4LLLA

Crystal structure of s. aureus mepr-dna complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 50
structure length 138
sequence length 138
chains with identical sequence B, C, D, I, J, M, O
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lllA00
3WE2A 1HKQA 2CFXA 3DFGA 4ZH4F 3E6BA 2DW4A 3KLNA 3E5UA 1R7JA 4LLLA 4RAZA 2VT2A 2DT5A 4IRGA 2JPBA 1S8NA 2LF8A 4LB6B 1KU2A 3K1PA 1ONVA 3EETA 1HKTA 2JPCA 1ZRFA 3DV8A 2EV5A 1IF1A 1P4AA 2NRAC 1SAXA 4PGHA 3FM5A 2A6HF 4WXCA 2EB7A 5D4SA 2NNYA 2GA1A 3GW2A 1F9NA 4A5NA 2ZCWA 1FP2A 1BJAA 2RGVA 3P9IA 4I98B 1A04A 3M1EA 4WCGA 4IHSA 2IPQX 1OYWA 3WTZA 1K7AA 2Z9OA 1S3JA 3T5XA 4OINF 1IN6A 4UUVA 2L4AA 4UXNA 1R1UA 4M9XA 2EFOA 4BAYA 2LF7A 2NS0A 4E70A 3TOBA 2M30A 2ISYA 2HS5A 2HYGD 4CYDA 3WGIA 4JBAA 4Q47A 3SQNA 2YU3A 2ZKZA 1WSUA 2XHKA 5AIPA 5CVJA 2EFWA 1O3TA 5JI6A 1XMKA 2HWVA 1T0FA 3ZMSA 4M6XA 2VXZA 2VC1A 2BE5F 3BP8A 4ESJA 3HOSA 4WWCA 2EA4A 5HLGA 5JFRA 1K78A 3F21A 2XVCA 2D2WA 3BPVA 2JRTA 2PG4A 1TLHB 4B8XA 3V7CA 2IA2A 3N97A 4Y17A 1IXCA 4EM0B 1U3EM 3I53A 2HTSA 4RGRA 2L4MA 4P9FA 2VONA 5JVTA 3I64A 3KP2A 4LMYA 1Z91A 2Z5UA 1EH7A 3CTAA 3ECHA 2XAFA 4WXHA 3RPQA 2HQRA 3F8CA 2HOEA 1QPMA 1REPC 2QM3A 1IZ1A 3B02A 2PI0A 3RKXA 1ON1A 3C18A 5FD6A 2XKPA 4Q48A 4GO1A 1O3QA 1FWZA 1V3FA 1LEAA 4CZZA 1YW9A 1J5YA 2L3DA 5F6FA 1H9TA 2M8EA 4RGUA 1R1VA 4I09A 3J80K 1K79A 1QZZA 2W24A 4R8HA 4LB5A 4LK0F 5D5UB 2KIFA 3L2CA 1O3SA 1VTNC 4G7OF 2BGCA 5D6EA 2NAZA 2K86A 4F7ZA 1OMIA 3ZN0A 5DUKA 5CVRA 2LSOA 1P2FA 5KVRA 2P5VA 2G7UA 2FMLA 2UXXA 4K2EA 3TO9A 1W4MA 2DO7A 3K1NA 2VBWA 2M5WA 1KU7A 1WKMA 1S7AA 2DI3A 3WTTC 2COMA 3ZQ7A 4CGZA 2M45A 2WC2A 4FT8A 3KLOA 3GFIA 1XD7A 2Q0OA 3GXOA 4HDUA 4CO8A 1T98A 2DPUA 3IHUA 5HLIA 3FXRA 4ZYHA 4L5IA 2F5DA 2HR3A 2AXLA 2OA4A 2FBHA 4KIGA 1BIAA 4I2OA 3GZ6A 2RN7A 3ZMTA 1BIBA 1L3LA 1U8RA 5CLSA 1E17A 1SD6A 1HBXG 1IUYA 1TQIA 4WK8F 1H0MA 3I5UA 2IA1A 4UVAA 3GUDA 3OOPA 4ZYEA 1SFUA 4AIKA 3ZP5A 4CHUA 2VE8A 2F5CA 1T38A 5L3EA 1IAWA 2FXAA 2EFNA 3IKVA 1J7KA 3M8FA 1ZREA 3IWFA 2NYXA 5DUIA 3QPTA 3MEXA 1HXDA 1ZRCA 1PP7U 3J80Z 1W7PA 1GHCA 2WV0A 3DKWA 1O7FA 1IN5A 5K1YA 3V8JA 4D0PA 4BNCA 4NB5A 5ICEA 4ZZDA 2QBYB 1UCRA 1FYLA 4ENJA 1YG2A 1W5SA 3SZTA 3HRMA 3GO5A 1LDJA 3J81K 1KYWA 2LKPA 3Q9SA 2P5KA 3DF8A 1E2XA 2OU2A 2K02A 2STTA 3HRUA 4A2UA 4O3MA 1R5HA 5E18F 4DNCA 3WGHA 1ZN2A 2ESNA 2ELHA 4I0AA 2P7CB 5HS7A 1ZLJA 5D5XB 5ILUA 3U9GA 3HOTA 2UWMA 2HTJA 4N0BA 2VODA 1PDNC 4LGWA 3FZVA 2JZYA 4RGSA 3SXYA 4HQEA 1XDUA 1IXRC 3JAMK 2OD5A 3IRRA 1G3SA 5D4RA 2FBKA 3E97A 3MFKA 2H94A 3BY6A 2K7LA 1SD5A 5E20A 3VODA 4IHTA 4L9VA 3N4MA 2M87A 4LFUA 4A12A 3O6BB 2HGCA 4HX7A 5E1ZB 1LNWA 4WF2A 1G4DA 1O7LA 5D5WB 5LHIA 2FBIA 3GZ5A 4M73A 4BHBA 3LQQA 3T0YA 1SMTA 4Q4ZF 2GXGA 2H6CA 3FXUA 1Y0UA 2F2EA 4EM1A 4CXFA 4Y13A 1KU9A 3CLOA 1J75A 2XROA 1FSEA 5J6XA 1UFMA 2E1NA 1HW2A 3ZPLA 1LVAA 3QOPA 3K2ZA 2OQRA 2K27A 3J81Z 2MH2A 2OBPA 4KIBA 5ICCA 1U6GA 2QUFA 3H92A 5H6RA 2ZBKA 3GFJA 4LLNA 5AONA 3RPUA 3TO6A 1HQCA 3LAJA 2J5PA 1G3YA 2FU4A 3RTRA 3LWFA 2CYYA 2XAHA 3E5XA 1GXPA 1S7OA 1P4WA 1FY7A 2V9VA 5L3FA 2PJPA 3ULQB 3GFMA 3TDUC 3TOAA 4U0VA 4OMYA 1AOYA 3JAMZ 1FBUA 4M72A 1QQIA 1R58A 3ZMZA 1IN4A 1ZH5A 2QVOA 1TW2A 4LG0B 3GX4X 1TBXA 2EFPA 2AS5F 3FMRA 3VEPA 2D45A 4L0YB 4YFKF 3KZZA 4O6JA 4HF0A 3B73A 1ODDA 4EJWA 3HHHA 3WU1B 4QWQA 3KFWX 5ED4A 2XAQA 4U88A 3LQRA 3BPXA 2CO5A 5EEGA 2ESHA 4R1HA 3ABTA 2FMYA 1SFEA 3EYIA 2A5YB 1EV7A 2Y75A 4JQFA 1W7PD 2ZJ2A 4AIJA 1BOAA 4ESBA 4L9JA 5JHUA 4S05A 2YX7A 5BMZA 1RZ4A 2ZNYA 3CO6C 3NRVA 3GWZA 4GYGA 4IVNA 2VE9A 5H20A 3K69A 2A3SA 2YX4A 2W84A 4HAMA 2H6BA 2DLLA 3FXQA 3FMQA 1XCBA 3PFIA 2KIMA 3D5LA 1MKMA 1IXSB 2EV6A 3FX3A 4A6EA 2JSCA 4LLGF 1UHWA 3F6OA 2E7XA 4Z2YA 1BC7C 4OIPF 1FT9A 5DD8A 3V8KA 1Z6TA 2GIVA 5HS9A 2VOPA 4LD5A 1H9GA 3L09A 3F22A 1BI2A 1EH6A 2KRFA 3V7RA 4UV8A 5LGUA 3RIRA 2WWYA 2KJCA 4IF4A 3JSOA 1LB2A 2VBYA 5L3CA 2R7DA 1F5TA 1R00A 4KUMA 5DEQA 3U2RA 2HZTA 1Z6RA 1S29A 1KQ9A 1FBQA 1SFXA 3T8RA 5HS8A 2X4HA 4HDVA 4EJVA 3WTVC 4G6DA 2FQ3A 1FYKA 4KYWA 5BPIA 2KKOA 3CUOA 4TV7A 1B59A 1FC3A 2V1DA 4YG2F 2PFBA 5DCFA 2DAOA 3G3ZA 2O6GE 2ZFWA 2XAJA 1BM9A 2O0YA 4RB0A 3M9AA 3NQOA 4EV0A 3OV8A 1STZA 3JTHA 4XSXF 4MNUA 3V8LA 1B1BA 3E6CC 4AVPA 1KQ8A 3E5QA 2EK5A 2IVMA 2CSOA 3DPLC 4BHCA 5FGMA 1D5VA 4S04A 3P7NA 2FOKA 2FA5A 4EGYA 1CF7B 2QBYA 4HZFA 4HBLA 2MBFA 3BROA 1WRJA 5LGNA 2Z99A 5DV5A 1LJ9A 2P8TA 1JHHA 3O3KA 1FZPB 3R60A 3WTSC 3BWGA 2L01A 2ZO4A 4MTDA 1P92A 1J2XA 3HIFA 1IN8A 3CUQC 2DTRA 4MEYF 2UZKA 1YW8A 1D8KA 4EVIA 3LFKA 4BQAA 3LA3A 5LHHA 4L0ZB 2YR2A 1ZLKA 5TRDA 4MGRA 3FHZA 2XKOA 4R79A 1Q1HA 4NQWA 2XUBA 2GXBA 2HEOA 1LDDA 3W6KB 2H09A 2DQRA 2LNBA 1KU3A 5DCMB 3HTUA 2ISZA 4KMFA 4LK1F 2YSRA 2Q2EA 4HF2A 3K0LA 2FRHA 4JK1X 1XCVA 1QO0D 5LBQA 4ESFA 1AWCA 3RYPA 3CO7C 4G7HF 3DP7A 2GA2A 1ZHFA 4ZZLA 3FWEA 1XMAA 2XAGA 3BJOA 4HX4A 3E3VA 4H0EA 3GF2A 3FMSA 2L54A 3FM3A 4A0XA 3Q9VA 1Z05A 1CGPA 3IC7A 2KJBA 2QZ8A 5JR3A 1ZARA 5L3GA 2Y0MA 2ZMEB 3F8MA 1DP7P 1BI0A 1OR7A 2OQGA 1OYIA 1KA8A 1QNTA 3RI4A 4G6QA 5H6QA 2K4BA 1DPUA 5BQTA 1EH8A 3HSRA 3ELKA 1YS6A 3LAPA 1U5TC 4MQ9F 3GLXA 1T6SA 3MCZA 4I7HA 2PBIA 3H3UA 5E8GA 1ZG1A 4L9TA 1MD0A 2IRFG 4MHGA 1XGNA 4I0BA 1RUOA 1S6LA 4ASNA 3J7AO 2Q8KA 3G73A 5J8FA 4EJTA 2QYOA 4HV6A 2FEZA 4U0YA 2RKHA 2O03A 1RIOH 3KP4A 1D3YA 2E7WA 4M9SA 3R61A 1K6OA 1MDMB 4XBFA 1Z1DA 4LG0A 3HHGA 4EJOA 4CDGA 1USSA 1TNTA 3IRQA 3I59B 5E1XA 4MEXF 1FNNA 3L00A 4HYEA 3RYRA 3RDIA 3WODF 3QP5A 1OYYA 3QPHA 2W25A 3JTGA 1FSHA 2HKXA 1KQ0A 3W6JB 5FO5A 1TW3A 3I4PA 2VC0A 1YW7A 4PDKA 2W85A 5D8KB 3K1MA 3TGNA 2A68F 4UVBA 2XRNA 6PAXA 1Z9CA 2FNPA 3LSTA 3F3XA 2EFQA 4U7BA 2W57A 1FPQA 2V6CA 2OAZA 5AIQA 2VT3A 3WTUC 1SD4A 1RUNA 1J0RA 2X0LA 2O61A 3KP6A 1J9IA 5LRRA 1WQ2A 3H3ZA 1I27A 2ZXJA 3CUQB 3E6DA 5K5OA 3MZYA 2EWNA 2EA2A 2V79A 3WU0A 4ON0A 5HDKA 5LGTA 2O8XA 1JE8A 2DK5A 4ZYGA 2V1UA 2GAUA 4RGXA 2QQ9A 1BC8C 2IA0A 3I71A 4WXDA 4B09A 1RI7A 5CYVA 5L3DA 2D1HA 5CVIA 4M71A 3R0JA 4Q5SF 3HYIA 2VBZA 5F1RA 2Z33A 4BXUA 4L5JA 3F8BA 2BYVE 1XGMA 2QQBA 4I01A 2HYFA 3R6SA 2VBXA 3QU3A 1UHMA 1GXQA 5J8CA 4G8XA 3TQNA 1BI1A 1X3UA 3TDZC 4MTEA 4FX0A 1IRFA 2G7HA 3QP6A 1MJ9A 3ROUA 4G9YA 1Z7UA 2RDPA 2Z3YA 2F5EA 1O3RA 4N9HA 3KEOA 1TQMA 1TQPA 2PLYA 1FYMA 2FNAA 3SZPA 1CF7A 1RNLA 1WWXA 1DPRA 2BBYA 1ZG3A 2L02A 2D1VA 3FF5A 1PUEE 4IJAA 4MQVA 2CGPA 4RB3C 2RC4A 3U1DA 4ZYDA 1G6NA 5D8LB 1UB9A 5ILVA 5DDGA 1XB4A 3VB2A 4OMZA 4KICA 2OZUA 5E1WA 2DBBA 5BS6A 2PN6A 5IT9K 2PMUA 3C7JA 5HDNA 1B9NA 4HX8A 1HSTA 3EYYA 3ML6A 3P9CA 1TTYA 2HDCA 1BI3A 1GVJA 1I6XA 1DDNA 2J5OA 4KT5C 3NEUA 5EEHA 4RB1A 1G3TA 1P4XA 4YFNF 1YS7A 1IRGA 1ZGJA 2LDUA 4YIIA 4ENMA 3CJNA 3P9KA 5DCMA 3IKTA 1KGSA 3C1DA 1LQ1A 3AAFA 2RQPA 2EJRA 1USTA 4G94A 3WGGA 4KMUX 1ZYRF 3E6MA 3KP3A 1OPCA 1I1GA 2NNNA 1R22A 4GGGA 1BN5A 1R1TA 1TNSA 4P96A 4HA8A 4IXAA 4IRIA 4UNOA 3DPTA 4UVCA 2BEOA 4CICA 3KE2A 2PQ8A 1C0WA 1QZYA 3C3WA 2ZMEA 3KZYA 4AD9A 5L3BA 1J59A 2WTEA 1JGSA 3IL2A 5ERIA 4OIRF 4U0WA 2MH9A 2G9WA 3KP7A 2HQNA 3L9FA 4AWXB 1IW7F 4KFCA 2P4WA 4L9NA 2P7VB 1QBJA 1JHFA 1MJBA 2VOOA 5IT9Z 4I02A 5CVVA 1V4RA 1R5GA 3MQ0A 2MC3A 5HOOA 1KYZA 4RS8A 4NHJA 2DPDA 4QLCU 2ETHA 4EQQA 5DD4A 1XSVA 5F64A 3ERED 1W5TA 3CDHA 1MDMA 3O2PE 3VFZA 2R3SA 2DK8A 3QAHA 4P9UA 3T8TA 3BDDA 2JTVA 3KP5A 4PCQA 1FOKA 3HRSA 2FF4A 1ON2A 5KK1A 3I59A 4AIHA 4IPAA 5IT3A 5ILSA 1I1SA 2MLGA 2B0LA 5FFXA 3ZN1A 2FSWA 5A2QK 5ICFA 5FD5A 2HFHA 3F8NA 1HSJA 4FX4A 4PGGA 2YPRA 4OOIA 3DEUA 1ZG5A 2IJLA 5LEKA 3WTXC 4HV5A 2TDXA 5K5QA 5HLHA 3RKWA 3HSFA 4G7ZF 3PQKA 3HUGA 3ZMDA 4HW0A 4OIQF 4ETSA 4KN4X 2A07F 1B6AA 3BOQA 1LDKB 3R0AA 1U2WA 4EM2A 4XLNF 4KN7X 2UXNA 3GFLA 1R36A 2ZNZA 3CUQA 5LLQA 4BHPA 2P5LC 1G3WA 1SMYF 3JW4A 3KEQA 4ENKA 4OIOF 2O3FA 2R7FA 3MZHA 2XASA 2IW5A 1QGPA 3Q5FA 3WG9A 5CVUA 4HQMA 1FX7A 3DXJF 3I58A 5FB2A 5K5RA 3DQVC 2C6YA 3F8FA 1XDSA 1YTYA 4GCVA 4RB2C 3BJ6A 4EGZA 1D8JA 1F1ZA 3I54A 4RAYA 1XN7A 4P5OA 2EV0A 1YFHA 2CG4A 2A69F 2MLKA 1K78B 3F23A 1L0OC 2A61A 5FLXK 5A2QZ 4XLPF 3S2WA 1I5ZA 3QRFF 4YFXF 2PMHA 2IT0A 3ABUA 1PP8F 4LJZF 1XGSA 2STWA 1B4AA 3M7GA 3TO7A 4A5MA 5D6FA 2BV6A 2QENA 2K4JA 3BJAA 3JSPA 1SD7A 4UHTA 3MWMA 4YIFA 1ZRDA 3V4GA 2E1CA 4A6DA 1U5TA 5BOXA 4OU0A 3K9TA 2Y48A 1YQAA 2ACJA 4HF1A 5BPDA 4M9ZA 3KCCA 1IN7A 2PEXA 3EDPA 4KNYA 4UV9A 2CW0F 2QWWA 2IP2A 5LHGA 3HRTA 3EQLF 4KDPA 3R4KA 2V1XA 5HVQC 3WTWC 1XSDA 1U78A 4GXOA 2CQKA 4BYYA 5DYMA 3I0TA 3HTSB 2XV4S 3IWZA 2XIGA 1T39A 1T2KA 5E17F 4M74A 2RV8A 4P55A 1ULYA 1DUXC 1HKSA 2RVCA 4Y15A 1XSXA 2F5FA 4N9IA 1ZGAA 2OZ6A 3VOEA 5FLXZ 4A0ZA 3T1BA 4EMSA 4KA4A 2VN2A 1LEBA 2DQLA 5LRSA 1O57A 4L18B 3ECOA 2FE3A 2MA3A 2P6SA 4FHTA 1WI9A 1YYVA 3M8EA 2ADUA 1MZBA 4HLXA 4KIFA 3GVAA 1YLFA 4HLYA 3SHFA 4XRFA 2JT1A 2GQQA 3COAC 4O5VA 3TKYA 4PZJA 3ISPA 2QQAA 3GYHX 4IRHA 1ZAOA 3QU6A 1HW1A 1MJAA 5ICGA 5D5VB 2P6TA 3ZMUA 2XGXA 2MD5A 3L7WA 1W7PB 3MAJA 5HDGA 1JXSA 2DFIA 5CJ9A 3EUHA 1R23A 3WE3A 1XGOA 4WX9A 2GZWA 4A0YA 4EJUA 1FP1D 1FLIA 2H27A 3RKYA 3BZ6A 1B9MA 3KETA 3ZMVA 2GWRA 2HKOA 2KIUA 1YO5C 4M6YA 1NHAA 4DQ2A 3LA7A 3F72A 4U7DA 1F4KA 3HSEA 1U5TB 4GYIA 1MGTA 4HOBA 5TJJA 2A6EF 3RJPA 2RNJA 4BH9A 3LA2A 3V7SA 4XSZF 5E8IA 2CWEA 2DU9A 1HW5A 1P6RA 3SFZA 1YIOA 4ENNA 5FFZA 3D0SA 1FBSA 3GEZA 3PQJA 1BBYA 5LEJA 3REOA 3WTYC 1OKRA 3F6VA 2QLZA 2M1BA
chains in the Genus database with same CATH superfamily
1TZLA 3FK7A 3WE2A 1HKQA 3JRFA 3ABMH 3CCVI 2CFXA 2KIQA 2YU9J 3O8HA 3MZ8A 1OCRH 4KJZA 3DFGA 3PJRA 4ZH4F 3LSHA 1DP3A 3E6BA 2R5YB 3EUAA 2DW4A 4M3FA 4Y4RA 3KLNA 2DA1A 3DLLF 3E5UA 1R7JA 4LLLA 4RAZA 2VT2A 2DT5A 3DCFA 1VQ5I 4IRGA 1IJWC 4ZDPA 1X1DA 2JPBA 3LFUA 1WJBA 3DTKA 4XLCA 3LL7A 1S8NA 3JRDA 2LF8A 4ZTJA 1P7IA 1KU2A 4II3A 4N4NB 4LB6B 1MW7A 1ONVA 3K1PA 3QYBA 3CC4I 2E5ZA 3EETA 4BJ5C 1HKTA 1VI0A 3PO2J 2JPCA 3G1MA 1PJRA 2R0QC 1ZRFA 3DV8A 4A3KJ 2EV5A 2L5QA 1IF1A 2B63J 1P4AA 1MSEC 2VLAA 2NRAC 5E79C 1SAXA 2VB6A 4YRVA 1YX3A 4PGHA 3FM5A 1Z3XA 2HVQA 2A6HF 4BE0A 4WXCA 2XB5A 2EB7A 1X3WB 4XNFA 5D4SA 2BXZA 1VQ4I 2X85A 2NNYA 1K4SA 2GA1A 1FEXA 1YI2I 2ICWG 1ITYA 3GW2A 1RESA 3ERMA 1F9NA 3GTOJ 4A5NA 2ZCWA 1FP2A 1BJAA 2QSFX 2RGVA 3P9IA 2VQHA 4I98B 3PIOF 1ZQ3P 1A04A 3M1EA 4WCGA 4IHSA 2HI3A 2IPQX 1OYWA 3PSFA 1IC8A 3WTZA 1K7AA 1UG0A 2M9HA 2Y9YA 4I99C 1JGGA 2Z9OA 1S3JA 3T5XA 4OINF 5IPAA 1IN6A 4UUVA 2KFDA 2L4AA 4UXNA 1R1UA 2XDVA 4M9XA 2EFOA 3OYGA 1ZTRA 1UZCA 2BVLA 2CFOA 4BAYA 2LF7A 2NS0A 4E70A 3TOBA 2M30A 4E6KG 3CCSI 2ISYA 2HS5A 2HYGD 2GM4A 3IAS2 4HSTA 1IRXA 4QTRA 3OYJA 4CYDA 1Y0NA 5E3LA 3WGIA 4JBAA 1WVRA 4Q47A 2YU3A 2ZKZA 3SQNA 4E7LA 2XHKA 1WSUA 1EJ9A 2IBDA 5AIPA 2OTJI 2KQRA 5CVJA 3OS2A 1DQUA 2EFWA 1O3TA 3FXOA 3QYFA 4M6VA 4BE2A 5JI6A 1XMKA 2DDBA 2HWVA 4XRMA 1T0FA 2DYSH 3ZMSA 4M6XA 2VXZA 2IS6A 2BZTA 2VC1A 2BE5F 3C2BA 3BP8A 4ESJA 3LSIA 3HOSA 4WWCA 2EA4A 3BCAA 2DDAA 5JFRA 5HLGA 1K78A 3DU5A 3F21A 3VYSB 2XVCA 2D2WA 3BPVA 3KZIC 2JRTA 2PG4A 1TLHB 4B8XA 3V7CA 2IA2A 3OY9A 3RZDJ 3N97A 4XN3A 3HBLA 2DOAA 4Y17A 1IXCA 1ETOA 2RAEA 1FOWA 2R7OA 4EM0B 1U3EM 1EKEA 3I53A 2HTSA 1JJ6C 2KDZA 4RGRA 2L4MA 2LLKA 4P9FA 1XPXA 2VONA 2DA6A 1BR4A 1WJFA 4CYCA 5JVTA 1I50J 1PYVA 4FCYA 3I64A 3KP2A 4LMYA 1RRJA 1Z91A 2XAUA 3SZGA 3KYCB 3J7YJ 4A3JJ 1X2NA 2Z5UA 1EH7A 3CTAA 3ECHA 2XAFA 1E3HA 4WXHA 5M5WJ 1W1WE 3RPQA 2VJIA 2HQRA 3F8CA 4YEJA 3LSJA 5H2FC 5K7HA 5M3FJ 2HOEA 3HOYJ 3JCUC 1QPMA 1REPC 2QM3A 4MFEA 3DEWA 3CCRI 1IZ1A 2CV2A 2DMQA 3B02A 3J7ZI 5TISC 2PI0A 3RKXA 4IZZA 1ON1A 3C18A 5CKTA 5FD6A 3HKZA 2XKPA 4IQJA 3VYRB 4Q48A 3KX2A 1A35A 3CESA 4GO1A 1O3QA 1FWZA 1V3FA 2OCEA 2Z1DA 4L5EA 2MW8A 1LEAA 3F0CA 4CZZA 2YS9A 1YW9A 3M07A 1MSFC 1IV8A 1J5YA 2WY8Q 3UR3C 2L3DA 1TT0A 5F6FA 1H9TA 2CUFA 2M8EA 4RGUA 1Z3YA 1R1VA 4I09A 3J80K 1R9TJ 1K79A 1QZZA 2W24A 4R8HA 4LB5A 4LK0F 2WADA 5D5UB 2KIFA 1X3ZB 4ZDLA 3RKQA 1MH3A 5LFAA 3L2CA 1O3SA 3CCMI 1VTNC 4G7OF 5KAFC 4KITB 2BGCA 5D6EA 2NAZA 3S15J 1A6IA 1NH3A 2K86A 4F7ZA 1OMIA 4BXXJ 2EIKH 3ZN0A 1JKQC 1FOYA 5DUKA 1VZ0A 4BQOA 5CVRA 3MKZA 2LSOA 1P2FA 3BQZA 5FROA 1OR7C 5KVRA 2F4MB 2WV1A 2P5VA 2G7UA 3BG5A 2EILH 2LK2A 2L7ZA 2FMLA 2UXXA 3LOCA 4K2EA 1W4MA 3TO9A 2DO7A 1JTXA 3BR6A 2KMUA 3KEYA 3BR5A 3K1NA 2VBWA 2M5WA 1KU7A 1WKMA 5DTDA 4KISA 1S7AA 2DI3A 3H36A 2COMA 3ZQ7A 3WTTC 4CGZA 4BDZA 2M45A 2LY1A 2WC2A 4FT8A 3OYMA 2Y9ZA 4CH7A 3KLOA 3GFIA 2K3FA 4JX4A 4QPQA 1XD7A 2Q0OA 3CCJI 3GXOA 4HDUA 4CO8A 1OISA 2L2OA 1T98A 2DPUA 2Y31A 3IHUA 2DMNA 1Y56A 5HLIA 4XLFA 3FXRA 4ZYHA 3OYDA 4L5IA 2F5DA 4XK4A 2HR3A 3TP3A 1A36A 2QF7A 2AXLA 2OA4A 2FBHA 3PUFA 2E5NA 4KIGA 1R5ID 1BIAA 5E3OA 4I2OA 3GZ6A 2RN7A 3ZMTA 1BIBA 1L3LA 1U8RA 5CLSA 3X2QH 1E17A 1SD6A 4NDLA 1HBXG 1IUYA 3BG9A 1TQIA 4WK8F 1H0MA 3I5UA 2IA1A 4F52A 4UVAA 3GUDA 4IHVA 2JA6J 3OOPA 4ZYEA 1SFUA 4CCOA 4U87A 4AIKA 3ZP5A 1QHGA 2XGEA 3DBLB 3ZQFA 4CHUA 5F0FA 2KRHA 2VE8A 1RKWA 4CSWA 2F5CA 1T38A 5L3EA 3IV5A 4NC7A 1IAWA 2FXAA 2EFNA 5J4YA 3IKVA 1ORKA 1Z67A 1OCCH 4UY8I 1D0YA 1J7KA 3M8FA 2EINH 2E1MC 2Y0SN 1ZREA 2R7QA 2WAFA 5E3MA 3IWFA 4EATA 1G8XA 3VPRA 2NYXA 5DUIA 3QPTA 3MEXA 2OJED 4DYRA 1HXDA 1B72B 1ZRCA 3H3VK 1PP7U 1OQYA 3J80Z 1SVLA 4AYBN 2ZJPF 3FK6A 2ZJQF 1W7PA 4J01A 2GIZA 4E7ZA 2A5WA 4CYCB 2EIMH 1GHCA 2JUCA 2WV0A 5FRNA 3DKWA 2NS8A 2WB1N 1O7FA 1IN5A 4Y33A 1ZK8A 5K1YA 3V8JA 4PFPA 5BNGA 1YJNI 2MYSA 4D0PA 4BNCA 4NB5A 1LE8B 3D5SC 2X6WA 5ICEA 4ZZDA 2QBYB 1N75A 2MG4A 4I76A 1YOVB 2L9VA 1UCRA 3FKIJ 4ENJA 1FYLA 1YG2A 1PVEA 3LMMA 1W5SA 3SZTA 1FIPA 1VF9A 4Y3OA 2QCOA 3CCEI 5EF6A 1D1BA 3G71I 4LITA 4FTHA 3HRMA 1MH4A 3GO5A 1LDJA 1U8BA 2VQLA 3J81K 1KYWA 1MBEA 1ZKGA 2LKPA 3RQIA 3H1CA 3Q0VA 3Q9SA 1VQOI 2P5KA 5KNLA 2FX0A 3DF8A 1E2XA 2OU2A 1HDDC 2K02A 3VYTB 2STTA 3HRUA 2XSDC 4A2UA 3H5AA 4B3XA 2HPMA 4O3MA 1R5HA 2R93J 4AC0A 4RLFA 3CP2A 5E18F 4DNCA 3WGHA 2E19A 1YJ9I 1S5LC 1ZN2A 2ELHA 2ESNA 1WFXA 3EPZA 1TC3C 4I0AA 2P7CB 5HS7A 1ZLJA 2FUG2 5D5XB 4H4KC 5ILUA 3U9GA 3HOTA 2UWMA 2HTJA 4N0BA 2VODA 2I5UA 5CPRB 1PDNC 2MC4A 4LGWA 1MNMC 2GBYA 1H8AC 3FZVA 2LFBA 2JZYA 4RGSA 3SXYA 4HQEA 4IQ4A 1XDUA 1IXRC 1MNDA 2OD5A 3K4CA 3K4BA 4BEHA 3JAMK 3IRRA 4IL6C 4QSHA 1G3SA 5D4RA 4NQWB 3CF5F 1ETWA 2FBKA 1U9NA 3E97A 3MFKA 2VKEA 2H94A 2N8GA 3BY6A 3HDDA 3SFIA 3GTKJ 2K7LA 4QIWN 1SD5A 5E20A 2B9SA 2R5YA 5IYBJ 1D0ZA 5K7FA 2K9SA 4BL0B 2ZJRF 2Q2EB 4PSWA 2X1CA 2MFZA 3VODA 2QGUA 4IHTA 1WJ5A 1YITI 4L9VA 4PJNA 1MBKA 2DFEA 3N4MA 2M87A 4LFUA 2M34A 4A12A 3O8GA 3O6BB 2HGCA 2M0MA 2X6XA 3QOEA 4A3GJ 4HX7A 5E1ZB 1LNWA 5EYRA 4WF2A 2HNHA 1JT0A 1G4DA 4BXFA 4NUBA 3VSKA 1O7LA 3ESWB 1S7EA 2KT0A 5D5WB 5LHIA 3S93A 1VQ9I 1QZEA 2FBIA 3GZ5A 4M73A 4BHBA 4F91B 4XRSA 5FJ8J 1NG6A 3LQQA 3T0YA 1Q1VA 3IP4B 2DMPA 1QA6A 3IH4A 1YIJI 1SMTA 4Q4ZF 4UB8C 2GXGA 2BY2A 4B1RA 2R7XA 2H6CA 3FXUA 4BY1J 2X51A 4EEFG 1Y0UA 2F2EA 4EM1A 1FOXA 4CXFA 4Y13A 3Q0UA 1KU9A 1TWCJ 3CLOA 1J75A 2UUZA 2O9LA 2XROA 2ME0A 1FSEA 4NC8A 5F1JA 5J6XA 1UFMA 2DN0A 1BOBA 2E1NA 4CZCA 1HW2A 3E1SA 5B66C 1W36D 3ZPLA 2LD5A 2ZXHA 1LVAA 3QOPA 2IGMA 4RLQA 1W0TA 3K2ZA 3L1PA 2OQRA 1AHDP 1OCPA 3HOWJ 3S3OA 2K27A 1MMGA 3J81Z 1Z21A 1GV5A 2MH2A 2OBPA 4KIBA 5ICCA 4XICA 3TEDA 1U6GA 4D5FA 2QUFA 3VSLA 1GLNA 3H92A 3S1QJ 1XS9A 5H6RA 2ZBKA 3GFJA 4D9JA 3ZQLA 1ETVA 2VUMJ 4LLNA 5AONA 3RPUA 3CCYA 1ETKA 2CJJA 3TO6A 1HQCA 3LAJA 3CJRB 5C3EJ 2J5PA 2AQEA 1A6QA 1G3YA 4XOPA 2FU4A 3RTRA 2GXAA 3LWFA 5J47A 2CYYA 2VI6A 1P9QC 2OCCH 2XAHA 3E5XA 1GXPA 3LSPA 1QU3A 1U9OA 1S7OA 1P4WA 1MNEA 2JMWA 1WH5A 4CCLA 1FY7A 2HXIA 2V9VA 4RAGA 3B6CA 5L3FA 2RREA 1LUJB 2PJPA 3ULQB 3GFMA 2XRLA 1GUUA 2BY1A 3SDGA 3TDUC 2DA7A 3TOAA 4U0VA 5J40A 5J1RA 2ELJA 4OMYA 1MMAA 1T08B 1AOYA 1FBUA 4M72A 2DCEA 2ECBA 3JAMZ 1QQIA 1W5CC 1R58A 4A3IJ 5IOYA 3ZMZA 1DGRM 2CUZA 2W1OA 4UUSB 1IN4A 3UNGC 1ZH5A 3LNQA 5KCMA 2AXTC 5GP9A 5JLWA 2QVOA 1Z77A 2E2IJ 1TW2A 3GTMJ 1R4MB 4ANJA 3GX4X 4LG0B 1TBXA 2EFPA 3CD6I 2AS5F 3FMRA 3TL4X 3VEPA 3WHBA 4FASD 2D45A 4L0YB 4YFKF 3KZZA 4O6JA 1ZGWA 4HF0A 3PSIA 3IAM2 3RCOA 3OYIA 3B73A 1ODDA 4EJWA 3HHHA 1A31A 4BS9A 3WU1B 3HOVJ 3FBNB 4QWQA 3KFWX 5ED4A 3HGYA 2XAQA 4U88A 1IRZA 2E1MB 2ZC2A 1WHUA 3LQRA 3BPXA 3PNVA 1OCTC 1TL8A 2CO5A 4XOTA 2JA7J 5EEGA 2ESHA 4OAYA 5CQEA 2LREA 3ABTA 4R1HA 2FMYA 2IAIA 1SFEA 4C3HJ 2NVQJ 3EYIA 2A5YB 1EV7A 1TWHJ 1Y39A 2Y75A 4JQFA 4MIMA 2HOSA 1W7PD 2IGKA 4FE4A 2ZJ2A 4AIJA 3K4KA 1BOAA 4BEHB 4ESBA 4L9JA 3AG2H 5JHUA 1PUFB 4S05A 5FKOA 4CCMA 3S2DJ 2YX7A 2XGCA 5BMZA 1WZ2A 4XKVA 1RZ4A 2X6YA 1HOMA 2ZNYA 3CO6C 2VQCA 3NRVA 1H89C 4P1WA 5GADJ 3GWZA 4GYGA 4IVNA 2W7NA 2VE9A 5H20A 1VQNI 3K69A 2A3SA 1X19A 2W48A 2YX4A 4X6AJ 2W84A 1Y1VJ 4HAMA 2H6BA 2DLLA 5DM6F 4LIUA 3VYUB 3FXQA 3FMQA 2IS1A 3S16J 1XCBA 1ETYA 3K7AJ 3SDBA 2R7TA 2EPFA 5GAGJ 3HKZN 2ZMEC 3PFIA 2KIMA 1Z7LA 3MKLA 3ZQHA 3D5LA 1MKMA 1IXSB 2EV6A 2OF7A 1ENHA 3FX3A 1F43A 1D1CA 4BE1A 2K9NA 4A6EA 2JSCA 3W2VA 4LLGF 1UHWA 2X6OA 3F6OA 4XORA 2E7XA 5GAHJ 1X1BA 4Z2YA 1BC7C 2W4SA 4OIPF 1FT9A 5DD8A 3V8KA 1Z6TA 1FIAA 3AG1H 3VDXA 2GIVA 1NK2P 5HS9A 3OR2C 4ITVA 3CP8A 2KHMA 2VOPA 2CQNA 4LD5A 1H9GA 2V6EA 3L09A 2BY3A 3F22A 1LVKA 1BI2A 1VFCA 3KYDB 1EH6A 3AKZA 2KRFA 3OYEA 2K5CA 3S8PA 1A5JA 3V7RA 4UV8A 2UV1A 2XB0X 3JRHA 2EH3A 2LVSA 3H0GJ 5LGUA 3RIRA 2WWYA 2KJCA 4IF4A 3JSOA 4DOZA 1LB2A 2VBYA 3F6VA 5F0CA 5L3CA 2R7DA 1F5TA 1R00A 2ZB9A 4KUMA 5DEQA 3U2RA 2HZTA 1IDYA 1V5FA 1Z6RA 1JUMA 2JK3A 4E4HA 1S29A 2KDOA 1KQ9A 1FBQA 3BR2A 1SFXA 3T8RA 5HS8A 2VJJA 2X4HA 4RBOA 4RM3A 1R49A 4DJAA 4HDVA 1ERDA 2B7EA 3ABLH 4HNUA 2WA0A 4EJVA 4XKWA 3WTVC 4X1EA 4G6DA 1UHSA 2FQ3A 1FYKA 4KYWA 4MO7A 2BW3A 5BPIA 2KKOA 3CUOA 5M5XJ 4TV7A 1B59A 1FC3A 3HG9A 2V1DA 4YG2F 2PFBA 4CCKA 3KIOA 5DCFA 2W82A 2DAOA 3G3ZA 3NARA 5J3LA 2O6GE 2ZFWA 3CCQI 2XAJA 2M2EA 1BM9A 2MABA 2BY0A 2O0YA 3IUOA 4RB0A 2H8RA 2R92J 3M9AA 2IS4A 2LRDA 3ZQCA 2NVTJ 2EBIA 3NQOA 1VQ8I 1UJ8A 3M1CA 2Y2ZA 4EV0A 2R7ZJ 3OV8A 4XIDA 2NXNB 1STZA 3JTHA 4XSXF 2JQ7A 4MNUA 2ZXWH 3V8LA 4ABZA 2HXOA 1B1BA 3OYHA 3BTLA 1IG7A 3S2HJ 1Z0XA 1B72A 4DW6A 3E6CC 2DA4A 5JHFA 4AVPA 1KQ8A 5FKKA 3E5QA 2EK5A 3ZCOA 2IVMA 2CSOA 3DPLC 1VQKI 4BHCA 3WG7H 5FGMA 1D5VA 3CJQB 4S04A 3OL3A 3P7NA 2FOKA 2FA5A 3BR0A 4EGYA 1LE8A 3G1OA 4DYQA 3DWLE 2Q1ZB 1CF7B 1MBFA 2DYRH 4HZFA 2QBYA 2L7KA 1WH7A 4HBLA 2MBFA 3BROA 1WRJA 1ETXA 5LGNA 1W36C 1D5YA 4JX5A 2E1OA 2Z99A 5DV5A 1K61A 2R7WA 1SAUA 3GCMA 3BCBA 1LJ9A 1X4PA 2KISA 2DA2A 2P8TA 1JHHA 2DT6A 3O3KA 1FZPB 1E0EA 2L7MP 2Y69H 1BL0A 3G1LA 3A4CA 3R60A 3WTSC 1JJ8C 3BWGA 1T56A 2L01A 2ZO4A 4MTDA 1P92A 1J2XA 3HIFA 1IN8A 3HPHA 3HOXJ 2FQ4A 3L2WA 3CUQC 2DTRA 2E34A 4MEYF 1OLTA 2UZKA 1DU6A 1YW8A 1D8KA 4EVIA 3LFKA 2JVHA 1YHQI 2FJ1A 3BTIA 1AU7A 3H5RA 3PNTA 3LA3A 5LHHA 4BQAA 4BQQA 4UUTA 2EZIA 4L0ZB 2YR2A 3TBIA 1ZLKA 2JVGA 4NC6A 4MGRA 5TRDA 2HPIA 5M5YJ 3FHZA 2XKOA 3JRGA 4R79A 2PX9A 4B43A 1Q1HA 4NQWA 1RETA 4M3EA 3G4SI 2XUBA 2Y30A 2WY7Q 2GXBA 2HEOA 1LDDA 4I6ZA 3W6KB 2H09A 2LY2A 2DQRA 2LNBA 1MBGA 3FXJA 4ZDOA 2M7AA 3TW6A 5B5EC 1KU3A 5DCMB 3FISA 3HTUA 1K4TA 3HM5A 2ISZA 4KMFA 5EGOB 2ZFUA 4LK1F 2L9RA 2Q2EA 2YSRA 3CF2A 3DBRB 5HNHA 5FRMA 2LY9A 3OR1C 4V2GA 3DPUA 4HF2A 3K0LA 2FRHA 3H9QA 4JK1X 3K4LA 2D5VA 1XCVA 1QO0D 5GPAA 5LBQA 4ESFA 1AWCA 2HOTA 2QKLB 2VXDA 2O7OA 3MMYB 3RYPA 3CO7C 4G7HF 1NK3P 3DP7A 3CC2I 2GA2A 1ZHFA 1QHHD 3S1RJ 2HVSA 3H35A 4ZZLA 3FWEA 1XMAA 2XAGA 3BJOA 2XPUA 1WJEA 4HX4A 3E3VA 5C44J 4QPOA 1LPQA 2CUJA 2GLOA 4YELA 4H0EA 3GF2A 2G0EA 2DJIA 3FMSA 3H9JA 4XMYA 2JA8J 2L54A 3FM3A 4A0XA 4IHWA 3Q9VA 1Z05A 1CGPA 1HLVA 3IC7A 5M3MJ 2HZDA 2KJBA 3BT9A 2QZ8A 5JR3A 1ZARA 3GZNB 4G12A 5L3GA 2Y0MA 4PJMA 2ZMEB 1GVDA 3F8MA 1RC9A 1DP7P 2BW3B 1BI0A 1OR7A 3RQ4A 1VQ7I 2F4IA 2OQGA 3QQAA 1I39A 1CQTA 1OYIA 3FXLA 1KA8A 1GDTA 1QNTA 2M0CA 3RI4A 4G6QA 5H6QA 2K4BA 4PJ0C 1DPUA 4F55A 1IDZA 1LKXA 5JLXA 5BQTA 4PFOA 1EH8A 2FD5A 3HSRA 3K10A 1TWAJ 2KLOA 3ELKA 2XSJC 1YS6A 2ME6A 3HC7A 3OYFA 3ZR8X 3LAPA 3BQYA 1U5TC 4MQ9F 3GLXA 4OAZA 4E7HA 1T6SA 4YIRX 3MCZA 4BJTA 4I7HA 3GTJJ 2LH9A 2PBIA 4V19K 3H3UA 5E8GA 5EG0A 1ZG1A 4L9TA 2DTZA 3OSFA 1MD0A 2IRFG 4MHGA 1XGNA 4I0BA 1RUOA 1S6LA 5IYDJ 4ASNA 3BTCA 4BU2A 3J7AO 2Q8KA 3G73A 3K4MA 5J8FA 2MSYA 4EJTA 3OWTA 2QYOA 4HSRA 4XN0A 4B4CA 4HV6A 2DA3A 2FEZA 3RSNA 4BDYA 4U0YA 3N05A 2RKHA 3ZQIA 3C2GA 3CQZJ 5F04A 2R5ZA 1IGNA 2O03A 1RIOH 2HQ5A 3KP4A 5GTIC 3W2WA 4UUSA 1D3YA 2E7WA 3OIOA 4M9SA 3R61A 1K6OA 1MDMB 4XBFA 1Z1DA 2EQRA 4LG0A 3PFYA 2A05A 3HHGA 4BJ6C 2DFHA 4EJOA 2R4GA 3BR1A 4CDGA 4NNJA 1USSA 1TNTA 2MD0A 2NVUB 2LMDA 3TP0A 1Y6IA 1OFCX 2JSPA 3HOZJ 4XONA 3I59B 3IRQA 2F48A 5E1XA 4MEXF 1LFBA 1FNNA 3L00A 4HYEA 2LTPA 3RYRA 3RDIA 3A03A 3S32A 3WODF 1X1PA 2LBFB 3QP5A 1VQPI 5FKMA 1OYYA 3QPHA 2W25A 3JTGA 1FSHA 2HKXA 1KQ0A 3W6JB 2AO9A 5FO5A 4BGDA 3A0HC 1TW3A 3I4PA 2CH0A 2VC0A 1YW7A 4PDKA 4Y7NJ 1K6YA 1PUFA 2H1KA 2W85A 3AG3H 5D8KB 3K1MA 3TGNA 2A68F 2PMZA 1X1CA 3K70D 4CCJA 3WHCA 4UVBA 4KT6A 1GT0C 4F92B 2XRNA 3MN2A 1JT6A 6PAXA 2QA4I 1T33A 1Z9CA 2FNPA 3LSTA 3F3XA 2L9SA 4CUGA 2EFQA 3HUGB 3PO3J 4U7BA 2W57A 4XKCA 2GOXB 1FPQA 1D1AA 5EZGA 2V6CA 2OAZA 5AIQA 1XX5A 2VT3A 1UG2A 3WTUC 2XGDA 1SD4A 1RUNA 1J0RA 1TWGJ 2X0LA 2L9NA 4BBRJ 1B8IA 2O61A 3KP6A 1J9IA 5LRRA 1VQLI 1WQ2A 3H3ZA 2HU9A 1I27A 2ZXJA 3CUQB 3OYLA 3QYEA 4AU7A 3E6DA 5K5OA 3MZYA 3PL8A 2EWNA 2EA2A 3S3MA 2V79A 3WU0A 4ON0A 5HDKA 5LGTA 5E3NA 1X2MA 2O8XA 1JE8A 3EUHC 3LSRA 2PJRB 5J1UA 2DK5A 4ZYGA 3HOUJ 2V1UA 3W2AA 4A3FJ 2GAUA 4RGXA 3OYAA 2QQ9A 2DODA 1BC8C 2IA0A 4GFBA 3E7LA 3I71A 4WXDA 2WAQN 4B09A 3UKGA 2LG4A 1RI7A 1TP4A 5CYVA 5L3DA 1ZR2A 2D1HA 2IS2A 5CVIA 1X58A 4M71A 5EDNA 4BBSJ 3R0JA 4Q5SF 3HYIA 3A02A 3J7AY 2VBZA 5F1RA 2Z33A 4BXUA 4L5JA 3RZOJ 2LC2A 5JVGF 3F8BA 2ZXIA 2R7UA 2W00A 1MBJA 4XLAA 1FMVA 5B1BH 5HODA 1AKHA 1AA7A 3W3CA 4JP0A 2ZSHB 2BYVE 1YJWI 3K4NA 1XGMA 2QQBA 4I01A 5GTHC 2HYFA 5EG0B 3R6SA 3GTGJ 2VBXA 3QU3A 1UHMA 1GXQA 5J8CA 4G8XA 3TQNA 1BI1A 1X3UA 1IO2A 3TDZC 2CU7A 3H5NA 4MTEA 3JR9A 4FX0A 4XM3A 1IRFA 4CA0A 2F5VA 1XMXA 2G7HA 2WBMA 3QP6A 3BZCA 3KPHA 1MJ9A 3ROUA 3TW7A 2XF5A 2JJ7A 4HRIA 4BY7J 2R5ZB 4G9YA 1Z7UA 2RDPA 3OYBA 2Z3YA 1HC8A 3CC7I 3FXMA 3C2HA 2F5EA 1O3RA 4N9HA 3KEOA 2DJNA 1TQMA 1VNDA 1TQPA 4IX7A 2WAEA 1YX5A 4FE7A 4XR6A 2PLYA 1X1AA 1FYMA 2FNAA 5EJCA 2IGNA 3SZPA 3CLQA 2CW8A 1CF7A 5CQGA 1RNLA 1WWXA 1DPRA 5IP7J 2BBYA 4PUSA 1ZG3A 5TGTA 1HF0A 2K40A 2L02A 1XG1A 1M1EB 2D1VA 3FF5A 1PUEE 4IJAA 3ZQQA 4E7SA 3JREA 1WJCA 1SVOA 4MQVA 3U21A 2CGPA 4RB3C 2QKMB 1TWFJ 2RC4A 3ASOH 3U1DA 1N77A 3CMAI 2I10A 4HG2A 2R7SA 4JYKA 4ZYDA 1JTYA 1G6NA 3CMMA 2GOMA 5D8LB 3SEZA 1UB9A 5ILVA 4J00A 3GMEA 5DDGA 1XB4A 3VB2A 4Z6YA 5F08A 4OMZA 4KICA 2OZUA 5E1WA 1XTAA 3JRIA 2DBBA 2H8WA 3SYTA 5BS6A 1ZR4A 2PN6A 1KZHA 3M3YJ 5IT9K 2PMUA 2NS7A 4S0HB 3C7JA 5HDNA 1B9NA 4HX8A 1HSTA 3EYYA 1EF4A 3ML6A 3P9CA 1TTYA 1JKOC 2HDCA 2CUEA 1BI3A 1GVJA 3OOUA 1I6XA 3PNYA 1DDNA 2J5OA 4KT5C 1MMNA 2LYCA 3NEUA 5EEHA 4RB1A 1G3TA 3PUBA 3BG7A 4M3DA 1P4XA 4YFNF 2COBA 4B44A 3EUKL 3MKWB 2WAQA 1YS7A 1B8IB 1IRGA 1ZGJA 2LDUA 3V42A 4YIIA 5FKLA 4BQNA 3I55I 5F0HA 5EZHA 3A01B 1MIJA 3CJNA 4ENMA 3P9KA 3A0BC 1Y8RB 5DCMA 3IKTA 2CW7A 3D5RC 1WJDA 5DS9A 3LSGA 1KGSA 4XQFA 5EGOA 3C1DA 1OCOH 1LQ1A 2HOAA 3AAFA 2RQPA 2X1EA 4JOMA 1T0FC 3S17J 4IOAF 2EJRA 2KRCA 4DZPA 4AM3A 3Q0WA 1USTA 2EZHA 2F6CA 4G94A 1QVUA 3WGGA 4KMUX 4RDUA 2E71A 4UB6C 1ZYRF 3E6MA 3KP3A 1OPCA 1I1GA 2P81A 5GAEJ 2NNNA 3BC8A 5FLVA 3JRBA 1R22A 4GGGA 1BN5A 3Q3SA 2NOJB 1R1TA 1TNSA 1MMDA 1R4NB 3ZOBA 4P96A 4HA8A 4IXAA 1FTZA 4IRIA 4UNOA 3DPTA 3E0JB 2CRGA 4UVCA 2AQFA 2BEOA 3I9V2 3OSGA 2JA2A 1U0JA 2HDWA 1ETQA 2ZSIB 3FHNA 3QWLA 4CICA 3KE2A 3BG6A 2M4KA 2PQ8A 1AKHB 1C0WA 1QZYA 4HEA2 3SJMA 3C3WA 5B3SH 2ZMEA 3KZYA 3MD2A 4AD9A 5L3BA 1Y8QB 1J59A 3K70C 1D0XA 4FISA 2Z2SB 3OYCA 2VIXA 2WTEA 2KZGA 5HNFA 1G59A 3DBHB 4GDFA 1JGSA 4F3QA 2V1NA 3IL2A 3L2VA 2QSHX 3OL4A 1VQ6I 2BVMA 1SEUA 1IUFA 5ERIA 4OIRF 4U0WA 4C30A 2MH9A 2BHZA 2G9WA 2XC7A 3KYLA 1TT5B 3KP7A 2HQNA 3L9FA 3CCLI 4AWXB 3ZQGA 1IW7F 3MKYB 2LP0A 4KFCA 1Y1WJ 5IYCJ 3FXKA 2P4WA 1BJZA 5FKNA 4L9NA 2P7VB 1JKPC 3BTJA 1QBJA 1JHFA 1MJBA 2VOOA 1RPWA 4IEJA 5IT9Z 3MVPA 4I02A 5C4JJ 2EIJH 2A6TA 4C2TA 4J19A 1I3AA 1R6RA 1E3OC 1RKTA 5KHDA 5CVVA 3FKJA 2V9KA 1V4RA 1RR8C 1SFOJ 1R5GA 3IH2A 3MQ0A 2MC3A 5HOOA 1KYZA 4RS8A 2K9MA 4NHJA 3HB9A 4PK4A 4RM2A 2DPDA 4QLCU 2ETHA 2V7FA 1FTTA 3CJTB 3HJEA 4EQQA 4BACA 2TCTA 5DD4A 2M7BA 2E2HJ 3CDLA 2ID3A 1JI8A 3RPUD 2K85A 2E35A 1XSVA 5F64A 2O8KA 3ERED 4C9YA 2TRTA 1W5TA 3CDHA 1MDMA 2R7VA 3O2PE 3VFZA 1HA8A 2VQGA 2R3SA 1K83J 1V5GA 2DK8A 2DFFA 3G6EI 3SEQA 2KL4A 3QAHA 2CV0A 4P9UA 3T8TA 4C2UA 1RR7A 1EA3A 3BDDA 2JTVA 3GTLJ 3KP5A 4PCQA 1FOKA 3HRSA 2FF4A 2OUMA 1ON2A 4M3GA 3I59A 5KK1A 4AIHA 4IPAA 4X0GA 1POGA 5IT3A 5ILSA 1LFUP 2XPVA 5J1YA 1I1SA 2LBFA 2MLGA 4W1UA 3ZGKA 2B0LA 4AVZA 2VKVA 5FFXA 3ZN1A 2FSWA 5A2QK 3OS1A 1BR2A 4BKXA 4XKBA 5ICFA 2R7RA 5FD5A 1QVTA 2MGQA 4A3EJ 1GV2A 1WGXA 3CMYA 1I3QJ 4ZC3A 3ONQA 2HFHA 2L0KA 3F8NA 1HDPA 1HSJA 5B1AH 2RNGA 4FX4A 4PGGA 4JX6A 2YPRA 3OS0A 3S1NJ 4OOIA 3DEUA 4AUXA 2IJLA 1ZG5A 5LEKA 2V26A 3WTXC 4HV5A 2TDXA 5K5QA 5HLHA 3RKWA 2X48A 3HSFA 4D1QA 4G7ZF 3PQKA 3HUGA 4F93B 3ZMDA 1F36A 4HW0A 4OIQF 4ETSA 9ANTA 5GPCA 4KN4X 3D1NI 3I4MJ 5K7ZA 1N25A 2A07F 1B6AA 3BOQA 3HGGA 4A3DJ 1LDKB 3R0AA 2XPWA 1U2WA 4EM2A 4N4OB 1MBHA 2PMZN 4XLNF 4KN7X 3H9GA 2UXNA 3GFLA 3A2KA 2DOFA 1V54H 2CS3A 2VPLA 1OJLA 1R36A 2ZNZA 4IO9F 4XLEA 3P5JA 5J4VA 3CUQA 5LLQA 4ZTFA 2JA5J 4BHPA 2P5LC 2OPTA 3BLYA 3GTPJ 4A69C 4V2FA 1G3WA 1SMYF 3JW4A 4C3IJ 3KEQA 3GBGA 2K9LA 2PJRA 1X4OA 2EZKA 2LKSA 2DA5A 4M3BA 4ENKA 3HEFA 4HNTA 2O3FA 4OIOF 5LD2C 4XRSG 2R7FA 2XF7A 3H0DA 3MZHA 2XASA 3M4OJ 1MMSA 2IW5A 1QGPA 3Q5FA 2X1DA 3WG9A 3DU6A 1DGWY 4W97A 5CVUA 4HQMA 2E2JJ 1UAAA 1FX7A 3B6AA 5IY5H 2VJ4A 3S14J 4OWRB 3DXJF 3I58A 2KP6A 5FB2A 4XLHA 1I6HJ 2X9DA 5K5RA 1SC7A 2LR8A 3DQVC 3DTIA 5EEAA 2C6YA 2IGOA 2JUGA 3F8FA 1XDSA 1YTYA 4D7MA 4GCVA 4RB2C 4GRIA 3BJ6A 4EGZA 1D8JA 1F1ZA 3ABKH 3I54A 4RAYA 4BUPA 1XN7A 4ZYAA 4P5OA 3K4JA 4PJLA 3AL0C 4CCNA 2EV0A 2DOEA 1YFHA 3U1KA 2HDDA 3HPGA 4A93J 2CG4A 2A69F 3PM1A 4DIQA 2MLKA 4LG3A 2M4GA 1K78B 1LFPA 5IP6A 3F23A 1BA5A 1L0OC 3G2BA 2BHYA 1T95A 4B47A 3S3NA 3CMEI 1JKRC 2I8DA 2A61A 5FLXK 3QODA 4B3AA 5KAIC 2V4JC 3CDIA 5A2QZ 3NAUA 4XLPF 2H1LA 4AIDA 5F27A 3S2WA 1I5ZA 2DMTA 3QRFF 2FOWA 4YFXF 2HVRA 2PMHA 5IOZA 2IT0A 3ABUA 3NWSA 1PP8F 4LJZF 4D7NA 1XGSA 2STWA 1B4AA 3M7GA 2KZVA 3TO7A 4A5MA 5D6FA 2BV6A 2DMUA 2QENA 2K4JA 3BJAA 4XL9A 2OC6A 2NOGA 1SD7A 3JSPA 3ZRGA 2JRMA 4UHTA 3AG4H 3MWMA 4YIFA 1ZRDA 3V4GA 4D5CA 2E1CA 4A6DA 3AFHA 1U5TA 1YRNA 2CV1A 5BOXA 1IV6A 4OU0A 3K9TA 3F9KA 4C2MJ 1FJLA 2JWTA 2Y48A 1YQAA 4MLOA 3HL2A 1W0UA 4Y52J 2ACJA 4HF1A 3DLAA 3NWTA 5BPDA 1NG7A 4M9ZA 3PIPF 3DTEA 2VPRA 4FQGA 2E60A 4IOCF 1YE9A 3KCCA 3HZJA 1IN7A 1NTCA 4LIVA 4ZJZA 2AHQA 4E7IA 4DZJA 2PEXA 2HQAA 3EDPA 4KNYA 4UV9A 2CW0F 2QWWA 2Z16A 2RQQA 2IP2A 2QSGX 5LHGA 3ASNH 3BG3A 3HRTA 4IHYA 3EQLF 3K6GA 4KDPA 3R4KA 3WU2C 2V1XA 4LOCA 5HVQC 3WTWC 2IXSA 1XSDA 3OYNA 2VKDA 5DM7F 4E7KA 1U78A 5IP9J 4GXOA 1WCMJ 2CQKA 4BYYA 5DYMA 2QEXI 3I0TA 3HTSB 2XV4S 1O4XA 3QPLA 4B48A 1ZELA 2YUSA 1S72I 2QQ8A 4A3CJ 2CMPA 3L2UA 1XC5A 1QPIA 1SFKA 3IWZA 3A01A 1JUPA 1FMWA 1V5EA 2XIGA 1T39A 1WI3A 3FDYA 4A3LJ 1SVMA 1T2KA 4DGWB 4IHXA 5E17F 3K2AA 4M74A 2RV8A 4P55A 1ULYA 1DUXC 1HKSA 2RVCA 4Y15A 4DYCA 1WPKA 3CCUI 1XSXA 2F5FA 4DBRA 2VKHA 1HCRA 4N9IA 4RAFA 1ZGAA 2OZ6A 3VOEA 3JRCA 4HPQA 5FLXZ 2CQQA 2P0WA 4A3MJ 3I56I 2IEKA 4A0ZA 5C4XJ 3T1BA 4EMSA 4KA4A 2VN2A 1V55H 1LEBA 4E7JA 2Y0SA 2JN6A 2DQLA 1UELB 5LRSA 2ECCA 1ACIA 1O57A 4L18B 3M8JA 3ECOA 2ELKA 2FE3A 2MA3A 2P6SA 3DKXA 4FHTA 2DXIA 1VQMI 1WI9A 1BW6A 1YYVA 2BOLA 3L2QA 2VJ5A 3M8EA 4RA2A 3OIQA 4AYBA 2ADUA 1MZBA 4HLXA 4KIFA 3GVAA 1QRYA 1YLFA 1SANA 2WB1A 3QPSA 4HLYA 3VWBA 4IKFA 3SHFA 2HYJA 4XRFA 1J09A 2JT1A 2GQQA 4MFDA 2L7FP 3COAC 2E36A 4O5VA 1BW5A 3TKYA 4PZJA 3ISPA 4PSXA 1JUSA 1S9HA 2QQAA 4PJJA 3ZXSA 3GYHX 4IRHA 1E3PA 1ZAOA 3QU6A 2XF6A 1DU0A 1HW1A 1MJAA 5ICGA 5D5VB 3W6VA 1T8IA 2P6TA 3ZMUA 4C3JJ 4G6TB 2XGXA 3FBIB 5HLTA 2MD5A 3L7WA 1W7PB 3MAJA 5HDGA 1JXSA 2K9QA 2DFIA 5CJ9A 3EUHA 3LSKA 3DEEA 1R23A 2F4OB 3WE3A 1R71A 1XGOA 4WX9A 2GZWA 2VL8A 4A0YA 1G2HA 3GTQJ 3OYKA 4EJUA 1FP1D 1FLIA 2V9PA 3OMYA 2H27A 3RKYA 3HXLA 2OTLI 3BZ6A 2M3AA 2CQXA 3CZ6A 3JRAA 1B9MA 3KETA 1APLC 3BR3A 2CQ7A 3ZMVA 2GWRA 4FETA 2M8GX 4II2A 2HKOA 2OV7A 3I4NJ 2KIUA 1YO5C 4M6YA 1NHAA 2EZLA 3I3LA 1P7JA 4DQ2A 2LOOA 3A1YA 3LA7A 4DBQA 2NVXJ 3F72A 4U7DA 1F4KA 1KONA 3HSEA 1U5TB 1YRNB 4GYIA 1MGTA 4HOBA 3AL0B 3IH3A 4RMNA 3GLLA 1OCZH 5TJJA 2A6EF 3RJPA 3TMOA 2LKXA 2KPMA 2RNJA 1N78A 2ID6A 3LSMA 2VASA 4BH9A 3BZKA 3LA2A 3V7SA 5FLMJ 1BR1A 4XSZF 2O5RA 5E8IA 2CWEA 2DU9A 1HW5A 1P6RA 3SFZA 1YIOA 2DT7B 2BXYA 4ENNA 1H88C 5FFZA 3D0SA 1FBSA 3GEZA 4HNVA 3FIWA 2K3PA 3PQJA 1BBYA 4NBQA 3L2RA 3DKYA 5LEJA 3S1MJ 4A3BJ 3OIPA 3REOA 1WJAA 3WTYC 1OKRA 1UMQA 2QLZA 2NVYJ 2M1BA
chains in the Genus database with same CATH topology
3WE2A 1HKQA 2CFXA 3DFGA 4ZH4F 3E6BA 2DW4A 3KLNA 3E5UA 1R7JA 4LLLA 4RAZA 2VT2A 2DT5A 4IRGA 2JPBA 1S8NA 2LF8A 4LB6B 1KU2A 3K1PA 1ONVA 3EETA 1HKTA 2JPCA 1ZRFA 3DV8A 2EV5A 1IF1A 1P4AA 2NRAC 1SAXA 4PGHA 3FM5A 2A6HF 4WXCA 2EB7A 5D4SA 2NNYA 2GA1A 3GW2A 1F9NA 4A5NA 2ZCWA 1FP2A 1BJAA 2RGVA 3P9IA 4I98B 1A04A 3M1EA 4WCGA 4IHSA 2IPQX 1OYWA 3WTZA 1K7AA 2Z9OA 1S3JA 3T5XA 4OINF 1IN6A 4UUVA 2L4AA 4UXNA 1R1UA 4M9XA 2EFOA 4BAYA 2LF7A 2NS0A 4E70A 3TOBA 2M30A 2ISYA 2HS5A 2HYGD 4CYDA 3WGIA 4JBAA 4Q47A 3SQNA 2YU3A 2ZKZA 1WSUA 2XHKA 5AIPA 5CVJA 2EFWA 1O3TA 5JI6A 1XMKA 2HWVA 1T0FA 3ZMSA 4M6XA 2VXZA 2VC1A 2BE5F 3BP8A 4ESJA 3HOSA 4WWCA 2EA4A 5HLGA 5JFRA 1K78A 3F21A 2XVCA 2D2WA 3BPVA 2JRTA 2PG4A 1TLHB 4B8XA 3V7CA 2IA2A 3N97A 4Y17A 1IXCA 4EM0B 1U3EM 3I53A 2HTSA 4RGRA 2L4MA 4P9FA 2VONA 5JVTA 3I64A 3KP2A 4LMYA 1Z91A 2Z5UA 1EH7A 3CTAA 3ECHA 2XAFA 4WXHA 3RPQA 2HQRA 3F8CA 2HOEA 1QPMA 1REPC 2QM3A 1IZ1A 3B02A 2PI0A 3RKXA 1ON1A 3C18A 5FD6A 2XKPA 4Q48A 4GO1A 1O3QA 1FWZA 1V3FA 1LEAA 4CZZA 1YW9A 1J5YA 2L3DA 5F6FA 1H9TA 2M8EA 4RGUA 1R1VA 4I09A 3J80K 1K79A 1QZZA 2W24A 4R8HA 4LB5A 4LK0F 5D5UB 2KIFA 3L2CA 1O3SA 1VTNC 4G7OF 2BGCA 5D6EA 2NAZA 2K86A 4F7ZA 1OMIA 3ZN0A 5DUKA 5CVRA 2LSOA 1P2FA 5KVRA 2P5VA 2G7UA 2FMLA 2UXXA 4K2EA 3TO9A 1W4MA 2DO7A 3K1NA 2VBWA 2M5WA 1KU7A 1WKMA 1S7AA 2DI3A 3WTTC 2COMA 3ZQ7A 4CGZA 2M45A 2WC2A 4FT8A 3KLOA 3GFIA 1XD7A 2Q0OA 3GXOA 4HDUA 4CO8A 1T98A 2DPUA 3IHUA 5HLIA 3FXRA 4ZYHA 4L5IA 2F5DA 2HR3A 2AXLA 2OA4A 2FBHA 4KIGA 1BIAA 4I2OA 3GZ6A 2RN7A 3ZMTA 1BIBA 1L3LA 1U8RA 5CLSA 1E17A 1SD6A 1HBXG 1IUYA 1TQIA 4WK8F 1H0MA 3I5UA 2IA1A 4UVAA 3GUDA 3OOPA 4ZYEA 1SFUA 4AIKA 3ZP5A 4CHUA 2VE8A 2F5CA 1T38A 5L3EA 1IAWA 2FXAA 2EFNA 3IKVA 1J7KA 3M8FA 1ZREA 3IWFA 2NYXA 5DUIA 3QPTA 3MEXA 1HXDA 1ZRCA 1PP7U 3J80Z 1W7PA 1GHCA 2WV0A 3DKWA 1O7FA 1IN5A 5K1YA 3V8JA 4D0PA 4BNCA 4NB5A 5ICEA 4ZZDA 2QBYB 1UCRA 1FYLA 4ENJA 1YG2A 1W5SA 3SZTA 3HRMA 3GO5A 1LDJA 3J81K 1KYWA 2LKPA 3Q9SA 2P5KA 3DF8A 1E2XA 2OU2A 2K02A 2STTA 3HRUA 4A2UA 4O3MA 1R5HA 5E18F 4DNCA 3WGHA 1ZN2A 2ESNA 2ELHA 4I0AA 2P7CB 5HS7A 1ZLJA 5D5XB 5ILUA 3U9GA 3HOTA 2UWMA 2HTJA 4N0BA 2VODA 1PDNC 4LGWA 3FZVA 2JZYA 4RGSA 3SXYA 4HQEA 1XDUA 1IXRC 3JAMK 2OD5A 3IRRA 1G3SA 5D4RA 2FBKA 3E97A 3MFKA 2H94A 3BY6A 2K7LA 1SD5A 5E20A 3VODA 4IHTA 4L9VA 3N4MA 2M87A 4LFUA 4A12A 3O6BB 2HGCA 4HX7A 5E1ZB 1LNWA 4WF2A 1G4DA 1O7LA 5D5WB 5LHIA 2FBIA 3GZ5A 4M73A 4BHBA 3LQQA 3T0YA 1SMTA 4Q4ZF 2GXGA 2H6CA 3FXUA 1Y0UA 2F2EA 4EM1A 4CXFA 4Y13A 1KU9A 3CLOA 1J75A 2XROA 1FSEA 5J6XA 1UFMA 2E1NA 1HW2A 3ZPLA 1LVAA 3QOPA 3K2ZA 2OQRA 2K27A 3J81Z 2MH2A 2OBPA 4KIBA 5ICCA 1U6GA 2QUFA 3H92A 5H6RA 2ZBKA 3GFJA 4LLNA 5AONA 3RPUA 3TO6A 1HQCA 3LAJA 2J5PA 1G3YA 2FU4A 3RTRA 3LWFA 2CYYA 2XAHA 3E5XA 1GXPA 1S7OA 1P4WA 1FY7A 2V9VA 5L3FA 2PJPA 3ULQB 3GFMA 3TDUC 3TOAA 4U0VA 4OMYA 1AOYA 3JAMZ 1FBUA 4M72A 1QQIA 1R58A 3ZMZA 1IN4A 1ZH5A 2QVOA 1TW2A 4LG0B 3GX4X 1TBXA 2EFPA 2AS5F 3FMRA 3VEPA 2D45A 4L0YB 4YFKF 3KZZA 4O6JA 4HF0A 3B73A 1ODDA 4EJWA 3HHHA 3WU1B 4QWQA 3KFWX 5ED4A 2XAQA 4U88A 3LQRA 3BPXA 2CO5A 5EEGA 2ESHA 4R1HA 3ABTA 2FMYA 1SFEA 3EYIA 2A5YB 1EV7A 2Y75A 4JQFA 1W7PD 2ZJ2A 4AIJA 1BOAA 4ESBA 4L9JA 5JHUA 4S05A 2YX7A 5BMZA 1RZ4A 2ZNYA 3CO6C 3NRVA 3GWZA 4GYGA 4IVNA 2VE9A 5H20A 3K69A 2A3SA 2YX4A 2W84A 4HAMA 2H6BA 2DLLA 3FXQA 3FMQA 1XCBA 3PFIA 2KIMA 3D5LA 1MKMA 1IXSB 2EV6A 3FX3A 4A6EA 2JSCA 4LLGF 1UHWA 3F6OA 2E7XA 4Z2YA 1BC7C 4OIPF 1FT9A 5DD8A 3V8KA 1Z6TA 2GIVA 5HS9A 2VOPA 4LD5A 1H9GA 3L09A 3F22A 1BI2A 1EH6A 2KRFA 3V7RA 4UV8A 5LGUA 3RIRA 2WWYA 2KJCA 4IF4A 3JSOA 1LB2A 2VBYA 5L3CA 2R7DA 1F5TA 1R00A 4KUMA 5DEQA 3U2RA 2HZTA 1Z6RA 1S29A 1KQ9A 1FBQA 1SFXA 3T8RA 5HS8A 2X4HA 4HDVA 4EJVA 3WTVC 4G6DA 2FQ3A 1FYKA 4KYWA 5BPIA 2KKOA 3CUOA 4TV7A 1B59A 1FC3A 2V1DA 4YG2F 2PFBA 5DCFA 2DAOA 3G3ZA 2O6GE 2ZFWA 2XAJA 1BM9A 2O0YA 4RB0A 3M9AA 3NQOA 4EV0A 3OV8A 1STZA 3JTHA 4XSXF 4MNUA 3V8LA 1B1BA 3E6CC 4AVPA 1KQ8A 3E5QA 2EK5A 2IVMA 2CSOA 3DPLC 4BHCA 5FGMA 1D5VA 4S04A 3P7NA 2FOKA 2FA5A 4EGYA 1CF7B 2QBYA 4HZFA 4HBLA 2MBFA 3BROA 1WRJA 5LGNA 2Z99A 5DV5A 1LJ9A 2P8TA 1JHHA 3O3KA 1FZPB 3R60A 3WTSC 3BWGA 2L01A 2ZO4A 4MTDA 1P92A 1J2XA 3HIFA 1IN8A 3CUQC 2DTRA 4MEYF 2UZKA 1YW8A 1D8KA 4EVIA 3LFKA 4BQAA 3LA3A 5LHHA 4L0ZB 2YR2A 1ZLKA 5TRDA 4MGRA 3FHZA 2XKOA 4R79A 1Q1HA 4NQWA 2XUBA 2GXBA 2HEOA 1LDDA 3W6KB 2H09A 2DQRA 2LNBA 1KU3A 5DCMB 3HTUA 2ISZA 4KMFA 4LK1F 2YSRA 2Q2EA 4HF2A 3K0LA 2FRHA 4JK1X 1XCVA 1QO0D 5LBQA 4ESFA 1AWCA 3RYPA 3CO7C 4G7HF 3DP7A 2GA2A 1ZHFA 4ZZLA 3FWEA 1XMAA 2XAGA 3BJOA 4HX4A 3E3VA 4H0EA 3GF2A 3FMSA 2L54A 3FM3A 4A0XA 3Q9VA 1Z05A 1CGPA 3IC7A 2KJBA 2QZ8A 5JR3A 1ZARA 5L3GA 2Y0MA 2ZMEB 3F8MA 1DP7P 1BI0A 1OR7A 2OQGA 1OYIA 1KA8A 1QNTA 3RI4A 4G6QA 5H6QA 2K4BA 1DPUA 5BQTA 1EH8A 3HSRA 3ELKA 1YS6A 3LAPA 1U5TC 4MQ9F 3GLXA 1T6SA 3MCZA 4I7HA 2PBIA 3H3UA 5E8GA 1ZG1A 4L9TA 1MD0A 2IRFG 4MHGA 1XGNA 4I0BA 1RUOA 1S6LA 4ASNA 3J7AO 2Q8KA 3G73A 5J8FA 4EJTA 2QYOA 4HV6A 2FEZA 4U0YA 2RKHA 2O03A 1RIOH 3KP4A 1D3YA 2E7WA 4M9SA 3R61A 1K6OA 1MDMB 4XBFA 1Z1DA 4LG0A 3HHGA 4EJOA 4CDGA 1USSA 1TNTA 3IRQA 3I59B 5E1XA 4MEXF 1FNNA 3L00A 4HYEA 3RYRA 3RDIA 3WODF 3QP5A 1OYYA 3QPHA 2W25A 3JTGA 1FSHA 2HKXA 1KQ0A 3W6JB 5FO5A 1TW3A 3I4PA 2VC0A 1YW7A 4PDKA 2W85A 5D8KB 3K1MA 3TGNA 2A68F 4UVBA 2XRNA 6PAXA 1Z9CA 2FNPA 3LSTA 3F3XA 2EFQA 4U7BA 2W57A 1FPQA 2V6CA 2OAZA 5AIQA 2VT3A 3WTUC 1SD4A 1RUNA 1J0RA 2X0LA 2O61A 3KP6A 1J9IA 5LRRA 1WQ2A 3H3ZA 1I27A 2ZXJA 3CUQB 3E6DA 5K5OA 3MZYA 2EWNA 2EA2A 2V79A 3WU0A 4ON0A 5HDKA 5LGTA 2O8XA 1JE8A 2DK5A 4ZYGA 2V1UA 2GAUA 4RGXA 2QQ9A 1BC8C 2IA0A 3I71A 4WXDA 4B09A 1RI7A 5CYVA 5L3DA 2D1HA 5CVIA 4M71A 3R0JA 4Q5SF 3HYIA 2VBZA 5F1RA 2Z33A 4BXUA 4L5JA 3F8BA 2BYVE 1XGMA 2QQBA 4I01A 2HYFA 3R6SA 2VBXA 3QU3A 1UHMA 1GXQA 5J8CA 4G8XA 3TQNA 1BI1A 1X3UA 3TDZC 4MTEA 4FX0A 1IRFA 2G7HA 3QP6A 1MJ9A 3ROUA 4G9YA 1Z7UA 2RDPA 2Z3YA 2F5EA 1O3RA 4N9HA 3KEOA 1TQMA 1TQPA 2PLYA 1FYMA 2FNAA 3SZPA 1CF7A 1RNLA 1WWXA 1DPRA 2BBYA 1ZG3A 2L02A 2D1VA 3FF5A 1PUEE 4IJAA 4MQVA 2CGPA 4RB3C 2RC4A 3U1DA 4ZYDA 1G6NA 5D8LB 1UB9A 5ILVA 5DDGA 1XB4A 3VB2A 4OMZA 4KICA 2OZUA 5E1WA 2DBBA 5BS6A 2PN6A 5IT9K 2PMUA 3C7JA 5HDNA 1B9NA 4HX8A 1HSTA 3EYYA 3ML6A 3P9CA 1TTYA 2HDCA 1BI3A 1GVJA 1I6XA 1DDNA 2J5OA 4KT5C 3NEUA 5EEHA 4RB1A 1G3TA 1P4XA 4YFNF 1YS7A 1IRGA 1ZGJA 2LDUA 4YIIA 4ENMA 3CJNA 3P9KA 5DCMA 3IKTA 1KGSA 3C1DA 1LQ1A 3AAFA 2RQPA 2EJRA 1USTA 4G94A 3WGGA 4KMUX 1ZYRF 3E6MA 3KP3A 1OPCA 1I1GA 2NNNA 1R22A 4GGGA 1BN5A 1R1TA 1TNSA 4P96A 4HA8A 4IXAA 4IRIA 4UNOA 3DPTA 4UVCA 2BEOA 4CICA 3KE2A 2PQ8A 1C0WA 1QZYA 3C3WA 2ZMEA 3KZYA 4AD9A 5L3BA 1J59A 2WTEA 1JGSA 3IL2A 5ERIA 4OIRF 4U0WA 2MH9A 2G9WA 3KP7A 2HQNA 3L9FA 4AWXB 1IW7F 4KFCA 2P4WA 4L9NA 2P7VB 1QBJA 1JHFA 1MJBA 2VOOA 5IT9Z 4I02A 5CVVA 1V4RA 1R5GA 3MQ0A 2MC3A 5HOOA 1KYZA 4RS8A 4NHJA 2DPDA 4QLCU 2ETHA 4EQQA 5DD4A 1XSVA 5F64A 3ERED 1W5TA 3CDHA 1MDMA 3O2PE 3VFZA 2R3SA 2DK8A 3QAHA 4P9UA 3T8TA 3BDDA 2JTVA 3KP5A 4PCQA 1FOKA 3HRSA 2FF4A 1ON2A 5KK1A 3I59A 4AIHA 4IPAA 5IT3A 5ILSA 1I1SA 2MLGA 2B0LA 5FFXA 3ZN1A 2FSWA 5A2QK 5ICFA 5FD5A 2HFHA 3F8NA 1HSJA 4FX4A 4PGGA 2YPRA 4OOIA 3DEUA 1ZG5A 2IJLA 5LEKA 3WTXC 4HV5A 2TDXA 5K5QA 5HLHA 3RKWA 3HSFA 4G7ZF 3PQKA 3HUGA 3ZMDA 4HW0A 4OIQF 4ETSA 4KN4X 2A07F 1B6AA 3BOQA 1LDKB 3R0AA 1U2WA 4EM2A 4XLNF 4KN7X 2UXNA 3GFLA 1R36A 2ZNZA 3CUQA 5LLQA 4BHPA 2P5LC 1G3WA 1SMYF 3JW4A 3KEQA 4ENKA 4OIOF 2O3FA 2R7FA 3MZHA 2XASA 2IW5A 1QGPA 3Q5FA 3WG9A 5CVUA 4HQMA 1FX7A 3DXJF 3I58A 5FB2A 5K5RA 3DQVC 2C6YA 3F8FA 1XDSA 1YTYA 4GCVA 4RB2C 3BJ6A 4EGZA 1D8JA 1F1ZA 3I54A 4RAYA 1XN7A 4P5OA 2EV0A 1YFHA 2CG4A 2A69F 2MLKA 1K78B 3F23A 1L0OC 2A61A 5FLXK 5A2QZ 4XLPF 3S2WA 1I5ZA 3QRFF 4YFXF 2PMHA 2IT0A 3ABUA 1PP8F 4LJZF 1XGSA 2STWA 1B4AA 3M7GA 3TO7A 4A5MA 5D6FA 2BV6A 2QENA 2K4JA 3BJAA 3JSPA 1SD7A 4UHTA 3MWMA 4YIFA 1ZRDA 3V4GA 2E1CA 4A6DA 1U5TA 5BOXA 4OU0A 3K9TA 2Y48A 1YQAA 2ACJA 4HF1A 5BPDA 4M9ZA 3KCCA 1IN7A 2PEXA 3EDPA 4KNYA 4UV9A 2CW0F 2QWWA 2IP2A 5LHGA 3HRTA 3EQLF 4KDPA 3R4KA 2V1XA 5HVQC 3WTWC 1XSDA 1U78A 4GXOA 2CQKA 4BYYA 5DYMA 3I0TA 3HTSB 2XV4S 3IWZA 2XIGA 1T39A 1T2KA 5E17F 4M74A 2RV8A 4P55A 1ULYA 1DUXC 1HKSA 2RVCA 4Y15A 1XSXA 2F5FA 4N9IA 1ZGAA 2OZ6A 3VOEA 5FLXZ 4A0ZA 3T1BA 4EMSA 4KA4A 2VN2A 1LEBA 2DQLA 5LRSA 1O57A 4L18B 3ECOA 2FE3A 2MA3A 2P6SA 4FHTA 1WI9A 1YYVA 3M8EA 2ADUA 1MZBA 4HLXA 4KIFA 3GVAA 1YLFA 4HLYA 3SHFA 4XRFA 2JT1A 2GQQA 3COAC 4O5VA 3TKYA 4PZJA 3ISPA 2QQAA 3GYHX 4IRHA 1ZAOA 3QU6A 1HW1A 1MJAA 5ICGA 5D5VB 2P6TA 3ZMUA 2XGXA 2MD5A 3L7WA 1W7PB 3MAJA 5HDGA 1JXSA 2DFIA 5CJ9A 3EUHA 1R23A 3WE3A 1XGOA 4WX9A 2GZWA 4A0YA 4EJUA 1FP1D 1FLIA 2H27A 3RKYA 3BZ6A 1B9MA 3KETA 3ZMVA 2GWRA 2HKOA 2KIUA 1YO5C 4M6YA 1NHAA 4DQ2A 3LA7A 3F72A 4U7DA 1F4KA 3HSEA 1U5TB 4GYIA 1MGTA 4HOBA 5TJJA 2A6EF 3RJPA 2RNJA 4BH9A 3LA2A 3V7SA 4XSZF 5E8IA 2CWEA 2DU9A 1HW5A 1P6RA 3SFZA 1YIOA 4ENNA 5FFZA 3D0SA 1FBSA 3GEZA 3PQJA 1BBYA 5LEJA 3REOA 3WTYC 1OKRA 3F6VA 2QLZA 2M1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WE2 A;  1HKQ A;  2CFX A;  3DFG A;  4ZH4 F;  3E6B A;  2DW4 A;  3KLN A;  3E5U A;  1R7J A;  4LLL A;  4RAZ A;  2VT2 A;  2DT5 A;  4IRG A;  2JPB A;  1S8N A;  2LF8 A;  4LB6 B;  1KU2 A;  3K1P A;  1ONV A;  3EET A;  1HKT A;  2JPC A;  1ZRF A;  3DV8 A;  2EV5 A;  1IF1 A;  1P4A A;  2NRA C;  1SAX A;  4PGH A;  3FM5 A;  2A6H F;  4WXC A;  2EB7 A;  5D4S A;  2NNY A;  2GA1 A;  3GW2 A;  1F9N A;  4A5N A;  2ZCW A;  1FP2 A;  1BJA A;  2RGV A;  3P9I A;  4I98 B;  1A04 A;  3M1E A;  4WCG A;  4IHS A;  2IPQ X;  1OYW A;  3WTZ A;  1K7A A;  2Z9O A;  1S3J A;  3T5X A;  4OIN F;  1IN6 A;  4UUV A;  2L4A A;  4UXN A;  1R1U A;  4M9X A;  2EFO A;  4BAY A;  2LF7 A;  2NS0 A;  4E70 A;  3TOB A;  2M30 A;  2ISY A;  2HS5 A;  2HYG D;  4CYD A;  3WGI A;  4JBA A;  4Q47 A;  3SQN A;  2YU3 A;  2ZKZ A;  1WSU A;  2XHK A;  5AIP A;  5CVJ A;  2EFW A;  1O3T A;  5JI6 A;  1XMK A;  2HWV A;  1T0F A;  3ZMS A;  4M6X A;  2VXZ A;  2VC1 A;  2BE5 F;  3BP8 A;  4ESJ A;  3HOS A;  4WWC A;  2EA4 A;  5HLG A;  5JFR A;  1K78 A;  3F21 A;  2XVC A;  2D2W A;  3BPV A;  2JRT A;  2PG4 A;  1TLH B;  4B8X A;  3V7C A;  2IA2 A;  3N97 A;  4Y17 A;  1IXC A;  4EM0 B;  1U3E M;  3I53 A;  2HTS A;  4RGR A;  2L4M A;  4P9F A;  2VON A;  5JVT A;  3I64 A;  3KP2 A;  4LMY A;  1Z91 A;  2Z5U A;  1EH7 A;  3CTA A;  3ECH A;  2XAF A;  4WXH A;  3RPQ A;  2HQR A;  3F8C A;  2HOE A;  1QPM A;  1REP C;  2QM3 A;  1IZ1 A;  3B02 A;  2PI0 A;  3RKX A;  1ON1 A;  3C18 A;  5FD6 A;  2XKP A;  4Q48 A;  4GO1 A;  1O3Q A;  1FWZ A;  1V3F A;  1LEA A;  4CZZ A;  1YW9 A;  1J5Y A;  2L3D A;  5F6F A;  1H9T A;  2M8E A;  4RGU A;  1R1V A;  4I09 A;  3J80 K;  1K79 A;  1QZZ A;  2W24 A;  4R8H A;  4LB5 A;  4LK0 F;  5D5U B;  2KIF A;  3L2C A;  1O3S A;  1VTN C;  4G7O F;  2BGC A;  5D6E A;  2NAZ A;  2K86 A;  4F7Z A;  1OMI A;  3ZN0 A;  5DUK A;  5CVR A;  2LSO A;  1P2F A;  5KVR A;  2P5V A;  2G7U A;  2FML A;  2UXX A;  4K2E A;  3TO9 A;  1W4M A;  2DO7 A;  3K1N A;  2VBW A;  2M5W A;  1KU7 A;  1WKM A;  1S7A A;  2DI3 A;  3WTT C;  2COM A;  3ZQ7 A;  4CGZ A;  2M45 A;  2WC2 A;  4FT8 A;  3KLO A;  3GFI A;  1XD7 A;  2Q0O A;  3GXO A;  4HDU A;  4CO8 A;  1T98 A;  2DPU A;  3IHU A;  5HLI A;  3FXR A;  4ZYH A;  4L5I A;  2F5D A;  2HR3 A;  2AXL A;  2OA4 A;  2FBH A;  4KIG A;  1BIA A;  4I2O A;  3GZ6 A;  2RN7 A;  3ZMT A;  1BIB A;  1L3L A;  1U8R A;  5CLS A;  1E17 A;  1SD6 A;  1HBX G;  1IUY A;  1TQI A;  4WK8 F;  1H0M A;  3I5U A;  2IA1 A;  4UVA A;  3GUD A;  3OOP A;  4ZYE A;  1SFU A;  4AIK A;  3ZP5 A;  4CHU A;  2VE8 A;  2F5C A;  1T38 A;  5L3E A;  1IAW A;  2FXA A;  2EFN A;  3IKV A;  1J7K A;  3M8F A;  1ZRE A;  3IWF A;  2NYX A;  5DUI A;  3QPT A;  3MEX A;  1HXD A;  1ZRC A;  1PP7 U;  3J80 Z;  1W7P A;  1GHC A;  2WV0 A;  3DKW A;  1O7F A;  1IN5 A;  5K1Y A;  3V8J A;  4D0P A;  4BNC A;  4NB5 A;  5ICE A;  4ZZD A;  2QBY B;  1UCR A;  1FYL A;  4ENJ A;  1YG2 A;  1W5S A;  3SZT A;  3HRM A;  3GO5 A;  1LDJ A;  3J81 K;  1KYW A;  2LKP A;  3Q9S A;  2P5K A;  3DF8 A;  1E2X A;  2OU2 A;  2K02 A;  2STT A;  3HRU A;  4A2U A;  4O3M A;  1R5H A;  5E18 F;  4DNC A;  3WGH A;  1ZN2 A;  2ESN A;  2ELH A;  4I0A A;  2P7C B;  5HS7 A;  1ZLJ A;  5D5X B;  5ILU A;  3U9G A;  3HOT A;  2UWM A;  2HTJ A;  4N0B A;  2VOD A;  1PDN C;  4LGW A;  3FZV A;  2JZY A;  4RGS A;  3SXY A;  4HQE A;  1XDU A;  1IXR C;  3JAM K;  2OD5 A;  3IRR A;  1G3S A;  5D4R A;  2FBK A;  3E97 A;  3MFK A;  2H94 A;  3BY6 A;  2K7L A;  1SD5 A;  5E20 A;  3VOD A;  4IHT A;  4L9V A;  3N4M A;  2M87 A;  4LFU A;  4A12 A;  3O6B B;  2HGC A;  4HX7 A;  5E1Z B;  1LNW A;  4WF2 A;  1G4D A;  1O7L A;  5D5W B;  5LHI A;  2FBI A;  3GZ5 A;  4M73 A;  4BHB A;  3LQQ A;  3T0Y A;  1SMT A;  4Q4Z F;  2GXG A;  2H6C A;  3FXU A;  1Y0U A;  2F2E A;  4EM1 A;  4CXF A;  4Y13 A;  1KU9 A;  3CLO A;  1J75 A;  2XRO A;  1FSE A;  5J6X A;  1UFM A;  2E1N A;  1HW2 A;  3ZPL A;  1LVA A;  3QOP A;  3K2Z A;  2OQR A;  2K27 A;  3J81 Z;  2MH2 A;  2OBP A;  4KIB A;  5ICC A;  1U6G A;  2QUF A;  3H92 A;  5H6R A;  2ZBK A;  3GFJ A;  4LLN A;  5AON A;  3RPU A;  3TO6 A;  1HQC A;  3LAJ A;  2J5P A;  1G3Y A;  2FU4 A;  3RTR A;  3LWF A;  2CYY A;  2XAH A;  3E5X A;  1GXP A;  1S7O A;  1P4W A;  1FY7 A;  2V9V A;  5L3F A;  2PJP A;  3ULQ B;  3GFM A;  3TDU C;  3TOA A;  4U0V A;  4OMY A;  1AOY A;  3JAM Z;  1FBU A;  4M72 A;  1QQI A;  1R58 A;  3ZMZ A;  1IN4 A;  1ZH5 A;  2QVO A;  1TW2 A;  4LG0 B;  3GX4 X;  1TBX A;  2EFP A;  2AS5 F;  3FMR A;  3VEP A;  2D45 A;  4L0Y B;  4YFK F;  3KZZ A;  4O6J A;  4HF0 A;  3B73 A;  1ODD A;  4EJW A;  3HHH A;  3WU1 B;  4QWQ A;  3KFW X;  5ED4 A;  2XAQ A;  4U88 A;  3LQR A;  3BPX A;  2CO5 A;  5EEG A;  2ESH A;  4R1H A;  3ABT A;  2FMY A;  1SFE A;  3EYI A;  2A5Y B;  1EV7 A;  2Y75 A;  4JQF A;  1W7P D;  2ZJ2 A;  4AIJ A;  1BOA A;  4ESB A;  4L9J A;  5JHU A;  4S05 A;  2YX7 A;  5BMZ A;  1RZ4 A;  2ZNY A;  3CO6 C;  3NRV A;  3GWZ A;  4GYG A;  4IVN A;  2VE9 A;  5H20 A;  3K69 A;  2A3S A;  2YX4 A;  2W84 A;  4HAM A;  2H6B A;  2DLL A;  3FXQ A;  3FMQ A;  1XCB A;  3PFI A;  2KIM A;  3D5L A;  1MKM A;  1IXS B;  2EV6 A;  3FX3 A;  4A6E A;  2JSC A;  4LLG F;  1UHW A;  3F6O A;  2E7X A;  4Z2Y A;  1BC7 C;  4OIP F;  1FT9 A;  5DD8 A;  3V8K A;  1Z6T A;  2GIV A;  5HS9 A;  2VOP A;  4LD5 A;  1H9G A;  3L09 A;  3F22 A;  1BI2 A;  1EH6 A;  2KRF A;  3V7R A;  4UV8 A;  5LGU A;  3RIR A;  2WWY A;  2KJC A;  4IF4 A;  3JSO A;  1LB2 A;  2VBY A;  5L3C A;  2R7D A;  1F5T A;  1R00 A;  4KUM A;  5DEQ A;  3U2R A;  2HZT A;  1Z6R A;  1S29 A;  1KQ9 A;  1FBQ A;  1SFX A;  3T8R A;  5HS8 A;  2X4H A;  4HDV A;  4EJV A;  3WTV C;  4G6D A;  2FQ3 A;  1FYK A;  4KYW A;  5BPI A;  2KKO A;  3CUO A;  4TV7 A;  1B59 A;  1FC3 A;  2V1D A;  4YG2 F;  2PFB A;  5DCF A;  2DAO A;  3G3Z A;  2O6G E;  2ZFW A;  2XAJ A;  1BM9 A;  2O0Y A;  4RB0 A;  3M9A A;  3NQO A;  4EV0 A;  3OV8 A;  1STZ A;  3JTH A;  4XSX F;  4MNU A;  3V8L A;  1B1B A;  3E6C C;  4AVP A;  1KQ8 A;  3E5Q A;  2EK5 A;  2IVM A;  2CSO A;  3DPL C;  4BHC A;  5FGM A;  1D5V A;  4S04 A;  3P7N A;  2FOK A;  2FA5 A;  4EGY A;  1CF7 B;  2QBY A;  4HZF A;  4HBL A;  2MBF A;  3BRO A;  1WRJ A;  5LGN A;  2Z99 A;  5DV5 A;  1LJ9 A;  2P8T A;  1JHH A;  3O3K A;  1FZP B;  3R60 A;  3WTS C;  3BWG A;  2L01 A;  2ZO4 A;  4MTD A;  1P92 A;  1J2X A;  3HIF A;  1IN8 A;  3CUQ C;  2DTR A;  4MEY F;  2UZK A;  1YW8 A;  1D8K A;  4EVI A;  3LFK A;  4BQA A;  3LA3 A;  5LHH A;  4L0Z B;  2YR2 A;  1ZLK A;  5TRD A;  4MGR A;  3FHZ A;  2XKO A;  4R79 A;  1Q1H A;  4NQW A;  2XUB A;  2GXB A;  2HEO A;  1LDD A;  3W6K B;  2H09 A;  2DQR A;  2LNB A;  1KU3 A;  5DCM B;  3HTU A;  2ISZ A;  4KMF A;  4LK1 F;  2YSR A;  2Q2E A;  4HF2 A;  3K0L A;  2FRH A;  4JK1 X;  1XCV A;  1QO0 D;  5LBQ A;  4ESF A;  1AWC A;  3RYP A;  3CO7 C;  4G7H F;  3DP7 A;  2GA2 A;  1ZHF A;  4ZZL A;  3FWE A;  1XMA A;  2XAG A;  3BJO A;  4HX4 A;  3E3V A;  4H0E A;  3GF2 A;  3FMS A;  2L54 A;  3FM3 A;  4A0X A;  3Q9V A;  1Z05 A;  1CGP A;  3IC7 A;  2KJB A;  2QZ8 A;  5JR3 A;  1ZAR A;  5L3G A;  2Y0M A;  2ZME B;  3F8M A;  1DP7 P;  1BI0 A;  1OR7 A;  2OQG A;  1OYI A;  1KA8 A;  1QNT A;  3RI4 A;  4G6Q A;  5H6Q A;  2K4B A;  1DPU A;  5BQT A;  1EH8 A;  3HSR A;  3ELK A;  1YS6 A;  3LAP A;  1U5T C;  4MQ9 F;  3GLX A;  1T6S A;  3MCZ A;  4I7H A;  2PBI A;  3H3U A;  5E8G A;  1ZG1 A;  4L9T A;  1MD0 A;  2IRF G;  4MHG A;  1XGN A;  4I0B A;  1RUO A;  1S6L A;  4ASN A;  3J7A O;  2Q8K A;  3G73 A;  5J8F A;  4EJT A;  2QYO A;  4HV6 A;  2FEZ A;  4U0Y A;  2RKH A;  2O03 A;  1RIO H;  3KP4 A;  1D3Y A;  2E7W A;  4M9S A;  3R61 A;  1K6O A;  1MDM B;  4XBF A;  1Z1D A;  4LG0 A;  3HHG A;  4EJO A;  4CDG A;  1USS A;  1TNT A;  3IRQ A;  3I59 B;  5E1X A;  4MEX F;  1FNN A;  3L00 A;  4HYE A;  3RYR A;  3RDI A;  3WOD F;  3QP5 A;  1OYY A;  3QPH A;  2W25 A;  3JTG A;  1FSH A;  2HKX A;  1KQ0 A;  3W6J B;  5FO5 A;  1TW3 A;  3I4P A;  2VC0 A;  1YW7 A;  4PDK A;  2W85 A;  5D8K B;  3K1M A;  3TGN A;  2A68 F;  4UVB A;  2XRN A;  6PAX A;  1Z9C A;  2FNP A;  3LST A;  3F3X A;  2EFQ A;  4U7B A;  2W57 A;  1FPQ A;  2V6C A;  2OAZ A;  5AIQ A;  2VT3 A;  3WTU C;  1SD4 A;  1RUN A;  1J0R A;  2X0L A;  2O61 A;  3KP6 A;  1J9I A;  5LRR A;  1WQ2 A;  3H3Z A;  1I27 A;  2ZXJ A;  3CUQ B;  3E6D A;  5K5O A;  3MZY A;  2EWN A;  2EA2 A;  2V79 A;  3WU0 A;  4ON0 A;  5HDK A;  5LGT A;  2O8X A;  1JE8 A;  2DK5 A;  4ZYG A;  2V1U A;  2GAU A;  4RGX A;  2QQ9 A;  1BC8 C;  2IA0 A;  3I71 A;  4WXD A;  4B09 A;  1RI7 A;  5CYV A;  5L3D A;  2D1H A;  5CVI A;  4M71 A;  3R0J A;  4Q5S F;  3HYI A;  2VBZ A;  5F1R A;  2Z33 A;  4BXU A;  4L5J A;  3F8B A;  2BYV E;  1XGM A;  2QQB A;  4I01 A;  2HYF A;  3R6S A;  2VBX A;  3QU3 A;  1UHM A;  1GXQ A;  5J8C A;  4G8X A;  3TQN A;  1BI1 A;  1X3U A;  3TDZ C;  4MTE A;  4FX0 A;  1IRF A;  2G7H A;  3QP6 A;  1MJ9 A;  3ROU A;  4G9Y A;  1Z7U A;  2RDP A;  2Z3Y A;  2F5E A;  1O3R A;  4N9H A;  3KEO A;  1TQM A;  1TQP A;  2PLY A;  1FYM A;  2FNA A;  3SZP A;  1CF7 A;  1RNL A;  1WWX A;  1DPR A;  2BBY A;  1ZG3 A;  2L02 A;  2D1V A;  3FF5 A;  1PUE E;  4IJA A;  4MQV A;  2CGP A;  4RB3 C;  2RC4 A;  3U1D A;  4ZYD A;  1G6N A;  5D8L B;  1UB9 A;  5ILV A;  5DDG A;  1XB4 A;  3VB2 A;  4OMZ A;  4KIC A;  2OZU A;  5E1W A;  2DBB A;  5BS6 A;  2PN6 A;  5IT9 K;  2PMU A;  3C7J A;  5HDN A;  1B9N A;  4HX8 A;  1HST A;  3EYY A;  3ML6 A;  3P9C A;  1TTY A;  2HDC A;  1BI3 A;  1GVJ A;  1I6X A;  1DDN A;  2J5O A;  4KT5 C;  3NEU A;  5EEH A;  4RB1 A;  1G3T A;  1P4X A;  4YFN F;  1YS7 A;  1IRG A;  1ZGJ A;  2LDU A;  4YII A;  4ENM A;  3CJN A;  3P9K A;  5DCM A;  3IKT A;  1KGS A;  3C1D A;  1LQ1 A;  3AAF A;  2RQP A;  2EJR A;  1UST A;  4G94 A;  3WGG A;  4KMU X;  1ZYR F;  3E6M A;  3KP3 A;  1OPC A;  1I1G A;  2NNN A;  1R22 A;  4GGG A;  1BN5 A;  1R1T A;  1TNS A;  4P96 A;  4HA8 A;  4IXA A;  4IRI A;  4UNO A;  3DPT A;  4UVC A;  2BEO A;  4CIC A;  3KE2 A;  2PQ8 A;  1C0W A;  1QZY A;  3C3W A;  2ZME A;  3KZY A;  4AD9 A;  5L3B A;  1J59 A;  2WTE A;  1JGS A;  3IL2 A;  5ERI A;  4OIR F;  4U0W A;  2MH9 A;  2G9W A;  3KP7 A;  2HQN A;  3L9F A;  4AWX B;  1IW7 F;  4KFC A;  2P4W A;  4L9N A;  2P7V B;  1QBJ A;  1JHF A;  1MJB A;  2VOO A;  5IT9 Z;  4I02 A;  5CVV A;  1V4R A;  1R5G A;  3MQ0 A;  2MC3 A;  5HOO A;  1KYZ A;  4RS8 A;  4NHJ A;  2DPD A;  4QLC U;  2ETH A;  4EQQ A;  5DD4 A;  1XSV A;  5F64 A;  3ERE D;  1W5T A;  3CDH A;  1MDM A;  3O2P E;  3VFZ A;  2R3S A;  2DK8 A;  3QAH A;  4P9U A;  3T8T A;  3BDD A;  2JTV A;  3KP5 A;  4PCQ A;  1FOK A;  3HRS A;  2FF4 A;  1ON2 A;  5KK1 A;  3I59 A;  4AIH A;  4IPA A;  5IT3 A;  5ILS A;  1I1S A;  2MLG A;  2B0L A;  5FFX A;  3ZN1 A;  2FSW A;  5A2Q K;  5ICF A;  5FD5 A;  2HFH A;  3F8N A;  1HSJ A;  4FX4 A;  4PGG A;  2YPR A;  4OOI A;  3DEU A;  1ZG5 A;  2IJL A;  5LEK A;  3WTX C;  4HV5 A;  2TDX A;  5K5Q A;  5HLH A;  3RKW A;  3HSF A;  4G7Z F;  3PQK A;  3HUG A;  3ZMD A;  4HW0 A;  4OIQ F;  4ETS A;  4KN4 X;  2A07 F;  1B6A A;  3BOQ A;  1LDK B;  3R0A A;  1U2W A;  4EM2 A;  4XLN F;  4KN7 X;  2UXN A;  3GFL A;  1R36 A;  2ZNZ A;  3CUQ A;  5LLQ A;  4BHP A;  2P5L C;  1G3W A;  1SMY F;  3JW4 A;  3KEQ A;  4ENK A;  4OIO F;  2O3F A;  2R7F A;  3MZH A;  2XAS A;  2IW5 A;  1QGP A;  3Q5F A;  3WG9 A;  5CVU A;  4HQM A;  1FX7 A;  3DXJ F;  3I58 A;  5FB2 A;  5K5R A;  3DQV C;  2C6Y A;  3F8F A;  1XDS A;  1YTY A;  4GCV A;  4RB2 C;  3BJ6 A;  4EGZ A;  1D8J A;  1F1Z A;  3I54 A;  4RAY A;  1XN7 A;  4P5O A;  2EV0 A;  1YFH A;  2CG4 A;  2A69 F;  2MLK A;  1K78 B;  3F23 A;  1L0O C;  2A61 A;  5FLX K;  5A2Q Z;  4XLP F;  3S2W A;  1I5Z A;  3QRF F;  4YFX F;  2PMH A;  2IT0 A;  3ABU A;  1PP8 F;  4LJZ F;  1XGS A;  2STW A;  1B4A A;  3M7G A;  3TO7 A;  4A5M A;  5D6F A;  2BV6 A;  2QEN A;  2K4J A;  3BJA A;  3JSP A;  1SD7 A;  4UHT A;  3MWM A;  4YIF A;  1ZRD A;  3V4G A;  2E1C A;  4A6D A;  1U5T A;  5BOX A;  4OU0 A;  3K9T A;  2Y48 A;  1YQA A;  2ACJ A;  4HF1 A;  5BPD A;  4M9Z A;  3KCC A;  1IN7 A;  2PEX A;  3EDP A;  4KNY A;  4UV9 A;  2CW0 F;  2QWW A;  2IP2 A;  5LHG A;  3HRT A;  3EQL F;  4KDP A;  3R4K A;  2V1X A;  5HVQ C;  3WTW C;  1XSD A;  1U78 A;  4GXO A;  2CQK A;  4BYY A;  5DYM A;  3I0T A;  3HTS B;  2XV4 S;  3IWZ A;  2XIG A;  1T39 A;  1T2K A;  5E17 F;  4M74 A;  2RV8 A;  4P55 A;  1ULY A;  1DUX C;  1HKS A;  2RVC A;  4Y15 A;  1XSX A;  2F5F A;  4N9I A;  1ZGA A;  2OZ6 A;  3VOE A;  5FLX Z;  4A0Z A;  3T1B A;  4EMS A;  4KA4 A;  2VN2 A;  1LEB A;  2DQL A;  5LRS A;  1O57 A;  4L18 B;  3ECO A;  2FE3 A;  2MA3 A;  2P6S A;  4FHT A;  1WI9 A;  1YYV A;  3M8E A;  2ADU A;  1MZB A;  4HLX A;  4KIF A;  3GVA A;  1YLF A;  4HLY A;  3SHF A;  4XRF A;  2JT1 A;  2GQQ A;  3COA C;  4O5V A;  3TKY A;  4PZJ A;  3ISP A;  2QQA A;  3GYH X;  4IRH A;  1ZAO A;  3QU6 A;  1HW1 A;  1MJA A;  5ICG A;  5D5V B;  2P6T A;  3ZMU A;  2XGX A;  2MD5 A;  3L7W A;  1W7P B;  3MAJ A;  5HDG A;  1JXS A;  2DFI A;  5CJ9 A;  3EUH A;  1R23 A;  3WE3 A;  1XGO A;  4WX9 A;  2GZW A;  4A0Y A;  4EJU A;  1FP1 D;  1FLI A;  2H27 A;  3RKY A;  3BZ6 A;  1B9M A;  3KET A;  3ZMV A;  2GWR A;  2HKO A;  2KIU A;  1YO5 C;  4M6Y A;  1NHA A;  4DQ2 A;  3LA7 A;  3F72 A;  4U7D A;  1F4K A;  3HSE A;  1U5T B;  4GYI A;  1MGT A;  4HOB A;  5TJJ A;  2A6E F;  3RJP A;  2RNJ A;  4BH9 A;  3LA2 A;  3V7S A;  4XSZ F;  5E8I A;  2CWE A;  2DU9 A;  1HW5 A;  1P6R A;  3SFZ A;  1YIO A;  4ENN A;  5FFZ A;  3D0S A;  1FBS A;  3GEZ A;  3PQJ A;  1BBY A;  5LEJ A;  3REO A;  3WTY C;  1OKR A;  3F6V A;  2QLZ A;  2M1B A; 
#chains in the Genus database with same CATH topology
 1TZL A;  3FK7 A;  3WE2 A;  1HKQ A;  3JRF A;  3ABM H;  3CCV I;  2CFX A;  2KIQ A;  2YU9 J;  3O8H A;  3MZ8 A;  1OCR H;  4KJZ A;  3DFG A;  3PJR A;  4ZH4 F;  3LSH A;  1DP3 A;  3E6B A;  2R5Y B;  3EUA A;  2DW4 A;  4M3F A;  4Y4R A;  3KLN A;  2DA1 A;  3DLL F;  3E5U A;  1R7J A;  4LLL A;  4RAZ A;  2VT2 A;  2DT5 A;  3DCF A;  1VQ5 I;  4IRG A;  1IJW C;  4ZDP A;  1X1D A;  2JPB A;  3LFU A;  1WJB A;  3DTK A;  4XLC A;  3LL7 A;  1S8N A;  3JRD A;  2LF8 A;  4ZTJ A;  1P7I A;  1KU2 A;  4II3 A;  4N4N B;  4LB6 B;  1MW7 A;  1ONV A;  3K1P A;  3QYB A;  3CC4 I;  2E5Z A;  3EET A;  4BJ5 C;  1HKT A;  1VI0 A;  3PO2 J;  2JPC A;  3G1M A;  1PJR A;  2R0Q C;  1ZRF A;  3DV8 A;  4A3K J;  2EV5 A;  2L5Q A;  1IF1 A;  2B63 J;  1P4A A;  1MSE C;  2VLA A;  2NRA C;  5E79 C;  1SAX A;  2VB6 A;  4YRV A;  1YX3 A;  4PGH A;  3FM5 A;  1Z3X A;  2HVQ A;  2A6H F;  4BE0 A;  4WXC A;  2XB5 A;  2EB7 A;  1X3W B;  4XNF A;  5D4S A;  2BXZ A;  1VQ4 I;  2X85 A;  2NNY A;  1K4S A;  2GA1 A;  1FEX A;  1YI2 I;  2ICW G;  1ITY A;  3GW2 A;  1RES A;  3ERM A;  1F9N A;  3GTO J;  4A5N A;  2ZCW A;  1FP2 A;  1BJA A;  2QSF X;  2RGV A;  3P9I A;  2VQH A;  4I98 B;  3PIO F;  1ZQ3 P;  1A04 A;  3M1E A;  4WCG A;  4IHS A;  2HI3 A;  2IPQ X;  1OYW A;  3PSF A;  1IC8 A;  3WTZ A;  1K7A A;  1UG0 A;  2M9H A;  2Y9Y A;  4I99 C;  1JGG A;  2Z9O A;  1S3J A;  3T5X A;  4OIN F;  5IPA A;  1IN6 A;  4UUV A;  2KFD A;  2L4A A;  4UXN A;  1R1U A;  2XDV A;  4M9X A;  2EFO A;  3OYG A;  1ZTR A;  1UZC A;  2BVL A;  2CFO A;  4BAY A;  2LF7 A;  2NS0 A;  4E70 A;  3TOB A;  2M30 A;  4E6K G;  3CCS I;  2ISY A;  2HS5 A;  2HYG D;  2GM4 A;  3IAS 2;  4HST A;  1IRX A;  4QTR A;  3OYJ A;  4CYD A;  1Y0N A;  5E3L A;  3WGI A;  4JBA A;  1WVR A;  4Q47 A;  2YU3 A;  2ZKZ A;  3SQN A;  4E7L A;  2XHK A;  1WSU A;  1EJ9 A;  2IBD A;  5AIP A;  2OTJ I;  2KQR A;  5CVJ A;  3OS2 A;  1DQU A;  2EFW A;  1O3T A;  3FXO A;  3QYF A;  4M6V A;  4BE2 A;  5JI6 A;  1XMK A;  2DDB A;  2HWV A;  4XRM A;  1T0F A;  2DYS H;  3ZMS A;  4M6X A;  2VXZ A;  2IS6 A;  2BZT A;  2VC1 A;  2BE5 F;  3C2B A;  3BP8 A;  4ESJ A;  3LSI A;  3HOS A;  4WWC A;  2EA4 A;  3BCA A;  2DDA A;  5JFR A;  5HLG A;  1K78 A;  3DU5 A;  3F21 A;  3VYS B;  2XVC A;  2D2W A;  3BPV A;  3KZI C;  2JRT A;  2PG4 A;  1TLH B;  4B8X A;  3V7C A;  2IA2 A;  3OY9 A;  3RZD J;  3N97 A;  4XN3 A;  3HBL A;  2DOA A;  4Y17 A;  1IXC A;  1ETO A;  2RAE A;  1FOW A;  2R7O A;  4EM0 B;  1U3E M;  1EKE A;  3I53 A;  2HTS A;  1JJ6 C;  2KDZ A;  4RGR A;  2L4M A;  2LLK A;  4P9F A;  1XPX A;  2VON A;  2DA6 A;  1BR4 A;  1WJF A;  4CYC A;  5JVT A;  1I50 J;  1PYV A;  4FCY A;  3I64 A;  3KP2 A;  4LMY A;  1RRJ A;  1Z91 A;  2XAU A;  3SZG A;  3KYC B;  3J7Y J;  4A3J J;  1X2N A;  2Z5U A;  1EH7 A;  3CTA A;  3ECH A;  2XAF A;  1E3H A;  4WXH A;  5M5W J;  1W1W E;  3RPQ A;  2VJI A;  2HQR A;  3F8C A;  4YEJ A;  3LSJ A;  5H2F C;  5K7H A;  5M3F J;  2HOE A;  3HOY J;  3JCU C;  1QPM A;  1REP C;  2QM3 A;  4MFE A;  3DEW A;  3CCR I;  1IZ1 A;  2CV2 A;  2DMQ A;  3B02 A;  3J7Z I;  5TIS C;  2PI0 A;  3RKX A;  4IZZ A;  1ON1 A;  3C18 A;  5CKT A;  5FD6 A;  3HKZ A;  2XKP A;  4IQJ A;  3VYR B;  4Q48 A;  3KX2 A;  1A35 A;  3CES A;  4GO1 A;  1O3Q A;  1FWZ A;  1V3F A;  2OCE A;  2Z1D A;  4L5E A;  2MW8 A;  1LEA A;  3F0C A;  4CZZ A;  2YS9 A;  1YW9 A;  3M07 A;  1MSF C;  1IV8 A;  1J5Y A;  2WY8 Q;  3UR3 C;  2L3D A;  1TT0 A;  5F6F A;  1H9T A;  2CUF A;  2M8E A;  4RGU A;  1Z3Y A;  1R1V A;  4I09 A;  3J80 K;  1R9T J;  1K79 A;  1QZZ A;  2W24 A;  4R8H A;  4LB5 A;  4LK0 F;  2WAD A;  5D5U B;  2KIF A;  1X3Z B;  4ZDL A;  3RKQ A;  1MH3 A;  5LFA A;  3L2C A;  1O3S A;  3CCM I;  1VTN C;  4G7O F;  5KAF C;  4KIT B;  2BGC A;  5D6E A;  2NAZ A;  3S15 J;  1A6I A;  1NH3 A;  2K86 A;  4F7Z A;  1OMI A;  4BXX J;  2EIK H;  3ZN0 A;  1JKQ C;  1FOY A;  5DUK A;  1VZ0 A;  4BQO A;  5CVR A;  3MKZ A;  2LSO A;  1P2F A;  3BQZ A;  5FRO A;  1OR7 C;  5KVR A;  2F4M B;  2WV1 A;  2P5V A;  2G7U A;  3BG5 A;  2EIL H;  2LK2 A;  2L7Z A;  2FML A;  2UXX A;  3LOC A;  4K2E A;  1W4M A;  3TO9 A;  2DO7 A;  1JTX A;  3BR6 A;  2KMU A;  3KEY A;  3BR5 A;  3K1N A;  2VBW A;  2M5W A;  1KU7 A;  1WKM A;  5DTD A;  4KIS A;  1S7A A;  2DI3 A;  3H36 A;  2COM A;  3ZQ7 A;  3WTT C;  4CGZ A;  4BDZ A;  2M45 A;  2LY1 A;  2WC2 A;  4FT8 A;  3OYM A;  2Y9Z A;  4CH7 A;  3KLO A;  3GFI A;  2K3F A;  4JX4 A;  4QPQ A;  1XD7 A;  2Q0O A;  3CCJ I;  3GXO A;  4HDU A;  4CO8 A;  1OIS A;  2L2O A;  1T98 A;  2DPU A;  2Y31 A;  3IHU A;  2DMN A;  1Y56 A;  5HLI A;  4XLF A;  3FXR A;  4ZYH A;  3OYD A;  4L5I A;  2F5D A;  4XK4 A;  2HR3 A;  3TP3 A;  1A36 A;  2QF7 A;  2AXL A;  2OA4 A;  2FBH A;  3PUF A;  2E5N A;  4KIG A;  1R5I D;  1BIA A;  5E3O A;  4I2O A;  3GZ6 A;  2RN7 A;  3ZMT A;  1BIB A;  1L3L A;  1U8R A;  5CLS A;  3X2Q H;  1E17 A;  1SD6 A;  4NDL A;  1HBX G;  1IUY A;  3BG9 A;  1TQI A;  4WK8 F;  1H0M A;  3I5U A;  2IA1 A;  4F52 A;  4UVA A;  3GUD A;  4IHV A;  2JA6 J;  3OOP A;  4ZYE A;  1SFU A;  4CCO A;  4U87 A;  4AIK A;  3ZP5 A;  1QHG A;  2XGE A;  3DBL B;  3ZQF A;  4CHU A;  5F0F A;  2KRH A;  2VE8 A;  1RKW A;  4CSW A;  2F5C A;  1T38 A;  5L3E A;  3IV5 A;  4NC7 A;  1IAW A;  2FXA A;  2EFN A;  5J4Y A;  3IKV A;  1ORK A;  1Z67 A;  1OCC H;  4UY8 I;  1D0Y A;  1J7K A;  3M8F A;  2EIN H;  2E1M C;  2Y0S N;  1ZRE A;  2R7Q A;  2WAF A;  5E3M A;  3IWF A;  4EAT A;  1G8X A;  3VPR A;  2NYX A;  5DUI A;  3QPT A;  3MEX A;  2OJE D;  4DYR A;  1HXD A;  1B72 B;  1ZRC A;  3H3V K;  1PP7 U;  1OQY A;  3J80 Z;  1SVL A;  4AYB N;  2ZJP F;  3FK6 A;  2ZJQ F;  1W7P A;  4J01 A;  2GIZ A;  4E7Z A;  2A5W A;  4CYC B;  2EIM H;  1GHC A;  2JUC A;  2WV0 A;  5FRN A;  3DKW A;  2NS8 A;  2WB1 N;  1O7F A;  1IN5 A;  4Y33 A;  1ZK8 A;  5K1Y A;  3V8J A;  4PFP A;  5BNG A;  1YJN I;  2MYS A;  4D0P A;  4BNC A;  4NB5 A;  1LE8 B;  3D5S C;  2X6W A;  5ICE A;  4ZZD A;  2QBY B;  1N75 A;  2MG4 A;  4I76 A;  1YOV B;  2L9V A;  1UCR A;  3FKI J;  4ENJ A;  1FYL A;  1YG2 A;  1PVE A;  3LMM A;  1W5S A;  3SZT A;  1FIP A;  1VF9 A;  4Y3O A;  2QCO A;  3CCE I;  5EF6 A;  1D1B A;  3G71 I;  4LIT A;  4FTH A;  3HRM A;  1MH4 A;  3GO5 A;  1LDJ A;  1U8B A;  2VQL A;  3J81 K;  1KYW A;  1MBE A;  1ZKG A;  2LKP A;  3RQI A;  3H1C A;  3Q0V A;  3Q9S A;  1VQO I;  2P5K A;  5KNL A;  2FX0 A;  3DF8 A;  1E2X A;  2OU2 A;  1HDD C;  2K02 A;  3VYT B;  2STT A;  3HRU A;  2XSD C;  4A2U A;  3H5A A;  4B3X A;  2HPM A;  4O3M A;  1R5H A;  2R93 J;  4AC0 A;  4RLF A;  3CP2 A;  5E18 F;  4DNC A;  3WGH A;  2E19 A;  1YJ9 I;  1S5L C;  1ZN2 A;  2ELH A;  2ESN A;  1WFX A;  3EPZ A;  1TC3 C;  4I0A A;  2P7C B;  5HS7 A;  1ZLJ A;  2FUG 2;  5D5X B;  4H4K C;  5ILU A;  3U9G A;  3HOT A;  2UWM A;  2HTJ A;  4N0B A;  2VOD A;  2I5U A;  5CPR B;  1PDN C;  2MC4 A;  4LGW A;  1MNM C;  2GBY A;  1H8A C;  3FZV A;  2LFB A;  2JZY A;  4RGS A;  3SXY A;  4HQE A;  4IQ4 A;  1XDU A;  1IXR C;  1MND A;  2OD5 A;  3K4C A;  3K4B A;  4BEH A;  3JAM K;  3IRR A;  4IL6 C;  4QSH A;  1G3S A;  5D4R A;  4NQW B;  3CF5 F;  1ETW A;  2FBK A;  1U9N A;  3E97 A;  3MFK A;  2VKE A;  2H94 A;  2N8G A;  3BY6 A;  3HDD A;  3SFI A;  3GTK J;  2K7L A;  4QIW N;  1SD5 A;  5E20 A;  2B9S A;  2R5Y A;  5IYB J;  1D0Z A;  5K7F A;  2K9S A;  4BL0 B;  2ZJR F;  2Q2E B;  4PSW A;  2X1C A;  2MFZ A;  3VOD A;  2QGU A;  4IHT A;  1WJ5 A;  1YIT I;  4L9V A;  4PJN A;  1MBK A;  2DFE A;  3N4M A;  2M87 A;  4LFU A;  2M34 A;  4A12 A;  3O8G A;  3O6B B;  2HGC A;  2M0M A;  2X6X A;  3QOE A;  4A3G J;  4HX7 A;  5E1Z B;  1LNW A;  5EYR A;  4WF2 A;  2HNH A;  1JT0 A;  1G4D A;  4BXF A;  4NUB A;  3VSK A;  1O7L A;  3ESW B;  1S7E A;  2KT0 A;  5D5W B;  5LHI A;  3S93 A;  1VQ9 I;  1QZE A;  2FBI A;  3GZ5 A;  4M73 A;  4BHB A;  4F91 B;  4XRS A;  5FJ8 J;  1NG6 A;  3LQQ A;  3T0Y A;  1Q1V A;  3IP4 B;  2DMP A;  1QA6 A;  3IH4 A;  1YIJ I;  1SMT A;  4Q4Z F;  4UB8 C;  2GXG A;  2BY2 A;  4B1R A;  2R7X A;  2H6C A;  3FXU A;  4BY1 J;  2X51 A;  4EEF G;  1Y0U A;  2F2E A;  4EM1 A;  1FOX A;  4CXF A;  4Y13 A;  3Q0U A;  1KU9 A;  1TWC J;  3CLO A;  1J75 A;  2UUZ A;  2O9L A;  2XRO A;  2ME0 A;  1FSE A;  4NC8 A;  5F1J A;  5J6X A;  1UFM A;  2DN0 A;  1BOB A;  2E1N A;  4CZC A;  1HW2 A;  3E1S A;  5B66 C;  1W36 D;  3ZPL A;  2LD5 A;  2ZXH A;  1LVA A;  3QOP A;  2IGM A;  4RLQ A;  1W0T A;  3K2Z A;  3L1P A;  2OQR A;  1AHD P;  1OCP A;  3HOW J;  3S3O A;  2K27 A;  1MMG A;  3J81 Z;  1Z21 A;  1GV5 A;  2MH2 A;  2OBP A;  4KIB A;  5ICC A;  4XIC A;  3TED A;  1U6G A;  4D5F A;  2QUF A;  3VSL A;  1GLN A;  3H92 A;  3S1Q J;  1XS9 A;  5H6R A;  2ZBK A;  3GFJ A;  4D9J A;  3ZQL A;  1ETV A;  2VUM J;  4LLN A;  5AON A;  3RPU A;  3CCY A;  1ETK A;  2CJJ A;  3TO6 A;  1HQC A;  3LAJ A;  3CJR B;  5C3E J;  2J5P A;  2AQE A;  1A6Q A;  1G3Y A;  4XOP A;  2FU4 A;  3RTR A;  2GXA A;  3LWF A;  5J47 A;  2CYY A;  2VI6 A;  1P9Q C;  2OCC H;  2XAH A;  3E5X A;  1GXP A;  3LSP A;  1QU3 A;  1U9O A;  1S7O A;  1P4W A;  1MNE A;  2JMW A;  1WH5 A;  4CCL A;  1FY7 A;  2HXI A;  2V9V A;  4RAG A;  3B6C A;  5L3F A;  2RRE A;  1LUJ B;  2PJP A;  3ULQ B;  3GFM A;  2XRL A;  1GUU A;  2BY1 A;  3SDG A;  3TDU C;  2DA7 A;  3TOA A;  4U0V A;  5J40 A;  5J1R A;  2ELJ A;  4OMY A;  1MMA A;  1T08 B;  1AOY A;  1FBU A;  4M72 A;  2DCE A;  2ECB A;  3JAM Z;  1QQI A;  1W5C C;  1R58 A;  4A3I J;  5IOY A;  3ZMZ A;  1DGR M;  2CUZ A;  2W1O A;  4UUS B;  1IN4 A;  3UNG C;  1ZH5 A;  3LNQ A;  5KCM A;  2AXT C;  5GP9 A;  5JLW A;  2QVO A;  1Z77 A;  2E2I J;  1TW2 A;  3GTM J;  1R4M B;  4ANJ A;  3GX4 X;  4LG0 B;  1TBX A;  2EFP A;  3CD6 I;  2AS5 F;  3FMR A;  3TL4 X;  3VEP A;  3WHB A;  4FAS D;  2D45 A;  4L0Y B;  4YFK F;  3KZZ A;  4O6J A;  1ZGW A;  4HF0 A;  3PSI A;  3IAM 2;  3RCO A;  3OYI A;  3B73 A;  1ODD A;  4EJW A;  3HHH A;  1A31 A;  4BS9 A;  3WU1 B;  3HOV J;  3FBN B;  4QWQ A;  3KFW X;  5ED4 A;  3HGY A;  2XAQ A;  4U88 A;  1IRZ A;  2E1M B;  2ZC2 A;  1WHU A;  3LQR A;  3BPX A;  3PNV A;  1OCT C;  1TL8 A;  2CO5 A;  4XOT A;  2JA7 J;  5EEG A;  2ESH A;  4OAY A;  5CQE A;  2LRE A;  3ABT A;  4R1H A;  2FMY A;  2IAI A;  1SFE A;  4C3H J;  2NVQ J;  3EYI A;  2A5Y B;  1EV7 A;  1TWH J;  1Y39 A;  2Y75 A;  4JQF A;  4MIM A;  2HOS A;  1W7P D;  2IGK A;  4FE4 A;  2ZJ2 A;  4AIJ A;  3K4K A;  1BOA A;  4BEH B;  4ESB A;  4L9J A;  3AG2 H;  5JHU A;  1PUF B;  4S05 A;  5FKO A;  4CCM A;  3S2D J;  2YX7 A;  2XGC A;  5BMZ A;  1WZ2 A;  4XKV A;  1RZ4 A;  2X6Y A;  1HOM A;  2ZNY A;  3CO6 C;  2VQC A;  3NRV A;  1H89 C;  4P1W A;  5GAD J;  3GWZ A;  4GYG A;  4IVN A;  2W7N A;  2VE9 A;  5H20 A;  1VQN I;  3K69 A;  2A3S A;  1X19 A;  2W48 A;  2YX4 A;  4X6A J;  2W84 A;  1Y1V J;  4HAM A;  2H6B A;  2DLL A;  5DM6 F;  4LIU A;  3VYU B;  3FXQ A;  3FMQ A;  2IS1 A;  3S16 J;  1XCB A;  1ETY A;  3K7A J;  3SDB A;  2R7T A;  2EPF A;  5GAG J;  3HKZ N;  2ZME C;  3PFI A;  2KIM A;  1Z7L A;  3MKL A;  3ZQH A;  3D5L A;  1MKM A;  1IXS B;  2EV6 A;  2OF7 A;  1ENH A;  3FX3 A;  1F43 A;  1D1C A;  4BE1 A;  2K9N A;  4A6E A;  2JSC A;  3W2V A;  4LLG F;  1UHW A;  2X6O A;  3F6O A;  4XOR A;  2E7X A;  5GAH J;  1X1B A;  4Z2Y A;  1BC7 C;  2W4S A;  4OIP F;  1FT9 A;  5DD8 A;  3V8K A;  1Z6T A;  1FIA A;  3AG1 H;  3VDX A;  2GIV A;  1NK2 P;  5HS9 A;  3OR2 C;  4ITV A;  3CP8 A;  2KHM A;  2VOP A;  2CQN A;  4LD5 A;  1H9G A;  2V6E A;  3L09 A;  2BY3 A;  3F22 A;  1LVK A;  1BI2 A;  1VFC A;  3KYD B;  1EH6 A;  3AKZ A;  2KRF A;  3OYE A;  2K5C A;  3S8P A;  1A5J A;  3V7R A;  4UV8 A;  2UV1 A;  2XB0 X;  3JRH A;  2EH3 A;  2LVS A;  3H0G J;  5LGU A;  3RIR A;  2WWY A;  2KJC A;  4IF4 A;  3JSO A;  4DOZ A;  1LB2 A;  2VBY A;  3F6V A;  5F0C A;  5L3C A;  2R7D A;  1F5T A;  1R00 A;  2ZB9 A;  4KUM A;  5DEQ A;  3U2R A;  2HZT A;  1IDY A;  1V5F A;  1Z6R A;  1JUM A;  2JK3 A;  4E4H A;  1S29 A;  2KDO A;  1KQ9 A;  1FBQ A;  3BR2 A;  1SFX A;  3T8R A;  5HS8 A;  2VJJ A;  2X4H A;  4RBO A;  4RM3 A;  1R49 A;  4DJA A;  4HDV A;  1ERD A;  2B7E A;  3ABL H;  4HNU A;  2WA0 A;  4EJV A;  4XKW A;  3WTV C;  4X1E A;  4G6D A;  1UHS A;  2FQ3 A;  1FYK A;  4KYW A;  4MO7 A;  2BW3 A;  5BPI A;  2KKO A;  3CUO A;  5M5X J;  4TV7 A;  1B59 A;  1FC3 A;  3HG9 A;  2V1D A;  4YG2 F;  2PFB A;  4CCK A;  3KIO A;  5DCF A;  2W82 A;  2DAO A;  3G3Z A;  3NAR A;  5J3L A;  2O6G E;  2ZFW A;  3CCQ I;  2XAJ A;  2M2E A;  1BM9 A;  2MAB A;  2BY0 A;  2O0Y A;  3IUO A;  4RB0 A;  2H8R A;  2R92 J;  3M9A A;  2IS4 A;  2LRD A;  3ZQC A;  2NVT J;  2EBI A;  3NQO A;  1VQ8 I;  1UJ8 A;  3M1C A;  2Y2Z A;  4EV0 A;  2R7Z J;  3OV8 A;  4XID A;  2NXN B;  1STZ A;  3JTH A;  4XSX F;  2JQ7 A;  4MNU A;  2ZXW H;  3V8L A;  4ABZ A;  2HXO A;  1B1B A;  3OYH A;  3BTL A;  1IG7 A;  3S2H J;  1Z0X A;  1B72 A;  4DW6 A;  3E6C C;  2DA4 A;  5JHF A;  4AVP A;  1KQ8 A;  5FKK A;  3E5Q A;  2EK5 A;  3ZCO A;  2IVM A;  2CSO A;  3DPL C;  1VQK I;  4BHC A;  3WG7 H;  5FGM A;  1D5V A;  3CJQ B;  4S04 A;  3OL3 A;  3P7N A;  2FOK A;  2FA5 A;  3BR0 A;  4EGY A;  1LE8 A;  3G1O A;  4DYQ A;  3DWL E;  2Q1Z B;  1CF7 B;  1MBF A;  2DYR H;  4HZF A;  2QBY A;  2L7K A;  1WH7 A;  4HBL A;  2MBF A;  3BRO A;  1WRJ A;  1ETX A;  5LGN A;  1W36 C;  1D5Y A;  4JX5 A;  2E1O A;  2Z99 A;  5DV5 A;  1K61 A;  2R7W A;  1SAU A;  3GCM A;  3BCB A;  1LJ9 A;  1X4P A;  2KIS A;  2DA2 A;  2P8T A;  1JHH A;  2DT6 A;  3O3K A;  1FZP B;  1E0E A;  2L7M P;  2Y69 H;  1BL0 A;  3G1L A;  3A4C A;  3R60 A;  3WTS C;  1JJ8 C;  3BWG A;  1T56 A;  2L01 A;  2ZO4 A;  4MTD A;  1P92 A;  1J2X A;  3HIF A;  1IN8 A;  3HPH A;  3HOX J;  2FQ4 A;  3L2W A;  3CUQ C;  2DTR A;  2E34 A;  4MEY F;  1OLT A;  2UZK A;  1DU6 A;  1YW8 A;  1D8K A;  4EVI A;  3LFK A;  2JVH A;  1YHQ I;  2FJ1 A;  3BTI A;  1AU7 A;  3H5R A;  3PNT A;  3LA3 A;  5LHH A;  4BQA A;  4BQQ A;  4UUT A;  2EZI A;  4L0Z B;  2YR2 A;  3TBI A;  1ZLK A;  2JVG A;  4NC6 A;  4MGR A;  5TRD A;  2HPI A;  5M5Y J;  3FHZ A;  2XKO A;  3JRG A;  4R79 A;  2PX9 A;  4B43 A;  1Q1H A;  4NQW A;  1RET A;  4M3E A;  3G4S I;  2XUB A;  2Y30 A;  2WY7 Q;  2GXB A;  2HEO A;  1LDD A;  4I6Z A;  3W6K B;  2H09 A;  2LY2 A;  2DQR A;  2LNB A;  1MBG A;  3FXJ A;  4ZDO A;  2M7A A;  3TW6 A;  5B5E C;  1KU3 A;  5DCM B;  3FIS A;  3HTU A;  1K4T A;  3HM5 A;  2ISZ A;  4KMF A;  5EGO B;  2ZFU A;  4LK1 F;  2L9R A;  2Q2E A;  2YSR A;  3CF2 A;  3DBR B;  5HNH A;  5FRM A;  2LY9 A;  3OR1 C;  4V2G A;  3DPU A;  4HF2 A;  3K0L A;  2FRH A;  3H9Q A;  4JK1 X;  3K4L A;  2D5V A;  1XCV A;  1QO0 D;  5GPA A;  5LBQ A;  4ESF A;  1AWC A;  2HOT A;  2QKL B;  2VXD A;  2O7O A;  3MMY B;  3RYP A;  3CO7 C;  4G7H F;  1NK3 P;  3DP7 A;  3CC2 I;  2GA2 A;  1ZHF A;  1QHH D;  3S1R J;  2HVS A;  3H35 A;  4ZZL A;  3FWE A;  1XMA A;  2XAG A;  3BJO A;  2XPU A;  1WJE A;  4HX4 A;  3E3V A;  5C44 J;  4QPO A;  1LPQ A;  2CUJ A;  2GLO A;  4YEL A;  4H0E A;  3GF2 A;  2G0E A;  2DJI A;  3FMS A;  3H9J A;  4XMY A;  2JA8 J;  2L54 A;  3FM3 A;  4A0X A;  4IHW A;  3Q9V A;  1Z05 A;  1CGP A;  1HLV A;  3IC7 A;  5M3M J;  2HZD A;  2KJB A;  3BT9 A;  2QZ8 A;  5JR3 A;  1ZAR A;  3GZN B;  4G12 A;  5L3G A;  2Y0M A;  4PJM A;  2ZME B;  1GVD A;  3F8M A;  1RC9 A;  1DP7 P;  2BW3 B;  1BI0 A;  1OR7 A;  3RQ4 A;  1VQ7 I;  2F4I A;  2OQG A;  3QQA A;  1I39 A;  1CQT A;  1OYI A;  3FXL A;  1KA8 A;  1GDT A;  1QNT A;  2M0C A;  3RI4 A;  4G6Q A;  5H6Q A;  2K4B A;  4PJ0 C;  1DPU A;  4F55 A;  1IDZ A;  1LKX A;  5JLX A;  5BQT A;  4PFO A;  1EH8 A;  2FD5 A;  3HSR A;  3K10 A;  1TWA J;  2KLO A;  3ELK A;  2XSJ C;  1YS6 A;  2ME6 A;  3HC7 A;  3OYF A;  3ZR8 X;  3LAP A;  3BQY A;  1U5T C;  4MQ9 F;  3GLX A;  4OAZ A;  4E7H A;  1T6S A;  4YIR X;  3MCZ A;  4BJT A;  4I7H A;  3GTJ J;  2LH9 A;  2PBI A;  4V19 K;  3H3U A;  5E8G A;  5EG0 A;  1ZG1 A;  4L9T A;  2DTZ A;  3OSF A;  1MD0 A;  2IRF G;  4MHG A;  1XGN A;  4I0B A;  1RUO A;  1S6L A;  5IYD J;  4ASN A;  3BTC A;  4BU2 A;  3J7A O;  2Q8K A;  3G73 A;  3K4M A;  5J8F A;  2MSY A;  4EJT A;  3OWT A;  2QYO A;  4HSR A;  4XN0 A;  4B4C A;  4HV6 A;  2DA3 A;  2FEZ A;  3RSN A;  4BDY A;  4U0Y A;  3N05 A;  2RKH A;  3ZQI A;  3C2G A;  3CQZ J;  5F04 A;  2R5Z A;  1IGN A;  2O03 A;  1RIO H;  2HQ5 A;  3KP4 A;  5GTI C;  3W2W A;  4UUS A;  1D3Y A;  2E7W A;  3OIO A;  4M9S A;  3R61 A;  1K6O A;  1MDM B;  4XBF A;  1Z1D A;  2EQR A;  4LG0 A;  3PFY A;  2A05 A;  3HHG A;  4BJ6 C;  2DFH A;  4EJO A;  2R4G A;  3BR1 A;  4CDG A;  4NNJ A;  1USS A;  1TNT A;  2MD0 A;  2NVU B;  2LMD A;  3TP0 A;  1Y6I A;  1OFC X;  2JSP A;  3HOZ J;  4XON A;  3I59 B;  3IRQ A;  2F48 A;  5E1X A;  4MEX F;  1LFB A;  1FNN A;  3L00 A;  4HYE A;  2LTP A;  3RYR A;  3RDI A;  3A03 A;  3S32 A;  3WOD F;  1X1P A;  2LBF B;  3QP5 A;  1VQP I;  5FKM A;  1OYY A;  3QPH A;  2W25 A;  3JTG A;  1FSH A;  2HKX A;  1KQ0 A;  3W6J B;  2AO9 A;  5FO5 A;  4BGD A;  3A0H C;  1TW3 A;  3I4P A;  2CH0 A;  2VC0 A;  1YW7 A;  4PDK A;  4Y7N J;  1K6Y A;  1PUF A;  2H1K A;  2W85 A;  3AG3 H;  5D8K B;  3K1M A;  3TGN A;  2A68 F;  2PMZ A;  1X1C A;  3K70 D;  4CCJ A;  3WHC A;  4UVB A;  4KT6 A;  1GT0 C;  4F92 B;  2XRN A;  3MN2 A;  1JT6 A;  6PAX A;  2QA4 I;  1T33 A;  1Z9C A;  2FNP A;  3LST A;  3F3X A;  2L9S A;  4CUG A;  2EFQ A;  3HUG B;  3PO3 J;  4U7B A;  2W57 A;  4XKC A;  2GOX B;  1FPQ A;  1D1A A;  5EZG A;  2V6C A;  2OAZ A;  5AIQ A;  1XX5 A;  2VT3 A;  1UG2 A;  3WTU C;  2XGD A;  1SD4 A;  1RUN A;  1J0R A;  1TWG J;  2X0L A;  2L9N A;  4BBR J;  1B8I A;  2O61 A;  3KP6 A;  1J9I A;  5LRR A;  1VQL I;  1WQ2 A;  3H3Z A;  2HU9 A;  1I27 A;  2ZXJ A;  3CUQ B;  3OYL A;  3QYE A;  4AU7 A;  3E6D A;  5K5O A;  3MZY A;  3PL8 A;  2EWN A;  2EA2 A;  3S3M A;  2V79 A;  3WU0 A;  4ON0 A;  5HDK A;  5LGT A;  5E3N A;  1X2M A;  2O8X A;  1JE8 A;  3EUH C;  3LSR A;  2PJR B;  5J1U A;  2DK5 A;  4ZYG A;  3HOU J;  2V1U A;  3W2A A;  4A3F J;  2GAU A;  4RGX A;  3OYA A;  2QQ9 A;  2DOD A;  1BC8 C;  2IA0 A;  4GFB A;  3E7L A;  3I71 A;  4WXD A;  2WAQ N;  4B09 A;  3UKG A;  2LG4 A;  1RI7 A;  1TP4 A;  5CYV A;  5L3D A;  1ZR2 A;  2D1H A;  2IS2 A;  5CVI A;  1X58 A;  4M71 A;  5EDN A;  4BBS J;  3R0J A;  4Q5S F;  3HYI A;  3A02 A;  3J7A Y;  2VBZ A;  5F1R A;  2Z33 A;  4BXU A;  4L5J A;  3RZO J;  2LC2 A;  5JVG F;  3F8B A;  2ZXI A;  2R7U A;  2W00 A;  1MBJ A;  4XLA A;  1FMV A;  5B1B H;  5HOD A;  1AKH A;  1AA7 A;  3W3C A;  4JP0 A;  2ZSH B;  2BYV E;  1YJW I;  3K4N A;  1XGM A;  2QQB A;  4I01 A;  5GTH C;  2HYF A;  5EG0 B;  3R6S A;  3GTG J;  2VBX A;  3QU3 A;  1UHM A;  1GXQ A;  5J8C A;  4G8X A;  3TQN A;  1BI1 A;  1X3U A;  1IO2 A;  3TDZ C;  2CU7 A;  3H5N A;  4MTE A;  3JR9 A;  4FX0 A;  4XM3 A;  1IRF A;  4CA0 A;  2F5V A;  1XMX A;  2G7H A;  2WBM A;  3QP6 A;  3BZC A;  3KPH A;  1MJ9 A;  3ROU A;  3TW7 A;  2XF5 A;  2JJ7 A;  4HRI A;  4BY7 J;  2R5Z B;  4G9Y A;  1Z7U A;  2RDP A;  3OYB A;  2Z3Y A;  1HC8 A;  3CC7 I;  3FXM A;  3C2H A;  2F5E A;  1O3R A;  4N9H A;  3KEO A;  2DJN A;  1TQM A;  1VND A;  1TQP A;  4IX7 A;  2WAE A;  1YX5 A;  4FE7 A;  4XR6 A;  2PLY A;  1X1A A;  1FYM A;  2FNA A;  5EJC A;  2IGN A;  3SZP A;  3CLQ A;  2CW8 A;  1CF7 A;  5CQG A;  1RNL A;  1WWX A;  1DPR A;  5IP7 J;  2BBY A;  4PUS A;  1ZG3 A;  5TGT A;  1HF0 A;  2K40 A;  2L02 A;  1XG1 A;  1M1E B;  2D1V A;  3FF5 A;  1PUE E;  4IJA A;  3ZQQ A;  4E7S A;  3JRE A;  1WJC A;  1SVO A;  4MQV A;  3U21 A;  2CGP A;  4RB3 C;  2QKM B;  1TWF J;  2RC4 A;  3ASO H;  3U1D A;  1N77 A;  3CMA I;  2I10 A;  4HG2 A;  2R7S A;  4JYK A;  4ZYD A;  1JTY A;  1G6N A;  3CMM A;  2GOM A;  5D8L B;  3SEZ A;  1UB9 A;  5ILV A;  4J00 A;  3GME A;  5DDG A;  1XB4 A;  3VB2 A;  4Z6Y A;  5F08 A;  4OMZ A;  4KIC A;  2OZU A;  5E1W A;  1XTA A;  3JRI A;  2DBB A;  2H8W A;  3SYT A;  5BS6 A;  1ZR4 A;  2PN6 A;  1KZH A;  3M3Y J;  5IT9 K;  2PMU A;  2NS7 A;  4S0H B;  3C7J A;  5HDN A;  1B9N A;  4HX8 A;  1HST A;  3EYY A;  1EF4 A;  3ML6 A;  3P9C A;  1TTY A;  1JKO C;  2HDC A;  2CUE A;  1BI3 A;  1GVJ A;  3OOU A;  1I6X A;  3PNY A;  1DDN A;  2J5O A;  4KT5 C;  1MMN A;  2LYC A;  3NEU A;  5EEH A;  4RB1 A;  1G3T A;  3PUB A;  3BG7 A;  4M3D A;  1P4X A;  4YFN F;  2COB A;  4B44 A;  3EUK L;  3MKW B;  2WAQ A;  1YS7 A;  1B8I B;  1IRG A;  1ZGJ A;  2LDU A;  3V42 A;  4YII A;  5FKL A;  4BQN A;  3I55 I;  5F0H A;  5EZH A;  3A01 B;  1MIJ A;  3CJN A;  4ENM A;  3P9K A;  3A0B C;  1Y8R B;  5DCM A;  3IKT A;  2CW7 A;  3D5R C;  1WJD A;  5DS9 A;  3LSG A;  1KGS A;  4XQF A;  5EGO A;  3C1D A;  1OCO H;  1LQ1 A;  2HOA A;  3AAF A;  2RQP A;  2X1E A;  4JOM A;  1T0F C;  3S17 J;  4IOA F;  2EJR A;  2KRC A;  4DZP A;  4AM3 A;  3Q0W A;  1UST A;  2EZH A;  2F6C A;  4G94 A;  1QVU A;  3WGG A;  4KMU X;  4RDU A;  2E71 A;  4UB6 C;  1ZYR F;  3E6M A;  3KP3 A;  1OPC A;  1I1G A;  2P81 A;  5GAE J;  2NNN A;  3BC8 A;  5FLV A;  3JRB A;  1R22 A;  4GGG A;  1BN5 A;  3Q3S A;  2NOJ B;  1R1T A;  1TNS A;  1MMD A;  1R4N B;  3ZOB A;  4P96 A;  4HA8 A;  4IXA A;  1FTZ A;  4IRI A;  4UNO A;  3DPT A;  3E0J B;  2CRG A;  4UVC A;  2AQF A;  2BEO A;  3I9V 2;  3OSG A;  2JA2 A;  1U0J A;  2HDW A;  1ETQ A;  2ZSI B;  3FHN A;  3QWL A;  4CIC A;  3KE2 A;  3BG6 A;  2M4K A;  2PQ8 A;  1AKH B;  1C0W A;  1QZY A;  4HEA 2;  3SJM A;  3C3W A;  5B3S H;  2ZME A;  3KZY A;  3MD2 A;  4AD9 A;  5L3B A;  1Y8Q B;  1J59 A;  3K70 C;  1D0X A;  4FIS A;  2Z2S B;  3OYC A;  2VIX A;  2WTE A;  2KZG A;  5HNF A;  1G59 A;  3DBH B;  4GDF A;  1JGS A;  4F3Q A;  2V1N A;  3IL2 A;  3L2V A;  2QSH X;  3OL4 A;  1VQ6 I;  2BVM A;  1SEU A;  1IUF A;  5ERI A;  4OIR F;  4U0W A;  4C30 A;  2MH9 A;  2BHZ A;  2G9W A;  2XC7 A;  3KYL A;  1TT5 B;  3KP7 A;  2HQN A;  3L9F A;  3CCL I;  4AWX B;  3ZQG A;  1IW7 F;  3MKY B;  2LP0 A;  4KFC A;  1Y1W J;  5IYC J;  3FXK A;  2P4W A;  1BJZ A;  5FKN A;  4L9N A;  2P7V B;  1JKP C;  3BTJ A;  1QBJ A;  1JHF A;  1MJB A;  2VOO A;  1RPW A;  4IEJ A;  5IT9 Z;  3MVP A;  4I02 A;  5C4J J;  2EIJ H;  2A6T A;  4C2T A;  4J19 A;  1I3A A;  1R6R A;  1E3O C;  1RKT A;  5KHD A;  5CVV A;  3FKJ A;  2V9K A;  1V4R A;  1RR8 C;  1SFO J;  1R5G A;  3IH2 A;  3MQ0 A;  2MC3 A;  5HOO A;  1KYZ A;  4RS8 A;  2K9M A;  4NHJ A;  3HB9 A;  4PK4 A;  4RM2 A;  2DPD A;  4QLC U;  2ETH A;  2V7F A;  1FTT A;  3CJT B;  3HJE A;  4EQQ A;  4BAC A;  2TCT A;  5DD4 A;  2M7B A;  2E2H J;  3CDL A;  2ID3 A;  1JI8 A;  3RPU D;  2K85 A;  2E35 A;  1XSV A;  5F64 A;  2O8K A;  3ERE D;  4C9Y A;  2TRT A;  1W5T A;  3CDH A;  1MDM A;  2R7V A;  3O2P E;  3VFZ A;  1HA8 A;  2VQG A;  2R3S A;  1K83 J;  1V5G A;  2DK8 A;  2DFF A;  3G6E I;  3SEQ A;  2KL4 A;  3QAH A;  2CV0 A;  4P9U A;  3T8T A;  4C2U A;  1RR7 A;  1EA3 A;  3BDD A;  2JTV A;  3GTL J;  3KP5 A;  4PCQ A;  1FOK A;  3HRS A;  2FF4 A;  2OUM A;  1ON2 A;  4M3G A;  3I59 A;  5KK1 A;  4AIH A;  4IPA A;  4X0G A;  1POG A;  5IT3 A;  5ILS A;  1LFU P;  2XPV A;  5J1Y A;  1I1S A;  2LBF A;  2MLG A;  4W1U A;  3ZGK A;  2B0L A;  4AVZ A;  2VKV A;  5FFX A;  3ZN1 A;  2FSW A;  5A2Q K;  3OS1 A;  1BR2 A;  4BKX A;  4XKB A;  5ICF A;  2R7R A;  5FD5 A;  1QVT A;  2MGQ A;  4A3E J;  1GV2 A;  1WGX A;  3CMY A;  1I3Q J;  4ZC3 A;  3ONQ A;  2HFH A;  2L0K A;  3F8N A;  1HDP A;  1HSJ A;  5B1A H;  2RNG A;  4FX4 A;  4PGG A;  4JX6 A;  2YPR A;  3OS0 A;  3S1N J;  4OOI A;  3DEU A;  4AUX A;  2IJL A;  1ZG5 A;  5LEK A;  2V26 A;  3WTX C;  4HV5 A;  2TDX A;  5K5Q A;  5HLH A;  3RKW A;  2X48 A;  3HSF A;  4D1Q A;  4G7Z F;  3PQK A;  3HUG A;  4F93 B;  3ZMD A;  1F36 A;  4HW0 A;  4OIQ F;  4ETS A;  9ANT A;  5GPC A;  4KN4 X;  3D1N I;  3I4M J;  5K7Z A;  1N25 A;  2A07 F;  1B6A A;  3BOQ A;  3HGG A;  4A3D J;  1LDK B;  3R0A A;  2XPW A;  1U2W A;  4EM2 A;  4N4O B;  1MBH A;  2PMZ N;  4XLN F;  4KN7 X;  3H9G A;  2UXN A;  3GFL A;  3A2K A;  2DOF A;  1V54 H;  2CS3 A;  2VPL A;  1OJL A;  1R36 A;  2ZNZ A;  4IO9 F;  4XLE A;  3P5J A;  5J4V A;  3CUQ A;  5LLQ A;  4ZTF A;  2JA5 J;  4BHP A;  2P5L C;  2OPT A;  3BLY A;  3GTP J;  4A69 C;  4V2F A;  1G3W A;  1SMY F;  3JW4 A;  4C3I J;  3KEQ A;  3GBG A;  2K9L A;  2PJR A;  1X4O A;  2EZK A;  2LKS A;  2DA5 A;  4M3B A;  4ENK A;  3HEF A;  4HNT A;  2O3F A;  4OIO F;  5LD2 C;  4XRS G;  2R7F A;  2XF7 A;  3H0D A;  3MZH A;  2XAS A;  3M4O J;  1MMS A;  2IW5 A;  1QGP A;  3Q5F A;  2X1D A;  3WG9 A;  3DU6 A;  1DGW Y;  4W97 A;  5CVU A;  4HQM A;  2E2J J;  1UAA A;  1FX7 A;  3B6A A;  5IY5 H;  2VJ4 A;  3S14 J;  4OWR B;  3DXJ F;  3I58 A;  2KP6 A;  5FB2 A;  4XLH A;  1I6H J;  2X9D A;  5K5R A;  1SC7 A;  2LR8 A;  3DQV C;  3DTI A;  5EEA A;  2C6Y A;  2IGO A;  2JUG A;  3F8F A;  1XDS A;  1YTY A;  4D7M A;  4GCV A;  4RB2 C;  4GRI A;  3BJ6 A;  4EGZ A;  1D8J A;  1F1Z A;  3ABK H;  3I54 A;  4RAY A;  4BUP A;  1XN7 A;  4ZYA A;  4P5O A;  3K4J A;  4PJL A;  3AL0 C;  4CCN A;  2EV0 A;  2DOE A;  1YFH A;  3U1K A;  2HDD A;  3HPG A;  4A93 J;  2CG4 A;  2A69 F;  3PM1 A;  4DIQ A;  2MLK A;  4LG3 A;  2M4G A;  1K78 B;  1LFP A;  5IP6 A;  3F23 A;  1BA5 A;  1L0O C;  3G2B A;  2BHY A;  1T95 A;  4B47 A;  3S3N A;  3CME I;  1JKR C;  2I8D A;  2A61 A;  5FLX K;  3QOD A;  4B3A A;  5KAI C;  2V4J C;  3CDI A;  5A2Q Z;  3NAU A;  4XLP F;  2H1L A;  4AID A;  5F27 A;  3S2W A;  1I5Z A;  2DMT A;  3QRF F;  2FOW A;  4YFX F;  2HVR A;  2PMH A;  5IOZ A;  2IT0 A;  3ABU A;  3NWS A;  1PP8 F;  4LJZ F;  4D7N A;  1XGS A;  2STW A;  1B4A A;  3M7G A;  2KZV A;  3TO7 A;  4A5M A;  5D6F A;  2BV6 A;  2DMU A;  2QEN A;  2K4J A;  3BJA A;  4XL9 A;  2OC6 A;  2NOG A;  1SD7 A;  3JSP A;  3ZRG A;  2JRM A;  4UHT A;  3AG4 H;  3MWM A;  4YIF A;  1ZRD A;  3V4G A;  4D5C A;  2E1C A;  4A6D A;  3AFH A;  1U5T A;  1YRN A;  2CV1 A;  5BOX A;  1IV6 A;  4OU0 A;  3K9T A;  3F9K A;  4C2M J;  1FJL A;  2JWT A;  2Y48 A;  1YQA A;  4MLO A;  3HL2 A;  1W0U A;  4Y52 J;  2ACJ A;  4HF1 A;  3DLA A;  3NWT A;  5BPD A;  1NG7 A;  4M9Z A;  3PIP F;  3DTE A;  2VPR A;  4FQG A;  2E60 A;  4IOC F;  1YE9 A;  3KCC A;  3HZJ A;  1IN7 A;  1NTC A;  4LIV A;  4ZJZ A;  2AHQ A;  4E7I A;  4DZJ A;  2PEX A;  2HQA A;  3EDP A;  4KNY A;  4UV9 A;  2CW0 F;  2QWW A;  2Z16 A;  2RQQ A;  2IP2 A;  2QSG X;  5LHG A;  3ASN H;  3BG3 A;  3HRT A;  4IHY A;  3EQL F;  3K6G A;  4KDP A;  3R4K A;  3WU2 C;  2V1X A;  4LOC A;  5HVQ C;  3WTW C;  2IXS A;  1XSD A;  3OYN A;  2VKD A;  5DM7 F;  4E7K A;  1U78 A;  5IP9 J;  4GXO A;  1WCM J;  2CQK A;  4BYY A;  5DYM A;  2QEX I;  3I0T A;  3HTS B;  2XV4 S;  1O4X A;  3QPL A;  4B48 A;  1ZEL A;  2YUS A;  1S72 I;  2QQ8 A;  4A3C J;  2CMP A;  3L2U A;  1XC5 A;  1QPI A;  1SFK A;  3IWZ A;  3A01 A;  1JUP A;  1FMW A;  1V5E A;  2XIG A;  1T39 A;  1WI3 A;  3FDY A;  4A3L J;  1SVM A;  1T2K A;  4DGW B;  4IHX A;  5E17 F;  3K2A A;  4M74 A;  2RV8 A;  4P55 A;  1ULY A;  1DUX C;  1HKS A;  2RVC A;  4Y15 A;  4DYC A;  1WPK A;  3CCU I;  1XSX A;  2F5F A;  4DBR A;  2VKH A;  1HCR A;  4N9I A;  4RAF A;  1ZGA A;  2OZ6 A;  3VOE A;  3JRC A;  4HPQ A;  5FLX Z;  2CQQ A;  2P0W A;  4A3M J;  3I56 I;  2IEK A;  4A0Z A;  5C4X J;  3T1B A;  4EMS A;  4KA4 A;  2VN2 A;  1V55 H;  1LEB A;  4E7J A;  2Y0S A;  2JN6 A;  2DQL A;  1UEL B;  5LRS A;  2ECC A;  1ACI A;  1O57 A;  4L18 B;  3M8J A;  3ECO A;  2ELK A;  2FE3 A;  2MA3 A;  2P6S A;  3DKX A;  4FHT A;  2DXI A;  1VQM I;  1WI9 A;  1BW6 A;  1YYV A;  2BOL A;  3L2Q A;  2VJ5 A;  3M8E A;  4RA2 A;  3OIQ A;  4AYB A;  2ADU A;  1MZB A;  4HLX A;  4KIF A;  3GVA A;  1QRY A;  1YLF A;  1SAN A;  2WB1 A;  3QPS A;  4HLY A;  3VWB A;  4IKF A;  3SHF A;  2HYJ A;  4XRF A;  1J09 A;  2JT1 A;  2GQQ A;  4MFD A;  2L7F P;  3COA C;  2E36 A;  4O5V A;  1BW5 A;  3TKY A;  4PZJ A;  3ISP A;  4PSX A;  1JUS A;  1S9H A;  2QQA A;  4PJJ A;  3ZXS A;  3GYH X;  4IRH A;  1E3P A;  1ZAO A;  3QU6 A;  2XF6 A;  1DU0 A;  1HW1 A;  1MJA A;  5ICG A;  5D5V B;  3W6V A;  1T8I A;  2P6T A;  3ZMU A;  4C3J J;  4G6T B;  2XGX A;  3FBI B;  5HLT A;  2MD5 A;  3L7W A;  1W7P B;  3MAJ A;  5HDG A;  1JXS A;  2K9Q A;  2DFI A;  5CJ9 A;  3EUH A;  3LSK A;  3DEE A;  1R23 A;  2F4O B;  3WE3 A;  1R71 A;  1XGO A;  4WX9 A;  2GZW A;  2VL8 A;  4A0Y A;  1G2H A;  3GTQ J;  3OYK A;  4EJU A;  1FP1 D;  1FLI A;  2V9P A;  3OMY A;  2H27 A;  3RKY A;  3HXL A;  2OTL I;  3BZ6 A;  2M3A A;  2CQX A;  3CZ6 A;  3JRA A;  1B9M A;  3KET A;  1APL C;  3BR3 A;  2CQ7 A;  3ZMV A;  2GWR A;  4FET A;  2M8G X;  4II2 A;  2HKO A;  2OV7 A;  3I4N J;  2KIU A;  1YO5 C;  4M6Y A;  1NHA A;  2EZL A;  3I3L A;  1P7J A;  4DQ2 A;  2LOO A;  3A1Y A;  3LA7 A;  4DBQ A;  2NVX J;  3F72 A;  4U7D A;  1F4K A;  1KON A;  3HSE A;  1U5T B;  1YRN B;  4GYI A;  1MGT A;  4HOB A;  3AL0 B;  3IH3 A;  4RMN A;  3GLL A;  1OCZ H;  5TJJ A;  2A6E F;  3RJP A;  3TMO A;  2LKX A;  2KPM A;  2RNJ A;  1N78 A;  2ID6 A;  3LSM A;  2VAS A;  4BH9 A;  3BZK A;  3LA2 A;  3V7S A;  5FLM J;  1BR1 A;  4XSZ F;  2O5R A;  5E8I A;  2CWE A;  2DU9 A;  1HW5 A;  1P6R A;  3SFZ A;  1YIO A;  2DT7 B;  2BXY A;  4ENN A;  1H88 C;  5FFZ A;  3D0S A;  1FBS A;  3GEZ A;  4HNV A;  3FIW A;  2K3P A;  3PQJ A;  1BBY A;  4NBQ A;  3L2R A;  3DKY A;  5LEJ A;  3S1M J;  4A3B J;  3OIP A;  3REO A;  1WJA A;  3WTY C;  1OKR A;  1UMQ A;  2QLZ A;  2NVY J;  2M1B A; 
#chains in the Genus database with same CATH homology
 3WE2 A;  1HKQ A;  2CFX A;  3DFG A;  4ZH4 F;  3E6B A;  2DW4 A;  3KLN A;  3E5U A;  1R7J A;  4LLL A;  4RAZ A;  2VT2 A;  2DT5 A;  4IRG A;  2JPB A;  1S8N A;  2LF8 A;  4LB6 B;  1KU2 A;  3K1P A;  1ONV A;  3EET A;  1HKT A;  2JPC A;  1ZRF A;  3DV8 A;  2EV5 A;  1IF1 A;  1P4A A;  2NRA C;  1SAX A;  4PGH A;  3FM5 A;  2A6H F;  4WXC A;  2EB7 A;  5D4S A;  2NNY A;  2GA1 A;  3GW2 A;  1F9N A;  4A5N A;  2ZCW A;  1FP2 A;  1BJA A;  2RGV A;  3P9I A;  4I98 B;  1A04 A;  3M1E A;  4WCG A;  4IHS A;  2IPQ X;  1OYW A;  3WTZ A;  1K7A A;  2Z9O A;  1S3J A;  3T5X A;  4OIN F;  1IN6 A;  4UUV A;  2L4A A;  4UXN A;  1R1U A;  4M9X A;  2EFO A;  4BAY A;  2LF7 A;  2NS0 A;  4E70 A;  3TOB A;  2M30 A;  2ISY A;  2HS5 A;  2HYG D;  4CYD A;  3WGI A;  4JBA A;  4Q47 A;  3SQN A;  2YU3 A;  2ZKZ A;  1WSU A;  2XHK A;  5AIP A;  5CVJ A;  2EFW A;  1O3T A;  5JI6 A;  1XMK A;  2HWV A;  1T0F A;  3ZMS A;  4M6X A;  2VXZ A;  2VC1 A;  2BE5 F;  3BP8 A;  4ESJ A;  3HOS A;  4WWC A;  2EA4 A;  5HLG A;  5JFR A;  1K78 A;  3F21 A;  2XVC A;  2D2W A;  3BPV A;  2JRT A;  2PG4 A;  1TLH B;  4B8X A;  3V7C A;  2IA2 A;  3N97 A;  4Y17 A;  1IXC A;  4EM0 B;  1U3E M;  3I53 A;  2HTS A;  4RGR A;  2L4M A;  4P9F A;  2VON A;  5JVT A;  3I64 A;  3KP2 A;  4LMY A;  1Z91 A;  2Z5U A;  1EH7 A;  3CTA A;  3ECH A;  2XAF A;  4WXH A;  3RPQ A;  2HQR A;  3F8C A;  2HOE A;  1QPM A;  1REP C;  2QM3 A;  1IZ1 A;  3B02 A;  2PI0 A;  3RKX A;  1ON1 A;  3C18 A;  5FD6 A;  2XKP A;  4Q48 A;  4GO1 A;  1O3Q A;  1FWZ A;  1V3F A;  1LEA A;  4CZZ A;  1YW9 A;  1J5Y A;  2L3D A;  5F6F A;  1H9T A;  2M8E A;  4RGU A;  1R1V A;  4I09 A;  3J80 K;  1K79 A;  1QZZ A;  2W24 A;  4R8H A;  4LB5 A;  4LK0 F;  5D5U B;  2KIF A;  3L2C A;  1O3S A;  1VTN C;  4G7O F;  2BGC A;  5D6E A;  2NAZ A;  2K86 A;  4F7Z A;  1OMI A;  3ZN0 A;  5DUK A;  5CVR A;  2LSO A;  1P2F A;  5KVR A;  2P5V A;  2G7U A;  2FML A;  2UXX A;  4K2E A;  3TO9 A;  1W4M A;  2DO7 A;  3K1N A;  2VBW A;  2M5W A;  1KU7 A;  1WKM A;  1S7A A;  2DI3 A;  3WTT C;  2COM A;  3ZQ7 A;  4CGZ A;  2M45 A;  2WC2 A;  4FT8 A;  3KLO A;  3GFI A;  1XD7 A;  2Q0O A;  3GXO A;  4HDU A;  4CO8 A;  1T98 A;  2DPU A;  3IHU A;  5HLI A;  3FXR A;  4ZYH A;  4L5I A;  2F5D A;  2HR3 A;  2AXL A;  2OA4 A;  2FBH A;  4KIG A;  1BIA A;  4I2O A;  3GZ6 A;  2RN7 A;  3ZMT A;  1BIB A;  1L3L A;  1U8R A;  5CLS A;  1E17 A;  1SD6 A;  1HBX G;  1IUY A;  1TQI A;  4WK8 F;  1H0M A;  3I5U A;  2IA1 A;  4UVA A;  3GUD A;  3OOP A;  4ZYE A;  1SFU A;  4AIK A;  3ZP5 A;  4CHU A;  2VE8 A;  2F5C A;  1T38 A;  5L3E A;  1IAW A;  2FXA A;  2EFN A;  3IKV A;  1J7K A;  3M8F A;  1ZRE A;  3IWF A;  2NYX A;  5DUI A;  3QPT A;  3MEX A;  1HXD A;  1ZRC A;  1PP7 U;  3J80 Z;  1W7P A;  1GHC A;  2WV0 A;  3DKW A;  1O7F A;  1IN5 A;  5K1Y A;  3V8J A;  4D0P A;  4BNC A;  4NB5 A;  5ICE A;  4ZZD A;  2QBY B;  1UCR A;  1FYL A;  4ENJ A;  1YG2 A;  1W5S A;  3SZT A;  3HRM A;  3GO5 A;  1LDJ A;  3J81 K;  1KYW A;  2LKP A;  3Q9S A;  2P5K A;  3DF8 A;  1E2X A;  2OU2 A;  2K02 A;  2STT A;  3HRU A;  4A2U A;  4O3M A;  1R5H A;  5E18 F;  4DNC A;  3WGH A;  1ZN2 A;  2ESN A;  2ELH A;  4I0A A;  2P7C B;  5HS7 A;  1ZLJ A;  5D5X B;  5ILU A;  3U9G A;  3HOT A;  2UWM A;  2HTJ A;  4N0B A;  2VOD A;  1PDN C;  4LGW A;  3FZV A;  2JZY A;  4RGS A;  3SXY A;  4HQE A;  1XDU A;  1IXR C;  3JAM K;  2OD5 A;  3IRR A;  1G3S A;  5D4R A;  2FBK A;  3E97 A;  3MFK A;  2H94 A;  3BY6 A;  2K7L A;  1SD5 A;  5E20 A;  3VOD A;  4IHT A;  4L9V A;  3N4M A;  2M87 A;  4LFU A;  4A12 A;  3O6B B;  2HGC A;  4HX7 A;  5E1Z B;  1LNW A;  4WF2 A;  1G4D A;  1O7L A;  5D5W B;  5LHI A;  2FBI A;  3GZ5 A;  4M73 A;  4BHB A;  3LQQ A;  3T0Y A;  1SMT A;  4Q4Z F;  2GXG A;  2H6C A;  3FXU A;  1Y0U A;  2F2E A;  4EM1 A;  4CXF A;  4Y13 A;  1KU9 A;  3CLO A;  1J75 A;  2XRO A;  1FSE A;  5J6X A;  1UFM A;  2E1N A;  1HW2 A;  3ZPL A;  1LVA A;  3QOP A;  3K2Z A;  2OQR A;  2K27 A;  3J81 Z;  2MH2 A;  2OBP A;  4KIB A;  5ICC A;  1U6G A;  2QUF A;  3H92 A;  5H6R A;  2ZBK A;  3GFJ A;  4LLN A;  5AON A;  3RPU A;  3TO6 A;  1HQC A;  3LAJ A;  2J5P A;  1G3Y A;  2FU4 A;  3RTR A;  3LWF A;  2CYY A;  2XAH A;  3E5X A;  1GXP A;  1S7O A;  1P4W A;  1FY7 A;  2V9V A;  5L3F A;  2PJP A;  3ULQ B;  3GFM A;  3TDU C;  3TOA A;  4U0V A;  4OMY A;  1AOY A;  3JAM Z;  1FBU A;  4M72 A;  1QQI A;  1R58 A;  3ZMZ A;  1IN4 A;  1ZH5 A;  2QVO A;  1TW2 A;  4LG0 B;  3GX4 X;  1TBX A;  2EFP A;  2AS5 F;  3FMR A;  3VEP A;  2D45 A;  4L0Y B;  4YFK F;  3KZZ A;  4O6J A;  4HF0 A;  3B73 A;  1ODD A;  4EJW A;  3HHH A;  3WU1 B;  4QWQ A;  3KFW X;  5ED4 A;  2XAQ A;  4U88 A;  3LQR A;  3BPX A;  2CO5 A;  5EEG A;  2ESH A;  4R1H A;  3ABT A;  2FMY A;  1SFE A;  3EYI A;  2A5Y B;  1EV7 A;  2Y75 A;  4JQF A;  1W7P D;  2ZJ2 A;  4AIJ A;  1BOA A;  4ESB A;  4L9J A;  5JHU A;  4S05 A;  2YX7 A;  5BMZ A;  1RZ4 A;  2ZNY A;  3CO6 C;  3NRV A;  3GWZ A;  4GYG A;  4IVN A;  2VE9 A;  5H20 A;  3K69 A;  2A3S A;  2YX4 A;  2W84 A;  4HAM A;  2H6B A;  2DLL A;  3FXQ A;  3FMQ A;  1XCB A;  3PFI A;  2KIM A;  3D5L A;  1MKM A;  1IXS B;  2EV6 A;  3FX3 A;  4A6E A;  2JSC A;  4LLG F;  1UHW A;  3F6O A;  2E7X A;  4Z2Y A;  1BC7 C;  4OIP F;  1FT9 A;  5DD8 A;  3V8K A;  1Z6T A;  2GIV A;  5HS9 A;  2VOP A;  4LD5 A;  1H9G A;  3L09 A;  3F22 A;  1BI2 A;  1EH6 A;  2KRF A;  3V7R A;  4UV8 A;  5LGU A;  3RIR A;  2WWY A;  2KJC A;  4IF4 A;  3JSO A;  1LB2 A;  2VBY A;  5L3C A;  2R7D A;  1F5T A;  1R00 A;  4KUM A;  5DEQ A;  3U2R A;  2HZT A;  1Z6R A;  1S29 A;  1KQ9 A;  1FBQ A;  1SFX A;  3T8R A;  5HS8 A;  2X4H A;  4HDV A;  4EJV A;  3WTV C;  4G6D A;  2FQ3 A;  1FYK A;  4KYW A;  5BPI A;  2KKO A;  3CUO A;  4TV7 A;  1B59 A;  1FC3 A;  2V1D A;  4YG2 F;  2PFB A;  5DCF A;  2DAO A;  3G3Z A;  2O6G E;  2ZFW A;  2XAJ A;  1BM9 A;  2O0Y A;  4RB0 A;  3M9A A;  3NQO A;  4EV0 A;  3OV8 A;  1STZ A;  3JTH A;  4XSX F;  4MNU A;  3V8L A;  1B1B A;  3E6C C;  4AVP A;  1KQ8 A;  3E5Q A;  2EK5 A;  2IVM A;  2CSO A;  3DPL C;  4BHC A;  5FGM A;  1D5V A;  4S04 A;  3P7N A;  2FOK A;  2FA5 A;  4EGY A;  1CF7 B;  2QBY A;  4HZF A;  4HBL A;  2MBF A;  3BRO A;  1WRJ A;  5LGN A;  2Z99 A;  5DV5 A;  1LJ9 A;  2P8T A;  1JHH A;  3O3K A;  1FZP B;  3R60 A;  3WTS C;  3BWG A;  2L01 A;  2ZO4 A;  4MTD A;  1P92 A;  1J2X A;  3HIF A;  1IN8 A;  3CUQ C;  2DTR A;  4MEY F;  2UZK A;  1YW8 A;  1D8K A;  4EVI A;  3LFK A;  4BQA A;  3LA3 A;  5LHH A;  4L0Z B;  2YR2 A;  1ZLK A;  5TRD A;  4MGR A;  3FHZ A;  2XKO A;  4R79 A;  1Q1H A;  4NQW A;  2XUB A;  2GXB A;  2HEO A;  1LDD A;  3W6K B;  2H09 A;  2DQR A;  2LNB A;  1KU3 A;  5DCM B;  3HTU A;  2ISZ A;  4KMF A;  4LK1 F;  2YSR A;  2Q2E A;  4HF2 A;  3K0L A;  2FRH A;  4JK1 X;  1XCV A;  1QO0 D;  5LBQ A;  4ESF A;  1AWC A;  3RYP A;  3CO7 C;  4G7H F;  3DP7 A;  2GA2 A;  1ZHF A;  4ZZL A;  3FWE A;  1XMA A;  2XAG A;  3BJO A;  4HX4 A;  3E3V A;  4H0E A;  3GF2 A;  3FMS A;  2L54 A;  3FM3 A;  4A0X A;  3Q9V A;  1Z05 A;  1CGP A;  3IC7 A;  2KJB A;  2QZ8 A;  5JR3 A;  1ZAR A;  5L3G A;  2Y0M A;  2ZME B;  3F8M A;  1DP7 P;  1BI0 A;  1OR7 A;  2OQG A;  1OYI A;  1KA8 A;  1QNT A;  3RI4 A;  4G6Q A;  5H6Q A;  2K4B A;  1DPU A;  5BQT A;  1EH8 A;  3HSR A;  3ELK A;  1YS6 A;  3LAP A;  1U5T C;  4MQ9 F;  3GLX A;  1T6S A;  3MCZ A;  4I7H A;  2PBI A;  3H3U A;  5E8G A;  1ZG1 A;  4L9T A;  1MD0 A;  2IRF G;  4MHG A;  1XGN A;  4I0B A;  1RUO A;  1S6L A;  4ASN A;  3J7A O;  2Q8K A;  3G73 A;  5J8F A;  4EJT A;  2QYO A;  4HV6 A;  2FEZ A;  4U0Y A;  2RKH A;  2O03 A;  1RIO H;  3KP4 A;  1D3Y A;  2E7W A;  4M9S A;  3R61 A;  1K6O A;  1MDM B;  4XBF A;  1Z1D A;  4LG0 A;  3HHG A;  4EJO A;  4CDG A;  1USS A;  1TNT A;  3IRQ A;  3I59 B;  5E1X A;  4MEX F;  1FNN A;  3L00 A;  4HYE A;  3RYR A;  3RDI A;  3WOD F;  3QP5 A;  1OYY A;  3QPH A;  2W25 A;  3JTG A;  1FSH A;  2HKX A;  1KQ0 A;  3W6J B;  5FO5 A;  1TW3 A;  3I4P A;  2VC0 A;  1YW7 A;  4PDK A;  2W85 A;  5D8K B;  3K1M A;  3TGN A;  2A68 F;  4UVB A;  2XRN A;  6PAX A;  1Z9C A;  2FNP A;  3LST A;  3F3X A;  2EFQ A;  4U7B A;  2W57 A;  1FPQ A;  2V6C A;  2OAZ A;  5AIQ A;  2VT3 A;  3WTU C;  1SD4 A;  1RUN A;  1J0R A;  2X0L A;  2O61 A;  3KP6 A;  1J9I A;  5LRR A;  1WQ2 A;  3H3Z A;  1I27 A;  2ZXJ A;  3CUQ B;  3E6D A;  5K5O A;  3MZY A;  2EWN A;  2EA2 A;  2V79 A;  3WU0 A;  4ON0 A;  5HDK A;  5LGT A;  2O8X A;  1JE8 A;  2DK5 A;  4ZYG A;  2V1U A;  2GAU A;  4RGX A;  2QQ9 A;  1BC8 C;  2IA0 A;  3I71 A;  4WXD A;  4B09 A;  1RI7 A;  5CYV A;  5L3D A;  2D1H A;  5CVI A;  4M71 A;  3R0J A;  4Q5S F;  3HYI A;  2VBZ A;  5F1R A;  2Z33 A;  4BXU A;  4L5J A;  3F8B A;  2BYV E;  1XGM A;  2QQB A;  4I01 A;  2HYF A;  3R6S A;  2VBX A;  3QU3 A;  1UHM A;  1GXQ A;  5J8C A;  4G8X A;  3TQN A;  1BI1 A;  1X3U A;  3TDZ C;  4MTE A;  4FX0 A;  1IRF A;  2G7H A;  3QP6 A;  1MJ9 A;  3ROU A;  4G9Y A;  1Z7U A;  2RDP A;  2Z3Y A;  2F5E A;  1O3R A;  4N9H A;  3KEO A;  1TQM A;  1TQP A;  2PLY A;  1FYM A;  2FNA A;  3SZP A;  1CF7 A;  1RNL A;  1WWX A;  1DPR A;  2BBY A;  1ZG3 A;  2L02 A;  2D1V A;  3FF5 A;  1PUE E;  4IJA A;  4MQV A;  2CGP A;  4RB3 C;  2RC4 A;  3U1D A;  4ZYD A;  1G6N A;  5D8L B;  1UB9 A;  5ILV A;  5DDG A;  1XB4 A;  3VB2 A;  4OMZ A;  4KIC A;  2OZU A;  5E1W A;  2DBB A;  5BS6 A;  2PN6 A;  5IT9 K;  2PMU A;  3C7J A;  5HDN A;  1B9N A;  4HX8 A;  1HST A;  3EYY A;  3ML6 A;  3P9C A;  1TTY A;  2HDC A;  1BI3 A;  1GVJ A;  1I6X A;  1DDN A;  2J5O A;  4KT5 C;  3NEU A;  5EEH A;  4RB1 A;  1G3T A;  1P4X A;  4YFN F;  1YS7 A;  1IRG A;  1ZGJ A;  2LDU A;  4YII A;  4ENM A;  3CJN A;  3P9K A;  5DCM A;  3IKT A;  1KGS A;  3C1D A;  1LQ1 A;  3AAF A;  2RQP A;  2EJR A;  1UST A;  4G94 A;  3WGG A;  4KMU X;  1ZYR F;  3E6M A;  3KP3 A;  1OPC A;  1I1G A;  2NNN A;  1R22 A;  4GGG A;  1BN5 A;  1R1T A;  1TNS A;  4P96 A;  4HA8 A;  4IXA A;  4IRI A;  4UNO A;  3DPT A;  4UVC A;  2BEO A;  4CIC A;  3KE2 A;  2PQ8 A;  1C0W A;  1QZY A;  3C3W A;  2ZME A;  3KZY A;  4AD9 A;  5L3B A;  1J59 A;  2WTE A;  1JGS A;  3IL2 A;  5ERI A;  4OIR F;  4U0W A;  2MH9 A;  2G9W A;  3KP7 A;  2HQN A;  3L9F A;  4AWX B;  1IW7 F;  4KFC A;  2P4W A;  4L9N A;  2P7V B;  1QBJ A;  1JHF A;  1MJB A;  2VOO A;  5IT9 Z;  4I02 A;  5CVV A;  1V4R A;  1R5G A;  3MQ0 A;  2MC3 A;  5HOO A;  1KYZ A;  4RS8 A;  4NHJ A;  2DPD A;  4QLC U;  2ETH A;  4EQQ A;  5DD4 A;  1XSV A;  5F64 A;  3ERE D;  1W5T A;  3CDH A;  1MDM A;  3O2P E;  3VFZ A;  2R3S A;  2DK8 A;  3QAH A;  4P9U A;  3T8T A;  3BDD A;  2JTV A;  3KP5 A;  4PCQ A;  1FOK A;  3HRS A;  2FF4 A;  1ON2 A;  5KK1 A;  3I59 A;  4AIH A;  4IPA A;  5IT3 A;  5ILS A;  1I1S A;  2MLG A;  2B0L A;  5FFX A;  3ZN1 A;  2FSW A;  5A2Q K;  5ICF A;  5FD5 A;  2HFH A;  3F8N A;  1HSJ A;  4FX4 A;  4PGG A;  2YPR A;  4OOI A;  3DEU A;  1ZG5 A;  2IJL A;  5LEK A;  3WTX C;  4HV5 A;  2TDX A;  5K5Q A;  5HLH A;  3RKW A;  3HSF A;  4G7Z F;  3PQK A;  3HUG A;  3ZMD A;  4HW0 A;  4OIQ F;  4ETS A;  4KN4 X;  2A07 F;  1B6A A;  3BOQ A;  1LDK B;  3R0A A;  1U2W A;  4EM2 A;  4XLN F;  4KN7 X;  2UXN A;  3GFL A;  1R36 A;  2ZNZ A;  3CUQ A;  5LLQ A;  4BHP A;  2P5L C;  1G3W A;  1SMY F;  3JW4 A;  3KEQ A;  4ENK A;  4OIO F;  2O3F A;  2R7F A;  3MZH A;  2XAS A;  2IW5 A;  1QGP A;  3Q5F A;  3WG9 A;  5CVU A;  4HQM A;  1FX7 A;  3DXJ F;  3I58 A;  5FB2 A;  5K5R A;  3DQV C;  2C6Y A;  3F8F A;  1XDS A;  1YTY A;  4GCV A;  4RB2 C;  3BJ6 A;  4EGZ A;  1D8J A;  1F1Z A;  3I54 A;  4RAY A;  1XN7 A;  4P5O A;  2EV0 A;  1YFH A;  2CG4 A;  2A69 F;  2MLK A;  1K78 B;  3F23 A;  1L0O C;  2A61 A;  5FLX K;  5A2Q Z;  4XLP F;  3S2W A;  1I5Z A;  3QRF F;  4YFX F;  2PMH A;  2IT0 A;  3ABU A;  1PP8 F;  4LJZ F;  1XGS A;  2STW A;  1B4A A;  3M7G A;  3TO7 A;  4A5M A;  5D6F A;  2BV6 A;  2QEN A;  2K4J A;  3BJA A;  3JSP A;  1SD7 A;  4UHT A;  3MWM A;  4YIF A;  1ZRD A;  3V4G A;  2E1C A;  4A6D A;  1U5T A;  5BOX A;  4OU0 A;  3K9T A;  2Y48 A;  1YQA A;  2ACJ A;  4HF1 A;  5BPD A;  4M9Z A;  3KCC A;  1IN7 A;  2PEX A;  3EDP A;  4KNY A;  4UV9 A;  2CW0 F;  2QWW A;  2IP2 A;  5LHG A;  3HRT A;  3EQL F;  4KDP A;  3R4K A;  2V1X A;  5HVQ C;  3WTW C;  1XSD A;  1U78 A;  4GXO A;  2CQK A;  4BYY A;  5DYM A;  3I0T A;  3HTS B;  2XV4 S;  3IWZ A;  2XIG A;  1T39 A;  1T2K A;  5E17 F;  4M74 A;  2RV8 A;  4P55 A;  1ULY A;  1DUX C;  1HKS A;  2RVC A;  4Y15 A;  1XSX A;  2F5F A;  4N9I A;  1ZGA A;  2OZ6 A;  3VOE A;  5FLX Z;  4A0Z A;  3T1B A;  4EMS A;  4KA4 A;  2VN2 A;  1LEB A;  2DQL A;  5LRS A;  1O57 A;  4L18 B;  3ECO A;  2FE3 A;  2MA3 A;  2P6S A;  4FHT A;  1WI9 A;  1YYV A;  3M8E A;  2ADU A;  1MZB A;  4HLX A;  4KIF A;  3GVA A;  1YLF A;  4HLY A;  3SHF A;  4XRF A;  2JT1 A;  2GQQ A;  3COA C;  4O5V A;  3TKY A;  4PZJ A;  3ISP A;  2QQA A;  3GYH X;  4IRH A;  1ZAO A;  3QU6 A;  1HW1 A;  1MJA A;  5ICG A;  5D5V B;  2P6T A;  3ZMU A;  2XGX A;  2MD5 A;  3L7W A;  1W7P B;  3MAJ A;  5HDG A;  1JXS A;  2DFI A;  5CJ9 A;  3EUH A;  1R23 A;  3WE3 A;  1XGO A;  4WX9 A;  2GZW A;  4A0Y A;  4EJU A;  1FP1 D;  1FLI A;  2H27 A;  3RKY A;  3BZ6 A;  1B9M A;  3KET A;  3ZMV A;  2GWR A;  2HKO A;  2KIU A;  1YO5 C;  4M6Y A;  1NHA A;  4DQ2 A;  3LA7 A;  3F72 A;  4U7D A;  1F4K A;  3HSE A;  1U5T B;  4GYI A;  1MGT A;  4HOB A;  5TJJ A;  2A6E F;  3RJP A;  2RNJ A;  4BH9 A;  3LA2 A;  3V7S A;  4XSZ F;  5E8I A;  2CWE A;  2DU9 A;  1HW5 A;  1P6R A;  3SFZ A;  1YIO A;  4ENN A;  5FFZ A;  3D0S A;  1FBS A;  3GEZ A;  3PQJ A;  1BBY A;  5LEJ A;  3REO A;  3WTY C;  1OKR A;  3F6V A;  2QLZ A;  2M1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...