4OAYA

Bldd ctd-c-di-gmp complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
80
structure length
80
Chain Sequence
PPKLVLDLERMAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Dna binding protein
total genus 27
structure length 80
sequence length 80
chains with identical sequence B, D, E, F, G, H, J, K, M, N, R
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4oayA00
2MC4A 5KHDA 4OAYA 4OAZA
chains in the Genus database with same CATH superfamily
2FXAA 2DU9A 1VI0A 2CWEA 3JRAA 3HPGA 4OIPF 2VONA 2O6GE 1FLIA 4M9SA 1IRXA 3EUHA 4XQFA 4FASD 5M5YJ 3R0JA 5LEJA 4EEFG 3LSHA 5F1RA 1J59A 3A0HC 4XRSA 4M71A 3V8LA 2W25A 4HNUA 5DS9A 2MC4A 3SXYA 4MFDA 4PJNA 3MZYA 2VBZA 4PJJA 2HDDA 2L02A 5GPCA 1U8RA 1OISA 2MD5A 4IHSA 4ZYEA 5E3MA 4I98B 1J7KA 4JK1X 5E1ZB 1QO0D 1QZZA 1SC7A 1SEUA 1XX5A 1JTYA 3ZN0A 2JA5J 2B0LA 2BYVE 5B66C 4ZYHA 2LKXA 5L3EA 1PDNC 2QGUA 2RC4A 2K86A 4XORA 3JRDA 2LR8A 1KU2A 2NNYA 4BU2A 4EGZA 3TW7A 4HDUA 4UB8C 1H9GA 2I10A 3SZGA 1WJCA 2P8TA 3ESWB 3I58A 4CYCB 3ZQCA 4RGRA 2FE3A 5IY5H 3UNGC 5JFRA 3U1DA 3LSTA 1R1VA 3SYTA 4AIKA 2JRTA 4ZYDA 2L2OA 5DUKA 5EZGA 4QLCU 2H6CA 2Y0SN 1R49A 1X3WB 2HYFA 1HKQA 3H5NA 3KP3A 3BY6A 4JOMA 2DJIA 5GTHC 3REOA 3G4SI 1EJ9A 3OY9A 3CMYA 3E6MA 2KQRA 1R23A 1V55H 3HRMA 3T5XA 2E2IJ 5K1YA 3ASNH 3E1SA 3ZP5A 2Z99A 2R7UA 1ODDA 1U5TC 5FFXA 2GBYA 1HLVA 4EJTA 1XDUA 5JVTA 4XOPA 3MKZA 1AU7A 1BIAA 2DK5A 1VNDA 4BGDA 2QLZA 4WXHA 3ERED 3GTMJ 1A5JA 1ON1A 3H3ZA 2QEXI 1RESA 4NQWB 1TBXA 2IVMA 2PQ8A 1R4MB 3HC7A 3T8RA 2RNJA 4CCLA 4CYCA 2A6EF 2FU4A 1R9TJ 3QYEA 2A6TA 1SANA 4G6QA 2JZYA 2O7OA 4YG2F 2NOGA 3Q0UA 1O4XA 3WGHA 4GRIA 3W3CA 1JTXA 3NRVA 1IZ1A 1Z3XA 2DA6A 3OR2C 4L9NA 2LY9A 3IL2A 2UZKA 1T0FA 4II2A 3OYCA 2QSGX 2MBFA 3ABLH 2QYOA 2NXNB 3NAUA 2JPCA 3RI4A 3TKYA 2DXIA 1OQYA 1RZ4A 3ZN1A 3DKWA 3I3LA 2GQQA 1Z7LA 2R7DA 2V9KA 3FX3A 3H5AA 3MWMA 1I5ZA 5KVRA 2W82A 1MSEC 1YO5C 2HQ5A 1WPKA 4BDZA 3GXOA 3GX4X 5HS7A 2W7NA 1RI7A 1Z1DA 2JSCA 2OA4A 3BT9A 4OOIA 1EH8A 2VB6A 3T1BA 2QBYB 3K2AA 4IQJA 1R71A 2EILH 3IH3A 5C4XJ 3CESA 1TW3A 3V4GA 4BEHB 1IUFA 2DJNA 2VT3A 1YLFA 4N9HA 3OYFA 2AHQA 2GZWA 5L3CA 3GUDA 1PP8F 2PMZA 5ILSA 2KIUA 3E6CC 2IS1A 3AL0B 2BHZA 4HA8A 3DQVC 3LOCA 2L0KA 2BV6A 3GFJA 3ZMSA 4BQNA 4AM3A 2VODA 2ISZA 1FSEA 3EDPA 3KLNA 1WFXA 3V8JA 1SFEA 2Z33A 1WQ2A 1KGSA 2X9DA 5J1RA 3I59B 3DEWA 1QQIA 3CCJI 3R4KA 2OU2A 2LREA 4A12A 4ESJA 5LFAA 1V5GA 2R7QA 2KL4A 2V26A 4A5NA 4MQ9F 3LSRA 2A61A 3SJMA 3OSGA 5FLMJ 1FTZA 4BEHA 3G3ZA 3U1KA 4I01A 2NNNA 3F8CA 4O5VA 2CQKA 1Z3YA 4BE2A 2PFBA 4NBQA 1GV2A 3BCBA 4A3EJ 1B72B 1QHHD 5KAFC 3W6JB 3J7AO 4RB1A 4FX4A 4XLHA 2K4BA 1GXQA 1F9NA 3FMSA 3WTZA 2JA8J 1HW2A 2V1DA 3B6AA 1WSUA 3NWSA 5LHHA 4OMZA 1DUXC 2UUZA 4GYGA 1MBHA 3I59A 4G94A 3RKYA 4XKBA 3BTCA 4LB6B 3G73A 2BY3A 2VKVA 2HZTA 2TCTA 4RDUA 3OYGA 2P6SA 5CVRA 3VOEA 4WXCA 1FJLA 1ERDA 3LQRA 2FQ3A 4S04A 4NNJA 3WTTC 3K4MA 4M74A 2ZKZA 3K4CA 2HOEA 2KZVA 2O8XA 4LJZF 3RQ4A 4I6ZA 4BHPA 1XS9A 5DD4A 1IAWA 3RYPA 3D1NI 4UV9A 5D5UB 2X6WA 3H3VK 5H6QA 2KIQA 1B72A 2ZXJA 1ZREA 5F1JA 3S17J 5FJ8J 1ZLKA 5KCMA 2HKOA 3JTHA 5DCMB 4GYIA 1GXPA 3M8FA 3CO6C 1Q1HA 3NEUA 1B1BA 1LVKA 1MNDA 4V2FA 3OYAA 2RGVA 3BCAA 1BI3A 1S3JA 3I4MJ 1ZG5A 3GTPJ 3BPXA 1ZKGA 3OIQA 3PQJA 4XLCA 3AG3H 1PUEE 3GWZA 1FSHA 3E7LA 3DTIA 2TDXA 1K83J 2MH9A 1LDKB 3WE3A 3ZR8X 4YIRX 4BDYA 5J3LA 3V7SA 2Y69H 4L9VA 2WV1A 5K7ZA 4IJAA 4ZDPA 1K4TA 2HOSA 1UAAA 3I53A 5JHFA 1WJEA 1SD6A 4JQFA 4UXNA 4UUSB 4MLOA 3F72A 2AQFA 2KDZA 1OR7C 3PSFA 2EWNA 2DAOA 2K3PA 1IDYA 2LRDA 2W00A 3B02A 2V4JC 5E1WA 1XTAA 3BR0A 2CH0A 4B47A 3RQIA 4HW0A 2LD5A 2JSPA 5CVUA 1I6HJ 3LWFA 5CLSA 1XN7A 4IKFA 4BYYA 4LLLA 3E3VA 1XMAA 2UV1A 4UV8A 3G6EI 2PX9A 2K9LA 1JUPA 1BJAA 2VKHA 1X3UA 4P55A 2MGQA 4L5JA 2BGCA 2N8GA 1FOYA 1FOKA 3GO5A 3ECOA 4S05A 4XOTA 2VOPA 1VQ8I 4KA4A 2UXNA 1MMGA 3DFGA 3G1OA 4PK4A 1ETYA 2XPUA 3RKQA 4G6TB 2CSOA 3CF2A 4ETSA 1I27A 3QPLA 2K5CA 2F5VA 1PJRA 4BUPA 4F3QA 3MKLA 2AXLA 4UUSA 3J81Z 2YR2A 4J19A 1G59A 3A2KA 2CMPA 3L2UA 2YUSA 2M9HA 5L3BA 5DTDA 4A3LJ 2AS5F 3HBLA 2M8GX 1ZK8A 2BXYA 2VC0A 4LIUA 4E7KA 5GADJ 4C2MJ 2BY1A 1BC8C 4CHUA 2M5WA 3V7CA 3TL4X 3DKXA 2DFEA 2IGKA 3SQNA 2PBIA 1S9HA 2HWVA 2OQGA 4WWCA 3CCRI 5D5XB 1D0YA 1X1DA 4BY7J 2F6CA 1IN6A 2H6BA 2LP0A 2W24A 3BG5A 5ICFA 1BI0A 5J4YA 1Z77A 2IAIA 2NVYJ 4KYWA 3J80Z 3EYIA 3DPLC 1IXRC 2P0WA 3SFIA 3RJPA 4F7ZA 2M1BA 2MW8A 3GTKJ 2K9NA 1IXSB 1YHQI 1XSVA 1CGPA 1K6OA 4HNTA 2PJRB 1BJZA 5CPRB 4Y3OA 2HQRA 1U3EM 1REPC 1Y56A 4BQAA 2DCEA 3HUGB 5EG0B 2FEZA 2KT0A 4BHBA 1VQKI 2JTVA 1RKTA 1DP7P 3ZGKA 2PEXA 3GEZA 2DA1A 4RAYA 1RPWA 2E71A 3GFLA 1HQCA 1VF9A 1VQPI 4ZZLA 2DFIA 2ECBA 3KEQA 3SDBA 3K69A 1HDPA 4IRIA 3E6BA 2E5ZA 5HLTA 2LNBA 2MA3A 2WADA 3S93A 1I50J 4L5IA 4Z2YA 1Z6TA 4HX4A 4BE1A 3VDXA 3I71A 3FF5A 5HDGA 2PJRA 4LLGF 2ZXWH 3MQ0A 4CICA 1U9NA 2F5DA 5LHGA 4C3IJ 5KAIC 2Q2EB 5GAEJ 5EG0A 2EQRA 3BR6A 4XONA 3E0JB 2JA7J 3ZMUA 4JP0A 2E1NA 1WJFA 5EEAA 2XGXA 1TNTA 2W48A 4HG2A 1U0JA 3CQZJ 1DQUA 3DLAA 5HLIA 4LOCA 2B63J 2Z5UA 3PFIA 2M7BA 3GLLA 4OAZA 1NH3A 4RGSA 2KLOA 5E3OA 2X1CA 4PFOA 3EETA 4Y4RA 4BJTA 5BS6A 4LG3A 2XB0X 5HDKA 1SFUA 4AC0A 2K9QA 2EPFA 5K5QA 4ABZA 4AWXB 2ID3A 1VTNC 5TGTA 3TDUC 2HTJA 1QZYA 4I76A 4D9JA 2RNGA 3DCFA 3F3XA 5AONA 2KFDA 4AYBA 1WCMJ 3CO7C 2D1HA 2DMPA 4CCMA 5B1AH 1SMYF 1MW7A 4AU7A 4W97A 1UHSA 1JKRC 2D5VA 4CH7A 3FK6A 1VQ5I 2JN6A 3BPVA 2M2EA 1BW5A 1T95A 3RKXA 3S14J 1QGPA 4Y33A 2R7FA 3B73A 4YEJA 4FHTA 2H8RA 5FLXZ 4IF4A 4DIQA 3J7YJ 2R7RA 2VJJA 5F0CA 1SAUA 1Z6RA 5EEHA 2JK3A 1F4KA 3K10A 3TOBA 4Q4ZF 1NG6A 2E1MB 1ETKA 4PGHA 2COBA 3LSPA 1AKHB 3UR3C 1MBGA 3ZQQA 3W2VA 4IZZA 5C4JJ 3L09A 1J5YA 2PMUA 3FHNA 4XRMA 3W6KB 1DPRA 3CLQA 2BVMA 3IKTA 4XLEA 1S7OA 1OKRA 1EH7A 3K1NA 5LRRA 4BAYA 1YI2I 2UXXA 2EV0A 1ZH5A 2RQQA 4PUSA 1VQ9I 3DEUA 3OMYA 2DDBA 3DPUA 1I1GA 5J1UA 1WH5A 4UUVA 4LLNA 3DBRB 3R60A 2RDPA 1DGWY 4ENKA 4CCKA 3IWZA 4I09A 1WJDA 3ZMVA 1ACIA 4DGWB 2ISYA 1R1UA 4M3GA 2ACJA 2DFHA 4CA0A 1AA7A 4DZPA 4DZJA 1N77A 1AKHA 2KRFA 2JWTA 1X19A 3LAJA 2YX7A 2Y9YA 3BQZA 2WA0A 2X48A 3BDDA 3OL3A 4E4HA 2ZJPF 4E7JA 1OCPA 5BOXA 2L3DA 1H0MA 1UMQA 1DDNA 1KU7A 2LY2A 1A35A 4ESFA 3BZKA 4DQ2A 5FKOA 4FISA 4Y7NJ 4OIOF 2H1KA 2PG4A 4AVPA 3L2RA 3QPSA 2DA5A 5LD2C 2VXZA 2P5KA 2BOLA 1R7JA 3HJEA 2BVLA 5JR3A 2R7ZJ 4B48A 1OMIA 4JX4A 4ZTFA 2A5WA 2QCOA 4L0ZB 1A6QA 1WI3A 3G71I 1UZCA 4FE7A 5FRNA 2FRHA 3MAJA 1XGSA 3PL8A 2DODA 3BG7A 3PO3J 3MMYB 4EJUA 2M4GA 1S6LA 3FM3A 4NC6A 2DQRA 3CCLI 3HIFA 2JMWA 2CG4A 3LMMA 1I3AA 3KYLA 3TO7A 2IRFG 2CFOA 5HS9A 2RREA 3HHHA 2ZXHA 4B4CA 3C1DA 3CMAI 1E17A 3RPQA 3MKWB 1S5LC 4I99C 3ZQLA 3KP5A 2CV1A 3LSKA 4AIHA 4D0PA 4BXFA 1JUSA 1FEXA 1FIAA 4II3A 2NOJB 2HPIA 2HYJA 5F27A 2IS4A 2XDVA 2XIGA 3GYHX 3K70C 1WKMA 1Z67A 4QWQA 4L18B 3IAM2 2VJ4A 3TGNA 1TWGJ 1S8NA 2TRTA 3IRQA 1KA8A 1HCRA 2GA2A 2CJJA 3P7NA 2OTLI 2Y31A 2CW8A 2LTPA 1WRJA 2CW0F 2LOOA 4Q5SF 2P81A 2CYYA 3Q9SA 2L7FP 4P1WA 3W6VA 4B8XA 4XK4A 3ML6A 4M3EA 2WAQA 3NWTA 2W84A 3O8HA 3S16J 3H3UA 1ETWA 2JJ7A 4RMNA 2O3FA 2MG4A 4HDVA 2EFOA 2ZSHB 2A07F 3LSIA 1IN4A 4XLAA 1IXCA 2W57A 1E3PA 2XAHA 2K7LA 1ONVA 4XRFA 4GDFA 3DU6A 3L00A 2KISA 3OS1A 4E7HA 3ZQHA 4DBRA 3WGGA 3PUBA 3QP5A 2V1UA 1XSXA 2XRLA 2L7ZA 1P4XA 1RR7A 4I0BA 2JUGA 3EQLF 3QU3A 4RB3C 1ZELA 2ME0A 1EA3A 2EV6A 3LA7A 3CCQI 2VT2A 2H1LA 2Z3YA 3WTSC 1WGXA 2VJIA 4R8HA 1UJ8A 2R3SA 3R61A 2R7XA 2Z16A 1K61A 4CSWA 2BEOA 4GO1A 1NK2P 2VOOA 5IT9K 2YX4A 1FOXA 5GP9A 3CCUI 2NVTJ 2QQBA 3EPZA 4HEA2 1LE8B 1Y6IA 1GV5A 5LGUA 3O3KA 1DU6A 2H27A 5JLWA 3CDHA 2BY0A 2I8DA 1MBKA 5TRDA 1VZ0A 1U9OA 5M3FJ 3BG9A 5CYVA 1D5VA 2RKHA 2XF5A 4KIFA 2CUJA 1OJLA 1E0EA 2Y75A 1ZG1A 2E7WA 1FYKA 2F5CA 3KX2A 1QHGA 3TMOA 5E17F 2GA1A 1E3OC 1XGMA 2HI3A 1QNTA 1H9TA 2VQHA 3F8NA 5GAGJ 3O6BB 2HQNA 4M6VA 3F22A 1K4SA 3WGIA 2AO9A 2W85A 3GMEA 4H0EA 4KN4X 4HQMA 1V54H 1Y0NA 3HB9A 4RAFA 4CO8A 4DYRA 1J9IA 1ZR2A 2GIVA 2L9NA 3RYRA 1T2KA 3OIPA 1LPQA 1LE8A 1HSTA 4IHYA 3MFKA 5F6FA 5FLVA 1QPIA 4GXOA 1FBUA 3BTIA 2DT7B 5FGMA 1XMKA 2PMZN 4B3AA 1XCVA 2V9PA 3H0DA 2XC7A 1FPQA 1J2XA 3BTLA 2ESHA 5J4VA 1G2HA 3ZOBA 1DGRM 3SZPA 5J1YA 1NG7A 2DT5A 5EJCA 1Y1WJ 1G3WA 3HRTA 1IUYA 3F23A 3HSFA 2DOFA 3F9KA 2OPTA 1TZLA 2LKSA 2HKXA 5K7FA 3HTUA 1D3YA 1VFCA 3VB2A 1P4WA 5D4SA 3GTJJ 2IJLA 4KIGA 3CP8A 1O3SA 4PZJA 4FTHA 4G9YA 4GFBA 2WBMA 2M45A 2X6YA 4G8XA 5D6EA 5BMZA 1HSJA 3K6GA 3IV5A 2A05A 3EUKL 1IW7F 4IHTA 4MO7A 1N78A 1U2WA 4NUBA 5GPAA 5M5XJ 4HX7A 1T8IA 1JE8A 1E2XA 1QVTA 1SFKA 2CQXA 1ZRFA 2FA5A 5DDGA 3C2GA 3T8TA 4HQEA 4IO9F 2ETHA 1QRYA 3L2QA 3ELKA 1R5GA 2M8EA 5CVJA 2HVQA 3KFWX 1YIJI 1Z05A 5FD5A 2F5EA 4LIVA 3RTRA 4WK8F 3TEDA 4KICA 5DD8A 3KZIC 4JBAA 5LEKA 3QYBA 2XAQA 3HOZJ 2Y0SA 3WTVC 3W2WA 3BJ6A 4XN0A 1VQOI 2HR3A 2GXBA 3P9IA 2E35A 1G3SA 3R6SA 5ICCA 3CMEI 1KONA 5JVGF 1ON2A 1OR7A 2X1EA 2DK8A 3AFHA 3MCZA 4M3FA 5J40A 3M3YJ 4F93B 2CQ7A 2R92J 2DMQA 3GTOJ 3M07A 1CQTA 3PIOF 1JGSA 3D5SC 4MEXF 2OF7A 2EZLA 5IT3A 2DOAA 2D45A 1FTTA 5H20A 3ZQFA 3HYIA 2L01A 4LFUA 2L9SA 1R6RA 1X1CA 1OLTA 1JKQC 4RLFA 3DKYA 4A0ZA 5C44J 2ZCWA 3LA3A 5J47A 3JRIA 1JT0A 2HQAA 2VI6A 3HZJA 4WF2A 2CV0A 4HAMA 2R7TA 3G1MA 4C3HJ 3ABMH 1QPMA 5KHDA 1JT6A 3S1RJ 3OYHA 4A5MA 2EFPA 3CCSI 1ITYA 2E2JJ 3FHZA 2W1OA 2MD0A 3K7AJ 2IBDA 1YOVB 1R58A 1W5SA 1FZPB 3KP4A 3QPTA 9ANTA 1HW5A 2VBXA 2QENA 2ZMEC 3OOPA 3HOXJ 5FRMA 4E7SA 2XSDC 1TWCJ 5HOOA 3I64A 3TW6A 2K02A 2M30A 2VPLA 4HOBA 2V1NA 3CCYA 3ZMDA 2HTSA 3Q5FA 3K4JA 2P4WA 5K7HA 2HVRA 2VBYA 2R7WA 4KMUX 3DV8A 3JTGA 1LEBA 5LHIA 5TJJA 4CUGA 1GT0C 3CJRB 4A3GJ 1G6NA 1YG2A 2DA7A 2OBPA 4V19K 4FQGA 2OQRA 3HPHA 1LVAA 2ZBKA 1S29A 1RUOA 2Y2ZA 1HKTA 1QA6A 3IH2A 3ABTA 3CUQC 1BN5A 2QKMB 1XGOA 5AIQA 4BL0B 3DTKA 4BXUA 3JRGA 5A2QZ 1AWCA 1P6RA 2XUBA 4BJ6C 1MMNA 4PCQA 1HF0A 3Q3SA 3WG9A 5M5WJ 2XF6A 3VFZA 2EH3A 1FY7A 3IWFA 3JREA 3WTWC 1W0UA 3KP2A 4P96A 2CRGA 5EEGA 1A6IA 4HSRA 4U88A 2NS0A 2L4AA 2X1DA 4OINF 1UFMA 5HS8A 2LSOA 5BQTA 1LQ1A 1XGNA 3H1CA 3S1NJ 3DP7A 3KZZA 3LNQA 4HV5A 2XAFA 4MIMA 4EM2A 1VQNI 3BJOA 3VYRB 3FXJA 4BQOA 2Y0MA 1YW8A 4EJOA 3BROA 4L9TA 4IQ4A 4E70A 3WTUC 2GXAA 2DFFA 4CZZA 4KJZA 5F0FA 4KNYA 4UB6C 3OYEA 1TW2A 3K2ZA 3QYFA 2JVGA 4DNCA 4PSWA 4HF2A 2EJRA 1ZQ3P 3LQQA 3PO2J 2IS2A 1FP2A 1FBQA 1K6YA 1XCBA 1UHWA 2BHYA 2L4MA 3QP6A 1P7JA 4LITA 5DV5A 2VPRA 1AOYA 3M7GA 3U9GA 2DDAA 2ADUA 3SEQA 2F48A 2LK2A 3CP2A 1W5CC 3B6CA 1MSFC 4LG0A 2H09A 3CUOA 5D4RA 1YFHA 2XVCA 2OZ6A 1SD4A 2ZXIA 4A0YA 1MH4A 1SVLA 3S3NA 2XASA 1VQ6I 1SVMA 1YITI 1D8KA 5TISC 1V5EA 3GVAA 4PFPA 2HGCA 4M73A 3S2HJ 3VYUB 3JAMZ 3AL0C 2DLLA 3GLXA 4GGGA 5EZHA 4Z6YA 4WCGA 2DN0A 2J5PA 2M7AA 2VQCA 4RB2C 1H8AC 4KT6A 1T39A 1ZRDA 3CJQB 4DYCA 2G0EA 4P9UA 1B4AA 4C2UA 2XROA 3ABUA 1ZARA 1BI1A 1MBEA 3HRUA 4BJ5C 2DYRH 2YU9J 2NS7A 2XHKA 1G4DA 1JKPC 3FXLA 3PQKA 3PNVA 3HM5A 3A0BC 3LSJA 2VJ5A 2LH9A 1KU9A 4HX8A 4XMYA 4ZDLA 4RAGA 2Q0OA 5HLHA 4NHJA 5HNFA 1TC3C 2CUFA 1F5TA 3N4MA 1FOWA 4LMYA 3Q0WA 2F2EA 1SMTA 1BR1A 1BA5A 4D7MA 4M6YA 2CV2A 1K7AA 1R36A 4MHGA 1BOBA 1JUMA 1WVRA 3IH4A 3ZMTA 5B5EC 5F64A 2IT0A 3A02A 1IN8A 2EFWA 3OS0A 2V6CA 2MC3A 1A31A 4Q47A 1IN7A 3VPRA 3M8JA 1ETQA 4BACA 3M1EA 2QZ8A 2EA4A 1M1EB 1I39A 2I5UA 4AIJA 2FQ4A 5F04A 2G9WA 2LVSA 3M1CA 3OV8A 3HGYA 4LK0F 5ERIA 2QSFX 3FM5A 4M3DA 4OIRF 1K79A 2P7VB 4X0GA 2STWA 1RETA 1IV6A 2A69F 1YJNI 2FJ1A 4L9JA 2AQEA 1R00A 2JUCA 5E20A 2BBYA 4MFEA 5BPIA 4G7HF 1JJ8C 1Z7UA 2DQLA 2QVOA 4DYQA 2X4HA 1D1BA 2ESNA 3C2BA 3W2AA 2HOAA 5H6RA 2J5OA 3BWGA 4F92B 4HF1A 2K40A 4XRSG 1BL0A 2EZIA 2LC2A 4JX6A 4C3JJ 3TP3A 2YSRA 2O9LA 2ZSIB 2K3FA 3OR1C 1UHMA 4UNOA 4L5EA 1X2NA 3SEZA 4O6JA 1O7LA 4B09A 1X3ZB 4LGWA 3CTAA 3I54A 1ZN2A 4HBLA 2WB1A 4AD9A 2QUFA 3OYDA 2IP2A 4QTRA 5IYBJ 1S72I 1XD7A 3P5JA 2DPUA 2OUMA 4IX7A 1LFPA 3I4PA 2ZFUA 1HW1A 2LBFA 2GLOA 4ZYGA 3QQAA 3HOWJ 1RNLA 2PN6A 4O3MA 1MZBA 4I7HA 1W1WE 4RAZA 1B8IB 4F52A 3HOTA 1NTCA 3Q0VA 1E3HA 3F6OA 1NHAA 1B9MA 1MJAA 2FD5A 4MTEA 4PJ0C 3GFMA 3P9KA 5GTIC 1Q1VA 4M3BA 4D1QA 1SFXA 2KP6A 1MJBA 4NB5A 4XICA 1XB4A 3IP4B 1LKXA 2LY1A 3G1LA 2JQ7A 1WWXA 4XKWA 3I4NJ 5JI6A 4FETA 3IKVA 3QU6A 2GXGA 1F1ZA 2JRMA 3BR3A 2P6TA 1A04A 4A6EA 2ID6A 3K9TA 3HSRA 5D8KB 2XKOA 1KZHA 2O8KA 1MIJA 2PJPA 4CCOA 3RCOA 3TBIA 2PI0A 3C3WA 1JXSA 1B8IA 1XSDA 4PGGA 1ULYA 3AG4H 3DF8A 2C6YA 3S32A 3IAS2 2VASA 2VBWA 4CXFA 3J81K 1RR8C 3K4KA 3OL4A 4XLPF 2ZO4A 3MKYB 2VQLA 1EV7A 2H94A 2E5NA 2DMTA 2XAGA 3D5RC 1I1SA 5E3LA 4LD5A 1MMAA 2FBIA 4X1EA 2GOXB 2WTEA 1W7PD 2WV0A 3RPUA 1Y8QB 4U0VA 4MQVA 4OMYA 5IPAA 4G7ZF 3KYCB 2XPWA 3PSIA 2V79A 2FUG2 1R1TA 2DMUA 2YPRA 5D8LB 3BLYA 3J80K 2A5YB 2M0CA 5CQGA 1MMDA 5CVVA 4UVBA 3PJRA 3JRCA 4RA2A 1U5TB 2EB7A 4W1UA 2P7CB 3IC7A 2COMA 5D5WB 1D5YA 5D5VB 4XBFA 5HNHA 3L2WA 1HC8A 2GAUA 5CKTA 1JJ6C 2F4MB 3JRFA 2WAQN 3T0YA 2LMDA 1P2FA 2XKPA 4I2OA 2EIKH 2K27A 3I0TA 3K4NA 3KEYA 4IHXA 2E60A 1WZ2A 1X2MA 2CQQA 2G7HA 2XB5A 3BR1A 2VN2A 4M9ZA 1IRFA 2FBKA 2K85A 4EM0B 1T38A 3I9V2 3OYLA 4P9FA 4BBRJ 3E6DA 1D0XA 1G8XA 5F0HA 2EIJH 2PMHA 4G6DA 3ZQ7A 3ZXSA 1MNMC 2DA3A 2M4KA 1XMXA 4CCNA 3ZCOA 1XDSA 2E34A 1TWFJ 3F6VA 1RRJA 2WY7Q 1X1BA 3KETA 5IYCJ 2KRHA 2R7SA 1Y39A 4UUTA 1U5TA 4EJWA 3HGGA 4ZTJA 1XPXA 2O03A 3SFZA 4A3IJ 1YX3A 4M6XA 5HODA 3OIOA 1YRNB 3R0AA 2E1CA 1YW9A 2QKLB 3V8KA 3KEOA 3QAHA 5DYMA 2LYCA 2EBIA 3KLOA 5J8FA 1OCOH 1B6AA 5FO5A 1FX7A 1TTYA 1J09A 1YX5A 4U7BA 3OYMA 3QRFF 1O3RA 2D1VA 3K1PA 1ZLJA 2HVSA 4ZZDA 3DLLF 3RDIA 5L3GA 3HKZA 4JX5A 1LUJB 4RBOA 4R79A 4B1RA 3F21A 4U7DA 2F4OB 3FXMA 1EKEA 1O7FA 1PVEA 2Q8KA 2XAUA 3A01B 2HU9A 4RGUA 3O2PE 3I56I 3GBGA 4UY8I 4KITB 3KP6A 4NC7A 3LFUA 3OYNA 1Y1VJ 1T33A 4E7IA 1YRNA 2WWYA 1X4PA 3WTXC 3VWBA 3QPHA 1H89C 2X6OA 3GZNB 4IRHA 4Y17A 2LG4A 5DM6F 4A0XA 3GZ5A 5FLXK 3CCEI 3VEPA 4AVZA 2X85A 4LB5A 1OYWA 3JSOA 4HSTA 2L5QA 4EM1A 3BG6A 3MN2A 3IUOA 1IF1A 1SD7A 3HSEA 2VE8A 1IC8A 1HKSA 3AKZA 4IOAF 4XN3A 3CLOA 2ELHA 5E79C 1WJAA 4RS8A 5B1BH 1YJ9I 3WU1B 1YS6A 2CS3A 2IGOA 2DW4A 3CCMI 1OCZH 3A01A 2QQ9A 3FXOA 2BY2A 3Q9VA 3V7RA 3OSFA 3BC8A 1QBJA 1YQAA 1B9NA 5AIPA 1YJWI 2VE9A 4HZFA 1TNSA 4XL9A 4IRGA 2DO7A 3GZ6A 1JKOC 1LDJA 2ZMEB 1BI2A 2FF4A 1O3TA 4N4OB 2IA0A 4ANJA 1UCRA 3DU5A 5IOYA 1Z91A 1TT0A 1ZTRA 3A03A 4ITVA 4A3JJ 3H36A 2ECCA 1R5ID 3L2CA 4ZYAA 2ZJQF 1RC9A 2ICWG 1QU3A 2HZDA 5LRSA 5DEQA 4QPOA 2IEKA 3JRBA 3ZMZA 5B3SH 5J6XA 3WU2C 2X51A 2NVUB 2STTA 2KJBA 3H5RA 4BNCA 1PUFB 3RSNA 4XR6A 1X1PA 1YYVA 2HYGD 5DCFA 2EFNA 2KPMA 4E6KG 4DW6A 5HVQC 2KIMA 1I3QJ 1FWZA 4Q48A 3CUQB 2OCCH 3HOYJ 2NAZA 3CD6I 5KNLA 4YIFA 2DMNA 2XGDA 4IOCF 2MYSA 5ILVA 4DBQA 2GWRA 1YIOA 4ENMA 5JLXA 4A3KJ 2ZMEA 3L7WA 4B44A 2HNHA 3ZQGA 3ZRGA 1ETOA 5E1XA 2GIZA 5FKNA 2JVHA 1U78A 3H9GA 1DPUA 4YELA 4C9YA 3FKIJ 4JYKA 1Y8RB 3DWLE 2X6XA 4PSXA 3CZ6A 3PM1A 1P92A 1ZGJA 1ORKA 1PUFA 4ON0A 4BQQA 5ED4A 1AHDP 2WAEA 2IW5A 2KHMA 2KDOA 3S2DJ 4P5OA 5LLQA 3TOAA 2EZKA 1FIPA 5FB2A 3CUQA 1K78B 2VC1A 3GTGJ 3WU0A 4CDGA 1SAXA 2XGEA 2FMYA 3WG7H 2QQAA 1HA8A 2XGCA 1JI8A 1I6XA 4OWRB 1NK3P 1U8BA 2V6EA 4OIQF 4N4NB 3MZHA 1KU3A 2IXSA 2CFXA 4G12A 4QIWN 3EUHC 2QWWA 3J7ZI 1BIBA 3FDYA 3TDZC 5LGTA 4NQWA 4IL6C 2RAEA 3BG3A 4EATA 5K5OA 2PLYA 3CC7I 4FCYA 4ENJA 1F43A 5IP7J 3RZOJ 3SDGA 3ZQIA 3GTLJ 1QZEA 1WHUA 2NYXA 1USTA 1D1CA 3S2WA 2AXTC 2CO5A 2KKOA 2L7KA 4KN7X 3S1MJ 1X4OA 2M3AA 4KISA 4A69C 1K78A 2GM4A 3I5UA 4MGRA 3KYDB 1DU0A 2GOMA 2ELJA 4FX0A 5CVIA 1EF4A 1IGNA 1OFCX 4HV6A 3WODF 1WJBA 4XLNF 2L9RA 1IO2A 2VKDA 2MSYA 4LK1F 2K4JA 4PJLA 4EV0A 1W4MA 2QSHX 2ZJ2A 3RZDJ 2D2WA 2QM3A 3M8EA 1QVUA 4XM3A 1R22A 2EINH 3HEFA 2DBBA 2E36A 4EQQA 3PIPF 2EK5A 5FKKA 1L0OC 4F91B 3OYIA 3FISA 1W36D 4UVCA 2QBYA 1OCCH 2VXDA 4EGYA 4C2TA 4IVNA 3BZCA 1D8JA 4HRIA 3DXJF 3U21A 3AG1H 1TL8A 3CCVI 1X58A 2O0YA 1PP7U 2OD5A 2HDCA 2EA2A 3E5QA 2A6HF 2IGMA 5KK1A 2RV8A 4KT5C 4S0HB 2HEOA 4G7OF 2DOEA 4A3FJ 1TWHJ 4N9IA 4YFNF 3E5XA 1IRGA 3ABKH 2NVXJ 1UG0A 1P4AA 2HDWA 3ERMA 2ME6A 2QA4I 3KE2A 4OU0A 4A2UA 5FFZA 4ZJZA 2VLAA 2R7VA 2XRNA 5IYDJ 1MKMA 1GLNA 1YW7A 3S1QJ 2FOWA 4C30A 1LFUP 1R4NB 2HXIA 3VYTB 3JRHA 4KDPA 2ZC2A 4NDLA 1T0FC 4DJAA 1FYLA 2XV4S 2ELKA 3NARA 5E18F 3P9CA 3C2HA 4MNUA 1FMWA 5K5RA 4H4KC 3S15J 1C0WA 2BXZA 3FK7A 5C3EJ 3X2QH 5DM7F 1STZA 4QPQA 4E7LA 3KIOA 4U87A 1YS7A 1D1AA 1ENHA 4IPAA 1Z21A 2A3SA 3TQNA 5J8CA 4LG0B 2MLKA 2NVQJ 2E19A 2CW7A 2V7FA 3D5LA 1JHFA 4QSHA 4Y52J 3KP7A 1UELB 2BW3B 2K9SA 4A93J 3V42A 1VQ4I 3M9AA 2DI3A 1ZR4A 1TLHB 3HG9A 1HXDA 5E8GA 4IEJA 4DOZA 1CF7B 1A36A 4BY1J 3HTSB 4Y13A 1GUUA 2Y48A 2IA2A 1OPCA 1KYWA 5BNGA 1DP3A 1MJ9A 4MEYF 1Z9CA 3MVPA 3BTJA 5EDNA 4BBSJ 1FMVA 2HFHA 3N05A 1BR2A 5DCMA 2EZHA 5LBQA 4HLXA 3JSPA 3WTYC 2JT1A 1GVJA 1FT9A 2EFQA 2KMUA 2K9MA 3BR2A 2R4GA 3FXUA 1KQ0A 3A1YA 5FKLA 3HOVJ 2BW3A 2L9VA 3BP8A 4UVAA 3TO6A 3ASOH 1VQMI 1OCTC 4YRVA 2ZNZA 2HS5A 1FP1D 2VIXA 1USSA 4J01A 3CDIA 1CF7A 3BZ6A 4ESBA 2R5ZB 3QOPA 3RKWA 3IHUA 3K4BA 2M0MA 3JW4A 2VL8A 4J00A 1BW6A 3QODA 4XLFA 4HF0A 3VSLA 5CJ9A 3CJNA 1LDDA 3DEEA 3EYYA 2ZNYA 3E97A 3C18A 5DUIA 2RN7A 2RVCA 3GFIA 3CC4I 2MABA 2EIMH 4A3MJ 3ECHA 3N97A 3F0CA 1N25A 1V4RA 3FIWA 4YFXF 3NQOA 5M3MJ 2OTJI 1WJ5A 2WAFA 4L0YB 3PFYA 2DA2A 3H92A 4I02A 5L3DA 1VQ7I 1MH3A 3FMQA 5HDNA 1GHCA 4N0BA 3UKGA 4GCVA 3PNYA 1Z0XA 1Y0UA 2WB1N 4AYBN 2R5ZA 1ZGAA 3SZTA 1TWAJ 1B59A 2OZUA 2Z2SB 2YU3A 1W5TA 1F36A 4CCJA 1SVOA 2FX0A 3BJAA 1ZRCA 1GVDA 5LGNA 5EF6A 1HBXG 1JGGA 4M72A 1POGA 4XKCA 1J75A 4EMSA 2JA2A 4NC8A 4I0AA 2JPBA 3MZ8A 2KIFA 1O3QA 4PJMA 2P5VA 2F4IA 1XC5A 3FXRA 1TT5B 1TQMA 1X1AA 1LB2A 2W4SA 4D7NA 1HOMA 5IOZA 1SD5A 2ZB9A 2DA4A 3BOQA 3CMMA 1J0RA 2QF7A 1W36C 1T56A 2OJED 3JR9A 2VQGA 2LBFB 3ISPA 3RIRA 1LNWA 1D0ZA 3FKJA 2L54A 3G2BA 3LL7A 1APLC 3WE2A 3WHBA 2CGPA 4BH9A 1FC3A 2LF7A 3WHCA 5IP6A 2KJCA 2XSJC 3OWTA 1ETXA 2R7OA 3LSMA 4XSXF 3K70D 2HPMA 2LLKA 2Q1ZB 4A3BJ 1IDZA 2E1OA 1BC7C 2RQPA 2CQNA 2R5YB 4HLYA 4KIBA 1FBSA 4YFKF 3TO9A 3HUGA 1ZGWA 4IHWA 3JCUC 5EGOB 1TP4A 1H88C 3FMRA 3HRSA 3GCMA 2A68F 5A2QK 2B7EA 3AG2H 3COAC 4BS9A 3GW2A 1ZYRF 2LDUA 1VQLI 3SHFA 2V9VA 1G3TA 2CUEA 4E7ZA 3HDDA 1TQIA 2M34A 4B43A 2Y30A 2IGNA 5E8IA 4CGZA 5FROA 2M87A 3IRRA 3H35A 3QWLA 5ILUA 2NS8A 6PAXA 3VYSB 2F5FA 4B3XA 3LFKA 4U0WA 5H2FC 2OAZA 1LJ9A 2XPVA 3RPUD 3L2VA 4RLQA 5E3NA 4BXXJ 2IS6A 3H0GJ 3H9QA 4XSZF 1T08B 3LAPA 5L3FA 3D0SA 3K1MA 2R5YA 3TP0A 1PYVA 5FKMA 2R93J 2CU7A 2Q2EA 4BKXA 3OYJA 2FBHA 5EGOA 1ZAOA 5IP9J 1MBFA 4AIDA 1ZG3A 3F8FA 1MD0A 1UB9A 1T98A 2FMLA 2R0QC 3LA2A 3F8MA 2OCEA 4M9XA 4XKVA 1GDTA 1RIOH 3HXLA 4FE4A 3HOUJ 2DT6A 1RUNA 2V1XA 4HYEA 4IXAA 2HOTA 3K4LA 5IT9Z 1T6SA 3A4CA 3CC2I 4TV7A 1O57A 3K0LA 3PUFA 2CUZA 3GF2A 3AAFA 3HOSA 1TQPA 2O5RA 3FWEA 2MFZA 2WC2A 3KCCA 1JHHA 4F55A 5FD6A 1RKWA 1BBYA 3U2RA 3C7JA 5BPDA 1OYYA 4ENNA 1LEAA 3ULQB 2DYSH 3PNTA 1HDDC 1G3YA 4PDKA 1ETVA 4ZDOA 3HHGA 4ZC3A 3JAMK 1WH7A 4YIIA 4WX9A 1MBJA 4OAYA 4U0YA 1V3FA 3BQYA 2VUMJ 2MLGA 4A6DA 2FOKA 3I55I 3S3MA 1LFBA 2OC6A 4UHTA 2HXOA 5F08A 1IJWC 4D5FA 2IA1A 3DPTA 3MEXA 1MGTA 3FBIB 2KZGA 4ASNA 5ICEA 2MH2A 3BR5A 1OYIA 4MTDA 1WI9A 2XAJA 1S7EA 1P7IA 4RGXA 2X0LA 3OYBA 4KMFA 2KRCA 3QOEA 3DBHB 2Z9OA 4V2GA 2VKEA 1V5FA 3GTQJ 2JA6J 3HKZN 4CZCA 2XF7A 5ICGA 3OYKA 4XIDA 3M4OJ 1OCRH 1N75A 2ZFWA 4ZH4F 3VSKA 3FBNB 5CQEA 4CYDA 3CF5F 1W7PB 3S3OA 2E2HJ 2H8WA 4EJVA 1BR4A 1S7AA 3MD2A 4RM2A 1L3LA 2FNAA 2L7MP 1MMSA 2BZTA 1KYZA 2LFBA 1MDMB 3LSGA 4WXDA 2Z1DA 1IN5A 2IPQX 3FXQA 2QQ8A 1UG2A 3FXKA 4X6AJ 3KPHA 1BOAA 3ROUA 5D6FA 2Y9ZA 3ZPLA 4RB0A 3VODA 1KQ9A 5GAHJ 4HNVA 2LKPA 3CDLA 2WY8Q 2FSWA 4D5CA 1IV8A 5HLGA 2O61A 1YE9A 1KQ8A 3S8PA 3DBLB 3L9FA 3ONQA 4K2EA 3KZYA 1SFOJ 3H9JA 2ZJRF 2BE5F 4BHCA 1MNEA 4R1HA 1YTYA 1R5HA 3OS2A 1W0TA 1EH6A 3CJTB 4RM3A 3O8GA 1W7PA 3DTEA 4BE0A 2DPDA 5EYRA 1P9QC 1XG1A 1BM9A 4XNFA 4KUMA 3L1PA 3OOUA 3J7AY 3E5UA 4IHVA 2FNPA 3HL2A 1IG7A 1MDMA 2G7UA 4KFCA 4EVIA 3FZVA 4HPQA 1FYMA 4A3DJ 1U6GA 2YS9A 4FT8A 1IRZA 2UWMA 4AUXA 2NRAC 4A3CJ 4Y15A 1ZHFA 2OV7A 2B9SA 1FNNA 3EUAA 3F8BA 2EV5A 2P5LC 2E1MC 2DTZA 2LF8A 2DTRA 5JHUA 2E7XA
chains in the Genus database with same CATH topology
2ZXIA 1X4OA 3ZQQA 2M3AA 3S3NA 3W2VA 4IZZA 4KISA 3FHNA 2GOMA 2ELJA 3HPGA 1V5EA 2BVMA 4XLEA 4PFPA 1WJBA 1IRXA 4XQFA 4FASD 2VKDA 3VYUB 3AL0C 2RQQA 4PUSA 4PJLA 3LSHA 3OMYA 2M7AA 2VQCA 3DPUA 4KT6A 4HNUA 2MC4A 3CJQB 4XM3A 4PJNA 1DGWY 4C2UA 4PJJA 4CCKA 3OYIA 4F91B 1W36D 1WJDA 4C2TA 2VXDA 4DGWB 4BJ5C 4HRIA 3U21A 3PNVA 4CA0A 1AA7A 1N77A 2VJ5A 2LH9A 4XMYA 4ZDLA 1X19A 5HNFA 3OL3A 2WA0A 4E4HA 4E7JA 4XORA 2LY2A 4BU2A 2IGMA 1BR1A 3SZGA 1WJCA 2CV2A 1BOBA 3L2RA 3UNGC 5LD2C 2VXZA 2BOLA 3OS0A 1UG0A 3SYTA 2HDWA 2BVLA 2L2OA 4ZJZA 2VLAA 3M8JA 4B48A 2R7VA 4BACA 1GLNA 4ZTFA 2A5WA 3H5NA 4JOMA 2DJIA 4C30A 3M1CA 5FRNA 3OY9A 2KQRA 3VYTB 3PL8A 4X0GA 1T0FC 3BG7A 3E1SA 4DJAA 2R7UA 3MMYB 2AQEA 3MKZA 4XOPA 2M4GA 3C2HA 1FMWA 4H4KC 4BGDA 1D1BA 3LMMA 3KYLA 3W2AA 4NQWB 4QPQA 3HC7A 4E7LA 4F92B 4CCLA 4U87A 1D1AA 2CFOA 3QYEA 2A6TA 2LC2A 2RREA 2ZXHA 1Z21A 2ZSIB 3MKWB 3OR1C 2CW7A 2V7FA 3D5LA 1UELB 3SEZA 2BW3B 4GRIA 3W3CA 2CV1A 3LSKA 3V42A 1Z3XA 3OR2C 3HG9A 4BXFA 4II2A 3OYCA 4II3A 2WB1A 2NOJB 4DOZA 3OYDA 2HPIA 2IS4A 2XDVA 2OUMA 3K70C 2DXIA 4IX7A 1LFPA 1DP3A 2ZFUA 3I3LA 3IAM2 1Z7LA 2LBFA 1FMVA 2VJ4A 2V9KA 3H5AA 2W82A 3N05A 1BR2A 4BDZA 2CW8A 4F52A 3HOTA 2LOOA 2W7NA 2VB6A 2KMUA 2K9MA 4P1WA 4IQJA 2R4GA 3CESA 4BEHB 2WAQA 3A1YA 3NWTA 4D1QA 2KP6A 3OYFA 2BW3A 4RMNA 2ZSHB 3IP4B 4YRVA 1LKXA 2LY1A 2PMZA 3LSIA 2VIXA 4XLAA 4XKWA 2IS1A 4J01A 3AL0B 4BQNA 4FETA 3DQVC 3DU6A 3OS1A 1WFXA 2M0MA 3K4BA 2VL8A 4E7HA 4J00A 4DBRA 3QODA 3PUBA 4XLFA 3VSLA 3DEEA 4CCOA 2JUGA 3RCOA 3TBIA 2LREA 1ZELA 5LFAA 1EA3A 2MABA 1V5GA 3IAS2 2VASA 3S32A 2R7QA 2KL4A 2V26A 3K4KA 2VJIA 3OL4A 2R7XA 4BEHA 2Z16A 1WJ5A 2WAFA 4CSWA 3PFYA 3MKYB 2VQLA 2E5NA 1Z3YA 4BE2A 3EPZA 4HEA2 1Y6IA 3BCBA 3D5RC 1QHHD 3PNYA 2I8DA 1VZ0A 4XLHA 1MMAA 2GOXB 2XF5A 2CUJA 1E0EA 2Z2SB 3NWSA 4CCJA 3PSIA 2FUG2 2UUZA 4XKBA 3KX2A 3BLYA 1QHGA 4XKCA 3TMOA 2JA2A 4NC8A 3OYGA 5CQGA 1MMDA 4PJMA 2VQHA 2F4IA 1ERDA 3PJRA 1X1AA 2W4SA 4NNJA 3K4MA 5HNHA 3K4CA 3L2WA 2KZVA 5CKTA 3RQ4A 3CMMA 1W36C 2L9NA 3OIPA 2X6WA 2VQGA 3K4NA 3KEYA 2LBFB 2E60A 1D0ZA 3FKJA 5KCMA 2DT7B 3G2BA 3LL7A 3H0DA 2XSJC 2XC7A 1LVKA 1MNDA 3OWTA 2R7OA 3LSMA 3K70D 3OYAA 3I9V2 3OYLA 2HPMA 3BCAA 1DGRM 1D0XA 1G8XA 2Q1ZB 1NG7A 3ZXSA 2M4KA 3OIQA 4XLCA 4CCNA 3F9KA 3ZCOA 1TZLA 3DTIA 3ZR8X 2WY7Q 1LDKB 4BDYA 1X1BA 2KRHA 2R7SA 3CP8A 4ZTJA 4BS9A 4ZDPA 1YX3A 2WBMA 2X6YA 1UAAA 5JHFA 3K6GA 1WJEA 3EUKL 4JQFA 2QKLB 4E7ZA 4MLOA 1N78A 4B43A 2AQFA 4NUBA 1OR7C 2IGNA 2LYCA 3PSFA 2K3PA 5FROA 2LRDA 2W00A 3H35A 2V4JC 1SFKA 3VYSB 4B3XA 2CH0A 3C2GA 4B47A 3RPUD 1J09A 1YX5A 4U7BA 2JSPA 4RLQA 3OYMA 3L2QA 3L2VA 4IKFA 2IS6A 3H9QA 2HVQA 2UV1A 2HVSA 2K9LA 4LIVA 3RTRA 2VKHA 3HKZA 1PYVA 4R79A 3QYBA 3OYJA 2Y0SA 4XOTA 3W2WA 2XAUA 4XN0A 1MMGA 2HU9A 4PK4A 4G6TB 3CF2A 3GBGA 4KITB 4NC7A 3LFUA 3OYNA 4E7IA 2K5CA 1KONA 1PJRA 2F5VA 4BUPA 4F3QA 2X1EA 1X4PA 3AFHA 4XKVA 1G59A 3A2KA 3VWBA 2CMPA 4F93B 3L2UA 3HXLA 2DT6A 2LG4A 3D5SC 3K4LA 4AVZA 2X85A 2DOAA 4LIUA 4E7KA 3A4CA 4HSTA 2L5QA 3BG6A 2CUZA 2L9SA 3IUOA 1X1CA 1R6RA 1OLTA 4RLFA 3DKYA 3HOSA 3TL4X 3DKXA 2IGKA 2O5RA 2MFZA 4F55A 1S9HA 3AKZA 1D0YA 2HQAA 4XN3A 1X1DA 2CV0A 1WJAA 2F6CA 2R7TA 3PNTA 2CS3A 2IGOA 5KHDA 3OYHA 3DPLC 4ZDOA 2P0WA 2W1OA 4ZC3A 3BC8A 2MD0A 4OAYA 4XL9A 4HNTA 2PJRB 5CPRB 3S3MA 4Y3OA 4N4OB 2OC6A 4ANJA 1Y56A 3DU5A 4ITVA 1TT0A 3DPTA 2DCEA 5FRMA 4E7SA 3HUGB 5HOOA 4ZYAA 3FBIB 2VPLA 1QU3A 2HZDA 2V1NA 3ZGKA 4QPOA 3K4JA 2X51A 2HVRA 3OYBA 2KRCA 2R7WA 3QOEA 3H5RA 1V5FA 3RSNA 4XR6A 3SDBA 4CUGA 4CZCA 3CJRB 2XF7A 3OYKA 2KPMA 4E6KG 2E5ZA 5HLTA 5HVQC 2WADA 3HPHA 3S93A 1N75A 5KNLA 3VSKA 3FBNB 5CQEA 2QKMB 4BL0B 3S3OA 3DTKA 4BE1A 2MYSA 3VDXA 4DBQA 2PJRA 1BR4A 3MD2A 4RM2A 4B44A 4BJ6C 1MMNA 2HNHA 3ZRGA 2XF6A 2Q2EB 4XONA 3E0JB 2JVHA 3LSGA 2Z1DA 3H9GA 1WJFA 4YELA 4C9YA 4PSXA 3DWLE 2X6XA 1U0JA 4HG2A 1DQUA 3CZ6A 3DLAA 4HSRA 2M7BA 2WY8Q 4OAZA 2KLOA 2X1DA 2X1CA 4BQQA 1YE9A 4PFOA 4Y4RA 3S8PA 4BJTA 2WAEA 3ONQA 4LG3A 2KHMA 2KDOA 3H9JA 4P5OA 1MNEA 5TGTA 3VYRB 4BQOA 4D9JA 2RNGA 3OS2A 4RM3A 4AYBA 1HA8A 4IQ4A 3DTEA 4BE0A 4OWRB 1JI8A 4CCMA 2V6EA 1P9QC 4N4NB 1MW7A 2IXSA 4KJZA 4AU7A 4XNFA 4CH7A 3EUHC 3OOUA 3FDYA 3J7AY 3OYEA 1T95A 3QYFA 2JVGA 4PSWA 3HL2A 4Y33A 4YEJA 2IS2A 4HPQA 1K6YA 4EATA 4DIQA 4LITA 2R7RA 2VJJA 2UWMA 1SAUA 2OV7A 3K10A 3EUAA 3SEQA 1NG6A 2E1MB 3CP2A 1D1CA 2E1MC 2L7KA 3UR3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC4 A;  5KHD A;  4OAY A;  4OAZ A; 
#chains in the Genus database with same CATH topology
 2FXA A;  2DU9 A;  1VI0 A;  2CWE A;  3JRA A;  3HPG A;  4OIP F;  2VON A;  2O6G E;  1FLI A;  4M9S A;  1IRX A;  3EUH A;  4XQF A;  4FAS D;  5M5Y J;  3R0J A;  5LEJ A;  4EEF G;  3LSH A;  5F1R A;  1J59 A;  3A0H C;  4XRS A;  4M71 A;  3V8L A;  2W25 A;  4HNU A;  5DS9 A;  2MC4 A;  3SXY A;  4MFD A;  4PJN A;  3MZY A;  2VBZ A;  4PJJ A;  2HDD A;  2L02 A;  5GPC A;  1U8R A;  1OIS A;  2MD5 A;  4IHS A;  4ZYE A;  5E3M A;  4I98 B;  1J7K A;  4JK1 X;  5E1Z B;  1QO0 D;  1QZZ A;  1SC7 A;  1SEU A;  1XX5 A;  1JTY A;  3ZN0 A;  2JA5 J;  2B0L A;  2BYV E;  5B66 C;  4ZYH A;  2LKX A;  5L3E A;  1PDN C;  2QGU A;  2RC4 A;  2K86 A;  4XOR A;  3JRD A;  2LR8 A;  1KU2 A;  2NNY A;  4BU2 A;  4EGZ A;  3TW7 A;  4HDU A;  4UB8 C;  1H9G A;  2I10 A;  3SZG A;  1WJC A;  2P8T A;  3ESW B;  3I58 A;  4CYC B;  3ZQC A;  4RGR A;  2FE3 A;  5IY5 H;  3UNG C;  5JFR A;  3U1D A;  3LST A;  1R1V A;  3SYT A;  4AIK A;  2JRT A;  4ZYD A;  2L2O A;  5DUK A;  5EZG A;  4QLC U;  2H6C A;  2Y0S N;  1R49 A;  1X3W B;  2HYF A;  1HKQ A;  3H5N A;  3KP3 A;  3BY6 A;  4JOM A;  2DJI A;  5GTH C;  3REO A;  3G4S I;  1EJ9 A;  3OY9 A;  3CMY A;  3E6M A;  2KQR A;  1R23 A;  1V55 H;  3HRM A;  3T5X A;  2E2I J;  5K1Y A;  3ASN H;  3E1S A;  3ZP5 A;  2Z99 A;  2R7U A;  1ODD A;  1U5T C;  5FFX A;  2GBY A;  1HLV A;  4EJT A;  1XDU A;  5JVT A;  4XOP A;  3MKZ A;  1AU7 A;  1BIA A;  2DK5 A;  1VND A;  4BGD A;  2QLZ A;  4WXH A;  3ERE D;  3GTM J;  1A5J A;  1ON1 A;  3H3Z A;  2QEX I;  1RES A;  4NQW B;  1TBX A;  2IVM A;  2PQ8 A;  1R4M B;  3HC7 A;  3T8R A;  2RNJ A;  4CCL A;  4CYC A;  2A6E F;  2FU4 A;  1R9T J;  3QYE A;  2A6T A;  1SAN A;  4G6Q A;  2JZY A;  2O7O A;  4YG2 F;  2NOG A;  3Q0U A;  1O4X A;  3WGH A;  4GRI A;  3W3C A;  1JTX A;  3NRV A;  1IZ1 A;  1Z3X A;  2DA6 A;  3OR2 C;  4L9N A;  2LY9 A;  3IL2 A;  2UZK A;  1T0F A;  4II2 A;  3OYC A;  2QSG X;  2MBF A;  3ABL H;  2QYO A;  2NXN B;  3NAU A;  2JPC A;  3RI4 A;  3TKY A;  2DXI A;  1OQY A;  1RZ4 A;  3ZN1 A;  3DKW A;  3I3L A;  2GQQ A;  1Z7L A;  2R7D A;  2V9K A;  3FX3 A;  3H5A A;  3MWM A;  1I5Z A;  5KVR A;  2W82 A;  1MSE C;  1YO5 C;  2HQ5 A;  1WPK A;  4BDZ A;  3GXO A;  3GX4 X;  5HS7 A;  2W7N A;  1RI7 A;  1Z1D A;  2JSC A;  2OA4 A;  3BT9 A;  4OOI A;  1EH8 A;  2VB6 A;  3T1B A;  2QBY B;  3K2A A;  4IQJ A;  1R71 A;  2EIL H;  3IH3 A;  5C4X J;  3CES A;  1TW3 A;  3V4G A;  4BEH B;  1IUF A;  2DJN A;  2VT3 A;  1YLF A;  4N9H A;  3OYF A;  2AHQ A;  2GZW A;  5L3C A;  3GUD A;  1PP8 F;  2PMZ A;  5ILS A;  2KIU A;  3E6C C;  2IS1 A;  3AL0 B;  2BHZ A;  4HA8 A;  3DQV C;  3LOC A;  2L0K A;  2BV6 A;  3GFJ A;  3ZMS A;  4BQN A;  4AM3 A;  2VOD A;  2ISZ A;  1FSE A;  3EDP A;  3KLN A;  1WFX A;  3V8J A;  1SFE A;  2Z33 A;  1WQ2 A;  1KGS A;  2X9D A;  5J1R A;  3I59 B;  3DEW A;  1QQI A;  3CCJ I;  3R4K A;  2OU2 A;  2LRE A;  4A12 A;  4ESJ A;  5LFA A;  1V5G A;  2R7Q A;  2KL4 A;  2V26 A;  4A5N A;  4MQ9 F;  3LSR A;  2A61 A;  3SJM A;  3OSG A;  5FLM J;  1FTZ A;  4BEH A;  3G3Z A;  3U1K A;  4I01 A;  2NNN A;  3F8C A;  4O5V A;  2CQK A;  1Z3Y A;  4BE2 A;  2PFB A;  4NBQ A;  1GV2 A;  3BCB A;  4A3E J;  1B72 B;  1QHH D;  5KAF C;  3W6J B;  3J7A O;  4RB1 A;  4FX4 A;  4XLH A;  2K4B A;  1GXQ A;  1F9N A;  3FMS A;  3WTZ A;  2JA8 J;  1HW2 A;  2V1D A;  3B6A A;  1WSU A;  3NWS A;  5LHH A;  4OMZ A;  1DUX C;  2UUZ A;  4GYG A;  1MBH A;  3I59 A;  4G94 A;  3RKY A;  4XKB A;  3BTC A;  4LB6 B;  3G73 A;  2BY3 A;  2VKV A;  2HZT A;  2TCT A;  4RDU A;  3OYG A;  2P6S A;  5CVR A;  3VOE A;  4WXC A;  1FJL A;  1ERD A;  3LQR A;  2FQ3 A;  4S04 A;  4NNJ A;  3WTT C;  3K4M A;  4M74 A;  2ZKZ A;  3K4C A;  2HOE A;  2KZV A;  2O8X A;  4LJZ F;  3RQ4 A;  4I6Z A;  4BHP A;  1XS9 A;  5DD4 A;  1IAW A;  3RYP A;  3D1N I;  4UV9 A;  5D5U B;  2X6W A;  3H3V K;  5H6Q A;  2KIQ A;  1B72 A;  2ZXJ A;  1ZRE A;  5F1J A;  3S17 J;  5FJ8 J;  1ZLK A;  5KCM A;  2HKO A;  3JTH A;  5DCM B;  4GYI A;  1GXP A;  3M8F A;  3CO6 C;  1Q1H A;  3NEU A;  1B1B A;  1LVK A;  1MND A;  4V2F A;  3OYA A;  2RGV A;  3BCA A;  1BI3 A;  1S3J A;  3I4M J;  1ZG5 A;  3GTP J;  3BPX A;  1ZKG A;  3OIQ A;  3PQJ A;  4XLC A;  3AG3 H;  1PUE E;  3GWZ A;  1FSH A;  3E7L A;  3DTI A;  2TDX A;  1K83 J;  2MH9 A;  1LDK B;  3WE3 A;  3ZR8 X;  4YIR X;  4BDY A;  5J3L A;  3V7S A;  2Y69 H;  4L9V A;  2WV1 A;  5K7Z A;  4IJA A;  4ZDP A;  1K4T A;  2HOS A;  1UAA A;  3I53 A;  5JHF A;  1WJE A;  1SD6 A;  4JQF A;  4UXN A;  4UUS B;  4MLO A;  3F72 A;  2AQF A;  2KDZ A;  1OR7 C;  3PSF A;  2EWN A;  2DAO A;  2K3P A;  1IDY A;  2LRD A;  2W00 A;  3B02 A;  2V4J C;  5E1W A;  1XTA A;  3BR0 A;  2CH0 A;  4B47 A;  3RQI A;  4HW0 A;  2LD5 A;  2JSP A;  5CVU A;  1I6H J;  3LWF A;  5CLS A;  1XN7 A;  4IKF A;  4BYY A;  4LLL A;  3E3V A;  1XMA A;  2UV1 A;  4UV8 A;  3G6E I;  2PX9 A;  2K9L A;  1JUP A;  1BJA A;  2VKH A;  1X3U A;  4P55 A;  2MGQ A;  4L5J A;  2BGC A;  2N8G A;  1FOY A;  1FOK A;  3GO5 A;  3ECO A;  4S05 A;  4XOT A;  2VOP A;  1VQ8 I;  4KA4 A;  2UXN A;  1MMG A;  3DFG A;  3G1O A;  4PK4 A;  1ETY A;  2XPU A;  3RKQ A;  4G6T B;  2CSO A;  3CF2 A;  4ETS A;  1I27 A;  3QPL A;  2K5C A;  2F5V A;  1PJR A;  4BUP A;  4F3Q A;  3MKL A;  2AXL A;  4UUS A;  3J81 Z;  2YR2 A;  4J19 A;  1G59 A;  3A2K A;  2CMP A;  3L2U A;  2YUS A;  2M9H A;  5L3B A;  5DTD A;  4A3L J;  2AS5 F;  3HBL A;  2M8G X;  1ZK8 A;  2BXY A;  2VC0 A;  4LIU A;  4E7K A;  5GAD J;  4C2M J;  2BY1 A;  1BC8 C;  4CHU A;  2M5W A;  3V7C A;  3TL4 X;  3DKX A;  2DFE A;  2IGK A;  3SQN A;  2PBI A;  1S9H A;  2HWV A;  2OQG A;  4WWC A;  3CCR I;  5D5X B;  1D0Y A;  1X1D A;  4BY7 J;  2F6C A;  1IN6 A;  2H6B A;  2LP0 A;  2W24 A;  3BG5 A;  5ICF A;  1BI0 A;  5J4Y A;  1Z77 A;  2IAI A;  2NVY J;  4KYW A;  3J80 Z;  3EYI A;  3DPL C;  1IXR C;  2P0W A;  3SFI A;  3RJP A;  4F7Z A;  2M1B A;  2MW8 A;  3GTK J;  2K9N A;  1IXS B;  1YHQ I;  1XSV A;  1CGP A;  1K6O A;  4HNT A;  2PJR B;  1BJZ A;  5CPR B;  4Y3O A;  2HQR A;  1U3E M;  1REP C;  1Y56 A;  4BQA A;  2DCE A;  3HUG B;  5EG0 B;  2FEZ A;  2KT0 A;  4BHB A;  1VQK I;  2JTV A;  1RKT A;  1DP7 P;  3ZGK A;  2PEX A;  3GEZ A;  2DA1 A;  4RAY A;  1RPW A;  2E71 A;  3GFL A;  1HQC A;  1VF9 A;  1VQP I;  4ZZL A;  2DFI A;  2ECB A;  3KEQ A;  3SDB A;  3K69 A;  1HDP A;  4IRI A;  3E6B A;  2E5Z A;  5HLT A;  2LNB A;  2MA3 A;  2WAD A;  3S93 A;  1I50 J;  4L5I A;  4Z2Y A;  1Z6T A;  4HX4 A;  4BE1 A;  3VDX A;  3I71 A;  3FF5 A;  5HDG A;  2PJR A;  4LLG F;  2ZXW H;  3MQ0 A;  4CIC A;  1U9N A;  2F5D A;  5LHG A;  4C3I J;  5KAI C;  2Q2E B;  5GAE J;  5EG0 A;  2EQR A;  3BR6 A;  4XON A;  3E0J B;  2JA7 J;  3ZMU A;  4JP0 A;  2E1N A;  1WJF A;  5EEA A;  2XGX A;  1TNT A;  2W48 A;  4HG2 A;  1U0J A;  3CQZ J;  1DQU A;  3DLA A;  5HLI A;  4LOC A;  2B63 J;  2Z5U A;  3PFI A;  2M7B A;  3GLL A;  4OAZ A;  1NH3 A;  4RGS A;  2KLO A;  5E3O A;  2X1C A;  4PFO A;  3EET A;  4Y4R A;  4BJT A;  5BS6 A;  4LG3 A;  2XB0 X;  5HDK A;  1SFU A;  4AC0 A;  2K9Q A;  2EPF A;  5K5Q A;  4ABZ A;  4AWX B;  2ID3 A;  1VTN C;  5TGT A;  3TDU C;  2HTJ A;  1QZY A;  4I76 A;  4D9J A;  2RNG A;  3DCF A;  3F3X A;  5AON A;  2KFD A;  4AYB A;  1WCM J;  3CO7 C;  2D1H A;  2DMP A;  4CCM A;  5B1A H;  1SMY F;  1MW7 A;  4AU7 A;  4W97 A;  1UHS A;  1JKR C;  2D5V A;  4CH7 A;  3FK6 A;  1VQ5 I;  2JN6 A;  3BPV A;  2M2E A;  1BW5 A;  1T95 A;  3RKX A;  3S14 J;  1QGP A;  4Y33 A;  2R7F A;  3B73 A;  4YEJ A;  4FHT A;  2H8R A;  5FLX Z;  4IF4 A;  4DIQ A;  3J7Y J;  2R7R A;  2VJJ A;  5F0C A;  1SAU A;  1Z6R A;  5EEH A;  2JK3 A;  1F4K A;  3K10 A;  3TOB A;  4Q4Z F;  1NG6 A;  2E1M B;  1ETK A;  4PGH A;  2COB A;  3LSP A;  1AKH B;  3UR3 C;  1MBG A;  3ZQQ A;  3W2V A;  4IZZ A;  5C4J J;  3L09 A;  1J5Y A;  2PMU A;  3FHN A;  4XRM A;  3W6K B;  1DPR A;  3CLQ A;  2BVM A;  3IKT A;  4XLE A;  1S7O A;  1OKR A;  1EH7 A;  3K1N A;  5LRR A;  4BAY A;  1YI2 I;  2UXX A;  2EV0 A;  1ZH5 A;  2RQQ A;  4PUS A;  1VQ9 I;  3DEU A;  3OMY A;  2DDB A;  3DPU A;  1I1G A;  5J1U A;  1WH5 A;  4UUV A;  4LLN A;  3DBR B;  3R60 A;  2RDP A;  1DGW Y;  4ENK A;  4CCK A;  3IWZ A;  4I09 A;  1WJD A;  3ZMV A;  1ACI A;  4DGW B;  2ISY A;  1R1U A;  4M3G A;  2ACJ A;  2DFH A;  4CA0 A;  1AA7 A;  4DZP A;  4DZJ A;  1N77 A;  1AKH A;  2KRF A;  2JWT A;  1X19 A;  3LAJ A;  2YX7 A;  2Y9Y A;  3BQZ A;  2WA0 A;  2X48 A;  3BDD A;  3OL3 A;  4E4H A;  2ZJP F;  4E7J A;  1OCP A;  5BOX A;  2L3D A;  1H0M A;  1UMQ A;  1DDN A;  1KU7 A;  2LY2 A;  1A35 A;  4ESF A;  3BZK A;  4DQ2 A;  5FKO A;  4FIS A;  4Y7N J;  4OIO F;  2H1K A;  2PG4 A;  4AVP A;  3L2R A;  3QPS A;  2DA5 A;  5LD2 C;  2VXZ A;  2P5K A;  2BOL A;  1R7J A;  3HJE A;  2BVL A;  5JR3 A;  2R7Z J;  4B48 A;  1OMI A;  4JX4 A;  4ZTF A;  2A5W A;  2QCO A;  4L0Z B;  1A6Q A;  1WI3 A;  3G71 I;  1UZC A;  4FE7 A;  5FRN A;  2FRH A;  3MAJ A;  1XGS A;  3PL8 A;  2DOD A;  3BG7 A;  3PO3 J;  3MMY B;  4EJU A;  2M4G A;  1S6L A;  3FM3 A;  4NC6 A;  2DQR A;  3CCL I;  3HIF A;  2JMW A;  2CG4 A;  3LMM A;  1I3A A;  3KYL A;  3TO7 A;  2IRF G;  2CFO A;  5HS9 A;  2RRE A;  3HHH A;  2ZXH A;  4B4C A;  3C1D A;  3CMA I;  1E17 A;  3RPQ A;  3MKW B;  1S5L C;  4I99 C;  3ZQL A;  3KP5 A;  2CV1 A;  3LSK A;  4AIH A;  4D0P A;  4BXF A;  1JUS A;  1FEX A;  1FIA A;  4II3 A;  2NOJ B;  2HPI A;  2HYJ A;  5F27 A;  2IS4 A;  2XDV A;  2XIG A;  3GYH X;  3K70 C;  1WKM A;  1Z67 A;  4QWQ A;  4L18 B;  3IAM 2;  2VJ4 A;  3TGN A;  1TWG J;  1S8N A;  2TRT A;  3IRQ A;  1KA8 A;  1HCR A;  2GA2 A;  2CJJ A;  3P7N A;  2OTL I;  2Y31 A;  2CW8 A;  2LTP A;  1WRJ A;  2CW0 F;  2LOO A;  4Q5S F;  2P81 A;  2CYY A;  3Q9S A;  2L7F P;  4P1W A;  3W6V A;  4B8X A;  4XK4 A;  3ML6 A;  4M3E A;  2WAQ A;  3NWT A;  2W84 A;  3O8H A;  3S16 J;  3H3U A;  1ETW A;  2JJ7 A;  4RMN A;  2O3F A;  2MG4 A;  4HDV A;  2EFO A;  2ZSH B;  2A07 F;  3LSI A;  1IN4 A;  4XLA A;  1IXC A;  2W57 A;  1E3P A;  2XAH A;  2K7L A;  1ONV A;  4XRF A;  4GDF A;  3DU6 A;  3L00 A;  2KIS A;  3OS1 A;  4E7H A;  3ZQH A;  4DBR A;  3WGG A;  3PUB A;  3QP5 A;  2V1U A;  1XSX A;  2XRL A;  2L7Z A;  1P4X A;  1RR7 A;  4I0B A;  2JUG A;  3EQL F;  3QU3 A;  4RB3 C;  1ZEL A;  2ME0 A;  1EA3 A;  2EV6 A;  3LA7 A;  3CCQ I;  2VT2 A;  2H1L A;  2Z3Y A;  3WTS C;  1WGX A;  2VJI A;  4R8H A;  1UJ8 A;  2R3S A;  3R61 A;  2R7X A;  2Z16 A;  1K61 A;  4CSW A;  2BEO A;  4GO1 A;  1NK2 P;  2VOO A;  5IT9 K;  2YX4 A;  1FOX A;  5GP9 A;  3CCU I;  2NVT J;  2QQB A;  3EPZ A;  4HEA 2;  1LE8 B;  1Y6I A;  1GV5 A;  5LGU A;  3O3K A;  1DU6 A;  2H27 A;  5JLW A;  3CDH A;  2BY0 A;  2I8D A;  1MBK A;  5TRD A;  1VZ0 A;  1U9O A;  5M3F J;  3BG9 A;  5CYV A;  1D5V A;  2RKH A;  2XF5 A;  4KIF A;  2CUJ A;  1OJL A;  1E0E A;  2Y75 A;  1ZG1 A;  2E7W A;  1FYK A;  2F5C A;  3KX2 A;  1QHG A;  3TMO A;  5E17 F;  2GA1 A;  1E3O C;  1XGM A;  2HI3 A;  1QNT A;  1H9T A;  2VQH A;  3F8N A;  5GAG J;  3O6B B;  2HQN A;  4M6V A;  3F22 A;  1K4S A;  3WGI A;  2AO9 A;  2W85 A;  3GME A;  4H0E A;  4KN4 X;  4HQM A;  1V54 H;  1Y0N A;  3HB9 A;  4RAF A;  4CO8 A;  4DYR A;  1J9I A;  1ZR2 A;  2GIV A;  2L9N A;  3RYR A;  1T2K A;  3OIP A;  1LPQ A;  1LE8 A;  1HST A;  4IHY A;  3MFK A;  5F6F A;  5FLV A;  1QPI A;  4GXO A;  1FBU A;  3BTI A;  2DT7 B;  5FGM A;  1XMK A;  2PMZ N;  4B3A A;  1XCV A;  2V9P A;  3H0D A;  2XC7 A;  1FPQ A;  1J2X A;  3BTL A;  2ESH A;  5J4V A;  1G2H A;  3ZOB A;  1DGR M;  3SZP A;  5J1Y A;  1NG7 A;  2DT5 A;  5EJC A;  1Y1W J;  1G3W A;  3HRT A;  1IUY A;  3F23 A;  3HSF A;  2DOF A;  3F9K A;  2OPT A;  1TZL A;  2LKS A;  2HKX A;  5K7F A;  3HTU A;  1D3Y A;  1VFC A;  3VB2 A;  1P4W A;  5D4S A;  3GTJ J;  2IJL A;  4KIG A;  3CP8 A;  1O3S A;  4PZJ A;  4FTH A;  4G9Y A;  4GFB A;  2WBM A;  2M45 A;  2X6Y A;  4G8X A;  5D6E A;  5BMZ A;  1HSJ A;  3K6G A;  3IV5 A;  2A05 A;  3EUK L;  1IW7 F;  4IHT A;  4MO7 A;  1N78 A;  1U2W A;  4NUB A;  5GPA A;  5M5X J;  4HX7 A;  1T8I A;  1JE8 A;  1E2X A;  1QVT A;  1SFK A;  2CQX A;  1ZRF A;  2FA5 A;  5DDG A;  3C2G A;  3T8T A;  4HQE A;  4IO9 F;  2ETH A;  1QRY A;  3L2Q A;  3ELK A;  1R5G A;  2M8E A;  5CVJ A;  2HVQ A;  3KFW X;  1YIJ I;  1Z05 A;  5FD5 A;  2F5E A;  4LIV A;  3RTR A;  4WK8 F;  3TED A;  4KIC A;  5DD8 A;  3KZI C;  4JBA A;  5LEK A;  3QYB A;  2XAQ A;  3HOZ J;  2Y0S A;  3WTV C;  3W2W A;  3BJ6 A;  4XN0 A;  1VQO I;  2HR3 A;  2GXB A;  3P9I A;  2E35 A;  1G3S A;  3R6S A;  5ICC A;  3CME I;  1KON A;  5JVG F;  1ON2 A;  1OR7 A;  2X1E A;  2DK8 A;  3AFH A;  3MCZ A;  4M3F A;  5J40 A;  3M3Y J;  4F93 B;  2CQ7 A;  2R92 J;  2DMQ A;  3GTO J;  3M07 A;  1CQT A;  3PIO F;  1JGS A;  3D5S C;  4MEX F;  2OF7 A;  2EZL A;  5IT3 A;  2DOA A;  2D45 A;  1FTT A;  5H20 A;  3ZQF A;  3HYI A;  2L01 A;  4LFU A;  2L9S A;  1R6R A;  1X1C A;  1OLT A;  1JKQ C;  4RLF A;  3DKY A;  4A0Z A;  5C44 J;  2ZCW A;  3LA3 A;  5J47 A;  3JRI A;  1JT0 A;  2HQA A;  2VI6 A;  3HZJ A;  4WF2 A;  2CV0 A;  4HAM A;  2R7T A;  3G1M A;  4C3H J;  3ABM H;  1QPM A;  5KHD A;  1JT6 A;  3S1R J;  3OYH A;  4A5M A;  2EFP A;  3CCS I;  1ITY A;  2E2J J;  3FHZ A;  2W1O A;  2MD0 A;  3K7A J;  2IBD A;  1YOV B;  1R58 A;  1W5S A;  1FZP B;  3KP4 A;  3QPT A;  9ANT A;  1HW5 A;  2VBX A;  2QEN A;  2ZME C;  3OOP A;  3HOX J;  5FRM A;  4E7S A;  2XSD C;  1TWC J;  5HOO A;  3I64 A;  3TW6 A;  2K02 A;  2M30 A;  2VPL A;  4HOB A;  2V1N A;  3CCY A;  3ZMD A;  2HTS A;  3Q5F A;  3K4J A;  2P4W A;  5K7H A;  2HVR A;  2VBY A;  2R7W A;  4KMU X;  3DV8 A;  3JTG A;  1LEB A;  5LHI A;  5TJJ A;  4CUG A;  1GT0 C;  3CJR B;  4A3G J;  1G6N A;  1YG2 A;  2DA7 A;  2OBP A;  4V19 K;  4FQG A;  2OQR A;  3HPH A;  1LVA A;  2ZBK A;  1S29 A;  1RUO A;  2Y2Z A;  1HKT A;  1QA6 A;  3IH2 A;  3ABT A;  3CUQ C;  1BN5 A;  2QKM B;  1XGO A;  5AIQ A;  4BL0 B;  3DTK A;  4BXU A;  3JRG A;  5A2Q Z;  1AWC A;  1P6R A;  2XUB A;  4BJ6 C;  1MMN A;  4PCQ A;  1HF0 A;  3Q3S A;  3WG9 A;  5M5W J;  2XF6 A;  3VFZ A;  2EH3 A;  1FY7 A;  3IWF A;  3JRE A;  3WTW C;  1W0U A;  3KP2 A;  4P96 A;  2CRG A;  5EEG A;  1A6I A;  4HSR A;  4U88 A;  2NS0 A;  2L4A A;  2X1D A;  4OIN F;  1UFM A;  5HS8 A;  2LSO A;  5BQT A;  1LQ1 A;  1XGN A;  3H1C A;  3S1N J;  3DP7 A;  3KZZ A;  3LNQ A;  4HV5 A;  2XAF A;  4MIM A;  4EM2 A;  1VQN I;  3BJO A;  3VYR B;  3FXJ A;  4BQO A;  2Y0M A;  1YW8 A;  4EJO A;  3BRO A;  4L9T A;  4IQ4 A;  4E70 A;  3WTU C;  2GXA A;  2DFF A;  4CZZ A;  4KJZ A;  5F0F A;  4KNY A;  4UB6 C;  3OYE A;  1TW2 A;  3K2Z A;  3QYF A;  2JVG A;  4DNC A;  4PSW A;  4HF2 A;  2EJR A;  1ZQ3 P;  3LQQ A;  3PO2 J;  2IS2 A;  1FP2 A;  1FBQ A;  1K6Y A;  1XCB A;  1UHW A;  2BHY A;  2L4M A;  3QP6 A;  1P7J A;  4LIT A;  5DV5 A;  2VPR A;  1AOY A;  3M7G A;  3U9G A;  2DDA A;  2ADU A;  3SEQ A;  2F48 A;  2LK2 A;  3CP2 A;  1W5C C;  3B6C A;  1MSF C;  4LG0 A;  2H09 A;  3CUO A;  5D4R A;  1YFH A;  2XVC A;  2OZ6 A;  1SD4 A;  2ZXI A;  4A0Y A;  1MH4 A;  1SVL A;  3S3N A;  2XAS A;  1VQ6 I;  1SVM A;  1YIT I;  1D8K A;  5TIS C;  1V5E A;  3GVA A;  4PFP A;  2HGC A;  4M73 A;  3S2H J;  3VYU B;  3JAM Z;  3AL0 C;  2DLL A;  3GLX A;  4GGG A;  5EZH A;  4Z6Y A;  4WCG A;  2DN0 A;  2J5P A;  2M7A A;  2VQC A;  4RB2 C;  1H8A C;  4KT6 A;  1T39 A;  1ZRD A;  3CJQ B;  4DYC A;  2G0E A;  4P9U A;  1B4A A;  4C2U A;  2XRO A;  3ABU A;  1ZAR A;  1BI1 A;  1MBE A;  3HRU A;  4BJ5 C;  2DYR H;  2YU9 J;  2NS7 A;  2XHK A;  1G4D A;  1JKP C;  3FXL A;  3PQK A;  3PNV A;  3HM5 A;  3A0B C;  3LSJ A;  2VJ5 A;  2LH9 A;  1KU9 A;  4HX8 A;  4XMY A;  4ZDL A;  4RAG A;  2Q0O A;  5HLH A;  4NHJ A;  5HNF A;  1TC3 C;  2CUF A;  1F5T A;  3N4M A;  1FOW A;  4LMY A;  3Q0W A;  2F2E A;  1SMT A;  1BR1 A;  1BA5 A;  4D7M A;  4M6Y A;  2CV2 A;  1K7A A;  1R36 A;  4MHG A;  1BOB A;  1JUM A;  1WVR A;  3IH4 A;  3ZMT A;  5B5E C;  5F64 A;  2IT0 A;  3A02 A;  1IN8 A;  2EFW A;  3OS0 A;  2V6C A;  2MC3 A;  1A31 A;  4Q47 A;  1IN7 A;  3VPR A;  3M8J A;  1ETQ A;  4BAC A;  3M1E A;  2QZ8 A;  2EA4 A;  1M1E B;  1I39 A;  2I5U A;  4AIJ A;  2FQ4 A;  5F04 A;  2G9W A;  2LVS A;  3M1C A;  3OV8 A;  3HGY A;  4LK0 F;  5ERI A;  2QSF X;  3FM5 A;  4M3D A;  4OIR F;  1K79 A;  2P7V B;  4X0G A;  2STW A;  1RET A;  1IV6 A;  2A69 F;  1YJN I;  2FJ1 A;  4L9J A;  2AQE A;  1R00 A;  2JUC A;  5E20 A;  2BBY A;  4MFE A;  5BPI A;  4G7H F;  1JJ8 C;  1Z7U A;  2DQL A;  2QVO A;  4DYQ A;  2X4H A;  1D1B A;  2ESN A;  3C2B A;  3W2A A;  2HOA A;  5H6R A;  2J5O A;  3BWG A;  4F92 B;  4HF1 A;  2K40 A;  4XRS G;  1BL0 A;  2EZI A;  2LC2 A;  4JX6 A;  4C3J J;  3TP3 A;  2YSR A;  2O9L A;  2ZSI B;  2K3F A;  3OR1 C;  1UHM A;  4UNO A;  4L5E A;  1X2N A;  3SEZ A;  4O6J A;  1O7L A;  4B09 A;  1X3Z B;  4LGW A;  3CTA A;  3I54 A;  1ZN2 A;  4HBL A;  2WB1 A;  4AD9 A;  2QUF A;  3OYD A;  2IP2 A;  4QTR A;  5IYB J;  1S72 I;  1XD7 A;  3P5J A;  2DPU A;  2OUM A;  4IX7 A;  1LFP A;  3I4P A;  2ZFU A;  1HW1 A;  2LBF A;  2GLO A;  4ZYG A;  3QQA A;  3HOW J;  1RNL A;  2PN6 A;  4O3M A;  1MZB A;  4I7H A;  1W1W E;  4RAZ A;  1B8I B;  4F52 A;  3HOT A;  1NTC A;  3Q0V A;  1E3H A;  3F6O A;  1NHA A;  1B9M A;  1MJA A;  2FD5 A;  4MTE A;  4PJ0 C;  3GFM A;  3P9K A;  5GTI C;  1Q1V A;  4M3B A;  4D1Q A;  1SFX A;  2KP6 A;  1MJB A;  4NB5 A;  4XIC A;  1XB4 A;  3IP4 B;  1LKX A;  2LY1 A;  3G1L A;  2JQ7 A;  1WWX A;  4XKW A;  3I4N J;  5JI6 A;  4FET A;  3IKV A;  3QU6 A;  2GXG A;  1F1Z A;  2JRM A;  3BR3 A;  2P6T A;  1A04 A;  4A6E A;  2ID6 A;  3K9T A;  3HSR A;  5D8K B;  2XKO A;  1KZH A;  2O8K A;  1MIJ A;  2PJP A;  4CCO A;  3RCO A;  3TBI A;  2PI0 A;  3C3W A;  1JXS A;  1B8I A;  1XSD A;  4PGG A;  1ULY A;  3AG4 H;  3DF8 A;  2C6Y A;  3S32 A;  3IAS 2;  2VAS A;  2VBW A;  4CXF A;  3J81 K;  1RR8 C;  3K4K A;  3OL4 A;  4XLP F;  2ZO4 A;  3MKY B;  2VQL A;  1EV7 A;  2H94 A;  2E5N A;  2DMT A;  2XAG A;  3D5R C;  1I1S A;  5E3L A;  4LD5 A;  1MMA A;  2FBI A;  4X1E A;  2GOX B;  2WTE A;  1W7P D;  2WV0 A;  3RPU A;  1Y8Q B;  4U0V A;  4MQV A;  4OMY A;  5IPA A;  4G7Z F;  3KYC B;  2XPW A;  3PSI A;  2V79 A;  2FUG 2;  1R1T A;  2DMU A;  2YPR A;  5D8L B;  3BLY A;  3J80 K;  2A5Y B;  2M0C A;  5CQG A;  1MMD A;  5CVV A;  4UVB A;  3PJR A;  3JRC A;  4RA2 A;  1U5T B;  2EB7 A;  4W1U A;  2P7C B;  3IC7 A;  2COM A;  5D5W B;  1D5Y A;  5D5V B;  4XBF A;  5HNH A;  3L2W A;  1HC8 A;  2GAU A;  5CKT A;  1JJ6 C;  2F4M B;  3JRF A;  2WAQ N;  3T0Y A;  2LMD A;  1P2F A;  2XKP A;  4I2O A;  2EIK H;  2K27 A;  3I0T A;  3K4N A;  3KEY A;  4IHX A;  2E60 A;  1WZ2 A;  1X2M A;  2CQQ A;  2G7H A;  2XB5 A;  3BR1 A;  2VN2 A;  4M9Z A;  1IRF A;  2FBK A;  2K85 A;  4EM0 B;  1T38 A;  3I9V 2;  3OYL A;  4P9F A;  4BBR J;  3E6D A;  1D0X A;  1G8X A;  5F0H A;  2EIJ H;  2PMH A;  4G6D A;  3ZQ7 A;  3ZXS A;  1MNM C;  2DA3 A;  2M4K A;  1XMX A;  4CCN A;  3ZCO A;  1XDS A;  2E34 A;  1TWF J;  3F6V A;  1RRJ A;  2WY7 Q;  1X1B A;  3KET A;  5IYC J;  2KRH A;  2R7S A;  1Y39 A;  4UUT A;  1U5T A;  4EJW A;  3HGG A;  4ZTJ A;  1XPX A;  2O03 A;  3SFZ A;  4A3I J;  1YX3 A;  4M6X A;  5HOD A;  3OIO A;  1YRN B;  3R0A A;  2E1C A;  1YW9 A;  2QKL B;  3V8K A;  3KEO A;  3QAH A;  5DYM A;  2LYC A;  2EBI A;  3KLO A;  5J8F A;  1OCO H;  1B6A A;  5FO5 A;  1FX7 A;  1TTY A;  1J09 A;  1YX5 A;  4U7B A;  3OYM A;  3QRF F;  1O3R A;  2D1V A;  3K1P A;  1ZLJ A;  2HVS A;  4ZZD A;  3DLL F;  3RDI A;  5L3G A;  3HKZ A;  4JX5 A;  1LUJ B;  4RBO A;  4R79 A;  4B1R A;  3F21 A;  4U7D A;  2F4O B;  3FXM A;  1EKE A;  1O7F A;  1PVE A;  2Q8K A;  2XAU A;  3A01 B;  2HU9 A;  4RGU A;  3O2P E;  3I56 I;  3GBG A;  4UY8 I;  4KIT B;  3KP6 A;  4NC7 A;  3LFU A;  3OYN A;  1Y1V J;  1T33 A;  4E7I A;  1YRN A;  2WWY A;  1X4P A;  3WTX C;  3VWB A;  3QPH A;  1H89 C;  2X6O A;  3GZN B;  4IRH A;  4Y17 A;  2LG4 A;  5DM6 F;  4A0X A;  3GZ5 A;  5FLX K;  3CCE I;  3VEP A;  4AVZ A;  2X85 A;  4LB5 A;  1OYW A;  3JSO A;  4HST A;  2L5Q A;  4EM1 A;  3BG6 A;  3MN2 A;  3IUO A;  1IF1 A;  1SD7 A;  3HSE A;  2VE8 A;  1IC8 A;  1HKS A;  3AKZ A;  4IOA F;  4XN3 A;  3CLO A;  2ELH A;  5E79 C;  1WJA A;  4RS8 A;  5B1B H;  1YJ9 I;  3WU1 B;  1YS6 A;  2CS3 A;  2IGO A;  2DW4 A;  3CCM I;  1OCZ H;  3A01 A;  2QQ9 A;  3FXO A;  2BY2 A;  3Q9V A;  3V7R A;  3OSF A;  3BC8 A;  1QBJ A;  1YQA A;  1B9N A;  5AIP A;  1YJW I;  2VE9 A;  4HZF A;  1TNS A;  4XL9 A;  4IRG A;  2DO7 A;  3GZ6 A;  1JKO C;  1LDJ A;  2ZME B;  1BI2 A;  2FF4 A;  1O3T A;  4N4O B;  2IA0 A;  4ANJ A;  1UCR A;  3DU5 A;  5IOY A;  1Z91 A;  1TT0 A;  1ZTR A;  3A03 A;  4ITV A;  4A3J J;  3H36 A;  2ECC A;  1R5I D;  3L2C A;  4ZYA A;  2ZJQ F;  1RC9 A;  2ICW G;  1QU3 A;  2HZD A;  5LRS A;  5DEQ A;  4QPO A;  2IEK A;  3JRB A;  3ZMZ A;  5B3S H;  5J6X A;  3WU2 C;  2X51 A;  2NVU B;  2STT A;  2KJB A;  3H5R A;  4BNC A;  1PUF B;  3RSN A;  4XR6 A;  1X1P A;  1YYV A;  2HYG D;  5DCF A;  2EFN A;  2KPM A;  4E6K G;  4DW6 A;  5HVQ C;  2KIM A;  1I3Q J;  1FWZ A;  4Q48 A;  3CUQ B;  2OCC H;  3HOY J;  2NAZ A;  3CD6 I;  5KNL A;  4YIF A;  2DMN A;  2XGD A;  4IOC F;  2MYS A;  5ILV A;  4DBQ A;  2GWR A;  1YIO A;  4ENM A;  5JLX A;  4A3K J;  2ZME A;  3L7W A;  4B44 A;  2HNH A;  3ZQG A;  3ZRG A;  1ETO A;  5E1X A;  2GIZ A;  5FKN A;  2JVH A;  1U78 A;  3H9G A;  1DPU A;  4YEL A;  4C9Y A;  3FKI J;  4JYK A;  1Y8R B;  3DWL E;  2X6X A;  4PSX A;  3CZ6 A;  3PM1 A;  1P92 A;  1ZGJ A;  1ORK A;  1PUF A;  4ON0 A;  4BQQ A;  5ED4 A;  1AHD P;  2WAE A;  2IW5 A;  2KHM A;  2KDO A;  3S2D J;  4P5O A;  5LLQ A;  3TOA A;  2EZK A;  1FIP A;  5FB2 A;  3CUQ A;  1K78 B;  2VC1 A;  3GTG J;  3WU0 A;  4CDG A;  1SAX A;  2XGE A;  2FMY A;  3WG7 H;  2QQA A;  1HA8 A;  2XGC A;  1JI8 A;  1I6X A;  4OWR B;  1NK3 P;  1U8B A;  2V6E A;  4OIQ F;  4N4N B;  3MZH A;  1KU3 A;  2IXS A;  2CFX A;  4G12 A;  4QIW N;  3EUH C;  2QWW A;  3J7Z I;  1BIB A;  3FDY A;  3TDZ C;  5LGT A;  4NQW A;  4IL6 C;  2RAE A;  3BG3 A;  4EAT A;  5K5O A;  2PLY A;  3CC7 I;  4FCY A;  4ENJ A;  1F43 A;  5IP7 J;  3RZO J;  3SDG A;  3ZQI A;  3GTL J;  1QZE A;  1WHU A;  2NYX A;  1UST A;  1D1C A;  3S2W A;  2AXT C;  2CO5 A;  2KKO A;  2L7K A;  4KN7 X;  3S1M J;  1X4O A;  2M3A A;  4KIS A;  4A69 C;  1K78 A;  2GM4 A;  3I5U A;  4MGR A;  3KYD B;  1DU0 A;  2GOM A;  2ELJ A;  4FX0 A;  5CVI A;  1EF4 A;  1IGN A;  1OFC X;  4HV6 A;  3WOD F;  1WJB A;  4XLN F;  2L9R A;  1IO2 A;  2VKD A;  2MSY A;  4LK1 F;  2K4J A;  4PJL A;  4EV0 A;  1W4M A;  2QSH X;  2ZJ2 A;  3RZD J;  2D2W A;  2QM3 A;  3M8E A;  1QVU A;  4XM3 A;  1R22 A;  2EIN H;  3HEF A;  2DBB A;  2E36 A;  4EQQ A;  3PIP F;  2EK5 A;  5FKK A;  1L0O C;  4F91 B;  3OYI A;  3FIS A;  1W36 D;  4UVC A;  2QBY A;  1OCC H;  2VXD A;  4EGY A;  4C2T A;  4IVN A;  3BZC A;  1D8J A;  4HRI A;  3DXJ F;  3U21 A;  3AG1 H;  1TL8 A;  3CCV I;  1X58 A;  2O0Y A;  1PP7 U;  2OD5 A;  2HDC A;  2EA2 A;  3E5Q A;  2A6H F;  2IGM A;  5KK1 A;  2RV8 A;  4KT5 C;  4S0H B;  2HEO A;  4G7O F;  2DOE A;  4A3F J;  1TWH J;  4N9I A;  4YFN F;  3E5X A;  1IRG A;  3ABK H;  2NVX J;  1UG0 A;  1P4A A;  2HDW A;  3ERM A;  2ME6 A;  2QA4 I;  3KE2 A;  4OU0 A;  4A2U A;  5FFZ A;  4ZJZ A;  2VLA A;  2R7V A;  2XRN A;  5IYD J;  1MKM A;  1GLN A;  1YW7 A;  3S1Q J;  2FOW A;  4C30 A;  1LFU P;  1R4N B;  2HXI A;  3VYT B;  3JRH A;  4KDP A;  2ZC2 A;  4NDL A;  1T0F C;  4DJA A;  1FYL A;  2XV4 S;  2ELK A;  3NAR A;  5E18 F;  3P9C A;  3C2H A;  4MNU A;  1FMW A;  5K5R A;  4H4K C;  3S15 J;  1C0W A;  2BXZ A;  3FK7 A;  5C3E J;  3X2Q H;  5DM7 F;  1STZ A;  4QPQ A;  4E7L A;  3KIO A;  4U87 A;  1YS7 A;  1D1A A;  1ENH A;  4IPA A;  1Z21 A;  2A3S A;  3TQN A;  5J8C A;  4LG0 B;  2MLK A;  2NVQ J;  2E19 A;  2CW7 A;  2V7F A;  3D5L A;  1JHF A;  4QSH A;  4Y52 J;  3KP7 A;  1UEL B;  2BW3 B;  2K9S A;  4A93 J;  3V42 A;  1VQ4 I;  3M9A A;  2DI3 A;  1ZR4 A;  1TLH B;  3HG9 A;  1HXD A;  5E8G A;  4IEJ A;  4DOZ A;  1CF7 B;  1A36 A;  4BY1 J;  3HTS B;  4Y13 A;  1GUU A;  2Y48 A;  2IA2 A;  1OPC A;  1KYW A;  5BNG A;  1DP3 A;  1MJ9 A;  4MEY F;  1Z9C A;  3MVP A;  3BTJ A;  5EDN A;  4BBS J;  1FMV A;  2HFH A;  3N05 A;  1BR2 A;  5DCM A;  2EZH A;  5LBQ A;  4HLX A;  3JSP A;  3WTY C;  2JT1 A;  1GVJ A;  1FT9 A;  2EFQ A;  2KMU A;  2K9M A;  3BR2 A;  2R4G A;  3FXU A;  1KQ0 A;  3A1Y A;  5FKL A;  3HOV J;  2BW3 A;  2L9V A;  3BP8 A;  4UVA A;  3TO6 A;  3ASO H;  1VQM I;  1OCT C;  4YRV A;  2ZNZ A;  2HS5 A;  1FP1 D;  2VIX A;  1USS A;  4J01 A;  3CDI A;  1CF7 A;  3BZ6 A;  4ESB A;  2R5Z B;  3QOP A;  3RKW A;  3IHU A;  3K4B A;  2M0M A;  3JW4 A;  2VL8 A;  4J00 A;  1BW6 A;  3QOD A;  4XLF A;  4HF0 A;  3VSL A;  5CJ9 A;  3CJN A;  1LDD A;  3DEE A;  3EYY A;  2ZNY A;  3E97 A;  3C18 A;  5DUI A;  2RN7 A;  2RVC A;  3GFI A;  3CC4 I;  2MAB A;  2EIM H;  4A3M J;  3ECH A;  3N97 A;  3F0C A;  1N25 A;  1V4R A;  3FIW A;  4YFX F;  3NQO A;  5M3M J;  2OTJ I;  1WJ5 A;  2WAF A;  4L0Y B;  3PFY A;  2DA2 A;  3H92 A;  4I02 A;  5L3D A;  1VQ7 I;  1MH3 A;  3FMQ A;  5HDN A;  1GHC A;  4N0B A;  3UKG A;  4GCV A;  3PNY A;  1Z0X A;  1Y0U A;  2WB1 N;  4AYB N;  2R5Z A;  1ZGA A;  3SZT A;  1TWA J;  1B59 A;  2OZU A;  2Z2S B;  2YU3 A;  1W5T A;  1F36 A;  4CCJ A;  1SVO A;  2FX0 A;  3BJA A;  1ZRC A;  1GVD A;  5LGN A;  5EF6 A;  1HBX G;  1JGG A;  4M72 A;  1POG A;  4XKC A;  1J75 A;  4EMS A;  2JA2 A;  4NC8 A;  4I0A A;  2JPB A;  3MZ8 A;  2KIF A;  1O3Q A;  4PJM A;  2P5V A;  2F4I A;  1XC5 A;  3FXR A;  1TT5 B;  1TQM A;  1X1A A;  1LB2 A;  2W4S A;  4D7N A;  1HOM A;  5IOZ A;  1SD5 A;  2ZB9 A;  2DA4 A;  3BOQ A;  3CMM A;  1J0R A;  2QF7 A;  1W36 C;  1T56 A;  2OJE D;  3JR9 A;  2VQG A;  2LBF B;  3ISP A;  3RIR A;  1LNW A;  1D0Z A;  3FKJ A;  2L54 A;  3G2B A;  3LL7 A;  1APL C;  3WE2 A;  3WHB A;  2CGP A;  4BH9 A;  1FC3 A;  2LF7 A;  3WHC A;  5IP6 A;  2KJC A;  2XSJ C;  3OWT A;  1ETX A;  2R7O A;  3LSM A;  4XSX F;  3K70 D;  2HPM A;  2LLK A;  2Q1Z B;  4A3B J;  1IDZ A;  2E1O A;  1BC7 C;  2RQP A;  2CQN A;  2R5Y B;  4HLY A;  4KIB A;  1FBS A;  4YFK F;  3TO9 A;  3HUG A;  1ZGW A;  4IHW A;  3JCU C;  5EGO B;  1TP4 A;  1H88 C;  3FMR A;  3HRS A;  3GCM A;  2A68 F;  5A2Q K;  2B7E A;  3AG2 H;  3COA C;  4BS9 A;  3GW2 A;  1ZYR F;  2LDU A;  1VQL I;  3SHF A;  2V9V A;  1G3T A;  2CUE A;  4E7Z A;  3HDD A;  1TQI A;  2M34 A;  4B43 A;  2Y30 A;  2IGN A;  5E8I A;  4CGZ A;  5FRO A;  2M87 A;  3IRR A;  3H35 A;  3QWL A;  5ILU A;  2NS8 A;  6PAX A;  3VYS B;  2F5F A;  4B3X A;  3LFK A;  4U0W A;  5H2F C;  2OAZ A;  1LJ9 A;  2XPV A;  3RPU D;  3L2V A;  4RLQ A;  5E3N A;  4BXX J;  2IS6 A;  3H0G J;  3H9Q A;  4XSZ F;  1T08 B;  3LAP A;  5L3F A;  3D0S A;  3K1M A;  2R5Y A;  3TP0 A;  1PYV A;  5FKM A;  2R93 J;  2CU7 A;  2Q2E A;  4BKX A;  3OYJ A;  2FBH A;  5EGO A;  1ZAO A;  5IP9 J;  1MBF A;  4AID A;  1ZG3 A;  3F8F A;  1MD0 A;  1UB9 A;  1T98 A;  2FML A;  2R0Q C;  3LA2 A;  3F8M A;  2OCE A;  4M9X A;  4XKV A;  1GDT A;  1RIO H;  3HXL A;  4FE4 A;  3HOU J;  2DT6 A;  1RUN A;  2V1X A;  4HYE A;  4IXA A;  2HOT A;  3K4L A;  5IT9 Z;  1T6S A;  3A4C A;  3CC2 I;  4TV7 A;  1O57 A;  3K0L A;  3PUF A;  2CUZ A;  3GF2 A;  3AAF A;  3HOS A;  1TQP A;  2O5R A;  3FWE A;  2MFZ A;  2WC2 A;  3KCC A;  1JHH A;  4F55 A;  5FD6 A;  1RKW A;  1BBY A;  3U2R A;  3C7J A;  5BPD A;  1OYY A;  4ENN A;  1LEA A;  3ULQ B;  2DYS H;  3PNT A;  1HDD C;  1G3Y A;  4PDK A;  1ETV A;  4ZDO A;  3HHG A;  4ZC3 A;  3JAM K;  1WH7 A;  4YII A;  4WX9 A;  1MBJ A;  4OAY A;  4U0Y A;  1V3F A;  3BQY A;  2VUM J;  2MLG A;  4A6D A;  2FOK A;  3I55 I;  3S3M A;  1LFB A;  2OC6 A;  4UHT A;  2HXO A;  5F08 A;  1IJW C;  4D5F A;  2IA1 A;  3DPT A;  3MEX A;  1MGT A;  3FBI B;  2KZG A;  4ASN A;  5ICE A;  2MH2 A;  3BR5 A;  1OYI A;  4MTD A;  1WI9 A;  2XAJ A;  1S7E A;  1P7I A;  4RGX A;  2X0L A;  3OYB A;  4KMF A;  2KRC A;  3QOE A;  3DBH B;  2Z9O A;  4V2G A;  2VKE A;  1V5F A;  3GTQ J;  2JA6 J;  3HKZ N;  4CZC A;  2XF7 A;  5ICG A;  3OYK A;  4XID A;  3M4O J;  1OCR H;  1N75 A;  2ZFW A;  4ZH4 F;  3VSK A;  3FBN B;  5CQE A;  4CYD A;  3CF5 F;  1W7P B;  3S3O A;  2E2H J;  2H8W A;  4EJV A;  1BR4 A;  1S7A A;  3MD2 A;  4RM2 A;  1L3L A;  2FNA A;  2L7M P;  1MMS A;  2BZT A;  1KYZ A;  2LFB A;  1MDM B;  3LSG A;  4WXD A;  2Z1D A;  1IN5 A;  2IPQ X;  3FXQ A;  2QQ8 A;  1UG2 A;  3FXK A;  4X6A J;  3KPH A;  1BOA A;  3ROU A;  5D6F A;  2Y9Z A;  3ZPL A;  4RB0 A;  3VOD A;  1KQ9 A;  5GAH J;  4HNV A;  2LKP A;  3CDL A;  2WY8 Q;  2FSW A;  4D5C A;  1IV8 A;  5HLG A;  2O61 A;  1YE9 A;  1KQ8 A;  3S8P A;  3DBL B;  3L9F A;  3ONQ A;  4K2E A;  3KZY A;  1SFO J;  3H9J A;  2ZJR F;  2BE5 F;  4BHC A;  1MNE A;  4R1H A;  1YTY A;  1R5H A;  3OS2 A;  1W0T A;  1EH6 A;  3CJT B;  4RM3 A;  3O8G A;  1W7P A;  3DTE A;  4BE0 A;  2DPD A;  5EYR A;  1P9Q C;  1XG1 A;  1BM9 A;  4XNF A;  4KUM A;  3L1P A;  3OOU A;  3J7A Y;  3E5U A;  4IHV A;  2FNP A;  3HL2 A;  1IG7 A;  1MDM A;  2G7U A;  4KFC A;  4EVI A;  3FZV A;  4HPQ A;  1FYM A;  4A3D J;  1U6G A;  2YS9 A;  4FT8 A;  1IRZ A;  2UWM A;  4AUX A;  2NRA C;  4A3C J;  4Y15 A;  1ZHF A;  2OV7 A;  2B9S A;  1FNN A;  3EUA A;  3F8B A;  2EV5 A;  2P5L C;  2E1M C;  2DTZ A;  2LF8 A;  2DTR A;  5JHU A;  2E7X A; 
#chains in the Genus database with same CATH homology
 2ZXI A;  1X4O A;  3ZQQ A;  2M3A A;  3S3N A;  3W2V A;  4IZZ A;  4KIS A;  3FHN A;  2GOM A;  2ELJ A;  3HPG A;  1V5E A;  2BVM A;  4XLE A;  4PFP A;  1WJB A;  1IRX A;  4XQF A;  4FAS D;  2VKD A;  3VYU B;  3AL0 C;  2RQQ A;  4PUS A;  4PJL A;  3LSH A;  3OMY A;  2M7A A;  2VQC A;  3DPU A;  4KT6 A;  4HNU A;  2MC4 A;  3CJQ B;  4XM3 A;  4PJN A;  1DGW Y;  4C2U A;  4PJJ A;  4CCK A;  3OYI A;  4F91 B;  1W36 D;  1WJD A;  4C2T A;  2VXD A;  4DGW B;  4BJ5 C;  4HRI A;  3U21 A;  3PNV A;  4CA0 A;  1AA7 A;  1N77 A;  2VJ5 A;  2LH9 A;  4XMY A;  4ZDL A;  1X19 A;  5HNF A;  3OL3 A;  2WA0 A;  4E4H A;  4E7J A;  4XOR A;  2LY2 A;  4BU2 A;  2IGM A;  1BR1 A;  3SZG A;  1WJC A;  2CV2 A;  1BOB A;  3L2R A;  3UNG C;  5LD2 C;  2VXZ A;  2BOL A;  3OS0 A;  1UG0 A;  3SYT A;  2HDW A;  2BVL A;  2L2O A;  4ZJZ A;  2VLA A;  3M8J A;  4B48 A;  2R7V A;  4BAC A;  1GLN A;  4ZTF A;  2A5W A;  3H5N A;  4JOM A;  2DJI A;  4C30 A;  3M1C A;  5FRN A;  3OY9 A;  2KQR A;  3VYT B;  3PL8 A;  4X0G A;  1T0F C;  3BG7 A;  3E1S A;  4DJA A;  2R7U A;  3MMY B;  2AQE A;  3MKZ A;  4XOP A;  2M4G A;  3C2H A;  1FMW A;  4H4K C;  4BGD A;  1D1B A;  3LMM A;  3KYL A;  3W2A A;  4NQW B;  4QPQ A;  3HC7 A;  4E7L A;  4F92 B;  4CCL A;  4U87 A;  1D1A A;  2CFO A;  3QYE A;  2A6T A;  2LC2 A;  2RRE A;  2ZXH A;  1Z21 A;  2ZSI B;  3MKW B;  3OR1 C;  2CW7 A;  2V7F A;  3D5L A;  1UEL B;  3SEZ A;  2BW3 B;  4GRI A;  3W3C A;  2CV1 A;  3LSK A;  3V42 A;  1Z3X A;  3OR2 C;  3HG9 A;  4BXF A;  4II2 A;  3OYC A;  4II3 A;  2WB1 A;  2NOJ B;  4DOZ A;  3OYD A;  2HPI A;  2IS4 A;  2XDV A;  2OUM A;  3K70 C;  2DXI A;  4IX7 A;  1LFP A;  1DP3 A;  2ZFU A;  3I3L A;  3IAM 2;  1Z7L A;  2LBF A;  1FMV A;  2VJ4 A;  2V9K A;  3H5A A;  2W82 A;  3N05 A;  1BR2 A;  4BDZ A;  2CW8 A;  4F52 A;  3HOT A;  2LOO A;  2W7N A;  2VB6 A;  2KMU A;  2K9M A;  4P1W A;  4IQJ A;  2R4G A;  3CES A;  4BEH B;  2WAQ A;  3A1Y A;  3NWT A;  4D1Q A;  2KP6 A;  3OYF A;  2BW3 A;  4RMN A;  2ZSH B;  3IP4 B;  4YRV A;  1LKX A;  2LY1 A;  2PMZ A;  3LSI A;  2VIX A;  4XLA A;  4XKW A;  2IS1 A;  4J01 A;  3AL0 B;  4BQN A;  4FET A;  3DQV C;  3DU6 A;  3OS1 A;  1WFX A;  2M0M A;  3K4B A;  2VL8 A;  4E7H A;  4J00 A;  4DBR A;  3QOD A;  3PUB A;  4XLF A;  3VSL A;  3DEE A;  4CCO A;  2JUG A;  3RCO A;  3TBI A;  2LRE A;  1ZEL A;  5LFA A;  1EA3 A;  2MAB A;  1V5G A;  3IAS 2;  2VAS A;  3S32 A;  2R7Q A;  2KL4 A;  2V26 A;  3K4K A;  2VJI A;  3OL4 A;  2R7X A;  4BEH A;  2Z16 A;  1WJ5 A;  2WAF A;  4CSW A;  3PFY A;  3MKY B;  2VQL A;  2E5N A;  1Z3Y A;  4BE2 A;  3EPZ A;  4HEA 2;  1Y6I A;  3BCB A;  3D5R C;  1QHH D;  3PNY A;  2I8D A;  1VZ0 A;  4XLH A;  1MMA A;  2GOX B;  2XF5 A;  2CUJ A;  1E0E A;  2Z2S B;  3NWS A;  4CCJ A;  3PSI A;  2FUG 2;  2UUZ A;  4XKB A;  3KX2 A;  3BLY A;  1QHG A;  4XKC A;  3TMO A;  2JA2 A;  4NC8 A;  3OYG A;  5CQG A;  1MMD A;  4PJM A;  2VQH A;  2F4I A;  1ERD A;  3PJR A;  1X1A A;  2W4S A;  4NNJ A;  3K4M A;  5HNH A;  3K4C A;  3L2W A;  2KZV A;  5CKT A;  3RQ4 A;  3CMM A;  1W36 C;  2L9N A;  3OIP A;  2X6W A;  2VQG A;  3K4N A;  3KEY A;  2LBF B;  2E60 A;  1D0Z A;  3FKJ A;  5KCM A;  2DT7 B;  3G2B A;  3LL7 A;  3H0D A;  2XSJ C;  2XC7 A;  1LVK A;  1MND A;  3OWT A;  2R7O A;  3LSM A;  3K70 D;  3OYA A;  3I9V 2;  3OYL A;  2HPM A;  3BCA A;  1DGR M;  1D0X A;  1G8X A;  2Q1Z B;  1NG7 A;  3ZXS A;  2M4K A;  3OIQ A;  4XLC A;  4CCN A;  3F9K A;  3ZCO A;  1TZL A;  3DTI A;  3ZR8 X;  2WY7 Q;  1LDK B;  4BDY A;  1X1B A;  2KRH A;  2R7S A;  3CP8 A;  4ZTJ A;  4BS9 A;  4ZDP A;  1YX3 A;  2WBM A;  2X6Y A;  1UAA A;  5JHF A;  3K6G A;  1WJE A;  3EUK L;  4JQF A;  2QKL B;  4E7Z A;  4MLO A;  1N78 A;  4B43 A;  2AQF A;  4NUB A;  1OR7 C;  2IGN A;  2LYC A;  3PSF A;  2K3P A;  5FRO A;  2LRD A;  2W00 A;  3H35 A;  2V4J C;  1SFK A;  3VYS B;  4B3X A;  2CH0 A;  3C2G A;  4B47 A;  3RPU D;  1J09 A;  1YX5 A;  4U7B A;  2JSP A;  4RLQ A;  3OYM A;  3L2Q A;  3L2V A;  4IKF A;  2IS6 A;  3H9Q A;  2HVQ A;  2UV1 A;  2HVS A;  2K9L A;  4LIV A;  3RTR A;  2VKH A;  3HKZ A;  1PYV A;  4R79 A;  3QYB A;  3OYJ A;  2Y0S A;  4XOT A;  3W2W A;  2XAU A;  4XN0 A;  1MMG A;  2HU9 A;  4PK4 A;  4G6T B;  3CF2 A;  3GBG A;  4KIT B;  4NC7 A;  3LFU A;  3OYN A;  4E7I A;  2K5C A;  1KON A;  1PJR A;  2F5V A;  4BUP A;  4F3Q A;  2X1E A;  1X4P A;  3AFH A;  4XKV A;  1G59 A;  3A2K A;  3VWB A;  2CMP A;  4F93 B;  3L2U A;  3HXL A;  2DT6 A;  2LG4 A;  3D5S C;  3K4L A;  4AVZ A;  2X85 A;  2DOA A;  4LIU A;  4E7K A;  3A4C A;  4HST A;  2L5Q A;  3BG6 A;  2CUZ A;  2L9S A;  3IUO A;  1X1C A;  1R6R A;  1OLT A;  4RLF A;  3DKY A;  3HOS A;  3TL4 X;  3DKX A;  2IGK A;  2O5R A;  2MFZ A;  4F55 A;  1S9H A;  3AKZ A;  1D0Y A;  2HQA A;  4XN3 A;  1X1D A;  2CV0 A;  1WJA A;  2F6C A;  2R7T A;  3PNT A;  2CS3 A;  2IGO A;  5KHD A;  3OYH A;  3DPL C;  4ZDO A;  2P0W A;  2W1O A;  4ZC3 A;  3BC8 A;  2MD0 A;  4OAY A;  4XL9 A;  4HNT A;  2PJR B;  5CPR B;  3S3M A;  4Y3O A;  4N4O B;  2OC6 A;  4ANJ A;  1Y56 A;  3DU5 A;  4ITV A;  1TT0 A;  3DPT A;  2DCE A;  5FRM A;  4E7S A;  3HUG B;  5HOO A;  4ZYA A;  3FBI B;  2VPL A;  1QU3 A;  2HZD A;  2V1N A;  3ZGK A;  4QPO A;  3K4J A;  2X51 A;  2HVR A;  3OYB A;  2KRC A;  2R7W A;  3QOE A;  3H5R A;  1V5F A;  3RSN A;  4XR6 A;  3SDB A;  4CUG A;  4CZC A;  3CJR B;  2XF7 A;  3OYK A;  2KPM A;  4E6K G;  2E5Z A;  5HLT A;  5HVQ C;  2WAD A;  3HPH A;  3S93 A;  1N75 A;  5KNL A;  3VSK A;  3FBN B;  5CQE A;  2QKM B;  4BL0 B;  3S3O A;  3DTK A;  4BE1 A;  2MYS A;  3VDX A;  4DBQ A;  2PJR A;  1BR4 A;  3MD2 A;  4RM2 A;  4B44 A;  4BJ6 C;  1MMN A;  2HNH A;  3ZRG A;  2XF6 A;  2Q2E B;  4XON A;  3E0J B;  2JVH A;  3LSG A;  2Z1D A;  3H9G A;  1WJF A;  4YEL A;  4C9Y A;  4PSX A;  3DWL E;  2X6X A;  1U0J A;  4HG2 A;  1DQU A;  3CZ6 A;  3DLA A;  4HSR A;  2M7B A;  2WY8 Q;  4OAZ A;  2KLO A;  2X1D A;  2X1C A;  4BQQ A;  1YE9 A;  4PFO A;  4Y4R A;  3S8P A;  4BJT A;  2WAE A;  3ONQ A;  4LG3 A;  2KHM A;  2KDO A;  3H9J A;  4P5O A;  1MNE A;  5TGT A;  3VYR B;  4BQO A;  4D9J A;  2RNG A;  3OS2 A;  4RM3 A;  4AYB A;  1HA8 A;  4IQ4 A;  3DTE A;  4BE0 A;  4OWR B;  1JI8 A;  4CCM A;  2V6E A;  1P9Q C;  4N4N B;  1MW7 A;  2IXS A;  4KJZ A;  4AU7 A;  4XNF A;  4CH7 A;  3EUH C;  3OOU A;  3FDY A;  3J7A Y;  3OYE A;  1T95 A;  3QYF A;  2JVG A;  4PSW A;  3HL2 A;  4Y33 A;  4YEJ A;  2IS2 A;  4HPQ A;  1K6Y A;  4EAT A;  4DIQ A;  4LIT A;  2R7R A;  2VJJ A;  2UWM A;  1SAU A;  2OV7 A;  3K10 A;  3EUA A;  3SEQ A;  1NG6 A;  2E1M B;  3CP2 A;  1D1C A;  2E1M C;  2L7K A;  3UR3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...