3CCLI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cclI00
1VQLI 1YJ9I 3CMAI 3J7YJ 4IOAF 2ZJQF 1YJNI 3CCSI 5GAGJ 1VQ7I 2K3FA 1YIJI 3CF5F 3PIOF 4IO9F 1FOWA 3CCJI 1QA6A 2E34A 2FOWA 3CCVI 1ACIA 1YHQI 1HC8A 1VQ5I 1MMSA 1FOXA 3CC7I 4V19K 3J7ZI 5GAEJ 3CD6I 3G4SI 1S72I 3CJTB 1VQOI 1YI2I 5GAHJ 2JQ7A 2QEXI 3CCQI 5GADJ 3I55I 1VQ4I 3G71I 3DLLF 2H8WA 1VQNI 1VQKI 2NXNB 1VQ6I 3G6EI 5JVGF 2ZJRF 1VQ9I 1YJWI 1YITI 5DM7F 3CCMI 3CMEI 3CCEI 3CCRI 2QA4I 3I56I 1VQMI 2E35A 3CCLI 2OTJI 4IOCF 5DM6F 1VQ8I 2ZJPF 1FOYA 4UY8I 2OTLI 3CC4I 3PIPF 3CC2I 1VQPI 1Y39A 3CCUI 2E36A
chains in the Genus database with same CATH superfamily
2W1OA 1X1DA 4KN4X 4U88A 3VYSB 3A01B 3V42A 1EA3A 4NUBA 5F0CA 1B72B 2E71A 3H0DA 4OAYA 4UV8A 2NNYA 2BY0A 4IX7A 3I9V2 4XRFA 5CKTA 1TWCJ 2CU7A 1AHDP 2K40A 1MSEC 3ZQGA 1G8XA 2AXLA 2P6SA 1HDDC 3CP2A 1YIJI 2KIUA 5IP6A 1TL8A 1ETQA 5FKKA 3MN2A 4KT5C 2QM3A 3HUGA 4EGZA 2CFOA 4XBFA 3OYGA 4AM3A 3BZ6A 3H5NA 5CVVA 2Q8KA 2ME6A 1O3QA 1U6GA 1B8IB 2RVCA 2WAQN 2ZXJA 3F8MA 2V4JC 1RI7A 1O7FA 3L09A 2NVYJ 1FOXA 1OCZH 3CC7I 2KDOA 1MSFC 2DA4A 2K85A 5BS6A 4C3HJ 1RR7A 1W5CC 2Y9YA 5DDGA 1D3YA 3TKYA 4U87A 5FKLA 2DAOA 4KNYA 2M7BA 4JYKA 5L3DA 4Z6YA 4HG2A 1O3RA 2EIKH 2OQGA 3X2QH 3ASOH 3L9FA 1IN5A 3EQLF 2NVXJ 3MKZA 3EETA 3IWZA 1WI3A 4AYBN 3ERMA 2HVSA 4HX4A 5B66C 4W1UA 2CSOA 3CUQA 3PO2J 2Z2SB 2EZIA 2E1MB 4BHPA 3F23A 3W6VA 4RB3C 3S1QJ 3O3KA 1Z9CA 2P5KA 1P6RA 3CF2A 2ACJA 2HU9A 1VQNI 1V5EA 1JUPA 3U2RA 2DI3A 3BY6A 1HBXG 3RKWA 2X6WA 5EG0B 4LOCA 5IT9Z 2NVUB 5LBQA 2KL4A 1XMAA 5LRRA 1T33A 3UR3C 1YITI 1BJZA 2KKOA 5DD8A 3KP2A 2D45A 2VQLA 5HS9A 5J4VA 3JRAA 4BXUA 3DBRB 3S14J 2VQGA 5AONA 2XPVA 4PSWA 3GTGJ 1FBQA 2V1NA 2WBMA 3JRBA 5D6FA 3RKQA 4RGUA 4UVBA 3A2KA 3PQJA 1ETKA 4F93B 3TOAA 4ZH4F 4IOCF 4CDGA 1FMWA 2MBFA 4OIRF 1IUFA 3PFIA 1JTYA 3BG6A 2E5NA 3LL7A 1OLTA 5DUKA 4D9JA 2RN7A 2EIMH 5H6QA 3H36A 1MJ9A 2VT3A 2EILH 1FPQA 2KZVA 3B73A 1N75A 2VQCA 1P2FA 2GAUA 2XGXA 4AWXB 3OS2A 5HNFA 2PFBA 4M3BA 5F27A 1OCRH 2BHZA 5KCMA 4OINF 1X1CA 3SHFA 2FBIA 3HKZA 4F7ZA 3ZGKA 2DT5A 3OYNA 3LMMA 1ZREA 2Q1ZB 3CF5F 1Z7LA 3EUHA 3TOBA 1SAUA 1X1BA 5C3EJ 1UG0A 3BR6A 4AIDA 2O9LA 2HWVA 4I6ZA 2MLGA 3O8HA 2Q0OA 3AL0C 4G9YA 3RQIA 3SZGA 4LMYA 1SD6A 3ZR8X 4RAZA 1S7OA 4NC6A 3HL2A 3VWBA 5L3BA 4E6KG 2JPBA 4AVPA 4KN7X 4A3KJ 5GAEJ 3F8FA 4HF0A 1JE8A 4O3MA 4Y17A 4EEFG 2KRHA 2HXIA 4F91B 2M1BA 2VBXA 3FXOA 2XSDC 2HTJA 2FBHA 2HQRA 1YI2I 3OR1C 4E7ZA 2W85A 4LLNA 3CCQI 3QOPA 3LFKA 3N05A 4G8XA 4XMYA 3ZN1A 2JUCA 1WGXA 2VJ4A 1FP1D 3I53A 2L7KA 2HYFA 4C3JJ 4XQFA 1K6OA 2BXZA 3GFMA 3KETA 1K7AA 4XRMA 1B6AA 5K1YA 2KDZA 2IA1A 2X4HA 4LIVA 2MH9A 2O03A 2W25A 3GEZA 3KPHA 1K4SA 2QBYA 3DBHB 4MFDA 1QZEA 4CO8A 4IRGA 3OWTA 4LG3A 2L7FP 3H5AA 1Q1VA 2RDPA 4UUTA 1KGSA 3CDHA 3OSFA 4HRIA 5FGMA 3CESA 4A6EA 1ETXA 4H0EA 1U5TA 4ZYGA 1D1CA 1SVMA 4XLEA 3CCMI 2M9HA 5IOZA 4WX9A 1VFCA 4HSTA 3FXUA 1E0EA 2CQKA 4Y4RA 2G7HA 1X4OA 2DPUA 1X1AA 3B6CA 1Y1VJ 3K0LA 3LQRA 1IV6A 2F5EA 2DO7A 1TC3C 1BR2A 1DGWY 2PX9A 1VQ8I 3A0HC 2GA1A 1U2WA 2FOKA 1O4XA 3O2PE 1FBSA 4UHTA 4GYGA 4A0YA 4EJVA 2ICWG 2Y9ZA 3KLNA 3HDDA 4Y52J 4RGRA 3OOPA 5HDNA 1ZR4A 3MEXA 3LSKA 1H89C 5ERIA 5GTHC 1L0OC 1I5ZA 4P55A 2V6CA 2IS1A 3HM5A 4JX4A 4E7KA 4PK4A 2XB0X 2L3DA 2M45A 1TT5B 4HF2A 2EA4A 1TT0A 4BQNA 5E1ZB 2OCEA 5EZHA 2VBZA 1OR7A 2DFFA 1TNSA 3M07A 4WXDA 3OYBA 1EV7A 3DLAA 1ITYA 1EJ9A 3EYIA 1OFCX 3GXOA 4G7ZF 3GBGA 4EATA 2XF6A 2OQRA 2ID3A 2CMPA 3I71A 2DMTA 3IUOA 4A5MA 4PDKA 2L02A 3FF5A 2LK2A 2VJIA 4OIPF 3SEQA 4MTDA 5J47A 3CCVI 1MBFA 2VN2A 1YHQI 2A6TA 2CUFA 4AIKA 1T95A 2WV1A 2K7LA 2FJ1A 2ZMEB 4D5FA 1R36A 1FSEA 2JTVA 3SZTA 2VC0A 2HDDA 2COBA 5LHIA 5D4SA 4CCOA 2NS0A 1P4WA 1HDPA 3M1EA 3WHCA 4KITB 5L3GA 1JI8A 4UV9A 1YLFA 3U9GA 1MJBA 3REOA 2UXXA 3ZMSA 1T39A 2XPUA 2QZ8A 2YPRA 2HDCA 1GUUA 3CMMA 1SFEA 4ESFA 3T1BA 1OKRA 1J0RA 2EPFA 2WA0A 3LQQA 1IV8A 2BHYA 2PN6A 1BW6A 5CPRB 2VUMJ 2PJRA 2ELHA 4XRSA 3CDLA 3DKWA 3MKWB 4E70A 3BPXA 4MQVA 4V2GA 3TP0A 4II3A 4HZFA 1KYWA 1S5LC 3IC7A 4KMUX 5M3MJ 3KEQA 2M8GX 1WH5A 3IWFA 4AU7A 3K69A 5IYBJ 4CSWA 2H8RA 2STWA 2VT2A 2BGCA 1JHFA 4B3AA 1OJLA 1W7PD 4RB2C 5KVRA 2RNGA 1TP4A 3KP4A 1LDJA 4V2FA 4F55A 5F6FA 3S16J 1VI0A 1USTA 2D1HA 5DCFA 1DPUA 1HW1A 4PCQA 2EV6A 5A2QZ 2QA4I 2ID6A 2ELKA 5ILUA 2QVOA 2CJJA 4RM3A 5DYMA 2ZB9A 3KEYA 3Q0VA 2VQHA 3RTRA 1YE9A 1H9TA 2OZ6A 3F6VA 1EH8A 1E17A 3PIPF 1ERDA 1VQPI 4K2EA 4NQWA 1LEAA 1Y39A 5E17F 1R1VA 1XGOA 5E8GA 4KICA 1MZBA 2QQAA 3FIWA 3ASNH 2KLOA 4PJ0C 4ZJZA 4HNVA 3VDXA 3H3VK 3T5XA 3PQKA 2CO5A 2ZJQF 3WU2C 1JHHA 5L3FA 3CTAA 2CUJA 4NNJA 3OS0A 5GPAA 3SYTA 3JRGA 4G6TB 2HTSA 3CJQB 4BH9A 1WZ2A 4EM2A 2I5UA 2VXZA 2M8EA 1FX7A 4L9NA 3QPTA 4BY7J 4PGHA 4HX7A 3AKZA 3TDZC 3H5RA 3LSPA 3GF2A 3JREA 3PL8A 1QHHD 3TO6A 2QSFX 2PI0A 5D5UB 2JRMA 1ACIA 1R5HA 2AQFA 4MEYF 4CA0A 1TZLA 4XRSG 1WPKA 1W5TA 3JRCA 1C0WA 2JMWA 1QO0D 1EH7A 1SD4A 1U5TB 3L2WA 2UV1A 1XDUA 1IN4A 2LP0A 4I2OA 5L3CA 2IXSA 3E6MA 3G3ZA 4XR6A 4UUSA 1E2XA 2EA2A 2BOLA 4Q48A 2ADUA 4XN0A 2QEXI 3WGGA 1MJAA 3GWZA 5B3SH 3RDIA 3CZ6A 5B1AH 2JRTA 5K5RA 4MTEA 3GUDA 1HF0A 3QU3A 5HS8A 2QSGX 3G71I 3KP7A 5TJJA 2V9PA 3J7AO 4HX8A 1OQYA 1XMKA 3HSRA 2KRCA 4OMZA 2R5YA 4BS9A 1NK3P 4P5OA 2YX7A 1YW9A 3A01A 1GXQA 3HRSA 4CICA 2NXNB 4TV7A 1B72A 4B43A 1SFXA 1Z6TA 2BEOA 1XCBA 2HVQA 3TL4X 2DT6A 1Y0NA 3GTQJ 4WCGA 4CGZA 4ON0A 2JJ7A 3I0TA 3TQNA 4B47A 4M74A 3DFGA 3GZ6A 5GTIC 5DTDA 1ZARA 4PJLA 4I7HA 5ILVA 4BYYA 3RQ4A 3KYDB 1Z0XA 4JX6A 4CH7A 3TBIA 4AC0A 2CH0A 2LY1A 4XLCA 1LVKA 1ZRDA 1B8IA 2CWEA 1Z3YA 1AKHB 3FK6A 3T8RA 3FXMA 3DU5A 2Z33A 4A12A 3T0YA 2IS6A 4B09A 2NOJB 1YRNA 2A69F 1VQLI 1S6LA 5IP9J 4BQAA 4BBRJ 2V26A 5CVJA 3SEZA 3QQAA 1ZYRF 1MMGA 1WH7A 2VASA 3BG7A 1ON2A 2HR3A 4P9FA 4X0GA 2P81A 2FD5A 3BR1A 1HLVA 4R8HA 2DJNA 1Y56A 4I09A 4BKXA 2ELJA 3R6SA 5M5YJ 4E7IA 1ZK8A 2QENA 2F4IA 5J8CA 3LAPA 2FOWA 3LSMA 1P4AA 1I1GA 2BXYA 3WTSC 3JR9A 1VQ5I 1B9NA 3RSNA 2DOFA 4BNCA 3J81Z 3DTKA 3F8NA 3R0JA 5EG0A 1POGA 4HW0A 4FCYA 3KX2A 3GVAA 1LNWA 3CD6I 2JT1A 2IGMA 2VE8A 4BUPA 2Y30A 3ABKH 4HQEA 4DYQA 3F72A 4OIQF 1WQ2A 1E3PA 1QZZA 2EFQA 2XAQA 4M9XA 3WTTC 1ZG5A 2A61A 3C2BA 3S3OA 3W6JB 2JA8J 1R9TJ 2NYXA 3RYPA 2OC6A 1FSHA 5E8IA 2R92J 1XGSA 3T8TA 1X3UA 2EFOA 2FBKA 2YSRA 3QU6A 1GHCA 4RM2A 1FIPA 4A6DA 1PP7U 1LVAA 4AIHA 1UJ8A 3VPRA 1PJRA 1D0YA 1ETWA 3SQNA 1GV2A 3Q0UA 3TO7A 1O57A 2Z5UA 2ZBKA 3V7RA 4BGDA 1Y0UA 2TDXA 4D0PA 3OYLA 2PEXA 2M5WA 1YJWI 3LAJA 2KZGA 1NG7A 3L2RA 3S1RJ 2DMQA 1HKTA 2M30A 1G3TA 3IH2A 4A3IJ 4XLFA 3K1PA 2A07F 1TW2A 2WB1A 2X1DA 5F1JA 5E20A 4KYWA 2YR2A 2ESNA 3GLLA 2MABA 3WU1B 2HZTA 4BACA 5CLSA 1LQ1A 4IQ4A 1UHMA 4PJMA 4O5VA 3S2WA 3WTZA 1WJEA 4MNUA 4OU0A 9ANTA 1ON1A 2E2IJ 3CC4I 1RRJA 1WJFA 4ZTFA 5BPDA 2HKOA 1K79A 3ZXSA 2FEZA 3C3WA 3LFUA 1DDNA 4GGGA 1KONA 2XSJC 3KZYA 2L2OA 1S7EA 2FSWA 1BC7C 3M9AA 3NEUA 4U0VA 5B1BH 4DYRA 1YJ9I 1IF1A 1T0FC 2B63J 3EUAA 2PMZN 3BZKA 4NBQA 4BXFA 1WKMA 2JA6J 4JX5A 1SMYF 3LSTA 3M1CA 2QQ9A 1FZPB 1SFKA 4C2UA 2VBWA 2VI6A 3QODA 5DCMB 3RZDJ 2L01A 3JTGA 3CLQA 3E3VA 3H1CA 4HOBA 4XKBA 4IHTA 2LKPA 1ZELA 4QLCU 2WADA 1QA6A 1ZLJA 2F5FA 4BDYA 5FB2A 3V8JA 1HKQA 1Z7UA 5M5XJ 3KP6A 4M71A 3S2HJ 3LA7A 3OS1A 1K78B 1HOMA 2AS5F 1FMVA 3HOYJ 4IEJA 2ZJ2A 1A6QA 2B0LA 4IHXA 2K9NA 3BZCA 4QIWN 3BPVA 3DWLE 1TTYA 3J7ZI 1E3OC 4RMNA 2QCOA 2P0WA 1ZH5A 2TCTA 5LEJA 2XB5A 2OF7A 2P5LC 3I54A 1S72I 4R1HA 3LSGA 3HOXJ 3E6DA 4FISA 5H2FC 1G3YA 5JFRA 3F9KA 3W2AA 2GBYA 4BE2A 4I76A 3K4NA 3OYFA 1UB9A 4I98B 5GADJ 1YW7A 3B02A 4BHBA 4RAGA 3W6KB 3R4KA 1QRYA 3PM1A 2OU2A 3WU0A 4BBSJ 4LG0B 3P9IA 2H8WA 4LD5A 2V1UA 3QP5A 1YRNB 1I50J 2EFPA 4MGRA 2AXTC 3BQYA 1D1BA 2XGCA 1VQKI 3CDIA 2GOXB 2XDVA 1KQ0A 1GVJA 2HQNA 1IXSB 2ZXHA 3G1OA 4RGSA 4BQQA 3HOUJ 2Z16A 3F8BA 3BR2A 3H9JA 1MDMB 4GDFA 4RDUA 3BTLA 3DQVC 2LFBA 2E5ZA 3K70D 3S3NA 4IHVA 4C2TA 3PNYA 2A05A 1Y8RB 4E7JA 4C30A 3I56I 4XK4A 4CUGA 5DM6F 4Y7NJ 3E0JB 3HZJA 1XCVA 3SXYA 3AAFA 1KU3A 2RKHA 2DT7B 3LSHA 2R7SA 3BR3A 4FX0A 2ZMEA 3FMRA 1D5YA 1TWAJ 3MAJA 2LR8A 1SANA 2HXOA 2LKSA 2BE5F 2C6YA 2V1XA 4UB6C 1P4XA 3GO5A 5F1RA 2BY3A 4MIMA 1BIAA 2V7FA 1P9QC 1EKEA 1BIBA 1H88C 2HQ5A 2CW7A 3KCCA 1G3WA 3K4JA 2XKPA 2A6HF 3C2GA 4MO7A 3ABMH 2JVHA 5JLXA 4IHSA 4FHTA 1J9IA 1A35A 1KU2A 4ESJA 3S8PA 1PDNC 3RPUD 1X2MA 3DKXA 3FK7A 1FYMA 3PNTA 2GZWA 5CVUA 3NWSA 1R5GA 4B4CA 3GW2A 1IRGA 4CZCA 3ZOBA 2XAGA 2NS7A 1IXRC 3EYYA 1SEUA 3HJEA 4II2A 4YELA 3D0SA 3C2HA 2W7NA 4R79A 1HW2A 5JR3A 5GAHJ 3ISPA 2RC4A 4IVNA 3D1NI 2EZLA 3CUQC 2KRFA 5LGTA 1MMDA 2R4GA 1VZ0A 3WTYC 3R60A 1IN6A 2DCEA 4OOIA 2NAZA 1OYYA 1FWZA 3A4CA 5FLXK 4U0YA 2O5RA 1IC8A 2GLOA 4A5NA 2RQPA 3MZ8A 1ENHA 1UG2A 5LD2C 3R61A 3ECOA 2PMUA 1V4RA 2WV0A 2H27A 1STZA 1ORKA 3HRTA 1YQAA 2PQ8A 4D7NA 3ONQA 4XOPA 4B1RA 4M72A 4FE7A 5H20A 2W24A 2DW4A 4EVIA 3CMYA 4AD9A 3WG9A 2E2JJ 1KQ9A 4HPQA 4A69C 1T56A 3U21A 1RPWA 1SAXA 5KNLA 4Z2YA 2CQXA 1T98A 2YU3A 3IP4B 3BOQA 4DW6A 1F5TA 2CUEA 1CF7B 1TQIA 4YG2F 2KJCA 2OTLI 2ZSIB 3CP8A 4RLFA 3F0CA 5AIQA 1R71A 3FMSA 1TWHJ 4X1EA 4B44A 4PGGA 2CFXA 4A3MJ 3WTWC 2VKEA 4LFUA 1PYVA 2Y0SN 3BTCA 4IXAA 3TW7A 1F4KA 2M4KA 4L0ZB 2IS4A 4CHUA 2MD0A 1D5VA 3MKLA 1LE8B 5EGOB 2DYSH 1JJ8C 4UVAA 1LJ9A 2IT0A 3H35A 4YEJA 1T8IA 2JWTA 2GIVA 1JT0A 4HEA2 3FZVA 2GXAA 3C18A 5IT3A 4NDLA 2EWNA 3OYDA 5E3OA 2KPMA 3BR0A 3CCJI 1WJAA 3KE2A 4HV5A 5FKOA 2A3SA 3G73A 1R23A 3I4PA 1JUSA 2DA1A 4YIFA 3GTMJ 1QQIA 2DLLA 2NOGA 4L5JA 4RS8A 4EQQA 5E18F 2XGDA 2ZSHB 2IW5A 2RREA 2HQAA 1Z05A 1BM9A 4ENJA 1U8BA 2ZXWH 3O8GA 1YX3A 1LFUP 2L54A 3Q5FA 2YUSA 4P96A 4XLHA 5TGTA 3ZQFA 5EDNA 1FTZA 2X6OA 1XC5A 2A5YB 1HSJA 1ONVA 4DNCA 3FHZA 3K9TA 3LNQA 2DPDA 1YOVB 4DQ2A 4ASNA 4XONA 4FETA 2FXAA 1R6RA 1Z77A 5ICGA 5EEAA 3QOEA 2D1VA 4D5CA 3V7SA 1AKHA 3OIOA 1WSUA 3RI4A 2JA5J 4GO1A 2BY1A 4XL9A 5B5EC 2DXIA 2KT0A 1AWCA 4XSXF 4M3GA 3KYLA 1V3FA 3AL0B 1OCCH 4KJZA 3L2QA 1IRFA 2R3SA 3UNGC 2R7ZJ 1F43A 1KZHA 2IVMA 3HRMA 2HZDA 3N97A 4W97A 1YYVA 2OAZA 3FXKA 1HXDA 1AU7A 1IDZA 3W2VA 4P9UA 4BE0A 4Y3OA 5KHDA 3U1DA 5BMZA 1WJBA 5HODA 2KIMA 2X48A 5ICEA 1IO2A 1LFPA 2K27A 1SFOJ 2VC1A 4F92B 1CQTA 2E35A 2GWRA 2OBPA 2VKVA 3CCLI 5HOOA 4LB6B 2OTJI 1M1EB 3R0AA 1LEBA 2W84A 2DFIA 1HSTA 1HCRA 2LY9A 1GVDA 4FTHA 1S7AA 1Q1HA 1ODDA 1XDSA 4IRHA 3H9QA 3H3UA 5JHUA 5LHHA 2E36A 2HEOA 2R93J 1BC8C 1R49A 2K02A 2H6CA 3JRFA 5HS7A 1RUOA 2K5CA 1BL0A 1IXCA 3AG2H 4ANJA 2HOTA 5D6EA 5EZGA 3JSPA 3WE3A 1UMQA 2JN6A 1OR7C 4X6AJ 3J80Z 2BYVE 3HGYA 1YJNI 1MW7A 3D5LA 4PFPA 3K10A 5LRSA 1EF4A 2M3AA 5IYCJ 2L4AA 2OCCH 1N25A 4A3EJ 1FBUA 2HPIA 1YS7A 1A6IA 2K9MA 4E4HA 2KMUA 4I99C 5J4YA 2KIQA 4L5IA 1P7IA 2CQNA 5EEHA 4RGXA 4G94A 2E34A 3OYCA 2EQRA 4N0BA 4NC8A 1SC7A 2L9SA 3FKIJ 2ISYA 5C44J 1BJAA 3BJAA 1QPMA 2LNBA 4KISA 1A5JA 3MZYA 2WAFA 1BOAA 5J40A 2GM4A 3K1MA 2W48A 3E1SA 5HLGA 4M3FA 1W7PB 1DQUA 3QAHA 2M0CA 2F5DA 4N4NB 1U9OA 2IP2A 1ZG3A 2K9SA 3FXRA 3AFHA 3ZQLA 1YS6A 4IPAA 2XKOA 2DMNA 2VJJA 1YTYA 2FUG2 2R7TA 3FISA 3L7WA 3P9CA 1SVLA 3WGIA 4KFCA 1RC9A 4ZZDA 3M8EA 1LB2A 1R00A 4OIOF 3M4OJ 3RKXA 1IDYA 2X85A 2D2WA 4N4OB 4I01A 1MMNA 1X3WB 4EV0A 3Q0WA 2IAIA 6PAXA 1I27A 5A2QK 3OMYA 3GTKJ 2PBIA 1JGSA 3C7JA 3Q3SA 4H4KC 3ZMUA 5D5VB 3HKZN 1FP2A 3RYRA 5JVGF 5CQGA 2O8XA 1XGMA 2DA3A 1K61A 1HKSA 2WAQA 2EJRA 2J5PA 2WAEA 4C2MJ 1I39A 5FLVA 2XVCA 2K4JA 3L2UA 3BJ6A 1R22A 1QNTA 2G9WA 2QKLB 5DCMA 1X2NA 1ZRFA 3OY9A 5J1RA 3TGNA 5KAIC 2YU9J 3RPQA 2E1CA 3MCZA 1SD7A 4A3LJ 2IS2A 3OIQA 1H8AC 4N9HA 2UUZA 1S29A 5E1XA 3GZ5A 1Z6RA 2A68F 3HXLA 5HLIA 5LEKA 1FOKA 3I4MJ 3HOZJ 3LSIA 3KIOA 3NRVA 3MWMA 4XN3A 3ZN0A 4AYBA 1K78A 1ZN2A 1WJ5A 4KIBA 2DU9A 5EEGA 2BBYA 1A04A 3Q9VA 5FLMJ 2V6EA 1W4MA 3FM3A 2IGNA 2LDUA 3K2ZA 3JRHA 4Q5SF 2E7WA 1F1ZA 2E2HJ 1QVTA 3SDBA 5K5QA 3VB2A 2NNNA 2FU4A 4GRIA 1JKQC 2HGCA 1U9NA 3G1LA 4G12A 2X6XA 3MZHA 1VQ7I 2HNHA 3BJOA 1O3SA 2E19A 2O6GE 2EK5A 5FJ8J 3WODF 4M6VA 1U78A 2LRDA 2M7AA 3HIFA 3K4BA 2A5WA 4LG0A 4GCVA 2H6BA 1D0ZA 5CYVA 1OCOH 1HC8A 3IV5A 1DUXC 4LLLA 2PLYA 1A36A 1ZRCA 4E7SA 2DOEA 5FO5A 3LOCA 1MDMA 1LKXA 1REPC 5D4RA 3A02A 3W2WA 5DV5A 5TRDA 4ENMA 4BY1J 3DBLB 4HSRA 2EFNA 3DPUA 1SFUA 3ULQB 4NHJA 2B7EA 2N8GA 2Y48A 2ZNZA 4LJZF 3RJPA 5AIPA 4CYCB 5FFZA 2DK8A 2I10A 4LLGF 3GTOJ 3KZIC 1ZGAA 3JRDA 3D5RC 1ZGWA 3EPZA 4NC7A 1ETYA 4EJOA 2LH9A 4EM1A 5HLTA 2JK3A 2LMDA 3CCYA 2UWMA 1TNTA 1YW8A 1B1BA 3CUOA 2NVQJ 2R7DA 1WWXA 2LKXA 1UFMA 2Z99A 2OPTA 4L9TA 4FE4A 5ILSA 4KT6A 3CLOA 4YIRX 4M9SA 5K7ZA 3BQZA 2K86A 4DBQA 1FEXA 1D8JA 3HSFA 4J00A 3H3ZA 2CRGA 3RCOA 4LK0F 5DD4A 3IRQA 1PUFB 1H9GA 1FY7A 3HGGA 5D5WB 1VQMI 3NWTA 4HV6A 3ERED 4D1QA 4L9VA 4JK1X 2STTA 1QU3A 3RZOJ 3FHNA 3SDGA 3KFWX 1F9NA 4AIJA 2PJPA 5JHFA 3HSEA 3I64A 3VFZA 1TW3A 1JUMA 1LDDA 3WTUC 3FMQA 3OOUA 2EB7A 1OCTC 4CCJA 2ZXIA 2L9NA 2MA3A 1G6NA 4ABZA 2O3FA 3BCAA 5FKMA 4L18B 1BN5A 5E3LA 2O8KA 2NVTJ 1S3JA 4UVCA 4BJ5C 1JKPC 2DDBA 2OUMA 4ZYDA 1KU7A 2OV7A 4XICA 2V79A 1YX5A 3GFIA 5KAFC 3WTVC 3DPTA 3FXLA 3E7LA 3FKJA 3QPLA 4RAYA 1WRJA 3A03A 1D8KA 2X1EA 1RESA 4MEXF 3M8FA 1S8NA 3L2VA 2DA5A 3NARA 4IO9F 1HA8A 1FOWA 1XX5A 4M3DA 2HFHA 1G4DA 3PUFA 4YFNF 1IZ1A 2ECCA 3BT9A 3K70C 2CV1A 1KA8A 1WCMJ 2VL8A 1A31A 3L2CA 2FQ3A 3ELKA 4DZPA 1J75A 2Y69H 2Z9OA 4FQGA 2IRFG 1W0UA 2VOOA 5ED4A 1MBGA 2IPQX 2LSOA 3ZP5A 3ABLH 5DEQA 4V19K 2XV4S 2JUGA 3A0BC 3F3XA 2RAEA 3MFKA 3TW6A 2L7ZA 1ETVA 1HW5A 4LB5A 1Y6IA 1R58A 1UELB 3FDYA 1QBJA 3S17J 2Q2EB 1VQOI 3GTJJ 2CQQA 2JQ7A 3WHBA 3E5XA 3ZQHA 3S2DJ 2W57A 3HOWJ 3GTLJ 4A93J 2XGEA 1S9HA 3DV8A 3ZCOA 1CF7A 5J3LA 2FNPA 4BJTA 4HNTA 5F64A 4YFKF 4Y33A 1UCRA 3BLYA 4GFBA 1IN8A 3PSIA 3KP3A 1KU9A 2H94A 4UNOA 4D7MA 3TO9A 1OYWA 5DUIA 1P92A 1R4MB 3RIRA 1U3EM 4IRIA 1Z1DA 1X19A 3EUKL 2LTPA 1LE8A 5EGOA 5F04A 3ZMZA 2ZO4A 2ZJRF 1MBKA 1QGPA 4CCMA 1WFXA 4MFEA 4M3EA 3E5UA 2FX0A 2HS5A 3JAMK 2RV8A 3IH4A 4ZYEA 3FBIB 3KYCB 2LG4A 5CVIA 5ICFA 4RAFA 1YIOA 2XAFA 2KIFA 2Z3YA 1W5SA 1XD7A 1OPCA 2X0LA 4KMFA 2DK5A 1B9MA 3HB9A 2DTRA 2BZTA 3P5JA 4RB1A 5EJCA 3QP6A 4S05A 3OIPA 4S0HB 3QPHA 4S04A 4OWRB 3HPGA 1FJLA 1UHSA 4HA8A 2ZCWA 3BC8A 4MLOA 1XMXA 2AQEA 1TQPA 3DP7A 4XLNF 4KA4A 3IAM2 3K6GA 2KFDA 3CMAI 3HHGA 3MVPA 1MD0A 2YX4A 3ECHA 1UAAA 1ZLKA 4ZDLA 2KJBA 3N4MA 4MQ9F 2O0YA 4IOAF 2DOAA 2QLZA 3GMEA 4G6DA 3CCSI 2KP6A 3ML6A 1I3QJ 5TISC 1NG6A 2L7MP 3PUBA 1FYLA 2EZKA 2V9VA 2X9DA 2LREA 3VYTB 3S3MA 2XAUA 3PO3J 2WTEA 1ZTRA 2PMHA 1JTXA 2HYJA 3CQZJ 4UXNA 4BL0B 3BCBA 4AUXA 5IP7J 1D0XA 4A3DJ 3JSOA 3FBNB 5FRNA 3DF8A 3I59B 3QYBA 3FWEA 2KHMA 3BDDA 4GYIA 4B8XA 5EF6A 4IJAA 2AHQA 4HF1A 4B48A 3MD2A 1MBHA 4CYDA 3K4CA 3K1NA 4OAZA 3VSLA 3IKTA 5FLXZ 2L9RA 2M34A 1IRXA 3DEEA 5F0HA 2VKDA 3KEOA 5LGNA 1GV5A 2Y75A 1APLC 4A3CJ 2COMA 3I4NJ 3DTEA 3BP8A 4J01A 5EYRA 2MGQA 3QRFF 1JT6A 1QVUA 1VF9A 2EBIA 3BG5A 3LA3A 3E6CC 3K4KA 4A2UA 2BV6A 3HHHA 3VEPA 1Z67A 2KQRA 3ABTA 3DLLF 2R5ZB 4BXXJ 2LF7A 5JI6A 2DJIA 4FX4A 2LD5A 4MHGA 1KQ8A 2R7VA 2HKXA 3OYIA 1ETOA 1W1WE 1R1TA 1MNEA 2XF7A 4BAYA 4RBOA 3S1MJ 3P9KA 3ROUA 3K4MA 4U7BA 3AG1H 3BTIA 1AOYA 4XORA 4QSHA 4ZDPA 4RA2A 2DA6A 1R7JA 2V1DA 3F8CA 2F5CA 4M6YA 1N77A 2F6CA 2M87A 5IT9K 3IHUA 4XIDA 4WXCA 2RNJA 2I8DA 1ZAOA 4NB5A 2XASA 2DA2A 3U1KA 2NS8A 4L0YB 2ZMEC 1JKOC 3CC2I 5F08A 4JP0A 1FLIA 1LDKB 4ZYHA 2LY2A 3BG9A 3GTPJ 2LBFB 5BPIA 1BA5A 2P6TA 4ESBA 1W7PA 3K2AA 1JKRC 4IHYA 4YRVA 4PSXA 2ISZA 5HVQC 1Z21A 4BJ6C 1K83J 1DP3A 1HQCA 2VB6A 3OYAA 2CS3A 3ZQ7A 1P7JA 3LA2A 4ZC3A 3DPLC 4CXFA 3HC7A 3H92A 1X58A 2FA5A 1Z91A 2J5OA 3ZMDA 2VODA 2ZFWA 1J2XA 4Y13A 2EZHA 1I1SA 4A3JJ 3H9GA 2XROA 1R4NB 5J1UA 3VODA 5H6RA 4IHWA 1EH6A 1XPXA 4C9YA 1BI0A 1TWGJ 5ICCA 5JVTA 4CCNA 4DGWB 2L4MA 4OMYA 1MNDA 1RETA 1B4AA 4WWCA 5BOXA 2LVSA 1MGTA 3P7NA 5CQEA 3W3CA 5HLHA 1RNLA 5K5OA 1T38A 1J59A 2H09A 3OYJA 1JJ6C 2LC2A 3G2BA 3ESWB 4F3QA 2WB1N 3HEFA 4HDUA 1WHUA 4Q47A 4CZZA 3HRUA 1W36C 4G7OF 3EUHC 2M0MA 4DOZA 4PZJA 2RQQA 3KZZA 4IKFA 3HOSA 2HVRA 5LGUA 3I5UA 4HBLA 4HLXA 3SJMA 1ZR2A 1DPRA 3HOTA 1MBEA 2WY8Q 3WG7H 3KLOA 1VQ4I 2L9VA 2RGVA 2IJLA 2FE3A 1J09A 2IBDA 2XF5A 2ESHA 3HUGB 4UUVA 1UZCA 2JZYA 2EH3A 1XSXA 2EINH 2DODA 2DMUA 4FASD 2MG4A 3QWLA 3BG3A 3TMOA 4IZZA 1IW7F 2DDAA 4DIQA 2BVMA 4C3IJ 2E60A 2HOEA 3NQOA 3HPHA 2VKHA 3PJRA 1FNNA 4XKVA 1TQMA 3QYFA 3OL3A 4PFOA 3DKYA 3A1YA 3RKYA 2A6EF 3CMEI 4A3GJ 1F36A 1SVOA 1WJDA 3LSJA 1ZQ3P 2L5QA 3BR5A 4FT8A 2WWYA 2FRHA 1YFHA 1WI9A 2OJED 5HNHA 4XLAA 4PJNA 3DU6A 3CUQB 4XNFA 1DP7P 3I58A 1T6SA 3SFIA 2XPWA 3F6OA 3VOEA 1I3AA 1QZYA 3OR2C 3JRIA 3CO7C 3LWFA 1U5TC 3CCUI 2NRAC 5IY5H 4G7HF 1I6HJ 2W82A 2M4GA 5HDKA 4JOMA 3J7YJ 3JW4A 3D5SC 1FYKA 2XUBA 2CYYA 3GX4X 3ZPLA 2UZKA 3K7AJ 3DEUA 3ABUA 3DTIA 3OL4A 3F22A 2DQRA 2Z1DA 4QPOA 3FM5A 2K9QA 4IL6C 5FFXA 4DJAA 5GAGJ 4BE1A 1W36D 1V5FA 1FT9A 4LITA 3GFJA 4ITVA 3SFZA 3IKVA 4CYCA 4J19A 2QKMB 1H0MA 1Z3XA 3PIOF 4XKCA 4ETSA 4BU2A 4XLPF 1OYIA 5E3NA 4KDPA 2WC2A 4I02A 1BBYA 3F21A 4ENKA 2XHKA 2DN0A 1MMSA 2CV0A 2H1KA 2F4MB 2OA4A 3V8KA 4LIUA 3ZQQA 2DQLA 1XN7A 3M8JA 4L5EA 5M3FJ 4GXOA 1IAWA 1GLNA 3GCMA 2MSYA 3B6AA 3V8LA 4AVZA 3HTUA 5E1WA 1DGRM 2FF4A 5BNGA 4CCLA 1PUFA 4HNUA 3S32A 4G6QA 1RKWA 4O6JA 2F4OB 3MQ0A 1JGGA 2PMZA 2FQ4A 1IGNA 3S15J 2UXNA 3I55I 4WF2A 4BQOA 1G2HA 5LFAA 1L3LA 2IA2A 3DCFA 3ZMVA 1XG1A 1T08B 4M73A 1WJCA 3L00A 3OYMA 5FKNA 4EGYA 1RR8C 2GXGA 2CGPA 2E7XA 1IG7A 1BI3A 1PP8F 1MMAA 2QYOA 1MNMC 2JSPA 4UB8C 1TBXA 4PUSA 1ULYA 3HOVJ 2AO9A 1ZG1A 1PVEA 3E5QA 1NTCA 3C1DA 2QQBA 2B9SA 1X1PA 1NK2P 3MMYB 3LSRA 2DFEA 3S1NJ 1RKTA 3G1MA 1O3TA 1XB4A 2LYCA 4YIIA 1AA7A 1DU0A 5J6XA 2JA7J 2HI3A 5FROA 4KUMA 5K7FA 2MLKA 1MH4A 2IGKA 2HYGD 1MH3A 3QPSA 4QTRA 1XTAA 2P7VB 3JCUC 4KIGA 2JA2A 1BW5A 3WGHA 3VSKA 1JXSA 4EJTA 2H1LA 2CV2A 3ZMTA 5D8KB 5J8FA 3J80K 2HOSA 3TEDA 3AG4H 4DZJA 3IL2A 1XSVA 5E79C 4BEHA 3ZQIA 2VPLA 4DYCA 2DTZA 3E6BA 2QBYB 3S93A 3SZPA 1LPQA 2GOMA 1J5YA 2R7XA 4B3XA 1MBJA 4LK1F 3HG9A 4A0XA 2ZKZA 2EFWA 2Q2EA 4EJWA 5D5XB 2DMPA 3JTHA 1VNDA 2QGUA 3OYEA 1FTTA 2R7OA 2ZFUA 1ZGJA 4E7HA 2BY2A 3EDPA 2XRNA 1RUNA 4XKWA 2HDWA 2R7RA 3QYEA 4DBRA 3BTJA 1BI2A 3BWGA 1SD5A 3NAUA 4QWQA 4A3FJ 2VPRA 2WY7Q 2X6YA 4BDZA 3OSGA 2GQQA 3CJNA 1GXPA 5D8LB 2DBBA 5IPAA 2XAHA 2CG4A 2LOOA 1VTNC 2VXDA 2JVGA 4N9IA 2QWWA 2JPCA 2DFHA 2BW3A 3TP3A 4HQMA 1MIJA 3HBLA 5GPCA 1NHAA 1T2KA 1ZHFA 3FXQA 1TLHB 5FD6A 1USSA 3GFLA 2XIGA 1OMIA 3V7CA 1QPIA 3AG3H 5CJ9A 2K4BA 2LF8A 3CJTB 3IAS2 4I0BA 4RB0A 3V4GA 1YG2A 2VE9A 2VLAA 1YO5C 2QSHX 2Y2ZA 2CQ7A 4HLYA 2O7OA 1O7LA 3VYUB 1E3HA 1LUJB 2FNAA 3H0GJ 2LLKA 2E1NA 2W00A 3HTSB 4YFXF 2F2EA 5DS9A 4BHCA 4HDVA 4LGWA 4EM0B 5HDGA 3VYRB 3M3YJ 5L3EA 2D5VA 2P4WA 2G0EA 4F52A 3OYHA 1CGPA 1SMTA 2JSCA 2R7UA 5J1YA 4Y15A 4HAMA 4JQFA 1B59A 2GA2A 1BI1A 5KK1A 3WTXC 1V54H 1PUEE 2M2EA 2ME0A 5DM7F 2R0QC 3CJRB 1MKMA 1X3ZB 1U0JA 2L0KA 2MC3A 2EV0A 3KP5A 2PG4A 2XAJA 4I0AA 2FMLA 2P7CB 2F5VA 1BR1A 2MW8A 3GZNB 4CCKA 5IYDJ 1R5ID 2PJRB 2W4SA 3DEWA 3I3LA 2QQ8A 2BVLA 1FOYA 2O61A 4UY8I 4PJJA 4IF4A 4M9ZA 3CO6C 1RZ4A 4XOTA 3FXJA 5CVRA 1G3SA 2MYSA 3I59A 3ZQCA 1Y1WJ 2ZNYA 1J7KA 2MFZA 3UKGA 3TDUC 2KISA 2CW0F 3PNVA 4RLQA 1FIAA 2VBYA 2MH2A 1TWFJ 2DA7A 1T0FA 3BROA 3FX3A 1ZKGA 3OV8A 4ZZLA 2HPMA 3MKYB 1UHWA 2QF7A 1X4PA 2MD5A 2K3FA 3O6BB 4IQJA 3J7AY 2XC7A 1DU6A 3HYIA 2ZC2A 4U7DA 1BR4A 1N78A 2GIZA 4WK8F 2VOPA 2R5ZA 1OCPA 1XS9A 1Y8QB 5C4XJ 2IGOA 3IH3A 3COAC 1LFBA 4XM3A 2V9KA 1K6YA 4ZDOA 2EIJH 2QUFA 4NQWB 2MC4A 1IRZA 1OISA 2FMYA 2G7UA 2IEKA 1QHGA 2K9LA 2XRLA 3E97A 4QPQA 4M6XA 1V5GA 1V55H 1D1AA 1NH3A 2EV5A 1G59A 2Y0SA 3G4SI 2X1CA 2IA0A 2X51A 2ETHA 2E1MC 3ZRGA 3J81K 5F0FA 1WVRA 5C4JJ 3OYKA 2YS9A 1W0TA 1BOBA 2P5VA 1K4TA 4L9JA 1IJWC 3RPUA 4A3BJ 3M7GA 4ZYAA 5IOYA 5FRMA 4KIFA 4P1WA 4BEHB 4WXHA 4E7LA 2F48A 3Q9SA 5E3MA 2K3PA 4EJUA 3JAMZ 2LBFA 2Y31A 2E1OA 1U8RA 4ENNA 2ECBA 4A0ZA 2CUZA 4Q4ZF 3GYHX 1R1UA 2TRTA 1VQ6I 3G6EI 5K7HA 1GT0C 1IN7A 1VQ9I 1GDTA 2HOAA 3PSFA 3DXJF 4HYEA 5FD5A 5BQTA 2CW8A 2R7FA 3CCEI 1XSDA 3CCRI 2VJ5A 4EMSA 5LLQA 4UUSB 3WE2A 5M5WJ 1KYZA 2GXBA 2R7QA 4ZTJA 5JLWA 2P8TA 2VONA 2DYRH 4U0WA 1XGNA 3IRRA 4XSZF 2ZJPF 3K4LA 4JBAA 2R7WA 2OZUA 3L1PA 5GP9A 5LHGA 3GLXA 1RIOH 2Y0MA 1IUYA 1FC3A 1I6XA 2VIXA 2BW3B 3PFYA 2OD5A 2R5YB
chains in the Genus database with same CATH topology
1VQLI 1YJ9I 3CMAI 3J7YJ 4IOAF 2ZJQF 1YJNI 3CCSI 5GAGJ 1VQ7I 2K3FA 1YIJI 3CF5F 3PIOF 4IO9F 1FOWA 3CCJI 1QA6A 2E34A 2FOWA 3CCVI 1ACIA 1YHQI 1HC8A 1VQ5I 1MMSA 1FOXA 3CC7I 4V19K 3J7ZI 5GAEJ 3CD6I 3G4SI 1S72I 3CJTB 1VQOI 1YI2I 5GAHJ 2JQ7A 2QEXI 3CCQI 5GADJ 3I55I 1VQ4I 3G71I 3DLLF 2H8WA 1VQNI 1VQKI 2NXNB 1VQ6I 3G6EI 5JVGF 2ZJRF 1VQ9I 1YJWI 1YITI 5DM7F 3CCMI 3CMEI 3CCEI 3CCRI 2QA4I 3I56I 1VQMI 2E35A 3CCLI 2OTJI 4IOCF 5DM6F 1VQ8I 2ZJPF 1FOYA 4UY8I 2OTLI 3CC4I 3PIPF 3CC2I 1VQPI 1Y39A 3CCUI 2E36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL I;  1YJ9 I;  3CMA I;  3J7Y J;  4IOA F;  2ZJQ F;  1YJN I;  3CCS I;  5GAG J;  1VQ7 I;  2K3F A;  1YIJ I;  3CF5 F;  3PIO F;  4IO9 F;  1FOW A;  3CCJ I;  1QA6 A;  2E34 A;  2FOW A;  3CCV I;  1ACI A;  1YHQ I;  1HC8 A;  1VQ5 I;  1MMS A;  1FOX A;  3CC7 I;  4V19 K;  3J7Z I;  5GAE J;  3CD6 I;  3G4S I;  1S72 I;  3CJT B;  1VQO I;  1YI2 I;  5GAH J;  2JQ7 A;  2QEX I;  3CCQ I;  5GAD J;  3I55 I;  1VQ4 I;  3G71 I;  3DLL F;  2H8W A;  1VQN I;  1VQK I;  2NXN B;  1VQ6 I;  3G6E I;  5JVG F;  2ZJR F;  1VQ9 I;  1YJW I;  1YIT I;  5DM7 F;  3CCM I;  3CME I;  3CCE I;  3CCR I;  2QA4 I;  3I56 I;  1VQM I;  2E35 A;  3CCL I;  2OTJ I;  4IOC F;  5DM6 F;  1VQ8 I;  2ZJP F;  1FOY A;  4UY8 I;  2OTL I;  3CC4 I;  3PIP F;  3CC2 I;  1VQP I;  1Y39 A;  3CCU I;  2E36 A; 
#chains in the Genus database with same CATH topology
 2W1O A;  1X1D A;  4KN4 X;  4U88 A;  3VYS B;  3A01 B;  3V42 A;  1EA3 A;  4NUB A;  5F0C A;  1B72 B;  2E71 A;  3H0D A;  4OAY A;  4UV8 A;  2NNY A;  2BY0 A;  4IX7 A;  3I9V 2;  4XRF A;  5CKT A;  1TWC J;  2CU7 A;  1AHD P;  2K40 A;  1MSE C;  3ZQG A;  1G8X A;  2AXL A;  2P6S A;  1HDD C;  3CP2 A;  1YIJ I;  2KIU A;  5IP6 A;  1TL8 A;  1ETQ A;  5FKK A;  3MN2 A;  4KT5 C;  2QM3 A;  3HUG A;  4EGZ A;  2CFO A;  4XBF A;  3OYG A;  4AM3 A;  3BZ6 A;  3H5N A;  5CVV A;  2Q8K A;  2ME6 A;  1O3Q A;  1U6G A;  1B8I B;  2RVC A;  2WAQ N;  2ZXJ A;  3F8M A;  2V4J C;  1RI7 A;  1O7F A;  3L09 A;  2NVY J;  1FOX A;  1OCZ H;  3CC7 I;  2KDO A;  1MSF C;  2DA4 A;  2K85 A;  5BS6 A;  4C3H J;  1RR7 A;  1W5C C;  2Y9Y A;  5DDG A;  1D3Y A;  3TKY A;  4U87 A;  5FKL A;  2DAO A;  4KNY A;  2M7B A;  4JYK A;  5L3D A;  4Z6Y A;  4HG2 A;  1O3R A;  2EIK H;  2OQG A;  3X2Q H;  3ASO H;  3L9F A;  1IN5 A;  3EQL F;  2NVX J;  3MKZ A;  3EET A;  3IWZ A;  1WI3 A;  4AYB N;  3ERM A;  2HVS A;  4HX4 A;  5B66 C;  4W1U A;  2CSO A;  3CUQ A;  3PO2 J;  2Z2S B;  2EZI A;  2E1M B;  4BHP A;  3F23 A;  3W6V A;  4RB3 C;  3S1Q J;  3O3K A;  1Z9C A;  2P5K A;  1P6R A;  3CF2 A;  2ACJ A;  2HU9 A;  1VQN I;  1V5E A;  1JUP A;  3U2R A;  2DI3 A;  3BY6 A;  1HBX G;  3RKW A;  2X6W A;  5EG0 B;  4LOC A;  5IT9 Z;  2NVU B;  5LBQ A;  2KL4 A;  1XMA A;  5LRR A;  1T33 A;  3UR3 C;  1YIT I;  1BJZ A;  2KKO A;  5DD8 A;  3KP2 A;  2D45 A;  2VQL A;  5HS9 A;  5J4V A;  3JRA A;  4BXU A;  3DBR B;  3S14 J;  2VQG A;  5AON A;  2XPV A;  4PSW A;  3GTG J;  1FBQ A;  2V1N A;  2WBM A;  3JRB A;  5D6F A;  3RKQ A;  4RGU A;  4UVB A;  3A2K A;  3PQJ A;  1ETK A;  4F93 B;  3TOA A;  4ZH4 F;  4IOC F;  4CDG A;  1FMW A;  2MBF A;  4OIR F;  1IUF A;  3PFI A;  1JTY A;  3BG6 A;  2E5N A;  3LL7 A;  1OLT A;  5DUK A;  4D9J A;  2RN7 A;  2EIM H;  5H6Q A;  3H36 A;  1MJ9 A;  2VT3 A;  2EIL H;  1FPQ A;  2KZV A;  3B73 A;  1N75 A;  2VQC A;  1P2F A;  2GAU A;  2XGX A;  4AWX B;  3OS2 A;  5HNF A;  2PFB A;  4M3B A;  5F27 A;  1OCR H;  2BHZ A;  5KCM A;  4OIN F;  1X1C A;  3SHF A;  2FBI A;  3HKZ A;  4F7Z A;  3ZGK A;  2DT5 A;  3OYN A;  3LMM A;  1ZRE A;  2Q1Z B;  3CF5 F;  1Z7L A;  3EUH A;  3TOB A;  1SAU A;  1X1B A;  5C3E J;  1UG0 A;  3BR6 A;  4AID A;  2O9L A;  2HWV A;  4I6Z A;  2MLG A;  3O8H A;  2Q0O A;  3AL0 C;  4G9Y A;  3RQI A;  3SZG A;  4LMY A;  1SD6 A;  3ZR8 X;  4RAZ A;  1S7O A;  4NC6 A;  3HL2 A;  3VWB A;  5L3B A;  4E6K G;  2JPB A;  4AVP A;  4KN7 X;  4A3K J;  5GAE J;  3F8F A;  4HF0 A;  1JE8 A;  4O3M A;  4Y17 A;  4EEF G;  2KRH A;  2HXI A;  4F91 B;  2M1B A;  2VBX A;  3FXO A;  2XSD C;  2HTJ A;  2FBH A;  2HQR A;  1YI2 I;  3OR1 C;  4E7Z A;  2W85 A;  4LLN A;  3CCQ I;  3QOP A;  3LFK A;  3N05 A;  4G8X A;  4XMY A;  3ZN1 A;  2JUC A;  1WGX A;  2VJ4 A;  1FP1 D;  3I53 A;  2L7K A;  2HYF A;  4C3J J;  4XQF A;  1K6O A;  2BXZ A;  3GFM A;  3KET A;  1K7A A;  4XRM A;  1B6A A;  5K1Y A;  2KDZ A;  2IA1 A;  2X4H A;  4LIV A;  2MH9 A;  2O03 A;  2W25 A;  3GEZ A;  3KPH A;  1K4S A;  2QBY A;  3DBH B;  4MFD A;  1QZE A;  4CO8 A;  4IRG A;  3OWT A;  4LG3 A;  2L7F P;  3H5A A;  1Q1V A;  2RDP A;  4UUT A;  1KGS A;  3CDH A;  3OSF A;  4HRI A;  5FGM A;  3CES A;  4A6E A;  1ETX A;  4H0E A;  1U5T A;  4ZYG A;  1D1C A;  1SVM A;  4XLE A;  3CCM I;  2M9H A;  5IOZ A;  4WX9 A;  1VFC A;  4HST A;  3FXU A;  1E0E A;  2CQK A;  4Y4R A;  2G7H A;  1X4O A;  2DPU A;  1X1A A;  3B6C A;  1Y1V J;  3K0L A;  3LQR A;  1IV6 A;  2F5E A;  2DO7 A;  1TC3 C;  1BR2 A;  1DGW Y;  2PX9 A;  1VQ8 I;  3A0H C;  2GA1 A;  1U2W A;  2FOK A;  1O4X A;  3O2P E;  1FBS A;  4UHT A;  4GYG A;  4A0Y A;  4EJV A;  2ICW G;  2Y9Z A;  3KLN A;  3HDD A;  4Y52 J;  4RGR A;  3OOP A;  5HDN A;  1ZR4 A;  3MEX A;  3LSK A;  1H89 C;  5ERI A;  5GTH C;  1L0O C;  1I5Z A;  4P55 A;  2V6C A;  2IS1 A;  3HM5 A;  4JX4 A;  4E7K A;  4PK4 A;  2XB0 X;  2L3D A;  2M45 A;  1TT5 B;  4HF2 A;  2EA4 A;  1TT0 A;  4BQN A;  5E1Z B;  2OCE A;  5EZH A;  2VBZ A;  1OR7 A;  2DFF A;  1TNS A;  3M07 A;  4WXD A;  3OYB A;  1EV7 A;  3DLA A;  1ITY A;  1EJ9 A;  3EYI A;  1OFC X;  3GXO A;  4G7Z F;  3GBG A;  4EAT A;  2XF6 A;  2OQR A;  2ID3 A;  2CMP A;  3I71 A;  2DMT A;  3IUO A;  4A5M A;  4PDK A;  2L02 A;  3FF5 A;  2LK2 A;  2VJI A;  4OIP F;  3SEQ A;  4MTD A;  5J47 A;  3CCV I;  1MBF A;  2VN2 A;  1YHQ I;  2A6T A;  2CUF A;  4AIK A;  1T95 A;  2WV1 A;  2K7L A;  2FJ1 A;  2ZME B;  4D5F A;  1R36 A;  1FSE A;  2JTV A;  3SZT A;  2VC0 A;  2HDD A;  2COB A;  5LHI A;  5D4S A;  4CCO A;  2NS0 A;  1P4W A;  1HDP A;  3M1E A;  3WHC A;  4KIT B;  5L3G A;  1JI8 A;  4UV9 A;  1YLF A;  3U9G A;  1MJB A;  3REO A;  2UXX A;  3ZMS A;  1T39 A;  2XPU A;  2QZ8 A;  2YPR A;  2HDC A;  1GUU A;  3CMM A;  1SFE A;  4ESF A;  3T1B A;  1OKR A;  1J0R A;  2EPF A;  2WA0 A;  3LQQ A;  1IV8 A;  2BHY A;  2PN6 A;  1BW6 A;  5CPR B;  2VUM J;  2PJR A;  2ELH A;  4XRS A;  3CDL A;  3DKW A;  3MKW B;  4E70 A;  3BPX A;  4MQV A;  4V2G A;  3TP0 A;  4II3 A;  4HZF A;  1KYW A;  1S5L C;  3IC7 A;  4KMU X;  5M3M J;  3KEQ A;  2M8G X;  1WH5 A;  3IWF A;  4AU7 A;  3K69 A;  5IYB J;  4CSW A;  2H8R A;  2STW A;  2VT2 A;  2BGC A;  1JHF A;  4B3A A;  1OJL A;  1W7P D;  4RB2 C;  5KVR A;  2RNG A;  1TP4 A;  3KP4 A;  1LDJ A;  4V2F A;  4F55 A;  5F6F A;  3S16 J;  1VI0 A;  1UST A;  2D1H A;  5DCF A;  1DPU A;  1HW1 A;  4PCQ A;  2EV6 A;  5A2Q Z;  2QA4 I;  2ID6 A;  2ELK A;  5ILU A;  2QVO A;  2CJJ A;  4RM3 A;  5DYM A;  2ZB9 A;  3KEY A;  3Q0V A;  2VQH A;  3RTR A;  1YE9 A;  1H9T A;  2OZ6 A;  3F6V A;  1EH8 A;  1E17 A;  3PIP F;  1ERD A;  1VQP I;  4K2E A;  4NQW A;  1LEA A;  1Y39 A;  5E17 F;  1R1V A;  1XGO A;  5E8G A;  4KIC A;  1MZB A;  2QQA A;  3FIW A;  3ASN H;  2KLO A;  4PJ0 C;  4ZJZ A;  4HNV A;  3VDX A;  3H3V K;  3T5X A;  3PQK A;  2CO5 A;  2ZJQ F;  3WU2 C;  1JHH A;  5L3F A;  3CTA A;  2CUJ A;  4NNJ A;  3OS0 A;  5GPA A;  3SYT A;  3JRG A;  4G6T B;  2HTS A;  3CJQ B;  4BH9 A;  1WZ2 A;  4EM2 A;  2I5U A;  2VXZ A;  2M8E A;  1FX7 A;  4L9N A;  3QPT A;  4BY7 J;  4PGH A;  4HX7 A;  3AKZ A;  3TDZ C;  3H5R A;  3LSP A;  3GF2 A;  3JRE A;  3PL8 A;  1QHH D;  3TO6 A;  2QSF X;  2PI0 A;  5D5U B;  2JRM A;  1ACI A;  1R5H A;  2AQF A;  4MEY F;  4CA0 A;  1TZL A;  4XRS G;  1WPK A;  1W5T A;  3JRC A;  1C0W A;  2JMW A;  1QO0 D;  1EH7 A;  1SD4 A;  1U5T B;  3L2W A;  2UV1 A;  1XDU A;  1IN4 A;  2LP0 A;  4I2O A;  5L3C A;  2IXS A;  3E6M A;  3G3Z A;  4XR6 A;  4UUS A;  1E2X A;  2EA2 A;  2BOL A;  4Q48 A;  2ADU A;  4XN0 A;  2QEX I;  3WGG A;  1MJA A;  3GWZ A;  5B3S H;  3RDI A;  3CZ6 A;  5B1A H;  2JRT A;  5K5R A;  4MTE A;  3GUD A;  1HF0 A;  3QU3 A;  5HS8 A;  2QSG X;  3G71 I;  3KP7 A;  5TJJ A;  2V9P A;  3J7A O;  4HX8 A;  1OQY A;  1XMK A;  3HSR A;  2KRC A;  4OMZ A;  2R5Y A;  4BS9 A;  1NK3 P;  4P5O A;  2YX7 A;  1YW9 A;  3A01 A;  1GXQ A;  3HRS A;  4CIC A;  2NXN B;  4TV7 A;  1B72 A;  4B43 A;  1SFX A;  1Z6T A;  2BEO A;  1XCB A;  2HVQ A;  3TL4 X;  2DT6 A;  1Y0N A;  3GTQ J;  4WCG A;  4CGZ A;  4ON0 A;  2JJ7 A;  3I0T A;  3TQN A;  4B47 A;  4M74 A;  3DFG A;  3GZ6 A;  5GTI C;  5DTD A;  1ZAR A;  4PJL A;  4I7H A;  5ILV A;  4BYY A;  3RQ4 A;  3KYD B;  1Z0X A;  4JX6 A;  4CH7 A;  3TBI A;  4AC0 A;  2CH0 A;  2LY1 A;  4XLC A;  1LVK A;  1ZRD A;  1B8I A;  2CWE A;  1Z3Y A;  1AKH B;  3FK6 A;  3T8R A;  3FXM A;  3DU5 A;  2Z33 A;  4A12 A;  3T0Y A;  2IS6 A;  4B09 A;  2NOJ B;  1YRN A;  2A69 F;  1VQL I;  1S6L A;  5IP9 J;  4BQA A;  4BBR J;  2V26 A;  5CVJ A;  3SEZ A;  3QQA A;  1ZYR F;  1MMG A;  1WH7 A;  2VAS A;  3BG7 A;  1ON2 A;  2HR3 A;  4P9F A;  4X0G A;  2P81 A;  2FD5 A;  3BR1 A;  1HLV A;  4R8H A;  2DJN A;  1Y56 A;  4I09 A;  4BKX A;  2ELJ A;  3R6S A;  5M5Y J;  4E7I A;  1ZK8 A;  2QEN A;  2F4I A;  5J8C A;  3LAP A;  2FOW A;  3LSM A;  1P4A A;  1I1G A;  2BXY A;  3WTS C;  3JR9 A;  1VQ5 I;  1B9N A;  3RSN A;  2DOF A;  4BNC A;  3J81 Z;  3DTK A;  3F8N A;  3R0J A;  5EG0 A;  1POG A;  4HW0 A;  4FCY A;  3KX2 A;  3GVA A;  1LNW A;  3CD6 I;  2JT1 A;  2IGM A;  2VE8 A;  4BUP A;  2Y30 A;  3ABK H;  4HQE A;  4DYQ A;  3F72 A;  4OIQ F;  1WQ2 A;  1E3P A;  1QZZ A;  2EFQ A;  2XAQ A;  4M9X A;  3WTT C;  1ZG5 A;  2A61 A;  3C2B A;  3S3O A;  3W6J B;  2JA8 J;  1R9T J;  2NYX A;  3RYP A;  2OC6 A;  1FSH A;  5E8I A;  2R92 J;  1XGS A;  3T8T A;  1X3U A;  2EFO A;  2FBK A;  2YSR A;  3QU6 A;  1GHC A;  4RM2 A;  1FIP A;  4A6D A;  1PP7 U;  1LVA A;  4AIH A;  1UJ8 A;  3VPR A;  1PJR A;  1D0Y A;  1ETW A;  3SQN A;  1GV2 A;  3Q0U A;  3TO7 A;  1O57 A;  2Z5U A;  2ZBK A;  3V7R A;  4BGD A;  1Y0U A;  2TDX A;  4D0P A;  3OYL A;  2PEX A;  2M5W A;  1YJW I;  3LAJ A;  2KZG A;  1NG7 A;  3L2R A;  3S1R J;  2DMQ A;  1HKT A;  2M30 A;  1G3T A;  3IH2 A;  4A3I J;  4XLF A;  3K1P A;  2A07 F;  1TW2 A;  2WB1 A;  2X1D A;  5F1J A;  5E20 A;  4KYW A;  2YR2 A;  2ESN A;  3GLL A;  2MAB A;  3WU1 B;  2HZT A;  4BAC A;  5CLS A;  1LQ1 A;  4IQ4 A;  1UHM A;  4PJM A;  4O5V A;  3S2W A;  3WTZ A;  1WJE A;  4MNU A;  4OU0 A;  9ANT A;  1ON1 A;  2E2I J;  3CC4 I;  1RRJ A;  1WJF A;  4ZTF A;  5BPD A;  2HKO A;  1K79 A;  3ZXS A;  2FEZ A;  3C3W A;  3LFU A;  1DDN A;  4GGG A;  1KON A;  2XSJ C;  3KZY A;  2L2O A;  1S7E A;  2FSW A;  1BC7 C;  3M9A A;  3NEU A;  4U0V A;  5B1B H;  4DYR A;  1YJ9 I;  1IF1 A;  1T0F C;  2B63 J;  3EUA A;  2PMZ N;  3BZK A;  4NBQ A;  4BXF A;  1WKM A;  2JA6 J;  4JX5 A;  1SMY F;  3LST A;  3M1C A;  2QQ9 A;  1FZP B;  1SFK A;  4C2U A;  2VBW A;  2VI6 A;  3QOD A;  5DCM B;  3RZD J;  2L01 A;  3JTG A;  3CLQ A;  3E3V A;  3H1C A;  4HOB A;  4XKB A;  4IHT A;  2LKP A;  1ZEL A;  4QLC U;  2WAD A;  1QA6 A;  1ZLJ A;  2F5F A;  4BDY A;  5FB2 A;  3V8J A;  1HKQ A;  1Z7U A;  5M5X J;  3KP6 A;  4M71 A;  3S2H J;  3LA7 A;  3OS1 A;  1K78 B;  1HOM A;  2AS5 F;  1FMV A;  3HOY J;  4IEJ A;  2ZJ2 A;  1A6Q A;  2B0L A;  4IHX A;  2K9N A;  3BZC A;  4QIW N;  3BPV A;  3DWL E;  1TTY A;  3J7Z I;  1E3O C;  4RMN A;  2QCO A;  2P0W A;  1ZH5 A;  2TCT A;  5LEJ A;  2XB5 A;  2OF7 A;  2P5L C;  3I54 A;  1S72 I;  4R1H A;  3LSG A;  3HOX J;  3E6D A;  4FIS A;  5H2F C;  1G3Y A;  5JFR A;  3F9K A;  3W2A A;  2GBY A;  4BE2 A;  4I76 A;  3K4N A;  3OYF A;  1UB9 A;  4I98 B;  5GAD J;  1YW7 A;  3B02 A;  4BHB A;  4RAG A;  3W6K B;  3R4K A;  1QRY A;  3PM1 A;  2OU2 A;  3WU0 A;  4BBS J;  4LG0 B;  3P9I A;  2H8W A;  4LD5 A;  2V1U A;  3QP5 A;  1YRN B;  1I50 J;  2EFP A;  4MGR A;  2AXT C;  3BQY A;  1D1B A;  2XGC A;  1VQK I;  3CDI A;  2GOX B;  2XDV A;  1KQ0 A;  1GVJ A;  2HQN A;  1IXS B;  2ZXH A;  3G1O A;  4RGS A;  4BQQ A;  3HOU J;  2Z16 A;  3F8B A;  3BR2 A;  3H9J A;  1MDM B;  4GDF A;  4RDU A;  3BTL A;  3DQV C;  2LFB A;  2E5Z A;  3K70 D;  3S3N A;  4IHV A;  4C2T A;  3PNY A;  2A05 A;  1Y8R B;  4E7J A;  4C30 A;  3I56 I;  4XK4 A;  4CUG A;  5DM6 F;  4Y7N J;  3E0J B;  3HZJ A;  1XCV A;  3SXY A;  3AAF A;  1KU3 A;  2RKH A;  2DT7 B;  3LSH A;  2R7S A;  3BR3 A;  4FX0 A;  2ZME A;  3FMR A;  1D5Y A;  1TWA J;  3MAJ A;  2LR8 A;  1SAN A;  2HXO A;  2LKS A;  2BE5 F;  2C6Y A;  2V1X A;  4UB6 C;  1P4X A;  3GO5 A;  5F1R A;  2BY3 A;  4MIM A;  1BIA A;  2V7F A;  1P9Q C;  1EKE A;  1BIB A;  1H88 C;  2HQ5 A;  2CW7 A;  3KCC A;  1G3W A;  3K4J A;  2XKP A;  2A6H F;  3C2G A;  4MO7 A;  3ABM H;  2JVH A;  5JLX A;  4IHS A;  4FHT A;  1J9I A;  1A35 A;  1KU2 A;  4ESJ A;  3S8P A;  1PDN C;  3RPU D;  1X2M A;  3DKX A;  3FK7 A;  1FYM A;  3PNT A;  2GZW A;  5CVU A;  3NWS A;  1R5G A;  4B4C A;  3GW2 A;  1IRG A;  4CZC A;  3ZOB A;  2XAG A;  2NS7 A;  1IXR C;  3EYY A;  1SEU A;  3HJE A;  4II2 A;  4YEL A;  3D0S A;  3C2H A;  2W7N A;  4R79 A;  1HW2 A;  5JR3 A;  5GAH J;  3ISP A;  2RC4 A;  4IVN A;  3D1N I;  2EZL A;  3CUQ C;  2KRF A;  5LGT A;  1MMD A;  2R4G A;  1VZ0 A;  3WTY C;  3R60 A;  1IN6 A;  2DCE A;  4OOI A;  2NAZ A;  1OYY A;  1FWZ A;  3A4C A;  5FLX K;  4U0Y A;  2O5R A;  1IC8 A;  2GLO A;  4A5N A;  2RQP A;  3MZ8 A;  1ENH A;  1UG2 A;  5LD2 C;  3R61 A;  3ECO A;  2PMU A;  1V4R A;  2WV0 A;  2H27 A;  1STZ A;  1ORK A;  3HRT A;  1YQA A;  2PQ8 A;  4D7N A;  3ONQ A;  4XOP A;  4B1R A;  4M72 A;  4FE7 A;  5H20 A;  2W24 A;  2DW4 A;  4EVI A;  3CMY A;  4AD9 A;  3WG9 A;  2E2J J;  1KQ9 A;  4HPQ A;  4A69 C;  1T56 A;  3U21 A;  1RPW A;  1SAX A;  5KNL A;  4Z2Y A;  2CQX A;  1T98 A;  2YU3 A;  3IP4 B;  3BOQ A;  4DW6 A;  1F5T A;  2CUE A;  1CF7 B;  1TQI A;  4YG2 F;  2KJC A;  2OTL I;  2ZSI B;  3CP8 A;  4RLF A;  3F0C A;  5AIQ A;  1R71 A;  3FMS A;  1TWH J;  4X1E A;  4B44 A;  4PGG A;  2CFX A;  4A3M J;  3WTW C;  2VKE A;  4LFU A;  1PYV A;  2Y0S N;  3BTC A;  4IXA A;  3TW7 A;  1F4K A;  2M4K A;  4L0Z B;  2IS4 A;  4CHU A;  2MD0 A;  1D5V A;  3MKL A;  1LE8 B;  5EGO B;  2DYS H;  1JJ8 C;  4UVA A;  1LJ9 A;  2IT0 A;  3H35 A;  4YEJ A;  1T8I A;  2JWT A;  2GIV A;  1JT0 A;  4HEA 2;  3FZV A;  2GXA A;  3C18 A;  5IT3 A;  4NDL A;  2EWN A;  3OYD A;  5E3O A;  2KPM A;  3BR0 A;  3CCJ I;  1WJA A;  3KE2 A;  4HV5 A;  5FKO A;  2A3S A;  3G73 A;  1R23 A;  3I4P A;  1JUS A;  2DA1 A;  4YIF A;  3GTM J;  1QQI A;  2DLL A;  2NOG A;  4L5J A;  4RS8 A;  4EQQ A;  5E18 F;  2XGD A;  2ZSH B;  2IW5 A;  2RRE A;  2HQA A;  1Z05 A;  1BM9 A;  4ENJ A;  1U8B A;  2ZXW H;  3O8G A;  1YX3 A;  1LFU P;  2L54 A;  3Q5F A;  2YUS A;  4P96 A;  4XLH A;  5TGT A;  3ZQF A;  5EDN A;  1FTZ A;  2X6O A;  1XC5 A;  2A5Y B;  1HSJ A;  1ONV A;  4DNC A;  3FHZ A;  3K9T A;  3LNQ A;  2DPD A;  1YOV B;  4DQ2 A;  4ASN A;  4XON A;  4FET A;  2FXA A;  1R6R A;  1Z77 A;  5ICG A;  5EEA A;  3QOE A;  2D1V A;  4D5C A;  3V7S A;  1AKH A;  3OIO A;  1WSU A;  3RI4 A;  2JA5 J;  4GO1 A;  2BY1 A;  4XL9 A;  5B5E C;  2DXI A;  2KT0 A;  1AWC A;  4XSX F;  4M3G A;  3KYL A;  1V3F A;  3AL0 B;  1OCC H;  4KJZ A;  3L2Q A;  1IRF A;  2R3S A;  3UNG C;  2R7Z J;  1F43 A;  1KZH A;  2IVM A;  3HRM A;  2HZD A;  3N97 A;  4W97 A;  1YYV A;  2OAZ A;  3FXK A;  1HXD A;  1AU7 A;  1IDZ A;  3W2V A;  4P9U A;  4BE0 A;  4Y3O A;  5KHD A;  3U1D A;  5BMZ A;  1WJB A;  5HOD A;  2KIM A;  2X48 A;  5ICE A;  1IO2 A;  1LFP A;  2K27 A;  1SFO J;  2VC1 A;  4F92 B;  1CQT A;  2E35 A;  2GWR A;  2OBP A;  2VKV A;  3CCL I;  5HOO A;  4LB6 B;  2OTJ I;  1M1E B;  3R0A A;  1LEB A;  2W84 A;  2DFI A;  1HST A;  1HCR A;  2LY9 A;  1GVD A;  4FTH A;  1S7A A;  1Q1H A;  1ODD A;  1XDS A;  4IRH A;  3H9Q A;  3H3U A;  5JHU A;  5LHH A;  2E36 A;  2HEO A;  2R93 J;  1BC8 C;  1R49 A;  2K02 A;  2H6C A;  3JRF A;  5HS7 A;  1RUO A;  2K5C A;  1BL0 A;  1IXC A;  3AG2 H;  4ANJ A;  2HOT A;  5D6E A;  5EZG A;  3JSP A;  3WE3 A;  1UMQ A;  2JN6 A;  1OR7 C;  4X6A J;  3J80 Z;  2BYV E;  3HGY A;  1YJN I;  1MW7 A;  3D5L A;  4PFP A;  3K10 A;  5LRS A;  1EF4 A;  2M3A A;  5IYC J;  2L4A A;  2OCC H;  1N25 A;  4A3E J;  1FBU A;  2HPI A;  1YS7 A;  1A6I A;  2K9M A;  4E4H A;  2KMU A;  4I99 C;  5J4Y A;  2KIQ A;  4L5I A;  1P7I A;  2CQN A;  5EEH A;  4RGX A;  4G94 A;  2E34 A;  3OYC A;  2EQR A;  4N0B A;  4NC8 A;  1SC7 A;  2L9S A;  3FKI J;  2ISY A;  5C44 J;  1BJA A;  3BJA A;  1QPM A;  2LNB A;  4KIS A;  1A5J A;  3MZY A;  2WAF A;  1BOA A;  5J40 A;  2GM4 A;  3K1M A;  2W48 A;  3E1S A;  5HLG A;  4M3F A;  1W7P B;  1DQU A;  3QAH A;  2M0C A;  2F5D A;  4N4N B;  1U9O A;  2IP2 A;  1ZG3 A;  2K9S A;  3FXR A;  3AFH A;  3ZQL A;  1YS6 A;  4IPA A;  2XKO A;  2DMN A;  2VJJ A;  1YTY A;  2FUG 2;  2R7T A;  3FIS A;  3L7W A;  3P9C A;  1SVL A;  3WGI A;  4KFC A;  1RC9 A;  4ZZD A;  3M8E A;  1LB2 A;  1R00 A;  4OIO F;  3M4O J;  3RKX A;  1IDY A;  2X85 A;  2D2W A;  4N4O B;  4I01 A;  1MMN A;  1X3W B;  4EV0 A;  3Q0W A;  2IAI A;  6PAX A;  1I27 A;  5A2Q K;  3OMY A;  3GTK J;  2PBI A;  1JGS A;  3C7J A;  3Q3S A;  4H4K C;  3ZMU A;  5D5V B;  3HKZ N;  1FP2 A;  3RYR A;  5JVG F;  5CQG A;  2O8X A;  1XGM A;  2DA3 A;  1K61 A;  1HKS A;  2WAQ A;  2EJR A;  2J5P A;  2WAE A;  4C2M J;  1I39 A;  5FLV A;  2XVC A;  2K4J A;  3L2U A;  3BJ6 A;  1R22 A;  1QNT A;  2G9W A;  2QKL B;  5DCM A;  1X2N A;  1ZRF A;  3OY9 A;  5J1R A;  3TGN A;  5KAI C;  2YU9 J;  3RPQ A;  2E1C A;  3MCZ A;  1SD7 A;  4A3L J;  2IS2 A;  3OIQ A;  1H8A C;  4N9H A;  2UUZ A;  1S29 A;  5E1X A;  3GZ5 A;  1Z6R A;  2A68 F;  3HXL A;  5HLI A;  5LEK A;  1FOK A;  3I4M J;  3HOZ J;  3LSI A;  3KIO A;  3NRV A;  3MWM A;  4XN3 A;  3ZN0 A;  4AYB A;  1K78 A;  1ZN2 A;  1WJ5 A;  4KIB A;  2DU9 A;  5EEG A;  2BBY A;  1A04 A;  3Q9V A;  5FLM J;  2V6E A;  1W4M A;  3FM3 A;  2IGN A;  2LDU A;  3K2Z A;  3JRH A;  4Q5S F;  2E7W A;  1F1Z A;  2E2H J;  1QVT A;  3SDB A;  5K5Q A;  3VB2 A;  2NNN A;  2FU4 A;  4GRI A;  1JKQ C;  2HGC A;  1U9N A;  3G1L A;  4G12 A;  2X6X A;  3MZH A;  1VQ7 I;  2HNH A;  3BJO A;  1O3S A;  2E19 A;  2O6G E;  2EK5 A;  5FJ8 J;  3WOD F;  4M6V A;  1U78 A;  2LRD A;  2M7A A;  3HIF A;  3K4B A;  2A5W A;  4LG0 A;  4GCV A;  2H6B A;  1D0Z A;  5CYV A;  1OCO H;  1HC8 A;  3IV5 A;  1DUX C;  4LLL A;  2PLY A;  1A36 A;  1ZRC A;  4E7S A;  2DOE A;  5FO5 A;  3LOC A;  1MDM A;  1LKX A;  1REP C;  5D4R A;  3A02 A;  3W2W A;  5DV5 A;  5TRD A;  4ENM A;  4BY1 J;  3DBL B;  4HSR A;  2EFN A;  3DPU A;  1SFU A;  3ULQ B;  4NHJ A;  2B7E A;  2N8G A;  2Y48 A;  2ZNZ A;  4LJZ F;  3RJP A;  5AIP A;  4CYC B;  5FFZ A;  2DK8 A;  2I10 A;  4LLG F;  3GTO J;  3KZI C;  1ZGA A;  3JRD A;  3D5R C;  1ZGW A;  3EPZ A;  4NC7 A;  1ETY A;  4EJO A;  2LH9 A;  4EM1 A;  5HLT A;  2JK3 A;  2LMD A;  3CCY A;  2UWM A;  1TNT A;  1YW8 A;  1B1B A;  3CUO A;  2NVQ J;  2R7D A;  1WWX A;  2LKX A;  1UFM A;  2Z99 A;  2OPT A;  4L9T A;  4FE4 A;  5ILS A;  4KT6 A;  3CLO A;  4YIR X;  4M9S A;  5K7Z A;  3BQZ A;  2K86 A;  4DBQ A;  1FEX A;  1D8J A;  3HSF A;  4J00 A;  3H3Z A;  2CRG A;  3RCO A;  4LK0 F;  5DD4 A;  3IRQ A;  1PUF B;  1H9G A;  1FY7 A;  3HGG A;  5D5W B;  1VQM I;  3NWT A;  4HV6 A;  3ERE D;  4D1Q A;  4L9V A;  4JK1 X;  2STT A;  1QU3 A;  3RZO J;  3FHN A;  3SDG A;  3KFW X;  1F9N A;  4AIJ A;  2PJP A;  5JHF A;  3HSE A;  3I64 A;  3VFZ A;  1TW3 A;  1JUM A;  1LDD A;  3WTU C;  3FMQ A;  3OOU A;  2EB7 A;  1OCT C;  4CCJ A;  2ZXI A;  2L9N A;  2MA3 A;  1G6N A;  4ABZ A;  2O3F A;  3BCA A;  5FKM A;  4L18 B;  1BN5 A;  5E3L A;  2O8K A;  2NVT J;  1S3J A;  4UVC A;  4BJ5 C;  1JKP C;  2DDB A;  2OUM A;  4ZYD A;  1KU7 A;  2OV7 A;  4XIC A;  2V79 A;  1YX5 A;  3GFI A;  5KAF C;  3WTV C;  3DPT A;  3FXL A;  3E7L A;  3FKJ A;  3QPL A;  4RAY A;  1WRJ A;  3A03 A;  1D8K A;  2X1E A;  1RES A;  4MEX F;  3M8F A;  1S8N A;  3L2V A;  2DA5 A;  3NAR A;  4IO9 F;  1HA8 A;  1FOW A;  1XX5 A;  4M3D A;  2HFH A;  1G4D A;  3PUF A;  4YFN F;  1IZ1 A;  2ECC A;  3BT9 A;  3K70 C;  2CV1 A;  1KA8 A;  1WCM J;  2VL8 A;  1A31 A;  3L2C A;  2FQ3 A;  3ELK A;  4DZP A;  1J75 A;  2Y69 H;  2Z9O A;  4FQG A;  2IRF G;  1W0U A;  2VOO A;  5ED4 A;  1MBG A;  2IPQ X;  2LSO A;  3ZP5 A;  3ABL H;  5DEQ A;  4V19 K;  2XV4 S;  2JUG A;  3A0B C;  3F3X A;  2RAE A;  3MFK A;  3TW6 A;  2L7Z A;  1ETV A;  1HW5 A;  4LB5 A;  1Y6I A;  1R58 A;  1UEL B;  3FDY A;  1QBJ A;  3S17 J;  2Q2E B;  1VQO I;  3GTJ J;  2CQQ A;  2JQ7 A;  3WHB A;  3E5X A;  3ZQH A;  3S2D J;  2W57 A;  3HOW J;  3GTL J;  4A93 J;  2XGE A;  1S9H A;  3DV8 A;  3ZCO A;  1CF7 A;  5J3L A;  2FNP A;  4BJT A;  4HNT A;  5F64 A;  4YFK F;  4Y33 A;  1UCR A;  3BLY A;  4GFB A;  1IN8 A;  3PSI A;  3KP3 A;  1KU9 A;  2H94 A;  4UNO A;  4D7M A;  3TO9 A;  1OYW A;  5DUI A;  1P92 A;  1R4M B;  3RIR A;  1U3E M;  4IRI A;  1Z1D A;  1X19 A;  3EUK L;  2LTP A;  1LE8 A;  5EGO A;  5F04 A;  3ZMZ A;  2ZO4 A;  2ZJR F;  1MBK A;  1QGP A;  4CCM A;  1WFX A;  4MFE A;  4M3E A;  3E5U A;  2FX0 A;  2HS5 A;  3JAM K;  2RV8 A;  3IH4 A;  4ZYE A;  3FBI B;  3KYC B;  2LG4 A;  5CVI A;  5ICF A;  4RAF A;  1YIO A;  2XAF A;  2KIF A;  2Z3Y A;  1W5S A;  1XD7 A;  1OPC A;  2X0L A;  4KMF A;  2DK5 A;  1B9M A;  3HB9 A;  2DTR A;  2BZT A;  3P5J A;  4RB1 A;  5EJC A;  3QP6 A;  4S05 A;  3OIP A;  4S0H B;  3QPH A;  4S04 A;  4OWR B;  3HPG A;  1FJL A;  1UHS A;  4HA8 A;  2ZCW A;  3BC8 A;  4MLO A;  1XMX A;  2AQE A;  1TQP A;  3DP7 A;  4XLN F;  4KA4 A;  3IAM 2;  3K6G A;  2KFD A;  3CMA I;  3HHG A;  3MVP A;  1MD0 A;  2YX4 A;  3ECH A;  1UAA A;  1ZLK A;  4ZDL A;  2KJB A;  3N4M A;  4MQ9 F;  2O0Y A;  4IOA F;  2DOA A;  2QLZ A;  3GME A;  4G6D A;  3CCS I;  2KP6 A;  3ML6 A;  1I3Q J;  5TIS C;  1NG6 A;  2L7M P;  3PUB A;  1FYL A;  2EZK A;  2V9V A;  2X9D A;  2LRE A;  3VYT B;  3S3M A;  2XAU A;  3PO3 J;  2WTE A;  1ZTR A;  2PMH A;  1JTX A;  2HYJ A;  3CQZ J;  4UXN A;  4BL0 B;  3BCB A;  4AUX A;  5IP7 J;  1D0X A;  4A3D J;  3JSO A;  3FBN B;  5FRN A;  3DF8 A;  3I59 B;  3QYB A;  3FWE A;  2KHM A;  3BDD A;  4GYI A;  4B8X A;  5EF6 A;  4IJA A;  2AHQ A;  4HF1 A;  4B48 A;  3MD2 A;  1MBH A;  4CYD A;  3K4C A;  3K1N A;  4OAZ A;  3VSL A;  3IKT A;  5FLX Z;  2L9R A;  2M34 A;  1IRX A;  3DEE A;  5F0H A;  2VKD A;  3KEO A;  5LGN A;  1GV5 A;  2Y75 A;  1APL C;  4A3C J;  2COM A;  3I4N J;  3DTE A;  3BP8 A;  4J01 A;  5EYR A;  2MGQ A;  3QRF F;  1JT6 A;  1QVU A;  1VF9 A;  2EBI A;  3BG5 A;  3LA3 A;  3E6C C;  3K4K A;  4A2U A;  2BV6 A;  3HHH A;  3VEP A;  1Z67 A;  2KQR A;  3ABT A;  3DLL F;  2R5Z B;  4BXX J;  2LF7 A;  5JI6 A;  2DJI A;  4FX4 A;  2LD5 A;  4MHG A;  1KQ8 A;  2R7V A;  2HKX A;  3OYI A;  1ETO A;  1W1W E;  1R1T A;  1MNE A;  2XF7 A;  4BAY A;  4RBO A;  3S1M J;  3P9K A;  3ROU A;  3K4M A;  4U7B A;  3AG1 H;  3BTI A;  1AOY A;  4XOR A;  4QSH A;  4ZDP A;  4RA2 A;  2DA6 A;  1R7J A;  2V1D A;  3F8C A;  2F5C A;  4M6Y A;  1N77 A;  2F6C A;  2M87 A;  5IT9 K;  3IHU A;  4XID A;  4WXC A;  2RNJ A;  2I8D A;  1ZAO A;  4NB5 A;  2XAS A;  2DA2 A;  3U1K A;  2NS8 A;  4L0Y B;  2ZME C;  1JKO C;  3CC2 I;  5F08 A;  4JP0 A;  1FLI A;  1LDK B;  4ZYH A;  2LY2 A;  3BG9 A;  3GTP J;  2LBF B;  5BPI A;  1BA5 A;  2P6T A;  4ESB A;  1W7P A;  3K2A A;  1JKR C;  4IHY A;  4YRV A;  4PSX A;  2ISZ A;  5HVQ C;  1Z21 A;  4BJ6 C;  1K83 J;  1DP3 A;  1HQC A;  2VB6 A;  3OYA A;  2CS3 A;  3ZQ7 A;  1P7J A;  3LA2 A;  4ZC3 A;  3DPL C;  4CXF A;  3HC7 A;  3H92 A;  1X58 A;  2FA5 A;  1Z91 A;  2J5O A;  3ZMD A;  2VOD A;  2ZFW A;  1J2X A;  4Y13 A;  2EZH A;  1I1S A;  4A3J J;  3H9G A;  2XRO A;  1R4N B;  5J1U A;  3VOD A;  5H6R A;  4IHW A;  1EH6 A;  1XPX A;  4C9Y A;  1BI0 A;  1TWG J;  5ICC A;  5JVT A;  4CCN A;  4DGW B;  2L4M A;  4OMY A;  1MND A;  1RET A;  1B4A A;  4WWC A;  5BOX A;  2LVS A;  1MGT A;  3P7N A;  5CQE A;  3W3C A;  5HLH A;  1RNL A;  5K5O A;  1T38 A;  1J59 A;  2H09 A;  3OYJ A;  1JJ6 C;  2LC2 A;  3G2B A;  3ESW B;  4F3Q A;  2WB1 N;  3HEF A;  4HDU A;  1WHU A;  4Q47 A;  4CZZ A;  3HRU A;  1W36 C;  4G7O F;  3EUH C;  2M0M A;  4DOZ A;  4PZJ A;  2RQQ A;  3KZZ A;  4IKF A;  3HOS A;  2HVR A;  5LGU A;  3I5U A;  4HBL A;  4HLX A;  3SJM A;  1ZR2 A;  1DPR A;  3HOT A;  1MBE A;  2WY8 Q;  3WG7 H;  3KLO A;  1VQ4 I;  2L9V A;  2RGV A;  2IJL A;  2FE3 A;  1J09 A;  2IBD A;  2XF5 A;  2ESH A;  3HUG B;  4UUV A;  1UZC A;  2JZY A;  2EH3 A;  1XSX A;  2EIN H;  2DOD A;  2DMU A;  4FAS D;  2MG4 A;  3QWL A;  3BG3 A;  3TMO A;  4IZZ A;  1IW7 F;  2DDA A;  4DIQ A;  2BVM A;  4C3I J;  2E60 A;  2HOE A;  3NQO A;  3HPH A;  2VKH A;  3PJR A;  1FNN A;  4XKV A;  1TQM A;  3QYF A;  3OL3 A;  4PFO A;  3DKY A;  3A1Y A;  3RKY A;  2A6E F;  3CME I;  4A3G J;  1F36 A;  1SVO A;  1WJD A;  3LSJ A;  1ZQ3 P;  2L5Q A;  3BR5 A;  4FT8 A;  2WWY A;  2FRH A;  1YFH A;  1WI9 A;  2OJE D;  5HNH A;  4XLA A;  4PJN A;  3DU6 A;  3CUQ B;  4XNF A;  1DP7 P;  3I58 A;  1T6S A;  3SFI A;  2XPW A;  3F6O A;  3VOE A;  1I3A A;  1QZY A;  3OR2 C;  3JRI A;  3CO7 C;  3LWF A;  1U5T C;  3CCU I;  2NRA C;  5IY5 H;  4G7H F;  1I6H J;  2W82 A;  2M4G A;  5HDK A;  4JOM A;  3J7Y J;  3JW4 A;  3D5S C;  1FYK A;  2XUB A;  2CYY A;  3GX4 X;  3ZPL A;  2UZK A;  3K7A J;  3DEU A;  3ABU A;  3DTI A;  3OL4 A;  3F22 A;  2DQR A;  2Z1D A;  4QPO A;  3FM5 A;  2K9Q A;  4IL6 C;  5FFX A;  4DJA A;  5GAG J;  4BE1 A;  1W36 D;  1V5F A;  1FT9 A;  4LIT A;  3GFJ A;  4ITV A;  3SFZ A;  3IKV A;  4CYC A;  4J19 A;  2QKM B;  1H0M A;  1Z3X A;  3PIO F;  4XKC A;  4ETS A;  4BU2 A;  4XLP F;  1OYI A;  5E3N A;  4KDP A;  2WC2 A;  4I02 A;  1BBY A;  3F21 A;  4ENK A;  2XHK A;  2DN0 A;  1MMS A;  2CV0 A;  2H1K A;  2F4M B;  2OA4 A;  3V8K A;  4LIU A;  3ZQQ A;  2DQL A;  1XN7 A;  3M8J A;  4L5E A;  5M3F J;  4GXO A;  1IAW A;  1GLN A;  3GCM A;  2MSY A;  3B6A A;  3V8L A;  4AVZ A;  3HTU A;  5E1W A;  1DGR M;  2FF4 A;  5BNG A;  4CCL A;  1PUF A;  4HNU A;  3S32 A;  4G6Q A;  1RKW A;  4O6J A;  2F4O B;  3MQ0 A;  1JGG A;  2PMZ A;  2FQ4 A;  1IGN A;  3S15 J;  2UXN A;  3I55 I;  4WF2 A;  4BQO A;  1G2H A;  5LFA A;  1L3L A;  2IA2 A;  3DCF A;  3ZMV A;  1XG1 A;  1T08 B;  4M73 A;  1WJC A;  3L00 A;  3OYM A;  5FKN A;  4EGY A;  1RR8 C;  2GXG A;  2CGP A;  2E7X A;  1IG7 A;  1BI3 A;  1PP8 F;  1MMA A;  2QYO A;  1MNM C;  2JSP A;  4UB8 C;  1TBX A;  4PUS A;  1ULY A;  3HOV J;  2AO9 A;  1ZG1 A;  1PVE A;  3E5Q A;  1NTC A;  3C1D A;  2QQB A;  2B9S A;  1X1P A;  1NK2 P;  3MMY B;  3LSR A;  2DFE A;  3S1N J;  1RKT A;  3G1M A;  1O3T A;  1XB4 A;  2LYC A;  4YII A;  1AA7 A;  1DU0 A;  5J6X A;  2JA7 J;  2HI3 A;  5FRO A;  4KUM A;  5K7F A;  2MLK A;  1MH4 A;  2IGK A;  2HYG D;  1MH3 A;  3QPS A;  4QTR A;  1XTA A;  2P7V B;  3JCU C;  4KIG A;  2JA2 A;  1BW5 A;  3WGH A;  3VSK A;  1JXS A;  4EJT A;  2H1L A;  2CV2 A;  3ZMT A;  5D8K B;  5J8F A;  3J80 K;  2HOS A;  3TED A;  3AG4 H;  4DZJ A;  3IL2 A;  1XSV A;  5E79 C;  4BEH A;  3ZQI A;  2VPL A;  4DYC A;  2DTZ A;  3E6B A;  2QBY B;  3S93 A;  3SZP A;  1LPQ A;  2GOM A;  1J5Y A;  2R7X A;  4B3X A;  1MBJ A;  4LK1 F;  3HG9 A;  4A0X A;  2ZKZ A;  2EFW A;  2Q2E A;  4EJW A;  5D5X B;  2DMP A;  3JTH A;  1VND A;  2QGU A;  3OYE A;  1FTT A;  2R7O A;  2ZFU A;  1ZGJ A;  4E7H A;  2BY2 A;  3EDP A;  2XRN A;  1RUN A;  4XKW A;  2HDW A;  2R7R A;  3QYE A;  4DBR A;  3BTJ A;  1BI2 A;  3BWG A;  1SD5 A;  3NAU A;  4QWQ A;  4A3F J;  2VPR A;  2WY7 Q;  2X6Y A;  4BDZ A;  3OSG A;  2GQQ A;  3CJN A;  1GXP A;  5D8L B;  2DBB A;  5IPA A;  2XAH A;  2CG4 A;  2LOO A;  1VTN C;  2VXD A;  2JVG A;  4N9I A;  2QWW A;  2JPC A;  2DFH A;  2BW3 A;  3TP3 A;  4HQM A;  1MIJ A;  3HBL A;  5GPC A;  1NHA A;  1T2K A;  1ZHF A;  3FXQ A;  1TLH B;  5FD6 A;  1USS A;  3GFL A;  2XIG A;  1OMI A;  3V7C A;  1QPI A;  3AG3 H;  5CJ9 A;  2K4B A;  2LF8 A;  3CJT B;  3IAS 2;  4I0B A;  4RB0 A;  3V4G A;  1YG2 A;  2VE9 A;  2VLA A;  1YO5 C;  2QSH X;  2Y2Z A;  2CQ7 A;  4HLY A;  2O7O A;  1O7L A;  3VYU B;  1E3H A;  1LUJ B;  2FNA A;  3H0G J;  2LLK A;  2E1N A;  2W00 A;  3HTS B;  4YFX F;  2F2E A;  5DS9 A;  4BHC A;  4HDV A;  4LGW A;  4EM0 B;  5HDG A;  3VYR B;  3M3Y J;  5L3E A;  2D5V A;  2P4W A;  2G0E A;  4F52 A;  3OYH A;  1CGP A;  1SMT A;  2JSC A;  2R7U A;  5J1Y A;  4Y15 A;  4HAM A;  4JQF A;  1B59 A;  2GA2 A;  1BI1 A;  5KK1 A;  3WTX C;  1V54 H;  1PUE E;  2M2E A;  2ME0 A;  5DM7 F;  2R0Q C;  3CJR B;  1MKM A;  1X3Z B;  1U0J A;  2L0K A;  2MC3 A;  2EV0 A;  3KP5 A;  2PG4 A;  2XAJ A;  4I0A A;  2FML A;  2P7C B;  2F5V A;  1BR1 A;  2MW8 A;  3GZN B;  4CCK A;  5IYD J;  1R5I D;  2PJR B;  2W4S A;  3DEW A;  3I3L A;  2QQ8 A;  2BVL A;  1FOY A;  2O61 A;  4UY8 I;  4PJJ A;  4IF4 A;  4M9Z A;  3CO6 C;  1RZ4 A;  4XOT A;  3FXJ A;  5CVR A;  1G3S A;  2MYS A;  3I59 A;  3ZQC A;  1Y1W J;  2ZNY A;  1J7K A;  2MFZ A;  3UKG A;  3TDU C;  2KIS A;  2CW0 F;  3PNV A;  4RLQ A;  1FIA A;  2VBY A;  2MH2 A;  1TWF J;  2DA7 A;  1T0F A;  3BRO A;  3FX3 A;  1ZKG A;  3OV8 A;  4ZZL A;  2HPM A;  3MKY B;  1UHW A;  2QF7 A;  1X4P A;  2MD5 A;  2K3F A;  3O6B B;  4IQJ A;  3J7A Y;  2XC7 A;  1DU6 A;  3HYI A;  2ZC2 A;  4U7D A;  1BR4 A;  1N78 A;  2GIZ A;  4WK8 F;  2VOP A;  2R5Z A;  1OCP A;  1XS9 A;  1Y8Q B;  5C4X J;  2IGO A;  3IH3 A;  3COA C;  1LFB A;  4XM3 A;  2V9K A;  1K6Y A;  4ZDO A;  2EIJ H;  2QUF A;  4NQW B;  2MC4 A;  1IRZ A;  1OIS A;  2FMY A;  2G7U A;  2IEK A;  1QHG A;  2K9L A;  2XRL A;  3E97 A;  4QPQ A;  4M6X A;  1V5G A;  1V55 H;  1D1A A;  1NH3 A;  2EV5 A;  1G59 A;  2Y0S A;  3G4S I;  2X1C A;  2IA0 A;  2X51 A;  2ETH A;  2E1M C;  3ZRG A;  3J81 K;  5F0F A;  1WVR A;  5C4J J;  3OYK A;  2YS9 A;  1W0T A;  1BOB A;  2P5V A;  1K4T A;  4L9J A;  1IJW C;  3RPU A;  4A3B J;  3M7G A;  4ZYA A;  5IOY A;  5FRM A;  4KIF A;  4P1W A;  4BEH B;  4WXH A;  4E7L A;  2F48 A;  3Q9S A;  5E3M A;  2K3P A;  4EJU A;  3JAM Z;  2LBF A;  2Y31 A;  2E1O A;  1U8R A;  4ENN A;  2ECB A;  4A0Z A;  2CUZ A;  4Q4Z F;  3GYH X;  1R1U A;  2TRT A;  1VQ6 I;  3G6E I;  5K7H A;  1GT0 C;  1IN7 A;  1VQ9 I;  1GDT A;  2HOA A;  3PSF A;  3DXJ F;  4HYE A;  5FD5 A;  5BQT A;  2CW8 A;  2R7F A;  3CCE I;  1XSD A;  3CCR I;  2VJ5 A;  4EMS A;  5LLQ A;  4UUS B;  3WE2 A;  5M5W J;  1KYZ A;  2GXB A;  2R7Q A;  4ZTJ A;  5JLW A;  2P8T A;  2VON A;  2DYR H;  4U0W A;  1XGN A;  3IRR A;  4XSZ F;  2ZJP F;  3K4L A;  4JBA A;  2R7W A;  2OZU A;  3L1P A;  5GP9 A;  5LHG A;  3GLX A;  1RIO H;  2Y0M A;  1IUY A;  1FC3 A;  1I6X A;  2VIX A;  2BW3 B;  3PFY A;  2OD5 A;  2R5Y B; 
#chains in the Genus database with same CATH homology
 1VQL I;  1YJ9 I;  3CMA I;  3J7Y J;  4IOA F;  2ZJQ F;  1YJN I;  3CCS I;  5GAG J;  1VQ7 I;  2K3F A;  1YIJ I;  3CF5 F;  3PIO F;  4IO9 F;  1FOW A;  3CCJ I;  1QA6 A;  2E34 A;  2FOW A;  3CCV I;  1ACI A;  1YHQ I;  1HC8 A;  1VQ5 I;  1MMS A;  1FOX A;  3CC7 I;  4V19 K;  3J7Z I;  5GAE J;  3CD6 I;  3G4S I;  1S72 I;  3CJT B;  1VQO I;  1YI2 I;  5GAH J;  2JQ7 A;  2QEX I;  3CCQ I;  5GAD J;  3I55 I;  1VQ4 I;  3G71 I;  3DLL F;  2H8W A;  1VQN I;  1VQK I;  2NXN B;  1VQ6 I;  3G6E I;  5JVG F;  2ZJR F;  1VQ9 I;  1YJW I;  1YIT I;  5DM7 F;  3CCM I;  3CME I;  3CCE I;  3CCR I;  2QA4 I;  3I56 I;  1VQM I;  2E35 A;  3CCL I;  2OTJ I;  4IOC F;  5DM6 F;  1VQ8 I;  2ZJP F;  1FOY A;  4UY8 I;  2OTL I;  3CC4 I;  3PIP F;  3CC2 I;  1VQP I;  1Y39 A;  3CCU I;  2E36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...