4LLLA

Crystal structure of s. aureus mepr-dna complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords MepR
publication title Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 50
structure length 138
sequence length 138
chains with identical sequence B, C, D, I, J, M, O
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lllA00
3I71A 1W7PB 4JK1X 2PG4A 3F8MA 4B8XA 3O2PE 5CYVA 5IT3A 4CZZA 1V3FA 2IA0A 2M87A 3E6DA 2AXLA 1BM9A 1STZA 4YIIA 1U8RA 4MHGA 2FBIA 2XV4S 2JZYA 1BC7C 4IJAA 5IT9K 1QZYA 3V7RA 1LDJA 5BMZA 4MEYF 3FZVA 4UV9A 2FF4A 3WTYC 1K6OA 3QU3A 3GYHX 1O3RA 4L18B 2IVMA 4NHJA 2VC0A 3T5XA 2KIFA 4Y17A 3F21A 3BY6A 3SFZA 3ZN0A 2QYOA 4P9FA 4RGUA 5E8IA 4AIKA 2GIVA 1IRFA 3HSEA 4AIHA 4ZZDA 2ZNYA 3IRQA 1W7PD 4LMYA 3LQQA 1YG2A 2HFHA 3RKYA 4M9SA 5H6QA 2ELHA 4LLGF 2DFIA 4EM0B 4CXFA 1HW5A 1Z05A 3FXQA 1P4AA 3F3XA 3OOPA 3BWGA 2E1CA 3MEXA 4KT5C 1IN4A 3SZPA 3T0YA 1IN6A 1SD6A 2BYVE 2STTA 3ULQB 1C0WA 2UWMA 1UHWA 2O03A 2OD5A 2Z3YA 3G3ZA 3IHUA 4M71A 5H20A 3ZMSA 1BJAA 2Q0OA 5E20A 2VBXA 5LLQA 6PAXA 4LB6B 1MZBA 2CG4A 4MTDA 4U7DA 3ZMTA 1Z1DA 2DQRA 4R1HA 3MZYA 2X0LA 1OKRA 1W5SA 1O3QA 1CF7B 3RTRA 3GW2A 1AWCA 3GLXA 1U5TA 3ZN1A 3JTHA 2L02A 2DTRA 2D2WA 3J80Z 2NRAC 4RGSA 1G3SA 3HTUA 5DCMA 2H27A 4ZZLA 1LJ9A 2UZKA 1KYZA 4EM2A 5JHUA 4NQWA 2DT5A 1P4XA 3KETA 5ICEA 1ON2A 4XSXF 2F2EA 2JRTA 3DPTA 3BJ6A 1DUXC 5E17F 4ENMA 3GFJA 2YX4A 2F5DA 3LA2A 5CLSA 1MDMB 1S3JA 1HSTA 2RKHA 2LF7A 3GUDA 1T2KA 2A6HF 3NQOA 4G6QA 4RAYA 4ENKA 1MGTA 4M74A 3L7WA 2O3FA 1XSDA 1KYWA 1ZN2A 4I09A 5JVTA 2QQBA 2Q8KA 1I6XA 4O5VA 3TO6A 4I2OA 3PQKA 2K02A 4RS8A 3WTVC 2HKXA 2HYFA 2VODA 2BE5F 2F5FA 4FT8A 3IKVA 4CDGA 1JHFA 4AIJA 4QWQA 1ZGAA 5FFXA 4LLNA 1MJ9A 2MLGA 2FMYA 1GVJA 2IJLA 1JGSA 4OIQF 1B59A 2FOKA 2BV6A 2HR3A 2ZNZA 3CTAA 2HWVA 3MFKA 1P6RA 2QBYA 4D0PA 1L0OC 4E70A 2R3SA 4MQVA 3QPTA 3JTGA 3M8FA 5LBQA 2XAJA 4Q48A 5FB2A 4KUMA 3TO7A 4BAYA 3LQRA 2YSRA 4LGWA 2ZO4A 4L9VA 1ZHFA 4N0BA 2XKOA 4KIBA 2A3SA 1KQ0A 5BS6A 2XVCA 2W24A 2PI0A 2P5VA 1WSUA 2OA4A 2LDUA 4WWCA 4KIFA 5EEGA 2NAZA 3G73A 4XSZF 5FO5A 3DFGA 4GCVA 2X4HA 1TNTA 1IAWA 3Q5FA 4EVIA 2HEOA 2UXXA 2ACJA 1TTYA 3IL2A 1JHHA 4DQ2A 5HVQC 1PP7U 5E1ZB 1KGSA 2E7WA 1UFMA 1P92A 3M8EA 3ROUA 5D4SA 3EQLF 1BN5A 4HX4A 1K78B 3FMQA 1U5TC 4O3MA 2J5OA 1EH6A 1S6LA 2M5WA 3C1DA 4CO8A 3T8RA 3RKXA 3V8KA 5D8LB 5FD5A 2E7XA 2CQKA 4P5OA 1ZREA 4BH9A 4G8XA 4ZYGA 3R0JA 1DPRA 1PUEE 4I01A 4BQAA 1IN7A 1BC8C 2QQ9A 2PJPA 1UB9A 3MQ0A 2M30A 4LJZF 4M9ZA 4L0ZB 2V79A 1B1BA 2WV0A 4UXNA 3SXYA 3R4KA 1GXQA 2JPCA 5CVJA 1H9TA 4N9IA 1T98A 4BYYA 1L3LA 4HA8A 2PN6A 3ZMUA 3HRSA 2P8TA 4HZFA 5D8KB 2V6CA 3ZQ7A 3KLNA 2GXBA 1IUYA 1HKSA 2GQQA 2MC3A 1V4RA 1D8JA 3I64A 2ZFWA 3CJNA 3I4PA 3P7NA 3RYRA 2RGVA 5CVVA 2NNYA 3IWFA 1HW2A 1CF7A 3K9TA 1LQ1A 3RIRA 3J81K 4KMUX 2MA3A 1BIAA 5DDGA 3KCCA 4A5NA 4LD5A 4UV8A 1G3WA 4I02A 1FX7A 2K27A 1BI1A 3MCZA 2IRFG 2CSOA 2K4BA 4UNOA 3FWEA 3W6KB 3F8NA 1AOYA 4MNUA 1J9IA 1FNNA 3KLOA 4I0AA 2YR2A 4B09A 4RB0A 2WC2A 1ZG5A 3GFIA 2DPDA 3LWFA 1YLFA 1S7OA 3P9KA 4IRGA 2EFQA 3F8FA 5D4RA 4G9YA 2QLZA 5K5QA 5KK1A 2O8XA 2RNJA 1WI9A 1XN7A 1WKMA 3I54A 1QQIA 4RGRA 2MLKA 2W57A 3QRFF 2DI3A 1LEAA 4KA4A 5DUIA 4NB5A 5LRRA 3FXUA 2EFWA 5DD8A 2QM3A 5JR3A 2O0YA 2AS5F 2R7FA 1P4WA 5HS7A 3WGHA 1QZZA 3FM5A 4U0VA 2KRFA 2BBYA 3IC7A 4P55A 3EDPA 2L54A 5LGTA 4HV5A 1J0RA 2GXGA 3GXOA 3LSTA 1HBXG 2RC4A 3P9IA 2YPRA 4OINF 1ZGJA 4IRHA 3F8BA 3DXJF 2FA5A 1W5TA 2FQ3A 3WTXC 3B02A 3E6MA 1FY7A 2J5PA 4HF2A 2PBIA 1I1SA 3WTTC 2P7CB 2HS5A 4EMSA 4HV6A 2ZJ2A 1QNTA 3K2ZA 3ELKA 2FU4A 2FNPA 4U0YA 2H6BA 2PMHA 1IZ1A 3FM3A 3Q9VA 5F1RA 3ZPLA 1ZLKA 2DPUA 4KDPA 1IRGA 1PDNC 2ZBKA 1R1TA 5LEKA 1FBQA 2UXNA 2XASA 2QVOA 3QOPA 2KIMA 3RDIA 1WWXA 4ENNA 4GXOA 2XAFA 2Z5UA 1RNLA 2XROA 2G9WA 1FBUA 3I0TA 1R5HA 3MWMA 2ISYA 3BP8A 1IF1A 3RPUA 1RI7A 2H94A 5DUKA 1XMAA 3KP4A 3OV8A 4ASNA 3JSOA 4HF0A 2XUBA 1R1VA 3KEOA 4P96A 1YS6A 4F7ZA 3E5XA 5D5WB 2EV0A 2HZTA 4PDKA 1VTNC 4OMZA 2A07F 5E1WA 3CLOA 4HX8A 2H6CA 1FYKA 3IWZA 3CUQA 4ZH4F 3TGNA 3F8CA 4HDUA 4PGHA 4R8HA 4Y15A 1GXPA 2VXZA 2JSCA 4RB3C 4HQEA 3FXRA 1RUOA 3M7GA 3DP7A 4M6YA 3KZZA 4EJUA 2PLYA 1DPUA 4ESBA 1EH8A 3GZ5A 1TNSA 1GHCA 2RN7A 3TDUC 1LDKB 1R5GA 1FT9A 3ECHA 2HTSA 1DDNA 3SQNA 3F23A 4YFXF 2XAHA 3BZ6A 4HLYA 3E97A 3PQJA 2L4AA 1TLHB 4L5JA 3HOTA 3SHFA 1K79A 2Y75A 2VONA 1SMTA 1UCRA 2MD5A 3F6VA 3R0AA 3MAJA 3T8TA 1D5VA 1H0MA 4MQ9F 1O57A 1ZRCA 1J75A 2OBPA 5KVRA 3HUGA 3KEQA 4DNCA 2NS0A 2DO7A 1TQMA 3VB2A 1MJBA 1R7JA 5J6XA 3RI4A 1YW8A 1QPMA 5A2QZ 1CGPA 3M1EA 4M73A 1QGPA 2A6EF 3ERED 3K0LA 2VN2A 4EM1A 1ZYRF 4PCQA 1HQCA 2FMLA 2HOEA 5F6FA 1B9NA 2DK8A 4HLXA 4EQQA 3KP6A 4GGGA 3H3ZA 2VT2A 1IW7F 3BPVA 1Z6RA 3REOA 1ZRDA 4IPAA 2VOOA 2ZMEB 1KU2A 4S04A 4L9TA 5F64A 3HYIA 4YIFA 1Q1HA 3KFWX 1X3UA 3V7CA 3FMSA 3GEZA 1UHMA 1YW7A 3BPXA 2HYGD 3D5LA 3EYIA 5HDNA 1XD7A 4U0WA 1HXDA 1FSHA 1D3YA 1KU9A 4KYWA 4H0EA 3VEPA 5BQTA 1W7PA 3I5UA 2VE9A 2YU3A 2FSWA 5FGMA 2VBWA 4YFKF 2OZ6A 4BHCA 3HOSA 1SMYF 5L3FA 4HDVA 1R1UA 2DK5A 2MH2A 1REPC 3BROA 3CUQC 1BI3A 5D6EA 5L3DA 3ML6A 4LG0B 2DBBA 1U2WA 2LF8A 5A2QK 1OPCA 4KN7X 1KU7A 2P5KA 2V1UA 5L3EA 2EA2A 3GX4X 1YW9A 2R7DA 2F5EA 4ENJA 4L0YB 1EH7A 2L3DA 4I0BA 1YFHA 1Z91A 2DQLA 5L3BA 3J81Z 2PMUA 2HDCA 3ZMZA 1FP1D 3HHGA 1LB2A 1XDSA 2EV5A 2COMA 1HKTA 2FEZA 5JFRA 5LHHA 4KNYA 4LFUA 2QUFA 4WK8F 3M9AA 2CWEA 4PZJA 1J5YA 1S8NA 2NNNA 3E6CC 5BPIA 4LLLA 1ODDA 1SD7A 1R58A 4FX0A 4HAMA 4PGGA 2XGXA 5H6RA 3IRRA 1IN5A 1I27A 5FLXK 3L9FA 2HTJA 2JPBA 2XIGA 4U7BA 3E5UA 1WQ2A 4WX9A 4QLCU 2V9VA 5E8GA 4LB5A 1OYWA 2VE8A 1ZARA 3LA7A 3JAMK 2P7VB 4Q4ZF 2NYXA 3U9GA 4ON0A 3ISPA 1U5TB 3P9CA 1Z6TA 3QU6A 3R60A 2FNAA 2H09A 2CO5A 4EJWA 4HOBA 3KP7A 3B73A 1ZG3A 5EEHA 3HSFA 5DCMB 4G7ZF 4EJVA 4L5IA 5CVRA 4FX4A 2G7HA 2VBYA 3ABUA 1W4MA 1TW3A 5ICGA 4CICA 3COAC 4A12A 1IXRC 1F9NA 1JXSA 2EV6A 1O3SA 2KIUA 3HRMA 1FSEA 4U88A 1OMIA 3WG9A 2A69F 5D5XB 1MJAA 3TOBA 1MDMA 1ULYA 4ZYDA 3HRUA 3VFZA 3RJPA 2RQPA 2GZWA 4EGZA 2A5YB 2E1NA 3JW4A 4BXUA 4UVAA 2KJBA 1H9GA 2OQRA 4GYGA 3WTZA 3QAHA 3LAPA 3WGIA 4UUVA 3NRVA 1FOKA 5CVIA 4WXHA 3EYYA 1HW1A 4XLPF 3PFIA 1BBYA 4IHTA 5HS9A 3V8LA 4RAZA 1YYVA 2L4MA 5DEQA 1QO0D 4HQMA 2XAQA 2EFPA 1XDUA 4MGRA 5AIPA 5HDKA 4KIGA 2QENA 3O3KA 3HRTA 2Z9OA 2JTVA 4IRIA 3LAJA 1SFEA 3RPQA 3HHHA 4ZYHA 1YS7A 3E6BA 3S2WA 1BIBA 2ETHA 4TV7A 1QBJA 2A61A 2ESHA 3CDHA 1OR7A 1LDDA 3C3WA 3RKWA 5LEJA 1XGSA 1FLIA 2EK5A 3C18A 1G4DA 2BEOA 1T0FA 3WE3A 5DD4A 2G7UA 3GFLA 5D5VB 3KE2A 2RV8A 4N9HA 4M9XA 4A2UA 2IA2A 5E18F 3AAFA 4LG0A 2FXAA 3VODA 4GO1A 1WRJA 3FHZA 4ESFA 4WF2A 3KZYA 1R23A 2Z33A 2VOPA 3WTWC 2IW5A 1G3YA 1YTYA 1TQPA 3GWZA 4HX7A 1ON1A 2D1VA 4OIRF 1K78A 2W84A 2VBZA 4IHSA 3HSRA 4XLNF 3U2RA 5TJJA 2MBFA 4OOIA 3BJAA 3N97A 2M1BA 1G6NA 1ZRFA 1TBXA 4XBFA 4IVNA 1RZ4A 2PQ8A 4UVCA 3KP3A 2EB7A 5LRSA 4RGXA 2Y48A 3DEUA 2LSOA 1R22A 2STWA 4IXAA 4ZYEA 1BI2A 3V8JA 3WTUC 3BJOA 3KP5A 2ZKZA 4I7HA 1U78A 1S29A 1RUNA 1B4AA 2HKOA 4S05A 4EJTA 2M8EA 1XGNA 2P6SA 3TDZC 2OAZA 3TOAA 2EWNA 2K86A 4FHTA 5ILUA 1ONVA 2XKPA 2Y0MA 4A0ZA 4Y13A 3D0SA 3RYPA 2C6YA 4CHUA 4CGZA 4EGYA 3CO7C 4AD9A 3I59B 1YO5C 1ZH5A 2KKOA 4GYIA 5DYMA 1TQIA 5BPDA 3SZTA 2K7LA 2D45A 4MEXF 5AONA 3IKTA 1PP8F 1EV7A 1XSXA 1USSA 3LFKA 1YIOA 5LHIA 4Z2YA 4AWXB 4K2EA 1FYMA 2EA4A 3HIFA 4WXDA 2GA1A 3K1MA 2P6TA 1KQ8A 5L3GA 1FP2A 2OQGA 1XB4A 5JI6A 2LNBA 4Q47A 1NHAA 2FRHA 5DV5A 1JE8A 2O6GE 2FE3A 3C7JA 5K1YA 4EV0A 4KFCA 3K1PA 3WGGA 2A68F 3I58A 3FF5A 3V7SA 5HLIA 4BNCA 1E17A 2OZUA 4JBAA 4EJOA 3U1DA 4UVBA 4ETSA 2GAUA 1FYLA 3J7AO 1LNWA 4A6DA 4BHBA 1J7KA 5J8FA 3LA3A 2QZ8A 2FBHA 2IPQX 3F22A 1E2XA 1KQ9A 2QWWA 4UHTA 3F72A 2FBKA 2ADUA 2EJRA 4HW0A 3L2CA 1J2XA 5ERIA 4L9JA 2Z99A 3DPLC 3DQVC 3QPHA 2W25A 2D1HA 1FC3A 3QP6A 5ICFA 1YQAA 3Q9SA 3GFMA 1B6AA 1TW2A 5CVUA 3GVAA 2ZCWA 1U3EM 4G6DA 2IP2A 1G3TA 1LEBA 3R61A 5HLGA 4KICA 4A0YA 4L9NA 2OU2A 3K69A 1ZAOA 1SD5A 4WXCA 2V1XA 1MD0A 3CO6C 1SFUA 2ZXJA 4HBLA 3WU1B 2EFNA 1IN8A 4M6XA 5E1XA 3J80K 2GA2A 4RB1A 2RVCA 1HKQA 2P4WA 1IXCA 1OYYA 3ZMDA 1ZG1A 5FLXZ 2DLLA 2PEXA 4M72A 4HYEA 2PFBA 1R00A 1T39A 3FX3A 2XHKA 4A0XA 4OU0A 4IF4A 2DU9A 1P2FA 2CFXA 3DKWA 1T6SA 3JAMZ 3ZMVA 4HF1A 2EFOA 2YX7A 4Q5SF 2ESNA 1S7AA 4ESJA 1F4KA 1XGOA 4XRFA 4G7OF 3I53A 4WCGA 2HQNA 2W85A 1F1ZA 1USTA 3ABTA 5FD6A 2K4JA 4G7HF 3CUOA 4OMYA 3H3UA 2DAOA 5J8CA 1SFXA 5CJ9A 3L00A 3QP5A 1Y0UA 1O3TA 5K5OA 1O7FA 3BDDA 3GZ6A 4A5MA 5K5RA 1Z7UA 1ZLJA 3WODF 3O6BB 3H92A 3TQNA 2KJCA 4OIOF 2DW4A 2XRNA 1OYIA 3TKYA 3EUHA 1XCVA 5LHGA 2O61A 2IA1A 1R36A 5TRDA 2CW0F 5HS8A 3CUQB 3V4GA 2HGCA 3EETA 2LKPA 1A04A 3BOQA 2F5CA 1XCBA 1U6GA 1HSJA 4MTEA 3WTSC 4CYDA 3L09A 2L01A 4P9UA 3GF2A 1D8KA 2GWRA 1RIOH 1FPQA 3R6SA 3VOEA 1K7AA 5LGUA 3I59A 1SD4A 5L3CA 5ILVA 4I98B 1Z9CA 3TO9A 1KU3A 2ISZA 1IXSB 2B0LA 2QQAA 5FFZA 3ECOA 3F6OA 4YFNF 4KN4X 3MZHA 1F5TA 3K1NA 3FMRA 2P5LC 5LGNA 2HQRA 1I1GA 2VT3A 5AIQA 5D5UB 3E5QA 2V1DA 4JQFA 3W6JB 1BOAA 1T38A 3NEUA 1XGMA 4O6JA 5IT9Z 5D6FA 1SAXA 1J59A 5HDGA 5DCFA 2XAGA 1XSVA 1FZPB 2WWYA 3N4MA 1XMKA 2VC1A 4OIPF 2M45A 4G94A 2TDXA 3WU0A 4R79A 1BI0A 5BOXA 2CYYA 2Q2EA 5ED4A 5ICCA 1MKMA 3KP2A 4AVPA 2IT0A 1KA8A 2CGPA 3GO5A 1DP7P 3HTSB 2JT1A 1FBSA 5HLHA 1FWZA 2MH9A 4LK1F 3T1BA 4RB2C 2BGCA 2WTEA 2ZMEA 4A6EA 2RDPA 1B9MA 1I5ZA 3DF8A 4KMFA 4BHPA 4YG2F 2QBYB 3WE2A 4LK0F 5ILSA 3JSPA 3ZP5A 1O7LA 1LVAA 3DV8A 3E3VA 5HOOA
chains in the Genus database with same CATH superfamily
3I71A 1W7PB 4JK1X 2WB1A 2PG4A 3F8MA 4B8XA 3AG2H 2Y9ZA 3O2PE 2ZB9A 2NVXJ 5CYVA 1X1BA 2IGKA 5IT3A 2JUGA 4CZZA 1V5FA 2LC2A 1V3FA 2IA0A 2M87A 1RR8C 4IHXA 3E6DA 3EUHC 1W5CC 3A4CA 2FOWA 2AXLA 1BM9A 1STZA 4N4NB 4PJ0C 1WCMJ 3MD2A 2PJRA 4YIIA 1IRZA 4UUSB 3CCEI 1RETA 1U8RA 3OYNA 4MHGA 2FBIA 2XV4S 1FOYA 2JZYA 1BC7C 3S15J 4IJAA 4PFPA 5IT9K 1QZYA 2K3PA 3E1SA 3V7RA 3CCVI 1LDJA 2YS9A 3TBIA 4MEYF 5BMZA 3FZVA 5JHFA 4XKWA 1XC5A 1W36C 4UV9A 3CP8A 1ETWA 2FF4A 4ZC3A 3WTYC 1K6OA 3QU3A 3GYHX 1AKHA 1O3RA 5EYRA 2DA5A 2EBIA 3M8JA 4L18B 2LBFA 5C4XJ 2IVMA 4NHJA 2VC0A 5FKMA 3T5XA 5FROA 3RSNA 2KIFA 2QEXI 4Y17A 4XRSG 3F21A 3BY6A 3H0GJ 3SFZA 5CKTA 4AC0A 1Y8QB 1JKOC 5C44J 3ZN0A 1Z3XA 1X1DA 2QYOA 2VIXA 4P9FA 4RGUA 1W0TA 1T08B 5E8IA 2NVQJ 4AIKA 2GIVA 1IRFA 3A1YA 3HSEA 4AIHA 5FLMJ 4A3GJ 4ZZDA 2ZNYA 3IRQA 1W7PD 2ZFUA 3DBLB 4LMYA 2EILH 4CCLA 3LQQA 1MBHA 1YG2A 1IO2A 2HFHA 1WJFA 5J4YA 3RKYA 4M9SA 5H6QA 2ELHA 4YEJA 1XPXA 2LD5A 4E6KG 1Z21A 4LLGF 2DFIA 3K4LA 4EM0B 4CXFA 2IS1A 5EZGA 1HW5A 2W1OA 1Z05A 3FXQA 1P4AA 3F3XA 2XSDC 3OOPA 3BWGA 2E1CA 3MEXA 2HZDA 2DMUA 2Y9YA 3L2UA 3S32A 4KT5C 2BVLA 1IN4A 2X9DA 3SZPA 3I3LA 3C2BA 3T0YA 5HOOA 1IN6A 1SD6A 2BYVE 2I5UA 3BG9A 1F36A 2STTA 3ULQB 3EUAA 5IY5H 1C0WA 3NARA 1WJCA 2FX0A 2UWMA 1UHWA 2O03A 2OD5A 2Z3YA 1OCRH 3JRIA 3G3ZA 3IHUA 4M71A 5H20A 3ZMSA 4LOCA 3MMYB 4PJNA 4NC7A 1APLC 3B6AA 1BJAA 2Q0OA 1LKXA 1HA8A 5E20A 4ZDLA 2DYSH 3SYTA 4DZJA 1BW5A 2VBXA 5LLQA 6PAXA 3OYFA 4XLFA 3SDBA 3FDYA 4LB6B 1MZBA 1VI0A 2CG4A 4FCYA 3ZQLA 1X3WB 2W00A 4BXFA 3Q0WA 5EG0B 4MTDA 3SDGA 4U7DA 3ZMTA 2IS4A 4LG3A 1Z1DA 2DQRA 1ZTRA 2Z2SB 4R1HA 2ECCA 1X4PA 3MZYA 2JSPA 3HBLA 2R7XA 3ERMA 2CV2A 3PIOF 2X0LA 1OKRA 1W5SA 4XOTA 1O3QA 1CF7B 1QU3A 3RTRA 3GW2A 3JRDA 1AWCA 9ANTA 3GLXA 2E2IJ 1YITI 1U5TA 4CA0A 2HVQA 3ZN1A 1NH3A 1X1CA 4HRIA 3JCUC 3JTHA 2L02A 1ITYA 2DTRA 4C30A 2DA6A 2HQ5A 2D2WA 2ZMEC 3J80Z 4IL6C 1A5JA 1X58A 4XK4A 2F5VA 1Z77A 2NRAC 2DDAA 4RGSA 1G3SA 3HTUA 2E1MB 2ZJRF 2QQ8A 5DCMA 2H27A 4ZZLA 1LJ9A 1M1EB 2UZKA 1OCCH 1KYZA 4GDFA 4EM2A 5JHUA 3RQIA 4NQWA 1OISA 2DT5A 1P4XA 3BC8A 3KETA 5ICEA 1ON2A 3KPHA 4XSXF 2F2EA 3JREA 2JRTA 1I3AA 3DPTA 2BOLA 2EIJH 3ZCOA 4A3KJ 2OF7A 1B8IA 4A3JJ 3BJ6A 1DUXC 5E17F 2BY3A 4ENMA 2DTZA 3GFJA 2YX4A 2DFEA 2F5DA 3LA2A 3CMYA 2HQAA 3LSJA 1Z0XA 5CLSA 1FTTA 4HNUA 1MDMB 5HNHA 1S3JA 1ORKA 1HSTA 2RKHA 1JUMA 2LF7A 3GUDA 1MH3A 4IEJA 1T2KA 1RPWA 4V19K 2A6HF 3PUBA 3NQOA 4G6QA 2LR8A 4RAYA 3K4KA 1MGTA 4M74A 4L5EA 4ENKA 4XMYA 3L7WA 2CJJA 3CC7I 1EJ9A 4LIVA 3S2DJ 3ZQHA 2O3FA 1XSDA 1KYWA 1R4MB 1ZN2A 4I09A 5JVTA 2QQBA 2Q8KA 1I6XA 4O5VA 3TO6A 4BACA 4NC6A 1I39A 3ZR8X 4I2OA 3PQKA 3H9JA 2K02A 1F43A 1JJ6C 4RS8A 3D5SC 4BJTA 3WTVC 1ETQA 2DMNA 1YRNA 1H89C 2CUEA 1JTYA 2R5ZB 2HKXA 2HYFA 1VQ5I 2VODA 2XC7A 2BE5F 2F5FA 4FT8A 3ZRGA 3IKVA 2DDBA 4CDGA 1JHFA 4AIJA 4QWQA 1ZGAA 3D5RC 5FFXA 5F1JA 3FXKA 3ZOBA 1TWHJ 4LLNA 1MJ9A 2MLGA 4RMNA 4XR6A 2R92J 1MMGA 2FMYA 1GVJA 1ZQ3P 2IJLA 2Y0SN 1JGSA 3OS1A 3K70C 4C3HJ 3FXLA 4OIQF 3A0BC 3LNQA 1B59A 2FOKA 1VNDA 2BV6A 1LUJB 2MC4A 1X3ZB 3GZNB 2HR3A 1YI2I 2ZNZA 3CTAA 2HWVA 3MFKA 1P6RA 3RCOA 2JWTA 2QBYA 3P5JA 4D0PA 1L0OC 4E70A 4QTRA 1D1AA 2R3SA 1YE9A 4MQVA 3QPTA 2P0WA 2VB6A 3OYKA 3JTGA 3M8FA 5LBQA 2XAJA 1MBGA 2HXIA 3K4BA 4Q48A 5FB2A 4KUMA 3TO7A 4BAYA 3LQRA 4XM3A 2YSRA 3ZQGA 4LGWA 4DGWB 5B66C 3LSKA 1JKRC 2ZO4A 4L9VA 1VFCA 2DT6A 3G6EI 1ZHFA 4A3MJ 4N0BA 4AU7A 2VL8A 2XKOA 4J19A 1IJWC 4KIBA 3E0JB 2A3SA 2M8GX 1KQ0A 5BS6A 2WAEA 2XVCA 2W24A 1ZELA 2M4KA 4IOAF 4HNTA 2PI0A 2P5VA 3IH3A 1WSUA 2OA4A 4UUSA 2ZJPF 2LDUA 2HOAA 4WWCA 2M2EA 2VJ4A 1BR2A 1U9OA 4KIFA 2XF6A 3UKGA 5EEGA 3GTMJ 1ETXA 2NAZA 3G73A 4XSZF 5FO5A 2BZTA 4CCKA 3DFGA 4GCVA 2X4HA 1TNTA 1IAWA 3Q5FA 4JOMA 4EVIA 2HEOA 4KISA 2K9QA 2L9RA 1DGRM 2UXXA 1J09A 1TTYA 4A3IJ 2ACJA 1FIPA 3IL2A 3KYCB 2NVYJ 2P81A 3QYEA 1JHHA 1Q1VA 4RBOA 4DQ2A 5HVQC 1ETVA 3X2QH 1PP7U 5E1ZB 1KGSA 2E7WA 1UFMA 3WHCA 1P92A 2M34A 3M8EA 3ROUA 5D4SA 3EQLF 1BN5A 4HX4A 1K78B 3FMQA 4U87A 1U5TC 1YJ9I 4O3MA 2J5OA 4BQQA 1EH6A 1S6LA 2M5WA 3C1DA 1LE8A 4CO8A 5FKLA 3BTCA 3T8RA 3RKXA 1Z7LA 3V8KA 3BTLA 5D8LB 4F55A 5FD5A 4B43A 2E7XA 1BR4A 2A6TA 2E71A 2CQKA 2EZIA 2ZSIB 4P5OA 4II3A 1ZREA 1QHGA 2BXYA 4BH9A 3CMEI 1G59A 4G8XA 5IP6A 4ZYGA 2VQGA 3TEDA 3R0JA 4Y4RA 1DPRA 1PUEE 4I01A 4AYBA 4ZTJA 1JI8A 3OYHA 4BQAA 4DOZA 1IN7A 4E7JA 1BC8C 2KDOA 5FKNA 4JP0A 4XRMA 1K6YA 2QQ9A 2PJPA 1UB9A 4XICA 3MQ0A 2M30A 4M3EA 3ONQA 4LJZF 4M9ZA 2QSHX 4L0ZB 2V79A 1B1BA 2R5YB 2WV0A 4UXNA 3SXYA 4JYKA 1JUSA 3R4KA 1GXQA 5E3OA 3HG9A 4FASD 2JPCA 5CVJA 1H9TA 4N9IA 4NBQA 1ZGWA 1T98A 4BYYA 1TWCJ 1L3LA 4HA8A 1O4XA 3LFUA 2PN6A 3G2BA 1KZHA 5J1YA 3HOUJ 3ZMUA 1K83J 4XRSA 5JVGF 1JKQC 5DS9A 2N8GA 3HRSA 4W1UA 3GTGJ 2P8TA 3BG7A 1N77A 4HZFA 5D8KB 2V6CA 2L7FP 3ZQ7A 3KLNA 2JN6A 1JKPC 2GXBA 1VQMI 1MW7A 2WY7Q 2F4IA 1IUYA 5EG0A 3VSLA 1HKSA 2GQQA 2MC3A 1V4RA 1D8JA 3I64A 2ZFWA 1GDTA 3CJNA 3I4PA 3P7NA 3RYRA 2RGVA 4BS9A 2FUG2 5CVVA 2R7ZJ 3L2WA 2NNYA 2X6WA 3H1CA 3IWFA 1JJ8C 1HW2A 1CF7A 2K9MA 3K9TA 1LQ1A 2QSGX 3RIRA 3J81K 4KMUX 4B47A 2MA3A 2HPMA 1BIAA 4KT6A 3PO3J 2M0CA 5DDGA 3KCCA 4A5NA 1V5EA 2VXDA 3M1CA 1QVUA 1WJ5A 2AQEA 2R4GA 3BCBA 4LD5A 3S17J 4UV8A 4F92B 1R4NB 1G3WA 4I02A 1FX7A 2K27A 2E1OA 1BI1A 3H3VK 2K9SA 2EZKA 3MCZA 5C4JJ 3ASNH 2IRFG 3HUGB 1G2HA 5IPAA 3ZXSA 2CSOA 2K4BA 3HB9A 3MKYB 4MFEA 4UNOA 2IXSA 3FWEA 3WHBA 3W6KB 3F8NA 3NWTA 1AOYA 4MNUA 1I6HJ 3HKZA 1J9IA 1FNNA 2XRLA 3KLOA 3WU2C 5KHDA 4I0AA 2QKMB 2YR2A 4B09A 4RB0A 3CJRB 2WC2A 3DLAA 1ZG5A 4FE7A 4BEHB 3GFIA 1YX3A 3HXLA 4H4KC 2DPDA 2OCEA 3HM5A 3LWFA 1YLFA 1S7OA 3P9KA 5TGTA 4IRGA 2EFQA 1SVMA 3F8FA 5D4RA 2O5RA 4G9YA 5LFAA 2QLZA 5K5QA 5FKKA 2JRMA 5KK1A 2LFBA 2O8XA 1S5LC 2RNJA 2QF7A 3H9QA 3OS2A 1WI9A 1XN7A 1VQ8I 3DU5A 1WKMA 3I54A 3CC2I 1QQIA 4BDYA 3CMAI 3S8PA 1R49A 2VI6A 1EA3A 3HOVJ 4RGRA 2MLKA 2W57A 3QRFF 1TP4A 4CYCB 2DI3A 1LEAA 4KA4A 5DUIA 4NB5A 3OSGA 4PJJA 5LRRA 3FXUA 3W2AA 1OLTA 2KRHA 2EFWA 1E3OC 3AL0C 5GPAA 5DD8A 2QM3A 5JR3A 2O0YA 2AS5F 2R7FA 2COBA 1P4WA 4A3CJ 3LSPA 5HS7A 1HLVA 3WGHA 3KX2A 3DEWA 2GOXB 3S1QJ 3IAM2 1QZZA 3FKIJ 3FM5A 4XLAA 4U0VA 2O9LA 1Y39A 3U1KA 3K4CA 2CW7A 2KRFA 2BBYA 2IEKA 3IC7A 4P55A 1Y1WJ 3EDPA 2L54A 1IV6A 2D5VA 2CQQA 4CUGA 3MZ8A 5LGTA 4HV5A 1A36A 1PVEA 4XKVA 3HPGA 5B1BH 2LP0A 1J0RA 2I8DA 1AHDP 3CCYA 3VYTB 2GXGA 3JRHA 3S93A 3GXOA 2OTJI 1ZKGA 3LSTA 1HBXG 2Q1ZB 1BJZA 1DQUA 3EPZA 2RC4A 2XPVA 3P9IA 1SVOA 2X48A 2YPRA 2XGEA 4OINF 1ZGJA 4IRHA 3CLQA 3F8BA 1SVLA 3DXJF 1ETOA 4PFOA 3H5NA 2FA5A 1X2MA 2HDWA 3VSKA 1W5TA 2CUZA 2RQQA 4J01A 2FQ3A 3LL7A 3WTXC 3B02A 3E6MA 1FY7A 2J5PA 5J4VA 4HF2A 2PBIA 2CUJA 3O8GA 4IKFA 2IS6A 1I1SA 2E2JJ 3CJQB 3WTTC 2P7CB 4F52A 2HS5A 2JA7J 2G0EA 2Y0SA 3DKYA 4EMSA 4XLEA 4HV6A 2BXZA 2ZJ2A 1ZK8A 5GAHJ 1QNTA 3K2ZA 3S14J 3ELKA 2FU4A 1N25A 2FNPA 4U0YA 5CQEA 2H6BA 1E3PA 2PMHA 3IH2A 1IZ1A 1OQYA 3FM3A 2M4GA 1P7IA 3RZOJ 3Q9VA 5F1RA 2WAQN 4IO9F 2QA4I 4XL9A 4A3FJ 3ZPLA 2W82A 1ZLKA 2DPUA 4KDPA 1IRGA 3HL2A 2ZBKA 1PDNC 1R1TA 5LEKA 2AQFA 1FBQA 2JVHA 3OYGA 2VPRA 2Z16A 4I76A 2M7AA 2UXNA 3K4JA 2XASA 2QVOA 5E3LA 3QOPA 3A01A 2KIMA 3RDIA 3JRAA 5EZHA 1WWXA 2FD5A 4GXOA 2BW3B 4ENNA 2XAFA 2NVTJ 2Z5UA 1RNLA 2XROA 2G9WA 1FBUA 4Y33A 2IGMA 3W2VA 3I0TA 1R5HA 2EIKH 3MWMA 4BE2A 3BTJA 2ISYA 1YOVB 2WBMA 3BP8A 2VJ5A 2Y69H 1IF1A 3RPUA 3CCLI 1RI7A 1VQ6I 5LD2C 2R7VA 2LH9A 2H94A 3OYDA 2DOAA 2Y2ZA 5DUKA 5KAFC 1YJWI 2R7QA 2E1MC 4B1RA 1XMAA 2K3FA 3KP4A 4M3DA 3OV8A 4CCOA 4ASNA 3JSOA 4ITVA 2R7SA 2CS3A 1A35A 4AIDA 4QIWN 4HF0A 2XUBA 2QKLB 1WH5A 1R1VA 3KEOA 2OPTA 4P96A 1P7JA 1X19A 1MBFA 1YS6A 3QODA 3CF5F 3Q3SA 3QYBA 4BJ5C 4F7ZA 2ELKA 3E5XA 3FXOA 2EV0A 2HZTA 1GLNA 5D5WB 4PDKA 1VTNC 1GVDA 4OMZA 3JRGA 3D1NI 2A07F 5EGOB 5E1WA 3CLOA 4HX8A 2H6CA 1FYKA 2LVSA 3IWZA 3CUQA 4ZH4F 4IQJA 3GMEA 3TGNA 2DA2A 3F8CA 1VQ4I 4HDUA 3VDXA 4PGHA 4R8HA 2BY2A 4Y15A 2ID6A 1GXPA 3GLLA 3LSMA 1UELB 2VXZA 3S2HJ 3FIWA 3HPHA 2DA1A 2RNGA 2CRGA 2JSCA 4RB3C 2DMPA 5DTDA 1QHHD 3GTQJ 4HQEA 3FXRA 3OIPA 3FBIB 1RUOA 3M7GA 3DP7A 4FTHA 4M6YA 3KZZA 4EJUA 2PLYA 4D5CA 3CDIA 2BHYA 1DPUA 4ESBA 1EH8A 3J7YJ 4IHYA 3GZ5A 1TNSA 1GHCA 3OY9A 5IYBJ 2RN7A 1WJBA 2JA5J 1B72B 3F9KA 3Q0VA 3TDUC 3BT9A 4EATA 2X1DA 2H1LA 1ENHA 1LDKB 3PNYA 4MFDA 1R5GA 1FT9A 3ECHA 2HTSA 1DDNA 3GCMA 3SQNA 2DFHA 3F23A 4PSXA 2NS8A 4YFXF 2V9KA 2XAHA 3BZ6A 4HLYA 3BQYA 2TCTA 2E5NA 3E97A 3PQJA 4RAGA 2L4AA 4IX7A 3KIOA 1TLHB 1VQ9I 4L5JA 3HOTA 2R7TA 3SHFA 3GTPJ 1K79A 2Y75A 2DA7A 2VONA 1SMTA 2CUFA 2CMPA 1UCRA 3AG4H 2MD5A 3F6VA 3R0AA 3MAJA 1RKWA 3T8TA 2NOGA 4C9YA 1WZ2A 1W36D 5GPCA 1GT0C 1D5VA 2XSJC 1H0MA 4RLQA 1D0XA 2VJIA 3DU6A 1CQTA 2KFDA 5K7FA 3ZGKA 5CQGA 4MQ9F 1O57A 3E7LA 1ZRCA 4RDUA 1MMAA 2X51A 1W1WE 1J75A 2OBPA 5KVRA 3HUGA 5KAIC 4D7MA 1H8AC 3DKXA 2IBDA 2KT0A 1E3HA 2IAIA 3CZ6A 3KEQA 4DNCA 2NS0A 2DO7A 1BOBA 5KNLA 3HOXJ 2CV1A 3K4MA 1TQMA 3BR5A 3VB2A 2IS2A 1MJBA 1R7JA 5J6XA 3RI4A 3DBHB 4CZCA 2Y31A 2L9SA 4AUXA 1YW8A 3BZKA 1QPMA 5A2QZ 1CGPA 3M1EA 4M73A 1QGPA 2A6EF 3ERED 4BKXA 3L2QA 3K0LA 1TL8A 1XTAA 2VN2A 2Q2EB 2CW8A 4EM1A 1ZYRF 4PCQA 1HQCA 2FMLA 1LFBA 2HOEA 4HNVA 5F6FA 1B9NA 1K61A 2DK8A 2YUSA 4HLXA 4YELA 4EQQA 3KP6A 1X4OA 2R7OA 4S0HB 1NG6A 2LYCA 4GGGA 5GADJ 3H3ZA 2VT2A 1IW7F 5CPRB 3BPVA 1Z6RA 5GTIC 3REOA 1ZRDA 4IPAA 2VOOA 1S9HA 1AA7A 2B7EA 1YIJI 2ZMEB 4A3LJ 1KU2A 4FETA 4S04A 2CQ7A 2PMZN 2L7KA 4L9TA 2EINH 5F64A 5IYCJ 3S1RJ 3SEQA 2BY1A 4BU2A 3DPUA 3HYIA 4YIFA 1Q1HA 2E35A 3KFWX 3G1OA 3HEFA 1X3UA 2NS7A 2OCCH 4QSHA 3BLYA 1HC8A 4BGDA 3V7CA 3FMSA 2VQHA 3JRFA 1DP3A 2WY8Q 4E7ZA 3GEZA 1UHMA 2HDDA 2RAEA 1YW7A 3BPXA 2HYGD 3D5LA 3EYIA 5HDNA 1XD7A 4U0WA 1MNDA 3H5AA 1HXDA 1FSHA 2JVGA 1D3YA 1KU9A 4KYWA 4H0EA 4A3EJ 3VEPA 1V54H 1PYVA 5BQTA 3BR6A 1W7PA 3I5UA 5F27A 5E79C 2VE9A 2DOEA 2YU3A 1HCRA 2PJRB 4M3GA 2FSWA 5FGMA 3SFIA 2VBWA 3J7ZI 1VZ0A 4YFKF 2W7NA 3IV5A 2OZ6A 3TW7A 3ZQFA 4BHCA 1SMYF 2DJIA 3HOSA 3VYUB 5L3FA 2EH3A 4HDVA 1R1UA 2DK5A 4ZDPA 2MH2A 1REPC 3OS0A 2XDVA 1U0JA 3BROA 2QGUA 3CUQC 5FRMA 1BI3A 3IUOA 5D6EA 5L3DA 3ML6A 4C2UA 4LG0B 2DBBA 1U2WA 2LF8A 1ETYA 2V6EA 5A2QK 1WJEA 1OPCA 4KN7X 3L2VA 4CCJA 3CCQI 1KU7A 2P5KA 1NK3P 4FE4A 2V1UA 5L3EA 2EA2A 1N75A 2K9LA 3UR3C 3GX4X 2DXIA 1YW9A 2R7DA 4DZPA 2F5EA 2X6YA 4ENJA 3OWTA 1WVRA 3K6GA 4L0YB 1EH7A 4B3XA 4CSWA 2L3DA 4I0BA 1YFHA 1OJLA 2E5ZA 1Z91A 2DQLA 2ZSHB 3ABLH 2VJJA 5L3BA 3J81Z 2PMUA 4B3AA 1WJDA 2HDCA 3ZMZA 4PJLA 1R5ID 4RAFA 1I3QJ 2EZHA 1FP1D 3HHGA 1LB2A 2CV0A 2EQRA 1FMWA 1DU0A 1XDSA 2EV5A 2XAUA 1JUPA 2COMA 1UMQA 1HKTA 2FEZA 3AG1H 5JFRA 3MVPA 5LHHA 5BNGA 4KNYA 4LFUA 4Y52J 2QUFA 4ABZA 4WK8F 3M9AA 4BE1A 2CWEA 4PZJA 1J5YA 2E36A 1S8NA 3BQZA 2BW3A 2ZXHA 4P1WA 2NNNA 3I9V2 3E6CC 5BPIA 3VWBA 2MD0A 2MFZA 2QCOA 4LLLA 3PIPF 4B4CA 3G4SI 1IDZA 2X85A 1ODDA 2F4OB 1SD7A 5B3SH 3RQ4A 1R58A 4FX0A 1FTZA 3W2WA 2LKSA 3PJRA 2EZLA 3OYAA 5M3FJ 4HAMA 4PGGA 4PSWA 2XGXA 5H6RA 1QZEA 1VQLI 3IRRA 1VQOI 1IN5A 3DCFA 1N78A 1I27A 1V5GA 2JK3A 4CH7A 5FLXK 3L9FA 2B63J 2DJNA 2HTJA 2JPBA 2XIGA 2HVSA 3QQAA 4UUTA 3OYMA 3G1LA 4U7BA 3E5UA 4Z6YA 2JMWA 1WQ2A 3JRBA 4WX9A 2HXOA 2V9VA 4QLCU 3S3MA 2V9PA 1AU7A 5E8GA 4LB5A 1OYWA 2DOFA 4XLCA 3MKZA 3DLLF 3ASOH 3K70D 2VE8A 1ZARA 3LA7A 2V26A 3JAMK 1BW6A 1JGGA 2P7VB 2LRDA 4Q4ZF 5IP9J 1GV2A 3OIOA 4X0GA 2NYXA 3U9GA 4F93B 1MSEC 4ON0A 2R0QC 2XF5A 3ISPA 1U5TB 3P9CA 1Z6TA 3FK7A 3QU6A 3FKJA 3R60A 3W6VA 2FNAA 3B6CA 2GLOA 2H09A 2CO5A 2WV1A 5J47A 2HPIA 2VQLA 4EJWA 1FMVA 4HOBA 4XN0A 5F0HA 3KP7A 3HGYA 5FRNA 3B73A 3DBRB 1ZG3A 5EEHA 1TZLA 3HSFA 5DCMB 1W0UA 3BZCA 3CCUI 5EEAA 4G7ZF 5HLTA 4DW6A 2HU9A 3A2KA 2ELJA 2M3AA 4EJVA 5K7ZA 2CH0A 4L5IA 1VQ7I 1S7EA 5CVRA 2PX9A 4FX4A 1PJRA 3OIQA 2G7HA 2VBYA 3CF2A 3ABUA 1GUUA 3OMYA 3BG3A 1W4MA 4GRIA 1WFXA 1TW3A 5ICGA 2TRTA 1B8IB 4CICA 2LOOA 3COAC 2HOTA 3MKWB 3LMMA 4A12A 1IXRC 1F9NA 5M5WJ 3OSFA 3JRCA 1JXSA 1LVKA 2E19A 2EV6A 2OUMA 2KIUA 1O3SA 1R71A 3HRMA 1FSEA 3S1MJ 4XORA 4U88A 3CQZJ 1OMIA 2MGQA 3WG9A 1RKTA 2WA0A 2A69F 5D5XB 3I56I 2LMDA 1MJAA 5IP7J 3TOBA 1MDMA 3RKQA 1ULYA 4ZYDA 3HRUA 4D1QA 2ME6A 3VFZA 1Y0NA 3RJPA 2RQPA 2GZWA 3FXJA 1D5YA 3GTKJ 1V55H 4E7SA 4EGZA 3M07A 1WH7A 4N4OB 1QRYA 2A5YB 2KQRA 2E1NA 3JW4A 2V1NA 4BXUA 4UVAA 2KJBA 1H9GA 2GIZA 2EIMH 4UB8C 1EF4A 3AKZA 4NDLA 2OQRA 4GYGA 2F6CA 2V7FA 3WTZA 1HF0A 1VQKI 3QAHA 4FQGA 3LAPA 3WGIA 2R7UA 3CDLA 4UUVA 3JR9A 2R5ZA 1JTXA 3NRVA 1FOKA 2R7WA 2MG4A 2ZXIA 5CVIA 4WXHA 3EYYA 1UZCA 3QWLA 3I4MJ 1HW1A 1UG0A 1SFKA 1P9QC 3WG7H 3BR1A 2E60A 4XLPF 3PFIA 1BBYA 2LKXA 3RZDJ 2K40A 4IHVA 4IHTA 5GP9A 4M3BA 5HS9A 3V8LA 4RAZA 1YYVA 2L4MA 5DEQA 3OR2C 2K9NA 1QO0D 1WJAA 4HQMA 5FLVA 2AXTC 2XAQA 2EFPA 4B48A 1XDUA 2FJ1A 2NXNB 4MGRA 5AIPA 5HDKA 4KIGA 2QENA 2DCEA 3O3KA 3HRTA 2CFOA 2Z9OA 3N05A 2JTVA 4DBQA 4IRIA 2JA6J 3LAJA 1SFEA 3RPQA 5JLWA 3HHHA 1YS7A 3E6BA 4ZYHA 4BXXJ 5J3LA 3S2WA 1BIBA 2ETHA 4TV7A 1VQNI 1FOXA 1QBJA 1WI3A 2A61A 2ESHA 3CDHA 4LIUA 1OR7A 1LDDA 5EDNA 3H0DA 3C3WA 3HZJA 4PUSA 2XF7A 3RKWA 5LEJA 3OYCA 5KCMA 1XGSA 4C2MJ 2R93J 3VYRB 1FLIA 2EK5A 3C18A 4XN3A 4CCNA 1G4DA 3K4NA 2BEOA 1LPQA 1IGNA 1T0FA 2M9HA 3KYDB 1XS9A 1SFOJ 2OC6A 3KYLA 3WE3A 4I6ZA 1MBJA 5EJCA 5DD4A 2G7UA 3GFLA 5D5VB 4F3QA 3V42A 2PMZA 3KE2A 3PSFA 1SANA 2RV8A 2L5QA 4AYBN 4N9HA 3IAS2 4M9XA 4M3FA 1MMNA 2VKHA 1FIAA 1YHQI 3KEYA 2OJED 3KZIC 4A2UA 2K85A 2IA2A 3SEZA 3U21A 5E18F 3AAFA 1K4TA 4LG0A 2FXAA 4DJAA 2ME0A 1D0ZA 2XPWA 3VODA 2ZXWH 3CESA 4JX4A 4GO1A 1WRJA 1TT5B 2KL4A 2JA8J 3FHZA 3AL0B 4ESFA 2K5CA 3ABKH 4WF2A 3KZYA 1R23A 2Z33A 3TP3A 2VOPA 4AVZA 3WTWC 2IW5A 2NVUB 1G3YA 3LOCA 1YTYA 1TQPA 3GWZA 4E4HA 4HX7A 1ON1A 1MMSA 2D1VA 4UB6C 1R9TJ 1LE8B 3CJTB 4OIRF 1K78A 2W84A 1I50J 2VBZA 4E7KA 4IHSA 3HSRA 4Y3OA 4XLNF 3U2RA 5TJJA 2MBFA 3EUKL 4F91B 5J40A 2L9VA 4OOIA 1OCPA 3BJAA 3N97A 2M1BA 4X1EA 1G6NA 1ZRFA 2GBYA 5M5XJ 1TBXA 2VPLA 4QPOA 4XBFA 3GTJJ 4IVNA 1RZ4A 2PQ8A 4UVCA 1TWAJ 3KP3A 3OOUA 5M3MJ 2EB7A 5LRSA 3J7AY 4RGXA 2Y48A 2GXAA 3DEUA 2LSOA 1R22A 5B5EC 2JQ7A 2STWA 4DBRA 4IXAA 4ZYEA 1BI2A 3V8JA 4ZJZA 4A3BJ 2HI3A 2ID3A 3WTUC 4ZTFA 3UNGC 2ZC2A 3AFHA 2L7ZA 5DM7F 1UAAA 4NUBA 3C2HA 3BJOA 2DFFA 3KP5A 2LREA 4D5FA 2ZKZA 1T56A 3HOYJ 2X6XA 4I7HA 2BY0A 2VKDA 2WADA 3CP2A 4DIQA 1U78A 1S29A 5GAEJ 1RUNA 1B4AA 2KPMA 1MBKA 2HKOA 2DA4A 4S05A 2R5YA 4EJTA 1A6QA 2E2HJ 1BR1A 2LG4A 1XGNA 2M8EA 2IGNA 2OAZA 2P6SA 3TDZC 3TOAA 1ACIA 3G1MA 3MN2A 2EWNA 2K86A 4BL0B 3H35A 2H8RA 4FHTA 5ILUA 1ONVA 4BY7J 4DYCA 2KZGA 3HOWJ 4PK4A 5HODA 2XKPA 2HOSA 2FQ4A 3HC7A 2Y0MA 4A0ZA 3BR2A 4Y13A 1IDYA 2OV7A 3M3YJ 4UY8I 1RC9A 3D0SA 3RYPA 2C6YA 2XB0X 3OYJA 5F0FA 4CHUA 4EGYA 4CGZA 3CO7C 3BG5A 4XIDA 4AD9A 4JX5A 2R7RA 3I59B 1NK2P 1YO5C 4HPQA 3IH4A 4BBRJ 1ZH5A 2KKOA 4GYIA 5DYMA 3QPSA 3HKZN 2LY1A 1TQIA 1GV5A 4I99C 5BPDA 4ANJA 1EKEA 3SZTA 2F48A 2K7LA 3ZQIA 2D45A 4MEXF 5AONA 3S3OA 1D1CA 2UV1A 4AM3A 3IKTA 2VASA 1EV7A 1G8XA 1XSXA 1USSA 3LFKA 1NG7A 1YJNI 1PP8F 4E7HA 1YIOA 5LHIA 4Z2YA 1OCZH 4AWXB 1Y56A 4K2EA 2MABA 5IOZA 1FYMA 1IRXA 4C3JJ 1JT6A 4BDZA 1ZR4A 2CQXA 2EA4A 3SZGA 2IGOA 3HIFA 4WXDA 2GA1A 3K1MA 2P6TA 1KQ8A 1Y6IA 4RM2A 1QVTA 5L3GA 5B1AH 1FP2A 5JLXA 2OQGA 2KP6A 2UUZA 1XB4A 4D7NA 5JI6A 1MNEA 2H8WA 2LNBA 3LSHA 4DYQA 4Q47A 1NHAA 2FRHA 1E0EA 5DV5A 4Y7NJ 1JE8A 2KIQA 2FE3A 2O6GE 1PUFB 2JA2A 3W3CA 3C7JA 5K1YA 4EV0A 4KFCA 3K1PA 3WGGA 2A68F 3I58A 4XKBA 2DT7B 3FF5A 2VQCA 3PUFA 2XGDA 4W97A 1ETKA 1IG7A 3V7SA 3O8HA 5HLIA 4BNCA 1E17A 2OZUA 5K7HA 4JBAA 1UHSA 4EJOA 1MSFC 2DMQA 3U1DA 4UVBA 4ETSA 2KRCA 2GAUA 1FYLA 3J7AO 1LNWA 4A6DA 2L2OA 4BHBA 4RA2A 4X6AJ 2MSYA 4OAYA 1J7KA 5J8FA 1SEUA 1OR7C 4XONA 3LA3A 2NOJB 2QZ8A 3OYBA 2FBHA 2IPQX 3F22A 1E2XA 1H88C 2B9SA 3OYLA 1KQ9A 2QWWA 3F0CA 4UHTA 1X1PA 2JJ7A 3F72A 4BEHA 1MH4A 2FBKA 2ADUA 1FJLA 1T0FC 2M7BA 3BTIA 2WB1N 1A6IA 2EPFA 1IC8A 2EJRA 3HDDA 1A31A 5IOYA 4HW0A 3L2CA 1J2XA 2HNHA 5ERIA 3CCMI 4XOPA 1JT0A 1LFPA 2A5WA 4L9JA 2KISA 4B44A 2KDZA 2Z99A 3DPLC 5C3EJ 3DQVC 3QPHA 2W25A 2D1HA 1FC3A 3QP6A 3PNVA 5ICFA 1YQAA 3NAUA 5E3MA 3Q9SA 3CC4I 1HOMA 3GFMA 1B6AA 3S16J 1TW2A 5CVUA 3GVAA 5TISC 2ZCWA 4CYCA 3GTOJ 3LSRA 2DA3A 1QPIA 1U3EM 4G6DA 1D0YA 3FK6A 3OYEA 2IP2A 1G3TA 1LEBA 3R61A 5HLGA 2AHQA 4KICA 4A0YA 4L9NA 2OU2A 3K69A 1ZAOA 4BY1J 4A93J 3C2GA 1MNMC 2LK2A 3I55I 2A05A 4BQNA 1SD5A 4WXCA 2V1XA 1MD0A 3CO6C 1SFUA 2ZXJA 4QPQA 3HJEA 2LLKA 3CMMA 3GTLJ 4HBLA 3OYIA 3WU1B 2EFNA 1IN8A 4M6XA 5E1XA 3J80K 2KZVA 3NWSA 2GA2A 4RB1A 4KJZA 2RVCA 1HKQA 1D1BA 1OFCX 2P4WA 1LFUP 1IXCA 1OYYA 2KHMA 1BL0A 3ZMDA 1ZG1A 1FOWA 5FLXZ 2DLLA 5J1RA 2PEXA 4M72A 3L2RA 1UJ8A 1X1AA 4HYEA 2PFBA 3H9GA 2H1KA 1R00A 1T39A 3FX3A 1Y1VJ 2XHKA 4A0XA 2O7OA 4OU0A 4IF4A 1FEXA 1U9NA 1U8BA 3DWLE 3TMOA 4XKCA 3ESWB 2DU9A 4HSRA 1ERDA 1P2FA 2CFXA 3DKWA 1T6SA 4BQOA 3JAMZ 3CCSI 1TWGJ 4A69C 4DYRA 1AKHB 1ZR2A 2LBFB 3FXMA 4XLHA 1OCTC 4IZZA 5M5YJ 1SAUA 3ZMVA 4HF1A 2EFOA 2YX7A 4Q5SF 2ESNA 2CQNA 5IYDJ 3PO2J 1S7AA 4MLOA 4ESJA 1RESA 4IHWA 3M4OJ 1F4KA 1XGOA 4XRFA 5F0CA 4G7OF 2L7MP 3I53A 4WCGA 2HQNA 2W85A 4PJMA 1VQPI 1F1ZA 1USTA 3ABTA 5FD6A 1T8IA 4V2FA 2RREA 2HYJA 2K4JA 4G7HF 3CUOA 4OMYA 3H3UA 5E3NA 1XMXA 2DAOA 2W4SA 5J8CA 1SFXA 3PL8A 1MMDA 2KLOA 2VKEA 4CCMA 1Z3YA 3A01B 3FISA 5F08A 2DYRH 3GBGA 5CJ9A 3BG6A 3L00A 1WGXA 2L0KA 3QP5A 1Y0UA 3A03A 1O3TA 2Z1DA 3QPLA 2DMTA 5K5OA 1S72I 3S3NA 1O7FA 3BDDA 1TWFJ 3GZ6A 3Q0UA 4A5MA 5K5RA 1T33A 1Z7UA 1ZLJA 3WODF 2GM4A 3O6BB 2O8KA 1RRJA 1POGA 1IUFA 3H92A 2XGCA 3TQNA 5FJ8J 3G71I 4G12A 2KJCA 2XB5A 4OIOF 2DW4A 3BCAA 2XRNA 1OYIA 3TKYA 2KMUA 4IQ4A 3EUHA 4II2A 3TP0A 1XX5A 4GFBA 3LSGA 1XCVA 4MIMA 5LHGA 2O61A 2IA1A 1R36A 5TRDA 3L1PA 2CW0F 5HS8A 3ABMH 3I4NJ 1MBEA 3CUQB 3FHNA 1RR7A 3V4GA 4BE0A 2MYSA 3BR0A 1TC3C 5EGOA 2WAQA 4ZDOA 2HGCA 3PFYA 4D9JA 2YU9J 3TW6A 3ZQQA 3PSIA 3A02A 3EETA 2LKPA 4YRVA 3CCRI 2CU7A 2L9NA 1A04A 2F4MB 3BOQA 3FBNB 2F5CA 2I10A 1XCBA 4JX6A 1U6GA 1HSJA 3VPRA 2E34A 4MTEA 2QSFX 3AG3H 1K4SA 4NNJA 3WTSC 2ECBA 4CYDA 3L09A 5DM6F 4NC8A 2L01A 2Y30A 3QOEA 3GF2A 1D8KA 2GWRA 4BJ6C 4P9UA 3RPUD 3OL4A 1RIOH 1FPQA 4FISA 3R6SA 3VOEA 1SC7A 1K7AA 4HG2A 5LGUA 1VF9A 4OAZA 3I59A 1SD4A 1HDPA 5L3CA 5ILVA 1B72A 1TT0A 4J00A 1KONA 1XG1A 3CD6I 4I98B 1Z9CA 3TO9A 3DEEA 1KU3A 4EEFG 2ISZA 1IXSB 1IV8A 4YIRX 2B0LA 4NQWB 4C3IJ 2QQAA 5FFZA 3ECOA 3F6OA 3VYSB 4KN4X 4YFNF 5F04A 3MZHA 5J1UA 2W48A 1F5TA 2WAFA 3K1NA 3FMRA 2M0MA 4XQFA 2GOMA 1QA6A 2P5LC 1WPKA 3DTKA 4V2GA 5LGNA 2HQRA 2VUMJ 1I1GA 1PUFA 2AO9A 2VT3A 4A3DJ 1UG2A 5AIQA 1T95A 5D5UB 3DTEA 3E5QA 3CCJI 4E7IA 2V1DA 4JQFA 3W6JB 3ZQCA 1BOAA 5EF6A 1T38A 1BA5A 3NEUA 1XGMA 5HNFA 4ZYAA 4O6JA 5IT9Z 3QYFA 2JUCA 5D6FA 1SAXA 4LITA 1J59A 5HDGA 5DCFA 2XAGA 1XSVA 1FZPB 2WWYA 1XMKA 2VC1A 3N4MA 4OIPF 2M45A 4G94A 2TDXA 3HGGA 3WU0A 3HOZJ 4BBSJ 3H5RA 3MKLA 4R79A 2XPUA 3A0HC 1BI0A 1X2NA 1Z67A 5BOXA 1YRNB 1YX5A 2CYYA 2Q2EA 5ED4A 5ICCA 1WHUA 2ICWG 1MKMA 3KP2A 3IP4B 4AVPA 4RLFA 1NTCA 2X1EA 2IT0A 3K2AA 1HDDC 3S1NJ 1KA8A 2CGPA 3GO5A 3H36A 4M6VA 1MIJA 4HEA2 1DP7P 3HTSB 4MO7A 1OCOH 2JT1A 1FBSA 2X6OA 3K10A 5HLHA 1FWZA 2MH9A 2MW8A 4OWRB 1DU6A 2DODA 2X1CA 4LK1F 3K7AJ 3T1BA 4RB2C 2OTLI 2BGCA 2WTEA 2LY2A 2ZMEA 2LTPA 2HVRA 4A6EA 5H2FC 2RDPA 2V4JC 2VLAA 3BR3A 1B9MA 1I5ZA 2DN0A 3DF8A 4KMFA 4BHPA 4YG2F 2QBYB 1Y8RB 3WE2A 3OL3A 4LK0F 4KITB 5ILSA 2BHZA 4HSTA 3JSPA 3SJMA 4C2TA 3ZP5A 2BVMA 3OR1C 1O7LA 3TL4X 5GAGJ 1LVAA 3DTIA 3LSIA 3PNTA 5FKOA 2ZJQF 3DV8A 1DGWY 4BUPA 4RM3A 5GTHC 4E7LA 3E3VA 3PM1A 4IOCF 1R6RA 2VKVA 4G6TB 4XNFA 2LY9A
chains in the Genus database with same CATH topology
3I71A 1W7PB 4JK1X 2PG4A 3F8MA 4B8XA 3O2PE 5CYVA 5IT3A 4CZZA 1V3FA 2IA0A 2M87A 3E6DA 2AXLA 1BM9A 1STZA 4YIIA 1U8RA 4MHGA 2FBIA 2XV4S 2JZYA 1BC7C 4IJAA 5IT9K 1QZYA 3V7RA 1LDJA 5BMZA 4MEYF 3FZVA 4UV9A 2FF4A 3WTYC 1K6OA 3QU3A 3GYHX 1O3RA 4L18B 2IVMA 4NHJA 2VC0A 3T5XA 2KIFA 4Y17A 3F21A 3BY6A 3SFZA 3ZN0A 2QYOA 4P9FA 4RGUA 5E8IA 4AIKA 2GIVA 1IRFA 3HSEA 4AIHA 4ZZDA 2ZNYA 3IRQA 1W7PD 4LMYA 3LQQA 1YG2A 2HFHA 3RKYA 4M9SA 5H6QA 2ELHA 4LLGF 2DFIA 4EM0B 4CXFA 1HW5A 1Z05A 3FXQA 1P4AA 3F3XA 3OOPA 3BWGA 2E1CA 3MEXA 4KT5C 1IN4A 3SZPA 3T0YA 1IN6A 1SD6A 2BYVE 2STTA 3ULQB 1C0WA 2UWMA 1UHWA 2O03A 2OD5A 2Z3YA 3G3ZA 3IHUA 4M71A 5H20A 3ZMSA 1BJAA 2Q0OA 5E20A 2VBXA 5LLQA 6PAXA 4LB6B 1MZBA 2CG4A 4MTDA 4U7DA 3ZMTA 1Z1DA 2DQRA 4R1HA 3MZYA 2X0LA 1OKRA 1W5SA 1O3QA 1CF7B 3RTRA 3GW2A 1AWCA 3GLXA 1U5TA 3ZN1A 3JTHA 2L02A 2DTRA 2D2WA 3J80Z 2NRAC 4RGSA 1G3SA 3HTUA 5DCMA 2H27A 4ZZLA 1LJ9A 2UZKA 1KYZA 4EM2A 5JHUA 4NQWA 2DT5A 1P4XA 3KETA 5ICEA 1ON2A 4XSXF 2F2EA 2JRTA 3DPTA 3BJ6A 1DUXC 5E17F 4ENMA 3GFJA 2YX4A 2F5DA 3LA2A 5CLSA 1MDMB 1S3JA 1HSTA 2RKHA 2LF7A 3GUDA 1T2KA 2A6HF 3NQOA 4G6QA 4RAYA 4ENKA 1MGTA 4M74A 3L7WA 2O3FA 1XSDA 1KYWA 1ZN2A 4I09A 5JVTA 2QQBA 2Q8KA 1I6XA 4O5VA 3TO6A 4I2OA 3PQKA 2K02A 4RS8A 3WTVC 2HKXA 2HYFA 2VODA 2BE5F 2F5FA 4FT8A 3IKVA 4CDGA 1JHFA 4AIJA 4QWQA 1ZGAA 5FFXA 4LLNA 1MJ9A 2MLGA 2FMYA 1GVJA 2IJLA 1JGSA 4OIQF 1B59A 2FOKA 2BV6A 2HR3A 2ZNZA 3CTAA 2HWVA 3MFKA 1P6RA 2QBYA 4D0PA 1L0OC 4E70A 2R3SA 4MQVA 3QPTA 3JTGA 3M8FA 5LBQA 2XAJA 4Q48A 5FB2A 4KUMA 3TO7A 4BAYA 3LQRA 2YSRA 4LGWA 2ZO4A 4L9VA 1ZHFA 4N0BA 2XKOA 4KIBA 2A3SA 1KQ0A 5BS6A 2XVCA 2W24A 2PI0A 2P5VA 1WSUA 2OA4A 2LDUA 4WWCA 4KIFA 5EEGA 2NAZA 3G73A 4XSZF 5FO5A 3DFGA 4GCVA 2X4HA 1TNTA 1IAWA 3Q5FA 4EVIA 2HEOA 2UXXA 2ACJA 1TTYA 3IL2A 1JHHA 4DQ2A 5HVQC 1PP7U 5E1ZB 1KGSA 2E7WA 1UFMA 1P92A 3M8EA 3ROUA 5D4SA 3EQLF 1BN5A 4HX4A 1K78B 3FMQA 1U5TC 4O3MA 2J5OA 1EH6A 1S6LA 2M5WA 3C1DA 4CO8A 3T8RA 3RKXA 3V8KA 5D8LB 5FD5A 2E7XA 2CQKA 4P5OA 1ZREA 4BH9A 4G8XA 4ZYGA 3R0JA 1DPRA 1PUEE 4I01A 4BQAA 1IN7A 1BC8C 2QQ9A 2PJPA 1UB9A 3MQ0A 2M30A 4LJZF 4M9ZA 4L0ZB 2V79A 1B1BA 2WV0A 4UXNA 3SXYA 3R4KA 1GXQA 2JPCA 5CVJA 1H9TA 4N9IA 1T98A 4BYYA 1L3LA 4HA8A 2PN6A 3ZMUA 3HRSA 2P8TA 4HZFA 5D8KB 2V6CA 3ZQ7A 3KLNA 2GXBA 1IUYA 1HKSA 2GQQA 2MC3A 1V4RA 1D8JA 3I64A 2ZFWA 3CJNA 3I4PA 3P7NA 3RYRA 2RGVA 5CVVA 2NNYA 3IWFA 1HW2A 1CF7A 3K9TA 1LQ1A 3RIRA 3J81K 4KMUX 2MA3A 1BIAA 5DDGA 3KCCA 4A5NA 4LD5A 4UV8A 1G3WA 4I02A 1FX7A 2K27A 1BI1A 3MCZA 2IRFG 2CSOA 2K4BA 4UNOA 3FWEA 3W6KB 3F8NA 1AOYA 4MNUA 1J9IA 1FNNA 3KLOA 4I0AA 2YR2A 4B09A 4RB0A 2WC2A 1ZG5A 3GFIA 2DPDA 3LWFA 1YLFA 1S7OA 3P9KA 4IRGA 2EFQA 3F8FA 5D4RA 4G9YA 2QLZA 5K5QA 5KK1A 2O8XA 2RNJA 1WI9A 1XN7A 1WKMA 3I54A 1QQIA 4RGRA 2MLKA 2W57A 3QRFF 2DI3A 1LEAA 4KA4A 5DUIA 4NB5A 5LRRA 3FXUA 2EFWA 5DD8A 2QM3A 5JR3A 2O0YA 2AS5F 2R7FA 1P4WA 5HS7A 3WGHA 1QZZA 3FM5A 4U0VA 2KRFA 2BBYA 3IC7A 4P55A 3EDPA 2L54A 5LGTA 4HV5A 1J0RA 2GXGA 3GXOA 3LSTA 1HBXG 2RC4A 3P9IA 2YPRA 4OINF 1ZGJA 4IRHA 3F8BA 3DXJF 2FA5A 1W5TA 2FQ3A 3WTXC 3B02A 3E6MA 1FY7A 2J5PA 4HF2A 2PBIA 1I1SA 3WTTC 2P7CB 2HS5A 4EMSA 4HV6A 2ZJ2A 1QNTA 3K2ZA 3ELKA 2FU4A 2FNPA 4U0YA 2H6BA 2PMHA 1IZ1A 3FM3A 3Q9VA 5F1RA 3ZPLA 1ZLKA 2DPUA 4KDPA 1IRGA 1PDNC 2ZBKA 1R1TA 5LEKA 1FBQA 2UXNA 2XASA 2QVOA 3QOPA 2KIMA 3RDIA 1WWXA 4ENNA 4GXOA 2XAFA 2Z5UA 1RNLA 2XROA 2G9WA 1FBUA 3I0TA 1R5HA 3MWMA 2ISYA 3BP8A 1IF1A 3RPUA 1RI7A 2H94A 5DUKA 1XMAA 3KP4A 3OV8A 4ASNA 3JSOA 4HF0A 2XUBA 1R1VA 3KEOA 4P96A 1YS6A 4F7ZA 3E5XA 5D5WB 2EV0A 2HZTA 4PDKA 1VTNC 4OMZA 2A07F 5E1WA 3CLOA 4HX8A 2H6CA 1FYKA 3IWZA 3CUQA 4ZH4F 3TGNA 3F8CA 4HDUA 4PGHA 4R8HA 4Y15A 1GXPA 2VXZA 2JSCA 4RB3C 4HQEA 3FXRA 1RUOA 3M7GA 3DP7A 4M6YA 3KZZA 4EJUA 2PLYA 1DPUA 4ESBA 1EH8A 3GZ5A 1TNSA 1GHCA 2RN7A 3TDUC 1LDKB 1R5GA 1FT9A 3ECHA 2HTSA 1DDNA 3SQNA 3F23A 4YFXF 2XAHA 3BZ6A 4HLYA 3E97A 3PQJA 2L4AA 1TLHB 4L5JA 3HOTA 3SHFA 1K79A 2Y75A 2VONA 1SMTA 1UCRA 2MD5A 3F6VA 3R0AA 3MAJA 3T8TA 1D5VA 1H0MA 4MQ9F 1O57A 1ZRCA 1J75A 2OBPA 5KVRA 3HUGA 3KEQA 4DNCA 2NS0A 2DO7A 1TQMA 3VB2A 1MJBA 1R7JA 5J6XA 3RI4A 1YW8A 1QPMA 5A2QZ 1CGPA 3M1EA 4M73A 1QGPA 2A6EF 3ERED 3K0LA 2VN2A 4EM1A 1ZYRF 4PCQA 1HQCA 2FMLA 2HOEA 5F6FA 1B9NA 2DK8A 4HLXA 4EQQA 3KP6A 4GGGA 3H3ZA 2VT2A 1IW7F 3BPVA 1Z6RA 3REOA 1ZRDA 4IPAA 2VOOA 2ZMEB 1KU2A 4S04A 4L9TA 5F64A 3HYIA 4YIFA 1Q1HA 3KFWX 1X3UA 3V7CA 3FMSA 3GEZA 1UHMA 1YW7A 3BPXA 2HYGD 3D5LA 3EYIA 5HDNA 1XD7A 4U0WA 1HXDA 1FSHA 1D3YA 1KU9A 4KYWA 4H0EA 3VEPA 5BQTA 1W7PA 3I5UA 2VE9A 2YU3A 2FSWA 5FGMA 2VBWA 4YFKF 2OZ6A 4BHCA 3HOSA 1SMYF 5L3FA 4HDVA 1R1UA 2DK5A 2MH2A 1REPC 3BROA 3CUQC 1BI3A 5D6EA 5L3DA 3ML6A 4LG0B 2DBBA 1U2WA 2LF8A 5A2QK 1OPCA 4KN7X 1KU7A 2P5KA 2V1UA 5L3EA 2EA2A 3GX4X 1YW9A 2R7DA 2F5EA 4ENJA 4L0YB 1EH7A 2L3DA 4I0BA 1YFHA 1Z91A 2DQLA 5L3BA 3J81Z 2PMUA 2HDCA 3ZMZA 1FP1D 3HHGA 1LB2A 1XDSA 2EV5A 2COMA 1HKTA 2FEZA 5JFRA 5LHHA 4KNYA 4LFUA 2QUFA 4WK8F 3M9AA 2CWEA 4PZJA 1J5YA 1S8NA 2NNNA 3E6CC 5BPIA 4LLLA 1ODDA 1SD7A 1R58A 4FX0A 4HAMA 4PGGA 2XGXA 5H6RA 3IRRA 1IN5A 1I27A 5FLXK 3L9FA 2HTJA 2JPBA 2XIGA 4U7BA 3E5UA 1WQ2A 4WX9A 4QLCU 2V9VA 5E8GA 4LB5A 1OYWA 2VE8A 1ZARA 3LA7A 3JAMK 2P7VB 4Q4ZF 2NYXA 3U9GA 4ON0A 3ISPA 1U5TB 3P9CA 1Z6TA 3QU6A 3R60A 2FNAA 2H09A 2CO5A 4EJWA 4HOBA 3KP7A 3B73A 1ZG3A 5EEHA 3HSFA 5DCMB 4G7ZF 4EJVA 4L5IA 5CVRA 4FX4A 2G7HA 2VBYA 3ABUA 1W4MA 1TW3A 5ICGA 4CICA 3COAC 4A12A 1IXRC 1F9NA 1JXSA 2EV6A 1O3SA 2KIUA 3HRMA 1FSEA 4U88A 1OMIA 3WG9A 2A69F 5D5XB 1MJAA 3TOBA 1MDMA 1ULYA 4ZYDA 3HRUA 3VFZA 3RJPA 2RQPA 2GZWA 4EGZA 2A5YB 2E1NA 3JW4A 4BXUA 4UVAA 2KJBA 1H9GA 2OQRA 4GYGA 3WTZA 3QAHA 3LAPA 3WGIA 4UUVA 3NRVA 1FOKA 5CVIA 4WXHA 3EYYA 1HW1A 4XLPF 3PFIA 1BBYA 4IHTA 5HS9A 3V8LA 4RAZA 1YYVA 2L4MA 5DEQA 1QO0D 4HQMA 2XAQA 2EFPA 1XDUA 4MGRA 5AIPA 5HDKA 4KIGA 2QENA 3O3KA 3HRTA 2Z9OA 2JTVA 4IRIA 3LAJA 1SFEA 3RPQA 3HHHA 4ZYHA 1YS7A 3E6BA 3S2WA 1BIBA 2ETHA 4TV7A 1QBJA 2A61A 2ESHA 3CDHA 1OR7A 1LDDA 3C3WA 3RKWA 5LEJA 1XGSA 1FLIA 2EK5A 3C18A 1G4DA 2BEOA 1T0FA 3WE3A 5DD4A 2G7UA 3GFLA 5D5VB 3KE2A 2RV8A 4N9HA 4M9XA 4A2UA 2IA2A 5E18F 3AAFA 4LG0A 2FXAA 3VODA 4GO1A 1WRJA 3FHZA 4ESFA 4WF2A 3KZYA 1R23A 2Z33A 2VOPA 3WTWC 2IW5A 1G3YA 1YTYA 1TQPA 3GWZA 4HX7A 1ON1A 2D1VA 4OIRF 1K78A 2W84A 2VBZA 4IHSA 3HSRA 4XLNF 3U2RA 5TJJA 2MBFA 4OOIA 3BJAA 3N97A 2M1BA 1G6NA 1ZRFA 1TBXA 4XBFA 4IVNA 1RZ4A 2PQ8A 4UVCA 3KP3A 2EB7A 5LRSA 4RGXA 2Y48A 3DEUA 2LSOA 1R22A 2STWA 4IXAA 4ZYEA 1BI2A 3V8JA 3WTUC 3BJOA 3KP5A 2ZKZA 4I7HA 1U78A 1S29A 1RUNA 1B4AA 2HKOA 4S05A 4EJTA 2M8EA 1XGNA 2P6SA 3TDZC 2OAZA 3TOAA 2EWNA 2K86A 4FHTA 5ILUA 1ONVA 2XKPA 2Y0MA 4A0ZA 4Y13A 3D0SA 3RYPA 2C6YA 4CHUA 4CGZA 4EGYA 3CO7C 4AD9A 3I59B 1YO5C 1ZH5A 2KKOA 4GYIA 5DYMA 1TQIA 5BPDA 3SZTA 2K7LA 2D45A 4MEXF 5AONA 3IKTA 1PP8F 1EV7A 1XSXA 1USSA 3LFKA 1YIOA 5LHIA 4Z2YA 4AWXB 4K2EA 1FYMA 2EA4A 3HIFA 4WXDA 2GA1A 3K1MA 2P6TA 1KQ8A 5L3GA 1FP2A 2OQGA 1XB4A 5JI6A 2LNBA 4Q47A 1NHAA 2FRHA 5DV5A 1JE8A 2O6GE 2FE3A 3C7JA 5K1YA 4EV0A 4KFCA 3K1PA 3WGGA 2A68F 3I58A 3FF5A 3V7SA 5HLIA 4BNCA 1E17A 2OZUA 4JBAA 4EJOA 3U1DA 4UVBA 4ETSA 2GAUA 1FYLA 3J7AO 1LNWA 4A6DA 4BHBA 1J7KA 5J8FA 3LA3A 2QZ8A 2FBHA 2IPQX 3F22A 1E2XA 1KQ9A 2QWWA 4UHTA 3F72A 2FBKA 2ADUA 2EJRA 4HW0A 3L2CA 1J2XA 5ERIA 4L9JA 2Z99A 3DPLC 3DQVC 3QPHA 2W25A 2D1HA 1FC3A 3QP6A 5ICFA 1YQAA 3Q9SA 3GFMA 1B6AA 1TW2A 5CVUA 3GVAA 2ZCWA 1U3EM 4G6DA 2IP2A 1G3TA 1LEBA 3R61A 5HLGA 4KICA 4A0YA 4L9NA 2OU2A 3K69A 1ZAOA 1SD5A 4WXCA 2V1XA 1MD0A 3CO6C 1SFUA 2ZXJA 4HBLA 3WU1B 2EFNA 1IN8A 4M6XA 5E1XA 3J80K 2GA2A 4RB1A 2RVCA 1HKQA 2P4WA 1IXCA 1OYYA 3ZMDA 1ZG1A 5FLXZ 2DLLA 2PEXA 4M72A 4HYEA 2PFBA 1R00A 1T39A 3FX3A 2XHKA 4A0XA 4OU0A 4IF4A 2DU9A 1P2FA 2CFXA 3DKWA 1T6SA 3JAMZ 3ZMVA 4HF1A 2EFOA 2YX7A 4Q5SF 2ESNA 1S7AA 4ESJA 1F4KA 1XGOA 4XRFA 4G7OF 3I53A 4WCGA 2HQNA 2W85A 1F1ZA 1USTA 3ABTA 5FD6A 2K4JA 4G7HF 3CUOA 4OMYA 3H3UA 2DAOA 5J8CA 1SFXA 5CJ9A 3L00A 3QP5A 1Y0UA 1O3TA 5K5OA 1O7FA 3BDDA 3GZ6A 4A5MA 5K5RA 1Z7UA 1ZLJA 3WODF 3O6BB 3H92A 3TQNA 2KJCA 4OIOF 2DW4A 2XRNA 1OYIA 3TKYA 3EUHA 1XCVA 5LHGA 2O61A 2IA1A 1R36A 5TRDA 2CW0F 5HS8A 3CUQB 3V4GA 2HGCA 3EETA 2LKPA 1A04A 3BOQA 2F5CA 1XCBA 1U6GA 1HSJA 4MTEA 3WTSC 4CYDA 3L09A 2L01A 4P9UA 3GF2A 1D8KA 2GWRA 1RIOH 1FPQA 3R6SA 3VOEA 1K7AA 5LGUA 3I59A 1SD4A 5L3CA 5ILVA 4I98B 1Z9CA 3TO9A 1KU3A 2ISZA 1IXSB 2B0LA 2QQAA 5FFZA 3ECOA 3F6OA 4YFNF 4KN4X 3MZHA 1F5TA 3K1NA 3FMRA 2P5LC 5LGNA 2HQRA 1I1GA 2VT3A 5AIQA 5D5UB 3E5QA 2V1DA 4JQFA 3W6JB 1BOAA 1T38A 3NEUA 1XGMA 4O6JA 5IT9Z 5D6FA 1SAXA 1J59A 5HDGA 5DCFA 2XAGA 1XSVA 1FZPB 2WWYA 3N4MA 1XMKA 2VC1A 4OIPF 2M45A 4G94A 2TDXA 3WU0A 4R79A 1BI0A 5BOXA 2CYYA 2Q2EA 5ED4A 5ICCA 1MKMA 3KP2A 4AVPA 2IT0A 1KA8A 2CGPA 3GO5A 1DP7P 3HTSB 2JT1A 1FBSA 5HLHA 1FWZA 2MH9A 4LK1F 3T1BA 4RB2C 2BGCA 2WTEA 2ZMEA 4A6EA 2RDPA 1B9MA 1I5ZA 3DF8A 4KMFA 4BHPA 4YG2F 2QBYB 3WE2A 4LK0F 5ILSA 3JSPA 3ZP5A 1O7LA 1LVAA 3DV8A 3E3VA 5HOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I71 A;  1W7P B;  4JK1 X;  2PG4 A;  3F8M A;  4B8X A;  3O2P E;  5CYV A;  5IT3 A;  4CZZ A;  1V3F A;  2IA0 A;  2M87 A;  3E6D A;  2AXL A;  1BM9 A;  1STZ A;  4YII A;  1U8R A;  4MHG A;  2FBI A;  2XV4 S;  2JZY A;  1BC7 C;  4IJA A;  5IT9 K;  1QZY A;  3V7R A;  1LDJ A;  5BMZ A;  4MEY F;  3FZV A;  4UV9 A;  2FF4 A;  3WTY C;  1K6O A;  3QU3 A;  3GYH X;  1O3R A;  4L18 B;  2IVM A;  4NHJ A;  2VC0 A;  3T5X A;  2KIF A;  4Y17 A;  3F21 A;  3BY6 A;  3SFZ A;  3ZN0 A;  2QYO A;  4P9F A;  4RGU A;  5E8I A;  4AIK A;  2GIV A;  1IRF A;  3HSE A;  4AIH A;  4ZZD A;  2ZNY A;  3IRQ A;  1W7P D;  4LMY A;  3LQQ A;  1YG2 A;  2HFH A;  3RKY A;  4M9S A;  5H6Q A;  2ELH A;  4LLG F;  2DFI A;  4EM0 B;  4CXF A;  1HW5 A;  1Z05 A;  3FXQ A;  1P4A A;  3F3X A;  3OOP A;  3BWG A;  2E1C A;  3MEX A;  4KT5 C;  1IN4 A;  3SZP A;  3T0Y A;  1IN6 A;  1SD6 A;  2BYV E;  2STT A;  3ULQ B;  1C0W A;  2UWM A;  1UHW A;  2O03 A;  2OD5 A;  2Z3Y A;  3G3Z A;  3IHU A;  4M71 A;  5H20 A;  3ZMS A;  1BJA A;  2Q0O A;  5E20 A;  2VBX A;  5LLQ A;  6PAX A;  4LB6 B;  1MZB A;  2CG4 A;  4MTD A;  4U7D A;  3ZMT A;  1Z1D A;  2DQR A;  4R1H A;  3MZY A;  2X0L A;  1OKR A;  1W5S A;  1O3Q A;  1CF7 B;  3RTR A;  3GW2 A;  1AWC A;  3GLX A;  1U5T A;  3ZN1 A;  3JTH A;  2L02 A;  2DTR A;  2D2W A;  3J80 Z;  2NRA C;  4RGS A;  1G3S A;  3HTU A;  5DCM A;  2H27 A;  4ZZL A;  1LJ9 A;  2UZK A;  1KYZ A;  4EM2 A;  5JHU A;  4NQW A;  2DT5 A;  1P4X A;  3KET A;  5ICE A;  1ON2 A;  4XSX F;  2F2E A;  2JRT A;  3DPT A;  3BJ6 A;  1DUX C;  5E17 F;  4ENM A;  3GFJ A;  2YX4 A;  2F5D A;  3LA2 A;  5CLS A;  1MDM B;  1S3J A;  1HST A;  2RKH A;  2LF7 A;  3GUD A;  1T2K A;  2A6H F;  3NQO A;  4G6Q A;  4RAY A;  4ENK A;  1MGT A;  4M74 A;  3L7W A;  2O3F A;  1XSD A;  1KYW A;  1ZN2 A;  4I09 A;  5JVT A;  2QQB A;  2Q8K A;  1I6X A;  4O5V A;  3TO6 A;  4I2O A;  3PQK A;  2K02 A;  4RS8 A;  3WTV C;  2HKX A;  2HYF A;  2VOD A;  2BE5 F;  2F5F A;  4FT8 A;  3IKV A;  4CDG A;  1JHF A;  4AIJ A;  4QWQ A;  1ZGA A;  5FFX A;  4LLN A;  1MJ9 A;  2MLG A;  2FMY A;  1GVJ A;  2IJL A;  1JGS A;  4OIQ F;  1B59 A;  2FOK A;  2BV6 A;  2HR3 A;  2ZNZ A;  3CTA A;  2HWV A;  3MFK A;  1P6R A;  2QBY A;  4D0P A;  1L0O C;  4E70 A;  2R3S A;  4MQV A;  3QPT A;  3JTG A;  3M8F A;  5LBQ A;  2XAJ A;  4Q48 A;  5FB2 A;  4KUM A;  3TO7 A;  4BAY A;  3LQR A;  2YSR A;  4LGW A;  2ZO4 A;  4L9V A;  1ZHF A;  4N0B A;  2XKO A;  4KIB A;  2A3S A;  1KQ0 A;  5BS6 A;  2XVC A;  2W24 A;  2PI0 A;  2P5V A;  1WSU A;  2OA4 A;  2LDU A;  4WWC A;  4KIF A;  5EEG A;  2NAZ A;  3G73 A;  4XSZ F;  5FO5 A;  3DFG A;  4GCV A;  2X4H A;  1TNT A;  1IAW A;  3Q5F A;  4EVI A;  2HEO A;  2UXX A;  2ACJ A;  1TTY A;  3IL2 A;  1JHH A;  4DQ2 A;  5HVQ C;  1PP7 U;  5E1Z B;  1KGS A;  2E7W A;  1UFM A;  1P92 A;  3M8E A;  3ROU A;  5D4S A;  3EQL F;  1BN5 A;  4HX4 A;  1K78 B;  3FMQ A;  1U5T C;  4O3M A;  2J5O A;  1EH6 A;  1S6L A;  2M5W A;  3C1D A;  4CO8 A;  3T8R A;  3RKX A;  3V8K A;  5D8L B;  5FD5 A;  2E7X A;  2CQK A;  4P5O A;  1ZRE A;  4BH9 A;  4G8X A;  4ZYG A;  3R0J A;  1DPR A;  1PUE E;  4I01 A;  4BQA A;  1IN7 A;  1BC8 C;  2QQ9 A;  2PJP A;  1UB9 A;  3MQ0 A;  2M30 A;  4LJZ F;  4M9Z A;  4L0Z B;  2V79 A;  1B1B A;  2WV0 A;  4UXN A;  3SXY A;  3R4K A;  1GXQ A;  2JPC A;  5CVJ A;  1H9T A;  4N9I A;  1T98 A;  4BYY A;  1L3L A;  4HA8 A;  2PN6 A;  3ZMU A;  3HRS A;  2P8T A;  4HZF A;  5D8K B;  2V6C A;  3ZQ7 A;  3KLN A;  2GXB A;  1IUY A;  1HKS A;  2GQQ A;  2MC3 A;  1V4R A;  1D8J A;  3I64 A;  2ZFW A;  3CJN A;  3I4P A;  3P7N A;  3RYR A;  2RGV A;  5CVV A;  2NNY A;  3IWF A;  1HW2 A;  1CF7 A;  3K9T A;  1LQ1 A;  3RIR A;  3J81 K;  4KMU X;  2MA3 A;  1BIA A;  5DDG A;  3KCC A;  4A5N A;  4LD5 A;  4UV8 A;  1G3W A;  4I02 A;  1FX7 A;  2K27 A;  1BI1 A;  3MCZ A;  2IRF G;  2CSO A;  2K4B A;  4UNO A;  3FWE A;  3W6K B;  3F8N A;  1AOY A;  4MNU A;  1J9I A;  1FNN A;  3KLO A;  4I0A A;  2YR2 A;  4B09 A;  4RB0 A;  2WC2 A;  1ZG5 A;  3GFI A;  2DPD A;  3LWF A;  1YLF A;  1S7O A;  3P9K A;  4IRG A;  2EFQ A;  3F8F A;  5D4R A;  4G9Y A;  2QLZ A;  5K5Q A;  5KK1 A;  2O8X A;  2RNJ A;  1WI9 A;  1XN7 A;  1WKM A;  3I54 A;  1QQI A;  4RGR A;  2MLK A;  2W57 A;  3QRF F;  2DI3 A;  1LEA A;  4KA4 A;  5DUI A;  4NB5 A;  5LRR A;  3FXU A;  2EFW A;  5DD8 A;  2QM3 A;  5JR3 A;  2O0Y A;  2AS5 F;  2R7F A;  1P4W A;  5HS7 A;  3WGH A;  1QZZ A;  3FM5 A;  4U0V A;  2KRF A;  2BBY A;  3IC7 A;  4P55 A;  3EDP A;  2L54 A;  5LGT A;  4HV5 A;  1J0R A;  2GXG A;  3GXO A;  3LST A;  1HBX G;  2RC4 A;  3P9I A;  2YPR A;  4OIN F;  1ZGJ A;  4IRH A;  3F8B A;  3DXJ F;  2FA5 A;  1W5T A;  2FQ3 A;  3WTX C;  3B02 A;  3E6M A;  1FY7 A;  2J5P A;  4HF2 A;  2PBI A;  1I1S A;  3WTT C;  2P7C B;  2HS5 A;  4EMS A;  4HV6 A;  2ZJ2 A;  1QNT A;  3K2Z A;  3ELK A;  2FU4 A;  2FNP A;  4U0Y A;  2H6B A;  2PMH A;  1IZ1 A;  3FM3 A;  3Q9V A;  5F1R A;  3ZPL A;  1ZLK A;  2DPU A;  4KDP A;  1IRG A;  1PDN C;  2ZBK A;  1R1T A;  5LEK A;  1FBQ A;  2UXN A;  2XAS A;  2QVO A;  3QOP A;  2KIM A;  3RDI A;  1WWX A;  4ENN A;  4GXO A;  2XAF A;  2Z5U A;  1RNL A;  2XRO A;  2G9W A;  1FBU A;  3I0T A;  1R5H A;  3MWM A;  2ISY A;  3BP8 A;  1IF1 A;  3RPU A;  1RI7 A;  2H94 A;  5DUK A;  1XMA A;  3KP4 A;  3OV8 A;  4ASN A;  3JSO A;  4HF0 A;  2XUB A;  1R1V A;  3KEO A;  4P96 A;  1YS6 A;  4F7Z A;  3E5X A;  5D5W B;  2EV0 A;  2HZT A;  4PDK A;  1VTN C;  4OMZ A;  2A07 F;  5E1W A;  3CLO A;  4HX8 A;  2H6C A;  1FYK A;  3IWZ A;  3CUQ A;  4ZH4 F;  3TGN A;  3F8C A;  4HDU A;  4PGH A;  4R8H A;  4Y15 A;  1GXP A;  2VXZ A;  2JSC A;  4RB3 C;  4HQE A;  3FXR A;  1RUO A;  3M7G A;  3DP7 A;  4M6Y A;  3KZZ A;  4EJU A;  2PLY A;  1DPU A;  4ESB A;  1EH8 A;  3GZ5 A;  1TNS A;  1GHC A;  2RN7 A;  3TDU C;  1LDK B;  1R5G A;  1FT9 A;  3ECH A;  2HTS A;  1DDN A;  3SQN A;  3F23 A;  4YFX F;  2XAH A;  3BZ6 A;  4HLY A;  3E97 A;  3PQJ A;  2L4A A;  1TLH B;  4L5J A;  3HOT A;  3SHF A;  1K79 A;  2Y75 A;  2VON A;  1SMT A;  1UCR A;  2MD5 A;  3F6V A;  3R0A A;  3MAJ A;  3T8T A;  1D5V A;  1H0M A;  4MQ9 F;  1O57 A;  1ZRC A;  1J75 A;  2OBP A;  5KVR A;  3HUG A;  3KEQ A;  4DNC A;  2NS0 A;  2DO7 A;  1TQM A;  3VB2 A;  1MJB A;  1R7J A;  5J6X A;  3RI4 A;  1YW8 A;  1QPM A;  5A2Q Z;  1CGP A;  3M1E A;  4M73 A;  1QGP A;  2A6E F;  3ERE D;  3K0L A;  2VN2 A;  4EM1 A;  1ZYR F;  4PCQ A;  1HQC A;  2FML A;  2HOE A;  5F6F A;  1B9N A;  2DK8 A;  4HLX A;  4EQQ A;  3KP6 A;  4GGG A;  3H3Z A;  2VT2 A;  1IW7 F;  3BPV A;  1Z6R A;  3REO A;  1ZRD A;  4IPA A;  2VOO A;  2ZME B;  1KU2 A;  4S04 A;  4L9T A;  5F64 A;  3HYI A;  4YIF A;  1Q1H A;  3KFW X;  1X3U A;  3V7C A;  3FMS A;  3GEZ A;  1UHM A;  1YW7 A;  3BPX A;  2HYG D;  3D5L A;  3EYI A;  5HDN A;  1XD7 A;  4U0W A;  1HXD A;  1FSH A;  1D3Y A;  1KU9 A;  4KYW A;  4H0E A;  3VEP A;  5BQT A;  1W7P A;  3I5U A;  2VE9 A;  2YU3 A;  2FSW A;  5FGM A;  2VBW A;  4YFK F;  2OZ6 A;  4BHC A;  3HOS A;  1SMY F;  5L3F A;  4HDV A;  1R1U A;  2DK5 A;  2MH2 A;  1REP C;  3BRO A;  3CUQ C;  1BI3 A;  5D6E A;  5L3D A;  3ML6 A;  4LG0 B;  2DBB A;  1U2W A;  2LF8 A;  5A2Q K;  1OPC A;  4KN7 X;  1KU7 A;  2P5K A;  2V1U A;  5L3E A;  2EA2 A;  3GX4 X;  1YW9 A;  2R7D A;  2F5E A;  4ENJ A;  4L0Y B;  1EH7 A;  2L3D A;  4I0B A;  1YFH A;  1Z91 A;  2DQL A;  5L3B A;  3J81 Z;  2PMU A;  2HDC A;  3ZMZ A;  1FP1 D;  3HHG A;  1LB2 A;  1XDS A;  2EV5 A;  2COM A;  1HKT A;  2FEZ A;  5JFR A;  5LHH A;  4KNY A;  4LFU A;  2QUF A;  4WK8 F;  3M9A A;  2CWE A;  4PZJ A;  1J5Y A;  1S8N A;  2NNN A;  3E6C C;  5BPI A;  4LLL A;  1ODD A;  1SD7 A;  1R58 A;  4FX0 A;  4HAM A;  4PGG A;  2XGX A;  5H6R A;  3IRR A;  1IN5 A;  1I27 A;  5FLX K;  3L9F A;  2HTJ A;  2JPB A;  2XIG A;  4U7B A;  3E5U A;  1WQ2 A;  4WX9 A;  4QLC U;  2V9V A;  5E8G A;  4LB5 A;  1OYW A;  2VE8 A;  1ZAR A;  3LA7 A;  3JAM K;  2P7V B;  4Q4Z F;  2NYX A;  3U9G A;  4ON0 A;  3ISP A;  1U5T B;  3P9C A;  1Z6T A;  3QU6 A;  3R60 A;  2FNA A;  2H09 A;  2CO5 A;  4EJW A;  4HOB A;  3KP7 A;  3B73 A;  1ZG3 A;  5EEH A;  3HSF A;  5DCM B;  4G7Z F;  4EJV A;  4L5I A;  5CVR A;  4FX4 A;  2G7H A;  2VBY A;  3ABU A;  1W4M A;  1TW3 A;  5ICG A;  4CIC A;  3COA C;  4A12 A;  1IXR C;  1F9N A;  1JXS A;  2EV6 A;  1O3S A;  2KIU A;  3HRM A;  1FSE A;  4U88 A;  1OMI A;  3WG9 A;  2A69 F;  5D5X B;  1MJA A;  3TOB A;  1MDM A;  1ULY A;  4ZYD A;  3HRU A;  3VFZ A;  3RJP A;  2RQP A;  2GZW A;  4EGZ A;  2A5Y B;  2E1N A;  3JW4 A;  4BXU A;  4UVA A;  2KJB A;  1H9G A;  2OQR A;  4GYG A;  3WTZ A;  3QAH A;  3LAP A;  3WGI A;  4UUV A;  3NRV A;  1FOK A;  5CVI A;  4WXH A;  3EYY A;  1HW1 A;  4XLP F;  3PFI A;  1BBY A;  4IHT A;  5HS9 A;  3V8L A;  4RAZ A;  1YYV A;  2L4M A;  5DEQ A;  1QO0 D;  4HQM A;  2XAQ A;  2EFP A;  1XDU A;  4MGR A;  5AIP A;  5HDK A;  4KIG A;  2QEN A;  3O3K A;  3HRT A;  2Z9O A;  2JTV A;  4IRI A;  3LAJ A;  1SFE A;  3RPQ A;  3HHH A;  4ZYH A;  1YS7 A;  3E6B A;  3S2W A;  1BIB A;  2ETH A;  4TV7 A;  1QBJ A;  2A61 A;  2ESH A;  3CDH A;  1OR7 A;  1LDD A;  3C3W A;  3RKW A;  5LEJ A;  1XGS A;  1FLI A;  2EK5 A;  3C18 A;  1G4D A;  2BEO A;  1T0F A;  3WE3 A;  5DD4 A;  2G7U A;  3GFL A;  5D5V B;  3KE2 A;  2RV8 A;  4N9H A;  4M9X A;  4A2U A;  2IA2 A;  5E18 F;  3AAF A;  4LG0 A;  2FXA A;  3VOD A;  4GO1 A;  1WRJ A;  3FHZ A;  4ESF A;  4WF2 A;  3KZY A;  1R23 A;  2Z33 A;  2VOP A;  3WTW C;  2IW5 A;  1G3Y A;  1YTY A;  1TQP A;  3GWZ A;  4HX7 A;  1ON1 A;  2D1V A;  4OIR F;  1K78 A;  2W84 A;  2VBZ A;  4IHS A;  3HSR A;  4XLN F;  3U2R A;  5TJJ A;  2MBF A;  4OOI A;  3BJA A;  3N97 A;  2M1B A;  1G6N A;  1ZRF A;  1TBX A;  4XBF A;  4IVN A;  1RZ4 A;  2PQ8 A;  4UVC A;  3KP3 A;  2EB7 A;  5LRS A;  4RGX A;  2Y48 A;  3DEU A;  2LSO A;  1R22 A;  2STW A;  4IXA A;  4ZYE A;  1BI2 A;  3V8J A;  3WTU C;  3BJO A;  3KP5 A;  2ZKZ A;  4I7H A;  1U78 A;  1S29 A;  1RUN A;  1B4A A;  2HKO A;  4S05 A;  4EJT A;  2M8E A;  1XGN A;  2P6S A;  3TDZ C;  2OAZ A;  3TOA A;  2EWN A;  2K86 A;  4FHT A;  5ILU A;  1ONV A;  2XKP A;  2Y0M A;  4A0Z A;  4Y13 A;  3D0S A;  3RYP A;  2C6Y A;  4CHU A;  4CGZ A;  4EGY A;  3CO7 C;  4AD9 A;  3I59 B;  1YO5 C;  1ZH5 A;  2KKO A;  4GYI A;  5DYM A;  1TQI A;  5BPD A;  3SZT A;  2K7L A;  2D45 A;  4MEX F;  5AON A;  3IKT A;  1PP8 F;  1EV7 A;  1XSX A;  1USS A;  3LFK A;  1YIO A;  5LHI A;  4Z2Y A;  4AWX B;  4K2E A;  1FYM A;  2EA4 A;  3HIF A;  4WXD A;  2GA1 A;  3K1M A;  2P6T A;  1KQ8 A;  5L3G A;  1FP2 A;  2OQG A;  1XB4 A;  5JI6 A;  2LNB A;  4Q47 A;  1NHA A;  2FRH A;  5DV5 A;  1JE8 A;  2O6G E;  2FE3 A;  3C7J A;  5K1Y A;  4EV0 A;  4KFC A;  3K1P A;  3WGG A;  2A68 F;  3I58 A;  3FF5 A;  3V7S A;  5HLI A;  4BNC A;  1E17 A;  2OZU A;  4JBA A;  4EJO A;  3U1D A;  4UVB A;  4ETS A;  2GAU A;  1FYL A;  3J7A O;  1LNW A;  4A6D A;  4BHB A;  1J7K A;  5J8F A;  3LA3 A;  2QZ8 A;  2FBH A;  2IPQ X;  3F22 A;  1E2X A;  1KQ9 A;  2QWW A;  4UHT A;  3F72 A;  2FBK A;  2ADU A;  2EJR A;  4HW0 A;  3L2C A;  1J2X A;  5ERI A;  4L9J A;  2Z99 A;  3DPL C;  3DQV C;  3QPH A;  2W25 A;  2D1H A;  1FC3 A;  3QP6 A;  5ICF A;  1YQA A;  3Q9S A;  3GFM A;  1B6A A;  1TW2 A;  5CVU A;  3GVA A;  2ZCW A;  1U3E M;  4G6D A;  2IP2 A;  1G3T A;  1LEB A;  3R61 A;  5HLG A;  4KIC A;  4A0Y A;  4L9N A;  2OU2 A;  3K69 A;  1ZAO A;  1SD5 A;  4WXC A;  2V1X A;  1MD0 A;  3CO6 C;  1SFU A;  2ZXJ A;  4HBL A;  3WU1 B;  2EFN A;  1IN8 A;  4M6X A;  5E1X A;  3J80 K;  2GA2 A;  4RB1 A;  2RVC A;  1HKQ A;  2P4W A;  1IXC A;  1OYY A;  3ZMD A;  1ZG1 A;  5FLX Z;  2DLL A;  2PEX A;  4M72 A;  4HYE A;  2PFB A;  1R00 A;  1T39 A;  3FX3 A;  2XHK A;  4A0X A;  4OU0 A;  4IF4 A;  2DU9 A;  1P2F A;  2CFX A;  3DKW A;  1T6S A;  3JAM Z;  3ZMV A;  4HF1 A;  2EFO A;  2YX7 A;  4Q5S F;  2ESN A;  1S7A A;  4ESJ A;  1F4K A;  1XGO A;  4XRF A;  4G7O F;  3I53 A;  4WCG A;  2HQN A;  2W85 A;  1F1Z A;  1UST A;  3ABT A;  5FD6 A;  2K4J A;  4G7H F;  3CUO A;  4OMY A;  3H3U A;  2DAO A;  5J8C A;  1SFX A;  5CJ9 A;  3L00 A;  3QP5 A;  1Y0U A;  1O3T A;  5K5O A;  1O7F A;  3BDD A;  3GZ6 A;  4A5M A;  5K5R A;  1Z7U A;  1ZLJ A;  3WOD F;  3O6B B;  3H92 A;  3TQN A;  2KJC A;  4OIO F;  2DW4 A;  2XRN A;  1OYI A;  3TKY A;  3EUH A;  1XCV A;  5LHG A;  2O61 A;  2IA1 A;  1R36 A;  5TRD A;  2CW0 F;  5HS8 A;  3CUQ B;  3V4G A;  2HGC A;  3EET A;  2LKP A;  1A04 A;  3BOQ A;  2F5C A;  1XCB A;  1U6G A;  1HSJ A;  4MTE A;  3WTS C;  4CYD A;  3L09 A;  2L01 A;  4P9U A;  3GF2 A;  1D8K A;  2GWR A;  1RIO H;  1FPQ A;  3R6S A;  3VOE A;  1K7A A;  5LGU A;  3I59 A;  1SD4 A;  5L3C A;  5ILV A;  4I98 B;  1Z9C A;  3TO9 A;  1KU3 A;  2ISZ A;  1IXS B;  2B0L A;  2QQA A;  5FFZ A;  3ECO A;  3F6O A;  4YFN F;  4KN4 X;  3MZH A;  1F5T A;  3K1N A;  3FMR A;  2P5L C;  5LGN A;  2HQR A;  1I1G A;  2VT3 A;  5AIQ A;  5D5U B;  3E5Q A;  2V1D A;  4JQF A;  3W6J B;  1BOA A;  1T38 A;  3NEU A;  1XGM A;  4O6J A;  5IT9 Z;  5D6F A;  1SAX A;  1J59 A;  5HDG A;  5DCF A;  2XAG A;  1XSV A;  1FZP B;  2WWY A;  3N4M A;  1XMK A;  2VC1 A;  4OIP F;  2M45 A;  4G94 A;  2TDX A;  3WU0 A;  4R79 A;  1BI0 A;  5BOX A;  2CYY A;  2Q2E A;  5ED4 A;  5ICC A;  1MKM A;  3KP2 A;  4AVP A;  2IT0 A;  1KA8 A;  2CGP A;  3GO5 A;  1DP7 P;  3HTS B;  2JT1 A;  1FBS A;  5HLH A;  1FWZ A;  2MH9 A;  4LK1 F;  3T1B A;  4RB2 C;  2BGC A;  2WTE A;  2ZME A;  4A6E A;  2RDP A;  1B9M A;  1I5Z A;  3DF8 A;  4KMF A;  4BHP A;  4YG2 F;  2QBY B;  3WE2 A;  4LK0 F;  5ILS A;  3JSP A;  3ZP5 A;  1O7L A;  1LVA A;  3DV8 A;  3E3V A;  5HOO A; 
#chains in the Genus database with same CATH topology
 3I71 A;  1W7P B;  4JK1 X;  2WB1 A;  2PG4 A;  3F8M A;  4B8X A;  3AG2 H;  2Y9Z A;  3O2P E;  2ZB9 A;  2NVX J;  5CYV A;  1X1B A;  2IGK A;  5IT3 A;  2JUG A;  4CZZ A;  1V5F A;  2LC2 A;  1V3F A;  2IA0 A;  2M87 A;  1RR8 C;  4IHX A;  3E6D A;  3EUH C;  1W5C C;  3A4C A;  2FOW A;  2AXL A;  1BM9 A;  1STZ A;  4N4N B;  4PJ0 C;  1WCM J;  3MD2 A;  2PJR A;  4YII A;  1IRZ A;  4UUS B;  3CCE I;  1RET A;  1U8R A;  3OYN A;  4MHG A;  2FBI A;  2XV4 S;  1FOY A;  2JZY A;  1BC7 C;  3S15 J;  4IJA A;  4PFP A;  5IT9 K;  1QZY A;  2K3P A;  3E1S A;  3V7R A;  3CCV I;  1LDJ A;  2YS9 A;  3TBI A;  4MEY F;  5BMZ A;  3FZV A;  5JHF A;  4XKW A;  1XC5 A;  1W36 C;  4UV9 A;  3CP8 A;  1ETW A;  2FF4 A;  4ZC3 A;  3WTY C;  1K6O A;  3QU3 A;  3GYH X;  1AKH A;  1O3R A;  5EYR A;  2DA5 A;  2EBI A;  3M8J A;  4L18 B;  2LBF A;  5C4X J;  2IVM A;  4NHJ A;  2VC0 A;  5FKM A;  3T5X A;  5FRO A;  3RSN A;  2KIF A;  2QEX I;  4Y17 A;  4XRS G;  3F21 A;  3BY6 A;  3H0G J;  3SFZ A;  5CKT A;  4AC0 A;  1Y8Q B;  1JKO C;  5C44 J;  3ZN0 A;  1Z3X A;  1X1D A;  2QYO A;  2VIX A;  4P9F A;  4RGU A;  1W0T A;  1T08 B;  5E8I A;  2NVQ J;  4AIK A;  2GIV A;  1IRF A;  3A1Y A;  3HSE A;  4AIH A;  5FLM J;  4A3G J;  4ZZD A;  2ZNY A;  3IRQ A;  1W7P D;  2ZFU A;  3DBL B;  4LMY A;  2EIL H;  4CCL A;  3LQQ A;  1MBH A;  1YG2 A;  1IO2 A;  2HFH A;  1WJF A;  5J4Y A;  3RKY A;  4M9S A;  5H6Q A;  2ELH A;  4YEJ A;  1XPX A;  2LD5 A;  4E6K G;  1Z21 A;  4LLG F;  2DFI A;  3K4L A;  4EM0 B;  4CXF A;  2IS1 A;  5EZG A;  1HW5 A;  2W1O A;  1Z05 A;  3FXQ A;  1P4A A;  3F3X A;  2XSD C;  3OOP A;  3BWG A;  2E1C A;  3MEX A;  2HZD A;  2DMU A;  2Y9Y A;  3L2U A;  3S32 A;  4KT5 C;  2BVL A;  1IN4 A;  2X9D A;  3SZP A;  3I3L A;  3C2B A;  3T0Y A;  5HOO A;  1IN6 A;  1SD6 A;  2BYV E;  2I5U A;  3BG9 A;  1F36 A;  2STT A;  3ULQ B;  3EUA A;  5IY5 H;  1C0W A;  3NAR A;  1WJC A;  2FX0 A;  2UWM A;  1UHW A;  2O03 A;  2OD5 A;  2Z3Y A;  1OCR H;  3JRI A;  3G3Z A;  3IHU A;  4M71 A;  5H20 A;  3ZMS A;  4LOC A;  3MMY B;  4PJN A;  4NC7 A;  1APL C;  3B6A A;  1BJA A;  2Q0O A;  1LKX A;  1HA8 A;  5E20 A;  4ZDL A;  2DYS H;  3SYT A;  4DZJ A;  1BW5 A;  2VBX A;  5LLQ A;  6PAX A;  3OYF A;  4XLF A;  3SDB A;  3FDY A;  4LB6 B;  1MZB A;  1VI0 A;  2CG4 A;  4FCY A;  3ZQL A;  1X3W B;  2W00 A;  4BXF A;  3Q0W A;  5EG0 B;  4MTD A;  3SDG A;  4U7D A;  3ZMT A;  2IS4 A;  4LG3 A;  1Z1D A;  2DQR A;  1ZTR A;  2Z2S B;  4R1H A;  2ECC A;  1X4P A;  3MZY A;  2JSP A;  3HBL A;  2R7X A;  3ERM A;  2CV2 A;  3PIO F;  2X0L A;  1OKR A;  1W5S A;  4XOT A;  1O3Q A;  1CF7 B;  1QU3 A;  3RTR A;  3GW2 A;  3JRD A;  1AWC A;  9ANT A;  3GLX A;  2E2I J;  1YIT I;  1U5T A;  4CA0 A;  2HVQ A;  3ZN1 A;  1NH3 A;  1X1C A;  4HRI A;  3JCU C;  3JTH A;  2L02 A;  1ITY A;  2DTR A;  4C30 A;  2DA6 A;  2HQ5 A;  2D2W A;  2ZME C;  3J80 Z;  4IL6 C;  1A5J A;  1X58 A;  4XK4 A;  2F5V A;  1Z77 A;  2NRA C;  2DDA A;  4RGS A;  1G3S A;  3HTU A;  2E1M B;  2ZJR F;  2QQ8 A;  5DCM A;  2H27 A;  4ZZL A;  1LJ9 A;  1M1E B;  2UZK A;  1OCC H;  1KYZ A;  4GDF A;  4EM2 A;  5JHU A;  3RQI A;  4NQW A;  1OIS A;  2DT5 A;  1P4X A;  3BC8 A;  3KET A;  5ICE A;  1ON2 A;  3KPH A;  4XSX F;  2F2E A;  3JRE A;  2JRT A;  1I3A A;  3DPT A;  2BOL A;  2EIJ H;  3ZCO A;  4A3K J;  2OF7 A;  1B8I A;  4A3J J;  3BJ6 A;  1DUX C;  5E17 F;  2BY3 A;  4ENM A;  2DTZ A;  3GFJ A;  2YX4 A;  2DFE A;  2F5D A;  3LA2 A;  3CMY A;  2HQA A;  3LSJ A;  1Z0X A;  5CLS A;  1FTT A;  4HNU A;  1MDM B;  5HNH A;  1S3J A;  1ORK A;  1HST A;  2RKH A;  1JUM A;  2LF7 A;  3GUD A;  1MH3 A;  4IEJ A;  1T2K A;  1RPW A;  4V19 K;  2A6H F;  3PUB A;  3NQO A;  4G6Q A;  2LR8 A;  4RAY A;  3K4K A;  1MGT A;  4M74 A;  4L5E A;  4ENK A;  4XMY A;  3L7W A;  2CJJ A;  3CC7 I;  1EJ9 A;  4LIV A;  3S2D J;  3ZQH A;  2O3F A;  1XSD A;  1KYW A;  1R4M B;  1ZN2 A;  4I09 A;  5JVT A;  2QQB A;  2Q8K A;  1I6X A;  4O5V A;  3TO6 A;  4BAC A;  4NC6 A;  1I39 A;  3ZR8 X;  4I2O A;  3PQK A;  3H9J A;  2K02 A;  1F43 A;  1JJ6 C;  4RS8 A;  3D5S C;  4BJT A;  3WTV C;  1ETQ A;  2DMN A;  1YRN A;  1H89 C;  2CUE A;  1JTY A;  2R5Z B;  2HKX A;  2HYF A;  1VQ5 I;  2VOD A;  2XC7 A;  2BE5 F;  2F5F A;  4FT8 A;  3ZRG A;  3IKV A;  2DDB A;  4CDG A;  1JHF A;  4AIJ A;  4QWQ A;  1ZGA A;  3D5R C;  5FFX A;  5F1J A;  3FXK A;  3ZOB A;  1TWH J;  4LLN A;  1MJ9 A;  2MLG A;  4RMN A;  4XR6 A;  2R92 J;  1MMG A;  2FMY A;  1GVJ A;  1ZQ3 P;  2IJL A;  2Y0S N;  1JGS A;  3OS1 A;  3K70 C;  4C3H J;  3FXL A;  4OIQ F;  3A0B C;  3LNQ A;  1B59 A;  2FOK A;  1VND A;  2BV6 A;  1LUJ B;  2MC4 A;  1X3Z B;  3GZN B;  2HR3 A;  1YI2 I;  2ZNZ A;  3CTA A;  2HWV A;  3MFK A;  1P6R A;  3RCO A;  2JWT A;  2QBY A;  3P5J A;  4D0P A;  1L0O C;  4E70 A;  4QTR A;  1D1A A;  2R3S A;  1YE9 A;  4MQV A;  3QPT A;  2P0W A;  2VB6 A;  3OYK A;  3JTG A;  3M8F A;  5LBQ A;  2XAJ A;  1MBG A;  2HXI A;  3K4B A;  4Q48 A;  5FB2 A;  4KUM A;  3TO7 A;  4BAY A;  3LQR A;  4XM3 A;  2YSR A;  3ZQG A;  4LGW A;  4DGW B;  5B66 C;  3LSK A;  1JKR C;  2ZO4 A;  4L9V A;  1VFC A;  2DT6 A;  3G6E I;  1ZHF A;  4A3M J;  4N0B A;  4AU7 A;  2VL8 A;  2XKO A;  4J19 A;  1IJW C;  4KIB A;  3E0J B;  2A3S A;  2M8G X;  1KQ0 A;  5BS6 A;  2WAE A;  2XVC A;  2W24 A;  1ZEL A;  2M4K A;  4IOA F;  4HNT A;  2PI0 A;  2P5V A;  3IH3 A;  1WSU A;  2OA4 A;  4UUS A;  2ZJP F;  2LDU A;  2HOA A;  4WWC A;  2M2E A;  2VJ4 A;  1BR2 A;  1U9O A;  4KIF A;  2XF6 A;  3UKG A;  5EEG A;  3GTM J;  1ETX A;  2NAZ A;  3G73 A;  4XSZ F;  5FO5 A;  2BZT A;  4CCK A;  3DFG A;  4GCV A;  2X4H A;  1TNT A;  1IAW A;  3Q5F A;  4JOM A;  4EVI A;  2HEO A;  4KIS A;  2K9Q A;  2L9R A;  1DGR M;  2UXX A;  1J09 A;  1TTY A;  4A3I J;  2ACJ A;  1FIP A;  3IL2 A;  3KYC B;  2NVY J;  2P81 A;  3QYE A;  1JHH A;  1Q1V A;  4RBO A;  4DQ2 A;  5HVQ C;  1ETV A;  3X2Q H;  1PP7 U;  5E1Z B;  1KGS A;  2E7W A;  1UFM A;  3WHC A;  1P92 A;  2M34 A;  3M8E A;  3ROU A;  5D4S A;  3EQL F;  1BN5 A;  4HX4 A;  1K78 B;  3FMQ A;  4U87 A;  1U5T C;  1YJ9 I;  4O3M A;  2J5O A;  4BQQ A;  1EH6 A;  1S6L A;  2M5W A;  3C1D A;  1LE8 A;  4CO8 A;  5FKL A;  3BTC A;  3T8R A;  3RKX A;  1Z7L A;  3V8K A;  3BTL A;  5D8L B;  4F55 A;  5FD5 A;  4B43 A;  2E7X A;  1BR4 A;  2A6T A;  2E71 A;  2CQK A;  2EZI A;  2ZSI B;  4P5O A;  4II3 A;  1ZRE A;  1QHG A;  2BXY A;  4BH9 A;  3CME I;  1G59 A;  4G8X A;  5IP6 A;  4ZYG A;  2VQG A;  3TED A;  3R0J A;  4Y4R A;  1DPR A;  1PUE E;  4I01 A;  4AYB A;  4ZTJ A;  1JI8 A;  3OYH A;  4BQA A;  4DOZ A;  1IN7 A;  4E7J A;  1BC8 C;  2KDO A;  5FKN A;  4JP0 A;  4XRM A;  1K6Y A;  2QQ9 A;  2PJP A;  1UB9 A;  4XIC A;  3MQ0 A;  2M30 A;  4M3E A;  3ONQ A;  4LJZ F;  4M9Z A;  2QSH X;  4L0Z B;  2V79 A;  1B1B A;  2R5Y B;  2WV0 A;  4UXN A;  3SXY A;  4JYK A;  1JUS A;  3R4K A;  1GXQ A;  5E3O A;  3HG9 A;  4FAS D;  2JPC A;  5CVJ A;  1H9T A;  4N9I A;  4NBQ A;  1ZGW A;  1T98 A;  4BYY A;  1TWC J;  1L3L A;  4HA8 A;  1O4X A;  3LFU A;  2PN6 A;  3G2B A;  1KZH A;  5J1Y A;  3HOU J;  3ZMU A;  1K83 J;  4XRS A;  5JVG F;  1JKQ C;  5DS9 A;  2N8G A;  3HRS A;  4W1U A;  3GTG J;  2P8T A;  3BG7 A;  1N77 A;  4HZF A;  5D8K B;  2V6C A;  2L7F P;  3ZQ7 A;  3KLN A;  2JN6 A;  1JKP C;  2GXB A;  1VQM I;  1MW7 A;  2WY7 Q;  2F4I A;  1IUY A;  5EG0 A;  3VSL A;  1HKS A;  2GQQ A;  2MC3 A;  1V4R A;  1D8J A;  3I64 A;  2ZFW A;  1GDT A;  3CJN A;  3I4P A;  3P7N A;  3RYR A;  2RGV A;  4BS9 A;  2FUG 2;  5CVV A;  2R7Z J;  3L2W A;  2NNY A;  2X6W A;  3H1C A;  3IWF A;  1JJ8 C;  1HW2 A;  1CF7 A;  2K9M A;  3K9T A;  1LQ1 A;  2QSG X;  3RIR A;  3J81 K;  4KMU X;  4B47 A;  2MA3 A;  2HPM A;  1BIA A;  4KT6 A;  3PO3 J;  2M0C A;  5DDG A;  3KCC A;  4A5N A;  1V5E A;  2VXD A;  3M1C A;  1QVU A;  1WJ5 A;  2AQE A;  2R4G A;  3BCB A;  4LD5 A;  3S17 J;  4UV8 A;  4F92 B;  1R4N B;  1G3W A;  4I02 A;  1FX7 A;  2K27 A;  2E1O A;  1BI1 A;  3H3V K;  2K9S A;  2EZK A;  3MCZ A;  5C4J J;  3ASN H;  2IRF G;  3HUG B;  1G2H A;  5IPA A;  3ZXS A;  2CSO A;  2K4B A;  3HB9 A;  3MKY B;  4MFE A;  4UNO A;  2IXS A;  3FWE A;  3WHB A;  3W6K B;  3F8N A;  3NWT A;  1AOY A;  4MNU A;  1I6H J;  3HKZ A;  1J9I A;  1FNN A;  2XRL A;  3KLO A;  3WU2 C;  5KHD A;  4I0A A;  2QKM B;  2YR2 A;  4B09 A;  4RB0 A;  3CJR B;  2WC2 A;  3DLA A;  1ZG5 A;  4FE7 A;  4BEH B;  3GFI A;  1YX3 A;  3HXL A;  4H4K C;  2DPD A;  2OCE A;  3HM5 A;  3LWF A;  1YLF A;  1S7O A;  3P9K A;  5TGT A;  4IRG A;  2EFQ A;  1SVM A;  3F8F A;  5D4R A;  2O5R A;  4G9Y A;  5LFA A;  2QLZ A;  5K5Q A;  5FKK A;  2JRM A;  5KK1 A;  2LFB A;  2O8X A;  1S5L C;  2RNJ A;  2QF7 A;  3H9Q A;  3OS2 A;  1WI9 A;  1XN7 A;  1VQ8 I;  3DU5 A;  1WKM A;  3I54 A;  3CC2 I;  1QQI A;  4BDY A;  3CMA I;  3S8P A;  1R49 A;  2VI6 A;  1EA3 A;  3HOV J;  4RGR A;  2MLK A;  2W57 A;  3QRF F;  1TP4 A;  4CYC B;  2DI3 A;  1LEA A;  4KA4 A;  5DUI A;  4NB5 A;  3OSG A;  4PJJ A;  5LRR A;  3FXU A;  3W2A A;  1OLT A;  2KRH A;  2EFW A;  1E3O C;  3AL0 C;  5GPA A;  5DD8 A;  2QM3 A;  5JR3 A;  2O0Y A;  2AS5 F;  2R7F A;  2COB A;  1P4W A;  4A3C J;  3LSP A;  5HS7 A;  1HLV A;  3WGH A;  3KX2 A;  3DEW A;  2GOX B;  3S1Q J;  3IAM 2;  1QZZ A;  3FKI J;  3FM5 A;  4XLA A;  4U0V A;  2O9L A;  1Y39 A;  3U1K A;  3K4C A;  2CW7 A;  2KRF A;  2BBY A;  2IEK A;  3IC7 A;  4P55 A;  1Y1W J;  3EDP A;  2L54 A;  1IV6 A;  2D5V A;  2CQQ A;  4CUG A;  3MZ8 A;  5LGT A;  4HV5 A;  1A36 A;  1PVE A;  4XKV A;  3HPG A;  5B1B H;  2LP0 A;  1J0R A;  2I8D A;  1AHD P;  3CCY A;  3VYT B;  2GXG A;  3JRH A;  3S93 A;  3GXO A;  2OTJ I;  1ZKG A;  3LST A;  1HBX G;  2Q1Z B;  1BJZ A;  1DQU A;  3EPZ A;  2RC4 A;  2XPV A;  3P9I A;  1SVO A;  2X48 A;  2YPR A;  2XGE A;  4OIN F;  1ZGJ A;  4IRH A;  3CLQ A;  3F8B A;  1SVL A;  3DXJ F;  1ETO A;  4PFO A;  3H5N A;  2FA5 A;  1X2M A;  2HDW A;  3VSK A;  1W5T A;  2CUZ A;  2RQQ A;  4J01 A;  2FQ3 A;  3LL7 A;  3WTX C;  3B02 A;  3E6M A;  1FY7 A;  2J5P A;  5J4V A;  4HF2 A;  2PBI A;  2CUJ A;  3O8G A;  4IKF A;  2IS6 A;  1I1S A;  2E2J J;  3CJQ B;  3WTT C;  2P7C B;  4F52 A;  2HS5 A;  2JA7 J;  2G0E A;  2Y0S A;  3DKY A;  4EMS A;  4XLE A;  4HV6 A;  2BXZ A;  2ZJ2 A;  1ZK8 A;  5GAH J;  1QNT A;  3K2Z A;  3S14 J;  3ELK A;  2FU4 A;  1N25 A;  2FNP A;  4U0Y A;  5CQE A;  2H6B A;  1E3P A;  2PMH A;  3IH2 A;  1IZ1 A;  1OQY A;  3FM3 A;  2M4G A;  1P7I A;  3RZO J;  3Q9V A;  5F1R A;  2WAQ N;  4IO9 F;  2QA4 I;  4XL9 A;  4A3F J;  3ZPL A;  2W82 A;  1ZLK A;  2DPU A;  4KDP A;  1IRG A;  3HL2 A;  2ZBK A;  1PDN C;  1R1T A;  5LEK A;  2AQF A;  1FBQ A;  2JVH A;  3OYG A;  2VPR A;  2Z16 A;  4I76 A;  2M7A A;  2UXN A;  3K4J A;  2XAS A;  2QVO A;  5E3L A;  3QOP A;  3A01 A;  2KIM A;  3RDI A;  3JRA A;  5EZH A;  1WWX A;  2FD5 A;  4GXO A;  2BW3 B;  4ENN A;  2XAF A;  2NVT J;  2Z5U A;  1RNL A;  2XRO A;  2G9W A;  1FBU A;  4Y33 A;  2IGM A;  3W2V A;  3I0T A;  1R5H A;  2EIK H;  3MWM A;  4BE2 A;  3BTJ A;  2ISY A;  1YOV B;  2WBM A;  3BP8 A;  2VJ5 A;  2Y69 H;  1IF1 A;  3RPU A;  3CCL I;  1RI7 A;  1VQ6 I;  5LD2 C;  2R7V A;  2LH9 A;  2H94 A;  3OYD A;  2DOA A;  2Y2Z A;  5DUK A;  5KAF C;  1YJW I;  2R7Q A;  2E1M C;  4B1R A;  1XMA A;  2K3F A;  3KP4 A;  4M3D A;  3OV8 A;  4CCO A;  4ASN A;  3JSO A;  4ITV A;  2R7S A;  2CS3 A;  1A35 A;  4AID A;  4QIW N;  4HF0 A;  2XUB A;  2QKL B;  1WH5 A;  1R1V A;  3KEO A;  2OPT A;  4P96 A;  1P7J A;  1X19 A;  1MBF A;  1YS6 A;  3QOD A;  3CF5 F;  3Q3S A;  3QYB A;  4BJ5 C;  4F7Z A;  2ELK A;  3E5X A;  3FXO A;  2EV0 A;  2HZT A;  1GLN A;  5D5W B;  4PDK A;  1VTN C;  1GVD A;  4OMZ A;  3JRG A;  3D1N I;  2A07 F;  5EGO B;  5E1W A;  3CLO A;  4HX8 A;  2H6C A;  1FYK A;  2LVS A;  3IWZ A;  3CUQ A;  4ZH4 F;  4IQJ A;  3GME A;  3TGN A;  2DA2 A;  3F8C A;  1VQ4 I;  4HDU A;  3VDX A;  4PGH A;  4R8H A;  2BY2 A;  4Y15 A;  2ID6 A;  1GXP A;  3GLL A;  3LSM A;  1UEL B;  2VXZ A;  3S2H J;  3FIW A;  3HPH A;  2DA1 A;  2RNG A;  2CRG A;  2JSC A;  4RB3 C;  2DMP A;  5DTD A;  1QHH D;  3GTQ J;  4HQE A;  3FXR A;  3OIP A;  3FBI B;  1RUO A;  3M7G A;  3DP7 A;  4FTH A;  4M6Y A;  3KZZ A;  4EJU A;  2PLY A;  4D5C A;  3CDI A;  2BHY A;  1DPU A;  4ESB A;  1EH8 A;  3J7Y J;  4IHY A;  3GZ5 A;  1TNS A;  1GHC A;  3OY9 A;  5IYB J;  2RN7 A;  1WJB A;  2JA5 J;  1B72 B;  3F9K A;  3Q0V A;  3TDU C;  3BT9 A;  4EAT A;  2X1D A;  2H1L A;  1ENH A;  1LDK B;  3PNY A;  4MFD A;  1R5G A;  1FT9 A;  3ECH A;  2HTS A;  1DDN A;  3GCM A;  3SQN A;  2DFH A;  3F23 A;  4PSX A;  2NS8 A;  4YFX F;  2V9K A;  2XAH A;  3BZ6 A;  4HLY A;  3BQY A;  2TCT A;  2E5N A;  3E97 A;  3PQJ A;  4RAG A;  2L4A A;  4IX7 A;  3KIO A;  1TLH B;  1VQ9 I;  4L5J A;  3HOT A;  2R7T A;  3SHF A;  3GTP J;  1K79 A;  2Y75 A;  2DA7 A;  2VON A;  1SMT A;  2CUF A;  2CMP A;  1UCR A;  3AG4 H;  2MD5 A;  3F6V A;  3R0A A;  3MAJ A;  1RKW A;  3T8T A;  2NOG A;  4C9Y A;  1WZ2 A;  1W36 D;  5GPC A;  1GT0 C;  1D5V A;  2XSJ C;  1H0M A;  4RLQ A;  1D0X A;  2VJI A;  3DU6 A;  1CQT A;  2KFD A;  5K7F A;  3ZGK A;  5CQG A;  4MQ9 F;  1O57 A;  3E7L A;  1ZRC A;  4RDU A;  1MMA A;  2X51 A;  1W1W E;  1J75 A;  2OBP A;  5KVR A;  3HUG A;  5KAI C;  4D7M A;  1H8A C;  3DKX A;  2IBD A;  2KT0 A;  1E3H A;  2IAI A;  3CZ6 A;  3KEQ A;  4DNC A;  2NS0 A;  2DO7 A;  1BOB A;  5KNL A;  3HOX J;  2CV1 A;  3K4M A;  1TQM A;  3BR5 A;  3VB2 A;  2IS2 A;  1MJB A;  1R7J A;  5J6X A;  3RI4 A;  3DBH B;  4CZC A;  2Y31 A;  2L9S A;  4AUX A;  1YW8 A;  3BZK A;  1QPM A;  5A2Q Z;  1CGP A;  3M1E A;  4M73 A;  1QGP A;  2A6E F;  3ERE D;  4BKX A;  3L2Q A;  3K0L A;  1TL8 A;  1XTA A;  2VN2 A;  2Q2E B;  2CW8 A;  4EM1 A;  1ZYR F;  4PCQ A;  1HQC A;  2FML A;  1LFB A;  2HOE A;  4HNV A;  5F6F A;  1B9N A;  1K61 A;  2DK8 A;  2YUS A;  4HLX A;  4YEL A;  4EQQ A;  3KP6 A;  1X4O A;  2R7O A;  4S0H B;  1NG6 A;  2LYC A;  4GGG A;  5GAD J;  3H3Z A;  2VT2 A;  1IW7 F;  5CPR B;  3BPV A;  1Z6R A;  5GTI C;  3REO A;  1ZRD A;  4IPA A;  2VOO A;  1S9H A;  1AA7 A;  2B7E A;  1YIJ I;  2ZME B;  4A3L J;  1KU2 A;  4FET A;  4S04 A;  2CQ7 A;  2PMZ N;  2L7K A;  4L9T A;  2EIN H;  5F64 A;  5IYC J;  3S1R J;  3SEQ A;  2BY1 A;  4BU2 A;  3DPU A;  3HYI A;  4YIF A;  1Q1H A;  2E35 A;  3KFW X;  3G1O A;  3HEF A;  1X3U A;  2NS7 A;  2OCC H;  4QSH A;  3BLY A;  1HC8 A;  4BGD A;  3V7C A;  3FMS A;  2VQH A;  3JRF A;  1DP3 A;  2WY8 Q;  4E7Z A;  3GEZ A;  1UHM A;  2HDD A;  2RAE A;  1YW7 A;  3BPX A;  2HYG D;  3D5L A;  3EYI A;  5HDN A;  1XD7 A;  4U0W A;  1MND A;  3H5A A;  1HXD A;  1FSH A;  2JVG A;  1D3Y A;  1KU9 A;  4KYW A;  4H0E A;  4A3E J;  3VEP A;  1V54 H;  1PYV A;  5BQT A;  3BR6 A;  1W7P A;  3I5U A;  5F27 A;  5E79 C;  2VE9 A;  2DOE A;  2YU3 A;  1HCR A;  2PJR B;  4M3G A;  2FSW A;  5FGM A;  3SFI A;  2VBW A;  3J7Z I;  1VZ0 A;  4YFK F;  2W7N A;  3IV5 A;  2OZ6 A;  3TW7 A;  3ZQF A;  4BHC A;  1SMY F;  2DJI A;  3HOS A;  3VYU B;  5L3F A;  2EH3 A;  4HDV A;  1R1U A;  2DK5 A;  4ZDP A;  2MH2 A;  1REP C;  3OS0 A;  2XDV A;  1U0J A;  3BRO A;  2QGU A;  3CUQ C;  5FRM A;  1BI3 A;  3IUO A;  5D6E A;  5L3D A;  3ML6 A;  4C2U A;  4LG0 B;  2DBB A;  1U2W A;  2LF8 A;  1ETY A;  2V6E A;  5A2Q K;  1WJE A;  1OPC A;  4KN7 X;  3L2V A;  4CCJ A;  3CCQ I;  1KU7 A;  2P5K A;  1NK3 P;  4FE4 A;  2V1U A;  5L3E A;  2EA2 A;  1N75 A;  2K9L A;  3UR3 C;  3GX4 X;  2DXI A;  1YW9 A;  2R7D A;  4DZP A;  2F5E A;  2X6Y A;  4ENJ A;  3OWT A;  1WVR A;  3K6G A;  4L0Y B;  1EH7 A;  4B3X A;  4CSW A;  2L3D A;  4I0B A;  1YFH A;  1OJL A;  2E5Z A;  1Z91 A;  2DQL A;  2ZSH B;  3ABL H;  2VJJ A;  5L3B A;  3J81 Z;  2PMU A;  4B3A A;  1WJD A;  2HDC A;  3ZMZ A;  4PJL A;  1R5I D;  4RAF A;  1I3Q J;  2EZH A;  1FP1 D;  3HHG A;  1LB2 A;  2CV0 A;  2EQR A;  1FMW A;  1DU0 A;  1XDS A;  2EV5 A;  2XAU A;  1JUP A;  2COM A;  1UMQ A;  1HKT A;  2FEZ A;  3AG1 H;  5JFR A;  3MVP A;  5LHH A;  5BNG A;  4KNY A;  4LFU A;  4Y52 J;  2QUF A;  4ABZ A;  4WK8 F;  3M9A A;  4BE1 A;  2CWE A;  4PZJ A;  1J5Y A;  2E36 A;  1S8N A;  3BQZ A;  2BW3 A;  2ZXH A;  4P1W A;  2NNN A;  3I9V 2;  3E6C C;  5BPI A;  3VWB A;  2MD0 A;  2MFZ A;  2QCO A;  4LLL A;  3PIP F;  4B4C A;  3G4S I;  1IDZ A;  2X85 A;  1ODD A;  2F4O B;  1SD7 A;  5B3S H;  3RQ4 A;  1R58 A;  4FX0 A;  1FTZ A;  3W2W A;  2LKS A;  3PJR A;  2EZL A;  3OYA A;  5M3F J;  4HAM A;  4PGG A;  4PSW A;  2XGX A;  5H6R A;  1QZE A;  1VQL I;  3IRR A;  1VQO I;  1IN5 A;  3DCF A;  1N78 A;  1I27 A;  1V5G A;  2JK3 A;  4CH7 A;  5FLX K;  3L9F A;  2B63 J;  2DJN A;  2HTJ A;  2JPB A;  2XIG A;  2HVS A;  3QQA A;  4UUT A;  3OYM A;  3G1L A;  4U7B A;  3E5U A;  4Z6Y A;  2JMW A;  1WQ2 A;  3JRB A;  4WX9 A;  2HXO A;  2V9V A;  4QLC U;  3S3M A;  2V9P A;  1AU7 A;  5E8G A;  4LB5 A;  1OYW A;  2DOF A;  4XLC A;  3MKZ A;  3DLL F;  3ASO H;  3K70 D;  2VE8 A;  1ZAR A;  3LA7 A;  2V26 A;  3JAM K;  1BW6 A;  1JGG A;  2P7V B;  2LRD A;  4Q4Z F;  5IP9 J;  1GV2 A;  3OIO A;  4X0G A;  2NYX A;  3U9G A;  4F93 B;  1MSE C;  4ON0 A;  2R0Q C;  2XF5 A;  3ISP A;  1U5T B;  3P9C A;  1Z6T A;  3FK7 A;  3QU6 A;  3FKJ A;  3R60 A;  3W6V A;  2FNA A;  3B6C A;  2GLO A;  2H09 A;  2CO5 A;  2WV1 A;  5J47 A;  2HPI A;  2VQL A;  4EJW A;  1FMV A;  4HOB A;  4XN0 A;  5F0H A;  3KP7 A;  3HGY A;  5FRN A;  3B73 A;  3DBR B;  1ZG3 A;  5EEH A;  1TZL A;  3HSF A;  5DCM B;  1W0U A;  3BZC A;  3CCU I;  5EEA A;  4G7Z F;  5HLT A;  4DW6 A;  2HU9 A;  3A2K A;  2ELJ A;  2M3A A;  4EJV A;  5K7Z A;  2CH0 A;  4L5I A;  1VQ7 I;  1S7E A;  5CVR A;  2PX9 A;  4FX4 A;  1PJR A;  3OIQ A;  2G7H A;  2VBY A;  3CF2 A;  3ABU A;  1GUU A;  3OMY A;  3BG3 A;  1W4M A;  4GRI A;  1WFX A;  1TW3 A;  5ICG A;  2TRT A;  1B8I B;  4CIC A;  2LOO A;  3COA C;  2HOT A;  3MKW B;  3LMM A;  4A12 A;  1IXR C;  1F9N A;  5M5W J;  3OSF A;  3JRC A;  1JXS A;  1LVK A;  2E19 A;  2EV6 A;  2OUM A;  2KIU A;  1O3S A;  1R71 A;  3HRM A;  1FSE A;  3S1M J;  4XOR A;  4U88 A;  3CQZ J;  1OMI A;  2MGQ A;  3WG9 A;  1RKT A;  2WA0 A;  2A69 F;  5D5X B;  3I56 I;  2LMD A;  1MJA A;  5IP7 J;  3TOB A;  1MDM A;  3RKQ A;  1ULY A;  4ZYD A;  3HRU A;  4D1Q A;  2ME6 A;  3VFZ A;  1Y0N A;  3RJP A;  2RQP A;  2GZW A;  3FXJ A;  1D5Y A;  3GTK J;  1V55 H;  4E7S A;  4EGZ A;  3M07 A;  1WH7 A;  4N4O B;  1QRY A;  2A5Y B;  2KQR A;  2E1N A;  3JW4 A;  2V1N A;  4BXU A;  4UVA A;  2KJB A;  1H9G A;  2GIZ A;  2EIM H;  4UB8 C;  1EF4 A;  3AKZ A;  4NDL A;  2OQR A;  4GYG A;  2F6C A;  2V7F A;  3WTZ A;  1HF0 A;  1VQK I;  3QAH A;  4FQG A;  3LAP A;  3WGI A;  2R7U A;  3CDL A;  4UUV A;  3JR9 A;  2R5Z A;  1JTX A;  3NRV A;  1FOK A;  2R7W A;  2MG4 A;  2ZXI A;  5CVI A;  4WXH A;  3EYY A;  1UZC A;  3QWL A;  3I4M J;  1HW1 A;  1UG0 A;  1SFK A;  1P9Q C;  3WG7 H;  3BR1 A;  2E60 A;  4XLP F;  3PFI A;  1BBY A;  2LKX A;  3RZD J;  2K40 A;  4IHV A;  4IHT A;  5GP9 A;  4M3B A;  5HS9 A;  3V8L A;  4RAZ A;  1YYV A;  2L4M A;  5DEQ A;  3OR2 C;  2K9N A;  1QO0 D;  1WJA A;  4HQM A;  5FLV A;  2AXT C;  2XAQ A;  2EFP A;  4B48 A;  1XDU A;  2FJ1 A;  2NXN B;  4MGR A;  5AIP A;  5HDK A;  4KIG A;  2QEN A;  2DCE A;  3O3K A;  3HRT A;  2CFO A;  2Z9O A;  3N05 A;  2JTV A;  4DBQ A;  4IRI A;  2JA6 J;  3LAJ A;  1SFE A;  3RPQ A;  5JLW A;  3HHH A;  1YS7 A;  3E6B A;  4ZYH A;  4BXX J;  5J3L A;  3S2W A;  1BIB A;  2ETH A;  4TV7 A;  1VQN I;  1FOX A;  1QBJ A;  1WI3 A;  2A61 A;  2ESH A;  3CDH A;  4LIU A;  1OR7 A;  1LDD A;  5EDN A;  3H0D A;  3C3W A;  3HZJ A;  4PUS A;  2XF7 A;  3RKW A;  5LEJ A;  3OYC A;  5KCM A;  1XGS A;  4C2M J;  2R93 J;  3VYR B;  1FLI A;  2EK5 A;  3C18 A;  4XN3 A;  4CCN A;  1G4D A;  3K4N A;  2BEO A;  1LPQ A;  1IGN A;  1T0F A;  2M9H A;  3KYD B;  1XS9 A;  1SFO J;  2OC6 A;  3KYL A;  3WE3 A;  4I6Z A;  1MBJ A;  5EJC A;  5DD4 A;  2G7U A;  3GFL A;  5D5V B;  4F3Q A;  3V42 A;  2PMZ A;  3KE2 A;  3PSF A;  1SAN A;  2RV8 A;  2L5Q A;  4AYB N;  4N9H A;  3IAS 2;  4M9X A;  4M3F A;  1MMN A;  2VKH A;  1FIA A;  1YHQ I;  3KEY A;  2OJE D;  3KZI C;  4A2U A;  2K85 A;  2IA2 A;  3SEZ A;  3U21 A;  5E18 F;  3AAF A;  1K4T A;  4LG0 A;  2FXA A;  4DJA A;  2ME0 A;  1D0Z A;  2XPW A;  3VOD A;  2ZXW H;  3CES A;  4JX4 A;  4GO1 A;  1WRJ A;  1TT5 B;  2KL4 A;  2JA8 J;  3FHZ A;  3AL0 B;  4ESF A;  2K5C A;  3ABK H;  4WF2 A;  3KZY A;  1R23 A;  2Z33 A;  3TP3 A;  2VOP A;  4AVZ A;  3WTW C;  2IW5 A;  2NVU B;  1G3Y A;  3LOC A;  1YTY A;  1TQP A;  3GWZ A;  4E4H A;  4HX7 A;  1ON1 A;  1MMS A;  2D1V A;  4UB6 C;  1R9T J;  1LE8 B;  3CJT B;  4OIR F;  1K78 A;  2W84 A;  1I50 J;  2VBZ A;  4E7K A;  4IHS A;  3HSR A;  4Y3O A;  4XLN F;  3U2R A;  5TJJ A;  2MBF A;  3EUK L;  4F91 B;  5J40 A;  2L9V A;  4OOI A;  1OCP A;  3BJA A;  3N97 A;  2M1B A;  4X1E A;  1G6N A;  1ZRF A;  2GBY A;  5M5X J;  1TBX A;  2VPL A;  4QPO A;  4XBF A;  3GTJ J;  4IVN A;  1RZ4 A;  2PQ8 A;  4UVC A;  1TWA J;  3KP3 A;  3OOU A;  5M3M J;  2EB7 A;  5LRS A;  3J7A Y;  4RGX A;  2Y48 A;  2GXA A;  3DEU A;  2LSO A;  1R22 A;  5B5E C;  2JQ7 A;  2STW A;  4DBR A;  4IXA A;  4ZYE A;  1BI2 A;  3V8J A;  4ZJZ A;  4A3B J;  2HI3 A;  2ID3 A;  3WTU C;  4ZTF A;  3UNG C;  2ZC2 A;  3AFH A;  2L7Z A;  5DM7 F;  1UAA A;  4NUB A;  3C2H A;  3BJO A;  2DFF A;  3KP5 A;  2LRE A;  4D5F A;  2ZKZ A;  1T56 A;  3HOY J;  2X6X A;  4I7H A;  2BY0 A;  2VKD A;  2WAD A;  3CP2 A;  4DIQ A;  1U78 A;  1S29 A;  5GAE J;  1RUN A;  1B4A A;  2KPM A;  1MBK A;  2HKO A;  2DA4 A;  4S05 A;  2R5Y A;  4EJT A;  1A6Q A;  2E2H J;  1BR1 A;  2LG4 A;  1XGN A;  2M8E A;  2IGN A;  2OAZ A;  2P6S A;  3TDZ C;  3TOA A;  1ACI A;  3G1M A;  3MN2 A;  2EWN A;  2K86 A;  4BL0 B;  3H35 A;  2H8R A;  4FHT A;  5ILU A;  1ONV A;  4BY7 J;  4DYC A;  2KZG A;  3HOW J;  4PK4 A;  5HOD A;  2XKP A;  2HOS A;  2FQ4 A;  3HC7 A;  2Y0M A;  4A0Z A;  3BR2 A;  4Y13 A;  1IDY A;  2OV7 A;  3M3Y J;  4UY8 I;  1RC9 A;  3D0S A;  3RYP A;  2C6Y A;  2XB0 X;  3OYJ A;  5F0F A;  4CHU A;  4EGY A;  4CGZ A;  3CO7 C;  3BG5 A;  4XID A;  4AD9 A;  4JX5 A;  2R7R A;  3I59 B;  1NK2 P;  1YO5 C;  4HPQ A;  3IH4 A;  4BBR J;  1ZH5 A;  2KKO A;  4GYI A;  5DYM A;  3QPS A;  3HKZ N;  2LY1 A;  1TQI A;  1GV5 A;  4I99 C;  5BPD A;  4ANJ A;  1EKE A;  3SZT A;  2F48 A;  2K7L A;  3ZQI A;  2D45 A;  4MEX F;  5AON A;  3S3O A;  1D1C A;  2UV1 A;  4AM3 A;  3IKT A;  2VAS A;  1EV7 A;  1G8X A;  1XSX A;  1USS A;  3LFK A;  1NG7 A;  1YJN I;  1PP8 F;  4E7H A;  1YIO A;  5LHI A;  4Z2Y A;  1OCZ H;  4AWX B;  1Y56 A;  4K2E A;  2MAB A;  5IOZ A;  1FYM A;  1IRX A;  4C3J J;  1JT6 A;  4BDZ A;  1ZR4 A;  2CQX A;  2EA4 A;  3SZG A;  2IGO A;  3HIF A;  4WXD A;  2GA1 A;  3K1M A;  2P6T A;  1KQ8 A;  1Y6I A;  4RM2 A;  1QVT A;  5L3G A;  5B1A H;  1FP2 A;  5JLX A;  2OQG A;  2KP6 A;  2UUZ A;  1XB4 A;  4D7N A;  5JI6 A;  1MNE A;  2H8W A;  2LNB A;  3LSH A;  4DYQ A;  4Q47 A;  1NHA A;  2FRH A;  1E0E A;  5DV5 A;  4Y7N J;  1JE8 A;  2KIQ A;  2FE3 A;  2O6G E;  1PUF B;  2JA2 A;  3W3C A;  3C7J A;  5K1Y A;  4EV0 A;  4KFC A;  3K1P A;  3WGG A;  2A68 F;  3I58 A;  4XKB A;  2DT7 B;  3FF5 A;  2VQC A;  3PUF A;  2XGD A;  4W97 A;  1ETK A;  1IG7 A;  3V7S A;  3O8H A;  5HLI A;  4BNC A;  1E17 A;  2OZU A;  5K7H A;  4JBA A;  1UHS A;  4EJO A;  1MSF C;  2DMQ A;  3U1D A;  4UVB A;  4ETS A;  2KRC A;  2GAU A;  1FYL A;  3J7A O;  1LNW A;  4A6D A;  2L2O A;  4BHB A;  4RA2 A;  4X6A J;  2MSY A;  4OAY A;  1J7K A;  5J8F A;  1SEU A;  1OR7 C;  4XON A;  3LA3 A;  2NOJ B;  2QZ8 A;  3OYB A;  2FBH A;  2IPQ X;  3F22 A;  1E2X A;  1H88 C;  2B9S A;  3OYL A;  1KQ9 A;  2QWW A;  3F0C A;  4UHT A;  1X1P A;  2JJ7 A;  3F72 A;  4BEH A;  1MH4 A;  2FBK A;  2ADU A;  1FJL A;  1T0F C;  2M7B A;  3BTI A;  2WB1 N;  1A6I A;  2EPF A;  1IC8 A;  2EJR A;  3HDD A;  1A31 A;  5IOY A;  4HW0 A;  3L2C A;  1J2X A;  2HNH A;  5ERI A;  3CCM I;  4XOP A;  1JT0 A;  1LFP A;  2A5W A;  4L9J A;  2KIS A;  4B44 A;  2KDZ A;  2Z99 A;  3DPL C;  5C3E J;  3DQV C;  3QPH A;  2W25 A;  2D1H A;  1FC3 A;  3QP6 A;  3PNV A;  5ICF A;  1YQA A;  3NAU A;  5E3M A;  3Q9S A;  3CC4 I;  1HOM A;  3GFM A;  1B6A A;  3S16 J;  1TW2 A;  5CVU A;  3GVA A;  5TIS C;  2ZCW A;  4CYC A;  3GTO J;  3LSR A;  2DA3 A;  1QPI A;  1U3E M;  4G6D A;  1D0Y A;  3FK6 A;  3OYE A;  2IP2 A;  1G3T A;  1LEB A;  3R61 A;  5HLG A;  2AHQ A;  4KIC A;  4A0Y A;  4L9N A;  2OU2 A;  3K69 A;  1ZAO A;  4BY1 J;  4A93 J;  3C2G A;  1MNM C;  2LK2 A;  3I55 I;  2A05 A;  4BQN A;  1SD5 A;  4WXC A;  2V1X A;  1MD0 A;  3CO6 C;  1SFU A;  2ZXJ A;  4QPQ A;  3HJE A;  2LLK A;  3CMM A;  3GTL J;  4HBL A;  3OYI A;  3WU1 B;  2EFN A;  1IN8 A;  4M6X A;  5E1X A;  3J80 K;  2KZV A;  3NWS A;  2GA2 A;  4RB1 A;  4KJZ A;  2RVC A;  1HKQ A;  1D1B A;  1OFC X;  2P4W A;  1LFU P;  1IXC A;  1OYY A;  2KHM A;  1BL0 A;  3ZMD A;  1ZG1 A;  1FOW A;  5FLX Z;  2DLL A;  5J1R A;  2PEX A;  4M72 A;  3L2R A;  1UJ8 A;  1X1A A;  4HYE A;  2PFB A;  3H9G A;  2H1K A;  1R00 A;  1T39 A;  3FX3 A;  1Y1V J;  2XHK A;  4A0X A;  2O7O A;  4OU0 A;  4IF4 A;  1FEX A;  1U9N A;  1U8B A;  3DWL E;  3TMO A;  4XKC A;  3ESW B;  2DU9 A;  4HSR A;  1ERD A;  1P2F A;  2CFX A;  3DKW A;  1T6S A;  4BQO A;  3JAM Z;  3CCS I;  1TWG J;  4A69 C;  4DYR A;  1AKH B;  1ZR2 A;  2LBF B;  3FXM A;  4XLH A;  1OCT C;  4IZZ A;  5M5Y J;  1SAU A;  3ZMV A;  4HF1 A;  2EFO A;  2YX7 A;  4Q5S F;  2ESN A;  2CQN A;  5IYD J;  3PO2 J;  1S7A A;  4MLO A;  4ESJ A;  1RES A;  4IHW A;  3M4O J;  1F4K A;  1XGO A;  4XRF A;  5F0C A;  4G7O F;  2L7M P;  3I53 A;  4WCG A;  2HQN A;  2W85 A;  4PJM A;  1VQP I;  1F1Z A;  1UST A;  3ABT A;  5FD6 A;  1T8I A;  4V2F A;  2RRE A;  2HYJ A;  2K4J A;  4G7H F;  3CUO A;  4OMY A;  3H3U A;  5E3N A;  1XMX A;  2DAO A;  2W4S A;  5J8C A;  1SFX A;  3PL8 A;  1MMD A;  2KLO A;  2VKE A;  4CCM A;  1Z3Y A;  3A01 B;  3FIS A;  5F08 A;  2DYR H;  3GBG A;  5CJ9 A;  3BG6 A;  3L00 A;  1WGX A;  2L0K A;  3QP5 A;  1Y0U A;  3A03 A;  1O3T A;  2Z1D A;  3QPL A;  2DMT A;  5K5O A;  1S72 I;  3S3N A;  1O7F A;  3BDD A;  1TWF J;  3GZ6 A;  3Q0U A;  4A5M A;  5K5R A;  1T33 A;  1Z7U A;  1ZLJ A;  3WOD F;  2GM4 A;  3O6B B;  2O8K A;  1RRJ A;  1POG A;  1IUF A;  3H92 A;  2XGC A;  3TQN A;  5FJ8 J;  3G71 I;  4G12 A;  2KJC A;  2XB5 A;  4OIO F;  2DW4 A;  3BCA A;  2XRN A;  1OYI A;  3TKY A;  2KMU A;  4IQ4 A;  3EUH A;  4II2 A;  3TP0 A;  1XX5 A;  4GFB A;  3LSG A;  1XCV A;  4MIM A;  5LHG A;  2O61 A;  2IA1 A;  1R36 A;  5TRD A;  3L1P A;  2CW0 F;  5HS8 A;  3ABM H;  3I4N J;  1MBE A;  3CUQ B;  3FHN A;  1RR7 A;  3V4G A;  4BE0 A;  2MYS A;  3BR0 A;  1TC3 C;  5EGO A;  2WAQ A;  4ZDO A;  2HGC A;  3PFY A;  4D9J A;  2YU9 J;  3TW6 A;  3ZQQ A;  3PSI A;  3A02 A;  3EET A;  2LKP A;  4YRV A;  3CCR I;  2CU7 A;  2L9N A;  1A04 A;  2F4M B;  3BOQ A;  3FBN B;  2F5C A;  2I10 A;  1XCB A;  4JX6 A;  1U6G A;  1HSJ A;  3VPR A;  2E34 A;  4MTE A;  2QSF X;  3AG3 H;  1K4S A;  4NNJ A;  3WTS C;  2ECB A;  4CYD A;  3L09 A;  5DM6 F;  4NC8 A;  2L01 A;  2Y30 A;  3QOE A;  3GF2 A;  1D8K A;  2GWR A;  4BJ6 C;  4P9U A;  3RPU D;  3OL4 A;  1RIO H;  1FPQ A;  4FIS A;  3R6S A;  3VOE A;  1SC7 A;  1K7A A;  4HG2 A;  5LGU A;  1VF9 A;  4OAZ A;  3I59 A;  1SD4 A;  1HDP A;  5L3C A;  5ILV A;  1B72 A;  1TT0 A;  4J00 A;  1KON A;  1XG1 A;  3CD6 I;  4I98 B;  1Z9C A;  3TO9 A;  3DEE A;  1KU3 A;  4EEF G;  2ISZ A;  1IXS B;  1IV8 A;  4YIR X;  2B0L A;  4NQW B;  4C3I J;  2QQA A;  5FFZ A;  3ECO A;  3F6O A;  3VYS B;  4KN4 X;  4YFN F;  5F04 A;  3MZH A;  5J1U A;  2W48 A;  1F5T A;  2WAF A;  3K1N A;  3FMR A;  2M0M A;  4XQF A;  2GOM A;  1QA6 A;  2P5L C;  1WPK A;  3DTK A;  4V2G A;  5LGN A;  2HQR A;  2VUM J;  1I1G A;  1PUF A;  2AO9 A;  2VT3 A;  4A3D J;  1UG2 A;  5AIQ A;  1T95 A;  5D5U B;  3DTE A;  3E5Q A;  3CCJ I;  4E7I A;  2V1D A;  4JQF A;  3W6J B;  3ZQC A;  1BOA A;  5EF6 A;  1T38 A;  1BA5 A;  3NEU A;  1XGM A;  5HNF A;  4ZYA A;  4O6J A;  5IT9 Z;  3QYF A;  2JUC A;  5D6F A;  1SAX A;  4LIT A;  1J59 A;  5HDG A;  5DCF A;  2XAG A;  1XSV A;  1FZP B;  2WWY A;  1XMK A;  2VC1 A;  3N4M A;  4OIP F;  2M45 A;  4G94 A;  2TDX A;  3HGG A;  3WU0 A;  3HOZ J;  4BBS J;  3H5R A;  3MKL A;  4R79 A;  2XPU A;  3A0H C;  1BI0 A;  1X2N A;  1Z67 A;  5BOX A;  1YRN B;  1YX5 A;  2CYY A;  2Q2E A;  5ED4 A;  5ICC A;  1WHU A;  2ICW G;  1MKM A;  3KP2 A;  3IP4 B;  4AVP A;  4RLF A;  1NTC A;  2X1E A;  2IT0 A;  3K2A A;  1HDD C;  3S1N J;  1KA8 A;  2CGP A;  3GO5 A;  3H36 A;  4M6V A;  1MIJ A;  4HEA 2;  1DP7 P;  3HTS B;  4MO7 A;  1OCO H;  2JT1 A;  1FBS A;  2X6O A;  3K10 A;  5HLH A;  1FWZ A;  2MH9 A;  2MW8 A;  4OWR B;  1DU6 A;  2DOD A;  2X1C A;  4LK1 F;  3K7A J;  3T1B A;  4RB2 C;  2OTL I;  2BGC A;  2WTE A;  2LY2 A;  2ZME A;  2LTP A;  2HVR A;  4A6E A;  5H2F C;  2RDP A;  2V4J C;  2VLA A;  3BR3 A;  1B9M A;  1I5Z A;  2DN0 A;  3DF8 A;  4KMF A;  4BHP A;  4YG2 F;  2QBY B;  1Y8R B;  3WE2 A;  3OL3 A;  4LK0 F;  4KIT B;  5ILS A;  2BHZ A;  4HST A;  3JSP A;  3SJM A;  4C2T A;  3ZP5 A;  2BVM A;  3OR1 C;  1O7L A;  3TL4 X;  5GAG J;  1LVA A;  3DTI A;  3LSI A;  3PNT A;  5FKO A;  2ZJQ F;  3DV8 A;  1DGW Y;  4BUP A;  4RM3 A;  5GTH C;  4E7L A;  3E3V A;  3PM1 A;  4IOC F;  1R6R A;  2VKV A;  4G6T B;  4XNF A;  2LY9 A; 
#chains in the Genus database with same CATH homology
 3I71 A;  1W7P B;  4JK1 X;  2PG4 A;  3F8M A;  4B8X A;  3O2P E;  5CYV A;  5IT3 A;  4CZZ A;  1V3F A;  2IA0 A;  2M87 A;  3E6D A;  2AXL A;  1BM9 A;  1STZ A;  4YII A;  1U8R A;  4MHG A;  2FBI A;  2XV4 S;  2JZY A;  1BC7 C;  4IJA A;  5IT9 K;  1QZY A;  3V7R A;  1LDJ A;  5BMZ A;  4MEY F;  3FZV A;  4UV9 A;  2FF4 A;  3WTY C;  1K6O A;  3QU3 A;  3GYH X;  1O3R A;  4L18 B;  2IVM A;  4NHJ A;  2VC0 A;  3T5X A;  2KIF A;  4Y17 A;  3F21 A;  3BY6 A;  3SFZ A;  3ZN0 A;  2QYO A;  4P9F A;  4RGU A;  5E8I A;  4AIK A;  2GIV A;  1IRF A;  3HSE A;  4AIH A;  4ZZD A;  2ZNY A;  3IRQ A;  1W7P D;  4LMY A;  3LQQ A;  1YG2 A;  2HFH A;  3RKY A;  4M9S A;  5H6Q A;  2ELH A;  4LLG F;  2DFI A;  4EM0 B;  4CXF A;  1HW5 A;  1Z05 A;  3FXQ A;  1P4A A;  3F3X A;  3OOP A;  3BWG A;  2E1C A;  3MEX A;  4KT5 C;  1IN4 A;  3SZP A;  3T0Y A;  1IN6 A;  1SD6 A;  2BYV E;  2STT A;  3ULQ B;  1C0W A;  2UWM A;  1UHW A;  2O03 A;  2OD5 A;  2Z3Y A;  3G3Z A;  3IHU A;  4M71 A;  5H20 A;  3ZMS A;  1BJA A;  2Q0O A;  5E20 A;  2VBX A;  5LLQ A;  6PAX A;  4LB6 B;  1MZB A;  2CG4 A;  4MTD A;  4U7D A;  3ZMT A;  1Z1D A;  2DQR A;  4R1H A;  3MZY A;  2X0L A;  1OKR A;  1W5S A;  1O3Q A;  1CF7 B;  3RTR A;  3GW2 A;  1AWC A;  3GLX A;  1U5T A;  3ZN1 A;  3JTH A;  2L02 A;  2DTR A;  2D2W A;  3J80 Z;  2NRA C;  4RGS A;  1G3S A;  3HTU A;  5DCM A;  2H27 A;  4ZZL A;  1LJ9 A;  2UZK A;  1KYZ A;  4EM2 A;  5JHU A;  4NQW A;  2DT5 A;  1P4X A;  3KET A;  5ICE A;  1ON2 A;  4XSX F;  2F2E A;  2JRT A;  3DPT A;  3BJ6 A;  1DUX C;  5E17 F;  4ENM A;  3GFJ A;  2YX4 A;  2F5D A;  3LA2 A;  5CLS A;  1MDM B;  1S3J A;  1HST A;  2RKH A;  2LF7 A;  3GUD A;  1T2K A;  2A6H F;  3NQO A;  4G6Q A;  4RAY A;  4ENK A;  1MGT A;  4M74 A;  3L7W A;  2O3F A;  1XSD A;  1KYW A;  1ZN2 A;  4I09 A;  5JVT A;  2QQB A;  2Q8K A;  1I6X A;  4O5V A;  3TO6 A;  4I2O A;  3PQK A;  2K02 A;  4RS8 A;  3WTV C;  2HKX A;  2HYF A;  2VOD A;  2BE5 F;  2F5F A;  4FT8 A;  3IKV A;  4CDG A;  1JHF A;  4AIJ A;  4QWQ A;  1ZGA A;  5FFX A;  4LLN A;  1MJ9 A;  2MLG A;  2FMY A;  1GVJ A;  2IJL A;  1JGS A;  4OIQ F;  1B59 A;  2FOK A;  2BV6 A;  2HR3 A;  2ZNZ A;  3CTA A;  2HWV A;  3MFK A;  1P6R A;  2QBY A;  4D0P A;  1L0O C;  4E70 A;  2R3S A;  4MQV A;  3QPT A;  3JTG A;  3M8F A;  5LBQ A;  2XAJ A;  4Q48 A;  5FB2 A;  4KUM A;  3TO7 A;  4BAY A;  3LQR A;  2YSR A;  4LGW A;  2ZO4 A;  4L9V A;  1ZHF A;  4N0B A;  2XKO A;  4KIB A;  2A3S A;  1KQ0 A;  5BS6 A;  2XVC A;  2W24 A;  2PI0 A;  2P5V A;  1WSU A;  2OA4 A;  2LDU A;  4WWC A;  4KIF A;  5EEG A;  2NAZ A;  3G73 A;  4XSZ F;  5FO5 A;  3DFG A;  4GCV A;  2X4H A;  1TNT A;  1IAW A;  3Q5F A;  4EVI A;  2HEO A;  2UXX A;  2ACJ A;  1TTY A;  3IL2 A;  1JHH A;  4DQ2 A;  5HVQ C;  1PP7 U;  5E1Z B;  1KGS A;  2E7W A;  1UFM A;  1P92 A;  3M8E A;  3ROU A;  5D4S A;  3EQL F;  1BN5 A;  4HX4 A;  1K78 B;  3FMQ A;  1U5T C;  4O3M A;  2J5O A;  1EH6 A;  1S6L A;  2M5W A;  3C1D A;  4CO8 A;  3T8R A;  3RKX A;  3V8K A;  5D8L B;  5FD5 A;  2E7X A;  2CQK A;  4P5O A;  1ZRE A;  4BH9 A;  4G8X A;  4ZYG A;  3R0J A;  1DPR A;  1PUE E;  4I01 A;  4BQA A;  1IN7 A;  1BC8 C;  2QQ9 A;  2PJP A;  1UB9 A;  3MQ0 A;  2M30 A;  4LJZ F;  4M9Z A;  4L0Z B;  2V79 A;  1B1B A;  2WV0 A;  4UXN A;  3SXY A;  3R4K A;  1GXQ A;  2JPC A;  5CVJ A;  1H9T A;  4N9I A;  1T98 A;  4BYY A;  1L3L A;  4HA8 A;  2PN6 A;  3ZMU A;  3HRS A;  2P8T A;  4HZF A;  5D8K B;  2V6C A;  3ZQ7 A;  3KLN A;  2GXB A;  1IUY A;  1HKS A;  2GQQ A;  2MC3 A;  1V4R A;  1D8J A;  3I64 A;  2ZFW A;  3CJN A;  3I4P A;  3P7N A;  3RYR A;  2RGV A;  5CVV A;  2NNY A;  3IWF A;  1HW2 A;  1CF7 A;  3K9T A;  1LQ1 A;  3RIR A;  3J81 K;  4KMU X;  2MA3 A;  1BIA A;  5DDG A;  3KCC A;  4A5N A;  4LD5 A;  4UV8 A;  1G3W A;  4I02 A;  1FX7 A;  2K27 A;  1BI1 A;  3MCZ A;  2IRF G;  2CSO A;  2K4B A;  4UNO A;  3FWE A;  3W6K B;  3F8N A;  1AOY A;  4MNU A;  1J9I A;  1FNN A;  3KLO A;  4I0A A;  2YR2 A;  4B09 A;  4RB0 A;  2WC2 A;  1ZG5 A;  3GFI A;  2DPD A;  3LWF A;  1YLF A;  1S7O A;  3P9K A;  4IRG A;  2EFQ A;  3F8F A;  5D4R A;  4G9Y A;  2QLZ A;  5K5Q A;  5KK1 A;  2O8X A;  2RNJ A;  1WI9 A;  1XN7 A;  1WKM A;  3I54 A;  1QQI A;  4RGR A;  2MLK A;  2W57 A;  3QRF F;  2DI3 A;  1LEA A;  4KA4 A;  5DUI A;  4NB5 A;  5LRR A;  3FXU A;  2EFW A;  5DD8 A;  2QM3 A;  5JR3 A;  2O0Y A;  2AS5 F;  2R7F A;  1P4W A;  5HS7 A;  3WGH A;  1QZZ A;  3FM5 A;  4U0V A;  2KRF A;  2BBY A;  3IC7 A;  4P55 A;  3EDP A;  2L54 A;  5LGT A;  4HV5 A;  1J0R A;  2GXG A;  3GXO A;  3LST A;  1HBX G;  2RC4 A;  3P9I A;  2YPR A;  4OIN F;  1ZGJ A;  4IRH A;  3F8B A;  3DXJ F;  2FA5 A;  1W5T A;  2FQ3 A;  3WTX C;  3B02 A;  3E6M A;  1FY7 A;  2J5P A;  4HF2 A;  2PBI A;  1I1S A;  3WTT C;  2P7C B;  2HS5 A;  4EMS A;  4HV6 A;  2ZJ2 A;  1QNT A;  3K2Z A;  3ELK A;  2FU4 A;  2FNP A;  4U0Y A;  2H6B A;  2PMH A;  1IZ1 A;  3FM3 A;  3Q9V A;  5F1R A;  3ZPL A;  1ZLK A;  2DPU A;  4KDP A;  1IRG A;  1PDN C;  2ZBK A;  1R1T A;  5LEK A;  1FBQ A;  2UXN A;  2XAS A;  2QVO A;  3QOP A;  2KIM A;  3RDI A;  1WWX A;  4ENN A;  4GXO A;  2XAF A;  2Z5U A;  1RNL A;  2XRO A;  2G9W A;  1FBU A;  3I0T A;  1R5H A;  3MWM A;  2ISY A;  3BP8 A;  1IF1 A;  3RPU A;  1RI7 A;  2H94 A;  5DUK A;  1XMA A;  3KP4 A;  3OV8 A;  4ASN A;  3JSO A;  4HF0 A;  2XUB A;  1R1V A;  3KEO A;  4P96 A;  1YS6 A;  4F7Z A;  3E5X A;  5D5W B;  2EV0 A;  2HZT A;  4PDK A;  1VTN C;  4OMZ A;  2A07 F;  5E1W A;  3CLO A;  4HX8 A;  2H6C A;  1FYK A;  3IWZ A;  3CUQ A;  4ZH4 F;  3TGN A;  3F8C A;  4HDU A;  4PGH A;  4R8H A;  4Y15 A;  1GXP A;  2VXZ A;  2JSC A;  4RB3 C;  4HQE A;  3FXR A;  1RUO A;  3M7G A;  3DP7 A;  4M6Y A;  3KZZ A;  4EJU A;  2PLY A;  1DPU A;  4ESB A;  1EH8 A;  3GZ5 A;  1TNS A;  1GHC A;  2RN7 A;  3TDU C;  1LDK B;  1R5G A;  1FT9 A;  3ECH A;  2HTS A;  1DDN A;  3SQN A;  3F23 A;  4YFX F;  2XAH A;  3BZ6 A;  4HLY A;  3E97 A;  3PQJ A;  2L4A A;  1TLH B;  4L5J A;  3HOT A;  3SHF A;  1K79 A;  2Y75 A;  2VON A;  1SMT A;  1UCR A;  2MD5 A;  3F6V A;  3R0A A;  3MAJ A;  3T8T A;  1D5V A;  1H0M A;  4MQ9 F;  1O57 A;  1ZRC A;  1J75 A;  2OBP A;  5KVR A;  3HUG A;  3KEQ A;  4DNC A;  2NS0 A;  2DO7 A;  1TQM A;  3VB2 A;  1MJB A;  1R7J A;  5J6X A;  3RI4 A;  1YW8 A;  1QPM A;  5A2Q Z;  1CGP A;  3M1E A;  4M73 A;  1QGP A;  2A6E F;  3ERE D;  3K0L A;  2VN2 A;  4EM1 A;  1ZYR F;  4PCQ A;  1HQC A;  2FML A;  2HOE A;  5F6F A;  1B9N A;  2DK8 A;  4HLX A;  4EQQ A;  3KP6 A;  4GGG A;  3H3Z A;  2VT2 A;  1IW7 F;  3BPV A;  1Z6R A;  3REO A;  1ZRD A;  4IPA A;  2VOO A;  2ZME B;  1KU2 A;  4S04 A;  4L9T A;  5F64 A;  3HYI A;  4YIF A;  1Q1H A;  3KFW X;  1X3U A;  3V7C A;  3FMS A;  3GEZ A;  1UHM A;  1YW7 A;  3BPX A;  2HYG D;  3D5L A;  3EYI A;  5HDN A;  1XD7 A;  4U0W A;  1HXD A;  1FSH A;  1D3Y A;  1KU9 A;  4KYW A;  4H0E A;  3VEP A;  5BQT A;  1W7P A;  3I5U A;  2VE9 A;  2YU3 A;  2FSW A;  5FGM A;  2VBW A;  4YFK F;  2OZ6 A;  4BHC A;  3HOS A;  1SMY F;  5L3F A;  4HDV A;  1R1U A;  2DK5 A;  2MH2 A;  1REP C;  3BRO A;  3CUQ C;  1BI3 A;  5D6E A;  5L3D A;  3ML6 A;  4LG0 B;  2DBB A;  1U2W A;  2LF8 A;  5A2Q K;  1OPC A;  4KN7 X;  1KU7 A;  2P5K A;  2V1U A;  5L3E A;  2EA2 A;  3GX4 X;  1YW9 A;  2R7D A;  2F5E A;  4ENJ A;  4L0Y B;  1EH7 A;  2L3D A;  4I0B A;  1YFH A;  1Z91 A;  2DQL A;  5L3B A;  3J81 Z;  2PMU A;  2HDC A;  3ZMZ A;  1FP1 D;  3HHG A;  1LB2 A;  1XDS A;  2EV5 A;  2COM A;  1HKT A;  2FEZ A;  5JFR A;  5LHH A;  4KNY A;  4LFU A;  2QUF A;  4WK8 F;  3M9A A;  2CWE A;  4PZJ A;  1J5Y A;  1S8N A;  2NNN A;  3E6C C;  5BPI A;  4LLL A;  1ODD A;  1SD7 A;  1R58 A;  4FX0 A;  4HAM A;  4PGG A;  2XGX A;  5H6R A;  3IRR A;  1IN5 A;  1I27 A;  5FLX K;  3L9F A;  2HTJ A;  2JPB A;  2XIG A;  4U7B A;  3E5U A;  1WQ2 A;  4WX9 A;  4QLC U;  2V9V A;  5E8G A;  4LB5 A;  1OYW A;  2VE8 A;  1ZAR A;  3LA7 A;  3JAM K;  2P7V B;  4Q4Z F;  2NYX A;  3U9G A;  4ON0 A;  3ISP A;  1U5T B;  3P9C A;  1Z6T A;  3QU6 A;  3R60 A;  2FNA A;  2H09 A;  2CO5 A;  4EJW A;  4HOB A;  3KP7 A;  3B73 A;  1ZG3 A;  5EEH A;  3HSF A;  5DCM B;  4G7Z F;  4EJV A;  4L5I A;  5CVR A;  4FX4 A;  2G7H A;  2VBY A;  3ABU A;  1W4M A;  1TW3 A;  5ICG A;  4CIC A;  3COA C;  4A12 A;  1IXR C;  1F9N A;  1JXS A;  2EV6 A;  1O3S A;  2KIU A;  3HRM A;  1FSE A;  4U88 A;  1OMI A;  3WG9 A;  2A69 F;  5D5X B;  1MJA A;  3TOB A;  1MDM A;  1ULY A;  4ZYD A;  3HRU A;  3VFZ A;  3RJP A;  2RQP A;  2GZW A;  4EGZ A;  2A5Y B;  2E1N A;  3JW4 A;  4BXU A;  4UVA A;  2KJB A;  1H9G A;  2OQR A;  4GYG A;  3WTZ A;  3QAH A;  3LAP A;  3WGI A;  4UUV A;  3NRV A;  1FOK A;  5CVI A;  4WXH A;  3EYY A;  1HW1 A;  4XLP F;  3PFI A;  1BBY A;  4IHT A;  5HS9 A;  3V8L A;  4RAZ A;  1YYV A;  2L4M A;  5DEQ A;  1QO0 D;  4HQM A;  2XAQ A;  2EFP A;  1XDU A;  4MGR A;  5AIP A;  5HDK A;  4KIG A;  2QEN A;  3O3K A;  3HRT A;  2Z9O A;  2JTV A;  4IRI A;  3LAJ A;  1SFE A;  3RPQ A;  3HHH A;  4ZYH A;  1YS7 A;  3E6B A;  3S2W A;  1BIB A;  2ETH A;  4TV7 A;  1QBJ A;  2A61 A;  2ESH A;  3CDH A;  1OR7 A;  1LDD A;  3C3W A;  3RKW A;  5LEJ A;  1XGS A;  1FLI A;  2EK5 A;  3C18 A;  1G4D A;  2BEO A;  1T0F A;  3WE3 A;  5DD4 A;  2G7U A;  3GFL A;  5D5V B;  3KE2 A;  2RV8 A;  4N9H A;  4M9X A;  4A2U A;  2IA2 A;  5E18 F;  3AAF A;  4LG0 A;  2FXA A;  3VOD A;  4GO1 A;  1WRJ A;  3FHZ A;  4ESF A;  4WF2 A;  3KZY A;  1R23 A;  2Z33 A;  2VOP A;  3WTW C;  2IW5 A;  1G3Y A;  1YTY A;  1TQP A;  3GWZ A;  4HX7 A;  1ON1 A;  2D1V A;  4OIR F;  1K78 A;  2W84 A;  2VBZ A;  4IHS A;  3HSR A;  4XLN F;  3U2R A;  5TJJ A;  2MBF A;  4OOI A;  3BJA A;  3N97 A;  2M1B A;  1G6N A;  1ZRF A;  1TBX A;  4XBF A;  4IVN A;  1RZ4 A;  2PQ8 A;  4UVC A;  3KP3 A;  2EB7 A;  5LRS A;  4RGX A;  2Y48 A;  3DEU A;  2LSO A;  1R22 A;  2STW A;  4IXA A;  4ZYE A;  1BI2 A;  3V8J A;  3WTU C;  3BJO A;  3KP5 A;  2ZKZ A;  4I7H A;  1U78 A;  1S29 A;  1RUN A;  1B4A A;  2HKO A;  4S05 A;  4EJT A;  2M8E A;  1XGN A;  2P6S A;  3TDZ C;  2OAZ A;  3TOA A;  2EWN A;  2K86 A;  4FHT A;  5ILU A;  1ONV A;  2XKP A;  2Y0M A;  4A0Z A;  4Y13 A;  3D0S A;  3RYP A;  2C6Y A;  4CHU A;  4CGZ A;  4EGY A;  3CO7 C;  4AD9 A;  3I59 B;  1YO5 C;  1ZH5 A;  2KKO A;  4GYI A;  5DYM A;  1TQI A;  5BPD A;  3SZT A;  2K7L A;  2D45 A;  4MEX F;  5AON A;  3IKT A;  1PP8 F;  1EV7 A;  1XSX A;  1USS A;  3LFK A;  1YIO A;  5LHI A;  4Z2Y A;  4AWX B;  4K2E A;  1FYM A;  2EA4 A;  3HIF A;  4WXD A;  2GA1 A;  3K1M A;  2P6T A;  1KQ8 A;  5L3G A;  1FP2 A;  2OQG A;  1XB4 A;  5JI6 A;  2LNB A;  4Q47 A;  1NHA A;  2FRH A;  5DV5 A;  1JE8 A;  2O6G E;  2FE3 A;  3C7J A;  5K1Y A;  4EV0 A;  4KFC A;  3K1P A;  3WGG A;  2A68 F;  3I58 A;  3FF5 A;  3V7S A;  5HLI A;  4BNC A;  1E17 A;  2OZU A;  4JBA A;  4EJO A;  3U1D A;  4UVB A;  4ETS A;  2GAU A;  1FYL A;  3J7A O;  1LNW A;  4A6D A;  4BHB A;  1J7K A;  5J8F A;  3LA3 A;  2QZ8 A;  2FBH A;  2IPQ X;  3F22 A;  1E2X A;  1KQ9 A;  2QWW A;  4UHT A;  3F72 A;  2FBK A;  2ADU A;  2EJR A;  4HW0 A;  3L2C A;  1J2X A;  5ERI A;  4L9J A;  2Z99 A;  3DPL C;  3DQV C;  3QPH A;  2W25 A;  2D1H A;  1FC3 A;  3QP6 A;  5ICF A;  1YQA A;  3Q9S A;  3GFM A;  1B6A A;  1TW2 A;  5CVU A;  3GVA A;  2ZCW A;  1U3E M;  4G6D A;  2IP2 A;  1G3T A;  1LEB A;  3R61 A;  5HLG A;  4KIC A;  4A0Y A;  4L9N A;  2OU2 A;  3K69 A;  1ZAO A;  1SD5 A;  4WXC A;  2V1X A;  1MD0 A;  3CO6 C;  1SFU A;  2ZXJ A;  4HBL A;  3WU1 B;  2EFN A;  1IN8 A;  4M6X A;  5E1X A;  3J80 K;  2GA2 A;  4RB1 A;  2RVC A;  1HKQ A;  2P4W A;  1IXC A;  1OYY A;  3ZMD A;  1ZG1 A;  5FLX Z;  2DLL A;  2PEX A;  4M72 A;  4HYE A;  2PFB A;  1R00 A;  1T39 A;  3FX3 A;  2XHK A;  4A0X A;  4OU0 A;  4IF4 A;  2DU9 A;  1P2F A;  2CFX A;  3DKW A;  1T6S A;  3JAM Z;  3ZMV A;  4HF1 A;  2EFO A;  2YX7 A;  4Q5S F;  2ESN A;  1S7A A;  4ESJ A;  1F4K A;  1XGO A;  4XRF A;  4G7O F;  3I53 A;  4WCG A;  2HQN A;  2W85 A;  1F1Z A;  1UST A;  3ABT A;  5FD6 A;  2K4J A;  4G7H F;  3CUO A;  4OMY A;  3H3U A;  2DAO A;  5J8C A;  1SFX A;  5CJ9 A;  3L00 A;  3QP5 A;  1Y0U A;  1O3T A;  5K5O A;  1O7F A;  3BDD A;  3GZ6 A;  4A5M A;  5K5R A;  1Z7U A;  1ZLJ A;  3WOD F;  3O6B B;  3H92 A;  3TQN A;  2KJC A;  4OIO F;  2DW4 A;  2XRN A;  1OYI A;  3TKY A;  3EUH A;  1XCV A;  5LHG A;  2O61 A;  2IA1 A;  1R36 A;  5TRD A;  2CW0 F;  5HS8 A;  3CUQ B;  3V4G A;  2HGC A;  3EET A;  2LKP A;  1A04 A;  3BOQ A;  2F5C A;  1XCB A;  1U6G A;  1HSJ A;  4MTE A;  3WTS C;  4CYD A;  3L09 A;  2L01 A;  4P9U A;  3GF2 A;  1D8K A;  2GWR A;  1RIO H;  1FPQ A;  3R6S A;  3VOE A;  1K7A A;  5LGU A;  3I59 A;  1SD4 A;  5L3C A;  5ILV A;  4I98 B;  1Z9C A;  3TO9 A;  1KU3 A;  2ISZ A;  1IXS B;  2B0L A;  2QQA A;  5FFZ A;  3ECO A;  3F6O A;  4YFN F;  4KN4 X;  3MZH A;  1F5T A;  3K1N A;  3FMR A;  2P5L C;  5LGN A;  2HQR A;  1I1G A;  2VT3 A;  5AIQ A;  5D5U B;  3E5Q A;  2V1D A;  4JQF A;  3W6J B;  1BOA A;  1T38 A;  3NEU A;  1XGM A;  4O6J A;  5IT9 Z;  5D6F A;  1SAX A;  1J59 A;  5HDG A;  5DCF A;  2XAG A;  1XSV A;  1FZP B;  2WWY A;  3N4M A;  1XMK A;  2VC1 A;  4OIP F;  2M45 A;  4G94 A;  2TDX A;  3WU0 A;  4R79 A;  1BI0 A;  5BOX A;  2CYY A;  2Q2E A;  5ED4 A;  5ICC A;  1MKM A;  3KP2 A;  4AVP A;  2IT0 A;  1KA8 A;  2CGP A;  3GO5 A;  1DP7 P;  3HTS B;  2JT1 A;  1FBS A;  5HLH A;  1FWZ A;  2MH9 A;  4LK1 F;  3T1B A;  4RB2 C;  2BGC A;  2WTE A;  2ZME A;  4A6E A;  2RDP A;  1B9M A;  1I5Z A;  3DF8 A;  4KMF A;  4BHP A;  4YG2 F;  2QBY B;  3WE2 A;  4LK0 F;  5ILS A;  3JSP A;  3ZP5 A;  1O7L A;  1LVA A;  3DV8 A;  3E3V A;  5HOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...