2QEXI

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2qexI00
3CMAI 3CCEI 1VQPI 2ZJRF 1YI2I 1YJWI 1FOWA 1VQKI 1Y39A 4UY8I 5DM7F 3CC7I 1YJNI 5GAGJ 5JVGF 2H8WA 1VQ4I 3PIOF 1VQOI 1VQ7I 4IOCF 4IO9F 3CCQI 1QA6A 2NXNB 3CCRI 3G4SI 1HC8A 3PIPF 3J7YJ 1VQ8I 3CCVI 3CD6I 2ZJPF 2OTLI 4IOAF 5DM6F 2E36A 3CCSI 1VQMI 3CC2I 5GADJ 1VQNI 3CCJI 2E34A 5GAHJ 3CCUI 2K3FA 1FOYA 1YIJI 2OTJI 2FOWA 1ACIA 2QA4I 1VQ5I 1FOXA 1YHQI 4V19K 1MMSA 3I55I 3CMEI 3J7ZI 2JQ7A 2E35A 1YITI 1S72I 3CF5F 1YJ9I 1VQLI 2QEXI 3CCMI 3I56I 1VQ9I 1VQ6I 3CCLI 3G71I 2ZJQF 3G6EI 3CJTB 3DLLF 5GAEJ 3CC4I
chains in the Genus database with same CATH superfamily
3V8JA 2F4IA 3EUAA 2IGOA 1B9NA 2V1DA 2XIGA 2MD0A 4KIFA 1X19A 5KNLA 2M34A 3K4CA 1MSEC 2FA5A 4I09A 5J3LA 1YW7A 1HW1A 2KFDA 1MBKA 1XGOA 4IRIA 3HUGB 1U2WA 3VYSB 1MNEA 3WU2C 2HYGD 3AG4H 2Y0SN 4HLXA 4E7ZA 5GAGJ 2DMQA 2KDZA 2P0WA 5GPAA 4ANJA 5LHGA 5L3DA 2V1NA 4H4KC 3M9AA 1J9IA 3ZN1A 3ABUA 4B3XA 1ZGJA 3QYEA 4FHTA 3D5RC 4LG0A 5E18F 2M3AA 1FBSA 2RGVA 4JX5A 4V2GA 4BHCA 5HNHA 3FXOA 4KICA 4G6QA 2V79A 5DV5A 5IYDJ 3R60A 4HZFA 3CCQI 2NS8A 2VJ5A 3PJRA 2OQRA 3HOXJ 2ECCA 2CG4A 3W2VA 3QYFA 2QSHX 4A3JJ 3LSIA 1BN5A 3JREA 5LGNA 3M8EA 3E6MA 3VSKA 1MKMA 4MLOA 2P6TA 4AVZA 2XC7A 3ABLH 2V4JC 1MBEA 2E36A 3GBGA 4JP0A 4L9TA 3FXQA 2DK8A 3H5NA 1ZARA 3I0TA 3CCJI 1G2HA 4ZDOA 2DA2A 5DD4A 2RNGA 1D0ZA 2Z99A 2R5ZA 5HLTA 2DFIA 3ZP5A 1S7OA 1ZGWA 1DGRM 1HW2A 1XC5A 2ZBKA 2FOWA 2GQQA 4ON0A 4XOTA 3IL2A 4A3DJ 2E7XA 5CVIA 2NYXA 1XMXA 2L7ZA 2Z2SB 2K4BA 3DKXA 1QU3A 2VC0A 3SEZA 3T8TA 2HWVA 5JHUA 4X6AJ 1FPQA 2RQQA 3GZ6A 1G8XA 2DTZA 2V9VA 1ETQA 5F1JA 1HDPA 5EG0B 2YU9J 3QPLA 2RC4A 3B73A 2JTVA 1S72I 1H9GA 1YG2A 2JN6A 2R7QA 4PK4A 4RM3A 1KGSA 1MMGA 3CZ6A 2O7OA 1OMIA 3BR1A 1IV6A 3PSIA 3HUGA 4U0YA 2L54A 4CXFA 2YX4A 4XIDA 2K40A 5JR3A 4AUXA 2QQ9A 1SMYF 5D8KB 1Y0NA 3EETA 2KL4A 3KIOA 5EEGA 1HBXG 2XB5A 2BVMA 3K4KA 1O3SA 1E3HA 2OZUA 2E1CA 1MGTA 1QHHD 4L5EA 3DXJF 3V42A 1XMAA 5FFZA 1FTZA 1W5SA 2W57A 2VOOA 3OWTA 3DV8A 5B1AH 5DUIA 1XMKA 2XROA 1P92A 2K27A 3MFKA 5BS6A 3ZOBA 4FASD 3QPHA 3GTMJ 4XM3A 4KISA 1NG7A 1JTYA 3A1YA 4HA8A 1FYLA 1G3SA 2E1MC 3BOQA 3R6SA 3S8PA 1VQ4I 4NQWB 4IQ4A 4P55A 4R8HA 5E1WA 4XL9A 4A3IJ 4DZJA 4IHYA 2DW4A 3KP4A 2QENA 3KCCA 3T8RA 3ZGKA 1R1VA 1SD5A 4GXOA 2JSCA 1FP1D 3P9CA 1UJ8A 2NVTJ 1OCOH 3L2CA 3QYBA 4LJZF 2AXTC 4CCOA 4IHVA 3DP7A 1S29A 2L5QA 3BJAA 1R5ID 4UNOA 4UVAA 1ETVA 2CSOA 3SXYA 4W1UA 1LVKA 3FDYA 1RR8C 5IT9Z 2LY2A 3GTPJ 3I71A 3J7AY 2FE3A 3DKYA 3HGGA 4RB0A 2VI6A 3LWFA 1IG7A 3S2DJ 4I0BA 1UMQA 1HXDA 3VFZA 1XSVA 4GDFA 5EG0A 1K78B 1TBXA 3FKJA 3Q0VA 1XSXA 3TO9A 1FTTA 1FP2A 2W00A 1XN7A 2GAUA 5E3NA 1YIJI 2X6XA 2OTJI 1HW5A 4CCJA 3ELKA 2L2OA 3ZMTA 1JXSA 2VKEA 2PQ8A 2LSOA 1R4MB 3QU6A 4Y52J 4Q47A 2IS6A 4FE7A 1OR7A 5EYRA 1GDTA 2JQ7A 2XAQA 4E7JA 1JGGA 3I54A 4BJ6C 3ZMDA 4BHBA 4F55A 3FXRA 2XGEA 1YITI 2JUGA 4C3IJ 4G9YA 4CA0A 2DMUA 3PNYA 2DYSH 4Q4ZF 2Y9ZA 3BTIA 4HRIA 1MNMC 5ERIA 2EZLA 4D1QA 4DW6A 5EDNA 1IN6A 4UXNA 1VQ9I 2DFFA 2OA4A 2HEOA 1QZEA 3CLOA 2M9HA 4D5CA 3OL4A 2K9NA 3ZMSA 4BJTA 1NK3P 6PAXA 4CYDA 4U0VA 2ID3A 2YS9A 5A2QK 5C4XJ 5LEKA 4AYBA 1QPMA 3CDIA 4NQWA 2OV7A 4JOMA 4UB6C 1V3FA 3BQZA 1O3RA 1IRFA 2K3PA 3V7CA 1O3TA 3IP4B 3NAUA 3FXLA 3TGNA 1IF1A 2IXSA 2HPIA 2V9PA 5LHIA 1YJWI 4DYQA 4X0GA 1J59A 2DA6A 1JUMA 2VXZA 5DM7F 1YX5A 1T08B 1Z3XA 2VPLA 1E17A 3QPSA 2IS2A 1JT0A 1OYWA 2IA0A 4OINF 4QIWN 3G1MA 3RZDJ 4LB6B 1KU2A 2ZXIA 1V5FA 3CUOA 2HXIA 3CESA 5CKTA 3REOA 2VBWA 1WFXA 2HZTA 1MZBA 1LE8B 2IPQX 3MKLA 3J80Z 1E3PA 3I5UA 4I99C 5BQTA 1K78A 3ZQHA 2E2JJ 2DQRA 2IA1A 2NXNB 4DYCA 2CV2A 3OYFA 2CUEA 2IJLA 1BR4A 4IXAA 5D5VB 1JKPC 2F2EA 4XKVA 3BPXA 2JVGA 3B02A 1X4OA 5HLIA 4QLCU 4IOAF 1NTCA 3CJQB 4BGDA 2ZSIB 2DXIA 4OIRF 1I6XA 1MD0A 3HEFA 3VB2A 4WWCA 4LIVA 3F0CA 4U0WA 5CVVA 2MFZA 3QP6A 4Q48A 2X1CA 2BY0A 2E34A 4XRFA 3A2KA 2XKOA 2QCOA 1KU3A 2B9SA 1YE9A 3J81Z 5D5UB 1K61A 2VQLA 5ICFA 5HS8A 1IAWA 5H6QA 1NK2P 3BG7A 3FISA 1VQ5I 1YHQI 4V19K 2LBFA 1AA7A 1N77A 1OR7C 4HX7A 3NEUA 2OBPA 2R4GA 2VKVA 3FBIB 3TO6A 1K4SA 3OIOA 4M3FA 4UV9A 2QZ8A 4YFNF 2MYSA 2B0LA 2RDPA 2EIMH 2ZKZA 4PUSA 3HRMA 2JPCA 2VASA 4P96A 3E6DA 3L2UA 2QEXI 2EK5A 4L5IA 1TC3C 3LQRA 3A0HC 3WGIA 1HSJA 3MAJA 3NARA 2WAQA 4KYWA 2JVHA 4CSWA 4FT8A 3DTEA 4ZJZA 3HOWJ 2O61A 2KZGA 3JCUC 2KZVA 3LMMA 3S16J 5KK1A 1MIJA 1B8IA 1PVEA 1BM9A 3LQQA 2DU9A 3JR9A 3E5UA 2M30A 3OYNA 2JWTA 2MH2A 3CCEI 1VQPI 5C44J 2MA3A 3GTKJ 5HODA 1DP3A 1D8JA 5KAIC 4WCGA 2C6YA 2LLKA 3IWFA 3LSRA 5ILSA 5L3EA 1IN8A 3JRAA 1X1PA 3RYPA 4RB3C 3FXMA 4M73A 1MMNA 2FD5A 4I2OA 1HQCA 2ZMEA 3GTLJ 4ZTJA 3IH3A 2GA1A 5HS9A 2JA8J 1YS7A 3PFYA 1YW9A 4BE0A 1HKTA 2R5YA 3BLYA 3D5LA 2BW3A 3N97A 3J7AO 2MBFA 1IDYA 2V26A 1AHDP 2RQPA 2M45A 4L9JA 1ZKGA 5J4YA 5L3GA 3KYCB 5D4SA 4AC0A 4L9VA 4IPAA 1H8AC 1ZGAA 1F4KA 2EV6A 3KPHA 4CYCA 1SFUA 3GTQJ 3JRDA 4HF1A 3HKZN 2R3SA 3I9V2 4EJWA 1O7LA 4I7HA 3OOUA 4RA2A 4DGWB 2VT3A 4AIJA 2QKLB 4XRSA 5CYVA 2EJRA 5TRDA 4G6TB 3ASOH 3FM3A 2Z33A 2XGXA 1TW2A 1OYIA 4YG2F 2ZXHA 2VQHA 1WJFA 2DJNA 1ONVA 2STTA 4ZTFA 1FOXA 2PLYA 1S6LA 1MJBA 3CMEI 2VT2A 3K2ZA 4DBRA 1NH3A 1D8KA 1KONA 2XSDC 1R7JA 1OISA 3OYEA 5M5XJ 3QODA 3BZ6A 2OCEA 4YEJA 3RIRA 1ETYA 2CUZA 2WWYA 5FJ8J 3TL4X 3BP8A 2RVCA 4IL6C 4U88A 2N8GA 2LMDA 3DPLC 1ZLKA 2X6YA 2R0QC 1W7PA 3CF5F 5JLWA 1EF4A 4QWQA 3K6GA 1WJEA 3IHUA 3LAPA 3PFIA 5E3OA 1POGA 2YPRA 2HTSA 4IHWA 1TWAJ 2KRFA 1QGPA 3V7SA 3S2WA 1IGNA 4AD9A 2V6CA 1S7EA 5C3EJ 2KLOA 1W7PD 3HRUA 2HVRA 2GZWA 4PFOA 1J2XA 4WK8F 1XDSA 2PMZA 3DU5A 1YI2I 3C2HA 3GZ5A 4I02A 1G6NA 1KQ9A 2VLAA 2FBKA 2P4WA 3L1PA 2R7OA 1Y39A 1VI0A 2TCTA 3JSPA 3SZPA 2TRTA 5GTIC 4JQFA 3VYUB 4J00A 1G3YA 4JK1X 2VB6A 1D3YA 3G1OA 2O6GE 2IGMA 2FEZA 3D5SC 1A5JA 2OC6A 3FKIJ 4BJ5C 2HQNA 2BXZA 3RKYA 3H5RA 2G0EA 3ZPLA 3DEEA 1IRZA 2CRGA 4HBLA 2IGKA 3PO2J 2DA7A 4XKCA 5IYBJ 2WA0A 2CUFA 2JRTA 4MIMA 3PIPF 1I5ZA 4HQMA 1F36A 3ZN0A 3J7YJ 2QKMB 1B72B 2DA3A 1GHCA 2DT6A 2JPBA 2W7NA 2O5RA 4ESJA 4LIUA 1XGSA 2J5OA 1O7FA 4BKXA 4XRSG 5LGTA 3OOPA 2DOEA 3JSOA 1GXPA 3W2WA 5HDNA 5E1XA 3WTYC 3K69A 2GM4A 4ZYAA 1AU7A 3QU3A 1HKSA 2EZKA 2PJRA 2MSYA 3RQIA 4XLPF 1FMWA 4DQ2A 2G9WA 2JMWA 4XR6A 5J47A 1MBGA 2VONA 2KRCA 3FK6A 3OMYA 2XUBA 2WV1A 4HX4A 2HOAA 1FBQA 2X9DA 2WAEA 5BNGA 4TV7A 2DA5A 2M0MA 4N4NB 1FYMA 1Z7UA 2K9MA 5A2QZ 4GYGA 1YRNB 2LRDA 2LYCA 3WHCA 2MC3A 2ICWG 2ZCWA 1N25A 3KEQA 1XCBA 3FZVA 1Y0UA 2AQEA 4ZZLA 2ZXWH 3KP7A 2Q1ZB 1RRJA 2EB7A 1C0WA 1Z91A 3VYRB 2CFOA 1WI9A 5D6FA 4Y13A 3V8KA 1FOKA 2KIMA 3DFGA 2KISA 4KIGA 1Y56A 2XPVA 3I59B 4XN3A 5E3MA 5K5OA 3GFLA 3ESWB 2LF7A 2M5WA 1X1BA 4BXFA 2HYFA 4HG2A 3E0JB 2DFHA 5DD8A 3GXOA 3HPGA 3MVPA 3NWTA 3CLQA 1T0FA 2EBIA 4RGXA 1F9NA 3RJPA 5BPIA 3P9IA 3CMAI 3QP5A 3HBLA 2LC2A 1UHMA 2ZSHB 1X3WB 4L0ZB 1TWFJ 1R49A 1G4DA 1A6QA 4ITVA 1I1SA 3FXKA 2XAFA 1OCPA 2HOEA 1JGSA 3JW4A 3M07A 3PQJA 1B72A 2BV6A 1QZZA 4D7MA 2PBIA 3BR2A 1LNWA 3OYJA 1IC8A 2LVSA 3PIOF 4LLLA 3OR1C 1ZYRF 2ZB9A 3DCFA 5F27A 1PP8F 4A3FJ 1LJ9A 4G12A 4RAFA 1J7KA 3OYMA 2WV0A 3TW6A 2CV0A 5KCMA 1IV8A 3MMYB 1IUYA 4BY1J 2ELJA 3P5JA 3PM1A 1SFKA 1SD4A 5L3CA 2QBYA 5GPCA 1HC8A 2A6TA 1WPKA 3R61A 4RAYA 3VPRA 3WTXC 5FKLA 2BBYA 1WGXA 1X1CA 2BY3A 2OZ6A 4OIQF 4F91B 3ZQQA 4M74A 4KN7X 3AG2H 3VODA 2IS1A 4G7HF 1RNLA 1ZK8A 4M3GA 5J1YA 4EJUA 3CC2I 2CQQA 3M8FA 2GXGA 3LOCA 2STWA 3I4NJ 4BU2A 4CHUA 2CYYA 1YX3A 5GTHC 3AFHA 1T33A 1HOMA 1FOYA 3CMMA 3I58A 1O4XA 5J40A 1OFCX 3I4PA 5B1BH 2XPWA 1RKWA 2GOXB 3K9TA 2RAEA 3K4NA 3ZMUA 4IQJA 2AXLA 2DK5A 3IRQA 3H5AA 2MH9A 3E5XA 3LSJA 3HYIA 2DJIA 3ERMA 5FKNA 3OY9A 1RC9A 2E19A 1T95A 5IOYA 3HOTA 1P7IA 2A6HF 2LFBA 4FETA 4MTDA 1RUOA 1LDJA 1VF9A 3N05A 4HV5A 2NNNA 5IOZA 3GUDA 3Q5FA 2QM3A 3DKWA 4EATA 3LA2A 4WF2A 3CCMI 5EEHA 2KT0A 2L4AA 2NNYA 2VE8A 2R92J 1S8NA 3EYYA 1FEXA 2MLGA 2Y0SA 1A04A 4XLAA 4EJVA 3LL7A 2V1XA 3EUKL 3I64A 3G6EI 1T0FC 3WTWC 1W1WE 3CJRB 3JAMK 2D45A 2IGNA 2NOJB 4QSHA 3I4MJ 4XRMA 3OYGA 4BBSJ 4QPOA 1EH8A 3HTSB 4NBQA 5M3MJ 1H89C 2ZXJA 1IXCA 4G7OF 2AO9A 5EGOB 4B8XA 3K10A 2A05A 4LB5A 4KN4X 1WI3A 4IJAA 1TTYA 2DODA 3T0YA 2UV1A 2E1OA 2FXAA 4UUVA 2R7RA 4WXCA 2H8WA 2HVSA 3OIPA 1BI0A 4J01A 4BXXJ 3SZGA 3H3UA 3AL0B 2F6CA 1W0UA 1IN4A 3E97A 2A5WA 3MQ0A 2LH9A 4BACA 2DAOA 1S7AA 4JX4A 5FLXK 2OUMA 1W0TA 1V5EA 1PYVA 3F6VA 1T38A 2MC4A 4G8XA 2H94A 2K9QA 2RREA 2FU4A 1TT0A 2A3SA 1D5VA 4C3HJ 2KP6A 1NHAA 1RI7A 1K4TA 1OQYA 2ZJPF 3MZ8A 5D5XB 2DA4A 3TEDA 4ZH4F 1T39A 1APLC 3JRIA 1XB4A 3ZCOA 1U8RA 3RQ4A 1OYYA 3LSTA 1UB9A 1JKOC 3A01B 2LKPA 3RKXA 1GV5A 4CDGA 1N75A 4A12A 1E3OC 3HC7A 2XDVA 1WRJA 2E1NA 3ZQ7A 4EQQA 3CTAA 5IPAA 5H6RA 1B4AA 1E2XA 4OOIA 4D9JA 1JTXA 4EVIA 2M1BA 3SEQA 3ZQFA 3CP8A 2HS5A 4MTEA 2KIFA 4HV6A 2JRMA 3M4OJ 3R0JA 1BL0A 2FRHA 2Y48A 3HOZJ 1KA8A 3IC7A 4FX0A 2CQNA 3GLLA 2CJJA 1FBUA 2ZNYA 3C1DA 5D6EA 1XG1A 5D4RA 3RDIA 2GLOA 4A3KJ 3ROUA 1ON2A 5EGOA 2W24A 4A3EJ 3H3VK 4KUMA 2XHKA 2LKXA 3DTKA 3C2GA 3HHHA 2P5LC 1W36C 3C7JA 1BOBA 3EUHC 4BHPA 3GLXA 3S1NJ 4ASNA 3CCLI 2HDDA 4AYBN 4YIRX 1ZR4A 1MH3A 3WG7H 3RZOJ 1KQ8A 2BY2A 1PJRA 4V2FA 2GBYA 2VBXA 3TO7A 3U1DA 1GVDA 1ZLJA 2VN2A 3DTIA 1ZRCA 1R6RA 2NVXJ 1BW6A 5GP9A 2CW0F 3T5XA 3GX4X 4S04A 4HSTA 2RN7A 2ETHA 1FOWA 2FJ1A 4I98B 2MD5A 1B6AA 4RBOA 1R5HA 2EINH 3S1MJ 4ZYHA 3S2HJ 2KDOA 4M72A 3TDZC 5JVGF 3ZQGA 5K7FA 2CQ7A 4MFEA 2K86A 2E2HJ 3LAJA 4KA4A 2DPUA 1EV7A 1GUUA 3TMOA 2WB1N 5D8LB 2Z16A 3B6AA 5EEAA 1JUPA 1LEAA 1DPRA 3GO5A 5F64A 1ZRDA 2EZIA 4ENKA 4OU0A 2E7WA 1MBJA 3ZMZA 1L3LA 5FB2A 4EJTA 1ULYA 3MKWB 3QOEA 4W97A 5KAFC 1H88C 2UWMA 5EJCA 2WAFA 2PG4A 2NS0A 1PUFB 4N9HA 2DT7B 1YOVB 4IVNA 4GYIA 2DMNA 4Y17A 2O8KA 3R0AA 2W48A 2X85A 2B7EA 1W5CC 3IH4A 5GADJ 2VIXA 3OYIA 4KFCA 1I50J 5CVJA 3BTCA 1ZRFA 1ZELA 2H1LA 3OYDA 1IDZA 1DDNA 1MJ9A 2BY1A 2OAZA 3VOEA 1JUSA 2IRFG 5LRRA 1MMSA 2F5EA 4B4CA 2DMTA 1FSEA 2ZO4A 4XICA 5DEQA 3M8JA 4HDVA 2Y9YA 1OCZH 1V5GA 3H9JA 2EFWA 1MMAA 3EYIA 3WU0A 1XDUA 3ZXSA 2BHYA 1IJWC 1Y1VJ 2QVOA 1XTAA 3C3WA 1XPXA 2BOLA 4KT6A 2LOOA 1CQTA 5J6XA 4ZYGA 2QLZA 4J19A 2WAQN 3F9KA 3MN2A 2VL8A 2XGCA 4XLNF 2QF7A 3CP2A 2D5VA 2IAIA 4HF2A 1Q1VA 2W4SA 2IEKA 1WSUA 1LDKB 2IW5A 1DQUA 3RPQA 3AL0C 5F1RA 4E7LA 3HL2A 2P7CB 4G94A 4Y3OA 1FWZA 3AG3H 2Q8KA 1XD7A 2LK2A 1T6SA 3TKYA 2CFXA 1SEUA 1K7AA 1CF7B 1QPIA 1JKRC 1A36A 5HDGA 1XSDA 2VJIA 2ZFUA 4EM1A 3H9GA 3LSPA 2R7WA 5M3FJ 4PGGA 2I10A 2A69F 5B3SH 4YIIA 3F21A 2DDBA 3N4MA 2X1EA 4O5VA 2CGPA 4DYRA 2BZTA 4NHJA 4IHSA 2HQ5A 4HYEA 2EV0A 2CV1A 1U5TB 1XGMA 2O03A 1SFXA 3FMSA 2ACJA 2M4KA 5ED4A 3BTJA 4WX9A 1IRGA 3S1RJ 1LE8A 1TNSA 4HPQA 4CCMA 2HNHA 4HDUA 3AAFA 3GW2A 1AWCA 1DP7P 4UUTA 2Y0MA 5F0HA 3D1NI 1PP7U 1SD6A 3SYTA 2XAGA 1BC7C 2M8GX 2MLKA 4NC7A 3OS0A 3MKYB 2V1UA 1VQ8I 3W6VA 2MABA 4BL0B 2BEOA 3ZMVA 4QTRA 3MD2A 2EIJH 3WTSC 2X1DA 2FNAA 1OCTC 3IKTA 1K6OA 2BE5F 2RNJA 3H0DA 3IAS2 2F4MB 3FX3A 4M9XA 4XQFA 1AKHB 3W2AA 2M7AA 4ESFA 3FMRA 4NUBA 4UHTA 4FE4A 1R36A 1BW5A 3HOVJ 1MH4A 4BQAA 1RUNA 2VJJA 2Y75A 3F8FA 4E7HA 4X1EA 3W3CA 1GLNA 5AONA 4FTHA 1RR7A 2VODA 1LB2A 2D2WA 1WJCA 2PI0A 4AU7A 1MJAA 4M6VA 1J09A 2H09A 4XOPA 5FROA 3V7RA 4BNCA 5J1UA 1TWHJ 1ENHA 2VQGA 3BCBA 5FGMA 1X3UA 4HQEA 1DPUA 1O3QA 1Z6RA 2VKHA 3MWMA 4FX4A 1VFCA 3A03A 3JAMZ 4F3QA 1K79A 1I1GA 3M3YJ 5IT3A 3F8NA 3GZNB 2GIZA 3A02A 2FF4A 1ZH5A 2FBHA 1KYWA 2DPDA 3H35A 3RKQA 1TW3A 2DI3A 3S14J 5L3BA 1Z77A 1Z7LA 3EDPA 3WTUC 1TL8A 1DU6A 2ME0A 1Z3YA 5CLSA 3A4CA 3IH2A 3OYCA 2OJED 4RAGA 1T8IA 3V4GA 1IUFA 2R7UA 1W5TA 3WODF 3LFUA 2NRAC 3HZJA 5JLXA 1U5TA 4B47A 5K5QA 1R58A 1BR1A 1S5LC 2X6WA 2PMZN 4RB2C 3FHZA 3ABTA 5HNFA 3EQLF 1ZG1A 2CH0A 4EEFG 5ILUA 1ETXA 1GVJA 1OCCH 2WY7Q 3U2RA 1YJNI 5KHDA 3GF2A 3RI4A 4YIFA 4BUPA 5IY5H 1ODDA 2K4JA 2UXXA 1VQ7I 3L2WA 4A3BJ 3KP2A 2DO7A 1YQAA 2EV5A 2DYRH 4AIHA 1U9NA 1A6IA 1WVRA 2VBZA 4G7ZF 3HRSA 5EZGA 4CZZA 5IYCJ 3H92A 4OWRB 2LTPA 5FLMJ 2QSFX 2YR2A 2HKOA 5HS7A 4II3A 2ELHA 2K7LA 4XK4A 3KETA 4A3MJ 4XSZF 5DCMB 2VOPA 3CO6C 4A93J 3ZRGA 2IVMA 5E17F 1U9OA 5JI6A 3CD6I 5K7ZA 1Z1DA 3KP3A 2EPFA 1X58A 2FBIA 4HOBA 3CCSI 2PMUA 3ZR8X 4BE1A 4OMYA 4LD5A 1HKQA 2L7MP 2L0KA 3FMQA 2NVUB 3TW7A 2R7FA 3K2AA 4A0ZA 4B44A 3MZYA 2K3FA 2VBYA 3DBHB 2UZKA 4LLGF 1AOYA 3S3OA 4R1HA 2ISZA 5ICCA 4B48A 2A07F 1ZHFA 3CUQB 4HX8A 5E1ZB 4PJMA 4U7DA 3JTHA 2VUMJ 3JRBA 1TLHB 4XLEA 4C3JJ 1P4AA 4F7ZA 2O8XA 4DOZA 3PNVA 3ULQB 4XONA 1YW8A 3HIFA 2ZFWA 1BBYA 2Y30A 1YJ9I 3WTTC 1ZG5A 1D1BA 4CZCA 1U78A 5CVRA 2LG4A 3KYDB 4BEHB 1Y8QB 2CO5A 1TQIA 3K0LA 2YSRA 5ICGA 3PL8A 1Y1WJ 1BC8C 5DS9A 2R7XA 3G71I 2AS5F 3WHBA 1Y6IA 4P9FA 3M1CA 1X1AA 2LD5A 4KJZA 1USSA 4C2MJ 2H8RA 3QWLA 1U5TC 2EQRA 3S93A 1X2NA 1IXRC 3ISPA 4BS9A 3LSKA 1X3ZB 5CVUA 1SANA 1UG0A 2HZDA 1BA5A 2OQGA 4E70A 4A2UA 5DYMA 2HDWA 3PNTA 2HOTA 2M4GA 1D1CA 5K1YA 3O2PE 4EV0A 3AKZA 5IP9J 2EFOA 4U7BA 3J80K 3QOPA 3FM5A 4BBRJ 2HGCA 2VKDA 4LG0B 3HSEA 4CCLA 3ABMH 2Z9OA 2KJBA 3HTUA 4E4HA 4CGZA 4OIPF 5J4VA 4IEJA 4RM2A 2JSPA 4LFUA 2LREA 4PSWA 2P7VB 2O9LA 1EA3A 3JRCA 4K2EA 4IKFA 3FF5A 1GXQA 4Y15A 3IRRA 4H0EA 3QQAA 3LA7A 1ETWA 1T56A 4A3GJ 1BIAA 4RS8A 4DNCA 2ADUA 3O8GA 3BTLA 3NWSA 3CCVI 1WQ2A 2V9KA 5M5YJ 2DMPA 5DTDA 5DUKA 1ZREA 4CCNA 2OTLI 1YTYA 5J8CA 5FRMA 2OF7A 4NNJA 3LNQA 3L2RA 4MFDA 4NB5A 3K70D 2ME6A 1B9MA 3KP5A 2QQ8A 2R5ZB 4UUSB 1MNDA 4C2UA 5FKOA 4D7NA 3KZIC 1V54H 4HEA2 4OAZA 4ABZA 2Q2EB 3E7LA 1HCRA 4IRHA 3HOUJ 3OS1A 1M1EB 5D5WB 3WE2A 1J75A 2KRHA 4ENMA 1PDNC 3E6BA 4MO7A 2XRNA 4NC6A 5TISC 1YRNA 4ZDPA 5J1RA 2GA2A 4EMSA 5BPDA 3OYKA 1R22A 3G1LA 4CICA 1W4MA 1QQIA 2A5YB 4B1RA 1BI3A 1Z9CA 2Z1DA 3I56I 3OV8A 3BCAA 4BDYA 4EGYA 2W84A 9ANTA 3OL3A 3SZTA 3JRFA 2F4OB 2G7HA 2DOAA 3I59A 3SQNA 1UHWA 2WC2A 1MMDA 3TOBA 1OJLA 3QRFF 4ZYEA 5GAEJ 4LMYA 1QO0D 1D0YA 3F3XA 1ETKA 2GXAA 1G3TA 2W25A 1OCRH 3ZQLA 4S05A 2X51A 2LKSA 2WADA 2L9SA 2L01A 5AIQA 3KLOA 3K7AJ 1I39A 1LVAA 1QRYA 2H6BA 5LGUA 2LY9A 1UG2A 5M5WJ 1MSFC 1X2MA 4UY8I 2LP0A 1Z0XA 2QWWA 1XCVA 1SVOA 4I01A 1BR2A 2ZC2A 4XKWA 2X4HA 2ECBA 1U3EM 5CPRB 4IHTA 3F22A 1H0MA 4U87A 3EUHA 2P8TA 1P4WA 5EZHA 1UHSA 1MW7A 3BR0A 4G6DA 3IUOA 4IOCF 4WXDA 2JA2A 2JA5J 2JT1A 3K70C 2OU2A 3V8LA 5JHFA 4IO9F 1UELB 1HA8A 1YO5C 3S32A 2CMPA 4UUSA 3CCYA 2K85A 5ILVA 5E8IA 1RKTA 1FIPA 4XLFA 3CUQC 3S1QJ 2VQCA 4HAMA 3OS2A 1W36D 5E79C 4OMZA 2Q2EA 4EM0B 1XS9A 3OR2C 1NG6A 3DEUA 4YELA 2CW8A 5LLQA 2ELKA 2FQ4A 2HQAA 2FSWA 1ON1A 2XGDA 3RTRA 4F93B 3WE3A 2DT5A 3GCMA 5HDKA 2KKOA 1BJAA 2I8DA 3E1SA 3BR5A 2OCCH 3FK7A 3Q0WA 2CWEA 2D1HA 4RGUA 4ENJA 3U9GA 2W1OA 2Y69H 3IWZA 3BQYA 3IKVA 3G3ZA 2NS7A 2ESNA 4BXUA 5F08A 2QA4I 2VJ4A 3JTGA 4UVBA 4AWXB 3FXJA 3OSFA 2IT0A 2E5NA 3S17J 5LHHA 3L2VA 4GFBA 1X4PA 1R1UA 2E35A 3HOYJ 4PCQA 4KIBA 3BJ6A 3VDXA 4I0AA 3DEWA 2DN0A 3L00A 4E7SA 1LFPA 1WJDA 3HXLA 4RLQA 4L0YB 2AHQA 3BWGA 2IS4A 3BR3A 2P6SA 3AG1H 1FJLA 1MDMB 2QQBA 1SFEA 2WTEA 4B09A 3K1NA 4P1WA 1R9TJ 4M3EA 4BDZA 2P5KA 2WBMA 1F43A 4HLYA 1QNTA 4UB8C 4IZZA 2COBA 3ABKH 5CQGA 2BYVE 1SAUA 1SMTA 4IF4A 4EGZA 1RETA 2HTJA 3UKGA 5FLVA 4A3LJ 1FT9A 1Y8RB 3DLLF 1WKMA 4ZYDA 1LPQA 3PSFA 3COAC 3H3ZA 1TP4A 1Z6TA 2QSGX 5HLGA 4GRIA 4BAYA 4Z2YA 3FWEA 2H6CA 4PJLA 2H1KA 2HYJA 3T1BA 3E3VA 3KX2A 2DDAA 3QAHA 1R00A 3OYHA 3IAM2 1DUXC 4S0HB 3HSRA 4M9ZA 4NC8A 1DGWY 3CC7I 1U6GA 4C30A 1OPCA 3LFKA 1SC7A 2MG4A 4BH9A 3SFIA 3F72A 1UCRA 2RKHA 3CQZJ 3U21A 3GYHX 1WCMJ 2F5CA 3SJMA 4P5OA 2KPMA 2EIKH 4HW0A 1B1BA 3KEYA 3SDBA 1P2FA 2K9SA 2VE9A 2A6EF 4XSXF 1ZTRA 5BOXA 1K6YA 3OSGA 1HSTA 1HLVA 3G4SI 2R7VA 3GFJA 3BJOA 3TOAA 2JJ7A 3I3LA 2CU7A 2HXOA 1IO2A 1BI2A 4N9IA 4UV8A 3DBRB 5J8FA 1YIOA 1RIOH 3FBNB 2IP2A 4A0YA 2KIQA 5CJ9A 3F6OA 1K83J 4KMFA 2XSJC 3HPHA 4E7KA 2PMHA 2R7TA 5DM6F 2F48A 5C4JJ 1FLIA 4HNVA 3HRTA 4PJ0C 2L02A 4PZJA 2JUCA 4YFKF 5HLHA 3A01A 1TZLA 4RGSA 3VWBA 1EKEA 1XGNA 3RSNA 1WJAA 3O8HA 1STZA 5EF6A 4XBFA 1MDMA 2DFEA 3TP3A 4DBQA 3B6CA 2VPRA 1ACIA 1ZN2A 3MCZA 2LBFB 3Q9SA 3H0GJ 5LD2C 2XAUA 3KYLA 4Y4RA 2H27A 4A69C 3PUFA 1X1DA 3BPVA 3ONQA 2FNPA 4A6DA 1E0EA 3U1KA 1TWGJ 5FRNA 3NRVA 2EFQA 5F6FA 2CW7A 2LR8A 2HKXA 2L3DA 2DCEA 2P5VA 1RPWA 3GFMA 4D5FA 3Q9VA 2ID6A 4JYKA 1QZYA 4ESBA 3DBLB 3DU6A 2DQLA 4LG3A 4KNYA 2XVCA 2E71A 1U0JA 1D5YA 3GEZA 2DA1A 3BG3A 3SHFA 4LGWA 2V6EA 1LDDA 2FMYA 2L4MA 1B8IB 1QHGA 4LOCA 5TJJA 2GWRA 2NAZA 2ZJQF 4FISA 1Z05A 2WB1A 1PUEE 4XLHA 2HFHA 3TBIA 1TWCJ 1WH5A 4M71A 4RMNA 2HVQA 3HJEA 4Z6YA 2HDCA 2EWNA 4LK0F 1RZ4A 3WGHA 1SAXA 3K4LA 1KU9A 4RGRA 3GTGJ 4M6XA 3OYLA 4Y7NJ 4LITA 3RCOA 3A0BC 1R71A 5ICEA 4I76A 3KE2A 1CGPA 1I27A 3WG9A 4BQOA 1ORKA 3MZHA 1WJBA 1ZG3A 2L7FP 4KT5C 4AM3A 4YRVA 1A31A 5K5RA 5F04A 1KU7A 2EA4A 2QGUA 3BG5A 3BC8A 4YFXF 1P9QC 4BE2A 3JRHA 4JX6A 3HG9A 2M8EA 2ZMEB 3F23A 3S15J 1BJZA 1FX7A 2M7BA 4PSXA 3F8BA 1FNNA 2K9LA 1FYKA 3HOSA 3OYAA 2QUFA 4CH7A 2BHZA 2R93J 4XLCA 1JHFA 2PX9A 1HDDC 1R5GA 4M3DA 2EFNA 1EH6A 2OD5A 1B59A 4JBAA 2W82A 2R5YB 2CUJA 3QPTA 1QA6A 2DBBA 2BW3B 3CCRI 2XRLA 2W85A 3K1PA 3L2QA 3K4BA 3F8MA 4RLFA 2R7SA 1V4RA 1WH7A 2X6OA 3O3KA 2MW8A 4QPQA 2XAHA 2R7DA 2IA2A 3P7NA 4CYCB 1PUFA 2F5DA 3O6BB 2GXBA 1VQMI 3L09A 1VQNI 1JI8A 4R79A 4II2A 4AIDA 2I5UA 4L18B 1O57A 3L7WA 3WGGA 4ZZDA 3WTZA 1IXSB 4MEYF 2YU3A 4LLNA 3BT9A 2HOSA 5IP6A 2Z3YA 1JKQC 5JFRA 4IHXA 2CQXA 1D1AA 2XAJA 3DPTA 3LA3A 3TP0A 2FUG2 2IBDA 2XPUA 1L0OC 3HM5A 4PJNA 2CQKA 3EPZA 4L9NA 2DLLA 2K02A 3FIWA 3R4KA 5AIPA 4B43A 3ASNH 1W7PB 3BZKA 1G59A 3DPUA 3GVAA 4HNUA 3TQNA 3F8CA 3ERED 1VQLI 3ECOA 2J5PA 3BG9A 3PO3J 4AIKA 2LY1A 3BZCA 1P4XA 3RPUA 3SDGA 4BY7J 4M9SA 5FFXA 1VQ6I 2Z5UA 3CDLA 3H9QA 5DDGA 1QBJA 3MKZA 2PFBA 1J5YA 3DWLE 4O3MA 1RESA 4O6JA 5B66C 1LKXA 2K5CA 5IP7J 2YUSA 3GMEA 2HR3A 4XNFA 3DF8A 1LFBA 3C2BA 3S3NA 4MQ9F 4C2TA 3W6KB 1F1ZA 1OKRA 2ZJRF 1ERDA 1CF7A 1JE8A 3BDDA 1YLFA 5JVTA 2HQRA 2LF8A 4MQVA 3K4JA 1IN5A 4Y33A 3H36A 3PUBA 4GGGA 4EJOA 1VQKI 5F0FA 1VTNC 3IV5A 3RPUD 2DOFA 3KP6A 1A35A 4XN0A 3GTJJ 4NDLA 1WJ5A 1UFMA 2BXYA 1Q1HA 1T2KA 4MGRA 3K4MA 3UNGC 1ZR2A 1IW7F 4PJJA 4MHGA 2XASA 3BR6A 4DJAA 1EJ9A 1SVLA 4HF0A 5FO5A 1R4NB 4XORA 4CO8A 1USTA 2EFPA 3KZZA 2E5ZA 1J0RA 5FLXZ 1WZ2A 3HGYA 1JJ8C 1R23A 4MNUA 5H20A 1YYVA 4PDKA 1ZAOA 1VNDA 2M2EA 3MEXA 1TQPA 3HB9A 2L7KA 1SD7A 3ECHA 3KLNA 2QYOA 3E6CC 4RB1A 2R7ZJ 2QQAA 1TNTA 1GT0C 4N0BA 1YFHA 5L3FA 3DLAA 5F0CA 1ITYA 2G7UA 2Y31A 1BOAA 3DQVC 5TGTA 4ETSA 4ENNA 3TDUC 2BGCA 4A6EA 1AKHA 2E60A 3HKZA 2VXDA 3D0SA 3X2QH 3W6JB 2PJRB 1HF0A 4ZDLA 1SFOJ 2ZNZA 4A0XA 2EH3A 2NVQJ 1QVUA 2FX0A 2L9VA 1JJ6C 3LSHA 2JA6J 2GOMA 2OPTA 2AQFA 2X0LA 3ZQCA 3BROA 1MBFA 2YX7A 1WWXA 3G2BA 3WU1B 2JK3A 1H9TA 5IT9K 2NOGA 5K7HA 2ZJ2A 5FD5A 3CF2A 3J7ZI 1S3JA 2KQRA 4DZPA 2GIVA 3H1CA 2PJPA 2TDXA 1BI1A 4RDUA 3S3MA 1G3WA 1I3AA 2UXNA 3UR3C 4EM2A 4BQQA 1TT5B 5BMZA 1R1TA 5E20A 5LBQA 4KDPA 2P81A 5LFAA 1GV2A 2ISYA 4HSRA 2X48A 3GWZA 5H2FC 1KYZA 2MGQA 1QVTA 3LSGA 3L9FA 4A3CJ 4ZC3A 2XV4S 5HOOA 3VSLA 2A61A 3PQKA 4N4OB 2FMLA 4DIQA 4XKBA 4A5MA 3M7GA 4GCVA 4E6KG 2DTRA 3HSFA 2ZMEC 3LSMA 2LNBA 1JHHA 3E5QA 5LEJA 2JZYA 4I6ZA 5FD6A 2HPMA 3G73A 2EZHA 3BG6A 2EILH 2XB0X 2BVLA 1JT6A 2EA2A 3KFWX 3JRGA 2XF7A 2COMA 1S9HA 1XX5A 1LQ1A 2O0YA 5KVRA 3C18A 2HI3A 4B3AA 2KMUA 2ESHA 3CDHA 2PN6A 2WY8Q 2KIUA 3KZYA 5DCFA 4IRGA 1KQ0A 3HHGA 1P6RA 4OAYA 2B63J 1TQMA 1SVMA 1V55H 3ML6A 5E3LA 1VQOI 2RV8A 1IRXA 3OIQA 2F5VA 2Y2ZA 1I6HJ 4HNTA 3M1EA 5E8GA 3RYRA 1IZ1A 4BYYA 1ZQ3P 1MBHA 4FQGA 4P9UA 2QBYB 1VZ0A 3CO7C 1ETOA 4LK1F 3WTVC 1WHUA 3HDDA 2E2IJ 3GTOJ 1IN7A 4KMUX 3KEOA 3FXUA 1FY7A 3RKWA 1T98A 4IX7A 5DCMA 2E1MB 1UZCA 1UAAA 4A5NA 4M3BA 2M0CA 1D0XA 3K1MA 4M6YA 2KJCA 5B5EC 1BIBA 2D1VA 2Q0OA 1DU0A 2A68F 4E7IA 1LFUP 1YS6A 2VC1A 2LDUA 2L9NA 2HU9A 3P9KA 5GAHJ 3CJNA 3CCUI 4Q5SF 2M87A 2XF6A 1F5TA 1FC3A 2PEXA 4UVCA 2NVYJ 1I3QJ 3GFIA 2XKPA 4CCKA 3Q3SA 2FQ3A 3VEPA 4PFPA 1FSHA 2FOKA 3CUQA 1P7JA 3I55I 4GO1A 4RAZA 5FKMA 5HVQC 4AVPA 3SFZA 4MEXF 1LUJB 4XMYA 4FCYA 3NQOA 2O3FA 3VYTB 3I53A 1Z21A 1EH7A 4OIOF 3BY6A 2JA7J 1U8BA 3J81K 3CMYA 5FKKA 4CUGA 2V7FA 4KITB 4C9YA 4L5JA 4WXHA 4PGHA 1OLTA 4BQNA 5CQEA 3OYBA 1FMVA 2UUZA 2KHMA 3Q0UA 5LRSA 4BEHA 2XF5A 1N78A 1FIAA 1KZHA 1FZPB 1REPC 2CS3A 1Z67A 1LEBA 3FHNA 2F5FA 3ZQIA 4F52A 3CJTB 4F92B 4D0PA 3CC4I 2L9RA
chains in the Genus database with same CATH topology
3CMAI 3CCEI 1VQPI 2ZJRF 1YI2I 1YJWI 1FOWA 1VQKI 1Y39A 4UY8I 5DM7F 3CC7I 1YJNI 5GAGJ 5JVGF 2H8WA 1VQ4I 3PIOF 1VQOI 1VQ7I 4IOCF 4IO9F 3CCQI 1QA6A 2NXNB 3CCRI 3G4SI 1HC8A 3PIPF 3J7YJ 1VQ8I 3CCVI 3CD6I 2ZJPF 2OTLI 4IOAF 5DM6F 2E36A 3CCSI 1VQMI 3CC2I 5GADJ 1VQNI 3CCJI 2E34A 5GAHJ 3CCUI 2K3FA 1FOYA 1YIJI 2OTJI 2FOWA 1ACIA 2QA4I 1VQ5I 1FOXA 1YHQI 4V19K 1MMSA 3I55I 3CMEI 3J7ZI 2JQ7A 2E35A 1YITI 1S72I 3CF5F 1YJ9I 1VQLI 2QEXI 3CCMI 3I56I 1VQ9I 1VQ6I 3CCLI 3G71I 2ZJQF 3G6EI 3CJTB 3DLLF 5GAEJ 3CC4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA I;  3CCE I;  1VQP I;  2ZJR F;  1YI2 I;  1YJW I;  1FOW A;  1VQK I;  1Y39 A;  4UY8 I;  5DM7 F;  3CC7 I;  1YJN I;  5GAG J;  5JVG F;  2H8W A;  1VQ4 I;  3PIO F;  1VQO I;  1VQ7 I;  4IOC F;  4IO9 F;  3CCQ I;  1QA6 A;  2NXN B;  3CCR I;  3G4S I;  1HC8 A;  3PIP F;  3J7Y J;  1VQ8 I;  3CCV I;  3CD6 I;  2ZJP F;  2OTL I;  4IOA F;  5DM6 F;  2E36 A;  3CCS I;  1VQM I;  3CC2 I;  5GAD J;  1VQN I;  3CCJ I;  2E34 A;  5GAH J;  3CCU I;  2K3F A;  1FOY A;  1YIJ I;  2OTJ I;  2FOW A;  1ACI A;  2QA4 I;  1VQ5 I;  1FOX A;  1YHQ I;  4V19 K;  1MMS A;  3I55 I;  3CME I;  3J7Z I;  2JQ7 A;  2E35 A;  1YIT I;  1S72 I;  3CF5 F;  1YJ9 I;  1VQL I;  2QEX I;  3CCM I;  3I56 I;  1VQ9 I;  1VQ6 I;  3CCL I;  3G71 I;  2ZJQ F;  3G6E I;  3CJT B;  3DLL F;  5GAE J;  3CC4 I; 
#chains in the Genus database with same CATH topology
 3V8J A;  2F4I A;  3EUA A;  2IGO A;  1B9N A;  2V1D A;  2XIG A;  2MD0 A;  4KIF A;  1X19 A;  5KNL A;  2M34 A;  3K4C A;  1MSE C;  2FA5 A;  4I09 A;  5J3L A;  1YW7 A;  1HW1 A;  2KFD A;  1MBK A;  1XGO A;  4IRI A;  3HUG B;  1U2W A;  3VYS B;  1MNE A;  3WU2 C;  2HYG D;  3AG4 H;  2Y0S N;  4HLX A;  4E7Z A;  5GAG J;  2DMQ A;  2KDZ A;  2P0W A;  5GPA A;  4ANJ A;  5LHG A;  5L3D A;  2V1N A;  4H4K C;  3M9A A;  1J9I A;  3ZN1 A;  3ABU A;  4B3X A;  1ZGJ A;  3QYE A;  4FHT A;  3D5R C;  4LG0 A;  5E18 F;  2M3A A;  1FBS A;  2RGV A;  4JX5 A;  4V2G A;  4BHC A;  5HNH A;  3FXO A;  4KIC A;  4G6Q A;  2V79 A;  5DV5 A;  5IYD J;  3R60 A;  4HZF A;  3CCQ I;  2NS8 A;  2VJ5 A;  3PJR A;  2OQR A;  3HOX J;  2ECC A;  2CG4 A;  3W2V A;  3QYF A;  2QSH X;  4A3J J;  3LSI A;  1BN5 A;  3JRE A;  5LGN A;  3M8E A;  3E6M A;  3VSK A;  1MKM A;  4MLO A;  2P6T A;  4AVZ A;  2XC7 A;  3ABL H;  2V4J C;  1MBE A;  2E36 A;  3GBG A;  4JP0 A;  4L9T A;  3FXQ A;  2DK8 A;  3H5N A;  1ZAR A;  3I0T A;  3CCJ I;  1G2H A;  4ZDO A;  2DA2 A;  5DD4 A;  2RNG A;  1D0Z A;  2Z99 A;  2R5Z A;  5HLT A;  2DFI A;  3ZP5 A;  1S7O A;  1ZGW A;  1DGR M;  1HW2 A;  1XC5 A;  2ZBK A;  2FOW A;  2GQQ A;  4ON0 A;  4XOT A;  3IL2 A;  4A3D J;  2E7X A;  5CVI A;  2NYX A;  1XMX A;  2L7Z A;  2Z2S B;  2K4B A;  3DKX A;  1QU3 A;  2VC0 A;  3SEZ A;  3T8T A;  2HWV A;  5JHU A;  4X6A J;  1FPQ A;  2RQQ A;  3GZ6 A;  1G8X A;  2DTZ A;  2V9V A;  1ETQ A;  5F1J A;  1HDP A;  5EG0 B;  2YU9 J;  3QPL A;  2RC4 A;  3B73 A;  2JTV A;  1S72 I;  1H9G A;  1YG2 A;  2JN6 A;  2R7Q A;  4PK4 A;  4RM3 A;  1KGS A;  1MMG A;  3CZ6 A;  2O7O A;  1OMI A;  3BR1 A;  1IV6 A;  3PSI A;  3HUG A;  4U0Y A;  2L54 A;  4CXF A;  2YX4 A;  4XID A;  2K40 A;  5JR3 A;  4AUX A;  2QQ9 A;  1SMY F;  5D8K B;  1Y0N A;  3EET A;  2KL4 A;  3KIO A;  5EEG A;  1HBX G;  2XB5 A;  2BVM A;  3K4K A;  1O3S A;  1E3H A;  2OZU A;  2E1C A;  1MGT A;  1QHH D;  4L5E A;  3DXJ F;  3V42 A;  1XMA A;  5FFZ A;  1FTZ A;  1W5S A;  2W57 A;  2VOO A;  3OWT A;  3DV8 A;  5B1A H;  5DUI A;  1XMK A;  2XRO A;  1P92 A;  2K27 A;  3MFK A;  5BS6 A;  3ZOB A;  4FAS D;  3QPH A;  3GTM J;  4XM3 A;  4KIS A;  1NG7 A;  1JTY A;  3A1Y A;  4HA8 A;  1FYL A;  1G3S A;  2E1M C;  3BOQ A;  3R6S A;  3S8P A;  1VQ4 I;  4NQW B;  4IQ4 A;  4P55 A;  4R8H A;  5E1W A;  4XL9 A;  4A3I J;  4DZJ A;  4IHY A;  2DW4 A;  3KP4 A;  2QEN A;  3KCC A;  3T8R A;  3ZGK A;  1R1V A;  1SD5 A;  4GXO A;  2JSC A;  1FP1 D;  3P9C A;  1UJ8 A;  2NVT J;  1OCO H;  3L2C A;  3QYB A;  4LJZ F;  2AXT C;  4CCO A;  4IHV A;  3DP7 A;  1S29 A;  2L5Q A;  3BJA A;  1R5I D;  4UNO A;  4UVA A;  1ETV A;  2CSO A;  3SXY A;  4W1U A;  1LVK A;  3FDY A;  1RR8 C;  5IT9 Z;  2LY2 A;  3GTP J;  3I71 A;  3J7A Y;  2FE3 A;  3DKY A;  3HGG A;  4RB0 A;  2VI6 A;  3LWF A;  1IG7 A;  3S2D J;  4I0B A;  1UMQ A;  1HXD A;  3VFZ A;  1XSV A;  4GDF A;  5EG0 A;  1K78 B;  1TBX A;  3FKJ A;  3Q0V A;  1XSX A;  3TO9 A;  1FTT A;  1FP2 A;  2W00 A;  1XN7 A;  2GAU A;  5E3N A;  1YIJ I;  2X6X A;  2OTJ I;  1HW5 A;  4CCJ A;  3ELK A;  2L2O A;  3ZMT A;  1JXS A;  2VKE A;  2PQ8 A;  2LSO A;  1R4M B;  3QU6 A;  4Y52 J;  4Q47 A;  2IS6 A;  4FE7 A;  1OR7 A;  5EYR A;  1GDT A;  2JQ7 A;  2XAQ A;  4E7J A;  1JGG A;  3I54 A;  4BJ6 C;  3ZMD A;  4BHB A;  4F55 A;  3FXR A;  2XGE A;  1YIT I;  2JUG A;  4C3I J;  4G9Y A;  4CA0 A;  2DMU A;  3PNY A;  2DYS H;  4Q4Z F;  2Y9Z A;  3BTI A;  4HRI A;  1MNM C;  5ERI A;  2EZL A;  4D1Q A;  4DW6 A;  5EDN A;  1IN6 A;  4UXN A;  1VQ9 I;  2DFF A;  2OA4 A;  2HEO A;  1QZE A;  3CLO A;  2M9H A;  4D5C A;  3OL4 A;  2K9N A;  3ZMS A;  4BJT A;  1NK3 P;  6PAX A;  4CYD A;  4U0V A;  2ID3 A;  2YS9 A;  5A2Q K;  5C4X J;  5LEK A;  4AYB A;  1QPM A;  3CDI A;  4NQW A;  2OV7 A;  4JOM A;  4UB6 C;  1V3F A;  3BQZ A;  1O3R A;  1IRF A;  2K3P A;  3V7C A;  1O3T A;  3IP4 B;  3NAU A;  3FXL A;  3TGN A;  1IF1 A;  2IXS A;  2HPI A;  2V9P A;  5LHI A;  1YJW I;  4DYQ A;  4X0G A;  1J59 A;  2DA6 A;  1JUM A;  2VXZ A;  5DM7 F;  1YX5 A;  1T08 B;  1Z3X A;  2VPL A;  1E17 A;  3QPS A;  2IS2 A;  1JT0 A;  1OYW A;  2IA0 A;  4OIN F;  4QIW N;  3G1M A;  3RZD J;  4LB6 B;  1KU2 A;  2ZXI A;  1V5F A;  3CUO A;  2HXI A;  3CES A;  5CKT A;  3REO A;  2VBW A;  1WFX A;  2HZT A;  1MZB A;  1LE8 B;  2IPQ X;  3MKL A;  3J80 Z;  1E3P A;  3I5U A;  4I99 C;  5BQT A;  1K78 A;  3ZQH A;  2E2J J;  2DQR A;  2IA1 A;  2NXN B;  4DYC A;  2CV2 A;  3OYF A;  2CUE A;  2IJL A;  1BR4 A;  4IXA A;  5D5V B;  1JKP C;  2F2E A;  4XKV A;  3BPX A;  2JVG A;  3B02 A;  1X4O A;  5HLI A;  4QLC U;  4IOA F;  1NTC A;  3CJQ B;  4BGD A;  2ZSI B;  2DXI A;  4OIR F;  1I6X A;  1MD0 A;  3HEF A;  3VB2 A;  4WWC A;  4LIV A;  3F0C A;  4U0W A;  5CVV A;  2MFZ A;  3QP6 A;  4Q48 A;  2X1C A;  2BY0 A;  2E34 A;  4XRF A;  3A2K A;  2XKO A;  2QCO A;  1KU3 A;  2B9S A;  1YE9 A;  3J81 Z;  5D5U B;  1K61 A;  2VQL A;  5ICF A;  5HS8 A;  1IAW A;  5H6Q A;  1NK2 P;  3BG7 A;  3FIS A;  1VQ5 I;  1YHQ I;  4V19 K;  2LBF A;  1AA7 A;  1N77 A;  1OR7 C;  4HX7 A;  3NEU A;  2OBP A;  2R4G A;  2VKV A;  3FBI B;  3TO6 A;  1K4S A;  3OIO A;  4M3F A;  4UV9 A;  2QZ8 A;  4YFN F;  2MYS A;  2B0L A;  2RDP A;  2EIM H;  2ZKZ A;  4PUS A;  3HRM A;  2JPC A;  2VAS A;  4P96 A;  3E6D A;  3L2U A;  2QEX I;  2EK5 A;  4L5I A;  1TC3 C;  3LQR A;  3A0H C;  3WGI A;  1HSJ A;  3MAJ A;  3NAR A;  2WAQ A;  4KYW A;  2JVH A;  4CSW A;  4FT8 A;  3DTE A;  4ZJZ A;  3HOW J;  2O61 A;  2KZG A;  3JCU C;  2KZV A;  3LMM A;  3S16 J;  5KK1 A;  1MIJ A;  1B8I A;  1PVE A;  1BM9 A;  3LQQ A;  2DU9 A;  3JR9 A;  3E5U A;  2M30 A;  3OYN A;  2JWT A;  2MH2 A;  3CCE I;  1VQP I;  5C44 J;  2MA3 A;  3GTK J;  5HOD A;  1DP3 A;  1D8J A;  5KAI C;  4WCG A;  2C6Y A;  2LLK A;  3IWF A;  3LSR A;  5ILS A;  5L3E A;  1IN8 A;  3JRA A;  1X1P A;  3RYP A;  4RB3 C;  3FXM A;  4M73 A;  1MMN A;  2FD5 A;  4I2O A;  1HQC A;  2ZME A;  3GTL J;  4ZTJ A;  3IH3 A;  2GA1 A;  5HS9 A;  2JA8 J;  1YS7 A;  3PFY A;  1YW9 A;  4BE0 A;  1HKT A;  2R5Y A;  3BLY A;  3D5L A;  2BW3 A;  3N97 A;  3J7A O;  2MBF A;  1IDY A;  2V26 A;  1AHD P;  2RQP A;  2M45 A;  4L9J A;  1ZKG A;  5J4Y A;  5L3G A;  3KYC B;  5D4S A;  4AC0 A;  4L9V A;  4IPA A;  1H8A C;  1ZGA A;  1F4K A;  2EV6 A;  3KPH A;  4CYC A;  1SFU A;  3GTQ J;  3JRD A;  4HF1 A;  3HKZ N;  2R3S A;  3I9V 2;  4EJW A;  1O7L A;  4I7H A;  3OOU A;  4RA2 A;  4DGW B;  2VT3 A;  4AIJ A;  2QKL B;  4XRS A;  5CYV A;  2EJR A;  5TRD A;  4G6T B;  3ASO H;  3FM3 A;  2Z33 A;  2XGX A;  1TW2 A;  1OYI A;  4YG2 F;  2ZXH A;  2VQH A;  1WJF A;  2DJN A;  1ONV A;  2STT A;  4ZTF A;  1FOX A;  2PLY A;  1S6L A;  1MJB A;  3CME I;  2VT2 A;  3K2Z A;  4DBR A;  1NH3 A;  1D8K A;  1KON A;  2XSD C;  1R7J A;  1OIS A;  3OYE A;  5M5X J;  3QOD A;  3BZ6 A;  2OCE A;  4YEJ A;  3RIR A;  1ETY A;  2CUZ A;  2WWY A;  5FJ8 J;  3TL4 X;  3BP8 A;  2RVC A;  4IL6 C;  4U88 A;  2N8G A;  2LMD A;  3DPL C;  1ZLK A;  2X6Y A;  2R0Q C;  1W7P A;  3CF5 F;  5JLW A;  1EF4 A;  4QWQ A;  3K6G A;  1WJE A;  3IHU A;  3LAP A;  3PFI A;  5E3O A;  1POG A;  2YPR A;  2HTS A;  4IHW A;  1TWA J;  2KRF A;  1QGP A;  3V7S A;  3S2W A;  1IGN A;  4AD9 A;  2V6C A;  1S7E A;  5C3E J;  2KLO A;  1W7P D;  3HRU A;  2HVR A;  2GZW A;  4PFO A;  1J2X A;  4WK8 F;  1XDS A;  2PMZ A;  3DU5 A;  1YI2 I;  3C2H A;  3GZ5 A;  4I02 A;  1G6N A;  1KQ9 A;  2VLA A;  2FBK A;  2P4W A;  3L1P A;  2R7O A;  1Y39 A;  1VI0 A;  2TCT A;  3JSP A;  3SZP A;  2TRT A;  5GTI C;  4JQF A;  3VYU B;  4J00 A;  1G3Y A;  4JK1 X;  2VB6 A;  1D3Y A;  3G1O A;  2O6G E;  2IGM A;  2FEZ A;  3D5S C;  1A5J A;  2OC6 A;  3FKI J;  4BJ5 C;  2HQN A;  2BXZ A;  3RKY A;  3H5R A;  2G0E A;  3ZPL A;  3DEE A;  1IRZ A;  2CRG A;  4HBL A;  2IGK A;  3PO2 J;  2DA7 A;  4XKC A;  5IYB J;  2WA0 A;  2CUF A;  2JRT A;  4MIM A;  3PIP F;  1I5Z A;  4HQM A;  1F36 A;  3ZN0 A;  3J7Y J;  2QKM B;  1B72 B;  2DA3 A;  1GHC A;  2DT6 A;  2JPB A;  2W7N A;  2O5R A;  4ESJ A;  4LIU A;  1XGS A;  2J5O A;  1O7F A;  4BKX A;  4XRS G;  5LGT A;  3OOP A;  2DOE A;  3JSO A;  1GXP A;  3W2W A;  5HDN A;  5E1X A;  3WTY C;  3K69 A;  2GM4 A;  4ZYA A;  1AU7 A;  3QU3 A;  1HKS A;  2EZK A;  2PJR A;  2MSY A;  3RQI A;  4XLP F;  1FMW A;  4DQ2 A;  2G9W A;  2JMW A;  4XR6 A;  5J47 A;  1MBG A;  2VON A;  2KRC A;  3FK6 A;  3OMY A;  2XUB A;  2WV1 A;  4HX4 A;  2HOA A;  1FBQ A;  2X9D A;  2WAE A;  5BNG A;  4TV7 A;  2DA5 A;  2M0M A;  4N4N B;  1FYM A;  1Z7U A;  2K9M A;  5A2Q Z;  4GYG A;  1YRN B;  2LRD A;  2LYC A;  3WHC A;  2MC3 A;  2ICW G;  2ZCW A;  1N25 A;  3KEQ A;  1XCB A;  3FZV A;  1Y0U A;  2AQE A;  4ZZL A;  2ZXW H;  3KP7 A;  2Q1Z B;  1RRJ A;  2EB7 A;  1C0W A;  1Z91 A;  3VYR B;  2CFO A;  1WI9 A;  5D6F A;  4Y13 A;  3V8K A;  1FOK A;  2KIM A;  3DFG A;  2KIS A;  4KIG A;  1Y56 A;  2XPV A;  3I59 B;  4XN3 A;  5E3M A;  5K5O A;  3GFL A;  3ESW B;  2LF7 A;  2M5W A;  1X1B A;  4BXF A;  2HYF A;  4HG2 A;  3E0J B;  2DFH A;  5DD8 A;  3GXO A;  3HPG A;  3MVP A;  3NWT A;  3CLQ A;  1T0F A;  2EBI A;  4RGX A;  1F9N A;  3RJP A;  5BPI A;  3P9I A;  3CMA I;  3QP5 A;  3HBL A;  2LC2 A;  1UHM A;  2ZSH B;  1X3W B;  4L0Z B;  1TWF J;  1R49 A;  1G4D A;  1A6Q A;  4ITV A;  1I1S A;  3FXK A;  2XAF A;  1OCP A;  2HOE A;  1JGS A;  3JW4 A;  3M07 A;  3PQJ A;  1B72 A;  2BV6 A;  1QZZ A;  4D7M A;  2PBI A;  3BR2 A;  1LNW A;  3OYJ A;  1IC8 A;  2LVS A;  3PIO F;  4LLL A;  3OR1 C;  1ZYR F;  2ZB9 A;  3DCF A;  5F27 A;  1PP8 F;  4A3F J;  1LJ9 A;  4G12 A;  4RAF A;  1J7K A;  3OYM A;  2WV0 A;  3TW6 A;  2CV0 A;  5KCM A;  1IV8 A;  3MMY B;  1IUY A;  4BY1 J;  2ELJ A;  3P5J A;  3PM1 A;  1SFK A;  1SD4 A;  5L3C A;  2QBY A;  5GPC A;  1HC8 A;  2A6T A;  1WPK A;  3R61 A;  4RAY A;  3VPR A;  3WTX C;  5FKL A;  2BBY A;  1WGX A;  1X1C A;  2BY3 A;  2OZ6 A;  4OIQ F;  4F91 B;  3ZQQ A;  4M74 A;  4KN7 X;  3AG2 H;  3VOD A;  2IS1 A;  4G7H F;  1RNL A;  1ZK8 A;  4M3G A;  5J1Y A;  4EJU A;  3CC2 I;  2CQQ A;  3M8F A;  2GXG A;  3LOC A;  2STW A;  3I4N J;  4BU2 A;  4CHU A;  2CYY A;  1YX3 A;  5GTH C;  3AFH A;  1T33 A;  1HOM A;  1FOY A;  3CMM A;  3I58 A;  1O4X A;  5J40 A;  1OFC X;  3I4P A;  5B1B H;  2XPW A;  1RKW A;  2GOX B;  3K9T A;  2RAE A;  3K4N A;  3ZMU A;  4IQJ A;  2AXL A;  2DK5 A;  3IRQ A;  3H5A A;  2MH9 A;  3E5X A;  3LSJ A;  3HYI A;  2DJI A;  3ERM A;  5FKN A;  3OY9 A;  1RC9 A;  2E19 A;  1T95 A;  5IOY A;  3HOT A;  1P7I A;  2A6H F;  2LFB A;  4FET A;  4MTD A;  1RUO A;  1LDJ A;  1VF9 A;  3N05 A;  4HV5 A;  2NNN A;  5IOZ A;  3GUD A;  3Q5F A;  2QM3 A;  3DKW A;  4EAT A;  3LA2 A;  4WF2 A;  3CCM I;  5EEH A;  2KT0 A;  2L4A A;  2NNY A;  2VE8 A;  2R92 J;  1S8N A;  3EYY A;  1FEX A;  2MLG A;  2Y0S A;  1A04 A;  4XLA A;  4EJV A;  3LL7 A;  2V1X A;  3EUK L;  3I64 A;  3G6E I;  1T0F C;  3WTW C;  1W1W E;  3CJR B;  3JAM K;  2D45 A;  2IGN A;  2NOJ B;  4QSH A;  3I4M J;  4XRM A;  3OYG A;  4BBS J;  4QPO A;  1EH8 A;  3HTS B;  4NBQ A;  5M3M J;  1H89 C;  2ZXJ A;  1IXC A;  4G7O F;  2AO9 A;  5EGO B;  4B8X A;  3K10 A;  2A05 A;  4LB5 A;  4KN4 X;  1WI3 A;  4IJA A;  1TTY A;  2DOD A;  3T0Y A;  2UV1 A;  2E1O A;  2FXA A;  4UUV A;  2R7R A;  4WXC A;  2H8W A;  2HVS A;  3OIP A;  1BI0 A;  4J01 A;  4BXX J;  3SZG A;  3H3U A;  3AL0 B;  2F6C A;  1W0U A;  1IN4 A;  3E97 A;  2A5W A;  3MQ0 A;  2LH9 A;  4BAC A;  2DAO A;  1S7A A;  4JX4 A;  5FLX K;  2OUM A;  1W0T A;  1V5E A;  1PYV A;  3F6V A;  1T38 A;  2MC4 A;  4G8X A;  2H94 A;  2K9Q A;  2RRE A;  2FU4 A;  1TT0 A;  2A3S A;  1D5V A;  4C3H J;  2KP6 A;  1NHA A;  1RI7 A;  1K4T A;  1OQY A;  2ZJP F;  3MZ8 A;  5D5X B;  2DA4 A;  3TED A;  4ZH4 F;  1T39 A;  1APL C;  3JRI A;  1XB4 A;  3ZCO A;  1U8R A;  3RQ4 A;  1OYY A;  3LST A;  1UB9 A;  1JKO C;  3A01 B;  2LKP A;  3RKX A;  1GV5 A;  4CDG A;  1N75 A;  4A12 A;  1E3O C;  3HC7 A;  2XDV A;  1WRJ A;  2E1N A;  3ZQ7 A;  4EQQ A;  3CTA A;  5IPA A;  5H6R A;  1B4A A;  1E2X A;  4OOI A;  4D9J A;  1JTX A;  4EVI A;  2M1B A;  3SEQ A;  3ZQF A;  3CP8 A;  2HS5 A;  4MTE A;  2KIF A;  4HV6 A;  2JRM A;  3M4O J;  3R0J A;  1BL0 A;  2FRH A;  2Y48 A;  3HOZ J;  1KA8 A;  3IC7 A;  4FX0 A;  2CQN A;  3GLL A;  2CJJ A;  1FBU A;  2ZNY A;  3C1D A;  5D6E A;  1XG1 A;  5D4R A;  3RDI A;  2GLO A;  4A3K J;  3ROU A;  1ON2 A;  5EGO A;  2W24 A;  4A3E J;  3H3V K;  4KUM A;  2XHK A;  2LKX A;  3DTK A;  3C2G A;  3HHH A;  2P5L C;  1W36 C;  3C7J A;  1BOB A;  3EUH C;  4BHP A;  3GLX A;  3S1N J;  4ASN A;  3CCL I;  2HDD A;  4AYB N;  4YIR X;  1ZR4 A;  1MH3 A;  3WG7 H;  3RZO J;  1KQ8 A;  2BY2 A;  1PJR A;  4V2F A;  2GBY A;  2VBX A;  3TO7 A;  3U1D A;  1GVD A;  1ZLJ A;  2VN2 A;  3DTI A;  1ZRC A;  1R6R A;  2NVX J;  1BW6 A;  5GP9 A;  2CW0 F;  3T5X A;  3GX4 X;  4S04 A;  4HST A;  2RN7 A;  2ETH A;  1FOW A;  2FJ1 A;  4I98 B;  2MD5 A;  1B6A A;  4RBO A;  1R5H A;  2EIN H;  3S1M J;  4ZYH A;  3S2H J;  2KDO A;  4M72 A;  3TDZ C;  5JVG F;  3ZQG A;  5K7F A;  2CQ7 A;  4MFE A;  2K86 A;  2E2H J;  3LAJ A;  4KA4 A;  2DPU A;  1EV7 A;  1GUU A;  3TMO A;  2WB1 N;  5D8L B;  2Z16 A;  3B6A A;  5EEA A;  1JUP A;  1LEA A;  1DPR A;  3GO5 A;  5F64 A;  1ZRD A;  2EZI A;  4ENK A;  4OU0 A;  2E7W A;  1MBJ A;  3ZMZ A;  1L3L A;  5FB2 A;  4EJT A;  1ULY A;  3MKW B;  3QOE A;  4W97 A;  5KAF C;  1H88 C;  2UWM A;  5EJC A;  2WAF A;  2PG4 A;  2NS0 A;  1PUF B;  4N9H A;  2DT7 B;  1YOV B;  4IVN A;  4GYI A;  2DMN A;  4Y17 A;  2O8K A;  3R0A A;  2W48 A;  2X85 A;  2B7E A;  1W5C C;  3IH4 A;  5GAD J;  2VIX A;  3OYI A;  4KFC A;  1I50 J;  5CVJ A;  3BTC A;  1ZRF A;  1ZEL A;  2H1L A;  3OYD A;  1IDZ A;  1DDN A;  1MJ9 A;  2BY1 A;  2OAZ A;  3VOE A;  1JUS A;  2IRF G;  5LRR A;  1MMS A;  2F5E A;  4B4C A;  2DMT A;  1FSE A;  2ZO4 A;  4XIC A;  5DEQ A;  3M8J A;  4HDV A;  2Y9Y A;  1OCZ H;  1V5G A;  3H9J A;  2EFW A;  1MMA A;  3EYI A;  3WU0 A;  1XDU A;  3ZXS A;  2BHY A;  1IJW C;  1Y1V J;  2QVO A;  1XTA A;  3C3W A;  1XPX A;  2BOL A;  4KT6 A;  2LOO A;  1CQT A;  5J6X A;  4ZYG A;  2QLZ A;  4J19 A;  2WAQ N;  3F9K A;  3MN2 A;  2VL8 A;  2XGC A;  4XLN F;  2QF7 A;  3CP2 A;  2D5V A;  2IAI A;  4HF2 A;  1Q1V A;  2W4S A;  2IEK A;  1WSU A;  1LDK B;  2IW5 A;  1DQU A;  3RPQ A;  3AL0 C;  5F1R A;  4E7L A;  3HL2 A;  2P7C B;  4G94 A;  4Y3O A;  1FWZ A;  3AG3 H;  2Q8K A;  1XD7 A;  2LK2 A;  1T6S A;  3TKY A;  2CFX A;  1SEU A;  1K7A A;  1CF7 B;  1QPI A;  1JKR C;  1A36 A;  5HDG A;  1XSD A;  2VJI A;  2ZFU A;  4EM1 A;  3H9G A;  3LSP A;  2R7W A;  5M3F J;  4PGG A;  2I10 A;  2A69 F;  5B3S H;  4YII A;  3F21 A;  2DDB A;  3N4M A;  2X1E A;  4O5V A;  2CGP A;  4DYR A;  2BZT A;  4NHJ A;  4IHS A;  2HQ5 A;  4HYE A;  2EV0 A;  2CV1 A;  1U5T B;  1XGM A;  2O03 A;  1SFX A;  3FMS A;  2ACJ A;  2M4K A;  5ED4 A;  3BTJ A;  4WX9 A;  1IRG A;  3S1R J;  1LE8 A;  1TNS A;  4HPQ A;  4CCM A;  2HNH A;  4HDU A;  3AAF A;  3GW2 A;  1AWC A;  1DP7 P;  4UUT A;  2Y0M A;  5F0H A;  3D1N I;  1PP7 U;  1SD6 A;  3SYT A;  2XAG A;  1BC7 C;  2M8G X;  2MLK A;  4NC7 A;  3OS0 A;  3MKY B;  2V1U A;  1VQ8 I;  3W6V A;  2MAB A;  4BL0 B;  2BEO A;  3ZMV A;  4QTR A;  3MD2 A;  2EIJ H;  3WTS C;  2X1D A;  2FNA A;  1OCT C;  3IKT A;  1K6O A;  2BE5 F;  2RNJ A;  3H0D A;  3IAS 2;  2F4M B;  3FX3 A;  4M9X A;  4XQF A;  1AKH B;  3W2A A;  2M7A A;  4ESF A;  3FMR A;  4NUB A;  4UHT A;  4FE4 A;  1R36 A;  1BW5 A;  3HOV J;  1MH4 A;  4BQA A;  1RUN A;  2VJJ A;  2Y75 A;  3F8F A;  4E7H A;  4X1E A;  3W3C A;  1GLN A;  5AON A;  4FTH A;  1RR7 A;  2VOD A;  1LB2 A;  2D2W A;  1WJC A;  2PI0 A;  4AU7 A;  1MJA A;  4M6V A;  1J09 A;  2H09 A;  4XOP A;  5FRO A;  3V7R A;  4BNC A;  5J1U A;  1TWH J;  1ENH A;  2VQG A;  3BCB A;  5FGM A;  1X3U A;  4HQE A;  1DPU A;  1O3Q A;  1Z6R A;  2VKH A;  3MWM A;  4FX4 A;  1VFC A;  3A03 A;  3JAM Z;  4F3Q A;  1K79 A;  1I1G A;  3M3Y J;  5IT3 A;  3F8N A;  3GZN B;  2GIZ A;  3A02 A;  2FF4 A;  1ZH5 A;  2FBH A;  1KYW A;  2DPD A;  3H35 A;  3RKQ A;  1TW3 A;  2DI3 A;  3S14 J;  5L3B A;  1Z77 A;  1Z7L A;  3EDP A;  3WTU C;  1TL8 A;  1DU6 A;  2ME0 A;  1Z3Y A;  5CLS A;  3A4C A;  3IH2 A;  3OYC A;  2OJE D;  4RAG A;  1T8I A;  3V4G A;  1IUF A;  2R7U A;  1W5T A;  3WOD F;  3LFU A;  2NRA C;  3HZJ A;  5JLX A;  1U5T A;  4B47 A;  5K5Q A;  1R58 A;  1BR1 A;  1S5L C;  2X6W A;  2PMZ N;  4RB2 C;  3FHZ A;  3ABT A;  5HNF A;  3EQL F;  1ZG1 A;  2CH0 A;  4EEF G;  5ILU A;  1ETX A;  1GVJ A;  1OCC H;  2WY7 Q;  3U2R A;  1YJN I;  5KHD A;  3GF2 A;  3RI4 A;  4YIF A;  4BUP A;  5IY5 H;  1ODD A;  2K4J A;  2UXX A;  1VQ7 I;  3L2W A;  4A3B J;  3KP2 A;  2DO7 A;  1YQA A;  2EV5 A;  2DYR H;  4AIH A;  1U9N A;  1A6I A;  1WVR A;  2VBZ A;  4G7Z F;  3HRS A;  5EZG A;  4CZZ A;  5IYC J;  3H92 A;  4OWR B;  2LTP A;  5FLM J;  2QSF X;  2YR2 A;  2HKO A;  5HS7 A;  4II3 A;  2ELH A;  2K7L A;  4XK4 A;  3KET A;  4A3M J;  4XSZ F;  5DCM B;  2VOP A;  3CO6 C;  4A93 J;  3ZRG A;  2IVM A;  5E17 F;  1U9O A;  5JI6 A;  3CD6 I;  5K7Z A;  1Z1D A;  3KP3 A;  2EPF A;  1X58 A;  2FBI A;  4HOB A;  3CCS I;  2PMU A;  3ZR8 X;  4BE1 A;  4OMY A;  4LD5 A;  1HKQ A;  2L7M P;  2L0K A;  3FMQ A;  2NVU B;  3TW7 A;  2R7F A;  3K2A A;  4A0Z A;  4B44 A;  3MZY A;  2K3F A;  2VBY A;  3DBH B;  2UZK A;  4LLG F;  1AOY A;  3S3O A;  4R1H A;  2ISZ A;  5ICC A;  4B48 A;  2A07 F;  1ZHF A;  3CUQ B;  4HX8 A;  5E1Z B;  4PJM A;  4U7D A;  3JTH A;  2VUM J;  3JRB A;  1TLH B;  4XLE A;  4C3J J;  1P4A A;  4F7Z A;  2O8X A;  4DOZ A;  3PNV A;  3ULQ B;  4XON A;  1YW8 A;  3HIF A;  2ZFW A;  1BBY A;  2Y30 A;  1YJ9 I;  3WTT C;  1ZG5 A;  1D1B A;  4CZC A;  1U78 A;  5CVR A;  2LG4 A;  3KYD B;  4BEH B;  1Y8Q B;  2CO5 A;  1TQI A;  3K0L A;  2YSR A;  5ICG A;  3PL8 A;  1Y1W J;  1BC8 C;  5DS9 A;  2R7X A;  3G71 I;  2AS5 F;  3WHB A;  1Y6I A;  4P9F A;  3M1C A;  1X1A A;  2LD5 A;  4KJZ A;  1USS A;  4C2M J;  2H8R A;  3QWL A;  1U5T C;  2EQR A;  3S93 A;  1X2N A;  1IXR C;  3ISP A;  4BS9 A;  3LSK A;  1X3Z B;  5CVU A;  1SAN A;  1UG0 A;  2HZD A;  1BA5 A;  2OQG A;  4E70 A;  4A2U A;  5DYM A;  2HDW A;  3PNT A;  2HOT A;  2M4G A;  1D1C A;  5K1Y A;  3O2P E;  4EV0 A;  3AKZ A;  5IP9 J;  2EFO A;  4U7B A;  3J80 K;  3QOP A;  3FM5 A;  4BBR J;  2HGC A;  2VKD A;  4LG0 B;  3HSE A;  4CCL A;  3ABM H;  2Z9O A;  2KJB A;  3HTU A;  4E4H A;  4CGZ A;  4OIP F;  5J4V A;  4IEJ A;  4RM2 A;  2JSP A;  4LFU A;  2LRE A;  4PSW A;  2P7V B;  2O9L A;  1EA3 A;  3JRC A;  4K2E A;  4IKF A;  3FF5 A;  1GXQ A;  4Y15 A;  3IRR A;  4H0E A;  3QQA A;  3LA7 A;  1ETW A;  1T56 A;  4A3G J;  1BIA A;  4RS8 A;  4DNC A;  2ADU A;  3O8G A;  3BTL A;  3NWS A;  3CCV I;  1WQ2 A;  2V9K A;  5M5Y J;  2DMP A;  5DTD A;  5DUK A;  1ZRE A;  4CCN A;  2OTL I;  1YTY A;  5J8C A;  5FRM A;  2OF7 A;  4NNJ A;  3LNQ A;  3L2R A;  4MFD A;  4NB5 A;  3K70 D;  2ME6 A;  1B9M A;  3KP5 A;  2QQ8 A;  2R5Z B;  4UUS B;  1MND A;  4C2U A;  5FKO A;  4D7N A;  3KZI C;  1V54 H;  4HEA 2;  4OAZ A;  4ABZ A;  2Q2E B;  3E7L A;  1HCR A;  4IRH A;  3HOU J;  3OS1 A;  1M1E B;  5D5W B;  3WE2 A;  1J75 A;  2KRH A;  4ENM A;  1PDN C;  3E6B A;  4MO7 A;  2XRN A;  4NC6 A;  5TIS C;  1YRN A;  4ZDP A;  5J1R A;  2GA2 A;  4EMS A;  5BPD A;  3OYK A;  1R22 A;  3G1L A;  4CIC A;  1W4M A;  1QQI A;  2A5Y B;  4B1R A;  1BI3 A;  1Z9C A;  2Z1D A;  3I56 I;  3OV8 A;  3BCA A;  4BDY A;  4EGY A;  2W84 A;  9ANT A;  3OL3 A;  3SZT A;  3JRF A;  2F4O B;  2G7H A;  2DOA A;  3I59 A;  3SQN A;  1UHW A;  2WC2 A;  1MMD A;  3TOB A;  1OJL A;  3QRF F;  4ZYE A;  5GAE J;  4LMY A;  1QO0 D;  1D0Y A;  3F3X A;  1ETK A;  2GXA A;  1G3T A;  2W25 A;  1OCR H;  3ZQL A;  4S05 A;  2X51 A;  2LKS A;  2WAD A;  2L9S A;  2L01 A;  5AIQ A;  3KLO A;  3K7A J;  1I39 A;  1LVA A;  1QRY A;  2H6B A;  5LGU A;  2LY9 A;  1UG2 A;  5M5W J;  1MSF C;  1X2M A;  4UY8 I;  2LP0 A;  1Z0X A;  2QWW A;  1XCV A;  1SVO A;  4I01 A;  1BR2 A;  2ZC2 A;  4XKW A;  2X4H A;  2ECB A;  1U3E M;  5CPR B;  4IHT A;  3F22 A;  1H0M A;  4U87 A;  3EUH A;  2P8T A;  1P4W A;  5EZH A;  1UHS A;  1MW7 A;  3BR0 A;  4G6D A;  3IUO A;  4IOC F;  4WXD A;  2JA2 A;  2JA5 J;  2JT1 A;  3K70 C;  2OU2 A;  3V8L A;  5JHF A;  4IO9 F;  1UEL B;  1HA8 A;  1YO5 C;  3S32 A;  2CMP A;  4UUS A;  3CCY A;  2K85 A;  5ILV A;  5E8I A;  1RKT A;  1FIP A;  4XLF A;  3CUQ C;  3S1Q J;  2VQC A;  4HAM A;  3OS2 A;  1W36 D;  5E79 C;  4OMZ A;  2Q2E A;  4EM0 B;  1XS9 A;  3OR2 C;  1NG6 A;  3DEU A;  4YEL A;  2CW8 A;  5LLQ A;  2ELK A;  2FQ4 A;  2HQA A;  2FSW A;  1ON1 A;  2XGD A;  3RTR A;  4F93 B;  3WE3 A;  2DT5 A;  3GCM A;  5HDK A;  2KKO A;  1BJA A;  2I8D A;  3E1S A;  3BR5 A;  2OCC H;  3FK7 A;  3Q0W A;  2CWE A;  2D1H A;  4RGU A;  4ENJ A;  3U9G A;  2W1O A;  2Y69 H;  3IWZ A;  3BQY A;  3IKV A;  3G3Z A;  2NS7 A;  2ESN A;  4BXU A;  5F08 A;  2QA4 I;  2VJ4 A;  3JTG A;  4UVB A;  4AWX B;  3FXJ A;  3OSF A;  2IT0 A;  2E5N A;  3S17 J;  5LHH A;  3L2V A;  4GFB A;  1X4P A;  1R1U A;  2E35 A;  3HOY J;  4PCQ A;  4KIB A;  3BJ6 A;  3VDX A;  4I0A A;  3DEW A;  2DN0 A;  3L00 A;  4E7S A;  1LFP A;  1WJD A;  3HXL A;  4RLQ A;  4L0Y B;  2AHQ A;  3BWG A;  2IS4 A;  3BR3 A;  2P6S A;  3AG1 H;  1FJL A;  1MDM B;  2QQB A;  1SFE A;  2WTE A;  4B09 A;  3K1N A;  4P1W A;  1R9T J;  4M3E A;  4BDZ A;  2P5K A;  2WBM A;  1F43 A;  4HLY A;  1QNT A;  4UB8 C;  4IZZ A;  2COB A;  3ABK H;  5CQG A;  2BYV E;  1SAU A;  1SMT A;  4IF4 A;  4EGZ A;  1RET A;  2HTJ A;  3UKG A;  5FLV A;  4A3L J;  1FT9 A;  1Y8R B;  3DLL F;  1WKM A;  4ZYD A;  1LPQ A;  3PSF A;  3COA C;  3H3Z A;  1TP4 A;  1Z6T A;  2QSG X;  5HLG A;  4GRI A;  4BAY A;  4Z2Y A;  3FWE A;  2H6C A;  4PJL A;  2H1K A;  2HYJ A;  3T1B A;  3E3V A;  3KX2 A;  2DDA A;  3QAH A;  1R00 A;  3OYH A;  3IAM 2;  1DUX C;  4S0H B;  3HSR A;  4M9Z A;  4NC8 A;  1DGW Y;  3CC7 I;  1U6G A;  4C30 A;  1OPC A;  3LFK A;  1SC7 A;  2MG4 A;  4BH9 A;  3SFI A;  3F72 A;  1UCR A;  2RKH A;  3CQZ J;  3U21 A;  3GYH X;  1WCM J;  2F5C A;  3SJM A;  4P5O A;  2KPM A;  2EIK H;  4HW0 A;  1B1B A;  3KEY A;  3SDB A;  1P2F A;  2K9S A;  2VE9 A;  2A6E F;  4XSX F;  1ZTR A;  5BOX A;  1K6Y A;  3OSG A;  1HST A;  1HLV A;  3G4S I;  2R7V A;  3GFJ A;  3BJO A;  3TOA A;  2JJ7 A;  3I3L A;  2CU7 A;  2HXO A;  1IO2 A;  1BI2 A;  4N9I A;  4UV8 A;  3DBR B;  5J8F A;  1YIO A;  1RIO H;  3FBN B;  2IP2 A;  4A0Y A;  2KIQ A;  5CJ9 A;  3F6O A;  1K83 J;  4KMF A;  2XSJ C;  3HPH A;  4E7K A;  2PMH A;  2R7T A;  5DM6 F;  2F48 A;  5C4J J;  1FLI A;  4HNV A;  3HRT A;  4PJ0 C;  2L02 A;  4PZJ A;  2JUC A;  4YFK F;  5HLH A;  3A01 A;  1TZL A;  4RGS A;  3VWB A;  1EKE A;  1XGN A;  3RSN A;  1WJA A;  3O8H A;  1STZ A;  5EF6 A;  4XBF A;  1MDM A;  2DFE A;  3TP3 A;  4DBQ A;  3B6C A;  2VPR A;  1ACI A;  1ZN2 A;  3MCZ A;  2LBF B;  3Q9S A;  3H0G J;  5LD2 C;  2XAU A;  3KYL A;  4Y4R A;  2H27 A;  4A69 C;  3PUF A;  1X1D A;  3BPV A;  3ONQ A;  2FNP A;  4A6D A;  1E0E A;  3U1K A;  1TWG J;  5FRN A;  3NRV A;  2EFQ A;  5F6F A;  2CW7 A;  2LR8 A;  2HKX A;  2L3D A;  2DCE A;  2P5V A;  1RPW A;  3GFM A;  4D5F A;  3Q9V A;  2ID6 A;  4JYK A;  1QZY A;  4ESB A;  3DBL B;  3DU6 A;  2DQL A;  4LG3 A;  4KNY A;  2XVC A;  2E71 A;  1U0J A;  1D5Y A;  3GEZ A;  2DA1 A;  3BG3 A;  3SHF A;  4LGW A;  2V6E A;  1LDD A;  2FMY A;  2L4M A;  1B8I B;  1QHG A;  4LOC A;  5TJJ A;  2GWR A;  2NAZ A;  2ZJQ F;  4FIS A;  1Z05 A;  2WB1 A;  1PUE E;  4XLH A;  2HFH A;  3TBI A;  1TWC J;  1WH5 A;  4M71 A;  4RMN A;  2HVQ A;  3HJE A;  4Z6Y A;  2HDC A;  2EWN A;  4LK0 F;  1RZ4 A;  3WGH A;  1SAX A;  3K4L A;  1KU9 A;  4RGR A;  3GTG J;  4M6X A;  3OYL A;  4Y7N J;  4LIT A;  3RCO A;  3A0B C;  1R71 A;  5ICE A;  4I76 A;  3KE2 A;  1CGP A;  1I27 A;  3WG9 A;  4BQO A;  1ORK A;  3MZH A;  1WJB A;  1ZG3 A;  2L7F P;  4KT5 C;  4AM3 A;  4YRV A;  1A31 A;  5K5R A;  5F04 A;  1KU7 A;  2EA4 A;  2QGU A;  3BG5 A;  3BC8 A;  4YFX F;  1P9Q C;  4BE2 A;  3JRH A;  4JX6 A;  3HG9 A;  2M8E A;  2ZME B;  3F23 A;  3S15 J;  1BJZ A;  1FX7 A;  2M7B A;  4PSX A;  3F8B A;  1FNN A;  2K9L A;  1FYK A;  3HOS A;  3OYA A;  2QUF A;  4CH7 A;  2BHZ A;  2R93 J;  4XLC A;  1JHF A;  2PX9 A;  1HDD C;  1R5G A;  4M3D A;  2EFN A;  1EH6 A;  2OD5 A;  1B59 A;  4JBA A;  2W82 A;  2R5Y B;  2CUJ A;  3QPT A;  1QA6 A;  2DBB A;  2BW3 B;  3CCR I;  2XRL A;  2W85 A;  3K1P A;  3L2Q A;  3K4B A;  3F8M A;  4RLF A;  2R7S A;  1V4R A;  1WH7 A;  2X6O A;  3O3K A;  2MW8 A;  4QPQ A;  2XAH A;  2R7D A;  2IA2 A;  3P7N A;  4CYC B;  1PUF A;  2F5D A;  3O6B B;  2GXB A;  1VQM I;  3L09 A;  1VQN I;  1JI8 A;  4R79 A;  4II2 A;  4AID A;  2I5U A;  4L18 B;  1O57 A;  3L7W A;  3WGG A;  4ZZD A;  3WTZ A;  1IXS B;  4MEY F;  2YU3 A;  4LLN A;  3BT9 A;  2HOS A;  5IP6 A;  2Z3Y A;  1JKQ C;  5JFR A;  4IHX A;  2CQX A;  1D1A A;  2XAJ A;  3DPT A;  3LA3 A;  3TP0 A;  2FUG 2;  2IBD A;  2XPU A;  1L0O C;  3HM5 A;  4PJN A;  2CQK A;  3EPZ A;  4L9N A;  2DLL A;  2K02 A;  3FIW A;  3R4K A;  5AIP A;  4B43 A;  3ASN H;  1W7P B;  3BZK A;  1G59 A;  3DPU A;  3GVA A;  4HNU A;  3TQN A;  3F8C A;  3ERE D;  1VQL I;  3ECO A;  2J5P A;  3BG9 A;  3PO3 J;  4AIK A;  2LY1 A;  3BZC A;  1P4X A;  3RPU A;  3SDG A;  4BY7 J;  4M9S A;  5FFX A;  1VQ6 I;  2Z5U A;  3CDL A;  3H9Q A;  5DDG A;  1QBJ A;  3MKZ A;  2PFB A;  1J5Y A;  3DWL E;  4O3M A;  1RES A;  4O6J A;  5B66 C;  1LKX A;  2K5C A;  5IP7 J;  2YUS A;  3GME A;  2HR3 A;  4XNF A;  3DF8 A;  1LFB A;  3C2B A;  3S3N A;  4MQ9 F;  4C2T A;  3W6K B;  1F1Z A;  1OKR A;  2ZJR F;  1ERD A;  1CF7 A;  1JE8 A;  3BDD A;  1YLF A;  5JVT A;  2HQR A;  2LF8 A;  4MQV A;  3K4J A;  1IN5 A;  4Y33 A;  3H36 A;  3PUB A;  4GGG A;  4EJO A;  1VQK I;  5F0F A;  1VTN C;  3IV5 A;  3RPU D;  2DOF A;  3KP6 A;  1A35 A;  4XN0 A;  3GTJ J;  4NDL A;  1WJ5 A;  1UFM A;  2BXY A;  1Q1H A;  1T2K A;  4MGR A;  3K4M A;  3UNG C;  1ZR2 A;  1IW7 F;  4PJJ A;  4MHG A;  2XAS A;  3BR6 A;  4DJA A;  1EJ9 A;  1SVL A;  4HF0 A;  5FO5 A;  1R4N B;  4XOR A;  4CO8 A;  1UST A;  2EFP A;  3KZZ A;  2E5Z A;  1J0R A;  5FLX Z;  1WZ2 A;  3HGY A;  1JJ8 C;  1R23 A;  4MNU A;  5H20 A;  1YYV A;  4PDK A;  1ZAO A;  1VND A;  2M2E A;  3MEX A;  1TQP A;  3HB9 A;  2L7K A;  1SD7 A;  3ECH A;  3KLN A;  2QYO A;  3E6C C;  4RB1 A;  2R7Z J;  2QQA A;  1TNT A;  1GT0 C;  4N0B A;  1YFH A;  5L3F A;  3DLA A;  5F0C A;  1ITY A;  2G7U A;  2Y31 A;  1BOA A;  3DQV C;  5TGT A;  4ETS A;  4ENN A;  3TDU C;  2BGC A;  4A6E A;  1AKH A;  2E60 A;  3HKZ A;  2VXD A;  3D0S A;  3X2Q H;  3W6J B;  2PJR B;  1HF0 A;  4ZDL A;  1SFO J;  2ZNZ A;  4A0X A;  2EH3 A;  2NVQ J;  1QVU A;  2FX0 A;  2L9V A;  1JJ6 C;  3LSH A;  2JA6 J;  2GOM A;  2OPT A;  2AQF A;  2X0L A;  3ZQC A;  3BRO A;  1MBF A;  2YX7 A;  1WWX A;  3G2B A;  3WU1 B;  2JK3 A;  1H9T A;  5IT9 K;  2NOG A;  5K7H A;  2ZJ2 A;  5FD5 A;  3CF2 A;  3J7Z I;  1S3J A;  2KQR A;  4DZP A;  2GIV A;  3H1C A;  2PJP A;  2TDX A;  1BI1 A;  4RDU A;  3S3M A;  1G3W A;  1I3A A;  2UXN A;  3UR3 C;  4EM2 A;  4BQQ A;  1TT5 B;  5BMZ A;  1R1T A;  5E20 A;  5LBQ A;  4KDP A;  2P81 A;  5LFA A;  1GV2 A;  2ISY A;  4HSR A;  2X48 A;  3GWZ A;  5H2F C;  1KYZ A;  2MGQ A;  1QVT A;  3LSG A;  3L9F A;  4A3C J;  4ZC3 A;  2XV4 S;  5HOO A;  3VSL A;  2A61 A;  3PQK A;  4N4O B;  2FML A;  4DIQ A;  4XKB A;  4A5M A;  3M7G A;  4GCV A;  4E6K G;  2DTR A;  3HSF A;  2ZME C;  3LSM A;  2LNB A;  1JHH A;  3E5Q A;  5LEJ A;  2JZY A;  4I6Z A;  5FD6 A;  2HPM A;  3G73 A;  2EZH A;  3BG6 A;  2EIL H;  2XB0 X;  2BVL A;  1JT6 A;  2EA2 A;  3KFW X;  3JRG A;  2XF7 A;  2COM A;  1S9H A;  1XX5 A;  1LQ1 A;  2O0Y A;  5KVR A;  3C18 A;  2HI3 A;  4B3A A;  2KMU A;  2ESH A;  3CDH A;  2PN6 A;  2WY8 Q;  2KIU A;  3KZY A;  5DCF A;  4IRG A;  1KQ0 A;  3HHG A;  1P6R A;  4OAY A;  2B63 J;  1TQM A;  1SVM A;  1V55 H;  3ML6 A;  5E3L A;  1VQO I;  2RV8 A;  1IRX A;  3OIQ A;  2F5V A;  2Y2Z A;  1I6H J;  4HNT A;  3M1E A;  5E8G A;  3RYR A;  1IZ1 A;  4BYY A;  1ZQ3 P;  1MBH A;  4FQG A;  4P9U A;  2QBY B;  1VZ0 A;  3CO7 C;  1ETO A;  4LK1 F;  3WTV C;  1WHU A;  3HDD A;  2E2I J;  3GTO J;  1IN7 A;  4KMU X;  3KEO A;  3FXU A;  1FY7 A;  3RKW A;  1T98 A;  4IX7 A;  5DCM A;  2E1M B;  1UZC A;  1UAA A;  4A5N A;  4M3B A;  2M0C A;  1D0X A;  3K1M A;  4M6Y A;  2KJC A;  5B5E C;  1BIB A;  2D1V A;  2Q0O A;  1DU0 A;  2A68 F;  4E7I A;  1LFU P;  1YS6 A;  2VC1 A;  2LDU A;  2L9N A;  2HU9 A;  3P9K A;  5GAH J;  3CJN A;  3CCU I;  4Q5S F;  2M87 A;  2XF6 A;  1F5T A;  1FC3 A;  2PEX A;  4UVC A;  2NVY J;  1I3Q J;  3GFI A;  2XKP A;  4CCK A;  3Q3S A;  2FQ3 A;  3VEP A;  4PFP A;  1FSH A;  2FOK A;  3CUQ A;  1P7J A;  3I55 I;  4GO1 A;  4RAZ A;  5FKM A;  5HVQ C;  4AVP A;  3SFZ A;  4MEX F;  1LUJ B;  4XMY A;  4FCY A;  3NQO A;  2O3F A;  3VYT B;  3I53 A;  1Z21 A;  1EH7 A;  4OIO F;  3BY6 A;  2JA7 J;  1U8B A;  3J81 K;  3CMY A;  5FKK A;  4CUG A;  2V7F A;  4KIT B;  4C9Y A;  4L5J A;  4WXH A;  4PGH A;  1OLT A;  4BQN A;  5CQE A;  3OYB A;  1FMV A;  2UUZ A;  2KHM A;  3Q0U A;  5LRS A;  4BEH A;  2XF5 A;  1N78 A;  1FIA A;  1KZH A;  1FZP B;  1REP C;  2CS3 A;  1Z67 A;  1LEB A;  3FHN A;  2F5F A;  3ZQI A;  4F52 A;  3CJT B;  4F92 B;  4D0P A;  3CC4 I;  2L9R A; 
#chains in the Genus database with same CATH homology
 3CMA I;  3CCE I;  1VQP I;  2ZJR F;  1YI2 I;  1YJW I;  1FOW A;  1VQK I;  1Y39 A;  4UY8 I;  5DM7 F;  3CC7 I;  1YJN I;  5GAG J;  5JVG F;  2H8W A;  1VQ4 I;  3PIO F;  1VQO I;  1VQ7 I;  4IOC F;  4IO9 F;  3CCQ I;  1QA6 A;  2NXN B;  3CCR I;  3G4S I;  1HC8 A;  3PIP F;  3J7Y J;  1VQ8 I;  3CCV I;  3CD6 I;  2ZJP F;  2OTL I;  4IOA F;  5DM6 F;  2E36 A;  3CCS I;  1VQM I;  3CC2 I;  5GAD J;  1VQN I;  3CCJ I;  2E34 A;  5GAH J;  3CCU I;  2K3F A;  1FOY A;  1YIJ I;  2OTJ I;  2FOW A;  1ACI A;  2QA4 I;  1VQ5 I;  1FOX A;  1YHQ I;  4V19 K;  1MMS A;  3I55 I;  3CME I;  3J7Z I;  2JQ7 A;  2E35 A;  1YIT I;  1S72 I;  3CF5 F;  1YJ9 I;  1VQL I;  2QEX I;  3CCM I;  3I56 I;  1VQ9 I;  1VQ6 I;  3CCL I;  3G71 I;  2ZJQ F;  3G6E I;  3CJT B;  3DLL F;  5GAE J;  3CC4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...