1T08B

Crystal structure of beta-catenin/icat helical domain/unphosphorylated apc r3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
GKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-catenin
publication title Mechanism of phosphorylation-dependent binding of APC to beta-catenin and its role in beta-catenin degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/cell cycle
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1t08B00
1LUJB 1M1EB 1T08B
chains in the Genus database with same CATH superfamily
2LK2A 4P9FA 2HU9A 4L9VA 4EM1A 1NTCA 1B72B 5EJCA 3Q5FA 3WTZA 1WHUA 2L5QA 3OR1C 2LH9A 2DYRH 1IO2A 1YIOA 2IGMA 5GADJ 3JRFA 1VZ0A 4G7ZF 1IXRC 4HZFA 2JJ7A 5FO5A 1E17A 3P9KA 4G8XA 3F22A 5BQTA 1HLVA 2XVCA 3LOCA 5CVRA 1ZTRA 1OFCX 5F6FA 1J5YA 2R7UA 1WJEA 1DPRA 1U2WA 4RM3A 3MMYB 1ETXA 1SMYF 4I02A 3RKWA 2EPFA 2EFQA 1FLIA 3KEOA 1BR2A 3RKQA 2HDDA 4II2A 1OQYA 1P4XA 1P7IA 4UVCA 4P5OA 4UXNA 2X48A 3ELKA 3SFIA 2EA4A 3VB2A 1EJ9A 3GX4X 5KAIC 1XGSA 3CTAA 4XQFA 3E3VA 4Y15A 2KKOA 1R5HA 3SDBA 2XGEA 5A2QK 1X58A 4LLLA 3RKYA 2LSOA 2PN6A 1IN7A 1K6OA 1Z91A 5K1YA 6PAXA 1BJAA 4IRHA 4A3IJ 3I56I 2L54A 2MABA 2Y30A 3HOYJ 3HTUA 2JSPA 3Q0VA 1J09A 1GT0C 2JA8J 5JFRA 1K4TA 4CO8A 1YOVB 4P55A 3WTWC 1WRJA 2BY0A 2F5VA 4W1UA 2DA7A 2K27A 4Y3OA 2X4HA 2ZCWA 3BG7A 1UHWA 5HDGA 1MJBA 2Y69H 4XONA 2IA1A 1PJRA 2CS3A 2HVSA 3QYEA 2B63J 2OTJI 2O9LA 2HVQA 3SZGA 4LK0F 1SAUA 1V5GA 2JVGA 3A4CA 4ZZLA 4EVIA 2ZXJA 1SD7A 3E97A 3M8EA 4XRSA 2X6OA 4EMSA 5LLQA 3AG1H 2BY1A 4U87A 5JLXA 1Z3XA 4O5VA 3TGNA 4M3EA 3OSFA 4JBAA 5BPDA 2VBXA 1H9TA 3BOQA 2NOGA 2RKHA 3GZ6A 3MCZA 4JP0A 5F64A 4DOZA 2PMHA 3H9GA 3BTJA 4WX9A 2HR3A 1YRNB 2HPIA 1FSHA 5ICCA 2EZLA 2NVXJ 3LMMA 2IGKA 1T8IA 2Z2SB 1J59A 3AL0B 1EF4A 2PJRB 2CW0F 2HOTA 3CUQC 3ZMDA 3OIQA 1RETA 2V26A 1SMTA 4II3A 1DGRM 4A69C 2JSCA 1RRJA 3OYEA 2R7WA 2HVRA 4I99C 1UELB 1MBHA 3CUQA 2IA2A 2KLOA 2X85A 2P5KA 3OY9A 1USTA 1XDSA 3S1RJ 2ZBKA 3CJQB 3DP7A 4ZJZA 4HDUA 4ESJA 4AIHA 2WADA 2HOEA 1HDDC 4HSTA 1Y56A 4ZDOA 4MIMA 3S2HJ 2KIUA 4M6YA 3IWFA 2M8GX 1ZN2A 4KJZA 1SD4A 2P81A 3J81Z 4BQNA 2QA4I 4UUSB 3TO7A 2PMZN 2ECCA 4OIOF 2M5WA 1XSVA 4GO1A 5E79C 4L5IA 5J1RA 4YIIA 2NVYJ 3OOUA 3WHCA 2LF7A 1ETKA 5EGOA 4WXCA 4GGGA 4A6DA 4EJVA 5JHUA 2KDOA 3I59A 4DZPA 3ZMUA 5HDNA 2EFOA 1OKRA 2KISA 1G3YA 2K40A 4L9TA 3F3XA 2JWTA 1IRZA 1YI2I 2H1LA 3D5LA 1BOBA 3FIWA 1RI7A 4JQFA 5E3NA 2KHMA 3RZDJ 2JUGA 3U2RA 1S5LC 2FBKA 4DJAA 2E2JJ 1BW6A 2LR8A 4NC7A 2G7HA 2M4GA 3Q0WA 4FCYA 2O61A 1Y0NA 2PG4A 3EETA 2W48A 4NNJA 1MNEA 2KRCA 2A07F 4ZYEA 1B8IB 1D8JA 4C2UA 4RS8A 4GRIA 1TQPA 4AM3A 5DYMA 4A6EA 1X2MA 2HXIA 5CVVA 4D0PA 3CC2I 3DPLC 3BJ6A 2EFWA 3PFIA 3EDPA 4ASNA 2QSFX 1VQ4I 3TP0A 1F5TA 5B5EC 1GDTA 2XKOA 4B47A 4HQEA 2Z16A 1WJAA 1YW9A 1QRYA 2OPTA 4WK8F 2ZMEC 1U5TA 1TWGJ 3O3KA 3ZQIA 3HOXJ 4A12A 1QQIA 1P9QC 2VC1A 3CCVI 5HVQC 2MBFA 2ISYA 4NHJA 3ABKH 1W7PA 5F0FA 5M5YJ 1DP3A 3PUBA 5K5QA 1JTYA 1RNLA 3IH3A 3I64A 1LNWA 3T5XA 2C6YA 3ZGKA 3K4CA 3H36A 1SVOA 5ICEA 2MC3A 4NB5A 1FYKA 3FXMA 3L2WA 3P5JA 4QIWN 5GTHC 3IC7A 2ELHA 1W5CC 3TO6A 4F91B 5L3BA 2FQ4A 1XDUA 3DV8A 1QHGA 2XB5A 3D1NI 2LY9A 2HNHA 3DPUA 1FSEA 3QU3A 3KLNA 2BVLA 4JX6A 4OINF 1YJ9I 1G3WA 3C2BA 2KDZA 4XRMA 2P4WA 4LGWA 4A3LJ 3SHFA 4BQAA 4UV9A 2YU3A 1RESA 4CCMA 1R5GA 4O3MA 5CKTA 2AQEA 2E36A 3F21A 5B1BH 5FRNA 5JHFA 5M5WJ 4PJLA 2WB1A 4F93B 3O6BB 2BBYA 2QBYA 4L5JA 3WTVC 2P7CB 4S05A 4XRSG 3F8NA 3J7ZI 3B02A 1P7JA 1E2XA 1S7EA 1UHSA 4LIUA 2I8DA 3TOBA 5DD8A 1MMAA 1D0ZA 3V7CA 4PFPA 3ML6A 5IT9K 3HRUA 1W0UA 4XOTA 4Y17A 3U9GA 2Z3YA 4FETA 1TP4A 4RLQA 1AA7A 1RKWA 3KEYA 5DUIA 2PX9A 1IDZA 3CLQA 3VPRA 1B1BA 3MWMA 4BGDA 1HQCA 3IH2A 2P6TA 3KPHA 2L2OA 1QU3A 5D5VB 4XMYA 3LWFA 4M3DA 4KYWA 1FP2A 1BC8C 2EBIA 4ETSA 3JCUC 3ZR8X 1IN6A 4I0BA 2HDCA 1SAXA 2H09A 3GZNB 3MKWB 1G3TA 4IEJA 3EUHA 1X1DA 2V1NA 5LRRA 4P96A 3M4OJ 1EH6A 1CF7B 3QWLA 3CCUI 1V3FA 4EJWA 2IVMA 3H92A 4B8XA 2DDBA 2XF5A 3GUDA 3Q0UA 5F0HA 1VQPI 2UXNA 1I27A 2R4GA 3KEQA 1MMSA 4H0EA 1BBYA 1T0FC 5IOZA 1EV7A 1X1PA 3N05A 1JUPA 4Y13A 2E35A 2R7QA 3M1EA 3BPVA 5IP9J 2FNAA 5L3EA 3N4MA 4DQ2A 4WCGA 3BWGA 2L02A 1FY7A 3M8JA 5LBQA 3LFUA 5FLXK 1PYVA 2JN6A 2FBIA 1CGPA 1R58A 4Q47A 4PSXA 3OSGA 4I09A 3LSHA 1FWZA 2ZXWH 1G8XA 3TBIA 1EA3A 2VL8A 5C3EJ 5GPCA 4A3DJ 2DCEA 2VASA 4IZZA 3KP6A 2WAQN 3NWSA 2DA5A 3CQZJ 3HYIA 5J1UA 4F3QA 3HOSA 3KP7A 3ZRGA 3GCMA 1WKMA 2OC6A 1KGSA 1ZARA 5F0CA 4DW6A 4BNCA 5BNGA 2E1MC 3K4BA 4IL6C 2W57A 1QA6A 2HWVA 2E7XA 4YELA 4KA4A 5LD2C 4IPAA 1JKOC 2JRMA 2K9QA 3L2UA 1ZRFA 3CDHA 1ZRCA 5LEKA 2NXNB 3ONQA 5DUKA 2NVUB 2XV4S 5HODA 3PIPF 4EJTA 2F48A 4OIRF 3M8FA 3CD6I 1WPKA 3HC7A 3COAC 1IDYA 2TCTA 1DQUA 5FROA 2YX7A 1YLFA 2VONA 2O7OA 4RMNA 3BR2A 4LLNA 3L00A 4CUGA 1WJCA 2QZ8A 2HXOA 2OZ6A 3HTSB 3KZZA 3EPZA 2KIMA 3HOWJ 2CW7A 3TQNA 1TWAJ 1OR7A 3DPTA 3GTLJ 4A2UA 1ZRDA 1K83J 1I5ZA 2KIFA 1LDKB 3C3WA 1XB4A 2OJED 3GLLA 3ECOA 5EEHA 2WAEA 1N25A 4JK1X 4S0HB 3I55I 1ZQ3P 4G6DA 1MD0A 3JSOA 1XG1A 4DZJA 1WSUA 1VF9A 4FASD 1ETOA 3CO6C 3HB9A 2E2HJ 4AYBA 2VXDA 1W4MA 2KFDA 5F27A 3TKYA 2E5NA 5H6RA 3S3MA 1IUYA 5DCMB 1WH5A 4MQVA 5IOYA 5M3FJ 2RQPA 2MA3A 2O8XA 4MLOA 5EG0B 3F72A 2IW5A 2M8EA 1GUUA 2DLLA 2JA7J 4PSWA 4ABZA 2CUFA 2KT0A 3VDXA 4G9YA 3KP3A 1JKPC 3BT9A 3CZ6A 1R4MB 1H0MA 4BS9A 3SJMA 5ERIA 1OJLA 1JT6A 2L7MP 4PCQA 3HSFA 3CF2A 1TNTA 5D5UB 4D1QA 1VQ7I 1W1WE 1LE8B 1BI2A 3SZPA 3V7RA 3HGGA 1RR8C 1G4DA 2V6EA 4L9NA 1JHHA 2K4JA 1A04A 5J6XA 3OR2C 3L9FA 2ZJQF 2CW8A 1Z6TA 4A3FJ 1ZG1A 3QQAA 1AWCA 2K9MA 4BBRJ 3I9V2 1IF1A 1SVLA 2BHZA 3FMSA 3HKZA 2VJIA 4EEFG 3GZ5A 4XNFA 4M74A 3CCLI 3HM5A 1WI3A 2P7VB 1XPXA 1JGGA 2O03A 2VOOA 1V5EA 2CG4A 1P6RA 3BTCA 1OMIA 1RC9A 5FFXA 1I39A 5CQGA 3SEQA 5HNFA 5EEGA 4D7MA 2FEZA 4DYCA 3FKIJ 1IXSB 4EATA 4CYCA 4NBQA 4YIFA 1FBQA 3PL8A 3RPQA 2ZJPF 3ZQCA 4X0GA 1LDJA 4EJOA 1T95A 2GLOA 2JPBA 3FXKA 3K1NA 4KFCA 1SFXA 5F1RA 5ED4A 1EKEA 3NAUA 1HXDA 1NG7A 2DMUA 3GFLA 3M07A 2PI0A 3GTQJ 2ZFUA 3JW4A 3CP8A 2G7UA 4I76A 1LEAA 4IO9F 3DTEA 1DGWY 4LD5A 2XROA 4E70A 2OAZA 2VBZA 4RBOA 4M73A 3IH4A 1G59A 2M87A 3CCSI 1F1ZA 2JPCA 4XN0A 1BN5A 4BY7J 3HPGA 2LRDA 4AU7A 3CCMI 4XICA 2IXSA 4DNCA 2QSGX 2Q8KA 1VQLI 1QGPA 2ZKZA 1HBXG 2E2IJ 1I6HJ 3ABLH 5GAGJ 4FHTA 2K02A 5KCMA 2MLKA 5C4JJ 3QPSA 4WXHA 3J7YJ 2XGDA 2GXGA 1KU3A 5D4RA 1OYWA 3E0JB 2WV1A 1FJLA 2QF7A 2YUSA 5E3OA 1OCTC 1D1AA 2JT1A 1OYIA 3FXRA 2W25A 5E1WA 2K9LA 2IS1A 3OMYA 4L0ZB 3PO2J 1IAWA 2JMWA 4IHSA 3O2PE 1TQMA 2EJRA 2DA4A 3ZQGA 2IJLA 2JUCA 1QPMA 1R1TA 2EINH 1U78A 2FUG2 2XF7A 5BS6A 3QP6A 1DDNA 5E3LA 2EFNA 3JRHA 5DV5A 2ISZA 5FB2A 1QVUA 2TDXA 3K9TA 4AIDA 1NK3P 2VBWA 4CZCA 2HTJA 3T1BA 2L01A 2AXLA 4JX5A 1SANA 4HAMA 2R5YA 1YW8A 4QWQA 1JUSA 2F5CA 2V1DA 4E7JA 3GTMJ 1UHMA 3L7WA 1A5JA 1FOWA 5E8IA 5DCFA 1PUFA 3OIPA 1REPC 2GIZA 1D1CA 4EM2A 2WWYA 1V4RA 1BI1A 3IL2A 3KYCB 2X0LA 2LKPA 4HBLA 2RREA 2HKOA 2LMDA 4IHVA 2R7VA 5IPAA 2DFIA 4ENMA 2DFHA 5K7FA 2P0WA 2GA2A 4E7IA 2DT6A 2Y48A 2P5LC 3J80Z 4XRFA 3UNGC 2CQQA 3HEFA 2VPRA 3FM5A 4ZC3A 2XSDC 3WU0A 5IYBJ 2ZC2A 4E7HA 4A93J 1POGA 2COBA 3S3NA 3RCOA 1OLTA 1Z7LA 4PGGA 2QM3A 4ZTJA 3WE3A 3DBHB 4AC0A 1LEBA 4IHYA 3MEXA 3BPXA 4M3BA 2KZGA 3V8JA 2QEXI 1FIPA 4LG0A 1BA5A 2Y9YA 1ZH5A 4B09A 5ICFA 2E1NA 2Q2EB 5CYVA 2VQGA 2FBHA 2XF6A 3HUGB 3KX2A 1Y39A 2GOXB 3BR0A 3JRAA 1Y6IA 2Y0MA 1D1BA 1U3EM 3JTHA 2MFZA 3AG2H 2QGUA 2X9DA 2XIGA 3BY6A 3I54A 4UNOA 2L9SA 1O7FA 4XLAA 5H20A 2M9HA 3WTXC 3RTRA 2FMYA 1U8RA 1BR4A 3T8TA 3WGIA 2QKLB 3JSPA 1HKTA 4RA2A 3V8LA 2DA3A 3K10A 3GTGJ 2HGCA 1L3LA 4CSWA 1G3SA 4IHXA 2CSOA 1BL0A 2B0LA 2VKHA 4ZDPA 1B72A 2DOAA 2GM4A 3DF8A 1D0XA 3KP5A 1O3RA 4HSRA 2EV5A 2HYGD 3W3CA 3KE2A 3VFZA 2LY2A 2VXZA 3CC7I 2ELJA 2ACJA 2LP0A 2LNBA 5CVUA 1WJDA 2M2EA 4BDZA 2EWNA 1HKQA 2J5OA 1ETWA 3IAM2 3CUQB 4XOPA 1YFHA 2IGOA 3JR9A 5CVIA 5HDKA 4J00A 3KZIC 1TT5B 2WB1N 1LJ9A 4QPQA 3OYFA 3JRBA 4M6VA 2IRFG 1V55H 4Z6YA 1K79A 4LB5A 2Q1ZB 2OCEA 3FXLA 1W5TA 1LFBA 1MJ9A 1P2FA 1T08B 1CQTA 3A1YA 2JRTA 1STZA 3ABUA 3MZYA 3SYTA 4RM2A 4P9UA 3OIOA 2X51A 4ENKA 3VYUB 2ICWG 2DPUA 2DI3A 3I58A 3GF2A 1Z7UA 3OOPA 4KIBA 3GTKJ 3V8KA 1P4AA 1IW7F 4ENJA 3ABMH 4XLPF 4HNUA 2LTPA 3JAMK 2QQAA 3RJPA 3TL4X 1FTTA 3MQ0A 3E5QA 4IRGA 4D5CA 2IT0A 4BQQA 2DTZA 1I50J 2E1OA 3C18A 2M4KA 4NQWB 1UJ8A 3HL2A 3OYLA 3N97A 5DTDA 3BQYA 2CU7A 1D5VA 4ZDLA 2VE8A 3FF5A 4BJ5C 5FKKA 4F52A 1XGOA 1GVJA 3S3OA 1ETYA 4K2EA 1ZGJA 3S93A 4GFBA 2R7ZJ 2FRHA 1ZK8A 3OYHA 3M7GA 4A5MA 5E17F 1GXPA 4A3BJ 4ESFA 3FXOA 1BIAA 4NC6A 3IKVA 4UUVA 2PBIA 2ZFWA 3DEUA 1IJWC 4MGRA 3L09A 1S7OA 3F8MA 2H27A 2PFBA 3PFYA 3ZQFA 4C3HJ 3DQVC 2OQRA 2R7XA 1U6GA 3QYBA 2AO9A 1GVDA 4AWXB 4IRIA 2Y0SA 2EZIA 3BZCA 1YRNA 3VYTB 1R9TJ 1N78A 4UB6C 2R7FA 5KAFC 5C4XJ 1ZAOA 3PM1A 4XN3A 2IBDA 4ZH4F 3W6JB 2GAUA 4YRVA 1YX5A 2CQXA 3E1SA 2DA1A 4QPOA 4EGYA 2ID6A 4G6TB 4DYQA 2ZB9A 3E6CC 1I3QJ 3PQJA 3CCYA 3Q9VA 4U0VA 4CCNA 3FHZA 5TRDA 3BCBA 2W85A 3RQIA 1U9OA 3OL4A 3KZYA 3TW7A 4XSXF 1WCMJ 4ITVA 2JA2A 3V42A 4A0XA 3E6MA 3K4MA 1RPWA 1FEXA 2F5EA 2DTRA 2MW8A 4CCKA 2XPUA 4CYDA 2VKDA 2DAOA 4HX7A 5EF6A 2K3PA 4WXDA 3GO5A 2DBBA 4BJ6C 2RNJA 1TLHB 3KYDB 4MFEA 1W7PB 2V7FA 3ZCOA 5F04A 2ZMEB 4L0YB 1I1SA 1FTZA 3K4LA 3HRSA 2GXBA 1IZ1A 4DIQA 2M7AA 1HA8A 4UUSA 1R71A 5E20A 4HNTA 2HS5A 3ZN0A 3LSGA 3WG7H 2CFXA 2OA4A 3LSMA 4D7NA 1U5TC 1X4PA 5D8KB 5M3MJ 2DOEA 2CWEA 3GMEA 5J1YA 2UXXA 4LOCA 4F55A 4XIDA 2EB7A 3HXLA 3S8PA 3DEWA 4OOIA 2M7BA 3M3YJ 3FBNB 5TGTA 3IHUA 4E4HA 3E6DA 1ZHFA 2ESNA 3BDDA 3PNVA 5LGUA 2A61A 3VYRB 4XKBA 4J19A 3EYIA 4AYBN 1QHHD 4ESBA 1VQ5I 3IUOA 2K3FA 3F6VA 5E1ZB 1ERDA 1TWHJ 2P6SA 3FMQA 3MN2A 3MZ8A 1YS7A 4LITA 4OWRB 1OISA 3E6BA 4MQ9F 2AHQA 4Y7NJ 3KLOA 3CCJI 1KQ9A 2Z1DA 2W7NA 3CP2A 3DTIA 5F08A 4A3GJ 4Y52J 5K5OA 1MBFA 2XRNA 1XC5A 2GQQA 1AHDP 1S6LA 4B3XA 4Q48A 3ZQHA 1B8IA 2D1VA 3FXQA 4KISA 1VQ6I 3HOVJ 1JJ8C 4JYKA 3FK6A 3MVPA 2LG4A 3OL3A 1DPUA 3R6SA 2VODA 4HDVA 4CZZA 3S2DJ 4PJJA 1GV2A 2OQGA 4BY1J 1ZREA 3TEDA 3CJTB 5HS9A 2RDPA 4B3AA 4IJAA 4RAGA 2Y9ZA 3TO9A 2VJJA 3MFKA 2A6TA 2V9VA 1K78A 2CO5A 2CYYA 4CXFA 1MMDA 4M3GA 3ROUA 3LA2A 2YS9A 1G6NA 2FOWA 3HKZN 2F4IA 5IY5H 2BXZA 4HRIA 1IC8A 3RKXA 3RI4A 1MH4A 3S16J 2LDUA 2R0QC 2L9RA 1UCRA 3A0HC 3H3UA 4G7HF 3DCFA 2Z99A 1U9NA 1SFKA 1VQMI 1ACIA 2X1DA 3U1KA 4AVZA 4YIRX 1TL8A 4CH7A 4XLEA 4D9JA 3ZXSA 3C7JA 2FXAA 2CRGA 2DK8A 1FIAA 3L2CA 3EUHC 4JOMA 1QZEA 2P5VA 1B4AA 5L3DA 2H6BA 4LJZF 1PUEE 2CFOA 2JK3A 3LAPA 3ASOH 1RUOA 3J7AO 4FX4A 2GZWA 9ANTA 2BHYA 2STTA 5J40A 4QLCU 2OD5A 4FTHA 2M30A 1USSA 2HZTA 2ZXIA 4B48A 1D5YA 1LPQA 1ORKA 1YX3A 2BYVE 2AXTC 3K2ZA 3KETA 1XS9A 5KNLA 2EV0A 1MGTA 5A2QZ 4ZZDA 2EIJH 2H6CA 5J47A 2EQRA 3K4NA 1LUJB 1XSDA 1BI0A 1S29A 2E60A 1LFPA 4AUXA 3A01A 1YIJI 2NVTJ 5LEJA 2E1MB 3DU6A 2W4SA 4RGUA 4OIPF 1BOAA 2ZNYA 4UB8C 5DEQA 4DGWB 3IRRA 1MBGA 2KRFA 1Y8RB 1X1CA 3PQKA 5E8GA 1G2HA 5EZGA 4M3FA 5K7ZA 3BR1A 2XRLA 1B9NA 3W6KB 5GAEJ 3ESWB 1J9IA 4KNYA 3QPHA 4UHTA 4CHUA 1XCBA 1EH7A 5CLSA 2QVOA 4IQ4A 4G94A 1ZR4A 2JQ7A 3HHGA 4I6ZA 3G3ZA 2H8WA 4F7ZA 4IHTA 2A5YB 3H5RA 2P8TA 2NNNA 2XAFA 1OCZH 3OYJA 4C2TA 1D0YA 1ON2A 2HYFA 3D5SC 4DYRA 3KYLA 3DBLB 1T56A 2AQFA 1R7JA 3E5XA 3IWZA 5L3FA 1VTNC 2DJNA 3FWEA 3CJRB 3Q9SA 1CF7A 2Z33A 4A3JJ 2L9VA 3B6AA 3VODA 1Z67A 4YFXF 1LQ1A 2E71A 1OR7C 4N4OB 1AKHB 4BJTA 1QZZA 4B4CA 1YS6A 4CDGA 1WZ2A 2PJPA 3KP2A 1H88C 1A6QA 1WH7A 4XSZF 5FKOA 2FD5A 2A5WA 4U0YA 3I3LA 1XMAA 5E3MA 2L0KA 3BTLA 3JTGA 1K6YA 2X6YA 3ASNH 2ZJRF 3HIFA 1MSFC 2E5ZA 2EFPA 4E7KA 2ETHA 1VQNI 4RGSA 1SD6A 1F4KA 4FE4A 2ZSIB 1O57A 3ERMA 1IV8A 3K1PA 5HS7A 2K5CA 3SXYA 2OV7A 3LSRA 1R22A 1UG0A 2MD0A 2LBFB 3CCRI 3G2BA 4I0AA 2LVSA 1BR1A 1H89C 2HKXA 3RDIA 2WAFA 3TDUC 1IRXA 5E1XA 4ANJA 1VQ9I 4XK4A 5H2FC 3PO3J 1OCRH 3PSFA 3AFHA 3V7SA 1QO0D 4LFUA 3SDGA 3SFZA 1WGXA 4FQGA 4R1HA 4BH9A 3HHHA 1T98A 2XAGA 1Z21A 3FM3A 4RGRA 2QKMB 1YG2A 3BJOA 2ADUA 3WTTC 2N8GA 1WWXA 2QWWA 3WHBA 2UWMA 1GHCA 2MLGA 4I98B 2B7EA 3LSTA 3UR3C 1JT0A 3H9QA 1E0EA 1MZBA 4UVAA 2R93J 3TDZC 3NRVA 4RGXA 4C9YA 1YO5C 1B59A 2LLKA 5TJJA 1R00A 3K7AJ 2BV6A 1I6XA 1GLNA 2KZVA 1LFUP 2G0EA 4HOBA 3ZN1A 1JKRC 4XLNF 2L4AA 1FMVA 3CUOA 5LFAA 5ILUA 2FA5A 2K9NA 1QPIA 2CV2A 1N75A 2GOMA 3S32A 3FKJA 3CDIA 3OS1A 1XGMA 5GTIC 5LRSA 1R1VA 5FGMA 1XTAA 3F8CA 4ZTFA 2HOSA 2EV6A 2BW3B 2DW4A 3O8HA 5KK1A 5K7HA 4BU2A 1PDNC 2Y31A 4A3KJ 3DEEA 3R61A 4PGHA 3BLYA 2R7SA 4YEJA 2W82A 2QQBA 4E7ZA 4UV8A 3J81K 5EG0A 4L18B 3GTOJ 4PZJA 4KN7X 1HOMA 4EJUA 1FP1D 2CH0A 2K9SA 5J4YA 3RYPA 1Q1HA 5GAHJ 2IAIA 4ZYAA 2FE3A 4GCVA 4LMYA 4A3CJ 1TQIA 3BCAA 3GLXA 3L1PA 3HOZJ 1MMNA 3A02A 2V79A 2BEOA 2V9PA 2XHKA 3E5UA 3LA7A 3BR3A 3MKYB 4Y33A 3P7NA 4HF1A 1MJAA 2IS6A 5B1AH 3GFJA 3R4KA 1JHFA 4PJ0C 4L9JA 2XDVA 4OIQF 1T33A 2RAEA 3S1NJ 4MFDA 1S3JA 1Z1DA 1L0OC 1Z9CA 3IP4B 4U7BA 5CVJA 5M5XJ 3FISA 3EUAA 4KT5C 4LIVA 3ZQQA 2FMLA 2XAQA 4XM3A 1A36A 3L2VA 2ZSHB 1BM9A 3VOEA 1HDPA 4H4KC 2FSWA 1YE9A 1O3TA 1F36A 3BZKA 3KP4A 1MDMB 1PUFB 1KQ8A 2K86A 1WJBA 3OYGA 2DQLA 4HYEA 4BEHB 2GXAA 1RIOH 1F43A 1YTYA 1ETVA 4ZYGA 4PFOA 2XAUA 3H5NA 4HX4A 1E3OC 4PUSA 3C2HA 5HLTA 1ZG3A 4U88A 5CPRB 2V6CA 2UV1A 2V9KA 1O4XA 2R5ZB 2STWA 3LSPA 2QUFA 5LHHA 2VKVA 3HRTA 3QRFF 1HW2A 4UVBA 1KA8A 2X1EA 2GWRA 2DODA 3GWZA 3R0AA 1YHQI 2DK5A 2F4OB 2Y0SN 4AIKA 1JI8A 2MYSA 2VPLA 1TBXA 3HSRA 5IT9Z 2LC2A 3E7LA 3H3ZA 5D6EA 2DDAA 1OCPA 2DJIA 4GYGA 2EK5A 1EH8A 4A3MJ 3AKZA 3EYYA 5HLIA 3OYBA 4G12A 3BG5A 4AIJA 1ZELA 2HFHA 2DOFA 2LF8A 3ZOBA 3LSJA 2JVHA 2MH9A 2EA2A 2I5UA 4BAYA 2DMQA 2OCCH 2BY2A 1YW7A 5TISC 4HLXA 2PLYA 2CMPA 2L3DA 2CV1A 4IF4A 1FMWA 1DU6A 3BR6A 3WODF 4BL0B 3K6GA 4O6JA 4N9HA 5JI6A 3LL7A 1BW5A 1XX5A 2VLAA 2HQNA 5EDNA 4I2OA 2NRAC 3K70D 2VQHA 3B6CA 1T38A 4J01A 3ZQ7A 4F92B 5DM7F 3FHNA 4M71A 1M1EB 4KIGA 4RAFA 1XGNA 2F5DA 5D5WB 3SQNA 4BUPA 3LA3A 2DN0A 4HF0A 1KU2A 2R3SA 1WVRA 5FLXZ 2M45A 3FMRA 1X3ZB 3G1OA 2XGXA 4HNVA 2OTLI 3HDDA 3QODA 3WE2A 3DBRB 4CICA 5LGNA 1LDDA 1FBSA 1YYVA 5JLWA 1MBKA 1ZR2A 3K4JA 1DU0A 2YSRA 3OWTA 2HDWA 1X2NA 2JTVA 4IQJA 2BVMA 2JA5J 5J3LA 2JZYA 2M1BA 1KQ0A 1WQ2A 4P1WA 3G1MA 2W00A 1SEUA 2D5VA 4HEA2 1LE8A 1XCVA 3DKXA 4KDPA 1IG7A 4XKVA 3OYCA 2ME6A 3X2QH 5DS9A 4BXXJ 3IAS2 2VB6A 1IN4A 1FNNA 4LK1F 4IOAF 3GBGA 4LB6B 2NOJB 2DMPA 4KUMA 2NVQJ 2MD5A 2DT7B 3BP8A 4CCOA 4HV6A 2YX4A 1FOXA 1OCOH 2COMA 2ME0A 3DLAA 2QYOA 3NARA 3ZPLA 2LKXA 1ZGWA 1VNDA 1ULYA 4YFNF 2DU9A 4KN4X 1D8KA 3MKLA 2L7ZA 2Q2EA 1MBJA 1R36A 1RZ4A 1JJ6C 3H0DA 2H94A 1I3AA 1R23A 3HUGA 2VN2A 3GEZA 1RKTA 5ILVA 2WV0A 4HQMA 3BQZA 2XASA 2XB0X 3CO7C 3D5RC 2OZUA 4CA0A 3TOAA 3JRIA 5CJ9A 5BPIA 2MH2A 1FC3A 3KIOA 5LHGA 4YG2F 2QSHX 2DMTA 1MKMA 2O0YA 4CCJA 5IT3A 3BG3A 3LNQA 3CMMA 1J75A 1H9GA 2BY3A 1ON1A 3FBIB 3REOA 1R6RA 2DO7A 3K69A 4FE7A 4NUBA 3G73A 1J0RA 5EYRA 3CMYA 4JX4A 4W97A 2WA0A 2XKPA 2R7RA 2VE9A 5HLGA 4BYYA 4ENNA 2XPWA 2M34A 3FX3A 4QSHA 3V4GA 4FISA 4BKXA 3S2WA 4HA8A 3QPLA 5EGOB 2VC0A 3I59B 1FOYA 1ZLJA 1WFXA 1BIBA 3RPUA 3BR5A 2V1UA 2QCOA 1NH3A 3VSKA 4BQOA 1JKQC 1NHAA 4OAZA 4N0BA 5HNHA 2CGPA 1UG2A 2XPVA 1KU7A 1Y0UA 2D45A 2O6GE 2ZNZA 5DM6F 2LYCA 1OCCH 3ZMZA 4U0WA 1MNDA 3I5UA 2EIMH 4I7HA 2KP6A 2KQRA 2WY8Q 3FZVA 1TWFJ 2LREA 3C1DA 1ETQA 3HGYA 3FK7A 4Q5SF 1S8NA 3AL0C 4ZYHA 3MAJA 2W84A 1O3SA 3HBLA 1AU7A 2XUBA 4X6AJ 3LFKA 2EIKH 5EZHA 3DTKA 4N4NB 1X1AA 1P92A 2PJRA 2RVCA 4BE1A 1B9MA 3JRDA 3GFIA 3TMOA 3O8GA 2UZKA 1KYWA 4WWCA 3DXJF 1WJFA 2CJJA 1QBJA 1VFCA 3AAFA 1X3WB 1TC3C 3H3VK 2DFEA 2VJ4A 3HG9A 3B73A 3BC8A 2ECBA 3NQOA 4GXOA 2IS4A 4NQWA 2B9SA 3P9IA 4BHBA 1U5TB 5EEAA 1HW5A 3K2AA 2V1XA 1YQAA 2X6WA 3OYAA 2QQ9A 1VQOI 3WTSC 4A0ZA 1ZKGA 3BTIA 2VKEA 4KMFA 1OPCA 2EZKA 1LVKA 3I4NJ 1ZLKA 2VQCA 2TRTA 4Q4ZF 3HPHA 5FKMA 1XMXA 2NAZA 4HV5A 4HF2A 4ON0A 1FPQA 1K4SA 3MZHA 5D6FA 2E34A 2W24A 1MBEA 3OYMA 1F9NA 2PEXA 3GTPJ 1TTYA 3BJAA 3H9JA 5ICGA 3PSIA 4A0YA 4BBSJ 4KMUX 3OYDA 1ITYA 1XN7A 2D2WA 1OYYA 3I71A 2R7TA 1HSTA 1T6SA 4QTRA 4V2FA 4GDFA 5IYDJ 1HW1A 1Y1VJ 3HRMA 2XAJA 3RIRA 3ZMTA 2X1CA 4U7DA 5HOOA 1K78B 2CUZA 3QAHA 1JGSA 3JRCA 2QBYB 2M3AA 2FQ3A 3I0TA 3K70C 1IXCA 3OYNA 2G9WA 3BZ6A 3WG9A 4R8HA 2ZMEA 2VI6A 1BC7C 3ISPA 3RSNA 4MHGA 2DMNA 4BHCA 4XLHA 5GPAA 4YFKF 5LHIA 1RUNA 1KYZA 4PJNA 1R49A 4E7SA 1LVAA 3QPTA 5L3CA 1V54H 2IEKA 3WU2C 3M9AA 4M6XA 2DYSH 4EGZA 3A2KA 3LQQA 1NK2P 4AD9A 4MEYF 4MO7A 5FD5A 3GW2A 1S7AA 1VI0A 2JA6J 1W0TA 4M9ZA 4BE0A 4UUTA 1X3UA 1IRFA 4BXUA 2VJ5A 4OMZA 2UUZA 1LB2A 3G4SI 5IP6A 1YJWI 1AOYA 1MIJA 4V19K 2OBPA 4FX0A 4G7OF 1HCRA 4IOCF 1X19A 2KL4A 1IGNA 1PP7U 2IS2A 2LY1A 2YU9J 2YR2A 2IPQX 3H5AA 3W2VA 4A5NA 1VQ8I 1MNMC 2HPMA 3F9KA 3A01B 4BE2A 2XSJC 1KONA 3K0LA 5HS8A 1UAAA 3OS0A 4C30A 3F8BA 3CCQI 2E19A 5D5XB 3ZQLA 3TW6A 5JVTA 4EM0B 3S14J 3CMAI 2K85A 3CMEI 3F6OA 4DBRA 1W5SA 2FNPA 2L9NA 3EUKL 2QLZA 3KFWX 1U0JA 4S04A 3IRQA 3LQRA 3OYKA 2RGVA 1C0WA 2ELKA 4XBFA 3A0BC 3NEUA 1TNSA 1FOKA 3J80K 5C44J 4DBQA 4PJMA 3FXJA 3Q3SA 3K4KA 1E3PA 2O5RA 3WU1B 3MKZA 2DT5A 5AIPA 4D5FA 1XD7A 2O3FA 1UB9A 2BE5F 2RV8A 1PP8F 3ZP5A 1HF0A 3D0SA 4XLCA 3FXUA 4EQQA 4Y4RA 2PMZA 2CUJA 2A6HF 2HZDA 2QQ8A 2WC2A 2KIQA 1B6AA 2XC7A 2VT3A 2R92J 2LFBA 3H35A 1A6IA 3WTUC 3P9CA 1T0FA 5FRMA 1Z0XA 3RZOJ 4B44A 1HKSA 3BROA 2KJCA 5FLMJ 2FX0A 2IP2A 5BMZA 1UFMA 4RB3C 1W36D 2VOPA 2YPRA 1O3QA 2MGQA 5JVGF 4X1EA 3QOPA 3FDYA 5E18F 4NDLA 2DPDA 3DFGA 5LGTA 4XORA 4KIFA 3TP3A 2DFFA 3CCEI 4M9SA 1R4NB 4R79A 5FLVA 1DP7P 3H1CA 4OMYA 2R7DA 1HSJA 2A05A 3QYFA 3G6EI 3VYSB 2NS0A 1A35A 5BOXA 2MSYA 2CUEA 2WY7Q 4HLYA 2RNGA 3JAMZ 4BDYA 3W2AA 4I01A 2HQRA 5HLHA 4AVPA 2A6EF 1UZCA 4BXFA 3WTYC 3ZMVA 2V4JC 3U1DA 1SVMA 2L7KA 1PVEA 3VWBA 1H8AC 1J2XA 2M0CA 1QVTA 2VQLA 4WF2A 3GVAA 5IYCJ 5FD6A 3F8FA 2ESHA 2PQ8A 3M1CA 2FU4A 2HYJA 3SEZA 3W2WA 1O7LA 4IX7A 5B3SH 3HZJA 2E1CA 5GP9A 1KZHA 2DQRA 3ECHA 3AG3H 3PNYA 1ZG5A 2VBYA 1K61A 3A03A 1UMQA 1RR7A 1TW2A 4RLFA 5AIQA 1QZYA 1MMGA 1ODDA 1Y8QB 2NS8A 4RAYA 3U21A 5FKNA 2OU2A 2FF4A 3IKTA 1N77A 3QOEA 2W1OA 2H8RA 1JE8A 1XMKA 1TWCJ 3G71I 2E7WA 3OYIA 3GFMA 4ZYDA 4XL9A 5J4VA 1Z3YA 1E3HA 2BOLA 2EZHA 1Z05A 2K7LA 2KJBA 1AKHA 2XGCA 3DKWA 4OU0A 5K5RA 2X6XA 1Z6RA 4KT6A 4CYCB 1U8BA 3ZMSA 2DA6A 1FYMA 3F23A 2HOAA 2HTSA 3ULQB 2BGCA 3ERED 3IV5A 1GXQA 4MTEA 1J7KA 4XR6A 3MD2A 3L2QA 1MSEC 1T2KA 2OF7A 3CF5F 2IGNA 1IN8A 1BI3A 3OV8A 2HEOA 1V5FA 4IKFA 5CQEA 4Z2YA 2LBFA 2VUMJ 3CC4I 4HW0A 1T39A 1ZGAA 5DCMA 1K7AA 1BJZA 3SZTA 2DA2A 2EILH 4HX8A 4C3IJ 1GV5A 5L3GA 3KCCA 5FJ8J 3BG6A 4IVNA 4RB0A 1A31A 1WJ5A 1TZLA 3RPUD 3S1MJ 2LKSA 3VSLA 1LKXA 1Q1VA 2Q0OA 4M9XA 3OS2A 4TV7A 5J8FA 2F5FA 5D4SA 3K1MA 2CQNA 5AONA 4IXAA 1DUXC 3F0CA 2RQQA 2CQKA 3RQ4A 2D1HA 4MNUA 1Z77A 3HOTA 1SFUA 2O8KA 2J5PA 2IA0A 2Y75A 3CDLA 1IN5A 3PJRA 3NWTA 5B66C 2KRHA 2Z9OA 3GXOA 2RN7A 3I4MJ 2KMUA 1S72I 3LSKA 2WTEA 1FBUA 5D8LB 3HSEA 3LAJA 1QNTA 3UKGA 2HQ5A 3BG9A 2Z5UA 3WGGA 2ZXHA 4L5EA 3S1QJ 3R60A 1R1UA 2LOOA 3R0JA 1YITI 2A69F 4NC8A 3G1LA 3AG4H 1ZYRF 2ID3A 5JR3A 4LG3A 4FT8A 4XKCA 4G6QA 5H6QA 4KICA 4RAZA 2CQ7A 3GYHX 1IV6A 1JTXA 2BW3A 1FYLA 4IHWA 2L4MA 2RC4A 1SC7A 3PUFA 1X4OA 1MW7A 3CJNA 1JUMA 2HQAA 2NS7A 2OUMA 1SFEA 2DXIA 3I53A 1Y1WJ 2I10A 5DD4A 2R5YB 1JXSA 3JREA 2K4BA 3QU6A 1R5ID 3DWLE 4HPQA 2FJ1A 1WI9A 4CGZA 2VIXA 2ZJ2A 3PNTA 5ILSA 3CLOA 2NYXA 1X1BA 1S9HA 1XSXA 2R7OA 4PK4A 1ENHA 3H0GJ 2CV0A 2NNYA 4CCLA 2EH3A 1FZPB 1ONVA 3HJEA 4GYIA 4OAYA 4PDKA 2M0MA 3QP5A 2BXYA 4KITB 4MTDA 3VEPA 5F1JA 4E6KG 5J8CA 4BHPA 2KPMA 3JRGA 3RYRA 1KU9A 4V2GA 2VT2A 3L2RA 3LSIA 4EV0A 3S17J 2PMUA 1SFOJ 3WGHA 2F6CA 2QENA 2A3SA 4RDUA 2WAQA 5DDGA 4RB1A 4XLFA 3DLLF 4M72A 5FFZA 3S15J 2F2EA 4LLGF 1IRGA 2H1KA 2XAHA 4E7LA 4LG0B 1TT0A 1NG6A 2FOKA 2F4MB 2LD5A 3EQLF 1MH3A 1YJNI 1VQKI 1D3YA 4UY8I 3J7AY 3DKYA 3CESA 4N9IA 5KHDA 4BACA 2GBYA 2Y2ZA 2AS5F 1MDMA 4B43A 1FT9A 4B1RA 3C2GA 3DU5A 4C3JJ 2GIVA 3W6VA 1FX7A 3GTJJ 4BEHA 1W36C 2L7FP 5KVRA 2BZTA 1P4WA 2A68F 3I4PA 1IUFA 2HI3A 4RB2C 3ABTA 2GA1A 3PIOF 1W7PD 5FKLA 3T0YA 5IP7J 4HG2A 2MG4A 4XKWA 4A3EJ 4MEXF 1APLC 1HC8A 2ZO4A 2R5ZA 2MC4A 2WBMA 1I1GA 1SD5A 3T8RA 3HOUJ 1TW3A 4C2MJ
chains in the Genus database with same CATH topology
1LUJB 1M1EB 1T08B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUJ B;  1M1E B;  1T08 B; 
#chains in the Genus database with same CATH topology
 2LK2 A;  4P9F A;  2HU9 A;  4L9V A;  4EM1 A;  1NTC A;  1B72 B;  5EJC A;  3Q5F A;  3WTZ A;  1WHU A;  2L5Q A;  3OR1 C;  2LH9 A;  2DYR H;  1IO2 A;  1YIO A;  2IGM A;  5GAD J;  3JRF A;  1VZ0 A;  4G7Z F;  1IXR C;  4HZF A;  2JJ7 A;  5FO5 A;  1E17 A;  3P9K A;  4G8X A;  3F22 A;  5BQT A;  1HLV A;  2XVC A;  3LOC A;  5CVR A;  1ZTR A;  1OFC X;  5F6F A;  1J5Y A;  2R7U A;  1WJE A;  1DPR A;  1U2W A;  4RM3 A;  3MMY B;  1ETX A;  1SMY F;  4I02 A;  3RKW A;  2EPF A;  2EFQ A;  1FLI A;  3KEO A;  1BR2 A;  3RKQ A;  2HDD A;  4II2 A;  1OQY A;  1P4X A;  1P7I A;  4UVC A;  4P5O A;  4UXN A;  2X48 A;  3ELK A;  3SFI A;  2EA4 A;  3VB2 A;  1EJ9 A;  3GX4 X;  5KAI C;  1XGS A;  3CTA A;  4XQF A;  3E3V A;  4Y15 A;  2KKO A;  1R5H A;  3SDB A;  2XGE A;  5A2Q K;  1X58 A;  4LLL A;  3RKY A;  2LSO A;  2PN6 A;  1IN7 A;  1K6O A;  1Z91 A;  5K1Y A;  6PAX A;  1BJA A;  4IRH A;  4A3I J;  3I56 I;  2L54 A;  2MAB A;  2Y30 A;  3HOY J;  3HTU A;  2JSP A;  3Q0V A;  1J09 A;  1GT0 C;  2JA8 J;  5JFR A;  1K4T A;  4CO8 A;  1YOV B;  4P55 A;  3WTW C;  1WRJ A;  2BY0 A;  2F5V A;  4W1U A;  2DA7 A;  2K27 A;  4Y3O A;  2X4H A;  2ZCW A;  3BG7 A;  1UHW A;  5HDG A;  1MJB A;  2Y69 H;  4XON A;  2IA1 A;  1PJR A;  2CS3 A;  2HVS A;  3QYE A;  2B63 J;  2OTJ I;  2O9L A;  2HVQ A;  3SZG A;  4LK0 F;  1SAU A;  1V5G A;  2JVG A;  3A4C A;  4ZZL A;  4EVI A;  2ZXJ A;  1SD7 A;  3E97 A;  3M8E A;  4XRS A;  2X6O A;  4EMS A;  5LLQ A;  3AG1 H;  2BY1 A;  4U87 A;  5JLX A;  1Z3X A;  4O5V A;  3TGN A;  4M3E A;  3OSF A;  4JBA A;  5BPD A;  2VBX A;  1H9T A;  3BOQ A;  2NOG A;  2RKH A;  3GZ6 A;  3MCZ A;  4JP0 A;  5F64 A;  4DOZ A;  2PMH A;  3H9G A;  3BTJ A;  4WX9 A;  2HR3 A;  1YRN B;  2HPI A;  1FSH A;  5ICC A;  2EZL A;  2NVX J;  3LMM A;  2IGK A;  1T8I A;  2Z2S B;  1J59 A;  3AL0 B;  1EF4 A;  2PJR B;  2CW0 F;  2HOT A;  3CUQ C;  3ZMD A;  3OIQ A;  1RET A;  2V26 A;  1SMT A;  4II3 A;  1DGR M;  4A69 C;  2JSC A;  1RRJ A;  3OYE A;  2R7W A;  2HVR A;  4I99 C;  1UEL B;  1MBH A;  3CUQ A;  2IA2 A;  2KLO A;  2X85 A;  2P5K A;  3OY9 A;  1UST A;  1XDS A;  3S1R J;  2ZBK A;  3CJQ B;  3DP7 A;  4ZJZ A;  4HDU A;  4ESJ A;  4AIH A;  2WAD A;  2HOE A;  1HDD C;  4HST A;  1Y56 A;  4ZDO A;  4MIM A;  3S2H J;  2KIU A;  4M6Y A;  3IWF A;  2M8G X;  1ZN2 A;  4KJZ A;  1SD4 A;  2P81 A;  3J81 Z;  4BQN A;  2QA4 I;  4UUS B;  3TO7 A;  2PMZ N;  2ECC A;  4OIO F;  2M5W A;  1XSV A;  4GO1 A;  5E79 C;  4L5I A;  5J1R A;  4YII A;  2NVY J;  3OOU A;  3WHC A;  2LF7 A;  1ETK A;  5EGO A;  4WXC A;  4GGG A;  4A6D A;  4EJV A;  5JHU A;  2KDO A;  3I59 A;  4DZP A;  3ZMU A;  5HDN A;  2EFO A;  1OKR A;  2KIS A;  1G3Y A;  2K40 A;  4L9T A;  3F3X A;  2JWT A;  1IRZ A;  1YI2 I;  2H1L A;  3D5L A;  1BOB A;  3FIW A;  1RI7 A;  4JQF A;  5E3N A;  2KHM A;  3RZD J;  2JUG A;  3U2R A;  1S5L C;  2FBK A;  4DJA A;  2E2J J;  1BW6 A;  2LR8 A;  4NC7 A;  2G7H A;  2M4G A;  3Q0W A;  4FCY A;  2O61 A;  1Y0N A;  2PG4 A;  3EET A;  2W48 A;  4NNJ A;  1MNE A;  2KRC A;  2A07 F;  4ZYE A;  1B8I B;  1D8J A;  4C2U A;  4RS8 A;  4GRI A;  1TQP A;  4AM3 A;  5DYM A;  4A6E A;  1X2M A;  2HXI A;  5CVV A;  4D0P A;  3CC2 I;  3DPL C;  3BJ6 A;  2EFW A;  3PFI A;  3EDP A;  4ASN A;  2QSF X;  1VQ4 I;  3TP0 A;  1F5T A;  5B5E C;  1GDT A;  2XKO A;  4B47 A;  4HQE A;  2Z16 A;  1WJA A;  1YW9 A;  1QRY A;  2OPT A;  4WK8 F;  2ZME C;  1U5T A;  1TWG J;  3O3K A;  3ZQI A;  3HOX J;  4A12 A;  1QQI A;  1P9Q C;  2VC1 A;  3CCV I;  5HVQ C;  2MBF A;  2ISY A;  4NHJ A;  3ABK H;  1W7P A;  5F0F A;  5M5Y J;  1DP3 A;  3PUB A;  5K5Q A;  1JTY A;  1RNL A;  3IH3 A;  3I64 A;  1LNW A;  3T5X A;  2C6Y A;  3ZGK A;  3K4C A;  3H36 A;  1SVO A;  5ICE A;  2MC3 A;  4NB5 A;  1FYK A;  3FXM A;  3L2W A;  3P5J A;  4QIW N;  5GTH C;  3IC7 A;  2ELH A;  1W5C C;  3TO6 A;  4F91 B;  5L3B A;  2FQ4 A;  1XDU A;  3DV8 A;  1QHG A;  2XB5 A;  3D1N I;  2LY9 A;  2HNH A;  3DPU A;  1FSE A;  3QU3 A;  3KLN A;  2BVL A;  4JX6 A;  4OIN F;  1YJ9 I;  1G3W A;  3C2B A;  2KDZ A;  4XRM A;  2P4W A;  4LGW A;  4A3L J;  3SHF A;  4BQA A;  4UV9 A;  2YU3 A;  1RES A;  4CCM A;  1R5G A;  4O3M A;  5CKT A;  2AQE A;  2E36 A;  3F21 A;  5B1B H;  5FRN A;  5JHF A;  5M5W J;  4PJL A;  2WB1 A;  4F93 B;  3O6B B;  2BBY A;  2QBY A;  4L5J A;  3WTV C;  2P7C B;  4S05 A;  4XRS G;  3F8N A;  3J7Z I;  3B02 A;  1P7J A;  1E2X A;  1S7E A;  1UHS A;  4LIU A;  2I8D A;  3TOB A;  5DD8 A;  1MMA A;  1D0Z A;  3V7C A;  4PFP A;  3ML6 A;  5IT9 K;  3HRU A;  1W0U A;  4XOT A;  4Y17 A;  3U9G A;  2Z3Y A;  4FET A;  1TP4 A;  4RLQ A;  1AA7 A;  1RKW A;  3KEY A;  5DUI A;  2PX9 A;  1IDZ A;  3CLQ A;  3VPR A;  1B1B A;  3MWM A;  4BGD A;  1HQC A;  3IH2 A;  2P6T A;  3KPH A;  2L2O A;  1QU3 A;  5D5V B;  4XMY A;  3LWF A;  4M3D A;  4KYW A;  1FP2 A;  1BC8 C;  2EBI A;  4ETS A;  3JCU C;  3ZR8 X;  1IN6 A;  4I0B A;  2HDC A;  1SAX A;  2H09 A;  3GZN B;  3MKW B;  1G3T A;  4IEJ A;  3EUH A;  1X1D A;  2V1N A;  5LRR A;  4P96 A;  3M4O J;  1EH6 A;  1CF7 B;  3QWL A;  3CCU I;  1V3F A;  4EJW A;  2IVM A;  3H92 A;  4B8X A;  2DDB A;  2XF5 A;  3GUD A;  3Q0U A;  5F0H A;  1VQP I;  2UXN A;  1I27 A;  2R4G A;  3KEQ A;  1MMS A;  4H0E A;  1BBY A;  1T0F C;  5IOZ A;  1EV7 A;  1X1P A;  3N05 A;  1JUP A;  4Y13 A;  2E35 A;  2R7Q A;  3M1E A;  3BPV A;  5IP9 J;  2FNA A;  5L3E A;  3N4M A;  4DQ2 A;  4WCG A;  3BWG A;  2L02 A;  1FY7 A;  3M8J A;  5LBQ A;  3LFU A;  5FLX K;  1PYV A;  2JN6 A;  2FBI A;  1CGP A;  1R58 A;  4Q47 A;  4PSX A;  3OSG A;  4I09 A;  3LSH A;  1FWZ A;  2ZXW H;  1G8X A;  3TBI A;  1EA3 A;  2VL8 A;  5C3E J;  5GPC A;  4A3D J;  2DCE A;  2VAS A;  4IZZ A;  3KP6 A;  2WAQ N;  3NWS A;  2DA5 A;  3CQZ J;  3HYI A;  5J1U A;  4F3Q A;  3HOS A;  3KP7 A;  3ZRG A;  3GCM A;  1WKM A;  2OC6 A;  1KGS A;  1ZAR A;  5F0C A;  4DW6 A;  4BNC A;  5BNG A;  2E1M C;  3K4B A;  4IL6 C;  2W57 A;  1QA6 A;  2HWV A;  2E7X A;  4YEL A;  4KA4 A;  5LD2 C;  4IPA A;  1JKO C;  2JRM A;  2K9Q A;  3L2U A;  1ZRF A;  3CDH A;  1ZRC A;  5LEK A;  2NXN B;  3ONQ A;  5DUK A;  2NVU B;  2XV4 S;  5HOD A;  3PIP F;  4EJT A;  2F48 A;  4OIR F;  3M8F A;  3CD6 I;  1WPK A;  3HC7 A;  3COA C;  1IDY A;  2TCT A;  1DQU A;  5FRO A;  2YX7 A;  1YLF A;  2VON A;  2O7O A;  4RMN A;  3BR2 A;  4LLN A;  3L00 A;  4CUG A;  1WJC A;  2QZ8 A;  2HXO A;  2OZ6 A;  3HTS B;  3KZZ A;  3EPZ A;  2KIM A;  3HOW J;  2CW7 A;  3TQN A;  1TWA J;  1OR7 A;  3DPT A;  3GTL J;  4A2U A;  1ZRD A;  1K83 J;  1I5Z A;  2KIF A;  1LDK B;  3C3W A;  1XB4 A;  2OJE D;  3GLL A;  3ECO A;  5EEH A;  2WAE A;  1N25 A;  4JK1 X;  4S0H B;  3I55 I;  1ZQ3 P;  4G6D A;  1MD0 A;  3JSO A;  1XG1 A;  4DZJ A;  1WSU A;  1VF9 A;  4FAS D;  1ETO A;  3CO6 C;  3HB9 A;  2E2H J;  4AYB A;  2VXD A;  1W4M A;  2KFD A;  5F27 A;  3TKY A;  2E5N A;  5H6R A;  3S3M A;  1IUY A;  5DCM B;  1WH5 A;  4MQV A;  5IOY A;  5M3F J;  2RQP A;  2MA3 A;  2O8X A;  4MLO A;  5EG0 B;  3F72 A;  2IW5 A;  2M8E A;  1GUU A;  2DLL A;  2JA7 J;  4PSW A;  4ABZ A;  2CUF A;  2KT0 A;  3VDX A;  4G9Y A;  3KP3 A;  1JKP C;  3BT9 A;  3CZ6 A;  1R4M B;  1H0M A;  4BS9 A;  3SJM A;  5ERI A;  1OJL A;  1JT6 A;  2L7M P;  4PCQ A;  3HSF A;  3CF2 A;  1TNT A;  5D5U B;  4D1Q A;  1VQ7 I;  1W1W E;  1LE8 B;  1BI2 A;  3SZP A;  3V7R A;  3HGG A;  1RR8 C;  1G4D A;  2V6E A;  4L9N A;  1JHH A;  2K4J A;  1A04 A;  5J6X A;  3OR2 C;  3L9F A;  2ZJQ F;  2CW8 A;  1Z6T A;  4A3F J;  1ZG1 A;  3QQA A;  1AWC A;  2K9M A;  4BBR J;  3I9V 2;  1IF1 A;  1SVL A;  2BHZ A;  3FMS A;  3HKZ A;  2VJI A;  4EEF G;  3GZ5 A;  4XNF A;  4M74 A;  3CCL I;  3HM5 A;  1WI3 A;  2P7V B;  1XPX A;  1JGG A;  2O03 A;  2VOO A;  1V5E A;  2CG4 A;  1P6R A;  3BTC A;  1OMI A;  1RC9 A;  5FFX A;  1I39 A;  5CQG A;  3SEQ A;  5HNF A;  5EEG A;  4D7M A;  2FEZ A;  4DYC A;  3FKI J;  1IXS B;  4EAT A;  4CYC A;  4NBQ A;  4YIF A;  1FBQ A;  3PL8 A;  3RPQ A;  2ZJP F;  3ZQC A;  4X0G A;  1LDJ A;  4EJO A;  1T95 A;  2GLO A;  2JPB A;  3FXK A;  3K1N A;  4KFC A;  1SFX A;  5F1R A;  5ED4 A;  1EKE A;  3NAU A;  1HXD A;  1NG7 A;  2DMU A;  3GFL A;  3M07 A;  2PI0 A;  3GTQ J;  2ZFU A;  3JW4 A;  3CP8 A;  2G7U A;  4I76 A;  1LEA A;  4IO9 F;  3DTE A;  1DGW Y;  4LD5 A;  2XRO A;  4E70 A;  2OAZ A;  2VBZ A;  4RBO A;  4M73 A;  3IH4 A;  1G59 A;  2M87 A;  3CCS I;  1F1Z A;  2JPC A;  4XN0 A;  1BN5 A;  4BY7 J;  3HPG A;  2LRD A;  4AU7 A;  3CCM I;  4XIC A;  2IXS A;  4DNC A;  2QSG X;  2Q8K A;  1VQL I;  1QGP A;  2ZKZ A;  1HBX G;  2E2I J;  1I6H J;  3ABL H;  5GAG J;  4FHT A;  2K02 A;  5KCM A;  2MLK A;  5C4J J;  3QPS A;  4WXH A;  3J7Y J;  2XGD A;  2GXG A;  1KU3 A;  5D4R A;  1OYW A;  3E0J B;  2WV1 A;  1FJL A;  2QF7 A;  2YUS A;  5E3O A;  1OCT C;  1D1A A;  2JT1 A;  1OYI A;  3FXR A;  2W25 A;  5E1W A;  2K9L A;  2IS1 A;  3OMY A;  4L0Z B;  3PO2 J;  1IAW A;  2JMW A;  4IHS A;  3O2P E;  1TQM A;  2EJR A;  2DA4 A;  3ZQG A;  2IJL A;  2JUC A;  1QPM A;  1R1T A;  2EIN H;  1U78 A;  2FUG 2;  2XF7 A;  5BS6 A;  3QP6 A;  1DDN A;  5E3L A;  2EFN A;  3JRH A;  5DV5 A;  2ISZ A;  5FB2 A;  1QVU A;  2TDX A;  3K9T A;  4AID A;  1NK3 P;  2VBW A;  4CZC A;  2HTJ A;  3T1B A;  2L01 A;  2AXL A;  4JX5 A;  1SAN A;  4HAM A;  2R5Y A;  1YW8 A;  4QWQ A;  1JUS A;  2F5C A;  2V1D A;  4E7J A;  3GTM J;  1UHM A;  3L7W A;  1A5J A;  1FOW A;  5E8I A;  5DCF A;  1PUF A;  3OIP A;  1REP C;  2GIZ A;  1D1C A;  4EM2 A;  2WWY A;  1V4R A;  1BI1 A;  3IL2 A;  3KYC B;  2X0L A;  2LKP A;  4HBL A;  2RRE A;  2HKO A;  2LMD A;  4IHV A;  2R7V A;  5IPA A;  2DFI A;  4ENM A;  2DFH A;  5K7F A;  2P0W A;  2GA2 A;  4E7I A;  2DT6 A;  2Y48 A;  2P5L C;  3J80 Z;  4XRF A;  3UNG C;  2CQQ A;  3HEF A;  2VPR A;  3FM5 A;  4ZC3 A;  2XSD C;  3WU0 A;  5IYB J;  2ZC2 A;  4E7H A;  4A93 J;  1POG A;  2COB A;  3S3N A;  3RCO A;  1OLT A;  1Z7L A;  4PGG A;  2QM3 A;  4ZTJ A;  3WE3 A;  3DBH B;  4AC0 A;  1LEB A;  4IHY A;  3MEX A;  3BPX A;  4M3B A;  2KZG A;  3V8J A;  2QEX I;  1FIP A;  4LG0 A;  1BA5 A;  2Y9Y A;  1ZH5 A;  4B09 A;  5ICF A;  2E1N A;  2Q2E B;  5CYV A;  2VQG A;  2FBH A;  2XF6 A;  3HUG B;  3KX2 A;  1Y39 A;  2GOX B;  3BR0 A;  3JRA A;  1Y6I A;  2Y0M A;  1D1B A;  1U3E M;  3JTH A;  2MFZ A;  3AG2 H;  2QGU A;  2X9D A;  2XIG A;  3BY6 A;  3I54 A;  4UNO A;  2L9S A;  1O7F A;  4XLA A;  5H20 A;  2M9H A;  3WTX C;  3RTR A;  2FMY A;  1U8R A;  1BR4 A;  3T8T A;  3WGI A;  2QKL B;  3JSP A;  1HKT A;  4RA2 A;  3V8L A;  2DA3 A;  3K10 A;  3GTG J;  2HGC A;  1L3L A;  4CSW A;  1G3S A;  4IHX A;  2CSO A;  1BL0 A;  2B0L A;  2VKH A;  4ZDP A;  1B72 A;  2DOA A;  2GM4 A;  3DF8 A;  1D0X A;  3KP5 A;  1O3R A;  4HSR A;  2EV5 A;  2HYG D;  3W3C A;  3KE2 A;  3VFZ A;  2LY2 A;  2VXZ A;  3CC7 I;  2ELJ A;  2ACJ A;  2LP0 A;  2LNB A;  5CVU A;  1WJD A;  2M2E A;  4BDZ A;  2EWN A;  1HKQ A;  2J5O A;  1ETW A;  3IAM 2;  3CUQ B;  4XOP A;  1YFH A;  2IGO A;  3JR9 A;  5CVI A;  5HDK A;  4J00 A;  3KZI C;  1TT5 B;  2WB1 N;  1LJ9 A;  4QPQ A;  3OYF A;  3JRB A;  4M6V A;  2IRF G;  1V55 H;  4Z6Y A;  1K79 A;  4LB5 A;  2Q1Z B;  2OCE A;  3FXL A;  1W5T A;  1LFB A;  1MJ9 A;  1P2F A;  1T08 B;  1CQT A;  3A1Y A;  2JRT A;  1STZ A;  3ABU A;  3MZY A;  3SYT A;  4RM2 A;  4P9U A;  3OIO A;  2X51 A;  4ENK A;  3VYU B;  2ICW G;  2DPU A;  2DI3 A;  3I58 A;  3GF2 A;  1Z7U A;  3OOP A;  4KIB A;  3GTK J;  3V8K A;  1P4A A;  1IW7 F;  4ENJ A;  3ABM H;  4XLP F;  4HNU A;  2LTP A;  3JAM K;  2QQA A;  3RJP A;  3TL4 X;  1FTT A;  3MQ0 A;  3E5Q A;  4IRG A;  4D5C A;  2IT0 A;  4BQQ A;  2DTZ A;  1I50 J;  2E1O A;  3C18 A;  2M4K A;  4NQW B;  1UJ8 A;  3HL2 A;  3OYL A;  3N97 A;  5DTD A;  3BQY A;  2CU7 A;  1D5V A;  4ZDL A;  2VE8 A;  3FF5 A;  4BJ5 C;  5FKK A;  4F52 A;  1XGO A;  1GVJ A;  3S3O A;  1ETY A;  4K2E A;  1ZGJ A;  3S93 A;  4GFB A;  2R7Z J;  2FRH A;  1ZK8 A;  3OYH A;  3M7G A;  4A5M A;  5E17 F;  1GXP A;  4A3B J;  4ESF A;  3FXO A;  1BIA A;  4NC6 A;  3IKV A;  4UUV A;  2PBI A;  2ZFW A;  3DEU A;  1IJW C;  4MGR A;  3L09 A;  1S7O A;  3F8M A;  2H27 A;  2PFB A;  3PFY A;  3ZQF A;  4C3H J;  3DQV C;  2OQR A;  2R7X A;  1U6G A;  3QYB A;  2AO9 A;  1GVD A;  4AWX B;  4IRI A;  2Y0S A;  2EZI A;  3BZC A;  1YRN A;  3VYT B;  1R9T J;  1N78 A;  4UB6 C;  2R7F A;  5KAF C;  5C4X J;  1ZAO A;  3PM1 A;  4XN3 A;  2IBD A;  4ZH4 F;  3W6J B;  2GAU A;  4YRV A;  1YX5 A;  2CQX A;  3E1S A;  2DA1 A;  4QPO A;  4EGY A;  2ID6 A;  4G6T B;  4DYQ A;  2ZB9 A;  3E6C C;  1I3Q J;  3PQJ A;  3CCY A;  3Q9V A;  4U0V A;  4CCN A;  3FHZ A;  5TRD A;  3BCB A;  2W85 A;  3RQI A;  1U9O A;  3OL4 A;  3KZY A;  3TW7 A;  4XSX F;  1WCM J;  4ITV A;  2JA2 A;  3V42 A;  4A0X A;  3E6M A;  3K4M A;  1RPW A;  1FEX A;  2F5E A;  2DTR A;  2MW8 A;  4CCK A;  2XPU A;  4CYD A;  2VKD A;  2DAO A;  4HX7 A;  5EF6 A;  2K3P A;  4WXD A;  3GO5 A;  2DBB A;  4BJ6 C;  2RNJ A;  1TLH B;  3KYD B;  4MFE A;  1W7P B;  2V7F A;  3ZCO A;  5F04 A;  2ZME B;  4L0Y B;  1I1S A;  1FTZ A;  3K4L A;  3HRS A;  2GXB A;  1IZ1 A;  4DIQ A;  2M7A A;  1HA8 A;  4UUS A;  1R71 A;  5E20 A;  4HNT A;  2HS5 A;  3ZN0 A;  3LSG A;  3WG7 H;  2CFX A;  2OA4 A;  3LSM A;  4D7N A;  1U5T C;  1X4P A;  5D8K B;  5M3M J;  2DOE A;  2CWE A;  3GME A;  5J1Y A;  2UXX A;  4LOC A;  4F55 A;  4XID A;  2EB7 A;  3HXL A;  3S8P A;  3DEW A;  4OOI A;  2M7B A;  3M3Y J;  3FBN B;  5TGT A;  3IHU A;  4E4H A;  3E6D A;  1ZHF A;  2ESN A;  3BDD A;  3PNV A;  5LGU A;  2A61 A;  3VYR B;  4XKB A;  4J19 A;  3EYI A;  4AYB N;  1QHH D;  4ESB A;  1VQ5 I;  3IUO A;  2K3F A;  3F6V A;  5E1Z B;  1ERD A;  1TWH J;  2P6S A;  3FMQ A;  3MN2 A;  3MZ8 A;  1YS7 A;  4LIT A;  4OWR B;  1OIS A;  3E6B A;  4MQ9 F;  2AHQ A;  4Y7N J;  3KLO A;  3CCJ I;  1KQ9 A;  2Z1D A;  2W7N A;  3CP2 A;  3DTI A;  5F08 A;  4A3G J;  4Y52 J;  5K5O A;  1MBF A;  2XRN A;  1XC5 A;  2GQQ A;  1AHD P;  1S6L A;  4B3X A;  4Q48 A;  3ZQH A;  1B8I A;  2D1V A;  3FXQ A;  4KIS A;  1VQ6 I;  3HOV J;  1JJ8 C;  4JYK A;  3FK6 A;  3MVP A;  2LG4 A;  3OL3 A;  1DPU A;  3R6S A;  2VOD A;  4HDV A;  4CZZ A;  3S2D J;  4PJJ A;  1GV2 A;  2OQG A;  4BY1 J;  1ZRE A;  3TED A;  3CJT B;  5HS9 A;  2RDP A;  4B3A A;  4IJA A;  4RAG A;  2Y9Z A;  3TO9 A;  2VJJ A;  3MFK A;  2A6T A;  2V9V A;  1K78 A;  2CO5 A;  2CYY A;  4CXF A;  1MMD A;  4M3G A;  3ROU A;  3LA2 A;  2YS9 A;  1G6N A;  2FOW A;  3HKZ N;  2F4I A;  5IY5 H;  2BXZ A;  4HRI A;  1IC8 A;  3RKX A;  3RI4 A;  1MH4 A;  3S16 J;  2LDU A;  2R0Q C;  2L9R A;  1UCR A;  3A0H C;  3H3U A;  4G7H F;  3DCF A;  2Z99 A;  1U9N A;  1SFK A;  1VQM I;  1ACI A;  2X1D A;  3U1K A;  4AVZ A;  4YIR X;  1TL8 A;  4CH7 A;  4XLE A;  4D9J A;  3ZXS A;  3C7J A;  2FXA A;  2CRG A;  2DK8 A;  1FIA A;  3L2C A;  3EUH C;  4JOM A;  1QZE A;  2P5V A;  1B4A A;  5L3D A;  2H6B A;  4LJZ F;  1PUE E;  2CFO A;  2JK3 A;  3LAP A;  3ASO H;  1RUO A;  3J7A O;  4FX4 A;  2GZW A;  9ANT A;  2BHY A;  2STT A;  5J40 A;  4QLC U;  2OD5 A;  4FTH A;  2M30 A;  1USS A;  2HZT A;  2ZXI A;  4B48 A;  1D5Y A;  1LPQ A;  1ORK A;  1YX3 A;  2BYV E;  2AXT C;  3K2Z A;  3KET A;  1XS9 A;  5KNL A;  2EV0 A;  1MGT A;  5A2Q Z;  4ZZD A;  2EIJ H;  2H6C A;  5J47 A;  2EQR A;  3K4N A;  1LUJ B;  1XSD A;  1BI0 A;  1S29 A;  2E60 A;  1LFP A;  4AUX A;  3A01 A;  1YIJ I;  2NVT J;  5LEJ A;  2E1M B;  3DU6 A;  2W4S A;  4RGU A;  4OIP F;  1BOA A;  2ZNY A;  4UB8 C;  5DEQ A;  4DGW B;  3IRR A;  1MBG A;  2KRF A;  1Y8R B;  1X1C A;  3PQK A;  5E8G A;  1G2H A;  5EZG A;  4M3F A;  5K7Z A;  3BR1 A;  2XRL A;  1B9N A;  3W6K B;  5GAE J;  3ESW B;  1J9I A;  4KNY A;  3QPH A;  4UHT A;  4CHU A;  1XCB A;  1EH7 A;  5CLS A;  2QVO A;  4IQ4 A;  4G94 A;  1ZR4 A;  2JQ7 A;  3HHG A;  4I6Z A;  3G3Z A;  2H8W A;  4F7Z A;  4IHT A;  2A5Y B;  3H5R A;  2P8T A;  2NNN A;  2XAF A;  1OCZ H;  3OYJ A;  4C2T A;  1D0Y A;  1ON2 A;  2HYF A;  3D5S C;  4DYR A;  3KYL A;  3DBL B;  1T56 A;  2AQF A;  1R7J A;  3E5X A;  3IWZ A;  5L3F A;  1VTN C;  2DJN A;  3FWE A;  3CJR B;  3Q9S A;  1CF7 A;  2Z33 A;  4A3J J;  2L9V A;  3B6A A;  3VOD A;  1Z67 A;  4YFX F;  1LQ1 A;  2E71 A;  1OR7 C;  4N4O B;  1AKH B;  4BJT A;  1QZZ A;  4B4C A;  1YS6 A;  4CDG A;  1WZ2 A;  2PJP A;  3KP2 A;  1H88 C;  1A6Q A;  1WH7 A;  4XSZ F;  5FKO A;  2FD5 A;  2A5W A;  4U0Y A;  3I3L A;  1XMA A;  5E3M A;  2L0K A;  3BTL A;  3JTG A;  1K6Y A;  2X6Y A;  3ASN H;  2ZJR F;  3HIF A;  1MSF C;  2E5Z A;  2EFP A;  4E7K A;  2ETH A;  1VQN I;  4RGS A;  1SD6 A;  1F4K A;  4FE4 A;  2ZSI B;  1O57 A;  3ERM A;  1IV8 A;  3K1P A;  5HS7 A;  2K5C A;  3SXY A;  2OV7 A;  3LSR A;  1R22 A;  1UG0 A;  2MD0 A;  2LBF B;  3CCR I;  3G2B A;  4I0A A;  2LVS A;  1BR1 A;  1H89 C;  2HKX A;  3RDI A;  2WAF A;  3TDU C;  1IRX A;  5E1X A;  4ANJ A;  1VQ9 I;  4XK4 A;  5H2F C;  3PO3 J;  1OCR H;  3PSF A;  3AFH A;  3V7S A;  1QO0 D;  4LFU A;  3SDG A;  3SFZ A;  1WGX A;  4FQG A;  4R1H A;  4BH9 A;  3HHH A;  1T98 A;  2XAG A;  1Z21 A;  3FM3 A;  4RGR A;  2QKM B;  1YG2 A;  3BJO A;  2ADU A;  3WTT C;  2N8G A;  1WWX A;  2QWW A;  3WHB A;  2UWM A;  1GHC A;  2MLG A;  4I98 B;  2B7E A;  3LST A;  3UR3 C;  1JT0 A;  3H9Q A;  1E0E A;  1MZB A;  4UVA A;  2R93 J;  3TDZ C;  3NRV A;  4RGX A;  4C9Y A;  1YO5 C;  1B59 A;  2LLK A;  5TJJ A;  1R00 A;  3K7A J;  2BV6 A;  1I6X A;  1GLN A;  2KZV A;  1LFU P;  2G0E A;  4HOB A;  3ZN1 A;  1JKR C;  4XLN F;  2L4A A;  1FMV A;  3CUO A;  5LFA A;  5ILU A;  2FA5 A;  2K9N A;  1QPI A;  2CV2 A;  1N75 A;  2GOM A;  3S32 A;  3FKJ A;  3CDI A;  3OS1 A;  1XGM A;  5GTI C;  5LRS A;  1R1V A;  5FGM A;  1XTA A;  3F8C A;  4ZTF A;  2HOS A;  2EV6 A;  2BW3 B;  2DW4 A;  3O8H A;  5KK1 A;  5K7H A;  4BU2 A;  1PDN C;  2Y31 A;  4A3K J;  3DEE A;  3R61 A;  4PGH A;  3BLY A;  2R7S A;  4YEJ A;  2W82 A;  2QQB A;  4E7Z A;  4UV8 A;  3J81 K;  5EG0 A;  4L18 B;  3GTO J;  4PZJ A;  4KN7 X;  1HOM A;  4EJU A;  1FP1 D;  2CH0 A;  2K9S A;  5J4Y A;  3RYP A;  1Q1H A;  5GAH J;  2IAI A;  4ZYA A;  2FE3 A;  4GCV A;  4LMY A;  4A3C J;  1TQI A;  3BCA A;  3GLX A;  3L1P A;  3HOZ J;  1MMN A;  3A02 A;  2V79 A;  2BEO A;  2V9P A;  2XHK A;  3E5U A;  3LA7 A;  3BR3 A;  3MKY B;  4Y33 A;  3P7N A;  4HF1 A;  1MJA A;  2IS6 A;  5B1A H;  3GFJ A;  3R4K A;  1JHF A;  4PJ0 C;  4L9J A;  2XDV A;  4OIQ F;  1T33 A;  2RAE A;  3S1N J;  4MFD A;  1S3J A;  1Z1D A;  1L0O C;  1Z9C A;  3IP4 B;  4U7B A;  5CVJ A;  5M5X J;  3FIS A;  3EUA A;  4KT5 C;  4LIV A;  3ZQQ A;  2FML A;  2XAQ A;  4XM3 A;  1A36 A;  3L2V A;  2ZSH B;  1BM9 A;  3VOE A;  1HDP A;  4H4K C;  2FSW A;  1YE9 A;  1O3T A;  1F36 A;  3BZK A;  3KP4 A;  1MDM B;  1PUF B;  1KQ8 A;  2K86 A;  1WJB A;  3OYG A;  2DQL A;  4HYE A;  4BEH B;  2GXA A;  1RIO H;  1F43 A;  1YTY A;  1ETV A;  4ZYG A;  4PFO A;  2XAU A;  3H5N A;  4HX4 A;  1E3O C;  4PUS A;  3C2H A;  5HLT A;  1ZG3 A;  4U88 A;  5CPR B;  2V6C A;  2UV1 A;  2V9K A;  1O4X A;  2R5Z B;  2STW A;  3LSP A;  2QUF A;  5LHH A;  2VKV A;  3HRT A;  3QRF F;  1HW2 A;  4UVB A;  1KA8 A;  2X1E A;  2GWR A;  2DOD A;  3GWZ A;  3R0A A;  1YHQ I;  2DK5 A;  2F4O B;  2Y0S N;  4AIK A;  1JI8 A;  2MYS A;  2VPL A;  1TBX A;  3HSR A;  5IT9 Z;  2LC2 A;  3E7L A;  3H3Z A;  5D6E A;  2DDA A;  1OCP A;  2DJI A;  4GYG A;  2EK5 A;  1EH8 A;  4A3M J;  3AKZ A;  3EYY A;  5HLI A;  3OYB A;  4G12 A;  3BG5 A;  4AIJ A;  1ZEL A;  2HFH A;  2DOF A;  2LF8 A;  3ZOB A;  3LSJ A;  2JVH A;  2MH9 A;  2EA2 A;  2I5U A;  4BAY A;  2DMQ A;  2OCC H;  2BY2 A;  1YW7 A;  5TIS C;  4HLX A;  2PLY A;  2CMP A;  2L3D A;  2CV1 A;  4IF4 A;  1FMW A;  1DU6 A;  3BR6 A;  3WOD F;  4BL0 B;  3K6G A;  4O6J A;  4N9H A;  5JI6 A;  3LL7 A;  1BW5 A;  1XX5 A;  2VLA A;  2HQN A;  5EDN A;  4I2O A;  2NRA C;  3K70 D;  2VQH A;  3B6C A;  1T38 A;  4J01 A;  3ZQ7 A;  4F92 B;  5DM7 F;  3FHN A;  4M71 A;  1M1E B;  4KIG A;  4RAF A;  1XGN A;  2F5D A;  5D5W B;  3SQN A;  4BUP A;  3LA3 A;  2DN0 A;  4HF0 A;  1KU2 A;  2R3S A;  1WVR A;  5FLX Z;  2M45 A;  3FMR A;  1X3Z B;  3G1O A;  2XGX A;  4HNV A;  2OTL I;  3HDD A;  3QOD A;  3WE2 A;  3DBR B;  4CIC A;  5LGN A;  1LDD A;  1FBS A;  1YYV A;  5JLW A;  1MBK A;  1ZR2 A;  3K4J A;  1DU0 A;  2YSR A;  3OWT A;  2HDW A;  1X2N A;  2JTV A;  4IQJ A;  2BVM A;  2JA5 J;  5J3L A;  2JZY A;  2M1B A;  1KQ0 A;  1WQ2 A;  4P1W A;  3G1M A;  2W00 A;  1SEU A;  2D5V A;  4HEA 2;  1LE8 A;  1XCV A;  3DKX A;  4KDP A;  1IG7 A;  4XKV A;  3OYC A;  2ME6 A;  3X2Q H;  5DS9 A;  4BXX J;  3IAS 2;  2VB6 A;  1IN4 A;  1FNN A;  4LK1 F;  4IOA F;  3GBG A;  4LB6 B;  2NOJ B;  2DMP A;  4KUM A;  2NVQ J;  2MD5 A;  2DT7 B;  3BP8 A;  4CCO A;  4HV6 A;  2YX4 A;  1FOX A;  1OCO H;  2COM A;  2ME0 A;  3DLA A;  2QYO A;  3NAR A;  3ZPL A;  2LKX A;  1ZGW A;  1VND A;  1ULY A;  4YFN F;  2DU9 A;  4KN4 X;  1D8K A;  3MKL A;  2L7Z A;  2Q2E A;  1MBJ A;  1R36 A;  1RZ4 A;  1JJ6 C;  3H0D A;  2H94 A;  1I3A A;  1R23 A;  3HUG A;  2VN2 A;  3GEZ A;  1RKT A;  5ILV A;  2WV0 A;  4HQM A;  3BQZ A;  2XAS A;  2XB0 X;  3CO7 C;  3D5R C;  2OZU A;  4CA0 A;  3TOA A;  3JRI A;  5CJ9 A;  5BPI A;  2MH2 A;  1FC3 A;  3KIO A;  5LHG A;  4YG2 F;  2QSH X;  2DMT A;  1MKM A;  2O0Y A;  4CCJ A;  5IT3 A;  3BG3 A;  3LNQ A;  3CMM A;  1J75 A;  1H9G A;  2BY3 A;  1ON1 A;  3FBI B;  3REO A;  1R6R A;  2DO7 A;  3K69 A;  4FE7 A;  4NUB A;  3G73 A;  1J0R A;  5EYR A;  3CMY A;  4JX4 A;  4W97 A;  2WA0 A;  2XKP A;  2R7R A;  2VE9 A;  5HLG A;  4BYY A;  4ENN A;  2XPW A;  2M34 A;  3FX3 A;  4QSH A;  3V4G A;  4FIS A;  4BKX A;  3S2W A;  4HA8 A;  3QPL A;  5EGO B;  2VC0 A;  3I59 B;  1FOY A;  1ZLJ A;  1WFX A;  1BIB A;  3RPU A;  3BR5 A;  2V1U A;  2QCO A;  1NH3 A;  3VSK A;  4BQO A;  1JKQ C;  1NHA A;  4OAZ A;  4N0B A;  5HNH A;  2CGP A;  1UG2 A;  2XPV A;  1KU7 A;  1Y0U A;  2D45 A;  2O6G E;  2ZNZ A;  5DM6 F;  2LYC A;  1OCC H;  3ZMZ A;  4U0W A;  1MND A;  3I5U A;  2EIM H;  4I7H A;  2KP6 A;  2KQR A;  2WY8 Q;  3FZV A;  1TWF J;  2LRE A;  3C1D A;  1ETQ A;  3HGY A;  3FK7 A;  4Q5S F;  1S8N A;  3AL0 C;  4ZYH A;  3MAJ A;  2W84 A;  1O3S A;  3HBL A;  1AU7 A;  2XUB A;  4X6A J;  3LFK A;  2EIK H;  5EZH A;  3DTK A;  4N4N B;  1X1A A;  1P92 A;  2PJR A;  2RVC A;  4BE1 A;  1B9M A;  3JRD A;  3GFI A;  3TMO A;  3O8G A;  2UZK A;  1KYW A;  4WWC A;  3DXJ F;  1WJF A;  2CJJ A;  1QBJ A;  1VFC A;  3AAF A;  1X3W B;  1TC3 C;  3H3V K;  2DFE A;  2VJ4 A;  3HG9 A;  3B73 A;  3BC8 A;  2ECB A;  3NQO A;  4GXO A;  2IS4 A;  4NQW A;  2B9S A;  3P9I A;  4BHB A;  1U5T B;  5EEA A;  1HW5 A;  3K2A A;  2V1X A;  1YQA A;  2X6W A;  3OYA A;  2QQ9 A;  1VQO I;  3WTS C;  4A0Z A;  1ZKG A;  3BTI A;  2VKE A;  4KMF A;  1OPC A;  2EZK A;  1LVK A;  3I4N J;  1ZLK A;  2VQC A;  2TRT A;  4Q4Z F;  3HPH A;  5FKM A;  1XMX A;  2NAZ A;  4HV5 A;  4HF2 A;  4ON0 A;  1FPQ A;  1K4S A;  3MZH A;  5D6F A;  2E34 A;  2W24 A;  1MBE A;  3OYM A;  1F9N A;  2PEX A;  3GTP J;  1TTY A;  3BJA A;  3H9J A;  5ICG A;  3PSI A;  4A0Y A;  4BBS J;  4KMU X;  3OYD A;  1ITY A;  1XN7 A;  2D2W A;  1OYY A;  3I71 A;  2R7T A;  1HST A;  1T6S A;  4QTR A;  4V2F A;  4GDF A;  5IYD J;  1HW1 A;  1Y1V J;  3HRM A;  2XAJ A;  3RIR A;  3ZMT A;  2X1C A;  4U7D A;  5HOO A;  1K78 B;  2CUZ A;  3QAH A;  1JGS A;  3JRC A;  2QBY B;  2M3A A;  2FQ3 A;  3I0T A;  3K70 C;  1IXC A;  3OYN A;  2G9W A;  3BZ6 A;  3WG9 A;  4R8H A;  2ZME A;  2VI6 A;  1BC7 C;  3ISP A;  3RSN A;  4MHG A;  2DMN A;  4BHC A;  4XLH A;  5GPA A;  4YFK F;  5LHI A;  1RUN A;  1KYZ A;  4PJN A;  1R49 A;  4E7S A;  1LVA A;  3QPT A;  5L3C A;  1V54 H;  2IEK A;  3WU2 C;  3M9A A;  4M6X A;  2DYS H;  4EGZ A;  3A2K A;  3LQQ A;  1NK2 P;  4AD9 A;  4MEY F;  4MO7 A;  5FD5 A;  3GW2 A;  1S7A A;  1VI0 A;  2JA6 J;  1W0T A;  4M9Z A;  4BE0 A;  4UUT A;  1X3U A;  1IRF A;  4BXU A;  2VJ5 A;  4OMZ A;  2UUZ A;  1LB2 A;  3G4S I;  5IP6 A;  1YJW I;  1AOY A;  1MIJ A;  4V19 K;  2OBP A;  4FX0 A;  4G7O F;  1HCR A;  4IOC F;  1X19 A;  2KL4 A;  1IGN A;  1PP7 U;  2IS2 A;  2LY1 A;  2YU9 J;  2YR2 A;  2IPQ X;  3H5A A;  3W2V A;  4A5N A;  1VQ8 I;  1MNM C;  2HPM A;  3F9K A;  3A01 B;  4BE2 A;  2XSJ C;  1KON A;  3K0L A;  5HS8 A;  1UAA A;  3OS0 A;  4C30 A;  3F8B A;  3CCQ I;  2E19 A;  5D5X B;  3ZQL A;  3TW6 A;  5JVT A;  4EM0 B;  3S14 J;  3CMA I;  2K85 A;  3CME I;  3F6O A;  4DBR A;  1W5S A;  2FNP A;  2L9N A;  3EUK L;  2QLZ A;  3KFW X;  1U0J A;  4S04 A;  3IRQ A;  3LQR A;  3OYK A;  2RGV A;  1C0W A;  2ELK A;  4XBF A;  3A0B C;  3NEU A;  1TNS A;  1FOK A;  3J80 K;  5C44 J;  4DBQ A;  4PJM A;  3FXJ A;  3Q3S A;  3K4K A;  1E3P A;  2O5R A;  3WU1 B;  3MKZ A;  2DT5 A;  5AIP A;  4D5F A;  1XD7 A;  2O3F A;  1UB9 A;  2BE5 F;  2RV8 A;  1PP8 F;  3ZP5 A;  1HF0 A;  3D0S A;  4XLC A;  3FXU A;  4EQQ A;  4Y4R A;  2PMZ A;  2CUJ A;  2A6H F;  2HZD A;  2QQ8 A;  2WC2 A;  2KIQ A;  1B6A A;  2XC7 A;  2VT3 A;  2R92 J;  2LFB A;  3H35 A;  1A6I A;  3WTU C;  3P9C A;  1T0F A;  5FRM A;  1Z0X A;  3RZO J;  4B44 A;  1HKS A;  3BRO A;  2KJC A;  5FLM J;  2FX0 A;  2IP2 A;  5BMZ A;  1UFM A;  4RB3 C;  1W36 D;  2VOP A;  2YPR A;  1O3Q A;  2MGQ A;  5JVG F;  4X1E A;  3QOP A;  3FDY A;  5E18 F;  4NDL A;  2DPD A;  3DFG A;  5LGT A;  4XOR A;  4KIF A;  3TP3 A;  2DFF A;  3CCE I;  4M9S A;  1R4N B;  4R79 A;  5FLV A;  1DP7 P;  3H1C A;  4OMY A;  2R7D A;  1HSJ A;  2A05 A;  3QYF A;  3G6E I;  3VYS B;  2NS0 A;  1A35 A;  5BOX A;  2MSY A;  2CUE A;  2WY7 Q;  4HLY A;  2RNG A;  3JAM Z;  4BDY A;  3W2A A;  4I01 A;  2HQR A;  5HLH A;  4AVP A;  2A6E F;  1UZC A;  4BXF A;  3WTY C;  3ZMV A;  2V4J C;  3U1D A;  1SVM A;  2L7K A;  1PVE A;  3VWB A;  1H8A C;  1J2X A;  2M0C A;  1QVT A;  2VQL A;  4WF2 A;  3GVA A;  5IYC J;  5FD6 A;  3F8F A;  2ESH A;  2PQ8 A;  3M1C A;  2FU4 A;  2HYJ A;  3SEZ A;  3W2W A;  1O7L A;  4IX7 A;  5B3S H;  3HZJ A;  2E1C A;  5GP9 A;  1KZH A;  2DQR A;  3ECH A;  3AG3 H;  3PNY A;  1ZG5 A;  2VBY A;  1K61 A;  3A03 A;  1UMQ A;  1RR7 A;  1TW2 A;  4RLF A;  5AIQ A;  1QZY A;  1MMG A;  1ODD A;  1Y8Q B;  2NS8 A;  4RAY A;  3U21 A;  5FKN A;  2OU2 A;  2FF4 A;  3IKT A;  1N77 A;  3QOE A;  2W1O A;  2H8R A;  1JE8 A;  1XMK A;  1TWC J;  3G71 I;  2E7W A;  3OYI A;  3GFM A;  4ZYD A;  4XL9 A;  5J4V A;  1Z3Y A;  1E3H A;  2BOL A;  2EZH A;  1Z05 A;  2K7L A;  2KJB A;  1AKH A;  2XGC A;  3DKW A;  4OU0 A;  5K5R A;  2X6X A;  1Z6R A;  4KT6 A;  4CYC B;  1U8B A;  3ZMS A;  2DA6 A;  1FYM A;  3F23 A;  2HOA A;  2HTS A;  3ULQ B;  2BGC A;  3ERE D;  3IV5 A;  1GXQ A;  4MTE A;  1J7K A;  4XR6 A;  3MD2 A;  3L2Q A;  1MSE C;  1T2K A;  2OF7 A;  3CF5 F;  2IGN A;  1IN8 A;  1BI3 A;  3OV8 A;  2HEO A;  1V5F A;  4IKF A;  5CQE A;  4Z2Y A;  2LBF A;  2VUM J;  3CC4 I;  4HW0 A;  1T39 A;  1ZGA A;  5DCM A;  1K7A A;  1BJZ A;  3SZT A;  2DA2 A;  2EIL H;  4HX8 A;  4C3I J;  1GV5 A;  5L3G A;  3KCC A;  5FJ8 J;  3BG6 A;  4IVN A;  4RB0 A;  1A31 A;  1WJ5 A;  1TZL A;  3RPU D;  3S1M J;  2LKS A;  3VSL A;  1LKX A;  1Q1V A;  2Q0O A;  4M9X A;  3OS2 A;  4TV7 A;  5J8F A;  2F5F A;  5D4S A;  3K1M A;  2CQN A;  5AON A;  4IXA A;  1DUX C;  3F0C A;  2RQQ A;  2CQK A;  3RQ4 A;  2D1H A;  4MNU A;  1Z77 A;  3HOT A;  1SFU A;  2O8K A;  2J5P A;  2IA0 A;  2Y75 A;  3CDL A;  1IN5 A;  3PJR A;  3NWT A;  5B66 C;  2KRH A;  2Z9O A;  3GXO A;  2RN7 A;  3I4M J;  2KMU A;  1S72 I;  3LSK A;  2WTE A;  1FBU A;  5D8L B;  3HSE A;  3LAJ A;  1QNT A;  3UKG A;  2HQ5 A;  3BG9 A;  2Z5U A;  3WGG A;  2ZXH A;  4L5E A;  3S1Q J;  3R60 A;  1R1U A;  2LOO A;  3R0J A;  1YIT I;  2A69 F;  4NC8 A;  3G1L A;  3AG4 H;  1ZYR F;  2ID3 A;  5JR3 A;  4LG3 A;  4FT8 A;  4XKC A;  4G6Q A;  5H6Q A;  4KIC A;  4RAZ A;  2CQ7 A;  3GYH X;  1IV6 A;  1JTX A;  2BW3 A;  1FYL A;  4IHW A;  2L4M A;  2RC4 A;  1SC7 A;  3PUF A;  1X4O A;  1MW7 A;  3CJN A;  1JUM A;  2HQA A;  2NS7 A;  2OUM A;  1SFE A;  2DXI A;  3I53 A;  1Y1W J;  2I10 A;  5DD4 A;  2R5Y B;  1JXS A;  3JRE A;  2K4B A;  3QU6 A;  1R5I D;  3DWL E;  4HPQ A;  2FJ1 A;  1WI9 A;  4CGZ A;  2VIX A;  2ZJ2 A;  3PNT A;  5ILS A;  3CLO A;  2NYX A;  1X1B A;  1S9H A;  1XSX A;  2R7O A;  4PK4 A;  1ENH A;  3H0G J;  2CV0 A;  2NNY A;  4CCL A;  2EH3 A;  1FZP B;  1ONV A;  3HJE A;  4GYI A;  4OAY A;  4PDK A;  2M0M A;  3QP5 A;  2BXY A;  4KIT B;  4MTD A;  3VEP A;  5F1J A;  4E6K G;  5J8C A;  4BHP A;  2KPM A;  3JRG A;  3RYR A;  1KU9 A;  4V2G A;  2VT2 A;  3L2R A;  3LSI A;  4EV0 A;  3S17 J;  2PMU A;  1SFO J;  3WGH A;  2F6C A;  2QEN A;  2A3S A;  4RDU A;  2WAQ A;  5DDG A;  4RB1 A;  4XLF A;  3DLL F;  4M72 A;  5FFZ A;  3S15 J;  2F2E A;  4LLG F;  1IRG A;  2H1K A;  2XAH A;  4E7L A;  4LG0 B;  1TT0 A;  1NG6 A;  2FOK A;  2F4M B;  2LD5 A;  3EQL F;  1MH3 A;  1YJN I;  1VQK I;  1D3Y A;  4UY8 I;  3J7A Y;  3DKY A;  3CES A;  4N9I A;  5KHD A;  4BAC A;  2GBY A;  2Y2Z A;  2AS5 F;  1MDM A;  4B43 A;  1FT9 A;  4B1R A;  3C2G A;  3DU5 A;  4C3J J;  2GIV A;  3W6V A;  1FX7 A;  3GTJ J;  4BEH A;  1W36 C;  2L7F P;  5KVR A;  2BZT A;  1P4W A;  2A68 F;  3I4P A;  1IUF A;  2HI3 A;  4RB2 C;  3ABT A;  2GA1 A;  3PIO F;  1W7P D;  5FKL A;  3T0Y A;  5IP7 J;  4HG2 A;  2MG4 A;  4XKW A;  4A3E J;  4MEX F;  1APL C;  1HC8 A;  2ZO4 A;  2R5Z A;  2MC4 A;  2WBM A;  1I1G A;  1SD5 A;  3T8R A;  3HOU J;  1TW3 A;  4C2M J; 
#chains in the Genus database with same CATH homology
 1LUJ B;  1M1E B;  1T08 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...