4PGHA

Caffeic acid o-methyltransferase from sorghum bicolor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
354
structure length
354
Chain Sequence
AAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKALAAEEVVARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFDESVSTLVDVGGGIGATLHAITSHHSHIRGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPEKGGKVIVVECVLPVTTDAVPKAQGVFHVDMIMLAHNPGGRERYEREFRDLAKAAGFSGFKATYIYANAWAIEFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
publication title Determination of the Structure and Catalytic Mechanism of Sorghum bicolor Caffeic Acid O-Methyltransferase and the Structural Impact of Three brown midrib12 Mutations.
pubmed doi rcsb
source organism Sorghum bicolor
total genus 101
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.68: Caffeate O-methyltransferase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pghA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pghA02
3RODA 3LA2A 4HX4A 3A7EA 3V7CA 1BJAA 3W6KB 4LB6B 2P3LA 2DTRA 2VDUE 1P4XA 3C3YA 2PLWA 3KR2A 1UHWA 5DTRA 3TO7A 2V74B 4TV7A 4M6YA 2OAZA 3F21A 1FT9A 2Q2EA 1BOAA 2ZZKA 1ZYRF 5D6EA 2ZO4A 1XMAA 2BH2A 2EFQA 4RVHA 5EEGA 2V7EA 3EMBA 3I9FA 4QVKA 5LSAA 5LLQA 3GYHX 2UXNA 3QU6A 4EM2A 3LCCA 4OMYA 3GX4X 2AOVA 2OYRA 3TOAA 3EVEA 2XASA 3E23A 3I71A 3MAGA 3FUXA 3ZMZA 3QP6A 3GRVA 2GA9A 3GUDA 3WE2A 5LQAA 1LJ9A 1JSXA 3HA5A 3V8JA 3OFJA 2R3SA 1IW7F 4EM0B 2PT9A 2F5FA 3BDDA 3RIEA 4RAZA 3JTGA 4L0YB 5LHHA 1G4DA 3HRMA 2BEOA 2H27A 4M37A 4A12A 4DQ0A 4I09A 3TO6A 3JWJA 2ACJA 2IPXA 3H3UA 5DLYA 3BKXA 2NYUA 4ESJA 2HQNA 3EVCA 5CVDA 3FMQA 1I27A 5ICGA 4RTOA 4IKPA 2NXNA 5E2AA 5DX1A 1XCBA 3GCZA 1P2FA 4GYIA 2A07F 3NJRA 2EG5A 1MGTA 4YUVA 3KQTA 5B1SA 5FD5A 2JJQA 4EK9A 1J2XA 3LQQA 3BJOA 1XSXA 4HYEA 1MJBA 3B5IA 3HHGA 5HLHA 2ONZA 2MH9A 1S3JA 3IKTA 3BUSA 2DK5A 3ZMUA 1CGPA 4EKIA 4HH4A 4PCQA 3TO9A 1VTNC 3EVGA 2O0YA 3T5XA 4BHCA 2H11A 1Z91A 3IRRA 2VP3A 4A0XA 5A2QZ 2EX4A 5CVRA 2O0LA 2ESNA 2WA1A 2HOEA 5FADA 3BPVA 4KN7X 2IT0A 1D8KA 3ERED 3KCCA 1EQAA 3FTEA 5FWDA 3NMUF 2Y0MA 4Y30A 4UVCA 5IT9K 1EJ6A 5GM1A 2DFIA 4IRGA 1FYKA 1R36A 2G1PA 3QU3A 2P3OA 2ZCWA 4A6DA 3F6OA 5K5RA 3WTTC 2CKDA 1IRGA 4YFNF 1YFLA 3PS9A 1S29A 2QBYA 2NNNA 4BY9E 3TFWA 1O57A 3P97A 1SFEA 2B3TA 3M70A 2DQLA 2FE3A 3A26A 2K86A 2P5LC 5CM2Z 4BHPA 4KYWA 3BWYA 3DMGA 4G94A 5KS2A 2DULA 2P41A 1SKMA 3KEOA 5E1WA 4GOOD 4F7ZA 2C6YA 1K78B 4AZWA 4RTNA 1R18A 4YV0A 4QLCU 3KETA 2X0LA 3NTVA 5BQTA 4ZZDA 4EJUA 4P7KA 5KQSA 4RVDA 3GRRA 3F6VA 3GEZA 4DF3A 2BYVE 2O06A 4MHTA 4WWCA 5K8VA 1G55A 1BOOA 4CKEA 3EUHA 3ZN0A 2IH5A 3MCTA 5HILA 2XAHA 3ZMSA 3QOPA 3SXJA 3QOWA 1SMYF 2Z6QA 5D4SA 3K9TA 2AOUB 1YFJA 3Q87B 2B78A 3RKYA 1B6AA 2OB1A 4CO8A 1O9HA 1V39A 3IYLW 3BT7A 1J0RA 3EDPA 4RGRA 4ZZLA 5D5WB 4PYIA 3UFBA 4L9NA 3C3WA 2IA2A 3KZZA 4OOIA 4WX9A 2CMGA 1JG1A 5EVJA 5E1BA 2JHAA 4MTEA 2O3FA 3SSNA 2XVAA 3TDZC 5HZMA 5EC8A 1YF3A 2Z6AA 4XSXF 2Q41A 4G7ZF 4ER7A 3O2PE 1IAWA 3D2LA 4O3MA 3DUWA 2O03A 1PJZA 2ZFUA 2H09A 3I53A 3HCDA 2CG4A 4A5MA 4PYQA 3ELUA 3J81Z 4EMSA 2I62A 1YFHA 3KQMA 1YYVA 3ERCA 1O9GA 3NQOA 4OX9Y 4K2EA 4L9TA 4ZYDA 3EYIA 1HKTA 2EJRA 2FOKA 4Q48A 3WTXC 4P96A 2BR5A 5IKMA 4GF5A 4GUAA 2K02A 4GO1A 2HEOA 2KJCA 3E5QA 5F64A 1LNWA 1R8XA 4XCXA 3KE2A 3LAPA 3OZTA 2PEXA 3JAMK 3WGGA 2GA1A 1ZKDA 1TNTA 3A4TA 3KR9A 4U0VA 1NE2A 2H6BA 2RV8A 4U7DA 3B02A 1RI4A 5FQNA 1QGPA 3GO5A 4HF0A 1XGOA 1P1CA 1K7AA 2EV5A 4ASNA 5EIWA 4AZSA 4F86A 3DPLC 1T39A 4QVGA 3LECA 3SGLA 3EMDA 2PSSA 1JSZA 2QVOA 2XYQA 2M8EA 1ZGJA 5CVIA 4L0ZB 1WG8A 3T7SA 1FOKA 1PUEE 3WE3A 1UWVA 4G8XA 3E5UA 1AV6A 1G8SA 5DUKA 2L4AA 1J9IA 1IM8A 3KQPA 1GXPA 4HF2A 5DEQA 4U7PB 4NECA 2YU3A 3KZYA 3DXZA 1R7JA 3CJRA 4Q47A 1L1EA 3SM3A 4CXMA 5EPEA 3FTCA 1FC3A 1TBXA 1L3LA 3ABTA 5DPMA 4M73A 5GOZA 3QOXA 4QDJA 1AQJA 4BQAA 2QZ8A 1OPCA 4HW0A 1W7PA 2STTA 1QBJA 2D1HA 4M72A 4BXUA 3R3HA 3FYCA 3HOTA 2GPYA 1FBSA 2ZCJA 2WWYA 2HWKA 5HLIA 3FZVA 3ELKA 3JWGA 5K0JA 2XYVA 5GIOE 4HGZA 2P8TA 3VYWA 5KK1A 2O8XA 3KQYA 1IXSB 1FY7A 1R00A 2B9EA 1BC5A 1OYIA 2Z99A 2Z3YA 4KIBA 5D4RA 4MIKA 5LQJA 4EM1A 3DR5A 3DMHA 3WSTA 3HYIA 4AD9A 3C1DA 3MWMA 1TW3A 4LG0A 4U7TB 5A2QK 1XCJA 3KLNA 4L5IA 4U0WA 2ESRA 3SZPA 1WSUA 2AS0A 5E18F 1P6RA 3TR6A 3HIFA 4RV9A 3PX2A 5EQJB 1R5GA 3NDJA 2V9VA 2ZULA 1XTPA 2F5DA 3HCCA 4HTFB 3C18A 5BPIA 3ZQ7A 3V4GA 2AVDA 5HDGA 1IN4A 3PTAA 1IN7A 3QAHA 3GFIA 3WGHA 3FPFA 4H0EA 1LDDA 3F8CA 5HIIA 2DT5A 4UXNA 2EA2A 4R6WA 1XB4A 3CUQC 2FNAA 2ZTHA 5LHGA 5AIQA 3FTDA 1EAMA 2DI3A 2B0LA 3F8BA 1D2CA 5TJJA 4POOA 1HQCA 3KP5A 4XBFA 5DDGA 4DMGA 3RPQA 2VT3A 4OMZA 4RGSA 3FRHA 3ROUA 1DUSA 3HA3A 3BWMA 5CVEA 3HVIA 1WY7A 2GWRA 1P39A 3F22A 2FK7A 2L3DA 5K01A 1Z1DA 2VXZA 4WXDA 4LLGF 4FSXA 2H00A 2P5KA 2XKPA 4GGGA 4L5JA 3E6CC 1N7JA 1R8YA 3T0IA 5HDNA 3DF8A 3HRTA 4Z2YA 2VE8A 5K0LA 4QQNA 4ER6A 4GQBA 2FBKA 1MD0A 3G5TA 1HXDA 4KICA 4QWQA 4N0BA 4RTQA 2FEZA 5BP7A 4LFUA 3CJNA 1X1AA 4PCAA 3ZPLA 2FF4A 4ZYEA 3AWIA 4I7HA 4KW7A 1FZPB 4WXCA 1ZH5A 3LQRA 5CD1A 3LBFA 5DT2A 4WF2A 3QV2A 2UZ4A 2UYCA 2EJUA 1VLMA 3VODA 5L3EA 2ZNYA 1SUIA 2QYOA 3MEXA 5E1ZB 3V8VA 3MFKA 3KP7A 5U4XA 2JHPA 3ZN1A 3E05A 3H3ZA 1DP7P 1H1DA 2VS1A 4ON0A 2HR3A 1CF7A 1ZHFA 5EZQA 5HIJA 5CVJA 1RJFA 2PWPA 3ZMTA 3E3VA 3FUUA 1BIAA 1DUXC 5E9QA 4DNCA 4U7BA 3J7AO 3DP7A 5EG5A 3M7GA 3GIWA 1EJ0A 4RTMA 1T38A 1XDSA 1SD7A 2KRFA 2FSWA 4KNYA 5LGUA 3RJPA 5L3GA 4X60A 1LEBA 5ILUA 2WA2A 3PFHA 3HCAA 2XAGA 3EYYA 1YZ3A 3X0DA 3NVKI 3BWCA 5EMJA 3R4KA 3ORHA 2ZWVA 4MTLA 3UJ6A 2K27A 3LKDA 3GFLA 1FP2A 2B25A 3H2BA 4XUDA 3GFJA 5D5VB 4DCGA 2HZTA 1L3BA 4CGZA 3IEIA 1VIDA 2NNYA 4HV5A 2PLYA 2NXJA 3L8DA 3LA3A 2R7FA 4Q4ZF 2ZMEB 1XSVA 2E5WA 4E2ZA 1I9GA 1U5TA 3PFGA 4FT2A 3R6TA 4LMYA 1FJXA 4E33A 4P5OA 3ZP5A 2EFWA 3C7JA 1IXKA 3CC8A 1WQ2A 3DQVC 4XUEA 4LJZF 1ON1A 2M30A 2OZ6A 4P55A 4ZTBA 1FLIA 5FFZA 2HFHA 4A2UA 3C0KA 4ER0A 3LPMA 4ER3A 3TGNA 3FWEA 4QTTB 1INLA 3PT9A 1ON2A 3M6VA 3K1NA 2P7VB 4YUXA 4HC4A 1T2KA 1RIOH 4LLLA 3M6UA 1SUSA 4A6EA 1S8NA 1HNNA 4MQVA 1Z6RA 2RN7A 5FQOA 3EVFA 4EJOA 1IY9A 4LG1A 3IHUA 5JFRA 2AOUA 5TRDA 1JG2A 2XIGA 3DEUA 2A14A 3G5LA 5J8CA 1FSEA 1U5TC 1NW8A 1KPHA 1J59A 1B42A 4CICA 3R0AA 3B3FA 3THRA 5HIMA 3J80K 2XYRA 2RC4A 3ZMVA 3B3GA 2H6CA 3GWZA 4IV0A 1E17A 2VOPA 2EWNA 4GBED 3GVAA 4IV8A 2L4MA 2F5EA 5EKUA 2AN3A 5FFXA 1VL5A 3UJ8A 5F6FA 2E1NA 1W5TA 2AR0A 1R1VA 5EMMA 2PGXA 3JAMZ 2XVCA 4OU0A 3KQWA 1IN6A 4ZH4F 3C6MA 3M6XA 1G3WA 3P9IA 5FLXZ 3NWBA 2LF8A 1KR5A 2EFOA 3D0SA 3NRVA 3EGVA 3KPUA 5LEJA 2PXCA 4ESFA 3DMFA 3DFGA 3M8EA 4XRFA 2A61A 1BI2A 2OZUA 2V1XA 3MQ2A 1QZYA 2GAFA 2XGXA 1FBUA 1U2ZA 1JQEA 1QNTA 4BLVA 5HDKA 3L00A 1J7KA 2JH8A 1WI9A 2FBHA 3MHTA 4A0YA 5D8KB 5ICCA 2I9KA 2NRAC 2BGCA 4P9UA 5KVRA 2IH4A 1BI1A 4HV6A 3FYDA 3WG9A 4N9IA 4E2YA 1D3YA 2NXCA 3COAC 1MDMB 3CBGA 3EVAA 1R1UA 2YXDA 1JG4A 5HLGA 4F85A 2A5YB 1LB2A 4HDVA 3MB5A 4HZFA 4G56A 2FK8A 4MQ9F 4UV9A 3M6WA 5KQRA 2RKHA 2NXEA 2FQ3A 3PLAE 3DXJF 2NS0A 2Z6UA 3PX3A 4EJWA 4QPPA 2BZGA 3BPXA 2P6SA 2HDCA 1LEAA 2ZLBA 2Q8KA 2LD4A 4PCLA 3ECHA 4HLXA 5CJ9A 3HCBA 5CYVA 4MQ4A 1ZG1A 3V97A 2CWEA 4RTSA 2ZBQA 1R1TA 2DW4A 3ER8A 4HAMA 3WODF 3TKAA 4R8SA 2FNPA 4S05A 3KPVA 1XVAA 2QWWA 2JG3A 3WGIA 4P7FA 4KUMA 5CVVA 1TQMA 1JG3A 2ZJ2A 4R8HA 2BR4A 4EJTA 1BHJA 3E6BA 1WRJA 1ZRDA 2P3QA 4CKBA 3R0QA 5LQRA 2OBPA 5DD8A 4LK1F 4DKJA 4YUYA 4OINF 3UWPA 4LK0F 3FHZA 3A25A 2PXXA 2IFTA 3IHTA 2TDXA 4L9VA 3P9KA 2PXAA 5E8IA 3S68A 4DQ2A 1MZBA 1O3SA 2NNWB 1BM9A 3LHDA 2V1UA 3B3JA 2ERCA 4WVLA 1Z9CA 3C3PA 2W25A 1G8AA 3NDIA 3LWFA 4UHTA 1ZG5A 2IDJA 3O6BB 5T64A 2FCAA 4S04A 2H94A 2IBSA 3FXRA 3FUWA 2CGPA 4HTFA 3TRKA 5ILSA 2MH2A 3CLOA 2PBFA 3W6JB 3JSPA 5E9JA 3NVMB 3E6MA 3I58A 2AZTA 4CTKA 1ZG3A 4OA8A 3BOQA 2PX2A 4UUVA 3C6KA 3FZGA 2CFXA 1XD7A 2PV0A 5DM0A 2OY0A 1QPMA 5FA8A 3GO4A 3FM3A 1U78A 4CKCA 1W7PD 2P40A 1DPRA 2PWYA 3KR0A 3LDGA 5HIKA 2NAZA 4M38A 3EEOA 2M87A 3THSA 2OD5A 3BP8A 3KP3A 2C7RA 4BLUA 1EH6A 3AJDA 4RB2C 1VQ1A 4RGXA 3D5LA 1XN7A 1T6SA 4MNUA 4KMUX 5L3BA 2M1BA 3CGGA 3CO6C 2QUFA 3M8FA 2ESHA 2FU4A 5C1IA 3BY6A 5JHUA 4IXAA 2AN4A 2ETHA 5CIYA 2WK1A 4WXHA 2FHPA 5LBQA 2I6GA 1B4AA 2KW5A 2JZYA 4PYKA 2ADMA 2JPCA 4ZYGA 5LHIA 1RZ4A 3UJBA 5GIPE 2IW5A 2IDKA 2VONA 2IGTA 5HS8A 3LL7A 4BNCA 2O07A 2EB7A 1G3YA 4AIHA 4RVFA 2QQ9A 4HSGA 2DPUA 4OQDA 2IP2A 1FP1D 4FX0A 3G8AA 4Q5SF 4XSZF 4I98B 3V7RA 1N7IA 2XAQA 2EK5A 4R6XA 1B9NA 1OMIA 5ICEA 3F23A 4O29A 3BGIA 5FHRA 5D8LB 2VC1A 5LGNA 4L9JA 9MHTA 4L18B 1AQIA 2HKOA 3P9CA 2GLUA 1I1SA 2P1DA 3FMRA 1A04A 3LDFA 1W4MA 1KXZA 1D8JA 1YW7A 2MD5A 3TQSA 2HR1A 2DLLA 2CQKA 5K1YA 2GH1A 5M5BA 5FLXK 1D2HA 2VE9A 3SZTA 4Y15A 2DO7A 2PBIA 3BGDA 3P2IA 4AZTA 3MERA 1KA8A 2JSCA 4MEXF 3OZSA 4L7VA 2E7WA 5ED4A 5GP1A 2IVMA 3SR4A 2GXBA 1L9KA 2VOOA 2BM8A 3F8MA 4EQZA 4GXOA 2HQRA 2UXXA 3OFKA 4I02A 1ODDA 3FPEA 1IN8A 3I5UA 5L3FA 3FXQA 5DM1A 4YMGA 5HOQA 2YR0A 1JTFA 2EFNA 5C9ZA 4GC9A 3Q9SA 3BZBA 2G9WA 4PINA 1V4RA 1M6YA 2QRVA 3U1DA 3CTAA 3I59A 4HGYA 3KPWA 1G6NA 5T67A 4M6XA 4P58A 1ZRFA 4DA4A 2EFJA 4V0RA 5LR6A 2AOXA 4KT5C 3FXUA 1WZNA 2ONYA 3FTFA 3J80Z 1KGSA 4O5VA 2QENA 4GYGA 3F4KA 1B9MA 3LKZA 1RI2A 1OR7A 1LVAA 1SQFA 4P7GA 4HX8A 5MHTA 5E8RA 4IRHA 3JTHA 4UOEA 1B59A 3HVKA 3FF5A 1G3SA 1HKSA 3WU0A 4RTLA 5K05A 1BN5A 2FRHA 2ZW9A 4AIJA 5F2KA 5DUIA 3PFIA 5FULA 2HS5A 3JWIA 2HMYB 1NHAA 1YG2A 3E8SA 2BM9A 4HOBA 3HA7A 4LLNA 5CUQA 2H1RA 3U9GA 1VP3A 4MGRA 2A69F 3P2EA 1KYZA 3KQSA 4YUZA 4MEYF 1JQ3A 1NBIA 3FM5A 4EQQA 3IWZA 3TM4A 5K0CA 3KPJA 2IA0A 2GS9A 5F1RA 1S6LA 5K09A 2BV6A 5K0BA 4HF1A 4ETSA 1F4KA 1RJEA 3HVJA 1WS6A 2PJDA 4M9XA 2QBYB 1J5YA 2ZFWA 3VFZA 5LRSA 3QPHA 2BE5F 4ENMA 5DRTA 3GRYA 1UIRA 4OIRF 5DTQA 2K4BA 5GINE 3TM5A 1NW3A 2FYTA 1EG2A 5EHGA 1SD4A 1DPUA 1FPQA 5HS9A 3SSOA 4YFKF 1ZQ9A 3G2PA 2E1CA 3EPPA 1ZN2A 4E2WA 3PQJA 3HTXA 5H02A 2HTSA 3R0JA 2ORED 3FPGA 1BI3A 2PJPA 2XKOA 3CDHA 3HUGA 5EGSA 4C07A 2YPRA 3EEYA 3UA3A 1KHHA 1ORHA 2PKWA 3GU3A 1FBQA 3JSOA 3BWBA 3BKWA 5FCDA 4HQEA 5HS7A 3G8BA 3G2MA 3MTEA 3ELDA 1VE3A 1G3TA 2Y1XA 3ZMDA 3M33A 1JXSA 3GJYA 3ANXA 2DK8A 3HNRA 4EGZA 4CXFA 1Z7UA 1MDMA 3HHHA 3IC7A 2QM3A 4MHGA 4QPNA 1O7LA 2I7CA 3KQQA 5LRRA 1YW9A 3L09A 1WKMA 1X19A 1EH7A 2EFPA 2ADUA 3KKZA 1S7OA 1IN5A 1QO0D 4HBLA 2Y75A 4FT8A 4IPAA 1WXXA 2OZVA 2FPOA 1SG9A 3O3KA 3GFMA 3G89A 3LBYA 1HBXG 1T0FA 4RGUA 2EA4A 1L3CA 1Q0SA 2OKCA 1I4WA 3ELYA 4DCMA 3REOA 5ERIA 4I0AA 1YQAA 1Y8CA 4DZRA 3U2RA 2V6CA 5DSXA 1BBYA 4EV0A 5EKXA 5JR3A 3GNLA 5D5XB 3O7WA 5F2OA 5CVUA 1NT2A 2PN6A 2LF7A 4Y13A 1KPIA 3TOSA 5DCMB 2D1VA 1HW5A 2QQBA 3LGAA 5K5QA 5FD6A 1HKQA 2M45A 1KPGA 3DPTA 1X3UA 1O3TA 3SQNA 1RI7A 4G6DA 5HFJA 3LSTA 2G8NA 3Q9VA 2OO3A 3A27A 2EV6A 4PYLA 1RUOA 4KA4A 2XUBA 1X1CA 2AVNA 4FS8A 4BP3A 2JRTA 3KP4A 3NW9A 2WC2A 3ECOA 5FGMA 2P4WA 1D5VA 4CYDA 3GF2A 3AXSA 1DL5A 2UYQA 4PWYA 1P92A 1K78A 2DU9A 2R6ZA 1X1BA 3RTRA 1Z3CA 1XJ5A 1R23A 2P35A 3E5XA 4U88A 1NW5A 1Z05A 1ZGAA 3MZHA 2Y1WA 4M7RA 4H0NA 3QRFF 4GOLD 3JWHA 2J5OA 5FO5A 3FPJA 3VC2A 3MGGA 4O6JA 1KP9A 5FTWA 4A0ZA 4GEKA 5E9WA 1AF7A 2CL5A 5E17F 4LWPA 3UJAA 3WTSC 3R6SA 1T43A 2ZBRA 4YV2A 5AONA 5LQUA 1KU7A 2XRNA 2YR2A 1BI0A 2KJBA 3KP2A 1RI3A 3PB3A 3BZ6A 2RDPA 4EJVA 1MJ9A 1KIAA 1L3IA 3O4FA 5H6RA 3CCFA 4YIIA 3IRQA 3HRSA 2NYXA 1QAMA 5BOXA 3ELWA 4YV1A 4EKGA 1O7FA 4ER5A 3B73A 2P7IA 3DTNA 3IL2A 1HW1A 3KEQA 2W57A 2F5CA 3E97A 3M9AA 2PX5A 4UVAA 2XROA 1YB2A 2BR3A 4KRGA 3IWFA 4AWXB 1UHMA 3CUQB 2YXLA 2YSRA 1XGNA 1IF1A 2ELHA 4UV8A 3ME5A 4C05A 3LA7A 5DSTA 1N2XA 3OU6A 4PIPA 4PONA 2O05A 4E70A 3BWGA 4CTJA 1Y0UA 3RYPA 4LG0B 4RSRA 1QYRA 4OIPF 2G71A 3FRIA 5DM2A 2FMLA 4NB5A 5JI6A 4ENJA 3K6RA 1YO5C 1HSJA 2AOTB 1PP8F 2L01A 3N4MA 4QQKA 2FMYA 4C06A 1L0OC 3F8NA 1NW7A 3LAJA 3OV8A 1XXLA 4EGYA 2ZWAA 5E8JA 4KIFA 4HA8A 2FBIA 1Z6TA 3CVOA 2W85A 4IWNA 4GCVA 1X1DA 1KQ0A 3P9NA 5D1NA 2VDWA 5BW4A 4WK8F 1YS7A 5DX0A 3UBTA 3R60A 5D6FA 3EVBA 1R5HA 6PAXA 3IV6A 1SFXA 3LDUA 2EJTA 2CSOA 3K1MA 4A5NA 2HKXA 3KR1A 3UZUA 1SFUA 1TTYA 3HTUA 2F2EA 2YX4A 1OYYA 5E20A 5EZSA 1MJFA 2GXGA 3CJTA 2IIPA 5E1XA 2ZZMA 1IXCA 4M71A 1REPC 1BC7C 4M9SA 3E7PA 4JXJA 4FSDA 1TLHB 1RI1A 1SMTA 2YTZA 4RTJA 2GIVA 1FSHA 1XMKA 4BH9A 5E8GA 1TQPA 4XLPF 4I01A 4Y17A 5KYGA 4RB3C 3WTUC 2DQRA 2C7OA 1I6XA 1WWXA 3HCEA 2XHKA 1SQGA 3RIRA 2YVLA 3GRZA 4RS8A 4LWOA 1O3QA 2ZIGA 1NV8A 4PYNA 2XV4S 1JR4A 3M1EA 1Q0TA 3N97A 3ISPA 1S7AA 3MCZA 4KVZA 3GW2A 3V7SA 1JQDA 4MWZA 4X63A 1K79A 2EV0A 1KQ8A 3KQOA 5E2BA 2AS5F 2YUIA 3IKVA 2VDVE 3OOPA 2IA1A 7MHTA 1SD5A 3HSFA 1CF7B 1GVJA 3M4XA 4IJAA 3G3ZA 4C04A 2WV0A 4RTRA 5J8FA 3L9FA 1YS6A 2O61A 3VSEA 2P7CB 2QY6A 4G9YA 3AAFA 2J5PA 2CWWA 3RPUA 4RYLA 1JTEA 4BYYA 1XSDA 4BLWA 3UJ9A 2ZBKA 1BC8C 1KU3A 1F9NA 2CO5A 1RJGA 3MTIA 8MHTA 3FX3A 1J75A 3HEMA 2ZKZA 2PX4A 4EVIA 4AX8A 3EQLF 4D0PA 1R22A 4R05A 4HLYA 3R9XB 4HG2A 1KYWA 4OBXA 1ORIA 3O31A 4B8XA 3OE4A 1I1GA 2VZ9A 5FUBA 1ONVA 3WTZA 3MAJA 3KPYA 1LQ1A 3HCFA 1Q1HA 4R1HA 4X41A 4RAYA 1FYLA 5DX8A 4PYOA 2PQ8A 4UVBA 3OPNA 4PYMA 2D2WA 2FRXA 2IPQX 1H9TA 3KU1A 1U5TB 2L54A 1MKMA 2YQZA 2GA2A 3GGDA 1ZLJA 3DXYA 1TQIA 1VP9A 3ML6A 2IH2A 1NV9A 4CZZA 1HSTA 4MTDA 1F38A 2DBBA 3I4PA 2RVCA 4R79A 1KQ9A 1USSA 2VBZA 1AWCA 4RWZA 3LFKA 5EEHA 2CW0F 4KWCA 5D5UB 1H0MA 2STWA 1F1ZA 3I64A 3TKYA 4OIOF 2ZNZA 2UWMA 3HM2A 3T7RA 4QDKA 2V79A 2D45A 5K0FA 4HX7A 4M9ZA 2DAOA 3L2CA 2O6GE 1KU9A 2W24A 4IF4A 2GZWA 3T7TA 2LNBA 1K6OA 5AIPA 4UNOA 1EV7A 3R24A 3TPZA 1HMYA 3ER9A 4QTUB 2HGCA 2Z33A 4LGWA 4KN4X 3BJ6A 4HQMA 3WTYC 1WXWA 1ZAOA 3T0YA 2HV9A 3HRUA 5EMKA 1JHFA 2E7XA 5F2NA 4ATNA 1FBNA 2VBWA 2F8LA 1IRFA 3F3XA 3TQNA 2YXEA 4K6MA 1ZARA 1EH8A 1F5TA 3R61A 5GWXA 3ABUA 1NKVA 1U6GA 5EOVA 2PVCA 1R6AA 5BPDA 4GOMD 4X1OA 3VC1A 4JQFA 1O3RA 3CKKA 3EGEA 3G2QA 2UYOA 2B2CA 3LX6A 1IUYA 2HYGD 4CWAA 3TLJA 4JBAA 4KDPA 3DOUA 2NP7A 3SFZA 2JPBA 2A3SA 3SMQA 1UCRA 2MC3A 2VC0A 3MZYA 1C0WA 3RW9A 4CHUA 1E2XA 3KP6A 5K0NA 4LD5A 4R8RA 4G7OF 5LQKA 1D2GA 3GXOA 1NBHA 5DCMA 2IRFG 2FXAA 1UB9A 3JW4A 3CO7C 3QPTA 4JK1X 4KDCA 5J6XA 4NHJA 1V3FA 2P5VA 4YIFA 5HOOA 5DTMA 1SD6A 5BXYA 2UYHA 5EHIA 4M36A 1RJDA 3K2ZA 2VBYA 5K5OA 1QQIA 3NEUA 5K0GA 2KIUA 3V8LA 2N47A 4FX4A 2JH9A 1GXQA 3VEPA 1GHCA 1JGSA 5HEKA 2X4HA 3OU7A 2MLKA 2K4JA 5DYMA 2ZMEA 1EIZA 4NQWA 3K69A 1IZ1A 3BJAA 3UJ7A 4BAYA 5EMLA 2JTVA 2CMHA 1LDJA 3FMSA 1R74A 5D1HA 5DCFA 1MJAA 3DULA 2DPMA 3U81A 4KFCA 5DRYA 1U8RA 4ENNA 1FYMA 4RB1A 1QZZA 3OZRA 3Q7EA 3OCJA 2OXTA 2COMA 1SAXA 5DXAA 4C03A 10MHA 1BKYA 1TNSA 3T8TA 1VPTA 4B09A 3SSMA 1U2WA 5IH3A 2A6HF 5BMZA 1P4WA 5L3CA 1XCLA 2GB4A 4N9HA 1VBFA 2DPDA 4PIMA 1SVUA 1H9GA 4LB5A 3PQKA 5K0EA 2HWVA 3FUVA 4PGGA 1W5SA 1M0EA 2HTJA 4G7HF 2OA4A 2JT1A 5FHQA 3RDIA 2XVMA 4AIKA 2Z5UA 3P7NA 3LCUA 2Y48A 1ZREA 3TMAA 4KIGA 4RTKA 3K1PA 3P71T 4E2XA 3UA4A 4LECA 3SVZA 4OA5A 4XUCA 4C08A 5CCXA 4E30A 4F84A 1I1NA 3HTSB 3P2KA 3CUQA 4FP9A 3F72A 4ZYHA 1JE8A 5DV5A 2OB2A 4OBWA 3LCVB 1OYWA 4FZVA 1XDZA 4P7JA 3B89A 2MA3A 1JHHA 4GC5A 3GDHA 2O57A 4YUWA 3GRUA 1PP7U 5JUWA 1XGSA 4AUKA 3DLCA 2L02A 2PT6A 2MLGA 2HNKA 3BGVA 5HVQC 2Q0OA 4E31A 5LEKA 4AZVA 2AOTA 1M6EX 2AN5A 4IVNA 4PDKA 4ESBA 4U0YA 3ID6C 2ZIEA 4XLNF 1ZRCA 1F3LA 4RB0A 3FPHA 1RUNA 1G6Q1 1USTA 5L3DA 3FUTA 1YIOA 3KHKA 1NW6A 2G7HA 1PDNC 2OPBA 1G38A 5FB2A 5LGTA 2LDUA 3DLIA 1QANA 1YW8A 1DDNA 2PMHA 5C0OE 2QQAA 3HSRA 2CYYA 5H20A 2NP6A 1STZA 3GLXA 5BS6A 2ISZA 1TW2A 5DXJA 1HW2A 4YFXF 2MBFA 4FHTA 1LDKB 4KDRA 2ZIFA 4FGZA 4WCGA 5DM4A 2G70A 4PYJA 2LKPA 2KIMA 3EETA 3OE5A 3WTVC 4G6QA 3KLOA 5BW5A 4AVPA 3UJCA 3S2WA 4FT4A 1ZLKA 2KKOA 1U3EM 3AXTA 5DWQA 1ULYA 5DD4A 1RNLA 3K0LA 2C7QA 4Y2HA 2IJLA 3QP5A 3DKWA 3F8FA 1FNNA 4BP1A 3G88A 4HDUA 4X61A 1UFMA 4HRAA 1UFKA 3T8RA 2P8JA 2PX8A 5CCBA 2LSOA 4PNEA 1MHTA 1FX7A 3PVCA 3A7DA 3I54A 3V8KA 4C4AA 2YX7A 5EIFA 1P91A 5G02A 5GM2A 2V1DA 3KQVA 2C7PA 5IT9Z 2RQPA 2ZSUA 5E1MA 2A68F 2RNJA 2K4MA 3KFWX 4IHSA 5JVTA 1B1BA 2OBFA 2BBYA 2HTEA 4PZJA 5E1OA 5K03A 3HOSA 4RVGA 1OR8A 3T1BA 3TDUC 4KMFA 3Q5FA 2K7LA 5E1DA 2ZVJA 1OKRA 3G7UA 2QLZA 4I2OA 3ULQB 3G73A 2OU2A 4ENKA 2R7DA 2AXLA 5ERGB 1XCVA 1TPYA 2PY6A 2XAFA 1YTYA 4RTPA 1KU2A 2UZKA 3RI4A 2PI0A 2XAJA 2QE6A 3VOEA 3BROA 3GZ5A 3CUOA 3AY0A 5P8WA 2ZBPA 3G2OA 3NWEA 3B7PA 3HSEA 2XBMA 3EGIA 3TOBA 2P7HA 3I0TA 2VBXA 3SHFA 1G60A 3DV8A 3SX0A 1R58A 3DXXA 4BHBA 1P1BA 3BXOA 5IT3A 4OQEA 4CDGA 3P8ZA 3J81K 5FA5A 5CLSA 3HP7A 2PMUA 3MQ0A 1O54A 2G72A 4IHTA 3H92A 1YZHA 1PRYA 2W84A 4PGHA 5KVAA 2QRVB 4V0QA 2P6TA 1XDUA 2A6EF 3EVZA 1XGMA 5ICFA 4IRIA 3I59B 4ISCA 3OU2A 3CJQA 2AOWA 3EVDA 1BIBA 4YMHA 2G7UA 1T98A 5H6QA 2IBTA 1FWZA 3GZ6A 1IXRC 2OQRA 1YUBA 5ILVA 1QAQA 3HVHA 1W7PB 4GOND 2OQGA 4E32A 2VODA 3WTWC 4P9FA 2FA5A 3UJDA 3RKXA 1DCTA 2KIFA 2ZXJA 2PFBA 4DM3A 2Z9OA 4RX1A 3L7WA 2PG4A 2JHCA 3DH0A 5LQCA 2ZZNA 4M74A 5FWAA 3E6DA 4OIQF 2HYFA 2M5WA 2VT2A 3K0BA 3RYRA 2YX1A 3RKWA 1YLFA 3SXYA 2WTEA 3WU1B 3VB2A 5LQNA 4B17A 1QAOA 4YG2F 1I5ZA 2GAUA 1RI5A 1P4AA 2VN2A 1AOYA 4I0BA 4FR0A 5T6BA 2GQQA 2ISYA 2RGVA
chains in the Genus database with same CATH superfamily
4NOMA 1KSGA 4U2KA 3W6KB 5J3JA 5EY5B 1G8JA 3U7IA 1P4XA 4C01A 4PSUA 4TV7A 1JALA 5EJ6A 3G17A 3TCKA 3EMBA 4H31A 3FOZA 4KV9A 3GYHX 3WR5A 5AO9A 4GPIB 2R6AA 1FNDA 2FU5C 5IEBA 2IHYA 2TSYB 2VKTA 4FNMA 1Z36A 1NYTA 2X40A 1T8YA 3H86A 2O7NA 1E32A 2CNBA 4KFRA 4XARA 1XFAA 1Z88A 2PT9A 2R2AA 5JFOA 4DIBA 1Q3HA 4L0YB 3R40A 4WVFA 4IOMA 1LQUA 2IE8A 3BPSA 2FLVA 1T4CA 2ACJA 1CB7A 2LW7A 2OPHA 2AE2A 1YA8A 5ICGA 4IO0A 4ONEA 2JIZA 5KQMA 1GU7A 2BEJA 1EFHA 3C2HA 2B8EA 4DA9A 1J7JA 5C5CA 1RQRA 3H0CA 4HZUB 3A6GA 4G67A 3VH1A 1BFUA 3R0ZA 1CGPA 4X45A 4BHCA 3ZQFA 3QLUC 1ETWA 2EX4A 5CVRA 4OGLA 4ARBA 5FADA 4XM0A 1PR0A 1YXMA 8ATCA 4QJBA 2CDAA 2F55A 4Q1FA 2DFIA 1EFPB 2MSKA 5AKKA 2P3OA 4FX5A 3DG9A 2J3QA 2NUAB 2RIPA 2NNNA 1O57A 2X15A 4EPTA 2X86A 2GBLC 3A2MA 3HN7A 5KS2A 2DULA 2E82A 3B1FA 1AVTA 2I3DA 3AIKA 3QW4B 4OAZA 3FHLA 2WF6A 3BB1A 4BNNA 1NMQA 1GAQA 3V2IA 5CVCA 3NTVA 2IHZA 3HN6A 5DNVA 2V7BA 1L5RA 5K8TA 5FKKA 2CUKA 4A2CA 2IZ6A 1E6LA 2NTNA 1N2BA 1F06A 3A1WA 4ZQEA 3BE8A 4YYZA 1IOLA 1SN7A 3QYPA 4HNVA 4G85A 4BTVA 1SUPA 2XYHA 5A3SA 2HB6A 3P0EA 2VTVA 5EVJA 5TQ0B 4BKRA 2XSJC 4BGIA 2E1RA 2C5SA 1XV5A 1O6BA 4OWRB 2ILVA 4JELA 5BSUA 5HF5A 2WU1A 1P1RA 4KWIA 1U8UA 2F6CA 4W4TA 3U49A 4FDUA 1ZI9A 4RJLA 1XJ0A 1G7TA 4R84A 4JKOA 1F51E 1T13A 2BR5A 4IILA 1T1EA 3LAPA 2PZKA 2QRPA 2GA1A 4DWWA 1U4OA 5JRDS 1C0EA 4U2GA 4MV1A 2C3OA 3KKEA 3TZ6A 1F2TA 4UTVA 4JKYA 3N2LA 3KB6A 2D59A 1SKQA 2DFVA 3QPDA 4W7SA 1WDWB 2PSSA 1DKUA 1KU0A 1E0KA 4G0NA 1L7PA 2EVWX 3L4BC 3WE3A 4GRIA 3H8SA 3KQPA 2XGJA 4GZ6A 1R0CA 3IURA 1QVTA 2LRDA 3DZIA 4MUGA 1D0SA 1QIGA 3SF8A 2QDKA 2M7AA 4IKEA 1EFKA 4U9HS 2FUG1 1O77A 5KTYA 3GUHA 1LDBA 1USIA 1S2MA 3H6GA 1DADA 5DTJA 5KYNA 5AJYA 1MFZA 2F1IA 2G5TA 3AHHA 3LY5A 3CMCO 4UBLA 3F6CA 2NVUA 3M6LA 1KO7A 2X1CA 2YZ7A 4KIBA 1R0LA 4G5RA 1Q3KA 2ODTX 3M3YJ 4AD9A 2W8ZA 4DEVA 1F43A 3BTIA 4U0WA 2AKYA 4DHEA 3FR7A 1WSUA 4FFVA 3HCCA 3GJ3A 4IKFA 4XGRA 1LDDA 1JW9B 3F8CA 1FYDA 1N0HA 1SIOA 4AWBA 1ENHA 3W4IA 3ND8A 4G5HA 4P4SB 2DECA 4RPCA 5D3QA 2ZJBA 3QUAA 2Q3HA 4POOA 4RELA 2QG9A 3I6ZA 1C9NA 1C8KA 5ILOA 5JVDA 2VH1A 4EG8A 3KQLA 1NKSA 1W47A 2IYFA 3D2AA 2XNKA 4GGGA 2EJCA 3DF8A 5B3JA 4HMPA 2FBKA 2XUZA 2WB1A 3CURA 5F1KA 3PBKA 4WXCA 3TSOA 4M1OA 5E1ZB 2WV9A 3LUFA 2QT9A 1X3ZB 4MHOA 1YCHA 3A3YA 5ITZB 2CLIB 2VS1A 5F73A 4U2EA 5F9MA 2YWGA 1BIAA 1I3AA 2EFYA 1V9SA 4A5SA 3CLTD 4O4HB 2BGGA 3V1NA 1H2XA 4WK0B 3GP8A 2OPTA 2D0IA 1EFPA 2WA2A 4NZZA 2QW8A 3OLXA 2NUAA 3BA6A 1QWSA 1AUQA 3PQFA 4EPXA 1QZUA 1FP2A 3QMPA 4XIGS 3OIVA 1I80A 1OT5A 1G7RA 1ZEMA 3SZGA 2QVXX 3LUDA 2DWPA 4R41A 2PUGA 1HYEA 3VPSA 3R6TA 3TTVA 2JRCA 1N77A 4RA9A 1HCRA 2WUEA 5BWMA 4ZPJA 3FYUB 2V9ZA 1I3NA 5LKAA 4O8CA 3SI7A 3W5HA 4GYYA 3FWEA 4QTTB 4ZYZA 1G20B 1E7RA 2PZFA 3FXOA 2GPNA 1RIOH 4K9OA 5I9MA 3A06A 1HNNA 2CXUA 2BGKA 4JGGA 2KQRA 2XIGA 3PUKA 1LV7A 3JALA 5JIBA 2IU6A 4AS1A 5CFOA 2XXAB 3GWZA 4KI0A 4F46A 4GBED 2WSIA 2OBYA 1C0PA 1DIAA 4KIUA 4LCEA 2G4CA 4TUYF 2PGXA 1FNCA 5T4FA 3VSCA 2BPOA 1IN6A 5BNIA 1N8TA 4ZEXA 5E6UB 1KR5A 1BW9B 2E2WA 5IAKA 1DC3A 5GADJ 4A4DA 4MV6A 3L93A 2J5XA 2GIZA 1QU2A 1UBMS 4RMJA 5HDKA 1J97A 1AK9A 3L00A 3E1KA 3JAKB 1OIWA 2FBHA 3B82A 4HPWA 2QX8A 3KAJA 2C9MA 1GZ3A 3CBGA 1QRTA 4EZBA 4YALA 1NC3A 4HZFA 2FB9A 3RRNA 1PX2A 4UV9A 1JU3A 1Z82A 2ZPUA 3PLAE 3DXJF 2WTAA 5ALWA 3PX3A 1RU3A 4DGQA 1OGYA 1FFWA 2AFRA 3FBGA 5H83A 3M5CA 3F6YA 5CYVA 2WJWA 3OQVA 4MQ4A 1XTKA 4Q05A 4BN4A 2CWEA 2ZR7A 2Z2ZA 3K4QA 1EAYA 3HDDA 5D7BA 1T2UA 1UMCB 4AMGA 5CVVA 1QRDA 4ITRC 3VC7A 4EJTA 3AVXA 2V4JC 4BEHA 4GYJA 4OX9B 1QIKA 4XONA 2C4KA 2YH2A 1U28A 1ZIYA 1KXJA 3LHDA 4W1RA 4D9GA 2GZDA 4FDLA 4C6RA 1QFJA 1DIBA 2BH9A 5JPDA 2OCXA 5DASA 5FV4A 1V25A 2GBGA 3TRKA 4ZU6X 3WLQA 1JKQC 3DE1X 2BMDA 3PR3A 4FZ5A 5SYNA 3RVBA 2MGQA 2AZTA 4A3FJ 1G291 2PX2A 2IUTA 4LRSB 1XD7A 1VMDA 5LLDA 4TQAA 2GPBA 2X42A 4PXAA 3FM3A 2WUDA 1ZC3A 1PBNA 4UVDA 4ZTZB 1SAUA 1JKRC 3CO6C 2BXZA 1DX9A 1X0VA 5TR9A 4Y8VA 4DWVA 4XDGA 1LPBB 2OAGA 4E4RA 4MJ7A 3O84A 3KNZA 1U6JA 4Y33A 4HDKB 3E53A 5LOVA 1RZ4A 5TB5A 1JVSA 3W5DA 2IW5A 4HF7A 4JVSB 3MHPA 5FI5A 3K9NA 1ISPA 1BDJA 4CCOA 3L6RA 3AM1A 5ITZA 2PMZN 3T5GA 4XLAA 3HOZJ 2GXUA 2GLUA 2MSWA 4I4TB 4YFVA 2KSQA 2QG6A 4YCMA 1D8JA 4KSBA 3MA0A 2E49A 4M55A 5COAA 1GFWA 5M5BA 5FLXK 3T3NA 2QN2A 2CNOA 4AJ2A 3MERA 4MEXF 2W6QA 4I5EA 3WL3A 4LFBB 4Y6RA 4LQCA 3NH6A 1QOPB 1IG3A 3FG9A 3O03A 3B2EA 2G9WA 3MFYA 5IYZF 2HPVA 1W34A 2JGFA 1RBZA 2EFJA 4K6HA 3FYUA 5LR6A 3VPDA 1H65A 2D2VA 2ONYA 5BYBA 1N6RA 2QENA 1YA6A 4IRHA 1G20A 3HZZA 3ZHCA 5C7IO 1QQ5A 2H52A 3HE3A 5TJ9A 1GTJ1 3CPSA 1RAAA 4N41A 1NHAA 2NVWA 4G24A 1MO4A 4PTLA 2RHOA 4MK4A 4N5HX 4MEYF 2XXAA 4BE2A 1RC8A 1AGRA 4GOJA 4Y7CA 1J9ZA 1LBHA 2C2KA 1E2QA 4AW9A 4BX2A 3W5BA 5EERA 1OWOA 1ZK3A 4CH7A 5E6UA 1I36A 5CEJA 1YS2X 5EHGA 2YV3A 1XPRA 2IOQA 2QX9A 1I4LD 3K9GA 3CDHA 4M1EA 3UA3A 2QEXI 1QRSA 4HQEA 3K70D 3NYWA 2HRZA 1USUA 4B1FA 1NUTA 3WADA 1GKIA 3I9V6 5H3LA 1O7LA 1S3IA 2ZC2A 1YQWA 4UD2A 1OC4A 5BT9A 1H0RA 2NOJB 1GARA 4QGFA 5A7FA 3UXYA 2EARA 1RFGE 4FFRA 3ADKA 1L4NA 4RZQA 5LYYA 1G0NA 1S7OA 1HLGA 2XWPA 3HDVA 4CKWA 4FT8A 3AV0B 4MMYB 2Y0SN 1EE1A 4OKIA 2H4WA 3CA8A 4LXGA 4UTOA 1UBRS 3AEQA 4HBGA 4G2TA 4DCMA 1YQAA 5EGNA 3U2RA 1H42A 2X0EA 2DOFA 1UMCA 2D74A 3HXTA 4AYXA 2IXAA 3A01A 3IVAA 3MOIA 2VQ6A 5DCMB 2VEOA 2RHRA 2Q3FA 1MOPA 3MWLA 5JH7B 2G1JA 4U1RA 3L4SO 1B7GO 1LPOA 1NMEA 4HGNA 1IL0A 1TCAA 4RGYA 4BMZA 4XI9A 1V3UA 1F3OA 1RXCA 1TPZA 2DLCX 3A05A 1DKMA 3MZHA 4M7RA 3DOCA 4Q4LA 4AK9A 2A92A 3Q7RA 2MD0A 5E9WA 4G84A 5AVSA 2X48A 3VHRA 1UAAA 3HPHA 2VCHA 3ZDXB 5CA1B 1ZUHA 3A2KA 3LSRA 3R23A 4YIIA 1AMUA 1QAMA 2NYXA 4YV1A 2M0CA 2GCNA 4K81B 2GARA 4EG4A 1UHMA 3KKQA 3SIRA 3OHMA 5H4HA 3ZV3A 1YDEA 1OVMA 2VPPA 2Q5OA 1KI1A 3BWGA 4LTDA 4CTJA 1GNQA 4Y1RB 1U7OA 3OLYA 2NZUG 2L01A 5L7TA 5CLQA 2CZCA 5HNFA 3UAXA 4EGYA 4AROA 3CLRD 2I2WA 1II8A 2D7JA 2M0MA 1A97A 2C2OA 2R0QC 3D6UA 3EC2A 2HVQA 5E6RB 3ZE0B 4HYTA 3CZPA 3ZN2A 5F04A 2G07A 4JUBA 2GYUA 3GQBB 3ZXYA 1SA0A 1OCCH 3BFJA 4A5NA 4GSKA 4EW6A 2MSNA 2BOVA 2JVJA 1H2EA 3UHAA 4XSVA 2Z04A 1Z8HA 4MLZA 4GVXA 3JD4A 5BNZA 5AVRA 4QFBA 5ALHA 3CYFA 4LS3A 5KYGA 2C7OA 5BURA 5DI9A 3B6IA 3TZLA 1VKZA 1E9AA 2GN1A 3ISPA 4QYTA 2GD0A 3ZQUA 2W90A 2LP4Y 4BEBA 2NUBA 3TRJA 1JQDA 2JFXA 4XMYA 2FSHA 3ZGNA 2AS5F 1SCIA 4HTAA 4QKQA 1X94A 2WV1A 5JSZB 1VE6A 2WG2A 5F12A 1R0RE 1TQDA 3NWOA 5BQ3A 2D2FA 2DBZA 5AM2A 2BKVA 5BV8A 1N9GB 4N47A 4AX8A 3EQLF 2EWVA 3M1AA 2WHRA 4Y4RA 4MR9B 5L3SA 1YQQA 1W35A 1P17A 3MAJA 3KPYA 3AJAA 2QP3A 1H2ZA 4R1HA 3VNRA 1Q0UA 4BV8A 2I6TA 2XE4A 3OPNA 3CVWA 4B1RA 3FROA 1TJ4A 2OXRA 4XEHA 4UM9D 3H8WA 1VP9A 1ZPDA 2L9VA 1N8NA 3SBXA 2DBBA 5J5AA 3SS9X 2GFIA 2I2DA 3ZNNA 4DMRA 2W1OA 3KC2A 3HNPA 4N0QA 3MINB 2AZMA 2YZMA 5B1IA 2A5FA 4WTOA 3ZDEA 4Z2AA 3QPBA 3QNUA 4QFMA 2Y9ZA 3PQCA 1EXNA 2QTNA 5AIPA 3QLEA 4RMGA 3EFHA 3CZ9A 1N4DA 1ZAOA 5LP6F 1C81A 1M7GA 2E7XA 2RC6A 3D4OA 3C4QA 1Z38A 1IATA 2CGEA 1E1DA 4BQPA 4LXQA 3WAJA 5GWXA 3O7MA 1JA0A 1NVEA 1DSSG 1HMPA 2OSBA 1NQ5A 2GSWA 1SHKA 2VHWA 1CJVC 2QE7A 2FQ4A 2ZSKA 1SC4A 2JPBA 3MUOA 4TTTS 1GY8A 4M7WA 3JQBA 3NC0C 4HV4A 4LSZA 4CHUA 1JYFA 4HH1A 4RF5A 3VZCA 5DCMA 3PC2A 4XRMA 3IPLA 3CO7C 1BGVA 2H65A 5JH7A 5EINA 5DTEA 2JLAA 4KXFB 2RAEA 2G1UA 1E60A 2GEKA 2X4HA 1DNPA 4JX6A 1XZDA 5FJIA 1WQ4A 4Q34A 3QOYA 4AO6A 1KQPA 3ISJA 4DNXA 1H2FA 1IZ1A 1YK1A 4H0FA 2CMHA 4HATA 1R74A 4PHFA 1SK8A 3LA8A 3V1KA 1WNFA 1C3LA 3LWDA 3U0BA 2NO9A 3PJEA 1Z3IX 1T1RA 3FNEA 4LOJA 2K7ZA 3KJZA 1TC2A 3I9MA 1VBFA 4TT8A 4XGIA 1H9GA 3A1TA 4MW4A 1U7XA 4XD7A 3RIHA 1P74A 3AU8A 3NHKA 6CHYA 5ALIA 1OTXA 1X7GA 1PW7A 1ZA2A 1ZREA 3K1PA 1SUEA 3NGMA 621PA 3CXUA 3SVZA 4E30A 1NUQA 1XRPA 1X2BA 4JJ4A 3ZJVA 3RKRA 5K6TA 3G1UA 3AF4A 4YUWA 4RIFA 5JUWA 3NOVA 3S99A 1ODCA 1UBCA 4E31A 2VYNA 4O2BB 2O5CA 1C8LA 5FRNA 4B6GA 4BVLA 3R9WA 3EJWA 2JGKA 4FEYA 3S44A 1PDNC 2DFFA 4NAUA 3A4IA 3W8FA 3UPUA 2JZOA 1QANA 1CR6A 1UZUA 2CXHA 2QQAA 2Y69H 2CYYA 3NEJA 2FPGB 2ORIA 4KDRA 5I9IA 4URYR 2G70A 1Z08A 1TM1E 3RC2A 4FT4A 1YR8A 4GLLA 1JHQA 4KFTA 1JR3D 3D8HA 2FEOA 3TVTA 3E03A 1IEQA 3IP6A 4HDUA 3FBIB 3N3AC 3U13A 4LRYA 3SEFA 1MV5A 3CNEA 4U00A 1QC5A 4OLFA 1T25A 4R16A 5D87A 4I8IA 1JIKA 1G66A 5IT9Z 2PYIA 4M88A 1XTSA 4MPRA 5HK8A 1GTVA 3KYLA 2BBYA 4PZJA 1H9AA 3Q5FA 3EIOA 4KMMA 5TE9A 3SOPA 2XSZA 5FNVF 5IXJA 3E9RA 3IJ5A 1N9GA 5AI4A 4DB4A 5FB3A 4RABA 3CVJA 3KRTA 1JLLB 2R1VB 4ZANA 3EGIA 1WMDA 5G4KA 1KH1A 4R40A 2ZVQX 4CDGA 4B6FA 3C87A 3CC4I 3WOVA 5J43A 2B98A 3IXQA 4XKVA 5H16A 5ILGA 4OCZA 5KVAA 3TZCA 1DX4A 5G0SA 1Z2EA 4RESA 4YECA 3LK6A 1ZCAA 3QTTA 5JAIA 3B5EA 3G0HA 3UFXB 2MFZA 3HL4A 2G7UA 4A69C 4IJQA 3D2CA 5M3FJ 3RS5A 3MINA 4WFJA 2BKLA 1USWA 4BO1A 4HWOA 3DWGA 2KIFA 5ALYA 2BP7A 5KMGA 4GI3A 4HS9A 2GYYA 2BFEB 4RLSA 3JQPA 4D43A 4V0KA 2CE7A 4B17A 2PSDA 2VN2A 1FTSA 1HC7A 2BFDB 1ICIA 2JGIA 4W97A 4E2FA 3RODA 1U98A 3HJAA 2VDUE 1F1BA 1OLSB 1QE0A 1NSFA 1FT9A 1ZYRF 2BH2A 2UXNA 1XTIA 1ZGBA 3FOAA 3EUEA 3L92A 5JBNA 3L7MA 2ZSJA 2QLBA 5A9RA 2H1VA 2QZ9A 2GAAA 2QYHA 4GEGA 2I3ZA 1PLJA 5H3HA 3JTGA 3PKIA 4HP8A 3IAXA 1YB6A 1Z4QA 3EIEA 2C5GA 4QNRA 3L1JA 1F7UA 1KOJA 1D9XA 2OV1A 5LCXA 4NDLA 1MDFA 3M9WA 4GYIA 2XRMA 5B1SA 1PZXA 4C2BA 4MA5A 4YJDA 4REOA 1RZRA 4ND3A 4OO3A 5I51A 1POXA 2XMZA 1BX0A 3C3EA 3C5HA 2OM6A 2VHYA 4X24A 1IYZA 1SBNE 2IS2A 2O3SA 2ESNA 2HOEA 3TDNA 4LZZA 3FZNA 4Q3CA 2GN9A 1Y3BE 3GA7A 3UWDA 3FMIA 5TGDA 4DXHA 1JAZA 4IJVA 4OJKA 3V00A 3G9UA 3ZX4A 2PL3A 5K5RA 3QE0A 4PC7A 4F5EA 1Z0JA 4UPEA 4BY9E 2XITA 3TFWA 2JJ7A 4D0GA 4NZYA 5CM2Z 4BHPA 3RWBA 4O2BA 1IVSA 2VOJA 3DVAA 4AAYA 2QKLB 2WU4A 2AZ4A 3D5RC 2MOKA 4Y0VA 2V9CA 1L5NA 3FRJA 1F8FA 5WRFA 4G0OA 4PLWA 4O4LB 2VQSA 1TVCA 2VZ0A 2PX6A 3N8KA 4RVDA 2INGX 5IANA 3VOSA 2QD5A 4ESHA 5IWCA 4MHTA 3PL1A 1MIJA 3DW1X 4MXDA 3FMFA 3C5WP 1EP9A 1ZNWA 2E6UX 4AS3A 1G8PA 3ZMSA 2H06A 4ASUD 3QOWA 1WPRA 1S01A 1R6RA 3UANA 4HNGA 3CLHA 3RC7A 3KYDB 1Z4KA 2EP5A 1N6IA 2HWYA 4WLFA 2FZGA 4HEJA 4CMEC 4IDCA 2RMKA 5KBYA 3LBIA 3DTIA 5CEEA 1P19A 4ZOLB 2JHAA 2K85A 2FGJA 2OC6A 1G5QA 2X0KA 5J2TF 3SP1A 4JROA 4Z0TA 4XSXF 1T1JA 3ORRA 1P9RA 5CW2A 2NPFA 2O8DB 6AT1A 1PFUA 1XEXB 1NUAA 4S1TA 1RKBA 4HSRA 4QYSA 4AQDA 3PNLA 2ZJ3A 2GUWA 4XSHA 5JLJA 3ZE7A 4ROSA 1N2GA 4UHFA 1DE0A 4F7DA 2GVNA 2K02A 2BY4A 4DM4A 2ZP1A 3LVBA 3OZTA 3HXOA 2XNDD 4O4JF 2H6BA 2RV8A 3GO5A 4Z3DA 3U7RA 4KP7A 1P1CA 4UNPA 3HJTA 2L9SA 3ACBA 1YSCA 1SBIA 3C8DA 2UYYA 2WIGA 4DZTA 3F97A 4EKDA 3HYNA 1LDNA 1CUCA 1EJBA 5A3VA 3MLBA 4RIEA 2ZM5A 1UWVA 2Y99A 4U7HA 3CMEI 1I4OA 3KZYA 3DXZA 3O91A 2ZUTA 3TG2A 3KXKA 4CMGA 5LUBA 1YOVB 1YZFA 2NUPB 4H7DA 2IOHA 4G65A 1OPCA 3U3RA 2GK4A 1LBSA 2STTA 1P0PA 2ALJA 4M72A 4UMEA 2YCLA 3SNKA 2HI3A 2YV5A 4N5MA 3GPDG 2WWYA 4N7RA 3A1DA 2AIRA 1N2CE 3H84A 4HNAA 2UUPA 2BFEA 1Y39A 2ZRHA 1KFCB 1CQWA 1BC5A 2EFDB 4G4JA 3TZBA 1U2DC 5JXGA 2XX3A 1CEEA 2GQ0A 1VJDA 4E6EA 4ESVA 4YGXB 1URPA 2RGYA 1FVHA 2IODA 4C76A 2F5DA 2DFKB 4D9KA 1T3LA 4B3RB 4Q9LA 1SXHA 5HDGA 3NKVA 1H6DA 1IN7A 5FA6A 4NHEA 4W1UA 1U7DA 2DT5A 2QA4I 4XLTA 2JLQA 4ZTJA 2Q1WA 3TLZA 3FTDA 2WTXA 4Z9AA 2C58A 4IXTA 4LF8B 1HQCA 5DDGA 1ZQ3P 3QWHA 4MNTA 4MVJA 4IJMA 1AUOA 5CT5A 3ICOA 4BECA 4Y2XA 5CKTA 4NF2A 3NCHA 2B2NA 1K2VN 2VXZA 1G98A 2CV0A 2XKPA 1K3FA 2CVHA 1U3CA 5HDNA 2EZIA 3RZOJ 4K6KA 4ER6A 3OS2A 1MD0A 1E1QA 3COPA 1WUKS 1KS2A 2HJSA 3K0AB 3LQRA 4CTNA 5C8YB 5EESA 1NJGA 2PO5A 1KJJA 4EHKA 3V7FA 2Y67A 2ZYGA 4IGAA 4TROA 4PLPA 3FB1A 3F74A 4WGGA 1X7XA 4QZVA 3VISA 4U7BA 3M6FA 2VP5A 2OOSA 3AB8A 1KA9H 3R0IA 5ILUA 1C7QA 1YHYA 1BHQ1 4MTLA 2XVYA 2P6UA 4XUDA 1M54A 2R92J 4FYMA 2PLNA 3I83A 5CIWA 1OF1A 3H1TA 1OKKA 3CVXA 3DM5A 2PWAA 1NSYA 1LS6A 3IP7A 2LKDA 2P4QA 1ODKA 4AO7A 4ZEWA 3WGVA 3DFIA 4BGEA 1VQPI 5LZ2A 4JVMA 1RHRA 4B33A 2HBQA 4Z1MA 2OC4A 3G8YA 2Y0EA 4IIDA 5EG0B 1SUSA 4BKXA 5DW0A 3B1VA 1GUUA 1KJNA 1ZOOA 1PJQA 1YZLA 1N33B 1U5TC 4CUKA 3OCXA 5ICSA 4CICA 3T7EA 5D3MB 3GLVA 2H6CA 1Y3HA 4TV8F 4TLEA 2LE0A 4KVGA 5FFXA 1AGYA 4ARCA 2JW5A 5C35A 4QOHA 1MAHA 3OOWA 5LMCA 2O8DA 2F1HA 3C6MA 3C6YA 3GA5A 4WLVA 1DGWY 2WPDD 3T61A 5BOVA 2FVYA 4KXXA 4NMWA 4YRIA 2OXIA 2PSFA 1C9KA 4YMIA 2IAIA 2X22A 3AUYA 5DJ5A 2HVRA 2AMFA 3F9KA 4R0VA 1G1AA 4KPUB 4P8RA 1RABA 1XFDA 5CYPA 1D3YA 1JKFA 4N76A 5FROA 1JFRA 1NVWQ 3OE7D 4TS3A 4GKAA 2Z8XA 2QSYA 4ZI3A 1H85A 5JNVA 3EDMA 3M6WA 2CCKA 4GRAA 1GPMA 1OX6A 1SEUA 1PW5A 3WX0A 1ZMRA 3ZV5A 4IDDA 2XRZA 1O4XA 4FFBA 4ZDWA 5EQFA 4OQMA 1E18A 5M5WJ 1VPDA 3DE3X 3RJZA 2NUPA 2Q2NA 2M9HA 2CB0A 3V4LA 2VAVA 5IXYA 4M98A 1JFVA 2AI3A 1CPYA 2VJLA 4Z1OA 4J0JA 3X1YA 5DD8A 2XMQA 1SZCA 4JI0B 1M75A 3P9KA 2AW3A 2NNWB 2FPWA 1UM9B 2ERCA 3CF6R 2QF7A 3FDIA 4EBBA 2IXFA 2V6JA 5T64A 1GQSA 2DFEA 2L0KA 1TQ8A 1EXVA 1QPZA 3HXPA 3ZWCA 2VDRB 1Y1LA 1K6IA 2QQGA 1QZXA 4OA8A 3NHYA 3BOQA 3W8RA 2C5HA 2V3VA 3OICA 1EFVA 4FR5A 2BHZA 3NUQA 5DOVA 2G1AA 5HIKA 4P53A 3EZFA 3KP3A 4GVLA 3SM9A 4IHJA 3LPLA 3GMSA 1JIQA 2I3AA 5JC1A 1DLJA 3RUCA 3F3YA 4LQLA 5BUCA 1E3HA 1KJIA 1ZNQO 2FHPA 5LBQA 2PTGA 4O2RA 1PQYA 1W25A 4DV7B 3K0AA 2ADMA 3IAS2 2IDKA 1J4AA 2IGTA 4A91A 1XAHA 4EEXA 2EB7A 5LA6F 4V03A 2QSHX 1JKXA 3I28A 3OLQA 2GM9A 4DIKA 1JI8A 2GEDA 3GNSA 4QSHA 4XVRA 5DK6A 3C43A 3EOBI 2ZVPX 5D8LB 1THMA 2PYZA 3U7GA 4D25A 4FJ1A 5KIAA 1X70A 2C57A 3P2IA 1P5JA 1IBKB 3CWCA 4BNJA 3IC5A 3I5UA 1GG9A 1ZVJA 2EOAA 5ARBA 2EFNA 3L77A 4QUAA 3GL9A 1VFCA 4K1XA 1TTTA 2FG5A 2DFDA 3EGOA 3LWNA 1RETA 1TKBA 5T67A 4FEEA 4Q02A 2EFHB 5ENVA 4XTRA 3DYBA 2TMYA 4BNXA 2BHTA 3EA0A 3QVUA 4QHYA 4RU1A 1F9AA 1ZI6A 5MHTA 2VJJA 1VHDA 1DHTA 4G6TB 2FMTA 3A9UA 3OM8A 3AINA 5F0HA 4MGRA 3FLMA 2BWJA 1JQ3A 3RV3A 4MV7A 3EXEB 4E7KA 1L8AA 5D3MA 1WGXA 4XASA 4FHDA 4N54A 3UUFA 2EFEB 4R7GA 1S6LA 5IM4F 4OHRA 2V26A 4M3BA 4ETSA 2Z3ZA 4K9QA 5DN6A 5F0CA 4QL3A 1FUIA 3ADPA 1G9XA 1XL1A 4RMHA 2CMKA 3TM5A 4Y6GB 4FQGA 1EG2A 1L5FA 5HS9A 1C7JA 2C95A 1PFVA 2E0IA 2X8AA 3S1QJ 3FYSA 3FK6A 4FILA 2NAFA 5JCJD 2BI7A 3STHA 5FTKA 1EUDA 4BCDA 3QSGA 1TRHA 2NT3A 2EQRA 3O38A 4KPUA 3B9PA 5KOIA 5K51A 5A02A 5DFAA 1CY4A 1Z35A 2ZI7A 3AUFA 2HPAA 3U3ZA 4H3HB 2QXUA 1PR1A 4WLOA 4LY6A 1G2IA 5CA0B 1J2RA 3U3MA 4KQMA 1X1PA 2FPOA 3G89A 3M34A 5TPZD 4MINA 1IH8A 2GZ3A 3ELYA 3DDUA 4V19K 2Z2JA 1KDYA 5JCXA 1VSQA 1B1AA 3L1KA 3F78A 1NW9B 4KLZA 3WBBA 4H35A 2F67A 4J29A 3TOSA 4OQNA 1A5BB 4FYVA 3OR2C 5H9VA 2LYCA 1UM9A 1W44A 1R4MB 1TWAJ 3L8HA 4LI3X 4DV6B 1OREA 1F2TB 3O8RA 1MGPA 1D5VA 4CYDA 1H94A 2XMSA 4Q5IA 1J1IA 3VR3A 5JNRA 2O8EA 1NW5A 2BFFA 4TPKA 5BNTA 2C97A 4XL9A 3LNTA 4R3NA 4O6JA 1Z3YA 3WP0A 3USZA 5DTDA 3LO5A 2YIVX 1X8LA 2EZ8A 4Q1CA 2ZBRA 2C9YA 4YV2A 1KU7A 3FZEA 3QA3E 2RDPA 4DG8A 2LPMA 1PDWA 5BOXA 3D02A 5FTNA 2ZWOA 2OZKA 4PTYA 4LX0A 3BXGA 1FRZA 1XEWY 2VPYA 1CEYA 3SG0A 2YSRA 1W46A 2V3WA 5GONB 2NVUB 4UTRA 2ELHA 4PHHA 1Q7GA 2M98A 2CDRA 1Z0IA 5DM2A 1S96A 1SK9A 3VHXA 4C06A 1Y4AE 5CM8B 3ZVNA 5F7XA 4ALJA 2GD2A 2IZ0A 1Z6TA 3TNJA 3CVOA 1ZD1A 1BS2A 1AUXA 1J8VA 4WLEA 4B85A 3SK0A 1TC1A 1WM1A 3P9NA 5D6FA 1QR6A 3BTLA 2CSOA 5LYJB 4QHTA 4ZCRA 1ETXA 5I4CA 3OZEA 1JDSA 3C3AA 2YHSA 5JVDB 1KAQA 4KKXB 1HT0A 2FSUA 4JT2A 3T3EA 1XZFA 3VBCA 1RXSA 5D3KA 3FOEC 3PX7A 1FSHA 3RPEA 5JD5A 3GNTA 4RB3C 3OOUA 1ZRNA 1Q12A 4FCWA 4TT3A 1JSRA 2YFKA 3MCZA 4O2AA 4KVZA 5CNMA 5IBQA 3HB0A 2NIPA 4LHWA 3H2SA 3IKVA 3HSFA 1L4KA 2L9NA 1GVJA 1DV2A 3TD2A 3WDLA 4GXTA 5J5CA 4JIGA 1JXMA 4U39A 3EXEA 3EBOA 1FVOA 3L18A 4ON9A 3UMCA 3JY6A 2ZJOA 4R05A 1DKRA 3FWHA 4OM7A 5ALMA 1OHHD 4B3JA 4ARIA 2C4WA 3V8NA 3ZW7A 2VZ9A 3ZPXA 2CXRA 4C0KA 4YH1A 5C5EA 1V5GA 4KGXA 4Z7OB 1I0LA 3G79A 5JEEA 4RETA 3LPNA 2GN8A 3M81A 3KD2A 2J0SA 2NO1A 5A5DA 4RA9B 1Y6ZA 3VR6H 2EGGA 3I4PA 1H0MA 2HFKA 3IOEA 1F1ZA 1NOJA 3GFPA 4QUEA 1XCMA 4G0XA 4RK1A 2QTWB 1V5WA 5D3ZA 2O6GE 4IS2A 2AFHE 3RAPR 3H16A 3EZNA 4RAFA 1PL6A 2ZJ4A 4KMSA 4C7OB 4V2FA 1BU5A 1OXVA 3F7NA 1XR3A 4WLUA 1CEXA 1IB0A 2EX0A 2PUEA 2JZCA 2WG1A 3JALB 5CA0A 1M74A 3DVQX 1YJQA 1U8TA 3QUBA 2DA2A 1H2HA 3RHFA 1HDEA 1IN1A 5EOVA 3EWAA 4ZJPA 4E5NA 3ETEA 3ZZ1A 3KEYA 3K2EA 3WYBA 2HYGD 4GT1A 1O97C 4FHZA 3CX6A 1E9BA 5BQ5A 3ZLUA 4O4IA 4OBEA 5LQKA 4G7OF 1D2GA 1Y81A 5DXFA 5BSVA 3SXPA 5FO0A 2UYHA 4NBKA 3P2JA 1UDXA 3I42A 2VBYA 3WFIA 2RDMA 3MJSA 4LDNA 4C78A 2E71A 1R4MA 3H97A 4BZPA 1LNZA 2DUUA 4JJ7A 5F52A 4US2R 3HG9A 1G5IA 4R3WA 5ALKA 5AJWA 1ZH2A 1ZSNA 3DKKA 3DJFA 2DG2A 2DA1A 5BSRA 2IYZA 3T1HB 3WY9A 3Q72A 4LY0A 2XB6A 4PIMA 2RK4A 3TNYA 4F06A 1FXSA 1Y5IA 1Y82A 4G7HF 1ORWA 3H9UA 1PHRA 1UXHA 3SJBA 3LCUA 4RTKA 1FS6A 5HS4A 3NT5A 4BEHB 4ZDLA 4HBZA 4M99A 4NZMA 4BZWA 3P2KA 5D51S 1XWIA 1JE8A 2XMPA 5GONA 2M7BA 2QAGC 2O19A 1BW5A 1SCAA 3CSSA 5DHAA 2PJUA 1YAHA 4AUKA 1WPQA 5HVQC 3D4BA 3D43A 3UY4A 3TQCA 4DZJA 4XLNF 3UNGC 2E3JA 1GL3A 1LJ8A 1SZDA 3LSPA 3EE6A 3QHAA 1XTUA 1BD3A 2P91A 5INTA 1P3JA 2RGUA 3JWPA 5K20A 1RLIA 3QEOA 2HPIA 3OSFA 5FLMJ 5LYJA 2AZDA 3GUZA 5F7OA 4Q7QA 2V8BA 3AM4A 4FGZA 4X00A 1C0LA 4EHAA 1IZ7A 3S2WA 3JR9A 2Q3LA 4G8BA 4IVRA 1FNNA 1XTAA 1VOTA 1MNEA 3FH0A 3I6QA 4PX3A 5L40A 1KAMA 2C42A 2E4UA 2I8LA 1SCBA 5LOVB 1PL7A 1B73A 2DCMA 1G2PA 5G0VA 3ZY4A 3K0SA 5JVTA 2OBFA 2J6CA 1MJHA 3HOSA 1S3FA 4RKQA 2O7QA 1G3QA 5B64A 4E7OA 3GFRA 1EXDA 3GVXA 4GU5A 2ZGVA 3MJEA 3THYA 3TEJA 3S81A 1DKLA 2EIXA 4BAZA 1D5WA 4MX8A 3AY0A 2FN7A 1IZ8A 4JUAA 4BMPB 5H59A 2H4XA 1JNYA 4H1HA 4DUZB 4BNLA 4YJKA 5CJPA 1N1DA 1KMCA 1EBBA 1Q11A 1GU0A 3S7ZA 2QVCA 4WBSA 2DUJA 5ALQA 1A1VA 4MJLA 5SY6A 1ISRA 2REQA 3MLEA 1FIPA 1CUUA 4WQMA 1FP4A 2Z2XA 3RKXA 2C5EA 2QT0A 1EU1A 3HB1A 3TP3A 1N9ZA 3FMVA 4FMDF 1GV1A 3NBXX 4LRQA 3N5CA 4C7OA 1QTIA 2ZPTX 4A16A 3DDCA 2JUGA 2YX1A 1YLFA 2SCUB 1W29A 3VB2A 4B43A 4JVLA 4ZO6A 5B2ZA 3BGOS 1HBJA 1EEHA 4DS3A 3DBHA 4WH0A 1PSZA 3EGXA 2RGVA 4UREA 1XPOA 4MKHA 3V7CA 2PA0A 1CUHA 5EDNA 1QYCA 1GZHB 5FORA 4K9LA 5H3CA 5L6MB 1QCCA 1DXHA 2G7ZA 5JLWA 4JBGA 4OMYA 2CK3D 4HX9A 2VOEA 3TOAA 5AKEA 4K05A 3VZPA 2WZQA 3MAGA 3GBPA 1MEOA 1BXZA 4MWTA 1P45A 2YV2A 1P44A 3A58B 4O25A 5LHHA 3OSUA 3QLUA 4RL4A 1MH9A 4A12A 2JFZA 3JWJA 3N2EA 1XMOB 4R5MA 4JU9A 3LL4A 5DLYA 1YK0A 1DVRA 5EJFA 1IVYA 3M49A 2COEA 4CKWB 4RDHA 1MJBA 3B5IA 2JS7A 4V39A 3OIDA 1E9RA 4LBWA 1BGWA 3WGYA 2GBLA 2VKHA 1E2NA 5C31A 3AEQB 4EKIA 4HH4A 5FKNA 4FKZA 1U0HC 1O1YA 4ECAA 3IJPA 5M2QA 2JIQA 4H16A 5J4HA 2M4GA 4YWJA 4LYEA 3A01B 2IY8A 1IAQA 1TWGJ 3Q4GA 4IIJF 1RRPA 1LRLA 1VLZA 4YMTA 4NRDA 1OY1A 2I4TA 3CX3A 3VU8A 3AC0A 3D8SA 4DSOA 3M70A 1GA6A 1K0UA 1AJEA 4NBSA 3IEPA 3DMGA 2DA4A 2IGNA 3TRHA 4GL2A 3WGZA 1T2DA 1K08A 1T8TA 2B8TA 3IV5A 4OLJA 2DMNA 4P7KA 3LYLA 1V5FA 1NQVA 3LAWA 4KWEA 2A33A 2AWOA 4W1QA 1CHDA 3EXAA 1UEJA 4ETWA 3GCDA 5D4SA 2EW8A 1WCIA 3GMDA 4CMAA 4X6LA 1RVDA 5AVZA 1O9HA 3BG6A 3IYLW 2JLBA 1BQEA 3HV2A 2WOJA 5JI3E 1U94A 5EJEA 2A3NA 2XVAA 2XC7A 1E5DA 1JECA 2ZJFA 3RROA 4TMYA 1OMOA 4TXHA 3FDXA 3CGWA 3ZXXA 9ANTA 2I6QA 2G08A 1KZ1A 2R00C 2HQAA 1O03A 3IAFA 4LZNA 3S8PA 2WNIA 1FEXA 3L4BA 2FEMA 1FU4A 3RK4A 3NQOA 2F4VB 1II8B 4ZYDA 2FZKA 1XWFA 4P96A 4BFVA 4HAWA 4INPA 1QO7A 4IUDS 3UYKA 5F64A 1R8XA 2J9FB 3AL0B 1CUIA 4EYSA 1SA0B 3A4TA 4MI3A 3H1FA 3IBFA 1XUOA 2X41A 1JFLA 2IZZA 4C89A 2EV5A 3DCYA 4R1PA 6NULA 4FISA 4GOXA 2H85A 1JSZA 2XYQA 2O59A 2R4UA 1P3Y1 1YRHA 3QVTA 3H1GA 1QA6A 4NABA 3LLUA 2MU1A 1YDFA 5DEQA 4GPBA 2C8JA 2FSFA 4J1SA 4HAUA 1GV0A 1M34A 1L1EA 3BULA 4H0CA 4CCYA 3I4NJ 1Q95A 4B6QA 4BWVA 2IV3A 1GGJA 2PGIA 2V6MA 2MHCA 3QTLA 1BMFD 1CXZA 4MULA 3I5XA 1EDDA 4KYVA 3WXMA 1OGIA 1CUSA 1PZNA 1P0CA 3TTTA 3WA6A 1J5EB 4HGZA 2PN1A 2OYCA 1Y1VJ 1HE8B 3KQYA 2Q1XA 4EY6A 5DNUA 4Y98A 2SCUA 4DJJA 4NKRA 4F2WA 3BIXA 3JV7A 2JAOA 3IAHA 1YT5A 1I32A 2FMHA 4JP2A 5K3SA 1XRQA 3D1JA 3ESWB 2VLAA 1WDLA 3PX2A 1NMZA 4L4RA 4FTHA 5L3SB 2DPYA 4L6AA 4A0SA 1M2EA 1QZTA 2WVGA 1AXRA 1UM8A 3GELA 3WGHA 4HVAA 1ENYA 4QOGA 1DELA 4B84A 4J3JA 1HA8A 2PD3A 3PPYA 3ZGKA 3LIPA 4RGSA 3FRHA 5JSUA 4KX5A 3DDNA 1QRAA 2ZYWX 1JPUA 5F33A 4IIGA 2ORVA 2Z09A 1IV8A 4QQNA 3PXDA 1XVTA 1HXDA 3E7XA 4JUFA 1TOAA 2RGDA 3AWIA 3F1KA 1CYDA 2X9GA 1AMOA 3FUCA 3GR6A 2DT6A 1PJCA 3WMXA 2QYOA 3V8VA 3FHCB 2JHPA 3IQWA 1T34A 3H5LA 2BUBA 2JJ1A 4E1VA 3GTGJ 2PWPA 1W2GA 2TS1A 3VYRB 3SYRA 1U0EA 3OTWA 1IOWA 5EG5A 1B4DA 4Z0NA 4RTMA 2R7OA 2O2ZA 1T38A 1JIVA 3E5MA 2R2GA 3E0JB 3WLIA 4HEA2 3SIPA 4CT0A 1WFXA 2R66A 2D5AA 1Z22A 2LGJA 1DEXA 2IP4A 3ENKA 4URXR 3Q2OA 2VPLA 2OLJA 2VJYA 1UUFA 4Q4ZF 4TRMA 4KZPA 3BFKA 2ZRMA 2DEUA 4KE7A 4DV0B 3P4UA 1KI6B 1FLIA 4UTPA 2IA5A 3G82C 3VKFA 4ER0A 3FDZA 3T5CA 4YUXA 4LLLA 1QPBA 2Z4SA 1ULSA 4XIYA 3BD6A 1LI4A 3Q2KA 5JAZA 2NV6A 3HJBA 3THRA 2AMJA 3B3GA 1KNXA 4IV0A 3DLHA 4R01A 2VOPA 4U6SA 2O3RA 3A4NA 3W79A 2PGNA 1T3SA 1YRYE 4U9IS 3IVRA 3HXKA 2D5BA 3ZHTA 1XNJA 1NVKA 5ALGA 1Z0XA 4X0GA 4B3XA 1E5QA 1HSZA 4LXTA 821PA 2R8PA 3KOOA 1ML4A 2EBUA 1C3VA 1KAGA 2P6NA 4KO8A 5IW8A 4I9UA 2ZUBA 3TQHA 1MO6A 3KKPA 2VZLA 4CLDA 2OO7A 4A8HA 2HU7A 2J9FA 1X3LA 2JVHA 2VDQB 3CR8A 1NTRA 3P27A 3RHTA 3M4YA 2IOYA 4CETA 4MQ9F 1KIFA 3OCYA 5IT0A 2PPVA 2WU8A 3RRXA 2W8BB 4RZUA 1EFTA 3KUUA 3WJ2A 1J8MF 4YRLA 1Q77A 3L7LA 1QC5B 1VKRA 1GQFA 3GTMJ 3KTAA 1V8ZA 2JLRA 1DOZA 2WRZA 2Z2IA 1G2OA 1IHDA 2FNPA 3OJWA 4BKPA 1XVAA 1MBFA 4YRMA 8AT1A 4Y2TA 2O8BA 5FJ8J 4N5NA 2WVHA 1BHJA 4RZHA 2P3QA 5MN4A 4FEGA 4YUYA 4YAEA 2WU0A 4BQIA 4LK0F 1DRJA 3EZGA 2EILH 1PUFA 4MGZR 2GDZA 3FW1A 1OYOA 4Y2YA 1SKYE 1Z7YA 4PQRA 1G8AA 1W0KD 4BFWA 2XT6A 3OL4A 2OV6A 1JPVA 1QH0A 1FFSA 2A7XA 3WIDA 5G4KB 2GBIA 5ILSA 3INTA 4D0SA 4AMYA 1L7DA 2JHFA 2WPNA 3I58A 3TAUA 4TKMA 3NXKA 2HSDA 4D8TA 1Z3XA 2CHQA 1T9ZA 3OQOA 4GYWA 2OY0A 3HJEA 1EF4A 2DVMA 3A3KA 1TYZA 2CJFA 4LYYA 3UCEA 1VHTA 3I6IA 1QE3A 3OJ0A 1VQMI 5JW6A 1GILA 3D5LA 4KO3S 4MNUA 2ESHA 2FU4A 5C1IA 3BORA 4YQYA 2BP7B 3T3OA 3U4MA 4LYFA 5KMGB 2NZ8A 2C8LA 3FIUA 4WXHA 1DG3A 5IEJA 5A2QA 2J48A 5KU1A 4A3KJ 3AJEA 5GIPE 2F90A 1W36D 3ZS8A 4E15A 5I3ZA 4GXNA 4PBSA 1V47A 1WXEA 3H65A 4PC1A 4HZIA 2DPUA 1AA9A 3NGXA 5BT8A 4FFPA 2W4MA 4A3CJ 2CLKB 2O20A 3F23A 5CG1A 3BGIA 5LGNA 1M2NA 5J59A 5KWVA 3W5UA 2P1DA 1M2VA 2MD5A 4PSAA 2LTPA 3FGOA 4YEJA 3SZTA 1EDZA 5J9FA 2IKQA 5J58A 3SR4A 5ALRA 4HDAA 2HQRA 1JLHA 5T3YA 4ARAA 2L7KA 4Q3NA 3OQBA 3JRAA 4HGYA 3KPWA 2CXNA 4D8VA 5EP4A 5EWMA 1KI6A 3FXUA 3AUKA 3FOBA 1XYGA 3O3MB 2OP1A 4MVXA 1RI2A 4P38A 2ZPAA 4ZICA 4E7IA 4EJ2A 3LTEA 3QRWA 3REGA 3JQQA 5E8RA 2GWHA 1GN9A 3WQQA 1G3SA 2NZXA 1BN5A 1IM5A 2HUPA 5DUIA 3HYRA 4D4IA 1YG2A 2BM9A 4HOBA 3HA7A 4R8VA 2ODQA 2BY2A 3UH1A 5TV2A 3WK4A 2GHRA 2A1TS 1WLSA 2QRGA 1NBIA 1ZQ1A 3FWYA 4Y2SA 1TYEB 2CYCA 5BR4A 3ZU5A 3HOWJ 3GJRA 4GD3Q 2XLBA 5EE5B 4M9XA 1YQ9A 4RCVA 2W58A 4QEKA 3VI3B 5CB4F 4AKEA 5GINE 3NP9A 4NCBA 4X8OA 3K8OE 1W96A 3DVAB 1QG4A 2YRXA 1ZD4A 3OO1A 2A1IA 3VJRA 1QYVA 1YQEA 1EDEA 1NIPA 1KS9A 1ZN2A 4X7BA 3BTVA 3R0JA 2HDOA 2XKOA 2BC9A 3KO8A 1KDVA 3GU3A 1N0WA 1XDWA 5DBOA 5FCDA 3STWA 3BN3A 3BL5A 4OFBA 3S8EA 2GZHA 4MHGA 3LT2A 3OFND 3DT6A 1TO2E 5LRRA 1XD2A 4JOMA 4V2GA 3FCEA 2B20A 5AHKA 3ESXA 5AVYA 1IN5A 2W8BA 4TLAA 5LL6P 1FC0A 4BQNA 1GHTA 1XA3A 4BUZA 2Q6KA 2HZDA 1OAKA 3OWXA 2OKCA 1YZYA 5ERIA 4GUDA 3IA2A 5B53A 2HX1A 1FVFA 5HOEA 2V7GA 4YLYA 3OEEA 1BBYA 3QSYA 1NP3A 1P7VA 3J7ZI 5EWJB 3NH9A 3HO6A 3HH8A 3S15J 3FTNA 2P5UA 2ZSIA 1M1ZA 3W9BA 2YDXA 3LGAA 1IMOA 4D9HA 2V58A 3GZJA 3Q9UA 3RC9A 4M8LA 3D1NI 4AZ0A 4EUFA 2AG0A 2IYRA 3OLCX 1FE8A 3BMCB 3RUPA 1P92A 1E3WB 3FPAA 2HIMA 1JPJA 3P9XA 2O8KA 1VHQA 1JKJA 4A0GA 1ATZA 5J4VA 1L7RA 2ZATA 3ITEA 1AF7A 2A1TR 3WTSC 2FMUA 2Y1EA 3M3DA 3PTLA 3DE7X 3TTWA 2GZ1A 2GZRA 2W2QA 1EVEA 4M9RA 3HK2A 1MJ9A 5DN9A 1X77A 3DKYA 3EFOA 2V5VA 1REQB 3K5HA 4KR9A 2F5CA 3U4HA 4KRGA 2OSVA 4HNAB 4S1NA 3EYAA 1NP6A 4C05A 5AM4A 5DYYA 3ANNA 2R5NA 2DWOA 3DDHA 3K6RA 3OIYA 1LA2A 2R48A 1RIFA 3CUVA 2EFGA 4GZLA 2AOTB 1H1TA 3O0DA 1EBUA 1CJCA 3ZV7A 2NW6A 4CI0B 1SQ5A 3O3CA 4HA8A 1H8HD 1Y4UA 1C3JA 2RHBA 1PD0A 2NV2B 2RHWA 4K8OA 4M2LA 3P9SA 1KOGA 1VL0A 4I4NA 5ANRB 4ZK6A 4WK8F 3IULA 2JK3A 6PAXA 3IPYA 2I03A 1TTYA 2PRKA 5EZSA 3O8BA 1MJGM 2QU7A 5NLLA 4BPRA 3LFUA 3KLMX 4Z99A 4MVJG 4Q7LA 4KN9S 5JJIA 3NT2A 2W2VA 1N1GA 6ABPA 2IZ7A 1BDBA 4L8LA 5J4KA 4Y6SA 2TECE 3M1YA 3HCEA 4FYPA 4F96A 2XHKA 2FWJA 1XQ9A 3ZLBA 4D97A 1MTOA 2DP4E 4XICA 1YS1X 3KALA 3M1EA 3V7SA 2IVFA 1CUXA 4OAYA 5BN5A 4CCNA 5LWQA 3T5MA 4JLDA 1W9HA 1AKTA 1JTVA 2WJGA 1JDUA 3ZGYA 3DFUA 5IU6A 4HGOA 1X7XB 4TRJA 4CHTA 1E64A 2WTMA 3ABRB 2X9LA 3I34X 4G9YA 1NVAA 1GRRA 1IJEA 1W4CA 2LRHA 5TX7A 1IWPB 3TQOA 4FMBB 1CQTA 4IQGA 5C51B 4D0PA 5JQGF 3RTAA 2QGNA 5IWAB 4MO2A 1VF9A 1ISSA 2VC2B 4EF6A 1HDGO 4LC0A 1WXFA 4KN8A 5BWBA 4KI7A 1E3TA 2ZR9A 2VYQA 3SDBA 5IDWA 3NARA 5K3BA 4II7A 4HX5A 1FJLA 3V9PA 4Z4CA 2FRXA 5KTTA 3LGSA 4TWZA 1FSPA 4IOKA 3FX2A 1RR6A 2Q8PA 4K0RA 3JZMA 4GDFA 1CF2O 1HFEL 3HDHA 2GERA 5IVPA 3H6KA 2UWMA 5SY4A 2YYSA 1FNMA 1K9VF 3L7AA 1V48A 2ODBA 4NYJQ 1JT6A 2JA8J 2QNRA 4JWTA 1HEUA 1QP7A 2EKZA 4DCJA 3L4KA 2AXNA 1A3CA 4MKFA 1KMMA 1JUSA 5NULA 1C4XA 2QRNA 1ZMTA 1IRFA 4ZT2A 2OBBA 3SCZA 5HZKA 1ECJA 2XUJA 3SYNA 2QSGX 1N78A 3K8QA 4Z4G