1JI8A

Solution structure of pyrobaculum aerophilum dsrc/gamma subunit of dissimilatory sulfite reductase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dissimilatory siroheme-sulfite reductase
publication title Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2001-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ji8A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1ji8A01
2A5WA 2XSJC 1JI8A 1YX3A 3OR2C 2V4JC 3OR1C 1SAUA
chains in the Genus database with same CATH superfamily
1D1AA 3BTJA 3WGIA 5GPCA 4I0AA 3I59B 1Z9CA 2A68F 2PMUA 4E7JA 3P9KA 1W5TA 5EG0A 1FPQA 2QBYA 4BACA 1X3UA 3ZQIA 4AYBA 1JHFA 3WU2C 3K70C 2CQXA 2UUZA 3COAC 1MMNA 1WQ2A 1KU7A 1DP7P 2QCOA 1MBFA 3BQZA 3GCMA 3S3NA 1GXPA 4R1HA 1UZCA 3OWTA 9ANTA 3TOAA 3B6AA 6PAXA 3HOWJ 2PMZN 1T0FA 1LJ9A 5D5WB 2E2IJ 2GM4A 3QPLA 3X2QH 3HOVJ 3PIPF 1WWXA 4WF2A 2KHMA 3FBNB 3RYRA 4A69C 3SXYA 1CGPA 1WFXA 5HDKA 3H36A 2B7EA 3JAMZ 2DOEA 2LKPA 1EH7A 3J7AO 1XD7A 1U2WA 3OIPA 4EV0A 1U5TB 2VT3A 4UVCA 2LRDA 2E1MB 4DJAA 4RGSA 2GZWA 5IYBJ 2HKXA 4BXFA 5KNLA 5EGOA 2M8GX 2HZDA 3S17J 2L7ZA 4R79A 2K4JA 1IDYA 4QTRA 2G0EA 5J40A 3ROUA 4BGDA 3L2UA 4PJJA 3F0CA 1VQ9I 2XRLA 4RB3C 3KP5A 2MLKA 2D1VA 5FKNA 1O3RA 5JVGF 3RPUA 2O03A 3DPTA 4BBRJ 1LE8B 3ZXSA 2A5WA 1WKMA 2KDZA 5E20A 3QP6A 2VJ5A 3U9GA 1W0TA 2W57A 2HS5A 5HNHA 3O8HA 3BR6A 4KT5C 1FOWA 4PSWA 1IN7A 4HDVA 1MIJA 2VJ4A 2Y0SN 4OAZA 1SFEA 2BHZA 4RAZA 3HOSA 4EGZA 2RN7A 1NTCA 3A1YA 4G7HF 1T6SA 1Y39A 1HLVA 3K69A 3SFIA 4D0PA 3P7NA 2HOEA 2L3DA 3K4KA 4B3XA 4J00A 5TJJA 3HKZN 1F4KA 4HRIA 2RQQA 2TCTA 3E5QA 3KZZA 2GQQA 5HDGA 5DV5A 5E8IA 4AIKA 1D1BA 3FXQA 3HM5A 3I4NJ 2KZVA 1Z0XA 3K2AA 1Y0UA 3T8RA 3OY9A 2DT5A 3BR0A 5K5QA 3ONQA 2ZMEC 1WPKA 3F6OA 1I6XA 4CYCB 1I39A 3LSTA 4ZYAA 3PL8A 4NQWB 3BZ6A 2O0YA 4OWRB 3OIOA 4RGRA 5FLXZ 1FT9A 2X1DA 2IAIA 3DKXA 1KYWA 2BY2A 5E3OA 3BR1A 3IV5A 2L02A 4XONA 3KE2A 2OQRA 2DJNA 2L54A 3ABUA 1N78A 1G3TA 2K9SA 5L3EA 2FQ4A 4MLOA 2EJRA 2CUEA 4E6KG 4PUSA 2OCEA 3G6EI 2I10A 1EKEA 4BQOA 4DGWB 3BZCA 3F8MA 3G2BA 3OYIA 2QQAA 3V7SA 2L9SA 1CF7A 3N4MA 2ELJA 3I4MJ 3I9V2 1IJWC 2H8RA 1KONA 2GIVA 4Y17A 1FSEA 1WH5A 3R61A 1A6QA 4YFNF 1MJAA 2WA0A 1X1CA 2KFDA 3DBRB 4OIQF 4LIUA 4UV8A 5FD5A 1TTYA 3U2RA 5BOXA 2CUJA 1XCVA 2YPRA 2MH9A 3C7JA 2L9NA 2Q2EB 1ZGJA 1STZA 4GRIA 4NUBA 2RREA 1PUFA 2OPTA 3KP2A 2QENA 3CESA 3AG2H 4FE4A 5LFAA 2P5LC 5K7ZA 2EINH 1IN5A 1XTAA 3GFIA 5KHDA 1BC7C 2HFHA 5EYRA 3M3YJ 2HNHA 4HA8A 2KJBA 3T8TA 1HSTA 1ZRDA 3CDHA 3K4JA 4PCQA 1SD7A 3D5SC 2EA4A 2DMUA 4OIPF 2R7QA 1TT5B 4ENMA 5A2QK 4EM0B 3OL4A 3DLLF 4HNUA 1W7PD 5DTDA 2ETHA 3I54A 4WK8F 1T8IA 4XLPF 1SD6A 3MCZA 2HPMA 3IKVA 1F36A 1FBUA 4EGYA 1Z3YA 3I3LA 1CQTA 2OBPA 2P7VB 2P4WA 4M3BA 4P5OA 3ZQGA 2DA4A 2F4MB 3WGGA 5IPAA 3WTTC 2DDBA 1MJBA 2K7LA 2PJRA 3BOQA 3F72A 5BPIA 2W25A 3VYUB 1RR7A 3A0HC 3SEQA 4LD5A 2QKMB 1VQ4I 2LC2A 4EVIA 1GT0C 4UUSB 4FCYA 3UNGC 4FASD 2E1CA 2M7AA 4F55A 3NWTA 1P7JA 2JT1A 4H0EA 1JGGA 2XAGA 2VQLA 5GPAA 3FK7A 1OMIA 3SFZA 2X48A 1OCRH 3W3CA 2Q0OA 3IRQA 1RR8C 1U78A 2PJPA 5D4SA 1RESA 1WZ2A 2M7BA 4ENJA 4EJVA 3VWBA 2X0LA 3DEUA 2RGVA 3GBGA 4BE2A 4UY8I 2FA5A 5E3LA 2EFOA 4BJ5C 1E2XA 4BXXJ 4R8HA 1BI1A 3HTSB 4RAGA 1G8XA 1YLFA 1M1EB 1FLIA 1QQIA 4BE1A 2AS5F 2R5YB 1Z67A 1HDDC 2KIFA 3S1MJ 2VPRA 1O3TA 4S0HB 3IWFA 1S9HA 2MG4A 3GEZA 4I6ZA 2XV4S 3HOZJ 3F8CA 3CDIA 5D5UB 4AVPA 1J0RA 5L3CA 3F21A 3TQNA 3PSIA 2V1NA 4B43A 2STWA 4EATA 4M72A 4U7DA 1DU6A 4LLGF 2H94A 4IF4A 1XDUA 2OD5A 5C4XJ 4ESFA 5ED4A 4IO9F 1TWCJ 1IZ1A 5M5XJ 2QQ9A 1H89C 1T33A 1C0WA 1JJ6C 2FXAA 2O8XA 2DYRH 1X1PA 5DCMB 1XSXA 4HV5A 4A3JJ 4L18B 3F3XA 3I5UA 1BOAA 3SDGA 1W7PB 1XC5A 3E1SA 3LA2A 3OYDA 1QHGA 4O3MA 3I58A 5EZGA 4A6EA 1TWGJ 2NVYJ 5HDNA 1SC7A 3C2GA 1MDMB 2K9NA 3W2VA 2KPMA 3M07A 4I09A 3G71I 2K9LA 4RAYA 5CQGA 4AC0A 1ETOA 4D5FA 2CV0A 2ICWG 4RM3A 1ZGWA 4FHTA 4PSXA 4G12A 1K4SA 1B8IA 2KRCA 5FKOA 1JI8A 4BY1J 3EDPA 3MKWB 3AG1H 4RA2A 3TO9A 2EPFA 1DDNA 1Z6RA 3BT9A 2VE8A 4F3QA 1K78B 2MH2A 3B73A 3ELKA 1U5TA 4HSTA 1VZ0A 5FROA 1UJ8A 3R0JA 2PFBA 4KIFA 2VXZA 2NRAC 2CQ7A 2VQHA 3CUQC 2W00A 2NVUB 1OQYA 1IN4A 5HLHA 2Y69H 1XMKA 1NK3P 2V79A 4MQVA 4NC8A 3FWEA 4DYRA 1T39A 2A69F 5DM7F 1ZELA 1WHUA 3A01B 1UFMA 3ZCOA 4IHSA 1K61A 2HYFA 3OYMA 1R36A 3CJTB 2ZJQF 1A5JA 4X0GA 2L9RA 4UUVA 4AD9A 4A3KJ 3I0TA 2CV1A 3QPTA 3QU3A 2IGNA 1P7IA 3HGGA 2LREA 4JBAA 5F27A 2DXIA 1VQNI 4RBOA 3OYNA 4ZTFA 3SZGA 3CCVI 2XVCA 3ZMTA 4YFXF 5LBQA 4M3FA 5LLQA 4V19K 3CC2I 1YOVB 4Y3OA 5LGTA 3OS1A 2WAQN 1GHCA 1TNTA 5EF6A 4XRMA 3UKGA 4UB6C 3GLXA 3ABKH 3J7YJ 1PVEA 3DBHB 4GXOA 2UWMA 1S29A 5IT9Z 3TO6A 2M87A 4CCNA 2L7KA 4Q5SF 2JUGA 2WY8Q 3U1DA 5F0CA 4A3DJ 4QPOA 2CQKA 2I8DA 2KIUA 4HAMA 1GV5A 2Z1DA 3V7RA 1XCBA 4DZJA 4CYCA 1BOBA 2E36A 1YS7A 4ZJZA 4NQWA 1WJBA 3KIOA 3AKZA 3ZQFA 1MSEC 4E7LA 1BW5A 2DAOA 3OSFA 1DU0A 3GTMJ 1BL0A 2K9QA 2KJCA 4XLCA 1X2NA 3ZGKA 5D6FA 4BEHB 1SVMA 4L0ZB 3IH4A 4JOMA 4XMYA 3F6VA 2ZJPF 1SFUA 4XRSG 1XG1A 1OFCX 3BWGA 1OR7C 4BU2A 2E71A 3UR3C 4E4HA 2LSOA 2NVXJ 2ZNZA 1E3PA 4JX4A 2PLYA 3FKJA 3V7CA 4EM2A 4Y52J 3WTYC 2PMZA 4XLAA 1XSVA 2XSDC 4HF0A 2EQRA 1J7KA 3FBIB 2K4BA 4EQQA 2GIZA 4LG0B 4MQ9F 1UCRA 1G4DA 3CP2A 3CCMI 1ERDA 5CJ9A 1IN6A 2VPLA 4NC7A 5ERIA 4XSXF 1A04A 2A6HF 2E1OA 2HU9A 3PUBA 2VBYA 3WTWC 3D1NI 2H27A 3J7AY 4XLHA 4YIFA 1JGSA 1SD5A 1MH4A 3J80Z 3GUDA 2R7UA 1KU2A 3CMAI 2L4MA 1WJAA 1QA6A 2ZXHA 3GW2A 1DPUA 5J6XA 4G6TB 2VLAA 1UG2A 3W6JB 1U6GA 1V5GA 3GZ5A 4DYQA 5E18F 3EUHC 3HOTA 4O6JA 5K5RA 1VI0A 5JHFA 1Y1WJ 3RKXA 5C44J 5DS9A 3W2AA 1ZH5A 2GOXB 1YRNA 1E3HA 4LITA 3VDXA 2CYYA 2Y0SA 1JKQC 1T95A 2VC0A 2LKXA 5GAHJ 1XGNA 1R1TA 2X6WA 3PO3J 2E19A 2YU9J 3RKWA 3EETA 3DWLE 3OOUA 3SHFA 2D5VA 4KN7X 2HDCA 5IP9J 2NOGA 3HKZA 2MA3A 4A2UA 5CYVA 4L9VA 1D0XA 1RETA 4LJZF 1IUYA 1UHWA 2MGQA 5EEGA 2DODA 4GFBA 2H6CA 3C1DA 1LVKA 5GADJ 4B3AA 3ERED 3IHUA 2OV7A 2Y48A 2AXLA 3PSFA 5JLXA 1J59A 3WU1B 4A3GJ 1H8AC 3U21A 2VONA 1JUMA 1FJLA 4MEYF 2K86A 1ETXA 1UHMA 1FOKA 1ETYA 1Z7LA 3EUHA 4M6VA 1TW2A 1WH7A 3IL2A 1NG6A 4LB6B 2BEOA 3W2WA 2DYSH 1S6LA 1BW6A 2MYSA 2UXNA 5J47A 1L3LA 3EQLF 2EK5A 5F1JA 2VASA 1O7LA 4NBQA 4EJUA 2XASA 2IA0A 3TDZC 3U1KA 2OTJI 4PJMA 2XAJA 3G1OA 5L3BA 1XGOA 2FE3A 3EUAA 1U9NA 2D2WA 1S3JA 1BJAA 4Y4RA 5BQTA 3OYKA 3PNYA 3I64A 1YW7A 3V8LA 3S32A 4MGRA 1LDJA 2J5PA 1MW7A 2M1BA 2P6SA 2O6GE 3HTUA 5E17F 4C2UA 1HXDA 4XLEA 2NS8A 4OOIA 2W4SA 4XOTA 3QAHA 4ZYEA 2AXTC 4BE0A 3M1CA 4I02A 2DPDA 1AHDP 4N4OB 5M5WJ 4KNYA 4M74A 2QM3A 1X19A 5FO5A 2YX4A 2KP6A 3KLOA 4D9JA 2FX0A 3DU6A 4FX0A 4ZYDA 4BL0B 1GUUA 2CS3A 4I2OA 3G1LA 3H5RA 2ZJRF 2O61A 1D8JA 3M1EA 5KAIC 3MMYB 3WODF 4BNCA 1T0FC 2MC4A 3G3ZA 3LQRA 3G4SI 3BC8A 3E97A 4XNFA 1VQ7I 1FIPA 4Y7NJ 1FEXA 4M6YA 4KJZA 5HLGA 2BBYA 4AUXA 1P4WA 2EZIA 2NOJB 5TISC 2XC7A 1K6YA 2ZXWH 5J1YA 3CCJI 2IEKA 5DUIA 1BBYA 1ETKA 1HKSA 3BY6A 2CU7A 5C4JJ 1ZG5A 1YX5A 2OZ6A 1G59A 4L5JA 4CCMA 1YIJI 2R7SA 2JA5J 1N75A 2ZB9A 4MHGA 5FJ8J 2AQEA 1FYMA 3BCBA 4XN0A 4DNCA 4PJ0C 4JQFA 5LD2C 1Z3XA 4I01A 2R7OA 3V42A 2PI0A 4IHXA 1H9GA 1LEBA 3GTKJ 4A6DA 4CYDA 2M4GA 3AL0B 2ELHA 3HB9A 4BJTA 2R5ZA 1K6OA 4JX6A 1HW2A 4O5VA 1FYKA 1B72B 4CZZA 2R7FA 1XN7A 1SFKA 2L01A 2M34A 2RNGA 2ZNYA 2VT2A 3K4CA 1TQIA 3E6DA 2HTSA 4FQGA 3LWFA 2VOOA 5JFRA 2E60A 2EIJH 3MFKA 2R7VA 3FHNA 1UB9A 4CCKA 5AIPA 4Q4ZF 1UHSA 3GTQJ 1B9MA 3LAPA 2OAZA 2Y75A 1UELB 2KMUA 2F5DA 2LTPA 4LGWA 3T5XA 3RZDJ 1YTYA 1B1BA 3ZPLA 1V54H 2QEXI 5FRNA 2EIKH 1G6NA 1EA3A 1AOYA 5FFXA 2L2OA 3TMOA 2RAEA 3A2KA 2F6CA 1OKRA 3NEUA 1I50J 4M9ZA 1QZZA 1ZLJA 3WTZA 1W36D 4ESBA 1QBJA 1QO0D 2H6BA 3L2VA 4KIBA 3HC7A 3CDLA 2Z33A 3DTEA 1R1VA 3LMMA 1IDZA 2MW8A 5DUKA 1NK2P 4UVAA 5E3MA 1D3YA 3KP7A 2EFWA 4KMFA 1QZEA 2OQGA 4HEA2 1IG7A 1RUOA 2XPWA 5IT9K 1IW7F 1ZG1A 4HYEA 3H0GJ 1TW3A 1HCRA 4ENKA 3QPHA 2X6XA 3Q0UA 3QOEA 2IBDA 1PUEE 2DMPA 1OYWA 1IN8A 1V5EA 3Q0WA 4BBSJ 1Y8RB 5LGUA 3OL3A 5K5OA 1ZLKA 1LDDA 3FXJA 3JRAA 1Q1HA 4C2TA 2NVTJ 3S15J 5FKMA 3WU0A 5B1BH 3VYRB 4BS9A 2X1CA 3PUFA 1R7JA 1FMWA 4Q47A 3FF5A 5BPDA 3HOXJ 3ZMDA 3REOA 2PBIA 5IYDJ 2BY3A 2YU3A 3A02A 3F23A 2EIMH 2K85A 3ERMA 1MNMC 1HC8A 3FXKA 3ECOA 4OIOF 1RKTA 1Z1DA 4NNJA 4LLNA 2OUMA 4Y13A 4HNVA 2CRGA 1R4NB 4PJNA 4QWQA 1BA5A 2K02A 3H9GA 3L7WA 3VYTB 1ZK8A 1VQPI 2XPUA 1JHHA 4GGGA 3ZMUA 2JWTA 2O9LA 1JKRC 1JUSA 4AIJA 4IHTA 3KP4A 1FC3A 4H4KC 2XAHA 3TKYA 3TW7A 4NDLA 2N8GA 3OYGA 5E1XA 4HBLA 1H0MA 4U88A 3HSFA 3CC7I 3MWMA 3H35A 3LSRA 4AWXB 2KDOA 1MKMA 3J80K 3V8KA 4CHUA 4XSZF 1ITYA 3TP3A 2ECCA 2IS4A 2BXZA 3BJAA 1HKQA 3S1RJ 4XLNF 3T0YA 4KITB 3IP4B 3HBLA 3BG6A 2F5EA 2KRHA 3C18A 2FBIA 1LUJB 4U0VA 1B4AA 1QPMA 1EH8A 3R60A 2VKVA 2BGCA 3L2QA 3J81K 2Y2ZA 4RLFA 2LBFB 2L9VA 3RKYA 1B59A 2JVGA 3TOBA 3KFWX 2ISYA 3JTHA 1TWAJ 2RDPA 1QZYA 5K1YA 3BDDA 2DQLA 3LQQA 3Q5FA 3S8PA 1PP8F 3CF2A 1KYZA 2BY1A 2BY0A 3JW4A 3AFHA 2A05A 3BR3A 3CJRB 2AHQA 1U8BA 1GVDA 2YR2A 2YX7A 3PJRA 1N77A 3E3VA 3FMQA 2X85A 2WAQA 3SQNA 2DMNA 5GTHC 4FX4A 4KICA 3QYFA 2QQ8A 4E7ZA 4GO1A 2YSRA 5E1ZB 2V6EA 3DPUA 3FXMA 2AQFA 4UHTA 2HKOA 4AVZA 4L0YB 4II2A 3DKYA 1T38A 2BW3B 3HHHA 3Q3SA 2VJJA 4GYGA 3OYCA 1LEAA 2DN0A 1FIAA 2QQBA 1LFPA 5F64A 1Z7UA 3LL7A 4JP0A 1UG0A 1X2MA 2ME0A 4IJAA 3K1MA 4LLLA 4KISA 1UMQA 1XMXA 1REPC 2QSGX 2R3SA 1APLC 3IWZA 1BJZA 2IS2A 1TP4A 4EJWA 5FD6A 1YHQI 2K5CA 2A3SA 1JT6A 1SFXA 2HVQA 4IKFA 5IOYA 4ZZDA 5JR3A 3OMYA 4B47A 3NWSA 2M3AA 3ABTA 5CVIA 4F92B 1K79A 3PO2J 4AIDA 1LB2A 2V6CA 2ZFWA 3ZRGA 3JR9A 4C2MJ 2EZKA 2LP0A 2WADA 4C3HJ 3JRHA 1LQ1A 3DEEA 3FKIJ 4J01A 2LF7A 3K6GA 1KZHA 1OCPA 3EYYA 4XORA 3IAS2 1WCMJ 1R49A 4OIRF 5E3NA 1X58A 2QZ8A 1R5ID 1BR1A 1JTXA 2P5VA 3ML6A 2F5VA 2FOKA 2DA6A 1QVUA 3PNVA 1K7AA 4A3CJ 1A6IA 1HQCA 2M0CA 3HUGB 4ZH4F 2JA7J 2LY2A 1NG7A 5DDGA 2TRTA 3CCYA 3CMYA 3FXOA 2FSWA 3H3VK 3CMMA 2KRFA 2OU2A 3PQKA 3EPZA 3WHBA 1KQ8A 4G7ZF 1FTZA 3OYLA 1SMYF 1O3QA 3BROA 3CP8A 3QYEA 1DGRM 1U5TC 3BLYA 2DFEA 2OCCH 4EJTA 3CZ6A 2DI3A 5E1WA 1TBXA 1JUPA 2Y9YA 4AU7A 1XB4A 2HVRA 1H88C 4C9YA 3I59A 3HOUJ 2QVOA 3RKQA 2GXAA 1EV7A 3R6SA 3K70D 1D5VA 3JRGA 1FNNA 2E7XA 4K2EA 2Y30A 2ID3A 1MMAA 2DLLA 2GAUA 3RPUD 2CGPA 2MD5A 2NNYA 5IY5H 3G73A 1YO5C 1XPXA 2QSHX 4BAYA 3HL2A 4ZC3A 2R92J 3K1PA 4RMNA 2ZO4A 2DO7A 3KP3A 2EZLA 3K4NA 2LR8A 2R7RA 1OYYA 2CQQA 1IRZA 1B72A 4A5MA 1KGSA 3JRDA 4A12A 1YW9A 1POGA 4EM1A 3I4PA 3WGHA 2E5ZA 1D0ZA 4KDPA 2DTRA 2EILH 4XM3A 3JAMK 4IOAF 2ECBA 4BHPA 1F43A 4I99C 4DW6A 1I6HJ 2G7HA 3H1CA 4BDYA 2MFZA 2CFOA 4IOCF 4KFCA 5CPRB 2F5FA 2RC4A 2QBYB 1V55H 5HLTA 3GF2A 4CA0A 3TDUC 2ZFUA 2O7OA 3FM5A 4WX9A 5L3FA 2WAEA 2FBHA 2QYOA 4M3GA 4RAFA 4DBQA 3HRMA 1D1CA 4PK4A 3GTJJ 1UAAA 2WY7Q 1O57A 2FBKA 5B1AH 2PMHA 1TC3C 2M30A 1TQPA 3LSMA 2F4OB 2CSOA 3JRBA 3TL4X 2RVCA 5D6EA 1LE8A 4IXAA 3RQIA 2FUG2 4L9NA 1U8RA 2O8KA 4ZTJA 5GAGJ 4IRIA 3K4BA 4FT8A 4XKWA 1QVTA 3CJQB 3MQ0A 4Q48A 1BIAA 1SD4A 1J75A 3FDYA 3R4KA 4XKVA 2LD5A 3LFUA 2NXNB 4AIHA 4ESJA 1LFUP 3CF5F 4XRSA 2GWRA 1W1WE 1R5HA 2PX9A 3WG9A 3DEWA 3MKYB 2WWYA 4Z2YA 3I71A 5D5XB 3KZIC 1QNTA 2A6TA 5H20A 4DBRA 3FXUA 4P1WA 5M3FJ 4D7MA 4I7HA 3BTLA 3B02A 2O3FA 4UVBA 3KETA 2W24A 3D5RC 4ON0A 4IQJA 5FLXK 1O4XA 2BV6A 2EFNA 2OJED 1AWCA 3E6CC 3SDBA 5HS8A 2DA5A 2COMA 4CO8A 1WGXA 2DA1A 2VKEA 1I1SA 2DFFA 2HQRA 4HDUA 4B1RA 1Y8QB 3L2RA 1YJWI 4CGZA 3OOPA 4XICA 3GFMA 4ITVA 3QWLA 1B6AA 4OMYA 4JK1X 3DKWA 5IP6A 1FBSA 2AO9A 4U7BA 4JYKA 2XGCA 1K83J 3BPVA 3Q9SA 1HBXG 2CV2A 2HVSA 2IGKA 2RNJA 3K1NA 3ZQLA 4CDGA 1MNDA 3ZMVA 2L5QA 2PQ8A 3OIQA 2EV5A 3Q0VA 1IGNA 4D5CA 4HX7A 1I5ZA 4M3EA 4ZYHA 4KA4A 3GTGJ 4D1QA 2RQPA 2Z99A 2BYVE 2VQCA 3LFKA 3S93A 5JI6A 5BNGA 4CSWA 1VTNC 4DOZA 1DUXC 1JXSA 4PDKA 3BG3A 2DFIA 1YE9A 2W1OA 1OCOH 1G3YA 2FRHA 4IHWA 5D5VB 3CC4I 3BG7A 4QPQA 3WHCA 4IPAA 2LBFA 2E35A 3ASOH 2E2HJ 3CO6C 3S3OA 3O8GA 2HOSA 2V7FA 3BZKA 3L2WA 2Q2EA 2VBZA 2XHKA 3GYHX 3L2CA 4IVNA 3ZQHA 1OLTA 1YW8A 4B48A 2C6YA 1R9TJ 4XKCA 1XDSA 3VODA 3SJMA 4IRHA 1DGWY 2XRNA 5CKTA 5E79C 4MTEA 1T98A 2HQNA 1O7FA 2IPQX 3FXRA 2CW7A 3E5UA 3HSEA 1Z05A 2JJ7A 5LRSA 2P5KA 2VKDA 4PFPA 1FY7A 3IH2A 2VBXA 1X1AA 2KT0A 4M9SA 4N4NB 2DT7B 4TV7A 2NS0A 2ZMEB 2DA7A 3ZQ7A 4OAYA 4IHVA 4KYWA 1IO2A 2ELKA 4V2FA 2DA2A 2Y0MA 4E7SA 5M3MJ 2LFBA 3JRCA 4HX4A 2XIGA 3KP6A 4MFDA 4HQEA 2HYGD 3ESWB 2CJJA 3H92A 4G94A 1IRXA 3CTAA 1S7OA 2MC3A 2WB1N 4MFEA 2BZTA 3PM1A 3FIWA 4BH9A 2XF5A 5TGTA 1I1GA 2VB6A 2O5RA 5GTIC 1OPCA 2EV0A 2GBYA 1TT0A 2LVSA 4MTDA 4MNUA 3PFYA 4P96A 1OCZH 1WJCA 1WJ5A 3NRVA 3CCLI 3HGYA 3HRTA 2M2EA 2ZXJA 1BI2A 4FE7A 3OV8A 1GXQA 1G2HA 3P9CA 1HW5A 1YX3A 1MD0A 2ZJ2A 3ABLH 1ENHA 3D5LA 4UUSA 1RPWA 2STTA 4A0YA 2DK5A 2JA8J 3PNTA 1BR2A 1Z21A 5K7HA 1VQKI 2WBMA 4YG2F 5A2QZ 1VQOI 3QQAA 3ZN1A 3CQZJ 4A3BJ 1S7EA 1LPQA 4I98B 4RGUA 2BVLA 1PJRA 3DTIA 2ZSHB 1TL8A 4PJLA 3GO5A 3HUGA 5LHIA 1GVJA 1YS6A 2FQ3A 4IZZA 1Z77A 2K3FA 2PJRB 1VQMI 4PGGA 1W5SA 5J3LA 3SZTA 2R5YA 3KYCB 1FOYA 3ULQB 5IOZA 2JPBA 4UNOA 2QUFA 3VB2A 4CCJA 4A5NA 5B66C 4JX5A 4A3EJ 2ESHA 4YIRX 1T08B 2EFQA 1BC8C 3MAJA 4N9HA 4LMYA 5IT3A 2M45A 2DT6A 5DD8A 1OCCH 1I3QJ 2XROA 2FNPA 1JJ8C 4XRFA 2R4GA 1WRJA 4F91B 4XQFA 1VFCA 4HZFA 2W85A 3M7GA 4M73A 5DCMA 2QF7A 2E2JJ 1R00A 2HGCA 2FD5A 3P5JA 3QP5A 3TW6A 2IA2A 4B44A 3JTGA 2CO5A 2HDDA 1W7PA 3K9TA 3DU5A 2R7XA 3S16J 1V5FA 4KIGA 2Y31A 2IGOA 2XGDA 2BE5F 2BHYA 2W82A 1G3SA 4FETA 1OJLA 1MDMA 2E5NA 1X3WB 1DP3A 3MZYA 3C2BA 5F08A 4ASNA 1QPIA 1RC9A 3BQYA 5H6QA 3QU6A 2VN2A 3WG7H 1WI9A 1FP1D 2L7MP 5EEHA 1P9QC 4B4CA 5BMZA 4HOBA 4UV9A 2XF7A 1S5LC 3HG9A 5DCFA 1FWZA 2H8WA 5HLIA 2Y9ZA 2W48A 5ILSA 1QRYA 2KLOA 1FP2A 2DMTA 4EMSA 3VEPA 2EV6A 3CLQA 5KCMA 1K78A 2P8TA 2DPUA 2FNAA 1Z6TA 2DK8A 1ETVA 5ICGA 4EEFG 4ZDLA 5HODA 2XAQA 2DU9A 3GVAA 4C3IJ 2V26A 5KVRA 5M5YJ 2FU4A 2M4KA 2K3PA 3WE3A 3Q9VA 2G7UA 1X4PA 3GFLA 4IL6C 1VF9A 2WV1A 3DBLB 2KIMA 2EA2A 4S05A 3A01A 1VNDA 2IS6A 3SYTA 2XB5A 3OS0A 2KISA 3FZVA 3QRFF 1ZRFA 3CCQI 1B8IB 1ZREA 1IV8A 4BUPA 1YI2I 1Y56A 1IAWA 2ME6A 5J8FA 1AKHB 5KK1A 2LYCA 1TLHB 5JLWA 4HF1A 3GZ6A 3E7LA 4P9UA 2NVQJ 5IYCJ 2VI6A 1X4OA 3S2HJ 2HYJA 5J8CA 4G6QA 3HEFA 1AA7A 2QSFX 2FMLA 3EUKL 3KYDB 1ZHFA 4CZCA 3S1NJ 3KLNA 3ISPA 3BPXA 1FBQA 2EH3A 2ZCWA 3PIOF 2K9MA 2I5UA 2CMPA 3M8JA 1YJ9I 2CUZA 1TNSA 1JT0A 3OSGA 2R7DA 2PEXA 2KQRA 1JE8A 4HSRA 3HRSA 1H9TA 3HXLA 4XK4A 2EB7A 2P7CB 2JA6J 1ACIA 5F04A 2F5CA 1WVRA 4PGHA 4XL9A 5K7FA 1GDTA 3C2HA 3WTXC 1ETWA 4E7HA 2K40A 1YG2A 2KIQA 2CFXA 4A0ZA 3GTPJ 2VODA 2BOLA 2DBBA 2DW4A 3RJPA 2NS7A 4RLQA 2LMDA 1G3WA 4A3LJ 1FYLA 2Z5UA 2VXDA 1ZGAA 4LIVA 4Z6YA 3LSIA 4BEHA 5B3SH 3KPHA 2OZUA 4X1EA 4M6XA 2DJIA 1XGMA 2M9HA 3HHGA 1MJ9A 3DXJF 4M9XA 3ZMSA 2LOOA 1EJ9A 1X1DA 2LDUA 2P6TA 4BKXA 4WXHA 2XPVA 3HPHA 4XOPA 2HOAA 4UB8C 1Z91A 2JTVA 3B6CA 1V3FA 2XKOA 3WTVC 1OYIA 2JN6A 4G8XA 5E8GA 1V4RA 3E5XA 3J7ZI 4RS8A 3HJEA 3CUQB 2CW0F 4LG0A 3JRIA 2JVHA 2HR3A 2M8EA 1E3OC 2QA4I 4HLYA 2JMWA 4L5EA 3JSOA 2R0QC 4CCOA 1RNLA 3KEYA 3BP8A 2R93J 3JRFA 3HIFA 3RSNA 3F9KA 4BY7J 3GWZA 4IX7A 4CCLA 2XF6A 1HF0A 3VOEA 3DPLC 4X6AJ 4KN4X 3N05A 1YQAA 3MEXA 3S1QJ 3K4MA 5EJCA 1LKXA 3MKZA 2WAFA 2F4IA 3GMEA 3FXLA 4G6DA 4F52A 4ABZA 2WTEA 4HW0A 3KZYA 1R1UA 1FMVA 1EF4A 1ZR4A 4IRGA 1QU3A 1XGSA 3DQVC 3QPSA 2W7NA 4M3DA 4BHBA 3OR2C 1HSJA 1TZLA 4E70A 4PFOA 2R7WA 1ZARA 1X1BA 4M71A 1KU3A 1KQ0A 3GTLJ 2ZMEA 2R7ZJ 2H1LA 3HZJA 3RIRA 3ZR8X 4XR6A 5H2FC 5AIQA 3MZ8A 3OR1C 2IP2A 3F22A 4WCGA 4ZZLA 2Z2SB 2XGEA 3K0LA 1U0JA 4U0WA 4N9IA 1ON1A 5CVJA 4RB1A 3LA3A 2GXBA 3TEDA 2VIXA 4XKBA 1ZR2A 3QOPA 3HDDA 3DLAA 2HXIA 5BS6A 3I53A 2OA4A 4RGXA 1EH6A 2LF8A 2VQGA 2B9SA 3FMSA 5KAFC 1U9OA 3RDIA 2EWNA 2IJLA 2HQ5A 4LB5A 2E34A 3F8BA 1MBGA 4XLFA 1YRNB 1I27A 3H9JA 2L7FP 1L0OC 1ODDA 3DF8A 4WXCA 4QLCU 2P0WA 2A6EF 2MBFA 5B5EC 2IS1A 1R4MB 2OTLI 3M8FA 3FM3A 1MBKA 4UUTA 2HWVA 2J5OA 3W6KB 1ZAOA 2LY9A 1BI0A 1WJFA 3T1BA 2GA1A 4AYBN 3CCRI 1ORKA 3MD2A 1ETQA 3TP0A 3CCSI 3DFGA 3R0AA 3ZP5A 3W6VA 1ON2A 2IT0A 4CXFA 5LHHA 4A3MJ 3HPGA 3PQJA 1ZYRF 3H5AA 1ZG3A 4C3JJ 4E7KA 3TO7A 4A3IJ 1BR4A 2D1HA 2DA3A 5LRRA 2CWEA 1VQ5I 1J5YA 1MMGA 3VFZA 2ISZA 3K4LA 3WE2A 1IUFA 2VJIA 2WV0A 1HW1A 4I76A 5HVQC 1FX7A 1MBHA 2ZKZA 1P2FA 3FK6A 4XIDA 1Q1VA 3CLOA 2Z3YA 5ICEA 3GTOJ 3CCEI 1Y0NA 3IAM2 2GOMA 3AL0C 3H9QA 1FSHA 3OYHA 2B0LA 3P9IA 5FKKA 1HA8A 3JREA 5GAEJ 1X3ZB 2ZXIA 4ZDPA 3BG5A 3FMRA 4U87A 5L3DA 3CCUI 2HI3A 3SZPA 2RKHA 3LSJA 3LSHA 3GXOA 3LSKA 3RTRA 2A61A 3RI4A 3H3ZA 3AAFA 3HSRA 1XS9A 2QLZA 2E1MC 3KYLA 2LNBA 4I0BA 3KEQA 1WJEA 3M8EA 3LSPA 3G1MA 5CQEA 5EDNA 3NAUA 4D7NA 3FISA 1HKTA 2F48A 4KT6A 3CD6I 3BR2A 1MH3A 4WWCA 3BTCA 1SAXA 4HX8A 2ZBKA 4G7OF 1RI7A 2M5WA 3E6BA 4FISA 2Q8KA 1RKWA 1JKPC 4L9JA 3WTSC 5J1RA 1F9NA 2WB1A 3MVPA 2ZSIB 3MZHA 1KA8A 3DCFA 5D4RA 3E0JB 3BJ6A 3LSGA 4E7IA 5LEJA 3QYBA 3MKLA 4B09A 3IC7A 2LLKA 1E0EA 5HS7A 4KMUX 3H0DA 2XGXA 4LK1F 3ECHA 3ABMH 3RCOA 1K4TA 4MO7A 2FJ1A 2FF4A 1ZQ3P 3GLLA 3JSPA 1PP7U 1P4XA 4KUMA 1TWFJ 1NH3A 4BYYA 1P92A 2FEZA 2UZKA 3DV8A 1O3SA 1LFBA 5EG0B 3RPQA 5CVVA 2JPCA 1IV6A 1JTYA 2TDXA 1RZ4A 4BQQA 1RIOH 1J09A 2DMQA 3GFJA 2MLGA 3CMEI 4XN3A 4L9TA 3IH3A 2L4AA 4DZPA 4B8XA 1QGPA 5GP9A 2QGUA 2P81A 4W97A 3A03A 1AKHA 1KU9A 2JUCA 2UXXA 4LK0F 5ICCA 3LNQA 2ID6A 4II3A 4BHCA 2R5ZB 2A07F 4MIMA 2V1XA 2GA2A 1TWHJ 4MEXF 5H6RA 1R5GA 2NAZA 1SAUA 5JVTA 1RRJA 1E17A 3VPRA 4ZDOA 4DYCA 1U3EM 2ADUA 4YIIA 2WC2A 5HS9A 3F8FA 2Z16A 3I55I 3OYAA 5D8KB 2LK2A 2QWWA 1R22A 1T56A 2ESNA 1ZRCA 1IRFA 1T2KA 1B9NA 2VUMJ 5F1RA 2H09A 4L5IA 2CH0A 2LY1A 3F8NA 4G9YA 5EGOB 3K7AJ 1R71A 4BQAA 5J4YA 2CUFA 2UV1A 3GX4X 1I3AA 1BN5A 3RQ4A 2OC6A 4DQ2A 2Z9OA 2F2EA 1MBJA 5DM6F 1HOMA 5LGNA 5TRDA 3L00A 1FZPB 1W36C 1A35A 4YRVA 1NHAA 3ZQCA 2B63J 1FOXA 1MSFC 4NC6A 1MMDA 2FOWA 2CG4A 2K27A 5LHGA 1PYVA 3VSLA 1IXCA 3FX3A 3BCAA 2MD0A 2IA1A 3S14J 2HPIA 1QHHD 3IKTA 1MBEA 1BI3A 1F1ZA 4LFUA 1MGTA 2KKOA 2QKLB 1D0YA 2PN6A 2V4JC 4HV6A 2LH9A 5JHUA 4BQNA 4S04A 5FB2A 2HQAA 1Y6IA 2YUSA 3AG3H 2IVMA 4RB0A 3CUQA 2HDWA 2HEOA 3IRRA 4AM3A 3I56I 3ZMZA 1W4MA 4GCVA 5CLSA 2V9PA 1YJNI 2R7TA 2V1DA 2XAUA 2NNNA 3K10A 1DQUA 2DDAA 2LKSA 4ANJA 4FTHA 5EZHA 3KX2A 2E1NA 4CICA 1W0UA 5AONA 2XAFA 1HDPA 4F7ZA 4YFKF 2JQ7A 1VQ8I 1ZN2A 3L09A 3QODA 3V8JA 1WI3A 3H5NA 2ACJA 3VSKA 1SFOJ 1OCTC 5HOOA 1ULYA 2JA2A 1USTA 2NYXA 1W5CC 3JCUC 2EZHA 4V2GA 4YELA 1DPRA 2IGMA 2CQNA 5FGMA 1VQLI 3V4GA 1S7AA 2X9DA 3L9FA 1RUNA 2IXSA 2BVMA 4J19A 1F5TA 3ZQQA 3L1PA 1SVLA 3KCCA 3K2ZA 1JKOC 4HF2A 2PG4A 5EEAA 3O6BB 1XMAA 1N25A 2JRMA 4LG3A 4W1UA 3CUOA 2X51A 1A36A 4ENNA 2X6OA 5D8LB 2OF7A 4DIQA 3HOYJ 2X4HA 2L0KA 1IRGA 2G9WA 4A93J 2IRFG 1PDNC 3BR5A 3DTKA 1R58A 3A0BC 2GXGA 4GDFA 1R23A 2YS9A 1CF7B 5FRMA 4CH7A 1D5YA 3KEOA 5C3EJ 2VC1A 3IUOA 5FFZA 4NHJA 2VE9A 3GZNB 3CJNA 1IF1A 1BIBA 3C3WA 2XB0X 2BW3A 2HZTA 1IXRC 3SEZA 3BG9A 4A0XA 4EJOA 3TBIA 4QIWN 2IW5A 1LNWA 1S72I 2A5YB 4QSHA 1OR7A 1FTTA 4OMZA 2VOPA 4OU0A 3J81Z 1YITI 4RB2C 1USSA 3OYJA 3RYPA 4UXNA 1PUFB 3LA7A 1BM9A 4NB5A 5DYMA 1YIOA 2BXYA 3ZN0A 4OINF 2HTJA 2COBA 2VBWA 3DP7A 1YFHA 3O3KA 5FLMJ 2EFPA 2E7WA 3HRUA 4CUGA 3AG4H 2JK3A 3ASNH 1OISA 4RDUA 2RV8A 5LEKA 3EYIA 1WSUA 1VQ6I 1LVAA 5FKLA 1SVOA 3E6MA 3NQOA 5ICFA 3OYFA 3TGNA 5J1UA 3FHZA 1ZTRA 1XSDA 4A3FJ 1SMTA 1WJDA 2DFHA 5L3GA 4GYIA 2DOFA 5ILVA 5HNFA 3BJOA 1J9IA 3RZOJ 2JSCA 1AU7A 4IHYA 5DEQA 4HNTA 2Q1ZB 1ZKGA 4HPQA 1A31A 1D8KA 2H1KA 1MMSA 4Y15A 4YEJA 2MABA 3D0SA 4PZJA 5CVRA 3M9AA 1MZBA 1IXSB 4LOCA 5J4VA 2XKPA 1IC8A 5ILUA 2XSJC 1GV2A 3WTUC 1Y1VJ 3OYBA 4BDZA 4P55A 2X6YA 3S2DJ 1YYVA 3O2PE 4ETSA 1SEUA 2VKHA 4C30A 3PFIA 4RM2A 4P9FA 5CVUA 2DTZA 2JRTA 3NARA 3M4OJ 1R6RA 2GLOA 4BJ6C 2XUBA 1TQMA 3LOCA 5F6FA 2CW8A 4WXDA 2DCEA 3VYSB 2V9VA 2DQRA 2FMYA 3CO7C 4U0YA 2XDVA 4IEJA 1XX5A 2JZYA 3N97A 3S3MA 5FLVA 2D45A 3MN2A 2X1EA 1P6RA 1LDKB 1S8NA 5DD4A 3H3UA 2HOTA 3BTIA 3LAJA 2M0MA 2JSPA 1KQ9A 2MSYA 5IP7J 4ZYGA 3S2WA 2V1UA 2HXOA 2W84A 2EBIA 3OS2A 4BXUA 5F0FA 2LG4A 4HLXA 1SANA 2KL4A 3A4CA 3HYIA 4N0BA 1MNEA 3OYEA 2VL8A 1GLNA 4IQ4A 2ZC2A 4XBFA 2KZGA 1ONVA 2V9KA 1J2XA 4Y33A 3ZOBA 4F93B 2DOAA 4HG2A 4HQMA 1P4AA 5F0HA
chains in the Genus database with same CATH topology
4ZC3A 1FMVA 1D1AA 3J7AY 4XLHA 4RMNA 4E7JA 2R7UA 1QU3A 3K4NA 2R7RA 4BACA 3DQVC 2W7NA 3OR2C 1TZLA 1WJAA 4AYBA 3K70C 4PFOA 2ZXHA 2R7WA 2UUZA 1X1BA 2E5ZA 1D0ZA 4G6TB 2VLAA 1MMNA 1V5GA 4XM3A 3HOTA 3EUHC 5JHFA 4BDYA 3ZR8X 3S3NA 4XR6A 2MFZA 2CFOA 3OWTA 3OR1C 3W2AA 5CPRB 2Z2SB 2GOXB 3VDXA 4LITA 5HLTA 1U0JA 2Y0SA 1T95A 4CA0A 2ZFUA 2VIXA 2X6WA 4XKBA 2WAEA 3DWLE 3OOUA 2KHMA 3FBNB 4DBQA 3DLAA 1D1CA 4PK4A 3HKZA 2VQGA 1WFXA 1UAAA 2WY7Q 1D0XA 3OIPA 3LSMA 2LRDA 2E1MB 4XLFA 3TL4X 3H9JA 4DJAA 1LVKA 4BXFA 2FUG2 5KNLA 2HZDA 2P0WA 4R79A 4ZTJA 3K4BA 2IS1A 4XKWA 2OV7A 3PSFA 3CJQB 3U21A 4BGDA 3L2UA 1WJFA 3FDYA 4XKVA 4PJJA 3MD2A 3LFUA 1Z7LA 3DPTA 3ZXSA 2A5WA 1NG6A 3W2WA 3HPGA 3H5AA 2MYSA 2VJ5A 3MKYB 4E7KA 1BR4A 5HNHA 2VASA 2A6TA 4PSWA 1MMGA 2VJ4A 4OAZA 4DBRA 3HOSA 3K4LA 4P1WA 4PJMA 3EUAA 2VJIA 3A1YA 4Y4RA 5HVQC 3OYKA 3K4KA 3PNYA 4B3XA 3D5RC 4J00A 4HRIA 3S32A 4IQJA 2RQQA 1MW7A 1D1BA 3IAM2 2GOMA 4C2UA 3H9QA 3SDBA 3AL0C 3OYHA 2KZVA 4XLEA 1HA8A 2W4SA 4XOTA 3OY9A 3L2RA 2ZXIA 4ZDPA 4BE0A 3M1CA 4ITVA 4N4OB 4U87A 3ONQA 1X19A 2KP6A 3LSHA 4D9JA 3LSKA 3RTRA 4ZYAA 3PL8A 3DU6A 4BL0B 2CS3A 4NQWB 4OWRB 4U7BA 3H5RA 2E1MC 2X1DA 3KYLA 3DKXA 2CV2A 2HVSA 1WJEA 3MMYB 1T0FC 2IGKA 2MC4A 5CQEA 3BC8A 4XONA 1MNDA 4XNFA 2L5QA 4KT6A 3OIQA 4KJZA 1N78A 2NOJB 4MLOA 2XC7A 4D1QA 1K6YA 2VQCA 3S93A 4CSWA 4E6KG 4DOZA 4PUSA 2WB1A 1YE9A 2W1OA 2ZSIB 3E0JB 3LSGA 3BG7A 4E7IA 4QPQA 1YX5A 4BQOA 3QYBA 4DGWB 4CCMA 1G59A 1E0EA 3G2BA 3OYIA 2LBFA 2R7SA 1N75A 3H0DA 2L9SA 3S3OA 2ELJA 2AQEA 3RCOA 3I9V2 2V7FA 3BCBA 1KONA 3L2WA 4XN0A 4JQFA 5LD2C 1OLTA 1Z3XA 2R7OA 4B48A 3V42A 2WA0A 1X1CA 4XKCA 1DGWY 5CKTA 4LIUA 2M4GA 3AL0B 2CW7A 4BJTA 2CUJA 2VKDA 4PFPA 4BQQA 1J09A 1X1AA 1SFKA 2L9NA 2Q2EB 2RNGA 4NUBA 4GRIA 2DT7B 2RREA 3K4CA 4N4NB 4XN3A 4OAYA 2E60A 3CESA 2R7VA 3FHNA 5LFAA 4CCKA 4E7SA 5KHDA 4II3A 1UELB 2KMUA 1IRXA 2HNHA 3K4JA 5FRNA 1SAUA 3D5SC 1EA3A 2XF5A 5TGTA 2R7QA 2L2OA 4ZDOA 2VB6A 2O5RA 3TMOA 3A2KA 2F6CA 1TT0A 3OL4A 1W36D 4HNUA 2Z16A 3PFYA 3OYAA 3L2VA 1WJCA 3HC7A 1WJ5A 3DTEA 3LMMA 2CH0A 2LY1A 2HPMA 1YX3A 3D5LA 2UV1A 1Z3YA 3I3LA 4P5OA 3PNTA 4HEA2 1BR2A 3RQ4A 1Z21A 2OC6A 2PJRA 2WBMA 1W36C 2X6XA 3VYUB 4YRVA 3QOEA 3SEQA 1MMDA 1V5EA 2QKMB 2BVLA 1PJRA 2LC2A 3DTIA 3OL3A 2ZSHB 4PJLA 4C2TA 1PYVA 3UNGC 3VSLA 4FASD 2M7AA 4F55A 3VYRB 3BCAA 4BS9A 2MD0A 3NWTA 4IZZA 2PJRB 2HPIA 1QHHD 2X1CA 2VQLA 1FMWA 3W3CA 2QKLB 1D0YA 2V4JC 4CCJA 2LH9A 2M7BA 4BQNA 3VWBA 2HQAA 1Y6IA 3GBGA 4BE2A 2HDWA 4BJ5C 4NNJA 2R7TA 2OUMA 2DT6A 1G8XA 4PJNA 2XAUA 3K10A 3H9GA 4BE1A 3VYTB 1DQUA 4ANJA 3KX2A 2R4GA 4F91B 4XQFA 1S9HA 3QODA 3H5NA 3VSKA 4H4KC 5HOOA 4B44A 2JA2A 3OYGA 3DU5A 3PSIA 4YELA 2R7XA 2V1NA 4B43A 1V5FA 4EATA 2IGOA 2IGMA 3H35A 2W82A 2KDOA 4FETA 2E5NA 1DP3A 2IXSA 2IS4A 2BVMA 3ZQQA 4KITB 3IP4B 1P9QC 3BG6A 2XF7A 3E1SA 3HG9A 2KRHA 4LG3A 3OYDA 1QHGA 2X51A 4DIQA 2KLOA 3L2QA 3C2GA 5KCMA 3DTKA 3W2VA 4RLFA 2LBFB 2KPMA 2JVGA 5FRMA 2K9LA 4CH7A 5CQGA 2CV0A 4ZDLA 3IUOA 4RM3A 4PSXA 3S8PA 3CF2A 2KRCA 2V26A 3AFHA 2BW3A 1JI8A 3SEZA 3CJRB 3MKWB 2M4KA 2K3PA 3TBIA 3PJRA 1N77A 2X85A 1X4PA 4F3QA 2WAQA 4HSTA 3QYFA 1VZ0A 4E7ZA 5FROA 3OYJA 2V6EA 3DPUA 2AQFA 2IS6A 3SYTA 3OS0A 4AVZA 2VXZA 4II2A 3DKYA 4BUPA 2BW3B 1Y56A 2VQHA 2VJJA 3OYCA 2W00A 2LYCA 1LFPA 4NC8A 4CUGA 3LL7A 1UG0A 1ZELA 1X4OA 4KISA 1AA7A 3EUKL 3ZCOA 4CZCA 3OYMA 4X0GA 2IS2A 2K9MA 2CMPA 2K5CA 3M8JA 3OYFA 2CUZA 2HVQA 2CV1A 4IKFA 2KQRA 3OMYA 4B47A 2IGNA 2LREA 4HSRA 2DXIA 3HXLA 3NWSA 2M3AA 4F92B 3OYNA 1WJDA 4ZTFA 3SZGA 3ZRGA 4XL9A 5HNFA 2WADA 3DEEA 3C2HA 4E7HA 4J01A 4HNTA 3K6GA 2Q1ZB 4HPQA 4Y3OA 3OS1A 2BOLA 4XORA 3IAS2 4RLQA 4YEJA 2MABA 2UWMA 1BR1A 2VXDA 4CCNA 2L7KA 4LIVA 2F5VA 2JUGA 2WY8Q 2XSJC 3LSIA 4BEHA 3PNVA 4QPOA 3OYBA 4BDZA 2I8DA 2X6YA 2Z1DA 2DJIA 1BOBA 3HUGB 2LY2A 2VKHA 1NG7A 1WJBA 4C30A 4ZJZA 3AKZA 4RM2A 2LOOA 1X1DA 4E7LA 1R6RA 3HPHA 3CMMA 4XOPA 4BJ6C 2CW8A 3EPZA 2DCEA 3VYSB 4XLCA 3ZGKA 4BEHB 4JOMA 3OYLA 4XMYA 2JVHA 3CP8A 1OR7C 1DGRM 2XDVA 3QYEA 3BLYA 4BU2A 3UR3C 3S3MA 4E4HA 4CCOA 3KEYA 2X1EA 1LDKB 3FKJA 3CZ6A 2PMZA 4AU7A 3RSNA 2M0MA 2JSPA 2HVRA 4C9YA 4XLAA 3F9KA 4IX7A 4CCLA 3OS2A 2XF6A 3FBIB 2LG4A 3DPLC 3K70D 3N05A 2KL4A 3A4CA 3K4MA 1LKXA 1MNEA 3CP2A 3OYEA 1MMAA 3MKZA 2WAFA 2VL8A 1ERDA 2F4IA 1GLNA 3RPUD 2VPLA 4NC7A 4IQ4A 4F52A 2V9KA 4Y33A 4F93B 2HU9A 2DOAA 4HG2A 3PUBA 3HL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5W A;  2XSJ C;  1JI8 A;  1YX3 A;  3OR2 C;  2V4J C;  3OR1 C;  1SAU A; 
#chains in the Genus database with same CATH topology
 1D1A A;  3BTJ A;  3WGI A;  5GPC A;  4I0A A;  3I59 B;  1Z9C A;  2A68 F;  2PMU A;  4E7J A;  3P9K A;  1W5T A;  5EG0 A;  1FPQ A;  2QBY A;  4BAC A;  1X3U A;  3ZQI A;  4AYB A;  1JHF A;  3WU2 C;  3K70 C;  2CQX A;  2UUZ A;  3COA C;  1MMN A;  1WQ2 A;  1KU7 A;  1DP7 P;  2QCO A;  1MBF A;  3BQZ A;  3GCM A;  3S3N A;  1GXP A;  4R1H A;  1UZC A;  3OWT A;  9ANT A;  3TOA A;  3B6A A;  6PAX A;  3HOW J;  2PMZ N;  1T0F A;  1LJ9 A;  5D5W B;  2E2I J;  2GM4 A;  3QPL A;  3X2Q H;  3HOV J;  3PIP F;  1WWX A;  4WF2 A;  2KHM A;  3FBN B;  3RYR A;  4A69 C;  3SXY A;  1CGP A;  1WFX A;  5HDK A;  3H36 A;  2B7E A;  3JAM Z;  2DOE A;  2LKP A;  1EH7 A;  3J7A O;  1XD7 A;  1U2W A;  3OIP A;  4EV0 A;  1U5T B;  2VT3 A;  4UVC A;  2LRD A;  2E1M B;  4DJA A;  4RGS A;  2GZW A;  5IYB J;  2HKX A;  4BXF A;  5KNL A;  5EGO A;  2M8G X;  2HZD A;  3S17 J;  2L7Z A;  4R79 A;  2K4J A;  1IDY A;  4QTR A;  2G0E A;  5J40 A;  3ROU A;  4BGD A;  3L2U A;  4PJJ A;  3F0C A;  1VQ9 I;  2XRL A;  4RB3 C;  3KP5 A;  2MLK A;  2D1V A;  5FKN A;  1O3R A;  5JVG F;  3RPU A;  2O03 A;  3DPT A;  4BBR J;  1LE8 B;  3ZXS A;  2A5W A;  1WKM A;  2KDZ A;  5E20 A;  3QP6 A;  2VJ5 A;  3U9G A;  1W0T A;  2W57 A;  2HS5 A;  5HNH A;  3O8H A;  3BR6 A;  4KT5 C;  1FOW A;  4PSW A;  1IN7 A;  4HDV A;  1MIJ A;  2VJ4 A;  2Y0S N;  4OAZ A;  1SFE A;  2BHZ A;  4RAZ A;  3HOS A;  4EGZ A;  2RN7 A;  1NTC A;  3A1Y A;  4G7H F;  1T6S A;  1Y39 A;  1HLV A;  3K69 A;  3SFI A;  4D0P A;  3P7N A;  2HOE A;  2L3D A;  3K4K A;  4B3X A;  4J00 A;  5TJJ A;  3HKZ N;  1F4K A;  4HRI A;  2RQQ A;  2TCT A;  3E5Q A;  3KZZ A;  2GQQ A;  5HDG A;  5DV5 A;  5E8I A;  4AIK A;  1D1B A;  3FXQ A;  3HM5 A;  3I4N J;  2KZV A;  1Z0X A;  3K2A A;  1Y0U A;  3T8R A;  3OY9 A;  2DT5 A;  3BR0 A;  5K5Q A;  3ONQ A;  2ZME C;  1WPK A;  3F6O A;  1I6X A;  4CYC B;  1I39 A;  3LST A;  4ZYA A;  3PL8 A;  4NQW B;  3BZ6 A;  2O0Y A;  4OWR B;  3OIO A;  4RGR A;  5FLX Z;  1FT9 A;  2X1D A;  2IAI A;  3DKX A;  1KYW A;  2BY2 A;  5E3O A;  3BR1 A;  3IV5 A;  2L02 A;  4XON A;  3KE2 A;  2OQR A;  2DJN A;  2L54 A;  3ABU A;  1N78 A;  1G3T A;  2K9S A;  5L3E A;  2FQ4 A;  4MLO A;  2EJR A;  2CUE A;  4E6K G;  4PUS A;  2OCE A;  3G6E I;  2I10 A;  1EKE A;  4BQO A;  4DGW B;  3BZC A;  3F8M A;  3G2B A;  3OYI A;  2QQA A;  3V7S A;  2L9S A;  1CF7 A;  3N4M A;  2ELJ A;  3I4M J;  3I9V 2;  1IJW C;  2H8R A;  1KON A;  2GIV A;  4Y17 A;  1FSE A;  1WH5 A;  3R61 A;  1A6Q A;  4YFN F;  1MJA A;  2WA0 A;  1X1C A;  2KFD A;  3DBR B;  4OIQ F;  4LIU A;  4UV8 A;  5FD5 A;  1TTY A;  3U2R A;  5BOX A;  2CUJ A;  1XCV A;  2YPR A;  2MH9 A;  3C7J A;  2L9N A;  2Q2E B;  1ZGJ A;  1STZ A;  4GRI A;  4NUB A;  2RRE A;  1PUF A;  2OPT A;  3KP2 A;  2QEN A;  3CES A;  3AG2 H;  4FE4 A;  5LFA A;  2P5L C;  5K7Z A;  2EIN H;  1IN5 A;  1XTA A;  3GFI A;  5KHD A;  1BC7 C;  2HFH A;  5EYR A;  3M3Y J;  2HNH A;  4HA8 A;  2KJB A;  3T8T A;  1HST A;  1ZRD A;  3CDH A;  3K4J A;  4PCQ A;  1SD7 A;  3D5S C;  2EA4 A;  2DMU A;  4OIP F;  2R7Q A;  1TT5 B;  4ENM A;  5A2Q K;  4EM0 B;  3OL4 A;  3DLL F;  4HNU A;  1W7P D;  5DTD A;  2ETH A;  3I54 A;  4WK8 F;  1T8I A;  4XLP F;  1SD6 A;  3MCZ A;  2HPM A;  3IKV A;  1F36 A;  1FBU A;  4EGY A;  1Z3Y A;  3I3L A;  1CQT A;  2OBP A;  2P7V B;  2P4W A;  4M3B A;  4P5O A;  3ZQG A;  2DA4 A;  2F4M B;  3WGG A;  5IPA A;  3WTT C;  2DDB A;  1MJB A;  2K7L A;  2PJR A;  3BOQ A;  3F72 A;  5BPI A;  2W25 A;  3VYU B;  1RR7 A;  3A0H C;  3SEQ A;  4LD5 A;  2QKM B;  1VQ4 I;  2LC2 A;  4EVI A;  1GT0 C;  4UUS B;  4FCY A;  3UNG C;  4FAS D;  2E1C A;  2M7A A;  4F55 A;  3NWT A;  1P7J A;  2JT1 A;  4H0E A;  1JGG A;  2XAG A;  2VQL A;  5GPA A;  3FK7 A;  1OMI A;  3SFZ A;  2X48 A;  1OCR H;  3W3C A;  2Q0O A;  3IRQ A;  1RR8 C;  1U78 A;  2PJP A;  5D4S A;  1RES A;  1WZ2 A;  2M7B A;  4ENJ A;  4EJV A;  3VWB A;  2X0L A;  3DEU A;  2RGV A;  3GBG A;  4BE2 A;  4UY8 I;  2FA5 A;  5E3L A;  2EFO A;  4BJ5 C;  1E2X A;  4BXX J;  4R8H A;  1BI1 A;  3HTS B;  4RAG A;  1G8X A;  1YLF A;  1M1E B;  1FLI A;  1QQI A;  4BE1 A;  2AS5 F;  2R5Y B;  1Z67 A;  1HDD C;  2KIF A;  3S1M J;  2VPR A;  1O3T A;  4S0H B;  3IWF A;  1S9H A;  2MG4 A;  3GEZ A;  4I6Z A;  2XV4 S;  3HOZ J;  3F8C A;  3CDI A;  5D5U B;  4AVP A;  1J0R A;  5L3C A;  3F21 A;  3TQN A;  3PSI A;  2V1N A;  4B43 A;  2STW A;  4EAT A;  4M72 A;  4U7D A;  1DU6 A;  4LLG F;  2H94 A;  4IF4 A;  1XDU A;  2OD5 A;  5C4X J;  4ESF A;  5ED4 A;  4IO9 F;  1TWC J;  1IZ1 A;  5M5X J;  2QQ9 A;  1H89 C;  1T33 A;  1C0W A;  1JJ6 C;  2FXA A;  2O8X A;  2DYR H;  1X1P A;  5DCM B;  1XSX A;  4HV5 A;  4A3J J;  4L18 B;  3F3X A;  3I5U A;  1BOA A;  3SDG A;  1W7P B;  1XC5 A;  3E1S A;  3LA2 A;  3OYD A;  1QHG A;  4O3M A;  3I58 A;  5EZG A;  4A6E A;  1TWG J;  2NVY J;  5HDN A;  1SC7 A;  3C2G A;  1MDM B;  2K9N A;  3W2V A;  2KPM A;  3M07 A;  4I09 A;  3G71 I;  2K9L A;  4RAY A;  5CQG A;  4AC0 A;  1ETO A;  4D5F A;  2CV0 A;  2ICW G;  4RM3 A;  1ZGW A;  4FHT A;  4PSX A;  4G12 A;  1K4S A;  1B8I A;  2KRC A;  5FKO A;  1JI8 A;  4BY1 J;  3EDP A;  3MKW B;  3AG1 H;  4RA2 A;  3TO9 A;  2EPF A;  1DDN A;  1Z6R A;  3BT9 A;  2VE8 A;  4F3Q A;  1K78 B;  2MH2 A;  3B73 A;  3ELK A;  1U5T A;  4HST A;  1VZ0 A;  5FRO A;  1UJ8 A;  3R0J A;  2PFB A;  4KIF A;  2VXZ A;  2NRA C;  2CQ7 A;  2VQH A;  3CUQ C;  2W00 A;  2NVU B;  1OQY A;  1IN4 A;  5HLH A;  2Y69 H;  1XMK A;  1NK3 P;  2V79 A;  4MQV A;  4NC8 A;  3FWE A;  4DYR A;  1T39 A;  2A69 F;  5DM7 F;  1ZEL A;  1WHU A;  3A01 B;  1UFM A;  3ZCO A;  4IHS A;  1K61 A;  2HYF A;  3OYM A;  1R36 A;  3CJT B;  2ZJQ F;  1A5J A;  4X0G A;  2L9R A;  4UUV A;  4AD9 A;  4A3K J;  3I0T A;  2CV1 A;  3QPT A;  3QU3 A;  2IGN A;  1P7I A;  3HGG A;  2LRE A;  4JBA A;  5F27 A;  2DXI A;  1VQN I;  4RBO A;  3OYN A;  4ZTF A;  3SZG A;  3CCV I;  2XVC A;  3ZMT A;  4YFX F;  5LBQ A;  4M3F A;  5LLQ A;  4V19 K;  3CC2 I;  1YOV B;  4Y3O A;  5LGT A;  3OS1 A;  2WAQ N;  1GHC A;  1TNT A;  5EF6 A;  4XRM A;  3UKG A;  4UB6 C;  3GLX A;  3ABK H;  3J7Y J;  1PVE A;  3DBH B;  4GXO A;  2UWM A;  1S29 A;  5IT9 Z;  3TO6 A;  2M87 A;  4CCN A;  2L7K A;  4Q5S F;  2JUG A;  2WY8 Q;  3U1D A;  5F0C A;  4A3D J;  4QPO A;  2CQK A;  2I8D A;  2KIU A;  4HAM A;  1GV5 A;  2Z1D A;  3V7R A;  1XCB A;  4DZJ A;  4CYC A;  1BOB A;  2E36 A;  1YS7 A;  4ZJZ A;  4NQW A;  1WJB A;  3KIO A;  3AKZ A;  3ZQF A;  1MSE C;  4E7L A;  1BW5 A;  2DAO A;  3OSF A;  1DU0 A;  3GTM J;  1BL0 A;  2K9Q A;  2KJC A;  4XLC A;  1X2N A;  3ZGK A;  5D6F A;  4BEH B;  1SVM A;  4L0Z B;  3IH4 A;  4JOM A;  4XMY A;  3F6V A;  2ZJP F;  1SFU A;  4XRS G;  1XG1 A;  1OFC X;  3BWG A;  1OR7 C;  4BU2 A;  2E71 A;  3UR3 C;  4E4H A;  2LSO A;  2NVX J;  2ZNZ A;  1E3P A;  4JX4 A;  2PLY A;  3FKJ A;  3V7C A;  4EM2 A;  4Y52 J;  3WTY C;  2PMZ A;  4XLA A;  1XSV A;  2XSD C;  4HF0 A;  2EQR A;  1J7K A;  3FBI B;  2K4B A;  4EQQ A;  2GIZ A;  4LG0 B;  4MQ9 F;  1UCR A;  1G4D A;  3CP2 A;  3CCM I;  1ERD A;  5CJ9 A;  1IN6 A;  2VPL A;  4NC7 A;  5ERI A;  4XSX F;  1A04 A;  2A6H F;  2E1O A;  2HU9 A;  3PUB A;  2VBY A;  3WTW C;  3D1N I;  2H27 A;  3J7A Y;  4XLH A;  4YIF A;  1JGS A;  1SD5 A;  1MH4 A;  3J80 Z;  3GUD A;  2R7U A;  1KU2 A;  3CMA I;  2L4M A;  1WJA A;  1QA6 A;  2ZXH A;  3GW2 A;  1DPU A;  5J6X A;  4G6T B;  2VLA A;  1UG2 A;  3W6J B;  1U6G A;  1V5G A;  3GZ5 A;  4DYQ A;  5E18 F;  3EUH C;  3HOT A;  4O6J A;  5K5R A;  1VI0 A;  5JHF A;  1Y1W J;  3RKX A;  5C44 J;  5DS9 A;  3W2A A;  1ZH5 A;  2GOX B;  1YRN A;  1E3H A;  4LIT A;  3VDX A;  2CYY A;  2Y0S A;  1JKQ C;  1T95 A;  2VC0 A;  2LKX A;  5GAH J;  1XGN A;  1R1T A;  2X6W A;  3PO3 J;  2E19 A;  2YU9 J;  3RKW A;  3EET A;  3DWL E;  3OOU A;  3SHF A;  2D5V A;  4KN7 X;  2HDC A;  5IP9 J;  2NOG A;  3HKZ A;  2MA3 A;  4A2U A;  5CYV A;  4L9V A;  1D0X A;  1RET A;  4LJZ F;  1IUY A;  1UHW A;  2MGQ A;  5EEG A;  2DOD A;  4GFB A;  2H6C A;  3C1D A;  1LVK A;  5GAD J;  4B3A A;  3ERE D;  3IHU A;  2OV7 A;  2Y48 A;  2AXL A;  3PSF A;  5JLX A;  1J59 A;  3WU1 B;  4A3G J;  1H8A C;  3U21 A;  2VON A;  1JUM A;  1FJL A;  4MEY F;  2K86 A;  1ETX A;  1UHM A;  1FOK A;  1ETY A;  1Z7L A;  3EUH A;  4M6V A;  1TW2 A;  1WH7 A;  3IL2 A;  1NG6 A;  4LB6 B;  2BEO A;  3W2W A;  2DYS H;  1S6L A;  1BW6 A;  2MYS A;  2UXN A;  5J47 A;  1L3L A;  3EQL F;  2EK5 A;  5F1J A;  2VAS A;  1O7L A;  4NBQ A;  4EJU A;  2XAS A;  2IA0 A;  3TDZ C;  3U1K A;  2OTJ I;  4PJM A;  2XAJ A;  3G1O A;  5L3B A;  1XGO A;  2FE3 A;  3EUA A;  1U9N A;  2D2W A;  1S3J A;  1BJA A;  4Y4R A;  5BQT A;  3OYK A;  3PNY A;  3I64 A;  1YW7 A;  3V8L A;  3S32 A;  4MGR A;  1LDJ A;  2J5P A;  1MW7 A;  2M1B A;  2P6S A;  2O6G E;  3HTU A;  5E17 F;  4C2U A;  1HXD A;  4XLE A;  2NS8 A;  4OOI A;  2W4S A;  4XOT A;  3QAH A;  4ZYE A;  2AXT C;  4BE0 A;  3M1C A;  4I02 A;  2DPD A;  1AHD P;  4N4O B;  5M5W J;  4KNY A;  4M74 A;  2QM3 A;  1X19 A;  5FO5 A;  2YX4 A;  2KP6 A;  3KLO A;  4D9J A;  2FX0 A;  3DU6 A;  4FX0 A;  4ZYD A;  4BL0 B;  1GUU A;  2CS3 A;  4I2O A;  3G1L A;  3H5R A;  2ZJR F;  2O61 A;  1D8J A;  3M1E A;  5KAI C;  3MMY B;  3WOD F;  4BNC A;  1T0F C;  2MC4 A;  3G3Z A;  3LQR A;  3G4S I;  3BC8 A;  3E97 A;  4XNF A;  1VQ7 I;  1FIP A;  4Y7N J;  1FEX A;  4M6Y A;  4KJZ A;  5HLG A;  2BBY A;  4AUX A;  1P4W A;  2EZI A;  2NOJ B;  5TIS C;  2XC7 A;  1K6Y A;  2ZXW H;  5J1Y A;  3CCJ I;  2IEK A;  5DUI A;  1BBY A;  1ETK A;  1HKS A;  3BY6 A;  2CU7 A;  5C4J J;  1ZG5 A;  1YX5 A;  2OZ6 A;  1G59 A;  4L5J A;  4CCM A;  1YIJ I;  2R7S A;  2JA5 J;  1N75 A;  2ZB9 A;  4MHG A;  5FJ8 J;  2AQE A;  1FYM A;  3BCB A;  4XN0 A;  4DNC A;  4PJ0 C;  4JQF A;  5LD2 C;  1Z3X A;  4I01 A;  2R7O A;  3V42 A;  2PI0 A;  4IHX A;  1H9G A;  1LEB A;  3GTK J;  4A6D A;  4CYD A;  2M4G A;  3AL0 B;  2ELH A;  3HB9 A;  4BJT A;  2R5Z A;  1K6O A;  4JX6 A;  1HW2 A;  4O5V A;  1FYK A;  1B72 B;  4CZZ A;  2R7F A;  1XN7 A;  1SFK A;  2L01 A;  2M34 A;  2RNG A;  2ZNY A;  2VT2 A;  3K4C A;  1TQI A;  3E6D A;  2HTS A;  4FQG A;  3LWF A;  2VOO A;  5JFR A;  2E60 A;  2EIJ H;  3MFK A;  2R7V A;  3FHN A;  1UB9 A;  4CCK A;  5AIP A;  4Q4Z F;  1UHS A;  3GTQ J;  1B9M A;  3LAP A;  2OAZ A;  2Y75 A;  1UEL B;  2KMU A;  2F5D A;  2LTP A;  4LGW A;  3T5X A;  3RZD J;  1YTY A;  1B1B A;  3ZPL A;  1V54 H;  2QEX I;  5FRN A;  2EIK H;  1G6N A;  1EA3 A;  1AOY A;  5FFX A;  2L2O A;  3TMO A;  2RAE A;  3A2K A;  2F6C A;  1OKR A;  3NEU A;  1I50 J;  4M9Z A;  1QZZ A;  1ZLJ A;  3WTZ A;  1W36 D;  4ESB A;  1QBJ A;  1QO0 D;  2H6B A;  3L2V A;  4KIB A;  3HC7 A;  3CDL A;  2Z33 A;  3DTE A;  1R1V A;  3LMM A;  1IDZ A;  2MW8 A;  5DUK A;  1NK2 P;  4UVA A;  5E3M A;  1D3Y A;  3KP7 A;  2EFW A;  4KMF A;  1QZE A;  2OQG A;  4HEA 2;  1IG7 A;  1RUO A;  2XPW A;  5IT9 K;  1IW7 F;  1ZG1 A;  4HYE A;  3H0G J;  1TW3 A;  1HCR A;  4ENK A;  3QPH A;  2X6X A;  3Q0U A;  3QOE A;  2IBD A;  1PUE E;  2DMP A;  1OYW A;  1IN8 A;  1V5E A;  3Q0W A;  4BBS J;  1Y8R B;  5LGU A;  3OL3 A;  5K5O A;  1ZLK A;  1LDD A;  3FXJ A;  3JRA A;  1Q1H A;  4C2T A;  2NVT J;  3S15 J;  5FKM A;  3WU0 A;  5B1B H;  3VYR B;  4BS9 A;  2X1C A;  3PUF A;  1R7J A;  1FMW A;  4Q47 A;  3FF5 A;  5BPD A;  3HOX J;  3ZMD A;  3REO A;  2PBI A;  5IYD J;  2BY3 A;  2YU3 A;  3A02 A;  3F23 A;  2EIM H;  2K85 A;  3ERM A;  1MNM C;  1HC8 A;  3FXK A;  3ECO A;  4OIO F;  1RKT A;  1Z1D A;  4NNJ A;  4LLN A;  2OUM A;  4Y13 A;  4HNV A;  2CRG A;  1R4N B;  4PJN A;  4QWQ A;  1BA5 A;  2K02 A;  3H9G A;  3L7W A;  3VYT B;  1ZK8 A;  1VQP I;  2XPU A;  1JHH A;  4GGG A;  3ZMU A;  2JWT A;  2O9L A;  1JKR C;  1JUS A;  4AIJ A;  4IHT A;  3KP4 A;  1FC3 A;  4H4K C;  2XAH A;  3TKY A;  3TW7 A;  4NDL A;  2N8G A;  3OYG A;  5E1X A;  4HBL A;  1H0M A;  4U88 A;  3HSF A;  3CC7 I;  3MWM A;  3H35 A;  3LSR A;  4AWX B;  2KDO A;  1MKM A;  3J80 K;  3V8K A;  4CHU A;  4XSZ F;  1ITY A;  3TP3 A;  2ECC A;  2IS4 A;  2BXZ A;  3BJA A;  1HKQ A;  3S1R J;  4XLN F;  3T0Y A;  4KIT B;  3IP4 B;  3HBL A;  3BG6 A;  2F5E A;  2KRH A;  3C18 A;  2FBI A;  1LUJ B;  4U0V A;  1B4A A;  1QPM A;  1EH8 A;  3R60 A;  2VKV A;  2BGC A;  3L2Q A;  3J81 K;  2Y2Z A;  4RLF A;  2LBF B;  2L9V A;  3RKY A;  1B59 A;  2JVG A;  3TOB A;  3KFW X;  2ISY A;  3JTH A;  1TWA J;  2RDP A;  1QZY A;  5K1Y A;  3BDD A;  2DQL A;  3LQQ A;  3Q5F A;  3S8P A;  1PP8 F;  3CF2 A;  1KYZ A;  2BY1 A;  2BY0 A;  3JW4 A;  3AFH A;  2A05 A;  3BR3 A;  3CJR B;  2AHQ A;  1U8B A;  1GVD A;  2YR2 A;  2YX7 A;  3PJR A;  1N77 A;  3E3V A;  3FMQ A;  2X85 A;  2WAQ A;  3SQN A;  2DMN A;  5GTH C;  4FX4 A;  4KIC A;  3QYF A;  2QQ8 A;  4E7Z A;  4GO1 A;  2YSR A;  5E1Z B;  2V6E A;  3DPU A;  3FXM A;  2AQF A;  4UHT A;  2HKO A;  4AVZ A;  4L0Y B;  4II2 A;  3DKY A;  1T38 A;  2BW3 B;  3HHH A;  3Q3S A;  2VJJ A;  4GYG A;  3OYC A;  1LEA A;  2DN0 A;  1FIA A;  2QQB A;  1LFP A;  5F64 A;  1Z7U A;  3LL7 A;  4JP0 A;  1UG0 A;  1X2M A;  2ME0 A;  4IJA A;  3K1M A;  4LLL A;  4KIS A;  1UMQ A;  1XMX A;  1REP C;  2QSG X;  2R3S A;  1APL C;  3IWZ A;  1BJZ A;  2IS2 A;  1TP4 A;  4EJW A;  5FD6 A;  1YHQ I;  2K5C A;  2A3S A;  1JT6 A;  1SFX A;  2HVQ A;  4IKF A;  5IOY A;  4ZZD A;  5JR3 A;  3OMY A;  4B47 A;  3NWS A;  2M3A A;  3ABT A;  5CVI A;  4F92 B;  1K79 A;  3PO2 J;  4AID A;  1LB2 A;  2V6C A;  2ZFW A;  3ZRG A;  3JR9 A;  4C2M J;  2EZK A;  2LP0 A;  2WAD A;  4C3H J;  3JRH A;  1LQ1 A;  3DEE A;  3FKI J;  4J01 A;  2LF7 A;  3K6G A;  1KZH A;  1OCP A;  3EYY A;  4XOR A;  3IAS 2;  1WCM J;  1R49 A;  4OIR F;  5E3N A;  1X58 A;  2QZ8 A;  1R5I D;  1BR1 A;  1JTX A;  2P5V A;  3ML6 A;  2F5V A;  2FOK A;  2DA6 A;  1QVU A;  3PNV A;  1K7A A;  4A3C J;  1A6I A;  1HQC A;  2M0C A;  3HUG B;  4ZH4 F;  2JA7 J;  2LY2 A;  1NG7 A;  5DDG A;  2TRT A;  3CCY A;  3CMY A;  3FXO A;  2FSW A;  3H3V K;  3CMM A;  2KRF A;  2OU2 A;  3PQK A;  3EPZ A;  3WHB A;  1KQ8 A;  4G7Z F;  1FTZ A;  3OYL A;  1SMY F;  1O3Q A;  3BRO A;  3CP8 A;  3QYE A;  1DGR M;  1U5T C;  3BLY A;  2DFE A;  2OCC H;  4EJT A;  3CZ6 A;  2DI3 A;  5E1W A;  1TBX A;  1JUP A;  2Y9Y A;  4AU7 A;  1XB4 A;  2HVR A;  1H88 C;  4C9Y A;  3I59 A;  3HOU J;  2QVO A;  3RKQ A;  2GXA A;  1EV7 A;  3R6S A;  3K70 D;  1D5V A;  3JRG A;  1FNN A;  2E7X A;  4K2E A;  2Y30 A;  2ID3 A;  1MMA A;  2DLL A;  2GAU A;  3RPU D;  2CGP A;  2MD5 A;  2NNY A;  5IY5 H;  3G73 A;  1YO5 C;  1XPX A;  2QSH X;  4BAY A;  3HL2 A;  4ZC3 A;  2R92 J;  3K1P A;  4RMN A;  2ZO4 A;  2DO7 A;  3KP3 A;  2EZL A;  3K4N A;  2LR8 A;  2R7R A;  1OYY A;  2CQQ A;  1IRZ A;  1B72 A;  4A5M A;  1KGS A;  3JRD A;  4A12 A;  1YW9 A;  1POG A;  4EM1 A;  3I4P A;  3WGH A;  2E5Z A;  1D0Z A;  4KDP A;  2DTR A;  2EIL H;  4XM3 A;  3JAM K;  4IOA F;  2ECB A;  4BHP A;  1F43 A;  4I99 C;  4DW6 A;  1I6H J;  2G7H A;  3H1C A;  4BDY A;  2MFZ A;  2CFO A;  4IOC F;  4KFC A;  5CPR B;  2F5F A;  2RC4 A;  2QBY B;  1V55 H;  5HLT A;  3GF2 A;  4CA0 A;  3TDU C;  2ZFU A;  2O7O A;  3FM5 A;  4WX9 A;  5L3F A;  2WAE A;  2FBH A;  2QYO A;  4M3G A;  4RAF A;  4DBQ A;  3HRM A;  1D1C A;  4PK4 A;  3GTJ J;  1UAA A;  2WY7 Q;  1O57 A;  2FBK A;  5B1A H;  2PMH A;  1TC3 C;  2M30 A;  1TQP A;  3LSM A;  2F4O B;  2CSO A;  3JRB A;  3TL4 X;  2RVC A;  5D6E A;  1LE8 A;  4IXA A;  3RQI A;  2FUG 2;  4L9N A;  1U8R A;  2O8K A;  4ZTJ A;  5GAG J;  4IRI A;  3K4B A;  4FT8 A;  4XKW A;  1QVT A;  3CJQ B;  3MQ0 A;  4Q48 A;  1BIA A;  1SD4 A;  1J75 A;  3FDY A;  3R4K A;  4XKV A;  2LD5 A;  3LFU A;  2NXN B;  4AIH A;  4ESJ A;  1LFU P;  3CF5 F;  4XRS A;  2GWR A;  1W1W E;  1R5H A;  2PX9 A;  3WG9 A;  3DEW A;  3MKY B;  2WWY A;  4Z2Y A;  3I71 A;  5D5X B;  3KZI C;  1QNT A;  2A6T A;  5H20 A;  4DBR A;  3FXU A;  4P1W A;  5M3F J;  4D7M A;  4I7H A;  3BTL A;  3B02 A;  2O3F A;  4UVB A;  3KET A;  2W24 A;  3D5R C;  4ON0 A;  4IQJ A;  5FLX K;  1O4X A;  2BV6 A;  2EFN A;  2OJE D;  1AWC A;  3E6C C;  3SDB A;  5HS8 A;  2DA5 A;  2COM A;  4CO8 A;  1WGX A;  2DA1 A;  2VKE A;  1I1S A;  2DFF A;  2HQR A;  4HDU A;  4B1R A;  1Y8Q B;  3L2R A;  1YJW I;  4CGZ A;  3OOP A;  4XIC A;  3GFM A;  4ITV A;  3QWL A;  1B6A A;  4OMY A;  4JK1 X;  3DKW A;  5IP6 A;  1FBS A;  2AO9 A;  4U7B A;  4JYK A;  2XGC A;  1K83 J;  3BPV A;  3Q9S A;  1HBX G;  2CV2 A;  2HVS A;  2IGK A;  2RNJ A;  3K1N A;  3ZQL A;  4CDG A;  1MND A;  3ZMV A;  2L5Q A;  2PQ8 A;  3OIQ A;  2EV5 A;  3Q0V A;  1IGN A;  4D5C A;  4HX7 A;  1I5Z A;  4M3E A;  4ZYH A;  4KA4 A;  3GTG J;  4D1Q A;  2RQP A;  2Z99 A;  2BYV E;  2VQC A;  3LFK A;  3S93 A;  5JI6 A;  5BNG A;  4CSW A;  1VTN C;  4DOZ A;  1DUX C;  1JXS A;  4PDK A;  3BG3 A;  2DFI A;  1YE9 A;  2W1O A;  1OCO H;  1G3Y A;  2FRH A;  4IHW A;  5D5V B;  3CC4 I;  3BG7 A;  4QPQ A;  3WHC A;  4IPA A;  2LBF A;  2E35 A;  3ASO H;  2E2H J;  3CO6 C;  3S3O A;  3O8G A;  2HOS A;  2V7F A;  3BZK A;  3L2W A;  2Q2E A;  2VBZ A;  2XHK A;  3GYH X;  3L2C A;  4IVN A;  3ZQH A;  1OLT A;  1YW8 A;  4B48 A;  2C6Y A;  1R9T J;  4XKC A;  1XDS A;  3VOD A;  3SJM A;  4IRH A;  1DGW Y;  2XRN A;  5CKT A;  5E79 C;  4MTE A;  1T98 A;  2HQN A;  1O7F A;  2IPQ X;  3FXR A;  2CW7 A;  3E5U A;  3HSE A;  1Z05 A;  2JJ7 A;  5LRS A;  2P5K A;  2VKD A;  4PFP A;  1FY7 A;  3IH2 A;  2VBX A;  1X1A A;  2KT0 A;  4M9S A;  4N4N B;  2DT7 B;  4TV7 A;  2NS0 A;  2ZME B;  2DA7 A;  3ZQ7 A;  4OAY A;  4IHV A;  4KYW A;  1IO2 A;  2ELK A;  4V2F A;  2DA2 A;  2Y0M A;  4E7S A;  5M3M J;  2LFB A;  3JRC A;  4HX4 A;  2XIG A;  3KP6 A;  4MFD A;  4HQE A;  2HYG D;  3ESW B;  2CJJ A;  3H92 A;  4G94 A;  1IRX A;  3CTA A;  1S7O A;  2MC3 A;  2WB1 N;  4MFE A;  2BZT A;  3PM1 A;  3FIW A;  4BH9 A;  2XF5 A;  5TGT A;  1I1G A;  2VB6 A;  2O5R A;  5GTI C;  1OPC A;  2EV0 A;  2GBY A;  1TT0 A;  2LVS A;  4MTD A;  4MNU A;  3PFY A;  4P96 A;  1OCZ H;  1WJC A;  1WJ5 A;  3NRV A;  3CCL I;  3HGY A;  3HRT A;  2M2E A;  2ZXJ A;  1BI2 A;  4FE7 A;  3OV8 A;  1GXQ A;  1G2H A;  3P9C A;  1HW5 A;  1YX3 A;  1MD0 A;  2ZJ2 A;  3ABL H;  1ENH A;  3D5L A;  4UUS A;  1RPW A;  2STT A;  4A0Y A;  2DK5 A;  2JA8 J;  3PNT A;  1BR2 A;  1Z21 A;  5K7H A;  1VQK I;  2WBM A;  4YG2 F;  5A2Q Z;  1VQO I;  3QQA A;  3ZN1 A;  3CQZ J;  4A3B J;  1S7E A;  1LPQ A;  4I98 B;  4RGU A;  2BVL A;  1PJR A;  3DTI A;  2ZSH B;  1TL8 A;  4PJL A;  3GO5 A;  3HUG A;  5LHI A;  1GVJ A;  1YS6 A;  2FQ3 A;  4IZZ A;  1Z77 A;  2K3F A;  2PJR B;  1VQM I;  4PGG A;  1W5S A;  5J3L A;  3SZT A;  2R5Y A;  3KYC B;  1FOY A;  3ULQ B;  5IOZ A;  2JPB A;  4UNO A;  2QUF A;  3VB2 A;  4CCJ A;  4A5N A;  5B66 C;  4JX5 A;  4A3E J;  2ESH A;  4YIR X;  1T08 B;  2EFQ A;  1BC8 C;  3MAJ A;  4N9H A;  4LMY A;  5IT3 A;  2M45 A;  2DT6 A;  5DD8 A;  1OCC H;  1I3Q J;  2XRO A;  2FNP A;  1JJ8 C;  4XRF A;  2R4G A;  1WRJ A;  4F91 B;  4XQF A;  1VFC A;  4HZF A;  2W85 A;  3M7G A;  4M73 A;  5DCM A;  2QF7 A;  2E2J J;  1R00 A;  2HGC A;  2FD5 A;  3P5J A;  3QP5 A;  3TW6 A;  2IA2 A;  4B44 A;  3JTG A;  2CO5 A;  2HDD A;  1W7P A;  3K9T A;  3DU5 A;  2R7X A;  3S16 J;  1V5F A;  4KIG A;  2Y31 A;  2IGO A;  2XGD A;  2BE5 F;  2BHY A;  2W82 A;  1G3S A;  4FET A;  1OJL A;  1MDM A;  2E5N A;  1X3W B;  1DP3 A;  3MZY A;  3C2B A;  5F08 A;  4ASN A;  1QPI A;  1RC9 A;  3BQY A;  5H6Q A;  3QU6 A;  2VN2 A;  3WG7 H;  1WI9 A;  1FP1 D;  2L7M P;  5EEH A;  1P9Q C;  4B4C A;  5BMZ A;  4HOB A;  4UV9 A;  2XF7 A;  1S5L C;  3HG9 A;  5DCF A;  1FWZ A;  2H8W A;  5HLI A;  2Y9Z A;  2W48 A;  5ILS A;  1QRY A;  2KLO A;  1FP2 A;  2DMT A;  4EMS A;  3VEP A;  2EV6 A;  3CLQ A;  5KCM A;  1K78 A;  2P8T A;  2DPU A;  2FNA A;  1Z6T A;  2DK8 A;  1ETV A;  5ICG A;  4EEF G;  4ZDL A;  5HOD A;  2XAQ A;  2DU9 A;  3GVA A;  4C3I J;  2V26 A;  5KVR A;  5M5Y J;  2FU4 A;  2M4K A;  2K3P A;  3WE3 A;  3Q9V A;  2G7U A;  1X4P A;  3GFL A;  4IL6 C;  1VF9 A;  2WV1 A;  3DBL B;  2KIM A;  2EA2 A;  4S05 A;  3A01 A;  1VND A;  2IS6 A;  3SYT A;  2XB5 A;  3OS0 A;  2KIS A;  3FZV A;  3QRF F;  1ZRF A;  3CCQ I;  1B8I B;  1ZRE A;  1IV8 A;  4BUP A;  1YI2 I;  1Y56 A;  1IAW A;  2ME6 A;  5J8F A;  1AKH B;  5KK1 A;  2LYC A;  1TLH B;  5JLW A;  4HF1 A;  3GZ6 A;  3E7L A;  4P9U A;  2NVQ J;  5IYC J;  2VI6 A;  1X4O A;  3S2H J;  2HYJ A;  5J8C A;  4G6Q A;  3HEF A;  1AA7 A;  2QSF X;  2FML A;  3EUK L;  3KYD B;  1ZHF A;  4CZC A;  3S1N J;  3KLN A;  3ISP A;  3BPX A;  1FBQ A;  2EH3 A;  2ZCW A;  3PIO F;  2K9M A;  2I5U A;  2CMP A;  3M8J A;  1YJ9 I;  2CUZ A;  1TNS A;  1JT0 A;  3OSG A;  2R7D A;  2PEX A;  2KQR A;  1JE8 A;  4HSR A;  3HRS A;  1H9T A;  3HXL A;  4XK4 A;  2EB7 A;  2P7C B;  2JA6 J;  1ACI A;  5F04 A;  2F5C A;  1WVR A;  4PGH A;  4XL9 A;  5K7F A;  1GDT A;  3C2H A;  3WTX C;  1ETW A;  4E7H A;  2K40 A;  1YG2 A;  2KIQ A;  2CFX A;  4A0Z A;  3GTP J;  2VOD A;  2BOL A;  2DBB A;  2DW4 A;  3RJP A;  2NS7 A;  4RLQ A;  2LMD A;  1G3W A;  4A3L J;  1FYL A;  2Z5U A;  2VXD A;  1ZGA A;  4LIV A;  4Z6Y A;  3LSI A;  4BEH A;  5B3S H;  3KPH A;  2OZU A;  4X1E A;  4M6X A;  2DJI A;  1XGM A;  2M9H A;  3HHG A;  1MJ9 A;  3DXJ F;  4M9X A;  3ZMS A;  2LOO A;  1EJ9 A;  1X1D A;  2LDU A;  2P6T A;  4BKX A;  4WXH A;  2XPV A;  3HPH A;  4XOP A;  2HOA A;  4UB8 C;  1Z91 A;  2JTV A;  3B6C A;  1V3F A;  2XKO A;  3WTV C;  1OYI A;  2JN6 A;  4G8X A;  5E8G A;  1V4R A;  3E5X A;  3J7Z I;  4RS8 A;  3HJE A;  3CUQ B;  2CW0 F;  4LG0 A;  3JRI A;  2JVH A;  2HR3 A;  2M8E A;  1E3O C;  2QA4 I;  4HLY A;  2JMW A;  4L5E A;  3JSO A;  2R0Q C;  4CCO A;  1RNL A;  3KEY A;  3BP8 A;  2R93 J;  3JRF A;  3HIF A;  3RSN A;  3F9K A;  4BY7 J;  3GWZ A;  4IX7 A;  4CCL A;  2XF6 A;  1HF0 A;  3VOE A;  3DPL C;  4X6A J;  4KN4 X;  3N05 A;  1YQA A;  3MEX A;  3S1Q J;  3K4M A;  5EJC A;  1LKX A;  3MKZ A;  2WAF A;  2F4I A;  3GME A;  3FXL A;  4G6D A;  4F52 A;  4ABZ A;  2WTE A;  4HW0 A;  3KZY A;  1R1U A;  1FMV A;  1EF4 A;  1ZR4 A;  4IRG A;  1QU3 A;  1XGS A;  3DQV C;  3QPS A;  2W7N A;  4M3D A;  4BHB A;  3OR2 C;  1HSJ A;  1TZL A;  4E70 A;  4PFO A;  2R7W A;  1ZAR A;  1X1B A;  4M71 A;  1KU3 A;  1KQ0 A;  3GTL J;  2ZME A;  2R7Z J;  2H1L A;  3HZJ A;  3RIR A;  3ZR8 X;  4XR6 A;  5H2F C;  5AIQ A;  3MZ8 A;  3OR1 C;  2IP2 A;  3F22 A;  4WCG A;  4ZZL A;  2Z2S B;  2XGE A;  3K0L A;  1U0J A;  4U0W A;  4N9I A;  1ON1 A;  5CVJ A;  4RB1 A;  3LA3 A;  2GXB A;  3TED A;  2VIX A;  4XKB A;  1ZR2 A;  3QOP A;  3HDD A;  3DLA A;  2HXI A;  5BS6 A;  3I53 A;  2OA4 A;  4RGX A;  1EH6 A;  2LF8 A;  2VQG A;  2B9S A;  3FMS A;  5KAF C;  1U9O A;  3RDI A;  2EWN A;  2IJL A;  2HQ5 A;  4LB5 A;  2E34 A;  3F8B A;  1MBG A;  4XLF A;  1YRN B;  1I27 A;  3H9J A;  2L7F P;  1L0O C;  1ODD A;  3DF8 A;  4WXC A;  4QLC U;  2P0W A;  2A6E F;  2MBF A;  5B5E C;  2IS1 A;  1R4M B;  2OTL I;  3M8F A;  3FM3 A;  1MBK A;  4UUT A;  2HWV A;  2J5O A;  3W6K B;  1ZAO A;  2LY9 A;  1BI0 A;  1WJF A;  3T1B A;  2GA1 A;  4AYB N;  3CCR I;  1ORK A;  3MD2 A;  1ETQ A;  3TP0 A;  3CCS I;  3DFG A;  3R0A A;  3ZP5 A;  3W6V A;  1ON2 A;  2IT0 A;  4CXF A;  5LHH A;  4A3M J;  3HPG A;  3PQJ A;  1ZYR F;  3H5A A;  1ZG3 A;  4C3J J;  4E7K A;  3TO7 A;  4A3I J;  1BR4 A;  2D1H A;  2DA3 A;  5LRR A;  2CWE A;  1VQ5 I;  1J5Y A;  1MMG A;  3VFZ A;  2ISZ A;  3K4L A;  3WE2 A;  1IUF A;  2VJI A;  2WV0 A;  1HW1 A;  4I76 A;  5HVQ C;  1FX7 A;  1MBH A;  2ZKZ A;  1P2F A;  3FK6 A;  4XID A;  1Q1V A;  3CLO A;  2Z3Y A;  5ICE A;  3GTO J;  3CCE I;  1Y0N A;  3IAM 2;  2GOM A;  3AL0 C;  3H9Q A;  1FSH A;  3OYH A;  2B0L A;  3P9I A;  5FKK A;  1HA8 A;  3JRE A;  5GAE J;  1X3Z B;  2ZXI A;  4ZDP A;  3BG5 A;  3FMR A;  4U87 A;  5L3D A;  3CCU I;  2HI3 A;  3SZP A;  2RKH A;  3LSJ A;  3LSH A;  3GXO A;  3LSK A;  3RTR A;  2A61 A;  3RI4 A;  3H3Z A;  3AAF A;  3HSR A;  1XS9 A;  2QLZ A;  2E1M C;  3KYL A;  2LNB A;  4I0B A;  3KEQ A;  1WJE A;  3M8E A;  3LSP A;  3G1M A;  5CQE A;  5EDN A;  3NAU A;  4D7N A;  3FIS A;  1HKT A;  2F48 A;  4KT6 A;  3CD6 I;  3BR2 A;  1MH3 A;  4WWC A;  3BTC A;  1SAX A;  4HX8 A;  2ZBK A;  4G7O F;  1RI7 A;  2M5W A;  3E6B A;  4FIS A;  2Q8K A;  1RKW A;  1JKP C;  4L9J A;  3WTS C;  5J1R A;  1F9N A;  2WB1 A;  3MVP A;  2ZSI B;  3MZH A;  1KA8 A;  3DCF A;  5D4R A;  3E0J B;  3BJ6 A;  3LSG A;  4E7I A;  5LEJ A;  3QYB A;  3MKL A;  4B09 A;  3IC7 A;  2LLK A;  1E0E A;  5HS7 A;  4KMU X;  3H0D A;  2XGX A;  4LK1 F;  3ECH A;  3ABM H;  3RCO A;  1K4T A;  4MO7 A;  2FJ1 A;  2FF4 A;  1ZQ3 P;  3GLL A;  3JSP A;  1PP7 U;  1P4X A;  4KUM A;  1TWF J;  1NH3 A;  4BYY A;  1P92 A;  2FEZ A;  2UZK A;  3DV8 A;  1O3S A;  1LFB A;  5EG0 B;  3RPQ A;  5CVV A;  2JPC A;  1IV6 A;  1JTY A;  2TDX A;  1RZ4 A;  4BQQ A;  1RIO H;  1J09 A;  2DMQ A;  3GFJ A;  2MLG A;  3CME I;  4XN3 A;  4L9T A;  3IH3 A;  2L4A A;  4DZP A;  4B8X A;  1QGP A;  5GP9 A;  2QGU A;  2P81 A;  4W97 A;  3A03 A;  1AKH A;  1KU9 A;  2JUC A;  2UXX A;  4LK0 F;  5ICC A;  3LNQ A;  2ID6 A;  4II3 A;  4BHC A;  2R5Z B;  2A07 F;  4MIM A;  2V1X A;  2GA2 A;  1TWH J;  4MEX F;  5H6R A;  1R5G A;  2NAZ A;  1SAU A;  5JVT A;  1RRJ A;  1E17 A;  3VPR A;  4ZDO A;  4DYC A;  1U3E M;  2ADU A;  4YII A;  2WC2 A;  5HS9 A;  3F8F A;  2Z16 A;  3I55 I;  3OYA A;  5D8K B;  2LK2 A;  2QWW A;  1R22 A;  1T56 A;  2ESN A;  1ZRC A;  1IRF A;  1T2K A;  1B9N A;  2VUM J;  5F1R A;  2H09 A;  4L5I A;  2CH0 A;  2LY1 A;  3F8N A;  4G9Y A;  5EGO B;  3K7A J;  1R71 A;  4BQA A;  5J4Y A;  2CUF A;  2UV1 A;  3GX4 X;  1I3A A;  1BN5 A;  3RQ4 A;  2OC6 A;  4DQ2 A;  2Z9O A;  2F2E A;  1MBJ A;  5DM6 F;  1HOM A;  5LGN A;  5TRD A;  3L00 A;  1FZP B;  1W36 C;  1A35 A;  4YRV A;  1NHA A;  3ZQC A;  2B63 J;  1FOX A;  1MSF C;  4NC6 A;  1MMD A;  2FOW A;  2CG4 A;  2K27 A;  5LHG A;  1PYV A;  3VSL A;  1IXC A;  3FX3 A;  3BCA A;  2MD0 A;  2IA1 A;  3S14 J;  2HPI A;  1QHH D;  3IKT A;  1MBE A;  1BI3 A;  1F1Z A;  4LFU A;  1MGT A;  2KKO A;  2QKL B;  1D0Y A;  2PN6 A;  2V4J C;  4HV6 A;  2LH9 A;  5JHU A;  4BQN A;  4S04 A;  5FB2 A;  2HQA A;  1Y6I A;  2YUS A;  3AG3 H;  2IVM A;  4RB0 A;  3CUQ A;  2HDW A;  2HEO A;  3IRR A;  4AM3 A;  3I56 I;  3ZMZ A;  1W4M A;  4GCV A;  5CLS A;  2V9P A;  1YJN I;  2R7T A;  2V1D A;  2XAU A;  2NNN A;  3K10 A;  1DQU A;  2DDA A;  2LKS A;  4ANJ A;  4FTH A;  5EZH A;  3KX2 A;  2E1N A;  4CIC A;  1W0U A;  5AON A;  2XAF A;  1HDP A;  4F7Z A;  4YFK F;  2JQ7 A;  1VQ8 I;  1ZN2 A;  3L09 A;  3QOD A;  3V8J A;  1WI3 A;  3H5N A;  2ACJ A;  3VSK A;  1SFO J;  1OCT C;  5HOO A;  1ULY A;  2JA2 A;  1UST A;  2NYX A;  1W5C C;  3JCU C;  2EZH A;  4V2G A;  4YEL A;  1DPR A;  2IGM A;  2CQN A;  5FGM A;  1VQL I;  3V4G A;  1S7A A;  2X9D A;  3L9F A;  1RUN A;  2IXS A;  2BVM A;  4J19 A;  1F5T A;  3ZQQ A;  3L1P A;  1SVL A;  3KCC A;  3K2Z A;  1JKO C;  4HF2 A;  2PG4 A;  5EEA A;  3O6B B;  1XMA A;  1N25 A;  2JRM A;  4LG3 A;  4W1U A;  3CUO A;  2X51 A;  1A36 A;  4ENN A;  2X6O A;  5D8L B;  2OF7 A;  4DIQ A;  3HOY J;  2X4H A;  2L0K A;  1IRG A;  2G9W A;  4A93 J;  2IRF G;  1PDN C;  3BR5 A;  3DTK A;  1R58 A;  3A0B C;  2GXG A;  4GDF A;  1R23 A;  2YS9 A;  1CF7 B;  5FRM A;  4CH7 A;  1D5Y A;  3KEO A;  5C3E J;  2VC1 A;  3IUO A;  5FFZ A;  4NHJ A;  2VE9 A;  3GZN B;  3CJN A;  1IF1 A;  1BIB A;  3C3W A;  2XB0 X;  2BW3 A;  2HZT A;  1IXR C;  3SEZ A;  3BG9 A;  4A0X A;  4EJO A;  3TBI A;  4QIW N;  2IW5 A;  1LNW A;  1S72 I;  2A5Y B;  4QSH A;  1OR7 A;  1FTT A;  4OMZ A;  2VOP A;  4OU0 A;  3J81 Z;  1YIT I;  4RB2 C;  1USS A;  3OYJ A;  3RYP A;  4UXN A;  1PUF B;  3LA7 A;  1BM9 A;  4NB5 A;  5DYM A;  1YIO A;  2BXY A;  3ZN0 A;  4OIN F;  2HTJ A;  2COB A;  2VBW A;  3DP7 A;  1YFH A;  3O3K A;  5FLM J;  2EFP A;  2E7W A;  3HRU A;  4CUG A;  3AG4 H;  2JK3 A;  3ASN H;  1OIS A;  4RDU A;  2RV8 A;  5LEK A;  3EYI A;  1WSU A;  1VQ6 I;  1LVA A;  5FKL A;  1SVO A;  3E6M A;  3NQO A;  5ICF A;  3OYF A;  3TGN A;  5J1U A;  3FHZ A;  1ZTR A;  1XSD A;  4A3F J;  1SMT A;  1WJD A;  2DFH A;  5L3G A;  4GYI A;  2DOF A;  5ILV A;  5HNF A;  3BJO A;  1J9I A;  3RZO J;  2JSC A;  1AU7 A;  4IHY A;  5DEQ A;  4HNT A;  2Q1Z B;  1ZKG A;  4HPQ A;  1A31 A;  1D8K A;  2H1K A;  1MMS A;  4Y15 A;  4YEJ A;  2MAB A;  3D0S A;  4PZJ A;  5CVR A;  3M9A A;  1MZB A;  1IXS B;  4LOC A;  5J4V A;  2XKP A;  1IC8 A;  5ILU A;  2XSJ C;  1GV2 A;  3WTU C;  1Y1V J;  3OYB A;  4BDZ A;  4P55 A;  2X6Y A;  3S2D J;  1YYV A;  3O2P E;  4ETS A;  1SEU A;  2VKH A;  4C30 A;  3PFI A;  4RM2 A;  4P9F A;  5CVU A;  2DTZ A;  2JRT A;  3NAR A;  3M4O J;  1R6R A;  2GLO A;  4BJ6 C;  2XUB A;  1TQM A;  3LOC A;  5F6F A;  2CW8 A;  4WXD A;  2DCE A;  3VYS B;  2V9V A;  2DQR A;  2FMY A;  3CO7 C;  4U0Y A;  2XDV A;  4IEJ A;  1XX5 A;  2JZY A;  3N97 A;  3S3M A;  5FLV A;  2D45 A;  3MN2 A;  2X1E A;  1P6R A;  1LDK B;  1S8N A;  5DD4 A;  3H3U A;  2HOT A;  3BTI A;  3LAJ A;  2M0M A;  2JSP A;  1KQ9 A;  2MSY A;  5IP7 J;  4ZYG A;  3S2W A;  2V1U A;  2HXO A;  2W84 A;  2EBI A;  3OS2 A;  4BXU A;  5F0F A;  2LG4 A;  4HLX A;  1SAN A;  2KL4 A;  3A4C A;  3HYI A;  4N0B A;  1MNE A;  3OYE A;  2VL8 A;  1GLN A;  4IQ4 A;  2ZC2 A;  4XBF A;  2KZG A;  1ONV A;  2V9K A;  1J2X A;  4Y33 A;  3ZOB A;  4F93 B;  2DOA A;  4HG2 A;  4HQM A;  1P4A A;  5F0H A; 
#chains in the Genus database with same CATH homology
 4ZC3 A;  1FMV A;  1D1A A;  3J7A Y;  4XLH A;  4RMN A;  4E7J A;  2R7U A;  1QU3 A;  3K4N A;  2R7R A;  4BAC A;  3DQV C;  2W7N A;  3OR2 C;  1TZL A;  1WJA A;  4AYB A;  3K70 C;  4PFO A;  2ZXH A;  2R7W A;  2UUZ A;  1X1B A;  2E5Z A;  1D0Z A;  4G6T B;  2VLA A;  1MMN A;  1V5G A;  4XM3 A;  3HOT A;  3EUH C;  5JHF A;  4BDY A;  3ZR8 X;  3S3N A;  4XR6 A;  2MFZ A;  2CFO A;  3OWT A;  3OR1 C;  3W2A A;  5CPR B;  2Z2S B;  2GOX B;  3VDX A;  4LIT A;  5HLT A;  1U0J A;  2Y0S A;  1T95 A;  4CA0 A;  2ZFU A;  2VIX A;  2X6W A;  4XKB A;  2WAE A;  3DWL E;  3OOU A;  2KHM A;  3FBN B;  4DBQ A;  3DLA A;  1D1C A;  4PK4 A;  3HKZ A;  2VQG A;  1WFX A;  1UAA A;  2WY7 Q;  1D0X A;  3OIP A;  3LSM A;  2LRD A;  2E1M B;  4XLF A;  3TL4 X;  3H9J A;  4DJA A;  1LVK A;  4BXF A;  2FUG 2;  5KNL A;  2HZD A;  2P0W A;  4R79 A;  4ZTJ A;  3K4B A;  2IS1 A;  4XKW A;  2OV7 A;  3PSF A;  3CJQ B;  3U21 A;  4BGD A;  3L2U A;  1WJF A;  3FDY A;  4XKV A;  4PJJ A;  3MD2 A;  3LFU A;  1Z7L A;  3DPT A;  3ZXS A;  2A5W A;  1NG6 A;  3W2W A;  3HPG A;  3H5A A;  2MYS A;  2VJ5 A;  3MKY B;  4E7K A;  1BR4 A;  5HNH A;  2VAS A;  2A6T A;  4PSW A;  1MMG A;  2VJ4 A;  4OAZ A;  4DBR A;  3HOS A;  3K4L A;  4P1W A;  4PJM A;  3EUA A;  2VJI A;  3A1Y A;  4Y4R A;  5HVQ C;  3OYK A;  3K4K A;  3PNY A;  4B3X A;  3D5R C;  4J00 A;  4HRI A;  3S32 A;  4IQJ A;  2RQQ A;  1MW7 A;  1D1B A;  3IAM 2;  2GOM A;  4C2U A;  3H9Q A;  3SDB A;  3AL0 C;  3OYH A;  2KZV A;  4XLE A;  1HA8 A;  2W4S A;  4XOT A;  3OY9 A;  3L2R A;  2ZXI A;  4ZDP A;  4BE0 A;  3M1C A;  4ITV A;  4N4O B;  4U87 A;  3ONQ A;  1X19 A;  2KP6 A;  3LSH A;  4D9J A;  3LSK A;  3RTR A;  4ZYA A;  3PL8 A;  3DU6 A;  4BL0 B;  2CS3 A;  4NQW B;  4OWR B;  4U7B A;  3H5R A;  2E1M C;  2X1D A;  3KYL A;  3DKX A;  2CV2 A;  2HVS A;  1WJE A;  3MMY B;  1T0F C;  2IGK A;  2MC4 A;  5CQE A;  3BC8 A;  4XON A;  1MND A;  4XNF A;  2L5Q A;  4KT6 A;  3OIQ A;  4KJZ A;  1N78 A;  2NOJ B;  4MLO A;  2XC7 A;  4D1Q A;  1K6Y A;  2VQC A;  3S93 A;  4CSW A;  4E6K G;  4DOZ A;  4PUS A;  2WB1 A;  1YE9 A;  2W1O A;  2ZSI B;  3E0J B;  3LSG A;  3BG7 A;  4E7I A;  4QPQ A;  1YX5 A;  4BQO A;  3QYB A;  4DGW B;  4CCM A;  1G59 A;  1E0E A;  3G2B A;  3OYI A;  2LBF A;  2R7S A;  1N75 A;  3H0D A;  2L9S A;  3S3O A;  2ELJ A;  2AQE A;  3RCO A;  3I9V 2;  2V7F A;  3BCB A;  1KON A;  3L2W A;  4XN0 A;  4JQF A;  5LD2 C;  1OLT A;  1Z3X A;  2R7O A;  4B48 A;  3V42 A;  2WA0 A;  1X1C A;  4XKC A;  1DGW Y;  5CKT A;  4LIU A;  2M4G A;  3AL0 B;  2CW7 A;  4BJT A;  2CUJ A;  2VKD A;  4PFP A;  4BQQ A;  1J09 A;  1X1A A;  1SFK A;  2L9N A;  2Q2E B;  2RNG A;  4NUB A;  4GRI A;  2DT7 B;  2RRE A;  3K4C A;  4N4N B;  4XN3 A;  4OAY A;  2E60 A;  3CES A;  2R7V A;  3FHN A;  5LFA A;  4CCK A;  4E7S A;  5KHD A;  4II3 A;  1UEL B;  2KMU A;  1IRX A;  2HNH A;  3K4J A;  5FRN A;  1SAU A;  3D5S C;  1EA3 A;  2XF5 A;  5TGT A;  2R7Q A;  2L2O A;  4ZDO A;  2VB6 A;  2O5R A;  3TMO A;  3A2K A;  2F6C A;  1TT0 A;  3OL4 A;  1W36 D;  4HNU A;  2Z16 A;  3PFY A;  3OYA A;  3L2V A;  1WJC A;  3HC7 A;  1WJ5 A;  3DTE A;  3LMM A;  2CH0 A;  2LY1 A;  2HPM A;  1YX3 A;  3D5L A;  2UV1 A;  1Z3Y A;  3I3L A;  4P5O A;  3PNT A;  4HEA 2;  1BR2 A;  3RQ4 A;  1Z21 A;  2OC6 A;  2PJR A;  2WBM A;  1W36 C;  2X6X A;  3VYU B;  4YRV A;  3QOE A;  3SEQ A;  1MMD A;  1V5E A;  2QKM B;  2BVL A;  1PJR A;  2LC2 A;  3DTI A;  3OL3 A;  2ZSH B;  4PJL A;  4C2T A;  1PYV A;  3UNG C;  3VSL A;  4FAS D;  2M7A A;  4F55 A;  3VYR B;  3BCA A;  4BS9 A;  2MD0 A;  3NWT A;  4IZZ A;  2PJR B;  2HPI A;  1QHH D;  2X1C A;  2VQL A;  1FMW A;  3W3C A;  2QKL B;  1D0Y A;  2V4J C;  4CCJ A;  2LH9 A;  2M7B A;  4BQN A;  3VWB A;  2HQA A;  1Y6I A;  3GBG A;  4BE2 A;  2HDW A;  4BJ5 C;  4NNJ A;  2R7T A;  2OUM A;  2DT6 A;  1G8X A;  4PJN A;  2XAU A;  3K10 A;  3H9G A;  4BE1 A;  3VYT B;  1DQU A;  4ANJ A;  3KX2 A;  2R4G A;  4F91 B;  4XQF A;  1S9H A;  3QOD A;  3H5N A;  3VSK A;  4H4K C;  5HOO A;  4B44 A;  2JA2 A;  3OYG A;  3DU5 A;  3PSI A;  4YEL A;  2R7X A;  2V1N A;  4B43 A;  1V5F A;  4EAT A;  2IGO A;  2IGM A;  3H35 A;  2W82 A;  2KDO A;  4FET A;  2E5N A;  1DP3 A;  2IXS A;  2IS4 A;  2BVM A;  3ZQQ A;  4KIT B;  3IP4 B;  1P9Q C;  3BG6 A;  2XF7 A;  3E1S A;  3HG9 A;  2KRH A;  4LG3 A;  3OYD A;  1QHG A;  2X51 A;  4DIQ A;  2KLO A;  3L2Q A;  3C2G A;  5KCM A;  3DTK A;  3W2V A;  4RLF A;  2LBF B;  2KPM A;  2JVG A;  5FRM A;  2K9L A;  4CH7 A;  5CQG A;  2CV0 A;  4ZDL A;  3IUO A;  4RM3 A;  4PSX A;  3S8P A;  3CF2 A;  2KRC A;  2V26 A;  3AFH A;  2BW3 A;  1JI8 A;  3SEZ A;  3CJR B;  3MKW B;  2M4K A;  2K3P A;  3TBI A;  3PJR A;  1N77 A;  2X85 A;  1X4P A;  4F3Q A;  2WAQ A;  4HST A;  3QYF A;  1VZ0 A;  4E7Z A;  5FRO A;  3OYJ A;  2V6E A;  3DPU A;  2AQF A;  2IS6 A;  3SYT A;  3OS0 A;  4AVZ A;  2VXZ A;  4II2 A;  3DKY A;  4BUP A;  2BW3 B;  1Y56 A;  2VQH A;  2VJJ A;  3OYC A;  2W00 A;  2LYC A;  1LFP A;  4NC8 A;  4CUG A;  3LL7 A;  1UG0 A;  1ZEL A;  1X4O A;  4KIS A;  1AA7 A;  3EUK L;  3ZCO A;  4CZC A;  3OYM A;  4X0G A;  2IS2 A;  2K9M A;  2CMP A;  2K5C A;  3M8J A;  3OYF A;  2CUZ A;  2HVQ A;  2CV1 A;  4IKF A;  2KQR A;  3OMY A;  4B47 A;  2IGN A;  2LRE A;  4HSR A;  2DXI A;  3HXL A;  3NWS A;  2M3A A;  4F92 B;  3OYN A;  1WJD A;  4ZTF A;  3SZG A;  3ZRG A;  4XL9 A;  5HNF A;  2WAD A;  3DEE A;  3C2H A;  4E7H A;  4J01 A;  4HNT A;  3K6G A;  2Q1Z B;  4HPQ A;  4Y3O A;  3OS1 A;  2BOL A;  4XOR A;  3IAS 2;  4RLQ A;  4YEJ A;  2MAB A;  2UWM A;  1BR1 A;  2VXD A;  4CCN A;  2L7K A;  4LIV A;  2F5V A;  2JUG A;  2WY8 Q;  2XSJ C;  3LSI A;  4BEH A;  3PNV A;  4QPO A;  3OYB A;  4BDZ A;  2I8D A;  2X6Y A;  2Z1D A;  2DJI A;  1BOB A;  3HUG B;  2LY2 A;  2VKH A;  1NG7 A;  1WJB A;  4C30 A;  4ZJZ A;  3AKZ A;  4RM2 A;  2LOO A;  1X1D A;  4E7L A;  1R6R A;  3HPH A;  3CMM A;  4XOP A;  4BJ6 C;  2CW8 A;  3EPZ A;  2DCE A;  3VYS B;  4XLC A;  3ZGK A;  4BEH B;  4JOM A;  3OYL A;  4XMY A;  2JVH A;  3CP8 A;  1OR7 C;  1DGR M;  2XDV A;  3QYE A;  3BLY A;  4BU2 A;  3UR3 C;  3S3M A;  4E4H A;  4CCO A;  3KEY A;  2X1E A;  1LDK B;  3FKJ A;  3CZ6 A;  2PMZ A;  4AU7 A;  3RSN A;  2M0M A;  2JSP A;  2HVR A;  4C9Y A;  4XLA A;  3F9K A;  4IX7 A;  4CCL A;  3OS2 A;  2XF6 A;  3FBI B;  2LG4 A;  3DPL C;  3K70 D;  3N05 A;  2KL4 A;  3A4C A;  3K4M A;  1LKX A;  1MNE A;  3CP2 A;  3OYE A;  1MMA A;  3MKZ A;  2WAF A;  2VL8 A;  1ERD A;  2F4I A;  1GLN A;  3RPU D;  2VPL A;  4NC7 A;  4IQ4 A;  4F52 A;  2V9K A;  4Y33 A;  4F93 B;  2HU9 A;  2DOA A;  4HG2 A;  3PUB A;  3HL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...