3CCLI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cclI00
3I55I 2ZJQF 3CCEI 4V19K 1VQNI 1FOXA 1VQKI 2OTJI 3CJTB 1VQOI 1VQ9I 3CCSI 5DM6F 3CC7I 5GADJ 3CF5F 3I56I 3CCMI 1VQ5I 3CMEI 4UY8I 3CCUI 1YIJI 1FOWA 3J7ZI 3PIPF 2FOWA 3J7YJ 5DM7F 2E36A 3CD6I 5GAHJ 3CC4I 4IOCF 1Y39A 4IO9F 1YJNI 1HC8A 1YJ9I 2QA4I 1VQ7I 1FOYA 1S72I 3DLLF 2QEXI 5JVGF 1YITI 3CCRI 5GAGJ 1VQ8I 3G6EI 3G71I 2NXNB 1YHQI 4IOAF 2E35A 1YI2I 1VQ6I 1ACIA 3CCLI 5GAEJ 2H8WA 2ZJRF 3CCVI 2ZJPF 3PIOF 1VQMI 3G4SI 2K3FA 1VQLI 3CCQI 2OTLI 3CMAI 2E34A 1MMSA 1VQ4I 1YJWI 3CC2I 1VQPI 3CCJI 1QA6A 2JQ7A
chains in the Genus database with same CATH superfamily
1MH4A 1JKRC 1G3YA 3JW4A 5HLGA 3ZQGA 4I0BA 2OCCH 1UG2A 3M8EA 3OSGA 3DEEA 4EGZA 2A5WA 4RA2A 1FZPB 2EIMH 2HXOA 1G6NA 1A04A 2WAFA 4II3A 4LMYA 3OYHA 3GCMA 1ZH5A 4N9HA 5E1ZB 2DA2A 1P7IA 1Z3XA 3HSFA 1I27A 5IP6A 2OC6A 3KX2A 3KP6A 4CYDA 2KJBA 2CU7A 5D6FA 4FE4A 2CQXA 3MKLA 3SXYA 1XN7A 1Y8QB 1LEBA 4BY1J 1FX7A 4ESBA 3BTJA 2L7FP 3FK7A 3C3WA 3CTAA 3ZMSA 2WAEA 2XKOA 3CJQB 3I9V2 4MIMA 2DMUA 2ESHA 4V2FA 2V7FA 5EZHA 2CQNA 2ZMEC 1JTXA 2E1OA 2R7QA 1T0FA 2LFBA 1JHFA 4M6XA 1TWHJ 4XQFA 3HOZJ 3GTKJ 2EIJH 2F5FA 2F5CA 2YS9A 3C7JA 1MZBA 1HKSA 5CVIA 2O61A 2AHQA 2BY0A 1LUJB 2OAZA 1R7JA 3GMEA 1BW5A 5F0FA 2BY1A 4JOMA 1B8IB 4XOTA 5IYBJ 2IJLA 3QODA 5DDGA 3M1CA 1ORKA 2FOKA 1YI2I 3HB9A 2JA6J 2CUFA 2KL4A 2Y9ZA 1QHHD 1KGSA 3CCLI 3BJ6A 4O3MA 3O8HA 4ZDPA 2KIMA 1FIPA 2QF7A 1USTA 2DMNA 2M0MA 5KCMA 1LE8A 2NVYJ 1AA7A 2UUZA 3ABMH 4EATA 4LJZF 2ZFWA 3WTVC 4E7JA 3MKZA 1XX5A 2VL8A 4RM3A 4BH9A 1RZ4A 2KPMA 1JE8A 3RIRA 4KA4A 4JX6A 2FX0A 4AVZA 1ZN2A 1O3TA 3NARA 2Y2ZA 4LLNA 5DD8A 1VQ4I 3BR3A 2P5LC 3CC2I 5HDGA 1JUMA 3K4MA 3UKGA 4PFPA 4UVBA 1EF4A 2MC4A 1SFUA 1WI3A 4J01A 1B59A 4RMNA 1YX5A 2DA5A 1E2XA 2LBFA 2K27A 3AKZA 2JA5J 3VODA 4R8HA 3CC7I 1BOBA 3OR2C 4EVIA 2CQKA 3I56I 4BHBA 5CJ9A 1E3PA 3BJOA 4I09A 3ERMA 2P6TA 4YG2F 4N0BA 2ME6A 1TWGJ 4XSXF 2RDPA 2V9PA 3G73A 2IS6A 4A93J 2VT2A 5M3MJ 1UELB 1ZELA 1Z7UA 4DQ2A 2JK3A 5DCFA 2YX4A 2L9RA 3OYIA 1YLFA 4LIVA 1U3EM 2F4MB 2YX7A 3BWGA 4A3GJ 3E6BA 1R6RA 1U9NA 5CVJA 1R58A 1X1AA 3V7CA 1IXSB 3TDUC 2DFIA 1WQ2A 4XONA 2JSCA 2NS7A 3K4CA 2ETHA 1UHMA 4D5FA 4AIJA 4BHPA 3JRHA 2XV4S 5ICEA 4ZYEA 4ZYGA 2HTJA 3CJRB 4UVCA 2HYJA 2Y0SA 2XRLA 3L9FA 4XLHA 1FYKA 5FGMA 1QPMA 4CZCA 5IP9J 3K0LA 1HDDC 5B66C 5E3MA 1C0WA 2DFFA 2OD5A 2KDZA 4NDLA 4PSWA 4EJUA 3KP2A 4CCNA 2RV8A 5LGNA 1P4AA 1IZ1A 1JGSA 2L9SA 3BR1A 4MLOA 5L3BA 2IGMA 2FRHA 4XKCA 2KMUA 3I0TA 3DTEA 4E7SA 2CFOA 5D5UB 3BR2A 3REOA 2PG4A 4I2OA 3HSEA 5CVUA 3SEZA 5K7FA 4ZTFA 2VBYA 5E17F 3AG4H 3PJRA 5E8IA 1QRYA 3GWZA 3DWLE 5D8LB 3LFUA 3BQYA 1IUFA 2DMQA 4PUSA 4MTDA 1MDMA 4OIOF 3ABTA 5LD2C 2EFPA 5J6XA 2WB1N 3WTZA 2BXZA 1XDSA 3B6CA 4F93B 1D1CA 4DZPA 2E5NA 2ZO4A 3WTUC 1SAUA 4XLCA 3AL0C 4BDYA 1BC8C 2HDDA 5DUIA 1LVKA 3E5QA 1IJWC 4L9TA 1DGWY 2OV7A 2P8TA 2XROA 1YRNA 2HQRA 2YU3A 3NEUA 5HLTA 3GYHX 1Y1VJ 4YIRX 1PDNC 4U0YA 2UZKA 1YYVA 2HU9A 4E70A 2KZVA 2M4GA 3V7SA 1U8RA 1LE8B 4PZJA 4I7HA 1G4DA 4HF2A 4X0GA 1N77A 2R5YB 3BZ6A 4Z6YA 3CZ6A 2XAGA 3TL4X 1ZRCA 2QSFX 1HKQA 2VODA 1Z7LA 3G3ZA 2O8XA 2W48A 1H9GA 4HSRA 4AIHA 1BA5A 2LVSA 1TZLA 4BXFA 1S7AA 2GLOA 2DO7A 2R7FA 4FE7A 4WWCA 4J19A 2ZSHB 4GYGA 2UXXA 2IS1A 2GZWA 3TP3A 3HRUA 2KIQA 3OIQA 3FK6A 4RGRA 5D5XB 3VB2A 2DODA 1OFCX 4BJ6C 3M1EA 3JR9A 2E2IJ 2LBFB 4DGWB 4BXXJ 4E6KG 2ZJ2A 1OCRH 5E20A 1R1TA 5FLXZ 4CGZA 2DYSH 4BKXA 3PSFA 2HDCA 2EIKH 1U0JA 2I8DA 2PX9A 4IVNA 5JVGF 1MSEC 3WG7H 3MKYB 4DW6A 2PQ8A 1P7JA 3HHGA 1VQ8I 1E17A 1OPCA 1SFXA 2EA4A 3G6EI 3ZN1A 2V26A 4AWXB 3BT9A 5B1AH 3OIOA 2BHZA 3JTGA 1IN5A 2JZYA 3D1NI 1HF0A 2R7DA 1AKHA 4BE1A 1U2WA 5J1RA 2L2OA 1YG2A 3ZCOA 1D8KA 3GTPJ 3VFZA 4JQFA 3E6MA 2E1MC 4EV0A 1HDPA 1YW9A 5KHDA 1ZG1A 2DA4A 4UUSB 2CV1A 3FMQA 1W4MA 4E7KA 1ETQA 2XF7A 5CLSA 2FUG2 3QPHA 2MABA 2CO5A 1H0MA 3HEFA 2EFOA 5JI6A 3N97A 2KDOA 2ZMEB 1YS6A 4PFOA 2QZ8A 2M8EA 2F6CA 4EQQA 3QQAA 5IOYA 4LIUA 1L0OC 2RKHA 2X1DA 3EUHA 2CWEA 1IXCA 1RR8C 5CVVA 2G7HA 4EJVA 4E7ZA 3JSPA 3HSRA 3O8GA 1JGGA 3V7RA 3DU6A 2JTVA 2HVSA 1QGPA 3OYMA 4QWQA 3S1RJ 2CUEA 2DA6A 1J7KA 1BIBA 1W7PA 4HX8A 2Z5UA 3ZR8X 3TOBA 2CG4A 3V8KA 1XS9A 4HF0A 3H0DA 5AONA 1MBEA 2A05A 3DLAA 4P9UA 5FROA 1M1EB 4LD5A 2ZB9A 4PJJA 4XRMA 5FLXK 3W3CA 2OZUA 5ILUA 4HF1A 2TDXA 1FOWA 3H3UA 4M3DA 4M9ZA 4B43A 1G3TA 2O9LA 2VXZA 5IT9Z 1MDMB 3F8NA 4RS8A 4LFUA 1I6XA 2DFHA 2W00A 3K9TA 2M7BA 3F0CA 2WADA 4IEJA 4U7DA 3M3YJ 5FD6A 4P5OA 2LLKA 3PO2J 3I64A 3QAHA 2DLLA 4ZH4F 3BZKA 2X4HA 1V5GA 2EZLA 4A3CJ 2DDAA 5GAHJ 2I10A 3JRDA 2MGQA 1YRNB 2EA2A 4L0ZB 2Y9YA 2M2EA 3M8JA 1ZQ3P 3M9AA 1LJ9A 2EV6A 1BC7C 1SAXA 1NG6A 4BE2A 1IRZA 5L3FA 4G7ZF 3PNTA 2QEXI 2QBYA 3KP3A 2IVMA 4KT6A 2CYYA 2ZNYA 2PJRA 2VE9A 3E6CC 4KIGA 4L9VA 1G2HA 3GX4X 3P9IA 2IA1A 1HQCA 2ID6A 2O5RA 3LQQA 3S1NJ 3HGGA 1SD6A 2GXBA 3RJPA 1PUEE 2XPVA 4JBAA 5BOXA 2KRCA 1JXSA 3KLOA 4PCQA 2QLZA 5J1YA 3OYGA 2XGCA 2HPIA 3JCUC 1IRFA 5D4SA 4EEFG 2QCOA 4R1HA 2P7CB 2B63J 1E0EA 3ZMDA 2IA0A 1PP8F 3TGNA 4QIWN 4FHTA 1DUXC 2DT7B 4QPQA 4C30A 4RAGA 5LHGA 3LA2A 2TRTA 4WXCA 2GOXB 2DTZA 2Z1DA 1U9OA 1GVDA 1OCOH 2MA3A 1B72A 4XRSG 2FE3A 2VE8A 4II2A 4BQAA 4XKBA 2M34A 5LHHA 2CUZA 3LA7A 3OOUA 1SFOJ 4GRIA 1ONVA 2VQCA 2VJIA 5HOOA 1JT0A 4RM2A 3HTSB 3LWFA 3F72A 2IGOA 3OS0A 3MVPA 5H20A 2H27A 2EK5A 3CCEI 2ELJA 4DYCA 5JVTA 1AKHB 1J9IA 2LKSA 4CZZA 1YIOA 4YRVA 2RQPA 3GF2A 5E18F 1OKRA 1XMKA 2CW0F 5FRMA 4HRIA 2M1BA 3DTIA 5EEAA 3S3NA 1WJCA 2L4AA 2JSPA 3FZVA 3KIOA 5IYCJ 5J4VA 3KP7A 1J59A 3BTCA 4CCMA 3FXJA 4MEXF 3FBIB 1F36A 3HPHA 5ICGA 3R0JA 2HTSA 1DPUA 2Y0MA 2DOFA 2ZXHA 1REPC 5A2QZ 4F52A 2HKXA 2OF7A 5FRNA 3FHNA 4ANJA 1Y6IA 2XB5A 1XSXA 3HGYA 2FOWA 2DK8A 4PJ0C 3RQ4A 3ZXSA 2VXDA 3PNYA 2Y0SN 4BGDA 4MQVA 1D1BA 4HNTA 4XLPF 1S8NA 4M9XA 3VWBA 4HLXA 1F4KA 1X1PA 3AL0B 3AFHA 1NK3P 1YJ9I 2E7XA 1XMAA 3MKWB 2HOSA 3BCBA 1FOYA 4P1WA 1W0UA 3P5JA 1Z3YA 4F7ZA 3CP2A 4NUBA 3KE2A 4F91B 1ETOA 3QOPA 1YITI 3FXQA 1JJ6C 3ZQLA 1G59A 4RDUA 4TV7A 4KIFA 1RKWA 4F3QA 2X6WA 3WHCA 4FQGA 1POGA 1J5YA 2WWYA 4ZZLA 2O7OA 3CMMA 1EJ9A 2E35A 5FLVA 1V3FA 2BY3A 3VSKA 2QQBA 3DKYA 3CUQC 4QPOA 2GWRA 3C2HA 1WJFA 1SD4A 3RCOA 1ERDA 3GTLJ 1Z0XA 4XSZF 3CCVI 1MKMA 1B6AA 1VQMI 1DU0A 3R6SA 3DU5A 1R1VA 1ZG3A 3GBGA 1BL0A 2P5KA 3HC7A 1BN5A 1ETXA 3QPSA 1AWCA 2ELHA 3KEQA 3COAC 1STZA 4OOIA 3BR5A 1BJAA 2L5QA 3MQ0A 1P92A 3SEQA 2ISYA 3ROUA 1Q1VA 3PUFA 1WKMA 2DA3A 4DOZA 1O7LA 3FXKA 1W1WE 5H6QA 3W6KB 3WU1B 4G8XA 3GTQJ 3NWSA 1S29A 2Y69H 2QBYB 5HS7A 1K4SA 3R61A 4GXOA 2KZGA 4GO1A 3RPQA 5A2QK 4Q5SF 3ERED 2PJRB 1VQPI 2F2EA 3ESWB 3K1MA 3S16J 4BDZA 5B3SH 2AO9A 1UJ8A 3CF2A 1D5VA 4M3GA 4MFEA 1WH7A 1LPQA 1D5YA 1CQTA 1FOXA 1HOMA 5F6FA 4D5CA 4HOBA 5LGTA 2BVMA 2OTJI 2FMLA 1GV2A 3S3OA 3SZTA 2IPQX 2E1MB 2NVQJ 1IO2A 4UUVA 3SDBA 4IX7A 3J7AY 2F5DA 1P4XA 2V79A 3BR6A 3T8TA 4G9YA 3J81K 1RUOA 2VKEA 4ZDLA 4G6DA 2JUCA 1RRJA 1UB9A 2GQQA 2BW3B 3A0HC 1BBYA 3S2WA 3K2AA 5HLHA 3H1CA 3P7NA 1SANA 2G7UA 1R9TJ 4ENNA 5K5QA 3QU6A 2X0LA 2MH9A 3OYCA 3C1DA 1FBSA 3HPGA 4CYCA 2PI0A 3TMOA 4CH7A 1IF1A 5J8FA 2ZC2A 1Y56A 3KFWX 4LK0F 2EJRA 1FPQA 1UMQA 2E60A 2Q2EA 3DLLF 3ZGKA 3CDLA 4KDPA 2FU4A 1TW3A 1VF9A 2MD0A 3S17J 5KK1A 3CCRI 3W2AA 2V1XA 5L3CA 3J80Z 1MW7A 1JTYA 5K5RA 4OIPF 1WJAA 5EYRA 1YHQI 4S04A 3MZ8A 2ECCA 1IW7F 3HRTA 1TLHB 1FOKA 1JUPA 1VQ6I 2MYSA 1TQMA 2HOEA 3OL3A 2H8WA 4WF2A 2K02A 3CUQA 3OWTA 2R3SA 4XKVA 1A6QA 2AXTC 4XN0A 4PJNA 3SHFA 3KP5A 1T2KA 1X2MA 4P9FA 2DXIA 2F5EA 2H94A 3F8BA 4MGRA 4ZYAA 1IN7A 4NHJA 2XGDA 3FXMA 2LF7A 1FNNA 1FBUA 3F8CA 4I0AA 1Z67A 2VJJA 3Q5FA 3P9KA 4A12A 4IF4A 2KP6A 4HA8A 3I3LA 1WHUA 2LH9A 1U5TC 1OJLA 3EDPA 4NB5A 4B47A 3HRMA 3ULQB 4IQ4A 3I4PA 1Y1WJ 2Q0OA 4ETSA 3M07A 1GVJA 2IS4A 4P55A 1GXPA 2LR8A 3OYKA 4LLGF 4MEYF 3T1BA 1Y0UA 1DP7P 2LP0A 5E1XA 1NHAA 2R5YA 4V19K 2ICWG 3GEZA 2P5VA 3HM5A 1SMTA 2V1DA 4GGGA 4A0ZA 3J7AO 2HKOA 2MFZA 2CV0A 1Y0NA 4UHTA 4M3BA 2H6BA 2OPTA 2VKDA 2FEZA 1IG7A 4EJTA 2L0KA 1J0RA 3IH2A 5DM6F 1ZHFA 2K85A 5GADJ 1I1GA 2UXNA 4G6QA 2VBZA 3L2QA 1X4PA 2OQGA 5H6RA 2HEOA 5JHFA 2M4KA 1ON2A 2HWVA 5IOZA 1O57A 1OCTC 3QYBA 5JLXA 2YU9J 3TOAA 4CXFA 3J7ZI 1Z05A 3K4BA 4L9JA 3NAUA 2WY8Q 4A3MJ 1OLTA 1U8BA 2QUFA 3J80K 2A5YB 1FMWA 4R79A 2M3AA 3JRAA 3S1QJ 2XGEA 3KYLA 3IH4A 4XMYA 4F92B 3N4MA 2Z99A 3K2ZA 3CC4I 3TEDA 2AQEA 3OYDA 1D8JA 1YJNI 3BPVA 4B48A 3JREA 1I3QJ 2HYGD 4A3BJ 5BPIA 2HQAA 2DYRH 4PGGA 1IN6A 2NAZA 4UB8C 2MLGA 2WV1A 4BBSJ 5DCMB 1A36A 4D7MA 3RI4A 5BQTA 3LSTA 2DMTA 4PK4A 1HXDA 5M5XJ 5HS8A 3S2DJ 4C2TA 4DNCA 1KU3A 4UUSA 4IXAA 4IHYA 2CH0A 1ZYRF 3A03A 1EA3A 2IRFG 5FFXA 5FO5A 4RB2C 4UUTA 1QZYA 3I5UA 1XTAA 5LRSA 1QBJA 1QU3A 5DTDA 2PN6A 4IRHA 2ZMEA 4IZZA 4CYCB 5C4JJ 3DFGA 2DN0A 2QYOA 1FWZA 2XRNA 5C3EJ 1UCRA 1WWXA 1Z77A 2K86A 4Y33A 1MBGA 5K7ZA 2V1UA 2XASA 2GM4A 1X1CA 4UXNA 3KLNA 3OY9A 1KZHA 4LGWA 4BAYA 2M8GX 5EGOB 3LSKA 4WXDA 3L1PA 2Q2EB 2LD5A 1XC5A 2STTA 1ULYA 1ENHA 3BOQA 1TW2A 3KZZA 1YFHA 4L0YB 2FBKA 4BJ5C 5JHUA 4J00A 2DI3A 2ID3A 4LB6B 1XPXA 3I71A 2R7VA 3B02A 3OYBA 1D0XA 4PGHA 1SD5A 1YTYA 3SYTA 2YUSA 3CUQB 3HJEA 5LLQA 1K6YA 4A3DJ 3JRIA 3DBHB 2FD5A 1APLC 4KUMA 4E4HA 3R0AA 3K10A 3GTOJ 1LFPA 2EV5A 3QWLA 3CF5F 2E2JJ 1X3UA 2PMZA 2R7SA 2Z16A 1ZR2A 1QPIA 3M4OJ 2CS3A 2JN6A 3RQIA 1VQ5I 4UY8I 1W7PD 2VOPA 2EQRA 3MCZA 3L2UA 1D0ZA 2I5UA 1X2NA 5BS6A 2PJPA 4HX7A 1R23A 1OMIA 4RAZA 1IV8A 2EFWA 2HZDA 3ECOA 2NOJB 3OYEA 1HW1A 1OR7C 5D5WB 2QVOA 1FBQA 1XCVA 5F0HA 2KISA 1R00A 2KFDA 5HDKA 3WU0A 2WAQA 2XB0X 2XUBA 2IW5A 2PFBA 2YPRA 4LOCA 1RUNA 4D1QA 5DYMA 2JA7J 1OYYA 3HYIA 4Y15A 2VBXA 3RPUA 4HAMA 1A6IA 2GBYA 1WCMJ 3A01A 1Q1HA 4CO8A 1WPKA 3DPUA 2VUMJ 2X1CA 4G94A 2P7VB 5HLIA 3EUKL 2QKMB 1PJRA 3FM5A 4IOAF 2EZHA 3I54A 4A6DA 4HNVA 5ED4A 2L01A 1ZGJA 4FX0A 5LBQA 1H88C 4HDVA 6PAXA 2ACJA 3SFIA 4AUXA 1KA8A 1FYLA 2EINH 2EFNA 2EILH 2ZJPF 3IKVA 3SQNA 2HFHA 5J3LA 3I4MJ 4I98B 2HDWA 4HBLA 4M73A 1PP7U 5CQEA 4I6ZA 3OL4A 2MC3A 4C3IJ 1XD7A 2KT0A 3HTUA 1TT5B 4MNUA 1WZ2A 2KIFA 1VQLI 3BLYA 3PO3J 3L00A 2HYFA 1I50J 1QZEA 3LA3A 1U78A 3E6DA 3H9JA 4EM0B 4DYQA 2VB6A 3GFJA 2STWA 2Y30A 1WSUA 1DQUA 1D0YA 4A3LJ 4C2UA 4BACA 2K9LA 5F04A 2BVLA 5TJJA 2P6SA 2CW7A 2A68F 1XMXA 4C2MJ 1PUFA 1OYWA 1JJ8C 3JAMZ 1ZREA 2X6OA 3LSHA 3VYSB 2CJJA 2E1CA 3BZCA 1LDKB 2AQFA 2JWTA 3WTWC 4W97A 3DBRB 1Y8RB 4MHGA 2K9NA 1T38A 3LL7A 3ABUA 3KEYA 2F4IA 2ZNZA 1EV7A 1TWCJ 4NQWA 2HPMA 4PDKA 1R5ID 1SVOA 3BTLA 3ZQFA 5FLMJ 1FTZA 2LMDA 4XLNF 4KMFA 4OAYA 1QNTA 2QSHX 2K7LA 2DQRA 2OZ6A 1Z91A 3PIPF 1R36A 2LDUA 3BTIA 2ELKA 4UV9A 1MNMC 1WGXA 2BGCA 2K4JA 3ZQHA 3C18A 3OV8A 4XICA 1ITYA 3CD6I 5F08A 1K6OA 3IV5A 4M71A 4ZZDA 3F22A 1OR7A 5CYVA 2E19A 2LKXA 2FMYA 4IOCF 1GUUA 1EH6A 4X6AJ 3LSGA 4M3FA 2NVXJ 1IGNA 2COMA 2MBFA 4YFXF 4A3JJ 3DBLB 4EGYA 2EV0A 2P0WA 1HA8A 5FFZA 1X19A 4UVAA 3LFKA 2VIXA 4ZTJA 1ZKGA 5DD4A 1JUSA 3BDDA 3BJAA 3M7GA 3IP4B 4Z2YA 4M3EA 3FM3A 3BY6A 3HKZA 1R5HA 2GA1A 1V5EA 3CLQA 4Y17A 3G71I 4XM3A 1LVAA 5K7HA 1GT0C 3AG1H 1SMYF 3FMSA 2WTEA 3S8PA 2A3SA 1VZ0A 4MQ9F 1Z6RA 4ENKA 3IAS2 3KEOA 2ZJRF 2DJIA 3FBNB 4BE0A 4U7BA 1SFKA 3BG5A 1TQIA 3BROA 5FKNA 1YE9A 2AS5F 3LSIA 1ZLJA 1SFEA 5BPDA 2XIGA 4ZC3A 2CGPA 5F1RA 3CMAI 1V5FA 4IHXA 3D0SA 4N4NB 1RC9A 5EEGA 1BI2A 1FYMA 1MMSA 3H5NA 2L9VA 3DPLC 3TP0A 2JT1A 3RKXA 3A01B 5LGUA 2FXAA 3W6JB 1F5TA 3GTMJ 1BOAA 4OU0A 4IPAA 2W1OA 1QA6A 1SD7A 1TWFJ 3ASNH 4FTHA 3HXLA 2EH3A 2ISZA 3G1MA 4NNJA 4E7HA 3L2CA 3HOSA 3OR1C 4RAYA 1LDJA 1VQNI 2ESNA 5LEJA 5FB2A 1S6LA 1TQPA 3HHHA 3SZPA 3K70D 1ON1A 1X4OA 4DBQA 3OS2A 2BW3A 3G2BA 4MTEA 5E3NA 4BU2A 3IRRA 4YIIA 1MMDA 4AIDA 4LK1F 1OCCH 4DJAA 2KJCA 5J47A 4B09A 3FHZA 2M30A 4H4KC 1FLIA 4ESFA 4BNCA 5IT9K 1BI0A 3FF5A 4IHSA 1R71A 3RKQA 2GIVA 4EJOA 1G8XA 3HBLA 2JRTA 1V54H 3CO7C 2CQQA 2GXGA 2NS0A 3HOTA 3CDHA 4HQEA 1K79A 1T98A 2EPFA 4XL9A 4DZJA 2Y31A 5ICFA 3NQOA 3WTTC 1TNTA 2DT5A 3RSNA 3FWEA 5C4XJ 3JRCA 1XDUA 3SJMA 1PUFB 4FT8A 5FJ8J 1K78B 2H1LA 1JI8A 4CCKA 2IT0A 3HOXJ 4A6EA 4RAFA 2L7MP 3KPHA 2QA4I 2M9HA 2TCTA 3PFIA 3WTYC 5KAFC 2OJED 3M8FA 4Q48A 4XK4A 2HQ5A 1X3WB 4FCYA 4NQWB 2HZTA 1WVRA 2JMWA 2IEKA 4XOPA 1KQ9A 1VFCA 4XLFA 1X1DA 1MJAA 3HDDA 4IHWA 4S05A 4Y4RA 2MSYA 1WJDA 1XSVA 3U1KA 2HXIA 1ZAOA 3K1PA 2VQGA 2Q1ZB 3ZRGA 1O4XA 3PIOF 1NG7A 5LRRA 4LB5A 1IV6A 3B73A 2QSGX 3N05A 2IGNA 1X58A 4A0YA 2NRAC 5LEKA 4YFKF 1MBJA 2F5VA 2LG4A 3RZDJ 3T8RA 3K7AJ 1D3YA 2XPUA 2H09A 1BR1A 2LREA 3QYFA 4I76A 1W36D 2QWWA 2KKOA 4AYBA 4LG3A 2VI6A 1E3HA 2JVGA 3GFIA 2PMZN 3WE3A 3WTSC 1F9NA 2QQ8A 3DXJF 2KQRA 4YFNF 1MBKA 1LKXA 2RREA 3QP6A 2HS5A 4O6JA 1DPRA 1OCPA 2X9DA 3X2QH 2RNGA 1TWAJ 4ON0A 4KN4X 4B44A 4V2GA 1HW2A 4LITA 1MMNA 4G7HF 1KQ8A 5C44J 3GLLA 4FASD 2G0EA 3S1MJ 4BJTA 3CJTB 5HVQC 5JR3A 1IN8A 2VPRA 4BL0B 2FA5A 2X85A 2RNJA 3PM1A 1SVMA 3Q0VA 1QO0D 3Q0UA 1T0FC 2X48A 2XHKA 3I59A 2WAQN 3UNGC 2L7KA 3OYFA 3CMEI 1N75A 3L09A 2DOEA 3JSOA 3S32A 1YIJI 3MFKA 1O3SA 2CRGA 3S93A 3RKWA 1OYIA 2RVCA 2PMUA 4AIKA 3P9CA 2K40A 2O03A 3K69A 4BUPA 1K4TA 4LG0B 3BPXA 4Y52J 1TP4A 3BG7A 2R0QC 4FETA 5K1YA 3DCFA 4RB1A 2VC1A 2VQLA 3CUOA 3TKYA 3W2VA 2Z9OA 2QENA 2L9NA 5DV5A 4M6VA 1RPWA 5DCMA 1FMVA 3E5UA 1XB4A 3LAJA 1Y39A 1NK2P 2DMPA 3QPTA 4D0PA 4IRGA 5TGTA 1ZARA 1HSJA 3GUDA 3RDIA 1A31A 2M0CA 4K2EA 3CP8A 2W85A 3HOUJ 5K5OA 2OQRA 3H92A 5GP9A 2KRFA 5BNGA 1MJ9A 3C2GA 3CQZJ 1I3AA 1IUYA 5EEHA 3ZMZA 1QHGA 2BBYA 1VTNC 4RGUA 2E5ZA 5J8CA 2F4OB 4A3IJ 5GAEJ 2XGXA 4HSTA 1ZGWA 1B9NA 2N8GA 3O2PE 4AC0A 4BEHB 2FQ3A 3BG3A 1OQYA 5FKOA 3K4KA 1U6GA 5EGOA 3E97A 3ZPLA 4OINF 1R4MB 3HIFA 1O7FA 4XLAA 5ILSA 3MWMA 2R93J 1K83J 1GDTA 2ZFUA 1H8AC 2M45A 2YSRA 3HUGA 2VJ5A 2UWMA 2Q8KA 3WODF 4E7IA 1RETA 1Z6TA 2LY1A 4M6YA 3EPZA 2QM3A 3ZQCA 3O3KA 4OWRB 3QP5A 1ETYA 4IQJA 2BHYA 3D5LA 3HOWJ 2A6EF 2CUJA 1MH3A 4AU7A 3WGGA 1OISA 4DYRA 1H89C 2DBBA 4BHCA 2VN2A 3A1YA 4BYYA 5KAIC 4IKFA 5D5VB 4B3AA 2DT6A 3VYUB 2YR2A 1UAAA 1ZLKA 2ZXIA 3U1DA 3QU3A 1KQ0A 3T0YA 2QGUA 3ABKH 4L9NA 3K6GA 2A6HF 1P6RA 2DU9A 2JRMA 4IL6C 3Q9SA 3B6AA 3ZMUA 2IBDA 1A5JA 5JFRA 2H8RA 5F1JA 5IY5H 1NTCA 1N78A 1WJEA 4WXHA 4RB3C 2DA7A 3PQJA 5ILVA 2LY2A 3HOYJ 1YQAA 3E0JB 1W5TA 1RI7A 2VKHA 2X1EA 3OMYA 2W7NA 2JA8J 1ETVA 2E7WA 3KZIC 1HLVA 2LYCA 3RKYA 5E79C 2NS8A 1O3QA 1J2XA 1X1BA 3EETA 3MN2A 4OMZA 4UB6C 4LLLA 2RAEA 3K4NA 3HKZN 1YW7A 4XRSA 2LRDA 2V9VA 2R7TA 2R7OA 4KITB 2LC2A 1R22A 3WG9A 2GXAA 3G1OA 3OSFA 4XIDA 2K3PA 3ZMVA 3EYIA 1WFXA 4L5JA 4IO9F 2LSOA 3TW7A 2B9SA 2VKVA 3D5RC 4M72A 5AIPA 1T8IA 1YW8A 4G6TB 2DA1A 2LF8A 1FSEA 5DS9A 4ITVA 5FKLA 1YS7A 2HGCA 3ONQA 4A3FJ 3K4LA 2V6EA 4XNFA 1IRXA 4QLCU 2FSWA 1FIAA 2CMPA 3NRVA 3OYAA 3I59B 3GVAA 2VBWA 3VYTB 4RGSA 4JP0A 4D9JA 2MD5A 4M74A 3RPUD 4HG2A 4WK8F 1V55H 2XC7A 1RESA 1IXRC 1S3JA 1BJZA 1HBXG 1XGMA 3OOPA 2HOAA 3PL8A 1IC8A 4I02A 2MG4A 2OU2A 1MD0A 2D1HA 3ZN0A 4HV6A 1XSDA 2OBPA 2XAQA 3H35A 2NVTJ 2K4BA 2A07F 2UV1A 3IH3A 3OYJA 1FJLA 4ZDOA 3KYDB 2L02A 3LSJA 1HCRA 2QQAA 3IWZA 3PSIA 2K9QA 3H36A 1MMGA 3V8JA 3CCQI 4S0HB 2ZXJA 2FBIA 3DTKA 1USSA 1MSFC 1FSHA 2R5ZA 1N25A 2M7AA 1BI1A 2BEOA 4KFCA 4F55A 2QQ9A 3W2WA 4U0VA 1PYVA 2XAFA 2BY2A 4GDFA 3CLOA 4ZJZA 3V42A 4JYKA 1WJ5A 3E7LA 2ME0A 4U0WA 1S5LC 2R4GA 2XPWA 5E3OA 3O6BB 5M5YJ 2V4JC 3G1LA 3CCJI 1D1AA 2JQ7A 1G3SA 1W0TA 4WX9A 3VOEA 1KYZA 4B8XA 4NC8A 4BQNA 3A2KA 2H6CA 4OMYA 4AM3A 4CUGA 2IGKA 4IHVA 1VQOI 1VQ9I 2R7UA 3LMMA 3L2WA 2PLYA 2MW8A 2VLAA 4A2UA 4CCOA 4X1EA 1LDDA 1U5TA 4H0EA 1EH7A 1BIAA 3WE2A 2Y75A 2X51A 2W82A 3CCMI 2LK2A 2Y48A 4CDGA 4CICA 3PUBA 4KMUX 3OYLA 3HOVJ 2VASA 3HUGB 4NC6A 2C6YA 2GAUA 5J4YA 3L2RA 3ZQIA 3IL2A 3F8MA 2O8KA 1GV5A 5KNLA 3J7YJ 2L4MA 2LY9A 1RNLA 3I4NJ 1FT9A 4C9YA 4OIQF 3SZGA 1KU7A 1UHWA 3SFZA 1ZTRA 1CF7A 3Q9VA 3TO6A 4C3JJ 2CFXA 3TDZC 1DGRM 1DDNA 1T39A 5ICCA 5M5WJ 1UFMA 3TO7A 3H0GJ 3IRQA 3DEWA 1QZZA 1TT0A 2X6XA 5IYDJ 2VT3A 3HG9A 1B1BA 4U88A 5HNFA 2VQHA 5D6EA 1RKTA 1XG1A 3U21A 3QRFF 1JKOC 2XF6A 2NNYA 2P4WA 5AIQA 5L3DA 2R7XA 4MFDA 1LB2A 3FXLA 1IRGA 2PBIA 2VC0A 1MBFA 5LFAA 2CW8A 3QPLA 3R4KA 2NNNA 4KN7X 3TBIA 3ASOH 5IPAA 2ZXWH 3UR3C 2ECBA 3EUHC 2H1KA 1DU6A 1EKEA 4RLQA 3H5AA 3FISA 2EBIA 4AYBN 4A5NA 2GIZA 4RGXA 3JRBA 2RN7A 2EZIA 3FDYA 3EUAA 2A69F 1SEUA 2KLOA 2E1NA 3FIWA 3DQVC 1TL8A 3G4SI 4XLEA 3ZQQA 2D2WA 4Y7NJ 2G9WA 2XKPA 5L3EA 4E7LA 4PJLA 3TO9A 3ZP5A 4BY7J 3CESA 1F43A 5HNHA 2BYVE 5M3FJ 1PVEA 4ABZA 2PMHA 3EYYA 4YELA 3WHBA 3E5XA 3FKIJ 4KISA 3H3ZA 4MO7A 1YJWI 5ERIA 3GFMA 2W25A 1I5ZA 4WCGA 3OIPA 2O3FA 4I01A 3RZOJ 5EG0A 4PJMA 2DDBA 1KYWA 2DCEA 2BV6A 5BMZA 3GTJJ 2QKLB 3CDIA 3PQKA 3QYEA 1MIJA 4CCJA 3QOEA 4N9IA 2M87A 2FNAA 2DK5A 2XDVA 3IHUA 2R7RA 2JPCA 5L3GA 2VJ4A 1OCZH 2MH2A 3IC7A 2PEXA 4ZYDA 3MD2A 4EM1A 1ZRFA 3IAM2 9ANTA 3V8LA 3ZQ7A 1GLNA 2R5ZB 2Z3YA 4ENJA 5GPAA 4BXUA 2RGVA 1K78A 2R7ZJ 2V6CA 2D45A 3F6OA 4G12A 2E36A 2OCEA 2WY7Q 4Q4ZF 1T6SA 2GOMA 3GXOA 2W84A 2B0LA 5CVRA 2CQ7A 4EM2A 4XORA 5HDNA 5TRDA 2XVCA 4HNUA 1ACIA 1MNDA 1UZCA 3LSMA 3LNQA 4ENMA 1AOYA 2KRHA 5TISC 1YO5C 1MBHA 3DP7A 2V9KA 1JKQC 2ZBKA 2ZCWA 1R1UA 1MNEA 1U5TB 5FKMA 2J5OA 2P81A 1S7OA 2WBMA 4CSWA 3HL2A 2XSDC 4HW0A 3CMYA 3ZMTA 2NXNB 4JX5A 5HS9A 3HRSA 2F48A 1XCBA 1HKTA 3AAFA 3K4JA 1P2FA 2BXYA 2DFEA 1FP2A 5KVRA 4OAZA 3VPRA 2JUGA 1J09A 1Z9CA 1QVUA 4ZYHA 1ZG5A 3GZNB 3VYRB 3C2BA 1ODDA 1DP3A 2A61A 3V4GA 1CF7B 2DQLA 2XAUA 3U2RA 3WGIA 3MAJA 1BR4A 2VPLA 2K3FA 3RYPA 1YX3A 2K5CA 2HOTA 2LKPA 3L7WA 4A3EJ 1WRJA 1TBXA 3TQNA 3BQZA 1ZGAA 2A6TA 5CQGA 3F3XA 4JK1X 4B1RA 4CCLA 2IXSA 2ZKZA 4A69C 1IN4A 2HNHA 2RQQA 2DTRA 3RTRA 3BCAA 4Q47A 2LOOA 5H2FC 5EJCA 3LSRA 1GXQA 5GTHC 4UNOA 3MEXA 2IAIA 5D8KB 4GCVA 3JAMK 4C3HJ 1K7AA 5EF6A 5F64A 2JA2A 2HVQA 2KIUA 1UG0A 3GFLA 4JX4A 4YIFA 3GW2A 2CV2A 2VONA 2WA0A 2D5VA 5D4RA 1IAWA 4QTRA 2COBA 1MGTA 1VQKI 1GHCA 3S15J 1FY7A 1T33A 1T56A 1Z1DA 2EWNA 2DOAA 5EZGA 5CKTA 5DEQA 5JLWA 1E3OC 3DV8A 3GZ6A 2ADUA 4LG0A 4P96A 1XGSA 3MMYB 3KETA 3L2VA 3FXRA 1BR2A 5F27A 3LSPA 1V4RA 2IS2A 2AXLA 4FISA 3DKWA 4AD9A 3KZYA 3ABLH 3E3VA 2W24A 2O6GE 4Y13A 5FD5A 1I6HJ 2L3DA 5LHIA 3D5SC 1ZRDA 1RR7A 2BOLA 4KT5C 3AG3H 1W5CC 3H9GA 5IT3A 4EJWA 3DPTA 1HSTA 4ESJA 4HEA2 2MLKA 1L3LA 2JPBA 3PNVA 4B3XA 2EFQA 2HI3A 3E1SA 5J40A 3W6VA 3AG2H 1AHDP 2XAHA 4B4CA 5EG0B 2NVUB 4O5VA 5EDNA 1IDYA 1T95A 4GYIA 3GTGJ 3S2HJ 1BW6A 1WH5A 4RBOA 4D7NA 1VQ7I 5FKKA 2HVRA 2X6YA 3Q0WA 3DF8A 4CHUA 4XR6A 2GA2A 2FF4A 1ETKA 2J5PA 3BC8A 4BQOA 3HZJA 2W57A 1S7EA 1R4NB 3I58A 4BEHA 5GAGJ 1FTTA 3F23A 3GLXA 1TNSA 2LTPA 1O3RA 3LQRA 3SDGA 3Q3SA 1J75A 1R49A 1AU7A 3K70C 1LFUP 4KICA 3CJNA 5J1UA 4KYWA 4HLYA 4XN3A 2DAOA 1T08B 3VSLA 2OA4A 3A4CA 1G3WA 4HQMA 4IRIA 4M9SA 3T5XA 1SC7A 1IDZA 3S14J 3EQLF 4HX4A 4RB0A 3TW6A 3ZOBA 5GTIC 2DJNA 3LAPA 2W4SA 5CPRB 4A3KJ 4IJAA 1X3ZB 2V1NA 1ETWA 1R5GA 1TTYA 1MJBA 2FQ4A 4DBRA 4HDUA 1KONA 3F8FA 4DIQA 1RIOH 2BZTA 3FXUA 4OIRF 3CO6C 4U87A 5GPCA 1S9HA 1EH8A 2XAJA 4Y3OA 4A5MA 1I39A 4HZFA 3NWTA 3WU2C 2K9MA 4XKWA 1K61A 1JT6A 3I55I 1JHHA 1P9QC 3LOCA 2ZJQF 3ML6A 1YOVB 3H3VK 1F1ZA 1KU2A 4I99C 5DUKA 3PFYA 4AVPA 2DW4A 3A02A 3I53A 1ZR4A 1KU9A 3KYCB 4CA0A 2DPUA 2Z2SB 1VI0A 1LEAA 1WI9A 5HODA 1WJBA 3CCSI 3VEPA 2WB1A 2Z33A 2BE5F 4UV8A 1VNDA 1B8IA 2O0YA 2ZSIB 4QSHA 3J81Z 1H9TA 3IWFA 1W7PB 4NC7A 4G7OF 3CCUI 2JJ7A 2R7WA 1UHSA 1TC3C 3H9QA 1Z21A 3JTHA 4FX4A 3A0BC 2XF5A 5DM7F 3OYNA 3F21A 4EMSA 2M5WA 3ELKA 4GFBA 2E71A 2LNBA 2D1VA 4XBFA 3WGHA 3IKTA 1CGPA 1ZK8A 3BR0A 1I1SA 3BG6A 3FMRA 2DPDA 1FC3A 3H5RA 2NOGA 1FEXA 2FNPA 1HC8A 1QVTA 2IA2A 3ECHA 1JKPC 3ISPA 4L5IA 1SVLA 1W36C 4L5EA 2L54A 4W1UA 1S72I 4NBQA 3JRFA 1A35A 2FJ1A 3S3MA 1B9MA 4KNYA 3F9KA 3WTXC 4PSXA 3MZHA 3MZYA 4BBRJ 3GZ5A 1MMAA 2WV0A 2L7ZA 2FBHA 1LQ1A 3FXOA 2JVHA 3U9GA 4KJZA 1BI3A 3BP8A 3FX3A 4BS9A 2HQNA 4HPQA 5B5EC 3CCYA 4ASNA 1BM9A 4IHTA 3JRGA 4A0XA 5B1BH 2VOOA 5E3LA 1XGNA 2IP2A 4L18B 1W5SA 2XSJC 3IUOA 2WC2A 2R92J 5F0CA 1B4AA 5E1WA 1NH3A 3DEUA 2KHMA 3KP4A 3FKJA 3KCCA 1LNWA 3OS1A 2EZKA 2K9SA 4HYEA 2RC4A 4RLFA 1QQIA 2OTLI 5E8GA 4XRFA 1XGOA 3K1NA 5IP7J 2E2HJ 3DKXA 2EB7A 2E34A 3F6VA 1LFBA 4BQQA 3BG9A 4N4OB 2CSOA 4KIBA 1P4WA 4YEJA 2OUMA 3RYRA 2NYXA 1B72B 1HW5A 2B7EA 4HV5A 2HR3A 3R60A 3VDXA 3GO5A 1FP1D
chains in the Genus database with same CATH topology
3I55I 2ZJQF 3CCEI 4V19K 1VQNI 1FOXA 1VQKI 2OTJI 3CJTB 1VQOI 1VQ9I 3CCSI 5DM6F 3CC7I 5GADJ 3CF5F 3I56I 3CCMI 1VQ5I 3CMEI 4UY8I 3CCUI 1YIJI 1FOWA 3J7ZI 3PIPF 2FOWA 3J7YJ 5DM7F 2E36A 3CD6I 5GAHJ 3CC4I 4IOCF 1Y39A 4IO9F 1YJNI 1HC8A 1YJ9I 2QA4I 1VQ7I 1FOYA 1S72I 3DLLF 2QEXI 5JVGF 1YITI 3CCRI 5GAGJ 1VQ8I 3G6EI 3G71I 2NXNB 1YHQI 4IOAF 2E35A 1YI2I 1VQ6I 1ACIA 3CCLI 5GAEJ 2H8WA 2ZJRF 3CCVI 2ZJPF 3PIOF 1VQMI 3G4SI 2K3FA 1VQLI 3CCQI 2OTLI 3CMAI 2E34A 1MMSA 1VQ4I 1YJWI 3CC2I 1VQPI 3CCJI 1QA6A 2JQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 I;  2ZJQ F;  3CCE I;  4V19 K;  1VQN I;  1FOX A;  1VQK I;  2OTJ I;  3CJT B;  1VQO I;  1VQ9 I;  3CCS I;  5DM6 F;  3CC7 I;  5GAD J;  3CF5 F;  3I56 I;  3CCM I;  1VQ5 I;  3CME I;  4UY8 I;  3CCU I;  1YIJ I;  1FOW A;  3J7Z I;  3PIP F;  2FOW A;  3J7Y J;  5DM7 F;  2E36 A;  3CD6 I;  5GAH J;  3CC4 I;  4IOC F;  1Y39 A;  4IO9 F;  1YJN I;  1HC8 A;  1YJ9 I;  2QA4 I;  1VQ7 I;  1FOY A;  1S72 I;  3DLL F;  2QEX I;  5JVG F;  1YIT I;  3CCR I;  5GAG J;  1VQ8 I;  3G6E I;  3G71 I;  2NXN B;  1YHQ I;  4IOA F;  2E35 A;  1YI2 I;  1VQ6 I;  1ACI A;  3CCL I;  5GAE J;  2H8W A;  2ZJR F;  3CCV I;  2ZJP F;  3PIO F;  1VQM I;  3G4S I;  2K3F A;  1VQL I;  3CCQ I;  2OTL I;  3CMA I;  2E34 A;  1MMS A;  1VQ4 I;  1YJW I;  3CC2 I;  1VQP I;  3CCJ I;  1QA6 A;  2JQ7 A; 
#chains in the Genus database with same CATH topology
 1MH4 A;  1JKR C;  1G3Y A;  3JW4 A;  5HLG A;  3ZQG A;  4I0B A;  2OCC H;  1UG2 A;  3M8E A;  3OSG A;  3DEE A;  4EGZ A;  2A5W A;  4RA2 A;  1FZP B;  2EIM H;  2HXO A;  1G6N A;  1A04 A;  2WAF A;  4II3 A;  4LMY A;  3OYH A;  3GCM A;  1ZH5 A;  4N9H A;  5E1Z B;  2DA2 A;  1P7I A;  1Z3X A;  3HSF A;  1I27 A;  5IP6 A;  2OC6 A;  3KX2 A;  3KP6 A;  4CYD A;  2KJB A;  2CU7 A;  5D6F A;  4FE4 A;  2CQX A;  3MKL A;  3SXY A;  1XN7 A;  1Y8Q B;  1LEB A;  4BY1 J;  1FX7 A;  4ESB A;  3BTJ A;  2L7F P;  3FK7 A;  3C3W A;  3CTA A;  3ZMS A;  2WAE A;  2XKO A;  3CJQ B;  3I9V 2;  4MIM A;  2DMU A;  2ESH A;  4V2F A;  2V7F A;  5EZH A;  2CQN A;  2ZME C;  1JTX A;  2E1O A;  2R7Q A;  1T0F A;  2LFB A;  1JHF A;  4M6X A;  1TWH J;  4XQF A;  3HOZ J;  3GTK J;  2EIJ H;  2F5F A;  2F5C A;  2YS9 A;  3C7J A;  1MZB A;  1HKS A;  5CVI A;  2O61 A;  2AHQ A;  2BY0 A;  1LUJ B;  2OAZ A;  1R7J A;  3GME A;  1BW5 A;  5F0F A;  2BY1 A;  4JOM A;  1B8I B;  4XOT A;  5IYB J;  2IJL A;  3QOD A;  5DDG A;  3M1C A;  1ORK A;  2FOK A;  1YI2 I;  3HB9 A;  2JA6 J;  2CUF A;  2KL4 A;  2Y9Z A;  1QHH D;  1KGS A;  3CCL I;  3BJ6 A;  4O3M A;  3O8H A;  4ZDP A;  2KIM A;  1FIP A;  2QF7 A;  1UST A;  2DMN A;  2M0M A;  5KCM A;  1LE8 A;  2NVY J;  1AA7 A;  2UUZ A;  3ABM H;  4EAT A;  4LJZ F;  2ZFW A;  3WTV C;  4E7J A;  3MKZ A;  1XX5 A;  2VL8 A;  4RM3 A;  4BH9 A;  1RZ4 A;  2KPM A;  1JE8 A;  3RIR A;  4KA4 A;  4JX6 A;  2FX0 A;  4AVZ A;  1ZN2 A;  1O3T A;  3NAR A;  2Y2Z A;  4LLN A;  5DD8 A;  1VQ4 I;  3BR3 A;  2P5L C;  3CC2 I;  5HDG A;  1JUM A;  3K4M A;  3UKG A;  4PFP A;  4UVB A;  1EF4 A;  2MC4 A;  1SFU A;  1WI3 A;  4J01 A;  1B59 A;  4RMN A;  1YX5 A;  2DA5 A;  1E2X A;  2LBF A;  2K27 A;  3AKZ A;  2JA5 J;  3VOD A;  4R8H A;  3CC7 I;  1BOB A;  3OR2 C;  4EVI A;  2CQK A;  3I56 I;  4BHB A;  5CJ9 A;  1E3P A;  3BJO A;  4I09 A;  3ERM A;  2P6T A;  4YG2 F;  4N0B A;  2ME6 A;  1TWG J;  4XSX F;  2RDP A;  2V9P A;  3G73 A;  2IS6 A;  4A93 J;  2VT2 A;  5M3M J;  1UEL B;  1ZEL A;  1Z7U A;  4DQ2 A;  2JK3 A;  5DCF A;  2YX4 A;  2L9R A;  3OYI A;  1YLF A;  4LIV A;  1U3E M;  2F4M B;  2YX7 A;  3BWG A;  4A3G J;  3E6B A;  1R6R A;  1U9N A;  5CVJ A;  1R58 A;  1X1A A;  3V7C A;  1IXS B;  3TDU C;  2DFI A;  1WQ2 A;  4XON A;  2JSC A;  2NS7 A;  3K4C A;  2ETH A;  1UHM A;  4D5F A;  4AIJ A;  4BHP A;  3JRH A;  2XV4 S;  5ICE A;  4ZYE A;  4ZYG A;  2HTJ A;  3CJR B;  4UVC A;  2HYJ A;  2Y0S A;  2XRL A;  3L9F A;  4XLH A;  1FYK A;  5FGM A;  1QPM A;  4CZC A;  5IP9 J;  3K0L A;  1HDD C;  5B66 C;  5E3M A;  1C0W A;  2DFF A;  2OD5 A;  2KDZ A;  4NDL A;  4PSW A;  4EJU A;  3KP2 A;  4CCN A;  2RV8 A;  5LGN A;  1P4A A;  1IZ1 A;  1JGS A;  2L9S A;  3BR1 A;  4MLO A;  5L3B A;  2IGM A;  2FRH A;  4XKC A;  2KMU A;  3I0T A;  3DTE A;  4E7S A;  2CFO A;  5D5U B;  3BR2 A;  3REO A;  2PG4 A;  4I2O A;  3HSE A;  5CVU A;  3SEZ A;  5K7F A;  4ZTF A;  2VBY A;  5E17 F;  3AG4 H;  3PJR A;  5E8I A;  1QRY A;  3GWZ A;  3DWL E;  5D8L B;  3LFU A;  3BQY A;  1IUF A;  2DMQ A;  4PUS A;  4MTD A;  1MDM A;  4OIO F;  3ABT A;  5LD2 C;  2EFP A;  5J6X A;  2WB1 N;  3WTZ A;  2BXZ A;  1XDS A;  3B6C A;  4F93 B;  1D1C A;  4DZP A;  2E5N A;  2ZO4 A;  3WTU C;  1SAU A;  4XLC A;  3AL0 C;  4BDY A;  1BC8 C;  2HDD A;  5DUI A;  1LVK A;  3E5Q A;  1IJW C;  4L9T A;  1DGW Y;  2OV7 A;  2P8T A;  2XRO A;  1YRN A;  2HQR A;  2YU3 A;  3NEU A;  5HLT A;  3GYH X;  1Y1V J;  4YIR X;  1PDN C;  4U0Y A;  2UZK A;  1YYV A;  2HU9 A;  4E70 A;  2KZV A;  2M4G A;  3V7S A;  1U8R A;  1LE8 B;  4PZJ A;  4I7H A;  1G4D A;  4HF2 A;  4X0G A;  1N77 A;  2R5Y B;  3BZ6 A;  4Z6Y A;  3CZ6 A;  2XAG A;  3TL4 X;  1ZRC A;  2QSF X;  1HKQ A;  2VOD A;  1Z7L A;  3G3Z A;  2O8X A;  2W48 A;  1H9G A;  4HSR A;  4AIH A;  1BA5 A;  2LVS A;  1TZL A;  4BXF A;  1S7A A;  2GLO A;  2DO7 A;  2R7F A;  4FE7 A;  4WWC A;  4J19 A;  2ZSH B;  4GYG A;  2UXX A;  2IS1 A;  2GZW A;  3TP3 A;  3HRU A;  2KIQ A;  3OIQ A;  3FK6 A;  4RGR A;  5D5X B;  3VB2 A;  2DOD A;  1OFC X;  4BJ6 C;  3M1E A;  3JR9 A;  2E2I J;  2LBF B;  4DGW B;  4BXX J;  4E6K G;  2ZJ2 A;  1OCR H;  5E20 A;  1R1T A;  5FLX Z;  4CGZ A;  2DYS H;  4BKX A;  3PSF A;  2HDC A;  2EIK H;  1U0J A;  2I8D A;  2PX9 A;  4IVN A;  5JVG F;  1MSE C;  3WG7 H;  3MKY B;  4DW6 A;  2PQ8 A;  1P7J A;  3HHG A;  1VQ8 I;  1E17 A;  1OPC A;  1SFX A;  2EA4 A;  3G6E I;  3ZN1 A;  2V26 A;  4AWX B;  3BT9 A;  5B1A H;  3OIO A;  2BHZ A;  3JTG A;  1IN5 A;  2JZY A;  3D1N I;  1HF0 A;  2R7D A;  1AKH A;  4BE1 A;  1U2W A;  5J1R A;  2L2O A;  1YG2 A;  3ZCO A;  1D8K A;  3GTP J;  3VFZ A;  4JQF A;  3E6M A;  2E1M C;  4EV0 A;  1HDP A;  1YW9 A;  5KHD A;  1ZG1 A;  2DA4 A;  4UUS B;  2CV1 A;  3FMQ A;  1W4M A;  4E7K A;  1ETQ A;  2XF7 A;  5CLS A;  2FUG 2;  3QPH A;  2MAB A;  2CO5 A;  1H0M A;  3HEF A;  2EFO A;  5JI6 A;  3N97 A;  2KDO A;  2ZME B;  1YS6 A;  4PFO A;  2QZ8 A;  2M8E A;  2F6C A;  4EQQ A;  3QQA A;  5IOY A;  4LIU A;  1L0O C;  2RKH A;  2X1D A;  3EUH A;  2CWE A;  1IXC A;  1RR8 C;  5CVV A;  2G7H A;  4EJV A;  4E7Z A;  3JSP A;  3HSR A;  3O8G A;  1JGG A;  3V7R A;  3DU6 A;  2JTV A;  2HVS A;  1QGP A;  3OYM A;  4QWQ A;  3S1R J;  2CUE A;  2DA6 A;  1J7K A;  1BIB A;  1W7P A;  4HX8 A;  2Z5U A;  3ZR8 X;  3TOB A;  2CG4 A;  3V8K A;  1XS9 A;  4HF0 A;  3H0D A;  5AON A;  1MBE A;  2A05 A;  3DLA A;  4P9U A;  5FRO A;  1M1E B;  4LD5 A;  2ZB9 A;  4PJJ A;  4XRM A;  5FLX K;  3W3C A;  2OZU A;  5ILU A;  4HF1 A;  2TDX A;  1FOW A;  3H3U A;  4M3D A;  4M9Z A;  4B43 A;  1G3T A;  2O9L A;  2VXZ A;  5IT9 Z;  1MDM B;  3F8N A;  4RS8 A;  4LFU A;  1I6X A;  2DFH A;  2W00 A;  3K9T A;  2M7B A;  3F0C A;  2WAD A;  4IEJ A;  4U7D A;  3M3Y J;  5FD6 A;  4P5O A;  2LLK A;  3PO2 J;  3I64 A;  3QAH A;  2DLL A;  4ZH4 F;  3BZK A;  2X4H A;  1V5G A;  2EZL A;  4A3C J;  2DDA A;  5GAH J;  2I10 A;  3JRD A;  2MGQ A;  1YRN B;  2EA2 A;  4L0Z B;  2Y9Y A;  2M2E A;  3M8J A;  1ZQ3 P;  3M9A A;  1LJ9 A;  2EV6 A;  1BC7 C;  1SAX A;  1NG6 A;  4BE2 A;  1IRZ A;  5L3F A;  4G7Z F;  3PNT A;  2QEX I;  2QBY A;  3KP3 A;  2IVM A;  4KT6 A;  2CYY A;  2ZNY A;  2PJR A;  2VE9 A;  3E6C C;  4KIG A;  4L9V A;  1G2H A;  3GX4 X;  3P9I A;  2IA1 A;  1HQC A;  2ID6 A;  2O5R A;  3LQQ A;  3S1N J;  3HGG A;  1SD6 A;  2GXB A;  3RJP A;  1PUE E;  2XPV A;  4JBA A;  5BOX A;  2KRC A;  1JXS A;  3KLO A;  4PCQ A;  2QLZ A;  5J1Y A;  3OYG A;  2XGC A;  2HPI A;  3JCU C;  1IRF A;  5D4S A;  4EEF G;  2QCO A;  4R1H A;  2P7C B;  2B63 J;  1E0E A;  3ZMD A;  2IA0 A;  1PP8 F;  3TGN A;  4QIW N;  4FHT A;  1DUX C;  2DT7 B;  4QPQ A;  4C30 A;  4RAG A;  5LHG A;  3LA2 A;  2TRT A;  4WXC A;  2GOX B;  2DTZ A;  2Z1D A;  1U9O A;  1GVD A;  1OCO H;  2MA3 A;  1B72 A;  4XRS G;  2FE3 A;  2VE8 A;  4II2 A;  4BQA A;  4XKB A;  2M34 A;  5LHH A;  2CUZ A;  3LA7 A;  3OOU A;  1SFO J;  4GRI A;  1ONV A;  2VQC A;  2VJI A;  5HOO A;  1JT0 A;  4RM2 A;  3HTS B;  3LWF A;  3F72 A;  2IGO A;  3OS0 A;  3MVP A;  5H20 A;  2H27 A;  2EK5 A;  3CCE I;  2ELJ A;  4DYC A;  5JVT A;  1AKH B;  1J9I A;  2LKS A;  4CZZ A;  1YIO A;  4YRV A;  2RQP A;  3GF2 A;  5E18 F;  1OKR A;  1XMK A;  2CW0 F;  5FRM A;  4HRI A;  2M1B A;  3DTI A;  5EEA A;  3S3N A;  1WJC A;  2L4A A;  2JSP A;  3FZV A;  3KIO A;  5IYC J;  5J4V A;  3KP7 A;  1J59 A;  3BTC A;  4CCM A;  3FXJ A;  4MEX F;  3FBI B;  1F36 A;  3HPH A;  5ICG A;  3R0J A;  2HTS A;  1DPU A;  2Y0M A;  2DOF A;  2ZXH A;  1REP C;  5A2Q Z;  4F52 A;  2HKX A;  2OF7 A;  5FRN A;  3FHN A;  4ANJ A;  1Y6I A;  2XB5 A;  1XSX A;  3HGY A;  2FOW A;  2DK8 A;  4PJ0 C;  3RQ4 A;  3ZXS A;  2VXD A;  3PNY A;  2Y0S N;  4BGD A;  4MQV A;  1D1B A;  4HNT A;  4XLP F;  1S8N A;  4M9X A;  3VWB A;  4HLX A;  1F4K A;  1X1P A;  3AL0 B;  3AFH A;  1NK3 P;  1YJ9 I;  2E7X A;  1XMA A;  3MKW B;  2HOS A;  3BCB A;  1FOY A;  4P1W A;  1W0U A;  3P5J A;  1Z3Y A;  4F7Z A;  3CP2 A;  4NUB A;  3KE2 A;  4F91 B;  1ETO A;  3QOP A;  1YIT I;  3FXQ A;  1JJ6 C;  3ZQL A;  1G59 A;  4RDU A;  4TV7 A;  4KIF A;  1RKW A;  4F3Q A;  2X6W A;  3WHC A;  4FQG A;  1POG A;  1J5Y A;  2WWY A;  4ZZL A;  2O7O A;  3CMM A;  1EJ9 A;  2E35 A;  5FLV A;  1V3F A;  2BY3 A;  3VSK A;  2QQB A;  3DKY A;  3CUQ C;  4QPO A;  2GWR A;  3C2H A;  1WJF A;  1SD4 A;  3RCO A;  1ERD A;  3GTL J;  1Z0X A;  4XSZ F;  3CCV I;  1MKM A;  1B6A A;  1VQM I;  1DU0 A;  3R6S A;  3DU5 A;  1R1V A;  1ZG3 A;  3GBG A;  1BL0 A;  2P5K A;  3HC7 A;  1BN5 A;  1ETX A;  3QPS A;  1AWC A;  2ELH A;  3KEQ A;  3COA C;  1STZ A;  4OOI A;  3BR5 A;  1BJA A;  2L5Q A;  3MQ0 A;  1P92 A;  3SEQ A;  2ISY A;  3ROU A;  1Q1V A;  3PUF A;  1WKM A;  2DA3 A;  4DOZ A;  1O7L A;  3FXK A;  1W1W E;  5H6Q A;  3W6K B;  3WU1 B;  4G8X A;  3GTQ J;  3NWS A;  1S29 A;  2Y69 H;  2QBY B;  5HS7 A;  1K4S A;  3R61 A;  4GXO A;  2KZG A;  4GO1 A;  3RPQ A;  5A2Q K;  4Q5S F;  3ERE D;  2PJR B;  1VQP I;  2F2E A;  3ESW B;  3K1M A;  3S16 J;  4BDZ A;  5B3S H;  2AO9 A;  1UJ8 A;  3CF2 A;  1D5V A;  4M3G A;  4MFE A;  1WH7 A;  1LPQ A;  1D5Y A;  1CQT A;  1FOX A;  1HOM A;  5F6F A;  4D5C A;  4HOB A;  5LGT A;  2BVM A;  2OTJ I;  2FML A;  1GV2 A;  3S3O A;  3SZT A;  2IPQ X;  2E1M B;  2NVQ J;  1IO2 A;  4UUV A;  3SDB A;  4IX7 A;  3J7A Y;  2F5D A;  1P4X A;  2V79 A;  3BR6 A;  3T8T A;  4G9Y A;  3J81 K;  1RUO A;  2VKE A;  4ZDL A;  4G6D A;  2JUC A;  1RRJ A;  1UB9 A;  2GQQ A;  2BW3 B;  3A0H C;  1BBY A;  3S2W A;  3K2A A;  5HLH A;  3H1C A;  3P7N A;  1SAN A;  2G7U A;  1R9T J;  4ENN A;  5K5Q A;  3QU6 A;  2X0L A;  2MH9 A;  3OYC A;  3C1D A;  1FBS A;  3HPG A;  4CYC A;  2PI0 A;  3TMO A;  4CH7 A;  1IF1 A;  5J8F A;  2ZC2 A;  1Y56 A;  3KFW X;  4LK0 F;  2EJR A;  1FPQ A;  1UMQ A;  2E60 A;  2Q2E A;  3DLL F;  3ZGK A;  3CDL A;  4KDP A;  2FU4 A;  1TW3 A;  1VF9 A;  2MD0 A;  3S17 J;  5KK1 A;  3CCR I;  3W2A A;  2V1X A;  5L3C A;  3J80 Z;  1MW7 A;  1JTY A;  5K5R A;  4OIP F;  1WJA A;  5EYR A;  1YHQ I;  4S04 A;  3MZ8 A;  2ECC A;  1IW7 F;  3HRT A;  1TLH B;  1FOK A;  1JUP A;  1VQ6 I;  2MYS A;  1TQM A;  2HOE A;  3OL3 A;  2H8W A;  4WF2 A;  2K02 A;  3CUQ A;  3OWT A;  2R3S A;  4XKV A;  1A6Q A;  2AXT C;  4XN0 A;  4PJN A;  3SHF A;  3KP5 A;  1T2K A;  1X2M A;  4P9F A;  2DXI A;  2F5E A;  2H94 A;  3F8B A;  4MGR A;  4ZYA A;  1IN7 A;  4NHJ A;  2XGD A;  3FXM A;  2LF7 A;  1FNN A;  1FBU A;  3F8C A;  4I0A A;  1Z67 A;  2VJJ A;  3Q5F A;  3P9K A;  4A12 A;  4IF4 A;  2KP6 A;  4HA8 A;  3I3L A;  1WHU A;  2LH9 A;  1U5T C;  1OJL A;  3EDP A;  4NB5 A;  4B47 A;  3HRM A;  3ULQ B;  4IQ4 A;  3I4P A;  1Y1W J;  2Q0O A;  4ETS A;  3M07 A;  1GVJ A;  2IS4 A;  4P55 A;  1GXP A;  2LR8 A;  3OYK A;  4LLG F;  4MEY F;  3T1B A;  1Y0U A;  1DP7 P;  2LP0 A;  5E1X A;  1NHA A;  2R5Y A;  4V19 K;  2ICW G;  3GEZ A;  2P5V A;  3HM5 A;  1SMT A;  2V1D A;  4GGG A;  4A0Z A;  3J7A O;  2HKO A;  2MFZ A;  2CV0 A;  1Y0N A;  4UHT A;  4M3B A;  2H6B A;  2OPT A;  2VKD A;  2FEZ A;  1IG7 A;  4EJT A;  2L0K A;  1J0R A;  3IH2 A;  5DM6 F;  1ZHF A;  2K85 A;  5GAD J;  1I1G A;  2UXN A;  4G6Q A;  2VBZ A;  3L2Q A;  1X4P A;  2OQG A;  5H6R A;  2HEO A;  5JHF A;  2M4K A;  1ON2 A;  2HWV A;  5IOZ A;  1O57 A;  1OCT C;  3QYB A;  5JLX A;  2YU9 J;  3TOA A;  4CXF A;  3J7Z I;  1Z05 A;  3K4B A;  4L9J A;  3NAU A;  2WY8 Q;  4A3M J;  1OLT A;  1U8B A;  2QUF A;  3J80 K;  2A5Y B;  1FMW A;  4R79 A;  2M3A A;  3JRA A;  3S1Q J;  2XGE A;  3KYL A;  3IH4 A;  4XMY A;  4F92 B;  3N4M A;  2Z99 A;  3K2Z A;  3CC4 I;  3TED A;  2AQE A;  3OYD A;  1D8J A;  1YJN I;  3BPV A;  4B48 A;  3JRE A;  1I3Q J;  2HYG D;  4A3B J;  5BPI A;  2HQA A;  2DYR H;  4PGG A;  1IN6 A;  2NAZ A;  4UB8 C;  2MLG A;  2WV1 A;  4BBS J;  5DCM B;  1A36 A;  4D7M A;  3RI4 A;  5BQT A;  3LST A;  2DMT A;  4PK4 A;  1HXD A;  5M5X J;  5HS8 A;  3S2D J;  4C2T A;  4DNC A;  1KU3 A;  4UUS A;  4IXA A;  4IHY A;  2CH0 A;  1ZYR F;  3A03 A;  1EA3 A;  2IRF G;  5FFX A;  5FO5 A;  4RB2 C;  4UUT A;  1QZY A;  3I5U A;  1XTA A;  5LRS A;  1QBJ A;  1QU3 A;  5DTD A;  2PN6 A;  4IRH A;  2ZME A;  4IZZ A;  4CYC B;  5C4J J;  3DFG A;  2DN0 A;  2QYO A;  1FWZ A;  2XRN A;  5C3E J;  1UCR A;  1WWX A;  1Z77 A;  2K86 A;  4Y33 A;  1MBG A;  5K7Z A;  2V1U A;  2XAS A;  2GM4 A;  1X1C A;  4UXN A;  3KLN A;  3OY9 A;  1KZH A;  4LGW A;  4BAY A;  2M8G X;  5EGO B;  3LSK A;  4WXD A;  3L1P A;  2Q2E B;  2LD5 A;  1XC5 A;  2STT A;  1ULY A;  1ENH A;  3BOQ A;  1TW2 A;  3KZZ A;  1YFH A;  4L0Y B;  2FBK A;  4BJ5 C;  5JHU A;  4J00 A;  2DI3 A;  2ID3 A;  4LB6 B;  1XPX A;  3I71 A;  2R7V A;  3B02 A;  3OYB A;  1D0X A;  4PGH A;  1SD5 A;  1YTY A;  3SYT A;  2YUS A;  3CUQ B;  3HJE A;  5LLQ A;  1K6Y A;  4A3D J;  3JRI A;  3DBH B;  2FD5 A;  1APL C;  4KUM A;  4E4H A;  3R0A A;  3K10 A;  3GTO J;  1LFP A;  2EV5 A;  3QWL A;  3CF5 F;  2E2J J;  1X3U A;  2PMZ A;  2R7S A;  2Z16 A;  1ZR2 A;  1QPI A;  3M4O J;  2CS3 A;  2JN6 A;  3RQI A;  1VQ5 I;  4UY8 I;  1W7P D;  2VOP A;  2EQR A;  3MCZ A;  3L2U A;  1D0Z A;  2I5U A;  1X2N A;  5BS6 A;  2PJP A;  4HX7 A;  1R23 A;  1OMI A;  4RAZ A;  1IV8 A;  2EFW A;  2HZD A;  3ECO A;  2NOJ B;  3OYE A;  1HW1 A;  1OR7 C;  5D5W B;  2QVO A;  1FBQ A;  1XCV A;  5F0H A;  2KIS A;  1R00 A;  2KFD A;  5HDK A;  3WU0 A;  2WAQ A;  2XB0 X;  2XUB A;  2IW5 A;  2PFB A;  2YPR A;  4LOC A;  1RUN A;  4D1Q A;  5DYM A;  2JA7 J;  1OYY A;  3HYI A;  4Y15 A;  2VBX A;  3RPU A;  4HAM A;  1A6I A;  2GBY A;  1WCM J;  3A01 A;  1Q1H A;  4CO8 A;  1WPK A;  3DPU A;  2VUM J;  2X1C A;  4G94 A;  2P7V B;  5HLI A;  3EUK L;  2QKM B;  1PJR A;  3FM5 A;  4IOA F;  2EZH A;  3I54 A;  4A6D A;  4HNV A;  5ED4 A;  2L01 A;  1ZGJ A;  4FX0 A;  5LBQ A;  1H88 C;  4HDV A;  6PAX A;  2ACJ A;  3SFI A;  4AUX A;  1KA8 A;  1FYL A;  2EIN H;  2EFN A;  2EIL H;  2ZJP F;  3IKV A;  3SQN A;  2HFH A;  5J3L A;  3I4M J;  4I98 B;  2HDW A;  4HBL A;  4M73 A;  1PP7 U;  5CQE A;  4I6Z A;  3OL4 A;  2MC3 A;  4C3I J;  1XD7 A;  2KT0 A;  3HTU A;  1TT5 B;  4MNU A;  1WZ2 A;  2KIF A;  1VQL I;  3BLY A;  3PO3 J;  3L00 A;  2HYF A;  1I50 J;  1QZE A;  3LA3 A;  1U78 A;  3E6D A;  3H9J A;  4EM0 B;  4DYQ A;  2VB6 A;  3GFJ A;  2STW A;  2Y30 A;  1WSU A;  1DQU A;  1D0Y A;  4A3L J;  4C2U A;  4BAC A;  2K9L A;  5F04 A;  2BVL A;  5TJJ A;  2P6S A;  2CW7 A;  2A68 F;  1XMX A;  4C2M J;  1PUF A;  1OYW A;  1JJ8 C;  3JAM Z;  1ZRE A;  2X6O A;  3LSH A;  3VYS B;  2CJJ A;  2E1C A;  3BZC A;  1LDK B;  2AQF A;  2JWT A;  3WTW C;  4W97 A;  3DBR B;  1Y8R B;  4MHG A;  2K9N A;  1T38 A;  3LL7 A;  3ABU A;  3KEY A;  2F4I A;  2ZNZ A;  1EV7 A;  1TWC J;  4NQW A;  2HPM A;  4PDK A;  1R5I D;  1SVO A;  3BTL A;  3ZQF A;  5FLM J;  1FTZ A;  2LMD A;  4XLN F;  4KMF A;  4OAY A;  1QNT A;  2QSH X;  2K7L A;  2DQR A;  2OZ6 A;  1Z91 A;  3PIP F;  1R36 A;  2LDU A;  3BTI A;  2ELK A;  4UV9 A;  1MNM C;  1WGX A;  2BGC A;  2K4J A;  3ZQH A;  3C18 A;  3OV8 A;  4XIC A;  1ITY A;  3CD6 I;  5F08 A;  1K6O A;  3IV5 A;  4M71 A;  4ZZD A;  3F22 A;  1OR7 A;  5CYV A;  2E19 A;  2LKX A;  2FMY A;  4IOC F;  1GUU A;  1EH6 A;  4X6A J;  3LSG A;  4M3F A;  2NVX J;  1IGN A;  2COM A;  2MBF A;  4YFX F;  4A3J J;  3DBL B;  4EGY A;  2EV0 A;  2P0W A;  1HA8 A;  5FFZ A;  1X19 A;  4UVA A;  3LFK A;  2VIX A;  4ZTJ A;  1ZKG A;  5DD4 A;  1JUS A;  3BDD A;  3BJA A;  3M7G A;  3IP4 B;  4Z2Y A;  4M3E A;  3FM3 A;  3BY6 A;  3HKZ A;  1R5H A;  2GA1 A;  1V5E A;  3CLQ A;  4Y17 A;  3G71 I;  4XM3 A;  1LVA A;  5K7H A;  1GT0 C;  3AG1 H;  1SMY F;  3FMS A;  2WTE A;  3S8P A;  2A3S A;  1VZ0 A;  4MQ9 F;  1Z6R A;  4ENK A;  3IAS 2;  3KEO A;  2ZJR F;  2DJI A;  3FBN B;  4BE0 A;  4U7B A;  1SFK A;  3BG5 A;  1TQI A;  3BRO A;  5FKN A;  1YE9 A;  2AS5 F;  3LSI A;  1ZLJ A;  1SFE A;  5BPD A;  2XIG A;  4ZC3 A;  2CGP A;  5F1R A;  3CMA I;  1V5F A;  4IHX A;  3D0S A;  4N4N B;  1RC9 A;  5EEG A;  1BI2 A;  1FYM A;  1MMS A;  3H5N A;  2L9V A;  3DPL C;  3TP0 A;  2JT1 A;  3RKX A;  3A01 B;  5LGU A;  2FXA A;  3W6J B;  1F5T A;  3GTM J;  1BOA A;  4OU0 A;  4IPA A;  2W1O A;  1QA6 A;  1SD7 A;  1TWF J;  3ASN H;  4FTH A;  3HXL A;  2EH3 A;  2ISZ A;  3G1M A;  4NNJ A;  4E7H A;  3L2C A;  3HOS A;  3OR1 C;  4RAY A;  1LDJ A;  1VQN I;  2ESN A;  5LEJ A;  5FB2 A;  1S6L A;  1TQP A;  3HHH A;  3SZP A;  3K70 D;  1ON1 A;  1X4O A;  4DBQ A;  3OS2 A;  2BW3 A;  3G2B A;  4MTE A;  5E3N A;  4BU2 A;  3IRR A;  4YII A;  1MMD A;  4AID A;  4LK1 F;  1OCC H;  4DJA A;  2KJC A;  5J47 A;  4B09 A;  3FHZ A;  2M30 A;  4H4K C;  1FLI A;  4ESF A;  4BNC A;  5IT9 K;  1BI0 A;  3FF5 A;  4IHS A;  1R71 A;  3RKQ A;  2GIV A;  4EJO A;  1G8X A;  3HBL A;  2JRT A;  1V54 H;  3CO7 C;  2CQQ A;  2GXG A;  2NS0 A;  3HOT A;  3CDH A;  4HQE A;  1K79 A;  1T98 A;  2EPF A;  4XL9 A;  4DZJ A;  2Y31 A;  5ICF A;  3NQO A;  3WTT C;  1TNT A;  2DT5 A;  3RSN A;  3FWE A;  5C4X J;  3JRC A;  1XDU A;  3SJM A;  1PUF B;  4FT8 A;  5FJ8 J;  1K78 B;  2H1L A;  1JI8 A;  4CCK A;  2IT0 A;  3HOX J;  4A6E A;  4RAF A;  2L7M P;  3KPH A;  2QA4 I;  2M9H A;  2TCT A;  3PFI A;  3WTY C;  5KAF C;  2OJE D;  3M8F A;  4Q48 A;  4XK4 A;  2HQ5 A;  1X3W B;  4FCY A;  4NQW B;  2HZT A;  1WVR A;  2JMW A;  2IEK A;  4XOP A;  1KQ9 A;  1VFC A;  4XLF A;  1X1D A;  1MJA A;  3HDD A;  4IHW A;  4S05 A;  4Y4R A;  2MSY A;  1WJD A;  1XSV A;  3U1K A;  2HXI A;  1ZAO A;  3K1P A;  2VQG A;  2Q1Z B;  3ZRG A;  1O4X A;  3PIO F;  1NG7 A;  5LRR A;  4LB5 A;  1IV6 A;  3B73 A;  2QSG X;  3N05 A;  2IGN A;  1X58 A;  4A0Y A;  2NRA C;  5LEK A;  4YFK F;  1MBJ A;  2F5V A;  2LG4 A;  3RZD J;  3T8R A;  3K7A J;  1D3Y A;  2XPU A;  2H09 A;  1BR1 A;  2LRE A;  3QYF A;  4I76 A;  1W36 D;  2QWW A;  2KKO A;  4AYB A;  4LG3 A;  2VI6 A;  1E3H A;  2JVG A;  3GFI A;  2PMZ N;  3WE3 A;  3WTS C;  1F9N A;  2QQ8 A;  3DXJ F;  2KQR A;  4YFN F;  1MBK A;  1LKX A;  2RRE A;  3QP6 A;  2HS5 A;  4O6J A;  1DPR A;  1OCP A;  2X9D A;  3X2Q H;  2RNG A;  1TWA J;  4ON0 A;  4KN4 X;  4B44 A;  4V2G A;  1HW2 A;  4LIT A;  1MMN A;  4G7H F;  1KQ8 A;  5C44 J;  3GLL A;  4FAS D;  2G0E A;  3S1M J;  4BJT A;  3CJT B;  5HVQ C;  5JR3 A;  1IN8 A;  2VPR A;  4BL0 B;  2FA5 A;  2X85 A;  2RNJ A;  3PM1 A;  1SVM A;  3Q0V A;  1QO0 D;  3Q0U A;  1T0F C;  2X48 A;  2XHK A;  3I59 A;  2WAQ N;  3UNG C;  2L7K A;  3OYF A;  3CME I;  1N75 A;  3L09 A;  2DOE A;  3JSO A;  3S32 A;  1YIJ I;  3MFK A;  1O3S A;  2CRG A;  3S93 A;  3RKW A;  1OYI A;  2RVC A;  2PMU A;  4AIK A;  3P9C A;  2K40 A;  2O03 A;  3K69 A;  4BUP A;  1K4T A;  4LG0 B;  3BPX A;  4Y52 J;  1TP4 A;  3BG7 A;  2R0Q C;  4FET A;  5K1Y A;  3DCF A;  4RB1 A;  2VC1 A;  2VQL A;  3CUO A;  3TKY A;  3W2V A;  2Z9O A;  2QEN A;  2L9N A;  5DV5 A;  4M6V A;  1RPW A;  5DCM A;  1FMV A;  3E5U A;  1XB4 A;  3LAJ A;  1Y39 A;  1NK2 P;  2DMP A;  3QPT A;  4D0P A;  4IRG A;  5TGT A;  1ZAR A;  1HSJ A;  3GUD A;  3RDI A;  1A31 A;  2M0C A;  4K2E A;  3CP8 A;  2W85 A;  3HOU J;  5K5O A;  2OQR A;  3H92 A;  5GP9 A;  2KRF A;  5BNG A;  1MJ9 A;  3C2G A;  3CQZ J;  1I3A A;  1IUY A;  5EEH A;  3ZMZ A;  1QHG A;  2BBY A;  1VTN C;  4RGU A;  2E5Z A;  5J8C A;  2F4O B;  4A3I J;  5GAE J;  2XGX A;  4HST A;  1ZGW A;  1B9N A;  2N8G A;  3O2P E;  4AC0 A;  4BEH B;  2FQ3 A;  3BG3 A;  1OQY A;  5FKO A;  3K4K A;  1U6G A;  5EGO A;  3E97 A;  3ZPL A;  4OIN F;  1R4M B;  3HIF A;  1O7F A;  4XLA A;  5ILS A;  3MWM A;  2R93 J;  1K83 J;  1GDT A;  2ZFU A;  1H8A C;  2M45 A;  2YSR A;  3HUG A;  2VJ5 A;  2UWM A;  2Q8K A;  3WOD F;  4E7I A;  1RET A;  1Z6T A;  2LY1 A;  4M6Y A;  3EPZ A;  2QM3 A;  3ZQC A;  3O3K A;  4OWR B;  3QP5 A;  1ETY A;  4IQJ A;  2BHY A;  3D5L A;  3HOW J;  2A6E F;  2CUJ A;  1MH3 A;  4AU7 A;  3WGG A;  1OIS A;  4DYR A;  1H89 C;  2DBB A;  4BHC A;  2VN2 A;  3A1Y A;  4BYY A;  5KAI C;  4IKF A;  5D5V B;  4B3A A;  2DT6 A;  3VYU B;  2YR2 A;  1UAA A;  1ZLK A;  2ZXI A;  3U1D A;  3QU3 A;  1KQ0 A;  3T0Y A;  2QGU A;  3ABK H;  4L9N A;  3K6G A;  2A6H F;  1P6R A;  2DU9 A;  2JRM A;  4IL6 C;  3Q9S A;  3B6A A;  3ZMU A;  2IBD A;  1A5J A;  5JFR A;  2H8R A;  5F1J A;  5IY5 H;  1NTC A;  1N78 A;  1WJE A;  4WXH A;  4RB3 C;  2DA7 A;  3PQJ A;  5ILV A;  2LY2 A;  3HOY J;  1YQA A;  3E0J B;  1W5T A;  1RI7 A;  2VKH A;  2X1E A;  3OMY A;  2W7N A;  2JA8 J;  1ETV A;  2E7W A;  3KZI C;  1HLV A;  2LYC A;  3RKY A;  5E79 C;  2NS8 A;  1O3Q A;  1J2X A;  1X1B A;  3EET A;  3MN2 A;  4OMZ A;  4UB6 C;  4LLL A;  2RAE A;  3K4N A;  3HKZ N;  1YW7 A;  4XRS A;  2LRD A;  2V9V A;  2R7T A;  2R7O A;  4KIT B;  2LC2 A;  1R22 A;  3WG9 A;  2GXA A;  3G1O A;  3OSF A;  4XID A;  2K3P A;  3ZMV A;  3EYI A;  1WFX A;  4L5J A;  4IO9 F;  2LSO A;  3TW7 A;  2B9S A;  2VKV A;  3D5R C;  4M72 A;  5AIP A;  1T8I A;  1YW8 A;  4G6T B;  2DA1 A;  2LF8 A;  1FSE A;  5DS9 A;  4ITV A;  5FKL A;  1YS7 A;  2HGC A;  3ONQ A;  4A3F J;  3K4L A;  2V6E A;  4XNF A;  1IRX A;  4QLC U;  2FSW A;  1FIA A;  2CMP A;  3NRV A;  3OYA A;  3I59 B;  3GVA A;  2VBW A;  3VYT B;  4RGS A;  4JP0 A;  4D9J A;  2MD5 A;  4M74 A;  3RPU D;  4HG2 A;  4WK8 F;  1V55 H;  2XC7 A;  1RES A;  1IXR C;  1S3J A;  1BJZ A;  1HBX G;  1XGM A;  3OOP A;  2HOA A;  3PL8 A;  1IC8 A;  4I02 A;  2MG4 A;  2OU2 A;  1MD0 A;  2D1H A;  3ZN0 A;  4HV6 A;  1XSD A;  2OBP A;  2XAQ A;  3H35 A;  2NVT J;  2K4B A;  2A07 F;  2UV1 A;  3IH3 A;  3OYJ A;  1FJL A;  4ZDO A;  3KYD B;  2L02 A;  3LSJ A;  1HCR A;  2QQA A;  3IWZ A;  3PSI A;  2K9Q A;  3H36 A;  1MMG A;  3V8J A;  3CCQ I;  4S0H B;  2ZXJ A;  2FBI A;  3DTK A;  1USS A;  1MSF C;  1FSH A;  2R5Z A;  1N25 A;  2M7A A;  1BI1 A;  2BEO A;  4KFC A;  4F55 A;  2QQ9 A;  3W2W A;  4U0V A;  1PYV A;  2XAF A;  2BY2 A;  4GDF A;  3CLO A;  4ZJZ A;  3V42 A;  4JYK A;  1WJ5 A;  3E7L A;  2ME0 A;  4U0W A;  1S5L C;  2R4G A;  2XPW A;  5E3O A;  3O6B B;  5M5Y J;  2V4J C;  3G1L A;  3CCJ I;  1D1A A;  2JQ7 A;  1G3S A;  1W0T A;  4WX9 A;  3VOE A;  1KYZ A;  4B8X A;  4NC8 A;  4BQN A;  3A2K A;  2H6C A;  4OMY A;  4AM3 A;  4CUG A;  2IGK A;  4IHV A;  1VQO I;  1VQ9 I;  2R7U A;  3LMM A;  3L2W A;  2PLY A;  2MW8 A;  2VLA A;  4A2U A;  4CCO A;  4X1E A;  1LDD A;  1U5T A;  4H0E A;  1EH7 A;  1BIA A;  3WE2 A;  2Y75 A;  2X51 A;  2W82 A;  3CCM I;  2LK2 A;  2Y48 A;  4CDG A;  4CIC A;  3PUB A;  4KMU X;  3OYL A;  3HOV J;  2VAS A;  3HUG B;  4NC6 A;  2C6Y A;  2GAU A;  5J4Y A;  3L2R A;  3ZQI A;  3IL2 A;  3F8M A;  2O8K A;  1GV5 A;  5KNL A;  3J7Y J;  2L4M A;  2LY9 A;  1RNL A;  3I4N J;  1FT9 A;  4C9Y A;  4OIQ F;  3SZG A;  1KU7 A;  1UHW A;  3SFZ A;  1ZTR A;  1CF7 A;  3Q9V A;  3TO6 A;  4C3J J;  2CFX A;  3TDZ C;  1DGR M;  1DDN A;  1T39 A;  5ICC A;  5M5W J;  1UFM A;  3TO7 A;  3H0G J;  3IRQ A;  3DEW A;  1QZZ A;  1TT0 A;  2X6X A;  5IYD J;  2VT3 A;  3HG9 A;  1B1B A;  4U88 A;  5HNF A;  2VQH A;  5D6E A;  1RKT A;  1XG1 A;  3U21 A;  3QRF F;  1JKO C;  2XF6 A;  2NNY A;  2P4W A;  5AIQ A;  5L3D A;  2R7X A;  4MFD A;  1LB2 A;  3FXL A;  1IRG A;  2PBI A;  2VC0 A;  1MBF A;  5LFA A;  2CW8 A;  3QPL A;  3R4K A;  2NNN A;  4KN7 X;  3TBI A;  3ASO H;  5IPA A;  2ZXW H;  3UR3 C;  2ECB A;  3EUH C;  2H1K A;  1DU6 A;  1EKE A;  4RLQ A;  3H5A A;  3FIS A;  2EBI A;  4AYB N;  4A5N A;  2GIZ A;  4RGX A;  3JRB A;  2RN7 A;  2EZI A;  3FDY A;  3EUA A;  2A69 F;  1SEU A;  2KLO A;  2E1N A;  3FIW A;  3DQV C;  1TL8 A;  3G4S I;  4XLE A;  3ZQQ A;  2D2W A;  4Y7N J;  2G9W A;  2XKP A;  5L3E A;  4E7L A;  4PJL A;  3TO9 A;  3ZP5 A;  4BY7 J;  3CES A;  1F43 A;  5HNH A;  2BYV E;  5M3F J;  1PVE A;  4ABZ A;  2PMH A;  3EYY A;  4YEL A;  3WHB A;  3E5X A;  3FKI J;  4KIS A;  3H3Z A;  4MO7 A;  1YJW I;  5ERI A;  3GFM A;  2W25 A;  1I5Z A;  4WCG A;  3OIP A;  2O3F A;  4I01 A;  3RZO J;  5EG0 A;  4PJM A;  2DDB A;  1KYW A;  2DCE A;  2BV6 A;  5BMZ A;  3GTJ J;  2QKL B;  3CDI A;  3PQK A;  3QYE A;  1MIJ A;  4CCJ A;  3QOE A;  4N9I A;  2M87 A;  2FNA A;  2DK5 A;  2XDV A;  3IHU A;  2R7R A;  2JPC A;  5L3G A;  2VJ4 A;  1OCZ H;  2MH2 A;  3IC7 A;  2PEX A;  4ZYD A;  3MD2 A;  4EM1 A;  1ZRF A;  3IAM 2;  9ANT A;  3V8L A;  3ZQ7 A;  1GLN A;  2R5Z B;  2Z3Y A;  4ENJ A;  5GPA A;  4BXU A;  2RGV A;  1K78 A;  2R7Z J;  2V6C A;  2D45 A;  3F6O A;  4G12 A;  2E36 A;  2OCE A;  2WY7 Q;  4Q4Z F;  1T6S A;  2GOM A;  3GXO A;  2W84 A;  2B0L A;  5CVR A;  2CQ7 A;  4EM2 A;  4XOR A;  5HDN A;  5TRD A;  2XVC A;  4HNU A;  1ACI A;  1MND A;  1UZC A;  3LSM A;  3LNQ A;  4ENM A;  1AOY A;  2KRH A;  5TIS C;  1YO5 C;  1MBH A;  3DP7 A;  2V9K A;  1JKQ C;  2ZBK A;  2ZCW A;  1R1U A;  1MNE A;  1U5T B;  5FKM A;  2J5O A;  2P81 A;  1S7O A;  2WBM A;  4CSW A;  3HL2 A;  2XSD C;  4HW0 A;  3CMY A;  3ZMT A;  2NXN B;  4JX5 A;  5HS9 A;  3HRS A;  2F48 A;  1XCB A;  1HKT A;  3AAF A;  3K4J A;  1P2F A;  2BXY A;  2DFE A;  1FP2 A;  5KVR A;  4OAZ A;  3VPR A;  2JUG A;  1J09 A;  1Z9C A;  1QVU A;  4ZYH A;  1ZG5 A;  3GZN B;  3VYR B;  3C2B A;  1ODD A;  1DP3 A;  2A61 A;  3V4G A;  1CF7 B;  2DQL A;  2XAU A;  3U2R A;  3WGI A;  3MAJ A;  1BR4 A;  2VPL A;  2K3F A;  3RYP A;  1YX3 A;  2K5C A;  2HOT A;  2LKP A;  3L7W A;  4A3E J;  1WRJ A;  1TBX A;  3TQN A;  3BQZ A;  1ZGA A;  2A6T A;  5CQG A;  3F3X A;  4JK1 X;  4B1R A;  4CCL A;  2IXS A;  2ZKZ A;  4A69 C;  1IN4 A;  2HNH A;  2RQQ A;  2DTR A;  3RTR A;  3BCA A;  4Q47 A;  2LOO A;  5H2F C;  5EJC A;  3LSR A;  1GXQ A;  5GTH C;  4UNO A;  3MEX A;  2IAI A;  5D8K B;  4GCV A;  3JAM K;  4C3H J;  1K7A A;  5EF6 A;  5F64 A;  2JA2 A;  2HVQ A;  2KIU A;  1UG0 A;  3GFL A;  4JX4 A;  4YIF A;  3GW2 A;  2CV2 A;  2VON A;  2WA0 A;  2D5V A;  5D4R A;  1IAW A;  4QTR A;  2COB A;  1MGT A;  1VQK I;  1GHC A;  3S15 J;  1FY7 A;  1T33 A;  1T56 A;  1Z1D A;  2EWN A;  2DOA A;  5EZG A;  5CKT A;  5DEQ A;  5JLW A;  1E3O C;  3DV8 A;  3GZ6 A;  2ADU A;  4LG0 A;  4P96 A;  1XGS A;  3MMY B;  3KET A;  3L2V A;  3FXR A;  1BR2 A;  5F27 A;  3LSP A;  1V4R A;  2IS2 A;  2AXL A;  4FIS A;  3DKW A;  4AD9 A;  3KZY A;  3ABL H;  3E3V A;  2W24 A;  2O6G E;  4Y13 A;  5FD5 A;  1I6H J;  2L3D A;  5LHI A;  3D5S C;  1ZRD A;  1RR7 A;  2BOL A;  4KT5 C;  3AG3 H;  1W5C C;  3H9G A;  5IT3 A;  4EJW A;  3DPT A;  1HST A;  4ESJ A;  4HEA 2;  2MLK A;  1L3L A;  2JPB A;  3PNV A;  4B3X A;  2EFQ A;  2HI3 A;  3E1S A;  5J40 A;  3W6V A;  3AG2 H;  1AHD P;  2XAH A;  4B4C A;  5EG0 B;  2NVU B;  4O5V A;  5EDN A;  1IDY A;  1T95 A;  4GYI A;  3GTG J;  3S2H J;  1BW6 A;  1WH5 A;  4RBO A;  4D7N A;  1VQ7 I;  5FKK A;  2HVR A;  2X6Y A;  3Q0W A;  3DF8 A;  4CHU A;  4XR6 A;  2GA2 A;  2FF4 A;  1ETK A;  2J5P A;  3BC8 A;  4BQO A;  3HZJ A;  2W57 A;  1S7E A;  1R4N B;  3I58 A;  4BEH A;  5GAG J;  1FTT A;  3F23 A;  3GLX A;  1TNS A;  2LTP A;  1O3R A;  3LQR A;  3SDG A;  3Q3S A;  1J75 A;  1R49 A;  1AU7 A;  3K70 C;  1LFU P;  4KIC A;  3CJN A;  5J1U A;  4KYW A;  4HLY A;  4XN3 A;  2DAO A;  1T08 B;  3VSL A;  2OA4 A;  3A4C A;  1G3W A;  4HQM A;  4IRI A;  4M9S A;  3T5X A;  1SC7 A;  1IDZ A;  3S14 J;  3EQL F;  4HX4 A;  4RB0 A;  3TW6 A;  3ZOB A;  5GTI C;  2DJN A;  3LAP A;  2W4S A;  5CPR B;  4A3K J;  4IJA A;  1X3Z B;  2V1N A;  1ETW A;  1R5G A;  1TTY A;  1MJB A;  2FQ4 A;  4DBR A;  4HDU A;  1KON A;  3F8F A;  4DIQ A;  1RIO H;  2BZT A;  3FXU A;  4OIR F;  3CO6 C;  4U87 A;  5GPC A;  1S9H A;  1EH8 A;  2XAJ A;  4Y3O A;  4A5M A;  1I39 A;  4HZF A;  3NWT A;  3WU2 C;  2K9M A;  4XKW A;  1K61 A;  1JT6 A;  3I55 I;  1JHH A;  1P9Q C;  3LOC A;  2ZJQ F;  3ML6 A;  1YOV B;  3H3V K;  1F1Z A;  1KU2 A;  4I99 C;  5DUK A;  3PFY A;  4AVP A;  2DW4 A;  3A02 A;  3I53 A;  1ZR4 A;  1KU9 A;  3KYC B;  4CA0 A;  2DPU A;  2Z2S B;  1VI0 A;  1LEA A;  1WI9 A;  5HOD A;  1WJB A;  3CCS I;  3VEP A;  2WB1 A;  2Z33 A;  2BE5 F;  4UV8 A;  1VND A;  1B8I A;  2O0Y A;  2ZSI B;  4QSH A;  3J81 Z;  1H9T A;  3IWF A;  1W7P B;  4NC7 A;  4G7O F;  3CCU I;  2JJ7 A;  2R7W A;  1UHS A;  1TC3 C;  3H9Q A;  1Z21 A;  3JTH A;  4FX4 A;  3A0B C;  2XF5 A;  5DM7 F;  3OYN A;  3F21 A;  4EMS A;  2M5W A;  3ELK A;  4GFB A;  2E71 A;  2LNB A;  2D1V A;  4XBF A;  3WGH A;  3IKT A;  1CGP A;  1ZK8 A;  3BR0 A;  1I1S A;  3BG6 A;  3FMR A;  2DPD A;  1FC3 A;  3H5R A;  2NOG A;  1FEX A;  2FNP A;  1HC8 A;  1QVT A;  2IA2 A;  3ECH A;  1JKP C;  3ISP A;  4L5I A;  1SVL A;  1W36 C;  4L5E A;  2L54 A;  4W1U A;  1S72 I;  4NBQ A;  3JRF A;  1A35 A;  2FJ1 A;  3S3M A;  1B9M A;  4KNY A;  3F9K A;  3WTX C;  4PSX A;  3MZH A;  3MZY A;  4BBR J;  3GZ5 A;  1MMA A;  2WV0 A;  2L7Z A;  2FBH A;  1LQ1 A;  3FXO A;  2JVH A;  3U9G A;  4KJZ A;  1BI3 A;  3BP8 A;  3FX3 A;  4BS9 A;  2HQN A;  4HPQ A;  5B5E C;  3CCY A;  4ASN A;  1BM9 A;  4IHT A;  3JRG A;  4A0X A;  5B1B H;  2VOO A;  5E3L A;  1XGN A;  2IP2 A;  4L18 B;  1W5S A;  2XSJ C;  3IUO A;  2WC2 A;  2R92 J;  5F0C A;  1B4A A;  5E1W A;  1NH3 A;  3DEU A;  2KHM A;  3KP4 A;  3FKJ A;  3KCC A;  1LNW A;  3OS1 A;  2EZK A;  2K9S A;  4HYE A;  2RC4 A;  4RLF A;  1QQI A;  2OTL I;  5E8G A;  4XRF A;  1XGO A;  3K1N A;  5IP7 J;  2E2H J;  3DKX A;  2EB7 A;  2E34 A;  3F6V A;  1LFB A;  4BQQ A;  3BG9 A;  4N4O B;  2CSO A;  4KIB A;  1P4W A;  4YEJ A;  2OUM A;  3RYR A;  2NYX A;  1B72 B;  1HW5 A;  2B7E A;  4HV5 A;  2HR3 A;  3R60 A;  3VDX A;  3GO5 A;  1FP1 D; 
#chains in the Genus database with same CATH homology
 3I55 I;  2ZJQ F;  3CCE I;  4V19 K;  1VQN I;  1FOX A;  1VQK I;  2OTJ I;  3CJT B;  1VQO I;  1VQ9 I;  3CCS I;  5DM6 F;  3CC7 I;  5GAD J;  3CF5 F;  3I56 I;  3CCM I;  1VQ5 I;  3CME I;  4UY8 I;  3CCU I;  1YIJ I;  1FOW A;  3J7Z I;  3PIP F;  2FOW A;  3J7Y J;  5DM7 F;  2E36 A;  3CD6 I;  5GAH J;  3CC4 I;  4IOC F;  1Y39 A;  4IO9 F;  1YJN I;  1HC8 A;  1YJ9 I;  2QA4 I;  1VQ7 I;  1FOY A;  1S72 I;  3DLL F;  2QEX I;  5JVG F;  1YIT I;  3CCR I;  5GAG J;  1VQ8 I;  3G6E I;  3G71 I;  2NXN B;  1YHQ I;  4IOA F;  2E35 A;  1YI2 I;  1VQ6 I;  1ACI A;  3CCL I;  5GAE J;  2H8W A;  2ZJR F;  3CCV I;  2ZJP F;  3PIO F;  1VQM I;  3G4S I;  2K3F A;  1VQL I;  3CCQ I;  2OTL I;  3CMA I;  2E34 A;  1MMS A;  1VQ4 I;  1YJW I;  3CC2 I;  1VQP I;  3CCJ I;  1QA6 A;  2JQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...