3MKYB

Structure of sopb(155-323)-18mer dna complex, i23 form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*CP*TP*GP*GP*GP*AP*CP*CP*AP*TP*GP*GP*TP*CP*CP*CP*A
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 115
sequence length 115
chains with identical sequence P
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkyB00
3MKWB 3MKZA 3MKYB 3W3CA 1VZ0A 3W2AA 3VWBA
chains in the Genus database with same CATH superfamily
4KIBA 4A69C 4ANJA 3JRAA 2DCEA 2H8WA 1L3LA 4KIGA 1DGRM 3CZ6A 3DKYA 3UKGA 1Q1HA 4L18B 1YRNA 2G9WA 1IDYA 4U87A 4BBRJ 3H5RA 2LREA 2PJPA 1WI3A 2VE9A 1ZRCA 2JJ7A 2J5OA 5LGNA 3T8RA 1W0UA 3HRMA 5IP9J 2MH9A 4N4OB 1ULYA 5DM6F 2ZJRF 4BEHB 4M3BA 3H9JA 2VLAA 4D1QA 1SFEA 4RMNA 1FBQA 4HG2A 2LOOA 4ZZLA 1W5SA 3HOXJ 3U1KA 2HKOA 3UR3C 3OYHA 3BC8A 3ONQA 3H3VK 3VYTB 2EV6A 3IKVA 1W4MA 2MD0A 2VBYA 2Y0SA 2M8GX 3OYFA 3F21A 2DA3A 2E2IJ 2IRFG 1O4XA 1B6AA 1F4KA 1TC3C 1MMDA 4RM3A 2H8RA 2IJLA 1J9IA 4CZZA 1HCRA 2KQRA 5C4XJ 2DK8A 4RGSA 3AG2H 4M3GA 3SEQA 4CA0A 3Q5FA 4PZJA 4CYDA 2ACJA 2IW5A 3L7WA 4M9ZA 1HKQA 1KU9A 4P96A 2K7LA 3ZMSA 5BOXA 3SJMA 1IW7F 2MLKA 4XONA 4C9YA 2OZ6A 5IY5H 5EF6A 1LQ1A 4P9UA 4RB3C 2CFOA 1S6LA 3FMQA 4YEJA 4LLGF 3M8EA 1ETQA 3LFKA 3OYDA 4IVNA 4HLYA 1W5TA 4AU7A 3S1MJ 4IPAA 1RUNA 1VI0A 2AXLA 4MQ9F 4FHTA 4F52A 1GLNA 2P7CB 1K7AA 2L3DA 2V26A 1P9QC 2B0LA 2WAQA 4LMYA 1ZGAA 5LRRA 1ZRFA 4MTDA 1FSHA 5DS9A 5HNFA 2V9KA 1VQ4I 2CUZA 1BA5A 4BHPA 5JLWA 3OS2A 3W2WA 2RNJA 2QKMB 3GTLJ 3GMEA 1R71A 2E1MB 1K78B 3S16J 5J1YA 3WODF 1O7LA 1CQTA 3ABUA 3ESWB 5ILUA 1HW2A 2P6SA 3L2UA 4I2OA 5H20A 3I59B 3D1NI 3C18A 3HRSA 3REOA 3KE2A 1FMVA 1JHHA 1SMYF 3ULQB 3W6KB 2NRAC 3GTPJ 3CCMI 3S8PA 3JREA 1LB2A 4CDGA 5F27A 3IH4A 3CUQB 1H0MA 1J5YA 2BHYA 1LE8B 3QYEA 2IPQX 2XDVA 3MQ0A 1DU6A 1ZGWA 5J3LA 2XSJC 1XG1A 2VN2A 4UB8C 3OYEA 1FSEA 2NVQJ 2COBA 1ORKA 3OYIA 2WAQN 2Z2SB 2STTA 4NQWA 1JKPC 4XOPA 1T2KA 1POGA 2EV0A 4A0XA 4L9TA 4LFUA 4U7DA 1ZELA 4II3A 2IAIA 2PMZA 3NEUA 3ABMH 4BL0B 1ZLKA 2NS8A 5HDKA 5B3SH 4XRFA 2WADA 3DCFA 1VNDA 3E0JB 4HF2A 4WCGA 2K3PA 2QM3A 3HG9A 3OIQA 4IF4A 1IRZA 1ACIA 4ZDLA 3CP8A 4XQFA 4L9NA 4XLCA 3K6GA 4MHGA 3RKYA 3F9KA 4I01A 3S2DJ 2GOXB 1H89C 4B48A 3ISPA 4D5CA 3H5AA 2KPMA 2ZJPF 3L2WA 1R4NB 5JR3A 2XAGA 2HVQA 4HDUA 4LIVA 4C3JJ 2DMQA 3LSMA 2XB5A 2HTJA 1DUXC 1OJLA 4F93B 3MD2A 3HRTA 4DIQA 2P5LC 4G6TB 3J81K 3AG3H 1Z21A 3LMMA 1OYWA 2GIZA 1H9TA 4B4CA 2DA2A 1QA6A 2Z1DA 3BZ6A 3OYMA 3JTHA 1G59A 2OJED 2PMZN 3BTCA 3DBHB 3JRHA 2CW7A 1TQPA 3FK6A 3MZ8A 1TQMA 5C4JJ 1TNTA 1IAWA 3V8LA 3S3OA 1W5CC 3O8HA 3G1OA 1SAXA 2WB1N 5GAHJ 3CCRI 2Z9OA 4PJLA 1H88C 1RIOH 2OV7A 2CQ7A 4XICA 2R0QC 3OS0A 4B09A 1FYMA 3VYUB 1Y56A 1ETVA 4PSWA 3FXUA 1JTXA 2M7AA 1F36A 1R23A 2BOLA 2OQGA 2XGCA 2YR2A 3DF8A 4G12A 3FM5A 3L2RA 2DJNA 3OOPA 3FWEA 2O0YA 1NTCA 3FXOA 2L5QA 3KP7A 3QU3A 4A2UA 2FUG2 2GA1A 1W7PA 1VFCA 5B1AH 5IYCJ 3HSRA 4AD9A 5DM7F 2PMHA 3DTEA 2OPTA 3M3YJ 3ECHA 3LL7A 3K70C 4EM2A 2O9LA 4Z2YA 1RI7A 4R1HA 3KEYA 1OCRH 2M4KA 3WGHA 3A02A 1TWAJ 3ECOA 2DW4A 4YRVA 3E97A 1FTZA 3J80Z 2H1LA 1GT0C 2EFWA 4LJZF 1IXCA 1YS7A 3R0AA 1WJFA 4IL6C 2DI3A 4ITVA 2HDDA 3W6VA 2BV6A 4B8XA 1ZKGA 4ABZA 2G7UA 3JRIA 2CYYA 1J59A 4HNUA 1ZLJA 5LFAA 1IZ1A 4ON0A 3S1NJ 2YU3A 2TCTA 1X2MA 3TP0A 1TWGJ 2XGDA 1U78A 3BOQA 3E3VA 4RAYA 1IC8A 3HDDA 4A6DA 1UCRA 3FHNA 2XAUA 5F04A 4ENNA 3GF2A 1IUYA 1XPXA 3CD6I 2DU9A 2RREA 2VOPA 3U21A 4LG3A 5DCMB 4A0YA 2ZFWA 2LTPA 1D0XA 3H5NA 3E6CC 2VQHA 3I58A 2X6WA 5A2QK 2BVMA 2PJRA 3TOBA 2M2EA 4E7IA 1B4AA 3DEEA 4X1EA 1JHFA 1IV6A 2IVMA 3K1PA 2HEOA 5D4RA 1YI2I 3TO9A 4RAZA 1R22A 1WPKA 2X1EA 2EIKH 4FASD 1WJDA 1UG0A 3PL8A 4FTHA 2A3SA 1JGSA 1HQCA 4BQNA 2HZDA 2A07F 2QSFX 5J8FA 1OFCX 1QRYA 1D1AA 3BT9A 5J6XA 3WTSC 5BPDA 4LG0B 2V9VA 1B9NA 3EDPA 1TP4A 2UUZA 2G7HA 2NS7A 2QGUA 4BHCA 3JTGA 3SFIA 1MMGA 2VUMJ 2KRCA 4CHUA 4BXFA 1R49A 1TT0A 4M6YA 1Y0UA 4LIUA 2P5VA 3FX3A 1U6GA 1A5JA 3IHUA 2EV5A 1WVRA 5F1RA 2BY3A 1FC3A 3B6AA 3CCVI 2EA4A 2IGKA 2JK3A 1QGPA 2MLGA 5EZGA 1QZEA 2AO9A 3WU2C 5TJJA 4JOMA 3BZCA 3K4JA 2F5CA 3L09A 3S93A 3F3XA 4S05A 3ZOBA 1VQ8I 1JXSA 1U5TA 5GADJ 1E17A 2F6CA 5FD5A 1JUPA 2KLOA 3ABTA 5EG0A 2MC3A 3KX2A 1YJ9I 1T6SA 2DOAA 5CKTA 2XIGA 2KRFA 2HR3A 4NC8A 4PUSA 2VODA 2JUCA 3DPUA 4XLAA 1S3JA 4DZPA 1LDKB 1EJ9A 5DUKA 1A35A 3TO6A 2OUMA 2X9DA 2DK5A 2ECBA 1UHMA 1V3FA 5D6EA 2NNNA 1OCPA 2QA4I 3I4MJ 2XHKA 4E7KA 3CMMA 2CMPA 3AG4H 1LPQA 4XKCA 3LSTA 4CCOA 2E2JJ 1S5LC 2BGCA 4P55A 4ZTJA 4OMZA 2EPFA 4A3CJ 4DBQA 2VBZA 1SFOJ 4XMYA 1JGGA 3OYAA 3GTOJ 2FXAA 3CTAA 1R6RA 3OIPA 2R7RA 3QYFA 1F43A 2DYSH 1ITYA 1U2WA 1X3UA 4OWRB 3AG1H 3GFLA 3GFMA 4LK0F 4XL9A 2PBIA 1D1CA 3I0TA 3JRBA 3VSKA 1HC8A 2E7XA 2FBIA 1ZG1A 3EPZA 2HOAA 3S2HJ 4DYQA 4DYRA 1FOYA 5HDGA 2MD5A 2UWMA 3CESA 4KMUX 4BH9A 3BPVA 4HSRA 1BC8C 2E2HJ 3HOVJ 3MN2A 5GTHC 2VXZA 1HXDA 4ZYHA 2LKSA 2AHQA 3BG6A 1BR2A 4PFPA 1ETKA 2PEXA 4BJ5C 3HTSB 1FBSA 2D5VA 4F3QA 3NQOA 5M3FJ 2OF7A 1XDSA 2XF6A 3RDIA 5F0FA 3WTXC 3DXJF 1QZYA 1B9MA 3LAJA 1K61A 3T0YA 1X3WB 1Y0NA 1B72B 3CDLA 1IRXA 2I10A 4XORA 4CCNA 2QBYB 2JA2A 5E8GA 2EFNA 2ZMEB 1ZYRF 3DEWA 3ASOH 1T98A 3PUBA 4EEFG 4AYBN 3HIFA 2P81A 1NK3P 3T8TA 4IXAA 1XTAA 2CS3A 2XAFA 5DD8A 3FHZA 1YX5A 3HPHA 4XKWA 2EQRA 3GZ6A 2DA7A 4G94A 2Y0MA 3CMAI 3MZHA 5AIPA 2NOGA 4CGZA 3GTKJ 1EA3A 2CO5A 2M8EA 2LP0A 2L7FP 3GXOA 3UNGC 3CCQI 2FU4A 4KUMA 4BEHA 1SD4A 1FZPB 3OYKA 1UFMA 5HLIA 2CRGA 3ZQ7A 1M1EB 4XN3A 5JI6A 2CGPA 3TW6A 2L7KA 4WXHA 4L0ZB 3OYLA 1JUMA 4GXOA 5E1ZB 1VQ7I 5FFZA 2E71A 2GOMA 2BYVE 1XCBA 4XLFA 2E1CA 4KT5C 3OSFA 3K0LA 1JJ8C 2R92J 1RC9A 2C6YA 2K27A 2W25A 4ZC3A 1S7AA 2WC2A 3VPRA 2B9SA 3J80K 4IO9F 1X1DA 2IGOA 2B7EA 4LK1F 4BDYA 1XSVA 1XMAA 2IGMA 1OCTC 4IRHA 3WG7H 5LHHA 4M3DA 2X6OA 1TZLA 2KRHA 5J1RA 5CYVA 1EKEA 4N9HA 4CSWA 5IOZA 2E19A 3HL2A 2HPMA 1G3SA 2IGNA 3KLNA 4MO7A 4HBLA 4E7LA 1Z3XA 4XLHA 2ZXJA 4XRSA 3JRGA 3IUOA 4HQMA 2BXYA 1WJAA 3T5XA 5F64A 5E8IA 4NC7A 4BNCA 1MH3A 5JLXA 5EG0B 2DDBA 4BE2A 3K7AJ 2ZCWA 2LBFB 1O3SA 3WGIA 3OSGA 2EB7A 3KEOA 5BPIA 4LGWA 1Z67A 3KZIC 2R5YA 2X1CA 5B1BH 2L4AA 3FBIB 2X48A 1K78A 4QWQA 3PJRA 2VC0A 3A2KA 2E36A 1FIPA 3F8MA 4F7ZA 3LQRA 2QVOA 3I59A 3R61A 1HOMA 1NG6A 5EYRA 1R5GA 2D1HA 3G2BA 3N05A 5HNHA 4F55A 5K7FA 4FX4A 3E6MA 1R4MB 3BR2A 3CUQA 1VQ5I 2ZXHA 3GTQJ 3S1QJ 2ZKZA 3QOPA 1LE8A 3GLXA 2W48A 1JJ6C 2WWYA 2KIUA 1U0JA 2VQCA 3X2QH 5BS6A 1QBJA 4IHSA 1VQKI 4E70A 4AVPA 4RM2A 2HOSA 1QHHD 3R4KA 3M4OJ 2BW3B 3JRDA 5E3LA 5DUIA 2VBWA 3K1NA 5KAIC 2HQAA 3LA7A 2O8XA 3V7SA 5FLXZ 4AUXA 4A5MA 1VF9A 4XRMA 4CCKA 3E5QA 4YFXF 2V4JC 5B5EC 3JSPA 4XIDA 2F5FA 2F5DA 4IJAA 5EEAA 3BTLA 4BXXJ 2LNBA 3N4MA 2JVHA 2A5YB 1X58A 1FP1D 2QCOA 1PP7U 3F8BA 1Y8RB 1YIOA 3E7LA 5IPAA 3HSFA 3K10A 2CQNA 5J8CA 3F8CA 3GYHX 2UXXA 2LY2A 1QVUA 1V4RA 3F6OA 4HOBA 3G4SI 5D5UB 2R93J 3MKLA 2PQ8A 1N25A 1UG2A 3QAHA 4G9YA 3SYTA 1D8KA 1ZTRA 1XGMA 2R7SA 3ZP5A 4DYCA 3JCUC 1QNTA 3KETA 1FOKA 1MJ9A 3C2GA 4I0AA 3G3ZA 1P4WA 2H1KA 2QYOA 4MEXF 3F22A 1LVAA 1ERDA 5CJ9A 3M8FA 4Q47A 4E7ZA 1E0EA 1WHUA 1XGOA 5J1UA 2HWVA 4A3DJ 3TP3A 2R7VA 1SVLA 4AWXB 3BG7A 2HKXA 1ZGJA 3BG5A 2VT2A 3RPUA 1E3OC 3SQNA 1X1CA 2E35A 2OU2A 3I9V2 4ZZDA 4X6AJ 4NNJA 2L7MP 4RB2C 2KIQA 1WJ5A 1BM9A 2GZWA 1FOXA 1R7JA 3QPLA 2XF7A 3HUGA 3QOEA 1BI2A 1G3TA 3OIOA 1U9OA 5J40A 1VQ6I 1JT6A 3K4BA 5CVUA 1FPQA 1SFKA 2R7TA 2V7FA 2O5RA 1FJLA 2LLKA 5A2QZ 3TEDA 2CJJA 2OTLI 1ON1A 5TISC 4L0YB 4OIOF 3DPTA 3H3ZA 2XAQA 4KN7X 1OCOH 3WHCA 4DOZA 4BUPA 3BTJA 1R58A 4KMFA 1DQUA 2MSYA 2DMPA 4C2MJ 3RKXA 5F0HA 3Q9VA 1X4PA 3J7AO 3OR1C 5AONA 4KA4A 3GUDA 1EF4A 5HLHA 3CC7I 2WV1A 3Q3SA 2WTEA 4ZYGA 3HGGA 1P92A 1U5TC 4JX5A 3BQZA 3WE3A 4HA8A 2RAEA 4HNVA 2FOKA 1WI9A 1SD7A 2RC4A 3PIPF 2JUGA 2W84A 2V9PA 5HS7A 2VPLA 1K4SA 5FRMA 1ZHFA 1BOBA 2TRTA 5HLGA 1FOWA 2CV1A 4PJMA 1ZAOA 1ZQ3P 3P9IA 1GVJA 4KISA 3KP3A 3RYPA 5HLTA 1YJWI 2ECCA 2JTVA 1AU7A 2MBFA 4FISA 4QSHA 5CVJA 2GWRA 2R5YB 2OCCH 4U0VA 2K9MA 3V42A 2DOFA 1VQPI 2YX7A 1SD6A 2KL4A 4A6EA 2ADUA 2DTRA 2K3FA 4WXDA 1IXSB 2NVUB 1W0TA 2EILH 3A4CA 2H6BA 3VEPA 1VQNI 5LHIA 3GW2A 1Z6RA 2MG4A 2LKXA 3ML6A 1JI8A 1Z77A 3A0HC 4G7ZF 5JVGF 5EEHA 1Z3YA 3WTUC 3KP2A 5DCMA 4L5EA 1FT9A 4Q5SF 2JA8J 3OYJA 1XGNA 4XM3A 3OY9A 1MKMA 2M45A 1GXPA 2FE3A 3CCUI 2XGEA 5HVQC 3KIOA 4ETSA 1S29A 2E60A 1TBXA 4A5NA 3Q9SA 5LGUA 5IOYA 4RBOA 4BQQA 2ESNA 1LVKA 1BC7C 1LUJB 1FLIA 1KU2A 4I76A 3GLLA 2XPVA 3D5LA 3VODA 4KITB 4A3JJ 5ILSA 3EQLF 4OMYA 3JAMZ 3LOCA 2F2EA 3DLLF 2UXNA 2BY2A 4LG0A 2JN6A 1E3PA 1TT5B 2JVGA 2DA4A 3VB2A 3GEZA 2M4GA 2WB1A 1KQ0A 3DQVC 3F8NA 4J01A 2D45A 1R9TJ 4KICA 4L9VA 4HPQA 3OS1A 3FM3A 3HJEA 1OCZH 4HX7A 3KFWX 5GTIC 2ZJ2A 2DPUA 1MBFA 3F72A 3FXQA 2F5VA 1TW2A 1ZREA 3PUFA 3QPHA 2VPRA 3J7YJ 2B63J 2VL8A 4F92B 3R0JA 4R8HA 1KA8A 4NDLA 5IP7J 1MBKA 2P0WA 1DPRA 2AXTC 2A5WA 3QWLA 1BJZA 1D5YA 1WH5A 1BR1A 3WU1B 5TRDA 2IA1A 1A36A 2XKPA 4FCYA 3Q0UA 3FXLA 9ANTA 1I39A 2Q2EB 3HB9A 1USTA 4GYIA 3OYGA 2GIVA 4WF2A 3RPUD 4Y13A 2LD5A 4HRIA 2ZFUA 3HUGB 3JW4A 3WG9A 3E6BA 3MAJA 3VYRB 4XSXF 2X1DA 2RDPA 1Z7UA 1WZ2A 1REPC 2WY8Q 4DBRA 4ZDOA 4KNYA 2FF4A 3OV8A 2EH3A 3GCMA 2DQLA 1KU3A 4RGUA 3IH2A 3I54A 2XASA 4ZYEA 5EGOB 5FLXK 5FKOA 1FYLA 1DDNA 2DO7A 5FKLA 5ICEA 3OYCA 4UV8A 5FO5A 5M5XJ 1SFUA 3MWMA 1N77A 2KZVA 3K4NA 3EETA 2DMTA 4U7BA 3HOYJ 1K6YA 2GAUA 1WJEA 3LSHA 1EH7A 4XSZF 4B3XA 1T0FC 4B47A 3TDUC 1OR7C 1OQYA 3PNYA 1FMWA 2X0LA 3FMRA 1MMSA 2H09A 3JRCA 3IKTA 3VSLA 3M9AA 2GXGA 5L3CA 1GDTA 1Y1WJ 3LNQA 3EUHC 1P7IA 4W1UA 2FX0A 2QZ8A 2HYGD 3FMSA 2KKOA 5CPRB 3G1LA 1W36C 1QU3A 4R79A 2M30A 2EJRA 3SHFA 1V54H 5LEKA 2CV0A 3ZCOA 1J09A 2E1MC 2JRMA 2DPDA 2JZYA 3LSIA 5JVTA 1W1WE 2DT7B 2AS5F 4P5OA 1X1BA 2QEXI 3LQQA 3CCJI 2K9LA 2QUFA 1B72A 4MIMA 5FROA 4E7JA 1ZR4A 2QBYA 3SFZA 3ERED 2HZTA 2ZMEA 4RLQA 5KHDA 1ZR2A 1X2NA 1EH6A 2Y30A 4G6DA 1FNNA 5CQEA 2IT0A 2HDWA 3M8JA 2CQQA 1XB4A 3G73A 2FJ1A 5CVVA 2QQ8A 2QF7A 3CJTB 4OINF 2R7XA 1YJNI 2CUEA 2ZXWH 2KIMA 2Y75A 2BVLA 2ELJA 3ZQLA 1GV2A 3PQJA 4GRIA 5DDGA 2M5WA 3HM5A 3ASNH 4ZTFA 4LB6B 4ENKA 2FOWA 2ID3A 2ME6A 4I0BA 1MZBA 4ESJA 2M9HA 3GBGA 1ZK8A 3K2AA 4B44A 1QO0D 4N9IA 2RGVA 5FKNA 1G6NA 4G7HF 4FT8A 3QU6A 5GPAA 3IH3A 4HF0A 4IOAF 2RKHA 1TW3A 2HVSA 2ISZA 4IRIA 2FA5A 2XRNA 3CP2A 2PI0A 2IA2A 1PUFB 2H6CA 2DYRH 1S9HA 2VJIA 1H8AC 1LJ9A 2NNYA 4A3FJ 1JKRC 4RGRA 3H9QA 4WWCA 4UY8I 1BJAA 1MJAA 3MCZA 2LFBA 4PSXA 3RI4A 4L9JA 2DA5A 1Y8QB 1F9NA 4Y52J 1RPWA 4I7HA 5DD4A 2VKHA 3PO2J 2VOOA 2NVYJ 1HW5A 4P1WA 3HHHA 1NG7A 2DAOA 3C2HA 1UB9A 3CF2A 4FE4A 2XC7A 1XX5A 2LVSA 2BBYA 2F4IA 4ASNA 5M3MJ 2LBFA 3MKWB 3K2ZA 1RESA 3SZPA 3SXYA 4Y4RA 3CUOA 3O3KA 3JR9A 1T08B 3TMOA 3SEZA 3TKYA 3FXJA 3ELKA 4NUBA 4XKBA 2X85A 1VTNC 3PIOF 4MGRA 3JSOA 2WY7Q 4IQ4A 3ZQIA 3BR5A 2GXAA 5KK1A 4QTRA 3HZJA 5K7HA 2ISYA 4GYGA 1R1VA 3HPGA 3AL0B 1MNEA 2QKLB 3M1EA 5D8LB 3W2AA 3LAPA 1CF7B 3U1DA 1IXRC 4Y15A 3JAMK 4RAFA 2UZKA 2VC1A 2K9QA 1IG7A 1F5TA 1T56A 4LOCA 2N8GA 4AYBA 1FBUA 4CH7A 5HS8A 2DXIA 2BW3A 2VT3A 5K5QA 1G8XA 5K5OA 4MLOA 4EGZA 3P9KA 5FJ8J 4M3FA 1D3YA 4IZZA 4LLLA 2GM4A 2L7ZA 4X0GA 4BJ6C 4A93J 1Y39A 1D8JA 4XBFA 1IUFA 3V8JA 2M0MA 3A01A 3NRVA 3IAS2 4M6XA 1A04A 2VXDA 2XVCA 2HNHA 2WBMA 3E1SA 3WE2A 1HLVA 4BQOA 3G71I 3PFYA 1P4XA 2KIFA 4PGHA 5EZHA 1SVOA 1K4TA 3ZMVA 3L00A 1FP2A 3S32A 5LHGA 4OIQF 2FQ3A 2FBHA 2RQPA 2QQ9A 1SMTA 1X4OA 1K79A 2V1DA 3ZPLA 4V19K 2WV0A 1WH7A 4JBAA 2LR8A 1IRGA 2AQEA 1BR4A 1C0WA 2COMA 4EJWA 1KQ8A 5C3EJ 3QRFF 2ETHA 2R5ZA 3K1MA 4XLPF 5IP6A 2O7OA 2GQQA 2VB6A 3I64A 2DFFA 3HRUA 5EJCA 1AWCA 3GZ5A 2L4MA 3WU0A 1OCCH 2VJ4A 2HOEA 4ZYDA 3T1BA 2V6EA 3OMYA 2JQ7A 3MKZA 2O3FA 3QP5A 2E1NA 2Y69H 4RB0A 1SEUA 1R36A 4UNOA 2L2OA 1E2XA 3P5JA 5HOOA 3BR6A 2XGXA 3GFJA 2QQBA 3H9GA 1WJBA 1GV5A 3BROA 1PVEA 3RCOA 2H27A 1YQAA 2EIMH 1HKTA 4EJTA 4XR6A 1LEBA 2XF5A 1MD0A 2HXIA 4M6VA 2K4JA 3BDDA 4UVCA 4A3MJ 1P2FA 1R1TA 2R3SA 4Y33A 3WGGA 3DP7A 2KZGA 4C2TA 3ZQHA 1YW8A 5CVIA 1X1PA 2MGQA 2QENA 1KZHA 3SZTA 2NOJB 2QWWA 5J4YA 2DBBA 6PAXA 1WRJA 4M3EA 3HXLA 2STWA 1XDUA 2DFEA 2ID6A 3WTZA 4IX7A 1SD5A 2HTSA 1BOAA 2OZUA 2GXBA 1IO2A 4HEA2 3B02A 3CLOA 4RLFA 1TWCJ 1MBEA 3QP6A 1LKXA 2DDAA 1QQIA 2LDUA 5F1JA 1TNSA 1PP8F 4J19A 3ERMA 1XCVA 4KYWA 4OIPF 3TGNA 2EZIA 1LFPA 2W82A 4OU0A 1QVTA 4BXUA 3P7NA 4P9FA 2EWNA 4OAZA 3IP4B 1XD7A 5ICCA 5FLVA 1L0OC 2KJBA 5ICGA 1NH3A 1G3WA 2YS9A 5LLQA 3ZMDA 1XMKA 1D0ZA 2R7WA 4LITA 2FSWA 1DU0A 2V1UA 1WSUA 4AM3A 2CFXA 3OWTA 2HVRA 4JX4A 1B1BA 2J5PA 2VKVA 2Y9YA 4CO8A 3HOUJ 3BR1A 4G6QA 1GVDA 1I5ZA 2VASA 2D1VA 2V1XA 1J75A 1ZG3A 4QLCU 2VI6A 1UZCA 3KYLA 1RR8C 2ELKA 2YU9J 4BS9A 5CLSA 3LWFA 1I1GA 3S3NA 3CJQB 1K6OA 4M74A 1WWXA 1NHAA 2GA2A 3WHBA 4EMSA 2HYFA 1D1BA 1RNLA 4DGWB 4CYCA 4IOCF 2IXSA 3VOEA 2NXNB 3RKWA 2JSCA 2CW0F 2P7VB 3G1MA 2NVTJ 2FEZA 3J7AY 4KJZA 2DT6A 4MEYF 1UMQA 4MQVA 2LMDA 3FXKA 4RS8A 3S1RJ 1T95A 1IN7A 1S8NA 4Q4ZF 3LFUA 4HF1A 4GCVA 1APLC 4HDVA 2L9VA 1BBYA 1DGWY 3RSNA 2A6TA 3A01B 4ENJA 2M3AA 4HV6A 4AC0A 4EQQA 1BW5A 2RN7A 1PDNC 3S14J 1ZN2A 1BIBA 1SVMA 1YOVB 2FMLA 2E5ZA 2X4HA 3MZYA 2CV2A 1VZ0A 3EUKL 3LA2A 5F6FA 3Q0WA 3LSGA 3S3MA 4I09A 4PCQA 2ZMEC 2Y9ZA 3V7CA 4D7MA 4M72A 2K85A 3J7ZI 1D5VA 3NAUA 3EYYA 3BY6A 4AIJA 1A6QA 4C3IJ 2QSHX 3E5UA 3FIWA 3H0GJ 3L2QA 4IHWA 3CDHA 2NYXA 3A0BC 2YX4A 4XN0A 3R60A 2JSPA 5DEQA 4LD5A 3ZQFA 3GVAA 5KAFC 1RUOA 5JFRA 3O2PE 1I3QJ 2R5ZB 1S7OA 1J2XA 3SZGA 4F91B 5J4VA 4MFDA 3V4GA 1OYYA 2Q2EA 2NVXJ 2R7DA 3I5UA 4N0BA 1JT0A 2MC4A 1KQ9A 1HDDC 2M1BA 2OBPA 5K1YA 2A61A 2Z99A 2ZSHB 4PDKA 5DV5A 2MFZA 1QPMA 1OKRA 2NS0A 2RQQA 1O3TA 2KDOA 2BY1A 2Q1ZB 1X3ZB 2YUSA 4MTEA 1HDPA 3QQAA 4OIRF 2LC2A 2CU7A 1Z1DA 5EGOA 1Q1VA 1NK2P 2A69F 3ZMTA 2LKPA 3K69A 1P6RA 3HTUA 1LEAA 1UJ8A 3KYCB 5ILVA 2E1OA 4C30A 1G3YA 2JA7J 2W57A 3M7GA 1R00A 1XSXA 2X51A 3ZQCA 2F5EA 2WAEA 3L1PA 2DFHA 4U88A 1KONA 2LY9A 5JHUA 3IV5A 3RKQA 1YFHA 3F0CA 2JA5J 3D5SC 4KDPA 3BZKA 3OYBA 3W3CA 1DPUA 2OAZA 4B3AA 4CUGA 3P9CA 3CCLI 2W24A 4BAYA 4EJVA 4ZJZA 1T38A 3S17J 4LB5A 1YX3A 3ZR8X 4RA2A 2DOEA 3ZGKA 4HAMA 1YS6A 2PG4A 4YELA 2FBKA 4ZH4F 5M5WJ 2K9SA 2VKDA 1WKMA 3L2CA 3HHGA 2ZXIA 1WFXA 1BL0A 1U8RA 2HQ5A 3CC4I 5BQTA 2JT1A 2PX9A 4BE0A 2IS2A 3M1CA 3PNVA 3SDGA 4HQEA 1MNMC 1I3AA 3CC2I 1FY7A 4JYKA 3K70D 3EYIA 1YYVA 4YG2F 1MW7A 1R5HA 2GLOA 1MSFC 2EFQA 2Y0SN 4RAGA 2IP2A 2FRHA 1O3QA 3F23A 1XGSA 4A3LJ 2BE5F 2F4OB 1TQIA 5E3NA 2ZNZA 3Q0VA 4UVBA 5TGTA 2M87A 3FXMA 3RQ4A 1LNWA 1X19A 2VIXA 4XK4A 4Z6YA 4JP0A 1IN5A 4DW6A 1W36D 1MSEC 1MBJA 4CYCB 4IHXA 2VKEA 3A1YA 1ODDA 4M73A 5E3OA 3NWSA 4OAYA 1S72I 2LH9A 2ZC2A 3AKZA 2EBIA 2BXZA 5LEJA 3C2BA 4BBSJ 1EH8A 2HU9A 2KHMA 4YIRX 2VQGA 1ENHA 1Z0XA 5BNGA 4EV0A 5FRNA 4NHJA 3VDXA 1CGPA 2MABA 3FISA 3H35A 1MGTA 4ZYAA 4U0YA 1ZG5A 5H6QA 1PUFA 1FYKA 3BPXA 1MNDA 4UUTA 3KPHA 4CICA 3PSFA 5GAEJ 2QQAA 2JPCA 2CH0A 2R7QA 3M07A 2M0CA 2OA4A 4EJUA 1IN6A 1HSJA 1G2HA 3D5RC 4YIIA 3ZXSA 3WTWC 2CSOA 3MVPA 3FF5A 4H4KC 3C3WA 4M9SA 3BR0A 4PJ0C 3QODA 4Q48A 4Y7NJ 1V5EA 5FKMA 4BY7J 1YITI 1MBGA 1IJWC 2W4SA 2HYJA 2XSDC 5LGTA 2FNAA 4M9XA 2O61A 4HNTA 1AA7A 3DU6A 2EA2A 1SFXA 2ME0A 1VQMI 3IRRA 1I6HJ 1YW9A 4WX9A 2JRTA 4TV7A 1YE9A 3ZN0A 2DLLA 2DT5A 3CJNA 3FBNB 1YIJI 3K4KA 3CF5F 5IYBJ 2X6XA 3EUAA 2RVCA 3D0SA 4RGXA 4D0PA 2L9RA 3W2VA 1LDJA 1A31A 4FETA 3F6VA 3HKZA 2HGCA 3HOZJ 2LF8A 2XB0X 2ZO4A 2NAZA 4FX0A 3ZMZA 1T39A 2RV8A 1Z6TA 1A6IA 2AQFA 4IHVA 1B59A 1OMIA 4NB5A 1YRNB 1K83J 1OISA 2CWEA 4KIFA 3RZDJ 5FB2A 2F4MB 5F08A 1U9NA 4A0ZA 2Q0OA 4UXNA 2D2WA 2KFDA 3BWGA 1SANA 1CF7A 5L3EA 1MDMA 1Y6IA 1KYZA 2DQRA 2E5NA 1UAAA 3FZVA 1QHGA 3PM1A 2BY0A 2HPIA 4II2A 1IRFA 5KCMA 2FD5A 1Z91A 4A3EJ 3GO5A 2PFBA 2DA6A 2G0EA 4BQAA 1U8BA 2XAHA 4XRSG 4B1RA 1H9GA 1S7EA 5D5WB 4Y3OA 2ZSIB 4HW0A 3CMYA 5LRSA 4EJOA 2H94A 1TLHB 1PUEE 2EFPA 4IQJA 2BZTA 3GTJJ 3IRQA 3HKZN 2LYCA 1B8IA 3MMYB 4PJJA 2K5CA 2P5KA 1LFUP 1WCMJ 3HSEA 3S2WA 4DQ2A 1I6XA 3DV8A 4QPQA 2K4BA 3BJOA 1SC7A 4G8XA 4MFEA 2EIJH 3FK7A 2FMYA 1MBHA 4N4NB 1U3EM 2KISA 2LSOA 4UV9A 3AAFA 4IHYA 2EZLA 5C44J 3CDIA 2K9NA 2HOTA 1O7FA 2IS6A 4D9JA 2JWTA 5D8KB 1R1UA 4H0EA 4ESFA 1V55H 3RQIA 3HOTA 2DMUA 2K40A 3V8KA 1ZRDA 4YIFA 3C7JA 3CUQC 5KNLA 5DYMA 1OYIA 3I53A 4XLNF 2Q8KA 1N75A 4O6JA 4V2GA 3OL3A 4CCLA 1XN7A 3KP4A 3RJPA 2L02A 2XKOA 4B43A 4CXFA 3VYSB 3ZMUA 1QPIA 1BI0A 3DKWA 4KN4X 3BCBA 1ON2A 3ROUA 2P6TA 2FNPA 2W85A 2JPBA 3DKXA 3K9TA 2XV4S 4GFBA 3HBLA 1BN5A 4YFKF 4AIHA 4UUSA 3OYNA 2W00A 4BY1J 5E3MA 1YTYA 3RPQA 3G6EI 2HDCA 4I6ZA 3ZQGA 1HBXG 3RZOJ 1FTTA 1I27A 3HGYA 4BACA 3B73A 4IKFA 5EEGA 5EDNA 1MMNA 1SAUA 3CMEI 3GWZA 3H1CA 2VONA 2FQ4A 1UELB 4JK1X 1BW6A 5LBQA 2A68F 1UHWA 3A03A 2OC6A 2L01A 1ZARA 2Z3YA 1VQLI 3BTIA 1BIAA 2YPRA 4E6KG 4NQWB 3PQKA 5IYDJ 1GHCA 4BJTA 5D6FA 2LF7A 1I50J 4XLEA 2CUFA 4RDUA 4ESBA 4Y17A 4DJAA 2XPUA 2VQLA 3U9GA 2VE8A 1Y1VJ 2M34A 3K4LA 4W97A 1JE8A 1AKHA 4QIWN 3HEFA 1R5ID 3DTIA 4YFNF 2MH2A 1VQOI 1WGXA 5M5YJ 1V5GA 2MW8A 5H2FC 2K86A 5L3DA 3GFIA 2Z33A 4EVIA 5K7ZA 3I4NJ 2HQNA 5KVRA 3ZRGA 1FIAA 2V6CA 4HYEA 4M71A 3BLYA 1MIJA 5L3FA 5D5XB 2VJJA 4E4HA 2P8TA 3CQZJ 3E5XA 3V7RA 3VWBA 5D4SA 4XOTA 4EGYA 2L0KA 3LSPA 1EV7A 3DPLC 3PSIA 3BJ6A 4S0HB 3OOUA 2HFHA 2DJIA 3K4MA 2DTZA 3CCYA 1FX7A 4L5JA 1RKWA 2EFOA 2I8DA 5LD2C 1ETXA 2L54A 4CZCA 4FE7A 3U2RA 3ZN1A 1O3RA 1GUUA 3RIRA 2IS1A 4GDFA 4IEJA 1RZ4A 4KT6A 5K5RA 1XMXA 3BCAA 5ED4A 2EZHA 3GX4X 3QYBA 4JX6A 2Z16A 3QPSA 5E17F 1YLFA 4I99C 3I55I 2UV1A 5FD6A 4BKXA 1BI1A 2WA0A 1MDMB 5E1WA 3L2VA 5IT9Z 4EATA 2HXOA 1WQ2A 1O57A 3TBIA 4A3IJ 1JTYA 3DFGA 2A6HF 4O5VA 2CQXA 2TDXA 4GO1A 2O8KA 4ENMA 3CO7C 2VJ5A 1HSTA 2HQRA 3MKYB 1TWFJ 1Z05A 2ELHA 4A3GJ 5HDNA 3RTRA 3E6DA 3CCSI 1W7PB 1B8IB 3BG3A 2XRLA 3WTTC 2IS4A 2R7UA 2IEKA 3DU5A 3IL2A 1GXQA 1I1SA 4HV5A 4UHTA 2Y48A 4CCJA 1W7PD 3FKJA 3H92A 4D5FA 2KMUA 2LK2A 4FQGA 1G4DA 5FGMA 4WXCA 3LSRA 3KZYA 5CQGA 4D7NA 2A6EF 3IWZA 2DA1A 3H3UA 4PFOA 2LY1A 2BHZA 4DNCA 4XNFA 3GTMJ 1ETYA 1IF1A 1RR7A 2EINH 2Y2ZA 5ERIA 3BR3A 2DMNA 4A12A 1IN8A 2DODA 4C3HJ 4CCMA 1ONVA 1BI3A 2Y31A 2JMWA 2OTJI 1HW1A 1LFBA 4PK4A 2ZBKA 1IDZA 3O8GA 3KLOA 3DTKA 3LA3A 2OD5A 3DWLE 4MNUA 4K2EA 1N78A 1Z7LA 1X1AA 2ESHA 1P4AA 4UUSB 4AIDA 3RYRA 3TOAA 2HS5A 3CO6C 2YSRA 1TTYA 1JUSA 5CVRA 3O6BB 2E7WA 2ZJQF 3CCEI 2KP6A 1RETA 2RNGA 4AVZA 3H0DA 2X6YA 1LDDA 3DLAA 3MFKA 1AHDP 2PJRB 1HKSA 1T8IA 1RRJA 5F0CA 3H36A 4I98B 3BP8A 5HODA 3IC7A 3FDYA 2PLYA 4I02A 5L3GA 5E1XA 4HSTA 1ETWA 2O03A 4LLNA 3DBLB 3WTVC 4WK8F 4BGDA 2IA0A 5H6RA 4S04A 4L5IA 1UHSA 2MYSA 3BJAA 2XPWA 3I4PA 4IRGA 4U0WA 2O6GE 3S15J 2LG4A 4A3BJ 2WAFA 1ZH5A 1XSDA 3ZQQA 3KEQA 1AKHB 3KCCA 5D5VB 3KZZA 1IGNA 5FFXA 2BEOA 2F48A 3VFZA 4BYYA 4HZFA 1AOYA 3F8FA 4BU2A 5E20A 3K4CA 2W1OA 5JHFA 1E3HA 5GP9A 3HC7A 4XKVA 3TDZC 4EM0B 4O3MA 3PO3J 4ZDPA 1IV8A 5E18F 2MA3A 1FWZA 1T0FA 2CQKA 2R7FA 2ZB9A 3DBRB 3COAC 4G7OF 1MH4A 1OR7A 2HI3A 4BHBA 4E7SA 3I56I 1YW7A 1OPCA 3MEXA 5FLMJ 1U5TB 2CW8A 4QPOA 4UVAA 2CG4A 3ABLH 2JA6J 3AL0C 5DTDA 4NBQA 1HF0A 3EUHA 2M7BA 3JRFA 3FKIJ 2PMUA 2XROA 5IT3A 1KGSA 2E34A 3TO7A 1JKOC 5FKKA 4HX4A 2DN0A 1PYVA 1ETOA 2A05A 3IAM2 3B6CA 4A3KJ 1KU7A 4C2UA 2VBXA 5HS9A 2LRDA 3I3LA 4HX8A 1XS9A 3C1DA 3FXRA 1J0RA 2R4GA 3J81Z 3NWTA 3HOSA 1HA8A 1RKTA 5ICFA 4J00A 1XC5A 3BQYA 1F1ZA 2EZKA 1WJCA 1MJBA 3W6JB 1QZZA 2KDZA 1USSA 2XAJA 2OCEA 3AFHA 4NC6A 4JQFA 4PGGA 1YO5C 1TWHJ 2KJCA 3L9FA 5E79C 2L9SA 5L3BA 3TL4X 2I5UA 2XUBA 4IHTA 4OOIA 4EM1A 2K02A 1IN4A 2Z5UA 3HYIA 5AIQA 1Z9CA 2CUJA 1DP7P 1JKQC 3R6SA 4BE1A 3BG9A 4KFCA 2L9NA 2W7NA 4AIKA 3PNTA 3LSKA 3ABKH 4GGGA 3IWFA 4E7HA 1J7KA 1STZA 3KP6A 5B66C 1P7JA 2DFIA 3CJRB 3I71A 2EK5A 1TL8A 1MMAA 4PJNA 3TW7A 3HOWJ 2ICWG 4RB1A 2KT0A 2V79A 3KYDB 3TQNA 1VQ9I 1FEXA 3OL4A 3LSJA 3DEUA 3KP5A 3PFIA 1T33A 4V2FA 5BMZA 2PN6A 3SDBA 2ZNYA 4BDZA 2V1NA 3N97A 1D0YA 5J47A 1DP3A 2QLZA 4UB6C 5DCFA 2R7OA 1PJRA 1YG2A 3CLQA 3NARA 1YHQI 1KYWA 2IBDA 3WTYC 5GPCA 3GTGJ 2GBYA 1V5FA 4UUVA 2QSGX 5IT9K 3GZNB 3QPTA 5GAGJ 3OR2C 4DZJA 1OLTA 2R7ZJ 2OQRA 2P4WA 4HLXA
chains in the Genus database with same CATH topology
3DU6A 3H9QA 4ANJA 2L7KA 2DCEA 1DGRM 3OYLA 1YE9A 3CZ6A 3DKYA 4PSXA 3FBNB 2GOMA 4U87A 3H5RA 2LREA 3K4KA 2X6XA 4XLFA 3EUAA 4N4OB 4BEHB 4ZC3A 3W2VA 3H9JA 2VLAA 4FETA 4D1QA 3HKZA 2VKHA 4RMNA 1X1DA 2IGOA 4HG2A 2LOOA 4BDYA 2IGMA 4P1WA 3UR3C 1NG7A 3BC8A 3ONQA 3C2HA 3CF2A 3OYHA 3VYTB 2XC7A 1TZLA 2AQFA 2F4IA 2LBFA 2KRHA 2Y0SA 2MD0A 3MKWB 3OYFA 4CSWA 4Y4RA 3TMOA 3HL2A 2HPMA 3SEZA 2IGNA 4NUBA 1MMDA 4RM3A 4XKBA 4E7LA 2X85A 1Z3XA 4XLHA 2WY7Q 1Y6IA 2E5NA 1UAAA 3IUOA 1QHGA 2KQRA 2HPIA 1WJAA 4IQ4A 4II2A 5KCMA 4NC7A 3SEQA 4CA0A 4BE2A 2LBFB 3HPGA 3AL0B 1MNEA 2QKLB 4C9YA 4XONA 3W2AA 2CFOA 2X1CA 2ZSIB 4Y3OA 4YEJA 3FBIB 3OYDA 4IQJA 4AU7A 3PJRA 3A2KA 2LYCA 3MMYB 4AYBA 4PJJA 4F52A 1GLNA 2K5CA 4CH7A 2DXIA 2V26A 1P9QC 2BW3A 2WAQA 4QPQA 1G8XA 1NG6A 3G2BA 3N05A 5HNFA 5HNHA 4F55A 2V9KA 4MLOA 2CUZA 4N4NB 3OS2A 4IZZA 3W2WA 4X0GA 4BJ6C 2QKMB 2ZXHA 2IS6A 2E1MB 4D9JA 1U0JA 2VQCA 2M0MA 4RM2A 1QHHD 3L2UA 3HOTA 3IAS2 2BW3B 5KNLA 2VXDA 2HNHA 2WBMA 1FMVA 3E1SA 2HQAA 3S8PA 4BQOA 1N75A 3PFYA 3OL3A 4CCLA 4CCKA 3QYEA 3S32A 4B43A 2XDVA 2V4JC 3VYSB 1X4OA 2XSJC 3BCBA 2JVHA 3DKXA 3OYEA 2AQEA 1BR4A 3OYNA 3OYIA 2W00A 2Z2SB 4XOPA 3K10A 2LY2A 1ZELA 2VB6A 4II3A 2PMZA 4BACA 4IKFA 3SYTA 1MMNA 1SAUA 4BL0B 2R7SA 2VJ4A 2V6EA 3OMYA 1UELB 2WADA 3MKZA 3C2GA 2OC6A 1ERDA 3E0JB 2K3PA 4E7ZA 1E0EA 2L2OA 3HG9A 3OIQA 4ZDLA 4E6KG 4NQWB 3CP8A 5HOOA 4XQFA 2R7VA 4XLCA 3K6GA 3H9GA 3F9KA 1WJBA 3BG7A 3RCOA 2GOXB 4BJTA 4B48A 3H5AA 2KPMA 4XLEA 1X1CA 3L2WA 3I9V2 4XR6A 4DJAA 2XF5A 2VQLA 4NNJA 2HVQA 3K4LA 4LIVA 4Y33A 3LSMA 1WJ5A 3DTIA 4C2TA 1V5GA 3MD2A 4DIQA 4F93B 2XF7A 4G6TB 3QOEA 2NOJB 1Z21A 3LMMA 3ZRGA 3K4BA 3HXLA 3BLYA 4IX7A 1SFKA 2VJJA 2Z1DA 2V7FA 4E4HA 2R7TA 2O5RA 3OYMA 3VWBA 4HEA2 1G59A 4RLFA 4XOTA 2CW7A 3DPLC 3DPTA 3PSIA 3S3OA 1LKXA 3OOUA 2DJIA 3K4MA 4DOZA 4BUPA 1DQUA 4PJLA 1LFPA 1X4PA 2W82A 2OV7A 2I8DA 3OR1C 3OS0A 5LD2C 4CZCA 3VYUB 1Y56A 4PSWA 4OAZA 2IS1A 2M7AA 2BOLA 3IP4B 4KT6A 3L2RA 3BCAA 3QYBA 2Z16A 2UV1A 2WA0A 2L5QA 3L2VA 4EATA 1D0ZA 2R7WA 2JUGA 2FUG2 4LITA 3TBIA 2VPLA 5FRMA 1BOBA 2CV1A 3OWTA 4PJMA 2HVRA 4KISA 3DTEA 5HLTA 3LL7A 3K70C 2VJ5A 3MKYB 2VASA 2K9MA 3V42A 3KEYA 2M4KA 3KYLA 2KL4A 3RTRA 4BS9A 4YRVA 3S3NA 3CJQB 3A4CA 1D1BA 4DGWB 1WJFA 2IS4A 2IXSA 2R7UA 4ITVA 1JI8A 3DU5A 1Z3YA 3J7AY 4KJZA 4CCJA 2DT6A 4HNUA 3FKJA 5LFAA 3OYJA 2KMUA 4XM3A 3OY9A 1T95A 5HVQC 3LFUA 2E60A 5CQGA 1DGWY 3RSNA 2A6TA 3FHNA 2M3AA 2XAUA 4BQQA 4PFOA 2LY1A 1LVKA 4XNFA 2E5ZA 2RREA 3U21A 4LG3A 2CV2A 1VZ0A 3EUKL 3D5LA 1D0XA 3LSGA 4KITB 3S3MA 3H5NA 2VQHA 2X6WA 2BVMA 4CCMA 2PJRA 4E7IA 2JVGA 3DEEA 3L2QA 4PK4A 2M4GA 2WB1A 3DTKA 3DQVC 3DWLE 4XN0A 4J01A 2JSPA 1N78A 1Z7LA 1X1AA 2X1EA 4HPQA 4FASD 3OS1A 1WJDA 1UG0A 3PL8A 3SZGA 4F91B 2F5VA 2KP6A 2RNGA 2HZDA 4AVZA 4BQNA 2X6YA 3H0DA 3DLAA 2PJRB 1D1AA 2MC4A 2UUZA 2VL8A 4F92B 1MMGA 2KRCA 3FDYA 4BXFA 1TT0A 4LIUA 2ZSHB 4HSTA 2P0WA 2MFZA 4BGDA 2RQQA 2KDOA 2A5WA 2MYSA 1BR1A 2Q1ZB 2LG4A 2IGKA 2WAFA 2LC2A 2Q2EB 3ZQQA 4JOMA 3K4JA 3S93A 3OYGA 3RPUD 4HRIA 2ZFUA 3HUGB 4C30A 4BU2A 3VYRB 2F6CA 2X1DA 2X51A 2WY8Q 3K4CA 4DBRA 2KLOA 2W1OA 5JHFA 4ZDOA 2WAEA 3KX2A 3HC7A 4XKVA 1KONA 2DOAA 5CKTA 4NC8A 4ZDPA 3D5SC 4PUSA 4XLAA 3DPUA 3OYBA 3W3CA 1LDKB 3OYCA 2OUMA 4CUGA 4E7SA 1N77A 2KZVA 3K4NA 4ZJZA 2CW8A 4QPOA 4U7BA 1YX3A 3ZR8X 1K6YA 3AL0C 4E7KA 3CMMA 1WJEA 2CMPA 3LSHA 4B3XA 4XKCA 3ZGKA 4CCOA 1T0FC 4B47A 2M7BA 4YELA 4ZTJA 1OR7C 2VKDA 4DBQA 3PNYA 1FMWA 4XMYA 3OYAA 1PYVA 2ZXIA 1R6RA 1WFXA 3IAM2 3VSLA 3OIPA 3EUHC 4C2UA 2LRDA 2R7RA 3QYFA 3I3LA 4BE0A 2IS2A 3M1CA 3PNVA 2R4GA 4OWRB 5CPRB 3NWTA 1W36C 4XL9A 4R79A 3HOSA 1QU3A 1D1CA 3K70D 1HA8A 1MW7A 3VSKA 4J00A 2CV0A 3EPZA 3ZCOA 1J09A 2E1MC 1WJCA 3LSIA 2UWMA 2DT7B 3CESA 4P5OA 1X1BA 2K9LA 3AFHA 4HSRA 5TGTA 3RQ4A 1X19A 2VIXA 2VXZA 4JQFA 5FROA 4E7JA 1W36D 3BG6A 1BR2A 4RLQA 5KHDA 4PFPA 2L9SA 3A1YA 3TL4X 4BJ5C 5CQEA 3NWSA 4F3QA 4OAYA 2LH9A 2HDWA 3M8JA 2CUJA 2XF6A 3AKZA 4BE1A 2L9NA 2W7NA 2HU9A 2KHMA 2VQGA 3PNTA 5FRNA 3LSKA 3VDXA 2MABA 4E7HA 1IRXA 2R7XA 3H35A 4ZYAA 4XORA 3CJRB 4CCNA 2JA2A 1MMAA 4PJNA 2BVLA 2ELJA 3OL4A 3PUBA 1MNDA 4GRIA 4BDZA 3SDBA 3PSFA 2V1NA 1D0YA 2R7QA 2CH0A 2CS3A 4ZTFA 1DP3A 1YX5A 3HPHA 4XKWA 2R7OA 1PJRA 3GBGA 4B44A 1EA3A 3D5RC 3ZXSA 4H4KC 3UNGC 1V5FA 3QODA 2HVSA 4BEHA 3CP2A 1V5EA 3OYKA 2W4SA 1S9HA 2VJIA 3OR2C 1OLTA 4HNTA 1AA7A 4XN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKW B;  3MKZ A;  3MKY B;  3W3C A;  1VZ0 A;  3W2A A;  3VWB A; 
#chains in the Genus database with same CATH topology
 4KIB A;  4A69 C;  4ANJ A;  3JRA A;  2DCE A;  2H8W A;  1L3L A;  4KIG A;  1DGR M;  3CZ6 A;  3DKY A;  3UKG A;  1Q1H A;  4L18 B;  1YRN A;  2G9W A;  1IDY A;  4U87 A;  4BBR J;  3H5R A;  2LRE A;  2PJP A;  1WI3 A;  2VE9 A;  1ZRC A;  2JJ7 A;  2J5O A;  5LGN A;  3T8R A;  1W0U A;  3HRM A;  5IP9 J;  2MH9 A;  4N4O B;  1ULY A;  5DM6 F;  2ZJR F;  4BEH B;  4M3B A;  3H9J A;  2VLA A;  4D1Q A;  1SFE A;  4RMN A;  1FBQ A;  4HG2 A;  2LOO A;  4ZZL A;  1W5S A;  3HOX J;  3U1K A;  2HKO A;  3UR3 C;  3OYH A;  3BC8 A;  3ONQ A;  3H3V K;  3VYT B;  2EV6 A;  3IKV A;  1W4M A;  2MD0 A;  2VBY A;  2Y0S A;  2M8G X;  3OYF A;  3F21 A;  2DA3 A;  2E2I J;  2IRF G;  1O4X A;  1B6A A;  1F4K A;  1TC3 C;  1MMD A;  4RM3 A;  2H8R A;  2IJL A;  1J9I A;  4CZZ A;  1HCR A;  2KQR A;  5C4X J;  2DK8 A;  4RGS A;  3AG2 H;  4M3G A;  3SEQ A;  4CA0 A;  3Q5F A;  4PZJ A;  4CYD A;  2ACJ A;  2IW5 A;  3L7W A;  4M9Z A;  1HKQ A;  1KU9 A;  4P96 A;  2K7L A;  3ZMS A;  5BOX A;  3SJM A;  1IW7 F;  2MLK A;  4XON A;  4C9Y A;  2OZ6 A;  5IY5 H;  5EF6 A;  1LQ1 A;  4P9U A;  4RB3 C;  2CFO A;  1S6L A;  3FMQ A;  4YEJ A;  4LLG F;  3M8E A;  1ETQ A;  3LFK A;  3OYD A;  4IVN A;  4HLY A;  1W5T A;  4AU7 A;  3S1M J;  4IPA A;  1RUN A;  1VI0 A;  2AXL A;  4MQ9 F;  4FHT A;  4F52 A;  1GLN A;  2P7C B;  1K7A A;  2L3D A;  2V26 A;  1P9Q C;  2B0L A;  2WAQ A;  4LMY A;  1ZGA A;  5LRR A;  1ZRF A;  4MTD A;  1FSH A;  5DS9 A;  5HNF A;  2V9K A;  1VQ4 I;  2CUZ A;  1BA5 A;  4BHP A;  5JLW A;  3OS2 A;  3W2W A;  2RNJ A;  2QKM B;  3GTL J;  3GME A;  1R71 A;  2E1M B;  1K78 B;  3S16 J;  5J1Y A;  3WOD F;  1O7L A;  1CQT A;  3ABU A;  3ESW B;  5ILU A;  1HW2 A;  2P6S A;  3L2U A;  4I2O A;  5H20 A;  3I59 B;  3D1N I;  3C18 A;  3HRS A;  3REO A;  3KE2 A;  1FMV A;  1JHH A;  1SMY F;  3ULQ B;  3W6K B;  2NRA C;  3GTP J;  3CCM I;  3S8P A;  3JRE A;  1LB2 A;  4CDG A;  5F27 A;  3IH4 A;  3CUQ B;  1H0M A;  1J5Y A;  2BHY A;  1LE8 B;  3QYE A;  2IPQ X;  2XDV A;  3MQ0 A;  1DU6 A;  1ZGW A;  5J3L A;  2XSJ C;  1XG1 A;  2VN2 A;  4UB8 C;  3OYE A;  1FSE A;  2NVQ J;  2COB A;  1ORK A;  3OYI A;  2WAQ N;  2Z2S B;  2STT A;  4NQW A;  1JKP C;  4XOP A;  1T2K A;  1POG A;  2EV0 A;  4A0X A;  4L9T A;  4LFU A;  4U7D A;  1ZEL A;  4II3 A;  2IAI A;  2PMZ A;  3NEU A;  3ABM H;  4BL0 B;  1ZLK A;  2NS8 A;  5HDK A;  5B3S H;  4XRF A;  2WAD A;  3DCF A;  1VND A;  3E0J B;  4HF2 A;  4WCG A;  2K3P A;  2QM3 A;  3HG9 A;  3OIQ A;  4IF4 A;  1IRZ A;  1ACI A;  4ZDL A;  3CP8 A;  4XQF A;  4L9N A;  4XLC A;  3K6G A;  4MHG A;  3RKY A;  3F9K A;  4I01 A;  3S2D J;  2GOX B;  1H89 C;  4B48 A;  3ISP A;  4D5C A;  3H5A A;  2KPM A;  2ZJP F;  3L2W A;  1R4N B;  5JR3 A;  2XAG A;  2HVQ A;  4HDU A;  4LIV A;  4C3J J;  2DMQ A;  3LSM A;  2XB5 A;  2HTJ A;  1DUX C;  1OJL A;  4F93 B;  3MD2 A;  3HRT A;  4DIQ A;  2P5L C;  4G6T B;  3J81 K;  3AG3 H;  1Z21 A;  3LMM A;  1OYW A;  2GIZ A;  1H9T A;  4B4C A;  2DA2 A;  1QA6 A;  2Z1D A;  3BZ6 A;  3OYM A;  3JTH A;  1G59 A;  2OJE D;  2PMZ N;  3BTC A;  3DBH B;  3JRH A;  2CW7 A;  1TQP A;  3FK6 A;  3MZ8 A;  1TQM A;  5C4J J;  1TNT A;  1IAW A;  3V8L A;  3S3O A;  1W5C C;  3O8H A;  3G1O A;  1SAX A;  2WB1 N;  5GAH J;  3CCR I;  2Z9O A;  4PJL A;  1H88 C;  1RIO H;  2OV7 A;  2CQ7 A;  4XIC A;  2R0Q C;  3OS0 A;  4B09 A;  1FYM A;  3VYU B;  1Y56 A;  1ETV A;  4PSW A;  3FXU A;  1JTX A;  2M7A A;  1F36 A;  1R23 A;  2BOL A;  2OQG A;  2XGC A;  2YR2 A;  3DF8 A;  4G12 A;  3FM5 A;  3L2R A;  2DJN A;  3OOP A;  3FWE A;  2O0Y A;  1NTC A;  3FXO A;  2L5Q A;  3KP7 A;  3QU3 A;  4A2U A;  2FUG 2;  2GA1 A;  1W7P A;  1VFC A;  5B1A H;  5IYC J;  3HSR A;  4AD9 A;  5DM7 F;  2PMH A;  3DTE A;  2OPT A;  3M3Y J;  3ECH A;  3LL7 A;  3K70 C;  4EM2 A;  2O9L A;  4Z2Y A;  1RI7 A;  4R1H A;  3KEY A;  1OCR H;  2M4K A;  3WGH A;  3A02 A;  1TWA J;  3ECO A;  2DW4 A;  4YRV A;  3E97 A;  1FTZ A;  3J80 Z;  2H1L A;  1GT0 C;  2EFW A;  4LJZ F;  1IXC A;  1YS7 A;  3R0A A;  1WJF A;  4IL6 C;  2DI3 A;  4ITV A;  2HDD A;  3W6V A;  2BV6 A;  4B8X A;  1ZKG A;  4ABZ A;  2G7U A;  3JRI A;  2CYY A;  1J59 A;  4HNU A;  1ZLJ A;  5LFA A;  1IZ1 A;  4ON0 A;  3S1N J;  2YU3 A;  2TCT A;  1X2M A;  3TP0 A;  1TWG J;  2XGD A;  1U78 A;  3BOQ A;  3E3V A;  4RAY A;  1IC8 A;  3HDD A;  4A6D A;  1UCR A;  3FHN A;  2XAU A;  5F04 A;  4ENN A;  3GF2 A;  1IUY A;  1XPX A;  3CD6 I;  2DU9 A;  2RRE A;  2VOP A;  3U21 A;  4LG3 A;  5DCM B;  4A0Y A;  2ZFW A;  2LTP A;  1D0X A;  3H5N A;  3E6C C;  2VQH A;  3I58 A;  2X6W A;  5A2Q K;  2BVM A;  2PJR A;  3TOB A;  2M2E A;  4E7I A;  1B4A A;  3DEE A;  4X1E A;  1JHF A;  1IV6 A;  2IVM A;  3K1P A;  2HEO A;  5D4R A;  1YI2 I;  3TO9 A;  4RAZ A;  1R22 A;  1WPK A;  2X1E A;  2EIK H;  4FAS D;  1WJD A;  1UG0 A;  3PL8 A;  4FTH A;  2A3S A;  1JGS A;  1HQC A;  4BQN A;  2HZD A;  2A07 F;  2QSF X;  5J8F A;  1OFC X;  1QRY A;  1D1A A;  3BT9 A;  5J6X A;  3WTS C;  5BPD A;  4LG0 B;  2V9V A;  1B9N A;  3EDP A;  1TP4 A;  2UUZ A;  2G7H A;  2NS7 A;  2QGU A;  4BHC A;  3JTG A;  3SFI A;  1MMG A;  2VUM J;  2KRC A;  4CHU A;  4BXF A;  1R49 A;  1TT0 A;  4M6Y A;  1Y0U A;  4LIU A;  2P5V A;  3FX3 A;  1U6G A;  1A5J A;  3IHU A;  2EV5 A;  1WVR A;  5F1R A;  2BY3 A;  1FC3 A;  3B6A A;  3CCV I;  2EA4 A;  2IGK A;  2JK3 A;  1QGP A;  2MLG A;  5EZG A;  1QZE A;  2AO9 A;  3WU2 C;  5TJJ A;  4JOM A;  3BZC A;  3K4J A;  2F5C A;  3L09 A;  3S93 A;  3F3X A;  4S05 A;  3ZOB A;  1VQ8 I;  1JXS A;  1U5T A;  5GAD J;  1E17 A;  2F6C A;  5FD5 A;  1JUP A;  2KLO A;  3ABT A;  5EG0 A;  2MC3 A;  3KX2 A;  1YJ9 I;  1T6S A;  2DOA A;  5CKT A;  2XIG A;  2KRF A;  2HR3 A;  4NC8 A;  4PUS A;  2VOD A;  2JUC A;  3DPU A;  4XLA A;  1S3J A;  4DZP A;  1LDK B;  1EJ9 A;  5DUK A;  1A35 A;  3TO6 A;  2OUM A;  2X9D A;  2DK5 A;  2ECB A;  1UHM A;  1V3F A;  5D6E A;  2NNN A;  1OCP A;  2QA4 I;  3I4M J;  2XHK A;  4E7K A;  3CMM A;  2CMP A;  3AG4 H;  1LPQ A;  4XKC A;  3LST A;  4CCO A;  2E2J J;  1S5L C;  2BGC A;  4P55 A;  4ZTJ A;  4OMZ A;  2EPF A;  4A3C J;  4DBQ A;  2VBZ A;  1SFO J;  4XMY A;  1JGG A;  3OYA A;  3GTO J;  2FXA A;  3CTA A;  1R6R A;  3OIP A;  2R7R A;  3QYF A;  1F43 A;  2DYS H;  1ITY A;  1U2W A;  1X3U A;  4OWR B;  3AG1 H;  3GFL A;  3GFM A;  4LK0 F;  4XL9 A;  2PBI A;  1D1C A;  3I0T A;  3JRB A;  3VSK A;  1HC8 A;  2E7X A;  2FBI A;  1ZG1 A;  3EPZ A;  2HOA A;  3S2H J;  4DYQ A;  4DYR A;  1FOY A;  5HDG A;  2MD5 A;  2UWM A;  3CES A;  4KMU X;  4BH9 A;  3BPV A;  4HSR A;  1BC8 C;  2E2H J;  3HOV J;  3MN2 A;  5GTH C;  2VXZ A;  1HXD A;  4ZYH A;  2LKS A;  2AHQ A;  3BG6 A;  1BR2 A;  4PFP A;  1ETK A;  2PEX A;  4BJ5 C;  3HTS B;  1FBS A;  2D5V A;  4F3Q A;  3NQO A;  5M3F J;  2OF7 A;  1XDS A;  2XF6 A;  3RDI A;  5F0F A;  3WTX C;  3DXJ F;  1QZY A;  1B9M A;  3LAJ A;  1K61 A;  3T0Y A;  1X3W B;  1Y0N A;  1B72 B;  3CDL A;  1IRX A;  2I10 A;  4XOR A;  4CCN A;  2QBY B;  2JA2 A;  5E8G A;  2EFN A;  2ZME B;  1ZYR F;  3DEW A;  3ASO H;  1T98 A;  3PUB A;  4EEF G;  4AYB N;  3HIF A;  2P81 A;  1NK3 P;  3T8T A;  4IXA A;  1XTA A;  2CS3 A;  2XAF A;  5DD8 A;  3FHZ A;  1YX5 A;  3HPH A;  4XKW A;  2EQR A;  3GZ6 A;  2DA7 A;  4G94 A;  2Y0M A;  3CMA I;  3MZH A;  5AIP A;  2NOG A;  4CGZ A;  3GTK J;  1EA3 A;  2CO5 A;  2M8E A;  2LP0 A;  2L7F P;  3GXO A;  3UNG C;  3CCQ I;  2FU4 A;  4KUM A;  4BEH A;  1SD4 A;  1FZP B;  3OYK A;  1UFM A;  5HLI A;  2CRG A;  3ZQ7 A;  1M1E B;  4XN3 A;  5JI6 A;  2CGP A;  3TW6 A;  2L7K A;  4WXH A;  4L0Z B;  3OYL A;  1JUM A;  4GXO A;  5E1Z B;  1VQ7 I;  5FFZ A;  2E71 A;  2GOM A;  2BYV E;  1XCB A;  4XLF A;  2E1C A;  4KT5 C;  3OSF A;  3K0L A;  1JJ8 C;  2R92 J;  1RC9 A;  2C6Y A;  2K27 A;  2W25 A;  4ZC3 A;  1S7A A;  2WC2 A;  3VPR A;  2B9S A;  3J80 K;  4IO9 F;  1X1D A;  2IGO A;  2B7E A;  4LK1 F;  4BDY A;  1XSV A;  1XMA A;  2IGM A;  1OCT C;  4IRH A;  3WG7 H;  5LHH A;  4M3D A;  2X6O A;  1TZL A;  2KRH A;  5J1R A;  5CYV A;  1EKE A;  4N9H A;  4CSW A;  5IOZ A;  2E19 A;  3HL2 A;  2HPM A;  1G3S A;  2IGN A;  3KLN A;  4MO7 A;  4HBL A;  4E7L A;  1Z3X A;  4XLH A;  2ZXJ A;  4XRS A;  3JRG A;  3IUO A;  4HQM A;  2BXY A;  1WJA A;  3T5X A;  5F64 A;  5E8I A;  4NC7 A;  4BNC A;  1MH3 A;  5JLX A;  5EG0 B;  2DDB A;  4BE2 A;  3K7A J;  2ZCW A;  2LBF B;  1O3S A;  3WGI A;  3OSG A;  2EB7 A;  3KEO A;  5BPI A;  4LGW A;  1Z67 A;  3KZI C;  2R5Y A;  2X1C A;  5B1B H;  2L4A A;  3FBI B;  2X48 A;  1K78 A;  4QWQ A;  3PJR A;  2VC0 A;  3A2K A;  2E36 A;  1FIP A;  3F8M A;  4F7Z A;  3LQR A;  2QVO A;  3I59 A;  3R61 A;  1HOM A;  1NG6 A;  5EYR A;  1R5G A;  2D1H A;  3G2B A;  3N05 A;  5HNH A;  4F55 A;  5K7F A;  4FX4 A;  3E6M A;  1R4M B;  3BR2 A;  3CUQ A;  1VQ5 I;  2ZXH A;  3GTQ J;  3S1Q J;  2ZKZ A;  3QOP A;  1LE8 A;  3GLX A;  2W48 A;  1JJ6 C;  2WWY A;  2KIU A;  1U0J A;  2VQC A;  3X2Q H;  5BS6 A;  1QBJ A;  4IHS A;  1VQK I;  4E70 A;  4AVP A;  4RM2 A;  2HOS A;  1QHH D;  3R4K A;  3M4O J;  2BW3 B;  3JRD A;  5E3L A;  5DUI A;  2VBW A;  3K1N A;  5KAI C;  2HQA A;  3LA7 A;  2O8X A;  3V7S A;  5FLX Z;  4AUX A;  4A5M A;  1VF9 A;  4XRM A;  4CCK A;  3E5Q A;  4YFX F;  2V4J C;  5B5E C;  3JSP A;  4XID A;  2F5F A;  2F5D A;  4IJA A;  5EEA A;  3BTL A;  4BXX J;  2LNB A;  3N4M A;  2JVH A;  2A5Y B;  1X58 A;  1FP1 D;  2QCO A;  1PP7 U;  3F8B A;  1Y8R B;  1YIO A;  3E7L A;  5IPA A;  3HSF A;  3K10 A;  2CQN A;  5J8C A;  3F8C A;  3GYH X;  2UXX A;  2LY2 A;  1QVU A;  1V4R A;  3F6O A;  4HOB A;  3G4S I;  5D5U B;  2R93 J;  3MKL A;  2PQ8 A;  1N25 A;  1UG2 A;  3QAH A;  4G9Y A;  3SYT A;  1D8K A;  1ZTR A;  1XGM A;  2R7S A;  3ZP5 A;  4DYC A;  3JCU C;  1QNT A;  3KET A;  1FOK A;  1MJ9 A;  3C2G A;  4I0A A;  3G3Z A;  1P4W A;  2H1K A;  2QYO A;  4MEX F;  3F22 A;  1LVA A;  1ERD A;  5CJ9 A;  3M8F A;  4Q47 A;  4E7Z A;  1E0E A;  1WHU A;  1XGO A;  5J1U A;  2HWV A;  4A3D J;  3TP3 A;  2R7V A;  1SVL A;  4AWX B;  3BG7 A;  2HKX A;  1ZGJ A;  3BG5 A;  2VT2 A;  3RPU A;  1E3O C;  3SQN A;  1X1C A;  2E35 A;  2OU2 A;  3I9V 2;  4ZZD A;  4X6A J;  4NNJ A;  2L7M P;  4RB2 C;  2KIQ A;  1WJ5 A;  1BM9 A;  2GZW A;  1FOX A;  1R7J A;  3QPL A;  2XF7 A;  3HUG A;  3QOE A;  1BI2 A;  1G3T A;  3OIO A;  1U9O A;  5J40 A;  1VQ6 I;  1JT6 A;  3K4B A;  5CVU A;  1FPQ A;  1SFK A;  2R7T A;  2V7F A;  2O5R A;  1FJL A;  2LLK A;  5A2Q Z;  3TED A;  2CJJ A;  2OTL I;  1ON1 A;  5TIS C;  4L0Y B;  4OIO F;  3DPT A;  3H3Z A;  2XAQ A;  4KN7 X;  1OCO H;  3WHC A;  4DOZ A;  4BUP A;  3BTJ A;  1R58 A;  4KMF A;  1DQU A;  2MSY A;  2DMP A;  4C2M J;  3RKX A;  5F0H A;  3Q9V A;  1X4P A;  3J7A O;  3OR1 C;  5AON A;  4KA4 A;  3GUD A;  1EF4 A;  5HLH A;  3CC7 I;  2WV1 A;  3Q3S A;  2WTE A;  4ZYG A;  3HGG A;  1P92 A;  1U5T C;  4JX5 A;  3BQZ A;  3WE3 A;  4HA8 A;  2RAE A;  4HNV A;  2FOK A;  1WI9 A;  1SD7 A;  2RC4 A;  3PIP F;  2JUG A;  2W84 A;  2V9P A;  5HS7 A;  2VPL A;  1K4S A;  5FRM A;  1ZHF A;  1BOB A;  2TRT A;  5HLG A;  1FOW A;  2CV1 A;  4PJM A;  1ZAO A;  1ZQ3 P;  3P9I A;  1GVJ A;  4KIS A;  3KP3 A;  3RYP A;  5HLT A;  1YJW I;  2ECC A;  2JTV A;  1AU7 A;  2MBF A;  4FIS A;  4QSH A;  5CVJ A;  2GWR A;  2R5Y B;  2OCC H;  4U0V A;  2K9M A;  3V42 A;  2DOF A;  1VQP I;  2YX7 A;  1SD6 A;  2KL4 A;  4A6E A;  2ADU A;  2DTR A;  2K3F A;  4WXD A;  1IXS B;  2NVU B;  1W0T A;  2EIL H;  3A4C A;  2H6B A;  3VEP A;  1VQN I;  5LHI A;  3GW2 A;  1Z6R A;  2MG4 A;  2LKX A;  3ML6 A;  1JI8 A;  1Z77 A;  3A0H C;  4G7Z F;  5JVG F;  5EEH A;  1Z3Y A;  3WTU C;  3KP2 A;  5DCM A;  4L5E A;  1FT9 A;  4Q5S F;  2JA8 J;  3OYJ A;  1XGN A;  4XM3 A;  3OY9 A;  1MKM A;  2M45 A;  1GXP A;  2FE3 A;  3CCU I;  2XGE A;  5HVQ C;  3KIO A;  4ETS A;  1S29 A;  2E60 A;  1TBX A;  4A5N A;  3Q9S A;  5LGU A;  5IOY A;  4RBO A;  4BQQ A;  2ESN A;  1LVK A;  1BC7 C;  1LUJ B;  1FLI A;  1KU2 A;  4I76 A;  3GLL A;  2XPV A;  3D5L A;  3VOD A;  4KIT B;  4A3J J;  5ILS A;  3EQL F;  4OMY A;  3JAM Z;  3LOC A;  2F2E A;  3DLL F;  2UXN A;  2BY2 A;  4LG0 A;  2JN6 A;  1E3P A;  1TT5 B;  2JVG A;  2DA4 A;  3VB2 A;  3GEZ A;  2M4G A;  2WB1 A;  1KQ0 A;  3DQV C;  3F8N A;  4J01 A;  2D45 A;  1R9T J;  4KIC A;  4L9V A;  4HPQ A;  3OS1 A;  3FM3 A;  3HJE A;  1OCZ H;  4HX7 A;  3KFW X;  5GTI C;  2ZJ2 A;  2DPU A;  1MBF A;  3F72 A;  3FXQ A;  2F5V A;  1TW2 A;  1ZRE A;  3PUF A;  3QPH A;  2VPR A;  3J7Y J;  2B63 J;  2VL8 A;  4F92 B;  3R0J A;  4R8H A;  1KA8 A;  4NDL A;  5IP7 J;  1MBK A;  2P0W A;  1DPR A;  2AXT C;  2A5W A;  3QWL A;  1BJZ A;  1D5Y A;  1WH5 A;  1BR1 A;  3WU1 B;  5TRD A;  2IA1 A;  1A36 A;  2XKP A;  4FCY A;  3Q0U A;  3FXL A;  9ANT A;  1I39 A;  2Q2E B;  3HB9 A;  1UST A;  4GYI A;  3OYG A;  2GIV A;  4WF2 A;  3RPU D;  4Y13 A;  2LD5 A;  4HRI A;  2ZFU A;  3HUG B;  3JW4 A;  3WG9 A;  3E6B A;  3MAJ A;  3VYR B;  4XSX F;  2X1D A;  2RDP A;  1Z7U A;  1WZ2 A;  1REP C;  2WY8 Q;  4DBR A;  4ZDO A;  4KNY A;  2FF4 A;  3OV8 A;  2EH3 A;  3GCM A;  2DQL A;  1KU3 A;  4RGU A;  3IH2 A;  3I54 A;  2XAS A;  4ZYE A;  5EGO B;  5FLX K;  5FKO A;  1FYL A;  1DDN A;  2DO7 A;  5FKL A;  5ICE A;  3OYC A;  4UV8 A;  5FO5 A;  5M5X J;  1SFU A;  3MWM A;  1N77 A;  2KZV A;  3K4N A;  3EET A;  2DMT A;  4U7B A;  3HOY J;  1K6Y A;  2GAU A;  1WJE A;  3LSH A;  1EH7 A;  4XSZ F;  4B3X A;  1T0F C;  4B47 A;  3TDU C;  1OR7 C;  1OQY A;  3PNY A;  1FMW A;  2X0L A;  3FMR A;  1MMS A;  2H09 A;  3JRC A;  3IKT A;  3VSL A;  3M9A A;  2GXG A;  5L3C A;  1GDT A;  1Y1W J;  3LNQ A;  3EUH C;  1P7I A;  4W1U A;  2FX0 A;  2QZ8 A;  2HYG D;  3FMS A;  2KKO A;  5CPR B;  3G1L A;  1W36 C;  1QU3 A;  4R79 A;  2M30 A;  2EJR A;  3SHF A;  1V54 H;  5LEK A;  2CV0 A;  3ZCO A;  1J09 A;  2E1M C;  2JRM A;  2DPD A;  2JZY A;  3LSI A;  5JVT A;  1W1W E;  2DT7 B;  2AS5 F;  4P5O A;  1X1B A;  2QEX I;  3LQQ A;  3CCJ I;  2K9L A;  2QUF A;  1B72 A;  4MIM A;  5FRO A;  4E7J A;  1ZR4 A;  2QBY A;  3SFZ A;  3ERE D;  2HZT A;  2ZME A;  4RLQ A;  5KHD A;  1ZR2 A;  1X2N A;  1EH6 A;  2Y30 A;  4G6D A;  1FNN A;  5CQE A;  2IT0 A;  2HDW A;  3M8J A;  2CQQ A;  1XB4 A;  3G73 A;  2FJ1 A;  5CVV A;  2QQ8 A;  2QF7 A;  3CJT B;  4OIN F;  2R7X A;  1YJN I;  2CUE A;  2ZXW H;  2KIM A;  2Y75 A;  2BVL A;  2ELJ A;  3ZQL A;  1GV2 A;  3PQJ A;  4GRI A;  5DDG A;  2M5W A;  3HM5 A;  3ASN H;  4ZTF A;  4LB6 B;  4ENK A;  2FOW A;  2ID3 A;  2ME6 A;  4I0B A;  1MZB A;  4ESJ A;  2M9H A;  3GBG A;  1ZK8 A;  3K2A A;  4B44 A;  1QO0 D;  4N9I A;  2RGV A;  5FKN A;  1G6N A;  4G7H F;  4FT8 A;  3QU6 A;  5GPA A;  3IH3 A;  4HF0 A;  4IOA F;  2RKH A;  1TW3 A;  2HVS A;  2ISZ A;  4IRI A;  2FA5 A;  2XRN A;  3CP2 A;  2PI0 A;  2IA2 A;  1PUF B;  2H6C A;  2DYR H;  1S9H A;  2VJI A;  1H8A C;  1LJ9 A;  2NNY A;  4A3F J;  1JKR C;  4RGR A;  3H9Q A;  4WWC A;  4UY8 I;  1BJA A;  1MJA A;  3MCZ A;  2LFB A;  4PSX A;  3RI4 A;  4L9J A;  2DA5 A;  1Y8Q B;  1F9N A;  4Y52 J;  1RPW A;  4I7H A;  5DD4 A;  2VKH A;  3PO2 J;  2VOO A;  2NVY J;  1HW5 A;  4P1W A;  3HHH A;  1NG7 A;  2DAO A;  3C2H A;  1UB9 A;  3CF2 A;  4FE4 A;  2XC7 A;  1XX5 A;  2LVS A;  2BBY A;  2F4I A;  4ASN A;  5M3M J;  2LBF A;  3MKW B;  3K2Z A;  1RES A;  3SZP A;  3SXY A;  4Y4R A;  3CUO A;  3O3K A;  3JR9 A;  1T08 B;  3TMO A;  3SEZ A;  3TKY A;  3FXJ A;  3ELK A;  4NUB A;  4XKB A;  2X85 A;  1VTN C;  3PIO F;  4MGR A;  3JSO A;  2WY7 Q;  4IQ4 A;  3ZQI A;  3BR5 A;  2GXA A;  5KK1 A;  4QTR A;  3HZJ A;  5K7H A;  2ISY A;  4GYG A;  1R1V A;  3HPG A;  3AL0 B;  1MNE A;  2QKL B;  3M1E A;  5D8L B;  3W2A A;  3LAP A;  1CF7 B;  3U1D A;  1IXR C;  4Y15 A;  3JAM K;  4RAF A;  2UZK A;  2VC1 A;  2K9Q A;  1IG7 A;  1F5T A;  1T56 A;  4LOC A;  2N8G A;  4AYB A;  1FBU A;  4CH7 A;  5HS8 A;  2DXI A;  2BW3 A;  2VT3 A;  5K5Q A;  1G8X A;  5K5O A;  4MLO A;  4EGZ A;  3P9K A;  5FJ8 J;  4M3F A;  1D3Y A;  4IZZ A;  4LLL A;  2GM4 A;  2L7Z A;  4X0G A;  4BJ6 C;  4A93 J;  1Y39 A;  1D8J A;  4XBF A;  1IUF A;  3V8J A;  2M0M A;  3A01 A;  3NRV A;  3IAS 2;  4M6X A;  1A04 A;  2VXD A;  2XVC A;  2HNH A;  2WBM A;  3E1S A;  3WE2 A;  1HLV A;  4BQO A;  3G71 I;  3PFY A;  1P4X A;  2KIF A;  4PGH A;  5EZH A;  1SVO A;  1K4T A;  3ZMV A;  3L00 A;  1FP2 A;  3S32 A;  5LHG A;  4OIQ F;  2FQ3 A;  2FBH A;  2RQP A;  2QQ9 A;  1SMT A;  1X4O A;  1K79 A;  2V1D A;  3ZPL A;  4V19 K;  2WV0 A;  1WH7 A;  4JBA A;  2LR8 A;  1IRG A;  2AQE A;  1BR4 A;  1C0W A;  2COM A;  4EJW A;  1KQ8 A;  5C3E J;  3QRF F;  2ETH A;  2R5Z A;  3K1M A;  4XLP F;  5IP6 A;  2O7O A;  2GQQ A;  2VB6 A;  3I64 A;  2DFF A;  3HRU A;  5EJC A;  1AWC A;  3GZ5 A;  2L4M A;  3WU0 A;  1OCC H;  2VJ4 A;  2HOE A;  4ZYD A;  3T1B A;  2V6E A;  3OMY A;  2JQ7 A;  3MKZ A;  2O3F A;  3QP5 A;  2E1N A;  2Y69 H;  4RB0 A;  1SEU A;  1R36 A;  4UNO A;  2L2O A;  1E2X A;  3P5J A;  5HOO A;  3BR6 A;  2XGX A;  3GFJ A;  2QQB A;  3H9G A;  1WJB A;  1GV5 A;  3BRO A;  1PVE A;  3RCO A;  2H27 A;  1YQA A;  2EIM H;  1HKT A;  4EJT A;  4XR6 A;  1LEB A;  2XF5 A;  1MD0 A;  2HXI A;  4M6V A;  2K4J A;  3BDD A;  4UVC A;  4A3M J;  1P2F A;  1R1T A;  2R3S A;  4Y33 A;  3WGG A;  3DP7 A;  2KZG A;  4C2T A;  3ZQH A;  1YW8 A;  5CVI A;  1X1P A;  2MGQ A;  2QEN A;  1KZH A;  3SZT A;  2NOJ B;  2QWW A;  5J4Y A;  2DBB A;  6PAX A;  1WRJ A;  4M3E A;  3HXL A;  2STW A;  1XDU A;  2DFE A;  2ID6 A;  3WTZ A;  4IX7 A;  1SD5 A;  2HTS A;  1BOA A;  2OZU A;  2GXB A;  1IO2 A;  4HEA 2;  3B02 A;  3CLO A;  4RLF A;  1TWC J;  1MBE A;  3QP6 A;  1LKX A;  2DDA A;  1QQI A;  2LDU A;  5F1J A;  1TNS A;  1PP8 F;  4J19 A;  3ERM A;  1XCV A;  4KYW A;  4OIP F;  3TGN A;  2EZI A;  1LFP A;  2W82 A;  4OU0 A;  1QVT A;  4BXU A;  3P7N A;  4P9F A;  2EWN A;  4OAZ A;  3IP4 B;  1XD7 A;  5ICC A;  5FLV A;  1L0O C;  2KJB A;  5ICG A;  1NH3 A;  1G3W A;  2YS9 A;  5LLQ A;  3ZMD A;  1XMK A;  1D0Z A;  2R7W A;  4LIT A;  2FSW A;  1DU0 A;  2V1U A;  1WSU A;  4AM3 A;  2CFX A;  3OWT A;  2HVR A;  4JX4 A;  1B1B A;  2J5P A;  2VKV A;  2Y9Y A;  4CO8 A;  3HOU J;  3BR1 A;  4G6Q A;  1GVD A;  1I5Z A;  2VAS A;  2D1V A;  2V1X A;  1J75 A;  1ZG3 A;  4QLC U;  2VI6 A;  1UZC A;  3KYL A;  1RR8 C;  2ELK A;  2YU9 J;  4BS9 A;  5CLS A;  3LWF A;  1I1G A;  3S3N A;  3CJQ B;  1K6O A;  4M74 A;  1WWX A;  1NHA A;  2GA2 A;  3WHB A;  4EMS A;  2HYF A;  1D1B A;  1RNL A;  4DGW B;  4CYC A;  4IOC F;  2IXS A;  3VOE A;  2NXN B;  3RKW A;  2JSC A;  2CW0 F;  2P7V B;  3G1M A;  2NVT J;  2FEZ A;  3J7A Y;  4KJZ A;  2DT6 A;  4MEY F;  1UMQ A;  4MQV A;  2LMD A;  3FXK A;  4RS8 A;  3S1R J;  1T95 A;  1IN7 A;  1S8N A;  4Q4Z F;  3LFU A;  4HF1 A;  4GCV A;  1APL C;  4HDV A;  2L9V A;  1BBY A;  1DGW Y;  3RSN A;  2A6T A;  3A01 B;  4ENJ A;  2M3A A;  4HV6 A;  4AC0 A;  4EQQ A;  1BW5 A;  2RN7 A;  1PDN C;  3S14 J;  1ZN2 A;  1BIB A;  1SVM A;  1YOV B;  2FML A;  2E5Z A;  2X4H A;  3MZY A;  2CV2 A;  1VZ0 A;  3EUK L;  3LA2 A;  5F6F A;  3Q0W A;  3LSG A;  3S3M A;  4I09 A;  4PCQ A;  2ZME C;  2Y9Z A;  3V7C A;  4D7M A;  4M72 A;  2K85 A;  3J7Z I;  1D5V A;  3NAU A;  3EYY A;  3BY6 A;  4AIJ A;  1A6Q A;  4C3I J;  2QSH X;  3E5U A;  3FIW A;  3H0G J;  3L2Q A;  4IHW A;  3CDH A;  2NYX A;  3A0B C;  2YX4 A;  4XN0 A;  3R60 A;  2JSP A;  5DEQ A;  4LD5 A;  3ZQF A;  3GVA A;  5KAF C;  1RUO A;  5JFR A;  3O2P E;  1I3Q J;  2R5Z B;  1S7O A;  1J2X A;  3SZG A;  4F91 B;  5J4V A;  4MFD A;  3V4G A;  1OYY A;  2Q2E A;  2NVX J;  2R7D A;  3I5U A;  4N0B A;  1JT0 A;  2MC4 A;  1KQ9 A;  1HDD C;  2M1B A;  2OBP A;  5K1Y A;  2A61 A;  2Z99 A;  2ZSH B;  4PDK A;  5DV5 A;  2MFZ A;  1QPM A;  1OKR A;  2NS0 A;  2RQQ A;  1O3T A;  2KDO A;  2BY1 A;  2Q1Z B;  1X3Z B;  2YUS A;  4MTE A;  1HDP A;  3QQA A;  4OIR F;  2LC2 A;  2CU7 A;  1Z1D A;  5EGO A;  1Q1V A;  1NK2 P;  2A69 F;  3ZMT A;  2LKP A;  3K69 A;  1P6R A;  3HTU A;  1LEA A;  1UJ8 A;  3KYC B;  5ILV A;  2E1O A;  4C30 A;  1G3Y A;  2JA7 J;  2W57 A;  3M7G A;  1R00 A;  1XSX A;  2X51 A;  3ZQC A;  2F5E A;  2WAE A;  3L1P A;  2DFH A;  4U88 A;  1KON A;  2LY9 A;  5JHU A;  3IV5 A;  3RKQ A;  1YFH A;  3F0C A;  2JA5 J;  3D5S C;  4KDP A;  3BZK A;  3OYB A;  3W3C A;  1DPU A;  2OAZ A;  4B3A A;  4CUG A;  3P9C A;  3CCL I;  2W24 A;  4BAY A;  4EJV A;  4ZJZ A;  1T38 A;  3S17 J;  4LB5 A;  1YX3 A;  3ZR8 X;  4RA2 A;  2DOE A;  3ZGK A;  4HAM A;  1YS6 A;  2PG4 A;  4YEL A;  2FBK A;  4ZH4 F;  5M5W J;  2K9S A;  2VKD A;  1WKM A;  3L2C A;  3HHG A;  2ZXI A;  1WFX A;  1BL0 A;  1U8R A;  2HQ5 A;  3CC4 I;  5BQT A;  2JT1 A;  2PX9 A;  4BE0 A;  2IS2 A;  3M1C A;  3PNV A;  3SDG A;  4HQE A;  1MNM C;  1I3A A;  3CC2 I;  1FY7 A;  4JYK A;  3K70 D;  3EYI A;  1YYV A;  4YG2 F;  1MW7 A;  1R5H A;  2GLO A;  1MSF C;  2EFQ A;  2Y0S N;  4RAG A;  2IP2 A;  2FRH A;  1O3Q A;  3F23 A;  1XGS A;  4A3L J;  2BE5 F;  2F4O B;  1TQI A;  5E3N A;  2ZNZ A;  3Q0V A;  4UVB A;  5TGT A;  2M87 A;  3FXM A;  3RQ4 A;  1LNW A;  1X19 A;  2VIX A;  4XK4 A;  4Z6Y A;  4JP0 A;  1IN5 A;  4DW6 A;  1W36 D;  1MSE C;  1MBJ A;  4CYC B;  4IHX A;  2VKE A;  3A1Y A;  1ODD A;  4M73 A;  5E3O A;  3NWS A;  4OAY A;  1S72 I;  2LH9 A;  2ZC2 A;  3AKZ A;  2EBI A;  2BXZ A;  5LEJ A;  3C2B A;  4BBS J;  1EH8 A;  2HU9 A;  2KHM A;  4YIR X;  2VQG A;  1ENH A;  1Z0X A;  5BNG A;  4EV0 A;  5FRN A;  4NHJ A;  3VDX A;  1CGP A;  2MAB A;  3FIS A;  3H35 A;  1MGT A;  4ZYA A;  4U0Y A;  1ZG5 A;  5H6Q A;  1PUF A;  1FYK A;  3BPX A;  1MND A;  4UUT A;  3KPH A;  4CIC A;  3PSF A;  5GAE J;  2QQA A;  2JPC A;  2CH0 A;  2R7Q A;  3M07 A;  2M0C A;  2OA4 A;  4EJU A;  1IN6 A;  1HSJ A;  1G2H A;  3D5R C;  4YII A;  3ZXS A;  3WTW C;  2CSO A;  3MVP A;  3FF5 A;  4H4K C;  3C3W A;  4M9S A;  3BR0 A;  4PJ0 C;  3QOD A;  4Q48 A;  4Y7N J;  1V5E A;  5FKM A;  4BY7 J;  1YIT I;  1MBG A;  1IJW C;  2W4S A;  2HYJ A;  2XSD C;  5LGT A;  2FNA A;  4M9X A;  2O61 A;  4HNT A;  1AA7 A;  3DU6 A;  2EA2 A;  1SFX A;  2ME0 A;  1VQM I;  3IRR A;  1I6H J;  1YW9 A;  4WX9 A;  2JRT A;  4TV7 A;  1YE9 A;  3ZN0 A;  2DLL A;  2DT5 A;  3CJN A;  3FBN B;  1YIJ I;  3K4K A;  3CF5 F;  5IYB J;  2X6X A;  3EUA A;  2RVC A;  3D0S A;  4RGX A;  4D0P A;  2L9R A;  3W2V A;  1LDJ A;  1A31 A;  4FET A;  3F6V A;  3HKZ A;  2HGC A;  3HOZ J;  2LF8 A;  2XB0 X;  2ZO4 A;  2NAZ A;  4FX0 A;  3ZMZ A;  1T39 A;  2RV8 A;  1Z6T A;  1A6I A;  2AQF A;  4IHV A;  1B59 A;  1OMI A;  4NB5 A;  1YRN B;  1K83 J;  1OIS A;  2CWE A;  4KIF A;  3RZD J;  5FB2 A;  2F4M B;  5F08 A;  1U9N A;  4A0Z A;  2Q0O A;  4UXN A;  2D2W A;  2KFD A;  3BWG A;  1SAN A;  1CF7 A;  5L3E A;  1MDM A;  1Y6I A;  1KYZ A;  2DQR A;  2E5N A;  1UAA A;  3FZV A;  1QHG A;  3PM1 A;  2BY0 A;  2HPI A;  4II2 A;  1IRF A;  5KCM A;  2FD5 A;  1Z91 A;  4A3E J;  3GO5 A;  2PFB A;  2DA6 A;  2G0E A;  4BQA A;  1U8B A;  2XAH A;  4XRS G;  4B1R A;  1H9G A;  1S7E A;  5D5W B;  4Y3O A;  2ZSI B;  4HW0 A;  3CMY A;  5LRS A;  4EJO A;  2H94 A;  1TLH B;  1PUE E;  2EFP A;  4IQJ A;  2BZT A;  3GTJ J;  3IRQ A;  3HKZ N;  2LYC A;  1B8I A;  3MMY B;  4PJJ A;  2K5C A;  2P5K A;  1LFU P;  1WCM J;  3HSE A;  3S2W A;  4DQ2 A;  1I6X A;  3DV8 A;  4QPQ A;  2K4B A;  3BJO A;  1SC7 A;  4G8X A;  4MFE A;  2EIJ H;  3FK7 A;  2FMY A;  1MBH A;  4N4N B;  1U3E M;  2KIS A;  2LSO A;  4UV9 A;  3AAF A;  4IHY A;  2EZL A;  5C44 J;  3CDI A;  2K9N A;  2HOT A;  1O7F A;  2IS6 A;  4D9J A;  2JWT A;  5D8K B;  1R1U A;  4H0E A;  4ESF A;  1V55 H;  3RQI A;  3HOT A;  2DMU A;  2K40 A;  3V8K A;  1ZRD A;  4YIF A;  3C7J A;  3CUQ C;  5KNL A;  5DYM A;  1OYI A;  3I53 A;  4XLN F;  2Q8K A;  1N75 A;  4O6J A;  4V2G A;  3OL3 A;  4CCL A;  1XN7 A;  3KP4 A;  3RJP A;  2L02 A;  2XKO A;  4B43 A;  4CXF A;  3VYS B;  3ZMU A;  1QPI A;  1BI0 A;  3DKW A;  4KN4 X;  3BCB A;  1ON2 A;  3ROU A;  2P6T A;  2FNP A;  2W85 A;  2JPB A;  3DKX A;  3K9T A;  2XV4 S;  4GFB A;  3HBL A;  1BN5 A;  4YFK F;  4AIH A;  4UUS A;  3OYN A;  2W00 A;  4BY1 J;  5E3M A;  1YTY A;  3RPQ A;  3G6E I;  2HDC A;  4I6Z A;  3ZQG A;  1HBX G;  3RZO J;  1FTT A;  1I27 A;  3HGY A;  4BAC A;  3B73 A;  4IKF A;  5EEG A;  5EDN A;  1MMN A;  1SAU A;  3CME I;  3GWZ A;  3H1C A;  2VON A;  2FQ4 A;  1UEL B;  4JK1 X;  1BW6 A;  5LBQ A;  2A68 F;  1UHW A;  3A03 A;  2OC6 A;  2L01 A;  1ZAR A;  2Z3Y A;  1VQL I;  3BTI A;  1BIA A;  2YPR A;  4E6K G;  4NQW B;  3PQK A;  5IYD J;  1GHC A;  4BJT A;  5D6F A;  2LF7 A;  1I50 J;  4XLE A;  2CUF A;  4RDU A;  4ESB A;  4Y17 A;  4DJA A;  2XPU A;  2VQL A;  3U9G A;  2VE8 A;  1Y1V J;  2M34 A;  3K4L A;  4W97 A;  1JE8 A;  1AKH A;  4QIW N;  3HEF A;  1R5I D;  3DTI A;  4YFN F;  2MH2 A;  1VQO I;  1WGX A;  5M5Y J;  1V5G A;  2MW8 A;  5H2F C;  2K86 A;  5L3D A;  3GFI A;  2Z33 A;  4EVI A;  5K7Z A;  3I4N J;  2HQN A;  5KVR A;  3ZRG A;  1FIA A;  2V6C A;  4HYE A;  4M71 A;  3BLY A;  1MIJ A;  5L3F A;  5D5X B;  2VJJ A;  4E4H A;  2P8T A;  3CQZ J;  3E5X A;  3V7R A;  3VWB A;  5D4S A;  4XOT A;  4EGY A;  2L0K A;  3LSP A;  1EV7 A;  3DPL C;  3PSI A;  3BJ6 A;  4S0H B;  3OOU A;  2HFH A;  2DJI A;  3K4M A;  2DTZ A;  3CCY A;  1FX7 A;  4L5J A;  1RKW A;  2EFO A;  2I8D A;  5LD2 C;  1ETX A;  2L54 A;  4CZC A;  4FE7 A;  3U2R A;  3ZN1 A;  1O3R A;  1GUU A;  3RIR A;  2IS1 A;  4GDF A;  4IEJ A;  1RZ4 A;  4KT6 A;  5K5R A;  1XMX A;  3BCA A;  5ED4 A;  2EZH A;  3GX4 X;  3QYB A;  4JX6 A;  2Z16 A;  3QPS A;  5E17 F;  1YLF A;  4I99 C;  3I55 I;  2UV1 A;  5FD6 A;  4BKX A;  1BI1 A;  2WA0 A;  1MDM B;  5E1W A;  3L2V A;  5IT9 Z;  4EAT A;  2HXO A;  1WQ2 A;  1O57 A;  3TBI A;  4A3I J;  1JTY A;  3DFG A;  2A6H F;  4O5V A;  2CQX A;  2TDX A;  4GO1 A;  2O8K A;  4ENM A;  3CO7 C;  2VJ5 A;  1HST A;  2HQR A;  3MKY B;  1TWF J;  1Z05 A;  2ELH A;  4A3G J;  5HDN A;  3RTR A;  3E6D A;  3CCS I;  1W7P B;  1B8I B;  3BG3 A;  2XRL A;  3WTT C;  2IS4 A;  2R7U A;  2IEK A;  3DU5 A;  3IL2 A;  1GXQ A;  1I1S A;  4HV5 A;  4UHT A;  2Y48 A;  4CCJ A;  1W7P D;  3FKJ A;  3H92 A;  4D5F A;  2KMU A;  2LK2 A;  4FQG A;  1G4D A;  5FGM A;  4WXC A;  3LSR A;  3KZY A;  5CQG A;  4D7N A;  2A6E F;  3IWZ A;  2DA1 A;  3H3U A;  4PFO A;  2LY1 A;  2BHZ A;  4DNC A;  4XNF A;  3GTM J;  1ETY A;  1IF1 A;  1RR7 A;  2EIN H;  2Y2Z A;  5ERI A;  3BR3 A;  2DMN A;  4A12 A;  1IN8 A;  2DOD A;  4C3H J;  4CCM A;  1ONV A;  1BI3 A;  2Y31 A;  2JMW A;  2OTJ I;  1HW1 A;  1LFB A;  4PK4 A;  2ZBK A;  1IDZ A;  3O8G A;  3KLO A;  3DTK A;  3LA3 A;  2OD5 A;  3DWL E;  4MNU A;  4K2E A;  1N78 A;  1Z7L A;  1X1A A;  2ESH A;  1P4A A;  4UUS B;  4AID A;  3RYR A;  3TOA A;  2HS5 A;  3CO6 C;  2YSR A;  1TTY A;  1JUS A;  5CVR A;  3O6B B;  2E7W A;  2ZJQ F;  3CCE I;  2KP6 A;  1RET A;  2RNG A;  4AVZ A;  3H0D A;  2X6Y A;  1LDD A;  3DLA A;  3MFK A;  1AHD P;  2PJR B;  1HKS A;  1T8I A;  1RRJ A;  5F0C A;  3H36 A;  4I98 B;  3BP8 A;  5HOD A;  3IC7 A;  3FDY A;  2PLY A;  4I02 A;  5L3G A;  5E1X A;  4HST A;  1ETW A;  2O03 A;  4LLN A;  3DBL B;  3WTV C;  4WK8 F;  4BGD A;  2IA0 A;  5H6R A;  4S04 A;  4L5I A;  1UHS A;  2MYS A;  3BJA A;  2XPW A;  3I4P A;  4IRG A;  4U0W A;  2O6G E;  3S15 J;  2LG4 A;  4A3B J;  2WAF A;  1ZH5 A;  1XSD A;  3ZQQ A;  3KEQ A;  1AKH B;  3KCC A;  5D5V B;  3KZZ A;  1IGN A;  5FFX A;  2BEO A;  2F48 A;  3VFZ A;  4BYY A;  4HZF A;  1AOY A;  3F8F A;  4BU2 A;  5E20 A;  3K4C A;  2W1O A;  5JHF A;  1E3H A;  5GP9 A;  3HC7 A;  4XKV A;  3TDZ C;  4EM0 B;  4O3M A;  3PO3 J;  4ZDP A;  1IV8 A;  5E18 F;  2MA3 A;  1FWZ A;  1T0F A;  2CQK A;  2R7F A;  2ZB9 A;  3DBR B;  3COA C;  4G7O F;  1MH4 A;  1OR7 A;  2HI3 A;  4BHB A;  4E7S A;  3I56 I;  1YW7 A;  1OPC A;  3MEX A;  5FLM J;  1U5T B;  2CW8 A;  4QPO A;  4UVA A;  2CG4 A;  3ABL H;  2JA6 J;  3AL0 C;  5DTD A;  4NBQ A;  1HF0 A;  3EUH A;  2M7B A;  3JRF A;  3FKI J;  2PMU A;  2XRO A;  5IT3 A;  1KGS A;  2E34 A;  3TO7 A;  1JKO C;  5FKK A;  4HX4 A;  2DN0 A;  1PYV A;  1ETO A;  2A05 A;  3IAM 2;  3B6C A;  4A3K J;  1KU7 A;  4C2U A;  2VBX A;  5HS9 A;  2LRD A;  3I3L A;  4HX8 A;  1XS9 A;  3C1D A;  3FXR A;  1J0R A;  2R4G A;  3J81 Z;  3NWT A;  3HOS A;  1HA8 A;  1RKT A;  5ICF A;  4J00 A;  1XC5 A;  3BQY A;  1F1Z A;  2EZK A;  1WJC A;  1MJB A;  3W6J B;  1QZZ A;  2KDZ A;  1USS A;  2XAJ A;  2OCE A;  3AFH A;  4NC6 A;  4JQF A;  4PGG A;  1YO5 C;  1TWH J;  2KJC A;  3L9F A;  5E79 C;  2L9S A;  5L3B A;  3TL4 X;  2I5U A;  2XUB A;  4IHT A;  4OOI A;  4EM1 A;  2K02 A;  1IN4 A;  2Z5U A;  3HYI A;  5AIQ A;  1Z9C A;  2CUJ A;  1DP7 P;  1JKQ C;  3R6S A;  4BE1 A;  3BG9 A;  4KFC A;  2L9N A;  2W7N A;  4AIK A;  3PNT A;  3LSK A;  3ABK H;  4GGG A;  3IWF A;  4E7H A;  1J7K A;  1STZ A;  3KP6 A;  5B66 C;  1P7J A;  2DFI A;  3CJR B;  3I71 A;  2EK5 A;  1TL8 A;  1MMA A;  4PJN A;  3TW7 A;  3HOW J;  2ICW G;  4RB1 A;  2KT0 A;  2V79 A;  3KYD B;  3TQN A;  1VQ9 I;  1FEX A;  3OL4 A;  3LSJ A;  3DEU A;  3KP5 A;  3PFI A;  1T33 A;  4V2F A;  5BMZ A;  2PN6 A;  3SDB A;  2ZNY A;  4BDZ A;  2V1N A;  3N97 A;  1D0Y A;  5J47 A;  1DP3 A;  2QLZ A;  4UB6 C;  5DCF A;  2R7O A;  1PJR A;  1YG2 A;  3CLQ A;  3NAR A;  1YHQ I;  1KYW A;  2IBD A;  3WTY C;  5GPC A;  3GTG J;  2GBY A;  1V5F A;  4UUV A;  2QSG X;  5IT9 K;  3GZN B;  3QPT A;  5GAG J;  3OR2 C;  4DZJ A;  1OLT A;  2R7Z J;  2OQR A;  2P4W A;  4HLX A; 
#chains in the Genus database with same CATH homology
 3DU6 A;  3H9Q A;  4ANJ A;  2L7K A;  2DCE A;  1DGR M;  3OYL A;  1YE9 A;  3CZ6 A;  3DKY A;  4PSX A;  3FBN B;  2GOM A;  4U87 A;  3H5R A;  2LRE A;  3K4K A;  2X6X A;  4XLF A;  3EUA A;  4N4O B;  4BEH B;  4ZC3 A;  3W2V A;  3H9J A;  2VLA A;  4FET A;  4D1Q A;  3HKZ A;  2VKH A;  4RMN A;  1X1D A;  2IGO A;  4HG2 A;  2LOO A;  4BDY A;  2IGM A;  4P1W A;  3UR3 C;  1NG7 A;  3BC8 A;  3ONQ A;  3C2H A;  3CF2 A;  3OYH A;  3VYT B;  2XC7 A;  1TZL A;  2AQF A;  2F4I A;  2LBF A;  2KRH A;  2Y0S A;  2MD0 A;  3MKW B;  3OYF A;  4CSW A;  4Y4R A;  3TMO A;  3HL2 A;  2HPM A;  3SEZ A;  2IGN A;  4NUB A;  1MMD A;  4RM3 A;  4XKB A;  4E7L A;  2X85 A;  1Z3X A;  4XLH A;  2WY7 Q;  1Y6I A;  2E5N A;  1UAA A;  3IUO A;  1QHG A;  2KQR A;  2HPI A;  1WJA A;  4IQ4 A;  4II2 A;  5KCM A;  4NC7 A;  3SEQ A;  4CA0 A;  4BE2 A;  2LBF B;  3HPG A;  3AL0 B;  1MNE A;  2QKL B;  4C9Y A;  4XON A;  3W2A A;  2CFO A;  2X1C A;  2ZSI B;  4Y3O A;  4YEJ A;  3FBI B;  3OYD A;  4IQJ A;  4AU7 A;  3PJR A;  3A2K A;  2LYC A;  3MMY B;  4AYB A;  4PJJ A;  4F52 A;  1GLN A;  2K5C A;  4CH7 A;  2DXI A;  2V26 A;  1P9Q C;  2BW3 A;  2WAQ A;  4QPQ A;  1G8X A;  1NG6 A;  3G2B A;  3N05 A;  5HNF A;  5HNH A;  4F55 A;  2V9K A;  4MLO A;  2CUZ A;  4N4N B;  3OS2 A;  4IZZ A;  3W2W A;  4X0G A;  4BJ6 C;  2QKM B;  2ZXH A;  2IS6 A;  2E1M B;  4D9J A;  1U0J A;  2VQC A;  2M0M A;  4RM2 A;  1QHH D;  3L2U A;  3HOT A;  3IAS 2;  2BW3 B;  5KNL A;  2VXD A;  2HNH A;  2WBM A;  1FMV A;  3E1S A;  2HQA A;  3S8P A;  4BQO A;  1N75 A;  3PFY A;  3OL3 A;  4CCL A;  4CCK A;  3QYE A;  3S32 A;  4B43 A;  2XDV A;  2V4J C;  3VYS B;  1X4O A;  2XSJ C;  3BCB A;  2JVH A;  3DKX A;  3OYE A;  2AQE A;  1BR4 A;  3OYN A;  3OYI A;  2W00 A;  2Z2S B;  4XOP A;  3K10 A;  2LY2 A;  1ZEL A;  2VB6 A;  4II3 A;  2PMZ A;  4BAC A;  4IKF A;  3SYT A;  1MMN A;  1SAU A;  4BL0 B;  2R7S A;  2VJ4 A;  2V6E A;  3OMY A;  1UEL B;  2WAD A;  3MKZ A;  3C2G A;  2OC6 A;  1ERD A;  3E0J B;  2K3P A;  4E7Z A;  1E0E A;  2L2O A;  3HG9 A;  3OIQ A;  4ZDL A;  4E6K G;  4NQW B;  3CP8 A;  5HOO A;  4XQF A;  2R7V A;  4XLC A;  3K6G A;  3H9G A;  3F9K A;  1WJB A;  3BG7 A;  3RCO A;  2GOX B;  4BJT A;  4B48 A;  3H5A A;  2KPM A;  4XLE A;  1X1C A;  3L2W A;  3I9V 2;  4XR6 A;  4DJA A;  2XF5 A;  2VQL A;  4NNJ A;  2HVQ A;  3K4L A;  4LIV A;  4Y33 A;  3LSM A;  1WJ5 A;  3DTI A;  4C2T A;  1V5G A;  3MD2 A;  4DIQ A;  4F93 B;  2XF7 A;  4G6T B;  3QOE A;  2NOJ B;  1Z21 A;  3LMM A;  3ZRG A;  3K4B A;  3HXL A;  3BLY A;  4IX7 A;  1SFK A;  2VJJ A;  2Z1D A;  2V7F A;  4E4H A;  2R7T A;  2O5R A;  3OYM A;  3VWB A;  4HEA 2;  1G59 A;  4RLF A;  4XOT A;  2CW7 A;  3DPL C;  3DPT A;  3PSI A;  3S3O A;  1LKX A;  3OOU A;  2DJI A;  3K4M A;  4DOZ A;  4BUP A;  1DQU A;  4PJL A;  1LFP A;  1X4P A;  2W82 A;  2OV7 A;  2I8D A;  3OR1 C;  3OS0 A;  5LD2 C;  4CZC A;  3VYU B;  1Y56 A;  4PSW A;  4OAZ A;  2IS1 A;  2M7A A;  2BOL A;  3IP4 B;  4KT6 A;  3L2R A;  3BCA A;  3QYB A;  2Z16 A;  2UV1 A;  2WA0 A;  2L5Q A;  3L2V A;  4EAT A;  1D0Z A;  2R7W A;  2JUG A;  2FUG 2;  4LIT A;  3TBI A;  2VPL A;  5FRM A;  1BOB A;  2CV1 A;  3OWT A;  4PJM A;  2HVR A;  4KIS A;  3DTE A;  5HLT A;  3LL7 A;  3K70 C;  2VJ5 A;  3MKY B;  2VAS A;  2K9M A;  3V42 A;  3KEY A;  2M4K A;  3KYL A;  2KL4 A;  3RTR A;  4BS9 A;  4YRV A;  3S3N A;  3CJQ B;  3A4C A;  1D1B A;  4DGW B;  1WJF A;  2IS4 A;  2IXS A;  2R7U A;  4ITV A;  1JI8 A;  3DU5 A;  1Z3Y A;  3J7A Y;  4KJZ A;  4CCJ A;  2DT6 A;  4HNU A;  3FKJ A;  5LFA A;  3OYJ A;  2KMU A;  4XM3 A;  3OY9 A;  1T95 A;  5HVQ C;  3LFU A;  2E60 A;  5CQG A;  1DGW Y;  3RSN A;  2A6T A;  3FHN A;  2M3A A;  2XAU A;  4BQQ A;  4PFO A;  2LY1 A;  1LVK A;  4XNF A;  2E5Z A;  2RRE A;  3U21 A;  4LG3 A;  2CV2 A;  1VZ0 A;  3EUK L;  3D5L A;  1D0X A;  3LSG A;  4KIT B;  3S3M A;  3H5N A;  2VQH A;  2X6W A;  2BVM A;  4CCM A;  2PJR A;  4E7I A;  2JVG A;  3DEE A;  3L2Q A;  4PK4 A;  2M4G A;  2WB1 A;  3DTK A;  3DQV C;  3DWL E;  4XN0 A;  4J01 A;  2JSP A;  1N78 A;  1Z7L A;  1X1A A;  2X1E A;  4HPQ A;  4FAS D;  3OS1 A;  1WJD A;  1UG0 A;  3PL8 A;  3SZG A;  4F91 B;  2F5V A;  2KP6 A;  2RNG A;  2HZD A;  4AVZ A;  4BQN A;  2X6Y A;  3H0D A;  3DLA A;  2PJR B;  1D1A A;  2MC4 A;  2UUZ A;  2VL8 A;  4F92 B;  1MMG A;  2KRC A;  3FDY A;  4BXF A;  1TT0 A;  4LIU A;  2ZSH B;  4HST A;  2P0W A;  2MFZ A;  4BGD A;  2RQQ A;  2KDO A;  2A5W A;  2MYS A;  1BR1 A;  2Q1Z B;  2LG4 A;  2IGK A;  2WAF A;  2LC2 A;  2Q2E B;  3ZQQ A;  4JOM A;  3K4J A;  3S93 A;  3OYG A;  3RPU D;  4HRI A;  2ZFU A;  3HUG B;  4C30 A;  4BU2 A;  3VYR B;  2F6C A;  2X1D A;  2X51 A;  2WY8 Q;  3K4C A;  4DBR A;  2KLO A;  2W1O A;  5JHF A;  4ZDO A;  2WAE A;  3KX2 A;  3HC7 A;  4XKV A;  1KON A;  2DOA A;  5CKT A;  4NC8 A;  4ZDP A;  3D5S C;  4PUS A;  4XLA A;  3DPU A;  3OYB A;  3W3C A;  1LDK B;  3OYC A;  2OUM A;  4CUG A;  4E7S A;  1N77 A;  2KZV A;  3K4N A;  4ZJZ A;  2CW8 A;  4QPO A;  4U7B A;  1YX3 A;  3ZR8 X;  1K6Y A;  3AL0 C;  4E7K A;  3CMM A;  1WJE A;  2CMP A;  3LSH A;  4B3X A;  4XKC A;  3ZGK A;  4CCO A;  1T0F C;  4B47 A;  2M7B A;  4YEL A;  4ZTJ A;  1OR7 C;  2VKD A;  4DBQ A;  3PNY A;  1FMW A;  4XMY A;  3OYA A;  1PYV A;  2ZXI A;  1R6R A;  1WFX A;  3IAM 2;  3VSL A;  3OIP A;  3EUH C;  4C2U A;  2LRD A;  2R7R A;  3QYF A;  3I3L A;  4BE0 A;  2IS2 A;  3M1C A;  3PNV A;  2R4G A;  4OWR B;  5CPR B;  3NWT A;  1W36 C;  4XL9 A;  4R79 A;  3HOS A;  1QU3 A;  1D1C A;  3K70 D;  1HA8 A;  1MW7 A;  3VSK A;  4J00 A;  2CV0 A;  3EPZ A;  3ZCO A;  1J09 A;  2E1M C;  1WJC A;  3LSI A;  2UWM A;  2DT7 B;  3CES A;  4P5O A;  1X1B A;  2K9L A;  3AFH A;  4HSR A;  5TGT A;  3RQ4 A;  1X19 A;  2VIX A;  2VXZ A;  4JQF A;  5FRO A;  4E7J A;  1W36 D;  3BG6 A;  1BR2 A;  4RLQ A;  5KHD A;  4PFP A;  2L9S A;  3A1Y A;  3TL4 X;  4BJ5 C;  5CQE A;  3NWS A;  4F3Q A;  4OAY A;  2LH9 A;  2HDW A;  3M8J A;  2CUJ A;  2XF6 A;  3AKZ A;  4BE1 A;  2L9N A;  2W7N A;  2HU9 A;  2KHM A;  2VQG A;  3PNT A;  5FRN A;  3LSK A;  3VDX A;  2MAB A;  4E7H A;  1IRX A;  2R7X A;  3H35 A;  4ZYA A;  4XOR A;  3CJR B;  4CCN A;  2JA2 A;  1MMA A;  4PJN A;  2BVL A;  2ELJ A;  3OL4 A;  3PUB A;  1MND A;  4GRI A;  4BDZ A;  3SDB A;  3PSF A;  2V1N A;  1D0Y A;  2R7Q A;  2CH0 A;  2CS3 A;  4ZTF A;  1DP3 A;  1YX5 A;  3HPH A;  4XKW A;  2R7O A;  1PJR A;  3GBG A;  4B44 A;  1EA3 A;  3D5R C;  3ZXS A;  4H4K C;  3UNG C;  1V5F A;  3QOD A;  2HVS A;  4BEH A;  3CP2 A;  1V5E A;  3OYK A;  2W4S A;  1S9H A;  2VJI A;  3OR2 C;  1OLT A;  4HNT A;  1AA7 A;  4XN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...