3MKYB

Structure of sopb(155-323)-18mer dna complex, i23 form
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADEVITLLTSVLKTSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*TP*GP*GP*GP*AP*CP*CP*AP*TP*GP*GP*TP*CP*CP*CP*A
publication title Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 39
structure length 115
sequence length 115
chains with identical sequence P
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18090 SoPB_HTH Centromere-binding protein HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3mkyB00
3MKWB 3VWBA 1VZ0A 3W3CA 3W2AA 3MKZA 3MKYB
chains in the Genus database with same CATH superfamily
4CYCA 1USSA 4ZZDA 3FK6A 2HTSA 1J75A 3PO2J 3ABUA 4L0ZB 2F4MB 3TEDA 2DXIA 2CV2A 5CLSA 2DPUA 1WWXA 3EQLF 3S2WA 1P92A 5EZHA 3CUOA 1I27A 1Z6TA 1SFKA 2LH9A 3KFWX 3AAFA 2M8EA 2VE9A 2LY2A 1AU7A 4PDKA 1C0WA 3FWEA 1J7KA 1Z0XA 2ISYA 4RMNA 1FLIA 2ZFWA 1VQ8I 1IXRC 2D1VA 2L3DA 1LDDA 2QM3A 3OYEA 4MEXF 2OTJI 1PP7U 3HRMA 2CGPA 1U3EM 2PX9A 3V7SA 4XOPA 2DFHA 2IEKA 4TV7A 1GVDA 4UUSA 4BQNA 3QODA 4A3FJ 2L9RA 3RQ4A 3ZMDA 2NS7A 2AXLA 3PSIA 4HRIA 3I5UA 4IRGA 2L7MP 3OYGA 4UUVA 4M9SA 3UR3C 2EQRA 2IW5A 3R60A 3AG1H 2WA0A 3OV8A 2QGUA 3IUOA 3LSRA 3N4MA 4UVAA 3BR0A 3GCMA 4IRHA 1EA3A 2BW3B 2MLKA 3LSGA 2VBZA 2NNYA 1FOKA 4F93B 3H35A 2IGNA 4L9JA 3FXUA 4XBFA 4M6YA 5E79C 2MGQA 3H9GA 4NQWB 1EH6A 2DOFA 2H27A 4KIGA 5CYVA 2GXAA 3HJEA 2D5VA 3C2BA 4Y15A 4HV5A 3VEPA 3KZZA 2DLLA 5L3CA 4BE0A 2XF6A 1WJFA 2QKLB 5EGOA 1LDJA 4LFUA 1K4TA 2QQBA 4PGGA 3U9GA 1HF0A 4KYWA 2FBHA 3GUDA 3FIWA 3ZRGA 5A2QK 1BM9A 3W2WA 1NK2P 1OFCX 2KRCA 3LMMA 2EFPA 2H6BA 4AIDA 4AU7A 1T0FC 2E35A 2HWVA 1E3OC 3E6CC 1WFXA 2YX4A 4ZTFA 1U8BA 3C2HA 2VJIA 4CSWA 2K7LA 4N4OB 4B48A 2LBFA 5BMZA 2PMUA 3IKTA 4MTDA 3R6SA 1MBJA 2NVUB 3MKLA 2MA3A 3MZYA 3UNGC 4I98B 2GM4A 2K4JA 2VL8A 4DIQA 1RKWA 5LFAA 3VFZA 3WG9A 1VQ9I 2TCTA 3A03A 4A3EJ 4ENJA 1KZHA 2OTLI 2ETHA 3AG4H 2PJRA 5J40A 1J09A 2VN2A 1UHMA 2RV8A 3CCEI 5EEGA 3BDDA 1Z6RA 3S15J 3H92A 2DI3A 2C6YA 1Y1VJ 2P6TA 1J59A 4WXCA 4PZJA 2ESNA 3PJRA 2BVLA 3JCUC 3HRUA 1L3LA 1G8XA 2EIMH 2W48A 1YG2A 3SZPA 1LEBA 5DD4A 1BA5A 2F5CA 3G71I 5IOYA 3T0YA 5DUIA 1WVRA 2M0CA 2L7FP 4RS8A 1FYLA 3V7RA 4C3IJ 4RGSA 2LRDA 5DEQA 2R7ZJ 3MQ0A 5E3OA 2A6TA 1HBXG 1XD7A 3BQZA 3GTJJ 2M5WA 4W1UA 3ECOA 2DMUA 3F0CA 1IN4A 3HIFA 2FBIA 4GO1A 3CCMI 1B1BA 3DP7A 1FSEA 4EV0A 2STTA 4XRMA 1FSHA 4P96A 1HSTA 1HDDC 3TW6A 1NHAA 2CSOA 2HYJA 1MBHA 4UV8A 5GADJ 2LK2A 4II2A 3DQVC 5J47A 4AVZA 4LOCA 1YX3A 1OR7C 3LFUA 3I58A 3ZQCA 1YLFA 4JP0A 1BJZA 5J1YA 3A1YA 2DOEA 3K4CA 2CG4A 1XCVA 3F8BA 1JHFA 2IS4A 3HSEA 2IA2A 1IN5A 1D1AA 5C4XJ 4F55A 1XGNA 1G3WA 2BZTA 2EZLA 1RR8C 3HHGA 3M3YJ 5F64A 1BI3A 5CVJA 1A35A 4R79A 3DLLF 3R4KA 2MC3A 1AWCA 3DU5A 3HB9A 5K1YA 2JWTA 4HSTA 4NQWA 2K40A 4H4KC 2JT1A 3DEWA 1R5HA 1G59A 4RB2C 2IT0A 1XX5A 5JVGF 1JKPC 1R1UA 4Q47A 5E1ZB 5JR3A 1QVTA 1A04A 3P9IA 2R7FA 3I59A 4ZYAA 1R49A 3KZYA 5H6RA 4B4CA 2QCOA 4XKWA 2NAZA 4IHYA 2QZ8A 3OR2C 1SVMA 5AONA 1ZAOA 3G1OA 2L9VA 3JSPA 4HF2A 3IKVA 4BJTA 1W5SA 3RPUD 1WI9A 2ZMEB 3W6JB 4FTHA 2E1CA 1SAUA 2G7HA 1S3JA 3MKYB 1AKHB 1NK3P 3CCLI 1RUOA 2FMLA 1DPUA 2GBYA 3C1DA 5F0FA 2MYSA 3KP6A 1W36C 2XB5A 5D8LB 4ESJA 2EV0A 1A36A 2QQ9A 2ZO4A 2X6WA 4CCOA 4DBRA 1WGXA 3MEXA 4O3MA 5J4YA 5EDNA 1BI0A 3LSMA 1ZTRA 1YI2I 4OWRB 2HKXA 2HOEA 5FLVA 5D8KB 1OCRH 2Y31A 4PSWA 1I39A 5LEJA 5FB2A 3VODA 2M7AA 3JR9A 1TW3A 5IP9J 4IQJA 4NUBA 3EDPA 4BAYA 2M9HA 3QYEA 1SAXA 3HPHA 2R7WA 2E1OA 1GXPA 2Q8KA 2V9KA 4BJ6C 3ZMVA 3S2HJ 1H8AC 2A69F 3I71A 1TP4A 3D5LA 4G8XA 3HGYA 3DTKA 1OJLA 3HG9A 4A5MA 3ZQHA 2CUZA 1I6XA 2A5WA 4IPAA 2HOTA 3PNYA 3NEUA 3K4MA 5C3EJ 1Z3YA 3F21A 4AIKA 5LGTA 3WTYC 2DDAA 5DV5A 1R22A 4LK0F 2VODA 1JGGA 4YELA 4AIJA 1QGPA 3BR6A 5FROA 2E36A 1B8IB 3BR2A 2HVRA 1IJWC 1R1TA 3CDIA 3QWLA 3I4PA 2W57A 4OMYA 4KICA 3SZTA 1Y6IA 5CPRB 5LGNA 2HEOA 4M71A 1YS7A 3Q0UA 5E8IA 3OS1A 3WTZA 2LSOA 1D0ZA 5EEHA 5LD2C 5B3SH 5HOOA 2CO5A 5JFRA 1ENHA 3L2WA 4V2FA 1TBXA 1ZG3A 5GTIC 4JBAA 1MJBA 4B3XA 2KT0A 1W1WE 3GTGJ 1HKTA 2BY0A 4HA8A 4C2UA 2RNJA 5CJ9A 1O3RA 1K83J 3FHZA 3G4SI 3ZMZA 1BIBA 1ZKGA 3HDDA 4M3GA 1ZGAA 3HRSA 2GZWA 2GIZA 4HLYA 2H8RA 3JSOA 3BZ6A 2WTEA 5HS7A 4ABZA 2HYGD 4Y13A 3HL2A 1LJ9A 2DFEA 2V1DA 3CC4I 3KX2A 1ETVA 3L1PA 4IJAA 3C2GA 4D1QA 5BNGA 2QBYB 2K9MA 3DF8A 3I64A 1K4SA 1G2HA 3SZGA 4BE1A 2K5CA 4ZTJA 3CCQI 4UNOA 4BU2A 3NAUA 1XG1A 1F4KA 2EV6A 3WTSC 3S8PA 2IA1A 2DBBA 2EILH 2NXNB 3BJOA 2OBPA 4RLFA 3TQNA 4XOTA 1U2WA 5D6EA 2DA5A 3CDLA 1USTA 2P0WA 4RB0A 5M5YJ 2QSFX 4Y52J 1FTTA 3A01B 1OKRA 5ICFA 2ZMEA 3SEQA 1F1ZA 4WX9A 3DV8A 3HTSB 3CCSI 2GOXB 4IL6C 1A31A 2JJ7A 3GVAA 3LWFA 2ZXJA 2V4JC 5D5XB 1D5VA 2OJED 1FBSA 4KA4A 3S1RJ 4HSRA 1ZLKA 2CUJA 3QPTA 2W25A 2PQ8A 2Q2EA 5FO5A 4R8HA 1XC5A 4WXHA 4BHPA 4UXNA 1MNDA 3C3WA 3EUHA 1J5YA 4IHSA 4RGRA 4RLQA 2JN6A 2R0QC 4AYBN 1K79A 2K85A 3CP2A 3L09A 1K61A 3RPUA 4CO8A 5EF6A 3F6VA 5ILUA 1E0EA 3M1EA 5F1RA 1VI0A 3I53A 3F22A 2BXZA 2X0LA 5C44J 2XPUA 1Z67A 3ABLH 1KU3A 3H0GJ 3RQIA 3TO9A 4MFEA 2W00A 3QOPA 1ZRFA 4ZC3A 5F04A 4LG3A 2XRNA 5BS6A 2VPLA 5K5RA 2HXIA 2GA2A 4U0VA 4XN0A 1REPC 3ZQGA 3WTWC 4XONA 3FM5A 2D2WA 2BY3A 2DMQA 3WG7H 1S6LA 2O8XA 2A3SA 3ZP5A 1B8IA 1RC9A 2WV1A 4I0BA 1MGTA 2F6CA 1RIOH 3LA3A 1PUEE 2VOPA 3IWFA 3DBHB 4C2MJ 4XN3A 3U2RA 4DYRA 1T56A 1FX7A 2QYOA 2WAFA 1I1SA 1ZYRF 3WGGA 5CVIA 2DU9A 5J8CA 2PG4A 4ITVA 3WU1B 4IZZA 4BQOA 2L54A 2F5DA 4IXAA 3TOBA 5FRMA 3W3CA 1ZK8A 2XAHA 3ZQQA 2EV5A 4HEA2 2KJCA 2A5YB 5AIQA 3ERED 4IKFA 3Q0WA 2M34A 3E6BA 4X0GA 3E97A 4BY1J 2JK3A 3VOEA 3J80K 2O5RA 2VONA 4M3DA 4O5VA 2PEXA 1ZLJA 1SD5A 4A6EA 3SEZA 2KZVA 1YS6A 4RAZA 1MH4A 3BR1A 4A3MJ 2JPCA 3CMAI 4GXOA 2ZC2A 4L5EA 3L7WA 4GRIA 3SFZA 2HYFA 5IYCJ 4OIPF 3FK7A 4E4HA 2HQNA 1IDZA 3DPTA 2QEXI 3LNQA 4MQ9F 1BR1A 4V19K 1ETOA 4ZYEA 2V6EA 1R71A 2DMNA 4FE7A 2DJNA 1PP8F 2X51A 3HC7A 4JX6A 4CYCB 4B1RA 1ETYA 1U6GA 2HPIA 4WCGA 1ZG1A 4DYCA 2EFOA 2HZTA 1FTZA 3CF5F 1P4WA 3NWSA 3O3KA 1LNWA 5FD5A 1FMVA 4PFOA 3I4NJ 3ZCOA 4KNYA 5IT9Z 1MD0A 4LG0A 4BEHB 3FBIB 1T8IA 1ULYA 1V3FA 3ISPA 1O57A 1SMTA 3RDIA 5HLIA 3GLXA 1OMIA 2FNPA 4UVBA 1QQIA 2E7WA 3V7CA 4BBSJ 3A0BC 3NWTA 2RC4A 4I02A 3CCYA 3ZGKA 2W82A 1LQ1A 3J7AO 1ETKA 3KEYA 1OCCH 1O3QA 3G3ZA 1Z9CA 4A0YA 3KYLA 1RUNA 1N75A 3IV5A 3D5RC 4UUSB 5D5WB 2ECCA 2UV1A 3H5AA 3G6EI 3VYUB 3LOCA 3CD6I 2F2EA 1FEXA 3I55I 2DQRA 1TQPA 3K2AA 4BKXA 1Z7LA 3HOXJ 3AG2H 4DZPA 3QP5A 1FIAA 1DGWY 5AIPA 1FP2A 3M07A 2LVSA 4JOMA 3BLYA 4XKBA 2TRTA 2FSWA 1P4AA 2X85A 1QZEA 4J01A 1QVUA 4HDVA 2I5UA 2LKPA 4L9NA 2VXZA 1S7AA 3DEEA 2JRMA 1Z1DA 2OAZA 5H2FC 5DDGA 5M5XJ 1TL8A 2R7RA 2NOJB 3KZIC 5D4SA 5IT3A 1T08B 4HQEA 4NC7A 3EUAA 2XUBA 3TDZC 5EGOB 1AHDP 5IP7J 1WH7A 4LB6B 2BGCA 2K86A 1IRGA 2LC2A 2ZFUA 1LPQA 5DUKA 2PJPA 2ID6A 5E8GA 4XKVA 2P81A 1BOBA 1F36A 2OD5A 2NS8A 3QP6A 1HKQA 5BQTA 3IRRA 2FF4A 4NBQA 3HOTA 4NHJA 3N97A 1XMXA 1WKMA 2DYSH 4XLFA 2MABA 3CLOA 3TO6A 3BWGA 3CZ6A 3IRQA 2WADA 3HRTA 2OCCH 3OMYA 5CVVA 1H88C 3LSPA 4UY8I 2HZDA 2OU2A 4HLXA 1U78A 1JJ8C 3PUBA 3ABMH 4IHVA 1R6RA 1W7PD 3IH3A 4Q4ZF 2EBIA 5IYDJ 2ZMEC 1ETWA 1SVLA 1QHHD 2K27A 3OSFA 3K6GA 2O9LA 1IUYA 2WAEA 2VJ4A 1DQUA 1Y56A 4QTRA 1R5GA 2BE5F 1D5YA 3B73A 1BI1A 4IOCF 4YG2F 2EH3A 5J1RA 4CCLA 1LEAA 2H94A 4D9JA 4M3FA 2XGCA 2AXTC 3JRBA 2E2IJ 3RKXA 4L9VA 4BEHA 2F5FA 4HBLA 3QPLA 4L9TA 1UCRA 3EUHC 3V8KA 3RZOJ 1KGSA 1UMQA 3FKIJ 2O61A 2LD5A 1ZR2A 4D0PA 2F5EA 4FE4A 3PQJA 3GWZA 2OUMA 3J7ZI 1YW8A 3BROA 3MZHA 1VQ6I 1MMGA 1JI8A 1SANA 1FT9A 1WCMJ 4C2TA 4CYDA 3F8FA 4ESFA 2DK8A 3EYIA 3DXJF 3ZR8X 5KCMA 1HDPA 4ZJZA 4RB3C 2XSDC 3HEFA 3A4CA 3S1NJ 2L4AA 4EATA 2PLYA 3ML6A 3S3MA 5K5OA 2Z9OA 5H6QA 3IAM2 2R4GA 1JJ6C 1D8JA 3IP4B 2IS6A 3FMSA 2E1MB 2ZXIA 2PN6A 3A02A 2V9PA 3M4OJ 3F72A 1EV7A 4G6QA 2NVXJ 3H5RA 1IN8A 1V54H 3BPXA 4A3KJ 5BPIA 4IHXA 3BC8A 4A0ZA 2P7CB 3FHNA 3ZOBA 2K9LA 5GPAA 5LEKA 3K1MA 4UVCA 3LAJA 4PK4A 2G9WA 2FRHA 2Y9ZA 3F23A 2MSYA 2ID3A 3OOUA 1RETA 3E7LA 2MFZA 3FDYA 2VB6A 2UZKA 2MG4A 1K78A 2CRGA 1HQCA 4CGZA 4HX4A 1X3UA 1L0OC 1P2FA 3I59B 3BTJA 4G94A 2QQ8A 1EJ9A 3FMQA 3ESWB 2NRAC 1OYIA 3LSTA 4Z6YA 2LREA 1ZGJA 2KFDA 2HDCA 1P6RA 3E3VA 1ZR4A 1BOAA 2EZKA 3ZN0A 1HCRA 3IWZA 1XS9A 3AKZA 2Z16A 4U7DA 3PO3J 3K4KA 3GFIA 2KISA 3HUGA 1MBFA 5DTDA 4MNUA 2LR8A 3JRIA 3TO7A 5HDNA 5IY5H 3GXOA 1V5EA 2X48A 1MJAA 1VNDA 1T33A 1LB2A 2HPMA 4EM2A 3GTOJ 1Q1HA 1LFUP 1R58A 1Z21A 2I8DA 2DODA 4KISA 4AD9A 4B3AA 1U5TA 1UG2A 2OQRA 1TWFJ 3K70C 4EJVA 3PQKA 1YRNB 3OS2A 3SYTA 1S29A 1Z77A 1JUPA 4U0WA 1AOYA 3BPVA 2Z33A 1Z7UA 2L7KA 3BG3A 5FGMA 4MFDA 4M74A 1Z3XA 2BYVE 2NYXA 3FMRA 3Q9VA 4A12A 1TNTA 5EYRA 4E7HA 2ZXWH 1XGMA 2BXYA 3E1SA 4DNCA 5LHIA 1PVEA 1UELB 5L3EA 1YIJI 2XVCA 2NVQJ 1ONVA 4A3BJ 1B9NA 2EWNA 2EFQA 3ABTA 4UUTA 3ONQA 4LLGF 4AVPA 1W7PA 4XIDA 1MBEA 2A05A 4BUPA 1QZYA 2VC0A 4ZZLA 1ZN2A 4RAYA 2OC6A 2D45A 2XIGA 2WY8Q 3WHBA 2E19A 3FF5A 1FP1D 3KYCB 3CTAA 4I76A 2BEOA 2WAQA 4XLAA 2HQRA 5FRNA 1T2KA 3EUKL 2M2EA 2KL4A 4AWXB 1FNNA 3RCOA 5E3NA 2CQ7A 4N0BA 2BBYA 3Q5FA 1DU6A 4NC6A 3J81Z 1V5FA 2FBKA 2XC7A 3IL2A 5HNFA 4BDZA 1KYWA 1LDKB 3M8EA 2O7OA 2CW7A 2ZNYA 1SC7A 4BXXJ 2MBFA 2VQGA 1IZ1A 3I54A 3NRVA 3P9CA 2XASA 3DKYA 2JRTA 2DA1A 3GMEA 2KHMA 1I50J 2ZJRF 1WZ2A 1T39A 3CO6C 1X1BA 3F8MA 5HNHA 3H3UA 3H0DA 3O2PE 2HVQA 2WB1A 5FLMJ 2E34A 3LFKA 1WJBA 2TDXA 3R0JA 2X1CA 2KIMA 2CV1A 2LP0A 2VOOA 1QHGA 2VT2A 1IN6A 2LF7A 3RSNA 1NH3A 1Y0NA 1VQ5I 4PUSA 2VBYA 2HOAA 2FUG2 1U9OA 1TWCJ 3HOWJ 3Q9SA 3GZNB 3OIPA 3JRDA 1XCBA 1YJ9I 3CJTB 3OYHA 2FXAA 5J6XA 2COBA 2W1OA 2FMYA 2M45A 2Q2EB 3CUQB 3HKZA 2RREA 1ETQA 4FX0A 2FNAA 2IGKA 4E7SA 4II3A 1JT0A 3BY6A 5JHFA 3KP7A 4FASD 1FBQA 1SFUA 1R00A 4YFNF 3QYBA 1SEUA 1B72A 1YRNA 2CQXA 3BZKA 2MW8A 2CV0A 5EG0A 1JTYA 2P4WA 2XAFA 4BJ5C 3OYKA 4YFXF 4OIRF 4N9HA 4GYGA 3CCVI 1APLC 3E6DA 2PBIA 2HOSA 4EQQA 1DUXC 5LRSA 2K3PA 4DZJA 1HSJA 2H6CA 2L5QA 4JYKA 3SHFA 4D7MA 1CQTA 3IAS2 3HOYJ 4Y17A 2CWEA 5DD8A 5F27A 1WJDA 3HM5A 3W6KB 1YJNI 1ZRDA 2ICWG 2OCEA 1OYYA 1WJEA 2B7EA 4LJZF 2F5VA 3CJRB 2XRLA 4A2UA 3TL4X 3ASNH 3CCJI 1Q1VA 1K7AA 1XGOA 5TRDA 1D1CA 4P5OA 2AS5F 5B5EC 3M8FA 3SDGA 1BI2A 4XORA 3HBLA 2XV4S 2LYCA 4F7ZA 4YIFA 5E18F 3MKZA 1X1CA 4UV9A 4WXDA 1MDMB 4QWQA 1FWZA 1MKMA 1X1DA 3WU2C 3L2UA 5L3GA 1RPWA 3K1NA 1NG6A 1MBGA 2A6HF 3K1PA 1MSEC 4LB5A 5F6FA 3RYRA 3OR1C 4CXFA 4YFKF 5M3FJ 1IV6A 1TLHB 3BQYA 2JTVA 4LD5A 4R1HA 5K5QA 1XMKA 2KP6A 5ICCA 3DLAA 2GXGA 3ULQB 1R4NB 4MTEA 1HKSA 4UB6C 2HKOA 1RRJA 3K9TA 1FBUA 2M4GA 3OWTA 1YTYA 3S1MJ 3H9QA 3VB2A 5BPDA 2QENA 4BL0B 4EGYA 2NVTJ 2AO9A 3E5UA 1X2NA 3HSFA 1BJAA 1MBKA 2H09A 4M3EA 3BP8A 2CFOA 2G0EA 3NARA 2VUMJ 2XAJA 4ZYGA 3H36A 4OINF 5DCMA 1QRYA 5FKNA 2B9SA 1ZARA 1WQ2A 4EJUA 2ME6A 3WTXC 4N4NB 1IRFA 2PFBA 4KN4X 1MSFC 4A3JJ 4XRFA 2VBXA 2XSJC 1LE8A 5LHHA 5CQGA 3I3LA 2AQFA 1X4PA 3PFYA 1MH3A 1CF7A 3FXLA 1OYWA 3VDXA 4PJMA 4LG0B 3S1QJ 4KUMA 2X9DA 3L2CA 3SJMA 4A5NA 3BZCA 3CUQA 3W6VA 3K4JA 2DA7A 2YU3A 3I4MJ 4JX5A 3J7YJ 3FM3A 2QSGX 4NNJA 2YSRA 3AL0B 4XLEA 1LKXA 3LSHA 1HW5A 4Q48A 1SVOA 2FJ1A 4BQAA 2FEZA 2HQAA 3O6BB 2JA8J 2EFNA 2E71A 1T6SA 5ICEA 5LGUA 1GV5A 4OAYA 3JW4A 3GEZA 4IRIA 1SFOJ 2JA5J 5TGTA 1K6YA 2DQLA 2XGEA 2DA2A 4MIMA 1FOYA 1XB4A 2E5NA 2CMPA 2KRHA 5FJ8J 1IUFA 2QQAA 4QPOA 5M5WJ 2ELKA 2IRFG 1V55H 1V4RA 4DOZA 4FETA 5D5UB 2DN0A 3H9JA 3KPHA 2PMHA 2ZBKA 4F52A 1S9HA 5B1BH 1BR2A 3JREA 2DFIA 2HGCA 2VLAA 3DCFA 4FISA 2DDBA 2JA6J 1ON2A 2COMA 2CUFA 5F1JA 3H3ZA 1FIPA 1R4MB 1IXSB 4GYIA 3KLNA 4E7LA 4E7ZA 2H1LA 1R23A 3FISA 3BCAA 3VSKA 4A0XA 4M72A 3D5SC 1O4XA 2J5PA 4FHTA 3L2QA 1MMDA 1QBJA 1MIJA 1FZPB 3KIOA 1VQOI 2ADUA 2R5ZB 3FXQA 3OYJA 5F0CA 2EFWA 4EGZA 1MW7A 1ORKA 1VQLI 3QRFF 1MDMA 3BJAA 4ETSA 4E7KA 4G7OF 2EINH 3L2VA 3S17J 3LL7A 2P5VA 4IEJA 4EM1A 2HXOA 3O8HA 4XR6A 4EM0B 2Y9YA 2STWA 1FOXA 4CICA 2DTRA 4LIVA 1O3TA 3LAPA 3P9KA 4JK1X 4ASNA 1F5TA 4PJJA 3ELKA 2I10A 1LFPA 5FLXZ 1VTNC 3DPUA 3D1NI 2LOOA 3I0TA 4WF2A 3PIPF 1W36D 2HDDA 1YO5C 2DAOA 4E6KG 1S7EA 3DTIA 3HHHA 4XICA 4YEJA 4YIIA 3V4GA 5HVQC 4KITB 4CZCA 3OYCA 2LFBA 1NTCA 2XPVA 4I09A 1R9TJ 5M3MJ 2LNBA 3MWMA 1OLTA 2IBDA 1G3SA 3EPZA 4OIOF 2ZNZA 3KYDB 2GLOA 4Z2YA 4X1EA 4PJ0C 3HYIA 3L2RA 1IRXA 1OPCA 2L4MA 2NOGA 1OCOH 4BY7J 1GXQA 3FBNB 3KLOA 2RVCA 3VYSB 4PSXA 1T0FA 4RM3A 2ZB9A 3K4LA 1VQMI 3TKYA 2PI0A 1VQNI 1Y8RB 2OZ6A 2G7UA 2V6CA 1HW2A 5JVTA 3GTPJ 1VQ7I 1ACIA 3LSIA 3I56I 3R0AA 1I3AA 4KN7X 4EJOA 3PM1A 1YE9A 1IV8A 3JAMZ 4BDYA 2B0LA 1W5CC 2ESHA 4ENNA 4IVNA 3DKWA 3LA2A 2ZJ2A 3HGGA 2N8GA 1YYVA 3SDBA 4IX7A 2M0MA 3KEOA 2ACJA 4ZH4F 3HOSA 3BR3A 1PYVA 2QKMB 5C4JJ 3MKWB 2K9QA 2Y75A 3PNVA 3GYHX 2BHZA 1LUJB 3FXRA 3WU0A 3U1DA 1JKQC 2DK5A 3ECHA 2CUEA 4DJAA 1YFHA 1POGA 1TW2A 4BE2A 4HF0A 2XDVA 2KKOA 3OL4A 1JT6A 5LRRA 4ZYHA 1JXSA 2Q0OA 4HDUA 5LLQA 1KU9A 5IOZA 4CH7A 3DWLE 2M8GX 1ON1A 3CMYA 3ERMA 1IG7A 2R7DA 1E3HA 2VXDA 3WODF 2K4BA 2R7XA 2HDWA 4M3BA 4E7JA 3ZQ7A 1DGRM 5GP9A 3FXOA 1KU2A 1YW9A 2L02A 1S72I 1G3YA 3HTUA 2JZYA 1VZ0A 5FFXA 2D1HA 4JQFA 5KVRA 1X3ZB 4HV6A 2R5ZA 3ASOH 3ABKH 2V7FA 1OR7A 5CQEA 4KT6A 2Y30A 1K78B 4IHTA 1TWAJ 1FY7A 1U9NA 2KIQA 4A3DJ 2GWRA 2OA4A 2PMZA 1QPIA 1KQ0A 2BHYA 1IC8A 2VIXA 1XN7A 5FD6A 5HDGA 3AFHA 2L01A 4RGXA 4L5JA 5KNLA 5DCFA 1GUUA 3PFIA 1Z91A 3HUGB 4WK8F 1H9GA 3CMMA 3F8NA 4MHGA 2MH9A 4ESBA 2KIFA 5H20A 4CZZA 3WTTC 4PGHA 4I01A 4C30A 1XMAA 3ZPLA 2IJLA 1JKRC 3HOVJ 4I7HA 4HNVA 3BG5A 5EZGA 5FKLA 2LY9A 4RAFA 1VF9A 5ED4A 3FX3A 5GPCA 3GZ5A 1U5TB 5FLXK 1D3YA 3KETA 3A0HC 2JMWA 1N78A 3RZDJ 2UXNA 2GQQA 1X19A 2CQNA 2HFHA 3OYDA 3S32A 2EK5A 2FQ3A 3IH4A 4ENKA 2R7OA 3ZMTA 2DMTA 2OZUA 3OYNA 4X6AJ 1S7OA 2IGOA 4BBRJ 5BOXA 1R7JA 1STZA 3BT9A 3CUQC 4LMYA 2VKHA 1DP7P 2MC4A 5E1XA 3JRHA 2IP2A 4BHCA 2XROA 1ERDA 4G6TB 1W7PB 1YOVB 1B9MA 1JUSA 4XLNF 1X2MA 2Z5UA 3E5XA 3K4BA 3LQRA 4XK4A 4CCNA 2R7TA 4OOIA 4CHUA 4RB1A 1OCPA 3O8GA 4KFCA 3MCZA 1XDSA 1NG7A 3X2QH 4C3JJ 2VT3A 1ZG5A 1QA6A 5IT9K 2QUFA 3D0SA 3JAMK 2YS9A 4KMFA 5D6FA 3SFIA 4G6DA 1SFXA 3W2AA 1MNMC 3LA7A 1OISA 2DMPA 4HZFA 4EJTA 4GDFA 3PSFA 3BCBA 2P6SA 3L00A 1UJ8A 3B6CA 2WB1N 1YHQI 3Q3SA 2KPMA 1IO2A 2VKEA 3RJPA 2VE8A 3B6AA 2VQHA 3WE3A 4M9ZA 3BG7A 2KDOA 1UB9A 1VFCA 2QA4I 3B02A 2ELHA 4K2EA 4XLHA 2M1BA 2V26A 1PUFA 1FJLA 4ZDLA 1DPRA 2R7VA 1YW7A 4A3GJ 3KE2A 4BXUA 3S14J 4UHTA 1IF1A 2FU4A 2O0YA 4P9UA 1IRZA 3JRAA 3KP4A 3DTEA 2M4KA 3FXJA 1ZELA 4QPQA 2LLKA 4LIUA 3OYIA 2DT5A 1GT0C 1RKTA 2BV6A 3HKZN 1BC8C 2XKOA 4RDUA 1CGPA 2UXXA 2UWMA 3G73A 4ON0A 1X58A 5HLHA 3CLQA 1IW7F 3BTLA 3QPHA 1FPQA 4XLCA 4QSHA 5K7HA 4OAZA 1G6NA 2VI6A 3MN2A 1S5LC 1XSVA 1PDNC 3REOA 2EIJH 2YR2A 3F3XA 2ZJPF 3TGNA 1IN7A 3JTHA 2MH2A 2LY1A 3DU6A 4BS9A 4CA0A 5F0HA 3MVPA 1N77A 3HXLA 2V9VA 3QAHA 3U21A 1WI3A 4S05A 2E7XA 1QO0D 1B72B 4L18B 4U7BA 4QIWN 2DW4A 3CDHA 5EG0B 3E5QA 1X3WB 5IP6A 3G1LA 4HYEA 1D0YA 3E6MA 4HW0A 1J9IA 5E3MA 4BACA 2OPTA 5KAIC 1HLVA 1DDNA 2NS0A 2A07F 3KP5A 2L7ZA 2XGDA 3F8CA 4HNTA 2Y0SA 4HQMA 5E17F 3COAC 5D5VB 1G4DA 3AL0C 1Y8QB 2QWWA 1SD7A 4DW6A 3PL8A 4HX8A 4KDPA 4BXFA 3WGHA 3QPSA 3VWBA 2R93J 2DA6A 5EEAA 4EEFG 2H1KA 3RKQA 4P1WA 1TNSA 2V79A 1EF4A 3T8RA 2XKPA 3GBGA 2OQGA 6PAXA 1N25A 3HSRA 1TT0A 4NC8A 1XSXA 2IAIA 3FKJA 2W24A 2GA1A 1J0RA 4W97A 5J8FA 2Y69H 2NVYJ 4A6DA 2A6EF 5FKMA 1Y0UA 5L3DA 2ZKZA 2LTPA 3ZN1A 4GGGA 3CJNA 2M30A 1KU7A 3K69A 1K6OA 3K4NA 2DA3A 3S3OA 2KMUA 3HPGA 5LBQA 4CCKA 2O8KA 9ANTA 1JE8A 4GCVA 2IS2A 4BGDA 4I2OA 5E1WA 5JLXA 1AA7A 5DM7F 2Y2ZA 4IO9F 3M1CA 2DT6A 2DJIA 4AUXA 5HDKA 3GTLJ 4NDLA 2LMDA 2M3AA 4PJLA 4XRSG 1B59A 1D8KA 1XSDA 4LLLA 1RNLA 2CS3A 2IVMA 3WGIA 5F08A 1MNEA 4A3IJ 4CCJA 1ZRCA 4BQQA 2RNGA 1E2XA 2EZHA 3EETA 2O3FA 2M87A 2BW3A 2W84A 5GAGJ 3H3VK 1UFMA 5DCMB 3QU3A 4BNCA 2XF7A 5LHGA 4HAMA 4IQ4A 3K0LA 2E60A 1BIAA 2CW8A 2A61A 3PUFA 5KK1A 1LE8B 2X1EA 3F9KA 2VJJA 2Z2SB 1X4OA 4PJNA 3LQQA 3IHUA 3JTGA 4ENMA 3GTKJ 3CP8A 4MGRA 4B09A 3BTIA 1CF7B 2E2HJ 2HR3A 3DKXA 3CESA 1ITYA 3DPLC 3GO5A 1I6HJ 4OU0A 2F48A 2Y0MA 1ZQ3P 2AHQA 4IHWA 4G9YA 3P7NA 2UUZA 2XAQA 3ZQIA 1E3PA 3QOEA 3ROUA 2DT7B 2EA4A 4KMUX 2F4IA 4HPQA 2EZIA 1VQ4I 3GFJA 2VBWA 2W85A 1UG0A 3PNTA 4ZDOA 2YX7A 4RGUA 3OIOA 5ILVA 3T8TA 4M6XA 1TTYA 3BOQA 3VYTB 2JSCA 1P7IA 1W4MA 2KRFA 2GXBA 4XLPF 1VQPI 4B47A 3CO7C 3MZ8A 2QVOA 2XAUA 1W5TA 1WHUA 4Y4RA 2KZGA 3OIQA 1BL0A 1MMNA 2XHKA 2KJBA 2R92J 2MLGA 4PFPA 2AQEA 3M8JA 3TOAA 1R1VA 1JGSA 4DQ2A 2DOAA 2FE3A 1QZZA 1YJWI 5CVRA 2V1UA 4L5IA 1P4XA 3HOZJ 2DYRH 2XAGA 3GF2A 2ME0A 1KONA 1GDTA 4P9FA 1JTXA 2X6OA 2E1NA 4MLOA 3GX4X 2IXSA 5GTHC 4O6JA 1BW5A 4G7HF 1BC7C 3FXKA 3K7AJ 5GAHJ 4XNFA 3OL3A 3AG3H 5JLWA 3QU6A 4KIBA 5L3FA 4L0YB 3ZQFA 2R7UA 1BBYA 3RIRA 3GTMJ 2Z1DA 3ZMSA 1GV2A 4AM3A 5D4RA 4YIRX 3V8JA 5B1AH 2W7NA 3FZVA 2HVSA 3J80Z 1ODDA 1EKEA 2P5LC 2KDZA 3LSJA 3E0JB 4N9IA 4RAGA 1FYKA 4QLCU 4C3HJ 3C18A 2R7SA 2P7VB 2O03A 2FOWA 3RPQA 2X1DA 2XPWA 4LGWA 2CYYA 4M9XA 1O7FA 2JVHA 2MD0A 2W4SA 2XB0X 3J81K 4ZYDA 2NNNA 5FFZA 3OOPA 3CJQB 1GHCA 2RDPA 2FD5A 1W0UA 3K70D 1TWGJ 1EH7A 1P9QC 4XRSA 1FYMA 3DEUA 3C7JA 5ICGA 2JUCA 4J00A 3MD2A 2BVMA 1H0MA 2VQCA 4A3LJ 2DA4A 3N05A 4UB8C 4IF4A 1FOWA 5JI6A 2OV7A 1B6AA 2R7QA 1LFBA 1PJRA 4V2GA 4FCYA 1GLNA 2VC1A 3MAJA 1WH5A 1VQKI 4BYYA 5IPAA 4I99C 1I3QJ 2XGXA 2KQRA 5DM6F 5FKKA 3P5JA 4Y3OA 3OS0A 1WSUA 3WE2A 4G7ZF 2CQQA 1U5TC 2CJJA 4BHBA 1FC3A 1XPXA 4C9YA 4ANJA 2RQQA 2LDUA 3S93A 1O7LA 2Y48A 4M6VA 1AKHA 4B44A 2L2OA 2EA2A 2VKVA 4E7IA 4CDGA 2F4OB 1MZBA 3Q0VA 3BR5A 2E5ZA 2X6XA 1IDYA 2YUSA 1RZ4A 3V8LA 2ECBA 4YRVA 2QF7A 3QQAA 5ILSA 4DYQA 5K7ZA 3HOUJ 3G2BA 4JX4A 2DO7A 3BTCA 1WJAA 1DP3A 4G12A 1FMWA 2WV0A 2GAUA 5J3LA 4HF1A 2WC2A 2KLOA 2XF5A 4F91B 3OYLA 4F3QA 4XL9A 5K7FA 3ZMUA 1H89C 2CQKA 4I6ZA 2PMZN 3DBLB 3KEQA 1OQYA 1A6IA 2RGVA 3JRGA 3K2ZA 5J4VA 2R3SA 2DTZA 3GTQJ 4U0YA 2DCEA 3K10A 1YQAA 4MQVA 3KP3A 3DBRB 4RBOA 4NB5A 3V42A 1IGNA 4DGWB 2FA5A 4OIQF 1X1PA 1MMAA 1D0XA 3MMYB 5IYBJ 2IGMA 1W0TA 1YX5A 2HS5A 1T95A 2E1MC 2FOKA 1YIOA 1R36A 2MD5A 1S8NA 2LF8A 5TJJA 3JRCA 1LVKA 4XQFA 2QSHX 1I1GA 2CH0A 2IS1A 1UAAA 3SXYA 2L9NA 3UKGA 3GW2A 2EPFA 3PIOF 1F43A 1SFEA 2JA2A 3RYPA 2JSPA 1SD6A 1U8RA 4B8XA 3HZJA 4A93J 5HODA 1BN5A 1XTAA 2YU9J 5DYMA 2O6GE 3GLLA 1I5ZA 3OYBA 2WBMA 2IA0A 2X4HA 3CCRI 1LVAA 1TT5B 1TC3C 4BH9A 5DS9A 1ZHFA 4XM3A 3U1KA 1TQIA 4OMZA 3RI4A 3EYYA 4KT5C 4ZDPA 4XMYA 1KYZA 2BOLA 4U87A 1RR7A 1RESA 3RKWA 3M9AA 1JUMA 2JVGA 3TDUC 3CMEI 3IH2A 3TW7A 2JA7J 2P5KA 5FKOA 1WPKA 2EIKH 5J1UA 4D5FA 3MFKA 2OF7A 2QBYA 1E17A 1KA8A 4HNUA 3CCUI 3RKYA 3T5XA 2P8TA 3VYRB 2HI3A 2YPRA 3DFGA 4KJZA 4HX7A 1HOMA 3CC2I 1SMYF 2FQ4A 1GVJA 2EJRA 3FXMA 2CU7A 3ZXSA 1WRJA 3BG6A 4HOBA 2BY2A 2ISZA 2R5YB 1Z05A 5HLGA 3TMOA 1KQ8A 3A01A 4P55A 2BY1A 2HTJA 1ETXA 3OYMA 3CC7I 5E20A 4H0EA 1Y1WJ 5CKTA 2VPRA 1ZREA 2GIVA 2DFFA 1IXCA 5HLTA 1ZGWA 4WWCA 1J2XA 5KHDA 2LKXA 1WJ5A 5TISC 2HNHA 5L3BA 1JKOC 2DPDA 2ZXHA 4MEYF 1T98A 1OCTC 1T38A 3H5NA 3R61A 2E2JJ 5E3LA 3GZ6A 1B4AA 3LSKA 1A5JA 2VQLA 4DBQA 2RAEA 2V1NA 4S0HB 1R5ID 4RM2A 3S16J 3S2DJ 4LITA 3RTRA 4M73A 3WTUC 4XSXF 1KQ9A 2K9NA 3ZQLA 4XKCA 1U0JA 1EH8A 3GFMA 1QU3A 4U88A 2VASA 3WHCA 3S3NA 2K3FA 4Q5SF 4FT8A 2WWYA 2VKDA 1XGSA 1WJCA 3F6OA 4LK1F 2ZSIB 3QYFA 2LG4A 3JRFA 3M7GA 1QNTA 1PUFB 4LLNA 3G1MA 1MMSA 1A6QA 4B43A 1Y39A 4MO7A 3OYAA 1YITI 1HA8A 3KCCA 5EJCA 1TQMA 4Y7NJ 4PCQA 2EB7A 4AYBA 4KIFA 3OY9A 4EJWA 2IPQX 4CCMA 3OYFA 2RN7A 1MJ9A 3T1BA 4F92B 1RI7A 1M1EB 1TWHJ 3CQZJ 5HS9A 5GAEJ 1O3SA 4A3CJ 4HG2A 2JUGA 2B63J 3W2VA 3I9V2 4CUGA 1SD4A 2ZCWA 3VSLA 3H1CA 2Z99A 3SQNA 2HU9A 3BJ6A 5A2QZ 2RQPA 1ZH5A 1V5GA 3VPRA 2VJ5A 1H9TA 1IAWA 2K02A 1HC8A 2A68F 1D1BA 3L9FA 2Q1ZB 3J7AY 4FX4A 1F9NA 1X1AA 2H8WA 4EVIA 1QPMA 4Y33A 1UZCA 2HQ5A 4D7NA 4GFBA 1HW1A 5B66C 1BW6A 3WTVC 2ZJQF 1HXDA 2JPBA 3NQOA 4FQGA 1UHSA 2Y0SN 2WY7Q 4XSZF 4EMSA 5HS8A 4D5CA 1G3TA 2FX0A 5JHUA 4S04A 3TP3A 5CVUA 4IOAF 2CW0F 4I0AA 2L0KA 2RKHA 3GFLA 1OCZH 2LBFB 1TZLA 3BG9A 4AC0A 1XDUA 2LKSA 2K9SA 1P7JA 3IC7A 2J5OA 3A2KA 1UHWA 5ERIA 4E70A 2GOMA 2L9SA 1BR4A 1JHHA 2X6YA 3TP0A 4A69C 5KAFC 4J19A 2CFXA 2JQ7A 2ELJA 3CF2A 2Z3YA 2M7BA 2WAQN 3KP2A 2ZSHB 4RA2A 1DU0A 4AIHA 2PJRB 2R5YA 3OSGA 2V1XA 3TBIA 2KIUA 2QLZA
chains in the Genus database with same CATH topology
1TT0A 4NC8A 3FKJA 2KP6A 3DLAA 4E4HA 3DPTA 2DXIA 2CV2A 1BR1A 2M4GA 2V6EA 3OWTA 3H9QA 2LH9A 2X51A 1SFKA 3HC7A 4BL0B 3K4NA 3S3OA 2KMUA 3HPGA 2LY2A 2HPIA 4CCKA 2IS2A 4BGDA 4RMNA 3NWSA 1AA7A 1FMVA 2CFOA 4PFOA 3OYEA 3ZCOA 3M1CA 2DT6A 2DJIA 4BEHB 3FBIB 2M3AA 4PJLA 4N4NB 4XOPA 2CS3A 2XSJC 1MNEA 5CQGA 4BQNA 4CCJA 4BQQA 3I3LA 2AQFA 3QODA 2RNGA 1X4PA 3RQ4A 3PFYA 3PSIA 3NWTA 2BW3A 4HRIA 3OYGA 3VDXA 4PJMA 3ZGKA 2W82A 2XF7A 3KEYA 3UR3C 4IQ4A 2E60A 2CW8A 3KYLA 2WA0A 1N75A 3K4JA 2X1EA 3D5RC 3F9KA 2VJJA 2Z2SB 1X4OA 4PJNA 2UV1A 3IUOA 3H5AA 4NNJA 3VYUB 3AL0B 4XLEA 3CP8A 1EA3A 1LKXA 2BW3B 3LSHA 3LSGA 3DKXA 2HQAA 3CESA 4F93B 1Z7LA 3H35A 3DPLC 2IGNA 4OAYA 1DGWY 5TGTA 3H9GA 1K6YA 4NQWB 4JOMA 3BLYA 2E5NA 2UUZA 2CMPA 2KRHA 3QOEA 4XKBA 4QPOA 2DT7B 4DOZA 2X85A 4FETA 2XF6A 4J01A 4BE0A 1WJFA 2F4IA 2QKLB 3H9JA 4HPQA 4F52A 1S9HA 1BR2A 2VLAA 2VXZA 1UG0A 3PNTA 4ZDOA 3DEEA 3VYTB 3ZRGA 2R7RA 2NOJB 3W2WA 3LMMA 2KRCA 4NC7A 3EUAA 4E7LA 4E7ZA 4B47A 4AU7A 3VSKA 3BCAA 2XAUA 1T0FC 3D5SC 4Y4RA 1WFXA 3L2QA 1MMDA 3OIQA 4ZTFA 2LC2A 3C2HA 2ZFUA 2VJIA 1MMNA 4CSWA 4N4OB 4B48A 2LBFA 3OYJA 4PFPA 2AQEA 4XKVA 3M8JA 1MW7A 1BOBA 2DOAA 3UNGC 4E7KA 3L2VA 3LL7A 2VL8A 4DIQA 4XR6A 5LFAA 3HOTA 4LIVA 1KONA 4XLFA 2MABA 2PJRA 4MLOA 2IXSA 1J09A 4PJJA 1LFPA 3CZ6A 3DPUA 2WADA 3OMYA 2LOOA 3PJRA 2BVLA 1W36D 2HZDA 3PUBA 4E6KG 1G8XA 3OL3A 4XNFA 3DTIA 1R6RA 2R7UA 4YEJA 5HVQC 2Z1DA 1QHHD 4KITB 4CZCA 3OYCA 3K6GA 2W7NA 2HVSA 1OLTA 3EPZA 2LRDA 2WAEA 2VJ4A 1DQUA 1Y56A 3E0JB 2A6TA 3L2RA 2R7SA 1IRXA 4CCLA 4D9JA 2X1DA 4BEHA 3FBNB 2JVHA 4PSXA 2MD0A 3EUHC 3VYSB 2W4SA 4RM3A 3K4LA 3CJQB 2OUMA 4II2A 3DQVC 3K70D 4AVZA 1MMGA 1JI8A 4C2TA 1P9QC 1YX3A 1OR7C 3LSIA 3ZR8X 4J00A 5KCMA 4ZJZA 3LFUA 3MD2A 1YE9A 2BVMA 4BDYA 2VQCA 3A4CA 3A1YA 3N05A 4EATA 3K4CA 2OV7A 2R7QA 1PJRA 3S3MA 3SDBA 2IS4A 4IX7A 2M0MA 1GLNA 3IAM2 2R4GA 1D1AA 4F55A 2KQRA 3HOSA 3IP4B 1PYVA 2IS6A 2QKMB 4R79A 3MKWB 2E1MB 3PNVA 2ZXIA 4Y3OA 3DU5A 3OS0A 4HSTA 3H5RA 4H4KC 4DJAA 4C9YA 4ANJA 1G59A 2RQQA 3S93A 4BE2A 2XDVA 3BC8A 4B44A 2L2OA 3FHNA 3OL4A 2K9LA 4ZYAA 4PK4A 4E7IA 4CH7A 3DWLE 4XKWA 3OR2C 3OOUA 4BJTA 2VXDA 2E5ZA 2X6XA 3RPUD 2MFZA 3FDYA 2VB6A 4YRVA 1SAUA 3MKYB 2R7XA 2HDWA 3G2BA 4E7JA 1DGRM 1WJAA 1DP3A 1FMWA 2MYSA 2LREA 1W36C 1VZ0A 4JQFA 2KLOA 2XF5A 4F91B 3OYLA 4F3QA 2V7FA 4XL9A 5CQEA 2X6WA 4KT6A 4CCOA 4DBRA 3AKZA 2Z16A 3LSMA 3K4KA 4OWRB 2DCEA 3K10A 2PMZA 4PSWA 3V42A 2VIXA 4DGWB 3AFHA 2M7AA 1V5EA 1MMAA 4IQJA 1D0XA 4NUBA 5KNLA 3QYEA 3MMYB 2HPMA 3HPHA 2R7WA 2IGMA 1YX5A 1T95A 2V9KA 2E1MC 1Z21A 2I8DA 3HUGB 4BJ6C 3CMMA 4KISA 3D5LA 3DTKA 3HG9A 3K70C 1LVKA 4C30A 2CUZA 3OS2A 4XQFA 3SYTA 2A5WA 2CH0A 2IS1A 1UAAA 2L9NA 3PNYA 3K4MA 1Z3YA 2L7KA 2JA2A 2JSPA 1Z3XA 4YELA 5FROA 2HVRA 3OYBA 2WBMA 4E7HA 1Y6IA 1N78A 5CPRB 3E1SA 1X19A 3OS1A 1UELB 3OYDA 3S32A 1D0ZA 5LD2C 5HOOA 4XM3A 3ONQA 3L2WA 2R7OA 4B3XA 4ZDPA 4BUPA 3OYNA 4XMYA 2IGOA 4C2UA 2BOLA 4U87A 2OC6A 2WY8Q 2JVGA 2VKHA 2MC4A 1ERDA 2WAQA 4XLAA 4G6TB 4HNUA 5FRNA 3EUKL 3VYRB 3K4BA 4KJZA 2KL4A 4CCNA 2R7TA 3RCOA 3HL2A 3KX2A 3ZXSA 3BG6A 3C2GA 1NG7A 4D1QA 1V5FA 2K9MA 2XC7A 5HNFA 3TMOA 3SZGA 4BE1A 4BDZA 2K5CA 1LDKB 4ZTJA 2CW7A 3OYMA 4BU2A 2VQGA 3W2AA 5CKTA 3S8PA 3PSFA 4RLFA 4XOTA 3BCBA 3DKYA 5HLTA 2P0WA 2KHMA 5KHDA 1WJ5A 2HNHA 2KPMA 1X1BA 2ZXHA 5HNHA 3SEQA 3H0DA 3H5NA 2VQHA 2HVQA 2WB1A 3BG7A 2KDOA 3LSKA 2GOXB 1WJBA 2V1NA 2VQLA 4DBQA 4RM2A 4LITA 2X1CA 3RTRA 2V4JC 4XLHA 2CV1A 2V26A 4ZDLA 4XKCA 2R7VA 1QHGA 1U0JA 1QU3A 4HSRA 3RSNA 2CUJA 4PUSA 2VASA 3S3NA 2FUG2 1MNDA 2VKDA 1WJCA 3DTEA 3OIPA 2M4KA 2ZSIB 3QYFA 2LG4A 1ZELA 4QPQA 4RLQA 4LIUA 3OYHA 3OYIA 3CP2A 4B43A 3OYAA 1HA8A 2W1OA 2UWMA 1E0EA 2Q2EB 3OY9A 4AYBA 3HKZA 4CCMA 3OYFA 2RREA 4F92B 2IGKA 4XLCA 4E7SA 4II3A 4HG2A 4OAZA 5JHFA 4FASD 2JUGA 2W00A 4ZC3A 3W2VA 3I9V2 3QYBA 4LG3A 4CUGA 2VPLA 3VSLA 4XN0A 2HU9A 2CV0A 4XONA 1V5GA 4BJ5C 3OYKA 2LY1A 2VJ5A 3DU6A 4BS9A 4CA0A 1N77A 3HXLA 3U21A 1D1BA 2K3PA 2F6CA 2Q1ZB 2L5QA 4U7BA 3J7AY 1X1AA 3IAS2 4Y33A 1WJDA 4XN3A 1D0YA 1WJEA 2WAFA 2F5VA 2WY7Q 3CJRB 3TL4X 4BACA 4ITVA 4IZZA 4BQOA 1D1CA 4P5OA 4HNTA 5FRMA 3W3CA 2Y0SA 3ZQQA 4HEA2 4XORA 4IKFA 2LBFB 2LYCA 1TZLA 4X0GA 3AL0C 3MKZA 3A2KA 1X1CA 2GOMA 3PL8A 2O5RA 2L9SA 1BR4A 2X6YA 4BXFA 3VWBA 1X1DA 2ELJA 3CF2A 3L2UA 2M7BA 3SEZA 2KZVA 4P1WA 1NG6A 2ZSHB 3GBGA 2PJRB 3TBIA 3OR1C 4GRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKW B;  3VWB A;  1VZ0 A;  3W3C A;  3W2A A;  3MKZ A;  3MKY B; 
#chains in the Genus database with same CATH topology
 4CYC A;  1USS A;  4ZZD A;  3FK6 A;  2HTS A;  1J75 A;  3PO2 J;  3ABU A;  4L0Z B;  2F4M B;  3TED A;  2DXI A;  2CV2 A;  5CLS A;  2DPU A;  1WWX A;  3EQL F;  3S2W A;  1P92 A;  5EZH A;  3CUO A;  1I27 A;  1Z6T A;  1SFK A;  2LH9 A;  3KFW X;  3AAF A;  2M8E A;  2VE9 A;  2LY2 A;  1AU7 A;  4PDK A;  1C0W A;  3FWE A;  1J7K A;  1Z0X A;  2ISY A;  4RMN A;  1FLI A;  2ZFW A;  1VQ8 I;  1IXR C;  2D1V A;  2L3D A;  1LDD A;  2QM3 A;  3OYE A;  4MEX F;  2OTJ I;  1PP7 U;  3HRM A;  2CGP A;  1U3E M;  2PX9 A;  3V7S A;  4XOP A;  2DFH A;  2IEK A;  4TV7 A;  1GVD A;  4UUS A;  4BQN A;  3QOD A;  4A3F J;  2L9R A;  3RQ4 A;  3ZMD A;  2NS7 A;  2AXL A;  3PSI A;  4HRI A;  3I5U A;  4IRG A;  2L7M P;  3OYG A;  4UUV A;  4M9S A;  3UR3 C;  2EQR A;  2IW5 A;  3R60 A;  3AG1 H;  2WA0 A;  3OV8 A;  2QGU A;  3IUO A;  3LSR A;  3N4M A;  4UVA A;  3BR0 A;  3GCM A;  4IRH A;  1EA3 A;  2BW3 B;  2MLK A;  3LSG A;  2VBZ A;  2NNY A;  1FOK A;  4F93 B;  3H35 A;  2IGN A;  4L9J A;  3FXU A;  4XBF A;  4M6Y A;  5E79 C;  2MGQ A;  3H9G A;  4NQW B;  1EH6 A;  2DOF A;  2H27 A;  4KIG A;  5CYV A;  2GXA A;  3HJE A;  2D5V A;  3C2B A;  4Y15 A;  4HV5 A;  3VEP A;  3KZZ A;  2DLL A;  5L3C A;  4BE0 A;  2XF6 A;  1WJF A;  2QKL B;  5EGO A;  1LDJ A;  4LFU A;  1K4T A;  2QQB A;  4PGG A;  3U9G A;  1HF0 A;  4KYW A;  2FBH A;  3GUD A;  3FIW A;  3ZRG A;  5A2Q K;  1BM9 A;  3W2W A;  1NK2 P;  1OFC X;  2KRC A;  3LMM A;  2EFP A;  2H6B A;  4AID A;  4AU7 A;  1T0F C;  2E35 A;  2HWV A;  1E3O C;  3E6C C;  1WFX A;  2YX4 A;  4ZTF A;  1U8B A;  3C2H A;  2VJI A;  4CSW A;  2K7L A;  4N4O B;  4B48 A;  2LBF A;  5BMZ A;  2PMU A;  3IKT A;  4MTD A;  3R6S A;  1MBJ A;  2NVU B;  3MKL A;  2MA3 A;  3MZY A;  3UNG C;  4I98 B;  2GM4 A;  2K4J A;  2VL8 A;  4DIQ A;  1RKW A;  5LFA A;  3VFZ A;  3WG9 A;  1VQ9 I;  2TCT A;  3A03 A;  4A3E J;  4ENJ A;  1KZH A;  2OTL I;  2ETH A;  3AG4 H;  2PJR A;  5J40 A;  1J09 A;  2VN2 A;  1UHM A;  2RV8 A;  3CCE I;  5EEG A;  3BDD A;  1Z6R A;  3S15 J;  3H92 A;  2DI3 A;  2C6Y A;  1Y1V J;  2P6T A;  1J59 A;  4WXC A;  4PZJ A;  2ESN A;  3PJR A;  2BVL A;  3JCU C;  3HRU A;  1L3L A;  1G8X A;  2EIM H;  2W48 A;  1YG2 A;  3SZP A;  1LEB A;  5DD4 A;  1BA5 A;  2F5C A;  3G71 I;  5IOY A;  3T0Y A;  5DUI A;  1WVR A;  2M0C A;  2L7F P;  4RS8 A;  1FYL A;  3V7R A;  4C3I J;  4RGS A;  2LRD A;  5DEQ A;  2R7Z J;  3MQ0 A;  5E3O A;  2A6T A;  1HBX G;  1XD7 A;  3BQZ A;  3GTJ J;  2M5W A;  4W1U A;  3ECO A;  2DMU A;  3F0C A;  1IN4 A;  3HIF A;  2FBI A;  4GO1 A;  3CCM I;  1B1B A;  3DP7 A;  1FSE A;  4EV0 A;  2STT A;  4XRM A;  1FSH A;  4P96 A;  1HST A;  1HDD C;  3TW6 A;  1NHA A;  2CSO A;  2HYJ A;  1MBH A;  4UV8 A;  5GAD J;  2LK2 A;  4II2 A;  3DQV C;  5J47 A;  4AVZ A;  4LOC A;  1YX3 A;  1OR7 C;  3LFU A;  3I58 A;  3ZQC A;  1YLF A;  4JP0 A;  1BJZ A;  5J1Y A;  3A1Y A;  2DOE A;  3K4C A;  2CG4 A;  1XCV A;  3F8B A;  1JHF A;  2IS4 A;  3HSE A;  2IA2 A;  1IN5 A;  1D1A A;  5C4X J;  4F55 A;  1XGN A;  1G3W A;  2BZT A;  2EZL A;  1RR8 C;  3HHG A;  3M3Y J;  5F64 A;  1BI3 A;  5CVJ A;  1A35 A;  4R79 A;  3DLL F;  3R4K A;  2MC3 A;  1AWC A;  3DU5 A;  3HB9 A;  5K1Y A;  2JWT A;  4HST A;  4NQW A;  2K40 A;  4H4K C;  2JT1 A;  3DEW A;  1R5H A;  1G59 A;  4RB2 C;  2IT0 A;  1XX5 A;  5JVG F;  1JKP C;  1R1U A;  4Q47 A;  5E1Z B;  5JR3 A;  1QVT A;  1A04 A;  3P9I A;  2R7F A;  3I59 A;  4ZYA A;  1R49 A;  3KZY A;  5H6R A;  4B4C A;  2QCO A;  4XKW A;  2NAZ A;  4IHY A;  2QZ8 A;  3OR2 C;  1SVM A;  5AON A;  1ZAO A;  3G1O A;  2L9V A;  3JSP A;  4HF2 A;  3IKV A;  4BJT A;  1W5S A;  3RPU D;  1WI9 A;  2ZME B;  3W6J B;  4FTH A;  2E1C A;  1SAU A;  2G7H A;  1S3J A;  3MKY B;  1AKH B;  1NK3 P;  3CCL I;  1RUO A;  2FML A;  1DPU A;  2GBY A;  3C1D A;  5F0F A;  2MYS A;  3KP6 A;  1W36 C;  2XB5 A;  5D8L B;  4ESJ A;  2EV0 A;  1A36 A;  2QQ9 A;  2ZO4 A;  2X6W A;  4CCO A;  4DBR A;  1WGX A;  3MEX A;  4O3M A;  5J4Y A;  5EDN A;  1BI0 A;  3LSM A;  1ZTR A;  1YI2 I;  4OWR B;  2HKX A;  2HOE A;  5FLV A;  5D8K B;  1OCR H;  2Y31 A;  4PSW A;  1I39 A;  5LEJ A;  5FB2 A;  3VOD A;  2M7A A;  3JR9 A;  1TW3 A;  5IP9 J;  4IQJ A;  4NUB A;  3EDP A;  4BAY A;  2M9H A;  3QYE A;  1SAX A;  3HPH A;  2R7W A;  2E1O A;  1GXP A;  2Q8K A;  2V9K A;  4BJ6 C;  3ZMV A;  3S2H J;  1H8A C;  2A69 F;  3I71 A;  1TP4 A;  3D5L A;  4G8X A;  3HGY A;  3DTK A;  1OJL A;  3HG9 A;  4A5M A;  3ZQH A;  2CUZ A;  1I6X A;  2A5W A;  4IPA A;  2HOT A;  3PNY A;  3NEU A;  3K4M A;  5C3E J;  1Z3Y A;  3F21 A;  4AIK A;  5LGT A;  3WTY C;  2DDA A;  5DV5 A;  1R22 A;  4LK0 F;  2VOD A;  1JGG A;  4YEL A;  4AIJ A;  1QGP A;  3BR6 A;  5FRO A;  2E36 A;  1B8I B;  3BR2 A;  2HVR A;  1IJW C;  1R1T A;  3CDI A;  3QWL A;  3I4P A;  2W57 A;  4OMY A;  4KIC A;  3SZT A;  1Y6I A;  5CPR B;  5LGN A;  2HEO A;  4M71 A;  1YS7 A;  3Q0U A;  5E8I A;  3OS1 A;  3WTZ A;  2LSO A;  1D0Z A;  5EEH A;  5LD2 C;  5B3S H;  5HOO A;  2CO5 A;  5JFR A;  1ENH A;  3L2W A;  4V2F A;  1TBX A;  1ZG3 A;  5GTI C;  4JBA A;  1MJB A;  4B3X A;  2KT0 A;  1W1W E;  3GTG J;  1HKT A;  2BY0 A;  4HA8 A;  4C2U A;  2RNJ A;  5CJ9 A;  1O3R A;  1K83 J;  3FHZ A;  3G4S I;  3ZMZ A;  1BIB A;  1ZKG A;  3HDD A;  4M3G A;  1ZGA A;  3HRS A;  2GZW A;  2GIZ A;  4HLY A;  2H8R A;  3JSO A;  3BZ6 A;  2WTE A;  5HS7 A;  4ABZ A;  2HYG D;  4Y13 A;  3HL2 A;  1LJ9 A;  2DFE A;  2V1D A;  3CC4 I;  3KX2 A;  1ETV A;  3L1P A;  4IJA A;  3C2G A;  4D1Q A;  5BNG A;  2QBY B;  2K9M A;  3DF8 A;  3I64 A;  1K4S A;  1G2H A;  3SZG A;  4BE1 A;  2K5C A;  4ZTJ A;  3CCQ I;  4UNO A;  4BU2 A;  3NAU A;  1XG1 A;  1F4K A;  2EV6 A;  3WTS C;  3S8P A;  2IA1 A;  2DBB A;  2EIL H;  2NXN B;  3BJO A;  2OBP A;  4RLF A;  3TQN A;  4XOT A;  1U2W A;  5D6E A;  2DA5 A;  3CDL A;  1UST A;  2P0W A;  4RB0 A;  5M5Y J;  2QSF X;  4Y52 J;  1FTT A;  3A01 B;  1OKR A;  5ICF A;  2ZME A;  3SEQ A;  1F1Z A;  4WX9 A;  3DV8 A;  3HTS B;  3CCS I;  2GOX B;  4IL6 C;  1A31 A;  2JJ7 A;  3GVA A;  3LWF A;  2ZXJ A;  2V4J C;  5D5X B;  1D5V A;  2OJE D;  1FBS A;  4KA4 A;  3S1R J;  4HSR A;  1ZLK A;  2CUJ A;  3QPT A;  2W25 A;  2PQ8 A;  2Q2E A;  5FO5 A;  4R8H A;  1XC5 A;  4WXH A;  4BHP A;  4UXN A;  1MND A;  3C3W A;  3EUH A;  1J5Y A;  4IHS A;  4RGR A;  4RLQ A;  2JN6 A;  2R0Q C;  4AYB N;  1K79 A;  2K85 A;  3CP2 A;  3L09 A;  1K61 A;  3RPU A;  4CO8 A;  5EF6 A;  3F6V A;  5ILU A;  1E0E A;  3M1E A;  5F1R A;  1VI0 A;  3I53 A;  3F22 A;  2BXZ A;  2X0L A;  5C44 J;  2XPU A;  1Z67 A;  3ABL H;  1KU3 A;  3H0G J;  3RQI A;  3TO9 A;  4MFE A;  2W00 A;  3QOP A;  1ZRF A;  4ZC3 A;  5F04 A;  4LG3 A;  2XRN A;  5BS6 A;  2VPL A;  5K5R A;  2HXI A;  2GA2 A;  4U0V A;  4XN0 A;  1REP C;  3ZQG A;  3WTW C;  4XON A;  3FM5 A;  2D2W A;  2BY3 A;  2DMQ A;  3WG7 H;  1S6L A;  2O8X A;  2A3S A;  3ZP5 A;  1B8I A;  1RC9 A;  2WV1 A;  4I0B A;  1MGT A;  2F6C A;  1RIO H;  3LA3 A;  1PUE E;  2VOP A;  3IWF A;  3DBH B;  4C2M J;  4XN3 A;  3U2R A;  4DYR A;  1T56 A;  1FX7 A;  2QYO A;  2WAF A;  1I1S A;  1ZYR F;  3WGG A;  5CVI A;  2DU9 A;  5J8C A;  2PG4 A;  4ITV A;  3WU1 B;  4IZZ A;  4BQO A;  2L54 A;  2F5D A;  4IXA A;  3TOB A;  5FRM A;  3W3C A;  1ZK8 A;  2XAH A;  3ZQQ A;  2EV5 A;  4HEA 2;  2KJC A;  2A5Y B;  5AIQ A;  3ERE D;  4IKF A;  3Q0W A;  2M34 A;  3E6B A;  4X0G A;  3E97 A;  4BY1 J;  2JK3 A;  3VOE A;  3J80 K;  2O5R A;  2VON A;  4M3D A;  4O5V A;  2PEX A;  1ZLJ A;  1SD5 A;  4A6E A;  3SEZ A;  2KZV A;  1YS6 A;  4RAZ A;  1MH4 A;  3BR1 A;  4A3M J;  2JPC A;  3CMA I;  4GXO A;  2ZC2 A;  4L5E A;  3L7W A;  4GRI A;  3SFZ A;  2HYF A;  5IYC J;  4OIP F;  3FK7 A;  4E4H A;  2HQN A;  1IDZ A;  3DPT A;  2QEX I;  3LNQ A;  4MQ9 F;  1BR1 A;  4V19 K;  1ETO A;  4ZYE A;  2V6E A;  1R71 A;  2DMN A;  4FE7 A;  2DJN A;  1PP8 F;  2X51 A;  3HC7 A;  4JX6 A;  4CYC B;  4B1R A;  1ETY A;  1U6G A;  2HPI A;  4WCG A;  1ZG1 A;  4DYC A;  2EFO A;  2HZT A;  1FTZ A;  3CF5 F;  1P4W A;  3NWS A;  3O3K A;  1LNW A;  5FD5 A;  1FMV A;  4PFO A;  3I4N J;  3ZCO A;  4KNY A;  5IT9 Z;  1MD0 A;  4LG0 A;  4BEH B;  3FBI B;  1T8I A;  1ULY A;  1V3F A;  3ISP A;  1O57 A;  1SMT A;  3RDI A;  5HLI A;  3GLX A;  1OMI A;  2FNP A;  4UVB A;  1QQI A;  2E7W A;  3V7C A;  4BBS J;  3A0B C;  3NWT A;  2RC4 A;  4I02 A;  3CCY A;  3ZGK A;  2W82 A;  1LQ1 A;  3J7A O;  1ETK A;  3KEY A;  1OCC H;  1O3Q A;  3G3Z A;  1Z9C A;  4A0Y A;  3KYL A;  1RUN A;  1N75 A;  3IV5 A;  3D5R C;  4UUS B;  5D5W B;  2ECC A;  2UV1 A;  3H5A A;  3G6E I;  3VYU B;  3LOC A;  3CD6 I;  2F2E A;  1FEX A;  3I55 I;  2DQR A;  1TQP A;  3K2A A;  4BKX A;  1Z7L A;  3HOX J;  3AG2 H;  4DZP A;  3QP5 A;  1FIA A;  1DGW Y;  5AIP A;  1FP2 A;  3M07 A;  2LVS A;  4JOM A;  3BLY A;  4XKB A;  2TRT A;  2FSW A;  1P4A A;  2X85 A;  1QZE A;  4J01 A;  1QVU A;  4HDV A;  2I5U A;  2LKP A;  4L9N A;  2VXZ A;  1S7A A;  3DEE A;  2JRM A;  1Z1D A;  2OAZ A;  5H2F C;  5DDG A;  5M5X J;  1TL8 A;  2R7R A;  2NOJ B;  3KZI C;  5D4S A;  5IT3 A;  1T08 B;  4HQE A;  4NC7 A;  3EUA A;  2XUB A;  3TDZ C;  5EGO B;  1AHD P;  5IP7 J;  1WH7 A;  4LB6 B;  2BGC A;  2K86 A;  1IRG A;  2LC2 A;  2ZFU A;  1LPQ A;  5DUK A;  2PJP A;  2ID6 A;  5E8G A;  4XKV A;  2P81 A;  1BOB A;  1F36 A;  2OD5 A;  2NS8 A;  3QP6 A;  1HKQ A;  5BQT A;  3IRR A;  2FF4 A;  4NBQ A;  3HOT A;  4NHJ A;  3N97 A;  1XMX A;  1WKM A;  2DYS H;  4XLF A;  2MAB A;  3CLO A;  3TO6 A;  3BWG A;  3CZ6 A;  3IRQ A;  2WAD A;  3HRT A;  2OCC H;  3OMY A;  5CVV A;  1H88 C;  3LSP A;  4UY8 I;  2HZD A;  2OU2 A;  4HLX A;  1U78 A;  1JJ8 C;  3PUB A;  3ABM H;  4IHV A;  1R6R A;  1W7P D;  3IH3 A;  4Q4Z F;  2EBI A;  5IYD J;  2ZME C;  1ETW A;  1SVL A;  1QHH D;  2K27 A;  3OSF A;  3K6G A;  2O9L A;  1IUY A;  2WAE A;  2VJ4 A;  1DQU A;  1Y56 A;  4QTR A;  1R5G A;  2BE5 F;  1D5Y A;  3B73 A;  1BI1 A;  4IOC F;  4YG2 F;  2EH3 A;  5J1R A;  4CCL A;  1LEA A;  2H94 A;  4D9J A;  4M3F A;  2XGC A;  2AXT C;  3JRB A;  2E2I J;  3RKX A;  4L9V A;  4BEH A;  2F5F A;  4HBL A;  3QPL A;  4L9T A;  1UCR A;  3EUH C;  3V8K A;  3RZO J;  1KGS A;  1UMQ A;  3FKI J;  2O61 A;  2LD5 A;  1ZR2 A;  4D0P A;  2F5E A;  4FE4 A;  3PQJ A;  3GWZ A;  2OUM A;  3J7Z I;  1YW8 A;  3BRO A;  3MZH A;  1VQ6 I;  1MMG A;  1JI8 A;  1SAN A;  1FT9 A;  1WCM J;  4C2T A;  4CYD A;  3F8F A;  4ESF A;  2DK8 A;  3EYI A;  3DXJ F;  3ZR8 X;  5KCM A;  1HDP A;  4ZJZ A;  4RB3 C;  2XSD C;  3HEF A;  3A4C A;  3S1N J;  2L4A A;  4EAT A;  2PLY A;  3ML6 A;  3S3M A;  5K5O A;  2Z9O A;  5H6Q A;  3IAM 2;  2R4G A;  1JJ6 C;  1D8J A;  3IP4 B;  2IS6 A;  3FMS A;  2E1M B;  2ZXI A;  2PN6 A;  3A02 A;  2V9P A;  3M4O J;  3F72 A;  1EV7 A;  4G6Q A;  2NVX J;  3H5R A;  1IN8 A;  1V54 H;  3BPX A;  4A3K J;  5BPI A;  4IHX A;  3BC8 A;  4A0Z A;  2P7C B;  3FHN A;  3ZOB A;  2K9L A;  5GPA A;  5LEK A;  3K1M A;  4UVC A;  3LAJ A;  4PK4 A;  2G9W A;  2FRH A;  2Y9Z A;  3F23 A;  2MSY A;  2ID3 A;  3OOU A;  1RET A;  3E7L A;  2MFZ A;  3FDY A;  2VB6 A;  2UZK A;  2MG4 A;  1K78 A;  2CRG A;  1HQC A;  4CGZ A;  4HX4 A;  1X3U A;  1L0O C;  1P2F A;  3I59 B;  3BTJ A;  4G94 A;  2QQ8 A;  1EJ9 A;  3FMQ A;  3ESW B;  2NRA C;  1OYI A;  3LST A;  4Z6Y A;  2LRE A;  1ZGJ A;  2KFD A;  2HDC A;  1P6R A;  3E3V A;  1ZR4 A;  1BOA A;  2EZK A;  3ZN0 A;  1HCR A;  3IWZ A;  1XS9 A;  3AKZ A;  2Z16 A;  4U7D A;  3PO3 J;  3K4K A;  3GFI A;  2KIS A;  3HUG A;  1MBF A;  5DTD A;  4MNU A;  2LR8 A;  3JRI A;  3TO7 A;  5HDN A;  5IY5 H;  3GXO A;  1V5E A;  2X48 A;  1MJA A;  1VND A;  1T33 A;  1LB2 A;  2HPM A;  4EM2 A;  3GTO J;  1Q1H A;  1LFU P;  1R58 A;  1Z21 A;  2I8D A;  2DOD A;  4KIS A;  4AD9 A;  4B3A A;  1U5T A;  1UG2 A;  2OQR A;  1TWF J;  3K70 C;  4EJV A;  3PQK A;  1YRN B;  3OS2 A;  3SYT A;  1S29 A;  1Z77 A;  1JUP A;  4U0W A;  1AOY A;  3BPV A;  2Z33 A;  1Z7U A;  2L7K A;  3BG3 A;  5FGM A;  4MFD A;  4M74 A;  1Z3X A;  2BYV E;  2NYX A;  3FMR A;  3Q9V A;  4A12 A;  1TNT A;  5EYR A;  4E7H A;  2ZXW H;  1XGM A;  2BXY A;  3E1S A;  4DNC A;  5LHI A;  1PVE A;  1UEL B;  5L3E A;  1YIJ I;  2XVC A;  2NVQ J;  1ONV A;  4A3B J;  1B9N A;  2EWN A;  2EFQ A;  3ABT A;  4UUT A;  3ONQ A;  4LLG F;  4AVP A;  1W7P A;  4XID A;  1MBE A;  2A05 A;  4BUP A;  1QZY A;  2VC0 A;  4ZZL A;  1ZN2 A;  4RAY A;  2OC6 A;  2D45 A;  2XIG A;  2WY8 Q;  3WHB A;  2E19 A;  3FF5 A;  1FP1 D;  3KYC B;  3CTA A;  4I76 A;  2BEO A;  2WAQ A;  4XLA A;  2HQR A;  5FRN A;  1T2K A;  3EUK L;  2M2E A;  2KL4 A;  4AWX B;  1FNN A;  3RCO A;  5E3N A;  2CQ7 A;  4N0B A;  2BBY A;  3Q5F A;  1DU6 A;  4NC6 A;  3J81 Z;  1V5F A;  2FBK A;  2XC7 A;  3IL2 A;  5HNF A;  4BDZ A;  1KYW A;  1LDK B;  3M8E A;  2O7O A;  2CW7 A;  2ZNY A;  1SC7 A;  4BXX J;  2MBF A;  2VQG A;  1IZ1 A;  3I54 A;  3NRV A;  3P9C A;  2XAS A;  3DKY A;  2JRT A;  2DA1 A;  3GME A;  2KHM A;  1I50 J;  2ZJR F;  1WZ2 A;  1T39 A;  3CO6 C;  1X1B A;  3F8M A;  5HNH A;  3H3U A;  3H0D A;  3O2P E;  2HVQ A;  2WB1 A;  5FLM J;  2E34 A;  3LFK A;  1WJB A;  2TDX A;  3R0J A;  2X1C A;  2KIM A;  2CV1 A;  2LP0 A;  2VOO A;  1QHG A;  2VT2 A;  1IN6 A;  2LF7 A;  3RSN A;  1NH3 A;  1Y0N A;  1VQ5 I;  4PUS A;  2VBY A;  2HOA A;  2FUG 2;  1U9O A;  1TWC J;  3HOW J;  3Q9S A;  3GZN B;  3OIP A;  3JRD A;  1XCB A;  1YJ9 I;  3CJT B;  3OYH A;  2FXA A;  5J6X A;  2COB A;  2W1O A;  2FMY A;  2M45 A;  2Q2E B;  3CUQ B;  3HKZ A;  2RRE A;  1ETQ A;  4FX0 A;  2FNA A;  2IGK A;  4E7S A;  4II3 A;  1JT0 A;  3BY6 A;  5JHF A;  3KP7 A;  4FAS D;  1FBQ A;  1SFU A;  1R00 A;  4YFN F;  3QYB A;  1SEU A;  1B72 A;  1YRN A;  2CQX A;  3BZK A;  2MW8 A;  2CV0 A;  5EG0 A;  1JTY A;  2P4W A;  2XAF A;  4BJ5 C;  3OYK A;  4YFX F;  4OIR F;  4N9H A;  4GYG A;  3CCV I;  1APL C;  3E6D A;  2PBI A;  2HOS A;  4EQQ A;  1DUX C;  5LRS A;  2K3P A;  4DZJ A;  1HSJ A;  2H6C A;  2L5Q A;  4JYK A;  3SHF A;  4D7M A;  1CQT A;  3IAS 2;  3HOY J;  4Y17 A;  2CWE A;  5DD8 A;  5F27 A;  1WJD A;  3HM5 A;  3W6K B;  1YJN I;  1ZRD A;  2ICW G;  2OCE A;  1OYY A;  1WJE A;  2B7E A;  4LJZ F;  2F5V A;  3CJR B;  2XRL A;  4A2U A;  3TL4 X;  3ASN H;  3CCJ I;  1Q1V A;  1K7A A;  1XGO A;  5TRD A;  1D1C A;  4P5O A;  2AS5 F;  5B5E C;  3M8F A;  3SDG A;  1BI2 A;  4XOR A;  3HBL A;  2XV4 S;  2LYC A;  4F7Z A;  4YIF A;  5E18 F;  3MKZ A;  1X1C A;  4UV9 A;  4WXD A;  1MDM B;  4QWQ A;  1FWZ A;  1MKM A;  1X1D A;  3WU2 C;  3L2U A;  5L3G A;  1RPW A;  3K1N A;  1NG6 A;  1MBG A;  2A6H F;  3K1P A;  1MSE C;  4LB5 A;  5F6F A;  3RYR A;  3OR1 C;  4CXF A;  4YFK F;  5M3F J;  1IV6 A;  1TLH B;  3BQY A;  2JTV A;  4LD5 A;  4R1H A;  5K5Q A;  1XMK A;  2KP6 A;  5ICC A;  3DLA A;  2GXG A;  3ULQ B;  1R4N B;  4MTE A;  1HKS A;  4UB6 C;  2HKO A;  1RRJ A;  3K9T A;  1FBU A;  2M4G A;  3OWT A;  1YTY A;  3S1M J;  3H9Q A;  3VB2 A;  5BPD A;  2QEN A;  4BL0 B;  4EGY A;  2NVT J;  2AO9 A;  3E5U A;  1X2N A;  3HSF A;  1BJA A;  1MBK A;  2H09 A;  4M3E A;  3BP8 A;  2CFO A;  2G0E A;  3NAR A;  2VUM J;  2XAJ A;  4ZYG A;  3H36 A;  4OIN F;  5DCM A;  1QRY A;  5FKN A;  2B9S A;  1ZAR A;  1WQ2 A;  4EJU A;  2ME6 A;  3WTX C;  4N4N B;  1IRF A;  2PFB A;  4KN4 X;  1MSF C;  4A3J J;  4XRF A;  2VBX A;  2XSJ C;  1LE8 A;  5LHH A;  5CQG A;  3I3L A;  2AQF A;  1X4P A;  3PFY A;  1MH3 A;  1CF7 A;  3FXL A;  1OYW A;  3VDX A;  4PJM A;  4LG0 B;  3S1Q J;  4KUM A;  2X9D A;  3L2C A;  3SJM A;  4A5N A;  3BZC A;  3CUQ A;  3W6V A;  3K4J A;  2DA7 A;  2YU3 A;  3I4M J;  4JX5 A;  3J7Y J;  3FM3 A;  2QSG X;  4NNJ A;  2YSR A;  3AL0 B;  4XLE A;  1LKX A;  3LSH A;  1HW5 A;  4Q48 A;  1SVO A;  2FJ1 A;  4BQA A;  2FEZ A;  2HQA A;  3O6B B;  2JA8 J;  2EFN A;  2E71 A;  1T6S A;  5ICE A;  5LGU A;  1GV5 A;  4OAY A;  3JW4 A;  3GEZ A;  4IRI A;  1SFO J;  2JA5 J;  5TGT A;  1K6Y A;  2DQL A;  2XGE A;  2DA2 A;  4MIM A;  1FOY A;  1XB4 A;  2E5N A;  2CMP A;  2KRH A;  5FJ8 J;  1IUF A;  2QQA A;  4QPO A;  5M5W J;  2ELK A;  2IRF G;  1V55 H;  1V4R A;  4DOZ A;  4FET A;  5D5U B;  2DN0 A;  3H9J A;  3KPH A;  2PMH A;  2ZBK A;  4F52 A;  1S9H A;  5B1B H;  1BR2 A;  3JRE A;  2DFI A;  2HGC A;  2VLA A;  3DCF A;  4FIS A;  2DDB A;  2JA6 J;  1ON2 A;  2COM A;  2CUF A;  5F1J A;  3H3Z A;  1FIP A;  1R4M B;  1IXS B;  4GYI A;  3KLN A;  4E7L A;  4E7Z A;  2H1L A;  1R23 A;  3FIS A;  3BCA A;  3VSK A;  4A0X A;  4M72 A;  3D5S C;  1O4X A;  2J5P A;  4FHT A;  3L2Q A;  1MMD A;  1QBJ A;  1MIJ A;  1FZP B;  3KIO A;  1VQO I;  2ADU A;  2R5Z B;  3FXQ A;  3OYJ A;  5F0C A;  2EFW A;  4EGZ A;  1MW7 A;  1ORK A;  1VQL I;  3QRF F;  1MDM A;  3BJA A;  4ETS A;  4E7K A;  4G7O F;  2EIN H;  3L2V A;  3S17 J;  3LL7 A;  2P5V A;  4IEJ A;  4EM1 A;  2HXO A;  3O8H A;  4XR6 A;  4EM0 B;  2Y9Y A;  2STW A;  1FOX A;  4CIC A;  2DTR A;  4LIV A;  1O3T A;  3LAP A;  3P9K A;  4JK1 X;  4ASN A;  1F5T A;  4PJJ A;  3ELK A;  2I10 A;  1LFP A;  5FLX Z;  1VTN C;  3DPU A;  3D1N I;  2LOO A;  3I0T A;  4WF2 A;  3PIP F;  1W36 D;  2HDD A;  1YO5 C;  2DAO A;  4E6K G;  1S7E A;  3DTI A;  3HHH A;  4XIC A;  4YEJ A;  4YII A;  3V4G A;  5HVQ C;  4KIT B;  4CZC A;  3OYC A;  2LFB A;  1NTC A;  2XPV A;  4I09 A;  1R9T J;  5M3M J;  2LNB A;  3MWM A;  1OLT A;  2IBD A;  1G3S A;  3EPZ A;  4OIO F;  2ZNZ A;  3KYD B;  2GLO A;  4Z2Y A;  4X1E A;  4PJ0 C;  3HYI A;  3L2R A;  1IRX A;  1OPC A;  2L4M A;  2NOG A;  1OCO H;  4BY7 J;  1GXQ A;  3FBN B;  3KLO A;  2RVC A;  3VYS B;  4PSX A;  1T0F A;  4RM3 A;  2ZB9 A;  3K4L A;  1VQM I;  3TKY A;  2PI0 A;  1VQN I;  1Y8R B;  2OZ6 A;  2G7U A;  2V6C A;  1HW2 A;  5JVT A;  3GTP J;  1VQ7 I;  1ACI A;  3LSI A;  3I56 I;  3R0A A;  1I3A A;  4KN7 X;  4EJO A;  3PM1 A;  1YE9 A;  1IV8 A;  3JAM Z;  4BDY A;  2B0L A;  1W5C C;  2ESH A;  4ENN A;  4IVN A;  3DKW A;  3LA2 A;  2ZJ2 A;  3HGG A;  2N8G A;  1YYV A;  3SDB A;  4IX7 A;  2M0M A;  3KEO A;  2ACJ A;  4ZH4 F;  3HOS A;  3BR3 A;  1PYV A;  2QKM B;  5C4J J;  3MKW B;  2K9Q A;  2Y75 A;  3PNV A;  3GYH X;  2BHZ A;  1LUJ B;  3FXR A;  3WU0 A;  3U1D A;  1JKQ C;  2DK5 A;  3ECH A;  2CUE A;  4DJA A;  1YFH A;  1POG A;  1TW2 A;  4BE2 A;  4HF0 A;  2XDV A;  2KKO A;  3OL4 A;  1JT6 A;  5LRR A;  4ZYH A;  1JXS A;  2Q0O A;  4HDU A;  5LLQ A;  1KU9 A;  5IOZ A;  4CH7 A;  3DWL E;  2M8G X;  1ON1 A;  3CMY A;  3ERM A;  1IG7 A;  2R7D A;  1E3H A;  2VXD A;  3WOD F;  2K4B A;  2R7X A;  2HDW A;  4M3B A;  4E7J A;  3ZQ7 A;  1DGR M;  5GP9 A;  3FXO A;  1KU2 A;  1YW9 A;  2L02 A;  1S72 I;  1G3Y A;  3HTU A;  2JZY A;  1VZ0 A;  5FFX A;  2D1H A;  4JQF A;  5KVR A;  1X3Z B;  4HV6 A;  2R5Z A;  3ASO H;  3ABK H;  2V7F A;  1OR7 A;  5CQE A;  4KT6 A;  2Y30 A;  1K78 B;  4IHT A;  1TWA J;  1FY7 A;  1U9N A;  2KIQ A;  4A3D J;  2GWR A;  2OA4 A;  2PMZ A;  1QPI A;  1KQ0 A;  2BHY A;  1IC8 A;  2VIX A;  1XN7 A;  5FD6 A;  5HDG A;  3AFH A;  2L01 A;  4RGX A;  4L5J A;  5KNL A;  5DCF A;  1GUU A;  3PFI A;  1Z91 A;  3HUG B;  4WK8 F;  1H9G A;  3CMM A;  3F8N A;  4MHG A;  2MH9 A;  4ESB A;  2KIF A;  5H20 A;  4CZZ A;  3WTT C;  4PGH A;  4I01 A;  4C30 A;  1XMA A;  3ZPL A;  2IJL A;  1JKR C;  3HOV J;  4I7H A;  4HNV A;  3BG5 A;  5EZG A;  5FKL A;  2LY9 A;  4RAF A;  1VF9 A;  5ED4 A;  3FX3 A;  5GPC A;  3GZ5 A;  1U5T B;  5FLX K;  1D3Y A;  3KET A;  3A0H C;  2JMW A;  1N78 A;  3RZD J;  2UXN A;  2GQQ A;  1X19 A;  2CQN A;  2HFH A;  3OYD A;  3S32 A;  2EK5 A;  2FQ3 A;  3IH4 A;  4ENK A;  2R7O A;  3ZMT A;  2DMT A;  2OZU A;  3OYN A;  4X6A J;  1S7O A;  2IGO A;  4BBR J;  5BOX A;  1R7J A;  1STZ A;  3BT9 A;  3CUQ C;  4LMY A;  2VKH A;  1DP7 P;  2MC4 A;  5E1X A;  3JRH A;  2IP2 A;  4BHC A;  2XRO A;  1ERD A;  4G6T B;  1W7P B;  1YOV B;  1B9M A;  1JUS A;  4XLN F;  1X2M A;  2Z5U A;  3E5X A;  3K4B A;  3LQR A;  4XK4 A;  4CCN A;  2R7T A;  4OOI A;  4CHU A;  4RB1 A;  1OCP A;  3O8G A;  4KFC A;  3MCZ A;  1XDS A;  1NG7 A;  3X2Q H;  4C3J J;  2VT3 A;  1ZG5 A;  1QA6 A;  5IT9 K;  2QUF A;  3D0S A;  3JAM K;  2YS9 A;  4KMF A;  5D6F A;  3SFI A;  4G6D A;  1SFX A;  3W2A A;  1MNM C;  3LA7 A;  1OIS A;  2DMP A;  4HZF A;  4EJT A;  4GDF A;  3PSF A;  3BCB A;  2P6S A;  3L00 A;  1UJ8 A;  3B6C A;  2WB1 N;  1YHQ I;  3Q3S A;  2KPM A;  1IO2 A;  2VKE A;  3RJP A;  2VE8 A;  3B6A A;  2VQH A;  3WE3 A;  4M9Z A;  3BG7 A;  2KDO A;  1UB9 A;  1VFC A;  2QA4 I;  3B02 A;  2ELH A;  4K2E A;  4XLH A;  2M1B A;  2V26 A;  1PUF A;  1FJL A;  4ZDL A;  1DPR A;  2R7V A;  1YW7 A;  4A3G J;  3KE2 A;  4BXU A;  3S14 J;  4UHT A;  1IF1 A;  2FU4 A;  2O0Y A;  4P9U A;  1IRZ A;  3JRA A;  3KP4 A;  3DTE A;  2M4K A;  3FXJ A;  1ZEL A;  4QPQ A;  2LLK A;  4LIU A;  3OYI A;  2DT5 A;  1GT0 C;  1RKT A;  2BV6 A;  3HKZ N;  1BC8 C;  2XKO A;  4RDU A;  1CGP A;  2UXX A;  2UWM A;  3G73 A;  4ON0 A;  1X58 A;  5HLH A;  3CLQ A;  1IW7 F;  3BTL A;  3QPH A;  1FPQ A;  4XLC A;  4QSH A;  5K7H A;  4OAZ A;  1G6N A;  2VI6 A;  3MN2 A;  1S5L C;  1XSV A;  1PDN C;  3REO A;  2EIJ H;  2YR2 A;  3F3X A;  2ZJP F;  3TGN A;  1IN7 A;  3JTH A;  2MH2 A;  2LY1 A;  3DU6 A;  4BS9 A;  4CA0 A;  5F0H A;  3MVP A;  1N77 A;  3HXL A;  2V9V A;  3QAH A;  3U21 A;  1WI3 A;  4S05 A;  2E7X A;  1QO0 D;  1B72 B;  4L18 B;  4U7B A;  4QIW N;  2DW4 A;  3CDH A;  5EG0 B;  3E5Q A;  1X3W B;  5IP6 A;  3G1L A;  4HYE A;  1D0Y A;  3E6M A;  4HW0 A;  1J9I A;  5E3M A;  4BAC A;  2OPT A;  5KAI C;  1HLV A;  1DDN A;  2NS0 A;  2A07 F;  3KP5 A;  2L7Z A;  2XGD A;  3F8C A;  4HNT A;  2Y0S A;  4HQM A;  5E17 F;  3COA C;  5D5V B;  1G4D A;  3AL0 C;  1Y8Q B;  2QWW A;  1SD7 A;  4DW6 A;  3PL8 A;  4HX8 A;  4KDP A;  4BXF A;  3WGH A;  3QPS A;  3VWB A;  2R93 J;  2DA6 A;  5EEA A;  4EEF G;  2H1K A;  3RKQ A;  4P1W A;  1TNS A;  2V79 A;  1EF4 A;  3T8R A;  2XKP A;  3GBG A;  2OQG A;  6PAX A;  1N25 A;  3HSR A;  1TT0 A;  4NC8 A;  1XSX A;  2IAI A;  3FKJ A;  2W24 A;  2GA1 A;  1J0R A;  4W97 A;  5J8F A;  2Y69 H;  2NVY J;  4A6D A;  2A6E F;  5FKM A;  1Y0U A;  5L3D A;  2ZKZ A;  2LTP A;  3ZN1 A;  4GGG A;  3CJN A;  2M30 A;  1KU7 A;  3K69 A;  1K6O A;  3K4N A;  2DA3 A;  3S3O A;  2KMU A;  3HPG A;  5LBQ A;  4CCK A;  2O8K A;  9ANT A;  1JE8 A;  4GCV A;  2IS2 A;  4BGD A;  4I2O A;  5E1W A;  5JLX A;  1AA7 A;  5DM7 F;  2Y2Z A;  4IO9 F;  3M1C A;  2DT6 A;  2DJI A;  4AUX A;  5HDK A;  3GTL J;  4NDL A;  2LMD A;  2M3A A;  4PJL A;  4XRS G;  1B59 A;  1D8K A;  1XSD A;  4LLL A;  1RNL A;  2CS3 A;  2IVM A;  3WGI A;  5F08 A;  1MNE A;  4A3I J;  4CCJ A;  1ZRC A;  4BQQ A;  2RNG A;  1E2X A;  2EZH A;  3EET A;  2O3F A;  2M87 A;  2BW3 A;  2W84 A;  5GAG J;  3H3V K;  1UFM A;  5DCM B;  3QU3 A;  4BNC A;  2XF7 A;  5LHG A;  4HAM A;  4IQ4 A;  3K0L A;  2E60 A;  1BIA A;  2CW8 A;  2A61 A;  3PUF A;  5KK1 A;  1LE8 B;  2X1E A;  3F9K A;  2VJJ A;  2Z2S B;  1X4O A;  4PJN A;  3LQQ A;  3IHU A;  3JTG A;  4ENM A;  3GTK J;  3CP8 A;  4MGR A;  4B09 A;  3BTI A;  1CF7 B;  2E2H J;  2HR3 A;  3DKX A;  3CES A;  1ITY A;  3DPL C;  3GO5 A;  1I6H J;  4OU0 A;  2F48 A;  2Y0M A;  1ZQ3 P;  2AHQ A;  4IHW A;  4G9Y A;  3P7N A;  2UUZ A;  2XAQ A;  3ZQI A;  1E3P A;  3QOE A;  3ROU A;  2DT7 B;  2EA4 A;  4KMU X;  2F4I A;  4HPQ A;  2EZI A;  1VQ4 I;  3GFJ A;  2VBW A;  2W85 A;  1UG0 A;  3PNT A;  4ZDO A;  2YX7 A;  4RGU A;  3OIO A;  5ILV A;  3T8T A;  4M6X A;  1TTY A;  3BOQ A;  3VYT B;  2JSC A;  1P7I A;  1W4M A;  2KRF A;  2GXB A;  4XLP F;  1VQP I;  4B47 A;  3CO7 C;  3MZ8 A;  2QVO A;  2XAU A;  1W5T A;  1WHU A;  4Y4R A;  2KZG A;  3OIQ A;  1BL0 A;  1MMN A;  2XHK A;  2KJB A;  2R92 J;  2MLG A;  4PFP A;  2AQE A;  3M8J A;  3TOA A;  1R1V A;  1JGS A;  4DQ2 A;  2DOA A;  2FE3 A;  1QZZ A;  1YJW I;  5CVR A;  2V1U A;  4L5I A;  1P4X A;  3HOZ J;  2DYR H;  2XAG A;  3GF2 A;  2ME0 A;  1KON A;  1GDT A;  4P9F A;  1JTX A;  2X6O A;  2E1N A;  4MLO A;  3GX4 X;  2IXS A;  5GTH C;  4O6J A;  1BW5 A;  4G7H F;  1BC7 C;  3FXK A;  3K7A J;  5GAH J;  4XNF A;  3OL3 A;  3AG3 H;  5JLW A;  3QU6 A;  4KIB A;  5L3F A;  4L0Y B;  3ZQF A;  2R7U A;  1BBY A;  3RIR A;  3GTM J;  2Z1D A;  3ZMS A;  1GV2 A;  4AM3 A;  5D4R A;  4YIR X;  3V8J A;  5B1A H;  2W7N A;  3FZV A;  2HVS A;  3J80 Z;  1ODD A;  1EKE A;  2P5L C;  2KDZ A;  3LSJ A;  3E0J B;  4N9I A;  4RAG A;  1FYK A;  4QLC U;  4C3H J;  3C18 A;  2R7S A;  2P7V B;  2O03 A;  2FOW A;  3RPQ A;  2X1D A;  2XPW A;  4LGW A;  2CYY A;  4M9X A;  1O7F A;  2JVH A;  2MD0 A;  2W4S A;  2XB0 X;  3J81 K;  4ZYD A;  2NNN A;  5FFZ A;  3OOP A;  3CJQ B;  1GHC A;  2RDP A;  2FD5 A;  1W0U A;  3K70 D;  1TWG J;  1EH7 A;  1P9Q C;  4XRS A;  1FYM A;  3DEU A;  3C7J A;  5ICG A;  2JUC A;  4J00 A;  3MD2 A;  2BVM A;  1H0M A;  2VQC A;  4A3L J;  2DA4 A;  3N05 A;  4UB8 C;  4IF4 A;  1FOW A;  5JI6 A;  2OV7 A;  1B6A A;  2R7Q A;  1LFB A;  1PJR A;  4V2G A;  4FCY A;  1GLN A;  2VC1 A;  3MAJ A;  1WH5 A;  1VQK I;  4BYY A;  5IPA A;  4I99 C;  1I3Q J;  2XGX A;  2KQR A;  5DM6 F;  5FKK A;  3P5J A;  4Y3O A;  3OS0 A;  1WSU A;  3WE2 A;  4G7Z F;  2CQQ A;  1U5T C;  2CJJ A;  4BHB A;  1FC3 A;  1XPX A;  4C9Y A;  4ANJ A;  2RQQ A;  2LDU A;  3S93 A;  1O7L A;  2Y48 A;  4M6V A;  1AKH A;  4B44 A;  2L2O A;  2EA2 A;  2VKV A;  4E7I A;  4CDG A;  2F4O B;  1MZB A;  3Q0V A;  3BR5 A;  2E5Z A;  2X6X A;  1IDY A;  2YUS A;  1RZ4 A;  3V8L A;  2ECB A;  4YRV A;  2QF7 A;  3QQA A;  5ILS A;  4DYQ A;  5K7Z A;  3HOU J;  3G2B A;  4JX4 A;  2DO7 A;  3BTC A;  1WJA A;  1DP3 A;  4G12 A;  1FMW A;  2WV0 A;  2GAU A;  5J3L A;  4HF1 A;  2WC2 A;  2KLO A;  2XF5 A;  4F91 B;  3OYL A;  4F3Q A;  4XL9 A;  5K7F A;  3ZMU A;  1H89 C;  2CQK A;  4I6Z A;  2PMZ N;  3DBL B;  3KEQ A;  1OQY A;  1A6I A;  2RGV A;  3JRG A;  3K2Z A;  5J4V A;  2R3S A;  2DTZ A;  3GTQ J;  4U0Y A;  2DCE A;  3K10 A;  1YQA A;  4MQV A;  3KP3 A;  3DBR B;  4RBO A;  4NB5 A;  3V42 A;  1IGN A;  4DGW B;  2FA5 A;  4OIQ F;  1X1P A;  1MMA A;  1D0X A;  3MMY B;  5IYB J;  2IGM A;  1W0T A;  1YX5 A;  2HS5 A;  1T95 A;  2E1M C;  2FOK A;  1YIO A;  1R36 A;  2MD5 A;  1S8N A;  2LF8 A;  5TJJ A;  3JRC A;  1LVK A;  4XQF A;  2QSH X;  1I1G A;  2CH0 A;  2IS1 A;  1UAA A;  3SXY A;  2L9N A;  3UKG A;  3GW2 A;  2EPF A;  3PIO F;  1F43 A;  1SFE A;  2JA2 A;  3RYP A;  2JSP A;  1SD6 A;  1U8R A;  4B8X A;  3HZJ A;  4A93 J;  5HOD A;  1BN5 A;  1XTA A;  2YU9 J;  5DYM A;  2O6G E;  3GLL A;  1I5Z A;  3OYB A;  2WBM A;  2IA0 A;  2X4H A;  3CCR I;  1LVA A;  1TT5 B;  1TC3 C;  4BH9 A;  5DS9 A;  1ZHF A;  4XM3 A;  3U1K A;  1TQI A;  4OMZ A;  3RI4 A;  3EYY A;  4KT5 C;  4ZDP A;  4XMY A;  1KYZ A;  2BOL A;  4U87 A;  1RR7 A;  1RES A;  3RKW A;  3M9A A;  1JUM A;  2JVG A;  3TDU C;  3CME I;  3IH2 A;  3TW7 A;  2JA7 J;  2P5K A;  5FKO A;  1WPK A;  2EIK H;  5J1U A;  4D5F A;  3MFK A;  2OF7 A;  2QBY A;  1E17 A;  1KA8 A;  4HNU A;  3CCU I;  3RKY A;  3T5X A;  2P8T A;  3VYR B;  2HI3 A;  2YPR A;  3DFG A;  4KJZ A;  4HX7 A;  1HOM A;  3CC2 I;  1SMY F;  2FQ4 A;  1GVJ A;  2EJR A;  3FXM A;  2CU7 A;  3ZXS A;  1WRJ A;  3BG6 A;  4HOB A;  2BY2 A;  2ISZ A;  2R5Y B;  1Z05 A;  5HLG A;  3TMO A;  1KQ8 A;  3A01 A;  4P55 A;  2BY1 A;  2HTJ A;  1ETX A;  3OYM A;  3CC7 I;  5E20 A;  4H0E A;  1Y1W J;  5CKT A;  2VPR A;  1ZRE A;  2GIV A;  2DFF A;  1IXC A;  5HLT A;  1ZGW A;  4WWC A;  1J2X A;  5KHD A;  2LKX A;  1WJ5 A;  5TIS C;  2HNH A;  5L3B A;  1JKO C;  2DPD A;  2ZXH A;  4MEY F;  1T98 A;  1OCT C;  1T38 A;  3H5N A;  3R61 A;  2E2J J;  5E3L A;  3GZ6 A;  1B4A A;  3LSK A;  1A5J A;  2VQL A;  4DBQ A;  2RAE A;  2V1N A;  4S0H B;  1R5I D;  4RM2 A;  3S16 J;  3S2D J;  4LIT A;  3RTR A;  4M73 A;  3WTU C;  4XSX F;  1KQ9 A;  2K9N A;  3ZQL A;  4XKC A;  1U0J A;  1EH8 A;  3GFM A;  1QU3 A;  4U88 A;  2VAS A;  3WHC A;  3S3N A;  2K3F A;  4Q5S F;  4FT8 A;  2WWY A;  2VKD A;  1XGS A;  1WJC A;  3F6O A;  4LK1 F;  2ZSI B;  3QYF A;  2LG4 A;  3JRF A;  3M7G A;  1QNT A;  1PUF B;  4LLN A;  3G1M A;  1MMS A;  1A6Q A;  4B43 A;  1Y39 A;  4MO7 A;  3OYA A;  1YIT I;  1HA8 A;  3KCC A;  5EJC A;  1TQM A;  4Y7N J;  4PCQ A;  2EB7 A;  4AYB A;  4KIF A;  3OY9 A;  4EJW A;  2IPQ X;  4CCM A;  3OYF A;  2RN7 A;  1MJ9 A;  3T1B A;  4F92 B;  1RI7 A;  1M1E B;  1TWH J;  3CQZ J;  5HS9 A;  5GAE J;  1O3S A;  4A3C J;  4HG2 A;  2JUG A;  2B63 J;  3W2V A;  3I9V 2;  4CUG A;  1SD4 A;  2ZCW A;  3VSL A;  3H1C A;  2Z99 A;  3SQN A;  2HU9 A;  3BJ6 A;  5A2Q Z;  2RQP A;  1ZH5 A;  1V5G A;  3VPR A;  2VJ5 A;  1H9T A;  1IAW A;  2K02 A;  1HC8 A;  2A68 F;  1D1B A;  3L9F A;  2Q1Z B;  3J7A Y;  4FX4 A;  1F9N A;  1X1A A;  2H8W A;  4EVI A;  1QPM A;  4Y33 A;  1UZC A;  2HQ5 A;  4D7N A;  4GFB A;  1HW1 A;  5B66 C;  1BW6 A;  3WTV C;  2ZJQ F;  1HXD A;  2JPB A;  3NQO A;  4FQG A;  1UHS A;  2Y0S N;  2WY7 Q;  4XSZ F;  4EMS A;  5HS8 A;  4D5C A;  1G3T A;  2FX0 A;  5JHU A;  4S04 A;  3TP3 A;  5CVU A;  4IOA F;  2CW0 F;  4I0A A;  2L0K A;  2RKH A;  3GFL A;  1OCZ H;  2LBF B;  1TZL A;  3BG9 A;  4AC0 A;  1XDU A;  2LKS A;  2K9S A;  1P7J A;  3IC7 A;  2J5O A;  3A2K A;  1UHW A;  5ERI A;  4E70 A;  2GOM A;  2L9S A;  1BR4 A;  1JHH A;  2X6Y A;  3TP0 A;  4A69 C;  5KAF C;  4J19 A;  2CFX A;  2JQ7 A;  2ELJ A;  3CF2 A;  2Z3Y A;  2M7B A;  2WAQ N;  3KP2 A;  2ZSH B;  4RA2 A;  1DU0 A;  4AIH A;  2PJR B;  2R5Y A;  3OSG A;  2V1X A;  3TBI A;  2KIU A;  2QLZ A; 
#chains in the Genus database with same CATH homology
 1TT0 A;  4NC8 A;  3FKJ A;  2KP6 A;  3DLA A;  4E4H A;  3DPT A;  2DXI A;  2CV2 A;  1BR1 A;  2M4G A;  2V6E A;  3OWT A;  3H9Q A;  2LH9 A;  2X51 A;  1SFK A;  3HC7 A;  4BL0 B;  3K4N A;  3S3O A;  2KMU A;  3HPG A;  2LY2 A;  2HPI A;  4CCK A;  2IS2 A;  4BGD A;  4RMN A;  3NWS A;  1AA7 A;  1FMV A;  2CFO A;  4PFO A;  3OYE A;  3ZCO A;  3M1C A;  2DT6 A;  2DJI A;  4BEH B;  3FBI B;  2M3A A;  4PJL A;  4N4N B;  4XOP A;  2CS3 A;  2XSJ C;  1MNE A;  5CQG A;  4BQN A;  4CCJ A;  4BQQ A;  3I3L A;  2AQF A;  3QOD A;  2RNG A;  1X4P A;  3RQ4 A;  3PFY A;  3PSI A;  3NWT A;  2BW3 A;  4HRI A;  3OYG A;  3VDX A;  4PJM A;  3ZGK A;  2W82 A;  2XF7 A;  3KEY A;  3UR3 C;  4IQ4 A;  2E60 A;  2CW8 A;  3KYL A;  2WA0 A;  1N75 A;  3K4J A;  2X1E A;  3D5R C;  3F9K A;  2VJJ A;  2Z2S B;  1X4O A;  4PJN A;  2UV1 A;  3IUO A;  3H5A A;  4NNJ A;  3VYU B;  3AL0 B;  4XLE A;  3CP8 A;  1EA3 A;  1LKX A;  2BW3 B;  3LSH A;  3LSG A;  3DKX A;  2HQA A;  3CES A;  4F93 B;  1Z7L A;  3H35 A;  3DPL C;  2IGN A;  4OAY A;  1DGW Y;  5TGT A;  3H9G A;  1K6Y A;  4NQW B;  4JOM A;  3BLY A;  2E5N A;  2UUZ A;  2CMP A;  2KRH A;  3QOE A;  4XKB A;  4QPO A;  2DT7 B;  4DOZ A;  2X85 A;  4FET A;  2XF6 A;  4J01 A;  4BE0 A;  1WJF A;  2F4I A;  2QKL B;  3H9J A;  4HPQ A;  4F52 A;  1S9H A;  1BR2 A;  2VLA A;  2VXZ A;  1UG0 A;  3PNT A;  4ZDO A;  3DEE A;  3VYT B;  3ZRG A;  2R7R A;  2NOJ B;  3W2W A;  3LMM A;  2KRC A;  4NC7 A;  3EUA A;  4E7L A;  4E7Z A;  4B47 A;  4AU7 A;  3VSK A;  3BCA A;  2XAU A;  1T0F C;  3D5S C;  4Y4R A;  1WFX A;  3L2Q A;  1MMD A;  3OIQ A;  4ZTF A;  2LC2 A;  3C2H A;  2ZFU A;  2VJI A;  1MMN A;  4CSW A;  4N4O B;  4B48 A;  2LBF A;  3OYJ A;  4PFP A;  2AQE A;  4XKV A;  3M8J A;  1MW7 A;  1BOB A;  2DOA A;  3UNG C;  4E7K A;  3L2V A;  3LL7 A;  2VL8 A;  4DIQ A;  4XR6 A;  5LFA A;  3HOT A;  4LIV A;  1KON A;  4XLF A;  2MAB A;  2PJR A;  4MLO A;  2IXS A;  1J09 A;  4PJJ A;  1LFP A;  3CZ6 A;  3DPU A;  2WAD A;  3OMY A;  2LOO A;  3PJR A;  2BVL A;  1W36 D;  2HZD A;  3PUB A;  4E6K G;  1G8X A;  3OL3 A;  4XNF A;  3DTI A;  1R6R A;  2R7U A;  4YEJ A;  5HVQ C;  2Z1D A;  1QHH D;  4KIT B;  4CZC A;  3OYC A;  3K6G A;  2W7N A;  2HVS A;  1OLT A;  3EPZ A;  2LRD A;  2WAE A;  2VJ4 A;  1DQU A;  1Y56 A;  3E0J B;  2A6T A;  3L2R A;  2R7S A;  1IRX A;  4CCL A;  4D9J A;  2X1D A;  4BEH A;  3FBN B;  2JVH A;  4PSX A;  2MD0 A;  3EUH C;  3VYS B;  2W4S A;  4RM3 A;  3K4L A;  3CJQ B;  2OUM A;  4II2 A;  3DQV C;  3K70 D;  4AVZ A;  1MMG A;  1JI8 A;  4C2T A;  1P9Q C;  1YX3 A;  1OR7 C;  3LSI A;  3ZR8 X;  4J00 A;  5KCM A;  4ZJZ A;  3LFU A;  3MD2 A;  1YE9 A;  2BVM A;  4BDY A;  2VQC A;  3A4C A;  3A1Y A;  3N05 A;  4EAT A;  3K4C A;  2OV7 A;  2R7Q A;  1PJR A;  3S3M A;  3SDB A;  2IS4 A;  4IX7 A;  2M0M A;  1GLN A;  3IAM 2;  2R4G A;  1D1A A;  4F55 A;  2KQR A;  3HOS A;  3IP4 B;  1PYV A;  2IS6 A;  2QKM B;  4R79 A;  3MKW B;  2E1M B;  3PNV A;  2ZXI A;  4Y3O A;  3DU5 A;  3OS0 A;  4HST A;  3H5R A;  4H4K C;  4DJA A;  4C9Y A;  4ANJ A;  1G59 A;  2RQQ A;  3S93 A;  4BE2 A;  2XDV A;  3BC8 A;  4B44 A;  2L2O A;  3FHN A;  3OL4 A;  2K9L A;  4ZYA A;  4PK4 A;  4E7I A;  4CH7 A;  3DWL E;  4XKW A;  3OR2 C;  3OOU A;  4BJT A;  2VXD A;  2E5Z A;  2X6X A;  3RPU D;  2MFZ A;  3FDY A;  2VB6 A;  4YRV A;  1SAU A;  3MKY B;  2R7X A;  2HDW A;  3G2B A;  4E7J A;  1DGR M;  1WJA A;  1DP3 A;  1FMW A;  2MYS A;  2LRE A;  1W36 C;  1VZ0 A;  4JQF A;  2KLO A;  2XF5 A;  4F91 B;  3OYL A;  4F3Q A;  2V7F A;  4XL9 A;  5CQE A;  2X6W A;  4KT6 A;  4CCO A;  4DBR A;  3AKZ A;  2Z16 A;  3LSM A;  3K4K A;  4OWR B;  2DCE A;  3K10 A;  2PMZ A;  4PSW A;  3V42 A;  2VIX A;  4DGW B;  3AFH A;  2M7A A;  1V5E A;  1MMA A;  4IQJ A;  1D0X A;  4NUB A;  5KNL A;  3QYE A;  3MMY B;  2HPM A;  3HPH A;  2R7W A;  2IGM A;  1YX5 A;  1T95 A;  2V9K A;  2E1M C;  1Z21 A;  2I8D A;  3HUG B;  4BJ6 C;  3CMM A;  4KIS A;  3D5L A;  3DTK A;  3HG9 A;  3K70 C;  1LVK A;  4C30 A;  2CUZ A;  3OS2 A;  4XQF A;  3SYT A;  2A5W A;  2CH0 A;  2IS1 A;  1UAA A;  2L9N A;  3PNY A;  3K4M A;  1Z3Y A;  2L7K A;  2JA2 A;  2JSP A;  1Z3X A;  4YEL A;  5FRO A;  2HVR A;  3OYB A;  2WBM A;  4E7H A;  1Y6I A;  1N78 A;  5CPR B;  3E1S A;  1X19 A;  3OS1 A;  1UEL B;  3OYD A;  3S32 A;  1D0Z A;  5LD2 C;  5HOO A;  4XM3 A;  3ONQ A;  3L2W A;  2R7O A;  4B3X A;  4ZDP A;  4BUP A;  3OYN A;  4XMY A;  2IGO A;  4C2U A;  2BOL A;  4U87 A;  2OC6 A;  2WY8 Q;  2JVG A;  2VKH A;  2MC4 A;  1ERD A;  2WAQ A;  4XLA A;  4G6T B;  4HNU A;  5FRN A;  3EUK L;  3VYR B;  3K4B A;  4KJZ A;  2KL4 A;  4CCN A;  2R7T A;  3RCO A;  3HL2 A;  3KX2 A;  3ZXS A;  3BG6 A;  3C2G A;  1NG7 A;  4D1Q A;  1V5F A;  2K9M A;  2XC7 A;  5HNF A;  3TMO A;  3SZG A;  4BE1 A;  4BDZ A;  2K5C A;  1LDK B;  4ZTJ A;  2CW7 A;  3OYM A;  4BU2 A;  2VQG A;  3W2A A;  5CKT A;  3S8P A;  3PSF A;  4RLF A;  4XOT A;  3BCB A;  3DKY A;  5HLT A;  2P0W A;  2KHM A;  5KHD A;  1WJ5 A;  2HNH A;  2KPM A;  1X1B A;  2ZXH A;  5HNH A;  3SEQ A;  3H0D A;  3H5N A;  2VQH A;  2HVQ A;  2WB1 A;  3BG7 A;  2KDO A;  3LSK A;  2GOX B;  1WJB A;  2V1N A;  2VQL A;  4DBQ A;  4RM2 A;  4LIT A;  2X1C A;  3RTR A;  2V4J C;  4XLH A;  2CV1 A;  2V26 A;  4ZDL A;  4XKC A;  2R7V A;  1QHG A;  1U0J A;  1QU3 A;  4HSR A;  3RSN A;  2CUJ A;  4PUS A;  2VAS A;  3S3N A;  2FUG 2;  1MND A;  2VKD A;  1WJC A;  3DTE A;  3OIP A;  2M4K A;  2ZSI B;  3QYF A;  2LG4 A;  1ZEL A;  4QPQ A;  4RLQ A;  4LIU A;  3OYH A;  3OYI A;  3CP2 A;  4B43 A;  3OYA A;  1HA8 A;  2W1O A;  2UWM A;  1E0E A;  2Q2E B;  3OY9 A;  4AYB A;  3HKZ A;  4CCM A;  3OYF A;  2RRE A;  4F92 B;  2IGK A;  4XLC A;  4E7S A;  4II3 A;  4HG2 A;  4OAZ A;  5JHF A;  4FAS D;  2JUG A;  2W00 A;  4ZC3 A;  3W2V A;  3I9V 2;  3QYB A;  4LG3 A;  4CUG A;  2VPL A;  3VSL A;  4XN0 A;  2HU9 A;  2CV0 A;  4XON A;  1V5G A;  4BJ5 C;  3OYK A;  2LY1 A;  2VJ5 A;  3DU6 A;  4BS9 A;  4CA0 A;  1N77 A;  3HXL A;  3U21 A;  1D1B A;  2K3P A;  2F6C A;  2Q1Z B;  2L5Q A;  4U7B A;  3J7A Y;  1X1A A;  3IAS 2;  4Y33 A;  1WJD A;  4XN3 A;  1D0Y A;  1WJE A;  2WAF A;  2F5V A;  2WY7 Q;  3CJR B;  3TL4 X;  4BAC A;  4ITV A;  4IZZ A;  4BQO A;  1D1C A;  4P5O A;  4HNT A;  5FRM A;  3W3C A;  2Y0S A;  3ZQQ A;  4HEA 2;  4XOR A;  4IKF A;  2LBF B;  2LYC A;  1TZL A;  4X0G A;  3AL0 C;  3MKZ A;  3A2K A;  1X1C A;  2GOM A;  3PL8 A;  2O5R A;  2L9S A;  1BR4 A;  2X6Y A;  4BXF A;  3VWB A;  1X1D A;  2ELJ A;  3CF2 A;  3L2U A;  2M7B A;  3SEZ A;  2KZV A;  4P1W A;  1NG6 A;  2ZSH B;  3GBG A;  2PJR B;  3TBI A;  3OR1 C;  4GRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...