4PGHA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
354
structure length
354
Chain Sequence
AAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 101
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pghA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pghA02
3EVFA 3DOUA 5DM2A 5BOXA 1KPGA 3BT7A 3NDIA 4I7HA 3B73A 5HLHA 1W4MA 4HF0A 3C0KA 4MQ4A 2IBTA 3PS9A 4O5VA 5H6RA 2VT2A 4LMYA 5TJJA 4WX9A 5LR6A 2IFTA 3P9IA 4RB3C 2FMLA 4KN7X 4R1HA 1I1NA 2O0LA 3BUSA 2HKXA 5K09A 3FXUA 3I58A 4MEYF 5EQJB 4G6DA 3HCBA 3S68A 2ZO4A 4C08A 4RTLA 1IN5A 3P2EA 2OQRA 4IV8A 1TQPA 3RI4A 5T6BA 4QPNA 2K7LA 2XUBA 3GGDA 4OBWA 2XGXA 2F5CA 4MQVA 4YUYA 4S05A 4AZSA 2QZ8A 2B9EA 2B25A 4PYLA 2AOTA 2GAUA 4QQKA 4BLUA 5FQNA 3FTFA 3PQJA 1OR7A 4N0BA 2FXAA 2BE5F 4CKCA 4FS8A 1NE2A 3HCDA 2RKHA 5K0GA 2PX5A 4A0XA 2L01A 1Q1HA 2DK5A 5DD4A 3FXRA 5H6QA 3WGHA 5CUQA 2XBMA 4RB1A 2FEZA 1J0RA 3V4GA 2JTVA 2ZZMA 3K2ZA 4BXUA 4C03A 1RI5A 1FP2A 3SGLA 1IXCA 2NS0A 1I1SA 2XROA 3OE5A 2XASA 4POOA 1B6AA 4HZFA 3FWEA 2HYFA 1FSEA 4HGYA 5E1MA 1KYWA 3OZSA 1FBNA 3FYCA 3DQVC 3DR5A 3HM2A 3IEIA 4OA5A 2OBFA 3P9NA 3GFMA 4LJZF 3F8NA 4L5JA 5FD6A 1F4KA 5M5BA 1BKYA 3JSPA 2FBKA 3LSTA 2M45A 4MHGA 2L3DA 4P5OA 4F7ZA 5E18F 2UXXA 2K86A 3G8BA 1IAWA 3ABUA 1W7PA 2KJCA 3NW9A 3ELDA 4F84A 1JG3A 3M9AA 4GOOD 2VT3A 3T7SA 3NVMB 2KIUA 2KW5A 5D5WB 1YFHA 3HCAA 1E17A 5EVJA 4YV1A 3Q5FA 3EQLF 4R6XA 2C7RA 3E6BA 2DQRA 4BH9A 5IT9Z 1RJEA 3ZQ7A 1WRJA 1NBHA 5T67A 5B1SA 2HKOA 1N7IA 3F23A 3TFWA 1KA8A 2CFXA 2NYXA 4HTFA 4HG2A 3BJOA 5KQRA 4QLCU 4BLVA 4IXAA 3B3JA 4YV0A 4IF4A 5E8IA 4QQNA 3P2KA 1UB9A 4HV6A 4WF2A 3CBGA 2Z33A 4OX9Y 3J80K 4M73A 4I01A 2NXEA 1KQ0A 1LDKB 1REPC 4RTRA 5CYVA 5ILVA 3B7PA 5FWAA 2PVCA 3FPEA 4MGRA 2JH8A 1SKMA 5FO5A 1MGTA 3JW4A 3SQNA 4IHTA 3MCTA 4BY9E 2EX4A 3OFKA 2NP6A 4PYQA 3WU0A 1HW5A 4Z2YA 1KIAA 3KQMA 3E5XA 2H00A 4GC9A 1AQIA 4G9YA 2NXJA 3SZPA 3GRRA 2PXAA 3X0DA 1CF7A 2B78A 1Z91A 5E1OA 2G7HA 4LD5A 1DL5A 3CJTA 9MHTA 2NRAC 2FSWA 3KP2A 2OPBA 2BH2A 3PQKA 3LFKA 3BROA 3ABTA 2K4MA 4RV9A 1Z6TA 2MA3A 3WTVC 5DXJA 5ERGB 2QENA 3BGIA 4G94A 2EA2A 2IJLA 2G8NA 2UYHA 3O7WA 4L7VA 4BYYA 2HV9A 1TNTA 4LLNA 3PLAE 1NBIA 1U2WA 3DF8A 1ZG5A 2ZKZA 1SUIA 5HS7A 1HKTA 3R0QA 4GYGA 1TBXA 2M1BA 3L09A 1YW8A 3HVJA 3M6VA 1HW2A 3MB5A 3HOTA 5ICEA 4A12A 4IHSA 1FSHA 4UUVA 4P9FA 3PB3A 4C04A 3NVKI 3BWMA 1D2HA 3E6MA 3CGGA 3DUWA 2LD4A 4RGRA 3B89A 1T98A 5CCXA 1RI1A 2AXLA 5JUWA 2WA2A 4UVAA 4LECA 2A5YB 3SXJA 4Y13A 3VC1A 1J2XA 1FZPB 2PMUA 5L3BA 5D8LB 3N4MA 1X1BA 2JJQA 3WTTC 4M6YA 5FWDA 7MHTA 1HMYA 1WKMA 1RI2A 3K1MA 4U0YA 4GQBA 5DSTA 2NAZA 1P92A 4LG0A 1OKRA 5T64A 2GS9A 3R0AA 3TOSA 2LF8A 4P7KA 3THSA 1X3UA 4LG1A 3G89A 1XCJA 3SMQA 2V1UA 1PRYA 4UNOA 1HSTA 4UVCA 4FSDA 3TM4A 1VP3A 3GRVA 3E3VA 4U0VA 2MLGA 3EVGA 3HTSB 5EEHA 3EETA 1BN5A 2XYQA 3RODA 5FA8A 4C4AA 5HLGA 4G6QA 1VPTA 1Z6RA 1MJ9A 3MFKA 2OD5A 1H9TA 3LHDA 2VE9A 2K27A 3RYPA 2ADMA 2Q41A 3WTSC 2J5OA 2YXEA 5CVUA 4RTSA 2CL5A 1TTYA 1XCBA 2PBIA 3A4TA 1UFKA 5EZSA 4X1OA 5G02A 3V7RA 3M6UA 1MHTA 3NMUF 4RGUA 2IGTA 2GB4A 1IF1A 3EYYA 3NQOA 4HF1A 1U6GA 2C7PA 3E5QA 2JH9A 2OB1A 2M87A 4PYOA 4WXHA 1O3TA 1O57A 5U4XA 1MDMB 4NHJA 4P58A 4ISCA 2K02A 2UWMA 1BI0A 4RVDA 2H6BA 4HF2A 4PYJA 3IRQA 1KU9A 2VBXA 2JRTA 3SFZA 2EFJA 1I4WA 3C18A 1TW3A 4RTKA 3TOAA 1L9KA 3V7SA 1I9GA 3SM3A 5L3GA 1F38A 2G7UA 2I6GA 3LCVB 4RAYA 1HQCA 3ZMDA 4RVHA 3RIEA 4QTUB 4HTFB 2J5PA 3I53A 1DPUA 4RB0A 2O61A 2YR0A 2VC1A 2GQQA 3ELWA 3KP5A 4QVKA 3P9KA 2C7OA 1WY7A 1T38A 5DYMA 2P7VB 1W5SA 1Z3CA 2FBIA 2G9WA 2AN4A 2FOKA 1O3QA 3VFZA 1RIOH 3QU6A 5DEQA 1IRGA 1D2GA 3U9GA 2AVDA 3KQSA 2WV0A 3K1PA 1R6AA 4YUZA 1B9NA 4I0AA 5A2QK 4PCAA 3G2QA 2OY0A 2ZWVA 3FHZA 4LG0B 5LQNA 3A27A 1YS6A 1Z9CA 3DMFA 2G1PA 3M4XA 3LCUA 4Y15A 2E5WA 4RAZA 5HOOA 3K0BA 5E1WA 4C06A 2OA4A 2ZSUA 3LECA 4U0WA 2AN3A 4HDUA 3G3ZA 4XBFA 1O9GA 1I6XA 3VEPA 3HP7A 5HDNA 1LJ9A 1JQDA 5C1IA 3NWEA 3RIRA 4HC4A 1WWXA 1ZG3A 1XSXA 5EHGA 5EMMA 3EVZA 1L3IA 1LEBA 1NW7A 4UOEA 1P1BA 2EFWA 3G73A 3G2MA 3QPTA 2YUIA 3KQWA 3C3WA 3GRUA 1RJGA 2WK1A 2MH9A 3MAGA 3R6TA 3T8TA 3BJAA 3GU3A 3KETA 1FYKA 3ZP5A 3WE2A 5C9ZA 4DKJA 2ZZNA 2PWPA 4KMFA 5E1DA 4YFKF 4RVGA 5DUIA 1OYYA 1IXKA 5LSAA 1ZHFA 5DT2A 2XVAA 3GUDA 3G5LA 5IT3A 2D1HA 3SX0A 1GXPA 1SFUA 2PEXA 1USTA 1FC3A 1QGPA 2P3LA 3LDUA 3QP6A 3Q7EA 5E8JA 3SZTA 5K1YA 3LA2A 1XMKA 2RV8A 3JSOA 5F6FA 2YQZA 2QBYB 5LQJA 4OQEA 1KR5A 2PWYA 4TV7A 3KQQA 1B9MA 1KP9A 2YTZA 2PXCA 3T5XA 5DXAA 3LWFA 5AONA 1EV7A 3EUHA 5ED4A 3LA3A 1ORIA 4M7RA 4CXMA 2RGVA 2FYTA 3GVAA 5D6FA 3EGEA 3FXQA 2W85A 5CD1A 4V0QA 5FHRA 3O6BB 2I7CA 1G3SA 5CLSA 4X61A 2XAHA 3OOPA 1AV6A 2A69F 4IKPA 1PP7U 2FCAA 3O4FA 1IY9A 4M38A 5F64A 3E7PA 1P4XA 2ZZKA 1YQAA 3GXOA 4CTJA 3HRMA 2RDPA 1DP7P 2CGPA 3OCJA 4PIMA 3LA7A 3T7RA 1QO0D 3CCFA 3IKTA 2AOUB 4CKEA 3EYIA 3BKXA 3DPLC 2ZULA 3M8FA 3T8RA 2E1CA 4U7PB 2FE3A 1HBXG 1R1TA 4GUAA 2XYRA 4H0NA 2P5LC 4GCVA 1IXSB 1G4DA 1X1DA 3KQOA 5GWXA 2HNKA 4ENKA 1G3WA 1GHCA 4E30A 2VDWA 3HIFA 5EIWA 4EK9A 2ZTHA 4CKBA 4OINF 3DTNA 1OPCA 3KPJA 2FHPA 1TNSA 2PN6A 3M6WA 4HX7A 5ILUA 4HX8A 1VL5A 4PINA 4C05A 5HIKA 3ZMSA 5K5RA 4HLYA 2YU3A 2ZCWA 2PV0A 1G38A 4BP3A 3T1BA 1XJ5A 3OFJA 3UJ6A 3QP5A 1YYVA 3ELKA 1IXRC 1J5YA 2D45A 1G6Q1 1UCRA 5KK1A 3TM5A 2BBYA 3IWZA 3FPHA 3KR2A 1Z05A 4RGSA 5LLQA 1XSDA 2PLYA 1MZBA 5KS2A 2X4HA 4AZTA 2MBFA 2CQKA 4DQ0A 3HVIA 1NHAA 5JFRA 2G70A 2Y1WA 2D2WA 2FNPA 4YIIA 1W5TA 3ER9A 4KIGA 4YMHA 2WA1A 3TKYA 3VSEA 5FADA 5CVVA 4ON0A 5K5OA 2YR2A 2HR3A 1JG4A 4LWPA 4U88A 4EQQA 1O9HA 2IA1A 2O3FA 1QYRA 5ICGA 1H1DA 3R0JA 1M6EX 2UYOA 1S7AA 2BEOA 1DDNA 4E70A 1PDNC 2V9VA 1PUEE 1NV9A 2Z6QA 4PYIA 2PLWA 3FTDA 2RVCA 1XGSA 3PX3A 2XRNA 2YX4A 1XXLA 2VE8A 2QBYA 3VOEA 2P35A 1IN6A 2DT5A 4EM2A 2EV6A 3F8FA 4F86A 1EG2A 1ODDA 2HOEA 5KVAA 2GWRA 3EVEA 4AIJA 4B8XA 2P4WA 3ECOA 1LDDA 3H92A 2N47A 2EJRA 1FOKA 1KU2A 3JWJA 4S04A 3CUQC 1WI9A 2V1XA 5LQKA 1YFJA 3ANXA 1YIOA 3M8EA 3P2IA 3P7NA 4CGZA 2HFHA 1USSA 4DA4A 1P39A 2PGXA 3DULA 2VDVE 3WTWC 2YVLA 3ER8A 1Z7UA 1KU3A 3UZUA 2OKCA 3EGIA 2EFOA 3TPZA 1ZREA 2QQ9A 1LEAA 4YIFA 4ZYGA 3M70A 3E6DA 3HRUA 3HUGA 3DXJF 3FPFA 5EG5A 4D0PA 2VOPA 3MZHA 4CICA 1R1VA 3J80Z 1R22A 2EK5A 5FLXZ 2FK7A 2R7FA 4KYWA 3HSFA 3O31A 1VBFA 3KQVA 3HA7A 4P96A 4OBXA 5F2OA 1YF3A 1EJ6A 2O0YA 1TW2A 2RQPA 2V74B 1V3FA 2BV6A 4PGHA 1IW7F 2XAGA 4KUMA 2JT1A 1RI4A 3HVKA 1U2ZA 4DZRA 1H9GA 3BPXA 3R61A 4GC5A 3M1EA 1PJZA 2XVMA 3LKZA 5LEJA 4U7BA 3R4KA 1AWCA 4I02A 1F9NA 4GOLD 2ZBRA 2ZJ2A 2P8JA 3PFIA 3FRHA 5D8KB 1W7PD 2HTJA 1J59A 1O7FA 1BC5A 3ERCA 2CG4A 2HWVA 2AS5F 3P97A 4G7HF 2YX1A 2XV4S 3BKWA 1QPMA 2ONYA 2DLLA 5HIMA 3CUQB 3R24A 1ZRCA 2DTRA 2Y0MA 4EJOA 2ZBPA 3EVCA 3HHHA 3V8KA 5K01A 1S7OA 5JHUA 1J9IA 5DM0A 4CTKA 4WK8F 4GO1A 5KVRA 2NYUA 4IWNA 4MIKA 5FA5A 4X63A 1IN7A 2PSSA 5E1BA 2BGCA 3R60A 2XIGA 3OE4A 3HA5A 2DPUA 5HZMA 3GFLA 3GZ5A 3UFBA 3C7JA 4KFCA 1FNNA 3E5UA 3GO4A 3NTVA 4MHTA 1CF7B 4G56A 2G72A 3AAFA 2P3OA 4FZVA 1HNNA 3BWYA 1Y8CA 4LLGF 4E33A 5KQSA 1FYMA 3ELYA 2ZLBA 4ER7A 4PDKA 5MHTA 2XVCA 5DDGA 2PMHA 3LDFA 3VC2A 3NRVA 5HDKA 4Q48A 2OU2A 5E9JA 3QPHA 1VIDA 3HRSA 1LDJA 2EFNA 1ZGAA 4OA8A 1I27A 3E97A 3BZBA 3HCCA 3ULQB 1LNWA 2DQLA 4ESFA 4HW0A 3MTEA 1SD6A 3ROUA 5FULA 4XLNF 3RYRA 4BHBA 3GF2A 3WTYC 1WG8A 1X1CA 3Q87B 5FFZA 5HS8A 2E1NA 4ATNA 1E2XA 3ZMZA 4AVPA 5E9WA 5E20A 3TDZC 3CTAA 4E2YA 3F3XA 3HHGA 3KEQA 2CSOA 2DBBA 2PXXA 2Z6AA 1QAMA 4QTTB 1MJFA 2VXZA 4EJTA 3MQ0A 3K9TA 4IRIA 3KP4A 1IZ1A 5DX0A 3WGGA 3SSOA 5CVRA 4EJUA 4MTEA 4U7DA 5J8FA 1TLHB 3KR1A 1R7JA 1KPHA 4K6MA 2BYVE 4EJWA 4E32A 4LK1F 3AWIA 2JHAA 4HYEA 3I64A 3E05A 1NKVA 3SVZA 1L1EA 2GA2A 2QQAA 2P8TA 3GLXA 3VODA 2XAFA 3NJRA 3REOA 3MERA 5H02A 2A61A 3EVBA 3T0YA 3M6XA 3UJDA 2IPQX 5ICFA 3IHTA 1S29A 2STTA 1O7LA 1BIBA 4I98B 4OIQF 2PQ8A 3MAJA 3L2CA 3S2WA 3CC8A 2VONA 1L3CA 2OB2A 4XUEA 5K05A 5K0EA 4R79A 4GOMD 3V8JA 3M33A 4F85A 4PCLA 2KRFA 3HRTA 3I59B 1O3SA 3KU1A 2O6GE 2YXDA 3RKXA 2F5DA 5LGUA 2ZIGA 2A6EF 2C6YA 3HSEA 1ORHA 2K4BA 1DCTA 2Q0OA 4M6XA 1MD0A 3FPJA 1SQGA 3G88A 1JE8A 5HIIA 4L0ZB 1IM8A 2XKOA 4B09A 5D4SA 5J8CA 3GYHX 5CVEA 5K03A 5DCFA 1ZKDA 1FWZA 2IP2A 4QDJA 1ZAOA 4MWZA 3RJPA 4EVIA 4M9SA 2P5KA 3AXSA 3RPUA 3NEUA 5D6EA 3OZTA 1XGNA 2ZIEA 1YFLA 2VC0A 2A3SA 4CYDA 3IRRA 1JHHA 1J7KA 4G7OF 3JWHA 3T7TA 3ZN1A 2Z9OA 3QOXA 2ACJA 5HFJA 4L0YB 5D1HA 1U8RA 2FPOA 2YPRA 2NNNA 4L9TA 4XUDA 3F6OA 1ZLJA 4BLWA 1XGMA 1UWVA 4OOIA 2UZ4A 4ZH4F 3RKYA 1K6OA 5FD5A 4L9JA 2NXCA 3GRYA 4LK0F 2H1RA 2HTEA 3FMRA 2HEOA 5LHGA 3DLIA 4ESBA 3GFJA 3HSRA 1F1ZA 1P4WA 5DRTA 4HQEA 5HDGA 5EKXA 2STWA 4OU0A 5FCDA 4M72A 1P6RA 3JAMK 3P9CA 1UFMA 4DNCA 2GAFA 1MDMA 2P41A 2AN5A 5AIPA 3WSTA 3VYWA 5F1RA 3PFGA 4QPPA 2G71A 3IHUA 3BGDA 3E23A 3TO9A 2GXBA 4YUXA 4HOBA 5E17F 2LF7A 4ER3A 5DM4A 3L8DA 4E2XA 2IRFG 2JHPA 1WXWA 2P6TA 3UJ9A 2ZNYA 5EOVA 4EQZA 1P91A 3K0LA 3DKWA 2ZMEA 4JK1X 3GJYA 3GRZA 3LGAA 3FTCA 3KZYA 2L02A 1VLMA 2ELHA 3C6KA 4NECA 2IVMA 3DP7A 3I59A 3F72A 3TO6A 5CVIA 3D5LA 4M9ZA 1CGPA 5EMLA 2KJBA 4E2WA 2FA5A 3TGNA 3FUXA 2OZUA 1BOAA 4OQDA 5DM1A 3F22A 5BPDA 4GYIA 4ENNA 2EFQA 5LGNA 1N7JA 1V39A 5LHIA 2YSRA 2CW0F 2TDXA 4ZTBA 4CWAA 1R36A 1HW1A 5DTRA 3F21A 4YFNF 1JQ3A 4RWZA 4OIPF 4EMSA 1D5VA 4AZVA 3EVDA 3MWMA 1KQ9A 1RI7A 3E6CC 3P71T 3TQNA 3CJQA 2Z99A 2PT6A 4KDRA 1Z1DA 3KE2A 3GCZA 2EG5A 3A7DA 2ZMEB 1O3RA 3MTIA 5K5QA 4XSZF 3H2BA 1W7PB 1EIZA 1KGSA 2EFPA 1TPYA 1K78A 2P7CB 3TQSA 4YUVA 1QQIA 2EJTA 1H0MA 3ME5A 3GWZA 4V0RA 1JG1A 1WXXA 2ISYA 3RPQA 5LEKA 3I4PA 1NW8A 1LB2A 5F2NA 3DXYA 4FT2A 2CWWA 2DW4A 2IA0A 2PT9A 1F3LA 1SUSA 1XCLA 1YO5C 5CJ9A 3K1NA 4JXJA 3FPGA 1XCVA 4IPAA 2Z6UA 1SVUA 3KQYA 2O8XA 3KZZA 1JXSA 4FT8A 4QVGA 1B4AA 4ER5A 1FLIA 3EEYA 2P6SA 2P7IA 2PBFA 4P7FA 2NXNA 1OR8A 1SG9A 1JHFA 4ASNA 2GA1A 4IRGA 2AOTB 1YW7A 3NDJA 5E2AA 4GBED 3ERED 2FK8A 4HGZA 4U7TB 4WVLA 4KN4X 1T2KA 1EAMA 2I62A 3FUUA 3K6RA 3GW2A 1QAOA 3WE3A 3MZYA 4R05A 2F2EA 5E8RA 5BXYA 3LBFA 4AX8A 6PAXA 4AUKA 1EQAA 2RC4A 4X60A 2DFIA 1KPIA 4ETSA 1L3LA 1HSJA 2A14A 5EHIA 1R74A 3KR9A 5EZQA 5EMKA 3I0TA 10MHA 3BY6A 2ETHA 2DPMA 4I0BA 3Q9SA 2GLUA 3KPWA 3GZ6A 2DU9A 3TKAA 3PVCA 2A07F 1D3YA 4PYKA 4KMUX 2EV5A 2QLZA 5CM2Z 2ZFWA 1R00A 3DMHA 2RNJA 4M71A 1RUOA 3CLOA 3JWIA 4YV2A 2HR1A 4DCGA 4CDGA 3E8SA 1I1GA 2JSCA 1FBUA 5BMZA 1P4AA 3B3FA 2FQ3A 3UJ7A 2HMYB 2JPCA 5L3FA 2EJUA 3TOBA 5FHQA 5C0OE 3KPVA 3WG9A 3QAHA 3F8BA 2DO7A 2GA9A 4EKIA 4KVZA 1IUYA 3B3GA 4IV0A 1BJAA 1XDUA 2O05A 5GIPE 3GFIA 3C6MA 3DV8A 3WODF 4RVFA 4HX4A 5HOQA 1SMTA 3ZMTA 4FHTA 3KEOA 4ZYEA 3RDIA 5EKUA 3KLOA 1YTYA 3WTXC 5HVQC 2ADUA 2ONZA 3D2LA 4EM1A 3COAC 2HQNA 4EM0B 4A5MA 3SSMA 2IDKA 1HKQA 4RYLA 5LRSA 1SD4A 3KQPA 2H11A 4X41A 2H27A 3OU2A 5FTWA 4G8XA 3P8ZA 2Z3YA 5GOZA 4M37A 4MTLA 4O29A 1A04A 1SQFA 3LDGA 3HCFA 3GEZA 3KLNA 4DMGA 2OYRA 2Y1XA 3BJ6A 2ZBQA 4EGYA 4BHPA 5K0BA 2HGCA 4IRHA 2P5VA 3KKZA 2UZKA 1G8SA 1EH7A 4Y30A 1XSVA 2HTSA 3KP6A 1IN8A 4WCGA 4PWYA 3T0IA 4PNEA 4BQAA 5K8VA 3BOQA 2LKPA 1JTFA 3I71A 3O3KA 5E2BA 3ECHA 3H3ZA 2VDUE 2OAZA 3PX2A 5LRRA 5LHHA 2HQRA 4MTDA 3EMDA 3UA4A 2Y75A 2COMA 2HS5A 2UYCA 4ER6A 3UWPA 3K69A 3A7EA 1QANA 3G7UA 3G2PA 2F8LA 3BGVA 5K0CA 1XD7A 3ZMUA 3IKVA 2AR0A 4OMYA 3FRIA 5JI6A 5FFXA 1Q0SA 2M8EA 3ZMVA 4Q5SF 1D2CA 3BXOA 1I5ZA 4K2EA 2P3QA 1RNLA 3GX4X 5DPMA 5CCBA 2CYYA 4ENJA 4RTMA 3W6JB 2ZW9A 1ZRFA 4L18B 2DULA 1ZRDA 1VE3A 2PJDA 1K79A 3LQQA 1UIRA 2NP7A 1SMYF 4UV9A 3PFHA 5HIJA 3IL2A 2ZNZA 5IT9K 4DF3A 1VTNC 3V8LA 1X19A 2KIMA 4HRAA 2AZTA 3GNLA 1BI1A 4JBAA 1G8AA 2PX8A 3R6SA 5ILSA 2L54A 1JR4A 3HVHA 3FZGA 4GEKA 1INLA 5EC8A 4P9UA 2ESHA 2M5WA 4UV8A 1AF7A 4GOND 4JQFA 4HLXA 2PX2A 3KR0A 4ZZDA 4OIOF 3UJAA 3UJ8A 2V7EA 3HYIA 2DI3A 5E9QA 1XN7A 1V4RA 2LNBA 2Y48A 4KDPA 1NT2A 4R6WA 5CVDA 3OV8A 3MCZA 2AOXA 3U2RA 2O57A 2CMHA 5L3EA 4FX0A 1YZ3A 3O2PE 4DM3A 2BR3A 3CO6C 4LGWA 3UJBA 2MD5A 1R1UA 3F8CA 2O03A 1ZARA 1U5TC 3LPMA 2CWEA 2L4AA 2ZWAA 1BI3A 1DUXC 2VBWA 3THRA 2CO5A 1ONVA 1GXQA 4Q4ZF 3IYLW 3HEMA 5GM1A 2EV0A 2QM3A 4N9IA 5JVTA 2YXLA 3KFWX 1XDZA 2ZCJA 4KIBA 4XCXA 2EB7A 1TQMA 3BZ6A 2XKPA 3CUOA 2E7WA 3LQRA 2OZVA 3DH0A 2IBSA 5DRYA 4ZZLA 5DX8A 2QY6A 3QV2A 1DUSA 2L4MA 3BWCA 1WZNA 3EVAA 2IH4A 4FR0A 3M7GA 5KYGA 3FYDA 4AWXB 3EPPA 3J81K 3BDDA 5AIQA 3CUQA 1RJFA 3FM5A 2ZVJA 1IRFA 3HA3A 3FF5A 4CXFA 2IT0A 4A2UA 2F5FA 2JZYA 1OMIA 3U1DA 3MEXA 1NW3A 3A25A 1K78B 1XGOA 4G7ZF 2NNYA 3WGIA 5BQTA 1JQEA 2M30A 4RTPA 2HYGD 3I9FA 3EEOA 1HKSA 2QRVB 1R5GA 2VBZA 4A6DA 2KIFA 1QBJA 2JPBA 3C3PA 1B1BA 2D1VA 5FLXK 1BOOA 2XAJA 3QRFF 4I2OA 3ISPA 5JR3A 2LSOA 5D1NA 2ZFUA 2HWKA 2ISZA 3WTZA 2UYQA 3HCEA 3IWFA 2HDCA 4MQ9F 4HSGA 5DV5A 4M9XA 2PY6A 3NWBA 1GVJA 3W6KB 4RB2C 3WU1B 2FMYA 2PKWA 3RW9A 4MEXF 2EA4A 3ELUA 3TMAA 1YG2A 1ZG1A 1G60A 1FP1D 1AQJA 1PP8F 2PI0A 1BC7C 1UHWA 3FMQA 5FQOA 2PFBA 3CJNA 4NQWA 2NNWB 3QOWA 3U81A 2R6ZA 3LCCA 4MNUA 3R9XB 2AOVA 1F5TA 1KHHA 5K0NA 2V6CA 5LBQA 1M6YA 3DXZA 1R18A 1T0FA 2LDUA 1HXDA 3N97A 2FRHA 4CO8A 2VZ9A 3CVOA 1ZQ9A 1FPQA 1KQ8A 3GDHA 2IPXA 2PG4A 2MH2A 4KDCA 4XRFA 2GH1A 3KCCA 1RJDA 2P40A 4B17A 3ORHA 4RTJA 3FTEA 1D8KA 2MC3A 1XB4A 4WXCA 2JHCA 5DD8A 3DXXA 3RKWA 4YFXF 1D8JA 3TLJA 1BIAA 1FBSA 3UJCA 4PONA 5EEGA 4RTNA 2FNAA 3CO7C 2XYVA 2ESNA 2ESRA 2VP3A 4HA8A 5D5UB 4LWOA 2AS0A 2KKOA 4L9VA 2I9KA 3LAPA 2CMGA 3Q9VA 2R7DA 3L00A 4FGZA 1ZYRF 4HDVA 5CVJA 5K0LA 4RS8A 4E2ZA 4XLPF 1JG2A 3OU7A 4HQMA 1BHJA 4PYNA 4RTQA 2DPDA 2H94A 2RN7A 1KXZA 1BI2A 1VP9A 2Q2EA 3DFGA 1NV8A 3DEUA 1VQ1A 2C7QA 1XDSA 4PGGA 4GF5A 1EH6A 1R58A 5DUKA 3FUWA 3BPVA 4P55A 5HS9A 1EJ0A 3JWGA 2PJPA 5FGMA 3C1DA 3RTRA 5TRDA 1RZ4A 2GXGA 1U5TB 1NW5A 1ON1A 4KT5C 5J6XA 5HEKA 1JTEA 4ENMA 1L3BA 1YZHA 4C07A 3LKDA 2Q8KA 1Q0TA 2A6HF 1BC8C 4UVBA 5DCMA 1DPRA 1WS6A 5EIFA 4R8SA 1ULYA 5IKMA 4WXDA 3CKKA 2FBHA 5L3DA 5D4RA 1RUNA 3SSNA 5FB2A 3F4KA 2OO3A 2FF4A 3F8MA 3LX6A 2XAQA 4KRGA 1WSUA 2BM8A 3R3HA 1LQ1A 5H20A 4KW7A 1T6SA 1YUBA 4Y2HA 2ZBKA 1YS7A 2FRXA 3EMBA 4XSXF 5HLIA 1S8NA 1U78A 4L5IA 5L3CA 2PX4A 4M74A 3WTUC 1ZGJA 1O54A 1XMAA 3KP3A 4LB6B 4KWCA 1R8XA 4ESJA 2W84A 3DPTA 3V8VA 1MJBA 2CKDA 2OXTA 3FM3A 2P1DA 2IH2A 3BWGA 4UHTA 1JSZA 2IIPA 5BP7A 5DLYA 1N2XA 2BR4A 1OYIA 2O06A 3QU3A 1C0WA 2B0LA 5DX1A 1MJAA 3OU6A 3TRKA 1ON2A 2AVNA 1SD5A 4LB5A 3DMGA 3HOSA 1SFXA 4EGZA 4M36A 4P7JA 2QE6A 4AZWA 1JGSA 3HTXA 2QYOA 2VOOA 3UA3A 2IDJA 3KPUA 2W24A 3VB2A 5EMJA 4BAYA 3BWBA 2F5EA 2BZGA 3TR6A 2HZTA 2IA2A 3A26A 5ERIA 1K7AA 4RSRA 5P8WA 3AJDA 3JTHA 3SHFA 2H6CA 4XUCA 5FUBA 3DLCA 5LQRA 1YB2A 4P7GA 4HH4A 5EPEA 1T43A 4AIHA 4GXOA 3IC7A 2ERCA 1TQIA 4YUWA 3I5UA 5GP1A 1FJXA 2W25A 2K4JA 3CDHA 3FZVA 2YX7A 1AOYA 2AOWA 4BP1A 3TDUC 1KU7A 1YLFA 4BNCA 1G3TA 5D5VB 4CHUA 1P1CA 4RGXA 2OQGA 5GIOE 2W57A 5LQAA 2B3TA 4ZYHA 3JAMZ 4EJVA 3JTGA 1BBYA 2IW5A 3UBTA 4NB5A 1FX7A 4WWCA 2JG3A 4FT4A 3PT9A 1KYZA 3I54A 5E8GA 4BHCA 4ZYDA 4EKGA 1FYLA 1XTPA 3J81Z 1YW9A 3AY0A 5IH3A 3D0SA 3TO7A 3AXTA 5DTQA 2VBYA 3L7WA 2XHKA 1IN4A 3GO5A 2QVOA 4R8RA 1U3EM 2GZWA 5ICCA 2AOUA 3MHTA 2QRVA 2WWYA 4Q47A 4A0YA 1ZLKA 3V97A 1R8YA 1QNTA 5GM2A 8MHTA 4IVNA 3LAJA 2QWWA 2O07A 5EGSA 5DCMB 3B5IA 1QZZA 4KNYA 2VS1A 2BR5A 1FBQA 1FY7A 4DCMA 2E7XA 2X0LA 3KP7A 4PYMA 5K0FA 2VODA 2V1DA 2P7HA 4O6JA 4RX1A 1P2FA 2ORED 5LQUA 3SR4A 3L9FA 2WTEA 5A2QZ 1B42A 4KIFA 4YMGA 1SFEA 5GINE 2MLKA 4AIKA 5LQCA 2WC2A 3OZRA 5BPIA 3OPNA 3ID6C 3HNRA 2A68F 3GIWA 2V79A 4A5NA 3EGVA 5BS6A 3FUTA 3HTUA 3V7CA 1X1AA 3FUVA 4PIPA 1Y0UA 4CZZA 3G2OA 5LGTA 4HAMA 3ZPLA 4IJAA 5D5XB 2QUFA 1G55A 3IV6A 4FP9A 4I09A 5HILA 5DWQA 2UXNA 3KQTA 4R8HA 1LVAA 5E1ZB 2B2CA 2BM9A 1ZN2A 3BP8A 4H0EA 1BM9A 4FX4A 3H3UA 4EV0A 1U5TA 1R5HA 4QWQA 1S6LA 4KICA 1OYWA 4PCQA 1NW6A 4LLLA 2IH5A 4A0ZA 1M0EA 4OMZA 4A6EA 1STZA 4QDKA 4UXNA 4PZJA 5BW5A 3LL7A 2EWNA 3G8AA 4YG2F 5BW4A 3ZN0A 5E1XA 3PTAA 4LFUA 3J7AO 3MGGA 3KHKA 4OIRF 4AD9A 4N9HA 2ZIFA 3QOPA 3MQ2A 1EH8A 4KA4A 3SXYA 4DQ2A 2DK8A 3C3YA 3F6VA 4ER0A 1L0OC 1QAQA 5F2KA 3G5TA 3FX3A 2GPYA 1SD7A 1J75A 4O3MA 5CIYA 4GGGA 1RI3A 5DSXA 4FSXA 1JSXA 2R3SA 2QQBA 1G3YA 2FU4A 1G6NA 2ZXJA 4RTOA 5K0JA 1XVAA 2OBPA 3ML6A 2OZ6A 1FT9A 1B59A 2VN2A 3B02A 3FMSA 2DAOA 1R23A 3KPYA 5DTMA 1SAXA 4E31A 4HBLA 3LBYA 3CJRA 1ZH5A 1UHMA 3EDPA 2GIVA 1S3JA 2H09A 1T39A 4L9NA 1QZYA 1WQ2A 2Z5UA 4HV5A 1MKMA 4Y17A
chains in the Genus database with same CATH superfamily
4FASD 2VXBA 3AHHA 3SHVA 3D7LA 3FXJA 3U7IA 4DE5A 4L7QA 1JEAA 2C5HA 5IJ0B 1CX9B 3WZLA 4B3AA 1MJHA 1ODIA 2BZSA 4I7HA 1JDUA 1FOXA 2F3QA 3DHVA 3OT1A 3TTTA 2GIZA 1L5WA 1BA2A 2ATEA 5D5HA 1W4MA 4TV8F 3U3JA 2PX9A 4HF0A 1NNUA 4MQ4A 3IXMA 4KR0A 3JU3A 4AX4A 1DS6A 4HN9A 4DRYA 1NJ6A 4O5VA 3HDHA 3NHKA 3VMFA 5H6RA 2VK4A 1JAYA 3DDWA 4BUPA 2ICAA 1VIMA 3LP6A 4TS3A 3M9WA 4FDVA 5FYQA 3SI7A 3A9CA 4AF7A 1TEVA 4J43A 3GTOJ 2D4HA 3SBDA 4TRJA 1SMKA 3X2SA 1I1HA 4GOXA 5EJ6A 4KIWA 4RFSA 1QPIA 1ABEA 5AW5A 4AKHA 1S0UA 1L8AA 1O3YA 2BFEA 3P9IA 3LYUA 4Z9XA 3OYAA 1Q7EA 2XTAA 4Z4QA 1MTZA 4OFXA 1YASA 5IJAA 2CLLB 2W8ZA 2YV5A 4DNXA 1X8LA 1JX6A 4MFEA 1FXSA 1QLWA 4W6QA 3S5JA 3HCBA 5JLJA 2RGAA 3EIEA 5ELXA 4DPLA 4M49A 4WESA 3U4GA 5LZ2A 1N4AA 4ASUD 4C08A 4R0NA 5LYJB 3NYIA 2OQRA 1C50A 4C0HA 4CQLB 4CV0A 5IPFA 5D3ZA 1R8SA 5JZOA 3T1HB 1CYEA 2LBFB 4FLFA 4I8DA 4YLEA 4BUCA 1TUBA 2A92A 2Z6VA 3QVKA 4N39A 1REQA 3IP9A 1N0HA 3L7YA 4QPNA 4V2UA 5ARCA 3ZQGA 1BO6A 4O2BB 4BV8A 1WA5A 4ZT2A 1WZEA 4BBAA 3U6BA 3GGDA 3WXBA 3DE3X 3ZDRA 3ZXYA 1XPXA 3QKTA 4MQVA 2F5CA 2P4QA 3QUSA 2PUBA 2OPHA 3NIBA 2W42A 3T3GA 1Y7PA 1YOVB 4PC1A 1PLLA 1AD2A 2B6HA 4PYLA 4Z0TA 4ECAA 1D3AA 5KNCH 3KKKA 2GPNA 5ENDA 2Y99A 1UK7A 1EINA 4BLUA 1COZA 4L4YA 2BKUA 4EUSA 4CRWB 2I2BA 3FZEA 2WHPB 1QHNA 1S1MA 1VPDA 2WV7A 4UHFA 3W1WA 4FWBA 1OR7A 5JT1A 3S8YA 1YNSA 1VRVA 2CHUA 2BE5F 1U8XX 2E4UA 4I2VA 3V9AA 4E5DA 3EH1A 4ZDOA 2FZ4A 1CCWA 1Q1AA 2QM7A 3A6DA 1WXEA 3B7WA 1RWNA 4IEFB 2RKWA 4J90A 1WXDA 4OHZA 4I55A 4XLAA 2XCOA 2PX5A 4A0XA 4AKGA 1U0TA 1UM8A 3OKPA 5H6QA 2WHPA 3ICVA 3M81A 1W0TA 2Q4RA 2X5JO 5L95A 2QJRA 4WT7A 3O8QB 2XUJA 1ZXBA 5BPHA 2NMVA 2AB0A 2A1TS 2YUTA 3CF4A 4HMPA 1UAYA 4IQJA 1UBOS 3BJEA 5MN6A 1X7WB 2I4LA 3I5XA 2JTVA 5KX5F 2ZZMA 3K2ZA 4BXUA 4Z6KA 3EXG2 4C03A 2GOMA 1QP8A 1OHHD 4PHFA 1I1SA 1KYVA 3NOOA 1FQOA 1NMZA 1Z06A 3H0EA 1EBBA 3BH6A 1TXGA 5AKZA 3WQRA 3WLOA 1S5PA 1WTAA 1B6AA 3FWEA 2BHYA 2BKEA 4IGEA 6REQA 3EK2A 4FE4A 3RWOA 4QOIA 4D43A 3ZGYA 4YJ2F 3ZHYA 1OUMA 1HTWA 1W4RA 3OZSA 1FBNA 1FFCA 1MJ5A 2ZSHB 5LP6F 3EULA 2W0SA 4JYAB 1HYBA 1ERDA 1EUDB 2HF9A 3FYCA 2QNIA 2QUKA 4FILA 4LY3A 3B6KA 2R1TB 3HM2A 3LRTA 4NFHA 2M6RA 3C7DB 4NJMB 4UBNA 5FPTA 3HM9A 4A2QA 4TYPA 3NHRA 1UZMA 4U8HA 1YJBA 2DJIA 4LJZF 1U2GA 5ECGC 4H1TA 3FMGA 4A0QA 2H4FA 1WPQA 1ZK2A 2OO5C 2OV4A 3GBGA 2R8OA 3AKZA 2QI9C 3KVVA 4EF5A 1XMOB 1J07A 4G5RA 1ETVA 1JVNA 3WRYA 4EMTA 2J0UA 3AW9A 4A0FA 3AR4A 1E9SA 1JMYA 3QPWA 3NU1A 3WRXA 1VKJA 5I9BA 2HYIC 2UXXA 1FS6A 4NC7A 3WGQA 7YASA 1IAWA 3ABUA 4HDKA 3GTJJ 2BFPA 1UAAA 1I4EB 2FOLA 3ELDA 4YLGA 5DW0A 3M9AA 2XBLA 2C07A 3T7SA 2KM1A 4PN7A 1P5JA 3MZ0A 2O8CA 4JBWA 1RXIA 5D5WB 4B2LA 5IBRA 1T5OA 3ZJTA 2I4RA 3H5VA 3PE6A 3CTMA 2RGWA 3VYUB 4UBKA 5DCLA 1YZGA 1UAGA 2FPKA 4R6XA 3PITA 3W90A 2MD0A 1VYHA 2GJSA 3OIVA 3UNXA 4JR2A 3WAKA 4W7IA 4IGIA 1QQBA 3QXSA 5IT9Z 1ZMRA 3RS5A 4BVKA 4C7VA 3ZZTA 4KOEC 1P44A 3F23A 1SU4A 2ZM6B 3RK1A 3T5DA 3E4CA 3Q8KA 4PJMA 2DOEA 2PUJA 4U0JA 5CT5A 1BD3A 3CUUA 2BMFA 3FXKA 1K5DA 2HPAA 5KCMA 1FYXA 2FG7C 2FPPB 2GCOB 3LNQA 3D2BA 4PZAA 1U7TA 2JGJA 3OICA 3GELA 4XGRA 4L1KA 5ALVA 5HKBA 2AN9A 2C8LA 4UCWA 2WFAA 1TIBA 3GUZA 1MJGA 2LDBA 4GPIB 2N9UA 4QPCA 5IOZA 4WJKB 5LA6F 4DZTA 3PNPA 3QFFA 3SF0A 5FRNA 2DHDA 4BLVA 1XJWA 5BNZA 5KTOA 4G89A 2HRDA 1I7DA 4IF4A 5E8IA 3C1UA 3CWZA 4QQNA 4HQNA 4BMNA 1W5AA 4IIJB 2EKBA 2WF6A 5ER6A 4DY6A 4GGPA 1ZW6A 5JALA 4HV6A 4DV5B 1IWPB 1T3GA 5F4BA 3KWMA 1KVQA 2O2YA 3H6GA 3NANA 4CFYA 1EWQA 3X1JA 1W1IA 2PUVA 2XOEA 3CSSA 3P45A 4TMKA 3OIUA 2NUPB 1I7LA 2D1YA 5JQWA 1EVJA 3MCUA 1REPC 1DO0A 3L4EA 3SDBA 5CYVA 1VE6A 3BVPA 4RSMA 4B3RB 1J09A 2C5LA 2XCLA 5CURA 5JWRA 3GA5A 2JH8A 4PSXA 2O0HA 2OQIA 3T7IA 5IEBA 3NV7A 4BNDA 4C7BA 3JW4A 3AIOA 4MR7A 4BGUA 3K6GA 1QLHA 2TRSB 4I1OA 4NS1A 2HK6A 2ZYIA 2GVNA 2AA3A 1OXTA 2GK3A 2ELKA 1OOEA 2CMDA 1BMTA 4WPGA 2H00A 5FYDA 3K2EA 5M29A 2IY9A 2PKQP 4M3EA 2PXAA 5FO0A 2CN1A 2AJBA 2QN7A 1OASA 1ZMOA 2FMTA 2B78A 4HAVA 1T4CA 1SC7A 3KEGA 4RTSA 2G7HA 2XQJA 4F12A 2NRAC 1LBHA 3WTBA 2DOFA 3I5YA 2VDKB 2C88A 1W75A 4QHYA 1IJEA 4IJQA 4XD7D 1LNQA 4XORA 3ZIDA 1UWLA 3BROA 4XD7A 4J0KA 5EXDA 3O3CA 3MMZA 2MA3A 5A4DA 2Z1DA 4YREA 4YCCA 3M1LA 3TLGA 2OORA 3ZIAD 3LX5A 4COKA 3FD8A 5ERGB 1XO1A 3SAJA 1EK2A 4G94A 4Y1RA 5KYVA 2IJLA 1PFGA 1AN0A 3NAZA 2XUGA 2DYRH 3O7WA 4L7VA 4G81A 4NDNE 3HSKA 4XNFA 2VQGA 1MN6A 2OMKA 2PO7A 5EIAA 2ZAYA 1PV1A 1QZXA 3D9QX 2ZKZA 2HY7A 1P33A 4U7WA 2O5VA 1CUBA 3DMPA 1NSTA 5IF9A 3AZQA 3ZU4A 3MLEA 4KN5A 4GYGA 3Q3SA 1GPJA 2BUAA 4RZ2A 4DYVA 1JEYB 1TBXA 3L09A 1HQKA 3HVJA 2X8WA 4L07A 4BO4A 4AYBA 2WIGA 1ZO8A 2X8JA 3MB5A 5ICEA 4A12A 3QBVA 4OGGA 3W34A 4I5IA 2HQSA 4G0PA 4XSGA 3GVXA 2REXB 4HWSA 3PB3A 1S1CA 3VI3B 2LXNA 4EY7A 1HA8A 3LPNA 3NVKI 1MGOA 3LSGA 1A31A 4BUZA 1QXSA 1WW3A 5ITSA 2V6EA 2HEIA 1YHNA 3IP5A 3T1VA 5A9SA 2BY1A 1ZXLA 3HB5X 4MQEA 3VHQA 5L3SB 4WERA 3CEAA 4D7MA 5KNDH 4P3YA 1UJ2A 4OY3A 2R65A 1CQIB 5CCXA 1SQ5A 1JFTA 2BFDA 2OV6A 2AXLA 2WA2A 2XMCA 1U9NA 2A5YB 1HKHA 4Y13A 3SXJA 2R5FA 1GCIA 1R49A 3RSQA 3AONB 4MIMA 3HC7A 3OYLA 3BMQA 2WINI 3G1WA 3QOFA 4N1AA 5L3BA 4H0FA 3VI4B 4ZKDA 3CKYA 4N6NA 4A73A 2PE5A 1SY7A 7MHTA 4M6YA 4JVLA 4RD2A 1KP2A 3NGMA 4DG5A 2WIKA 4INZA 4YB8A 5K0ZA 4FEAA 4U00A 1F43A 1ENZA 4U0YA 1UG0A 3NOXA 2J4DA 3WC4A 2ZR0A 4BCCA 4PRKA 5IVIA 2GMWA 4XJXA 3RABA 3TNLA 3S16J 3KTOA 1P92A 2MCFA 1WDMA 3H1CA 3ZWQA 1UOQA 1Q0RA 1IBKB 1FIUA 3BC1A 4LNAA 1OXMA 2QYTA 1I6MA 4Q1FA 1AM4D 1RJ9A 1XKTA 2PQ2A 2X14A 3AHJA 3D7MA 4H7KA 4Z54A 5BRJA 3HXQA 3TZ6A 4BB9A 3D1LA 4XLEA 4BKUA 2X51A 1TTPB 3R2JA 4LG1A 4WFJA 2X8AA 2I22A 5DYYA 3SMQA 3LDHA 4MRNA 1T5HX 4IH4A 2FCRA 4OHVA 3TVDA 5F98A 3IEXA 4UNOA 1HSTA 2YCLA 3FYUA 1XU7A 2BOLA 1H8HD 4H7PA 3WL3A 2QXTA 3LVBA 3LUFA 5SICE 1UP6A 3E3VA 2Y0EA 4IGKA 4OYRA 4YXWA 1ZK8A 2W37A 2YHUA 2ZYAA 4P36A 2XB4A 3VZCA 5JSFA 1EQ2A 1F1JA 1U8EA 1YACA 3EVGA 4O4LF 3JRCA 4GP7A 4OQMA 4WGGA 4C1NA 2E5NA 1DI0A 2FB9A 4MYDA 1B93A 1BSVA 4PF1A 4LF5B 3NP9A 1FMVA 2J5QA 4NCKA 1BN5A 4UUNA 4Y18A 1N9GA 4C4AA 5KBYA 1KEEA 2EBWA 3OTOB 1UCFA 1OFHA 1JHDA 1MJ9A 1A76A 2G5TA 3AIKA 2OD5A 4MDHA 4YBZA 2FSSA 3LHDA 4BLSA 2VE9A 1A4RA 1L7RA 2EDCA 4BO3A 1PSZA 2GEBA 2J5OA 3IT3A 4H7DA 2YXEA 3ZV5A 1QVUA 4FTHA 3IBTA 2FZGA 5TQJA 4JFAA 3A4TA 1Y7TA 1SU8A 5AKEA 4CG3A 1AJEA 3GFRA 2WUEA 5EZSA 2IU0A 2NVWA 6YASA 3TFQA 4F6RB 3CN7A 4KQGA 1MHTA 4HNUA 3FR7A 1QCYA 2A3NA 1BWSA 4JI3B 4ARVA 5BUSA 1WJEA 3W4JA 4A4DA 1FSGA 4DAEA 3VR6D 3WI7A 3OYKA 5HDQA 4UPEA 3NHYA 4FS3A 3EYYA 5JD6A 1A88A 1XQXA 3NQOA 2LD5A 2IE8A 2OZEA 4WCVA 1U6GA 1WNFA 2YH2A 2NSJA 4F6RA 5DM60 5EKSA 1MJGM 4OLHA 2EW1A 3D8SA 4UJ3A 1O3TA 4NYMR 4TKVB 3IKLA 5D3MA 3NHAA 1QZTA 4XA8A 3UATA 4EKEA 2JIPA 1JQ5A 2V7GA 1IEQA 3R40A 4JJ8A 1FUKA 3OF5A 1UBCA 2WJPA 3L49A 4S1PA 1N32B 1W0UA 5EXTA 3L2UA 3C7TA 3SF8B 4G65A 4MRMB 1G98A 2DCEA 2NYAA 5AI8A 5M5WJ 5IF3A 2H6BA 1W8DA 4Q93A 5MF6A 1EFAA 4PYJA 4QOFA 1YNOA 2R6R1 2P6OA 3M49A 5D3MB 1R4NA 3O82A 1N9GB 1NQVA 2B69A 1D2NA 3D5EA 3L9WA 1R9JA 3OAAD 4Q5IA 3TTUA 1DAHA 5A5DA 2ZJ0A 2K6GA 3KB2A 3QWHA 5KWSA 4KO1S 1L9KA 3ISTA 2Z2ZA 2W2QA 3CONA 1Y82A 1NR1A 3P0RA 4OYHA 5G4KB 3QPCA 2G7UA 1PR5A 4EO4A 4HYTA 1SXGA 4W1RA 1AMUA 3ZGZA 1X92A 2I6GA 3GMIA 2FP3A 4RAYA 3H2JA 3I0MA 3ZMDA 5BVHB 3BQNB 5KINB 1K97A 3Q0EA 1MEJA 2WAOA 4P80A 4RIFA 3I53A 1DPUA 3TW8A 3ES9A 3ZY3A 3CQZJ 2GQQA 4DDHA 2FMXA 4R0VA 3ELWA 2G6TA 3KP5A 1RPTA 1ZVJA 2VN8A 5IYZF 3P9KA 1WDLA 5C7IO 1E66A 1A82A 1KERA 1WY7A 5E3MA 3DVAA 4O2BA 2IBMA 3I2HA 4TZKA 3SNHA 3QMPA 3D1NI 1D4FA 2JFVA 4P2GA 2YRFA 1W5SA 3LPCA 4MROA 5JCOA 2G9WA 3BEDA 1F20A 3HR7A 3KQKA 3VFZA 3H4TA 3IESA 3C45A 1Z33A 2H5JA 1KJ9A 1Z6AA 3L8GA 4WA7A 2AEMA 2ZB4A 2ZG6A 3DCJA 3ZWAA 1MMNA 1Q15A 3QLVA 2DRIA 5A3JA 1M2KA 4U1RA 5TMPA 4LBZA 1Z8NA 4PCAA 3M6AA 4G5XA 3WK5A 3EXHB 4LG0B 5LQNA 2JBWA 3A27A 2QQEA 3R6GA 1NMEA 2IU4A 2WKRA 1XZJA 2A5LA 2KLOA 2BBWA 4BGDA 1FFHA 5CT9A 5DI9A 4FKMA 2DBRA 4C2BA 4EJSC 4PJNA 4DQVA 2C57A 2GQ0A 3THXB 5HOOA 3C43A 1MAUA 2PNFA 3TE6A 1VMIA 4X8HA 2ZXIA 1KKLA 2OHXA 2OA4A 2AF3C 2DC1A 3HL2A 3F9IA 3LECA 1VLZA 4NARA 5CNMA 1FU7A 4W1UA 4ENWA 1W5BA 2JJ7A 2A0UA 2I2CA 1O9GA 1VGVA 1NP3A 5EP4A 5EP1A 4BJ5A 1T4CB 3VEPA 1DC4A 2QS9A 1P5HA 3M7IA 1Q14A 3H19A 1LJ9A 4FXOA 4E7JA 4BQPA 1JWAB 2RJ3A 2I6XA 2QG9A 2CW7A 1LBTA 4M9CA 3KAJA 4QX6A 1UMQA 4UNRA 1P4RA 1FC0A 1TVCA 3NWEA 3QBTA 4FZJA 5HF6A 3O4JA 3GK3A 4XLZA 1V8FA 3N7TA 4J0GA 4E46A 1JJBA 3GVPA 1LEBA 4I66A 4ALIA 3QU5A 3ZI7A 2IYLD 5AM2A 4FISA 4REQB 1E3MA 2XIQA 3UG7A 3I62A 3OSUA 1V4VA 3IUEA 2EFWA 4J8PA 3JAMA 1WPKA 3G73A 4ZDJA 2P8SA 4YACA 2LGJA 3G2MA 4FJ0A 4ZYYA 2JCYA 3L1PA 3GEIA 5EIEA 3HB4X 3C3WA 1KAMA 1RC0A 1FYFA 3MOSA 2C3PA 5F0CA 4NMMA 2MH9A 3MAGA 4LCJA 2POQX 3DWFA 4WKPA 4I3GA 1X87A 3HU5A 1NY5A 4RYDA 3NIFB 1VTKA 4K9DA 2EIKH 1E62A 1XR3A 2VCHA 4RK6A 1O03A 2X4LA 2PUEA 3KETA 1FYKA 5BV1A 2YYZA 5C9ZA 2ZZNA 4NQRA 2B8TA 4Q03A 3G0GA 4O0MA 5HGJA 1Z8HA 4KMFA 4YFKF 4GR4A 4BKPA 1U7OA 1ZVKA 3P2MA 1FYDA 4B71A 1G4AE 1ZHFA 1T5IA 3OT4A 4OO3A 4QXOA 3Q2OA 1W88A 5FKOA 2OEPA 4D4IA 1O77A 1GILA 1PTKA 3DDOA 3LGXA 3W3ZB 2IX3A 3QEAZ 5A0VA 3FHOA 2WJ3A 3FNBA 1I80A 3SX0A 1ADCA 2A9VA 2VPPA 4R69A 2XHZA 2XQKA 1SFUA 1XC7A 3OM1A 1C9NA 2H59A 1USTA 2XDVA 1OX5A 2OBXA 4M0PA 3UMFA 1QGPA 4KPEC 1L7EA 3O47A 4WXRA 4DYRA 3EY9A 4P93A 3PE4A 4Q05A 2WM3A 3SZTA 2ZBGA 2DJ5A 2QG6A 3LTEA 5AMXA 3VOSA 3ZNPA 3LA2A 4CF5A 1WFXA 3GGJA 1G3QA 2ISQA 3QMWA 3R8XA 4JODA 1RKXA 1CDZA 1J9ZA 3TEDA 1IQPA 3AH8A 3NOQA 3CC4I 1P29A 4OAOA 1CNEA 2VH5R 4XM3A 2ZBFA 1JMVA 3FNRA 4F2WA 3A03A 2XXAA 4U4AA 1KR5A 3QXCA 1EUZA 4KQFA 4QU5A 5A9RA 2HBYA 4TV7A 3VR4H 4J0HA 1TL7C 4PVDA 4AL4A 4GLFA 3CURA 3OE1A 2PXCA 2MSWA 1R88A 3G59A 3Q5GA 3MWEA 4PX9A 2JB9A 5LJLA 1U2DA 3HSYA 1QHHD 4RMJA 5DXAA 4YN3A 3LWFA 2RARA 5G41A 1A2KC 4UXIA 1OY1A 1UP4A 1M1YA 1WLYA 5ED4A 4CXMA 4HNAA 3AL0C 5HKOA 2WVJA 3AF1A 4QIHA 3A3KA 3HUEA 3U1VA 1ULTA 3C5CA 4HEA6 3QUCA 4LIVA 4EJFA 3HUUA 4HD8A 2R7WA 1MX3A 3QQ5A 4K9QA 1SWVA 3TRFA 1RZRA 3WQSB 4V0QA 1XDGA 2WOJA 4R7ZA 2VQ3A 5CLSA 1LQUA 1F6WA 3M4NA 4L3OA 4FD2A 2H2DA 3FMIA 4IOLA 2A69F 1YR9A 5C4JJ 4XX1A 2HOSA 2QIPA 5H59A 1ZH6A 4IDHA 3VZSA 2V0CA 5I9TA 2CFIA 1CPYA 1Z6PA 1HYEA 4J4BA 4NCAA 2CD7A 4UREA 2HQAA 1W0JA 3HE3A 4NCXA 1G8MA 2BKLA 3LRPA 4OSOA 4AS3A 3JCUC 5F64A 1XOIA 3E7PA 4E7LA 5D84A 1Y98A 4Z9BA 4EG3A 5KHLB 2BGMA 1JHRA 3BTOA 2JLUA 3GXOA 4CTJA 5JH7F 5K0TA 2CGPA 1LJ8A 1QE0A 2X4DA 3E4DA 3OX3A 3B7GA 2N1MA 4IHJB 3LA7A 4OJTA 4EGCB 5C8YB 4RGYA 2W22A 1ZS9A 2Z30A 4J91A 3VPBA 4BGEA 3F3MA 4G0WA 3HR8A 2Z2XA 3K20A 1F8FA 2OV3A 2VWQA 4JP5A 4OPMA 4CMEA 1AUOA 2ODBA 3JQQA 4J01A 2AOUB 5KOYA 3QKRB 4HNVA 1LLUA 3H05A 1QYCA 3DPLC 2PWZA 3M8FA 1QG4A 2L2QA 1UEIA 3CLRD 4IIFA 5HBRA 4F3CA 3JYHA 2V0NA 3TYXA 4Y2VA 2XYRA 1XHEA 2C4MA 2PZBA 4CCNA 4JOSA 1RACA 2BFCA 1ZI9A 4QEZA 5E3IA 4BJ6A 1X1DA 1JXAA 3CNQS 3F0TA 3KQOA 4N40A 1J90A 5DN9A 1OPXA 4WNCA 5BYJA 2C4UA 4US2R 1GHCA 4BC1A 2M4KA 2VDWA 4IR7A 3HIFA 4JCOA 1XL0A 1I3KA 2FUG6 1H5NA 4DQUA 2X58A 2Q5EA 2QT1A 4E4TA 2ZTHA 1UBUS 1J42A 4TN5A 1IU9A 4JP0A 3ZJVA 1P7YA 3M07A 1DTWB 2YFYA 5EE9A 3PU6A 3W5BA 1OLSB 1WU7A 3FKQA 2GHRA 1S7CA 4RA2A 3A36A 3ILYA 2PN6A 3IO3A 3M6WA 2CNBA 1XNJA 2ACWA 2DAPA 5ILUA 1CUWA 1NQXA 4ZZIA 4TGLA 4CM8A 1IYZA 2HLHA 3ZY2A 4PINA 4MGZR 4I4LA 2JKVA 4YALA 5K5RA 5HIKA 3D4LA 3SZMA 2O8EB 2COEA 1VQMI 1PSWA 3U31A 3WWYA 2PS1A 1DBRA 4E13A 3LHIA 3ZS8A 1FMTA 1TJYA 1JJ7A 1HTTA 4LRSB 4N0PA 5JNLA 2GETA 3T1BA 1XJ5A 4BP3A 1V5GA 4JQSA 2YIDA 3COWA 4DVGA 5JSUA 1XIVA 2FE1A 1KWGA 4HH0A 1LU9A 2IKQA 4A8JC 2LKDA 1IXRC 1J5YA 2PX0A 2D45A 1JBEA 5M3MJ 1F12A 3O21A 1N6HA 4YC7A 1T95A 2BBYA 4I50A 3DLHA 4CL2A 1GDHA 3JRGA 3KR2A 5DISB 4ZYUA 2HRQA 4E08A 5KS2A 2PLYA 1KNXA 1M7BA 1RD4A 2EHDA 3W0LB 1FDUA 4QDJA 2QDXA 4HX2A 4AZTA 4I6JA 3AZOA 2MBFA 4R54A 3RG8A 3E9DA 3ILHA 1MD9A 4DQ0A 1ICIA 5EXEA 1A5BB 1P9OA 4G9GA 4FC7A 4B6JA 2A9RA 2YWHA 2KX7A 2R8BA 3HVIA 4FI3F 1OBFO 2VUTA 4JQOA 5DTDA 1KBQA 1PE0A 2V7PA 2VKTA 1SN7A 2Y1WA 3JTEA 1U5BA 1QK4A 3LQ2A 3RT7A 4WBNB 1SO8A 2LRHA 3KEYA 4FQ7A 4D4KA 2VKVA 2IEZA 3ER9A 2BGRA 2ACKA 1XEWX 3CX3A 1Q0QA 4AN1A 3SS8A 1W0JD 1C1HA 3ND9A 3VSEA 1FTGA 2RH4A 5MDHA 1E6CA 2AMJA 3JQ7B 1IUOA 4O4IA 4RZXA 1V3VA 2G9NA 4K9MA 4PXYA 4ON0A 5K5OA 1JE1A 3KK0A 2M2EA 3LQ1A 1Z0SA 2X6QA 4U88A 4B45A 5JXWA 2R7LA 4MW7A 2IA1A 2BSXA 2FI1A 1QYRA 3OOYA 1Z67A 1PK8A 4EAAA 5ICGA 3HI4A 5IU6A 5JVDA 2UYOA 1M6EX 1CRWG 5B5EC 1KKMA 3D59A 1S7AA 1PDNC 1PUEE 3R4VA 4RQUA 2V9VA 3DCFA 3DCIA 2CXTA 4RL6A 2FQWA 4J3JA 4CYMA 1SHZA 3FTDA 2E37A 3AF0A 3KUKA 3QMVA 4G26A 2ZDGA 2Q27A 4URYR 1YQDA 4WBXC 1XGSA 1M5TA 5ECDA 5CA0A 4R68A 2N75A 1CUXA 2Q5FA 4MWCA 2XRNA 4PS1A 1X2MA 4I9UA 2PTHA 1TGYA 3ZCUA 5T5QA 5L4LA 2F1KA 2OE2A 2R11A 4ZDWA 3I9NA 1VLJA 5HFNA 2V4JC 1UT6A 2DFVA 3ZD9A 1IN6A 4K5QA 4D0SA 4GPBA 5K8TA 3F8FA 3FY4A 3DV0A 1N3BA 1QU3A 1U1IA 2IDMA 2F48A 2VUSA 3HDYA 3R5FA 1ZM3A 2IW1A 2V7FA 4FYXA 4HO1X 5PNTA 5KVAA 4GUDA 4NIMA 1OGYA 4OXRA 4QO7A 3S44A 5JIBA 1RIIA 4B8XA 4LF7B 2JC3A 3H92A 1B8VA 5DSZA 5F27A 2FPLA 2N47A 3WLJA 4N4AA 1KZYC 4ARZB 4YDSA 3RQ4A 5DI3B 4LOCA 1Z9BA 1WI9A 1VA5A 4LZZA 4O02B 4WZBB 3BCBA 2JCSA 1YFJA 1Q0UA 2EQ5A 1NJ8A 2VDNB 3E6AA 2Q99A 3GMTA 2HFHA 4JJKA 1AK9A 2PGXA 2TCTA 1A36A 1WHTA 2XE6A 3LMMA 4LNUA 1TWGJ 3WTWC 1D5CA 2GVDC 4GKVA 4XIDA 2VJAA 4CLRB 4CIDA 4GS5A 1R15A 2OKCA 3S2UA 3MJHA 2ZPTX 3BTJA 1BIFA 1ZUNA 1LPPA 2Q6KA 4BZPA 1UZNA 2XKAA 1SOVA 1WXIA 1WZUA 3SX4A 3V55A 1SAYA 4NCHA 2PMZA 4ZYGA 1GTVA 3A14A 3R3JA 3O5AA 1Z88A 3DXJF 2GJAA 4IGAA 3I0NA 3W3CA 1ZONA 2QKYA 3OFVA 4RD0A 4JUAA 2KMLA 2VUIB 3I6QA 3V6MA 3WSWA 1R10A 2R7QA 3MZHA 4J6FA 4URWR 2JBAB 2ZYWX 2ODQA 2FMIA 3M4ZA 1R1VA 5K3FA 5C8ZA 2EK5A 1E92A 1LSJA 3KL2A 2O6LA 3KFLA 4JZYA 5H3CA 3AKDA 4C7OB 4HDQB 4LCBA 4BP8A 1SQ0A 1RR8C 3GQVA 2BY4A 2G25A 1N6PA 4FUQA 3X43A 5CFQA 2R7FA 3I1IA 4YRKA 1RQPA 3IHKA 2G76A 3K0KA 3MS7A 4YR7A 1ZVVA 1WUTA 1YF3A 4HDKB 4F9EA 4NAHA 3L82B 1CR6A 2AWOA 1NQUA 4R84A 5ALMA 3RU7A 4EJ0A 5BQ5A 5JS7A 5B2ZA 1FRFS 3AF3A 4TKZA 2V74B 5AWFC 1Y6ZA 3NTRA 2O8BA 1DWOA 4KUMA 4CEJA 2E1PA 4ALNA 2OCXA 3HHEA 4L8FA 4O1IA 4QGAA 3GLVA 3GLHE 3RHZA 1PK7A 2I91A 1X2NA 1PJZA 4FCYA 2YC2C 1T2CA 3IGFA 2BYTA 3UK7A 4J0CA 3IT2A 3T0GA 4IFIA 4GM0A 4CGYA 2O1WA 2PSDA 2O8VA 4QRDA 4C76A 2LUOA 4XJTA 3V5NA 3R4KA 5JSHA 1AWCA 1YE3A 1NL3A 3GLUA 4GOLD 5EUCA 5F9FA 4L5CA 4ZZ1A 3QOEA 2AL7A 2IUFA 4L02A 2O6HA 3H5OA 5KOHB 4IS3A 4Q7LA 3GA7A 5D8KB 1QQ6A 1T9GR 2G3YA 3B8HA 2JBAA 5JNWA 3ERCA 4M8SA 2X5XA 1CHNA 2Q3JA 2WYOA 3N2EA 3P97A 2DUNA 3L9XA 3ZHQA 5HBGA 1TC2A 4RF4A 1QPMA 2CQQA 2FQYA 5THKA 5CPFA 3PCXA 3L7CA 3NALA 2GI4A 2VSYA 3FLAA 2HLDA 3D3WA 3R24A 4H59A 5AJVB 3HBJA 1DWUA 2HSGA 2W6NA 5IUNC 4TKUB 2QGFA 3KYCB 4EJOA 1BMQA 1N2OA 3EVCA 4ZZ3A 5K03A 1B26A 2I29A 1VQPI 1YI1A 3RUCA 1M1NA 3V8KA 1X3SA 5IANA 3IDFA 1V25A 3OMXA 3KUUA 1Z6QA 5EE0A 4BKOA 3ZDCA 4WK8F 3D3WB 5IAEA 3TF5A 2NYUA 1M2NA 3KYBA 5CB4F 2IUEA 5FA5A 3O8HA 3BF8A 3K0FB 2OV1A 4KGVA 3G02A 4QT0A 2QVGA 3FCOA 4G5QA 2DFNA 2NVUA 3ZLBA 3OE4A 1WMAA 5K5EA 2ZTLA 1SHLA 3LL4A 4H1UA 1U9CA 4TQ9A 1IATA 4UNNA 1B74A 5TJHA 4IOKA 4E88A 3OLXA 3DQQA 2DPUA 3RVJA 1UT5A 4KYUA 4N8SA 3RF6A 4JUFA 4HYQA 3GCMA 4KXUA 3QIVA 3GO4A 3LX4A 1YL6A 3F6BX 3OLZA 5TQ0A 2NVUB 3D2CA 1ZJ4A 2OUMA 4OB6A 3PWZA 4G56A 2G72A 2XB2A 3BMNB 2Q2OA 1HNNA 3A2NA 1P3DA 3TIIA 3VAZA 4E22A 4EB0A 2QLFA 4E33A 4E1BA 5LIPA 1XF9A 1E7MA 1EIWA 1FYMA 4FFBA 1ZHHA 4QNMA 3V4ZA 2COBA 5K51A 1KONA 1E79A 3GJTA 5MHTA 2P9BA 5JXGA 4KODA 2XVCA 4JJGA 2A4KA 2Q6VA 3P9XA 4V24A 3M5DA 3HKEB 5DGTA 5J59A 4KO4S 1NBWB 1GZ4A 1SA0B 1LA2A 3OL4A 3F3YA 3SK0A 5HDKA 4B3HA 5A6SA 1E3TA 3LTNC 1T36A 2VP4A 2RK6A 2H8GA 4XAQA 1XMPA 4J0FA 2AI1A 3PQ8A 1TVKB 4UNSA 4Y1RB 3H1EA 2C0CA 1GEEA 3DL0A 4B6FA 1U7DA 1FUYB 1IIRA 3HWWA 4IHQA 5AI4A 5A05A 5C7LO 3H42B 5KNCD 1M7HA 1O6CA 4TX1A 3HOWJ 4BNFA 1M76A 3BZBA 1AQNA 2NVYJ 1AN9A 2JFFA 4HRVA 3CEPB 1HM5A 4JN6B 3FGNA 4ESFA 4UW9A 4AECA 8ATCA 5JS1A 1V71A 3A4YA 2JCXA 1W34A 2R6GA 3C5HA 3PFYA 1GCOA 1N7GA 5FULA 1HFKA 3M6MD 1E20A 2O3RA 3F96A 3NYQA 1I6WA 4UMFA 1Y6GA 1NN0A 5G0WA 3GLQA 4JWKA 3AY3A 1QBKC 4XWWA 2Q3EA 3AESA 2YXPX 3DBIA 3QLVC 4KRFA 4KQ6A 3LT1A 3KZMA 3F3XA 4CTMA 8LDHA 2VT6A 2DBBA 2DEUA 3K73O 2PXXA 2VYND 4HVCA 3OWXA 1IZ9A 3NHMA 4X64B 2VXZA 3UGTA 3MQ0A 1E94E 5TIIA 2OFPA 2BAGA 3BXZA 1Q1VA 1N3YA 1BR2A 1KMHB 2JLRA 3TBFA 4O25A 2P62A 3KP4A 2FPUA 1PT6A 4FW8A 4Q4CA 6NULA 4IVQA 4NYMQ 1ZCZA 1N0VC 5IC4A 1ONOA 3NC1C 5J8FA 1JFFB 4K6MA 1MAVA 1TF7A 1P2DA 2F8SA 5JD4A 1CRZA 1EGVB 1W5CC 4BWVA 4DSZA 2WF8A 2H1OA 1CLUA 2ZJPF 2D00A 2VDRB 2JHAA 2E1MC 2V9PA 1JYFA 4FXPA 1C3VA 2I1WA 3RROA 1UODA 1SOWA 1A35A 4US0R 4AMUA 3SVZA 5B7QA 5DBHX 4V2FA 3X1MA 2QQAA 1QHYA 3GLXA 3CCQI 3GQBA 3ZDDA 3HXPA 3DCYA 2NQTA 1T5LA 2YN0A 1UDWA 2IIQA 2XAFA 3PNKA 4DLBA 2VHEA 3RS3A 1D2AA 1ETUA 1N2JA 1PZHA 2F8MA 3CF6R 3D8RA 3EVBA 4HB4A 4KU4A 4M7WA 3RTDA 3W3AH 2RHRA 2UUBB 5ICFA 2W8BB 4P53A 1YJNI 1N2GA 1NOKA 2ZSJA 4PFOA 1OU0A 5EINA 4HUTA 3U1TA 4OIQF 1I0LA 3MAJA 3L2CA 4C2AA 3SKVA 2CU7A 4PK4A 3CC8A 3HACA 4IQGA 1L5ZA 3IMGA 1VIYA 2G83A 3FNGA 2EINH 4R79A 5GP9A 1FFXB 2WJVA 3V8JA 4HAIA 1VDMA 2GYUA 4B3XA 1T8SA 3GP3A 3QUAA 3WSVA 4EVRA 1THZA 4TMWA 4WRRA 4UBLA 4UMDA 3RRNA 1ZK0A 4JUDX 2YXDA 5BSHA 4DUGA 3VO9A 5JAUA 4BBSJ 1JR3A 1TIPA 2TMGA 3IDOA 1XZGA 4Q66C 4TWBA 2A6EF 2CHFA 4S1OA 5IJ9B 1PBNA 3HSEA 1FFXA 1ORHA 3GRKA 1KI1A 4PLPA 1N2CB 2QD1A 1KEEB 1JHQA 1DCTA 4WCFC 3ZUPA 4KK4A 5J1TB 1FXWF 2GBGA 4GWLA 4M6WA 4RLHA 3B3QA 4TUYB 2KDZA 2AQIA 4WWHA 4XPZA 3AG3H 2ODAA 4HGOA 2ACVA 2WKWA 3UPDA 1SQGA 3OT1B 3IP6A 5HIIA 1L5KA 5H70A 1B3RA 2DJNA 3ROXA 2BE7A 3ICEA 4FEEA 2QMUA 3GJ7A 3EEBA 2O5EA 4LXQA 4XOPA 4RJTA 5EJ8A 3NCHA 4WNYA 3A01B 1FWZA 4DDVA 5D01A 1AXRA 1NVAA 3LOCA 4EVIA 2VBIA 3K5PA 3QK7A 5EZYA 4QJ3A 5GVSA 1NM5C 4OK5A 3JS5A 4MUNA 3IJRA 3CRMA 1WWKA 1OILA 2JVKA 4S0ZA 3U3ZA 4XEHA 4LXXA 1KEWA 1X8JA 4JEIA 1IMJA 3AX6A 4B3TB 3AYZB 3OZTA 4EPWA 1CQXA 3CVVA 2PU7A 1JKJB 1DELA 1I0ZA 1K63A 1NVUQ 2VJQA 1FP7A 1NXOA 2VWHA 2Z5LA 2ZROA 2D2IA 3IEUA 4JLMA 2NOGA 1EFLA 4J3NA 3DE0X 3BFVA 1Q6YA 1U9OA 2ACJA 4TZTA 2WAMA 5I8WA 1PL0A 1Y3FE 3SZLA 1IVNA 1Y6RA 4BL5A 5I7SA 3D8HA 2EZHA 2BRUC 3N59A 1O94D 3OHPA 4FK8A 3D1VA 2HUPA 4RAOA 1GPAA 1XGMA 4L8VA 4JSRA 1WD7A 4BFWA 4F9TA 1XLTC 3VGPA 3RKYA 3QLTA 2DE0X 3HKCA 2QVZX 4QUAA 2X1CA 1PYVA 4L9JA 3GRYA 5A6VA 4KB5A 3UNGC 2H1RA 1ZH0A 3GUCA 2HTEA 4TV9B 1J8FA 2B4QA 4H7FA 2QZ4A 4AZ0B 5EVCA 3RSZA 3I1JA 3VSAA 3RFVA 4C4XA 4N48A 3VU1A 5F23A 3BD9A 2GD6A 4WINA 1Y9DA 3L5KA 2D0OB 5CDFA 4X66B 4G2NA 3GLFB 1HFEL 3NHWA 1ADJA 1M1ZA 3V1UA 1ZWKA 3S2DJ 1YBVA 3HSRA 4KR2A 1F1ZA 2YXNA 4XQ9A 4TXHA 4UEWA 1G1MA 3MVEA 1C4WA 2O2HA 4BNIA 1DSSG 2LP4Y 3MJVA 5FPHA 1QQ7A 3WIBA 3JAMK 3SJZA 2I03A 4RXUA 1UFMA 3FUCA 2GAFA 2HTFA 2Z4SA 2AMLA 3JQ8A 3LM8A 1YE8A 3OCUA 3MLAA 1LK5A 4J49A 4RZUA 4TWRA 1K1EA 1I7SB 4ESVA 3PFGA 4ZOEA 1B1CA 3TTXA 3PPVA 1U4NA 3OZDA 5HQ3A 4DV1B 5CQEA 2Q2NA 3ZK8A 3OMYA 3E23A 5FBZA 3LZDA 3TO9A 4GP6A 1MTOA 3JAWB 2VWPA 5DM4A 4MQBA 4Y2GA 4YXFA 3P27A 4E2XA 1BTOA 2IRFG 3NV9A 3C1TA 5FBHA 1SRRA 1GRNA 2VTVA 1PQWA 2NUTB 3OHSX 1XRPA 3HPRA 3MILA 1GOTA 1RQXA 2WIFA 5KREA 2D1SA 2P6TA 2VHZA 3UJ9A 4MO2A 5G0VA 4AMGA 2VF7A 3OP1A 4XN3A 1NF8A 1JIXA 1G5FA 4PSCA 3ROGA 3PEWA 2JAUA 5DGDA 4JK1X 2C2MA 3LGAA 5LKRA 2MGQA 4XDHA 5FLMJ 1NLYA 3LF2A 1TZBA 4DR3B 2AI3A 4OM7A 3K2QA 3LVQE 2QN9A 1PKXA 4NECA 5L53A 3K8OE 1HLGA 2Z8YA 4YRQA 1VJ0A 2NWQA 3DP7A 2Z2YA 1K4YA 3EXFA 3OJ0A 1E3JA 1NBME 5HSGA 3HJEA 4CQNA 1TKBA 4FU0A 2XNDA 3H35A 3N8GA 5EMLA 3SHTA 1XZEA 1KMMA 1O4VA 2B82A 3HPQA 4E2WA 3WDLA 4Z4GA 1DP4A 2WWGA 4P3PA 2FA5A 3C8DA 1J8DA 3FUXA 4OK6A 1QBGA 2OZUA 3IMEA 2ZYHA 5CFZA 1HI9A 1L4BA 5CJPA 3QQAA 1BXRA 1NN5A 4I4TF 3KJHA 4N18A 2OD2A 2VPZA 2XWQA 3SYMA 2EFQA 3KTAB 5A5GA 1HDXA 3MW8A 2Y1DA 5LHIA 3K0EA 3RS0A 4XM2A 2CW0F 1D1PA 3VNUA 1LS1A 2D0IA 4F1WA 3F21A 3V8MA 2IUYA 3ROQA 1IV8A 3R3YA 3RVRA 3PO2J 1G9TA 2DWUA 4OIPF 1M54A 2HUNA 2I3BA 3PQ2A 5DEOA 3P96A 1D5VA 4JLVA 4LCEA 3UCXA 1KQ9A 1P0FA 4PTZA 3E6CC 3CUTA 2IXGA 3O3OB 4LOKA 1AGXA 4FFMA 4YCJA 2E5ZA 2PT6A 5EYPB 1KQ3A 1XA0A 4KDRA 4MUKA 4MQUA 4O4JA 3UFXB 2QTBA 4AN0A 1Y6JA 2GUWA 2EG5A 2Y77A 3GCZA 4BNUA 1WB9A 1E63A 1QIIA 1UBFA 3G9XA 5D5PA 1PX0A 4WCDA 5ESXA 3ABMH 4RENA 2PUCA 3UT5B 4BYMA 3PXEA 4JXZA 3ZGOA 1UXKA 1WMEA 3C8MA 1II8B 3AF2A 1EIZA 1KGSA 3OPYB 1HT1E 5T8KA 3RKSA 1JFRA 1K78A 1Y48E 1K9VF 1QLJA 1M6WA 2C4NA 2MSCB 1DRWA 1U3GA 1JWBB 4YUVA 5AK3A 1H2ZA 2P9YA 1NM5A 1XDBA 3VU3A 1JG1A 4LNHA 3CIFA 3WAGA 1W94A 3EZ6A 4LBYA 1LJUA 3C2GA 1XQ6A 1BEUB 5LEKA 5C4IA 3G1MA 3K4QA 1TT5B 1G18A 2RG1A 3NBQA 3KYJB 1J2YA 3DXYA 3F7TA 4I3FA 1U2QA 2CUZA 2WEKA 2AYZA 3MQ4A 1XTTA 2LVSA 1WKVA 3GRCA 4ID3A 1PGQA 4PG4A 4P82A 5FEMA 3EXIB 3RVLA 3ZR4B 3SR3A 1DNPA 3K8ZA 3JRNA 4FINA 4MYCA 3DL4A 1XCVA 4G41A 2OAEA 1GUAA 1C9YA 1A2OA 1JP7A 2WUFA 2ZJOA 4JEMA 4XE5A 3NR2A 2FGJA 3GGGA 2B1RA 2O8XA 1OXKB 3SZ3A 5KU7A 3E35A 4FT8A 4QVGA 3DUFA 5D6OA 1B4AA 1FIPA 4BWFB 4ER5A 3EEYA 4E7PA 2P6SA 1U8AA 1GTRA 4RKEA 1SVWA 5FLVA 4J2HA 4P7FA 3JW8A 2NXNA 4V0KA 2QU7A 3BE8A 2LREA 5D7NA 4D4GA 2F1IA 2N1BA 4RDIA 1P0QA 1X70A 1RRJA 5F51A 2QQ0A 4FUTA 4LZOA 2HMSA 1WCYA 5E2AA 3ZHZA 4GBED 4CL3A 4IRXA 4IJMA 1CP3A 4E11A 1GQFA 2YASA 2F3TA 3CSUA 2L9RA 3IILA 1C29B 2H85A 1VLHA 4F56A 1NMSA 1BX1A 4B7ZA 5IT0A 4MW6A 4DCOA 4BVJA 3P0EA 3PXGA 2Z58A 3WE3A 3PSHA 4X1IB 1IDZA 2VNAA 5E8RA 4MIYA 2PH7A 1HDPA 2DA2A 1OBVA 3GT7A 2NU9B 3MWGA 3ZOZA 5BXYA 3UWKA 1Q92A 2D2EA 3PSFA 4Y2TA 2Y3IA 3DB2A 4AUKA 3R6LA 4TWIA 3SHQA 4BVFA 1RWVA 1DKUA 5KTMA 1KK0A 1EQAA 2PX6A 4X60A 3D6HA 3DU5A 4G0QA 3VOBA 3RKUA 4NBKA 4OL0A 1SVOA 1L3LA 1CJMA 1KS2A 2L5QA 4HI0E 2I54A 4J1TC 4C6HA 4WMLA 3A6PC 5EHIA 3KR9A 3VO8A 1AHPA 4ZT3A 1PD0A 4I99A 1UADA 4X00A 3ZVKA 1PYGA 2XHEA 2XVXA 3BY6A 4UM5A 5HXAA 1FP6A 1FZTA 4I0BA 4TRMA 4ZDKA 5JLXA 3WZ2A 4B6PA 2GLUA 4JLSA 3GNQA 4K6HA 3OO0A 3QLUC 4H1HA 5DNDA 4D9CA 3Q0WA 4CM9A 2DU9A 5JARA 4DA8A 4UU1A 2A07F 3GJ6A 3HH8A 4G1FA 2OG1A 3PJRA 2QIOA 1JQAA 2JUCA 2EV5A 5FOVA 3FFBA 1Y3HA 2R1TA 2GA8A 1R00A 4GBJA 4I55B 4Y6PA 4C5CA 2RNJA 1XEXA 3HJBA 1OX4A 4D0RA 5CB4B 1IHUA 1B15A 2UVDA 2ZVPX 4F1JA 3RO7A 2RK3A 3DDNA 1S2OA 1HKUA 3DKRA 4BXFA 2VBCA 1L5GB 1E2PA 2OHVA 1FBUA 3HDGA 1C0LA 3LSHA 1JEEA 1P4AA 1E89A 4LGCA 1ZAKA 2PCJA 2HMYB 3Q98A 2V7VA 4Q4HB 4DLAA 2FOIA 4LUCA 1GV1A 2WDZA 4FDUA 2CXQA 2VHQA 3S1QJ 2ZI7A 4WDQA 4MWOA 1AXEA 4KVZA 3SDSA 1MENA 4BDZA 2PUHA 2H57A 3W06A 4C6TA 5GIPE 4OHPA 3WODF 4AUMA 1TT7A 1N5LA 3K9BA 4NZOA 1VHJA 2HSWA 4R31A 4GRIA 5LCXA 3JQRA 5KSPA 2LBFA 3B5JA 4OOFA 3TTVA 4FHTA 5CA1F 3RDIA 1KHTA 2C3YA 1DKMA 2ZUWA 1XWWA 2BE9A 4K26A 2OBBA 3T3NA 5B3SH 5HVQC 1Y1RA 4KDEA 4AYXA 1JI8A 1GG5A 3WB9A 1CFJA 5LVAA 5K7SA 2ORYA 5ADUS 3A4MA 4KBGA 4HH3C 4RYLA 2VDWB 3IAEA 1O0CA 3QF4A 3DBVO 4X41A 3H9QA 3KSDO 2H27A 3T5PA 1RETA 4G8XA 1FPMA 3P8ZA 3A2KA 4MI3A 4JX8A 5GOZA 5D2CA 3TGPA 3BTSA 3ZBUA 4MS3B 4UE2A 3FNHA 1XQ9A 1H0HA 1P5RA 2FJ0A 3M4JA 3IIIA 4M54A 4LXIA 1C9DB 2MSDB 3LDGA 4MO9A 3JD1A 4KKXB 1JLHA 3ROTA 1FQJA 4BFYA 1KC1A 5DM7F 1HGXA 1OZGA 2CHEA 2YMPA 1QOZA 4KISA 1E4OA 1Z3IX 5EHZA 3N8IA 1YCHA 1FFDA 4N0MA 3G23A 1R64A 5ALDA 3ESDA 1JDZA 2Q9BA 4Y8VA 4PRLA 1CB7A 4EW3A 1I36A 1TLTA 5ITWA 5CH3A 1RRMA 1UXOA 5DHRA 3KO8A 2HGCA 3DW3X 4B47A 3EB9A 3RJTA 5K0BA 2UZKA 1CF9A 4IKFA 2AG6A 5I51A 1XSVA 4Q4JA 4BY1J 4ZVRA 3N8HA 3F4BA 3KSBC 2W2NA 1L7DA 2BL4A 2YHIA 3MWKA 1F7VA 1PVOA 4AWAA 1QWOA 2ANCA 5FEUA 2WAYA 4BQAA 3NETA 3QYAA 2X6WA 1F5NA 2WIJA 4I4CA 2IC5A 3VR1A 1IJFA 4CMIA 2C31A 1JTFA 1K6IA 2R8YA 3H3ZA 3NFYA 4N9QA 2EBHX 2MYNA 5BN1A 4TROA 5TEVA 4TLEA 2G0AA 4B7CA 5KMGB 5LRRA 2EQBA 3M5WA 1OAAA 4MTDA 2E2WA 3CLQA 2Q7OE 3I9V1 1GARA 2DOAA 1SCBA 2BFOA 3QE0A 4H6XA 4ER6A 2FRDC 3H5WA 1XA4A 3K69A 1IOLA 1XLVA 3P5SA 1B16A 1EVYA 1QANA 3E48A 3G7UA 4QYXA 2XSJC 3G2PA 2F8LA 5H5JA 5DWDA 5KZMB 4MCHA 4US1R 5JZBA 2HF8A 4OMYA 4CCLA 2XA1A 2Y0PA 3HNPA 1JKQC 4PNZA 4OQNA 1KFBB 4NWIA 4ECEA 1NSFA 1U0RA 1CYDA 2P3SA 1T25A 3H9CA 3DPUA 3UWSA 2C8VA 2BMVA 1I5ZA 2I6QA 2P3QA 3KZXA 3ZTWA 3CCUI 3RLIA 4DABA 1IQRA 1RNLA 1RWWA 3GX4X 2J07A 2KLBA 4RY8A 3H1BA 4UUSB 3ELBA 2HU8A 1RR7A 1P6XA 1E9DA 3DU6A 2BISA 1J4AA 3IMKA 4A36A 1ORRA 1ODKA 3C5EA 1VE7A 3ZWKA 1EGHA 4CVNA 3OCYA 3KJNA 4NBSA 4O2AA 3OECA 4KC0A 3H13A 1N25A 7ADHA 1JFVA 1ZRDA 3PPIA 4CKXA 3LC0A 4CMAA 5JSKA 5I7RA 1GU0A 3LQQA 3T38A 2IX9A 2WTUA 1G8FA 4MQFB 2D8AA 1SMYF 2VXDA 3K4MA 1STOA 2ZKLA 4ND1A 2VB6A 2O9LA 1S3FA 1Z2NX 2I1VB 3EAGA 4FZRA 2CHGA 4G4SO 1DPGA 4IQ4A 5EHNA 3IL2A 3S29A 3V8RA 4DG9A 1X3ZB 1QIEA 1YHQI 3F9CA 4QTZA 3U60B 3C5VA 1GDDA 1HY3A 1UBJS 2JI7A 3BXPA 4FMPA 2AQEA 3V7UA 2BHRA 1Y9AA 1YS4A 2CLKB 2SHKA 3ILSA 1VG1A 3QFCA 4PPNA 2XI4A 2AZTA 3GNLA 4UZEA 4ROSA 1WDKA 1Y4UA 5FFNA 2EX0A 4YJGB 3ISJA 3C3DA 1ZH2A 3D4NA 5HQJA 3U1BA 4C7KA 3DM9B 1Y37A 3D64A 2VLBA 2IGKA 4REMA 4ZEMA 2ES4A 5JNRA 1XK7A 2I4TA 2AXPA 2FW8A 2HCFA