4OAYA

Bldd ctd-c-di-gmp complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
80
structure length
80
Chain Sequence
PPKLVLDLERMAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Dna binding protein
total genus 27
structure length 80
sequence length 80
chains with identical sequence B, D, E, F, G, H, J, K, M, N, R
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4oayA00
5KHDA 2MC4A 4OAYA 4OAZA
chains in the Genus database with same CATH superfamily
2KJCA 4L5JA 4Y13A 4CXFA 3MZHA 2ZFWA 2ISZA 4B43A 3LFKA 3GTOJ 3ABKH 1VFCA 1IC8A 4A3BJ 2RN7A 2D45A 1XGMA 1MSEC 3HGYA 1P4WA 4KT6A 1MBHA 3TDUC 3O8GA 3HKZA 1D0ZA 4G7OF 4IO9F 4J00A 2WAEA 4X0GA 3ZQIA 3H5AA 4UUTA 3FKIJ 1WVRA 2FOWA 1BR1A 1R1TA 4LD5A 1EV7A 2AS5F 3A0HC 4BKXA 2PX9A 1E0EA 5A2QZ 5IT9K 1D3YA 3BQZA 3OYMA 1K6OA 3HOVJ 2ESHA 3OIQA 2XASA 4M3EA 2LC2A 3IKVA 4PJ0C 4AWXB 2XAJA 2R7XA 1RETA 3BWGA 1STZA 3FX3A 1DU0A 3WTWC 1UCRA 1ZQ3P 4JX6A 4XORA 1D8KA 4JQFA 1SVOA 1SFEA 2HR3A 4AUXA 2B7EA 4I0AA 5HS9A 4BY7J 1PVEA 1G4DA 3OIPA 1VQMI 1AOYA 1O7FA 2LFBA 4PGHA 1R49A 1XMXA 1UHWA 1DP7P 2EA2A 1EH6A 2EWNA 4CH7A 5K1YA 3KIOA 5EZGA 2DK5A 2E7XA 4DBRA 1OISA 3KP2A 2FNPA 2KLOA 1N78A 5F04A 4BHPA 3WG9A 4PK4A 4I0BA 3CP2A 1D1CA 3I58A 1QVTA 1X58A 3IH3A 4HLYA 4FTHA 2CV1A 3TO7A 1XCVA 5IY5H 5BOXA 2OUMA 3JRIA 2H6CA 4BYYA 1O7LA 3F22A 3NWSA 3AFHA 1MMSA 5FD6A 2E1NA 5E79C 2CS3A 3QWLA 2CFXA 4CYCB 4BY1J 1VQ4I 2MLKA 2R92J 2COBA 1YRNB 3GBGA 2HOTA 1EA3A 3S15J 5D4SA 1VI0A 4Y33A 2Z9OA 4XM3A 1OCCH 3MD2A 1H9TA 4DZPA 5D4RA 2EQRA 3GCMA 1HA8A 2W57A 3S93A 3K4CA 1B9MA 2DMUA 3KP7A 2QM3A 4P5OA 4BBRJ 1Z91A 2K40A 3JTHA 3L09A 1OR7A 2BOLA 2HQAA 5E3LA 4CYDA 1PUFB 2IA2A 1K61A 1IXSB 2AQFA 2RQQA 3CUQA 1ON1A 2RDPA 3HUGA 2XAGA 2D2WA 4XRFA 5J8FA 1NK3P 3KZZA 1IF1A 4CZZA 5F1JA 1ZK8A 3Q9SA 2LF8A 3FMQA 5CVJA 2WAQA 2LY9A 2RKHA 2KZGA 2GIVA 3K4LA 5JHUA 1FP2A 2ISYA 2VC0A 1TNTA 4HSTA 4Y15A 2V7FA 3LSGA 1ULYA 2L7FP 3FMRA 2Z33A 3OOUA 1MBJA 1RZ4A 2EFNA 5CQGA 3JREA 5E3MA 1UHMA 2IRFG 3I3LA 2A5YB 2EJRA 3ZN0A 1BW5A 3ZPLA 1YS7A 4KNYA 2DA5A 1T08B 4M3BA 1P6RA 1R1UA 2LSOA 4NNJA 2FX0A 1T39A 1LVKA 4DIQA 2E7WA 1H0MA 3HOUJ 1RUNA 2ZNZA 2DU9A 2W00A 2GA2A 3DEEA 3F8FA 2VJ5A 4UB8C 4XONA 2FJ1A 4M9SA 1SD7A 4LK1F 3GMEA 3MKYB 2PMUA 2HOSA 2L3DA 5FFZA 4PSXA 4G7HF 2CG4A 2PJRA 1JTXA 3DBHB 4MTEA 3TBIA 3RZDJ 1J0RA 3CJRB 1VQ5I 1D0YA 4WXDA 4RAZA 4HNUA 2QSFX 3JSOA 3E5QA 4LLGF 3HKZN 1R6RA 2XUBA 3NEUA 2ZBKA 3K4NA 4UVAA 5TRDA 4CGZA 4HSRA 4N4NB 3L9FA 4D5FA 4NC6A 2HOAA 1W36C 2DO7A 5LRSA 4RAFA 1GXQA 2DFHA 1XG1A 4HX7A 1ONVA 2A68F 3QP5A 4OINF 5H20A 2LOOA 4EJOA 3VODA 1CF7B 3K70D 3S3NA 2CQNA 3PIPF 2R0QC 1N75A 3E6BA 5BPIA 3A02A 3F8CA 5M5YJ 3LSJA 3KETA 1D1BA 1NG6A 4IQJA 3WTYC 3PQJA 5ED4A 4BDYA 2VODA 2H6BA 3T8TA 1VZ0A 2DYRH 2KIQA 2XGXA 2D1VA 1TP4A 2OTLI 3HSRA 1ZR2A 4KT5C 1RESA 2VOPA 3N05A 3L1PA 3N4MA 1BN5A 5BQTA 4LG0A 1TWGJ 3ZQLA 1OFCX 2UWMA 1ETWA 4MHGA 1FOKA 2IP2A 3T0YA 1T33A 2PBIA 2V1XA 3AAFA 3G1OA 2QSGX 1SFXA 2RV8A 1RKWA 4OOIA 1IXCA 1JTYA 2VJIA 1W5SA 2G9WA 3C2GA 4UVBA 4RAYA 2EPFA 4GDFA 3EUHA 1HLVA 1G2HA 2KDZA 4Z2YA 3WGIA 1VTNC 4G8XA 3I59A 2X4HA 3ROUA 3W2WA 2F48A 2EZHA 3RIRA 3OY9A 2L7ZA 2VT2A 3H3VK 3VWBA 5C44J 1XDUA 3IWZA 4NQWA 4BJ6C 5J47A 2O9LA 4XBFA 2QBYA 2HGCA 4FHTA 4WF2A 4C30A 3V4GA 2OA4A 1BI3A 4ZYDA 1ZR4A 2JQ7A 1DPRA 2HU9A 1SC7A 1V54H 4L9JA 4CHUA 3ASNH 1MBGA 4UV8A 5FJ8J 3ZMSA 3WHCA 2KPMA 3AKZA 2QQ8A 5E8IA 1W7PB 3W6VA 1MBFA 1X4PA 3DV8A 3U1DA 2FSWA 3GXOA 3SZTA 4CICA 1LPQA 3QPLA 1I6XA 1L0OC 2PG4A 2M87A 5FKOA 1Y6IA 2GOMA 2ZJ2A 4BHCA 2QVOA 3I53A 3J7ZI 2F4IA 2VBZA 3HGGA 4ESJA 2F5EA 2XF5A 3FXRA 1RNLA 2VLAA 1XCBA 3BTIA 3BTJA 3H1CA 5GPAA 4PJMA 3JRCA 3BT9A 3DEWA 1W0UA 2OU2A 3R0JA 3BG9A 2MBFA 4XK4A 1A6QA 1VNDA 1W1WE 2DMTA 2QLZA 5DUKA 4J19A 4O3MA 3KYCB 3A4CA 5FGMA 1LDDA 4QIWN 1FT9A 2RGVA 4EGZA 1DGRM 3RSNA 1HSJA 2XPVA 4N9HA 1HBXG 4M72A 2WAQN 1ETXA 1FY7A 5CYVA 1N77A 1UHSA 2CSOA 3ZQFA 5LBQA 2E1OA 2A69F 1MNMC 4GYGA 2W7NA 1RR8C 3I5UA 3C1DA 2M30A 3V42A 2WWYA 1QZYA 2I5UA 1UZCA 3IHUA 1V55H 2Q2EB 1NTCA 4Y4RA 1LFUP 1I5ZA 4XLHA 2LKPA 4TV7A 2LG4A 2XGEA 4HG2A 4LOCA 3M1CA 2LNBA 1S9HA 3EYYA 3LQQA 2Y48A 5FFXA 4BL0B 4HQEA 3RQIA 2FE3A 2OCCH 4MGRA 5HNHA 3LFUA 5JLWA 3OYEA 2DTZA 4FETA 5J40A 3LMMA 3EYIA 2EA4A 3ERMA 2WV0A 1Z7LA 2VQLA 4X6AJ 2M1BA 2MGQA 2XGCA 2M34A 3RI4A 1YI2I 3GYHX 1K78A 3E6CC 2LD5A 2IVMA 4A12A 3LOCA 5GTIC 2V9PA 3BCBA 2Y0MA 4HX4A 1UAAA 2DCEA 3JRDA 2E2IJ 2XAFA 1REPC 1EF4A 2DW4A 3DQVC 1LFPA 2OZ6A 2JA6J 3K4MA 4A3IJ 1JKRC 3W2AA 2M3AA 3BZCA 3P7NA 3HTUA 5IYDJ 3I4PA 4BUPA 4KFCA 1TQIA 4DW6A 3K2ZA 2CUZA 4KIFA 4L9VA 4I7HA 4C9YA 6PAXA 4ENKA 2VKDA 3VOEA 4IJAA 4U0VA 2CW8A 2VC1A 4UUSB 4RGUA 1Y8QB 2V1NA 4IX7A 2GBYA 3HL2A 4BXUA 2H27A 2ZFUA 2A5WA 2OC6A 4JX4A 1FMVA 4CCNA 2R7RA 1OPCA 4P9FA 3ZQGA 2OQGA 3FISA 1FNNA 5EJCA 2P6TA 1IN8A 4DQ2A 1YIOA 3HTSB 5IOYA 2A07F 1HKTA 2XGDA 2R93J 2IPQX 1TW2A 1P4XA 1LDKB 1IW7F 1VQOI 1ZLKA 3OL3A 3K4KA 4B44A 1WH5A 1XSDA 1G3SA 1E3HA 2CH0A 2DN0A 3E97A 1T38A 2Q8KA 3SEZA 1X1AA 3ECOA 1EH8A 4IQ4A 1W5TA 1JKOC 3U2RA 4BH9A 2TRTA 4Q4ZF 1ENHA 4F91B 1Z3YA 2VXZA 1RPWA 4HAMA 1MBKA 5DV5A 2LY2A 4PZJA 5JHFA 5F64A 2DDBA 2HXIA 3A2KA 1ETQA 3JW4A 3C18A 1OYYA 2L9SA 2Q0OA 2QQBA 1LVAA 1OCZH 2QQ9A 2MYSA 1A36A 4JBAA 2A6HF 1T0FA 1MGTA 3CJQB 3DBRB 4QWQA 2W85A 2Y31A 1VQ9I 1R36A 2XIGA 3G1LA 4JK1X 1P7JA 2NVQJ 3GLXA 2VI6A 4D7MA 4XN0A 3S2WA 3RTRA 3FXQA 4LB5A 3FMSA 2DODA 2ZKZA 4PJJA 1W0TA 2DYSH 4ZYAA 4UVCA 2NAZA 5L3FA 2HDDA 3W6JB 4BE1A 1GT0C 4S04A 1JGGA 1XDSA 4L9TA 3F8BA 1XC5A 1SFOJ 3G71I 4BACA 3X2QH 2JUGA 2ZNYA 3HC7A 3KEOA 3TP3A 3TQNA 4C3HJ 4I2OA 5DCFA 5FB2A 1LDJA 4A93J 2QYOA 3KLNA 2VUMJ 1Q1HA 4ZDLA 1QZZA 4EM0B 2ZSHB 3BLYA 1YG2A 2HDWA 3CLQA 4ZH4F 1UELB 4CYCA 3GZ5A 5B3SH 1DPUA 3BROA 2E5NA 3ULQB 2BBYA 5ILUA 2O03A 1YRNA 2PEXA 3DTEA 4M6YA 1G6NA 2GA1A 2P5VA 2BZTA 3ZRGA 4IHXA 1LE8B 2M45A 2MW8A 2O3FA 1JUPA 3HG9A 2PMZA 2DFIA 3F6VA 3IKTA 3G3ZA 2GXAA 3C2BA 2DOEA 5EEHA 3CMAI 3H5RA 4BJ5C 3IAS2 3QPSA 1SD5A 5CJ9A 2QKMB 4E7IA 3HRTA 2NS7A 2BGCA 1IJWC 2YU3A 1JHHA 2CWEA 3IH4A 1FBSA 4ZYHA 5JVTA 1PUFA 2H1LA 4KIGA 4CCMA 4M3FA 2F2EA 4S05A 2FQ4A 4KN4X 3BZKA 2JRMA 4KDPA 2YU9J 4M3GA 3GFJA 4BQQA 3GZNB 4IVNA 2KFDA 4G7ZF 3DXJF 4AVZA 2FOKA 1A5JA 1MSFC 1FZPB 3E5UA 1QHGA 2DPUA 1JXSA 5CVRA 3GLLA 2JVGA 4MIMA 1HQCA 3EUKL 3E7LA 4P55A 2PLYA 1U6GA 3IL2A 2HXOA 4BQNA 2DDAA 1HDDC 1XX5A 2D1HA 3TOBA 2ZJPF 4CZCA 3GEZA 4A3KJ 1FSEA 4IL6C 1F5TA 2ZCWA 3M8JA 1J75A 1G3YA 1HOMA 3V7RA 2Q1ZB 5B66C 5ICGA 2HYGD 1WJCA 3DPUA 3PNYA 1YX5A 1R4MB 1YYVA 3QPHA 2R7ZJ 3I4NJ 1BJAA 2AQEA 2RC4A 1FX7A 4KMFA 1P92A 1R4NB 3WGHA 2BY0A 3CJTB 2ADUA 4A3CJ 2L2OA 3KX2A 4CDGA 4MEXF 2WB1N 2KHMA 5D8LB 3JAMZ 2XPWA 3VYTB 5LLQA 1BIBA 3OS0A 2FBIA 3UKGA 2IA1A 1R5GA 3QU3A 3H35A 1ZREA 5BS6A 2CU7A 1WSUA 4Q5SF 4XKCA 2BV6A 1ITYA 4AD9A 5J3LA 1PP7U 4B09A 1Y39A 2O8XA 1ODDA 3ELKA 4AU7A 1CF7A 1JHFA 3F0CA 4HYEA 3CMYA 5D5WB 2M2EA 5E3OA 1IV6A 4KA4A 4B3AA 4AM3A 3RCOA 3DFGA 3KZIC 2FBHA 1HW2A 3PNTA 4A3FJ 5EDNA 2IS6A 1B1BA 1I50J 1MH3A 4XRSG 1IGNA 2V9VA 2W25A 1X4OA 4HDUA 4XKBA 3SZPA 3LNQA 2O61A 3QPTA 3GF2A 2DQLA 4YIRX 5DDGA 5DS9A 3WTTC 1YIJI 2XHKA 4DBQA 1Z67A 2FD5A 3BTCA 3FWEA 2KDOA 1EKEA 2QGUA 3L2WA 1QBJA 1QVUA 4A0XA 4F7ZA 5E17F 3G73A 3ZOBA 2W4SA 1GDTA 3BR0A 4XOPA 3IAM2 2W84A 3K2AA 4ZZLA 2OTJI 2EZLA 4ZDOA 4NC7A 2YX7A 2FEZA 4HA8A 2LH9A 2WV1A 3AG1H 3DTKA 5J4YA 1W4MA 5DYMA 1HF0A 3GZ6A 1UJ8A 2DI3A 1BR4A 5IP9J 2R5ZB 2VBXA 4BBSJ 2NNNA 4YELA 4ESBA 2Z99A 1SFKA 3TO9A 2D5VA 4ABZA 1JT0A 1FWZA 3P5JA 1KU7A 3BY6A 3F72A 2A3SA 2GWRA 3ZP5A 2EBIA 1SFUA 1W7PA 2KISA 1P2FA 3OYNA 4CO8A 2KIFA 2PMZN 2NVYJ 2BW3B 5EEAA 1WFXA 1JKQC 2EFQA 1U8RA 2YR2A 3D5RC 4MFEA 4ZTFA 4BE0A 4FCYA 2HKOA 5F27A 3S2DJ 3PUFA 1MJAA 4XICA 3GFIA 1ACIA 2VQGA 3PSFA 1Z21A 5LEJA 4HBLA 2CYYA 1FBUA 3VYUB 4HF1A 2XPUA 4MEYF 4H4KC 4I02A 3OYBA 2DMQA 2CJJA 1ZGJA 3WU0A 1X1CA 3R4KA 3FM3A 3IH2A 3V8KA 4IF4A 1MW7A 2M8GX 2WY8Q 2A61A 1TTYA 4EGYA 1IUFA 4LLNA 4UB6C 3FDYA 3W6KB 3S1QJ 3GTMJ 2HDCA 3LSRA 4OIQF 2Q2EA 4IHVA 2RREA 3CP8A 2JWTA 3DWLE 4HW0A 1D1AA 1S5LC 3GW2A 1U8BA 3DU6A 2O7OA 2GQQA 1Y56A 3I4MJ 2XAQA 4A3MJ 4MFDA 3AG3H 4FQGA 3CCJI 1Y8RB 3JRHA 4M9XA 2R3SA 2V1UA 2RNGA 3ECHA 2EZKA 5LGUA 2QF7A 3K9TA 5E18F 2YX4A 5HVQC 3B6CA 1YJWI 4BJTA 3DKWA 2JA2A 3S3OA 2E71A 1ZLJA 3LSKA 3J81Z 3EQLF 1WI9A 5HDGA 5HNFA 4V19K 3HSFA 2F5CA 1E2XA 1MZBA 2XB0X 3JRFA 1F4KA 3ZMZA 1XGNA 3QQAA 4I76A 3CC4I 3Q0VA 1A35A 4D1QA 1BA5A 4OIPF 4AVPA 2Y9ZA 4W1UA 2L0KA 3CO6C 2DFEA 9ANTA 3PNVA 1WI3A 4NDLA 3OSGA 1XS9A 1L3LA 1T98A 3FXMA 2L01A 2YS9A 4UUSA 3KFWX 2FA5A 1VQPI 2EIJH 2K4BA 4IZZA 1NHAA 2VT3A 2IGKA 2CV2A 3ABMH 5GTHC 1MNEA 1S7AA 5E3NA 2G7UA 4A3JJ 4XLAA 4CCLA 3COAC 4RMNA 2Y30A 3H36A 3CZ6A 3OYAA 5HLGA 2OV7A 4I98B 3CMMA 4C3JJ 1D0XA 2WAFA 2CUJA 2R5YB 1HKQA 2X85A 1BW6A 2NXNB 2QUFA 3K70C 3ZMDA 1P4AA 3R0AA 1G59A 1RC9A 2MC4A 5KK1A 1UG0A 5AIQA 5KVRA 4A0YA 1D5YA 3PO2J 4PCQA 3WU2C 2L5QA 2HVQA 4IHWA 4V2GA 2XRLA 3GTLJ 3HSEA 2R7WA 5IP7J 2ZMEB 1OJLA 1JGSA 3ZQ7A 3S8PA 5F6FA 1E3PA 3GTKJ 2EFOA 5DCMB 3VFZA 3BPXA 2MD5A 4KIBA 2K5CA 5FLXK 2HWVA 1R71A 1F9NA 2B0LA 2AXLA 2XAUA 4U87A 4D7NA 1YW9A 2JUCA 2XSJC 2DOAA 2VIXA 3CCRI 3D5LA 2JA7J 1ZTRA 3CCUI 1Z6RA 4IKFA 1H89C 2KRFA 3S17J 5HLIA 2XAHA 1F43A 4IRIA 2WBMA 2KP6A 1S6LA 5CKTA 2VOOA 5GADJ 4BGDA 3RKYA 3FKJA 2STTA 4GFBA 2F5DA 3VPRA 1ZRDA 3FK7A 3SQNA 3U1KA 1YJNI 3HOSA 4F55A 1GHCA 3CDLA 3TGNA 3WG7H 2EILH 1GXPA 1P7IA 1MMNA 4HRIA 3E3VA 4LIUA 5TISC 4RLFA 3TKYA 4IRGA 1ZYRF 1H88C 3BDDA 3FXUA 1TNSA 3J80Z 4XN3A 2VB6A 3HIFA 4NHJA 5TGTA 1FMWA 1WJFA 2LYCA 4H0EA 3BJOA 2E1MC 3HOZJ 3LSHA 1BBYA 1ETKA 4I09A 3BG7A 4U0WA 1SVMA 3HRSA 4XSXF 2JT1A 2KIUA 1XSVA 1FP1D 2WTEA 3C2HA 3SZGA 4S0HB 2VE9A 3HJEA 1IRFA 4PJLA 4WK8F 4N9IA 1JKPC 4XKVA 3ERED 2QWWA 4ZC3A 5EG0B 4Y3OA 2Z5UA 4YEJA 2E1CA 3Q3SA 5FKMA 2NOGA 1WRJA 3H3ZA 2ICWG 2K27A 2Z3YA 4E7SA 3LSPA 2J5PA 5KNLA 3L2QA 2R7TA 2FQ3A 3T8RA 1OCOH 1FTZA 1XPXA 3K69A 4II3A 1YFHA 1IDZA 5F0FA 4Y52J 2W24A 1J7KA 3V8JA 3ESWB 5FKKA 2RNJA 2VKHA 3FHNA 5HS7A 1HDPA 1WKMA 3DKYA 3SEQA 3JCUC 2QQAA 5D6FA 2ECBA 2ELHA 3F8MA 4RM3A 5JLXA 3LA7A 4XIDA 1C0WA 5L3DA 3DLLF 3BPVA 2FXAA 1R23A 5H2FC 1U5TC 3S2HJ 2VPLA 2E34A 4G9YA 5L3CA 4DYQA 5IT9Z 5D5UB 5IPAA 4RDUA 2VQCA 1U3EM 2UXXA 5KAFC 2BXZA 4AYBA 4WXCA 4D5CA 1KYWA 3G2BA 1MNDA 1MD0A 2M8EA 5C4JJ 2HVRA 1JUMA 4QLCU 5EF6A 4MQ9F 1EH7A 2ME0A 3B73A 3BTLA 3OV8A 4E7JA 3K10A 1YS6A 3PO3J 4HF2A 5HLHA 3RPUA 2NRAC 3Q5FA 4C2UA 3JAMK 4ESFA 2QZ8A 1BJZA 3GTQJ 1YHQI 5H6RA 1WJAA 1NK2P 2P4WA 3HPHA 3M8EA 2MLGA 4NC8A 4B48A 2BE5F 1SVLA 4EM2A 1KONA 1DU6A 2IXSA 5DEQA 1EJ9A 4LFUA 1WJDA 3L2RA 3WTZA 2LY1A 3KP3A 2W82A 1HKSA 3MMYB 3OYGA 2LREA 2I10A 1S72I 3B02A 2XC7A 1J5YA 1ZHFA 1OQYA 2IGNA 3HXLA 5GP9A 2HZDA 4IHTA 5CLSA 1IO2A 2HYFA 3PL8A 3QYFA 3SFIA 4EM1A 3MWMA 5ILVA 2IS4A 3E1SA 1BC7C 1XB4A 3CF2A 3FBNB 1JUSA 1WJBA 1APLC 1TQPA 4A3EJ 4IPAA 4XLCA 4M73A 4C3IJ 4EJUA 2ZMEC 1SD4A 3PFYA 5CVVA 2PI0A 1QZEA 4QPQA 3I56I 3IC7A 4YFNF 4RBOA 5LHHA 5FLMJ 3D5SC 4A0ZA 3FM5A 4FASD 1FYKA 1YQAA 2CO5A 2X6WA 4AIKA 2PJPA 5JFRA 2VBYA 2MABA 3OS2A 1B72B 4FE4A 2XROA 1X1BA 3MVPA 1OYIA 2XF7A 2GLOA 3H0GJ 1Y0NA 3CTAA 4L0ZB 3HUGB 2GAUA 2VXDA 1V5GA 1GLNA 3CUOA 4I99C 2ECCA 3HBLA 4E6KG 2Z2SB 5H6QA 1KGSA 3LL7A 1HSTA 5K5OA 1SEUA 5LEKA 1B4AA 4J01A 3OYCA 2K4JA 3ISPA 1QHHD 1U9NA 3QOPA 4DYRA 1BR2A 2HQ5A 3ONQA 1MJ9A 4M71A 3MEXA 3TOAA 3OYIA 3CCVI 3I54A 5A2QK 4Z6YA 2WB1A 1M1EB 1UG2A 1U2WA 2LTPA 3RPQA 4OAYA 5CVUA 3VDXA 1SMTA 3MFKA 2DLLA 3V7CA 5FRNA 1O3TA 2VONA 4U0YA 4RM2A 2X51A 2I8DA 4RB2C 2K85A 4KITB 5M3FJ 3E5XA 1XGSA 4ZZDA 3DEUA 2IGOA 1KU9A 5ILSA 2JJ7A 3PSIA 1O3SA 1PUEE 2G0EA 2XRNA 3HRMA 1VQ8I 4UNOA 3DLAA 2EB7A 1OMIA 2DT7B 1I3AA 1E17A 2LBFB 1Z05A 4E7KA 1ZG5A 3H92A 5J4VA 2LR8A 1BM9A 1MH4A 2GXGA 2R5ZA 1YITI 1ZH5A 4NUBA 1WPKA 2ESNA 1BOAA 1TT0A 3LSIA 4XNFA 2DA6A 1BOBA 4JYKA 1TWFJ 1QA6A 1TLHB 3M4OJ 1FLIA 3I64A 3IWFA 2YSRA 3OMYA 1POGA 3F23A 1ZRFA 2BW3A 3E0JB 3AG4H 4U88A 2CQKA 1HW1A 2K9QA 4P96A 1JI8A 5HDNA 5K5QA 3PJRA 2MSYA 3O3KA 5M5WJ 4N0BA 2XSDC 2JK3A 3J7AY 3DCFA 4XLNF 1Z0XA 2KRCA 2X0LA 3RJPA 3SJMA 4A2UA 5GAHJ 3KYDB 4ITVA 1TW3A 2IBDA 2IS1A 4I6ZA 2O0YA 3TW6A 3WTXC 2HS5A 5D8KB 2IT0A 3E6MA 3U9GA 4ZYEA 1SMYF 4AIDA 1TBXA 2H09A 2X6XA 2DA2A 4IXAA 1S7OA 5EEGA 3V8LA 4AYBN 1DUXC 3JR9A 3CC7I 2DJIA 3BR6A 4YIIA 1FYLA 4X1EA 3HOTA 3U21A 4LLLA 3R60A 4KUMA 3FF5A 4LG3A 2K3FA 2X48A 4A3DJ 3JTGA 1HCRA 1MDMB 5IOZA 1IN6A 3BJ6A 5HDKA 3L2CA 1A31A 2J5OA 4KICA 3C7JA 4O5VA 1VQKI 2ZSIB 1WGXA 3DPTA 2XKOA 4ZYGA 4PUSA 5AONA 5IYBJ 2M9HA 1YJ9I 2EV0A 2ZO4A 3JRGA 4PGGA 3GWZA 2PN6A 3S32A 4YRVA 1V3FA 4RGXA 3VYRB 1PDNC 5CPRB 2QKLB 3UR3C 3CUQC 3H5NA 5J1UA 3BG3A 2HPIA 2P8TA 2X9DA 5BPDA 3NQOA 1S29A 1R1VA 2CMPA 3WU1B 3GFLA 1AWCA 3ML6A 1JE8A 2V6EA 3G1MA 1R5HA 2R7SA 4L18B 3M7GA 3OWTA 4HF0A 4LITA 4D0PA 5B5EC 5K7FA 4V2FA 2P6SA 3GO5A 4RA2A 2TCTA 1FTTA 1IG7A 4II2A 4EMSA 2M5WA 2HVSA 3CMEI 4KMUX 4L5EA 1TWCJ 1GVJA 2P5LC 1Q1VA 4GYIA 4L9NA 3LAJA 1PJRA 4ZDPA 5IT3A 1Y1VJ 1ETOA 4UHTA 4QPOA 2F4OB 2FF4A 3CLOA 3QOEA 2ME6A 2W1OA 2WC2A 1WHUA 3RQ4A 2AO9A 3PFIA 2HFHA 1O57A 2FRHA 2KT0A 3P9CA 2BEOA 3OYKA 2R5YA 3EUAA 5F08A 1QQIA 4PDKA 3CCSI 2HTSA 4DJAA 3PIOF 5J8CA 2WA0A 3OIOA 1FJLA 1X1DA 4I01A 3S16J 2GIZA 3BP8A 4ENNA 2EFPA 2OBPA 3K0LA 2QCOA 2ZMEA 3W3CA 2O8KA 4WWCA 5K7ZA 5DCMA 2DQRA 5LRRA 1ZELA 5L3BA 5D5XB 1QPIA 2BY1A 3GTGJ 2ZC2A 4Q47A 3CD6I 1USTA 1YTYA 1YO5C 3FXJA 1G3TA 1YX3A 4W97A 3IV5A 5ICEA 2VPRA 2E19A 3CQZJ 1X3WB 3ZXSA 3K7AJ 2BHZA 1OCTC 5JVGF 1DQUA 2DFFA 1FPQA 4GRIA 5LHGA 4OU0A 4FX4A 3Q0UA 2A6TA 2DMPA 3RKWA 3VYSB 4ENMA 4ZJZA 5FKLA 2DAOA 2DA7A 3K1MA 3AG2H 2K7LA 3QU6A 1ETYA 4BU2A 2L4MA 1BIAA 3SYTA 4BS9A 2QSHX 1TC3C 1I27A 1K6YA 2HNHA 1IN7A 3GTPJ 5FD5A 1BL0A 1QO0D 1QRYA 5GPCA 2AXTC 4D9JA 4HDVA 1CQTA 1HC8A 2CQ7A 3K4BA 5GAEJ 4NB5A 2KKOA 3I9V2 1KZHA 4IOCF 2L7MP 3EUHC 3KEYA 2CW7A 2Y75A 1Y0UA 1SAXA 4M74A 1QGPA 1YW8A 2JZYA 5EG0A 3HZJA 2Y0SN 3A1YA 1FEXA 1OCRH 4BHBA 3HHHA 1G3WA 1R7JA 3GFMA 3CJNA 1ZARA 3EETA 1J09A 1AA7A 3V7SA 2F5VA 3OYFA 4IHYA 3J7YJ 5DD8A 1B8IB 1LFBA 1A6IA 2EK5A 2VBWA 2M7AA 1SAUA 3FHZA 1ZRCA 1WH7A 1HXDA 1I1SA 5HS8A 3KZYA 4DGWB 2BVMA 4FT8A 5E8GA 1AHDP 4DZJA 5KCMA 3A01B 3ZMVA 1Y1WJ 2BYVE 1USSA 2ETHA 5F1RA 2FBKA 3QODA 4HEA2 5B1AH 5C4XJ 1RUOA 2TDXA 2YUSA 3HRUA 3OR1C 1IZ1A 1NH3A 3H9JA 2GZWA 5ERIA 2EV6A 4U7DA 4RB3C 2ELJA 2GOXB 1UB9A 3KEQA 1OYWA 4BAYA 3G6EI 3HM5A 4F93B 2E35A 2V6CA 2UUZA 1TQMA 2ELKA 2VL8A 5LD2C 3QYEA 3VEPA 4OAZA 3OOPA 1K83J 1FC3A 3SHFA 1XSXA 3KLOA 4MQVA 2IW5A 4PJNA 3LWFA 4E4HA 2KMUA 2E1MB 2LDUA 4A3GJ 3VSKA 3P9IA 1VQ7I 3O2PE 1MJBA 2CFOA 2Y2ZA 3IRRA 2VKVA 1WJEA 4AIHA 1K4SA 3ABUA 4QSHA 5D5VB 5FRMA 2M4KA 3CESA 3R6SA 3S3MA 3I55I 5BMZA 2V1DA 3F3XA 4WXHA 5EGOB 2Z16A 4FX0A 4C2MJ 1FIPA 4AIJA 1N25A 3HHGA 3O8HA 1JT6A 2X6YA 3E6DA 3RPUD 5FROA 5J1YA 1J2XA 3CO7C 2ZJRF 4BXXJ 3T1BA 1BI1A 2E5ZA 4G12A 2VQHA 4FE7A 3HEFA 3HYIA 3WHBA 2K02A 3BZ6A 5J1RA 3BG6A 3W2VA 4AC0A 3SFZA 2FUG2 3WE3A 4YFXF 1RR7A 1F36A 1B72A 1U5TB 4JOMA 3QAHA 2JA5J 4HNVA 1UMQA 4MLOA 1V5EA 5DD4A 1AKHB 1KQ8A 5EZHA 4NBQA 2NVUB 3TEDA 3NRVA 3MZYA 1V5FA 3BQYA 3P9KA 3ZR8X 2C6YA 1J9IA 4OIRF 2HEOA 2P5KA 2Y69H 2OCEA 4HQMA 2EH3A 2NS8A 2L7KA 5CQEA 5BNGA 2EV5A 2L9RA 4KN7X 2LK2A 3DU5A 1YE9A 4ENJA 3ZMTA 3RDIA 2V9KA 5HLTA 2K86A 3MCZA 3ZQQA 2R7QA 3BR2A 1K7AA 2JVHA 4G6DA 2NYXA 3DP7A 1X2NA 2X1CA 4G94A 2ACJA 2RVCA 4HNTA 3OR2C 4E7HA 2BVLA 5DUIA 2OD5A 1R58A 1QPMA 1S8NA 4E7ZA 2A05A 2KZVA 3CDIA 3HPGA 1IN4A 4E70A 2LBFA 3HOYJ 3DKXA 2MD0A 1XTAA 3H9QA 3CCMI 2IA0A 1NG7A 2LKXA 3TW7A 2M0MA 2DBBA 1MKMA 5JR3A 4CA0A 2F4MB 5E1XA 2V79A 5K5RA 2B9SA 1DP3A 1FOXA 3FXKA 3KP5A 2VJJA 1T2KA 1KU3A 2CUFA 3M07A 2NNYA 2LP0A 4BEHB 4CUGA 1K4TA 1T0FC 1KQ9A 2EIMH 2G7HA 1SD6A 1DGWY 4U7BA 3K1PA 5ICCA 2CGPA 3F21A 1W36D 2HKXA 2PFBA 4A3LJ 1FIAA 1WCMJ 3HDDA 2JPCA 3FK6A 1XN7A 4EV0A 2QEXI 4JP0A 2IS2A 4XRSA 2MA3A 3KE2A 3CF5F 2BY3A 3L00A 3MQ0A 3WODF 5L3GA 2LF7A 4MNUA 1B9NA 1F1ZA 3C3WA 3RKQA 2K9NA 3QP6A 3QYBA 2P0WA 4BE2A 1OKRA 4RLQA 2HPMA 4DYCA 2ZXIA 4A5NA 4DOZA 2KRHA 1IXRC 1LJ9A 3VSLA 3ZQCA 1PP8F 1V4RA 1VQ6I 4BQAA 4HOBA 3K1NA 4MTDA 3BR5A 3REOA 2LKSA 3NAUA 1LE8A 1HW5A 4F92B 1U0JA 2HYJA 3PQKA 4XOTA 1TWHJ 1MMAA 5E1WA 1MDMA 3L7WA 1KU2A 5CVIA 4WCGA 3CCLI 1S3JA 2RQPA 3BOQA 3AL0B 3DTIA 1U78A 2HI3A 2DJNA 4IOAF 1Z9CA 1TL8A 2HQNA 2IGMA 1R00A 1ZKGA 1S7EA 2PQ8A 2F6CA 5KHDA 5LGNA 2MH2A 4R79A 3EPZA 3CCEI 4A6DA 4EEFG 1FBQA 2HQRA 2JRTA 3Q9VA 4ANJA 4RGRA 3ZMUA 3S14J 2R7FA 1YLFA 4XLEA 3QRFF 3MZ8A 2L4AA 3MKWB 2H1KA 3F8NA 2KJBA 2R7OA 2JN6A 3GVAA 5M3MJ 4B4CA 2IJLA 4EVIA 5IYCJ 3MN2A 5LFAA 4EJVA 1MMGA 4GGGA 5LHIA 4UUVA 2CUEA 3WTUC 2MG4A 4XMYA 2X1DA 4ETSA 1KYZA 2VJ4A 2FMYA 4GXOA 1X3UA 3CC2I 2DOFA 3M1EA 2VE8A 1YW7A 2A6EF 2XVCA 3I0TA 4OWRB 3RYPA 1K79A 4KJZA 1LEBA 1LEAA 1J59A 3IUOA 2LRDA 1B59A 3DBLB 4YIFA 3DPLC 2E2JJ 3MKLA 2DPDA 1Z1DA 4LIVA 2JPBA 2M7BA 2XDVA 1ZAOA 1IAWA 1ORKA 2JMWA 3BC8A 2JA8J 1TZLA 4C2TA 1IRZA 1XD7A 2XB5A 3JSPA 3CCYA 1IRXA 2CW0F 3ZQHA 1ERDA 4BQOA 2BY2A 2V26A 5FKNA 4A69C 1ZGWA 4P9UA 4ZTJA 3WTVC 4L5IA 2OZUA 2HOEA 1BC8C 1I1GA 3M9AA 1A04A 3WGGA 3ABLH 1ZN2A 4LK0F 3CUQB 4G6QA 5ICFA 4CCKA 4XLPF 1FYMA 5FO5A 3GUDA 4WX9A 2QA4I 2H8WA 1LUJB 4LGWA 3Q0WA 2NVTJ 4YFKF 1KQ0A 3CCQI 1U9OA 1GV2A 1B6AA 1MMDA 2DA3A 2FMLA 1Z6TA 3GTJJ 3OL4A 3RKXA 4KYWA 1RKTA 1RI7A 1X19A 3J7AO 4LMYA 3WE2A 4EQQA 3RYRA 1FSHA 1I39A 1O3RA 1D5VA 3OYLA 2VKEA 3KPHA 1LKXA 4EJTA 2FU4A 1O4XA 3G4SI 3ABTA 1QU3A 4XRMA 3BJAA 4F52A 3LQRA 4IEJA 5L3EA 3A03A 2DA4A 2P7CB 2NVXJ 2VASA 5AIPA 2X1EA 3H9GA 3B6AA 3KCCA 4IRHA 4N4OB 2H8RA 5F0HA 1KA8A 4A6EA 5B1BH 4XQFA 4GCVA 2R7DA 4CCOA 3HB9A 4B3XA 2PJRB 2K3PA 2H94A 1T56A 2CQXA 3OSFA 4EATA 1WWXA 5KAIC 4ON0A 4HX8A 3AL0C 3CDHA 3PM1A 1IV8A 2WY7Q 2HZTA 4RB0A 2XKPA 3M3YJ 2F5FA 4L0YB 3OYHA 2L02A 3NARA 4UXNA 1XMKA 2R4GA 2NS0A 3EDPA 3K4JA 2R7VA 5FLVA 5HODA 5K7HA 4XL9A 4QTRA 3IRQA 1B8IA 2DT5A 2DK8A 3KP4A 1Z3XA 1IUYA 1BI2A 1TT5B 2LLKA 2OAZA 2P7VB 3D0SA 4F3QA 3LSMA 3A01A 4M6VA 2B63J 1FOWA 5E1ZB 2M0CA 4B47A 3SXYA 3ZCOA 2DMNA 3OYJA 3BG5A 1LB2A 4UV9A 2O5RA 4HV5A 1VQNI 1WZ2A 2EIKH 3FXLA 2N8GA 3IP4B 2MFZA 3O6BB 3R61A 3HOWJ 2DT6A 3FBIB 2Z1DA 1W7PD 4O6JA 2ZXJA 5LGTA 5F0CA 5C3EJ 3L2UA 5DM7F 2KQRA 3LSTA 4LG0B 1X3ZB 4KISA 2JTVA 4B8XA 3WTSC 2Y0SA 2CRGA 4M3DA 2LMDA 1T95A 3BCAA 5FLXZ 1JJ8C 3MKZA 1IRGA 1DDNA 2ZXHA 4G6TB 1MBEA 2K9SA 2ZXWH 4FISA 2CV0A 3H3UA 1R9TJ 3KYLA 4B1RA 3BR3A 2KIMA 1GVDA 4PSWA 3J81K 3I59B 1UFMA 5HOOA 1AU7A 3NWTA 5EGOA 1LNWA 1CGPA 4NQWB 1H9GA 1ETVA 2DTRA 4XKWA 2EFWA 4RGSA 5D6EA 2QBYB 3LAPA 1RIOH 2X6OA 2UXNA 2COMA 4EJWA 3VB2A 1OR7C 4XR6A 2E60A 1Z7UA 2ZJQF 2GXBA 4PFOA 3ZN1A 1R5ID 1IDYA 4BDZA 2DA1A 2E2HJ 3TO6A 1MIJA 4XSZF 5GAGJ 2IAIA 5TJJA 2W48A 2PMHA 2L9VA 2LVSA 3F6OA 4OMYA 3GX4X 4HPQA 1O3QA 3H0DA 4BNCA 1U5TA 2YPRA 2IEKA 3UNGC 4DNCA 3OYDA 1XGOA 2NOJB 4CCJA 1JJ6C 1YOVB 1OLTA 4ASNA 1P9QC 3L2VA 2ID6A 1X2MA 4K2EA 2UZKA 1LQ1A 2BXYA 3SDBA 2ZB9A 3D1NI 4LB6B 2KL4A 3TDZC 4MO7A 2EINH 1I3QJ 3LA2A 3PUBA 2XV4S 1AKHA 2OPTA 4E7LA 3S1NJ 4RAGA 1VF9A 4IHSA 5JI6A 1IN5A 4P1WA 2BHYA 2OF7A 3S1RJ 3M8FA 2WADA 2L9NA 1TWAJ 4RB1A 4Q48A 2ID3A 2STWA 2XF6A 4HZFA 2RAEA 3ASOH 3K6GA 3MAJA 4R1HA 4M6XA 1D8JA 3DF8A 3FIWA 2M4GA 1GV5A 1PYVA 2E36A 3LA3A 4GO1A 5DM6F 2V4JC 5J6XA 4XLFA 2MH9A 5DTDA 1BI0A 3BR1A 3F9KA 1E3OC 2EZIA 2JSPA 4CSWA 4JX5A 2CQQA 1H8AC 1G8XA 4LJZF 1ZG1A 2QENA 3FZVA 1R22A 3T5XA 4A5MA 2L54A 3I71A 3JRBA 1W5CC 4YG2F 1FOYA 4RS8A 1Z77A 2HTJA 3TP0A 5IP6A 1RRJA 2GM4A 1WQ2A 5E20A 4Y17A 2K9LA 1K78B 2DXIA 2OQRA 2VN2A 2R7UA 3KP6A 4Y7NJ 3RZOJ 3S1MJ 2AHQA 1SANA 1I6HJ 1ZG3A 3HOXJ 4HV6A 2OJED 4R8HA 3JRAA 5EYRA 3J80K 1OCPA 3SDGA 1GUUA 1ZGAA 2JSCA 4M9ZA 1T8IA 4OMZA 4BEHA 1T6SA 2P81A 4PFPA 4HLXA 3N97A 4OIOF 2UV1A 1WJ5A 2MC3A 1QNTA 3OS1A 4BXFA 2K9MA 3TL4X 3ZGKA 4UY8I 2FNAA 3FXOA 1X1PA 5M5XJ 1VQLI 2O6GE 3TMOA 2Y9YA 3A0BC 1XMAA 1ON2A
chains in the Genus database with same CATH topology
3ZR8X 4E7JA 4BE1A 4B43A 3K10A 4BACA 2JUGA 4C2UA 3HC7A 2L7KA 5CQEA 4KT6A 3DU5A 1YE9A 1WJAA 3HKZA 1D0ZA 3HPHA 4B48A 4NC8A 2V9KA 5HLTA 1KONA 2WAEA 4J00A 2IXSA 3ZQQA 4X0GA 2R7QA 4ZDLA 1WJDA 3H5AA 2JVHA 2ZSHB 3L2RA 3BLYA 2HDWA 2X1CA 1UELB 2LY1A 3MMYB 2W82A 1BR1A 2E5NA 3OR2C 2LREA 4HNTA 3OYGA 4E7HA 2BVLA 2XC7A 3DTEA 2IGNA 3HXLA 3ZRGA 1E0EA 2HZDA 3PL8A 3QYFA 4E7ZA 3HG9A 2KZVA 2IS4A 3OYMA 2PMZA 3E1SA 3HPGA 2LBFA 3CF2A 3FBNB 3OIQA 1WJBA 3DKXA 2LC2A 2MD0A 3H5RA 3H9QA 3IAS2 4BJ5C 4XLCA 1NG7A 2M0MA 2QKMB 3PFYA 4E7IA 4QPQA 2R7XA 4CA0A 3D5SC 4FASD 1DP3A 2X6WA 4XORA 4CCMA 4JQFA 2MABA 3OS2A 2VJJA 1X1BA 4BEHB 4CUGA 2XF7A 1T0FC 3HUGB 3OIPA 4BQQA 2VXDA 1V5GA 1DGWY 4U7BA 1GLNA 4AVZA 4E6KG 2Z2SB 1W36D 3LL7A 1QHGA 4J01A 3OYCA 1QHHD 2JVGA 4CH7A 1BR2A 3ONQA 2IS2A 3EUKL 3OYIA 4DBRA 2KLOA 1N78A 2WB1A 4BQNA 4PK4A 4OAYA 3VDXA 3CP2A 4CZCA 5FRNA 3QYBA 2P0WA 1D1CA 4BE2A 2CV1A 4RM2A 2X51A 2I8DA 4RLQA 2OUMA 2HPMA 3M8JA 4KITB 2ZXIA 2Q1ZB 3NWSA 4DOZA 3AFHA 2KRHA 3DPUA 1WJCA 3VSLA 2IGOA 3PNYA 1YX5A 2CS3A 3PSIA 2AQEA 3GBGA 1EA3A 4F92B 3DLAA 2L2OA 3KX2A 4Y33A 2DT7B 1U0JA 4XM3A 4XOTA 2KHMA 1MMAA 2LBFB 3MD2A 4E7KA 3VYTB 3AL0B 3DTIA 1HA8A 3OS0A 3S93A 3K4CA 2IGMA 3H35A 4P5OA 4NUBA 2F6CA 3LSIA 1TT0A 4XKCA 5KHDA 4XNFA 2BOLA 2HQAA 1BOBA 4R79A 3EPZA 2AQFA 2RQQA 4ANJA 4AU7A 3OMYA 4XLEA 2BW3A 3E0JB 3MKWB 2WAQA 2R7OA 3RCOA 1JI8A 3PNTA 3K4LA 3PJRA 2IS6A 4HSTA 2V7FA 3LSGA 5LFAA 1MMGA 3OOUA 5CQGA 3J7AY 1X4OA 4XMYA 2KRCA 2X1DA 4XKBA 3I3LA 2VJ4A 4ITVA 2IS1A 4NNJA 4DBQA 4OWRB 1LVKA 4DIQA 4KJZA 2X6XA 3IUOA 2LRDA 2KDOA 3L2WA 3DPLC 2W00A 3DEEA 2VJ5A 4XONA 2DJIA 2W4SA 3HOTA 3U21A 4XOPA 3MKYB 3IAM2 2XDVA 2M7BA 4LIVA 4PSXA 4LG3A 4ZDOA 2PJRA 4NC7A 2LH9A 3TBIA 3DTKA 3BC8A 3CJRB 1TZLA 4C2TA 1D0YA 4HNUA 1R6RA 3K4NA 1BR4A 1IRXA 1ERDA 4HSRA 2V26A 4BQOA 4N4NB 4YELA 2ZSIB 1SFKA 4ZTJA 1W36C 3DPTA 4PUSA 3S32A 4YRVA 2LOOA 3VYRB 4CCKA 3K70D 3S3NA 5CPRB 3OYNA 2QKLB 3UR3C 1N75A 3H5NA 2HPIA 2BW3B 1WFXA 1MMDA 4IQJA 1D1BA 1NG6A 3OL4A 1X19A 2CMPA 3D5RC 4BDYA 4ZTFA 1VZ0A 2V6EA 4BE0A 2R7SA 3OWTA 4LITA 3OYLA 2VQGA 3PSFA 1Z21A 3N05A 1LKXA 4II2A 3VYUB 3OYBA 1QU3A 4H4KC 2HVSA 2UWMA 4F52A 1X1CA 1MW7A 2VASA 2WY8Q 2X1EA 3H9GA 1PJRA 4ZDPA 4N4OB 4QPOA 3QOEA 2VJIA 2W1OA 3RQ4A 3FDYA 3C2GA 4XQFA 4CCOA 4B3XA 2PJRB 3OYKA 2RREA 3CP8A 3EUAA 3DWLE 2K3PA 1D1AA 3W2WA 4DJAA 4EATA 3OY9A 3DU6A 2WA0A 3VWBA 1X1DA 1Y56A 3AL0C 2WY7Q 4BJ6C 4C30A 3OYHA 2R4GA 2HU9A 2RNGA 3K4JA 2R7VA 4XL9A 5HVQC 2KPMA 3AKZA 3W3CA 1Z3XA 4BJTA 1X4PA 2JA2A 4F3QA 3S3OA 3LSMA 1ZELA 3LSKA 5HNFA 1Y6IA 2GOMA 4B47A 3ZCOA 3OYJA 2O5RA 2F4IA 2XF5A 1YX3A 3IP4B 2MFZA 2DT6A 3FBIB 2Z1DA 4D1QA 2VLAA 4PJMA 3ZXSA 3L2UA 3PNVA 1DQUA 2KQRA 4GRIA 3A4CA 4KISA 2A6TA 2Y0SA 3VYSB 4ZJZA 1DGRM 3RSNA 4IZZA 1T95A 3BCAA 4BU2A 2IGKA 3SYTA 4BS9A 1N77A 2CV2A 3MKZA 1MNEA 1K6YA 2HNHA 2ZXHA 4XLAA 4G6TB 4CCLA 2CV0A 4RMNA 2W7NA 3CZ6A 3OYAA 4D9JA 3KYLA 2OV7A 3V42A 3CMMA 1D0XA 2WAFA 2CUJA 2Q2EB 3K4BA 4PSWA 2X85A 3I9V2 4Y4RA 3EUHC 4XLHA 5HOOA 2LG4A 3KEYA 4HG2A 3NWTA 2CW7A 3K70C 3M1CA 1S9HA 1G59A 2MC4A 4BL0B 4NQWB 1UG0A 4XKWA 3A1YA 5HNHA 3LFUA 3OYEA 2L5QA 4FETA 3LMMA 2HVQA 1J09A 1OR7C 1AA7A 4XR6A 1Z7LA 2F5VA 2VQLA 3OYFA 2E60A 2R7WA 2M7AA 4PFOA 1SAUA 4BDZA 3S8PA 4DGWB 2BVMA 5KCMA 3BCBA 1UAAA 2K5CA 2DCEA 2XAUA 3QODA 4HEA2 4U87A 4HPQA 3DQVC 3H0DA 1LFPA 2XSJC 3UNGC 2DOAA 3OR1C 3OYDA 2NOJB 2VIXA 3K4MA 4CCJA 1OLTA 3D5LA 1P9QC 3L2VA 2M3AA 3W2AA 3H9JA 4IKFA 3SDBA 4BUPA 2KL4A 2ELJA 2GOXB 3PUBA 2CUZA 2WBMA 2KP6A 5CKTA 4C9YA 4BGDA 4E7LA 2VKDA 3FKJA 4F93B 4P1WA 2CW8A 3HOSA 4F55A 2UUZA 2WADA 2L9NA 2V1NA 4IX7A 2VL8A 3HL2A 5LD2C 3QYEA 2ZFUA 1MMNA 4HRIA 2A5WA 2OC6A 4LIUA 4OAZA 4RLFA 1FMVA 2XF6A 4CCNA 4E4HA 2R7RA 4PJNA 3K6GA 2KMUA 2E1MB 2VB6A 4XN3A 5TGTA 3VSKA 2M4GA 1FMWA 1PYVA 1WJFA 2LYCA 2V4JC 2CFOA 2E1MC 4XLFA 3LSHA 1WJEA 5FRMA 3BG7A 2M4KA 3CESA 3F9KA 3S3MA 3C2HA 2JSPA 3SZGA 4CSWA 1LDKB 1G8XA 4PJLA 2Z16A 4XKVA 3OL3A 3K4KA 4Y3OA 4ZC3A 4B44A 4YEJA 2CH0A 2X6YA 3RPUD 3SEZA 1X1AA 5FROA 4E7SA 4IQ4A 2E5ZA 5KNLA 3L2QA 2VQHA 2R7TA 4F91B 1Z3YA 2VXZA 2LY2A 2K9LA 3BG6A 4II3A 3W2VA 2DXIA 2R7UA 5JHFA 2FUG2 3A2KA 2VKHA 3FHNA 2L9SA 3DKYA 3SEQA 2MYSA 4RM3A 3CJQB 4BEHA 4PFPA 4JOMA 2UV1A 1WJ5A 2VPLA 4MLOA 3OS1A 1V5EA 4BXFA 2VQCA 4XN0A 2K9MA 3RTRA 3TL4X 3ZGKA 4AYBA 4PJJA 3G2BA 3TMOA 1MNDA 4ZYAA 1V5FA 2HVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHD A;  2MC4 A;  4OAY A;  4OAZ A; 
#chains in the Genus database with same CATH topology
 2KJC A;  4L5J A;  4Y13 A;  4CXF A;  3MZH A;  2ZFW A;  2ISZ A;  4B43 A;  3LFK A;  3GTO J;  3ABK H;  1VFC A;  1IC8 A;  4A3B J;  2RN7 A;  2D45 A;  1XGM A;  1MSE C;  3HGY A;  1P4W A;  4KT6 A;  1MBH A;  3TDU C;  3O8G A;  3HKZ A;  1D0Z A;  4G7O F;  4IO9 F;  4J00 A;  2WAE A;  4X0G A;  3ZQI A;  3H5A A;  4UUT A;  3FKI J;  1WVR A;  2FOW A;  1BR1 A;  1R1T A;  4LD5 A;  1EV7 A;  2AS5 F;  3A0H C;  4BKX A;  2PX9 A;  1E0E A;  5A2Q Z;  5IT9 K;  1D3Y A;  3BQZ A;  3OYM A;  1K6O A;  3HOV J;  2ESH A;  3OIQ A;  2XAS A;  4M3E A;  2LC2 A;  3IKV A;  4PJ0 C;  4AWX B;  2XAJ A;  2R7X A;  1RET A;  3BWG A;  1STZ A;  3FX3 A;  1DU0 A;  3WTW C;  1UCR A;  1ZQ3 P;  4JX6 A;  4XOR A;  1D8K A;  4JQF A;  1SVO A;  1SFE A;  2HR3 A;  4AUX A;  2B7E A;  4I0A A;  5HS9 A;  4BY7 J;  1PVE A;  1G4D A;  3OIP A;  1VQM I;  1AOY A;  1O7F A;  2LFB A;  4PGH A;  1R49 A;  1XMX A;  1UHW A;  1DP7 P;  2EA2 A;  1EH6 A;  2EWN A;  4CH7 A;  5K1Y A;  3KIO A;  5EZG A;  2DK5 A;  2E7X A;  4DBR A;  1OIS A;  3KP2 A;  2FNP A;  2KLO A;  1N78 A;  5F04 A;  4BHP A;  3WG9 A;  4PK4 A;  4I0B A;  3CP2 A;  1D1C A;  3I58 A;  1QVT A;  1X58 A;  3IH3 A;  4HLY A;  4FTH A;  2CV1 A;  3TO7 A;  1XCV A;  5IY5 H;  5BOX A;  2OUM A;  3JRI A;  2H6C A;  4BYY A;  1O7L A;  3F22 A;  3NWS A;  3AFH A;  1MMS A;  5FD6 A;  2E1N A;  5E79 C;  2CS3 A;  3QWL A;  2CFX A;  4CYC B;  4BY1 J;  1VQ4 I;  2MLK A;  2R92 J;  2COB A;  1YRN B;  3GBG A;  2HOT A;  1EA3 A;  3S15 J;  5D4S A;  1VI0 A;  4Y33 A;  2Z9O A;  4XM3 A;  1OCC H;  3MD2 A;  1H9T A;  4DZP A;  5D4R A;  2EQR A;  3GCM A;  1HA8 A;  2W57 A;  3S93 A;  3K4C A;  1B9M A;  2DMU A;  3KP7 A;  2QM3 A;  4P5O A;  4BBR J;  1Z91 A;  2K40 A;  3JTH A;  3L09 A;  1OR7 A;  2BOL A;  2HQA A;  5E3L A;  4CYD A;  1PUF B;  2IA2 A;  1K61 A;  1IXS B;  2AQF A;  2RQQ A;  3CUQ A;  1ON1 A;  2RDP A;  3HUG A;  2XAG A;  2D2W A;  4XRF A;  5J8F A;  1NK3 P;  3KZZ A;  1IF1 A;  4CZZ A;  5F1J A;  1ZK8 A;  3Q9S A;  2LF8 A;  3FMQ A;  5CVJ A;  2WAQ A;  2LY9 A;  2RKH A;  2KZG A;  2GIV A;  3K4L A;  5JHU A;  1FP2 A;  2ISY A;  2VC0 A;  1TNT A;  4HST A;  4Y15 A;  2V7F A;  3LSG A;  1ULY A;  2L7F P;  3FMR A;  2Z33 A;  3OOU A;  1MBJ A;  1RZ4 A;  2EFN A;  5CQG A;  3JRE A;  5E3M A;  1UHM A;  2IRF G;  3I3L A;  2A5Y B;  2EJR A;  3ZN0 A;  1BW5 A;  3ZPL A;  1YS7 A;  4KNY A;  2DA5 A;  1T08 B;  4M3B A;  1P6R A;  1R1U A;  2LSO A;  4NNJ A;  2FX0 A;  1T39 A;  1LVK A;  4DIQ A;  2E7W A;  1H0M A;  3HOU J;  1RUN A;  2ZNZ A;  2DU9 A;  2W00 A;  2GA2 A;  3DEE A;  3F8F A;  2VJ5 A;  4UB8 C;  4XON A;  2FJ1 A;  4M9S A;  1SD7 A;  4LK1 F;  3GME A;  3MKY B;  2PMU A;  2HOS A;  2L3D A;  5FFZ A;  4PSX A;  4G7H F;  2CG4 A;  2PJR A;  1JTX A;  3DBH B;  4MTE A;  3TBI A;  3RZD J;  1J0R A;  3CJR B;  1VQ5 I;  1D0Y A;  4WXD A;  4RAZ A;  4HNU A;  2QSF X;  3JSO A;  3E5Q A;  4LLG F;  3HKZ N;  1R6R A;  2XUB A;  3NEU A;  2ZBK A;  3K4N A;  4UVA A;  5TRD A;  4CGZ A;  4HSR A;  4N4N B;  3L9F A;  4D5F A;  4NC6 A;  2HOA A;  1W36 C;  2DO7 A;  5LRS A;  4RAF A;  1GXQ A;  2DFH A;  1XG1 A;  4HX7 A;  1ONV A;  2A68 F;  3QP5 A;  4OIN F;  5H20 A;  2LOO A;  4EJO A;  3VOD A;  1CF7 B;  3K70 D;  3S3N A;  2CQN A;  3PIP F;  2R0Q C;  1N75 A;  3E6B A;  5BPI A;  3A02 A;  3F8C A;  5M5Y J;  3LSJ A;  3KET A;  1D1B A;  1NG6 A;  4IQJ A;  3WTY C;  3PQJ A;  5ED4 A;  4BDY A;  2VOD A;  2H6B A;  3T8T A;  1VZ0 A;  2DYR H;  2KIQ A;  2XGX A;  2D1V A;  1TP4 A;  2OTL I;  3HSR A;  1ZR2 A;  4KT5 C;  1RES A;  2VOP A;  3N05 A;  3L1P A;  3N4M A;  1BN5 A;  5BQT A;  4LG0 A;  1TWG J;  3ZQL A;  1OFC X;  2UWM A;  1ETW A;  4MHG A;  1FOK A;  2IP2 A;  3T0Y A;  1T33 A;  2PBI A;  2V1X A;  3AAF A;  3G1O A;  2QSG X;  1SFX A;  2RV8 A;  1RKW A;  4OOI A;  1IXC A;  1JTY A;  2VJI A;  1W5S A;  2G9W A;  3C2G A;  4UVB A;  4RAY A;  2EPF A;  4GDF A;  3EUH A;  1HLV A;  1G2H A;  2KDZ A;  4Z2Y A;  3WGI A;  1VTN C;  4G8X A;  3I59 A;  2X4H A;  3ROU A;  3W2W A;  2F48 A;  2EZH A;  3RIR A;  3OY9 A;  2L7Z A;  2VT2 A;  3H3V K;  3VWB A;  5C44 J;  1XDU A;  3IWZ A;  4NQW A;  4BJ6 C;  5J47 A;  2O9L A;  4XBF A;  2QBY A;  2HGC A;  4FHT A;  4WF2 A;  4C30 A;  3V4G A;  2OA4 A;  1BI3 A;  4ZYD A;  1ZR4 A;  2JQ7 A;  1DPR A;  2HU9 A;  1SC7 A;  1V54 H;  4L9J A;  4CHU A;  3ASN H;  1MBG A;  4UV8 A;  5FJ8 J;  3ZMS A;  3WHC A;  2KPM A;  3AKZ A;  2QQ8 A;  5E8I A;  1W7P B;  3W6V A;  1MBF A;  1X4P A;  3DV8 A;  3U1D A;  2FSW A;  3GXO A;  3SZT A;  4CIC A;  1LPQ A;  3QPL A;  1I6X A;  1L0O C;  2PG4 A;  2M87 A;  5FKO A;  1Y6I A;  2GOM A;  2ZJ2 A;  4BHC A;  2QVO A;  3I53 A;  3J7Z I;  2F4I A;  2VBZ A;  3HGG A;  4ESJ A;  2F5E A;  2XF5 A;  3FXR A;  1RNL A;  2VLA A;  1XCB A;  3BTI A;  3BTJ A;  3H1C A;  5GPA A;  4PJM A;  3JRC A;  3BT9 A;  3DEW A;  1W0U A;  2OU2 A;  3R0J A;  3BG9 A;  2MBF A;  4XK4 A;  1A6Q A;  1VND A;  1W1W E;  2DMT A;  2QLZ A;  5DUK A;  4J19 A;  4O3M A;  3KYC B;  3A4C A;  5FGM A;  1LDD A;  4QIW N;  1FT9 A;  2RGV A;  4EGZ A;  1DGR M;  3RSN A;  1HSJ A;  2XPV A;  4N9H A;  1HBX G;  4M72 A;  2WAQ N;  1ETX A;  1FY7 A;  5CYV A;  1N77 A;  1UHS A;  2CSO A;  3ZQF A;  5LBQ A;  2E1O A;  2A69 F;  1MNM C;  4GYG A;  2W7N A;  1RR8 C;  3I5U A;  3C1D A;  2M30 A;  3V42 A;  2WWY A;  1QZY A;  2I5U A;  1UZC A;  3IHU A;  1V55 H;  2Q2E B;  1NTC A;  4Y4R A;  1LFU P;  1I5Z A;  4XLH A;  2LKP A;  4TV7 A;  2LG4 A;  2XGE A;  4HG2 A;  4LOC A;  3M1C A;  2LNB A;  1S9H A;  3EYY A;  3LQQ A;  2Y48 A;  5FFX A;  4BL0 B;  4HQE A;  3RQI A;  2FE3 A;  2OCC H;  4MGR A;  5HNH A;  3LFU A;  5JLW A;  3OYE A;  2DTZ A;  4FET A;  5J40 A;  3LMM A;  3EYI A;  2EA4 A;  3ERM A;  2WV0 A;  1Z7L A;  2VQL A;  4X6A J;  2M1B A;  2MGQ A;  2XGC A;  2M34 A;  3RI4 A;  1YI2 I;  3GYH X;  1K78 A;  3E6C C;  2LD5 A;  2IVM A;  4A12 A;  3LOC A;  5GTI C;  2V9P A;  3BCB A;  2Y0M A;  4HX4 A;  1UAA A;  2DCE A;  3JRD A;  2E2I J;  2XAF A;  1REP C;  1EF4 A;  2DW4 A;  3DQV C;  1LFP A;  2OZ6 A;  2JA6 J;  3K4M A;  4A3I J;  1JKR C;  3W2A A;  2M3A A;  3BZC A;  3P7N A;  3HTU A;  5IYD J;  3I4P A;  4BUP A;  4KFC A;  1TQI A;  4DW6 A;  3K2Z A;  2CUZ A;  4KIF A;  4L9V A;  4I7H A;  4C9Y A;  6PAX A;  4ENK A;  2VKD A;  3VOE A;  4IJA A;  4U0V A;  2CW8 A;  2VC1 A;  4UUS B;  4RGU A;  1Y8Q B;  2V1N A;  4IX7 A;  2GBY A;  3HL2 A;  4BXU A;  2H27 A;  2ZFU A;  2A5W A;  2OC6 A;  4JX4 A;  1FMV A;  4CCN A;  2R7R A;  1OPC A;  4P9F A;  3ZQG A;  2OQG A;  3FIS A;  1FNN A;  5EJC A;  2P6T A;  1IN8 A;  4DQ2 A;  1YIO A;  3HTS B;  5IOY A;  2A07 F;  1HKT A;  2XGD A;  2R93 J;  2IPQ X;  1TW2 A;  1P4X A;  1LDK B;  1IW7 F;  1VQO I;  1ZLK A;  3OL3 A;  3K4K A;  4B44 A;  1WH5 A;  1XSD A;  1G3S A;  1E3H A;  2CH0 A;  2DN0 A;  3E97 A;  1T38 A;  2Q8K A;  3SEZ A;  1X1A A;  3ECO A;  1EH8 A;  4IQ4 A;  1W5T A;  1JKO C;  3U2R A;  4BH9 A;  2TRT A;  4Q4Z F;  1ENH A;  4F91 B;  1Z3Y A;  2VXZ A;  1RPW A;  4HAM A;  1MBK A;  5DV5 A;  2LY2 A;  4PZJ A;  5JHF A;  5F64 A;  2DDB A;  2HXI A;  3A2K A;  1ETQ A;  3JW4 A;  3C18 A;  1OYY A;  2L9S A;  2Q0O A;  2QQB A;  1LVA A;  1OCZ H;  2QQ9 A;  2MYS A;  1A36 A;  4JBA A;  2A6H F;  1T0F A;  1MGT A;  3CJQ B;  3DBR B;  4QWQ A;  2W85 A;  2Y31 A;  1VQ9 I;  1R36 A;  2XIG A;  3G1L A;  4JK1 X;  1P7J A;  2NVQ J;  3GLX A;  2VI6 A;  4D7M A;  4XN0 A;  3S2W A;  3RTR A;  3FXQ A;  4LB5 A;  3FMS A;  2DOD A;  2ZKZ A;  4PJJ A;  1W0T A;  2DYS H;  4ZYA A;  4UVC A;  2NAZ A;  5L3F A;  2HDD A;  3W6J B;  4BE1 A;  1GT0 C;  4S04 A;  1JGG A;  1XDS A;  4L9T A;  3F8B A;  1XC5 A;  1SFO J;  3G71 I;  4BAC A;  3X2Q H;  2JUG A;  2ZNY A;  3HC7 A;  3KEO A;  3TP3 A;  3TQN A;  4C3H J;  4I2O A;  5DCF A;  5FB2 A;  1LDJ A;  4A93 J;  2QYO A;  3KLN A;  2VUM J;  1Q1H A;  4ZDL A;  1QZZ A;  4EM0 B;  2ZSH B;  3BLY A;  1YG2 A;  2HDW A;  3CLQ A;  4ZH4 F;  1UEL B;  4CYC A;  3GZ5 A;  5B3S H;  1DPU A;  3BRO A;  2E5N A;  3ULQ B;  2BBY A;  5ILU A;  2O03 A;  1YRN A;  2PEX A;  3DTE A;  4M6Y A;  1G6N A;  2GA1 A;  2P5V A;  2BZT A;  3ZRG A;  4IHX A;  1LE8 B;  2M45 A;  2MW8 A;  2O3F A;  1JUP A;  3HG9 A;  2PMZ A;  2DFI A;  3F6V A;  3IKT A;  3G3Z A;  2GXA A;  3C2B A;  2DOE A;  5EEH A;  3CMA I;  3H5R A;  4BJ5 C;  3IAS 2;  3QPS A;  1SD5 A;  5CJ9 A;  2QKM B;  4E7I A;  3HRT A;  2NS7 A;  2BGC A;  1IJW C;  2YU3 A;  1JHH A;  2CWE A;  3IH4 A;  1FBS A;  4ZYH A;  5JVT A;  1PUF A;  2H1L A;  4KIG A;  4CCM A;  4M3F A;  2F2E A;  4S05 A;  2FQ4 A;  4KN4 X;  3BZK A;  2JRM A;  4KDP A;  2YU9 J;  4M3G A;  3GFJ A;  4BQQ A;  3GZN B;  4IVN A;  2KFD A;  4G7Z F;  3DXJ F;  4AVZ A;  2FOK A;  1A5J A;  1MSF C;  1FZP B;  3E5U A;  1QHG A;  2DPU A;  1JXS A;  5CVR A;  3GLL A;  2JVG A;  4MIM A;  1HQC A;  3EUK L;  3E7L A;  4P55 A;  2PLY A;  1U6G A;  3IL2 A;  2HXO A;  4BQN A;  2DDA A;  1HDD C;  1XX5 A;  2D1H A;  3TOB A;  2ZJP F;  4CZC A;  3GEZ A;  4A3K J;  1FSE A;  4IL6 C;  1F5T A;  2ZCW A;  3M8J A;  1J75 A;  1G3Y A;  1HOM A;  3V7R A;  2Q1Z B;  5B66 C;  5ICG A;  2HYG D;  1WJC A;  3DPU A;  3PNY A;  1YX5 A;  1R4M B;  1YYV A;  3QPH A;  2R7Z J;  3I4N J;  1BJA A;  2AQE A;  2RC4 A;  1FX7 A;  4KMF A;  1P92 A;  1R4N B;  3WGH A;  2BY0 A;  3CJT B;  2ADU A;  4A3C J;  2L2O A;  3KX2 A;  4CDG A;  4MEX F;  2WB1 N;  2KHM A;  5D8L B;  3JAM Z;  2XPW A;  3VYT B;  5LLQ A;  1BIB A;  3OS0 A;  2FBI A;  3UKG A;  2IA1 A;  1R5G A;  3QU3 A;  3H35 A;  1ZRE A;  5BS6 A;  2CU7 A;  1WSU A;  4Q5S F;  4XKC A;  2BV6 A;  1ITY A;  4AD9 A;  5J3L A;  1PP7 U;  4B09 A;  1Y39 A;  2O8X A;  1ODD A;  3ELK A;  4AU7 A;  1CF7 A;  1JHF A;  3F0C A;  4HYE A;  3CMY A;  5D5W B;  2M2E A;  5E3O A;  1IV6 A;  4KA4 A;  4B3A A;  4AM3 A;  3RCO A;  3DFG A;  3KZI C;  2FBH A;  1HW2 A;  3PNT A;  4A3F J;  5EDN A;  2IS6 A;  1B1B A;  1I50 J;  1MH3 A;  4XRS G;  1IGN A;  2V9V A;  2W25 A;  1X4O A;  4HDU A;  4XKB A;  3SZP A;  3LNQ A;  2O61 A;  3QPT A;  3GF2 A;  2DQL A;  4YIR X;  5DDG A;  5DS9 A;  3WTT C;  1YIJ I;  2XHK A;  4DBQ A;  1Z67 A;  2FD5 A;  3BTC A;  3FWE A;  2KDO A;  1EKE A;  2QGU A;  3L2W A;  1QBJ A;  1QVU A;  4A0X A;  4F7Z A;  5E17 F;  3G73 A;  3ZOB A;  2W4S A;  1GDT A;  3BR0 A;  4XOP A;  3IAM 2;  2W84 A;  3K2A A;  4ZZL A;  2OTJ I;  2EZL A;  4ZDO A;  4NC7 A;  2YX7 A;  2FEZ A;  4HA8 A;  2LH9 A;  2WV1 A;  3AG1 H;  3DTK A;  5J4Y A;  1W4M A;  5DYM A;  1HF0 A;  3GZ6 A;  1UJ8 A;  2DI3 A;  1BR4 A;  5IP9 J;  2R5Z B;  2VBX A;  4BBS J;  2NNN A;  4YEL A;  4ESB A;  2Z99 A;  1SFK A;  3TO9 A;  2D5V A;  4ABZ A;  1JT0 A;  1FWZ A;  3P5J A;  1KU7 A;  3BY6 A;  3F72 A;  2A3S A;  2GWR A;  3ZP5 A;  2EBI A;  1SFU A;  1W7P A;  2KIS A;  1P2F A;  3OYN A;  4CO8 A;  2KIF A;  2PMZ N;  2NVY J;  2BW3 B;  5EEA A;  1WFX A;  1JKQ C;  2EFQ A;  1U8R A;  2YR2 A;  3D5R C;  4MFE A;  4ZTF A;  4BE0 A;  4FCY A;  2HKO A;  5F27 A;  3S2D J;  3PUF A;  1MJA A;  4XIC A;  3GFI A;  1ACI A;  2VQG A;  3PSF A;  1Z21 A;  5LEJ A;  4HBL A;  2CYY A;  1FBU A;  3VYU B;  4HF1 A;  2XPU A;  4MEY F;  4H4K C;  4I02 A;  3OYB A;  2DMQ A;  2CJJ A;  1ZGJ A;  3WU0 A;  1X1C A;  3R4K A;  3FM3 A;  3IH2 A;  3V8K A;  4IF4 A;  1MW7 A;  2M8G X;  2WY8 Q;  2A61 A;  1TTY A;  4EGY A;  1IUF A;  4LLN A;  4UB6 C;  3FDY A;  3W6K B;  3S1Q J;  3GTM J;  2HDC A;  3LSR A;  4OIQ F;  2Q2E A;  4IHV A;  2RRE A;  3CP8 A;  2JWT A;  3DWL E;  4HW0 A;  1D1A A;  1S5L C;  3GW2 A;  1U8B A;  3DU6 A;  2O7O A;  2GQQ A;  1Y56 A;  3I4M J;  2XAQ A;  4A3M J;  4MFD A;  3AG3 H;  4FQG A;  3CCJ I;  1Y8R B;  3JRH A;  4M9X A;  2R3S A;  2V1U A;  2RNG A;  3ECH A;  2EZK A;  5LGU A;  2QF7 A;  3K9T A;  5E18 F;  2YX4 A;  5HVQ C;  3B6C A;  1YJW I;  4BJT A;  3DKW A;  2JA2 A;  3S3O A;  2E71 A;  1ZLJ A;  3LSK A;  3J81 Z;  3EQL F;  1WI9 A;  5HDG A;  5HNF A;  4V19 K;  3HSF A;  2F5C A;  1E2X A;  1MZB A;  2XB0 X;  3JRF A;  1F4K A;  3ZMZ A;  1XGN A;  3QQA A;  4I76 A;  3CC4 I;  3Q0V A;  1A35 A;  4D1Q A;  1BA5 A;  4OIP F;  4AVP A;  2Y9Z A;  4W1U A;  2L0K A;  3CO6 C;  2DFE A;  9ANT A;  3PNV A;  1WI3 A;  4NDL A;  3OSG A;  1XS9 A;  1L3L A;  1T98 A;  3FXM A;  2L01 A;  2YS9 A;  4UUS A;  3KFW X;  2FA5 A;  1VQP I;  2EIJ H;  2K4B A;  4IZZ A;  1NHA A;  2VT3 A;  2IGK A;  2CV2 A;  3ABM H;  5GTH C;  1MNE A;  1S7A A;  5E3N A;  2G7U A;  4A3J J;  4XLA A;  4CCL A;  3COA C;  4RMN A;  2Y30 A;  3H36 A;  3CZ6 A;  3OYA A;  5HLG A;  2OV7 A;  4I98 B;  3CMM A;  4C3J J;  1D0X A;  2WAF A;  2CUJ A;  2R5Y B;  1HKQ A;  2X85 A;  1BW6 A;  2NXN B;  2QUF A;  3K70 C;  3ZMD A;  1P4A A;  3R0A A;  1G59 A;  1RC9 A;  2MC4 A;  5KK1 A;  1UG0 A;  5AIQ A;  5KVR A;  4A0Y A;  1D5Y A;  3PO2 J;  4PCQ A;  3WU2 C;  2L5Q A;  2HVQ A;  4IHW A;  4V2G A;  2XRL A;  3GTL J;  3HSE A;  2R7W A;  5IP7 J;  2ZME B;  1OJL A;  1JGS A;  3ZQ7 A;  3S8P A;  5F6F A;  1E3P A;  3GTK J;  2EFO A;  5DCM B;  3VFZ A;  3BPX A;  2MD5 A;  4KIB A;  2K5C A;  5FLX K;  2HWV A;  1R71 A;  1F9N A;  2B0L A;  2AXL A;  2XAU A;  4U87 A;  4D7N A;  1YW9 A;  2JUC A;  2XSJ C;  2DOA A;  2VIX A;  3CCR I;  3D5L A;  2JA7 J;  1ZTR A;  3CCU I;  1Z6R A;  4IKF A;  1H89 C;  2KRF A;  3S17 J;  5HLI A;  2XAH A;  1F43 A;  4IRI A;  2WBM A;  2KP6 A;  1S6L A;  5CKT A;  2VOO A;  5GAD J;  4BGD A;  3RKY A;  3FKJ A;  2STT A;  4GFB A;  2F5D A;  3VPR A;  1ZRD A;  3FK7 A;  3SQN A;  3U1K A;  1YJN I;  3HOS A;  4F55 A;  1GHC A;  3CDL A;  3TGN A;  3WG7 H;  2EIL H;  1GXP A;  1P7I A;  1MMN A;  4HRI A;  3E3V A;  4LIU A;  5TIS C;  4RLF A;  3TKY A;  4IRG A;  1ZYR F;  1H88 C;  3BDD A;  3FXU A;  1TNS A;  3J80 Z;  4XN3 A;  2VB6 A;  3HIF A;  4NHJ A;  5TGT A;  1FMW A;  1WJF A;  2LYC A;  4H0E A;  3BJO A;  2E1M C;  3HOZ J;  3LSH A;  1BBY A;  1ETK A;  4I09 A;  3BG7 A;  4U0W A;  1SVM A;  3HRS A;  4XSX F;  2JT1 A;  2KIU A;  1XSV A;  1FP1 D;  2WTE A;  3C2H A;  3SZG A;  4S0H B;  2VE9 A;  3HJE A;  1IRF A;  4PJL A;  4WK8 F;  4N9I A;  1JKP C;  4XKV A;  3ERE D;  2QWW A;  4ZC3 A;  5EG0 B;  4Y3O A;  2Z5U A;  4YEJ A;  2E1C A;  3Q3S A;  5FKM A;  2NOG A;  1WRJ A;  3H3Z A;  2ICW G;  2K27 A;  2Z3Y A;  4E7S A;  3LSP A;  2J5P A;  5KNL A;  3L2Q A;  2R7T A;  2FQ3 A;  3T8R A;  1OCO H;  1FTZ A;  1XPX A;  3K69 A;  4II3 A;  1YFH A;  1IDZ A;  5F0F A;  4Y52 J;  2W24 A;  1J7K A;  3V8J A;  3ESW B;  5FKK A;  2RNJ A;  2VKH A;  3FHN A;  5HS7 A;  1HDP A;  1WKM A;  3DKY A;  3SEQ A;  3JCU C;  2QQA A;  5D6F A;  2ECB A;  2ELH A;  3F8M A;  4RM3 A;  5JLX A;  3LA7 A;  4XID A;  1C0W A;  5L3D A;  3DLL F;  3BPV A;  2FXA A;  1R23 A;  5H2F C;  1U5T C;  3S2H J;  2VPL A;  2E34 A;  4G9Y A;  5L3C A;  4DYQ A;  5IT9 Z;  5D5U B;  5IPA A;  4RDU A;  2VQC A;  1U3E M;  2UXX A;  5KAF C;  2BXZ A;  4AYB A;  4WXC A;  4D5C A;  1KYW A;  3G2B A;  1MND A;  1MD0 A;  2M8E A;  5C4J J;  2HVR A;  1JUM A;  4QLC U;  5EF6 A;  4MQ9 F;  1EH7 A;  2ME0 A;  3B73 A;  3BTL A;  3OV8 A;  4E7J A;  3K10 A;  1YS6 A;  3PO3 J;  4HF2 A;  5HLH A;  3RPU A;  2NRA C;  3Q5F A;  4C2U A;  3JAM K;  4ESF A;  2QZ8 A;  1BJZ A;  3GTQ J;  1YHQ I;  5H6R A;  1WJA A;  1NK2 P;  2P4W A;  3HPH A;  3M8E A;  2MLG A;  4NC8 A;  4B48 A;  2BE5 F;  1SVL A;  4EM2 A;  1KON A;  1DU6 A;  2IXS A;  5DEQ A;  1EJ9 A;  4LFU A;  1WJD A;  3L2R A;  3WTZ A;  2LY1 A;  3KP3 A;  2W82 A;  1HKS A;  3MMY B;  3OYG A;  2LRE A;  2I10 A;  1S72 I;  3B02 A;  2XC7 A;  1J5Y A;  1ZHF A;  1OQY A;  2IGN A;  3HXL A;  5GP9 A;  2HZD A;  4IHT A;  5CLS A;  1IO2 A;  2HYF A;  3PL8 A;  3QYF A;  3SFI A;  4EM1 A;  3MWM A;  5ILV A;  2IS4 A;  3E1S A;  1BC7 C;  1XB4 A;  3CF2 A;  3FBN B;  1JUS A;  1WJB A;  1APL C;  1TQP A;  4A3E J;  4IPA A;  4XLC A;  4M73 A;  4C3I J;  4EJU A;  2ZME C;  1SD4 A;  3PFY A;  5CVV A;  2PI0 A;  1QZE A;  4QPQ A;  3I56 I;  3IC7 A;  4YFN F;  4RBO A;  5LHH A;  5FLM J;  3D5S C;  4A0Z A;  3FM5 A;  4FAS D;  1FYK A;  1YQA A;  2CO5 A;  2X6W A;  4AIK A;  2PJP A;  5JFR A;  2VBY A;  2MAB A;  3OS2 A;  1B72 B;  4FE4 A;  2XRO A;  1X1B A;  3MVP A;  1OYI A;  2XF7 A;  2GLO A;  3H0G J;  1Y0N A;  3CTA A;  4L0Z B;  3HUG B;  2GAU A;  2VXD A;  1V5G A;  1GLN A;  3CUO A;  4I99 C;  2ECC A;  3HBL A;  4E6K G;  2Z2S B;  5H6Q A;  1KGS A;  3LL7 A;  1HST A;  5K5O A;  1SEU A;  5LEK A;  1B4A A;  4J01 A;  3OYC A;  2K4J A;  3ISP A;  1QHH D;  1U9N A;  3QOP A;  4DYR A;  1BR2 A;  2HQ5 A;  3ONQ A;  1MJ9 A;  4M71 A;  3MEX A;  3TOA A;  3OYI A;  3CCV I;  3I54 A;  5A2Q K;  4Z6Y A;  2WB1 A;  1M1E B;  1UG2 A;  1U2W A;  2LTP A;  3RPQ A;  4OAY A;  5CVU A;  3VDX A;  1SMT A;  3MFK A;  2DLL A;  3V7C A;  5FRN A;  1O3T A;  2VON A;  4U0Y A;  4RM2 A;  2X51 A;  2I8D A;  4RB2 C;  2K85 A;  4KIT B;  5M3F J;  3E5X A;  1XGS A;  4ZZD A;  3DEU A;  2IGO A;  1KU9 A;  5ILS A;  2JJ7 A;  3PSI A;  1O3S A;  1PUE E;  2G0E A;  2XRN A;  3HRM A;  1VQ8 I;  4UNO A;  3DLA A;  2EB7 A;  1OMI A;  2DT7 B;  1I3A A;  1E17 A;  2LBF B;  1Z05 A;  4E7K A;  1ZG5 A;  3H92 A;  5J4V A;  2LR8 A;  1BM9 A;  1MH4 A;  2GXG A;  2R5Z A;  1YIT I;  1ZH5 A;  4NUB A;  1WPK A;  2ESN A;  1BOA A;  1TT0 A;  3LSI A;  4XNF A;  2DA6 A;  1BOB A;  4JYK A;  1TWF J;  1QA6 A;  1TLH B;  3M4O J;  1FLI A;  3I64 A;  3IWF A;  2YSR A;  3OMY A;  1POG A;  3F23 A;  1ZRF A;  2BW3 A;  3E0J B;  3AG4 H;  4U88 A;  2CQK A;  1HW1 A;  2K9Q A;  4P96 A;  1JI8 A;  5HDN A;  5K5Q A;  3PJR A;  2MSY A;  3O3K A;  5M5W J;  4N0B A;  2XSD C;  2JK3 A;  3J7A Y;  3DCF A;  4XLN F;  1Z0X A;  2KRC A;  2X0L A;  3RJP A;  3SJM A;  4A2U A;  5GAH J;  3KYD B;  4ITV A;  1TW3 A;  2IBD A;  2IS1 A;  4I6Z A;  2O0Y A;  3TW6 A;  3WTX C;  2HS5 A;  5D8K B;  2IT0 A;  3E6M A;  3U9G A;  4ZYE A;  1SMY F;  4AID A;  1TBX A;  2H09 A;  2X6X A;  2DA2 A;  4IXA A;  1S7O A;  5EEG A;  3V8L A;  4AYB N;  1DUX C;  3JR9 A;  3CC7 I;  2DJI A;  3BR6 A;  4YII A;  1FYL A;  4X1E A;  3HOT A;  3U21 A;  4LLL A;  3R60 A;  4KUM A;  3FF5 A;  4LG3 A;  2K3F A;  2X48 A;  4A3D J;  3JTG A;  1HCR A;  1MDM B;  5IOZ A;  1IN6 A;  3BJ6 A;  5HDK A;  3L2C A;  1A31 A;  2J5O A;  4KIC A;  3C7J A;  4O5V A;  1VQK I;  2ZSI B;  1WGX A;  3DPT A;  2XKO A;  4ZYG A;  4PUS A;  5AON A;  5IYB J;  2M9H A;  1YJ9 I;  2EV0 A;  2ZO4 A;  3JRG A;  4PGG A;  3GWZ A;  2PN6 A;  3S32 A;  4YRV A;  1V3F A;  4RGX A;  3VYR B;  1PDN C;  5CPR B;  2QKL B;  3UR3 C;  3CUQ C;  3H5N A;  5J1U A;  3BG3 A;  2HPI A;  2P8T A;  2X9D A;  5BPD A;  3NQO A;  1S29 A;  1R1V A;  2CMP A;  3WU1 B;  3GFL A;  1AWC A;  3ML6 A;  1JE8 A;  2V6E A;  3G1M A;  1R5H A;  2R7S A;  4L18 B;  3M7G A;  3OWT A;  4HF0 A;  4LIT A;  4D0P A;  5B5E C;  5K7F A;  4V2F A;  2P6S A;  3GO5 A;  4RA2 A;  2TCT A;  1FTT A;  1IG7 A;  4II2 A;  4EMS A;  2M5W A;  2HVS A;  3CME I;  4KMU X;  4L5E A;  1TWC J;  1GVJ A;  2P5L C;  1Q1V A;  4GYI A;  4L9N A;  3LAJ A;  1PJR A;  4ZDP A;  5IT3 A;  1Y1V J;  1ETO A;  4UHT A;  4QPO A;  2F4O B;  2FF4 A;  3CLO A;  3QOE A;  2ME6 A;  2W1O A;  2WC2 A;  1WHU A;  3RQ4 A;  2AO9 A;  3PFI A;  2HFH A;  1O57 A;  2FRH A;  2KT0 A;  3P9C A;  2BEO A;  3OYK A;  2R5Y A;  3EUA A;  5F08 A;  1QQI A;  4PDK A;  3CCS I;  2HTS A;  4DJA A;  3PIO F;  5J8C A;  2WA0 A;  3OIO A;  1FJL A;  1X1D A;  4I01 A;  3S16 J;  2GIZ A;  3BP8 A;  4ENN A;  2EFP A;  2OBP A;  3K0L A;  2QCO A;  2ZME A;  3W3C A;  2O8K A;  4WWC A;  5K7Z A;  5DCM A;  2DQR A;  5LRR A;  1ZEL A;  5L3B A;  5D5X B;  1QPI A;  2BY1 A;  3GTG J;  2ZC2 A;  4Q47 A;  3CD6 I;  1UST A;  1YTY A;  1YO5 C;  3FXJ A;  1G3T A;  1YX3 A;  4W97 A;  3IV5 A;  5ICE A;  2VPR A;  2E19 A;  3CQZ J;  1X3W B;  3ZXS A;  3K7A J;  2BHZ A;  1OCT C;  5JVG F;  1DQU A;  2DFF A;  1FPQ A;  4GRI A;  5LHG A;  4OU0 A;  4FX4 A;  3Q0U A;  2A6T A;  2DMP A;  3RKW A;  3VYS B;  4ENM A;  4ZJZ A;  5FKL A;  2DAO A;  2DA7 A;  3K1M A;  3AG2 H;  2K7L A;  3QU6 A;  1ETY A;  4BU2 A;  2L4M A;  1BIA A;  3SYT A;  4BS9 A;  2QSH X;  1TC3 C;  1I27 A;  1K6Y A;  2HNH A;  1IN7 A;  3GTP J;  5FD5 A;  1BL0 A;  1QO0 D;  1QRY A;  5GPC A;  2AXT C;  4D9J A;  4HDV A;  1CQT A;  1HC8 A;  2CQ7 A;  3K4B A;  5GAE J;  4NB5 A;  2KKO A;  3I9V 2;  1KZH A;  4IOC F;  2L7M P;  3EUH C;  3KEY A;  2CW7 A;  2Y75 A;  1Y0U A;  1SAX A;  4M74 A;  1QGP A;  1YW8 A;  2JZY A;  5EG0 A;  3HZJ A;  2Y0S N;  3A1Y A;  1FEX A;  1OCR H;  4BHB A;  3HHH A;  1G3W A;  1R7J A;  3GFM A;  3CJN A;  1ZAR A;  3EET A;  1J09 A;  1AA7 A;  3V7S A;  2F5V A;  3OYF A;  4IHY A;  3J7Y J;  5DD8 A;  1B8I B;  1LFB A;  1A6I A;  2EK5 A;  2VBW A;  2M7A A;  1SAU A;  3FHZ A;  1ZRC A;  1WH7 A;  1HXD A;  1I1S A;  5HS8 A;  3KZY A;  4DGW B;  2BVM A;  4FT8 A;  5E8G A;  1AHD P;  4DZJ A;  5KCM A;  3A01 B;  3ZMV A;  1Y1W J;  2BYV E;  1USS A;  2ETH A;  5F1R A;  2FBK A;  3QOD A;  4HEA 2;  5B1A H;  5C4X J;  1RUO A;  2TDX A;  2YUS A;  3HRU A;  3OR1 C;  1IZ1 A;  1NH3 A;  3H9J A;  2GZW A;  5ERI A;  2EV6 A;  4U7D A;  4RB3 C;  2ELJ A;  2GOX B;  1UB9 A;  3KEQ A;  1OYW A;  4BAY A;  3G6E I;  3HM5 A;  4F93 B;  2E35 A;  2V6C A;  2UUZ A;  1TQM A;  2ELK A;  2VL8 A;  5LD2 C;  3QYE A;  3VEP A;  4OAZ A;  3OOP A;  1K83 J;  1FC3 A;  3SHF A;  1XSX A;  3KLO A;  4MQV A;  2IW5 A;  4PJN A;  3LWF A;  4E4H A;  2KMU A;  2E1M B;  2LDU A;  4A3G J;  3VSK A;  3P9I A;  1VQ7 I;  3O2P E;  1MJB A;  2CFO A;  2Y2Z A;  3IRR A;  2VKV A;  1WJE A;  4AIH A;  1K4S A;  3ABU A;  4QSH A;  5D5V B;  5FRM A;  2M4K A;  3CES A;  3R6S A;  3S3M A;  3I55 I;  5BMZ A;  2V1D A;  3F3X A;  4WXH A;  5EGO B;  2Z16 A;  4FX0 A;  4C2M J;  1FIP A;  4AIJ A;  1N25 A;  3HHG A;  3O8H A;  1JT6 A;  2X6Y A;  3E6D A;  3RPU D;  5FRO A;  5J1Y A;  1J2X A;  3CO7 C;  2ZJR F;  4BXX J;  3T1B A;  1BI1 A;  2E5Z A;  4G12 A;  2VQH A;  4FE7 A;  3HEF A;  3HYI A;  3WHB A;  2K02 A;  3BZ6 A;  5J1R A;  3BG6 A;  3W2V A;  4AC0 A;  3SFZ A;  2FUG 2;  3WE3 A;  4YFX F;  1RR7 A;  1F36 A;  1B72 A;  1U5T B;  4JOM A;  3QAH A;  2JA5 J;  4HNV A;  1UMQ A;  4MLO A;  1V5E A;  5DD4 A;  1AKH B;  1KQ8 A;  5EZH A;  4NBQ A;  2NVU B;  3TED A;  3NRV A;  3MZY A;  1V5F A;  3BQY A;  3P9K A;  3ZR8 X;  2C6Y A;  1J9I A;  4OIR F;  2HEO A;  2P5K A;  2Y69 H;  2OCE A;  4HQM A;  2EH3 A;  2NS8 A;  2L7K A;  5CQE A;  5BNG A;  2EV5 A;  2L9R A;  4KN7 X;  2LK2 A;  3DU5 A;  1YE9 A;  4ENJ A;  3ZMT A;  3RDI A;  2V9K A;  5HLT A;  2K86 A;  3MCZ A;  3ZQQ A;  2R7Q A;  3BR2 A;  1K7A A;  2JVH A;  4G6D A;  2NYX A;  3DP7 A;  1X2N A;  2X1C A;  4G94 A;  2ACJ A;  2RVC A;  4HNT A;  3OR2 C;  4E7H A;  2BVL A;  5DUI A;  2OD5 A;  1R58 A;  1QPM A;  1S8N A;  4E7Z A;  2A05 A;  2KZV A;  3CDI A;  3HPG A;  1IN4 A;  4E70 A;  2LBF A;  3HOY J;  3DKX A;  2MD0 A;  1XTA A;  3H9Q A;  3CCM I;  2IA0 A;  1NG7 A;  2LKX A;  3TW7 A;  2M0M A;  2DBB A;  1MKM A;  5JR3 A;  4CA0 A;  2F4M B;  5E1X A;  2V79 A;  5K5R A;  2B9S A;  1DP3 A;  1FOX A;  3FXK A;  3KP5 A;  2VJJ A;  1T2K A;  1KU3 A;  2CUF A;  3M07 A;  2NNY A;  2LP0 A;  4BEH B;  4CUG A;  1K4T A;  1T0F C;  1KQ9 A;  2EIM H;  2G7H A;  1SD6 A;  1DGW Y;  4U7B A;  3K1P A;  5ICC A;  2CGP A;  3F21 A;  1W36 D;  2HKX A;  2PFB A;  4A3L J;  1FIA A;  1WCM J;  3HDD A;  2JPC A;  3FK6 A;  1XN7 A;  4EV0 A;  2QEX I;  4JP0 A;  2IS2 A;  4XRS A;  2MA3 A;  3KE2 A;  3CF5 F;  2BY3 A;  3L00 A;  3MQ0 A;  3WOD F;  5L3G A;  2LF7 A;  4MNU A;  1B9N A;  1F1Z A;  3C3W A;  3RKQ A;  2K9N A;  3QP6 A;  3QYB A;  2P0W A;  4BE2 A;  1OKR A;  4RLQ A;  2HPM A;  4DYC A;  2ZXI A;  4A5N A;  4DOZ A;  2KRH A;  1IXR C;  1LJ9 A;  3VSL A;  3ZQC A;  1PP8 F;  1V4R A;  1VQ6 I;  4BQA A;  4HOB A;  3K1N A;  4MTD A;  3BR5 A;  3REO A;  2LKS A;  3NAU A;  1LE8 A;  1HW5 A;  4F92 B;  1U0J A;  2HYJ A;  3PQK A;  4XOT A;  1TWH J;  1MMA A;  5E1W A;  1MDM A;  3L7W A;  1KU2 A;  5CVI A;  4WCG A;  3CCL I;  1S3J A;  2RQP A;  3BOQ A;  3AL0 B;  3DTI A;  1U78 A;  2HI3 A;  2DJN A;  4IOA F;  1Z9C A;  1TL8 A;  2HQN A;  2IGM A;  1R00 A;  1ZKG A;  1S7E A;  2PQ8 A;  2F6C A;  5KHD A;  5LGN A;  2MH2 A;  4R79 A;  3EPZ A;  3CCE I;  4A6D A;  4EEF G;  1FBQ A;  2HQR A;  2JRT A;  3Q9V A;  4ANJ A;  4RGR A;  3ZMU A;  3S14 J;  2R7F A;  1YLF A;  4XLE A;  3QRF F;  3MZ8 A;  2L4A A;  3MKW B;  2H1K A;  3F8N A;  2KJB A;  2R7O A;  2JN6 A;  3GVA A;  5M3M J;  4B4C A;  2IJL A;  4EVI A;  5IYC J;  3MN2 A;  5LFA A;  4EJV A;  1MMG A;  4GGG A;  5LHI A;  4UUV A;  2CUE A;  3WTU C;  2MG4 A;  4XMY A;  2X1D A;  4ETS A;  1KYZ A;  2VJ4 A;  2FMY A;  4GXO A;  1X3U A;  3CC2 I;  2DOF A;  3M1E A;  2VE8 A;  1YW7 A;  2A6E F;  2XVC A;  3I0T A;  4OWR B;  3RYP A;  1K79 A;  4KJZ A;  1LEB A;  1LEA A;  1J59 A;  3IUO A;  2LRD A;  1B59 A;  3DBL B;  4YIF A;  3DPL C;  2E2J J;  3MKL A;  2DPD A;  1Z1D A;  4LIV A;  2JPB A;  2M7B A;  2XDV A;  1ZAO A;  1IAW A;  1ORK A;  2JMW A;  3BC8 A;  2JA8 J;  1TZL A;  4C2T A;  1IRZ A;  1XD7 A;  2XB5 A;  3JSP A;  3CCY A;  1IRX A;  2CW0 F;  3ZQH A;  1ERD A;  4BQO A;  2BY2 A;  2V26 A;  5FKN A;  4A69 C;  1ZGW A;  4P9U A;  4ZTJ A;  3WTV C;  4L5I A;  2OZU A;  2HOE A;  1BC8 C;  1I1G A;  3M9A A;  1A04 A;  3WGG A;  3ABL H;  1ZN2 A;  4LK0 F;  3CUQ B;  4G6Q A;  5ICF A;  4CCK A;  4XLP F;  1FYM A;  5FO5 A;  3GUD A;  4WX9 A;  2QA4 I;  2H8W A;  1LUJ B;  4LGW A;  3Q0W A;  2NVT J;  4YFK F;  1KQ0 A;  3CCQ I;  1U9O A;  1GV2 A;  1B6A A;  1MMD A;  2DA3 A;  2FML A;  1Z6T A;  3GTJ J;  3OL4 A;  3RKX A;  4KYW A;  1RKT A;  1RI7 A;  1X19 A;  3J7A O;  4LMY A;  3WE2 A;  4EQQ A;  3RYR A;  1FSH A;  1I39 A;  1O3R A;  1D5V A;  3OYL A;  2VKE A;  3KPH A;  1LKX A;  4EJT A;  2FU4 A;  1O4X A;  3G4S I;  3ABT A;  1QU3 A;  4XRM A;  3BJA A;  4F52 A;  3LQR A;  4IEJ A;  5L3E A;  3A03 A;  2DA4 A;  2P7C B;  2NVX J;  2VAS A;  5AIP A;  2X1E A;  3H9G A;  3B6A A;  3KCC A;  4IRH A;  4N4O B;  2H8R A;  5F0H A;  1KA8 A;  4A6E A;  5B1B H;  4XQF A;  4GCV A;  2R7D A;  4CCO A;  3HB9 A;  4B3X A;  2PJR B;  2K3P A;  2H94 A;  1T56 A;  2CQX A;  3OSF A;  4EAT A;  1WWX A;  5KAI C;  4ON0 A;  4HX8 A;  3AL0 C;  3CDH A;  3PM1 A;  1IV8 A;  2WY7 Q;  2HZT A;  4RB0 A;  2XKP A;  3M3Y J;  2F5F A;  4L0Y B;  3OYH A;  2L02 A;  3NAR A;  4UXN A;  1XMK A;  2R4G A;  2NS0 A;  3EDP A;  3K4J A;  2R7V A;  5FLV A;  5HOD A;  5K7H A;  4XL9 A;  4QTR A;  3IRQ A;  1B8I A;  2DT5 A;  2DK8 A;  3KP4 A;  1Z3X A;  1IUY A;  1BI2 A;  1TT5 B;  2LLK A;  2OAZ A;  2P7V B;  3D0S A;  4F3Q A;  3LSM A;  3A01 A;  4M6V A;  2B63 J;  1FOW A;  5E1Z B;  2M0C A;  4B47 A;  3SXY A;  3ZCO A;  2DMN A;  3OYJ A;  3BG5 A;  1LB2 A;  4UV9 A;  2O5R A;  4HV5 A;  1VQN I;  1WZ2 A;  2EIK H;  3FXL A;  2N8G A;  3IP4 B;  2MFZ A;  3O6B B;  3R61 A;  3HOW J;  2DT6 A;  3FBI B;  2Z1D A;  1W7P D;  4O6J A;  2ZXJ A;  5LGT A;  5F0C A;  5C3E J;  3L2U A;  5DM7 F;  2KQR A;  3LST A;  4LG0 B;  1X3Z B;  4KIS A;  2JTV A;  4B8X A;  3WTS C;  2Y0S A;  2CRG A;  4M3D A;  2LMD A;  1T95 A;  3BCA A;  5FLX Z;  1JJ8 C;  3MKZ A;  1IRG A;  1DDN A;  2ZXH A;  4G6T B;  1MBE A;  2K9S A;  2ZXW H;  4FIS A;  2CV0 A;  3H3U A;  1R9T J;  3KYL A;  4B1R A;  3BR3 A;  2KIM A;  1GVD A;  4PSW A;  3J81 K;  3I59 B;  1UFM A;  5HOO A;  1AU7 A;  3NWT A;  5EGO A;  1LNW A;  1CGP A;  4NQW B;  1H9G A;  1ETV A;  2DTR A;  4XKW A;  2EFW A;  4RGS A;  5D6E A;  2QBY B;  3LAP A;  1RIO H;  2X6O A;  2UXN A;  2COM A;  4EJW A;  3VB2 A;  1OR7 C;  4XR6 A;  2E60 A;  1Z7U A;  2ZJQ F;  2GXB A;  4PFO A;  3ZN1 A;  1R5I D;  1IDY A;  4BDZ A;  2DA1 A;  2E2H J;  3TO6 A;  1MIJ A;  4XSZ F;  5GAG J;  2IAI A;  5TJJ A;  2W48 A;  2PMH A;  2L9V A;  2LVS A;  3F6O A;  4OMY A;  3GX4 X;  4HPQ A;  1O3Q A;  3H0D A;  4BNC A;  1U5T A;  2YPR A;  2IEK A;  3UNG C;  4DNC A;  3OYD A;  1XGO A;  2NOJ B;  4CCJ A;  1JJ6 C;  1YOV B;  1OLT A;  4ASN A;  1P9Q C;  3L2V A;  2ID6 A;  1X2M A;  4K2E A;  2UZK A;  1LQ1 A;  2BXY A;  3SDB A;  2ZB9 A;  3D1N I;  4LB6 B;  2KL4 A;  3TDZ C;  4MO7 A;  2EIN H;  1I3Q J;  3LA2 A;  3PUB A;  2XV4 S;  1AKH A;  2OPT A;  4E7L A;  3S1N J;  4RAG A;  1VF9 A;  4IHS A;  5JI6 A;  1IN5 A;  4P1W A;  2BHY A;  2OF7 A;  3S1R J;  3M8F A;  2WAD A;  2L9N A;  1TWA J;  4RB1 A;  4Q48 A;  2ID3 A;  2STW A;  2XF6 A;  4HZF A;  2RAE A;  3ASO H;  3K6G A;  3MAJ A;  4R1H A;  4M6X A;  1D8J A;  3DF8 A;  3FIW A;  2M4G A;  1GV5 A;  1PYV A;  2E36 A;  3LA3 A;  4GO1 A;  5DM6 F;  2V4J C;  5J6X A;  4XLF A;  2MH9 A;  5DTD A;  1BI0 A;  3BR1 A;  3F9K A;  1E3O C;  2EZI A;  2JSP A;  4CSW A;  4JX5 A;  2CQQ A;  1H8A C;  1G8X A;  4LJZ F;  1ZG1 A;  2QEN A;  3FZV A;  1R22 A;  3T5X A;  4A5M A;  2L54 A;  3I71 A;  3JRB A;  1W5C C;  4YG2 F;  1FOY A;  4RS8 A;  1Z77 A;  2HTJ A;  3TP0 A;  5IP6 A;  1RRJ A;  2GM4 A;  1WQ2 A;  5E20 A;  4Y17 A;  2K9L A;  1K78 B;  2DXI A;  2OQR A;  2VN2 A;  2R7U A;  3KP6 A;  4Y7N J;  3RZO J;  3S1M J;  2AHQ A;  1SAN A;  1I6H J;  1ZG3 A;  3HOX J;  4HV6 A;  2OJE D;  4R8H A;  3JRA A;  5EYR A;  3J80 K;  1OCP A;  3SDG A;  1GUU A;  1ZGA A;  2JSC A;  4M9Z A;  1T8I A;  4OMZ A;  4BEH A;  1T6S A;  2P81 A;  4PFP A;  4HLX A;  3N97 A;  4OIO F;  2UV1 A;  1WJ5 A;  2MC3 A;  1QNT A;  3OS1 A;  4BXF A;  2K9M A;  3TL4 X;  3ZGK A;  4UY8 I;  2FNA A;  3FXO A;  1X1P A;  5M5X J;  1VQL I;  2O6G E;  3TMO A;  2Y9Y A;  3A0B C;  1XMA A;  1ON2 A; 
#chains in the Genus database with same CATH homology
 3ZR8 X;  4E7J A;  4BE1 A;  4B43 A;  3K10 A;  4BAC A;  2JUG A;  4C2U A;  3HC7 A;  2L7K A;  5CQE A;  4KT6 A;  3DU5 A;  1YE9 A;  1WJA A;  3HKZ A;  1D0Z A;  3HPH A;  4B48 A;  4NC8 A;  2V9K A;  5HLT A;  1KON A;  2WAE A;  4J00 A;  2IXS A;  3ZQQ A;  4X0G A;  2R7Q A;  4ZDL A;  1WJD A;  3H5A A;  2JVH A;  2ZSH B;  3L2R A;  3BLY A;  2HDW A;  2X1C A;  1UEL B;  2LY1 A;  3MMY B;  2W82 A;  1BR1 A;  2E5N A;  3OR2 C;  2LRE A;  4HNT A;  3OYG A;  4E7H A;  2BVL A;  2XC7 A;  3DTE A;  2IGN A;  3HXL A;  3ZRG A;  1E0E A;  2HZD A;  3PL8 A;  3QYF A;  4E7Z A;  3HG9 A;  2KZV A;  2IS4 A;  3OYM A;  2PMZ A;  3E1S A;  3HPG A;  2LBF A;  3CF2 A;  3FBN B;  3OIQ A;  1WJB A;  3DKX A;  2LC2 A;  2MD0 A;  3H5R A;  3H9Q A;  3IAS 2;  4BJ5 C;  4XLC A;  1NG7 A;  2M0M A;  2QKM B;  3PFY A;  4E7I A;  4QPQ A;  2R7X A;  4CA0 A;  3D5S C;  4FAS D;  1DP3 A;  2X6W A;  4XOR A;  4CCM A;  4JQF A;  2MAB A;  3OS2 A;  2VJJ A;  1X1B A;  4BEH B;  4CUG A;  2XF7 A;  1T0F C;  3HUG B;  3OIP A;  4BQQ A;  2VXD A;  1V5G A;  1DGW Y;  4U7B A;  1GLN A;  4AVZ A;  4E6K G;  2Z2S B;  1W36 D;  3LL7 A;  1QHG A;  4J01 A;  3OYC A;  1QHH D;  2JVG A;  4CH7 A;  1BR2 A;  3ONQ A;  2IS2 A;  3EUK L;  3OYI A;  4DBR A;  2KLO A;  1N78 A;  2WB1 A;  4BQN A;  4PK4 A;  4OAY A;  3VDX A;  3CP2 A;  4CZC A;  5FRN A;  3QYB A;  2P0W A;  1D1C A;  4BE2 A;  2CV1 A;  4RM2 A;  2X51 A;  2I8D A;  4RLQ A;  2OUM A;  2HPM A;  3M8J A;  4KIT B;  2ZXI A;  2Q1Z B;  3NWS A;  4DOZ A;  3AFH A;  2KRH A;  3DPU A;  1WJC A;  3VSL A;  2IGO A;  3PNY A;  1YX5 A;  2CS3 A;  3PSI A;  2AQE A;  3GBG A;  1EA3 A;  4F92 B;  3DLA A;  2L2O A;  3KX2 A;  4Y33 A;  2DT7 B;  1U0J A;  4XM3 A;  4XOT A;  2KHM A;  1MMA A;  2LBF B;  3MD2 A;  4E7K A;  3VYT B;  3AL0 B;  3DTI A;  1HA8 A;  3OS0 A;  3S93 A;  3K4C A;  2IGM A;  3H35 A;  4P5O A;  4NUB A;  2F6C A;  3LSI A;  1TT0 A;  4XKC A;  5KHD A;  4XNF A;  2BOL A;  2HQA A;  1BOB A;  4R79 A;  3EPZ A;  2AQF A;  2RQQ A;  4ANJ A;  4AU7 A;  3OMY A;  4XLE A;  2BW3 A;  3E0J B;  3MKW B;  2WAQ A;  2R7O A;  3RCO A;  1JI8 A;  3PNT A;  3K4L A;  3PJR A;  2IS6 A;  4HST A;  2V7F A;  3LSG A;  5LFA A;  1MMG A;  3OOU A;  5CQG A;  3J7A Y;  1X4O A;  4XMY A;  2KRC A;  2X1D A;  4XKB A;  3I3L A;  2VJ4 A;  4ITV A;  2IS1 A;  4NNJ A;  4DBQ A;  4OWR B;  1LVK A;  4DIQ A;  4KJZ A;  2X6X A;  3IUO A;  2LRD A;  2KDO A;  3L2W A;  3DPL C;  2W00 A;  3DEE A;  2VJ5 A;  4XON A;  2DJI A;  2W4S A;  3HOT A;  3U21 A;  4XOP A;  3MKY B;  3IAM 2;  2XDV A;  2M7B A;  4LIV A;  4PSX A;  4LG3 A;  4ZDO A;  2PJR A;  4NC7 A;  2LH9 A;  3TBI A;  3DTK A;  3BC8 A;  3CJR B;  1TZL A;  4C2T A;  1D0Y A;  4HNU A;  1R6R A;  3K4N A;  1BR4 A;  1IRX A;  1ERD A;  4HSR A;  2V26 A;  4BQO A;  4N4N B;  4YEL A;  2ZSI B;  1SFK A;  4ZTJ A;  1W36 C;  3DPT A;  4PUS A;  3S32 A;  4YRV A;  2LOO A;  3VYR B;  4CCK A;  3K70 D;  3S3N A;  5CPR B;  3OYN A;  2QKL B;  3UR3 C;  1N75 A;  3H5N A;  2HPI A;  2BW3 B;  1WFX A;  1MMD A;  4IQJ A;  1D1B A;  1NG6 A;  3OL4 A;  1X19 A;  2CMP A;  3D5R C;  4BDY A;  4ZTF A;  1VZ0 A;  2V6E A;  4BE0 A;  2R7S A;  3OWT A;  4LIT A;  3OYL A;  2VQG A;  3PSF A;  1Z21 A;  3N05 A;  1LKX A;  4II2 A;  3VYU B;  3OYB A;  1QU3 A;  4H4K C;  2HVS A;  2UWM A;  4F52 A;  1X1C A;  1MW7 A;  2VAS A;  2WY8 Q;  2X1E A;  3H9G A;  1PJR A;  4ZDP A;  4N4O B;  4QPO A;  3QOE A;  2VJI A;  2W1O A;  3RQ4 A;  3FDY A;  3C2G A;  4XQF A;  4CCO A;  4B3X A;  2PJR B;  3OYK A;  2RRE A;  3CP8 A;  3EUA A;  3DWL E;  2K3P A;  1D1A A;  3W2W A;  4DJA A;  4EAT A;  3OY9 A;  3DU6 A;  2WA0 A;  3VWB A;  1X1D A;  1Y56 A;  3AL0 C;  2WY7 Q;  4BJ6 C;  4C30 A;  3OYH A;  2R4G A;  2HU9 A;  2RNG A;  3K4J A;  2R7V A;  4XL9 A;  5HVQ C;  2KPM A;  3AKZ A;  3W3C A;  1Z3X A;  4BJT A;  1X4P A;  2JA2 A;  4F3Q A;  3S3O A;  3LSM A;  1ZEL A;  3LSK A;  5HNF A;  1Y6I A;  2GOM A;  4B47 A;  3ZCO A;  3OYJ A;  2O5R A;  2F4I A;  2XF5 A;  1YX3 A;  3IP4 B;  2MFZ A;  2DT6 A;  3FBI B;  2Z1D A;  4D1Q A;  2VLA A;  4PJM A;  3ZXS A;  3L2U A;  3PNV A;  1DQU A;  2KQR A;  4GRI A;  3A4C A;  4KIS A;  2A6T A;  2Y0S A;  3VYS B;  4ZJZ A;  1DGR M;  3RSN A;  4IZZ A;  1T95 A;  3BCA A;  4BU2 A;  2IGK A;  3SYT A;  4BS9 A;  1N77 A;  2CV2 A;  3MKZ A;  1MNE A;  1K6Y A;  2HNH A;  2ZXH A;  4XLA A;  4G6T B;  4CCL A;  2CV0 A;  4RMN A;  2W7N A;  3CZ6 A;  3OYA A;  4D9J A;  3KYL A;  2OV7 A;  3V42 A;  3CMM A;  1D0X A;  2WAF A;  2CUJ A;  2Q2E B;  3K4B A;  4PSW A;  2X85 A;  3I9V 2;  4Y4R A;  3EUH C;  4XLH A;  5HOO A;  2LG4 A;  3KEY A;  4HG2 A;  3NWT A;  2CW7 A;  3K70 C;  3M1C A;  1S9H A;  1G59 A;  2MC4 A;  4BL0 B;  4NQW B;  1UG0 A;  4XKW A;  3A1Y A;  5HNH A;  3LFU A;  3OYE A;  2L5Q A;  4FET A;  3LMM A;  2HVQ A;  1J09 A;  1OR7 C;  1AA7 A;  4XR6 A;  1Z7L A;  2F5V A;  2VQL A;  3OYF A;  2E60 A;  2R7W A;  2M7A A;  4PFO A;  1SAU A;  4BDZ A;  3S8P A;  4DGW B;  2BVM A;  5KCM A;  3BCB A;  1UAA A;  2K5C A;  2DCE A;  2XAU A;  3QOD A;  4HEA 2;  4U87 A;  4HPQ A;  3DQV C;  3H0D A;  1LFP A;  2XSJ C;  3UNG C;  2DOA A;  3OR1 C;  3OYD A;  2NOJ B;  2VIX A;  3K4M A;  4CCJ A;  1OLT A;  3D5L A;  1P9Q C;  3L2V A;  2M3A A;  3W2A A;  3H9J A;  4IKF A;  3SDB A;  4BUP A;  2KL4 A;  2ELJ A;  2GOX B;  3PUB A;  2CUZ A;  2WBM A;  2KP6 A;  5CKT A;  4C9Y A;  4BGD A;  4E7L A;  2VKD A;  3FKJ A;  4F93 B;  4P1W A;  2CW8 A;  3HOS A;  4F55 A;  2UUZ A;  2WAD A;  2L9N A;  2V1N A;  4IX7 A;  2VL8 A;  3HL2 A;  5LD2 C;  3QYE A;  2ZFU A;  1MMN A;  4HRI A;  2A5W A;  2OC6 A;  4LIU A;  4OAZ A;  4RLF A;  1FMV A;  2XF6 A;  4CCN A;  4E4H A;  2R7R A;  4PJN A;  3K6G A;  2KMU A;  2E1M B;  2VB6 A;  4XN3 A;  5TGT A;  3VSK A;  2M4G A;  1FMW A;  1PYV A;  1WJF A;  2LYC A;  2V4J C;  2CFO A;  2E1M C;  4XLF A;  3LSH A;  1WJE A;  5FRM A;  3BG7 A;  2M4K A;  3CES A;  3F9K A;  3S3M A;  3C2H A;  2JSP A;  3SZG A;  4CSW A;  1LDK B;  1G8X A;  4PJL A;  2Z16 A;  4XKV A;  3OL3 A;  3K4K A;  4Y3O A;  4ZC3 A;  4B44 A;  4YEJ A;  2CH0 A;  2X6Y A;  3RPU D;  3SEZ A;  1X1A A;  5FRO A;  4E7S A;  4IQ4 A;  2E5Z A;  5KNL A;  3L2Q A;  2VQH A;  2R7T A;  4F91 B;  1Z3Y A;  2VXZ A;  2LY2 A;  2K9L A;  3BG6 A;  4II3 A;  3W2V A;  2DXI A;  2R7U A;  5JHF A;  2FUG 2;  3A2K A;  2VKH A;  3FHN A;  2L9S A;  3DKY A;  3SEQ A;  2MYS A;  4RM3 A;  3CJQ B;  4BEH A;  4PFP A;  4JOM A;  2UV1 A;  1WJ5 A;  2VPL A;  4MLO A;  3OS1 A;  1V5E A;  4BXF A;  2VQC A;  4XN0 A;  2K9M A;  3RTR A;  3TL4 X;  3ZGK A;  4AYB A;  4PJJ A;  3G2B A;  3TMO A;  1MND A;  4ZYA A;  1V5F A;  2HVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...