4PGHA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
354
structure length
354
Chain Sequence
AAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
total genus 101
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pghA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pghA02
2ZBRA 4H0EA 2KW5A 1SG9A 1HKSA 1FYKA 1PUEE 1N2XA 1STZA 4B8XA 3GRRA 1B9MA 3UJAA 5ICGA 3CJNA 3I5UA 4UOEA 5LQAA 2EA2A 1SQFA 3G8AA 4A0XA 3VOEA 2RDPA 2PEXA 3ERED 2O61A 2AS5F 5KVAA 1MDMB 3GFMA 4I02A 5CD1A 2QVOA 3FUTA 4P7GA 3HOSA 4YV2A 2DT5A 3K1NA 4A12A 2V1DA 2P40A 3VC1A 4M9ZA 1JSXA 1PJZA 3NMUF 2ZCWA 3IRRA 1D8JA 3FRIA 3I64A 1CF7B 4EVIA 1ZGAA 1QNTA 3QOWA 4HRAA 1HW5A 3MERA 3LCCA 1D8KA 4DM3A 1KYZA 1KR5A 2HQNA 2RQPA 2A07F 5CJ9A 1FYLA 2PY6A 4PNEA 1VBFA 5HIIA 1IW7F 4Z2YA 5E20A 3WU1B 2VBXA 3F8CA 4GO1A 4AVPA 3V8LA 3T7SA 3KE2A 1HBXG 4EGYA 3A25A 3DLCA 5DSTA 4Q5SF 1QAQA 2VDWA 1JGSA 4KFCA 1IY9A 4BAYA 5E1BA 4YUYA 2KKOA 1EH6A 4O29A 3WGHA 3LAPA 1NW5A 1FT9A 1XJ5A 2FK7A 3BZBA 3BJAA 3LX6A 3I59A 3CC8A 3O31A 2ETHA 1I1GA 1GHCA 5F1RA 4HF1A 3FXRA 2ZIEA 4WXCA 3HYIA 1HXDA 4I01A 3DFGA 1FY7A 4U7BA 1OYWA 1H0MA 2YXDA 3A7EA 5CVEA 3V8VA 1ZLJA 2OYRA 5CVIA 2G8NA 4XLNF 1QAOA 1J2XA 4Y15A 1P4XA 2VT2A 3A4TA 1AOYA 4M38A 4ESBA 5MHTA 2EFWA 2ESRA 3B02A 3LA3A 1QZYA 2VN2A 4OINF 1YB2A 1NBIA 3I4PA 5M5BA 2GIVA 4GOMD 4WVLA 4DCMA 3HCBA 2BM8A 3GJYA 5TRDA 2ZFWA 1WZNA 1WXXA 5FHRA 1P6RA 5F64A 3LGAA 5CYVA 4U0WA 3UZUA 2QZ8A 3E97A 4PYQA 4FT4A 3LCUA 3L7WA 5K1YA 1HW1A 2A3SA 2Z99A 3NRVA 4EQQA 3HCAA 3LBYA 5DDGA 1RI3A 4UVAA 5KYGA 3M9AA 4HZFA 5LEKA 1HNNA 1IN7A 1NW3A 5BPIA 3G5TA 3OCJA 1AQJA 2VDVE 4XSXF 1Q0SA 2FHPA 3EETA 3SFZA 2FNPA 4L7VA 3THSA 3TM5A 5FFXA 3T8RA 4KT5C 3T5XA 5DXJA 2JZYA 4K6MA 3KPWA 2D1HA 3P97A 3HNRA 2DLLA 5FGMA 3SZPA 5J8FA 2K86A 1VE3A 1G3WA 1YFHA 4BP1A 3ELUA 5LQUA 2PX5A 3WODF 1W5SA 1LVAA 3KP2A 3TM4A 4D0PA 1ZGJA 3JAMZ 3KEOA 2C6YA 2P6TA 2HS5A 3SM3A 4CO8A 2BM9A 2K02A 3KETA 1ZG5A 1OMIA 2P7VB 5KVRA 3OU7A 1AWCA 5EIWA 1QBJA 2HR1A 2GXGA 5H20A 3J80K 2QY6A 2Z6QA 4A6EA 2LF7A 3J81Z 3I59B 2YR0A 5EG5A 2IVMA 3R0JA 4RB3C 4ZYGA 3CKKA 2KIUA 3VFZA 5HZMA 1E2XA 2W85A 3FRHA 2XAHA 4R79A 2M1BA 2J5OA 1JTEA 2AZTA 3BZ6A 3MZHA 5K0CA 4ZYEA 2HNKA 5FA5A 1T2KA 1FP2A 2HTSA 3O3KA 4G94A 3ML6A 3DMFA 4ATNA 3LKZA 4FT2A 3MB5A 2ZO4A 4GGGA 4IJAA 4BLWA 3ZMSA 1ON1A 1R36A 2F5EA 5EPEA 1AV6A 3R4KA 3JWGA 1M0EA 4EM0B 1Y0UA 2EFJA 1NV8A 2ZXJA 2XVAA 5F2OA 3LDUA 1FBNA 3KQSA 3V8KA 3CJTA 5LQRA 4WX9A 1S7OA 5DX0A 5T67A 2XKPA 4LK1F 2JRTA 3ZMVA 2ZZNA 3BJOA 3OU2A 4NB5A 2XASA 5FA8A 1SD5A 5DD4A 3QV2A 3WTVC 5BPDA 1VIDA 6PAXA 3ZPLA 3B89A 1E17A 2MC3A 2Z5UA 1XCBA 3FYDA 5DM0A 5LQJA 3BGIA 4IV8A 2DU9A 1NE2A 4M7RA 4OU0A 4RAZA 2OBPA 5E1DA 4ER3A 3FF5A 1G3SA 1OYIA 2H94A 1XCVA 2FPOA 3RYPA 3JWHA 2BR3A 4MQ4A 4C03A 1X1AA 4FHTA 2AOVA 3DF8A 4G8XA 4ZYDA 3ORHA 3CUOA 3KPUA 3BPVA 2VS1A 3ELYA 5K0LA 4CXMA 3HRMA 5DUIA 5ILVA 4HLXA 4AX8A 4GQBA 1Z6TA 3GUDA 3K0BA 2C7PA 3I54A 2FXAA 1KYWA 2EB7A 1DP7P 3SVZA 3THRA 1EV7A 5BOXA 2MLGA 2ZWVA 4N0BA 5KS2A 3JSOA 2IH5A 2OO3A 5U4XA 2BV6A 3TPZA 4DQ0A 5L3CA 5A2QZ 5LRRA 4PZJA 3G73A 4U7PB 3MFKA 1P91A 2FBHA 5F2KA 3BWBA 4G6DA 3RYRA 4G56A 3SZTA 1F5TA 2YUIA 2ZFUA 4YFXF 4RAYA 4RB2C 2ZNYA 3KQVA 1R1UA 2YQZA 4LWOA 5DSXA 3P2KA 1TPYA 3FXQA 3V7CA 5HLHA 2A6HF 3FUWA 2DPUA 2HR3A 3SQNA 1O54A 3WTYC 1R00A 2VBYA 2HGCA 1YZ3A 4CHUA 2LF8A 4LG1A 4B17A 4BH9A 1GXPA 5EIFA 1ORHA 1RJEA 5J6XA 2X0LA 4KIGA 1SD6A 1A04A 3FZVA 1DPUA 4YIIA 3B3GA 1EQAA 2P35A 1V4RA 2HTEA 2BH2A 4UV8A 3EVAA 3TOAA 1RI4A 3C1DA 4RGXA 1BIBA 2EJRA 1RZ4A 3COAC 2V1UA 4PYIA 3VB2A 2P3LA 3EMDA 2Z6AA 3CVOA 5LLQA 5DV5A 3BP8A 2V7EA 3DH0A 1HSTA 4UXNA 1YS6A 3PFHA 2ERCA 3HA7A 3BT7A 5HDGA 2P7IA 5D6FA 1R22A 4KUMA 3UJ9A 1EAMA 4P7JA 4XUEA 1BOOA 5HIMA 1FSHA 1DUSA 4KN7X 2P41A 4PYLA 2BE5F 4QDJA 2PXCA 4A5NA 2O03A 4HGYA 3JWJA 1SKMA 4YMGA 3V7SA 3BJ6A 4N9HA 3FZGA 4PCAA 5DPMA 3TMAA 2PT9A 1S3JA 3SHFA 2F8LA 1KU7A 5ICCA 1LEAA 2OY0A 1FSEA 1EJ0A 5E9JA 3LA2A 1JQEA 3FUUA 2K4BA 3GZ5A 5E1XA 1T0FA 3EVFA 1F38A 5AIPA 4AWXB 3MWMA 3UJCA 3QOXA 3MHTA 3F6VA 3KR0A 3MQ2A 2ZNZA 1Y8CA 3FHZA 2L02A 2F5DA 3RODA 3FWEA 1HMYA 3NW9A 1O7FA 1GXQA 2M30A 5BP7A 2PVCA 5JR3A 4E30A 3PTAA 5HEKA 1MGTA 3O2PE 5K0BA 3FM3A 2G9WA 3GRYA 3WGIA 3NJRA 2EV5A 2HWVA 2PN6A 1L3BA 3M8FA 5E2AA 2RNJA 4PWYA 2O0YA 3JSPA 3DXJF 4V0RA 2HWKA 2GS9A 1I1SA 1RJFA 2HTJA 3KQMA 5K5QA 3M70A 1P2FA 3I9FA 4OMYA 4GUAA 4I0AA 4GOND 3QOPA 1G8SA 4A2UA 2O8XA 2PXAA 1P1BA 2Z3YA 5H02A 3F72A 1XMAA 2W84A 3R60A 5CUQA 2VDUE 4EJWA 2NNNA 3CGGA 3H92A 5D8KB 1VQ1A 5IKMA 1QANA 4YUXA 1I27A 3NQOA 3CJRA 4RV9A 2STWA 4RGRA 4RTLA 5BXYA 3HRUA 4QDKA 4P7KA 3FPGA 3LCVB 4OA5A 5K5RA 4HQMA 1OR8A 3E5QA 2G72A 2Z33A 5LGNA 1IXCA 1WKMA 3RJPA 2C7QA 2G7UA 3RKWA 1U2ZA 1FC3A 2TDXA 4L9TA 3U81A 1R23A 1TNSA 3T0YA 4P96A 4MGRA 3TGNA 4P7FA 3J80Z 1LQ1A 2G70A 2YTZA 2RC4A 5K09A 5C9ZA 2ZZKA 4UVCA 3LPMA 3CUQC 2UYQA 2OKCA 4POOA 4MIKA 5EHIA 1R18A 3ZP5A 3OZRA 5ICEA 2B9EA 1RI1A 5LSAA 2Z6UA 4P9FA 4R1HA 5E1OA 4FR0A 4IKPA 1XN7A 1IN4A 3GEZA 3ER8A 5ILSA 1UB9A 2OU2A 4Y30A 2E7WA 3TO7A 4GOLD 4ENMA 3SSMA 4V0QA 2O57A 1NV9A 5BMZA 2VBWA 3SXJA 3LDGA 3FYCA 4A6DA 2FMYA 4OIRF 3IL2A 5GINE 2MBFA 2H6BA 2B3TA 4IHTA 2JJQA 3NDIA 3CTAA 1DL5A 4JK1X 4FSXA 2VBZA 5FWDA 4UHTA 2EJTA 2PXXA 5K01A 3EYYA 1WY7A 2OQGA 3VSEA 3IWFA 1O3QA 1LEBA 1OKRA 1TW3A 1R8YA 1YW8A 4A0YA 2IW5A 2R7DA 4P9UA 2J5PA 5EVJA 1ONVA 4RTSA 5LGUA 3R61A 5FFZA 4GYIA 4RS8A 2IP2A 3DKWA 2DO7A 2EFPA 3RPUA 4YV0A 2P7HA 4UNOA 4XCXA 3RW9A 5A2QK 4AZVA 5K0JA 5B1SA 3GYHX 2KJBA 2MD5A 1KU9A 1H9GA 5GP1A 4DA4A 1YZHA 1KP9A 2IRFG 5HLIA 4S04A 3KZZA 1JG1A 2CQKA 1W7PD 4G7OF 4AIJA 1G6Q1 2R6ZA 1UCRA 3QAHA 1W4MA 1TQMA 5CCBA 3E3VA 3ZN1A 4R8HA 1FLIA 2B0LA 1QGPA 4MEXF 4HH4A 4ENKA 2QQ9A 3OPNA 4BLUA 5HOQA 4MTLA 1J59A 4KDRA 4HV6A 3NVKI 2V79A 3OE5A 3R0QA 4HX4A 4PGHA 2CYYA 2WA1A 1JQ3A 4XSZF 4XRFA 4KWCA 1AQIA 1K6OA 5CIYA 3N97A 1WQ2A 4TV7A 3P2EA 4RB0A 3CUQA 1LDDA 4X63A 3M7GA 1MJBA 3TDZC 3GDHA 1FYMA 1FP1D 2DK5A 3DMHA 3H2BA 3DXXA 5DRYA 4P55A 2ZKZA 3TO6A 3TQNA 1O3RA 3BPXA 3U9GA 2WA2A 1Z05A 2QRVA 2O3FA 4ZYHA 3PB3A 3PS9A 5EOVA 3EUHA 1DPRA 3JTHA 5H6QA 5E9WA 2G7HA 1ZAOA 1KPIA 1MJAA 2IIPA 5CVDA 2ZLBA 4YUZA 4KMUX 5HIKA 5LGTA 4K2EA 3WTUC 4QLCU 4L5JA 4CTKA 4LGWA 1N7IA 2L54A 2FU4A 5LBQA 2NYXA 2IDKA 3BROA 3SR4A 3KPVA 1BI3A 1LDKB 3KCCA 3KR9A 3M6XA 1SD7A 4HX7A 1F4KA 2DPMA 2FNAA 5CLSA 1YG2A 3UFBA 3WTSC 3FPEA 2PWYA 2CSOA 2JPBA 1BC7C 4RTMA 2ORED 4WWCA 2YX7A 3NEUA 2AOTA 4LK0F 5HVQC 1U6GA 4L5IA 4GBED 3V8JA 2LKPA 3KQWA 4E2YA 1RIOH 1IRGA 2ZWAA 4HAMA 3GO4A 7MHTA 3HM2A 3QU6A 2CL5A 2YX1A 1YIOA 3LBFA 2ISYA 4M6YA 2WC2A 1JQDA 1L3CA 4FGZA 3EGEA 3FUXA 2W24A 1QO0D 4HQEA 2XAFA 1KXZA 2P7CB 4WXHA 3QRFF 1IF1A 3KPJA 2UZ4A 2CFXA 4CKCA 3DTNA 4KIBA 4GCVA 4HBLA 3ISPA 4FT8A 2H27A 4E31A 4M9XA 3IYLW 2P8JA 4C06A 2W57A 3QU3A 4NQWA 2VZ9A 2AN5A 4AZTA 1IN6A 2UXNA 2ZZMA 1BI1A 3Q9VA 1OPCA 2Q2EA 3E8SA 1F9NA 4OA8A 3F6OA 1BIAA 2HYGD 1P4WA 4M71A 2D2WA 3HUGA 2LNBA 3S68A 4Q47A 2VXZA 3ERCA 4X1OA 2CW0F 5ILUA 3DXZA 1ZHFA 2A5YB 4EJVA 2RV8A 3KQTA 1G4DA 3MEXA 4MTEA 3OOPA 3PQJA 3TOBA 3MTIA 3UJBA 3Q5FA 3CUQB 4QQKA 2N47A 5P8WA 1R1TA 4F85A 3G5LA 3KP4A 4OBWA 3IEIA 4ER0A 5FHQA 4KW7A 3EEYA 2EA4A 4NHJA 1V39A 2ZBQA 1FBSA 4E2XA 3MCTA 2GA2A 5DD8A 3F22A 1JTFA 2HV9A 1PP7U 2MA3A 3DOUA 1B42A 3B7PA 3QP5A 3FM5A 2P4WA 2GH1A 1KGSA 1J9IA 3HVIA 4YUWA 3B73A 3EVBA 1U5TC 3IRQA 1BI0A 3HHGA 2X4HA 2Y1WA 3WG9A 5K5OA 2OD5A 1OR7A 3F3XA 3GRUA 2YVLA 3OZTA 4IV0A 2LDUA 1G60A 2BZGA 2ZVJA 3LAJA 3ABUA 1NW6A 1VLMA 4HG2A 3V97A 5LR6A 4JXJA 5DRTA 2CWEA 2FSWA 4PIMA 4MTDA 3HCCA 2AOTB 1S7AA 3JWIA 1U2WA 2DPDA 3LA7A 1J5YA 1QPMA 2BBYA 3TFWA 2PX4A 3KP3A 2WV0A 5DEQA 4E2ZA 4EGZA 2STTA 3TO9A 5DT2A 3OFJA 3ULQB 5FADA 4DCGA 1UFKA 1PDNC 4YV1A 3GU3A 2ESNA 3DPLC 2GZWA 4PCQA 3FTDA 1UHWA 2PI0A 4ETSA 5CVVA 4CKBA 2JSCA 3SSOA 1FBUA 1YS7A 2D1VA 5DCMA 5FWAA 3C18A 5FO5A 3GW2A 2XYVA 3MQ0A 2CGPA 1U78A 4HLYA 3HCFA 4LLLA 4IVNA 1W7PA 5EZSA 3K0LA 5HIJA 2PMHA 1ULYA 4ENJA 4X41A 2E1NA 2VOOA 1M6YA 1HQCA 1B4AA 1T98A 3HVJA 2OQRA 1DUXC 3MTEA 2VONA 1RI5A 4RTNA 4GEKA 1KPGA 1ODDA 1P92A 3KR2A 5LQCA 5EKXA 5KQSA 1KQ8A 4KYWA 3C6KA 2P8TA 2O05A 3PT9A 1XD7A 2UYHA 2XUBA 3WTZA 3K2ZA 2WK1A 4HA8A 4L0ZB 1FJXA 3CO6C 1WWXA 4H0NA 1FOKA 5LHHA 4G7ZF 2ADUA 4RVDA 2FOKA 2GAFA 3HIFA 3WU0A 2PV0A 3DR5A 4MWZA 1G3TA 2IT0A 4RX1A 1G3YA 3C6MA 4Q4ZF 1SQGA 2NP7A 4HSGA 5IH3A 3QP6A 2XROA 1J0RA 3G89A 3TOSA 3I0TA 1O57A 3EVCA 1IUYA 1U5TA 2EFNA 1VTNC 2KJCA 3WTXC 2FMLA 1NKVA 2AN4A 1ZREA 4YFKF 4E70A 2QQAA 2MH9A 1R74A 4OX9Y 2GLUA 1YUBA 1S6LA 2E1CA 2NXNA 2HDCA 2YXEA 2ZBPA 3KPYA 1G55A 2XIGA 3EVGA 3D5LA 5D5XB 1YW7A 2VE9A 3FMSA 4KIFA 4RGUA 4AIKA 1FNNA 2Y0MA 3B3FA 1WG8A 4BLVA 3I71A 2I9KA 2NNWB 4KICA 4LECA 4MNUA 4HGZA 2DK8A 1RI7A 1JG4A 5CVUA 3CLOA 2XVMA 3EMBA 3L9FA 5EEGA 5DCFA 5LHGA 5HFJA 2M87A 3KFWX 3MZYA 1XXLA 5EQJB 3I58A 3V4GA 5LQNA 2IA0A 3B3JA 3M6VA 1ZYRF 1K79A 1F3LA 5DCMB 2IBSA 4U0YA 2AN3A 4KVZA 2JPCA 3C0KA 3UJ7A 4M6XA 5L3GA 5E17F 2OXTA 4E32A 3GFJA 4OIPF 5FLXK 4E33A 2VC0A 3V7RA 1G38A 2F5CA 2B78A 1W7PB 4HTFA 1YO5C 1YW9A 2GA1A 4CKEA 5TJJA 4PONA 1RNLA 1H1DA 1XVAA 4M37A 4U7DA 4NECA 4PYJA 3RDIA 4HF2A 5GOZA 2W25A 3T7TA 1O9HA 3GCZA 5F2NA 4YIFA 3VC2A 2FE3A 1TQPA 3A27A 4QVGA 2VP3A 1G8AA 3HCEA 2Y1XA 3LHDA 3HRTA 3SGLA 3FXUA 5JI6A 4FSDA 3PX2A 4P5OA 3T8TA 4MEYF 3SSNA 2ISZA 1LJ9A 2HKOA 2QWWA 3WTWC 2L01A 2Y48A 1ZH5A 3UJ6A 4WXDA 1D5VA 4Y17A 3G2OA 3TQSA 4O6JA 2K27A 10MHA 2K4MA 3HTUA 3EVEA 4QTUB 2M5WA 1ZRCA 4DKJA 2IPQX 1I5ZA 4DMGA 5K8VA 1JHHA 3RIRA 3ME5A 1SFEA 5C1IA 1U5TB 2YR2A 2PX8A 1L3LA 4C07A 5K0FA 3J7AO 2JH9A 3GNLA 5HLGA 1HW2A 4ON0A 4EQZA 1W5TA 2PX2A 5KQRA 2XAGA 1TNTA 1SD4A 3H3ZA 4IRGA 1R8XA 3BDDA 1IN8A 3LSTA 2COMA 3P9CA 5D5UB 3GXOA 3HCDA 2IJLA 1BI2A 3S2WA 3UA4A 4GXOA 4EV0A 4I0BA 4G6QA 2JH8A 5L3FA 4QVKA 5K0EA 2IBTA 1I9GA 1YQAA 1VL5A 5DM1A 1Z3CA 4YG2F 2GPYA 2XBMA 3R3HA 2IH2A 2EJUA 3E6CC 1UFMA 4XBFA 4EJTA 5DX1A 2GQQA 1X3UA 3E6MA 4HF0A 3RKYA 1D2CA 3ANXA 2AOUA 2ZCJA 3BOQA 2DQLA 3BXOA 3MCZA 2PLWA 3PFIA 2H11A 1XGSA 3DQVC 2DTRA 3AWIA 5IT9K 3O7WA 2PQ8A 4HTFB 4QWQA 4RTKA 1FBQA 3ZMUA 1IZ1A 3FTEA 2OZ6A 1EIZA 1R5HA 4PINA 2E7XA 4RTPA 1RUNA 3HA5A 1YFLA 4L0YB 2Z9OA 4CXFA 1I6XA 1X1BA 3ZMDA 3KP6A 2AVNA 1DDNA 3G2MA 3M6WA 3GFLA 1C0WA 8MHTA 2PKWA 2QUFA 4QTTB 2MH2A 1J75A 1B9NA 1HSJA 3R24A 2B25A 3K1PA 1V3FA 1QAMA 3KU1A 1HKTA 4WCGA 3HVHA 3G88A 4YMHA 4HYEA 3OFKA 2K4JA 4MHTA 3L09A 2EWNA 5L3DA 3T1BA 5GM1A 1TBXA 4PDKA 4ESJA 1EH7A 1T6SA 1ZQ9A 2Y75A 5E1WA 2EX4A 4LFUA 1B1BA 3VEPA 1JR4A 4OQDA 2IA2A 1BKYA 1X19A 3G2QA 5KK1A 2ELHA 4N9IA 3F8BA 3F21A 3KLOA 3BGDA 3FX3A 4ENNA 3P9KA 5C0OE 5DUKA 2NRAC 2LSOA 3L2CA 1IAWA 2PJPA 2UXXA 3F4KA 1RJDA 3G3ZA 5E18F 3EDPA 2OA4A 1EG2A 2FA5A 5BS6A 1JG3A 4PIPA 4ER5A 3TRKA 4BHPA 4HV5A 4MHGA 2PFBA 5FUBA 3QPTA 3IC7A 5HDKA 1I4WA 2OB1A 4RSRA 3QPHA 2FYTA 4RWZA 1M6EX 4E2WA 2XGXA 4PYNA 2XVCA 3UJ8A 3OU6A 2QBYA 3EYIA 1D2GA 1P39A 3GO5A 1LB2A 5E1MA 3WSTA 4M74A 4DQ2A 2HKXA 2V1XA 2FBKA 5EZQA 3K1MA 1NW8A 5DYMA 1INLA 4EJOA 1Z7UA 2O06A 4RVGA 5HOOA 2YU3A 4KNYA 1DCTA 4M72A 5FTWA 2AOUB 2QM3A 3TKAA 1YFJA 1XCJA 3OV8A 1KQ9A 5EMMA 2A6EF 2FCAA 3PFGA 4HX8A 4U7TB 5HS9A 4KDCA 4OMZA 3Q7EA 1ZN2A 1XSDA 3ZN0A 1WS6A 4XUCA 2KRFA 3FMRA 2P3OA 5DXAA 4BHCA 3ZMZA 5EGSA 3BGVA 3REOA 4XLPF 1MJFA 3EEOA 1BBYA 5JUWA 2OBFA 1SFXA 4RTQA 2KIMA 1Z6RA 3KZYA 3BWGA 1IN5A 3T7RA 1K7AA 1O3SA 5HS8A 4C4AA 3I53A 1BM9A 4RB1A 2JHAA 1Z9CA 3E7PA 3PLAE 3GGDA 3K6RA 3KHKA 4XUDA 3FPHA 2JT1A 3BWYA 2OZVA 2L4AA 4EKIA 3RKXA 1D3YA 1R5GA 2HMYB 4LG0A 2LD4A 3DXYA 3LWFA 3GVAA 3AXSA 1L0OC 5F6FA 2PBFA 3A7DA 1HKQA 3SXYA 2FEZA 2WTEA 4GOOD 3HRSA 4HOBA 1KA8A 5E1ZB 1U3EM 1KIAA 3LKDA 3SMQA 5ED4A 4M36A 5E8RA 2HEOA 2IDJA 3WTTC 4OIQF 2O0LA 1Z1DA 3M8EA 4R6WA 4IRHA 5DTRA 3HOTA 1TTYA 2P3QA 4C04A 3C3WA 5BQTA 4KA4A 2RGVA 2XKOA 5FLXZ 2BR5A 2NXJA 3RIEA 5DM4A 4ASNA 1PP8F 2DFIA 1FWZA 4OIOF 5T6BA 1XGOA 4M9SA 1J7KA 2DAOA 1UWVA 1KU2A 5AIQA 4GC5A 5GIPE 3P9NA 4FX0A 2IGTA 1WRJA 5JFRA 3KEQA 3ABTA 3FMQA 2QBYB 2NAZA 3JW4A 3BWMA 3KQPA 5ERGB 3GX4X 1XGMA 2EV6A 4CDGA 2XHKA 1L9KA 2XAQA 1NT2A 2QENA 4O3MA 1B6AA 5K0NA 4S05A 3EVDA 4Y2HA 1SMYF 3HTXA 2ADMA 2VE8A 3UJDA 4KMFA 2B2CA 5D1HA 4HDVA 2H00A 2NXEA 2ONZA 2AOWA 2ZIGA 1QZZA 3GIWA 3MGGA 1VP3A 5G02A 2M45A 4F84A 2V9VA 3FTFA 1Q1HA 1XDZA 2NNYA 3LQRA 1XSVA 4CYDA 3Q87B 3P9IA 1X1DA 3E6BA 9MHTA 4CICA 4P58A 3P2IA 4RTJA 2FRHA 1MHTA 3OE4A 4ZZDA 3HEMA 3K9TA 4PYOA 3ER9A 3R6TA 3FTCA 1ZARA 2BGCA 4CZZA 2CMHA 2UYCA 4EM2A 4FX4A 2QRVB 2ZW9A 3LFKA 5LRSA 3P71T 5IT3A 2DULA 2GAUA 4L9VA 1ON2A 4IRIA 3F8NA 3DMGA 1XB4A 4LMYA 2ZSUA 2CMGA 3P7NA 2CWWA 4PYKA 2P5KA 3ECOA 1ORIA 5HS7A 4LG0B 1BHJA 1SMTA 1O7LA 3Q9SA 2HFHA 1SUIA 2UWMA 3CJQA 2ZMEA 2O6GE 3E5UA 4AZWA 4GYGA 4I7HA 1SUSA 3G8BA 2PT6A 2XRNA 4RTRA 1BN5A 4PGGA 5GIOE 3ZMTA 4BY9E 3PQKA 3VODA 3EVZA 3DPTA 4RVHA 2I6GA 1IRFA 5EHGA 2GXBA 5D1NA 3KP5A 3TDUC 1R7JA 5K05A 4IXAA 4IHSA 4ER6A 2P5VA 5IT9Z 4JBAA 2NS0A 3L8DA 2R3SA 4L9JA 1WSUA 2P6SA 2AVDA 3ELWA 3FUVA 5E8GA 4LB5A 3HA3A 5FQOA 5EEHA 4IF4A 3GLXA 3N4MA 2YX4A 2GWRA 3IKVA 2RKHA 2BR4A 2YXLA 4RYLA 2A61A 1BC5A 5DWQA 5ICFA 1FZPB 3ZQ7A 3DV8A 4B09A 3C3YA 4Q48A 2FBIA 2QYOA 2VODA 5LQKA 4YFNF 3DLIA 5D4SA 3B5IA 3LDFA 5E8IA 3BUSA 1F1ZA 1SFUA 5L3BA 3KLNA 3R0AA 1R6AA 3C7JA 1USSA 3D0SA 2EK5A 4I98B 2PBIA 3TKYA 2I62A 1IXSB 2UYOA 1REPC 3PVCA 3F23A 5DLYA 1TW2A 5FULA 2QE6A 2UZKA 1H9TA 4I09A 4OQEA 4HW0A 1ZRDA 5EC8A 4BXUA 3L00A 1ZKDA 2C7RA 3ID6C 1KHHA 5EMJA 3M33A 3IHUA 4LJZF 2JHPA 1KU3A 1EJ6A 1VPTA 2ONYA 1NBHA 5DTMA 3AJDA 5EKUA 2IA1A 4BYYA 1XDUA 3BY6A 1Q0TA 5FD5A 4A5MA 5H6RA 1O9GA 1JXSA 4BP3A 5LHIA 1NHAA 3NVMB 2EFOA 2G71A 4ISCA 1IXRC 2H6CA 4MQVA 2HQRA 2QQBA 1NW7A 1XGNA 5CVRA 2A14A 3GWZA 4HC4A 5D8LB 3NWEA 1U8RA 2FQ3A 3BKWA 5ERIA 2BEOA 1GVJA 4UVBA 2QLZA 2ZMEB 2RN7A 3EQLF 3T0IA 4G7HF 2G1PA 3HSEA 1N7JA 4OOIA 4AZSA 2NYUA 5EMLA 3M4XA 5BW4A 3LL7A 5DM2A 3GFIA 2H09A 2M8EA 4LD5A 4UV9A 5D4RA 4F7ZA 2PSSA 3RPQA 4GC9A 4RTOA 5D5WB 5JHUA 3DUWA 2DBBA 1MKMA 4L18B 5FD6A 1CGPA 1T38A 1R58A 3GRVA 4FP9A 2XV4S 4FS8A 2F5FA 1XCLA 3WE2A 5E2BA 1USTA 5FB2A 1B59A 3X0DA 4U88A 2AXLA 3IKTA 3AY0A 4A0ZA 3EGVA 3FPJA 2YSRA 5GM2A 3KQOA 3CO7C 2E5WA 2PMUA 2L4MA 4R8RA 3SX0A 1X1CA 3KP7A 2RVCA 4EK9A 4CGZA 3HVKA 2EV0A 1O3TA 2Q41A 1MJ9A 4ZH4F 3NDJA 3KKZA 2R7FA 3BWCA 1BC8C 2OZUA 4IWNA 1JHFA 5AONA 4R8SA 1LDJA 3GF2A 3HHHA 1L3IA 1T39A 1L1EA 1XSXA 2K7LA 5FCDA 2A68F 2P5LC 2HOEA 3IHTA 4CTJA 3ROUA 1BOAA 2GB4A 1ZG1A 2ACJA 4EMSA 2P1DA 3LQQA 4U0VA 4ZTBA 5EMKA 3BKXA 4ER7A 3HSFA 4RGSA 3GZ6A 3EGIA 3F8MA 3D2LA 1RJGA 4I2OA 2EG5A 2ZJ2A 4BHBA 2DI3A 1XTPA 5CVJA 5GWXA 3NWBA 4QQNA 2GA9A 4PCLA 5DTQA 4R05A 3KQYA 2YPRA 5L3EA 1Z91A 1FX7A 4M73A 4AIHA 3MAGA 2EFQA 3AXTA 2VOPA 5J8CA 3CBGA 1P1CA 2AOXA 3A26A 2KIFA 1G6NA 3KR1A 3E05A 2VC1A 4KRGA 2PJDA 3DULA 5DX8A 4O5VA 2I7CA 2FRXA 4X60A 1YYVA 3R6SA 2IPXA 4HDUA 4WF2A 2PG4A 2H1RA 3FPFA 3P8ZA 1QQIA 3O4FA 1K78A 4QPPA 4DZRA 4C08A 4X61A 4LB6B 3ECHA 3NTVA 4EKGA 1MZBA 3U2RA 3IV6A 2Q8KA 2VT3A 3WE3A 3RTRA 5T64A 1JE8A 3JAMK 1SAXA 3RI4A 2CG4A 3JTGA 5CM2Z 2C7OA 5CCXA 4EJUA 5K0GA 3MAJA 3F8FA 1P4AA 1SVUA 3TR6A 3C3PA 3UBTA 1UHMA 4C05A 4Y13A 2JHCA 2JG3A 3G7UA 1S29A 1OYYA 2V74B 2AR0A 3ELDA 3J81K 3E6DA 2NP6A 1YTYA 4AUKA 1WXWA 1UIRA 4WK8F 3TLJA 1R1VA 3OZSA 2MLKA 4ZZLA 1PRYA 2HYFA 1WI9A 5E9QA 1JG2A 2D45A 1AF7A 2XAJA 3UA3A 5K03A 1QYRA 4RVFA 1MDMA 4LLNA 5HILA 4OBXA 2FF4A 5FQNA 3W6JB 2OPBA 4LLGF 4GF5A 2Q0OA 3O6BB 3HSRA 1IXKA 3ELKA 4JQFA 4F86A 4IPAA 4FZVA 4EM1A 5D6EA 3GRZA 4DNCA 3UWPA 2ZTHA 3M6UA 1CF7A 2AS0A 2IFTA 5E8JA 2OB2A 2OAZA 3K69A 2XYQA 3HP7A 3U1DA 4CWAA 3AAFA 3LECA 2ESHA 2V6CA 4G9YA 2WWYA 2NXCA 2PGXA 1MD0A 2L3DA 3W6KB 2F2EA 2A69F 2DW4A 3EPPA 4UUVA 2ZULA 1KQ0A 4AD9A 4ESFA 1T43A 3E23A 1ZG3A 2DQRA 1TLHB 1XMKA 3DEUA 1S8NA 1TQIA 4L9NA 1ZRFA 1VP9A 4BQAA 1I1NA 5LEJA 3KQQA 2PLYA 2CKDA 4LWPA 1EH8A 3CCFA 2HZTA 4QPNA 4MQ9F 1YF3A 1BJAA 2JTVA 1YLFA 3G2PA 2BYVE 1K78B 3M1EA 4R6XA 5BW5A 3CDHA 2ZBKA 1JSZA 4KN4X 1LNWA 3PX3A 2FK8A 5HDNA 1ZLKA 2XYRA 5D5VB 3H3UA 3E5XA 4DF3A 3R9XB 4PYMA 2IH4A 3WGGA 3VYWA 1FPQA 2O07A 4KDPA 1KPHA 4BNCA 2CO5A 3DP7A 5JVTA 1RI2A 4YUVA 1IM8A 1D2HA 2PWPA 1XDSA 1RUOA 3IWZA 3HTSB 2ZIFA
chains in the Genus database with same CATH superfamily
1Q20A 2I6TA 5CT4A 3RYTC 3G1MA 1NF9A 4R40A 1A9PA 3FK7A 5J5VA 5IN5A 3EW9A 3T3PB 4NG4A 3K7AJ 1UZLA 4G41A 1G0NA 3V42A 2EL7A 3E7DA 1PT5A 5CD1A 2R93J 5DM70 4P7GA 3GLVA 3TIIA 4LHVA 1NLUA 4W82A 3VC1A 4E21A 1HA3A 3W2FA 4RQAA 4M1SA 5F73A 4D9BA 1QNTA 4MRMB 5K7ZA 2JI7A 4G2TA 2HQNA 4BFWA 3I2JA 5ADWA 3U7EB 4LE1A 1HBXG 2NO6A 3NHLA 4YUYA 2CNNA 4LYDA 5C18A 1Q0UA 3PFCA 5DN6D 1WPGA 3BZBA 3LX6A 4IGFA 1AH2A 3F78A 5F1RA 4FTHA 5A4FS 5FI3A 4I36A 3NHJA 1LTQA 5KSOA 4Q4AA 1TC1A 4UE6A 2EV9A 1QAOA 2AKYA 5IYBJ 2FWAA 2PH1A 1K0FA 4RD0A 4QO8A 1K5DA 1NFQA 1I7QB 1HFWA 3V1KA 1PE0A 1NJFA 2NOGA 1EGMB 2B4QA 1D1BA 5DO9A 2P9HA 2WBLC 2DFPA 1XPRA 1P60A 2G25A 4KK3A 4RAOA 5C80A 3ONEA 3IO3A 3MWEA 2GHRA 1NZDA 2GHTA 3EFBA 2DQKA 4CN9A 3CEAA 3OC0A 2PL5A 2NWQA 2M2IA 3LS2A 3Q2OA 4B8ZA 1F5NA 1P8JA 2GVDC 4EG6A 4BQIA 3JAMZ 2OE2A 1JYEA 1MBZA 2BM0A 1HDOA 3NOXA 3KETA 1J2JA 1CUBA 3JQAD 3R2JA 4RMHA 5T8KA 2Z6QA 2QY6A 2LF7A 3FCCA 4I5GA 1UBUS 4WUVA 4KIWA 3HJFA 2W43A 1M6VA 2E4WA 1QU2A 3B53X 3ADDA 5ALWA 1SPXA 1RIFA 2VJQA 4HDAA 1QKJA 3O8OA 3RGGA 2OC6A 4ZK2A 3UENA 2ZUSA 4IL5A 1DX9A 1F0KA 3Q8WA 2AHOA 4TWIA 1XAGA 2GTHA 3FSRA 4DZJA 3P0RA 3S1LA 1RBZA 3F5QA 3LOCA 1T3TA 2BY2A 1YBMA 5F2OA 1Z6AA 3NV9A 2O2IA 2PMEA 4JQYA 4JGBA 5DX0A 1WB4A 2R5ZB 4GPEA 3OT5A 3RSLA 4L78A 4WLEA 4Q19A 3EGXA 2KT0A 3B89A 2W48A 5DOVA 3FKSA 1BS1A 4OU0A 3GLTA 3ZWXA 1RKUA 3DZ8A 4DDHA 4WXPA 4P5EA 4JJ6A 1O6GA 4P22A 4DRYA 2F3SA 2MMCA 3L9WA 3N6VA 5CCEA 1NK2P 1WKBA 1JI3A 4GZMA 1G21B 1BKDR 4HQNA 4LYJA 1X1RA 4ID9A 1UF9A 1EX6A 2FXAA 5CLGA 1KBOA 3I6BA 5KAMA 5JAOA 2EW2A 2XQJA 5L3CA 5AXAA 3DZGA 1I3NA 4KMOA 3II6X 4B3CA 4MS4B 2GO1A 3L6UA 4BACA 1WQ3A 2BGLA 1RE0A 5F2KA 4AS3A 1PJRA 2YQZA 4F4UA 3HDYA 3OSZA 2KLOA 3BC8A 2G08A 3QBEA 3NAGA 4Y7CA 4G5GA 3FUWA 3GFRA 1E77A 4F93B 4IUDS 2PT7A 3OCXA 4LG1A 5TMPA 4C2BA 3DP9A 3NAUA 5EA2A 2G5CA 3OD1A 2G4LA 2C61A 2YJTD 3BRWA 2EJRA 1A6QA 3Q8MA 2JK3A 1LSJA 5GAEJ 3TIXB 2RIPA 1ZNWA 1PFYA 4LHEA 1CRLA 4H6WA 1PS8A 4FE3A 1R49A 1BOOA 2P41A 2BE5F 4XFDA 1SKMA 1TYZA 4PCAA 3N2ZB 5DPMA 1PNOA 4BNDB 2ZTMA 2FWMX 4DB2A 3CCVI 2YYYA 4OMCA 3M2PA 5FXMA 3ZR8X 2J45A 1IEWA 4ESOA 5E1XA 3U3JA 4D74A 1P2DA 2FWRA 4ZAGA 2GD0A 3EA5A 4OYLA 3F6VA 4D9FA 1O96A 2W2LA 3NW9A 2TS1A 3WZLA 4GXRA 1E4YA 3EIUA 2FRVA 4BJTA 5LL6P 4LOHA 3SS9X 4PWYA 1T33A 1NMSA 2FQYA 4MIYA 1NOIA 4V0RA 3H36A 2HTJA 2GEFA 5J1YA 3KQMA 3BR6A 1W4ZA 1PQYA 1THZA 1IK6A 5FR1A 3ESAA 2OO7A 5JLWA 3QY0A 4RLFA 2V9KA 2A84A 4US1R 1XB2A 1TZKA 4B0OA 3QQ5A 2QVCA 1J00A 3HRUA 1R15A 1RWBA 4GM0A 5AJZA 3KK0A 2XWBF 3TMYA 3D43A 3G1TA 4RS3A 1WCIB 1E9CA 4A0QA 1JR6A 1POWA 3HDHA 2ID3A 1FC3A 4EKNB 2YV1A 4QEZA 1KMHA 2WF7A 1RQXA 1WHTB 2YTZA 1YRNA 4BE2A 4P53A 4KE9A 4JP5A 3JRFA 4KQHA 3GLHB 2E9SA 3K2IA 3PD7A 3GEZA 1Z4OA 2VUMJ 2R00C 1M2VB 3AZPA 3TO7A 1K3UB 4Q3BA 4NENA 3THXA 3RIMA 2W6JD 4DJFC 3KWMA 4B7CA 2NU9A 2Y1GA 3LDGA 2WU1A 4J7UA 1IEQA 4Z49A 2VF2A 3NDIA 1C7RA 3M83A 4FSXA 5FWDA 3CSUA 3OM9A 2W2KB 5K01A 4N3BA 1C9KA 3OHSX 4LF8B 1LEBA 1TW3A 3ZWWA 5ICSA 1YW8A 3HYCA 3CHYA 2VJMB 2O52A 2OGZA 3ESQA 5A9RA 3KAQA 2Q28A 1G59A 3DKWA 1G20A 2EFPA 3RPUA 1T91A 1VKJA 4ZQHA 2ETVA 1WOYA 1BCRB 4MJXA 2HF8A 1Q2XA 2BTQB 1ZJZA 4Q7LA 1FLIA 3DPSA 3VTZA 3P9ZA 4R2WA 1QGPA 4MEXF 3VRHA 2VPRA 4BLUA 1B76A 4G5HA 2EFDB 1RYEA 2AI3A 3PUFA 4FCWA 4GWKA 1JQ5A 2IXBA 2NADA 2IV7A 3DLHA 1M5TA 4N5MA 1YZVA 1ND5A 1MU0A 3CG4A 3NALA 3TDZC 1G8KA 1FX1A 2ACVA 2VNSA 1B41A 2CHGA 4LY3A 4QU0A 1D7AA 2RCYA 3T7AA 2QTRA 1SHLA 4XJXA 3T4EA 5H6QA 2I5UA 5JNUA 2IGKA 3K72B 4KGVA 4XSGA 4AKSA 1X1TA 5DWVA 5LBQA 4M88A 4M3DA 3MIZA 2DPMA 2HAEA 3K3PA 3PFWO 5L3SB 5JCOC 2J5QA 2PWYA 4B4KA 3MJVA 4QASA 2FW6A 3N2YA 3RTDA 2JPBA 2GI4A 3ZGXA 1XMSA 1T0BA 4HNTA 4WNIA 2IODA 3OTOB 5JJKA 2SICE 3DTEA 4TTTS 4N0PA 1M1NA 4BGDA 1ECGA 1GQ2A 1EXNA 2IYYA 1J09A 3K0CA 1HI9A 5ALPA 4IDQA 4HDKB 1RXIA 2Z1DA 4IINA 2WWTA 4OSPA 4ZA2A 3ETEA 5T6MA 4E31A 5B1HA 4XL9A 1GYRA 4LZOA 1BW6A 4KQJA 3S2SA 2HL6A 1GADO 4NQWA 1JEOA 1Y8RB 2MFZA 1ERDA 4IIXA 2JLSA 3QLUC 4MZDA 1P4WA 4M71A 1MIOB 1YR3A 3EMVA 4WLFA 3H2GA 4LTNA 2GVZC 1Y3CE 2GN0A 2WAYA 1RYNA 4L8GA 5DCWA 4KBYA 1TM1E 4RKQA 3FWHA 1C9YA 5P8WA 1R1TA 2YJNA 4ER0A 3DFUA 3EEYA 3V8NA 4G8BA 5ESDA 1RKQA 3RAFC 5EIBC 2I80A 1Y6QA 2CY0A 2GKOA 3ZWKA 4K6FA 2P4WA 3SIXA 5HKAA 3CC2I 4LNUB 2R5YB 3N0TA 2DQSA 2BZGA 5LR6A 2HHJA 3EYWA 1N8KA 4BRSA 3N0RA 5J2TA 3SK0A 4XRGA 5AICA 3GJRA 3TFWA 3S8YA 5JWRA 3AFHA 1ZIOA 3M3PA 4B4OA 4J16A 1EH5A 3N0WA 5JI3E 3GU3A 3WRXA 4D25A 1YDHA 1QR2A 3ZX5A 1KYXA 3HUFA 4BNTA 4H3SA 2CGPA 5BSKA 3HABA 2FGJA 1W7AA 4DR2B 2PMHA 2AV6A 4QICA 4ARIA 4MKRA 1IPEA 1UFRA 2QD1A 2QUZA 4TTJA 3VUEA 4P34A 3MSCA 3ZX4A 3MTEA 3Q3EA 1Z4NA 5TQJA 1LDMA 3F6SA 4QUIA 1ARZA 1F6WA 2P4EA 2GDJA 4PZLA 1T0FC 1W0UA 1NW4A 1UBLS 3K4QA 3L0SA 1TI7A 4LMAA 5I7RA 3CPHA 4LRXA 1LBEA 4AECA 3WGMA 1FLVA 1E2DA 4PNHA 2ZB7A 2C3YA 2V7TA 3O93A 5JSQA 4HB3A 2QTLA 2E4UA 3BWEA 2RKBA 4WK2B 2E1CA 2NXNA 3T38A 2ZBPA 4LXHA 1G55A 1YBVA 4ZPJA 5AI6A 2NAPA 3EVGA 1NJSA 2X9DA 2AF4C 1ADJA 5KAPA 2VRNA 3E61A 4WZBA 4D4LA 4R1TA 1Q1EA 3ZHQA 1WABA 5LHGA 3PL5A 3KFWX 2P4QA 3V2GA 4A92A 5LQNA 4QHYA 1G291 1PG5A 4U0YA 4AZ3A 4F9FA 4HXFB 1LNQA 3DMNA 2F5CA 1YO5C 5IASA 2RGNA 3U0VA 4XCVA 1DHTA 3O95A 3PK0A 3HCEA 5A3QA 3HRTA 3SXUB 3EQ9A 2DSTA 2UUOA 2FPPB 1ILWA 4MEYF 5G1NA 1BEZA 3LKVA 2CVQA 1LH0A 4A5OA 4EP1A 2WICA 2NQTA 2JLBA 4I4TF 2ZROA 1SCAA 3CZRA 1UC8A 3RIRA 2C04A 3ZS8A 2IEKA 2ZTVA 4NCKA 4Z1OA 4D99A 3J7AO 2BJHA 3QXCA 4HNSA 4IHAA 3LSTA 2REQA 5JZVA 3OYBA 3PEEA 3EDCA 5B3KA 1X74A 4J91A 5K0EA 4CG2A 1E0SA 821PA 1NATA 4A8TA 2Z95A 4DV4B 2ZE6A 1CD5A 3H6HA 2AOUA 2VKTA 1C0KA 1BA2A 2X2OA 3PWKA 5DGXA 2FEKA 2YICA 4AWAA 1YL6A 2JIQA 4KUHA 4QWQA 3JATB 2POCA 1BH6A 1RC9A 1TYAE 2C20A 5B7GA 2HF2A 3AP1A 1HZZA 2V7GA 5B58C 3ZZNA 5CX1A 4ZMBA 1TMKA 4FLMA 4YCSA 2VP5A 4RBNA 4XRMA 4OWRB 1T9KA 2L82A 3K1PA 4A3FJ 5E3NA 2R60A 4BC0A 1NYTA 1WKCA 4NPHA 5JAHA 2XQKA 4ISBA 1NFRA 3N2NA 2YJZA 5K6AA 3ZVLA 3F8BA 4FYHA 4TLBA 3PIOF 2OORA 3A4YA 3B6AA 2AZ4A 1XC7A 2ZRKA 4MICA 4N5IX 3D54D 2DU8A 3N59A 4K05A 1U7HA 2HPHA 2R92J 2C2ZA 4X7MA 2QGFA 3G0OA 2BI4A 5DNDA 1CR1A 1LB2A 4L4ZA 3BFVA 5AVVA 5FBKA 1JEQB 1Q50A 3AUTA 1AHNA 1YFJA 2QM3A 3TNFA 3MJCA 3OV8A 1TGYA 1QE5A 1W9MA 2ZREA 3QVMA 5ALSA 4PG4A 1ZN2A 1OLTA 3ZN0A 4G0PA 5E3OA 3HJRA 5JAZA 2DMQA 3FYTA 3HLTA 4BQPA 1XK7A 3REOA 2QLFA 3EEOA 1ESDA 1BBYA 5EUBA 3HP4A 2OBFA 3WG7H 4BNLA 2KIMA 1ZCBA 2GN8A 3IDFA 1KEEB 2LCIA 3BWGA 4KSBA 4UHCA 4DLKA 4NSNA 3IPYA 1KDPA 4EGSA 4FWTA 3PWSA 1TD9A 2WUWE 2REOA 1U8FO 2EZUA 3ZTYA 3N0XA 2FTKE 1D3YA 1Y33E 3KT8A 2VJKA 3H2YA 5I7HA 2CXOA 4XB2A 4E6PA 5E6UB 5B1AH 1N3BA 1HKQA 2DMTA 4P3KA 2JGIA 4MV5A 3VO1A 3KOZA 1VLVA 4JX9A 4YEJA 2DDBA 2FUNB 1NNI1 3GLIB 2CLCX 1XR3A 2O0LA 4IHYA 4BFLA 2BGGA 1ZH8A 2BR5A 4S1VA 5DM4A 1LPAB 3V7NA 1DQNA 3BMOB 2VNIA 5ALYA 1XGOA 3GLRA 4XRSG 4Y9RA 2UXBB 3MWKA 3W1VA 4TN5A 3FMQA 2QBYB 1UMQA 3RS0A 4WOBA 3H0GJ 2XHKA 4Q5IA 2XCIA 4WK4B 1U4NA 2E19A 1TJNA 2ATVA 4JUIA 1SNYA 4KMFA 2B2CA 1B3BA 3HN2A 2NXEA 3CRQA 4PZDA 3DDZX 2WSBA 4FCCA 2VI6A 4XGIA 4F84A 3GZNA 3P5SA 3AJAA 1XDZA 3Q87B 4CLRA 1KEPA 3S3MA 5KTTA 4RTJA 3QE9Y 1Y3AA 2ZQZA 2P78A 2XDWA 3UGKA 2Z2JA 2XOKA 2X6RA 3SNHA 1Q92A 2F2TA 3I4LA 3QXGA 5EE1A 2Y6VA 2P5KA 2FP4A 3KB8A 4NR0A 2CEAA 2P9QA 1JKPC 4ZVPA 4RTRA 1XA4A 2VPWA 2VI5A 4OVKA 1MFZA 3W5VA 4IHSA 4CR8A 1LBHA 1IBMB 3UYLA 4HAVA 3CEMA 4FYJA 3K8ZA 2GWRA 4ZAVA 1FP6A 1YDEA 4B09A 4U0JA 1HDXA 2FBIA 1E7WA 4YFNF 2QNIA 1GVHA 1Z22A 5E8IA 4Y2XA 4L3OA 2VNHA 3BTSA 3SKXA 3GZ4A 1RPAA 2I62A 4ZANA 3LSJA 5CT6A 4K03A 4RGYA 3QW2A 1JZTA 3OOEA 5J40A 4GI1A 1KORA 4IWYA 2WKQA 3IHUA 4XYBA 2QN9A 3AF5A 1KU3A 1EJ6A 5IAKA 3ZC3A 3F6YA 1NMYA 1Q3KA 1VPTA 3A9UA 1V11A 2DCUA 5LHIA 2EFOA 4ISCA 4WK6A 4MIOA 2H6CA 2L7KA 4MWGA 2FQ3A 1OPXA 3I6IA 1PV1A 4I1YA 5AHXA 3Q3HA 1E32A 3CMYA 4TV8B 1N7JA 5IH7A 3S1RJ 2GPTA 1QOZA 4HH3C 3IPRA 4FOTA 2AE1A 4UV9A 4NOMA 5KREA 1VMDA 4UBJA 5JHUA 3DBHB 1ESZA 2PSDA 1YI0A 4CCYB 2H1KA 2A78A 1E1YA 1RWOA 1GU7A 1OU0A 1HE2A 1EHYA 4M1KA 4GZ5A 1Q57A 3EGVA 4JKYA 4X7RA 3VMFA 3W5CA 4J76A 1WIWA 1UFOA 4EK9A 2EV0A 1JLRA 1JT0A 3LYLA 1V48A 1OQYA 1QZXA 3M4JA 2AMFA 5HBGA 4HH0A 5ENDA 4CTJA 5L7TA 1AO3A 2REBA 4HB2A 4I1VA 2BMEA 1WEKA 4QXRA 1Y1WJ 2NPOA 4MV9A 1S4QA 2BELA 2HLNA 3M1YA 3VGJA 2WAQN 2H1RA 1BU5A 2DCMA 3JD3A 5AW1A 3NBMA 5FKKA 1KO1A 3O3CA 4DZRA 1R5OA 2I9PA 2IEGA 2X3UA 5BXQC 1A5AB 1WDKA 2GDZA 2IHKA 1K9VF 3OQVA 1PVDA 4QPOA 2C9DA 3TLZA 5J59A 4UU8A 4PO9A 3JPYA 4YJ3B 2DR3A 3NBFA 2V74B 2AR0A 3FN4A 3E6DA 4G85A 3SI7A 4MNTA 3TVYA 2Z8ZA 3WLTA 5G0WA 2QPAA 3W8EA 5HNKA 1KVSA 5HVNA 1WI9A 3T1NA 3UA3A 4G1UC 3NHFA 2JLXA 2KQUA 2I29A 4R84A 3JAWB 4P8RA 3TX6A 2FA9A 4JJFA 3CMEI 1Y6IA 5E7JA 1XMIA 3VPGA 4YLYA 3WB2A 2XYQA 4RXTA 3C5CA 3RQSA 3J80A 3HYRA 2Y9MB 3VPSA 2XSJC 3T7DA 3K1AA 4MVJP 1SUCA 4HGPA 2Q4TA 5DHAA 3KIPA 1XMKA 4YR7A 1PSDA 2AQ8A 2NXWA 5BN4A 1GRNA 1YLFA 1JEJA 2OAP1 1LI7A 4ITUA 1ODTC 2ZIXB 1F06A 1LNWA 3C45A 3LPAA 3OEHD 3LY8A 4CL2A 3EB9A 3KKPA 2O07A 1BS2A 4RHTA 1M2GA 1W4RA 4O8ZA 1SXJA 4PFKA 4OI1A 4FGWA 4FJ1A 5EWLA 4B43A 1NVGA 4TV9A 2GBIA 1ZNZA 3FKQA 3CJNA 1NVTA 2YWBA 5EE5B 1CQZA 3K6SA 4YRBA 1QRTA 1Z0JA 3I30X 1MZPA 2WV1A 4Q4DA 2P40A 4D5EA 4ZHQA 1I2BA 2QD4A 2AQKA 3I64A 4DAOA 1JAIA 1HA8A 3QOWA 3LCCA 2XF2A 1KR5A 3WKCA 1LW7A 2OCYC 4DABA 5BVGA 2JCXA 2VBXA 3L8CA 3E5NA 2MR5A 3UK7A 1J33A 1CJVC 4KFCA 3MTGA 4DDMA 3K4LA 3TBFA 4NFLA 2PKRA 2AC2A 1R0XA 2BOVA 2PKQP 4OKIA 4ZO4A 3WYDA 5EUCA 5KYWA 3NYQA 4CDRA 4IZIA 3IE0A 1GZUA 3TQQA 5IVIA 5BNFA 5HDQA 4DDTA 4XM0A 3Q2IA 2C82A 2FSVA 1T4CA 3L1UA 2JIOA 3HCBA 5LC1A 3DAFA 5IMBA 1Y37A 4UTOA 2Z99A 2C7BA 3OC6A 3AF2A 4RKEA 3FVRA 4L57A 3LLSA 5ABPA 3AF0A 4BMDA 4QOHA 3RS7A 2JGAA 2R7OA 4XICA 4XQCA 5LA6F 2P75A 3CF4G 1K68A 1MO2A 2ZUWA 1HLGA 3VBEA 5EP4A 5KCZA 1CPYA 2KHMA 2C6YA 2P6TA 2V54A 2BM9A 1NBMD 3OQNA 3SHQA 2BZTA 1CCWA 1U8BA 4D26A 2YR0A 5EG5A 5AI8A 2MSCB 1ISHA 3GT4A 4DT1B 2ZR7A 2AZTA 3RU9A 1SD1A 4DTCA 4Z7JA 5AW4A 5JMTA 4GGGA 1NR1A 4INJA 1R36A 2KMLA 1KI8A 3H3FA 4A27A 2I3AA 1XHLA 1U4SA 2QSZA 4Q9IA 3CJTA 3R7LA 5DIZA 4QQRA 1SD5A 4HDMB 3KFLA 2P4SA 1VTKA 2XMDA 3IT3A 5L3QB 3AP2A 3NWTA 4ER3A 3FF5A 4HPQA 1ZGZA 3A6FA 2AOVA 4ZAFA 3FNIA 4Q1FA 1ZONA 4G8XA 5JLXA 2QYTA 4CXMA 3HRMA 2YNMC 1BEEA 4HLXA 2GD6A 4LGMA 3K0BA 1PX0A 3A6LA 4GSLA 3HI6A 3MWLA 4ZYUA 1X6VA 4FINA 2BV6A 3VR4A 4RZUA 4MQ5A 2MMGA 4G0QA 3PGA1 2VCYA 3Q3CA 3HXKA 1B6TA 1UMBB 4DW8A 4G0UA 1XNQB 3P9RA 3ZBUA 2GGSA 2VH1A 1FMLA 5ITWA 3TW0A 3C8HA 1O1YA 3K1YA 4XOTA 2M98A 2QRPA 4X1YB 2GJ9A 3N8DA 1KOFA 1A9YA 1WZCA 1GUAA 2R8PA 1GGKA 5DLDA 1I30A 2X2FA 3ZGZA 1N9GA 1MBFA 3PA8A 4ZZ3A 1VI2A 2M8GX 1SBNE 1GGMA 4AF6A 1ZGCA 4WX2B 1XPJA 1A9XB 2RHWA 2A0XA 4DGWB 3RUCA 4A2WA 3AB7A 2BZ0A 2M0CA 4EGJA 1EUYA 3QBVA 1I80A 2IQ5A 1DCFA 3STUA 3EVFA 5AIPA 4Q18A 1A9TA 1X7WA 4FXOA 4RSGA 1TVKB 3MJFA 1U2TA 4C78A 1ZELA 1FF9A 2C2BA 2MC4A 1HMYA 3WGVA 3DO5A 5K0BA 3FM3A 3JQ9A 4ND3A 1OILA 3G2BA 3M8FA 5DB4A 4DNFA 1SQ5A 2LBFB 3UHFA 3LCJA 3JSPA 1MTOA 1HQYE 2AJCA 4UMEA 4I9UA 3HGMA 3MD2A 3FB4A 1KEUA 4IDGA 4GOND 3T99A 5K3DA 3LVQE 4YELA 3KOMA 1GAXA 2PXAA 2Z3YA 2MYNA 2XGOA 2H4HA 2W84A 4HBZA 3GLUA 3KM0A 3H92A 1PBNA 1OT5A 4ZOLB 2AQIA 1JDVA 1WPQA 2HA5A 3FRJA 1KAOA 1IUPA 3NFYA 4WOCA 3UKJA 3NEAA 2QQ5A 4ZGBA 4HQMA 4O4LF 2Z33A 3BHMA 4UNSA 5KSYA 3RJPA 2WNIA 2TDXA 4ZQCB 3M6IA 5C4MA 3J80Z 3H4VA 3TSZA 3ENWA 1ZAKA 4N7RA 2UYQA 4WZAB 3ZP5A 3CMMA 3AKDA 4P9FA 4MDYA 3UNGC 3WYFA 2WAQA 5U4QA 1PNVA 1VJGA 2RGUA 3V2UA 5AVWA 4A10A 5GZ6A 3C8ZA 2OO5C 3E3AA 4A6DA 1G9XA 4QARA 1XYYA 1M33A 3IESA 1XVVA 3PL8A 2H1CA 4FFBA 3FD8A 4NCHA 4HZGA 4I3FA 1HOTA 4WOJA 3R8FA 3C7AA 4UM9D 1MHPA 2IYEA 2I91A 2GZ3A 1MV5A 1IY0A 3PQ2A 3PL1A 3CLTC 2A0FA 4YV0A 1GZ4A 2FJUA 2G17A 2HMAA 4KH1A 2MOKA 4AU1A 4AUNA 1W47A 4DA4A 1SD2A 1XMXA 3U3XA 4JXKA 1W4MA 1TAUA 2BW0A 1W30A 3DT6A 4OHKA 4EUEA 2HMWA 2WHRA 4ENKA 4A8HA 5C4XJ 3DHEA 1M8PA 1BMFA 2Q3JA 5CLJA 4HB0A 3H65A 1LFUP 4UCWA 2A58A 1PZFA 1EA5A 2QN7A 2W4MA 4CM5A 4IHKA 3P2EA 1ZM2A 3GEEA 3WKBA 1LDDA 4P55A 1ZI6A 2HOSA 1F6BA 3MYRA 2WA2A 4X8MA 1Z05A 3PB3A 2CGEA 3SCZA 4MO7A 1XCGB 5ERXA 3RYFB 3OICA 4BP8A 4L4SA 2CE2X 2C78A 3ET5A 3OIOA 5LOVA 2D5AA 2FNAA 4Q7EA 1H6BA 2D0IA 4E4YA 5TLSA 2OTLI 1TZMA 1KK2A 2HA2A 4S1NA 3MKZA 3ED1A 1ODLA 5BVHB 7MHTA 1OFHA 3WTBA 3CVWA 1R5NA 4G36A 2R8EA 3WMGA 2ZXHA 4G2NA 3TNDA 4LYEA 2WC2A 1JQDA 4NDLA 3CCQI 5IZCA 2JLUA 2PR7A 5C51B 4BCBA 2UZ4A 4DAEA 5JXWA 2Q6IA 5IP9J 3PHCA 4OHBA 1PHPA 3OZWA 3ZW7A 4N03A 1EU1A 2C4KA 2WWXA 2C5BA 2FSGA 1V71A 5DGHA 4KN8A 4II2A 1GSOA 1VE6A 3S68A 2C1ZA 3ERCA 3E9QA 1NE7A 4EJVA 1NRWA 1RXWA 3G17A 1NNEA 3GV0A 2EIXA 4LAFA 3WK8A 4QODA 2X1MA 4L76A 2HVQA 3KTAA 4BJ1A 4JN6B 4AW9A 2IYVA 3U1BA 1B42A 4HWSA 2VHUA 1QG4A 2YS6A 4YAFA 2D1QA 4TVKA 1VKOA 1D0ZA 4NC8A 4H7EA 3C87A 2C4TA 4HG2A 4JXJA 4YY3B 4Q05A 2H8RA 2AOTB 4YONB 1I1HA 2YZNA 5IJXA 3DBVO 4DIEA 1F51E 4PPFA 1NH3A 2PX4A 5C8YB 3AWDA 2LKCA 3VZBA 4FR2A 1KMNA 1NVVR 2CHEA 5BWCA 5A5VA 1MO6A 1UHWA 3U26A 5D6OA 4K40A 3B6EA 1ZUNA 2E21A 5A5FA 1STOA 1XT6A 3PO3J 4LLLA 4D6PA 1XG1A 3VUFA 3K0LA 3EF3A 1OCRH 1CQIA 3GXBA 1HQCA 1US8B 5HA5A 3D0KA 3HUGB 4YMTA 1CJTC 3ND6A 3AKEA 7YASA 3BR1A 4ZTJA 3TJMA 3SX2A 1W1WA 3VC7A 3AF1A 5KNBA 1WY5A 1WVMA 1RAAA 1SANA 3BG6A 1XTZA 3MKWB 1YCFA 1QYDA 2WJGA 4F0JA 3OX3A 2PV0A 1EGHA 4GXTA 1B8UA 5EMNA 1AKNA 3EXHA 4OFBA 3S28A 3NP9A 4FS3A 2ZSAA 4UM7A 3WTXC 5LUAA 4FDTA 2IS2A 2MH9A 2IZOA 1A4RA 2NYRA 4KSYA 1YW7A 3PBKA 1JR3E 1NMXA 3JY6A 2QI9C 4AIKA 4ZRDA 4N7BA 2QG9A 1J0XO 2GK6A 3CVYA 2XVMA 1DBWA 2DOFA 2M87A 2CB9A 1JWBB 1WW3A 3T12A 3PXCX 2XNHA 4BO9A 1MZVA 5D7NA 5E3LA 1Z5UA 4C7OB 3N7TA 1WUIS 3PYXA 4MCAA 2PRIA 4E33A 1WZ2A 3CF6R 4R8VA 4ZYAA 4E5KA 4HTFA 1MA3A 2DLCX 4CKEA 1QH1A 4NJMB 1MQ9A 4QPDA 5ED0A 4OXIA 1VKNA 1I5EA 2RARA 1ZW6A 2PO7A 5IBCA 4P3NA 5CA1B 3E9DA 4G09A 1AA7A 1UP7A 3KU4A 3D5EA 3ELBA 5BR4A 3LOUA 5DP2A 3KJZA 3VZPA 2AD1A 3GAFA 1Q7GA 3VU9B 1IZ9A 4EG8A 5ES4B 2VIXA 1FX0B 3TEJA 1E6KA 1Z39A 4R3NA 3K09C 3KWFA 3LUGA 4RY0A 1EGVB 4FC6A 5JH7A 2G1KA 2WQZA 4GX1A 1CQJB 4ZFNA 1VG0B 2JBAB 2WC1A 2ADFA 2BFEB 4JELA 1MMSA 3FBGA 2BY0A 1MAWA 1G17A 3UA4A 4G6QA 1W0KD 3EZ2A 4UOQA 2JAHA 5ICMA 1CJUC 2I4IA 3T0GA 3AHJA 4LN1A 4N6GA 5DU2A 5K8JB 3M1AA 3BMQB 1AVTA 5F4ZA 5TQ0B 3LF1A 2VK1A 3CUSA 1VQKI 3SEAA 4EYQA 4CF5A 3ZWDA 3MGCA 3QUCA 2LH9A 1M2EA 3I5XA 1GQSA 4QAQA 1AQUA 2WNHA 2GXAA 1CTQA 3WWCA 3NPMA 8MHTA 1LW6E 3UAWA 3A6EA 3THOA 3KU1A 5D3MB 1O97C 4CRWB 5A3SA 1CUSA 3OFKA 3KIOA 3L09A 1MENA 1QV7A 2C99A 3F8TA 1FQOA 4JQCA 1QH8B 1TM5E 4X91A 4U6NA 1JR4A 1RXYA 3TEFA 1T2DA 4O5AA 5EUQB 2JLCA 2XIJA 3DHVA 1E2NA 3R3VA 4AQDA 1ZXBA 1AN9A 2NRAC 1FA9A 3C70A 2BDTA 1O6CA 4QBKA 3FCOA 2P4UA 4RA9B 2FOIA 1XTJA 4OLHA 3DMTC 2FA5A 2HIMA 1YZQA 3AUSA 2FR1A 2MYUA 3SS8A 1TKAA 3VR4H 3F3SA 4IHVA 2I1QA 1VL8A 4INZA 4PJNA 3ZCSA 3VU3A 3A0HC 5EWMA 2HYJA 4K2AA 1Z7UA 5HOOA 4GR4A 4LDZA 1KDTA 3QF7A 2PKXA 1TGVA 5DVZA 3DLTA 4D96A 1U7OA 1ZISA 3OYKA 3PE6A 4LX8A 4AJ1A 3H9GA 3H1TA 4KDCA 1WH7A 2KRFA 1Z4KA 3B13B 3GROA 3D3JA 3LQ2A 3UFXB 4PRYA 3T7RA 3QPSA 4IIEA 4WXRA 2PVSA 1RESA 5IC6A 4PBSA 2Q2OA 3WY9A 1VHQA 4Y2QA 5DI3B 3D4LA 4Q16A 3LWFA 4KV7A 3TW8B 2Y71A 1W52X 3A6KA 1KYYA 5L45A 2PBFA 3A7DA 5IDQA 1IAVA 4YRQA 3M5DA 5KYXA 2A5GA 1KIAA 4RGQA 4DUGA 1JLSA 4DM4A 2K5UA 4MR9B 3LOQA 5CK4A 2JJ1A 1VBNA 1QVUA 1UJCA 5FLXA 5GIPE 4MMYB 2CQQA 3KEQA 4PZEA 3D8RA 1XAHA 3CRMA 4BYGA 4L15A 4B3HA 3R4VA 2XAQA 1TLLA 2XGGA 3VJLA 2FN9A 1F6DA 2HHHB 5H16A 2ADMA 1I3OA 3L9XA 1OX6A 1MRZA 1NDUA 4IJKA 2AOWA 2ZIGA 3QELB 5G02A 2M45A 1QS0A 4M7WA 4XKWA 3NNDA 4S12A 5SYNA 3HKDB 1H0SA 4J1SA 2BFCA 4DA7A 3H6KA 1P7ZA 4RL6A 5B36A 3L0CA 1PTKA 4B44A 1GTRA 5EL0A 2GXUA 1W2GA 4ID3A 5K1ZA 3ICEA 3UAOA 3BQMB 3TAXA 3DQPA 5CIWA 3FNBA 1OX5A 1ORIA 3MCVA 3OEEA 3PEYA 3VHXA 3GLGE 2ARKA 1JGTA 2ZMEA 1C41A 3BTVA 2E89A 1NUPA 2YUTA 3RZOJ 3HJEA 1P4HA 1ZUIA 3OJOA 1D7OA 3MRXA 3VBCA 3RSFA 1JUSA 5IT9Z 3I2KA 4X62B 2FPSA 2P6SA 4IZZA 1K7YA 2Q2QA 3IOEA 4H9GA 1EE1A 4OXQA 2PFGA 4LGYA 1Z6YA 4L4XA 1YACA 4D6XA 1SMKA 4KLRA 3HHEA 4JVOA 5L3BA 1R6AA 1BVYF 1FFCA 1BGVA 1XIVA 2IYUA 3AF4A 2UZKA 2VK4A 1YZNA 2WFZA 1W25A 5CLQA 4MAMA 3GTKJ 5K0TA 1KHHA 3U1KA 3OE7A 4KE7A 4EDFA 2E5FA 1YO6A 2DFDA 3UHOA 3KKEA 1CUJA 3CUEF 3GB9A 1VL1A 1HT1E 1TB4A 2QQBA 5CVRA 2OCKA 1ZC3A 1BJZA 1II9A 2A14A 4HFJA 4NV0A 3F0TA 1P3JA 2Y9YA 4Z99A 2PX6A 2BEOA 3OZBA 2QRJA 5L95A 4UVBA 1WD5A 1VIAA 3ZU3A 2YWJA 4F72A 4PPQA 4C5BA 3DJFA 3IX7A 4U2KA 3SJ7A 3B85A 1NBWB 1RWNA 1N2BA 1ZIYA 3QEOA 5DM2A 4I08A 5EIHA 3LF2A 3U9TA 4F7ZA 3QENA 4GC9A 3RREA 3RDPA 3SC2B 3BF7A 2WINI 2ERYA 3MJHA 4FDAA 1FK8A 4CYCB 4NZOA 3IP6A 4GLLA 3IKTA 3DBRB 4IS2A 2F90A 5DGIA 1XTQA 4RBOA 2A9FA 3ENNA 3VYSB 2IYPA 5FNVA 3VX3A 4EYSA 2IP4A 1J1ZA 2VYQA 3NETA 4G4GA 3G0IA 3GF2A 1J0EA 5C8DA 2P5SA 2DBYA 2PJRA 2J9ZB 5FPTA 2VCHA 5JPCA 4ZT6A 1YSCA 3AY7A 2C00A 3IDQA 3HOXJ 4CCKA 5GWXA 3G6WA 3ZTWA 2RJOA 3S4YA 2O7RA 4UMFA 4J0KA 4FFLA 5J8CA 2QJOA 3RF6A 1BRTA 3U44B 1DS6A 3ROEA 1RSZA 2AUNA 1V47A 4LOKA 2AD5A 3HU2A 1H8AC 5CMLA 3WB1A 2J6IA 4QPPA 3V1LA 3ICCA 2VQLA 1GITA 1GPNA 3NTVA 1Q84A 3OEYA 4TT3A 4QFCA 5CGQB 4X94A 1C9DB 3UANA 2IU4A 2C7OA 3PX7A 3L4BC 4ZCIA 4Y13A 3Q2KA 2VP9A 4HNUA 3GY0A 1OYYA 2VATA 3ELDA 1TJ4A 2IIBA 1UIRA 3K16A 3V7YA 4CI0B 3SG0A 2J9RA 3BWXA 4BP9A 4MARA 1VG9B 3LWBA 3L2WA 4YRCA 3T41A 1HZJA 1H6CA 2HCRA 3V9PA 4KB5A 2Q2NA 1DG1G 3AQIA 1HM5A 4OGKA 4OJTA 4TWRA 4B3RB 3EW7A 3ZN2A 4Y1FA 3ZI0A 3U6KA 1B14A 1YJCA 4XGQA 3AAFA 4RNDB 2HVSA 2WWYA 1DKMA 1C7EA 1JHOA 1V3VA 2K3FA 3EPPA 1ILEA 4Z8YA 1UKBA 2BEVA 2VUUA 4QRDA 3C74A 3H2KA 5ALDA 5LMNB 5H7XA 4C9BA 1GRRA 5KNBH 4IDDA 3CPSA 5B5EC 3RRNA 1L1FA 1OV4A 3AVVA 3AIOA 1W29A 2RBGA 4M8KA 3H3UA 3R9XB 1F48A 1FPQA 2R6R1 3VYWA 5B7PA 4OUKX 4B8WA 1SGWA 4K9LA 4CMHA 5IF3A 3DDWA 3PQ6A 3HTSB 4Q1VA 2FSIA 2X6QA 1K8YB 2AG1A 1HKSA 4CM9A 3G8DA 5AFSA 1ITZA 4WFIA 2RAFA 3K20A 1M8JA 3LJKA 1SQFA 4TZ6A 2P2NA 3ERED 1CKEA 1CRQA 1FSZA 3GFMA 2JVKA 1G19A 5FROA 4BEHA 5E3HA 2RIRA 5JPIA 3K9CA 4PZUA 4Y2UA 3DDSA 2QX8A 3EOZA 3MZ8A 2KLBA 2VJYA 4BJ5A 4EA7A 3JQFC 1QFJA 3OECA 4KXLA 4DE5A 3BE4A 2H31A 4Q15A 3A25A 4EGYA 5DSTA 4Q5SF 3INNA 1HEYA 5E1BA 1Y7LA 5CDYA 2R6GA 4K9QA 2PT5A 3TTSA 4EHAA 2NU6A 3IIMA 1NC1A 1QTIA 1U1FA 4EHFA 3ET4A 2GFQA 5KU7A 3VYTB 3O21A 7ABPA 3PNQA 3AVWA 3QQPA 3C7KA 3DWLE 2CNBA 5DNYB 4DV0B 1Z88A 4ZTUB 5KQMA 4DC1A 2GASA 1NSFA 5THKA 4IMRA 1S02A 2Q9BA 4R2IA 2C1EA 3RSGA 4GI2A 2WSSD 3WK6A 1EQUA 2JRMA 3A6ZA 2B4RO 4EHIA 4EQQA 2BDEA 4TZTA 2BLNA 1N32B 5EG0A 1EX7A 4PTYA 4J07A 4G1MB 4B84A 2ZXEA 3VKVA 1TM2A 4ZT4A 3G5TA 4TMTA 2VDVE 2Z0MA 3ZR4B 1IXZA 2ODPA 4C4SA 1UKYA 3HOUJ 4YJ2F 2D1HA 3B1JA 1NQAO 3RIHA 4MYRA 4WV3A 1QRDA 3P9QA 1XKTA 2FFHA 1DCMA 2CXUA 3IRUA 2HIAA 4FB4A 3PNMA 2VRBA 1VZ0A 4N6NA 2K02A 5CK5A 1A1SA 2N42A 5HE9A 4D92A 2QN6A 3CC4I 3MF4A 2G83A 3R0JA 3DTYA 1E2XA 2AXQA 1ZK1A 4F4DA 2E1OA 4TMFA 5I9TA 3BZ6A 1DLIA 2P68A 1JJ7A 4JLKA 4KC0A 1EAYA 3MB5A 2RAUA 2ZO4A 4IJAA 4ITVA 1ZQ3P 4BQRA 4M2LA 4XOUA 4N76A 1B0AA 2FN4A 1H4TA 5JJ5A 1C0EA 4UVIA 1EKEA 1LVHA 4UMDA 4C88A 4QEDA 3KAPA 1MBJA 1FRVA 2D7JA 3UN1A 1CY0A 3HM9A 2TMYA 4B82A 2VSOA 2BKAA 4CMGA 4JCOA 4BVFA 3KXLA 4LHZA 4KYUA 4LF5B 3UAYA 1BR2A 4Z7QB 1DAEA 4FHTA 4PBRA 2J7PD 4KDEA 4RD2A 2OHOA 2VFAA 3SBEA 4CR7A 1FL9A 3VU0A 3GFQA 1C7IA 3NXSA 3BA6A 3MT7A 4D0NA 4H7DA 4HVAA 1XDDA 3A28A 3ENZA 2PMFA 5FPPA 3OLZA 2RHMA 4OK3A 1I7SB 3I2HA 2ZJ8A 4N3AA 3CP2A 4WL0A 1P91A 1RCUA 1MSEC 1PV2A 2MG4A 5CLIA 1R1UA 4B79A 1C14A 4KITB 1E1QA 5CKTA 2GRUA 4JUDX 4G37A 4B3AA 3UGTA 5K45A 3KUUA 1YK1A 2OC4A 2HIHA 2O8DA 1A6IA 2F3QA 4EPXA 3Q7RA 1LUAA 2HTEA 5E3IA 4J9UE 2OV7A 2HGZA 5FI0B 5LFAA 3PO2J 3VB2A 2LR0A 1GSIA 1BE6A 1FYEA 3PUHA 2GJAA 2P1RA 1DADA 4IHWA 1R22A 1IZ8A 1ABFA 3N07A 5FBWB 5JQGA 3W5HA 4LXXA 4XD7A 4XUEA 3ZU4A 3OETA 2W6MA 4PQGA 2HRRA 2OZKA 3CZPA 4RQBA 5JYCA 1GHTA 1VG8A 4JITA 3A1YA 3GMIA 2BISA 3GEDA 2CK3D 3AFIA 5AW9A 1CS4C 2XT0A 4ARAA 1NN0A 5LIRA 4MQ6A 3FUUA 3WGJA 4HP8A 2HVRA 4G5RA 4IFTA 3LQYA 3RQIA 3MWMA 4TL6A 3UJCA 3H2JA 3MHTA 2P9BA 3ISTA 3DLAA 3EOBI 1ZGBA 3NB0A 5HEKA 1NTCA 2VT6A 4F7DA 2K9QA 3O2PE 2P2SA 2I3BA 2HWVA 5ALEA 1ONPA 5E6SA 3FNFA 2A2ZA 3M70A 2C9OA 1TE2A 4TTAA 4JROA 3PLRA 3N05A 3INYA 4A2UA 2XUGA 1B15A 4YQEA 1D0XA 1MT0A 4BGVA 3R3WA 2ASVA 3JQGA 1RFGE 4WCFA 2OPTA 2WAAA 2NSYA 3I12A 4MITA 3CJRA 3VSAA 1BHSA 2LFBA 4FKMA 1N6OA 3B9QA 1OXXK 3HXQA 1XU4A 2VNAA 5K5RA 4G86A 1U2ZA 3AI3A 4X7BA 1GN8A 4Y6LA 1TUBB 5FPYA 4PICA 1E6LA 3KOXA 4R51A 3KHUA 4U7HA 2Z6UA 1P0FA 4JLMA 3L7DA 2ZR8A 1DKQA 1HT3A 4HAXA 3O83A 4X6AJ 4PHGA 1HE8B 2Q21A 3QU4A 2C5EA 2K87A 1EWKA 3OMYA 1WDTA 4WT7A 2FN7A 1NX6A 3EIOA 4KXMA 3MILA 1FOEB 1WP9A 3TEMA 2B3TA 2HXYA 4LIPD 3QX3A 2XPVA 1DOAA 4AJOA 2BMWA 1JFFA 3M5WA 5CR9A 2R7DA 4EMUA 1U6IA 1T0IA 4JP8A 2PA3A 1JE1A 4QA9A 2VPXA 3M9WA 1USVA 1LSSA 3W4IA 5B1SA 1BFUA 4Z4FA 3S81A 3H0KA 4P9NA 2IRFG 3TLGA 3AYZB 3KZZA 4DUPA 2E0IA 2I4OA 4XFJA 3NC1C 3R3YA 2XPCA 2Q45A 3ZN1A 4R8HA 1GUBA 2B0LA 1PVVA 5IBQA 3PGMA 1YJAA 1A50B 1RACA 4Y1EA 4BRZA 1ATZA 3MWDA 3FROA 3N8IA 2QX7A 1PF7E 2HSGA 2PIAA 5H83A 3I6ZA 3COJA 4CT5A 4FBLA 1WU7A 4ENWA 4K6GA 4D3DA 5DRYA 5B58T 2RH5A 3TO6A 2W2PA 1O3RA 2BVLA 4KTTE 3JTHA 5JHGB 1QB7A 4KXWA 1MJAA 3I1FA 1T0UA 3A04A 3WLAA 4X85A 4XWGA 4Z4HA 2L54A 5D5QA 1YOVB 5I4CA 2OM6A 3GTGJ 1JXMA 1CQPA 1CZKA 4WUTA 1FQJA 4ND1A 1Z0XA 4MI6A 4NBVA 2BYTA 1U6GA 2YZGA 3CUVA 2JFXA 1Q0QA 5EQDA 1BROA 3QU6A 4OYHA 1C3LA 3ISVA 4L0QA 1WJAA 1PEDA 1L3CA 3EAQA 3S93A 2KDZA 4FGZA 3EGEA 1HMPA 3C4JA 2JPDA 2G0NA 3DTNA 1LPBB 5DV9A 3L93A 4C06A 2VN8A 4YACA 1XHEA 3F2IA 4NOKA 1YZGA 4XQ0A 1XMVA 5AVSA 1M3SA 3F6OA 1ODCA 1AQYA 2VXZA 1PGQA 1V8OA 4RIFA 1QPZA 2ODTX 3OOPA 2VQCA 2VPYA 2OILA 1S89A 4Q1EA 1S0UA 1AHHA 1XKXA 2JVGA 3PA6A 2YN4A 4JBHA 1MMFB 2DJNA 3JSAA 4CCMA 1M6HA 3CWQA 2EXXA 2WM8A 4WFJA 3B73A 3STYA 2SKDA 3HHGA 4XXHA 3NCHA 1YBHA 3ETCA 2IUEA 4M6WB 1G60A 4RJTA 2HYDA 4I76A 4QPJC 3W2WA 5JAPA 2VZEA 1E9SA 2BBYA 3WRWA 4EAQA 2NX2A 3JZFA 3S2EA 2IYSA 1J97A 1PGNA 5BQOA 1WV0A 1Z7WA 1SCQA 4ZPXA 1J6UA 1UFKA 4JOCA 3OP1A 3ZKAA 3HUEA 3RG8A 5CB0A 2QRUA 2JSCA 5FWAA 3RF7A 5BV2P 5GGYA 3GTQJ 4O2BB 2BCGY 3SJBA 3DVAA 5KC8A 2BKVA 3I83A 2Q5OA 2VOOA 1T98A 1R4NA 4ANFA 1DUXC 3AOEC 4DPMA 1KPGA 1X42A 2JARA 4Q4LA 2QM7A 1G8YA 3L8ZA 2CL0X 1V43A 4IIYA 3C6KA 2VP2A 1HDGO 3AG4H 1T8IA 3KZOA 2WZBA 3LDAA 5JYEA 4PSUA 5KTYA 1KEVA 3EBLA 1Q1ZA 3M82A 4GGMX 1NVEA 4TL9A 2X6TA 4XIGS 4FOLA 1TIPA 4NDNE 4IEFB 4WMLA 2A7XA 1BVRA 3DFIA 4WNAB 1XX6A 2IX3A 1L5QA 3A4NA 2PGLA 4HYYA 5E7QA 1X86B 1P4JA 2BGIA 2YS7A 2OCEA 1R74A 3FXKA 4FHGA 1EKXA 2VOEA 1MG5A 4LTDA 4DV5B 2VE9A 2LW7A 3AG6A 3G79A 2NNWB 5CVUA 2J4DA 1DEOA 3AFMA 3SF8B 1ORDA 3SHWA 1M8FA 1K79A 1F3LA 4KVZA 3BQNB 4YR9A 3HPHA 4B6SA 3IDOA 1NOKA 2J0UB 2B78A 1ANKA 4I4LA 3RDIA 1Y7TA 1MA0A 3TLCA 3ZIDA 2ZSHA 3HXMA 4U4AA 3CCUI 4KFTA 5CVCA 5KYUB 2QE7D 2NZ2A 3DLBA 2FG5A 1YJQA 2J6CA 2HKOA 3O47A 2V7QA 3WTWC 2AFVA 2W1OA 5E4TA 3C6ZA 1RWXA 1Z34A 2Y2ZA 4WY5A 1KSFX 5A1JA 10MHA 1Y42X 3EVEA 4KN9S 1SJ9A 5KHAA 4G1CA 1I5ZA 2XDAA 2P77A 3FFAA 4B1FA 3U4CA 5D3QA 3THYA 2YL2A 4L3WA 3PFYA 3GD5A 4E0BA 4C4YA 3V55A 4TXLA 4YMIA 1SD4A 4LQ4A 2KM1A 1KONA 4A3JJ 3SJUA 3P9CA 2NVUB 4UUAA 3EPKA 4EG1A 5D3ZA 2G6BA 3RPEA 4QVKA 2BHLA 3DG9A 2IBTA 2I87A 1J99A 5AD1A 4JKIA 3HB9A 4MO2A 5TARA 1T2NA 4MCIA 2FSHA 1X3UA 1R66A 2OOKA 2R7LA 3UT5A 2QTNA 3IUYA 1S6YA 4R5MA 1SN7A 1YULA 1IDZA 1K06A 3OZXA 4YS6A 3RWBA 1D4OA 5IT0A 3GVIA 2QTWB 2H63A 4ENTA 4YROA 2CD7A 4RV4A 3CP8A 1I6XA 3UPUA 1XELA 1P9WA 3UO8B 1NAIA 1ZEMA 5KPDA 3EIEA 2B25A 1HKTA 5AVZA 2VYVD 3SY8A 3TRFA 3IDSA 3W2GA 1JIUA 3GFBA 2GM9A 2Y75A 1E3HA 1E79A 4LJAA 4TXJA 5KK1A 5L3RA 3MUFA 3FX3A 1YCGA 3INTA 5DUKA 1VSQA 3TTWA 5KOJB 1EINA 4RQTA 5AUQA 3SIWA 3R9IA 4PIPA 4Y33A 5EXDA 2ZXFA 2BW3B 2FX0A 2FYTA 1D2GA 1JU4A 3ZHBA 1DJMA 2R1VB 1T6BY 2M32A 3UB4A 3AY6A 2A5DA 1R4MA 2WWIA 3O8NA 3WNZA 2PMDA 4D57A 3PFGA 1ZK4A 2G77B 5HS9A 1TU4A 4OMZA 2R7AA 2AQEA 5JAQA 4C4TA 1PNTA 3BMXA 3ZJVA 1C7JA 4ZAWA 3VM6A 2WJYA 4RTQA 4RD1A 3TSAA 1YRHA 2O5CA 4JA0A 1UJBA 3A31A 4FSHA 3R7WB 3NHSA 1IHDA 2B1QA 5JD6A 3L79A 1EF4A 4MHOA 3OZAA 1K4YA 2ADOA 4OHFA 2Y1OA 2VP0A 3LTNC 1O5TA 2CUZA 2ZRLA 3NJ4A 3LDHA 3SMQA 2Z2IA 4CFYA 2IZ7A 2IDJA 5F0HA 4CHTA 3RKRA 3PU6A 4OB7A 4KA4A 2XKOA 2ZT7A 4Q7KA 2EBUA 3T7KA 3OFVA 1FWZA 2IELA 2EOAA 4JMLA 1Y3DE 1KU2A 1JQBA 4NTZA 3TWOA 2DPHA 5CXQA 3N3AC 2PGNA 4MV1A 4CNBA 3KDAA 3IJPA 1B6AA 2GN1A 1FFAA 5LJLA 4ADSG 4WGFA 1UK8A 5DNWA 4Y2HA 3PNYA 4EVRA 1U1GA 3UJDA 1N0IA 2IYWA 1PT8A 3T4UA 1LB1B 4BWFB 1ISSA 1VGVA 4PHCA 1SXHA 2AXTC 4EIWA 5DK6A 3FF1A 2A57A 4FYPA 2QQFA 3T3IA 3NGMA 4CICA 1UADA 2VYCA 1XVIA 5H81A 4DMHA 1PU2A 4IY1A 3N9IA 1P7JA 1U94A 4MUMA 3ECCA 3ZDBA 4RD3A 1G5QA 1Q7BA 5HQJA 4H27A 2Y9ZA 5JSKA 4BE7B 3Q9SA 1YITI 2D4HA 4WDRA 3PCTA 2O6GE 1KI3A 1HNWB 1WVGA 2CHUA 2XRNA 1BN5A 1UBJS 4ZVMA 4BEVA 4R8MA 2FKAA 1O94A 3PC8A 1F0PA 3N87A