4OAYA

Bldd ctd-c-di-gmp complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
80
structure length
80
Chain Sequence
PPKLVLDLERMAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces venezuelae
total genus 27
structure length 80
sequence length 80
chains with identical sequence B, D, E, F, G, H, J, K, M, N, R
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4oayA00
2MC4A 4OAZA 5KHDA 4OAYA
chains in the Genus database with same CATH superfamily
1QZYA 3PIOF 5F6FA 3ZQFA 2QYOA 4XRSA 1ZLKA 3WTUC 3I55I 2HZDA 1A35A 2OTJI 2E1CA 3HKZN 1FLIA 2EIMH 3DEEA 4XLPF 2CQ7A 3QYBA 4PUSA 5DDGA 3VPRA 5L3BA 4II3A 4CYCB 4GFBA 3FXKA 2R92J 3H9GA 1TW2A 3EYYA 4RAGA 1Z6RA 2QZ8A 2RVCA 2ICWG 2DQRA 3BOQA 3K70D 1ETKA 2B7EA 2R93J 1XG1A 1S3JA 2GWRA 4YEJA 3U9GA 5KAFC 2K9LA 3K4KA 4KA4A 2IT0A 4KISA 2ETHA 5EZGA 2L5QA 5D4RA 2D5VA 5M3MJ 2VT2A 3BC8A 2D2WA 1XMKA 2WB1N 4XKVA 4IQJA 5K1YA 3OOUA 5C4JJ 3E5QA 3HRMA 5HLHA 2M4KA 1XCVA 2VPRA 2NVYJ 3JRCA 3JTGA 2OTLI 4GDFA 3ZGKA 3H3VK 2ZJQF 3WHBA 4RGRA 3OYJA 1H0MA 1BJZA 3M1EA 4OIRF 3TGNA 5DM6F 5HODA 3BR1A 3WODF 2VJJA 3FXOA 2KJBA 3ZQHA 2XSDC 3BG6A 4BAYA 2LR8A 1IV6A 3GTMJ 4LLLA 3HUGA 3LSIA 3WGHA 1TZLA 3V4GA 3VYRB 2L9SA 5F04A 1IC8A 2RQPA 2Z9OA 1MIJA 3E97A 2Z33A 2G9WA 3MVPA 1VTNC 2XKPA 3U1KA 1SFKA 4IKFA 2OCCH 2GXAA 1XGNA 5FLVA 3EUAA 1VQ5I 5E3MA 2I8DA 3P7NA 5L3FA 2A68F 3VYUB 2ISZA 4BE1A 4CCMA 3VEPA 4DQ2A 4XLEA 2BE5F 2PEXA 5HLGA 1TWCJ 1RIOH 1IG7A 3OOPA 5CVJA 1IN8A 5HS7A 3WTSC 4A3FJ 4CZZA 3CCMI 1D5YA 3OYKA 4KN7X 4B1RA 3F8CA 2R5YA 3QWLA 2Q2EB 2R7FA 2M87A 3DKYA 4N4NB 4A3IJ 1U78A 4L9TA 2NNYA 4I2OA 5M5WJ 3R60A 2VE8A 3MKWB 2OJED 3J7AY 2CO5A 2LYCA 3FXJA 4RA2A 5D5VB 3GYHX 2XVCA 4FT8A 3VB2A 3OYNA 1LE8A 3WGGA 1ORKA 1MMAA 5LEKA 3GTGJ 3HIFA 3HDDA 3G1LA 5IP9J 2MD5A 3VOEA 3NRVA 5B1AH 2YR2A 1G6NA 4HQEA 4BKXA 1P4WA 3FWEA 3VSKA 1J09A 3MCZA 4BQNA 1MNMC 1LDDA 2WA0A 3C2GA 4B8XA 4F7ZA 1MSEC 3BTLA 4F93B 1JE8A 4AC0A 3WU0A 1NG7A 4GYIA 4ENMA 1OCRH 1FOKA 5DS9A 1MH3A 4IHYA 5F64A 1H88C 3N4MA 2HS5A 3TW6A 5E3OA 1Z0XA 2HVQA 3I9V2 1J9IA 3UKGA 3DLAA 1PJRA 3H36A 2JA5J 4UVCA 3HTSB 5GAGJ 3L2WA 3OR1C 3I59B 3S2WA 2VE9A 5J40A 2H8WA 4J01A 2FD5A 2ZNZA 2PJPA 4EEFG 3DEUA 4UUSA 2F6CA 4X1EA 2L7KA 1RRJA 4LLNA 1X58A 2BGCA 3CTAA 4CYDA 1Z67A 4II2A 4MQVA 2DN0A 4DGWB 3KP5A 1W5TA 5LBQA 4ESJA 3LSGA 4CA0A 3Q9VA 3CZ6A 2ZJ2A 4YIIA 4ZYEA 1ZR4A 3IKTA 2XB0X 5K7HA 3DLLF 3FDYA 5JLXA 4E7SA 2MLGA 3TP0A 2Q2EA 1LKXA 4RB2C 3QOPA 3H5AA 4M6XA 3B73A 2WY8Q 1QHGA 4KJZA 4A3CJ 2HPMA 2FJ1A 1U2WA 2FE3A 4BJ5C 5D5WB 2W00A 1X2NA 1HCRA 1GDTA 1GHCA 1VF9A 3QPHA 3G3ZA 4UVBA 4UB8C 5LFAA 3ZRGA 5DV5A 4M3EA 1IJWC 1LPQA 1XN7A 1U9OA 4IQ4A 2EBIA 3IH2A 3LSTA 4HOBA 1WJEA 2CQQA 5CQEA 2QBYB 1TNSA 1P7JA 3P9IA 4OMZA 1IN6A 2XASA 2PBIA 3CC2I 2M7BA 3BR0A 1B4AA 3S14J 3M3YJ 3HSFA 1ETQA 3D5LA 2R7UA 4FASD 1YJNI 4ANJA 3HB9A 1EV7A 4PDKA 4CCJA 2B9SA 3V42A 1T39A 2H27A 1OISA 3GCMA 4J19A 3CP8A 2VQLA 4EM0B 2GLOA 2DYSH 4EGYA 3EYIA 1BC8C 3OS2A 3K4MA 1U5TA 2MGQA 1WKMA 1R7JA 2K4BA 2MBFA 4HRIA 5H6RA 2MLKA 2H1KA 1PUFA 3K0LA 2DT5A 2Y48A 2KHMA 2W84A 3F9KA 5HDGA 3TKYA 4I6ZA 5EYRA 5E79C 1X19A 1ZREA 2EA2A 3L2CA 2HQRA 1OCOH 2ELJA 3OYAA 1FC3A 4X6AJ 1F4KA 3SYTA 4HX7A 4AD9A 1FSHA 2XV4S 1LFBA 2W25A 1B72A 2DMPA 2O8KA 1BR4A 4AM3A 2IP2A 2QQ9A 2XGCA 4LK0F 1YLFA 4ZJZA 2L9VA 1R36A 3BP8A 3LSHA 5GPAA 2JVGA 4W1UA 1BIAA 1OKRA 1KQ8A 4HPQA 1FTZA 3EUHA 1EH6A 5D6FA 5B5EC 1BOAA 4YFNF 2ZMEB 1D1AA 2IAIA 3GFLA 4C2MJ 4H0EA 2OZUA 4NC7A 5HDKA 1TQIA 1IZ1A 1QVTA 1ZGJA 3NEUA 3OS0A 1AKHB 1N25A 1XX5A 4BNCA 1FMVA 1Z7UA 2LF8A 1O7FA 2COMA 1XC5A 2CYYA 2RAEA 1G2HA 2RDPA 4MFEA 2QBYA 2MYSA 4EJWA 3RKQA 3IP4B 1RC9A 5HS9A 5EGOA 1JUSA 2CJJA 2F5FA 5BQTA 1R5HA 1XDUA 5IYCJ 3B6CA 3BPXA 4FE4A 1SD4A 1SVOA 4B3AA 4DNCA 2X1EA 3M8FA 1BI1A 2CFXA 3LOCA 5LHHA 5KAIC 1ETYA 3DXJF 3DU6A 2DA5A 4V2FA 4QPQA 2VKDA 2XAUA 4XM3A 1FYKA 3JRFA 3FMQA 2YUSA 2QKMB 2PFBA 5LRRA 5J8FA 4S0HB 4RBOA 1D5VA 1MBHA 1D0YA 1PVEA 3MZYA 4UUTA 1MMSA 1U5TC 1W5CC 4PK4A 2QSHX 3P9KA 1QNTA 2L01A 3OL4A 5DCMA 2VN2A 3HSRA 3T0YA 3TO6A 1MBEA 3A02A 1FJLA 2MA3A 3S8PA 2M5WA 3W2WA 3GTQJ 3RQ4A 4UXNA 5CQGA 5DTDA 1H9TA 2OF7A 2DA4A 4BACA 3OYHA 3FHZA 2L9NA 1K61A 4P1WA 2KDZA 1ACIA 5HOOA 4JK1X 2R3SA 2EFNA 1U8BA 2E1NA 5FROA 1T2KA 4I98B 1R49A 3K9TA 5IOYA 2HVRA 2VBWA 3KP7A 3H9JA 4P96A 3TO9A 3AL0C 2R7XA 2JVHA 3HRTA 4LB6B 5FFXA 5KVRA 4E7JA 2WAQN 2XDVA 5C3EJ 1CGPA 1VQ6I 4IHSA 4AIHA 2ESHA 2CFOA 3ZMZA 3WTZA 1FP2A 3V8JA 2ZMEA 4UV9A 1FPQA 3EUHC 3QP5A 3IUOA 5H6QA 5F1RA 2XRNA 1AHDP 3E6MA 4XMYA 5J4YA 4D9JA 3JCUC 3F23A 4O6JA 4ZYDA 2V1NA 2K3FA 2E7WA 2A5WA 3OSGA 4ENJA 2CV1A 2H6CA 4HNVA 1XB4A 1RUOA 2WAFA 1LUJB 5IT9K 1YIOA 4K2EA 1YE9A 3IHUA 3M8JA 1FBQA 1MKMA 3BQZA 3K6GA 2R7SA 3K2ZA 2UZKA 1BW6A 5IT9Z 2V9VA 1VQLI 1WI9A 2FNAA 4YIRX 1K83J 4RGXA 5M5YJ 2HKXA 1B6AA 5TGTA 3H3UA 2D1HA 2MSYA 3ZN0A 3PO3J 3DF8A 2HI3A 1Z3YA 4BUPA 3GFIA 3CC4I 4KICA 2RQQA 3HGYA 1UHWA 2LH9A 3RCOA 2LSOA 1ZELA 3GZNB 5L3CA 2CUJA 4ENKA 3AAFA 1MNEA 1MBKA 2X6OA 3HRUA 4AVPA 2GIZA 5IOZA 2VBZA 2VT3A 1QA6A 3TW7A 5IPAA 2VOOA 3DV8A 2STWA 3FISA 1HSTA 4FE7A 4BS9A 2NVXJ 2CGPA 1K4SA 2XIGA 2VPLA 3FXQA 2NS7A 4OMYA 1DDNA 1YITI 3TBIA 3FM5A 3HOVJ 3CCQI 2GXBA 1T08B 3ZQQA 1V55H 1HQCA 2M30A 1L0OC 2LKSA 4D0PA 1MMNA 3HC7A 2OC6A 2HKOA 5IYBJ 3M1CA 3I54A 3C1DA 2BW3B 3DU5A 4M3DA 4A0XA 3I71A 3ZN1A 4A3EJ 2DTZA 4ZYAA 4BHPA 2P6TA 3TDZC 5D5XB 1S7AA 4DZPA 3CCSI 3S1QJ 4XN0A 3KPHA 2HQ5A 5HNHA 2EJRA 2YU3A 5GTHC 4U88A 1W7PB 2HXIA 1V4RA 4R1HA 1T0FA 3OV8A 4RLQA 2KZVA 2ZMEC 3MEXA 3DBHB 4WX9A 2M0CA 5BPDA 1Y0NA 3N97A 4HX4A 4B47A 2X1DA 2EZLA 1FOYA 5FD6A 5LEJA 5CKTA 3ZQCA 4MHGA 3OIPA 2OD5A 1ZARA 2DMNA 5HLTA 4OIQF 2QQBA 5FFZA 3IH4A 3K4NA 2DFIA 3OIQA 1E0EA 1HOMA 4BY1J 1SD6A 1IRGA 2H6BA 2HFHA 4NBQA 1DPUA 3FXMA 1B1BA 2ZXJA 4PJMA 1R00A 4GCVA 4BXUA 2LD5A 1JGSA 1T6SA 2MABA 4KMUX 3CCVI 4NHJA 3QP6A 5LHGA 2EILH 2HQAA 5AIQA 2JSCA 3PQJA 2ZNYA 1ZG5A 2FUG2 3S93A 5DD4A 4XICA 2P5VA 3JTHA 2IS2A 1B59A 1O3QA 2G7UA 4D5FA 2VJ4A 5GAHJ 2QSFX 1BN5A 3T5XA 4L5JA 3LQRA 1KYWA 1HA8A 1U8RA 2ELHA 2V9PA 2LTPA 2Y0SA 2DXIA 1TC3C 2XPWA 1W36D 1Z7LA 4M9XA 5EJCA 3OYBA 2H1LA 4Q48A 2O03A 2DYRH 4MFDA 5CPRB 1BI3A 2R5ZA 3U2RA 1RKTA 2BYVE 2UXNA 3OYIA 2QKLB 2M8EA 4BE0A 4OIPF 4I01A 5CVVA 4XRFA 3ERED 3K1PA 3BROA 5M5XJ 3HOZJ 3P5JA 2KIUA 5E1ZB 1O3SA 1L3LA 1H8AC 1OFCX 4HF1A 4EM2A 2CQKA 4AIDA 1R23A 1UELB 3HEFA 5E20A 1TP4A 3VSLA 4UHTA 2J5OA 5GADJ 1JT6A 2F5DA 2V9KA 1T0FC 1Z1DA 1ZH5A 2VKHA 2NVTJ 1SMYF 3HUGB 3I3LA 3M7GA 3NQOA 1YW9A 2NVQJ 2WAEA 1NK2P 3HM5A 1ETXA 1RZ4A 3CCLI 3H9QA 3AG3H 3ZMTA 2AHQA 3DKXA 4WWCA 4M74A 1SC7A 4KUMA 3H5NA 1YJWI 1OYWA 3S32A 2X0LA 3L1PA 1F43A 3QPLA 1MMDA 1YS6A 3TP3A 1ZRDA 2R7QA 4A3JJ 3BT9A 3ABTA 6PAXA 4G9YA 4MEYF 5JFRA 4UVAA 4WF2A 3BDDA 1WPKA 2QF7A 4LOCA 1ON1A 1VQKI 2EFPA 3CF5F 4M6VA 4P9FA 2A6EF 3PM1A 3FMSA 3V8LA 3RPQA 2QQAA 5JR3A 3JAMZ 4UUVA 2ID3A 3HYIA 5FJ8J 1NH3A 5CJ9A 2R5YB 1X1PA 1OCPA 2VL8A 3DP7A 3HPHA 5J1UA 4EVIA 4EJOA 4AVZA 4NC8A 3GW2A 3F0CA 4AU7A 4WCGA 3KEOA 5F0CA 3ULQB 4PGGA 3KEQA 2EZHA 1VFCA 1LE8B 1UFMA 3SXYA 1V54H 2GZWA 2CMPA 2LVSA 4IRHA 1I6XA 4U0VA 1J5YA 4IOAF 1YIJI 1BI2A 1T98A 3HXLA 2L7MP 4D7NA 4A3BJ 3D5RC 2X51A 1XD7A 2KIMA 3SZTA 4BGDA 2E1MB 1U0JA 4LITA 3ISPA 1NK3P 1XSDA 2JZYA 2AQEA 4AUXA 3GTLJ 4N9IA 4PJJA 3WE3A 2NS0A 4EQQA 3J81K 4LLGF 4P5OA 1O57A 2ZSIB 1WH5A 2IS1A 3FKJA 2CQNA 1S5LC 4L9NA 3J81Z 1X1DA 3KEYA 3UR3C 2DI3A 1OJLA 4XKBA 2BY0A 2R7ZJ 1ZR2A 1SVMA 1YOVB 4R8HA 3KYLA 4XOTA 3QYEA 4O3MA 1FOXA 1HW2A 2HPIA 2VKVA 2F4OB 3E1SA 2DDBA 1O7LA 2X1CA 4NNJA 2KDOA 1TQPA 2M3AA 3F3XA 1FY7A 1RESA 2DJNA 4RGSA 3A1YA 3FK7A 3CCYA 4UV8A 4Y15A 4CSWA 2KT0A 3CUOA 4UUSB 4XSXF 3S3NA 4PCQA 4DOZA 4JQFA 2F48A 4NUBA 4E4HA 2KLOA 2UUZA 2P81A 2FOWA 3SZPA 1K78A 2FEZA 4Z2YA 1G4DA 2F2EA 2JRTA 3QRFF 4CH7A 1ZGAA 4BBSJ 3SHFA 2A69F 1S6LA 2IPQX 2DA7A 2P0WA 1IUFA 3GFMA 2IW5A 4ENNA 2C6YA 3W2VA 2EK5A 2DFFA 1CQTA 3MD2A 1B8IA 1SANA 1JJ8C 1QZEA 4HV6A 2FA5A 1EH8A 2QEXI 1MGTA 3RYRA 5HDNA 4KT5C 2BV6A 3HKZA 4CUGA 2Q0OA 4H4KC 3J7YJ 1SEUA 1A5JA 3OYCA 3DKWA 4RAYA 1BR1A 3G6EI 1R1UA 1TWFJ 2CQXA 5EDNA 2QGUA 2YSRA 2RGVA 2DMTA 3PJRA 3VDXA 1UG2A 2W1OA 9ANTA 5GTIC 2HOEA 3ROUA 2EV5A 3SDGA 1WHUA 5K5QA 4BDZA 1R5GA 4XRMA 3SJMA 3GF2A 3HRSA 2IGOA 4QIWN 1WJ5A 4ZZDA 5GPCA 1Z21A 5C4XJ 4MIMA 2O61A 2W48A 2HYJA 1WVRA 5DUKA 4EV0A 2LNBA 2X6XA 4E6KG 4FTHA 3KYCB 1KQ0A 3E6CC 1R4NB 4M73A 4CO8A 3RQIA 4L5IA 1QGPA 4I76A 2JPCA 2BY3A 2WB1A 5LGNA 4PFOA 1KA8A 4WXHA 2QSGX 2XAFA 4C2UA 3OIOA 2P5LC 4XIDA 3H35A 3FHNA 1HDDC 4PJLA 2ME6A 1WH7A 2P5KA 2D1VA 5EEGA 3F6VA 1JKRC 2XKOA 1U5TB 1G59A 1MDMA 4NQWA 3D0SA 3RKYA 3OSFA 1T33A 5ICFA 1TTYA 3SDBA 4BQQA 2QA4I 2DBBA 2GQQA 4HZFA 4G6QA 3W6JB 1PUFB 3PNTA 1WRJA 3LA7A 1MNDA 3OYDA 2ZXIA 2BBYA 4UY8I 1GXQA 2LY2A 3ASNH 3OS1A 1ZYRF 4RB0A 3REOA 1BIBA 3FIWA 4HEA2 2Z99A 4OAYA 3AL0B 1V5FA 4HAMA 3S1NJ 1F5TA 2Q8KA 1ULYA 3LQQA 1B72B 3O8HA 3ZXSA 4B48A 1DP7P 1QQIA 1V5GA 2CW8A 4F55A 1MBGA 1FX7A 1Y0UA 1HDPA 2AXTC 3L7WA 4ASNA 1E3OC 5DCFA 1W0TA 2NNNA 3U21A 1VI0A 2E36A 3CD6I 4G12A 3H0GJ 1XMAA 5F0FA 4D1QA 3FXLA 2E60A 5EEHA 4C3JJ 3CF2A 4OU0A 4ETSA 3GLLA 5IP6A 1Y8QB 2CSOA 2W57A 4L18B 2BXYA 3NWTA 3WE2A 1BI0A 2XSJC 3HPGA 1I39A 3DPUA 2ZXHA 3L2RA 1MJAA 4CGZA 4LMYA 2IJLA 4B44A 1Z9CA 2EZKA 2A6TA 4D7MA 3VWBA 2E1MC 1Y6IA 4A5NA 4M9SA 4B4CA 4EATA 2UXXA 2Y69H 1W36C 4IHVA 2FF4A 5ILSA 4AYBN 5EGOB 1S8NA 3A0BC 1STZA 2IA0A 2NOJB 2EFOA 3OR2C 3V8KA 2G0EA 1WGXA 2VQHA 3ABLH 3OYFA 5TJJA 5J47A 3I64A 4HSTA 3ZMUA 3PSIA 2JQ7A 4Y17A 4CCNA 1V5EA 3KYDB 4IF4A 2HWVA 2QWWA 3LL7A 5DEQA 5LRSA 5ILVA 1TQMA 3K4BA 2H94A 3L2VA 2FU4A 5J6XA 3F8NA 2KL4A 1IDZA 4GO1A 3CO6C 2R7WA 1XSVA 3RPUD 2K3PA 3EQLF 3CC7I 4YELA 4XRSG 5FLMJ 4RM2A 1VQMI 3Q9SA 3MKZA 5DCMB 2M4GA 2K9NA 1ETOA 2JUCA 3K69A 4U7DA 3ZPLA 4HV5A 2ACJA 4N4OB 3AFHA 2OUMA 3A03A 3GTJJ 4HF2A 3JR9A 3F72A 5KHDA 2HDWA 2PG4A 1R9TJ 3NAUA 3R6SA 2BOLA 5LD2C 2L0KA 3F21A 2PI0A 1LFUP 1FYLA 3BZCA 4HLYA 2QLZA 5FKLA 2Z16A 4F3QA 1JUMA 2F5CA 3R61A 3CO7C 1VQ7I 1X1AA 3RDIA 2LF7A 4M71A 1UCRA 5ICEA 2VI6A 3L9FA 5HLIA 3FMRA 1B9NA 3KP3A 1XMXA 2LFBA 4MTDA 1WFXA 4AIKA 3FBNB 1KU2A 4KYWA 3ERMA 3R0AA 1USTA 1XPXA 2V1XA 1JTXA 4JX6A 4FISA 1OR7A 3GZ6A 2HTSA 5F0HA 2JA8J 1VNDA 3K70C 1UJ8A 1REPC 2FX0A 3O3KA 3MQ0A 3CMYA 1OCTC 1KYZA 2XROA 4DJAA 3ASOH 3I56I 5HS8A 2WBMA 3FXUA 4KN4X 5KNLA 2A5YB 2HYGD 2DK5A 3TOAA 3BCBA 3B02A 2CWEA 3IWZA 2V1UA 4PSXA 4C3HJ 1KU3A 4U87A 2XAGA 1LEAA 2JA6J 3FX3A 4NDLA 3C2BA 4FCYA 2EA4A 2K9SA 3RKXA 1XS9A 3LWFA 2ZFUA 2A6HF 5L3DA 2ID6A 4RS8A 2RC4A 1H9GA 3W3CA 1YRNA 4I0AA 4LG0A 1IV8A 1HW1A 1YYVA 2IGMA 2VQCA 2CV2A 1RNLA 4IL6C 3QQAA 4MGRA 5KCMA 1MBFA 4A0YA 1WI3A 1WJBA 1DU0A 1X4PA 2OCEA 2BHZA 1M1EB 3T8RA 4LIUA 5J1RA 4XQFA 3H1CA 1ENHA 2MD0A 1WCMJ 4G94A 1ZRCA 1P9QC 3KZYA 2AQFA 2O5RA 3H92A 5AONA 2L4MA 2Z2SB 2QCOA 3KP2A 5DYMA 3AG4H 1I1SA 3M07A 4IVNA 5F27A 4ZTJA 4BH9A 2HGCA 4CDGA 1YHQI 1A31A 2BVLA 2M7AA 1S29A 2O3FA 2IXSA 2NS8A 4L0YB 5CVIA 1YW7A 4QWQA 1XDSA 4KDPA 4JBAA 1OR7C 4N9HA 1ZK8A 4Q5SF 5HNFA 3ABMH 4NC6A 5FLXK 2P4WA 2MW8A 1MBJA 2KRFA 4JX4A 4JOMA 1F1ZA 5GP9A 4IX7A 3H5RA 2XAQA 5FLXZ 3G71I 4M3GA 5DUIA 2YS9A 2QUFA 5K5OA 3U1DA 4HG2A 3ZR8X 1O3RA 3M9AA 1TW3A 4P9UA 3FZVA 4F91B 4BE2A 4XBFA 2X4HA 1IN7A 3KETA 5EZHA 3E7LA 2DCEA 4NB5A 2DOEA 3BLYA 2P7VB 2NXNB 3R4KA 3A2KA 1RETA 2XPVA 3CJTB 2PMHA 3LSJA 2CS3A 5EG0A 2O8XA 1WWXA 4X0GA 4LJZF 3HOSA 3HOTA 3E5UA 2JPBA 3C7JA 1BL0A 2STTA 3HOUJ 3RI4A 3DTEA 4FETA 3RPUA 2CW7A 2DT6A 2GA1A 2Z5UA 2R5ZB 2LC2A 4BEHA 5TRDA 1VQ9I 4RMNA 4XN3A 4DYCA 3COAC 4CZCA 2FBKA 5EF6A 2JUGA 1ZN2A 1OQYA 2HTJA 1IN5A 1X3ZB 3D5SC 3V7SA 1JT0A 1KONA 1T38A 2F5VA 1GT0C 2ECCA 2JA2A 2DT7B 1ETVA 1UMQA 3E3VA 2GAUA 1CF7A 3S3MA 3T8TA 4Y7NJ 2A05A 1QVUA 3OYEA 2X85A 4DIQA 4BL0B 2FRHA 1F9NA 1FP1D 3WU2C 2QQ8A 3IRQA 3I5UA 1W0UA 3O8GA 3MKLA 2FSWA 1HKQA 2WV0A 4M3BA 1QPMA 3DCFA 4PJNA 2CUEA 3ZMSA 2FXAA 2MFZA 2VJIA 1UHSA 3GLXA 2F5EA 3DQVC 2WAQA 2DMQA 3WTXC 3GTKJ 3G73A 3JREA 2P6SA 2BEOA 1P6RA 2VXZA 3KE2A 4KIBA 3MKYB 2IA2A 2VBYA 2FOKA 3BY6A 4I0BA 5D8KB 1AOYA 2QENA 4M3FA 4KIGA 3MN2A 3KP4A 4BXFA 1Q1VA 1IO2A 1U6GA 3K4LA 3DBRB 3PNVA 5BNGA 2IS4A 4HNTA 3DEWA 1PP7U 3N05A 4BQAA 3D1NI 4JX5A 3GVAA 1TWAJ 1P4XA 3MWMA 2BY2A 3G1OA 3OYGA 3Q0WA 4HDVA 4IHXA 3QAHA 2GA2A 2KKOA 4IPAA 4ESFA 3RSNA 3ABKH 4LGWA 1RUNA 2X9DA 4L0ZB 1ZRFA 1MJ9A 1XCBA 4CCLA 1PUEE 4GXOA 4RB1A 3JSOA 4O5VA 3BG3A 2UV1A 3IH3A 5ERIA 4RB3C 3CCRI 5CVRA 3TDUC 5F1JA 5IYDJ 3NWSA 5BPIA 5JHFA 4MLOA 2EINH 1NHAA 2VC1A 2LG4A 2ZBKA 4KIFA 3W6VA 3MZHA 1LJ9A 3F22A 3FM3A 1I50J 2VXDA 4HQMA 2P7CB 1FT9A 1D8JA 2W24A 2OZ6A 3KP6A 4RAZA 1TWHJ 4R79A 5K7FA 4CXFA 3OMYA 3JRGA 3PSFA 2R7DA 2DPDA 4A3LJ 1BM9A 2X6WA 1HSJA 5FKMA 2FMLA 3HOWJ 2KIQA 3RZOJ 4YFXF 3WU1B 1Y1WJ 5J4VA 2R7RA 3SFZA 3RTRA 3JW4A 2HOAA 3G1MA 1NG6A 2LBFB 5CLSA 2K02A 1R71A 2DOFA 2VQGA 5LGTA 3BZKA 2Y0MA 5J1YA 3ZP5A 2K40A 1ZKGA 3IKVA 1I3QJ 4M9ZA 2B63J 2HOSA 1G8XA 1POGA 1SD5A 1K7AA 1IRFA 2M8GX 3ONQA 3W6KB 4B3XA 1E3PA 3BPVA 5JVTA 4DBQA 4IHTA 2CU7A 2GOMA 1HF0A 1U9NA 5M3FJ 4A3MJ 3OL3A 3A0HC 1OPCA 4BY7J 5A2QK 2XGXA 1DGRM 1D0ZA 3DFGA 4JYKA 1K78B 4UNOA 4BBRJ 2L9RA 3ECOA 1W1WE 3GBGA 1BA5A 3JAMK 4E7IA 4ABZA 4KNYA 1J0RA 1YX5A 4BU2A 2NVUB 1D1CA 3IV5A 5A2QZ 3EETA 2ZJPF 4HX8A 3LFUA 5K5RA 1QHHD 1MD0A 2Z3YA 3ZMDA 2XRLA 2EIKH 4IJAA 3G2BA 1UZCA 3I53A 5L3GA 1B8IB 4ZDLA 5DM7F 1OMIA 5FB2A 2A07F 2J5PA 2P8TA 5ED4A 1Y56A 3KFWX 3TQNA 4A69C 3JRDA 3LSPA 2IGNA 3JRBA 2NOGA 1IW7F 2HOTA 2H09A 1APLC 1GUUA 2DQLA 3R0JA 4U0YA 2OQGA 4FX4A 2EB7A 5JVGF 3JRIA 1D3YA 1A6IA 3E6BA 4MNUA 1YJ9I 3K10A 5JLWA 2PMZA 1TLHB 4Y13A 2PX9A 3E6DA 1MZBA 2PJRB 3ML6A 3V7CA 2O0YA 2WTEA 4EJUA 2ZKZA 3WTWC 3BR2A 4GGGA 1T95A 1JTYA 4MEXF 1YX3A 2YX7A 1S9HA 1K6YA 1JHHA 1R1VA 3J7ZI 4G8XA 3FXRA 1DU6A 2KRCA 2E34A 1R4MB 4E7LA 1TT5B 3DBLB 2AS5F 3MAJA 4XK4A 3CUQA 3OYLA 1BC7C 1ZTRA 2DODA 3GTOJ 3TOBA 1IXCA 3Q0UA 1SAUA 2OQRA 5IY5H 1VQOI 3PUBA 1J59A 2LBFA 1D0XA 2DO7A 2V7FA 4GYGA 2WC2A 2Y31A 1QBJA 3E0JB 4E7ZA 2OAZA 3MZ8A 1MDMB 1MW7A 1YS7A 4NQWB 4A6EA 1Z3XA 1VQ4I 4G7OF 4V2GA 4OIOF 1USSA 1Z05A 2V1DA 2HDDA 4M6YA 4C9YA 4ESBA 5J3LA 2E2JJ 5FKNA 1B9MA 1PP8F 2K85A 4DW6A 4LIVA 1LDJA 2O7OA 1X2MA 5LLQA 1E17A 3B6AA 2VB6A 4Z6YA 2L3DA 1TL8A 2O6GE 4RM3A 3KLOA 4G6DA 1FIPA 3QU6A 4FHTA 3ZQ7A 1UG0A 4A5MA 2IA1A 1I3AA 4FX0A 3L2UA 2R7VA 3Q0VA 3NARA 2MC3A 2UWMA 2AO9A 4J00A 1X3UA 3ECHA 4RAFA 3T1BA 2KPMA 3KIOA 4CHUA 3V7RA 2EPFA 1FMWA 2RNGA 2JJ7A 4WK8F 2LOOA 4V19K 4Y3OA 3HHHA 4A3DJ 2A61A 1HW5A 1AA7A 2GIVA 2VC0A 4HA8A 3CCEI 3RIRA 4CYCA 4DBRA 2XF6A 1OLTA 5IT3A 2CW0F 4IZZA 4MQ9F 4E70A 2PN6A 3BG5A 3IWFA 3L09A 3S2HJ 1MH4A 2DFEA 2VBXA 2VKEA 1KQ9A 2IRFG 2B0LA 4M72A 3CP2A 2PJRA 1ONVA 4BHBA 2JRMA 2KJCA 3SEQA 1FNNA 1OCCH 1QU3A 3BJ6A 2XB5A 4BHCA 4B43A 2OA4A 1BJAA 1R1TA 3E5XA 1Z77A 5B1BH 5K7ZA 1G3YA 2L4AA 2VLAA 1N78A 1RKWA 2ZSHB 1PDNC 3DTKA 4L9VA 3Q5FA 2BXZA 2TDXA 2XGDA 4ZDPA 3O6BB 3G4SI 1KU9A 3CUQC 3GZ5A 1J7KA 1GV2A 3DTIA 2VJ5A 3BR6A 3HJEA 1P92A 1ITYA 3HOXJ 3BTCA 2DFHA 2XPUA 3BR3A 3DPTA 2Z1DA 2ZXWH 4HLXA 4LK1F 3LAJA 3QU3A 3PO2J 4EM1A 4YRVA 4S05A 2PQ8A 4AWXB 2FMYA 2ADUA 5FGMA 5B3SH 4LB5A 2E7XA 2FBHA 1DGWY 1UB9A 2W4SA 1FSEA 2DU9A 1FYMA 1I1GA 4A3GJ 4XKWA 2DLLA 3WG7H 2NAZA 2HYFA 2V4JC 1YQAA 2L7FP 3S16J 3HG9A 4A3KJ 1XSXA 2EFQA 3JRHA 4BYYA 4A93J 4EGZA 1NTCA 2F4IA 2Y9YA 4MTEA 3BTIA 3HHGA 3WHCA 1UHMA 2DOAA 4OAZA 1LDKB 3OY9A 2KIFA 2ZJRF 1JKQC 1IDYA 1JKPC 2Y2ZA 1P7IA 2VONA 1ZLJA 1JXSA 3BJOA 4ITVA 4TV7A 4C3IJ 4XKCA 2DDAA 3IAM2 2ELKA 2E5ZA 2EH3A 2XHKA 3C18A 1OCZH 2YX4A 1KZHA 4DZJA 5E3NA 2VUMJ 1W4MA 3I4NJ 2JTVA 3LA2A 2M1BA 4WXDA 2MH9A 3LAPA 5JHUA 2K7LA 1XGSA 1G3TA 1VZ0A 3F8FA 4ZYHA 3BJAA 1YW8A 1SFEA 3GX4X 1SMTA 1DUXC 2ZCWA 4U7BA 1LVAA 1ZHFA 4XLHA 3GEZA 1RR8C 3BQYA 1TT0A 5HVQC 1GLNA 1ODDA 4HSRA 3BTJA 1SFUA 2HQNA 2I10A 1TNTA 2LRDA 2YPRA 3VFZA 2RREA 3ZOBA 1FZPB 4JP0A 4P55A 2LY9A 3F8MA 2BHYA 2I5UA 2ZO4A 5CVUA 2RKHA 1XGOA 1WSUA 4Y33A 4KMFA 1IXSB 1P2FA 2IVMA 1IN4A 4XNFA 3HL2A 3CMMA 4Y4RA 3SZGA 4A2UA 4EJTA 4ZYGA 5EEAA 1X3WB 1RR7A 3JRAA 5D4SA 1OYYA 2DK8A 2LP0A 3I0TA 3LA3A 3SEZA 1C0WA 2IS6A 3TO7A 4IO9F 1YRNB 4I02A 1A6QA 3BG9A 2HZTA 4LG0B 2MC4A 3ESWB 1FTTA 4KITB 2M45A 2HU9A 5H20A 1DQUA 2EZIA 4PFPA 2MG4A 1N75A 4QPOA 1LNWA 5FKKA 5D5UB 1S7OA 5D8LB 2RV8A 3HTUA 3I59A 2X48A 1TBXA 3HOYJ 1ERDA 2HEOA 3W2AA 5FRNA 2X6YA 5FD5A 4G6TB 4I99C 3IL2A 1J2XA 2L02A 3VODA 3S3OA 4N0BA 4S04A 3CJNA 3SFIA 3PFIA 4IRIA 1YG2A 2ZFWA 2LKPA 2ISYA 4XORA 1R5ID 3EUKL 4AIJA 3BZ6A 5C44J 1PYVA 5FO5A 1Y39A 1ZQ3P 1HKTA 1FEXA 3WTVC 4HNUA 1A04A 2K5CA 1AWCA 5E18F 1O4XA 4MO7A 3RKWA 2DW4A 2DA3A 1FBSA 4G7ZF 1SFOJ 2VODA 2TRTA 1VQNI 2PMUA 3ABUA 2F4MB 3BR5A 2EQRA 2KZGA 1FOWA 3M8EA 3QODA 3F6OA 3L2QA 2BY1A 4D5CA 2OPTA 3LSKA 2H8RA 3GFJA 3F8BA 4XONA 1D1BA 3CLOA 3CESA 1MMGA 3EDPA 5E1WA 3CMAI 2L2OA 1QPIA 2M2EA 2N8GA 3J7AO 2WWYA 4C2TA 2NYXA 1E2XA 2V6CA 1P4AA 2KP6A 3GMEA 3K1NA 5BS6A 1WJDA 3O2PE 1A36A 3CCUI 2KRHA 4IRGA 4BJTA 3CMEI 1RPWA 3PQKA 5E3LA 1EF4A 2ESNA 1JJ6C 1LEBA 2W85A 4F92B 1SD7A 2DMUA 1OYIA 2L7ZA 3MFKA 1O3TA 1IUYA 3EPZA 3S1RJ 2HVSA 2FNPA 5FRMA 4AYBA 2FQ4A 3LMMA 1I5ZA 1IAWA 2W7NA 1K4TA 5EG0B 3BG7A 1X1BA 1WJAA 3DPLC 2HNHA 4Q4ZF 5JI6A 2OU2A 3PNYA 2QVOA 4PZJA 2EFWA 1SAXA 1VQ8I 2K4JA 5IP7J 4IXAA 5ILUA 3H3ZA 4BDYA 3CQZJ 3CLQA 4L5EA 3OWTA 1Z6TA 3LSMA 4I09A 2FQ3A 4BEHB 4ZH4F 2V26A 1IRZA 3PUFA 3PIPF 2XC7A 2R7OA 1Y1VJ 3GO5A 3ZQGA 5E8GA 2M0MA 5DD8A 3QOEA 3QPSA 1GVJA 1WJFA 4RGUA 2LKXA 3S15J 3IC7A 1T56A 2K86A 2G7HA 4B09A 2JWTA 1WQ2A 4YIFA 3UNGC 1CF7B 2DA6A 1E3HA 4HF0A 1JUPA 1FBUA 3L00A 1JHFA 1W7PD 1HC8A 2LMDA 2JA7J 4GRIA 4RLFA 4BQOA 2ZB9A 2R0QC 1Y8RB 4Q47A 4XSZF 4XOPA 4DYRA 2XAJA 3IRRA 2VOPA 1FWZA 3S1MJ 2GOXB 2JT1A 1ZG3A 2O9LA 4L9JA 3SQNA 2QM3A 2MH2A 1T8IA 3GUDA 2E35A 4HDUA 2TCTA 2E71A 1BBYA 2AXLA 1DP3A 2IBDA 4XLCA 2OBPA 2DA2A 2JSPA 2KMUA 1AKHA 3HBLA 1EJ9A 3ELKA 4WXCA 1V3FA 3TL4X 2EIJH 2E2HJ 4ZDOA 3BWGA 3RYPA 3HGGA 4W97A 1Z91A 3RJPA 4G7HF 1QZZA 2XUBA 5ICCA 1K6OA 2XF5A 3RZDJ 3K4CA 4YFKF 4HYEA 1S72I 3K4JA 2CUFA 2GBYA 4OOIA 4XR6A 1DPRA 3QYFA 3CDHA 1KU7A 2DPUA 1IRXA 3VYSB 2Y0SN 1ZGWA 5BMZA 5B66C 3LNQA 2DA1A 2E2IJ 1SFXA 2K9QA 5L3EA 2NRAC 2L54A 1Q1HA 2VIXA 2E19A 3MMYB 3KLNA 1X4OA 5CYVA 3C3WA 3K1MA 1GV5A 1YFHA 2FBIA 3M4OJ 1ON2A 2BZTA 4YG2F 3WTTC 4PSWA 4LG3A 2GM4A 3WGIA 3CJRB 1K79A 1R6RA 4PJ0C 2YU9J 4ON0A 2RNJA 1YTYA 1WZ2A 2JMWA 2M9HA 2Y75A 4IHWA 3AG1H 3AKZA 1LVKA 4Y52J 5LHIA 4RDUA 2ME0A 1X1CA 2DAOA 3TMOA 3HSEA 4HBLA 1D8KA 4E7HA 4A0ZA 3S17J 4UB6C 3GTPJ 3HZJA 2XAHA 4XLAA 2R4GA 1U3EM 3K2AA 4CICA 3LSRA 3A4CA 2LLKA 2E1OA 3LFKA 3PFYA 4CCKA 3CDIA 5AIPA 3J80K 3P9CA 2LDUA 2KFDA 2OV7A 4QSHA 3BCAA 5E17F 2M34A 2KISA 1EKEA 4OWRB 3H0DA 3J80Z 3QPTA 1XGMA 3A01B 1MSFC 3CDLA 1XTAA 3I58A 3ZMVA 1H89C 1VQPI 2IGKA 2Q1ZB 2CRGA 5E8IA 3C2HA 4QLCU 1JGGA 1AU7A 4IOCF 2JN6A 3I4PA 1ZAOA 4BXXJ 1YO5C 3ZCOA 2CUZA 1ZG1A 1GVDA 2PLYA 1I6HJ 4E7KA 4C30A 1W5SA 2XGEA 2GXGA 4IEJA 1QRYA 2V6EA 2LY1A 1JKOC 4XL9A 2CG4A 3PL8A 1R58A 2ECBA 4LD5A 3KZZA 5H2FC 1BW5A 2WV1A 1SVLA 2A3SA 1HXDA 1G3SA 2HXOA 5TISC 5J8CA 1IF1A 1WJCA 4I7HA 4CCOA 3I4MJ 2BVMA 1S7EA 2JK3A 2WADA 2PMZN 5GAEJ 4BJ6C 4QTRA 1N77A 1FIAA 4A12A 2ZC2A 2EWNA 1UAAA 1G3WA 2RN7A 4XLFA 3FK6A 5BOXA 5D6EA 1GXPA 2Y9ZA 3FBIB 4ZTFA 2HR3A 2K9MA 1EH7A 2D45A 3GWZA 3KX2A 3TEDA 2V79A 3WTYC 3ZQLA 2E5NA 3ZQIA 1BOBA 1HLVA 2CV0A 4FQGA 5LGUA 5ICGA 1J75A 3KZIC 3K7AJ 1KGSA 5F08A 3WG9A 4U0WA 3CUQB 4PGHA 3X2QH 3CCJI 4XLNF 2EV6A 2BW3A 1TWGJ 2WY7Q 2DTRA 3VYTB 2K27A 1HKSA 1BR2A 1LB2A 4HW0A 1EA3A 2COBA 4ZC3A 2W82A 4KT6A 1HBXG 1RI7A 2VASA 2LK2A 3Q3SA 1LFPA 1W7PA 2KQRA 3OYMA 4LFUA 3AG2H 4EJVA 2HDCA 3CJQB 1IGNA 3FF5A 2XF7A 4A6DA 4DYQA 1QO0D 3FKIJ 3A01A 1ETWA 4KFCA 2LREA 1R22A 3IAS2 5KK1A 1JI8A 3S2DJ 4F52A 1LQ1A 1YI2I 3GXOA 5FKOA 2R7TA 4EMSA 2Y30A 5E1XA 3DWLE 3KCCA 2DJIA 4ZZLA 3JSPA 2EV0A 1F36A 1IXRC 1MJBA 2IEKA 1I27A 4OINF 2CH0A
chains in the Genus database with same CATH topology
2VJ5A 2VPLA 3TBIA 3DPTA 2Z1DA 2HZDA 3K70C 4YRVA 3ZQQA 3DEEA 3QYBA 4PUSA 1MMNA 3HC7A 2OC6A 4II3A 3M1CA 1DGWY 2BW3B 3DU5A 4DJAA 2W4SA 3H9GA 2WBMA 4ZYAA 4XKWA 5KNLA 4XN0A 2V4JC 5HNHA 3HG9A 3BCBA 3K70D 4PSXA 4RLQA 4YEJA 2F4IA 2KZVA 4U87A 2K9LA 3K4KA 2DOAA 4OAZA 1LDKB 3OY9A 4KISA 2L5QA 4B47A 2X1DA 3BC8A 2ZFUA 5CKTA 4XKVA 3OIPA 4IQJA 3OOUA 4ITVA 5HLTA 3W3CA 4XKCA 2IGMA 2VQCA 3K4NA 3OIQA 2M4KA 2CV2A 3IAM2 2E5ZA 1E0EA 3ZGKA 5KCMA 1WJBA 3OYJA 4PJMA 1X4PA 2MABA 1VZ0A 4LIUA 2VJJA 2HQAA 4XQFA 2FUG2 3BG6A 3S93A 4U7BA 4XLHA 1TT0A 3LSIA 1TZLA 2MD0A 1GLNA 2L9SA 3VYRB 5HVQC 2IS2A 4HSRA 1P9QC 2VJ4A 2AQFA 2O5RA 2LRDA 2Z2SB 2RREA 1HA8A 4ZTJA 1SFKA 2Y0SA 2DXIA 4IKFA 2BVLA 2M7AA 1W36D 1Z7LA 3OYBA 2IXSA 4Y33A 3EUAA 4XNFA 3HL2A 2I8DA 5CPRB 3CMMA 4Y4RA 3SZGA 3VYUB 4BE1A 4CCMA 1OR7C 3OYIA 4XLEA 2QKLB 4BE0A 5HNFA 2IS6A 3SEZA 4JOMA 2MC4A 4IX7A 3H5RA 4KITB 2HU9A 3OYKA 1DQUA 4PFPA 1UELB 1N75A 4QPOA 2Q2EB 4HG2A 3ZR8X 3DKYA 4N4NB 3VSLA 1ERDA 3W2AA 5FRNA 2X6YA 3MKWB 4G6TB 4F91B 2V9KA 3J7AY 1T0FC 4BE2A 2LYCA 3S3OA 2VKHA 3HUGB 3I3LA 3OYNA 2DCEA 4XORA 2WAEA 3BLYA 3EUKL 1MMAA 3A2KA 1PYVA 3H9QA 2CS3A 3DKXA 4HNUA 2K5CA 4X0GA 3HOSA 3HOTA 3H5NA 3VSKA 1J09A 3S32A 4BQNA 2WA0A 1MMDA 3C2GA 2R7QA 3DTEA 4FETA 4F93B 2CW7A 2DT6A 2LC2A 4BEHA 1NG7A 4RMNA 4XN3A 4CZCA 3QODA 3L2QA 2JUGA 3LSKA 3D5SC 4XONA 1D1BA 1KONA 2F5VA 1MMGA 2HVQA 3CESA 3I9V2 2L2OA 3DLAA 1PJRA 2JA2A 4C2TA 2DT7B 2KP6A 3S3MA 1WJDA 3L2WA 2VL8A 3OR1C 2KRHA 4BJTA 3OYEA 2X85A 4DIQA 4BL0B 3HPHA 4AVZA 4J01A 4NC8A 4F92B 4AU7A 2F6CA 3EPZA 2L7KA 4PJNA 2CMPA 2HVSA 2MFZA 5FRMA 2VJIA 4AYBA 3HXLA 3LMMA 3DQVC 2W7NA 2WAQA 4II2A 4DGWB 3BG7A 3D5RC 2X51A 4BGDA 1X1BA 1WJAA 3DPLC 2HNHA 3LSGA 4CA0A 2E1MB 1U0JA 3PNYA 4LITA 3CZ6A 2AQEA 4BDYA 2VXZA 4PJJA 3FDYA 3MKYB 3OWTA 4E7SA 3LSMA 4P5OA 1LKXA 4BEHB 2ZSIB 3H5AA 2V26A 4BXFA 3FKJA 2IS1A 2XC7A 2R7OA 3K4LA 2WY8Q 3PNVA 1QHGA 1X1DA 2M0MA 3KEYA 4KJZA 3UR3C 2HPMA 4XKBA 3QOEA 4HNTA 2IS4A 3N05A 1WJFA 3KYLA 4BJ5C 4XOTA 3QYEA 2W00A 2HPIA 3E1SA 2X1CA 4NNJA 3OYGA 3UNGC 2KDOA 5LFAA 3RSNA 2M3AA 3ZRGA 4IQ4A 3A1YA 4CSWA 4GRIA 4RLFA 4BQOA 4CCLA 1WJEA 3S3NA 5CQEA 2UV1A 4DOZA 4JQFA 4XOPA 4NUBA 2M7BA 3NWSA 4E4HA 2KLOA 2UUZA 5JHFA 2GOXB 4MLOA 3D5LA 2R7UA 4FASD 2LG4A 4ANJA 4CH7A 2VXDA 1DP3A 4CCJA 4XLCA 3V42A 2JSPA 4R79A 2P0WA 2KMUA 3OMYA 3CP8A 2VQLA 3TL4X 3W2VA 3PSFA 4ZDOA 3MD2A 3OS2A 3K4MA 2X6WA 2XF5A 4HRIA 3K4CA 3HKZA 4CUGA 4H4KC 3K4JA 2KHMA 3F9KA 3OYCA 2R7RA 1BR1A 4XR6A 3RTRA 3QYFA 1X19A 2LBFB 1NG6A 3PJRA 3VDXA 1IRXA 2W1OA 2VQGA 3VYSB 2ELJA 4BDZA 3OYAA 3SYTA 2IGOA 1WJ5A 1G8XA 1Z21A 2VIXA 3ONQA 4B3XA 3MMYB 4DBQA 2X6XA 1BR4A 4E6KG 1X4OA 2GOMA 3OL3A 4ZJZA 3LSHA 1DGRM 1D0ZA 2JVGA 4HPQA 3GBGA 2WB1A 4PSWA 4E7IA 4LG3A 1YX5A 4PFOA 4BU2A 1D1CA 3CJRB 1R6RA 4C2UA 3LFUA 1D1AA 1QHHD 4NC7A 3H35A 3OS0A 3FHNA 4PJLA 1FMVA 3AKZA 3G2BA 1LVKA 4ZDLA 1G59A 1X1CA 3TMOA 1Y56A 3SDBA 4BQQA 2MYSA 2IGNA 4E7HA 3IP4B 3PNTA 1MNDA 3OYDA 4XLAA 2R4GA 2ZXIA 2LY2A 3A4CA 3K10A 2X1EA 3OS1A 2PMZA 3PFYA 4HEA2 4CCKA 4OAYA 2PJRB 3AL0B 1V5FA 3DU6A 4QPQA 2OV7A 2VKDA 3BCAA 2XAUA 3ZXSA 4B48A 4XM3A 1V5GA 2CW8A 4OWRB 4F55A 3H0DA 2QKMB 1T95A 3U21A 1YX3A 1D0YA 1S9HA 1K6YA 2IGKA 2Q1ZB 4D1QA 2KRCA 3C2HA 2E60A 4PK4A 4E7LA 3CF2A 3OL4A 3OYLA 3S8PA 2CUZA 3W2WA 3ZCOA 1SAUA 3RQ4A 4E7KA 3NWTA 4C30A 3PUBA 2LBFA 5CQGA 1D0XA 2V7FA 2XSJC 3HPGA 4BACA 3DPUA 2ZXHA 3OYHA 2L9NA 3L2RA 3E0JB 2V6EA 2LY1A 4E7ZA 4P1WA 4XL9A 3PL8A 4B44A 5HOOA 1MW7A 2A6TA 4NQWB 5FROA 1Z3XA 3VWBA 2E1MC 2HVRA 1Y6IA 4C9YA 3H9JA 3AL0C 4EATA 2R7XA 1W36C 2JVHA 4LIVA 4E7JA 2XDVA 1WJCA 4CCOA 3OR2C 2NOJB 2BVMA 2VB6A 2WADA 4BJ6C 2VQHA 3OYFA 1N77A 4RM3A 4HSTA 1UAAA 3PSIA 2CFOA 4XLFA 1V5EA 4CCNA 3LL7A 3EUHC 1UG0A 3FBIB 3K4BA 3IUOA 3L2VA 4ZTFA 3L2UA 2R7VA 4XMYA 2K9MA 4D9JA 2KL4A 3KX2A 2R7WA 2UWMA 2E5NA 3RPUD 2K3PA 2V1NA 4J00A 2KPMA 4YELA 2A5WA 1BOBA 2CV1A 4RM2A 1FMWA 2RNGA 2LOOA 2CV0A 4Y3OA 2WAFA 3MKZA 1AA7A 1YE9A 2M4GA 3M8JA 3K6GA 2R7SA 4DBRA 2XF6A 1OLTA 2BW3A 4IZZA 2WY7Q 3VYTB 1BR2A 4N4OB 3AFHA 5TGTA 2OUMA 1EA3A 4ZC3A 2W82A 4KT6A 2VASA 5KHDA 1LFPA 1Z3YA 4BUPA 3CP2A 2HDWA 2RQQA 2KQRA 3OYMA 2PJRA 2LH9A 3RCOA 5LD2C 2BOLA 3SEQA 3CJQB 1ZELA 1QU3A 4B43A 2CUJA 2XF7A 2Z16A 1MNEA 4F3QA 2LREA 3IAS2 1JI8A 1X1AA 4F52A 1N78A 2VLAA 2R7TA 2ZSHB 3DTKA 3DWLE 4ZDPA 1WFXA 2DJIA 3FBNB 4BS9A 3DTIA 2CH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC4 A;  4OAZ A;  5KHD A;  4OAY A; 
#chains in the Genus database with same CATH topology
 1QZY A;  3PIO F;  5F6F A;  3ZQF A;  2QYO A;  4XRS A;  1ZLK A;  3WTU C;  3I55 I;  2HZD A;  1A35 A;  2OTJ I;  2E1C A;  3HKZ N;  1FLI A;  2EIM H;  3DEE A;  4XLP F;  2CQ7 A;  3QYB A;  4PUS A;  5DDG A;  3VPR A;  5L3B A;  4II3 A;  4CYC B;  4GFB A;  3FXK A;  2R92 J;  3H9G A;  1TW2 A;  3EYY A;  4RAG A;  1Z6R A;  2QZ8 A;  2RVC A;  2ICW G;  2DQR A;  3BOQ A;  3K70 D;  1ETK A;  2B7E A;  2R93 J;  1XG1 A;  1S3J A;  2GWR A;  4YEJ A;  3U9G A;  5KAF C;  2K9L A;  3K4K A;  4KA4 A;  2IT0 A;  4KIS A;  2ETH A;  5EZG A;  2L5Q A;  5D4R A;  2D5V A;  5M3M J;  2VT2 A;  3BC8 A;  2D2W A;  1XMK A;  2WB1 N;  4XKV A;  4IQJ A;  5K1Y A;  3OOU A;  5C4J J;  3E5Q A;  3HRM A;  5HLH A;  2M4K A;  1XCV A;  2VPR A;  2NVY J;  3JRC A;  3JTG A;  2OTL I;  4GDF A;  3ZGK A;  3H3V K;  2ZJQ F;  3WHB A;  4RGR A;  3OYJ A;  1H0M A;  1BJZ A;  3M1E A;  4OIR F;  3TGN A;  5DM6 F;  5HOD A;  3BR1 A;  3WOD F;  2VJJ A;  3FXO A;  2KJB A;  3ZQH A;  2XSD C;  3BG6 A;  4BAY A;  2LR8 A;  1IV6 A;  3GTM J;  4LLL A;  3HUG A;  3LSI A;  3WGH A;  1TZL A;  3V4G A;  3VYR B;  2L9S A;  5F04 A;  1IC8 A;  2RQP A;  2Z9O A;  1MIJ A;  3E97 A;  2Z33 A;  2G9W A;  3MVP A;  1VTN C;  2XKP A;  3U1K A;  1SFK A;  4IKF A;  2OCC H;  2GXA A;  1XGN A;  5FLV A;  3EUA A;  1VQ5 I;  5E3M A;  2I8D A;  3P7N A;  5L3F A;  2A68 F;  3VYU B;  2ISZ A;  4BE1 A;  4CCM A;  3VEP A;  4DQ2 A;  4XLE A;  2BE5 F;  2PEX A;  5HLG A;  1TWC J;  1RIO H;  1IG7 A;  3OOP A;  5CVJ A;  1IN8 A;  5HS7 A;  3WTS C;  4A3F J;  4CZZ A;  3CCM I;  1D5Y A;  3OYK A;  4KN7 X;  4B1R A;  3F8C A;  2R5Y A;  3QWL A;  2Q2E B;  2R7F A;  2M87 A;  3DKY A;  4N4N B;  4A3I J;  1U78 A;  4L9T A;  2NNY A;  4I2O A;  5M5W J;  3R60 A;  2VE8 A;  3MKW B;  2OJE D;  3J7A Y;  2CO5 A;  2LYC A;  3FXJ A;  4RA2 A;  5D5V B;  3GYH X;  2XVC A;  4FT8 A;  3VB2 A;  3OYN A;  1LE8 A;  3WGG A;  1ORK A;  1MMA A;  5LEK A;  3GTG J;  3HIF A;  3HDD A;  3G1L A;  5IP9 J;  2MD5 A;  3VOE A;  3NRV A;  5B1A H;  2YR2 A;  1G6N A;  4HQE A;  4BKX A;  1P4W A;  3FWE A;  3VSK A;  1J09 A;  3MCZ A;  4BQN A;  1MNM C;  1LDD A;  2WA0 A;  3C2G A;  4B8X A;  4F7Z A;  1MSE C;  3BTL A;  4F93 B;  1JE8 A;  4AC0 A;  3WU0 A;  1NG7 A;  4GYI A;  4ENM A;  1OCR H;  1FOK A;  5DS9 A;  1MH3 A;  4IHY A;  5F64 A;  1H88 C;  3N4M A;  2HS5 A;  3TW6 A;  5E3O A;  1Z0X A;  2HVQ A;  3I9V 2;  1J9I A;  3UKG A;  3DLA A;  1PJR A;  3H36 A;  2JA5 J;  4UVC A;  3HTS B;  5GAG J;  3L2W A;  3OR1 C;  3I59 B;  3S2W A;  2VE9 A;  5J40 A;  2H8W A;  4J01 A;  2FD5 A;  2ZNZ A;  2PJP A;  4EEF G;  3DEU A;  4UUS A;  2F6C A;  4X1E A;  2L7K A;  1RRJ A;  4LLN A;  1X58 A;  2BGC A;  3CTA A;  4CYD A;  1Z67 A;  4II2 A;  4MQV A;  2DN0 A;  4DGW B;  3KP5 A;  1W5T A;  5LBQ A;  4ESJ A;  3LSG A;  4CA0 A;  3Q9V A;  3CZ6 A;  2ZJ2 A;  4YII A;  4ZYE A;  1ZR4 A;  3IKT A;  2XB0 X;  5K7H A;  3DLL F;  3FDY A;  5JLX A;  4E7S A;  2MLG A;  3TP0 A;  2Q2E A;  1LKX A;  4RB2 C;  3QOP A;  3H5A A;  4M6X A;  3B73 A;  2WY8 Q;  1QHG A;  4KJZ A;  4A3C J;  2HPM A;  2FJ1 A;  1U2W A;  2FE3 A;  4BJ5 C;  5D5W B;  2W00 A;  1X2N A;  1HCR A;  1GDT A;  1GHC A;  1VF9 A;  3QPH A;  3G3Z A;  4UVB A;  4UB8 C;  5LFA A;  3ZRG A;  5DV5 A;  4M3E A;  1IJW C;  1LPQ A;  1XN7 A;  1U9O A;  4IQ4 A;  2EBI A;  3IH2 A;  3LST A;  4HOB A;  1WJE A;  2CQQ A;  5CQE A;  2QBY B;  1TNS A;  1P7J A;  3P9I A;  4OMZ A;  1IN6 A;  2XAS A;  2PBI A;  3CC2 I;  2M7B A;  3BR0 A;  1B4A A;  3S14 J;  3M3Y J;  3HSF A;  1ETQ A;  3D5L A;  2R7U A;  4FAS D;  1YJN I;  4ANJ A;  3HB9 A;  1EV7 A;  4PDK A;  4CCJ A;  2B9S A;  3V42 A;  1T39 A;  2H27 A;  1OIS A;  3GCM A;  4J19 A;  3CP8 A;  2VQL A;  4EM0 B;  2GLO A;  2DYS H;  4EGY A;  3EYI A;  1BC8 C;  3OS2 A;  3K4M A;  1U5T A;  2MGQ A;  1WKM A;  1R7J A;  2K4B A;  2MBF A;  4HRI A;  5H6R A;  2MLK A;  2H1K A;  1PUF A;  3K0L A;  2DT5 A;  2Y48 A;  2KHM A;  2W84 A;  3F9K A;  5HDG A;  3TKY A;  4I6Z A;  5EYR A;  5E79 C;  1X19 A;  1ZRE A;  2EA2 A;  3L2C A;  2HQR A;  1OCO H;  2ELJ A;  3OYA A;  1FC3 A;  4X6A J;  1F4K A;  3SYT A;  4HX7 A;  4AD9 A;  1FSH A;  2XV4 S;  1LFB A;  2W25 A;  1B72 A;  2DMP A;  2O8K A;  1BR4 A;  4AM3 A;  2IP2 A;  2QQ9 A;  2XGC A;  4LK0 F;  1YLF A;  4ZJZ A;  2L9V A;  1R36 A;  3BP8 A;  3LSH A;  5GPA A;  2JVG A;  4W1U A;  1BIA A;  1OKR A;  1KQ8 A;  4HPQ A;  1FTZ A;  3EUH A;  1EH6 A;  5D6F A;  5B5E C;  1BOA A;  4YFN F;  2ZME B;  1D1A A;  2IAI A;  3GFL A;  4C2M J;  4H0E A;  2OZU A;  4NC7 A;  5HDK A;  1TQI A;  1IZ1 A;  1QVT A;  1ZGJ A;  3NEU A;  3OS0 A;  1AKH B;  1N25 A;  1XX5 A;  4BNC A;  1FMV A;  1Z7U A;  2LF8 A;  1O7F A;  2COM A;  1XC5 A;  2CYY A;  2RAE A;  1G2H A;  2RDP A;  4MFE A;  2QBY A;  2MYS A;  4EJW A;  3RKQ A;  3IP4 B;  1RC9 A;  5HS9 A;  5EGO A;  1JUS A;  2CJJ A;  2F5F A;  5BQT A;  1R5H A;  1XDU A;  5IYC J;  3B6C A;  3BPX A;  4FE4 A;  1SD4 A;  1SVO A;  4B3A A;  4DNC A;  2X1E A;  3M8F A;  1BI1 A;  2CFX A;  3LOC A;  5LHH A;  5KAI C;  1ETY A;  3DXJ F;  3DU6 A;  2DA5 A;  4V2F A;  4QPQ A;  2VKD A;  2XAU A;  4XM3 A;  1FYK A;  3JRF A;  3FMQ A;  2YUS A;  2QKM B;  2PFB A;  5LRR A;  5J8F A;  4S0H B;  4RBO A;  1D5V A;  1MBH A;  1D0Y A;  1PVE A;  3MZY A;  4UUT A;  1MMS A;  1U5T C;  1W5C C;  4PK4 A;  2QSH X;  3P9K A;  1QNT A;  2L01 A;  3OL4 A;  5DCM A;  2VN2 A;  3HSR A;  3T0Y A;  3TO6 A;  1MBE A;  3A02 A;  1FJL A;  2MA3 A;  3S8P A;  2M5W A;  3W2W A;  3GTQ J;  3RQ4 A;  4UXN A;  5CQG A;  5DTD A;  1H9T A;  2OF7 A;  2DA4 A;  4BAC A;  3OYH A;  3FHZ A;  2L9N A;  1K61 A;  4P1W A;  2KDZ A;  1ACI A;  5HOO A;  4JK1 X;  2R3S A;  2EFN A;  1U8B A;  2E1N A;  5FRO A;  1T2K A;  4I98 B;  1R49 A;  3K9T A;  5IOY A;  2HVR A;  2VBW A;  3KP7 A;  3H9J A;  4P96 A;  3TO9 A;  3AL0 C;  2R7X A;  2JVH A;  3HRT A;  4LB6 B;  5FFX A;  5KVR A;  4E7J A;  2WAQ N;  2XDV A;  5C3E J;  1CGP A;  1VQ6 I;  4IHS A;  4AIH A;  2ESH A;  2CFO A;  3ZMZ A;  3WTZ A;  1FP2 A;  3V8J A;  2ZME A;  4UV9 A;  1FPQ A;  3EUH C;  3QP5 A;  3IUO A;  5H6Q A;  5F1R A;  2XRN A;  1AHD P;  3E6M A;  4XMY A;  5J4Y A;  4D9J A;  3JCU C;  3F23 A;  4O6J A;  4ZYD A;  2V1N A;  2K3F A;  2E7W A;  2A5W A;  3OSG A;  4ENJ A;  2CV1 A;  2H6C A;  4HNV A;  1XB4 A;  1RUO A;  2WAF A;  1LUJ B;  5IT9 K;  1YIO A;  4K2E A;  1YE9 A;  3IHU A;  3M8J A;  1FBQ A;  1MKM A;  3BQZ A;  3K6G A;  2R7S A;  3K2Z A;  2UZK A;  1BW6 A;  5IT9 Z;  2V9V A;  1VQL I;  1WI9 A;  2FNA A;  4YIR X;  1K83 J;  4RGX A;  5M5Y J;  2HKX A;  1B6A A;  5TGT A;  3H3U A;  2D1H A;  2MSY A;  3ZN0 A;  3PO3 J;  3DF8 A;  2HI3 A;  1Z3Y A;  4BUP A;  3GFI A;  3CC4 I;  4KIC A;  2RQQ A;  3HGY A;  1UHW A;  2LH9 A;  3RCO A;  2LSO A;  1ZEL A;  3GZN B;  5L3C A;  2CUJ A;  4ENK A;  3AAF A;  1MNE A;  1MBK A;  2X6O A;  3HRU A;  4AVP A;  2GIZ A;  5IOZ A;  2VBZ A;  2VT3 A;  1QA6 A;  3TW7 A;  5IPA A;  2VOO A;  3DV8 A;  2STW A;  3FIS A;  1HST A;  4FE7 A;  4BS9 A;  2NVX J;  2CGP A;  1K4S A;  2XIG A;  2VPL A;  3FXQ A;  2NS7 A;  4OMY A;  1DDN A;  1YIT I;  3TBI A;  3FM5 A;  3HOV J;  3CCQ I;  2GXB A;  1T08 B;  3ZQQ A;  1V55 H;  1HQC A;  2M30 A;  1L0O C;  2LKS A;  4D0P A;  1MMN A;  3HC7 A;  2OC6 A;  2HKO A;  5IYB J;  3M1C A;  3I54 A;  3C1D A;  2BW3 B;  3DU5 A;  4M3D A;  4A0X A;  3I71 A;  3ZN1 A;  4A3E J;  2DTZ A;  4ZYA A;  4BHP A;  2P6T A;  3TDZ C;  5D5X B;  1S7A A;  4DZP A;  3CCS I;  3S1Q J;  4XN0 A;  3KPH A;  2HQ5 A;  5HNH A;  2EJR A;  2YU3 A;  5GTH C;  4U88 A;  1W7P B;  2HXI A;  1V4R A;  4R1H A;  1T0F A;  3OV8 A;  4RLQ A;  2KZV A;  2ZME C;  3MEX A;  3DBH B;  4WX9 A;  2M0C A;  5BPD A;  1Y0N A;  3N97 A;  4HX4 A;  4B47 A;  2X1D A;  2EZL A;  1FOY A;  5FD6 A;  5LEJ A;  5CKT A;  3ZQC A;  4MHG A;  3OIP A;  2OD5 A;  1ZAR A;  2DMN A;  5HLT A;  4OIQ F;  2QQB A;  5FFZ A;  3IH4 A;  3K4N A;  2DFI A;  3OIQ A;  1E0E A;  1HOM A;  4BY1 J;  1SD6 A;  1IRG A;  2H6B A;  2HFH A;  4NBQ A;  1DPU A;  3FXM A;  1B1B A;  2ZXJ A;  4PJM A;  1R00 A;  4GCV A;  4BXU A;  2LD5 A;  1JGS A;  1T6S A;  2MAB A;  4KMU X;  3CCV I;  4NHJ A;  3QP6 A;  5LHG A;  2EIL H;  2HQA A;  5AIQ A;  2JSC A;  3PQJ A;  2ZNY A;  1ZG5 A;  2FUG 2;  3S93 A;  5DD4 A;  4XIC A;  2P5V A;  3JTH A;  2IS2 A;  1B59 A;  1O3Q A;  2G7U A;  4D5F A;  2VJ4 A;  5GAH J;  2QSF X;  1BN5 A;  3T5X A;  4L5J A;  3LQR A;  1KYW A;  1HA8 A;  1U8R A;  2ELH A;  2V9P A;  2LTP A;  2Y0S A;  2DXI A;  1TC3 C;  2XPW A;  1W36 D;  1Z7L A;  4M9X A;  5EJC A;  3OYB A;  2H1L A;  4Q48 A;  2O03 A;  2DYR H;  4MFD A;  5CPR B;  1BI3 A;  2R5Z A;  3U2R A;  1RKT A;  2BYV E;  2UXN A;  3OYI A;  2QKL B;  2M8E A;  4BE0 A;  4OIP F;  4I01 A;  5CVV A;  4XRF A;  3ERE D;  3K1P A;  3BRO A;  5M5X J;  3HOZ J;  3P5J A;  2KIU A;  5E1Z B;  1O3S A;  1L3L A;  1H8A C;  1OFC X;  4HF1 A;  4EM2 A;  2CQK A;  4AID A;  1R23 A;  1UEL B;  3HEF A;  5E20 A;  1TP4 A;  3VSL A;  4UHT A;  2J5O A;  5GAD J;  1JT6 A;  2F5D A;  2V9K A;  1T0F C;  1Z1D A;  1ZH5 A;  2VKH A;  2NVT J;  1SMY F;  3HUG B;  3I3L A;  3M7G A;  3NQO A;  1YW9 A;  2NVQ J;  2WAE A;  1NK2 P;  3HM5 A;  1ETX A;  1RZ4 A;  3CCL I;  3H9Q A;  3AG3 H;  3ZMT A;  2AHQ A;  3DKX A;  4WWC A;  4M74 A;  1SC7 A;  4KUM A;  3H5N A;  1YJW I;  1OYW A;  3S32 A;  2X0L A;  3L1P A;  1F43 A;  3QPL A;  1MMD A;  1YS6 A;  3TP3 A;  1ZRD A;  2R7Q A;  4A3J J;  3BT9 A;  3ABT A;  6PAX A;  4G9Y A;  4MEY F;  5JFR A;  4UVA A;  4WF2 A;  3BDD A;  1WPK A;  2QF7 A;  4LOC A;  1ON1 A;  1VQK I;  2EFP A;  3CF5 F;  4M6V A;  4P9F A;  2A6E F;  3PM1 A;  3FMS A;  3V8L A;  3RPQ A;  2QQA A;  5JR3 A;  3JAM Z;  4UUV A;  2ID3 A;  3HYI A;  5FJ8 J;  1NH3 A;  5CJ9 A;  2R5Y B;  1X1P A;  1OCP A;  2VL8 A;  3DP7 A;  3HPH A;  5J1U A;  4EVI A;  4EJO A;  4AVZ A;  4NC8 A;  3GW2 A;  3F0C A;  4AU7 A;  4WCG A;  3KEO A;  5F0C A;  3ULQ B;  4PGG A;  3KEQ A;  2EZH A;  1VFC A;  1LE8 B;  1UFM A;  3SXY A;  1V54 H;  2GZW A;  2CMP A;  2LVS A;  4IRH A;  1I6X A;  4U0V A;  1J5Y A;  4IOA F;  1YIJ I;  1BI2 A;  1T98 A;  3HXL A;  2L7M P;  4D7N A;  4A3B J;  3D5R C;  2X51 A;  1XD7 A;  2KIM A;  3SZT A;  4BGD A;  2E1M B;  1U0J A;  4LIT A;  3ISP A;  1NK3 P;  1XSD A;  2JZY A;  2AQE A;  4AUX A;  3GTL J;  4N9I A;  4PJJ A;  3WE3 A;  2NS0 A;  4EQQ A;  3J81 K;  4LLG F;  4P5O A;  1O57 A;  2ZSI B;  1WH5 A;  2IS1 A;  3FKJ A;  2CQN A;  1S5L C;  4L9N A;  3J81 Z;  1X1D A;  3KEY A;  3UR3 C;  2DI3 A;  1OJL A;  4XKB A;  2BY0 A;  2R7Z J;  1ZR2 A;  1SVM A;  1YOV B;  4R8H A;  3KYL A;  4XOT A;  3QYE A;  4O3M A;  1FOX A;  1HW2 A;  2HPI A;  2VKV A;  2F4O B;  3E1S A;  2DDB A;  1O7L A;  2X1C A;  4NNJ A;  2KDO A;  1TQP A;  2M3A A;  3F3X A;  1FY7 A;  1RES A;  2DJN A;  4RGS A;  3A1Y A;  3FK7 A;  3CCY A;  4UV8 A;  4Y15 A;  4CSW A;  2KT0 A;  3CUO A;  4UUS B;  4XSX F;  3S3N A;  4PCQ A;  4DOZ A;  4JQF A;  2F48 A;  4NUB A;  4E4H A;  2KLO A;  2UUZ A;  2P81 A;  2FOW A;  3SZP A;  1K78 A;  2FEZ A;  4Z2Y A;  1G4D A;  2F2E A;  2JRT A;  3QRF F;  4CH7 A;  1ZGA A;  4BBS J;  3SHF A;  2A69 F;  1S6L A;  2IPQ X;  2DA7 A;  2P0W A;  1IUF A;  3GFM A;  2IW5 A;  4ENN A;  2C6Y A;  3W2V A;  2EK5 A;  2DFF A;  1CQT A;  3MD2 A;  1B8I A;  1SAN A;  1JJ8 C;  1QZE A;  4HV6 A;  2FA5 A;  1EH8 A;  2QEX I;  1MGT A;  3RYR A;  5HDN A;  4KT5 C;  2BV6 A;  3HKZ A;  4CUG A;  2Q0O A;  4H4K C;  3J7Y J;  1SEU A;  1A5J A;  3OYC A;  3DKW A;  4RAY A;  1BR1 A;  3G6E I;  1R1U A;  1TWF J;  2CQX A;  5EDN A;  2QGU A;  2YSR A;  2RGV A;  2DMT A;  3PJR A;  3VDX A;  1UG2 A;  2W1O A;  9ANT A;  5GTI C;  2HOE A;  3ROU A;  2EV5 A;  3SDG A;  1WHU A;  5K5Q A;  4BDZ A;  1R5G A;  4XRM A;  3SJM A;  3GF2 A;  3HRS A;  2IGO A;  4QIW N;  1WJ5 A;  4ZZD A;  5GPC A;  1Z21 A;  5C4X J;  4MIM A;  2O61 A;  2W48 A;  2HYJ A;  1WVR A;  5DUK A;  4EV0 A;  2LNB A;  2X6X A;  4E6K G;  4FTH A;  3KYC B;  1KQ0 A;  3E6C C;  1R4N B;  4M73 A;  4CO8 A;  3RQI A;  4L5I A;  1QGP A;  4I76 A;  2JPC A;  2BY3 A;  2WB1 A;  5LGN A;  4PFO A;  1KA8 A;  4WXH A;  2QSG X;  2XAF A;  4C2U A;  3OIO A;  2P5L C;  4XID A;  3H35 A;  3FHN A;  1HDD C;  4PJL A;  2ME6 A;  1WH7 A;  2P5K A;  2D1V A;  5EEG A;  3F6V A;  1JKR C;  2XKO A;  1U5T B;  1G59 A;  1MDM A;  4NQW A;  3D0S A;  3RKY A;  3OSF A;  1T33 A;  5ICF A;  1TTY A;  3SDB A;  4BQQ A;  2QA4 I;  2DBB A;  2GQQ A;  4HZF A;  4G6Q A;  3W6J B;  1PUF B;  3PNT A;  1WRJ A;  3LA7 A;  1MND A;  3OYD A;  2ZXI A;  2BBY A;  4UY8 I;  1GXQ A;  2LY2 A;  3ASN H;  3OS1 A;  1ZYR F;  4RB0 A;  3REO A;  1BIB A;  3FIW A;  4HEA 2;  2Z99 A;  4OAY A;  3AL0 B;  1V5F A;  4HAM A;  3S1N J;  1F5T A;  2Q8K A;  1ULY A;  3LQQ A;  1B72 B;  3O8H A;  3ZXS A;  4B48 A;  1DP7 P;  1QQI A;  1V5G A;  2CW8 A;  4F55 A;  1MBG A;  1FX7 A;  1Y0U A;  1HDP A;  2AXT C;  3L7W A;  4ASN A;  1E3O C;  5DCF A;  1W0T A;  2NNN A;  3U21 A;  1VI0 A;  2E36 A;  3CD6 I;  4G12 A;  3H0G J;  1XMA A;  5F0F A;  4D1Q A;  3FXL A;  2E60 A;  5EEH A;  4C3J J;  3CF2 A;  4OU0 A;  4ETS A;  3GLL A;  5IP6 A;  1Y8Q B;  2CSO A;  2W57 A;  4L18 B;  2BXY A;  3NWT A;  3WE2 A;  1BI0 A;  2XSJ C;  3HPG A;  1I39 A;  3DPU A;  2ZXH A;  3L2R A;  1MJA A;  4CGZ A;  4LMY A;  2IJL A;  4B44 A;  1Z9C A;  2EZK A;  2A6T A;  4D7M A;  3VWB A;  2E1M C;  1Y6I A;  4A5N A;  4M9S A;  4B4C A;  4EAT A;  2UXX A;  2Y69 H;  1W36 C;  4IHV A;  2FF4 A;  5ILS A;  4AYB N;  5EGO B;  1S8N A;  3A0B C;  1STZ A;  2IA0 A;  2NOJ B;  2EFO A;  3OR2 C;  3V8K A;  2G0E A;  1WGX A;  2VQH A;  3ABL H;  3OYF A;  5TJJ A;  5J47 A;  3I64 A;  4HST A;  3ZMU A;  3PSI A;  2JQ7 A;  4Y17 A;  4CCN A;  1V5E A;  3KYD B;  4IF4 A;  2HWV A;  2QWW A;  3LL7 A;  5DEQ A;  5LRS A;  5ILV A;  1TQM A;  3K4B A;  2H94 A;  3L2V A;  2FU4 A;  5J6X A;  3F8N A;  2KL4 A;  1IDZ A;  4GO1 A;  3CO6 C;  2R7W A;  1XSV A;  3RPU D;  2K3P A;  3EQL F;  3CC7 I;  4YEL A;  4XRS G;  5FLM J;  4RM2 A;  1VQM I;  3Q9S A;  3MKZ A;  5DCM B;  2M4G A;  2K9N A;  1ETO A;  2JUC A;  3K69 A;  4U7D A;  3ZPL A;  4HV5 A;  2ACJ A;  4N4O B;  3AFH A;  2OUM A;  3A03 A;  3GTJ J;  4HF2 A;  3JR9 A;  3F72 A;  5KHD A;  2HDW A;  2PG4 A;  1R9T J;  3NAU A;  3R6S A;  2BOL A;  5LD2 C;  2L0K A;  3F21 A;  2PI0 A;  1LFU P;  1FYL A;  3BZC A;  4HLY A;  2QLZ A;  5FKL A;  2Z16 A;  4F3Q A;  1JUM A;  2F5C A;  3R61 A;  3CO7 C;  1VQ7 I;  1X1A A;  3RDI A;  2LF7 A;  4M71 A;  1UCR A;  5ICE A;  2VI6 A;  3L9F A;  5HLI A;  3FMR A;  1B9N A;  3KP3 A;  1XMX A;  2LFB A;  4MTD A;  1WFX A;  4AIK A;  3FBN B;  1KU2 A;  4KYW A;  3ERM A;  3R0A A;  1UST A;  1XPX A;  2V1X A;  1JTX A;  4JX6 A;  4FIS A;  1OR7 A;  3GZ6 A;  2HTS A;  5F0H A;  2JA8 J;  1VND A;  3K70 C;  1UJ8 A;  1REP C;  2FX0 A;  3O3K A;  3MQ0 A;  3CMY A;  1OCT C;  1KYZ A;  2XRO A;  4DJA A;  3ASO H;  3I56 I;  5HS8 A;  2WBM A;  3FXU A;  4KN4 X;  5KNL A;  2A5Y B;  2HYG D;  2DK5 A;  3TOA A;  3BCB A;  3B02 A;  2CWE A;  3IWZ A;  2V1U A;  4PSX A;  4C3H J;  1KU3 A;  4U87 A;  2XAG A;  1LEA A;  2JA6 J;  3FX3 A;  4NDL A;  3C2B A;  4FCY A;  2EA4 A;  2K9S A;  3RKX A;  1XS9 A;  3LWF A;  2ZFU A;  2A6H F;  5L3D A;  2ID6 A;  4RS8 A;  2RC4 A;  1H9G A;  3W3C A;  1YRN A;  4I0A A;  4LG0 A;  1IV8 A;  1HW1 A;  1YYV A;  2IGM A;  2VQC A;  2CV2 A;  1RNL A;  4IL6 C;  3QQA A;  4MGR A;  5KCM A;  1MBF A;  4A0Y A;  1WI3 A;  1WJB A;  1DU0 A;  1X4P A;  2OCE A;  2BHZ A;  1M1E B;  3T8R A;  4LIU A;  5J1R A;  4XQF A;  3H1C A;  1ENH A;  2MD0 A;  1WCM J;  4G94 A;  1ZRC A;  1P9Q C;  3KZY A;  2AQF A;  2O5R A;  3H92 A;  5AON A;  2L4M A;  2Z2S B;  2QCO A;  3KP2 A;  5DYM A;  3AG4 H;  1I1S A;  3M07 A;  4IVN A;  5F27 A;  4ZTJ A;  4BH9 A;  2HGC A;  4CDG A;  1YHQ I;  1A31 A;  2BVL A;  2M7A A;  1S29 A;  2O3F A;  2IXS A;  2NS8 A;  4L0Y B;  5CVI A;  1YW7 A;  4QWQ A;  1XDS A;  4KDP A;  4JBA A;  1OR7 C;  4N9H A;  1ZK8 A;  4Q5S F;  5HNF A;  3ABM H;  4NC6 A;  5FLX K;  2P4W A;  2MW8 A;  1MBJ A;  2KRF A;  4JX4 A;  4JOM A;  1F1Z A;  5GP9 A;  4IX7 A;  3H5R A;  2XAQ A;  5FLX Z;  3G71 I;  4M3G A;  5DUI A;  2YS9 A;  2QUF A;  5K5O A;  3U1D A;  4HG2 A;  3ZR8 X;  1O3R A;  3M9A A;  1TW3 A;  4P9U A;  3FZV A;  4F91 B;  4BE2 A;  4XBF A;  2X4H A;  1IN7 A;  3KET A;  5EZH A;  3E7L A;  2DCE A;  4NB5 A;  2DOE A;  3BLY A;  2P7V B;  2NXN B;  3R4K A;  3A2K A;  1RET A;  2XPV A;  3CJT B;  2PMH A;  3LSJ A;  2CS3 A;  5EG0 A;  2O8X A;  1WWX A;  4X0G A;  4LJZ F;  3HOS A;  3HOT A;  3E5U A;  2JPB A;  3C7J A;  1BL0 A;  2STT A;  3HOU J;  3RI4 A;  3DTE A;  4FET A;  3RPU A;  2CW7 A;  2DT6 A;  2GA1 A;  2Z5U A;  2R5Z B;  2LC2 A;  4BEH A;  5TRD A;  1VQ9 I;  4RMN A;  4XN3 A;  4DYC A;  3COA C;  4CZC A;  2FBK A;  5EF6 A;  2JUG A;  1ZN2 A;  1OQY A;  2HTJ A;  1IN5 A;  1X3Z B;  3D5S C;  3V7S A;  1JT0 A;  1KON A;  1T38 A;  2F5V A;  1GT0 C;  2ECC A;  2JA2 A;  2DT7 B;  1ETV A;  1UMQ A;  3E3V A;  2GAU A;  1CF7 A;  3S3M A;  3T8T A;  4Y7N J;  2A05 A;  1QVU A;  3OYE A;  2X85 A;  4DIQ A;  4BL0 B;  2FRH A;  1F9N A;  1FP1 D;  3WU2 C;  2QQ8 A;  3IRQ A;  3I5U A;  1W0U A;  3O8G A;  3MKL A;  2FSW A;  1HKQ A;  2WV0 A;  4M3B A;  1QPM A;  3DCF A;  4PJN A;  2CUE A;  3ZMS A;  2FXA A;  2MFZ A;  2VJI A;  1UHS A;  3GLX A;  2F5E A;  3DQV C;  2WAQ A;  2DMQ A;  3WTX C;  3GTK J;  3G73 A;  3JRE A;  2P6S A;  2BEO A;  1P6R A;  2VXZ A;  3KE2 A;  4KIB A;  3MKY B;  2IA2 A;  2VBY A;  2FOK A;  3BY6 A;  4I0B A;  5D8K B;  1AOY A;  2QEN A;  4M3F A;  4KIG A;  3MN2 A;  3KP4 A;  4BXF A;  1Q1V A;  1IO2 A;  1U6G A;  3K4L A;  3DBR B;  3PNV A;  5BNG A;  2IS4 A;  4HNT A;  3DEW A;  1PP7 U;  3N05 A;  4BQA A;  3D1N I;  4JX5 A;  3GVA A;  1TWA J;  1P4X A;  3MWM A;  2BY2 A;  3G1O A;  3OYG A;  3Q0W A;  4HDV A;  4IHX A;  3QAH A;  2GA2 A;  2KKO A;  4IPA A;  4ESF A;  3RSN A;  3ABK H;  4LGW A;  1RUN A;  2X9D A;  4L0Z B;  1ZRF A;  1MJ9 A;  1XCB A;  4CCL A;  1PUE E;  4GXO A;  4RB1 A;  3JSO A;  4O5V A;  3BG3 A;  2UV1 A;  3IH3 A;  5ERI A;  4RB3 C;  3CCR I;  5CVR A;  3TDU C;  5F1J A;  5IYD J;  3NWS A;  5BPI A;  5JHF A;  4MLO A;  2EIN H;  1NHA A;  2VC1 A;  2LG4 A;  2ZBK A;  4KIF A;  3W6V A;  3MZH A;  1LJ9 A;  3F22 A;  3FM3 A;  1I50 J;  2VXD A;  4HQM A;  2P7C B;  1FT9 A;  1D8J A;  2W24 A;  2OZ6 A;  3KP6 A;  4RAZ A;  1TWH J;  4R79 A;  5K7F A;  4CXF A;  3OMY A;  3JRG A;  3PSF A;  2R7D A;  2DPD A;  4A3L J;  1BM9 A;  2X6W A;  1HSJ A;  5FKM A;  2FML A;  3HOW J;  2KIQ A;  3RZO J;  4YFX F;  3WU1 B;  1Y1W J;  5J4V A;  2R7R A;  3SFZ A;  3RTR A;  3JW4 A;  2HOA A;  3G1M A;  1NG6 A;  2LBF B;  5CLS A;  2K02 A;  1R71 A;  2DOF A;  2VQG A;  5LGT A;  3BZK A;  2Y0M A;  5J1Y A;  3ZP5 A;  2K40 A;  1ZKG A;  3IKV A;  1I3Q J;  4M9Z A;  2B63 J;  2HOS A;  1G8X A;  1POG A;  1SD5 A;  1K7A A;  1IRF A;  2M8G X;  3ONQ A;  3W6K B;  4B3X A;  1E3P A;  3BPV A;  5JVT A;  4DBQ A;  4IHT A;  2CU7 A;  2GOM A;  1HF0 A;  1U9N A;  5M3F J;  4A3M J;  3OL3 A;  3A0H C;  1OPC A;  4BY7 J;  5A2Q K;  2XGX A;  1DGR M;  1D0Z A;  3DFG A;  4JYK A;  1K78 B;  4UNO A;  4BBR J;  2L9R A;  3ECO A;  1W1W E;  3GBG A;  1BA5 A;  3JAM K;  4E7I A;  4ABZ A;  4KNY A;  1J0R A;  1YX5 A;  4BU2 A;  2NVU B;  1D1C A;  3IV5 A;  5A2Q Z;  3EET A;  2ZJP F;  4HX8 A;  3LFU A;  5K5R A;  1QHH D;  1MD0 A;  2Z3Y A;  3ZMD A;  2XRL A;  2EIK H;  4IJA A;  3G2B A;  1UZC A;  3I53 A;  5L3G A;  1B8I B;  4ZDL A;  5DM7 F;  1OMI A;  5FB2 A;  2A07 F;  2J5P A;  2P8T A;  5ED4 A;  1Y56 A;  3KFW X;  3TQN A;  4A69 C;  3JRD A;  3LSP A;  2IGN A;  3JRB A;  2NOG A;  1IW7 F;  2HOT A;  2H09 A;  1APL C;  1GUU A;  2DQL A;  3R0J A;  4U0Y A;  2OQG A;  4FX4 A;  2EB7 A;  5JVG F;  3JRI A;  1D3Y A;  1A6I A;  3E6B A;  4MNU A;  1YJ9 I;  3K10 A;  5JLW A;  2PMZ A;  1TLH B;  4Y13 A;  2PX9 A;  3E6D A;  1MZB A;  2PJR B;  3ML6 A;  3V7C A;  2O0Y A;  2WTE A;  4EJU A;  2ZKZ A;  3WTW C;  3BR2 A;  4GGG A;  1T95 A;  1JTY A;  4MEX F;  1YX3 A;  2YX7 A;  1S9H A;  1K6Y A;  1JHH A;  1R1V A;  3J7Z I;  4G8X A;  3FXR A;  1DU6 A;  2KRC A;  2E34 A;  1R4M B;  4E7L A;  1TT5 B;  3DBL B;  2AS5 F;  3MAJ A;  4XK4 A;  3CUQ A;  3OYL A;  1BC7 C;  1ZTR A;  2DOD A;  3GTO J;  3TOB A;  1IXC A;  3Q0U A;  1SAU A;  2OQR A;  5IY5 H;  1VQO I;  3PUB A;  1J59 A;  2LBF A;  1D0X A;  2DO7 A;  2V7F A;  4GYG A;  2WC2 A;  2Y31 A;  1QBJ A;  3E0J B;  4E7Z A;  2OAZ A;  3MZ8 A;  1MDM B;  1MW7 A;  1YS7 A;  4NQW B;  4A6E A;  1Z3X A;  1VQ4 I;  4G7O F;  4V2G A;  4OIO F;  1USS A;  1Z05 A;  2V1D A;  2HDD A;  4M6Y A;  4C9Y A;  4ESB A;  5J3L A;  2E2J J;  5FKN A;  1B9M A;  1PP8 F;  2K85 A;  4DW6 A;  4LIV A;  1LDJ A;  2O7O A;  1X2M A;  5LLQ A;  1E17 A;  3B6A A;  2VB6 A;  4Z6Y A;  2L3D A;  1TL8 A;  2O6G E;  4RM3 A;  3KLO A;  4G6D A;  1FIP A;  3QU6 A;  4FHT A;  3ZQ7 A;  1UG0 A;  4A5M A;  2IA1 A;  1I3A A;  4FX0 A;  3L2U A;  2R7V A;  3Q0V A;  3NAR A;  2MC3 A;  2UWM A;  2AO9 A;  4J00 A;  1X3U A;  3ECH A;  4RAF A;  3T1B A;  2KPM A;  3KIO A;  4CHU A;  3V7R A;  2EPF A;  1FMW A;  2RNG A;  2JJ7 A;  4WK8 F;  2LOO A;  4V19 K;  4Y3O A;  3HHH A;  4A3D J;  2A61 A;  1HW5 A;  1AA7 A;  2GIV A;  2VC0 A;  4HA8 A;  3CCE I;  3RIR A;  4CYC A;  4DBR A;  2XF6 A;  1OLT A;  5IT3 A;  2CW0 F;  4IZZ A;  4MQ9 F;  4E70 A;  2PN6 A;  3BG5 A;  3IWF A;  3L09 A;  3S2H J;  1MH4 A;  2DFE A;  2VBX A;  2VKE A;  1KQ9 A;  2IRF G;  2B0L A;  4M72 A;  3CP2 A;  2PJR A;  1ONV A;  4BHB A;  2JRM A;  2KJC A;  3SEQ A;  1FNN A;  1OCC H;  1QU3 A;  3BJ6 A;  2XB5 A;  4BHC A;  4B43 A;  2OA4 A;  1BJA A;  1R1T A;  3E5X A;  1Z77 A;  5B1B H;  5K7Z A;  1G3Y A;  2L4A A;  2VLA A;  1N78 A;  1RKW A;  2ZSH B;  1PDN C;  3DTK A;  4L9V A;  3Q5F A;  2BXZ A;  2TDX A;  2XGD A;  4ZDP A;  3O6B B;  3G4S I;  1KU9 A;  3CUQ C;  3GZ5 A;  1J7K A;  1GV2 A;  3DTI A;  2VJ5 A;  3BR6 A;  3HJE A;  1P92 A;  1ITY A;  3HOX J;  3BTC A;  2DFH A;  2XPU A;  3BR3 A;  3DPT A;  2Z1D A;  2ZXW H;  4HLX A;  4LK1 F;  3LAJ A;  3QU3 A;  3PO2 J;  4EM1 A;  4YRV A;  4S05 A;  2PQ8 A;  4AWX B;  2FMY A;  2ADU A;  5FGM A;  5B3S H;  4LB5 A;  2E7X A;  2FBH A;  1DGW Y;  1UB9 A;  2W4S A;  1FSE A;  2DU9 A;  1FYM A;  1I1G A;  4A3G J;  4XKW A;  2DLL A;  3WG7 H;  2NAZ A;  2HYF A;  2V4J C;  1YQA A;  2L7F P;  3S16 J;  3HG9 A;  4A3K J;  1XSX A;  2EFQ A;  3JRH A;  4BYY A;  4A93 J;  4EGZ A;  1NTC A;  2F4I A;  2Y9Y A;  4MTE A;  3BTI A;  3HHG A;  3WHC A;  1UHM A;  2DOA A;  4OAZ A;  1LDK B;  3OY9 A;  2KIF A;  2ZJR F;  1JKQ C;  1IDY A;  1JKP C;  2Y2Z A;  1P7I A;  2VON A;  1ZLJ A;  1JXS A;  3BJO A;  4ITV A;  4TV7 A;  4C3I J;  4XKC A;  2DDA A;  3IAM 2;  2ELK A;  2E5Z A;  2EH3 A;  2XHK A;  3C18 A;  1OCZ H;  2YX4 A;  1KZH A;  4DZJ A;  5E3N A;  2VUM J;  1W4M A;  3I4N J;  2JTV A;  3LA2 A;  2M1B A;  4WXD A;  2MH9 A;  3LAP A;  5JHU A;  2K7L A;  1XGS A;  1G3T A;  1VZ0 A;  3F8F A;  4ZYH A;  3BJA A;  1YW8 A;  1SFE A;  3GX4 X;  1SMT A;  1DUX C;  2ZCW A;  4U7B A;  1LVA A;  1ZHF A;  4XLH A;  3GEZ A;  1RR8 C;  3BQY A;  1TT0 A;  5HVQ C;  1GLN A;  1ODD A;  4HSR A;  3BTJ A;  1SFU A;  2HQN A;  2I10 A;  1TNT A;  2LRD A;  2YPR A;  3VFZ A;  2RRE A;  3ZOB A;  1FZP B;  4JP0 A;  4P55 A;  2LY9 A;  3F8M A;  2BHY A;  2I5U A;  2ZO4 A;  5CVU A;  2RKH A;  1XGO A;  1WSU A;  4Y33 A;  4KMF A;  1IXS B;  1P2F A;  2IVM A;  1IN4 A;  4XNF A;  3HL2 A;  3CMM A;  4Y4R A;  3SZG A;  4A2U A;  4EJT A;  4ZYG A;  5EEA A;  1X3W B;  1RR7 A;  3JRA A;  5D4S A;  1OYY A;  2DK8 A;  2LP0 A;  3I0T A;  3LA3 A;  3SEZ A;  1C0W A;  2IS6 A;  3TO7 A;  4IO9 F;  1YRN B;  4I02 A;  1A6Q A;  3BG9 A;  2HZT A;  4LG0 B;  2MC4 A;  3ESW B;  1FTT A;  4KIT B;  2M45 A;  2HU9 A;  5H20 A;  1DQU A;  2EZI A;  4PFP A;  2MG4 A;  1N75 A;  4QPO A;  1LNW A;  5FKK A;  5D5U B;  1S7O A;  5D8L B;  2RV8 A;  3HTU A;  3I59 A;  2X48 A;  1TBX A;  3HOY J;  1ERD A;  2HEO A;  3W2A A;  5FRN A;  2X6Y A;  5FD5 A;  4G6T B;  4I99 C;  3IL2 A;  1J2X A;  2L02 A;  3VOD A;  3S3O A;  4N0B A;  4S04 A;  3CJN A;  3SFI A;  3PFI A;  4IRI A;  1YG2 A;  2ZFW A;  2LKP A;  2ISY A;  4XOR A;  1R5I D;  3EUK L;  4AIJ A;  3BZ6 A;  5C44 J;  1PYV A;  5FO5 A;  1Y39 A;  1ZQ3 P;  1HKT A;  1FEX A;  3WTV C;  4HNU A;  1A04 A;  2K5C A;  1AWC A;  5E18 F;  1O4X A;  4MO7 A;  3RKW A;  2DW4 A;  2DA3 A;  1FBS A;  4G7Z F;  1SFO J;  2VOD A;  2TRT A;  1VQN I;  2PMU A;  3ABU A;  2F4M B;  3BR5 A;  2EQR A;  2KZG A;  1FOW A;  3M8E A;  3QOD A;  3F6O A;  3L2Q A;  2BY1 A;  4D5C A;  2OPT A;  3LSK A;  2H8R A;  3GFJ A;  3F8B A;  4XON A;  1D1B A;  3CLO A;  3CES A;  1MMG A;  3EDP A;  5E1W A;  3CMA I;  2L2O A;  1QPI A;  2M2E A;  2N8G A;  3J7A O;  2WWY A;  4C2T A;  2NYX A;  1E2X A;  2V6C A;  1P4A A;  2KP6 A;  3GME A;  3K1N A;  5BS6 A;  1WJD A;  3O2P E;  1A36 A;  3CCU I;  2KRH A;  4IRG A;  4BJT A;  3CME I;  1RPW A;  3PQK A;  5E3L A;  1EF4 A;  2ESN A;  1JJ6 C;  1LEB A;  2W85 A;  4F92 B;  1SD7 A;  2DMU A;  1OYI A;  2L7Z A;  3MFK A;  1O3T A;  1IUY A;  3EPZ A;  3S1R J;  2HVS A;  2FNP A;  5FRM A;  4AYB A;  2FQ4 A;  3LMM A;  1I5Z A;  1IAW A;  2W7N A;  1K4T A;  5EG0 B;  3BG7 A;  1X1B A;  1WJA A;  3DPL C;  2HNH A;  4Q4Z F;  5JI6 A;  2OU2 A;  3PNY A;  2QVO A;  4PZJ A;  2EFW A;  1SAX A;  1VQ8 I;  2K4J A;  5IP7 J;  4IXA A;  5ILU A;  3H3Z A;  4BDY A;  3CQZ J;  3CLQ A;  4L5E A;  3OWT A;  1Z6T A;  3LSM A;  4I09 A;  2FQ3 A;  4BEH B;  4ZH4 F;  2V26 A;  1IRZ A;  3PUF A;  3PIP F;  2XC7 A;  2R7O A;  1Y1V J;  3GO5 A;  3ZQG A;  5E8G A;  2M0M A;  5DD8 A;  3QOE A;  3QPS A;  1GVJ A;  1WJF A;  4RGU A;  2LKX A;  3S15 J;  3IC7 A;  1T56 A;  2K86 A;  2G7H A;  4B09 A;  2JWT A;  1WQ2 A;  4YIF A;  3UNG C;  1CF7 B;  2DA6 A;  1E3H A;  4HF0 A;  1JUP A;  1FBU A;  3L00 A;  1JHF A;  1W7P D;  1HC8 A;  2LMD A;  2JA7 J;  4GRI A;  4RLF A;  4BQO A;  2ZB9 A;  2R0Q C;  1Y8R B;  4Q47 A;  4XSZ F;  4XOP A;  4DYR A;  2XAJ A;  3IRR A;  2VOP A;  1FWZ A;  3S1M J;  2GOX B;  2JT1 A;  1ZG3 A;  2O9L A;  4L9J A;  3SQN A;  2QM3 A;  2MH2 A;  1T8I A;  3GUD A;  2E35 A;  4HDU A;  2TCT A;  2E71 A;  1BBY A;  2AXL A;  1DP3 A;  2IBD A;  4XLC A;  2OBP A;  2DA2 A;  2JSP A;  2KMU A;  1AKH A;  3HBL A;  1EJ9 A;  3ELK A;  4WXC A;  1V3F A;  3TL4 X;  2EIJ H;  2E2H J;  4ZDO A;  3BWG A;  3RYP A;  3HGG A;  4W97 A;  1Z91 A;  3RJP A;  4G7H F;  1QZZ A;  2XUB A;  5ICC A;  1K6O A;  2XF5 A;  3RZD J;  3K4C A;  4YFK F;  4HYE A;  1S72 I;  3K4J A;  2CUF A;  2GBY A;  4OOI A;  4XR6 A;  1DPR A;  3QYF A;  3CDH A;  1KU7 A;  2DPU A;  1IRX A;  3VYS B;  2Y0S N;  1ZGW A;  5BMZ A;  5B66 C;  3LNQ A;  2DA1 A;  2E2I J;  1SFX A;  2K9Q A;  5L3E A;  2NRA C;  2L54 A;  1Q1H A;  2VIX A;  2E19 A;  3MMY B;  3KLN A;  1X4O A;  5CYV A;  3C3W A;  3K1M A;  1GV5 A;  1YFH A;  2FBI A;  3M4O J;  1ON2 A;  2BZT A;  4YG2 F;  3WTT C;  4PSW A;  4LG3 A;  2GM4 A;  3WGI A;  3CJR B;  1K79 A;  1R6R A;  4PJ0 C;  2YU9 J;  4ON0 A;  2RNJ A;  1YTY A;  1WZ2 A;  2JMW A;  2M9H A;  2Y75 A;  4IHW A;  3AG1 H;  3AKZ A;  1LVK A;  4Y52 J;  5LHI A;  4RDU A;  2ME0 A;  1X1C A;  2DAO A;  3TMO A;  3HSE A;  4HBL A;  1D8K A;  4E7H A;  4A0Z A;  3S17 J;  4UB6 C;  3GTP J;  3HZJ A;  2XAH A;  4XLA A;  2R4G A;  1U3E M;  3K2A A;  4CIC A;  3LSR A;  3A4C A;  2LLK A;  2E1O A;  3LFK A;  3PFY A;  4CCK A;  3CDI A;  5AIP A;  3J80 K;  3P9C A;  2LDU A;  2KFD A;  2OV7 A;  4QSH A;  3BCA A;  5E17 F;  2M34 A;  2KIS A;  1EKE A;  4OWR B;  3H0D A;  3J80 Z;  3QPT A;  1XGM A;  3A01 B;  1MSF C;  3CDL A;  1XTA A;  3I58 A;  3ZMV A;  1H89 C;  1VQP I;  2IGK A;  2Q1Z B;  2CRG A;  5E8I A;  3C2H A;  4QLC U;  1JGG A;  1AU7 A;  4IOC F;  2JN6 A;  3I4P A;  1ZAO A;  4BXX J;  1YO5 C;  3ZCO A;  2CUZ A;  1ZG1 A;  1GVD A;  2PLY A;  1I6H J;  4E7K A;  4C30 A;  1W5S A;  2XGE A;  2GXG A;  4IEJ A;  1QRY A;  2V6E A;  2LY1 A;  1JKO C;  4XL9 A;  2CG4 A;  3PL8 A;  1R58 A;  2ECB A;  4LD5 A;  3KZZ A;  5H2F C;  1BW5 A;  2WV1 A;  1SVL A;  2A3S A;  1HXD A;  1G3S A;  2HXO A;  5TIS C;  5J8C A;  1IF1 A;  1WJC A;  4I7H A;  4CCO A;  3I4M J;  2BVM A;  1S7E A;  2JK3 A;  2WAD A;  2PMZ N;  5GAE J;  4BJ6 C;  4QTR A;  1N77 A;  1FIA A;  4A12 A;  2ZC2 A;  2EWN A;  1UAA A;  1G3W A;  2RN7 A;  4XLF A;  3FK6 A;  5BOX A;  5D6E A;  1GXP A;  2Y9Z A;  3FBI B;  4ZTF A;  2HR3 A;  2K9M A;  1EH7 A;  2D45 A;  3GWZ A;  3KX2 A;  3TED A;  2V79 A;  3WTY C;  3ZQL A;  2E5N A;  3ZQI A;  1BOB A;  1HLV A;  2CV0 A;  4FQG A;  5LGU A;  5ICG A;  1J75 A;  3KZI C;  3K7A J;  1KGS A;  5F08 A;  3WG9 A;  4U0W A;  3CUQ B;  4PGH A;  3X2Q H;  3CCJ I;  4XLN F;  2EV6 A;  2BW3 A;  1TWG J;  2WY7 Q;  2DTR A;  3VYT B;  2K27 A;  1HKS A;  1BR2 A;  1LB2 A;  4HW0 A;  1EA3 A;  2COB A;  4ZC3 A;  2W82 A;  4KT6 A;  1HBX G;  1RI7 A;  2VAS A;  2LK2 A;  3Q3S A;  1LFP A;  1W7P A;  2KQR A;  3OYM A;  4LFU A;  3AG2 H;  4EJV A;  2HDC A;  3CJQ B;  1IGN A;  3FF5 A;  2XF7 A;  4A6D A;  4DYQ A;  1QO0 D;  3FKI J;  3A01 A;  1ETW A;  4KFC A;  2LRE A;  1R22 A;  3IAS 2;  5KK1 A;  1JI8 A;  3S2D J;  4F52 A;  1LQ1 A;  1YI2 I;  3GXO A;  5FKO A;  2R7T A;  4EMS A;  2Y30 A;  5E1X A;  3DWL E;  3KCC A;  2DJI A;  4ZZL A;  3JSP A;  2EV0 A;  1F36 A;  1IXR C;  1MJB A;  2IEK A;  1I27 A;  4OIN F;  2CH0 A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  2VPL A;  3TBI A;  3DPT A;  2Z1D A;  2HZD A;  3K70 C;  4YRV A;  3ZQQ A;  3DEE A;  3QYB A;  4PUS A;  1MMN A;  3HC7 A;  2OC6 A;  4II3 A;  3M1C A;  1DGW Y;  2BW3 B;  3DU5 A;  4DJA A;  2W4S A;  3H9G A;  2WBM A;  4ZYA A;  4XKW A;  5KNL A;  4XN0 A;  2V4J C;  5HNH A;  3HG9 A;  3BCB A;  3K70 D;  4PSX A;  4RLQ A;  4YEJ A;  2F4I A;  2KZV A;  4U87 A;  2K9L A;  3K4K A;  2DOA A;  4OAZ A;  1LDK B;  3OY9 A;  4KIS A;  2L5Q A;  4B47 A;  2X1D A;  3BC8 A;  2ZFU A;  5CKT A;  4XKV A;  3OIP A;  4IQJ A;  3OOU A;  4ITV A;  5HLT A;  3W3C A;  4XKC A;  2IGM A;  2VQC A;  3K4N A;  3OIQ A;  2M4K A;  2CV2 A;  3IAM 2;  2E5Z A;  1E0E A;  3ZGK A;  5KCM A;  1WJB A;  3OYJ A;  4PJM A;  1X4P A;  2MAB A;  1VZ0 A;  4LIU A;  2VJJ A;  2HQA A;  4XQF A;  2FUG 2;  3BG6 A;  3S93 A;  4U7B A;  4XLH A;  1TT0 A;  3LSI A;  1TZL A;  2MD0 A;  1GLN A;  2L9S A;  3VYR B;  5HVQ C;  2IS2 A;  4HSR A;  1P9Q C;  2VJ4 A;  2AQF A;  2O5R A;  2LRD A;  2Z2S B;  2RRE A;  1HA8 A;  4ZTJ A;  1SFK A;  2Y0S A;  2DXI A;  4IKF A;  2BVL A;  2M7A A;  1W36 D;  1Z7L A;  3OYB A;  2IXS A;  4Y33 A;  3EUA A;  4XNF A;  3HL2 A;  2I8D A;  5CPR B;  3CMM A;  4Y4R A;  3SZG A;  3VYU B;  4BE1 A;  4CCM A;  1OR7 C;  3OYI A;  4XLE A;  2QKL B;  4BE0 A;  5HNF A;  2IS6 A;  3SEZ A;  4JOM A;  2MC4 A;  4IX7 A;  3H5R A;  4KIT B;  2HU9 A;  3OYK A;  1DQU A;  4PFP A;  1UEL B;  1N75 A;  4QPO A;  2Q2E B;  4HG2 A;  3ZR8 X;  3DKY A;  4N4N B;  3VSL A;  1ERD A;  3W2A A;  5FRN A;  2X6Y A;  3MKW B;  4G6T B;  4F91 B;  2V9K A;  3J7A Y;  1T0F C;  4BE2 A;  2LYC A;  3S3O A;  2VKH A;  3HUG B;  3I3L A;  3OYN A;  2DCE A;  4XOR A;  2WAE A;  3BLY A;  3EUK L;  1MMA A;  3A2K A;  1PYV A;  3H9Q A;  2CS3 A;  3DKX A;  4HNU A;  2K5C A;  4X0G A;  3HOS A;  3HOT A;  3H5N A;  3VSK A;  1J09 A;  3S32 A;  4BQN A;  2WA0 A;  1MMD A;  3C2G A;  2R7Q A;  3DTE A;  4FET A;  4F93 B;  2CW7 A;  2DT6 A;  2LC2 A;  4BEH A;  1NG7 A;  4RMN A;  4XN3 A;  4CZC A;  3QOD A;  3L2Q A;  2JUG A;  3LSK A;  3D5S C;  4XON A;  1D1B A;  1KON A;  2F5V A;  1MMG A;  2HVQ A;  3CES A;  3I9V 2;  2L2O A;  3DLA A;  1PJR A;  2JA2 A;  4C2T A;  2DT7 B;  2KP6 A;  3S3M A;  1WJD A;  3L2W A;  2VL8 A;  3OR1 C;  2KRH A;  4BJT A;  3OYE A;  2X85 A;  4DIQ A;  4BL0 B;  3HPH A;  4AVZ A;  4J01 A;  4NC8 A;  4F92 B;  4AU7 A;  2F6C A;  3EPZ A;  2L7K A;  4PJN A;  2CMP A;  2HVS A;  2MFZ A;  5FRM A;  2VJI A;  4AYB A;  3HXL A;  3LMM A;  3DQV C;  2W7N A;  2WAQ A;  4II2 A;  4DGW B;  3BG7 A;  3D5R C;  2X51 A;  4BGD A;  1X1B A;  1WJA A;  3DPL C;  2HNH A;  3LSG A;  4CA0 A;  2E1M B;  1U0J A;  3PNY A;  4LIT A;  3CZ6 A;  2AQE A;  4BDY A;  2VXZ A;  4PJJ A;  3FDY A;  3MKY B;  3OWT A;  4E7S A;  3LSM A;  4P5O A;  1LKX A;  4BEH B;  2ZSI B;  3H5A A;  2V26 A;  4BXF A;  3FKJ A;  2IS1 A;  2XC7 A;  2R7O A;  3K4L A;  2WY8 Q;  3PNV A;  1QHG A;  1X1D A;  2M0M A;  3KEY A;  4KJZ A;  3UR3 C;  2HPM A;  4XKB A;  3QOE A;  4HNT A;  2IS4 A;  3N05 A;  1WJF A;  3KYL A;  4BJ5 C;  4XOT A;  3QYE A;  2W00 A;  2HPI A;  3E1S A;  2X1C A;  4NNJ A;  3OYG A;  3UNG C;  2KDO A;  5LFA A;  3RSN A;  2M3A A;  3ZRG A;  4IQ4 A;  3A1Y A;  4CSW A;  4GRI A;  4RLF A;  4BQO A;  4CCL A;  1WJE A;  3S3N A;  5CQE A;  2UV1 A;  4DOZ A;  4JQF A;  4XOP A;  4NUB A;  2M7B A;  3NWS A;  4E4H A;  2KLO A;  2UUZ A;  5JHF A;  2GOX B;  4MLO A;  3D5L A;  2R7U A;  4FAS D;  2LG4 A;  4ANJ A;  4CH7 A;  2VXD A;  1DP3 A;  4CCJ A;  4XLC A;  3V42 A;  2JSP A;  4R79 A;  2P0W A;  2KMU A;  3OMY A;  3CP8 A;  2VQL A;  3TL4 X;  3W2V A;  3PSF A;  4ZDO A;  3MD2 A;  3OS2 A;  3K4M A;  2X6W A;  2XF5 A;  4HRI A;  3K4C A;  3HKZ A;  4CUG A;  4H4K C;  3K4J A;  2KHM A;  3F9K A;  3OYC A;  2R7R A;  1BR1 A;  4XR6 A;  3RTR A;  3QYF A;  1X19 A;  2LBF B;  1NG6 A;  3PJR A;  3VDX A;  1IRX A;  2W1O A;  2VQG A;  3VYS B;  2ELJ A;  4BDZ A;  3OYA A;  3SYT A;  2IGO A;  1WJ5 A;  1G8X A;  1Z21 A;  2VIX A;  3ONQ A;  4B3X A;  3MMY B;  4DBQ A;  2X6X A;  1BR4 A;  4E6K G;  1X4O A;  2GOM A;  3OL3 A;  4ZJZ A;  3LSH A;  1DGR M;  1D0Z A;  2JVG A;  4HPQ A;  3GBG A;  2WB1 A;  4PSW A;  4E7I A;  4LG3 A;  1YX5 A;  4PFO A;  4BU2 A;  1D1C A;  3CJR B;  1R6R A;  4C2U A;  3LFU A;  1D1A A;  1QHH D;  4NC7 A;  3H35 A;  3OS0 A;  3FHN A;  4PJL A;  1FMV A;  3AKZ A;  3G2B A;  1LVK A;  4ZDL A;  1G59 A;  1X1C A;  3TMO A;  1Y56 A;  3SDB A;  4BQQ A;  2MYS A;  2IGN A;  4E7H A;  3IP4 B;  3PNT A;  1MND A;  3OYD A;  4XLA A;  2R4G A;  2ZXI A;  2LY2 A;  3A4C A;  3K10 A;  2X1E A;  3OS1 A;  2PMZ A;  3PFY A;  4HEA 2;  4CCK A;  4OAY A;  2PJR B;  3AL0 B;  1V5F A;  3DU6 A;  4QPQ A;  2OV7 A;  2VKD A;  3BCA A;  2XAU A;  3ZXS A;  4B48 A;  4XM3 A;  1V5G A;  2CW8 A;  4OWR B;  4F55 A;  3H0D A;  2QKM B;  1T95 A;  3U21 A;  1YX3 A;  1D0Y A;  1S9H A;  1K6Y A;  2IGK A;  2Q1Z B;  4D1Q A;  2KRC A;  3C2H A;  2E60 A;  4PK4 A;  4E7L A;  3CF2 A;  3OL4 A;  3OYL A;  3S8P A;  2CUZ A;  3W2W A;  3ZCO A;  1SAU A;  3RQ4 A;  4E7K A;  3NWT A;  4C30 A;  3PUB A;  2LBF A;  5CQG A;  1D0X A;  2V7F A;  2XSJ C;  3HPG A;  4BAC A;  3DPU A;  2ZXH A;  3OYH A;  2L9N A;  3L2R A;  3E0J B;  2V6E A;  2LY1 A;  4E7Z A;  4P1W A;  4XL9 A;  3PL8 A;  4B44 A;  5HOO A;  1MW7 A;  2A6T A;  4NQW B;  5FRO A;  1Z3X A;  3VWB A;  2E1M C;  2HVR A;  1Y6I A;  4C9Y A;  3H9J A;  3AL0 C;  4EAT A;  2R7X A;  1W36 C;  2JVH A;  4LIV A;  4E7J A;  2XDV A;  1WJC A;  4CCO A;  3OR2 C;  2NOJ B;  2BVM A;  2VB6 A;  2WAD A;  4BJ6 C;  2VQH A;  3OYF A;  1N77 A;  4RM3 A;  4HST A;  1UAA A;  3PSI A;  2CFO A;  4XLF A;  1V5E A;  4CCN A;  3LL7 A;  3EUH C;  1UG0 A;  3FBI B;  3K4B A;  3IUO A;  3L2V A;  4ZTF A;  3L2U A;  2R7V A;  4XMY A;  2K9M A;  4D9J A;  2KL4 A;  3KX2 A;  2R7W A;  2UWM A;  2E5N A;  3RPU D;  2K3P A;  2V1N A;  4J00 A;  2KPM A;  4YEL A;  2A5W A;  1BOB A;  2CV1 A;  4RM2 A;  1FMW A;  2RNG A;  2LOO A;  2CV0 A;  4Y3O A;  2WAF A;  3MKZ A;  1AA7 A;  1YE9 A;  2M4G A;  3M8J A;  3K6G A;  2R7S A;  4DBR A;  2XF6 A;  1OLT A;  2BW3 A;  4IZZ A;  2WY7 Q;  3VYT B;  1BR2 A;  4N4O B;  3AFH A;  5TGT A;  2OUM A;  1EA3 A;  4ZC3 A;  2W82 A;  4KT6 A;  2VAS A;  5KHD A;  1LFP A;  1Z3Y A;  4BUP A;  3CP2 A;  2HDW A;  2RQQ A;  2KQR A;  3OYM A;  2PJR A;  2LH9 A;  3RCO A;  5LD2 C;  2BOL A;  3SEQ A;  3CJQ B;  1ZEL A;  1QU3 A;  4B43 A;  2CUJ A;  2XF7 A;  2Z16 A;  1MNE A;  4F3Q A;  2LRE A;  3IAS 2;  1JI8 A;  1X1A A;  4F52 A;  1N78 A;  2VLA A;  2R7T A;  2ZSH B;  3DTK A;  3DWL E;  4ZDP A;  1WFX A;  2DJI A;  3FBN B;  4BS9 A;  3DTI A;  2CH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...