HNHA 1G6NA 2RV8A 2IGKA 1UJ8A 3MAJA 2O8XA 4OAZA 3WE2A 1IRZA 5C4JJ 2QENA 4ZYGA 4XLCA 4RBOA 1P4XA 5HODA 4RB0A 2VASA 1HCRA 1WJDA 1H88C 2JUCA 2EIMH 1GLNA 4M6VA 4F55A 1MIJA 3Q9VA 2VE9A 2H8RA 2MYSA 5FKOA 3FXRA 4P9FA 4HF2A 4IX7A 3K4MA 3PQKA 3HOSA 3MWMA 2MG4A 4ZDLA 1DU0A 3J81K 4U0YA 2QQ9A 1QVUA 4OINF 2Z2SB 2VQCA 3LQRA 3TGNA 5F1JA 3ZP5A 4G7OF 2X0LA 2EZHA 4ESJA 2RC4A 1BI3A 2OV7A 3P9KA 4PJLA 1EV7A 4MFDA 3DEWA 4PDKA 4HNVA 4M3EA 2L4AA 2Z99A 2O3FA 1QBJA 1OISA 3K4BA 4I0AA 2STTA 4NHJA 1SFXA 3J7AY 4GGGA 2KIFA 2W48A 1HKTA 4B09A 1YITI 3KP2A 3RKWA 2IS1A 2E34A 1S6LA 1YO5C 2FMYA 2O7OA 2RGVA 4FT8A 2O6GE 1QZYA 5J4VA 1I6XA 1QPMA 1ON1A 1Z6RA 3AG4H 3TQNA 4JX6A 3ZN0A 3Q0WA 1VNDA 2DTZA 1RUOA 2K9LA 1DGRM 4II2A 1D0XA 5KVRA 4ZYEA 2Z3YA 2CW8A 2XROA 3FIWA 1BJZA 2N8GA 2P6TA 2COBA 3BQYA 2PX9A 4AIJA 2M5WA 2W85A 4YFKF 4XICA 4YRVA 3NRVA 1R1TA 4XLNF 4QSHA 3IL2A 3KP5A 2DTRA 2VQGA 2A5YB 3K2AA 2FOWA 3ZMTA 2DXIA 5LHHA 1W5CC 3F8BA 1B4AA 1F9NA 5H6QA 4BE0A 2QSFX 5F0CA 1YIJI 3M1CA 2YX4A 1RZ4A 2X1CA 1FTTA 2WAQA 4XBFA 3K6GA 4ZYDA 1A5JA 2CFOA 5B66C 4BYYA 1K83J 2UZKA 1YIOA 3RYPA 3ABKH 3WU2C 1VQKI 3PSFA 4RMNA 1N75A 1HC8A 4L9VA 3G71I 4E7HA 2FBKA 5LRRA 4B8XA 3KLNA 3KLOA 3DKYA 3LAJA 2HYJA 1GUUA 3FKIJ 2OTJI 2EILH 2IVMA 1X3ZB 1XGNA 1QO0D 2XB0X 1O3QA 1IRFA 3HC7A 1BW6A 1OR7C 3CF5F 2HFHA 1MBEA 2K4JA 2E60A 3JRDA 2H6CA 2QYOA 3GTLJ 2MD5A 2DPDA 4HG2A 1CF7B 4CICA 3BTLA 2V1UA 1OYIA 3F8MA 5E17F 5ILVA 4WXDA 3ABMH 4XR6A 1MBFA 4E7SA 3DPTA 4HYEA 1NG7A 1P92A 3CCLI 3CDIA 1NTCA 1VQPI 2FU4A 1EA3A 4IOAF 2CUJA 4CYDA 3A02A 1OMIA 3FXKA 3CCUI 1Z05A 2Y69H 2HVRA 1A31A 1S29A 3CC2I 2ID6A 5AIPA 3DEEA 1SMYF 3FM3A 1XMKA 2X6WA 1HDPA 4XQFA 5HDKA 3HIFA 5K5OA 2P7CB 4L9TA 4S05A 2LKSA 1Z67A 4W97A 5F6FA 2KMUA 2KP6A 3V4GA 1VQ8I 1BOAA 2RN7A 4I01A 4D5FA 3MZHA 2Y2ZA 1MJBA 3GZ5A 2EFQA 2JA2A 1DQUA 4XKWA 3BG7A 1W1WE 3ASNH 3D0SA 4A0YA 4AYBN 2I8DA 1FP2A 3B6CA 1FEXA 4UY8I 3G1OA 4BBSJ 4CHUA 2AXTC 3UR3C 5HOOA 1VQ7I 4OMZA 2Y31A 4YFXF 2GOXB 3I64A 4HBLA 3HKZA 4BXFA 1BL0A 2FF4A 5LGUA 3LA7A 1W7PA 4MTEA 1Y8QB 3RYRA 3MEXA 1P2FA 2XF5A 1ETXA 4IRGA 2H09A 3NQOA 5DEQA 3JREA 2E71A 4LK1F 4XRFA 4E7JA 5LBQA 1S9HA 2EA4A 4LLLA 5D5UB 4EV0A 3IWFA 2VUMJ 1V4RA 2JK3A 1VQOI 5D8LB 2AQEA 3PNYA 1DU6A 2E1MC 3GCMA 2IT0A 3WHCA 1H9GA 4EJOA 3E5QA 4MQVA 2JQ7A 2BVMA 3M9AA 2V9KA 4NBQA 2OQRA 5EDNA 2V7FA 1BBYA 3EPZA 4BL0B 4RAGA 3KP3A 1B9MA 2F5DA 4A3CJ 3EQLF 3P9CA 3J7ZI 1ZARA 3LNQA 1XGOA 3U9GA 4M3GA 2CQQA 1WGXA 3MKYB 2E1CA 2RNJA 3I0TA 2LR8A 4U88A 3RKYA 4OIOF 1MH3A 4LG0B 3ISPA 2VOPA 3LSPA 1SFKA 2QBYA 3HZJA 3DU5A 3LWFA 1LDDA 3CCRI 1QZEA 4O5VA 3R61A 2QQBA 3F72A 1B72A 1XB4A 4PSWA 3NWSA 3OYIA 3J7AO 3F9KA 3L7WA 3ECOA 2KJBA 1X1BA 4WXCA 1FSEA 1OCOH 4OU0A 2K27A 1ETWA 2CGPA 2FE3A 5L3FA 4DZPA 1MW7A 3K1MA 3OSFA 4QWQA 5D8KB 4YIIA 2P8TA 4ZJZA 5EEAA 2HQ5A 4LFUA 2CU7A 3J80Z 4WK8F 3VODA 2Y0SN 3IAS2 1I3AA 4XL9A 1S7EA 3SDGA 1B8IB 1MD0A 3RPUD 1O57A 2CG4A 3CUOA 3GO5A 2PLYA 1MMSA 1QPIA 2HWVA 4V2GA 2M0MA 3CJQB 3R60A 4D7NA 2DT6A 2IS2A 2A6HF 3MKZA 1RI7A 4N4OB 2QEXI 1FC3A 2ID3A 2R7QA 1USTA 2ZB9A 3C3WA 3AG3H 2BBYA 4AYBA 3H36A 3S14J 5JVTA 4L5JA 2XRNA 3HSEA 2K86A 3IH2A 1JJ6C 1WZ2A 1WI9A 2G7UA 2F5EA 2GZWA 1YW9A 3OL4A 5FKMA 1BA5A 1ETQA 3HKZN 2JZYA 1G3YA 3HGGA 2OUMA 1U5TC 3H0DA 5A2QK 3RKQA 1R58A 5KK1A 2JPCA 5B1BH 4HNUA 5GAGJ 3IKTA 3W2VA 5M5WJ 2PMHA 1RRJA 3GXOA 3CZ6A 2B9SA 1XC5A 1PJRA 4V2FA 1LKXA 2GM4A 2DN0A 3C2HA 4LGWA 1ZLJA 3HEFA 4TV7A 1WSUA 4GRIA 4ANJA 5IYCJ 2K5CA 2CQXA 4NQWA 1ONVA 1TZLA 5EZGA 4BQOA 4IRIA 1EJ9A 1T2KA 3EDPA 2H94A 3WGHA 3BQZA 2DODA 2PBIA 3O8GA 5FD6A 5HDNA 5LD2C 4GFBA 4QPQA 2K9QA 5JFRA 2QA4I 4OOIA 3ABUA 4DW6A 1WJAA 3GX4X 1UG2A 2IW5A 4BXUA 1MBGA 2V1NA 4AIDA 1UAAA 3H9QA 4M71A 1MJ9A 4X6AJ 2GQQA 2W25A 4PK4A 4A0ZA 4F52A 4ENKA 5E3MA 2STWA 2AQFA 1LJ9A 2V6EA 2X9DA 2BXZA 4D0PA 1E3PA 2KISA 4CO8A 1RPWA 1GDTA 2JVHA 1FTZA 1J2XA 3GW2A 1ZGWA 2L4MA 2MD0A 1TLHB 4YFNF 2H8WA 4XOPA 2OU2A 2X48A 1OCCH 5E1WA 5F04A 1UCRA 3I9V2 5ICGA 4KIBA 4M9SA 3V7CA 5EJCA 5JHFA 3ZXSA 3OYKA 2UUZA 5DS9A 2MABA 3N05A 2EK5A 2CV1A 2JUGA 3BCBA 1IAWA 3HGYA 4UUSA 1NK3P 1JE8A 5F08A 1D0ZA 1F36A 2F5CA 5JLWA 2QWWA 3KFWX 2FRHA 3BR0A 3GF2A 3IUOA 3SEZA 1BI1A 3MCZA 4GO1A 2AO9A 4LITA 4AM3A 5EEHA 3U1KA 2OF7A 5ED4A 1G3SA 4I98B 2UV1A 3PFIA 4ON0A 2VQLA 4GXOA 5HLIA 1PUEE 3MKLA 4WCGA 3I4MJ 2IS6A 2EFPA 1GV2A 1XMXA 3ZCOA 3LFUA 2O61A 3JTGA 2PJRA 3S1QJ 3NEUA 3Q0VA 4EATA 2M4GA 5IPAA 2BVLA 2JA6J 1PDNC 2XAJA 4RB3C 2ISZA 3DTEA 1YFHA 2ESHA 2HZTA 4CCNA 4BQQA 1IN7A 2IGOA 5LHIA 2J5OA 3GFJA 4EM1A 1WFXA 4LLGF 1ZG1A 2VKDA 3TEDA 1QNTA 1IUYA 4E6KG 2HI3A 3EUHA 3BPXA 4B1RA 2XSDC 1PUFA 3HRTA 2DOFA 3C1DA 1ITYA 4IHVA 1B9NA 2UXNA 3IAM2 1WRJA 3Q3SA 4G9YA 2COMA 4BJTA 1IN5A 4IHSA 1VF9A 4DZJA 3JRAA 3I54A 2FBHA 2V9PA 4JK1X 1AWCA 3OV8A 1AKHB 4WF2A 3E5XA 4Y3OA 3DBHB 4L0ZB 2BHYA 1R4MB 5HS8A 1U5TA 3FXQA 3OYEA 2CUZA 2Z1DA 4JYKA 3H5RA 3E97A 2A3SA 2NOGA 3O2PE 3ZMDA 3ZMVA 1WVRA 1LFBA 3K4NA 2EA2A 3I59A 2JRTA 3CUQA 3FBNB 3O8HA 4E7IA 2QGUA 4XONA 5B1AH 1XSXA 3GZNB 4CGZA 4WX9A 2MLGA 4NDLA 3FK7A 3K69A 3BDDA 4XKBA 1R36A 4C9YA 5FB2A 3L09A 3H92A 3EETA 1TP4A 4PJMA 1Z21A 4FASD 3OYCA 3G4SI 3FWEA 5L3GA 1O3TA 1H0MA 4E7LA 4NC8A 1GXPA 1HSTA 4D1QA 1I6HJ 1F43A 2ELHA 3HHGA 2LF7A 3S8PA 3JSPA 1MBHA 2VLAA 4XRMA 2C6YA 1FZPB 5FO5A 3N97A 2IA1A 4A3EJ 3MZYA 2LYCA 3U1DA 5D6EA 2ZO4A 4XNFA 1FJLA 1DUXC 1ZN2A 1APLC 4ENNA 4CCMA 2L5QA 1UFMA 1Z1DA 1SFEA 4AD9A 4S04A 3R0AA 2CJJA 3F8FA 4I09A 3OIOA 2ECBA 4KMUX 4KITB 2Z16A 1LQ1A 3BZKA 4BEHB 5L3EA 3QRFF 3GEZA 2R4GA 2Z33A 2VOOA 2FQ4A 4YG2F 2H6BA 3M8JA 4OWRB 3HDDA 4Z6YA 4HF0A 3CLOA 3SZTA 3TOBA 5DD4A 1IRGA 3BR5A 4UB8C 2BW3A 2LOOA 4OMYA 4HQMA 1R7JA 3IHUA 5GPCA 2YS9A 5CLSA 1UHWA 3OIQA 1EH7A 2DK8A 4L5IA 2EJRA 5IYBJ 1X2MA 4P9UA 3GUDA 3LSMA 4L0YB 5LLQA 4BQNA 2CO5A 2Y30A 1ZAOA 3LMMA 2TRTA 5JHUA 3OOPA 2HOAA 3WODF 1LUJB 2VPLA 5CVJA 1J9IA 4PJNA 2HQAA 1F1ZA 4F91B 4JX5A 1A6IA 3CO6C 1KONA 3FHNA 3MZ8A 4BUPA 1RUNA 1ZQ3P 1Z9CA 4GDFA 3ML6A 1REPC 3CP8A 3N4MA 2W57A 2GAUA 2DJNA 4IOCF 5F1RA 1D1CA 3ABLH 5K5RA 1U8RA 4I0BA 5DYMA 1TQPA 2R7TA 1DP7P 5DCMA 5GTHC 1HKSA 1Y6IA 2XDVA 5JLXA 5EGOB 2LG4A 4XLPF 2GLOA 1LDKB 2D2WA 3H0GJ 4EJVA 2IGNA 2D5VA 1AOYA 4ESBA 1KQ8A 3QODA 4DJAA 2DMUA 3W2AA 2M9HA 3QYBA 1SVLA 2CW0F 2DJIA 4BAYA 3TKYA 5KNLA 2YU9J 1TQIA 1PVEA 5CVRA 4PSXA 5IP9J 1NH3A 4DBRA 2PEXA 3G2BA 1S8NA 2DA7A 5E1XA 4UHTA 3FXUA 3RPUA 1IDZA 1MMAA 4HA8A 2EV6A 2VC1A 1S3JA 1J7KA 1T56A 1XGSA 2WADA 2WV1A 5LEKA 1J09A 1FP1D 3CD6I 3HUGA 3AKZA 2IS4A 2NVXJ 3E3VA 1X1DA 2FNAA 2ZJRF 5K7FA 1OCZH 1YX5A 2KZVA 2GA1A 1TNSA 2CRGA 2VT2A 4M3BA 1MBKA 2HEOA 3KEQA 5TJJA 3VPRA 2KT0A 4HQEA 2DYRH 1IO2A 3BC8A 1SD7A 2PN6A 4E7ZA 3DLAA 2FOKA 4I7HA 3ZMUA 1KYZA 4FE4A 4PJJA 5DCMB 3JAMZ 2OCEA 1TWHJ 4BJ6C 1FBSA 3TOAA 1P4WA 1V5GA 4ZZDA 5B3SH 1FIPA 5FD5A 3GTJJ 2CUEA 3GTKJ 2ZMEC 1SD6A 4J00A 4M73A 2L2OA 1FIAA 2YU3A 3RTRA 3RKXA 3WG7H 1ZELA 2VXZA 3FXLA 4HLYA 1IZ1A 5AONA 3TDZC 2G9WA 3ZQLA 5HLTA 2YUSA 3HYIA 3TP0A 2K85A 2WAEA 3Q5FA 4CYCB 1N78A 5GTIC 1BJAA 5FJ8J 4KN4X 2HDDA 1NHAA 2DDBA 4XN3A 2FXAA 1JUMA 2PJRB 3CDHA 4WXHA 5K5QA 1JHHA 4Y52J 3EUKL 3G3ZA 4IHXA 1Z7LA 2HVQA 2LSOA 4X1EA 1ZGJA 3OR2C 4ZDPA 5J8CA 5FLXK 2NS8A 2VJJA 1RESA 2XGDA 5ILUA 4DQ2A 1YYVA 1MH4A 3SXYA 1T0FC 1IDYA 3B6AA 1B6AA 3D5RC 3SQNA 3VSKA 1ENHA 2DFEA 2GXGA 3SFZA 2VPRA 1ERDA 3ABTA 4ZTFA 4M9ZA 2CV2A 3ROUA 1Q1HA 3CCMI 4JBAA 5C4XJ 3LSHA 1XX5A 2L7ZA 1BW5A 1KA8A 2EH3A 1IJWC 2XAQA 1X3WB 2DAOA 1YE9A 4DOZA 3ZQ7A 1FLIA 1T0FA 4DGWB 2KIMA 1JT6A 1GXQA 1SAUA 2LBFA 2QQAA 2DMNA 4RAFA 3L2CA 1JT0A 3VFZA 2BYVE 5D6FA 3CCEI 2RAEA 3LSGA 4B4CA 1WKMA 2QQ8A 1LEAA 2XASA 4UUTA 3AL0C 3H5AA 5E3NA 5IT9K 1V3FA 3QWLA 1FYKA 5CPRB 2DI3A 4C3HJ 1BR1A 3JSOA 3CLQA 4NC7A 2RDPA 4BDZA 1E0EA 3VOEA 1E3OC 4IL6C 5CVVA 2R7SA 4R79A 1ON2A 1P7JA 3CQZJ 3CUQB 2LF8A 3KZIC 1SFOJ 2LC2A 2ZMEB 3L2QA 4BE2A 4DBQA 2DFFA 1LE8A 4O3MA 4D9JA 2H1LA 2V6CA 2CV0A 1OQYA 4M3FA 3J81Z 4DYCA 4IZZA 2L7KA 1XTAA 1UELB 3I56I 1U9NA 5IOYA 3WTSC 1VQ4I 4F93B 3HXLA 2VKHA 2E7WA 5E20A 2BW3B 2E35A 4AUXA 3D5SC 2J5PA 1Z3YA 2HTJA 2IEKA 5ILSA 3S15J 1ZRCA 2NVTJ 1L0OC 2HYFA 4NB5A 2ECCA 3ZQHA 5CQEA 3J80K 2OAZA 3E6MA 1EKEA 3SHFA 3PNTA 3QP6A 3CMAI 3PO3J 4KT6A 4LIUA 3W6KB 2LBFB 5DTDA 3SDBA 2OCCH 4Y7NJ 2XIGA 1FBQA 2I10A 3OL3A 3E1SA 1G3TA 3QU6A 5E3OA 2M0CA 3DPLC 4EVIA 4M6YA 1XDUA 2BOLA 4Q47A 3RQIA 2IA2A 2L3DA 3PNVA 3M3YJ 5DM6F 3X2QH 1NK2P 3QU3A 3F21A 2KRHA 5EZHA 1ZTRA 3QPTA 4QIWN 1WI3A 3OR1C 4Q4ZF 2Z5UA 4BHPA 3K70D 2K02A 3DTKA 2DDAA 4UXNA 2XB5A 2HVSA 5IOZA 3PFYA 3FZVA 4I2OA 2IRFG 1BOBA 2VQHA 4F3QA 2L7FP 1JGSA 2MGQA 2PMZA 2XGEA 4ZYAA 3WTWC 3OYBA 5FFZA 3CCQI 1N77A 1HLVA 1VQLI 4A3LJ 2NVUB 4BXXJ 4XRSA 5DDGA 5J1UA 3RZDJ 1QHGA 1WJCA 4MNUA 3OIPA 1MKMA 2BY2A 3A1YA 2WC2A 4HOBA 4KNYA 5KCMA 1P9QC 2KDZA 4NC6A 2K3PA 2WA0A 5J1RA 3KYLA 2WWYA 1TL8A 2JA7J 3PUBA 1SEUA 2HS5A 3PIOF 2DOAA 2RKHA 3EUHC 3G6EI 4FX0A 1KU2A 2LRDA 4CZZA 3OYLA 3K0LA 2VB6A 2NAZA 2DA4A 2QZ8A 4V19K 1W7PB 2FBIA 3HTUA 2OQGA 3T8TA 2DYSH 1UMQA 2HDCA 3JRIA 4J19A 5C44J 1LVAA 3MN2A 3PJRA 1S7OA 2ELKA 2F5FA 2KIUA 2W24A 4IO9F 2V9VA 5CYVA 3Q9SA 1A35A 2VJIA 2OZ6A 2F4IA 4S0HB 3JW4A 3I59B 1Z91A 3DEUA 1RKWA 2ZFUA 3OWTA 3CP2A 1OCRH 1B72B 4L9JA 1YJ9I 2L7MP 3GZ6A 1N25A 1MNDA 3BCAA 4HLXA 5FFXA 4EGZA 4A3IJ 2VBZA 2LY1A 1MMNA 3ZQCA 1K78A 4IQ4A 5GAEJ 4KISA 3DPUA 1ZRFA 4MFEA 3K9TA 4XK4A 4RB1A 4A6EA 2DPUA 2EZIA 2XAUA 3B02A 5IT3A 1DPRA 1Q1VA 1XG1A 2D1VA 1XMAA 1ZR2A 1T08B 1JKOC 4I76A 1O3SA 2PI0A 3I58A 1ZH5A 3WHBA 2KKOA 2YR2A 4EEFG 1LB2A 2HPIA 2NRAC 1R00A 2KRCA 3FX3A 1TWFJ 4RM2A 4CSWA 4LB6B 1TWGJ 2BEOA 2E36A 3CF2A 3DXJF 5CKTA 3FHZA 1A6QA 1OYYA 2XGCA 1R1UA 2YSRA 5J8FA 2CWEA 4KN7X 5FKLA 3DFGA 4KJZA 1W36D 1R23A 4IHWA 2OTLI 3ZQGA 3GWZA 2V26A 1KU3A 4GCVA 5H20A 2P5VA 3SEQA 3RJPA 1IXCA 4L5EA 1W0UA 4RA2A 5FRMA 3RDIA 2M7BA 2VT3A 2F48A 3V8LA 3WGIA 2Q8KA 2VKEA 1G4DA 2MFZA 1X1AA 2HPMA 2R5YA 2K9SA 3QYEA 4E4HA 2XRLA 5IP6A 4Y15A 5FLMJ 3GTOJ 1ZG3A 4HF1A 4A3FJ 2ZJPF 1ZLKA 2XF7A 5J3LA 4KIFA 3WTYC 2Y0SA 2W4SA 4BDYA 2X6XA 1QVTA 5HDGA 2DLLA 4CYCA 5IYDJ 4MEYF 4CCKA 2L54A 4N0BA 1HQCA 2EINH 4RB2C 4XN0A 3PL8A 1GVDA 4N4NB 1S72I 2MLKA 3GYHX 3HM5A 2AHQA 1UG0A 3A03A 2H27A 4QPOA 2NOJB 4XSXF 4C3JJ 1MDMA 3A01A 2RVCA 3M4OJ 1XN7A 4BE1A 2PMZN 3I71A 2G0EA 4Q5SF 4HX4A 2QVOA 2JJ7A 1BI0A 3H3UA 2HOSA 1V5EA 1L3LA 3MMYB 1LFUP 2EFOA 5E18F 3E6BA 3TW6A 3DBLB 1I39A 2VL8A 5EF6A 1K79A 3L2VA 3I3LA 2P5KA 1SVMA 2Q0OA 1S5LC 2ZXJA 3ZMSA 1OCTC 1DP3A 1D1AA 3F3XA 2E1NA 1MNEA 2P5LC 2O5RA 3TO7A 3COAC 4JP0A 2QKLB 3V7RA 3CCJI 4XORA 5HVQC 2DBBA 2VODA 3DBRB 5D5XB 2ZJQF 3IWZA 1OYWA 2FJ1A 1GV5A 2MH9A 1V54H 2Q2EA 2DT5A 2E2HJ 4ENMA 3S3MA 4HRIA 3I4PA 2ZBKA 1ETVA 4BEHA 4G7HF 1QZZA 4A93J 1JHFA 3ERED 1K4SA 3H3VK 2IJLA 4KA4A 1XSDA 5AIQA 4LG0A 4HV6A 4P1WA 3CO7C 1TWAJ 2HYGD 4M6XA 2L02A 2XUBA 4FCYA 1B8IA 4BU2A 3OYAA 1VI0A 4UV9A 3JR9A 1SC7A 2VN2A 2LY9A 1IXSB 1C0WA 1W7PD 4PFPA 5J40A 5LRSA 2JN6A 4XM3A 1U78A 6PAXA 3ZMZA 2ISYA 1FMWA 2EZKA 1W5SA 5BMZA 1Y1WJ 3DQVC 3CESA 2K9MA 3KEYA 2WY7Q 4CA0A 3R6SA 1DGWY 1SMTA 1BC8C 4XKVA 1T33A 2LTPA 2P0WA 3GVAA 4F7ZA 1OKRA 5FRNA 1D8KA 2M7AA 3DF8A 2LREA 3BY6A 3QQAA 1ZR4A 2A07F 2KPMA 3AL0B 2M3AA 3DV8A 4K2EA 2ME6A 1WHUA 2HOEA 3HRSA 1UHSA 3KEOA 3BR3A 2HQRA 2KHMA 4II3A 2BHZA 1T38A 3A2KA 2VONA 2OPTA 3OYHA 1HSJA 1F5TA 3BTIA 1ACIA 1VFCA 3A0BC 5J1YA 1Y56A 4AVZA 3OS2A 1FWZA 4A6DA 1T39A 3PM1A 2WB1A 4HX8A 1G3WA 4BQAA 3I4NJ 2HKOA 2B0LA 2GA2A 3L00A 4BKXA 2Z9OA 2IXSA 3BLYA 3HOYJ 3V8JA 4A3MJ 5BPDA 4EMSA 3IKVA 2VKVA 4G6DA 2PMUA 2FMLA 1U0JA 1EH8A 2ACJA 1JTXA 3IC7A 2LY2A 1QGPA 4U7BA 3U21A 5DM7F 4J01A 1YTYA 5J4YA 1WH5A 3RIRA 1ORKA 1WCMJ 4CXFA 2XVCA 2LKPA 1WJFA 2P4WA 4KFCA 5C3EJ 1X19A 2AXLA 4L9NA 5LHGA 5D5WB 1I5ZA 3MFKA 2E19A 2XSJC 3VWBA 1HF0A 2E5NA 1ETKA 3KPHA 3L1PA 3BR2A 1O3RA 2R7UA 2R7WA 1D5VA 1VQ5I 4ZTJA 3KZZA 2DFIA 1YOVB 4U0VA 2OC6A 1OCPA 5LGTA 3S2HJ 4BHCA 2JT1A 1RC9A 1VZ0A 1LFPA 1W0TA 4A69C 1WPKA 3VEPA 3JRBA 1ZGAA 2WY8Q 2F6CA 1GT0C 2ZSHB 3E6CC 3CTAA 1JI8A 2CSOA 2TDXA 3BOQA 5A2QZ 1PYVA 1X1CA 4FE7A 3FKJA 2V1XA 1VQ9I 1CF7A 2CH0A 2W84A 3TDUC 4B48A 5BOXA 4JX4A 3RPQA 4BY1J 4A5MA 4CUGA 4LLNA 2X1DA 4O6JA 3QOEA 3BG3A 3FXMA 2HKXA 5HLHA 5L3CA 4HDVA 1P7IA 3KYDB 1VQNI 3HHHA 3ULQB 2DO7A 3TP3A 4H0EA 1X2NA 2QF7A 1K61A 4PZJA 4ZYHA 2ADUA 1K7AA 2V79A 4E70A 1R49A 2IA0A 2UXXA 4B44A 2KL4A 3FMRA 2E5ZA 3DTIA 4ZDOA 3E5UA 2PFBA 1OLTA 1U8BA 5CJ9A 1YS6A 4I99C 2MC3A 4ENJA 4H4KC 5TRDA 4RAYA 2LLKA 5GADJ 4LMYA 2BV6A 4B43A 2Y75A 3NWTA 3ASOH 4A3BJ 1DPUA 3CUQC 1RIOH 5BS6A 5LGNA 1MNMC 3LQQA 3HOTA 4NNJA 3G73A 3NAUA 2EBIA 2QM3A 1W36C 4X0GA 3P5JA 3KIOA 4A3JJ 1P6RA 2M2EA 3GFMA 3VDXA 2VBXA 1Y1VJ 2K40A 4RM3A 3JRGA 5H2FC 3GFIA 3GLLA 3VYRB 3ERMA 1RETA 1TT5B 1VTNC 2WBMA 3A01B 3LA3A 1R6RA 2M8EA 2OJED 3ZRGA 2V1DA 3VYUB 3M1EA 2IGMA 2A6EF 4DIQA 4KDPA 2CQNA 4CCOA 1E2XA 2EFNA 1I1GA 2JSCA 3WTUC 1RR8C 3HOZJ 3GLXA 1JUSA 4RLFA 3LOCA 2XV4S 4UVCA 4XLHA 3VSLA 3CCVI 4ZH4F 1IGNA 3WTZA 2M4KA 4UUVA 4LOCA 1B59A 2W1OA 3QPHA 4RGXA 1K6YA 5J6XA 2WAQN 2Q1ZB 2BZTA 2M1BA 3HJEA 4A3DJ 1OJLA 4MLOA 4IVNA 3MVPA 2FA5A 3L9FA 2FUG2 5KHDA 3WU0A 4MEXF 1D3YA 3C2BA 4RS8A 5EYRA 2MW8A 2DQRA 3T0YA 4MTDA 4CDGA 1LVKA 1Y0UA 4A12A 2IBDA 1ZK8A 4PGHA 2JRMA 2P81A 5CVUA 1NG6A 1YW8A 3MKWB 3KZYA 2V4JC 2VBYA 2Q2EB 2PG4A 1X4PA 3ZQIA 1D8JA 2K7LA 4G6TB 3JRHA 3CJNA 3DU6A 1KU9A 1GVJA 2QBYB 2DOEA 2XPVA 2NNYA 2R92J 1V55H 2M8GX 3C18A 1AKHA 1HW5A 4M3DA 2JMWA 3JCUC 4E7KA 3DLLF 1J5YA 1E17A 2D45A 5F0HA 4BBRJ 5JVGF 1FMVA 2XPUA 3FMSA 3UKGA 1Z0XA 2NVYJ 2QCOA 1H9TA 1HW2A 5IT9Z 4BH9A 5KAFC 1PUFB 2P6SA 1BIAA 2W7NA 3H9JA 3M8FA 1TC3C 4B3XA 2A05A 3OMYA 3KP4A 2EFWA 2LNBA 2VC0A 1MDMB 4DYQA 2XKOA 1YS7A 1B1BA 4XKCA 3LL7A 1ZG5A 3TW7A 2VXDA 5DUKA 2KIQA 4RGUA 3S17J 3ECHA 2HXIA 4HAMA 2UWMA 2M34A 2FX0A 2DA1A 4BNCA 2O9LA 2XKPA 4WWCA 2IPQX 2GXAA 5M3FJ 2D1HA 4I6ZA 3TO9A 5BPIA 4XMYA 2NVQJ 1XSVA 2JWTA 1U3EM 3G1MA 2MC4A 3VB2A 4ITVA 2ZSIB 3ZQQA 2L9SA 1I3QJ 3LAPA 2Y9YA 3NARA 1W5TA 2F4OB 2HQNA 2Y0MA 4IEJA 4UUSB 4XOTA 1YLFA 2E7XA 2DA5A 2ZMEA 3BPVA 5EG0A 3BR6A 1X58A 5HLGA 1JTYA 3FK6A 5BQTA 1IW7F 1TQMA 3S3NA 1XGMA 1R1VA 2X1EA 2LDUA 5KAIC 3FXOA 2R7ZJ 1IN8A 4EJUA 3F23A 2R7XA 3ZR8X 3SZPA 4LIVA 1Z7UA 2NS7A 3CCSI 2I5UA 2ME0A 3ZGKA 5FROA 3BJOA 2A61A 4RLQA 2RNGA 3SJMA 3C7JA 3KP6A 5E8IA 1K4TA 1TW2A 4IJAA 2X85A 4BHBA 2NYXA 2JSPA 1TBXA 1KZHA 1FYMA 1IRXA 3M7GA 3E7LA 2EB7A 3F0CA 3P7NA 4Y4RA 1IG7A 5F0FA 3TMOA 2ZXIA 3OOUA 4HW0A 1ZKGA 5L3BA 1JXSA 2A6TA 1MGTA 2L0KA 1IUFA 4A0XA 2CQ7A 4G6QA 2R7RA 4C2UA 3W2WA 2FD5A 3MQ0A 1O7FA 2E2JJ 4G94A 1IV8A 1J59A 3H9GA 3O6BB 3D5LA 3DCFA 2K9NA 2HU9A 2K3FA 2ZNYA 3JTHA 3KP7A 4G7ZF 1R5GA 4IHTA 5LFAA 4OIPF 5GPAA 3OYFA 3HOWJ 3O3KA 1Z6TA 3OS1A 3G1LA 2HDWA 2Y9ZA 4P55A 2WV0A 4RGSA 2BY0A 5HS7A 2EIKH 1M1EB 2PJPA 3AG1H 1EH6A 2HR3A 2NS0A 2WAFA 3GTGJ 2Y48A 4AVPA 4FHTA 2B63J 1G8XA 4RGRA 2FQ3A 1HA8A 1POGA 3QOPA 3PO2J 2EWNA 5DUIA 2BXYA 3RZOJ 2XAFA 3HSFA 2H1KA 3ZPLA 2DMQA 3F22A 1TWCJ 3LSKA 1WJBA 2BY1A 2HNHA 2YPRA 3S3OA 3TL4X 3H3ZA 5K1YA 1YJNI 1JKQC 3WTVC 1KGSA 3I5UA 5D4RA 3ZOBA 3PUFA 5ICEA 1MMGA 1MJAA 1YW7A 3WTTC 1BC7C 4A3GJ 5HNFA 4XLAA 3K1PA 3EUAA 1Z77A 3HB9A 2L01A 1KQ0A 3WE3A 3JRFA 3HL2A 4KMFA 2VJ4A 2X51A 3R4KA 1ETYA 3OYDA 2LH9A 1O7LA 1EF4A 5E8GA 4G8XA 4OAYA 1YI2I 1XCVA 3ELKA 1H8AC 4PJ0C 2M30A 2MA3A 3M8EA 1T98A 1STZA 4JOMA 5ICFA 4PGGA 1MMDA 1I27A 1AA7A 3BR1A 4Z2YA 2PQ8A 1D5YA 2XF6A 3LSTA 2JVGA 2FSWA 2GBYA 4AC0A 4IF4A 3L2WA 2KJCA 3HRMA 5FLXZ 1O4XA 4MQ9F 5FKNA 3QP5A 4CCLA 1WQ2A 2O0YA 4UB6C 1WH7A 3BJ6A 1LEBA 4HZFA 3IV5A 3B73A 2LFBA 5LEJA 3PIPF 1YRNA 1U2WA 1ETOA 4L18B 5FKKA 4JQFA 2DMTA 2CUFA 3HG9A 2DA3A 3A0HC 4LJZF 1ULYA 3OY9A 3HPHA 2WB1N 3IP4B 1MSEC 3BTJA 1J0RA 3R0JA 1IC8A 1DDNA 2KZGA 3CJTB 3OYNA 1CGPA 3KX2A 5F64A 4BGDA 4YIRX 1YG2A 4HDUA 1D1BA 2HZDA 3BTCA 3C2GA 4ZC3A 3WTXC 2TCTA 3FBIB 2QSHX 4F92B 1I1SA 3EYIA 3S1NJ 2A5WA 3T8RA 2K4BA 1UHMA 2GWRA 1TW3A 1LE8B 2R5ZB 2O03A 4ABZA 3EYYA 2WTEA 4OIQF 2L9NA 4HX7A 1JKRC 3CCYA 2O8KA 2XPWA 4RAZA 4Y17A 1SVOA 1YX3A 4ESFA 4QTRA 3K10A 4KYWA 5GAHJ 3DKWA 3TBIA 3AAFA 4MGRA 1FOWA 4IQJA 2EV5A 2L9VA 5ICCA 4GYGA 2M45A 4ETSA 3HTSB 2XAGA 3KYCB 4C2MJ 2LMDA 3H35A 3BJAA 9ANTA 1G2HA 3JAMK 4UV8A 4AWXB 3S16J 1XDSA 1FOKA 1X4OA 4IHYA 3K1NA 4C3IJ 2QSGX 1Y39A 1XS9A 1JUPA 3PSIA 1MZBA 1X1PA 2EIJH 2QUFA 2ETHA 5E1ZB 3QPSA 1RR7A 5CVIA 4HSRA 4FTHA 1IV6A 3HUGB 4AIKA 4A5NA 2FEZA 4HSTA 4HV5A 3K7AJ 5B5EC 4YELA 3QPLA 1YQAA 3WG9A 3BROA 4B3AA 2GXBA 5M5YJ 1CQTA 1OPCA 2DQLA 2HOTA 4EJTA 3HOUJ 3F8CA 5TISC 1KU7A 4U0WA 1YRNB 1IN4A 2JPBA 3OSGA 4CCJA 3S93A 1HDDC 4CH7A 1G59A 4PFOA 2ZXHA 3CC7I 2R5ZA 2W82A 4HPQA 4OIRF 1ZREA 1LPQA 1SFUA 2F2EA 5DCFA 3FM5A 3RCOA 3S1MJ 1J75A 3K4CA 5K7HA 4XIDA 2BY3A 3QYFA 1JGGA 1TT0A 4Q48A 2R7DA 2KLOA 1FPQA 2GIVA 5EGOA 2R7VA 2BE5F 3P9IA 1ZRDA 1TTYA 1WJEA 3IH4A 4IRHA 2CMPA 4UVBA 3MD2A 1BN5A 2OBPA 2G7HA 2JA5J 2OA4A 4P5OA 1RNLA 3HRUA 5F27A 1TNTA 5J47A 2R7FA 1KQ9A 3S2DJ 1HBXG 2RQPA 1XCBA 2LKXA 1T6SA 1IN6A 2A68F 2CYYA 4YIFA 2YX7A 1MBJA 2XHKA 2RQQA 5EG0B 3RQ4A 1Y8RB 1IXRC 1ZHFA 4NQWB 2LVSA 1IF1A 4ASNA 1USSA 3BG6A 1R71A 3HPGA 1WWXA 2ELJA 2XGXA 1HW1A 2MBFA 4R1HA 2KQRA 4R8HA 2IAIA 4HEA2 5GP9A 1V5FA 1U9OA 4FX4A 3OS0A 4D7MA 5DV5A 1FBUA 1BR4A 1RKTA 1XPXA 2ICWG 2CS3A 2GOMA 3UNGC 2F5VA 1F4KA 3LFKA 1PP8F 2EPFA 3HSRA 4U87A 2VBWA 4EJWA 3CMMA 3V8KA 2XC7A 1FOXA 1QHHD 3D1NI 5M5XJ 4ZZLA 2P7VB 5IP7J 1BM9A 4M74A 2DA6A 1D0YA 4PCQA 1R4NB 1LNWA 4LB5A 3LA2A 3PQJA 4M72A 3ZQFA 3F8NA 4CZCA 1XD7A 4W1UA 4EM0B 4RDUA 3BZ6A 1MSFC 2OZUA 3S32A 5D4SA 4Y13A 1Y0NA 3DKXA 3CC4I 1FOYA 1UB9A 1ODDA 2KDOA 2R7OA 1HXDA 1GHCA 3SFIA 1R5HA 1QRYA 2ZNZA 3REOA 1W4MA 5K7ZA 2E1OA 2QLZA 5BNGA 3L2RA 3K70C 1A36A 5FLVA 2ZJ2A 2HTSA 2VE8A 1SD5A 2F4MB 3JRCA 1VQMI 4Y33A 4I02A 3LSRA 3K4LA 2ZCWA 1SANA 4GYIA 4A3KJ 5DD8A 2NXNB 1BI2A 3F6VA 5JR3A 3VYSB 1T95A 1T8IA 1SD4A 2BGCA 1P4AA 1Z3XA 3E6DA 3FF5A 3S2WA 2ZKZA 1FX7A 3A4CA 3T5XA 4MHGA 2ESNA 4XLEA 1JJ8C 2E1MB 4MO7A 2IP2A 3T1BA
chains in the Genus database with same CATH topology
2I10A 2HXOA 2CQXA 3HOVJ 2IBDA 1ZK8A 3GTQJ 2DMPA 1JKPC 2P81A 5EZGA 5E3OA 2M0CA 2E2IJ 3FISA 3BQZA 3O8GA 3ZQIA 3RQIA 4GFBA 3HOXJ 2K9QA 3M3YJ 2JA8J 4DW6A 3JRHA 1UG2A 1NK2P 1MBGA 5EZHA 3CMYA 1ZTRA 2XPVA 5E3LA 2R92J 4QIWN 2M8GX 4X6AJ 1AKHA 2EZLA 1WI3A 2JMWA 4M3DA 4MIMA 3HBLA 5E3MA 2X9DA 3IH3A 1RPWA 5F0HA 1GDTA 4BBRJ 2LK2A 1FTZA 2XB5A 2XPUA 5IOZA 1ZGWA 2R5YB 2L7FP 2XGEA 2MGQA 2X48A 1Z0XA 2NVYJ 2QCOA 3BG9A 3UKGA 1HLVA 4A3LJ 5F04A 4BXXJ 4XRSA 1AHDP 4D5CA 1PUFB 5J1UA 3RZDJ 2LD5A 3Q0UA 1HOMA 1TC3C 4XRSG 5DS9A 2KDZA 4DYQA 4G12A 5J1RA 3GTPJ 2JA7J 3HGYA 4UUSA 1NK3P 5F08A 3S1RJ 3TW7A 5M3MJ 1F36A 5JLWA 1H89C 3GBGA 3BR0A 3S17J 2DA4A 2HXIA 1R9TJ 1OFCX 4BY7J 2M34A 2FX0A 2R93J 2DA1A 2AO9A 2OF7A 2O9LA 5M3FJ 4I6ZA 3BT9A 3MKLA 3I4MJ 1UMQA 1GV2A 2NVQJ 3JRIA 4J19A 3S1QJ 5C44J 2JWTA 3G1MA 3Q0VA 3MN2A 3LSJA 2ELKA 5IPAA 1I3QJ 2Y9YA 3NARA 3W6VA 2JA6J 1I50J 4IEJA 4UUSB 2X6OA 4S0HB 2DA5A 5EG0A 3BR6A 2EQRA 1X58A 1RKWA 2MSYA 1JTYA 3FK6A 1B72B 1AU7A 2L7MP 2R7ZJ 4A3IJ 3TEDA 3CDLA 3ZQCA 2HI3A 4B1RA 1PUFA 2XSDC 2NS7A 2VI6A 4FISA 2ME0A 2LP0A 1ITYA 4IHVA 4MFEA 2L9RA 4XK4A 3Q3SA 3SJMA 2EZIA 1ZR2A 1Q1VA 1XG1A 3BG5A 1JKOC 4I76A 3GTMJ 1VF9A 4DZJA 2DA2A 4DYRA 3WHBA 4EEFG 3JRAA 2R0QC 1AKHB 1TWFJ 1TWGJ 3E7LA 1IRZA 3F0CA 1IG7A 2XGCA 5C4JJ 5F0FA 3OOUA 4JYKA 1ZKGA 4RBOA 2NOGA 5FKLA 5HODA 1HCRA 2L0KA 1LFBA 1IUFA 1H88C 4IHWA 3ZQGA 2FD5A 4M6VA 3O8HA 2H8RA 4L5EA 1W0UA 5FKOA 2E2JJ 4NDLA 2MG4A 3FK7A 1DU0A 3DCFA 2K9NA 1QVUA 5F1JA 2VKEA 2EZHA 5GPAA 3HOWJ 2R5YA 4MFDA 2K9SA 3DEWA 3G1LA 2XRLA 5IP6A 4HNVA 4M3EA 5FLMJ 3GTOJ 4A3FJ 2Y9ZA 5J3LA 1I6HJ 1F43A 1MBHA 4XRMA 1QVTA 2W48A 3GTGJ 5IYDJ 4CYCA 2B63J 1POGA 2O7OA 3PO2J 1GVDA 4A3EJ 3RZOJ 2H1KA 3HM5A 2AHQA 2DMQA 3A03A 1TWCJ 4JX6A 1FJLA 1APLC 3Q0WA 1JKQC 1VNDA 2DTZA 4C3JJ 3A01A 3ZOBA 3M4OJ 4A3GJ 2PMZN 2CJJA 2G0EA 1Z77A 3HB9A 3OIOA 3JRFA 2ECBA 2JJ7A 1ETYA 2HOSA 3FIWA 1EF4A 1BJZA 2N8GA 2COBA 1LFUP 3BQYA 3TW6A 4XICA 2FQ4A 1H8AC 5EF6A 3HDDA 4QSHA 3BR5A 3K2AA 5GPCA 1OCTC 3BR1A 2YS9A 1D5YA 2GBYA 4AC0A 5F0CA 5IYBJ 1X2MA 4JP0A 1O4XA 1FTTA 1A5JA 5FKNA 2Y30A 2FJ1A 1GV5A 1K83J 2TRTA 2E2HJ 2HOAA 1WH7A 3IV5A 2LFBA 1ETVA 1YRNA 1ETOA 4JX5A 1A6IA 4A93J 1ZQ3P 5FKKA 2HYJA 1GUUA 2DMTA 3FKIJ 3H3VK 2CUFA 2DA3A 2DJNA 2XB0X 1BW6A 1TWAJ 2WB1N 1MBEA 1MSEC 4FCYA 1B8IA 3JRDA 3GTLJ 3BTJA 1VI0A 3JR9A 1IC8A 2LY9A 5JLXA 5EGOB 3BTLA 2GLOA 2JN6A 1U78A 3H0GJ 2D5VA 2EZKA 1MBFA 1Y1WJ 3BTCA 2DMUA 1NTCA 2M9HA 2TCTA 2YU9J 3A02A 3S1NJ 1LE8B 2R5ZB 4ABZA 1T33A 2LTPA 5IP9J 2ID6A 1JKRC 3CCYA 2DA7A 2O8KA 2XPWA 3QQAA 1ZR4A 1IDZA 4QTRA 1HDPA 2ME6A 1UHSA 4W97A 3BR3A 1T56A 2WV1A 2OPTA 4C2MJ 3BTIA 4D5FA 1VFCA 9ANTA 5J1YA 2Y2ZA 1G2HA 2NVXJ 3S16J 5K7FA 3PM1A 4AYBN 3B6CA 4IHYA 2CRGA 3I4NJ 1FEXA 3G1OA 4M3BA 4BKXA 1MBKA 4C3IJ 3HOYJ 1XS9A 4BBSJ 1JUPA 4A3MJ 3VPRA 2KT0A 2VKVA 2Y31A 3QPSA 1RR7A 1JTXA 4FTHA 1BL0A 1IV6A 4FE4A 1WH5A 1ORKA 1WCMJ 1TWHJ 1ETXA 3K7AJ 3JREA 5C3EJ 3QPLA 1FIPA 2E19A 3GTJJ 1HF0A 4B3AA 2CUEA 1ETKA 5M5YJ 3GTKJ 3L1PA 1CQTA 2HOTA 3BR2A 3HOUJ 2VUMJ 2JK3A 1YRNB 1FIAA 3OSGA 1DU6A 1OCPA 3WHCA 1HDDC 3ZQLA 2R5ZA 3S2HJ 2YUSA 3TP0A 4CYCB 1W0TA 4A69C 5FJ8J 1WPKA 3JRBA 2HDDA 1GT0C 5EDNA 1JUMA 3S1MJ 4Y52J 5K7HA 4IHXA 4A3CJ 4XIDA 4X1EA 3LNQA 1JGGA 4FE7A 4M3GA 5EGOA 2CQQA 2NS8A 2XGDA 1RESA 1WGXA 1MH4A 4JX4A 4BY1J 3IH4A 1IDYA 3B6AA 2JA5J 2LR8A 3BG3A 1MH3A 1ENHA 3LSPA 5F27A 1P7IA 2VPRA 3S2DJ 3TP3A 2LKXA 5C4XJ 1B72A 1X2NA 2L7ZA 2QF7A 1K61A 1BW5A 1MBJA 2EH3A 5EG0B 1IJWC 2LVSA 1ETWA 1JT6A 1U8BA 2IAIA 5GP9A 4DZPA 2DMNA 1U9OA 1JT0A 3OSFA 4D7MA 2LLKA 2RAEA 3LSGA 4B4CA 1RKTA 5EEAA 2HQ5A 4UUTA 4A3BJ 2CU7A 2Y0SN 5E3NA 1S7EA 3SDGA 1MNMC 1B8IB 3D1NI 5M5XJ 5IP7J 2DA6A 4C3HJ 3NAUA 1QPIA 2EBIA 3ZQFA 4V2GA 4A3JJ 2M2EA 4W1UA 4D7NA 4RDUA 1Y1VJ 2K40A 3JRGA 1E3OC 1MSFC 1RETA 3A01B 2ID3A 1P7JA 3CQZJ 2ZB9A 1SFOJ 3S14J 3SFIA 1LE8A 1QRYA 5K7ZA 4M3FA 2E1OA 3IH2A 5BNGA 1JJ6C 5FLVA 4DYCA 5FKMA 1BA5A 1ETQA 3HKZN 3HOZJ 3JRCA 1JUSA 1U9NA 3HGGA 5IOYA 3LOCA 3LSRA 1SANA 4A3KJ 4AUXA 1IGNA 3RKQA 4LOCA 5M5WJ 2IEKA 3S15J 2NVTJ 2ECCA 3ZQHA 1XC5A 2WAQN 4V2FA 2GM4A 2DN0A 1OJLA 4A3DJ 4MLOA 3HEFA 3PO3J 1JJ8C 3MVPA 5DTDA 3C2BA 4MO7A 4Y7NJ 5EYRA 2MW8A 5IYCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I10 A;  2HXO A;  2CQX A;  3HOV J;  2IBD A;  1ZK8 A;  3GTQ J;  2DMP A;  1JKP C;  2P81 A;  5EZG A;  5E3O A;  2M0C A;  2E2I J;  3FIS A;  3BQZ A;  3O8G A;  3ZQI A;  3RQI A;  4GFB A;  3HOX J;  2K9Q A;  3M3Y J;  2JA8 J;  4DW6 A;  3JRH A;  1UG2 A;  1NK2 P;  1MBG A;  5EZH A;  3CMY A;  1ZTR A;  2XPV A;  5E3L A;  2R92 J;  4QIW N;  2M8G X;  4X6A J;  1AKH A;  2EZL A;  1WI3 A;  2JMW A;  4M3D A;  4MIM A;  3HBL A;  5E3M A;  2X9D A;  3IH3 A;  1RPW A;  5F0H A;  1GDT A;  4BBR J;  2LK2 A;  1FTZ A;  2XB5 A;  2XPU A;  5IOZ A;  1ZGW A;  2R5Y B;  2L7F P;  2XGE A;  2MGQ A;  2X48 A;  1Z0X A;  2NVY J;  2QCO A;  3BG9 A;  3UKG A;  1HLV A;  4A3L J;  5F04 A;  4BXX J;  4XRS A;  1AHD P;  4D5C A;  1PUF B;  5J1U A;  3RZD J;  2LD5 A;  3Q0U A;  1HOM A;  1TC3 C;  4XRS G;  5DS9 A;  2KDZ A;  4DYQ A;  4G12 A;  5J1R A;  3GTP J;  2JA7 J;  3HGY A;  4UUS A;  1NK3 P;  5F08 A;  3S1R J;  3TW7 A;  5M3M J;  1F36 A;  5JLW A;  1H89 C;  3GBG A;  3BR0 A;  3S17 J;  2DA4 A;  2HXI A;  1R9T J;  1OFC X;  4BY7 J;  2M34 A;  2FX0 A;  2R93 J;  2DA1 A;  2AO9 A;  2OF7 A;  2O9L A;  5M3F J;  4I6Z A;  3BT9 A;  3MKL A;  3I4M J;  1UMQ A;  1GV2 A;  2NVQ J;  3JRI A;  4J19 A;  3S1Q J;  5C44 J;  2JWT A;  3G1M A;  3Q0V A;  3MN2 A;  3LSJ A;  2ELK A;  5IPA A;  1I3Q J;  2Y9Y A;  3NAR A;  3W6V A;  2JA6 J;  1I50 J;  4IEJ A;  4UUS B;  2X6O A;  4S0H B;  2DA5 A;  5EG0 A;  3BR6 A;  2EQR A;  1X58 A;  1RKW A;  2MSY A;  1JTY A;  3FK6 A;  1B72 B;  1AU7 A;  2L7M P;  2R7Z J;  4A3I J;  3TED A;  3CDL A;  3ZQC A;  2HI3 A;  4B1R A;  1PUF A;  2XSD C;  2NS7 A;  2VI6 A;  4FIS A;  2ME0 A;  2LP0 A;  1ITY A;  4IHV A;  4MFE A;  2L9R A;  4XK4 A;  3Q3S A;  3SJM A;  2EZI A;  1ZR2 A;  1Q1V A;  1XG1 A;  3BG5 A;  1JKO C;  4I76 A;  3GTM J;  1VF9 A;  4DZJ A;  2DA2 A;  4DYR A;  3WHB A;  4EEF G;  3JRA A;  2R0Q C;  1AKH B;  1TWF J;  1TWG J;  3E7L A;  1IRZ A;  3F0C A;  1IG7 A;  2XGC A;  5C4J J;  5F0F A;  3OOU A;  4JYK A;  1ZKG A;  4RBO A;  2NOG A;  5FKL A;  5HOD A;  1HCR A;  2L0K A;  1LFB A;  1IUF A;  1H88 C;  4IHW A;  3ZQG A;  2FD5 A;  4M6V A;  3O8H A;  2H8R A;  4L5E A;  1W0U A;  5FKO A;  2E2J J;  4NDL A;  2MG4 A;  3FK7 A;  1DU0 A;  3DCF A;  2K9N A;  1QVU A;  5F1J A;  2VKE A;  2EZH A;  5GPA A;  3HOW J;  2R5Y A;  4MFD A;  2K9S A;  3DEW A;  3G1L A;  2XRL A;  5IP6 A;  4HNV A;  4M3E A;  5FLM J;  3GTO J;  4A3F J;  2Y9Z A;  5J3L A;  1I6H J;  1F43 A;  1MBH A;  4XRM A;  1QVT A;  2W48 A;  3GTG J;  5IYD J;  4CYC A;  2B63 J;  1POG A;  2O7O A;  3PO2 J;  1GVD A;  4A3E J;  3RZO J;  2H1K A;  3HM5 A;  2AHQ A;  2DMQ A;  3A03 A;  1TWC J;  4JX6 A;  1FJL A;  1APL C;  3Q0W A;  1JKQ C;  1VND A;  2DTZ A;  4C3J J;  3A01 A;  3ZOB A;  3M4O J;  4A3G J;  2PMZ N;  2CJJ A;  2G0E A;  1Z77 A;  3HB9 A;  3OIO A;  3JRF A;  2ECB A;  2JJ7 A;  1ETY A;  2HOS A;  3FIW A;  1EF4 A;  1BJZ A;  2N8G A;  2COB A;  1LFU P;  3BQY A;  3TW6 A;  4XIC A;  2FQ4 A;  1H8A C;  5EF6 A;  3HDD A;  4QSH A;  3BR5 A;  3K2A A;  5GPC A;  1OCT C;  3BR1 A;  2YS9 A;  1D5Y A;  2GBY A;  4AC0 A;  5F0C A;  5IYB J;  1X2M A;  4JP0 A;  1O4X A;  1FTT A;  1A5J A;  5FKN A;  2Y30 A;  2FJ1 A;  1GV5 A;  1K83 J;  2TRT A;  2E2H J;  2HOA A;  1WH7 A;  3IV5 A;  2LFB A;  1ETV A;  1YRN A;  1ETO A;  4JX5 A;  1A6I A;  4A93 J;  1ZQ3 P;  5FKK A;  2HYJ A;  1GUU A;  2DMT A;  3FKI J;  3H3V K;  2CUF A;  2DA3 A;  2DJN A;  2XB0 X;  1BW6 A;  1TWA J;  2WB1 N;  1MBE A;  1MSE C;  4FCY A;  1B8I A;  3JRD A;  3GTL J;  3BTJ A;  1VI0 A;  3JR9 A;  1IC8 A;  2LY9 A;  5JLX A;  5EGO B;  3BTL A;  2GLO A;  2JN6 A;  1U78 A;  3H0G J;  2D5V A;  2EZK A;  1MBF A;  1Y1W J;  3BTC A;  2DMU A;  1NTC A;  2M9H A;  2TCT A;  2YU9 J;  3A02 A;  3S1N J;  1LE8 B;  2R5Z B;  4ABZ A;  1T33 A;  2LTP A;  5IP9 J;  2ID6 A;  1JKR C;  3CCY A;  2DA7 A;  2O8K A;  2XPW A;  3QQA A;  1ZR4 A;  1IDZ A;  4QTR A;  1HDP A;  2ME6 A;  1UHS A;  4W97 A;  3BR3 A;  1T56 A;  2WV1 A;  2OPT A;  4C2M J;  3BTI A;  4D5F A;  1VFC A;  9ANT A;  5J1Y A;  2Y2Z A;  1G2H A;  2NVX J;  3S16 J;  5K7F A;  3PM1 A;  4AYB N;  3B6C A;  4IHY A;  2CRG A;  3I4N J;  1FEX A;  3G1O A;  4M3B A;  4BKX A;  1MBK A;  4C3I J;  3HOY J;  1XS9 A;  4BBS J;  1JUP A;  4A3M J;  3VPR A;  2KT0 A;  2VKV A;  2Y31 A;  3QPS A;  1RR7 A;  1JTX A;  4FTH A;  1BL0 A;  1IV6 A;  4FE4 A;  1WH5 A;  1ORK A;  1WCM J;  1TWH J;  1ETX A;  3K7A J;  3JRE A;  5C3E J;  3QPL A;  1FIP A;  2E19 A;  3GTJ J;  1HF0 A;  4B3A A;  2CUE A;  1ETK A;  5M5Y J;  3GTK J;  3L1P A;  1CQT A;  2HOT A;  3BR2 A;  3HOU J;  2VUM J;  2JK3 A;  1YRN B;  1FIA A;  3OSG A;  1DU6 A;  1OCP A;  3WHC A;  1HDD C;  3ZQL A;  2R5Z A;  3S2H J;  2YUS A;  3TP0 A;  4CYC B;  1W0T A;  4A69 C;  5FJ8 J;  1WPK A;  3JRB A;  2HDD A;  1GT0 C;  5EDN A;  1JUM A;  3S1M J;  4Y52 J;  5K7H A;  4IHX A;  4A3C J;  4XID A;  4X1E A;  3LNQ A;  1JGG A;  4FE7 A;  4M3G A;  5EGO A;  2CQQ A;  2NS8 A;  2XGD A;  1RES A;  1WGX A;  1MH4 A;  4JX4 A;  4BY1 J;  3IH4 A;  1IDY A;  3B6A A;  2JA5 J;  2LR8 A;  3BG3 A;  1MH3 A;  1ENH A;  3LSP A;  5F27 A;  1P7I A;  2VPR A;  3S2D J;  3TP3 A;  2LKX A;  5C4X J;  1B72 A;  1X2N A;  2L7Z A;  2QF7 A;  1K61 A;  1BW5 A;  1MBJ A;  2EH3 A;  5EG0 B;  1IJW C;  2LVS A;  1ETW A;  1JT6 A;  1U8B A;  2IAI A;  5GP9 A;  4DZP A;  2DMN A;  1U9O A;  1JT0 A;  3OSF A;  4D7M A;  2LLK A;  2RAE A;  3LSG A;  4B4C A;  1RKT A;  5EEA A;  2HQ5 A;  4UUT A;  4A3B J;  2CU7 A;  2Y0S N;  5E3N A;  1S7E A;  3SDG A;  1MNM C;  1B8I B;  3D1N I;  5M5X J;  5IP7 J;  2DA6 A;  4C3H J;  3NAU A;  1QPI A;  2EBI A;  3ZQF A;  4V2G A;  4A3J J;  2M2E A;  4W1U A;  4D7N A;  4RDU A;  1Y1V J;  2K40 A;  3JRG A;  1E3O C;  1MSF C;  1RET A;  3A01 B;  2ID3 A;  1P7J A;  3CQZ J;  2ZB9 A;  1SFO J;  3S14 J;  3SFI A;  1LE8 A;  1QRY A;  5K7Z A;  4M3F A;  2E1O A;  3IH2 A;  5BNG A;  1JJ6 C;  5FLV A;  4DYC A;  5FKM A;  1BA5 A;  1ETQ A;  3HKZ N;  3HOZ J;  3JRC A;  1JUS A;  1U9N A;  3HGG A;  5IOY A;  3LOC A;  3LSR A;  1SAN A;  4A3K J;  4AUX A;  1IGN A;  3RKQ A;  4LOC A;  5M5W J;  2IEK A;  3S15 J;  2NVT J;  2ECC A;  3ZQH A;  1XC5 A;  2WAQ N;  4V2F A;  2GM4 A;  2DN0 A;  1OJL A;  4A3D J;  4MLO A;  3HEF A;  3PO3 J;  1JJ8 C;  3MVP A;  5DTD A;  3C2B A;  4MO7 A;  4Y7N J;  5EYR A;  2MW8 A;  5IYC J; 
#chains in the Genus database with same CATH topology
 3ESW B;  2HXO A;  4C2T A;  3HOV J;  3GTQ J;  1A04 A;  2DMP A;  4P96 A;  1JKP C;  5EEG A;  4BJ5 C;  1QU3 A;  3WGG A;  2E2I J;  3FIS A;  2EV0 A;  2B7E A;  4EQQ A;  2ZC2 A;  5ERI A;  3CJR B;  3HOX J;  2CW7 A;  3BP8 A;  2JA8 J;  3FMQ A;  4QLC U;  1FT9 A;  1KYW A;  4FQG A;  2KRF A;  3CMY A;  5E3L A;  4KIC A;  3FXJ A;  3H5N A;  3LSI A;  4N9I A;  1YJW I;  2EZL A;  4MIM A;  2DFH A;  3HBL A;  5E79 C;  2ZXW H;  3IH3 A;  4N9H A;  4IKF A;  2HGC A;  2GIZ A;  4YEJ A;  2LK2 A;  4U7D A;  3GME A;  3V7S A;  5IY5 H;  3ZN1 A;  3OYJ A;  3L2U A;  2R5Y B;  4KT5 C;  3BG9 A;  3BWG A;  4AIH A;  4IPA A;  3K4K A;  1AHD P;  4D5C A;  1K78 B;  1SAX A;  2LD5 A;  3V42 A;  3I53 A;  3Q0U A;  3H1C A;  3IRQ A;  1HOM A;  3U2R A;  3RI4 A;  4XRS G;  3E0J B;  1U6G A;  5FGM A;  4G12 A;  1WJ5 A;  4C30 A;  3GTP J;  1BR2 A;  1R5I D;  3BZC A;  3KE2 A;  2DCE A;  2M87 A;  2NNN A;  3I55 I;  2RRE A;  1FSH A;  1FY7 A;  3S1R J;  2KFD A;  5M3M J;  4UVA A;  1YHQ I;  1H89 C;  1FYL A;  3GBG A;  2DU9 A;  1R9T J;  3M07 A;  3OYG A;  2VJ5 A;  1OFC X;  4EM2 A;  4BY7 J;  4LK0 F;  1OR7 A;  2R93 J;  1S7A A;  5CQG A;  3KCC A;  3J7Y J;  2XAH A;  2X4H A;  2CFX A;  2OD5 A;  5JI6 A;  3KET A;  3DWL E;  1FNN A;  2W00 A;  4LD5 A;  3QAH A;  2AS5 F;  2X6Y A;  3BT9 A;  4IXA A;  4AU7 A;  1ZYR F;  1VQ6 I;  3ONQ A;  5H6R A;  5TGT A;  5D5V B;  4BS9 A;  2ZFW A;  3W3C A;  3LSJ A;  3RSN A;  3VYT B;  3WU1 B;  2R3S A;  3W6V A;  2DW4 A;  1E3H A;  1I50 J;  1UZC A;  2X6O A;  4UNO A;  4BAC A;  4EGY A;  3F6O A;  1QA6 A;  3FDY A;  2EQR A;  3AFH A;  3CME I;  3GFL A;  2MSY A;  4DNC A;  2FNP A;  1QQI A;  3K2Z A;  1U5T B;  3AG2 H;  3W6J B;  3OYM A;  1PP7 U;  1AU7 A;  4A2U A;  4XSZ F;  3K4J A;  2DT7 B;  3CDL A;  4KIG A;  2QKM B;  3SYT A;  3SZG A;  2JTV A;  2VI6 A;  2VIX A;  4FIS A;  1HKQ A;  1LDJ A;  1X3U A;  4XLF A;  2LP0 A;  4M9X A;  2A69 F;  5HS9 A;  4LG3 A;  3DP7 A;  3IRR A;  4PUS A;  5L3D A;  2L9R A;  4B47 A;  1R22 A;  4FET A;  4NUB A;  4HNT A;  4KUM A;  2CQK A;  3BG5 A;  1BIB A;  3TO6 A;  3GTM J;  2R0Q C;  2DA2 A;  2MH2 A;  4DYR A;  2DK5 A;  1K6O A;  5HNH A;  1G6N A;  2RV8 A;  2IGK A;  1UJ8 A;  3MAJ A;  2O8X A;  4OAZ A;  3WE2 A;  1IRZ A;  5C4J J;  2QEN A;  4ZYG A;  4XLC A;  4RBO A;  1P4X A;  5HOD A;  4RB0 A;  2VAS A;  1HCR A;  1WJD A;  1H88 C;  2JUC A;  2EIM H;  1GLN A;  4M6V A;  4F55 A;  1MIJ A;  3Q9V A;  2VE9 A;  2H8R A;  2MYS A;  5FKO A;  3FXR A;  4P9F A;  4HF2 A;  4IX7 A;  3K4M A;  3PQK A;  3HOS A;  3MWM A;  2MG4 A;  4ZDL A;  1DU0 A;  3J81 K;  4U0Y A;  2QQ9 A;  1QVU A;  4OIN F;  2Z2S B;  2VQC A;  3LQR A;  3TGN A;  5F1J A;  3ZP5 A;  4G7O F;  2X0L A;  2EZH A;  4ESJ A;  2RC4 A;  1BI3 A;  2OV7 A;  3P9K A;  4PJL A;  1EV7 A;  4MFD A;  3DEW A;  4PDK A;  4HNV A;  4M3E A;  2L4A A;  2Z99 A;  2O3F A;  1QBJ A;  1OIS A;  3K4B A;  4I0A A;  2STT A;  4NHJ A;  1SFX A;  3J7A Y;  4GGG A;  2KIF A;  2W48 A;  1HKT A;  4B09 A;  1YIT I;  3KP2 A;  3RKW A;  2IS1 A;  2E34 A;  1S6L A;  1YO5 C;  2FMY A;  2O7O A;  2RGV A;  4FT8 A;  2O6G E;  1QZY A;  5J4V A;  1I6X A;  1QPM A;  1ON1 A;  1Z6R A;  3AG4 H;  3TQN A;  4JX6 A;  3ZN0 A;  3Q0W A;  1VND A;  2DTZ A;  1RUO A;  2K9L A;  1DGR M;  4II2 A;  1D0X A;  5KVR A;  4ZYE A;  2Z3Y A;  2CW8 A;  2XRO A;  3FIW A;  1BJZ A;  2N8G A;  2P6T A;  2COB A;  3BQY A;  2PX9 A;  4AIJ A;  2M5W A;  2W85 A;  4YFK F;  4XIC A;  4YRV A;  3NRV A;  1R1T A;  4XLN F;  4QSH A;  3IL2 A;  3KP5 A;  2DTR A;  2VQG A;  2A5Y B;  3K2A A;  2FOW A;  3ZMT A;  2DXI A;  5LHH A;  1W5C C;  3F8B A;  1B4A A;  1F9N A;  5H6Q A;  4BE0 A;  2QSF X;  5F0C A;  1YIJ I;  3M1C A;  2YX4 A;  1RZ4 A;  2X1C A;  1FTT A;  2WAQ A;  4XBF A;  3K6G A;  4ZYD A;  1A5J A;  2CFO A;  5B66 C;  4BYY A;  1K83 J;  2UZK A;  1YIO A;  3RYP A;  3ABK H;  3WU2 C;  1VQK I;  3PSF A;  4RMN A;  1N75 A;  1HC8 A;  4L9V A;  3G71 I;  4E7H A;  2FBK A;  5LRR A;  4B8X A;  3KLN A;  3KLO A;  3DKY A;  3LAJ A;  2HYJ A;  1GUU A;  3FKI J;  2OTJ I;  2EIL H;  2IVM A;  1X3Z B;  1XGN A;  1QO0 D;  2XB0 X;  1O3Q A;  1IRF A;  3HC7 A;  1BW6 A;  1OR7 C;  3CF5 F;  2HFH A;  1MBE A;  2K4J A;  2E60 A;  3JRD A;  2H6C A;  2QYO A;  3GTL J;  2MD5 A;  2DPD A;  4HG2 A;  1CF7 B;  4CIC A;  3BTL A;  2V1U A;  1OYI A;  3F8M A;  5E17 F;  5ILV A;  4WXD A;  3ABM H;  4XR6 A;  1MBF A;  4E7S A;  3DPT A;  4HYE A;  1NG7 A;  1P92 A;  3CCL I;  3CDI A;  1NTC A;  1VQP I;  2FU4 A;  1EA3 A;  4IOA F;  2CUJ A;  4CYD A;  3A02 A;  1OMI A;  3FXK A;  3CCU I;  1Z05 A;  2Y69 H;  2HVR A;  1A31 A;  1S29 A;  3CC2 I;  2ID6 A;  5AIP A;  3DEE A;  1SMY F;  3FM3 A;  1XMK A;  2X6W A;  1HDP A;  4XQF A;  5HDK A;  3HIF A;  5K5O A;  2P7C B;  4L9T A;  4S05 A;  2LKS A;  1Z67 A;  4W97 A;  5F6F A;  2KMU A;  2KP6 A;  3V4G A;  1VQ8 I;  1BOA A;  2RN7 A;  4I01 A;  4D5F A;  3MZH A;  2Y2Z A;  1MJB A;  3GZ5 A;  2EFQ A;  2JA2 A;  1DQU A;  4XKW A;  3BG7 A;  1W1W E;  3ASN H;  3D0S A;  4A0Y A;  4AYB N;  2I8D A;  1FP2 A;  3B6C A;  1FEX A;  4UY8 I;  3G1O A;  4BBS J;  4CHU A;  2AXT C;  3UR3 C;  5HOO A;  1VQ7 I;  4OMZ A;  2Y31 A;  4YFX F;  2GOX B;  3I64 A;  4HBL A;  3HKZ A;  4BXF A;  1BL0 A;  2FF4 A;  5LGU A;  3LA7 A;  1W7P A;  4MTE A;  1Y8Q B;  3RYR A;  3MEX A;  1P2F A;  2XF5 A;  1ETX A;  4IRG A;  2H09 A;  3NQO A;  5DEQ A;  3JRE A;  2E71 A;  4LK1 F;  4XRF A;  4E7J A;  5LBQ A;  1S9H A;  2EA4 A;  4LLL A;  5D5U B;  4EV0 A;  3IWF A;  2VUM J;  1V4R A;  2JK3 A;  1VQO I;  5D8L B;  2AQE A;  3PNY A;  1DU6 A;  2E1M C;  3GCM A;  2IT0 A;  3WHC A;  1H9G A;  4EJO A;  3E5Q A;  4MQV A;  2JQ7 A;  2BVM A;  3M9A A;  2V9K A;  4NBQ A;  2OQR A;  5EDN A;  2V7F A;  1BBY A;  3EPZ A;  4BL0 B;  4RAG A;  3KP3 A;  1B9M A;  2F5D A;  4A3C J;  3EQL F;  3P9C A;  3J7Z I;  1ZAR A;  3LNQ A;  1XGO A;  3U9G A;  4M3G A;  2CQQ A;  1WGX A;  3MKY B;  2E1C A;  2RNJ A;  3I0T A;  2LR8 A;  4U88 A;  3RKY A;  4OIO F;  1MH3 A;  4LG0 B;  3ISP A;  2VOP A;  3LSP A;  1SFK A;  2QBY A;  3HZJ A;  3DU5 A;  3LWF A;  1LDD A;  3CCR I;  1QZE A;  4O5V A;  3R61 A;  2QQB A;  3F72 A;  1B72 A;  1XB4 A;  4PSW A;  3NWS A;  3OYI A;  3J7A O;  3F9K A;  3L7W A;  3ECO A;  2KJB A;  1X1B A;  4WXC A;  1FSE A;  1OCO H;  4OU0 A;  2K27 A;  1ETW A;  2CGP A;  2FE3 A;  5L3F A;  4DZP A;  1MW7 A;  3K1M A;  3OSF A;  4QWQ A;  5D8K B;  4YII A;  2P8T A;  4ZJZ A;  5EEA A;  2HQ5 A;  4LFU A;  2CU7 A;  3J80 Z;  4WK8 F;  3VOD A;  2Y0S N;  3IAS 2;  1I3A A;  4XL9 A;  1S7E A;  3SDG A;  1B8I B;  1MD0 A;  3RPU D;  1O57 A;  2CG4 A;  3CUO A;  3GO5 A;  2PLY A;  1MMS A;  1QPI A;  2HWV A;  4V2G A;  2M0M A;  3CJQ B;  3R60 A;  4D7N A;  2DT6 A;  2IS2 A;  2A6H F;  3MKZ A;  1RI7 A;  4N4O B;  2QEX I;  1FC3 A;  2ID3 A;  2R7Q A;  1UST A;  2ZB9 A;  3C3W A;  3AG3 H;  2BBY A;  4AYB A;  3H36 A;  3S14 J;  5JVT A;  4L5J A;  2XRN A;  3HSE A;  2K86 A;  3IH2 A;  1JJ6 C;  1WZ2 A;  1WI9 A;  2G7U A;  2F5E A;  2GZW A;  1YW9 A;  3OL4 A;  5FKM A;  1BA5 A;  1ETQ A;  3HKZ N;  2JZY A;  1G3Y A;  3HGG A;  2OUM A;  1U5T C;  3H0D A;  5A2Q K;  3RKQ A;  1R58 A;  5KK1 A;  2JPC A;  5B1B H;  4HNU A;  5GAG J;  3IKT A;  3W2V A;  5M5W J;  2PMH A;  1RRJ A;  3GXO A;  3CZ6 A;  2B9S A;  1XC5 A;  1PJR A;  4V2F A;  1LKX A;  2GM4 A;  2DN0 A;  3C2H A;  4LGW A;  1ZLJ A;  3HEF A;  4TV7 A;  1WSU A;  4GRI A;  4ANJ A;  5IYC J;  2K5C A;  2CQX A;  4NQW A;  1ONV A;  1TZL A;  5EZG A;  4BQO A;  4IRI A;  1EJ9 A;  1T2K A;  3EDP A;  2H94 A;  3WGH A;  3BQZ A;  2DOD A;  2PBI A;  3O8G A;  5FD6 A;  5HDN A;  5LD2 C;  4GFB A;  4QPQ A;  2K9Q A;  5JFR A;  2QA4 I;  4OOI A;  3ABU A;  4DW6 A;  1WJA A;  3GX4 X;  1UG2 A;  2IW5 A;  4BXU A;  1MBG A;  2V1N A;  4AID A;  1UAA A;  3H9Q A;  4M71 A;  1MJ9 A;  4X6A J;  2GQQ A;  2W25 A;  4PK4 A;  4A0Z A;  4F52 A;  4ENK A;  5E3M A;  2STW A;  2AQF A;  1LJ9 A;  2V6E A;  2X9D A;  2BXZ A;  4D0P A;  1E3P A;  2KIS A;  4CO8 A;  1RPW A;  1GDT A;  2JVH A;  1FTZ A;  1J2X A;  3GW2 A;  1ZGW A;  2L4M A;  2MD0 A;  1TLH B;  4YFN F;  2H8W A;  4XOP A;  2OU2 A;  2X48 A;  1OCC H;  5E1W A;  5F04 A;  1UCR A;  3I9V 2;  5ICG A;  4KIB A;  4M9S A;  3V7C A;  5EJC A;  5JHF A;  3ZXS A;  3OYK A;  2UUZ A;  5DS9 A;  2MAB A;  3N05 A;  2EK5 A;  2CV1 A;  2JUG A;  3BCB A;  1IAW A;  3HGY A;  4UUS A;  1NK3 P;  1JE8 A;  5F08 A;  1D0Z A;  1F36 A;  2F5C A;  5JLW A;  2QWW A;  3KFW X;  2FRH A;  3BR0 A;  3GF2 A;  3IUO A;  3SEZ A;  1BI1 A;  3MCZ A;  4GO1 A;  2AO9 A;  4LIT A;  4AM3 A;  5EEH A;  3U1K A;  2OF7 A;  5ED4 A;  1G3S A;  4I98 B;  2UV1 A;  3PFI A;  4ON0 A;  2VQL A;  4GXO A;  5HLI A;  1PUE E;  3MKL A;  4WCG A;  3I4M J;  2IS6 A;  2EFP A;  1GV2 A;  1XMX A;  3ZCO A;  3LFU A;  2O61 A;  3JTG A;  2PJR A;  3S1Q J;  3NEU A;  3Q0V A;  4EAT A;  2M4G A;  5IPA A;  2BVL A;  2JA6 J;  1PDN C;  2XAJ A;  4RB3 C;  2ISZ A;  3DTE A;  1YFH A;  2ESH A;  2HZT A;  4CCN A;  4BQQ A;  1IN7 A;  2IGO A;  5LHI A;  2J5O A;  3GFJ A;  4EM1 A;  1WFX A;  4LLG F;  1ZG1 A;  2VKD A;  3TED A;  1QNT A;  1IUY A;  4E6K G;  2HI3 A;  3EUH A;  3BPX A;  4B1R A;  2XSD C;  1PUF A;  3HRT A;  2DOF A;  3C1D A;  1ITY A;  4IHV A;  1B9N A;  2UXN A;  3IAM 2;  1WRJ A;  3Q3S A;  4G9Y A;  2COM A;  4BJT A;  1IN5 A;  4IHS A;  1VF9 A;  4DZJ A;  3JRA A;  3I54 A;  2FBH A;  2V9P A;  4JK1 X;  1AWC A;  3OV8 A;  1AKH B;  4WF2 A;  3E5X A;  4Y3O A;  3DBH B;  4L0Z B;  2BHY A;  1R4M B;  5HS8 A;  1U5T A;  3FXQ A;  3OYE A;  2CUZ A;  2Z1D A;  4JYK A;  3H5R A;  3E97 A;  2A3S A;  2NOG A;  3O2P E;  3ZMD A;  3ZMV A;  1WVR A;  1LFB A;  3K4N A;  2EA2 A;  3I59 A;  2JRT A;  3CUQ A;  3FBN B;  3O8H A;  4E7I A;  2QGU A;  4XON A;  5B1A H;  1XSX A;  3GZN B;  4CGZ A;  4WX9 A;  2MLG A;  4NDL A;  3FK7 A;  3K69 A;  3BDD A;  4XKB A;  1R36 A;  4C9Y A;  5FB2 A;  3L09 A;  3H92 A;  3EET A;  1TP4 A;  4PJM A;  1Z21 A;  4FAS D;  3OYC A;  3G4S I;  3FWE A;  5L3G A;  1O3T A;  1H0M A;  4E7L A;  4NC8 A;  1GXP A;  1HST A;  4D1Q A;  1I6H J;  1F43 A;  2ELH A;  3HHG A;  2LF7 A;  3S8P A;  3JSP A;  1MBH A;  2VLA A;  4XRM A;  2C6Y A;  1FZP B;  5FO5 A;  3N97 A;  2IA1 A;  4A3E J;  3MZY A;  2LYC A;  3U1D A;  5D6E A;  2ZO4 A;  4XNF A;  1FJL A;  1DUX C;  1ZN2 A;  1APL C;  4ENN A;  4CCM A;  2L5Q A;  1UFM A;  1Z1D A;  1SFE A;  4AD9 A;  4S04 A;  3R0A A;  2CJJ A;  3F8F A;  4I09 A;  3OIO A;  2ECB A;  4KMU X;  4KIT B;  2Z16 A;  1LQ1 A;  3BZK A;  4BEH B;  5L3E A;  3QRF F;  3GEZ A;  2R4G A;  2Z33 A;  2VOO A;  2FQ4 A;  4YG2 F;  2H6B A;  3M8J A;  4OWR B;  3HDD A;  4Z6Y A;  4HF0 A;  3CLO A;  3SZT A;  3TOB A;  5DD4 A;  1IRG A;  3BR5 A;  4UB8 C;  2BW3 A;  2LOO A;  4OMY A;  4HQM A;  1R7J A;  3IHU A;  5GPC A;  2YS9 A;  5CLS A;  1UHW A;  3OIQ A;  1EH7 A;  2DK8 A;  4L5I A;  2EJR A;  5IYB J;  1X2M A;  4P9U A;  3GUD A;  3LSM A;  4L0Y B;  5LLQ A;  4BQN A;  2CO5 A;  2Y30 A;  1ZAO A;  3LMM A;  2TRT A;  5JHU A;  3OOP A;  2HOA A;  3WOD F;  1LUJ B;  2VPL A;  5CVJ A;  1J9I A;  4PJN A;  2HQA A;  1F1Z A;  4F91 B;  4JX5 A;  1A6I A;  3CO6 C;  1KON A;  3FHN A;  3MZ8 A;  4BUP A;  1RUN A;  1ZQ3 P;  1Z9C A;  4GDF A;  3ML6 A;  1REP C;  3CP8 A;  3N4M A;  2W57 A;  2GAU A;  2DJN A;  4IOC F;  5F1R A;  1D1C A;  3ABL H;  5K5R A;  1U8R A;  4I0B A;  5DYM A;  1TQP A;  2R7T A;  1DP7 P;  5DCM A;  5GTH C;  1HKS A;  1Y6I A;  2XDV A;  5JLX A;  5EGO B;  2LG4 A;  4XLP F;  2GLO A;  1LDK B;  2D2W A;  3H0G J;  4EJV A;  2IGN A;  2D5V A;  1AOY A;  4ESB A;  1KQ8 A;  3QOD A;  4DJA A;  2DMU A;  3W2A A;  2M9H A;  3QYB A;  1SVL A;  2CW0 F;  2DJI A;  4BAY A;  3TKY A;  5KNL A;  2YU9 J;  1TQI A;  1PVE A;  5CVR A;  4PSX A;  5IP9 J;  1NH3 A;  4DBR A;  2PEX A;  3G2B A;  1S8N A;  2DA7 A;  5E1X A;  4UHT A;  3FXU A;  3RPU A;  1IDZ A;  1MMA A;  4HA8 A;  2EV6 A;  2VC1 A;  1S3J A;  1J7K A;  1T56 A;  1XGS A;  2WAD A;  2WV1 A;  5LEK A;  1J09 A;  1FP1 D;  3CD6 I;  3HUG A;  3AKZ A;  2IS4 A;  2NVX J;  3E3V A;  1X1D A;  2FNA A;  2ZJR F;  5K7F A;  1OCZ H;  1YX5 A;  2KZV A;  2GA1 A;  1TNS A;  2CRG A;  2VT2 A;  4M3B A;  1MBK A;  2HEO A;  3KEQ A;  5TJJ A;  3VPR A;  2KT0 A;  4HQE A;  2DYR H;  1IO2 A;  3BC8 A;  1SD7 A;  2PN6 A;  4E7Z A;  3DLA A;  2FOK A;  4I7H A;  3ZMU A;  1KYZ A;  4FE4 A;  4PJJ A;  5DCM B;  3JAM Z;  2OCE A;  1TWH J;  4BJ6 C;  1FBS A;  3TOA A;  1P4W A;  1V5G A;  4ZZD A;  5B3S H;  1FIP A;  5FD5 A;  3GTJ J;  2CUE A;  3GTK J;  2ZME C;  1SD6 A;  4J00 A;  4M73 A;  2L2O A;  1FIA A;  2YU3 A;  3RTR A;  3RKX A;  3WG7 H;  1ZEL A;  2VXZ A;  3FXL A;  4HLY A;  1IZ1 A;  5AON A;  3TDZ C;  2G9W A;  3ZQL A;  5HLT A;  2YUS A;  3HYI A;  3TP0 A;  2K85 A;  2WAE A;  3Q5F A;  4CYC B;  1N78 A;  5GTI C;  1BJA A;  5FJ8 J;  4KN4 X;  2HDD A;  1NHA A;  2DDB A;  4XN3 A;  2FXA A;  1JUM A;  2PJR B;  3CDH A;  4WXH A;  5K5Q A;  1JHH A;  4Y52 J;  3EUK L;  3G3Z A;  4IHX A;  1Z7L A;  2HVQ A;  2LSO A;  4X1E A;  1ZGJ A;  3OR2 C;  4ZDP A;  5J8C A;  5FLX K;  2NS8 A;  2VJJ A;  1RES A;  2XGD A;  5ILU A;  4DQ2 A;  1YYV A;  1MH4 A;  3SXY A;  1T0F C;  1IDY A;  3B6A A;  1B6A A;  3D5R C;  3SQN A;  3VSK A;  1ENH A;  2DFE A;  2GXG A;  3SFZ A;  2VPR A;  1ERD A;  3ABT A;  4ZTF A;  4M9Z A;  2CV2 A;  3ROU A;  1Q1H A;  3CCM I;  4JBA A;  5C4X J;  3LSH A;  1XX5 A;  2L7Z A;  1BW5 A;  1KA8 A;  2EH3 A;  1IJW C;  2XAQ A;  1X3W B;  2DAO A;  1YE9 A;  4DOZ A;  3ZQ7 A;  1FLI A;  1T0F A;  4DGW B;  2KIM A;  1JT6 A;  1GXQ A;  1SAU A;  2LBF A;  2QQA A;  2DMN A;  4RAF A;  3L2C A;  1JT0 A;  3VFZ A;  2BYV E;  5D6F A;  3CCE I;  2RAE A;  3LSG A;  4B4C A;  1WKM A;  2QQ8 A;  1LEA A;  2XAS A;  4UUT A;  3AL0 C;  3H5A A;  5E3N A;  5IT9 K;  1V3F A;  3QWL A;  1FYK A;  5CPR B;  2DI3 A;  4C3H J;  1BR1 A;  3JSO A;  3CLQ A;  4NC7 A;  2RDP A;  4BDZ A;  1E0E A;  3VOE A;  1E3O C;  4IL6 C;  5CVV A;  2R7S A;  4R79 A;  1ON2 A;  1P7J A;  3CQZ J;  3CUQ B;  2LF8 A;  3KZI C;  1SFO J;  2LC2 A;  2ZME B;  3L2Q A;  4BE2 A;  4DBQ A;  2DFF A;  1LE8 A;  4O3M A;  4D9J A;  2H1L A;  2V6C A;  2CV0 A;  1OQY A;  4M3F A;  3J81 Z;  4DYC A;  4IZZ A;  2L7K A;  1XTA A;  1UEL B;  3I56 I;  1U9N A;  5IOY A;  3WTS C;  1VQ4 I;  4F93 B;  3HXL A;  2VKH A;  2E7W A;  5E20 A;  2BW3 B;  2E35 A;  4AUX A;  3D5S C;  2J5P A;  1Z3Y A;  2HTJ A;  2IEK A;  5ILS A;  3S15 J;  1ZRC A;  2NVT J;  1L0O C;  2HYF A;  4NB5 A;  2ECC A;  3ZQH A;  5CQE A;  3J80 K;  2OAZ A;  3E6M A;  1EKE A;  3SHF A;  3PNT A;  3QP6 A;  3CMA I;  3PO3 J;  4KT6 A;  4LIU A;  3W6K B;  2LBF B;  5DTD A;  3SDB A;  2OCC H;  4Y7N J;  2XIG A;  1FBQ A;  2I10 A;  3OL3 A;  3E1S A;  1G3T A;  3QU6 A;  5E3O A;  2M0C A;  3DPL C;  4EVI A;  4M6Y A;  1XDU A;  2BOL A;  4Q47 A;  3RQI A;  2IA2 A;  2L3D A;  3PNV A;  3M3Y J;  5DM6 F;  3X2Q H;  1NK2 P;  3QU3 A;  3F21 A;  2KRH A;  5EZH A;  1ZTR A;  3QPT A;  4QIW N;  1WI3 A;  3OR1 C;  4Q4Z F;  2Z5U A;  4BHP A;  3K70 D;  2K02 A;  3DTK A;  2DDA A;  4UXN A;  2XB5 A;  2HVS A;  5IOZ A;  3PFY A;  3FZV A;  4I2O A;  2IRF G;  1BOB A;  2VQH A;  4F3Q A;  2L7F P;  1JGS A;  2MGQ A;  2PMZ A;  2XGE A;  4ZYA A;  3WTW C;  3OYB A;  5FFZ A;  3CCQ I;  1N77 A;  1HLV A;  1VQL I;  4A3L J;  2NVU B;  4BXX J;  4XRS A;  5DDG A;  5J1U A;  3RZD J;  1QHG A;  1WJC A;  4MNU A;  3OIP A;  1MKM A;  2BY2 A;  3A1Y A;  2WC2 A;  4HOB A;  4KNY A;  5KCM A;  1P9Q C;  2KDZ A;  4NC6 A;  2K3P A;  2WA0 A;  5J1R A;  3KYL A;  2WWY A;  1TL8 A;  2JA7 J;  3PUB A;  1SEU A;  2HS5 A;  3PIO F;  2DOA A;  2RKH A;  3EUH C;  3G6E I;  4FX0 A;  1KU2 A;  2LRD A;  4CZZ A;  3OYL A;  3K0L A;  2VB6 A;  2NAZ A;  2DA4 A;  2QZ8 A;  4V19 K;  1W7P B;  2FBI A;  3HTU A;  2OQG A;  3T8T A;  2DYS H;  1UMQ A;  2HDC A;  3JRI A;  4J19 A;  5C44 J;  1LVA A;  3MN2 A;  3PJR A;  1S7O A;  2ELK A;  2F5F A;  2KIU A;  2W24 A;  4IO9 F;  2V9V A;  5CYV A;  3Q9S A;  1A35 A;  2VJI A;  2OZ6 A;  2F4I A;  4S0H B;  3JW4 A;  3I59 B;  1Z91 A;  3DEU A;  1RKW A;  2ZFU A;  3OWT A;  3CP2 A;  1OCR H;  1B72 B;  4L9J A;  1YJ9 I;  2L7M P;  3GZ6 A;  1N25 A;  1MND A;  3BCA A;  4HLX A;  5FFX A;  4EGZ A;  4A3I J;  2VBZ A;  2LY1 A;  1MMN A;  3ZQC A;  1K78 A;  4IQ4 A;  5GAE J;  4KIS A;  3DPU A;  1ZRF A;  4MFE A;  3K9T A;  4XK4 A;  4RB1 A;  4A6E A;  2DPU A;  2EZI A;  2XAU A;  3B02 A;  5IT3 A;  1DPR A;  1Q1V A;  1XG1 A;  2D1V A;  1XMA A;  1ZR2 A;  1T08 B;  1JKO C;  4I76 A;  1O3S A;  2PI0 A;  3I58 A;  1ZH5 A;  3WHB A;  2KKO A;  2YR2 A;  4EEF G;  1LB2 A;  2HPI A;  2NRA C;  1R00 A;  2KRC A;  3FX3 A;  1TWF J;  4RM2 A;  4CSW A;  4LB6 B;  1TWG J;  2BEO A;  2E36 A;  3CF2 A;  3DXJ F;  5CKT A;  3FHZ A;  1A6Q A;  1OYY A;  2XGC A;  1R1U A;  2YSR A;  5J8F A;  2CWE A;  4KN7 X;  5FKL A;  3DFG A;  4KJZ A;  1W36 D;  1R23 A;  4IHW A;  2OTL I;  3ZQG A;  3GWZ A;  2V26 A;  1KU3 A;  4GCV A;  5H20 A;  2P5V A;  3SEQ A;  3RJP A;  1IXC A;  4L5E A;  1W0U A;  4RA2 A;  5FRM A;  3RDI A;  2M7B A;  2VT3 A;  2F48 A;  3V8L A;  3WGI A;  2Q8K A;  2VKE A;  1G4D A;  2MFZ A;  1X1A A;  2HPM A;  2R5Y A;  2K9S A;  3QYE A;  4E4H A;  2XRL A;  5IP6 A;  4Y15 A;  5FLM J;  3GTO J;  1ZG3 A;  4HF1 A;  4A3F J;  2ZJP F;  1ZLK A;  2XF7 A;  5J3L A;  4KIF A;  3WTY C;  2Y0S A;  2W4S A;  4BDY A;  2X6X A;  1QVT A;  5HDG A;  2DLL A;  4CYC A;  5IYD J;  4MEY F;  4CCK A;  2L54 A;  4N0B A;  1HQC A;  2EIN H;  4RB2 C;  4XN0 A;  3PL8 A;  1GVD A;  4N4N B;  1S72 I;  2MLK A;  3GYH X;  3HM5 A;  2AHQ A;  1UG0 A;  3A03 A;  2H27 A;  4QPO A;  2NOJ B;  4XSX F;  4C3J J;  1MDM A;  3A01 A;  2RVC A;  3M4O J;  1XN7 A;  4BE1 A;  2PMZ N;  3I71 A;  2G0E A;  4Q5S F;  4HX4 A;  2QVO A;  2JJ7 A;  1BI0 A;  3H3U A;  2HOS A;  1V5E A;  1L3L A;  3MMY B;  1LFU P;  2EFO A;  5E18 F;  3E6B A;  3TW6 A;  3DBL B;  1I39 A;  2VL8 A;  5EF6 A;  1K79 A;  3L2V A;  3I3L A;  2P5K A;  1SVM A;  2Q0O A;  1S5L C;  2ZXJ A;  3ZMS A;  1OCT C;  1DP3 A;  1D1A A;  3F3X A;  2E1N A;  1MNE A;  2P5L C;  2O5R A;  3TO7 A;  3COA C;  4JP0 A;  2QKL B;  3V7R A;  3CCJ I;  4XOR A;  5HVQ C;  2DBB A;  2VOD A;  3DBR B;  5D5X B;  2ZJQ F;  3IWZ A;  1OYW A;  2FJ1 A;  1GV5 A;  2MH9 A;  1V54 H;  2Q2E A;  2DT5 A;  2E2H J;  4ENM A;  3S3M A;  4HRI A;  3I4P A;  2ZBK A;  1ETV A;  4BEH A;  4G7H F;  1QZZ A;  4A93 J;  1JHF A;  3ERE D;  1K4S A;  3H3V K;  2IJL A;  4KA4 A;  1XSD A;  5AIQ A;  4LG0 A;  4HV6 A;  4P1W A;  3CO7 C;  1TWA J;  2HYG D;  4M6X A;  2L02 A;  2XUB A;  4FCY A;  1B8I A;  4BU2 A;  3OYA A;  1VI0 A;  4UV9 A;  3JR9 A;  1SC7 A;  2VN2 A;  2LY9 A;  1IXS B;  1C0W A;  1W7P D;  4PFP A;  5J40 A;  5LRS A;  2JN6 A;  4XM3 A;  1U78 A;  6PAX A;  3ZMZ A;  2ISY A;  1FMW A;  2EZK A;  1W5S A;  5BMZ A;  1Y1W J;  3DQV C;  3CES A;  2K9M A;  3KEY A;  2WY7 Q;  4CA0 A;  3R6S A;  1DGW Y;  1SMT A;  1BC8 C;  4XKV A;  1T33 A;  2LTP A;  2P0W A;  3GVA A;  4F7Z A;  1OKR A;  5FRN A;  1D8K A;  2M7A A;  3DF8 A;  2LRE A;  3BY6 A;  3QQA A;  1ZR4 A;  2A07 F;  2KPM A;  3AL0 B;  2M3A A;  3DV8 A;  4K2E A;  2ME6 A;  1WHU A;  2HOE A;  3HRS A;  1UHS A;  3KEO A;  3BR3 A;  2HQR A;  2KHM A;  4II3 A;  2BHZ A;  1T38 A;  3A2K A;  2VON A;  2OPT A;  3OYH A;  1HSJ A;  1F5T A;  3BTI A;  1ACI A;  1VFC A;  3A0B C;  5J1Y A;  1Y56 A;  4AVZ A;  3OS2 A;  1FWZ A;  4A6D A;  1T39 A;  3PM1 A;  2WB1 A;  4HX8 A;  1G3W A;  4BQA A;  3I4N J;  2HKO A;  2B0L A;  2GA2 A;  3L00 A;  4BKX A;  2Z9O A;  2IXS A;  3BLY A;  3HOY J;  3V8J A;  4A3M J;  5BPD A;  4EMS A;  3IKV A;  2VKV A;  4G6D A;  2PMU A;  2FML A;  1U0J A;  1EH8 A;  2ACJ A;  1JTX A;  3IC7 A;  2LY2 A;  1QGP A;  4U7B A;  3U21 A;  5DM7 F;  4J01 A;  1YTY A;  5J4Y A;  1WH5 A;  3RIR A;  1ORK A;  1WCM J;  4CXF A;  2XVC A;  2LKP A;  1WJF A;  2P4W A;  4KFC A;  5C3E J;  1X19 A;  2AXL A;  4L9N A;  5LHG A;  5D5W B;  1I5Z A;  3MFK A;  2E19 A;  2XSJ C;  3VWB A;  1HF0 A;  2E5N A;  1ETK A;  3KPH A;  3L1P A;  3BR2 A;  1O3R A;  2R7U A;  2R7W A;  1D5V A;  1VQ5 I;  4ZTJ A;  3KZZ A;  2DFI A;  1YOV B;  4U0V A;  2OC6 A;  1OCP A;  5LGT A;  3S2H J;  4BHC A;  2JT1 A;  1RC9 A;  1VZ0 A;  1LFP A;  1W0T A;  4A69 C;  1WPK A;  3VEP A;  3JRB A;  1ZGA A;  2WY8 Q;  2F6C A;  1GT0 C;  2ZSH B;  3E6C C;  3CTA A;  1JI8 A;  2CSO A;  2TDX A;  3BOQ A;  5A2Q Z;  1PYV A;  1X1C A;  4FE7 A;  3FKJ A;  2V1X A;  1VQ9 I;  1CF7 A;  2CH0 A;  2W84 A;  3TDU C;  4B48 A;  5BOX A;  4JX4 A;  3RPQ A;  4BY1 J;  4A5M A;  4CUG A;  4LLN A;  2X1D A;  4O6J A;  3QOE A;  3BG3 A;  3FXM A;  2HKX A;  5HLH A;  5L3C A;  4HDV A;  1P7I A;  3KYD B;  1VQN I;  3HHH A;  3ULQ B;  2DO7 A;  3TP3 A;  4H0E A;  1X2N A;  2QF7 A;  1K61 A;  4PZJ A;  4ZYH A;  2ADU A;  1K7A A;  2V79 A;  4E70 A;  1R49 A;  2IA0 A;  2UXX A;  4B44 A;  2KL4 A;  3FMR A;  2E5Z A;  3DTI A;  4ZDO A;  3E5U A;  2PFB A;  1OLT A;  1U8B A;  5CJ9 A;  1YS6 A;  4I99 C;  2MC3 A;  4ENJ A;  4H4K C;  5TRD A;  4RAY A;  2LLK A;  5GAD J;  4LMY A;  2BV6 A;  4B43 A;  2Y75 A;  3NWT A;  3ASO H;  4A3B J;  1DPU A;  3CUQ C;  1RIO H;  5BS6 A;  5LGN A;  1MNM C;  3LQQ A;  3HOT A;  4NNJ A;  3G73 A;  3NAU A;  2EBI A;  2QM3 A;  1W36 C;  4X0G A;  3P5J A;  3KIO A;  4A3J J;  1P6R A;  2M2E A;  3GFM A;  3VDX A;  2VBX A;  1Y1V J;  2K40 A;  4RM3 A;  3JRG A;  5H2F C;  3GFI A;  3GLL A;  3VYR B;  3ERM A;  1RET A;  1TT5 B;  1VTN C;  2WBM A;  3A01 B;  3LA3 A;  1R6R A;  2M8E A;  2OJE D;  3ZRG A;  2V1D A;  3VYU B;  3M1E A;  2IGM A;  2A6E F;  4DIQ A;  4KDP A;  2CQN A;  4CCO A;  1E2X A;  2EFN A;  1I1G A;  2JSC A;  3WTU C;  1RR8 C;  3HOZ J;  3GLX A;  1JUS A;  4RLF A;  3LOC A;  2XV4 S;  4UVC A;  4XLH A;  3VSL A;  3CCV I;  4ZH4 F;  1IGN A;  3WTZ A;  2M4K A;  4UUV A;  4LOC A;  1B59 A;  2W1O A;  3QPH A;  4RGX A;  1K6Y A;  5J6X A;  2WAQ N;  2Q1Z B;  2BZT A;  2M1B A;  3HJE A;  4A3D J;  1OJL A;  4MLO A;  4IVN A;  3MVP A;  2FA5 A;  3L9F A;  2FUG 2;  5KHD A;  3WU0 A;  4MEX F;  1D3Y A;  3C2B A;  4RS8 A;  5EYR A;  2MW8 A;  2DQR A;  3T0Y A;  4MTD A;  4CDG A;  1LVK A;  1Y0U A;  4A12 A;  2IBD A;  1ZK8 A;  4PGH A;  2JRM A;  2P81 A;  5CVU A;  1NG6 A;  1YW8 A;  3MKW B;  3KZY A;  2V4J C;  2VBY A;  2Q2E B;  2PG4 A;  1X4P A;  3ZQI A;  1D8J A;  2K7L A;  4G6T B;  3JRH A;  3CJN A;  3DU6 A;  1KU9 A;  1GVJ A;  2QBY B;  2DOE A;  2XPV A;  2NNY A;  2R92 J;  1V55 H;  2M8G X;  3C18 A;  1AKH A;  1HW5 A;  4M3D A;  2JMW A;  3JCU C;  4E7K A;  3DLL F;  1J5Y A;  1E17 A;  2D45 A;  5F0H A;  4BBR J;  5JVG F;  1FMV A;  2XPU A;  3FMS A;  3UKG A;  1Z0X A;  2NVY J;  2QCO A;  1H9T A;  1HW2 A;  5IT9 Z;  4BH9 A;  5KAF C;  1PUF B;  2P6S A;  1BIA A;  2W7N A;  3H9J A;  3M8F A;  1TC3 C;  4B3X A;  2A05 A;  3OMY A;  3KP4 A;  2EFW A;  2LNB A;  2VC0 A;  1MDM B;  4DYQ A;  2XKO A;  1YS7 A;  1B1B A;  4XKC A;  3LL7 A;  1ZG5 A;  3TW7 A;  2VXD A;  5DUK A;  2KIQ A;  4RGU A;  3S17 J;  3ECH A;  2HXI A;  4HAM A;  2UWM A;  2M34 A;  2FX0 A;  2DA1 A;  4BNC A;  2O9L A;  2XKP A;  4WWC A;  2IPQ X;  2GXA A;  5M3F J;  2D1H A;  4I6Z A;  3TO9 A;  5BPI A;  4XMY A;  2NVQ J;  1XSV A;  2JWT A;  1U3E M;  3G1M A;  2MC4 A;  3VB2 A;  4ITV A;  2ZSI B;  3ZQQ A;  2L9S A;  1I3Q J;  3LAP A;  2Y9Y A;  3NAR A;  1W5T A;  2F4O B;  2HQN A;  2Y0M A;  4IEJ A;  4UUS B;  4XOT A;  1YLF A;  2E7X A;  2DA5 A;  2ZME A;  3BPV A;  5EG0 A;  3BR6 A;  1X58 A;  5HLG A;  1JTY A;  3FK6 A;  5BQT A;  1IW7 F;  1TQM A;  3S3N A;  1XGM A;  1R1V A;  2X1E A;  2LDU A;  5KAI C;  3FXO A;  2R7Z J;  1IN8 A;  4EJU A;  3F23 A;  2R7X A;  3ZR8 X;  3SZP A;  4LIV A;  1Z7U A;  2NS7 A;  3CCS I;  2I5U A;  2ME0 A;  3ZGK A;  5FRO A;  3BJO A;  2A61 A;  4RLQ A;  2RNG A;  3SJM A;  3C7J A;  3KP6 A;  5E8I A;  1K4T A;  1TW2 A;  4IJA A;  2X85 A;  4BHB A;  2NYX A;  2JSP A;  1TBX A;  1KZH A;  1FYM A;  1IRX A;  3M7G A;  3E7L A;  2EB7 A;  3F0C A;  3P7N A;  4Y4R A;  1IG7 A;  5F0F A;  3TMO A;  2ZXI A;  3OOU A;  4HW0 A;  1ZKG A;  5L3B A;  1JXS A;  2A6T A;  1MGT A;  2L0K A;  1IUF A;  4A0X A;  2CQ7 A;  4G6Q A;  2R7R A;  4C2U A;  3W2W A;  2FD5 A;  3MQ0 A;  1O7F A;  2E2J J;  4G94 A;  1IV8 A;  1J59 A;  3H9G A;  3O6B B;  3D5L A;  3DCF A;  2K9N A;  2HU9 A;  2K3F A;  2ZNY A;  3JTH A;  3KP7 A;  4G7Z F;  1R5G A;  4IHT A;  5LFA A;  4OIP F;  5GPA A;  3OYF A;  3HOW J;  3O3K A;  1Z6T A;  3OS1 A;  3G1L A;  2HDW A;  2Y9Z A;  4P55 A;  2WV0 A;  4RGS A;  2BY0 A;  5HS7 A;  2EIK H;  1M1E B;  2PJP A;  3AG1 H;  1EH6 A;  2HR3 A;  2NS0 A;  2WAF A;  3GTG J;  2Y48 A;  4AVP A;  4FHT A;  2B63 J;  1G8X A;  4RGR A;  2FQ3 A;  1HA8 A;  1POG A;  3QOP A;  3PO2 J;  2EWN A;  5DUI A;  2BXY A;  3RZO J;  2XAF A;  3HSF A;  2H1K A;  3ZPL A;  2DMQ A;  3F22 A;  1TWC J;  3LSK A;  1WJB A;  2BY1 A;  2HNH A;  2YPR A;  3S3O A;  3TL4 X;  3H3Z A;  5K1Y A;  1YJN I;  1JKQ C;  3WTV C;  1KGS A;  3I5U A;  5D4R A;  3ZOB A;  3PUF A;  5ICE A;  1MMG A;  1MJA A;  1YW7 A;  3WTT C;  1BC7 C;  4A3G J;  5HNF A;  4XLA A;  3K1P A;  3EUA A;  1Z77 A;  3HB9 A;  2L01 A;  1KQ0 A;  3WE3 A;  3JRF A;  3HL2 A;  4KMF A;  2VJ4 A;  2X51 A;  3R4K A;  1ETY A;  3OYD A;  2LH9 A;  1O7L A;  1EF4 A;  5E8G A;  4G8X A;  4OAY A;  1YI2 I;  1XCV A;  3ELK A;  1H8A C;  4PJ0 C;  2M30 A;  2MA3 A;  3M8E A;  1T98 A;  1STZ A;  4JOM A;  5ICF A;  4PGG A;  1MMD A;  1I27 A;  1AA7 A;  3BR1 A;  4Z2Y A;  2PQ8 A;  1D5Y A;  2XF6 A;  3LST A;  2JVG A;  2FSW A;  2GBY A;  4AC0 A;  4IF4 A;  3L2W A;  2KJC A;  3HRM A;  5FLX Z;  1O4X A;  4MQ9 F;  5FKN A;  3QP5 A;  4CCL A;  1WQ2 A;  2O0Y A;  4UB6 C;  1WH7 A;  3BJ6 A;  1LEB A;  4HZF A;  3IV5 A;  3B73 A;  2LFB A;  5LEJ A;  3PIP F;  1YRN A;  1U2W A;  1ETO A;  4L18 B;  5FKK A;  4JQF A;  2DMT A;  2CUF A;  3HG9 A;  2DA3 A;  3A0H C;  4LJZ F;  1ULY A;  3OY9 A;  3HPH A;  2WB1 N;  3IP4 B;  1MSE C;  3BTJ A;  1J0R A;  3R0J A;  1IC8 A;  1DDN A;  2KZG A;  3CJT B;  3OYN A;  1CGP A;  3KX2 A;  5F64 A;  4BGD A;  4YIR X;  1YG2 A;  4HDU A;  1D1B A;  2HZD A;  3BTC A;  3C2G A;  4ZC3 A;  3WTX C;  2TCT A;  3FBI B;  2QSH X;  4F92 B;  1I1S A;  3EYI A;  3S1N J;  2A5W A;  3T8R A;  2K4B A;  1UHM A;  2GWR A;  1TW3 A;  1LE8 B;  2R5Z B;  2O03 A;  4ABZ A;  3EYY A;  2WTE A;  4OIQ F;  2L9N A;  4HX7 A;  1JKR C;  3CCY A;  2O8K A;  2XPW A;  4RAZ A;  4Y17 A;  1SVO A;  1YX3 A;  4ESF A;  4QTR A;  3K10 A;  4KYW A;  5GAH J;  3DKW A;  3TBI A;  3AAF A;  4MGR A;  1FOW A;  4IQJ A;  2EV5 A;  2L9V A;  5ICC A;  4GYG A;  2M45 A;  4ETS A;  3HTS B;  2XAG A;  3KYC B;  4C2M J;  2LMD A;  3H35 A;  3BJA A;  9ANT A;  1G2H A;  3JAM K;  4UV8 A;  4AWX B;  3S16 J;  1XDS A;  1FOK A;  1X4O A;  4IHY A;  3K1N A;  4C3I J;  2QSG X;  1Y39 A;  1XS9 A;  1JUP A;  3PSI A;  1MZB A;  1X1P A;  2EIJ H;  2QUF A;  2ETH A;  5E1Z B;  3QPS A;  1RR7 A;  5CVI A;  4HSR A;  4FTH A;  1IV6 A;  3HUG B;  4AIK A;  4A5N A;  2FEZ A;  4HST A;  4HV5 A;  3K7A J;  5B5E C;  4YEL A;  3QPL A;  1YQA A;  3WG9 A;  3BRO A;  4B3A A;  2GXB A;  5M5Y J;  1CQT A;  1OPC A;  2DQL A;  2HOT A;  4EJT A;  3HOU J;  3F8C A;  5TIS C;  1KU7 A;  4U0W A;  1YRN B;  1IN4 A;  2JPB A;  3OSG A;  4CCJ A;  3S93 A;  1HDD C;  4CH7 A;  1G59 A;  4PFO A;  2ZXH A;  3CC7 I;  2R5Z A;  2W82 A;  4HPQ A;  4OIR F;  1ZRE A;  1LPQ A;  1SFU A;  2F2E A;  5DCF A;  3FM5 A;  3RCO A;  3S1M J;  1J75 A;  3K4C A;  5K7H A;  4XID A;  2BY3 A;  3QYF A;  1JGG A;  1TT0 A;  4Q48 A;  2R7D A;  2KLO A;  1FPQ A;  2GIV A;  5EGO A;  2R7V A;  2BE5 F;  3P9I A;  1ZRD A;  1TTY A;  1WJE A;  3IH4 A;  4IRH A;  2CMP A;  4UVB A;  3MD2 A;  1BN5 A;  2OBP A;  2G7H A;  2JA5 J;  2OA4 A;  4P5O A;  1RNL A;  3HRU A;  5F27 A;  1TNT A;  5J47 A;  2R7F A;  1KQ9 A;  3S2D J;  1HBX G;  2RQP A;  1XCB A;  2LKX A;  1T6S A;  1IN6 A;  2A68 F;  2CYY A;  4YIF A;  2YX7 A;  1MBJ A;  2XHK A;  2RQQ A;  5EG0 B;  3RQ4 A;  1Y8R B;  1IXR C;  1ZHF A;  4NQW B;  2LVS A;  1IF1 A;  4ASN A;  1USS A;  3BG6 A;  1R71 A;  3HPG A;  1WWX A;  2ELJ A;  2XGX A;  1HW1 A;  2MBF A;  4R1H A;  2KQR A;  4R8H A;  2IAI A;  4HEA 2;  5GP9 A;  1V5F A;  1U9O A;  4FX4 A;  3OS0 A;  4D7M A;  5DV5 A;  1FBU A;  1BR4 A;  1RKT A;  1XPX A;  2ICW G;  2CS3 A;  2GOM A;  3UNG C;  2F5V A;  1F4K A;  3LFK A;  1PP8 F;  2EPF A;  3HSR A;  4U87 A;  2VBW A;  4EJW A;  3CMM A;  3V8K A;  2XC7 A;  1FOX A;  1QHH D;  3D1N I;  5M5X J;  4ZZL A;  2P7V B;  5IP7 J;  1BM9 A;  4M74 A;  2DA6 A;  1D0Y A;  4PCQ A;  1R4N B;  1LNW A;  4LB5 A;  3LA2 A;  3PQJ A;  4M72 A;  3ZQF A;  3F8N A;  4CZC A;  1XD7 A;  4W1U A;  4EM0 B;  4RDU A;  3BZ6 A;  1MSF C;  2OZU A;  3S32 A;  5D4S A;  4Y13 A;  1Y0N A;  3DKX A;  3CC4 I;  1FOY A;  1UB9 A;  1ODD A;  2KDO A;  2R7O A;  1HXD A;  1GHC A;  3SFI A;  1R5H A;  1QRY A;  2ZNZ A;  3REO A;  1W4M A;  5K7Z A;  2E1O A;  2QLZ A;  5BNG A;  3L2R A;  3K70 C;  1A36 A;  5FLV A;  2ZJ2 A;  2HTS A;  2VE8 A;  1SD5 A;  2F4M B;  3JRC A;  1VQM I;  4Y33 A;  4I02 A;  3LSR A;  3K4L A;  2ZCW A;  1SAN A;  4GYI A;  4A3K J;  5DD8 A;  2NXN B;  1BI2 A;  3F6V A;  5JR3 A;  3VYS B;  1T95 A;  1T8I A;  1SD4 A;  2BGC A;  1P4A A;  1Z3X A;  3E6D A;  3FF5 A;  3S2W A;  2ZKZ A;  1FX7 A;  3A4C A;  3T5X A;  4MHG A;  2ESN A;  4XLE A;  1JJ8 C;  2E1M B;  4MO7 A;  2IP2 A;  3T1B A; 
#chains in the Genus database with same CATH homology
 2I10 A;  2HXO A;  2CQX A;  3HOV J;  2IBD A;  1ZK8 A;  3GTQ J;  2DMP A;  1JKP C;  2P81 A;  5EZG A;  5E3O A;  2M0C A;  2E2I J;  3FIS A;  3BQZ A;  3O8G A;  3ZQI A;  3RQI A;  4GFB A;  3HOX J;  2K9Q A;  3M3Y J;  2JA8 J;  4DW6 A;  3JRH A;  1UG2 A;  1NK2 P;  1MBG A;  5EZH A;  3CMY A;  1ZTR A;  2XPV A;  5E3L A;  2R92 J;  4QIW N;  2M8G X;  4X6A J;  1AKH A;  2EZL A;  1WI3 A;  2JMW A;  4M3D A;  4MIM A;  3HBL A;  5E3M A;  2X9D A;  3IH3 A;  1RPW A;  5F0H A;  1GDT A;  4BBR J;  2LK2 A;  1FTZ A;  2XB5 A;  2XPU A;  5IOZ A;  1ZGW A;  2R5Y B;  2L7F P;  2XGE A;  2MGQ A;  2X48 A;  1Z0X A;  2NVY J;  2QCO A;  3BG9 A;  3UKG A;  1HLV A;  4A3L J;  5F04 A;  4BXX J;  4XRS A;  1AHD P;  4D5C A;  1PUF B;  5J1U A;  3RZD J;  2LD5 A;  3Q0U A;  1HOM A;  1TC3 C;  4XRS G;  5DS9 A;  2KDZ A;  4DYQ A;  4G12 A;  5J1R A;  3GTP J;  2JA7 J;  3HGY A;  4UUS A;  1NK3 P;  5F08 A;  3S1R J;  3TW7 A;  5M3M J;  1F36 A;  5JLW A;  1H89 C;  3GBG A;  3BR0 A;  3S17 J;  2DA4 A;  2HXI A;  1R9T J;  1OFC X;  4BY7 J;  2M34 A;  2FX0 A;  2R93 J;  2DA1 A;  2AO9 A;  2OF7 A;  2O9L A;  5M3F J;  4I6Z A;  3BT9 A;  3MKL A;  3I4M J;  1UMQ A;  1GV2 A;  2NVQ J;  3JRI A;  4J19 A;  3S1Q J;  5C44 J;  2JWT A;  3G1M A;  3Q0V A;  3MN2 A;  3LSJ A;  2ELK A;  5IPA A;  1I3Q J;  2Y9Y A;  3NAR A;  3W6V A;  2JA6 J;  1I50 J;  4IEJ A;  4UUS B;  2X6O A;  4S0H B;  2DA5 A;  5EG0 A;  3BR6 A;  2EQR A;  1X58 A;  1RKW A;  2MSY A;  1JTY A;  3FK6 A;  1B72 B;  1AU7 A;  2L7M P;  2R7Z J;  4A3I J;  3TED A;  3CDL A;  3ZQC A;  2HI3 A;  4B1R A;  1PUF A;  2XSD C;  2NS7 A;  2VI6 A;  4FIS A;  2ME0 A;  2LP0 A;  1ITY A;  4IHV A;  4MFE A;  2L9R A;  4XK4 A;  3Q3S A;  3SJM A;  2EZI A;  1ZR2 A;  1Q1V A;  1XG1 A;  3BG5 A;  1JKO C;  4I76 A;  3GTM J;  1VF9 A;  4DZJ A;  2DA2 A;  4DYR A;  3WHB A;  4EEF G;  3JRA A;  2R0Q C;  1AKH B;  1TWF J;  1TWG J;  3E7L A;  1IRZ A;  3F0C A;  1IG7 A;  2XGC A;  5C4J J;  5F0F A;  3OOU A;  4JYK A;  1ZKG A;  4RBO A;  2NOG A;  5FKL A;  5HOD A;  1HCR A;  2L0K A;  1LFB A;  1IUF A;  1H88 C;  4IHW A;  3ZQG A;  2FD5 A;  4M6V A;  3O8H A;  2H8R A;  4L5E A;  1W0U A;  5FKO A;  2E2J J;  4NDL A;  2MG4 A;  3FK7 A;  1DU0 A;  3DCF A;  2K9N A;  1QVU A;  5F1J A;  2VKE A;  2EZH A;  5GPA A;  3HOW J;  2R5Y A;  4MFD A;  2K9S A;  3DEW A;  3G1L A;  2XRL A;  5IP6 A;  4HNV A;  4M3E A;  5FLM J;  3GTO J;  4A3F J;  2Y9Z A;  5J3L A;  1I6H J;  1F43 A;  1MBH A;  4XRM A;  1QVT A;  2W48 A;  3GTG J;  5IYD J;  4CYC A;  2B63 J;  1POG A;  2O7O A;  3PO2 J;  1GVD A;  4A3E J;  3RZO J;  2H1K A;  3HM5 A;  2AHQ A;  2DMQ A;  3A03 A;  1TWC J;  4JX6 A;  1FJL A;  1APL C;  3Q0W A;  1JKQ C;  1VND A;  2DTZ A;  4C3J J;  3A01 A;  3ZOB A;  3M4O J;  4A3G J;  2PMZ N;  2CJJ A;  2G0E A;  1Z77 A;  3HB9 A;  3OIO A;  3JRF A;  2ECB A;  2JJ7 A;  1ETY A;  2HOS A;  3FIW A;  1EF4 A;  1BJZ A;  2N8G A;  2COB A;  1LFU P;  3BQY A;  3TW6 A;  4XIC A;  2FQ4 A;  1H8A C;  5EF6 A;  3HDD A;  4QSH A;  3BR5 A;  3K2A A;  5GPC A;  1OCT C;  3BR1 A;  2YS9 A;  1D5Y A;  2GBY A;  4AC0 A;  5F0C A;  5IYB J;  1X2M A;  4JP0 A;  1O4X A;  1FTT A;  1A5J A;  5FKN A;  2Y30 A;  2FJ1 A;  1GV5 A;  1K83 J;  2TRT A;  2E2H J;  2HOA A;  1WH7 A;  3IV5 A;  2LFB A;  1ETV A;  1YRN A;  1ETO A;  4JX5 A;  1A6I A;  4A93 J;  1ZQ3 P;  5FKK A;  2HYJ A;  1GUU A;  2DMT A;  3FKI J;  3H3V K;  2CUF A;  2DA3 A;  2DJN A;  2XB0 X;  1BW6 A;  1TWA J;  2WB1 N;  1MBE A;  1MSE C;  4FCY A;  1B8I A;  3JRD A;  3GTL J;  3BTJ A;  1VI0 A;  3JR9 A;  1IC8 A;  2LY9 A;  5JLX A;  5EGO B;  3BTL A;  2GLO A;  2JN6 A;  1U78 A;  3H0G J;  2D5V A;  2EZK A;  1MBF A;  1Y1W J;  3BTC A;  2DMU A;  1NTC A;  2M9H A;  2TCT A;  2YU9 J;  3A02 A;  3S1N J;  1LE8 B;  2R5Z B;  4ABZ A;  1T33 A;  2LTP A;  5IP9 J;  2ID6 A;  1JKR C;  3CCY A;  2DA7 A;  2O8K A;  2XPW A;  3QQA A;  1ZR4 A;  1IDZ A;  4QTR A;  1HDP A;  2ME6 A;  1UHS A;  4W97 A;  3BR3 A;  1T56 A;  2WV1 A;  2OPT A;  4C2M J;  3BTI A;  4D5F A;  1VFC A;  9ANT A;  5J1Y A;  2Y2Z A;  1G2H A;  2NVX J;  3S16 J;  5K7F A;  3PM1 A;  4AYB N;  3B6C A;  4IHY A;  2CRG A;  3I4N J;  1FEX A;  3G1O A;  4M3B A;  4BKX A;  1MBK A;  4C3I J;  3HOY J;  1XS9 A;  4BBS J;  1JUP A;  4A3M J;  3VPR A;  2KT0 A;  2VKV A;  2Y31 A;  3QPS A;  1RR7 A;  1JTX A;  4FTH A;  1BL0 A;  1IV6 A;  4FE4 A;  1WH5 A;  1ORK A;  1WCM J;  1TWH J;  1ETX A;  3K7A J;  3JRE A;  5C3E J;  3QPL A;  1FIP A;  2E19 A;  3GTJ J;  1HF0 A;  4B3A A;  2CUE A;  1ETK A;  5M5Y J;  3GTK J;  3L1P A;  1CQT A;  2HOT A;  3BR2 A;  3HOU J;  2VUM J;  2JK3 A;  1YRN B;  1FIA A;  3OSG A;  1DU6 A;  1OCP A;  3WHC A;  1HDD C;  3ZQL A;  2R5Z A;  3S2H J;  2YUS A;  3TP0 A;  4CYC B;  1W0T A;  4A69 C;  5FJ8 J;  1WPK A;  3JRB A;  2HDD A;  1GT0 C;  5EDN A;  1JUM A;  3S1M J;  4Y52 J;  5K7H A;  4IHX A;  4A3C J;  4XID A;  4X1E A;  3LNQ A;  1JGG A;  4FE7 A;  4M3G A;  5EGO A;  2CQQ A;  2NS8 A;  2XGD A;  1RES A;  1WGX A;  1MH4 A;  4JX4 A;  4BY1 J;  3IH4 A;  1IDY A;  3B6A A;  2JA5 J;  2LR8 A;  3BG3 A;  1MH3 A;  1ENH A;  3LSP A;  5F27 A;  1P7I A;  2VPR A;  3S2D J;  3TP3 A;  2LKX A;  5C4X J;  1B72 A;  1X2N A;  2L7Z A;  2QF7 A;  1K61 A;  1BW5 A;  1MBJ A;  2EH3 A;  5EG0 B;  1IJW C;  2LVS A;  1ETW A;  1JT6 A;  1U8B A;  2IAI A;  5GP9 A;  4DZP A;  2DMN A;  1U9O A;  1JT0 A;  3OSF A;  4D7M A;  2LLK A;  2RAE A;  3LSG A;  4B4C A;  1RKT A;  5EEA A;  2HQ5 A;  4UUT A;  4A3B J;  2CU7 A;  2Y0S N;  5E3N A;  1S7E A;  3SDG A;  1MNM C;  1B8I B;  3D1N I;  5M5X J;  5IP7 J;  2DA6 A;  4C3H J;  3NAU A;  1QPI A;  2EBI A;  3ZQF A;  4V2G A;  4A3J J;  2M2E A;  4W1U A;  4D7N A;  4RDU A;  1Y1V J;  2K40 A;  3JRG A;  1E3O C;  1MSF C;  1RET A;  3A01 B;  2ID3 A;  1P7J A;  3CQZ J;  2ZB9 A;  1SFO J;  3S14 J;  3SFI A;  1LE8 A;  1QRY A;  5K7Z A;  4M3F A;  2E1O A;  3IH2 A;  5BNG A;  1JJ6 C;  5FLV A;  4DYC A;  5FKM A;  1BA5 A;  1ETQ A;  3HKZ N;  3HOZ J;  3JRC A;  1JUS A;  1U9N A;  3HGG A;  5IOY A;  3LOC A;  3LSR A;  1SAN A;  4A3K J;  4AUX A;  1IGN A;  3RKQ A;  4LOC A;  5M5W J;  2IEK A;  3S15 J;  2NVT J;  2ECC A;  3ZQH A;  1XC5 A;  2WAQ N;  4V2F A;  2GM4 A;  2DN0 A;  1OJL A;  4A3D J;  4MLO A;  3HEF A;  3PO3 J;  1JJ8 C;  3MVP A;  5DTD A;  3C2B A;  4MO7 A;  4Y7N J;  5EYR A;  2MW8 A;  5IYC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...