1T08B

Crystal structure of beta-catenin/icat helical domain/unphosphorylated apc r3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
b'GKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-catenin
publication title Mechanism of phosphorylation-dependent binding of APC to beta-catenin and its role in beta-catenin degradation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/cell cycle
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1t08B00
1M1EB 1T08B 1LUJB
chains in the Genus database with same CATH superfamily
1G3SA 3DWLE 2DOEA 2I10A 3LA7A 2L7FP 1LFBA 1P4AA 2CUEA 5LEKA 3CJTB 5IP9J 2PJRA 2BY3A 1IN4A 1P92A 2ISYA 1ZLJA 1Y1WJ 5DUIA 2HKOA 4KISA 4C3JJ 4BE2A 4AYBA 2ZJRF 3IP4B 5E3LA 3OSFA 2VC1A 3VSKA 2K86A 2ZFWA 1OYYA 3FXLA 4RB2C 1XX5A 5HNFA 4HSTA 4BNCA 1Y0NA 1OCPA 3JSPA 1P4WA 2JUCA 2WAEA 1LE8B 3DEWA 4WXCA 4R79A 3KETA 2LBFA 1R4MB 2JT1A 4XIDA 3VWBA 2LOOA 2MD0A 4D9JA 3OYGA 1OYIA 3V42A 2LF8A 3QOEA 2ELKA 3LAPA 2DDBA 2Y0SA 3IL2A 1K4TA 1O3QA 2K7LA 1B4AA 2E5ZA 4WXDA 5LLQA 2L2OA 2P7CB 4E7SA 1R1VA 1LDDA 1OYWA 3IC7A 5E3NA 3U21A 2EZLA 3T8RA 1XMKA 4UV9A 4A3CJ 1JJ6C 1LEBA 4XBFA 3L2WA 3HL2A 1K6YA 3MZYA 4EJWA 2BYVE 5IYCJ 2QCOA 2ZNZA 3AG1H 3CJRB 4UB8C 1T0FC 2QBYA 2ZMEA 1FWZA 4HNTA 3CP2A 1I39A 3PNYA 4PJ0C 5D4SA 4L9NA 3RIRA 3RQIA 1TBXA 2UV1A 2CJJA 1NG6A 4EM0B 3BCBA 3U2RA 4AWXB 2OZUA 3P7NA 1HKSA 1WGXA 5EEAA 1WJ5A 3BPXA 3D0SA 3S2HJ 1DDNA 2X6YA 3HGGA 1ITYA 3OMYA 5H2FC 1YI2I 1FTZA 3KYLA 2FQ3A 2K02A 1HA8A 3H5AA 3TMOA 1X1PA 5KNLA 2ME6A 5D5VB 2CV0A 1KGSA 2LREA 2XB5A 4BKXA 2NVTJ 1JHFA 2JMWA 4A5NA 2O8XA 2M34A 1MNEA 4PCQA 1O7LA 2XF6A 2FRHA 4M71A 5A2QK 3TOBA 2M8GX 3U9GA 5BQTA 3FXRA 3SQNA 3RYRA 2KLOA 3BZCA 2LLKA 4GCVA 1XC5A 3HM5A 5EZHA 4RB3C 2KPMA 3IRQA 3PL8A 2R5YB 1IXCA 3IWZA 1FP1D 1YOVB 4M6XA 4U0VA 3BWGA 2LTPA 2VBWA 5EF6A 2KISA 3WODF 5IOZA 1Y39A 3W3CA 2BHZA 1MNMC 4ZYDA 2ZSIB 4DOZA 2L7MP 3OYHA 4Z2YA 2BY0A 2W00A 1ETOA 2OPTA 3EUKL 3SFIA 2HKXA 5IP6A 2XAQA 5CVRA 3RKXA 3OYDA 2X48A 1VQ8I 3TP0A 2AO9A 3I3LA 5ILVA 4A3DJ 3DEEA 2K9LA 5L3EA 2QQBA 3KLOA 3G6EI 5GP9A 3OWTA 2IS1A 3OYNA 2CUJA 4M6YA 1V5FA 4XLNF 3IV5A 3ABLH 4WK8F 4QIWN 1BI0A 3SYTA 4IKFA 1LFUP 4BQQA 3V7SA 3ASNH 1W7PA 5LBQA 2P0WA 2ZBKA 3CUQA 1DUXC 2FF4A 1VQPI 3I71A 2CQNA 4QPQA 4NDLA 5B5EC 2L3DA 1B1BA 2LSOA 3K4NA 3L2UA 2PMZN 4LLGF 1ERDA 4KYWA 2F4IA 2Z99A 1QRYA 5M5WJ 5M3MJ 2BEOA 2IT0A 2EV6A 3DEUA 1IRZA 3HOYJ 1EF4A 3E0JB 4I98B 4LFUA 2QEXI 2QBYB 1OCOH 3AFHA 5F1JA 3IKTA 1BA5A 2AQEA 1EH7A 1TZLA 3Q0UA 4BXFA 4U0YA 2XPUA 1TWGJ 2XPVA 1OCRH 3HG9A 5J1RA 2GOXB 3CZ6A 4I2OA 2HZTA 3PO2J 5K5QA 1BJZA 2HQNA 2P7VB 4M3DA 1O57A 4CCKA 3JCUC 3HHHA 2BZTA 4ZYEA 2CSOA 1T8IA 1TNSA 2QKLB 3WU2C 5CJ9A 2ACJA 4B43A 2A05A 2FMLA 3CQZJ 4GRIA 3KZYA 4A2UA 1TNTA 1H9GA 4KMUX 2DOFA 5D5WB 2COMA 1REPC 5JHFA 3CDHA 2JTVA 1APLC 1ZREA 4OAYA 3K4LA 3TO6A 1IN5A 1QO0D 1BOBA 2Y30A 2GXGA 5M5YJ 1EJ9A 2DYSH 1SFOJ 2XAFA 1EH8A 5C3EJ 1MKMA 2P6SA 1BIAA 3J7AY 4CCJA 2ZB9A 1Y8QB 4HW0A 3B6CA 2Y0MA 2WBMA 1I5ZA 3BT9A 1ULYA 1Z7UA 4F3QA 3OOUA 4O3MA 4CGZA 1SMYF 2ADUA 1AA7A 4L5IA 3OSGA 3Q9VA 1LPQA 2OF7A 4A3KJ 5TISC 2L9RA 1QNTA 2RAEA 3ZPLA 2QGUA 2L5QA 3P5JA 3CCJI 2QSFX 3NARA 2E35A 1B9NA 1UFMA 2NAZA 3W6JB 1BI2A 2JSCA 3IKVA 4AVPA 4N4OB 4BY7J 2R5ZA 3DCFA 2ME0A 2M1BA 3EUAA 4FX4A 3SZPA 1B9MA 3H35A 4C3HJ 5E3OA 1SANA 2QWWA 2PI0A 2VKHA 2LD5A 3G3ZA 1FOKA 1VQ4I 3PSIA 2DCEA 2VL8A 3CUQB 2K27A 3M1EA 3KP3A 2FJ1A 1ZR2A 2XGCA 4O6JA 4ZTJA 2XAHA 3FKIJ 3N4MA 2ICWG 3ZMVA 3RKQA 2K9SA 1H9TA 1HQCA 2W4SA 3EDPA 1R5HA 1VQOI 4YG2F 3ECOA 2UUZA 3MWMA 1VQ5I 3S1MJ 3M9AA 1D0XA 1F5TA 4PJMA 4M73A 1HKTA 4HPQA 4XRSA 3B6AA 3HDDA 5FLXZ 1V5EA 3GLXA 5D5UB 3BR2A 2YUSA 4GYGA 1GT0C 2VODA 1WH5A 3E6DA 3JRDA 3I54A 2K4BA 1BJAA 4AD9A 3S3MA 1R36A 4MHGA 4IHYA 3FXMA 2MH2A 2W57A 4ETSA 2LG4A 3TEDA 1TL8A 4YRVA 2AS5F 2F4MB 1S7AA 3UNGC 4ESJA 2CUZA 4I76A 5C4JJ 3FISA 4LD5A 1TWFJ 1ZELA 2MABA 1A36A 3OYEA 5ILSA 3O2PE 5L3CA 2EWNA 1YS7A 1FBUA 3R4KA 5JVGF 2DXIA 1BI1A 5E79C 3VYUB 2GXAA 5HLGA 3DU5A 1QGPA 2YX4A 1HDDC 3A1YA 1WI3A 1ZHFA 4P55A 4MFEA 5ICCA 2W24A 3LQQA 4HX8A 2EZHA 2O5RA 4B3AA 4BHBA 3OS0A 2ZXWH 2VQHA 2PMHA 2PMZA 1Z7LA 3D5SC 3VFZA 2FEZA 3S2WA 4A3LJ 2IW5A 1R4NB 4GYIA 3VDXA 5L3DA 2VPLA 4M9XA 3BCAA 5EG0B 3GTOJ 3QPTA 1OKRA 5LHHA 1W0UA 2XDVA 3G4SI 3I9V2 1Z05A 3MEXA 4XKBA 1BM9A 1FNNA 3CMEI 4MTEA 2DDAA 3OYIA 4X6AJ 3MCZA 3OYAA 1J5YA 3K10A 5DYMA 4PGGA 4AIJA 2BOLA 4M6VA 4XMYA 4HNVA 2WA0A 3WTZA 2R5ZB 1TP4A 2KJCA 3H92A 1A5JA 2GA1A 1VQLI 4KFCA 3GZ5A 1O4XA 2OBPA 2A07F 3RQ4A 1K83J 3EUHA 1FYLA 1RR7A 2X4HA 4P9FA 1LDKB 3AG2H 5B1AH 3S17J 4Y4RA 1UMQA 2X0LA 1J0RA 2Q0OA 2E34A 3WHBA 3CMMA 4XM3A 4S05A 1Y0UA 1YJNI 1KQ8A 1Y1VJ 2OTJI 1S8NA 2WAQN 3GXOA 2DK5A 3MFKA 1SD4A 1BL0A 4Y17A 5M3FJ 1S72I 4ENKA 2J5OA 4HZFA 3TGNA 3BJAA 3V7CA 3ZQCA 3IRRA 3X2QH 4YIFA 5GAHJ 2QF7A 2M7AA 4I09A 4XLHA 1LNWA 4HF0A 1XTAA 1I6HJ 2E7WA 4ZDOA 1WZ2A 2M9HA 1BIBA 3FMQA 3QAHA 3SJMA 3L2RA 4V19K 3ZR8X 1X1BA 2OUMA 4UV8A 1D5VA 5E17F 4P9UA 3D5LA 1FX7A 1K78A 1Y6IA 3JW4A 1K6OA 1WQ2A 3BG9A 3CLOA 5DCFA 2V1DA 3A4CA 4R1HA 3SFZA 4ITVA 2E60A 3OYJA 2IEKA 2M45A 4KN7X 1P7JA 4YFNF 2ISZA 5GTIC 4CYCA 4I7HA 5CLSA 4NBQA 4LOCA 5AIPA 4A5MA 3TO9A 2P6TA 1WJBA 1ZK8A 3QQAA 4CZCA 2DI3A 2ECBA 3DLAA 3QODA 4M3BA 3H9JA 3PFIA 1X1DA 2VC0A 2VKDA 1E3HA 2ID3A 2OD5A 4I0BA 1E17A 1FSHA 2N8GA 3GX4X 3BP8A 4CA0A 1VFCA 5D8LB 1OR7A 1A04A 4OMYA 3E5QA 2A6HF 3B73A 1A6IA 4BU2A 2KJBA 3J80K 3R6SA 1W5CC 4A0XA 4G94A 2M2EA 1SFEA 1D0ZA 1PYVA 2MG4A 2BXZA 3F21A 3S8PA 2YU3A 3CMAI 2ZJQF 4U0WA 1FYMA 2HOEA 3KP7A 2TDXA 1YJWI 5FKNA 3JR9A 5ILUA 2L4AA 1MSFC 3VSLA 4OIOF 1O3SA 1XSXA 2UWMA 4KITB 2DMPA 5K7HA 4IOAF 1U9OA 2W82A 1PP8F 5KVRA 3JTHA 4IRIA 3I55I 3EUHC 5FD6A 2I8DA 1RC9A 1QQIA 3DTIA 2M3AA 2R7XA 2P81A 3WGIA 1K7AA 4CUGA 2V1UA 3HHGA 4OOIA 3WGHA 5HNHA 5ICFA 3ZOBA 5IT9K 1BW6A 4ZC3A 3Q9SA 1CQTA 1YW8A 2P5KA 2I5UA 3F8CA 4PUSA 2RVCA 1R9TJ 2NVQJ 5DD4A 4XICA 2E1MC 1Y56A 2LF7A 4CICA 5GPCA 2R7QA 3G71I 2E1MB 2A61A 1TQMA 1AKHA 3BJOA 5JFRA 3HIFA 4LG3A 3E3VA 3W2AA 1VQ9I 3IH4A 5EZGA 2W84A 2LY1A 1FMWA 4G9YA 1IDZA 5LHGA 1YX5A 2DTZA 4FX0A 4YFKF 5F0CA 2DPUA 1Z9CA 5HLTA 2MLGA 1ZLKA 3KEOA 1PVEA 1FC3A 1FBSA 3I64A 4ZYAA 1O3TA 2H6CA 2XRNA 1V3FA 4KJZA 2W7NA 2CQXA 1JKPC 2DPDA 3FXJA 1G4DA 3QWLA 2FOWA 4F93B 4Q4ZF 1POGA 2B63J 1MMAA 4KDPA 4RM3A 2Y9ZA 3GWZA 2NVYJ 4HV6A 2IGOA 5DCMA 3DPLC 3GYHX 3F8FA 5IY5H 4HF2A 5EYRA 4E7ZA 2BVLA 1X4PA 4AIHA 3J81K 2FMYA 3EQLF 4N0BA 3TOAA 4H4KC 3OR2C 5FO5A 2LKSA 2CW7A 3FF5A 2XC7A 1OR7C 2OC6A 4Y7NJ 1R49A 5BMZA 1P4XA 1HF0A 3GEZA 4I0AA 2EH3A 2STTA 4Z6YA 1GXQA 1QPIA 2QQ9A 1T0FA 1MGTA 3CCLI 2WAQA 1T39A 4L0YB 1FLIA 4BHPA 1LVAA 4UVBA 1E2XA 4W97A 3KPHA 4LGWA 3P9IA 3H0DA 3C2HA 3F23A 4JQFA 5CQGA 1JT6A 2EILH 1ORKA 2RNJA 3L2QA 1HLVA 2GLOA 5J40A 1MMNA 2YPRA 4I99C 1SD5A 4RAYA 1ENHA 2XSJC 1H8AC 2R7UA 2WV1A 2O03A 3CJQB 1GV2A 2NNYA 5BS6A 1GV5A 3WTSC 4FASD 3WE2A 5FRMA 1DPUA 3CCYA 5HS8A 3DKYA 1HXDA 2OV7A 3DXJF 3GMEA 1IV8A 3SEQA 2HDWA 1JTXA 3HSFA 5FGMA 2HR3A 2XGEA 1UELB 4EVIA 2HXOA 3DU6A 5ICEA 4O5VA 2LKPA 3GCMA 1GVDA 3I53A 4M3FA 2BXYA 4KT5C 2A69F 5JLWA 4YEJA 1AKHB 6PAXA 1JXSA 1A35A 1F9NA 2LDUA 1RR8C 3O6BB 3VYSB 3SZGA 4WXHA 4ENMA 3Q0WA 1D5YA 3HTSB 3FBNB 4ASNA 2KP6A 4RGXA 1BI3A 2STWA 4C9YA 4KIGA 5J8CA 3K2ZA 2K9NA 2VBYA 2PFBA 5DUKA 1U0JA 5IP7J 2DW4A 4EATA 3FBIB 3QP5A 2JA7J 4R8HA 4XN0A 3D5RC 2D1HA 1WHUA 1GLNA 2M5WA 1MIJA 2GXBA 4OIQF 1ONVA 5DDGA 1SFKA 3MN2A 4IQ4A 3CCEI 3VOEA 1T2KA 5DCMB 3F8NA 4DYQA 2QENA 3JTGA 3PNTA 3WTXC 1IXRC 4IRHA 1SFUA 2M30A 1OJLA 3ABTA 2MYSA 2F5VA 3HZJA 3NEUA 2RC4A 1ETWA 5CVJA 2WAFA 3DQVC 1YX3A 5DS9A 1XGNA 3JRIA 4D5FA 3GTQJ 2R7DA 3M07A 1KZHA 3PQJA 4UUTA 3U1DA 4IJAA 2DBBA 3VPRA 2HVRA 1T38A 4CCMA 3BOQA 2X85A 3G2BA 3L00A 4RGRA 5E1WA 2QSHX 3SZTA 2Q1ZB 3ZGKA 2HQ5A 4BXUA 2NS8A 2BE5F 4OINF 2VJ4A 3ZQ7A 1I27A 2GWRA 5BOXA 1XSVA 3BQYA 4CSWA 3E7LA 1USSA 2R7VA 1ETKA 2BBYA 2AQFA 2PMUA 2H27A 2XKPA 2HVQA 2M4KA 2XPWA 1T33A 3BJ6A 4ZDLA 1UB9A 2ZCWA 2JN6A 3QU6A 2CU7A 2IVMA 2JA5J 3GF2A 5AIQA 3RYPA 2R0QC 3HPGA 4LIVA 4KIFA 5C4XJ 1YS6A 2JSPA 3ONQA 2IA1A 5LGUA 4BDZA 1WPKA 1LJ9A 2DA6A 5F64A 1SAUA 3LSKA 1O7FA 1G3TA 2ELHA 3ABUA 3BPVA 1R22A 4IX7A 3LSTA 2MGQA 4L5EA 5F27A 2IPQX 3BG6A 3C2BA 3GO5A 3LSPA 2B9SA 4BYYA 3H3ZA 4ZZDA 3IAS2 1SVLA 4B4CA 1FBQA 5GAEJ 2EV5A 5LRSA 3S2DJ 5LGNA 4UY8I 1IN6A 4EJTA 1XDSA 1FIAA 2M0CA 2VQCA 3WGGA 4B09A 1GUUA 1BR1A 4HBLA 1WRJA 3FK6A 2VBZA 1YJ9I 1FT9A 3ZQLA 1W1WE 3S3OA 4ZYGA 1HOMA 3MKLA 3K9TA 3RCOA 2KDZA 4BJ6C 2JA6J 4FISA 1FEXA 2WWYA 2LY9A 2Z3YA 4NUBA 1JGSA 2R7OA 4CO8A 5L3FA 4A69C 3BROA 3CLQA 4AIKA 2L9SA 3GTJJ 1Z6RA 3LSMA 5GADJ 3L1PA 3HOWJ 3C7JA 1XSDA 3A03A 5IYDJ 3FMSA 2F5CA 3LMMA 4YIRX 3RDIA 3OYBA 1J2XA 4NC6A 2X9DA 4J00A 1W36C 2E1CA 1IO2A 3G1LA 3JRAA 3WU1B 5LFAA 2DMTA 4WCGA 2CGPA 1U5TC 3RJPA 4KT6A 1FZPB 1IV6A 1Z21A 1JTYA 3ZQQA 3TL4X 1FJLA 4ZZLA 4F91B 2R7FA 2LY2A 3O8GA 1T6SA 2KRFA 2LFBA 1MD0A 4LK0F 2NYXA 2DA3A 2DOAA 3PQKA 3AAFA 4NC8A 2O7OA 3OIQA 2KT0A 2R3SA 3DPTA 1R00A 3S16J 4AM3A 1S29A 1ZG3A 2EINH 3L7WA 3HUGB 3OOPA 3RKWA 2OQRA 3ZMSA 2BY2A 4MNUA 2IBDA 2MW8A 2XKOA 3CF5F 2HYGD 1KU9A 2E36A 1X1CA 5HODA 2DQLA 2IA2A 3LWFA 2XVCA 3FIWA 2R7RA 2QQ8A 4CZZA 5LGTA 3BTLA 2EFQA 5ERIA 4G6DA 5J4YA 1B72A 1OMIA 4HA8A 4II3A 2WC2A 4XN3A 1UHWA 1IRFA 2DU9A 3AG4H 2CG4A 4IHSA 1IJWC 1E3OC 2D2WA 1YQAA 5FKOA 4UNOA 2DMQA 1E3PA 3HRUA 3RTRA 2VJ5A 3JRGA 1K61A 5EG0A 3EYIA 3HGYA 3SXYA 4XLEA 5DEQA 5J47A 4G6QA 1AHDP 1ETXA 5E1ZB 2HNHA 2EFWA 4ESFA 5DTDA 1TWHJ 3W6VA 2K3FA 3P9CA 4RDUA 2PBIA 4G12A 1SEUA 4LITA 3M8EA 1I3QJ 3CC2I 3CMYA 3OIPA 2V6CA 1D1CA 4ZH4F 5B66C 4BUPA 2H8WA 4M3GA 2HTSA 5M5XJ 3QPSA 3DKXA 2L7ZA 1PUFB 3ZMUA 3GTGJ 1YW9A 4BE1A 1NTCA 2KKOA 1LQ1A 1MMGA 4DNCA 4DBRA 3J7YJ 2A6TA 1Z6TA 5L3GA 2JUGA 4MFDA 3K7AJ 1ZN2A 1XCBA 4FETA 5FKLA 1X4OA 1TLHB 2BW3A 2PX9A 3KP6A 3ZMDA 2IGKA 3EETA 2AXTC 4JOMA 3O3KA 3ZCOA 5AONA 2HPIA 3FX3A 3O8HA 4ESBA 5J4VA 1YHQI 2E1OA 4PFOA 1IN7A 1V55H 2HZDA 3T0YA 2ETHA 3K4MA 4L0ZB 1VZ0A 3WTYC 1KA8A 3OYLA 3T8TA 3GZNB 2D1VA 2YR2A 1J7KA 2DQRA 4HQEA 2LKXA 3ZXSA 1XB4A 1QA6A 2Q8KA 3BQZA 3K4JA 5FRNA 2FA5A 1D1AA 4HX4A 2Z1DA 3F3XA 4EV0A 2XSDC 1QVUA 2BGCA 2M0MA 4RGSA 1IUFA 4ON0A 2C6YA 2F4OB 4Y3OA 3VEPA 3KEYA 3QP6A 5E18F 1IUYA 4E7JA 4TV7A 1S6LA 2VJIA 3NAUA 5B3SH 1NK2P 1BOAA 3GZ6A 3WTTC 5K5OA 4XONA 5K7FA 2V26A 1I50J 2VE8A 4LIUA 4XKVA 4LLNA 3BR6A 1YG2A 1F1ZA 3NRVA 2CUFA 4G7OF 3HXLA 4JX4A 2LC2A 4M9SA 1RIOH 2JPBA 5E20A 3I4MJ 3HRSA 2VI6A 2IS4A 5B1BH 1SD7A 4HV5A 2R7ZJ 2M87A 1JKQC 2HTJA 1H0MA 2Y31A 3S1QJ 2F5DA 1B72B 3C2GA 1OCTC 1ZRFA 1VI0A 2HDCA 5KHDA 3A01A 1UZCA 3W2WA 1FYKA 1UHSA 2DTRA 2Q2EA 5JLXA 2HQRA 4P5OA 2JRMA 5HDNA 1XD7A 5HOOA 1JJ8C 4PFPA 4BBRJ 3K6GA 1YTYA 3KP2A 2HDDA 1J9IA 3DLLF 1ZKGA 3RPUD 1E0EA 2E7XA 4HDUA 1X58A 2NNNA 1U3EM 2NRAC 3E5UA 2RN7A 4AVZA 3H0GJ 4JX5A 1ON1A 2CQKA 4OAZA 1TTYA 1ZRDA 1P2FA 1USTA 4BH9A 1B59A 1TQIA 1KQ9A 4EM2A 5ICGA 2LK2A 2L01A 4NB5A 1DGWY 1UG0A 4W1UA 2JA8J 2ZJ2A 4UHTA 2PLYA 1SAXA 1LVKA 4D7MA 2IS2A 3CCMI 2EIKH 4P96A 3TW7A 1V4RA 3ECHA 1H89C 3F9KA 3P9KA 3LL7A 2RV8A 2BW3B 1U2WA 1HSJA 2X6XA 2E2IJ 1Z0XA 1DGRM 3K4KA 2K9QA 2L9NA 5D4RA 2HGCA 1FP2A 4Y52J 3MAJA 1A6QA 2F2EA 1BW5A 4PSWA 1WJDA 2EIMH 3V8LA 1FPQA 4J01A 2VXDA 2DMUA 3E1SA 3GW2A 1VQ7I 4BJTA 2CFOA 2L9VA 1IDYA 1PUEE 1GDTA 3SDGA 2XB0X 3V8JA 2HQAA 3IH2A 3G73A 5J6XA 3OL3A 1BC7C 3REOA 5EJCA 2HU9A 3H9QA 4E7HA 1VQKI 3G1MA 2ESHA 2G7HA 2GQQA 1FIPA 1LDJA 1YW7A 1WVRA 5F08A 4LG0A 1HCRA 3OV8A 4MQ9F 1OQYA 1G6NA 1I1GA 5LRRA 1U8BA 1FY7A 4XLCA 4KUMA 1P9QC 4BEHB 4A3EJ 3M4OJ 3HBLA 3V7RA 2ZJPF 1OCZH 2O8KA 1TT5B 3JRHA 3A2KA 2IJLA 2CO5A 3S14J 1FOXA 3BZ6A 4S0HB 4G8XA 1T98A 5KCMA 2CW0F 2JPCA 4XOPA 3TKYA 2UZKA 4A0ZA 3CCVI 1FSEA 4H0EA 5K7ZA 3GFJA 2V1NA 4UUSB 3A01B 3EYYA 2CS3A 3M7GA 4RLQA 2CWEA 5J8FA 2Q2EB 2ZKZA 2XAUA 1HW2A 5FLXK 4Q48A 3PJRA 1U6GA 2KIFA 1JKOC 4HX7A 2LMDA 4A6DA 4UXNA 3HSRA 2DFIA 2V6EA 4YELA 2KIQA 2DFEA 5BPDA 1XS9A 1IC8A 3BDDA 3VYTB 2HI3A 3JAMZ 2PG4A 3MKZA 4PZJA 2BY1A 4LJZF 4OU0A 2ZXIA 2OTLI 5KAIC 1D8KA 2MBFA 4DYRA 3G1OA 1W4MA 4E4HA 1GXPA 1QHGA 2FX0A 1WI9A 1R5ID 3MZHA 3TO7A 3BR0A 1X3ZB 3E6CC 2NS0A 4RA2A 5FJ8J 2FE3A 4AUXA 4QPOA 2P4WA 3KIOA 2FOKA 4IEJA 1RRJA 2Y75A 2EBIA 2M8EA 5JR3A 3ZP5A 1WFXA 3W6KB 2W85A 4D0PA 3MZ8A 4IOCF 3ZMTA 2H1LA 5HS9A 2DA4A 1CGPA 3HYIA 5TJJA 4ZTFA 2X6OA 5FD5A 3KYDB 2JVGA 1K4SA 1DQUA 4XRFA 1JI8A 5HVQC 4E6KG 5HDKA 1XGSA 3KX2A 2ZO4A 3C3WA 3HRTA 3CO7C 1ZYRF 2L7KA 4I01A 3DTKA 3Q3SA 2ZFUA 5DD8A 4MEYF 1W36D 1C0WA 1EA3A 2P5LC 3BG7A 2GZWA 3RPUA 1MDMA 1FTTA 2MFZA 3S15J 5H6QA 3SEZA 2NS7A 3R60A 1TWCJ 2JK3A 2DT5A 1XDUA 3FDYA 1MSEC 2VLAA 4BS9A 2X51A 3CDLA 5LD2C 4DZJA 2V9KA 2W1OA 2E5NA 3CDIA 2ZSHB 5EGOA 3CC7I 4AC0A 4CYDA 4LG0B 1NH3A 1G3YA 1NG7A 4U88A 5CYVA 4G7HF 5IOYA 2VJJA 1LB2A 1MH3A 3K4CA 2LYCA 2V79A 3ZRGA 1Z91A 2IP2A 3FZVA 4BGDA 3PFYA 1G59A 4RMNA 1BC8C 1U78A 5E8GA 3ESWB 4JX6A 4IF4A 3PSFA 5H20A 3LSIA 1T56A 1Z3XA 1ZAOA 2G9WA 2OU2A 2V7FA 5H6RA 4RLFA 3C18A 4UUVA 4IZZA 1ZRCA 3AL0C 3L09A 1QVTA 3AL0B 3AKZA 3OYKA 1MZBA 1HDPA 3J7ZI 1VQMI 1BBYA 1DU0A 3PUFA 3QYFA 2K85A 1GVJA 2QVOA 4M74A 5GAGJ 2K40A 2MC4A 1VQ6I 3E6MA 4ENNA 2QM3A 4C30A 1TWAJ 5A2QZ 2VT3A 3LA2A 3LSHA 1B6AA 2HEOA 4BHCA 1MJAA 2DA5A 4UVCA 5KK1A 4KNYA 2R7TA 2R92J 4PSXA 3S32A 1ZGAA 4QSHA 3FHZA 2E2JJ 3L9FA 1RUNA 1I6XA 2VOOA 2HFHA 2EFOA 2Y2ZA 4XNFA 1KU3A 1QZZA 3MVPA 1YFHA 1ZTRA 3ZQFA 3HJEA 1OFCX 5JVTA 4BQOA 3UR3C 2ESNA 3T5XA 2X6WA 5HLIA 2TRTA 3ROUA 1Z67A 4DQ2A 3H1CA 2CW8A 2OCEA 2LRDA 3VYRB 2DMNA 3FXOA 3OS1A 3WTVC 2LP0A 2OJED 2A6EF 2EPFA 3K1NA 1IAWA 2IRFG 3S1NJ 4IVNA 2GAUA 4Y13A 3H5NA 1TW3A 4D7NA 1R58A 3MQ0A 1RKWA 3FXKA 1KU7A 3I4NJ 1KU2A 2VKVA 2BV6A 1MDMB 1K79A 2F48A 2XF5A 1AWCA 1SC7A 2FSWA 3CJNA 2LR8A 4B3XA 3FXQA 3S1RJ 4AIDA 3HSEA 1IN8A 2FBKA 4YIIA 5F6FA 4A3BJ 1VTNC 3L2CA 3LFKA 2KRCA 3K4BA 5EGOB 1EV7A 3LQRA 3MMYB 2MLKA 2HWVA 3A02A 1AU7A 2FNPA 1DP7P 2DT7B 2XAGA 1RESA 4OIPF 2L02A 1IF1A 3DTEA 2P8TA 3RKYA 4B47A 3DPUA 3DV8A 3H3UA 1YIOA 3GFIA 2JA2A 1MBEA 3RSNA 2ZNYA 2EFPA 4U87A 3DKWA 1TT0A 5CVVA 2GM4A 3NWTA 3PNVA 2VONA 2K4JA 1LFPA 4IQJA 5EDNA 4PK4A 4BE0A 4D5CA 1D3YA 1O3RA 4PJLA 1U5TA 4B48A 1OCCH 1FOWA 2QUFA 2OCCH 4RAFA 3ISPA 3I59A 3K70C 5J3LA 4MO7A 2O0YA 1SVOA 5DV5A 4HQMA 2QLZA 4GXOA 4II2A 4E70A 1W0TA 5IT3A 3TP3A 1B8IA 1OLTA 1TQPA 2FNAA 2EJRA 3HUGA 4IPAA 4KA4A 4KICA 2H8RA 4BY1J 4ANJA 4XLPF 1JKRC 2DODA 2KHMA 1BN5A 2GIVA 1PDNC 3F6VA 4NQWA 3U1KA 1P6RA 2ZC2A 5FKMA 4A3FJ 2XF7A 3FM3A 3DFGA 4XSZF 3CD6I 2COBA 2CH0A 4LK1F 4UVAA 2L0KA 2LNBA 2DK8A 3HC7A 1N25A 5D8KB 4D1QA 2CV1A 2KIUA 2JVHA 3GFLA 3CP8A 1LEAA 2OA4A 1SMTA 3WTWC 3LNQA 1UG2A 2XUBA 4MIMA 1R5GA 3FKJA 1J59A 1SFXA 5TGTA 3CCUI 2A5WA 3E97A 5FFZA 3S3NA 1D1BA 1RKTA 1X3UA 4ZDPA 3ZN1A 4XSXF 2HYFA 1MBHA 1MH4A 3IUOA 3DBRB 5TRDA 3CESA 2A5YB 5FKKA 1KONA 3ZQHA 3BTJA 1W5TA 4PDKA 3WTUC 3N05A 1JGGA 3BY6A 4IHWA 2R7SA 3WHCA 4RBOA 3TDUC 3I4PA 5K1YA 3H9GA 1XPXA 2OQGA 3R61A 3ELKA 1R23A 1WJAA 4G6TB 3ABKH 4N4NB 4GFBA 2PJRB 1OPCA 1HW1A 2Z9OA 1HKQA 2FUG2 1DU6A 4E7LA 3OIOA 1G2HA 5HDGA 1Q1VA 4B8XA 1WJFA 1PUFA 4QWQA 2KQRA 3ERED 1N78A 2DFHA 4CCNA 2JQ7A 1TC3C 2KL4A 1VQNI 4HNUA 3I56I 4LB5A 2OAZA 2ECCA 2KFDA 2DFFA 1UCRA 2L54A 4XK4A 5E1XA 1ZG5A 4RAZA 3BR1A 3H5RA 2LBFB 2Z33A 4F92B 2O61A 1I3AA 3KE2A 3COAC 4CXFA 2R93J 4L9TA 4C2MJ 1N77A 1RUOA 3R0AA 4E7IA 1HSTA 1JUMA 3A0HC 3BLYA 1ZR4A 3DBLB 4IHXA 1U5TB 3QU3A 4ZYHA 4FCYA 4KN4X 5E8IA 2FBHA 4CCOA 1IG7A 1U8RA 4EEFG 2QSGX 2F6CA 4XKWA 3I59B 3BR3A 1QPMA 5KAFC 4IRGA 3LFUA 3CCRI 2W25A 1ETQA 3BG5A 3KLNA 3H36A 2VE9A 2DA1A 2NOGA 4G7ZF 2IGMA 4M9ZA 1ZQ3P 4C2TA 3HOXJ 1PJRA 2ZMEC 2EQRA 4DGWB 1B8IB 2KZVA 2RQQA 2ZMEB 3R0JA 2EB7A 4HSRA 2J5PA 3CO6C 2KRHA 3DF8A 1S5LC 1A31A 4HEA2 4NQWB 2VT2A 3LSRA 3KP5A 3RPQA 2QKMB 1WWXA 3K1PA 4BJ5C 2ZXHA 3KZZA 5HS7A 1MW7A 4B44A 2DYRH 2CFXA 3QOPA 4XQFA 3ZN0A 1IRXA 3ML6A 1X3WB 2H6BA 2VN2A 2G7UA 3KYCB 3LAJA 2YU9J 4GO1A 2VQLA 2G0EA 1BR4A 4RB0A 2LH9A 3M8FA 3F8MA 4NC7A 2O3FA 4MEXF 3HKZN 2WB1N 3L2VA 2HXIA 4XORA 1ZARA 3OS2A 3JSOA 1RPWA 4IHTA 1D8JA 2GOMA 3LSJA 3SHFA 2WTEA 2IS6A 4IO9F 1MJ9A 3M8JA 2DA2A 2GIZA 2MA3A 2XGXA 4BBSJ 3RZDJ 3FM5A 2RNGA 3F72A 5D5XB 1QBJA 3HOTA 1MMSA 2TCTA 2GBYA 4XRSG 2HPMA 1F4KA 5EEHA 1XMAA 3ULQB 1ODDA 3ERMA 2OZ6A 4FT8A 1YIJI 2Y69H 2EIJH 3BC8A 4A3GJ 2VXZA 3PUBA 3WG9A 4LMYA 3ZMZA 1MBKA 3LOCA 4AU7A 2ZXJA 1EKEA 3CCQI 4PJJA 1SD6A 4FTHA 1X1AA 2KDOA 4LLLA 5CVIA 3JREA 4YFXF 4L9VA 1UAAA 3CUQC 5F0FA 1W7PB 1YO5C 1P7IA 3K2AA 4LB6B 3SDBA 3KEQA 3QRFF 1HBXG 2V1XA 3DBHB 1RNLA 3HOUJ 1I1SA 1IW7F 2RGVA 4UB6C 1R1UA 1XMXA 1MNDA 4M72A 1LUJB 3DP7A 1X2MA 3BG3A 1J09A 3QPLA 4BAYA 1UHMA 4A6EA 3IHUA 1WSUA 4F7ZA 5JHUA 4BDYA 2V4JC 3F6OA 2VQGA 3JRCA 2H1KA 4K2EA 3J80Z 4MLOA 4BQAA 2HOTA 4BEHA 3EPZA 2A3SA 3OL4A 5FFXA 3V8KA 4JP0A 4XLFA 3E6BA 5FROA 2BVMA 2CQQA 5CPRB 4V2FA 3TBIA 4FE7A 3I5UA 1ETYA 1VF9A 3I58A 4PJNA 1UJ8A 4XLAA 4A93J 3WU0A 5F04A 4UUSA 1YITI 4GGGA 1WCMJ 2XIGA 1S7EA 5BNGA 2YS9A 2EFNA 4WF2A 2DT6A 1AOYA 4A3MJ 2E2HJ 5LEJA 1XGMA 1D0YA 2WY8Q 4XOTA 3TW6A 5IT9Z 3B02A 4XL9A 4DYCA 2Z16A 1JT0A 3JRFA 1V5GA 2EK5A 4F52A 3FMRA 4L9JA 2XROA 1YYVA 2YSRA 1ACIA 5D6FA 5F0HA 1RETA 3F8BA 4X0GA 1Y8RB 3F22A 2QYOA 2NVUB 2Z2SB 3ASOH 1XN7A 2VBXA 3PIOF 3NQOA 1DPRA 1YLFA 4Q5SF 1CF7A 4KIBA 3H3VK 4DBQA 1Z3YA 5ED4A 1YE9A 4Q47A 4EMSA 1IGNA 2HVSA 2H09A 2HS5A 2FD5A 4XRMA 4EM1A 2HYJA 1QU3A 3MKYB 2M7BA 2VUMJ 2P5VA 3CTAA 4EJUA 4FHTA 3HRMA 2H94A 3ZQIA 2VPRA 1S9HA 2X1DA 3TDZC 3GFMA 4EQQA 1R6RA 4RB1A 3W2VA 2DJNA 1TW2A 3KFWX 4IXAA 2BHYA 1JUSA 2O9LA 2K9MA 2PEXA 1T08B 1KYWA 3BR5A 3HTUA 4X1EA 2MC3A 2V9VA 4ENJA 3J81Z 2RQPA 2CMPA 5L3BA 3HKZA 5LHIA 4BACA 2WB1A 3NWSA 4C3IJ 1RI7A 4HRIA 2WADA 1VNDA 2EA4A 5CQEA 4CDGA 5FB2A 1L3LA 3K69A 4A3JJ 4WWCA 3OYCA 1WJCA 3K70D 4DIQA 4I6ZA 4FQGA 1MBJA 4JK1X 3HPHA 3PIPF 3IAM2 4MGRA 2O6GE 2D45A 1G3WA 1QZEA 2V9PA 3FHNA 4A12A 4HAMA 2VIXA 3IWFA 2PQ8A 5K5RA 4CHUA 3LSGA 4ZJZA 4HF1A 1EH6A 5EEGA 4HLYA 1QZYA 1H88C 1LKXA 1DP3A 3OYMA 4MQVA 2UXXA 1S7OA 3HOSA 4ABZA 1ZGWA 2DN0A 3QYEA 3IH3A 1MMDA 4RGUA 3BTIA 3GBGA 2JRTA 2IXSA 5HLHA 1F43A 1MBGA 5DM7F 5CVUA 2MSYA 2E19A 2ID6A 5CKTA 4GDFA 2DAOA 2XRLA 2FQ4A 2XHKA 4OIRF 2XAJA 5DM6F 4HDVA 2R7WA 1YRNA 2FXAA 2XASA 4JYKA 4A0YA 4U7DA 5D6EA 1FOYA 4NHJA 4EGYA 3FXUA 5F1RA 3GTPJ 1NK3P 3GTKJ 1HC8A 9ANTA 1KQ0A 2DA7A 4EJVA 3F0CA 1WKMA 5BPIA 4AYBN 2KZGA 3K1MA 4U7BA 2CYYA 1KYZA 4F55A 2ELJA 2GA2A 3GLLA 4FE4A 4HOBA 3HEFA 1R7JA 2KMUA 5FLMJ 2IAIA 4DJAA 1CF7B 1ON2A 3M3YJ 1Z1DA 1FMVA 4JBAA 3PM1A 4RS8A 1S3JA 1OISA 4CH7A 3AG3H 4Y15A 5J1UA 1STZA 3ZQGA 4PGHA 4Y33A 4XKCA 3OYFA 1F36A 4HYEA 4OWRB 1U9NA 1ZH5A 2K5CA 3K0LA 2MD5A 2VASA 1Q1HA 3WG7H 2CRGA 4M3EA 2DLLA 2Y48A 2VOPA 4S04A 2Y0SN 3C1DA 2E1NA 2JJ7A 5JI6A 2YX7A 3BTCA 3UKGA 3GTLJ 1JUPA 4BXXJ 2Z5UA 4I02A 4N9HA 1WH7A 5E3MA 2RREA 2WV0A 1MBFA 3RZOJ 2DJIA 4L5JA 2B0LA 4EJOA 1M1EB 2CV2A 1L0OC 3JRBA 1ZGJA 1MJBA 2L4MA 3MD2A 2PN6A 3OR1C 3D1NI 2EZKA 1ZG1A 2DO7A 2AHQA 3OY9A 2F5FA 5IPAA 2RKHA 1XCVA 3M1CA 1HW5A 2D5VA 2NVXJ 4A3IJ 1W5SA 2VKEA 3T1BA 1ETVA 2QZ8A 2EA2A 2HOSA 2X1CA 3S93A 3TQNA 3QYBA 4EGZA 3GVAA 1T95A 4DZPA 2E71A 4KMFA 4J19A 3VODA 1JHHA 2EV0A 2X1EA 1SVMA 1R71A 2XGDA 1LE8A 2NOJB 4MTDA 5GTHC 1K78B 1IRGA 2FBIA 3VB2A 1RZ4A 2M4GA 4E7KA 3HOVJ 3CF2A 4IHVA 2LVSA 3E5XA 2AXLA 3PO3J 4NNJA 1XGOA 2RDPA 4L18B 1IZ1A 3KP4A 4CYCB 1X19A 2CQ7A 1Z77A 1YRNB 2K3PA 1BR2A 2PJPA 3I0TA 3KCCA 2FU4A 4B1RA 1V54H 3QPHA 4QLCU 4RM2A 2QQAA 4HG2A 4CCLA 2A68F 2B7EA 2JZYA 3CUOA 4RAGA 3ABMH 5FLVA 2IGNA 2JWTA 2MH9A 4N9IA 4WX9A 2W48A 3FK7A 1IXSB 4C2UA 3KZIC 3HOZJ 3GUDA 1QHHD 4HLXA 3J7AO 3V4GA 3WE3A 3MKWB 4BQNA 4BL0B 3RI4A 3CCSI 1PP7U 1R1TA 4IL6C 5J1YA 2WY7Q 1XG1A 1GHCA 3BZKA 2XV4S 2UXNA 3N97A 1WJEA 1NHAA 2EZIA 2R4GA 3CC4I 2F5EA 2HOAA 4OMZA 2NXNB 3GTMJ 2Y9YA 2VB6A 1N75A 4P1WA 5GPAA 4V2GA 2IA0A 1W7PD 4XR6A 3LA3A 2QA4I 1X2NA 3JAMK 1J75A 3A0BC 3Q5FA 5C44J 1JE8A 4QTRA 3HB9A 3FWEA 2KIMA 1G8XA 4DW6A 2R5YA 5IYBJ 3Q0VA
chains in the Genus database with same CATH topology
1M1EB 1T08B 1LUJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1E B;  1T08 B;  1LUJ B; 
#chains in the Genus database with same CATH topology
 1G3S A;  3DWL E;  2DOE A;  2I10 A;  3LA7 A;  2L7F P;  1LFB A;  1P4A A;  2CUE A;  5LEK A;  3CJT B;  5IP9 J;  2PJR A;  2BY3 A;  1IN4 A;  1P92 A;  2ISY A;  1ZLJ A;  1Y1W J;  5DUI A;  2HKO A;  4KIS A;  4C3J J;  4BE2 A;  4AYB A;  2ZJR F;  3IP4 B;  5E3L A;  3OSF A;  2VC1 A;  3VSK A;  2K86 A;  2ZFW A;  1OYY A;  3FXL A;  4RB2 C;  1XX5 A;  5HNF A;  4HST A;  4BNC A;  1Y0N A;  1OCP A;  3JSP A;  1P4W A;  2JUC A;  2WAE A;  1LE8 B;  3DEW A;  4WXC A;  4R79 A;  3KET A;  2LBF A;  1R4M B;  2JT1 A;  4XID A;  3VWB A;  2LOO A;  2MD0 A;  4D9J A;  3OYG A;  1OYI A;  3V42 A;  2LF8 A;  3QOE A;  2ELK A;  3LAP A;  2DDB A;  2Y0S A;  3IL2 A;  1K4T A;  1O3Q A;  2K7L A;  1B4A A;  2E5Z A;  4WXD A;  5LLQ A;  2L2O A;  2P7C B;  4E7S A;  1R1V A;  1LDD A;  1OYW A;  3IC7 A;  5E3N A;  3U21 A;  2EZL A;  3T8R A;  1XMK A;  4UV9 A;  4A3C J;  1JJ6 C;  1LEB A;  4XBF A;  3L2W A;  3HL2 A;  1K6Y A;  3MZY A;  4EJW A;  2BYV E;  5IYC J;  2QCO A;  2ZNZ A;  3AG1 H;  3CJR B;  4UB8 C;  1T0F C;  2QBY A;  2ZME A;  1FWZ A;  4HNT A;  3CP2 A;  1I39 A;  3PNY A;  4PJ0 C;  5D4S A;  4L9N A;  3RIR A;  3RQI A;  1TBX A;  2UV1 A;  2CJJ A;  1NG6 A;  4EM0 B;  3BCB A;  3U2R A;  4AWX B;  2OZU A;  3P7N A;  1HKS A;  1WGX A;  5EEA A;  1WJ5 A;  3BPX A;  3D0S A;  3S2H J;  1DDN A;  2X6Y A;  3HGG A;  1ITY A;  3OMY A;  5H2F C;  1YI2 I;  1FTZ A;  3KYL A;  2FQ3 A;  2K02 A;  1HA8 A;  3H5A A;  3TMO A;  1X1P A;  5KNL A;  2ME6 A;  5D5V B;  2CV0 A;  1KGS A;  2LRE A;  2XB5 A;  4BKX A;  2NVT J;  1JHF A;  2JMW A;  4A5N A;  2O8X A;  2M34 A;  1MNE A;  4PCQ A;  1O7L A;  2XF6 A;  2FRH A;  4M71 A;  5A2Q K;  3TOB A;  2M8G X;  3U9G A;  5BQT A;  3FXR A;  3SQN A;  3RYR A;  2KLO A;  3BZC A;  2LLK A;  4GCV A;  1XC5 A;  3HM5 A;  5EZH A;  4RB3 C;  2KPM A;  3IRQ A;  3PL8 A;  2R5Y B;  1IXC A;  3IWZ A;  1FP1 D;  1YOV B;  4M6X A;  4U0V A;  3BWG A;  2LTP A;  2VBW A;  5EF6 A;  2KIS A;  3WOD F;  5IOZ A;  1Y39 A;  3W3C A;  2BHZ A;  1MNM C;  4ZYD A;  2ZSI B;  4DOZ A;  2L7M P;  3OYH A;  4Z2Y A;  2BY0 A;  2W00 A;  1ETO A;  2OPT A;  3EUK L;  3SFI A;  2HKX A;  5IP6 A;  2XAQ A;  5CVR A;  3RKX A;  3OYD A;  2X48 A;  1VQ8 I;  3TP0 A;  2AO9 A;  3I3L A;  5ILV A;  4A3D J;  3DEE A;  2K9L A;  5L3E A;  2QQB A;  3KLO A;  3G6E I;  5GP9 A;  3OWT A;  2IS1 A;  3OYN A;  2CUJ A;  4M6Y A;  1V5F A;  4XLN F;  3IV5 A;  3ABL H;  4WK8 F;  4QIW N;  1BI0 A;  3SYT A;  4IKF A;  1LFU P;  4BQQ A;  3V7S A;  3ASN H;  1W7P A;  5LBQ A;  2P0W A;  2ZBK A;  3CUQ A;  1DUX C;  2FF4 A;  1VQP I;  3I71 A;  2CQN A;  4QPQ A;  4NDL A;  5B5E C;  2L3D A;  1B1B A;  2LSO A;  3K4N A;  3L2U A;  2PMZ N;  4LLG F;  1ERD A;  4KYW A;  2F4I A;  2Z99 A;  1QRY A;  5M5W J;  5M3M J;  2BEO A;  2IT0 A;  2EV6 A;  3DEU A;  1IRZ A;  3HOY J;  1EF4 A;  3E0J B;  4I98 B;  4LFU A;  2QEX I;  2QBY B;  1OCO H;  3AFH A;  5F1J A;  3IKT A;  1BA5 A;  2AQE A;  1EH7 A;  1TZL A;  3Q0U A;  4BXF A;  4U0Y A;  2XPU A;  1TWG J;  2XPV A;  1OCR H;  3HG9 A;  5J1R A;  2GOX B;  3CZ6 A;  4I2O A;  2HZT A;  3PO2 J;  5K5Q A;  1BJZ A;  2HQN A;  2P7V B;  4M3D A;  1O57 A;  4CCK A;  3JCU C;  3HHH A;  2BZT A;  4ZYE A;  2CSO A;  1T8I A;  1TNS A;  2QKL B;  3WU2 C;  5CJ9 A;  2ACJ A;  4B43 A;  2A05 A;  2FML A;  3CQZ J;  4GRI A;  3KZY A;  4A2U A;  1TNT A;  1H9G A;  4KMU X;  2DOF A;  5D5W B;  2COM A;  1REP C;  5JHF A;  3CDH A;  2JTV A;  1APL C;  1ZRE A;  4OAY A;  3K4L A;  3TO6 A;  1IN5 A;  1QO0 D;  1BOB A;  2Y30 A;  2GXG A;  5M5Y J;  1EJ9 A;  2DYS H;  1SFO J;  2XAF A;  1EH8 A;  5C3E J;  1MKM A;  2P6S A;  1BIA A;  3J7A Y;  4CCJ A;  2ZB9 A;  1Y8Q B;  4HW0 A;  3B6C A;  2Y0M A;  2WBM A;  1I5Z A;  3BT9 A;  1ULY A;  1Z7U A;  4F3Q A;  3OOU A;  4O3M A;  4CGZ A;  1SMY F;  2ADU A;  1AA7 A;  4L5I A;  3OSG A;  3Q9V A;  1LPQ A;  2OF7 A;  4A3K J;  5TIS C;  2L9R A;  1QNT A;  2RAE A;  3ZPL A;  2QGU A;  2L5Q A;  3P5J A;  3CCJ I;  2QSF X;  3NAR A;  2E35 A;  1B9N A;  1UFM A;  2NAZ A;  3W6J B;  1BI2 A;  2JSC A;  3IKV A;  4AVP A;  4N4O B;  4BY7 J;  2R5Z A;  3DCF A;  2ME0 A;  2M1B A;  3EUA A;  4FX4 A;  3SZP A;  1B9M A;  3H35 A;  4C3H J;  5E3O A;  1SAN A;  2QWW A;  2PI0 A;  2VKH A;  2LD5 A;  3G3Z A;  1FOK A;  1VQ4 I;  3PSI A;  2DCE A;  2VL8 A;  3CUQ B;  2K27 A;  3M1E A;  3KP3 A;  2FJ1 A;  1ZR2 A;  2XGC A;  4O6J A;  4ZTJ A;  2XAH A;  3FKI J;  3N4M A;  2ICW G;  3ZMV A;  3RKQ A;  2K9S A;  1H9T A;  1HQC A;  2W4S A;  3EDP A;  1R5H A;  1VQO I;  4YG2 F;  3ECO A;  2UUZ A;  3MWM A;  1VQ5 I;  3S1M J;  3M9A A;  1D0X A;  1F5T A;  4PJM A;  4M73 A;  1HKT A;  4HPQ A;  4XRS A;  3B6A A;  3HDD A;  5FLX Z;  1V5E A;  3GLX A;  5D5U B;  3BR2 A;  2YUS A;  4GYG A;  1GT0 C;  2VOD A;  1WH5 A;  3E6D A;  3JRD A;  3I54 A;  2K4B A;  1BJA A;  4AD9 A;  3S3M A;  1R36 A;  4MHG A;  4IHY A;  3FXM A;  2MH2 A;  2W57 A;  4ETS A;  2LG4 A;  3TED A;  1TL8 A;  4YRV A;  2AS5 F;  2F4M B;  1S7A A;  3UNG C;  4ESJ A;  2CUZ A;  4I76 A;  5C4J J;  3FIS A;  4LD5 A;  1TWF J;  1ZEL A;  2MAB A;  1A36 A;  3OYE A;  5ILS A;  3O2P E;  5L3C A;  2EWN A;  1YS7 A;  1FBU A;  3R4K A;  5JVG F;  2DXI A;  1BI1 A;  5E79 C;  3VYU B;  2GXA A;  5HLG A;  3DU5 A;  1QGP A;  2YX4 A;  1HDD C;  3A1Y A;  1WI3 A;  1ZHF A;  4P55 A;  4MFE A;  5ICC A;  2W24 A;  3LQQ A;  4HX8 A;  2EZH A;  2O5R A;  4B3A A;  4BHB A;  3OS0 A;  2ZXW H;  2VQH A;  2PMH A;  2PMZ A;  1Z7L A;  3D5S C;  3VFZ A;  2FEZ A;  3S2W A;  4A3L J;  2IW5 A;  1R4N B;  4GYI A;  3VDX A;  5L3D A;  2VPL A;  4M9X A;  3BCA A;  5EG0 B;  3GTO J;  3QPT A;  1OKR A;  5LHH A;  1W0U A;  2XDV A;  3G4S I;  3I9V 2;  1Z05 A;  3MEX A;  4XKB A;  1BM9 A;  1FNN A;  3CME I;  4MTE A;  2DDA A;  3OYI A;  4X6A J;  3MCZ A;  3OYA A;  1J5Y A;  3K10 A;  5DYM A;  4PGG A;  4AIJ A;  2BOL A;  4M6V A;  4XMY A;  4HNV A;  2WA0 A;  3WTZ A;  2R5Z B;  1TP4 A;  2KJC A;  3H92 A;  1A5J A;  2GA1 A;  1VQL I;  4KFC A;  3GZ5 A;  1O4X A;  2OBP A;  2A07 F;  3RQ4 A;  1K83 J;  3EUH A;  1FYL A;  1RR7 A;  2X4H A;  4P9F A;  1LDK B;  3AG2 H;  5B1A H;  3S17 J;  4Y4R A;  1UMQ A;  2X0L A;  1J0R A;  2Q0O A;  2E34 A;  3WHB A;  3CMM A;  4XM3 A;  4S05 A;  1Y0U A;  1YJN I;  1KQ8 A;  1Y1V J;  2OTJ I;  1S8N A;  2WAQ N;  3GXO A;  2DK5 A;  3MFK A;  1SD4 A;  1BL0 A;  4Y17 A;  5M3F J;  1S72 I;  4ENK A;  2J5O A;  4HZF A;  3TGN A;  3BJA A;  3V7C A;  3ZQC A;  3IRR A;  3X2Q H;  4YIF A;  5GAH J;  2QF7 A;  2M7A A;  4I09 A;  4XLH A;  1LNW A;  4HF0 A;  1XTA A;  1I6H J;  2E7W A;  4ZDO A;  1WZ2 A;  2M9H A;  1BIB A;  3FMQ A;  3QAH A;  3SJM A;  3L2R A;  4V19 K;  3ZR8 X;  1X1B A;  2OUM A;  4UV8 A;  1D5V A;  5E17 F;  4P9U A;  3D5L A;  1FX7 A;  1K78 A;  1Y6I A;  3JW4 A;  1K6O A;  1WQ2 A;  3BG9 A;  3CLO A;  5DCF A;  2V1D A;  3A4C A;  4R1H A;  3SFZ A;  4ITV A;  2E60 A;  3OYJ A;  2IEK A;  2M45 A;  4KN7 X;  1P7J A;  4YFN F;  2ISZ A;  5GTI C;  4CYC A;  4I7H A;  5CLS A;  4NBQ A;  4LOC A;  5AIP A;  4A5M A;  3TO9 A;  2P6T A;  1WJB A;  1ZK8 A;  3QQA A;  4CZC A;  2DI3 A;  2ECB A;  3DLA A;  3QOD A;  4M3B A;  3H9J A;  3PFI A;  1X1D A;  2VC0 A;  2VKD A;  1E3H A;  2ID3 A;  2OD5 A;  4I0B A;  1E17 A;  1FSH A;  2N8G A;  3GX4 X;  3BP8 A;  4CA0 A;  1VFC A;  5D8L B;  1OR7 A;  1A04 A;  4OMY A;  3E5Q A;  2A6H F;  3B73 A;  1A6I A;  4BU2 A;  2KJB A;  3J80 K;  3R6S A;  1W5C C;  4A0X A;  4G94 A;  2M2E A;  1SFE A;  1D0Z A;  1PYV A;  2MG4 A;  2BXZ A;  3F21 A;  3S8P A;  2YU3 A;  3CMA I;  2ZJQ F;  4U0W A;  1FYM A;  2HOE A;  3KP7 A;  2TDX A;  1YJW I;  5FKN A;  3JR9 A;  5ILU A;  2L4A A;  1MSF C;  3VSL A;  4OIO F;  1O3S A;  1XSX A;  2UWM A;  4KIT B;  2DMP A;  5K7H A;  4IOA F;  1U9O A;  2W82 A;  1PP8 F;  5KVR A;  3JTH A;  4IRI A;  3I55 I;  3EUH C;  5FD6 A;  2I8D A;  1RC9 A;  1QQI A;  3DTI A;  2M3A A;  2R7X A;  2P81 A;  3WGI A;  1K7A A;  4CUG A;  2V1U A;  3HHG A;  4OOI A;  3WGH A;  5HNH A;  5ICF A;  3ZOB A;  5IT9 K;  1BW6 A;  4ZC3 A;  3Q9S A;  1CQT A;  1YW8 A;  2P5K A;  2I5U A;  3F8C A;  4PUS A;  2RVC A;  1R9T J;  2NVQ J;  5DD4 A;  4XIC A;  2E1M C;  1Y56 A;  2LF7 A;  4CIC A;  5GPC A;  2R7Q A;  3G71 I;  2E1M B;  2A61 A;  1TQM A;  1AKH A;  3BJO A;  5JFR A;  3HIF A;  4LG3 A;  3E3V A;  3W2A A;  1VQ9 I;  3IH4 A;  5EZG A;  2W84 A;  2LY1 A;  1FMW A;  4G9Y A;  1IDZ A;  5LHG A;  1YX5 A;  2DTZ A;  4FX0 A;  4YFK F;  5F0C A;  2DPU A;  1Z9C A;  5HLT A;  2MLG A;  1ZLK A;  3KEO A;  1PVE A;  1FC3 A;  1FBS A;  3I64 A;  4ZYA A;  1O3T A;  2H6C A;  2XRN A;  1V3F A;  4KJZ A;  2W7N A;  2CQX A;  1JKP C;  2DPD A;  3FXJ A;  1G4D A;  3QWL A;  2FOW A;  4F93 B;  4Q4Z F;  1POG A;  2B63 J;  1MMA A;  4KDP A;  4RM3 A;  2Y9Z A;  3GWZ A;  2NVY J;  4HV6 A;  2IGO A;  5DCM A;  3DPL C;  3GYH X;  3F8F A;  5IY5 H;  4HF2 A;  5EYR A;  4E7Z A;  2BVL A;  1X4P A;  4AIH A;  3J81 K;  2FMY A;  3EQL F;  4N0B A;  3TOA A;  4H4K C;  3OR2 C;  5FO5 A;  2LKS A;  2CW7 A;  3FF5 A;  2XC7 A;  1OR7 C;  2OC6 A;  4Y7N J;  1R49 A;  5BMZ A;  1P4X A;  1HF0 A;  3GEZ A;  4I0A A;  2EH3 A;  2STT A;  4Z6Y A;  1GXQ A;  1QPI A;  2QQ9 A;  1T0F A;  1MGT A;  3CCL I;  2WAQ A;  1T39 A;  4L0Y B;  1FLI A;  4BHP A;  1LVA A;  4UVB A;  1E2X A;  4W97 A;  3KPH A;  4LGW A;  3P9I A;  3H0D A;  3C2H A;  3F23 A;  4JQF A;  5CQG A;  1JT6 A;  2EIL H;  1ORK A;  2RNJ A;  3L2Q A;  1HLV A;  2GLO A;  5J40 A;  1MMN A;  2YPR A;  4I99 C;  1SD5 A;  4RAY A;  1ENH A;  2XSJ C;  1H8A C;  2R7U A;  2WV1 A;  2O03 A;  3CJQ B;  1GV2 A;  2NNY A;  5BS6 A;  1GV5 A;  3WTS C;  4FAS D;  3WE2 A;  5FRM A;  1DPU A;  3CCY A;  5HS8 A;  3DKY A;  1HXD A;  2OV7 A;  3DXJ F;  3GME A;  1IV8 A;  3SEQ A;  2HDW A;  1JTX A;  3HSF A;  5FGM A;  2HR3 A;  2XGE A;  1UEL B;  4EVI A;  2HXO A;  3DU6 A;  5ICE A;  4O5V A;  2LKP A;  3GCM A;  1GVD A;  3I53 A;  4M3F A;  2BXY A;  4KT5 C;  2A69 F;  5JLW A;  4YEJ A;  1AKH B;  6PAX A;  1JXS A;  1A35 A;  1F9N A;  2LDU A;  1RR8 C;  3O6B B;  3VYS B;  3SZG A;  4WXH A;  4ENM A;  3Q0W A;  1D5Y A;  3HTS B;  3FBN B;  4ASN A;  2KP6 A;  4RGX A;  1BI3 A;  2STW A;  4C9Y A;  4KIG A;  5J8C A;  3K2Z A;  2K9N A;  2VBY A;  2PFB A;  5DUK A;  1U0J A;  5IP7 J;  2DW4 A;  4EAT A;  3FBI B;  3QP5 A;  2JA7 J;  4R8H A;  4XN0 A;  3D5R C;  2D1H A;  1WHU A;  1GLN A;  2M5W A;  1MIJ A;  2GXB A;  4OIQ F;  1ONV A;  5DDG A;  1SFK A;  3MN2 A;  4IQ4 A;  3CCE I;  3VOE A;  1T2K A;  5DCM B;  3F8N A;  4DYQ A;  2QEN A;  3JTG A;  3PNT A;  3WTX C;  1IXR C;  4IRH A;  1SFU A;  2M30 A;  1OJL A;  3ABT A;  2MYS A;  2F5V A;  3HZJ A;  3NEU A;  2RC4 A;  1ETW A;  5CVJ A;  2WAF A;  3DQV C;  1YX3 A;  5DS9 A;  1XGN A;  3JRI A;  4D5F A;  3GTQ J;  2R7D A;  3M07 A;  1KZH A;  3PQJ A;  4UUT A;  3U1D A;  4IJA A;  2DBB A;  3VPR A;  2HVR A;  1T38 A;  4CCM A;  3BOQ A;  2X85 A;  3G2B A;  3L00 A;  4RGR A;  5E1W A;  2QSH X;  3SZT A;  2Q1Z B;  3ZGK A;  2HQ5 A;  4BXU A;  2NS8 A;  2BE5 F;  4OIN F;  2VJ4 A;  3ZQ7 A;  1I27 A;  2GWR A;  5BOX A;  1XSV A;  3BQY A;  4CSW A;  3E7L A;  1USS A;  2R7V A;  1ETK A;  2BBY A;  2AQF A;  2PMU A;  2H27 A;  2XKP A;  2HVQ A;  2M4K A;  2XPW A;  1T33 A;  3BJ6 A;  4ZDL A;  1UB9 A;  2ZCW A;  2JN6 A;  3QU6 A;  2CU7 A;  2IVM A;  2JA5 J;  3GF2 A;  5AIQ A;  3RYP A;  2R0Q C;  3HPG A;  4LIV A;  4KIF A;  5C4X J;  1YS6 A;  2JSP A;  3ONQ A;  2IA1 A;  5LGU A;  4BDZ A;  1WPK A;  1LJ9 A;  2DA6 A;  5F64 A;  1SAU A;  3LSK A;  1O7F A;  1G3T A;  2ELH A;  3ABU A;  3BPV A;  1R22 A;  4IX7 A;  3LST A;  2MGQ A;  4L5E A;  5F27 A;  2IPQ X;  3BG6 A;  3C2B A;  3GO5 A;  3LSP A;  2B9S A;  4BYY A;  3H3Z A;  4ZZD A;  3IAS 2;  1SVL A;  4B4C A;  1FBQ A;  5GAE J;  2EV5 A;  5LRS A;  3S2D J;  5LGN A;  4UY8 I;  1IN6 A;  4EJT A;  1XDS A;  1FIA A;  2M0C A;  2VQC A;  3WGG A;  4B09 A;  1GUU A;  1BR1 A;  4HBL A;  1WRJ A;  3FK6 A;  2VBZ A;  1YJ9 I;  1FT9 A;  3ZQL A;  1W1W E;  3S3O A;  4ZYG A;  1HOM A;  3MKL A;  3K9T A;  3RCO A;  2KDZ A;  4BJ6 C;  2JA6 J;  4FIS A;  1FEX A;  2WWY A;  2LY9 A;  2Z3Y A;  4NUB A;  1JGS A;  2R7O A;  4CO8 A;  5L3F A;  4A69 C;  3BRO A;  3CLQ A;  4AIK A;  2L9S A;  3GTJ J;  1Z6R A;  3LSM A;  5GAD J;  3L1P A;  3HOW J;  3C7J A;  1XSD A;  3A03 A;  5IYD J;  3FMS A;  2F5C A;  3LMM A;  4YIR X;  3RDI A;  3OYB A;  1J2X A;  4NC6 A;  2X9D A;  4J00 A;  1W36 C;  2E1C A;  1IO2 A;  3G1L A;  3JRA A;  3WU1 B;  5LFA A;  2DMT A;  4WCG A;  2CGP A;  1U5T C;  3RJP A;  4KT6 A;  1FZP B;  1IV6 A;  1Z21 A;  1JTY A;  3ZQQ A;  3TL4 X;  1FJL A;  4ZZL A;  4F91 B;  2R7F A;  2LY2 A;  3O8G A;  1T6S A;  2KRF A;  2LFB A;  1MD0 A;  4LK0 F;  2NYX A;  2DA3 A;  2DOA A;  3PQK A;  3AAF A;  4NC8 A;  2O7O A;  3OIQ A;  2KT0 A;  2R3S A;  3DPT A;  1R00 A;  3S16 J;  4AM3 A;  1S29 A;  1ZG3 A;  2EIN H;  3L7W A;  3HUG B;  3OOP A;  3RKW A;  2OQR A;  3ZMS A;  2BY2 A;  4MNU A;  2IBD A;  2MW8 A;  2XKO A;  3CF5 F;  2HYG D;  1KU9 A;  2E36 A;  1X1C A;  5HOD A;  2DQL A;  2IA2 A;  3LWF A;  2XVC A;  3FIW A;  2R7R A;  2QQ8 A;  4CZZ A;  5LGT A;  3BTL A;  2EFQ A;  5ERI A;  4G6D A;  5J4Y A;  1B72 A;  1OMI A;  4HA8 A;  4II3 A;  2WC2 A;  4XN3 A;  1UHW A;  1IRF A;  2DU9 A;  3AG4 H;  2CG4 A;  4IHS A;  1IJW C;  1E3O C;  2D2W A;  1YQA A;  5FKO A;  4UNO A;  2DMQ A;  1E3P A;  3HRU A;  3RTR A;  2VJ5 A;  3JRG A;  1K61 A;  5EG0 A;  3EYI A;  3HGY A;  3SXY A;  4XLE A;  5DEQ A;  5J47 A;  4G6Q A;  1AHD P;  1ETX A;  5E1Z B;  2HNH A;  2EFW A;  4ESF A;  5DTD A;  1TWH J;  3W6V A;  2K3F A;  3P9C A;  4RDU A;  2PBI A;  4G12 A;  1SEU A;  4LIT A;  3M8E A;  1I3Q J;  3CC2 I;  3CMY A;  3OIP A;  2V6C A;  1D1C A;  4ZH4 F;  5B66 C;  4BUP A;  2H8W A;  4M3G A;  2HTS A;  5M5X J;  3QPS A;  3DKX A;  2L7Z A;  1PUF B;  3ZMU A;  3GTG J;  1YW9 A;  4BE1 A;  1NTC A;  2KKO A;  1LQ1 A;  1MMG A;  4DNC A;  4DBR A;  3J7Y J;  2A6T A;  1Z6T A;  5L3G A;  2JUG A;  4MFD A;  3K7A J;  1ZN2 A;  1XCB A;  4FET A;  5FKL A;  1X4O A;  1TLH B;  2BW3 A;  2PX9 A;  3KP6 A;  3ZMD A;  2IGK A;  3EET A;  2AXT C;  4JOM A;  3O3K A;  3ZCO A;  5AON A;  2HPI A;  3FX3 A;  3O8H A;  4ESB A;  5J4V A;  1YHQ I;  2E1O A;  4PFO A;  1IN7 A;  1V55 H;  2HZD A;  3T0Y A;  2ETH A;  3K4M A;  4L0Z B;  1VZ0 A;  3WTY C;  1KA8 A;  3OYL A;  3T8T A;  3GZN B;  2D1V A;  2YR2 A;  1J7K A;  2DQR A;  4HQE A;  2LKX A;  3ZXS A;  1XB4 A;  1QA6 A;  2Q8K A;  3BQZ A;  3K4J A;  5FRN A;  2FA5 A;  1D1A A;  4HX4 A;  2Z1D A;  3F3X A;  4EV0 A;  2XSD C;  1QVU A;  2BGC A;  2M0M A;  4RGS A;  1IUF A;  4ON0 A;  2C6Y A;  2F4O B;  4Y3O A;  3VEP A;  3KEY A;  3QP6 A;  5E18 F;  1IUY A;  4E7J A;  4TV7 A;  1S6L A;  2VJI A;  3NAU A;  5B3S H;  1NK2 P;  1BOA A;  3GZ6 A;  3WTT C;  5K5O A;  4XON A;  5K7F A;  2V26 A;  1I50 J;  2VE8 A;  4LIU A;  4XKV A;  4LLN A;  3BR6 A;  1YG2 A;  1F1Z A;  3NRV A;  2CUF A;  4G7O F;  3HXL A;  4JX4 A;  2LC2 A;  4M9S A;  1RIO H;  2JPB A;  5E20 A;  3I4M J;  3HRS A;  2VI6 A;  2IS4 A;  5B1B H;  1SD7 A;  4HV5 A;  2R7Z J;  2M87 A;  1JKQ C;  2HTJ A;  1H0M A;  2Y31 A;  3S1Q J;  2F5D A;  1B72 B;  3C2G A;  1OCT C;  1ZRF A;  1VI0 A;  2HDC A;  5KHD A;  3A01 A;  1UZC A;  3W2W A;  1FYK A;  1UHS A;  2DTR A;  2Q2E A;  5JLX A;  2HQR A;  4P5O A;  2JRM A;  5HDN A;  1XD7 A;  5HOO A;  1JJ8 C;  4PFP A;  4BBR J;  3K6G A;  1YTY A;  3KP2 A;  2HDD A;  1J9I A;  3DLL F;  1ZKG A;  3RPU D;  1E0E A;  2E7X A;  4HDU A;  1X58 A;  2NNN A;  1U3E M;  2NRA C;  3E5U A;  2RN7 A;  4AVZ A;  3H0G J;  4JX5 A;  1ON1 A;  2CQK A;  4OAZ A;  1TTY A;  1ZRD A;  1P2F A;  1UST A;  4BH9 A;  1B59 A;  1TQI A;  1KQ9 A;  4EM2 A;  5ICG A;  2LK2 A;  2L01 A;  4NB5 A;  1DGW Y;  1UG0 A;  4W1U A;  2JA8 J;  2ZJ2 A;  4UHT A;  2PLY A;  1SAX A;  1LVK A;  4D7M A;  2IS2 A;  3CCM I;  2EIK H;  4P96 A;  3TW7 A;  1V4R A;  3ECH A;  1H89 C;  3F9K A;  3P9K A;  3LL7 A;  2RV8 A;  2BW3 B;  1U2W A;  1HSJ A;  2X6X A;  2E2I J;  1Z0X A;  1DGR M;  3K4K A;  2K9Q A;  2L9N A;  5D4R A;  2HGC A;  1FP2 A;  4Y52 J;  3MAJ A;  1A6Q A;  2F2E A;  1BW5 A;  4PSW A;  1WJD A;  2EIM H;  3V8L A;  1FPQ A;  4J01 A;  2VXD A;  2DMU A;  3E1S A;  3GW2 A;  1VQ7 I;  4BJT A;  2CFO A;  2L9V A;  1IDY A;  1PUE E;  1GDT A;  3SDG A;  2XB0 X;  3V8J A;  2HQA A;  3IH2 A;  3G73 A;  5J6X A;  3OL3 A;  1BC7 C;  3REO A;  5EJC A;  2HU9 A;  3H9Q A;  4E7H A;  1VQK I;  3G1M A;  2ESH A;  2G7H A;  2GQQ A;  1FIP A;  1LDJ A;  1YW7 A;  1WVR A;  5F08 A;  4LG0 A;  1HCR A;  3OV8 A;  4MQ9 F;  1OQY A;  1G6N A;  1I1G A;  5LRR A;  1U8B A;  1FY7 A;  4XLC A;  4KUM A;  1P9Q C;  4BEH B;  4A3E J;  3M4O J;  3HBL A;  3V7R A;  2ZJP F;  1OCZ H;  2O8K A;  1TT5 B;  3JRH A;  3A2K A;  2IJL A;  2CO5 A;  3S14 J;  1FOX A;  3BZ6 A;  4S0H B;  4G8X A;  1T98 A;  5KCM A;  2CW0 F;  2JPC A;  4XOP A;  3TKY A;  2UZK A;  4A0Z A;  3CCV I;  1FSE A;  4H0E A;  5K7Z A;  3GFJ A;  2V1N A;  4UUS B;  3A01 B;  3EYY A;  2CS3 A;  3M7G A;  4RLQ A;  2CWE A;  5J8F A;  2Q2E B;  2ZKZ A;  2XAU A;  1HW2 A;  5FLX K;  4Q48 A;  3PJR A;  1U6G A;  2KIF A;  1JKO C;  4HX7 A;  2LMD A;  4A6D A;  4UXN A;  3HSR A;  2DFI A;  2V6E A;  4YEL A;  2KIQ A;  2DFE A;  5BPD A;  1XS9 A;  1IC8 A;  3BDD A;  3VYT B;  2HI3 A;  3JAM Z;  2PG4 A;  3MKZ A;  4PZJ A;  2BY1 A;  4LJZ F;  4OU0 A;  2ZXI A;  2OTL I;  5KAI C;  1D8K A;  2MBF A;  4DYR A;  3G1O A;  1W4M A;  4E4H A;  1GXP A;  1QHG A;  2FX0 A;  1WI9 A;  1R5I D;  3MZH A;  3TO7 A;  3BR0 A;  1X3Z B;  3E6C C;  2NS0 A;  4RA2 A;  5FJ8 J;  2FE3 A;  4AUX A;  4QPO A;  2P4W A;  3KIO A;  2FOK A;  4IEJ A;  1RRJ A;  2Y75 A;  2EBI A;  2M8E A;  5JR3 A;  3ZP5 A;  1WFX A;  3W6K B;  2W85 A;  4D0P A;  3MZ8 A;  4IOC F;  3ZMT A;  2H1L A;  5HS9 A;  2DA4 A;  1CGP A;  3HYI A;  5TJJ A;  4ZTF A;  2X6O A;  5FD5 A;  3KYD B;  2JVG A;  1K4S A;  1DQU A;  4XRF A;  1JI8 A;  5HVQ C;  4E6K G;  5HDK A;  1XGS A;  3KX2 A;  2ZO4 A;  3C3W A;  3HRT A;  3CO7 C;  1ZYR F;  2L7K A;  4I01 A;  3DTK A;  3Q3S A;  2ZFU A;  5DD8 A;  4MEY F;  1W36 D;  1C0W A;  1EA3 A;  2P5L C;  3BG7 A;  2GZW A;  3RPU A;  1MDM A;  1FTT A;  2MFZ A;  3S15 J;  5H6Q A;  3SEZ A;  2NS7 A;  3R60 A;  1TWC J;  2JK3 A;  2DT5 A;  1XDU A;  3FDY A;  1MSE C;  2VLA A;  4BS9 A;  2X51 A;  3CDL A;  5LD2 C;  4DZJ A;  2V9K A;  2W1O A;  2E5N A;  3CDI A;  2ZSH B;  5EGO A;  3CC7 I;  4AC0 A;  4CYD A;  4LG0 B;  1NH3 A;  1G3Y A;  1NG7 A;  4U88 A;  5CYV A;  4G7H F;  5IOY A;  2VJJ A;  1LB2 A;  1MH3 A;  3K4C A;  2LYC A;  2V79 A;  3ZRG A;  1Z91 A;  2IP2 A;  3FZV A;  4BGD A;  3PFY A;  1G59 A;  4RMN A;  1BC8 C;  1U78 A;  5E8G A;  3ESW B;  4JX6 A;  4IF4 A;  3PSF A;  5H20 A;  3LSI A;  1T56 A;  1Z3X A;  1ZAO A;  2G9W A;  2OU2 A;  2V7F A;  5H6R A;  4RLF A;  3C18 A;  4UUV A;  4IZZ A;  1ZRC A;  3AL0 C;  3L09 A;  1QVT A;  3AL0 B;  3AKZ A;  3OYK A;  1MZB A;  1HDP A;  3J7Z I;  1VQM I;  1BBY A;  1DU0 A;  3PUF A;  3QYF A;  2K85 A;  1GVJ A;  2QVO A;  4M74 A;  5GAG J;  2K40 A;  2MC4 A;  1VQ6 I;  3E6M A;  4ENN A;  2QM3 A;  4C30 A;  1TWA J;  5A2Q Z;  2VT3 A;  3LA2 A;  3LSH A;  1B6A A;  2HEO A;  4BHC A;  1MJA A;  2DA5 A;  4UVC A;  5KK1 A;  4KNY A;  2R7T A;  2R92 J;  4PSX A;  3S32 A;  1ZGA A;  4QSH A;  3FHZ A;  2E2J J;  3L9F A;  1RUN A;  1I6X A;  2VOO A;  2HFH A;  2EFO A;  2Y2Z A;  4XNF A;  1KU3 A;  1QZZ A;  3MVP A;  1YFH A;  1ZTR A;  3ZQF A;  3HJE A;  1OFC X;  5JVT A;  4BQO A;  3UR3 C;  2ESN A;  3T5X A;  2X6W A;  5HLI A;  2TRT A;  3ROU A;  1Z67 A;  4DQ2 A;  3H1C A;  2CW8 A;  2OCE A;  2LRD A;  3VYR B;  2DMN A;  3FXO A;  3OS1 A;  3WTV C;  2LP0 A;  2OJE D;  2A6E F;  2EPF A;  3K1N A;  1IAW A;  2IRF G;  3S1N J;  4IVN A;  2GAU A;  4Y13 A;  3H5N A;  1TW3 A;  4D7N A;  1R58 A;  3MQ0 A;  1RKW A;  3FXK A;  1KU7 A;  3I4N J;  1KU2 A;  2VKV A;  2BV6 A;  1MDM B;  1K79 A;  2F48 A;  2XF5 A;  1AWC A;  1SC7 A;  2FSW A;  3CJN A;  2LR8 A;  4B3X A;  3FXQ A;  3S1R J;  4AID A;  3HSE A;  1IN8 A;  2FBK A;  4YII A;  5F6F A;  4A3B J;  1VTN C;  3L2C A;  3LFK A;  2KRC A;  3K4B A;  5EGO B;  1EV7 A;  3LQR A;  3MMY B;  2MLK A;  2HWV A;  3A02 A;  1AU7 A;  2FNP A;  1DP7 P;  2DT7 B;  2XAG A;  1RES A;  4OIP F;  2L02 A;  1IF1 A;  3DTE A;  2P8T A;  3RKY A;  4B47 A;  3DPU A;  3DV8 A;  3H3U A;  1YIO A;  3GFI A;  2JA2 A;  1MBE A;  3RSN A;  2ZNY A;  2EFP A;  4U87 A;  3DKW A;  1TT0 A;  5CVV A;  2GM4 A;  3NWT A;  3PNV A;  2VON A;  2K4J A;  1LFP A;  4IQJ A;  5EDN A;  4PK4 A;  4BE0 A;  4D5C A;  1D3Y A;  1O3R A;  4PJL A;  1U5T A;  4B48 A;  1OCC H;  1FOW A;  2QUF A;  2OCC H;  4RAF A;  3ISP A;  3I59 A;  3K70 C;  5J3L A;  4MO7 A;  2O0Y A;  1SVO A;  5DV5 A;  4HQM A;  2QLZ A;  4GXO A;  4II2 A;  4E70 A;  1W0T A;  5IT3 A;  3TP3 A;  1B8I A;  1OLT A;  1TQP A;  2FNA A;  2EJR A;  3HUG A;  4IPA A;  4KA4 A;  4KIC A;  2H8R A;  4BY1 J;  4ANJ A;  4XLP F;  1JKR C;  2DOD A;  2KHM A;  1BN5 A;  2GIV A;  1PDN C;  3F6V A;  4NQW A;  3U1K A;  1P6R A;  2ZC2 A;  5FKM A;  4A3F J;  2XF7 A;  3FM3 A;  3DFG A;  4XSZ F;  3CD6 I;  2COB A;  2CH0 A;  4LK1 F;  4UVA A;  2L0K A;  2LNB A;  2DK8 A;  3HC7 A;  1N25 A;  5D8K B;  4D1Q A;  2CV1 A;  2KIU A;  2JVH A;  3GFL A;  3CP8 A;  1LEA A;  2OA4 A;  1SMT A;  3WTW C;  3LNQ A;  1UG2 A;  2XUB A;  4MIM A;  1R5G A;  3FKJ A;  1J59 A;  1SFX A;  5TGT A;  3CCU I;  2A5W A;  3E97 A;  5FFZ A;  3S3N A;  1D1B A;  1RKT A;  1X3U A;  4ZDP A;  3ZN1 A;  4XSX F;  2HYF A;  1MBH A;  1MH4 A;  3IUO A;  3DBR B;  5TRD A;  3CES A;  2A5Y B;  5FKK A;  1KON A;  3ZQH A;  3BTJ A;  1W5T A;  4PDK A;  3WTU C;  3N05 A;  1JGG A;  3BY6 A;  4IHW A;  2R7S A;  3WHC A;  4RBO A;  3TDU C;  3I4P A;  5K1Y A;  3H9G A;  1XPX A;  2OQG A;  3R61 A;  3ELK A;  1R23 A;  1WJA A;  4G6T B;  3ABK H;  4N4N B;  4GFB A;  2PJR B;  1OPC A;  1HW1 A;  2Z9O A;  1HKQ A;  2FUG 2;  1DU6 A;  4E7L A;  3OIO A;  1G2H A;  5HDG A;  1Q1V A;  4B8X A;  1WJF A;  1PUF A;  4QWQ A;  2KQR A;  3ERE D;  1N78 A;  2DFH A;  4CCN A;  2JQ7 A;  1TC3 C;  2KL4 A;  1VQN I;  4HNU A;  3I56 I;  4LB5 A;  2OAZ A;  2ECC A;  2KFD A;  2DFF A;  1UCR A;  2L54 A;  4XK4 A;  5E1X A;  1ZG5 A;  4RAZ A;  3BR1 A;  3H5R A;  2LBF B;  2Z33 A;  4F92 B;  2O61 A;  1I3A A;  3KE2 A;  3COA C;  4CXF A;  2R93 J;  4L9T A;  4C2M J;  1N77 A;  1RUO A;  3R0A A;  4E7I A;  1HST A;  1JUM A;  3A0H C;  3BLY A;  1ZR4 A;  3DBL B;  4IHX A;  1U5T B;  3QU3 A;  4ZYH A;  4FCY A;  4KN4 X;  5E8I A;  2FBH A;  4CCO A;  1IG7 A;  1U8R A;  4EEF G;  2QSG X;  2F6C A;  4XKW A;  3I59 B;  3BR3 A;  1QPM A;  5KAF C;  4IRG A;  3LFU A;  3CCR I;  2W25 A;  1ETQ A;  3BG5 A;  3KLN A;  3H36 A;  2VE9 A;  2DA1 A;  2NOG A;  4G7Z F;  2IGM A;  4M9Z A;  1ZQ3 P;  4C2T A;  3HOX J;  1PJR A;  2ZME C;  2EQR A;  4DGW B;  1B8I B;  2KZV A;  2RQQ A;  2ZME B;  3R0J A;  2EB7 A;  4HSR A;  2J5P A;  3CO6 C;  2KRH A;  3DF8 A;  1S5L C;  1A31 A;  4HEA 2;  4NQW B;  2VT2 A;  3LSR A;  3KP5 A;  3RPQ A;  2QKM B;  1WWX A;  3K1P A;  4BJ5 C;  2ZXH A;  3KZZ A;  5HS7 A;  1MW7 A;  4B44 A;  2DYR H;  2CFX A;  3QOP A;  4XQF A;  3ZN0 A;  1IRX A;  3ML6 A;  1X3W B;  2H6B A;  2VN2 A;  2G7U A;  3KYC B;  3LAJ A;  2YU9 J;  4GO1 A;  2VQL A;  2G0E A;  1BR4 A;  4RB0 A;  2LH9 A;  3M8F A;  3F8M A;  4NC7 A;  2O3F A;  4MEX F;  3HKZ N;  2WB1 N;  3L2V A;  2HXI A;  4XOR A;  1ZAR A;  3OS2 A;  3JSO A;  1RPW A;  4IHT A;  1D8J A;  2GOM A;  3LSJ A;  3SHF A;  2WTE A;  2IS6 A;  4IO9 F;  1MJ9 A;  3M8J A;  2DA2 A;  2GIZ A;  2MA3 A;  2XGX A;  4BBS J;  3RZD J;  3FM5 A;  2RNG A;  3F72 A;  5D5X B;  1QBJ A;  3HOT A;  1MMS A;  2TCT A;  2GBY A;  4XRS G;  2HPM A;  1F4K A;  5EEH A;  1XMA A;  3ULQ B;  1ODD A;  3ERM A;  2OZ6 A;  4FT8 A;  1YIJ I;  2Y69 H;  2EIJ H;  3BC8 A;  4A3G J;  2VXZ A;  3PUB A;  3WG9 A;  4LMY A;  3ZMZ A;  1MBK A;  3LOC A;  4AU7 A;  2ZXJ A;  1EKE A;  3CCQ I;  4PJJ A;  1SD6 A;  4FTH A;  1X1A A;  2KDO A;  4LLL A;  5CVI A;  3JRE A;  4YFX F;  4L9V A;  1UAA A;  3CUQ C;  5F0F A;  1W7P B;  1YO5 C;  1P7I A;  3K2A A;  4LB6 B;  3SDB A;  3KEQ A;  3QRF F;  1HBX G;  2V1X A;  3DBH B;  1RNL A;  3HOU J;  1I1S A;  1IW7 F;  2RGV A;  4UB6 C;  1R1U A;  1XMX A;  1MND A;  4M72 A;  1LUJ B;  3DP7 A;  1X2M A;  3BG3 A;  1J09 A;  3QPL A;  4BAY A;  1UHM A;  4A6E A;  3IHU A;  1WSU A;  4F7Z A;  5JHU A;  4BDY A;  2V4J C;  3F6O A;  2VQG A;  3JRC A;  2H1K A;  4K2E A;  3J80 Z;  4MLO A;  4BQA A;  2HOT A;  4BEH A;  3EPZ A;  2A3S A;  3OL4 A;  5FFX A;  3V8K A;  4JP0 A;  4XLF A;  3E6B A;  5FRO A;  2BVM A;  2CQQ A;  5CPR B;  4V2F A;  3TBI A;  4FE7 A;  3I5U A;  1ETY A;  1VF9 A;  3I58 A;  4PJN A;  1UJ8 A;  4XLA A;  4A93 J;  3WU0 A;  5F04 A;  4UUS A;  1YIT I;  4GGG A;  1WCM J;  2XIG A;  1S7E A;  5BNG A;  2YS9 A;  2EFN A;  4WF2 A;  2DT6 A;  1AOY A;  4A3M J;  2E2H J;  5LEJ A;  1XGM A;  1D0Y A;  2WY8 Q;  4XOT A;  3TW6 A;  5IT9 Z;  3B02 A;  4XL9 A;  4DYC A;  2Z16 A;  1JT0 A;  3JRF A;  1V5G A;  2EK5 A;  4F52 A;  3FMR A;  4L9J A;  2XRO A;  1YYV A;  2YSR A;  1ACI A;  5D6F A;  5F0H A;  1RET A;  3F8B A;  4X0G A;  1Y8R B;  3F22 A;  2QYO A;  2NVU B;  2Z2S B;  3ASO H;  1XN7 A;  2VBX A;  3PIO F;  3NQO A;  1DPR A;  1YLF A;  4Q5S F;  1CF7 A;  4KIB A;  3H3V K;  4DBQ A;  1Z3Y A;  5ED4 A;  1YE9 A;  4Q47 A;  4EMS A;  1IGN A;  2HVS A;  2H09 A;  2HS5 A;  2FD5 A;  4XRM A;  4EM1 A;  2HYJ A;  1QU3 A;  3MKY B;  2M7B A;  2VUM J;  2P5V A;  3CTA A;  4EJU A;  4FHT A;  3HRM A;  2H94 A;  3ZQI A;  2VPR A;  1S9H A;  2X1D A;  3TDZ C;  3GFM A;  4EQQ A;  1R6R A;  4RB1 A;  3W2V A;  2DJN A;  1TW2 A;  3KFW X;  4IXA A;  2BHY A;  1JUS A;  2O9L A;  2K9M A;  2PEX A;  1T08 B;  1KYW A;  3BR5 A;  3HTU A;  4X1E A;  2MC3 A;  2V9V A;  4ENJ A;  3J81 Z;  2RQP A;  2CMP A;  5L3B A;  3HKZ A;  5LHI A;  4BAC A;  2WB1 A;  3NWS A;  4C3I J;  1RI7 A;  4HRI A;  2WAD A;  1VND A;  2EA4 A;  5CQE A;  4CDG A;  5FB2 A;  1L3L A;  3K69 A;  4A3J J;  4WWC A;  3OYC A;  1WJC A;  3K70 D;  4DIQ A;  4I6Z A;  4FQG A;  1MBJ A;  4JK1 X;  3HPH A;  3PIP F;  3IAM 2;  4MGR A;  2O6G E;  2D45 A;  1G3W A;  1QZE A;  2V9P A;  3FHN A;  4A12 A;  4HAM A;  2VIX A;  3IWF A;  2PQ8 A;  5K5R A;  4CHU A;  3LSG A;  4ZJZ A;  4HF1 A;  1EH6 A;  5EEG A;  4HLY A;  1QZY A;  1H88 C;  1LKX A;  1DP3 A;  3OYM A;  4MQV A;  2UXX A;  1S7O A;  3HOS A;  4ABZ A;  1ZGW A;  2DN0 A;  3QYE A;  3IH3 A;  1MMD A;  4RGU A;  3BTI A;  3GBG A;  2JRT A;  2IXS A;  5HLH A;  1F43 A;  1MBG A;  5DM7 F;  5CVU A;  2MSY A;  2E19 A;  2ID6 A;  5CKT A;  4GDF A;  2DAO A;  2XRL A;  2FQ4 A;  2XHK A;  4OIR F;  2XAJ A;  5DM6 F;  4HDV A;  2R7W A;  1YRN A;  2FXA A;  2XAS A;  4JYK A;  4A0Y A;  4U7D A;  5D6E A;  1FOY A;  4NHJ A;  4EGY A;  3FXU A;  5F1R A;  3GTP J;  1NK3 P;  3GTK J;  1HC8 A;  9ANT A;  1KQ0 A;  2DA7 A;  4EJV A;  3F0C A;  1WKM A;  5BPI A;  4AYB N;  2KZG A;  3K1M A;  4U7B A;  2CYY A;  1KYZ A;  4F55 A;  2ELJ A;  2GA2 A;  3GLL A;  4FE4 A;  4HOB A;  3HEF A;  1R7J A;  2KMU A;  5FLM J;  2IAI A;  4DJA A;  1CF7 B;  1ON2 A;  3M3Y J;  1Z1D A;  1FMV A;  4JBA A;  3PM1 A;  4RS8 A;  1S3J A;  1OIS A;  4CH7 A;  3AG3 H;  4Y15 A;  5J1U A;  1STZ A;  3ZQG A;  4PGH A;  4Y33 A;  4XKC A;  3OYF A;  1F36 A;  4HYE A;  4OWR B;  1U9N A;  1ZH5 A;  2K5C A;  3K0L A;  2MD5 A;  2VAS A;  1Q1H A;  3WG7 H;  2CRG A;  4M3E A;  2DLL A;  2Y48 A;  2VOP A;  4S04 A;  2Y0S N;  3C1D A;  2E1N A;  2JJ7 A;  5JI6 A;  2YX7 A;  3BTC A;  3UKG A;  3GTL J;  1JUP A;  4BXX J;  2Z5U A;  4I02 A;  4N9H A;  1WH7 A;  5E3M A;  2RRE A;  2WV0 A;  1MBF A;  3RZO J;  2DJI A;  4L5J A;  2B0L A;  4EJO A;  1M1E B;  2CV2 A;  1L0O C;  3JRB A;  1ZGJ A;  1MJB A;  2L4M A;  3MD2 A;  2PN6 A;  3OR1 C;  3D1N I;  2EZK A;  1ZG1 A;  2DO7 A;  2AHQ A;  3OY9 A;  2F5F A;  5IPA A;  2RKH A;  1XCV A;  3M1C A;  1HW5 A;  2D5V A;  2NVX J;  4A3I J;  1W5S A;  2VKE A;  3T1B A;  1ETV A;  2QZ8 A;  2EA2 A;  2HOS A;  2X1C A;  3S93 A;  3TQN A;  3QYB A;  4EGZ A;  3GVA A;  1T95 A;  4DZP A;  2E71 A;  4KMF A;  4J19 A;  3VOD A;  1JHH A;  2EV0 A;  2X1E A;  1SVM A;  1R71 A;  2XGD A;  1LE8 A;  2NOJ B;  4MTD A;  5GTH C;  1K78 B;  1IRG A;  2FBI A;  3VB2 A;  1RZ4 A;  2M4G A;  4E7K A;  3HOV J;  3CF2 A;  4IHV A;  2LVS A;  3E5X A;  2AXL A;  3PO3 J;  4NNJ A;  1XGO A;  2RDP A;  4L18 B;  1IZ1 A;  3KP4 A;  4CYC B;  1X19 A;  2CQ7 A;  1Z77 A;  1YRN B;  2K3P A;  1BR2 A;  2PJP A;  3I0T A;  3KCC A;  2FU4 A;  4B1R A;  1V54 H;  3QPH A;  4QLC U;  4RM2 A;  2QQA A;  4HG2 A;  4CCL A;  2A68 F;  2B7E A;  2JZY A;  3CUO A;  4RAG A;  3ABM H;  5FLV A;  2IGN A;  2JWT A;  2MH9 A;  4N9I A;  4WX9 A;  2W48 A;  3FK7 A;  1IXS B;  4C2U A;  3KZI C;  3HOZ J;  3GUD A;  1QHH D;  4HLX A;  3J7A O;  3V4G A;  3WE3 A;  3MKW B;  4BQN A;  4BL0 B;  3RI4 A;  3CCS I;  1PP7 U;  1R1T A;  4IL6 C;  5J1Y A;  2WY7 Q;  1XG1 A;  1GHC A;  3BZK A;  2XV4 S;  2UXN A;  3N97 A;  1WJE A;  1NHA A;  2EZI A;  2R4G A;  3CC4 I;  2F5E A;  2HOA A;  4OMZ A;  2NXN B;  3GTM J;  2Y9Y A;  2VB6 A;  1N75 A;  4P1W A;  5GPA A;  4V2G A;  2IA0 A;  1W7P D;  4XR6 A;  3LA3 A;  2QA4 I;  1X2N A;  3JAM K;  1J75 A;  3A0B C;  3Q5F A;  5C44 J;  1JE8 A;  4QTR A;  3HB9 A;  3FWE A;  2KIM A;  1G8X A;  4DW6 A;  2R5Y A;  5IYB J;  3Q0V A; 
#chains in the Genus database with same CATH homology
 1M1E B;  1T08 B;  1LUJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...