4PGHA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
354
structure length
354
Chain Sequence
AAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
total genus 101
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pghA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pghA02
2QRVB 3BPXA 5HOOA 1B42A 4MHGA 2YXLA 4EQQA 1O3TA 2OKCA 2H09A 1PP8F 1O3SA 3I4PA 3M6UA 1YF3A 2DBBA 2A68F 3G73A 3FTEA 5LEJA 4I2OA 1IAWA 2MA3A 1KPHA 4XUEA 2QVOA 1AOYA 1GXQA 3C6MA 3I71A 1OYIA 4LK1F 4OMYA 4DA4A 2NP7A 3HVJA 1K78B 3TO6A 1WSUA 3KEQA 3VSEA 4RTPA 4U0WA 3IKVA 4V0QA 2FSWA 3FUXA 3GRRA 2CMGA 2PLYA 5F2NA 3C7JA 2F5FA 3QP6A 1ZREA 2ELHA 2IBTA 4L9VA 3UJ9A 2MC3A 2EFPA 3R24A 1B59A 2KW5A 1ZG3A 1XXLA 4O29A 1UIRA 3BGIA 2YU3A 3GIWA 3VODA 4M6YA 4LG0A 2H1RA 3ELDA 2EWNA 2A6EF 4LLGF 3TLJA 3LGAA 1XGOA 1VP9A 4OQDA 2XYRA 2O07A 4KWCA 3EMDA 3B89A 1FOKA 3SMQA 1BI2A 3GX4X 1JHHA 1D8JA 1YQAA 3SZPA 3GZ5A 2CL5A 4IV0A 1NBIA 2W25A 2E1CA 1EG2A 1W5SA 2OZUA 2UXNA 3R6SA 4P96A 2FHPA 1CGPA 1ZYRF 3G2MA 4HTFB 4EGZA 2HFHA 5K0LA 5P8WA 2RC4A 4V0RA 1IY9A 1TTYA 3AY0A 2IIPA 1ORHA 4ZTBA 3R60A 1ZGAA 5K03A 3FMQA 1P1CA 1LDKB 2G9WA 3CUOA 3R0AA 3NDIA 3ML6A 3KP3A 2F5DA 4X1OA 2DPDA 3FPEA 1P91A 2NXJA 3F8CA 1RZ4A 3MQ2A 4FGZA 5CCBA 3T5XA 5FFXA 1UFKA 2NXNA 5EEGA 1KPGA 4LFUA 5C0OE 3C3YA 3JWIA 1NW5A 5D4SA 2ZIFA 3R0QA 2K02A 2FBHA 2LF8A 3UJCA 3L00A 3KR9A 3LDGA 3RDIA 4RGSA 3DR5A 1FP2A 5BW4A 2ZBQA 2C6YA 4M37A 5GP1A 5E8RA 5LBQA 3OE4A 3BZBA 4HV5A 2B25A 4RSRA 2GA1A 2KIFA 4M9SA 2V79A 3UJBA 5EKUA 5LQKA 1NW6A 3BPVA 3KQVA 4FP9A 2JZYA 3E6BA 3TM5A 3PQJA 2AN3A 3KQPA 2D1HA 3V7RA 5DWQA 4AIKA 5IT9K 2NYUA 2PMHA 4CXFA 4CKCA 2P40A 2EV0A 2P5LC 3HRSA 3E05A 3PFHA 2NNNA 2JSCA 1JSXA 4EJWA 3DEUA 3SHFA 2AOUB 2HWKA 1W7PD 3O4FA 3EMBA 4GEKA 3DFGA 1EJ6A 4ZYGA 1RI7A 4KIGA 5CVRA 2PVCA 2BZGA 3T8TA 3MCTA 1I27A 5DX1A 4RAZA 2O0LA 4FT4A 4KRGA 1RI5A 4G9YA 2HDCA 4H0EA 4ASNA 3WGGA 5K0BA 3J81K 1Z3CA 3VFZA 3GFIA 1QBJA 2IPQX 3A4TA 3EGVA 2YPRA 1FLIA 1NW3A 2PX8A 4OA5A 5B1SA 1QZZA 1RI1A 3EVCA 4KIBA 1XSDA 3EVFA 5FLXZ 4HGYA 2HV9A 1R36A 4G7ZF 5CVIA 1FSHA 2ISZA 3AXSA 4O3MA 3RKXA 3V7CA 1FZPB 4WVLA 3I54A 1YS7A 4P55A 3DP7A 3EGIA 5HOQA 2HTSA 3DXYA 1BOAA 2PT9A 2IH2A 2IVMA 2WV0A 2A3SA 1FNNA 2GWRA 4IHTA 5E17F 1Z7UA 1BC7C 3I9FA 1DUXC 5GIPE 4EV0A 4F86A 2EFWA 5CIYA 2I9KA 4AX8A 2WWYA 3ZMZA 5HDKA 1XDUA 4L0ZB 2HQRA 4I09A 3NRVA 4UV8A 3A7DA 3L7WA 5LHGA 1IN5A 4YFXF 3ME5A 2JPCA 5K01A 3HSRA 4B8XA 2FE3A 3F4KA 4PINA 2E7WA 4BHBA 3BROA 3CKKA 2NP6A 4ENKA 3THRA 4X41A 5DEQA 2EFQA 4OX9Y 1J59A 1BOOA 3HTXA 1KR5A 1XGSA 2PMUA 2FCAA 3LQRA 1XGNA 4A2UA 5MHTA 3R6TA 4G6DA 3WTXC 4GOMD 4GQBA 2XYVA 1R22A 2BV6A 2K4JA 5IH3A 3TGNA 3T0YA 3BKWA 4CO8A 2VDVE 4GC5A 2DW4A 2B9EA 2P8TA 1G38A 4LMYA 3ABUA 3IHUA 3FUWA 4RGXA 5FB2A 1QPMA 3E8SA 4RVFA 4C07A 1ZHFA 1IN8A 4BY9E 3RI4A 4UHTA 3QOPA 2D2WA 3EUHA 5AONA 4CXMA 3THSA 1E17A 3KEOA 4PONA 2XVCA 1S8NA 4GXOA 2PX4A 4HX8A 2IA0A 3HM2A 1KQ9A 3JAMK 1JR4A 1RJEA 1IRGA 2BH2A 3SM3A 5DM1A 4L7VA 1YW8A 2IJLA 1SD7A 3DTNA 3UJ7A 4EGYA 2P3LA 1QZYA 3ELKA 1MZBA 3TO7A 1XCBA 1FYLA 3REOA 1LEAA 4DQ2A 1LQ1A 5CLSA 2QQAA 2UWMA 5D4RA 2HNKA 3KPUA 1Z6TA 2FU4A 3GEZA 3KP2A 3KHKA 2F2EA 5HDNA 5K5QA 2FYTA 4MWZA 5TRDA 2YXEA 3C1DA 3G2PA 2GIVA 2OZVA 1ZH5A 4M71A 5BPIA 3G3ZA 2VOOA 4JBAA 3DUWA 2FRXA 3EVDA 5HZMA 3L2CA 1IUYA 1BC5A 1U5TA 3QU6A 3WE3A 3D5LA 2QQ9A 3K1PA 3LQQA 2G71A 1DCTA 3ECHA 2PX5A 1YLFA 4P9UA 5HFJA 1M6EX 4LB5A 1L3IA 5DD4A 1AQIA 5LGTA 5ERIA 5DX8A 4R1HA 4YIIA 4B09A 4A0YA 2FNPA 5D5VB 5EC8A 4LG0B 3VC1A 4E32A 5FCDA 2AOWA 2OY0A 1PRYA 1HSJA 2H6BA 2A07F 1BN5A 3DH0A 2FRHA 1J5YA 3GRVA 4NHJA 2G7HA 4GOOD 1R23A 1B9NA 1MKMA 1SD4A 3ANXA 2CQKA 5CM2Z 2NAZA 4HX4A 2ZVJA 4A5NA 5K0FA 1YFJA 2V9VA 1UFMA 2PT6A 4PYIA 3TKYA 1G3WA 5H20A 1YFLA 3N97A 1RNLA 3GRZA 1F5TA 2C7RA 5LLQA 4P7KA 3BUSA 5FFZA 4E2ZA 3G2QA 2PKWA 1WY7A 1UHWA 5FQNA 5HLGA 5F2KA 1TNTA 1WQ2A 3HA5A 4QLCU 3E3VA 1D8KA 2Z6AA 3M1EA 4FT8A 4BP3A 3M6WA 2D45A 2BGCA 2WA1A 2ESHA 3EVGA 1V39A 1A04A 2M5WA 2RV8A 3QOXA 1HSTA 2MLKA 5A2QK 2OQRA 2EA2A 1HQCA 1U78A 1F4KA 1VP3A 5ILUA 3LDUA 5DM2A 4E2XA 4AZTA 5KK1A 4BXUA 2J5PA 3VB2A 1XD7A 2YR2A 4RB2C 5DUIA 1O3QA 2FOKA 2PLWA 5KQRA 5DSTA 1VIDA 2UZ4A 4GBED 1PJZA 1F9NA 4IRGA 5DSXA 1N2XA 3ZPLA 4RTQA 1UCRA 4CKBA 1EJ0A 4ISCA 4I0AA 5FA8A 4L9TA 2YQZA 4DCMA 3SXYA 3KQSA 1CF7B 1ZGJA 4FSDA 2WK1A 4GGGA 4ZZLA 3GNLA 4P7FA 1K6OA 2WTEA 2XKOA 4HYEA 1H9TA 1X1AA 2P41A 3KZZA 3P97A 4PZJA 5L3FA 4U0YA 4Y30A 3TDZC 4PIPA 3GCZA 3X0DA 1L3CA 2GZWA 3SFZA 1S3JA 4F84A 1XCJA 2XHKA 5T6BA 3ZN0A 4UNOA 2OXTA 3AJDA 2PFBA 4A0ZA 3G8AA 4RAYA 4XCXA 2XUBA 2HGCA 4MTEA 5LHHA 1BJAA 1SFXA 3KU1A 1YIOA 1V4RA 1M0EA 4N0BA 3KETA 3RKWA 4EKGA 5D8LB 4ESFA 3P2KA 1P92A 4M73A 3ZMSA 2ZZMA 1ON2A 3OU2A 4IKPA 3UJAA 1MJBA 2BM8A 4LLLA 4LECA 2ADUA 2OAZA 4U7DA 2RDPA 4GF5A 4IRIA 5EHGA 5HDGA 3ZMTA 4O5VA 2LNBA 1TW2A 3RIRA 1TBXA 2P5VA 3BGVA 1J9IA 1KU7A 2VBWA 4KMUX 3C3PA 1AF7A 5H6QA 4AZSA 2VXZA 4KN4X 2IBSA 4RV9A 5DT2A 2MD5A 1FBNA 2LDUA 4EJOA 3RYPA 5HEKA 4F7ZA 2EFJA 3I59A 2OD5A 2ERCA 4H0NA 4P58A 3KE2A 1FJXA 4CTKA 3H3ZA 5JR3A 4QDKA 2Y48A 2H6CA 3C0KA 2CFXA 5CYVA 4YUYA 5ICEA 5GM1A 1NBHA 4AUKA 3MFKA 3TPZA 2K4BA 4L9JA 5KVAA 3RIEA 3OU7A 4HH4A 3MZHA 2EFOA 5LRSA 2RQPA 3W6JB 3BZ6A 1VL5A 1Z9CA 4FX0A 3ABTA 3EYYA 5C1IA 5K05A 1D5VA 1G8AA 2VZ9A 1EV7A 4I01A 2PWYA 5FHQA 4RB0A 3E6DA 2NS0A 5G02A 4XLPF 2YX4A 4ENNA 2FA5A 1L1EA 2AZTA 3OZSA 3ELYA 1SAXA 1YTYA 4MGRA 3HVKA 3IRRA 1P4WA 2DO7A 1SUIA 3ERED 2FK8A 5E9JA 3DQVC 5EEHA 3B3FA 2P6SA 4N9IA 1XMAA 1ORIA 7MHTA 3WODF 4IWNA 3M70A 4AZVA 2ACJA 4ZYEA 3E6MA 1JG2A 2V1XA 1O57A 4Q47A 3HOTA 2M30A 2ZW9A 3W6KB 3J80Z 4PYOA 4C4AA 2DT5A 3WE2A 4G8XA 4CICA 3FXRA 3LAPA 4PCAA 2ZNYA 1KA8A 4ENMA 3SSMA 1MJ9A 1JG4A 4LWPA 3R61A 1S6LA 3FRHA 1EH6A 3I64A 5E8GA 3E23A 4Y2HA 3F6OA 1QNTA 3I53A 4Z2YA 3U9GA 2GH1A 1ZRFA 2HKOA 3MZYA 3E97A 1SFUA 1LVAA 4KN7X 1VLMA 4YUXA 4ER5A 4M9XA 3M7GA 2P7IA 3HCCA 2O57A 3CO6C 1I1NA 5CVUA 3VOEA 4KMFA 3OFJA 3SXJA 2ONYA 3HTUA 4KUMA 4NECA 4MEXF 2L54A 4C04A 5JHUA 4JK1X 1HKSA 5J8FA 5DV5A 4HRAA 4EMSA 3FZGA 2Z6QA 3P2IA 3FZVA 2ZSUA 4RYLA 3NMUF 3OOPA 2M45A 3P8ZA 4DCGA 3Q87B 1QQIA 3QOWA 3NVKI 1ONVA 5EMKA 1LNWA 1QAQA 5LGNA 4LGWA 1ZLKA 1AV6A 2IW5A 1TQIA 5CUQA 4QDJA 3R9XB 2WA2A 2DQRA 4HV6A 3CVOA 4QPNA 2UYHA 1SD5A 3CLOA 2JT1A 3JWGA 1DP7P 1NW8A 3FPHA 1STZA 4CYDA 3KPWA 1MHTA 4MTLA 3HUGA 2PV0A 1YW9A 2EJTA 1W5TA 3ZQ7A 1MDMA 4Q48A 2C7PA 5LQUA 1JQDA 4BYYA 3ER9A 5LQJA 3QPTA 4L9NA 5KVRA 2PXAA 3TRKA 2B3TA 5CJ9A 3G2OA 1NV9A 2DTRA 5H6RA 1JG3A 3H92A 3DMGA 2HS5A 1NV8A 4FR0A 2IH4A 2VT3A 2X4HA 2ZBPA 3C3WA 2ZXJA 3KPVA 4Y15A 2N47A 3HSFA 2FK7A 1MGTA 2M8EA 2F5EA 1U2ZA 5AIQA 2LD4A 3QPHA 4LG1A 4MHTA 4OOIA 2HYFA 3MQ0A 1G6Q1 1SMYF 3JSOA 4KIFA 4UOEA 3QAHA 1OYYA 1W4MA 5LQAA 2XASA 5EZSA 3L9FA 3B3GA 3TOSA 3BWYA 3WTWC 5K0JA 2STWA 1GXPA 2VONA 2PI0A 4Q5SF 1WS6A 1WI9A 4X63A 2C7OA 1T2KA 2FMYA 1IN7A 5BS6A 2VE9A 1ZAOA 4XSZF 1X3UA 5CVVA 3O3KA 5IT3A 1GVJA 1DL5A 3CC8A 4BHPA 2MBFA 2CGPA 4YG2F 4YIFA 4Y13A 3LA7A 2Y1WA 3LL7A 1Y8CA 2HR1A 3IEIA 1SMTA 4KFCA 1I9GA 3TKAA 3CUQC 2PY6A 3HCFA 5DTQA 5HS8A 3WU1B 2QYOA 3BJOA 2RNJA 3QP5A 5C9ZA 4EM0B 1WWXA 3CCFA 3GRUA 2OBPA 2IDJA 2GA2A 1R1TA 1SVUA 3D2LA 3EVBA 3RJPA 3GWZA 4JQFA 4ZZDA 5EMMA 2VODA 1G4DA 4X60A 2B78A 4WK8F 4NB5A 1O9HA 3EYIA 2GLUA 2Z5UA 4C08A 3C18A 4PCQA 2ZNZA 3HRMA 2VT2A 3PFGA 5E1ZB 1IN4A 5E1WA 2GXGA 4OU0A 3MTIA 4HQEA 3SSOA 1KU2A 5FGMA 4CKEA 1U2WA 1QYRA 2RN7A 3DULA 1WZNA 3DOUA 3RODA 1USTA 2L02A 1H1DA 4G7OF 3S2WA 1OKRA 3MB5A 5FULA 1MJFA 1XMKA 5CD1A 5F1RA 5FA5A 4ESBA 4LK0F 1FT9A 1XB4A 4RGUA 5E2BA 3T7SA 2NYXA 3VYWA 4ER0A 4I02A 4FZVA 1FSEA 5F64A 2XAGA 3LPMA 3GGDA 2BYVE 4F85A 3KZYA 2ZFWA 2IP2A 2UXXA 5HLIA 3BKXA 1SG9A 3N4MA 4RTRA 4BLVA 4OMZA 4Q4ZF 3M9AA 1Q0TA 4IF4A 2NNWB 3F23A 2O06A 4P7JA 3FM5A 3KQMA 1AWCA 1P4XA 2V1UA 3HHHA 3KR1A 2P35A 2A5YB 4WXCA 2EFNA 4HW0A 5BQTA 2RVCA 1INLA 2Z33A 5AIPA 2XVMA 3SQNA 1KPIA 2YTZA 4FT2A 3ULQB 1W7PB 2HQNA 2ZMEB 4CTJA 3GW2A 1R58A 2P7VB 3SSNA 2PBFA 4U88A 2PSSA 1UWVA 4U7TB 2XBMA 4ER3A 1BI3A 1XVAA 1VQ1A 3F8BA 3KP6A 3V7SA 5L3EA 3L09A 1KHHA 5LQNA 2PJDA 3LX6A 3FUVA 1IF1A 4E30A 2K4MA 4S05A 2FF4A 2G1PA 5FWAA 2Z6UA 1YZHA 2IH5A 3BWGA 5IT9Z 3T7RA 3NWBA 4MQ4A 1TPYA 1HW1A 1ZN2A 4HDUA 2R3SA 3E5UA 4PCLA 4BP1A 2G7UA 3LAJA 3ELWA 3GDHA 1OR8A 1NT2A 4QTTB 3TO9A 5ERGB 3F3XA 4RVGA 1V3FA 2M1BA 10MHA 2DK8A 3AWIA 4HBLA 4ER6A 1REPC 4R05A 2IGTA 2FQ3A 1XSVA 3KQOA 3G8BA 3A25A 3J81Z 3LA3A 1OMIA 4CGZA 4KVZA 5E9WA 2NNYA 2GPYA 5D1NA 4HC4A 2OU2A 3FPJA 3KLNA 1B4AA 2E7XA 4RVHA 3HCEA 3A7EA 2BBYA 5DXJA 3CJQA 5KQSA 1YUBA 5K0GA 2V1DA 4E70A 3O31A 1P1BA 1U6GA 3MCZA 2QUFA 2AOXA 5T64A 4PNEA 1K78A 1RJDA 1D2HA 4HX7A 4LB6B 2AR0A 5JI6A 1EH7A 4AIJA 3LDFA 4EM2A 5DCMA 3FMSA 1E2XA 1KU9A 4OIPF 4YMGA 2R6ZA 4PYMA 2QBYA 4U0VA 1WKMA 1SKMA 1R8YA 2FPOA 3HRTA 3EEYA 1QGPA 5E8IA 4RB1A 2RGVA 1G6NA 3KFWX 3H2BA 4RTJA 5K0EA 1LDDA 1JTEA 2H00A 2H11A 3CBGA 3FWEA 1XN7A 2ZBKA 3GYHX 1D2CA 2MLGA 2YX1A 5DTRA 4ZYDA 2ZWAA 4ZH4F 5FQOA 3V8KA 1R6AA 4HAMA 1DPUA 3F8MA 1L0OC 2YVLA 1IM8A 3IYLW 2ZO4A 1DUSA 1LB2A 4RTOA 4WF2A 3JWHA 2IA2A 2QQBA 4RGRA 1RJGA 5EVJA 4HTFA 2HTJA 5GWXA 3MWMA 3MERA 4M6XA 5L3GA 3BY6A 4ER7A 1I1SA 2QLZA 3B02A 3HNRA 3ZP5A 3G88A 4QTUB 3G89A 4PYNA 1QANA 5K0NA 1YS6A 1R5GA 3B5IA 4KA4A 3P7NA 3ER8A 2COMA 2Z99A 1QAOA 2HMYB 3I0TA 2JH9A 2OB1A 1R18A 5EIWA 4OINF 2O3FA 3O6BB 5JVTA 1D3YA 2AN4A 1I4WA 3PX3A 3HHGA 1R1VA 5EPEA 3HVHA 4C05A 2RKHA 1RUOA 4YV2A 3JAMZ 2EV6A 3CJTA 1C0WA 4RS8A 4QQNA 3MEXA 4KNYA 3PTAA 4WWCA 5KYGA 4ETSA 5F2OA 1T43A 1YW7A 1PDNC 4ATNA 2X0LA 2Z3YA 4HLXA 1BIAA 2CYYA 4XUDA 3OFKA 3BWBA 1JGSA 3B7PA 3WGIA 1X1DA 2OBFA 4OBWA 4LD5A 1T98A 1DDNA 2VOPA 4UXNA 3HCAA 5BXYA 2CWEA 2BEOA 2GAFA 2CKDA 2HOEA 4DMGA 2W85A 2P3QA 3M6XA 3HIFA 2HKXA 3FX3A 3DXZA 3OZRA 3IWZA 3HYIA 5D6FA 3GXOA 4PYJA 2CWWA 1XTPA 3TOAA 3SVZA 1SQGA 2DU9A 1IXCA 1HKQA 1S29A 2E5WA 3U1DA 3DPTA 5T67A 1FWZA 2BR4A 4GOND 3NWEA 4E31A 2CO5A 4BLUA 2O61A 5D5XB 1RUNA 5ED4A 1MJAA 4R6WA 2EX4A 3V8JA 4HF0A 4L5JA 4EJVA 1VTNC 4KT5C 1G60A 1XGMA 3GO5A 3LWFA 2F8LA 2NXCA 5M5BA 2R7FA 3F6VA 2Q2EA 3LBFA 2JRTA 1R74A 3KQQA 3OU6A 5EZQA 1X19A 2PGXA 4WXDA 2YSRA 3M8FA 5DD8A 3EVAA 1HKTA 3DXXA 2ZBRA 3FTCA 5DXAA 2FNAA 1JE8A 3DKWA 2EK5A 2D1VA 4A5MA 3D0SA 3ZMUA 1Q0SA 5BOXA 4DNCA 3GLXA 3WG9A 2HEOA 4E2WA 3QRFF 3UZUA 2DULA 4KDPA 4L0YB 4UVCA 4I0BA 1FYMA 1JG1A 1J0RA 4I98B 4RX1A 1IXKA 3FTDA 3EGEA 3P9NA 3QV2A 4RB3C 2IRFG 2P1DA 3U2RA 4HF1A 5U4XA 3UWPA 4M38A 2L4AA 5A2QZ 4YUZA 5DRTA 4YFNF 2IFTA 1ZRDA 4EJUA 2ZZKA 3FYDA 2PEXA 4BH9A 1HMYA 2QM3A 2IDKA 3JW4A 1NW7A 2YR0A 3K1NA 4A0XA 5E9QA 3DLCA 3FUUA 3CUQA 1F1ZA 2GB4A 2QZ8A 2OZ6A 5DM0A 5TJJA 2Y1XA 2FBKA 3BXOA 5EMLA 3HOSA 1O9GA 2DAOA 3IL2A 2OA4A 5LSAA 4E2YA 2E1NA 2EB7A 1WXWA 2DFIA 3TDUC 4RTKA 1FBSA 1IN6A 2AOTA 3QU3A 2JHAA 5FADA 3CTAA 2C7QA 2DLLA 3CO7C 2ZULA 5LHIA 4C03A 4A6EA 1TW3A 5CCXA 3JSPA 1ODDA 3E7PA 1R5HA 1FX7A 1IXRC 2XV4S 3OPNA 3KKZA 2ZWVA 3ZN1A 1O54A 3NQOA 4NQWA 1B9MA 4BNCA 3PB3A 2M87A 2DQLA 2GS9A 2GQQA 3F8NA 5E20A 2JJQA 2PXXA 3PFIA 4HDVA 2XVAA 4HSGA 1IRFA 4EJTA 3WTTC 2L3DA 1Z6RA 3U81A 5DX0A 1VE3A 4TV7A 2PG4A 1PP7U 1JQEA 2UZKA 4BHCA 4DZRA 4S04A 5GIOE 1O7LA 2F5CA 1M6YA 4IJAA 3F22A 3OE5A 3P9KA 5E1BA 3SZTA 1KIAA 4EK9A 4PYKA 5GM2A 3WTVC 1N7IA 1L3LA 3NTVA 2AOVA 3UJDA 3GRYA 1ZG5A 2L01A 5E1MA 5FUBA 5H02A 3TR6A 1Z05A 3UJ6A 1U3EM 3LSTA 2YX7A 4KYWA 4YV1A 4XUCA 3PS9A 3GUDA 2EV5A 1LDJA 2LSOA 3FRIA 5EOVA 3TFWA 4HLYA 5CVDA 1K79A 4IRHA 2V7EA 3TM4A 1IZ1A 5K5RA 1WG8A 5EGSA 1G8SA 2FBIA 1U5TB 3HSEA 3AXTA 3CGGA 3ECOA 3FUTA 3V97A 3DV8A 5DRYA 4CWAA 4R6XA 3HEMA 5DCMB 3MTEA 2VP3A 1WRJA 1UB9A 5L3DA 4HA8A 5DDGA 2LKPA 4WCGA 2QBYB 2EJRA 4UUVA 1T0FA 2AS5F 1XCLA 4EM1A 5DLYA 3BP8A 2ESNA 3FYCA 3WTSC 4P7GA 5ICGA 3FMRA 4RTSA 3JWJA 2HWVA 2VC1A 1P39A 2CG4A 2B2CA 5EIFA 2DPUA 3M8EA 3WTUC 1ZARA 1RI2A 3BDDA 4GYIA 4GOLD 3CJRA 5K0CA 5FLXK 3FPFA 1JQ3A 1K7AA 5LR6A 5E18F 5EHIA 2OPBA 2AVDA 3KPYA 4GYGA 5GINE 3K2ZA 4LJZF 5HVQC 2WC2A 3WSTA 1YYVA 2W24A 4QWQA 4MQ9F 2Y75A 2KJBA 3H3UA 3DLIA 3E5QA 2IPXA 2FEZA 2AS0A 5ILVA 3BJ6A 3ISPA 3NDJA 3P2EA 4XBFA 5J6XA 1U8RA 1FBQA 2VBXA 2XAFA 1UHMA 1MD0A 4MTDA 5HLHA 3HTSB 2STTA 2I6GA 4K6MA 2KIMA 3KLOA 3ZMDA 1L3BA 2ONZA 4UVBA 3EVEA 2JG3A 2ZKZA 5DM4A 2VDWA 3TQNA 3WU0A 4M36A 3PVCA 2QWWA 1Y0UA 3F8FA 4RWZA 1BC8C 1KU3A 2ZIGA 4EKIA 1D2GA 2P4WA 1RI4A 2XIGA 3K69A 3NEUA 2ZTHA 4K2EA 3I58A 5E8JA 3FF5A 1O7FA 2CMHA 1IW7F 3I5UA 2Q8KA 3L8DA 3KR2A 5LRRA 1YFHA 4POOA 1DPRA 2ZCWA 1HW2A 5JUWA 3LCUA 1BI0A 1T38A 1FYKA 2R7DA 3GU3A 8MHTA 4O6JA 4RVDA 1VPTA 4PDKA 1CF7A 3T8RA 2J5OA 3RW9A 2P7CB 1I1GA 2GA9A 9MHTA 1OYWA 3GF2A 2P7HA 2XKPA 3V8LA 2OQGA 3K0LA 4IXAA 1P6RA 2BE5F 2XGXA 2ADMA 4YV0A 3F72A 2P6TA 2I7CA 1T39A 5F6FA 1J7KA 2ZLBA 1Z1DA 1X1CA 2JHPA 3T1BA 2H94A 4M7RA 4R8SA 4D0PA 4PIMA 1TQPA 1XJ5A 4DQ0A 3RYRA 4BQAA 2MH2A 2HZTA 3UFBA 3K1MA 5HS7A 3WTZA 3HCBA 4G56A 2AN5A 5HILA 1R00A 4N9HA 2O8XA 3EDPA 2ZJ2A 5E1DA 2XRNA 3VC2A 1R8XA 3ID6C 1KP9A 4CDGA 4YFKF 1SUSA 1ZKDA 4BLWA 1R1UA 3LA2A 1XCVA 2EJUA 3LFKA 3I59B 4L5IA 1USSA 4M9ZA 1G3YA 1XDSA 4IPAA 5BP7A 3AAFA 4G6QA 3R0JA 3UBTA 1B1BA 1EIZA 2VN2A 3IV6A 4C06A 4YMHA 4G7HF 4GO1A 3Q9VA 2XAJA 1ULYA 2GXBA 4CZZA 5BW5A 5DCFA 1HW5A 5FO5A 2A69F 5IKMA 1FPQA 1BHJA 1Q1HA 4JXJA 4WX9A 4OQEA 4YUWA 4P5OA 1BI1A 4XSXF 2ORED 4QPPA 3ELUA 3EVZA 1O3RA 3NJRA 2VBYA 5HIJA 2IT0A 3O2PE 1JTFA 5BMZA 3PLAE 3TMAA 3FPGA 2PBIA 3CUQB 4BAYA 3BWCA 4ENJA 3WGHA 5D1HA 1IXSB 2DPMA 5FD6A 4AD9A 1QAMA 5EQJB 2ETHA 2ZFUA 3K0BA 2K86A 3A27A 2Y0MA 2K27A 3RTRA 4DM3A 3E5XA 2AOTB 5GOZA 2YUIA 3K9TA 3IC7A 4AVPA 2A14A 2CW0F 4R79A 4OIRF 4HG2A 1X1BA 1YZ3A 1QO0D 3HCDA 1P2FA 5E1XA 5K1YA 3DMFA 3LBYA 3EQLF 4HQMA 3KR0A 3O7WA 4U7PB 5FD5A 4PWYA 2Q41A 3CJNA 2EA4A 2QRVA 4ZYHA 3HRUA 3S68A 2BM9A 2B0LA 3V4GA 1BM9A 1ZG1A 3HA7A 3Q7EA 2CSOA 3COAC 4XRFA 1LEBA 3MGGA 1BKYA 5L3CA 1OR7A 5D6EA 2K7LA 1KQ8A 5HIMA 1EQAA 4ON0A 4MNUA 1SFEA 3KCCA 1F3LA 3T7TA 4FX4A 3MHTA 2VE8A 3GVAA 4LWOA 3R3HA 4EQZA 4IHSA 2PWPA 4OIOF 3OCJA 2HYGD 1J2XA 2P3OA 1KGSA 1RIOH 1L9KA 1F38A 4E33A 3RKYA 4AIHA 3KP7A 3M33A 1R7JA 2ESRA 3ORHA 4HOBA 3GFLA 3DPLC 4QVGA 2NRAC 5ICCA 1S7AA 1J75A 4AWXB 5K09A 2IA1A 1S7OA 4KDCA 3IWFA 1SD6A 1N7JA 3WTYC 3VEPA 3ROUA 4XLNF 2VS1A 3DF8A 4HGZA 3LCCA 2ZZNA 3HVIA 2BR3A 5CVEA 5D8KB 2O0YA 4ESJA 3GFMA 5D5UB 3P9CA 4B17A 5HIIA 2XAHA 3DMHA 3KQYA 2PX2A 3RPUA 1HNNA 3T0IA 1HBXG 1RI3A 3M6VA 1BBYA 2KKOA 3GZ6A 1MDMB 4GCVA 3SR4A 4PYLA 4MEYF 2VC0A 5EKXA 4HZFA 4FS8A 2G70A 2YXDA 5HIKA 6PAXA 4Y17A 4FSXA 3V8VA 2QY6A 4PGHA 2ZIEA 3EPPA 2LF7A 4CHUA 2KRFA 3BJAA 3MAJA 3R4KA 2KIUA 1XDZA 2P8JA 2G72A 3Q5FA 1GHCA 3JTGA 5LQRA 2L4MA 3ERCA 5KS2A 3SX0A 5ICFA 4G94A 3BWMA 4U7BA 4DKJA 4OIQF 2QE6A 3G5TA 1OPCA 2V6CA 2MH9A 3BT7A 3ZMVA 1FC3A 2XAQA 1P4AA 2PJPA 3BOQA 1ON1A 2UYQA 4M74A 2V74B 1Z91A 2PXCA 1WXXA 4HF2A 1PUEE 1TQMA 5FTWA 1NHAA 1RJFA 1YB2A 4LLNA 3C6KA 2A61A 3UA4A 2P5KA 4L18B 5E2AA 2DK5A 1LJ9A 3CDHA 2XROA 2JH8A 3KP5A 3EEOA 5DPMA 3P71T 4KW7A 3RPQA 3FHZA 3UA3A 3PQKA 1ZRCA 2XYQA 4MIKA 4RTNA 3GJYA 2AOUA 1KYZA 4RTLA 5DUKA 3IHTA 3MAGA 4GUAA 5K8VA 5JFRA 1TLHB 3J80K 5HS9A 3HP7A 1XSXA 2O6GE 2UYOA 1FBUA 5J8CA 2TDXA 2BR5A 1EAMA 2AVNA 1ZLJA 3G5LA 2W57A 2O03A 1NE2A 5EMJA 5K5OA 3HA3A 1EH8A 1I6XA 3NVMB 3PX2A 2OO3A 4OA8A 2VBZA 3KP4A 4PGGA 1JXSA 3KQTA 3G7UA 2O05A 2JPBA 3B3JA 2HR3A 3NW9A 4QVKA 4PYQA 4KICA 2H27A 2GAUA 4IVNA 1G55A 5FHRA 5FWDA 4YUVA 4RTMA 4I7HA 2KJCA 2AXLA 5DYMA 3GO4A 4X61A 4UV9A 4EVIA 5E1OA 5L3BA 2JTVA 3FTFA 4OBXA 3IRQA 5EG5A 1HXDA 3LKZA 3Q9SA 2FXAA 2FMLA 4WXHA 3LCVB 3OV8A 3E6CC 3A26A 2G8NA 2PQ8A 3FXUA 5DTMA 3PT9A 1T6SA 2ISYA 3GFJA 2NXEA 4R8RA 1U5TC 1YG2A 3KPJA 1B6AA 3DXJF 3P9IA 5BPDA 3FM3A 1SQFA 2QENA 3FXQA 4P9FA 3LKDA 4AZWA 5D5WB 1H0MA 1W7PA 4MQVA 2JHCA 4A6DA 2OB2A 2OYRA 3LECA 2DI3A 2ZMEA 2UYCA 3F21A 4DF3A 1G3TA 1KQ0A 1NKVA 1AQJA 2VDUE 2Q0OA 1I5ZA 2Z9OA 4UVAA 4M72A 1JSZA 1YO5C 3J7AO 3TOBA 5CVJA 3IKTA 1FP1D 1JHFA 3EETA 5ILSA 3M4XA 1KYWA 3OZTA 4QQKA 1ZQ9A 3K6RA 3UJ8A 2EG5A 1VBFA 3SGLA 1FY7A 3BGDA 2HTEA 2PN6A 1H9GA 1BIBA 5LQCA 4FHTA 1G3SA 1TNSA 2A6HF 3KQWA 4KDRA 3TQSA 4A12A 4R8HA 4GC9A 3JTHA 3LHDA 2W84A 4IV8A 2I62A 3B73A 2ZCJA 1KXZA 5LEKA 5LGUA
chains in the Genus database with same CATH superfamily
3BPXA 3G0BA 3L7BA 2N1MA 1M1NB 4KN9S 4G41A 2OXCA 2BPOA 2DBBA 2JGLA 5LEJA 3B6EA 3DHVA 2O8FB 2EPFA 5GONB 1HETA 3T34A 2LTPA 3OM9A 2IEBA 4ZGBA 2ZYTX 5JNVA 4R71A 4RTPA 4BXFA 1DC3A 3RSQA 1QGUA 4QYSA 4HQKA 1YXMA 2WSSA 3RVLA 3W5HA 1IONA 3VODA 2H1RA 2WHPB 2JAHA 4AZ0A 3AIIA 1NPDA 1I5OA 1YUNA 3B89A 1NVFA 2BY3A 3OPMA 2GXAA 5M7EA 1JI3A 2FHPA 2AI1A 3C8DA 3QKTA 1FU7A 4TUYB 4M0DA 2D2EA 4GT1A 4D8UA 5IKXA 4G4IA 3VVMA 4R1SA 3NV7A 4IHYA 3A8TA 1Q95A 3HGGA 2V6JA 1ODKA 5CNMA 1P91A 2EFYA 5BW6B 1XWWA 4QJ3A 3SYKA 4CMIA 3TZHA 3KG2A 1DT5A 1TTHA 1UKVY 5REQB 1L7DA 1XZIA 5ABPA 1VL8A 3DOJA 2HF9A 2JFPA 1X1QA 1D04A 3LDGA 4ZCQA 2IXBA 3DL0A 3KPHA 3ZE9A 2OGUA 3AL2A 3ICEA 3HV0A 4PG4A 4F72A 1ODTC 5B64A 3TXAA 1NVTA 3N2NA 4M9SA 3ER6A 3CMAI 2VKVA 3KQVA 3WDLA 2HQ5A 1PFQA 3IBCA 2VSYA 5G0VA 3BTUA 4L3WA 2GHIA 4CKCA 5FI5A 1NC3A 1C2YA 1JEAA 2I71A 2WPDD 5LM3A 3ELBA 1GFIA 3HY3A 5D2CA 3X1ZA 1MJGM 4N3GA 2A4KA 2XUFA 5JTTA 2Z98A 4H0CA 1VI2A 3VFZA 1XTBA 3GFIA 2RBKA 4N7JA 4AJ1A 4NZ9A 4J90A 1QM5A 2XGJA 4ZVVA 1JP7A 4O1HA 3M6LA 2QD4A 3FWZA 4EYQA 2ISZA 2BVLA 1V6AA 3OX4A 2FPPB 3L4BA 1A7KA 1YVEI 4HS9A 2BGJA 3OY2A 5CIYA 5LHGA 2XNJA 2VJQA 2Z2JA 3U7RA 5DFAA 3KYDA 2ISSD 1T8RA 3IVRA 4LDNA 1ZM4A 2QSYA 1B0UA 821PA 4AY4A 1YRNA 3T9FA 1EDDA 3E3LA 4GQBA 1S72I 1R22A 2WJAA 5EYRA 3SFVA 3QWLA 2R7OA 3MBIA 1ZHFA 2WQ6A 1WJ5A 4BUZA 1S4MA 4YQZA 5AONA 3M8JA 4PLHA 5KOYA 2ZYGA 2XVCA 4AG6A 3DAPA 2OBMA 1FYEA 1D0ZA 3K30A 3JZMA 2IJLA 4AL4A 1XAIA 5G3ZA 3ELKA 2DFLA 5CQEA 2DP4E 3LQ4A 4TKZA 4F38A 5F21A 2QQAA 3VVBA 2F2EA 4RHEA 4I50A 1FP4B 3EZGA 3P45A 4M71A 4RCYA 1IVNA 1G8KA 3L2CA 1MQ9A 4UM7A 3JQAA 4EUHA 5FX2A 5C1OA 2X8BA 4OYLA 1U7OA 4F1JA 1TK3A 3TD2A 4E2FA 3IA7A 4LDRA 1Y1SA 4WNCA 2X7JA 4DW8A 5AQEA 3VYSB 4ESVA 3SC2A 2CHVA 4I6ZA 5JSQA 4D80A 2IKQA 2HCRA 1KARA 3HR4A 2P5YA 1H0KA 3I37X 1RRVA 3FOFC 1EWTA 1LV7A 2R8XA 4G63A 1Q3TA 1H6DA 1EBFA 1X13A 3AG3H 1SBHA 2YWHA 3NM5A 2WA1A 2ESHA 3MRSA 2EZ9A 1CC1S 3O8LA 1TM3E 5A2QK 4BPRA 2OQRA 3H8SA 2ZE6A 3FDXA 1EUCA 5JECA 2QLFA 3P0EA 2C1ZA 1O95A 1MSEC 3VKUA 4K3VA 5KQRA 4QFMA 1J1UA 2MSLA 2P5UA 3QHAA 1D8AA 3GNLA 1VA5A 4E46A 3T9DA 3KZZA 2H31A 1XMOB 3ZV4A 2GZWA 4XB6B 3RSSA 1O1YA 2P2YA 5AYVA 4JB0A 4J3FA 4YT4A 1PV2A 1AK2A 1BJAA 4RQAA 6REQA 5A3QA 2QNRA 3MVEA 2W58A 4CR8A 2X7HA 3FJYA 4CT5A 2WUWE 4YHHB 4Y2XA 5KYWA 2GEKA 2P9ZA 3DEZA 4CM4B 1QKIA 3BB3A 4EUSA 3BGVA 4LK2A 1WCIA 3O3OB 4ZZIA 2GERA 5DT2A 3AOEC 4EPVA 4FJ2A 4OKNA 1C3VA 1BNCA 4ZT7A 4IQJA 1YK0A 4YH1A 4CTKA 5CA0B 4HDNA 4PFPA 1JKOC 5EWMB 1EXVA 2CDCA 1RXYA 2IOQA 4OSEA 3R0ZA 4DQDA 2WF7A 4RD1A 1KZGB 1Y1KE 2JD0A 3QF7A 1A2KC 2XB2A 1X0VA 3UO8B 1UPCA 5K05A 1A27A 1YD7A 3RBVA 3OZSA 1P7WA 2C9ZA 2I0FA 5ITZB 2WJ4A 5IVPA 2VN8A 4JLOA 5A1TA 3B3FA 4N9IA 1F1BA 2ZJFA 3D43A 2ACJA 4D9EA 4G1EB 6Q21A 2ATCA 2NZ8A 1R5JA 2H54A 4F5EA 5EXPA 1FMLA 3B20A 3I6BA 1NBEA 2Q3CA 5KYVA 3DMPA 2RKOA 4MLPA 1EH6A 4JVLA 4YP9A 4FINA 1FDRA 2EHDA 4EGSA 4KN7X 1DQYA 2OTJI 3W7AA 1EKXA 4Q4CA 4KMFA 1MT3A 3AF4A 2EZ8A 1JB1A 2QRMA 1GV5A 3S3OA 4G5YA 4HYTA 4AY3A 1HKSA 3HO6A 4QSHA 3IUQA 3NMUF 4O63O 1EFCA 2EZUA 4C7MA 3NWSA 2WC1A 1UBUS 4FCYA 1SD5A 2JT1A 3QMVA 5E6RB 1ZESA 1BHO1 4XWYA 3HUGA 4CLEA 1NM5C 1ZJJA 3NH9A 1EYZA 2Y05A 4OB8A 2UZ3A 5A4FS 2REQB 2EWWA 2PXAA 5GAGJ 2QRGA 2OHHA 5ITWA 3ZHTA 1NV8A 1KP3A 1W9HA 3PO2J 2ZXJA 3E3NA 4G5XA 2GF9A 5BN4B 2GFIA 3UB2A 1NONA 1SMYF 3QE2A 3PTZA 4JZKA 1V55H 2H0AA 2NO6A 2MSCB 3HKBA 5HNKA 1GXPA 2X0KA 5CG1A 4LS3A 4LRQA 2YDXA 4FGJA 5U1PA 1DL5A 4BHPA 4JJ6A 3RVKA 3MJVA 3L8ZA 4AG5A 2Y1OA 4FR5A 3CTMA 4IXTA 4US2R 2DMRA 2RNJA 2EW2A 2DA5A 4UUAA 5L95A 3V48A 4JI5B 3SDSA 1TK2A 3N0TA 1YHZA 1BZYA 5K3BA 1W34A 1IDOA 4ZDKA 2WB4A 4JS0A 2HSDA 2VFAA 3ML1A 4F1KA 2W4IA 3VNUA 1GG5A 2XF7A 1MAWA 3NKFA 4AKTA 2B7BA 3MTIA 3RS8A 3SSOA 5AXCA 1KU2A 2RN7A 3JYQA 4IVQA 5IXYA 1USTA 1I13A 3DBLB 4DYCA 4J0JA 1F17A 4GE0A 2FSPA 5E2BA 4HLUA 5LIRA 3E22A 1XKTA 2Q0HA 2DECA 4AWAA 2DZDA 3FIUA 3LBAA 2ANBA 1C1XB 3K0FA 2OOKA 2C58A 3GDFA 4U39A 4IF4A 3V7WA 3KEMA 4P7JA 1D1PA 1P4XA 1QIJA 1GQOA 2HRQA 2ELJA 5G1OA 3GAAA 4PANA 1TCBA 3JRCA 3NBZC 2FHSA 4HDKA 1N3LA 5F9HA 4CM9D 1IWPB 3MUEA 1ITYA 2AB0A 4JJ4A 3JREA 1C3LA 3CZAA 3H6GA 3SOZA 4U7TB 3RBAA 5E7JA 3SBOA 2C4WA 5BMOA 2VJLA 1JFFB 1S8OA 5FWAA 1TT0A 2PEYA 3ETGA 3KT8A 4I9NA 5JCZA 3KEGA 3F74A 4M9CA 3LAJA 1ZCFA 1H2ZA 3N87A 3MG9A 2QPOA 3I5XA 3SKYA 3F3XA 4ETNA 1V3FA 3QVMA 1KEVA 2Z5LA 1U5BB 3TQQA 1I1QB 3WDMA 3E3AA 1N77A 2K5UA 3TB6A 1ULUA 2DQ4A 1BXKA 1Z25A 3TUIC 2BBYA 1GZ7A 2K9SA 1P1BA 1KKLA 4LOCA 3JRIA 1UMBA 2IZ0A 2AOXA 1IJEA 1JWLA 1UP4A 1SXJA 3I52A 3CPJB 3OY9A 3GQBB 1K6JA 3ZTYA 4UU8A 4B3AA 1UKCA 1EFRA 3IJ5A 2R6ZA 1B15A 5F78A 4U0VA 5E8IA 2C96A 1MIOA 2B2NA 1WP4A 5CKTA 2ZI4A 4C43A 1P9QC 1XD9A 5DN9A 2ZE5A 3IOEA 3V8QA 4L5CA 4RTOA 1KC1A 2O20A 2ZYIA 2MYSA 2Z3ZA 4DC0A 3MWMA 4PC2A 4DJEC 5B3JA 5F04A 1WJEA 1CULC 3BOSA 3LT0A 2G7ZA 4DLWA 2OILA 4N4AA 1IU9A 4UEKA 4K46A 4MGHA 4CCAA 3R5TA 3RTDA 4PK4A 1P1RA 4H4EA 1EZ1A 3HRKA 2W7TA 2X0LA 4YJ3B 2RH9B 1NXWA 5JAPA 3B7PA 1M34B 2HHLA 3PKIA 1QFZA 1T0JB 2ZSHA 2CKDA 2IV2X 5EE1A 1KI8A 4A3EJ 2PM8A 1GADO 3CA8A 1TVEA 3OZRA 2QTBA 1TZMA 1TZCA 3VOAA 1HKQA 3LLCA 4ZQGA 1QHHA 4WTOA 1C7FA 4E31A 1TQ4A 2CJJA 1XQWA 3SR3A 5D5XB 2W00A 2VTDA 1E79A 1PTJC 3EVTA 3AI1A 5M5BA 2EBIA 2Q2EA 2OD2A 2G8LA 4FMDB 1H4SA 1HK7A 2Z9CA 1Q50A 3VZRA 1YBHA 3PG5A 2PCLA 1NW9B 1Q0SA 2ZJBA 1NWCA 1ZN7A 4JR0A 1T2NA 4DR5B 1G6HA 3ZI7A 1H3FA 4ABYA 3T9BA 1DO2A 5E2IA 3U2RA 1XZCA 1Z21A 1GILA 3D3QA 3DUFB 4D8YA 4MIOA 4M55A 3U3MA 1OV4A 1CRQA 3JW4A 2I5PO 5E9QA 3P2MA 5CAEA 3LP8A 3PQCA 2OZ6A 2V03A 4ALKA 4WJKB 4Z1MA 2AC2A 4I55F 4NYMR 1FBSA 1TUGA 1IN6A 3VC7A 2C7QA 5BV2P 2BP7B 3WX0A 2O54A 4DXAA 3WLAA 5FI0B 3C7KA 4KAFA 1R5HA 1YVUA 1P5RA 4PYOA 3OQIB 4IF6A 4G1BA 1Z6RA 4P7BA 4KI7A 5JZSA 4ZC8A 3C41J 2F5CA 1WQ3A 3P9KA 1B8PA 3VSKA 2G5TA 4IZZA 4X8LA 2P68A 4RH3A 1HM5A 1DVRA 3OCZA 4EAAA 2CUKA 1LDJA 1ESEA 4C22A 4UUSB 4WXMA 2OPHA 1IZ1A 2FEMA 9ANTA 5EGSA 1A8IA 5CYPA 5K20A 4M0CA 3QE9Y 5HODA 3D3NA 3ESQA 2GPSA 3U37A 1AS2A 1VMAA 5TMPA 1F6DA 5GPCA 1S2GA 1H4TA 5CDGA 3WTSC 3KZXA 4K3UA 2NUPA 5LQDA 1SUFA 2Q1SA 2W2XA 1TLLA 1OCEA 2WFZA 1W5EA 2N46A 3BDDA 2Q5OA 5B1DA 3HOYJ 4NFLA 3OPYA 4RMIA 2RARA 3EUAA 4MPTA 1UG0A 3OYHA 3AV3A 5CLGA 2K3FA 4ETWA 2NADA 4YPVA 3G0GA 2XX3A 2VIXA 3WADA 3NT2A 1IAVA 4I4LA 5KEIA 2DRIA 1NRXA 2KIMA 2VHXA 4LJ4A 2Z5GA 4MR9A 1TE2A 4B6SA 5ALUA 4DIBA 1Z7WA 4CMBA 3WU0A 2QP9X 1COWD 1QFYA 4K87A 1D2GA 3NEUA 4UDXX 2ZUBA 3GUHA 1MN6A 1Q0RA 2ZE7A 3OZBA 2Q8KA 3BYZA 2PQ6A 3LY8A 1Y9JA 2P2ZA 1XFAA 1Y56A 1G9TA 1ZOPA 3KUDA 2GXSA 3D5SC 1WPKA 4ZVOA 4ENSA 1GCUA 4NG5A 1UKBA 2XUZA 1QO7A 3AUUA 4BX3A 3V8LA 4HN2A 1GTMA 5CX4A 1T39A 5JSUA 2WTXA 5CVCA 2PS3A 2W2KB 1XFDA 4R8SA 4WOBA 4PIMA 2WYVA 3CURA 3PNSA 1VE9A 1A98A 2FD5A 2FB9A 1TUIA 3ZH9B 3IKJA 3HCBA 2DUMA 1TCAA 1U9ZA 3EDPA 1XNHA 1SD2A 3K6JA 5H7XA 3UUEA 5AXDA 4G1UC 4Y2TA 4CM8A 3OZUA 2H9AA 4YRIA 5IDVA 3RC2A 1E4OA 2RHMA 3I59B 3MSXA 2RG1A 3PDJA 2XAJA 2X15A 4IJKA 3G17A 1ACIA 2QOEA 5IRCD 2BGMA 2DKNA 3I4FA 1Z2CA 4F6LA 2CE2X 1UWCA 4UATA 2FX3A 3MB8A 1PYGA 2ZYRA 3BDAA 3A1VA 1AN0A 1DO0A 4O4JB 2ABWA 2LRHA 2NPFA 2VHQA 1XZMA 4CT4B 4QAJA 3FDYA 3HDDA 1ZL0A 2E5LB 1X4OA 4JC8A 5EUQB 4O5AA 4MARA 3DV0B 1A50B 1QTNA 5EMHA 3QPBA 2RQQA 1JLKA 4OIRF 1NVWQ 1G7CA 5K1YA 1Z17A 5EJ7A 5FD5A 4PWYA 3W5SA 3STTA 3GZTB 1ZITA 1W0CA 1VQ5I 3S68A 1S3IA 5BPHA 4NP6A 1O6ZA 4PPGA 1U02A 4ON0A 4F4FA 3KE8A 4ZTZB 3QFFA 1L9KA 1BH6A 3RKYA 3M33A 4W7HA 4S0HB 4A3IJ 2FPWA 2Q4EA 4QBKA 1ZZEA 3VEPA 4PQEA 3T06B 1J8VA 3JQCA 1ZGCA 3SIXA 4HGZA 3S7TA 4R7TA 3HVIA 3QLVC 4CCSA 3P9CA 4M8NE 1Y1PA 5ESDA 4H7PA 3PPVA 4NBRA 1A8UA 1EH5A 2EIMH 2W6JA 1L5VA 4R0MA 4DADA 4UUTA 2YXDA 1CB0A 2D2XA 2LF7A 1E3EA 4FC7A 1NT4A 2JMWA 2G72A 1WY5A 4GHWA 2QN7A 3Q85A 2IEIA 4MGEA 4ZOLA 2XMCA 3TBIA 3UB4A 4EGFA 2EIHA 2FUG1 2P4UA 4EFLA 4K9MA 3UFXA 1W48A 2D3WA 4L8GA 1KFCB 1E0DA 3E8XA 3MRTA 3IPAA 4D9KA 1CJUC 2Y92A 3ZKWB 3ENVA 3ESZA 4NY1A 2J09A 3ZVNA 2V3WA 1RJFA 1WCYA 1Q44A 1E9VA 2E71A 2VJJA 4UZFA 3GFBA 3M6AA 3W5UA 2FXIA 4IHJB 3CDHA 2XROA 1W4RA 2IPMA 5FO1A 3HS3A 3Q3CA 1I0ZA 3UA3A 1PYDA 2AOUA 3KS9A 2DERA 1P9OA 2A9VA 5HS9A 3G2IA 2XNKA 4ZK6A 3S1SA 3T3MB 5J8CA 2TDXA 4RZXA 1UJNA 2R8EA 2A1TS 3RS4A 3G5LA 3ETLA 2WADA 3AU9A 5HX7A 4DSOA 3DTYA 1V9SA 4YRNA 3F9IA 1KU6A 1G55A 3ROKA 2WTAA 3BC8A 3ZQHA 1NQXA 1WABA 4G2NA 3NNNA 1HKUA 4BOYA 1F7VA 4KSBA 4EHNA 5EJGA 2J3DA 2FMLA 2FDRA 5IP6A 1M8KA 2G8NA 2PQ8A 1RLOA 3VU9B 2XRFA 3LUAA 3N2EA 2FDCA 1XPXA 2FLKA 4OQFA 3TLGB 1PGOA 2C4HA 3NWJA 2XBUA 4H6WA 1R8QA 1SEUA 2JHCA 4WW0A 3JD2A 5C4JJ 1Y7HA 2N75A 2C92A 4YLEA 3GK3A 2M7AA 3WGLA 1GA6A 4MPRA 4B3CA 2WHYA 3VQTA 1CF4A 4LZLA 5E3IA 1Y1RA 2Q1WA 2CNNA 1QK3A 1TZKA 3CRZA 3BM5A 1BR1A 2BMDA 2ZC2A 2OP0A 3B73A 5GONF 1WZUA 3M2TA 1SXGA 1ZUNA 2J5RA 3W6PA 1MC5A 1KL7A 1QCDA 1BVUA 1MBFA 2QB5A 3H1TA 1OWLA 5FP0A 4DA9A 5A4MS 4D8TA 3VJLA 4UBKA 4JYAB 2VJYA 2ELHA 5HG0A 2IBTA 2JKZA 3GMEA 4UM5A 5A3RA 4O0MA 4BDZA 3ELDA 3TLJA 1Y6JA 1XGOA 2XCOA 4TUYF 2UZIR 1CTQA 2JJ8A 3A05A 4KWCA 4E03A 2XE7A 3H17A 5AJUA 5GTDA 1SXHA 4EO9A 2E1CA 1EG2A 3CN7A 4XK4A 3PWZA 4ZDLA 3MD2A 3ADOA 5EXDA 1N8NA 1YS2X 1T13A 3E53A 1QYWA 2AHOA 3G2MA 3VKHA 1QZTA 6YASA 1IY9A 2IIPA 2YY6A 1W94A 4RBNA 3VR2A 1OXMA 2WJWA 1BCRA 5IDYA 4UARA 5LU9A 2NSJA 2EERA 1K98A 4TZTA 3SXUA 1KFEB 4JL8A 4OF4A 3HQ4O 2VSNA 1G41A 5K3FB 2ZYUX 3BULA 1RCUA 1N36B 4DDUA 1KO7A 5DE3A 3LT4A 3HCWA 5GP1A 3VX3A 2VTVA 2GA1A 2KIFA 1XNJA 2HK7A 1E6WA 1C9MA 1USWA 1PBNA 3PQJA 3V7RA 5E3OA 3A6PC 3T99A 5FDFA 2PMHA 1B2RA 2EV0A 4C89A 3HFGA 4K40A 4C6TA 1BX0A 4UCFA 4RZHA 1CZKA 1OFCX 2BZGA 4PZ9A 4DSNA 3WBKA 1VLQA 4NU8X 1UBTS 1PS8A 2IZ6A 1RI5A 5L7TA 4G5HA 1I10A 3ZY2A 2CVZA 4OGLA 5FLXZ 3VISA 3ZV3A 1TWHJ 1G6OA 5EA2A 5IJ0A 2DWPA 2C7VA 3S81A 2BAGA 1R16A 2CLOB 3I9NA 1TQHA 3DP7A 3T7DA 5H80A 1TXGA 4EY6A 4DYHA 2IVMA 4TKMA 2NSDA 2CZCA 3RYIA 3LBHA 3O26A 3K9HA 1XZPA 3H4VA 1U7WA 3FPKA 1MNQA 3SJAA 4EJFA 3ADKA 3HI4A 4ITVA 1X86B 5C37A 2R8OA 1TYAE 3WY9A 1VFNA 4R01A 4GU5A 4XB2A 1QRDA 4ZI3A 1WMSA 3IEPA 1KDTA 3LSJA 2C95A 2XWQA 5JASA 2PYZA 4LSGA 2NV6A 1E17A 4RVOA 4NS4A 1JR4A 5EP2A 1Y89A 3F67A 3N8GA 4RGYA 5KDLA 1EQUA 3KKLA 3PUVA 2P3LA 2W2OA 2ID4A 2HNKA 3VH4A 2FU4A 4E7OA 1MCZA 1ZHHA 5K5QA 4JI2B 4YUAA 2B3DA 4M2LA 2X9LA 4RF2A 1WD7A 4GWGA 2JFWA 1RRJA 1BXGB 5GV7A 1VG9B 9LDBA 3DKIA 2P6OA 2GO7A 3K4BA 3VC1A 5FL7D 1QGOA 2OC6A 5HBGA 2H6BA 5IC5A 3BE6A 2R7WA 4A92A 4FDUA 3LC0A 4Y2QA 4BWVA 5K3EA 4DJDC 4EHLA 2QP4A 1ONSA 3L1UA 2LUOA 3KHTA 2MINB 1EUZA 2QR2A 5JSFA 3L2QA 2R1ZA 4P2BA 5U9CA 1F5TA 3ZNQA 1ZKGA 4W1UA 5ALOA 2J7PA 1NF8A 4E5MA 5LL6P 2PKWA 3L07A 3EOBI 5IASA 1E8MA 5CLQA 4TT3D 4EA9A 4PXAA 5C32A 1L4GA 3ZXUB 1G17A 2F9FA 4H3VA 3RARA 3ZCUA 2WEKA 2XI4A 3OBBA 4TLBA 4N8DA 1LPQA 1XCPA 2I8CA 3DVAA 4LYEA 1C8BA 2ETVA 1WIWA 3SS7X 4H7FA 3TRFA 4BEHA 4M1SA 1SBQA 3AKEA 4X6AJ 2Q3EA 1QOPB 2GRJA 1CF7B 4MJLA 3TW0A 4FCTA 3CW8X 1ZJ6A 4HNRA 1HORA 2JAPA 2OHIA 3K71B 5L3FA 3C3BA 2OV7A 1M2VA 4CGYA 1U5CA 2ME0A 1EE2A 2JGJA 5HRAA 2HGCA 4N0BA 1HWYA 3GVCA 4FD2A 3P2KA 3ZMSA 1R9JA 3K53A 3LUDA 1E59A 3TEFA 2F48A 2O8VA 1PV1A 4S0ZA 3PLNA 3TZQA 1DEXA 2R7RA 5IEBA 4O5VA 5GJVC 2AQKA 3UWDA 1GT6A 1OU4A 4FNMA 4FD3A 5CA0F 3KO8A 2Q7XA 1T3LA 4LNUB 1S1CA 2PLNA 5L7YA 2HQBA 3RYPA 5BV7A 3ZHXA 3H3ZA 1SH7A 2BFAA 1GD1O 5CXXA 2FGKA 4CV0A 2IS4A 2C7GA 2X2EA 1DCFA 2CFXA 2H29A 4PZ0A 1HC7A 2VCEA 2ZKLA 3IDQA 4B3JA 3N2GA 3QYBA 1A5JA 1QF9A 3I9V1 1G2HA 5SYNA 4FX0A 3ABTA 2Q9UA 4MS3B 5J63A 4I01A 5LWHA 2ZJPF 3FCCA 1FVFA 3GZNB 3OR2C 4OX9B 2BCJQ 3K5PA 3NM6B 1ORIA 4F97A 1P9NA 5K9ZA 4PZUA 2R00A 4R3WA 1O57A 1PQYA 2I3DA 3IP7A 4EYGA 3OLZA 4JQZA 5CB8A 4OB7A 2DEUA 1R0ZA 1IZZA 5TISC 1YQQA 1QLWA 3HMKA 2W8BB 1KA8A 2MCFA 3U4HA 3EX7C 3R9IA 2HOQA 3MZYA 1C7QA 2A35A 4RENA 2CF6A 2IUUA 2ADOA 4QO7A 3U4QB 4M1YA 1CEXA 2EP5A 4DLVA 3FHNA 4RPIA 3VOEA 1QH1A 2IXGA 1OI4A 4G4GA 3HTUA 4NECA 3JRGA 2R7LA 1KZ6A 1XHEA 5TS2A 2YJGA 3MMZA 3IP5A 3JQ7B 3T41A 4L4YA 1UJ6A 3UUGA 4LBWA 3THYA 2O2HA 4CMJA 5IJAA 5KHLB 1N5LA 3IEUA 1EZ4A 2J3HA 4QOSA 1WKBA 2KSQA 1JJ8C 3A1NA 4KGDA 4J3NA 2WYUA 5KNBA 4Q48A 3ROZA 4E6EA 4H1TA 4U4AA 3OZFA 2VNAA 3AV0B 1LE8A 2HL6A 4KFTA 1N2GA 1Z4OA 1P44A 4LX0A 5DTIA 1MW8X 2N47A 4XRSA 5ALVA 1U11A 2VO1A 2LD4A 3FBIB 2KLHA 1IPHA 2XNDD 1OYYA 4IHAA 3V33A 4X64B 2STWA 1WI9A 1VLVA 5FPQA 4HJXA 4KRXA 2QLNA 1D7OA 3L0IB 3CC8A 2FWAA 3L8GA 4PRZA 2MBFA 1HT1E 3QVVA 3G9ZA 3JRHA 5CB4B 3RH0A 4HFJA 4DKXA 2OBLA 4C7OA 1B6TA 1IWBB 2QYOA 1OREA 4URUR 2HQAA 1UZAA 2P8SA 3IQZA 1SVSA 1G5QA 4ALLA 5IXSA 1DC6A 4DMMA 3CQZJ 4FJ0A 1CFZA 4PC3A 5JMTA 3OCYA 1C0EA 3NHJA 3S2EA 3UTCA 5SZKB 3KL4A 3L6DA 4D7MA 4FHGA 5AKZA 4CKEA 1H1DA 4QOHA 1BMQA 3O82A 1YZGA 4IFBA 5JOQA 2V55B 2F1IA 3P2OA 3T7SA 3V2UA 3D8HA 2CEAA 2QGZA 3SDZA 3LPMA 4FGUA 4C6RA 4F85A 5BSUA 1ULAA 1L8QA 1OAKA 3EGXB 1DGQA 3L05A 4QUDA 1Q0TA 1BA2A 4ZDWA 3DTIA 1D1BA 1ZU5A 3P2YA 2P35A 2A5YB 2CHEA 1SM4A 2XB0X 1LLFA 3Q8MA 4OMDA 3GGCA 1Z3IX 3GB9A 3BQMB 3S1QJ 2VPXA 3ED5A 3HYTA 3LCMA 1JVSA 3S7ZA 5EXSA 3C8MA 4ITRC 2F90A 2Q07A 4M3FA 4W9NA 4JX6A 1NVBA 4H7DA 4FI3C 4FHFA 2XUQA 4ZJYA 2O0MA 1PR9A 4BGEA 2Y1EA 9LDTA 4WEOA 5G4KA 3U3DA 1GA1A 4PU0A 4LOIA 2QN2A 3AHEA 3KFLA 1GPKA 4AUEA 3O7MA 3TO9A 2WU4A 4UEOA 3LNCA 3PL8A 5GZ6A 4ND1A 4KR7A 2QN6A 3QJGA 1DCKA 4CGZA 1SNYA 4KVZA 4U3JB 3PUZA 4INPA 3QXCA 4QYIA 3PGJA 1ZI9A 2ATVA 2ZTUA 1G2OA 5T8KC 1X2BA 5E6UA 2BKAA 2B8WA 2V1DA 2QSGX 4JNCA 3C7TA 1B43A 4LHXA 4PSWA 1E61A 1MAAA 3PUFA 1YB7A 3GMIA 2C3UA 3C3XA 1V35A 2F00A 2A5WA 1ZINA 1M1YE 1N2CB 1XJCA 1OQYA 2IS1A 3FHLA 3H2BA 5ICSA 3KKMA 5JAIA 4OI1A 1DTWA 3FWEA 1D2CA 2MLGA 1RC0A 4CKYA 1TL8A 3W5BA 1KY4A 1L5HB 1NVAA 1KYIA 3DMDA 3IYLW 3AVYA 1MF7A 4OJYA 2JC3A 3R7DA 4HSRA 3SU8A 2NSYA 3N7TA 4HLUC 5FOQA 3Q9LA 3K9LA 3BJMA 5ALWA 3G89A 3OJXA 4WQMA 3Q3EA 3HUDA 2J3LA 2WHRA 2QSUA 4CTMA 2R6GA 1W4LA 3RFUA 1M2KA 3TTYA 4WOPA 5GAEJ 1QVAA 1DTEA 4IOCF 3EDCA 3O1LA 4DLLA 2VI6A 5JJBA 2XZPA 3FNRA 2EATA 3UMYA 2UUAB 4WWCA 1A31A 1SIWA 3P9YA 4RA2A 1YW7A 4FDMA 3H16A 1BIAA 1RKQA 4MWCA 3AEQB 5DEOA 3WV5A 2ZG6A 4V1CI 1G3IA 2II6A 3OTOB 1P7CA 1Z4IA 3JRBA 2HSJA 2PX9A 1L5NA 3KEYA 3GXOA 3ZEIA 2CWWA 1EP2B 2HFKA 4CU5A 1ZIYA 4IIVA 3G1MA 3HL2A 2NZJA 5CDTA 4KU4A 3NXKA 2BFBA 4FMDF 3KSDO 2VPYA 5BO5A 3D4OA 4YFYA 2VC2B 1CJCA 5EZQA 4MVJM 2PGXA 4WXDA 1WXQA 5DD8A 3FTCA 1QHGA 2YRWA 4HGRA 1RIFA 4LE0A 4OHPA 3ZMUA 4RVNA 1XLWA 4UHCA 2Z09A 3BR0A 2HDNB 1EDZA 1OLXB 2VJIA 3LWDA 5E0KB 2VJCA 5F73A 5KTMA 3AF0A 5TF4A 4J0KA 1BOBA 4QYWA 4J7CA 2PJUA 5F3DA 2JAQA 4RY2A 4E7SA 5U4XA 2RI6A 1CRPA 1EVJA 1C9EA 1PZEA 2WJ6A 1CUFA 4N18A 4PNZA 5F76A 3W2VA 4P3YA 4C78A 4PO3X 4DLTA 1XK6A 2QM3A 1FXUA 2CJWB 1H05A 4E88A 4UVHA 7ADHA 1V11B 3CZMA 2YZGA 4OHXA 4KZKA 5EMLA 1GCGA 1L9XA 4ND3A 1G20B 4PBSA 2V4ZA 4TLEA 1QHXA 5HQ3A 1I36A 1SVLA 1KMIY 1H85A 5I7SA 2A9KA 1O54A 2PGJA 1MB3A 1G5TA 2JJQA 4UEQA 5LMUB 3WZ2A 4HSGA 1IRFA 4HP8A 1N34B 1K0FA 4M83A 1LRJA 4RDXA 1GUAA 1M72A 3ZX4A 4MCJA 4U2KA 1UZMA 5JCJA 1RM3A 2IZ5A 1YZTA 1JI8A 5H02A 4KQCA 1Z05A 1GZ6A 2YX7A 4YV1A 5EOVA 1Z36A 3V8EA 4HWPA 2XQIA 1SBCA 3OR1C 3DV8A 4CWAA 2VJMB 2CV1A 1J1IA 5DDGA 3A4NA 3SNKA 4MQEA 3L2WA 1JR3D 2CXHA 1SRQA 2I67A 4EENA 4P7GA 1PV4A 3ANSA 3SEQA 1QO0A 1VZ0A 3IP4B 2MT9A 4H1VA 5F5NA 3M8EA 1RI2A 2M4KA 3G9QA 3UK6A 1XQ9A 2VEOA 5IT5A 1K7AA 4EHKA 1UOQA 4LTNA 5HVQC 2XQFA 4HYQA 5L4LA 1LFPA 1KONA 4URHA 2LP4Y 2GM4A 4KVGA 3CRW1 3NDJA 3DD1A 4KIWA 2Q29A 4UZEA 3CKMA 2I2FA 2FWBA 2C2WA 1R0XA 3EVEA 1RWOA 3HABA 1HF0A 2P2GA 4JXZA 1A6QA 4AX4A 2P4WA 4U0KA 3HO1A 1MLDA 2ZIVB 421PA 3NS7A 1U2TA 2PZJA 2D0PB 2ZRAA 5IY5H 4TV8B 1OPXA 2YYAA 3KR2A 1NMZA 3HXTA 3H5VA 5ES4B 1ADYA 3KK0A 1IUFA 1PZFA 4M98A 1AKYA 3VO1A 1H5NA 2NTVA 1V8ZA 2FFRA 1Q7TA 4XI9A 4TYYA 1WUIS 2YQ5A 3K7EA 3WNQA 5BV8A 1OX4A 1BWSA 1T8TA 1FU8A 5BSEA 4K6CA 4AP9A 1GPMA 2GZ3A 4RV5A 2OXEA 2MH2A 4KXFB 4QC2A 1NBOA 3AR4A 5AJHA 2RI1A 5IABA 1SUSA 2CLEB 2FZCA 4A0QA 5BP7A 1ODLA 4FBMA 4YGXB 1IY1A 2GCIA 5IJ9A 3VNQA 2V9PA 2CXTA 4O4JF 1ULYA 4QXRA 4HF7A 3GCDA 4Q1AA 1T9GR 3PGXA 3UR3C 1EFDN 1IG0A 1IBSA 4EFDA 4P5OA 4HQ0A 2ZTMA 1LZLA 4G9GA 4BO2A 4I1UA 3L3BA 1IJWC 1TYEB 2IY9A 2YS6A 2FZEA 4LOAA 1US8A 2CD9A 1EFPB 1E1LA 2XMGA 3C2GA 4W1QA 4YK7A 4A36A 2YUIA 3O4JA 2H08A 2ZVPX 1X1BA 3O47A 2JANA 4P80A 4DUGD 2I4OA 3KR0A 3O7WA 3QK7A 1XZGA 3D3WA 3KFVA 2Q41A 2JZNA 1Z67A 3R0IA 1K7FB 4TSFD 3WKEA 5KHOC 2B0LA 3H8VA 4D4HA 2L9RA 2CSOA 3KKNA 1XDDA 1JALA 2A7QA 4HDMA 1Q0HA 1ZFNA 3B36A 2XTZA 1L8AA 1RIOH 2WJYA 1DQUA 1R7JA 2ESRA 1T2FA 3LUJA 3FFWA 1S4QA 3ROUA 1Q1EA 3DF8A 4ZWNA 4MLDA 5JWHA 3A14A 4JLAA 2EQRA 2MABA 4IEJA 3KT6A 5KVSA 3N0VA 4Q7QA 2PX2A 1UKYA 3I2JA 1HNNA 1UBHS 3UHJA 1EP9A 3ED1A 4Z8YA 3SR4A 4TMTA 1GTVA 4MKHA 3O90A 2JLVA 2PU5A 4KXWA 2VC0A 4HZFA 5MFZA 3D5RC 2HN9A 1I7LA 2AXPA 4GDFA 1U80A 4YS6A 4CCKA 4EG4A 4C4PA 1HDEA 4G81A 1MMFB 1YGPA 5JROA 3BWMA 4DKJA 1MPTA 4QLBA 2C7BA 3N2LA 3NB0A 3GLGB 3ZVLA 2QLMA 3E9EA 5ECYA 4MVJF 3OYJA 3RK0A 4JJZA 4NU6A 5KTYA 3WSWA 4IHJF 2IF2A 4XGQA 3ECAA 1WXXA 4MS1A 3ECSA 2WZQA 5AVQA 2X7XA 3EEIA 3ENWA 4L6IA 2QJFA 3WRXA 2QVYX 5AVTA 4L85A 3TZ6A 1Q91A 1WL8A 5HDBB 1RWVA 2WAYA 3JQGB 4W97A 3CZQA 4MIKA 2NUAB 2DT7B 2L9VA 2OXIA 3JQFC 3HXQA 3EEBA 5ELXA 3Q98A 2KRCA 4NESA 3KSRA 1A5BB 3EULA 3T5AA 4MWTA 2HO5A 4WGFA 1WPQA 3DE5X 3QPSA 4CYMA 1JXSA 1OGIA 4H4CA 3D3EA 2H9YA 1G98A 3ZY5A 5FOTA 4PSCA 2GETA 4BKXA 4I7HA 2PL5A 5ALHA 2B2XA 5F1KA 5H59A 4G85A 4X61A 4D5FA 2JTVA 1VFPA 3NJ8A 1XZHA 4L0QA 2PKRA 2ZI3A 3NPMA 3E6CC 3OYLA 5BRJA 2P90A 4DOMA 2Q28A 1U8BA 4JLUA 1FS6A 1U8XX 5HTKA 3PXEA 3F97A 1CEEA 5BNIA 2JL1A 3P9IA 1A7AA 1WSWA 3AL0B 1K2VN 2RIPA 3GEHA 4PZYA 2DMNA 1K2WA 1LDMA 3F7TA 1AQJA 1V5FA 3FFTA 1XG5A 4GKBA 4TVSA 2CBGA 1L1QA 4A9AA 5KQGA 1H2FA 4WCDA 4YCJA 4AUMA 3NO4A 3QLUA 1VXOA 4XRMA 2JA5J 4DEXA 1MB0A 3EXEB 3KQWA 1VMIA 5K6AC 1W88B 3T5BA 1MOPA 3DV2A 3AY3A 4LSWA 2WSBA 1QVRA 5HOOA 1QV7A 2H51A 4EX7A 3ADCA 3HPHA 3ZS8A 2JLSA 5JVDA 4IX7A 2QVOA 4F5ZA 4A91A 4W8HA 1XIVA 3TZLA 4P3NA 1ZREA 3QP6A 3P20A 4ZYWA 3K8OE 2LTAA 1GKLA 3L7CA 3KKQA 4QPJC 3VAYA 4KJXA 1EEHA 3N3BC 2KIQA 3ASOH 4YA6A 1LLUA 3PQ3A 2Z2YA 4YMUA 2G09A 5EWLA 1ORWA 5J4LA 2UXNA 3R6SA 1T3ZA 1ZYRF 4Y9SA 2IA5A 4D57A 1MT0A 4DHEA 4V0RA 3F2IA 3TI7A 1P1CA 2FOXA 1E1QD 2F1JA 2DPDA 1TF7A 4FOSA 1R0BA 2HA2A 5C8DA 5TSDA 5FFXA 4YAJA 3ABQB 2PSJA 1NW5A 2ZIFA 3KOXA 2OG1A 2JGAA 3GXBA 3BIWA 4CDRA 2K3PA 4ZIRB 3EYWA 4NIMA 3OE4A 4PR0A 4YPFA 4AICA 3LRXA 5AIBA 4BBZA 2PLRA 2IX9A 2G4VA 1NPYA 2OLEA 3DMTC 2PPVA 1DOHA 1JSXA 3CZ5A 1L7OA 4RK0A 5CVRA 4FZJA 1KAOA 2GNAA 2P2SA 2O0LA 2KI5A 2V26A 4D41A 4RKYA 1Z3CA 3OD5A 1FLIA 3NT4A 3PJGA 2G9NA 4XGRA 3U48A 5GJCA 3D59A 2X2OA 3EVFA 1R1DA 3UV6A 3FMFA 4LPKA 5CCEA 2CF5A 4JLKA 4O3MA 3LLMA 5BYBA 1K06A 2A1UB 4KX3A 2HTSA 4C3VA 1U81A 3X2QH 1MSFC 3EG5A 3N5KA 3ILSA 1H2RS 3MKYB 5KQPA 4D3ZA 1EE9A 1IULA 2CCKA 1L5FA 3I9FA 1DUXC 1QIGA 2CNWD 3H11A 5GIPE 2YVUA 4JEIA 1Z77A 1UM8A 1H94A 3G1TA 5JQGA 4ZN6A 4ECAA 1ZM3A 3LA8A 3RQIA 5AJXA 4UMFA 2PMDA 1JEOA 3GMSA 4EDFA 2PMUA 3L7YA 3D5QA 3QA9A 1VHWA 3R74A 3T0YA 2XPUA 4U2DA 4OQQA 2R4UA 2X1EA 3ABUA 3IHUA 3JTMA 3PP8A 3FYUA 4CN9A 1ZY2A 1DIGA 2IY7A 5FOUA 3CWZA 1MA0A 3HPQA 4G07A 2YKGA 1GITA 2AK2A 4EGYA 3DGEC 4Q03A 1FYLA 3BH0A 1OAOC 5IAJA 4DQ2A 4GMXA 1RXWA 2ARKA 4R1QA 5TRDA 2OAEA 3TG8A 5ELLA 1XDWA 1LJLA 4URYR 2VOOA 2G88A 2L0XA 1IUYA 3RWBA 4DJTA 3WTBA 1A9QA 3D4LA 1U5TA 4XYEA 1P7PA 4LB5A 4PGFA 3IBSA 2BW3A 3R9XA 5DX8A 1E2HA 1EK5A 2PZ8A 2X4IA 1MJNA 3DYIA 4LJLA 3GRVA 4M60A 4S1PA 5AI0A 2GYYA 4JQSA 3NBXX 1OHHD 1NURA 3LCRA 1U9IC 4DRZA 4P7KA 3RRMA 4WZ6A 1P81A 4A27A 4WKPA 2WVHA 2ZPUA 3DLHA 3CX8A 4FQ7A 2L7ZA 4TKUA 4G0YA 4E2XA 3FWPA 4CF3A 2G80A 5FB3A 3S6JA 1DBRA 1Y6RA 5ALZA 1OH6A 2IL1A 1GU0A 3D2AA 1BCSB 3CC7I 4W5HA 5CB0A 4BRWA 4ISCA 3DMNA 3P32A 4J1NA 4MYUA 3MKWB 1POGA 5JS1A 3BR2A 1T1EA 2JA2A 3S2SA 1S3JA 2ZRIA 3ZJ5A 2PO7A 1IRZA 1L4HA 3G8AA 1GR0A 4Y2RA 1YIOA 2YW2A 2BLLA 4Q4AA 4MA5A 2VXDA 4J8PA 2QW0X 3PCXA 2ADUA 2LKXA 4X66B 2WU0A 3B1VA 2GBLA 3DZHA 5EHGA 2BZ1A 2PSEA 5CM8B 1VMEA 4B3BA 2FPIB 2A9JA 1U9CA 4EA8A 4N8EA 3TVTA 5CYGA 3R6WA 3IDAA 3BEDA 5HEKA 1O5IA 4H0NA 3LOPA 5JR3A 3S17J 1CQIA 3N75A 4EARA 1IK4A 1VPEA 2WM9B 4YUYA 5GM1A 4D46A 1H23A 1NBHA 2R5ZB 5KVAA 4BJ5C 4LHSA 3ZNOA 3ZVMA 1E1CB 2RQPA 2DPLA 3BZ6A 4KISA 2QGFA 4EPTA 3W1VA 1ZH2A 4OP2A 2KM1A 5JS2A 2GOXB 1U28A 1VJ0A 1E6CA 3D1JA 4BB0A 2FG5A 4A26A 3P0JA 2G25A 3J80Z 3PF9A 4S1VA 4ND2A 2H8GA 1YX3A 1K3FA 2PSHA 5HHTA 3B38A 1XXHA 2TECE 1ECGA 4QEZA 3A01A 4JJFA 4OHMA 3ZIAD 2HC9A 2GH1A 3U80A 1V1JA 4F3QA 1BKDR 2GBPA 4HNAB 5K7HA 3VNBA 3TSCA 3CCJI 1CVRA 1FNMA 2HRDA 2P7IA 4N49A 2DH5A 1JRLA 3CO6C 4G24A 1RIIA 2W8ZA 4YI3A 3T1NA 2FPSA 5EG0A 1BVRA 4MS4A 3RS9A 2XPVA 3WMFA 4MQUA 2G7MC 4IIJB 1P18A 2WKQA 1XA3A 5HJ7A 3KQNA 1HO3A 3QFRA 2LZ0A 4KT6A 5JDIA 1OX6A 1F5SA 1YK1A 3JQ8A 3N3AC 1BS2A 4HDSA 3DWGA 2ZU0C 3SVLA 2OC4A 4M0EA 1NSFA 4IOMA 1J49A 2VZ0A 1S5PA 3TRKA 4RW0A 4F5YA 2E3JA 2HCBA 1NI4A 3P0IA 2HS5A 3OOEA 3AUXA 1ADJA 2FSIA 3RYFB 2LC2A 2IZ7A 5JHFA 4B79A 2HSGA 1N0IA 3U7EB 1A9XA 4HDRA 4JJEA 4DUPA 1W4MA 4IIEA 1BMDA 5EZSA 3ZLBA 3WTWC 1W36C 5E3MA 2BBOA 4FTWA 4CKWB 2GZ1A 3WXBA 1GVJA 4NDAA 3AEKA 2BFDB 1O2DA 3W5CA 5J2UA 1O03A 1SMTA 3NRJA 3DBHB 1AH2A 2R47A 2A78A 3ZGOA 1I7PA 4ERNA 4W9RA 3RFXA 4DA8A 3DFMA 5I45A 4IHWA 1C0KA 1BMFA 4OIMA 3IAM6 5AW7A 2Z4RA 4ZCSA 3WRYA 1L8OA 3VR3A 2E82A 4F4CA 1RQLA 3CE9A 4XR6A 2CC2A 1IN4A 4WFJA 1VCHA 4GZ3A 1DG3A 1GUYA 2RGAA 4G7OF 4KQIA 4LVOA 4FBGA 4YBZA 3W3AH 2H59A 1UOEA 5MGBA 4ISBA 1QGDA 3X1KA 4CLOB 3UMBA 3OF5A 1HUQA 1RWNA 1USIA 2R44A 1MQAA 4MFDA 2G77B 3F23A 2F1RA 4XQFA 5DGXA 3KR1A 5BRNA 4V3BA 3HEFA 1ECCA 3PTLA 2XVMA 3SQNA 3SNHA 3OKCA 3QU7A 3REGA 3TZKA 2ZMEB 3CZPA 5EZ6B 2BEKA 1T0FC 3SEZA 4FMBB 1Z5OA 1JJVA 1FJHA 4WDQA 4MR7B 4DQLA 1YC2A 4MP8A 4UNIA 1Z5WA 5CM9C 2K4MA 2Z6UA 1MC4A 3FYHA 1M1EB 2QHXA 1WAMA 4E0BA 3JX9A 3WWDA 1E0SA 2ACEA 4JLJA 3BG9A 1H2EA 1NJ6A 4XIYA 3LU1A 2YDYA 2D06A 1HBJA 5I9LA 1T1SA 1GPDG 3TNJA 2Y1CA 4QTTB 3UY4A 3RSLA 2DXIA 1FSPA 3FPLA 4PW0A 4IQFA 4NULA 3AWIA 1GPJA 1FOYA 4MUKA 1JKJA 1W1WA 1M2GA 1SIBE 3KLNA 2FW0A 3DDZX 5KTSA 1IVSA 1IOVA 3CJQA 4TPKA 1UHSA 3TW4A 2HU7A 4BB5A 2UDPA 3AR8A 1FX0B 4MW4A 5T64A 1D2HA 4HCJA 1N1DA 4IJUA 5DCMA 3TLKA 2JFQA 1Y8QB 1ORKA 1P7JA 1M33A 4XR4A 3KFWX 2H00A 3GUYA 5F1JA 2ZRMA 4G01B 4WIAA 1RXIA 3VI4B 4D3FA 5DTRA 3U40A 1R6AA 1DKLA 3ZZTA 3AB3A 4YRQA 1DAKA 2UUBB 3BMOB 1E9AA 2Q0XA 2HTJA 3WKBA 4UUBA 2R1VB 3ZV7A 5L3GA 3SJZA 1PI3A 5HS6A 1Z5ZA 4RJIA 5ECWA 3AC0A 1GNPA 1MB9A 3SZLA 1GRVA 5JT1A 1C7ZA 4AZ3A 2BMJA 4CDNA 4QZVA 5IC4A 5K0ZA 5ALFA 3M81A 5CLJA 4KLNA 1D3YA 3BQYA 1CJBA 4BBPA 4JMLA 3ZWXA 1RKWA 3JWEA 3UMGA 2EV6A 1G3UA 1C0WA 3ZDEA 2O7VA 5AUQA 2EBHX 1ZR2A 3MEXA 1ADBA 3ERMA 4JJAA 5DYWA 1DLJA 4JVMA 3OFKA 2OV6A 3JR7A 1X1DA 2PN1A 3NG1A 4O08A 2HOEA 4W8OA 3ANYB 1F2UB 1I5EA 4W9NC 3BRQA 5KOHA 3C4QA 4FZ3A 1OC4A 1LNZA 2ACKA 4OKIA 4K8RB 4AF6A 1CF2O 5T67A 2HVSA 3SDBA 1T6XA 3EAQA 3OTQA 1VL6A 3F8TA 3NAMA 1QDEA 5ES3A 1SC1A 2DWCA 3VR6H 2XR1A 1X7ZB 5DXAA 3GNTA 2FNAA 1JE8A 1OSNA 2IIQA 1FXWA 2VDPB 1QR2A 4DNCA 3D4NA 1L4FA 4WKOA 2DN0A 1CNMA 1LC0A 2AZMA 2PRSA 2IZOA 5BYJA 4II3A 1LK5A 1Y5MA 3E1KA 3EGEA 1RVDA 1FDUA 5DXFA 1VKRA 3DDUA 3ECCA 3HJAA 3A1FA 4XM0A 2BJWA 2Q3DA 2Q7OE 1STOA 2NU8A 4AO7A 2IYNA 3DLCA 1H8HA 4CZCA 2R4QA 3WNCA 1YX5A 3JALB 3RK1A 1IZ0A 3KZOA 2A8YA 3AETA 3ZOKA 1ZS9A 3GIDA 4QDOA 1TW3A 5CCXA 2O2YA 2ENUA 1GN8A 2CLHB 2XXAA 2DQLA 2Q99A 3GBPA 2AUNA 5EWJB 2UZKA 4P6VF 2ZXIA 1FDTA 2AQHA 3IURA 2FU5C 2ID6A 4OGWA 3GRYA 1CE8A 4Q1FA 4RY9A 4JBHA 4HRIA 1CEQA 3DVSX 3J81k 5M5WJ 4HK4A 5CVDA 4AWXA 2ZRHA 2QW8A 2MWMA 3LV8A 2FBIA 4XTCS 2GX6A 1I4TD 5FT9A 1W0UA 2FZ5A 1WR8A 3FDZB 4A93J 3G8DA 2YXNA 3MTEA 2VP3A 3PRKE 5L3RA 1JR2A 3KCQA 2FWMX 1II9A 4UHFA 5GAJA 1WFXA 3B5EA 2ESNA 4CEIA 4OGGA 4AW9A 4YDHB 3OETA 4ZYAA 4KP7A 4YRZA 2K2QB 2J9ZB 1QR6A 3DW1X 4Q4LA 4AAYA 2V45A 3LC7O 1R4NB 1H89C 5DT9A 1QRSA 3SKVA 3CBQA 1MMDA 5IPFA 4OG2A 5EP4A 3Q7IA 3ISPA 2KHMA 3REFA 4B75A 3V4VB 2QSHX 5KSYA 2I6GA 5HPYB 4PG7A 4FM9A 3DOFA 2AW3A 1ZWKA 3FROA 4TV8F 1CBUA 5D86A 1R6RA 3K1YA 4A0RA 1E3MA 1O6BA 5F7XA 5D8DA 5IP9J 4CKBB 1VCMA 2SHKA 1ESCA 4GGPA 2YOFA 3WLNA 2FQWA 3IPYA 4PX3A 3QKWA 1XQYA 5EQTA 4RVDA 2ZI5A 1A4IA 2P7CB 1I1GA 2GA9A 4LG3A 5CQGA 2YWFA 5M3BA 3RRZA 4V0MA 3IGFA 3T1BA 3H84A 1TEVA 3QW2A 1PL6A 2HPIA 3RYRA 4EPWA 3AUTA 1JMKC 3WTCA 2V9KA 4FXOA 1MH4A 3MOIA 4LTDA 4GYYA 1N2IA 2UXBB 1UJ8A 4ZAXA 3E4CA 3K9NA 2EKQA 2A7XA 4M9ZA 1IATA 1XDSA 2AO9A 1QBKC 2VN2A 2X0EA 3HXOA 1UDRA 2AYZA 2WAAA 4FDTA 1WNFA 4BVBA 2DOEA 3AFOA 3AJ8A 1YL5A 1BHJA 3K4CA 1SFKA 1JLSA 1W75A 4Z3KA 1W2WB 3ZI4A 1EMDA 2GEBA 2BFCA 3CMCO 5EIBD 1O3RA 2FUG2 2VBYA 2PX6A 3THXB 2OYSA 2TS1A 3U49A 4FDVA 5BVGA 1WE2A 5AW4A 4PXYA 3M5DA 3LSRA 1S5LC 1Z63A 4AUNA 1V48A 1AQYA 4PX5A 4J07A 2ZFUA 2WD7A 2ZJ7A 1SVWA 4GR4A 2DKOA 3AWDA 4E07A 1UUFA