1JI8A

Solution structure of pyrobaculum aerophilum dsrc/gamma subunit of dissimilatory sulfite reductase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
molecule keywords dissimilatory siroheme-sulfite reductase
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2001-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ji8A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1ji8A01
1YX3A 3OR2C 1JI8A 2V4JC 2XSJC 2A5WA 3OR1C 1SAUA
chains in the Genus database with same CATH superfamily
1X2MA 2NS8A 2W85A 2RQQA 4L5JA 2DO7A 5F64A 2X48A 1YS7A 4EMSA 3IKTA 2EV6A 5KHDA 1J0RA 1YE9A 4HAMA 2EQRA 2O5RA 3FXJA 1HF0A 2A6TA 1ITYA 3HHGA 2M9HA 3QAHA 2EFWA 2NOGA 1JUMA 2KISA 4B3XA 2IRFG 1YS6A 1TQIA 4ANJA 5L3GA 2XV4S 1IW7F 4E7IA 3ZQHA 5LGTA 1IC8A 1B9MA 4EEFG 2JRTA 4DNCA 2R7QA 3TO7A 3DEWA 4IHWA 1Y6IA 1AKHA 3Q0UA 1FTZA 4WCGA 1Z7LA 5D5VB 2VL8A 1K78A 2BW3B 1PP7U 1F4KA 2JMWA 3G2BA 2PJPA 2JA5J 1YJWI 1IDZA 2R3SA 5FLVA 4ZTJA 1HKTA 2PI0A 4LIUA 1B1BA 4R79A 2DOEA 2PMHA 5DS9A 1WH5A 1OR7C 2M3AA 4NQWA 4A6EA 1X19A 1Y8RB 1M1EB 4E7JA 3SDGA 3FM3A 2DODA 2OZ6A 1OYIA 2DDBA 1RUOA 1FLIA 1P4AA 2DMPA 3S1MJ 4CICA 1LUJB 5CYVA 4RM3A 3PJRA 2DCEA 2X6XA 3H36A 2ZNZA 2R0QC 2HVSA 4C3JJ 3FDYA 4RMNA 1S5LC 2WAQA 1X3ZB 1BR4A 3TOAA 2LNBA 3HIFA 2NVTJ 4I01A 4XONA 3ZN1A 2V9KA 2L7MP 2X85A 3CUQC 2XRLA 3JRGA 3NEUA 2KHMA 1JE8A 3KZYA 1P2FA 3GFJA 3CCJI 5ILSA 4UY8I 3MKYB 4EJUA 4IHXA 1V5FA 1SEUA 2XROA 4HQEA 4N9HA 4NC8A 3I3LA 1D0ZA 4DW6A 5DCFA 4XLHA 4S05A 1RZ4A 1WJBA 4A93J 2LFBA 2M4KA 3RTRA 1WPKA 2WAEA 1S3JA 5L3BA 4FQGA 1IN6A 4OWRB 3HOVJ 1P7IA 1V55H 2B7EA 4I98B 2XAJA 3JSPA 3JRDA 1LFUP 3EYYA 5JI6A 1FOXA 5GP9A 4L9JA 1DPRA 3SYTA 3K10A 3VYUB 4G6TB 3S8PA 5IT3A 1R5GA 2DK5A 4ITVA 5DDGA 1JUPA 4IHVA 3JREA 2BW3A 3EYIA 2R93J 1L3LA 1WSUA 3MKLA 4EM0B 3LSGA 5IP7J 2KZGA 3RQIA 1A36A 1WVRA 4BU2A 2VASA 3ZGKA 2H09A 1KU3A 5D6EA 4D7MA 3S2HJ 2BXZA 4J01A 2A6HF 1MBJA 1PP8F 4Y3OA 3WHBA 5ILVA 4JX4A 1RUNA 2HOAA 1BI2A 2DW4A 3M9AA 4CSWA 4YIIA 5M5YJ 2QQBA 2RVCA 4BNCA 5K5OA 2AS5F 1R1VA 1OQYA 4L9VA 4UUTA 3LA2A 2E35A 1XCVA 3DF8A 5J1RA 3VEPA 5DM7F 5LGUA 1ZK8A 3A01A 2VT2A 3OR2C 1DDNA 4E7HA 1B8IB 3UR3C 4D0PA 3E6MA 2ELJA 2NAZA 1LKXA 4F91B 1YTYA 2KFDA 1B8IA 4ENNA 3E5QA 3PFIA 3K4NA 4IVNA 3DP7A 4A0ZA 3BY6A 5E3MA 4FHTA 2FX0A 4R8HA 3HOUJ 5IT9K 5BOXA 3H5RA 3LSTA 1MSEC 3ULQB 3WHCA 4RB3C 4CCLA 4DZJA 4JP0A 3GMEA 1UHSA 2GA1A 3Q9VA 1I6XA 3RYRA 1I39A 1BL0A 4EATA 1YI2I 2XPWA 3S3OA 4A0YA 3BTIA 1UMQA 2JSCA 3H35A 2W57A 5ICGA 1XS9A 2JQ7A 2V1UA 1TBXA 2NVUB 3CMEI 2HNHA 2R7UA 4RGUA 1GVJA 2HZTA 3M07A 2WV1A 3OY9A 1P7JA 1JT6A 2DFFA 2TCTA 4XR6A 3RZDJ 5F6FA 1LE8B 4LJZF 4I2OA 4UB6C 1BI0A 2LY2A 4CYDA 1XG1A 4PJNA 3FKJA 3FBIB 3HEFA 4LMYA 5F27A 2DK8A 3DKYA 4UNOA 4MO7A 2ZO4A 3A02A 1UFMA 2VQGA 3ABTA 1IUFA 2PLYA 1E17A 4YIRX 3EQLF 3T0YA 5E18F 1XPXA 2P8TA 1QA6A 3IH4A 5E1WA 2FNPA 3SEQA 1G3SA 3DTIA 4MGRA 4D5FA 1POGA 3WU1B 2VQCA 2LBFA 3KYCB 2IVMA 4BXUA 1IRZA 1TC3C 1RR8C 2ETHA 4Q47A 2X1CA 1MNEA 1XDUA 3I54A 4Y15A 1MJAA 3U1DA 1FOYA 2RN7A 4XOTA 4GFBA 1G2HA 2ZJRF 1E0EA 2HDWA 1F5TA 2CSOA 4JBAA 4RA2A 4OAZA 5FKOA 5E8IA 1X4PA 1EJ9A 2VOPA 2HDCA 4CHUA 4BGDA 2KL4A 3HRSA 5E3OA 3H5NA 3IH2A 1N25A 3RIRA 1VQ8I 1K78B 4BQAA 1W5CC 2BY0A 1UELB 1TQPA 4HRIA 3IWZA 2IS6A 1OFCX 4EJVA 3HOXJ 5K5RA 5M5WJ 2VXDA 2E1NA 4ZTFA 4XLNF 2UV1A 4ESFA 2CUJA 2P5VA 1UHMA 3CJRB 5HS8A 3BZCA 4EM1A 5HLTA 2CV2A 1S7OA 4FX4A 1UAAA 4XBFA 1LDJA 2W84A 2BYVE 1TQMA 2Y30A 3C7JA 1IN4A 3CCQI 1D1BA 2LP0A 5FKMA 5LLQA 2LYCA 4I09A 3M4OJ 2KIMA 2Y75A 2XDVA 1H0MA 3HB9A 1U5TA 1K4TA 1FBSA 1X1CA 3OYJA 2V4JC 1ZAOA 2MD0A 3OOUA 3CCYA 1GHCA 2Q8KA 3PUBA 3O3KA 4U87A 4WXDA 1A31A 1RESA 1TWFJ 3KCCA 2E2IJ 4ENJA 3ZQLA 3PQJA 1D1AA 3U2RA 4QLCU 1QVTA 4GCVA 1J59A 4N9IA 1B6AA 3RJPA 2QUFA 5IT9Z 1J2XA 5EDNA 2EZIA 2HOSA 3ASNH 3WTWC 1ZRDA 2NVYJ 4YEJA 2BBYA 3ABLH 4NC7A 5ICFA 3GCMA 4A3FJ 1UZCA 3ML6A 2XC7A 2RGVA 1R9TJ 1S72I 4J00A 3CF5F 3CJTB 3EPZA 3BPVA 4RDUA 1NG6A 2W1OA 2CMPA 3BC8A 3FM5A 2LF8A 3CF2A 4FT8A 2VONA 5A2QK 2E1OA 3K1PA 1MNDA 2O3FA 5FD5A 2M4GA 3T8RA 4KNYA 1PUEE 2RV8A 2Y31A 5H6RA 1IF1A 4WK8F 2KIFA 3GTOJ 3WGHA 3OYNA 1NK3P 3Q0VA 2WV0A 3K7AJ 3O2PE 2E1CA 1RRJA 2CQNA 1FP2A 1ZLKA 1MIJA 4HNVA 3ZQQA 3I0TA 1OCRH 1T38A 1MJBA 4E7SA 2LLKA 4RAZA 2L7ZA 3X2QH 4E4HA 3SFIA 4PGGA 4C2MJ 1ETXA 4TV7A 4U88A 3F22A 2AXTC 2QQ9A 3FK6A 4XQFA 2IS4A 1U5TB 1IXRC 3QOPA 1TW3A 3IUOA 2BV6A 2K9MA 2ZMEB 2ME0A 4IOAF 2QSFX 2K4BA 1ETVA 4RLFA 2A5WA 1YQAA 3RPUD 1IAWA 1ENHA 2QA4I 2CUEA 4L0YB 2DYRH 2R7TA 3QPLA 1K4SA 3OS2A 1V3FA 3H9GA 3BPXA 2X6YA 4HQMA 4M9SA 5D5XB 3MAJA 3PFYA 4MHGA 2TDXA 4CCJA 1FTTA 4JOMA 1NTCA 2ADUA 3MN2A 3F6OA 5FROA 1EH6A 5CVUA 3K70C 1CF7A 3R0AA 1FC3A 3HSFA 4A3IJ 1S7EA 1VQ4I 3V8KA 5JFRA 5F1JA 2VIXA 1JKOC 2O6GE 1SMTA 1QZYA 2KZVA 4M3FA 3F6VA 4A5NA 1CF7B 2DQLA 2M1BA 4BQOA 3FIWA 3KEOA 4PZJA 1I27A 3H0DA 2Z99A 2XASA 1Z0XA 3SEZA 2YX7A 4KFCA 1VFCA 3M7GA 2H6CA 4O5VA 2ZKZA 3KP7A 3QYFA 3QQAA 5AONA 5GPAA 4MEXF 3DFGA 3TGNA 2DMNA 4XORA 2F4MB 3CZ6A 2W00A 3FF5A 3PM1A 1MSFC 1KQ8A 2W48A 5C3EJ 2EBIA 2HQRA 2ECBA 2E7WA 3ZMDA 1I6HJ 2ZSHB 1R58A 4MEYF 5C4XJ 2W4SA 3HG9A 3FMSA 3GYHX 3DPTA 1K7AA 3I56I 1HC8A 2R7SA 3EUHC 1P92A 2ID3A 1K79A 5HNFA 1EF4A 1LEAA 4M6YA 1T95A 3WTYC 3FXOA 1IRFA 2ZXHA 4IHTA 4N4OB 4A3JJ 1QU3A 1Z6RA 4XICA 2XIGA 2Q0OA 3WE2A 5IP6A 2XSDC 3G3ZA 4IRHA 4RB0A 2VPLA 1ZRFA 5DCMA 1DUXC 1ZR2A 3HHHA 4M3GA 1ZKGA 2LKSA 2MD5A 2QZ8A 1ON2A 2OCEA 4KN7X 4MTDA 5FKKA 1LJ9A 3GFLA 1O7FA 4ZJZA 4UVBA 1HOMA 2L9VA 4BBRJ 3L2VA 2E7XA 3G73A 1OCTC 3GZ5A 3FK7A 4JX5A 3SZGA 2AQEA 2P7VB 4W97A 4LG0A 1SD5A 5JVTA 2IS2A 4B1RA 2DQRA 4XRSG 1A6IA 5AIQA 3BJOA 2H27A 4LD5A 2V6CA 4U7BA 3VWBA 2B63J 3P9KA 3K70D 4G6DA 2E5NA 1HDDC 1GLNA 1VQ6I 3Q5FA 1IV6A 2G7UA 3OIQA 1RKWA 1BC8C 1YX5A 1ZYRF 2CW8A 2KRCA 2IA2A 3HGYA 3VDXA 3REOA 3ESWB 3S2DJ 4LLLA 1R5HA 1ZGJA 2DI3A 2OCCH 5FLXZ 4A3LJ 1J7KA 1TWHJ 5FGMA 5B5EC 4BDZA 3DKWA 4RLQA 2W7NA 3Q0WA 2JT1A 1U3EM 4G7OF 2VI6A 2XUBA 4KJZA 3PL8A 3GFMA 2CS3A 3JTHA 3KZIC 3C18A 3HOWJ 5CVVA 2FA5A 1ERDA 1MBKA 1S29A 3VYTB 2VPRA 2W82A 1W36D 1N75A 2BXYA 5FRNA 2GM4A 2LVSA 3HC7A 3HOYJ 4BH9A 2VUMJ 2NS7A 4B8XA 2WTEA 3OYAA 2JSPA 3EUHA 5BNGA 1KQ9A 3BR0A 3MQ0A 3BG5A 4IX7A 3N97A 3FXRA 4UB8C 2IGMA 3CCUI 1WFXA 2VBXA 2X0LA 2VQLA 2WADA 5EEGA 2IA0A 3HKZN 1Z91A 2W25A 4YIFA 1VQKI 2KJBA 2Z1DA 3JRAA 1ZREA 5J3LA 1Q1HA 5FO5A 4D9JA 2VKVA 3HM5A 3HRUA 3B02A 1WJ5A 1LVKA 3S1NJ 2VC0A 1Z7UA 2KJCA 2KT0A 2NS0A 1XTAA 2ZXIA 4F7ZA 4BE2A 1H88C 3Q9SA 3I55I 3J80Z 1CGPA 5IY5H 2ZMEC 3SZTA 2DA1A 2IW5A 2QM3A 3G1MA 2UZKA 1GXQA 1R4NB 5K7ZA 3F21A 1AHDP 3GZNB 4IEJA 3V4GA 3WTTC 1YLFA 2QKMB 2K85A 1YO5C 1FYMA 2Y0SA 1Z77A 5IP9J 4QIWN 2JWTA 4ZZDA 2ZMEA 3CC7I 2M7BA 1FSEA 1SFXA 2EIJH 1X1PA 3CUQB 3B6AA 3VPRA 3VFZA 4C9YA 1X1DA 4IHSA 2F4IA 1Y56A 2COMA 3DU5A 4ZZLA 5BQTA 4QTRA 1ZN2A 5HS7A 1JKQC 3TKYA 3OS1A 4IQJA 4XOPA 1KU9A 4HF0A 1Z3YA 5TRDA 2GAUA 2XRNA 3MVPA 4U0WA 2HPIA 1IXCA 3G4SI 2OTJI 5J4YA 2PMZA 2WBMA 3MD2A 5FFZA 9ANTA 5L3EA 2HQNA 4M3DA 1KGSA 1WZ2A 1YRNA 5KAIC 3CC4I 1W7PA 3JTGA 1R4MB 3H9QA 3QOEA 3LA3A 3OL3A 4A6DA 2PJRA 3GLLA 3ABUA 2H8WA 2CO5A 1X1AA 1MMAA 3DCFA 3CCSI 3CC2I 1YW7A 2GXAA 3AG4H 4E7KA 1MBEA 1YHQI 1VQMI 2EJRA 3CDLA 2KQRA 3CJNA 2MW8A 2NYXA 2P5LC 5BPIA 1AWCA 2XGCA 4CCNA 2LRDA 2A61A 2LDUA 1FOKA 2CQKA 3HGGA 1I3AA 3OYCA 4FE4A 2CQQA 4ZYDA 3PNTA 4HNTA 4BY7J 1BOBA 2NNYA 2WAFA 4HEA2 3RDIA 1F36A 3O8HA 2DA5A 2ZNYA 1U78A 3ZMZA 3QP6A 4BHPA 4I99C 5EEAA 4A3GJ 1W5TA 3GZ6A 1JGSA 3LWFA 2ME6A 3IHUA 3CTAA 4Q4ZF 2MLGA 1Y0UA 3PO3J 1P4WA 3GXOA 4HW0A 4XMYA 2L4MA 3TQNA 5A2QZ 4A3BJ 4M3EA 4LK0F 4BY1J 2P6TA 4XRFA 1XN7A 2HOTA 2G7HA 3QYBA 1XD7A 5F0HA 4KDPA 3VOEA 3HTUA 3FZVA 2VC1A 2DFIA 3ERED 4P5OA 4UV9A 3P9CA 3HUGB 1BI3A 2PMZN 1E3OC 1BJZA 4BE1A 4OIRF 1B9NA 2ZSIB 1T8IA 2QF7A 4KICA 2MH9A 2FNAA 1SFKA 3DLLF 4IOCF 2CU7A 2LC2A 2V26A 2EZLA 4L5EA 3J7ZI 3K4LA 4FASD 5CVRA 2VN2A 3WG7H 4OU0A 1S8NA 1NHAA 4MNUA 5IOZA 3F8NA 1G3YA 2UUZA 3DEEA 2A5YB 1O3SA 4YG2F 1QPMA 4PJMA 2V79A 4F3QA 1JKPC 4W1UA 1KU7A 2MBFA 3CLOA 3W3CA 2EV5A 4XNFA 1FIAA 2IGOA 3L2UA 1MDMA 2VE8A 4P1WA 2CRGA 1QZEA 4PDKA 3DQVC 3CUQA 2K9LA 4KIGA 5IPAA 3J81K 1BR1A 3LSJA 1V5GA 2RC4A 4GRIA 4D1QA 1T2KA 2XPUA 5D8KB 3OWTA 1WI3A 4UUSB 3ZMTA 3G6EI 4CZCA 2DFHA 2M0MA 2HXOA 3BG6A 3VSKA 1SD6A 4AWXB 4MFEA 3GTLJ 1APLC 1DGRM 3K4MA 3ZCOA 3C1DA 4B4CA 1ZRCA 2VJJA 1T98A 2EILH 4HBLA 2VKHA 1SFUA 3HKZA 4JYKA 5B1BH 1PUFA 1OCPA 4I0BA 3L00A 4ENKA 3GEZA 3VSLA 1ETKA 1XGOA 3PUFA 4BXXJ 1TTYA 1L0OC 3SHFA 3BR2A 4XLAA 3ABKH 1FX7A 3I64A 4RB2C 3LFKA 4LLGF 3A2KA 3E6CC 1LPQA 1ZGAA 1HSTA 2ESNA 2XAQA 1WKMA 1WRJA 4AIJA 3M8EA 1R5ID 5ERIA 3ZMSA 3J81Z 1VZ0A 3L1PA 3K69A 4LITA 2EZKA 2VBWA 3TP3A 5B1AH 1U8RA 4L5IA 1XMKA 2W24A 4KUMA 2XGDA 4FE7A 4UVAA 2A3SA 4PJLA 1R00A 2HR3A 2FD5A 2OA4A 4ZYAA 2L9RA 2M45A 2ZB9A 2OZUA 2FBHA 4AIKA 1JJ8C 4DYCA 5GTIC 4KMUX 2L0KA 1FZPB 3CCMI 3I59A 4ZDOA 5JHUA 2HQAA 5JLXA 1D1CA 1OJLA 1JJ6C 1JTXA 2F5DA 4IHYA 1Z1DA 1G59A 4XKVA 2A6EF 3IL2A 1Z21A 1FBUA 2JA7J 3DV8A 4Y4RA 4XN0A 4OOIA 3S1RJ 2E60A 3CUOA 3GTPJ 4AYBN 3I4NJ 3U9GA 2JTVA 4K2EA 2IT0A 4G8XA 1OCCH 1OYYA 2VE9A 2P4WA 4FISA 1I1GA 4J19A 1D3YA 2QENA 3E6BA 5EJCA 4HDUA 5JR3A 3BR6A 2ZXJA 5FKLA 2X1EA 4BS9A 1BC7C 4HV5A 4XSXF 1TT5B 2OC6A 2L9SA 2OU2A 3BTJA 3DTKA 2HKXA 2GQQA 1ODDA 2FMLA 2KLOA 3JR9A 3FKIJ 3JW4A 3IP4B 2Q2EA 1ZELA 1MZBA 2DMTA 1JHFA 2LY1A 4CYCA 3LSRA 2E34A 1IO2A 1W7PD 2M5WA 2OTLI 4ZYEA 4HZFA 4X1EA 4C2UA 2COBA 1S9HA 2ESHA 1XSVA 2GOXB 1BA5A 1GV5A 3FX3A 3L2WA 1T08B 3DBHB 1SVOA 2K27A 3S3NA 4KYWA 3OYBA 3RPUA 2DMUA 2VXZA 4MIMA 3AFHA 2E19A 3A0HC 3L9FA 4PSXA 5DYMA 3BR3A 2AXLA 4HX4A 3S32A 2MABA 3GFIA 4A12A 3S16J 1G3TA 2DA2A 5EG0A 1MMNA 2EA2A 2L5QA 4AIDA 3J7AY 5DV5A 1GT0C 5IYBJ 2NRAC 3BTCA 4DZPA 5FJ8J 3OYIA 2IGNA 1GVDA 1OMIA 3UNGC 4RAFA 4IXAA 1OCZH 1LEBA 1JXSA 2LG4A 1HW5A 1QPIA 5DD4A 5GAEJ 2ICWG 2RKHA 4HA8A 1X58A 4KIFA 4NQWB 4UV8A 2M8GX 3B73A 1R36A 3R4KA 2O0YA 4WXHA 5CQGA 3NAUA 1YFHA 2DT5A 1UJ8A 1OPCA 3HSEA 4RGRA 5J4VA 3R0JA 4WWCA 2DPUA 3GLXA 1B72B 3MWMA 4KT5C 3WU0A 3RKWA 2LOOA 3LOCA 1XDSA 2JVHA 3ABMH 4OINF 2STTA 2X9DA 2RREA 3HRMA 4CDGA 4HX7A 3BT9A 3E0JB 2K02A 2YPRA 4XK4A 2P81A 4PCQA 3DBLB 4D5CA 2Y69H 5TJJA 2KDZA 2H8RA 1UHWA 2LBFB 3SFZA 3F3XA 3OYFA 4C2TA 3LNQA 2QYOA 1EKEA 4A0XA 5H20A 3NWTA 2DMQA 3I5UA 3OSFA 2E2JJ 3LSIA 5FLMJ 3QRFF 5F04A 2V1XA 5L3DA 2X1DA 2PFBA 1JT0A 2L7FP 2X6OA 2HS5A 1IN5A 2QVOA 2VBZA 2V6EA 2DYSH 4CA0A 2VQHA 5DEQA 1ON1A 1O57A 4BE0A 4G7ZF 2D1VA 5DM6F 1I5ZA 4AUXA 1H8AC 5CLSA 5LD2C 1AKHB 3ERMA 1WJCA 3MCZA 3O8GA 2DA4A 4PUSA 1TL8A 3SXYA 4CCMA 1TLHB 5CVJA 4NHJA 2IAIA 4XLFA 3V42A 3LQQA 3V7SA 3MEXA 3W2AA 3DKXA 1T39A 4M6VA 4RGXA 2O7OA 2XGEA 2YUSA 3OYLA 1FNNA 1IUYA 1RKTA 2XAHA 3BQZA 2RNGA 2Q2EB 1Z67A 2CH0A 1LQ1A 2VODA 3KP5A 2K7LA 3LFUA 1GV2A 4G9YA 2OAZA 2XKOA 3CP8A 3PQKA 4XKWA 1A04A 5DUIA 1YG2A 3HJEA 4P9UA 4LG3A 3EUKL 4EJOA 1Y39A 2WC2A 2LREA 4DIQA 2DA7A 3TEDA 5GADJ 3K6GA 2I5UA 2CUZA 3J7YJ 3H9JA 3A01B 5B3SH 2O8XA 2QGUA 2YX4A 2KRFA 2XGXA 4BACA 5KCMA 4ESBA 1NH3A 2LY9A 4GO1A 2ZFUA 3K9TA 3U1KA 4A3DJ 2R4GA 1ETQA 3OYKA 4HX8A 5LEKA 2K86A 2ELHA 3FXKA 2ZFWA 1FYKA 2G0EA 3FMRA 3V7RA 1UG0A 1KZHA 4M73A 1XGSA 4QPOA 5EEHA 3TO9A 3WG9A 4BUPA 1FYLA 4ESJA 2R7FA 3OV8A 1W0UA 3KP6A 2CV1A 3E5UA 4CCKA 1MBFA 4BHBA 4GYGA 2KPMA 2QKLB 3JRCA 2NVXJ 2VJ5A 2H1KA 1E3HA 1OYWA 1CQTA 2HU9A 3KE2A 3UKGA 1D0XA 1HQCA 4MTEA 4HG2A 3EETA 2CQXA 4PJJA 2V1DA 1FSHA 1FWZA 4F55A 1J09A 3BP8A 1W36C 3HYIA 3P5JA 1E3PA 1T6SA 2HGCA 1RIOH 2GWRA 3LAPA 3HRTA 4PJ0C 2R7ZJ 5JLWA 1AA7A 2M34A 2MLKA 1JTYA 2K3PA 4BXFA 3CCLI 1KYZA 3L7WA 4F52A 2OF7A 5C44J 1NK2P 1NG7A 1SAUA 3BROA 4A69C 3DWLE 4AVZA 3R61A 1U2WA 2BY1A 4CYCB 1LB2A 3QP5A 4RAYA 3HPGA 4V2GA 4YFKF 2GLOA 1PYVA 2H1LA 2CUFA 3GUDA 4IKFA 4DYQA 3J80K 2JJ7A 4IQ4A 1HA8A 4XLCA 1RR7A 2GZWA 4RGSA 3PNVA 4YFNF 2BOLA 2O9LA 1OR7A 3FISA 1MH4A 5HLGA 4G6QA 4U0YA 3OYDA 1XSXA 3M8FA 4BYYA 2F5FA 2K3FA 3C2BA 1VQPI 1MJ9A 1ZTRA 1BIBA 4MLOA 1K6YA 4Y33A 3AL0B 2Z33A 2XAUA 3AG2H 1ULYA 3GVAA 4BEHB 1TNTA 4G94A 3T8TA 4HYEA 4U0VA 2GOMA 1A6QA 5HS9A 3AG1H 3ECOA 5E3LA 4KN4X 2JZYA 2EWNA 1R6RA 2XHKA 3IRRA 2EK5A 2EFNA 1UG2A 5F1RA 2BEOA 2JPCA 4M3BA 2I8DA 3CMMA 1W5SA 5E1XA 3T5XA 2R7DA 1MNMC 2QQAA 2Z9OA 4KA4A 2BY3A 2YR2A 5GPCA 1W0TA 2L3DA 4RBOA 4GDFA 5EF6A 3OIOA 1QRYA 2CV0A 5B66C 5CPRB 5HNHA 2OJED 2F5VA 5ICEA 1YW8A 1J5YA 2HYJA 2FRHA 3OS0A 1QHGA 2PX9A 4E7LA 4H4KC 4M72A 4CXFA 3KETA 2IGKA 3C2HA 5HDGA 2E71A 2CGPA 4QWQA 3SDBA 5E1ZB 5C4JJ 4FX0A 4O3MA 1RC9A 5LGNA 2VT3A 4XSZF 2R7VA 4HF2A 2X51A 4YFXF 2LKPA 4QPQA 4AIHA 1O3QA 4ZYHA 1PVEA 2MC3A 4M71A 4XM3A 2JA8J 3EDPA 5LFAA 2ISZA 2GBYA 3R60A 1WWXA 5EZHA 4PGHA 2DOFA 1D0YA 2Y2ZA 4L9TA 3S17J 3CDHA 4MFDA 4BEHA 2GXGA 3E5XA 3CO6C 4GGGA 3AG3H 1Q1VA 3LSHA 4L0ZB 2HVRA 3M1CA 1MH3A 4BJTA 5CVIA 3GTKJ 3J7AO 2UWMA 5KK1A 1R49A 2HQ5A 4UUVA 2HZDA 4XLPF 1YJNI 4GYIA 4S04A 3JRHA 3SJMA 1T0FC 4DYRA 1QZZA 3SQNA 3GF2A 3F0CA 3K0LA 1I3QJ 2HVQA 3F72A 3OYGA 3AKZA 2EFOA 3RYPA 4F93B 5HOOA 3NRVA 2MA3A 3W6KB 2IEKA 1TWCJ 5LRSA 1DGWY 1S6LA 4KMFA 4PFPA 4AU7A 2NOJB 1MMDA 3JSOA 2EA4A 1X3UA 4IO9F 2PEXA 3H3VK 3KP2A 1REPC 2GXBA 2D1HA 5J1UA 4L9NA 1IV8A 5GAHJ 3GTJJ 4ZC3A 2DLLA 2HPMA 1TW2A 1ETOA 1P9QC 1X2NA 2Z3YA 2OV7A 3E7LA 1FIPA 5TISC 2XPVA 3D5SC 3HOTA 2M7AA 4OIPF 2ZJ2A 1V5EA 4UXNA 1ZR4A 4D7NA 3BWGA 3CQZJ 5EGOA 4OMZA 2JUGA 1X1BA 2CYYA 3K1NA 2LSOA 5M3FJ 6PAXA 1IRXA 2STWA 1A35A 2F2EA 3WGIA 3EUAA 4CUGA 3M3YJ 3D0SA 2L4AA 5DTDA 2PN6A 4KT6A 3KEQA 5IYCJ 3A03A 3IC7A 5J40A 2CG4A 2CW7A 2GA2A 4OAYA 4IZZA 3BDDA 5HLHA 3FWEA 2XB5A 1R22A 4IRIA 2CFOA 3ROUA 2XSJC 3HBLA 1SD4A 5H2FC 1VQLI 3F23A 3IH3A 4Z6YA 5KAFC 3RZOJ 2MFZA 3MKZA 3PIPF 2XVCA 1KQ0A 3ZN0A 1MW7A 4I7HA 4CH7A 1D5VA 3DPUA 4Y13A 4BBSJ 4MQ9F 3QPHA 2EV0A 2L54A 3QPSA 3LMMA 1K61A 1R1UA 4PFOA 4XL9A 1X4OA 2R7OA 4DGWB 3S15J 2DBBA 1FJLA 5GAGJ 3F8FA 1WHUA 3WTUC 1WI9A 3PO2J 3BQYA 1GUUA 2EB7A 2FBKA 4A5MA 2FU4A 2KRHA 2K9SA 4ASNA 1QGPA 2CJJA 2L2OA 1T56A 5CQEA 1EA3A 1FBQA 4E6KG 1ZQ3P 2QQ8A 5DCMB 3PSIA 2VKDA 3HTSB 3L2CA 3WTZA 3MFKA 4DBQA 2LR8A 2EPFA 4P96A 1WGXA 2KIUA 3DU6A 3BOQA 4HPQA 3CD6I 1DU6A 3TMOA 1D8JA 4OIOF 2QSGX 5F0FA 2HYFA 2FMYA 1MMSA 1IRGA 3KFWX 5EGOB 4FCYA 3VODA 4EV0A 1D8KA 1YIJI 4B47A 3O6BB 2JRMA 2DT6A 3ZR8X 2P0WA 2N8GA 1VTNC 1UCRA 1BBYA 2CFXA 2LF7A 1P4XA 1FEXA 1Z9CA 3B6CA 1X3WB 3BCBA 2PG4A 3T1BA 4NUBA 4RAGA 1YIOA 2EFPA 5FD6A 1ETWA 2EIMH 4LB5A 4C3IJ 3M8JA 3QWLA 2XF7A 1HLVA 4XKBA 3CESA 4V2FA 1MBHA 1ETYA 3BJ6A 5FLXK 3BZKA 1AOYA 2M0CA 1TNSA 3QPTA 3I4PA 4DBRA 1R1TA 3KLOA 4LB6B 1F1ZA 3IWFA 3CCRI 5DUKA 2FF4A 2HTSA 2M87A 2V7FA 3NWSA 2IA1A 3ZMVA 3L2QA 3GWZA 2ECCA 2KMUA 2A07F 3WGGA 1WJFA 4M6XA 4AD9A 1FMWA 4I0AA 5K1YA 3OYMA 3SZPA 2R7WA 1N77A 1ZG5A 1DP3A 2FOKA 3BTLA 2DXIA 2BHZA 1JGGA 3H0GJ 2FSWA 4X6AJ 4A2UA 5JHFA 2OBPA 1P6RA 2BZTA 2F6CA 3KPHA 2HWVA 4WF2A 1RNLA 1A5JA 4AVPA 2BE5F 2L7KA 2R92J 3D5RC 3V8LA 2MC4A 5L3CA 4AM3A 4CO8A 3K4KA 2YS9A 4HV6A 2D5VA 2YU9J 2O8KA 2DFEA 4XRSA 1AU7A 2JUCA 1IJWC 2DPDA 3MZ8A 3ZQIA 3GTMJ 2DA3A 4X0GA 2HFHA 2E1MC 5D4SA 3OYHA 1VF9A 1BR2A 4ZDLA 3I9V2 1SVLA 4EGYA 5E79C 2MYSA 3ONQA 3F8CA 2MG4A 4QSHA 4I02A 4B3AA 2FQ3A 4LG0B 1SD7A 3Q3SA 3GTQJ 2PQ8A 5F0CA 1XMXA 1IXSB 2K9QA 5K5QA 2YSRA 1UB9A 4HSTA 1HW1A 1MD0A 3KZZA 3PIOF 3TW6A 2B9SA 3DTEA 2LD5A 3COAC 2ZCWA 3LSPA 4IF4A 2K4JA 1YW9A 5EZGA 3PNYA 3CCVI 3A1YA 1KA8A 2ISYA 3KYDB 2L9NA 1D5YA 4Y7NJ 2LH9A 1QVUA 4XRMA 2JPBA 5LBQA 4PSWA 3MKWB 1ZG1A 2D2WA 3IKVA 3JAMK 3S2WA 2OQRA 2Y0SN 1OLTA 2FXAA 2DA6A 4M74A 5KNLA 1ZG3A 2JA2A 3WODF 4LOCA 4Y17A 3TP0A 5D5UB 1HW2A 1N78A 3QU3A 4A3MJ 5AIPA 4OIQF 5FRMA 2R5YA 1XCBA 2RDPA 1LDKB 3LAJA 4HNUA 4ABZA 1K6OA 5ICCA 1TWGJ 2YU3A 1BM9A 2OPTA 1TT0A 3BG3A 3OL4A 2V9VA 1XC5A 4BKXA 1V54H 2BHYA 3A4CA 2FUG2 2WY7Q 3DEUA 2NNNA 1XGMA 2VLAA 2KKOA 3FXQA 5DD8A 3HOSA 1GXPA 4BL0B 3HPHA 3W2WA 5E17F 4BHCA 4KITB 3ZMUA 1IGNA 2F5CA 3D1NI 1IZ1A 5LHGA 4ETSA 2ACJA 3QU6A 3RKXA 1DU0A 3H3ZA 3TOBA 2XAGA 5D8LB 2WB1N 2XB0X 2KDOA 2RQPA 4FTHA 2IXSA 3F9KA 3AL0C 3VYSB 3BZ6A 3PSFA 3F8MA 1LFBA 1BJAA 1RETA 2VBYA 2M8EA 3N05A 3C3WA 4KISA 1YITI 2Y0MA 2ZJPF 4B44A 1E2XA 1Y8QB 1YOVB 1QBJA 4WXCA 3I59B 1WH7A 2QSHX 2J5PA 2KP6A 1O3TA 3TW7A 1ZARA 3LA7A 2K5CA 3FXUA 3RCOA 3CMYA 5E8GA 3FBNB 3ELKA 1HKSA 1SVMA 5GTHC 2VB6A 1KONA 5K7HA 1XSDA 1U0JA 4OMYA 1HCRA 3G1OA 1BI1A 3KYLA 5IOYA 2R5YB 3WTXC 1BW6A 2QWWA 2R5ZA 4IL6C 2IBDA 1G6NA 1PUFB 3HXLA 2CW0F 3RPQA 1EV7A 3K4CA 4JK1X 1WCMJ 5M3MJ 2QEXI 1Z6TA 4U7DA 2HYGD 3K4BA 2WA0A 3AAFA 2FJ1A 1YRNB 1W7PB 2ZC2A 5HDNA 3BLYA 3G71I 2UXNA 3JRBA 3ZQCA 4YELA 3FHNA 3V8JA 3BG9A 2D45A 2X6WA 1HBXG 3FXMA 1RI7A 2JVGA 4HSRA 1QNTA 4Z2YA 2HDDA 4JX6A 4L18B 3VYRB 4II2A 3OOPA 1Y0NA 2EH3A 2EINH 2Z2SB 2VOOA 4O6JA 2M30A 1ORKA 4H0EA 2DU9A 2UXXA 4YRVA 3I4MJ 3GBGA 1XMAA 5TGTA 2J5OA 2GIVA 1KYWA 2P7CB 2OD5A 2VKEA 1BIAA 2P6SA 3HSRA 2XF6A 3E97A 1ZGWA 1U5TC 3H1CA 1DPUA 2XF5A 1IDYA 4NBQA 3LQRA 2IP2A 1LNWA 1O3RA 4EQQA 1YX3A 1SAXA 1JUSA 4Q48A 2E5ZA 3TO6A 1XGNA 1B59A 2H94A 1KU2A 5HDKA 4V19K 1OKRA 3ISPA 3ECHA 4BJ6C 1R7JA 3GX4X 3D5LA 1FPQA 2Y9ZA 1QQIA 2FEZA 4RS8A 3NQOA 5HLIA 2WWYA 1K83J 3BCAA 3S3MA 5LRRA 4I76A 1U8BA 5J47A 3LSMA 3GW2A 2CWEA 2F48A 4Q5SF 1GDTA 1W1WE 2V1NA 2LMDA 2ZBKA 1HDPA 3LSKA 1TWAJ 4C30A 1O7LA 3A0BC 2DTZA 5BS6A 4PK4A 2L01A 3OMYA 2E1MB 4WX9A 4M9XA 4UVCA 3HZJA 3JRFA 3P7NA 1LDDA 3CO7C 1QHHD 2AQFA 1WJAA 1SANA 2QBYB 3ZOBA 3ASOH 1BW5A 1EH7A 3N4MA 3E1SA 3OYEA 5H6QA 1H89C 1C0WA 1MDMB 1Z3XA 1LVAA 4LGWA 2H6BA 1VI0A 1F43A 1U6GA 3U21A 2GIZA 1I1SA 3DLAA 3VB2A 1ZH5A 1I50J 5FB2A 2NXNB 1Y1WJ 1IG7A 2ID6A 3RKQA 3WTSC 2DN0A 3KEYA 4NB5A 1YJ9I 3QODA 3CLQA 4C3HJ 2F5EA 1Y1VJ 4IRGA 4F92B 4CZZA 5FFXA 5CKTA 1DQUA 2Z5UA 2PMUA 4LK1F 1VQ7I 3IV5A 2L02A 2WY8Q 1IN7A 4DJAA 4E7ZA 1SC7A 2R7XA 4BQQA 3I58A 1BN5A 4AYBA 4EGZA 4MQVA 5JVGF 2R5ZB 5J1YA 3BR1A 4CCOA 3CMAI 3ZPLA 1BOAA 3K1MA 2X4HA 3FMQA 2LK2A 3K2AA 2PJRB 3HDDA 2BY2A 3KX2A 2WAQN 3MZYA 3W2VA 3QYEA 3MZHA 1ZLJA 4EJWA 4DQ2A 2WB1A 1XX5A 4XLEA 4AC0A 3FHZA 1JI8A 1WJDA 4XN3A 1RPWA 5ED4A 3KP4A 5KVRA 3ZQGA 2HI3A 3H92A 2PBIA 4II3A 1XB4A 4UHTA 1Z05A 3KP3A 1VQOI 2RAEA 2FOWA 2VJIA 2XAFA 3ZQ7A 5HVQC 2LTPA 3WTVC 3MMYB 4P9FA 4NNJA 3CCEI 1VNDA 2DT7B 3BG7A 3ZP5A 3ZQFA 1J9IA 4ZYGA 3GO5A 2OUMA 3LL7A 3V7CA 2JN6A 3HL2A 3KIOA 4R1HA 4HOBA 1B72A 2NVQJ 4JQFA 4IPAA 1T33A 4IJAA 3K2ZA 5ILUA 3I71A 4M9ZA 4BQNA 3G1LA 3JCUC 3R6SA 4RB1A 2JK3A 2FE3A 1SFEA 2EIKH 2AO9A 3L2RA 2DDAA 1HKQA 2P5KA 2XKPA 1HXDA 5FKNA 4B48A 4HLYA 5IYDJ 3CP2A 3ZRGA 3IAS2 3S93A 4I6ZA 3H5AA 1VQ9I 4ON0A 1FMVA 1PJRA 2Q1ZB 1USSA 2ELKA 1U9OA 2FQ4A 2K9NA 5E20A 2V9PA 2O61A 4ZDPA 4UUSA 2G9WA 4KIBA 3TBIA 4NC6A 2F4OB 3IAM2 5BMZA 2QCOA 2KIQA 4DOZA 2B0LA 4LLNA 1H9TA 4ZH4F 5J6XA 3OSGA 1JHHA 1IN8A 2HEOA 2ZXWH 5J8CA 2R7RA 2A69F 4BAYA 5J8FA 3JAMZ 1SMYF 4GXOA 4LIVA 1MGTA 1ONVA 3WE3A 2AHQA 3RSNA 1MMGA 4CGZA 5EYRA 2EZHA 1B4AA 1TZLA 2IJLA 1H9GA 2HKOA 1WQ2A 2QBYA 1FT9A 3S1QJ 1MBGA 3P9IA 4EVIA 1MKMA 2E2HJ 2OQGA 3TL4X 2MH2A 1U9NA 5CJ9A 4EM2A 3CDIA 1YYVA 3KLNA 4BJ5C 4Y52J 1V4RA 2DJIA 1WJEA 3DPLC 2Y48A 1SFOJ 3F8BA 3L09A 3RI4A 1OCOH 2C6YA 3GTGJ 4A3CJ 1STZA 5BPDA 4G12A 1TP4A 1G4DA 1ACIA 1PDNC 2BVMA 4N0BA 1J75A 2HTJA 3E6DA 3OIPA 1VQNI 1S7AA 4ENMA 3S14J 1EH8A 4XIDA 3E3VA 2MGQA 5LHIA 1FP1D 2I10A 2DAOA 2EFQA 3NARA 4G7HF 1OISA 4BDYA 5D6FA 3TDZC 2A68F 5D5WB 5EG0B 1T0FA 1DP7P 2K40A 4HLXA 1VQ5I 2IS1A 2E36A 2LKXA 3ZXSA 1FOWA 2DTRA 1O4XA 4HDVA 3DXJF 4LFUA 3W6JB 1JKRC 2A05A 3DBRB 1R71A 4HF1A 2JA6J 4NDLA 5LEJA 1G8XA 4XKCA 4A3KJ 4A3EJ 4N4NB 4P55A 4S0HB 3C2GA 3RKYA 1G3WA 1R23A 3BR5A 3K4JA 3H3UA 2O03A 2IPQX 3OR1C 2Y9YA 2BVLA 3HUGA 1HSJA 1USTA 5M5XJ 2ZJQF 4FETA 1QO0D 2QLZA 2Z16A 5F08A 2M2EA 3IRQA 1FY7A 1ZHFA 2HXIA 3I53A 2HOEA 3FXLA 4EJTA 5D4RA 4RM2A 2VJ4A 3BJAA 4B43A 3TDUC 1LFPA 4E70A 2FBIA 2CQ7A 4B09A 2DOAA 2DJNA 3M1EA 2TRTA 1LE8A 2BGCA 3CJQB 5K7FA 3RQ4A 5L3FA 5E3NA 2RNJA 3WU2C 3JRIA 5LHHA 3HOZJ 2MSYA 3W6VA 5HODA 1W4MA 1F9NA
chains in the Genus database with same CATH topology
4X0GA 3E0JB 3L2VA 2E1MC 2RQQA 3OYHA 3SZGA 1BR2A 2AQEA 4ZDLA 5KHDA 3I9V2 1YE9A 2O5RA 2IS2A 2A6TA 2LBFB 4C2TA 2MYSA 3ONQA 3OYFA 3NWTA 4U7BA 3VWBA 3K70D 4B3XA 2E5NA 3LSIA 1GLNA 4ANJA 2X1DA 4E7IA 3OIQA 4HSTA 1YX5A 2CW8A 2R7QA 2KRCA 2V6EA 3VDXA 1Y6IA 4CA0A 2VQHA 3DTEA 4BE0A 1Z7LA 4BDZA 4RLQA 2VL8A 2W7NA 2BW3B 3G2BA 5LD2C 3PNYA 3A1YA 1WJCA 4PUSA 4KJZA 3PL8A 2L9NA 4CCMA 2CS3A 2LH9A 4ZTJA 4XLFA 4PSWA 3V42A 4LIUA 3MKWB 4R79A 3W2AA 3DKXA 1ERDA 1OR7C 2M3AA 3VYTB 2W82A 1X19A 3OYLA 1OLTA 1N75A 1W36D 4E7JA 5KNLA 2JA2A 5FRNA 2RNGA 2Q2EB 3HC7A 1N78A 2CH0A 4RM3A 3PJRA 5FRMA 2DCEA 2X6XA 1LDKB 3LFUA 2HVSA 3OYAA 2JSPA 3FDYA 4RMNA 4HNUA 2WAQA 4IX7A 3CP8A 4XKWA 1BR4A 2IGMA 1WFXA 4XONA 2VQLA 4LG3A 3EUKL 2WADA 2V9KA 2LREA 1TT0A 2X85A 4DIQA 3OL4A 3K6GA 2Z1DA 2CUZA 3H9JA 2KHMA 3A4CA 2FUG2 2WY7Q 4D9JA 2VLAA 3HOSA 4BL0B 4BACA 1WJ5A 1LVKA 3HPHA 3MKYB 5KCMA 3W2WA 1V5FA 2ZXIA 4BE2A 2ZFUA 4KITB 2R4GA 3OYKA 4NC8A 3I3LA 1D0ZA 4XLHA 1WJBA 2M4KA 3RTRA 2WAEA 4OWRB 1UG0A 4BUPA 4QPOA 2KDOA 2IXSA 2QKMB 3F9KA 3AL0C 2Y0SA 3VYSB 3PSFA 3SYTA 3K10A 3VYUB 4G6TB 3S8PA 4CCKA 2CV1A 4ITVA 2KPMA 2BW3A 3N05A 2QKLB 2M7BA 4KISA 2VJ5A 4B44A 3LSGA 4C9YA 2HU9A 2KP6A 1X1DA 1D0XA 4HG2A 2F4IA 4PJJA 4BU2A 1Y56A 2VASA 2K5CA 1J09A 3DU5A 4F55A 3RCOA 3ZGKA 1W36C 3FBNB 3OS1A 2VB6A 4IQJA 4XOPA 1KONA 1Z3YA 4J01A 1U0JA 2HPIA 3KYLA 1AA7A 2PMZA 4Y3OA 2K3PA 2WBMA 4BXFA 4F52A 3MD2A 1NG7A 1SAUA 3DWLE 4CSWA 3HXLA 4AVZA 3K4CA 3H9QA 3QOEA 3OL3A 3HPGA 2PJRA 1PYVA 1X1AA 4IKFA 3K4BA 1MMAA 2WA0A 4IQ4A 1HA8A 4XLCA 4E7KA 3BLYA 3PNVA 2KQRA 3OR2C 2BOLA 4E7HA 4YELA 3UR3C 4CCNA 3FHNA 3OYDA 2LRDA 2ELJA 2X6WA 1LKXA 4F91B 2JVGA 4HSRA 3OYCA 4MLOA 1K6YA 3PNTA 4Y33A 3AL0B 4HNTA 3K4NA 1BOBA 2XAUA 4II2A 3VYRB 2WAFA 2Z2SB 4HEA2 4BEHB 3H5RA 4YRVA 3GBGA 5TGTA 2GOMA 4CCLA 2XF6A 1R6RA 4EATA 4XMYA 3S3OA 2XF5A 3H35A 2I8DA 1YX3A 3CMMA 2HNHA 2R7UA 2E5ZA 3OY9A 3QYBA 4BJ6C 4XR6A 3D5LA 4P5OA 2LY2A 3HUGB 3BCAA 3FKJA 3FBIB 4PJNA 3S3MA 2CV0A 4BE1A 5CPRB 3DKYA 3LSMA 5HNHA 2ZSIB 2F5VA 2V1NA 3LSKA 2VQGA 4C30A 1SFKA 3OS0A 1QHGA 4PK4A 3OMYA 2E1MB 2LC2A 4E7LA 4H4KC 2V26A 2IGKA 3C2HA 3K4LA 4FASD 3SDBA 1QHHD 3SEQA 2AQFA 3DTIA 2VQCA 1WJAA 2LBFA 2R7VA 2UUZA 3DEEA 2X51A 4QPQA 2X1CA 3E1SA 3OYEA 1MNEA 4XM3A 5LFAA 1Z3XA 4PJMA 4F3QA 4XOTA 3U21A 3W3CA 4XNFA 3DLAA 1E0EA 2HDWA 2IGOA 1D0YA 4OAZA 3L2UA 1X4PA 4P1WA 3DQVC 3KEYA 4BGDA 2KL4A 2K9LA 4BEHA 3H5NA 3QODA 1BR1A 1V5GA 1UELB 4HRIA 4F92B 4GRIA 2IS6A 3LSHA 4D1QA 5CKTA 3M1CA 1DQUA 2VXDA 3OWTA 4BJTA 4ZTFA 2HVRA 2UWMA 2UV1A 2CUJA 4CZCA 2M0MA 2HZDA 3BG6A 3CJRB 3VSKA 5HLTA 2WY8Q 4DJAA 4E7ZA 2CV2A 1DGRM 1T0FC 3K4MA 1UAAA 2R7XA 3ZCOA 4BQQA 2VJJA 4AYBA 1D1BA 2HVQA 2VKHA 3OYGA 2LYCA 3AKZA 3HKZA 4F93B 2XDVA 5HOOA 4CCOA 1DGWY 1X1CA 3VSLA 2PJRB 3OYJA 3KX2A 2V4JC 3W2VA 2MD0A 3QYEA 3OOUA 2WB1A 3PUBA 4PFPA 4U87A 4AU7A 2NOJB 1MMDA 4XLAA 4XLEA 1JI8A 1D1AA 1WJDA 4XN3A 3A2KA 4ZC3A 2HPMA 1P9QC 4II3A 2OV7A 3D5SC 3HOTA 2VJIA 2M7AA 5HVQC 3MMYB 4NNJA 1V5EA 2DT7B 3BG7A 1VZ0A 4YEJA 3LL7A 2OUMA 4LITA 4NC7A 2JUGA 3HL2A 1X1BA 2XC7A 4J00A 4JQFA 1IRXA 3EPZA 1NG6A 2W1OA 2CMPA 3BC8A 3EUAA 4CUGA 3CF2A 4BQNA 4KT6A 1MNDA 4PJLA 2M4GA 3L2RA 4B48A 3CP2A 2CW7A 4OAYA 3ZRGA 3IAS2 3S93A 4IZZA 3H5AA 4ZYAA 3OYNA 1FMVA 1PJRA 2Q1ZB 2CFOA 2XSJC 4ZDPA 2MFZA 3TBIA 3MKZA 4ZDOA 2HQAA 1D1CA 3IAM2 1MW7A 3ZQQA 4CH7A 3DPUA 4E7SA 4DOZA 4E4HA 3LMMA 1G59A 4XKVA 4PFOA 4XL9A 1X4OA 1Z21A 4Y4RA 2R7OA 4XN0A 4DGWB 2E60A 2R7RA 4XQFA 2IS4A 4LIVA 3IUOA 2K9MA 3RSNA 1MMGA 1TZLA 4RLFA 2A5WA 3RPUD 2KRHA 3TL4X 2R7TA 2L2OA 3OS2A 5CQEA 1EA3A 3H9GA 4E6KG 2X1EA 2X6YA 4BJ5C 3PSIA 4BS9A 2VKDA 2DJIA 3PFYA 4DBQA 1WJEA 2OC6A 3DPLC 4CCJA 2L9SA 3DTKA 4JOMA 3DU6A 4HPQA 5FROA 3TMOA 2KLOA 3K70C 3IP4B 1ZELA 2BVMA 2LY1A 2VIXA 3OIPA 4B47A 2DT6A 3ZR8X 2P0WA 2KZVA 4BQOA 4C2UA 3BCBA 1S9HA 3H0DA 4NUBA 2GOXB 3L2WA 3SEZA 4BDYA 3M8JA 3S3NA 2XF7A 4XKBA 3CESA 3OYBA 2VXZA 3AFHA 4PSXA 2IS1A 3QYFA 3S32A 2MABA 3ZXSA 4DBRA 1MMNA 1G8XA 2L5QA 3J7AY 4XKCA 4XORA 2V7FA 4N4NB 3CZ6A 3NWSA 2W00A 3C2GA 3L2QA 3K4JA 3OR1C 2KMUA 3OYIA 2IGNA 3UNGC 1WJFA 2ZSHB 2BVLA 2LG4A 2W4SA 3HG9A 1FMWA 2R7WA 3OYMA 1N77A 3DPTA 4FETA 1DP3A 2R7SA 3EUHC 4NQWB 2DXIA 2Z16A 5HNFA 1T95A 5JHFA 5CQGA 2ZXHA 2F6CA 4N4OB 1QU3A 4RM2A 2VJ4A 4B43A 1LFPA 2L7KA 3D5RC 2DOAA 2VPLA 2MC4A 3K4KA 3CJQB 3RQ4A 2LOOA 2JVHA 4ZJZA 2RREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX3 A;  3OR2 C;  1JI8 A;  2V4J C;  2XSJ C;  2A5W A;  3OR1 C;  1SAU A; 
#chains in the Genus database with same CATH topology
 1X2M A;  2NS8 A;  2W85 A;  2RQQ A;  4L5J A;  2DO7 A;  5F64 A;  2X48 A;  1YS7 A;  4EMS A;  3IKT A;  2EV6 A;  5KHD A;  1J0R A;  1YE9 A;  4HAM A;  2EQR A;  2O5R A;  3FXJ A;  1HF0 A;  2A6T A;  1ITY A;  3HHG A;  2M9H A;  3QAH A;  2EFW A;  2NOG A;  1JUM A;  2KIS A;  4B3X A;  2IRF G;  1YS6 A;  1TQI A;  4ANJ A;  5L3G A;  2XV4 S;  1IW7 F;  4E7I A;  3ZQH A;  5LGT A;  1IC8 A;  1B9M A;  4EEF G;  2JRT A;  4DNC A;  2R7Q A;  3TO7 A;  3DEW A;  4IHW A;  1Y6I A;  1AKH A;  3Q0U A;  1FTZ A;  4WCG A;  1Z7L A;  5D5V B;  2VL8 A;  1K78 A;  2BW3 B;  1PP7 U;  1F4K A;  2JMW A;  3G2B A;  2PJP A;  2JA5 J;  1YJW I;  1IDZ A;  2R3S A;  5FLV A;  4ZTJ A;  1HKT A;  2PI0 A;  4LIU A;  1B1B A;  4R79 A;  2DOE A;  2PMH A;  5DS9 A;  1WH5 A;  1OR7 C;  2M3A A;  4NQW A;  4A6E A;  1X19 A;  1Y8R B;  1M1E B;  4E7J A;  3SDG A;  3FM3 A;  2DOD A;  2OZ6 A;  1OYI A;  2DDB A;  1RUO A;  1FLI A;  1P4A A;  2DMP A;  3S1M J;  4CIC A;  1LUJ B;  5CYV A;  4RM3 A;  3PJR A;  2DCE A;  2X6X A;  3H36 A;  2ZNZ A;  2R0Q C;  2HVS A;  4C3J J;  3FDY A;  4RMN A;  1S5L C;  2WAQ A;  1X3Z B;  1BR4 A;  3TOA A;  2LNB A;  3HIF A;  2NVT J;  4I01 A;  4XON A;  3ZN1 A;  2V9K A;  2L7M P;  2X85 A;  3CUQ C;  2XRL A;  3JRG A;  3NEU A;  2KHM A;  1JE8 A;  3KZY A;  1P2F A;  3GFJ A;  3CCJ I;  5ILS A;  4UY8 I;  3MKY B;  4EJU A;  4IHX A;  1V5F A;  1SEU A;  2XRO A;  4HQE A;  4N9H A;  4NC8 A;  3I3L A;  1D0Z A;  4DW6 A;  5DCF A;  4XLH A;  4S05 A;  1RZ4 A;  1WJB A;  4A93 J;  2LFB A;  2M4K A;  3RTR A;  1WPK A;  2WAE A;  1S3J A;  5L3B A;  4FQG A;  1IN6 A;  4OWR B;  3HOV J;  1P7I A;  1V55 H;  2B7E A;  4I98 B;  2XAJ A;  3JSP A;  3JRD A;  1LFU P;  3EYY A;  5JI6 A;  1FOX A;  5GP9 A;  4L9J A;  1DPR A;  3SYT A;  3K10 A;  3VYU B;  4G6T B;  3S8P A;  5IT3 A;  1R5G A;  2DK5 A;  4ITV A;  5DDG A;  1JUP A;  4IHV A;  3JRE A;  2BW3 A;  3EYI A;  2R93 J;  1L3L A;  1WSU A;  3MKL A;  4EM0 B;  3LSG A;  5IP7 J;  2KZG A;  3RQI A;  1A36 A;  1WVR A;  4BU2 A;  2VAS A;  3ZGK A;  2H09 A;  1KU3 A;  5D6E A;  4D7M A;  3S2H J;  2BXZ A;  4J01 A;  2A6H F;  1MBJ A;  1PP8 F;  4Y3O A;  3WHB A;  5ILV A;  4JX4 A;  1RUN A;  2HOA A;  1BI2 A;  2DW4 A;  3M9A A;  4CSW A;  4YII A;  5M5Y J;  2QQB A;  2RVC A;  4BNC A;  5K5O A;  2AS5 F;  1R1V A;  1OQY A;  4L9V A;  4UUT A;  3LA2 A;  2E35 A;  1XCV A;  3DF8 A;  5J1R A;  3VEP A;  5DM7 F;  5LGU A;  1ZK8 A;  3A01 A;  2VT2 A;  3OR2 C;  1DDN A;  4E7H A;  1B8I B;  3UR3 C;  4D0P A;  3E6M A;  2ELJ A;  2NAZ A;  1LKX A;  4F91 B;  1YTY A;  2KFD A;  1B8I A;  4ENN A;  3E5Q A;  3PFI A;  3K4N A;  4IVN A;  3DP7 A;  4A0Z A;  3BY6 A;  5E3M A;  4FHT A;  2FX0 A;  4R8H A;  3HOU J;  5IT9 K;  5BOX A;  3H5R A;  3LST A;  1MSE C;  3ULQ B;  3WHC A;  4RB3 C;  4CCL A;  4DZJ A;  4JP0 A;  3GME A;  1UHS A;  2GA1 A;  3Q9V A;  1I6X A;  3RYR A;  1I39 A;  1BL0 A;  4EAT A;  1YI2 I;  2XPW A;  3S3O A;  4A0Y A;  3BTI A;  1UMQ A;  2JSC A;  3H35 A;  2W57 A;  5ICG A;  1XS9 A;  2JQ7 A;  2V1U A;  1TBX A;  2NVU B;  3CME I;  2HNH A;  2R7U A;  4RGU A;  1GVJ A;  2HZT A;  3M07 A;  2WV1 A;  3OY9 A;  1P7J A;  1JT6 A;  2DFF A;  2TCT A;  4XR6 A;  3RZD J;  5F6F A;  1LE8 B;  4LJZ F;  4I2O A;  4UB6 C;  1BI0 A;  2LY2 A;  4CYD A;  1XG1 A;  4PJN A;  3FKJ A;  3FBI B;  3HEF A;  4LMY A;  5F27 A;  2DK8 A;  3DKY A;  4UNO A;  4MO7 A;  2ZO4 A;  3A02 A;  1UFM A;  2VQG A;  3ABT A;  1IUF A;  2PLY A;  1E17 A;  4YIR X;  3EQL F;  3T0Y A;  5E18 F;  1XPX A;  2P8T A;  1QA6 A;  3IH4 A;  5E1W A;  2FNP A;  3SEQ A;  1G3S A;  3DTI A;  4MGR A;  4D5F A;  1POG A;  3WU1 B;  2VQC A;  2LBF A;  3KYC B;  2IVM A;  4BXU A;  1IRZ A;  1TC3 C;  1RR8 C;  2ETH A;  4Q47 A;  2X1C A;  1MNE A;  1XDU A;  3I54 A;  4Y15 A;  1MJA A;  3U1D A;  1FOY A;  2RN7 A;  4XOT A;  4GFB A;  1G2H A;  2ZJR F;  1E0E A;  2HDW A;  1F5T A;  2CSO A;  4JBA A;  4RA2 A;  4OAZ A;  5FKO A;  5E8I A;  1X4P A;  1EJ9 A;  2VOP A;  2HDC A;  4CHU A;  4BGD A;  2KL4 A;  3HRS A;  5E3O A;  3H5N A;  3IH2 A;  1N25 A;  3RIR A;  1VQ8 I;  1K78 B;  4BQA A;  1W5C C;  2BY0 A;  1UEL B;  1TQP A;  4HRI A;  3IWZ A;  2IS6 A;  1OFC X;  4EJV A;  3HOX J;  5K5R A;  5M5W J;  2VXD A;  2E1N A;  4ZTF A;  4XLN F;  2UV1 A;  4ESF A;  2CUJ A;  2P5V A;  1UHM A;  3CJR B;  5HS8 A;  3BZC A;  4EM1 A;  5HLT A;  2CV2 A;  1S7O A;  4FX4 A;  1UAA A;  4XBF A;  1LDJ A;  2W84 A;  2BYV E;  1TQM A;  2Y30 A;  3C7J A;  1IN4 A;  3CCQ I;  1D1B A;  2LP0 A;  5FKM A;  5LLQ A;  2LYC A;  4I09 A;  3M4O J;  2KIM A;  2Y75 A;  2XDV A;  1H0M A;  3HB9 A;  1U5T A;  1K4T A;  1FBS A;  1X1C A;  3OYJ A;  2V4J C;  1ZAO A;  2MD0 A;  3OOU A;  3CCY A;  1GHC A;  2Q8K A;  3PUB A;  3O3K A;  4U87 A;  4WXD A;  1A31 A;  1RES A;  1TWF J;  3KCC A;  2E2I J;  4ENJ A;  3ZQL A;  3PQJ A;  1D1A A;  3U2R A;  4QLC U;  1QVT A;  4GCV A;  1J59 A;  4N9I A;  1B6A A;  3RJP A;  2QUF A;  5IT9 Z;  1J2X A;  5EDN A;  2EZI A;  2HOS A;  3ASN H;  3WTW C;  1ZRD A;  2NVY J;  4YEJ A;  2BBY A;  3ABL H;  4NC7 A;  5ICF A;  3GCM A;  4A3F J;  1UZC A;  3ML6 A;  2XC7 A;  2RGV A;  1R9T J;  1S72 I;  4J00 A;  3CF5 F;  3CJT B;  3EPZ A;  3BPV A;  4RDU A;  1NG6 A;  2W1O A;  2CMP A;  3BC8 A;  3FM5 A;  2LF8 A;  3CF2 A;  4FT8 A;  2VON A;  5A2Q K;  2E1O A;  3K1P A;  1MND A;  2O3F A;  5FD5 A;  2M4G A;  3T8R A;  4KNY A;  1PUE E;  2RV8 A;  2Y31 A;  5H6R A;  1IF1 A;  4WK8 F;  2KIF A;  3GTO J;  3WGH A;  3OYN A;  1NK3 P;  3Q0V A;  2WV0 A;  3K7A J;  3O2P E;  2E1C A;  1RRJ A;  2CQN A;  1FP2 A;  1ZLK A;  1MIJ A;  4HNV A;  3ZQQ A;  3I0T A;  1OCR H;  1T38 A;  1MJB A;  4E7S A;  2LLK A;  4RAZ A;  2L7Z A;  3X2Q H;  4E4H A;  3SFI A;  4PGG A;  4C2M J;  1ETX A;  4TV7 A;  4U88 A;  3F22 A;  2AXT C;  2QQ9 A;  3FK6 A;  4XQF A;  2IS4 A;  1U5T B;  1IXR C;  3QOP A;  1TW3 A;  3IUO A;  2BV6 A;  2K9M A;  2ZME B;  2ME0 A;  4IOA F;  2QSF X;  2K4B A;  1ETV A;  4RLF A;  2A5W A;  1YQA A;  3RPU D;  1IAW A;  1ENH A;  2QA4 I;  2CUE A;  4L0Y B;  2DYR H;  2R7T A;  3QPL A;  1K4S A;  3OS2 A;  1V3F A;  3H9G A;  3BPX A;  2X6Y A;  4HQM A;  4M9S A;  5D5X B;  3MAJ A;  3PFY A;  4MHG A;  2TDX A;  4CCJ A;  1FTT A;  4JOM A;  1NTC A;  2ADU A;  3MN2 A;  3F6O A;  5FRO A;  1EH6 A;  5CVU A;  3K70 C;  1CF7 A;  3R0A A;  1FC3 A;  3HSF A;  4A3I J;  1S7E A;  1VQ4 I;  3V8K A;  5JFR A;  5F1J A;  2VIX A;  1JKO C;  2O6G E;  1SMT A;  1QZY A;  2KZV A;  4M3F A;  3F6V A;  4A5N A;  1CF7 B;  2DQL A;  2M1B A;  4BQO A;  3FIW A;  3KEO A;  4PZJ A;  1I27 A;  3H0D A;  2Z99 A;  2XAS A;  1Z0X A;  3SEZ A;  2YX7 A;  4KFC A;  1VFC A;  3M7G A;  2H6C A;  4O5V A;  2ZKZ A;  3KP7 A;  3QYF A;  3QQA A;  5AON A;  5GPA A;  4MEX F;  3DFG A;  3TGN A;  2DMN A;  4XOR A;  2F4M B;  3CZ6 A;  2W00 A;  3FF5 A;  3PM1 A;  1MSF C;  1KQ8 A;  2W48 A;  5C3E J;  2EBI A;  2HQR A;  2ECB A;  2E7W A;  3ZMD A;  1I6H J;  2ZSH B;  1R58 A;  4MEY F;  5C4X J;  2W4S A;  3HG9 A;  3FMS A;  3GYH X;  3DPT A;  1K7A A;  3I56 I;  1HC8 A;  2R7S A;  3EUH C;  1P92 A;  2ID3 A;  1K79 A;  5HNF A;  1EF4 A;  1LEA A;  4M6Y A;  1T95 A;  3WTY C;  3FXO A;  1IRF A;  2ZXH A;  4IHT A;  4N4O B;  4A3J J;  1QU3 A;  1Z6R A;  4XIC A;  2XIG A;  2Q0O A;  3WE2 A;  5IP6 A;  2XSD C;  3G3Z A;  4IRH A;  4RB0 A;  2VPL A;  1ZRF A;  5DCM A;  1DUX C;  1ZR2 A;  3HHH A;  4M3G A;  1ZKG A;  2LKS A;  2MD5 A;  2QZ8 A;  1ON2 A;  2OCE A;  4KN7 X;  4MTD A;  5FKK A;  1LJ9 A;  3GFL A;  1O7F A;  4ZJZ A;  4UVB A;  1HOM A;  2L9V A;  4BBR J;  3L2V A;  2E7X A;  3G73 A;  1OCT C;  3GZ5 A;  3FK7 A;  4JX5 A;  3SZG A;  2AQE A;  2P7V B;  4W97 A;  4LG0 A;  1SD5 A;  5JVT A;  2IS2 A;  4B1R A;  2DQR A;  4XRS G;  1A6I A;  5AIQ A;  3BJO A;  2H27 A;  4LD5 A;  2V6C A;  4U7B A;  3VWB A;  2B63 J;  3P9K A;  3K70 D;  4G6D A;  2E5N A;  1HDD C;  1GLN A;  1VQ6 I;  3Q5F A;  1IV6 A;  2G7U A;  3OIQ A;  1RKW A;  1BC8 C;  1YX5 A;  1ZYR F;  2CW8 A;  2KRC A;  2IA2 A;  3HGY A;  3VDX A;  3REO A;  3ESW B;  3S2D J;  4LLL A;  1R5H A;  1ZGJ A;  2DI3 A;  2OCC H;  5FLX Z;  4A3L J;  1J7K A;  1TWH J;  5FGM A;  5B5E C;  4BDZ A;  3DKW A;  4RLQ A;  2W7N A;  3Q0W A;  2JT1 A;  1U3E M;  4G7O F;  2VI6 A;  2XUB A;  4KJZ A;  3PL8 A;  3GFM A;  2CS3 A;  3JTH A;  3KZI C;  3C18 A;  3HOW J;  5CVV A;  2FA5 A;  1ERD A;  1MBK A;  1S29 A;  3VYT B;  2VPR A;  2W82 A;  1W36 D;  1N75 A;  2BXY A;  5FRN A;  2GM4 A;  2LVS A;  3HC7 A;  3HOY J;  4BH9 A;  2VUM J;  2NS7 A;  4B8X A;  2WTE A;  3OYA A;  2JSP A;  3EUH A;  5BNG A;  1KQ9 A;  3BR0 A;  3MQ0 A;  3BG5 A;  4IX7 A;  3N97 A;  3FXR A;  4UB8 C;  2IGM A;  3CCU I;  1WFX A;  2VBX A;  2X0L A;  2VQL A;  2WAD A;  5EEG A;  2IA0 A;  3HKZ N;  1Z91 A;  2W25 A;  4YIF A;  1VQK I;  2KJB A;  2Z1D A;  3JRA A;  1ZRE A;  5J3L A;  1Q1H A;  5FO5 A;  4D9J A;  2VKV A;  3HM5 A;  3HRU A;  3B02 A;  1WJ5 A;  1LVK A;  3S1N J;  2VC0 A;  1Z7U A;  2KJC A;  2KT0 A;  2NS0 A;  1XTA A;  2ZXI A;  4F7Z A;  4BE2 A;  1H88 C;  3Q9S A;  3I55 I;  3J80 Z;  1CGP A;  5IY5 H;  2ZME C;  3SZT A;  2DA1 A;  2IW5 A;  2QM3 A;  3G1M A;  2UZK A;  1GXQ A;  1R4N B;  5K7Z A;  3F21 A;  1AHD P;  3GZN B;  4IEJ A;  3V4G A;  3WTT C;  1YLF A;  2QKM B;  2K85 A;  1YO5 C;  1FYM A;  2Y0S A;  1Z77 A;  5IP9 J;  4QIW N;  2JWT A;  4ZZD A;  2ZME A;  3CC7 I;  2M7B A;  1FSE A;  1SFX A;  2EIJ H;  1X1P A;  3CUQ B;  3B6A A;  3VPR A;  3VFZ A;  4C9Y A;  1X1D A;  4IHS A;  2F4I A;  1Y56 A;  2COM A;  3DU5 A;  4ZZL A;  5BQT A;  4QTR A;  1ZN2 A;  5HS7 A;  1JKQ C;  3TKY A;  3OS1 A;  4IQJ A;  4XOP A;  1KU9 A;  4HF0 A;  1Z3Y A;  5TRD A;  2GAU A;  2XRN A;  3MVP A;  4U0W A;  2HPI A;  1IXC A;  3G4S I;  2OTJ I;  5J4Y A;  2PMZ A;  2WBM A;  3MD2 A;  5FFZ A;  9ANT A;  5L3E A;  2HQN A;  4M3D A;  1KGS A;  1WZ2 A;  1YRN A;  5KAI C;  3CC4 I;  1W7P A;  3JTG A;  1R4M B;  3H9Q A;  3QOE A;  3LA3 A;  3OL3 A;  4A6D A;  2PJR A;  3GLL A;  3ABU A;  2H8W A;  2CO5 A;  1X1A A;  1MMA A;  3DCF A;  3CCS I;  3CC2 I;  1YW7 A;  2GXA A;  3AG4 H;  4E7K A;  1MBE A;  1YHQ I;  1VQM I;  2EJR A;  3CDL A;  2KQR A;  3CJN A;  2MW8 A;  2NYX A;  2P5L C;  5BPI A;  1AWC A;  2XGC A;  4CCN A;  2LRD A;  2A61 A;  2LDU A;  1FOK A;  2CQK A;  3HGG A;  1I3A A;  3OYC A;  4FE4 A;  2CQQ A;  4ZYD A;  3PNT A;  4HNT A;  4BY7 J;  1BOB A;  2NNY A;  2WAF A;  4HEA 2;  3RDI A;  1F36 A;  3O8H A;  2DA5 A;  2ZNY A;  1U78 A;  3ZMZ A;  3QP6 A;  4BHP A;  4I99 C;  5EEA A;  4A3G J;  1W5T A;  3GZ6 A;  1JGS A;  3LWF A;  2ME6 A;  3IHU A;  3CTA A;  4Q4Z F;  2MLG A;  1Y0U A;  3PO3 J;  1P4W A;  3GXO A;  4HW0 A;  4XMY A;  2L4M A;  3TQN A;  5A2Q Z;  4A3B J;  4M3E A;  4LK0 F;  4BY1 J;  2P6T A;  4XRF A;  1XN7 A;  2HOT A;  2G7H A;  3QYB A;  1XD7 A;  5F0H A;  4KDP A;  3VOE A;  3HTU A;  3FZV A;  2VC1 A;  2DFI A;  3ERE D;  4P5O A;  4UV9 A;  3P9C A;  3HUG B;  1BI3 A;  2PMZ N;  1E3O C;  1BJZ A;  4BE1 A;  4OIR F;  1B9N A;  2ZSI B;  1T8I A;  2QF7 A;  4KIC A;  2MH9 A;  2FNA A;  1SFK A;  3DLL F;  4IOC F;  2CU7 A;  2LC2 A;  2V26 A;  2EZL A;  4L5E A;  3J7Z I;  3K4L A;  4FAS D;  5CVR A;  2VN2 A;  3WG7 H;  4OU0 A;  1S8N A;  1NHA A;  4MNU A;  5IOZ A;  3F8N A;  1G3Y A;  2UUZ A;  3DEE A;  2A5Y B;  1O3S A;  4YG2 F;  1QPM A;  4PJM A;  2V79 A;  4F3Q A;  1JKP C;  4W1U A;  1KU7 A;  2MBF A;  3CLO A;  3W3C A;  2EV5 A;  4XNF A;  1FIA A;  2IGO A;  3L2U A;  1MDM A;  2VE8 A;  4P1W A;  2CRG A;  1QZE A;  4PDK A;  3DQV C;  3CUQ A;  2K9L A;  4KIG A;  5IPA A;  3J81 K;  1BR1 A;  3LSJ A;  1V5G A;  2RC4 A;  4GRI A;  4D1Q A;  1T2K A;  2XPU A;  5D8K B;  3OWT A;  1WI3 A;  4UUS B;  3ZMT A;  3G6E I;  4CZC A;  2DFH A;  2M0M A;  2HXO A;  3BG6 A;  3VSK A;  1SD6 A;  4AWX B;  4MFE A;  3GTL J;  1APL C;  1DGR M;  3K4M A;  3ZCO A;  3C1D A;  4B4C A;  1ZRC A;  2VJJ A;  1T98 A;  2EIL H;  4HBL A;  2VKH A;  1SFU A;  3HKZ A;  4JYK A;  5B1B H;  1PUF A;  1OCP A;  4I0B A;  3L00 A;  4ENK A;  3GEZ A;  3VSL A;  1ETK A;  1XGO A;  3PUF A;  4BXX J;  1TTY A;  1L0O C;  3SHF A;  3BR2 A;  4XLA A;  3ABK H;  1FX7 A;  3I64 A;  4RB2 C;  3LFK A;  4LLG F;  3A2K A;  3E6C C;  1LPQ A;  1ZGA A;  1HST A;  2ESN A;  2XAQ A;  1WKM A;  1WRJ A;  4AIJ A;  3M8E A;  1R5I D;  5ERI A;  3ZMS A;  3J81 Z;  1VZ0 A;  3L1P A;  3K69 A;  4LIT A;  2EZK A;  2VBW A;  3TP3 A;  5B1A H;  1U8R A;  4L5I A;  1XMK A;  2W24 A;  4KUM A;  2XGD A;  4FE7 A;  4UVA A;  2A3S A;  4PJL A;  1R00 A;  2HR3 A;  2FD5 A;  2OA4 A;  4ZYA A;  2L9R A;  2M45 A;  2ZB9 A;  2OZU A;  2FBH A;  4AIK A;  1JJ8 C;  4DYC A;  5GTI C;  4KMU X;  2L0K A;  1FZP B;  3CCM I;  3I59 A;  4ZDO A;  5JHU A;  2HQA A;  5JLX A;  1D1C A;  1OJL A;  1JJ6 C;  1JTX A;  2F5D A;  4IHY A;  1Z1D A;  1G59 A;  4XKV A;  2A6E F;  3IL2 A;  1Z21 A;  1FBU A;  2JA7 J;  3DV8 A;  4Y4R A;  4XN0 A;  4OOI A;  3S1R J;  2E60 A;  3CUO A;  3GTP J;  4AYB N;  3I4N J;  3U9G A;  2JTV A;  4K2E A;  2IT0 A;  4G8X A;  1OCC H;  1OYY A;  2VE9 A;  2P4W A;  4FIS A;  1I1G A;  4J19 A;  1D3Y A;  2QEN A;  3E6B A;  5EJC A;  4HDU A;  5JR3 A;  3BR6 A;  2ZXJ A;  5FKL A;  2X1E A;  4BS9 A;  1BC7 C;  4HV5 A;  4XSX F;  1TT5 B;  2OC6 A;  2L9S A;  2OU2 A;  3BTJ A;  3DTK A;  2HKX A;  2GQQ A;  1ODD A;  2FML A;  2KLO A;  3JR9 A;  3FKI J;  3JW4 A;  3IP4 B;  2Q2E A;  1ZEL A;  1MZB A;  2DMT A;  1JHF A;  2LY1 A;  4CYC A;  3LSR A;  2E34 A;  1IO2 A;  1W7P D;  2M5W A;  2OTL I;  4ZYE A;  4HZF A;  4X1E A;  4C2U A;  2COB A;  1S9H A;  2ESH A;  1XSV A;  2GOX B;  1BA5 A;  1GV5 A;  3FX3 A;  3L2W A;  1T08 B;  3DBH B;  1SVO A;  2K27 A;  3S3N A;  4KYW A;  3OYB A;  3RPU A;  2DMU A;  2VXZ A;  4MIM A;  3AFH A;  2E19 A;  3A0H C;  3L9F A;  4PSX A;  5DYM A;  3BR3 A;  2AXL A;  4HX4 A;  3S32 A;  2MAB A;  3GFI A;  4A12 A;  3S16 J;  1G3T A;  2DA2 A;  5EG0 A;  1MMN A;  2EA2 A;  2L5Q A;  4AID A;  3J7A Y;  5DV5 A;  1GT0 C;  5IYB J;  2NRA C;  3BTC A;  4DZP A;  5FJ8 J;  3OYI A;  2IGN A;  1GVD A;  1OMI A;  3UNG C;  4RAF A;  4IXA A;  1OCZ H;  1LEB A;  1JXS A;  2LG4 A;  1HW5 A;  1QPI A;  5DD4 A;  5GAE J;  2ICW G;  2RKH A;  4HA8 A;  1X58 A;  4KIF A;  4NQW B;  4UV8 A;  2M8G X;  3B73 A;  1R36 A;  3R4K A;  2O0Y A;  4WXH A;  5CQG A;  3NAU A;  1YFH A;  2DT5 A;  1UJ8 A;  1OPC A;  3HSE A;  4RGR A;  5J4V A;  3R0J A;  4WWC A;  2DPU A;  3GLX A;  1B72 B;  3MWM A;  4KT5 C;  3WU0 A;  3RKW A;  2LOO A;  3LOC A;  1XDS A;  2JVH A;  3ABM H;  4OIN F;  2STT A;  2X9D A;  2RRE A;  3HRM A;  4CDG A;  4HX7 A;  3BT9 A;  3E0J B;  2K02 A;  2YPR A;  4XK4 A;  2P81 A;  4PCQ A;  3DBL B;  4D5C A;  2Y69 H;  5TJJ A;  2KDZ A;  2H8R A;  1UHW A;  2LBF B;  3SFZ A;  3F3X A;  3OYF A;  4C2T A;  3LNQ A;  2QYO A;  1EKE A;  4A0X A;  5H20 A;  3NWT A;  2DMQ A;  3I5U A;  3OSF A;  2E2J J;  3LSI A;  5FLM J;  3QRF F;  5F04 A;  2V1X A;  5L3D A;  2X1D A;  2PFB A;  1JT0 A;  2L7F P;  2X6O A;  2HS5 A;  1IN5 A;  2QVO A;  2VBZ A;  2V6E A;  2DYS H;  4CA0 A;  2VQH A;  5DEQ A;  1ON1 A;  1O57 A;  4BE0 A;  4G7Z F;  2D1V A;  5DM6 F;  1I5Z A;  4AUX A;  1H8A C;  5CLS A;  5LD2 C;  1AKH B;  3ERM A;  1WJC A;  3MCZ A;  3O8G A;  2DA4 A;  4PUS A;  1TL8 A;  3SXY A;  4CCM A;  1TLH B;  5CVJ A;  4NHJ A;  2IAI A;  4XLF A;  3V42 A;  3LQQ A;  3V7S A;  3MEX A;  3W2A A;  3DKX A;  1T39 A;  4M6V A;  4RGX A;  2O7O A;  2XGE A;  2YUS A;  3OYL A;  1FNN A;  1IUY A;  1RKT A;  2XAH A;  3BQZ A;  2RNG A;  2Q2E B;  1Z67 A;  2CH0 A;  1LQ1 A;  2VOD A;  3KP5 A;  2K7L A;  3LFU A;  1GV2 A;  4G9Y A;  2OAZ A;  2XKO A;  3CP8 A;  3PQK A;  4XKW A;  1A04 A;  5DUI A;  1YG2 A;  3HJE A;  4P9U A;  4LG3 A;  3EUK L;  4EJO A;  1Y39 A;  2WC2 A;  2LRE A;  4DIQ A;  2DA7 A;  3TED A;  5GAD J;  3K6G A;  2I5U A;  2CUZ A;  3J7Y J;  3H9J A;  3A01 B;  5B3S H;  2O8X A;  2QGU A;  2YX4 A;  2KRF A;  2XGX A;  4BAC A;  5KCM A;  4ESB A;  1NH3 A;  2LY9 A;  4GO1 A;  2ZFU A;  3K9T A;  3U1K A;  4A3D J;  2R4G A;  1ETQ A;  3OYK A;  4HX8 A;  5LEK A;  2K86 A;  2ELH A;  3FXK A;  2ZFW A;  1FYK A;  2G0E A;  3FMR A;  3V7R A;  1UG0 A;  1KZH A;  4M73 A;  1XGS A;  4QPO A;  5EEH A;  3TO9 A;  3WG9 A;  4BUP A;  1FYL A;  4ESJ A;  2R7F A;  3OV8 A;  1W0U A;  3KP6 A;  2CV1 A;  3E5U A;  4CCK A;  1MBF A;  4BHB A;  4GYG A;  2KPM A;  2QKL B;  3JRC A;  2NVX J;  2VJ5 A;  2H1K A;  1E3H A;  1OYW A;  1CQT A;  2HU9 A;  3KE2 A;  3UKG A;  1D0X A;  1HQC A;  4MTE A;  4HG2 A;  3EET A;  2CQX A;  4PJJ A;  2V1D A;  1FSH A;  1FWZ A;  4F55 A;  1J09 A;  3BP8 A;  1W36 C;  3HYI A;  3P5J A;  1E3P A;  1T6S A;  2HGC A;  1RIO H;  2GWR A;  3LAP A;  3HRT A;  4PJ0 C;  2R7Z J;  5JLW A;  1AA7 A;  2M34 A;  2MLK A;  1JTY A;  2K3P A;  4BXF A;  3CCL I;  1KYZ A;  3L7W A;  4F52 A;  2OF7 A;  5C44 J;  1NK2 P;  1NG7 A;  1SAU A;  3BRO A;  4A69 C;  3DWL E;  4AVZ A;  3R61 A;  1U2W A;  2BY1 A;  4CYC B;  1LB2 A;  3QP5 A;  4RAY A;  3HPG A;  4V2G A;  4YFK F;  2GLO A;  1PYV A;  2H1L A;  2CUF A;  3GUD A;  4IKF A;  4DYQ A;  3J80 K;  2JJ7 A;  4IQ4 A;  1HA8 A;  4XLC A;  1RR7 A;  2GZW A;  4RGS A;  3PNV A;  4YFN F;  2BOL A;  2O9L A;  1OR7 A;  3FIS A;  1MH4 A;  5HLG A;  4G6Q A;  4U0Y A;  3OYD A;  1XSX A;  3M8F A;  4BYY A;  2F5F A;  2K3F A;  3C2B A;  1VQP I;  1MJ9 A;  1ZTR A;  1BIB A;  4MLO A;  1K6Y A;  4Y33 A;  3AL0 B;  2Z33 A;  2XAU A;  3AG2 H;  1ULY A;  3GVA A;  4BEH B;  1TNT A;  4G94 A;  3T8T A;  4HYE A;  4U0V A;  2GOM A;  1A6Q A;  5HS9 A;  3AG1 H;  3ECO A;  5E3L A;  4KN4 X;  2JZY A;  2EWN A;  1R6R A;  2XHK A;  3IRR A;  2EK5 A;  2EFN A;  1UG2 A;  5F1R A;  2BEO A;  2JPC A;  4M3B A;  2I8D A;  3CMM A;  1W5S A;  5E1X A;  3T5X A;  2R7D A;  1MNM C;  2QQA A;  2Z9O A;  4KA4 A;  2BY3 A;  2YR2 A;  5GPC A;  1W0T A;  2L3D A;  4RBO A;  4GDF A;  5EF6 A;  3OIO A;  1QRY A;  2CV0 A;  5B66 C;  5CPR B;  5HNH A;  2OJE D;  2F5V A;  5ICE A;  1YW8 A;  1J5Y A;  2HYJ A;  2FRH A;  3OS0 A;  1QHG A;  2PX9 A;  4E7L A;  4H4K C;  4M72 A;  4CXF A;  3KET A;  2IGK A;  3C2H A;  5HDG A;  2E71 A;  2CGP A;  4QWQ A;  3SDB A;  5E1Z B;  5C4J J;  4FX0 A;  4O3M A;  1RC9 A;  5LGN A;  2VT3 A;  4XSZ F;  2R7V A;  4HF2 A;  2X51 A;  4YFX F;  2LKP A;  4QPQ A;  4AIH A;  1O3Q A;  4ZYH A;  1PVE A;  2MC3 A;  4M71 A;  4XM3 A;  2JA8 J;  3EDP A;  5LFA A;  2ISZ A;  2GBY A;  3R60 A;  1WWX A;  5EZH A;  4PGH A;  2DOF A;  1D0Y A;  2Y2Z A;  4L9T A;  3S17 J;  3CDH A;  4MFD A;  4BEH A;  2GXG A;  3E5X A;  3CO6 C;  4GGG A;  3AG3 H;  1Q1V A;  3LSH A;  4L0Z B;  2HVR A;  3M1C A;  1MH3 A;  4BJT A;  5CVI A;  3GTK J;  3J7A O;  2UWM A;  5KK1 A;  1R49 A;  2HQ5 A;  4UUV A;  2HZD A;  4XLP F;  1YJN I;  4GYI A;  4S04 A;  3JRH A;  3SJM A;  1T0F C;  4DYR A;  1QZZ A;  3SQN A;  3GF2 A;  3F0C A;  3K0L A;  1I3Q J;  2HVQ A;  3F72 A;  3OYG A;  3AKZ A;  2EFO A;  3RYP A;  4F93 B;  5HOO A;  3NRV A;  2MA3 A;  3W6K B;  2IEK A;  1TWC J;  5LRS A;  1DGW Y;  1S6L A;  4KMF A;  4PFP A;  4AU7 A;  2NOJ B;  1MMD A;  3JSO A;  2EA4 A;  1X3U A;  4IO9 F;  2PEX A;  3H3V K;  3KP2 A;  1REP C;  2GXB A;  2D1H A;  5J1U A;  4L9N A;  1IV8 A;  5GAH J;  3GTJ J;  4ZC3 A;  2DLL A;  2HPM A;  1TW2 A;  1ETO A;  1P9Q C;  1X2N A;  2Z3Y A;  2OV7 A;  3E7L A;  1FIP A;  5TIS C;  2XPV A;  3D5S C;  3HOT A;  2M7A A;  4OIP F;  2ZJ2 A;  1V5E A;  4UXN A;  1ZR4 A;  4D7N A;  3BWG A;  3CQZ J;  5EGO A;  4OMZ A;  2JUG A;  1X1B A;  2CYY A;  3K1N A;  2LSO A;  5M3F J;  6PAX A;  1IRX A;  2STW A;  1A35 A;  2F2E A;  3WGI A;  3EUA A;  4CUG A;  3M3Y J;  3D0S A;  2L4A A;  5DTD A;  2PN6 A;  4KT6 A;  3KEQ A;  5IYC J;  3A03 A;  3IC7 A;  5J40 A;  2CG4 A;  2CW7 A;  2GA2 A;  4OAY A;  4IZZ A;  3BDD A;  5HLH A;  3FWE A;  2XB5 A;  1R22 A;  4IRI A;  2CFO A;  3ROU A;  2XSJ C;  3HBL A;  1SD4 A;  5H2F C;  1VQL I;  3F23 A;  3IH3 A;  4Z6Y A;  5KAF C;  3RZO J;  2MFZ A;  3MKZ A;  3PIP F;  2XVC A;  1KQ0 A;  3ZN0 A;  1MW7 A;  4I7H A;  4CH7 A;  1D5V A;  3DPU A;  4Y13 A;  4BBS J;  4MQ9 F;  3QPH A;  2EV0 A;  2L54 A;  3QPS A;  3LMM A;  1K61 A;  1R1U A;  4PFO A;  4XL9 A;  1X4O A;  2R7O A;  4DGW B;  3S15 J;  2DBB A;  1FJL A;  5GAG J;  3F8F A;  1WHU A;  3WTU C;  1WI9 A;  3PO2 J;  3BQY A;  1GUU A;  2EB7 A;  2FBK A;  4A5M A;  2FU4 A;  2KRH A;  2K9S A;  4ASN A;  1QGP A;  2CJJ A;  2L2O A;  1T56 A;  5CQE A;  1EA3 A;  1FBQ A;  4E6K G;  1ZQ3 P;  2QQ8 A;  5DCM B;  3PSI A;  2VKD A;  3HTS B;  3L2C A;  3WTZ A;  3MFK A;  4DBQ A;  2LR8 A;  2EPF A;  4P96 A;  1WGX A;  2KIU A;  3DU6 A;  3BOQ A;  4HPQ A;  3CD6 I;  1DU6 A;  3TMO A;  1D8J A;  4OIO F;  2QSG X;  5F0F A;  2HYF A;  2FMY A;  1MMS A;  1IRG A;  3KFW X;  5EGO B;  4FCY A;  3VOD A;  4EV0 A;  1D8K A;  1YIJ I;  4B47 A;  3O6B B;  2JRM A;  2DT6 A;  3ZR8 X;  2P0W A;  2N8G A;  1VTN C;  1UCR A;  1BBY A;  2CFX A;  2LF7 A;  1P4X A;  1FEX A;  1Z9C A;  3B6C A;  1X3W B;  3BCB A;  2PG4 A;  3T1B A;  4NUB A;  4RAG A;  1YIO A;  2EFP A;  5FD6 A;  1ETW A;  2EIM H;  4LB5 A;  4C3I J;  3M8J A;  3QWL A;  2XF7 A;  1HLV A;  4XKB A;  3CES A;  4V2F A;  1MBH A;  1ETY A;  3BJ6 A;  5FLX K;  3BZK A;  1AOY A;  2M0C A;  1TNS A;  3QPT A;  3I4P A;  4DBR A;  1R1T A;  3KLO A;  4LB6 B;  1F1Z A;  3IWF A;  3CCR I;  5DUK A;  2FF4 A;  2HTS A;  2M87 A;  2V7F A;  3NWS A;  2IA1 A;  3ZMV A;  3L2Q A;  3GWZ A;  2ECC A;  2KMU A;  2A07 F;  3WGG A;  1WJF A;  4M6X A;  4AD9 A;  1FMW A;  4I0A A;  5K1Y A;  3OYM A;  3SZP A;  2R7W A;  1N77 A;  1ZG5 A;  1DP3 A;  2FOK A;  3BTL A;  2DXI A;  2BHZ A;  1JGG A;  3H0G J;  2FSW A;  4X6A J;  4A2U A;  5JHF A;  2OBP A;  1P6R A;  2BZT A;  2F6C A;  3KPH A;  2HWV A;  4WF2 A;  1RNL A;  1A5J A;  4AVP A;  2BE5 F;  2L7K A;  2R92 J;  3D5R C;  3V8L A;  2MC4 A;  5L3C A;  4AM3 A;  4CO8 A;  3K4K A;  2YS9 A;  4HV6 A;  2D5V A;  2YU9 J;  2O8K A;  2DFE A;  4XRS A;  1AU7 A;  2JUC A;  1IJW C;  2DPD A;  3MZ8 A;  3ZQI A;  3GTM J;  2DA3 A;  4X0G A;  2HFH A;  2E1M C;  5D4S A;  3OYH A;  1VF9 A;  1BR2 A;  4ZDL A;  3I9V 2;  1SVL A;  4EGY A;  5E79 C;  2MYS A;  3ONQ A;  3F8C A;  2MG4 A;  4QSH A;  4I02 A;  4B3A A;  2FQ3 A;  4LG0 B;  1SD7 A;  3Q3S A;  3GTQ J;  2PQ8 A;  5F0C A;  1XMX A;  1IXS B;  2K9Q A;  5K5Q A;  2YSR A;  1UB9 A;  4HST A;  1HW1 A;  1MD0 A;  3KZZ A;  3PIO F;  3TW6 A;  2B9S A;  3DTE A;  2LD5 A;  3COA C;  2ZCW A;  3LSP A;  4IF4 A;  2K4J A;  1YW9 A;  5EZG A;  3PNY A;  3CCV I;  3A1Y A;  1KA8 A;  2ISY A;  3KYD B;  2L9N A;  1D5Y A;  4Y7N J;  2LH9 A;  1QVU A;  4XRM A;  2JPB A;  5LBQ A;  4PSW A;  3MKW B;  1ZG1 A;  2D2W A;  3IKV A;  3JAM K;  3S2W A;  2OQR A;  2Y0S N;  1OLT A;  2FXA A;  2DA6 A;  4M74 A;  5KNL A;  1ZG3 A;  2JA2 A;  3WOD F;  4LOC A;  4Y17 A;  3TP0 A;  5D5U B;  1HW2 A;  1N78 A;  3QU3 A;  4A3M J;  5AIP A;  4OIQ F;  5FRM A;  2R5Y A;  1XCB A;  2RDP A;  1LDK B;  3LAJ A;  4HNU A;  4ABZ A;  1K6O A;  5ICC A;  1TWG J;  2YU3 A;  1BM9 A;  2OPT A;  1TT0 A;  3BG3 A;  3OL4 A;  2V9V A;  1XC5 A;  4BKX A;  1V54 H;  2BHY A;  3A4C A;  2FUG 2;  2WY7 Q;  3DEU A;  2NNN A;  1XGM A;  2VLA A;  2KKO A;  3FXQ A;  5DD8 A;  3HOS A;  1GXP A;  4BL0 B;  3HPH A;  3W2W A;  5E17 F;  4BHC A;  4KIT B;  3ZMU A;  1IGN A;  2F5C A;  3D1N I;  1IZ1 A;  5LHG A;  4ETS A;  2ACJ A;  3QU6 A;  3RKX A;  1DU0 A;  3H3Z A;  3TOB A;  2XAG A;  5D8L B;  2WB1 N;  2XB0 X;  2KDO A;  2RQP A;  4FTH A;  2IXS A;  3F9K A;  3AL0 C;  3VYS B;  3BZ6 A;  3PSF A;  3F8M A;  1LFB A;  1BJA A;  1RET A;  2VBY A;  2M8E A;  3N05 A;  3C3W A;  4KIS A;  1YIT I;  2Y0M A;  2ZJP F;  4B44 A;  1E2X A;  1Y8Q B;  1YOV B;  1QBJ A;  4WXC A;  3I59 B;  1WH7 A;  2QSH X;  2J5P A;  2KP6 A;  1O3T A;  3TW7 A;  1ZAR A;  3LA7 A;  2K5C A;  3FXU A;  3RCO A;  3CMY A;  5E8G A;  3FBN B;  3ELK A;  1HKS A;  1SVM A;  5GTH C;  2VB6 A;  1KON A;  5K7H A;  1XSD A;  1U0J A;  4OMY A;  1HCR A;  3G1O A;  1BI1 A;  3KYL A;  5IOY A;  2R5Y B;  3WTX C;  1BW6 A;  2QWW A;  2R5Z A;  4IL6 C;  2IBD A;  1G6N A;  1PUF B;  3HXL A;  2CW0 F;  3RPQ A;  1EV7 A;  3K4C A;  4JK1 X;  1WCM J;  5M3M J;  2QEX I;  1Z6T A;  4U7D A;  2HYG D;  3K4B A;  2WA0 A;  3AAF A;  2FJ1 A;  1YRN B;  1W7P B;  2ZC2 A;  5HDN A;  3BLY A;  3G71 I;  2UXN A;  3JRB A;  3ZQC A;  4YEL A;  3FHN A;  3V8J A;  3BG9 A;  2D45 A;  2X6W A;  1HBX G;  3FXM A;  1RI7 A;  2JVG A;  4HSR A;  1QNT A;  4Z2Y A;  2HDD A;  4JX6 A;  4L18 B;  3VYR B;  4II2 A;  3OOP A;  1Y0N A;  2EH3 A;  2EIN H;  2Z2S B;  2VOO A;  4O6J A;  2M30 A;  1ORK A;  4H0E A;  2DU9 A;  2UXX A;  4YRV A;  3I4M J;  3GBG A;  1XMA A;  5TGT A;  2J5O A;  2GIV A;  1KYW A;  2P7C B;  2OD5 A;  2VKE A;  1BIA A;  2P6S A;  3HSR A;  2XF6 A;  3E97 A;  1ZGW A;  1U5T C;  3H1C A;  1DPU A;  2XF5 A;  1IDY A;  4NBQ A;  3LQR A;  2IP2 A;  1LNW A;  1O3R A;  4EQQ A;  1YX3 A;  1SAX A;  1JUS A;  4Q48 A;  2E5Z A;  3TO6 A;  1XGN A;  1B59 A;  2H94 A;  1KU2 A;  5HDK A;  4V19 K;  1OKR A;  3ISP A;  3ECH A;  4BJ6 C;  1R7J A;  3GX4 X;  3D5L A;  1FPQ A;  2Y9Z A;  1QQI A;  2FEZ A;  4RS8 A;  3NQO A;  5HLI A;  2WWY A;  1K83 J;  3BCA A;  3S3M A;  5LRR A;  4I76 A;  1U8B A;  5J47 A;  3LSM A;  3GW2 A;  2CWE A;  2F48 A;  4Q5S F;  1GDT A;  1W1W E;  2V1N A;  2LMD A;  2ZBK A;  1HDP A;  3LSK A;  1TWA J;  4C30 A;  1O7L A;  3A0B C;  2DTZ A;  5BS6 A;  4PK4 A;  2L01 A;  3OMY A;  2E1M B;  4WX9 A;  4M9X A;  4UVC A;  3HZJ A;  3JRF A;  3P7N A;  1LDD A;  3CO7 C;  1QHH D;  2AQF A;  1WJA A;  1SAN A;  2QBY B;  3ZOB A;  3ASO H;  1BW5 A;  1EH7 A;  3N4M A;  3E1S A;  3OYE A;  5H6Q A;  1H89 C;  1C0W A;  1MDM B;  1Z3X A;  1LVA A;  4LGW A;  2H6B A;  1VI0 A;  1F43 A;  1U6G A;  3U21 A;  2GIZ A;  1I1S A;  3DLA A;  3VB2 A;  1ZH5 A;  1I50 J;  5FB2 A;  2NXN B;  1Y1W J;  1IG7 A;  2ID6 A;  3RKQ A;  3WTS C;  2DN0 A;  3KEY A;  4NB5 A;  1YJ9 I;  3QOD A;  3CLQ A;  4C3H J;  2F5E A;  1Y1V J;  4IRG A;  4F92 B;  4CZZ A;  5FFX A;  5CKT A;  1DQU A;  2Z5U A;  2PMU A;  4LK1 F;  1VQ7 I;  3IV5 A;  2L02 A;  2WY8 Q;  1IN7 A;  4DJA A;  4E7Z A;  1SC7 A;  2R7X A;  4BQQ A;  3I58 A;  1BN5 A;  4AYB A;  4EGZ A;  4MQV A;  5JVG F;  2R5Z B;  5J1Y A;  3BR1 A;  4CCO A;  3CMA I;  3ZPL A;  1BOA A;  3K1M A;  2X4H A;  3FMQ A;  2LK2 A;  3K2A A;  2PJR B;  3HDD A;  2BY2 A;  3KX2 A;  2WAQ N;  3MZY A;  3W2V A;  3QYE A;  3MZH A;  1ZLJ A;  4EJW A;  4DQ2 A;  2WB1 A;  1XX5 A;  4XLE A;  4AC0 A;  3FHZ A;  1JI8 A;  1WJD A;  4XN3 A;  1RPW A;  5ED4 A;  3KP4 A;  5KVR A;  3ZQG A;  2HI3 A;  3H92 A;  2PBI A;  4II3 A;  1XB4 A;  4UHT A;  1Z05 A;  3KP3 A;  1VQO I;  2RAE A;  2FOW A;  2VJI A;  2XAF A;  3ZQ7 A;  5HVQ C;  2LTP A;  3WTV C;  3MMY B;  4P9F A;  4NNJ A;  3CCE I;  1VND A;  2DT7 B;  3BG7 A;  3ZP5 A;  3ZQF A;  1J9I A;  4ZYG A;  3GO5 A;  2OUM A;  3LL7 A;  3V7C A;  2JN6 A;  3HL2 A;  3KIO A;  4R1H A;  4HOB A;  1B72 A;  2NVQ J;  4JQF A;  4IPA A;  1T33 A;  4IJA A;  3K2Z A;  5ILU A;  3I71 A;  4M9Z A;  4BQN A;  3G1L A;  3JCU C;  3R6S A;  4RB1 A;  2JK3 A;  2FE3 A;  1SFE A;  2EIK H;  2AO9 A;  3L2R A;  2DDA A;  1HKQ A;  2P5K A;  2XKP A;  1HXD A;  5FKN A;  4B48 A;  4HLY A;  5IYD J;  3CP2 A;  3ZRG A;  3IAS 2;  3S93 A;  4I6Z A;  3H5A A;  1VQ9 I;  4ON0 A;  1FMV A;  1PJR A;  2Q1Z B;  1USS A;  2ELK A;  1U9O A;  2FQ4 A;  2K9N A;  5E20 A;  2V9P A;  2O61 A;  4ZDP A;  4UUS A;  2G9W A;  4KIB A;  3TBI A;  4NC6 A;  2F4O B;  3IAM 2;  5BMZ A;  2QCO A;  2KIQ A;  4DOZ A;  2B0L A;  4LLN A;  1H9T A;  4ZH4 F;  5J6X A;  3OSG A;  1JHH A;  1IN8 A;  2HEO A;  2ZXW H;  5J8C A;  2R7R A;  2A69 F;  4BAY A;  5J8F A;  3JAM Z;  1SMY F;  4GXO A;  4LIV A;  1MGT A;  1ONV A;  3WE3 A;  2AHQ A;  3RSN A;  1MMG A;  4CGZ A;  5EYR A;  2EZH A;  1B4A A;  1TZL A;  2IJL A;  1H9G A;  2HKO A;  1WQ2 A;  2QBY A;  1FT9 A;  3S1Q J;  1MBG A;  3P9I A;  4EVI A;  1MKM A;  2E2H J;  2OQG A;  3TL4 X;  2MH2 A;  1U9N A;  5CJ9 A;  4EM2 A;  3CDI A;  1YYV A;  3KLN A;  4BJ5 C;  4Y52 J;  1V4R A;  2DJI A;  1WJE A;  3DPL C;  2Y48 A;  1SFO J;  3F8B A;  3L09 A;  3RI4 A;  1OCO H;  2C6Y A;  3GTG J;  4A3C J;  1STZ A;  5BPD A;  4G12 A;  1TP4 A;  1G4D A;  1ACI A;  1PDN C;  2BVM A;  4N0B A;  1J75 A;  2HTJ A;  3E6D A;  3OIP A;  1VQN I;  1S7A A;  4ENM A;  3S14 J;  1EH8 A;  4XID A;  3E3V A;  2MGQ A;  5LHI A;  1FP1 D;  2I10 A;  2DAO A;  2EFQ A;  3NAR A;  4G7H F;  1OIS A;  4BDY A;  5D6F A;  3TDZ C;  2A68 F;  5D5W B;  5EG0 B;  1T0F A;  1DP7 P;  2K40 A;  4HLX A;  1VQ5 I;  2IS1 A;  2E36 A;  2LKX A;  3ZXS A;  1FOW A;  2DTR A;  1O4X A;  4HDV A;  3DXJ F;  4LFU A;  3W6J B;  1JKR C;  2A05 A;  3DBR B;  1R71 A;  4HF1 A;  2JA6 J;  4NDL A;  5LEJ A;  1G8X A;  4XKC A;  4A3K J;  4A3E J;  4N4N B;  4P55 A;  4S0H B;  3C2G A;  3RKY A;  1G3W A;  1R23 A;  3BR5 A;  3K4J A;  3H3U A;  2O03 A;  2IPQ X;  3OR1 C;  2Y9Y A;  2BVL A;  3HUG A;  1HSJ A;  1UST A;  5M5X J;  2ZJQ F;  4FET A;  1QO0 D;  2QLZ A;  2Z16 A;  5F08 A;  2M2E A;  3IRQ A;  1FY7 A;  1ZHF A;  2HXI A;  3I53 A;  2HOE A;  3FXL A;  4EJT A;  5D4R A;  4RM2 A;  2VJ4 A;  3BJA A;  4B43 A;  3TDU C;  1LFP A;  4E70 A;  2FBI A;  2CQ7 A;  4B09 A;  2DOA A;  2DJN A;  3M1E A;  2TRT A;  1LE8 A;  2BGC A;  3CJQ B;  5K7F A;  3RQ4 A;  5L3F A;  5E3N A;  2RNJ A;  3WU2 C;  3JRI A;  5LHH A;  3HOZ J;  2MSY A;  3W6V A;  5HOD A;  1W4M A;  1F9N A; 
#chains in the Genus database with same CATH homology
 4X0G A;  3E0J B;  3L2V A;  2E1M C;  2RQQ A;  3OYH A;  3SZG A;  1BR2 A;  2AQE A;  4ZDL A;  5KHD A;  3I9V 2;  1YE9 A;  2O5R A;  2IS2 A;  2A6T A;  2LBF B;  4C2T A;  2MYS A;  3ONQ A;  3OYF A;  3NWT A;  4U7B A;  3VWB A;  3K70 D;  4B3X A;  2E5N A;  3LSI A;  1GLN A;  4ANJ A;  2X1D A;  4E7I A;  3OIQ A;  4HST A;  1YX5 A;  2CW8 A;  2R7Q A;  2KRC A;  2V6E A;  3VDX A;  1Y6I A;  4CA0 A;  2VQH A;  3DTE A;  4BE0 A;  1Z7L A;  4BDZ A;  4RLQ A;  2VL8 A;  2W7N A;  2BW3 B;  3G2B A;  5LD2 C;  3PNY A;  3A1Y A;  1WJC A;  4PUS A;  4KJZ A;  3PL8 A;  2L9N A;  4CCM A;  2CS3 A;  2LH9 A;  4ZTJ A;  4XLF A;  4PSW A;  3V42 A;  4LIU A;  3MKW B;  4R79 A;  3W2A A;  3DKX A;  1ERD A;  1OR7 C;  2M3A A;  3VYT B;  2W82 A;  1X19 A;  3OYL A;  1OLT A;  1N75 A;  1W36 D;  4E7J A;  5KNL A;  2JA2 A;  5FRN A;  2RNG A;  2Q2E B;  3HC7 A;  1N78 A;  2CH0 A;  4RM3 A;  3PJR A;  5FRM A;  2DCE A;  2X6X A;  1LDK B;  3LFU A;  2HVS A;  3OYA A;  2JSP A;  3FDY A;  4RMN A;  4HNU A;  2WAQ A;  4IX7 A;  3CP8 A;  4XKW A;  1BR4 A;  2IGM A;  1WFX A;  4XON A;  2VQL A;  4LG3 A;  3EUK L;  2WAD A;  2V9K A;  2LRE A;  1TT0 A;  2X85 A;  4DIQ A;  3OL4 A;  3K6G A;  2Z1D A;  2CUZ A;  3H9J A;  2KHM A;  3A4C A;  2FUG 2;  2WY7 Q;  4D9J A;  2VLA A;  3HOS A;  4BL0 B;  4BAC A;  1WJ5 A;  1LVK A;  3HPH A;  3MKY B;  5KCM A;  3W2W A;  1V5F A;  2ZXI A;  4BE2 A;  2ZFU A;  4KIT B;  2R4G A;  3OYK A;  4NC8 A;  3I3L A;  1D0Z A;  4XLH A;  1WJB A;  2M4K A;  3RTR A;  2WAE A;  4OWR B;  1UG0 A;  4BUP A;  4QPO A;  2KDO A;  2IXS A;  2QKM B;  3F9K A;  3AL0 C;  2Y0S A;  3VYS B;  3PSF A;  3SYT A;  3K10 A;  3VYU B;  4G6T B;  3S8P A;  4CCK A;  2CV1 A;  4ITV A;  2KPM A;  2BW3 A;  3N05 A;  2QKL B;  2M7B A;  4KIS A;  2VJ5 A;  4B44 A;  3LSG A;  4C9Y A;  2HU9 A;  2KP6 A;  1X1D A;  1D0X A;  4HG2 A;  2F4I A;  4PJJ A;  4BU2 A;  1Y56 A;  2VAS A;  2K5C A;  1J09 A;  3DU5 A;  4F55 A;  3RCO A;  3ZGK A;  1W36 C;  3FBN B;  3OS1 A;  2VB6 A;  4IQJ A;  4XOP A;  1KON A;  1Z3Y A;  4J01 A;  1U0J A;  2HPI A;  3KYL A;  1AA7 A;  2PMZ A;  4Y3O A;  2K3P A;  2WBM A;  4BXF A;  4F52 A;  3MD2 A;  1NG7 A;  1SAU A;  3DWL E;  4CSW A;  3HXL A;  4AVZ A;  3K4C A;  3H9Q A;  3QOE A;  3OL3 A;  3HPG A;  2PJR A;  1PYV A;  1X1A A;  4IKF A;  3K4B A;  1MMA A;  2WA0 A;  4IQ4 A;  1HA8 A;  4XLC A;  4E7K A;  3BLY A;  3PNV A;  2KQR A;  3OR2 C;  2BOL A;  4E7H A;  4YEL A;  3UR3 C;  4CCN A;  3FHN A;  3OYD A;  2LRD A;  2ELJ A;  2X6W A;  1LKX A;  4F91 B;  2JVG A;  4HSR A;  3OYC A;  4MLO A;  1K6Y A;  3PNT A;  4Y33 A;  3AL0 B;  4HNT A;  3K4N A;  1BOB A;  2XAU A;  4II2 A;  3VYR B;  2WAF A;  2Z2S B;  4HEA 2;  4BEH B;  3H5R A;  4YRV A;  3GBG A;  5TGT A;  2GOM A;  4CCL A;  2XF6 A;  1R6R A;  4EAT A;  4XMY A;  3S3O A;  2XF5 A;  3H35 A;  2I8D A;  1YX3 A;  3CMM A;  2HNH A;  2R7U A;  2E5Z A;  3OY9 A;  3QYB A;  4BJ6 C;  4XR6 A;  3D5L A;  4P5O A;  2LY2 A;  3HUG B;  3BCA A;  3FKJ A;  3FBI B;  4PJN A;  3S3M A;  2CV0 A;  4BE1 A;  5CPR B;  3DKY A;  3LSM A;  5HNH A;  2ZSI B;  2F5V A;  2V1N A;  3LSK A;  2VQG A;  4C30 A;  1SFK A;  3OS0 A;  1QHG A;  4PK4 A;  3OMY A;  2E1M B;  2LC2 A;  4E7L A;  4H4K C;  2V26 A;  2IGK A;  3C2H A;  3K4L A;  4FAS D;  3SDB A;  1QHH D;  3SEQ A;  2AQF A;  3DTI A;  2VQC A;  1WJA A;  2LBF A;  2R7V A;  2UUZ A;  3DEE A;  2X51 A;  4QPQ A;  2X1C A;  3E1S A;  3OYE A;  1MNE A;  4XM3 A;  5LFA A;  1Z3X A;  4PJM A;  4F3Q A;  4XOT A;  3U21 A;  3W3C A;  4XNF A;  3DLA A;  1E0E A;  2HDW A;  2IGO A;  1D0Y A;  4OAZ A;  3L2U A;  1X4P A;  4P1W A;  3DQV C;  3KEY A;  4BGD A;  2KL4 A;  2K9L A;  4BEH A;  3H5N A;  3QOD A;  1BR1 A;  1V5G A;  1UEL B;  4HRI A;  4F92 B;  4GRI A;  2IS6 A;  3LSH A;  4D1Q A;  5CKT A;  3M1C A;  1DQU A;  2VXD A;  3OWT A;  4BJT A;  4ZTF A;  2HVR A;  2UWM A;  2UV1 A;  2CUJ A;  4CZC A;  2M0M A;  2HZD A;  3BG6 A;  3CJR B;  3VSK A;  5HLT A;  2WY8 Q;  4DJA A;  4E7Z A;  2CV2 A;  1DGR M;  1T0F C;  3K4M A;  1UAA A;  2R7X A;  3ZCO A;  4BQQ A;  2VJJ A;  4AYB A;  1D1B A;  2HVQ A;  2VKH A;  3OYG A;  2LYC A;  3AKZ A;  3HKZ A;  4F93 B;  2XDV A;  5HOO A;  4CCO A;  1DGW Y;  1X1C A;  3VSL A;  2PJR B;  3OYJ A;  3KX2 A;  2V4J C;  3W2V A;  2MD0 A;  3QYE A;  3OOU A;  2WB1 A;  3PUB A;  4PFP A;  4U87 A;  4AU7 A;  2NOJ B;  1MMD A;  4XLA A;  4XLE A;  1JI8 A;  1D1A A;  1WJD A;  4XN3 A;  3A2K A;  4ZC3 A;  2HPM A;  1P9Q C;  4II3 A;  2OV7 A;  3D5S C;  3HOT A;  2VJI A;  2M7A A;  5HVQ C;  3MMY B;  4NNJ A;  1V5E A;  2DT7 B;  3BG7 A;  1VZ0 A;  4YEJ A;  3LL7 A;  2OUM A;  4LIT A;  4NC7 A;  2JUG A;  3HL2 A;  1X1B A;  2XC7 A;  4J00 A;  4JQF A;  1IRX A;  3EPZ A;  1NG6 A;  2W1O A;  2CMP A;  3BC8 A;  3EUA A;  4CUG A;  3CF2 A;  4BQN A;  4KT6 A;  1MND A;  4PJL A;  2M4G A;  3L2R A;  4B48 A;  3CP2 A;  2CW7 A;  4OAY A;  3ZRG A;  3IAS 2;  3S93 A;  4IZZ A;  3H5A A;  4ZYA A;  3OYN A;  1FMV A;  1PJR A;  2Q1Z B;  2CFO A;  2XSJ C;  4ZDP A;  2MFZ A;  3TBI A;  3MKZ A;  4ZDO A;  2HQA A;  1D1C A;  3IAM 2;  1MW7 A;  3ZQQ A;  4CH7 A;  3DPU A;  4E7S A;  4DOZ A;  4E4H A;  3LMM A;  1G59 A;  4XKV A;  4PFO A;  4XL9 A;  1X4O A;  1Z21 A;  4Y4R A;  2R7O A;  4XN0 A;  4DGW B;  2E60 A;  2R7R A;  4XQF A;  2IS4 A;  4LIV A;  3IUO A;  2K9M A;  3RSN A;  1MMG A;  1TZL A;  4RLF A;  2A5W A;  3RPU D;  2KRH A;  3TL4 X;  2R7T A;  2L2O A;  3OS2 A;  5CQE A;  1EA3 A;  3H9G A;  4E6K G;  2X1E A;  2X6Y A;  4BJ5 C;  3PSI A;  4BS9 A;  2VKD A;  2DJI A;  3PFY A;  4DBQ A;  1WJE A;  2OC6 A;  3DPL C;  4CCJ A;  2L9S A;  3DTK A;  4JOM A;  3DU6 A;  4HPQ A;  5FRO A;  3TMO A;  2KLO A;  3K70 C;  3IP4 B;  1ZEL A;  2BVM A;  2LY1 A;  2VIX A;  3OIP A;  4B47 A;  2DT6 A;  3ZR8 X;  2P0W A;  2KZV A;  4BQO A;  4C2U A;  3BCB A;  1S9H A;  3H0D A;  4NUB A;  2GOX B;  3L2W A;  3SEZ A;  4BDY A;  3M8J A;  3S3N A;  2XF7 A;  4XKB A;  3CES A;  3OYB A;  2VXZ A;  3AFH A;  4PSX A;  2IS1 A;  3QYF A;  3S32 A;  2MAB A;  3ZXS A;  4DBR A;  1MMN A;  1G8X A;  2L5Q A;  3J7A Y;  4XKC A;  4XOR A;  2V7F A;  4N4N B;  3CZ6 A;  3NWS A;  2W00 A;  3C2G A;  3L2Q A;  3K4J A;  3OR1 C;  2KMU A;  3OYI A;  2IGN A;  3UNG C;  1WJF A;  2ZSH B;  2BVL A;  2LG4 A;  2W4S A;  3HG9 A;  1FMW A;  2R7W A;  3OYM A;  1N77 A;  3DPT A;  4FET A;  1DP3 A;  2R7S A;  3EUH C;  4NQW B;  2DXI A;  2Z16 A;  5HNF A;  1T95 A;  5JHF A;  5CQG A;  2ZXH A;  2F6C A;  4N4O B;  1QU3 A;  4RM2 A;  2VJ4 A;  4B43 A;  1LFP A;  2L7K A;  3D5R C;  2DOA A;  2VPL A;  2MC4 A;  3K4K A;  3CJQ B;  3RQ4 A;  2LOO A;  2JVH A;  4ZJZ A;  2RRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...