3MKYB

Structure of sopb(155-323)-18mer dna complex, i23 form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*TP*GP*GP*GP*AP*CP*CP*AP*TP*GP*GP*TP*CP*CP*CP*A
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 39
structure length 115
sequence length 115
chains with identical sequence P
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkyB00
3W3CA 3MKWB 3W2AA 3VWBA 1VZ0A 3MKZA 3MKYB
chains in the Genus database with same CATH superfamily
1BR2A 2O8KA 2ZKZA 4DYQA 3Q0UA 1R5GA 5B1AH 3E6CC 2R7UA 2XSJC 2XGXA 3K1NA 4A5MA 4AUXA 3MQ0A 5J4YA 3CC4I 1A04A 1ETYA 2KFDA 1ETQA 1WHUA 3OS1A 4NQWB 1NG6A 2YU3A 2IS4A 2EFNA 5K7HA 3E0JB 4LMYA 1OLTA 3U21A 2OAZA 4LLGF 1D0ZA 1MZBA 4P96A 3S32A 4PJJA 5BNGA 2HQ5A 3CJRB 1R1VA 4IHVA 1O3QA 4FQGA 2ZNZA 3GTLJ 4ZDPA 3HOUJ 5D5WB 5F0CA 1OYIA 3WTUC 5LGTA 4C3HJ 2VQHA 5FKLA 2WAQN 4ZZLA 3H9QA 2ZXIA 4A3JJ 1FOXA 1H88C 4HV6A 3PSFA 4O3MA 2MYSA 5CJ9A 1KA8A 3I4MJ 3WE3A 3J7ZI 4FX4A 3R0JA 2YUSA 4HPQA 1SFKA 1CQTA 2GM4A 2ZC2A 2V1XA 4D9JA 4AIHA 5JLXA 1TW3A 3BTLA 5JLWA 3EDPA 2A05A 3F6VA 4D5FA 1ZGAA 2JT1A 2HFHA 1K6YA 4RGUA 4UXNA 4KNYA 3F0CA 1B4AA 1JGGA 2DTRA 3N05A 1FZPB 4HBLA 3J7YJ 3BR5A 2WWYA 3GZ5A 2LSOA 1GXQA 4ON0A 2CQKA 2OZ6A 5EYRA 4E70A 3WG7H 4E7KA 4UVAA 5IT3A 4IHYA 4HX8A 3FXKA 2PJRA 1JGSA 1UAAA 3E6DA 1FNNA 3ZQFA 1FIPA 4LK0F 2V6EA 4CZCA 1YYVA 1XSDA 1O3TA 1EJ9A 3FDYA 2NOJB 1XMAA 2NVUB 2OQGA 2LRDA 3HOYJ 2LLKA 5J4VA 1SFOJ 2WAFA 2HQNA 2XPUA 1KU9A 3GLXA 1W1WE 4BEHA 1WZ2A 2VODA 3CDLA 4ENMA 3OYAA 1HDDC 3IH3A 3O8GA 3R0AA 4RAZA 2MG4A 4XLHA 3IRQA 5DYMA 2NNNA 1Z6TA 2F4OB 4F55A 4BE0A 1J9IA 3OIOA 3ML6A 1YJ9I 2L7MP 3DP7A 5D4RA 3VFZA 2PI0A 4D7NA 4II3A 4EMSA 4PJLA 1YTYA 5HLHA 1U5TC 1Z77A 5AONA 5EZHA 4M72A 2CW0F 3A01B 1D1BA 1YIJI 5E3MA 1K6OA 2EV6A 3SZTA 4IO9F 3CCJI 1I1GA 1AKHA 2QQBA 1L0OC 4LFUA 2ISYA 1RRJA 3IRRA 3BPXA 4UV8A 2QVOA 1B8IA 2Y0MA 2YX7A 1DGWY 4L18B 4XICA 2C6YA 2F5EA 3L00A 1UCRA 3TW6A 2FA5A 3ULQB 5D6FA 3BG3A 1ZR4A 1AA7A 3K69A 2XC7A 2R7ZJ 3LSKA 1JKRC 5GP9A 4KICA 3O6BB 3C1DA 3H5NA 3B02A 1LFUP 3ABMH 4ZYGA 5HOOA 5D5UB 2HYJA 1BR4A 1E3OC 5EG0B 4QIWN 3HOVJ 1IXSB 1FT9A 3NARA 2XRLA 4CCKA 3IAS2 2Y69H 2RREA 2NVYJ 1D0XA 2HOAA 1QQIA 1XGSA 4FISA 3LSPA 2V1NA 2P6TA 2QEXI 3FMRA 4JX4A 4HSRA 5DV5A 1Y0NA 1Y1VJ 2OQRA 4BHPA 2H8WA 1U9OA 3OL4A 5DCMB 3R61A 1SVMA 2K9LA 2PQ8A 3T1BA 3WTZA 3TOBA 1KQ9A 4LK1F 3CP8A 4IRGA 2YSRA 1LE8A 3LA7A 3CCUI 4QPQA 1JUPA 3H9JA 1YHQI 5ICEA 2R5ZB 1H9TA 4CYCB 4HQMA 4OMYA 3OOPA 4RB3C 3F21A 1UMQA 3SEZA 1FP1D 4A12A 3DPLC 2CG4A 4BAYA 5EGOA 1H8AC 2X4HA 4IRHA 1T39A 3S1MJ 3ZRGA 4BXFA 2XAQA 1J59A 5LHHA 2Y9YA 2ZB9A 3HGYA 4UUSA 4F7ZA 2L4MA 3DTKA 2D1VA 1P9QC 4CCOA 3ZQ7A 2Y0SA 4G8XA 4S05A 2CW8A 2GAUA 2X6XA 1P7IA 4XSZF 5FD6A 4KT5C 3FHNA 3FXRA 3VOEA 1XGMA 4XBFA 2R7WA 3EETA 1FMVA 2UUZA 4X1EA 3F8MA 1Z7UA 2AS5F 1UFMA 3I54A 4DQ2A 3HZJA 3K4JA 1YS6A 2XKOA 3JRBA 3OOUA 3SHFA 5J47A 2QQ8A 5LEJA 4B3AA 6PAXA 1EH8A 2R7XA 2RAEA 1ZQ3P 3DKYA 3GF2A 4I0BA 2NS8A 2XAFA 3LSJA 2UZKA 2L9RA 1MBFA 2VOPA 1UHWA 4BXUA 3OYBA 2ID6A 2ZBKA 3VYSB 4JX5A 2JVGA 2ZSHB 9ANTA 4Z6YA 3W2VA 3PM1A 4KISA 3HOTA 3CCEI 2XRNA 4Y3OA 5E3LA 3V42A 5HDGA 3M9AA 2XB0X 4NC8A 4BY1J 1MBGA 2CV0A 4RM2A 3HL2A 1D5VA 1USSA 3F8NA 1QRYA 3ZP5A 3ABLH 2OA4A 3C2HA 3HUGB 1HKQA 2Q0OA 1ON1A 3VYRB 4LLLA 2WC2A 3TBIA 4MEYF 3HB9A 4AVZA 4LB5A 3P7NA 5LGNA 4RDUA 3ZGKA 2EA2A 1HC8A 2HWVA 2CQ7A 4DIQA 1T95A 2E7WA 3GCMA 3F6OA 4B48A 5HLTA 3LQRA 3KX2A 4IQ4A 2IGOA 3S2HJ 5H6QA 1ORKA 4UVBA 1NK2P 3K0LA 4TV7A 3DCFA 2Y0SN 3I56I 4BH9A 3QWLA 3HSFA 4QPOA 1ETKA 4A3MJ 1MNMC 1SFXA 1PUFA 1QO0D 5D5VB 3MMYB 4YELA 2ME6A 1JJ6C 4M9XA 2W57A 4L9TA 2F48A 2VIXA 1N25A 3FKIJ 4OAZA 2VKHA 1GLNA 3PO3J 4N9IA 4EJTA 1SFEA 1WJEA 2MGQA 2MLGA 3L7WA 5CVJA 4WF2A 2KIMA 3CCYA 5M5WJ 3S1RJ 1LDJA 1MMGA 2QGUA 4KIGA 3D5LA 2WTEA 2A69F 3P5JA 3CCSI 3I58A 3FBIB 1ULYA 1YLFA 2XPWA 3KP7A 1JI8A 4BL0B 1Y56A 2B63J 4XL9A 1YRNA 2DMNA 5FLMJ 2W84A 3UNGC 3G71I 2LOOA 2EIKH 3HRMA 1Q1HA 1TZLA 1TWHJ 3KETA 2QA4I 1G6NA 2BY3A 2QBYB 4IOAF 2B9SA 4BGDA 4M3BA 5HODA 1X3ZB 3V7SA 3CF5F 2R7TA 3TEDA 2M3AA 1A31A 1ONVA 1SAUA 2H1KA 3TW7A 4KITB 1QHHD 1T33A 4XKBA 3FZVA 3HOSA 5BPIA 3C7JA 3OS2A 3LSRA 2KRCA 2VQGA 2DFEA 2LF8A 2VE9A 2BZTA 1QZZA 2ZXWH 2PLYA 5CVRA 1POGA 3DU6A 3HSRA 1O7FA 4KYWA 3AL0C 4ZTJA 3FX3A 1W7PA 2VC1A 2JA7J 3B6AA 3OL3A 3OYDA 3C18A 5FD5A 2O61A 1PUEE 3T5XA 3HHGA 1JE8A 3RSNA 1QPIA 4XLFA 4XOTA 2E2JJ 1IV8A 1SD5A 1VZ0A 2QZ8A 3L2CA 5B5EC 2ZMEB 3M8EA 3MVPA 4H0EA 2FBKA 3PQKA 4XKCA 2KL4A 3QQAA 2V1DA 2HKXA 3AAFA 3BTCA 5FRMA 2LK2A 2HGCA 3ZQQA 2W25A 3IUOA 3HOXJ 2R93J 2WV0A 3L2UA 2XV4S 1HXDA 1TBXA 4D5CA 2BVMA 2Z9OA 4BBSJ 4IXAA 1I1SA 2BW3A 5KNLA 1XMKA 2GIVA 3ZN1A 1IN4A 3A03A 3OR1C 2EZKA 2K9NA 1XN7A 3I59A 2IJLA 1TQIA 1ETWA 1TP4A 4I7HA 2VXDA 4ETSA 1MGTA 4PCQA 3AG2H 3FF5A 1R4NB 4C9YA 1HKSA 1R5ID 4CCJA 2DA2A 1KZHA 2ETHA 1FYLA 5L3EA 5DD4A 4Z2YA 5M5YJ 5EJCA 3RKYA 4XONA 3ERMA 1IRZA 1RI7A 4L9VA 1BOBA 1F36A 3FXJA 2CUJA 4RGXA 4EJOA 4A69C 4CCMA 1MMSA 2MC4A 3CTAA 3L1PA 2W48A 1X1CA 1T0FC 3DWLE 1B72B 3LL7A 1ZGWA 3QYFA 2CWEA 2BVLA 4G9YA 2MABA 3HC7A 1IRGA 2BE5F 3K7AJ 1FTTA 3V7RA 1BJZA 2EB7A 2DO7A 4HEA2 3RKQA 3FKJA 4OIPF 2L4AA 3BP8A 4A3CJ 2QKMB 3ASNH 5JVTA 2ME0A 3DLAA 5LRRA 3EUAA 5KHDA 4YG2F 4HYEA 4F91B 2DA7A 2M9HA 2IA2A 2I5UA 2X85A 1ZK8A 3W6KB 2CV2A 3BTIA 2K9QA 1MH3A 4JX6A 1S5LC 1WFXA 2DA4A 1DQUA 1OR7A 3OY9A 3OYLA 1Q1VA 4YIIA 2MC3A 5FKOA 4ZTFA 3JSOA 3MKZA 3LWFA 3EUHA 4IQJA 2KRFA 3GTGJ 2HOEA 1OR7C 2DQLA 5IPAA 5ICFA 2RV8A 3TP3A 3CUQB 2DJNA 2EINH 3RI4A 2QLZA 2IS6A 1JJ8C 1U8RA 2M0MA 2LBFA 1SD7A 4PFOA 2HU9A 2X51A 4MQVA 1T98A 4I01A 1X1BA 1KYZA 2PN6A 3W3CA 1MMAA 2ISZA 2E5ZA 2B7EA 2KZGA 4P5OA 1DPRA 3E5QA 2JWTA 2V6CA 2XVCA 3RCOA 2A5WA 1XS9A 2KHMA 2HKOA 5J3LA 3SJMA 4C3JJ 1IXCA 2RKHA 1EH7A 1LFPA 1V54H 1R58A 2OTLI 3Q0WA 2E19A 4BS9A 3KP6A 2QCOA 3VYTB 3H36A 1JHFA 3CMMA 5DCFA 3FXOA 2IGNA 1XC5A 2P81A 5BS6A 1HCRA 4A0XA 1LUJB 3F9KA 2LR8A 2MD5A 3EQLF 3Q9SA 2JA5J 1W5TA 3TP0A 3BZKA 2JN6A 1MMNA 4EM2A 2JSCA 1TNSA 4AC0A 4C2MJ 2GXBA 1RKWA 1TWFJ 2FOWA 4BJ5C 4IHXA 4EM0B 2OPTA 1Y1WJ 2WY8Q 3FK6A 1DU0A 1AOYA 1Z21A 2DI3A 2M30A 2JRTA 2YU9J 2HYFA 4FTHA 2IEKA 1R36A 2CS3A 2JPCA 2VC0A 4I76A 5CQEA 4CYDA 2OTJI 2L7ZA 2V1UA 3R6SA 2XF7A 3JAMK 1V5FA 4UB6C 2PG4A 3U9GA 1AU7A 2UXNA 2X9DA 3ZMDA 2LP0A 3U2RA 1FSHA 2FUG2 4HA8A 1D0YA 3CCVI 2VASA 3QAHA 4ABZA 4M3FA 3KE2A 2JZYA 3W6VA 3BROA 3BJOA 5JHFA 4MTDA 5F27A 4XLEA 1EA3A 3HXLA 3I64A 1BM9A 4CXFA 3GTJJ 1U2WA 4CICA 5A2QZ 2YR2A 2DTZA 3DBRB 2Z33A 3HG9A 4UUVA 1UHSA 3CD6I 4I98B 1QZYA 2L01A 3I71A 2TDXA 4IJAA 1J7KA 1ETXA 1QU3A 1ZN2A 3DQVC 2FF4A 4G94A 4XKWA 2LKXA 3IH2A 1K61A 3BTJA 1J2XA 1KYWA 1K78A 2ID3A 2F6CA 1KQ0A 2K02A 4HQEA 4JK1X 4UB8C 4E6KG 2D45A 3JTGA 3JREA 3QP6A 2M4GA 4FASD 3RIRA 1EF4A 5GPAA 1OQYA 2R3SA 2V79A 5HNHA 3IP4B 2GBYA 2UXXA 4I0AA 3FM3A 3PNVA 5DD8A 4F3QA 1RNLA 3VWBA 2VOOA 3B6CA 2DA6A 3NQOA 2LF7A 1FLIA 3ZXSA 1P4WA 4HDUA 3CJNA 4HF2A 3GLLA 2FBHA 4HNVA 2HXOA 2A6HF 2E71A 5IYCJ 5ERIA 1FIAA 2CU7A 5IOYA 1V3FA 2FBIA 1J75A 3DPUA 4XRSA 3LSMA 2E1MC 3RPUA 2R7FA 4C30A 4U0VA 4ZC3A 4P9UA 4OOIA 2DA1A 3OYHA 1E2XA 3G1OA 2VLAA 1IO2A 4XLNF 4G7HF 1IUYA 4QWQA 5J1UA 1ZTRA 4PFPA 1VI0A 3M4OJ 2CV1A 3S1NJ 1MBHA 4F52A 3SXYA 2NS0A 2WB1A 1IN8A 4LOCA 4V2GA 1LNWA 2A6TA 1WH7A 1IC8A 1QZEA 4MNUA 2J5OA 3D0SA 3KZIC 3P9CA 3J80K 1OCRH 4ZDLA 1AHDP 2ZJQF 2X48A 5HLIA 4OU0A 3L2WA 3DEEA 4EJUA 3A01A 5DS9A 3PNTA 3BT9A 1XB4A 5E79C 1ODDA 2L5QA 2CQNA 1X1AA 4R79A 1YS7A 1SD4A 1KONA 4XOPA 4BDZA 1R4MB 2RC4A 1JKOC 3HTUA 1LPQA 1J5YA 3I4PA 2E1MB 3KP5A 3HKZN 3G1LA 2FU4A 1WKMA 2HI3A 4GYGA 4PK4A 5CVUA 2HVRA 4M73A 2GA2A 1T8IA 2P4WA 4I6ZA 5FKMA 3K1MA 4XIDA 2LREA 3F8FA 2L9VA 2KISA 1SANA 5IP9J 5CVVA 2L9NA 4A3IJ 4YFNF 5F1RA 4IRIA 4HX4A 4B47A 3ZQHA 3S14J 1FSEA 1T6SA 5EEHA 1TT0A 1OPCA 3I3LA 4XN3A 3KCCA 4FX0A 1RC9A 5J1YA 2JSPA 3KFWX 4N4OB 5F0HA 5J40A 2ZJ2A 5LGUA 2M34A 4LB6B 2F5FA 1XDSA 2HTSA 2DYSH 3VSKA 1U5TA 2MA3A 5DCMA 1GV2A 2OUMA 4U7DA 4J19A 3V8LA 4IZZA 2IS1A 1VQ5I 2WB1N 2COBA 3K4NA 2ZJPF 3CJTB 2GXAA 2EZHA 2E36A 2F5VA 2QSHX 2LY1A 1X3UA 1K83J 4CYCA 1R1UA 1HLVA 1Z1DA 1TC3C 3EUKL 4H4KC 5HS7A 4AVPA 2XSDC 4B3XA 2DODA 3IL2A 2R92J 1BI0A 3KLNA 3BDDA 4LG0B 2VBWA 1NG7A 2F4MB 4NUBA 4HAMA 3CCLI 1MDMA 2DXIA 2QENA 3IWZA 3SEQA 1W36D 4XLAA 2NVQJ 1GV5A 3Q9VA 1T08B 1MMDA 2DMPA 2ICWG 1LVKA 4D7MA 4RB0A 3S93A 3ZQIA 5K7ZA 4ANJA 1O3RA 1YE9A 2VKDA 5HDKA 1IAWA 3GTKJ 4HG2A 3I4NJ 3UR3C 2WADA 4ASNA 1B1BA 1ETOA 1WPKA 1WRJA 1MBKA 2ZSIB 3PFIA 2PJRB 1WJDA 1N77A 2A07F 3WGHA 1FX7A 1KU2A 4O5VA 4OIRF 4NDLA 2DFFA 3TDZC 3BY6A 3S1QJ 1I27A 2FJ1A 3H0DA 1MNEA 5F64A 2D1HA 2CO5A 4FETA 5BPDA 4BE1A 2L54A 1BIAA 2EV5A 1M1EB 4WWCA 1XGNA 3BQZA 3SQNA 1BBYA 4ENNA 3FXQA 1F9NA 4N0BA 1SD6A 2OBPA 3LNQA 3KP4A 3LMMA 1R49A 1IN6A 3QU6A 5D6EA 4RBOA 5AIQA 1YW7A 4MLOA 3E3VA 3DXJF 1DGRM 4DW6A 2EPFA 2WAEA 4RAYA 3K6GA 2X6YA 5KAFC 1IGNA 5DTDA 2IPQX 2Q2EB 3ZMTA 4HNUA 2ZCWA 3F72A 3T8RA 2LVSA 2BBYA 4M9SA 3ELKA 5KAIC 1RKTA 4V19K 2ZFWA 4RB1A 1AKHB 2LY2A 4A2UA 4QTRA 1OCPA 5IY5H 2R5YB 2Y48A 2M7BA 3K4LA 1B8IB 3KYCB 2M8EA 3A0BC 3BG7A 4AM3A 1W4MA 5FLXK 4XNFA 1LJ9A 3E1SA 2HQAA 2DOAA 1VQ4I 1B9NA 1JXSA 3MZHA 3NEUA 2AQEA 2WA0A 2OD5A 3VSLA 4X6AJ 1RETA 3E5UA 2Y31A 1OCOH 4BDYA 1NH3A 3OYMA 5E20A 1P92A 3RZDJ 3ONQA 2PMZA 2L7FP 4S04A 3JRFA 3KP3A 4L5IA 4BHBA 1FY7A 1HQCA 4A3EJ 1GT0C 2STTA 1X19A 1RIOH 3MKYB 1N75A 1WWXA 1S7EA 2M87A 2AXTC 4U87A 5H20A 3V8JA 5K1YA 1ZREA 2ECCA 2RNJA 4AD9A 5IYDJ 4XK4A 1KU3A 5GAGJ 4XRSG 5L3BA 5DM7F 1C0WA 2PBIA 3H3ZA 1TT5B 3MAJA 3OWTA 3TO9A 2FNPA 1R1TA 5FFXA 5J8CA 1IRXA 2QBYA 1ITYA 4RLFA 2MH2A 2GLOA 1Y0UA 3H0GJ 1XX5A 2HQRA 4OMZA 2HTJA 2FXAA 2M2EA 3BC8A 3K4BA 1YOVB 1MIJA 1ZLJA 3AG1H 4W97A 3IC7A 5F04A 4DBRA 4GGGA 4CH7A 4RA2A 2I10A 3QPHA 1BW5A 1JT0A 3OYGA 3JCUC 1EKEA 4OWRB 2PEXA 3BCBA 3U1DA 4BU2A 5E3OA 2VN2A 2TCTA 1O3SA 2PJPA 1HSJA 3CQZJ 5TJJA 5HDNA 4BQOA 3F8BA 4A5NA 3HOWJ 2BY2A 1GVDA 3K70D 3PFYA 1B6AA 5DEQA 3KZZA 1P4AA 1YG2A 2L9SA 2EV0A 1R7JA 2A6EF 3QP5A 5CVIA 3W2WA 3DU5A 4P55A 1V5GA 2PMHA 1Y8RB 1JKPC 1JKQC 1UG2A 2HVQA 4M6YA 4M3EA 2FNAA 1BA5A 5FFZA 4DZJA 1I39A 2B0LA 2KLOA 3ABKH 3BQYA 4XN0A 4CA0A 4A3KJ 2YS9A 1VQ7I 4U7BA 5M3FJ 1SAXA 1IRFA 3ROUA 4EV0A 2NVTJ 2ZMEC 4WCGA 3DV8A 1IXRC 2PMZN 4B43A 4Y4RA 1LEBA 5E1ZB 4MQ9F 1OCTC 1STZA 1Z7LA 3H3UA 2RN7A 5EZGA 1U9NA 1G3SA 5TISC 2MSYA 1LVAA 2H6BA 2ACJA 2DOFA 5FROA 4CCNA 3RQ4A 2HYGD 3CDHA 2L02A 1YO5C 5E17F 3G6EI 4KN4X 3F23A 3ZR8X 2IA1A 5GADJ 1P7JA 1UB9A 2A3SA 2LC2A 3JSPA 2EH3A 4MTEA 1CF7A 4KMFA 2ZFUA 4XQFA 2O3FA 1BC7C 3BZ6A 4D1QA 1S6LA 4RAFA 1WJCA 1G8XA 3OYIA 1B72A 2HVSA 2XGEA 4A6EA 2RGVA 2E7XA 2FRHA 2KP6A 3K2AA 4YFXF 1WJBA 3BWGA 5CKTA 1K4TA 1MJAA 4E7IA 4BACA 3CDIA 2W4SA 2KRHA 2FMLA 2UV1A 1NHAA 2IVMA 2M8GX 4KN7X 1UG0A 3JRAA 1D5YA 3KLOA 3O3KA 2BOLA 4KT6A 2NOGA 2BYVE 2V9KA 2JJ7A 1G3TA 1PUFB 5IT9K 2WV1A 2IGKA 3PNYA 1DP7P 4B44A 5GTHC 2HR3A 4ESJA 2QQAA 1WCMJ 1VNDA 4BQAA 2CGPA 3GVAA 3WGIA 2ESNA 1CGPA 2QSGX 2BEOA 2HXIA 2VT3A 3HDDA 2E2HJ 3WGGA 2OZUA 4ZDOA 3KIOA 3WE2A 5DDGA 1WSUA 5GPCA 4DZPA 2M1BA 3CMEI 1ZYRF 4CO8A 5ICGA 1NTCA 4JP0A 3ZQGA 3SZPA 4RLQA 1VQPI 4OINF 4BHCA 1T0FA 2Y75A 3D5SC 5LFAA 2DYRH 3CUQC 1Y6IA 3QRFF 1Y39A 3PO2J 2XF5A 3RYRA 2KIUA 4A3BJ 1VQ8I 4GRIA 5JVGF 1W0UA 2HNHA 4Q5SF 5KVRA 2OV7A 4A3LJ 1I5ZA 3K1PA 4UHTA 4EJVA 4E7JA 2DCEA 1HW5A 1YQAA 2X0LA 5BMZA 1DDNA 3BLYA 5E1XA 4G12A 1VTNC 4IVNA 1RZ4A 4CUGA 1ZARA 1K7AA 3K4CA 3HIFA 2BY0A 2LNBA 2VBYA 3MCZA 3H1CA 1MKMA 4UUTA 3G3ZA 3W6JB 2Y9ZA 4M3GA 5AIPA 4DYCA 2EFWA 1BW6A 3N4MA 2LTPA 2MD0A 2Q1ZB 1W7PB 2QKLB 1SFUA 4IHTA 4EGZA 4UY8I 2ECBA 2GA1A 3G2BA 4L5JA 4MGRA 2G7HA 3GFMA 2VL8A 1F4KA 2O9LA 3LAPA 3J81K 2Z5UA 3HTSB 2FEZA 2DJIA 2HOSA 3BCAA 4KIBA 3GTMJ 2M4KA 2P5KA 4DJAA 5FKKA 3BPVA 4YRVA 3M8FA 2FOKA 3I53A 5JR3A 1B59A 1XCVA 3CLOA 1XDUA 5J1RA 5DUKA 1HBXG 5H6RA 2E1CA 2CYYA 4BUPA 1FC3A 4F92B 3GWZA 3ERED 3P9IA 3LAJA 4PJMA 1REPC 4ZZDA 1X1DA 1PDNC 1XCBA 1RUOA 2XASA 2BW3B 2WY7Q 1QHGA 2JPBA 1Z67A 4LIUA 4M6VA 2DA3A 2EA4A 4AIJA 5GTIC 1HSTA 2Z2SB 3I59B 2FSWA 2W24A 3IH4A 5D4SA 5LHGA 2JUGA 1W5CC 2KKOA 3HRSA 4Y15A 3CC2I 2DAOA 1RR8C 3DBLB 2RQPA 1LDDA 3JRDA 1TL8A 3HSEA 3DEWA 2P0WA 2QSFX 1I6HJ 3WG9A 3FM5A 5TGTA 1ZR2A 1ZELA 4KJZA 1YW9A 1W7PD 4JYKA 1GDTA 1FOWA 2W82A 3BZCA 1O7LA 1QNTA 2OU2A 3SFZA 3Q5FA 3FXUA 1Z05A 3S17J 4HW0A 4XRMA 3GFJA 3WTYC 4IKFA 4XR6A 3TKYA 4BKXA 3VEPA 3VODA 2IP2A 2MFZA 1DPUA 3J7AO 1NK3P 3FHZA 3FXMA 4BJTA 2R4GA 3N97A 2V4JC 4Q47A 1USTA 3A0HC 1HDPA 4WX9A 2CSOA 4XSXF 2F2EA 3SDGA 2JRMA 2UWMA 2AHQA 3OIPA 2XIGA 1ZLKA 3WHBA 3RPQA 4RB2C 2H6CA 2TRTA 1G4DA 1XG1A 4NQWA 3WTSC 2DFHA 3MWMA 3KEYA 4ESFA 4JOMA 3M1CA 2R7SA 5F1JA 3GUDA 1X1PA 3Q3SA 5LD2C 2COMA 3HHHA 1ETVA 3HBLA 4WXHA 2Q8KA 4A93J 4IL6C 3HRTA 1TW2A 4OAYA 5F0FA 1ERDA 2NAZA 3K9TA 4FCYA 1MNDA 3NWSA 3ISPA 1F43A 1MW7A 3LFKA 3R60A 2VQCA 2KPMA 3IKVA 4NNJA 2H8RA 5JFRA 2WAQA 1RESA 3ZOBA 2EFPA 2K3FA 1FEXA 1IV6A 3GTQJ 3L2VA 1ZRFA 5BQTA 3RZOJ 1XSXA 2HZTA 4EM1A 4FE7A 3TQNA 1IW7F 1PVEA 2PX9A 5DUIA 3A1YA 3PJRA 3A2KA 3JRCA 4Q4ZF 3V4GA 4DGWB 1LDKB 5ED4A 3FXLA 1R71A 2LKSA 2DK8A 3NWTA 3EYYA 4IPAA 1TWGJ 2EZLA 2G7UA 3OYJA 4Y17A 4I99C 3UKGA 1HF0A 3DBHB 3T8TA 4B8XA 4YIFA 1WQ2A 1F5TA 2BGCA 2MLKA 3SDBA 3RKWA 5H2FC 4E7ZA 2EQRA 4N9HA 2KDZA 1JTXA 3K4MA 4PZJA 1VQLI 5HLGA 2CH0A 5ILVA 4PUSA 1S8NA 2IS2A 1Y8QB 4U0WA 4U0YA 1JTYA 3I0TA 4GFBA 3FISA 2ZNYA 5FJ8J 2V7FA 1XTAA 5CLSA 3OS0A 1YI2I 3AFHA 2H94A 5DM6F 1BC8C 5FKNA 5L3DA 5J6XA 1GUUA 2GIZA 4L0YB 1D1CA 3KZYA 4HNTA 2IRFG 2DMUA 1J09A 2IT0A 4LG3A 2CFXA 4G6DA 2H27A 2FD5A 1ZG1A 2ADUA 2GZWA 3H9GA 3IWFA 3OYCA 1IF1A 1W36C 4UV9A 5JI6A 3AG4H 1U0JA 2JVHA 2YX4A 4ZYEA 2DT6A 1BI1A 4M3DA 2HPIA 2HDWA 3HYIA 2VE8A 4PDKA 1JHHA 3M7GA 2L7KA 2CUEA 3WODF 3GBGA 4ENJA 1K4SA 3PUBA 2DK5A 3CO7C 2JK3A 2Z1DA 4HLYA 3CJQB 1MSEC 4M9ZA 3W2AA 1FOKA 4G7ZF 4OIQF 1UZCA 4JQFA 2KJCA 1XMXA 2KQRA 2DU9A 3GZ6A 1LFBA 3DKWA 3LFUA 2K4JA 4GO1A 4IHWA 2VPLA 1J0RA 4A3DJ 1TQMA 2XAUA 2RNGA 1LB2A 1G59A 2OC6A 3L2RA 4BXXJ 5TRDA 4UNOA 5IYBJ 1Z0XA 2JMWA 2ELKA 4II2A 5CPRB 1T2KA 2QF7A 1OCCH 2K86A 2P6SA 4LG0A 1K78B 4HF1A 2E1OA 3HGGA 2IXSA 3A02A 4WXDA 2CUZA 3U1KA 2E60A 4J00A 1SMTA 2ZXHA 3ESWB 2QWWA 2EILH 2OF7A 4LD5A 3K10A 1O4XA 3GTOJ 2Z99A 1I6XA 4AIDA 1JUSA 2M7AA 2R0QC 3H3VK 5LEKA 1R5HA 3DEUA 3HM5A 3MEXA 3NRVA 4KIFA 4L9NA 4V2FA 5EG0A 1GHCA 1IDZA 4KUMA 1IG7A 1UJ8A 4B09A 4ZJZA 4FHTA 2O03A 1APLC 1SVLA 2DDAA 5FRNA 3JW4A 2O6GE 3ZMZA 2RVCA 2DT7B 3QYEA 1EH6A 3CCMI 2HZDA 3FMSA 4J01A 2E34A 4ENKA 1IN5A 5B1BH 1QA6A 3JAMZ 2VJ4A 2K5CA 2W7NA 4MFDA 1H0MA 5E8IA 1FP2A 2QYOA 3QPTA 4WXCA 3AG3H 4U88A 1R6RA 4E7HA 4L9JA 2VQLA 3DKXA 3WTVC 5IP7J 1OMIA 4R1HA 2DPUA 2VBZA 3IHUA 2HPMA 2R5ZA 3FIWA 2DPDA 3HPHA 3MN2A 2XAGA 1X58A 3MKLA 1WGXA 2JQ7A 1EV7A 4C3IJ 2XB5A 5D8LB 5L3CA 2K4BA 5C4JJ 2BY1A 1V4RA 4MEXF 4BQNA 4A6DA 1S29A 4NB5A 2I8DA 5CQGA 1MH4A 5F6FA 4DOZA 2AXLA 1G3YA 2K9MA 4IOCF 3M3YJ 1JUMA 1VQ6I 4MIMA 2Q2EA 3F8CA 2L0KA 4EQQA 3WTWC 4AYBA 1RPWA 2P7VB 4I09A 4Y7NJ 2LDUA 2X6OA 1VF9A 4NC7A 1U3EM 2FQ3A 2ZO4A 1XSVA 3C2BA 3DTEA 2R5YA 2L2OA 2AO9A 3ZCOA 5HVQC 3X2QH 2K40A 2CFOA 3S3OA 1BOAA 3L9FA 5FB2A 3RPUD 4DNCA 5D8KB 3LQQA 4BBRJ 1ZRDA 1H9GA 3ASOH 5IOZA 1AWCA 1Z3XA 2V9VA 1E17A 3S16J 1TNTA 3WHCA 3GFIA 1SEUA 3ZQLA 4CSWA 2M5WA 4KFCA 4O6JA 2BHZA 2Z3YA 2DMTA 4MO7A 3CUOA 5LHIA 1ZHFA 3E7LA 3OR2C 2P5LC 4CZZA 1YX3A 3GEZA 2STWA 1V55H 2PFBA 3P9KA 1FYKA 3GTPJ 1BIBA 5E8GA 1FJLA 3EYIA 4NHJA 2XAJA 1BI3A 4BEHB 1QPMA 1YIOA 3K70C 1QBJA 1E0EA 1QVUA 1YFHA 1U5TB 2H1LA 1D3YA 3Q0VA 2E2IJ 2VKEA 4B1RA 4HOBA 3J80Z 5B3SH 2JA8J 1BR1A 1DU6A 1W5SA 3HUGA 4KA4A 1Z3YA 2IBDA 3ZMVA 2LKPA 3JRHA 5GAHJ 2F4IA 1QGPA 2CQXA 4A0YA 3B73A 2K27A 4XLCA 5C3EJ 3VPRA 2LD5A 1Z6RA 4EEFG 2K85A 2W00A 4QLCU 3TOAA 1VQKI 1RUNA 1A6IA 1LQ1A 5ICCA 4NC6A 3ECHA 4AYBN 4AIKA 1OCZH 2DT5A 1OYWA 4CHUA 2GQQA 3OSGA 4B4CA 3JR9A 1O57A 4Y13A 1MDMB 1S7AA 2ZXJA 2O8XA 4M74A 3BOQA 2IGMA 2LH9A 2V9PA 2L3DA 1VQ9I 4RMNA 2A61A 4OIOF 3L2QA 1HA8A 4XKVA 1S72I 3SYTA 1HOMA 1S3JA 2OCCH 1ZAOA 3CZ6A 4L5EA 4M6XA 2XAHA 4A0ZA 3G4SI 2J5PA 2VB6A 2MBFA 2QQ9A 3V7CA 3KEOA 2DOEA 3AKZA 3CCRI 2GWRA 3DFGA 1X2NA 2X6WA 4L0ZB 1ZH5A 2XF6A 3D5RC 4ZYDA 5LBQA 4NBQA 3DPTA 2EWNA 2F5CA 2A68F 2YPRA 3CP2A 1V5EA 1MJBA 1TWCJ 2GXGA 3KPHA 3K2ZA 3TGNA 3I55I 1L3LA 2GOMA 4G6TB 5C44J 1TWAJ 1LE8B 2VJJA 1QVTA 4RGSA 2HDDA 2EIMH 2P5VA 3CMYA 3E97A 3D1NI 1S7OA 1HW1A 4GYIA 4BE2A 2VPRA 1R9TJ 1WH5A 1YITI 4PSXA 3FMQA 2M45A 4HX7A 3F22A 5EGOB 1FYMA 1BI2A 2FMYA 1IZ1A 1YW8A 2CQQA 1D8JA 3S2DJ 1UHMA 2AQFA 2V26A 4E4HA 3CF2A 4UUSB 3M07A 1G2HA 5ILSA 1H89C 2XUBA 4EJWA 2W85A 4XORA 5E1WA 5EDNA 4BNCA 4C2UA 5IP6A 4PJ0C 1KU7A 2A5YB 3WU2C 5FO5A 4FE4A 3ZN0A 1WI9A 4Y33A 2O7OA 1IJWC 2LY9A 3MKWB 3J7AY 1MBEA 3CC7I 3WTTC 1ZKGA 5K5QA 2CMPA 3GX4X 3C2GA 2KIFA 2ZMEA 2WBMA 4LIVA 3MD2A 4X0GA 3BG6A 4C2TA 1SC7A 1R00A 1MSFC 1Z9CA 3BR2A 5HS9A 2P7CB 3LSHA 1GXPA 2NXNB 4G6QA 4P9FA 4EGYA 2CJJA 2RDPA 4AU7A 4KDPA 3FBNB 2EFOA 3H5AA 1R23A 3GZNB 3H5RA 4I02A 2N8GA 4RM3A 4BY7J 3RJPA 3IKTA 4BJ6C 4D0PA 4GCVA 5K5OA 5EEGA 1OYYA 1XGOA 3A4CA 1FBQA 5KCMA 2HOTA 2ZJRF 3BJ6A 4EVIA 3KEQA 3KYLA 4IX7A 4N4NB 2KT0A 4F93B 2IW5A 3QOPA 1VQOI 3S2WA 3CMAI 2NS7A 4RAGA 2VKVA 2XDVA 4MFEA 3T0YA 1D1AA 2XROA 3HOZJ 3OIQA 4RS8A 2DW4A 4BQQA 1S9HA 1A6QA 4ZYAA 3TO7A 4CDGA 3WU0A 1K79A 2LMDA 4ITVA 3CESA 2JA2A 1I3QJ 1T56A 3K4KA 4KMUX 3KP2A 1LKXA 1TLHB 3RTRA 2O5RA 1RR7A 5FLVA 3VYUB 1I50J 2VXZA 3DF8A 2NNYA 2DMQA 2DFIA 1FMWA 3WU1B 3DTIA 2CW7A 3QOEA 5F08A 3QPLA 1U78A 1PP8F 2CUFA 2F5DA 2EBIA 2KDOA 2H09A 3H92A 5FLXZ 1ON2A 3REOA 3KYDB 3JRIA 1D8KA 3LSGA 1E3PA 3BR1A 3E6MA 2XGDA 4IEJA 3M1EA 2HS5A 2XKPA 3DLLF 5L3FA 2Z16A 2DN0A 4HF0A 2DQRA 3BG9A 2QUFA 3MZ8A 1MJ9A 1DUXC 1N78A 3CUQA 5EF6A 1MD0A 2EJRA 3ZQCA 2E35A 4R8HA 3OYFA 1YJWI 1A35A 4AWXB 1LEAA 2DA5A 4XM3A 2HDCA 2VJ5A 3O8HA 4S0HB 1YRNB 4CGZA 3TL4X 1R22A 3MFKA 1KQ8A 1MBJA 1G3WA 5FGMA 2KIQA 2FX0A 4BYYA 1P4XA 1IDYA 3V8KA 3BG5A 3IV5A 2O0YA 3GMEA 3PIOF 2MH9A 5GAEJ 2R7DA 3ECOA 3FK7A 4RGRA 3PIPF 2XGCA 1IUFA 5A2QK 1P6RA 2BXYA 3RDIA 1UELB 1ZG3A 2X1DA 3E6BA 2P8TA 3ABTA 5E18F 2G0EA 4P1WA 4ESBA 3AL0B 3OSFA 4HDVA 4LJZF 2VUMJ 3BR6A 4A3FJ 1YJNI 1IN7A 2RQQA 1CF7B 3S8PA 5LLQA 2DLLA 2VI6A 2BHYA 3RYPA 3BR3A 5J8FA 4PSWA 3QPSA 2VBXA 3JTHA 4ZYHA 4ZH4F 3ABUA 2NVXJ 4XMYA 2IA0A 2D2WA 3HEFA 1FWZA 5KK1A 5ILUA 3GFLA 2E5NA 1SVOA 1I3AA 3L09A 3TO6A 1WJ5A 3ZMUA 1FBUA 2JA6J 1P2FA 4PGHA 2KMUA 3PUFA 5CYVA 2QM3A 4E7LA 2G9WA 1HW2A 1KGSA 2W1OA 2XHKA 3BR0A 1T38A 1VQMI 5M5XJ 3G1MA 4FT8A 2M0CA 3OYEA 1DP3A 4XLPF 2FE3A 1GVJA 2ELHA 4UVCA 1FPQA 2ELJA 1OFCX 3CO6C 3LSIA 1X3WB 3QYBA 2MW8A 3GW2A 2LG4A 2FQ4A 1X4OA 4PGGA 1WI3A 5JHUA 2NRAC 4YEJA 5K7FA 1F1ZA 5HNFA 3HJEA 3G73A 4GDFA 5LRSA 3R4KA 2KZVA 1FBSA 1ZG5A 3SFIA 2NYXA 1ZGJA 4IHSA 3GYHX 3EUHC 2EZIA 4I2OA 1ZRCA 1Z91A 4HZFA 1E3HA 1WJFA 1U8BA 3JRGA 2KJBA 2E1NA 2EK5A 3RKXA 3GO5A 1VQNI 2GOXB 3F3XA 1FOYA 2EIJH 3COAC 2R7VA 4A3GJ 1OJLA 2OJED 1PJRA 4HV5A 4LITA 3QU3A 3RQIA 1JT6A 1XD7A 4QSHA 2ESHA 3PL8A 5D5XB 1WJAA 3PQJA 4W1UA 1HKTA 2BXZA 5BOXA 4G7OF 3S3NA 5C4XJ 1FTZA 4HLXA 2VONA 1BL0A 3E5XA 2DDBA 2XPVA 3HRUA 2IAIA 3LOCA 3PSIA 4EATA 3VDXA 4CCLA 5L3GA 3CCQI 3EPZA 1PP7U 5E3NA 1VFCA 3OYKA 3LA2A 2R7QA 3O2PE 3OV8A 2OCEA 2Y30A 5IT9Z 1X2MA 5K5RA 3S15J 2HEOA 1W0TA 2X1EA 3H35A 4YIRX 4Y52J 3IAM2 4DYRA 1SMYF 2X1CA 4MHGA 3C3WA 4LGWA 3TDUC 2BV6A 1X4PA 4JBAA 2R7OA 1OISA 1TQPA 3FWEA 3GXOA 1PYVA 1YX5A 2CRGA 1ACIA 2LBFB 3SZGA 3VB2A 3BJAA 2VT2A 2PMUA 1U6GA 3M8JA 2LFBA 5HS8A 4LLNA 1TTYA 2EFQA 4YFKF 1A5JA 4Q48A 3ZPLA 4HRIA 3S3MA 3LA3A 4E7SA 2R7RA 3HPGA 4PJNA 3WTXC 2VJIA 3MZYA 4IF4A 4DBQA 3TMOA 3CLQA 2D5VA 5B66C 3LSTA 1OKRA 1A36A 2LYCA 1XPXA 1B9MA 2K3PA 4K2EA 4WK8F 1ENHA 2JUCA 4GXOA 5M3MJ 1WVRA 2JTVA 3I9V2 2DBBA 4XRFA 3ZMSA 2K7LA 4HSTA 3OYNA 3I5UA 2Y2ZA 3HKZA 3OMYA 3QODA 4M71A 1BJAA 5EEAA 2K9SA 3J81Z 3NAUA 1BN5A
chains in the Genus database with same CATH topology
1BR2A 2X85A 2R7UA 2XSJC 1Z3XA 2CV2A 2HVQA 1WFXA 4CSWA 1DQUA 3OY9A 3OYLA 4ZTFA 3OS1A 4NQWB 3MKZA 1NG6A 2KLOA 4CA0A 4XN0A 2IS4A 3OR2C 4U7BA 3E0JB 1YX3A 1OLTA 3U21A 4IQJA 3S32A 1D0ZA 4PJJA 1OR7C 3CJRB 4BEHB 3K70C 4ZDPA 4Y4RA 4B43A 2IS6A 2M0MA 1Z7LA 2LBFA 4PFOA 2HU9A 1E0EA 2X51A 2VQHA 1X1BA 3H9QA 2ZXIA 3PSFA 3W3CA 5FROA 2MYSA 1MMAA 4CCNA 1BR1A 3RQ4A 2E5ZA 1Z3YA 4P5OA 2F4IA 3ZR8X 4HPQA 1SFKA 3RCOA 2A5WA 4XLCA 2KHMA 2LC2A 2W00A 2ZFUA 4XQFA 1LFPA 4D9JA 4BS9A 4D1QA 1WJCA 1G8XA 3OYIA 3VYTB 2HVSA 3CMMA 1K6YA 2IGNA 2KP6A 1WJBA 5CKTA 3N05A 3F9KA 4E7IA 4BACA 2IGMA 2LH9A 2W4SA 2KRHA 1MMNA 4RMNA 2UV1A 3S3OA 1UG0A 4E7KA 3L2QA 2BOLA 4KT6A 1HA8A 2V9KA 4XKVA 2PJRA 1UAAA 4BJ5C 3SYTA 2WY8Q 1Z21A 2IGKA 3PNYA 3CZ6A 2V6EA 4CZCA 2VB6A 4B44A 2CS3A 3AKZA 3FDYA 5CQEA 2X6WA 2NOJB 2XF7A 1V5FA 2LRDA 4ZDOA 2XF6A 3D5RC 2WAFA 3DPTA 2FUG2 3CP2A 1D0YA 1V5EA 2VASA 4BEHA 2GOMA 3OYAA 4RLQA 5JHFA 4G6TB 4XLHA 2VJJA 3D5SC 4XLEA 1EA3A 5LFAA 4F55A 3HXLA 1Y6IA 4BE0A 4BE2A 2XF5A 4PSXA 4II3A 4GRIA 3HG9A 4PJLA 2HNHA 2OV7A 1D1BA 4E7JA 2DCEA 1QU3A 3DQVC 4XKWA 3BLYA 2AQFA 2V26A 4CUGA 4E4HA 3CF2A 2F6CA 4XORA 4E6KG 4C2UA 3K4CA 4FASD 2M4GA 1DGWY 5HNHA 4Y33A 3IP4B 2MD0A 2Q1ZB 1AA7A 2QKLB 3MKWB 3J7AY 2XC7A 3PNVA 3G2BA 3LSKA 4F3QA 3VWBA 2VL8A 2CMPA 3ZXSA 3C2GA 3H5NA 2DJIA 2WBMA 4LIVA 5HOOA 3MD2A 3BCAA 4X0GA 3BG6A 4C2TA 1BR4A 2M4KA 4DJAA 4YRVA 3LSHA 3DPUA 4CCKA 3IAS2 3LSMA 2E1MC 4AU7A 2RREA 3FBNB 3H5AA 3H5RA 4RM3A 4C30A 1D0XA 4BUPA 4ZC3A 4BJ6C 2V1NA 4F92B 3OYHA 2VLAA 4HSRA 4PJMA 4PFPA 3A4CA 1X1DA 5KCMA 2CV1A 3OL4A 4F52A 2K9LA 2BW3B 2WB1A 2WY7Q 1QHGA 3KYLA 4IX7A 4N4NB 4LIUA 4F93B 3CP8A 2Z2SB 2A6TA 2JUGA 4QPQA 3H9JA 2XDVA 1D1AA 4ZDLA 2P0WA 3OIQA 4BQQA 1S9HA 3SEZA 5TGTA 3DPLC 3L2WA 1ZELA 4KJZA 4ZYAA 3DEEA 4ITVA 2W82A 3CESA 2JA2A 3K4KA 3PNTA 1LKXA 3ZRGA 4BXFA 2L5QA 3RTRA 4IKFA 1X1AA 4XR6A 4R79A 2O5RA 1KONA 3VYUB 4XOPA 2VXZA 4BDZA 3DTKA 2MFZA 1P9QC 4CCOA 1FMWA 3DTIA 2Y0SA 2CW7A 2E1MB 2CW8A 2R4GA 3QOEA 4BJTA 2V4JC 2X6XA 4PK4A 2KDOA 2HVRA 3FHNA 2UWMA 3OIPA 3LSGA 2R7WA 2LREA 1FMVA 2UUZA 3K4JA 2Z16A 2L9NA 3KEYA 3OOUA 4JOMA 4B47A 3M1CA 2R7SA 1N78A 5LD2C 1TT0A 2R7XA 4XN3A 3I3LA 1ERDA 4OAYA 3OYFA 2JSPA 4N4OB 3DKYA 4XM3A 1MNDA 2VJ5A 3NWSA 3TL4X 3OYBA 3VSKA 3VYSB 1MW7A 2JVGA 2ZSHB 3W2VA 2OUMA 2VQCA 4IZZA 4KISA 2IS1A 3HOTA 2KPMA 4NNJA 4Y3OA 3V42A 2WAQA 3K4NA 4NC8A 3L2VA 2CV0A 4RM2A 3HL2A 2F5VA 2LY1A 1UELB 2X1DA 3C2HA 3A1YA 3HUGB 3PJRA 3A2KA 4P1WA 3AL0B 3EUKL 4H4KC 3VYRB 4DGWB 3TBIA 1LDKB 4AVZA 4B3XA 3NWTA 3ZGKA 2RQQA 4DIQA 1T95A 3S8PA 3OYJA 1NG7A 4NUBA 4PSWA 4B48A 2DXIA 5HLTA 3SEQA 1W36D 4XLAA 3KX2A 3SDBA 4IQ4A 4XMYA 2IGOA 4E7ZA 1MMDA 3K4MA 1LVKA 2E5NA 3S93A 4ANJA 2CH0A 1YE9A 4QPOA 2VKDA 4PUSA 1WJ5A 2IS2A 4HG2A 3UR3C 2KMUA 2WADA 4E7LA 3MMYB 4YELA 2VIXA 2W1OA 2ZSIB 4OAZA 2V7FA 1WJDA 3OS0A 2VKHA 2PJRB 1GLNA 3AFHA 3OYEA 1DP3A 1N77A 1WJEA 2ELJA 1D1CA 4HNTA 1J09A 1MMGA 4LG3A 3LSIA 3D5LA 3QYBA 3H0DA 1MNEA 3H9GA 3FBIB 3OYCA 1W36C 2LG4A 4FETA 4BL0B 1Y56A 1X4OA 4XL9A 4BE1A 1U0JA 1JI8A 4YEJA 2JVHA 5HNFA 3UNGC 2DT6A 2LOOA 2KZVA 2HPIA 1TZLA 2HDWA 2L7KA 3GBGA 3EUHC 3PUBA 4BGDA 3LMMA 2Z1DA 2R7TA 3CJQB 1WJFA 2M3AA 3W2AA 1SAUA 4JQFA 2GOXB 4MLOA 2KQRA 1DGRM 4KITB 2R7VA 1QHHD 3LFUA 2WAEA 4XKBA 3HOSA 3K6GA 3OS2A 2X6YA 2KRCA 2VPLA 2VQGA 1PJRA 2Q2EB 2XAUA 2RNGA 4HNUA 4LITA 1G59A 2OC6A 3L2RA 3DU6A 3PL8A 1WJAA 4II2A 5CPRB 2LY2A 3AL0C 4ZTJA 2M7BA 2IXSA 3K4LA 3S3NA 2CUZA 3OL3A 2E60A 3OYDA 4J00A 2ZXHA 3BG7A 3K10A 3RSNA 4EATA 2M7AA 3PSIA 4XLFA 4XOTA 4XNFA 3VDXA 3E1SA 4CCLA 2HQAA 3EPZA 1VZ0A 2DOAA 3OYKA 2R7QA 4ZJZA 2AQEA 2WA0A 5FRNA 3VSLA 4XKCA 2X1EA 3H35A 2KL4A 2DT7B 3QYEA 4BDYA 3IAM2 2HZDA 5FRMA 2X1CA 3OYMA 3ZQQA 4J01A 3IUOA 3L2UA 3ONQA 2PMZA 2VJ4A 2K5CA 2W7NA 1X4PA 2BVMA 2R7OA 1PYVA 1YX5A 2BW3A 5KNLA 1R6RA 1X19A 4E7HA 3MKYB 1N75A 2VQLA 2LBFB 3DKXA 4U87A 3OR1C 3SZGA 2VXDA 2HPMA 3M8JA 3OWTA 3HPHA 4C9YA 1IRXA 4CCJA 4RLFA 4HRIA 3S3MA 4XONA 3BC8A 4E7SA 2R7RA 1BOBA 3HPGA 3K4BA 4PJNA 2CUJA 2VJIA 4BQNA 4DBQA 4DBRA 3TMOA 4CCMA 4CH7A 2I8DA 2MC4A 5CQGA 4DOZA 2K9MA 1X1CA 3OYGA 1T0FC 3DWLE 4OWRB 3LL7A 4AYBA 3BCBA 2LYCA 2BVLA 3QYFA 2MABA 3HC7A 2K3PA 4BU2A 4NC7A 4BQOA 3K70D 3I9V2 3PFYA 3DTEA 4HEA2 2L2OA 3FKJA 4HSTA 3ZCOA 5HVQC 3OYNA 2QKMB 2L9SA 2CFOA 3DLAA 3HKZA 3OMYA 3QODA 3EUAA 3W2WA 5KHDA 3DU5A 3RPUD 4F91B 1V5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W3C A;  3MKW B;  3W2A A;  3VWB A;  1VZ0 A;  3MKZ A;  3MKY B; 
#chains in the Genus database with same CATH topology
 1BR2 A;  2O8K A;  2ZKZ A;  4DYQ A;  3Q0U A;  1R5G A;  5B1A H;  3E6C C;  2R7U A;  2XSJ C;  2XGX A;  3K1N A;  4A5M A;  4AUX A;  3MQ0 A;  5J4Y A;  3CC4 I;  1A04 A;  1ETY A;  2KFD A;  1ETQ A;  1WHU A;  3OS1 A;  4NQW B;  1NG6 A;  2YU3 A;  2IS4 A;  2EFN A;  5K7H A;  3E0J B;  4LMY A;  1OLT A;  3U21 A;  2OAZ A;  4LLG F;  1D0Z A;  1MZB A;  4P96 A;  3S32 A;  4PJJ A;  5BNG A;  2HQ5 A;  3CJR B;  1R1V A;  4IHV A;  1O3Q A;  4FQG A;  2ZNZ A;  3GTL J;  4ZDP A;  3HOU J;  5D5W B;  5F0C A;  1OYI A;  3WTU C;  5LGT A;  4C3H J;  2VQH A;  5FKL A;  2WAQ N;  4ZZL A;  3H9Q A;  2ZXI A;  4A3J J;  1FOX A;  1H88 C;  4HV6 A;  3PSF A;  4O3M A;  2MYS A;  5CJ9 A;  1KA8 A;  3I4M J;  3WE3 A;  3J7Z I;  4FX4 A;  3R0J A;  2YUS A;  4HPQ A;  1SFK A;  1CQT A;  2GM4 A;  2ZC2 A;  2V1X A;  4D9J A;  4AIH A;  5JLX A;  1TW3 A;  3BTL A;  5JLW A;  3EDP A;  2A05 A;  3F6V A;  4D5F A;  1ZGA A;  2JT1 A;  2HFH A;  1K6Y A;  4RGU A;  4UXN A;  4KNY A;  3F0C A;  1B4A A;  1JGG A;  2DTR A;  3N05 A;  1FZP B;  4HBL A;  3J7Y J;  3BR5 A;  2WWY A;  3GZ5 A;  2LSO A;  1GXQ A;  4ON0 A;  2CQK A;  2OZ6 A;  5EYR A;  4E70 A;  3WG7 H;  4E7K A;  4UVA A;  5IT3 A;  4IHY A;  4HX8 A;  3FXK A;  2PJR A;  1JGS A;  1UAA A;  3E6D A;  1FNN A;  3ZQF A;  1FIP A;  4LK0 F;  2V6E A;  4CZC A;  1YYV A;  1XSD A;  1O3T A;  1EJ9 A;  3FDY A;  2NOJ B;  1XMA A;  2NVU B;  2OQG A;  2LRD A;  3HOY J;  2LLK A;  5J4V A;  1SFO J;  2WAF A;  2HQN A;  2XPU A;  1KU9 A;  3GLX A;  1W1W E;  4BEH A;  1WZ2 A;  2VOD A;  3CDL A;  4ENM A;  3OYA A;  1HDD C;  3IH3 A;  3O8G A;  3R0A A;  4RAZ A;  2MG4 A;  4XLH A;  3IRQ A;  5DYM A;  2NNN A;  1Z6T A;  2F4O B;  4F55 A;  4BE0 A;  1J9I A;  3OIO A;  3ML6 A;  1YJ9 I;  2L7M P;  3DP7 A;  5D4R A;  3VFZ A;  2PI0 A;  4D7N A;  4II3 A;  4EMS A;  4PJL A;  1YTY A;  5HLH A;  1U5T C;  1Z77 A;  5AON A;  5EZH A;  4M72 A;  2CW0 F;  3A01 B;  1D1B A;  1YIJ I;  5E3M A;  1K6O A;  2EV6 A;  3SZT A;  4IO9 F;  3CCJ I;  1I1G A;  1AKH A;  2QQB A;  1L0O C;  4LFU A;  2ISY A;  1RRJ A;  3IRR A;  3BPX A;  4UV8 A;  2QVO A;  1B8I A;  2Y0M A;  2YX7 A;  1DGW Y;  4L18 B;  4XIC A;  2C6Y A;  2F5E A;  3L00 A;  1UCR A;  3TW6 A;  2FA5 A;  3ULQ B;  5D6F A;  3BG3 A;  1ZR4 A;  1AA7 A;  3K69 A;  2XC7 A;  2R7Z J;  3LSK A;  1JKR C;  5GP9 A;  4KIC A;  3O6B B;  3C1D A;  3H5N A;  3B02 A;  1LFU P;  3ABM H;  4ZYG A;  5HOO A;  5D5U B;  2HYJ A;  1BR4 A;  1E3O C;  5EG0 B;  4QIW N;  3HOV J;  1IXS B;  1FT9 A;  3NAR A;  2XRL A;  4CCK A;  3IAS 2;  2Y69 H;  2RRE A;  2NVY J;  1D0X A;  2HOA A;  1QQI A;  1XGS A;  4FIS A;  3LSP A;  2V1N A;  2P6T A;  2QEX I;  3FMR A;  4JX4 A;  4HSR A;  5DV5 A;  1Y0N A;  1Y1V J;  2OQR A;  4BHP A;  2H8W A;  1U9O A;  3OL4 A;  5DCM B;  3R61 A;  1SVM A;  2K9L A;  2PQ8 A;  3T1B A;  3WTZ A;  3TOB A;  1KQ9 A;  4LK1 F;  3CP8 A;  4IRG A;  2YSR A;  1LE8 A;  3LA7 A;  3CCU I;  4QPQ A;  1JUP A;  3H9J A;  1YHQ I;  5ICE A;  2R5Z B;  1H9T A;  4CYC B;  4HQM A;  4OMY A;  3OOP A;  4RB3 C;  3F21 A;  1UMQ A;  3SEZ A;  1FP1 D;  4A12 A;  3DPL C;  2CG4 A;  4BAY A;  5EGO A;  1H8A C;  2X4H A;  4IRH A;  1T39 A;  3S1M J;  3ZRG A;  4BXF A;  2XAQ A;  1J59 A;  5LHH A;  2Y9Y A;  2ZB9 A;  3HGY A;  4UUS A;  4F7Z A;  2L4M A;  3DTK A;  2D1V A;  1P9Q C;  4CCO A;  3ZQ7 A;  2Y0S A;  4G8X A;  4S05 A;  2CW8 A;  2GAU A;  2X6X A;  1P7I A;  4XSZ F;  5FD6 A;  4KT5 C;  3FHN A;  3FXR A;  3VOE A;  1XGM A;  4XBF A;  2R7W A;  3EET A;  1FMV A;  2UUZ A;  4X1E A;  3F8M A;  1Z7U A;  2AS5 F;  1UFM A;  3I54 A;  4DQ2 A;  3HZJ A;  3K4J A;  1YS6 A;  2XKO A;  3JRB A;  3OOU A;  3SHF A;  5J47 A;  2QQ8 A;  5LEJ A;  4B3A A;  6PAX A;  1EH8 A;  2R7X A;  2RAE A;  1ZQ3 P;  3DKY A;  3GF2 A;  4I0B A;  2NS8 A;  2XAF A;  3LSJ A;  2UZK A;  2L9R A;  1MBF A;  2VOP A;  1UHW A;  4BXU A;  3OYB A;  2ID6 A;  2ZBK A;  3VYS B;  4JX5 A;  2JVG A;  2ZSH B;  9ANT A;  4Z6Y A;  3W2V A;  3PM1 A;  4KIS A;  3HOT A;  3CCE I;  2XRN A;  4Y3O A;  5E3L A;  3V42 A;  5HDG A;  3M9A A;  2XB0 X;  4NC8 A;  4BY1 J;  1MBG A;  2CV0 A;  4RM2 A;  3HL2 A;  1D5V A;  1USS A;  3F8N A;  1QRY A;  3ZP5 A;  3ABL H;  2OA4 A;  3C2H A;  3HUG B;  1HKQ A;  2Q0O A;  1ON1 A;  3VYR B;  4LLL A;  2WC2 A;  3TBI A;  4MEY F;  3HB9 A;  4AVZ A;  4LB5 A;  3P7N A;  5LGN A;  4RDU A;  3ZGK A;  2EA2 A;  1HC8 A;  2HWV A;  2CQ7 A;  4DIQ A;  1T95 A;  2E7W A;  3GCM A;  3F6O A;  4B48 A;  5HLT A;  3LQR A;  3KX2 A;  4IQ4 A;  2IGO A;  3S2H J;  5H6Q A;  1ORK A;  4UVB A;  1NK2 P;  3K0L A;  4TV7 A;  3DCF A;  2Y0S N;  3I56 I;  4BH9 A;  3QWL A;  3HSF A;  4QPO A;  1ETK A;  4A3M J;  1MNM C;  1SFX A;  1PUF A;  1QO0 D;  5D5V B;  3MMY B;  4YEL A;  2ME6 A;  1JJ6 C;  4M9X A;  2W57 A;  4L9T A;  2F48 A;  2VIX A;  1N25 A;  3FKI J;  4OAZ A;  2VKH A;  1GLN A;  3PO3 J;  4N9I A;  4EJT A;  1SFE A;  1WJE A;  2MGQ A;  2MLG A;  3L7W A;  5CVJ A;  4WF2 A;  2KIM A;  3CCY A;  5M5W J;  3S1R J;  1LDJ A;  1MMG A;  2QGU A;  4KIG A;  3D5L A;  2WTE A;  2A69 F;  3P5J A;  3CCS I;  3I58 A;  3FBI B;  1ULY A;  1YLF A;  2XPW A;  3KP7 A;  1JI8 A;  4BL0 B;  1Y56 A;  2B63 J;  4XL9 A;  1YRN A;  2DMN A;  5FLM J;  2W84 A;  3UNG C;  3G71 I;  2LOO A;  2EIK H;  3HRM A;  1Q1H A;  1TZL A;  1TWH J;  3KET A;  2QA4 I;  1G6N A;  2BY3 A;  2QBY B;  4IOA F;  2B9S A;  4BGD A;  4M3B A;  5HOD A;  1X3Z B;  3V7S A;  3CF5 F;  2R7T A;  3TED A;  2M3A A;  1A31 A;  1ONV A;  1SAU A;  2H1K A;  3TW7 A;  4KIT B;  1QHH D;  1T33 A;  4XKB A;  3FZV A;  3HOS A;  5BPI A;  3C7J A;  3OS2 A;  3LSR A;  2KRC A;  2VQG A;  2DFE A;  2LF8 A;  2VE9 A;  2BZT A;  1QZZ A;  2ZXW H;  2PLY A;  5CVR A;  1POG A;  3DU6 A;  3HSR A;  1O7F A;  4KYW A;  3AL0 C;  4ZTJ A;  3FX3 A;  1W7P A;  2VC1 A;  2JA7 J;  3B6A A;  3OL3 A;  3OYD A;  3C18 A;  5FD5 A;  2O61 A;  1PUE E;  3T5X A;  3HHG A;  1JE8 A;  3RSN A;  1QPI A;  4XLF A;  4XOT A;  2E2J J;  1IV8 A;  1SD5 A;  1VZ0 A;  2QZ8 A;  3L2C A;  5B5E C;  2ZME B;  3M8E A;  3MVP A;  4H0E A;  2FBK A;  3PQK A;  4XKC A;  2KL4 A;  3QQA A;  2V1D A;  2HKX A;  3AAF A;  3BTC A;  5FRM A;  2LK2 A;  2HGC A;  3ZQQ A;  2W25 A;  3IUO A;  3HOX J;  2R93 J;  2WV0 A;  3L2U A;  2XV4 S;  1HXD A;  1TBX A;  4D5C A;  2BVM A;  2Z9O A;  4BBS J;  4IXA A;  1I1S A;  2BW3 A;  5KNL A;  1XMK A;  2GIV A;  3ZN1 A;  1IN4 A;  3A03 A;  3OR1 C;  2EZK A;  2K9N A;  1XN7 A;  3I59 A;  2IJL A;  1TQI A;  1ETW A;  1TP4 A;  4I7H A;  2VXD A;  4ETS A;  1MGT A;  4PCQ A;  3AG2 H;  3FF5 A;  1R4N B;  4C9Y A;  1HKS A;  1R5I D;  4CCJ A;  2DA2 A;  1KZH A;  2ETH A;  1FYL A;  5L3E A;  5DD4 A;  4Z2Y A;  5M5Y J;  5EJC A;  3RKY A;  4XON A;  3ERM A;  1IRZ A;  1RI7 A;  4L9V A;  1BOB A;  1F36 A;  3FXJ A;  2CUJ A;  4RGX A;  4EJO A;  4A69 C;  4CCM A;  1MMS A;  2MC4 A;  3CTA A;  3L1P A;  2W48 A;  1X1C A;  1T0F C;  3DWL E;  1B72 B;  3LL7 A;  1ZGW A;  3QYF A;  2CWE A;  2BVL A;  4G9Y A;  2MAB A;  3HC7 A;  1IRG A;  2BE5 F;  3K7A J;  1FTT A;  3V7R A;  1BJZ A;  2EB7 A;  2DO7 A;  4HEA 2;  3RKQ A;  3FKJ A;  4OIP F;  2L4A A;  3BP8 A;  4A3C J;  2QKM B;  3ASN H;  5JVT A;  2ME0 A;  3DLA A;  5LRR A;  3EUA A;  5KHD A;  4YG2 F;  4HYE A;  4F91 B;  2DA7 A;  2M9H A;  2IA2 A;  2I5U A;  2X85 A;  1ZK8 A;  3W6K B;  2CV2 A;  3BTI A;  2K9Q A;  1MH3 A;  4JX6 A;  1S5L C;  1WFX A;  2DA4 A;  1DQU A;  1OR7 A;  3OY9 A;  3OYL A;  1Q1V A;  4YII A;  2MC3 A;  5FKO A;  4ZTF A;  3JSO A;  3MKZ A;  3LWF A;  3EUH A;  4IQJ A;  2KRF A;  3GTG J;  2HOE A;  1OR7 C;  2DQL A;  5IPA A;  5ICF A;  2RV8 A;  3TP3 A;  3CUQ B;  2DJN A;  2EIN H;  3RI4 A;  2QLZ A;  2IS6 A;  1JJ8 C;  1U8R A;  2M0M A;  2LBF A;  1SD7 A;  4PFO A;  2HU9 A;  2X51 A;  4MQV A;  1T98 A;  4I01 A;  1X1B A;  1KYZ A;  2PN6 A;  3W3C A;  1MMA A;  2ISZ A;  2E5Z A;  2B7E A;  2KZG A;  4P5O A;  1DPR A;  3E5Q A;  2JWT A;  2V6C A;  2XVC A;  3RCO A;  2A5W A;  1XS9 A;  2KHM A;  2HKO A;  5J3L A;  3SJM A;  4C3J J;  1IXC A;  2RKH A;  1EH7 A;  1LFP A;  1V54 H;  1R58 A;  2OTL I;  3Q0W A;  2E19 A;  4BS9 A;  3KP6 A;  2QCO A;  3VYT B;  3H36 A;  1JHF A;  3CMM A;  5DCF A;  3FXO A;  2IGN A;  1XC5 A;  2P81 A;  5BS6 A;  1HCR A;  4A0X A;  1LUJ B;  3F9K A;  2LR8 A;  2MD5 A;  3EQL F;  3Q9S A;  2JA5 J;  1W5T A;  3TP0 A;  3BZK A;  2JN6 A;  1MMN A;  4EM2 A;  2JSC A;  1TNS A;  4AC0 A;  4C2M J;  2GXB A;  1RKW A;  1TWF J;  2FOW A;  4BJ5 C;  4IHX A;  4EM0 B;  2OPT A;  1Y1W J;  2WY8 Q;  3FK6 A;  1DU0 A;  1AOY A;  1Z21 A;  2DI3 A;  2M30 A;  2JRT A;  2YU9 J;  2HYF A;  4FTH A;  2IEK A;  1R36 A;  2CS3 A;  2JPC A;  2VC0 A;  4I76 A;  5CQE A;  4CYD A;  2OTJ I;  2L7Z A;  2V1U A;  3R6S A;  2XF7 A;  3JAM K;  1V5F A;  4UB6 C;  2PG4 A;  3U9G A;  1AU7 A;  2UXN A;  2X9D A;  3ZMD A;  2LP0 A;  3U2R A;  1FSH A;  2FUG 2;  4HA8 A;  1D0Y A;  3CCV I;  2VAS A;  3QAH A;  4ABZ A;  4M3F A;  3KE2 A;  2JZY A;  3W6V A;  3BRO A;  3BJO A;  5JHF A;  4MTD A;  5F27 A;  4XLE A;  1EA3 A;  3HXL A;  3I64 A;  1BM9 A;  4CXF A;  3GTJ J;  1U2W A;  4CIC A;  5A2Q Z;  2YR2 A;  2DTZ A;  3DBR B;  2Z33 A;  3HG9 A;  4UUV A;  1UHS A;  3CD6 I;  4I98 B;  1QZY A;  2L01 A;  3I71 A;  2TDX A;  4IJA A;  1J7K A;  1ETX A;  1QU3 A;  1ZN2 A;  3DQV C;  2FF4 A;  4G94 A;  4XKW A;  2LKX A;  3IH2 A;  1K61 A;  3BTJ A;  1J2X A;  1KYW A;  1K78 A;  2ID3 A;  2F6C A;  1KQ0 A;  2K02 A;  4HQE A;  4JK1 X;  4UB8 C;  4E6K G;  2D45 A;  3JTG A;  3JRE A;  3QP6 A;  2M4G A;  4FAS D;  3RIR A;  1EF4 A;  5GPA A;  1OQY A;  2R3S A;  2V79 A;  5HNH A;  3IP4 B;  2GBY A;  2UXX A;  4I0A A;  3FM3 A;  3PNV A;  5DD8 A;  4F3Q A;  1RNL A;  3VWB A;  2VOO A;  3B6C A;  2DA6 A;  3NQO A;  2LF7 A;  1FLI A;  3ZXS A;  1P4W A;  4HDU A;  3CJN A;  4HF2 A;  3GLL A;  2FBH A;  4HNV A;  2HXO A;  2A6H F;  2E71 A;  5IYC J;  5ERI A;  1FIA A;  2CU7 A;  5IOY A;  1V3F A;  2FBI A;  1J75 A;  3DPU A;  4XRS A;  3LSM A;  2E1M C;  3RPU A;  2R7F A;  4C30 A;  4U0V A;  4ZC3 A;  4P9U A;  4OOI A;  2DA1 A;  3OYH A;  1E2X A;  3G1O A;  2VLA A;  1IO2 A;  4XLN F;  4G7H F;  1IUY A;  4QWQ A;  5J1U A;  1ZTR A;  4PFP A;  1VI0 A;  3M4O J;  2CV1 A;  3S1N J;  1MBH A;  4F52 A;  3SXY A;  2NS0 A;  2WB1 A;  1IN8 A;  4LOC A;  4V2G A;  1LNW A;  2A6T A;  1WH7 A;  1IC8 A;  1QZE A;  4MNU A;  2J5O A;  3D0S A;  3KZI C;  3P9C A;  3J80 K;  1OCR H;  4ZDL A;  1AHD P;  2ZJQ F;  2X48 A;  5HLI A;  4OU0 A;  3L2W A;  3DEE A;  4EJU A;  3A01 A;  5DS9 A;  3PNT A;  3BT9 A;  1XB4 A;  5E79 C;  1ODD A;  2L5Q A;  2CQN A;  1X1A A;  4R79 A;  1YS7 A;  1SD4 A;  1KON A;  4XOP A;  4BDZ A;  1R4M B;  2RC4 A;  1JKO C;  3HTU A;  1LPQ A;  1J5Y A;  3I4P A;  2E1M B;  3KP5 A;  3HKZ N;  3G1L A;  2FU4 A;  1WKM A;  2HI3 A;  4GYG A;  4PK4 A;  5CVU A;  2HVR A;  4M73 A;  2GA2 A;  1T8I A;  2P4W A;  4I6Z A;  5FKM A;  3K1M A;  4XID A;  2LRE A;  3F8F A;  2L9V A;  2KIS A;  1SAN A;  5IP9 J;  5CVV A;  2L9N A;  4A3I J;  4YFN F;  5F1R A;  4IRI A;  4HX4 A;  4B47 A;  3ZQH A;  3S14 J;  1FSE A;  1T6S A;  5EEH A;  1TT0 A;  1OPC A;  3I3L A;  4XN3 A;  3KCC A;  4FX0 A;  1RC9 A;  5J1Y A;  2JSP A;  3KFW X;  4N4O B;  5F0H A;  5J40 A;  2ZJ2 A;  5LGU A;  2M34 A;  4LB6 B;  2F5F A;  1XDS A;  2HTS A;  2DYS H;  3VSK A;  1U5T A;  2MA3 A;  5DCM A;  1GV2 A;  2OUM A;  4U7D A;  4J19 A;  3V8L A;  4IZZ A;  2IS1 A;  1VQ5 I;  2WB1 N;  2COB A;  3K4N A;  2ZJP F;  3CJT B;  2GXA A;  2EZH A;  2E36 A;  2F5V A;  2QSH X;  2LY1 A;  1X3U A;  1K83 J;  4CYC A;  1R1U A;  1HLV A;  1Z1D A;  1TC3 C;  3EUK L;  4H4K C;  5HS7 A;  4AVP A;  2XSD C;  4B3X A;  2DOD A;  3IL2 A;  2R92 J;  1BI0 A;  3KLN A;  3BDD A;  4LG0 B;  2VBW A;  1NG7 A;  2F4M B;  4NUB A;  4HAM A;  3CCL I;  1MDM A;  2DXI A;  2QEN A;  3IWZ A;  3SEQ A;  1W36 D;  4XLA A;  2NVQ J;  1GV5 A;  3Q9V A;  1T08 B;  1MMD A;  2DMP A;  2ICW G;  1LVK A;  4D7M A;  4RB0 A;  3S93 A;  3ZQI A;  5K7Z A;  4ANJ A;  1O3R A;  1YE9 A;  2VKD A;  5HDK A;  1IAW A;  3GTK J;  4HG2 A;  3I4N J;  3UR3 C;  2WAD A;  4ASN A;  1B1B A;  1ETO A;  1WPK A;  1WRJ A;  1MBK A;  2ZSI B;  3PFI A;  2PJR B;  1WJD A;  1N77 A;  2A07 F;  3WGH A;  1FX7 A;  1KU2 A;  4O5V A;  4OIR F;  4NDL A;  2DFF A;  3TDZ C;  3BY6 A;  3S1Q J;  1I27 A;  2FJ1 A;  3H0D A;  1MNE A;  5F64 A;  2D1H A;  2CO5 A;  4FET A;  5BPD A;  4BE1 A;  2L54 A;  1BIA A;  2EV5 A;  1M1E B;  4WWC A;  1XGN A;  3BQZ A;  3SQN A;  1BBY A;  4ENN A;  3FXQ A;  1F9N A;  4N0B A;  1SD6 A;  2OBP A;  3LNQ A;  3KP4 A;  3LMM A;  1R49 A;  1IN6 A;  3QU6 A;  5D6E A;  4RBO A;  5AIQ A;  1YW7 A;  4MLO A;  3E3V A;  3DXJ F;  1DGR M;  4DW6 A;  2EPF A;  2WAE A;  4RAY A;  3K6G A;  2X6Y A;  5KAF C;  1IGN A;  5DTD A;  2IPQ X;  2Q2E B;  3ZMT A;  4HNU A;  2ZCW A;  3F72 A;  3T8R A;  2LVS A;  2BBY A;  4M9S A;  3ELK A;  5KAI C;  1RKT A;  4V19 K;  2ZFW A;  4RB1 A;  1AKH B;  2LY2 A;  4A2U A;  4QTR A;  1OCP A;  5IY5 H;  2R5Y B;  2Y48 A;  2M7B A;  3K4L A;  1B8I B;  3KYC B;  2M8E A;  3A0B C;  3BG7 A;  4AM3 A;  1W4M A;  5FLX K;  4XNF A;  1LJ9 A;  3E1S A;  2HQA A;  2DOA A;  1VQ4 I;  1B9N A;  1JXS A;  3MZH A;  3NEU A;  2AQE A;  2WA0 A;  2OD5 A;  3VSL A;  4X6A J;  1RET A;  3E5U A;  2Y31 A;  1OCO H;  4BDY A;  1NH3 A;  3OYM A;  5E20 A;  1P92 A;  3RZD J;  3ONQ A;  2PMZ A;  2L7F P;  4S04 A;  3JRF A;  3KP3 A;  4L5I A;  4BHB A;  1FY7 A;  1HQC A;  4A3E J;  1GT0 C;  2STT A;  1X19 A;  1RIO H;  3MKY B;  1N75 A;  1WWX A;  1S7E A;  2M87 A;  2AXT C;  4U87 A;  5H20 A;  3V8J A;  5K1Y A;  1ZRE A;  2ECC A;  2RNJ A;  4AD9 A;  5IYD J;  4XK4 A;  1KU3 A;  5GAG J;  4XRS G;  5L3B A;  5DM7 F;  1C0W A;  2PBI A;  3H3Z A;  1TT5 B;  3MAJ A;  3OWT A;  3TO9 A;  2FNP A;  1R1T A;  5FFX A;  5J8C A;  1IRX A;  2QBY A;  1ITY A;  4RLF A;  2MH2 A;  2GLO A;  1Y0U A;  3H0G J;  1XX5 A;  2HQR A;  4OMZ A;  2HTJ A;  2FXA A;  2M2E A;  3BC8 A;  3K4B A;  1YOV B;  1MIJ A;  1ZLJ A;  3AG1 H;  4W97 A;  3IC7 A;  5F04 A;  4DBR A;  4GGG A;  4CH7 A;  4RA2 A;  2I10 A;  3QPH A;  1BW5 A;  1JT0 A;  3OYG A;  3JCU C;  1EKE A;  4OWR B;  2PEX A;  3BCB A;  3U1D A;  4BU2 A;  5E3O A;  2VN2 A;  2TCT A;  1O3S A;  2PJP A;  1HSJ A;  3CQZ J;  5TJJ A;  5HDN A;  4BQO A;  3F8B A;  4A5N A;  3HOW J;  2BY2 A;  1GVD A;  3K70 D;  3PFY A;  1B6A A;  5DEQ A;  3KZZ A;  1P4A A;  1YG2 A;  2L9S A;  2EV0 A;  1R7J A;  2A6E F;  3QP5 A;  5CVI A;  3W2W A;  3DU5 A;  4P55 A;  1V5G A;  2PMH A;  1Y8R B;  1JKP C;  1JKQ C;  1UG2 A;  2HVQ A;  4M6Y A;  4M3E A;  2FNA A;  1BA5 A;  5FFZ A;  4DZJ A;  1I39 A;  2B0L A;  2KLO A;  3ABK H;  3BQY A;  4XN0 A;  4CA0 A;  4A3K J;  2YS9 A;  1VQ7 I;  4U7B A;  5M3F J;  1SAX A;  1IRF A;  3ROU A;  4EV0 A;  2NVT J;  2ZME C;  4WCG A;  3DV8 A;  1IXR C;  2PMZ N;  4B43 A;  4Y4R A;  1LEB A;  5E1Z B;  4MQ9 F;  1OCT C;  1STZ A;  1Z7L A;  3H3U A;  2RN7 A;  5EZG A;  1U9N A;  1G3S A;  5TIS C;  2MSY A;  1LVA A;  2H6B A;  2ACJ A;  2DOF A;  5FRO A;  4CCN A;  3RQ4 A;  2HYG D;  3CDH A;  2L02 A;  1YO5 C;  5E17 F;  3G6E I;  4KN4 X;  3F23 A;  3ZR8 X;  2IA1 A;  5GAD J;  1P7J A;  1UB9 A;  2A3S A;  2LC2 A;  3JSP A;  2EH3 A;  4MTE A;  1CF7 A;  4KMF A;  2ZFU A;  4XQF A;  2O3F A;  1BC7 C;  3BZ6 A;  4D1Q A;  1S6L A;  4RAF A;  1WJC A;  1G8X A;  3OYI A;  1B72 A;  2HVS A;  2XGE A;  4A6E A;  2RGV A;  2E7X A;  2FRH A;  2KP6 A;  3K2A A;  4YFX F;  1WJB A;  3BWG A;  5CKT A;  1K4T A;  1MJA A;  4E7I A;  4BAC A;  3CDI A;  2W4S A;  2KRH A;  2FML A;  2UV1 A;  1NHA A;  2IVM A;  2M8G X;  4KN7 X;  1UG0 A;  3JRA A;  1D5Y A;  3KLO A;  3O3K A;  2BOL A;  4KT6 A;  2NOG A;  2BYV E;  2V9K A;  2JJ7 A;  1G3T A;  1PUF B;  5IT9 K;  2WV1 A;  2IGK A;  3PNY A;  1DP7 P;  4B44 A;  5GTH C;  2HR3 A;  4ESJ A;  2QQA A;  1WCM J;  1VND A;  4BQA A;  2CGP A;  3GVA A;  3WGI A;  2ESN A;  1CGP A;  2QSG X;  2BEO A;  2HXI A;  2VT3 A;  3HDD A;  2E2H J;  3WGG A;  2OZU A;  4ZDO A;  3KIO A;  3WE2 A;  5DDG A;  1WSU A;  5GPC A;  4DZP A;  2M1B A;  3CME I;  1ZYR F;  4CO8 A;  5ICG A;  1NTC A;  4JP0 A;  3ZQG A;  3SZP A;  4RLQ A;  1VQP I;  4OIN F;  4BHC A;  1T0F A;  2Y75 A;  3D5S C;  5LFA A;  2DYR H;  3CUQ C;  1Y6I A;  3QRF F;  1Y39 A;  3PO2 J;  2XF5 A;  3RYR A;  2KIU A;  4A3B J;  1VQ8 I;  4GRI A;  5JVG F;  1W0U A;  2HNH A;  4Q5S F;  5KVR A;  2OV7 A;  4A3L J;  1I5Z A;  3K1P A;  4UHT A;  4EJV A;  4E7J A;  2DCE A;  1HW5 A;  1YQA A;  2X0L A;  5BMZ A;  1DDN A;  3BLY A;  5E1X A;  4G12 A;  1VTN C;  4IVN A;  1RZ4 A;  4CUG A;  1ZAR A;  1K7A A;  3K4C A;  3HIF A;  2BY0 A;  2LNB A;  2VBY A;  3MCZ A;  3H1C A;  1MKM A;  4UUT A;  3G3Z A;  3W6J B;  2Y9Z A;  4M3G A;  5AIP A;  4DYC A;  2EFW A;  1BW6 A;  3N4M A;  2LTP A;  2MD0 A;  2Q1Z B;  1W7P B;  2QKL B;  1SFU A;  4IHT A;  4EGZ A;  4UY8 I;  2ECB A;  2GA1 A;  3G2B A;  4L5J A;  4MGR A;  2G7H A;  3GFM A;  2VL8 A;  1F4K A;  2O9L A;  3LAP A;  3J81 K;  2Z5U A;  3HTS B;  2FEZ A;  2DJI A;  2HOS A;  3BCA A;  4KIB A;  3GTM J;  2M4K A;  2P5K A;  4DJA A;  5FKK A;  3BPV A;  4YRV A;  3M8F A;  2FOK A;  3I53 A;  5JR3 A;  1B59 A;  1XCV A;  3CLO A;  1XDU A;  5J1R A;  5DUK A;  1HBX G;  5H6R A;  2E1C A;  2CYY A;  4BUP A;  1FC3 A;  4F92 B;  3GWZ A;  3ERE D;  3P9I A;  3LAJ A;  4PJM A;  1REP C;  4ZZD A;  1X1D A;  1PDN C;  1XCB A;  1RUO A;  2XAS A;  2BW3 B;  2WY7 Q;  1QHG A;  2JPB A;  1Z67 A;  4LIU A;  4M6V A;  2DA3 A;  2EA4 A;  4AIJ A;  5GTI C;  1HST A;  2Z2S B;  3I59 B;  2FSW A;  2W24 A;  3IH4 A;  5D4S A;  5LHG A;  2JUG A;  1W5C C;  2KKO A;  3HRS A;  4Y15 A;  3CC2 I;  2DAO A;  1RR8 C;  3DBL B;  2RQP A;  1LDD A;  3JRD A;  1TL8 A;  3HSE A;  3DEW A;  2P0W A;  2QSF X;  1I6H J;  3WG9 A;  3FM5 A;  5TGT A;  1ZR2 A;  1ZEL A;  4KJZ A;  1YW9 A;  1W7P D;  4JYK A;  1GDT A;  1FOW A;  2W82 A;  3BZC A;  1O7L A;  1QNT A;  2OU2 A;  3SFZ A;  3Q5F A;  3FXU A;  1Z05 A;  3S17 J;  4HW0 A;  4XRM A;  3GFJ A;  3WTY C;  4IKF A;  4XR6 A;  3TKY A;  4BKX A;  3VEP A;  3VOD A;  2IP2 A;  2MFZ A;  1DPU A;  3J7A O;  1NK3 P;  3FHZ A;  3FXM A;  4BJT A;  2R4G A;  3N97 A;  2V4J C;  4Q47 A;  1UST A;  3A0H C;  1HDP A;  4WX9 A;  2CSO A;  4XSX F;  2F2E A;  3SDG A;  2JRM A;  2UWM A;  2AHQ A;  3OIP A;  2XIG A;  1ZLK A;  3WHB A;  3RPQ A;  4RB2 C;  2H6C A;  2TRT A;  1G4D A;  1XG1 A;  4NQW A;  3WTS C;  2DFH A;  3MWM A;  3KEY A;  4ESF A;  4JOM A;  3M1C A;  2R7S A;  5F1J A;  3GUD A;  1X1P A;  3Q3S A;  5LD2 C;  2COM A;  3HHH A;  1ETV A;  3HBL A;  4WXH A;  2Q8K A;  4A93 J;  4IL6 C;  3HRT A;  1TW2 A;  4OAY A;  5F0F A;  1ERD A;  2NAZ A;  3K9T A;  4FCY A;  1MND A;  3NWS A;  3ISP A;  1F43 A;  1MW7 A;  3LFK A;  3R60 A;  2VQC A;  2KPM A;  3IKV A;  4NNJ A;  2H8R A;  5JFR A;  2WAQ A;  1RES A;  3ZOB A;  2EFP A;  2K3F A;  1FEX A;  1IV6 A;  3GTQ J;  3L2V A;  1ZRF A;  5BQT A;  3RZO J;  1XSX A;  2HZT A;  4EM1 A;  4FE7 A;  3TQN A;  1IW7 F;  1PVE A;  2PX9 A;  5DUI A;  3A1Y A;  3PJR A;  3A2K A;  3JRC A;  4Q4Z F;  3V4G A;  4DGW B;  1LDK B;  5ED4 A;  3FXL A;  1R71 A;  2LKS A;  2DK8 A;  3NWT A;  3EYY A;  4IPA A;  1TWG J;  2EZL A;  2G7U A;  3OYJ A;  4Y17 A;  4I99 C;  3UKG A;  1HF0 A;  3DBH B;  3T8T A;  4B8X A;  4YIF A;  1WQ2 A;  1F5T A;  2BGC A;  2MLK A;  3SDB A;  3RKW A;  5H2F C;  4E7Z A;  2EQR A;  4N9H A;  2KDZ A;  1JTX A;  3K4M A;  4PZJ A;  1VQL I;  5HLG A;  2CH0 A;  5ILV A;  4PUS A;  1S8N A;  2IS2 A;  1Y8Q B;  4U0W A;  4U0Y A;  1JTY A;  3I0T A;  4GFB A;  3FIS A;  2ZNY A;  5FJ8 J;  2V7F A;  1XTA A;  5CLS A;  3OS0 A;  1YI2 I;  3AFH A;  2H94 A;  5DM6 F;  1BC8 C;  5FKN A;  5L3D A;  5J6X A;  1GUU A;  2GIZ A;  4L0Y B;  1D1C A;  3KZY A;  4HNT A;  2IRF G;  2DMU A;  1J09 A;  2IT0 A;  4LG3 A;  2CFX A;  4G6D A;  2H27 A;  2FD5 A;  1ZG1 A;  2ADU A;  2GZW A;  3H9G A;  3IWF A;  3OYC A;  1IF1 A;  1W36 C;  4UV9 A;  5JI6 A;  3AG4 H;  1U0J A;  2JVH A;  2YX4 A;  4ZYE A;  2DT6 A;  1BI1 A;  4M3D A;  2HPI A;  2HDW A;  3HYI A;  2VE8 A;  4PDK A;  1JHH A;  3M7G A;  2L7K A;  2CUE A;  3WOD F;  3GBG A;  4ENJ A;  1K4S A;  3PUB A;  2DK5 A;  3CO7 C;  2JK3 A;  2Z1D A;  4HLY A;  3CJQ B;  1MSE C;  4M9Z A;  3W2A A;  1FOK A;  4G7Z F;  4OIQ F;  1UZC A;  4JQF A;  2KJC A;  1XMX A;  2KQR A;  2DU9 A;  3GZ6 A;  1LFB A;  3DKW A;  3LFU A;  2K4J A;  4GO1 A;  4IHW A;  2VPL A;  1J0R A;  4A3D J;  1TQM A;  2XAU A;  2RNG A;  1LB2 A;  1G59 A;  2OC6 A;  3L2R A;  4BXX J;  5TRD A;  4UNO A;  5IYB J;  1Z0X A;  2JMW A;  2ELK A;  4II2 A;  5CPR B;  1T2K A;  2QF7 A;  1OCC H;  2K86 A;  2P6S A;  4LG0 A;  1K78 B;  4HF1 A;  2E1O A;  3HGG A;  2IXS A;  3A02 A;  4WXD A;  2CUZ A;  3U1K A;  2E60 A;  4J00 A;  1SMT A;  2ZXH A;  3ESW B;  2QWW A;  2EIL H;  2OF7 A;  4LD5 A;  3K10 A;  1O4X A;  3GTO J;  2Z99 A;  1I6X A;  4AID A;  1JUS A;  2M7A A;  2R0Q C;  3H3V K;  5LEK A;  1R5H A;  3DEU A;  3HM5 A;  3MEX A;  3NRV A;  4KIF A;  4L9N A;  4V2F A;  5EG0 A;  1GHC A;  1IDZ A;  4KUM A;  1IG7 A;  1UJ8 A;  4B09 A;  4ZJZ A;  4FHT A;  2O03 A;  1APL C;  1SVL A;  2DDA A;  5FRN A;  3JW4 A;  2O6G E;  3ZMZ A;  2RVC A;  2DT7 B;  3QYE A;  1EH6 A;  3CCM I;  2HZD A;  3FMS A;  4J01 A;  2E34 A;  4ENK A;  1IN5 A;  5B1B H;  1QA6 A;  3JAM Z;  2VJ4 A;  2K5C A;  2W7N A;  4MFD A;  1H0M A;  5E8I A;  1FP2 A;  2QYO A;  3QPT A;  4WXC A;  3AG3 H;  4U88 A;  1R6R A;  4E7H A;  4L9J A;  2VQL A;  3DKX A;  3WTV C;  5IP7 J;  1OMI A;  4R1H A;  2DPU A;  2VBZ A;  3IHU A;  2HPM A;  2R5Z A;  3FIW A;  2DPD A;  3HPH A;  3MN2 A;  2XAG A;  1X58 A;  3MKL A;  1WGX A;  2JQ7 A;  1EV7 A;  4C3I J;  2XB5 A;  5D8L B;  5L3C A;  2K4B A;  5C4J J;  2BY1 A;  1V4R A;  4MEX F;  4BQN A;  4A6D A;  1S29 A;  4NB5 A;  2I8D A;  5CQG A;  1MH4 A;  5F6F A;  4DOZ A;  2AXL A;  1G3Y A;  2K9M A;  4IOC F;  3M3Y J;  1JUM A;  1VQ6 I;  4MIM A;  2Q2E A;  3F8C A;  2L0K A;  4EQQ A;  3WTW C;  4AYB A;  1RPW A;  2P7V B;  4I09 A;  4Y7N J;  2LDU A;  2X6O A;  1VF9 A;  4NC7 A;  1U3E M;  2FQ3 A;  2ZO4 A;  1XSV A;  3C2B A;  3DTE A;  2R5Y A;  2L2O A;  2AO9 A;  3ZCO A;  5HVQ C;  3X2Q H;  2K40 A;  2CFO A;  3S3O A;  1BOA A;  3L9F A;  5FB2 A;  3RPU D;  4DNC A;  5D8K B;  3LQQ A;  4BBR J;  1ZRD A;  1H9G A;  3ASO H;  5IOZ A;  1AWC A;  1Z3X A;  2V9V A;  1E17 A;  3S16 J;  1TNT A;  3WHC A;  3GFI A;  1SEU A;  3ZQL A;  4CSW A;  2M5W A;  4KFC A;  4O6J A;  2BHZ A;  2Z3Y A;  2DMT A;  4MO7 A;  3CUO A;  5LHI A;  1ZHF A;  3E7L A;  3OR2 C;  2P5L C;  4CZZ A;  1YX3 A;  3GEZ A;  2STW A;  1V55 H;  2PFB A;  3P9K A;  1FYK A;  3GTP J;  1BIB A;  5E8G A;  1FJL A;  3EYI A;  4NHJ A;  2XAJ A;  1BI3 A;  4BEH B;  1QPM A;  1YIO A;  3K70 C;  1QBJ A;  1E0E A;  1QVU A;  1YFH A;  1U5T B;  2H1L A;  1D3Y A;  3Q0V A;  2E2I J;  2VKE A;  4B1R A;  4HOB A;  3J80 Z;  5B3S H;  2JA8 J;  1BR1 A;  1DU6 A;  1W5S A;  3HUG A;  4KA4 A;  1Z3Y A;  2IBD A;  3ZMV A;  2LKP A;  3JRH A;  5GAH J;  2F4I A;  1QGP A;  2CQX A;  4A0Y A;  3B73 A;  2K27 A;  4XLC A;  5C3E J;  3VPR A;  2LD5 A;  1Z6R A;  4EEF G;  2K85 A;  2W00 A;  4QLC U;  3TOA A;  1VQK I;  1RUN A;  1A6I A;  1LQ1 A;  5ICC A;  4NC6 A;  3ECH A;  4AYB N;  4AIK A;  1OCZ H;  2DT5 A;  1OYW A;  4CHU A;  2GQQ A;  3OSG A;  4B4C A;  3JR9 A;  1O57 A;  4Y13 A;  1MDM B;  1S7A A;  2ZXJ A;  2O8X A;  4M74 A;  3BOQ A;  2IGM A;  2LH9 A;  2V9P A;  2L3D A;  1VQ9 I;  4RMN A;  2A61 A;  4OIO F;  3L2Q A;  1HA8 A;  4XKV A;  1S72 I;  3SYT A;  1HOM A;  1S3J A;  2OCC H;  1ZAO A;  3CZ6 A;  4L5E A;  4M6X A;  2XAH A;  4A0Z A;  3G4S I;  2J5P A;  2VB6 A;  2MBF A;  2QQ9 A;  3V7C A;  3KEO A;  2DOE A;  3AKZ A;  3CCR I;  2GWR A;  3DFG A;  1X2N A;  2X6W A;  4L0Z B;  1ZH5 A;  2XF6 A;  3D5R C;  4ZYD A;  5LBQ A;  4NBQ A;  3DPT A;  2EWN A;  2F5C A;  2A68 F;  2YPR A;  3CP2 A;  1V5E A;  1MJB A;  1TWC J;  2GXG A;  3KPH A;  3K2Z A;  3TGN A;  3I55 I;  1L3L A;  2GOM A;  4G6T B;  5C44 J;  1TWA J;  1LE8 B;  2VJJ A;  1QVT A;  4RGS A;  2HDD A;  2EIM H;  2P5V A;  3CMY A;  3E97 A;  3D1N I;  1S7O A;  1HW1 A;  4GYI A;  4BE2 A;  2VPR A;  1R9T J;  1WH5 A;  1YIT I;  4PSX A;  3FMQ A;  2M45 A;  4HX7 A;  3F22 A;  5EGO B;  1FYM A;  1BI2 A;  2FMY A;  1IZ1 A;  1YW8 A;  2CQQ A;  1D8J A;  3S2D J;  1UHM A;  2AQF A;  2V26 A;  4E4H A;  3CF2 A;  4UUS B;  3M07 A;  1G2H A;  5ILS A;  1H89 C;  2XUB A;  4EJW A;  2W85 A;  4XOR A;  5E1W A;  5EDN A;  4BNC A;  4C2U A;  5IP6 A;  4PJ0 C;  1KU7 A;  2A5Y B;  3WU2 C;  5FO5 A;  4FE4 A;  3ZN0 A;  1WI9 A;  4Y33 A;  2O7O A;  1IJW C;  2LY9 A;  3MKW B;  3J7A Y;  1MBE A;  3CC7 I;  3WTT C;  1ZKG A;  5K5Q A;  2CMP A;  3GX4 X;  3C2G A;  2KIF A;  2ZME A;  2WBM A;  4LIV A;  3MD2 A;  4X0G A;  3BG6 A;  4C2T A;  1SC7 A;  1R00 A;  1MSF C;  1Z9C A;  3BR2 A;  5HS9 A;  2P7C B;  3LSH A;  1GXP A;  2NXN B;  4G6Q A;  4P9F A;  4EGY A;  2CJJ A;  2RDP A;  4AU7 A;  4KDP A;  3FBN B;  2EFO A;  3H5A A;  1R23 A;  3GZN B;  3H5R A;  4I02 A;  2N8G A;  4RM3 A;  4BY7 J;  3RJP A;  3IKT A;  4BJ6 C;  4D0P A;  4GCV A;  5K5O A;  5EEG A;  1OYY A;  1XGO A;  3A4C A;  1FBQ A;  5KCM A;  2HOT A;  2ZJR F;  3BJ6 A;  4EVI A;  3KEQ A;  3KYL A;  4IX7 A;  4N4N B;  2KT0 A;  4F93 B;  2IW5 A;  3QOP A;  1VQO I;  3S2W A;  3CMA I;  2NS7 A;  4RAG A;  2VKV A;  2XDV A;  4MFE A;  3T0Y A;  1D1A A;  2XRO A;  3HOZ J;  3OIQ A;  4RS8 A;  2DW4 A;  4BQQ A;  1S9H A;  1A6Q A;  4ZYA A;  3TO7 A;  4CDG A;  3WU0 A;  1K79 A;  2LMD A;  4ITV A;  3CES A;  2JA2 A;  1I3Q J;  1T56 A;  3K4K A;  4KMU X;  3KP2 A;  1LKX A;  1TLH B;  3RTR A;  2O5R A;  1RR7 A;  5FLV A;  3VYU B;  1I50 J;  2VXZ A;  3DF8 A;  2NNY A;  2DMQ A;  2DFI A;  1FMW A;  3WU1 B;  3DTI A;  2CW7 A;  3QOE A;  5F08 A;  3QPL A;  1U78 A;  1PP8 F;  2CUF A;  2F5D A;  2EBI A;  2KDO A;  2H09 A;  3H92 A;  5FLX Z;  1ON2 A;  3REO A;  3KYD B;  3JRI A;  1D8K A;  3LSG A;  1E3P A;  3BR1 A;  3E6M A;  2XGD A;  4IEJ A;  3M1E A;  2HS5 A;  2XKP A;  3DLL F;  5L3F A;  2Z16 A;  2DN0 A;  4HF0 A;  2DQR A;  3BG9 A;  2QUF A;  3MZ8 A;  1MJ9 A;  1DUX C;  1N78 A;  3CUQ A;  5EF6 A;  1MD0 A;  2EJR A;  3ZQC A;  2E35 A;  4R8H A;  3OYF A;  1YJW I;  1A35 A;  4AWX B;  1LEA A;  2DA5 A;  4XM3 A;  2HDC A;  2VJ5 A;  3O8H A;  4S0H B;  1YRN B;  4CGZ A;  3TL4 X;  1R22 A;  3MFK A;  1KQ8 A;  1MBJ A;  1G3W A;  5FGM A;  2KIQ A;  2FX0 A;  4BYY A;  1P4X A;  1IDY A;  3V8K A;  3BG5 A;  3IV5 A;  2O0Y A;  3GME A;  3PIO F;  2MH9 A;  5GAE J;  2R7D A;  3ECO A;  3FK7 A;  4RGR A;  3PIP F;  2XGC A;  1IUF A;  5A2Q K;  1P6R A;  2BXY A;  3RDI A;  1UEL B;  1ZG3 A;  2X1D A;  3E6B A;  2P8T A;  3ABT A;  5E18 F;  2G0E A;  4P1W A;  4ESB A;  3AL0 B;  3OSF A;  4HDV A;  4LJZ F;  2VUM J;  3BR6 A;  4A3F J;  1YJN I;  1IN7 A;  2RQQ A;  1CF7 B;  3S8P A;  5LLQ A;  2DLL A;  2VI6 A;  2BHY A;  3RYP A;  3BR3 A;  5J8F A;  4PSW A;  3QPS A;  2VBX A;  3JTH A;  4ZYH A;  4ZH4 F;  3ABU A;  2NVX J;  4XMY A;  2IA0 A;  2D2W A;  3HEF A;  1FWZ A;  5KK1 A;  5ILU A;  3GFL A;  2E5N A;  1SVO A;  1I3A A;  3L09 A;  3TO6 A;  1WJ5 A;  3ZMU A;  1FBU A;  2JA6 J;  1P2F A;  4PGH A;  2KMU A;  3PUF A;  5CYV A;  2QM3 A;  4E7L A;  2G9W A;  1HW2 A;  1KGS A;  2W1O A;  2XHK A;  3BR0 A;  1T38 A;  1VQM I;  5M5X J;  3G1M A;  4FT8 A;  2M0C A;  3OYE A;  1DP3 A;  4XLP F;  2FE3 A;  1GVJ A;  2ELH A;  4UVC A;  1FPQ A;  2ELJ A;  1OFC X;  3CO6 C;  3LSI A;  1X3W B;  3QYB A;  2MW8 A;  3GW2 A;  2LG4 A;  2FQ4 A;  1X4O A;  4PGG A;  1WI3 A;  5JHU A;  2NRA C;  4YEJ A;  5K7F A;  1F1Z A;  5HNF A;  3HJE A;  3G73 A;  4GDF A;  5LRS A;  3R4K A;  2KZV A;  1FBS A;  1ZG5 A;  3SFI A;  2NYX A;  1ZGJ A;  4IHS A;  3GYH X;  3EUH C;  2EZI A;  4I2O A;  1ZRC A;  1Z91 A;  4HZF A;  1E3H A;  1WJF A;  1U8B A;  3JRG A;  2KJB A;  2E1N A;  2EK5 A;  3RKX A;  3GO5 A;  1VQN I;  2GOX B;  3F3X A;  1FOY A;  2EIJ H;  3COA C;  2R7V A;  4A3G J;  1OJL A;  2OJE D;  1PJR A;  4HV5 A;  4LIT A;  3QU3 A;  3RQI A;  1JT6 A;  1XD7 A;  4QSH A;  2ESH A;  3PL8 A;  5D5X B;  1WJA A;  3PQJ A;  4W1U A;  1HKT A;  2BXZ A;  5BOX A;  4G7O F;  3S3N A;  5C4X J;  1FTZ A;  4HLX A;  2VON A;  1BL0 A;  3E5X A;  2DDB A;  2XPV A;  3HRU A;  2IAI A;  3LOC A;  3PSI A;  4EAT A;  3VDX A;  4CCL A;  5L3G A;  3CCQ I;  3EPZ A;  1PP7 U;  5E3N A;  1VFC A;  3OYK A;  3LA2 A;  2R7Q A;  3O2P E;  3OV8 A;  2OCE A;  2Y30 A;  5IT9 Z;  1X2M A;  5K5R A;  3S15 J;  2HEO A;  1W0T A;  2X1E A;  3H35 A;  4YIR X;  4Y52 J;  3IAM 2;  4DYR A;  1SMY F;  2X1C A;  4MHG A;  3C3W A;  4LGW A;  3TDU C;  2BV6 A;  1X4P A;  4JBA A;  2R7O A;  1OIS A;  1TQP A;  3FWE A;  3GXO A;  1PYV A;  1YX5 A;  2CRG A;  1ACI A;  2LBF B;  3SZG A;  3VB2 A;  3BJA A;  2VT2 A;  2PMU A;  1U6G A;  3M8J A;  2LFB A;  5HS8 A;  4LLN A;  1TTY A;  2EFQ A;  4YFK F;  1A5J A;  4Q48 A;  3ZPL A;  4HRI A;  3S3M A;  3LA3 A;  4E7S A;  2R7R A;  3HPG A;  4PJN A;  3WTX C;  2VJI A;  3MZY A;  4IF4 A;  4DBQ A;  3TMO A;  3CLQ A;  2D5V A;  5B66 C;  3LST A;  1OKR A;  1A36 A;  2LYC A;  1XPX A;  1B9M A;  2K3P A;  4K2E A;  4WK8 F;  1ENH A;  2JUC A;  4GXO A;  5M3M J;  1WVR A;  2JTV A;  3I9V 2;  2DBB A;  4XRF A;  3ZMS A;  2K7L A;  4HST A;  3OYN A;  3I5U A;  2Y2Z A;  3HKZ A;  3OMY A;  3QOD A;  4M71 A;  1BJA A;  5EEA A;  2K9S A;  3J81 Z;  3NAU A;  1BN5 A; 
#chains in the Genus database with same CATH homology
 1BR2 A;  2X85 A;  2R7U A;  2XSJ C;  1Z3X A;  2CV2 A;  2HVQ A;  1WFX A;  4CSW A;  1DQU A;  3OY9 A;  3OYL A;  4ZTF A;  3OS1 A;  4NQW B;  3MKZ A;  1NG6 A;  2KLO A;  4CA0 A;  4XN0 A;  2IS4 A;  3OR2 C;  4U7B A;  3E0J B;  1YX3 A;  1OLT A;  3U21 A;  4IQJ A;  3S32 A;  1D0Z A;  4PJJ A;  1OR7 C;  3CJR B;  4BEH B;  3K70 C;  4ZDP A;  4Y4R A;  4B43 A;  2IS6 A;  2M0M A;  1Z7L A;  2LBF A;  4PFO A;  2HU9 A;  1E0E A;  2X51 A;  2VQH A;  1X1B A;  3H9Q A;  2ZXI A;  3PSF A;  3W3C A;  5FRO A;  2MYS A;  1MMA A;  4CCN A;  1BR1 A;  3RQ4 A;  2E5Z A;  1Z3Y A;  4P5O A;  2F4I A;  3ZR8 X;  4HPQ A;  1SFK A;  3RCO A;  2A5W A;  4XLC A;  2KHM A;  2LC2 A;  2W00 A;  2ZFU A;  4XQF A;  1LFP A;  4D9J A;  4BS9 A;  4D1Q A;  1WJC A;  1G8X A;  3OYI A;  3VYT B;  2HVS A;  3CMM A;  1K6Y A;  2IGN A;  2KP6 A;  1WJB A;  5CKT A;  3N05 A;  3F9K A;  4E7I A;  4BAC A;  2IGM A;  2LH9 A;  2W4S A;  2KRH A;  1MMN A;  4RMN A;  2UV1 A;  3S3O A;  1UG0 A;  4E7K A;  3L2Q A;  2BOL A;  4KT6 A;  1HA8 A;  2V9K A;  4XKV A;  2PJR A;  1UAA A;  4BJ5 C;  3SYT A;  2WY8 Q;  1Z21 A;  2IGK A;  3PNY A;  3CZ6 A;  2V6E A;  4CZC A;  2VB6 A;  4B44 A;  2CS3 A;  3AKZ A;  3FDY A;  5CQE A;  2X6W A;  2NOJ B;  2XF7 A;  1V5F A;  2LRD A;  4ZDO A;  2XF6 A;  3D5R C;  2WAF A;  3DPT A;  2FUG 2;  3CP2 A;  1D0Y A;  1V5E A;  2VAS A;  4BEH A;  2GOM A;  3OYA A;  4RLQ A;  5JHF A;  4G6T B;  4XLH A;  2VJJ A;  3D5S C;  4XLE A;  1EA3 A;  5LFA A;  4F55 A;  3HXL A;  1Y6I A;  4BE0 A;  4BE2 A;  2XF5 A;  4PSX A;  4II3 A;  4GRI A;  3HG9 A;  4PJL A;  2HNH A;  2OV7 A;  1D1B A;  4E7J A;  2DCE A;  1QU3 A;  3DQV C;  4XKW A;  3BLY A;  2AQF A;  2V26 A;  4CUG A;  4E4H A;  3CF2 A;  2F6C A;  4XOR A;  4E6K G;  4C2U A;  3K4C A;  4FAS D;  2M4G A;  1DGW Y;  5HNH A;  4Y33 A;  3IP4 B;  2MD0 A;  2Q1Z B;  1AA7 A;  2QKL B;  3MKW B;  3J7A Y;  2XC7 A;  3PNV A;  3G2B A;  3LSK A;  4F3Q A;  3VWB A;  2VL8 A;  2CMP A;  3ZXS A;  3C2G A;  3H5N A;  2DJI A;  2WBM A;  4LIV A;  5HOO A;  3MD2 A;  3BCA A;  4X0G A;  3BG6 A;  4C2T A;  1BR4 A;  2M4K A;  4DJA A;  4YRV A;  3LSH A;  3DPU A;  4CCK A;  3IAS 2;  3LSM A;  2E1M C;  4AU7 A;  2RRE A;  3FBN B;  3H5A A;  3H5R A;  4RM3 A;  4C30 A;  1D0X A;  4BUP A;  4ZC3 A;  4BJ6 C;  2V1N A;  4F92 B;  3OYH A;  2VLA A;  4HSR A;  4PJM A;  4PFP A;  3A4C A;  1X1D A;  5KCM A;  2CV1 A;  3OL4 A;  4F52 A;  2K9L A;  2BW3 B;  2WB1 A;  2WY7 Q;  1QHG A;  3KYL A;  4IX7 A;  4N4N B;  4LIU A;  4F93 B;  3CP8 A;  2Z2S B;  2A6T A;  2JUG A;  4QPQ A;  3H9J A;  2XDV A;  1D1A A;  4ZDL A;  2P0W A;  3OIQ A;  4BQQ A;  1S9H A;  3SEZ A;  5TGT A;  3DPL C;  3L2W A;  1ZEL A;  4KJZ A;  4ZYA A;  3DEE A;  4ITV A;  2W82 A;  3CES A;  2JA2 A;  3K4K A;  3PNT A;  1LKX A;  3ZRG A;  4BXF A;  2L5Q A;  3RTR A;  4IKF A;  1X1A A;  4XR6 A;  4R79 A;  2O5R A;  1KON A;  3VYU B;  4XOP A;  2VXZ A;  4BDZ A;  3DTK A;  2MFZ A;  1P9Q C;  4CCO A;  1FMW A;  3DTI A;  2Y0S A;  2CW7 A;  2E1M B;  2CW8 A;  2R4G A;  3QOE A;  4BJT A;  2V4J C;  2X6X A;  4PK4 A;  2KDO A;  2HVR A;  3FHN A;  2UWM A;  3OIP A;  3LSG A;  2R7W A;  2LRE A;  1FMV A;  2UUZ A;  3K4J A;  2Z16 A;  2L9N A;  3KEY A;  3OOU A;  4JOM A;  4B47 A;  3M1C A;  2R7S A;  1N78 A;  5LD2 C;  1TT0 A;  2R7X A;  4XN3 A;  3I3L A;  1ERD A;  4OAY A;  3OYF A;  2JSP A;  4N4O B;  3DKY A;  4XM3 A;  1MND A;  2VJ5 A;  3NWS A;  3TL4 X;  3OYB A;  3VSK A;  3VYS B;  1MW7 A;  2JVG A;  2ZSH B;  3W2V A;  2OUM A;  2VQC A;  4IZZ A;  4KIS A;  2IS1 A;  3HOT A;  2KPM A;  4NNJ A;  4Y3O A;  3V42 A;  2WAQ A;  3K4N A;  4NC8 A;  3L2V A;  2CV0 A;  4RM2 A;  3HL2 A;  2F5V A;  2LY1 A;  1UEL B;  2X1D A;  3C2H A;  3A1Y A;  3HUG B;  3PJR A;  3A2K A;  4P1W A;  3AL0 B;  3EUK L;  4H4K C;  3VYR B;  4DGW B;  3TBI A;  1LDK B;  4AVZ A;  4B3X A;  3NWT A;  3ZGK A;  2RQQ A;  4DIQ A;  1T95 A;  3S8P A;  3OYJ A;  1NG7 A;  4NUB A;  4PSW A;  4B48 A;  2DXI A;  5HLT A;  3SEQ A;  1W36 D;  4XLA A;  3KX2 A;  3SDB A;  4IQ4 A;  4XMY A;  2IGO A;  4E7Z A;  1MMD A;  3K4M A;  1LVK A;  2E5N A;  3S93 A;  4ANJ A;  2CH0 A;  1YE9 A;  4QPO A;  2VKD A;  4PUS A;  1WJ5 A;  2IS2 A;  4HG2 A;  3UR3 C;  2KMU A;  2WAD A;  4E7L A;  3MMY B;  4YEL A;  2VIX A;  2W1O A;  2ZSI B;  4OAZ A;  2V7F A;  1WJD A;  3OS0 A;  2VKH A;  2PJR B;  1GLN A;  3AFH A;  3OYE A;  1DP3 A;  1N77 A;  1WJE A;  2ELJ A;  1D1C A;  4HNT A;  1J09 A;  1MMG A;  4LG3 A;  3LSI A;  3D5L A;  3QYB A;  3H0D A;  1MNE A;  3H9G A;  3FBI B;  3OYC A;  1W36 C;  2LG4 A;  4FET A;  4BL0 B;  1Y56 A;  1X4O A;  4XL9 A;  4BE1 A;  1U0J A;  1JI8 A;  4YEJ A;  2JVH A;  5HNF A;  3UNG C;  2DT6 A;  2LOO A;  2KZV A;  2HPI A;  1TZL A;  2HDW A;  2L7K A;  3GBG A;  3EUH C;  3PUB A;  4BGD A;  3LMM A;  2Z1D A;  2R7T A;  3CJQ B;  1WJF A;  2M3A A;  3W2A A;  1SAU A;  4JQF A;  2GOX B;  4MLO A;  2KQR A;  1DGR M;  4KIT B;  2R7V A;  1QHH D;  3LFU A;  2WAE A;  4XKB A;  3HOS A;  3K6G A;  3OS2 A;  2X6Y A;  2KRC A;  2VPL A;  2VQG A;  1PJR A;  2Q2E B;  2XAU A;  2RNG A;  4HNU A;  4LIT A;  1G59 A;  2OC6 A;  3L2R A;  3DU6 A;  3PL8 A;  1WJA A;  4II2 A;  5CPR B;  2LY2 A;  3AL0 C;  4ZTJ A;  2M7B A;  2IXS A;  3K4L A;  3S3N A;  2CUZ A;  3OL3 A;  2E60 A;  3OYD A;  4J00 A;  2ZXH A;  3BG7 A;  3K10 A;  3RSN A;  4EAT A;  2M7A A;  3PSI A;  4XLF A;  4XOT A;  4XNF A;  3VDX A;  3E1S A;  4CCL A;  2HQA A;  3EPZ A;  1VZ0 A;  2DOA A;  3OYK A;  2R7Q A;  4ZJZ A;  2AQE A;  2WA0 A;  5FRN A;  3VSL A;  4XKC A;  2X1E A;  3H35 A;  2KL4 A;  2DT7 B;  3QYE A;  4BDY A;  3IAM 2;  2HZD A;  5FRM A;  2X1C A;  3OYM A;  3ZQQ A;  4J01 A;  3IUO A;  3L2U A;  3ONQ A;  2PMZ A;  2VJ4 A;  2K5C A;  2W7N A;  1X4P A;  2BVM A;  2R7O A;  1PYV A;  1YX5 A;  2BW3 A;  5KNL A;  1R6R A;  1X19 A;  4E7H A;  3MKY B;  1N75 A;  2VQL A;  2LBF B;  3DKX A;  4U87 A;  3OR1 C;  3SZG A;  2VXD A;  2HPM A;  3M8J A;  3OWT A;  3HPH A;  4C9Y A;  1IRX A;  4CCJ A;  4RLF A;  4HRI A;  3S3M A;  4XON A;  3BC8 A;  4E7S A;  2R7R A;  1BOB A;  3HPG A;  3K4B A;  4PJN A;  2CUJ A;  2VJI A;  4BQN A;  4DBQ A;  4DBR A;  3TMO A;  4CCM A;  4CH7 A;  2I8D A;  2MC4 A;  5CQG A;  4DOZ A;  2K9M A;  1X1C A;  3OYG A;  1T0F C;  3DWL E;  4OWR B;  3LL7 A;  4AYB A;  3BCB A;  2LYC A;  2BVL A;  3QYF A;  2MAB A;  3HC7 A;  2K3P A;  4BU2 A;  4NC7 A;  4BQO A;  3K70 D;  3I9V 2;  3PFY A;  3DTE A;  4HEA 2;  2L2O A;  3FKJ A;  4HST A;  3ZCO A;  5HVQ C;  3OYN A;  2QKM B;  2L9S A;  2CFO A;  3DLA A;  3HKZ A;  3OMY A;  3QOD A;  3EUA A;  3W2W A;  5KHD A;  3DU5 A;  3RPU D;  4F91 B;  1V5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...