3CCLI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cclI00
2FOWA 2E35A 1ACIA 1FOXA 3CMEI 4IOCF 3CC4I 1YI2I 1QA6A 2OTJI 1YJWI 1YJ9I 1YJNI 1VQ5I 5GAGJ 1VQNI 1MMSA 3CCLI 5GAEJ 1VQMI 3J7ZI 1FOWA 1VQOI 3G71I 5GADJ 3DLLF 3CCRI 3J7YJ 3CCEI 2ZJPF 1Y39A 1YHQI 1HC8A 3CMAI 2H8WA 2JQ7A 1YIJI 3CJTB 2K3FA 5DM7F 3CCJI 3CC2I 3CCVI 4UY8I 3G6EI 5DM6F 2E36A 3PIOF 2QA4I 3CC7I 3CCSI 3PIPF 4IO9F 3CD6I 1VQ9I 4IOAF 2ZJRF 1YITI 1VQKI 3CCUI 1VQ7I 1VQLI 1FOYA 3CF5F 2NXNB 1S72I 3I56I 4V19K 1VQ6I 3CCMI 5JVGF 2OTLI 2ZJQF 3CCQI 3G4SI 1VQPI 2QEXI 5GAHJ 2E34A 1VQ8I 3I55I 1VQ4I
chains in the Genus database with same CATH superfamily
3DPUA 1LNWA 4P1WA 4BQAA 4I09A 5D5WB 4HV5A 1XGMA 2O3FA 4AIDA 2JA5J 3H5RA 4RM2A 3HRSA 2NVUB 1QZEA 1UFMA 3ULQB 2NVXJ 1P4WA 3HOUJ 3L9FA 4CCNA 1BL0A 5LD2C 3CC7I 1O7FA 1R1VA 2K27A 2LNBA 3BPVA 4IJAA 3IAS2 1K83J 2K40A 4QSHA 1TT5B 4D5FA 1UAAA 4PJNA 5EYRA 2XKPA 1IUFA 2DK8A 3FHNA 5AIQA 4YFKF 2GA2A 4FTHA 2VBYA 4I01A 5D8LB 4IL6C 4C3IJ 4BE0A 1N75A 2C6YA 4B3AA 4RGRA 3VODA 2HKXA 1A35A 3I59A 2A69F 2QSFX 1T98A 3LMMA 4RAGA 5E3OA 4HX7A 5BQTA 3C2GA 4UY8I 3BCAA 2FOKA 2XRLA 4L5JA 3Q0UA 3CCSI 2R7WA 3CTAA 2EB7A 1NK2P 3VB2A 2G7HA 2QEXI 1WZ2A 3O6BB 2CQXA 2VJJA 2MSYA 4AU7A 4BQQA 1H0MA 1FT9A 5FKKA 2KZVA 4HSTA 1RI7A 2FBHA 1LDKB 2VJ4A 5BPDA 4A6EA 2PBIA 3TGNA 3COAC 2M8GX 4FE7A 4NNJA 2JRTA 2XF7A 3MVPA 4CA0A 1XS9A 3FMSA 2EA4A 4BH9A 2J5PA 3GTMJ 1XMXA 1I27A 2KISA 2WY7Q 5LLQA 3J7AY 3ZMZA 5J3LA 2YPRA 2E5NA 3ZMTA 5K5QA 2Y0SA 2BY1A 3F0CA 1FOKA 3K70D 3KYLA 3L00A 5EZHA 2G7UA 2CQKA 3CLOA 1K4SA 2CO5A 2TCTA 4M6XA 1YIJI 4RB3C 3F21A 2KIMA 1HSTA 3TOBA 4PDKA 1YRNB 4A0ZA 3GFJA 1WQ2A 1BIAA 3FXRA 1JHFA 4WF2A 4CYDA 1FP1D 4EM0B 2KFDA 5TISC 4EV0A 1UELB 1K6YA 1I1GA 4DYCA 2R7UA 3VWBA 2MFZA 3S3NA 3V8JA 3SEZA 1IRGA 2DA1A 1KU2A 2M30A 4QPQA 2E35A 1RNLA 5F64A 3FXQA 2VJIA 1QO0D 1TNSA 2GIZA 3K4KA 2OC6A 5IYCJ 3QU3A 4OMYA 2E1CA 2WA0A 3L2VA 1FP2A 4A93J 3AG2H 4NC6A 1DU6A 3ECOA 4D5CA 1R22A 4A3MJ 1R23A 5IYDJ 3BY6A 3FMRA 2W7NA 3ZQCA 3CUOA 3CCMI 1KZHA 5KHDA 2YS9A 3W2AA 1R58A 4G94A 3GZNB 4G8XA 1N25A 1R71A 3H3VK 3K0LA 5CQGA 3ABLH 3ESWB 2VPLA 5BPIA 1K61A 4RM3A 4M9ZA 2ZSHB 2IXSA 1W0TA 3FKJA 3I3LA 2WAFA 2L9RA 2OZ6A 2LOOA 2KT0A 2Y9YA 1IRXA 5DM7F 5CKTA 3PIPF 4XLEA 4E7JA 1T8IA 1BA5A 2K86A 2HOEA 4RLQA 5GPAA 2F6CA 2L7ZA 1GUUA 3KX2A 2CQNA 4KISA 4MFDA 3C2BA 1D1AA 1HCRA 1ITYA 4HAMA 5GPCA 4L0YB 2BV6A 4BACA 2Y0MA 2F48A 3L2WA 2WB1N 4PJLA 2OPTA 1S29A 1P4XA 2K9MA 4F3QA 4CCLA 5FROA 2FXAA 2FMYA 1FSEA 2FNPA 3DKXA 2JTVA 4LFUA 2BZTA 1X1AA 3EYYA 4DGWB 5DM6F 4XKVA 4BY7J 2KRHA 1RC9A 5CVUA 2GA1A 4IXAA 5H2FC 4NUBA 2OTLI 2L7KA 4L9NA 1X1CA 5B5EC 3C18A 2RREA 3GZ5A 1SAXA 3DV8A 2M4KA 4M3BA 4H0EA 2XGCA 3CF2A 4BXFA 2M0CA 1F5TA 3KLOA 1YI2I 5HLHA 3VPRA 1XTAA 2BHYA 4PFOA 4A3IJ 4A5NA 4KN7X 1YRNA 1E2XA 2PJRB 3GTLJ 1YS7A 3AFHA 1S3JA 2VT3A 4XRSG 2EBIA 2QA4I 3HOSA 3FBIB 2ZCWA 1A36A 2HQNA 3RIRA 1J0RA 1S7AA 3S1RJ 1A04A 2Z3YA 4L9JA 1OCRH 3RZDJ 3N4MA 3QOEA 4JOMA 1TWCJ 4XIDA 1FOXA 1R6RA 3IH2A 4DOZA 2MBFA 1BJZA 2B63J 2L01A 1G3WA 1VI0A 1OR7A 1Y39A 2BEOA 3DQVC 2DPDA 2R5ZB 2B7EA 1NH3A 1X3UA 2ELKA 2ESHA 4HLYA 5J1RA 3BJOA 2H27A 1Y56A 4KMFA 3TQNA 2M87A 3H0DA 3OIPA 3QYEA 3O8GA 4UV9A 3FXKA 4QPOA 2DW4A 2NNNA 3K4CA 3ZR8X 3ASNH 3AG4H 3WTUC 4FETA 1ZLKA 2E1OA 4AVPA 4KICA 3P9IA 5IYBJ 3CJTB 4A3KJ 5M3FJ 1RR7A 1SFXA 2ZKZA 1ON2A 1I6XA 1FIAA 1XPXA 4OOIA 4AYBN 1HKTA 4HF0A 4J19A 2QSGX 2KP6A 3WTWC 4MEYF 1RRJA 1MH4A 4CICA 1VQ8I 2B9SA 1ZYRF 2DK5A 4RB0A 5DS9A 3BLYA 4KUMA 2O9LA 2DTRA 1R49A 1S7OA 3GTGJ 1HW5A 1OYYA 4NB5A 1XG1A 3MKLA 3V4GA 2L9NA 3S93A 1H9TA 3HEFA 3ZQIA 1MBEA 1GV2A 3F3XA 3H9JA 3JSOA 3SDGA 1JJ8C 3F8CA 4N4OB 1AU7A 2IGOA 3NWSA 4EMSA 1IUYA 1AKHB 5HNFA 1MKMA 4D7NA 1P4AA 4U88A 3ZMVA 1TTYA 3FIWA 5JI6A 3V42A 5CVIA 1SVMA 4A3EJ 4HX8A 2GM4A 2M3AA 4Y17A 4DZPA 1PUFA 5HS8A 3LQQA 2PJPA 2WBMA 4LG0B 3T8RA 2RAEA 3KZIC 4A5MA 3ZQLA 1A6QA 2UV1A 1ZHFA 2TDXA 5E3MA 3X2QH 5D8KB 2M7AA 4IPAA 4HLXA 4IOAF 2P6TA 4UUSB 4LITA 2QLZA 1VQ6I 3DLAA 2EK5A 1LDDA 2VQLA 4FX4A 1ZREA 3MD2A 3P9CA 3S2HJ 2RNJA 1FBUA 3ZXSA 1ZR2A 3HJEA 2CUJA 3TEDA 5BMZA 4XBFA 4ZDPA 2R92J 1JGGA 4NBQA 2ECBA 2H94A 2H1LA 4LK0F 2HEOA 2EFPA 2P5VA 2Z1DA 4ZYEA 3GVAA 1FMWA 3AL0C 3OOUA 2DFEA 4MGRA 1EH7A 3BDDA 1CQTA 2V4JC 3LFKA 1BI0A 2QBYA 3Q3SA 3WHCA 2CV0A 3SFIA 4Y13A 4GXOA 4ZC3A 4I0AA 5JHFA 1U3EM 1IG7A 1EH8A 4A3DJ 1Z7LA 4G7OF 5F0FA 3ZMDA 1E3HA 2P7VB 3BG7A 2BHZA 5DTDA 1YJNI 1FJLA 3CMMA 4AYBA 4E7IA 1FOWA 4I76A 2R7VA 2FF4A 2JJ7A 3K9TA 2E5ZA 2VE8A 2OBPA 2V1DA 3OSGA 5IT9Z 2LR8A 4BBRJ 3JAMK 4A12A 3SFZA 2XROA 1U0JA 2XC7A 2OD5A 1T0FA 1Z21A 2BVLA 2XGDA 4HSRA 3MAJA 2FE3A 2DBBA 2DQRA 1XGOA 1MJAA 3LAPA 2JUGA 1MMNA 2X48A 2JUCA 5HNHA 2KMUA 2JN6A 4F7ZA 2JWTA 2R7OA 1ZR4A 3BJAA 4GCVA 2K4JA 4CZCA 4LMYA 3IL2A 4B8XA 2CV2A 3ASOH 5DD4A 2XF5A 2IRFG 4G12A 2RKHA 1DP3A 1GDTA 4PCQA 2XRNA 3F22A 2RNGA 3LSTA 3BR2A 3OYKA 1Z3XA 1YITI 2DPUA 2LG4A 3DU5A 4Q48A 5IPAA 2XGXA 5E1ZB 4DIQA 4NC7A 4R8HA 1WJAA 3DF8A 1EJ9A 3L2RA 2ZXIA 2IA0A 3KYDB 1P2FA 3ISPA 2PI0A 3C2HA 5HVQC 3HHHA 2W1OA 2H6BA 2DYRH 3WU2C 1I6HJ 3MCZA 1R1TA 4KIGA 3T8TA 2HXIA 2OQGA 3A0HC 2XB0X 1R7JA 3ZQFA 3ERMA 4ZYGA 3S2DJ 5J8CA 2GQQA 2HWVA 5E3NA 1NK3P 1FY7A 2E1NA 3B73A 2BOLA 2LDUA 2PEXA 4N0BA 2LF8A 3S17J 3BCBA 4PJJA 3QQAA 3PQKA 3WU1B 2NVTJ 2X0LA 3JRBA 1LUJB 2ISYA 4R1HA 1IN8A 3HKZA 3QYFA 2RVCA 4PJ0C 1IJWC 1WHUA 3S3MA 4XR6A 2J5OA 3I9V2 2F5CA 1MNMC 2BY3A 3CZ6A 3DP7A 3TW7A 5E18F 3T1BA 3MQ0A 2DDBA 2RV8A 2L4MA 3BR5A 5EF6A 2GXAA 3N05A 1ZLJA 1G3TA 2NS8A 3E3VA 4D7MA 2ZB9A 2VN2A 4M73A 3I59B 5J8FA 4X1EA 3G4SI 1ZRCA 3CDIA 3HSRA 1PP8F 3CC2I 4Y33A 2OU2A 4UVAA 3ZN0A 3E6MA 1I50J 2O5RA 4NQWB 5HS9A 1YX3A 3U1DA 1IXRC 1YO5C 3BZCA 3CCYA 4OIRF 2HKOA 3OSFA 2ECCA 1BC7C 1BIBA 5FLXZ 1TNTA 1W4MA 2HTSA 2EV0A 2PQ8A 3FX3A 3RQIA 1WKMA 4IEJA 3TOAA 1FOYA 3BQZA 4M3DA 4LIUA 2CS3A 1XSDA 2EZHA 2ACJA 4S05A 2XSDC 5LRRA 2NAZA 5F0HA 2IGKA 4P55A 1O3QA 3GTKJ 3OYIA 3I55I 3L2UA 4C3HJ 1OCZH 2W57A 1HOMA 3EUHC 1XCVA 4EJVA 4YIFA 3DKYA 2VLAA 5CPRB 3AKZA 1IXSB 3KP5A 2UXNA 2DMPA 4FHTA 4HRIA 2M1BA 2E2HJ 5F0CA 2E36A 4KN4X 3JRDA 3SZTA 3LA3A 2ZJRF 1XMAA 1VQLI 1HDDC 4BJTA 4YEJA 1S7EA 3H0GJ 4M3GA 2Z99A 2PMUA 5H6QA 4EQQA 1GLNA 4G6TB 4A3BJ 1QQIA 3IHUA 2I10A 1ACIA 3S8PA 4B3XA 2FJ1A 1YJ9I 2BY0A 2K85A 1HXDA 1IN5A 3HDDA 3VYRB 1T6SA 2BYVE 5L3GA 3QPTA 4V2GA 2LVSA 2VJ5A 3E5QA 3J80K 2EINH 4UNOA 4WK8F 2HYFA 4HF2A 3OYGA 1A6IA 3F6OA 1MSEC 4JX5A 2K3PA 3GX4X 4I02A 2ICWG 5L3DA 4UV8A 3MEXA 4JP0A 1QPIA 2FD5A 2VT2A 1Y8QB 2E34A 2MLGA 4BEHB 1ZRFA 1PDNC 9ANTA 3TBIA 2STWA 3TL4X 3RKWA 1R36A 1W36C 3VYSB 3DWLE 2PN6A 5DUIA 1P6RA 3HOZJ 1FTTA 1J75A 4OIPF 1UHSA 1SMYF 5CVRA 4EJWA 1BC8C 2JT1A 3QODA 4LOCA 1SFOJ 3Q0VA 1H9GA 1ZRDA 2O8KA 2LRDA 2K7LA 5M3MJ 3IUOA 1U8BA 1OCCH 3LSIA 3JRFA 2CW8A 3MKYB 1IXCA 5M5YJ 4B09A 1AHDP 5C3EJ 2OQRA 1RUNA 2VQGA 1JKQC 1B1BA 3V7SA 5C4XJ 1MBGA 5KAIC 3FWEA 2AXTC 3HL2A 1QA6A 5FD5A 4J00A 4ZTFA 3CCLI 2FRHA 2FQ4A 1Z6RA 3DU6A 3H35A 4R79A 4CYCA 3FMQA 1ZGAA 4CYCB 3DEEA 1Z0XA 4E7HA 2DA4A 2X51A 1SD6A 5KVRA 3LL7A 5F04A 4LG3A 2VOOA 1E3OC 2D1HA 2W24A 1Z6TA 2JPCA 3A01A 2L7FP 3GTQJ 3W6VA 1OKRA 3LSKA 2DN0A 1FLIA 2MW8A 3I56I 2VE9A 1G3YA 5FLVA 4YIRX 1R5ID 2RC4A 4JQFA 1ODDA 1TWGJ 3ONQA 1TWAJ 2BBYA 2MABA 2XB5A 4PSXA 5IP6A 1USTA 4JYKA 4IOCF 3L2QA 2CGPA 3QAHA 2KRCA 1DPUA 5IOYA 3IWZA 1P7IA 4GRIA 1W5SA 2DMNA 3KZYA 4AWXB 5HODA 3CCVI 3B02A 1QPMA 3WE2A 4UUVA 1UHMA 2VC1A 3PM1A 2OZUA 3QPSA 4H4KC 4HDVA 2YU3A 2VXZA 2MD5A 3K4JA 5AIPA 3EUAA 4A2UA 5E17F 3PUBA 5CVJA 3E5UA 2HQAA 1Q1VA 1UCRA 4YIIA 2AO9A 4QWQA 3K4LA 2MC3A 2DCEA 3S2WA 1ETWA 1B9NA 1TL8A 3TP3A 3A03A 3HC7A 2ZC2A 1U8RA 3KETA 4ZDLA 4CHUA 1D3YA 2LLKA 2Q2EB 4M71A 4II3A 3ZRGA 5DCMB 1EA3A 1XB4A 1XMKA 4XRSA 4EATA 1O7LA 1W7PB 3FK7A 3PO2J 1MSFC 3M7GA 2O0YA 1C0WA 1YW8A 2AS5F 3H36A 2CMPA 3KEOA 2ZXWH 1TQIA 2XPVA 2XVCA 3HOYJ 1YX5A 2H1KA 1X3ZB 4LGWA 4CZZA 4BHCA 4XQFA 3BC8A 3GTJJ 2DODA 2IVMA 1U5TC 2F5EA 1IN7A 5F1RA 1S9HA 2Q1ZB 2VBXA 5HS7A 1YHQI 2V9VA 3NQOA 3R4KA 3RDIA 3W3CA 3OYCA 4AIJA 2NYXA 3W2WA 3KEQA 2IA1A 4IHVA 2Z5UA 3BG5A 2Q0OA 3OMYA 3PQJA 1PUEE 3CP2A 1FYKA 4MO7A 3LQRA 1S6LA 3OS0A 1O4XA 2VBWA 4GYIA 1BM9A 2X1DA 2V79A 3VSKA 2V6EA 5K1YA 2E1MC 3ECHA 3I53A 2N8GA 1L0OC 1ETVA 4KDPA 1O57A 1LFBA 2EWNA 2E60A 4HA8A 2PLYA 3FXLA 4MHGA 2R4GA 4IRIA 1A31A 3HRTA 2W25A 5GP9A 4HF1A 4XL9A 1D1CA 2EQRA 2DT5A 1WGXA 3EETA 5ICFA 2IGNA 4L5EA 2CFOA 2DQLA 3V7CA 4GYGA 3VEPA 4C2MJ 4IF4A 4XN3A 4BL0B 3MMYB 1KQ9A 2V1UA 3FK6A 4GO1A 2V1NA 3SQNA 5GAEJ 5D6FA 5D5XB 4S0HB 4ZDOA 1YW7A 2GOXB 4XK4A 2NVYJ 1GHCA 1MJ9A 2ELHA 5LGNA 4WXHA 2E2JJ 2QKMB 3RPUA 2X9DA 2XAQA 4KMUX 1EF4A 3M3YJ 3HGGA 5L3EA 3NRVA 2V6CA 3KE2A 3MZHA 4W1UA 5TRDA 1SC7A 1ZQ3P 3G1OA 3SJMA 1VQ4I 2HDWA 3M8EA 2MD0A 2JMWA 3ABTA 5HLIA 1J7KA 1FIPA 2DXIA 2FSWA 3MKZA 3OYHA 5HDGA 2R5YB 2R5YA 5EJCA 2ISZA 2OF7A 1V55H 1UMQA 1QBJA 5HLGA 4LIVA 4XNFA 4IHXA 3IKVA 2DYSH 2BW3A 3FBNB 2OJED 3GYHX 2QGUA 4PJMA 1WH5A 5EEAA 1J09A 4P5OA 5DD8A 1MIJA 2BXYA 2KIQA 4RB2C 1ZG5A 3OIOA 2IS1A 2HZTA 3O2PE 3DPTA 3H3UA 1R4NB 4PGHA 3ZCOA 3OYAA 1K4TA 4F93B 1I1SA 3M4OJ 3ZGKA 4F91B 5J1UA 3HZJA 2ZJ2A 3V8LA 4MLOA 1B59A 4RGSA 5F1JA 1OYIA 3LSPA 4A0YA 4U0YA 4LLGF 3VOEA 1XSXA 3CO6C 2HVQA 4RMNA 1RZ4A 2WAQA 3BR3A 1NHAA 2CUZA 4GDFA 4ENNA 3DEWA 4V19K 4GGGA 3S14J 1X58A 4XLPF 3HPGA 3E0JB 1BW6A 2X6WA 2F5FA 1JTYA 1WJ5A 3ML6A 2HFHA 2R93J 2EIJH 4K2EA 3JCUC 4ON0A 3F9KA 1YQAA 3BT9A 3EPZA 3NEUA 3OYNA 5CJ9A 2LBFB 1HA8A 1HW1A 4LJZF 4DW6A 1APLC 5FFXA 3FF5A 1GVDA 3K1MA 3WTYC 2AQFA 1YIOA 4M72A 2LTPA 4IRHA 2KLOA 1YFHA 2R7ZJ 4IHSA 1I5ZA 2VL8A 4U0WA 3OWTA 5EEHA 5JLXA 4ENMA 4XMYA 4CCMA 5FFZA 5JFRA 3D1NI 4RAFA 4BJ5C 1TWHJ 3NAUA 2L3DA 3S15J 3O8HA 1T38A 1JI8A 3QP6A 1BR2A 1G3SA 2EPFA 3ABMH 1UZCA 3JRIA 4U7DA 4CGZA 3S32A 2ETHA 2ZMEC 2P6SA 2VPRA 2ZO4A 4E4HA 2OAZA 4PSWA 3JTGA 5E79C 2ZBKA 4O3MA 1QNTA 3EUKL 4DYQA 3M07A 1V5GA 4KNYA 1Y0NA 1HKSA 1IRFA 1Z1DA 2HZDA 1QHHD 3QRFF 2DA7A 2JK3A 1JTXA 4MTDA 2JVHA 3CDHA 2DDAA 5LBQA 3ABKH 3BR0A 2XASA 3UNGC 2A5WA 3L1PA 1DP7P 1LJ9A 2WV0A 1GVJA 2M0MA 1MDMB 2VASA 1KA8A 4PFPA 3H92A 1ZARA 4IRGA 4UB8C 3WU0A 1MNDA 3OL3A 4FISA 1USSA 4HX4A 2JSCA 2NS0A 2VQHA 1DPRA 3PJRA 5DEQA 3F8BA 3KIOA 2DOEA 1DQUA 4PGGA 1YLFA 1Z91A 4KITB 3BG6A 3CJRB 5FRNA 2K9NA 2NOJB 2DMTA 1G8XA 3DEUA 3KP4A 4AVZA 4B43A 3ZQQA 3FHZA 3BTLA 5GAGJ 3JRAA 1MBFA 4Q47A 3MFKA 4Q4ZF 1D5VA 3RSNA 1IV6A 1LVAA 2IGMA 3WTZA 1LFUP 1JKOC 3EDPA 2MA3A 3BZKA 2FNAA 4IQ4A 1KQ8A 3BTCA 3CDLA 1TW2A 1QVTA 5GTIC 1SANA 2XAJA 3DTIA 2W85A 5H20A 5KNLA 4E6KG 5HDKA 2ZXHA 2QM3A 3MZ8A 4CDGA 2MLKA 1KYWA 2VKHA 2LBFA 3RPQA 2UZKA 4IQJA 3R0JA 1R9TJ 1B72B 2EV6A 1H89C 1WH7A 3KEYA 3KP6A 1D0XA 2M34A 4HYEA 5GTHC 3CMAI 2H8WA 2LSOA 3OYEA 1XC5A 4ZTJA 3HGYA 1UJ8A 1TLHB 3OYFA 1E3PA 3OL4A 2ME6A 5M5XJ 2V1XA 5HLTA 1OLTA 3Q9VA 1N77A 1MH3A 2CG4A 2R7FA 1IF1A 3S1QJ 3WODF 1Q1HA 2JA8J 2XAGA 2CUEA 4EVIA 1BI2A 3FM3A 2IA2A 2YU9J 3BWGA 3GLLA 3CLQA 4NDLA 1VTNC 3HSFA 2ESNA 1FNNA 2CYYA 2WC2A 3CCEI 4BE1A 1YTYA 1K6OA 1RUOA 5CQEA 5LEKA 1I3QJ 1FC3A 2A07F 2DT7B 5B3SH 1MZBA 2QVOA 4M9XA 2XAUA 2QENA 3H9GA 3RKYA 4ENKA 4XOTA 1IW7F 5LGTA 2QWWA 5A2QZ 1VQ9I 3ZMUA 2JZYA 1J9IA 3S3OA 4WX9A 4BU2A 2IAIA 4AIKA 3K4BA 3SEQA 2Z9OA 2HTJA 3OYBA 1Y0UA 5D6EA 3GFIA 2LH9A 2COMA 2HOSA 1D8KA 1OYWA 2A6HF 1WI9A 2OUMA 4DZJA 4BEHA 1ZH5A 1QZZA 2V7FA 5FD6A 5IP9J 4PZJA 2D5VA 5LHGA 4G6DA 1ENHA 1HF0A 2JRMA 2X1CA 3LNQA 3FISA 4OWRB 3TP0A 4F55A 3Q0WA 4E7SA 1A5JA 1KONA 4XRMA 2MC4A 2R3SA 1F36A 2EILH 2EFOA 5ILSA 2KDZA 3MN2A 2F4IA 4XOPA 2KDOA 4A69C 2DJIA 1PJRA 3FKIJ 4E7LA 4KFCA 1YOVB 3KP7A 4L18B 3RKXA 1X1BA 5DUKA 4BBSJ 1ZG3A 4BJ6C 2CRGA 2FEZA 1G6NA 1YS6A 3WE3A 2EFWA 3V7RA 3OOPA 1Y8RB 4F52A 3C1DA 4ZZLA 4ESJA 1HLVA 2Z2SB 4O5VA 5J6XA 1T08B 1U5TB 2NXNB 4F92B 3QP5A 1R5HA 1XGSA 3CUQB 4ETSA 2NOGA 3GTPJ 2F5DA 1WJFA 1T33A 4XLCA 1JUSA 3GW2A 5BNGA 1OCTC 3VYTB 2EV5A 4A0XA 5K5RA 3E6BA 5CVVA 2VKVA 1LFPA 2VBZA 4MQVA 3W6KB 2HDCA 3W6JB 2D1VA 1F1ZA 2Y31A 2E1MB 4RLFA 2P5KA 2A6EF 2R7SA 3HOXJ 1CGPA 2A5YB 1R1UA 3D0SA 4C2UA 3GO5A 2QUFA 5HDNA 1OJLA 4ESBA 3E1SA 3E6CC 2QQAA 2LYCA 1U9OA 4M6YA 1ZKGA 1JKRC 6PAXA 1MJBA 3HTUA 1PVEA 1V54H 3KFWX 5TJJA 1QHGA 3F8FA 5B1BH 1OCOH 3M1EA 4OU0A 3G71I 3PUFA 4DJAA 3LSRA 1FZPB 2FU4A 4YRVA 1KQ0A 1ETQA 2K3FA 1U78A 2BGCA 2DA5A 2UXXA 1Z9CA 5JVTA 2X6YA 4P9FA 2FQ3A 3WG7H 3ZPLA 3W2VA 4ESFA 2HOAA 2DMUA 1ON1A 3QPLA 3PO3J 3CJQB 5DCMA 1JUPA 2L4AA 1E0EA 2HYGD 1O3SA 2VOPA 2VODA 2VB6A 5KAFC 4A6DA 1MMSA 1LEBA 5JR3A 1ORKA 1EKEA 1ZK8A 5DV5A 1F43A 1X4PA 2VIXA 4XRFA 2VUMJ 2VKEA 3U21A 1S72I 2V26A 4CH7A 3OYDA 4BXUA 1Z3YA 2A68F 3JRHA 3M8JA 2ME0A 3IWFA 5K5OA 5D5UB 3PNYA 5CLSA 4LB6B 2FOWA 1W0UA 2DAOA 1ULYA 1V4RA 3E7LA 4AC0A 5E8GA 3FXMA 4W97A 3KZZA 5FB2A 2KHMA 3HTSB 3CO7C 2XPUA 3QU6A 3OYLA 2K9QA 2HGCA 1VQKI 1TWFJ 2HI3A 4HV6A 4HPQA 3GUDA 2Y9ZA 1QGPA 1KU7A 3KPHA 2O61A 1POGA 4C30A 3TKYA 3LWFA 4BQNA 2WY8Q 4I99C 1NTCA 2X1EA 1WVRA 5JHUA 4Y15A 4FE4A 3ZQHA 4ABZA 2EZLA 1UG2A 2WV1A 3P5JA 4DBRA 4XORA 5IT9K 2W82A 1D0YA 4Y3OA 1QRYA 1B72A 3KCCA 2HPMA 2HR3A 4CCKA 1HQCA 2DFFA 5LHIA 2WAQN 1EV7A 3IKTA 2XIGA 2DFHA 2IW5A 2V9PA 4HOBA 2HXOA 1KU3A 1N78A 4HEA2 3G3ZA 2GXGA 2UWMA 2MGQA 3JSPA 2KJBA 1XGNA 2X85A 2B0LA 2JA7J 2IPQX 5EG0A 2M2EA 2RGVA 3PNTA 4G9YA 2GAUA 5IY5H 4X6AJ 3F8MA 2O8XA 3BZ6A 1TZLA 4P9UA 4S04A 2HS5A 4M3FA 3CCUI 2VC0A 5D4RA 1JHHA 1XSVA 2X6XA 5DCFA 4N4NB 4DQ2A 1GXQA 3HUGB 1LB2A 3AG3H 2KQRA 2L02A 5IOZA 3CQZJ 3NWTA 3D5SC 1V5FA 5L3FA 1IDZA 1OMIA 3G2BA 3SZPA 3B6CA 4EJOA 2DT6A 3K2AA 5ERIA 3CESA 1S5LC 2XHKA 2LP0A 4LG0A 1WWXA 5DYMA 4YG2F 5BOXA 4BGDA 2PFBA 2V9KA 2P8TA 4D9JA 4CXFA 4U7BA 2LFBA 5A2QK 2QQBA 3KP3A 4GFBA 5ICGA 2OA4A 3QWLA 1UHWA 1I3AA 2YUSA 4A3CJ 1Y6IA 3HSEA 4FT8A 5J1YA 3CJNA 2P81A 4CUGA 2GOMA 3A02A 3ZN1A 3KP2A 3JREA 3OIQA 4U87A 5GADJ 2XF6A 1D1BA 4BDYA 3RCOA 3E5XA 5BS6A 2JQ7A 2M8EA 2FA5A 2GZWA 3LSHA 4M74A 3R60A 2IS2A 1RPWA 1P7JA 4Y52J 1BR4A 3U9GA 1H88C 4BKXA 2F4OB 4KA4A 5H6RA 1IO2A 2E7WA 2A05A 4EM1A 3G73A 5D4SA 1F4KA 3I58A 2ZJQF 2BY2A 1X2NA 5ILUA 1FPQA 4I2OA 4JK1X 1K7AA 4MNUA 3U2RA 1D5YA 1DU0A 2ZSIB 4C3JJ 3E6DA 2PG4A 4OIOF 3JAMZ 1OR7C 4XICA 2QQ9A 1ETOA 1VF9A 3D5LA 1JXSA 5TGTA 2DO7A 3F6VA 4RA2A 1J5YA 1WJDA 1IV8A 1O3RA 1MMDA 4HDUA 3I4PA 4X0GA 1Z7UA 3G1MA 5FKOA 4C2TA 1K78B 4EGZA 1BOAA 3BG3A 3E97A 4UXNA 1WI3A 3LA7A 4E7KA 4LB5A 1KGSA 3J81K 1XCBA 3H1CA 3OYMA 2P7CB 3HB9A 1PP7U 1ERDA 2ADUA 3GTOJ 4QLCU 1PYVA 3ZP5A 1BI1A 1AWCA 2D45A 3LSJA 2K9SA 3GFMA 1LKXA 3BTIA 4Y4RA 5J47A 4B1RA 4O6JA 3I54A 2LF7A 2P5LC 4WWCA 1TW3A 2I8DA 3OV8A 3J7YJ 4NHJA 1HC8A 1IDYA 2D2WA 3SDBA 2OCEA 3TW6A 3FM5A 4KT6A 3S1NJ 2R5ZA 2K4BA 3IC7A 2KRFA 3AG1H 4TV7A 2XV4S 3T5XA 2HDDA 3OS1A 3REOA 4DNCA 3H5NA 5EDNA 5J4YA 1IC8A 3R61A 5FKNA 4MFEA 1SFUA 3R0AA 3ZQ7A 2GWRA 5FKLA 1BR1A 1JT6A 4ITVA 2KKOA 1WSUA 3IH3A 3I0TA 4HBLA 1RKTA 4BDZA 2JSPA 2DA3A 3K2ZA 3RQ4A 1T2KA 3A1YA 3R6SA 1R5GA 4PK4A 1SEUA 2FUG2 2H8RA 3F72A 1R4MB 3GXOA 2H09A 1BOBA 3CCJI 1P9QC 2PJRA 4EJTA 2M45A 3MWMA 5LEJA 5J4VA 2ID6A 3UKGA 1H8AC 2CUFA 2L2OA 3BR6A 5C44J 3CP8A 1ETYA 3V8KA 4MIMA 1B4AA 3PFIA 3PL8A 4G7ZF 3DCFA 2FBIA 4A3LJ 1T0FC 2IBDA 3K6GA 2EZKA 2KZGA 1SVOA 4UHTA 4DBQA 3CC4I 1Z05A 3IAM2 1WCMJ 3GCMA 5L3CA 4I6ZA 2CFXA 1SD4A 5FO5A 2PMZA 3EQLF 1IN6A 2YSRA 3K7AJ 2Q8KA 2IT0A 3GWZA 4DYRA 2LMDA 4MEXF 1AA7A 2L7MP 3CF5F 1RESA 1XN7A 2MH9A 1DDNA 4BE2A 1FEXA 3OR1C 4HNVA 3TMOA 1QVUA 1WPKA 1XDSA 3RZOJ 1W7PD 4IX7A 1YJWI 3A0BC 3KLNA 1ZG1A 2R7XA 2M7BA 3K1PA 4UB6C 4UVCA 2ZJPF 2GLOA 4IVNA 2CSOA 1ETXA 4CO8A 3H5AA 1FSHA 5B1AH 2HVSA 1FBSA 1SD5A 1IAWA 1U9NA 2XGEA 1T56A 3F8NA 3SXYA 1W36D 1TQPA 2L54A 3RI4A 4M9SA 4RAZA 1IGNA 1JT0A 2CQQA 2CH0A 2LY1A 2A3SA 1WFXA 3CMEI 1JE8A 4IKFA 2X4HA 3PFYA 1G4DA 1VQMI 2R7TA 2IJLA 5K7ZA 1LDJA 1YW9A 2ZMEB 1UB9A 1RR8C 2MH2A 1J2XA 3SHFA 3H9QA 2EH3A 4HG2A 2E71A 4U0VA 4IZZA 3HPHA 3NARA 3LSMA 4Q5SF 5EEGA 2Z16A 4ANJA 3PIOF 3WGIA 2RN7A 2XAFA 2NVQJ 2JA6J 3LA2A 3JW4A 4NC8A 3DBHB 3OYJA 3HOTA 2KIUA 2W48A 5IP7J 4XSXF 2IEKA 4OMZA 5JVGF 1X1DA 2LKXA 2LREA 2EZIA 2FMLA 4L0ZB 1MDMA 2HQRA 4Z2YA 1Z67A 2DOFA 2ZFWA 2EIKH 2L9VA 4I98B 1W7PA 2ZNZA 1PUFB 5F6FA 4BS9A 2Z33A 2EA2A 4L9VA 4RB1A 3HG9A 1U2WA 1HKQA 3G6EI 2KJCA 1DUXC 4LK1F 1X4OA 2IS6A 1IZ1A 1FYMA 1STZA 3WTXC 2DA6A 1VQ7I 3QPHA 1JGSA 1ZTRA 5EG0B 4MQ9F 2G9WA 2AHQA 3GBGA 3KYCB 1MD0A 1I39A 1U6GA 1V3FA 3D5RC 4AD9A 1J59A 4WCGA 2STTA 2DJNA 1HSJA 2O03A 3L09A 3LSGA 4RBOA 5EGOA 1VNDA 4HW0A 2W84A 3BOQA 4BUPA 3PNVA 3T0YA 3HHGA 3J7ZI 1VQOI 1MBKA 2F4MB 3K70C 1SMTA 1T39A 3K69A 4P96A 2AXLA 4G7HF 4IHWA 1L3LA 5K7FA 3JRCA 2XAHA 3HXLA 3PSIA 5JLWA 2YX4A 2DFIA 2EFQA 2HOTA 4HQEA 4YFNF 3I4NJ 3GLXA 4ZH4F 4BHPA 5LFAA 3G1LA 2L5QA 3MKWB 2MG4A 2W00A 2K5CA 1T95A 2R0QC 3FZVA 2M4GA 2HYJA 4OIQF 2QQ8A 1BN5A 1M1EB 5DDGA 1JUMA 1MGTA 3LAJA 4XKBA 3IH4A 2LD5A 1LQ1A 2DU9A 1REPC 4HQMA 5FJ8J 1IRZA 1WJEA 3A01B 4XLAA 1GT0C 3QOPA 5J40A 3WTVC 2QSHX 3HOWJ 3DKWA 4A3FJ 4LLNA 3CD6I 3BJ6A 1OFCX 2XKOA 4WXDA 3RKQA 1FX7A 5FLMJ 4MTEA 3BP8A 3MZYA 4D1QA 2QF7A 3F23A 1BBYA 3CCQI 3GFLA 2CJJA 2O7OA 4EEFG 4ENJA 3I4MJ 1O3TA 2E7XA 3DXJF 5C4JJ 4A3JJ 2XDVA 3RTRA 4D0PA 4N9HA 5E1WA 5LHHA 2WADA 5ILVA 4RS8A 4II2A 4B48A 2M9HA 4JX4A 2VONA 1D8JA 3LOCA 1KU9A 5EGOB 3ZQGA 1SVLA 1NG6A 2XSJC 1ONVA 4M3EA 3CMYA 1DGWY 1FTZA 2BXZA 2XUBA 1S8NA 1TQMA 2E19A 4ZZDA 3J81Z 3AL0B 5GAHJ 4L5IA 1Z77A 4CSWA 3IRQA 2BVMA 1RKWA 3VFZA 4B47A 4J01A 2PMHA 4N9IA 4RDUA 1LE8B 1W5TA 5IT3A 2I5UA 1W1WE 3C7JA 1MNEA 3HRMA 2L9SA 2CW0F 4M6VA 3GF2A 1B9MA 3J80Z 3RPUD 1MMAA 5EZGA 2G0EA 3FXUA 1ZGJA 1B8IB 5F08A 4OINF 4XONA 1X19A 4B4CA 2K9LA 1BJAA 3BR1A 5HOOA 4UUSA 3K1NA 3P9KA 1MBJA 1FMVA 2CW7A 2GBYA 2E2IJ 2QZ8A 2WAEA 1TP4A 2KPMA 2RDPA 2CV1A 1HBXG 1YE9A 1HW2A 4XN0A 2Y2ZA 1DGRM 2CQ7A 5K7HA 2RQQA 3AAFA 1XX5A 3HIFA 2ZMEA 3EYIA 1EH6A 2XPWA 4LLLA 3IRRA 4BXXJ 2EFNA 5F27A 3JR9A 2P4WA 3HOVJ 3EUHA 4B44A 1GXPA 3TDUC 1OPCA 3K4MA 4IO9F 3QYBA 1YYVA 1G59A 2WWYA 3C3WA 3DTKA 2UUZA 5M5WJ 1X3WB 3I71A 1MMGA 1WRJA 3OR2C 5D5VB 3B6AA 3M8FA 1F9NA 4LD5A 5ICCA 1K79A 4RAYA 3TO6A 2GIVA 3UR3C 3L2CA 4E70A 2OTJI 1BW5A 2RQPA 2M5WA 2OV7A 2LK2A 2YR2A 3K4NA 4QIWN 4NQWA 2X6OA 4PUSA 2VKDA 1VZ0A 4BY1J 2JA2A 1TC3C 4RGUA 2ID3A 4FASD 3JRGA 1QU3A 4G6QA 4BNCA 2HU9A 1OISA 3VYUB 2IP2A 2ZNYA 2QCOA 2ELJA 5LRSA 3TO7A 1LVKA 4WXCA 1WJBA 2Y48A 5FRMA 4Y7NJ 4Z6YA 2TRTA 4EGYA 1HDPA 2DI3A 3DTEA 5ED4A 5KCMA 3ZMSA 3DLLF 3BG9A 3HYIA 2H6CA 2COBA 2JPBA 2LKPA 3M9AA 2HQ5A 3RJPA 3CUQC 3WG9A 3N97A 4OAZA 1CF7B 2Y69H 2ZXJA 2A61A 2Q2EA 3RYRA 2NRAC 4JX6A 1P92A 2BE5F 3GMEA 4OAYA 2O6GE 5AONA 1X2MA 3Q5FA 2NS7A 3SZGA 2Y30A 5B66C 1LE8A 2Y75A 2IS4A 2CWEA 4KJZA 1VQ5I 1VQNI 2BW3B 4I0BA 4AIHA 3I5UA 1W5CC 1XDUA 2DA2A 2DLLA 3RYPA 4ZYAA 2L0KA 3IP4B 1BI3A 2WB1A 2DOAA 4CCOA 1ZAOA 1NG7A 2FBKA 2HPIA 2MYSA 1JJ6C 4BQOA 1IN4A 1ZELA 3BROA 4BAYA 4XM3A 3K10A 4XKWA 1KYZA 1RETA 5LGUA 4IHTA 4BHBA 3GEZA 3WTTC 3WTSC 2F5VA 4QTRA 3CCRI 5ICEA 5CYVA 5FKMA 2VQCA 4HNTA 3H3ZA 1LPQA 1Y1VJ 3A4CA 1MW7A 3HBLA 1TBXA 1WJCA 2LKSA 2EIMH 3ZOBA 1UG0A 3BQYA 2CU7A 1OQYA 2YX7A 4I7HA 3IV5A 1GV5A 1CF7A 1JKPC 1LEAA 4KIBA 3TDZC 3Q9SA 2JVGA 1K78A 4UUTA 4UVBA 1TT0A 2PX9A 2NNYA 4FX0A 4KIFA 2P0WA 3PSFA 2AQEA 4EM2A 3VSLA 2DTZA 1ETKA 3FDYA 3TO9A 4L9TA 2FX0A 3P7NA 3ERED 1ZGWA 3L7WA 4JBAA 3BTJA 3S1MJ 3DPLC 4YFXF 4HZFA 4E7ZA 1QZYA 2F2EA 1E17A 1FWZA 4C9YA 1ZN2A 3I64A 3WGGA 1XD7A 2DMQA 3HKZN 2PMZN 2EJRA 2OCCH 1B6AA 3OS2A 1RIOH 3SYTA 1R00A 3ABUA 3U1KA 1VQPI 1D0ZA 3HM5A 4EJUA 4XLNF 1AOYA 4XSZF 4AM3A 1MBHA 4BYYA 1SFEA 2K02A 2R7QA 4FQGA 4XLFA 4V2FA 2QBYB 5L3BA 3WHBA 4ZJZA 4IHYA 5KK1A 4FCYA 3CUQA 3ROUA 2HVRA 3J7AO 4KYWA 4XLHA 2ZFUA 5E20A 1Y1WJ 1U5TA 2R7DA 3DFGA 2W4SA 1G2HA 2WTEA 3M1CA 2R7RA 2QKLB 4KT5C 1X1PA 2KL4A 3HRUA 4RGXA 3VDXA 3OY9A 3BPXA 4XKCA 1YG2A 2LY2A 3JTHA 2LY9A 1SAUA 2GXBA 3S16J 1FBQA 3DBLB 3O3KA 4ZYHA 3LFUA 1OCPA 3FXOA 4YELA 4ASNA 2VI6A 5E3LA 1FYLA 4HNUA 5FLXK 1SFKA 1B8IA 2VXDA 3GZ6A 2A6TA 2QYOA 2Y0SN 5FGMA 3DBRB 4CCJA 4AUXA 4ZYDA 5E1XA 3A2KA 1AKHA 5E8IA 4A3GJ 1V5EA 2HNHA 1VFCA 3ELKA 3HUGA 3WGHA 1SD7A 2KIFA 2LC2A 3FXJA
chains in the Genus database with same CATH topology
2FOWA 2E35A 1ACIA 1FOXA 3CMEI 4IOCF 3CC4I 1YI2I 1QA6A 2OTJI 1YJWI 1YJ9I 1YJNI 1VQ5I 5GAGJ 1VQNI 1MMSA 3CCLI 5GAEJ 1VQMI 3J7ZI 1FOWA 1VQOI 3G71I 5GADJ 3DLLF 3CCRI 3J7YJ 3CCEI 2ZJPF 1Y39A 1YHQI 1HC8A 3CMAI 2H8WA 2JQ7A 1YIJI 3CJTB 2K3FA 5DM7F 3CCJI 3CC2I 3CCVI 4UY8I 3G6EI 5DM6F 2E36A 3PIOF 2QA4I 3CC7I 3CCSI 3PIPF 4IO9F 3CD6I 1VQ9I 4IOAF 2ZJRF 1YITI 1VQKI 3CCUI 1VQ7I 1VQLI 1FOYA 3CF5F 2NXNB 1S72I 3I56I 4V19K 1VQ6I 3CCMI 5JVGF 2OTLI 2ZJQF 3CCQI 3G4SI 1VQPI 2QEXI 5GAHJ 2E34A 1VQ8I 3I55I 1VQ4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOW A;  2E35 A;  1ACI A;  1FOX A;  3CME I;  4IOC F;  3CC4 I;  1YI2 I;  1QA6 A;  2OTJ I;  1YJW I;  1YJ9 I;  1YJN I;  1VQ5 I;  5GAG J;  1VQN I;  1MMS A;  3CCL I;  5GAE J;  1VQM I;  3J7Z I;  1FOW A;  1VQO I;  3G71 I;  5GAD J;  3DLL F;  3CCR I;  3J7Y J;  3CCE I;  2ZJP F;  1Y39 A;  1YHQ I;  1HC8 A;  3CMA I;  2H8W A;  2JQ7 A;  1YIJ I;  3CJT B;  2K3F A;  5DM7 F;  3CCJ I;  3CC2 I;  3CCV I;  4UY8 I;  3G6E I;  5DM6 F;  2E36 A;  3PIO F;  2QA4 I;  3CC7 I;  3CCS I;  3PIP F;  4IO9 F;  3CD6 I;  1VQ9 I;  4IOA F;  2ZJR F;  1YIT I;  1VQK I;  3CCU I;  1VQ7 I;  1VQL I;  1FOY A;  3CF5 F;  2NXN B;  1S72 I;  3I56 I;  4V19 K;  1VQ6 I;  3CCM I;  5JVG F;  2OTL I;  2ZJQ F;  3CCQ I;  3G4S I;  1VQP I;  2QEX I;  5GAH J;  2E34 A;  1VQ8 I;  3I55 I;  1VQ4 I; 
#chains in the Genus database with same CATH topology
 3DPU A;  1LNW A;  4P1W A;  4BQA A;  4I09 A;  5D5W B;  4HV5 A;  1XGM A;  2O3F A;  4AID A;  2JA5 J;  3H5R A;  4RM2 A;  3HRS A;  2NVU B;  1QZE A;  1UFM A;  3ULQ B;  2NVX J;  1P4W A;  3HOU J;  3L9F A;  4CCN A;  1BL0 A;  5LD2 C;  3CC7 I;  1O7F A;  1R1V A;  2K27 A;  2LNB A;  3BPV A;  4IJA A;  3IAS 2;  1K83 J;  2K40 A;  4QSH A;  1TT5 B;  4D5F A;  1UAA A;  4PJN A;  5EYR A;  2XKP A;  1IUF A;  2DK8 A;  3FHN A;  5AIQ A;  4YFK F;  2GA2 A;  4FTH A;  2VBY A;  4I01 A;  5D8L B;  4IL6 C;  4C3I J;  4BE0 A;  1N75 A;  2C6Y A;  4B3A A;  4RGR A;  3VOD A;  2HKX A;  1A35 A;  3I59 A;  2A69 F;  2QSF X;  1T98 A;  3LMM A;  4RAG A;  5E3O A;  4HX7 A;  5BQT A;  3C2G A;  4UY8 I;  3BCA A;  2FOK A;  2XRL A;  4L5J A;  3Q0U A;  3CCS I;  2R7W A;  3CTA A;  2EB7 A;  1NK2 P;  3VB2 A;  2G7H A;  2QEX I;  1WZ2 A;  3O6B B;  2CQX A;  2VJJ A;  2MSY A;  4AU7 A;  4BQQ A;  1H0M A;  1FT9 A;  5FKK A;  2KZV A;  4HST A;  1RI7 A;  2FBH A;  1LDK B;  2VJ4 A;  5BPD A;  4A6E A;  2PBI A;  3TGN A;  3COA C;  2M8G X;  4FE7 A;  4NNJ A;  2JRT A;  2XF7 A;  3MVP A;  4CA0 A;  1XS9 A;  3FMS A;  2EA4 A;  4BH9 A;  2J5P A;  3GTM J;  1XMX A;  1I27 A;  2KIS A;  2WY7 Q;  5LLQ A;  3J7A Y;  3ZMZ A;  5J3L A;  2YPR A;  2E5N A;  3ZMT A;  5K5Q A;  2Y0S A;  2BY1 A;  3F0C A;  1FOK A;  3K70 D;  3KYL A;  3L00 A;  5EZH A;  2G7U A;  2CQK A;  3CLO A;  1K4S A;  2CO5 A;  2TCT A;  4M6X A;  1YIJ I;  4RB3 C;  3F21 A;  2KIM A;  1HST A;  3TOB A;  4PDK A;  1YRN B;  4A0Z A;  3GFJ A;  1WQ2 A;  1BIA A;  3FXR A;  1JHF A;  4WF2 A;  4CYD A;  1FP1 D;  4EM0 B;  2KFD A;  5TIS C;  4EV0 A;  1UEL B;  1K6Y A;  1I1G A;  4DYC A;  2R7U A;  3VWB A;  2MFZ A;  3S3N A;  3V8J A;  3SEZ A;  1IRG A;  2DA1 A;  1KU2 A;  2M30 A;  4QPQ A;  2E35 A;  1RNL A;  5F64 A;  3FXQ A;  2VJI A;  1QO0 D;  1TNS A;  2GIZ A;  3K4K A;  2OC6 A;  5IYC J;  3QU3 A;  4OMY A;  2E1C A;  2WA0 A;  3L2V A;  1FP2 A;  4A93 J;  3AG2 H;  4NC6 A;  1DU6 A;  3ECO A;  4D5C A;  1R22 A;  4A3M J;  1R23 A;  5IYD J;  3BY6 A;  3FMR A;  2W7N A;  3ZQC A;  3CUO A;  3CCM I;  1KZH A;  5KHD A;  2YS9 A;  3W2A A;  1R58 A;  4G94 A;  3GZN B;  4G8X A;  1N25 A;  1R71 A;  3H3V K;  3K0L A;  5CQG A;  3ABL H;  3ESW B;  2VPL A;  5BPI A;  1K61 A;  4RM3 A;  4M9Z A;  2ZSH B;  2IXS A;  1W0T A;  3FKJ A;  3I3L A;  2WAF A;  2L9R A;  2OZ6 A;  2LOO A;  2KT0 A;  2Y9Y A;  1IRX A;  5DM7 F;  5CKT A;  3PIP F;  4XLE A;  4E7J A;  1T8I A;  1BA5 A;  2K86 A;  2HOE A;  4RLQ A;  5GPA A;  2F6C A;  2L7Z A;  1GUU A;  3KX2 A;  2CQN A;  4KIS A;  4MFD A;  3C2B A;  1D1A A;  1HCR A;  1ITY A;  4HAM A;  5GPC A;  4L0Y B;  2BV6 A;  4BAC A;  2Y0M A;  2F48 A;  3L2W A;  2WB1 N;  4PJL A;  2OPT A;  1S29 A;  1P4X A;  2K9M A;  4F3Q A;  4CCL A;  5FRO A;  2FXA A;  2FMY A;  1FSE A;  2FNP A;  3DKX A;  2JTV A;  4LFU A;  2BZT A;  1X1A A;  3EYY A;  4DGW B;  5DM6 F;  4XKV A;  4BY7 J;  2KRH A;  1RC9 A;  5CVU A;  2GA1 A;  4IXA A;  5H2F C;  4NUB A;  2OTL I;  2L7K A;  4L9N A;  1X1C A;  5B5E C;  3C18 A;  2RRE A;  3GZ5 A;  1SAX A;  3DV8 A;  2M4K A;  4M3B A;  4H0E A;  2XGC A;  3CF2 A;  4BXF A;  2M0C A;  1F5T A;  3KLO A;  1YI2 I;  5HLH A;  3VPR A;  1XTA A;  2BHY A;  4PFO A;  4A3I J;  4A5N A;  4KN7 X;  1YRN A;  1E2X A;  2PJR B;  3GTL J;  1YS7 A;  3AFH A;  1S3J A;  2VT3 A;  4XRS G;  2EBI A;  2QA4 I;  3HOS A;  3FBI B;  2ZCW A;  1A36 A;  2HQN A;  3RIR A;  1J0R A;  1S7A A;  3S1R J;  1A04 A;  2Z3Y A;  4L9J A;  1OCR H;  3RZD J;  3N4M A;  3QOE A;  4JOM A;  1TWC J;  4XID A;  1FOX A;  1R6R A;  3IH2 A;  4DOZ A;  2MBF A;  1BJZ A;  2B63 J;  2L01 A;  1G3W A;  1VI0 A;  1OR7 A;  1Y39 A;  2BEO A;  3DQV C;  2DPD A;  2R5Z B;  2B7E A;  1NH3 A;  1X3U A;  2ELK A;  2ESH A;  4HLY A;  5J1R A;  3BJO A;  2H27 A;  1Y56 A;  4KMF A;  3TQN A;  2M87 A;  3H0D A;  3OIP A;  3QYE A;  3O8G A;  4UV9 A;  3FXK A;  4QPO A;  2DW4 A;  2NNN A;  3K4C A;  3ZR8 X;  3ASN H;  3AG4 H;  3WTU C;  4FET A;  1ZLK A;  2E1O A;  4AVP A;  4KIC A;  3P9I A;  5IYB J;  3CJT B;  4A3K J;  5M3F J;  1RR7 A;  1SFX A;  2ZKZ A;  1ON2 A;  1I6X A;  1FIA A;  1XPX A;  4OOI A;  4AYB N;  1HKT A;  4HF0 A;  4J19 A;  2QSG X;  2KP6 A;  3WTW C;  4MEY F;  1RRJ A;  1MH4 A;  4CIC A;  1VQ8 I;  2B9S A;  1ZYR F;  2DK5 A;  4RB0 A;  5DS9 A;  3BLY A;  4KUM A;  2O9L A;  2DTR A;  1R49 A;  1S7O A;  3GTG J;  1HW5 A;  1OYY A;  4NB5 A;  1XG1 A;  3MKL A;  3V4G A;  2L9N A;  3S93 A;  1H9T A;  3HEF A;  3ZQI A;  1MBE A;  1GV2 A;  3F3X A;  3H9J A;  3JSO A;  3SDG A;  1JJ8 C;  3F8C A;  4N4O B;  1AU7 A;  2IGO A;  3NWS A;  4EMS A;  1IUY A;  1AKH B;  5HNF A;  1MKM A;  4D7N A;  1P4A A;  4U88 A;  3ZMV A;  1TTY A;  3FIW A;  5JI6 A;  3V42 A;  5CVI A;  1SVM A;  4A3E J;  4HX8 A;  2GM4 A;  2M3A A;  4Y17 A;  4DZP A;  1PUF A;  5HS8 A;  3LQQ A;  2PJP A;  2WBM A;  4LG0 B;  3T8R A;  2RAE A;  3KZI C;  4A5M A;  3ZQL A;  1A6Q A;  2UV1 A;  1ZHF A;  2TDX A;  5E3M A;  3X2Q H;  5D8K B;  2M7A A;  4IPA A;  4HLX A;  4IOA F;  2P6T A;  4UUS B;  4LIT A;  2QLZ A;  1VQ6 I;  3DLA A;  2EK5 A;  1LDD A;  2VQL A;  4FX4 A;  1ZRE A;  3MD2 A;  3P9C A;  3S2H J;  2RNJ A;  1FBU A;  3ZXS A;  1ZR2 A;  3HJE A;  2CUJ A;  3TED A;  5BMZ A;  4XBF A;  4ZDP A;  2R92 J;  1JGG A;  4NBQ A;  2ECB A;  2H94 A;  2H1L A;  4LK0 F;  2HEO A;  2EFP A;  2P5V A;  2Z1D A;  4ZYE A;  3GVA A;  1FMW A;  3AL0 C;  3OOU A;  2DFE A;  4MGR A;  1EH7 A;  3BDD A;  1CQT A;  2V4J C;  3LFK A;  1BI0 A;  2QBY A;  3Q3S A;  3WHC A;  2CV0 A;  3SFI A;  4Y13 A;  4GXO A;  4ZC3 A;  4I0A A;  5JHF A;  1U3E M;  1IG7 A;  1EH8 A;  4A3D J;  1Z7L A;  4G7O F;  5F0F A;  3ZMD A;  1E3H A;  2P7V B;  3BG7 A;  2BHZ A;  5DTD A;  1YJN I;  1FJL A;  3CMM A;  4AYB A;  4E7I A;  1FOW A;  4I76 A;  2R7V A;  2FF4 A;  2JJ7 A;  3K9T A;  2E5Z A;  2VE8 A;  2OBP A;  2V1D A;  3OSG A;  5IT9 Z;  2LR8 A;  4BBR J;  3JAM K;  4A12 A;  3SFZ A;  2XRO A;  1U0J A;  2XC7 A;  2OD5 A;  1T0F A;  1Z21 A;  2BVL A;  2XGD A;  4HSR A;  3MAJ A;  2FE3 A;  2DBB A;  2DQR A;  1XGO A;  1MJA A;  3LAP A;  2JUG A;  1MMN A;  2X48 A;  2JUC A;  5HNH A;  2KMU A;  2JN6 A;  4F7Z A;  2JWT A;  2R7O A;  1ZR4 A;  3BJA A;  4GCV A;  2K4J A;  4CZC A;  4LMY A;  3IL2 A;  4B8X A;  2CV2 A;  3ASO H;  5DD4 A;  2XF5 A;  2IRF G;  4G12 A;  2RKH A;  1DP3 A;  1GDT A;  4PCQ A;  2XRN A;  3F22 A;  2RNG A;  3LST A;  3BR2 A;  3OYK A;  1Z3X A;  1YIT I;  2DPU A;  2LG4 A;  3DU5 A;  4Q48 A;  5IPA A;  2XGX A;  5E1Z B;  4DIQ A;  4NC7 A;  4R8H A;  1WJA A;  3DF8 A;  1EJ9 A;  3L2R A;  2ZXI A;  2IA0 A;  3KYD B;  1P2F A;  3ISP A;  2PI0 A;  3C2H A;  5HVQ C;  3HHH A;  2W1O A;  2H6B A;  2DYR H;  3WU2 C;  1I6H J;  3MCZ A;  1R1T A;  4KIG A;  3T8T A;  2HXI A;  2OQG A;  3A0H C;  2XB0 X;  1R7J A;  3ZQF A;  3ERM A;  4ZYG A;  3S2D J;  5J8C A;  2GQQ A;  2HWV A;  5E3N A;  1NK3 P;  1FY7 A;  2E1N A;  3B73 A;  2BOL A;  2LDU A;  2PEX A;  4N0B A;  2LF8 A;  3S17 J;  3BCB A;  4PJJ A;  3QQA A;  3PQK A;  3WU1 B;  2NVT J;  2X0L A;  3JRB A;  1LUJ B;  2ISY A;  4R1H A;  1IN8 A;  3HKZ A;  3QYF A;  2RVC A;  4PJ0 C;  1IJW C;  1WHU A;  3S3M A;  4XR6 A;  2J5O A;  3I9V 2;  2F5C A;  1MNM C;  2BY3 A;  3CZ6 A;  3DP7 A;  3TW7 A;  5E18 F;  3T1B A;  3MQ0 A;  2DDB A;  2RV8 A;  2L4M A;  3BR5 A;  5EF6 A;  2GXA A;  3N05 A;  1ZLJ A;  1G3T A;  2NS8 A;  3E3V A;  4D7M A;  2ZB9 A;  2VN2 A;  4M73 A;  3I59 B;  5J8F A;  4X1E A;  3G4S I;  1ZRC A;  3CDI A;  3HSR A;  1PP8 F;  3CC2 I;  4Y33 A;  2OU2 A;  4UVA A;  3ZN0 A;  3E6M A;  1I50 J;  2O5R A;  4NQW B;  5HS9 A;  1YX3 A;  3U1D A;  1IXR C;  1YO5 C;  3BZC A;  3CCY A;  4OIR F;  2HKO A;  3OSF A;  2ECC A;  1BC7 C;  1BIB A;  5FLX Z;  1TNT A;  1W4M A;  2HTS A;  2EV0 A;  2PQ8 A;  3FX3 A;  3RQI A;  1WKM A;  4IEJ A;  3TOA A;  1FOY A;  3BQZ A;  4M3D A;  4LIU A;  2CS3 A;  1XSD A;  2EZH A;  2ACJ A;  4S05 A;  2XSD C;  5LRR A;  2NAZ A;  5F0H A;  2IGK A;  4P55 A;  1O3Q A;  3GTK J;  3OYI A;  3I55 I;  3L2U A;  4C3H J;  1OCZ H;  2W57 A;  1HOM A;  3EUH C;  1XCV A;  4EJV A;  4YIF A;  3DKY A;  2VLA A;  5CPR B;  3AKZ A;  1IXS B;  3KP5 A;  2UXN A;  2DMP A;  4FHT A;  4HRI A;  2M1B A;  2E2H J;  5F0C A;  2E36 A;  4KN4 X;  3JRD A;  3SZT A;  3LA3 A;  2ZJR F;  1XMA A;  1VQL I;  1HDD C;  4BJT A;  4YEJ A;  1S7E A;  3H0G J;  4M3G A;  2Z99 A;  2PMU A;  5H6Q A;  4EQQ A;  1GLN A;  4G6T B;  4A3B J;  1QQI A;  3IHU A;  2I10 A;  1ACI A;  3S8P A;  4B3X A;  2FJ1 A;  1YJ9 I;  2BY0 A;  2K85 A;  1HXD A;  1IN5 A;  3HDD A;  3VYR B;  1T6S A;  2BYV E;  5L3G A;  3QPT A;  4V2G A;  2LVS A;  2VJ5 A;  3E5Q A;  3J80 K;  2EIN H;  4UNO A;  4WK8 F;  2HYF A;  4HF2 A;  3OYG A;  1A6I A;  3F6O A;  1MSE C;  4JX5 A;  2K3P A;  3GX4 X;  4I02 A;  2ICW G;  5L3D A;  4UV8 A;  3MEX A;  4JP0 A;  1QPI A;  2FD5 A;  2VT2 A;  1Y8Q B;  2E34 A;  2MLG A;  4BEH B;  1ZRF A;  1PDN C;  9ANT A;  3TBI A;  2STW A;  3TL4 X;  3RKW A;  1R36 A;  1W36 C;  3VYS B;  3DWL E;  2PN6 A;  5DUI A;  1P6R A;  3HOZ J;  1FTT A;  1J75 A;  4OIP F;  1UHS A;  1SMY F;  5CVR A;  4EJW A;  1BC8 C;  2JT1 A;  3QOD A;  4LOC A;  1SFO J;  3Q0V A;  1H9G A;  1ZRD A;  2O8K A;  2LRD A;  2K7L A;  5M3M J;  3IUO A;  1U8B A;  1OCC H;  3LSI A;  3JRF A;  2CW8 A;  3MKY B;  1IXC A;  5M5Y J;  4B09 A;  1AHD P;  5C3E J;  2OQR A;  1RUN A;  2VQG A;  1JKQ C;  1B1B A;  3V7S A;  5C4X J;  1MBG A;  5KAI C;  3FWE A;  2AXT C;  3HL2 A;  1QA6 A;  5FD5 A;  4J00 A;  4ZTF A;  3CCL I;  2FRH A;  2FQ4 A;  1Z6R A;  3DU6 A;  3H35 A;  4R79 A;  4CYC A;  3FMQ A;  1ZGA A;  4CYC B;  3DEE A;  1Z0X A;  4E7H A;  2DA4 A;  2X51 A;  1SD6 A;  5KVR A;  3LL7 A;  5F04 A;  4LG3 A;  2VOO A;  1E3O C;  2D1H A;  2W24 A;  1Z6T A;  2JPC A;  3A01 A;  2L7F P;  3GTQ J;  3W6V A;  1OKR A;  3LSK A;  2DN0 A;  1FLI A;  2MW8 A;  3I56 I;  2VE9 A;  1G3Y A;  5FLV A;  4YIR X;  1R5I D;  2RC4 A;  4JQF A;  1ODD A;  1TWG J;  3ONQ A;  1TWA J;  2BBY A;  2MAB A;  2XB5 A;  4PSX A;  5IP6 A;  1UST A;  4JYK A;  4IOC F;  3L2Q A;  2CGP A;  3QAH A;  2KRC A;  1DPU A;  5IOY A;  3IWZ A;  1P7I A;  4GRI A;  1W5S A;  2DMN A;  3KZY A;  4AWX B;  5HOD A;  3CCV I;  3B02 A;  1QPM A;  3WE2 A;  4UUV A;  1UHM A;  2VC1 A;  3PM1 A;  2OZU A;  3QPS A;  4H4K C;  4HDV A;  2YU3 A;  2VXZ A;  2MD5 A;  3K4J A;  5AIP A;  3EUA A;  4A2U A;  5E17 F;  3PUB A;  5CVJ A;  3E5U A;  2HQA A;  1Q1V A;  1UCR A;  4YII A;  2AO9 A;  4QWQ A;  3K4L A;  2MC3 A;  2DCE A;  3S2W A;  1ETW A;  1B9N A;  1TL8 A;  3TP3 A;  3A03 A;  3HC7 A;  2ZC2 A;  1U8R A;  3KET A;  4ZDL A;  4CHU A;  1D3Y A;  2LLK A;  2Q2E B;  4M71 A;  4II3 A;  3ZRG A;  5DCM B;  1EA3 A;  1XB4 A;  1XMK A;  4XRS A;  4EAT A;  1O7L A;  1W7P B;  3FK7 A;  3PO2 J;  1MSF C;  3M7G A;  2O0Y A;  1C0W A;  1YW8 A;  2AS5 F;  3H36 A;  2CMP A;  3KEO A;  2ZXW H;  1TQI A;  2XPV A;  2XVC A;  3HOY J;  1YX5 A;  2H1K A;  1X3Z B;  4LGW A;  4CZZ A;  4BHC A;  4XQF A;  3BC8 A;  3GTJ J;  2DOD A;  2IVM A;  1U5T C;  2F5E A;  1IN7 A;  5F1R A;  1S9H A;  2Q1Z B;  2VBX A;  5HS7 A;  1YHQ I;  2V9V A;  3NQO A;  3R4K A;  3RDI A;  3W3C A;  3OYC A;  4AIJ A;  2NYX A;  3W2W A;  3KEQ A;  2IA1 A;  4IHV A;  2Z5U A;  3BG5 A;  2Q0O A;  3OMY A;  3PQJ A;  1PUE E;  3CP2 A;  1FYK A;  4MO7 A;  3LQR A;  1S6L A;  3OS0 A;  1O4X A;  2VBW A;  4GYI A;  1BM9 A;  2X1D A;  2V79 A;  3VSK A;  2V6E A;  5K1Y A;  2E1M C;  3ECH A;  3I53 A;  2N8G A;  1L0O C;  1ETV A;  4KDP A;  1O57 A;  1LFB A;  2EWN A;  2E60 A;  4HA8 A;  2PLY A;  3FXL A;  4MHG A;  2R4G A;  4IRI A;  1A31 A;  3HRT A;  2W25 A;  5GP9 A;  4HF1 A;  4XL9 A;  1D1C A;  2EQR A;  2DT5 A;  1WGX A;  3EET A;  5ICF A;  2IGN A;  4L5E A;  2CFO A;  2DQL A;  3V7C A;  4GYG A;  3VEP A;  4C2M J;  4IF4 A;  4XN3 A;  4BL0 B;  3MMY B;  1KQ9 A;  2V1U A;  3FK6 A;  4GO1 A;  2V1N A;  3SQN A;  5GAE J;  5D6F A;  5D5X B;  4S0H B;  4ZDO A;  1YW7 A;  2GOX B;  4XK4 A;  2NVY J;  1GHC A;  1MJ9 A;  2ELH A;  5LGN A;  4WXH A;  2E2J J;  2QKM B;  3RPU A;  2X9D A;  2XAQ A;  4KMU X;  1EF4 A;  3M3Y J;  3HGG A;  5L3E A;  3NRV A;  2V6C A;  3KE2 A;  3MZH A;  4W1U A;  5TRD A;  1SC7 A;  1ZQ3 P;  3G1O A;  3SJM A;  1VQ4 I;  2HDW A;  3M8E A;  2MD0 A;  2JMW A;  3ABT A;  5HLI A;  1J7K A;  1FIP A;  2DXI A;  2FSW A;  3MKZ A;  3OYH A;  5HDG A;  2R5Y B;  2R5Y A;  5EJC A;  2ISZ A;  2OF7 A;  1V55 H;  1UMQ A;  1QBJ A;  5HLG A;  4LIV A;  4XNF A;  4IHX A;  3IKV A;  2DYS H;  2BW3 A;  3FBN B;  2OJE D;  3GYH X;  2QGU A;  4PJM A;  1WH5 A;  5EEA A;  1J09 A;  4P5O A;  5DD8 A;  1MIJ A;  2BXY A;  2KIQ A;  4RB2 C;  1ZG5 A;  3OIO A;  2IS1 A;  2HZT A;  3O2P E;  3DPT A;  3H3U A;  1R4N B;  4PGH A;  3ZCO A;  3OYA A;  1K4T A;  4F93 B;  1I1S A;  3M4O J;  3ZGK A;  4F91 B;  5J1U A;  3HZJ A;  2ZJ2 A;  3V8L A;  4MLO A;  1B59 A;  4RGS A;  5F1J A;  1OYI A;  3LSP A;  4A0Y A;  4U0Y A;  4LLG F;  3VOE A;  1XSX A;  3CO6 C;  2HVQ A;  4RMN A;  1RZ4 A;  2WAQ A;  3BR3 A;  1NHA A;  2CUZ A;  4GDF A;  4ENN A;  3DEW A;  4V19 K;  4GGG A;  3S14 J;  1X58 A;  4XLP F;  3HPG A;  3E0J B;  1BW6 A;  2X6W A;  2F5F A;  1JTY A;  1WJ5 A;  3ML6 A;  2HFH A;  2R93 J;  2EIJ H;  4K2E A;  3JCU C;  4ON0 A;  3F9K A;  1YQA A;  3BT9 A;  3EPZ A;  3NEU A;  3OYN A;  5CJ9 A;  2LBF B;  1HA8 A;  1HW1 A;  4LJZ F;  4DW6 A;  1APL C;  5FFX A;  3FF5 A;  1GVD A;  3K1M A;  3WTY C;  2AQF A;  1YIO A;  4M72 A;  2LTP A;  4IRH A;  2KLO A;  1YFH A;  2R7Z J;  4IHS A;  1I5Z A;  2VL8 A;  4U0W A;  3OWT A;  5EEH A;  5JLX A;  4ENM A;  4XMY A;  4CCM A;  5FFZ A;  5JFR A;  3D1N I;  4RAF A;  4BJ5 C;  1TWH J;  3NAU A;  2L3D A;  3S15 J;  3O8H A;  1T38 A;  1JI8 A;  3QP6 A;  1BR2 A;  1G3S A;  2EPF A;  3ABM H;  1UZC A;  3JRI A;  4U7D A;  4CGZ A;  3S32 A;  2ETH A;  2ZME C;  2P6S A;  2VPR A;  2ZO4 A;  4E4H A;  2OAZ A;  4PSW A;  3JTG A;  5E79 C;  2ZBK A;  4O3M A;  1QNT A;  3EUK L;  4DYQ A;  3M07 A;  1V5G A;  4KNY A;  1Y0N A;  1HKS A;  1IRF A;  1Z1D A;  2HZD A;  1QHH D;  3QRF F;  2DA7 A;  2JK3 A;  1JTX A;  4MTD A;  2JVH A;  3CDH A;  2DDA A;  5LBQ A;  3ABK H;  3BR0 A;  2XAS A;  3UNG C;  2A5W A;  3L1P A;  1DP7 P;  1LJ9 A;  2WV0 A;  1GVJ A;  2M0M A;  1MDM B;  2VAS A;  1KA8 A;  4PFP A;  3H92 A;  1ZAR A;  4IRG A;  4UB8 C;  3WU0 A;  1MND A;  3OL3 A;  4FIS A;  1USS A;  4HX4 A;  2JSC A;  2NS0 A;  2VQH A;  1DPR A;  3PJR A;  5DEQ A;  3F8B A;  3KIO A;  2DOE A;  1DQU A;  4PGG A;  1YLF A;  1Z91 A;  4KIT B;  3BG6 A;  3CJR B;  5FRN A;  2K9N A;  2NOJ B;  2DMT A;  1G8X A;  3DEU A;  3KP4 A;  4AVZ A;  4B43 A;  3ZQQ A;  3FHZ A;  3BTL A;  5GAG J;  3JRA A;  1MBF A;  4Q47 A;  3MFK A;  4Q4Z F;  1D5V A;  3RSN A;  1IV6 A;  1LVA A;  2IGM A;  3WTZ A;  1LFU P;  1JKO C;  3EDP A;  2MA3 A;  3BZK A;  2FNA A;  4IQ4 A;  1KQ8 A;  3BTC A;  3CDL A;  1TW2 A;  1QVT A;  5GTI C;  1SAN A;  2XAJ A;  3DTI A;  2W85 A;  5H20 A;  5KNL A;  4E6K G;  5HDK A;  2ZXH A;  2QM3 A;  3MZ8 A;  4CDG A;  2MLK A;  1KYW A;  2VKH A;  2LBF A;  3RPQ A;  2UZK A;  4IQJ A;  3R0J A;  1R9T J;  1B72 B;  2EV6 A;  1H89 C;  1WH7 A;  3KEY A;  3KP6 A;  1D0X A;  2M34 A;  4HYE A;  5GTH C;  3CMA I;  2H8W A;  2LSO A;  3OYE A;  1XC5 A;  4ZTJ A;  3HGY A;  1UJ8 A;  1TLH B;  3OYF A;  1E3P A;  3OL4 A;  2ME6 A;  5M5X J;  2V1X A;  5HLT A;  1OLT A;  3Q9V A;  1N77 A;  1MH3 A;  2CG4 A;  2R7F A;  1IF1 A;  3S1Q J;  3WOD F;  1Q1H A;  2JA8 J;  2XAG A;  2CUE A;  4EVI A;  1BI2 A;  3FM3 A;  2IA2 A;  2YU9 J;  3BWG A;  3GLL A;  3CLQ A;  4NDL A;  1VTN C;  3HSF A;  2ESN A;  1FNN A;  2CYY A;  2WC2 A;  3CCE I;  4BE1 A;  1YTY A;  1K6O A;  1RUO A;  5CQE A;  5LEK A;  1I3Q J;  1FC3 A;  2A07 F;  2DT7 B;  5B3S H;  1MZB A;  2QVO A;  4M9X A;  2XAU A;  2QEN A;  3H9G A;  3RKY A;  4ENK A;  4XOT A;  1IW7 F;  5LGT A;  2QWW A;  5A2Q Z;  1VQ9 I;  3ZMU A;  2JZY A;  1J9I A;  3S3O A;  4WX9 A;  4BU2 A;  2IAI A;  4AIK A;  3K4B A;  3SEQ A;  2Z9O A;  2HTJ A;  3OYB A;  1Y0U A;  5D6E A;  3GFI A;  2LH9 A;  2COM A;  2HOS A;  1D8K A;  1OYW A;  2A6H F;  1WI9 A;  2OUM A;  4DZJ A;  4BEH A;  1ZH5 A;  1QZZ A;  2V7F A;  5FD6 A;  5IP9 J;  4PZJ A;  2D5V A;  5LHG A;  4G6D A;  1ENH A;  1HF0 A;  2JRM A;  2X1C A;  3LNQ A;  3FIS A;  4OWR B;  3TP0 A;  4F55 A;  3Q0W A;  4E7S A;  1A5J A;  1KON A;  4XRM A;  2MC4 A;  2R3S A;  1F36 A;  2EIL H;  2EFO A;  5ILS A;  2KDZ A;  3MN2 A;  2F4I A;  4XOP A;  2KDO A;  4A69 C;  2DJI A;  1PJR A;  3FKI J;  4E7L A;  4KFC A;  1YOV B;  3KP7 A;  4L18 B;  3RKX A;  1X1B A;  5DUK A;  4BBS J;  1ZG3 A;  4BJ6 C;  2CRG A;  2FEZ A;  1G6N A;  1YS6 A;  3WE3 A;  2EFW A;  3V7R A;  3OOP A;  1Y8R B;  4F52 A;  3C1D A;  4ZZL A;  4ESJ A;  1HLV A;  2Z2S B;  4O5V A;  5J6X A;  1T08 B;  1U5T B;  2NXN B;  4F92 B;  3QP5 A;  1R5H A;  1XGS A;  3CUQ B;  4ETS A;  2NOG A;  3GTP J;  2F5D A;  1WJF A;  1T33 A;  4XLC A;  1JUS A;  3GW2 A;  5BNG A;  1OCT C;  3VYT B;  2EV5 A;  4A0X A;  5K5R A;  3E6B A;  5CVV A;  2VKV A;  1LFP A;  2VBZ A;  4MQV A;  3W6K B;  2HDC A;  3W6J B;  2D1V A;  1F1Z A;  2Y31 A;  2E1M B;  4RLF A;  2P5K A;  2A6E F;  2R7S A;  3HOX J;  1CGP A;  2A5Y B;  1R1U A;  3D0S A;  4C2U A;  3GO5 A;  2QUF A;  5HDN A;  1OJL A;  4ESB A;  3E1S A;  3E6C C;  2QQA A;  2LYC A;  1U9O A;  4M6Y A;  1ZKG A;  1JKR C;  6PAX A;  1MJB A;  3HTU A;  1PVE A;  1V54 H;  3KFW X;  5TJJ A;  1QHG A;  3F8F A;  5B1B H;  1OCO H;  3M1E A;  4OU0 A;  3G71 I;  3PUF A;  4DJA A;  3LSR A;  1FZP B;  2FU4 A;  4YRV A;  1KQ0 A;  1ETQ A;  2K3F A;  1U78 A;  2BGC A;  2DA5 A;  2UXX A;  1Z9C A;  5JVT A;  2X6Y A;  4P9F A;  2FQ3 A;  3WG7 H;  3ZPL A;  3W2V A;  4ESF A;  2HOA A;  2DMU A;  1ON1 A;  3QPL A;  3PO3 J;  3CJQ B;  5DCM A;  1JUP A;  2L4A A;  1E0E A;  2HYG D;  1O3S A;  2VOP A;  2VOD A;  2VB6 A;  5KAF C;  4A6D A;  1MMS A;  1LEB A;  5JR3 A;  1ORK A;  1EKE A;  1ZK8 A;  5DV5 A;  1F43 A;  1X4P A;  2VIX A;  4XRF A;  2VUM J;  2VKE A;  3U21 A;  1S72 I;  2V26 A;  4CH7 A;  3OYD A;  4BXU A;  1Z3Y A;  2A68 F;  3JRH A;  3M8J A;  2ME0 A;  3IWF A;  5K5O A;  5D5U B;  3PNY A;  5CLS A;  4LB6 B;  2FOW A;  1W0U A;  2DAO A;  1ULY A;  1V4R A;  3E7L A;  4AC0 A;  5E8G A;  3FXM A;  4W97 A;  3KZZ A;  5FB2 A;  2KHM A;  3HTS B;  3CO7 C;  2XPU A;  3QU6 A;  3OYL A;  2K9Q A;  2HGC A;  1VQK I;  1TWF J;  2HI3 A;  4HV6 A;  4HPQ A;  3GUD A;  2Y9Z A;  1QGP A;  1KU7 A;  3KPH A;  2O61 A;  1POG A;  4C30 A;  3TKY A;  3LWF A;  4BQN A;  2WY8 Q;  4I99 C;  1NTC A;  2X1E A;  1WVR A;  5JHU A;  4Y15 A;  4FE4 A;  3ZQH A;  4ABZ A;  2EZL A;  1UG2 A;  2WV1 A;  3P5J A;  4DBR A;  4XOR A;  5IT9 K;  2W82 A;  1D0Y A;  4Y3O A;  1QRY A;  1B72 A;  3KCC A;  2HPM A;  2HR3 A;  4CCK A;  1HQC A;  2DFF A;  5LHI A;  2WAQ N;  1EV7 A;  3IKT A;  2XIG A;  2DFH A;  2IW5 A;  2V9P A;  4HOB A;  2HXO A;  1KU3 A;  1N78 A;  4HEA 2;  3G3Z A;  2GXG A;  2UWM A;  2MGQ A;  3JSP A;  2KJB A;  1XGN A;  2X85 A;  2B0L A;  2JA7 J;  2IPQ X;  5EG0 A;  2M2E A;  2RGV A;  3PNT A;  4G9Y A;  2GAU A;  5IY5 H;  4X6A J;  3F8M A;  2O8X A;  3BZ6 A;  1TZL A;  4P9U A;  4S04 A;  2HS5 A;  4M3F A;  3CCU I;  2VC0 A;  5D4R A;  1JHH A;  1XSV A;  2X6X A;  5DCF A;  4N4N B;  4DQ2 A;  1GXQ A;  3HUG B;  1LB2 A;  3AG3 H;  2KQR A;  2L02 A;  5IOZ A;  3CQZ J;  3NWT A;  3D5S C;  1V5F A;  5L3F A;  1IDZ A;  1OMI A;  3G2B A;  3SZP A;  3B6C A;  4EJO A;  2DT6 A;  3K2A A;  5ERI A;  3CES A;  1S5L C;  2XHK A;  2LP0 A;  4LG0 A;  1WWX A;  5DYM A;  4YG2 F;  5BOX A;  4BGD A;  2PFB A;  2V9K A;  2P8T A;  4D9J A;  4CXF A;  4U7B A;  2LFB A;  5A2Q K;  2QQB A;  3KP3 A;  4GFB A;  5ICG A;  2OA4 A;  3QWL A;  1UHW A;  1I3A A;  2YUS A;  4A3C J;  1Y6I A;  3HSE A;  4FT8 A;  5J1Y A;  3CJN A;  2P81 A;  4CUG A;  2GOM A;  3A02 A;  3ZN1 A;  3KP2 A;  3JRE A;  3OIQ A;  4U87 A;  5GAD J;  2XF6 A;  1D1B A;  4BDY A;  3RCO A;  3E5X A;  5BS6 A;  2JQ7 A;  2M8E A;  2FA5 A;  2GZW A;  3LSH A;  4M74 A;  3R60 A;  2IS2 A;  1RPW A;  1P7J A;  4Y52 J;  1BR4 A;  3U9G A;  1H88 C;  4BKX A;  2F4O B;  4KA4 A;  5H6R A;  1IO2 A;  2E7W A;  2A05 A;  4EM1 A;  3G73 A;  5D4S A;  1F4K A;  3I58 A;  2ZJQ F;  2BY2 A;  1X2N A;  5ILU A;  1FPQ A;  4I2O A;  4JK1 X;  1K7A A;  4MNU A;  3U2R A;  1D5Y A;  1DU0 A;  2ZSI B;  4C3J J;  3E6D A;  2PG4 A;  4OIO F;  3JAM Z;  1OR7 C;  4XIC A;  2QQ9 A;  1ETO A;  1VF9 A;  3D5L A;  1JXS A;  5TGT A;  2DO7 A;  3F6V A;  4RA2 A;  1J5Y A;  1WJD A;  1IV8 A;  1O3R A;  1MMD A;  4HDU A;  3I4P A;  4X0G A;  1Z7U A;  3G1M A;  5FKO A;  4C2T A;  1K78 B;  4EGZ A;  1BOA A;  3BG3 A;  3E97 A;  4UXN A;  1WI3 A;  3LA7 A;  4E7K A;  4LB5 A;  1KGS A;  3J81 K;  1XCB A;  3H1C A;  3OYM A;  2P7C B;  3HB9 A;  1PP7 U;  1ERD A;  2ADU A;  3GTO J;  4QLC U;  1PYV A;  3ZP5 A;  1BI1 A;  1AWC A;  2D45 A;  3LSJ A;  2K9S A;  3GFM A;  1LKX A;  3BTI A;  4Y4R A;  5J47 A;  4B1R A;  4O6J A;  3I54 A;  2LF7 A;  2P5L C;  4WWC A;  1TW3 A;  2I8D A;  3OV8 A;  3J7Y J;  4NHJ A;  1HC8 A;  1IDY A;  2D2W A;  3SDB A;  2OCE A;  3TW6 A;  3FM5 A;  4KT6 A;  3S1N J;  2R5Z A;  2K4B A;  3IC7 A;  2KRF A;  3AG1 H;  4TV7 A;  2XV4 S;  3T5X A;  2HDD A;  3OS1 A;  3REO A;  4DNC A;  3H5N A;  5EDN A;  5J4Y A;  1IC8 A;  3R61 A;  5FKN A;  4MFE A;  1SFU A;  3R0A A;  3ZQ7 A;  2GWR A;  5FKL A;  1BR1 A;  1JT6 A;  4ITV A;  2KKO A;  1WSU A;  3IH3 A;  3I0T A;  4HBL A;  1RKT A;  4BDZ A;  2JSP A;  2DA3 A;  3K2Z A;  3RQ4 A;  1T2K A;  3A1Y A;  3R6S A;  1R5G A;  4PK4 A;  1SEU A;  2FUG 2;  2H8R A;  3F72 A;  1R4M B;  3GXO A;  2H09 A;  1BOB A;  3CCJ I;  1P9Q C;  2PJR A;  4EJT A;  2M45 A;  3MWM A;  5LEJ A;  5J4V A;  2ID6 A;  3UKG A;  1H8A C;  2CUF A;  2L2O A;  3BR6 A;  5C44 J;  3CP8 A;  1ETY A;  3V8K A;  4MIM A;  1B4A A;  3PFI A;  3PL8 A;  4G7Z F;  3DCF A;  2FBI A;  4A3L J;  1T0F C;  2IBD A;  3K6G A;  2EZK A;  2KZG A;  1SVO A;  4UHT A;  4DBQ A;  3CC4 I;  1Z05 A;  3IAM 2;  1WCM J;  3GCM A;  5L3C A;  4I6Z A;  2CFX A;  1SD4 A;  5FO5 A;  2PMZ A;  3EQL F;  1IN6 A;  2YSR A;  3K7A J;  2Q8K A;  2IT0 A;  3GWZ A;  4DYR A;  2LMD A;  4MEX F;  1AA7 A;  2L7M P;  3CF5 F;  1RES A;  1XN7 A;  2MH9 A;  1DDN A;  4BE2 A;  1FEX A;  3OR1 C;  4HNV A;  3TMO A;  1QVU A;  1WPK A;  1XDS A;  3RZO J;  1W7P D;  4IX7 A;  1YJW I;  3A0B C;  3KLN A;  1ZG1 A;  2R7X A;  2M7B A;  3K1P A;  4UB6 C;  4UVC A;  2ZJP F;  2GLO A;  4IVN A;  2CSO A;  1ETX A;  4CO8 A;  3H5A A;  1FSH A;  5B1A H;  2HVS A;  1FBS A;  1SD5 A;  1IAW A;  1U9N A;  2XGE A;  1T56 A;  3F8N A;  3SXY A;  1W36 D;  1TQP A;  2L54 A;  3RI4 A;  4M9S A;  4RAZ A;  1IGN A;  1JT0 A;  2CQQ A;  2CH0 A;  2LY1 A;  2A3S A;  1WFX A;  3CME I;  1JE8 A;  4IKF A;  2X4H A;  3PFY A;  1G4D A;  1VQM I;  2R7T A;  2IJL A;  5K7Z A;  1LDJ A;  1YW9 A;  2ZME B;  1UB9 A;  1RR8 C;  2MH2 A;  1J2X A;  3SHF A;  3H9Q A;  2EH3 A;  4HG2 A;  2E71 A;  4U0V A;  4IZZ A;  3HPH A;  3NAR A;  3LSM A;  4Q5S F;  5EEG A;  2Z16 A;  4ANJ A;  3PIO F;  3WGI A;  2RN7 A;  2XAF A;  2NVQ J;  2JA6 J;  3LA2 A;  3JW4 A;  4NC8 A;  3DBH B;  3OYJ A;  3HOT A;  2KIU A;  2W48 A;  5IP7 J;  4XSX F;  2IEK A;  4OMZ A;  5JVG F;  1X1D A;  2LKX A;  2LRE A;  2EZI A;  2FML A;  4L0Z B;  1MDM A;  2HQR A;  4Z2Y A;  1Z67 A;  2DOF A;  2ZFW A;  2EIK H;  2L9V A;  4I98 B;  1W7P A;  2ZNZ A;  1PUF B;  5F6F A;  4BS9 A;  2Z33 A;  2EA2 A;  4L9V A;  4RB1 A;  3HG9 A;  1U2W A;  1HKQ A;  3G6E I;  2KJC A;  1DUX C;  4LK1 F;  1X4O A;  2IS6 A;  1IZ1 A;  1FYM A;  1STZ A;  3WTX C;  2DA6 A;  1VQ7 I;  3QPH A;  1JGS A;  1ZTR A;  5EG0 B;  4MQ9 F;  2G9W A;  2AHQ A;  3GBG A;  3KYC B;  1MD0 A;  1I39 A;  1U6G A;  1V3F A;  3D5R C;  4AD9 A;  1J59 A;  4WCG A;  2STT A;  2DJN A;  1HSJ A;  2O03 A;  3L09 A;  3LSG A;  4RBO A;  5EGO A;  1VND A;  4HW0 A;  2W84 A;  3BOQ A;  4BUP A;  3PNV A;  3T0Y A;  3HHG A;  3J7Z I;  1VQO I;  1MBK A;  2F4M B;  3K70 C;  1SMT A;  1T39 A;  3K69 A;  4P96 A;  2AXL A;  4G7H F;  4IHW A;  1L3L A;  5K7F A;  3JRC A;  2XAH A;  3HXL A;  3PSI A;  5JLW A;  2YX4 A;  2DFI A;  2EFQ A;  2HOT A;  4HQE A;  4YFN F;  3I4N J;  3GLX A;  4ZH4 F;  4BHP A;  5LFA A;  3G1L A;  2L5Q A;  3MKW B;  2MG4 A;  2W00 A;  2K5C A;  1T95 A;  2R0Q C;  3FZV A;  2M4G A;  2HYJ A;  4OIQ F;  2QQ8 A;  1BN5 A;  1M1E B;  5DDG A;  1JUM A;  1MGT A;  3LAJ A;  4XKB A;  3IH4 A;  2LD5 A;  1LQ1 A;  2DU9 A;  1REP C;  4HQM A;  5FJ8 J;  1IRZ A;  1WJE A;  3A01 B;  4XLA A;  1GT0 C;  3QOP A;  5J40 A;  3WTV C;  2QSH X;  3HOW J;  3DKW A;  4A3F J;  4LLN A;  3CD6 I;  3BJ6 A;  1OFC X;  2XKO A;  4WXD A;  3RKQ A;  1FX7 A;  5FLM J;  4MTE A;  3BP8 A;  3MZY A;  4D1Q A;  2QF7 A;  3F23 A;  1BBY A;  3CCQ I;  3GFL A;  2CJJ A;  2O7O A;  4EEF G;  4ENJ A;  3I4M J;  1O3T A;  2E7X A;  3DXJ F;  5C4J J;  4A3J J;  2XDV A;  3RTR A;  4D0P A;  4N9H A;  5E1W A;  5LHH A;  2WAD A;  5ILV A;  4RS8 A;  4II2 A;  4B48 A;  2M9H A;  4JX4 A;  2VON A;  1D8J A;  3LOC A;  1KU9 A;  5EGO B;  3ZQG A;  1SVL A;  1NG6 A;  2XSJ C;  1ONV A;  4M3E A;  3CMY A;  1DGW Y;  1FTZ A;  2BXZ A;  2XUB A;  1S8N A;  1TQM A;  2E19 A;  4ZZD A;  3J81 Z;  3AL0 B;  5GAH J;  4L5I A;  1Z77 A;  4CSW A;  3IRQ A;  2BVM A;  1RKW A;  3VFZ A;  4B47 A;  4J01 A;  2PMH A;  4N9I A;  4RDU A;  1LE8 B;  1W5T A;  5IT3 A;  2I5U A;  1W1W E;  3C7J A;  1MNE A;  3HRM A;  2L9S A;  2CW0 F;  4M6V A;  3GF2 A;  1B9M A;  3J80 Z;  3RPU D;  1MMA A;  5EZG A;  2G0E A;  3FXU A;  1ZGJ A;  1B8I B;  5F08 A;  4OIN F;  4XON A;  1X19 A;  4B4C A;  2K9L A;  1BJA A;  3BR1 A;  5HOO A;  4UUS A;  3K1N A;  3P9K A;  1MBJ A;  1FMV A;  2CW7 A;  2GBY A;  2E2I J;  2QZ8 A;  2WAE A;  1TP4 A;  2KPM A;  2RDP A;  2CV1 A;  1HBX G;  1YE9 A;  1HW2 A;  4XN0 A;  2Y2Z A;  1DGR M;  2CQ7 A;  5K7H A;  2RQQ A;  3AAF A;  1XX5 A;  3HIF A;  2ZME A;  3EYI A;  1EH6 A;  2XPW A;  4LLL A;  3IRR A;  4BXX J;  2EFN A;  5F27 A;  3JR9 A;  2P4W A;  3HOV J;  3EUH A;  4B44 A;  1GXP A;  3TDU C;  1OPC A;  3K4M A;  4IO9 F;  3QYB A;  1YYV A;  1G59 A;  2WWY A;  3C3W A;  3DTK A;  2UUZ A;  5M5W J;  1X3W B;  3I71 A;  1MMG A;  1WRJ A;  3OR2 C;  5D5V B;  3B6A A;  3M8F A;  1F9N A;  4LD5 A;  5ICC A;  1K79 A;  4RAY A;  3TO6 A;  2GIV A;  3UR3 C;  3L2C A;  4E70 A;  2OTJ I;  1BW5 A;  2RQP A;  2M5W A;  2OV7 A;  2LK2 A;  2YR2 A;  3K4N A;  4QIW N;  4NQW A;  2X6O A;  4PUS A;  2VKD A;  1VZ0 A;  4BY1 J;  2JA2 A;  1TC3 C;  4RGU A;  2ID3 A;  4FAS D;  3JRG A;  1QU3 A;  4G6Q A;  4BNC A;  2HU9 A;  1OIS A;  3VYU B;  2IP2 A;  2ZNY A;  2QCO A;  2ELJ A;  5LRS A;  3TO7 A;  1LVK A;  4WXC A;  1WJB A;  2Y48 A;  5FRM A;  4Y7N J;  4Z6Y A;  2TRT A;  4EGY A;  1HDP A;  2DI3 A;  3DTE A;  5ED4 A;  5KCM A;  3ZMS A;  3DLL F;  3BG9 A;  3HYI A;  2H6C A;  2COB A;  2JPB A;  2LKP A;  3M9A A;  2HQ5 A;  3RJP A;  3CUQ C;  3WG9 A;  3N97 A;  4OAZ A;  1CF7 B;  2Y69 H;  2ZXJ A;  2A61 A;  2Q2E A;  3RYR A;  2NRA C;  4JX6 A;  1P92 A;  2BE5 F;  3GME A;  4OAY A;  2O6G E;  5AON A;  1X2M A;  3Q5F A;  2NS7 A;  3SZG A;  2Y30 A;  5B66 C;  1LE8 A;  2Y75 A;  2IS4 A;  2CWE A;  4KJZ A;  1VQ5 I;  1VQN I;  2BW3 B;  4I0B A;  4AIH A;  3I5U A;  1W5C C;  1XDU A;  2DA2 A;  2DLL A;  3RYP A;  4ZYA A;  2L0K A;  3IP4 B;  1BI3 A;  2WB1 A;  2DOA A;  4CCO A;  1ZAO A;  1NG7 A;  2FBK A;  2HPI A;  2MYS A;  1JJ6 C;  4BQO A;  1IN4 A;  1ZEL A;  3BRO A;  4BAY A;  4XM3 A;  3K10 A;  4XKW A;  1KYZ A;  1RET A;  5LGU A;  4IHT A;  4BHB A;  3GEZ A;  3WTT C;  3WTS C;  2F5V A;  4QTR A;  3CCR I;  5ICE A;  5CYV A;  5FKM A;  2VQC A;  4HNT A;  3H3Z A;  1LPQ A;  1Y1V J;  3A4C A;  1MW7 A;  3HBL A;  1TBX A;  1WJC A;  2LKS A;  2EIM H;  3ZOB A;  1UG0 A;  3BQY A;  2CU7 A;  1OQY A;  2YX7 A;  4I7H A;  3IV5 A;  1GV5 A;  1CF7 A;  1JKP C;  1LEA A;  4KIB A;  3TDZ C;  3Q9S A;  2JVG A;  1K78 A;  4UUT A;  4UVB A;  1TT0 A;  2PX9 A;  2NNY A;  4FX0 A;  4KIF A;  2P0W A;  3PSF A;  2AQE A;  4EM2 A;  3VSL A;  2DTZ A;  1ETK A;  3FDY A;  3TO9 A;  4L9T A;  2FX0 A;  3P7N A;  3ERE D;  1ZGW A;  3L7W A;  4JBA A;  3BTJ A;  3S1M J;  3DPL C;  4YFX F;  4HZF A;  4E7Z A;  1QZY A;  2F2E A;  1E17 A;  1FWZ A;  4C9Y A;  1ZN2 A;  3I64 A;  3WGG A;  1XD7 A;  2DMQ A;  3HKZ N;  2PMZ N;  2EJR A;  2OCC H;  1B6A A;  3OS2 A;  1RIO H;  3SYT A;  1R00 A;  3ABU A;  3U1K A;  1VQP I;  1D0Z A;  3HM5 A;  4EJU A;  4XLN F;  1AOY A;  4XSZ F;  4AM3 A;  1MBH A;  4BYY A;  1SFE A;  2K02 A;  2R7Q A;  4FQG A;  4XLF A;  4V2F A;  2QBY B;  5L3B A;  3WHB A;  4ZJZ A;  4IHY A;  5KK1 A;  4FCY A;  3CUQ A;  3ROU A;  2HVR A;  3J7A O;  4KYW A;  4XLH A;  2ZFU A;  5E20 A;  1Y1W J;  1U5T A;  2R7D A;  3DFG A;  2W4S A;  1G2H A;  2WTE A;  3M1C A;  2R7R A;  2QKL B;  4KT5 C;  1X1P A;  2KL4 A;  3HRU A;  4RGX A;  3VDX A;  3OY9 A;  3BPX A;  4XKC A;  1YG2 A;  2LY2 A;  3JTH A;  2LY9 A;  1SAU A;  2GXB A;  3S16 J;  1FBQ A;  3DBL B;  3O3K A;  4ZYH A;  3LFU A;  1OCP A;  3FXO A;  4YEL A;  4ASN A;  2VI6 A;  5E3L A;  1FYL A;  4HNU A;  5FLX K;  1SFK A;  1B8I A;  2VXD A;  3GZ6 A;  2A6T A;  2QYO A;  2Y0S N;  5FGM A;  3DBR B;  4CCJ A;  4AUX A;  4ZYD A;  5E1X A;  3A2K A;  1AKH A;  5E8I A;  4A3G J;  1V5E A;  2HNH A;  1VFC A;  3ELK A;  3HUG A;  3WGH A;  1SD7 A;  2KIF A;  2LC2 A;  3FXJ A; 
#chains in the Genus database with same CATH homology
 2FOW A;  2E35 A;  1ACI A;  1FOX A;  3CME I;  4IOC F;  3CC4 I;  1YI2 I;  1QA6 A;  2OTJ I;  1YJW I;  1YJ9 I;  1YJN I;  1VQ5 I;  5GAG J;  1VQN I;  1MMS A;  3CCL I;  5GAE J;  1VQM I;  3J7Z I;  1FOW A;  1VQO I;  3G71 I;  5GAD J;  3DLL F;  3CCR I;  3J7Y J;  3CCE I;  2ZJP F;  1Y39 A;  1YHQ I;  1HC8 A;  3CMA I;  2H8W A;  2JQ7 A;  1YIJ I;  3CJT B;  2K3F A;  5DM7 F;  3CCJ I;  3CC2 I;  3CCV I;  4UY8 I;  3G6E I;  5DM6 F;  2E36 A;  3PIO F;  2QA4 I;  3CC7 I;  3CCS I;  3PIP F;  4IO9 F;  3CD6 I;  1VQ9 I;  4IOA F;  2ZJR F;  1YIT I;  1VQK I;  3CCU I;  1VQ7 I;  1VQL I;  1FOY A;  3CF5 F;  2NXN B;  1S72 I;  3I56 I;  4V19 K;  1VQ6 I;  3CCM I;  5JVG F;  2OTL I;  2ZJQ F;  3CCQ I;  3G4S I;  1VQP I;  2QEX I;  5GAH J;  2E34 A;  1VQ8 I;  3I55 I;  1VQ4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...