4OAYA

Bldd ctd-c-di-gmp complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
80
structure length
80
Chain Sequence
PPKLVLDLERMAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDADARRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
molecule keywords DNA-binding protein
source organism Streptomyces venezuelae
molecule tags Dna binding protein
total genus 27
structure length 80
sequence length 80
chains with identical sequence B, D, E, F, G, H, J, K, M, N, R
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4oayA00
2MC4A 4OAYA 4OAZA 5KHDA
chains in the Genus database with same CATH superfamily
1U8BA 4C30A 3FXLA 2R7QA 2IJLA 4EM1A 2LY9A 4IRGA 4GGGA 1X58A 2JPBA 2L0KA 2L7FP 4HQEA 1MBFA 2RQPA 5AIQA 4I2OA 3OYBA 1OLTA 2ISYA 2LLKA 4PGGA 2KL4A 1W5CC 2QGUA 4XNFA 3R0JA 2DCEA 2R7FA 3P9CA 2Y75A 5CPRB 3AL0B 2LRDA 4L5JA 2L5QA 3W6JB 2VLAA 4KIFA 3HOXJ 2R5ZA 3E3VA 1YX3A 3S93A 2R92J 3OYGA 2XSJC 2M34A 2F5EA 4QPOA 4FQGA 2QZ8A 1SFKA 3BY6A 1OCPA 3Q0WA 2IA0A 1ZKGA 1N77A 4IRIA 1W7PD 5IPAA 4ITVA 3H3VK 1XSDA 1E3PA 5ICCA 2HYGD 1QRYA 3GLLA 4F91B 4CUGA 2H8RA 1G3WA 2K7LA 3FIWA 1TL8A 1I1SA 3K4LA 3SDGA 1XGOA 1J5YA 2BGCA 5EGOA 2ZXIA 2L7MP 2HKXA 1REPC 1R36A 3VWBA 2BVMA 4Y3OA 1D0XA 2ZJ2A 1MSEC 2HTJA 3IAS2 2ID3A 5IOYA 4B4CA 5J40A 2XASA 4CCJA 1YYVA 3EPZA 1TQMA 3KEYA 1RUOA 4U88A 4NHJA 3CCEI 2LVSA 3TP0A 1O7LA 4PFPA 2FMYA 3F0CA 4ESJA 2XRLA 4EVIA 4IF4A 2XAUA 4JP0A 1MMNA 3H3UA 2VE8A 1X2MA 2E1MC 1NH3A 4E7ZA 1LNWA 2HS5A 2GXAA 1WCMJ 4I02A 2DXIA 1B8IA 2LK2A 1YO5C 1FYLA 1BR1A 3FXRA 4IOCF 1R1TA 2IGMA 2JK3A 5CVUA 4RB2C 4GYIA 4EM2A 3HTSB 4CXFA 2E5NA 4R79A 3I4PA 3LL7A 1BL0A 3TO7A 1IRZA 2HQ5A 2OTJI 1CF7B 3DEUA 1R58A 2L9RA 1D1BA 2QLZA 3QP6A 3V4GA 3LQRA 3TDUC 2FXAA 5J47A 1W0TA 3WTUC 2Z5UA 3BG7A 5J6XA 3KPHA 1W1WE 3DBHB 3FX3A 1YHQI 3ZCOA 2DO7A 4CSWA 3LSTA 5F1RA 3LNQA 3U2RA 3F8MA 3KE2A 5C4XJ 1BR4A 3DTEA 3MWMA 4M3FA 1XMAA 2L4MA 1JHFA 5HLIA 2XIGA 2CQ7A 5LGTA 1R4NB 2P5LC 1Z9CA 4CYCA 1V3FA 1WHUA 4WK8F 3BTCA 5HLGA 1FOYA 3Q0UA 1MBKA 5C44J 2ZO4A 1LJ9A 2V1XA 1SEUA 1RRJA 2RKHA 1KU9A 4ZDOA 2XGEA 2VJ4A 1VQOI 2JPCA 5D5UB 2EA2A 1ETVA 2ZJPF 2RNJA 1JTYA 1LB2A 4BXUA 5IYCJ 2RQQA 2YPRA 2EINH 1XGNA 2KIFA 1U5TB 4YFNF 3PM1A 2MD5A 4B48A 2JMWA 1D0YA 3OSFA 5B66C 2CFOA 4HX4A 4OMZA 2VONA 2G7UA 4I99C 4QSHA 4N0BA 1T95A 1TTYA 3UNGC 3T5XA 2DT6A 4P55A 1BJAA 3WODF 5IYDJ 1ENHA 5M5WJ 4WCGA 1KQ8A 2ZMEB 2EV0A 4XM3A 4H4KC 4LFUA 3BROA 1Y0NA 2CW8A 4LIVA 4QTRA 5E8IA 3CCRI 4NC8A 1T0FA 1EF4A 5H6QA 3H0DA 1D5YA 3FWEA 1Z3YA 4NC6A 3H5AA 2XGXA 2Y30A 4MFDA 5ILUA 1ZQ3P 3GMEA 1RIOH 2X6OA 2QENA 2G0EA 4ENKA 1YS6A 2QBYB 3PO2J 3O6BB 1BOAA 3ECOA 2YR2A 2QCOA 3HUGB 4KFCA 2JVGA 2BV6A 1KYWA 2OCEA 1JXSA 4M9ZA 3W2WA 2D2WA 1HW1A 1ULYA 5LHHA 1LDKB 1PVEA 4NUBA 1T2KA 3AG2H 3T8TA 3GLXA 1ETWA 3ZR8X 2PMUA 2IRFG 5L3FA 1IF1A 1NHAA 3HPHA 2HZTA 1K6YA 2MA3A 4XSZF 1T39A 5LGUA 2RNGA 3S2DJ 4AYBA 3CP2A 3ZQGA 4BAYA 3RI4A 5IP7J 4Z6YA 1H89C 2HTSA 1GVDA 3EUHA 1WRJA 3OV8A 1WPKA 2DA6A 1VQ9I 2EFQA 1LVKA 2IGKA 3HSRA 3PFYA 2DMUA 3KZZA 2UUZA 4ESBA 2VOOA 2K4BA 3GBGA 4ENNA 1T8IA 2CH0A 4M6YA 1TWCJ 4IOAF 2IA2A 2V9VA 3KFWX 4A3DJ 1F43A 1HDDC 2PEXA 2JN6A 3SZPA 3OIQA 1ZK8A 2FQ3A 3HRTA 4HF1A 3MZHA 1W5SA 2W85A 4RAZA 2JRTA 4F92B 3AG1H 4BUPA 2DMQA 4UB6C 3FZVA 1V5EA 3PL8A 3ROUA 1YIOA 4UUSA 3G71I 2WV1A 3MQ0A 3GTKJ 4JX6A 1E3HA 1I50J 2XVCA 4KUMA 3TKYA 4V2FA 1FOXA 3PNYA 3DFGA 4A6DA 1P92A 1RETA 2IGNA 4AIHA 2YU9J 3U1DA 1OCZH 3L09A 2VXDA 3RYRA 3H5NA 2XAJA 4XLHA 1K7AA 4PGHA 3CF5F 3I59B 1QNTA 1P9QC 5FLXK 2JA7J 3M9AA 2ESNA 4XRMA 2OQRA 4LIUA 1LFUP 3PNVA 2JT1A 4NB5A 3COAC 3I55I 4UXNA 1QBJA 2NAZA 3FK7A 1U2WA 1X1BA 3ULQB 1FP1D 5GPCA 3TO9A 4IXAA 3U1KA 3CTAA 2DTRA 2PJRA 3FXUA 4OAYA 3E97A 1WI9A 4BEHB 2GAUA 1A36A 1FBSA 2OPTA 3D0SA 1P4AA 3BPXA 1MBHA 2GBYA 1FP2A 3WE2A 1W7PA 4PSXA 3A02A 1FX7A 1UAAA 3E6DA 3AG3H 5F04A 5JHUA 3HEFA 3E5UA 2YX4A 3MVPA 1IN8A 1BM9A 3QQAA 2MW8A 4JX4A 4W97A 5JVGF 1DQUA 2MBFA 4OAZA 5ICGA 1NK2P 5EYRA 3GZ6A 4UNOA 2KPMA 1BI3A 2UV1A 3MZ8A 3CC4I 3BR3A 4AWXB 4ZH4F 1ZG3A 4RAYA 4HEA2 2AXLA 3M8JA 4HZFA 2GOXB 3GEZA 2Y2ZA 2UXNA 2W82A 3VSLA 1WZ2A 2CV0A 4ZYEA 3GTLJ 2D5VA 3G6EI 1HLVA 1DGWY 2X6XA 2BVLA 1K78A 3OYMA 2M8GX 3C18A 2W1OA 2NS0A 1IGNA 5GAEJ 3WG9A 3ZMTA 2LFBA 1OYYA 2V6CA 3H0GJ 4JYKA 1YG2A 2BHYA 1Y1VJ 1QHGA 1SC7A 4RM2A 2R5ZB 1UHMA 2RGVA 1F1ZA 2CQKA 2HFHA 2L2OA 1EV7A 2K86A 2K4JA 3FKIJ 3LSHA 4EGYA 1BW6A 3VFZA 3HRMA 4M71A 1WJ5A 2HR3A 3ZQFA 3F8CA 2MSYA 2FU4A 4MEYF 5HOOA 2CV2A 4I09A 4KT5C 1PUFA 3P9KA 4FX0A 3ZQ7A 2H8WA 2JUCA 2CWEA 4IKFA 2JA2A 3IKVA 2XF7A 4IX7A 4KA4A 2R7TA 2XF5A 1Y8QB 4L9VA 2MH9A 3DLAA 5EGOB 2M4KA 5EEGA 2ECBA 3KZYA 4YFXF 3EYIA 4C2TA 3IWFA 1JI8A 3BG9A 3GFLA 1D8JA 3HHGA 5LEJA 2X48A 4I0AA 1Z67A 5GPAA 4ASNA 4L5IA 2KDOA 2JJ7A 1ITYA 2Y0SA 1ODDA 2P7CB 4LLLA 3DXJF 1AA7A 4WXHA 1T6SA 3K4JA 3JRGA 4XLPF 1ZLKA 1H9GA 1GDTA 2HOSA 3GTOJ 2O5RA 2VKEA 1XCBA 5FD6A 2Z9OA 3RKWA 5D8KB 3WTYC 3BDDA 1SFOJ 4IO9F 4G6TB 2HOEA 2Y31A 3K69A 3OYDA 2LNBA 2GA2A 3PO3J 5J4YA 2XAQA 2FJ1A 1FBQA 4KT6A 1B8IB 3HKZN 3CJQB 4BYYA 3P9IA 4Y52J 3F8FA 1MMGA 3QYEA 2X85A 5FGMA 2BW3A 4CA0A 5EDNA 3CZ6A 1TWFJ 1O3QA 1MJBA 4HYEA 3LSKA 2OZ6A 2DOAA 2FNAA 3ABMH 1E3OC 2LKPA 1TLHB 4OU0A 2E2HJ 3FM5A 3A0BC 2XB0X 4M72A 4Q48A 2ME6A 1Q1VA 3K1MA 5FKKA 4Q4ZF 1RPWA 4BBRJ 3TOAA 3RKYA 3KEOA 3W2VA 5H6RA 1RKWA 4I76A 1WJAA 2DI3A 1XGMA 1XN7A 4UVBA 1ORKA 3CP8A 4CYCB 2ZCWA 4S04A 4P96A 3OIOA 4V2GA 3BR6A 1DP7P 3LA7A 2H94A 3M3YJ 4MTEA 2OF7A 1ZN2A 2P4WA 2VUMJ 2MD0A 4HF2A 3F3XA 5DTDA 4XIDA 1RESA 4A3IJ 5BOXA 1GXQA 4ENMA 2XF6A 3W3CA 2R5YA 2XUBA 4E7SA 2V4JC 2K02A 1UMQA 1WI3A 1YTYA 2LSOA 3MZYA 4DZJA 3CMMA 3WU1B 3C3WA 3CJNA 3K4NA 2E34A 3GZ5A 3CJRB 5L3GA 2ZXJA 3S2HJ 3SZGA 2XAFA 2ESHA 3N97A 4G7OF 1WKMA 3JRFA 3CQZJ 2X1DA 2VPRA 2DOFA 2D1VA 3T0YA 3LSPA 2PI0A 2FF4A 1I6XA 1YRNB 2V6EA 1Z21A 2W00A 2M7BA 1A35A 2DW4A 4LB6B 1YJNI 1VQ5I 3SEQA 3QPTA 2CO5A 2MLGA 3GCMA 2HDCA 4GYGA 3F6OA 3SEZA 2DA1A 5DEQA 4HF0A 3F72A 2DYRH 1O7FA 3WTXC 1KQ0A 4PK4A 2W84A 2FSWA 2WTEA 1X3WB 4OIRF 3I54A 2MG4A 5BQTA 4U0YA 1X1PA 1JKPC 1RZ4A 2QQBA 2PQ8A 2WC2A 5HS8A 2MFZA 5E18F 1TWHJ 1IN6A 5C3EJ 1IN4A 4LGWA 2DMPA 3H9JA 1HC8A 3AFHA 4M3BA 2E35A 3KX2A 3WGGA 1U8RA 3KP2A 1KGSA 3PNTA 3IUOA 4GDFA 3OR1C 3O8GA 1SFEA 4M74A 4UUTA 4BJTA 4HAMA 1FJLA 1J2XA 3AG4H 3WE3A 3I3LA 4LG0A 2HVSA 1HKQA 2CUFA 2F6CA 4DBRA 4AUXA 1MNDA 3BG3A 5K1YA 1P7IA 2HU9A 1HF0A 1R9TJ 2Q1ZB 2NVUB 2DN0A 4IPAA 1D8KA 2FOWA 5EJCA 3RZDJ 4HSRA 2R7VA 3N05A 1VF9A 2DFIA 1VQ6I 3LSIA 3HHHA 3PSFA 3LA3A 2A5YB 3ZQIA 2QA4I 1OYWA 2R0QC 4YIRX 2QVOA 1YS7A 2M1BA 3PQJA 4RDUA 1IG7A 1FLIA 3BOQA 4DYCA 1FBUA 1LDDA 2KKOA 3T8RA 3J7AO 3C2GA 5FKOA 1OPCA 3J80Z 5ERIA 1FYKA 2GQQA 3I0TA 1Y8RB 4YIIA 2EZKA 4XSXF 4DW6A 1NK3P 3KP3A 3SDBA 2ZNYA 3S2WA 4Y13A 5B3SH 1FPQA 4HX7A 4Y33A 2HPMA 2RVCA 2CW0F 4C3HJ 4A3LJ 4YELA 4KN7X 4AIKA 2P81A 2VT2A 3ZP5A 1BA5A 4TV7A 3F8NA 1HQCA 2CQXA 3LFKA 3PIOF 1LEAA 1C0WA 4DQ2A 2LY2A 4YFKF 4F52A 4BXFA 3K2AA 1ZG1A 2A3SA 1IDYA 3VODA 4UUSB 3CCSI 1SVLA 2R7OA 1G6NA 2MC3A 3CMAI 2E2JJ 2FA5A 1B9MA 3JRIA 2H1LA 2ICWG 3QWLA 1ETOA 5F0CA 2DOEA 4G9YA 1Z1DA 2DAOA 3DKWA 5B1AH 1L3LA 3HPGA 5KAFC 3JRCA 3QODA 4LOCA 5FLVA 4C2MJ 4BACA 3S15J 3H35A 5D6EA 3MKYB 2KHMA 2VPLA 3U21A 3MCZA 3ZOBA 2DLLA 3OYIA 1Z91A 2L9NA 3LOCA 4RGRA 3CCVI 2NVXJ 1JGSA 4RMNA 3R60A 2X51A 1YIJI 4CGZA 1G4DA 3KYLA 4B09A 3G1LA 4A2UA 2O7OA 3KP4A 4FASD 2PJRB 2K27A 3QU3A 2DBBA 1B9NA 4OWRB 4L18B 2JSPA 5F0FA 3PSIA 2K9NA 1W7PB 3C7JA 4XLFA 3F21A 1GXPA 4HV6A 4EJOA 1IJWC 2EA4A 5E1WA 4N9IA 4XBFA 1QVUA 2KZGA 1D1CA 3F8BA 4BY1J 5F6FA 3VPRA 1HBXG 5L3EA 1FNNA 2ACJA 3TL4X 1AHDP 4KICA 1BI1A 3CUOA 4LITA 2HQAA 1VQ7I 1VQLI 4HV5A 1OR7C 3M1EA 3BR5A 2VBZA 2W24A 1R22A 2CS3A 1VQPI 5H20A 5FB2A 3HSEA 2DT7B 2KIUA 2ZXWH 2QUFA 2XB5A 3E5QA 3FXJA 4A3BJ 2VB6A 1HCRA 1ACIA 4LD5A 1SD6A 2WAEA 2VBXA 5GP9A 4ZTFA 2W48A 4AIJA 1UHSA 4UV8A 4PZJA 3MKWB 5B1BH 1K79A 4XMYA 3BCBA 3L2QA 4V19K 3ABLH 3HYIA 5K7FA 3J7YJ 2ZBKA 1V5GA 1QPIA 4KIGA 2YX7A 1UELB 2F2EA 2KMUA 4I6ZA 3TQNA 3CLQA 2B9SA 1E2XA 4BQNA 2WB1A 3KLNA 2CV1A 2ZKZA 3V8KA 3QOEA 1GVJA 3HJEA 4XOPA 1PUFB 1SVOA 1IV6A 3HM5A 2HOTA 3DBLB 1ETQA 2BXZA 3EDPA 3EQLF 4EV0A 5ED4A 1ZREA 4BQAA 5IYBJ 1R7JA 1STZA 2V26A 3WTVC 2PLYA 5IP9J 3ZXSA 1BOBA 3QOPA 2M5WA 2AXTC 5HNFA 3UKGA 1I6HJ 2DFFA 4UY8I 2V9KA 1OYIA 5D4RA 1YFHA 2Y69H 2JTVA 4HBLA 4U0WA 2JSCA 3ELKA 3V7RA 2H6BA 1MNMC 3PFIA 2IT0A 1AKHA 2L7ZA 2COMA 2F5DA 4QPQA 1ETYA 3HIFA 3BTJA 5DM7F 4PJ0C 3P5JA 2EB7A 4LJZF 1P7JA 3J7ZI 1W4MA 3FMRA 2MLKA 2XV4S 3AKZA 1MIJA 3ERMA 4KITB 2D45A 1LPQA 1BIBA 5CVIA 1I5ZA 3A1YA 1QHHD 1R5HA 3JRAA 2RC4A 1GV2A 2ZFUA 4HG2A 3HL2A 1WSUA 2K9LA 1VQ8I 3DTKA 1TT5B 1T56A 4CCOA 2KT0A 4IQ4A 4P5OA 5CYVA 4KN4X 1VQ4I 5CVRA 2A61A 3HBLA 2P6SA 3LA2A 4JX5A 2M9HA 2Z1DA 2L9VA 1P4XA 1BC7C 2JQ7A 3K70C 4A0XA 3R6SA 1ZARA 4YG2F 2BYVE 3BPVA 1DPUA 3I58A 3JRHA 4DBQA 4RGSA 3JSPA 4L5EA 3EUAA 3LSRA 5HDNA 1HW2A 2X6WA 2VKHA 2WAQA 1VZ0A 3BR1A 2IAIA 3H36A 4EEFG 3WTTC 2R7UA 2VE9A 1FTZA 3E6MA 3B6AA 4FISA 4YEJA 1FMVA 2Q2EA 1P6RA 4KJZA 1HA8A 2YU3A 2BXYA 3GO5A 3HGGA 4EMSA 2HGCA 3AAFA 2AQEA 2KIQA 3S8PA 2FOKA 3OMYA 1N25A 3BP8A 1A6IA 4CICA 2PMZA 5EEHA 1QQIA 3CJTB 1MDMA 5IP6A 4ON0A 3OS2A 2KIMA 2RDPA 1FSHA 3FMQA 1I27A 4E7LA 4XLEA 5FKLA 2KZVA 4HLXA 3JRBA 2R5YB 1K6OA 2R7XA 1FIAA 4L9TA 3CUQC 1D1AA 3E5XA 3PIPF 2XPVA 3H3ZA 4CCKA 4BJ5C 2E5ZA 2VN2A 3IL2A 2XC7A 1MD0A 2Z33A 4XKCA 5KK1A 5DCFA 3BT9A 1KZHA 3BG6A 3Q3SA 1QZZA 3A2KA 2XAHA 2COBA 2Z2SB 3FHNA 2GXBA 4NQWB 2LP0A 1D3YA 5J8FA 1B4AA 2TDXA 3K4BA 3QYBA 3GUDA 1FZPB 2BY1A 4KMUX 3GTJJ 4BJ6C 2DJIA 5HLTA 1GV5A 1MMAA 5M3MJ 5HNHA 3BR2A 3JTHA 1JKOC 3CC2I 2TCTA 3SJMA 4HX8A 4BHCA 1F4KA 3G3ZA 3K4KA 4AVPA 3W2AA 2CQQA 2GZWA 4LLNA 1R1UA 2ZSHB 4B3AA 4B43A 1T33A 3VEPA 2WY7Q 3BR0A 1Z3XA 2X1EA 1JHHA 2E19A 2PMZN 2A6EF 1ZYRF 1JTXA 2EJRA 1QGPA 3ESWB 3FM3A 3QYFA 1UJ8A 3R0AA 4AYBN 5HDKA 3MMYB 3KCCA 3NAUA 5BPIA 4KISA 4A3CJ 2VC0A 5LGNA 2DK8A 3U9GA 5IOZA 1WH5A 5BMZA 1PDNC 3WTZA 3S3OA 4LG0B 2DU9A 3GVAA 3S14J 1PJRA 4XLNF 4D5CA 3WGIA 5DM6F 2CUZA 1WH7A 3IRRA 2A68F 3WU2C 2IPQX 2UXXA 2EIKH 2H6CA 3ECHA 3G1OA 1YQAA 3BJOA 4DYRA 1JUSA 3IKTA 2P5KA 3KEQA 2OAZA 3JW4A 1ZRCA 2OU2A 2LBFB 1ETXA 2E60A 4PSWA 1H8AC 1LDJA 3OR2C 3SQNA 2LF7A 2F5FA 1POGA 4U87A 2M45A 3KLOA 2EH3A 4S05A 1O57A 4ZZLA 1FY7A 3D5LA 2H09A 1FMWA 2VT3A 2KQRA 3CCQI 2EZLA 2FRHA 4D7NA 2CG4A 2HQRA 3DWLE 3FF5A 1W0UA 3JR9A 3QPHA 1RR8C 4KYWA 1SAUA 2BHZA 3DBRB 1N78A 4FHTA 2FBIA 4X0GA 4BE2A 2LD5A 1ZR2A 4D7MA 3VOEA 5J8CA 1SFUA 3RZOJ 1IRGA 1S7OA 2RN7A 2ISZA 2E7XA 2D1HA 2JWTA 1FC3A 3ZN1A 1LEBA 4Z2YA 2BY2A 2JA8J 1IXRC 1W5TA 2CRGA 2PFBA 3JSOA 4JQFA 3I71A 2XGDA 2HI3A 3CO7C 4F7ZA 3I56I 4OIOF 2LREA 2BBYA 2LG4A 4OIPF 4A3JJ 4FE7A 2HDDA 4EJUA 3S16J 5LHIA 2CFXA 4CCMA 2B0LA 1OR7A 2CGPA 3CCMI 1B1BA 2JVHA 1UHWA 1R00A 3DPLC 2STWA 1WJBA 1YE9A 1EH7A 2F5CA 3L2RA 5KNLA 2JZYA 2QKMB 1TBXA 4ZC3A 2KJCA 4MIMA 2N8GA 1T08B 2E1CA 5DDGA 2XAGA 3OYNA 1TZLA 1USSA 1L0OC 4R1HA 2ZXHA 2NRAC 3W6KB 3IC7A 3Q9VA 3CCUI 4GRIA 1I39A 1U78A 4ZYAA 4AM3A 2Z16A 4L9NA 4BXXJ 3REOA 4P9FA 2DT5A 4BE0A 1SD4A 2ELJA 4HDUA 4IZZA 4ZYHA 2QF7A 5BPDA 1ETKA 2DA3A 2F4OB 3JCUC 3Q9SA 5HS7A 3QP5A 2IP2A 4UV9A 1LQ1A 2EZHA 1XDSA 2GWRA 3F23A 2O3FA 1QU3A 4MQVA 4XRFA 1H88C 1USTA 2K9QA 1A5JA 1IZ1A 3C2BA 1KU3A 4G7ZF 3ZMZA 2JA5J 4RB1A 5AIPA 3DPTA 4II2A 1RNLA 5EEAA 1QPMA 3FDYA 3RPUD 4BU2A 1ZHFA 2XRNA 3LAJA 1S9HA 3HRUA 3HOVJ 1XTAA 4FCYA 2FUG2 3L2VA 1QA6A 3OL3A 2MGQA 4AD9A 2EIJH 3ASOH 3K2ZA 2HZDA 2VIXA 1JT0A 3QAHA 1IDZA 5LRRA 1TW2A 1LE8A 4CHUA 4EATA 3G2BA 2M8EA 5JLXA 3OYKA 3GW2A 3ZGKA 2CW7A 3CMEI 3I5UA 4Y17A 3RYPA 2OCCH 3UR3C 2GIVA 4HLYA 2Y0SN 2VJ5A 2M30A 3H9GA 1R23A 1TQIA 4G8XA 5GAHJ 4HSTA 4JK1X 1XD7A 5DD4A 1LKXA 1X1DA 1MSFC 1U9OA 4LB5A 3QU6A 1AU7A 1ZRDA 2QBYA 2EK5A 3J80K 1FIPA 4LG3A 3HTUA 3M8FA 2OV7A 2LMDA 3HUGA 4HPQA 5EZGA 4ZDLA 4AIDA 4RLFA 4C9YA 2O61A 1EH8A 1BI0A 3KP6A 2IW5A 3ZN0A 1EJ9A 3D5RC 3KETA 5F1JA 5D5XB 2XDVA 4B44A 3HXLA 1XPXA 4PCQA 4RM3A 5C4JJ 2EFPA 2QSGX 2A6TA 2NYXA 5L3DA 3N4MA 5CVVA 1Z7UA 5J1RA 3OY9A 1APLC 4BKXA 1BIAA 1XX5A 3BLYA 4C3JJ 3PUBA 1BW5A 3MKLA 1R1VA 1B59A 3RKQA 5TRDA 4UVCA 2QM3A 1YW8A 5CVJA 3R61A 4ESFA 2RAEA 3MN2A 4HW0A 1U6GA 1UZCA 5FFZA 2BY3A 5DYMA 2DJNA 1DUXC 2IEKA 3LFUA 1A04A 1CQTA 1YX5A 4BHPA 3L7WA 1MZBA 2VBWA 1F9NA 2FMLA 2R4GA 2CU7A 3HDDA 5DCMA 4PJJA 3ZQHA 4PFOA 3WHCA 4EQQA 2R3SA 1MH4A 2KFDA 3CCYA 1XS9A 1Y56A 5L3CA 1TQPA 2R93J 4O6JA 5FKNA 3SYTA 5IY5H 5FKMA 3CUQA 3O3KA 2WBMA 2GXGA 4CDGA 3JRDA 2WY8Q 4B8XA 2KRHA 4IHVA 4D5FA 5EG0A 2JA6J 2QQ9A 1S72I 3CDLA 2LH9A 2IS6A 6PAXA 2EIMH 2EV6A 3O2PE 4PJNA 4A0YA 2EFWA 2Q2EB 3BC8A 3GF2A 3RIRA 2O6GE 3LSMA 3IV5A 3CCJI 2DFEA 3E7LA 5GTIC 3OS0A 1NTCA 4IHSA 3L1PA 1FSEA 3PUFA 1K61A 3RTRA 1UG2A 2FQ4A 4GFBA 1YJWI 3MAJA 3DEWA 2X0LA 3BCAA 4RA2A 2IA1A 1MDMB 2M2EA 2XPUA 3FXKA 3V8LA 4U7BA 1G2HA 2BEOA 2RREA 1G3SA 3GFJA 1X3ZB 3OL4A 4NNJA 4RLQA 5FO5A 3JAMK 3LAPA 3DV8A 5E79C 4A93J 3GX4X 3CC7I 1I1GA 1MMSA 1BN5A 1Z05A 4PDKA 2CMPA 2GM4A 2IS2A 1Y39A 4M3DA 4BL0B 4MHGA 3AL0C 1G3YA 4EGZA 3IH4A 1FOKA 2ZNZA 1R5ID 5J3LA 1YOVB 4P9UA 3EETA 1ON1A 3GTQJ 3I53A 1D5VA 3S1MJ 1PUEE 2ZB9A 1JE8A 5KCMA 4BNCA 3NEUA 5ILVA 5E1ZB 4JBAA 3OYCA 1MW7A 3HGYA 4HA8A 4XKWA 4F3QA 2HYJA 1V4RA 3MD2A 4LK1F 2EZIA 3OYAA 3QPLA 2ELHA 3WGHA 3IWZA 2G7HA 3ZMDA 4WX9A 5IT9K 4QLCU 5CLSA 5GTHC 1BC8C 1S29A 4GO1A 3CF2A 1T38A 3HOTA 1X1AA 1MGTA 1WJEA 3IH2A 4ZYGA 1PP8F 3FK6A 1RC9A 4M9XA 4DYQA 5E3NA 4KIBA 3BQYA 4DNCA 1RUNA 1ZR4A 4E4HA 2PG4A 1IRFA 2JUGA 3O8HA 2OUMA 2L02A 1GHCA 2QQAA 3BJAA 1RI7A 4A3MJ 4L0ZB 1MJAA 4PJLA 3F22A 3A03A 1VNDA 3NWTA 1XDUA 2VI6A 2CYYA 4A12A 4IHYA 2A05A 1U0JA 1E0EA 1KONA 2J5PA 2MC4A 1O4XA 2L54A 2IS1A 1YLFA 1OCTC 4XOTA 2NVQJ 4G94A 1Z6TA 5A2QK 1GUUA 2FBKA 4M6XA 2LOOA 2YS9A 4ZYDA 1MBEA 1W36C 4FETA 2O03A 4GXOA 3Q5FA 3NQOA 2X6YA 1TNTA 3SHFA 4XONA 3TBIA 2AO9A 2XPWA 3IHUA 1S7AA 4AVZA 1GLNA 2OD5A 5K5OA 1TW3A 5HDGA 4ETSA 2K40A 5KHDA 4QIWN 4II3A 2OZUA 2M3AA 4UHTA 3S3MA 2ZJRF 1W36D 2IBDA 2C6YA 5CQEA 3C2HA 2ZC2A 3JAMZ 3ZPLA 1ZGJA 2ECCA 3FHZA 4Q47A 2DQRA 4XR6A 4MTDA 3S1RJ 2IS4A 2MH2A 4N9HA 2WA0A 2Y48A 1JUPA 3VYUB 2OQGA 1O3TA 4A5MA 3V42A 1X2NA 3HC7A 1MMDA 2VJJA 1K78B 4PUSA 1D0ZA 4MNUA 2XKOA 4C2UA 2ZJQF 4EJTA 3GYHX 1T98A 2HOAA 1JJ6C 2FE3A 4MQ9F 4Y7NJ 1VI0A 3LSGA 3BQZA 4B47A 3WU0A 3WG7H 4RAGA 3CCLI 2O0YA 5CKTA 1ZAOA 2E7WA 2DODA 3DQVC 4M9SA 4RGUA 5HVQC 1IAWA 1QZYA 2VXZA 1OMIA 3B02A 4CCLA 2F48A 5E3MA 1FWZA 3VYSB 4XRSG 4IVNA 2M0MA 5IT9Z 3QPSA 2Y9ZA 2P6TA 3RPUA 2R7SA 2ME0A 1S8NA 2NOGA 2E1MB 4M6VA 3HB9A 1B72A 3K10A 2MYSA 3IAM2 1V54H 1AOYA 4A3KJ 2F4MB 3IP4B 5M5YJ 1FEXA 1S6LA 2VQHA 1U5TC 5JVTA 3Q0VA 4N4OB 1J7KA 1J09A 2CSOA 2P0WA 3CMYA 4EJWA 3H9QA 4E7IA 4G6QA 3CDIA 3FXQA 3ML6A 3OOPA 5KAIC 1MKMA 3DCFA 1SD5A 1SFXA 2FX0A 1OFCX 3H5RA 3OYEA 2J5OA 3D1NI 2V1NA 4CCNA 3GZNB 4BGDA 1ONVA 2Z99A 1RR7A 2MABA 2DK5A 5E20A 2UWMA 2ZMEC 3BTIA 4I01A 4G7HF 1Z0XA 2Z3YA 5D5WB 5DUIA 5D4SA 4AU7A 4DJAA 2R7WA 2YSRA 5E1XA 1MNEA 4B3XA 5LRSA 1WGXA 4ANJA 3IH3A 5A2QZ 2OA4A 3V7SA 4LK0F 2H27A 3BG5A 5TJJA 1BBYA 2NVYJ 2PJPA 3A4CA 1PYVA 2AQFA 3OOUA 2I10A 5HS9A 1CGPA 1F5TA 4IEJA 4XLAA 1LFBA 4GCVA 2O8KA 1S5LC 2QEXI 2HVQA 2HKOA 3BJ6A 2X9DA 4BDYA 4XLCA 2A5WA 5M5XJ 2WB1N 4MEXF 1H9TA 2K9SA 1Y6IA 3ABUA 2CJJA 3JTGA 1Q1HA 4DIQA 4RGXA 1WFXA 1ZELA 2OBPA 4I0BA 4WXDA 3K1NA 1BR2A 4CYDA 3E6BA 2BW3B 3SZTA 1X4OA 5TISC 3BZCA 2VBYA 2NNNA 1YRNA 3M07A 1LE8B 2X4HA 4WF2A 4HNUA 2H1KA 3K70D 3I9V2 3RQIA 1SANA 5B5EC 3TW6A 1S7EA 3ABTA 1WJCA 1EA3A 3K6GA 1ZTRA 1DPRA 4QWQA 5F0HA 4FE4A 3DPUA 1OISA 3VSKA 2KRCA 1VQNI 2ETHA 1J59A 1V55H 2HDWA 5FRNA 5JFRA 2GLOA 5H2FC 1IXCA 4RAFA 2P8TA 1Z7LA 2DDBA 3HOYJ 4BY7J 4LLGF 5JLWA 2KRFA 3TO6A 3FMSA 4MO7A 3OYJA 4OIQF 3RPQA 3VB2A 3CO6C 1U3EM 5E8GA 3TOBA 3DP7A 3G73A 1Z77A 1G59A 1ZG5A 1TNSA 4IQJA 2KLOA 4A69C 3T1BA 1ZH5A 2B63J 3M4OJ 1N75A 2EFNA 3BTLA 1MH3A 1E17A 2LDUA 5ICFA 1LFPA 1DP3A 1XGSA 1G8XA 5CJ9A 4IL6C 3ERED 3RQ4A 2XROA 1I3QJ 3M7GA 3L2WA 3A01A 5JHFA 2I8DA 5DUKA 1KA8A 4RB0A 4M3GA 2DTZA 4R8HA 1IN7A 1Z6RA 2IGOA 3DLLF 2WAQN 4A3FJ 1IN5A 3BZKA 4IJAA 2XSDC 5IT3A 3PJRA 2DMNA 1VQMI 1HKSA 2EILH 5K7ZA 4XICA 5DCMB 2R7RA 1R71A 1IUYA 2DPUA 1TWGJ 3FXMA 2PMHA 1UB9A 5LHGA 1VQKI 4IHTA 1UFMA 2HYFA 4CZCA 2VKDA 4ABZA 2VODA 2PBIA 4XN0A 1JUMA 1EH6A 2GOMA 5J4VA 5M3FJ 1IV8A 3ZRGA 3CUQB 2VQGA 1KYZA 1P4WA 2FD5A 2Y0MA 5HODA 5EG0B 4A6EA 1ZRFA 2K3FA 3G1MA 4U7DA 4L0YB 4RB3C 3H1CA 3VYRB 4E6KG 1QVTA 1KQ9A 1K4SA 2EPFA 4Y15A 2PN6A 1Y1WJ 1HW5A 2CUJA 4HRIA 3B6CA 3K4CA 1A31A 2QSFX 3KP7A 5FD5A 5BS6A 2OTLI 2ADUA 2IXSA 3HOZJ 4A0ZA 1DDNA 3FKJA 5E17F 1WJFA 2OJED 3G4SI 3RSNA 4G12A 2L01A 3CDHA 5E3LA 3KZIC 2HXOA 3OYLA 4O3MA 4ENJA 1J9IA 3L2CA 2HVRA 1HDPA 4BE1A 1WJDA 1QO0D 1H0MA 3ONQA 3I4NJ 2KDZA 2V1UA 1WWXA 2FEZA 4I98B 4EJVA 3HZJA 2RV8A 4KMFA 2K3PA 4KNYA 5K5QA 2LTPA 4IRHA 3L2UA 3NARA 2R7ZJ 3HSFA 3ZMUA 2E1OA 1VFCA 4J01A 5LFAA 4MGRA 4NDLA 1SMTA 4A3EJ 3MEXA 3V8JA 2L4AA 1FTTA 1ERDA 5LLQA 4H0EA 2NS8A 2EWNA 3I4MJ 1O3RA 5FROA 2L7KA 3HOSA 4F55A 3SFIA 5CQGA 3HG9A 4X1EA 4E7JA 1V5FA 2IVMA 3FISA 4D0PA 2YUSA 2G9WA 2E71A 2P7VB 3NWSA 1S3JA 3M8EA 4XKVA 2VQLA 5L3BA 4BBSJ 4BQQA 3K9TA 5D8LB 3EUKL 5FFXA 5KVRA 2FNPA 2Y9YA 3R4KA 4DZPA 3TGNA 1XC5A 2AS5F 1KU7A 4D1QA 2STTA 1UG0A 3L9FA 3CD6I 4MFEA 1JKQC 3VYTB 3KIOA 1DGRM 2HQNA 5F64A 1RKTA 3DU6A 5TGTA 2W57A 3E6CC 2ZSIB 1HOMA 4U0VA 4IHXA 1X19A 2WADA 3ISPA 1FYMA 5J1UA 1YI2I 3H92A 1JKRC 4PJMA 4O5VA 1CF7A 4YIFA 3TMOA 4E7HA 2KP6A 5J1YA 1WQ2A 1MJ9A 3ZQCA 2DA5A 2LYCA 3OIPA 1J75A 3GTGJ 3RKXA 1HSTA 1OCCH 5LBQA 4UB8C 4G6DA 2V9PA 4K2EA 3J7AY 3HKZA 2EFOA 5E3OA 2I5UA 1R6RA 2A6HF 3KP5A 3DF8A 3MFKA 1ZGAA 1MBGA 4XKBA 2OC6A 1B6AA 4N4NB 2ELKA 3NRVA 3HOUJ 2QYOA 2KJBA 3HOWJ 3PQKA 1LUJB 1R49A 2NNYA 2A07F 2CUEA 3DU5A 5LD2C 1PP7U 4A5NA 2W25A 4Y4RA 3LQQA 1YW7A 2DA4A 1X3UA 5GADJ 5FLXZ 4M3EA 2QKLB 1HSJA 3GTMJ 1OKRA 2VJIA 2DMTA 5DS9A 2DA2A 4YRVA 4BHBA 2EBIA 3KYDB 3GWZA 4W1UA 2HNHA 1YITI 3EYYA 2QSHX 3GTPJ 4OINF 1R4MB 1WVRA 2V7FA 3WHBA 1U5TA 1AWCA 3W6VA 1I3AA 5GAGJ 4AC0A 2WWYA 1R5GA 5F27A 4HQMA 1XMXA 4RS8A 3SFZA 4NC7A 2VL8A 1NG6A 3OYFA 3IRQA 4E70A 4MLOA 3V7CA 4OOIA 4LMYA 3RJPA 3VDXA 2O9LA 1SD7A 3ZMSA 2ZMEA 2W7NA 4FX4A 2QQ8A 3I64A 3S3NA 3TEDA 2BOLA 5DD8A 1SMYF 1XMKA 4HNTA 3E0JB 3M1CA 4FT8A 5HLHA 3TP3A 5FJ8J 4S0HB 4WXCA 1OCRH 3J81K 2FBHA 3RCOA 2NS7A 3JREA 3S32A 2F5VA 3HRSA 1OCOH 1FOWA 1ZGWA 3BZ6A 3K4MA 4XORA 1B72B 4UVAA 5DV5A 3MKZA 1JGGA 2E1NA 3F9KA 2LR8A 4Q5SF 4XL9A 5LEKA 4J19A 4BS9A 1TC3C 3C1DA 1IO2A 4WWCA 3B73A 3GFIA 2XHKA 2K9MA 2PX9A 4ZZDA 5BNGA 3A0HC 1DU0A 1XB4A 4IHWA 2VQCA 4DGWB 1JT6A 5D5VB 1HKTA 2M87A 2WV0A 3QRFF 5ICEA 1AKHB 3S17J 5FLMJ 3DKYA 2DQLA 1SAXA 2L9SA 1IXSB 1JJ8C 2HPIA 3K7AJ 3TW7A 2TRTA 4HOBA 3SXYA 5K5RA 3OS1A 1SVMA 3DEEA 1OJLA 1K4TA 2K85A 1T0FC 1VTNC 2DFHA 2VC1A 3P7NA 4I7HA 4HNVA 4A3GJ 4D9JA 5ILSA 3LWFA 2DYSH 1XCVA 1ZLJA 5F08A 3DTIA 3X2QH 2K5CA 1HXDA 3K0LA 1X4PA 2P5VA 3CESA 4E7KA 2HWVA 2X1CA 5K7HA 4X6AJ 1TT0A 2O8XA 2HEOA 2A69F 1TP4A 2AHQA 2HXIA 1YW9A 4BH9A 2LKSA 4C3IJ 2V79A 1ON2A 3ZQLA 4NQWA 3ASNH 1TWAJ 4F93B 1O3SA 2M7AA 3RDIA 2KISA 2L3DA 3K1PA 1IW7F 2E36A 4ZDPA 4KDPA 2GA1A 3FBIB 3WTWC 5D6FA 3OWTA 4XK4A 3KYCB 2V1DA 3F6VA 4XN3A 1OQYA 2B7EA 2NVTJ 4CZZA 3OYHA 1KU2A 3GXOA 2Q8KA 1M1EB 2M4GA 3DKXA 5AONA 3S1NJ 4ZTJA 3D5SC 3ZQQA 2R7DA 2M0CA 3GFMA 3LMMA 1G3TA 2EV5A 2WAFA 4JOMA 4OMYA 2LC2A 3L00A 2LKXA 3EUHC 3FXOA 2UZKA 5JR3A 1U9NA 1XSVA 4BDZA 1XG1A 3I59A 3WTSC 3ZMVA 2E2IJ 3J81Z 1K83J 2VASA 2LY1A 2BE5F 4M73A 4XRSA 1F36A 2GIZA 4DOZA 1YJ9I 1EKEA 1NG7A 4CO8A 4BQOA 1P2FA 2Q0OA 5JI6A 3CLOA 4XQFA 4B1RA 1LVAA 2EQRA 4CH7A 5EZHA 2DDAA 5EF6A 2NOJB 2BZTA 2LF8A 1Y0UA 4NBQA 4BEHA 9ANTA 3FBNB 1IRXA 1QZEA 3E1SA 4J00A 3OSGA 1A6QA 2ZFWA 1DU6A 1X1CA 1UCRA 3S1QJ 3TDZC 2DPDA 2W4SA 4P1WA 1MBJA 4HDVA 1IUFA 2XGCA 4RBOA 2F4IA 1BJZA 2CQNA 3A01B 4L9JA 2LBFA 1BI2A 1J0RA 2XKPA 4UUVA 4ZJZA 2ID6A 2NXNB 2DA7A 2VKVA 3BWGA 2QWWA 1XSXA 1IC8A 1GT0C 2JRMA 1FT9A 4FTHA 3LSJA 2VOPA 4EM0B 3ABKH 2BY0A 5FRMA
chains in the Genus database with same CATH topology
4C30A 4ANJA 2R7QA 3LSKA 1PJRA 2DOAA 2CUZA 3OYBA 1OLTA 1PYVA 3A4CA 2AQFA 2KL4A 3OOUA 4CA0A 4XLAA 4XNFA 2DCEA 2HVQA 4BDYA 4XLCA 2A5WA 5CPRB 3AL0B 2LRDA 3W2VA 2LBFB 2L5QA 2E60A 1Y6IA 4PSWA 2VLAA 1WJAA 3OR2C 4DIQA 3CP8A 4U87A 1WFXA 1ZELA 1YX3A 3S93A 3OYGA 2XSJC 1BR2A 4QPOA 3D5LA 2BW3B 1FMWA 1X4OA 2KQRA 1SFKA 2MD0A 3DWLE 1N77A 4ITVA 2XF6A 3W3CA 1SAUA 4HNUA 4F91B 4E7SA 1N78A 4CUGA 3K70D 2V4JC 3I9V2 4X0GA 4BE2A 3K4LA 1WJCA 1EA3A 3K6GA 3CMMA 2ZXIA 3DPUA 3K4NA 3VSKA 2KRCA 3CJRB 3VWBA 2BVMA 4Y3OA 1D0XA 3SZGA 2HDWA 5FRNA 3IAS2 4JQFA 2X1DA 1Z7LA 4CCJA 2LREA 3EPZA 1Z21A 2W00A 2LG4A 2M7BA 3OYJA 2V6EA 3KEYA 3SEQA 3SEZA 4CCMA 4PFPA 2JVHA 1G59A 3DPLC 1WJBA 1YE9A 4IQJA 3L2RA 5KNLA 2KLOA 2XAUA 2QKMB 4PK4A 1N75A 1MMNA 4ZC3A 2E1MC 1DP3A 1LFPA 4E7ZA 1G8XA 3OYNA 1TZLA 3RQ4A 2ZXHA 2DXIA 2MFZA 3L2WA 5JHFA 2I8DA 4GRIA 4ZYAA 2Z16A 2IGOA 1BR1A 3H9JA 3AFHA 2IGMA 3KX2A 3PNTA 4BE0A 3IUOA 3PJRA 2E5NA 2ELJA 4R79A 3OR1C 4IZZA 2R7RA 3LL7A 4BJTA 3I3LA 2HVSA 4CZCA 2F6CA 2VKDA 4DBRA 1D1BA 1MNDA 4XN0A 2GOMA 2HU9A 3ZRGA 2Q1ZB 3BG7A 2VQGA 1QU3A 3ZCOA 4HSRA 4CSWA 3N05A 2R7VA 3LSIA 3PSFA 1BR4A 3DTEA 3DPTA 4II2A 3VYRB 3FDYA 4E6KG 3RPUD 4BU2A 3C2GA 1S9HA 4HRIA 2CUJA 3K4CA 2FUG2 3L2VA 3OL3A 3SDBA 2IXSA 2HPMA 2HZDA 4Y33A 4ZDOA 4B3XA 2VJ4A 2VIXA 3FKJA 1WJFA 3RSNA 4YELA 4EATA 3OYLA 3G2BA 3OYKA 3ZGKA 2HVRA 2CW7A 4BE1A 1WJDA 3UR3C 3ONQA 2RQQA 2VJ5A 2LY2A 4B48A 3H9GA 4F52A 1D0YA 4HSTA 2K3PA 4BXFA 1LKXA 1X1DA 2CFOA 2R7OA 3L2UA 4LG3A 1T95A 4J01A 3UNGC 5LFAA 2DT6A 2OV7A 3HPGA 1ERDA 4HPQA 4ZDLA 3QODA 4RLFA 4C9YA 4XM3A 4BACA 4H4KC 3H35A 2CW8A 5FROA 4LIVA 3D5RC 2L7KA 3HOSA 4NC8A 4F55A 2KHMA 3MKYB 2VPLA 2XDVA 3HG9A 5CQGA 3HXLA 1V5FA 3U21A 4B44A 4E7JA 3OYIA 4RM3A 3H0DA 2L9NA 2A6TA 4RMNA 1Z3YA 2X51A 3NWSA 3OY9A 3KYLA 4XKVA 2VQLA 4BQQA 3BLYA 3H5AA 3EUKL 3PUBA 4FASD 2PJRB 4OWRB 2JSPA 3PSIA 4D1QA 1UG0A 4XLFA 3VYTB 1DGRM 3HUGB 3LFUA 2JVGA 3DU6A 5TGTA 1YX5A 2ZSIB 1D1CA 1X19A 2WADA 2R4GA 3W2WA 4PJJA 4PFOA 1LDKB 3TL4X 4NUBA 4PJMA 4LITA 2HQAA 3TMOA 3ZR8X 4E7HA 1Y56A 2KP6A 3SYTA 3HPHA 1K6YA 2LYCA 3OIPA 1OR7C 2WBMA 2RNGA 2WY8Q 2KRHA 4AYBA 2CS3A 3J7AY 3CP2A 2DT7B 3HKZA 1R6RA 4XKBA 2OC6A 2LH9A 4N4NB 2VB6A 2IS6A 1LVKA 2IGKA 4PJNA 2WAEA 2Q2EB 3DU5A 3PFYA 4ZTFA 3BC8A 2UUZA 5LD2C 4Y4RA 3GBGA 3LSMA 3OS0A 2CH0A 3MKWB 2QKLB 4XMYA 3BCBA 2VJIA 3L2QA 3RTRA 1V5GA 4YRVA 3BCAA 1UELB 3OIQA 2KMUA 4U7BA 2HNHA 2RREA 4RLQA 3OL4A 4NNJA 4BQNA 2WB1A 2V7FA 4F92B 4BUPA 2CV1A 3QOEA 4XOPA 2CMPA 1V5EA 3PL8A 2IS2A 2V26A 4NC7A 2VL8A 1NG6A 4BL0B 3OYFA 3PNYA 3ZXSA 1BOBA 5HNFA 3AL0C 4MLOA 2V9KA 2IGNA 3VDXA 2VXDA 3H5NA 4XLHA 5KCMA 2W7NA 3S3NA 1P9QC 2BOLA 3OYCA 1MW7A 4HNTA 4XKWA 3E0JB 3M1CA 4F3QA 4LIUA 3MD2A 3PNVA 4QPQA 3RCOA 3OYAA 3S32A 2F5VA 1X1BA 3K4MA 4XORA 2PJRA 4OAYA 3MKZA 3F9KA 4BEHB 4XL9A 3CF2A 4BS9A 3AKZA 3HOTA 1X1AA 4KITB 1WJEA 3A1YA 4PSXA 1QHHD 2K9MA 1UAAA 2ZFUA 4HG2A 3HL2A 2K9LA 2VQCA 4DGWB 3DTKA 4E4HA 2JUGA 4CCOA 2OUMA 4IQ4A 4P5OA 3DKYA 2L9SA 4PJLA 2Z1DA 2HPIA 1DQUA 3NWTA 4OAZA 3K70C 1U0JA 3OS1A 1E0EA 2KPMA 1KONA 2UV1A 3DEEA 2MC4A 1T0FC 4HEA2 2IS1A 4D9JA 4DBQA 3M8JA 2GOXB 3EUAA 4XOTA 2W82A 3VSLA 2CV0A 3DTIA 2X6WA 2LOOA 2K5CA 2VKHA 2WAQA 1VZ0A 1W36C 1X4PA 4FETA 1DGWY 2X6XA 2BVLA 2R7UA 2X6YA 3CESA 3OYMA 4XONA 3TBIA 2W1OA 4E7KA 2X1CA 1TT0A 4YEJA 1FMVA 1GLNA 4AVZA 4KJZA 5KHDA 1HA8A 4II3A 1QHGA 4RM2A 2M3AA 4F93B 2AQEA 3S3MA 2M7AA 1W36D 2L2OA 3S8PA 3OMYA 5CQEA 4ZDPA 3C2HA 3FBIB 3LSHA 2PMZA 3OS2A 1WJ5A 3OWTA 4XR6A 2IS4A 4E7LA 5HOOA 2WA0A 4XN3A 4XLEA 2KZVA 2CV2A 3VYUB 2R7XA 3V42A 3OYHA 3HC7A 1MMDA 1D1AA 2VJJA 2M4GA 4PUSA 1D0ZA 3DKXA 4IKFA 4CCKA 2JA2A 3D5SC 2XF7A 3ZQQA 4BJ5C 4IX7A 4ZTJA 3LMMA 2E5ZA 4C2UA 2XF5A 2R7TA 2XC7A 4XKCA 2WAFA 3DLAA 4JOMA 2LC2A 2M4KA 3BG6A 3EUHC 3LSGA 4C2TA 3FHNA 2Z2SB 4B47A 3A2KA 4NQWB 1JI8A 4BDZA 3K4BA 5CKTA 3QYBA 3DQVC 2KDOA 2VASA 4BJ6C 2DJIA 2LY1A 5HVQC 1MMAA 5HLTA 2VXZA 2Y0SA 4CCLA 5HNHA 4DOZA 1NG7A 3VYSB 4BQOA 2M0MA 1AA7A 3K4JA 4XQFA 2R7SA 2E1MB 4CH7A 2NOJB 3K4KA 3K10A 3W2AA 2MYSA 3IAM2 4BEHA 2O5RA 3IP4B 3S3OA 3FBNB 2VQHA 2ZSHB 1IRXA 3E1SA 4B43A 4J00A 4N4OB 2WY7Q 1J09A 2P0WA 1X1CA 1Z3XA 4G6TB 2X1EA 3H9QA 3OYDA 4E7IA 2W4SA 3QYFA 4P1WA 3H5RA 2F4IA 4KT6A 3OYEA 2LBFA 2V1NA 4CCNA 3CJQB 4BGDA 4ZJZA 2MABA 3MMYB 4KISA 2UWMA 4AU7A 4DJAA 2R7WA 1MMGA 3QYEA 1MNEA 2X85A 2BW3A 5FRMA 3CZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC4 A;  4OAY A;  4OAZ A;  5KHD A; 
#chains in the Genus database with same CATH topology
 1U8B A;  4C30 A;  3FXL A;  2R7Q A;  2IJL A;  4EM1 A;  2LY9 A;  4IRG A;  4GGG A;  1X58 A;  2JPB A;  2L0K A;  2L7F P;  4HQE A;  1MBF A;  2RQP A;  5AIQ A;  4I2O A;  3OYB A;  1OLT A;  2ISY A;  2LLK A;  4PGG A;  2KL4 A;  1W5C C;  2QGU A;  4XNF A;  3R0J A;  2DCE A;  2R7F A;  3P9C A;  2Y75 A;  5CPR B;  3AL0 B;  2LRD A;  4L5J A;  2L5Q A;  3W6J B;  2VLA A;  4KIF A;  3HOX J;  2R5Z A;  3E3V A;  1YX3 A;  3S93 A;  2R92 J;  3OYG A;  2XSJ C;  2M34 A;  2F5E A;  4QPO A;  4FQG A;  2QZ8 A;  1SFK A;  3BY6 A;  1OCP A;  3Q0W A;  2IA0 A;  1ZKG A;  1N77 A;  4IRI A;  1W7P D;  5IPA A;  4ITV A;  3H3V K;  1XSD A;  1E3P A;  5ICC A;  2HYG D;  1QRY A;  3GLL A;  4F91 B;  4CUG A;  2H8R A;  1G3W A;  2K7L A;  3FIW A;  1TL8 A;  1I1S A;  3K4L A;  3SDG A;  1XGO A;  1J5Y A;  2BGC A;  5EGO A;  2ZXI A;  2L7M P;  2HKX A;  1REP C;  1R36 A;  3VWB A;  2BVM A;  4Y3O A;  1D0X A;  2ZJ2 A;  1MSE C;  2HTJ A;  3IAS 2;  2ID3 A;  5IOY A;  4B4C A;  5J40 A;  2XAS A;  4CCJ A;  1YYV A;  3EPZ A;  1TQM A;  3KEY A;  1RUO A;  4U88 A;  4NHJ A;  3CCE I;  2LVS A;  3TP0 A;  1O7L A;  4PFP A;  2FMY A;  3F0C A;  4ESJ A;  2XRL A;  4EVI A;  4IF4 A;  2XAU A;  4JP0 A;  1MMN A;  3H3U A;  2VE8 A;  1X2M A;  2E1M C;  1NH3 A;  4E7Z A;  1LNW A;  2HS5 A;  2GXA A;  1WCM J;  4I02 A;  2DXI A;  1B8I A;  2LK2 A;  1YO5 C;  1FYL A;  1BR1 A;  3FXR A;  4IOC F;  1R1T A;  2IGM A;  2JK3 A;  5CVU A;  4RB2 C;  4GYI A;  4EM2 A;  3HTS B;  4CXF A;  2E5N A;  4R79 A;  3I4P A;  3LL7 A;  1BL0 A;  3TO7 A;  1IRZ A;  2HQ5 A;  2OTJ I;  1CF7 B;  3DEU A;  1R58 A;  2L9R A;  1D1B A;  2QLZ A;  3QP6 A;  3V4G A;  3LQR A;  3TDU C;  2FXA A;  5J47 A;  1W0T A;  3WTU C;  2Z5U A;  3BG7 A;  5J6X A;  3KPH A;  1W1W E;  3DBH B;  3FX3 A;  1YHQ I;  3ZCO A;  2DO7 A;  4CSW A;  3LST A;  5F1R A;  3LNQ A;  3U2R A;  3F8M A;  3KE2 A;  5C4X J;  1BR4 A;  3DTE A;  3MWM A;  4M3F A;  1XMA A;  2L4M A;  1JHF A;  5HLI A;  2XIG A;  2CQ7 A;  5LGT A;  1R4N B;  2P5L C;  1Z9C A;  4CYC A;  1V3F A;  1WHU A;  4WK8 F;  3BTC A;  5HLG A;  1FOY A;  3Q0U A;  1MBK A;  5C44 J;  2ZO4 A;  1LJ9 A;  2V1X A;  1SEU A;  1RRJ A;  2RKH A;  1KU9 A;  4ZDO A;  2XGE A;  2VJ4 A;  1VQO I;  2JPC A;  5D5U B;  2EA2 A;  1ETV A;  2ZJP F;  2RNJ A;  1JTY A;  1LB2 A;  4BXU A;  5IYC J;  2RQQ A;  2YPR A;  2EIN H;  1XGN A;  2KIF A;  1U5T B;  4YFN F;  3PM1 A;  2MD5 A;  4B48 A;  2JMW A;  1D0Y A;  3OSF A;  5B66 C;  2CFO A;  4HX4 A;  4OMZ A;  2VON A;  2G7U A;  4I99 C;  4QSH A;  4N0B A;  1T95 A;  1TTY A;  3UNG C;  3T5X A;  2DT6 A;  4P55 A;  1BJA A;  3WOD F;  5IYD J;  1ENH A;  5M5W J;  4WCG A;  1KQ8 A;  2ZME B;  2EV0 A;  4XM3 A;  4H4K C;  4LFU A;  3BRO A;  1Y0N A;  2CW8 A;  4LIV A;  4QTR A;  5E8I A;  3CCR I;  4NC8 A;  1T0F A;  1EF4 A;  5H6Q A;  3H0D A;  1D5Y A;  3FWE A;  1Z3Y A;  4NC6 A;  3H5A A;  2XGX A;  2Y30 A;  4MFD A;  5ILU A;  1ZQ3 P;  3GME A;  1RIO H;  2X6O A;  2QEN A;  2G0E A;  4ENK A;  1YS6 A;  2QBY B;  3PO2 J;  3O6B B;  1BOA A;  3ECO A;  2YR2 A;  2QCO A;  3HUG B;  4KFC A;  2JVG A;  2BV6 A;  1KYW A;  2OCE A;  1JXS A;  4M9Z A;  3W2W A;  2D2W A;  1HW1 A;  1ULY A;  5LHH A;  1LDK B;  1PVE A;  4NUB A;  1T2K A;  3AG2 H;  3T8T A;  3GLX A;  1ETW A;  3ZR8 X;  2PMU A;  2IRF G;  5L3F A;  1IF1 A;  1NHA A;  3HPH A;  2HZT A;  1K6Y A;  2MA3 A;  4XSZ F;  1T39 A;  5LGU A;  2RNG A;  3S2D J;  4AYB A;  3CP2 A;  3ZQG A;  4BAY A;  3RI4 A;  5IP7 J;  4Z6Y A;  1H89 C;  2HTS A;  1GVD A;  3EUH A;  1WRJ A;  3OV8 A;  1WPK A;  2DA6 A;  1VQ9 I;  2EFQ A;  1LVK A;  2IGK A;  3HSR A;  3PFY A;  2DMU A;  3KZZ A;  2UUZ A;  4ESB A;  2VOO A;  2K4B A;  3GBG A;  4ENN A;  1T8I A;  2CH0 A;  4M6Y A;  1TWC J;  4IOA F;  2IA2 A;  2V9V A;  3KFW X;  4A3D J;  1F43 A;  1HDD C;  2PEX A;  2JN6 A;  3SZP A;  3OIQ A;  1ZK8 A;  2FQ3 A;  3HRT A;  4HF1 A;  3MZH A;  1W5S A;  2W85 A;  4RAZ A;  2JRT A;  4F92 B;  3AG1 H;  4BUP A;  2DMQ A;  4UB6 C;  3FZV A;  1V5E A;  3PL8 A;  3ROU A;  1YIO A;  4UUS A;  3G71 I;  2WV1 A;  3MQ0 A;  3GTK J;  4JX6 A;  1E3H A;  1I50 J;  2XVC A;  4KUM A;  3TKY A;  4V2F A;  1FOX A;  3PNY A;  3DFG A;  4A6D A;  1P92 A;  1RET A;  2IGN A;  4AIH A;  2YU9 J;  3U1D A;  1OCZ H;  3L09 A;  2VXD A;  3RYR A;  3H5N A;  2XAJ A;  4XLH A;  1K7A A;  4PGH A;  3CF5 F;  3I59 B;  1QNT A;  1P9Q C;  5FLX K;  2JA7 J;  3M9A A;  2ESN A;  4XRM A;  2OQR A;  4LIU A;  1LFU P;  3PNV A;  2JT1 A;  4NB5 A;  3COA C;  3I55 I;  4UXN A;  1QBJ A;  2NAZ A;  3FK7 A;  1U2W A;  1X1B A;  3ULQ B;  1FP1 D;  5GPC A;  3TO9 A;  4IXA A;  3U1K A;  3CTA A;  2DTR A;  2PJR A;  3FXU A;  4OAY A;  3E97 A;  1WI9 A;  4BEH B;  2GAU A;  1A36 A;  1FBS A;  2OPT A;  3D0S A;  1P4A A;  3BPX A;  1MBH A;  2GBY A;  1FP2 A;  3WE2 A;  1W7P A;  4PSX A;  3A02 A;  1FX7 A;  1UAA A;  3E6D A;  3AG3 H;  5F04 A;  5JHU A;  3HEF A;  3E5U A;  2YX4 A;  3MVP A;  1IN8 A;  1BM9 A;  3QQA A;  2MW8 A;  4JX4 A;  4W97 A;  5JVG F;  1DQU A;  2MBF A;  4OAZ A;  5ICG A;  1NK2 P;  5EYR A;  3GZ6 A;  4UNO A;  2KPM A;  1BI3 A;  2UV1 A;  3MZ8 A;  3CC4 I;  3BR3 A;  4AWX B;  4ZH4 F;  1ZG3 A;  4RAY A;  4HEA 2;  2AXL A;  3M8J A;  4HZF A;  2GOX B;  3GEZ A;  2Y2Z A;  2UXN A;  2W82 A;  3VSL A;  1WZ2 A;  2CV0 A;  4ZYE A;  3GTL J;  2D5V A;  3G6E I;  1HLV A;  1DGW Y;  2X6X A;  2BVL A;  1K78 A;  3OYM A;  2M8G X;  3C18 A;  2W1O A;  2NS0 A;  1IGN A;  5GAE J;  3WG9 A;  3ZMT A;  2LFB A;  1OYY A;  2V6C A;  3H0G J;  4JYK A;  1YG2 A;  2BHY A;  1Y1V J;  1QHG A;  1SC7 A;  4RM2 A;  2R5Z B;  1UHM A;  2RGV A;  1F1Z A;  2CQK A;  2HFH A;  2L2O A;  1EV7 A;  2K86 A;  2K4J A;  3FKI J;  3LSH A;  4EGY A;  1BW6 A;  3VFZ A;  3HRM A;  4M71 A;  1WJ5 A;  2HR3 A;  3ZQF A;  3F8C A;  2MSY A;  2FU4 A;  4MEY F;  5HOO A;  2CV2 A;  4I09 A;  4KT5 C;  1PUF A;  3P9K A;  4FX0 A;  3ZQ7 A;  2H8W A;  2JUC A;  2CWE A;  4IKF A;  2JA2 A;  3IKV A;  2XF7 A;  4IX7 A;  4KA4 A;  2R7T A;  2XF5 A;  1Y8Q B;  4L9V A;  2MH9 A;  3DLA A;  5EGO B;  2M4K A;  5EEG A;  2ECB A;  3KZY A;  4YFX F;  3EYI A;  4C2T A;  3IWF A;  1JI8 A;  3BG9 A;  3GFL A;  1D8J A;  3HHG A;  5LEJ A;  2X48 A;  4I0A A;  1Z67 A;  5GPA A;  4ASN A;  4L5I A;  2KDO A;  2JJ7 A;  1ITY A;  2Y0S A;  1ODD A;  2P7C B;  4LLL A;  3DXJ F;  1AA7 A;  4WXH A;  1T6S A;  3K4J A;  3JRG A;  4XLP F;  1ZLK A;  1H9G A;  1GDT A;  2HOS A;  3GTO J;  2O5R A;  2VKE A;  1XCB A;  5FD6 A;  2Z9O A;  3RKW A;  5D8K B;  3WTY C;  3BDD A;  1SFO J;  4IO9 F;  4G6T B;  2HOE A;  2Y31 A;  3K69 A;  3OYD A;  2LNB A;  2GA2 A;  3PO3 J;  5J4Y A;  2XAQ A;  2FJ1 A;  1FBQ A;  4KT6 A;  1B8I B;  3HKZ N;  3CJQ B;  4BYY A;  3P9I A;  4Y52 J;  3F8F A;  1MMG A;  3QYE A;  2X85 A;  5FGM A;  2BW3 A;  4CA0 A;  5EDN A;  3CZ6 A;  1TWF J;  1O3Q A;  1MJB A;  4HYE A;  3LSK A;  2OZ6 A;  2DOA A;  2FNA A;  3ABM H;  1E3O C;  2LKP A;  1TLH B;  4OU0 A;  2E2H J;  3FM5 A;  3A0B C;  2XB0 X;  4M72 A;  4Q48 A;  2ME6 A;  1Q1V A;  3K1M A;  5FKK A;  4Q4Z F;  1RPW A;  4BBR J;  3TOA A;  3RKY A;  3KEO A;  3W2V A;  5H6R A;  1RKW A;  4I76 A;  1WJA A;  2DI3 A;  1XGM A;  1XN7 A;  4UVB A;  1ORK A;  3CP8 A;  4CYC B;  2ZCW A;  4S04 A;  4P96 A;  3OIO A;  4V2G A;  3BR6 A;  1DP7 P;  3LA7 A;  2H94 A;  3M3Y J;  4MTE A;  2OF7 A;  1ZN2 A;  2P4W A;  2VUM J;  2MD0 A;  4HF2 A;  3F3X A;  5DTD A;  4XID A;  1RES A;  4A3I J;  5BOX A;  1GXQ A;  4ENM A;  2XF6 A;  3W3C A;  2R5Y A;  2XUB A;  4E7S A;  2V4J C;  2K02 A;  1UMQ A;  1WI3 A;  1YTY A;  2LSO A;  3MZY A;  4DZJ A;  3CMM A;  3WU1 B;  3C3W A;  3CJN A;  3K4N A;  2E34 A;  3GZ5 A;  3CJR B;  5L3G A;  2ZXJ A;  3S2H J;  3SZG A;  2XAF A;  2ESH A;  3N97 A;  4G7O F;  1WKM A;  3JRF A;  3CQZ J;  2X1D A;  2VPR A;  2DOF A;  2D1V A;  3T0Y A;  3LSP A;  2PI0 A;  2FF4 A;  1I6X A;  1YRN B;  2V6E A;  1Z21 A;  2W00 A;  2M7B A;  1A35 A;  2DW4 A;  4LB6 B;  1YJN I;  1VQ5 I;  3SEQ A;  3QPT A;  2CO5 A;  2MLG A;  3GCM A;  2HDC A;  4GYG A;  3F6O A;  3SEZ A;  2DA1 A;  5DEQ A;  4HF0 A;  3F72 A;  2DYR H;  1O7F A;  3WTX C;  1KQ0 A;  4PK4 A;  2W84 A;  2FSW A;  2WTE A;  1X3W B;  4OIR F;  3I54 A;  2MG4 A;  5BQT A;  4U0Y A;  1X1P A;  1JKP C;  1RZ4 A;  2QQB A;  2PQ8 A;  2WC2 A;  5HS8 A;  2MFZ A;  5E18 F;  1TWH J;  1IN6 A;  5C3E J;  1IN4 A;  4LGW A;  2DMP A;  3H9J A;  1HC8 A;  3AFH A;  4M3B A;  2E35 A;  3KX2 A;  3WGG A;  1U8R A;  3KP2 A;  1KGS A;  3PNT A;  3IUO A;  4GDF A;  3OR1 C;  3O8G A;  1SFE A;  4M74 A;  4UUT A;  4BJT A;  4HAM A;  1FJL A;  1J2X A;  3AG4 H;  3WE3 A;  3I3L A;  4LG0 A;  2HVS A;  1HKQ A;  2CUF A;  2F6C A;  4DBR A;  4AUX A;  1MND A;  3BG3 A;  5K1Y A;  1P7I A;  2HU9 A;  1HF0 A;  1R9T J;  2Q1Z B;  2NVU B;  2DN0 A;  4IPA A;  1D8K A;  2FOW A;  5EJC A;  3RZD J;  4HSR A;  2R7V A;  3N05 A;  1VF9 A;  2DFI A;  1VQ6 I;  3LSI A;  3HHH A;  3PSF A;  3LA3 A;  2A5Y B;  3ZQI A;  2QA4 I;  1OYW A;  2R0Q C;  4YIR X;  2QVO A;  1YS7 A;  2M1B A;  3PQJ A;  4RDU A;  1IG7 A;  1FLI A;  3BOQ A;  4DYC A;  1FBU A;  1LDD A;  2KKO A;  3T8R A;  3J7A O;  3C2G A;  5FKO A;  1OPC A;  3J80 Z;  5ERI A;  1FYK A;  2GQQ A;  3I0T A;  1Y8R B;  4YII A;  2EZK A;  4XSX F;  4DW6 A;  1NK3 P;  3KP3 A;  3SDB A;  2ZNY A;  3S2W A;  4Y13 A;  5B3S H;  1FPQ A;  4HX7 A;  4Y33 A;  2HPM A;  2RVC A;  2CW0 F;  4C3H J;  4A3L J;  4YEL A;  4KN7 X;  4AIK A;  2P81 A;  2VT2 A;  3ZP5 A;  1BA5 A;  4TV7 A;  3F8N A;  1HQC A;  2CQX A;  3LFK A;  3PIO F;  1LEA A;  1C0W A;  4DQ2 A;  2LY2 A;  4YFK F;  4F52 A;  4BXF A;  3K2A A;  1ZG1 A;  2A3S A;  1IDY A;  3VOD A;  4UUS B;  3CCS I;  1SVL A;  2R7O A;  1G6N A;  2MC3 A;  3CMA I;  2E2J J;  2FA5 A;  1B9M A;  3JRI A;  2H1L A;  2ICW G;  3QWL A;  1ETO A;  5F0C A;  2DOE A;  4G9Y A;  1Z1D A;  2DAO A;  3DKW A;  5B1A H;  1L3L A;  3HPG A;  5KAF C;  3JRC A;  3QOD A;  4LOC A;  5FLV A;  4C2M J;  4BAC A;  3S15 J;  3H35 A;  5D6E A;  3MKY B;  2KHM A;  2VPL A;  3U21 A;  3MCZ A;  3ZOB A;  2DLL A;  3OYI A;  1Z91 A;  2L9N A;  3LOC A;  4RGR A;  3CCV I;  2NVX J;  1JGS A;  4RMN A;  3R60 A;  2X51 A;  1YIJ I;  4CGZ A;  1G4D A;  3KYL A;  4B09 A;  3G1L A;  4A2U A;  2O7O A;  3KP4 A;  4FAS D;  2PJR B;  2K27 A;  3QU3 A;  2DBB A;  1B9N A;  4OWR B;  4L18 B;  2JSP A;  5F0F A;  3PSI A;  2K9N A;  1W7P B;  3C7J A;  4XLF A;  3F21 A;  1GXP A;  4HV6 A;  4EJO A;  1IJW C;  2EA4 A;  5E1W A;  4N9I A;  4XBF A;  1QVU A;  2KZG A;  1D1C A;  3F8B A;  4BY1 J;  5F6F A;  3VPR A;  1HBX G;  5L3E A;  1FNN A;  2ACJ A;  3TL4 X;  1AHD P;  4KIC A;  1BI1 A;  3CUO A;  4LIT A;  2HQA A;  1VQ7 I;  1VQL I;  4HV5 A;  1OR7 C;  3M1E A;  3BR5 A;  2VBZ A;  2W24 A;  1R22 A;  2CS3 A;  1VQP I;  5H20 A;  5FB2 A;  3HSE A;  2DT7 B;  2KIU A;  2ZXW H;  2QUF A;  2XB5 A;  3E5Q A;  3FXJ A;  4A3B J;  2VB6 A;  1HCR A;  1ACI A;  4LD5 A;  1SD6 A;  2WAE A;  2VBX A;  5GP9 A;  4ZTF A;  2W48 A;  4AIJ A;  1UHS A;  4UV8 A;  4PZJ A;  3MKW B;  5B1B H;  1K79 A;  4XMY A;  3BCB A;  3L2Q A;  4V19 K;  3ABL H;  3HYI A;  5K7F A;  3J7Y J;  2ZBK A;  1V5G A;  1QPI A;  4KIG A;  2YX7 A;  1UEL B;  2F2E A;  2KMU A;  4I6Z A;  3TQN A;  3CLQ A;  2B9S A;  1E2X A;  4BQN A;  2WB1 A;  3KLN A;  2CV1 A;  2ZKZ A;  3V8K A;  3QOE A;  1GVJ A;  3HJE A;  4XOP A;  1PUF B;  1SVO A;  1IV6 A;  3HM5 A;  2HOT A;  3DBL B;  1ETQ A;  2BXZ A;  3EDP A;  3EQL F;  4EV0 A;  5ED4 A;  1ZRE A;  4BQA A;  5IYB J;  1R7J A;  1STZ A;  2V26 A;  3WTV C;  2PLY A;  5IP9 J;  3ZXS A;  1BOB A;  3QOP A;  2M5W A;  2AXT C;  5HNF A;  3UKG A;  1I6H J;  2DFF A;  4UY8 I;  2V9K A;  1OYI A;  5D4R A;  1YFH A;  2Y69 H;  2JTV A;  4HBL A;  4U0W A;  2JSC A;  3ELK A;  3V7R A;  2H6B A;  1MNM C;  3PFI A;  2IT0 A;  1AKH A;  2L7Z A;  2COM A;  2F5D A;  4QPQ A;  1ETY A;  3HIF A;  3BTJ A;  5DM7 F;  4PJ0 C;  3P5J A;  2EB7 A;  4LJZ F;  1P7J A;  3J7Z I;  1W4M A;  3FMR A;  2MLK A;  2XV4 S;  3AKZ A;  1MIJ A;  3ERM A;  4KIT B;  2D45 A;  1LPQ A;  1BIB A;  5CVI A;  1I5Z A;  3A1Y A;  1QHH D;  1R5H A;  3JRA A;  2RC4 A;  1GV2 A;  2ZFU A;  4HG2 A;  3HL2 A;  1WSU A;  2K9L A;  1VQ8 I;  3DTK A;  1TT5 B;  1T56 A;  4CCO A;  2KT0 A;  4IQ4 A;  4P5O A;  5CYV A;  4KN4 X;  1VQ4 I;  5CVR A;  2A61 A;  3HBL A;  2P6S A;  3LA2 A;  4JX5 A;  2M9H A;  2Z1D A;  2L9V A;  1P4X A;  1BC7 C;  2JQ7 A;  3K70 C;  4A0X A;  3R6S A;  1ZAR A;  4YG2 F;  2BYV E;  3BPV A;  1DPU A;  3I58 A;  3JRH A;  4DBQ A;  4RGS A;  3JSP A;  4L5E A;  3EUA A;  3LSR A;  5HDN A;  1HW2 A;  2X6W A;  2VKH A;  2WAQ A;  1VZ0 A;  3BR1 A;  2IAI A;  3H36 A;  4EEF G;  3WTT C;  2R7U A;  2VE9 A;  1FTZ A;  3E6M A;  3B6A A;  4FIS A;  4YEJ A;  1FMV A;  2Q2E A;  1P6R A;  4KJZ A;  1HA8 A;  2YU3 A;  2BXY A;  3GO5 A;  3HGG A;  4EMS A;  2HGC A;  3AAF A;  2AQE A;  2KIQ A;  3S8P A;  2FOK A;  3OMY A;  1N25 A;  3BP8 A;  1A6I A;  4CIC A;  2PMZ A;  5EEH A;  1QQI A;  3CJT B;  1MDM A;  5IP6 A;  4ON0 A;  3OS2 A;  2KIM A;  2RDP A;  1FSH A;  3FMQ A;  1I27 A;  4E7L A;  4XLE A;  5FKL A;  2KZV A;  4HLX A;  3JRB A;  2R5Y B;  1K6O A;  2R7X A;  1FIA A;  4L9T A;  3CUQ C;  1D1A A;  3E5X A;  3PIP F;  2XPV A;  3H3Z A;  4CCK A;  4BJ5 C;  2E5Z A;  2VN2 A;  3IL2 A;  2XC7 A;  1MD0 A;  2Z33 A;  4XKC A;  5KK1 A;  5DCF A;  3BT9 A;  1KZH A;  3BG6 A;  3Q3S A;  1QZZ A;  3A2K A;  2XAH A;  2COB A;  2Z2S B;  3FHN A;  2GXB A;  4NQW B;  2LP0 A;  1D3Y A;  5J8F A;  1B4A A;  2TDX A;  3K4B A;  3QYB A;  3GUD A;  1FZP B;  2BY1 A;  4KMU X;  3GTJ J;  4BJ6 C;  2DJI A;  5HLT A;  1GV5 A;  1MMA A;  5M3M J;  5HNH A;  3BR2 A;  3JTH A;  1JKO C;  3CC2 I;  2TCT A;  3SJM A;  4HX8 A;  4BHC A;  1F4K A;  3G3Z A;  3K4K A;  4AVP A;  3W2A A;  2CQQ A;  2GZW A;  4LLN A;  1R1U A;  2ZSH B;  4B3A A;  4B43 A;  1T33 A;  3VEP A;  2WY7 Q;  3BR0 A;  1Z3X A;  2X1E A;  1JHH A;  2E19 A;  2PMZ N;  2A6E F;  1ZYR F;  1JTX A;  2EJR A;  1QGP A;  3ESW B;  3FM3 A;  3QYF A;  1UJ8 A;  3R0A A;  4AYB N;  5HDK A;  3MMY B;  3KCC A;  3NAU A;  5BPI A;  4KIS A;  4A3C J;  2VC0 A;  5LGN A;  2DK8 A;  3U9G A;  5IOZ A;  1WH5 A;  5BMZ A;  1PDN C;  3WTZ A;  3S3O A;  4LG0 B;  2DU9 A;  3GVA A;  3S14 J;  1PJR A;  4XLN F;  4D5C A;  3WGI A;  5DM6 F;  2CUZ A;  1WH7 A;  3IRR A;  2A68 F;  3WU2 C;  2IPQ X;  2UXX A;  2EIK H;  2H6C A;  3ECH A;  3G1O A;  1YQA A;  3BJO A;  4DYR A;  1JUS A;  3IKT A;  2P5K A;  3KEQ A;  2OAZ A;  3JW4 A;  1ZRC A;  2OU2 A;  2LBF B;  1ETX A;  2E60 A;  4PSW A;  1H8A C;  1LDJ A;  3OR2 C;  3SQN A;  2LF7 A;  2F5F A;  1POG A;  4U87 A;  2M45 A;  3KLO A;  2EH3 A;  4S05 A;  1O57 A;  4ZZL A;  1FY7 A;  3D5L A;  2H09 A;  1FMW A;  2VT3 A;  2KQR A;  3CCQ I;  2EZL A;  2FRH A;  4D7N A;  2CG4 A;  2HQR A;  3DWL E;  3FF5 A;  1W0U A;  3JR9 A;  3QPH A;  1RR8 C;  4KYW A;  1SAU A;  2BHZ A;  3DBR B;  1N78 A;  4FHT A;  2FBI A;  4X0G A;  4BE2 A;  2LD5 A;  1ZR2 A;  4D7M A;  3VOE A;  5J8C A;  1SFU A;  3RZO J;  1IRG A;  1S7O A;  2RN7 A;  2ISZ A;  2E7X A;  2D1H A;  2JWT A;  1FC3 A;  3ZN1 A;  1LEB A;  4Z2Y A;  2BY2 A;  2JA8 J;  1IXR C;  1W5T A;  2CRG A;  2PFB A;  3JSO A;  4JQF A;  3I71 A;  2XGD A;  2HI3 A;  3CO7 C;  4F7Z A;  3I56 I;  4OIO F;  2LRE A;  2BBY A;  2LG4 A;  4OIP F;  4A3J J;  4FE7 A;  2HDD A;  4EJU A;  3S16 J;  5LHI A;  2CFX A;  4CCM A;  2B0L A;  1OR7 A;  2CGP A;  3CCM I;  1B1B A;  2JVH A;  1UHW A;  1R00 A;  3DPL C;  2STW A;  1WJB A;  1YE9 A;  1EH7 A;  2F5C A;  3L2R A;  5KNL A;  2JZY A;  2QKM B;  1TBX A;  4ZC3 A;  2KJC A;  4MIM A;  2N8G A;  1T08 B;  2E1C A;  5DDG A;  2XAG A;  3OYN A;  1TZL A;  1USS A;  1L0O C;  4R1H A;  2ZXH A;  2NRA C;  3W6K B;  3IC7 A;  3Q9V A;  3CCU I;  4GRI A;  1I39 A;  1U78 A;  4ZYA A;  4AM3 A;  2Z16 A;  4L9N A;  4BXX J;  3REO A;  4P9F A;  2DT5 A;  4BE0 A;  1SD4 A;  2ELJ A;  4HDU A;  4IZZ A;  4ZYH A;  2QF7 A;  5BPD A;  1ETK A;  2DA3 A;  2F4O B;  3JCU C;  3Q9S A;  5HS7 A;  3QP5 A;  2IP2 A;  4UV9 A;  1LQ1 A;  2EZH A;  1XDS A;  2GWR A;  3F23 A;  2O3F A;  1QU3 A;  4MQV A;  4XRF A;  1H88 C;  1UST A;  2K9Q A;  1A5J A;  1IZ1 A;  3C2B A;  1KU3 A;  4G7Z F;  3ZMZ A;  2JA5 J;  4RB1 A;  5AIP A;  3DPT A;  4II2 A;  1RNL A;  5EEA A;  1QPM A;  3FDY A;  3RPU D;  4BU2 A;  1ZHF A;  2XRN A;  3LAJ A;  1S9H A;  3HRU A;  3HOV J;  1XTA A;  4FCY A;  2FUG 2;  3L2V A;  1QA6 A;  3OL3 A;  2MGQ A;  4AD9 A;  2EIJ H;  3ASO H;  3K2Z A;  2HZD A;  2VIX A;  1JT0 A;  3QAH A;  1IDZ A;  5LRR A;  1TW2 A;  1LE8 A;  4CHU A;  4EAT A;  3G2B A;  2M8E A;  5JLX A;  3OYK A;  3GW2 A;  3ZGK A;  2CW7 A;  3CME I;  3I5U A;  4Y17 A;  3RYP A;  2OCC H;  3UR3 C;  2GIV A;  4HLY A;  2Y0S N;  2VJ5 A;  2M30 A;  3H9G A;  1R23 A;  1TQI A;  4G8X A;  5GAH J;  4HST A;  4JK1 X;  1XD7 A;  5DD4 A;  1LKX A;  1X1D A;  1MSF C;  1U9O A;  4LB5 A;  3QU6 A;  1AU7 A;  1ZRD A;  2QBY A;  2EK5 A;  3J80 K;  1FIP A;  4LG3 A;  3HTU A;  3M8F A;  2OV7 A;  2LMD A;  3HUG A;  4HPQ A;  5EZG A;  4ZDL A;  4AID A;  4RLF A;  4C9Y A;  2O61 A;  1EH8 A;  1BI0 A;  3KP6 A;  2IW5 A;  3ZN0 A;  1EJ9 A;  3D5R C;  3KET A;  5F1J A;  5D5X B;  2XDV A;  4B44 A;  3HXL A;  1XPX A;  4PCQ A;  4RM3 A;  5C4J J;  2EFP A;  2QSG X;  2A6T A;  2NYX A;  5L3D A;  3N4M A;  5CVV A;  1Z7U A;  5J1R A;  3OY9 A;  1APL C;  4BKX A;  1BIA A;  1XX5 A;  3BLY A;  4C3J J;  3PUB A;  1BW5 A;  3MKL A;  1R1V A;  1B59 A;  3RKQ A;  5TRD A;  4UVC A;  2QM3 A;  1YW8 A;  5CVJ A;  3R61 A;  4ESF A;  2RAE A;  3MN2 A;  4HW0 A;  1U6G A;  1UZC A;  5FFZ A;  2BY3 A;  5DYM A;  2DJN A;  1DUX C;  2IEK A;  3LFU A;  1A04 A;  1CQT A;  1YX5 A;  4BHP A;  3L7W A;  1MZB A;  2VBW A;  1F9N A;  2FML A;  2R4G A;  2CU7 A;  3HDD A;  5DCM A;  4PJJ A;  3ZQH A;  4PFO A;  3WHC A;  4EQQ A;  2R3S A;  1MH4 A;  2KFD A;  3CCY A;  1XS9 A;  1Y56 A;  5L3C A;  1TQP A;  2R93 J;  4O6J A;  5FKN A;  3SYT A;  5IY5 H;  5FKM A;  3CUQ A;  3O3K A;  2WBM A;  2GXG A;  4CDG A;  3JRD A;  2WY8 Q;  4B8X A;  2KRH A;  4IHV A;  4D5F A;  5EG0 A;  2JA6 J;  2QQ9 A;  1S72 I;  3CDL A;  2LH9 A;  2IS6 A;  6PAX A;  2EIM H;  2EV6 A;  3O2P E;  4PJN A;  4A0Y A;  2EFW A;  2Q2E B;  3BC8 A;  3GF2 A;  3RIR A;  2O6G E;  3LSM A;  3IV5 A;  3CCJ I;  2DFE A;  3E7L A;  5GTI C;  3OS0 A;  1NTC A;  4IHS A;  3L1P A;  1FSE A;  3PUF A;  1K61 A;  3RTR A;  1UG2 A;  2FQ4 A;  4GFB A;  1YJW I;  3MAJ A;  3DEW A;  2X0L A;  3BCA A;  4RA2 A;  2IA1 A;  1MDM B;  2M2E A;  2XPU A;  3FXK A;  3V8L A;  4U7B A;  1G2H A;  2BEO A;  2RRE A;  1G3S A;  3GFJ A;  1X3Z B;  3OL4 A;  4NNJ A;  4RLQ A;  5FO5 A;  3JAM K;  3LAP A;  3DV8 A;  5E79 C;  4A93 J;  3GX4 X;  3CC7 I;  1I1G A;  1MMS A;  1BN5 A;  1Z05 A;  4PDK A;  2CMP A;  2GM4 A;  2IS2 A;  1Y39 A;  4M3D A;  4BL0 B;  4MHG A;  3AL0 C;  1G3Y A;  4EGZ A;  3IH4 A;  1FOK A;  2ZNZ A;  1R5I D;  5J3L A;  1YOV B;  4P9U A;  3EET A;  1ON1 A;  3GTQ J;  3I53 A;  1D5V A;  3S1M J;  1PUE E;  2ZB9 A;  1JE8 A;  5KCM A;  4BNC A;  3NEU A;  5ILV A;  5E1Z B;  4JBA A;  3OYC A;  1MW7 A;  3HGY A;  4HA8 A;  4XKW A;  4F3Q A;  2HYJ A;  1V4R A;  3MD2 A;  4LK1 F;  2EZI A;  3OYA A;  3QPL A;  2ELH A;  3WGH A;  3IWZ A;  2G7H A;  3ZMD A;  4WX9 A;  5IT9 K;  4QLC U;  5CLS A;  5GTH C;  1BC8 C;  1S29 A;  4GO1 A;  3CF2 A;  1T38 A;  3HOT A;  1X1A A;  1MGT A;  1WJE A;  3IH2 A;  4ZYG A;  1PP8 F;  3FK6 A;  1RC9 A;  4M9X A;  4DYQ A;  5E3N A;  4KIB A;  3BQY A;  4DNC A;  1RUN A;  1ZR4 A;  4E4H A;  2PG4 A;  1IRF A;  2JUG A;  3O8H A;  2OUM A;  2L02 A;  1GHC A;  2QQA A;  3BJA A;  1RI7 A;  4A3M J;  4L0Z B;  1MJA A;  4PJL A;  3F22 A;  3A03 A;  1VND A;  3NWT A;  1XDU A;  2VI6 A;  2CYY A;  4A12 A;  4IHY A;  2A05 A;  1U0J A;  1E0E A;  1KON A;  2J5P A;  2MC4 A;  1O4X A;  2L54 A;  2IS1 A;  1YLF A;  1OCT C;  4XOT A;  2NVQ J;  4G94 A;  1Z6T A;  5A2Q K;  1GUU A;  2FBK A;  4M6X A;  2LOO A;  2YS9 A;  4ZYD A;  1MBE A;  1W36 C;  4FET A;  2O03 A;  4GXO A;  3Q5F A;  3NQO A;  2X6Y A;  1TNT A;  3SHF A;  4XON A;  3TBI A;  2AO9 A;  2XPW A;  3IHU A;  1S7A A;  4AVZ A;  1GLN A;  2OD5 A;  5K5O A;  1TW3 A;  5HDG A;  4ETS A;  2K40 A;  5KHD A;  4QIW N;  4II3 A;  2OZU A;  2M3A A;  4UHT A;  3S3M A;  2ZJR F;  1W36 D;  2IBD A;  2C6Y A;  5CQE A;  3C2H A;  2ZC2 A;  3JAM Z;  3ZPL A;  1ZGJ A;  2ECC A;  3FHZ A;  4Q47 A;  2DQR A;  4XR6 A;  4MTD A;  3S1R J;  2IS4 A;  2MH2 A;  4N9H A;  2WA0 A;  2Y48 A;  1JUP A;  3VYU B;  2OQG A;  1O3T A;  4A5M A;  3V42 A;  1X2N A;  3HC7 A;  1MMD A;  2VJJ A;  1K78 B;  4PUS A;  1D0Z A;  4MNU A;  2XKO A;  4C2U A;  2ZJQ F;  4EJT A;  3GYH X;  1T98 A;  2HOA A;  1JJ6 C;  2FE3 A;  4MQ9 F;  4Y7N J;  1VI0 A;  3LSG A;  3BQZ A;  4B47 A;  3WU0 A;  3WG7 H;  4RAG A;  3CCL I;  2O0Y A;  5CKT A;  1ZAO A;  2E7W A;  2DOD A;  3DQV C;  4M9S A;  4RGU A;  5HVQ C;  1IAW A;  1QZY A;  2VXZ A;  1OMI A;  3B02 A;  4CCL A;  2F48 A;  5E3M A;  1FWZ A;  3VYS B;  4XRS G;  4IVN A;  2M0M A;  5IT9 Z;  3QPS A;  2Y9Z A;  2P6T A;  3RPU A;  2R7S A;  2ME0 A;  1S8N A;  2NOG A;  2E1M B;  4M6V A;  3HB9 A;  1B72 A;  3K10 A;  2MYS A;  3IAM 2;  1V54 H;  1AOY A;  4A3K J;  2F4M B;  3IP4 B;  5M5Y J;  1FEX A;  1S6L A;  2VQH A;  1U5T C;  5JVT A;  3Q0V A;  4N4O B;  1J7K A;  1J09 A;  2CSO A;  2P0W A;  3CMY A;  4EJW A;  3H9Q A;  4E7I A;  4G6Q A;  3CDI A;  3FXQ A;  3ML6 A;  3OOP A;  5KAI C;  1MKM A;  3DCF A;  1SD5 A;  1SFX A;  2FX0 A;  1OFC X;  3H5R A;  3OYE A;  2J5O A;  3D1N I;  2V1N A;  4CCN A;  3GZN B;  4BGD A;  1ONV A;  2Z99 A;  1RR7 A;  2MAB A;  2DK5 A;  5E20 A;  2UWM A;  2ZME C;  3BTI A;  4I01 A;  4G7H F;  1Z0X A;  2Z3Y A;  5D5W B;  5DUI A;  5D4S A;  4AU7 A;  4DJA A;  2R7W A;  2YSR A;  5E1X A;  1MNE A;  4B3X A;  5LRS A;  1WGX A;  4ANJ A;  3IH3 A;  5A2Q Z;  2OA4 A;  3V7S A;  4LK0 F;  2H27 A;  3BG5 A;  5TJJ A;  1BBY A;  2NVY J;  2PJP A;  3A4C A;  1PYV A;  2AQF A;  3OOU A;  2I10 A;  5HS9 A;  1CGP A;  1F5T A;  4IEJ A;  4XLA A;  1LFB A;  4GCV A;  2O8K A;  1S5L C;  2QEX I;  2HVQ A;  2HKO A;  3BJ6 A;  2X9D A;  4BDY A;  4XLC A;  2A5W A;  5M5X J;  2WB1 N;  4MEX F;  1H9T A;  2K9S A;  1Y6I A;  3ABU A;  2CJJ A;  3JTG A;  1Q1H A;  4DIQ A;  4RGX A;  1WFX A;  1ZEL A;  2OBP A;  4I0B A;  4WXD A;  3K1N A;  1BR2 A;  4CYD A;  3E6B A;  2BW3 B;  3SZT A;  1X4O A;  5TIS C;  3BZC A;  2VBY A;  2NNN A;  1YRN A;  3M07 A;  1LE8 B;  2X4H A;  4WF2 A;  4HNU A;  2H1K A;  3K70 D;  3I9V 2;  3RQI A;  1SAN A;  5B5E C;  3TW6 A;  1S7E A;  3ABT A;  1WJC A;  1EA3 A;  3K6G A;  1ZTR A;  1DPR A;  4QWQ A;  5F0H A;  4FE4 A;  3DPU A;  1OIS A;  3VSK A;  2KRC A;  1VQN I;  2ETH A;  1J59 A;  1V55 H;  2HDW A;  5FRN A;  5JFR A;  2GLO A;  5H2F C;  1IXC A;  4RAF A;  2P8T A;  1Z7L A;  2DDB A;  3HOY J;  4BY7 J;  4LLG F;  5JLW A;  2KRF A;  3TO6 A;  3FMS A;  4MO7 A;  3OYJ A;  4OIQ F;  3RPQ A;  3VB2 A;  3CO6 C;  1U3E M;  5E8G A;  3TOB A;  3DP7 A;  3G73 A;  1Z77 A;  1G59 A;  1ZG5 A;  1TNS A;  4IQJ A;  2KLO A;  4A69 C;  3T1B A;  1ZH5 A;  2B63 J;  3M4O J;  1N75 A;  2EFN A;  3BTL A;  1MH3 A;  1E17 A;  2LDU A;  5ICF A;  1LFP A;  1DP3 A;  1XGS A;  1G8X A;  5CJ9 A;  4IL6 C;  3ERE D;  3RQ4 A;  2XRO A;  1I3Q J;  3M7G A;  3L2W A;  3A01 A;  5JHF A;  2I8D A;  5DUK A;  1KA8 A;  4RB0 A;  4M3G A;  2DTZ A;  4R8H A;  1IN7 A;  1Z6R A;  2IGO A;  3DLL F;  2WAQ N;  4A3F J;  1IN5 A;  3BZK A;  4IJA A;  2XSD C;  5IT3 A;  3PJR A;  2DMN A;  1VQM I;  1HKS A;  2EIL H;  5K7Z A;  4XIC A;  5DCM B;  2R7R A;  1R71 A;  1IUY A;  2DPU A;  1TWG J;  3FXM A;  2PMH A;  1UB9 A;  5LHG A;  1VQK I;  4IHT A;  1UFM A;  2HYF A;  4CZC A;  2VKD A;  4ABZ A;  2VOD A;  2PBI A;  4XN0 A;  1JUM A;  1EH6 A;  2GOM A;  5J4V A;  5M3F J;  1IV8 A;  3ZRG A;  3CUQ B;  2VQG A;  1KYZ A;  1P4W A;  2FD5 A;  2Y0M A;  5HOD A;  5EG0 B;  4A6E A;  1ZRF A;  2K3F A;  3G1M A;  4U7D A;  4L0Y B;  4RB3 C;  3H1C A;  3VYR B;  4E6K G;  1QVT A;  1KQ9 A;  1K4S A;  2EPF A;  4Y15 A;  2PN6 A;  1Y1W J;  1HW5 A;  2CUJ A;  4HRI A;  3B6C A;  3K4C A;  1A31 A;  2QSF X;  3KP7 A;  5FD5 A;  5BS6 A;  2OTL I;  2ADU A;  2IXS A;  3HOZ J;  4A0Z A;  1DDN A;  3FKJ A;  5E17 F;  1WJF A;  2OJE D;  3G4S I;  3RSN A;  4G12 A;  2L01 A;  3CDH A;  5E3L A;  3KZI C;  2HXO A;  3OYL A;  4O3M A;  4ENJ A;  1J9I A;  3L2C A;  2HVR A;  1HDP A;  4BE1 A;  1WJD A;  1QO0 D;  1H0M A;  3ONQ A;  3I4N J;  2KDZ A;  2V1U A;  1WWX A;  2FEZ A;  4I98 B;  4EJV A;  3HZJ A;  2RV8 A;  4KMF A;  2K3P A;  4KNY A;  5K5Q A;  2LTP A;  4IRH A;  3L2U A;  3NAR A;  2R7Z J;  3HSF A;  3ZMU A;  2E1O A;  1VFC A;  4J01 A;  5LFA A;  4MGR A;  4NDL A;  1SMT A;  4A3E J;  3MEX A;  3V8J A;  2L4A A;  1FTT A;  1ERD A;  5LLQ A;  4H0E A;  2NS8 A;  2EWN A;  3I4M J;  1O3R A;  5FRO A;  2L7K A;  3HOS A;  4F55 A;  3SFI A;  5CQG A;  3HG9 A;  4X1E A;  4E7J A;  1V5F A;  2IVM A;  3FIS A;  4D0P A;  2YUS A;  2G9W A;  2E71 A;  2P7V B;  3NWS A;  1S3J A;  3M8E A;  4XKV A;  2VQL A;  5L3B A;  4BBS J;  4BQQ A;  3K9T A;  5D8L B;  3EUK L;  5FFX A;  5KVR A;  2FNP A;  2Y9Y A;  3R4K A;  4DZP A;  3TGN A;  1XC5 A;  2AS5 F;  1KU7 A;  4D1Q A;  2STT A;  1UG0 A;  3L9F A;  3CD6 I;  4MFE A;  1JKQ C;  3VYT B;  3KIO A;  1DGR M;  2HQN A;  5F64 A;  1RKT A;  3DU6 A;  5TGT A;  2W57 A;  3E6C C;  2ZSI B;  1HOM A;  4U0V A;  4IHX A;  1X19 A;  2WAD A;  3ISP A;  1FYM A;  5J1U A;  1YI2 I;  3H92 A;  1JKR C;  4PJM A;  4O5V A;  1CF7 A;  4YIF A;  3TMO A;  4E7H A;  2KP6 A;  5J1Y A;  1WQ2 A;  1MJ9 A;  3ZQC A;  2DA5 A;  2LYC A;  3OIP A;  1J75 A;  3GTG J;  3RKX A;  1HST A;  1OCC H;  5LBQ A;  4UB8 C;  4G6D A;  2V9P A;  4K2E A;  3J7A Y;  3HKZ A;  2EFO A;  5E3O A;  2I5U A;  1R6R A;  2A6H F;  3KP5 A;  3DF8 A;  3MFK A;  1ZGA A;  1MBG A;  4XKB A;  2OC6 A;  1B6A A;  4N4N B;  2ELK A;  3NRV A;  3HOU J;  2QYO A;  2KJB A;  3HOW J;  3PQK A;  1LUJ B;  1R49 A;  2NNY A;  2A07 F;  2CUE A;  3DU5 A;  5LD2 C;  1PP7 U;  4A5N A;  2W25 A;  4Y4R A;  3LQQ A;  1YW7 A;  2DA4 A;  1X3U A;  5GAD J;  5FLX Z;  4M3E A;  2QKL B;  1HSJ A;  3GTM J;  1OKR A;  2VJI A;  2DMT A;  5DS9 A;  2DA2 A;  4YRV A;  4BHB A;  2EBI A;  3KYD B;  3GWZ A;  4W1U A;  2HNH A;  1YIT I;  3EYY A;  2QSH X;  3GTP J;  4OIN F;  1R4M B;  1WVR A;  2V7F A;  3WHB A;  1U5T A;  1AWC A;  3W6V A;  1I3A A;  5GAG J;  4AC0 A;  2WWY A;  1R5G A;  5F27 A;  4HQM A;  1XMX A;  4RS8 A;  3SFZ A;  4NC7 A;  2VL8 A;  1NG6 A;  3OYF A;  3IRQ A;  4E70 A;  4MLO A;  3V7C A;  4OOI A;  4LMY A;  3RJP A;  3VDX A;  2O9L A;  1SD7 A;  3ZMS A;  2ZME A;  2W7N A;  4FX4 A;  2QQ8 A;  3I64 A;  3S3N A;  3TED A;  2BOL A;  5DD8 A;  1SMY F;  1XMK A;  4HNT A;  3E0J B;  3M1C A;  4FT8 A;  5HLH A;  3TP3 A;  5FJ8 J;  4S0H B;  4WXC A;  1OCR H;  3J81 K;  2FBH A;  3RCO A;  2NS7 A;  3JRE A;  3S32 A;  2F5V A;  3HRS A;  1OCO H;  1FOW A;  1ZGW A;  3BZ6 A;  3K4M A;  4XOR A;  1B72 B;  4UVA A;  5DV5 A;  3MKZ A;  1JGG A;  2E1N A;  3F9K A;  2LR8 A;  4Q5S F;  4XL9 A;  5LEK A;  4J19 A;  4BS9 A;  1TC3 C;  3C1D A;  1IO2 A;  4WWC A;  3B73 A;  3GFI A;  2XHK A;  2K9M A;  2PX9 A;  4ZZD A;  5BNG A;  3A0H C;  1DU0 A;  1XB4 A;  4IHW A;  2VQC A;  4DGW B;  1JT6 A;  5D5V B;  1HKT A;  2M87 A;  2WV0 A;  3QRF F;  5ICE A;  1AKH B;  3S17 J;  5FLM J;  3DKY A;  2DQL A;  1SAX A;  2L9S A;  1IXS B;  1JJ8 C;  2HPI A;  3K7A J;  3TW7 A;  2TRT A;  4HOB A;  3SXY A;  5K5R A;  3OS1 A;  1SVM A;  3DEE A;  1OJL A;  1K4T A;  2K85 A;  1T0F C;  1VTN C;  2DFH A;  2VC1 A;  3P7N A;  4I7H A;  4HNV A;  4A3G J;  4D9J A;  5ILS A;  3LWF A;  2DYS H;  1XCV A;  1ZLJ A;  5F08 A;  3DTI A;  3X2Q H;  2K5C A;  1HXD A;  3K0L A;  1X4P A;  2P5V A;  3CES A;  4E7K A;  2HWV A;  2X1C A;  5K7H A;  4X6A J;  1TT0 A;  2O8X A;  2HEO A;  2A69 F;  1TP4 A;  2AHQ A;  2HXI A;  1YW9 A;  4BH9 A;  2LKS A;  4C3I J;  2V79 A;  1ON2 A;  3ZQL A;  4NQW A;  3ASN H;  1TWA J;  4F93 B;  1O3S A;  2M7A A;  3RDI A;  2KIS A;  2L3D A;  3K1P A;  1IW7 F;  2E36 A;  4ZDP A;  4KDP A;  2GA1 A;  3FBI B;  3WTW C;  5D6F A;  3OWT A;  4XK4 A;  3KYC B;  2V1D A;  3F6V A;  4XN3 A;  1OQY A;  2B7E A;  2NVT J;  4CZZ A;  3OYH A;  1KU2 A;  3GXO A;  2Q8K A;  1M1E B;  2M4G A;  3DKX A;  5AON A;  3S1N J;  4ZTJ A;  3D5S C;  3ZQQ A;  2R7D A;  2M0C A;  3GFM A;  3LMM A;  1G3T A;  2EV5 A;  2WAF A;  4JOM A;  4OMY A;  2LC2 A;  3L00 A;  2LKX A;  3EUH C;  3FXO A;  2UZK A;  5JR3 A;  1U9N A;  1XSV A;  4BDZ A;  1XG1 A;  3I59 A;  3WTS C;  3ZMV A;  2E2I J;  3J81 Z;  1K83 J;  2VAS A;  2LY1 A;  2BE5 F;  4M73 A;  4XRS A;  1F36 A;  2GIZ A;  4DOZ A;  1YJ9 I;  1EKE A;  1NG7 A;  4CO8 A;  4BQO A;  1P2F A;  2Q0O A;  5JI6 A;  3CLO A;  4XQF A;  4B1R A;  1LVA A;  2EQR A;  4CH7 A;  5EZH A;  2DDA A;  5EF6 A;  2NOJ B;  2BZT A;  2LF8 A;  1Y0U A;  4NBQ A;  4BEH A;  9ANT A;  3FBN B;  1IRX A;  1QZE A;  3E1S A;  4J00 A;  3OSG A;  1A6Q A;  2ZFW A;  1DU6 A;  1X1C A;  1UCR A;  3S1Q J;  3TDZ C;  2DPD A;  2W4S A;  4P1W A;  1MBJ A;  4HDV A;  1IUF A;  2XGC A;  4RBO A;  2F4I A;  1BJZ A;  2CQN A;  3A01 B;  4L9J A;  2LBF A;  1BI2 A;  1J0R A;  2XKP A;  4UUV A;  4ZJZ A;  2ID6 A;  2NXN B;  2DA7 A;  2VKV A;  3BWG A;  2QWW A;  1XSX A;  1IC8 A;  1GT0 C;  2JRM A;  1FT9 A;  4FTH A;  3LSJ A;  2VOP A;  4EM0 B;  3ABK H;  2BY0 A;  5FRM A; 
#chains in the Genus database with same CATH homology
 4C30 A;  4ANJ A;  2R7Q A;  3LSK A;  1PJR A;  2DOA A;  2CUZ A;  3OYB A;  1OLT A;  1PYV A;  3A4C A;  2AQF A;  2KL4 A;  3OOU A;  4CA0 A;  4XLA A;  4XNF A;  2DCE A;  2HVQ A;  4BDY A;  4XLC A;  2A5W A;  5CPR B;  3AL0 B;  2LRD A;  3W2V A;  2LBF B;  2L5Q A;  2E60 A;  1Y6I A;  4PSW A;  2VLA A;  1WJA A;  3OR2 C;  4DIQ A;  3CP8 A;  4U87 A;  1WFX A;  1ZEL A;  1YX3 A;  3S93 A;  3OYG A;  2XSJ C;  1BR2 A;  4QPO A;  3D5L A;  2BW3 B;  1FMW A;  1X4O A;  2KQR A;  1SFK A;  2MD0 A;  3DWL E;  1N77 A;  4ITV A;  2XF6 A;  3W3C A;  1SAU A;  4HNU A;  4F91 B;  4E7S A;  1N78 A;  4CUG A;  3K70 D;  2V4J C;  3I9V 2;  4X0G A;  4BE2 A;  3K4L A;  1WJC A;  1EA3 A;  3K6G A;  3CMM A;  2ZXI A;  3DPU A;  3K4N A;  3VSK A;  2KRC A;  3CJR B;  3VWB A;  2BVM A;  4Y3O A;  1D0X A;  3SZG A;  2HDW A;  5FRN A;  3IAS 2;  4JQF A;  2X1D A;  1Z7L A;  4CCJ A;  2LRE A;  3EPZ A;  1Z21 A;  2W00 A;  2LG4 A;  2M7B A;  3OYJ A;  2V6E A;  3KEY A;  3SEQ A;  3SEZ A;  4CCM A;  4PFP A;  2JVH A;  1G59 A;  3DPL C;  1WJB A;  1YE9 A;  4IQJ A;  3L2R A;  5KNL A;  2KLO A;  2XAU A;  2QKM B;  4PK4 A;  1N75 A;  1MMN A;  4ZC3 A;  2E1M C;  1DP3 A;  1LFP A;  4E7Z A;  1G8X A;  3OYN A;  1TZL A;  3RQ4 A;  2ZXH A;  2DXI A;  2MFZ A;  3L2W A;  5JHF A;  2I8D A;  4GRI A;  4ZYA A;  2Z16 A;  2IGO A;  1BR1 A;  3H9J A;  3AFH A;  2IGM A;  3KX2 A;  3PNT A;  4BE0 A;  3IUO A;  3PJR A;  2E5N A;  2ELJ A;  4R79 A;  3OR1 C;  4IZZ A;  2R7R A;  3LL7 A;  4BJT A;  3I3L A;  2HVS A;  4CZC A;  2F6C A;  2VKD A;  4DBR A;  1D1B A;  1MND A;  4XN0 A;  2GOM A;  2HU9 A;  3ZRG A;  2Q1Z B;  3BG7 A;  2VQG A;  1QU3 A;  3ZCO A;  4HSR A;  4CSW A;  3N05 A;  2R7V A;  3LSI A;  3PSF A;  1BR4 A;  3DTE A;  3DPT A;  4II2 A;  3VYR B;  3FDY A;  4E6K G;  3RPU D;  4BU2 A;  3C2G A;  1S9H A;  4HRI A;  2CUJ A;  3K4C A;  2FUG 2;  3L2V A;  3OL3 A;  3SDB A;  2IXS A;  2HPM A;  2HZD A;  4Y33 A;  4ZDO A;  4B3X A;  2VJ4 A;  2VIX A;  3FKJ A;  1WJF A;  3RSN A;  4YEL A;  4EAT A;  3OYL A;  3G2B A;  3OYK A;  3ZGK A;  2HVR A;  2CW7 A;  4BE1 A;  1WJD A;  3UR3 C;  3ONQ A;  2RQQ A;  2VJ5 A;  2LY2 A;  4B48 A;  3H9G A;  4F52 A;  1D0Y A;  4HST A;  2K3P A;  4BXF A;  1LKX A;  1X1D A;  2CFO A;  2R7O A;  3L2U A;  4LG3 A;  1T95 A;  4J01 A;  3UNG C;  5LFA A;  2DT6 A;  2OV7 A;  3HPG A;  1ERD A;  4HPQ A;  4ZDL A;  3QOD A;  4RLF A;  4C9Y A;  4XM3 A;  4BAC A;  4H4K C;  3H35 A;  2CW8 A;  5FRO A;  4LIV A;  3D5R C;  2L7K A;  3HOS A;  4NC8 A;  4F55 A;  2KHM A;  3MKY B;  2VPL A;  2XDV A;  3HG9 A;  5CQG A;  3HXL A;  1V5F A;  3U21 A;  4B44 A;  4E7J A;  3OYI A;  4RM3 A;  3H0D A;  2L9N A;  2A6T A;  4RMN A;  1Z3Y A;  2X51 A;  3NWS A;  3OY9 A;  3KYL A;  4XKV A;  2VQL A;  4BQQ A;  3BLY A;  3H5A A;  3EUK L;  3PUB A;  4FAS D;  2PJR B;  4OWR B;  2JSP A;  3PSI A;  4D1Q A;  1UG0 A;  4XLF A;  3VYT B;  1DGR M;  3HUG B;  3LFU A;  2JVG A;  3DU6 A;  5TGT A;  1YX5 A;  2ZSI B;  1D1C A;  1X19 A;  2WAD A;  2R4G A;  3W2W A;  4PJJ A;  4PFO A;  1LDK B;  3TL4 X;  4NUB A;  4PJM A;  4LIT A;  2HQA A;  3TMO A;  3ZR8 X;  4E7H A;  1Y56 A;  2KP6 A;  3SYT A;  3HPH A;  1K6Y A;  2LYC A;  3OIP A;  1OR7 C;  2WBM A;  2RNG A;  2WY8 Q;  2KRH A;  4AYB A;  2CS3 A;  3J7A Y;  3CP2 A;  2DT7 B;  3HKZ A;  1R6R A;  4XKB A;  2OC6 A;  2LH9 A;  4N4N B;  2VB6 A;  2IS6 A;  1LVK A;  2IGK A;  4PJN A;  2WAE A;  2Q2E B;  3DU5 A;  3PFY A;  4ZTF A;  3BC8 A;  2UUZ A;  5LD2 C;  4Y4R A;  3GBG A;  3LSM A;  3OS0 A;  2CH0 A;  3MKW B;  2QKL B;  4XMY A;  3BCB A;  2VJI A;  3L2Q A;  3RTR A;  1V5G A;  4YRV A;  3BCA A;  1UEL B;  3OIQ A;  2KMU A;  4U7B A;  2HNH A;  2RRE A;  4RLQ A;  3OL4 A;  4NNJ A;  4BQN A;  2WB1 A;  2V7F A;  4F92 B;  4BUP A;  2CV1 A;  3QOE A;  4XOP A;  2CMP A;  1V5E A;  3PL8 A;  2IS2 A;  2V26 A;  4NC7 A;  2VL8 A;  1NG6 A;  4BL0 B;  3OYF A;  3PNY A;  3ZXS A;  1BOB A;  5HNF A;  3AL0 C;  4MLO A;  2V9K A;  2IGN A;  3VDX A;  2VXD A;  3H5N A;  4XLH A;  5KCM A;  2W7N A;  3S3N A;  1P9Q C;  2BOL A;  3OYC A;  1MW7 A;  4HNT A;  4XKW A;  3E0J B;  3M1C A;  4F3Q A;  4LIU A;  3MD2 A;  3PNV A;  4QPQ A;  3RCO A;  3OYA A;  3S32 A;  2F5V A;  1X1B A;  3K4M A;  4XOR A;  2PJR A;  4OAY A;  3MKZ A;  3F9K A;  4BEH B;  4XL9 A;  3CF2 A;  4BS9 A;  3AKZ A;  3HOT A;  1X1A A;  4KIT B;  1WJE A;  3A1Y A;  4PSX A;  1QHH D;  2K9M A;  1UAA A;  2ZFU A;  4HG2 A;  3HL2 A;  2K9L A;  2VQC A;  4DGW B;  3DTK A;  4E4H A;  2JUG A;  4CCO A;  2OUM A;  4IQ4 A;  4P5O A;  3DKY A;  2L9S A;  4PJL A;  2Z1D A;  2HPI A;  1DQU A;  3NWT A;  4OAZ A;  3K70 C;  1U0J A;  3OS1 A;  1E0E A;  2KPM A;  1KON A;  2UV1 A;  3DEE A;  2MC4 A;  1T0F C;  4HEA 2;  2IS1 A;  4D9J A;  4DBQ A;  3M8J A;  2GOX B;  3EUA A;  4XOT A;  2W82 A;  3VSL A;  2CV0 A;  3DTI A;  2X6W A;  2LOO A;  2K5C A;  2VKH A;  2WAQ A;  1VZ0 A;  1W36 C;  1X4P A;  4FET A;  1DGW Y;  2X6X A;  2BVL A;  2R7U A;  2X6Y A;  3CES A;  3OYM A;  4XON A;  3TBI A;  2W1O A;  4E7K A;  2X1C A;  1TT0 A;  4YEJ A;  1FMV A;  1GLN A;  4AVZ A;  4KJZ A;  5KHD A;  1HA8 A;  4II3 A;  1QHG A;  4RM2 A;  2M3A A;  4F93 B;  2AQE A;  3S3M A;  2M7A A;  1W36 D;  2L2O A;  3S8P A;  3OMY A;  5CQE A;  4ZDP A;  3C2H A;  3FBI B;  3LSH A;  2PMZ A;  3OS2 A;  1WJ5 A;  3OWT A;  4XR6 A;  2IS4 A;  4E7L A;  5HOO A;  2WA0 A;  4XN3 A;  4XLE A;  2KZV A;  2CV2 A;  3VYU B;  2R7X A;  3V42 A;  3OYH A;  3HC7 A;  1MMD A;  1D1A A;  2VJJ A;  2M4G A;  4PUS A;  1D0Z A;  3DKX A;  4IKF A;  4CCK A;  2JA2 A;  3D5S C;  2XF7 A;  3ZQQ A;  4BJ5 C;  4IX7 A;  4ZTJ A;  3LMM A;  2E5Z A;  4C2U A;  2XF5 A;  2R7T A;  2XC7 A;  4XKC A;  2WAF A;  3DLA A;  4JOM A;  2LC2 A;  2M4K A;  3BG6 A;  3EUH C;  3LSG A;  4C2T A;  3FHN A;  2Z2S B;  4B47 A;  3A2K A;  4NQW B;  1JI8 A;  4BDZ A;  3K4B A;  5CKT A;  3QYB A;  3DQV C;  2KDO A;  2VAS A;  4BJ6 C;  2DJI A;  2LY1 A;  5HVQ C;  1MMA A;  5HLT A;  2VXZ A;  2Y0S A;  4CCL A;  5HNH A;  4DOZ A;  1NG7 A;  3VYS B;  4BQO A;  2M0M A;  1AA7 A;  3K4J A;  4XQF A;  2R7S A;  2E1M B;  4CH7 A;  2NOJ B;  3K4K A;  3K10 A;  3W2A A;  2MYS A;  3IAM 2;  4BEH A;  2O5R A;  3IP4 B;  3S3O A;  3FBN B;  2VQH A;  2ZSH B;  1IRX A;  3E1S A;  4B43 A;  4J00 A;  4N4O B;  2WY7 Q;  1J09 A;  2P0W A;  1X1C A;  1Z3X A;  4G6T B;  2X1E A;  3H9Q A;  3OYD A;  4E7I A;  2W4S A;  3QYF A;  4P1W A;  3H5R A;  2F4I A;  4KT6 A;  3OYE A;  2LBF A;  2V1N A;  4CCN A;  3CJQ B;  4BGD A;  4ZJZ A;  2MAB A;  3MMY B;  4KIS A;  2UWM A;  4AU7 A;  4DJA A;  2R7W A;  1MMG A;  3QYE A;  1MNE A;  2X85 A;  2BW3 A;  5FRM A;  3CZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...