1T08B

Crystal structure of beta-catenin/icat helical domain/unphosphorylated apc r3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
GKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of phosphorylation-dependent binding of APC to beta-catenin and its role in beta-catenin degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/cell cycle
molecule keywords Beta-catenin
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1t08B00
1LUJB 1T08B 1M1EB
chains in the Genus database with same CATH superfamily
2VJ5A 5IT9Z 3EUHC 3J7YJ 2KRHA 2WB1N 2X85A 2LVSA 1POGA 3K4KA 4IRHA 2E1OA 2QKLB 2W25A 3FXOA 2ACJA 2R5ZB 2HQAA 2Y0SN 1OYYA 3L9FA 3G1LA 4EGZA 2JRMA 2VQGA 2Z16A 1X1PA 5CVIA 2A68F 5F1JA 3ZMSA 1SFEA 2NS7A 1BOAA 4E7ZA 1OR7A 2DO7A 9ANTA 2L7ZA 4BDYA 2R3SA 2XKPA 4E6KG 3WGIA 2KRCA 1F5TA 2R7RA 4XLFA 3L7WA 5KCMA 3ZMTA 4A69C 2LK2A 4DW6A 4G7HF 2P81A 1UAAA 2O6GE 1EF4A 5HOOA 2I10A 1DQUA 2O3FA 2K40A 5LHHA 1DU0A 2ZXWH 2JT1A 3FF5A 4ENNA 3BWGA 4B48A 4KFCA 5ICGA 3DCFA 3LOCA 1WCMJ 3BCBA 2QSGX 4WXCA 3NEUA 4C2UA 2RC4A 3QODA 3KLNA 3W2VA 2X0LA 1ON2A 3D1NI 1ORKA 2ZNZA 4WXDA 1U78A 2HKOA 1TWFJ 1PUFB 3ZCOA 3C18A 2QSHX 3ABLH 3ZQHA 4M6XA 3HGYA 4FETA 4XIDA 3MD2A 3GYHX 2FBIA 2FX0A 3QYEA 5D6EA 5J40A 3JRHA 2MG4A 3VDXA 3OYIA 2FQ4A 1V3FA 3BZ6A 2JWTA 3J80K 1Y39A 1XGNA 3LSJA 4XLPF 2YU9J 1YI2I 4A3EJ 1S5LC 3QU3A 4FE4A 5KHDA 2P5LC 3F22A 4U0VA 1LDKB 2IA2A 3EUKL 5M5WJ 3PNTA 2FOWA 1FIAA 5CVRA 2EK5A 5D5WB 3K4MA 4DYCA 2R93J 1ODDA 2OC6A 1HCRA 4BUPA 2P5VA 1ZAOA 3F72A 4EJOA 2A07F 1ZTRA 1XDUA 3SHFA 5DV5A 1UMQA 3OWTA 1U0JA 4CCOA 2IGOA 2VBZA 4IHVA 3CUQC 4P5OA 2OCCH 5D4RA 5BMZA 5EZHA 3RQIA 3CMYA 1D1BA 1PVEA 2LFBA 3S3MA 2IGNA 2XPVA 3H92A 4KICA 4HA8A 3WTTC 2Y48A 2V1UA 4D7NA 3ABMH 2KT0A 2O8XA 3BOQA 2JK3A 3HOYJ 1RESA 2A6TA 1J2XA 1X19A 4DYQA 3LSPA 3CCMI 3SJMA 3JRAA 1LNWA 1YLFA 4FISA 4ZZLA 1LE8B 4M6VA 3Q0UA 2QBYA 2M45A 2JMWA 3F3XA 5GPAA 4LB6B 1VQ5I 2V9KA 2K86A 2GWRA 1AA7A 2DFIA 2DA4A 1MBGA 4IZZA 1PYVA 3JRCA 3FDYA 3DWLE 3QWLA 1R9TJ 2AQFA 1EJ9A 2PMHA 2JA6J 2FMLA 4ZYGA 3ULQB 3L2QA 4NC8A 2ADUA 2JN6A 3BJOA 5L3EA 1E0EA 3K4BA 1A36A 1BM9A 1ZGJA 4M74A 2Z1DA 2ZFWA 4AWXB 3S1NJ 5HLTA 4E7KA 2XSDC 1BIBA 3FXMA 2H6CA 1XG1A 4JYKA 5LRSA 2COMA 4JX4A 4MHGA 4UV8A 5TISC 5FROA 4IRIA 2DFHA 5F04A 2RQQA 1KYWA 2QM3A 1F9NA 2CU7A 2DA5A 3TOBA 3BPVA 5L3CA 3CJNA 4GGGA 2CQNA 2FF4A 3DP7A 1G4DA 4Y4RA 1BIAA 3BT9A 3DTIA 3SZPA 2X6XA 2M1BA 1KU9A 4R1HA 5JR3A 4HNVA 3IUOA 4ZDPA 3K1MA 3R0AA 1IC8A 2GLOA 1XN7A 3I71A 4HRIA 4P9UA 1YYVA 3SZGA 1J9IA 1USSA 2FBHA 1VNDA 4QTRA 1DPRA 2FU4A 3VOEA 5EGOA 3CCLI 1SAXA 5J1YA 2F48A 3KP4A 1SFXA 1OKRA 4A5MA 3S2DJ 4ZZDA 2WC2A 2NS8A 4NC7A 4Y33A 2QSFX 1V4RA 3M3YJ 3K1NA 4PK4A 2ICWG 4YEJA 4Y7NJ 1X58A 5EF6A 4CYCA 3I58A 1F43A 1V5EA 3TGNA 4ABZA 2QWWA 3HYIA 3BR6A 3DPLC 4LLNA 3CJTB 3BPXA 5ICCA 4LG0A 5FB2A 5IP6A 2V9PA 5FGMA 5CJ9A 1YG2A 3FMQA 1TWCJ 5AIPA 1VQLI 3DV8A 4RB2C 3CCYA 5HODA 2CRGA 1AU7A 1N78A 3JAMK 1E3PA 2EIJH 4HLYA 3S93A 1R36A 2A5WA 1MJAA 1HA8A 2F5VA 3NAUA 2ETHA 2A05A 2E60A 5FJ8J 3OSFA 1P7JA 2FJ1A 4PZJA 4M3FA 2EJRA 5IP7J 3RYRA 3B6CA 5JHUA 2RNGA 3OMYA 4YIFA 5D5UB 4RB1A 4U7DA 4BY1J 2P7VB 2WB1A 4EGYA 4GFBA 4UVBA 1VQ7I 2I5UA 3KEOA 3F8FA 1R5ID 1TZLA 4JQFA 5GTIC 2LKXA 2M7AA 1JKQC 4CDGA 2BY1A 2AXTC 2OF7A 2ZXHA 3CZ6A 2B7EA 4MNUA 2EZKA 3ZRGA 4YIRX 2LBFA 3ABTA 1U5TB 4ZTFA 2ZO4A 4A3MJ 3A0BC 2LR8A 1WZ2A 2ZSIB 4DIQA 1B72B 2EB7A 3MQ0A 5CKTA 4CICA 3HM5A 3VPRA 2GZWA 1IUFA 3JTHA 4UUSB 1XD7A 3M8FA 2R0QC 3HRSA 3KP2A 4M9XA 3GLXA 1F36A 4BHBA 2ZCWA 5CVVA 5GP9A 3HUGB 1S9HA 4XSZF 1VQKI 2FBKA 3KP5A 2EZIA 2D5VA 5F1RA 2MFZA 4A6DA 1G2HA 2PX9A 1LFBA 3OYCA 3LAPA 3V8LA 3DFGA 1X3UA 3BG9A 1PP8F 3S2HJ 2KIMA 5IT9K 3X2QH 3D5LA 4K2EA 4MQ9F 1LDDA 4QLCU 1T0FC 1FMWA 1H88C 4O3MA 2V1NA 4N4NB 1ZQ3P 3J7AO 3WTVC 1TP4A 3KYLA 1ACIA 3CO7C 3FWEA 4HX4A 3ZN0A 4PGGA 4G6QA 4TV7A 1O3SA 2ZSHB 3CO6C 3I0TA 1N75A 1Z6RA 3A2KA 3DBRB 2F5EA 1MH4A 3CCQI 2XPWA 4EJTA 3ROUA 4O6JA 3N4MA 2L01A 3RPUA 1YRNB 4A3JJ 1R4MB 2P5KA 1AHDP 2K5CA 2LOOA 5TJJA 4D5CA 1GT0C 1HOMA 4E4HA 1A04A 2IGKA 2QZ8A 2V9VA 3F8NA 4I98B 4Z2YA 3ZOBA 4FASD 3RI4A 1RIOH 2M7BA 4BACA 5LRRA 2Z9OA 5C4XJ 2K85A 5EG0A 1OR7C 1JUSA 3NRVA 3HJEA 4C2MJ 2HZTA 3WU2C 3UKGA 2DYSH 2DMQA 2XGCA 1JTXA 3BJ6A 5H2FC 2NAZA 4KISA 1HBXG 2DI3A 2QQ9A 4LLLA 3K4LA 4XSXF 2PJRB 4N9IA 1RI7A 3GCMA 2EILH 5DTDA 5DDGA 2ELHA 2DFEA 2WV0A 2D1VA 5KVRA 3LQQA 3QPTA 2DPUA 4CUGA 4MTEA 1J75A 1Z05A 2N8GA 3BR1A 3BZKA 3OY9A 2R5YB 5LEJA 2HXOA 5FLMJ 3VWBA 1BJAA 5CYVA 1Y1VJ 1KONA 1W7PB 3CCVI 1WJEA 5GAGJ 1GDTA 4HX8A 2JUCA 1OCTC 2NVQJ 3KP6A 3W6KB 2XROA 3Q3SA 1MMAA 4U0WA 5DYMA 5HLGA 5EEGA 3MKLA 2LNBA 1DPUA 4M71A 4UUTA 2XB0X 4KN4X 4F52A 5DS9A 3GFLA 4KYWA 1R5GA 4BY7J 1ZKGA 3G1MA 3H3ZA 2ZKZA 3JSPA 4II3A 1TW2A 3OR2C 2MGQA 1ENHA 5FFZA 2LF7A 5FO5A 1QNTA 3KETA 2KP6A 1D0ZA 1K6YA 2QF7A 4ZYAA 3HOXJ 4LD5A 3AG1H 5JVTA 3OSGA 3VB2A 1QVTA 1OCCH 5IY5H 3I53A 3FXLA 3V8KA 2ESHA 4UXNA 3O6BB 1UJ8A 2PLYA 5B5EC 1ETXA 3EQLF 4XORA 1FPQA 2RV8A 2HQ5A 1XGSA 2I8DA 5M5XJ 4MIMA 1RZ4A 2XAUA 5E3MA 4XONA 4AUXA 2OCEA 4ASNA 2V1XA 1BW6A 2VKDA 2W82A 3OYMA 1H9TA 3R4KA 4RMNA 2E7WA 5D8KB 4HSTA 2DDBA 2VBXA 1WJ5A 1P4XA 1WGXA 3MMYB 2Q2EA 3CCSI 4KMUX 3VYTB 2OZ6A 1KU2A 2JRTA 3KZYA 2X51A 2H09A 3RDIA 4KNYA 2ZFUA 3KEQA 4AD9A 2AS5F 3V4GA 4BQNA 4L9VA 4F3QA 1RR8C 4B3XA 2DAOA 2XHKA 1ITYA 5DCFA 4RAFA 3D5RC 3AAFA 5H20A 2DA6A 4ESJA 2CW7A 1H8AC 1VQ6I 2KFDA 2MW8A 2GM4A 4OWRB 1SD4A 1FZPB 1SVLA 1HLVA 1ZGAA 4NC6A 1QA6A 4BAYA 2M9HA 5E18F 2PG4A 3ECHA 3LWFA 1F1ZA 4FHTA 2XKOA 2CO5A 5C44J 2WAQA 3OYFA 2LG4A 2BHZA 4B3AA 2HOTA 4RGRA 2DU9A 5D4SA 1LQ1A 1FEXA 2QQAA 2ELKA 2NYXA 2DA1A 5D5XB 1A6QA 3IH3A 1R22A 2VXDA 2O9LA 4IXAA 1HKSA 3KZZA 5HS9A 4XLAA 1JHHA 1W5SA 3OYKA 1YS7A 1SEUA 3O8HA 4MQVA 3A02A 2YR2A 2K9MA 2XDVA 3K7AJ 1OCOH 2XASA 1FYLA 4ON0A 1BA5A 2E1CA 2EV6A 3P9KA 3GTKJ 1GV2A 1B72A 1S29A 2HGCA 3ZQIA 4A0ZA 4BL0B 1HSJA 1USTA 2M30A 3WTUC 1TL8A 1VQ4I 4Q5SF 1PJRA 4JOMA 1P92A 4LGWA 3GZ6A 5BOXA 4Y13A 1BBYA 1MZBA 3FBIB 3F8CA 2L0KA 5D6FA 1P6RA 1T33A 1NTCA 1IXRC 2K7LA 5EG0B 1ZR4A 4XKCA 3FMRA 5F08A 3W6JB 3TP0A 2LY9A 1LPQA 2HDDA 3NWTA 2VQCA 3VYUB 4IQ4A 3REOA 4L5IA 1J5YA 3V7SA 2WBMA 3FZVA 4IL6C 3M1CA 2AQEA 2ZBKA 4KIGA 1G8XA 1XTAA 3I59A 1R7JA 3HRUA 5DUKA 4D9JA 1P2FA 2GOMA 4RM3A 2C6YA 2AO9A 1WJCA 1Z7LA 2W4SA 5J4YA 2PJPA 3ASOH 2R7VA 2FNAA 1MNEA 4BJTA 2V79A 3QPHA 3IH2A 4GYGA 1UFMA 4FQGA 3GW2A 4NUBA 3QRFF 3E6BA 2ISYA 3HHHA 2UXNA 3H0GJ 3LAJA 2YSRA 2GQQA 4X1EA 5A2QK 4CHUA 1SMTA 3S17J 4B09A 3FM3A 1WRJA 3GEZA 3KEYA 3E0JB 3BROA 4KJZA 4L9JA 4EVIA 2CQXA 4HBLA 3E5UA 1I1SA 4UUSA 4Q48A 1Z1DA 3K10A 2LREA 3LSKA 3JRDA 2NRAC 1T38A 2FUG2 2V6EA 3ZQQA 1XGMA 3TMOA 4GDFA 4BXXJ 1ON1A 1OJLA 4HAMA 4IF4A 4PSWA 2P4WA 2LBFB 1H89C 1RKTA 5TRDA 4XR6A 1XCBA 3JRFA 2LD5A 1T6SA 4RB0A 2VODA 4ZC3A 2Q0OA 4XRMA 1MIJA 2OBPA 3V7CA 3DF8A 4M3BA 1O3RA 3EUHA 3K70D 1NH3A 2Y0SA 1STZA 4Y3OA 1T39A 1IRGA 2QENA 4JBAA 2CUJA 3DU6A 2HI3A 3E5QA 1HC8A 2NVTJ 3E6CC 2M0MA 2KL4A 5GAEJ 4JX5A 2R7TA 1R00A 3JSOA 5DD4A 1V5FA 3SEZA 5B3SH 3G4SI 3G73A 2BV6A 2IA1A 3AL0C 4I09A 2KJCA 4BDZA 1FP1D 3TO9A 1MDMB 4LK1F 1T56A 2BXYA 2LH9A 2R7SA 2DDAA 1OPCA 2QKMB 6PAXA 2VASA 1MBFA 1YITI 1RRJA 4Y52J 4BE0A 4UNOA 1EV7A 2Y0MA 3HOVJ 4A3GJ 1JXSA 2K9LA 3M1EA 4YRVA 2EFPA 2KZVA 1WWXA 2BW3B 4WXHA 1IGNA 4LIVA 4BJ6C 2MC4A 1ZN2A 4DNCA 3W3CA 4BQAA 3GBGA 3S15J 1S6LA 3L00A 1FBSA 1W7PA 2J5PA 5F27A 1NK3P 1RNLA 2E5ZA 2XV4S 5F6FA 1IN6A 3S2WA 2IP2A 3Q9SA 4HV5A 4DOZA 2YX4A 5JLWA 2EV5A 4IHTA 5FKMA 2CUEA 1KQ8A 3DKWA 3OOPA 4A0XA 2GXGA 4PFPA 5FD5A 2L9SA 2R7WA 4DZJA 1K4TA 3PUBA 1J09A 3BTIA 5EJCA 1SMYF 2H1KA 2PMUA 2E1NA 2H8WA 1Y0NA 2DJIA 5EEAA 2Y2ZA 3SXYA 3VSKA 2HQNA 2HWVA 2L4MA 3HOSA 4M73A 2YU3A 2VT2A 2XF7A 1G3SA 3FKIJ 1V5GA 3IAS2 4YELA 2DT5A 3CF5F 5DD8A 2IRFG 2HTSA 3Q5FA 1Z3YA 4P55A 3RSNA 4C2TA 1GUUA 3LA7A 2R5YA 4EEFG 1VQMI 3F21A 1U2WA 4N4OB 3ZXSA 1U9OA 4C3IJ 4KITB 2TCTA 1FOYA 4G6TB 1X3ZB 1MW7A 2LKPA 1VQ8I 1KU3A 1TW3A 2MD5A 5IYDJ 2G0EA 3BY6A 1WHUA 3FK7A 2Z99A 5J8CA 1TQMA 1XC5A 3CUQA 2L2OA 4XLCA 1LVAA 2A69F 3ERED 1IDYA 4BJ5C 3P5JA 3OIOA 2DTRA 4B43A 3CDIA 2OUMA 3COAC 3B02A 4B1RA 2HPMA 1MDMA 4LMYA 3EDPA 3GVAA 2IT0A 1M1EB 3P7NA 4Y15A 1FSEA 1QPIA 2PBIA 2KZGA 1Z6TA 1K61A 4IKFA 2G9WA 1T2KA 1HW1A 3GFMA 4NB5A 4GCVA 4ZTJA 1RETA 2PFBA 2FA5A 3HZJA 4JX6A 4S0HB 4Q4ZF 3HEFA 1G59A 5L3BA 2STWA 3U1KA 1O3QA 1Z3XA 4LFUA 5HDGA 3H3VK 3BTLA 4EMSA 1ZK8A 4RGXA 2Z3YA 4RAZA 1HF0A 2DYRH 3TO7A 1D3YA 1FYMA 3QPLA 5E8GA 2CV2A 1OFCX 2BZTA 5K7ZA 2Z2SB 3JREA 1JJ8C 1WH7A 4D5FA 1WI9A 1ETOA 1UELB 1LJ9A 3ISPA 1IRXA 2KIFA 2L5QA 4HDVA 2GXBA 4W1UA 2PMZA 4M3DA 2M8GX 3I9V2 1TT5B 1LEAA 3BTCA 2VOPA 1U6GA 1N25A 3BZCA 5B1AH 3HSEA 2DTZA 3MEXA 2F5CA 2W00A 3F9KA 1JT6A 3I3LA 1R5HA 4XICA 3HB9A 1RUNA 3GX4X 2CFOA 4L18B 1LVKA 3NQOA 1YX3A 3CDLA 4U0YA 3DKYA 1T95A 2KDOA 3RZDJ 1WI3A 2COBA 4RAGA 5LGNA 1YW8A 2JSPA 2K02A 3VEPA 1IJWC 1MJ9A 3DTEA 1S7EA 1X1DA 3R6SA 1REPC 2E1MB 4Z6YA 4LJZF 4UV9A 4DBQA 2X1DA 1K4SA 2XRNA 3BG7A 3M8EA 1YO5C 3PL8A 2BOLA 3OYNA 3HC7A 5J4VA 3FM5A 4AVPA 4F55A 1O57A 2QCOA 5M3FJ 5E1XA 5IOYA 2X6OA 4GRIA 3PJRA 2R92J 3G1OA 1OYWA 4FT8A 2ECCA 2J5OA 1D0XA 1MBEA 1X3WB 1EH8A 2NNYA 2HOSA 3BLYA 3BR3A 2EWNA 3CESA 4HNTA 4U88A 1RKWA 4BBRJ 4AU7A 3DLAA 3RYPA 3LNQA 2NVXJ 3OS0A 1UB9A 3K2AA 1YFHA 1CQTA 2GIVA 1OMIA 4ZH4F 3K69A 3TP3A 2KPMA 2MH2A 3BG5A 3IAM2 4RBOA 2WAFA 1WSUA 3GFIA 1KGSA 2KIUA 3U21A 4E70A 3JR9A 1A6IA 1ZREA 1DGWY 3ZQFA 5GPCA 4EM0B 2M4GA 2DK5A 2DMTA 2V6CA 1R4NB 4BE2A 2F2EA 2LP0A 2E7XA 2PQ8A 2K9SA 3OYGA 3CDHA 1K78A 1ZRDA 4L5JA 2IBDA 1MKMA 4MFEA 5LEKA 1SD5A 2O0YA 2B63J 1R23A 3J81Z 4KT6A 2DQRA 3DQVC 2JA7J 2XAJA 4C3JJ 2GXAA 5CLSA 4L9NA 3B73A 4M72A 5K1YA 4A12A 1T8IA 3FMSA 1MBKA 1N77A 2CQ7A 4OAYA 1VF9A 4AIKA 2O03A 1TWGJ 2BW3A 2KIQA 2VKVA 4A2UA 3RIRA 5DEQA 4BHPA 4IOAF 2CUFA 5L3FA 4PDKA 1JHFA 3UNGC 1ZARA 1B6AA 2PJRA 4KMFA 4B8XA 1ZG3A 3HKZA 3HPGA 2CYYA 5FKKA 1I27A 3K2ZA 3QAHA 3TBIA 3ZMDA 5IOZA 4XRSA 1W0UA 5IPAA 1XSDA 2ZC2A 3RCOA 3GTJJ 2Y30A 5E3NA 2VBYA 2GBYA 4X6AJ 3IC7A 1WJAA 4A3FJ 4P9FA 2HR3A 2CGPA 2HFHA 2DODA 1QVUA 4NQWB 4MEYF 1O3TA 3LFUA 2A5YB 2CW8A 2FEZA 1ZR2A 4PJ0C 1Z91A 3T0YA 2W48A 4AM3A 3FBNB 2WTEA 2GA1A 3HRMA 1TNSA 2RNJA 4NBQA 3LQRA 1FC3A 1UHSA 5HDNA 1G3WA 3HBLA 1FOXA 1DU6A 2HTJA 3BDDA 1X2MA 1IW7F 5ILSA 3BQYA 2L9VA 4ZYDA 4FX0A 3TL4X 3CMEI 2XB5A 4CH7A 2V1DA 3ASNH 3RTRA 3HPHA 4HLXA 3HKZN 4A3IJ 2VXZA 4OINF 2X6YA 3LFKA 1X1AA 2QVOA 3MZYA 2DK8A 4RDUA 3J7ZI 3HTSB 1HDPA 5K5QA 3VFZA 1WFXA 4ZYEA 4OMYA 1D1CA 1IG7A 3EYYA 2L3DA 2H6BA 3CMAI 4V2GA 3RKYA 3KX2A 1FJLA 1A31A 3KE2A 4UY8I 4QIWN 2CSOA 2MC3A 1VI0A 3ZQGA 5HS7A 1WVRA 4IHSA 5K7HA 3ELKA 4BH9A 2CQQA 3KP3A 4HF2A 3KPHA 4BEHA 2HYJA 5E20A 1MMSA 3A01B 1K79A 3ML6A 2WA0A 1AOYA 5FRMA 3BG3A 1IXSB 4HOBA 3FXQA 4CCJA 2P7CB 4IEJA 2VN2A 4I6ZA 1DGRM 2VBWA 2FOKA 3E6DA 1CF7B 3H5AA 1FX7A 2UWMA 1FSHA 1W7PD 5HNFA 1CF7A 3O8GA 5FLXZ 1SANA 1SFOJ 2EFNA 2CUZA 2ZB9A 3HRTA 2CFXA 4PJLA 5M5YJ 5HDKA 4IX7A 2K4BA 4AVZA 3P9IA 1EKEA 2VL8A 3CLQA 1QZYA 3WTWC 1W5TA 4PFOA 5JLXA 1SVOA 3MN2A 1XMKA 2LMDA 2VLAA 2ME0A 2ZMEA 2PI0A 1IRFA 1FIPA 5F0HA 1LDJA 2HVSA 3F6OA 4KA4A 3LSHA 5D5VB 4RAYA 1MMGA 4RGSA 3E5XA 2HU9A 3L2VA 3MCZA 1U5TC 3C3WA 2FMYA 4XKVA 3OYBA 3KLOA 3T5XA 3TEDA 5IYBJ 3WU0A 3LL7A 3U9GA 4LG0B 1LFPA 1K78B 3M9AA 2DMUA 1I5ZA 2GIZA 1NHAA 5LHIA 1C0WA 4R8HA 1KZHA 2BY3A 2GOXB 3O3KA 1QZZA 3LSRA 3TKYA 3H1CA 1IN8A 2LRDA 3BJAA 1UCRA 1UHWA 2HZDA 1YW7A 2IJLA 3HTUA 4IO9F 2DOAA 3I64A 4LITA 1GXQA 2QA4I 1B9MA 4WX9A 3GMEA 3GZ5A 1IV8A 1B1BA 3H0DA 1VFCA 4G6DA 1FBUA 3CC7I 1Y8RB 4IHYA 2GAUA 1XX5A 3PNVA 4BHCA 1ZRFA 5CQEA 5ERIA 3FKJA 5A2QZ 3WGHA 4I0BA 3AKZA 4D0PA 4C3HJ 2M2EA 3PQKA 3I4PA 1LUJB 3IKTA 4V19K 2R7OA 3H36A 4UUVA 2RDPA 3QQAA 3GXOA 1JJ6C 2CV1A 4YFKF 2LKSA 5DUIA 1U8BA 1JT0A 3UR3C 4E7JA 1XPXA 5ILVA 2ESNA 3ZPLA 2H94A 2NXNB 1XSXA 2WADA 3TDUC 3S1RJ 3WTSC 4XRFA 1GXPA 3PSIA 4DYRA 5DM7F 2K9QA 5FLVA 3HSFA 4I76A 4NDLA 1W36D 3BP8A 1IV6A 4Y17A 2XVCA 5J3LA 2ZJPF 2O8KA 1O4XA 2VQLA 5J6XA 3LA2A 1TBXA 2DOFA 1TQPA 3IKVA 3FXRA 2K27A 5JI6A 1YIOA 1WJDA 3MKYB 1GVJA 2BY0A 4GXOA 1OCZH 3NARA 3U1DA 1BJZA 1RC9A 1R71A 2VPLA 2JA5J 4XLHA 2STTA 3ZGKA 4EM1A 1IXCA 1FY7A 4BNCA 2M0CA 4HW0A 3OV8A 3RPQA 1BI1A 3OOUA 2DT7B 5FLXK 2QQBA 1S72I 2RGVA 4F91B 4LLGF 4M6YA 2O7OA 3HL2A 1JKOC 4BXUA 2VE8A 1GVDA 4CCKA 4IVNA 5GAHJ 4RA2A 1AKHB 4HNUA 3I56I 4FE7A 3JRGA 2B0LA 3V42A 1MMNA 2BVMA 4HEA2 3ABKH 3F6VA 3OIPA 2DW4A 1UHMA 1FTTA 3RPUD 2ME6A 2Z33A 2LLKA 2ISZA 1P9QC 1VQ9I 5J1RA 3T8TA 2EINH 2FD5A 2VE9A 5GTHC 3G71I 4IRGA 1J7KA 3CUOA 2CMPA 3WU1B 1DUXC 2JPCA 1FOKA 2JUGA 2E71A 2E5NA 3I59B 2RQPA 4UB6C 4FX4A 1Y0UA 3LSIA 4QPOA 3E7LA 2R7ZJ 4BXFA 4XN3A 4L5EA 3V8JA 1X1BA 2DMPA 1JKRC 3H5RA 3IHUA 4J01A 3K1PA 1Y56A 1JGGA 2IPQX 2QGUA 2A6EF 3OYLA 1T08B 2QEXI 5LGTA 1RR7A 1X1CA 1E17A 1VZ0A 4HX7A 3W6VA 3R61A 2W24A 4RS8A 4CXFA 3DKXA 1YHQI 1P4WA 3PSFA 4P1WA 1B9NA 3PM1A 3OYEA 2IS1A 1R1TA 2RAEA 1KQ0A 1HKTA 3CCEI 1K83J 2MABA 1QHGA 4HV6A 5CVUA 1R58A 3QOPA 2ZNYA 1QHHD 3I5UA 4O5VA 4PCQA 3EPZA 5FFXA 1WPKA 3EETA 2XGEA 3TO6A 1S7AA 1G3TA 2EFWA 2HEOA 4CZZA 1FTZA 2BVLA 3A03A 3WG9A 4I0AA 2W85A 1ZELA 3MKWB 1P7IA 2IVMA 2IXSA 4J19A 3I4NJ 3C2BA 5E79C 1D0YA 1XMXA 5B66C 3T8RA 1XGOA 4X0GA 2D45A 3C7JA 1ZLKA 3RJPA 2VQHA 1Y6IA 2XF6A 2A6HF 2H1LA 3JTGA 3CJRB 4E7SA 3BC8A 3Q0WA 1HSTA 2ELJA 2P8TA 2LDUA 5F0CA 3M07A 2JPBA 1LB2A 3CTAA 5KNLA 1LKXA 1W1WE 2HVRA 3CC2I 2CW0F 5EZGA 3SZTA 4I02A 4CO8A 4LB5A 4PSXA 4EJWA 3EYIA 5EGOB 1WJFA 4LIUA 4RM2A 4CGZA 3RKQA 4N9HA 2IS2A 1ZLJA 2ZXJA 1TT0A 3VODA 3BR5A 4IJAA 3QP6A 5FKNA 2MLKA 3S8PA 1KQ9A 4AYBN 4A3CJ 3WTYC 3S14J 1XB4A 1SAUA 4PGHA 2AXLA 3H9JA 4IQJA 2HXIA 2L9NA 1HDDC 1XSVA 2EV0A 1YJWI 2DLLA 1MBHA 3CUQB 4G7ZF 5IP9J 1TWHJ 2OQRA 5ED4A 2NOJB 3ZN1A 2KJBA 1APLC 2DN0A 1OLTA 5EDNA 2RVCA 4CCLA 3GTQJ 1NK2P 4ETSA 2KISA 3HG9A 3CP8A 2B9SA 3GO5A 3R60A 4M9SA 4A5NA 3K0LA 5AIQA 1BN5A 2UUZA 1V54H 5CVJA 5BS6A 4ITVA 4S04A 1YW9A 2D2WA 5EYRA 1QO0D 2LYCA 3C1DA 5E8IA 4I2OA 3IL2A 3MAJA 5FD6A 2HOEA 2HNHA 4MEXF 2L4AA 2MYSA 1FYKA 5HVQC 1XDSA 4PUSA 3CQZJ 2HDWA 3HDDA 3PFYA 3TQNA 1ZGWA 1ETWA 2WY8Q 4RLFA 3ZQCA 2E2IJ 2FSWA 5ILUA 5C3EJ 3GTPJ 2NNNA 1R49A 1U3EM 3SDBA 1JUMA 3KYDB 3LSTA 1PP7U 4HZFA 5F64A 3I54A 1Z77A 4A6EA 4IHXA 1IN5A 4OIOF 2A3SA 1TNTA 4RB3C 2E2JJ 2JVGA 1DP3A 1U8RA 2MD0A 4IOCF 2FNPA 2DA7A 2X6WA 3GF2A 3WHBA 2KHMA 5E3OA 2VKEA 2Y9YA 4YIIA 5BPIA 4NNJA 5HLIA 3WE2A 4B47A 4BE1A 3N05A 4XN0A 2E1MC 2Y69H 5TGTA 4BBSJ 2IAIA 1HW5A 3SFZA 3B6AA 4ANJA 4QSHA 3GUDA 2QQ8A 4AIJA 3OL4A 1ETKA 1T98A 2VC1A 2OJED 2IW5A 4XM3A 3E3VA 1WKMA 4XKBA 1K6OA 1B8IA 3S32A 2DOEA 3SFIA 3JRIA 1UG2A 5HS8A 5C4JJ 4XK4A 1U5TA 1WJBA 4D1QA 2HDCA 5FKOA 1H0MA 2YX7A 3K4NA 2W7NA 2FXAA 5LGUA 2OTLI 2W57A 1JTYA 1QRYA 3FXJA 3J81K 1E3HA 1I6XA 3ABUA 2RN7A 2FQ3A 3GTMJ 4EJVA 4LK0F 1IRZA 2FE3A 2LTPA 1S8NA 5GADJ 4IPAA 3GWZA 2VT3A 4PJMA 4A93J 1YE9A 4Q47A 1S7OA 4U7BA 5L3GA 1J0RA 3JW4A 1FT9A 4W97A 3G6EI 2WY7Q 3DBHB 4CA0A 2V4JC 1D8JA 4V2FA 1YRNA 3QP5A 3PQJA 2VPRA 2HYFA 1E2XA 3BTJA 5J47A 2IA0A 3E6MA 3L2CA 1IF1A 1Z9CA 1MD0A 1FP2A 2F6CA 1BI0A 4BEHB 4G12A 2HQRA 3ZMVA 2CG4A 5J8FA 3WGGA 1H9GA 3K6GA 5BQTA 3IRQA 2VI6A 1ONVA 2XC7A 2OA4A 3AL0B 1AKHA 4BYYA 3MZHA 4G94A 2Y75A 1IN4A 3HOTA 1Q1HA 1TTYA 1QGPA 3DU5A 5LBQA 2AHQA 3CD6I 4ENJA 1GHCA 2XAFA 3F8BA 1OQYA 2VC0A 2H27A 4KT5C 3G2BA 2E35A 1D8KA 2EZHA 2M3AA 2MA3A 2DQLA 3AFHA 3W2AA 1Q1VA 2WWYA 2D1HA 3TOAA 3CP2A 3NWSA 5EEHA 4AYBA 5K5RA 2DXIA 3RQ4A 2HVQA 3TW7A 4L0ZB 1JGSA 3A0HC 2CWEA 4ESBA 2VJIA 3KCCA 1W36C 1ZG5A 5J1UA 1IN7A 2JJ7A 2KRFA 1SC7A 4H0EA 5DCMA 1R6RA 4A3KJ 2BGCA 4AIHA 2E34A 3CJQB 2TRTA 1O7FA 2DCEA 2JZYA 4CCMA 4A3BJ 3JAMZ 3K9TA 3BR2A 3IRRA 2WAEA 1HKQA 1V55H 4G8XA 4NHJA 2KKOA 4ZYHA 3CMMA 4CZCA 3HHGA 1HW2A 4OMZA 3BCAA 4DJAA 4ZDLA 4KN7X 4XRSG 3IWFA 3GTLJ 3S1MJ 2VOOA 4ZJZA 1MH3A 4QPQA 1GV5A 2KQRA 3E97A 4HG2A 5KAIC 2O5RA 1SD6A 2NOGA 3J80Z 2OPTA 3BR0A 1IO2A 3KZIC 3QYFA 2EFOA 1PUFA 2IEKA 3VYSB 5JVGF 1EA3A 2BY2A 2YUSA 1IUYA 1BC8C 3K4CA 1ZHFA 1B4AA 2XAHA 3E1SA 2DFFA 4CYCB 3F8MA 2OQGA 1UG0A 2M87A 4EATA 4E7IA 4DZPA 4OU0A 3HSRA 2MBFA 1FNNA 5IT3A 2VB6A 3IWZA 1RUOA 3ZMZA 2EZLA 2DJNA 5B1BH 2XIGA 4UVCA 1JKPC 3J7AY 2OV7A 1I6HJ 4XL9A 4CYDA 1ULYA 3L1PA 2DT6A 2F5FA 3D5SC 3GTGJ 1JE8A 4B44A 5H6RA 3OS1A 2K3PA 4CCNA 3ZR8X 3PNYA 4EM2A 2V7FA 5ICEA 4C9YA 2R7FA 1SVMA 4GO1A 5KAFC 1Z0XA 2QUFA 1G3YA 2CQKA 3H35A 2L7KA 1PUEE 1XCVA 3FX3A 5CQGA 3JRBA 3QYBA 4LG3A 2EBIA 3ONQA 4KIFA 5DM6F 3SDGA 3CF2A 3FHZA 1ERDA 5BNGA 2UXXA 3TW6A 1YQAA 3ZP5A 1LEBA 2XRLA 1R1UA 2WV1A 4F7ZA 5LFAA 1OYIA 1SFKA 2L54A 3FISA 3C2GA 3ZQ7A 3C2HA 3OYAA 1G6NA 2EH3A 3DXJF 3MZ8A 3L2RA 2M34A 2ZMEB 5E17F 3CCRI 2LF8A 2X9DA 4J00A 3H9GA 1I3QJ 1OISA 3Q0VA 4BKXA 1E3OC 3DTKA 2X48A 1HQCA 1KYZA 3LSGA 3LSMA 4ESFA 3CC4I 4UHTA 4KDPA 1A35A 2DPDA 3H9QA 5E3LA 3KIOA 1LFUP 1WQ2A 1LE8A 2XUBA 5LD2C 2XSJC 2VIXA 4MO7A 4C30A 3PO2J 1SD7A 2TDXA 3WTZA 1VQNI 2HS5A 1B8IB 2O61A 3I55I 3L2UA 2M8EA 5FRNA 1D1AA 2MH9A 2XF5A 3G3ZA 3HGGA 3M8JA 2EIKH 2EIMH 1SFUA 3S3OA 3GTOJ 1Z67A 2QBYB 4EJUA 2QLZA 1Z21A 3QU6A 3GFJA 1W5CC 3S1QJ 2CH0A 3U2RA 5H6QA 4XQFA 4HF0A 3ZQLA 1BR4A 2OZUA 3DPUA 3PFIA 1BC7C 2KMUA 4D7MA 4LOCA 4R79A 3WHCA 4B4CA 1OCRH 4RLQA 1BI3A 2VUMJ 3A4CA 4ENKA 2H8RA 3ERMA 5BPDA 2FRHA 2Q2EB 3MFKA 5ICFA 4IHWA 1X4OA 1MMDA 2Y31A 2W84A 4HQMA 2P6TA 1DDNA 4E7LA 2A61A 2KDZA 2ZMEC 2OU2A 4I01A 2PMZN 2HKXA 2R5ZA 3WG7H 4OIPF 2VJJA 4F92B 4NQWA 1YIJI 1L3LA 1QPMA 3ESWB 4JK1X 3HOWJ 3IH4A 1IDZA 2EA4A 4XBFA 2MLGA 2HOAA 4S05A 1FMVA 1YX5A 1KU7A 1MNMC 2EPFA 2VJ4A 1PDNC 2K3FA 2CV0A 1D5VA 1MNDA 3P9CA 3KYCB 4ZDOA 1BW5A 2NVUB 5D8LB 2LY2A 1FOWA 2HPIA 1FBQA 3JCUC 3RKWA 3TDZC 1TWAJ 3SQNA 2F4OB 2ZXIA 2GA2A 2W1OA 1YS6A 1QZEA 3A1YA 3PIPF 2DA2A 2K9NA 3OS2A 3FHNA 1ZRCA 2BEOA 3H3UA 5E1ZB 1BR2A 1YJ9I 3CLOA 1UZCA 2WAQN 4CSWA 5LHGA 1VQPI 2L9RA 2XGXA 4WF2A 3HOUJ 4A3LJ 2ID3A 2JTVA 4WCGA 1QU3A 3K70C 1ETQA 1A5JA 3WODF 4KIBA 5AONA 3S3NA 2XAGA 4YFNF 1P4AA 4HDUA 4MGRA 1TLHB 3LA3A 4ENMA 4P96A 3IV5A 1MGTA 1YTYA 4AC0A 1W0TA 2V26A 1EH6A 4PJJA 1S3JA 2L7FP 3GZNB 2E19A 1OCPA 4II2A 3SYTA 3MKZA 3N97A 4UVAA 2EQRA 4HYEA 1ZG1A 1MSFC 3DEWA 4GYIA 2L7MP 3CCUI 4XNFA 3O2PE 1MJBA 2XPUA 3MVPA 3OR1C 4XKWA 1CGPA 1TC3C 1FWZA 2DMNA 2E2HJ 2DBBA 2L02A 2OTJI 3I4MJ 4XMYA 4MTDA 3BG6A 1DP7P 2BYVE 2BXZA 4DQ2A 4I99C 3FXUA 2ZJRF 2UV1A 1Z7UA 2YS9A 3PUFA 1GLNA 1JUPA 5HLHA 5M3MJ 2UZKA 1ETVA 4KUMA 1VTNC 3OYJA 1MBJA 2ZJQF 5F0FA 3FK6A 1ETYA 1I1GA 2G7HA 4AIDA 3OYDA 2M5WA 3L2WA 3DEUA 4XOTA 3L09A 2NS0A 2QYOA 4OIQF 3VYRB 2HYGD 4BQQA 4G9YA 2IS4A 4H4KC 5JHFA 3D0SA 2YPRA 5FKLA 2OD5A 1U9NA 4XLEA 2EFQA 1TQIA 2VKHA 1QBJA 2MSYA 3IP4B 3AG3H 1VQOI 1AWCA 1K7AA 3VSLA 2LSOA 3DLLF 1X2NA 2R7XA 1QQIA 4DGWB 3DBLB 1D5YA 5IYCJ 5JFRA 3HOZJ 5E1WA 2RREA 4F93B 2LC2A 2CS3A 3S16J 2IGMA 2R7DA 3GLLA 1WH5A 1W4MA 4WK8F 2F4MB 3WE3A 4A3DJ 1R1VA 4BU2A 2X4HA 3OYHA 1NG7A 1EH7A 2RKHA 4M3EA 1Y1WJ 3PO3J 2DA3A 2XAQA 3M4OJ 1L0OC 3HIFA 2CJJA 3OL3A 1F4KA 2Q8KA 3FXKA 1O7LA 2R7QA 1BR1A 2E36A 3EUAA 2XGDA 4OAZA 3QPSA 2IS6A 4MLOA 3WTXC 2KLOA 3KFWX 4UB8C 2PEXA 4YG2F 1YOVB 5K5OA 4DBRA 2PN6A 2F5DA 3ECOA 2BE5F 5DCMB 2R7UA 3AG4H 4L9TA 2EA2A 5CPRB 3DEEA 4WWCA 4FCYA 1XMAA 4BGDA 4I7HA 3AG2H 3R0JA 4U87A 1ZYRF 4PJNA 2F4IA 1IAWA 3F0CA 5L3DA 1KA8A 2R4GA 3RKXA 1BI2A 4BS9A 1HXDA 1BOBA 4E7HA 4L0YB 2JA8J 1IZ1A 1I50J 2JA2A 3HUGA 4JP0A 4XOPA 3PIOF 2JSCA 1FLIA 3QOEA 3FIWA 3DPTA 1JI8A 3V7RA 5LLQA 4HQEA 3H5NA 3M7GA 4XLNF 2LY1A 3ZMUA 2Y9ZA 5K7FA 5HNHA 1BL0A 2P6SA 4QWQA 3T1BA 1MSEC 2BBYA 1J59A 4YFXF 2Q1ZB 2JQ7A 1Y8QB 4HSRA 5KK1A 2VONA 3W2WA 4M3GA 4M9ZA 4HPQA 3RZOJ 4EQQA 3BQZA 3Q9VA 3HXLA 4EV0A 3SEQA 3A01A 2NVYJ 3K4JA 1ZH5A 1X4PA 2X1EA 3MWMA 4FTHA 2BHYA 2X1CA 4BQOA 1I39A 2M4KA 1XS9A 3KP7A 2OAZA 3OIQA 4RGUA 4A0YA 4N0BA 2JVHA 3CCJI 4HF1A 1YJNI 2P0WA 2ZJ2A 1B59A 2Z5UA 1T0FA 4OIRF 3LMMA 1NG6A 1RPWA 2K4JA 4OOIA 4G7OF 2G7UA 3F23A 2ECBA 2ID6A 1I3AA 4MFDA
chains in the Genus database with same CATH topology
1LUJB 1T08B 1M1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUJ B;  1T08 B;  1M1E B; 
#chains in the Genus database with same CATH topology
 2VJ5 A;  5IT9 Z;  3EUH C;  3J7Y J;  2KRH A;  2WB1 N;  2X85 A;  2LVS A;  1POG A;  3K4K A;  4IRH A;  2E1O A;  2QKL B;  2W25 A;  3FXO A;  2ACJ A;  2R5Z B;  2HQA A;  2Y0S N;  1OYY A;  3L9F A;  3G1L A;  4EGZ A;  2JRM A;  2VQG A;  2Z16 A;  1X1P A;  5CVI A;  2A68 F;  5F1J A;  3ZMS A;  1SFE A;  2NS7 A;  1BOA A;  4E7Z A;  1OR7 A;  2DO7 A;  9ANT A;  2L7Z A;  4BDY A;  2R3S A;  2XKP A;  4E6K G;  3WGI A;  2KRC A;  1F5T A;  2R7R A;  4XLF A;  3L7W A;  5KCM A;  3ZMT A;  4A69 C;  2LK2 A;  4DW6 A;  4G7H F;  2P81 A;  1UAA A;  2O6G E;  1EF4 A;  5HOO A;  2I10 A;  1DQU A;  2O3F A;  2K40 A;  5LHH A;  1DU0 A;  2ZXW H;  2JT1 A;  3FF5 A;  4ENN A;  3BWG A;  4B48 A;  4KFC A;  5ICG A;  3DCF A;  3LOC A;  1WCM J;  3BCB A;  2QSG X;  4WXC A;  3NEU A;  4C2U A;  2RC4 A;  3QOD A;  3KLN A;  3W2V A;  2X0L A;  1ON2 A;  3D1N I;  1ORK A;  2ZNZ A;  4WXD A;  1U78 A;  2HKO A;  1TWF J;  1PUF B;  3ZCO A;  3C18 A;  2QSH X;  3ABL H;  3ZQH A;  4M6X A;  3HGY A;  4FET A;  4XID A;  3MD2 A;  3GYH X;  2FBI A;  2FX0 A;  3QYE A;  5D6E A;  5J40 A;  3JRH A;  2MG4 A;  3VDX A;  3OYI A;  2FQ4 A;  1V3F A;  3BZ6 A;  2JWT A;  3J80 K;  1Y39 A;  1XGN A;  3LSJ A;  4XLP F;  2YU9 J;  1YI2 I;  4A3E J;  1S5L C;  3QU3 A;  4FE4 A;  5KHD A;  2P5L C;  3F22 A;  4U0V A;  1LDK B;  2IA2 A;  3EUK L;  5M5W J;  3PNT A;  2FOW A;  1FIA A;  5CVR A;  2EK5 A;  5D5W B;  3K4M A;  4DYC A;  2R93 J;  1ODD A;  2OC6 A;  1HCR A;  4BUP A;  2P5V A;  1ZAO A;  3F72 A;  4EJO A;  2A07 F;  1ZTR A;  1XDU A;  3SHF A;  5DV5 A;  1UMQ A;  3OWT A;  1U0J A;  4CCO A;  2IGO A;  2VBZ A;  4IHV A;  3CUQ C;  4P5O A;  2OCC H;  5D4R A;  5BMZ A;  5EZH A;  3RQI A;  3CMY A;  1D1B A;  1PVE A;  2LFB A;  3S3M A;  2IGN A;  2XPV A;  3H92 A;  4KIC A;  4HA8 A;  3WTT C;  2Y48 A;  2V1U A;  4D7N A;  3ABM H;  2KT0 A;  2O8X A;  3BOQ A;  2JK3 A;  3HOY J;  1RES A;  2A6T A;  1J2X A;  1X19 A;  4DYQ A;  3LSP A;  3CCM I;  3SJM A;  3JRA A;  1LNW A;  1YLF A;  4FIS A;  4ZZL A;  1LE8 B;  4M6V A;  3Q0U A;  2QBY A;  2M45 A;  2JMW A;  3F3X A;  5GPA A;  4LB6 B;  1VQ5 I;  2V9K A;  2K86 A;  2GWR A;  1AA7 A;  2DFI A;  2DA4 A;  1MBG A;  4IZZ A;  1PYV A;  3JRC A;  3FDY A;  3DWL E;  3QWL A;  1R9T J;  2AQF A;  1EJ9 A;  2PMH A;  2JA6 J;  2FML A;  4ZYG A;  3ULQ B;  3L2Q A;  4NC8 A;  2ADU A;  2JN6 A;  3BJO A;  5L3E A;  1E0E A;  3K4B A;  1A36 A;  1BM9 A;  1ZGJ A;  4M74 A;  2Z1D A;  2ZFW A;  4AWX B;  3S1N J;  5HLT A;  4E7K A;  2XSD C;  1BIB A;  3FXM A;  2H6C A;  1XG1 A;  4JYK A;  5LRS A;  2COM A;  4JX4 A;  4MHG A;  4UV8 A;  5TIS C;  5FRO A;  4IRI A;  2DFH A;  5F04 A;  2RQQ A;  1KYW A;  2QM3 A;  1F9N A;  2CU7 A;  2DA5 A;  3TOB A;  3BPV A;  5L3C A;  3CJN A;  4GGG A;  2CQN A;  2FF4 A;  3DP7 A;  1G4D A;  4Y4R A;  1BIA A;  3BT9 A;  3DTI A;  3SZP A;  2X6X A;  2M1B A;  1KU9 A;  4R1H A;  5JR3 A;  4HNV A;  3IUO A;  4ZDP A;  3K1M A;  3R0A A;  1IC8 A;  2GLO A;  1XN7 A;  3I71 A;  4HRI A;  4P9U A;  1YYV A;  3SZG A;  1J9I A;  1USS A;  2FBH A;  1VND A;  4QTR A;  1DPR A;  2FU4 A;  3VOE A;  5EGO A;  3CCL I;  1SAX A;  5J1Y A;  2F48 A;  3KP4 A;  1SFX A;  1OKR A;  4A5M A;  3S2D J;  4ZZD A;  2WC2 A;  2NS8 A;  4NC7 A;  4Y33 A;  2QSF X;  1V4R A;  3M3Y J;  3K1N A;  4PK4 A;  2ICW G;  4YEJ A;  4Y7N J;  1X58 A;  5EF6 A;  4CYC A;  3I58 A;  1F43 A;  1V5E A;  3TGN A;  4ABZ A;  2QWW A;  3HYI A;  3BR6 A;  3DPL C;  4LLN A;  3CJT B;  3BPX A;  5ICC A;  4LG0 A;  5FB2 A;  5IP6 A;  2V9P A;  5FGM A;  5CJ9 A;  1YG2 A;  3FMQ A;  1TWC J;  5AIP A;  1VQL I;  3DV8 A;  4RB2 C;  3CCY A;  5HOD A;  2CRG A;  1AU7 A;  1N78 A;  3JAM K;  1E3P A;  2EIJ H;  4HLY A;  3S93 A;  1R36 A;  2A5W A;  1MJA A;  1HA8 A;  2F5V A;  3NAU A;  2ETH A;  2A05 A;  2E60 A;  5FJ8 J;  3OSF A;  1P7J A;  2FJ1 A;  4PZJ A;  4M3F A;  2EJR A;  5IP7 J;  3RYR A;  3B6C A;  5JHU A;  2RNG A;  3OMY A;  4YIF A;  5D5U B;  4RB1 A;  4U7D A;  4BY1 J;  2P7V B;  2WB1 A;  4EGY A;  4GFB A;  4UVB A;  1VQ7 I;  2I5U A;  3KEO A;  3F8F A;  1R5I D;  1TZL A;  4JQF A;  5GTI C;  2LKX A;  2M7A A;  1JKQ C;  4CDG A;  2BY1 A;  2AXT C;  2OF7 A;  2ZXH A;  3CZ6 A;  2B7E A;  4MNU A;  2EZK A;  3ZRG A;  4YIR X;  2LBF A;  3ABT A;  1U5T B;  4ZTF A;  2ZO4 A;  4A3M J;  3A0B C;  2LR8 A;  1WZ2 A;  2ZSI B;  4DIQ A;  1B72 B;  2EB7 A;  3MQ0 A;  5CKT A;  4CIC A;  3HM5 A;  3VPR A;  2GZW A;  1IUF A;  3JTH A;  4UUS B;  1XD7 A;  3M8F A;  2R0Q C;  3HRS A;  3KP2 A;  4M9X A;  3GLX A;  1F36 A;  4BHB A;  2ZCW A;  5CVV A;  5GP9 A;  3HUG B;  1S9H A;  4XSZ F;  1VQK I;  2FBK A;  3KP5 A;  2EZI A;  2D5V A;  5F1R A;  2MFZ A;  4A6D A;  1G2H A;  2PX9 A;  1LFB A;  3OYC A;  3LAP A;  3V8L A;  3DFG A;  1X3U A;  3BG9 A;  1PP8 F;  3S2H J;  2KIM A;  5IT9 K;  3X2Q H;  3D5L A;  4K2E A;  4MQ9 F;  1LDD A;  4QLC U;  1T0F C;  1FMW A;  1H88 C;  4O3M A;  2V1N A;  4N4N B;  1ZQ3 P;  3J7A O;  3WTV C;  1TP4 A;  3KYL A;  1ACI A;  3CO7 C;  3FWE A;  4HX4 A;  3ZN0 A;  4PGG A;  4G6Q A;  4TV7 A;  1O3S A;  2ZSH B;  3CO6 C;  3I0T A;  1N75 A;  1Z6R A;  3A2K A;  3DBR B;  2F5E A;  1MH4 A;  3CCQ I;  2XPW A;  4EJT A;  3ROU A;  4O6J A;  3N4M A;  2L01 A;  3RPU A;  1YRN B;  4A3J J;  1R4M B;  2P5K A;  1AHD P;  2K5C A;  2LOO A;  5TJJ A;  4D5C A;  1GT0 C;  1HOM A;  4E4H A;  1A04 A;  2IGK A;  2QZ8 A;  2V9V A;  3F8N A;  4I98 B;  4Z2Y A;  3ZOB A;  4FAS D;  3RI4 A;  1RIO H;  2M7B A;  4BAC A;  5LRR A;  2Z9O A;  5C4X J;  2K85 A;  5EG0 A;  1OR7 C;  1JUS A;  3NRV A;  3HJE A;  4C2M J;  2HZT A;  3WU2 C;  3UKG A;  2DYS H;  2DMQ A;  2XGC A;  1JTX A;  3BJ6 A;  5H2F C;  2NAZ A;  4KIS A;  1HBX G;  2DI3 A;  2QQ9 A;  4LLL A;  3K4L A;  4XSX F;  2PJR B;  4N9I A;  1RI7 A;  3GCM A;  2EIL H;  5DTD A;  5DDG A;  2ELH A;  2DFE A;  2WV0 A;  2D1V A;  5KVR A;  3LQQ A;  3QPT A;  2DPU A;  4CUG A;  4MTE A;  1J75 A;  1Z05 A;  2N8G A;  3BR1 A;  3BZK A;  3OY9 A;  2R5Y B;  5LEJ A;  2HXO A;  5FLM J;  3VWB A;  1BJA A;  5CYV A;  1Y1V J;  1KON A;  1W7P B;  3CCV I;  1WJE A;  5GAG J;  1GDT A;  4HX8 A;  2JUC A;  1OCT C;  2NVQ J;  3KP6 A;  3W6K B;  2XRO A;  3Q3S A;  1MMA A;  4U0W A;  5DYM A;  5HLG A;  5EEG A;  3MKL A;  2LNB A;  1DPU A;  4M71 A;  4UUT A;  2XB0 X;  4KN4 X;  4F52 A;  5DS9 A;  3GFL A;  4KYW A;  1R5G A;  4BY7 J;  1ZKG A;  3G1M A;  3H3Z A;  2ZKZ A;  3JSP A;  4II3 A;  1TW2 A;  3OR2 C;  2MGQ A;  1ENH A;  5FFZ A;  2LF7 A;  5FO5 A;  1QNT A;  3KET A;  2KP6 A;  1D0Z A;  1K6Y A;  2QF7 A;  4ZYA A;  3HOX J;  4LD5 A;  3AG1 H;  5JVT A;  3OSG A;  3VB2 A;  1QVT A;  1OCC H;  5IY5 H;  3I53 A;  3FXL A;  3V8K A;  2ESH A;  4UXN A;  3O6B B;  1UJ8 A;  2PLY A;  5B5E C;  1ETX A;  3EQL F;  4XOR A;  1FPQ A;  2RV8 A;  2HQ5 A;  1XGS A;  2I8D A;  5M5X J;  4MIM A;  1RZ4 A;  2XAU A;  5E3M A;  4XON A;  4AUX A;  2OCE A;  4ASN A;  2V1X A;  1BW6 A;  2VKD A;  2W82 A;  3OYM A;  1H9T A;  3R4K A;  4RMN A;  2E7W A;  5D8K B;  4HST A;  2DDB A;  2VBX A;  1WJ5 A;  1P4X A;  1WGX A;  3MMY B;  2Q2E A;  3CCS I;  4KMU X;  3VYT B;  2OZ6 A;  1KU2 A;  2JRT A;  3KZY A;  2X51 A;  2H09 A;  3RDI A;  4KNY A;  2ZFU A;  3KEQ A;  4AD9 A;  2AS5 F;  3V4G A;  4BQN A;  4L9V A;  4F3Q A;  1RR8 C;  4B3X A;  2DAO A;  2XHK A;  1ITY A;  5DCF A;  4RAF A;  3D5R C;  3AAF A;  5H20 A;  2DA6 A;  4ESJ A;  2CW7 A;  1H8A C;  1VQ6 I;  2KFD A;  2MW8 A;  2GM4 A;  4OWR B;  1SD4 A;  1FZP B;  1SVL A;  1HLV A;  1ZGA A;  4NC6 A;  1QA6 A;  4BAY A;  2M9H A;  5E18 F;  2PG4 A;  3ECH A;  3LWF A;  1F1Z A;  4FHT A;  2XKO A;  2CO5 A;  5C44 J;  2WAQ A;  3OYF A;  2LG4 A;  2BHZ A;  4B3A A;  2HOT A;  4RGR A;  2DU9 A;  5D4S A;  1LQ1 A;  1FEX A;  2QQA A;  2ELK A;  2NYX A;  2DA1 A;  5D5X B;  1A6Q A;  3IH3 A;  1R22 A;  2VXD A;  2O9L A;  4IXA A;  1HKS A;  3KZZ A;  5HS9 A;  4XLA A;  1JHH A;  1W5S A;  3OYK A;  1YS7 A;  1SEU A;  3O8H A;  4MQV A;  3A02 A;  2YR2 A;  2K9M A;  2XDV A;  3K7A J;  1OCO H;  2XAS A;  1FYL A;  4ON0 A;  1BA5 A;  2E1C A;  2EV6 A;  3P9K A;  3GTK J;  1GV2 A;  1B72 A;  1S29 A;  2HGC A;  3ZQI A;  4A0Z A;  4BL0 B;  1HSJ A;  1UST A;  2M30 A;  3WTU C;  1TL8 A;  1VQ4 I;  4Q5S F;  1PJR A;  4JOM A;  1P92 A;  4LGW A;  3GZ6 A;  5BOX A;  4Y13 A;  1BBY A;  1MZB A;  3FBI B;  3F8C A;  2L0K A;  5D6F A;  1P6R A;  1T33 A;  1NTC A;  1IXR C;  2K7L A;  5EG0 B;  1ZR4 A;  4XKC A;  3FMR A;  5F08 A;  3W6J B;  3TP0 A;  2LY9 A;  1LPQ A;  2HDD A;  3NWT A;  2VQC A;  3VYU B;  4IQ4 A;  3REO A;  4L5I A;  1J5Y A;  3V7S A;  2WBM A;  3FZV A;  4IL6 C;  3M1C A;  2AQE A;  2ZBK A;  4KIG A;  1G8X A;  1XTA A;  3I59 A;  1R7J A;  3HRU A;  5DUK A;  4D9J A;  1P2F A;  2GOM A;  4RM3 A;  2C6Y A;  2AO9 A;  1WJC A;  1Z7L A;  2W4S A;  5J4Y A;  2PJP A;  3ASO H;  2R7V A;  2FNA A;  1MNE A;  4BJT A;  2V79 A;  3QPH A;  3IH2 A;  4GYG A;  1UFM A;  4FQG A;  3GW2 A;  4NUB A;  3QRF F;  3E6B A;  2ISY A;  3HHH A;  2UXN A;  3H0G J;  3LAJ A;  2YSR A;  2GQQ A;  4X1E A;  5A2Q K;  4CHU A;  1SMT A;  3S17 J;  4B09 A;  3FM3 A;  1WRJ A;  3GEZ A;  3KEY A;  3E0J B;  3BRO A;  4KJZ A;  4L9J A;  4EVI A;  2CQX A;  4HBL A;  3E5U A;  1I1S A;  4UUS A;  4Q48 A;  1Z1D A;  3K10 A;  2LRE A;  3LSK A;  3JRD A;  2NRA C;  1T38 A;  2FUG 2;  2V6E A;  3ZQQ A;  1XGM A;  3TMO A;  4GDF A;  4BXX J;  1ON1 A;  1OJL A;  4HAM A;  4IF4 A;  4PSW A;  2P4W A;  2LBF B;  1H89 C;  1RKT A;  5TRD A;  4XR6 A;  1XCB A;  3JRF A;  2LD5 A;  1T6S A;  4RB0 A;  2VOD A;  4ZC3 A;  2Q0O A;  4XRM A;  1MIJ A;  2OBP A;  3V7C A;  3DF8 A;  4M3B A;  1O3R A;  3EUH A;  3K70 D;  1NH3 A;  2Y0S A;  1STZ A;  4Y3O A;  1T39 A;  1IRG A;  2QEN A;  4JBA A;  2CUJ A;  3DU6 A;  2HI3 A;  3E5Q A;  1HC8 A;  2NVT J;  3E6C C;  2M0M A;  2KL4 A;  5GAE J;  4JX5 A;  2R7T A;  1R00 A;  3JSO A;  5DD4 A;  1V5F A;  3SEZ A;  5B3S H;  3G4S I;  3G73 A;  2BV6 A;  2IA1 A;  3AL0 C;  4I09 A;  2KJC A;  4BDZ A;  1FP1 D;  3TO9 A;  1MDM B;  4LK1 F;  1T56 A;  2BXY A;  2LH9 A;  2R7S A;  2DDA A;  1OPC A;  2QKM B;  6PAX A;  2VAS A;  1MBF A;  1YIT I;  1RRJ A;  4Y52 J;  4BE0 A;  4UNO A;  1EV7 A;  2Y0M A;  3HOV J;  4A3G J;  1JXS A;  2K9L A;  3M1E A;  4YRV A;  2EFP A;  2KZV A;  1WWX A;  2BW3 B;  4WXH A;  1IGN A;  4LIV A;  4BJ6 C;  2MC4 A;  1ZN2 A;  4DNC A;  3W3C A;  4BQA A;  3GBG A;  3S15 J;  1S6L A;  3L00 A;  1FBS A;  1W7P A;  2J5P A;  5F27 A;  1NK3 P;  1RNL A;  2E5Z A;  2XV4 S;  5F6F A;  1IN6 A;  3S2W A;  2IP2 A;  3Q9S A;  4HV5 A;  4DOZ A;  2YX4 A;  5JLW A;  2EV5 A;  4IHT A;  5FKM A;  2CUE A;  1KQ8 A;  3DKW A;  3OOP A;  4A0X A;  2GXG A;  4PFP A;  5FD5 A;  2L9S A;  2R7W A;  4DZJ A;  1K4T A;  3PUB A;  1J09 A;  3BTI A;  5EJC A;  1SMY F;  2H1K A;  2PMU A;  2E1N A;  2H8W A;  1Y0N A;  2DJI A;  5EEA A;  2Y2Z A;  3SXY A;  3VSK A;  2HQN A;  2HWV A;  2L4M A;  3HOS A;  4M73 A;  2YU3 A;  2VT2 A;  2XF7 A;  1G3S A;  3FKI J;  1V5G A;  3IAS 2;  4YEL A;  2DT5 A;  3CF5 F;  5DD8 A;  2IRF G;  2HTS A;  3Q5F A;  1Z3Y A;  4P55 A;  3RSN A;  4C2T A;  1GUU A;  3LA7 A;  2R5Y A;  4EEF G;  1VQM I;  3F21 A;  1U2W A;  4N4O B;  3ZXS A;  1U9O A;  4C3I J;  4KIT B;  2TCT A;  1FOY A;  4G6T B;  1X3Z B;  1MW7 A;  2LKP A;  1VQ8 I;  1KU3 A;  1TW3 A;  2MD5 A;  5IYD J;  2G0E A;  3BY6 A;  1WHU A;  3FK7 A;  2Z99 A;  5J8C A;  1TQM A;  1XC5 A;  3CUQ A;  2L2O A;  4XLC A;  1LVA A;  2A69 F;  3ERE D;  1IDY A;  4BJ5 C;  3P5J A;  3OIO A;  2DTR A;  4B43 A;  3CDI A;  2OUM A;  3COA C;  3B02 A;  4B1R A;  2HPM A;  1MDM A;  4LMY A;  3EDP A;  3GVA A;  2IT0 A;  1M1E B;  3P7N A;  4Y15 A;  1FSE A;  1QPI A;  2PBI A;  2KZG A;  1Z6T A;  1K61 A;  4IKF A;  2G9W A;  1T2K A;  1HW1 A;  3GFM A;  4NB5 A;  4GCV A;  4ZTJ A;  1RET A;  2PFB A;  2FA5 A;  3HZJ A;  4JX6 A;  4S0H B;  4Q4Z F;  3HEF A;  1G59 A;  5L3B A;  2STW A;  3U1K A;  1O3Q A;  1Z3X A;  4LFU A;  5HDG A;  3H3V K;  3BTL A;  4EMS A;  1ZK8 A;  4RGX A;  2Z3Y A;  4RAZ A;  1HF0 A;  2DYR H;  3TO7 A;  1D3Y A;  1FYM A;  3QPL A;  5E8G A;  2CV2 A;  1OFC X;  2BZT A;  5K7Z A;  2Z2S B;  3JRE A;  1JJ8 C;  1WH7 A;  4D5F A;  1WI9 A;  1ETO A;  1UEL B;  1LJ9 A;  3ISP A;  1IRX A;  2KIF A;  2L5Q A;  4HDV A;  2GXB A;  4W1U A;  2PMZ A;  4M3D A;  2M8G X;  3I9V 2;  1TT5 B;  1LEA A;  3BTC A;  2VOP A;  1U6G A;  1N25 A;  3BZC A;  5B1A H;  3HSE A;  2DTZ A;  3MEX A;  2F5C A;  2W00 A;  3F9K A;  1JT6 A;  3I3L A;  1R5H A;  4XIC A;  3HB9 A;  1RUN A;  3GX4 X;  2CFO A;  4L18 B;  1LVK A;  3NQO A;  1YX3 A;  3CDL A;  4U0Y A;  3DKY A;  1T95 A;  2KDO A;  3RZD J;  1WI3 A;  2COB A;  4RAG A;  5LGN A;  1YW8 A;  2JSP A;  2K02 A;  3VEP A;  1IJW C;  1MJ9 A;  3DTE A;  1S7E A;  1X1D A;  3R6S A;  1REP C;  2E1M B;  4Z6Y A;  4LJZ F;  4UV9 A;  4DBQ A;  2X1D A;  1K4S A;  2XRN A;  3BG7 A;  3M8E A;  1YO5 C;  3PL8 A;  2BOL A;  3OYN A;  3HC7 A;  5J4V A;  3FM5 A;  4AVP A;  4F55 A;  1O57 A;  2QCO A;  5M3F J;  5E1X A;  5IOY A;  2X6O A;  4GRI A;  3PJR A;  2R92 J;  3G1O A;  1OYW A;  4FT8 A;  2ECC A;  2J5O A;  1D0X A;  1MBE A;  1X3W B;  1EH8 A;  2NNY A;  2HOS A;  3BLY A;  3BR3 A;  2EWN A;  3CES A;  4HNT A;  4U88 A;  1RKW A;  4BBR J;  4AU7 A;  3DLA A;  3RYP A;  3LNQ A;  2NVX J;  3OS0 A;  1UB9 A;  3K2A A;  1YFH A;  1CQT A;  2GIV A;  1OMI A;  4ZH4 F;  3K69 A;  3TP3 A;  2KPM A;  2MH2 A;  3BG5 A;  3IAM 2;  4RBO A;  2WAF A;  1WSU A;  3GFI A;  1KGS A;  2KIU A;  3U21 A;  4E70 A;  3JR9 A;  1A6I A;  1ZRE A;  1DGW Y;  3ZQF A;  5GPC A;  4EM0 B;  2M4G A;  2DK5 A;  2DMT A;  2V6C A;  1R4N B;  4BE2 A;  2F2E A;  2LP0 A;  2E7X A;  2PQ8 A;  2K9S A;  3OYG A;  3CDH A;  1K78 A;  1ZRD A;  4L5J A;  2IBD A;  1MKM A;  4MFE A;  5LEK A;  1SD5 A;  2O0Y A;  2B63 J;  1R23 A;  3J81 Z;  4KT6 A;  2DQR A;  3DQV C;  2JA7 J;  2XAJ A;  4C3J J;  2GXA A;  5CLS A;  4L9N A;  3B73 A;  4M72 A;  5K1Y A;  4A12 A;  1T8I A;  3FMS A;  1MBK A;  1N77 A;  2CQ7 A;  4OAY A;  1VF9 A;  4AIK A;  2O03 A;  1TWG J;  2BW3 A;  2KIQ A;  2VKV A;  4A2U A;  3RIR A;  5DEQ A;  4BHP A;  4IOA F;  2CUF A;  5L3F A;  4PDK A;  1JHF A;  3UNG C;  1ZAR A;  1B6A A;  2PJR A;  4KMF A;  4B8X A;  1ZG3 A;  3HKZ A;  3HPG A;  2CYY A;  5FKK A;  1I27 A;  3K2Z A;  3QAH A;  3TBI A;  3ZMD A;  5IOZ A;  4XRS A;  1W0U A;  5IPA A;  1XSD A;  2ZC2 A;  3RCO A;  3GTJ J;  2Y30 A;  5E3N A;  2VBY A;  2GBY A;  4X6A J;  3IC7 A;  1WJA A;  4A3F J;  4P9F A;  2HR3 A;  2CGP A;  2HFH A;  2DOD A;  1QVU A;  4NQW B;  4MEY F;  1O3T A;  3LFU A;  2A5Y B;  2CW8 A;  2FEZ A;  1ZR2 A;  4PJ0 C;  1Z91 A;  3T0Y A;  2W48 A;  4AM3 A;  3FBN B;  2WTE A;  2GA1 A;  3HRM A;  1TNS A;  2RNJ A;  4NBQ A;  3LQR A;  1FC3 A;  1UHS A;  5HDN A;  1G3W A;  3HBL A;  1FOX A;  1DU6 A;  2HTJ A;  3BDD A;  1X2M A;  1IW7 F;  5ILS A;  3BQY A;  2L9V A;  4ZYD A;  4FX0 A;  3TL4 X;  3CME I;  2XB5 A;  4CH7 A;  2V1D A;  3ASN H;  3RTR A;  3HPH A;  4HLX A;  3HKZ N;  4A3I J;  2VXZ A;  4OIN F;  2X6Y A;  3LFK A;  1X1A A;  2QVO A;  3MZY A;  2DK8 A;  4RDU A;  3J7Z I;  3HTS B;  1HDP A;  5K5Q A;  3VFZ A;  1WFX A;  4ZYE A;  4OMY A;  1D1C A;  1IG7 A;  3EYY A;  2L3D A;  2H6B A;  3CMA I;  4V2G A;  3RKY A;  3KX2 A;  1FJL A;  1A31 A;  3KE2 A;  4UY8 I;  4QIW N;  2CSO A;  2MC3 A;  1VI0 A;  3ZQG A;  5HS7 A;  1WVR A;  4IHS A;  5K7H A;  3ELK A;  4BH9 A;  2CQQ A;  3KP3 A;  4HF2 A;  3KPH A;  4BEH A;  2HYJ A;  5E20 A;  1MMS A;  3A01 B;  1K79 A;  3ML6 A;  2WA0 A;  1AOY A;  5FRM A;  3BG3 A;  1IXS B;  4HOB A;  3FXQ A;  4CCJ A;  2P7C B;  4IEJ A;  2VN2 A;  4I6Z A;  1DGR M;  2VBW A;  2FOK A;  3E6D A;  1CF7 B;  3H5A A;  1FX7 A;  2UWM A;  1FSH A;  1W7P D;  5HNF A;  1CF7 A;  3O8G A;  5FLX Z;  1SAN A;  1SFO J;  2EFN A;  2CUZ A;  2ZB9 A;  3HRT A;  2CFX A;  4PJL A;  5M5Y J;  5HDK A;  4IX7 A;  2K4B A;  4AVZ A;  3P9I A;  1EKE A;  2VL8 A;  3CLQ A;  1QZY A;  3WTW C;  1W5T A;  4PFO A;  5JLX A;  1SVO A;  3MN2 A;  1XMK A;  2LMD A;  2VLA A;  2ME0 A;  2ZME A;  2PI0 A;  1IRF A;  1FIP A;  5F0H A;  1LDJ A;  2HVS A;  3F6O A;  4KA4 A;  3LSH A;  5D5V B;  4RAY A;  1MMG A;  4RGS A;  3E5X A;  2HU9 A;  3L2V A;  3MCZ A;  1U5T C;  3C3W A;  2FMY A;  4XKV A;  3OYB A;  3KLO A;  3T5X A;  3TED A;  5IYB J;  3WU0 A;  3LL7 A;  3U9G A;  4LG0 B;  1LFP A;  1K78 B;  3M9A A;  2DMU A;  1I5Z A;  2GIZ A;  1NHA A;  5LHI A;  1C0W A;  4R8H A;  1KZH A;  2BY3 A;  2GOX B;  3O3K A;  1QZZ A;  3LSR A;  3TKY A;  3H1C A;  1IN8 A;  2LRD A;  3BJA A;  1UCR A;  1UHW A;  2HZD A;  1YW7 A;  2IJL A;  3HTU A;  4IO9 F;  2DOA A;  3I64 A;  4LIT A;  1GXQ A;  2QA4 I;  1B9M A;  4WX9 A;  3GME A;  3GZ5 A;  1IV8 A;  1B1B A;  3H0D A;  1VFC A;  4G6D A;  1FBU A;  3CC7 I;  1Y8R B;  4IHY A;  2GAU A;  1XX5 A;  3PNV A;  4BHC A;  1ZRF A;  5CQE A;  5ERI A;  3FKJ A;  5A2Q Z;  3WGH A;  4I0B A;  3AKZ A;  4D0P A;  4C3H J;  2M2E A;  3PQK A;  3I4P A;  1LUJ B;  3IKT A;  4V19 K;  2R7O A;  3H36 A;  4UUV A;  2RDP A;  3QQA A;  3GXO A;  1JJ6 C;  2CV1 A;  4YFK F;  2LKS A;  5DUI A;  1U8B A;  1JT0 A;  3UR3 C;  4E7J A;  1XPX A;  5ILV A;  2ESN A;  3ZPL A;  2H94 A;  2NXN B;  1XSX A;  2WAD A;  3TDU C;  3S1R J;  3WTS C;  4XRF A;  1GXP A;  3PSI A;  4DYR A;  5DM7 F;  2K9Q A;  5FLV A;  3HSF A;  4I76 A;  4NDL A;  1W36 D;  3BP8 A;  1IV6 A;  4Y17 A;  2XVC A;  5J3L A;  2ZJP F;  2O8K A;  1O4X A;  2VQL A;  5J6X A;  3LA2 A;  1TBX A;  2DOF A;  1TQP A;  3IKV A;  3FXR A;  2K27 A;  5JI6 A;  1YIO A;  1WJD A;  3MKY B;  1GVJ A;  2BY0 A;  4GXO A;  1OCZ H;  3NAR A;  3U1D A;  1BJZ A;  1RC9 A;  1R71 A;  2VPL A;  2JA5 J;  4XLH A;  2STT A;  3ZGK A;  4EM1 A;  1IXC A;  1FY7 A;  4BNC A;  2M0C A;  4HW0 A;  3OV8 A;  3RPQ A;  1BI1 A;  3OOU A;  2DT7 B;  5FLX K;  2QQB A;  1S72 I;  2RGV A;  4F91 B;  4LLG F;  4M6Y A;  2O7O A;  3HL2 A;  1JKO C;  4BXU A;  2VE8 A;  1GVD A;  4CCK A;  4IVN A;  5GAH J;  4RA2 A;  1AKH B;  4HNU A;  3I56 I;  4FE7 A;  3JRG A;  2B0L A;  3V42 A;  1MMN A;  2BVM A;  4HEA 2;  3ABK H;  3F6V A;  3OIP A;  2DW4 A;  1UHM A;  1FTT A;  3RPU D;  2ME6 A;  2Z33 A;  2LLK A;  2ISZ A;  1P9Q C;  1VQ9 I;  5J1R A;  3T8T A;  2EIN H;  2FD5 A;  2VE9 A;  5GTH C;  3G71 I;  4IRG A;  1J7K A;  3CUO A;  2CMP A;  3WU1 B;  1DUX C;  2JPC A;  1FOK A;  2JUG A;  2E71 A;  2E5N A;  3I59 B;  2RQP A;  4UB6 C;  4FX4 A;  1Y0U A;  3LSI A;  4QPO A;  3E7L A;  2R7Z J;  4BXF A;  4XN3 A;  4L5E A;  3V8J A;  1X1B A;  2DMP A;  1JKR C;  3H5R A;  3IHU A;  4J01 A;  3K1P A;  1Y56 A;  1JGG A;  2IPQ X;  2QGU A;  2A6E F;  3OYL A;  1T08 B;  2QEX I;  5LGT A;  1RR7 A;  1X1C A;  1E17 A;  1VZ0 A;  4HX7 A;  3W6V A;  3R61 A;  2W24 A;  4RS8 A;  4CXF A;  3DKX A;  1YHQ I;  1P4W A;  3PSF A;  4P1W A;  1B9N A;  3PM1 A;  3OYE A;  2IS1 A;  1R1T A;  2RAE A;  1KQ0 A;  1HKT A;  3CCE I;  1K83 J;  2MAB A;  1QHG A;  4HV6 A;  5CVU A;  1R58 A;  3QOP A;  2ZNY A;  1QHH D;  3I5U A;  4O5V A;  4PCQ A;  3EPZ A;  5FFX A;  1WPK A;  3EET A;  2XGE A;  3TO6 A;  1S7A A;  1G3T A;  2EFW A;  2HEO A;  4CZZ A;  1FTZ A;  2BVL A;  3A03 A;  3WG9 A;  4I0A A;  2W85 A;  1ZEL A;  3MKW B;  1P7I A;  2IVM A;  2IXS A;  4J19 A;  3I4N J;  3C2B A;  5E79 C;  1D0Y A;  1XMX A;  5B66 C;  3T8R A;  1XGO A;  4X0G A;  2D45 A;  3C7J A;  1ZLK A;  3RJP A;  2VQH A;  1Y6I A;  2XF6 A;  2A6H F;  2H1L A;  3JTG A;  3CJR B;  4E7S A;  3BC8 A;  3Q0W A;  1HST A;  2ELJ A;  2P8T A;  2LDU A;  5F0C A;  3M07 A;  2JPB A;  1LB2 A;  3CTA A;  5KNL A;  1LKX A;  1W1W E;  2HVR A;  3CC2 I;  2CW0 F;  5EZG A;  3SZT A;  4I02 A;  4CO8 A;  4LB5 A;  4PSX A;  4EJW A;  3EYI A;  5EGO B;  1WJF A;  4LIU A;  4RM2 A;  4CGZ A;  3RKQ A;  4N9H A;  2IS2 A;  1ZLJ A;  2ZXJ A;  1TT0 A;  3VOD A;  3BR5 A;  4IJA A;  3QP6 A;  5FKN A;  2MLK A;  3S8P A;  1KQ9 A;  4AYB N;  4A3C J;  3WTY C;  3S14 J;  1XB4 A;  1SAU A;  4PGH A;  2AXL A;  3H9J A;  4IQJ A;  2HXI A;  2L9N A;  1HDD C;  1XSV A;  2EV0 A;  1YJW I;  2DLL A;  1MBH A;  3CUQ B;  4G7Z F;  5IP9 J;  1TWH J;  2OQR A;  5ED4 A;  2NOJ B;  3ZN1 A;  2KJB A;  1APL C;  2DN0 A;  1OLT A;  5EDN A;  2RVC A;  4CCL A;  3GTQ J;  1NK2 P;  4ETS A;  2KIS A;  3HG9 A;  3CP8 A;  2B9S A;  3GO5 A;  3R60 A;  4M9S A;  4A5N A;  3K0L A;  5AIQ A;  1BN5 A;  2UUZ A;  1V54 H;  5CVJ A;  5BS6 A;  4ITV A;  4S04 A;  1YW9 A;  2D2W A;  5EYR A;  1QO0 D;  2LYC A;  3C1D A;  5E8I A;  4I2O A;  3IL2 A;  3MAJ A;  5FD6 A;  2HOE A;  2HNH A;  4MEX F;  2L4A A;  2MYS A;  1FYK A;  5HVQ C;  1XDS A;  4PUS A;  3CQZ J;  2HDW A;  3HDD A;  3PFY A;  3TQN A;  1ZGW A;  1ETW A;  2WY8 Q;  4RLF A;  3ZQC A;  2E2I J;  2FSW A;  5ILU A;  5C3E J;  3GTP J;  2NNN A;  1R49 A;  1U3E M;  3SDB A;  1JUM A;  3KYD B;  3LST A;  1PP7 U;  4HZF A;  5F64 A;  3I54 A;  1Z77 A;  4A6E A;  4IHX A;  1IN5 A;  4OIO F;  2A3S A;  1TNT A;  4RB3 C;  2E2J J;  2JVG A;  1DP3 A;  1U8R A;  2MD0 A;  4IOC F;  2FNP A;  2DA7 A;  2X6W A;  3GF2 A;  3WHB A;  2KHM A;  5E3O A;  2VKE A;  2Y9Y A;  4YII A;  5BPI A;  4NNJ A;  5HLI A;  3WE2 A;  4B47 A;  4BE1 A;  3N05 A;  4XN0 A;  2E1M C;  2Y69 H;  5TGT A;  4BBS J;  2IAI A;  1HW5 A;  3SFZ A;  3B6A A;  4ANJ A;  4QSH A;  3GUD A;  2QQ8 A;  4AIJ A;  3OL4 A;  1ETK A;  1T98 A;  2VC1 A;  2OJE D;  2IW5 A;  4XM3 A;  3E3V A;  1WKM A;  4XKB A;  1K6O A;  1B8I A;  3S32 A;  2DOE A;  3SFI A;  3JRI A;  1UG2 A;  5HS8 A;  5C4J J;  4XK4 A;  1U5T A;  1WJB A;  4D1Q A;  2HDC A;  5FKO A;  1H0M A;  2YX7 A;  3K4N A;  2W7N A;  2FXA A;  5LGU A;  2OTL I;  2W57 A;  1JTY A;  1QRY A;  3FXJ A;  3J81 K;  1E3H A;  1I6X A;  3ABU A;  2RN7 A;  2FQ3 A;  3GTM J;  4EJV A;  4LK0 F;  1IRZ A;  2FE3 A;  2LTP A;  1S8N A;  5GAD J;  4IPA A;  3GWZ A;  2VT3 A;  4PJM A;  4A93 J;  1YE9 A;  4Q47 A;  1S7O A;  4U7B A;  5L3G A;  1J0R A;  3JW4 A;  1FT9 A;  4W97 A;  3G6E I;  2WY7 Q;  3DBH B;  4CA0 A;  2V4J C;  1D8J A;  4V2F A;  1YRN A;  3QP5 A;  3PQJ A;  2VPR A;  2HYF A;  1E2X A;  3BTJ A;  5J47 A;  2IA0 A;  3E6M A;  3L2C A;  1IF1 A;  1Z9C A;  1MD0 A;  1FP2 A;  2F6C A;  1BI0 A;  4BEH B;  4G12 A;  2HQR A;  3ZMV A;  2CG4 A;  5J8F A;  3WGG A;  1H9G A;  3K6G A;  5BQT A;  3IRQ A;  2VI6 A;  1ONV A;  2XC7 A;  2OA4 A;  3AL0 B;  1AKH A;  4BYY A;  3MZH A;  4G94 A;  2Y75 A;  1IN4 A;  3HOT A;  1Q1H A;  1TTY A;  1QGP A;  3DU5 A;  5LBQ A;  2AHQ A;  3CD6 I;  4ENJ A;  1GHC A;  2XAF A;  3F8B A;  1OQY A;  2VC0 A;  2H27 A;  4KT5 C;  3G2B A;  2E35 A;  1D8K A;  2EZH A;  2M3A A;  2MA3 A;  2DQL A;  3AFH A;  3W2A A;  1Q1V A;  2WWY A;  2D1H A;  3TOA A;  3CP2 A;  3NWS A;  5EEH A;  4AYB A;  5K5R A;  2DXI A;  3RQ4 A;  2HVQ A;  3TW7 A;  4L0Z B;  1JGS A;  3A0H C;  2CWE A;  4ESB A;  2VJI A;  3KCC A;  1W36 C;  1ZG5 A;  5J1U A;  1IN7 A;  2JJ7 A;  2KRF A;  1SC7 A;  4H0E A;  5DCM A;  1R6R A;  4A3K J;  2BGC A;  4AIH A;  2E34 A;  3CJQ B;  2TRT A;  1O7F A;  2DCE A;  2JZY A;  4CCM A;  4A3B J;  3JAM Z;  3K9T A;  3BR2 A;  3IRR A;  2WAE A;  1HKQ A;  1V55 H;  4G8X A;  4NHJ A;  2KKO A;  4ZYH A;  3CMM A;  4CZC A;  3HHG A;  1HW2 A;  4OMZ A;  3BCA A;  4DJA A;  4ZDL A;  4KN7 X;  4XRS G;  3IWF A;  3GTL J;  3S1M J;  2VOO A;  4ZJZ A;  1MH3 A;  4QPQ A;  1GV5 A;  2KQR A;  3E97 A;  4HG2 A;  5KAI C;  2O5R A;  1SD6 A;  2NOG A;  3J80 Z;  2OPT A;  3BR0 A;  1IO2 A;  3KZI C;  3QYF A;  2EFO A;  1PUF A;  2IEK A;  3VYS B;  5JVG F;  1EA3 A;  2BY2 A;  2YUS A;  1IUY A;  1BC8 C;  3K4C A;  1ZHF A;  1B4A A;  2XAH A;  3E1S A;  2DFF A;  4CYC B;  3F8M A;  2OQG A;  1UG0 A;  2M87 A;  4EAT A;  4E7I A;  4DZP A;  4OU0 A;  3HSR A;  2MBF A;  1FNN A;  5IT3 A;  2VB6 A;  3IWZ A;  1RUO A;  3ZMZ A;  2EZL A;  2DJN A;  5B1B H;  2XIG A;  4UVC A;  1JKP C;  3J7A Y;  2OV7 A;  1I6H J;  4XL9 A;  4CYD A;  1ULY A;  3L1P A;  2DT6 A;  2F5F A;  3D5S C;  3GTG J;  1JE8 A;  4B44 A;  5H6R A;  3OS1 A;  2K3P A;  4CCN A;  3ZR8 X;  3PNY A;  4EM2 A;  2V7F A;  5ICE A;  4C9Y A;  2R7F A;  1SVM A;  4GO1 A;  5KAF C;  1Z0X A;  2QUF A;  1G3Y A;  2CQK A;  3H35 A;  2L7K A;  1PUE E;  1XCV A;  3FX3 A;  5CQG A;  3JRB A;  3QYB A;  4LG3 A;  2EBI A;  3ONQ A;  4KIF A;  5DM6 F;  3SDG A;  3CF2 A;  3FHZ A;  1ERD A;  5BNG A;  2UXX A;  3TW6 A;  1YQA A;  3ZP5 A;  1LEB A;  2XRL A;  1R1U A;  2WV1 A;  4F7Z A;  5LFA A;  1OYI A;  1SFK A;  2L54 A;  3FIS A;  3C2G A;  3ZQ7 A;  3C2H A;  3OYA A;  1G6N A;  2EH3 A;  3DXJ F;  3MZ8 A;  3L2R A;  2M34 A;  2ZME B;  5E17 F;  3CCR I;  2LF8 A;  2X9D A;  4J00 A;  3H9G A;  1I3Q J;  1OIS A;  3Q0V A;  4BKX A;  1E3O C;  3DTK A;  2X48 A;  1HQC A;  1KYZ A;  3LSG A;  3LSM A;  4ESF A;  3CC4 I;  4UHT A;  4KDP A;  1A35 A;  2DPD A;  3H9Q A;  5E3L A;  3KIO A;  1LFU P;  1WQ2 A;  1LE8 A;  2XUB A;  5LD2 C;  2XSJ C;  2VIX A;  4MO7 A;  4C30 A;  3PO2 J;  1SD7 A;  2TDX A;  3WTZ A;  1VQN I;  2HS5 A;  1B8I B;  2O61 A;  3I55 I;  3L2U A;  2M8E A;  5FRN A;  1D1A A;  2MH9 A;  2XF5 A;  3G3Z A;  3HGG A;  3M8J A;  2EIK H;  2EIM H;  1SFU A;  3S3O A;  3GTO J;  1Z67 A;  2QBY B;  4EJU A;  2QLZ A;  1Z21 A;  3QU6 A;  3GFJ A;  1W5C C;  3S1Q J;  2CH0 A;  3U2R A;  5H6Q A;  4XQF A;  4HF0 A;  3ZQL A;  1BR4 A;  2OZU A;  3DPU A;  3PFI A;  1BC7 C;  2KMU A;  4D7M A;  4LOC A;  4R79 A;  3WHC A;  4B4C A;  1OCR H;  4RLQ A;  1BI3 A;  2VUM J;  3A4C A;  4ENK A;  2H8R A;  3ERM A;  5BPD A;  2FRH A;  2Q2E B;  3MFK A;  5ICF A;  4IHW A;  1X4O A;  1MMD A;  2Y31 A;  2W84 A;  4HQM A;  2P6T A;  1DDN A;  4E7L A;  2A61 A;  2KDZ A;  2ZME C;  2OU2 A;  4I01 A;  2PMZ N;  2HKX A;  2R5Z A;  3WG7 H;  4OIP F;  2VJJ A;  4F92 B;  4NQW A;  1YIJ I;  1L3L A;  1QPM A;  3ESW B;  4JK1 X;  3HOW J;  3IH4 A;  1IDZ A;  2EA4 A;  4XBF A;  2MLG A;  2HOA A;  4S05 A;  1FMV A;  1YX5 A;  1KU7 A;  1MNM C;  2EPF A;  2VJ4 A;  1PDN C;  2K3F A;  2CV0 A;  1D5V A;  1MND A;  3P9C A;  3KYC B;  4ZDO A;  1BW5 A;  2NVU B;  5D8L B;  2LY2 A;  1FOW A;  2HPI A;  1FBQ A;  3JCU C;  3RKW A;  3TDZ C;  1TWA J;  3SQN A;  2F4O B;  2ZXI A;  2GA2 A;  2W1O A;  1YS6 A;  1QZE A;  3A1Y A;  3PIP F;  2DA2 A;  2K9N A;  3OS2 A;  3FHN A;  1ZRC A;  2BEO A;  3H3U A;  5E1Z B;  1BR2 A;  1YJ9 I;  3CLO A;  1UZC A;  2WAQ N;  4CSW A;  5LHG A;  1VQP I;  2L9R A;  2XGX A;  4WF2 A;  3HOU J;  4A3L J;  2ID3 A;  2JTV A;  4WCG A;  1QU3 A;  3K70 C;  1ETQ A;  1A5J A;  3WOD F;  4KIB A;  5AON A;  3S3N A;  2XAG A;  4YFN F;  1P4A A;  4HDU A;  4MGR A;  1TLH B;  3LA3 A;  4ENM A;  4P96 A;  3IV5 A;  1MGT A;  1YTY A;  4AC0 A;  1W0T A;  2V26 A;  1EH6 A;  4PJJ A;  1S3J A;  2L7F P;  3GZN B;  2E19 A;  1OCP A;  4II2 A;  3SYT A;  3MKZ A;  3N97 A;  4UVA A;  2EQR A;  4HYE A;  1ZG1 A;  1MSF C;  3DEW A;  4GYI A;  2L7M P;  3CCU I;  4XNF A;  3O2P E;  1MJB A;  2XPU A;  3MVP A;  3OR1 C;  4XKW A;  1CGP A;  1TC3 C;  1FWZ A;  2DMN A;  2E2H J;  2DBB A;  2L02 A;  2OTJ I;  3I4M J;  4XMY A;  4MTD A;  3BG6 A;  1DP7 P;  2BYV E;  2BXZ A;  4DQ2 A;  4I99 C;  3FXU A;  2ZJR F;  2UV1 A;  1Z7U A;  2YS9 A;  3PUF A;  1GLN A;  1JUP A;  5HLH A;  5M3M J;  2UZK A;  1ETV A;  4KUM A;  1VTN C;  3OYJ A;  1MBJ A;  2ZJQ F;  5F0F A;  3FK6 A;  1ETY A;  1I1G A;  2G7H A;  4AID A;  3OYD A;  2M5W A;  3L2W A;  3DEU A;  4XOT A;  3L09 A;  2NS0 A;  2QYO A;  4OIQ F;  3VYR B;  2HYG D;  4BQQ A;  4G9Y A;  2IS4 A;  4H4K C;  5JHF A;  3D0S A;  2YPR A;  5FKL A;  2OD5 A;  1U9N A;  4XLE A;  2EFQ A;  1TQI A;  2VKH A;  1QBJ A;  2MSY A;  3IP4 B;  3AG3 H;  1VQO I;  1AWC A;  1K7A A;  3VSL A;  2LSO A;  3DLL F;  1X2N A;  2R7X A;  1QQI A;  4DGW B;  3DBL B;  1D5Y A;  5IYC J;  5JFR A;  3HOZ J;  5E1W A;  2RRE A;  4F93 B;  2LC2 A;  2CS3 A;  3S16 J;  2IGM A;  2R7D A;  3GLL A;  1WH5 A;  1W4M A;  4WK8 F;  2F4M B;  3WE3 A;  4A3D J;  1R1V A;  4BU2 A;  2X4H A;  3OYH A;  1NG7 A;  1EH7 A;  2RKH A;  4M3E A;  1Y1W J;  3PO3 J;  2DA3 A;  2XAQ A;  3M4O J;  1L0O C;  3HIF A;  2CJJ A;  3OL3 A;  1F4K A;  2Q8K A;  3FXK A;  1O7L A;  2R7Q A;  1BR1 A;  2E36 A;  3EUA A;  2XGD A;  4OAZ A;  3QPS A;  2IS6 A;  4MLO A;  3WTX C;  2KLO A;  3KFW X;  4UB8 C;  2PEX A;  4YG2 F;  1YOV B;  5K5O A;  4DBR A;  2PN6 A;  2F5D A;  3ECO A;  2BE5 F;  5DCM B;  2R7U A;  3AG4 H;  4L9T A;  2EA2 A;  5CPR B;  3DEE A;  4WWC A;  4FCY A;  1XMA A;  4BGD A;  4I7H A;  3AG2 H;  3R0J A;  4U87 A;  1ZYR F;  4PJN A;  2F4I A;  1IAW A;  3F0C A;  5L3D A;  1KA8 A;  2R4G A;  3RKX A;  1BI2 A;  4BS9 A;  1HXD A;  1BOB A;  4E7H A;  4L0Y B;  2JA8 J;  1IZ1 A;  1I50 J;  2JA2 A;  3HUG A;  4JP0 A;  4XOP A;  3PIO F;  2JSC A;  1FLI A;  3QOE A;  3FIW A;  3DPT A;  1JI8 A;  3V7R A;  5LLQ A;  4HQE A;  3H5N A;  3M7G A;  4XLN F;  2LY1 A;  3ZMU A;  2Y9Z A;  5K7F A;  5HNH A;  1BL0 A;  2P6S A;  4QWQ A;  3T1B A;  1MSE C;  2BBY A;  1J59 A;  4YFX F;  2Q1Z B;  2JQ7 A;  1Y8Q B;  4HSR A;  5KK1 A;  2VON A;  3W2W A;  4M3G A;  4M9Z A;  4HPQ A;  3RZO J;  4EQQ A;  3BQZ A;  3Q9V A;  3HXL A;  4EV0 A;  3SEQ A;  3A01 A;  2NVY J;  3K4J A;  1ZH5 A;  1X4P A;  2X1E A;  3MWM A;  4FTH A;  2BHY A;  2X1C A;  4BQO A;  1I39 A;  2M4K A;  1XS9 A;  3KP7 A;  2OAZ A;  3OIQ A;  4RGU A;  4A0Y A;  4N0B A;  2JVH A;  3CCJ I;  4HF1 A;  1YJN I;  2P0W A;  2ZJ2 A;  1B59 A;  2Z5U A;  1T0F A;  4OIR F;  3LMM A;  1NG6 A;  1RPW A;  2K4J A;  4OOI A;  4G7O F;  2G7U A;  3F23 A;  2ECB A;  2ID6 A;  1I3A A;  4MFD A; 
#chains in the Genus database with same CATH homology
 1LUJ B;  1T08 B;  1M1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...