3CCLI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cclI00
1S72I 3CCJI 1QA6A 1VQ6I 1YHQI 5GAGJ 3I55I 2QEXI 1YI2I 5JVGF 5GAEJ 3G4SI 1VQLI 3CF5F 3CCQI 2E34A 3CCEI 3PIOF 5DM6F 3CCMI 3CJTB 1VQ8I 3CC7I 3CD6I 2QA4I 1VQ5I 5GADJ 3CCVI 2E36A 3CMEI 4UY8I 2NXNB 1VQNI 4V19K 2K3FA 1VQKI 3CC4I 2OTJI 4IOAF 1VQ4I 1YITI 1VQ9I 3CCRI 1FOXA 1ACIA 1MMSA 1VQMI 5GAHJ 1FOYA 3PIPF 3G6EI 4IOCF 5DM7F 2OTLI 3CCUI 1YJNI 1Y39A 2H8WA 1VQOI 2ZJQF 3CCLI 2ZJRF 2E35A 3J7YJ 4IO9F 1YJWI 3CCSI 1VQPI 1HC8A 1YJ9I 3CC2I 1VQ7I 2JQ7A 3I56I 3J7ZI 2FOWA 3CMAI 2ZJPF 1FOWA 3DLLF 3G71I 1YIJI
chains in the Genus database with same CATH superfamily
5HLIA 2MABA 1R4NB 2WB1A 4D5FA 4P9FA 1VFCA 4KIGA 4A3BJ 2Q2EB 4BBSJ 3Q9VA 2NAZA 3SJMA 2EH3A 4HZFA 3NWTA 1XG1A 3K9TA 1W5TA 2PMUA 1D1BA 3E3VA 4ENKA 6PAXA 3HPHA 1ZRDA 2DA7A 3OOUA 1S6LA 5HLTA 3HJEA 4EVIA 4U7DA 4BQOA 2KRHA 4AM3A 1UG2A 2AO9A 2LBFB 2KLOA 2DA3A 4IKFA 2RV8A 4G6QA 3GTQJ 5F6FA 3HOUJ 3P9KA 1ZARA 3RYRA 4DNCA 1E17A 1WJEA 3ZMTA 4CYCB 2MSYA 4I0AA 2OF7A 3AL0C 3BG3A 1TWAJ 2CWEA 3GTOJ 3RPQA 1ERDA 2QKLB 2UXXA 3LSJA 4DBRA 2CUFA 3E1SA 3L2CA 3CESA 4ENMA 2VJIA 1Z7UA 4UVCA 2BXZA 4DZJA 5ICEA 4XRMA 1HXDA 1YQAA 3B73A 3WHCA 4AYBN 3OYIA 2LD5A 3S3MA 3W6JB 2L5QA 4G94A 2VC0A 1TT0A 3P9IA 3KP5A 2IT0A 2WB1N 3RQ4A 2UXNA 2WY8Q 1O3QA 1S7AA 3QPHA 3E6BA 2KIUA 4M9SA 1OQYA 2DT7B 4BS9A 1FBQA 3I54A 2HEOA 1FLIA 1IRXA 4G9YA 4BXXJ 1O7LA 2D5VA 2Z16A 4M3GA 5LLQA 4XOTA 5TJJA 3ABKH 1L3LA 2YX4A 3T0YA 4HX8A 5LEJA 1GVDA 2VQGA 3B02A 5IPAA 2H8RA 1Y0NA 1UAAA 1YLFA 2R7XA 4BHBA 4RGXA 2LH9A 3WU0A 4E7ZA 3BLYA 1OR7C 5D5XB 4KICA 3C2GA 2MC4A 1MDMA 2HNHA 4V2GA 4HNUA 4EATA 3HYIA 3C2HA 3U1KA 1TT5B 3G73A 3W2AA 3ZPLA 2JK3A 3MKYB 3I4NJ 4PJNA 4BHPA 4L9VA 4FASD 2KIMA 3HOYJ 3DQVC 4BQAA 2RN7A 4AWXB 3WTSC 3H0DA 3FXKA 1IZ1A 1T98A 3I71A 3OR1C 4HOBA 4A0YA 2PJRB 2FEZA 2WY7Q 4BE0A 3ZRGA 4ABZA 1ZTRA 1ZELA 1BN5A 2QKMB 1IXSB 2LY1A 3HB9A 4C3IJ 2C6YA 1S8NA 5ICGA 3GMEA 1G3WA 1IN7A 4Y4RA 1MW7A 2VLAA 1RC9A 5JVGF 4E6KG 1QVUA 3M07A 4UUSB 4ZZDA 1QZEA 1OLTA 2VBZA 2E34A 4CCOA 1LVAA 2GAUA 1KA8A 4P5OA 3V7CA 2JUGA 2DMUA 5FLMJ 1I6HJ 3CC7I 4R79A 1PDNC 2JUCA 2K85A 1PP7U 1FT9A 1HKQA 2M7BA 1EV7A 1L0OC 2VASA 1C0WA 1ZG1A 2MW8A 3OYHA 5J4YA 2EZKA 2AQEA 4XORA 4R1HA 2VKEA 2Q8KA 1OKRA 4A2UA 4BJTA 1X2NA 2CG4A 2E1NA 2F4IA 5F1RA 2ZBKA 1FOXA 3TP3A 1QNTA 2L01A 3M8FA 3HRSA 2HS5A 3MZYA 4F91B 1VQMI 1MDMB 4LLNA 3QAHA 1FZPB 1KGSA 3WG7H 2XHKA 3OWTA 4KDPA 1H9GA 2A05A 1ZRFA 4II3A 2X1EA 3KZZA 4J01A 2DCEA 1T8IA 2OTLI 1KYWA 3CLQA 4GXOA 4II2A 1QRYA 3CTAA 2IVMA 2Z99A 4N4NB 4XKVA 2ZJ2A 2OCEA 3SZTA 4LIVA 5HS9A 9ANTA 2O7OA 3TOBA 2QQAA 1Z6TA 3ZQIA 1NTCA 2VE8A 5FKMA 3QYFA 5H6RA 4IPAA 2ELHA 2JPCA 4IHSA 2EIKH 2RKHA 3BR3A 1K7AA 5AIQA 3K4BA 2STWA 4Q5SF 5IYBJ 2FQ4A 3AAFA 2EWNA 3FKJA 4GYIA 3WTYC 2JA8J 1JUMA 2CH0A 3TL4X 2F6CA 3HUGA 3B6AA 2G7HA 1IDYA 1N75A 1SD7A 2ZJPF 4FT8A 2JRMA 1EJ9A 1YX3A 4RM3A 1D1CA 1U8BA 3QP5A 3LMMA 1W7PD 5GTHC 1SANA 2RGVA 1YW9A 4HBLA 3ZN1A 4A3LJ 1YIJI 1P92A 2MA3A 1SFEA 2V9PA 4E7KA 2VKHA 1FTZA 2CJJA 2X6YA 2XAUA 5BPDA 1M1EB 4BGDA 3AL0B 4OOIA 4YIIA 1KU7A 3F9KA 2OV7A 5F0FA 5LD2C 2W4SA 2O0YA 5FROA 3LSHA 3G4SI 1B8IA 4I01A 1GDTA 2R7SA 2G0EA 1F43A 2DODA 5L3FA 1JKPC 1REPC 2UWMA 4FHTA 1LKXA 1Y0UA 2IPQX 2MLKA 3IL2A 1LEBA 1RETA 1USTA 2XAJA 1STZA 2COMA 4MQVA 2QQ8A 3DKXA 3F0CA 5HS8A 1O4XA 1MNMC 2MD5A 3KZIC 4P9UA 3F6OA 4A69C 3W3CA 4UXNA 2HGCA 2K5CA 4RAZA 4CCKA 1KU9A 2JT1A 3BROA 1XDUA 3ZQFA 4MFDA 2MH2A 4M72A 1MH4A 2FD5A 2QQBA 1IN8A 2QZ8A 5HDNA 4HYEA 2XASA 3ERMA 3CJNA 2NVTJ 4D5CA 4IJAA 5E8GA 1ZG5A 2IA1A 2DT5A 3GTKJ 1XMKA 5H2FC 1NG6A 1QBJA 5IT9K 3HSRA 2F5EA 1R36A 2XC7A 1TWGJ 1JGSA 3DPTA 5DM7F 1T0FA 2FNPA 4ANJA 3HUGB 4N0BA 4EM1A 1KQ0A 2OU2A 2VB6A 3CCUI 4Y17A 3F6VA 3KPHA 5E3MA 1R5HA 3DU6A 1GLNA 2H8WA 2M4KA 4Q4ZF 1VQOI 1RI7A 4HSRA 4IX7A 2VKDA 3HSFA 2VJJA 4I7HA 3SHFA 4C2TA 2RC4A 1IXRC 5CVUA 1TNSA 1ZGJA 2E2IJ 2DA1A 2X1DA 3SDGA 3D1NI 3RIRA 4C3JJ 4A12A 4PFOA 4ZYGA 2OJED 1D3YA 3O8GA 2FF4A 1B8IB 1NG7A 1R58A 4MEXF 1ZR2A 3L2QA 1FOWA 2W24A 3O2PE 3MZ8A 3Q9SA 2YS9A 1A04A 2CGPA 3GWZA 3CJRB 5AONA 4OMYA 3BCBA 1YG2A 1TWFJ 1U5TC 3QODA 1J7KA 3TO9A 4OIOF 1FWZA 5BS6A 2LC2A 3K0LA 5HNHA 2WV0A 2R93J 1PUFA 3HOXJ 4AC0A 2MYSA 1V5GA 2IW5A 1F9NA 1Z3YA 1DPRA 3H3VK 1GXPA 3D5LA 2EA4A 3ESWB 4DJAA 3C1DA 1OYYA 1QHGA 3I55I 2GQQA 5M5WJ 3MKLA 4ZTFA 3BG5A 5JHFA 3SXYA 4DBQA 2M87A 3L2RA 1DU6A 4JX4A 5CPRB 1X3WB 3VOEA 4AD9A 1JUPA 3PNYA 4XICA 5CVVA 2GOXB 4BBRJ 1HW2A 4LK0F 4RAYA 1BR1A 2O9LA 2WAFA 1QPIA 3FKIJ 4ZTJA 1ETWA 1LFPA 4J00A 3MZHA 3H5NA 3CMEI 1TWHJ 3M3YJ 2EFNA 1AU7A 5EG0A 5BNGA 1VQNI 4C3HJ 3SFZA 4XRSA 4PJJA 2DMTA 5DCFA 2E2HJ 2X85A 2QGUA 5HNFA 3SQNA 4IOAF 3EUAA 1BOBA 1ETOA 5M5YJ 3GZ6A 3IV5A 3J7AY 2R7RA 3DU5A 2HPMA 2V1DA 4M3EA 3FMSA 1RUNA 4WK8F 3K4JA 2XKOA 2VJ4A 1E2XA 2UV1A 1LDKB 2BVMA 5D8KB 3BJAA 2DN0A 5ILVA 1TLHB 1IW7F 1UHWA 5FRNA 1W1WE 4BL0B 1G2HA 2XUBA 4L18B 2M3AA 3WU1B 1VI0A 2BY2A 2DQRA 1RZ4A 3ABLH 5E3NA 3DLAA 4RAFA 3OS2A 1EA3A 3GTPJ 2BBYA 2CFXA 4BY7J 4A3MJ 5IT9Z 1DUXC 5F04A 4M9ZA 2ME0A 1Z67A 2PBIA 3V8KA 1PUFB 1IV8A 2FA5A 4XBFA 2UUZA 2WADA 3ABMH 2AHQA 1MNDA 4ZYHA 5LRSA 2DDBA 1QHHD 1BI1A 3MD2A 2XGCA 5M3MJ 2BYVE 4EM0B 5LGTA 1R6RA 2DI3A 4KNYA 1Z6RA 1P7JA 2DTRA 2W85A 5FLXK 3H9JA 1HC8A 1W36C 4PSWA 3H36A 1KU2A 3WODF 5B66C 2YU9J 2FNAA 1TC3C 1MBHA 5DUKA 3HGYA 3GFJA 2E2JJ 1XX5A 4M3DA 3EUHC 1E3PA 2GXAA 3FXOA 1H9TA 1DGRM 1JKOC 5ERIA 1USSA 3BDDA 3QQAA 2K9QA 3JRHA 4BNCA 5EG0B 2RREA 4ESBA 2MG4A 1BM9A 2KFDA 1QA6A 5CVRA 1X3ZB 1IC8A 2FU4A 2OBPA 3TW7A 1QZYA 3ZQLA 3K4NA 2ECBA 2O61A 2DFHA 1G3TA 2V1NA 4A0XA 3HGGA 3H1CA 3ZN0A 3CQZJ 1GT0C 2DA4A 5J4VA 2RQQA 1D5VA 1ZQ3P 1ITYA 3J7AO 3JRAA 1FBUA 1PUEE 1OISA 4HEA2 1ZG3A 1FOKA 2QWWA 4Y3OA 2RDPA 2VT2A 2L4AA 1WQ2A 1DP7P 2ZSIB 3OYGA 3KYLA 3IH2A 1X4OA 2HFHA 2L7KA 5E3LA 2DPUA 4BDYA 3VFZA 1UFMA 2K9LA 4E70A 3E7LA 3MKZA 2WWYA 1UJ8A 2ZMEA 3PO2J 3QP6A 3JW4A 4L9JA 4D9JA 5DS9A 1QO0D 4W1UA 1IO2A 2CU7A 2ZXHA 1BW6A 5ICFA 5BQTA 1TBXA 4HPQA 4P55A 3G6EI 5JI6A 5HDKA 5HODA 3C7JA 5L3DA 4EEFG 5K7FA 3OR2C 2ZC2A 4CDGA 5K7ZA 3GTJJ 2HVQA 4L9TA 4JK1X 3G1OA 1YIOA 3KX2A 3H35A 2QSHX 2FJ1A 2HOTA 4RGUA 1SC7A 4UVBA 4FX0A 4MLOA 3I3LA 4L0ZB 1HKTA 2GOMA 4ZZLA 3HM5A 3I0TA 3ZQQA 1W7PA 2FQ3A 3TGNA 1MJBA 3L2VA 3HXLA 2E1MC 3O8HA 4A3GJ 4RAGA 2QCOA 3IKTA 3BJ6A 4YFNF 1O3TA 1YJ9I 3CDHA 4CH7A 1EH8A 2BY3A 4XQFA 3F72A 4GGGA 2GM4A 2LLKA 4A6EA 2Z2SB 4CCNA 3H9GA 3F22A 4LLLA 2HXOA 2HDWA 3GVAA 4U0YA 2HDDA 5FLXZ 2E7WA 2JPBA 4WXHA 4LB5A 1SD4A 2IS6A 2IGNA 1BJZA 3OYCA 3R61A 3ZR8X 1N78A 1UZCA 2ZXIA 4DYCA 3H0GJ 2IS2A 2EV5A 1LNWA 1PYVA 1VQ6I 1EKEA 2NRAC 1LDDA 2ZMEB 3H3ZA 2X0LA 5HLHA 1ETQA 3LA3A 3SFIA 4WCGA 5JR3A 2R5YA 2DTZA 1HOMA 2A68F 3ASOH 3CLOA 4YG2F 5CVIA 2FSWA 3S3OA 3CDIA 4L5EA 4XM3A 3FISA 3GLLA 4XSZF 3CJTB 2MGQA 1P2FA 1MJAA 1FSHA 2QA4I 1BBYA 2HOAA 1JHHA 2YR2A 3S93A 4DOZA 1VQ5I 4PJLA 4B3AA 5GADJ 3JREA 4DYQA 2CQKA 3I4MJ 1RR8C 2V6EA 3HRUA 1WH7A 3HG9A 4YFKF 1CF7A 2R7WA 4M73A 3HC7A 4A93J 1O7FA 3ASNH 3J80K 4LD5A 2D45A 1W7PB 1MKMA 5AIPA 2OQGA 2F4MB 5K5QA 1G8XA 1P9QC 1ZAOA 1XB4A 2K40A 2CW8A 3IWZA 3JRIA 4JP0A 2K4BA 3E5QA 2IGMA 3LWFA 2BOLA 2R4GA 4MTEA 2X48A 4QPOA 3WTVC 3S1RJ 4KUMA 2WAQA 3KYDB 2I5UA 3I59A 2CV0A 1JKQC 1TWCJ 1UHSA 1SFXA 3A4CA 5DTDA 4X1EA 1XCVA 4ON0A 3GCMA 1N77A 1KYZA 2KT0A 2ZJQF 3ZGKA 4BXUA 1D8KA 2JJ7A 2HU9A 4BACA 4IO9F 3HKZA 2P5LC 3IRRA 1Q1VA 4EQQA 3S8PA 5D8LB 2YX7A 4XLEA 2J5PA 1B59A 2CFOA 3K1PA 2HVSA 2X6OA 1D0YA 2BY1A 3HTSB 3V42A 1A6QA 2OPTA 2M1BA 3F8MA 3OYKA 1ETXA 2R5YB 2LRDA 2JQ7A 3JSPA 1XSDA 1B9NA 1BR2A 1F4KA 2CV1A 4YELA 4R8HA 1AWCA 4GCVA 1TQIA 3S32A 1S7OA 3BQYA 4UB8C 3K70C 2HYJA 2XGXA 2PMZA 2DLLA 2ICWG 3ZQ7A 1SAXA 1BI2A 4FX4A 3J81K 5DD4A 4ITVA 3RCOA 2LMDA 2LF7A 4C9YA 4HDUA 1CF7B 3GXOA 3WTZA 2PFBA 4PJ0C 3KEQA 3PM1A 4ETSA 5JVTA 2BV6A 1R1TA 1JGGA 5FO5A 3V7SA 3QOPA 3G1MA 3CJQB 1D8JA 3DKYA 4OINF 2NS8A 3GZNB 4IRHA 4EJVA 2Z3YA 1AKHA 1RNLA 1OCCH 1JTXA 2VQLA 3R60A 3CZ6A 3L9FA 2XPVA 3HKZN 4BXFA 1NK3P 1W4MA 1U2WA 3BPXA 4A6DA 3GEZA 3HSEA 3CO6C 3RKXA 1T2KA 4UY8I 2VPLA 3ERED 2LDUA 3MFKA 3H92A 3DV8A 4PCQA 2P0WA 3A02A 3UR3C 1G6NA 2MFZA 2HR3A 2D1HA 2L7ZA 3PFYA 2HKOA 2FBHA 2V9KA 4G7OF 1Z9CA 5TRDA 3QYBA 1FJLA 4BH9A 2E1MB 4A3DJ 5IP7J 3CCRI 4HNVA 4XKCA 1LDJA 1TQPA 2PMZN 4KISA 3PUFA 3CMYA 1OCOH 3SDBA 4B8XA 3HZJA 2NNYA 5FD6A 5J8CA 4IOCF 2DOFA 1H88C 1XD7A 2B9SA 3IRQA 3RI4A 2JMWA 3EUKL 3OYDA 2FOKA 3J80Z 5EYRA 4JX5A 2CW0F 5LFAA 3FMQA 4IHYA 2DDAA 3GBGA 4Y15A 3ABTA 2RVCA 1SFUA 3RSNA 4JYKA 4O3MA 5EZGA 1WFXA 3T8RA 2VKVA 1BI0A 2ZJRF 2E35A 3FXMA 2HQAA 1NH3A 1B6AA 5KAIC 4FISA 2O3FA 3DTIA 2NVYJ 4QIWN 4A3EJ 1T6SA 4HRIA 1IN6A 4M6XA 1I6XA 2H1LA 2EV6A 5EDNA 4Z2YA 4D0PA 2R7UA 1T38A 2AXTC 3MWMA 3RZDJ 3BP8A 1T0FC 2HKXA 3BTCA 1TL8A 1DGWY 5GPCA 3BQZA 2O03A 4XLNF 2ME6A 1AKHB 2K9MA 3MEXA 4XNFA 2DFFA 2OC6A 4RGRA 4XLCA 5H20A 1A36A 4KYWA 1MSEC 3K1MA 2CYYA 4FE4A 3I64A 3ZMZA 1XGOA 4Y33A 1MBKA 5KNLA 1WKMA 1GUUA 2A61A 3P7NA 3KP4A 5F27A 1SMYF 1SAUA 3E5XA 2A3SA 1FYMA 1YI2I 2GBYA 3S1QJ 2CMPA 2LREA 2F5VA 3HPGA 2BGCA 1TZLA 4FTHA 1FIAA 5LHHA 3J81Z 2OQRA 1HLVA 3MQ0A 3I53A 3PIOF 3CCMI 2HVRA 3VSKA 5TGTA 3DKWA 2M5WA 2PG4A 1LUJB 1G59A 2OAZA 2JVHA 3JTHA 2GZWA 1EF4A 2EFOA 2EK5A 2LYCA 3RKYA 4JX6A 1QGPA 4KA4A 4AIKA 2K3FA 1U3EM 2TRTA 2VOPA 4DW6A 2KJCA 2KJBA 3ML6A 1HQCA 2EV0A 3BOQA 3L1PA 4XRFA 1SVOA 5J6XA 3QOEA 1S9HA 4NB5A 1I3AA 2NOGA 2H94A 4NNJA 2V7FA 4HDVA 3RPUD 3RKWA 2OZUA 3BG7A 3K1NA 2A6EF 1I39A 5FKLA 3TP0A 4OIRF 2W84A 4U88A 4HA8A 5DYMA 3NQOA 2EB7A 4NQWA 3ECOA 1HDPA 5GPAA 3S16J 2XRNA 1WCMJ 1E3HA 3S1NJ 2HTSA 1RUOA 3PQKA 1WJBA 1LEAA 2R7QA 2LVSA 4PGGA 3O3KA 2M7AA 3TEDA 2DU9A 5F64A 3PQJA 2P7VB 3K69A 2YU3A 4RM2A 4XL9A 1F5TA 1Y8QB 1ULYA 5C4JJ 2Z33A 3DEEA 3HOZJ 3A2KA 3J7YJ 3OYEA 3R6SA 2MC3A 1VNDA 4CZZA 3N97A 3RJPA 1P4XA 2QSGX 2HPIA 2FRHA 2M34A 3RDIA 3WGGA 2QENA 2PJPA 1KQ9A 3BZ6A 1I5ZA 2VIXA 1ZLKA 1DP3A 1JHFA 3FBIB 1Q1HA 1Z05A 3L00A 3ZCOA 2DW4A 2W25A 1UCRA 3J7ZI 3LFKA 3T1BA 1FP1D 3P9CA 5KVRA 3KLNA 1I1SA 3ZQGA 1SVMA 3HRTA 1FNNA 3BC8A 3S2HJ 1WI9A 2JA2A 2P6SA 1Y56A 3GFIA 4I99C 2CUJA 2G7UA 5KCMA 5C4XJ 1A5JA 3V4GA 5LGNA 3GF2A 2Y69H 4L5JA 4M6YA 2DA5A 4PGHA 2F5FA 2KP6A 1PP8F 3BWGA 4IHTA 2VT3A 3K10A 1WJDA 5IOZA 5LEKA 2KL4A 2R0QC 4OIQF 3C2BA 1LE8A 2VI6A 1N25A 3B6CA 2P7CB 2EFPA 2V79A 5CQEA 3MVPA 4CYDA 3R0JA 1RRJA 1ZK8A 2JTVA 2XF6A 4DYRA 1ONVA 1FEXA 1J9IA 2JSPA 1X1AA 1BIAA 4NQWB 5LBQA 2LOOA 1UMQA 4PSXA 1XSVA 4BEHA 3S3NA 1LFUP 2ZKZA 3FK6A 3CCVI 1FX7A 2BHYA 4G6TB 3QRFF 3CP2A 5L3EA 4BJ5C 2NXNB 3KETA 4V19K 2VE9A 3Q3SA 4OIPF 3WG9A 1XPXA 4Y7NJ 4A3CJ 4NC7A 4OAYA 2MBFA 5EJCA 1Z77A 2DPDA 5A2QK 2M2EA 3OYJA 4Y13A 2E5ZA 4MIMA 1BR4A 4D7MA 2R7FA 1ZR4A 4FCYA 2VJ5A 1VTNC 4YFXF 4RA2A 2K3PA 3TKYA 2Y2ZA 2WBMA 5HOOA 1R5GA 1Z91A 5LHIA 2JA7J 4O6JA 3FXUA 3GZ5A 1XSXA 3FXLA 2ELKA 1YO5C 1S3JA 4BYYA 5K1YA 1HSTA 5D6FA 5FRMA 3HTUA 2A07F 4BQQA 2R3SA 2H27A 5DCMA 5HDGA 2K4JA 3GTGJ 3LSTA 4PJMA 5EZHA 1YJNI 4GRIA 2EFQA 1T39A 1YYVA 3BY6A 4L9NA 3S2DJ 1KU3A 4IHXA 5B1BH 5DD8A 2XVCA 1W5CC 3KP7A 3GTMJ 5FFZA 3HDDA 4KN7X 2ZMEC 2BE5F 2E60A 2HYGD 3U2RA 3C3WA 4E7JA 1APLC 2A5WA 2I8DA 1CQTA 3A03A 2VN2A 5JHUA 2LKXA 3DPLC 1BL0A 4ASNA 2IS4A 2HWVA 1GXQA 5E79C 1K4SA 2LK2A 4I09A 1K4TA 4XN3A 5M3FJ 2ZFUA 2PX9A 2DMNA 1ZN2A 2L2OA 1LE8B 1ENHA 1WI3A 3ZQCA 1V55H 4U87A 1BW5A 2E71A 4N4OB 2ISYA 1WWXA 2IBDA 5BPIA 2L7FP 3PSIA 1P4AA 2L0KA 2V6CA 3GYHX 4F3QA 2EQRA 3I58A 1WSUA 3ABUA 3SZPA 4PZJA 3VYSB 3G71I 1O57A 5FJ8J 4A3KJ 4XR6A 3S15J 4BEHB 5C44J 3W6VA 2JWTA 5FLVA 1U0JA 2ZCWA 3LOCA 1LB2A 3CCJI 4B44A 1FY7A 2NOJB 3UNGC 2LTPA 3T8TA 1ZHFA 1ZGAA 2OD5A 2O5RA 1B9MA 3BR1A 2V4JC 2MD0A 4CICA 1JJ8C 1OJLA 2CW7A 1JI8A 3A1YA 1Z7LA 4IZZA 1XGSA 2EPFA 1X19A 1YOVB 4GO1A 4PFPA 5EGOA 2IRFG 4IHVA 2M0CA 1XS9A 2Q0OA 3TOAA 4LLGF 4PDKA 1R71A 4HV6A 1H0MA 4UV9A 3HHGA 4UNOA 5ILUA 3UKGA 4EJTA 5DCMB 2R7TA 4OU0A 3WGHA 2XIGA 2XGDA 4CZCA 2R7VA 3BR6A 4F93B 4CO8A 3BR2A 3QYEA 1R1VA 4B47A 1POGA 2COBA 2LY2A 1IUYA 4I6ZA 3DXJF 2L9NA 3VYUB 1SD5A 2Z1DA 3CUQA 4IVNA 4LGWA 3PO3J 2GA2A 2A6TA 3I5UA 2FUG2 3IH4A 4E4HA 4HQEA 1RKTA 1MMNA 3FHNA 2HTJA 1D0XA 3HRMA 5IYCJ 1ZREA 2Z5UA 1P6RA 5A2QZ 1U6GA 3K2ZA 2K02A 5D5WB 3F21A 1R22A 4I02A 3WU2C 1X4PA 2E7XA 2R7ZJ 4LG0A 4C2UA 2K7LA 3IH3A 2HOEA 2W7NA 1R1UA 5FGMA 4B1RA 3FZVA 3ZOBA 2XSJC 2IS1A 5E3OA 2EJRA 3U1DA 3RKQA 3LSRA 4RB3C 1UG0A 2CO5A 3G1LA 4H4KC 4DIQA 5FKOA 1YTYA 3ELKA 1YJWI 2ETHA 1ON2A 4KIFA 1XN7A 2LY9A 3CF2A 2JRTA 5M5XJ 3CCSI 5GP9A 3IAS2 5J47A 2STTA 3M1EA 2ZNYA 4B3XA 3OYNA 2W1OA 1YS7A 5ICCA 1SEUA 1WH5A 1JKRC 1K61A 4FETA 4HX4A 5EGOB 3IWFA 4CCJA 3DPUA 5DDGA 3JSOA 1UB9A 1GVJA 2VL8A 4HX7A 5E8IA 2GLOA 2V1UA 4AIDA 2XAFA 1R49A 3LSKA 5L3BA 5IP9J 3SZGA 4QWQA 1EH7A 1W0UA 4M74A 2FBIA 4QSHA 2CUEA 2Z9OA 2BW3A 3ZQHA 2XDVA 2A6HF 5L3GA 1V4RA 3BTIA 5GAGJ 4PUSA 4RBOA 3A01A 4HW0A 3S17J 4WXCA 1VQLI 1R7JA 3QU3A 2BHZA 2ZFWA 4UUVA 3W2WA 3SYTA 1B4AA 1SFKA 1OYIA 3JAMK 5FKNA 2HQNA 5D6EA 1MMGA 3KYCB 3EDPA 2GIVA 3RPUA 3HOVJ 2ESHA 2YUSA 3BJOA 2PQ8A 4QLCU 4HLXA 1MBGA 4I76A 1IUFA 3ECHA 4LG0B 2VODA 1FC3A 3HOSA 1Y1WJ 5BMZA 2H6CA 2DAOA 3CDLA 5EF6A 1HBXG 3K4CA 2KQRA 1OPCA 1MSFC 1S5LC 1TTYA 1BA5A 4M9XA 3JR9A 2IJLA 4EJOA 1VQ9I 4LFUA 4A5NA 3WTUC 2AXLA 2BY0A 5FKKA 1WPKA 4EJWA 1RESA 5J1YA 4NC8A 2RQPA 4MTDA 1BIBA 4XKWA 1UELB 2LSOA 2D1VA 1Z21A 4KT6A 4G7HF 4QPQA 3ZMSA 1QU3A 2XB5A 3DBRB 3BTJA 2K86A 1MNEA 3TDZC 3QPSA 2ID3A 3EPZA 3JTGA 5H6QA 4A0ZA 2QUFA 3KIOA 3GX4X 2O6GE 1OFCX 1U9NA 3ONQA 2IGKA 5KK1A 1ETVA 3DEUA 2W82A 4HV5A 2LR8A 3W6KB 1OCPA 2LNBA 5IP6A 4PK4A 4HF0A 3VODA 3K6GA 4RB0A 2KDZA 3WE3A 4EMSA 3KEOA 4KN4X 1MIJA 2BW3B 2DYSH 4B4CA 3OL3A 3VYTB 1ZH5A 2E1OA 3PJRA 2M8GX 3A01B 2XAGA 4U0WA 3TO7A 3H3UA 3K4MA 3AG1H 4MNUA 1PJRA 3MCZA 1FIPA 2FOWA 3R4KA 3CMAI 2Y31A 5IYDJ 2NYXA 2UZKA 4E7SA 2DOEA 1XMXA 2DO7A 2GXGA 3BT9A 4Z6YA 2DXIA 4Q48A 1IN4A 1MMDA 1W5SA 3OOPA 4CCLA 2CQNA 3KP3A 2PJRA 2NVUB 4M71A 1IDZA 4HG2A 5EEHA 1FMWA 1J59A 2ESNA 3X2QH 3KP6A 3PL8A 4XLHA 2M45A 2P6TA 3CCQI 3MKWB 4ZH4F 2V1XA 1IRFA 4UUSA 1ZYRF 4ZDLA 2DBBA 3WHBA 4S0HB 2X4HA 3NAUA 2D2WA 2Y0SA 1V3FA 3SEZA 1NHAA 1J2XA 1R23A 2CUZA 2Y48A 3H9QA 2KDOA 3LFUA 3KLOA 5F0HA 5K5RA 5EEGA 4F7ZA 3BR5A 2DK8A 3T5XA 3TMOA 3JAMZ 4DQ2A 2WAQN 2A69F 5IT3A 4UV8A 2F4OB 4BAYA 5GTIC 4OMZA 3P5JA 4XK4A 3F8NA 4XONA 1ACIA 5CYVA 3QU6A 1WRJA 2O8XA 3DCFA 2Y75A 5F0CA 1YE9A 3PIPF 2OA4A 3K2AA 1U9OA 2HZDA 3NWSA 1IN5A 1ETKA 2EIJH 3K7AJ 4W97A 3I59B 4KMFA 4XMYA 3L7WA 1T56A 3E6DA 2CV2A 2A5YB 1S29A 1GV5A 3VB2A 2IA0A 3FIWA 4G6DA 3IUOA 4KFCA 3E97A 2EILH 4IRGA 1ZRCA 4IEJA 4M3BA 3FXJA 1LFBA 3QPLA 4WXDA 3F3XA 4E7IA 5TISC 3DEWA 4AU7A 2EFWA 2X1CA 3DFGA 5J1RA 4NDLA 4HAMA 2IP2A 2Y0SN 4YEJA 2CSOA 5HVQC 4NHJA 2RNJA 3LQRA 3V8JA 2PI0A 1KQ8A 4UVAA 3TBIA 2CQQA 3G2BA 5K5OA 1G3YA 2L9SA 2M4GA 3GFLA 3AG3H 4J19A 2Q1ZB 5D5UB 2H09A 1MMAA 2CQXA 4N9IA 4AIHA 2V26A 4WWCA 3GO5A 3PNVA 1BJAA 2NNNA 4CCMA 4MO7A 1DQUA 1K78A 2DOAA 3AFHA 1R9TJ 1AOYA 3R0AA 2HDCA 1ON1A 3K4KA 1TQMA 3A0HC 3BZCA 1P7IA 1YS6A 4C30A 3OL4A 4MEYF 5DUIA 4Y52J 3U21A 3FHZA 3OIQA 4JQFA 4LIUA 2IXSA 3KE2A 1W0TA 2HZTA 4LK1F 4A5MA 3NRVA 4XLAA 3OYMA 4UUTA 4F52A 2R92J 3VPRA 1BC7C 4C2MJ 1RKWA 1IAWA 4MQ9F 3GFMA 3C18A 2RAEA 3ZMUA 1A6IA 4HNTA 2EZIA 4A3JJ 1H89C 2X51A 4ZC3A 3CCEI 2Y30A 2FMYA 2OCCH 4KITB 1I3QJ 1XGMA 3PFIA 1OCTC 1FSEA 2HI3A 2ADUA 1MBFA 4ESFA 4ZYDA 4HF1A 1T08B 3KCCA 3CCYA 3LA2A 1U78A 2XPWA 4BY1J 1BC8C 2ZXJA 2XPUA 4AVZA 1YW8A 4OAZA 1HDDC 1OYWA 3ISPA 2P5KA 2Y0MA 1LJ9A 4KJZA 4D7NA 4YIFA 1MZBA 3SEQA 2OUMA 1MGTA 2L3DA 4GFBA 2CQ7A 3F8CA 3GW2A 3TW6A 4WX9A 1H8AC 1D0ZA 3WGIA 1QVTA 5ILSA 4B48A 2VBXA 1OR7A 3KP2A 3M8EA 3CUOA 1YITI 4IQ4A 3OYLA 1K83J 1MMSA 5GAHJ 4FQGA 2NVQJ 4G7ZF 1BI3A 2XF5A 3OIOA 4BKXA 2BEOA 2IAIA 1UHMA 3AKZA 4KIBA 1D1AA 2EA2A 1HF0A 5IY5H 1V5EA 3RYPA 1K78B 1F36A 3FM3A 3RZOJ 1FYLA 2CRGA 4HQMA 1B72A 3PSFA 5L3CA 5FB2A 1Y39A 3OSFA 2P4WA 2IEKA 3FK7A 3FMRA 3COAC 1W36D 3JCUC 1FPQA 3FM5A 5B5EC 5F08A 3IC7A 5D5VB 3OIPA 3IP4B 2XF7A 2K9NA 1VQPI 1XGNA 4RLFA 1G3SA 5E18F 2J5OA 2IA2A 4ZYAA 4S05A 3H5RA 4ZDPA 1T95A 1X1PA 3LA7A 4BUPA 4ZDOA 2EIMH 4LITA 4EJUA 3L2WA 3Q0VA 2XKPA 3HEFA 1FYKA 3OV8A 2QM3A 2F2EA 1CGPA 5CJ9A 3ZMVA 1GHCA 1TW2A 3FX3A 1LVKA 1T33A 4ENJA 5D4SA 5CLSA 1HCRA 2HQRA 2LFBA 2WTEA 1S72I 3AG2H 3FXQA 5LGUA 1MJ9A 1R00A 3V7RA 1A35A 1HSJA 1FMVA 2XAHA 2H1KA 2LKPA 2ZO4A 2ZNZA 4RLQA 1YHQI 2FXAA 2O8KA 2QSFX 1BOAA 5GAEJ 3AG4H 4QTRA 3BR0A 4S04A 5F1JA 2DJIA 1E0EA 2KIQA 5E1ZB 3G3ZA 1YRNA 1QPMA 3L09A 1HA8A 2F5DA 2VQCA 3O6BB 3VWBA 1GV2A 3KEYA 5B3SH 3HL2A 2KISA 2X6XA 4I2OA 3DTEA 2ID6A 2W48A 2XV4S 2E36A 2L9RA 2E19A 2KIFA 4K2EA 2H6BA 1R5ID 2DK5A 2DQLA 3M8JA 3W2VA 4ZJZA 1AA7A 1B72B 1IRGA 3LSIA 2OTJI 3FWEA 1SD6A 4AVPA 1HKSA 3KZYA 2QQ9A 2P5VA 4E7HA 2DMQA 5LRRA 2JA5J 4XLPF 2N8GA 2GA1A 3I9V2 2KZVA 3BPVA 2OZ6A 4EV0A 1I1GA 4AUXA 1O3RA 4CSWA 5E1WA 2FE3A 5J8FA 4MGRA 2DFEA 4RS8A 3E6MA 3S14J 4X6AJ 1WVRA 2ECCA 4E7LA 5LHGA 1RIOH 1WHUA 2DA6A 3EYYA 3BG6A 3WTTC 3M7GA 3HOWJ 1QZZA 3ULQB 2W00A 3K4LA 2PMHA 1MBJA 4G12A 2GXBA 2VOOA 5DEQA 1XCBA 1D5YA 3PNTA 1IG7A 3EQLF 5K7HA 2PLYA 1X3UA 1J09A 1X1CA 3CUQC 3BG9A 2WAEA 4BQNA 2B7EA 1SVLA 4XKBA 2M0MA 3U9GA 2NS7A 1O3SA 1FTTA 4U0VA 3MMYB 2ZB9A 3I4PA 4YIRX 3DBLB 2HYFA 2L9VA 4HSTA 2XB0X 1WJAA 1JT6A 2DFIA 2DMPA 1S7EA 2R7DA 3OYBA 1RPWA 5BOXA 1WJCA 3JRGA 2VXZA 3DLLF 4NUBA 3KFWX 1ODDA 1YRNB 1ORKA 2ELJA 5B1AH 2F5CA 4XLFA 5FD5A 5IOYA 4ENNA 5CVJA 4DZPA 1SFOJ 3OYAA 2P81A 4M3FA 3OY9A 1TNTA 1K79A 1RR7A 4G8XA 1Z1DA 2EZHA 1OMIA 3E6CC 4H0EA 4LMYA 1G4DA 3TDUC 2AS5F 1HW5A 3HBLA 3S1MJ 4HF2A 4XN0A 4L0YB 1IF1A 4CHUA 3MAJA 3M1CA 3ROUA 3D5SC 2QEXI 2W57A 3IHUA 2R5ZA 4JOMA 4P96A 5CKTA 1XDSA 1V5FA 4KT5C 2VXDA 2KHMA 3CP8A 3CF5F 3OS1A 3DTKA 4CXFA 2DJNA 1R4MB 2XSDC 3RTRA 3VEPA 4XIDA 3NEUA 3TQNA 3WTXC 1QQIA 1WGXA 1K6YA 3JRBA 3FBNB 2DT6A 2XGEA 3DWLE 3DF8A 3DP7A 4UB6C 3MN2A 3Q0WA 4XRSG 1XC5A 4IHWA 4F92B 4F55A 1EH6A 5HS7A 3LSPA 3BTLA 3LSGA 3D5RC 5E20A 2GIZA 3F8FA 1YW7A 4D1QA 3E5UA 3FDYA 1VQKI 3CC4I 4RDUA 1WJ5A 2VC1A 2P8TA 3WE2A 3LNQA 3LQQA 1PVEA 2KRFA 1VQ4I 4P1WA 4RMNA 2IGOA 3JRFA 1OCRH 2RNGA 4BE1A 2TCTA 1FP2A 3HHHA 3M4OJ 3HOTA 2VBWA 1VZ0A 2XAQA 1FOYA 1X1DA 2LF8A 1K6OA 4IRIA 1JJ6C 1MBEA 1B1BA 4M6VA 4RB2C 1JT0A 4XOPA 2HXIA 3JRDA 3TO6A 3FXRA 4X0GA 1A31A 2KMUA 4BDZA 1DPUA 3ZMDA 2TDXA 4CA0A 1TP4A 1U5TA 1MH3A 1JE8A 2XROA 2CS3A 1IXCA 2F48A 2JN6A 2MLGA 3CCLI 2ZXWH 4JBAA 2E1CA 2E5NA 4BJ6C 1JTYA 2ZSHB 1Z3XA 2WV1A 1IV6A 2ISZA 2QBYA 2G9WA 2YPRA 2L54A 3GUDA 4LOCA 5J40A 2HQ5A 2X6WA 4EM2A 4YRVA 1J5YA 2AQFA 2R5ZB 3HIFA 5HLGA 3CC2I 3K70D 2K9SA 2VQHA 2I10A 3V8LA 2BXYA 4CUGA 4LB6B 1VQ7I 2PN6A 3I56I 4IQJA 1FBSA 3OYFA 2WA0A 3IAM2 1NK2P 3F23A 2DA2A 2FMLA 2X9DA 3ZP5A 2PEXA 4L5IA 4HLYA 4AIJA 2KRCA 5JLXA 2NVXJ 2B0LA 1XTAA 4LG3A 2NS0A 2Y9YA 3F8BA 3JRCA 1Y6IA 4O5VA 4IXAA 4U7BA 4RB1A 5JLWA 3A0BC 3NARA 4ESJA 2KZGA 1JUSA 4NC6A 2VUMJ 2QF7A 3E0JB 4ZYEA 4CGZA 2Y9ZA 4LJZF 1IRZA 4WF2A 1YX5A 3N4MA 1V54H 5KAFC 5J1UA 2FX0A 4Q47A 4UHTA 4I0BA 2L02A 1X1BA 1DU0A 1OCZH 2JA6J 5DM6F 2KKOA 2KPMA 3Q0UA 1XMAA 4GDFA 2JVGA 4NBQA 1VQ8I 3CD6I 3S2WA 5ED4A 4DGWB 4B43A 3PUBA 1ZKGA 5EEAA 3Q5FA 3D0SA 5E1XA 1IGNA 3EETA 5CQGA 1VF9A 3M9AA 3IKVA 4IF4A 3ZXSA 2Q2EA 4MFEA 1U5TB 2VBYA 1Y8RB 3VYRB 2MH9A 3CUQB 3WTWC 3DBHB 2EBIA 1F1ZA 4EGYA 2QVOA 2EZLA 5D4RA 3QWLA 1Y1VJ 4OWRB 3N05A 3BZKA 4FE7A 3OS0A 5E17F 2L7MP 4A3IJ 1TW3A 2WC2A 2QBYB 3LL7A 2M9HA 2EINH 2LP0A 2BZTA 2HOSA 2K27A 2FBKA 2QYOA 2JSCA 3REOA 2M8EA 2LBFA 3VSLA 1I27A 1ZLJA 1LQ1A 3EYIA 1X58A 2V9VA 4V2FA 4A3FJ 1ZGWA 2B63J 4KMUX 4BU2A 3OMYA 4GYGA 5C3EJ 3LAJA 1KONA 1YFHA 2QLZA 3EUHA 1ETYA 1HW1A 3VDXA 2YSRA 3OSGA 4CYCA 1MD0A 5J3LA 3RQIA 1P4WA 2M30A 3QPTA 3FF5A 4BHCA 3GLXA 2VPRA 4I98B 1SMTA 4IL6C 2ACJA 1KZHA 1X2MA 1JXSA 4TV7A 4RGSA 4BE2A 1AHDP 1E3OC 3BCAA 4MHGA 3GTLJ 3CMMA 2L4MA 1LPQA 2XRLA 2DYRH 2GWRA 5KHDA 1WJFA 2LG4A 1IJWC 2R7OA 5JFRA 3L2UA 1U8RA 3LSMA 4B09A 1DDNA 4N9HA 2VONA 5DV5A 3H5AA 2BVLA 3LAPA 1WZ2A 2JZYA 2LKSA 1J75A 1J0RA 4XSXF 1I50J 5FFXA 4EGZA 3CO7C 4AYBA 1Z0XA
chains in the Genus database with same CATH topology
1S72I 3CCJI 1QA6A 1VQ6I 1YHQI 5GAGJ 3I55I 2QEXI 1YI2I 5JVGF 5GAEJ 3G4SI 1VQLI 3CF5F 3CCQI 2E34A 3CCEI 3PIOF 5DM6F 3CCMI 3CJTB 1VQ8I 3CC7I 3CD6I 2QA4I 1VQ5I 5GADJ 3CCVI 2E36A 3CMEI 4UY8I 2NXNB 1VQNI 4V19K 2K3FA 1VQKI 3CC4I 2OTJI 4IOAF 1VQ4I 1YITI 1VQ9I 3CCRI 1FOXA 1ACIA 1MMSA 1VQMI 5GAHJ 1FOYA 3PIPF 3G6EI 4IOCF 5DM7F 2OTLI 3CCUI 1YJNI 1Y39A 2H8WA 1VQOI 2ZJQF 3CCLI 2ZJRF 2E35A 3J7YJ 4IO9F 1YJWI 3CCSI 1VQPI 1HC8A 1YJ9I 3CC2I 1VQ7I 2JQ7A 3I56I 3J7ZI 2FOWA 3CMAI 2ZJPF 1FOWA 3DLLF 3G71I 1YIJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 I;  3CCJ I;  1QA6 A;  1VQ6 I;  1YHQ I;  5GAG J;  3I55 I;  2QEX I;  1YI2 I;  5JVG F;  5GAE J;  3G4S I;  1VQL I;  3CF5 F;  3CCQ I;  2E34 A;  3CCE I;  3PIO F;  5DM6 F;  3CCM I;  3CJT B;  1VQ8 I;  3CC7 I;  3CD6 I;  2QA4 I;  1VQ5 I;  5GAD J;  3CCV I;  2E36 A;  3CME I;  4UY8 I;  2NXN B;  1VQN I;  4V19 K;  2K3F A;  1VQK I;  3CC4 I;  2OTJ I;  4IOA F;  1VQ4 I;  1YIT I;  1VQ9 I;  3CCR I;  1FOX A;  1ACI A;  1MMS A;  1VQM I;  5GAH J;  1FOY A;  3PIP F;  3G6E I;  4IOC F;  5DM7 F;  2OTL I;  3CCU I;  1YJN I;  1Y39 A;  2H8W A;  1VQO I;  2ZJQ F;  3CCL I;  2ZJR F;  2E35 A;  3J7Y J;  4IO9 F;  1YJW I;  3CCS I;  1VQP I;  1HC8 A;  1YJ9 I;  3CC2 I;  1VQ7 I;  2JQ7 A;  3I56 I;  3J7Z I;  2FOW A;  3CMA I;  2ZJP F;  1FOW A;  3DLL F;  3G71 I;  1YIJ I; 
#chains in the Genus database with same CATH topology
 5HLI A;  2MAB A;  1R4N B;  2WB1 A;  4D5F A;  4P9F A;  1VFC A;  4KIG A;  4A3B J;  2Q2E B;  4BBS J;  3Q9V A;  2NAZ A;  3SJM A;  2EH3 A;  4HZF A;  3NWT A;  1XG1 A;  3K9T A;  1W5T A;  2PMU A;  1D1B A;  3E3V A;  4ENK A;  6PAX A;  3HPH A;  1ZRD A;  2DA7 A;  3OOU A;  1S6L A;  5HLT A;  3HJE A;  4EVI A;  4U7D A;  4BQO A;  2KRH A;  4AM3 A;  1UG2 A;  2AO9 A;  2LBF B;  2KLO A;  2DA3 A;  4IKF A;  2RV8 A;  4G6Q A;  3GTQ J;  5F6F A;  3HOU J;  3P9K A;  1ZAR A;  3RYR A;  4DNC A;  1E17 A;  1WJE A;  3ZMT A;  4CYC B;  2MSY A;  4I0A A;  2OF7 A;  3AL0 C;  3BG3 A;  1TWA J;  2CWE A;  3GTO J;  3RPQ A;  1ERD A;  2QKL B;  2UXX A;  3LSJ A;  4DBR A;  2CUF A;  3E1S A;  3L2C A;  3CES A;  4ENM A;  2VJI A;  1Z7U A;  4UVC A;  2BXZ A;  4DZJ A;  5ICE A;  4XRM A;  1HXD A;  1YQA A;  3B73 A;  3WHC A;  4AYB N;  3OYI A;  2LD5 A;  3S3M A;  3W6J B;  2L5Q A;  4G94 A;  2VC0 A;  1TT0 A;  3P9I A;  3KP5 A;  2IT0 A;  2WB1 N;  3RQ4 A;  2UXN A;  2WY8 Q;  1O3Q A;  1S7A A;  3QPH A;  3E6B A;  2KIU A;  4M9S A;  1OQY A;  2DT7 B;  4BS9 A;  1FBQ A;  3I54 A;  2HEO A;  1FLI A;  1IRX A;  4G9Y A;  4BXX J;  1O7L A;  2D5V A;  2Z16 A;  4M3G A;  5LLQ A;  4XOT A;  5TJJ A;  3ABK H;  1L3L A;  2YX4 A;  3T0Y A;  4HX8 A;  5LEJ A;  1GVD A;  2VQG A;  3B02 A;  5IPA A;  2H8R A;  1Y0N A;  1UAA A;  1YLF A;  2R7X A;  4BHB A;  4RGX A;  2LH9 A;  3WU0 A;  4E7Z A;  3BLY A;  1OR7 C;  5D5X B;  4KIC A;  3C2G A;  2MC4 A;  1MDM A;  2HNH A;  4V2G A;  4HNU A;  4EAT A;  3HYI A;  3C2H A;  3U1K A;  1TT5 B;  3G73 A;  3W2A A;  3ZPL A;  2JK3 A;  3MKY B;  3I4N J;  4PJN A;  4BHP A;  4L9V A;  4FAS D;  2KIM A;  3HOY J;  3DQV C;  4BQA A;  2RN7 A;  4AWX B;  3WTS C;  3H0D A;  3FXK A;  1IZ1 A;  1T98 A;  3I71 A;  3OR1 C;  4HOB A;  4A0Y A;  2PJR B;  2FEZ A;  2WY7 Q;  4BE0 A;  3ZRG A;  4ABZ A;  1ZTR A;  1ZEL A;  1BN5 A;  2QKM B;  1IXS B;  2LY1 A;  3HB9 A;  4C3I J;  2C6Y A;  1S8N A;  5ICG A;  3GME A;  1G3W A;  1IN7 A;  4Y4R A;  1MW7 A;  2VLA A;  1RC9 A;  5JVG F;  4E6K G;  1QVU A;  3M07 A;  4UUS B;  4ZZD A;  1QZE A;  1OLT A;  2VBZ A;  2E34 A;  4CCO A;  1LVA A;  2GAU A;  1KA8 A;  4P5O A;  3V7C A;  2JUG A;  2DMU A;  5FLM J;  1I6H J;  3CC7 I;  4R79 A;  1PDN C;  2JUC A;  2K85 A;  1PP7 U;  1FT9 A;  1HKQ A;  2M7B A;  1EV7 A;  1L0O C;  2VAS A;  1C0W A;  1ZG1 A;  2MW8 A;  3OYH A;  5J4Y A;  2EZK A;  2AQE A;  4XOR A;  4R1H A;  2VKE A;  2Q8K A;  1OKR A;  4A2U A;  4BJT A;  1X2N A;  2CG4 A;  2E1N A;  2F4I A;  5F1R A;  2ZBK A;  1FOX A;  3TP3 A;  1QNT A;  2L01 A;  3M8F A;  3HRS A;  2HS5 A;  3MZY A;  4F91 B;  1VQM I;  1MDM B;  4LLN A;  3QAH A;  1FZP B;  1KGS A;  3WG7 H;  2XHK A;  3OWT A;  4KDP A;  1H9G A;  2A05 A;  1ZRF A;  4II3 A;  2X1E A;  3KZZ A;  4J01 A;  2DCE A;  1T8I A;  2OTL I;  1KYW A;  3CLQ A;  4GXO A;  4II2 A;  1QRY A;  3CTA A;  2IVM A;  2Z99 A;  4N4N B;  4XKV A;  2ZJ2 A;  2OCE A;  3SZT A;  4LIV A;  5HS9 A;  9ANT A;  2O7O A;  3TOB A;  2QQA A;  1Z6T A;  3ZQI A;  1NTC A;  2VE8 A;  5FKM A;  3QYF A;  5H6R A;  4IPA A;  2ELH A;  2JPC A;  4IHS A;  2EIK H;  2RKH A;  3BR3 A;  1K7A A;  5AIQ A;  3K4B A;  2STW A;  4Q5S F;  5IYB J;  2FQ4 A;  3AAF A;  2EWN A;  3FKJ A;  4GYI A;  3WTY C;  2JA8 J;  1JUM A;  2CH0 A;  3TL4 X;  2F6C A;  3HUG A;  3B6A A;  2G7H A;  1IDY A;  1N75 A;  1SD7 A;  2ZJP F;  4FT8 A;  2JRM A;  1EJ9 A;  1YX3 A;  4RM3 A;  1D1C A;  1U8B A;  3QP5 A;  3LMM A;  1W7P D;  5GTH C;  1SAN A;  2RGV A;  1YW9 A;  4HBL A;  3ZN1 A;  4A3L J;  1YIJ I;  1P92 A;  2MA3 A;  1SFE A;  2V9P A;  4E7K A;  2VKH A;  1FTZ A;  2CJJ A;  2X6Y A;  2XAU A;  5BPD A;  1M1E B;  4BGD A;  3AL0 B;  4OOI A;  4YII A;  1KU7 A;  3F9K A;  2OV7 A;  5F0F A;  5LD2 C;  2W4S A;  2O0Y A;  5FRO A;  3LSH A;  3G4S I;  1B8I A;  4I01 A;  1GDT A;  2R7S A;  2G0E A;  1F43 A;  2DOD A;  5L3F A;  1JKP C;  1REP C;  2UWM A;  4FHT A;  1LKX A;  1Y0U A;  2IPQ X;  2MLK A;  3IL2 A;  1LEB A;  1RET A;  1UST A;  2XAJ A;  1STZ A;  2COM A;  4MQV A;  2QQ8 A;  3DKX A;  3F0C A;  5HS8 A;  1O4X A;  1MNM C;  2MD5 A;  3KZI C;  4P9U A;  3F6O A;  4A69 C;  3W3C A;  4UXN A;  2HGC A;  2K5C A;  4RAZ A;  4CCK A;  1KU9 A;  2JT1 A;  3BRO A;  1XDU A;  3ZQF A;  4MFD A;  2MH2 A;  4M72 A;  1MH4 A;  2FD5 A;  2QQB A;  1IN8 A;  2QZ8 A;  5HDN A;  4HYE A;  2XAS A;  3ERM A;  3CJN A;  2NVT J;  4D5C A;  4IJA A;  5E8G A;  1ZG5 A;  2IA1 A;  2DT5 A;  3GTK J;  1XMK A;  5H2F C;  1NG6 A;  1QBJ A;  5IT9 K;  3HSR A;  2F5E A;  1R36 A;  2XC7 A;  1TWG J;  1JGS A;  3DPT A;  5DM7 F;  1T0F A;  2FNP A;  4ANJ A;  3HUG B;  4N0B A;  4EM1 A;  1KQ0 A;  2OU2 A;  2VB6 A;  3CCU I;  4Y17 A;  3F6V A;  3KPH A;  5E3M A;  1R5H A;  3DU6 A;  1GLN A;  2H8W A;  2M4K A;  4Q4Z F;  1VQO I;  1RI7 A;  4HSR A;  4IX7 A;  2VKD A;  3HSF A;  2VJJ A;  4I7H A;  3SHF A;  4C2T A;  2RC4 A;  1IXR C;  5CVU A;  1TNS A;  1ZGJ A;  2E2I J;  2DA1 A;  2X1D A;  3SDG A;  3D1N I;  3RIR A;  4C3J J;  4A12 A;  4PFO A;  4ZYG A;  2OJE D;  1D3Y A;  3O8G A;  2FF4 A;  1B8I B;  1NG7 A;  1R58 A;  4MEX F;  1ZR2 A;  3L2Q A;  1FOW A;  2W24 A;  3O2P E;  3MZ8 A;  3Q9S A;  2YS9 A;  1A04 A;  2CGP A;  3GWZ A;  3CJR B;  5AON A;  4OMY A;  3BCB A;  1YG2 A;  1TWF J;  1U5T C;  3QOD A;  1J7K A;  3TO9 A;  4OIO F;  1FWZ A;  5BS6 A;  2LC2 A;  3K0L A;  5HNH A;  2WV0 A;  2R93 J;  1PUF A;  3HOX J;  4AC0 A;  2MYS A;  1V5G A;  2IW5 A;  1F9N A;  1Z3Y A;  1DPR A;  3H3V K;  1GXP A;  3D5L A;  2EA4 A;  3ESW B;  4DJA A;  3C1D A;  1OYY A;  1QHG A;  3I55 I;  2GQQ A;  5M5W J;  3MKL A;  4ZTF A;  3BG5 A;  5JHF A;  3SXY A;  4DBQ A;  2M87 A;  3L2R A;  1DU6 A;  4JX4 A;  5CPR B;  1X3W B;  3VOE A;  4AD9 A;  1JUP A;  3PNY A;  4XIC A;  5CVV A;  2GOX B;  4BBR J;  1HW2 A;  4LK0 F;  4RAY A;  1BR1 A;  2O9L A;  2WAF A;  1QPI A;  3FKI J;  4ZTJ A;  1ETW A;  1LFP A;  4J00 A;  3MZH A;  3H5N A;  3CME I;  1TWH J;  3M3Y J;  2EFN A;  1AU7 A;  5EG0 A;  5BNG A;  1VQN I;  4C3H J;  3SFZ A;  4XRS A;  4PJJ A;  2DMT A;  5DCF A;  2E2H J;  2X85 A;  2QGU A;  5HNF A;  3SQN A;  4IOA F;  3EUA A;  1BOB A;  1ETO A;  5M5Y J;  3GZ6 A;  3IV5 A;  3J7A Y;  2R7R A;  3DU5 A;  2HPM A;  2V1D A;  4M3E A;  3FMS A;  1RUN A;  4WK8 F;  3K4J A;  2XKO A;  2VJ4 A;  1E2X A;  2UV1 A;  1LDK B;  2BVM A;  5D8K B;  3BJA A;  2DN0 A;  5ILV A;  1TLH B;  1IW7 F;  1UHW A;  5FRN A;  1W1W E;  4BL0 B;  1G2H A;  2XUB A;  4L18 B;  2M3A A;  3WU1 B;  1VI0 A;  2BY2 A;  2DQR A;  1RZ4 A;  3ABL H;  5E3N A;  3DLA A;  4RAF A;  3OS2 A;  1EA3 A;  3GTP J;  2BBY A;  2CFX A;  4BY7 J;  4A3M J;  5IT9 Z;  1DUX C;  5F04 A;  4M9Z A;  2ME0 A;  1Z67 A;  2PBI A;  3V8K A;  1PUF B;  1IV8 A;  2FA5 A;  4XBF A;  2UUZ A;  2WAD A;  3ABM H;  2AHQ A;  1MND A;  4ZYH A;  5LRS A;  2DDB A;  1QHH D;  1BI1 A;  3MD2 A;  2XGC A;  5M3M J;  2BYV E;  4EM0 B;  5LGT A;  1R6R A;  2DI3 A;  4KNY A;  1Z6R A;  1P7J A;  2DTR A;  2W85 A;  5FLX K;  3H9J A;  1HC8 A;  1W36 C;  4PSW A;  3H36 A;  1KU2 A;  3WOD F;  5B66 C;  2YU9 J;  2FNA A;  1TC3 C;  1MBH A;  5DUK A;  3HGY A;  3GFJ A;  2E2J J;  1XX5 A;  4M3D A;  3EUH C;  1E3P A;  2GXA A;  3FXO A;  1H9T A;  1DGR M;  1JKO C;  5ERI A;  1USS A;  3BDD A;  3QQA A;  2K9Q A;  3JRH A;  4BNC A;  5EG0 B;  2RRE A;  4ESB A;  2MG4 A;  1BM9 A;  2KFD A;  1QA6 A;  5CVR A;  1X3Z B;  1IC8 A;  2FU4 A;  2OBP A;  3TW7 A;  1QZY A;  3ZQL A;  3K4N A;  2ECB A;  2O61 A;  2DFH A;  1G3T A;  2V1N A;  4A0X A;  3HGG A;  3H1C A;  3ZN0 A;  3CQZ J;  1GT0 C;  2DA4 A;  5J4V A;  2RQQ A;  1D5V A;  1ZQ3 P;  1ITY A;  3J7A O;  3JRA A;  1FBU A;  1PUE E;  1OIS A;  4HEA 2;  1ZG3 A;  1FOK A;  2QWW A;  4Y3O A;  2RDP A;  2VT2 A;  2L4A A;  1WQ2 A;  1DP7 P;  2ZSI B;  3OYG A;  3KYL A;  3IH2 A;  1X4O A;  2HFH A;  2L7K A;  5E3L A;  2DPU A;  4BDY A;  3VFZ A;  1UFM A;  2K9L A;  4E70 A;  3E7L A;  3MKZ A;  2WWY A;  1UJ8 A;  2ZME A;  3PO2 J;  3QP6 A;  3JW4 A;  4L9J A;  4D9J A;  5DS9 A;  1QO0 D;  4W1U A;  1IO2 A;  2CU7 A;  2ZXH A;  1BW6 A;  5ICF A;  5BQT A;  1TBX A;  4HPQ A;  4P55 A;  3G6E I;  5JI6 A;  5HDK A;  5HOD A;  3C7J A;  5L3D A;  4EEF G;  5K7F A;  3OR2 C;  2ZC2 A;  4CDG A;  5K7Z A;  3GTJ J;  2HVQ A;  4L9T A;  4JK1 X;  3G1O A;  1YIO A;  3KX2 A;  3H35 A;  2QSH X;  2FJ1 A;  2HOT A;  4RGU A;  1SC7 A;  4UVB A;  4FX0 A;  4MLO A;  3I3L A;  4L0Z B;  1HKT A;  2GOM A;  4ZZL A;  3HM5 A;  3I0T A;  3ZQQ A;  1W7P A;  2FQ3 A;  3TGN A;  1MJB A;  3L2V A;  3HXL A;  2E1M C;  3O8H A;  4A3G J;  4RAG A;  2QCO A;  3IKT A;  3BJ6 A;  4YFN F;  1O3T A;  1YJ9 I;  3CDH A;  4CH7 A;  1EH8 A;  2BY3 A;  4XQF A;  3F72 A;  4GGG A;  2GM4 A;  2LLK A;  4A6E A;  2Z2S B;  4CCN A;  3H9G A;  3F22 A;  4LLL A;  2HXO A;  2HDW A;  3GVA A;  4U0Y A;  2HDD A;  5FLX Z;  2E7W A;  2JPB A;  4WXH A;  4LB5 A;  1SD4 A;  2IS6 A;  2IGN A;  1BJZ A;  3OYC A;  3R61 A;  3ZR8 X;  1N78 A;  1UZC A;  2ZXI A;  4DYC A;  3H0G J;  2IS2 A;  2EV5 A;  1LNW A;  1PYV A;  1VQ6 I;  1EKE A;  2NRA C;  1LDD A;  2ZME B;  3H3Z A;  2X0L A;  5HLH A;  1ETQ A;  3LA3 A;  3SFI A;  4WCG A;  5JR3 A;  2R5Y A;  2DTZ A;  1HOM A;  2A68 F;  3ASO H;  3CLO A;  4YG2 F;  5CVI A;  2FSW A;  3S3O A;  3CDI A;  4L5E A;  4XM3 A;  3FIS A;  3GLL A;  4XSZ F;  3CJT B;  2MGQ A;  1P2F A;  1MJA A;  1FSH A;  2QA4 I;  1BBY A;  2HOA A;  1JHH A;  2YR2 A;  3S93 A;  4DOZ A;  1VQ5 I;  4PJL A;  4B3A A;  5GAD J;  3JRE A;  4DYQ A;  2CQK A;  3I4M J;  1RR8 C;  2V6E A;  3HRU A;  1WH7 A;  3HG9 A;  4YFK F;  1CF7 A;  2R7W A;  4M73 A;  3HC7 A;  4A93 J;  1O7F A;  3ASN H;  3J80 K;  4LD5 A;  2D45 A;  1W7P B;  1MKM A;  5AIP A;  2OQG A;  2F4M B;  5K5Q A;  1G8X A;  1P9Q C;  1ZAO A;  1XB4 A;  2K40 A;  2CW8 A;  3IWZ A;  3JRI A;  4JP0 A;  2K4B A;  3E5Q A;  2IGM A;  3LWF A;  2BOL A;  2R4G A;  4MTE A;  2X48 A;  4QPO A;  3WTV C;  3S1R J;  4KUM A;  2WAQ A;  3KYD B;  2I5U A;  3I59 A;  2CV0 A;  1JKQ C;  1TWC J;  1UHS A;  1SFX A;  3A4C A;  5DTD A;  4X1E A;  1XCV A;  4ON0 A;  3GCM A;  1N77 A;  1KYZ A;  2KT0 A;  2ZJQ F;  3ZGK A;  4BXU A;  1D8K A;  2JJ7 A;  2HU9 A;  4BAC A;  4IO9 F;  3HKZ A;  2P5L C;  3IRR A;  1Q1V A;  4EQQ A;  3S8P A;  5D8L B;  2YX7 A;  4XLE A;  2J5P A;  1B59 A;  2CFO A;  3K1P A;  2HVS A;  2X6O A;  1D0Y A;  2BY1 A;  3HTS B;  3V42 A;  1A6Q A;  2OPT A;  2M1B A;  3F8M A;  3OYK A;  1ETX A;  2R5Y B;  2LRD A;  2JQ7 A;  3JSP A;  1XSD A;  1B9N A;  1BR2 A;  1F4K A;  2CV1 A;  4YEL A;  4R8H A;  1AWC A;  4GCV A;  1TQI A;  3S32 A;  1S7O A;  3BQY A;  4UB8 C;  3K70 C;  2HYJ A;  2XGX A;  2PMZ A;  2DLL A;  2ICW G;  3ZQ7 A;  1SAX A;  1BI2 A;  4FX4 A;  3J81 K;  5DD4 A;  4ITV A;  3RCO A;  2LMD A;  2LF7 A;  4C9Y A;  4HDU A;  1CF7 B;  3GXO A;  3WTZ A;  2PFB A;  4PJ0 C;  3KEQ A;  3PM1 A;  4ETS A;  5JVT A;  2BV6 A;  1R1T A;  1JGG A;  5FO5 A;  3V7S A;  3QOP A;  3G1M A;  3CJQ B;  1D8J A;  3DKY A;  4OIN F;  2NS8 A;  3GZN B;  4IRH A;  4EJV A;  2Z3Y A;  1AKH A;  1RNL A;  1OCC H;  1JTX A;  2VQL A;  3R60 A;  3CZ6 A;  3L9F A;  2XPV A;  3HKZ N;  4BXF A;  1NK3 P;  1W4M A;  1U2W A;  3BPX A;  4A6D A;  3GEZ A;  3HSE A;  3CO6 C;  3RKX A;  1T2K A;  4UY8 I;  2VPL A;  3ERE D;  2LDU A;  3MFK A;  3H92 A;  3DV8 A;  4PCQ A;  2P0W A;  3A02 A;  3UR3 C;  1G6N A;  2MFZ A;  2HR3 A;  2D1H A;  2L7Z A;  3PFY A;  2HKO A;  2FBH A;  2V9K A;  4G7O F;  1Z9C A;  5TRD A;  3QYB A;  1FJL A;  4BH9 A;  2E1M B;  4A3D J;  5IP7 J;  3CCR I;  4HNV A;  4XKC A;  1LDJ A;  1TQP A;  2PMZ N;  4KIS A;  3PUF A;  3CMY A;  1OCO H;  3SDB A;  4B8X A;  3HZJ A;  2NNY A;  5FD6 A;  5J8C A;  4IOC F;  2DOF A;  1H88 C;  1XD7 A;  2B9S A;  3IRQ A;  3RI4 A;  2JMW A;  3EUK L;  3OYD A;  2FOK A;  3J80 Z;  5EYR A;  4JX5 A;  2CW0 F;  5LFA A;  3FMQ A;  4IHY A;  2DDA A;  3GBG A;  4Y15 A;  3ABT A;  2RVC A;  1SFU A;  3RSN A;  4JYK A;  4O3M A;  5EZG A;  1WFX A;  3T8R A;  2VKV A;  1BI0 A;  2ZJR F;  2E35 A;  3FXM A;  2HQA A;  1NH3 A;  1B6A A;  5KAI C;  4FIS A;  2O3F A;  3DTI A;  2NVY J;  4QIW N;  4A3E J;  1T6S A;  4HRI A;  1IN6 A;  4M6X A;  1I6X A;  2H1L A;  2EV6 A;  5EDN A;  4Z2Y A;  4D0P A;  2R7U A;  1T38 A;  2AXT C;  3MWM A;  3RZD J;  3BP8 A;  1T0F C;  2HKX A;  3BTC A;  1TL8 A;  1DGW Y;  5GPC A;  3BQZ A;  2O03 A;  4XLN F;  2ME6 A;  1AKH B;  2K9M A;  3MEX A;  4XNF A;  2DFF A;  2OC6 A;  4RGR A;  4XLC A;  5H20 A;  1A36 A;  4KYW A;  1MSE C;  3K1M A;  2CYY A;  4FE4 A;  3I64 A;  3ZMZ A;  1XGO A;  4Y33 A;  1MBK A;  5KNL A;  1WKM A;  1GUU A;  2A61 A;  3P7N A;  3KP4 A;  5F27 A;  1SMY F;  1SAU A;  3E5X A;  2A3S A;  1FYM A;  1YI2 I;  2GBY A;  3S1Q J;  2CMP A;  2LRE A;  2F5V A;  3HPG A;  2BGC A;  1TZL A;  4FTH A;  1FIA A;  5LHH A;  3J81 Z;  2OQR A;  1HLV A;  3MQ0 A;  3I53 A;  3PIO F;  3CCM I;  2HVR A;  3VSK A;  5TGT A;  3DKW A;  2M5W A;  2PG4 A;  1LUJ B;  1G59 A;  2OAZ A;  2JVH A;  3JTH A;  2GZW A;  1EF4 A;  2EFO A;  2EK5 A;  2LYC A;  3RKY A;  4JX6 A;  1QGP A;  4KA4 A;  4AIK A;  2K3F A;  1U3E M;  2TRT A;  2VOP A;  4DW6 A;  2KJC A;  2KJB A;  3ML6 A;  1HQC A;  2EV0 A;  3BOQ A;  3L1P A;  4XRF A;  1SVO A;  5J6X A;  3QOE A;  1S9H A;  4NB5 A;  1I3A A;  2NOG A;  2H94 A;  4NNJ A;  2V7F A;  4HDV A;  3RPU D;  3RKW A;  2OZU A;  3BG7 A;  3K1N A;  2A6E F;  1I39 A;  5FKL A;  3TP0 A;  4OIR F;  2W84 A;  4U88 A;  4HA8 A;  5DYM A;  3NQO A;  2EB7 A;  4NQW A;  3ECO A;  1HDP A;  5GPA A;  3S16 J;  2XRN A;  1WCM J;  1E3H A;  3S1N J;  2HTS A;  1RUO A;  3PQK A;  1WJB A;  1LEA A;  2R7Q A;  2LVS A;  4PGG A;  3O3K A;  2M7A A;  3TED A;  2DU9 A;  5F64 A;  3PQJ A;  2P7V B;  3K69 A;  2YU3 A;  4RM2 A;  4XL9 A;  1F5T A;  1Y8Q B;  1ULY A;  5C4J J;  2Z33 A;  3DEE A;  3HOZ J;  3A2K A;  3J7Y J;  3OYE A;  3R6S A;  2MC3 A;  1VND A;  4CZZ A;  3N97 A;  3RJP A;  1P4X A;  2QSG X;  2HPI A;  2FRH A;  2M34 A;  3RDI A;  3WGG A;  2QEN A;  2PJP A;  1KQ9 A;  3BZ6 A;  1I5Z A;  2VIX A;  1ZLK A;  1DP3 A;  1JHF A;  3FBI B;  1Q1H A;  1Z05 A;  3L00 A;  3ZCO A;  2DW4 A;  2W25 A;  1UCR A;  3J7Z I;  3LFK A;  3T1B A;  1FP1 D;  3P9C A;  5KVR A;  3KLN A;  1I1S A;  3ZQG A;  1SVM A;  3HRT A;  1FNN A;  3BC8 A;  3S2H J;  1WI9 A;  2JA2 A;  2P6S A;  1Y56 A;  3GFI A;  4I99 C;  2CUJ A;  2G7U A;  5KCM A;  5C4X J;  1A5J A;  3V4G A;  5LGN A;  3GF2 A;  2Y69 H;  4L5J A;  4M6Y A;  2DA5 A;  4PGH A;  2F5F A;  2KP6 A;  1PP8 F;  3BWG A;  4IHT A;  2VT3 A;  3K10 A;  1WJD A;  5IOZ A;  5LEK A;  2KL4 A;  2R0Q C;  4OIQ F;  3C2B A;  1LE8 A;  2VI6 A;  1N25 A;  3B6C A;  2P7C B;  2EFP A;  2V79 A;  5CQE A;  3MVP A;  4CYD A;  3R0J A;  1RRJ A;  1ZK8 A;  2JTV A;  2XF6 A;  4DYR A;  1ONV A;  1FEX A;  1J9I A;  2JSP A;  1X1A A;  1BIA A;  4NQW B;  5LBQ A;  2LOO A;  1UMQ A;  4PSX A;  1XSV A;  4BEH A;  3S3N A;  1LFU P;  2ZKZ A;  3FK6 A;  3CCV I;  1FX7 A;  2BHY A;  4G6T B;  3QRF F;  3CP2 A;  5L3E A;  4BJ5 C;  2NXN B;  3KET A;  4V19 K;  2VE9 A;  3Q3S A;  4OIP F;  3WG9 A;  1XPX A;  4Y7N J;  4A3C J;  4NC7 A;  4OAY A;  2MBF A;  5EJC A;  1Z77 A;  2DPD A;  5A2Q K;  2M2E A;  3OYJ A;  4Y13 A;  2E5Z A;  4MIM A;  1BR4 A;  4D7M A;  2R7F A;  1ZR4 A;  4FCY A;  2VJ5 A;  1VTN C;  4YFX F;  4RA2 A;  2K3P A;  3TKY A;  2Y2Z A;  2WBM A;  5HOO A;  1R5G A;  1Z91 A;  5LHI A;  2JA7 J;  4O6J A;  3FXU A;  3GZ5 A;  1XSX A;  3FXL A;  2ELK A;  1YO5 C;  1S3J A;  4BYY A;  5K1Y A;  1HST A;  5D6F A;  5FRM A;  3HTU A;  2A07 F;  4BQQ A;  2R3S A;  2H27 A;  5DCM A;  5HDG A;  2K4J A;  3GTG J;  3LST A;  4PJM A;  5EZH A;  1YJN I;  4GRI A;  2EFQ A;  1T39 A;  1YYV A;  3BY6 A;  4L9N A;  3S2D J;  1KU3 A;  4IHX A;  5B1B H;  5DD8 A;  2XVC A;  1W5C C;  3KP7 A;  3GTM J;  5FFZ A;  3HDD A;  4KN7 X;  2ZME C;  2BE5 F;  2E60 A;  2HYG D;  3U2R A;  3C3W A;  4E7J A;  1APL C;  2A5W A;  2I8D A;  1CQT A;  3A03 A;  2VN2 A;  5JHU A;  2LKX A;  3DPL C;  1BL0 A;  4ASN A;  2IS4 A;  2HWV A;  1GXQ A;  5E79 C;  1K4S A;  2LK2 A;  4I09 A;  1K4T A;  4XN3 A;  5M3F J;  2ZFU A;  2PX9 A;  2DMN A;  1ZN2 A;  2L2O A;  1LE8 B;  1ENH A;  1WI3 A;  3ZQC A;  1V55 H;  4U87 A;  1BW5 A;  2E71 A;  4N4O B;  2ISY A;  1WWX A;  2IBD A;  5BPI A;  2L7F P;  3PSI A;  1P4A A;  2L0K A;  2V6C A;  3GYH X;  4F3Q A;  2EQR A;  3I58 A;  1WSU A;  3ABU A;  3SZP A;  4PZJ A;  3VYS B;  3G71 I;  1O57 A;  5FJ8 J;  4A3K J;  4XR6 A;  3S15 J;  4BEH B;  5C44 J;  3W6V A;  2JWT A;  5FLV A;  1U0J A;  2ZCW A;  3LOC A;  1LB2 A;  3CCJ I;  4B44 A;  1FY7 A;  2NOJ B;  3UNG C;  2LTP A;  3T8T A;  1ZHF A;  1ZGA A;  2OD5 A;  2O5R A;  1B9M A;  3BR1 A;  2V4J C;  2MD0 A;  4CIC A;  1JJ8 C;  1OJL A;  2CW7 A;  1JI8 A;  3A1Y A;  1Z7L A;  4IZZ A;  1XGS A;  2EPF A;  1X19 A;  1YOV B;  4GO1 A;  4PFP A;  5EGO A;  2IRF G;  4IHV A;  2M0C A;  1XS9 A;  2Q0O A;  3TOA A;  4LLG F;  4PDK A;  1R71 A;  4HV6 A;  1H0M A;  4UV9 A;  3HHG A;  4UNO A;  5ILU A;  3UKG A;  4EJT A;  5DCM B;  2R7T A;  4OU0 A;  3WGH A;  2XIG A;  2XGD A;  4CZC A;  2R7V A;  3BR6 A;  4F93 B;  4CO8 A;  3BR2 A;  3QYE A;  1R1V A;  4B47 A;  1POG A;  2COB A;  2LY2 A;  1IUY A;  4I6Z A;  3DXJ F;  2L9N A;  3VYU B;  1SD5 A;  2Z1D A;  3CUQ A;  4IVN A;  4LGW A;  3PO3 J;  2GA2 A;  2A6T A;  3I5U A;  2FUG 2;  3IH4 A;  4E4H A;  4HQE A;  1RKT A;  1MMN A;  3FHN A;  2HTJ A;  1D0X A;  3HRM A;  5IYC J;  1ZRE A;  2Z5U A;  1P6R A;  5A2Q Z;  1U6G A;  3K2Z A;  2K02 A;  5D5W B;  3F21 A;  1R22 A;  4I02 A;  3WU2 C;  1X4P A;  2E7X A;  2R7Z J;  4LG0 A;  4C2U A;  2K7L A;  3IH3 A;  2HOE A;  2W7N A;  1R1U A;  5FGM A;  4B1R A;  3FZV A;  3ZOB A;  2XSJ C;  2IS1 A;  5E3O A;  2EJR A;  3U1D A;  3RKQ A;  3LSR A;  4RB3 C;  1UG0 A;  2CO5 A;  3G1L A;  4H4K C;  4DIQ A;  5FKO A;  1YTY A;  3ELK A;  1YJW I;  2ETH A;  1ON2 A;  4KIF A;  1XN7 A;  2LY9 A;  3CF2 A;  2JRT A;  5M5X J;  3CCS I;  5GP9 A;  3IAS 2;  5J47 A;  2STT A;  3M1E A;  2ZNY A;  4B3X A;  3OYN A;  2W1O A;  1YS7 A;  5ICC A;  1SEU A;  1WH5 A;  1JKR C;  1K61 A;  4FET A;  4HX4 A;  5EGO B;  3IWF A;  4CCJ A;  3DPU A;  5DDG A;  3JSO A;  1UB9 A;  1GVJ A;  2VL8 A;  4HX7 A;  5E8I A;  2GLO A;  2V1U A;  4AID A;  2XAF A;  1R49 A;  3LSK A;  5L3B A;  5IP9 J;  3SZG A;  4QWQ A;  1EH7 A;  1W0U A;  4M74 A;  2FBI A;  4QSH A;  2CUE A;  2Z9O A;  2BW3 A;  3ZQH A;  2XDV A;  2A6H F;  5L3G A;  1V4R A;  3BTI A;  5GAG J;  4PUS A;  4RBO A;  3A01 A;  4HW0 A;  3S17 J;  4WXC A;  1VQL I;  1R7J A;  3QU3 A;  2BHZ A;  2ZFW A;  4UUV A;  3W2W A;  3SYT A;  1B4A A;  1SFK A;  1OYI A;  3JAM K;  5FKN A;  2HQN A;  5D6E A;  1MMG A;  3KYC B;  3EDP A;  2GIV A;  3RPU A;  3HOV J;  2ESH A;  2YUS A;  3BJO A;  2PQ8 A;  4QLC U;  4HLX A;  1MBG A;  4I76 A;  1IUF A;  3ECH A;  4LG0 B;  2VOD A;  1FC3 A;  3HOS A;  1Y1W J;  5BMZ A;  2H6C A;  2DAO A;  3CDL A;  5EF6 A;  1HBX G;  3K4C A;  2KQR A;  1OPC A;  1MSF C;  1S5L C;  1TTY A;  1BA5 A;  4M9X A;  3JR9 A;  2IJL A;  4EJO A;  1VQ9 I;  4LFU A;  4A5N A;  3WTU C;  2AXL A;  2BY0 A;  5FKK A;  1WPK A;  4EJW A;  1RES A;  5J1Y A;  4NC8 A;  2RQP A;  4MTD A;  1BIB A;  4XKW A;  1UEL B;  2LSO A;  2D1V A;  1Z21 A;  4KT6 A;  4G7H F;  4QPQ A;  3ZMS A;  1QU3 A;  2XB5 A;  3DBR B;  3BTJ A;  2K86 A;  1MNE A;  3TDZ C;  3QPS A;  2ID3 A;  3EPZ A;  3JTG A;  5H6Q A;  4A0Z A;  2QUF A;  3KIO A;  3GX4 X;  2O6G E;  1OFC X;  1U9N A;  3ONQ A;  2IGK A;  5KK1 A;  1ETV A;  3DEU A;  2W82 A;  4HV5 A;  2LR8 A;  3W6K B;  1OCP A;  2LNB A;  5IP6 A;  4PK4 A;  4HF0 A;  3VOD A;  3K6G A;  4RB0 A;  2KDZ A;  3WE3 A;  4EMS A;  3KEO A;  4KN4 X;  1MIJ A;  2BW3 B;  2DYS H;  4B4C A;  3OL3 A;  3VYT B;  1ZH5 A;  2E1O A;  3PJR A;  2M8G X;  3A01 B;  2XAG A;  4U0W A;  3TO7 A;  3H3U A;  3K4M A;  3AG1 H;  4MNU A;  1PJR A;  3MCZ A;  1FIP A;  2FOW A;  3R4K A;  3CMA I;  2Y31 A;  5IYD J;  2NYX A;  2UZK A;  4E7S A;  2DOE A;  1XMX A;  2DO7 A;  2GXG A;  3BT9 A;  4Z6Y A;  2DXI A;  4Q48 A;  1IN4 A;  1MMD A;  1W5S A;  3OOP A;  4CCL A;  2CQN A;  3KP3 A;  2PJR A;  2NVU B;  4M71 A;  1IDZ A;  4HG2 A;  5EEH A;  1FMW A;  1J59 A;  2ESN A;  3X2Q H;  3KP6 A;  3PL8 A;  4XLH A;  2M45 A;  2P6T A;  3CCQ I;  3MKW B;  4ZH4 F;  2V1X A;  1IRF A;  4UUS A;  1ZYR F;  4ZDL A;  2DBB A;  3WHB A;  4S0H B;  2X4H A;  3NAU A;  2D2W A;  2Y0S A;  1V3F A;  3SEZ A;  1NHA A;  1J2X A;  1R23 A;  2CUZ A;  2Y48 A;  3H9Q A;  2KDO A;  3LFU A;  3KLO A;  5F0H A;  5K5R A;  5EEG A;  4F7Z A;  3BR5 A;  2DK8 A;  3T5X A;  3TMO A;  3JAM Z;  4DQ2 A;  2WAQ N;  2A69 F;  5IT3 A;  4UV8 A;  2F4O B;  4BAY A;  5GTI C;  4OMZ A;  3P5J A;  4XK4 A;  3F8N A;  4XON A;  1ACI A;  5CYV A;  3QU6 A;  1WRJ A;  2O8X A;  3DCF A;  2Y75 A;  5F0C A;  1YE9 A;  3PIP F;  2OA4 A;  3K2A A;  1U9O A;  2HZD A;  3NWS A;  1IN5 A;  1ETK A;  2EIJ H;  3K7A J;  4W97 A;  3I59 B;  4KMF A;  4XMY A;  3L7W A;  1T56 A;  3E6D A;  2CV2 A;  2A5Y B;  1S29 A;  1GV5 A;  3VB2 A;  2IA0 A;  3FIW A;  4G6D A;  3IUO A;  4KFC A;  3E97 A;  2EIL H;  4IRG A;  1ZRC A;  4IEJ A;  4M3B A;  3FXJ A;  1LFB A;  3QPL A;  4WXD A;  3F3X A;  4E7I A;  5TIS C;  3DEW A;  4AU7 A;  2EFW A;  2X1C A;  3DFG A;  5J1R A;  4NDL A;  4HAM A;  2IP2 A;  2Y0S N;  4YEJ A;  2CSO A;  5HVQ C;  4NHJ A;  2RNJ A;  3LQR A;  3V8J A;  2PI0 A;  1KQ8 A;  4UVA A;  3TBI A;  2CQQ A;  3G2B A;  5K5O A;  1G3Y A;  2L9S A;  2M4G A;  3GFL A;  3AG3 H;  4J19 A;  2Q1Z B;  5D5U B;  2H09 A;  1MMA A;  2CQX A;  4N9I A;  4AIH A;  2V26 A;  4WWC A;  3GO5 A;  3PNV A;  1BJA A;  2NNN A;  4CCM A;  4MO7 A;  1DQU A;  1K78 A;  2DOA A;  3AFH A;  1R9T J;  1AOY A;  3R0A A;  2HDC A;  1ON1 A;  3K4K A;  1TQM A;  3A0H C;  3BZC A;  1P7I A;  1YS6 A;  4C30 A;  3OL4 A;  4MEY F;  5DUI A;  4Y52 J;  3U21 A;  3FHZ A;  3OIQ A;  4JQF A;  4LIU A;  2IXS A;  3KE2 A;  1W0T A;  2HZT A;  4LK1 F;  4A5M A;  3NRV A;  4XLA A;  3OYM A;  4UUT A;  4F52 A;  2R92 J;  3VPR A;  1BC7 C;  4C2M J;  1RKW A;  1IAW A;  4MQ9 F;  3GFM A;  3C18 A;  2RAE A;  3ZMU A;  1A6I A;  4HNT A;  2EZI A;  4A3J J;  1H89 C;  2X51 A;  4ZC3 A;  3CCE I;  2Y30 A;  2FMY A;  2OCC H;  4KIT B;  1I3Q J;  1XGM A;  3PFI A;  1OCT C;  1FSE A;  2HI3 A;  2ADU A;  1MBF A;  4ESF A;  4ZYD A;  4HF1 A;  1T08 B;  3KCC A;  3CCY A;  3LA2 A;  1U78 A;  2XPW A;  4BY1 J;  1BC8 C;  2ZXJ A;  2XPU A;  4AVZ A;  1YW8 A;  4OAZ A;  1HDD C;  1OYW A;  3ISP A;  2P5K A;  2Y0M A;  1LJ9 A;  4KJZ A;  4D7N A;  4YIF A;  1MZB A;  3SEQ A;  2OUM A;  1MGT A;  2L3D A;  4GFB A;  2CQ7 A;  3F8C A;  3GW2 A;  3TW6 A;  4WX9 A;  1H8A C;  1D0Z A;  3WGI A;  1QVT A;  5ILS A;  4B48 A;  2VBX A;  1OR7 A;  3KP2 A;  3M8E A;  3CUO A;  1YIT I;  4IQ4 A;  3OYL A;  1K83 J;  1MMS A;  5GAH J;  4FQG A;  2NVQ J;  4G7Z F;  1BI3 A;  2XF5 A;  3OIO A;  4BKX A;  2BEO A;  2IAI A;  1UHM A;  3AKZ A;  4KIB A;  1D1A A;  2EA2 A;  1HF0 A;  5IY5 H;  1V5E A;  3RYP A;  1K78 B;  1F36 A;  3FM3 A;  3RZO J;  1FYL A;  2CRG A;  4HQM A;  1B72 A;  3PSF A;  5L3C A;  5FB2 A;  1Y39 A;  3OSF A;  2P4W A;  2IEK A;  3FK7 A;  3FMR A;  3COA C;  1W36 D;  3JCU C;  1FPQ A;  3FM5 A;  5B5E C;  5F08 A;  3IC7 A;  5D5V B;  3OIP A;  3IP4 B;  2XF7 A;  2K9N A;  1VQP I;  1XGN A;  4RLF A;  1G3S A;  5E18 F;  2J5O A;  2IA2 A;  4ZYA A;  4S05 A;  3H5R A;  4ZDP A;  1T95 A;  1X1P A;  3LA7 A;  4BUP A;  4ZDO A;  2EIM H;  4LIT A;  4EJU A;  3L2W A;  3Q0V A;  2XKP A;  3HEF A;  1FYK A;  3OV8 A;  2QM3 A;  2F2E A;  1CGP A;  5CJ9 A;  3ZMV A;  1GHC A;  1TW2 A;  3FX3 A;  1LVK A;  1T33 A;  4ENJ A;  5D4S A;  5CLS A;  1HCR A;  2HQR A;  2LFB A;  2WTE A;  1S72 I;  3AG2 H;  3FXQ A;  5LGU A;  1MJ9 A;  1R00 A;  3V7R A;  1A35 A;  1HSJ A;  1FMV A;  2XAH A;  2H1K A;  2LKP A;  2ZO4 A;  2ZNZ A;  4RLQ A;  1YHQ I;  2FXA A;  2O8K A;  2QSF X;  1BOA A;  5GAE J;  3AG4 H;  4QTR A;  3BR0 A;  4S04 A;  5F1J A;  2DJI A;  1E0E A;  2KIQ A;  5E1Z B;  3G3Z A;  1YRN A;  1QPM A;  3L09 A;  1HA8 A;  2F5D A;  2VQC A;  3O6B B;  3VWB A;  1GV2 A;  3KEY A;  5B3S H;  3HL2 A;  2KIS A;  2X6X A;  4I2O A;  3DTE A;  2ID6 A;  2W48 A;  2XV4 S;  2E36 A;  2L9R A;  2E19 A;  2KIF A;  4K2E A;  2H6B A;  1R5I D;  2DK5 A;  2DQL A;  3M8J A;  3W2V A;  4ZJZ A;  1AA7 A;  1B72 B;  1IRG A;  3LSI A;  2OTJ I;  3FWE A;  1SD6 A;  4AVP A;  1HKS A;  3KZY A;  2QQ9 A;  2P5V A;  4E7H A;  2DMQ A;  5LRR A;  2JA5 J;  4XLP F;  2N8G A;  2GA1 A;  3I9V 2;  2KZV A;  3BPV A;  2OZ6 A;  4EV0 A;  1I1G A;  4AUX A;  1O3R A;  4CSW A;  5E1W A;  2FE3 A;  5J8F A;  4MGR A;  2DFE A;  4RS8 A;  3E6M A;  3S14 J;  4X6A J;  1WVR A;  2ECC A;  4E7L A;  5LHG A;  1RIO H;  1WHU A;  2DA6 A;  3EYY A;  3BG6 A;  3WTT C;  3M7G A;  3HOW J;  1QZZ A;  3ULQ B;  2W00 A;  3K4L A;  2PMH A;  1MBJ A;  4G12 A;  2GXB A;  2VOO A;  5DEQ A;  1XCB A;  1D5Y A;  3PNT A;  1IG7 A;  3EQL F;  5K7H A;  2PLY A;  1X3U A;  1J09 A;  1X1C A;  3CUQ C;  3BG9 A;  2WAE A;  4BQN A;  2B7E A;  1SVL A;  4XKB A;  2M0M A;  3U9G A;  2NS7 A;  1O3S A;  1FTT A;  4U0V A;  3MMY B;  2ZB9 A;  3I4P A;  4YIR X;  3DBL B;  2HYF A;  2L9V A;  4HST A;  2XB0 X;  1WJA A;  1JT6 A;  2DFI A;  2DMP A;  1S7E A;  2R7D A;  3OYB A;  1RPW A;  5BOX A;  1WJC A;  3JRG A;  2VXZ A;  3DLL F;  4NUB A;  3KFW X;  1ODD A;  1YRN B;  1ORK A;  2ELJ A;  5B1A H;  2F5C A;  4XLF A;  5FD5 A;  5IOY A;  4ENN A;  5CVJ A;  4DZP A;  1SFO J;  3OYA A;  2P81 A;  4M3F A;  3OY9 A;  1TNT A;  1K79 A;  1RR7 A;  4G8X A;  1Z1D A;  2EZH A;  1OMI A;  3E6C C;  4H0E A;  4LMY A;  1G4D A;  3TDU C;  2AS5 F;  1HW5 A;  3HBL A;  3S1M J;  4HF2 A;  4XN0 A;  4L0Y B;  1IF1 A;  4CHU A;  3MAJ A;  3M1C A;  3ROU A;  3D5S C;  2QEX I;  2W57 A;  3IHU A;  2R5Z A;  4JOM A;  4P96 A;  5CKT A;  1XDS A;  1V5F A;  4KT5 C;  2VXD A;  2KHM A;  3CP8 A;  3CF5 F;  3OS1 A;  3DTK A;  4CXF A;  2DJN A;  1R4M B;  2XSD C;  3RTR A;  3VEP A;  4XID A;  3NEU A;  3TQN A;  3WTX C;  1QQI A;  1WGX A;  1K6Y A;  3JRB A;  3FBN B;  2DT6 A;  2XGE A;  3DWL E;  3DF8 A;  3DP7 A;  4UB6 C;  3MN2 A;  3Q0W A;  4XRS G;  1XC5 A;  4IHW A;  4F92 B;  4F55 A;  1EH6 A;  5HS7 A;  3LSP A;  3BTL A;  3LSG A;  3D5R C;  5E20 A;  2GIZ A;  3F8F A;  1YW7 A;  4D1Q A;  3E5U A;  3FDY A;  1VQK I;  3CC4 I;  4RDU A;  1WJ5 A;  2VC1 A;  2P8T A;  3WE2 A;  3LNQ A;  3LQQ A;  1PVE A;  2KRF A;  1VQ4 I;  4P1W A;  4RMN A;  2IGO A;  3JRF A;  1OCR H;  2RNG A;  4BE1 A;  2TCT A;  1FP2 A;  3HHH A;  3M4O J;  3HOT A;  2VBW A;  1VZ0 A;  2XAQ A;  1FOY A;  1X1D A;  2LF8 A;  1K6O A;  4IRI A;  1JJ6 C;  1MBE A;  1B1B A;  4M6V A;  4RB2 C;  1JT0 A;  4XOP A;  2HXI A;  3JRD A;  3TO6 A;  3FXR A;  4X0G A;  1A31 A;  2KMU A;  4BDZ A;  1DPU A;  3ZMD A;  2TDX A;  4CA0 A;  1TP4 A;  1U5T A;  1MH3 A;  1JE8 A;  2XRO A;  2CS3 A;  1IXC A;  2F48 A;  2JN6 A;  2MLG A;  3CCL I;  2ZXW H;  4JBA A;  2E1C A;  2E5N A;  4BJ6 C;  1JTY A;  2ZSH B;  1Z3X A;  2WV1 A;  1IV6 A;  2ISZ A;  2QBY A;  2G9W A;  2YPR A;  2L54 A;  3GUD A;  4LOC A;  5J40 A;  2HQ5 A;  2X6W A;  4EM2 A;  4YRV A;  1J5Y A;  2AQF A;  2R5Z B;  3HIF A;  5HLG A;  3CC2 I;  3K70 D;  2K9S A;  2VQH A;  2I10 A;  3V8L A;  2BXY A;  4CUG A;  4LB6 B;  1VQ7 I;  2PN6 A;  3I56 I;  4IQJ A;  1FBS A;  3OYF A;  2WA0 A;  3IAM 2;  1NK2 P;  3F23 A;  2DA2 A;  2FML A;  2X9D A;  3ZP5 A;  2PEX A;  4L5I A;  4HLY A;  4AIJ A;  2KRC A;  5JLX A;  2NVX J;  2B0L A;  1XTA A;  4LG3 A;  2NS0 A;  2Y9Y A;  3F8B A;  3JRC A;  1Y6I A;  4O5V A;  4IXA A;  4U7B A;  4RB1 A;  5JLW A;  3A0B C;  3NAR A;  4ESJ A;  2KZG A;  1JUS A;  4NC6 A;  2VUM J;  2QF7 A;  3E0J B;  4ZYE A;  4CGZ A;  2Y9Z A;  4LJZ F;  1IRZ A;  4WF2 A;  1YX5 A;  3N4M A;  1V54 H;  5KAF C;  5J1U A;  2FX0 A;  4Q47 A;  4UHT A;  4I0B A;  2L02 A;  1X1B A;  1DU0 A;  1OCZ H;  2JA6 J;  5DM6 F;  2KKO A;  2KPM A;  3Q0U A;  1XMA A;  4GDF A;  2JVG A;  4NBQ A;  1VQ8 I;  3CD6 I;  3S2W A;  5ED4 A;  4DGW B;  4B43 A;  3PUB A;  1ZKG A;  5EEA A;  3Q5F A;  3D0S A;  5E1X A;  1IGN A;  3EET A;  5CQG A;  1VF9 A;  3M9A A;  3IKV A;  4IF4 A;  3ZXS A;  2Q2E A;  4MFE A;  1U5T B;  2VBY A;  1Y8R B;  3VYR B;  2MH9 A;  3CUQ B;  3WTW C;  3DBH B;  2EBI A;  1F1Z A;  4EGY A;  2QVO A;  2EZL A;  5D4R A;  3QWL A;  1Y1V J;  4OWR B;  3N05 A;  3BZK A;  4FE7 A;  3OS0 A;  5E17 F;  2L7M P;  4A3I J;  1TW3 A;  2WC2 A;  2QBY B;  3LL7 A;  2M9H A;  2EIN H;  2LP0 A;  2BZT A;  2HOS A;  2K27 A;  2FBK A;  2QYO A;  2JSC A;  3REO A;  2M8E A;  2LBF A;  3VSL A;  1I27 A;  1ZLJ A;  1LQ1 A;  3EYI A;  1X58 A;  2V9V A;  4V2F A;  4A3F J;  1ZGW A;  2B63 J;  4KMU X;  4BU2 A;  3OMY A;  4GYG A;  5C3E J;  3LAJ A;  1KON A;  1YFH A;  2QLZ A;  3EUH A;  1ETY A;  1HW1 A;  3VDX A;  2YSR A;  3OSG A;  4CYC A;  1MD0 A;  5J3L A;  3RQI A;  1P4W A;  2M30 A;  3QPT A;  3FF5 A;  4BHC A;  3GLX A;  2VPR A;  4I98 B;  1SMT A;  4IL6 C;  2ACJ A;  1KZH A;  1X2M A;  1JXS A;  4TV7 A;  4RGS A;  4BE2 A;  1AHD P;  1E3O C;  3BCA A;  4MHG A;  3GTL J;  3CMM A;  2L4M A;  1LPQ A;  2XRL A;  2DYR H;  2GWR A;  5KHD A;  1WJF A;  2LG4 A;  1IJW C;  2R7O A;  5JFR A;  3L2U A;  1U8R A;  3LSM A;  4B09 A;  1DDN A;  4N9H A;  2VON A;  5DV5 A;  3H5A A;  2BVL A;  3LAP A;  1WZ2 A;  2JZY A;  2LKS A;  1J75 A;  1J0R A;  4XSX F;  1I50 J;  5FFX A;  4EGZ A;  3CO7 C;  4AYB A;  1Z0X A; 
#chains in the Genus database with same CATH homology
 1S72 I;  3CCJ I;  1QA6 A;  1VQ6 I;  1YHQ I;  5GAG J;  3I55 I;  2QEX I;  1YI2 I;  5JVG F;  5GAE J;  3G4S I;  1VQL I;  3CF5 F;  3CCQ I;  2E34 A;  3CCE I;  3PIO F;  5DM6 F;  3CCM I;  3CJT B;  1VQ8 I;  3CC7 I;  3CD6 I;  2QA4 I;  1VQ5 I;  5GAD J;  3CCV I;  2E36 A;  3CME I;  4UY8 I;  2NXN B;  1VQN I;  4V19 K;  2K3F A;  1VQK I;  3CC4 I;  2OTJ I;  4IOA F;  1VQ4 I;  1YIT I;  1VQ9 I;  3CCR I;  1FOX A;  1ACI A;  1MMS A;  1VQM I;  5GAH J;  1FOY A;  3PIP F;  3G6E I;  4IOC F;  5DM7 F;  2OTL I;  3CCU I;  1YJN I;  1Y39 A;  2H8W A;  1VQO I;  2ZJQ F;  3CCL I;  2ZJR F;  2E35 A;  3J7Y J;  4IO9 F;  1YJW I;  3CCS I;  1VQP I;  1HC8 A;  1YJ9 I;  3CC2 I;  1VQ7 I;  2JQ7 A;  3I56 I;  3J7Z I;  2FOW A;  3CMA I;  2ZJP F;  1FOW A;  3DLL F;  3G71 I;  1YIJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...