1JI8A

Solution structure of pyrobaculum aerophilum dsrc/gamma subunit of dissimilatory sulfite reductase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dissimilatory siroheme-sulfite reductase
publication title Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2001-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ji8A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1ji8A01
3OR1C 2XSJC 1JI8A 3OR2C 2V4JC 1YX3A 1SAUA 2A5WA
chains in the Genus database with same CATH superfamily
2M30A 1ETOA 5IP9J 2STTA 2Y69H 3OYGA 5FJ8J 4HNTA 3E7LA 5ICGA 2OBPA 4CCNA 4A6DA 3FBIB 2VKHA 1GVDA 2R7ZJ 1YW9A 2L7KA 2W82A 3M7GA 3IL2A 2OZ6A 1RKWA 4MLOA 2FXAA 4A3CJ 4RDUA 3HOYJ 2E71A 3OYAA 5JVTA 3J80K 3H35A 2R93J 4BQNA 1HKTA 3NWSA 3BR2A 4DBRA 2NS0A 2V1DA 2FU4A 2O6GE 4KN4X 5IYBJ 3HDDA 5FLXZ 4NUBA 3OY9A 1H88C 2PI0A 3WODF 3FMRA 1MMAA 5LHGA 1IO2A 2VKEA 2RQQA 3A1YA 1HQCA 3DTIA 5DV5A 4IRIA 1HSTA 4WXHA 2DLLA 1YG2A 2V1XA 3DQVC 4BQAA 2R7TA 2P5VA 3PO2J 2L02A 3C3WA 3DBRB 2R5ZA 2BVLA 2VE8A 2RAEA 1TNTA 3LWFA 3MZYA 3K2ZA 3Q9SA 2HOEA 5GADJ 2DQLA 1D0XA 2HOAA 2LKSA 2V6EA 5CVJA 1RIOH 3F9KA 2JK3A 2TDXA 2X1CA 4CHUA 2Q0OA 4N9IA 1T38A 1IRXA 2JA8J 1PP8F 5HS8A 2K7LA 2VODA 3FM5A 5K1YA 1AKHB 1S3JA 4KIFA 4BBSJ 2HQ5A 3I4MJ 5FKOA 3JRHA 3MCZA 3D0SA 5F0CA 4DBQA 1H9TA 1QZEA 3GBGA 3TBIA 3IRQA 5EJCA 4YFKF 2VQGA 3ABUA 3EUAA 2OAZA 1B4AA 3EUKL 1XG1A 3W6KB 3W2WA 5IP7J 5JVGF 1BC8C 1WVRA 4Y4RA 2HEOA 2JTVA 2L0KA 4AC0A 1MBFA 4V2GA 3IUOA 2M1BA 2QF7A 2G7HA 3BZKA 4G6DA 1DGRM 4BXXJ 2ZSIB 3QYFA 2ZJQF 2ETHA 3R0JA 4KITB 2WA0A 1ZLKA 2DMQA 2W85A 2FSWA 4I7HA 3ELKA 4LD5A 1VQ5I 2BXYA 5F1RA 2V9PA 1YO5C 1LJ9A 2VOPA 1TLHB 1XC5A 3ESWB 3WHCA 3F8BA 4IVNA 1B9NA 4CZZA 5GTHC 2LOOA 4G8XA 4XMYA 5DUKA 3CC7I 3GZ6A 2COMA 2CSOA 2A68F 1LUJB 1MBKA 2K40A 5F27A 3OWTA 2KDOA 3GF2A 2V7FA 5FD6A 3B73A 3HPHA 1VQPI 1ZR4A 3TP0A 1WWXA 4WK8F 1SD7A 3HGYA 2HQRA 3MZHA 4I2OA 2M3AA 4AVZA 3PIOF 1XPXA 4H4KC 4JK1X 3K4KA 3CTAA 3DU5A 1PUFA 1A36A 2DAOA 2M0CA 3OSFA 3R60A 1EF4A 2NYXA 1FBUA 5E1WA 3HUGB 3U1DA 3I64A 2LY9A 5LHHA 2RGVA 3ONQA 2K85A 5IOYA 3M9AA 1LDKB 2LY1A 1W7PB 3BG5A 4XLCA 1SEUA 2JN6A 2W57A 3CESA 5E20A 2QBYB 5KVRA 1OFCX 3H3VK 3W6JB 4EM1A 1SFEA 1E3PA 1R5ID 1ONVA 4HV5A 4B47A 1HC8A 2KDZA 2QSFX 4N9HA 2K5CA 1NK3P 2UZKA 1DQUA 4EGZA 1X3UA 5D6FA 1MNEA 2EJRA 4PJMA 1E2XA 2ZNYA 5IPAA 3J81K 2V1UA 1MJBA 4MGRA 5CVVA 3E5XA 1LFUP 3CLQA 3ZCOA 3E1SA 2E1CA 2DA3A 2JQ7A 5HLTA 1SANA 2Y0SA 3ZN0A 1D1BA 2DYSH 4LITA 4A3GJ 1KU2A 5KAFC 1KGSA 2HZTA 3WHBA 2M9HA 2PN6A 2IAIA 2M87A 3S2WA 2OCCH 5ICFA 3PQKA 1RPWA 2VONA 1ERDA 2HDWA 3FIWA 4XKCA 1UG2A 4E6KG 4MTEA 3ECHA 3BDDA 4CICA 3H5AA 4RB1A 1HCRA 4F92B 5EEAA 2NS8A 3ZQ7A 1XGMA 1YJNI 5JR3A 2VQHA 3CZ6A 1H0MA 1BR4A 4MFEA 2XHKA 4AWXB 5CLSA 2ISYA 2CW7A 4HEA2 1R49A 4JQFA 4ZYGA 4KYWA 3H92A 4IJAA 1TQPA 1WH7A 3BWGA 2CH0A 1W5TA 4B4CA 2EFNA 1OLTA 3U1KA 3VYSB 4PSWA 2Y9YA 1F9NA 4RLQA 4ZC3A 2ECCA 2DOFA 1UAAA 4HDVA 2HPMA 2XF5A 3TEDA 4RS8A 4Z2YA 1CGPA 3JTHA 4HF2A 1BI2A 1YE9A 1WPKA 3QU6A 4LJZF 4ZYAA 1RR7A 5CJ9A 3ZXSA 2R7DA 2Z3YA 2L9VA 3FBNB 2IA0A 2IS2A 1MMSA 2A5YB 1G4DA 3IKVA 3F8MA 5HDKA 1LFPA 1HW2A 3H5NA 1TT0A 5K7HA 1XD7A 2E60A 3NEUA 1YS7A 1J7KA 2HXIA 3M3YJ 2ME0A 4A0YA 1OISA 5F64A 1Y1WJ 1R23A 2JPCA 2KIMA 3WTXC 5EEHA 1OCTC 4EEFG 3FMSA 1XCBA 1YYVA 1HSJA 2HKOA 3JSPA 1FT9A 2VXZA 1IDYA 3VWBA 5LEJA 4C9YA 2CG4A 2WB1A 2LKPA 1J59A 2XIGA 2E1NA 3OYBA 5HNHA 4WXDA 2QGUA 3TW7A 1X4PA 1FNNA 1WJAA 1QZYA 4CXFA 1PP7U 3GUDA 2L9RA 3VYTB 1FOXA 3CUOA 4RB3C 3T5XA 1K79A 2VC0A 2CFOA 3HIFA 1Z9CA 1XGSA 4A2UA 3PL8A 3JREA 2MLGA 3QP6A 3VEPA 3HC7A 1VQ7I 2CV0A 2EK5A 4FQGA 1BR2A 2XGEA 2ZFWA 2P5LC 5C3EJ 3T1BA 1U3EM 3QOPA 1JKQC 3G4SI 4OIQF 4B44A 1IUYA 2TRTA 3HBLA 1IJWC 3MKLA 3EDPA 3CUQA 4G94A 3Q0UA 1JHFA 4U0VA 3WGGA 2MYSA 4P9FA 1VQOI 2E1MC 3W2AA 4DQ2A 3ABLH 2DK5A 2QLZA 3HSEA 2JUGA 1KU9A 1Y8RB 2KT0A 3OS1A 3N4MA 3HEFA 1ZARA 3BTCA 5FO5A 3CMMA 4KFCA 1BI1A 2HTSA 2IA2A 1XSDA 3K4NA 2QKMB 2EA4A 4BDZA 4FE4A 3H36A 2LREA 3JRAA 3RIRA 3MWMA 2WBMA 2OUMA 3WG9A 2KJCA 2XSDC 2BYVE 1TC3C 2VC1A 1GT0C 4BXFA 1FEXA 4DNCA 5DM6F 1ACIA 1P9QC 2DTZA 4XSZF 4RLFA 1ON1A 4DYCA 3VB2A 5AONA 1MH4A 2PBIA 4FISA 4IHSA 2KLOA 3HOZJ 2XPUA 3Q9VA 2H1LA 2XF7A 1FTTA 2NNYA 3SHFA 4HBLA 2YX4A 1SFUA 2E2HJ 3I59B 5F1JA 2JUCA 1FSHA 2M0MA 2RVCA 3FX3A 3H5RA 4L9NA 2Q8KA 2IRFG 3P7NA 1B59A 1I6HJ 1K78A 4I0BA 2GLOA 1YJ9I 1YIJI 1MMNA 4UXNA 3HOVJ 3HOWJ 2PMZA 1LB2A 2RN7A 3GLLA 4B3XA 2O03A 2K9NA 5FKLA 3WTVC 2OU2A 3TGNA 2ELJA 4B43A 3K4MA 3VOEA 3TP3A 1T56A 5L3CA 3SZGA 2F48A 3KZZA 2VPRA 1TL8A 4AYBN 1CF7A 2ZBKA 1I3AA 2XAQA 2P0WA 2PX9A 5K5RA 2K4JA 5GP9A 1VQ8I 1ZGWA 4OIRF 1Y6IA 2DA5A 2DODA 3ZQGA 4GXOA 3CCUI 1N25A 1O3RA 2L54A 2CMPA 4V19K 2E7WA 2GIZA 1F4KA 3DBLB 2P6SA 3BP8A 4TV7A 3ZQHA 5FLXK 1T0FC 1WHUA 2ZCWA 2IS4A 1ZREA 1SFOJ 2PG4A 2R92J 1BBYA 1SMTA 2LF7A 4MQ9F 4HZFA 1X1PA 2M7BA 4XOTA 4C2UA 2L7FP 2NVXJ 3K4CA 1K61A 1IXCA 2L7MP 4E7IA 4QPOA 3A0HC 3G1OA 3S1RJ 3GTPJ 3HKZA 2DT7B 3K4LA 3BT9A 3K1PA 1BOAA 2X4HA 4BS9A 2EZIA 3AAFA 1P2FA 2FJ1A 1YITI 3CDHA 2IGMA 2OZUA 1LVAA 3FXOA 3CDIA 2LTPA 4AIJA 1K83J 3SXYA 1R71A 5EZGA 4NDLA 2WAQN 5BPDA 4IKFA 1W5SA 4CDGA 2UV1A 3TDZC 1YOVB 3ZOBA 1T2KA 1EV7A 1NG6A 3BQYA 2RNGA 1BI0A 4XK4A 3ZQFA 2LMDA 4XLAA 5DD8A 1X19A 3JAMZ 4FX4A 4NHJA 3W6VA 4HF0A 3KZYA 5LLQA 3R0AA 1XMKA 1RESA 2HYGD 4HOBA 2R7UA 1H9GA 2Z1DA 3FKIJ 1V54H 1TNSA 2R3SA 5TRDA 2BY2A 2KP6A 2P8TA 4G6QA 3TO7A 1HW1A 4PZJA 2QSGX 4BE2A 5DUIA 4L5IA 3QYEA 4BBRJ 5DDGA 2ACJA 2JA7J 2F4IA 3S3NA 4LB5A 4Y52J 4RB0A 1WI9A 1AKHA 3GTQJ 1JJ6C 3ERED 4A3EJ 2KIUA 3J7AO 4PDKA 2MLKA 4Y7NJ 2PJPA 3L2WA 3I53A 1HDDC 5IYDJ 3GFMA 5CQEA 2DJIA 4QWQA 2BE5F 2EIMH 1UG0A 2ZJ2A 3TO9A 1FPQA 4PJLA 3SFIA 3F8CA 4GYGA 4CZCA 4CCLA 5ICEA 2XAGA 2GOMA 2W7NA 2B9SA 2JRTA 5J4YA 3CQZJ 2EV5A 2M8EA 5AIQA 4HG2A 1R58A 4ENNA 5IP6A 2DPUA 1TZLA 1LNWA 3LSIA 4KT5C 1RI7A 1OR7C 2H8RA 2DT6A 1DPRA 2O9LA 1ZK8A 4IRHA 3S1QJ 4BJ5C 2I10A 2R7RA 3EQLF 3R4KA 3W2VA 3JSOA 1U5TA 1BA5A 4C3JJ 1X1BA 2A6TA 3HGGA 2QA4I 3CP2A 3DKYA 4Y13A 2HQNA 3EETA 5E1XA 5B66C 3ZMZA 3OYFA 2XPVA 5HVQC 3OL3A 2KRFA 3DF8A 1DP7P 4E7LA 2QWWA 1I27A 3CD6I 2XB5A 3LSHA 1O3TA 2Z9OA 1D5VA 5DM7F 1MIJA 5L3GA 1YX3A 3CCJI 4IHXA 4L9TA 2DN0A 3TDUC 5H2FC 5DTDA 1SFKA 3RKQA 4U87A 3HRSA 3ISPA 3Q3SA 3IHUA 1FP1D 9ANTA 1BR1A 1BN5A 2BZTA 1W7PD 2XAJA 3N05A 4G7OF 2EA2A 3WU0A 2MA3A 2HDDA 5GTIC 2E36A 1K78B 2HS5A 2A07F 3HOUJ 4F7ZA 2VBZA 2ZXJA 3I71A 3CCYA 3V42A 5KHDA 4IL6C 1OJLA 1JKRC 2PJRB 2MBFA 2BVMA 4EM2A 2OF7A 1S7OA 1SMYF 5E18F 1YW8A 3RI4A 4MQVA 1WJFA 1N77A 3CP8A 3P5JA 2A6HF 1USSA 1LQ1A 1JUPA 1UHSA 1W7PA 2LKXA 3O8GA 5D4SA 3NAUA 4GFBA 4CCMA 1QGPA 1PJRA 4KN7X 1OYYA 1YI2I 2X6OA 1S9HA 1VNDA 2GA2A 4ZYEA 2QBYA 2DJNA 2OQGA 4PJ0C 3CO7C 1JXSA 5DCFA 4XIDA 2O0YA 1XN7A 4DGWB 4UNOA 2TCTA 4HLYA 3OYJA 1P4AA 1BJZA 2GBYA 3LA7A 2BEOA 4NQWB 1APLC 3A2KA 3RKYA 4BE0A 2DO7A 4XOPA 4UB8C 3FXMA 1MBHA 1Y39A 1KU3A 4M3DA 4ITVA 1O7FA 1XX5A 2WWYA 3J7ZI 1U8BA 1FIAA 4M3GA 1ZQ3P 2RDPA 1A5JA 2VJIA 1ZRDA 1FX7A 4BYYA 2L9NA 4ZH4F 1IZ1A 3O2PE 3CCEI 3DU6A 2HVRA 1UFMA 4HX7A 3CCLI 4HQEA 5EGOA 3MFKA 1I5ZA 1SAXA 3GXOA 4IOAF 4JX6A 1WJCA 4I99C 5DYMA 1N78A 5FKKA 1X1DA 4EJWA 3L2QA 4YIIA 3BJ6A 2EBIA 2V9KA 4EJVA 3ULQB 1D8JA 2WV1A 2RV8A 2WTEA 1SFXA 3H0GJ 1RRJA 3FDYA 4M6XA 1OYIA 3ZMDA 2XAHA 2BHYA 1P4WA 1DUXC 1R4NB 3RQIA 2KISA 3ZPLA 2X1DA 4PFPA 2VQCA 3WTYC 2MD5A 1SD4A 1ULYA 1J2XA 1W36D 2HOTA 2V9VA 5D8LB 3L2RA 5LD2C 2HU9A 3HRTA 4D1QA 4BGDA 1Z7UA 4ZYHA 2M45A 4I6ZA 4ESFA 3D5LA 1OCRH 3BY6A 4OIOF 2F2EA 3BJAA 2YX7A 4ENKA 2CQ7A 1IV6A 5F04A 2CUZA 2HI3A 2MW8A 3IWZA 2BW3B 2ZXHA 3HRMA 2FX0A 2JMWA 5ERIA 4U7DA 2LDUA 1VQNI 4P96A 2VLAA 4I09A 2LD5A 2E1MB 2LFBA 1ZGJA 3R61A 2BY0A 4ZYDA 4EJTA 1Y56A 3F0CA 3U21A 4F3QA 3OYHA 3OYEA 3EPZA 1JHHA 3S16J 2YU3A 1ZHFA 1REPC 1IF1A 3FHNA 1EJ9A 1J09A 1XMAA 1ZRFA 4KT6A 4PJJA 4XN3A 2Y48A 1HA8A 2L01A 2VJ4A 3QAHA 3EUHC 4G12A 2CQNA 1Y0NA 1ZN2A 2V26A 4P55A 2VPLA 4RGSA 3S2HJ 2JA2A 1SD6A 1YTYA 2HDCA 2R7XA 1D1CA 2Y31A 1FMWA 4LG3A 4G6TB 1ZG5A 1P92A 3FK7A 4OOIA 1S7EA 1OQYA 1TWHJ 3L2UA 3V7CA 3O6BB 2V6CA 3OYNA 4AU7A 3P9CA 1SVLA 2CQQA 4II3A 2Y30A 3FXQA 4HPQA 4XLEA 1T98A 1WZ2A 1G2HA 4II2A 4CGZA 4RBOA 4BY7J 1LEAA 3RSNA 4I76A 3RKXA 1U5TB 5JHUA 2VBWA 4MFDA 2OQRA 1UCRA 4HRIA 1YFHA 1EH7A 4LB6B 2PMUA 3FZVA 3EYIA 2ZB9A 5E79C 1SVOA 2L7ZA 1FP2A 1XGNA 2XDVA 4A6EA 3FXUA 1TTYA 2DDBA 1XSXA 4LGWA 2K9SA 5CVIA 3MKZA 4BQQA 3LOCA 1FMVA 4QLCU 2IBDA 4MEXF 3W3CA 4F93B 3E97A 2ME6A 3G1MA 4YELA 3HL2A 5GAGJ 2EV6A 2GQQA 2R7SA 5EF6A 5K7ZA 4V2FA 4CH7A 3LQRA 1NK2P 4Q4ZF 4PUSA 2MC4A 3REOA 2R7WA 3OR1C 3AKZA 3CMAI 1QVTA 5H6QA 5EYRA 1KYWA 4BE1A 3I5UA 1OCPA 2O8XA 1VI0A 2AQEA 4HF1A 2AHQA 1RC9A 3BJOA 1Z77A 2DK8A 3KP4A 4E7ZA 2VL8A 4RGXA 3FXLA 5J47A 1V5FA 3I59A 2XGXA 4NC6A 4RAFA 1N75A 4BKXA 1ZH5A 2HWVA 3KP5A 1BW6A 3ABKH 3FXJA 1RUNA 5TJJA 4ASNA 1FYKA 1ZG1A 1IN5A 2VT3A 2Z5UA 1AOYA 5IT3A 1LKXA 3CCMI 4E7JA 4KMFA 2H6CA 3LSPA 3E3VA 3OYMA 4RM3A 1VQKI 3OS0A 2Y0SN 2K3PA 3I58A 1VTNC 3PO3J 2G9WA 4AUXA 4H0EA 3V8KA 4MHGA 3PIPF 1S72I 4ZTJA 2ECBA 4GDFA 1KQ9A 1GHCA 3KP2A 4Y17A 1HKQA 2X51A 2ZNZA 3NARA 2E2JJ 2ESHA 4OAZA 2CRGA 1IUFA 4E4HA 2XC7A 3ABMH 1JJ8C 3CF2A 1I1SA 1I39A 1BW5A 1FLIA 3MKWB 1JGSA 2D2WA 2EFQA 2XKOA 1ZLJA 5EGOB 2L3DA 2LBFA 3GTKJ 2W00A 3B6CA 4GCVA 3GCMA 5AIPA 1K4TA 2HVQA 3WU2C 3A01A 2FOWA 3MQ0A 1JT0A 3FWEA 3A02A 1ZELA 4Z6YA 2Y2ZA 4WXCA 4BHBA 3HYIA 4D7NA 3Q5FA 5J40A 1XCVA 4XONA 3E0JB 2Q2EB 2RKHA 1ZAOA 1A6QA 2PEXA 3LFKA 1XDUA 5CQGA 5LGTA 5HLGA 2XRLA 2LLKA 1OCOH 4EGYA 3SDBA 1Z21A 3NWTA 1R9TJ 2DOEA 2ZSHB 2KKOA 3WG7H 4YG2F 4EV0A 1P7IA 1I50J 2LSOA 3S14J 4FTHA 2COBA 4LK1F 2DDAA 3HOTA 5DEQA 1JKPC 1BIBA 1JTXA 5JHFA 3C2BA 3GO5A 3RPQA 1LFBA 1K4SA 3KFWX 2W24A 3TOAA 5DCMB 3K7AJ 5GAHJ 1O3QA 2CGPA 2CYYA 3GW2A 2ELKA 2KRCA 1K6OA 2UUZA 2FEZA 3CJRB 3K70D 5GPAA 4A3IJ 3LFUA 2X48A 3BROA 3L9FA 4F91B 4XKVA 1LDJA 1P4XA 2WB1N 4XLPF 3KX2A 4A3KJ 4HA8A 2H6BA 3J80Z 2I5UA 3AL0C 3ZRGA 3F6VA 1IW7F 2OCEA 5E3MA 1W1WE 3CJTB 1IRFA 3A4CA 4A69C 1D0ZA 2LYCA 1B1BA 4XRFA 4CSWA 1Y1VJ 1XDSA 4YFNF 4ZTFA 4FT8A 1JKOC 4Y3OA 1QHHD 4XORA 3B6AA 4NB5A 2I8DA 1FOWA 3HM5A 4D9JA 4A12A 2GAUA 4M3FA 4X6AJ 1T95A 3RPUD 3E6CC 5FGMA 4WF2A 2CV2A 2NVTJ 3GLXA 1VQ4I 2OV7A 3ZP5A 5HS7A 2W48A 2FBHA 4EVIA 4A3LJ 1J0RA 3IAS2 1YIOA 5FKMA 1IAWA 4NNJA 3UNGC 4CYCB 1HXDA 3RPUA 2XAUA 3LA3A 4BHCA 3SEZA 5K5OA 5KAIC 2EWNA 1YHQI 4XRMA 1S5LC 2ZMEC 4QIWN 2HQAA 1V5EA 3ZMVA 1JTYA 2ID6A 3SEQA 1PUEE 2X0LA 3WGIA 5E3LA 2GIVA 2K86A 1R36A 3WTUC 2IGKA 4OMZA 2QKLB 1UMQA 2F4MB 1PYVA 5E17F 1TP4A 4EJOA 2Z33A 4S0HB 3HG9A 2VIXA 3BTLA 3CO6C 3NQOA 3R6SA 5L3DA 1HDPA 3M07A 1YW7A 2DA6A 4HYEA 4ZZDA 2VOOA 2FBKA 2QSHX 2X9DA 2O3FA 2JVGA 3VFZA 1I6XA 2A3SA 3VSKA 2M34A 5J4VA 3I4PA 2JSPA 2CFXA 1IGNA 3K0LA 3QPTA 4CCOA 2NVYJ 5IT9K 2A69F 2ZFUA 4UHTA 2BBYA 4F55A 4LLGF 3O3KA 1RR8C 2KZGA 1X1CA 2PMZN 2EFWA 1YQAA 3COAC 3BPVA 2PJRA 4XSXF 1B6AA 2VBXA 3E6MA 4IHWA 4AVPA 1RKTA 3OMYA 3BPXA 1BM9A 2LY2A 2ICWG 1JUSA 1USTA 2HYFA 3OS2A 1E17A 2YR2A 2EFPA 2HYJA 1AU7A 1Z7LA 2DA7A 4P1WA 3F6OA 3K4JA 1Z6TA 2GXAA 1MW7A 3D1NI 3DV8A 3BZ6A 3J7AY 3MKYB 1GV5A 1X4OA 1QPMA 2A6EF 3F22A 1ON2A 1FYLA 3NRVA 4NQWA 5J3LA 1MMGA 3GZNB 4GRIA 2LBFB 4D5FA 2P7VB 1D0YA 2M7AA 3JTGA 3CCRI 3A01B 3K10A 4P9UA 4J01A 2OTLI 1F1ZA 3WU1B 2LK2A 2RC4A 3BCAA 3SFZA 2YUSA 2STWA 4L5EA 4A3FJ 1T08B 2KFDA 4Y15A 3BOQA 3HJEA 4DW6A 3MN2A 2VKVA 4O5VA 3SQNA 3E6DA 2UXNA 4WWCA 4E70A 4Y33A 4HDUA 1VF9A 4XN0A 3IC7A 4B8XA 4BAYA 4NBQA 5LBQA 2FNAA 4ESBA 2CW8A 1HF0A 1UHWA 4BEHA 2FF4A 4ENMA 1QVUA 2FBIA 2MD0A 3J81Z 1GV2A 5BS6A 1TQIA 1TWFJ 3S17J 2IPQX 1TWCJ 1YX5A 3LAPA 2D1VA 3RYRA 4CUGA 1W4MA 1ZRCA 4LG0A 2DBBA 2IEKA 2QVOA 1IN8A 2LR8A 1B72A 4EQQA 2H27A 3C2HA 1RZ4A 1RETA 3OYIA 1EH8A 5FFZA 5E3NA 3S3MA 2BW3A 3RDIA 4C2TA 4AIDA 1BJAA 4LIVA 4DYQA 2ADUA 5D6EA 4IPAA 3OL4A 5D5XB 5BQTA 2WAFA 2JRMA 3PNTA 4CO8A 1TQMA 1WJBA 2HFHA 3F72A 2WAQA 4WCGA 4D0PA 3VPRA 2V1NA 2F5VA 2M5WA 4IRGA 1QA6A 3BTJA 1B8IB 2H1KA 1FC3A 2DOAA 2IJLA 3S93A 2Y0MA 5ILSA 3H1CA 2X6WA 1QQIA 2F5FA 1NH3A 4HNUA 2ZKZA 3L2VA 2NOJB 1XGOA 2WC2A 2CW0F 4XLNF 4M9ZA 3AG4H 1QNTA 2L9SA 3H3ZA 2EIJH 3OSGA 2GOXB 3K1NA 1BL0A 5KNLA 2CQKA 1Z1DA 3C7JA 1XMXA 1RNLA 1R7JA 1KU7A 3KP7A 3HB9A 4KJZA 2CV1A 2EZKA 2XROA 2HTJA 1KONA 4HV6A 3WTTC 2MH2A 4BY1J 2IP2A 4BUPA 3I4NJ 5KK1A 3SDGA 1O4XA 1WJ5A 3GFIA 1OCZH 3IH3A 3DEUA 4PK4A 2RQPA 3WE2A 1U78A 3VODA 3IH2A 2DYRH 1FBSA 4N0BA 2LF8A 3GZ5A 3DBHB 2HKXA 2ZXWH 2C6YA 4OINF 2BY3A 4L5JA 2LVSA 3OIQA 2BOLA 5JLXA 4XLFA 3GTJJ 3DLLF 5K7FA 2DXIA 2X6XA 4PJNA 1LVKA 4C30A 2DT5A 3DEEA 3VDXA 4E7KA 1QHGA 2GA1A 4AD9A 2MABA 5C4XJ 2XGCA 1UB9A 2IA1A 2M4GA 3I55I 3PSFA 5EEGA 1D8KA 3JW4A 5ILVA 4OMYA 3F21A 1K6YA 3IWFA 3IRRA 5HLIA 1RUOA 2XKPA 4J19A 4AIHA 2HZDA 3DLAA 1QBJA 3HHGA 2XPWA 4ANJA 1WCMJ 3TOBA 3OV8A 1LPQA 2ID3A 4CCKA 3LSGA 3GMEA 4B09A 1T0FA 1BI3A 2NRAC 3HTUA 4UUVA 2AXTC 2FRHA 3IAM2 4K2EA 4PCQA 2EINH 4LLLA 4C2MJ 2JA6J 3TO6A 1AA7A 2KHMA 1AWCA 2R7OA 1FIPA 1ZG3A 2VN2A 3S2DJ 2IVMA 1Z91A 4EM0B 1DU6A 1MD0A 1KYZA 5J6XA 2FD5A 1BOBA 5EG0B 2YSRA 4ON0A 1R1TA 2QEXI 1HOMA 1LDDA 1H8AC 3KEQA 1QRYA 1FWZA 1W0UA 3LSRA 1Q1VA 2E34A 2FMLA 4LLNA 5L3BA 4OAYA 3GVAA 1D1AA 5BNGA 4JBAA 4R8HA 1ODDA 2GZWA 3HHHA 2XAFA 1EH6A 4KICA 4RGRA 4UV8A 2O8KA 4HLXA 2FE3A 1MDMB 1A31A 5J1YA 2DMNA 2HPIA 2P6TA 5F0FA 3RZOJ 4ZDPA 1D5YA 4Q48A 3DEWA 1A04A 2JA5J 4UUSB 4ETSA 3ASNH 5F08A 1U9NA 1YLFA 1MBJA 3LMMA 3K4BA 3OIPA 5CPRB 5BOXA 3QODA 2VQLA 2VB6A 3H9GA 2GM4A 2VE9A 2QUFA 1MH3A 2EFOA 2EV0A 2JSCA 4YIRX 4N4NB 3S15J 1R1VA 3AL0B 3PM1A 3KP3A 2ZXIA 4XL9A 2IT0A 4BEHB 4IQ4A 4OIPF 3IKTA 1FJLA 4EATA 3G3ZA 1PDNC 1V55H 2KMUA 2XB0X 3OYKA 2Q2EA 3KPHA 4BXUA 3D5SC 2HNHA 4IF4A 3U9GA 3IV5A 4IHTA 3U2RA 4LG0B 4B48A 2M2EA 4G9YA 4B1RA 4F52A 1IG7A 1I3QJ 4NC7A 2L5QA 1B72B 3HXLA 2R5YA 5J8FA 5GAEJ 2G7UA 2IW5A 3V7RA 2XASA 2IGOA 2OPTA 5A2QZ 3JRDA 3G6EI 4D5CA 3QQAA 2Q1ZB 1R4MB 5KCMA 2E2IJ 3BQZA 3KYDB 1MZBA 5IYCJ 2DCEA 3K9TA 4BJ6C 1OR7A 3Q0VA 5DCMA 4C3IJ 1TWGJ 2X6YA 4XBFA 3FHZA 2W25A 2XRNA 3P9IA 1FOKA 2ZMEB 2OC6A 4MO7A 1TW2A 2MC3A 4M6VA 3F8FA 2KIQA 2YU9J 1IRZA 3WGHA 3DPTA 3C2GA 3I0TA 5HDNA 1R5HA 2FNPA 1YJWI 4CYDA 1Y8QB 5EZHA 3CF5F 5CKTA 2R7VA 1EA3A 2GXBA 1WKMA 4FX0A 1JE8A 1ETKA 2VI6A 2MH9A 3I3LA 1E3HA 1MKMA 3P9KA 4JOMA 3V8LA 1ETQA 2MGQA 4UY8I 3SZPA 1G59A 2A05A 2E7XA 3BG6A 3ZQIA 2QQ9A 4IO9F 3ZGKA 4UUTA 4MTDA 4U88A 1G3SA 3PSIA 4LOCA 1T8IA 3L2CA 4M6YA 1FOYA 3DPLC 4AM3A 4DZPA 2W1OA 4W1UA 3HSRA 3GYHX 4YRVA 4RAYA 4XR6A 3M8FA 3LSTA 1IC8A 2QQ8A 1MBGA 3T0YA 1IXSB 4LIUA 4AIKA 1FSEA 2FUG2 2O5RA 3TQNA 1GLNA 4G7HF 3VSLA 3K2AA 4EMSA 3M8JA 4M9XA 5CYVA 1WJDA 3LL7A 3ZQCA 1FYMA 2E5ZA 2D1HA 3QP5A 3EYYA 3ZQQA 4CYCA 3ERMA 2KPMA 2X1EA 4A3JJ 5LGUA 2NXNB 1JGGA 2DTRA 4UV9A 3FXRA 2JVHA 1EKEA 3CJNA 4B3AA 1MNDA 4EJUA 2FQ3A 1XB4A 3ROUA 4GYIA 4U7BA 2HGCA 2F5DA 2D45A 5HOOA 1MMDA 3PUFA 2CUFA 3MVPA 2BXZA 2HXOA 2WV0A 5B3SH 3DXJF 1G8XA 3ZR8X 2K02A 2R7FA 2Z2SB 1L3LA 2DFIA 5LRSA 5FD5A 5M5WJ 1FBQA 5BPIA 3G71I 3K70C 3CC2I 2Y75A 2F5EA 5DD4A 3C1DA 5E1ZB 1MJAA 1HBXG 4HAMA 2XVCA 1V3FA 2QCOA 5HS9A 3FF5A 5B1AH 3OR2C 4QPQA 4S04A 2XGDA 3GFLA 1OKRA 1ZR2A 3WTSC 3KZIC 5EDNA 1U6GA 4LMYA 4A0ZA 1QZZA 5TISC 3RTRA 1KQ8A 4I98B 5ED4A 1Z6RA 4RB2C 3PUBA 1DP3A 2EPFA 4GGGA 2BY1A 4P5OA 1YRNB 1ETXA 3FMQA 3RCOA 2DA2A 3CUQC 4JX4A 2QQBA 1VQMI 2DQRA 4UVAA 3H9QA 4OWRB 2HOSA 3L00A 5HODA 2M8GX 3HOSA 3GTOJ 1GVJA 1MSEC 1OPCA 1Z3YA 4M74A 2BGCA 3LAJA 1X3WB 1KQ0A 1G3TA 2UWMA 2J5OA 3S1MJ 3M4OJ 4U0WA 3MEXA 3S1NJ 3E5UA 1J5YA 1GDTA 5M3MJ 3KCCA 1TW3A 3LQQA 2OTJI 3RYPA 3WTWC 1R00A 4KIBA 2DI3A 3DP7A 4R79A 4KA4A 1D3YA 4NC8A 2X85A 3G2BA 1IN6A 3M8EA 3CMYA 3L7WA 3GX4X 1XTAA 1L0OC 3X2QH 2CJJA 3JAMK 4IX7A 4N4OB 2EILH 2RNJA 1IN7A 5FFXA 5L3EA 2DFHA 2A61A 3SYTA 3B02A 4BJTA 4DIQA 3DKWA 2PQ8A 2P4WA 3EUHA 1J75A 2VJJA 3BR6A 5CVUA 3T8RA 5B5EC 4X0GA 1WH5A 2R0QC 2OJED 2CUEA 3I56I 2Y9ZA 5LGNA 3RZDJ 2NS7A 3A0BC 1SC7A 2K9LA 5CVRA 3CLOA 1WI3A 2BHZA 3IP4B 2R5YB 1K7AA 4IHYA 4D7MA 4I01A 1E0EA 3BTIA 4I0AA 5IOZA 5IY5H 3V8JA 4I02A 4YEJA 3DKXA 2P5KA 1POGA 1OYWA 3UR3C 2VUMJ 3MD2A 1H89C 1U9OA 1O7LA 3ECOA 4HQMA 1GUUA 4PFOA 3PQJA 4BNCA 1W5CC 2OD5A 4BL0B 4RM2A 3SZTA 3KLOA 3ZMTA 1XS9A 3F8NA 2AS5F 2R5ZB 3RKWA 4IOCF 1MGTA 2IXSA 4M72A 2BV6A 2CUJA 2ZJRF 3CDLA 4JP0A 3A03A 1ETYA 3AG3H 2ZC2A 4HW0A 1Z67A 3KP6A 1JI8A 2KRHA 2CQXA 3KETA 2B63J 3S8PA 2ZJPF 3QU3A 4XRSA 1B8IA 1U0JA 4XICA 2DMTA 2XSJC 3GTMJ 3BCBA 3BG7A 5M3FJ 3Q0WA 1OMIA 3JRCA 4UVCA 2ISZA 1XSVA 2B0LA 3PFIA 2EH3A 3G1LA 5HLHA 1T39A 4FHTA 1Z0XA 2O7OA 3JRBA 5J8CA 4MEYF 1R5GA 2DMPA 2XV4S 1WJEA 2FA5A 4BH9A 4M3EA 1DGWY 5BMZA 4XKBA 1ITYA 1A6IA 3RJPA 1QPIA 2L4AA 2WY8Q 2JWTA 3F23A 1VZ0A 2VASA 2LRDA 2ZO4A 3PNVA 3GTGJ 1VFCA 1P6RA 5D5WB 3ZMUA 4A5NA 3S32A 1SAUA 1LE8A 1JUMA 4J00A 3E6BA 2EZLA 1A35A 1MJ9A 3TKYA 1NHAA 1R22A 4DZJA 4M9SA 4ABZA 2DA4A 4JX5A 1W0TA 3AFHA 2UXXA 2MG4A 3L09A 2GWRA 4FASD 3LSKA 4BQOA 1F5TA 4A3BJ 5FKNA 1G3YA 3QPHA 1BIAA 2DW4A 1FY7A 1DDNA 2KIFA 1X58A 1MBEA 2PMHA 2E5NA 2F6CA 1Z3XA 3OYDA 3HSFA 3WTZA 3CMEI 3KEYA 3BG9A 4L9JA 2RREA 4BU2A 2JZYA 1S7AA 4C3HJ 4QSHA 1PUFB 2DPDA 2PFBA 1Z05A 4YFXF 3LA2A 1YS6A 4ESJA 5LHIA 5FROA 1ETVA 1KZHA 2LH9A 4QTRA 3GWZA 1TBXA 3QPLA 3BR1A 3LNQA 2KZVA 3C18A 1QU3A 1IN4A 2Z16A 5C44J 4KIGA 2QENA 1DU0A 1LEBA 2DFEA 3BG3A 2OA4A 2VXDA 2QZ8A 3WE3A 1NTCA 4XLHA 5EG0A 3QWLA 3VYRB 4KISA 1F43A 5LEKA 1OCCH 5F6FA 1ZYRF 1GXPA 4DYRA 2FMYA 3V4GA 4ENJA 1T6SA 3DTEA 3J7YJ 1VQ9I 2V4JC 4FETA 4Q47A 3BR0A 1U5TC 3FM3A 2FQ4A 2W4SA 1CQTA 1U2WA 2K9QA 3M1CA 2EB7A 2NAZA 5J1RA 4A3MJ 1O57A 4S05A 2JPBA 4IHVA 3T8TA 1MDMA 2VJ5A 3OYCA 4PGHA 5F0HA 1AHDP 3QOEA 3QYBA 2NOGA 3PFYA 4UUSA 2KL4A 5M5XJ 1WFXA 3HKZN 3BR3A 4KMUX 2NVQJ 2HR3A 3AG2H 2AXLA 3V7SA 1S29A 5D5UB 4AYBA 5TGTA 3TMOA 3KE2A 1PVEA 2QYOA 5A2QK 1IDZA 5E8IA 1MNMC 2LNBA 1X1AA 2K9MA 3O8HA 1R6RA 3DFGA 1UZCA 5M5YJ 2YS9A 3H3UA 1JT6A 3BZCA 5ICCA 2CWEA 3VYUB 5L3FA 1M1EB 5JLWA 4ZDLA 3BC8A 4A3DJ 4PSXA 3DTKA 4BACA 1ENHA 2VT2A 2EIKH 3S3OA 1HW5A 2M4KA 4ZJZA 3E5QA 4W97A 1O3SA 2PLYA 1TT5B 3RQ4A 2JJ7A 4YIFA 5ILUA 1T33A 2G0EA 4WX9A 3CCVI 4IQJA 2ESNA 2GXGA 3MMYB 4DOZA 5D4RA 3L1PA 1G3WA 3I54A 2H8WA 3HTSB 3UKGA 3N97A 5HDGA 5B1BH 2E35A 2L4MA 5FRNA 1IXRC 3K1MA 4O6JA 3JCUC 1UHMA 5JI6A 5E3OA 3CCSI 2K3FA 5JFRA 4DJAA 2XUBA 3I9V2 4MIMA 5FLVA 2ZMEA 2MSYA 4M71A 5H6RA 1SD5A 3LSMA 3JR9A 3PJRA 1VQ6I 2L2OA 4MNUA 3K6GA 3KYLA 3TL4X 2ELHA 4XNFA 5D5VB 2QM3A 3OIOA 3M1EA 2JT1A 2K4BA 3KYCB 1WRJA 2F5CA 3KLNA 4XRSG 1R1UA 2DA1A 3K69A 2HVSA 4L0YB 2MFZA 2O61A 2IS6A 4FCYA 1BC7C 2LC2A 2D5VA 6PAXA 1S8NA 2WAEA 2XF6A 5E8GA 1U8RA 2R7QA 3MZ8A 4RAZA 3HZJA 1KA8A 1E3OC 3GEZA 3OYLA 1C0WA 5FLMJ 2P7CB 4RGUA 1Q1HA 5H20A 4A93J 3AG1H 2CO5A 4BDYA 1LE8B 1ORKA 5LFAA 1FTZA 1VQLI 3HPGA 4M73A 1X3ZB 3ZMSA 4IXAA 4LK0F 2LG4A 3CUQB 1W36C 2WY7Q 2B7EA 3CJQB 4HX8A 3LSJA 5FB2A 3BR5A 4RA2A 3MAJA 2DFFA 4XKWA 2J5PA 4FE7A 4KUMA 5HNFA 4PGGA 3TW6A 2IGNA 4L0ZB 3H9JA 2AO9A 1UJ8A 3JRGA 3JRIA 1S6LA 2VKDA 3F3XA 2WADA 4GO1A 3BLYA 3JRFA 3ABTA 3KIOA 3OOUA 2NNNA 2F4OB 2LP0A 2W84A 2A5WA 1ZGAA 1X2NA 3FK6A 4KDPA 4HSRA 1I1GA 4E7SA 2EQRA 5GPCA 1WGXA 5K5QA 2AQFA 4L18B 2KQRA 3ZN1A 4Q5SF 4ZZLA 2IS1A 3GFJA 2Z99A 4E7HA 2NVUB 1ETWA 4JYKA 1ZTRA 3FXKA 4IEJA 5LRRA 3OOPA 2EZHA 3H0DA 2E19A 1STZA 2H94A 4A0XA 1DPUA 3ASOH 1HLVA 3HRUA 4OU0A 4ZDOA 2QQAA 1SVMA 1WQ2A 3GTLJ 4BHPA 3KEOA 5C4JJ 4IZZA 1WSUA 4R1HA 1QO0D 3CCQI 3HUGA 4X1EA 4G7ZF 4XM3A 1UELB 5J1UA 2P81A 1ZKGA 4M3BA 4RAGA 1GXQA 5DS9A 3PNYA 3HOXJ 3G73A 2R4GA 4O3MA 1NG7A 1FZPB 5D8KB 1MSFC 2DU9A 1Y0UA 3CC4I 1YRNA 2FOKA 1G6NA 5FRMA 4U0YA 3IH4A 2N8GA 1HKSA 1X2MA 3ML6A 2DMUA 3DCFA 3QRFF 4A5MA 2V79A 4LFUA 1CF7B 1V5GA 2CS3A 4KNYA 1TWAJ 4XQFA 2H09A 4HSTA 3FISA 4UB6C 1V4RA 2E1OA 2YPRA 3ZQLA 1F36A 2KJBA 5IT9Z 4CCJA 3FKJA 4L9VA 4RMNA 1IRGA 2K27A 1B9MA 4CA0A 1P7JA 3D5RC 4HNVA 1IV8A 3DWLE 1J9IA 4HX4A 2VBYA 3QPSA 2CU7A 4UVBA 3SJMA 3DPUA
chains in the Genus database with same CATH topology
4NNJA 3UNGC 3OYGA 3RTRA 2XAUA 2KP6A 3SEZA 4HNTA 4CCNA 3FBIB 4BE2A 2VKHA 3PUBA 1DP3A 2L7KA 3QYEA 2W82A 2HQAA 1V5EA 2F4IA 3S3NA 3SEQA 4P5OA 4MLOA 3RCOA 3OYAA 2IGKA 3H9QA 2QKLB 3H35A 4OWRB 4BQNA 1PYVA 3NWSA 3HOSA 3L2WA 3HG9A 1Z3YA 2VIXA 4DBRA 5CQEA 2DJIA 2UWMA 1UG0A 4NUBA 3OY9A 4PJLA 1MMAA 2JVGA 3VSKA 2RQQA 3A1YA 4CZCA 3DTIA 4CCLA 2JSPA 4R79A 2GOMA 2W7NA 4NC8A 2X85A 3DQVC 3G2BA 4CCOA 2R7TA 4HG2A 2ZFUA 4F55A 2BVLA 1TZLA 1X1CA 3LSIA 4IX7A 4N4OB 1OR7C 2DT6A 1D0XA 3SYTA 2V6EA 2PJRA 4BJ5C 2R7RA 3F9KA 3W2VA 4BJTA 4DIQA 2X1CA 3OMYA 1IRXA 1X1BA 2A6TA 2VJJA 3CP2A 3DKYA 2LY2A 4X0GA 3OS2A 3OYCA 3OYFA 2K9LA 3OL3A 5HVQC 3IP4B 1Z7LA 4P1WA 3K4JA 1E0EA 4DBQA 3GBGA 3TBIA 4E7LA 1MW7A 4YEJA 3J7AY 3MKYB 2VQGA 3LSHA 3DKXA 3EUAA 3EUKL 3W2WA 3UR3C 1X4OA 1YX3A 3MD2A 4Y4RA 1MMGA 1SFKA 3IUOA 4GRIA 4U87A 4PFOA 2LBFB 1D0YA 1DGRM 2M7AA 4BL0B 4RM2A 2ZSIB 3QYFA 1BR1A 3N05A 4KITB 2WA0A 3K10A 4J01A 2IXSA 3BCAA 2CUJA 2PJRB 3V42A 5KHDA 2BVMA 1JI8A 2KRHA 4Y33A 1WJFA 1N77A 3CP8A 4XN0A 3S8PA 1U0JA 2CW8A 2XSJC 3BCBA 1PJRA 3BG7A 4CCMA 2LOOA 4XMYA 4BEHA 1S9HA 2MD0A 3OWTA 2KDOA 2V7FA 3HPHA 1YX5A 4DGWB 4CUGA 3OYJA 2M3AA 4AVZA 4NQWB 4H4KC 3A2KA 1WJEA 3K4KA 4BE0A 4XOPA 1DGWY 3DU5A 4XKBA 3C2HA 4ITVA 2WY8Q 3HUGB 3OYIA 1VZ0A 3S3MA 2VJIA 4C2TA 2BW3A 2LRDA 2VASA 3PNVA 4LIVA 2L9NA 3OL4A 3DU6A 2HVRA 2WAFA 3PNTA 3S32A 1WJBA 1SAUA 2WAQA 3ONQA 4J00A 2V1NA 1WJCA 2F5VA 1N78A 1X1DA 1LDKB 3L2QA 2LY1A 4XLCA 2DOAA 2V9KA 3AFHA 3S93A 4FASD 3CESA 3LSKA 4BQOA 2X6WA 3FDYA 4HNUA 3L2VA 2NOJB 4B47A 2E5NA 2F6CA 2X1DA 4PFPA 2K5CA 1Z3XA 2L9SA 2VQCA 3OYDA 1DQUA 1W36D 1MNEA 2GOXB 3KEYA 4PJMA 5LD2C 3L2RA 2HU9A 5KNLA 2RREA 4BU2A 4D1QA 4BGDA 3D5LA 3ZCOA 3E1SA 2CV1A 4KJZA 5FROA 5HLTA 2CUZA 2Y0SA 1KONA 1D1BA 2LH9A 2BW3B 2ZXHA 4LITA 4BUPA 2KZVA 1QU3A 1WJ5A 2Z16A 2VLAA 2E1MB 4PK4A 2VXDA 1Y56A 3U21A 4XLHA 4F3QA 1ERDA 2HDWA 3VYRB 4XKCA 3OYEA 3OYHA 4KISA 3EPZA 4E6KG 3OIQA 2BOLA 4XLFA 3H5AA 2DXIA 2X6XA 3DTEA 4PJNA 2V4JC 3FHNA 1J09A 1LVKA 4FETA 4C30A 4F92B 4KT6A 4PJJA 4XN3A 1HA8A 2VQHA 3CZ6A 3DEEA 2W4SA 2VJ4A 3VDXA 4E7KA 3EUHC 1QHGA 3M1CA 2MABA 1BR4A 2M4GA 2CW7A 4HEA2 4JQFA 2V26A 3PSFA 2VPLA 1K6YA 2JA2A 2VJ5A 2R7XA 1D1CA 2CH0A 2HZDA 1FMWA 3DLAA 1OLTA 4G6TB 4LG3A 3VYSB 4PSWA 4RLQA 4ZC3A 4ANJA 3QOEA 3QYBA 3L2UA 3PFYA 1UAAA 2KL4A 2HPMA 4CCKA 3OYNA 1WFXA 2XF5A 3LSGA 4AU7A 4II3A 4HPQA 4XLEA 3IAM2 1YE9A 1AA7A 2KHMA 4ZYAA 4II2A 3ZXSA 4AYBA 5TGTA 2R7OA 3TMOA 3FBNB 2IS2A 3RSNA 1LFPA 3H5NA 4HRIA 1TT0A 1X1AA 2E60A 2K9MA 1BOBA 1R6RA 2XDVA 3VYUB 4ZDLA 3BC8A 4PSXA 3MKZA 4OAYA 3DTKA 4BQQA 1D1AA 4BACA 1FMVA 2VXZA 3S3OA 3VWBA 3W3CA 4C9YA 4F93B 2WB1A 2M4KA 4ZJZA 4YELA 3OYBA 2HPIA 5HNHA 3HL2A 3RQ4A 1X4PA 4ZDPA 2R7SA 1WJAA 4CH7A 4IQJA 3VYTB 4PUSA 3MMYB 3LMMA 3K4BA 2MC4A 3OIPA 5CPRB 3QODA 4DOZA 3OR1C 3AKZA 2CFOA 2R7WA 2VQLA 4BE1A 2VB6A 3H9GA 3PL8A 5FRNA 2AQEA 3HC7A 2CV0A 4N4NB 1BR2A 4DJAA 3I9V2 4E7ZA 2VL8A 3AL0B 1V5FA 2ZXIA 4XL9A 1N75A 3LSMA 4B44A 3PJRA 4BEHB 4IQ4A 2L2OA 4EATA 3K6GA 3KYLA 2MYSA 2KMUA 3TL4X 4XNFA 2E1MC 1LKXA 3W2AA 3OYKA 4E7JA 3D5SC 2HNHA 2JUGA 3OYMA 3OS1A 4RM3A 2HVSA 3CMMA 2MFZA 2IS6A 3OS0A 3K4NA 4B48A 2LC2A 2K3PA 2QKMB 2XF6A 2WAEA 4F52A 2R7QA 4BDZA 4NC7A 2L5QA 2LREA 4ZTJA 3HXLA 2WBMA 2OUMA 2X51A 2IGOA 4OAZA 2Q1ZB 4BXFA 3OYLA 4E4HA 2XC7A 3CF2A 1P9QC 5KCMA 4RLFA 2DCEA 4BJ6C 3MKWB 2KLOA 4BDYA 2X6YA 2XF7A 2LBFA 5LFAA 2OC6A 2W00A 3HPGA 2HVQA 2M0MA 3DPTA 3H5RA 3C2GA 2LG4A 1W36C 1ZELA 2WY7Q 4XONA 3E0JB 5CKTA 2R7VA 2Q2EB 3CJQB 1EA3A 1MMNA 5CQGA 2PMZA 4XKWA 5HNFA 4B3XA 3I3LA 4JOMA 3SDBA 2IGNA 1Z21A 3H9JA 3NWTA 2ELJA 4B43A 2VKDA 3K4MA 1G59A 2WADA 3BG6A 2ZSHB 3BLYA 3SZGA 3ZGKA 3OOUA 3PSIA 2A5WA 2P0WA 3HOTA 3DPLC 4HSRA 4E7SA 2W1OA 2AQFA 1Y6IA 5JHFA 2KQRA 4YRVA 2CMPA 2IS1A 4XR6A 4E7HA 3H0DA 4LIUA 2FUG2 2O5RA 1GLNA 1T0FC 3VSLA 4ZDOA 2IS4A 3M8JA 2KRCA 2UUZA 3CJRB 3K70D 4IZZA 1WJDA 3LL7A 2E5ZA 2M7BA 3ZQQA 3LFUA 4F91B 4XOTA 4XKVA 4XM3A 1UELB 2KPMA 2X1EA 4C2UA 3KX2A 3K4CA 3PNYA 4QPOA 4E7IA 2R4GA 3AL0C 3ZRGA 1NG7A 3HKZA 2DT7B 2JVHA 3K4LA 1MNDA 4BS9A 4U7BA 3A4CA 5FRMA 5HOOA 1D0ZA 1MMDA 2LYCA 2IGMA 4CSWA 4ZTFA 1V5GA 2CS3A 4Y3OA 4XQFA 1G8XA 3ZR8X 2Z2SB 1QHHD 4HSTA 4XORA 4IKFA 2I8DA 4D9JA 2UV1A 3K70C 1T95A 3RPUD 1NG6A 4CCJA 2RNGA 3FKJA 2CV2A 4RMNA 4XLAA 4CA0A 1X19A 3D5RC 3OR2C 4QPQA 2OV7A 3DWLE 2R7UA 2Z1DA 3IAS2 3DPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR1 C;  2XSJ C;  1JI8 A;  3OR2 C;  2V4J C;  1YX3 A;  1SAU A;  2A5W A; 
#chains in the Genus database with same CATH topology
 2M30 A;  1ETO A;  5IP9 J;  2STT A;  2Y69 H;  3OYG A;  5FJ8 J;  4HNT A;  3E7L A;  5ICG A;  2OBP A;  4CCN A;  4A6D A;  3FBI B;  2VKH A;  1GVD A;  2R7Z J;  1YW9 A;  2L7K A;  2W82 A;  3M7G A;  3IL2 A;  2OZ6 A;  1RKW A;  4MLO A;  2FXA A;  4A3C J;  4RDU A;  3HOY J;  2E71 A;  3OYA A;  5JVT A;  3J80 K;  3H35 A;  2R93 J;  4BQN A;  1HKT A;  3NWS A;  3BR2 A;  4DBR A;  2NS0 A;  2V1D A;  2FU4 A;  2O6G E;  4KN4 X;  5IYB J;  3HDD A;  5FLX Z;  4NUB A;  3OY9 A;  1H88 C;  2PI0 A;  3WOD F;  3FMR A;  1MMA A;  5LHG A;  1IO2 A;  2VKE A;  2RQQ A;  3A1Y A;  1HQC A;  3DTI A;  5DV5 A;  4IRI A;  1HST A;  4WXH A;  2DLL A;  1YG2 A;  2V1X A;  3DQV C;  4BQA A;  2R7T A;  2P5V A;  3PO2 J;  2L02 A;  3C3W A;  3DBR B;  2R5Z A;  2BVL A;  2VE8 A;  2RAE A;  1TNT A;  3LWF A;  3MZY A;  3K2Z A;  3Q9S A;  2HOE A;  5GAD J;  2DQL A;  1D0X A;  2HOA A;  2LKS A;  2V6E A;  5CVJ A;  1RIO H;  3F9K A;  2JK3 A;  2TDX A;  2X1C A;  4CHU A;  2Q0O A;  4N9I A;  1T38 A;  1IRX A;  2JA8 J;  1PP8 F;  5HS8 A;  2K7L A;  2VOD A;  3FM5 A;  5K1Y A;  1AKH B;  1S3J A;  4KIF A;  4BBS J;  2HQ5 A;  3I4M J;  5FKO A;  3JRH A;  3MCZ A;  3D0S A;  5F0C A;  4DBQ A;  1H9T A;  1QZE A;  3GBG A;  3TBI A;  3IRQ A;  5EJC A;  4YFK F;  2VQG A;  3ABU A;  3EUA A;  2OAZ A;  1B4A A;  3EUK L;  1XG1 A;  3W6K B;  3W2W A;  5IP7 J;  5JVG F;  1BC8 C;  1WVR A;  4Y4R A;  2HEO A;  2JTV A;  2L0K A;  4AC0 A;  1MBF A;  4V2G A;  3IUO A;  2M1B A;  2QF7 A;  2G7H A;  3BZK A;  4G6D A;  1DGR M;  4BXX J;  2ZSI B;  3QYF A;  2ZJQ F;  2ETH A;  3R0J A;  4KIT B;  2WA0 A;  1ZLK A;  2DMQ A;  2W85 A;  2FSW A;  4I7H A;  3ELK A;  4LD5 A;  1VQ5 I;  2BXY A;  5F1R A;  2V9P A;  1YO5 C;  1LJ9 A;  2VOP A;  1TLH B;  1XC5 A;  3ESW B;  3WHC A;  3F8B A;  4IVN A;  1B9N A;  4CZZ A;  5GTH C;  2LOO A;  4G8X A;  4XMY A;  5DUK A;  3CC7 I;  3GZ6 A;  2COM A;  2CSO A;  2A68 F;  1LUJ B;  1MBK A;  2K40 A;  5F27 A;  3OWT A;  2KDO A;  3GF2 A;  2V7F A;  5FD6 A;  3B73 A;  3HPH A;  1VQP I;  1ZR4 A;  3TP0 A;  1WWX A;  4WK8 F;  1SD7 A;  3HGY A;  2HQR A;  3MZH A;  4I2O A;  2M3A A;  4AVZ A;  3PIO F;  1XPX A;  4H4K C;  4JK1 X;  3K4K A;  3CTA A;  3DU5 A;  1PUF A;  1A36 A;  2DAO A;  2M0C A;  3OSF A;  3R60 A;  1EF4 A;  2NYX A;  1FBU A;  5E1W A;  3HUG B;  3U1D A;  3I64 A;  2LY9 A;  5LHH A;  2RGV A;  3ONQ A;  2K85 A;  5IOY A;  3M9A A;  1LDK B;  2LY1 A;  1W7P B;  3BG5 A;  4XLC A;  1SEU A;  2JN6 A;  2W57 A;  3CES A;  5E20 A;  2QBY B;  5KVR A;  1OFC X;  3H3V K;  3W6J B;  4EM1 A;  1SFE A;  1E3P A;  1R5I D;  1ONV A;  4HV5 A;  4B47 A;  1HC8 A;  2KDZ A;  2QSF X;  4N9H A;  2K5C A;  1NK3 P;  2UZK A;  1DQU A;  4EGZ A;  1X3U A;  5D6F A;  1MNE A;  2EJR A;  4PJM A;  1E2X A;  2ZNY A;  5IPA A;  3J81 K;  2V1U A;  1MJB A;  4MGR A;  5CVV A;  3E5X A;  1LFU P;  3CLQ A;  3ZCO A;  3E1S A;  2E1C A;  2DA3 A;  2JQ7 A;  5HLT A;  1SAN A;  2Y0S A;  3ZN0 A;  1D1B A;  2DYS H;  4LIT A;  4A3G J;  1KU2 A;  5KAF C;  1KGS A;  2HZT A;  3WHB A;  2M9H A;  2PN6 A;  2IAI A;  2M87 A;  3S2W A;  2OCC H;  5ICF A;  3PQK A;  1RPW A;  2VON A;  1ERD A;  2HDW A;  3FIW A;  4XKC A;  1UG2 A;  4E6K G;  4MTE A;  3ECH A;  3BDD A;  4CIC A;  3H5A A;  4RB1 A;  1HCR A;  4F92 B;  5EEA A;  2NS8 A;  3ZQ7 A;  1XGM A;  1YJN I;  5JR3 A;  2VQH A;  3CZ6 A;  1H0M A;  1BR4 A;  4MFE A;  2XHK A;  4AWX B;  5CLS A;  2ISY A;  2CW7 A;  4HEA 2;  1R49 A;  4JQF A;  4ZYG A;  4KYW A;  3H92 A;  4IJA A;  1TQP A;  1WH7 A;  3BWG A;  2CH0 A;  1W5T A;  4B4C A;  2EFN A;  1OLT A;  3U1K A;  3VYS B;  4PSW A;  2Y9Y A;  1F9N A;  4RLQ A;  4ZC3 A;  2ECC A;  2DOF A;  1UAA A;  4HDV A;  2HPM A;  2XF5 A;  3TED A;  4RS8 A;  4Z2Y A;  1CGP A;  3JTH A;  4HF2 A;  1BI2 A;  1YE9 A;  1WPK A;  3QU6 A;  4LJZ F;  4ZYA A;  1RR7 A;  5CJ9 A;  3ZXS A;  2R7D A;  2Z3Y A;  2L9V A;  3FBN B;  2IA0 A;  2IS2 A;  1MMS A;  2A5Y B;  1G4D A;  3IKV A;  3F8M A;  5HDK A;  1LFP A;  1HW2 A;  3H5N A;  1TT0 A;  5K7H A;  1XD7 A;  2E60 A;  3NEU A;  1YS7 A;  1J7K A;  2HXI A;  3M3Y J;  2ME0 A;  4A0Y A;  1OIS A;  5F64 A;  1Y1W J;  1R23 A;  2JPC A;  2KIM A;  3WTX C;  5EEH A;  1OCT C;  4EEF G;  3FMS A;  1XCB A;  1YYV A;  1HSJ A;  2HKO A;  3JSP A;  1FT9 A;  2VXZ A;  1IDY A;  3VWB A;  5LEJ A;  4C9Y A;  2CG4 A;  2WB1 A;  2LKP A;  1J59 A;  2XIG A;  2E1N A;  3OYB A;  5HNH A;  4WXD A;  2QGU A;  3TW7 A;  1X4P A;  1FNN A;  1WJA A;  1QZY A;  4CXF A;  1PP7 U;  3GUD A;  2L9R A;  3VYT B;  1FOX A;  3CUO A;  4RB3 C;  3T5X A;  1K79 A;  2VC0 A;  2CFO A;  3HIF A;  1Z9C A;  1XGS A;  4A2U A;  3PL8 A;  3JRE A;  2MLG A;  3QP6 A;  3VEP A;  3HC7 A;  1VQ7 I;  2CV0 A;  2EK5 A;  4FQG A;  1BR2 A;  2XGE A;  2ZFW A;  2P5L C;  5C3E J;  3T1B A;  1U3E M;  3QOP A;  1JKQ C;  3G4S I;  4OIQ F;  4B44 A;  1IUY A;  2TRT A;  3HBL A;  1IJW C;  3MKL A;  3EDP A;  3CUQ A;  4G94 A;  3Q0U A;  1JHF A;  4U0V A;  3WGG A;  2MYS A;  4P9F A;  1VQO I;  2E1M C;  3W2A A;  4DQ2 A;  3ABL H;  2DK5 A;  2QLZ A;  3HSE A;  2JUG A;  1KU9 A;  1Y8R B;  2KT0 A;  3OS1 A;  3N4M A;  3HEF A;  1ZAR A;  3BTC A;  5FO5 A;  3CMM A;  4KFC A;  1BI1 A;  2HTS A;  2IA2 A;  1XSD A;  3K4N A;  2QKM B;  2EA4 A;  4BDZ A;  4FE4 A;  3H36 A;  2LRE A;  3JRA A;  3RIR A;  3MWM A;  2WBM A;  2OUM A;  3WG9 A;  2KJC A;  2XSD C;  2BYV E;  1TC3 C;  2VC1 A;  1GT0 C;  4BXF A;  1FEX A;  4DNC A;  5DM6 F;  1ACI A;  1P9Q C;  2DTZ A;  4XSZ F;  4RLF A;  1ON1 A;  4DYC A;  3VB2 A;  5AON A;  1MH4 A;  2PBI A;  4FIS A;  4IHS A;  2KLO A;  3HOZ J;  2XPU A;  3Q9V A;  2H1L A;  2XF7 A;  1FTT A;  2NNY A;  3SHF A;  4HBL A;  2YX4 A;  1SFU A;  2E2H J;  3I59 B;  5F1J A;  2JUC A;  1FSH A;  2M0M A;  2RVC A;  3FX3 A;  3H5R A;  4L9N A;  2Q8K A;  2IRF G;  3P7N A;  1B59 A;  1I6H J;  1K78 A;  4I0B A;  2GLO A;  1YJ9 I;  1YIJ I;  1MMN A;  4UXN A;  3HOV J;  3HOW J;  2PMZ A;  1LB2 A;  2RN7 A;  3GLL A;  4B3X A;  2O03 A;  2K9N A;  5FKL A;  3WTV C;  2OU2 A;  3TGN A;  2ELJ A;  4B43 A;  3K4M A;  3VOE A;  3TP3 A;  1T56 A;  5L3C A;  3SZG A;  2F48 A;  3KZZ A;  2VPR A;  1TL8 A;  4AYB N;  1CF7 A;  2ZBK A;  1I3A A;  2XAQ A;  2P0W A;  2PX9 A;  5K5R A;  2K4J A;  5GP9 A;  1VQ8 I;  1ZGW A;  4OIR F;  1Y6I A;  2DA5 A;  2DOD A;  3ZQG A;  4GXO A;  3CCU I;  1N25 A;  1O3R A;  2L54 A;  2CMP A;  4V19 K;  2E7W A;  2GIZ A;  1F4K A;  3DBL B;  2P6S A;  3BP8 A;  4TV7 A;  3ZQH A;  5FLX K;  1T0F C;  1WHU A;  2ZCW A;  2IS4 A;  1ZRE A;  1SFO J;  2PG4 A;  2R92 J;  1BBY A;  1SMT A;  2LF7 A;  4MQ9 F;  4HZF A;  1X1P A;  2M7B A;  4XOT A;  4C2U A;  2L7F P;  2NVX J;  3K4C A;  1K61 A;  1IXC A;  2L7M P;  4E7I A;  4QPO A;  3A0H C;  3G1O A;  3S1R J;  3GTP J;  3HKZ A;  2DT7 B;  3K4L A;  3BT9 A;  3K1P A;  1BOA A;  2X4H A;  4BS9 A;  2EZI A;  3AAF A;  1P2F A;  2FJ1 A;  1YIT I;  3CDH A;  2IGM A;  2OZU A;  1LVA A;  3FXO A;  3CDI A;  2LTP A;  4AIJ A;  1K83 J;  3SXY A;  1R71 A;  5EZG A;  4NDL A;  2WAQ N;  5BPD A;  4IKF A;  1W5S A;  4CDG A;  2UV1 A;  3TDZ C;  1YOV B;  3ZOB A;  1T2K A;  1EV7 A;  1NG6 A;  3BQY A;  2RNG A;  1BI0 A;  4XK4 A;  3ZQF A;  2LMD A;  4XLA A;  5DD8 A;  1X19 A;  3JAM Z;  4FX4 A;  4NHJ A;  3W6V A;  4HF0 A;  3KZY A;  5LLQ A;  3R0A A;  1XMK A;  1RES A;  2HYG D;  4HOB A;  2R7U A;  1H9G A;  2Z1D A;  3FKI J;  1V54 H;  1TNS A;  2R3S A;  5TRD A;  2BY2 A;  2KP6 A;  2P8T A;  4G6Q A;  3TO7 A;  1HW1 A;  4PZJ A;  2QSG X;  4BE2 A;  5DUI A;  4L5I A;  3QYE A;  4BBR J;  5DDG A;  2ACJ A;  2JA7 J;  2F4I A;  3S3N A;  4LB5 A;  4Y52 J;  4RB0 A;  1WI9 A;  1AKH A;  3GTQ J;  1JJ6 C;  3ERE D;  4A3E J;  2KIU A;  3J7A O;  4PDK A;  2MLK A;  4Y7N J;  2PJP A;  3L2W A;  3I53 A;  1HDD C;  5IYD J;  3GFM A;  5CQE A;  2DJI A;  4QWQ A;  2BE5 F;  2EIM H;  1UG0 A;  2ZJ2 A;  3TO9 A;  1FPQ A;  4PJL A;  3SFI A;  3F8C A;  4GYG A;  4CZC A;  4CCL A;  5ICE A;  2XAG A;  2GOM A;  2W7N A;  2B9S A;  2JRT A;  5J4Y A;  3CQZ J;  2EV5 A;  2M8E A;  5AIQ A;  4HG2 A;  1R58 A;  4ENN A;  5IP6 A;  2DPU A;  1TZL A;  1LNW A;  3LSI A;  4KT5 C;  1RI7 A;  1OR7 C;  2H8R A;  2DT6 A;  1DPR A;  2O9L A;  1ZK8 A;  4IRH A;  3S1Q J;  4BJ5 C;  2I10 A;  2R7R A;  3EQL F;  3R4K A;  3W2V A;  3JSO A;  1U5T A;  1BA5 A;  4C3J J;  1X1B A;  2A6T A;  3HGG A;  2QA4 I;  3CP2 A;  3DKY A;  4Y13 A;  2HQN A;  3EET A;  5E1X A;  5B66 C;  3ZMZ A;  3OYF A;  2XPV A;  5HVQ C;  3OL3 A;  2KRF A;  3DF8 A;  1DP7 P;  4E7L A;  2QWW A;  1I27 A;  3CD6 I;  2XB5 A;  3LSH A;  1O3T A;  2Z9O A;  1D5V A;  5DM7 F;  1MIJ A;  5L3G A;  1YX3 A;  3CCJ I;  4IHX A;  4L9T A;  2DN0 A;  3TDU C;  5H2F C;  5DTD A;  1SFK A;  3RKQ A;  4U87 A;  3HRS A;  3ISP A;  3Q3S A;  3IHU A;  1FP1 D;  9ANT A;  1BR1 A;  1BN5 A;  2BZT A;  1W7P D;  2XAJ A;  3N05 A;  4G7O F;  2EA2 A;  3WU0 A;  2MA3 A;  2HDD A;  5GTI C;  2E36 A;  1K78 B;  2HS5 A;  2A07 F;  3HOU J;  4F7Z A;  2VBZ A;  2ZXJ A;  3I71 A;  3CCY A;  3V42 A;  5KHD A;  4IL6 C;  1OJL A;  1JKR C;  2PJR B;  2MBF A;  2BVM A;  4EM2 A;  2OF7 A;  1S7O A;  1SMY F;  5E18 F;  1YW8 A;  3RI4 A;  4MQV A;  1WJF A;  1N77 A;  3CP8 A;  3P5J A;  2A6H F;  1USS A;  1LQ1 A;  1JUP A;  1UHS A;  1W7P A;  2LKX A;  3O8G A;  5D4S A;  3NAU A;  4GFB A;  4CCM A;  1QGP A;  1PJR A;  4KN7 X;  1OYY A;  1YI2 I;  2X6O A;  1S9H A;  1VND A;  2GA2 A;  4ZYE A;  2QBY A;  2DJN A;  2OQG A;  4PJ0 C;  3CO7 C;  1JXS A;  5DCF A;  4XID A;  2O0Y A;  1XN7 A;  4DGW B;  4UNO A;  2TCT A;  4HLY A;  3OYJ A;  1P4A A;  1BJZ A;  2GBY A;  3LA7 A;  2BEO A;  4NQW B;  1APL C;  3A2K A;  3RKY A;  4BE0 A;  2DO7 A;  4XOP A;  4UB8 C;  3FXM A;  1MBH A;  1Y39 A;  1KU3 A;  4M3D A;  4ITV A;  1O7F A;  1XX5 A;  2WWY A;  3J7Z I;  1U8B A;  1FIA A;  4M3G A;  1ZQ3 P;  2RDP A;  1A5J A;  2VJI A;  1ZRD A;  1FX7 A;  4BYY A;  2L9N A;  4ZH4 F;  1IZ1 A;  3O2P E;  3CCE I;  3DU6 A;  2HVR A;  1UFM A;  4HX7 A;  3CCL I;  4HQE A;  5EGO A;  3MFK A;  1I5Z A;  1SAX A;  3GXO A;  4IOA F;  4JX6 A;  1WJC A;  4I99 C;  5DYM A;  1N78 A;  5FKK A;  1X1D A;  4EJW A;  3L2Q A;  4YII A;  3BJ6 A;  2EBI A;  2V9K A;  4EJV A;  3ULQ B;  1D8J A;  2WV1 A;  2RV8 A;  2WTE A;  1SFX A;  3H0G J;  1RRJ A;  3FDY A;  4M6X A;  1OYI A;  3ZMD A;  2XAH A;  2BHY A;  1P4W A;  1DUX C;  1R4N B;  3RQI A;  2KIS A;  3ZPL A;  2X1D A;  4PFP A;  2VQC A;  3WTY C;  2MD5 A;  1SD4 A;  1ULY A;  1J2X A;  1W36 D;  2HOT A;  2V9V A;  5D8L B;  3L2R A;  5LD2 C;  2HU9 A;  3HRT A;  4D1Q A;  4BGD A;  1Z7U A;  4ZYH A;  2M45 A;  4I6Z A;  4ESF A;  3D5L A;  1OCR H;  3BY6 A;  4OIO F;  2F2E A;  3BJA A;  2YX7 A;  4ENK A;  2CQ7 A;  1IV6 A;  5F04 A;  2CUZ A;  2HI3 A;  2MW8 A;  3IWZ A;  2BW3 B;  2ZXH A;  3HRM A;  2FX0 A;  2JMW A;  5ERI A;  4U7D A;  2LDU A;  1VQN I;  4P96 A;  2VLA A;  4I09 A;  2LD5 A;  2E1M B;  2LFB A;  1ZGJ A;  3R61 A;  2BY0 A;  4ZYD A;  4EJT A;  1Y56 A;  3F0C A;  3U21 A;  4F3Q A;  3OYH A;  3OYE A;  3EPZ A;  1JHH A;  3S16 J;  2YU3 A;  1ZHF A;  1REP C;  1IF1 A;  3FHN A;  1EJ9 A;  1J09 A;  1XMA A;  1ZRF A;  4KT6 A;  4PJJ A;  4XN3 A;  2Y48 A;  1HA8 A;  2L01 A;  2VJ4 A;  3QAH A;  3EUH C;  4G12 A;  2CQN A;  1Y0N A;  1ZN2 A;  2V26 A;  4P55 A;  2VPL A;  4RGS A;  3S2H J;  2JA2 A;  1SD6 A;  1YTY A;  2HDC A;  2R7X A;  1D1C A;  2Y31 A;  1FMW A;  4LG3 A;  4G6T B;  1ZG5 A;  1P92 A;  3FK7 A;  4OOI A;  1S7E A;  1OQY A;  1TWH J;  3L2U A;  3V7C A;  3O6B B;  2V6C A;  3OYN A;  4AU7 A;  3P9C A;  1SVL A;  2CQQ A;  4II3 A;  2Y30 A;  3FXQ A;  4HPQ A;  4XLE A;  1T98 A;  1WZ2 A;  1G2H A;  4II2 A;  4CGZ A;  4RBO A;  4BY7 J;  1LEA A;  3RSN A;  4I76 A;  3RKX A;  1U5T B;  5JHU A;  2VBW A;  4MFD A;  2OQR A;  1UCR A;  4HRI A;  1YFH A;  1EH7 A;  4LB6 B;  2PMU A;  3FZV A;  3EYI A;  2ZB9 A;  5E79 C;  1SVO A;  2L7Z A;  1FP2 A;  1XGN A;  2XDV A;  4A6E A;  3FXU A;  1TTY A;  2DDB A;  1XSX A;  4LGW A;  2K9S A;  5CVI A;  3MKZ A;  4BQQ A;  3LOC A;  1FMV A;  4QLC U;  2IBD A;  4MEX F;  3W3C A;  4F93 B;  3E97 A;  2ME6 A;  3G1M A;  4YEL A;  3HL2 A;  5GAG J;  2EV6 A;  2GQQ A;  2R7S A;  5EF6 A;  5K7Z A;  4V2F A;  4CH7 A;  3LQR A;  1NK2 P;  4Q4Z F;  4PUS A;  2MC4 A;  3REO A;  2R7W A;  3OR1 C;  3AKZ A;  3CMA I;  1QVT A;  5H6Q A;  5EYR A;  1KYW A;  4BE1 A;  3I5U A;  1OCP A;  2O8X A;  1VI0 A;  2AQE A;  4HF1 A;  2AHQ A;  1RC9 A;  3BJO A;  1Z77 A;  2DK8 A;  3KP4 A;  4E7Z A;  2VL8 A;  4RGX A;  3FXL A;  5J47 A;  1V5F A;  3I59 A;  2XGX A;  4NC6 A;  4RAF A;  1N75 A;  4BKX A;  1ZH5 A;  2HWV A;  3KP5 A;  1BW6 A;  3ABK H;  3FXJ A;  1RUN A;  5TJJ A;  4ASN A;  1FYK A;  1ZG1 A;  1IN5 A;  2VT3 A;  2Z5U A;  1AOY A;  5IT3 A;  1LKX A;  3CCM I;  4E7J A;  4KMF A;  2H6C A;  3LSP A;  3E3V A;  3OYM A;  4RM3 A;  1VQK I;  3OS0 A;  2Y0S N;  2K3P A;  3I58 A;  1VTN C;  3PO3 J;  2G9W A;  4AUX A;  4H0E A;  3V8K A;  4MHG A;  3PIP F;  1S72 I;  4ZTJ A;  2ECB A;  4GDF A;  1KQ9 A;  1GHC A;  3KP2 A;  4Y17 A;  1HKQ A;  2X51 A;  2ZNZ A;  3NAR A;  2E2J J;  2ESH A;  4OAZ A;  2CRG A;  1IUF A;  4E4H A;  2XC7 A;  3ABM H;  1JJ8 C;  3CF2 A;  1I1S A;  1I39 A;  1BW5 A;  1FLI A;  3MKW B;  1JGS A;  2D2W A;  2EFQ A;  2XKO A;  1ZLJ A;  5EGO B;  2L3D A;  2LBF A;  3GTK J;  2W00 A;  3B6C A;  4GCV A;  3GCM A;  5AIP A;  1K4T A;  2HVQ A;  3WU2 C;  3A01 A;  2FOW A;  3MQ0 A;  1JT0 A;  3FWE A;  3A02 A;  1ZEL A;  4Z6Y A;  2Y2Z A;  4WXC A;  4BHB A;  3HYI A;  4D7N A;  3Q5F A;  5J40 A;  1XCV A;  4XON A;  3E0J B;  2Q2E B;  2RKH A;  1ZAO A;  1A6Q A;  2PEX A;  3LFK A;  1XDU A;  5CQG A;  5LGT A;  5HLG A;  2XRL A;  2LLK A;  1OCO H;  4EGY A;  3SDB A;  1Z21 A;  3NWT A;  1R9T J;  2DOE A;  2ZSH B;  2KKO A;  3WG7 H;  4YG2 F;  4EV0 A;  1P7I A;  1I50 J;  2LSO A;  3S14 J;  4FTH A;  2COB A;  4LK1 F;  2DDA A;  3HOT A;  5DEQ A;  1JKP C;  1BIB A;  1JTX A;  5JHF A;  3C2B A;  3GO5 A;  3RPQ A;  1LFB A;  1K4S A;  3KFW X;  2W24 A;  3TOA A;  5DCM B;  3K7A J;  5GAH J;  1O3Q A;  2CGP A;  2CYY A;  3GW2 A;  2ELK A;  2KRC A;  1K6O A;  2UUZ A;  2FEZ A;  3CJR B;  3K70 D;  5GPA A;  4A3I J;  3LFU A;  2X48 A;  3BRO A;  3L9F A;  4F91 B;  4XKV A;  1LDJ A;  1P4X A;  2WB1 N;  4XLP F;  3KX2 A;  4A3K J;  4HA8 A;  2H6B A;  3J80 Z;  2I5U A;  3AL0 C;  3ZRG A;  3F6V A;  1IW7 F;  2OCE A;  5E3M A;  1W1W E;  3CJT B;  1IRF A;  3A4C A;  4A69 C;  1D0Z A;  2LYC A;  1B1B A;  4XRF A;  4CSW A;  1Y1V J;  1XDS A;  4YFN F;  4ZTF A;  4FT8 A;  1JKO C;  4Y3O A;  1QHH D;  4XOR A;  3B6A A;  4NB5 A;  2I8D A;  1FOW A;  3HM5 A;  4D9J A;  4A12 A;  2GAU A;  4M3F A;  4X6A J;  1T95 A;  3RPU D;  3E6C C;  5FGM A;  4WF2 A;  2CV2 A;  2NVT J;  3GLX A;  1VQ4 I;  2OV7 A;  3ZP5 A;  5HS7 A;  2W48 A;  2FBH A;  4EVI A;  4A3L J;  1J0R A;  3IAS 2;  1YIO A;  5FKM A;  1IAW A;  4NNJ A;  3UNG C;  4CYC B;  1HXD A;  3RPU A;  2XAU A;  3LA3 A;  4BHC A;  3SEZ A;  5K5O A;  5KAI C;  2EWN A;  1YHQ I;  4XRM A;  1S5L C;  2ZME C;  4QIW N;  2HQA A;  1V5E A;  3ZMV A;  1JTY A;  2ID6 A;  3SEQ A;  1PUE E;  2X0L A;  3WGI A;  5E3L A;  2GIV A;  2K86 A;  1R36 A;  3WTU C;  2IGK A;  4OMZ A;  2QKL B;  1UMQ A;  2F4M B;  1PYV A;  5E17 F;  1TP4 A;  4EJO A;  2Z33 A;  4S0H B;  3HG9 A;  2VIX A;  3BTL A;  3CO6 C;  3NQO A;  3R6S A;  5L3D A;  1HDP A;  3M07 A;  1YW7 A;  2DA6 A;  4HYE A;  4ZZD A;  2VOO A;  2FBK A;  2QSH X;  2X9D A;  2O3F A;  2JVG A;  3VFZ A;  1I6X A;  2A3S A;  3VSK A;  2M34 A;  5J4V A;  3I4P A;  2JSP A;  2CFX A;  1IGN A;  3K0L A;  3QPT A;  4CCO A;  2NVY J;  5IT9 K;  2A69 F;  2ZFU A;  4UHT A;  2BBY A;  4F55 A;  4LLG F;  3O3K A;  1RR8 C;  2KZG A;  1X1C A;  2PMZ N;  2EFW A;  1YQA A;  3COA C;  3BPV A;  2PJR A;  4XSX F;  1B6A A;  2VBX A;  3E6M A;  4IHW A;  4AVP A;  1RKT A;  3OMY A;  3BPX A;  1BM9 A;  2LY2 A;  2ICW G;  1JUS A;  1UST A;  2HYF A;  3OS2 A;  1E17 A;  2YR2 A;  2EFP A;  2HYJ A;  1AU7 A;  1Z7L A;  2DA7 A;  4P1W A;  3F6O A;  3K4J A;  1Z6T A;  2GXA A;  1MW7 A;  3D1N I;  3DV8 A;  3BZ6 A;  3J7A Y;  3MKY B;  1GV5 A;  1X4O A;  1QPM A;  2A6E F;  3F22 A;  1ON2 A;  1FYL A;  3NRV A;  4NQW A;  5J3L A;  1MMG A;  3GZN B;  4GRI A;  2LBF B;  4D5F A;  2P7V B;  1D0Y A;  2M7A A;  3JTG A;  3CCR I;  3A01 B;  3K10 A;  4P9U A;  4J01 A;  2OTL I;  1F1Z A;  3WU1 B;  2LK2 A;  2RC4 A;  3BCA A;  3SFZ A;  2YUS A;  2STW A;  4L5E A;  4A3F J;  1T08 B;  2KFD A;  4Y15 A;  3BOQ A;  3HJE A;  4DW6 A;  3MN2 A;  2VKV A;  4O5V A;  3SQN A;  3E6D A;  2UXN A;  4WWC A;  4E70 A;  4Y33 A;  4HDU A;  1VF9 A;  4XN0 A;  3IC7 A;  4B8X A;  4BAY A;  4NBQ A;  5LBQ A;  2FNA A;  4ESB A;  2CW8 A;  1HF0 A;  1UHW A;  4BEH A;  2FF4 A;  4ENM A;  1QVU A;  2FBI A;  2MD0 A;  3J81 Z;  1GV2 A;  5BS6 A;  1TQI A;  1TWF J;  3S17 J;  2IPQ X;  1TWC J;  1YX5 A;  3LAP A;  2D1V A;  3RYR A;  4CUG A;  1W4M A;  1ZRC A;  4LG0 A;  2DBB A;  2IEK A;  2QVO A;  1IN8 A;  2LR8 A;  1B72 A;  4EQQ A;  2H27 A;  3C2H A;  1RZ4 A;  1RET A;  3OYI A;  1EH8 A;  5FFZ A;  5E3N A;  3S3M A;  2BW3 A;  3RDI A;  4C2T A;  4AID A;  1BJA A;  4LIV A;  4DYQ A;  2ADU A;  5D6E A;  4IPA A;  3OL4 A;  5D5X B;  5BQT A;  2WAF A;  2JRM A;  3PNT A;  4CO8 A;  1TQM A;  1WJB A;  2HFH A;  3F72 A;  2WAQ A;  4WCG A;  4D0P A;  3VPR A;  2V1N A;  2F5V A;  2M5W A;  4IRG A;  1QA6 A;  3BTJ A;  1B8I B;  2H1K A;  1FC3 A;  2DOA A;  2IJL A;  3S93 A;  2Y0M A;  5ILS A;  3H1C A;  2X6W A;  1QQI A;  2F5F A;  1NH3 A;  4HNU A;  2ZKZ A;  3L2V A;  2NOJ B;  1XGO A;  2WC2 A;  2CW0 F;  4XLN F;  4M9Z A;  3AG4 H;  1QNT A;  2L9S A;  3H3Z A;  2EIJ H;  3OSG A;  2GOX B;  3K1N A;  1BL0 A;  5KNL A;  2CQK A;  1Z1D A;  3C7J A;  1XMX A;  1RNL A;  1R7J A;  1KU7 A;  3KP7 A;  3HB9 A;  4KJZ A;  2CV1 A;  2EZK A;  2XRO A;  2HTJ A;  1KON A;  4HV6 A;  3WTT C;  2MH2 A;  4BY1 J;  2IP2 A;  4BUP A;  3I4N J;  5KK1 A;  3SDG A;  1O4X A;  1WJ5 A;  3GFI A;  1OCZ H;  3IH3 A;  3DEU A;  4PK4 A;  2RQP A;  3WE2 A;  1U78 A;  3VOD A;  3IH2 A;  2DYR H;  1FBS A;  4N0B A;  2LF8 A;  3GZ5 A;  3DBH B;  2HKX A;  2ZXW H;  2C6Y A;  4OIN F;  2BY3 A;  4L5J A;  2LVS A;  3OIQ A;  2BOL A;  5JLX A;  4XLF A;  3GTJ J;  3DLL F;  5K7F A;  2DXI A;  2X6X A;  4PJN A;  1LVK A;  4C30 A;  2DT5 A;  3DEE A;  3VDX A;  4E7K A;  1QHG A;  2GA1 A;  4AD9 A;  2MAB A;  5C4X J;  2XGC A;  1UB9 A;  2IA1 A;  2M4G A;  3I55 I;  3PSF A;  5EEG A;  1D8K A;  3JW4 A;  5ILV A;  4OMY A;  3F21 A;  1K6Y A;  3IWF A;  3IRR A;  5HLI A;  1RUO A;  2XKP A;  4J19 A;  4AIH A;  2HZD A;  3DLA A;  1QBJ A;  3HHG A;  2XPW A;  4ANJ A;  1WCM J;  3TOB A;  3OV8 A;  1LPQ A;  2ID3 A;  4CCK A;  3LSG A;  3GME A;  4B09 A;  1T0F A;  1BI3 A;  2NRA C;  3HTU A;  4UUV A;  2AXT C;  2FRH A;  3IAM 2;  4K2E A;  4PCQ A;  2EIN H;  4LLL A;  4C2M J;  2JA6 J;  3TO6 A;  1AA7 A;  2KHM A;  1AWC A;  2R7O A;  1FIP A;  1ZG3 A;  2VN2 A;  3S2D J;  2IVM A;  1Z91 A;  4EM0 B;  1DU6 A;  1MD0 A;  1KYZ A;  5J6X A;  2FD5 A;  1BOB A;  5EG0 B;  2YSR A;  4ON0 A;  1R1T A;  2QEX I;  1HOM A;  1LDD A;  1H8A C;  3KEQ A;  1QRY A;  1FWZ A;  1W0U A;  3LSR A;  1Q1V A;  2E34 A;  2FML A;  4LLN A;  5L3B A;  4OAY A;  3GVA A;  1D1A A;  5BNG A;  4JBA A;  4R8H A;  1ODD A;  2GZW A;  3HHH A;  2XAF A;  1EH6 A;  4KIC A;  4RGR A;  4UV8 A;  2O8K A;  4HLX A;  2FE3 A;  1MDM B;  1A31 A;  5J1Y A;  2DMN A;  2HPI A;  2P6T A;  5F0F A;  3RZO J;  4ZDP A;  1D5Y A;  4Q48 A;  3DEW A;  1A04 A;  2JA5 J;  4UUS B;  4ETS A;  3ASN H;  5F08 A;  1U9N A;  1YLF A;  1MBJ A;  3LMM A;  3K4B A;  3OIP A;  5CPR B;  5BOX A;  3QOD A;  2VQL A;  2VB6 A;  3H9G A;  2GM4 A;  2VE9 A;  2QUF A;  1MH3 A;  2EFO A;  2EV0 A;  2JSC A;  4YIR X;  4N4N B;  3S15 J;  1R1V A;  3AL0 B;  3PM1 A;  3KP3 A;  2ZXI A;  4XL9 A;  2IT0 A;  4BEH B;  4IQ4 A;  4OIP F;  3IKT A;  1FJL A;  4EAT A;  3G3Z A;  1PDN C;  1V55 H;  2KMU A;  2XB0 X;  3OYK A;  2Q2E A;  3KPH A;  4BXU A;  3D5S C;  2HNH A;  4IF4 A;  3U9G A;  3IV5 A;  4IHT A;  3U2R A;  4LG0 B;  4B48 A;  2M2E A;  4G9Y A;  4B1R A;  4F52 A;  1IG7 A;  1I3Q J;  4NC7 A;  2L5Q A;  1B72 B;  3HXL A;  2R5Y A;  5J8F A;  5GAE J;  2G7U A;  2IW5 A;  3V7R A;  2XAS A;  2IGO A;  2OPT A;  5A2Q Z;  3JRD A;  3G6E I;  4D5C A;  3QQA A;  2Q1Z B;  1R4M B;  5KCM A;  2E2I J;  3BQZ A;  3KYD B;  1MZB A;  5IYC J;  2DCE A;  3K9T A;  4BJ6 C;  1OR7 A;  3Q0V A;  5DCM A;  4C3I J;  1TWG J;  2X6Y A;  4XBF A;  3FHZ A;  2W25 A;  2XRN A;  3P9I A;  1FOK A;  2ZME B;  2OC6 A;  4MO7 A;  1TW2 A;  2MC3 A;  4M6V A;  3F8F A;  2KIQ A;  2YU9 J;  1IRZ A;  3WGH A;  3DPT A;  3C2G A;  3I0T A;  5HDN A;  1R5H A;  2FNP A;  1YJW I;  4CYD A;  1Y8Q B;  5EZH A;  3CF5 F;  5CKT A;  2R7V A;  1EA3 A;  2GXB A;  1WKM A;  4FX0 A;  1JE8 A;  1ETK A;  2VI6 A;  2MH9 A;  3I3L A;  1E3H A;  1MKM A;  3P9K A;  4JOM A;  3V8L A;  1ETQ A;  2MGQ A;  4UY8 I;  3SZP A;  1G59 A;  2A05 A;  2E7X A;  3BG6 A;  3ZQI A;  2QQ9 A;  4IO9 F;  3ZGK A;  4UUT A;  4MTD A;  4U88 A;  1G3S A;  3PSI A;  4LOC A;  1T8I A;  3L2C A;  4M6Y A;  1FOY A;  3DPL C;  4AM3 A;  4DZP A;  2W1O A;  4W1U A;  3HSR A;  3GYH X;  4YRV A;  4RAY A;  4XR6 A;  3M8F A;  3LST A;  1IC8 A;  2QQ8 A;  1MBG A;  3T0Y A;  1IXS B;  4LIU A;  4AIK A;  1FSE A;  2FUG 2;  2O5R A;  3TQN A;  1GLN A;  4G7H F;  3VSL A;  3K2A A;  4EMS A;  3M8J A;  4M9X A;  5CYV A;  1WJD A;  3LL7 A;  3ZQC A;  1FYM A;  2E5Z A;  2D1H A;  3QP5 A;  3EYY A;  3ZQQ A;  4CYC A;  3ERM A;  2KPM A;  2X1E A;  4A3J J;  5LGU A;  2NXN B;  1JGG A;  2DTR A;  4UV9 A;  3FXR A;  2JVH A;  1EKE A;  3CJN A;  4B3A A;  1MND A;  4EJU A;  2FQ3 A;  1XB4 A;  3ROU A;  4GYI A;  4U7B A;  2HGC A;  2F5D A;  2D45 A;  5HOO A;  1MMD A;  3PUF A;  2CUF A;  3MVP A;  2BXZ A;  2HXO A;  2WV0 A;  5B3S H;  3DXJ F;  1G8X A;  3ZR8 X;  2K02 A;  2R7F A;  2Z2S B;  1L3L A;  2DFI A;  5LRS A;  5FD5 A;  5M5W J;  1FBQ A;  5BPI A;  3G71 I;  3K70 C;  3CC2 I;  2Y75 A;  2F5E A;  5DD4 A;  3C1D A;  5E1Z B;  1MJA A;  1HBX G;  4HAM A;  2XVC A;  1V3F A;  2QCO A;  5HS9 A;  3FF5 A;  5B1A H;  3OR2 C;  4QPQ A;  4S04 A;  2XGD A;  3GFL A;  1OKR A;  1ZR2 A;  3WTS C;  3KZI C;  5EDN A;  1U6G A;  4LMY A;  4A0Z A;  1QZZ A;  5TIS C;  3RTR A;  1KQ8 A;  4I98 B;  5ED4 A;  1Z6R A;  4RB2 C;  3PUB A;  1DP3 A;  2EPF A;  4GGG A;  2BY1 A;  4P5O A;  1YRN B;  1ETX A;  3FMQ A;  3RCO A;  2DA2 A;  3CUQ C;  4JX4 A;  2QQB A;  1VQM I;  2DQR A;  4UVA A;  3H9Q A;  4OWR B;  2HOS A;  3L00 A;  5HOD A;  2M8G X;  3HOS A;  3GTO J;  1GVJ A;  1MSE C;  1OPC A;  1Z3Y A;  4M74 A;  2BGC A;  3LAJ A;  1X3W B;  1KQ0 A;  1G3T A;  2UWM A;  2J5O A;  3S1M J;  3M4O J;  4U0W A;  3MEX A;  3S1N J;  3E5U A;  1J5Y A;  1GDT A;  5M3M J;  3KCC A;  1TW3 A;  3LQQ A;  2OTJ I;  3RYP A;  3WTW C;  1R00 A;  4KIB A;  2DI3 A;  3DP7 A;  4R79 A;  4KA4 A;  1D3Y A;  4NC8 A;  2X85 A;  3G2B A;  1IN6 A;  3M8E A;  3CMY A;  3L7W A;  3GX4 X;  1XTA A;  1L0O C;  3X2Q H;  2CJJ A;  3JAM K;  4IX7 A;  4N4O B;  2EIL H;  2RNJ A;  1IN7 A;  5FFX A;  5L3E A;  2DFH A;  2A61 A;  3SYT A;  3B02 A;  4BJT A;  4DIQ A;  3DKW A;  2PQ8 A;  2P4W A;  3EUH A;  1J75 A;  2VJJ A;  3BR6 A;  5CVU A;  3T8R A;  5B5E C;  4X0G A;  1WH5 A;  2R0Q C;  2OJE D;  2CUE A;  3I56 I;  2Y9Z A;  5LGN A;  3RZD J;  2NS7 A;  3A0B C;  1SC7 A;  2K9L A;  5CVR A;  3CLO A;  1WI3 A;  2BHZ A;  3IP4 B;  2R5Y B;  1K7A A;  4IHY A;  4D7M A;  4I01 A;  1E0E A;  3BTI A;  4I0A A;  5IOZ A;  5IY5 H;  3V8J A;  4I02 A;  4YEJ A;  3DKX A;  2P5K A;  1POG A;  1OYW A;  3UR3 C;  2VUM J;  3MD2 A;  1H89 C;  1U9O A;  1O7L A;  3ECO A;  4HQM A;  1GUU A;  4PFO A;  3PQJ A;  4BNC A;  1W5C C;  2OD5 A;  4BL0 B;  4RM2 A;  3SZT A;  3KLO A;  3ZMT A;  1XS9 A;  3F8N A;  2AS5 F;  2R5Z B;  3RKW A;  4IOC F;  1MGT A;  2IXS A;  4M72 A;  2BV6 A;  2CUJ A;  2ZJR F;  3CDL A;  4JP0 A;  3A03 A;  1ETY A;  3AG3 H;  2ZC2 A;  4HW0 A;  1Z67 A;  3KP6 A;  1JI8 A;  2KRH A;  2CQX A;  3KET A;  2B63 J;  3S8P A;  2ZJP F;  3QU3 A;  4XRS A;  1B8I A;  1U0J A;  4XIC A;  2DMT A;  2XSJ C;  3GTM J;  3BCB A;  3BG7 A;  5M3F J;  3Q0W A;  1OMI A;  3JRC A;  4UVC A;  2ISZ A;  1XSV A;  2B0L A;  3PFI A;  2EH3 A;  3G1L A;  5HLH A;  1T39 A;  4FHT A;  1Z0X A;  2O7O A;  3JRB A;  5J8C A;  4MEY F;  1R5G A;  2DMP A;  2XV4 S;  1WJE A;  2FA5 A;  4BH9 A;  4M3E A;  1DGW Y;  5BMZ A;  4XKB A;  1ITY A;  1A6I A;  3RJP A;  1QPI A;  2L4A A;  2WY8 Q;  2JWT A;  3F23 A;  1VZ0 A;  2VAS A;  2LRD A;  2ZO4 A;  3PNV A;  3GTG J;  1VFC A;  1P6R A;  5D5W B;  3ZMU A;  4A5N A;  3S32 A;  1SAU A;  1LE8 A;  1JUM A;  4J00 A;  3E6B A;  2EZL A;  1A35 A;  1MJ9 A;  3TKY A;  1NHA A;  1R22 A;  4DZJ A;  4M9S A;  4ABZ A;  2DA4 A;  4JX5 A;  1W0T A;  3AFH A;  2UXX A;  2MG4 A;  3L09 A;  2GWR A;  4FAS D;  3LSK A;  4BQO A;  1F5T A;  4A3B J;  5FKN A;  1G3Y A;  3QPH A;  1BIA A;  2DW4 A;  1FY7 A;  1DDN A;  2KIF A;  1X58 A;  1MBE A;  2PMH A;  2E5N A;  2F6C A;  1Z3X A;  3OYD A;  3HSF A;  3WTZ A;  3CME I;  3KEY A;  3BG9 A;  4L9J A;  2RRE A;  4BU2 A;  2JZY A;  1S7A A;  4C3H J;  4QSH A;  1PUF B;  2DPD A;  2PFB A;  1Z05 A;  4YFX F;  3LA2 A;  1YS6 A;  4ESJ A;  5LHI A;  5FRO A;  1ETV A;  1KZH A;  2LH9 A;  4QTR A;  3GWZ A;  1TBX A;  3QPL A;  3BR1 A;  3LNQ A;  2KZV A;  3C18 A;  1QU3 A;  1IN4 A;  2Z16 A;  5C44 J;  4KIG A;  2QEN A;  1DU0 A;  1LEB A;  2DFE A;  3BG3 A;  2OA4 A;  2VXD A;  2QZ8 A;  3WE3 A;  1NTC A;  4XLH A;  5EG0 A;  3QWL A;  3VYR B;  4KIS A;  1F43 A;  5LEK A;  1OCC H;  5F6F A;  1ZYR F;  1GXP A;  4DYR A;  2FMY A;  3V4G A;  4ENJ A;  1T6S A;  3DTE A;  3J7Y J;  1VQ9 I;  2V4J C;  4FET A;  4Q47 A;  3BR0 A;  1U5T C;  3FM3 A;  2FQ4 A;  2W4S A;  1CQT A;  1U2W A;  2K9Q A;  3M1C A;  2EB7 A;  2NAZ A;  5J1R A;  4A3M J;  1O57 A;  4S05 A;  2JPB A;  4IHV A;  3T8T A;  1MDM A;  2VJ5 A;  3OYC A;  4PGH A;  5F0H A;  1AHD P;  3QOE A;  3QYB A;  2NOG A;  3PFY A;  4UUS A;  2KL4 A;  5M5X J;  1WFX A;  3HKZ N;  3BR3 A;  4KMU X;  2NVQ J;  2HR3 A;  3AG2 H;  2AXL A;  3V7S A;  1S29 A;  5D5U B;  4AYB A;  5TGT A;  3TMO A;  3KE2 A;  1PVE A;  2QYO A;  5A2Q K;  1IDZ A;  5E8I A;  1MNM C;  2LNB A;  1X1A A;  2K9M A;  3O8H A;  1R6R A;  3DFG A;  1UZC A;  5M5Y J;  2YS9 A;  3H3U A;  1JT6 A;  3BZC A;  5ICC A;  2CWE A;  3VYU B;  5L3F A;  1M1E B;  5JLW A;  4ZDL A;  3BC8 A;  4A3D J;  4PSX A;  3DTK A;  4BAC A;  1ENH A;  2VT2 A;  2EIK H;  3S3O A;  1HW5 A;  2M4K A;  4ZJZ A;  3E5Q A;  4W97 A;  1O3S A;  2PLY A;  1TT5 B;  3RQ4 A;  2JJ7 A;  4YIF A;  5ILU A;  1T33 A;  2G0E A;  4WX9 A;  3CCV I;  4IQJ A;  2ESN A;  2GXG A;  3MMY B;  4DOZ A;  5D4R A;  3L1P A;  1G3W A;  3I54 A;  2H8W A;  3HTS B;  3UKG A;  3N97 A;  5HDG A;  5B1B H;  2E35 A;  2L4M A;  5FRN A;  1IXR C;  3K1M A;  4O6J A;  3JCU C;  1UHM A;  5JI6 A;  5E3O A;  3CCS I;  2K3F A;  5JFR A;  4DJA A;  2XUB A;  3I9V 2;  4MIM A;  5FLV A;  2ZME A;  2MSY A;  4M71 A;  5H6R A;  1SD5 A;  3LSM A;  3JR9 A;  3PJR A;  1VQ6 I;  2L2O A;  4MNU A;  3K6G A;  3KYL A;  3TL4 X;  2ELH A;  4XNF A;  5D5V B;  2QM3 A;  3OIO A;  3M1E A;  2JT1 A;  2K4B A;  3KYC B;  1WRJ A;  2F5C A;  3KLN A;  4XRS G;  1R1U A;  2DA1 A;  3K69 A;  2HVS A;  4L0Y B;  2MFZ A;  2O61 A;  2IS6 A;  4FCY A;  1BC7 C;  2LC2 A;  2D5V A;  6PAX A;  1S8N A;  2WAE A;  2XF6 A;  5E8G A;  1U8R A;  2R7Q A;  3MZ8 A;  4RAZ A;  3HZJ A;  1KA8 A;  1E3O C;  3GEZ A;  3OYL A;  1C0W A;  5FLM J;  2P7C B;  4RGU A;  1Q1H A;  5H20 A;  4A93 J;  3AG1 H;  2CO5 A;  4BDY A;  1LE8 B;  1ORK A;  5LFA A;  1FTZ A;  1VQL I;  3HPG A;  4M73 A;  1X3Z B;  3ZMS A;  4IXA A;  4LK0 F;  2LG4 A;  3CUQ B;  1W36 C;  2WY7 Q;  2B7E A;  3CJQ B;  4HX8 A;  3LSJ A;  5FB2 A;  3BR5 A;  4RA2 A;  3MAJ A;  2DFF A;  4XKW A;  2J5P A;  4FE7 A;  4KUM A;  5HNF A;  4PGG A;  3TW6 A;  2IGN A;  4L0Z B;  3H9J A;  2AO9 A;  1UJ8 A;  3JRG A;  3JRI A;  1S6L A;  2VKD A;  3F3X A;  2WAD A;  4GO1 A;  3BLY A;  3JRF A;  3ABT A;  3KIO A;  3OOU A;  2NNN A;  2F4O B;  2LP0 A;  2W84 A;  2A5W A;  1ZGA A;  1X2N A;  3FK6 A;  4KDP A;  4HSR A;  1I1G A;  4E7S A;  2EQR A;  5GPC A;  1WGX A;  5K5Q A;  2AQF A;  4L18 B;  2KQR A;  3ZN1 A;  4Q5S F;  4ZZL A;  2IS1 A;  3GFJ A;  2Z99 A;  4E7H A;  2NVU B;  1ETW A;  4JYK A;  1ZTR A;  3FXK A;  4IEJ A;  5LRR A;  3OOP A;  2EZH A;  3H0D A;  2E19 A;  1STZ A;  2H94 A;  4A0X A;  1DPU A;  3ASO H;  1HLV A;  3HRU A;  4OU0 A;  4ZDO A;  2QQA A;  1SVM A;  1WQ2 A;  3GTL J;  4BHP A;  3KEO A;  5C4J J;  4IZZ A;  1WSU A;  4R1H A;  1QO0 D;  3CCQ I;  3HUG A;  4X1E A;  4G7Z F;  4XM3 A;  1UEL B;  5J1U A;  2P81 A;  1ZKG A;  4M3B A;  4RAG A;  1GXQ A;  5DS9 A;  3PNY A;  3HOX J;  3G73 A;  2R4G A;  4O3M A;  1NG7 A;  1FZP B;  5D8K B;  1MSF C;  2DU9 A;  1Y0U A;  3CC4 I;  1YRN A;  2FOK A;  1G6N A;  5FRM A;  4U0Y A;  3IH4 A;  2N8G A;  1HKS A;  1X2M A;  3ML6 A;  2DMU A;  3DCF A;  3QRF F;  4A5M A;  2V79 A;  4LFU A;  1CF7 B;  1V5G A;  2CS3 A;  4KNY A;  1TWA J;  4XQF A;  2H09 A;  4HST A;  3FIS A;  4UB6 C;  1V4R A;  2E1O A;  2YPR A;  3ZQL A;  1F36 A;  2KJB A;  5IT9 Z;  4CCJ A;  3FKJ A;  4L9V A;  4RMN A;  1IRG A;  2K27 A;  1B9M A;  4CA0 A;  1P7J A;  3D5R C;  4HNV A;  1IV8 A;  3DWL E;  1J9I A;  4HX4 A;  2VBY A;  3QPS A;  2CU7 A;  4UVB A;  3SJM A;  3DPU A; 
#chains in the Genus database with same CATH homology
 4NNJ A;  3UNG C;  3OYG A;  3RTR A;  2XAU A;  2KP6 A;  3SEZ A;  4HNT A;  4CCN A;  3FBI B;  4BE2 A;  2VKH A;  3PUB A;  1DP3 A;  2L7K A;  3QYE A;  2W82 A;  2HQA A;  1V5E A;  2F4I A;  3S3N A;  3SEQ A;  4P5O A;  4MLO A;  3RCO A;  3OYA A;  2IGK A;  3H9Q A;  2QKL B;  3H35 A;  4OWR B;  4BQN A;  1PYV A;  3NWS A;  3HOS A;  3L2W A;  3HG9 A;  1Z3Y A;  2VIX A;  4DBR A;  5CQE A;  2DJI A;  2UWM A;  1UG0 A;  4NUB A;  3OY9 A;  4PJL A;  1MMA A;  2JVG A;  3VSK A;  2RQQ A;  3A1Y A;  4CZC A;  3DTI A;  4CCL A;  2JSP A;  4R79 A;  2GOM A;  2W7N A;  4NC8 A;  2X85 A;  3DQV C;  3G2B A;  4CCO A;  2R7T A;  4HG2 A;  2ZFU A;  4F55 A;  2BVL A;  1TZL A;  1X1C A;  3LSI A;  4IX7 A;  4N4O B;  1OR7 C;  2DT6 A;  1D0X A;  3SYT A;  2V6E A;  2PJR A;  4BJ5 C;  2R7R A;  3F9K A;  3W2V A;  4BJT A;  4DIQ A;  2X1C A;  3OMY A;  1IRX A;  1X1B A;  2A6T A;  2VJJ A;  3CP2 A;  3DKY A;  2LY2 A;  4X0G A;  3OS2 A;  3OYC A;  3OYF A;  2K9L A;  3OL3 A;  5HVQ C;  3IP4 B;  1Z7L A;  4P1W A;  3K4J A;  1E0E A;  4DBQ A;  3GBG A;  3TBI A;  4E7L A;  1MW7 A;  4YEJ A;  3J7A Y;  3MKY B;  2VQG A;  3LSH A;  3DKX A;  3EUA A;  3EUK L;  3W2W A;  3UR3 C;  1X4O A;  1YX3 A;  3MD2 A;  4Y4R A;  1MMG A;  1SFK A;  3IUO A;  4GRI A;  4U87 A;  4PFO A;  2LBF B;  1D0Y A;  1DGR M;  2M7A A;  4BL0 B;  4RM2 A;  2ZSI B;  3QYF A;  1BR1 A;  3N05 A;  4KIT B;  2WA0 A;  3K10 A;  4J01 A;  2IXS A;  3BCA A;  2CUJ A;  2PJR B;  3V42 A;  5KHD A;  2BVM A;  1JI8 A;  2KRH A;  4Y33 A;  1WJF A;  1N77 A;  3CP8 A;  4XN0 A;  3S8P A;  1U0J A;  2CW8 A;  2XSJ C;  3BCB A;  1PJR A;  3BG7 A;  4CCM A;  2LOO A;  4XMY A;  4BEH A;  1S9H A;  2MD0 A;  3OWT A;  2KDO A;  2V7F A;  3HPH A;  1YX5 A;  4DGW B;  4CUG A;  3OYJ A;  2M3A A;  4AVZ A;  4NQW B;  4H4K C;  3A2K A;  1WJE A;  3K4K A;  4BE0 A;  4XOP A;  1DGW Y;  3DU5 A;  4XKB A;  3C2H A;  4ITV A;  2WY8 Q;  3HUG B;  3OYI A;  1VZ0 A;  3S3M A;  2VJI A;  4C2T A;  2BW3 A;  2LRD A;  2VAS A;  3PNV A;  4LIV A;  2L9N A;  3OL4 A;  3DU6 A;  2HVR A;  2WAF A;  3PNT A;  3S32 A;  1WJB A;  1SAU A;  2WAQ A;  3ONQ A;  4J00 A;  2V1N A;  1WJC A;  2F5V A;  1N78 A;  1X1D A;  1LDK B;  3L2Q A;  2LY1 A;  4XLC A;  2DOA A;  2V9K A;  3AFH A;  3S93 A;  4FAS D;  3CES A;  3LSK A;  4BQO A;  2X6W A;  3FDY A;  4HNU A;  3L2V A;  2NOJ B;  4B47 A;  2E5N A;  2F6C A;  2X1D A;  4PFP A;  2K5C A;  1Z3X A;  2L9S A;  2VQC A;  3OYD A;  1DQU A;  1W36 D;  1MNE A;  2GOX B;  3KEY A;  4PJM A;  5LD2 C;  3L2R A;  2HU9 A;  5KNL A;  2RRE A;  4BU2 A;  4D1Q A;  4BGD A;  3D5L A;  3ZCO A;  3E1S A;  2CV1 A;  4KJZ A;  5FRO A;  5HLT A;  2CUZ A;  2Y0S A;  1KON A;  1D1B A;  2LH9 A;  2BW3 B;  2ZXH A;  4LIT A;  4BUP A;  2KZV A;  1QU3 A;  1WJ5 A;  2Z16 A;  2VLA A;  2E1M B;  4PK4 A;  2VXD A;  1Y56 A;  3U21 A;  4XLH A;  4F3Q A;  1ERD A;  2HDW A;  3VYR B;  4XKC A;  3OYE A;  3OYH A;  4KIS A;  3EPZ A;  4E6K G;  3OIQ A;  2BOL A;  4XLF A;  3H5A A;  2DXI A;  2X6X A;  3DTE A;  4PJN A;  2V4J C;  3FHN A;  1J09 A;  1LVK A;  4FET A;  4C30 A;  4F92 B;  4KT6 A;  4PJJ A;  4XN3 A;  1HA8 A;  2VQH A;  3CZ6 A;  3DEE A;  2W4S A;  2VJ4 A;  3VDX A;  4E7K A;  3EUH C;  1QHG A;  3M1C A;  2MAB A;  1BR4 A;  2M4G A;  2CW7 A;  4HEA 2;  4JQF A;  2V26 A;  3PSF A;  2VPL A;  1K6Y A;  2JA2 A;  2VJ5 A;  2R7X A;  1D1C A;  2CH0 A;  2HZD A;  1FMW A;  3DLA A;  1OLT A;  4G6T B;  4LG3 A;  3VYS B;  4PSW A;  4RLQ A;  4ZC3 A;  4ANJ A;  3QOE A;  3QYB A;  3L2U A;  3PFY A;  1UAA A;  2KL4 A;  2HPM A;  4CCK A;  3OYN A;  1WFX A;  2XF5 A;  3LSG A;  4AU7 A;  4II3 A;  4HPQ A;  4XLE A;  3IAM 2;  1YE9 A;  1AA7 A;  2KHM A;  4ZYA A;  4II2 A;  3ZXS A;  4AYB A;  5TGT A;  2R7O A;  3TMO A;  3FBN B;  2IS2 A;  3RSN A;  1LFP A;  3H5N A;  4HRI A;  1TT0 A;  1X1A A;  2E60 A;  2K9M A;  1BOB A;  1R6R A;  2XDV A;  3VYU B;  4ZDL A;  3BC8 A;  4PSX A;  3MKZ A;  4OAY A;  3DTK A;  4BQQ A;  1D1A A;  4BAC A;  1FMV A;  2VXZ A;  3S3O A;  3VWB A;  3W3C A;  4C9Y A;  4F93 B;  2WB1 A;  2M4K A;  4ZJZ A;  4YEL A;  3OYB A;  2HPI A;  5HNH A;  3HL2 A;  3RQ4 A;  1X4P A;  4ZDP A;  2R7S A;  1WJA A;  4CH7 A;  4IQJ A;  3VYT B;  4PUS A;  3MMY B;  3LMM A;  3K4B A;  2MC4 A;  3OIP A;  5CPR B;  3QOD A;  4DOZ A;  3OR1 C;  3AKZ A;  2CFO A;  2R7W A;  2VQL A;  4BE1 A;  2VB6 A;  3H9G A;  3PL8 A;  5FRN A;  2AQE A;  3HC7 A;  2CV0 A;  4N4N B;  1BR2 A;  4DJA A;  3I9V 2;  4E7Z A;  2VL8 A;  3AL0 B;  1V5F A;  2ZXI A;  4XL9 A;  1N75 A;  3LSM A;  4B44 A;  3PJR A;  4BEH B;  4IQ4 A;  2L2O A;  4EAT A;  3K6G A;  3KYL A;  2MYS A;  2KMU A;  3TL4 X;  4XNF A;  2E1M C;  1LKX A;  3W2A A;  3OYK A;  4E7J A;  3D5S C;  2HNH A;  2JUG A;  3OYM A;  3OS1 A;  4RM3 A;  2HVS A;  3CMM A;  2MFZ A;  2IS6 A;  3OS0 A;  3K4N A;  4B48 A;  2LC2 A;  2K3P A;  2QKM B;  2XF6 A;  2WAE A;  4F52 A;  2R7Q A;  4BDZ A;  4NC7 A;  2L5Q A;  2LRE A;  4ZTJ A;  3HXL A;  2WBM A;  2OUM A;  2X51 A;  2IGO A;  4OAZ A;  2Q1Z B;  4BXF A;  3OYL A;  4E4H A;  2XC7 A;  3CF2 A;  1P9Q C;  5KCM A;  4RLF A;  2DCE A;  4BJ6 C;  3MKW B;  2KLO A;  4BDY A;  2X6Y A;  2XF7 A;  2LBF A;  5LFA A;  2OC6 A;  2W00 A;  3HPG A;  2HVQ A;  2M0M A;  3DPT A;  3H5R A;  3C2G A;  2LG4 A;  1W36 C;  1ZEL A;  2WY7 Q;  4XON A;  3E0J B;  5CKT A;  2R7V A;  2Q2E B;  3CJQ B;  1EA3 A;  1MMN A;  5CQG A;  2PMZ A;  4XKW A;  5HNF A;  4B3X A;  3I3L A;  4JOM A;  3SDB A;  2IGN A;  1Z21 A;  3H9J A;  3NWT A;  2ELJ A;  4B43 A;  2VKD A;  3K4M A;  1G59 A;  2WAD A;  3BG6 A;  2ZSH B;  3BLY A;  3SZG A;  3ZGK A;  3OOU A;  3PSI A;  2A5W A;  2P0W A;  3HOT A;  3DPL C;  4HSR A;  4E7S A;  2W1O A;  2AQF A;  1Y6I A;  5JHF A;  2KQR A;  4YRV A;  2CMP A;  2IS1 A;  4XR6 A;  4E7H A;  3H0D A;  4LIU A;  2FUG 2;  2O5R A;  1GLN A;  1T0F C;  3VSL A;  4ZDO A;  2IS4 A;  3M8J A;  2KRC A;  2UUZ A;  3CJR B;  3K70 D;  4IZZ A;  1WJD A;  3LL7 A;  2E5Z A;  2M7B A;  3ZQQ A;  3LFU A;  4F91 B;  4XOT A;  4XKV A;  4XM3 A;  1UEL B;  2KPM A;  2X1E A;  4C2U A;  3KX2 A;  3K4C A;  3PNY A;  4QPO A;  4E7I A;  2R4G A;  3AL0 C;  3ZRG A;  1NG7 A;  3HKZ A;  2DT7 B;  2JVH A;  3K4L A;  1MND A;  4BS9 A;  4U7B A;  3A4C A;  5FRM A;  5HOO A;  1D0Z A;  1MMD A;  2LYC A;  2IGM A;  4CSW A;  4ZTF A;  1V5G A;  2CS3 A;  4Y3O A;  4XQF A;  1G8X A;  3ZR8 X;  2Z2S B;  1QHH D;  4HST A;  4XOR A;  4IKF A;  2I8D A;  4D9J A;  2UV1 A;  3K70 C;  1T95 A;  3RPU D;  1NG6 A;  4CCJ A;  2RNG A;  3FKJ A;  2CV2 A;  4RMN A;  4XLA A;  4CA0 A;  1X19 A;  3D5R C;  3OR2 C;  4QPQ A;  2OV7 A;  3DWL E;  2R7U A;  2Z1D A;  3IAS 2;  3DPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...