2QEXI

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2qexI00
1VQ5I 3CCUI 3CCLI 1VQ9I 1VQ8I 3CC4I 1VQ6I 3G4SI 1YJNI 3G71I 4UY8I 2FOWA 5DM6F 3CCRI 3I56I 3I55I 5JVGF 2ZJPF 5GAGJ 3J7ZI 1VQLI 2E35A 1FOXA 1ACIA 1FOWA 3CJTB 4IO9F 3CCSI 1Y39A 3CCQI 2ZJRF 4IOAF 5GAHJ 2ZJQF 2E34A 1VQ4I 3CD6I 1VQKI 3PIOF 1S72I 1QA6A 3CCMI 4V19K 1YJ9I 1VQ7I 5DM7F 3CC7I 3DLLF 1YI2I 2K3FA 3CCEI 1YIJI 2OTJI 3CMEI 2E36A 4IOCF 3CF5F 1VQNI 1YJWI 1FOYA 3CCJI 5GADJ 5GAEJ 2NXNB 2JQ7A 1YHQI 3J7YJ 3CMAI 1VQPI 1VQMI 1HC8A 3CC2I 1VQOI 2H8WA 3PIPF 2QA4I 2QEXI 3G6EI 1YITI 2OTLI 3CCVI 1MMSA
chains in the Genus database with same CATH superfamily
3LNQA 1PDNC 4E70A 5HOOA 2ECBA 4DGWB 2WAQN 2F2EA 2GXAA 1MNEA 2XPVA 2BBYA 2XF5A 1BC8C 3BP8A 3M9AA 1K6OA 1VQ8I 1G3SA 1G6NA 1YS7A 2LH9A 1TT0A 4XRSA 3JRAA 4LIVA 2RNGA 3CP2A 2NOJB 4BDYA 4ASNA 1FSEA 4OOIA 1X1DA 1F4KA 3A01A 1Z91A 4XN0A 1ZGJA 1GDTA 1MH4A 4MO7A 1Q1VA 1HDPA 4I99C 2MABA 3H5RA 1T0FC 5HLIA 1OPCA 4PGGA 3OYNA 1P9QC 2E35A 2RVCA 4J19A 1IDYA 4I6ZA 2JRMA 2BY3A 2EA2A 4GCVA 3V7RA 2VODA 2YU9J 2YX4A 1VI0A 5LEKA 1WVRA 4YFKF 3DV8A 2EV6A 2XUBA 2IJLA 2E34A 1XGMA 4GXOA 1D5VA 4L9JA 2L7FP 1WSUA 3BG3A 2OBPA 2HZTA 3KZZA 4BJ5C 2MLGA 2STTA 4A93J 2YUSA 4N4OB 2CRGA 4V19K 5FFXA 2HYFA 3JR9A 3I4NJ 2ISZA 5C4JJ 5IT9K 1WRJA 1SD4A 4AIJA 1BI2A 1D3YA 2ZXIA 5E1ZB 2V6EA 1ON2A 3KCCA 1LEAA 2A3SA 3ZN1A 4CCKA 3DQVC 4XSXF 1YI2I 1IRZA 2PQ8A 2QGUA 2QSGX 2VQGA 5HS8A 3QOEA 2LR8A 2P5VA 3HXLA 3KEOA 4IX7A 4OIPF 4DNCA 2XIGA 3KLNA 2O8KA 1O57A 3HUGA 3W3CA 3U9GA 1YJWI 1OLTA 1U9OA 2ZKZA 5DDGA 1SFOJ 3WGGA 2F48A 2WADA 4M73A 3RKWA 3CMAI 3ZR8X 3A03A 2XAFA 1BN5A 3KYCB 2ZNYA 3S2WA 4A3IJ 5D4SA 1E2XA 1UB9A 2JA2A 4LK1F 3DU5A 5HDNA 2L7KA 2IEKA 2BE5F 1H8AC 3IP4B 1IGNA 3P5JA 4B3XA 1X1CA 2LLKA 2BY1A 4C3HJ 2XAGA 3CUQB 4HX7A 2E2JJ 5BNGA 4ZYEA 2PI0A 3FKIJ 4F7ZA 3ZP5A 5J4VA 3BR3A 5IT3A 5EZGA 1ZN2A 2LF8A 4RB0A 1VQ5I 4U88A 5IYCJ 2GXGA 4JOMA 3CCLI 3BOQA 3LSMA 3CMYA 4AC0A 1LE8B 3GFJA 2HKOA 2W84A 3E1SA 3G4SI 3J7AY 2QYOA 4IHVA 1I3QJ 2O3FA 1SVMA 3UNGC 1IW7F 2BGCA 1ZTRA 2MBFA 4JYKA 2VBZA 5LFAA 4GRIA 1P6RA 2NVUB 3HZJA 1WH5A 3LMMA 4PJLA 3W6KB 5D8KB 1W7PB 2ZO4A 3IV5A 2LY1A 4BEHB 5C4XJ 2O03A 1ONVA 5DCMA 3BROA 3LAJA 2CUEA 1RR7A 1LFPA 2LG4A 3HOTA 1ZELA 2IW5A 4OU0A 3PO3J 3F6VA 5CVUA 1ZG5A 4M72A 3RIRA 3VSKA 4BXUA 3LSJA 1Z0XA 2K9QA 3JRFA 1Z3YA 4Y4RA 1Z7UA 3QOPA 5CVIA 4MFDA 1J75A 2VPLA 5K5RA 2QBYA 2HXIA 3K0LA 1TW2A 1NTCA 3SEZA 5ED4A 2LMDA 3ZQQA 3PSFA 3VYUB 1T56A 3F9KA 3HIFA 3OYAA 5DTDA 3SXYA 3LWFA 2ETHA 2ELJA 4JBAA 1TWCJ 3FXKA 3TKYA 4C3JJ 3AG3H 3ABKH 1P7JA 4CO8A 1XGNA 2P4WA 4U87A 2UXXA 4Y33A 2I8DA 4KICA 2OTJI 1AKHB 3ZMTA 4HV6A 2ADUA 3FIWA 5AONA 4RGUA 2XGEA 2ID3A 1LVKA 1FMWA 3MN2A 4EM0B 4BJ6C 3QU3A 2D1VA 5ERIA 1K61A 2EZHA 2H8WA 5GPCA 2CW8A 4Z2YA 2YR2A 2WY7Q 3M3YJ 2QZ8A 5DYMA 1IG7A 2E2IJ 4L0ZB 2DOAA 1YITI 3S1NJ 1U5TC 3SYTA 1IC8A 3OYDA 1MIJA 1B6AA 2KIFA 1QVTA 5DD4A 5C44J 2FU4A 2F5EA 3DLAA 1ZR4A 4RGRA 3TDZC 3GTKJ 4L5EA 1WJBA 4QWQA 2DJNA 2OD5A 2FQ4A 5IP7J 2VE9A 3BJAA 2E1OA 3GTQJ 3S3OA 2OJED 3G71I 3HSEA 4L0YB 3CMMA 4LK0F 4PSWA 5JHUA 2JZYA 5EEAA 3G3ZA 2ZBKA 4F93B 2R92J 4ITVA 4YELA 2KFDA 2H6BA 2Z3YA 1OMIA 3GWZA 3I55I 3K6GA 1UZCA 1B59A 5KAFC 1R22A 2X0LA 3ERED 5E17F 3CO7C 2WAFA 3DU6A 4RAFA 1V4RA 3I59A 3J7ZI 2JPCA 2CV2A 2ZXWH 3HHHA 1ACIA 3H5AA 1E3OC 2ZSIB 4IO9F 2FF4A 3BJ6A 2YSRA 3B73A 2VT3A 3HOXJ 1PP7U 1ZRDA 4IHTA 5J6XA 3P9IA 1KQ0A 3OSGA 3JSPA 2ZMEC 5JHFA 3CD6I 1Z05A 1YLFA 4CYDA 4UUSA 3QYEA 1UFMA 1YS6A 4RAZA 1MBJA 2F4OB 3WTUC 1B8IB 4M6XA 5B66C 3GYHX 4XORA 3CUOA 2M7BA 2P5LC 1FP2A 2LFBA 3DTKA 1IAWA 2JK3A 3AG1H 2K3FA 3L2WA 4IRIA 2LTPA 4JQFA 3FZVA 3GZNB 4BE0A 1MD0A 2EPFA 1QGPA 4L5IA 3TDUC 3I4PA 3O8HA 1W5CC 1AU7A 1YE9A 1GT0C 1J09A 2FQ3A 4IOCF 3ISPA 1VQNI 2K7LA 1FOYA 2V7FA 2DA2A 2DFEA 2FBIA 3VYRB 5GADJ 2B63J 1DGRM 3FXOA 2CYYA 3A02A 3HG9A 2ID6A 1TWFJ 1IN7A 3MQ0A 2V6CA 2VONA 4NQWB 3V7SA 1U2WA 2Z2SB 1TWAJ 2LK2A 2VJ5A 2HTJA 1G3TA 2XPWA 3MFKA 2QKMB 3JW4A 1YIOA 1X1BA 5JVTA 1MMSA 1WPKA 1N77A 1RKTA 4D7MA 1A6IA 4HSRA 5M5XJ 5ICFA 4S05A 2L7MP 1HKQA 3OMYA 4XSZF 3AAFA 2X1DA 4CUGA 3RJPA 1IV6A 2RQQA 1FWZA 1U78A 2KDZA 5HLHA 4EJWA 5IYDJ 3DP7A 2ECCA 3ABLH 2LDUA 3PQJA 5ILUA 3OYFA 3JRGA 4J01A 1GXPA 1UAAA 3E5XA 1FTZA 3CC4I 2E7WA 2MW8A 2O8XA 1UELB 2DU9A 2K9LA 2OV7A 5F04A 5J1UA 1HXDA 2EZIA 2R5YB 2LNBA 1T33A 4CCMA 2HQNA 2DMNA 1TQPA 3PL8A 5K7HA 4A3BJ 3OV8A 1OISA 1NG6A 3KX2A 2GIZA 1X3WB 3RKQA 2LOOA 4BXXJ 2L3DA 4OWRB 2YS9A 1K6YA 5EGOB 5CKTA 3ZPLA 4LLLA 1LDKB 2J5OA 4CH7A 3D5SC 1D8KA 1HCRA 3WTSC 3OS0A 4PJ0C 3HOWJ 4OMYA 1MBKA 1XMKA 2WB1A 2DT5A 2PJRB 3F21A 5LD2C 4HSTA 4KNYA 2IGMA 1T95A 4GYGA 2E1CA 2FMYA 1R5HA 1N78A 1HBXG 2YPRA 4ON0A 3SZGA 3FXUA 3BPVA 5TGTA 3LFUA 1SD7A 2VKDA 3WU1B 4E6KG 2QM3A 2CQQA 5F0HA 1NK3P 2NS7A 4BE2A 1O4XA 3L9FA 2D5VA 2A61A 2FNPA 1O3QA 1LQ1A 2IA0A 5BPDA 2XROA 4HX8A 2A68F 2ZJ2A 1JUPA 4G9YA 1KQ8A 4RS8A 1P2FA 5IYBJ 3K7AJ 3V4GA 1SFUA 3BR6A 1LDJA 3LQRA 3HRSA 4C3IJ 3RCOA 3W2WA 2K4BA 1SC7A 4HZFA 2VKEA 4A12A 2COMA 1HF0A 4OIOF 2O9LA 5EDNA 4DZJA 2D45A 3MWMA 2LVSA 4D0PA 1PUEE 2EB7A 4N9HA 1IF1A 3VSLA 4BQQA 1VQOI 3GTLJ 3RZDJ 3OYLA 1U0JA 1O7LA 2F4MB 3AG2H 2DA6A 1OCRH 3TGNA 1MGTA 5FD5A 4Z6YA 1D1BA 2GOXB 1R49A 1WJFA 2JJ7A 2R7OA 4KIBA 1U5TB 4A3MJ 3K4KA 1G3YA 4I0BA 1FMVA 3EETA 1Z9CA 5FKOA 2DFFA 4LG0B 3K1NA 4EATA 1Z21A 1DUXC 2KQRA 2KHMA 4XOPA 1S29A 5DS9A 1YTYA 4W1UA 2E60A 4ZDOA 4CCJA 3H9QA 1T6SA 3BDDA 3PUFA 2FXAA 3IC7A 2HZDA 2OPTA 2X85A 1TL8A 3I5UA 4LB5A 3IWFA 2EZLA 3F8CA 4HA8A 2FOWA 2QUFA 2PMUA 2EWNA 1VNDA 1Y0NA 1WJDA 4LGWA 3P7NA 4FX0A 3LA7A 2PBIA 4KT5C 1ORKA 1XN7A 3CDIA 4BU2A 2LBFB 2Q8KA 2PLYA 2EJRA 4ZYAA 4F92B 3E6MA 5GAGJ 2DA5A 4EGZA 4EJUA 4XKVA 5F64A 4B47A 1W0UA 4A3EJ 2F5VA 2NOGA 2QVOA 2IS4A 1IXCA 1ON1A 1KU7A 2P8TA 4XLEA 4XOTA 3CJRB 2E1NA 1FYLA 1AHDP 2IP2A 2V1DA 1LVAA 4HQMA 1XGSA 3SFIA 3DTEA 1KONA 2XF7A 2DXIA 3BG9A 3FXLA 1R1UA 1BR1A 4IZZA 3OY9A 3ZCOA 1KU2A 2M45A 4DYRA 3GO5A 1JTYA 2JRTA 3FXQA 2V9VA 3DKWA 3OL4A 3R0AA 3BJOA 1JKQC 3HB9A 4A3LJ 4A3GJ 4A3FJ 1QHGA 2Y9YA 4KIGA 5GTHC 1F1ZA 1FIAA 3G73A 2VOOA 1ZHFA 2HGCA 1YJ9I 1RETA 2ELHA 4LLNA 2E1MB 3KYDB 3MEXA 3GLXA 5J1RA 1MH3A 1R4MB 4XM3A 1W4MA 2MC4A 3K4NA 4QPQA 2F5CA 2CWEA 2KKOA 2QKLB 3K4LA 4N0BA 1MDMB 4NB5A 2W00A 5LHGA 1KGSA 3AKZA 3FKJA 3IHUA 2NNYA 1FBQA 1F43A 5K5QA 4WXDA 2O5RA 3HKZN 1MZBA 1I6XA 1I1GA 4XRSG 2E5ZA 4EM2A 1TW3A 1X3UA 1YHQI 2M8GX 4KDPA 5HODA 1JJ6C 1FTTA 2DO7A 4IVNA 4LG3A 5HS7A 2EINH 4CYCB 4HQEA 2VJIA 3DBRB 3OIOA 1MBHA 4M3GA 2JSCA 4A5NA 3O6BB 2Y0SN 3SHFA 5D5VB 1LNWA 3K1MA 1R00A 3K70C 2W57A 5L3CA 2Y2ZA 4B1RA 3EYYA 2L9SA 1TLHB 1Y1VJ 5CQGA 4KMUX 2KIMA 5CVRA 1YFHA 3R4KA 2GLOA 1KYWA 1C0WA 3WE2A 1BOBA 5FROA 1WZ2A 2L4AA 3DPLC 3KE2A 3MKYB 5LGTA 4OAYA 2DAOA 4II2A 1WJCA 1KU9A 2QQAA 3LL7A 2W7NA 3IL2A 1VQ6I 5H6RA 4BHBA 3C7JA 1HSJA 1NH3A 4HF1A 3BWGA 2E19A 3ELKA 1J5YA 2RNJA 4BY7J 2HOTA 3M8FA 5FJ8J 4Q47A 5DCFA 1GV5A 4G94A 2VPRA 3S15J 3SQNA 2TCTA 5FKMA 3I0TA 3PNVA 1BIBA 2DPDA 1E0EA 3S1RJ 3TOBA 5EG0A 1BI0A 1P7IA 2O6GE 1OR7A 3BG5A 2ZJPF 4WWCA 2KT0A 2K3PA 1QNTA 1QZEA 3EUHA 1OCTC 1FSHA 2LSOA 3KLOA 1LFUP 3PQKA 1FY7A 2L9RA 2IA2A 2P81A 2XC7A 2HWVA 2XAHA 4NHJA 5E1WA 5EJCA 2RREA 4LB6B 4MEYF 4N9IA 4GDFA 1ETVA 3CTAA 1X2MA 1VQ4I 2M87A 2LKXA 3H0DA 2V1XA 2DDBA 2G7UA 1EKEA 3HHGA 1J0RA 1QA6A 5EEGA 3GTGJ 3Q0WA 3SJMA 3VWBA 5CVVA 1X1PA 3U21A 1A36A 4FETA 2DOFA 4HF0A 4PK4A 3WHBA 1BC7C 1SANA 2ZXHA 1SMTA 3H3UA 4UB8C 1TP4A 3L2RA 4CZCA 3ML6A 1IRXA 5IOYA 3S3NA 2DA7A 1XMXA 1WGXA 1OCPA 1AA7A 1CGPA 1WH7A 1G4DA 1SVLA 3EDPA 1RUNA 1LEBA 3IUOA 5FO5A 4YFXF 1ZLJA 3DPTA 3VDXA 4KUMA 3OIQA 3L2CA 2NRAC 4OINF 2A6TA 2CW7A 3BQZA 4QSHA 4ZH4F 3KETA 2JQ7A 4EMSA 2A5WA 1SEUA 2RV8A 3D1NI 2W85A 2D2WA 2M4KA 1IXRC 1HQCA 3MKLA 3K4CA 4AU7A 4RAYA 2OZUA 2WC2A 4XMYA 3JAMK 3OYMA 2OF7A 1XTAA 5IY5H 2EFQA 3L09A 5FB2A 2JVGA 2HKXA 5B5EC 1BL0A 4AD9A 4JX4A 4DW6A 3M7GA 3NAUA 3CDHA 3J80Z 1WJEA 1HKSA 3KP3A 3CUQA 1XSVA 2EV0A 2HDWA 4Y52J 3FK6A 1XSDA 4BBRJ 3E5UA 4E7JA 1TTYA 2K02A 5KCMA 1V5EA 3O2PE 4OAZA 3NWSA 1IUYA 1T98A 3P9CA 4II3A 3LSHA 1S5LC 1K4TA 2DYSH 1RKWA 2JSPA 5E8GA 3JRDA 3MVPA 2AO9A 2EIMH 2R7VA 4ZDLA 4IHWA 2FSWA 5DV5A 4BS9A 3ZQHA 3LQQA 5A2QZ 2PMHA 1UJ8A 4AVPA 2KZVA 2N8GA 3J81K 3TP0A 4AIHA 5HVQC 1GV2A 3AG4H 1D1AA 5D6EA 4YRVA 5JVGF 3Q3SA 3L7WA 3V8LA 1W7PA 1V3FA 4B09A 5FLMJ 1XS9A 3HTSB 1WJAA 4BEHA 2DMPA 2Y0MA 3HGYA 5K5OA 5CPRB 3CJTB 4E7KA 4FE4A 1ITYA 2CG4A 4A5MA 2GOMA 3OYCA 4S0HB 1O3TA 3ROUA 5GAHJ 2ZJQF 3GFLA 5IOZA 3HSRA 3S2HJ 3WE3A 1G59A 3E6BA 2Z99A 2R5ZB 3E6CC 2R7SA 1QHHD 1STZA 4U7DA 2DTZA 1DQUA 3KP4A 3M1CA 3IAS2 4P96A 1RNLA 2OQGA 2WV0A 5EF6A 1YRNB 1I50J 1VFCA 4NUBA 5IP9J 1ZK8A 4WXHA 3DPUA 1TT5B 2DMQA 3RPQA 2XAQA 4M9XA 2X6YA 3ZGKA 1HLVA 2Q0OA 3WTZA 3IH3A 4U0VA 1K4SA 1SFKA 4RDUA 4H4KC 2R0QC 1O3SA 4KJZA 2FMLA 2HPIA 3E7LA 3J7AO 4IRHA 1HSTA 3T8TA 3N4MA 1LFBA 1FBSA 1SAUA 1U6GA 2F6CA 5LGUA 2DQRA 4HAMA 5L3FA 3L2UA 2DOEA 3HYIA 6PAXA 1AOYA 2F5FA 4HNTA 2X1EA 2VKVA 3QU6A 2XRLA 1XD7A 1FJLA 1UG2A 4PJMA 4AVZA 1X19A 2GAUA 1WQ2A 1BIAA 3CC2I 2HOAA 3TW7A 1DPRA 2PEXA 5ICEA 4JK1X 1O3RA 2OA4A 2Y30A 2QA4I 5FLVA 4V2FA 2UZKA 1ERDA 3O3KA 1K78A 5F1JA 5K7FA 3LA2A 5L3BA 3WU0A 2LY9A 1JE8A 1ZREA 4LFUA 2GA2A 1T08B 2DMUA 4XIDA 2VKHA 2CW0F 2V1NA 3U1DA 5J3LA 3PFIA 3CCUI 2Y69H 2L9VA 4DBRA 1IN8A 3JRHA 5DD8A 5LEJA 4XKCA 2O61A 3FM3A 4XL9A 3TO7A 3BG7A 1Y8RB 2HQAA 2NAZA 1XB4A 4KYWA 1FP1D 1PUFA 1R9TJ 4MNUA 2GXBA 1JKPC 4HNVA 1YJNI 2YX7A 1S8NA 4X6AJ 2FD5A 2GQQA 1QO0D 2XKPA 1TZLA 1EH7A 4TV7A 4GYIA 1MKMA 1RR8C 2VB6A 2RQPA 4B8XA 2XVCA 4AIKA 1GHCA 1A5JA 1VQLI 2V9PA 1FOXA 4KITB 3GMEA 1T0FA 5D5UB 1FOKA 4LIUA 1XDSA 2R7WA 2W25A 2R7TA 5GPAA 1GUUA 3CCQI 2Y31A 1B9NA 3A4CA 3SEQA 3DEWA 1KU3A 1WJ5A 2CQXA 1RPWA 1Q1HA 3QP5A 1BJZA 3JREA 3ECOA 5JLXA 1MJ9A 4CCNA 4ANJA 2MD0A 2H1KA 3AFHA 3SDBA 1XX5A 3DF8A 1NG7A 1RI7A 3IKVA 4BQOA 3CCMI 3GFMA 1B8IA 1KQ9A 3F8BA 4BYYA 1JKOC 1DGWY 2OU2A 3LSTA 4M74A 4IHXA 4OIQF 1OYIA 4IQ4A 1HW5A 4XK4A 2QQBA 4MFEA 5CVJA 1RZ4A 1D1CA 4E4HA 4DOZA 2W48A 5KVRA 4WX9A 5IPAA 3UR3C 2RDPA 4UHTA 3CF5F 2M5WA 5J4YA 1APLC 3CO6C 4XONA 5EZHA 2GBYA 3JCUC 2NXNB 1X4OA 4L9TA 1LDDA 3N97A 5FKKA 2E1MC 1ZLKA 1R6RA 2H09A 1X2NA 2ZXJA 1JUSA 3W2VA 5JLWA 3K4BA 4XLPF 4HLYA 2ACJA 3FISA 2DW4A 2NYXA 5HDKA 1W36C 4XRMA 5M5WJ 1WI9A 5FRNA 4NQWA 2P7VB 3I64A 4E7SA 3F3XA 2CU7A 2B7EA 1T2KA 5F08A 2R7ZJ 2KIUA 3IH4A 2WTEA 2OTLI 1ZR2A 2HYGD 1JHFA 1H9GA 4F55A 2AHQA 1MJBA 2BY2A 4I7HA 3Q5FA 1FBUA 3H92A 2EA4A 2WV1A 3KEYA 1NHAA 3OR1C 5B1BH 4EJOA 5L3GA 2P5KA 3A0HC 3KZIC 4FHTA 1A35A 2VIXA 4PFOA 3K10A 1H9TA 5D5XB 2MA3A 1USTA 2XGCA 3WGHA 3IRRA 2X6WA 2A05A 3H35A 4W97A 1OYYA 4BQNA 2CSOA 4ZYHA 4CZZA 4Y7NJ 2W4SA 5H6QA 4YG2F 5DUIA 4UY8I 2P0WA 3RPUD 4M3BA 5ILVA 4UUSB 3D0SA 2CUZA 1MBGA 1IRGA 4I98B 3RSNA 4IKFA 4E7IA 2E71A 2KLOA 2BHZA 2MFZA 2CQKA 3PNYA 2IA1A 4FT8A 5EGOA 1L3LA 3DWLE 1BOAA 2X6OA 4RMNA 4F3QA 2V26A 4CDGA 3TP3A 3F22A 2BW3B 2ZC2A 1E3PA 3BG6A 4B44A 3LSPA 2R7RA 2W1OA 3I54A 1JUMA 4EGYA 4LMYA 2PJRA 1IRFA 2DMTA 2L5QA 2XSJC 3ABUA 3MZ8A 1X1AA 3A1YA 4EM1A 3HC7A 3MKWB 1S7EA 2FRHA 5D8LB 1ZQ3P 2HR3A 3E6DA 4EVIA 2BXZA 5FD6A 3VODA 1ZGAA 3DFGA 2H27A 3IWZA 2PX9A 4LOCA 1IXSB 3W6JB 3HKZA 5IP6A 3WTTC 2XGDA 4NC8A 2HOSA 1Z7LA 3GEZA 3T5XA 3E3VA 3KP2A 2IS1A 4GO1A 5KHDA 5TRDA 3M4OJ 1A31A 1F5TA 2IRFG 3SDGA 3GCMA 4A0ZA 4CCLA 2CV1A 1CF7A 3EQLF 3WTYC 3WTVC 1UHMA 2Q2EA 2CGPA 1M1EB 2RGVA 1R58A 2VUMJ 2Y0SA 3A2KA 4NNJA 3S17J 2ZFWA 2LREA 2H94A 2QLZA 2UUZA 3S16J 3H3ZA 2KISA 3BY6A 3Q9SA 4S04A 4M9SA 3BCBA 3J7YJ 1Z67A 4BHCA 1RUOA 3L2VA 3NEUA 4XICA 1J9IA 4KMFA 4IPAA 5M3FJ 4XLHA 4CSWA 1G2HA 3HOSA 2HQ5A 4DZPA 2KIQA 2QEXI 2IT0A 4RB1A 2IAIA 3OYBA 1JGSA 3L1PA 4EV0A 4C30A 4ETSA 3E5QA 5FGMA 2R7DA 1QVUA 2EV5A 2Y48A 3QODA 3CF2A 4YIRX 3I58A 1U5TA 5JR3A 2V1UA 2HTSA 4IQJA 4AUXA 1HDDC 1LPQA 4LG0A 3BTCA 4IJAA 4D9JA 3JRIA 1G3WA 4FASD 2Y9ZA 5GP9A 3ASOH 3LSKA 1A04A 1N75A 3S1MJ 3BR5A 2P7CB 4HBLA 1AWCA 2L2OA 3M8EA 2O7OA 5D6FA 2IS2A 4NDLA 3COAC 3IKTA 1T8IA 4I76A 1FNNA 3U2RA 2CV0A 4MIMA 3QQAA 3BZ6A 2HU9A 4BKXA 2LBFA 5E3LA 3FK7A 2JUGA 1KYZA 3H9JA 3DEUA 3I3LA 4X1EA 4CICA 2BVLA 5B3SH 1DP3A 1FOWA 3VYSB 3ZOBA 2OC6A 2ZFUA 2HI3A 5DEQA 2QSFX 4BE1A 2ZJRF 3ZMSA 2K9NA 1B72B 2XF6A 1W7PD 3FBNB 1Y1WJ 3ZQFA 1S7AA 4LJZF 3ASNH 1YG2A 2ZMEA 1BM9A 3HSFA 1JGGA 5IT9Z 3GZ5A 3KP7A 5BS6A 4BHPA 2GM4A 2KP6A 4BUPA 1D5YA 1XCBA 2HVRA 2HVQA 3DKXA 2CQ7A 4I01A 2XHKA 3JAMZ 1FYMA 4UVBA 1EH6A 3TO6A 3W6VA 3S8PA 3SZPA 3L2QA 3KP6A 2ME0A 3K2AA 1MDMA 4O3MA 5BQTA 3WGIA 2VQLA 2M4GA 3RYPA 1XGOA 3BQYA 4HV5A 3RZOJ 4XLFA 3ZQGA 1PJRA 1JTXA 2X1CA 2JA6J 2BZTA 3TQNA 4WF2A 5KAIC 4O6JA 3QAHA 3QPLA 1U3EM 1MBEA 4HF2A 1J2XA 2IPQX 3TL4X 2FNAA 3ONQA 1ZG3A 4RBOA 2FA5A 3JSOA 3CLOA 5HLGA 4HDUA 1OCOH 4I0AA 4B3AA 2CFXA 2VXZA 4G6TB 4L9NA 2D1HA 2L01A 2XRNA 1ETWA 2V4JC 3C2HA 3HRMA 1LUJB 3ZXSA 3F8NA 4A3CJ 2HVSA 1JHHA 4KT6A 2QF7A 3BLYA 3S3MA 1D8JA 4WXCA 3FDYA 2A5YB 4YFNF 2Z1DA 1R5ID 2MH2A 4UVCA 1ENHA 3IRQA 2DQLA 4LD5A 3BTJA 3ABTA 2VQHA 2DDAA 1QBJA 5FLXK 1I1SA 1UCRA 2C6YA 3PFYA 5D4RA 1Y0UA 2KDOA 3HPGA 4MTDA 1VQ9I 1WFXA 3WG9A 3T0YA 2NS0A 2JWTA 3QWLA 3H0GJ 1XDUA 1YQAA 4WCGA 4KN4X 1N25A 3GF2A 2HNHA 3E0JB 4G7HF 4B43A 4M3DA 5F1RA 2GIVA 3CCRI 2UWMA 2PN6A 4MGRA 4M3EA 3RQIA 3OS1A 3M1EA 4R1HA 1MNDA 4P9UA 3I56I 4QIWN 5HLTA 2X6XA 3G1MA 3F6OA 2R7XA 3RPUA 4PJNA 2EBIA 2Z9OA 4QPOA 4YIFA 2V79A 2K9SA 3DXJF 1H89C 1ZH5A 3HOUJ 2M0MA 4XLCA 2LY2A 4HYEA 2HFHA 2VBXA 3ZMZA 1X3ZB 4BACA 2EFPA 2CH0A 2PFBA 3ZQ7A 1EA3A 5FFZA 2AXLA 4KN7X 3CJNA 1S6LA 1HW2A 5H2FC 1R1VA 3MKZA 2BHYA 3WTWC 4Y3OA 1YW9A 2PMZN 1K79A 2DI3A 3WG7H 2PG4A 1FYKA 3ULQB 1VZ0A 2QQ9A 2W82A 2B9SA 2MD5A 1MJAA 3BTIA 3HEFA 3GUDA 4FTHA 2I10A 2CUFA 4OIRF 3OSFA 2NNNA 4U0YA 1KA8A 3BCAA 2XAUA 3D5RC 2RN7A 2FX0A 4PJJA 3H5NA 1V54H 3BTLA 4BL0B 2P6TA 3TBIA 3FM5A 2QQ8A 1XPXA 2E36A 4BBSJ 5AIQA 3VB2A 3BZKA 2EIJH 3GXOA 5HS9A 2L02A 2P6SA 1K7AA 3GTJJ 5LLQA 3HRTA 2LD5A 1A6QA 1IN5A 2ICWG 2WA0A 3GZ6A 2WAEA 1VQPI 4RM2A 4Q5SF 3H3VK 2LP0A 3T1BA 3WODF 1TWGJ 3FXJA 3DBLB 2JVHA 4XNFA 1R5GA 2L4MA 5LRRA 1T39A 1I6HJ 2QSHX 3X2QH 2G7HA 3G1LA 5GTIC 3G6EI 4V2GA 2CQNA 4XRFA 4XN3A 3OR2C 4ABZA 1CQTA 4XKBA 5EG0B 4NC6A 2EK5A 2L7ZA 1SFXA 4LITA 2H8RA 1VF9A 4E7ZA 4IF4A 3ZQCA 1JI8A 1U8BA 2LRDA 1MMGA 1R36A 3SZTA 3V7CA 4DIQA 3NQOA 3KP5A 2M34A 2W24A 3FBIB 4EEFG 2OZ6A 4PGHA 3BR0A 3JRBA 2UV1A 2XPUA 5FKNA 4A0YA 1J59A 2DN0A 2EFNA 3B6AA 4G6DA 4MTEA 4E7HA 2R7FA 3A01B 2JN6A 2EFWA 1MW7A 2VASA 5DUKA 4C2MJ 1BW6A 4D1QA 3CJQB 3KIOA 2YU3A 3PJRA 3OYGA 2X9DA 1S3JA 3B6CA 1IDZA 5CJ9A 1Y6IA 4M6YA 4U7BA 3N05A 3CCSI 2L0KA 4Y17A 4BNCA 5F0FA 3FMRA 4IOAF 5E8IA 1YW7A 3KZYA 4RB3C 3OL3A 4C2TA 1LE8A 2K9MA 3HTUA 4EQQA 2KRCA 1JT0A 1YW8A 4UVAA 4CHUA 2R5ZA 2QWWA 1XC5A 2GZWA 1B9MA 2DBBA 4ZYDA 5E20A 3LAPA 2NVTJ 3TO9A 1BW5A 1YRNA 4FQGA 2DYRH 4KFCA 2QENA 4M71A 1W5SA 4F91B 2Z16A 3CC7I 1ZYRF 1S9HA 1R71A 2KRHA 4HNUA 3WTXC 5L3DA 1P4WA 1WCMJ 4KIFA 4XR6A 1KZHA 3S1QJ 1S7OA 1P4XA 1YIJI 3ZQIA 3MZHA 3HUGB 2XDVA 4IEJA 2KZGA 3K2ZA 1D0ZA 3G1OA 3SFZA 3CCJI 4RGSA 1MMDA 1IN4A 5CLSA 3JRCA 3QPTA 3S2DJ 4D5CA 3S14J 2OAZA 2DPUA 2F5DA 1FZPB 1FPQA 5ICGA 2FOKA 1MNMC 2AQFA 5HNFA 2VXDA 4UV8A 2R7UA 1TWHJ 4G7ZF 1GLNA 2NS8A 4BGDA 1IO2A 2LF7A 5F27A 1DDNA 2EQRA 1P92A 3GX4X 2NVYJ 4M6VA 2WY8Q 4IXAA 1RESA 3GBGA 1AKHA 4L18B 2GA1A 2OCEA 1YX3A 2MH9A 3DTIA 3LFKA 1ZKGA 2M30A 2X51A 1EJ9A 2R93J 2XKOA 4AM3A 2LKSA 2CMPA 4HLXA 2XV4S 3WHCA 2AXTC 2BXYA 1HOMA 2BYVE 2HS5A 4ZDPA 1OJLA 3E97A 4Q4ZF 1IZ1A 2ZNZA 4I09A 4KA4A 2IVMA 2ISYA 2M0CA 3L00A 5DM6F 1B4AA 2HDDA 1IN6A 3GTOJ 1YOVB 2DA1A 5J1YA 2Z5UA 4RLQA 4ESFA 1FX7A 3GFIA 1W5TA 4C9YA 4P5OA 3D5LA 5DCMB 3KPHA 2RAEA 3R60A 3RQ4A 4BJTA 2LYCA 1QZYA 3DCFA 3LSIA 5BMZA 1R4NB 2AQEA 1Z6RA 3M8JA 2L9NA 4M3FA 1V5FA 3HRUA 3GTPJ 3C1DA 3Q0UA 3QP6A 3FXMA 3W2AA 5E3NA 2XSDC 3K1PA 4RLFA 1OFCX 3BC8A 2ESHA 3C2BA 2FJ1A 5BPIA 2QBYB 2G9WA 3CLQA 4AYBA 2XB0X 1IV8A 2HPMA 1PYVA 4AWXB 1FLIA 5BOXA 4MEXF 5LHIA 3ZN0A 4FE7A 3OS2A 2XAJA 1SMYF 2WBMA 2E7XA 3KEQA 4RGXA 4ZTJA 2IGNA 2VQCA 4O5VA 2ME6A 3A0BC 2Q1ZB 5E3OA 2J5PA 5K7ZA 4FX4A 2MSYA 3FHNA 3OYEA 1K78B 3VYTB 2I5UA 2IBDA 3EUKL 3U1KA 3CCEI 2UXNA 4RA2A 3FF5A 5J40A 4AIDA 3CMEI 2K85A 4Y15A 3OOUA 3PO2J 1BI1A 2VOPA 1TNSA 1V55H 2VN2A 1JKRC 3AL0B 3GVAA 2M9HA 3BR1A 4A0XA 4HOBA 2OUMA 5E1XA 5CYVA 1QRYA 4PFPA 1QU3A 1VTNC 1UMQA 3I71A 4PZJA 1GXQA 1W36D 3QYBA 4HEA2 2BOLA 4A2UA 1MBFA 1PUFB 3ZQLA 1MSEC 2TDXA 3V8JA 1YO5C 1HA8A 4XKWA 4D7NA 1NK2P 1GVJA 2H1LA 2JUCA 4QLCU 4ZC3A 1OCCH 3PSIA 4PUSA 4J00A 3J80K 3OYHA 2JMWA 2IGKA 3S32A 2DLLA 4BXFA 2A69F 5CQEA 2NVQJ 1B1BA 1PVEA 1UHWA 2R3SA 4JP0A 5FKLA 2OQRA 1LKXA 1JT6A 4BH9A 1BBYA 3TEDA 3QRFF 1XMAA 2FUG2 3PM1A 1OQYA 5KNLA 4L5JA 4DYCA 3F0CA 4ZZLA 5TISC 4I02A 1JJ8C 2KPMA 1PP8F 4P9FA 1BR4A 3ZMUA 3R61A 4C2UA 3IH2A 5M5YJ 2NVXJ 1SVOA 4HRIA 5A2QK 4XLNF 4B48A 1QPMA 1REPC 1FT9A 4A3JJ 3BT9A 3I59B 4R79A 3C18A 2DFIA 2ELKA 5E79C 5AIPA 1ETKA 1MMNA 3H9GA 4G12A 1WI3A 3EPZA 3CESA 2EZKA 4D5FA 5LBQA 3OOPA 1GVDA 2VE8A 3HJEA 4IRGA 5HDGA 5M3MJ 4P55A 3GW2A 1IJWC 4ENJA 2DCEA 2BW3A 2HYJA 2EH3A 3DBHB 5F0CA 2OCCH 1DU6A 4FISA 1QZZA 5E18F 2R5YA 2VI6A 1WKMA 2X48A 3RTRA 1MSFC 5LHHA 2FE3A 1S72I 3ABMH 1YYVA 2TRTA 2X4HA 1R1TA 3DKYA 5D5WB 1P4AA 1ULYA 1K83J 3CDLA 3I4MJ 3DLLF 1E3HA 3GTMJ 3F72A 2A07F 4F52A 2DT6A 3C3WA 5J8FA 2FEZA 3FMSA 3VPRA 3HPHA 2EIKH 2IGOA 4IL6C 1O7FA 2RKHA 1JXSA 2BEOA 3HOZJ 2K5CA 2CO5A 4LLGF 4HG2A 2KMUA 3ZMVA 5EYRA 3RDIA 3OIPA 5FLXZ 5F6FA 5ICCA 3F23A 1V5GA 2QCOA 1BR2A 2V9KA 2VC0A 1H0MA 3ECHA 1EH8A 1UG0A 2DJIA 4EJTA 4PCQA 4U0WA 3HBLA 4P1WA 4A69C 2XB5A 1ETYA 3I9V2 4PDKA 1W0TA 2MGQA 3HGGA 3QPSA 4Q48A 4ZJZA 4ENNA 2M7AA 4AYBN 4ZTFA 1ETQA 3PUBA 1OYWA 4QTRA 3UKGA 3QPHA 5K1YA 3LSRA 2VLAA 2WWYA 2EILH 3WU2C 4CGZA 4MLOA 2ZSHB 2E2HJ 3G2BA 2HEOA 2KRFA 3TW6A 1USSA 2IS6A 1I5ZA 2M8EA 1SAXA 1LJ9A 1SD5A 3RKYA 4OMZA 4A3KJ 2MC3A 2K86A 2HDCA 1SFEA 4ZYGA 3F8FA 1ZARA 1TNTA 3REOA 3K4MA 2XGXA 2VC1A 1POGA 4CA0A 1OR7C 1T38A 1XSXA 2VJ4A 1RRJA 2DFHA 3RI4A 2PMZA 4E7LA 1X4PA 1I3AA 2KL4A 3PNTA 3EUHC 2Z33A 5J8CA 1DU0A 3EYIA 2COBA 1FIPA 4A3DJ 4MHGA 1UHSA 2LC2A 2K4JA 2R4GA 4RM3A 4M9ZA 3M07A 3R6SA 1CF7B 1DP7P 3ERMA 2DK8A 1WHUA 2Q2EB 2ESNA 2IXSA 2VL8A 3ESWB 4R8HA 1FC3A 1RC9A 4X0GA 4CCOA 2A6EF 2ZCWA 1B72A 4EJVA 2JA8J 1VQKI 1MMAA 2O0YA 1TQIA 1XG1A 3HDDA 3OYJA 3V42A 3OYIA 3I53A 1Y8QB 3ZRGA 3MAJA 3HOYJ 2KJCA 1Z3XA 1ETXA 1OCZH 2CJJA 4UXNA 5DM7F 2G0EA 4KISA 3K9TA 1Y56A 1E17A 3EUAA 2EFOA 5JI6A 3NWTA 2WAQA 3K4JA 2M1BA 3FX3A 4UUTA 1I39A 2JA7J 5HNHA 3HL2A 5KK1A 3TMOA 3P9KA 1Z1DA 4HX4A 3FXRA 2VBYA 3LOCA 3FHZA 4XBFA 3HM5A 1F36A 4N4NB 3MZYA 2MG4A 3O8GA 4K2EA 2RC4A 1ODDA 3LSGA 5GAEJ 1D0YA 4DYQA 1TQMA 4GGGA 1ZRCA 3C2GA 3F8MA 3MD2A 2CS3A 3PIPF 4YEJA 5J47A 1R23A 1W1WE 1TBXA 4BAYA 2K27A 1U8RA 2JPBA 3CUQC 3KFWX 5EEHA 4ESJA 4UV9A 2BV6A 4I2OA 2VJJA 3CCVI 3OWTA 4UUVA 4ENKA 2BY0A 3H1CA 1BA5A 2K40A 4DQ2A 2M3AA 3IAM2 2DTRA 4H0EA 5LRSA 4ZZDA 2MLKA 1SD6A 5TJJA 3VOEA 3GLLA 5E3MA 4JX5A 5L3EA 2VT2A 3MCZA 4PSXA 3BZCA 1TC3C 3VEPA 1FEXA 2CFOA 4UNOA 3RKXA 4CYCA 3VFZA 3K70D 4BQAA 3J81Z 1J7KA 4DBQA 2ZMEB 1I27A 1F9NA 1DPUA 2B0LA 2JA5J 2E5NA 1HW1A 2Y75A 4ENMA 1WWXA 2FBHA 2JTVA 2BVMA 2ZB9A 3MMYB 2HOEA 3BPXA 1R7JA 3HOVJ 1QPIA 1D0XA 4HDVA 3S93A 5LGNA 1H88C 1Y39A 2JT1A 3JTGA 4B4CA 4BDZA 4ESBA 4IHSA 4RB2C 2DA4A 1BJAA 2STWA 1ZG1A 2LKPA 2PJPA 1ETOA 4XLAA 1BI3A 3T8RA 5ILSA 1YX5A 3CCYA 4BY1J 1IUFA 3PIOF 4IHYA 4MQVA 1HKTA 3JTHA 2DA3A 2FBKA 4MQ9F 4GFBA 4XQFA 3LA3A 4DJAA 5JFRA 4NBQA 3ZMDA 2DK5A 3K69A 2HQRA 2XASA 1EV7A 1G8XA 2WB1N 5B1AH 1VQ7I 2VBWA 1XCVA 3TOAA 1L0OC 1ZGWA 4G8XA 1ZRFA 4HW0A 2GWRA 3Q9VA 3Q0VA 4A6EA 2H6CA 3KYLA 2L54A 2DT7B 4CXFA 3R0JA 4WK8F 1Z77A 2M2EA 1OKRA 4L9VA 4UB6C 5FRMA 1QQIA 4Y13A 2AS5F 3FMQA 4HPQA 3NARA 3FWEA 1Z6TA 4A6DA 2R7QA 1EF4A 2A6HF 2HXOA 1VQMI 3QYFA 1HC8A 3CQZJ 4RAGA 4NC7A 3CZ6A 4FCYA 4JX6A 4G6QA 2MYSA 2KJBA 3V8KA 3BR2A 5C3EJ 1U9NA 4YIIA 1X58A 3DEEA 4G7OF 5H20A 3NRVA 3B02A 3OYKA 3AL0C 3CP8A 9ANTA 1ZAOA 3RYRA 3H36A 2DODA 1RIOH 2CUJA 2F4IA 1LB2A
chains in the Genus database with same CATH topology
1VQ5I 3CCUI 3CCLI 1VQ9I 1VQ8I 3CC4I 1VQ6I 3G4SI 1YJNI 3G71I 4UY8I 2FOWA 5DM6F 3CCRI 3I56I 3I55I 5JVGF 2ZJPF 5GAGJ 3J7ZI 1VQLI 2E35A 1FOXA 1ACIA 1FOWA 3CJTB 4IO9F 3CCSI 1Y39A 3CCQI 2ZJRF 4IOAF 5GAHJ 2ZJQF 2E34A 1VQ4I 3CD6I 1VQKI 3PIOF 1S72I 1QA6A 3CCMI 4V19K 1YJ9I 1VQ7I 5DM7F 3CC7I 3DLLF 1YI2I 2K3FA 3CCEI 1YIJI 2OTJI 3CMEI 2E36A 4IOCF 3CF5F 1VQNI 1YJWI 1FOYA 3CCJI 5GADJ 5GAEJ 2NXNB 2JQ7A 1YHQI 3J7YJ 3CMAI 1VQPI 1VQMI 1HC8A 3CC2I 1VQOI 2H8WA 3PIPF 2QA4I 2QEXI 3G6EI 1YITI 2OTLI 3CCVI 1MMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 I;  3CCU I;  3CCL I;  1VQ9 I;  1VQ8 I;  3CC4 I;  1VQ6 I;  3G4S I;  1YJN I;  3G71 I;  4UY8 I;  2FOW A;  5DM6 F;  3CCR I;  3I56 I;  3I55 I;  5JVG F;  2ZJP F;  5GAG J;  3J7Z I;  1VQL I;  2E35 A;  1FOX A;  1ACI A;  1FOW A;  3CJT B;  4IO9 F;  3CCS I;  1Y39 A;  3CCQ I;  2ZJR F;  4IOA F;  5GAH J;  2ZJQ F;  2E34 A;  1VQ4 I;  3CD6 I;  1VQK I;  3PIO F;  1S72 I;  1QA6 A;  3CCM I;  4V19 K;  1YJ9 I;  1VQ7 I;  5DM7 F;  3CC7 I;  3DLL F;  1YI2 I;  2K3F A;  3CCE I;  1YIJ I;  2OTJ I;  3CME I;  2E36 A;  4IOC F;  3CF5 F;  1VQN I;  1YJW I;  1FOY A;  3CCJ I;  5GAD J;  5GAE J;  2NXN B;  2JQ7 A;  1YHQ I;  3J7Y J;  3CMA I;  1VQP I;  1VQM I;  1HC8 A;  3CC2 I;  1VQO I;  2H8W A;  3PIP F;  2QA4 I;  2QEX I;  3G6E I;  1YIT I;  2OTL I;  3CCV I;  1MMS A; 
#chains in the Genus database with same CATH topology
 3LNQ A;  1PDN C;  4E70 A;  5HOO A;  2ECB A;  4DGW B;  2WAQ N;  2F2E A;  2GXA A;  1MNE A;  2XPV A;  2BBY A;  2XF5 A;  1BC8 C;  3BP8 A;  3M9A A;  1K6O A;  1VQ8 I;  1G3S A;  1G6N A;  1YS7 A;  2LH9 A;  1TT0 A;  4XRS A;  3JRA A;  4LIV A;  2RNG A;  3CP2 A;  2NOJ B;  4BDY A;  4ASN A;  1FSE A;  4OOI A;  1X1D A;  1F4K A;  3A01 A;  1Z91 A;  4XN0 A;  1ZGJ A;  1GDT A;  1MH4 A;  4MO7 A;  1Q1V A;  1HDP A;  4I99 C;  2MAB A;  3H5R A;  1T0F C;  5HLI A;  1OPC A;  4PGG A;  3OYN A;  1P9Q C;  2E35 A;  2RVC A;  4J19 A;  1IDY A;  4I6Z A;  2JRM A;  2BY3 A;  2EA2 A;  4GCV A;  3V7R A;  2VOD A;  2YU9 J;  2YX4 A;  1VI0 A;  5LEK A;  1WVR A;  4YFK F;  3DV8 A;  2EV6 A;  2XUB A;  2IJL A;  2E34 A;  1XGM A;  4GXO A;  1D5V A;  4L9J A;  2L7F P;  1WSU A;  3BG3 A;  2OBP A;  2HZT A;  3KZZ A;  4BJ5 C;  2MLG A;  2STT A;  4A93 J;  2YUS A;  4N4O B;  2CRG A;  4V19 K;  5FFX A;  2HYF A;  3JR9 A;  3I4N J;  2ISZ A;  5C4J J;  5IT9 K;  1WRJ A;  1SD4 A;  4AIJ A;  1BI2 A;  1D3Y A;  2ZXI A;  5E1Z B;  2V6E A;  1ON2 A;  3KCC A;  1LEA A;  2A3S A;  3ZN1 A;  4CCK A;  3DQV C;  4XSX F;  1YI2 I;  1IRZ A;  2PQ8 A;  2QGU A;  2QSG X;  2VQG A;  5HS8 A;  3QOE A;  2LR8 A;  2P5V A;  3HXL A;  3KEO A;  4IX7 A;  4OIP F;  4DNC A;  2XIG A;  3KLN A;  2O8K A;  1O57 A;  3HUG A;  3W3C A;  3U9G A;  1YJW I;  1OLT A;  1U9O A;  2ZKZ A;  5DDG A;  1SFO J;  3WGG A;  2F48 A;  2WAD A;  4M73 A;  3RKW A;  3CMA I;  3ZR8 X;  3A03 A;  2XAF A;  1BN5 A;  3KYC B;  2ZNY A;  3S2W A;  4A3I J;  5D4S A;  1E2X A;  1UB9 A;  2JA2 A;  4LK1 F;  3DU5 A;  5HDN A;  2L7K A;  2IEK A;  2BE5 F;  1H8A C;  3IP4 B;  1IGN A;  3P5J A;  4B3X A;  1X1C A;  2LLK A;  2BY1 A;  4C3H J;  2XAG A;  3CUQ B;  4HX7 A;  2E2J J;  5BNG A;  4ZYE A;  2PI0 A;  3FKI J;  4F7Z A;  3ZP5 A;  5J4V A;  3BR3 A;  5IT3 A;  5EZG A;  1ZN2 A;  2LF8 A;  4RB0 A;  1VQ5 I;  4U88 A;  5IYC J;  2GXG A;  4JOM A;  3CCL I;  3BOQ A;  3LSM A;  3CMY A;  4AC0 A;  1LE8 B;  3GFJ A;  2HKO A;  2W84 A;  3E1S A;  3G4S I;  3J7A Y;  2QYO A;  4IHV A;  1I3Q J;  2O3F A;  1SVM A;  3UNG C;  1IW7 F;  2BGC A;  1ZTR A;  2MBF A;  4JYK A;  2VBZ A;  5LFA A;  4GRI A;  1P6R A;  2NVU B;  3HZJ A;  1WH5 A;  3LMM A;  4PJL A;  3W6K B;  5D8K B;  1W7P B;  2ZO4 A;  3IV5 A;  2LY1 A;  4BEH B;  5C4X J;  2O03 A;  1ONV A;  5DCM A;  3BRO A;  3LAJ A;  2CUE A;  1RR7 A;  1LFP A;  2LG4 A;  3HOT A;  1ZEL A;  2IW5 A;  4OU0 A;  3PO3 J;  3F6V A;  5CVU A;  1ZG5 A;  4M72 A;  3RIR A;  3VSK A;  4BXU A;  3LSJ A;  1Z0X A;  2K9Q A;  3JRF A;  1Z3Y A;  4Y4R A;  1Z7U A;  3QOP A;  5CVI A;  4MFD A;  1J75 A;  2VPL A;  5K5R A;  2QBY A;  2HXI A;  3K0L A;  1TW2 A;  1NTC A;  3SEZ A;  5ED4 A;  2LMD A;  3ZQQ A;  3PSF A;  3VYU B;  1T56 A;  3F9K A;  3HIF A;  3OYA A;  5DTD A;  3SXY A;  3LWF A;  2ETH A;  2ELJ A;  4JBA A;  1TWC J;  3FXK A;  3TKY A;  4C3J J;  3AG3 H;  3ABK H;  1P7J A;  4CO8 A;  1XGN A;  2P4W A;  4U87 A;  2UXX A;  4Y33 A;  2I8D A;  4KIC A;  2OTJ I;  1AKH B;  3ZMT A;  4HV6 A;  2ADU A;  3FIW A;  5AON A;  4RGU A;  2XGE A;  2ID3 A;  1LVK A;  1FMW A;  3MN2 A;  4EM0 B;  4BJ6 C;  3QU3 A;  2D1V A;  5ERI A;  1K61 A;  2EZH A;  2H8W A;  5GPC A;  2CW8 A;  4Z2Y A;  2YR2 A;  2WY7 Q;  3M3Y J;  2QZ8 A;  5DYM A;  1IG7 A;  2E2I J;  4L0Z B;  2DOA A;  1YIT I;  3S1N J;  1U5T C;  3SYT A;  1IC8 A;  3OYD A;  1MIJ A;  1B6A A;  2KIF A;  1QVT A;  5DD4 A;  5C44 J;  2FU4 A;  2F5E A;  3DLA A;  1ZR4 A;  4RGR A;  3TDZ C;  3GTK J;  4L5E A;  1WJB A;  4QWQ A;  2DJN A;  2OD5 A;  2FQ4 A;  5IP7 J;  2VE9 A;  3BJA A;  2E1O A;  3GTQ J;  3S3O A;  2OJE D;  3G71 I;  3HSE A;  4L0Y B;  3CMM A;  4LK0 F;  4PSW A;  5JHU A;  2JZY A;  5EEA A;  3G3Z A;  2ZBK A;  4F93 B;  2R92 J;  4ITV A;  4YEL A;  2KFD A;  2H6B A;  2Z3Y A;  1OMI A;  3GWZ A;  3I55 I;  3K6G A;  1UZC A;  1B59 A;  5KAF C;  1R22 A;  2X0L A;  3ERE D;  5E17 F;  3CO7 C;  2WAF A;  3DU6 A;  4RAF A;  1V4R A;  3I59 A;  3J7Z I;  2JPC A;  2CV2 A;  2ZXW H;  3HHH A;  1ACI A;  3H5A A;  1E3O C;  2ZSI B;  4IO9 F;  2FF4 A;  3BJ6 A;  2YSR A;  3B73 A;  2VT3 A;  3HOX J;  1PP7 U;  1ZRD A;  4IHT A;  5J6X A;  3P9I A;  1KQ0 A;  3OSG A;  3JSP A;  2ZME C;  5JHF A;  3CD6 I;  1Z05 A;  1YLF A;  4CYD A;  4UUS A;  3QYE A;  1UFM A;  1YS6 A;  4RAZ A;  1MBJ A;  2F4O B;  3WTU C;  1B8I B;  4M6X A;  5B66 C;  3GYH X;  4XOR A;  3CUO A;  2M7B A;  2P5L C;  1FP2 A;  2LFB A;  3DTK A;  1IAW A;  2JK3 A;  3AG1 H;  2K3F A;  3L2W A;  4IRI A;  2LTP A;  4JQF A;  3FZV A;  3GZN B;  4BE0 A;  1MD0 A;  2EPF A;  1QGP A;  4L5I A;  3TDU C;  3I4P A;  3O8H A;  1W5C C;  1AU7 A;  1YE9 A;  1GT0 C;  1J09 A;  2FQ3 A;  4IOC F;  3ISP A;  1VQN I;  2K7L A;  1FOY A;  2V7F A;  2DA2 A;  2DFE A;  2FBI A;  3VYR B;  5GAD J;  2B63 J;  1DGR M;  3FXO A;  2CYY A;  3A02 A;  3HG9 A;  2ID6 A;  1TWF J;  1IN7 A;  3MQ0 A;  2V6C A;  2VON A;  4NQW B;  3V7S A;  1U2W A;  2Z2S B;  1TWA J;  2LK2 A;  2VJ5 A;  2HTJ A;  1G3T A;  2XPW A;  3MFK A;  2QKM B;  3JW4 A;  1YIO A;  1X1B A;  5JVT A;  1MMS A;  1WPK A;  1N77 A;  1RKT A;  4D7M A;  1A6I A;  4HSR A;  5M5X J;  5ICF A;  4S05 A;  2L7M P;  1HKQ A;  3OMY A;  4XSZ F;  3AAF A;  2X1D A;  4CUG A;  3RJP A;  1IV6 A;  2RQQ A;  1FWZ A;  1U78 A;  2KDZ A;  5HLH A;  4EJW A;  5IYD J;  3DP7 A;  2ECC A;  3ABL H;  2LDU A;  3PQJ A;  5ILU A;  3OYF A;  3JRG A;  4J01 A;  1GXP A;  1UAA A;  3E5X A;  1FTZ A;  3CC4 I;  2E7W A;  2MW8 A;  2O8X A;  1UEL B;  2DU9 A;  2K9L A;  2OV7 A;  5F04 A;  5J1U A;  1HXD A;  2EZI A;  2R5Y B;  2LNB A;  1T33 A;  4CCM A;  2HQN A;  2DMN A;  1TQP A;  3PL8 A;  5K7H A;  4A3B J;  3OV8 A;  1OIS A;  1NG6 A;  3KX2 A;  2GIZ A;  1X3W B;  3RKQ A;  2LOO A;  4BXX J;  2L3D A;  4OWR B;  2YS9 A;  1K6Y A;  5EGO B;  5CKT A;  3ZPL A;  4LLL A;  1LDK B;  2J5O A;  4CH7 A;  3D5S C;  1D8K A;  1HCR A;  3WTS C;  3OS0 A;  4PJ0 C;  3HOW J;  4OMY A;  1MBK A;  1XMK A;  2WB1 A;  2DT5 A;  2PJR B;  3F21 A;  5LD2 C;  4HST A;  4KNY A;  2IGM A;  1T95 A;  4GYG A;  2E1C A;  2FMY A;  1R5H A;  1N78 A;  1HBX G;  2YPR A;  4ON0 A;  3SZG A;  3FXU A;  3BPV A;  5TGT A;  3LFU A;  1SD7 A;  2VKD A;  3WU1 B;  4E6K G;  2QM3 A;  2CQQ A;  5F0H A;  1NK3 P;  2NS7 A;  4BE2 A;  1O4X A;  3L9F A;  2D5V A;  2A61 A;  2FNP A;  1O3Q A;  1LQ1 A;  2IA0 A;  5BPD A;  2XRO A;  4HX8 A;  2A68 F;  2ZJ2 A;  1JUP A;  4G9Y A;  1KQ8 A;  4RS8 A;  1P2F A;  5IYB J;  3K7A J;  3V4G A;  1SFU A;  3BR6 A;  1LDJ A;  3LQR A;  3HRS A;  4C3I J;  3RCO A;  3W2W A;  2K4B A;  1SC7 A;  4HZF A;  2VKE A;  4A12 A;  2COM A;  1HF0 A;  4OIO F;  2O9L A;  5EDN A;  4DZJ A;  2D45 A;  3MWM A;  2LVS A;  4D0P A;  1PUE E;  2EB7 A;  4N9H A;  1IF1 A;  3VSL A;  4BQQ A;  1VQO I;  3GTL J;  3RZD J;  3OYL A;  1U0J A;  1O7L A;  2F4M B;  3AG2 H;  2DA6 A;  1OCR H;  3TGN A;  1MGT A;  5FD5 A;  4Z6Y A;  1D1B A;  2GOX B;  1R49 A;  1WJF A;  2JJ7 A;  2R7O A;  4KIB A;  1U5T B;  4A3M J;  3K4K A;  1G3Y A;  4I0B A;  1FMV A;  3EET A;  1Z9C A;  5FKO A;  2DFF A;  4LG0 B;  3K1N A;  4EAT A;  1Z21 A;  1DUX C;  2KQR A;  2KHM A;  4XOP A;  1S29 A;  5DS9 A;  1YTY A;  4W1U A;  2E60 A;  4ZDO A;  4CCJ A;  3H9Q A;  1T6S A;  3BDD A;  3PUF A;  2FXA A;  3IC7 A;  2HZD A;  2OPT A;  2X85 A;  1TL8 A;  3I5U A;  4LB5 A;  3IWF A;  2EZL A;  3F8C A;  4HA8 A;  2FOW A;  2QUF A;  2PMU A;  2EWN A;  1VND A;  1Y0N A;  1WJD A;  4LGW A;  3P7N A;  4FX0 A;  3LA7 A;  2PBI A;  4KT5 C;  1ORK A;  1XN7 A;  3CDI A;  4BU2 A;  2LBF B;  2Q8K A;  2PLY A;  2EJR A;  4ZYA A;  4F92 B;  3E6M A;  5GAG J;  2DA5 A;  4EGZ A;  4EJU A;  4XKV A;  5F64 A;  4B47 A;  1W0U A;  4A3E J;  2F5V A;  2NOG A;  2QVO A;  2IS4 A;  1IXC A;  1ON1 A;  1KU7 A;  2P8T A;  4XLE A;  4XOT A;  3CJR B;  2E1N A;  1FYL A;  1AHD P;  2IP2 A;  2V1D A;  1LVA A;  4HQM A;  1XGS A;  3SFI A;  3DTE A;  1KON A;  2XF7 A;  2DXI A;  3BG9 A;  3FXL A;  1R1U A;  1BR1 A;  4IZZ A;  3OY9 A;  3ZCO A;  1KU2 A;  2M45 A;  4DYR A;  3GO5 A;  1JTY A;  2JRT A;  3FXQ A;  2V9V A;  3DKW A;  3OL4 A;  3R0A A;  3BJO A;  1JKQ C;  3HB9 A;  4A3L J;  4A3G J;  4A3F J;  1QHG A;  2Y9Y A;  4KIG A;  5GTH C;  1F1Z A;  1FIA A;  3G73 A;  2VOO A;  1ZHF A;  2HGC A;  1YJ9 I;  1RET A;  2ELH A;  4LLN A;  2E1M B;  3KYD B;  3MEX A;  3GLX A;  5J1R A;  1MH3 A;  1R4M B;  4XM3 A;  1W4M A;  2MC4 A;  3K4N A;  4QPQ A;  2F5C A;  2CWE A;  2KKO A;  2QKL B;  3K4L A;  4N0B A;  1MDM B;  4NB5 A;  2W00 A;  5LHG A;  1KGS A;  3AKZ A;  3FKJ A;  3IHU A;  2NNY A;  1FBQ A;  1F43 A;  5K5Q A;  4WXD A;  2O5R A;  3HKZ N;  1MZB A;  1I6X A;  1I1G A;  4XRS G;  2E5Z A;  4EM2 A;  1TW3 A;  1X3U A;  1YHQ I;  2M8G X;  4KDP A;  5HOD A;  1JJ6 C;  1FTT A;  2DO7 A;  4IVN A;  4LG3 A;  5HS7 A;  2EIN H;  4CYC B;  4HQE A;  2VJI A;  3DBR B;  3OIO A;  1MBH A;  4M3G A;  2JSC A;  4A5N A;  3O6B B;  2Y0S N;  3SHF A;  5D5V B;  1LNW A;  3K1M A;  1R00 A;  3K70 C;  2W57 A;  5L3C A;  2Y2Z A;  4B1R A;  3EYY A;  2L9S A;  1TLH B;  1Y1V J;  5CQG A;  4KMU X;  2KIM A;  5CVR A;  1YFH A;  3R4K A;  2GLO A;  1KYW A;  1C0W A;  3WE2 A;  1BOB A;  5FRO A;  1WZ2 A;  2L4A A;  3DPL C;  3KE2 A;  3MKY B;  5LGT A;  4OAY A;  2DAO A;  4II2 A;  1WJC A;  1KU9 A;  2QQA A;  3LL7 A;  2W7N A;  3IL2 A;  1VQ6 I;  5H6R A;  4BHB A;  3C7J A;  1HSJ A;  1NH3 A;  4HF1 A;  3BWG A;  2E19 A;  3ELK A;  1J5Y A;  2RNJ A;  4BY7 J;  2HOT A;  3M8F A;  5FJ8 J;  4Q47 A;  5DCF A;  1GV5 A;  4G94 A;  2VPR A;  3S15 J;  3SQN A;  2TCT A;  5FKM A;  3I0T A;  3PNV A;  1BIB A;  2DPD A;  1E0E A;  3S1R J;  3TOB A;  5EG0 A;  1BI0 A;  1P7I A;  2O6G E;  1OR7 A;  3BG5 A;  2ZJP F;  4WWC A;  2KT0 A;  2K3P A;  1QNT A;  1QZE A;  3EUH A;  1OCT C;  1FSH A;  2LSO A;  3KLO A;  1LFU P;  3PQK A;  1FY7 A;  2L9R A;  2IA2 A;  2P81 A;  2XC7 A;  2HWV A;  2XAH A;  4NHJ A;  5E1W A;  5EJC A;  2RRE A;  4LB6 B;  4MEY F;  4N9I A;  4GDF A;  1ETV A;  3CTA A;  1X2M A;  1VQ4 I;  2M87 A;  2LKX A;  3H0D A;  2V1X A;  2DDB A;  2G7U A;  1EKE A;  3HHG A;  1J0R A;  1QA6 A;  5EEG A;  3GTG J;  3Q0W A;  3SJM A;  3VWB A;  5CVV A;  1X1P A;  3U21 A;  1A36 A;  4FET A;  2DOF A;  4HF0 A;  4PK4 A;  3WHB A;  1BC7 C;  1SAN A;  2ZXH A;  1SMT A;  3H3U A;  4UB8 C;  1TP4 A;  3L2R A;  4CZC A;  3ML6 A;  1IRX A;  5IOY A;  3S3N A;  2DA7 A;  1XMX A;  1WGX A;  1OCP A;  1AA7 A;  1CGP A;  1WH7 A;  1G4D A;  1SVL A;  3EDP A;  1RUN A;  1LEB A;  3IUO A;  5FO5 A;  4YFX F;  1ZLJ A;  3DPT A;  3VDX A;  4KUM A;  3OIQ A;  3L2C A;  2NRA C;  4OIN F;  2A6T A;  2CW7 A;  3BQZ A;  4QSH A;  4ZH4 F;  3KET A;  2JQ7 A;  4EMS A;  2A5W A;  1SEU A;  2RV8 A;  3D1N I;  2W85 A;  2D2W A;  2M4K A;  1IXR C;  1HQC A;  3MKL A;  3K4C A;  4AU7 A;  4RAY A;  2OZU A;  2WC2 A;  4XMY A;  3JAM K;  3OYM A;  2OF7 A;  1XTA A;  5IY5 H;  2EFQ A;  3L09 A;  5FB2 A;  2JVG A;  2HKX A;  5B5E C;  1BL0 A;  4AD9 A;  4JX4 A;  4DW6 A;  3M7G A;  3NAU A;  3CDH A;  3J80 Z;  1WJE A;  1HKS A;  3KP3 A;  3CUQ A;  1XSV A;  2EV0 A;  2HDW A;  4Y52 J;  3FK6 A;  1XSD A;  4BBR J;  3E5U A;  4E7J A;  1TTY A;  2K02 A;  5KCM A;  1V5E A;  3O2P E;  4OAZ A;  3NWS A;  1IUY A;  1T98 A;  3P9C A;  4II3 A;  3LSH A;  1S5L C;  1K4T A;  2DYS H;  1RKW A;  2JSP A;  5E8G A;  3JRD A;  3MVP A;  2AO9 A;  2EIM H;  2R7V A;  4ZDL A;  4IHW A;  2FSW A;  5DV5 A;  4BS9 A;  3ZQH A;  3LQQ A;  5A2Q Z;  2PMH A;  1UJ8 A;  4AVP A;  2KZV A;  2N8G A;  3J81 K;  3TP0 A;  4AIH A;  5HVQ C;  1GV2 A;  3AG4 H;  1D1A A;  5D6E A;  4YRV A;  5JVG F;  3Q3S A;  3L7W A;  3V8L A;  1W7P A;  1V3F A;  4B09 A;  5FLM J;  1XS9 A;  3HTS B;  1WJA A;  4BEH A;  2DMP A;  2Y0M A;  3HGY A;  5K5O A;  5CPR B;  3CJT B;  4E7K A;  4FE4 A;  1ITY A;  2CG4 A;  4A5M A;  2GOM A;  3OYC A;  4S0H B;  1O3T A;  3ROU A;  5GAH J;  2ZJQ F;  3GFL A;  5IOZ A;  3HSR A;  3S2H J;  3WE3 A;  1G59 A;  3E6B A;  2Z99 A;  2R5Z B;  3E6C C;  2R7S A;  1QHH D;  1STZ A;  4U7D A;  2DTZ A;  1DQU A;  3KP4 A;  3M1C A;  3IAS 2;  4P96 A;  1RNL A;  2OQG A;  2WV0 A;  5EF6 A;  1YRN B;  1I50 J;  1VFC A;  4NUB A;  5IP9 J;  1ZK8 A;  4WXH A;  3DPU A;  1TT5 B;  2DMQ A;  3RPQ A;  2XAQ A;  4M9X A;  2X6Y A;  3ZGK A;  1HLV A;  2Q0O A;  3WTZ A;  3IH3 A;  4U0V A;  1K4S A;  1SFK A;  4RDU A;  4H4K C;  2R0Q C;  1O3S A;  4KJZ A;  2FML A;  2HPI A;  3E7L A;  3J7A O;  4IRH A;  1HST A;  3T8T A;  3N4M A;  1LFB A;  1FBS A;  1SAU A;  1U6G A;  2F6C A;  5LGU A;  2DQR A;  4HAM A;  5L3F A;  3L2U A;  2DOE A;  3HYI A;  6PAX A;  1AOY A;  2F5F A;  4HNT A;  2X1E A;  2VKV A;  3QU6 A;  2XRL A;  1XD7 A;  1FJL A;  1UG2 A;  4PJM A;  4AVZ A;  1X19 A;  2GAU A;  1WQ2 A;  1BIA A;  3CC2 I;  2HOA A;  3TW7 A;  1DPR A;  2PEX A;  5ICE A;  4JK1 X;  1O3R A;  2OA4 A;  2Y30 A;  2QA4 I;  5FLV A;  4V2F A;  2UZK A;  1ERD A;  3O3K A;  1K78 A;  5F1J A;  5K7F A;  3LA2 A;  5L3B A;  3WU0 A;  2LY9 A;  1JE8 A;  1ZRE A;  4LFU A;  2GA2 A;  1T08 B;  2DMU A;  4XID A;  2VKH A;  2CW0 F;  2V1N A;  3U1D A;  5J3L A;  3PFI A;  3CCU I;  2Y69 H;  2L9V A;  4DBR A;  1IN8 A;  3JRH A;  5DD8 A;  5LEJ A;  4XKC A;  2O61 A;  3FM3 A;  4XL9 A;  3TO7 A;  3BG7 A;  1Y8R B;  2HQA A;  2NAZ A;  1XB4 A;  4KYW A;  1FP1 D;  1PUF A;  1R9T J;  4MNU A;  2GXB A;  1JKP C;  4HNV A;  1YJN I;  2YX7 A;  1S8N A;  4X6A J;  2FD5 A;  2GQQ A;  1QO0 D;  2XKP A;  1TZL A;  1EH7 A;  4TV7 A;  4GYI A;  1MKM A;  1RR8 C;  2VB6 A;  2RQP A;  4B8X A;  2XVC A;  4AIK A;  1GHC A;  1A5J A;  1VQL I;  2V9P A;  1FOX A;  4KIT B;  3GME A;  1T0F A;  5D5U B;  1FOK A;  4LIU A;  1XDS A;  2R7W A;  2W25 A;  2R7T A;  5GPA A;  1GUU A;  3CCQ I;  2Y31 A;  1B9N A;  3A4C A;  3SEQ A;  3DEW A;  1KU3 A;  1WJ5 A;  2CQX A;  1RPW A;  1Q1H A;  3QP5 A;  1BJZ A;  3JRE A;  3ECO A;  5JLX A;  1MJ9 A;  4CCN A;  4ANJ A;  2MD0 A;  2H1K A;  3AFH A;  3SDB A;  1XX5 A;  3DF8 A;  1NG7 A;  1RI7 A;  3IKV A;  4BQO A;  3CCM I;  3GFM A;  1B8I A;  1KQ9 A;  3F8B A;  4BYY A;  1JKO C;  1DGW Y;  2OU2 A;  3LST A;  4M74 A;  4IHX A;  4OIQ F;  1OYI A;  4IQ4 A;  1HW5 A;  4XK4 A;  2QQB A;  4MFE A;  5CVJ A;  1RZ4 A;  1D1C A;  4E4H A;  4DOZ A;  2W48 A;  5KVR A;  4WX9 A;  5IPA A;  3UR3 C;  2RDP A;  4UHT A;  3CF5 F;  2M5W A;  5J4Y A;  1APL C;  3CO6 C;  4XON A;  5EZH A;  2GBY A;  3JCU C;  2NXN B;  1X4O A;  4L9T A;  1LDD A;  3N97 A;  5FKK A;  2E1M C;  1ZLK A;  1R6R A;  2H09 A;  1X2N A;  2ZXJ A;  1JUS A;  3W2V A;  5JLW A;  3K4B A;  4XLP F;  4HLY A;  2ACJ A;  3FIS A;  2DW4 A;  2NYX A;  5HDK A;  1W36 C;  4XRM A;  5M5W J;  1WI9 A;  5FRN A;  4NQW A;  2P7V B;  3I64 A;  4E7S A;  3F3X A;  2CU7 A;  2B7E A;  1T2K A;  5F08 A;  2R7Z J;  2KIU A;  3IH4 A;  2WTE A;  2OTL I;  1ZR2 A;  2HYG D;  1JHF A;  1H9G A;  4F55 A;  2AHQ A;  1MJB A;  2BY2 A;  4I7H A;  3Q5F A;  1FBU A;  3H92 A;  2EA4 A;  2WV1 A;  3KEY A;  1NHA A;  3OR1 C;  5B1B H;  4EJO A;  5L3G A;  2P5K A;  3A0H C;  3KZI C;  4FHT A;  1A35 A;  2VIX A;  4PFO A;  3K10 A;  1H9T A;  5D5X B;  2MA3 A;  1UST A;  2XGC A;  3WGH A;  3IRR A;  2X6W A;  2A05 A;  3H35 A;  4W97 A;  1OYY A;  4BQN A;  2CSO A;  4ZYH A;  4CZZ A;  4Y7N J;  2W4S A;  5H6Q A;  4YG2 F;  5DUI A;  4UY8 I;  2P0W A;  3RPU D;  4M3B A;  5ILV A;  4UUS B;  3D0S A;  2CUZ A;  1MBG A;  1IRG A;  4I98 B;  3RSN A;  4IKF A;  4E7I A;  2E71 A;  2KLO A;  2BHZ A;  2MFZ A;  2CQK A;  3PNY A;  2IA1 A;  4FT8 A;  5EGO A;  1L3L A;  3DWL E;  1BOA A;  2X6O A;  4RMN A;  4F3Q A;  2V26 A;  4CDG A;  3TP3 A;  3F22 A;  2BW3 B;  2ZC2 A;  1E3P A;  3BG6 A;  4B44 A;  3LSP A;  2R7R A;  2W1O A;  3I54 A;  1JUM A;  4EGY A;  4LMY A;  2PJR A;  1IRF A;  2DMT A;  2L5Q A;  2XSJ C;  3ABU A;  3MZ8 A;  1X1A A;  3A1Y A;  4EM1 A;  3HC7 A;  3MKW B;  1S7E A;  2FRH A;  5D8L B;  1ZQ3 P;  2HR3 A;  3E6D A;  4EVI A;  2BXZ A;  5FD6 A;  3VOD A;  1ZGA A;  3DFG A;  2H27 A;  3IWZ A;  2PX9 A;  4LOC A;  1IXS B;  3W6J B;  3HKZ A;  5IP6 A;  3WTT C;  2XGD A;  4NC8 A;  2HOS A;  1Z7L A;  3GEZ A;  3T5X A;  3E3V A;  3KP2 A;  2IS1 A;  4GO1 A;  5KHD A;  5TRD A;  3M4O J;  1A31 A;  1F5T A;  2IRF G;  3SDG A;  3GCM A;  4A0Z A;  4CCL A;  2CV1 A;  1CF7 A;  3EQL F;  3WTY C;  3WTV C;  1UHM A;  2Q2E A;  2CGP A;  1M1E B;  2RGV A;  1R58 A;  2VUM J;  2Y0S A;  3A2K A;  4NNJ A;  3S17 J;  2ZFW A;  2LRE A;  2H94 A;  2QLZ A;  2UUZ A;  3S16 J;  3H3Z A;  2KIS A;  3BY6 A;  3Q9S A;  4S04 A;  4M9S A;  3BCB A;  3J7Y J;  1Z67 A;  4BHC A;  1RUO A;  3L2V A;  3NEU A;  4XIC A;  1J9I A;  4KMF A;  4IPA A;  5M3F J;  4XLH A;  4CSW A;  1G2H A;  3HOS A;  2HQ5 A;  4DZP A;  2KIQ A;  2QEX I;  2IT0 A;  4RB1 A;  2IAI A;  3OYB A;  1JGS A;  3L1P A;  4EV0 A;  4C30 A;  4ETS A;  3E5Q A;  5FGM A;  2R7D A;  1QVU A;  2EV5 A;  2Y48 A;  3QOD A;  3CF2 A;  4YIR X;  3I58 A;  1U5T A;  5JR3 A;  2V1U A;  2HTS A;  4IQJ A;  4AUX A;  1HDD C;  1LPQ A;  4LG0 A;  3BTC A;  4IJA A;  4D9J A;  3JRI A;  1G3W A;  4FAS D;  2Y9Z A;  5GP9 A;  3ASO H;  3LSK A;  1A04 A;  1N75 A;  3S1M J;  3BR5 A;  2P7C B;  4HBL A;  1AWC A;  2L2O A;  3M8E A;  2O7O A;  5D6F A;  2IS2 A;  4NDL A;  3COA C;  3IKT A;  1T8I A;  4I76 A;  1FNN A;  3U2R A;  2CV0 A;  4MIM A;  3QQA A;  3BZ6 A;  2HU9 A;  4BKX A;  2LBF A;  5E3L A;  3FK7 A;  2JUG A;  1KYZ A;  3H9J A;  3DEU A;  3I3L A;  4X1E A;  4CIC A;  2BVL A;  5B3S H;  1DP3 A;  1FOW A;  3VYS B;  3ZOB A;  2OC6 A;  2ZFU A;  2HI3 A;  5DEQ A;  2QSF X;  4BE1 A;  2ZJR F;  3ZMS A;  2K9N A;  1B72 B;  2XF6 A;  1W7P D;  3FBN B;  1Y1W J;  3ZQF A;  1S7A A;  4LJZ F;  3ASN H;  1YG2 A;  2ZME A;  1BM9 A;  3HSF A;  1JGG A;  5IT9 Z;  3GZ5 A;  3KP7 A;  5BS6 A;  4BHP A;  2GM4 A;  2KP6 A;  4BUP A;  1D5Y A;  1XCB A;  2HVR A;  2HVQ A;  3DKX A;  2CQ7 A;  4I01 A;  2XHK A;  3JAM Z;  1FYM A;  4UVB A;  1EH6 A;  3TO6 A;  3W6V A;  3S8P A;  3SZP A;  3L2Q A;  3KP6 A;  2ME0 A;  3K2A A;  1MDM A;  4O3M A;  5BQT A;  3WGI A;  2VQL A;  2M4G A;  3RYP A;  1XGO A;  3BQY A;  4HV5 A;  3RZO J;  4XLF A;  3ZQG A;  1PJR A;  1JTX A;  2X1C A;  2JA6 J;  2BZT A;  3TQN A;  4WF2 A;  5KAI C;  4O6J A;  3QAH A;  3QPL A;  1U3E M;  1MBE A;  4HF2 A;  1J2X A;  2IPQ X;  3TL4 X;  2FNA A;  3ONQ A;  1ZG3 A;  4RBO A;  2FA5 A;  3JSO A;  3CLO A;  5HLG A;  4HDU A;  1OCO H;  4I0A A;  4B3A A;  2CFX A;  2VXZ A;  4G6T B;  4L9N A;  2D1H A;  2L01 A;  2XRN A;  1ETW A;  2V4J C;  3C2H A;  3HRM A;  1LUJ B;  3ZXS A;  3F8N A;  4A3C J;  2HVS A;  1JHH A;  4KT6 A;  2QF7 A;  3BLY A;  3S3M A;  1D8J A;  4WXC A;  3FDY A;  2A5Y B;  4YFN F;  2Z1D A;  1R5I D;  2MH2 A;  4UVC A;  1ENH A;  3IRQ A;  2DQL A;  4LD5 A;  3BTJ A;  3ABT A;  2VQH A;  2DDA A;  1QBJ A;  5FLX K;  1I1S A;  1UCR A;  2C6Y A;  3PFY A;  5D4R A;  1Y0U A;  2KDO A;  3HPG A;  4MTD A;  1VQ9 I;  1WFX A;  3WG9 A;  3T0Y A;  2NS0 A;  2JWT A;  3QWL A;  3H0G J;  1XDU A;  1YQA A;  4WCG A;  4KN4 X;  1N25 A;  3GF2 A;  2HNH A;  3E0J B;  4G7H F;  4B43 A;  4M3D A;  5F1R A;  2GIV A;  3CCR I;  2UWM A;  2PN6 A;  4MGR A;  4M3E A;  3RQI A;  3OS1 A;  3M1E A;  4R1H A;  1MND A;  4P9U A;  3I56 I;  4QIW N;  5HLT A;  2X6X A;  3G1M A;  3F6O A;  2R7X A;  3RPU A;  4PJN A;  2EBI A;  2Z9O A;  4QPO A;  4YIF A;  2V79 A;  2K9S A;  3DXJ F;  1H89 C;  1ZH5 A;  3HOU J;  2M0M A;  4XLC A;  2LY2 A;  4HYE A;  2HFH A;  2VBX A;  3ZMZ A;  1X3Z B;  4BAC A;  2EFP A;  2CH0 A;  2PFB A;  3ZQ7 A;  1EA3 A;  5FFZ A;  2AXL A;  4KN7 X;  3CJN A;  1S6L A;  1HW2 A;  5H2F C;  1R1V A;  3MKZ A;  2BHY A;  3WTW C;  4Y3O A;  1YW9 A;  2PMZ N;  1K79 A;  2DI3 A;  3WG7 H;  2PG4 A;  1FYK A;  3ULQ B;  1VZ0 A;  2QQ9 A;  2W82 A;  2B9S A;  2MD5 A;  1MJA A;  3BTI A;  3HEF A;  3GUD A;  4FTH A;  2I10 A;  2CUF A;  4OIR F;  3OSF A;  2NNN A;  4U0Y A;  1KA8 A;  3BCA A;  2XAU A;  3D5R C;  2RN7 A;  2FX0 A;  4PJJ A;  3H5N A;  1V54 H;  3BTL A;  4BL0 B;  2P6T A;  3TBI A;  3FM5 A;  2QQ8 A;  1XPX A;  2E36 A;  4BBS J;  5AIQ A;  3VB2 A;  3BZK A;  2EIJ H;  3GXO A;  5HS9 A;  2L02 A;  2P6S A;  1K7A A;  3GTJ J;  5LLQ A;  3HRT A;  2LD5 A;  1A6Q A;  1IN5 A;  2ICW G;  2WA0 A;  3GZ6 A;  2WAE A;  1VQP I;  4RM2 A;  4Q5S F;  3H3V K;  2LP0 A;  3T1B A;  3WOD F;  1TWG J;  3FXJ A;  3DBL B;  2JVH A;  4XNF A;  1R5G A;  2L4M A;  5LRR A;  1T39 A;  1I6H J;  2QSH X;  3X2Q H;  2G7H A;  3G1L A;  5GTI C;  3G6E I;  4V2G A;  2CQN A;  4XRF A;  4XN3 A;  3OR2 C;  4ABZ A;  1CQT A;  4XKB A;  5EG0 B;  4NC6 A;  2EK5 A;  2L7Z A;  1SFX A;  4LIT A;  2H8R A;  1VF9 A;  4E7Z A;  4IF4 A;  3ZQC A;  1JI8 A;  1U8B A;  2LRD A;  1MMG A;  1R36 A;  3SZT A;  3V7C A;  4DIQ A;  3NQO A;  3KP5 A;  2M34 A;  2W24 A;  3FBI B;  4EEF G;  2OZ6 A;  4PGH A;  3BR0 A;  3JRB A;  2UV1 A;  2XPU A;  5FKN A;  4A0Y A;  1J59 A;  2DN0 A;  2EFN A;  3B6A A;  4G6D A;  4MTE A;  4E7H A;  2R7F A;  3A01 B;  2JN6 A;  2EFW A;  1MW7 A;  2VAS A;  5DUK A;  4C2M J;  1BW6 A;  4D1Q A;  3CJQ B;  3KIO A;  2YU3 A;  3PJR A;  3OYG A;  2X9D A;  1S3J A;  3B6C A;  1IDZ A;  5CJ9 A;  1Y6I A;  4M6Y A;  4U7B A;  3N05 A;  3CCS I;  2L0K A;  4Y17 A;  4BNC A;  5F0F A;  3FMR A;  4IOA F;  5E8I A;  1YW7 A;  3KZY A;  4RB3 C;  3OL3 A;  4C2T A;  1LE8 A;  2K9M A;  3HTU A;  4EQQ A;  2KRC A;  1JT0 A;  1YW8 A;  4UVA A;  4CHU A;  2R5Z A;  2QWW A;  1XC5 A;  2GZW A;  1B9M A;  2DBB A;  4ZYD A;  5E20 A;  3LAP A;  2NVT J;  3TO9 A;  1BW5 A;  1YRN A;  4FQG A;  2DYR H;  4KFC A;  2QEN A;  4M71 A;  1W5S A;  4F91 B;  2Z16 A;  3CC7 I;  1ZYR F;  1S9H A;  1R71 A;  2KRH A;  4HNU A;  3WTX C;  5L3D A;  1P4W A;  1WCM J;  4KIF A;  4XR6 A;  1KZH A;  3S1Q J;  1S7O A;  1P4X A;  1YIJ I;  3ZQI A;  3MZH A;  3HUG B;  2XDV A;  4IEJ A;  2KZG A;  3K2Z A;  1D0Z A;  3G1O A;  3SFZ A;  3CCJ I;  4RGS A;  1MMD A;  1IN4 A;  5CLS A;  3JRC A;  3QPT A;  3S2D J;  4D5C A;  3S14 J;  2OAZ A;  2DPU A;  2F5D A;  1FZP B;  1FPQ A;  5ICG A;  2FOK A;  1MNM C;  2AQF A;  5HNF A;  2VXD A;  4UV8 A;  2R7U A;  1TWH J;  4G7Z F;  1GLN A;  2NS8 A;  4BGD A;  1IO2 A;  2LF7 A;  5F27 A;  1DDN A;  2EQR A;  1P92 A;  3GX4 X;  2NVY J;  4M6V A;  2WY8 Q;  4IXA A;  1RES A;  3GBG A;  1AKH A;  4L18 B;  2GA1 A;  2OCE A;  1YX3 A;  2MH9 A;  3DTI A;  3LFK A;  1ZKG A;  2M30 A;  2X51 A;  1EJ9 A;  2R93 J;  2XKO A;  4AM3 A;  2LKS A;  2CMP A;  4HLX A;  2XV4 S;  3WHC A;  2AXT C;  2BXY A;  1HOM A;  2BYV E;  2HS5 A;  4ZDP A;  1OJL A;  3E97 A;  4Q4Z F;  1IZ1 A;  2ZNZ A;  4I09 A;  4KA4 A;  2IVM A;  2ISY A;  2M0C A;  3L00 A;  5DM6 F;  1B4A A;  2HDD A;  1IN6 A;  3GTO J;  1YOV B;  2DA1 A;  5J1Y A;  2Z5U A;  4RLQ A;  4ESF A;  1FX7 A;  3GFI A;  1W5T A;  4C9Y A;  4P5O A;  3D5L A;  5DCM B;  3KPH A;  2RAE A;  3R60 A;  3RQ4 A;  4BJT A;  2LYC A;  1QZY A;  3DCF A;  3LSI A;  5BMZ A;  1R4N B;  2AQE A;  1Z6R A;  3M8J A;  2L9N A;  4M3F A;  1V5F A;  3HRU A;  3GTP J;  3C1D A;  3Q0U A;  3QP6 A;  3FXM A;  3W2A A;  5E3N A;  2XSD C;  3K1P A;  4RLF A;  1OFC X;  3BC8 A;  2ESH A;  3C2B A;  2FJ1 A;  5BPI A;  2QBY B;  2G9W A;  3CLQ A;  4AYB A;  2XB0 X;  1IV8 A;  2HPM A;  1PYV A;  4AWX B;  1FLI A;  5BOX A;  4MEX F;  5LHI A;  3ZN0 A;  4FE7 A;  3OS2 A;  2XAJ A;  1SMY F;  2WBM A;  2E7X A;  3KEQ A;  4RGX A;  4ZTJ A;  2IGN A;  2VQC A;  4O5V A;  2ME6 A;  3A0B C;  2Q1Z B;  5E3O A;  2J5P A;  5K7Z A;  4FX4 A;  2MSY A;  3FHN A;  3OYE A;  1K78 B;  3VYT B;  2I5U A;  2IBD A;  3EUK L;  3U1K A;  3CCE I;  2UXN A;  4RA2 A;  3FF5 A;  5J40 A;  4AID A;  3CME I;  2K85 A;  4Y15 A;  3OOU A;  3PO2 J;  1BI1 A;  2VOP A;  1TNS A;  1V55 H;  2VN2 A;  1JKR C;  3AL0 B;  3GVA A;  2M9H A;  3BR1 A;  4A0X A;  4HOB A;  2OUM A;  5E1X A;  5CYV A;  1QRY A;  4PFP A;  1QU3 A;  1VTN C;  1UMQ A;  3I71 A;  4PZJ A;  1GXQ A;  1W36 D;  3QYB A;  4HEA 2;  2BOL A;  4A2U A;  1MBF A;  1PUF B;  3ZQL A;  1MSE C;  2TDX A;  3V8J A;  1YO5 C;  1HA8 A;  4XKW A;  4D7N A;  1NK2 P;  1GVJ A;  2H1L A;  2JUC A;  4QLC U;  4ZC3 A;  1OCC H;  3PSI A;  4PUS A;  4J00 A;  3J80 K;  3OYH A;  2JMW A;  2IGK A;  3S32 A;  2DLL A;  4BXF A;  2A69 F;  5CQE A;  2NVQ J;  1B1B A;  1PVE A;  1UHW A;  2R3S A;  4JP0 A;  5FKL A;  2OQR A;  1LKX A;  1JT6 A;  4BH9 A;  1BBY A;  3TED A;  3QRF F;  1XMA A;  2FUG 2;  3PM1 A;  1OQY A;  5KNL A;  4L5J A;  4DYC A;  3F0C A;  4ZZL A;  5TIS C;  4I02 A;  1JJ8 C;  2KPM A;  1PP8 F;  4P9F A;  1BR4 A;  3ZMU A;  3R61 A;  4C2U A;  3IH2 A;  5M5Y J;  2NVX J;  1SVO A;  4HRI A;  5A2Q K;  4XLN F;  4B48 A;  1QPM A;  1REP C;  1FT9 A;  4A3J J;  3BT9 A;  3I59 B;  4R79 A;  3C18 A;  2DFI A;  2ELK A;  5E79 C;  5AIP A;  1ETK A;  1MMN A;  3H9G A;  4G12 A;  1WI3 A;  3EPZ A;  3CES A;  2EZK A;  4D5F A;  5LBQ A;  3OOP A;  1GVD A;  2VE8 A;  3HJE A;  4IRG A;  5HDG A;  5M3M J;  4P55 A;  3GW2 A;  1IJW C;  4ENJ A;  2DCE A;  2BW3 A;  2HYJ A;  2EH3 A;  3DBH B;  5F0C A;  2OCC H;  1DU6 A;  4FIS A;  1QZZ A;  5E18 F;  2R5Y A;  2VI6 A;  1WKM A;  2X48 A;  3RTR A;  1MSF C;  5LHH A;  2FE3 A;  1S72 I;  3ABM H;  1YYV A;  2TRT A;  2X4H A;  1R1T A;  3DKY A;  5D5W B;  1P4A A;  1ULY A;  1K83 J;  3CDL A;  3I4M J;  3DLL F;  1E3H A;  3GTM J;  3F72 A;  2A07 F;  4F52 A;  2DT6 A;  3C3W A;  5J8F A;  2FEZ A;  3FMS A;  3VPR A;  3HPH A;  2EIK H;  2IGO A;  4IL6 C;  1O7F A;  2RKH A;  1JXS A;  2BEO A;  3HOZ J;  2K5C A;  2CO5 A;  4LLG F;  4HG2 A;  2KMU A;  3ZMV A;  5EYR A;  3RDI A;  3OIP A;  5FLX Z;  5F6F A;  5ICC A;  3F23 A;  1V5G A;  2QCO A;  1BR2 A;  2V9K A;  2VC0 A;  1H0M A;  3ECH A;  1EH8 A;  1UG0 A;  2DJI A;  4EJT A;  4PCQ A;  4U0W A;  3HBL A;  4P1W A;  4A69 C;  2XB5 A;  1ETY A;  3I9V 2;  4PDK A;  1W0T A;  2MGQ A;  3HGG A;  3QPS A;  4Q48 A;  4ZJZ A;  4ENN A;  2M7A A;  4AYB N;  4ZTF A;  1ETQ A;  3PUB A;  1OYW A;  4QTR A;  3UKG A;  3QPH A;  5K1Y A;  3LSR A;  2VLA A;  2WWY A;  2EIL H;  3WU2 C;  4CGZ A;  4MLO A;  2ZSH B;  2E2H J;  3G2B A;  2HEO A;  2KRF A;  3TW6 A;  1USS A;  2IS6 A;  1I5Z A;  2M8E A;  1SAX A;  1LJ9 A;  1SD5 A;  3RKY A;  4OMZ A;  4A3K J;  2MC3 A;  2K86 A;  2HDC A;  1SFE A;  4ZYG A;  3F8F A;  1ZAR A;  1TNT A;  3REO A;  3K4M A;  2XGX A;  2VC1 A;  1POG A;  4CA0 A;  1OR7 C;  1T38 A;  1XSX A;  2VJ4 A;  1RRJ A;  2DFH A;  3RI4 A;  2PMZ A;  4E7L A;  1X4P A;  1I3A A;  2KL4 A;  3PNT A;  3EUH C;  2Z33 A;  5J8C A;  1DU0 A;  3EYI A;  2COB A;  1FIP A;  4A3D J;  4MHG A;  1UHS A;  2LC2 A;  2K4J A;  2R4G A;  4RM3 A;  4M9Z A;  3M07 A;  3R6S A;  1CF7 B;  1DP7 P;  3ERM A;  2DK8 A;  1WHU A;  2Q2E B;  2ESN A;  2IXS A;  2VL8 A;  3ESW B;  4R8H A;  1FC3 A;  1RC9 A;  4X0G A;  4CCO A;  2A6E F;  2ZCW A;  1B72 A;  4EJV A;  2JA8 J;  1VQK I;  1MMA A;  2O0Y A;  1TQI A;  1XG1 A;  3HDD A;  3OYJ A;  3V42 A;  3OYI A;  3I53 A;  1Y8Q B;  3ZRG A;  3MAJ A;  3HOY J;  2KJC A;  1Z3X A;  1ETX A;  1OCZ H;  2CJJ A;  4UXN A;  5DM7 F;  2G0E A;  4KIS A;  3K9T A;  1Y56 A;  1E17 A;  3EUA A;  2EFO A;  5JI6 A;  3NWT A;  2WAQ A;  3K4J A;  2M1B A;  3FX3 A;  4UUT A;  1I39 A;  2JA7 J;  5HNH A;  3HL2 A;  5KK1 A;  3TMO A;  3P9K A;  1Z1D A;  4HX4 A;  3FXR A;  2VBY A;  3LOC A;  3FHZ A;  4XBF A;  3HM5 A;  1F36 A;  4N4N B;  3MZY A;  2MG4 A;  3O8G A;  4K2E A;  2RC4 A;  1ODD A;  3LSG A;  5GAE J;  1D0Y A;  4DYQ A;  1TQM A;  4GGG A;  1ZRC A;  3C2G A;  3F8M A;  3MD2 A;  2CS3 A;  3PIP F;  4YEJ A;  5J47 A;  1R23 A;  1W1W E;  1TBX A;  4BAY A;  2K27 A;  1U8R A;  2JPB A;  3CUQ C;  3KFW X;  5EEH A;  4ESJ A;  4UV9 A;  2BV6 A;  4I2O A;  2VJJ A;  3CCV I;  3OWT A;  4UUV A;  4ENK A;  2BY0 A;  3H1C A;  1BA5 A;  2K40 A;  4DQ2 A;  2M3A A;  3IAM 2;  2DTR A;  4H0E A;  5LRS A;  4ZZD A;  2MLK A;  1SD6 A;  5TJJ A;  3VOE A;  3GLL A;  5E3M A;  4JX5 A;  5L3E A;  2VT2 A;  3MCZ A;  4PSX A;  3BZC A;  1TC3 C;  3VEP A;  1FEX A;  2CFO A;  4UNO A;  3RKX A;  4CYC A;  3VFZ A;  3K70 D;  4BQA A;  3J81 Z;  1J7K A;  4DBQ A;  2ZME B;  1I27 A;  1F9N A;  1DPU A;  2B0L A;  2JA5 J;  2E5N A;  1HW1 A;  2Y75 A;  4ENM A;  1WWX A;  2FBH A;  2JTV A;  2BVM A;  2ZB9 A;  3MMY B;  2HOE A;  3BPX A;  1R7J A;  3HOV J;  1QPI A;  1D0X A;  4HDV A;  3S93 A;  5LGN A;  1H88 C;  1Y39 A;  2JT1 A;  3JTG A;  4B4C A;  4BDZ A;  4ESB A;  4IHS A;  4RB2 C;  2DA4 A;  1BJA A;  2STW A;  1ZG1 A;  2LKP A;  2PJP A;  1ETO A;  4XLA A;  1BI3 A;  3T8R A;  5ILS A;  1YX5 A;  3CCY A;  4BY1 J;  1IUF A;  3PIO F;  4IHY A;  4MQV A;  1HKT A;  3JTH A;  2DA3 A;  2FBK A;  4MQ9 F;  4GFB A;  4XQF A;  3LA3 A;  4DJA A;  5JFR A;  4NBQ A;  3ZMD A;  2DK5 A;  3K69 A;  2HQR A;  2XAS A;  1EV7 A;  1G8X A;  2WB1 N;  5B1A H;  1VQ7 I;  2VBW A;  1XCV A;  3TOA A;  1L0O C;  1ZGW A;  4G8X A;  1ZRF A;  4HW0 A;  2GWR A;  3Q9V A;  3Q0V A;  4A6E A;  2H6C A;  3KYL A;  2L54 A;  2DT7 B;  4CXF A;  3R0J A;  4WK8 F;  1Z77 A;  2M2E A;  1OKR A;  4L9V A;  4UB6 C;  5FRM A;  1QQI A;  4Y13 A;  2AS5 F;  3FMQ A;  4HPQ A;  3NAR A;  3FWE A;  1Z6T A;  4A6D A;  2R7Q A;  1EF4 A;  2A6H F;  2HXO A;  1VQM I;  3QYF A;  1HC8 A;  3CQZ J;  4RAG A;  4NC7 A;  3CZ6 A;  4FCY A;  4JX6 A;  4G6Q A;  2MYS A;  2KJB A;  3V8K A;  3BR2 A;  5C3E J;  1U9N A;  4YII A;  1X58 A;  3DEE A;  4G7O F;  5H20 A;  3NRV A;  3B02 A;  3OYK A;  3AL0 C;  3CP8 A;  9ANT A;  1ZAO A;  3RYR A;  3H36 A;  2DOD A;  1RIO H;  2CUJ A;  2F4I A;  1LB2 A; 
#chains in the Genus database with same CATH homology
 1VQ5 I;  3CCU I;  3CCL I;  1VQ9 I;  1VQ8 I;  3CC4 I;  1VQ6 I;  3G4S I;  1YJN I;  3G71 I;  4UY8 I;  2FOW A;  5DM6 F;  3CCR I;  3I56 I;  3I55 I;  5JVG F;  2ZJP F;  5GAG J;  3J7Z I;  1VQL I;  2E35 A;  1FOX A;  1ACI A;  1FOW A;  3CJT B;  4IO9 F;  3CCS I;  1Y39 A;  3CCQ I;  2ZJR F;  4IOA F;  5GAH J;  2ZJQ F;  2E34 A;  1VQ4 I;  3CD6 I;  1VQK I;  3PIO F;  1S72 I;  1QA6 A;  3CCM I;  4V19 K;  1YJ9 I;  1VQ7 I;  5DM7 F;  3CC7 I;  3DLL F;  1YI2 I;  2K3F A;  3CCE I;  1YIJ I;  2OTJ I;  3CME I;  2E36 A;  4IOC F;  3CF5 F;  1VQN I;  1YJW I;  1FOY A;  3CCJ I;  5GAD J;  5GAE J;  2NXN B;  2JQ7 A;  1YHQ I;  3J7Y J;  3CMA I;  1VQP I;  1VQM I;  1HC8 A;  3CC2 I;  1VQO I;  2H8W A;  3PIP F;  2QA4 I;  2QEX I;  3G6E I;  1YIT I;  2OTL I;  3CCV I;  1MMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...