4PGHA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
354
structure length
354
Chain Sequence
AAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 101
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pghA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pghA02
1PRYA 3KEOA 2GXGA 4IVNA 1DUXC 3M9AA 3P8ZA 3ERCA 5F1RA 4O5VA 5K8VA 2ACJA 4FSXA 4LK1F 3WU1B 3KR2A 3VC1A 4A12A 2IH2A 3MZHA 1JQ3A 4GCVA 2FF4A 4PONA 3P2KA 3D2LA 2ADMA 3K1MA 3LDUA 2BR5A 5DSXA 5E8GA 5L3DA 2FEZA 2HS5A 1VIDA 3F8NA 2W57A 2G9WA 5EEHA 1YO5C 1TQPA 1TQIA 3CJTA 2FRHA 4MEXF 2VXZA 1ZRFA 3BUSA 4MEYF 3GRZA 4DCMA 4U0VA 1ZARA 3ROUA 1I9GA 4I02A 3CJRA 2R7DA 3EVDA 4HTFB 1QGPA 2ESNA 5EVJA 2XYQA 2JHPA 3RIEA 3HHGA 4QPNA 2DO7A 3BWMA 3NEUA 3B02A 3KP2A 3GRVA 4QVKA 1WWXA 1YW7A 4E32A 1FSEA 2ZULA 3HNRA 3VFZA 1L9KA 4L9TA 2QM3A 5DM4A 2PVCA 5EKXA 2O8XA 5EOVA 1REPC 3SXJA 4L5JA 4PCQA 1MGTA 1YTYA 1P39A 4YUZA 3CUOA 1QAOA 5DLYA 2Z99A 4ZZDA 3EQLF 3IRRA 3PTAA 3C3WA 4OIRF 3T8TA 1MZBA 2CKDA 3P2IA 4RTNA 4E2ZA 2V1XA 5DXAA 2DK5A 3HCAA 4EK9A 3LBFA 3S2WA 2FHPA 5CYVA 4G6DA 3U2RA 3WGIA 2HOEA 4XSXF 2IH5A 4E31A 2HV9A 2PT6A 1X19A 3DMGA 2PEXA 3LAJA 3KU1A 4RAYA 3M8EA 2Q2EA 3GZ6A 2F5DA 4BXUA 5FWAA 1OYIA 1BC5A 1IRFA 1DDNA 2Z9OA 2DPMA 3L9FA 2OAZA 2MH2A 4DA4A 2BGCA 3FUXA 1BHJA 3KP4A 5CVRA 4QPPA 5E17F 2HQRA 5G02A 1KQ8A 3OU2A 3JW4A 2P3LA 3ERED 3CJNA 2PJPA 5DEQA 1OPCA 2JT1A 3MEXA 4HX7A 3QV2A 4EQQA 1ONVA 5DTQA 5B1SA 3NWBA 4ON0A 2BR4A 2XUBA 2L02A 3ECHA 3DXZA 3ULQB 1DL5A 1SD7A 2IBSA 2VBXA 4P58A 2PMUA 4I09A 3E6CC 1RUNA 3KHKA 5BQTA 1AWCA 1U2ZA 5EG5A 3ZMSA 4CO8A 1SQFA 1W7PD 4A0XA 4LG0B 4EKGA 4BLUA 2PG4A 2EV5A 5DTMA 3KKZA 5DX8A 4M6XA 1XJ5A 1SD6A 1LB2A 1G3WA 1U5TC 3K9TA 1FJXA 2GAFA 4Y2HA 2AOTA 4LLLA 2ISYA 5D6FA 4MQ9F 4PCAA 1JHHA 4CYDA 2O07A 5E1MA 3VSEA 2DBBA 2B25A 2YXDA 2QQBA 4AIHA 2H94A 2NP6A 1F5TA 4UVAA 1EIZA 3K1NA 5FQOA 1XGNA 3BJ6A 3ML6A 4I0AA 1RI1A 3LKDA 4PDKA 3BDDA 4CDGA 4BQAA 2JRTA 1WSUA 1KGSA 3LA7A 4K2EA 1I6XA 5GOZA 2ZIFA 3GO5A 5DX1A 1XMKA 5K0BA 3U81A 1U3EM 4K6MA 3MZYA 2V1UA 3EMDA 3HIFA 1HKSA 2H1RA 4HLYA 3SM3A 1T38A 1WXXA 4G9YA 3JSPA 3E6BA 4OIOF 3SMQA 3HRTA 1J2XA 4LWOA 2E1CA 5A2QK 3DULA 4XUDA 1I5ZA 1O9HA 2EB7A 5GM1A 1J5YA 3C6MA 4ER3A 3R6TA 3FTCA 3DH0A 4LB6B 4N9HA 2M30A 2QUFA 5CM2Z 1L1EA 2LDUA 4X1OA 3C18A 4LLGF 4PIPA 2J5OA 2Z6AA 5E8IA 1V39A 1WS6A 1FYMA 1TW3A 4AIKA 2HKXA 3ZMVA 4KUMA 3JAMZ 1MDMA 2P7VB 1MJAA 3LGAA 5KYGA 2FMLA 2E5WA 1U2WA 1KU9A 3WE2A 2ZWVA 1RIOH 3BWCA 4FS8A 2VBZA 3HCBA 2D45A 4Z2YA 5FD5A 4HGZA 5C0OE 1XSXA 5L3BA 3WTTC 2ZIGA 4PYMA 2FOKA 3G5TA 1OR7A 3D5LA 5F2NA 5LGUA 2ZZNA 3SSNA 2MBFA 3HVIA 5D1NA 4G56A 2DLLA 3RTRA 3R61A 3RKXA 2IA1A 2P7CB 5LQJA 3DLIA 2KIUA 5J8CA 2NXEA 2HTEA 3EVAA 3EMBA 5E1XA 3HRUA 4G7OF 2L3DA 1U8RA 1SQGA 2FXAA 1FP1D 4DQ2A 5DX0A 3GRYA 1P1BA 1UHWA 3PQKA 4RAZA 4P9FA 3BKXA 3FUUA 2IW5A 5LHIA 4GUAA 2FYTA 1S7OA 1PP7U 3RPQA 2EWNA 3KQQA 1IW7F 1SFXA 3EGVA 3BT7A 2XAQA 1NV8A 2HYFA 4PYJA 1FZPB 3EVFA 2NYXA 5CLSA 1HQCA 2UYOA 1PUEE 5K5OA 3CC8A 5DRYA 3ORHA 5U4XA 1Z7UA 1H0MA 2B9EA 2WWYA 4HOBA 4I2OA 4X60A 2DAOA 1O3TA 4RTQA 3TM5A 1IRGA 5DWQA 3KFWX 2RVCA 3B3FA 4CZZA 3NMUF 3MQ2A 4PYIA 5CVJA 3TM4A 3TPZA 1DPUA 3GJYA 1QQIA 2YQZA 1NV9A 3V8KA 1BIAA 1MDMB 3TKAA 3DFGA 5FLXZ 1HBXG 1Q0SA 4XSZF 3IEIA 5HEKA 3MTIA 3QP6A 2STTA 4EJWA 2E1NA 3DPLC 5ICGA 5EMKA 3D0SA 4C03A 3ABUA 3W6KB 2DTRA 3FUVA 3T7SA 5LQRA 1MJFA 1CGPA 2LD4A 5BW4A 1J0RA 3P9NA 2IDJA 1F1ZA 1WY7A 5MHTA 3GU3A 2OY0A 4PYQA 3PX2A 1QAMA 2GAUA 4H0NA 3OZRA 1P2FA 4E30A 4KYWA 1G8AA 1X1DA 3X0DA 1EH8A 4RTLA 2K27A 1FLIA 4NQWA 4RB3C 3M8FA 1HNNA 2EK5A 4MQ4A 4X63A 3I53A 3P9KA 4YUVA 4HW0A 1IXCA 1TLHB 3LCCA 4RB1A 4ZYGA 2EFNA 2GZWA 3DLCA 3EVCA 4LD5A 5D5XB 3EVEA 3KQTA 5GM2A 4RGRA 5H6QA 1R5GA 3GXOA 3SR4A 1IXKA 1UWVA 2RDPA 4EV0A 1FWZA 2RGVA 2AVNA 3O31A 3ID6C 3ECOA 5DD4A 5GP1A 2ESHA 3E3VA 5HIJA 4RVFA 4M6YA 1TPYA 3JWIA 3JTGA 2AS5F 4DQ0A 4TV7A 4U7PB 5KQRA 3KR0A 4XUCA 2B3TA 2HFHA 5LBQA 2ESRA 3V4GA 4RTKA 5ICCA 3RJPA 2XAHA 3F6OA 1WXWA 3NDIA 3CLOA 2FNPA 2VONA 3TO7A 4KN7X 4ENNA 5DRTA 3H2BA 5K5RA 1CF7B 2NYUA 3BP8A 3EUHA 1BJAA 3JAMK 2ZKZA 1SAXA 1KU3A 3K2ZA 5TRDA 2NXNA 2ZBPA 3SGLA 2JSCA 1JQDA 2FK8A 1U5TB 4L0ZB 3EGIA 1ODDA 4AZVA 1DPRA 2AVDA 3UA3A 4S05A 2CMHA 1GXQA 3OZSA 3MERA 4AD9A 5JUWA 2JG3A 3R3HA 4IHTA 3RDIA 1O3SA 2FBIA 4ZYHA 5GWXA 4UXNA 3ZMTA 2VE9A 4FR0A 2PFBA 3G5LA 2XKPA 1SMTA 9MHTA 2ERCA 2VZ9A 3A7DA 2M8EA 3M1EA 1G3YA 1XGMA 2OB2A 1T0FA 4CHUA 3A27A 5DCMB 1T6SA 3KQVA 4HZFA 1R1UA 3CTAA 4G8XA 4HV5A 2ZJ2A 3IRQA 1WKMA 2KIMA 4HA8A 2ORED 2ZIEA 3KQPA 1FT9A 2QENA 2XAJA 3REOA 3T7TA 2O05A 2P3OA 2PBIA 1KXZA 1YLFA 3WTSC 1XB4A 3UJ8A 3GFMA 4OMZA 3GNLA 5LGTA 4M71A 2BYVE 5EC8A 3PLAE 2ZZKA 4QTTB 2OQRA 4ER6A 2P5KA 1RI2A 3OZTA 3ZMUA 4BHCA 1YYVA 2BH2A 3QP5A 4IV8A 2L4AA 1BIBA 2PXCA 3C6KA 2MD5A 4LK0F 4YIIA 2XIGA 3DXYA 1UHMA 3RPUA 4Q47A 1V3FA 5HS7A 2L01A 3J7AO 10MHA 3OFKA 4GBED 3CKKA 4A6EA 3LCUA 3BGDA 2JPBA 1O54A 2BR3A 1ZQ9A 3E97A 2ZCJA 3FMQA 3Q87B 4UUVA 4RX1A 2LF7A 1D8JA 2WTEA 3DEUA 5D5UB 5L3EA 1D3YA 1WI9A 2PX8A 4QWQA 4DCGA 2XGXA 4P55A 1VQ1A 1TW2A 2XYVA 4FX0A 5E9QA 1X3UA 5CCBA 2HWVA 3KZYA 1P4XA 3WTZA 2MA3A 3BXOA 2RC4A 4FT4A 3H3UA 2UXNA 2YVLA 4EJTA 1W7PA 4JK1X 4DF3A 1WG8A 1QANA 2EJRA 2KW5A 2VODA 3G2QA 4I0BA 3HTXA 2IGTA 2W24A 2V6CA 4HGYA 5LQNA 1XCBA 4Y15A 4OQEA 2ZXJA 3FZGA 3KP7A 2JH9A 2VBYA 1T98A 3ELYA 3F21A 3GW2A 5FQNA 1KU7A 1Z3CA 2CL5A 3I71A 5E1ZB 2OD5A 1H9TA 2F8LA 2UZ4A 3I0TA 5HILA 3KPYA 2CO5A 3UJ7A 2WC2A 3HCEA 3FMSA 1KPGA 3HCCA 5EIFA 3ER9A 1BI0A 4WXHA 4R8SA 1Z9CA 2C6YA 2ZW9A 4PYKA 2P5VA 2FRXA 3M6WA 2XYRA 2IRFG 1B9MA 3IV6A 4HQMA 4O29A 3WG9A 5FWDA 3FX3A 5EEGA 2H11A 3HTSB 2XROA 3TOBA 5FO5A 1IN8A 1KYZA 3KLOA 3O3KA 1VL5A 3G8AA 4GYGA 4EJOA 3QPHA 2PWYA 3IKTA 1XGSA 4UV9A 2G70A 4L9VA 3WTVC 2IFTA 2F5CA 3E7PA 5C1IA 1RJDA 4L0YB 3C3YA 5ILSA 2ZSUA 3SZPA 4GOOD 1ZRDA 1L3LA 4P5OA 1LQ1A 5LQKA 3EVBA 3VC2A 2YU3A 2JHCA 3I9FA 5FA8A 4V0RA 4HX4A 3SQNA 3ZN0A 5IT9K 3B5IA 3ABTA 3DOUA 3I5UA 3PFHA 2W85A 3F8CA 2PI0A 1UB9A 2ZNZA 2OBPA 3FM5A 4PWYA 3FRIA 2PLYA 4RTPA 1D2HA 3I59B 3V7CA 2QRVB 3BROA 1BI3A 4A5MA 1Q1HA 4E2XA 5CVVA 5DUIA 3K69A 4V0QA 5DPMA 3QAHA 4YFNF 5ERIA 4GYIA 4R1HA 2P6TA 1NW3A 2IIPA 1G6NA 4M9XA 4GGGA 3KQMA 5H02A 5DCMA 4HV6A 5ICFA 4RTMA 1X1BA 4LWPA 1PP8F 3PB3A 1HSTA 2QZ8A 3E8SA 5F64A 4X41A 4WF2A 4EGZA 2EG5A 2DPUA 4GQBA 2HTJA 1L3CA 2Q8KA 2ZZMA 2C7RA 2VE8A 5KK1A 1UFKA 2KKOA 2LF8A 2A5YB 1O9GA 2G7HA 4H0EA 4ZH4F 2P3QA 1X1AA 1I1NA 3SSOA 4R79A 2G1PA 3GRRA 8MHTA 2NNWB 1AQIA 2PLWA 3FHZA 5BS6A 2PN6A 1NBHA 4EM0B 4G6QA 1EJ6A 2WV0A 1XDSA 1K78B 2C7OA 4O6JA 2PT9A 4U0WA 4C04A 1KYWA 1LDJA 5E1WA 1IM8A 5BPIA 2VBWA 1IAWA 1KPHA 1KQ9A 1JE8A 4F7ZA 4OA8A 4PYNA 2FSWA 1E2XA 2CW0F 3HOTA 3BOQA 1W5TA 2CGPA 1SFUA 1LEBA 4U7TB 1O7LA 4YMGA 4Q48A 2AS0A 1J75A 5EMLA 3HYIA 5D5WB 3F8FA 3UJBA 1BN5A 2EFOA 4GC9A 5BP7A 5LLQA 2C7QA 3KQSA 4BLVA 5T64A 5BW5A 3BWYA 2X4HA 3TOSA 4F85A 2O0YA 2G72A 3HUGA 2JTVA 2OO3A 4FSDA 4YUYA 1N7JA 3FXRA 3TKYA 3G7UA 4QVGA 1S29A 3T7RA 1ZN2A 1P4WA 3HSFA 3EEOA 1WQ2A 4ENJA 3Q9SA 3LA2A 5E8RA 2E7XA 4WX9A 5LRRA 2PGXA 2BZGA 1ON2A 3M70A 5H6RA 5HIMA 3BPVA 2WA1A 3GCZA 2FQ3A 3ELWA 5EMMA 5CVDA 1HMYA 3EVZA 5D4SA 1FOKA 3UJCA 1MJ9A 2ZMEA 3VYWA 3S68A 4O3MA 2EJTA 1ZREA 4FP9A 1UFMA 1RJEA 5C9ZA 2PKWA 3KQWA 4E2WA 3CUQC 5F2KA 2O61A 3LQQA 4CKBA 4LGWA 3WODF 4GXOA 3THSA 1JHFA 3ZP5A 4G7HF 3CGGA 1P6RA 5DCFA 4BLWA 2FCAA 1O7FA 3ANXA 4P7JA 4EMSA 3RW9A 3B3GA 2QYOA 2OZ6A 4RSRA 4YUWA 4BHPA 3J81Z 5T6BA 3QPTA 3GDHA 2PWPA 3PQJA 2QBYA 4AWXB 4ZYEA 5LQCA 1MD0A 5L3CA 5LGNA 4RB2C 3TFWA 5GIOE 1B1BA 2GWRA 1FX7A 3IWZA 4ENKA 5D4RA 2QLZA 4C06A 5JVTA 3BKWA 4ESJA 4CXMA 3K0BA 2ADUA 2YPRA 2L54A 4N9IA 3A7EA 1EJ0A 3O4FA 3G88A 4BP1A 5CJ9A 2VT2A 2V1DA 2ZO4A 5HOOA 1B6AA 1ZG3A 4POOA 3TO6A 4PYLA 1EG2A 4ENMA 2ONZA 4RVDA 4X61A 4PZJA 2JJQA 1OYWA 3RKYA 3DP7A 4NECA 2A69F 4A6DA 5BXYA 1ORHA 1AQJA 4KDRA 1G38A 3RODA 1ULYA 1P1CA 1E17A 2GXBA 4MQVA 3MTEA 4A5NA 3W6JB 3RKWA 3WTYC 3N4MA 4XBFA 3A25A 4B17A 1XDUA 3WTXC 3GFIA 2O57A 4M36A 3P9IA 4AZWA 3R9XB 3WE3A 3WTUC 2B78A 3TQSA 1MHTA 1VTNC 3U1DA 2QWWA 4BYYA 3V97A 5E9JA 1SUSA 1QYRA 3F22A 2H00A 4L7VA 3LHDA 3K6RA 1V4RA 1XN7A 3AWIA 2FK7A 2G8NA 3HSRA 4FX4A 2ZNYA 4L5IA 2HZTA 3UJDA 3BJOA 3J81K 2D1VA 1R8YA 5DT2A 1FNNA 3UJ9A 2GQQA 1EAMA 3MAGA 5CVIA 3K0LA 3HA3A 2HQNA 2VOPA 5AIPA 2ZTHA 1TNSA 4NB5A 3FZVA 1RZ4A 3G3ZA 3B73A 1IXRC 5K5QA 1WRJA 3QOWA 3PFGA 2K4BA 5FFXA 2CWWA 2XASA 2XAFA 2J5PA 1W7PB 2FE3A 3MHTA 1NW8A 4GO1A 4EQZA 3C0KA 3NQOA 1S7AA 3UZUA 1Z91A 2UZKA 4G94A 4PGHA 4EVIA 5HDKA 1IN6A 1IUYA 2Z6UA 2ZBKA 1JSXA 1ORIA 4M9SA 2TDXA 4CGZA 3J80Z 5FFZA 4LB5A 3ER8A 1ZG1A 1YFHA 1DP7P 3WGGA 3P2EA 4PIMA 3IL2A 1I1GA 2BM9A 3NJRA 1IXSB 1HKTA 5D1HA 2XAGA 3TDZC 2Y75A 3HA5A 3V7RA 4MWZA 1S8NA 3FPFA 4ZZLA 3G73A 4KVZA 4AUKA 2ONYA 4KA4A 3SZTA 2PJDA 3HM2A 1I4WA 3JWHA 1U6GA 1EQAA 2V9VA 3VODA 3Q7EA 4MTDA 5TJJA 5DTRA 3O2PE 2GIVA 3LWFA 1XSVA 3NW9A 3FF5A 4ER7A 4ER5A 5J8FA 2P8JA 3AJDA 5L3GA 3KQOA 2PY6A 1G4DA 1TTYA 3EYIA 4BH9A 4U88A 2ISZA 2OQGA 1BOOA 3PT9A 2RNJA 4OIPF 1LVAA 4IRIA 3LAPA 2PXAA 4HC4A 3C7JA 2VDVE 2PBFA 1FYLA 4KIFA 4P7GA 4MHTA 2D1HA 2OZUA 3I54A 4GEKA 2AOWA 3RYPA 1RNLA 1IY9A 4I7HA 3F72A 3JWGA 2XKOA 4HF0A 4HLXA 3SHFA 5FTWA 2QY6A 2R3SA 5JR3A 4KMFA 3L00A 4YV0A 3LDFA 3C1DA 5F2OA 2ZMEB 1XGOA 3DUWA 1R7JA 3H3ZA 3SXYA 5HLIA 2O6GE 3TGNA 3G89A 2F5FA 2NP7A 5DDGA 1NE2A 3KETA 1LDKB 2CFXA 3DV8A 1AOYA 4M72A 3DQVC 4RYLA 1RI7A 4XRFA 1TBXA 3LQRA 4OIQF 3BWBA 2NNYA 1FBUA 2I9KA 3FUWA 3FPHA 2H6CA 1D2CA 4OU0A 1B4AA 2HNKA 3C3PA 1BBYA 2GH1A 2OB1A 1Z6RA 3GO4A 2CYYA 5LEJA 1NBIA 4MIKA 3I64A 3EDPA 3GRUA 4GC5A 5FLXK 2KIFA 4BNCA 2V79A 4IF4A 4YIFA 1LEAA 3EGEA 2A6EF 1JR4A 3R0QA 3V8VA 3KCCA 2YTZA 3DXJF 3E6MA 5EKUA 4IHSA 1L3IA 2I7CA 4R6XA 4RVGA 3NDJA 1M0EA 4DZRA 2MC3A 4C08A 5LR6A 4YV2A 4A2UA 4WXCA 3J80K 4HBLA 2P5LC 5K03A 3F6VA 2AOTB 2PV0A 5DM2A 1EH6A 2PX5A 1XCJA 2KJBA 1W4MA 4OINF 2IH4A 2Z6QA 3G2OA 1F9NA 2IPQX 4YV1A 3K1PA 3BZBA 4QDJA 5D8LB 3E5UA 3GFJA 1U78A 1JG3A 5EMJA 4HQEA 5HVQC 1L3BA 2VC1A 2Q0OA 4LG1A 2A3SA 3MFKA 5FGMA 2P35A 3CJQA 1JSZA 3R0AA 3KEQA 3LSTA 1KU2A 4LLNA 3COAC 2HKOA 3DR5A 4KMUX 2AXLA 2NXCA 5EHGA 4RTSA 2W84A 5ILUA 1HW5A 2AN5A 2P41A 5K0LA 4KT5C 3HVJA 2VC0A 3MAJA 2DFIA 3OU6A 1R36A 3IKVA 5E1BA 4P96A 3BGVA 3F3XA 3TR6A 4L9JA 1KR5A 1R6AA 3L8DA 3GWZA 2XVCA 4KIGA 2V7EA 2EA4A 3QU3A 3R24A 3KPWA 1HXDA 5K0CA 5HDNA 2ZBRA 5HS8A 5E9WA 5HFJA 1ZGAA 2UWMA 2EV0A 2XBMA 2RKHA 5L3FA 2GS9A 2WK1A 4CTJA 3B3JA 1T43A 3OFJA 3BJAA 4XCXA 5ERGB 4MTLA 2OZVA 3H92A 4LJZF 1O3QA 1ZGJA 6PAXA 4CWAA 1VLMA 4M74A 4UVCA 1RJGA 3KP5A 4ETSA 4E2YA 1XCLA 2Y1XA 3FTEA 1RUOA 1WZNA 2UYHA 3DMHA 2HR1A 3F8MA 4CXFA 4HDUA 2VN2A 4IRHA 2IP2A 5LHHA 5CIYA 3LCVB 2Y0MA 4UVBA 1NW6A 4KRGA 1KP9A 3IWFA 3CUQA 3ZMDA 3KPUA 5LHGA 1YFLA 2JH8A 2EJUA 1MKMA 1ZAOA 4EM2A 3KLNA 1P91A 1I1SA 3EEYA 1TNTA 3HRMA 2EFQA 4RWZA 2LNBA 3FM3A 1R8XA 4HH4A 3ELDA 1KA8A 2EFWA 1EV7A 3LDGA 3BZ6A 3GF2A 5E8JA 2OXTA 4CKCA 2GA9A 3Q9VA 2DQRA 1G8SA 4EKIA 3R4KA 3GVAA 3HCFA 2MLGA 4L9NA 5EHIA 4AIJA 2FMYA 3JWJA 4OBXA 3TDUC 1ZLJA 1N7IA 5IT9Z 1R22A 2R7FA 3UJ6A 3FRHA 5HDGA 2YX4A 1H1DA 2IDKA 3OU7A 1O57A 5CVEA 4E70A 2FPOA 3AXTA 2K02A 5LSAA 1P92A 3P9CA 2DI3A 4R05A 2YUIA 3AY0A 4D0PA 4F86A 3DKWA 2AOXA 3A26A 2WA2A 3ZMZA 1YZ3A 2G7UA 3OOPA 4KDPA 5FD6A 1K7AA 1IN7A 2K4JA 2HGCA 5BOXA 3F23A 3RI4A 3HHHA 4HX8A 1QZZA 5ED4A 4QDKA 3GX4X 5FB2A 3KR1A 3QOPA 2PMHA 3T8RA 3E6DA 3GUDA 2PX2A 1ZYRF 2IA2A 3TO9A 3WTWC 4B8XA 2G71A 1STZA 1RJFA 4WK8F 3B7PA 1BM9A 2CQKA 4I01A 2LSOA 3V8LA 4S04A 1KHHA 5E1OA 3KE2A 1R1VA 1NT2A 5IKMA 2O0LA 3E23A 1KQ0A 1RI5A 3ELKA 5K0NA 3TRKA 4M9ZA 2W25A 1HSJA 4OMYA 4FZVA 2YXEA 3M6XA 1MJBA 2VDUE 2Y1WA 3P71T 2COMA 4RB0A 4G7ZF 2P7HA 2I6GA 3UJAA 4GOLD 1Z1DA 2MH9A 3DMFA 3TOAA 1B59A 3CDHA 5LRSA 2YR2A 1KIAA 2MLKA 4RGUA 2OA4A 1ZRCA 3T0IA 3HSEA 3WU0A 2XV4S 1K6OA 2HDCA 1OKRA 4P9UA 4EJVA 4C4AA 3NVKI 1X1CA 4WXDA 4C07A 5BMZA 4EM1A 3WGHA 5HS9A 1D5VA 4WVLA 2NAZA 3MCTA 3N97A 2P7IA 3LKZA 3EETA 1HKQA 2GB4A 3EVGA 5J6XA 1RI3A 1QNTA 2XVMA 3CBGA 5JHUA 1YUBA 4UHTA 2NXJA 3M7GA 1SKMA 2F2EA 2GPYA 3HEMA 5T67A 1K78A 3E5QA 2QBYB 4FT2A 1BI2A 2FBKA 1SG9A 1OR8A 4LG0A 1YFJA 3ZQ7A 3L7WA 3E05A 3WSTA 3PX3A 2HEOA 4EGYA 2QE6A 4RTRA 1IF1A 1IZ1A 1LDDA 5DD8A 1J7KA 3FUTA 4B09A 5KVRA 1OMIA 3CO6C 3FPEA 4RGXA 2UYCA 3T0YA 1KPIA 2FA5A 5FA5A 4BHBA 1J59A 2IT0A 3GIWA 1AF7A 4WWCA 4Y17A 2BE5F 1JG2A 1PJZA 4R6WA 4EJUA 4QTUB 2V74B 2Y48A 5EIWA 1N2XA 4OBWA 5IT3A 3G2PA 4LECA 2KJCA 1S6LA 4MGRA 3LBYA 3NTVA 1JG4A 4IJAA 4ER0A 1R58A 3GZ5A 1F38A 2CMGA 1Z05A 2I62A 2ETHA 2YR0A 3LPMA 2QQ9A 4CKEA 4UOEA 4U7BA 3DTNA 4AX8A 1CF7A 5D6EA 4ZYDA 3FXUA 1OYYA 3AXSA 1YW8A 4HF1A 1NHAA 3L2CA 3KZZA 1FBQA 3QRFF 2RQPA 5CVUA 1UIRA 5AONA 2ELHA 1H9GA 2PSSA 2JPCA 2OPBA 2DW4A 1GVJA 2VOOA 4KN4X 1FC3A 4KW7A 3I4PA 5F6FA 2BM8A 5BPDA 1SVUA 3UFBA 5K1YA 1R18A 5DM1A 2B0LA 2M87A 4MHGA 4N0BA 4RGSA 1RI4A 3LFKA 3GFLA 2A07F 4UNOA 1W5SA 2K7LA 1R00A 1BC8C 2IA0A 4M73A 4PINA 4F84A 4QLCU 5E2BA 3TMAA 1G6Q1 4HTFA 2H09A 2AN3A 2PXXA 2ZFUA 4M38A 2XVAA 3KPVA 5K0EA 2DULA 2A6HF 4A0YA 3JTHA 1BOAA 1NW7A 3BY6A 4KFCA 3O7WA 1IN4A 2HTSA 2YX1A 4QQKA 1YIOA 5HOQA 3O6BB 4NHJA 3R0JA 3OE5A 2BEOA 2A14A 3RIRA 5ICEA 4HF2A 2IPXA 2VP3A 1VP3A 1BC7C 1GXPA 1J9IA 2XHKA 3FYDA 1F4KA 1Y0UA 4PGGA 4ZTBA 1TQMA 1R23A 3QU6A 3SSMA 4GOMD 3UWPA 5FADA 1PDNC 4AZTA 2GA2A 3TLJA 3FTFA 4QQNA 5DXJA 4HG2A 3HTUA 3R6SA 5D8KB 1FY7A 3VEPA 5E2AA 1B9NA 1QPMA 3DF8A 4I98B 3AAFA 2IVMA 2HWKA 2N47A 4Y13A 3FMRA 1YF3A 2RV8A 2DU9A 2CSOA 1DCTA 2EV6A 3LECA 4A0ZA 3IC7A 2AOUB 3G2MA 4PYOA 1M6YA 4U7DA 1XD7A 2P1DA 1FP2A 2M5WA 5FUBA 3T5XA 4KICA 4RS8A 1ZH5A 1FYKA 2QRVA 3FPGA 3VOEA 2Q41A 3I59A 3SVZA 4KNYA 4Q5SF 5FCDA 3LX6A 3M4XA 3M6VA 3R60A 4KIBA 1G60A 4DKJA 5LEKA 4RVHA 2EFJA 4MNUA 2KRFA 3E5XA 1XTPA 3ZPLA 1FPQA 1JG1A 5IH3A 4JXJA 1G3TA 1B42A 2RN7A 4DM3A 3B89A 1ZHFA 2HR3A 1QZYA 5ILVA 3I58A 2GLUA 1ZKDA 5A2QZ 3LL7A 2ZCWA 1G55A 3ISPA 4UV8A 5FHRA 2AR0A 2BBYA 2JHAA 1T39A 5AIQA 1YQAA 5EZQA 1JGSA 2FBHA 1S3JA 4AVPA 2R6ZA 3BGIA 4R8RA 2EX4A 2CWEA 4HSGA 3MCZA 3UA4A 1YS6A 2D2WA 1AV6A 1L0OC 3UBTA 3MQ0A 4OOIA 5HZMA 2AOUA 3GGDA 3OCJA 2YSRA 2STWA 5HIIA 2DQLA 4HDVA 4M7RA 2O03A 2ZBQA 4ASNA 1USTA 2DT5A 1D8KA 2Z33A 2B2CA 3IYLW 4YUXA 3HA7A 2P4WA 5DV5A 4OA5A 4YMHA 1UCRA 3KR9A 2OYRA 3G8BA 4HRAA 3MGGA 3QOXA 2IBTA 4ISCA 3M33A 2ZFWA 4L18B 1U5TA 4DNCA 2OKCA 2YXLA 1GHCA 2NRAC 2K86A 2YX7A 2IJLA 3IHUA 4LMYA 2A61A 2DPDA 2M45A 4ESBA 4RV9A 5FULA 1VPTA 3IHTA 4PCLA 3ZN1A 4HAMA 2VDWA 3NVMB 5P8WA 2JZYA 1XDZA 1YW9A 4AZSA 1ZLKA 4GF5A 1NKVA 3JSOA 3P97A 4U0YA 1YG2A 5HLGA 3GEZA 2M1BA 3GYHX 5FHQA 3MWMA 1D2GA 1R5HA 4FT8A 2ZLBA 1USSA 2O3FA 1JQEA 2H27A 1FBSA 2P6SA 4XUEA 3P7NA 5HLHA 4HYEA 1XMAA 5K0GA 4RTOA 1IN5A 1QO0D 1ZG5A 3OV8A 4FHTA 4IV0A 5K09A 2H6BA 4C05A 1R74A 1YB2A 3SFZA 2A68F 4DMGA 1QAQA 2AN4A 5CCXA 1SUIA 3CCFA 3BWGA 3HP7A 4R8HA 5LQUA 3FYCA 5DYMA 4ATNA 3HVHA 3Q5FA 1ON1A 4MTEA 4FGZA 1K79A 5EQJB 2OBFA 2GA1A 3F4KA 3RYRA 3V7SA 4KDCA 5E18F 3ELUA 4IWNA 3NWEA 3L09A 3THRA 4JBAA 2X0LA 2Z3YA 2HMYB 5LQAA 5GIPE 4E33A 3FTDA 3VB2A 1VBFA 3EPPA 4YG2F 1DUSA 2AOVA 4GOND 3SX0A 4IKPA 5DSTA 2BV6A 1SFEA 1VP9A 1LJ9A 4OX9Y 3PVCA 5JI6A 1HW2A 3T1BA 3V8JA 3NRVA 1JTEA 3CVOA 3HCDA 5DM0A 5K0JA 2XRNA 4RTJA 3HRSA 3BPXA 4BY9E 1R1TA 1FSHA 2NNNA 5KVAA 3ME5A 3CO7C 2L4MA 1XCVA 2VT3A 2CG4A 1QBJA 2HYGD 3A4TA 3KP6A 5H20A 3KQYA 1O3RA 5K05A 2P40A 1SD5A 2F5EA 2NS0A 1NW5A 1XXLA 1LNWA 5D5VB 1Y8CA 1G3SA 5KS2A 5DUKA 2FNAA 5KQSA 1Z6TA 1T2KA 2C7PA 1I27A 5CUQA 5HIKA 4BP3A 1Q0TA 4KWCA 5K0FA 3F8BA 5E20A 1SMYF 4YFXF 2K4MA 3DPTA 2VS1A 4Y30A 2FU4A 5M5BA 5JFRA 2UXXA 3KP3A 1JXSA 2ZVJA 3LA3A 5EGSA 2OU2A 4Q4ZF 2E7WA 3EYYA 5EZSA 4XLPF 2P8TA 2EA2A 3HVKA 4ESFA 2LKPA 5E1DA 3FWEA 1INLA 4CTKA 1P4AA 4IPAA 2EFPA 3CUQB 1YZHA 2QVOA 3FXQA 2ZWAA 3GLXA 3KPJA 2DK8A 3PS9A 5K01A 7MHTA 4XLNF 1A04A 4IXAA 1HW1A 3PFIA 3U9GA 3MB5A 1M6EX 4CICA 4YFKF 3M6UA 2PX4A 2Z5UA 1EH7A 5CD1A 1JTFA 4OQDA 2AZTA 4BAYA 2QQAA 3OE4A 1XSDA 3FPJA 4P7KA 2UYQA 1YS7A 5GINE 4LFUA 5EPEA 4PNEA 4P7FA 1BI1A 2PQ8A 2O06A 1C0WA 1XVAA 4M37A 1FBNA 4IRGA 1F3LA 3HOSA 3OPNA 1SD4A 1BKYA 4JQFA 3TQNA 3DXXA 1VE3A 4WCGA
chains in the Genus database with same CATH superfamily
2VJKA 2P9JA 4QA9A 4R51A 1GNRA 1ZM3A 4BVFA 2Q0SA 5KC8A 4L9WA 3LC1O 3CCYA 4TQUS 4AMBA 1OXVA 3QWLA 5K51A 2XTMA 1VHDA 3BCAA 2WAOA 4K2HA 3KR2A 3RWBA 4KPGA 3VC1A 1V8DA 1ESZA 2GYVA 2R7KA 3MPUA 3R7FA 3S81A 3GRFA 1I6WA 3L5KA 1KYQA 4ZVVA 4EPTA 1Q1NA 2G4VA 4GGPA 2W82A 4N5DA 1X7YB 2EWVA 2GHQA 3P2KA 1NDQA 2ADMA 4RO0A 1HBJA 3N0WA 5BR1A 4TRMA 2DA4A 1G1MA 2X15A 3GVXA 4XN0A 1L5QA 5E8GA 5L3DA 1XNHA 2ZEJA 2PUJA 2C8KA 3RGGA 2ZUUA 9ABPA 4K26A 1MOZA 5DDIP 4D6XA 4LJ5A 4MV6A 2P75A 1P7IA 3WR5A 3ZN2A 3B2QA 4BX2A 3C3EA 1NQXA 3EDYA 1YIAA 4J6EA 1AXEA 2CKMA 1GQSA 4Q7EA 1SHJA 5CNMA 3N2YA 3T34A 4LZNA 1ODSA 4M76B 4QT4A 3CEMA 1CNEA 3G2KA 1VMIA 4MUGA 1RKBA 1EBBA 2BDUA 3BE8A 3PE3A 1N5JA 4U0VA 3RHFA 5TMBA 5JYBA 2OO5C 4I02A 3A01A 2ZT7A 2WAAA 1U8UA 1HG0A 1AD2A 5JEEA 3LDAA 3BGSA 3HDQA 1G8HA 3R0VA 1FDUA 1ZESA 1FP7A 2YY7A 3CJRA 3BSSA 3Q3VA 2R7DA 1QO7A 3UKOA 1QGPA 3ZW9A 2UZAA 3GRAA 2JHPA 4RH1A 1BW9A 1P0IA 1T9DA 1DRWA 2GR9A 3HEBA 3PF9A 2XMGA 3W6OA 5KYYB 1RRCA 1UKEA 2FRDC 2PMKA 3ZWKA 5HR5A 3NEUA 3B02A 2GN1A 3AR5A 2O0HA 4WBNF 4B79A 2ORYA 2Q1SA 3BK2A 4CZCA 5JNRA 3GCGA 1DWOA 2O2ZA 3H19A 4JIMA 4EG0A 1U5BB 1JHPA 2KDZA 2C8VA 2PWAA 2GKOA 1IEXA 4R9VA 2MD0A 2XHZA 2NVTJ 4MVJD 2LW7A 5EKXA 2GJ9A 3RJ5A 2GYUA 3JRIA 3FXLA 1YXMA 2ZS7A 1TE2A 1WBJB 2F1JA 1GUAA 3FNBA 2PSFA 3BK7A 3LYLA 3SXJA 5KNBD 2HRBA 2OFOA 4QECA 4M55A 3CUOA 4GMKA 1QAOA 4IICA 2OUMA 4ALIA 2WU0A 4V1CB 3ZE0B 4ZZDA 4HPWA 3EQLF 1JVBA 3IRRA 1CY6A 2GESA 3GCXA 3PTAA 4OIRF 1ZMBA 4BFSA 2ORWA 2N9UA 3ABOB 1WHSB 2HIHA 5KOJB 5AOAA 2R66A 3T8TA 3FOAA 2DF8A 4XLEA 3U7QA 3EEIA 1NVEA 1V95A 3SC3A 3GQBB 4E2ZA 5C8YF 5FBLB 2VDOB 2DK5A 2A1UA 4G0NA 3CDLA 1KSGA 1SHTX 3IAUA 4NV0A 1DP4A 3LOQA 2XKKA 2MWMA 3M81A 2LRHA 3ZHZA 3JTEA 4CCLA 1ES9A 1XK7A 3I76A 3PEEA 3WZMA 1IQPA 3ZIAD 4C3OB 1NVTA 1K6EA 2IH5A 3V1KA 4E31A 5FKOA 3M4OJ 4AMYA 1L8LA 4BYGA 3LP5A 4YRGA 2C2ZA 3L7DA 3WLKX 2L9RA 3JX9A 5GTDA 1UEXC 3GZ6A 4UPDA 2CYAA 4BOYA 2JJ2D 4B3BA 5T8KA 2BHZA 3FE2A 4R3WA 3I5XA 1IRFA 4JLSA 3ZV7A 2Z9OA 3CCVI 3NWSA 2OAZA 2MH2A 1KI6B 1WU7A 2BGCA 2CQQA 2NSLA 2I1VB 3NWJA 4ZDWA 1P9OA 3FK7A 3RAGA 1GZ3A 1PSZA 1IC8A 2J3KA 4H1TA 3D2BA 2K9LA 4PVCA 2AA3A 1DPFA 1Y7LA 5G02A 4A4DA 1JFSA 1A9XA 3LMMA 3S5UA 4KE9A 4CT4B 1T1RA 1UBSB 1SIUA 2P3LA 2W6MA 1TT5B 3CJNA 3PSIA 2VK2A 4LZJA 4OGWA 4RADA 1PWZA 4U63A 1XL1A 3MEXA 4HX7A 1Z22A 1BR2A 2OP0A 2PN1A 2J3JA 2OAEA 2QZ9A 3H9BA 4EQQA 1BJZA 1CUEA 5B53A 1KI6A 2ZJ3A 4HWPA 3R9KA 1B1AA 4NHEA 1NH3A 3WWCA 3RVPA 4R7GA 2VG8A 1SD7A 1PLKA 2O2SA 4WCDA 1QF9A 4LEIA 3KSBC 2TECE 2ZR0A 3DFFA 4MFEA 2VJQA 3KHKA 4MKIA 4M0UA 4NJOA 4XB6B 1C9MA 4Z1MD 2VH5R 4J7CA 3R2JA 4B3RB 4JHXA 3ZMSA 2B99A 5C34B 5HIAA 1GDTA 2VDRB 1DOAA 2FN7A 5C53B 4OXQA 5JNTA 4XFKA 4CO8A 1RAAA 5JNVA 3QE4A 1RQRA 1LD3A 4LG0B 1N2CB 1Z8DA 3F8SA 2HKIA 4FK8A 2EV5A 3PFYA 3AEKB 1Y39A 3UVEA 4DIQA 1XTZA 2C2WA 4J2HA 3URKA 1YFZA 1ECCA 2CJYA 1K8XB 4WAUA 3U1TA 1ZW6A 3TFQA 3SVLA 3A6KA 4CF7A 3ZRGA 1EE1A 2YJGA 3DL7A 4RYDA 2JRMA 3UMYA 1SD6A 4B87A 3AHJA 3QFCA 1NURA 1C7FA 2FMXA 3TCNA 3GLIA 3U4QA 2GAAA 4ZQCB 1F2UA 4DIKA 5BOSB 1G3WA 3N58A 1E63A 2GAFA 3AP2A 5D5HA 1NBAA 4UHHA 2P9ZA 4OX9B 1K68A 2AOTA 2DWCA 2XRYA 4RZ2A 1ZITA 5AYVA 5D6FA 5JH7F 2JAPA 4MQ9F 1ONBA 3CRRA 1IAVA 4V3BA 5ILQA 3P5BA 4X44A 5JY1A 3I9V2 5E1MA 4ZJZA 4BO7A 3VBEA 4MRMA 2YHAA 2B25A 3H05A 4D9KA 3I2GA 3JRNA 3PNTA 1KSJA 1P7VA 1V6AA 1XU7A 2ZB2A 3AHGA 5EMNA 4G8BA 3ZE1B 1OV4A 1SD2A 1ZK4A 1MTOA 2NVBA 4BBRJ 4NSNA 5DB4A 3RFVA 4AY2A 1UWKA 4MRMB 2CGEA 3VO1A 2QM7A 2NNLD 4PDKA 5EIBD 3BDDA 2PZEA 4GGMX 5BV8A 1Y6JA 3RVQA 1KFKB 4GNRA 4O4LB 3F73A 1WSUA 1KGSA 1YV9A 5BO5A 1VC2A 2AYYA 2F62A 4YJ3F 4BX8A 4PSCA 4KUGA 2Q4BA 2FUG2 3GO5A 3RKUA 4F9TA 4GXQA 5AO9A 3U81A 3I6IA 3CJRB 1U3EM 2YRXA 4MCHA 4ND4A 3TLMA 2V0GA 3QKSA 3D59A 2G0TA 3MZYA 1PDOA 1W5FA 2AN1A 3OPYI 3LDHA 4MP3A 5DMXA 1WABA 2FJPA 3SE7A 2PUDA 1E9AA 3NKFA 4NOLA 4ZALA 3KZKA 2O5EA 1DBSA 2E5FA 3ABZA 1IU9A 1ZMRA 1QTRA 2PZGA 2VYCA 4X3OA 1VJRA 1Y7HA 1YVPA 3GNQA 1JZQA 2ZSAA 1KH1A 1JJVA 4W7IA 3SMQA 3WHLA 2YN2A 5ITSA 3IAS6 3RBVA 4JQOA 2AE2A 1OCZH 4GI3A 1BZYA 1KC1A 4G5RA 2WSLA 4HMPA 4XUDA 5GM1A 4KE6A 5L7YA 3BJRA 4PSVA 1P6UA 3C6MA 1I10A 4CCMA 5LD2B 4KQJA 2AV6A 2WJHA 2QGFA 1ZDMA 3FTCA 2QY9A 1V4VA 3E3OA 2V3WA 4TMKA 4OI1A 4CGYA 1YNSA 4Z1MA 1JZSA 3DPSA 1RLIA 2J7PD 3GLUA 3PHBE 4IR7A 4TLEA 5A4FS 1QIFA 1J1ZA 3P9PA 4KKVA 4EYSA 4X1OA 1OWLA 4M60A 3T7JA 3SK0A 4LLGF 4PIPA 2Z6AA 4A2CA 4FM9A 1GDDA 1TF5A 1L5OA 2J5QA 1NLMA 3CUWA 3ENKA 5E8IA 5EHNA 1WHUA 3SZGA 4PLHA 1FDSA 1HF3A 1CP2A 3GGPA 4EG4A 1V2GA 3IEMA 4NC7A 3R3SA 3IBCA 4Q93A 4RA6A 4BZPA 4XH9B 1NQUA 2QVCA 1RZUA 4BNTA 4TLMB 2VJOA 3KJXA 4HWSA 2VIXA 2P7VB 2WJ4A 1GCGA 3TN7A 3LGAA 5KYGA 4TUYB 1QYIA 1DQUA 2JGLA 1KYIA 1CVRA 2P9TA 1REQB 2UV8A 1JFFB 5ALVA 1E1QA 3DEFA 4R2LA 1EFPB 4Y7CA 3WE2A 2PUVA 1YJXA 2QTFA 2JEOA 1OKKD 2ZE8A 1RIOH 3FSGA 5FO0A 4B6EA 1B4DA 3MQFA 3OY9A 2CEAA 4D46A 1C8KA 4EGQA 5L45A 4MI1A 3RVMA 1K83J 1WB9A 3E1KA 2O23A 1E2PA 4UDYX 5L3BA 1EDZA 4QDTA 3T12A 5TJHA 5KQLA 2H06A 4OMFG 4PS1A 1OR7A 4GWLA 3LUKA 1V96A 3D5LA 5KSYA 1APBA 5F2NA 1U94A 4HDRB 5LGUA 2QSGX 4PBRA 3DEWA 2EEPA 3BCHA 5F1KA 3UV6A 5H4GA 3U7QB 3PNMA 4KE8A 1T29A 5BYBA 4BBSJ 4CKZA 2G17A 1GEEA 1LI7A 2O0JA 3WLPA 1KSHA 1Y4SA 3JATA 4U6SA 1D3AA 3RKXA 2P7CB 1PJCA 2V6EA 2EZUA 3CW9A 3DLIA 3U4HA 3ZJYA 2ZB4A 3UUEA 1ZZEA 3H9JA 2BCGY 4ARAA 2REOA 3QEBZ 5JH7B 5BSWA 5L6MB 5FNVB 4ARCA 4LIUA 2CSUA 3C7TA 3SG0A 3TR5A 1TLFA 1JAZA 2HTEA 1GPKA 4RFLA 4X8OA 3EAQA 4G7OF 2HU5A 3LX4A 4RD1A 1PFKA 1AMUA 3TCXB 2E37A 2GBLC 3JQFC 1X7ZB 4QFDA 1XZIA 1THTA 2WZBA 4ROSA 2D5VA 1RE1A 1V5IA 1R6VA 4AWBA 3IPRA 1MX9A 3ETNA 2DA7A 4P9FA 1XO1A 2WTBA 2ZIWB 3BKXA 1HQKA 4ZP1A 5KX5B 3E2IA 3EIFA 4JQCA 4LJSA 4CTNA 3PGVA 3KCNA 3CNLA 4LJAA 1BMTA 2B35A 3RPQA 5TRTA 3TQHA 3HXQA 2X9GA 1ZL2A 3EGVA 2RD2A 4JI0B 4PK4A 3BT7A 2J08A 1SJ9A 5C3MA 4N4AA 1KOFA 1FZPB 1VFNA 3EVFA 1AZLA 2ODTX 4LV8B 4DVJA 3I5MA 4ED9A 2NVWA 5FFNA 1EFRA 4FQGA 1PUFB 5H68A 4A8TA 1HQDA 2KWIA 1AK9A 2XLBA 2ZWOA 1SVLA 1X2NA 5BNIA 2H48A 3ZS8A 3IMFA 4BX9A 4YCSA 3I1FA 2XCLA 4EJFA 1XRMA 1Q92A 1XC7A 1RBYA 2K2WA 4UVGA 3JCUC 3QXCA 5K1ZA 4CM9D 5FKLA 4PX2A 4RTQA 1NG9A 1F8XA 3FXOA 2CYBA 1TTPB 4Q1CA 4EO7A 5K6AC 3KFWX 2R00A 3QW2A 3B3FA 4FOLA 3UC9A 3QHAA 4Z49A 3NMUF 3HFJA 4AECA 3EX7C 2XXAB 1X9GA 5TMPA 2MTBA 5BW6B 5CBPA 4HWTA 3TM4A 1RABA 2P6MA 4TGLA 4UD2A 3C8ZA 4QXMA 1S8OA 1XVLA 2VB6A 2C0QA 3FCAA 4RVOA 5DO9A 1ZONA 5FWNA 1PVVA 5ABPA 5HCIA 5JD5A 1IOWA 3UMBA 4DPMA 1OILA 1TU0A 4IINA 3CT6A 1USVA 2X3YA 1BIAA 1RP7A 4P92A 3VR5H 4A73A 2IHVA 4A0GA 2C59A 4L72A 1C4KA 4WOPA 3ZGOA 2WHYA 2CHUA 3QP6A 2Z6VA 2QD4A 2O8NA 1PEKE 4EJWA 4V02A 4UU0A 3TI7A 1U2TA 5CH5A 3DPLC 5ICGA 2CWDA 2DP4E 4HNAA 5E6UA 1FDWA 2OT3B 4NBSA 3ABUA 1Z4MA 3ZR8X 2LCIA 3FUVA 4OQNA 4RIGA 4DSAA 1H65A 5LQRA 4X3PA 1J0RA 3IQZA 4KDEA 5G0UA 1HYGA 3I9NA 3P9NA 4LXTA 5J1YA 2EFDB 4BU1A 4EPWA 2XGJA 5DYIA 4N0DA 3C4QA 3ITNA 3VHLB 4DDUA 2NYRA 3EFOA 5I45A 1I2DA 4YAEA 2BKAA 4W6ZA 4G0PA 5ALHA 1M7BA 4DL9A 1ZVQA 1V5FA 5FRNA 2GPWA 2G67A 2C03A 3D4OA 3OI7A 3P1JA 1JIQA 2NSDA 4IHJB 5K3FA 5BNWA 4AVZA 1ND5A 3O9VA 3Q3CA 4X20A 1GQRA 3R9IA 1VB3A 2BAGA 4OGLA 1M2NA 1LCIA 4MLCA 4KYWA 5LZ4A 1UJNA 2Z3WA 3EPHA 4XFJA 4E6KG 4HPQA 1B0PA 2B94A 2K27A 4Q24A 3A4IA 4NQWA 1IZYA 4G4IA 4AYBA 4PXYA 5DBHX 3O74A 1CF4A 3I53A 1BE6A 1JVSA 3BTCA 4H08A 2FWNA 1MGPA 4HW0A 2JA5J 1EX1A 5B3SH 4N6NA 2MSKA 4OYLA 5J5CA 4IYRA 2EVWX 2IYLD 1EVQA 1RM3A 1YU9A 5EUCA 4R1QA 1OB2A 2Q50A 2GZWA 4N7BA 4LF9B 2IT1A 4OBEA 1N2ZA 3KWLA 1E6EA 4RPCA 3TW0A 4M8KA 2P2LA 4YAGA 2OE2A 3HGQA 5DIFA 3HZJA 2AHQA 3ZNNA 4RIIA 3TSYA 3NS7A 2FEPA 3ANTA 3FLAA 2JCGA 2F59A 1JBQA 4X64B 3H9EO 1UWVA 2RDPA 4EV0A 1FWZA 3IDOA 3VPRA 2XYHA 3M4YA 3PE6A 4X24A 4C3VA 3CDIA 1KZHA 1ULZA 3AW9A 4KODA 4R0NA 2VYVA 4UPVA 3ID6C 1AGPA 2OHFA 3AY3A 4L6IA 1PK8A 2D0DA 2IE0A 5T4BA 1YL5A 3VU9B 1G5TA 2ESHA 1C3OA 1YR9A 2H1WA 5HIJA 5KTOA 3C39A 4BMSA 4ENRA 3EUFA 4XLLA 3DMDA 4C3IJ 3JTGA 1T5BA 2ZUDA 5HMMA 2ECQA 4ZYLA 2LR8A 1ZWLA 2Y30A 2ACWA 3E4DA 4DQ0A 5BQFA 2BZTA 2N1BA 2O6LA 1AS0A 4U7PB 1USUA 1LTQA 3AR6A 3CX4A 3GR6A 4U7HA 2HMUA 3KR0A 5JAQA 1AJEA 2H5LA 3VMFA 4LCJA 3UICA 3V4GA 1O7JA 1YE8A 1A71A 1MD9A 2XAHA 3DBIA 3F6OA 3LOCA 1ZN7A 3P9RA 1K88A 4ZARA 5CB4A 1EUDB 3CLOA 2FNPA 1LBSA 1IEVA 4PPQA 5FR1A 3DR3A 1E79A 4YMVA 4YWHA 3U61B 3TO7A 3MWJA 4KN7X 4YIRX 5LA6B 4R1LA 3PUIA 1E92A 2ZVDA 3UMGA 1P31A 5JMOA 3F5FA 1U2DC 3BQMB 1CQIA 2VWHA 4DOZA 4HQFA 3EUHA 2B6HA 1BJAA 3PEYA 2PL9A 2JLCA 4BLSA 3ZU2A 4H3HB 4IUDS 1JHUA 1SAXA 2QN7A 1KU3A 3K2ZA 4NMLA 3W8FA 2QSHX 1JQDA 2FK8A 1B8IA 1TVCA 3G2NA 4L0ZB 3HB1A 3MXTA 2VSQA 4L4RA 5GV7A 2ZI6A 4LDQA 3ZDQA 4LF6B 4J00A 3ON5A 1MG5A 1ODDA 4D7AA 4AZVA 2JLRA 2CHEA 3OSFA 3ZY2A 1L4KA 2WUVA 1ZGCA 2GHTA 3C3AA 3LGSA 2X2OA 3ABRB 4X85A 3X1DA 5A0TA 1F8UA 4PR3A 3KB6A 4LISA 2GJAA 3V2UA 3ZJVA 1II8B 5JUWA 3QFRA 3R3HA 4IHTA 1QE0A 2BGUA 3VR3A 4CMKA 1E20A 1A2BA 3L3BA 4C7VA 1MH1A 4A0RA 1CEQA 2VA8A 2Z08A 2NVOA 1ILEA 1UEJA 1PJSA 2JFWA 3L77A 1UP7A 3C5EA 4B84A 1UR5A 4M9RA 2WKPA 4C43A 2BMAA 1UXIA 3AHFA 4CMIA 1MJ5A 2C1XA 1QQ5A 3GVHA 1ONPA 2NV2B 2VZ9A 1DOZA 7GPBA 3GLLA 1R1DA 3S17J 4TZ6A 2XUOA 1CSEE 3VKUA 4H1HA 4W5NA 1SUFA 4CHUA 5I47A 3TQQA 5FKNA 5TISC 2AFIA 1NYLA 4DV7B 2WQ6A 3U60B 1T15A 1T8WA 2QNBA 2KIMA 3RYCB 4HO1X 1D7OA 1O94A 1D0ZA 1SD1A 3MHPA 4CR8A 1YMUA 4DWVA 5AVUA 2OHOA 2I8DA 1KMNA 1OHHA 3G7NA 3T7TA 3VR0A 2P3OA 4WY5A 4P08A 2PMEA 3DEEA 2QTMA 1WUJS 1YLFA 3O4VA 4CL8A 3GFMA 4OMZA 3OE1A 3P4YA 3HO1A 4KWEA 1AHNA 4FSHA 1ZD2P 1NI4A 2CF5A 4Y0VA 4M71A 3DDUA 3ZHTA 3UMFA 1E6UA 2BHSA 3PC3A 1QFZA 2I7XA 4MICA 4ZAVA 4LFCB 3JRFA 3OFVA 1ZQ3P 3C6XA 2OQRA 2HADA 2NAPA 3AKEA 3ETHA 3N8GA 3OLVA 4JB8A 4WBXC 2W6QA 4GW3A 2NZXA 3A4YA 3T0GA 4B4VA 4NVRA 2JGNA 3R5JA 2WJPA 2BH2A 4IV8A 3HC7A 4DRYA 2VAPA 1C7RA 2IF2A 3ZDEA 1X1RA 1OFGA 2G9QA 1CUAA 2WDZA 3HKBB 3LX8A 4WA8A 4JBWA 1MVOA 3RC1A 3ZQUA 2XIGA 2N75A 2XRMA 5DULA 2JIRA 5JZSA 4ZV9A 4UFNA 1Z13A 1EM8A 2HREA 2J3QA 2X41A 1SC3A 4MR7B 2Y1OA 4QSMA 3G49A 4QBHA 4O4IB 4HF7A 3J7AO 3GLFA 4L9AA 2NT4A 4RCVA 1E3IA 4YBZA 5HS6A 1ZRSA 4D99A 4ABTA 5E7QA 5C7OO 3VWBA 1TU4A 4FN5A 4BVKA 2WSSA 2XITA 1WAMA 3OOEA 1ZQ9A 3LUDA 3E97A 4BY7J 3A0BC 4DJAA 1YDEA 4E7JA 4ZVPA 3MS2A 3K0EA 1O0BA 3WLIA 2LF7A 1CYDA 5CQEA 3H8VA 1GKLA 4MYSA 1LPBB 4HHEA 4PPFA 4KAFA 5IXSA 2QS9A 5AJXA 5EJIA 2PX8A 3TDNA 1W4RA 4UEKA 5TEWA 5C7LO 1ABBA 4XOUA 5AJTA 1H8ED 1OX4A 4NQWB 2Y93A 3IJPA 4URFA 4E11A 3AEQA 1WO8A 3CE9A 4FX0A 1D2MA 3MCWA 4TSRA 5E9QA 4B8YA 4E5YA 3H7AA 2OZLB 2PGNA 2RG7A 2HWVA 2YJ5A 2FU5C 1Q0RA 2Q6IA 3D0OA 1OHHD 4FDUA 4W5JA 3WYAA 4X91A 1RQ2A 3GLTA 4F21A 3ZG6A 1OBOA 3PNVA 4IEEA 2W48A 3BXOA 4O4LA 4A0QA 2JAXA 2R6FA 1YJWI 2CFIA 2E18A 2CVPA 1TK2A 4PNZA 3D5SC 5JDIC 1KP2A 2WYVA 2VR1A 3HYNA 3EFOB 2OSVA 2C94A 5EIAA 1WG8A 2JGFA 4FCTA 4KR9A 1JHRA 4DF3A 5JBIA 2DA3A 1H2BA 2PJRB 5IKPA 2ZI3A 4JXKA 1M2EA 5LDDC 2C9CA 4ZOQI 2LKXA 5ELMA 2V6CA 4C7JA 3DA8A 1P73A 5BQXA 2E34A 3KFLA 3RBZA 3FZGA 1YJBA 2Q5JA 4Y2SA 2I1QA 2DECA 3SJ7A 3UENA 3WNBA 3KVVA 2ID3A 4C30A 1M3SA 4ZAYA 1T98A 3B6AA 3ELYA 3GW2A 1ZJJA 1WMBA 3SJCA 2BUBA 2VK4A 1Z3CA 3OJ0A 4J9VA 5BQOA 5C46F 3GLGE 2CHGA 2PKYX 1JSCA 3B82A 4XD2A 1LVUA 4HVTA 1V11A 2GHIA 2OD5A 1LRLA 2UZ4A 2PD3A 1VKRA 1MBFA 5CM8B 3HKCA 1ORKA 3C70A 4LITA 1F5NA 2CO5A 2F43B 2RK3A 4N49A 3HOVJ 4BEHA 2QMQA 2WWXA 3FMSA 1KPGA 3HCCA 5JQWA 3ZX4A 1XPOA 2NPOA 3BTOA 1JLHA 1OLUA 1X94A 3QYFA 1Z9CA 1I6KA 2SCUA 4R7ZA 4G5FA 3V1TC 4NDLA 3CLUC 2P5VA 4IKFA 2FRXA 2GD2A 1XD8A 3Q0VA 2HBQA 2I4IA 2J3MA 2RHBA 2WVGA 3IV9A 1I7PA 4AVYA 1B9MA 1A97A 2YV5A 1ETOA 4HQMA 2OQIA 4C3HJ 2IZOA 4CUGA 2O2CA 1JQ5A 2FF7A 2QDXA 3ED1A 3N1UA 4A8JC 4CKWB 4ZCPA 1IPHA 4CEHB 3G1WA 1QQAA 3PQ7A 3ITKA 3V1MA 4BQIA 3T8YA 2OENG 3UJ3X 2G0NA 2O6HA 2H11A 2QZPA 2VA9A 1HT0A 3NX4A 3ZU3A 1QP7A 1N5DA 2B1JA 2FZ4A 3HY3A 4XKBA 1X42A 3QPVA 3GUUA 2D3TA 3O3KA 3G8AA 4O4HF 1YTLA 4I7EA 3T7AA 2GK4A 2CQNA 5J9FA 3KOXA 1T34A 4OB8A 4TKUA 3THOA 5KWSA 3HCOA 1KMHB 2DUWA 2PE5A 1M8FA 4UV9A 2WY7Q 3NHAA 3ZD6A 4G4SO 1VLJA 1YVRA 3W2AA 1JIVA 1Z4KA 2IFTA 3E7PA 1XRQA 2Q46A 3PNKA 4YFVA 2ZCVA 4AKSA 3DB1A 4L0YB 1NRJB 4KXWA 4Q18A 3C3YA 1S2MA 3NHRA 4LKOA 2VFAA 3VHXA 1TUGA 2FN4A 1ZRDA 3B1KA 1IBRA 1ZGZA 5EJ2A 5FTNA 1LQ1A 2BBSA 2G6TA 2HL6A 3TVTA 2D5IA 3VC2A 3EDOA 4OHWA 4ZO9A 4O2AA 1MTZA 1T2EA 2RFLA 5G41A 1N0UA 1NY5A 1P0PA 4TWBA 4J0HA 2GXAA 4WIAA 4XDGA 1I94B 5DM7F 2H8RA 2P6UA 5F27A 4QO8A 5FA8A 1AKMA 1W93A 4NNPA 4PV7A 3ZN0A 3KV3O 1M83A 1FYWA 5BUSA 3VQTA 4HUQA 3B5IA 3NBQA 5JH7A 5FKMA 2FSHA 2W85A 1NM5A 4PN3A 1MJGM 1UB9A 3QUBA 3KUXA 3RAJA 3VNQA 3II6X 1N9KA 3JATB 3LSJA 4DGWB 2JH3A 2JJ1D 4PWYA 2VUIB 5G0WA 5HF9A 3EC1A 1JFRA 2R96A 2ZIXB 1A8UA 1QRYA 2KBEA 3NIWA 3PC8C 3V7CA 2G09A 2X1VA 4IFTA 1ZNQO 4QBIA 4Y2UA 3EQ6A 1DFIA 5AM4A 3VR2A 3DZGA 1F06A 3I09A 5HX7A 3UH0A 1UMBB 5F04A 4E2XA 3A36A 1SM4A 5DUIA 3BXHA 4NAUA 3RU9A 1DGRM 4AWXA 2VZEA 2XCQA 3QAHA 1NW3A 2YVUA 1LLFA 1SKYB 1XDDA 1GR0A 2GBYA 1W87A 2OC9A 2PD6A 2Q4OA 3A1VA 3VH2A 3X2QH 4KQ6A 1UL1X 4JOBA 4PLCA 4U4AA 1Y1PA 4XAQA 4JLBA 1NXWA 3LUGA 4OH1A 3DW1X 1MOQA 4QE3A 1PJLA 5FX2A 1FNCA 2P91A 1X1BA 4LWPA 1Z33A 4OGGA 5JWHA 4TRNA 2OWEA 4MKXA 1Y42X 4M0PA 1RCUA 1GKIA 2PU5A 2QQGA 2JLXA 1AKTA 2JIDA 3DYBA 2NVYJ 4J8PA 1Y0NA 4OQ4A 4DDKA 4Q9NA 2H63A 2DPUA 3X1JA 3I4MJ 2UXDB 1L3CA 4JBIA 3HUFA 3WDKA 1MZVA 4RPHA 1FNSA 2VSXA 4GVPA 1FQOA 1ZJ4A 2LF8A 1EGHA 2A5YB 1M6HA 1N2GA 2KHMA 2A9VA 1MW9X 3DONA 3K2QA 5C4JJ 4FTWA 2Y9PB 2V7TA 2ZDQA 3STYA 4A2WA 4C89A 2CEKA 4PR0A 1MAWA 3A32A 3FHOA 2ZUFA 5KJ6A 5JWOA 4FFDA 1Z0FA 3UQYS 1FP6A 1Z45A 3NHYA 5LOVA 3QG1A 4GBMA 4AQYB 4DPLA 1BWSA 1GEGA 2ZBUA 1EWKA 1PT5A 3WHBA 1XF9A 4G86A 4BCCA 2OV4A 1FFYA 4B4WA 3DDWA 3FOBA 3T1YB 4P5DA 4EG5A 4F11A 5ERXA 5AJWA 4IJVA 1WMAA 2ZITA 1YZTA 4XM2A 1XMJA 2BW3A 1P60A 3CCBA 3COZA 3A2NA 4OJTA 3W1VA 2PZMA 3W6ZA 4AF6A 1FFGA 3A0RB 1X6VA 4KK3A 4RESA 1I3LA 4BL5A 1PGQA 3EIUA 1XIVA 4N0QA 1Z21A 2G88A 2J4CA 3REGA 3RRBA 4O6JA 4BL0B 3EG9B 1E5QA 3K6JA 2PT9A 1ZKGA 2NV6A 4D9GA 2X7XA 2HQ1A 4L75A 3G17A 5I4CA 3H6KA 5BSKA 3G5AA 1POGA 1EFRD 1LFDB 1U65A 4B48A 4JP1A 2J6CA 1IM8A 1X87A 2E2JJ 5THKA 1TRHA 1YR1A 3BT9A 1T5TA 4OQQA 4CT5A 4RZ3A 2INGX 4KPUA 1CWUA 2HBZA 3EISA 4LWQA 4Y18A 1VKZA 4Q4CA 5AHRA 3OPXA 1LRKA 4PYNA 3OYKA 4KQMA 1IIBA 2CGPA 4YRTA 3V32A 3QMVA 1RHKA 5EPOA 3HLTA 4W5TA 2TS1A 5FLMJ 2AS0A 2G36A 3NNNA 3G4SI 1J75A 2XB6A 3F3YA 4HKTA 3HYIA 4MCAA 2ZVQX 5D5WB 3F8FA 2B7EA 1IN1A 2OHIA 4B76A 4YCDA 3TI9A 2ZRHA 1VQMI 1BNCA 3MIIA 1A9YA 2IOFK 2KI5A 4KH0A 3WRYC 5FOQA 2Q99A 2XY4A 4YCNA 1H66A 3HSKA 3DBRB 1WJEA 3KQSA 4MI9A 4BLVA 5IANA 1Q1AA 3CFYA 5DU2A 5T64A 5BW5A 3JZFA 2GBFA 3OOUA 3BWYA 4L07A 2Z58A 4A23A 4F85A 2P4HX 3MINA 3MTQA 4FW8A 2OO3A 1U1EA 4X1IB 3BZKA 3VKFA 1XHFA 3ZV5A 5IP6A 1CYEA 2QAGB 3U4QB 1K6XA 3V1YA 1F2VA 1N7JA 1PR5A 3FXRA 2B9VA 2ZRAA 4II7A 5ALTA 1MEOA 3B13B 4FHEA 4HX2A 3K1AA 3RFCA 1YTUA 1AUPA 3KDAA 1KJYA 1TCCA 1SZPA 421PA 4QYSA 1WQ2A 4ENJA 3EEOA 1EA3A 2G5TA 4A3DJ 3NALA 2LP4Y 1CDZA 1PJ4A 3HNOA 4WY2A 2OFPA 5KVCA 1ISPA 2IPMA 3H9UA 3S99A 4IKOA 2PGXA 1ON2A 2HD4A 3M70A 4K9NA 1XTBA 2RJ3A 4ZD6A 3ZUPA 1WJDA 4WFIA 2CVHA 5FOWA 3C6YA 5JNSA 3GCZA 3ELWA 1J09A 2F55A 3L7YA 2LYCA 3D4PA 2XF7A 3ENVA 3NAZA 5ALJA 2ZQ5A 4M1YA 4JYPA 4B9AA 4AULA 3WL6A 1O96A 1QS0B 1DJQA 4MLPA 1FOKA 4FMBB 4MROA 4NULA 1QX4A 1R4AA 1VCMA 1MJ9A 1XZMA 3FMFA 3PC8A 4MHSA 2V6BA 4PQGA 1B3RA 1VPVA 2QXUA 1KE1A 2RH5A 1B8VA 4UD6A 5LMCA 3IUNA 3WIOA 5IKOA 3GMSA 3CVYA 4F9EA 4MQFB 3DAFA 1U8XX 5EE3A 5C9ZA 3GGSA 4LWZA 2D00A 3KQWA 1H5UA 1JDJA 4GRIA 4L8YA 5F4ZA 3G1UA 4KOAA 4M1KA 3EGXB 4EWLA 3LQQA 4L95C 4DLYA 4LGWA 1SAYA 3GCDA 2G9UA 3EDRA 1GLGA 1N3YA 2R48A 4H7DA 4URYR 1JR3A 1APLC 2WJVA 2XUDA 1EXWA 4G0XA 4JI1B 2I6QA 3QPLA 4I08A 3FYUC 5LBTA 4BLWA 1W8IA 4RLQA 4DZZA 1H1TA 2VQFB 4MVJA 1IHDA 4RA2A 2ZYWX 1QVVA 2I3GA 5DLQC 4EMSA 3G0IA 1YL7A 4PHCA 4V38A 5ILGA 3RW9A 2QYOA 5DV9A 4XQFA 2B82A 3FN4A 3W2HA 1DEKA 4LRWA 2GUGA 2Q49A 3DU6A 4RSRA 2CBZA 2NW6A 5DGCA 4B3JA 4YUWA 5IKEA 3UGKA 3WNZA 3RU7A 5TMEA 2RHOA 3GDHA 3PQJA 3QYBA 3DLPX 4JBNA 4P1ZA 3HXMA 3NIBA 1SAUA 5LQCA 1KQOA 4EA9A 3WRXC 1MD0A 5LGNA 2VP0A 1C2YA 4IDBA 3USES 4EA7A 5GIOE 1P72A 1B1BA 1SH7A 2GWRA 1VJ5A 1OUMA 5IN5A 3GFSA 4GPIB 4OLBA 3W2EA 3DTKA 4TYQA 2RI1A 3A2MA 2P3SA 4HB3A 4C06A 1M1YE 4E21A 2YPRA 4BU0A 4R3NA 1CZKA 1I7QB 3KSRA 5ALOA 1EJ0A 2VQGA 4HS4A 4DJFC 1VL6A 1C8LA 5FXMA 3FA2A 4X1EA 4HDMB 5U9CA 1RP1A 3E35A 2H8WA 2V1DA 1N6RA 1OFIA 1S89A 2QGZA 4OAPA 2HWUA 3OY2A 1QQ6A 4D9HA 4PYLA 1EG2A 4TWRA 2B21A 2GXSA 2VNHA 3PPYA 4R0VA 4IHYA 1Z2PX 1ETWA 1LFBA 2N8GA 2BE7A 3NBKA 1K6YA 2F4VB 2SNIE 1KK0A 5JCXA 4OBBA 3RG8A 1KO8A 1U5BA 4NECA 2A69F 2BMDA 1E1RD 1FYEA 1ORHA 3IVRA 4ETWA 3IEVA 4EQ6B 4KDRA 1SVKA 5IT5A 1G38A 5F9FA 4BX0A 4N1AA 1E17A 2GXBA 4TXLA 3MTEA 2V65A 3VNUA 4A5NA 3TTXA 1TMYA 3BREA 2VPYA 4PJLA 4WDRA 4WTOA 5JSUA 5K20A 1BA5A 1N9GA 3I4LA 3OD1A 1UKBA 1XQYA 1Y3DE 1OIVA 5EUQB 1A8QA 2DPXA 4G25A 3M5DA 4QXQA 2QMYA 3C7KA 3HP4A 4MJXA 1M2HA 4H27A 3ZC3A 1XDUA 3HADA 5IM4A 1UJBA 2X8BA 1CCWA 1U8CB 4E7KA 4BV9A 4EEXA 3EXEA 4MVJF 1JYFA 5B30A 3TLGB 3GFTA 1E3DA 1NSFA 4LHVA 3H65A 2G28A 1NG6A 1NW4A 3HV0A 3Q7IA 4MITA 1IB6A 5DNDA 3K6KA 4X93A 1Z6AA 4ZREA 1B3BA 5F08A 3WTUC 1SPXA 2FWMX 3M3HA 1MHTA 3O8HA 1ENZA 1K7XB 3ZDBA 2ZUEA 2Z5FA 4ZRDA 3U1DA 2TMYA 3B1VA 3Q40A 1G6HA 2QWWA 4ZOLF 1VA5A 5IUJC 3V97A 1KYYA 1Y8RA 4CMGA 2D8MA 2CVZA 2IPLA 3EULA 1WJAA 2LFBA 3ASOH 1UJ5A 4IMJB 4L7VA 4FFLA 1XN7A 5HOQA 3N05A 1KZ6A 3EA5A 1ITYA 1UBJS 3BR0A 4XWOA 4GE3A 1TX4B 1H9AA 2WWFA 4X6AJ 2AJCA 4RJKA 3TLKA 1FMCA 3ZXIA 2HZTA 4RDUA 4ARIA 4DZPA 1YZVA 121PA 2O3TA 2OXRA 3A3KA 3EXIB 3M7IA 2D1VA 3MGAA 3JRDA 1LQTA 1CJCA 2R8YA 3GEBA 3GEMA 2PBZA 1KVQA 1ODTC 4FHFA 1EAMA 4LXQA 1EU1A 4MGHA 1FSSA 3H17A 3SYRA 4CMCA 4MPTA 4WKCA 1VYVA 1YCGA 5HCUA 1A0OA 3K0LA 2ZB9A 5LD2C 1IZZA 2COKA 3TKLA 1HG1A 4DMUB 4M7WA 2ZTHA 3AUJB 2YOHA 4TYYA 2MG4A 3OQPA 3V48A 3TTTA 4NB5A 4IO9F 3NHSA 2XB5A 3G3ZA 2R44A 1FTNA 4AIIA 3EXIA 1Y1WJ 5JLXA 4UVDA 1CRZA 3N9IA 2ZRGA 3R23A 1T0PA 1KA9H 4Z0NA 4AKGA 5KAMA 5FFXA 1D0VA 1EH5A 2CWWA 4X6UA 2OCCH 2XASA 1NI5A 1PAUA 2DYKA 2OF7A 2XAFA 3AHDA 5AK4A 5CDFA 4E1VA 2FE3A 3IKLA 1ESNA 4KO2S 1U3UA 1NW8A 2ZTVA 4XEHA 5FOVA 3M1IA 3TZ6A 1J22A 3REQA 2XD4A 4LIPD 3RUCA 5JWRA 4EQZA 2Z1NA 4GMDA 3CCJI 2MINA 4NQRA 4YRJA 3C0KA 3KL4A 1ACIA 3VR6D 1S7AA 1XMSA 3DZIA 2UZKA 1D0IA 1KVTA 1NAIA 3QU4A 1XEXB 4KZKA 4P84A 4CF4A 2J9XB 4HDNB 4KHPB 1EDEA 1A1VA 2NVXJ 1XR3A 1L5WA 4B1RA 5HDKA 3ESQA 5BV7A 2CXQA 1AURA 2JF0A 3NOQA 4L51A 4AMGA 2O8DA 4X97A 4MKZA 4Q0MA 2Z6UA 1EVIA 3QOYA 5HGXA 4M9SA 1LTHR 4WLEA 2WSSD 3EEQA 3UT0A 3A6FA 1HTTA 1ZK3A 5LB2A 5AHOA 3RS3A 1PKEA 3E3NA 2X58A 1ZG1A 3NH9A 3CX8A 2IXGA 1A50B 1AK1A 3L05A 1UDCA 4PIVA 4B5KA 4CQMD 3OESA 2REBA 2BEVA 2NQ8A 3P2EA 2E35A 3AI3A 4PIMA 3VJRA 7YASA 2VPIA 4RY2A 5CM9C 2HVQA 4JP8A 3MJTA 2ANCA 3WIEA 2X8JB 4MIEA 1LBIA 1ECLA 2X9DA 1HKTA 2AR9A 2H3EA 1PW5A 4IILA 1I50J 4P2BA 1FFEA 3IUMA 2Q5CA 3NUQA 3TZKA 8ADHA 4HWKA 4DV5B 2UUAB 4BP1A 3T9AA 4Q7QA 2ZXEA 1OAKA 1N8TA 3C15C 4ZZLA 3G73A 1A9QA 1T3GA 1UJCA 1HKUA 3JSAA 4PLTA 4HXGA 4BAZA 4KA4A 2WWGA 4HAWA 2RBEA 5IP5A 3R7SA 1TT7A 1JE1A 2C9OA 2VO1A 1BWRA 1I4WA 2I6XA 4W63A 2QE7D 3ESWB 2JIBA 3HUDA 4YASA 2WFAA 3EXHC 4QGAA 4PLYA 2X0DA 4B32A 4DY6A 5LNK1 4JX5A 2UVQA 1EQAA 4NOMA 4PANA 5D51S 4UUTA 3EC2A 4RK5A 1Z77A 1Q3TA 2IUFA 3OEWA 2V9VA 5AKXA 3VODA 4HRYA 3GVIA 5HKAA 5I7WA 4LY9A 2MW8A 2IGKA 2X9QA 2K9SA 3NW9A 1C9DB 2GN9A 4M6VA 3R1IA 4R83A 5J8FA 4OYHA 3BTIA 4TKVB 1UDAA 3FZYA 1XHLA 2CUZA 4RHTA 1KFEB 4IF6A 2H92A 3GW8A 1PYGA 1Y9AA 1S96A 3B7GA 5K4AA 2PXHA 4CM4A 4HGPA 3LZCA 2IYQA 2ISZA 1DG9A 2OQGA 2W2TA 3E81A 1JKFA 1CQZA 1IRIA 1M10A 1K6JA 3HKDB 3N07A 4MS1A 3NIGB 4JVOA 3TJMA 2DA6A 1UBNA 3P2OA 4QUBA 3ZWPA 4A2QA 1IG0A 1OWNA 3ABMH 1M6VA 2IZ7A 521PA 2RH9B 3NGLA 4HC4A 4LQDA 4M98A 3CPJB 4MWBA 4ND8A 5FOSA 1OGJA 2XUKA 1E7WA 4F9GA 1RRVA 4KIFA 1BQ3A 5J59A 2R1UA 4AKHA 3FDYA 4LYGA 2TYSB 3MOGA 1N2EA 4FGUA 4B3CA 1RYDA 5J2TB 2M9MA 3TMYA 1DLIA 1GPNA 3FHCB 3ZHYA 1XNGA 2PA0A 3BD8A 3K6SB 3CU5A 3F72A 2WV9A 2EL7A 1GNLA 4Z7OB 4WL0A 3WY9A 5FTWA 1USWA 3H8WA 3IQFA 4KTTE 3Q5EA 1C3XA 4RDCA 5JR3A 2G1KA 4QWMA 2WC1A 3NYIA 1W85B 3LDFA 5IWAB 3OIUA 2QROA 2WICA 4B6PA 1CJTC 3U3XA 3WVNA 5A2QA 2H4ZA 5JCZA 3IP7A 2TMKA 1F7UA 1NXOA 5IABA 2H57A 3ASUA 1W2GA 2XT6A 3TGNA 1CS4C 1DMRA 5F0CA 1L2TA 1U0HC 5KINB 3RE1A 3G89A 4O08A 2NP7A 3QVUA 4HK4A 3CF6R 3EDMA 3QBDA 1S3GA 4JIGA 5NULA 1G8YA 4A0FA 4EYQA 4DTCA 1G16A 4F3NA 1XB2A 4QOGA 3ZQFA 1JQJC 3KLBA 4I4TF 1RI7A 1DC7A 4AY3A 1TBXA 5FPHA 4CV1A 1FBUA 1R50A 3FPHA 1PBTA 2BEWA 1G20E 4V2GA 2ZG6A 4OU0A 4MQ5A 4DLUA 4QTXA 5D3MB 1BBYA 2V4ZA 2HJGA 2OB1A 3U26A 4R71A 2Q1YA 2B4AA 3BE5A 1J4AA 1DB3A 2PVSA 3DU5A 2B30A 2SKCA 2SHKA 3GO4A 5JG7A 1R0WA 4QSHA 1RADA 2CYYA 2AW3A 4QATA 2HK8A 4Y6PA 1NBIA 4B2YA 4N4OB 3JQ7A 3H1CA 2BOLA 3EPZA 4GC5A 3PDUA 4DLKA 4IOAF 4UMFA 1ZI6A 3DCJA 3ET5A 3IERA 5KTKA 4BNCA 5FT9A 1R0KA 1KAMA 1UBUS 5AI0A 3PT5A 4LYAA 3CZ9A 1CR4A 5F1PA 3HI4A 3SP1A 5AW7A 1T8SA 3A06A 2AQ8A 3EGEA 4TTQA 2CW8A 3R0QA 1QF6A 3AF1A 2YTZA 2Y1GA 3A1EA 1QB7A 1DAIA 2A7QA 3PXXA 4Y1GA 2Y69H 1AKRA 1YHNA 3CCCA 1EP1B 3WZLA 4RVGA 4DM7A 8OHMA 1M0EA 2GN8A 2VL8A 2BTOA 2I4MA 3PLNA 1NVDA 4QHSA 4C08A 1ADGA 1YJ5A 1T25A 4KN6A 5JHFA 3IP5A 4HBLA 3UF0A 5MN5A 1HDGO 4N8SA 3F98A 1GPWB 4G9GA 2EYUA 3LT5A 3MS4A 5CFZA 5JXWA 1YX5A 3KFVA 3F2VA 3PNPA 4O25A 2BGTA 2JANA 2W98A 1L7PA 4ZANA 1Q0ZA 3LLUA 1W34A 2XMRA 4TROA 2WPNA 3W5IA 3D7NA 4DV3B 3CZ5A 1W25A 2KJBA 1P81A 2EQAA 5DLDA 5H4HA 1VBMA 2BUCA 4E13A 4DB4A 2WJ3A 4JB0A 2DFEA 1R4ZA 2RJOA 3L2UA 5HF8A 1MZPA 2QSZA 4G01B 4OK5A 3GFJA 1NX9A 2C96A 2HSJA 3Q0WA 2XNCA 1VRWA 4GQAA 4PC1A 3ZI0A 5C5CA 4AY6A 4B4OA 1J2TA 4HDAA 1V6SA 3AR3A 3D8RA 3OJWA 1UBEA 1J0XO 2O19A 3N0VA 1EXDA 2O4CA 1RHRA 2P35A 3EFHA 3SYLA 2NSYA 3GJ3A 3NPAA 4I9UA 4IHJF 1NPYA 2VYFA 4LDNA 3FCCA 2XE7A 1L5NA 4IDCA 4KMSA 5A3RA 4MMXB 4JBYA 1J9EA 1YVUA 3HDJA 3LSTA 5JJIA 2Q4EA 3THYA 4NK5A 2HO5A 1NVGA 3C3CA 4MW5A 4UDOA 5I7AA 1KFJB 3AFNA 3I05A 3RPEA 2W00A 3H83A 4IGAA 2GRUA 2ORVA 3DF9A 2A1TS 1CY8A 3HFGA 3OOHA 1MMAA 2AN5A 3L7BA 4FLEA 5CYFA 5JZOA 3ZDXB 4BVBA 3KX2A 3KZMA 4BUPA 3EOZA 4GSKA 4TN1A 3ZDRA 3M8KA 4QJIA 5IH7A 5K6AA 1IBCA 2DFIA 3OU6A 3VO9A 5LQKA 5E1BA 1V16A 3QX8A 1S3IA 1WVRA 4JP5A 4MW0A 5ALNA 3RVJA 3F3XA 1K4YA 3DOHA 3QVLA 3VOSA 4F2DA 3L8DA 3H8JA 3ENWA 2ZU6A 3LXUX 5T8KC 2JVJA 1EZZA 2GF0A 3HWRA 1ETUA 2JUCA 1GZDA 3O4RA 1MR3F 2XVCA 1EDOA 2WFZA 4J76A 1MO2A 2XA2A 3U3KA 1IWOA 3EJWA 4XRSG 1ZCFA 4JUIA 3QU3A 1Z28A 4YXFA 4NC8A 2OTJI 1ODFA 4FMCF 2LKCA 3HR4A 5DLPA 1RXWA 5HDNA 4BIIA 2ZBRA 5HFJA 5B36A 1R5JA 4K9RA 3ZNPA 1QJ4A 4C9BA 4H7KA 5J58A 1CUBA 3IVAA 1M34B 3DM9B 3I8SA 2DSTA 1KMIY 3HPQA 3DZBA 4DV6B 3L6CA 3BJAA 1NYTA 3JWPA 3NBMA 4PUSA 1A96A 1PL0A 4UVIA 5GZ3A 4KIJA 4TVKA 3ER6A 2VJMB 3KOUA 1O3QA 1TYCA 2E1OA 3SF8A 5T3YA 1U99A 2YXNA 4ZV7A 4PRKA 1PL7A 4DIMA 3IS3A 2OLKA 1ADYA 1DEHA 4S0HB 1QOQB 2REQB 1VGQA 3IJ5A 3OQ1A 1L7MA 1U8EA 1ZNZA 2R6DA 2WVHA 3HGGA 1RJGA 3HYLA 3IAM1 2FSVA 3C98A 3PGMA 4GR5A 4E2YA 3KVRA 4DXHA 2Y1XA 3KSAC 1WZNA 1A36A 2F2TA 2WMDA 3G2LA 4FI3F 2XSZD 3E9ZA 4MV9A 1MN6A 1ZPDA 2RAUA 5AR1A 4YJHB 3E9YA 3FYUA 4TVBA 4RA9A 3UFXB 3LKBA 2IP2A 5LHHA 5CIYA 4BJ5C 2Q29A 2XYPA 5CLFA 3LCVB 5ALKA 2KLHA 1QYDA 4KRGA 1QRTA 1XTUA 3IWFA 1ATZA 2C2GA 4D5FA 4OMUA 2I8AA 1FTGA 4PFSA 4DRXB 1YFLA 4PN7A 2XMBA 3KDSE 2JH8A 5HOEA 4MJLA 1MKMA 5BSUA 3WGYA 5LMZA 1ZCAA 4EM2A 2JI8A 4XVCA 2JLQA 4N5MA 2L9NA 3ZDYB 5HXAA 1F14A 2IP4A 2Y1KA 3IQEA 2LNBA 4GEGA 5FFFA 3FM3A 1I13A 1IJEA 3A9UA 4Q3NA 4CE6A 2QLBA 4MV1A 4LFAB 1NG1A 3DVQX 4HH4A 1O6FA 1KKMA 1KA8A 1OAAA 1JIIA 4EI7A 3ETDA 1ZJ5A 3UWPA 1KVSA 2I5PO 3A9RA 1EV7A 1BX1A 3EH1A 3LDGA 4GX5A 1YQUA 4N8EA 4PBTA 4AI6A 1ACMA 1X3LA 2H2GA 3Q9VA 3TCKA 4CKCA 1KEVA 3WGTA 1QRAA 2Q0HA 4DW8A 2MLGA 4KC0A 4IGEA 3VFDA 4L9NA 1DWUA 3SQOA 3HB9A 1RWQA 4AIJA 4RK7A 4XYLA 4TS1A 4J16A 1JMKC 3PWSA 5FROA 1BVYF 4FGWA 3O84A 2CW7A 1KWGA 5ESRA 3DS8A 2ID6A 3A37A 3B6KA 1R22A 1D09A 1HETA 3TS1A 4KLZA 4XYBA 2HSGA 5DGTA 5HDGA 2YX4A 2IDKA 1IBSA 3FBIB 2RI6A 3OU7A 3H4MA 1M34A 3CWQA 4Q9AA 5JS7A 5F77A 5TF4A 1GVNB 3QMWA 4FYJA 2QVYX 3AXTA 2K02A 4I6EA 4JI7B 1L4BA 2SCUB 3ESAA 4M49A 3FVWA 1D9XA 2WM9B 3PUJA 5ITZB 3Q9LA 4KN9S 3VZSA 4OHYA 2PMCA 3A28A 3K4HA 5BN1A 2I3ZA 3AY0A 3QLUA 4OVKA 4ZPJA 4IHAA 3DKWA 5CA0F 1BO6A 2GVNA 2GUWA 2WA2A 3CZMA 5DWVA 3VV2A 4PTZA 3W05A 1YZ3A 4ZMBA 2YWXA 2O2JA 3RJMA 3B52X 3MILA 1ATIA 2AIRA 5FD6A 1YE3A 3ANLA 3VX3A 4B31A 1GPAA 1BROA 4MQ6A 5DHUA 3WZ2A 1XYYA 1M1YA 2BPOA 1YHZA 2HGCA 1Z5GA 1FUYB 4ZVSA 5FWXA 3ZWVA 1LBTA 1HOTA 2VPWA 1C7QA 3OJCA 2QKYA 3PYXA 1RETA 4JENA 2R47A 3BIJA 4IHKA 1P2GA 1BGWA 3GX4X 3AJRA 4MO9A 3TZQA 2XKBA 1DXHA 1JU4A 4I9NA 1O2DA 1WUYA 4CQLB 5GVRA 1CUGA 2XUPA 3O1JC 4PAOA