1JI8A

Solution structure of pyrobaculum aerophilum dsrc/gamma subunit of dissimilatory sulfite reductase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
molecule keywords dissimilatory siroheme-sulfite reductase
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2001-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ji8A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1ji8A01
1JI8A 3OR2C 2A5WA 2V4JC 1SAUA 1YX3A 2XSJC 3OR1C
chains in the Genus database with same CATH superfamily
1BW5A 4PFOA 2E5ZA 2PBIA 2VL8A 5H20A 4YFXF 5B1BH 2QWWA 3D5RC 3OY9A 4HX4A 3R4KA 5FKOA 1O57A 3HM5A 2M0CA 4RGRA 1KGSA 1BOBA 5FLMJ 2KRHA 4M3FA 1Z05A 2OZUA 1PUFA 3BG7A 2KJBA 2L9NA 1TTYA 2A6HF 5FFZA 4EJWA 3OYMA 1V5FA 3RSNA 3CUQA 1XC5A 4PGHA 5KK1A 3S2WA 3CDLA 2HKOA 1LVAA 1U5TC 5L3CA 3WGGA 4IHVA 4FTHA 2K3PA 4F52A 3LFKA 2IJLA 4LMYA 4DBQA 2ZCWA 4L5EA 4D7NA 1IG7A 1LDDA 4NB5A 2LRDA 4G6DA 3KP5A 4UVBA 2DQRA 3CTAA 2DJNA 3K2ZA 2E2JJ 1R1UA 1LFPA 1H0MA 2NAZA 4AWXB 1GDTA 3W6KB 2A69F 3K2AA 5CJ9A 5JR3A 1W7PA 3EUHA 4BXFA 5IYCJ 3OYNA 5E18F 3CJTB 3KEYA 2DN0A 1FOKA 4OIRF 2CV1A 2IXSA 3O2PE 1MNDA 1E0EA 2R4GA 4KIGA 3VB2A 4BE2A 3BZKA 4UVAA 4G6TB 3M9AA 3W3CA 2DU9A 3K4BA 3LA3A 4Q5SF 3BQZA 4MFDA 1ZGWA 1D0XA 1XGNA 3SZGA 4G7HF 5HODA 4L0YB 4A3FJ 4P9UA 5IP6A 2L9RA 4C3JJ 4MQ9F 3VPRA 2VKVA 3G6EI 4WWCA 1G3WA 2Y9YA 3OYFA 4HF0A 1PJRA 5FB2A 2IGMA 2HQ5A 1HF0A 2KFDA 4BACA 2KT0A 2VODA 2JTVA 1WHUA 4H4KC 3TKYA 4ZDOA 4MTDA 5ICEA 1LJ9A 3J81Z 3QYEA 1Z77A 4Y7NJ 3HOUJ 3HHGA 3BJAA 3WTSC 3W2VA 4BQNA 2NS8A 2DYSH 4BY7J 2TRTA 1K78B 4KNYA 4FE7A 1UZCA 4A3JJ 2KISA 3GFLA 1IJWC 3CMEI 3KPHA 1HDPA 1OCPA 3F3XA 5BQTA 2LG4A 4BE0A 2CUFA 3CMYA 2QQ9A 2FBIA 3VWBA 2M30A 1VQ4I 4KUMA 4BDZA 2E19A 5TGTA 2X6XA 3D5SC 1XD7A 3JRFA 3BC8A 3M1CA 4NQWB 3WTVC 4DZJA 4AM3A 1Z6TA 2DFIA 4CCNA 3OS1A 2F4IA 5CKTA 5DCFA 3TMOA 1QBJA 3FHZA 4CDGA 2XAHA 3KIOA 3OYCA 1G4DA 3I64A 2RC4A 1SFKA 3GFJA 4NBQA 2ZJ2A 3F22A 1K4TA 2B9SA 3VYUB 5E79C 3F21A 2R93J 2O3FA 2DT5A 3JAMZ 2GXAA 4EATA 4ENJA 4KIBA 5EEAA 1DQUA 2L7KA 2X85A 3KFWX 2EFOA 1U3EM 1ZN2A 4QIWN 4KISA 4LG3A 3BG5A 3SZPA 1N25A 2VIXA 2ZB9A 1X2NA 2EZHA 2K4JA 2ZMEA 4HF1A 4WX9A 1E17A 1MIJA 3S3MA 3CO7C 1K79A 2XAFA 4LG0A 2LR8A 2A6EF 1RZ4A 1T56A 3R60A 5B5EC 3BR1A 1T6SA 4QLCU 4IOAF 1N77A 3RPUA 3VFZA 3EUHC 3BZ6A 4V19K 1VQ9I 4GYIA 1S7EA 2EQRA 2KIUA 2P5VA 4BXUA 3KYLA 2YUSA 4L5JA 3LSMA 4MEYF 1W36C 4A3CJ 3WU1B 3V7RA 2CFXA 2FMYA 2GXGA 3GLLA 3H5AA 4RMNA 4RGXA 3E6DA 1IV6A 2VLAA 3S2HJ 1FEXA 3KYCB 2Z33A 3GZ5A 3IH4A 2STWA 4WF2A 3JSPA 2L4MA 2V1DA 2NOGA 2K4BA 2FJ1A 1BR4A 2HXIA 2R7VA 3H9JA 4PJMA 4PUSA 4E7HA 1LNWA 3FBIB 3I59A 3S15J 4HV6A 2EFPA 4M6XA 1JJ6C 1OCCH 3H35A 4XNFA 2DODA 2XB5A 1K7AA 2H6CA 2VN2A 1O3SA 2ZO4A 1Y1WJ 1SC7A 3RYRA 2DW4A 3GMEA 1OISA 1VQLI 2DDBA 4XONA 4BS9A 1UG2A 4GFBA 2HR3A 4AIKA 4BJTA 4OAZA 4CYDA 2EB7A 2LK2A 3ZMDA 2DA3A 3BR5A 1YJNI 2A07F 1UHWA 2L4AA 4EJOA 3DBLB 1OMIA 4BQOA 4U7DA 4JP0A 3WTZA 1S3JA 3EYYA 3HOWJ 4RB0A 4KDPA 4KMFA 3KZZA 2G7HA 1VQ5I 3PQKA 4PJNA 4I7HA 3ABUA 2ESHA 4QTRA 1T8IA 1QU3A 3HZJA 2K27A 3RJPA 3LSRA 5DM7F 2LDUA 2W24A 2D45A 4CZZA 5TJJA 2BY0A 2BHYA 2IAIA 1BM9A 1QVUA 3FM3A 3FXKA 3L7WA 2JJ7A 4LK0F 3QWLA 4FE4A 1Y39A 2FUG2 3O8HA 2FRHA 3R0AA 5F64A 1WKMA 2B7EA 2DO7A 1OYYA 1T08B 4KT6A 2WADA 3FK7A 5E1ZB 3HTUA 4HBLA 3BR3A 2E1NA 1P7JA 1OYIA 2JVGA 2X6WA 1B59A 1KYZA 2F5DA 3QPHA 1MJAA 1GLNA 1YG2A 1R58A 2DFHA 4XSXF 1IW7F 3HOVJ 1XX5A 4YIRX 3HSEA 3QQAA 4NC6A 2E60A 3U21A 2CGPA 3M07A 3ASOH 4ZYDA 1LDKB 1IXRC 4IRGA 4FT8A 1MW7A 4E4HA 1PP7U 1FBSA 3LNQA 1FYKA 2P6TA 3H92A 4XIDA 1ETVA 1G8XA 5BMZA 3FISA 2L54A 5B1AH 2DMTA 4XL9A 4ENNA 3KETA 3V8LA 2EA4A 2R5ZB 3FXRA 4ETSA 2QQ8A 4CGZA 3QOPA 1J75A 1YS7A 5BS6A 1U6GA 3L2QA 2L7FP 2OF7A 2DFEA 1WH5A 2R3SA 4OOIA 1Y8RB 4U0VA 5D5XB 1JKPC 3GTPJ 2O03A 2DA5A 1S6LA 2DK8A 3DU5A 3RKWA 4H0EA 4NQWA 2A3SA 5M3MJ 5E8IA 1FYMA 4PCQA 1T0FC 3OR2C 5ICGA 5GAGJ 3LAJA 3OIQA 4BHPA 2VJ5A 4HOBA 4CICA 1X1CA 2MSYA 3RPUD 2EFNA 2YX7A 3MMYB 1O7LA 1YFHA 5D4RA 2IT0A 1HQCA 3K4KA 2Y31A 2EV5A 2NNNA 1O3RA 1P9QC 1FX7A 4DGWB 5LLQA 5D5UB 3MVPA 2ELHA 4IXAA 1JGSA 1NK3P 3HYIA 3TBIA 4K2EA 4RAFA 1K6OA 2QBYA 3J7AY 3P9IA 2EBIA 2ZSHB 1P2FA 1WJDA 4II3A 2QENA 2FBKA 4V2FA 1YX3A 1K4SA 4X6AJ 4OMZA 5C4JJ 2OJED 4UUSB 1EKEA 1H88C 4D7MA 4HF2A 1OFCX 4BDYA 1IDYA 2PMHA 3ESWB 3LSHA 4B3XA 5KHDA 2RQPA 3LSTA 2HOEA 5DUKA 1N75A 5E3MA 3CC2I 3CD6I 3SJMA 3IH3A 4EVIA 2X1CA 3C2HA 2BVLA 2LFBA 2ID6A 2PQ8A 1J59A 2DA7A 1X3WB 5AONA 4MEXF 2VBXA 3ULQB 3AL0B 3BJOA 1V3FA 3K1NA 2IS1A 3I53A 4P55A 2A61A 2FSWA 2M34A 2HGCA 3A2KA 1QRYA 3E1SA 1TT0A 1H9GA 3V8JA 2JRTA 3A01B 2FU4A 4BJ5C 4QSHA 3MD2A 1F43A 2KIFA 2YS9A 1W5CC 1XTAA 2TDXA 1K6YA 3RKYA 2MW8A 2V6EA 1YHQI 3KYDB 4CUGA 2R7SA 2E5NA 2WY8Q 2IA2A 5C4XJ 5EZGA 1T0FA 3GYHX 2R92J 1Q1VA 5FKLA 3RQ4A 4HLXA 3ZMTA 1MBFA 2ZXHA 2V9KA 2DTZA 2DPUA 2VBYA 4HSRA 2P5KA 1BW6A 2M8GX 2H09A 4LIUA 3NQOA 3Q0VA 5ED4A 4KIFA 2M7BA 3H36A 3HRTA 3ZMSA 4U0YA 1C0WA 4F7ZA 1MH4A 2OC6A 3A4CA 4ABZA 3CC7I 5FRMA 2BV6A 5K1YA 3W2WA 2R0QC 3ZMZA 3K4MA 2WY7Q 4BGDA 4XOTA 3MFKA 2K9MA 1SVLA 2JSCA 2HPIA 1PUFB 1DGRM 1K61A 1BC7C 2JA5J 3H3ZA 4G8XA 3AG4H 4GRIA 1W0TA 2IBDA 4EQQA 2O0YA 1SVMA 1TNSA 4XKWA 1JKQC 2RVCA 1X19A 3QAHA 5BNGA 5CVVA 5DV5A 2QM3A 4HX7A 1FY7A 3F8NA 4YIFA 2IRFG 4N0BA 1S72I 1AOYA 2QQAA 1Y56A 5DDGA 3E5XA 4G94A 4Y4RA 3RZDJ 3F72A 5K5QA 3GTQJ 2K9LA 3H0DA 3QOEA 2DK5A 4A3BJ 4JK1X 2PMZA 2WAQN 1GXPA 3A0BC 3PUBA 5FROA 3DPLC 1LE8B 1JE8A 3GBGA 1ON1A 3T8TA 3WG9A 2FNAA 1FOYA 3DQVC 5KNLA 2F5EA 2LSOA 1FTTA 3PIPF 3GW2A 3LL7A 1Q1HA 3BT9A 3L2CA 1G3SA 2ZBKA 2ELJA 5TISC 4IEJA 1UFMA 4XN0A 1U5TB 2X9DA 3AKZA 3Q9VA 3OIOA 4CSWA 1LE8A 3KLOA 3R61A 3DKXA 1I1GA 1XGOA 4A3LJ 2ICWG 5DYMA 2O6GE 1WRJA 4LIVA 1XGSA 1FJLA 1QA6A 3EUKL 5M3FJ 3DEUA 4UUSA 2EZIA 4X0GA 3LA7A 2KIQA 2Y2ZA 4ESBA 5JHUA 1ZTRA 1D0YA 4D1QA 2IA1A 1LVKA 1UCRA 1V5GA 2BBYA 3GXOA 4XLFA 1X1BA 2E71A 1YI2I 2XHKA 2Z16A 4IZZA 1RKTA 2MH9A 4RAYA 4M9SA 2V9PA 3HEFA 4HLYA 2O8XA 2Z2SB 3KE2A 2UZKA 5CVIA 5EYRA 1H9TA 4WXCA 4CO8A 2HQAA 3SQNA 1R4MB 2JPBA 2NYXA 1BI3A 2ME6A 3L00A 1RR8C 1E2XA 1KQ0A 2FD5A 1CGPA 4JX6A 2I8DA 4DJAA 1UELB 3ZCOA 1R23A 2ZJRF 4S0HB 3JTHA 2H94A 1DDNA 2QKLB 4D5FA 4Y33A 1ZGJA 5DTDA 4I99C 2RNJA 2FNPA 5D8KB 5JFRA 4OIPF 1ZG5A 2Y9ZA 3TGNA 1OLTA 5LHGA 2M4KA 3MQ0A 4LGWA 4HV5A 3MKZA 2L9SA 3BDDA 1YX5A 2XGEA 1G3TA 1S29A 2UWMA 3FIWA 1FOWA 2E1OA 4KJZA 3PM1A 3KZYA 1PVEA 4BU2A 2BXYA 2UUZA 4M3DA 2Z1DA 1ZRCA 2MBFA 1YW7A 3F0CA 1ZRFA 1TWGJ 4AVZA 3ASNH 4JYKA 1X4PA 1XSVA 3IC7A 1XG1A 4I0AA 1R4NB 1VQKI 1KQ8A 1P7IA 4LFUA 1DU0A 3COAC 4UUVA 3B6AA 5J1RA 1U78A 1IDZA 5F27A 1ON2A 4EJUA 5D4SA 3DLLF 2H27A 3U2RA 2M2EA 2X6YA 2XASA 4ENMA 4XLNF 3L2WA 4HRIA 2HOAA 1J5YA 2ISYA 2V26A 4XLEA 4NUBA 3GWZA 2OCEA 5DUIA 4HAMA 1ZG3A 1GHCA 2OQRA 1QZYA 2XB0X 4PK4A 3BY6A 4N9IA 1XN7A 2M3AA 4PSWA 3Q3SA 2A68F 5IYDJ 1LB2A 1IUYA 3K0LA 2O8KA 3OSFA 2VT2A 5HLIA 4ZZLA 2NVUB 1JTYA 3ECOA 2BW3A 2CW8A 2GIVA 1NTCA 2GAUA 4HYEA 2STTA 1P6RA 5L3FA 5F04A 4D9JA 1XSXA 3UR3C 2W1OA 2HDCA 4FHTA 4HQMA 4ZYHA 2GIZA 2KZGA 3I9V2 1IRXA 1ETOA 2LF7A 3S3OA 1LEBA 3E5QA 4JOMA 1SFEA 3IWFA 3FKJA 4EJVA 3G1MA 3FM5A 4GO1A 1EV7A 1WJBA 2R7DA 1G3YA 3HKZN 3HIFA 2XKOA 1APLC 1ZELA 5K7FA 3CMAI 4PFPA 3WTXC 3U1DA 4XORA 2FBHA 3IWZA 1N78A 1IN7A 2VPRA 2LF8A 3A0HC 1T95A 3NEUA 3M1EA 5EGOA 4A69C 2HVRA 2V79A 2WTEA 1WSUA 1RIOH 3NAUA 3WE3A 2VJ4A 4XN3A 4Z6YA 4F55A 1B6AA 1BN5A 2HTJA 3DPTA 1W0UA 2PJRB 1HW5A 1Z91A 2X48A 3MZ8A 2QSFX 3ZGKA 4IHTA 2FEZA 3WU2C 3X2QH 3QRFF 1ZAOA 3FZVA 3DKYA 2CV2A 2DAOA 1J2XA 4DZPA 4I0BA 1L3LA 1FBQA 4C2MJ 4XICA 4BYYA 5FLXZ 1TT5B 1JUMA 1RRJA 4RGUA 2DOFA 1ZREA 1I3QJ 4RA2A 2UV1A 1QHGA 3V7CA 2R5YB 5IP7J 2KLOA 2GA1A 2VC1A 1EA3A 3G2BA 2N8GA 4PSXA 3OR1C 4LOCA 3VYSB 1MBKA 1PP8F 1GUUA 2Y69H 4M73A 1GT0C 3JCUC 2ECBA 1YRNB 2IS6A 3AG3H 2XAJA 1WJEA 2G9WA 2W7NA 1R49A 2CO5A 2ZKZA 1CQTA 4PGGA 3CCEI 4G7OF 1MD0A 5CVJA 2DI3A 2VE8A 4P1WA 3OOPA 2E36A 1V4RA 4WK8F 2HKXA 1IC8A 1MMSA 3R0JA 2M45A 2XAGA 5LHIA 3JSOA 3OYAA 4M9XA 1TQPA 1YO5C 4XM3A 2YX4A 4ZC3A 1D1AA 2DA1A 5J40A 1VQ6I 1H8AC 2RNGA 1YE9A 4MNUA 4XRFA 2CQQA 2HZTA 3JRIA 3CCJI 3AAFA 4AIDA 4HNUA 1VNDA 2LY1A 2NVQJ 4YG2F 3OYBA 2L01A 2XSJC 2P6SA 1LPQA 2ADUA 4IL6C 3HJEA 3WODF 4EJTA 3HG9A 4BXXJ 1MNMC 4XMYA 4E6KG 5IOYA 2DMUA 3SYTA 4B1RA 5F6FA 1SFUA 2FE3A 2L0KA 5LRSA 2CRGA 4RGSA 4RBOA 2K02A 5ICFA 1VQ8I 5EEHA 4A5MA 2M87A 1MH3A 1J9IA 3E7LA 1Z7LA 3CMMA 3HRMA 3S1QJ 2MC4A 3R6SA 1WGXA 1X1AA 2Z5UA 3I54A 4A2UA 1NK2P 4ZDLA 4XLCA 5JI6A 2XSDC 1FC3A 4X1EA 1UHSA 2PLYA 1WH7A 3D1NI 5J8CA 1OJLA 1Z67A 1DPRA 2K9SA 2JVHA 4A6DA 3CCYA 1Y1VJ 3FDYA 4N4OB 1BOAA 2HOSA 1ONVA 2AS5F 3SFIA 2XAQA 2KKOA 1HXDA 2OAZA 3ECHA 4BE1A 2B63J 3C7JA 2QQBA 4ZYAA 1FIAA 2BXZA 3GO5A 1BJAA 2Q1ZB 2XGDA 2PX9A 3NARA 2X51A 3KZIC 1TQIA 1BIAA 3KLNA 1V54H 1IRFA 3CP2A 2ID3A 4Q4ZF 5E17F 4IKFA 5L3GA 1KZHA 1TWCJ 1UG0A 1I1SA 4CYCB 4GYGA 4IO9F 3PFYA 5HDGA 4Z2YA 1KYWA 1F9NA 2LREA 3SEZA 4HW0A 5HNHA 4L9TA 3IL2A 2XVCA 3GCMA 4EV0A 2CU7A 4CCKA 2IW5A 4R8HA 1BI0A 1TC3C 2BVMA 3G4SI 1UAAA 3OOUA 3HSFA 4NC8A 4A93J 5IYBJ 5HOOA 3F23A 2DJIA 3OL3A 4EGZA 2PFBA 2W00A 2WV1A 4IRHA 3OYGA 2Z9OA 3HHHA 1F36A 2QF7A 1CF7B 1RETA 3ZQLA 1POGA 3A1YA 1R71A 3LSGA 3MAJA 2XKPA 4ITVA 4BBSJ 2IS2A 1XMKA 4L9NA 4I98B 4ZDPA 2AXTC 4B3AA 3PQJA 4DQ2A 1DGWY 4JX4A 4KYWA 1IUFA 2D5VA 4LJZF 2XGCA 2V7FA 1TW2A 1VZ0A 3F8MA 2HS5A 4UV9A 5J3LA 2E1CA 1W5TA 3C3WA 4IHWA 4Y52J 3GFIA 3FX3A 1RC9A 3BLYA 2OTLI 1ZLKA 1XSDA 3I4MJ 4G6QA 2VUMJ 3ZP5A 4ESFA 2WC2A 3QYFA 4HDUA 2HDWA 2DQLA 2CWEA 4C3IJ 3TW7A 1GVJA 4GXOA 1U9OA 4RDUA 5C44J 3T8RA 2V1NA 4B44A 1TW3A 3DLAA 3HUGA 3AFHA 2ZXWH 4UB6C 5LRRA 2PEXA 3ZXSA 4U7BA 2VBWA 1IXCA 4G7ZF 2QUFA 5FLVA 2Q8KA 3WU0A 1FNNA 2X6OA 1V5EA 2LC2A 2E35A 2MA3A 3T0YA 1DUXC 1X3ZB 3WTTC 5FKNA 2AHQA 3D0SA 3P9KA 1FMVA 1BI1A 1IZ1A 2UXXA 1LEAA 3U9GA 2HVQA 1P92A 1UMQA 2KPMA 1EH8A 5JVTA 1B1BA 1Z6RA 3RKQA 5IT3A 1XDUA 1SEUA 3LAPA 1O7FA 3VDXA 2EFQA 3TO9A 1MSEC 3HOSA 2PJRA 2CJJA 2B0LA 3G71I 3C2GA 3ERMA 2OCCH 2EA2A 1RPWA 2GOMA 2L7MP 4ANJA 1ZARA 3DEEA 3A01A 3WG7H 5B66C 2VPLA 1WCMJ 4MQVA 1T39A 2LLKA 3ABTA 4CCMA 5HS8A 5C3EJ 2JZYA 1W5SA 1R5ID 3FMSA 3MZYA 3KP4A 4A0ZA 1SMTA 2VJJA 3RQIA 5HLGA 3VSKA 1IV8A 1FMWA 1TZLA 3LSKA 3OYHA 2EZLA 3IH2A 1H89C 5EJCA 2EINH 3K10A 2GQQA 2VXZA 3OYIA 2HFHA 4HG2A 3I4NJ 3ZQHA 1VFCA 4O3MA 3N05A 1YLFA 3BTCA 4S04A 5IY5H 3H3VK 1IO2A 1MBEA 2Q2EA 5J1YA 1D0ZA 3CJRB 5LGTA 1MBHA 3FF5A 4C9YA 2M4GA 3LQRA 5M5XJ 3CJNA 1MZBA 3AG2H 3NWTA 3PIOF 1J0RA 4UY8I 1AA7A 3HGGA 3D5LA 3BTIA 1MBJA 3J7ZI 2JT1A 3TL4X 4IQJA 3JR9A 4WXDA 1MMNA 2ZSIB 3DTEA 1AKHB 3FXQA 3FXOA 2E7XA 2L9VA 3BCAA 3IAS2 1A6IA 2VQHA 3S2DJ 4ZTFA 3G1LA 1AU7A 2JMWA 2COBA 1MKMA 2WAFA 4M72A 1XGMA 1SAXA 4XRMA 2F48A 4CZCA 2GXBA 3RPQA 3IRRA 4BHCA 2KDZA 4LB5A 2VXDA 2M1BA 3L09A 3GFMA 1F1ZA 1SD6A 1HW2A 2M9HA 4E7IA 5HDNA 5EDNA 4HZFA 3L2UA 3LFUA 1R6RA 5J6XA 2EIJH 3IP4B 5J8FA 1WI9A 2WV0A 4B8XA 1ITYA 2GZWA 1YQAA 4XKBA 2F4MB 3P5JA 1SD4A 1AWCA 4F92B 2OUMA 5M5YJ 2R7XA 1A6QA 2QVOA 2XPUA 3I0TA 5E3OA 4OIQF 3I71A 2UXNA 3TOBA 3GTLJ 3RKXA 2OTJI 2RV8A 2RGVA 1IN5A 3SDBA 1G6NA 3CCLI 3JTGA 2RKHA 2F5VA 2P5LC 5EGOB 3L2RA 2PN6A 3O3KA 4CA0A 1V55H 3L9FA 3CO6C 1DP3A 5FGMA 4OAYA 4AVPA 5BPDA 2QZ8A 1TWFJ 4M9ZA 2HYFA 3IKVA 2CW7A 4E7ZA 4JQFA 4S05A 1NG6A 3HL2A 3KCCA 1UHMA 4XR6A 1W4MA 2FOKA 1NG7A 5H6RA 2IGNA 3B73A 3OSGA 3ABLH 2K5CA 2Y0MA 2NRAC 1HA8A 1S7AA 3HBLA 1VF9A 1KONA 2QLZA 2A5YB 2AQFA 4ZH4F 2IGOA 5FJ8J 5D6FA 1BJZA 4UHTA 5KCMA 1RNLA 2WB1N 1MJBA 4FX4A 2V6CA 2CQKA 3J7YJ 3CCQI 5BPIA 2JQ7A 4YEJA 2M8EA 3WE2A 1MMDA 1OCTC 3VODA 2IEKA 3HTSB 4IPAA 1XCVA 2VKEA 3TO6A 3DTKA 5B3SH 4AIHA 2NVXJ 3GTGJ 3MKYB 2E1MC 3ZQQA 4N9HA 3DWLE 2O7OA 2DMPA 3FXLA 2O61A 1KQ9A 1A36A 2OU2A 1LKXA 1QVTA 1S5LC 2K9NA 5CVUA 4IJAA 3SEQA 4BJ6C 2CQXA 3KP3A 1FP2A 5LGUA 1YOVB 1YW9A 1R36A 5DCMB 3OYKA 2BY3A 3S14J 1ETYA 3S16J 3ZQFA 1FP1D 2GLOA 2AO9A 2FMLA 4BHBA 1SMYF 2JRMA 1IN8A 2PMUA 4LLNA 3O8GA 3ABKH 3HC7A 2L7ZA 3L2VA 3DU6A 2JA6J 2L2OA 1VQPI 3HUGB 1K83J 2L5QA 5GTIC 1ZR2A 1OCRH 3DBRB 3JAMK 3B02A 3BG9A 2WAEA 4MO7A 4BL0B 3QU6A 3V4GA 3ML6A 3GLXA 1GV5A 2HI3A 4I01A 4DYRA 4RS8A 2P81A 1USTA 4QPOA 4U0WA 3BTLA 5DS9A 5F0FA 3RDIA 1TQMA 2MLGA 2MFZA 1SFXA 1YYVA 2VONA 2BGCA 2E2IJ 2CSOA 2ZXJA 3BOQA 3QP6A 5EF6A 2R5ZA 3TQNA 3GZNB 2QSHX 1YJ9I 2DT6A 4HNTA 4QPQA 3TDUC 2Q0OA 1RUOA 4M6YA 5F08A 3DXJF 1B72B 2QSGX 1XPXA 2Z99A 3WGIA 3GVAA 4DYCA 3TEDA 2I5UA 5A2QZ 2YU3A 5DD8A 4OU0A 2AXLA 5ILUA 2EIKH 1LFBA 4B4CA 1VI0A 4WCGA 3MZHA 1XS9A 2DT7B 5IOZA 1FSHA 2ZNZA 2HZDA 3BR2A 2A5WA 1W7PD 4CCJA 4RB3C 4HQEA 1JKOC 4MLOA 2XGXA 3LSPA 2V1XA 1W36D 3P9CA 4BUPA 3CCMI 1EJ9A 2FXAA 2MD0A 2QKMB 2VASA 3M8EA 3H9GA 2Z3YA 3I4PA 4XRSA 3P7NA 1P4AA 4XQFA 3EYIA 2VB6A 2Y0SN 1I27A 1LUJB 5TRDA 2R7FA 4I02A 1X1PA 3ZR8X 1WZ2A 4I6ZA 3ZQCA 3RYPA 3WTYC 1QNTA 3OS2A 2KQRA 5DM6F 4XLAA 2GM4A 9ANTA 4A12A 3TDZC 3FXJA 5D5WB 3TOAA 2MGQA 3PNVA 4JX5A 1OYWA 1XMAA 2Y0SA 3KX2A 4E7JA 2VC0A 1Z0XA 1ODDA 2ZJQF 3E6MA 4E7KA 1CF7A 4Y17A 5LFAA 2JA7J 3GTKJ 1MDMB 2FQ3A 5E20A 1W1WE 3GF2A 5M5WJ 3S17J 2I10A 1BIBA 1OPCA 3F8BA 3RCOA 1HKTA 1UJ8A 2GOXB 2MD5A 1RESA 5FKMA 3REOA 2WA0A 2R7WA 1GVDA 2KJCA 5HNFA 1JUPA 4DBRA 2DXIA 2DA4A 3QODA 4BQAA 2KRFA 2GBYA 4OMYA 1QPMA 2K7LA 5D5VB 2CV0A 4IF4A 2PI0A 1WJ5A 5IT9Z 3HXLA 4L18B 1D1CA 3SXYA 4WXHA 3QPSA 1HDDC 1ZG1A 4RAGA 3ROUA 4DIQA 1E3OC 4L9VA 4DW6A 3LQQA 1OQYA 3L1PA 4I2OA 3SFZA 2BHZA 3BPXA 2KP6A 3LSIA 3HPHA 2HNHA 2JA2A 3CLQA 3HOTA 5F0CA 1ZR4A 4U87A 5DEQA 4F3QA 3K7AJ 3BWGA 1YRNA 2BE5F 1ZK8A 3HRUA 2QA4I 4KFCA 1AHDP 3O6BB 3LSJA 3HB9A 3CCSI 5D6EA 1QGPA 3TW6A 3OL4A 3IUOA 1FTZA 2FA5A 4CCOA 5CYVA 1FIPA 5DD4A 2KDOA 3FXUA 2J5PA 1MGTA 3ZQIA 2K40A 5BOXA 4BH9A 3G3ZA 3MKWB 1WWXA 4XRSG 3I3LA 3DTIA 5FRNA 2OQGA 2XV4S 3OS0A 1IRGA 2YPRA 2F2EA 3N4MA 1DPUA 3V7SA 3RZOJ 3NRVA 1E3PA 3ERED 1MSFC 1R5HA 3BPVA 2XIGA 2KRCA 2HTSA 2DA2A 1JHHA 3K1MA 3ZN0A 4AYBN 2EV6A 4IQ4A 4HDVA 1MBGA 1HCRA 3F8CA 4YFKF 2E2HJ 4ZYGA 1HLVA 3BG6A 5CQGA 4PZJA 1X58A 3HDDA 3CZ6A 3H1CA 2LTPA 3JRGA 1ZHFA 1TLHB 3PSFA 4HEA2 1J7KA 3H3UA 2F5FA 4AYBA 2W84A 1U2WA 3E5UA 4L9JA 5GPAA 1YS6A 3HRSA 3V8KA 2K86A 5FD6A 1IN4A 4XKVA 3VEPA 3CUQB 3PNYA 2DPDA 4II2A 4B47A 2HQNA 2LKSA 2MC3A 2W25A 2RDPA 3PJRA 5LBQA 1Z3XA 1R22A 3GTJJ 3HOZJ 1XB4A 4KA4A 1JHFA 3F8FA 1D5YA 1WQ2A 2M0MA 4UB8C 5CPRB 1Z21A 3EQLF 4ESJA 3E6CC 1ACIA 1QQIA 4A5NA 1P4WA 2VT3A 1NHAA 5GTHC 5HVQC 4BEHA 2ZMEB 2FF4A 2Y30A 3ZMUA 2XF7A 3I59B 2LY2A 2KL4A 3OIPA 4HSTA 2P4WA 4XOPA 4ZTJA 5F1RA 2OBPA 3ZMVA 3K9TA 5GPCA 2YU9J 2NS7A 1J09A 4LITA 2MG4A 3K4LA 3KP7A 2EIMH 3ISPA 1I6HJ 1ETQA 4AD9A 2Y75A 2LYCA 2JK3A 1T2KA 2FX0A 2D1HA 2RQQA 1TNTA 1ULYA 4GCVA 3I55I 3S1NJ 2LNBA 1ZKGA 2W82A 5HLTA 4DYQA 1JKRC 2H8RA 3OYLA 2RAEA 2F4OB 2VE9A 2LP0A 2ACJA 4RM2A 3PFIA 3GTMJ 3CC4I 3LOCA 4MIMA 3WTUC 1JTXA 4CYCA 2A05A 4IRIA 1OR7C 3OMYA 1U9NA 5LGNA 4AIJA 4BY1J 1I6XA 2JWTA 3NWSA 1WPKA 2MABA 3EDPA 4M71A 3K4NA 1R9TJ 1ZLJA 1T38A 2O9LA 3IKTA 1JUSA 4B43A 2IS4A 4PJ0C 1BI2A 2ZXIA 1STZA 2XUBA 4IHSA 3DKWA 2F6CA 3J80Z 1Z7UA 4M74A 2L02A 1HW1A 4E7SA 2FQ4A 2O5RA 2XROA 2P7VB 4HA8A 4W97A 4IHYA 1HKSA 3ZPLA 4KT5C 5K5OA 2DOAA 2X4HA 3T1BA 2QCOA 1IN6A 4PJLA 2CW0F 3I56I 1ZRDA 4LD5A 3GUDA 3KEQA 2D1VA 4RB1A 1ENHA 3CP8A 3BTJA 4XBFA 2W85A 1PDNC 2NVYJ 2DYRH 3FK6A 4RM3A 2HEOA 2LBFA 1GXQA 4KMUX 4A3EJ 3BR6A 4EM2A 2VKDA 1YW8A 2ZFUA 3QU3A 3F6VA 4D0PA 2MYSA 3Q0WA 2EH3A 3U1KA 1U8RA 2JPCA 4YRVA 5L3DA 2BY1A 2EZKA 3ONQA 2CUEA 2VI6A 1Y8QB 4C30A 2HQRA 5HLHA 3PO3J 2IA0A 3IAM2 5HDKA 3CF5F 3QPLA 4Q48A 4M3BA 5L3EA 1VTNC 4C2TA 4EMSA 3Q5FA 1EH7A 2DA6A 4XLHA 4E70A 2PMZN 1IGNA 1ETWA 4KN4X 5K7ZA 5GAHJ 1S7OA 5J4VA 2A6TA 3LMMA 2EJRA 4IHXA 2F5CA 2GWRA 3WTWC 3OV8A 1R1TA 1EH6A 5AIPA 2CYYA 4I76A 5IP9J 1LQ1A 2K85A 5E3LA 2DBBA 2DMQA 2LOOA 3BZCA 3ZOBA 1ZYRF 2X1DA 1HSTA 1G2HA 4R1HA 1FBUA 2P0WA 4MGRA 2R7ZJ 2CG4A 3DCFA 4XKCA 5KAIC 2V1UA 4NHJA 2HOTA 4YIIA 5ILVA 1O3QA 1E3HA 3FMRA 4O6JA 1KA8A 4I09A 4A3KJ 3DP7A 1ORKA 4L5IA 4CXFA 2DDAA 4LLLA 1HSJA 2JSPA 2WBMA 3M8JA 3UKGA 4FASD 4A3DJ 3JRHA 2X1EA 3LA2A 5JHFA 1BA5A 3KP6A 2VQGA 4U88A 3ZN1A 3MN2A 1T33A 3RTRA 2VJIA 2LY9A 4R79A 2HVSA 2VQCA 2WWYA 1IXSB 5J47A 1MMGA 2NNYA 3JRAA 1BL0A 2YR2A 1KU7A 2E1MB 3BCBA 3LWFA 5EZHA 3G1OA 1ZQ3P 2EILH 2LMDA 3DFGA 1U0JA 2ZFWA 1S9HA 3QP5A 5LEKA 2HYJA 1I50J 3M8FA 2BOLA 3JW4A 5A2QK 1BC8C 1QZEA 4ZZDA 4ZYEA 2W4SA 5GAEJ 3HPGA 2ZNYA 3KEOA 1FT9A 2NS0A 1DP7P 1R1VA 3J81K 3MKLA 4Y3OA 1NH3A 2W48A 3K4CA 3SZTA 2EWNA 4UVCA 3MWMA 1FPQA 3FMQA 1MDMA 3I58A 4NNJA 1FWZA 1REPC 2NVTJ 2QEXI 1SVOA 4MTEA 5JLXA 3GX4X 1OCOH 2KIMA 4F91B 3AL0C 1QPIA 2HDDA 1DU6A 1F5TA 2YSRA 3E3VA 3K1PA 3K6GA 2AQEA 3V42A 5J1UA 1YITI 5EG0B 4Y15A 3VSLA 2EV0A 2CUJA 4F93B 4Q47A 3M4OJ 1Z3YA 3H9QA 4M3EA 6PAXA 4ENKA 4RAZA 5HS9A 1YIJI 1HOMA 3TP0A 2HU9A 1SD7A 1UB9A 2JN6A 2EK5A 3CQZJ 4EGYA 5F1JA 2K3FA 1YIOA 2IP2A 3CCVI 3DF8A 1JT6A 2VQLA 3C18A 1K78A 2CFOA 2CUZA 3OYJA 4J01A 2VOOA 4XSZF 2PG4A 1IAWA 3E97A 1R5GA 3JRBA 1YTYA 2KZVA 3ZQGA 2JA8J 1X2MA 5KAFC 1S8NA 3S1MJ 3K4JA 4NC7A 5FD5A 2L3DA 4UXNA 5FLXK 2FOWA 2ELKA 4OWRB 2LKXA 5E3NA 1QHHD 2OD5A 4B09A 4NDLA 1VQOI 4C3HJ 4YELA 3VYRB 4KITB 5ICCA 3G73A 2IGKA 4A0YA 4N4NB 3HSRA 5H2FC 1B9MA 3FWEA 4ASNA 5JLWA 2ZC2A 1I5ZA 2XF6A 3HOYJ 1LFUP 2ZMEC 2IVMA 2COMA 2DLLA 3CLOA 4IX7A 3AG1H 2XC7A 3CCUI 1PUEE 5ILSA 5EEGA 1D8JA 1D1BA 1R7JA 3S8PA 4UV8A 4BAYA 1A35A 1FLIA 2BEOA 1ETXA 1WI3A 2JUGA 2R7QA 4G12A 1TP4A 3F6OA 1IF1A 4E7LA 4L0ZB 2J5OA 2BZTA 2ESNA 2WAQA 4IOCF 2C6YA 4FX0A 2E7WA 2V9VA 3CDIA 4TV7A 3IRQA 1W7PB 2Y48A 5L3BA 4LB6B 4GGGA 3SHFA 4EM0B 2CS3A 1MJ9A 3TP3A 4UUTA 4BNCA 3BQYA 1O4XA 2VOPA 2RN7A 3B6CA 4CH7A 3DV8A 2H1LA 3S32A 3RIRA 3FHNA 1D3YA 2Q2EB 5DCMA 1EF4A 2KHMA 1Y6IA 1FOXA 1IRZA 1U8BA 1SAUA 1ZGAA 3CUOA 3A03A 2XPWA 3IHUA 3K70C 1X1DA 2DCEA 4YFNF 3PUFA 1VQNI 5IT9K 5CQEA 1QZZA 1TWAJ 2BW3B 2QGUA 3M3YJ 3MEXA 2TCTA 2R7OA 3OYDA 4XK4A 1SFOJ 4KN7X 3BROA 5E8GA 2RREA 4QWQA 2OPTA 3HOXJ 4KICA 3ZRGA 1Y0UA 2HYGD 3DPUA 1MMAA 5GADJ 4A3GJ 1WVRA 4DOZA 3PNTA 1OCZH 5JVGF 1OKRA 2E34A 4O5VA 2XAUA 4LLGF 1B9NA 3MCZA 4HX8A 5CVRA 2H8WA 2HPMA 1RUNA 3A02A 2MLKA 5K7HA 4W1UA 2M5WA 4AC0A 2R7UA 2ZJPF 2LVSA 1T98A 2M7AA 4HPQA 3S1RJ 3PO2J 5LEJA 2R7RA 3VYTB 2ISZA 4FQGA 4BKXA 2P7CB 1FZPB 2DMNA 2NXNB 4J19A 4XLPF 1I39A 1B72A 5IPAA 3K70D 2G0EA 1HC8A 4J00A 5LD2C 1ERDA 3DBHB 1KU9A 1X4OA 1HBXG 4LG0B 4A0XA 3F9KA 1QO0D 5ERIA 1JXSA 2BYVE 4P5OA 2ME0A 4RLFA 4DNCA 1TL8A 2DOEA 1KU2A 1AKHA 2LBFB 2GA2A 4ZJZA 1TBXA 1GV2A 2H1KA 3OWTA 2V4JC 3BR0A 5FO5A 3W6VA 4M3GA 3W6JB 3JRDA 3J80K 3FBNB 1R00A 1O3TA 2QBYB 1Y0NA 2ECCA 1BR1A 5E1WA 3PL8A 3T5XA 1JI8A 3BJ6A 3CF2A 3ELKA 4CCLA 5D8LB 3BP8A 4JBAA 1F4KA 4ON0A 1USSA 1M1EB 5FFXA 2XDVA 4PDKA 4Y13A 3QYBA 4FETA 1KU3A 1JJ8C 3Q0UA 3CJQB 3EUAA 3FXMA 1LDJA 2X0LA 3Q9SA 3GZ6A 3M7GA 2KMUA 3E0JB 4FISA 3JREA 1U5TA 1RI7A 1TWHJ 2IPQX 4V2GA 3C2BA 2LD5A 2W57A 1VQMI 2XF5A 3H5NA 2LH9A 4A6EA 2HXOA 4D5CA 4IVNA 2ETHA 1VQ7I 1I3AA 2G7UA 1SANA 1B8IB 1HKQA 2DTRA 1B4AA 3CUQC 4AU7A 3JRCA 3H0GJ 4EEFG 5HS7A 3S3NA 2LKPA 4A3MJ 3GTOJ 3ABMH 1Z9CA 1JGGA 3GEZA 2K9QA 3CCRI 2DFFA 2R5YA 1B8IA 3VOEA 1OR7A 4HNVA 3HGYA 4M6VA 5FKKA 3DEWA 3W2AA 5J4YA 2XRLA 3RI4A 4A3IJ 4EM1A 2OV7A 2NOJB 3E6BA 2WB1A 1PYVA 2CMPA 4BEHB 4BBRJ 2EPFA 2VBZA 4UNOA 4C2UA 2CQNA 1SD5A 3WHCA 2OZ6A 3PSIA 2D2WA 3TO7A 3HKZA 2QYOA 3EPZA 3S93A 1A5JA 1A31A 1WJFA 3EETA 4B48A 3J7AO 2P8TA 4RLQA 5CLSA 3WGHA 1XMXA 2CQ7A 1P4XA 2HWVA 3N97A 5AIQA 2R7TA 1FYLA 3H5RA 3FKIJ 5E1XA 1L0OC 4RB2C 1ETKA 1YJWI 2BY2A 3KP2A 3CESA 1D8KA 1WJAA 4PJJA 1JT0A 5LHHA 3BG3A 4CHUA 1ZH5A 3QPTA 2EFWA 3IV5A 3C1DA 1G59A 3UNGC 4AUXA 1X3UA 3WHBA 4MFEA 4BQQA 5EG0A 1Z1DA 4FCYA 4LK1F 4OIOF 1RR7A 4OINF 1BR2A 1FSEA 2XRNA 2JUCA 3I5UA 1XDSA 3OYEA 1WJCA 5GP9A 1RKWA 1D5VA 2MH2A 1MNEA 2PJPA 2OA4A 5KVRA 4P9FA 3ZQ7A 3CDHA 4GDFA 2VKHA 1BBYA 2CH0A 3K69A 4MHGA 2XPVA 5H6QA 1WFXA 5K5RA 1A04A 5F0HA 4P96A 3SDGA 2H6BA 4G9YA 1XCBA
chains in the Genus database with same CATH topology
4PFOA 2E5ZA 2HPIA 2VL8A 1DGRM 2VJJA 4E7SA 2O5RA 3D5RC 3VSKA 3OY9A 1FMWA 4GRIA 1BOBA 1TZLA 3LSKA 3OYHA 2KRHA 4XKWA 1X19A 3BG7A 2L9NA 2DOAA 3K10A 4PJLA 2VXZA 3OYIA 3OYMA 4HG2A 1V5FA 3RSNA 3N05A 1Y56A 2K3PA 4F52A 4Y4RA 4DBQA 3CP8A 1D0ZA 3CJRB 2K9LA 4C9YA 3H0DA 2M4GA 3QOEA 4RM3A 2LBFA 3NWTA 2LRDA 2VKDA 2ZFUA 1AA7A 3D5LA 2PMZA 2MYSA 3PUBA 3TL4X 4IQJA 1LFPA 4YRVA 1MMNA 5FROA 2ZSIB 3DTEA 3DPLC 3ONQA 3GBGA 4C30A 3DQVC 5KNLA 3IAM2 3BCAA 3IAS2 2VQHA 4ZTFA 3LL7A 3OYNA 4BXFA 4C2TA 3KEYA 2ELJA 4XN0A 2CV1A 2WAFA 2IXSA 4XLHA 1MNDA 3AKZA 4CZCA 2R4GA 1E0EA 4BE2A 2VXDA 4G6TB 3W3CA 3K4BA 4CSWA 2A6TA 3LMMA 3DKXA 1D0XA 3SZGA 4E7IA 3EUKL 3L2UA 2LOOA 3LFUA 4X0GA 1R6RA 3IP4B 1D0YA 2X1DA 4D1QA 4XLFA 1LVKA 1V5GA 1X1BA 4XKBA 3OYFA 2Z16A 4IZZA 2P0WA 1PJRA 4XKCA 4F92B 2IGMA 2OUMA 2R7XA 4BACA 2Z2SB 4H4KC 4ZDOA 3SDBA 2JSPA 2WBMA 3QYEA 3M8JA 4FASD 2F5VA 2HQAA 3L2RA 4CA0A 1DP3A 2X1EA 3W2VA 4BQNA 5JHFA 4OAYA 2VQGA 2CW7A 4E7ZA 4JQFA 2VJIA 3RTRA 1NG6A 4R79A 4XR6A 2VQCA 3HL2A 2HVSA 1MMGA 1NG7A 4BE0A 2LG4A 2I8DA 2IGNA 4DJAA 1UELB 3ZCOA 2E1MB 3BCBA 1HA8A 2K5CA 1KONA 2QKLB 3VWBA 1U0JA 1S9HA 2AQFA 2IGOA 4BDZA 4Y33A 2BOLA 5TGTA 2X6XA 3D5SC 5KCMA 2W4SA 3BC8A 3M1CA 4NQWB 3HPGA 1OLTA 4CCNA 2M4KA 3OS1A 2F4IA 4Y3OA 5CKTA 4YEJA 3MKZA 1MMDA 3K4CA 3TMOA 2L9SA 1YX5A 3DTKA 2UWMA 3MKYB 3OYCA 2E1MC 4NNJA 3ZQQA 4KJZA 1SFKA 3DWLE 4F91B 4BU2A 3AL0C 1LKXA 2UUZA 2Z1DA 3SEQA 4BJ6C 3VYUB 3K6GA 2AQEA 3V42A 4AVZA 3OYKA 1X4PA 4EATA 3VSLA 2CUJA 4F93B 1DQUA 1Z3YA 2L7KA 3H9QA 2X85A 3HC7A 2X6YA 2HU9A 4KISA 4LG3A 3L2VA 3DU6A 3L2WA 2VIXA 2V26A 2L2OA 4XLEA 3HUGB 4HRIA 4NUBA 2L5QA 3S3MA 2WAEA 4BL0B 4PK4A 2VQLA 2CFOA 2CUZA 2M3AA 3OYJA 4PSWA 4J01A 4QPOA 1N77A 3EUHC 2MFZA 2KZVA 3KYLA 2BW3A 2CW8A 3LSMA 1W36C 3K4JA 4NC7A 4OWRB 3H5AA 4RMNA 1QHHD 2VLAA 2DT6A 4D9JA 4HNTA 4QPQA 2W1OA 4YELA 3UR3C 3VYRB 4KITB 2IGKA 4N4NB 3I9V2 2XF6A 1IRXA 3S3OA 1BR4A 4JOMA 4IX7A 2R7VA 3H9JA 3FKJA 2DT7B 4PUSA 4PJMA 2XC7A 2HZDA 2A5WA 1WJBA 4E7HA 3FBIB 4CCJA 1D1BA 1ZELA 3S8PA 4MLOA 4PFPA 3H35A 2R7QA 4XNFA 2JUGA 1W36D 4XORA 4BUPA 2MD0A 2QKMB 2VASA 1N78A 4E7LA 3H9GA 1T95A 4XQFA 2WAQA 2VB6A 2HVRA 4XONA 4BS9A 3ZR8X 2VJ4A 4XN3A 2CS3A 3OS2A 4F55A 2KQRA 3DPTA 4XLAA 2PJRB 4BJTA 4CH7A 4OAZA 3S32A 3ZGKA 3FHNA 2Q2EB 3PNVA 2KHMA 3DKYA 2Y0SA 2CV2A 1Y6IA 3KX2A 4E7JA 1SAUA 4BQOA 4E7KA 2UV1A 3K70C 1QHGA 1X1DA 2DCEA 5LFAA 2KLOA 5CQEA 1EA3A 2BW3B 3G2BA 4PSXA 3VYSB 3OR1C 2R7OA 4PJNA 3OYDA 1QU3A 2RREA 2IS6A 1WJEA 2W7NA 3RCOA 3ZRGA 3DPUA 2GOXB 1MMAA 4P1WA 4DOZA 2WA0A 3PNTA 2R7WA 2FUG2 3OYAA 5HNFA 4DBRA 2XAUA 4XM3A 2DXIA 4ZC3A 3QODA 2WADA 4KT6A 1D1AA 2HPMA 4LIVA 1YE9A 2RNGA 2CV0A 2JVGA 2X6WA 2R7UA 2M7AA 1WJ5A 3HXLA 4HPQA 1GLNA 4HNUA 1D1CA 2LY1A 3OYBA 2XSJC 2R7RA 3VYTB 3K70D 2E60A 3U21A 3HG9A 4DIQA 4J00A 5LD2C 1LDKB 1X4OA 4XMYA 4E6KG 1ERDA 3F9KA 1MW7A 4E4HA 3SYTA 4P5OA 4RLFA 2KP6A 3LSIA 2HNHA 2JA2A 3HPHA 3HOTA 2LBFB 4ZJZA 1G8XA 4U87A 4F3QA 1Z7LA 3OWTA 2V4JC 3CMMA 4XL9A 3FBNB 2MC4A 1X1AA 4ZDLA 4XLCA 1BR1A 3OL4A 3IUOA 3PL8A 3L2QA 1JI8A 3CF2A 4CCOA 4CCLA 2KDOA 2JVHA 3DU5A 3FDYA 4N4OB 2XDVA 3MKWB 1T0FC 3QYBA 3I3LA 4BE1A 4FETA 3DTIA 4ZYAA 5FRNA 3OR2C 3CJQB 3OS0A 2Q1ZB 3EUAA 2X51A 3OIQA 2VJ5A 2KMUA 1X1CA 3CP2A 3E0JB 3RPUD 3MMYB 4IKFA 2KRCA 1UG0A 3K4KA 3PFYA 1P9QC 4IQ4A 2XF5A 3H5NA 2LREA 2LH9A 3SEZA 4DGWB 5HNHA 3BG6A 5CQGA 3CZ6A 3TBIA 4CCKA 3PSFA 3J7AY 4HEA2 4AU7A 2BVMA 2ZSHB 4II3A 1WJDA 1UAAA 3OOUA 4AYBA 4NC8A 5HOOA 2DJIA 3S3NA 1YX3A 3OL3A 2W00A 4BDYA 3LSHA 4B3XA 3OYGA 5KHDA 1N75A 3A1YA 4XKVA 3PNYA 3LSGA 4ITVA 4II2A 2X1CA 3C2HA 3W2AA 2IS2A 2BVLA 4B47A 4ZDPA 2OV7A 2NOJB 2WB1A 1PYVA 3PJRA 1DGWY 2CMPA 1Z3XA 3AL0B 4BEHB 2IS1A 2V7FA 1VZ0A 2M0MA 5CPRB 1Z21A 4C2UA 3BLYA 5HVQC 3PSIA 4BEHA 3A2KA 3HKZA 3EPZA 3S93A 3QYFA 3E1SA 2XF7A 1TT0A 2HDWA 2KL4A 2LY2A 1WJFA 3OIPA 4HSTA 4XOPA 4B48A 4ZTJA 4BJ5C 4RLQA 4B44A 2V1NA 3DLAA 3MD2A 1J09A 4LITA 3AFHA 2R7TA 1K6YA 3H5RA 3ZXSA 4U7BA 2V6EA 3K4LA 4CUGA 3CESA 1WJAA 4PJJA 2E5NA 2WY8Q 2R7SA 1V5EA 2LYCA 2LC2A 1G59A 3UNGC 3RQ4A 4BQQA 2RQQA 2ZXHA 2V9KA 4HSRA 4LIUA 1FMVA 2W82A 5HLTA 1BR2A 3OYEA 3OYLA 2HVQA 2KPMA 2M7BA 1WJCA 4RM2A 1MNEA 2VKHA 3VDXA 2CH0A 2OC6A 3A4CA 3HOSA 2PJRA 1OR7C 3OMYA 5FRMA 3C2GA 2GOMA 3NWSA 2MABA 1WFXA 3K4NA 4ANJA 3W2WA 3DEEA 3K4MA 4B43A 2VPLA 2IS4A 2ZXIA 2WY7Q 4BGDA 4XOTA 4CCMA 2K9MA 2F6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI8 A;  3OR2 C;  2A5W A;  2V4J C;  1SAU A;  1YX3 A;  2XSJ C;  3OR1 C; 
#chains in the Genus database with same CATH topology
 1BW5 A;  4PFO A;  2E5Z A;  2PBI A;  2VL8 A;  5H20 A;  4YFX F;  5B1B H;  2QWW A;  3D5R C;  3OY9 A;  4HX4 A;  3R4K A;  5FKO A;  1O57 A;  3HM5 A;  2M0C A;  4RGR A;  1KGS A;  1BOB A;  5FLM J;  2KRH A;  4M3F A;  1Z05 A;  2OZU A;  1PUF A;  3BG7 A;  2KJB A;  2L9N A;  1TTY A;  2A6H F;  5FFZ A;  4EJW A;  3OYM A;  1V5F A;  3RSN A;  3CUQ A;  1XC5 A;  4PGH A;  5KK1 A;  3S2W A;  3CDL A;  2HKO A;  1LVA A;  1U5T C;  5L3C A;  3WGG A;  4IHV A;  4FTH A;  2K3P A;  4F52 A;  3LFK A;  2IJL A;  4LMY A;  4DBQ A;  2ZCW A;  4L5E A;  4D7N A;  1IG7 A;  1LDD A;  4NB5 A;  2LRD A;  4G6D A;  3KP5 A;  4UVB A;  2DQR A;  3CTA A;  2DJN A;  3K2Z A;  2E2J J;  1R1U A;  1LFP A;  1H0M A;  2NAZ A;  4AWX B;  1GDT A;  3W6K B;  2A69 F;  3K2A A;  5CJ9 A;  5JR3 A;  1W7P A;  3EUH A;  4BXF A;  5IYC J;  3OYN A;  5E18 F;  3CJT B;  3KEY A;  2DN0 A;  1FOK A;  4OIR F;  2CV1 A;  2IXS A;  3O2P E;  1MND A;  1E0E A;  2R4G A;  4KIG A;  3VB2 A;  4BE2 A;  3BZK A;  4UVA A;  4G6T B;  3M9A A;  3W3C A;  2DU9 A;  3K4B A;  3LA3 A;  4Q5S F;  3BQZ A;  4MFD A;  1ZGW A;  1D0X A;  1XGN A;  3SZG A;  4G7H F;  5HOD A;  4L0Y B;  4A3F J;  4P9U A;  5IP6 A;  2L9R A;  4C3J J;  4MQ9 F;  3VPR A;  2VKV A;  3G6E I;  4WWC A;  1G3W A;  2Y9Y A;  3OYF A;  4HF0 A;  1PJR A;  5FB2 A;  2IGM A;  2HQ5 A;  1HF0 A;  2KFD A;  4BAC A;  2KT0 A;  2VOD A;  2JTV A;  1WHU A;  4H4K C;  3TKY A;  4ZDO A;  4MTD A;  5ICE A;  1LJ9 A;  3J81 Z;  3QYE A;  1Z77 A;  4Y7N J;  3HOU J;  3HHG A;  3BJA A;  3WTS C;  3W2V A;  4BQN A;  2NS8 A;  2DYS H;  4BY7 J;  2TRT A;  1K78 B;  4KNY A;  4FE7 A;  1UZC A;  4A3J J;  2KIS A;  3GFL A;  1IJW C;  3CME I;  3KPH A;  1HDP A;  1OCP A;  3F3X A;  5BQT A;  2LG4 A;  4BE0 A;  2CUF A;  3CMY A;  2QQ9 A;  2FBI A;  3VWB A;  2M30 A;  1VQ4 I;  4KUM A;  4BDZ A;  2E19 A;  5TGT A;  2X6X A;  3D5S C;  1XD7 A;  3JRF A;  3BC8 A;  3M1C A;  4NQW B;  3WTV C;  4DZJ A;  4AM3 A;  1Z6T A;  2DFI A;  4CCN A;  3OS1 A;  2F4I A;  5CKT A;  5DCF A;  3TMO A;  1QBJ A;  3FHZ A;  4CDG A;  2XAH A;  3KIO A;  3OYC A;  1G4D A;  3I64 A;  2RC4 A;  1SFK A;  3GFJ A;  4NBQ A;  2ZJ2 A;  3F22 A;  1K4T A;  2B9S A;  3VYU B;  5E79 C;  3F21 A;  2R93 J;  2O3F A;  2DT5 A;  3JAM Z;  2GXA A;  4EAT A;  4ENJ A;  4KIB A;  5EEA A;  1DQU A;  2L7K A;  2X85 A;  3KFW X;  2EFO A;  1U3E M;  1ZN2 A;  4QIW N;  4KIS A;  4LG3 A;  3BG5 A;  3SZP A;  1N25 A;  2VIX A;  2ZB9 A;  1X2N A;  2EZH A;  2K4J A;  2ZME A;  4HF1 A;  4WX9 A;  1E17 A;  1MIJ A;  3S3M A;  3CO7 C;  1K79 A;  2XAF A;  4LG0 A;  2LR8 A;  2A6E F;  1RZ4 A;  1T56 A;  3R60 A;  5B5E C;  3BR1 A;  1T6S A;  4QLC U;  4IOA F;  1N77 A;  3RPU A;  3VFZ A;  3EUH C;  3BZ6 A;  4V19 K;  1VQ9 I;  4GYI A;  1S7E A;  2EQR A;  2KIU A;  2P5V A;  4BXU A;  3KYL A;  2YUS A;  4L5J A;  3LSM A;  4MEY F;  1W36 C;  4A3C J;  3WU1 B;  3V7R A;  2CFX A;  2FMY A;  2GXG A;  3GLL A;  3H5A A;  4RMN A;  4RGX A;  3E6D A;  1IV6 A;  2VLA A;  3S2H J;  1FEX A;  3KYC B;  2Z33 A;  3GZ5 A;  3IH4 A;  2STW A;  4WF2 A;  3JSP A;  2L4M A;  2V1D A;  2NOG A;  2K4B A;  2FJ1 A;  1BR4 A;  2HXI A;  2R7V A;  3H9J A;  4PJM A;  4PUS A;  4E7H A;  1LNW A;  3FBI B;  3I59 A;  3S15 J;  4HV6 A;  2EFP A;  4M6X A;  1JJ6 C;  1OCC H;  3H35 A;  4XNF A;  2DOD A;  2XB5 A;  1K7A A;  2H6C A;  2VN2 A;  1O3S A;  2ZO4 A;  1Y1W J;  1SC7 A;  3RYR A;  2DW4 A;  3GME A;  1OIS A;  1VQL I;  2DDB A;  4XON A;  4BS9 A;  1UG2 A;  4GFB A;  2HR3 A;  4AIK A;  4BJT A;  4OAZ A;  4CYD A;  2EB7 A;  2LK2 A;  3ZMD A;  2DA3 A;  3BR5 A;  1YJN I;  2A07 F;  1UHW A;  2L4A A;  4EJO A;  3DBL B;  1OMI A;  4BQO A;  4U7D A;  4JP0 A;  3WTZ A;  1S3J A;  3EYY A;  3HOW J;  4RB0 A;  4KDP A;  4KMF A;  3KZZ A;  2G7H A;  1VQ5 I;  3PQK A;  4PJN A;  4I7H A;  3ABU A;  2ESH A;  4QTR A;  1T8I A;  1QU3 A;  3HZJ A;  2K27 A;  3RJP A;  3LSR A;  5DM7 F;  2LDU A;  2W24 A;  2D45 A;  4CZZ A;  5TJJ A;  2BY0 A;  2BHY A;  2IAI A;  1BM9 A;  1QVU A;  3FM3 A;  3FXK A;  3L7W A;  2JJ7 A;  4LK0 F;  3QWL A;  4FE4 A;  1Y39 A;  2FUG 2;  3O8H A;  2FRH A;  3R0A A;  5F64 A;  1WKM A;  2B7E A;  2DO7 A;  1OYY A;  1T08 B;  4KT6 A;  2WAD A;  3FK7 A;  5E1Z B;  3HTU A;  4HBL A;  3BR3 A;  2E1N A;  1P7J A;  1OYI A;  2JVG A;  2X6W A;  1B59 A;  1KYZ A;  2F5D A;  3QPH A;  1MJA A;  1GLN A;  1YG2 A;  1R58 A;  2DFH A;  4XSX F;  1IW7 F;  3HOV J;  1XX5 A;  4YIR X;  3HSE A;  3QQA A;  4NC6 A;  2E60 A;  3U21 A;  2CGP A;  3M07 A;  3ASO H;  4ZYD A;  1LDK B;  1IXR C;  4IRG A;  4FT8 A;  1MW7 A;  4E4H A;  1PP7 U;  1FBS A;  3LNQ A;  1FYK A;  2P6T A;  3H92 A;  4XID A;  1ETV A;  1G8X A;  5BMZ A;  3FIS A;  2L54 A;  5B1A H;  2DMT A;  4XL9 A;  4ENN A;  3KET A;  3V8L A;  2EA4 A;  2R5Z B;  3FXR A;  4ETS A;  2QQ8 A;  4CGZ A;  3QOP A;  1J75 A;  1YS7 A;  5BS6 A;  1U6G A;  3L2Q A;  2L7F P;  2OF7 A;  2DFE A;  1WH5 A;  2R3S A;  4OOI A;  1Y8R B;  4U0V A;  5D5X B;  1JKP C;  3GTP J;  2O03 A;  2DA5 A;  1S6L A;  2DK8 A;  3DU5 A;  3RKW A;  4H0E A;  4NQW A;  2A3S A;  5M3M J;  5E8I A;  1FYM A;  4PCQ A;  1T0F C;  3OR2 C;  5ICG A;  5GAG J;  3LAJ A;  3OIQ A;  4BHP A;  2VJ5 A;  4HOB A;  4CIC A;  1X1C A;  2MSY A;  3RPU D;  2EFN A;  2YX7 A;  3MMY B;  1O7L A;  1YFH A;  5D4R A;  2IT0 A;  1HQC A;  3K4K A;  2Y31 A;  2EV5 A;  2NNN A;  1O3R A;  1P9Q C;  1FX7 A;  4DGW B;  5LLQ A;  5D5U B;  3MVP A;  2ELH A;  4IXA A;  1JGS A;  1NK3 P;  3HYI A;  3TBI A;  4K2E A;  4RAF A;  1K6O A;  2QBY A;  3J7A Y;  3P9I A;  2EBI A;  2ZSH B;  1P2F A;  1WJD A;  4II3 A;  2QEN A;  2FBK A;  4V2F A;  1YX3 A;  1K4S A;  4X6A J;  4OMZ A;  5C4J J;  2OJE D;  4UUS B;  1EKE A;  1H88 C;  4D7M A;  4HF2 A;  1OFC X;  4BDY A;  1IDY A;  2PMH A;  3ESW B;  3LSH A;  4B3X A;  5KHD A;  2RQP A;  3LST A;  2HOE A;  5DUK A;  1N75 A;  5E3M A;  3CC2 I;  3CD6 I;  3SJM A;  3IH3 A;  4EVI A;  2X1C A;  3C2H A;  2BVL A;  2LFB A;  2ID6 A;  2PQ8 A;  1J59 A;  2DA7 A;  1X3W B;  5AON A;  4MEX F;  2VBX A;  3ULQ B;  3AL0 B;  3BJO A;  1V3F A;  3K1N A;  2IS1 A;  3I53 A;  4P55 A;  2A61 A;  2FSW A;  2M34 A;  2HGC A;  3A2K A;  1QRY A;  3E1S A;  1TT0 A;  1H9G A;  3V8J A;  2JRT A;  3A01 B;  2FU4 A;  4BJ5 C;  4QSH A;  3MD2 A;  1F43 A;  2KIF A;  2YS9 A;  1W5C C;  1XTA A;  2TDX A;  1K6Y A;  3RKY A;  2MW8 A;  2V6E A;  1YHQ I;  3KYD B;  4CUG A;  2R7S A;  2E5N A;  2WY8 Q;  2IA2 A;  5C4X J;  5EZG A;  1T0F A;  3GYH X;  2R92 J;  1Q1V A;  5FKL A;  3RQ4 A;  4HLX A;  3ZMT A;  1MBF A;  2ZXH A;  2V9K A;  2DTZ A;  2DPU A;  2VBY A;  4HSR A;  2P5K A;  1BW6 A;  2M8G X;  2H09 A;  4LIU A;  3NQO A;  3Q0V A;  5ED4 A;  4KIF A;  2M7B A;  3H36 A;  3HRT A;  3ZMS A;  4U0Y A;  1C0W A;  4F7Z A;  1MH4 A;  2OC6 A;  3A4C A;  4ABZ A;  3CC7 I;  5FRM A;  2BV6 A;  5K1Y A;  3W2W A;  2R0Q C;  3ZMZ A;  3K4M A;  2WY7 Q;  4BGD A;  4XOT A;  3MFK A;  2K9M A;  1SVL A;  2JSC A;  2HPI A;  1PUF B;  1DGR M;  1K61 A;  1BC7 C;  2JA5 J;  3H3Z A;  4G8X A;  3AG4 H;  4GRI A;  1W0T A;  2IBD A;  4EQQ A;  2O0Y A;  1SVM A;  1TNS A;  4XKW A;  1JKQ C;  2RVC A;  1X19 A;  3QAH A;  5BNG A;  5CVV A;  5DV5 A;  2QM3 A;  4HX7 A;  1FY7 A;  3F8N A;  4YIF A;  2IRF G;  4N0B A;  1S72 I;  1AOY A;  2QQA A;  1Y56 A;  5DDG A;  3E5X A;  4G94 A;  4Y4R A;  3RZD J;  3F72 A;  5K5Q A;  3GTQ J;  2K9L A;  3H0D A;  3QOE A;  2DK5 A;  4A3B J;  4JK1 X;  2PMZ A;  2WAQ N;  1GXP A;  3A0B C;  3PUB A;  5FRO A;  3DPL C;  1LE8 B;  1JE8 A;  3GBG A;  1ON1 A;  3T8T A;  3WG9 A;  2FNA A;  1FOY A;  3DQV C;  5KNL A;  2F5E A;  2LSO A;  1FTT A;  3PIP F;  3GW2 A;  3LL7 A;  1Q1H A;  3BT9 A;  3L2C A;  1G3S A;  2ZBK A;  2ELJ A;  5TIS C;  4IEJ A;  1UFM A;  4XN0 A;  1U5T B;  2X9D A;  3AKZ A;  3Q9V A;  3OIO A;  4CSW A;  1LE8 A;  3KLO A;  3R61 A;  3DKX A;  1I1G A;  1XGO A;  4A3L J;  2ICW G;  5DYM A;  2O6G E;  1WRJ A;  4LIV A;  1XGS A;  1FJL A;  1QA6 A;  3EUK L;  5M3F J;  3DEU A;  4UUS A;  2EZI A;  4X0G A;  3LA7 A;  2KIQ A;  2Y2Z A;  4ESB A;  5JHU A;  1ZTR A;  1D0Y A;  4D1Q A;  2IA1 A;  1LVK A;  1UCR A;  1V5G A;  2BBY A;  3GXO A;  4XLF A;  1X1B A;  2E71 A;  1YI2 I;  2XHK A;  2Z16 A;  4IZZ A;  1RKT A;  2MH9 A;  4RAY A;  4M9S A;  2V9P A;  3HEF A;  4HLY A;  2O8X A;  2Z2S B;  3KE2 A;  2UZK A;  5CVI A;  5EYR A;  1H9T A;  4WXC A;  4CO8 A;  2HQA A;  3SQN A;  1R4M B;  2JPB A;  2NYX A;  1BI3 A;  2ME6 A;  3L00 A;  1RR8 C;  1E2X A;  1KQ0 A;  2FD5 A;  1CGP A;  4JX6 A;  2I8D A;  4DJA A;  1UEL B;  3ZCO A;  1R23 A;  2ZJR F;  4S0H B;  3JTH A;  2H94 A;  1DDN A;  2QKL B;  4D5F A;  4Y33 A;  1ZGJ A;  5DTD A;  4I99 C;  2RNJ A;  2FNP A;  5D8K B;  5JFR A;  4OIP F;  1ZG5 A;  2Y9Z A;  3TGN A;  1OLT A;  5LHG A;  2M4K A;  3MQ0 A;  4LGW A;  4HV5 A;  3MKZ A;  2L9S A;  3BDD A;  1YX5 A;  2XGE A;  1G3T A;  1S29 A;  2UWM A;  3FIW A;  1FOW A;  2E1O A;  4KJZ A;  3PM1 A;  3KZY A;  1PVE A;  4BU2 A;  2BXY A;  2UUZ A;  4M3D A;  2Z1D A;  1ZRC A;  2MBF A;  1YW7 A;  3F0C A;  1ZRF A;  1TWG J;  4AVZ A;  3ASN H;  4JYK A;  1X4P A;  1XSV A;  3IC7 A;  1XG1 A;  4I0A A;  1R4N B;  1VQK I;  1KQ8 A;  1P7I A;  4LFU A;  1DU0 A;  3COA C;  4UUV A;  3B6A A;  5J1R A;  1U78 A;  1IDZ A;  5F27 A;  1ON2 A;  4EJU A;  5D4S A;  3DLL F;  2H27 A;  3U2R A;  2M2E A;  2X6Y A;  2XAS A;  4ENM A;  4XLN F;  3L2W A;  4HRI A;  2HOA A;  1J5Y A;  2ISY A;  2V26 A;  4XLE A;  4NUB A;  3GWZ A;  2OCE A;  5DUI A;  4HAM A;  1ZG3 A;  1GHC A;  2OQR A;  1QZY A;  2XB0 X;  4PK4 A;  3BY6 A;  4N9I A;  1XN7 A;  2M3A A;  4PSW A;  3Q3S A;  2A68 F;  5IYD J;  1LB2 A;  1IUY A;  3K0L A;  2O8K A;  3OSF A;  2VT2 A;  5HLI A;  4ZZL A;  2NVU B;  1JTY A;  3ECO A;  2BW3 A;  2CW8 A;  2GIV A;  1NTC A;  2GAU A;  4HYE A;  2STT A;  1P6R A;  5L3F A;  5F04 A;  4D9J A;  1XSX A;  3UR3 C;  2W1O A;  2HDC A;  4FHT A;  4HQM A;  4ZYH A;  2GIZ A;  2KZG A;  3I9V 2;  1IRX A;  1ETO A;  2LF7 A;  3S3O A;  1LEB A;  3E5Q A;  4JOM A;  1SFE A;  3IWF A;  3FKJ A;  4EJV A;  3G1M A;  3FM5 A;  4GO1 A;  1EV7 A;  1WJB A;  2R7D A;  1G3Y A;  3HKZ N;  3HIF A;  2XKO A;  1APL C;  1ZEL A;  5K7F A;  3CMA I;  4PFP A;  3WTX C;  3U1D A;  4XOR A;  2FBH A;  3IWZ A;  1N78 A;  1IN7 A;  2VPR A;  2LF8 A;  3A0H C;  1T95 A;  3NEU A;  3M1E A;  5EGO A;  4A69 C;  2HVR A;  2V79 A;  2WTE A;  1WSU A;  1RIO H;  3NAU A;  3WE3 A;  2VJ4 A;  4XN3 A;  4Z6Y A;  4F55 A;  1B6A A;  1BN5 A;  2HTJ A;  3DPT A;  1W0U A;  2PJR B;  1HW5 A;  1Z91 A;  2X48 A;  3MZ8 A;  2QSF X;  3ZGK A;  4IHT A;  2FEZ A;  3WU2 C;  3X2Q H;  3QRF F;  1ZAO A;  3FZV A;  3DKY A;  2CV2 A;  2DAO A;  1J2X A;  4DZP A;  4I0B A;  1L3L A;  1FBQ A;  4C2M J;  4XIC A;  4BYY A;  5FLX Z;  1TT5 B;  1JUM A;  1RRJ A;  4RGU A;  2DOF A;  1ZRE A;  1I3Q J;  4RA2 A;  2UV1 A;  1QHG A;  3V7C A;  2R5Y B;  5IP7 J;  2KLO A;  2GA1 A;  2VC1 A;  1EA3 A;  3G2B A;  2N8G A;  4PSX A;  3OR1 C;  4LOC A;  3VYS B;  1MBK A;  1PP8 F;  1GUU A;  2Y69 H;  4M73 A;  1GT0 C;  3JCU C;  2ECB A;  1YRN B;  2IS6 A;  3AG3 H;  2XAJ A;  1WJE A;  2G9W A;  2W7N A;  1R49 A;  2CO5 A;  2ZKZ A;  1CQT A;  4PGG A;  3CCE I;  4G7O F;  1MD0 A;  5CVJ A;  2DI3 A;  2VE8 A;  4P1W A;  3OOP A;  2E36 A;  1V4R A;  4WK8 F;  2HKX A;  1IC8 A;  1MMS A;  3R0J A;  2M45 A;  2XAG A;  5LHI A;  3JSO A;  3OYA A;  4M9X A;  1TQP A;  1YO5 C;  4XM3 A;  2YX4 A;  4ZC3 A;  1D1A A;  2DA1 A;  5J40 A;  1VQ6 I;  1H8A C;  2RNG A;  1YE9 A;  4MNU A;  4XRF A;  2CQQ A;  2HZT A;  3JRI A;  3CCJ I;  3AAF A;  4AID A;  4HNU A;  1VND A;  2LY1 A;  2NVQ J;  4YG2 F;  3OYB A;  2L01 A;  2XSJ C;  2P6S A;  1LPQ A;  2ADU A;  4IL6 C;  3HJE A;  3WOD F;  4EJT A;  3HG9 A;  4BXX J;  1MNM C;  4XMY A;  4E6K G;  5IOY A;  2DMU A;  3SYT A;  4B1R A;  5F6F A;  1SFU A;  2FE3 A;  2L0K A;  5LRS A;  2CRG A;  4RGS A;  4RBO A;  2K02 A;  5ICF A;  1VQ8 I;  5EEH A;  4A5M A;  2M87 A;  1MH3 A;  1J9I A;  3E7L A;  1Z7L A;  3CMM A;  3HRM A;  3S1Q J;  2MC4 A;  3R6S A;  1WGX A;  1X1A A;  2Z5U A;  3I54 A;  4A2U A;  1NK2 P;  4ZDL A;  4XLC A;  5JI6 A;  2XSD C;  1FC3 A;  4X1E A;  1UHS A;  2PLY A;  1WH7 A;  3D1N I;  5J8C A;  1OJL A;  1Z67 A;  1DPR A;  2K9S A;  2JVH A;  4A6D A;  3CCY A;  1Y1V J;  3FDY A;  4N4O B;  1BOA A;  2HOS A;  1ONV A;  2AS5 F;  3SFI A;  2XAQ A;  2KKO A;  1HXD A;  2OAZ A;  3ECH A;  4BE1 A;  2B63 J;  3C7J A;  2QQB A;  4ZYA A;  1FIA A;  2BXZ A;  3GO5 A;  1BJA A;  2Q1Z B;  2XGD A;  2PX9 A;  3NAR A;  2X51 A;  3KZI C;  1TQI A;  1BIA A;  3KLN A;  1V54 H;  1IRF A;  3CP2 A;  2ID3 A;  4Q4Z F;  5E17 F;  4IKF A;  5L3G A;  1KZH A;  1TWC J;  1UG0 A;  1I1S A;  4CYC B;  4GYG A;  4IO9 F;  3PFY A;  5HDG A;  4Z2Y A;  1KYW A;  1F9N A;  2LRE A;  3SEZ A;  4HW0 A;  5HNH A;  4L9T A;  3IL2 A;  2XVC A;  3GCM A;  4EV0 A;  2CU7 A;  4CCK A;  2IW5 A;  4R8H A;  1BI0 A;  1TC3 C;  2BVM A;  3G4S I;  1UAA A;  3OOU A;  3HSF A;  4NC8 A;  4A93 J;  5IYB J;  5HOO A;  3F23 A;  2DJI A;  3OL3 A;  4EGZ A;  2PFB A;  2W00 A;  2WV1 A;  4IRH A;  3OYG A;  2Z9O A;  3HHH A;  1F36 A;  2QF7 A;  1CF7 B;  1RET A;  3ZQL A;  1POG A;  3A1Y A;  1R71 A;  3LSG A;  3MAJ A;  2XKP A;  4ITV A;  4BBS J;  2IS2 A;  1XMK A;  4L9N A;  4I98 B;  4ZDP A;  2AXT C;  4B3A A;  3PQJ A;  4DQ2 A;  1DGW Y;  4JX4 A;  4KYW A;  1IUF A;  2D5V A;  4LJZ F;  2XGC A;  2V7F A;  1TW2 A;  1VZ0 A;  3F8M A;  2HS5 A;  4UV9 A;  5J3L A;  2E1C A;  1W5T A;  3C3W A;  4IHW A;  4Y52 J;  3GFI A;  3FX3 A;  1RC9 A;  3BLY A;  2OTL I;  1ZLK A;  1XSD A;  3I4M J;  4G6Q A;  2VUM J;  3ZP5 A;  4ESF A;  2WC2 A;  3QYF A;  4HDU A;  2HDW A;  2DQL A;  2CWE A;  4C3I J;  3TW7 A;  1GVJ A;  4GXO A;  1U9O A;  4RDU A;  5C44 J;  3T8R A;  2V1N A;  4B44 A;  1TW3 A;  3DLA A;  3HUG A;  3AFH A;  2ZXW H;  4UB6 C;  5LRR A;  2PEX A;  3ZXS A;  4U7B A;  2VBW A;  1IXC A;  4G7Z F;  2QUF A;  5FLV A;  2Q8K A;  3WU0 A;  1FNN A;  2X6O A;  1V5E A;  2LC2 A;  2E35 A;  2MA3 A;  3T0Y A;  1DUX C;  1X3Z B;  3WTT C;  5FKN A;  2AHQ A;  3D0S A;  3P9K A;  1FMV A;  1BI1 A;  1IZ1 A;  2UXX A;  1LEA A;  3U9G A;  2HVQ A;  1P92 A;  1UMQ A;  2KPM A;  1EH8 A;  5JVT A;  1B1B A;  1Z6R A;  3RKQ A;  5IT3 A;  1XDU A;  1SEU A;  3LAP A;  1O7F A;  3VDX A;  2EFQ A;  3TO9 A;  1MSE C;  3HOS A;  2PJR A;  2CJJ A;  2B0L A;  3G71 I;  3C2G A;  3ERM A;  2OCC H;  2EA2 A;  1RPW A;  2GOM A;  2L7M P;  4ANJ A;  1ZAR A;  3DEE A;  3A01 A;  3WG7 H;  5B66 C;  2VPL A;  1WCM J;  4MQV A;  1T39 A;  2LLK A;  3ABT A;  4CCM A;  5HS8 A;  5C3E J;  2JZY A;  1W5S A;  1R5I D;  3FMS A;  3MZY A;  3KP4 A;  4A0Z A;  1SMT A;  2VJJ A;  3RQI A;  5HLG A;  3VSK A;  1IV8 A;  1FMW A;  1TZL A;  3LSK A;  3OYH A;  2EZL A;  3IH2 A;  1H89 C;  5EJC A;  2EIN H;  3K10 A;  2GQQ A;  2VXZ A;  3OYI A;  2HFH A;  4HG2 A;  3I4N J;  3ZQH A;  1VFC A;  4O3M A;  3N05 A;  1YLF A;  3BTC A;  4S04 A;  5IY5 H;  3H3V K;  1IO2 A;  1MBE A;  2Q2E A;  5J1Y A;  1D0Z A;  3CJR B;  5LGT A;  1MBH A;  3FF5 A;  4C9Y A;  2M4G A;  3LQR A;  5M5X J;  3CJN A;  1MZB A;  3AG2 H;  3NWT A;  3PIO F;  1J0R A;  4UY8 I;  1AA7 A;  3HGG A;  3D5L A;  3BTI A;  1MBJ A;  3J7Z I;  2JT1 A;  3TL4 X;  4IQJ A;  3JR9 A;  4WXD A;  1MMN A;  2ZSI B;  3DTE A;  1AKH B;  3FXQ A;  3FXO A;  2E7X A;  2L9V A;  3BCA A;  3IAS 2;  1A6I A;  2VQH A;  3S2D J;  4ZTF A;  3G1L A;  1AU7 A;  2JMW A;  2COB A;  1MKM A;  2WAF A;  4M72 A;  1XGM A;  1SAX A;  4XRM A;  2F48 A;  4CZC A;  2GXB A;  3RPQ A;  3IRR A;  4BHC A;  2KDZ A;  4LB5 A;  2VXD A;  2M1B A;  3L09 A;  3GFM A;  1F1Z A;  1SD6 A;  1HW2 A;  2M9H A;  4E7I A;  5HDN A;  5EDN A;  4HZF A;  3L2U A;  3LFU A;  1R6R A;  5J6X A;  2EIJ H;  3IP4 B;  5J8F A;  1WI9 A;  2WV0 A;  4B8X A;  1ITY A;  2GZW A;  1YQA A;  4XKB A;  2F4M B;  3P5J A;  1SD4 A;  1AWC A;  4F92 B;  2OUM A;  5M5Y J;  2R7X A;  1A6Q A;  2QVO A;  2XPU A;  3I0T A;  5E3O A;  4OIQ F;  3I71 A;  2UXN A;  3TOB A;  3GTL J;  3RKX A;  2OTJ I;  2RV8 A;  2RGV A;  1IN5 A;  3SDB A;  1G6N A;  3CCL I;  3JTG A;  2RKH A;  2F5V A;  2P5L C;  5EGO B;  3L2R A;  2PN6 A;  3O3K A;  4CA0 A;  1V55 H;  3L9F A;  3CO6 C;  1DP3 A;  5FGM A;  4OAY A;  4AVP A;  5BPD A;  2QZ8 A;  1TWF J;  4M9Z A;  2HYF A;  3IKV A;  2CW7 A;  4E7Z A;  4JQF A;  4S05 A;  1NG6 A;  3HL2 A;  3KCC A;  1UHM A;  4XR6 A;  1W4M A;  2FOK A;  1NG7 A;  5H6R A;  2IGN A;  3B73 A;  3OSG A;  3ABL H;  2K5C A;  2Y0M A;  2NRA C;  1HA8 A;  1S7A A;  3HBL A;  1VF9 A;  1KON A;  2QLZ A;  2A5Y B;  2AQF A;  4ZH4 F;  2IGO A;  5FJ8 J;  5D6F A;  1BJZ A;  4UHT A;  5KCM A;  1RNL A;  2WB1 N;  1MJB A;  4FX4 A;  2V6C A;  2CQK A;  3J7Y J;  3CCQ I;  5BPI A;  2JQ7 A;  4YEJ A;  2M8E A;  3WE2 A;  1MMD A;  1OCT C;  3VOD A;  2IEK A;  3HTS B;  4IPA A;  1XCV A;  2VKE A;  3TO6 A;  3DTK A;  5B3S H;  4AIH A;  2NVX J;  3GTG J;  3MKY B;  2E1M C;  3ZQQ A;  4N9H A;  3DWL E;  2O7O A;  2DMP A;  3FXL A;  2O61 A;  1KQ9 A;  1A36 A;  2OU2 A;  1LKX A;  1QVT A;  1S5L C;  2K9N A;  5CVU A;  4IJA A;  3SEQ A;  4BJ6 C;  2CQX A;  3KP3 A;  1FP2 A;  5LGU A;  1YOV B;  1YW9 A;  1R36 A;  5DCM B;  3OYK A;  2BY3 A;  3S14 J;  1ETY A;  3S16 J;  3ZQF A;  1FP1 D;  2GLO A;  2AO9 A;  2FML A;  4BHB A;  1SMY F;  2JRM A;  1IN8 A;  2PMU A;  4LLN A;  3O8G A;  3ABK H;  3HC7 A;  2L7Z A;  3L2V A;  3DU6 A;  2JA6 J;  2L2O A;  1VQP I;  3HUG B;  1K83 J;  2L5Q A;  5GTI C;  1ZR2 A;  1OCR H;  3DBR B;  3JAM K;  3B02 A;  3BG9 A;  2WAE A;  4MO7 A;  4BL0 B;  3QU6 A;  3V4G A;  3ML6 A;  3GLX A;  1GV5 A;  2HI3 A;  4I01 A;  4DYR A;  4RS8 A;  2P81 A;  1UST A;  4QPO A;  4U0W A;  3BTL A;  5DS9 A;  5F0F A;  3RDI A;  1TQM A;  2MLG A;  2MFZ A;  1SFX A;  1YYV A;  2VON A;  2BGC A;  2E2I J;  2CSO A;  2ZXJ A;  3BOQ A;  3QP6 A;  5EF6 A;  2R5Z A;  3TQN A;  3GZN B;  2QSH X;  1YJ9 I;  2DT6 A;  4HNT A;  4QPQ A;  3TDU C;  2Q0O A;  1RUO A;  4M6Y A;  5F08 A;  3DXJ F;  1B72 B;  2QSG X;  1XPX A;  2Z99 A;  3WGI A;  3GVA A;  4DYC A;  3TED A;  2I5U A;  5A2Q Z;  2YU3 A;  5DD8 A;  4OU0 A;  2AXL A;  5ILU A;  2EIK H;  1LFB A;  4B4C A;  1VI0 A;  4WCG A;  3MZH A;  1XS9 A;  2DT7 B;  5IOZ A;  1FSH A;  2ZNZ A;  2HZD A;  3BR2 A;  2A5W A;  1W7P D;  4CCJ A;  4RB3 C;  4HQE A;  1JKO C;  4MLO A;  2XGX A;  3LSP A;  2V1X A;  1W36 D;  3P9C A;  4BUP A;  3CCM I;  1EJ9 A;  2FXA A;  2MD0 A;  2QKM B;  2VAS A;  3M8E A;  3H9G A;  2Z3Y A;  3I4P A;  4XRS A;  3P7N A;  1P4A A;  4XQF A;  3EYI A;  2VB6 A;  2Y0S N;  1I27 A;  1LUJ B;  5TRD A;  2R7F A;  4I02 A;  1X1P A;  3ZR8 X;  1WZ2 A;  4I6Z A;  3ZQC A;  3RYP A;  3WTY C;  1QNT A;  3OS2 A;  2KQR A;  5DM6 F;  4XLA A;  2GM4 A;  9ANT A;  4A12 A;  3TDZ C;  3FXJ A;  5D5W B;  3TOA A;  2MGQ A;  3PNV A;  4JX5 A;  1OYW A;  1XMA A;  2Y0S A;  3KX2 A;  4E7J A;  2VC0 A;  1Z0X A;  1ODD A;  2ZJQ F;  3E6M A;  4E7K A;  1CF7 A;  4Y17 A;  5LFA A;  2JA7 J;  3GTK J;  1MDM B;  2FQ3 A;  5E20 A;  1W1W E;  3GF2 A;  5M5W J;  3S17 J;  2I10 A;  1BIB A;  1OPC A;  3F8B A;  3RCO A;  1HKT A;  1UJ8 A;  2GOX B;  2MD5 A;  1RES A;  5FKM A;  3REO A;  2WA0 A;  2R7W A;  1GVD A;  2KJC A;  5HNF A;  1JUP A;  4DBR A;  2DXI A;  2DA4 A;  3QOD A;  4BQA A;  2KRF A;  2GBY A;  4OMY A;  1QPM A;  2K7L A;  5D5V B;  2CV0 A;  4IF4 A;  2PI0 A;  1WJ5 A;  5IT9 Z;  3HXL A;  4L18 B;  1D1C A;  3SXY A;  4WXH A;  3QPS A;  1HDD C;  1ZG1 A;  4RAG A;  3ROU A;  4DIQ A;  1E3O C;  4L9V A;  4DW6 A;  3LQQ A;  1OQY A;  3L1P A;  4I2O A;  3SFZ A;  2BHZ A;  3BPX A;  2KP6 A;  3LSI A;  3HPH A;  2HNH A;  2JA2 A;  3CLQ A;  3HOT A;  5F0C A;  1ZR4 A;  4U87 A;  5DEQ A;  4F3Q A;  3K7A J;  3BWG A;  1YRN A;  2BE5 F;  1ZK8 A;  3HRU A;  2QA4 I;  4KFC A;  1AHD P;  3O6B B;  3LSJ A;  3HB9 A;  3CCS I;  5D6E A;  1QGP A;  3TW6 A;  3OL4 A;  3IUO A;  1FTZ A;  2FA5 A;  4CCO A;  5CYV A;  1FIP A;  5DD4 A;  2KDO A;  3FXU A;  2J5P A;  1MGT A;  3ZQI A;  2K40 A;  5BOX A;  4BH9 A;  3G3Z A;  3MKW B;  1WWX A;  4XRS G;  3I3L A;  3DTI A;  5FRN A;  2OQG A;  2XV4 S;  3OS0 A;  1IRG A;  2YPR A;  2F2E A;  3N4M A;  1DPU A;  3V7S A;  3RZO J;  3NRV A;  1E3P A;  3ERE D;  1MSF C;  1R5H A;  3BPV A;  2XIG A;  2KRC A;  2HTS A;  2DA2 A;  1JHH A;  3K1M A;  3ZN0 A;  4AYB N;  2EV6 A;  4IQ4 A;  4HDV A;  1MBG A;  1HCR A;  3F8C A;  4YFK F;  2E2H J;  4ZYG A;  1HLV A;  3BG6 A;  5CQG A;  4PZJ A;  1X58 A;  3HDD A;  3CZ6 A;  3H1C A;  2LTP A;  3JRG A;  1ZHF A;  1TLH B;  3PSF A;  4HEA 2;  1J7K A;  3H3U A;  2F5F A;  4AYB A;  2W84 A;  1U2W A;  3E5U A;  4L9J A;  5GPA A;  1YS6 A;  3HRS A;  3V8K A;  2K86 A;  5FD6 A;  1IN4 A;  4XKV A;  3VEP A;  3CUQ B;  3PNY A;  2DPD A;  4II2 A;  4B47 A;  2HQN A;  2LKS A;  2MC3 A;  2W25 A;  2RDP A;  3PJR A;  5LBQ A;  1Z3X A;  1R22 A;  3GTJ J;  3HOZ J;  1XB4 A;  4KA4 A;  1JHF A;  3F8F A;  1D5Y A;  1WQ2 A;  2M0M A;  4UB8 C;  5CPR B;  1Z21 A;  3EQL F;  4ESJ A;  3E6C C;  1ACI A;  1QQI A;  4A5N A;  1P4W A;  2VT3 A;  1NHA A;  5GTH C;  5HVQ C;  4BEH A;  2ZME B;  2FF4 A;  2Y30 A;  3ZMU A;  2XF7 A;  3I59 B;  2LY2 A;  2KL4 A;  3OIP A;  4HST A;  2P4W A;  4XOP A;  4ZTJ A;  5F1R A;  2OBP A;  3ZMV A;  3K9T A;  5GPC A;  2YU9 J;  2NS7 A;  1J09 A;  4LIT A;  2MG4 A;  3K4L A;  3KP7 A;  2EIM H;  3ISP A;  1I6H J;  1ETQ A;  4AD9 A;  2Y75 A;  2LYC A;  2JK3 A;  1T2K A;  2FX0 A;  2D1H A;  2RQQ A;  1TNT A;  1ULY A;  4GCV A;  3I55 I;  3S1N J;  2LNB A;  1ZKG A;  2W82 A;  5HLT A;  4DYQ A;  1JKR C;  2H8R A;  3OYL A;  2RAE A;  2F4O B;  2VE9 A;  2LP0 A;  2ACJ A;  4RM2 A;  3PFI A;  3GTM J;  3CC4 I;  3LOC A;  4MIM A;  3WTU C;  1JTX A;  4CYC A;  2A05 A;  4IRI A;  1OR7 C;  3OMY A;  1U9N A;  5LGN A;  4AIJ A;  4BY1 J;  1I6X A;  2JWT A;  3NWS A;  1WPK A;  2MAB A;  3EDP A;  4M71 A;  3K4N A;  1R9T J;  1ZLJ A;  1T38 A;  2O9L A;  3IKT A;  1JUS A;  4B43 A;  2IS4 A;  4PJ0 C;  1BI2 A;  2ZXI A;  1STZ A;  2XUB A;  4IHS A;  3DKW A;  2F6C A;  3J80 Z;  1Z7U A;  4M74 A;  2L02 A;  1HW1 A;  4E7S A;  2FQ4 A;  2O5R A;  2XRO A;  2P7V B;  4HA8 A;  4W97 A;  4IHY A;  1HKS A;  3ZPL A;  4KT5 C;  5K5O A;  2DOA A;  2X4H A;  3T1B A;  2QCO A;  1IN6 A;  4PJL A;  2CW0 F;  3I56 I;  1ZRD A;  4LD5 A;  3GUD A;  3KEQ A;  2D1V A;  4RB1 A;  1ENH A;  3CP8 A;  3BTJ A;  4XBF A;  2W85 A;  1PDN C;  2NVY J;  2DYR H;  3FK6 A;  4RM3 A;  2HEO A;  2LBF A;  1GXQ A;  4KMU X;  4A3E J;  3BR6 A;  4EM2 A;  2VKD A;  1YW8 A;  2ZFU A;  3QU3 A;  3F6V A;  4D0P A;  2MYS A;  3Q0W A;  2EH3 A;  3U1K A;  1U8R A;  2JPC A;  4YRV A;  5L3D A;  2BY1 A;  2EZK A;  3ONQ A;  2CUE A;  2VI6 A;  1Y8Q B;  4C30 A;  2HQR A;  5HLH A;  3PO3 J;  2IA0 A;  3IAM 2;  5HDK A;  3CF5 F;  3QPL A;  4Q48 A;  4M3B A;  5L3E A;  1VTN C;  4C2T A;  4EMS A;  3Q5F A;  1EH7 A;  2DA6 A;  4XLH A;  4E70 A;  2PMZ N;  1IGN A;  1ETW A;  4KN4 X;  5K7Z A;  5GAH J;  1S7O A;  5J4V A;  2A6T A;  3LMM A;  2EJR A;  4IHX A;  2F5C A;  2GWR A;  3WTW C;  3OV8 A;  1R1T A;  1EH6 A;  5AIP A;  2CYY A;  4I76 A;  5IP9 J;  1LQ1 A;  2K85 A;  5E3L A;  2DBB A;  2DMQ A;  2LOO A;  3BZC A;  3ZOB A;  1ZYR F;  2X1D A;  1HST A;  1G2H A;  4R1H A;  1FBU A;  2P0W A;  4MGR A;  2R7Z J;  2CG4 A;  3DCF A;  4XKC A;  5KAI C;  2V1U A;  4NHJ A;  2HOT A;  4YII A;  5ILV A;  1O3Q A;  1E3H A;  3FMR A;  4O6J A;  1KA8 A;  4I09 A;  4A3K J;  3DP7 A;  1ORK A;  4L5I A;  4CXF A;  2DDA A;  4LLL A;  1HSJ A;  2JSP A;  2WBM A;  3M8J A;  3UKG A;  4FAS D;  4A3D J;  3JRH A;  2X1E A;  3LA2 A;  5JHF A;  1BA5 A;  3KP6 A;  2VQG A;  4U88 A;  3ZN1 A;  3MN2 A;  1T33 A;  3RTR A;  2VJI A;  2LY9 A;  4R79 A;  2HVS A;  2VQC A;  2WWY A;  1IXS B;  5J47 A;  1MMG A;  2NNY A;  3JRA A;  1BL0 A;  2YR2 A;  1KU7 A;  2E1M B;  3BCB A;  3LWF A;  5EZH A;  3G1O A;  1ZQ3 P;  2EIL H;  2LMD A;  3DFG A;  1U0J A;  2ZFW A;  1S9H A;  3QP5 A;  5LEK A;  2HYJ A;  1I50 J;  3M8F A;  2BOL A;  3JW4 A;  5A2Q K;  1BC8 C;  1QZE A;  4ZZD A;  4ZYE A;  2W4S A;  5GAE J;  3HPG A;  2ZNY A;  3KEO A;  1FT9 A;  2NS0 A;  1DP7 P;  1R1V A;  3J81 K;  3MKL A;  4Y3O A;  1NH3 A;  2W48 A;  3K4C A;  3SZT A;  2EWN A;  4UVC A;  3MWM A;  1FPQ A;  3FMQ A;  1MDM A;  3I58 A;  4NNJ A;  1FWZ A;  1REP C;  2NVT J;  2QEX I;  1SVO A;  4MTE A;  5JLX A;  3GX4 X;  1OCO H;  2KIM A;  4F91 B;  3AL0 C;  1QPI A;  2HDD A;  1DU6 A;  1F5T A;  2YSR A;  3E3V A;  3K1P A;  3K6G A;  2AQE A;  3V42 A;  5J1U A;  1YIT I;  5EG0 B;  4Y15 A;  3VSL A;  2EV0 A;  2CUJ A;  4F93 B;  4Q47 A;  3M4O J;  1Z3Y A;  3H9Q A;  4M3E A;  6PAX A;  4ENK A;  4RAZ A;  5HS9 A;  1YIJ I;  1HOM A;  3TP0 A;  2HU9 A;  1SD7 A;  1UB9 A;  2JN6 A;  2EK5 A;  3CQZ J;  4EGY A;  5F1J A;  2K3F A;  1YIO A;  2IP2 A;  3CCV I;  3DF8 A;  1JT6 A;  2VQL A;  3C18 A;  1K78 A;  2CFO A;  2CUZ A;  3OYJ A;  4J01 A;  2VOO A;  4XSZ F;  2PG4 A;  1IAW A;  3E97 A;  1R5G A;  3JRB A;  1YTY A;  2KZV A;  3ZQG A;  2JA8 J;  1X2M A;  5KAF C;  1S8N A;  3S1M J;  3K4J A;  4NC7 A;  5FD5 A;  2L3D A;  4UXN A;  5FLX K;  2FOW A;  2ELK A;  4OWR B;  2LKX A;  5E3N A;  1QHH D;  2OD5 A;  4B09 A;  4NDL A;  1VQO I;  4C3H J;  4YEL A;  3VYR B;  4KIT B;  5ICC A;  3G73 A;  2IGK A;  4A0Y A;  4N4N B;  3HSR A;  5H2F C;  1B9M A;  3FWE A;  4ASN A;  5JLW A;  2ZC2 A;  1I5Z A;  2XF6 A;  3HOY J;  1LFU P;  2ZME C;  2IVM A;  2COM A;  2DLL A;  3CLO A;  4IX7 A;  3AG1 H;  2XC7 A;  3CCU I;  1PUE E;  5ILS A;  5EEG A;  1D8J A;  1D1B A;  1R7J A;  3S8P A;  4UV8 A;  4BAY A;  1A35 A;  1FLI A;  2BEO A;  1ETX A;  1WI3 A;  2JUG A;  2R7Q A;  4G12 A;  1TP4 A;  3F6O A;  1IF1 A;  4E7L A;  4L0Z B;  2J5O A;  2BZT A;  2ESN A;  2WAQ A;  4IOC F;  2C6Y A;  4FX0 A;  2E7W A;  2V9V A;  3CDI A;  4TV7 A;  3IRQ A;  1W7P B;  2Y48 A;  5L3B A;  4LB6 B;  4GGG A;  3SHF A;  4EM0 B;  2CS3 A;  1MJ9 A;  3TP3 A;  4UUT A;  4BNC A;  3BQY A;  1O4X A;  2VOP A;  2RN7 A;  3B6C A;  4CH7 A;  3DV8 A;  2H1L A;  3S32 A;  3RIR A;  3FHN A;  1D3Y A;  2Q2E B;  5DCM A;  1EF4 A;  2KHM A;  1Y6I A;  1FOX A;  1IRZ A;  1U8B A;  1SAU A;  1ZGA A;  3CUO A;  3A03 A;  2XPW A;  3IHU A;  3K70 C;  1X1D A;  2DCE A;  4YFN F;  3PUF A;  1VQN I;  5IT9 K;  5CQE A;  1QZZ A;  1TWA J;  2BW3 B;  2QGU A;  3M3Y J;  3MEX A;  2TCT A;  2R7O A;  3OYD A;  4XK4 A;  1SFO J;  4KN7 X;  3BRO A;  5E8G A;  2RRE A;  4QWQ A;  2OPT A;  3HOX J;  4KIC A;  3ZRG A;  1Y0U A;  2HYG D;  3DPU A;  1MMA A;  5GAD J;  4A3G J;  1WVR A;  4DOZ A;  3PNT A;  1OCZ H;  5JVG F;  1OKR A;  2E34 A;  4O5V A;  2XAU A;  4LLG F;  1B9N A;  3MCZ A;  4HX8 A;  5CVR A;  2H8W A;  2HPM A;  1RUN A;  3A02 A;  2MLK A;  5K7H A;  4W1U A;  2M5W A;  4AC0 A;  2R7U A;  2ZJP F;  2LVS A;  1T98 A;  2M7A A;  4HPQ A;  3S1R J;  3PO2 J;  5LEJ A;  2R7R A;  3VYT B;  2ISZ A;  4FQG A;  4BKX A;  2P7C B;  1FZP B;  2DMN A;  2NXN B;  4J19 A;  4XLP F;  1I39 A;  1B72 A;  5IPA A;  3K70 D;  2G0E A;  1HC8 A;  4J00 A;  5LD2 C;  1ERD A;  3DBH B;  1KU9 A;  1X4O A;  1HBX G;  4LG0 B;  4A0X A;  3F9K A;  1QO0 D;  5ERI A;  1JXS A;  2BYV E;  4P5O A;  2ME0 A;  4RLF A;  4DNC A;  1TL8 A;  2DOE A;  1KU2 A;  1AKH A;  2LBF B;  2GA2 A;  4ZJZ A;  1TBX A;  1GV2 A;  2H1K A;  3OWT A;  2V4J C;  3BR0 A;  5FO5 A;  3W6V A;  4M3G A;  3W6J B;  3JRD A;  3J80 K;  3FBN B;  1R00 A;  1O3T A;  2QBY B;  1Y0N A;  2ECC A;  1BR1 A;  5E1W A;  3PL8 A;  3T5X A;  1JI8 A;  3BJ6 A;  3CF2 A;  3ELK A;  4CCL A;  5D8L B;  3BP8 A;  4JBA A;  1F4K A;  4ON0 A;  1USS A;  1M1E B;  5FFX A;  2XDV A;  4PDK A;  4Y13 A;  3QYB A;  4FET A;  1KU3 A;  1JJ8 C;  3Q0U A;  3CJQ B;  3EUA A;  3FXM A;  1LDJ A;  2X0L A;  3Q9S A;  3GZ6 A;  3M7G A;  2KMU A;  3E0J B;  4FIS A;  3JRE A;  1U5T A;  1RI7 A;  1TWH J;  2IPQ X;  4V2G A;  3C2B A;  2LD5 A;  2W57 A;  1VQM I;  2XF5 A;  3H5N A;  2LH9 A;  4A6E A;  2HXO A;  4D5C A;  4IVN A;  2ETH A;  1VQ7 I;  1I3A A;  2G7U A;  1SAN A;  1B8I B;  1HKQ A;  2DTR A;  1B4A A;  3CUQ C;  4AU7 A;  3JRC A;  3H0G J;  4EEF G;  5HS7 A;  3S3N A;  2LKP A;  4A3M J;  3GTO J;  3ABM H;  1Z9C A;  1JGG A;  3GEZ A;  2K9Q A;  3CCR I;  2DFF A;  2R5Y A;  1B8I A;  3VOE A;  1OR7 A;  4HNV A;  3HGY A;  4M6V A;  5FKK A;  3DEW A;  3W2A A;  5J4Y A;  2XRL A;  3RI4 A;  4A3I J;  4EM1 A;  2OV7 A;  2NOJ B;  3E6B A;  2WB1 A;  1PYV A;  2CMP A;  4BEH B;  4BBR J;  2EPF A;  2VBZ A;  4UNO A;  4C2U A;  2CQN A;  1SD5 A;  3WHC A;  2OZ6 A;  3PSI A;  2D2W A;  3TO7 A;  3HKZ A;  2QYO A;  3EPZ A;  3S93 A;  1A5J A;  1A31 A;  1WJF A;  3EET A;  4B48 A;  3J7A O;  2P8T A;  4RLQ A;  5CLS A;  3WGH A;  1XMX A;  2CQ7 A;  1P4X A;  2HWV A;  3N97 A;  5AIQ A;  2R7T A;  1FYL A;  3H5R A;  3FKI J;  5E1X A;  1L0O C;  4RB2 C;  1ETK A;  1YJW I;  2BY2 A;  3KP2 A;  3CES A;  1D8K A;  1WJA A;  4PJJ A;  1JT0 A;  5LHH A;  3BG3 A;  4CHU A;  1ZH5 A;  3QPT A;  2EFW A;  3IV5 A;  3C1D A;  1G59 A;  3UNG C;  4AUX A;  1X3U A;  3WHB A;  4MFE A;  4BQQ A;  5EG0 A;  1Z1D A;  4FCY A;  4LK1 F;  4OIO F;  1RR7 A;  4OIN F;  1BR2 A;  1FSE A;  2XRN A;  2JUC A;  3I5U A;  1XDS A;  3OYE A;  1WJC A;  5GP9 A;  1RKW A;  1D5V A;  2MH2 A;  1MNE A;  2PJP A;  2OA4 A;  5KVR A;  4P9F A;  3ZQ7 A;  3CDH A;  4GDF A;  2VKH A;  1BBY A;  2CH0 A;  3K69 A;  4MHG A;  2XPV A;  5H6Q A;  1WFX A;  5K5R A;  1A04 A;  5F0H A;  4P96 A;  3SDG A;  2H6B A;  4G9Y A;  1XCB A; 
#chains in the Genus database with same CATH homology
 4PFO A;  2E5Z A;  2HPI A;  2VL8 A;  1DGR M;  2VJJ A;  4E7S A;  2O5R A;  3D5R C;  3VSK A;  3OY9 A;  1FMW A;  4GRI A;  1BOB A;  1TZL A;  3LSK A;  3OYH A;  2KRH A;  4XKW A;  1X19 A;  3BG7 A;  2L9N A;  2DOA A;  3K10 A;  4PJL A;  2VXZ A;  3OYI A;  3OYM A;  4HG2 A;  1V5F A;  3RSN A;  3N05 A;  1Y56 A;  2K3P A;  4F52 A;  4Y4R A;  4DBQ A;  3CP8 A;  1D0Z A;  3CJR B;  2K9L A;  4C9Y A;  3H0D A;  2M4G A;  3QOE A;  4RM3 A;  2LBF A;  3NWT A;  2LRD A;  2VKD A;  2ZFU A;  1AA7 A;  3D5L A;  2PMZ A;  2MYS A;  3PUB A;  3TL4 X;  4IQJ A;  1LFP A;  4YRV A;  1MMN A;  5FRO A;  2ZSI B;  3DTE A;  3DPL C;  3ONQ A;  3GBG A;  4C30 A;  3DQV C;  5KNL A;  3IAM 2;  3BCA A;  3IAS 2;  2VQH A;  4ZTF A;  3LL7 A;  3OYN A;  4BXF A;  4C2T A;  3KEY A;  2ELJ A;  4XN0 A;  2CV1 A;  2WAF A;  2IXS A;  4XLH A;  1MND A;  3AKZ A;  4CZC A;  2R4G A;  1E0E A;  4BE2 A;  2VXD A;  4G6T B;  3W3C A;  3K4B A;  4CSW A;  2A6T A;  3LMM A;  3DKX A;  1D0X A;  3SZG A;  4E7I A;  3EUK L;  3L2U A;  2LOO A;  3LFU A;  4X0G A;  1R6R A;  3IP4 B;  1D0Y A;  2X1D A;  4D1Q A;  4XLF A;  1LVK A;  1V5G A;  1X1B A;  4XKB A;  3OYF A;  2Z16 A;  4IZZ A;  2P0W A;  1PJR A;  4XKC A;  4F92 B;  2IGM A;  2OUM A;  2R7X A;  4BAC A;  2Z2S B;  4H4K C;  4ZDO A;  3SDB A;  2JSP A;  2WBM A;  3QYE A;  3M8J A;  4FAS D;  2F5V A;  2HQA A;  3L2R A;  4CA0 A;  1DP3 A;  2X1E A;  3W2V A;  4BQN A;  5JHF A;  4OAY A;  2VQG A;  2CW7 A;  4E7Z A;  4JQF A;  2VJI A;  3RTR A;  1NG6 A;  4R79 A;  4XR6 A;  2VQC A;  3HL2 A;  2HVS A;  1MMG A;  1NG7 A;  4BE0 A;  2LG4 A;  2I8D A;  2IGN A;  4DJA A;  1UEL B;  3ZCO A;  2E1M B;  3BCB A;  1HA8 A;  2K5C A;  1KON A;  2QKL B;  3VWB A;  1U0J A;  1S9H A;  2AQF A;  2IGO A;  4BDZ A;  4Y33 A;  2BOL A;  5TGT A;  2X6X A;  3D5S C;  5KCM A;  2W4S A;  3BC8 A;  3M1C A;  4NQW B;  3HPG A;  1OLT A;  4CCN A;  2M4K A;  3OS1 A;  2F4I A;  4Y3O A;  5CKT A;  4YEJ A;  3MKZ A;  1MMD A;  3K4C A;  3TMO A;  2L9S A;  1YX5 A;  3DTK A;  2UWM A;  3MKY B;  3OYC A;  2E1M C;  4NNJ A;  3ZQQ A;  4KJZ A;  1SFK A;  3DWL E;  4F91 B;  4BU2 A;  3AL0 C;  1LKX A;  2UUZ A;  2Z1D A;  3SEQ A;  4BJ6 C;  3VYU B;  3K6G A;  2AQE A;  3V42 A;  4AVZ A;  3OYK A;  1X4P A;  4EAT A;  3VSL A;  2CUJ A;  4F93 B;  1DQU A;  1Z3Y A;  2L7K A;  3H9Q A;  2X85 A;  3HC7 A;  2X6Y A;  2HU9 A;  4KIS A;  4LG3 A;  3L2V A;  3DU6 A;  3L2W A;  2VIX A;  2V26 A;  2L2O A;  4XLE A;  3HUG B;  4HRI A;  4NUB A;  2L5Q A;  3S3M A;  2WAE A;  4BL0 B;  4PK4 A;  2VQL A;  2CFO A;  2CUZ A;  2M3A A;  3OYJ A;  4PSW A;  4J01 A;  4QPO A;  1N77 A;  3EUH C;  2MFZ A;  2KZV A;  3KYL A;  2BW3 A;  2CW8 A;  3LSM A;  1W36 C;  3K4J A;  4NC7 A;  4OWR B;  3H5A A;  4RMN A;  1QHH D;  2VLA A;  2DT6 A;  4D9J A;  4HNT A;  4QPQ A;  2W1O A;  4YEL A;  3UR3 C;  3VYR B;  4KIT B;  2IGK A;  4N4N B;  3I9V 2;  2XF6 A;  1IRX A;  3S3O A;  1BR4 A;  4JOM A;  4IX7 A;  2R7V A;  3H9J A;  3FKJ A;  2DT7 B;  4PUS A;  4PJM A;  2XC7 A;  2HZD A;  2A5W A;  1WJB A;  4E7H A;  3FBI B;  4CCJ A;  1D1B A;  1ZEL A;  3S8P A;  4MLO A;  4PFP A;  3H35 A;  2R7Q A;  4XNF A;  2JUG A;  1W36 D;  4XOR A;  4BUP A;  2MD0 A;  2QKM B;  2VAS A;  1N78 A;  4E7L A;  3H9G A;  1T95 A;  4XQF A;  2WAQ A;  2VB6 A;  2HVR A;  4XON A;  4BS9 A;  3ZR8 X;  2VJ4 A;  4XN3 A;  2CS3 A;  3OS2 A;  4F55 A;  2KQR A;  3DPT A;  4XLA A;  2PJR B;  4BJT A;  4CH7 A;  4OAZ A;  3S32 A;  3ZGK A;  3FHN A;  2Q2E B;  3PNV A;  2KHM A;  3DKY A;  2Y0S A;  2CV2 A;  1Y6I A;  3KX2 A;  4E7J A;  1SAU A;  4BQO A;  4E7K A;  2UV1 A;  3K70 C;  1QHG A;  1X1D A;  2DCE A;  5LFA A;  2KLO A;  5CQE A;  1EA3 A;  2BW3 B;  3G2B A;  4PSX A;  3VYS B;  3OR1 C;  2R7O A;  4PJN A;  3OYD A;  1QU3 A;  2RRE A;  2IS6 A;  1WJE A;  2W7N A;  3RCO A;  3ZRG A;  3DPU A;  2GOX B;  1MMA A;  4P1W A;  4DOZ A;  2WA0 A;  3PNT A;  2R7W A;  2FUG 2;  3OYA A;  5HNF A;  4DBR A;  2XAU A;  4XM3 A;  2DXI A;  4ZC3 A;  3QOD A;  2WAD A;  4KT6 A;  1D1A A;  2HPM A;  4LIV A;  1YE9 A;  2RNG A;  2CV0 A;  2JVG A;  2X6W A;  2R7U A;  2M7A A;  1WJ5 A;  3HXL A;  4HPQ A;  1GLN A;  4HNU A;  1D1C A;  2LY1 A;  3OYB A;  2XSJ C;  2R7R A;  3VYT B;  3K70 D;  2E60 A;  3U21 A;  3HG9 A;  4DIQ A;  4J00 A;  5LD2 C;  1LDK B;  1X4O A;  4XMY A;  4E6K G;  1ERD A;  3F9K A;  1MW7 A;  4E4H A;  3SYT A;  4P5O A;  4RLF A;  2KP6 A;  3LSI A;  2HNH A;  2JA2 A;  3HPH A;  3HOT A;  2LBF B;  4ZJZ A;  1G8X A;  4U87 A;  4F3Q A;  1Z7L A;  3OWT A;  2V4J C;  3CMM A;  4XL9 A;  3FBN B;  2MC4 A;  1X1A A;  4ZDL A;  4XLC A;  1BR1 A;  3OL4 A;  3IUO A;  3PL8 A;  3L2Q A;  1JI8 A;  3CF2 A;  4CCO A;  4CCL A;  2KDO A;  2JVH A;  3DU5 A;  3FDY A;  4N4O B;  2XDV A;  3MKW B;  1T0F C;  3QYB A;  3I3L A;  4BE1 A;  4FET A;  3DTI A;  4ZYA A;  5FRN A;  3OR2 C;  3CJQ B;  3OS0 A;  2Q1Z B;  3EUA A;  2X51 A;  3OIQ A;  2VJ5 A;  2KMU A;  1X1C A;  3CP2 A;  3E0J B;  3RPU D;  3MMY B;  4IKF A;  2KRC A;  1UG0 A;  3K4K A;  3PFY A;  1P9Q C;  4IQ4 A;  2XF5 A;  3H5N A;  2LRE A;  2LH9 A;  3SEZ A;  4DGW B;  5HNH A;  3BG6 A;  5CQG A;  3CZ6 A;  3TBI A;  4CCK A;  3PSF A;  3J7A Y;  4HEA 2;  4AU7 A;  2BVM A;  2ZSH B;  4II3 A;  1WJD A;  1UAA A;  3OOU A;  4AYB A;  4NC8 A;  5HOO A;  2DJI A;  3S3N A;  1YX3 A;  3OL3 A;  2W00 A;  4BDY A;  3LSH A;  4B3X A;  3OYG A;  5KHD A;  1N75 A;  3A1Y A;  4XKV A;  3PNY A;  3LSG A;  4ITV A;  4II2 A;  2X1C A;  3C2H A;  3W2A A;  2IS2 A;  2BVL A;  4B47 A;  4ZDP A;  2OV7 A;  2NOJ B;  2WB1 A;  1PYV A;  3PJR A;  1DGW Y;  2CMP A;  1Z3X A;  3AL0 B;  4BEH B;  2IS1 A;  2V7F A;  1VZ0 A;  2M0M A;  5CPR B;  1Z21 A;  4C2U A;  3BLY A;  5HVQ C;  3PSI A;  4BEH A;  3A2K A;  3HKZ A;  3EPZ A;  3S93 A;  3QYF A;  3E1S A;  2XF7 A;  1TT0 A;  2HDW A;  2KL4 A;  2LY2 A;  1WJF A;  3OIP A;  4HST A;  4XOP A;  4B48 A;  4ZTJ A;  4BJ5 C;  4RLQ A;  4B44 A;  2V1N A;  3DLA A;  3MD2 A;  1J09 A;  4LIT A;  3AFH A;  2R7T A;  1K6Y A;  3H5R A;  3ZXS A;  4U7B A;  2V6E A;  3K4L A;  4CUG A;  3CES A;  1WJA A;  4PJJ A;  2E5N A;  2WY8 Q;  2R7S A;  1V5E A;  2LYC A;  2LC2 A;  1G59 A;  3UNG C;  3RQ4 A;  4BQQ A;  2RQQ A;  2ZXH A;  2V9K A;  4HSR A;  4LIU A;  1FMV A;  2W82 A;  5HLT A;  1BR2 A;  3OYE A;  3OYL A;  2HVQ A;  2KPM A;  2M7B A;  1WJC A;  4RM2 A;  1MNE A;  2VKH A;  3VDX A;  2CH0 A;  2OC6 A;  3A4C A;  3HOS A;  2PJR A;  1OR7 C;  3OMY A;  5FRM A;  3C2G A;  2GOM A;  3NWS A;  2MAB A;  1WFX A;  3K4N A;  4ANJ A;  3W2W A;  3DEE A;  3K4M A;  4B43 A;  2VPL A;  2IS4 A;  2ZXI A;  2WY7 Q;  4BGD A;  4XOT A;  4CCM A;  2K9M A;  2F6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...