1ETYA

The crystal structure of e. coli wild-type fis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
74
Chain Sequence
VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etyA00
2JA8J 3G1MA 1R9TJ 2B63J 3H0GJ 1XS9A 2R92J 3GTKJ 4M3DA 2DN0A 1B8IA 2LD5A 5EGOA 1OCPA 3BR3A 1ZGWA 2L9RA 4FE7A 2NS8A 3BT9A 1B72B 1W0TA 3A02A 1SFOJ 5F04A 4Y52J 2R5ZA 1WI3A 1HCRA 3GTOJ 5FKLA 1ETXA 1XG1A 3B6AA 2XPVA 5IP9J 5IOYA 2CQXA 5J1UA 3OSFA 3HOVJ 3LSJA 3JRCA 5IPAA 3ZQGA 1IV6A 3HB9A 1D5YA 2JK3A 3GTQJ 3FK6A 2KDZA 1RETA 1ETKA 1F36A 2ME6A 4RBOA 3HEFA 2EZLA 2LP0A 4M3BA 1MH3A 5C3EJ 4J19A 2DA2A 3CMYA 1WCMJ 1X2NA 3HGGA 1NK2P 4IEJA 2R5YA 1JTXA 1WH7A 1JT6A 3GTGJ 5GP9A 1PUFB 2WB1N 1AKHA 1I50J 3MVPA 1JKPC 3CCYA 1IRZA 3F0CA 3S1MJ 2O7OA 2XRLA 1VF9A 3G1LA 4DW6A 3JRDA 1GV2A 3CDLA 2G0EA 3S1QJ 3BR2A 5F27A 2Y2ZA 1T33A 4DYCA 2MW8A 2QCOA 3O8GA 2O9LA 2NVTJ 4X1EA 1Y1WJ 1JUMA 1G2HA 1ORKA 4A3BJ 2VUMJ 1ETYA 2RAEA 2DMNA 3CQZJ 1LFUP 2ZB9A 1JKOC 5JLWA 3RZOJ 5C44J 5DS9A 1YRNB 4XK4A 2HI3A 3BR0A 5M5WJ 3PM1A 3G1OA 1OCTC 1X2MA 3K2AA 1X58A 4FTHA 2Y9ZA 3O8HA 3FKIJ 2ECBA 2O8KA 1JKQC 2E19A 2Y0SN 3S1RJ 4A3JJ 1IC8A 1BA5A 2AO9A 2GBYA 1UMQA 5IP6A 3RKQA 3IV5A 3GBGA 3WHBA 4I76A 4W97A 1ITYA 3OIOA 3BR5A 2HXOA 1HF0A 2XGDA 3JRBA 4C3IJ 3C2BA 2Y30A 4MIMA 5HODA 2OPTA 2GM4A 2NVXJ 2HOSA 1MNMC 4X6AJ 2ELKA 3SFIA 3TP3A 2L7FP 1QRYA 3S15J 3DCFA 2YU9J 4NDLA 2DMPA 2M9HA 1ETVA 1ETOA 1GUUA 1IGNA 5C4JJ 4A3GJ 3BG9A 5F0FA 5DTDA 1S7EA 4BKXA 4M3EA 4CYCB 3S17J 1WPKA 3GTMJ 1B72A 2CRGA 4C2MJ 1MBGA 2MGQA 2X48A 4QIWN 4JX6A 2LR8A 2NOGA 4ABZA 1MBKA 4BY7J 2DA7A 1MBJA 1ENHA 4B4CA 5K7ZA 1GVDA 3HOUJ 2Y31A 2JA5J 5FLVA 1FIAA 1GV5A 3TW6A 9ANTA 3K7AJ 1JJ8C 2LKXA 4IHXA 2DA4A 1VI0A 3LSRA 2FJ1A 5EYRA 4GFBA 3JRIA 1PUFA 4M6VA 3ZOBA 3VPRA 5K7FA 5JLXA 4UUTA 1JKRC 2R93J 5M5XJ 4AC0A 4XIDA 1K61A 1JT0A 3BQYA 1NTCA 3IH3A 1K83J 3PO2J 3IH4A 4XICA 1ZK8A 4B3AA 4LOCA 4FCYA 2NS7A 3H3VK 2EQRA 2WAQN 3RZDJ 3ZQIA 3HKZN 3TEDA 3BR6A 5IP7J 3BR1A 2XPWA 1AHDP 1QPIA 1HLVA 2R7ZJ 1I3QJ 1YRNA 2XB0X 2JA6J 2XGCA 3JRHA 3JRFA 1MSEC 1TWHJ 3M4OJ 3IH2A 3FIWA 4W1UA 4DYRA 3QQAA 4MLOA 4M3GA 2EBIA 4A3FJ 2EH3A 2LFBA 3E7LA 4S0HB 5EZHA 5F08A 5IYCJ 3A01B 3HOZJ 2R0QC 1HDDC 2H1KA 3JREA 3BTIA 4A3KJ 2HXIA 2X6OA 2HYJA 3A03A 5K7HA 1IJWC 1IDYA 1JGGA 4XRSA 1FJLA 1H88C 2IAIA 2FX0A 1DU0A 2X9DA 5IYBJ 1JUSA 5FKOA 1MSFC 4JP0A 1FTZA 4V2FA 1DU6A 3LSPA 2CUEA 4A3CJ 4FISA 3D1NI 1ZQ3P 1TC3C 3GTPJ 1VNDA 2HDDA 4M3FA 5J3LA 3S2HJ 5FLMJ 5EZGA 2M2EA 3ZQLA 2JMWA 4MFDA 2E2HJ 4D5FA 4CYCA 2DMQA 4XRMA 1BL0A 5J1YA 5M3MJ 2XPUA 3HM5A 5E3LA 3FK7A 2TRTA 1I6HJ 5F1JA 1MBEA 1GDTA 3Q3SA 3L1PA 2MSYA 1ZR2A 3RQIA 1TWGJ 1QVTA 1IG7A 2L7ZA 2LTPA 2OF7A 1U9NA 5EG0B 1JTYA 3I4NJ 4UUSB 1T56A 3DEWA 1O4XA 3HDDA 5FKMA 1IDZA 2IBDA 1Z77A 3S1NJ 3ZQFA 4G12A 1P7IA 4D7NA 4DZJA 2VI6A 1WGXA 2JA7J 1APLC 3LOCA 3BTJA 3W6VA 3FISA 3BG5A 1BW6A 4EEFG 1AU7A 2DA1A 1BJZA 1MH4A 2M34A 2CUFA 2ME0A 5FKNA 5EEAA 5E3MA 2HOAA 1POGA 3NARA 4A3EJ 1ETWA 2VKEA 2DA3A 4C3HJ 2Y9YA 2E1OA 2P81A 5E3NA 4C3JJ 1HDPA 3ZQCA 4IHWA 4A3DJ 3JR9A 2CU7A 5FJ8J 3ZQHA 4Y7NJ 1GT0C 1FEXA 3LSGA 1TWFJ 2I10A 3JRGA 5GPAA 1MBHA 1RPWA 3JRAA 2K40A 2JJ7A 3HBLA 3GTLJ 2ID6A 4JYKA 1U9OA 2VKVA 4QTRA 1LE8B 1WH5A 3M3YJ 1SANA 1RESA 2TCTA 2K9QA 2AHQA 2JN6A 1F43A 1B8IB 3S14J 5EGOB 2XB5A 5M3FJ 5C4XJ 4B1RA 2K9SA 2DTZA 3A01A 4AYBN 3OOUA 3WHCA 1BW5A 3NAUA 2NVQJ 3I4MJ 3QPSA 3BTCA 5BNGA 2R5ZB 1FIPA 2ECCA 3TW7A 1ZTRA 2FD5A 1U78A 2LLKA 2M8GX 1RKWA 1Z0XA 4RDUA 2YS9A 2N8GA 4D7MA 4A3MJ 4QSHA 3S16J 2CQQA 4FE4A 4XRSG 2QF7A 2D5VA 3Q0VA 2DMTA 2NVYJ 1QVUA 2W48A 4MFEA 2XSDC 1VFCA 2L0KA 4I6ZA 5IYDJ 4DZPA 4BY1J 2E2IJ 2PMZN 4MO7A 4HNVA 2R5YB 2HOTA 3B6CA 1NK3P 2M0CA 1Q1VA 3OSGA 5FKKA 1AKHB 1EF4A 2DJNA 1E3OC 2EZIA 1JUPA 2JWTA 1ETQA 2H8RA 1FTTA 2MG4A 4A69C 1JJ6C 1U8BA 2VPRA 2K9NA 4D5CA 4IHYA 1OFCX 4JX5A 5F0CA 2ID3A 1ZR4A 3BQZA 1TWAJ 2HQ5A 1CQTA 2LVSA 3HOWJ 1W0UA 5EF6A 4A3IJ 2WV1A 2DMUA 3MN2A 5EG0A 5E3OA 1P7JA 1RR7A 2IEKA 4UUSA 3HOXJ 3HOYJ 3S2DJ 1RKTA 4BBRJ 2FQ4A 5J1RA 2DA5A 3Q0WA 1UHSA 3TP0A 5EDNA 5M5YJ 4AUXA 2EZHA 1H89C 2COBA 3BG3A 1IUFA 4L5EA 3GTJJ 4A3LJ 2KT0A 2CJJA 3LNQA 1H8AC 4JX4A 4A93J 5GPCA 1TWCJ 1UG2A 1LFBA 1ZKGA 3UKGA 3BTLA 1MBFA 2EZKA 1OJLA 2L7MP 2LK2A 3QPLA 4DYQA 2LY9A 3MKLA 2XGEA 1A6IA 1HOMA 4BBSJ 2DA6A 3SJMA 3SDGA 1XC5A 2E2JJ 3HGYA 4BXXJ 3Q0UA 2GLOA 3PO3J 4V2GA 5IOZA 5F0HA 4IHVA 1Y1VJ 1LE8A 1A5JA 2YUSA
chains in the Genus database with same CATH superfamily
1MMAA 3CMMA 2B63J 2R92J 4P9UA 2RDPA 2OU2A 3LMMA 2LD5A 1VQOI 1JXSA 2COMA 3KP2A 4DBQA 1H0MA 2E60A 2EWNA 4BE0A 2A3SA 1H9TA 1D0XA 2BW3A 2W25A 1L0OC 1FSEA 4A12A 1SFOJ 1P6RA 1WI3A 4PJ0C 3WTYC 3GTOJ 2HGCA 2H1LA 1XG1A 1SD4A 5IP9J 2JPBA 5IOYA 2DTRA 4GYGA 1D5VA 5J1UA 4EM0B 5IPAA 1IV6A 3HB9A 3OOPA 2JK3A 4EV0A 2IGMA 5GTHC 3GTQJ 2BW3B 4FX0A 2VT2A 3E6BA 1W5TA 1ETKA 1ZYRF 4RBOA 3WE3A 4ZTJA 1K7AA 3SZGA 3CMYA 1WCMJ 1X2NA 2HZTA 1JTXA 3JTHA 3J81K 2BHZA 2ZO4A 3GTGJ 1A6QA 1UFMA 1PUFB 2RNJA 2KRCA 2O0YA 5FFXA 2HS5A 4XLAA 3S93A 2LC2A 3GYHX 1AKHA 1E17A 1JKPC 1T6SA 2O7OA 2BVLA 2DFEA 1Z7UA 2E7XA 2MD5A 2R7QA 3KEOA 1T39A 4LG0B 2WB1A 5CJ9A 3HIFA 2MD0A 2MW8A 2QCOA 4X1EA 4MGRA 1JUMA 2CYYA 1G3TA 2EINH 2DPUA 1ETYA 3W6KB 3F23A 2NAZA 4XNFA 3R4KA 1S9HA 2PMZA 2DMNA 3OV8A 5CKTA 2QLZA 4N4OB 5JLWA 4CCLA 4KT5C 1HBXG 4EGYA 4RB0A 2IS4A 5M5WJ 1XPXA 5DCMB 4EJVA 3OL3A 5DM6F 3K2AA 2V6CA 1W1WE 1X58A 4FTHA 2UXXA 1KU7A 3FKIJ 2ECBA 3F6VA 1KU9A 2O8KA 3FBNB 1VQ9I 2VKHA 3H3UA 2OJED 3PIPF 3S1RJ 2PJRB 3K0LA 1K78A 2AO9A 3LQRA 5IP6A 4OU0A 1ZELA 2FBKA 4W97A 3U1DA 3DPLC 4F93B 3OIOA 3BR5A 3L09A 3GEZA 3DTIA 3SQNA 2NS0A 4B09A 1XTAA 2E7WA 2LSOA 4BQNA 4D9JA 4I0BA 2M4GA 1MNDA 2NVXJ 2V7FA 3CDIA 5FRMA 4LIVA 4X6AJ 2ELKA 3OR1C 3SEQA 4IPAA 2Z2SB 4MQVA 4YEJA 2L7FP 3F8BA 4U0WA 3WU0A 1B9MA 5KAFC 3G6EI 1PDNC 4CUGA 3DCFA 3A0HC 3ZPLA 4XOTA 2ICWG 2DMPA 1PP8F 1C0WA 2O61A 4U7BA 5DCFA 1MD0A 1GUUA 1IGNA 3T8TA 3BG9A 1IF1A 1LNWA 3I4PA 4JBAA 3TDUC 3VYTB 5J8FA 1K4SA 1FYLA 2DDBA 2XVCA 3WTVC 1B72A 2CRGA 1A04A 2Q0OA 2LY2A 1KU3A 3IL2A 2CFOA 3WGGA 2LR8A 2NOGA 4ZC3A 3RCOA 1VQNI 1MBJA 2GAUA 1PVEA 3HOUJ 2FRHA 2LDUA 2QM3A 5FLVA 4R8HA 1GV5A 2M1BA 4R1HA 4KFCA 9ANTA 3UR3C 2PEXA 1ZLJA 1G4DA 2CGPA 2K3PA 4AIHA 2WAFA 1LKXA 3LSIA 4ZDPA 3QRFF 4XL9A 4ENKA 3CD6I 2V79A 3LSRA 2L01A 1PYVA 4PK4A 2R3SA 5EYRA 4A2UA 1VQ7I 1R1VA 3ZMSA 5JLXA 4U7DA 1VQLI 2DODA 1JT0A 3BQYA 4S04A 2Q2EB 4Y15A 2XAQA 2ZXWH 2Z99A 2IA0A 1J59A 1FYKA 2QSHX 3BR1A 3N97A 2XPWA 1R22A 1YI2I 2OQGA 1AHDP 1HLVA 3GFMA 3VSLA 2H6CA 3CCQI 4HF1A 1YRNA 4RLFA 3W6JB 3HKZA 2XGCA 4EJTA 3JRHA 3JRFA 2FSWA 3FIWA 3IH2A 2A07F 1PJRA 5IT3A 5HS9A 4M3GA 2OZUA 2EBIA 4S0HB 4O3MA 1XGOA 2H1KA 2LYCA 4D1QA 4CA0A 4II3A 1U5TB 1N77A 3BTIA 2ISZA 2HXIA 2PI0A 2HYJA 2HWVA 3H1CA 4CCJA 2VOOA 1YYVA 3DU6A 3QP6A 1IJWC 3K4NA 1IDYA 1OR7C 2BY1A 4CCMA 5ED4A 2QGUA 4XOPA 3DKYA 5J4VA 2PN6A 4G94A 1HQCA 2IAIA 2OZ6A 4XLNF 3MKZA 1IV8A 2X9DA 3IP4B 5IYBJ 2ZJQF 4XSXF 1RUNA 1HA8A 4HSRA 1I1GA 4V2FA 1BM9A 3LSPA 2V9VA 1LEBA 1IZ1A 3ASNH 2ZNYA 3N05A 4GXOA 1V5FA 1R5GA 3ONQA 2OC6A 1ZN2A 2VASA 3GFJA 3L7WA 1DGWY 1BC8C 3LA7A 4IF4A 5J3LA 3J80Z 2KZGA 1OYYA 3H0DA 2F4IA 1G59A 5CVJA 4OIRF 3E6MA 3FBIB 2CWEA 4A5MA 2CQKA 4L9NA 3PSFA 5E18F 1I6HJ 1S5LC 2Z9OA 5GAHJ 1TNSA 5AIQA 1WWXA 2M5WA 3L1PA 2P7CB 3RQIA 3CP2A 2HDCA 1QVTA 3KPHA 3TMOA 2FUG2 2OF7A 5H6QA 1U9NA 1I6XA 5L3BA 3I4NJ 3MZ8A 2B9SA 1XSVA 2L3DA 5FKMA 5FO5A 4NC8A 4IQ4A 1W5SA 2DFHA 4DZJA 2VI6A 3AAFA 3E3VA 1GXPA 3OYMA 2JA7J 3ZN0A 2WWYA 3LAJA 2OV7A 3LOCA 1RUOA 3D5LA 3BTJA 1W5CC 1MW7A 2G7UA 1BW6A 4EEFG 3GFLA 2M34A 2ME0A 2XC7A 2HOAA 2DOFA 4KN7X 4A6DA 1YX3A 1SVMA 4C3HJ 5B66C 1Y6IA 3MQ0A 2CQNA 4XMYA 5E3NA 2E71A 3ZQCA 4A3DJ 1O3TA 3KP4A 3NWSA 1FY7A 3ELKA 5HNFA 4LG3A 1Z21A 5E20A 3WTTC 4C9YA 4N4NB 5LHHA 3C2GA 3CLOA 1PUEE 1B59A 1IN7A 4Z6YA 3W2AA 1MBHA 4BQAA 5J40A 3K4MA 3ZGKA 1U9OA 4QTRA 1LE8B 3M3YJ 1RI7A 1EH6A 4HRIA 3FZVA 2VL8A 3GZNB 4UV8A 2JN6A 3N4MA 5J6XA 3AKZA 2DDAA 5ILUA 2EFNA 1OKRA 3G3ZA 2XB5A 4HF0A 3PUFA 4P1WA 1BI1A 4RA2A 4RAZA 1T38A 5C4XJ 3A01A 3V8KA 5HNHA 3LSHA 1BW5A 1WJCA 4NQWB 3NAUA 3I4MJ 2JUGA 2A6TA 3QPSA 2CMPA 2UUZA 5IT9K 1MNEA 4UVCA 2V1NA 2IGNA 4AYBA 1Z0XA 2KFDA 2YS9A 2N8GA 1GVJA 2Z5UA 3C2HA 3ZN1A 2D5VA 3LSTA 2DMTA 2DO7A 4PSWA 1JI8A 1QVUA 2W48A 1QZYA 3CCSI 1T08B 5F64A 2L0KA 3T1BA 2HQNA 4DZPA 1LPQA 4HNVA 2X85A 2VE9A 2HOTA 5FRNA 1IXSB 1YFHA 2WC2A 3O6BB 1TQPA 1P92A 1A36A 1MZBA 2X0LA 5IT9Z 5LGUA 4P55A 2JWTA 3FKJA 5CVUA 2H8RA 4A0XA 1IXCA 1WHUA 2BZTA 2MG4A 1JJ6C 4HPQA 2VPRA 1EH8A 1OFCX 4JX5A 5F0CA 3SYTA 3KYLA 1DPRA 2L02A 3P7NA 2ZFUA 2LVSA 1CQTA 2FXAA 1KA8A 4A3IJ 2WV1A 5E3OA 4XLPF 1Y8QB 2ZKZA 4CYDA 3ABUA 3QYBA 2Q1ZB 2OCCH 3MD2A 4MQ9F 2HR3A 2EIKH 4KNYA 4WXHA 1QZZA 2HYFA 3BZCA 4G6TB 2XKPA 1IN4A 1O7LA 3TP0A 2X6WA 4S05A 2W7NA 3M8FA 1KONA 3IKVA 1BI3A 2EZHA 2XKOA 3FXRA 3IUOA 2COBA 3HSFA 4L5EA 3ZMTA 4HDUA 1H8AC 1T8IA 3PJRA 1LVKA 1TWCJ 1SFKA 2K85A 5GPCA 5LRSA 5JHUA 3S2WA 1ZKGA 1YS6A 4AU7A 3UKGA 2IT0A 4DJAA 5CVRA 1MBFA 3RKYA 4XORA 3QPLA 3KEQA 4DYQA 3F22A 4BAYA 1S29A 2MABA 2IW5A 4JQFA 2QEXI 2XGEA 3NWTA 1KZHA 2DA6A 4EJUA 2R7FA 3FF5A 1WZ2A 3SDGA 1XC5A 4HSTA 1XMXA 2CSOA 3WG9A 5IOZA 1NH3A 1N78A 1Y1VJ 2LBFB 5HOOA 3O2PE 3VOEA 3GTKJ 5E8IA 2KRHA 1B8IA 2JTVA 3KZZA 1LDJA 3ABLH 3BR3A 3V7CA 4CCOA 1O57A 4FE7A 3KETA 1AOYA 2EFPA 2XGXA 3BZKA 5LGTA 1ZG1A 2K86A 1HW2A 1W0TA 3A02A 2GXAA 3F72A 3F9KA 4Y52J 2R5ZA 3DP7A 5D8KB 2NXNB 2WADA 5FKLA 1P2FA 1I27A 2DQLA 2CQXA 4NB5A 3SZPA 3V4GA 2HU9A 1P4AA 3L9FA 3I55I 3JRCA 3PUBA 3Q5FA 5HLGA 3KP3A 2HQAA 4LK0F 3CJRB 4KJZA 4LJZF 3QODA 3AL0C 5JHFA 2LP0A 4ASNA 1MH3A 5C3EJ 2CO5A 2GXGA 2IA2A 4RGRA 2KPMA 3KP6A 1LQ1A 4IEJA 2FMYA 4CH7A 2KKOA 4YFNF 3G73A 3K4LA 5E1WA 2E34A 2R7DA 2R7UA 4QPOA 3I56I 1I50J 1YW7A 3MVPA 5GAGJ 1IRZA 2FE3A 2L2OA 4XSZF 1VF9A 3G1LA 3T5XA 3HOTA 3IC7A 2KMUA 3FHNA 3OYJA 4KIFA 3JRDA 1GV2A 2G0EA 3S1QJ 1SD5A 5HLHA 2STWA 4FT8A 2VT3A 4CZCA 3JSPA 2DJIA 2GIVA 1J0RA 2BGCA 2VN2A 1TBXA 1G2HA 1ORKA 3PFIA 3R6SA 3ULQB 1TQMA 4BEHB 2RAEA 3WTZA 2DT5A 4LD5A 2F2EA 2ZB9A 2CV0A 2ADUA 2XUBA 5C44J 3MZHA 4C30A 3CO7C 4ZH4F 5F6FA 1R5HA 2HI3A 1UZCA 2LMDA 2H8WA 4L9JA 1WJDA 3W2VA 3G1OA 1O3SA 4XLHA 1X2MA 1ON2A 5DYMA 5DDGA 5LLQA 2EJRA 2Y9ZA 2ZSHB 2L54A 2QSGX 5KK1A 3RQ4A 1JKQC 4KIGA 3GX4X 3DPTA 1HC8A 2MBFA 5D8LB 4HQMA 2EV0A 3TGNA 1XDSA 2DK5A 1IC8A 2P6SA 1BA5A 1DQUA 2RGVA 3CCUI 2ZXHA 3VYUB 3RKQA 2JA2A 2HNHA 3RKXA 3GLXA 4IRGA 3OL4A 2QA4I 4CCNA 1HF0A 2XGDA 3KZYA 3JRBA 3I64A 4C3IJ 3C2BA 2QBYB 4KITB 3OYCA 2OPTA 3M7GA 1H9GA 1LJ9A 2WA0A 3HTUA 1VQ4I 3ZXSA 1MNMC 3AG2H 3I58A 2XSJC 4CXFA 2NYXA 3FWEA 1QRYA 3S15J 2A6EF 1ULYA 4DQ2A 3KEYA 2IS6A 4XLEA 1T2KA 3DEUA 5JVGF 1YQAA 2GXBA 3VSKA 5TRDA 4G7HF 2GWRA 3PQJA 5F0FA 4A3GJ 5DTDA 2DFIA 3DLAA 4OOIA 4M3EA 4CYCB 3P5JA 1QHGA 2XHKA 4C2UA 3GTMJ 1N75A 1HXDA 5EEHA 1V5GA 2MGQA 3WU1B 1IO2A 1TNTA 5DUKA 1Z91A 3GCMA 4QIWN 1BIBA 4JX6A 4PJMA 1QU3A 3ASOH 3BWGA 4BY7J 2KL4A 2DA7A 3O3KA 1D1AA 3K4BA 3CUQC 4ITVA 1GVDA 2CW0F 2XDVA 2EFQA 2JA5J 2V26A 4HZFA 1OPCA 1XB4A 2IJLA 2VODA 3M1CA 3D5RC 2QSFX 3K1MA 2DA4A 3MEXA 3QWLA 3B73A 1VI0A 3IAM2 4PJJA 4HAMA 2QVOA 1MJ9A 1PUFA 4AM3A 3VPRA 5K7FA 5AONA 1IUYA 4AC0A 1K61A 3FXUA 4RM2A 4BJTA 3IH3A 2DBBA 4PSXA 1LVAA 2NVUB 4CZZA 3SEZA 1UAAA 3EPZA 4LG0A 3CMAI 2HQRA 1WFXA 2KIQA 3ERED 3OS1A 2WAQN 1X19A 2KIFA 3ZQQA 3TEDA 1ERDA 2F5FA 2VQCA 3HC7A 4LMYA 2A68F 3BPXA 2UZKA 4IO9F 1QPIA 4UY8I 2R7ZJ 1R4MB 2K7LA 2E36A 1FPQA 2JUCA 4K2EA 2XB0X 4UNOA 2JA6J 1BBYA 2X51A 4BACA 1MSEC 3QYEA 3C7JA 5DCMA 3M4OJ 1EH7A 3ECOA 3V7RA 1ZRCA 4MLOA 4XN0A 4A3FJ 3CCEI 2HKOA 3RPQA 5IYCJ 2FOWA 2NNYA 2ELJA 3J81Z 2PX9A 2PJRA 3RYRA 2QQAA 4WK8F 4M71A 1Z1DA 2X6OA 4E7HA 2EK5A 4YG2F 4II2A 4B44A 2D2WA 4XRSA 4ZDLA 3K4KA 2CG4A 3HRSA 2FX0A 4LK1F 3BCAA 4BUPA 1DU0A 3HXLA 1HSJA 3PNVA 4WXDA 5LBQA 3D5SC 3OY9A 3WGIA 1Y0UA 1FTZA 2EIMH 4M72A 4HNTA 1BIAA 1Z6TA 2FQ3A 4A3CJ 3WE2A 4FISA 4HF2A 2Y0SA 2F6CA 3DLLF 2HDDA 3GTPJ 3W3CA 2ETHA 4M3FA 4F3QA 1WJEA 5GAEJ 2CW7A 2FU4A 3K4JA 1DP7P 2M4KA 4EM2A 4E7SA 3CDHA 3R60A 2JMWA 4MFDA 1YJNI 1DUXC 4D5FA 2DMQA 3H36A 4XRMA 2IVMA 3L2VA 3EUAA 3GW2A 3HL2A 3VB2A 2P5LC 3J7AY 2ZXJA 3HM5A 2ZJ2A 1GDTA 1L3LA 2MSYA 4AIJA 1LFPA 2OTJI 1S6LA 3CF2A 4DGWB 2LTPA 2DYSH 4YFXF 2VE8A 5EG0B 1OCOH 4XQFA 3VFZA 3HHGA 4UUSB 3DEWA 2O8XA 1V55H 2NRAC 4F7ZA 3HDDA 1IDZA 3H9JA 1TQIA 4D7NA 1S72I 3OYBA 1TW2A 2J5PA 4Q5SF 4NUBA 1IRFA 1WKMA 2Z1DA 1APLC 4BU2A 2W4SA 1T98A 4QLCU 1JHHA 4BQOA 2DA1A 3CO6C 4BE1A 3MWMA 3K2ZA 2CUFA 4KDPA 5EEAA 5E3MA 1POGA 4D0PA 2FNAA 1UHMA 2BY0A 1BOAA 2DA3A 5D6FA 2STTA 3V8JA 3GZ5A 4ON0A 5BOXA 2JSPA 2Q2EA 4IHWA 3DTEA 1W4MA 5CVIA 4RB3C 4HOBA 5FJ8J 2QUFA 4F55A 4ESJA 3LSGA 5ICFA 3TQNA 3RPUD 2YX4A 1VQPI 3PFYA 1IAWA 1FOXA 1RPWA 3I0TA 3HBLA 5IY5H 1FX7A 1WJ5A 2RVCA 3EUHC 3I3LA 3F8NA 2ID6A 1S8NA 2M7AA 3KE2A 4LIUA 4NHJA 1ODDA 5KNLA 4AWXB 2TCTA 4CICA 1D8JA 5EGOB 4LLNA 2XAUA 2F48A 3RKWA 2K4BA 5M3FJ 4EJWA 5BS6A 1ONVA 3F8FA 4HLXA 3WHCA 1U5TA 3OYAA 2LREA 1FIPA 2ECCA 2OAZA 1YO5C 2FD5A 1U78A 5FLXK 4E7ZA 3PQKA 1IRGA 1OCCH 5ICEA 3AG3H 1J5YA 3COAC 4KN4X 1DP3A 4D7MA 1G3SA 1OLTA 2QF7A 3PIOF 4IRHA 1E0EA 1TP4A 4G9YA 4HV5A 3KP5A 4B8XA 1VFCA 4I6ZA 2RQQA 5IYDJ 5TGTA 1YLFA 4E7JA 4BY1J 2PMZN 2JSCA 3IRRA 2R5YB 2VONA 1KGSA 3K4CA 4HW0A 4HX4A 5E8GA 5FKKA 4IZZA 5D5VB 2ZXIA 4XLCA 2QQ9A 5FLXZ 3OS0A 2DJNA 5GADJ 3FMSA 4HQEA 4MEYF 2JVGA 4TV7A 1FTTA 1KQ9A 3MKWB 1U8BA 2K9NA 1V5EA 1RC9A 1Z9CA 2VBYA 1FMVA 4DOZA 5JR3A 5E79C 4L9VA 3I59B 1U6GA 4LITA 1TT0A 4B3XA 4BJ6C 2Y48A 1TWAJ 3HOWJ 4Y17A 2RNGA 4OWRB 5EF6A 2LF7A 1CF7B 2DMUA 2WV0A 3MN2A 2DPDA 1J9IA 2XAHA 5L3DA 1RR7A 3EETA 4YELA 2G7HA 1SAXA 3HOXJ 1D1CA 5K5QA 3HOYJ 3DBHB 2ZJPF 1V4RA 5FROA 5J1RA 3DQVC 4BYYA 1YE9A 2HTJA 3K10A 2F5VA 5LFAA 1UHSA 4R79A 3JSOA 1X1CA 5M5YJ 4OIQF 4HX8A 4AUXA 3NQOA 4RMNA 3PL8A 5H6RA 5A2QK 1MGTA 3PSIA 2LKPA 1R1UA 2W85A 2VJIA 3G2BA 2KT0A 2Z16A 4ZYEA 1IN6A 3P9IA 4P9FA 3T0YA 3KIOA 3ZMVA 3KLOA 2V9PA 2E1CA 4PJNA 4L0YB 1SFUA 2FMLA 3TKYA 3FXQA 2IS2A 3MMYB 4NBQA 2L7MP 3CTAA 1OJLA 1LUJB 5CQGA 2LY9A 3VYRB 1O7FA 2M3AA 2O5RA 1FSHA 2I5UA 1TL8A 4GCVA 2E2JJ 2PFBA 2X6XA 3SHFA 5J8CA 1LE8A 3KYDB 1FP2A 1ZH5A 1A5JA 1BC7C 4G6DA 4M3DA 5JFRA 3LAPA 3I53A 3LFKA 1HW5A 4U0YA 1IRXA 5DD4A 2MC4A 2L9RA 2FOKA 2NS8A 3BT9A 5HLIA 2K5CA 2LRDA 2DW4A 3L2UA 4NQWA 2W1OA 5F04A 2XRNA 3TBIA 4HNUA 4GO1A 1TTYA 1HCRA 2XPVA 1FP1D 2KQRA 1YS7A 5CPRB 2AS5F 4PGGA 3X2QH 3LSJA 2K27A 1D5YA 1QZEA 2A5WA 3FXLA 1ZLKA 1LDDA 2VC0A 5CQEA 1JGSA 3FK6A 4UB8C 1RETA 1F5TA 1F36A 1WRJA 2EZLA 3HEFA 1XDUA 4JK1X 1HKQA 3BJ6A 4N0BA 3W2WA 3L00A 1UB9A 3HGGA 2O3FA 3VYSB 4KT6A 2E35A 3IKTA 4YRVA 2YU3A 4RAGA 1X1AA 1QNTA 2OQRA 5B5EC 3S1MJ 4PFPA 4B48A 2DQRA 4DW6A 3FXKA 3RJPA 3LWFA 3OYEA 2VOPA 3M8EA 1W7PD 3GXOA 3I54A 1A35A 2DAOA 1MMNA 2KP6A 4YIFA 4ANJA 3F6OA 3L2CA 2L9VA 4F52A 5EJCA 2ACJA 2O9LA 2YX7A 3S3MA 2GOXB 4CGZA 3AL0B 1QGPA 3CC2I 3HRUA 1MDMB 4B47A 1LFUP 3QP5A 5ICCA 5DS9A 2CUZA 1LDKB 1YOVB 3BR0A 4I0AA 3CJNA 4J00A 3PM1A 4BH9A 2ZJRF 1OCTC 2PBIA 1W36C 4RLQA 3O8HA 3U2RA 4NNJA 4RAYA 2D45A 2W84A 2E19A 1WSUA 2IGOA 1QQIA 2A61A 3DKWA 4A3JJ 4M6XA 1J09A 1I5ZA 3DU5A 4ZYHA 1UMQA 2EILH 3BP8A 3GBGA 3HTSB 5D4SA 1FBUA 1ITYA 1EJ9A 4CDGA 4I98B 5E1ZB 5BMZA 2H09A 2M7BA 1BJAA 4HA8A 1R23A 1QBJA 4MIMA 1ZG3A 2BVMA 4FQGA 4P96A 5EEGA 2P6TA 3HHHA 5HODA 1HKSA 1YJWI 3DWLE 4MTEA 3REOA 4E7LA 2HOSA 3U9GA 3SFIA 4XLFA 2L9NA 2AQFA 2M30A 1R36A 2VPLA 4FX4A 2VQLA 3ZMZA 3BJOA 2PG4A 2LG4A 2W00A 1OISA 2HZDA 4OAZA 3SZTA 1B9NA 2LBFA 4MNUA 4NDLA 1SFEA 3J7YJ 1ETOA 2P0WA 5C4JJ 2P8TA 4ENMA 4KICA 2M45A 1XD7A 3CESA 3S17J 1WPKA 2D1HA 1MBGA 2W57A 3RSNA 3AG4H 2EFWA 2Y0MA 2TDXA 2YR2A 2GQQA 5D4RA 1CGPA 3OIPA 3MFKA 2C6YA 1MBKA 3A0BC 2ISYA 4IL6C 2QQ8A 5K7ZA 1E3PA 3H5NA 1IN8A 1FIAA 1UELB 2DYRH 1P9QC 3TW6A 3S8PA 1E2XA 1QHHD 1QA6A 1D0ZA 2LKXA 1BN5A 1ON1A 3HG9A 1OCRH 3Q9VA 4UVBA 3MZYA 6PAXA 1R00A 5KAIC 2CS3A 1FBSA 2L7KA 4YFKF 5D5WB 3ABMH 1K6OA 4GFBA 4HV6A 1MMGA 5LHGA 1S7AA 4ESFA 3CCJI 4HYEA 1D0YA 4UUTA 1JKRC 3BDDA 2IXSA 4CCKA 1O3QA 3IWFA 3R0JA 4U0VA 3PO2J 3CUQB 2W24A 4KIBA 5H2FC 4B3AA 2IRFG 4FCYA 2NS7A 3H3VK 2EQRA 1S7OA 3RZDJ 3E5XA 2XROA 1BR2A 3J7ZI 3BR6A 2LY1A 4GRIA 1XCVA 2VB6A 4BEHA 3AG1H 1V54H 5HDKA 2XAJA 1YIOA 4Y3OA 3CP8A 4MHGA 3VODA 1I3QJ 4N9HA 3FXMA 4KA4A 4AIKA 2BOLA 1TWHJ 1Z3YA 2EIJH 1YX5A 2E5NA 3QQAA 4RS8A 5EZHA 5F08A 5L3CA 3JAMK 3HOZJ 3LL7A 2R0QC 1HDDC 2R7VA 1R4NB 3JREA 3GWZA 3S32A 2ELHA 3EQLF 4UXNA 3TOBA 2EV5A 5DD8A 3A2KA 1X4OA 5DM7F 2B0LA 3OMYA 5K7HA 3IWZA 1DPUA 1SVLA 1JGGA 1DGRM 1V3FA 2FA5A 4M9ZA 1FJLA 4L18B 2KHMA 2WAEA 2QBYA 2R7OA 4NC6A 2ZNZA 3B02A 3WODF 4EM1A 3A1YA 2JRMA 1MSFC 4JP0A 2RREA 3HUGB 1XGMA 1DU6A 1XN7A 2CUEA 4O5VA 3JAMZ 2CUJA 3D1NI 2H94A 5HDNA 1ZQ3P 3E1SA 1U3EM 3F3XA 2NOJB 1VNDA 3OR2C 3K6GA 3RIRA 3DV8A 2ZBKA 2ESHA 3FM3A 1LEAA 2MA3A 5FLMJ 1K6YA 2K9MA 5FFZA 3CCMI 5EZGA 2BE5F 2M2EA 3JW4A 1M1EB 2E2HJ 4CYCA 3QU6A 1G8XA 2IA1A 1BL0A 5J1YA 4LFUA 1YJ9I 5ILSA 3TOAA 2R7TA 2XPUA 5E3LA 3CC7I 1EV7A 1ZR2A 1IG7A 4YIIA 2L7ZA 3MKYB 4IKFA 1X1PA 4OINF 3E6DA 1Z3XA 4E6KG 3Q9SA 2DK8A 1T56A 4GGGA 1O4XA 4BQQA 1FOWA 1VZ0A 4HLYA 2OUMA 2XAFA 4YIRX 1SVOA 1Z77A 2IBDA 3ZQFA 2F4MB 4G12A 1P7IA 4LLLA 1NG7A 1W7PB 1WGXA 2E1NA 3C3WA 2HEOA 3BPVA 4BDYA 1F9NA 2HVRA 1Y0NA 4LB6B 2R7SA 3RYPA 1AU7A 4IX7A 3QOPA 1SAUA 1BJZA 1Z6RA 2K3FA 1TW3A 3NARA 4XKWA 4MEXF 3S3NA 2HOEA 1ETWA 1KQ8A 2VKEA 2YPRA 2X6YA 2QKMB 2Y9YA 2E1OA 2P81A 3L2RA 3BC8A 1HDPA 3GVAA 3HJEA 3KFWX 2AXLA 2Z3YA 2PMHA 4Y33A 3JR9A 2VKDA 2PJPA 4Y7NJ 1G3WA 4I01A 1X3UA 3H5RA 3QAHA 1KYWA 3RTRA 5LRRA 5GPAA 1B6AA 1R1TA 1ZG5A 1T0FC 1QPMA 2K40A 2JJ7A 3OIQA 4BDZA 4JYKA 3HPGA 2VKVA 3SXYA 3P9KA 2JVHA 1WH5A 1SANA 1RESA 2ZMEC 3R61A 2FF4A 2K9QA 4WXCA 3EYIA 5L3EA 3P9CA 2GIZA 3RDIA 1F43A 2BY3A 5L3FA 3NEUA 4MTDA 1FLIA 2QKLB 1FC3A 4B1RA 4ZJZA 2DTZA 2AQEA 3EUHA 1D1BA 1W36D 3OOUA 4OIPF 2NVQJ 5BNGA 4ZYGA 2ZCWA 3H35A 3TW7A 4QWQA 2L5QA 5LD2C 2VQHA 4A0YA 4BGDA 2F5DA 4ETSA 1RKWA 4IXAA 4V19K 3S16J 1RR8C 1KQ0A 3U21A 1K4TA 2NVYJ 2MH9A 3FX3A 2P5VA 4M9SA 4MFEA 3EYYA 4UHTA 5AIPA 1KYZA 3DEEA 3TO9A 1XMAA 2JT1A 4HDVA 4MO7A 2LH9A 3B6CA 1NK3P 4DBRA 3G71I 4BNCA 1X3WB 2M0CA 1Q1VA 2YSRA 2L9SA 1AKHB 2I8DA 4E7IA 1A31A 2DT7B 1OQYA 1FYMA 4RB1A 1E3OC 1JUPA 2Q8KA 2CQ7A 4A69C 2HVSA 2VBZA 1OR7A 3CC4I 4D5CA 4DIQA 4IHYA 2DCEA 3FHZA 3ABTA 2E1MB 1B1BA 1FNNA 1ZR4A 2HQ5A 2ESNA 5ILVA 1W0UA 4G6QA 4ZYAA 2HDWA 4EMSA 2VJJA 2M0MA 1VQ5I 1SFXA 2W82A 2IPQX 2VXDA 5EG0A 2A6HF 1D3YA 2FBIA 2IEKA 3HOSA 1RZ4A 1X3ZB 4UUSA 1O3RA 4LB5A 2QENA 1FOYA 5F1RA 2BYVE 2FQ4A 3Q0WA 1X4PA 2X1DA 5EDNA 3LQQA 3E5UA 4EJOA 1OCZH 2WY8Q 2EA2A 2XF5A 5DUIA 1Y56A 3U1KA 4G7OF 3V7SA 1WJBA 1K78B 1UJ8A 2ZSIB 4XN3A 3SDBA 3GTJJ 4A3LJ 4H0EA 2OD5A 4HX7A 1J7KA 1G3YA 2KIMA 3CMEI 4JX4A 3OYHA 1UG2A 1LFBA 4OAYA 3ABKH 2OA4A 3BTLA 3FM5A 3V8LA 1JHFA 3WTWC 4QPQA 4ESBA 5TISC 2ZC2A 2VJ4A 1I39A 3FXJA 3R0AA 3DF8A 4I02A 2R4GA 4FHTA 3SJMA 3LA3A 2GOMA 3Q0UA 2R7WA 2GLOA 5E17F 4V2GA 4E7KA 1Z05A 5CLSA 4IHVA 2KJCA 2BBYA 2BY2A 2JA8J 3G1MA 4LLGF 1R9TJ 1ZRFA 3BZ6A 3H0GJ 1XS9A 3FMQA 2DN0A 2QYOA 2XF6A 3ISPA 4Q47A 1YW8A 1OCPA 5EGOA 3OYFA 1ZGWA 4RAFA 3FMRA 4G8XA 4NC7A 2Y69H 1B72B 1GXQA 5J47A 2KISA 1XSXA 2F4OB 3OWTA 5LEKA 4CO8A 1ETXA 3B6AA 3I71A 4CSWA 2XAGA 3OSFA 3HOVJ 5ERIA 5HVQC 3ZQGA 3C18A 4WCGA 2ZFWA 3M8JA 2JRTA 1YTYA 3EUKL 4FASD 2KDZA 1X1BA 3DBLB 4L9TA 4XM3A 1YIJI 3J7AO 2ME6A 2DFFA 4RGXA 3LA2A 4M3BA 3H5AA 2XIGA 4M6YA 3M1EA 4Z2YA 5ICGA 4J19A 2DA2A 1TT5B 2OCEA 1G6NA 2V9KA 1NK2P 2R5YA 3F8MA 1WH7A 1JT6A 2MLKA 4UV9A 5GP9A 3WU2C 2FBHA 2WB1N 3ZR8X 2E1MC 2DXIA 4L0ZB 3CCYA 1X1DA 2WY7Q 3F0CA 1OYWA 1USSA 2XRLA 3LSKA 2VJ5A 4XKBA 4Q4ZF 3OYGA 2FEZA 1WQ2A 2QZ8A 3HPHA 3CDLA 5BPDA 1HSTA 3BR2A 5F27A 2Y2ZA 2LKSA 4IOCF 1T33A 1Q1HA 3O8GA 4M73A 3I59A 4DYCA 2NVTJ 3L2QA 1GLNA 1Y1WJ 1YG2A 4A3BJ 1NHAA 2VUMJ 4XONA 3D0SA 1CF7A 3CQZJ 2DU9A 3KZIC 1JKOC 3RZOJ 2VIXA 4I99C 2VBWA 2KLOA 3JTGA 3HYIA 4XK4A 4XRFA 1YRNB 1MMSA 1BI0A 4PGHA 3J80K 2V1UA 1AWCA 4PZJA 1SD6A 3CJQB 3K70C 1OYIA 1ZAOA 1USTA 1WI9A 2Y0SN 3FXOA 3OYKA 2MFZA 5B3SH 1SMYF 2X4HA 4U87A 2DLLA 3WTUC 2GBYA 1IXRC 2CFXA 3GUDA 2V1DA 3WHBA 3IV5A 4BHPA 2PLYA 4I76A 3K1PA 3QPTA 2HXOA 1N25A 4X0GA 5E1XA 2Y30A 3DPUA 1VQ6I 2RV8A 1XMKA 2GM4A 2V6EA 3DTKA 4RGSA 1GHCA 5HS8A 4E4HA 2IP2A 2K4JA 4PCQA 5HLTA 1FWZA 2HKXA 3TP3A 3IHUA 2O6GE 4U88A 1EA3A 3CZ6A 1SEUA 2GA2A 3ECHA 2A5YB 1FZPB 1RNLA 3H92A 2L4MA 4ENNA 2CV2A 4GDFA 2YU9J 2EFOA 2M9HA 1ETVA 1ZRDA 3LSMA 4AD9A 3CCRI 2KRFA 1S7EA 1VTNC 1S3JA 4BKXA 3ERMA 3ZP5A 4I09A 1WVRA 3A4CA 5A2QZ 1UCRA 4C2MJ 3F21A 2BHYA 2K02A 2X48A 1KU2A 4M9XA 4B43A 3DXJF 1YITI 4WX9A 4H4KC 4ABZA 2PQ8A 2RQPA 2E5ZA 1ENHA 2RC4A 4B4CA 1EKEA 4AVZA 1T95A 2Y31A 5K5RA 4IJAA 4O6JA 4XKVA 2VQGA 1RIOH 3TO7A 3K7AJ 2JPCA 1JJ8C 3M07A 4RB2C 4JOMA 4IHXA 3RI4A 3E97A 5FB2A 1ZARA 4ZZLA 5FGMA 2A69F 3BOQA 1B4AA 5L3GA 2FJ1A 2Y75A 3KLNA 2HTSA 4OMZA 4BHBA 3JRIA 4AVPA 4M6VA 2HYGD 3ZOBA 2JQ7A 3I5UA 2VXZA 3HSEA 2M87A 4BXUA 2LNBA 2R93J 2LOOA 5M5XJ 3AFHA 2CH0A 4XIDA 5LHIA 3JCUC 5BQTA 1NTCA 1K83J 3DKXA 2M8EA 4I2OA 4BL0B 3IH4A 1XGNA 2AXTC 1U5TC 4XICA 1ZK8A 2OBPA 4LOCA 2HPMA 2BV6A 3ZQIA 5K1YA 4PUSA 4IHSA 3HKZN 2UXNA 1FMWA 1U0JA 2EPFA 3ML6A 5IP7J 3CCVI 2NNNA 4EGZA 1MDMA 1VQKI 4KYWA 2FNPA 2G9WA 2IS1A 4KMUX 2IGKA 3BLYA 3PNTA 4ZZDA 1R7JA 1FOKA 2HPIA 3KYCB 1XGSA 4RM3A 3ZQ7A 4W1UA 4DYRA 2A05A 2BXZA 1DDNA 2EH3A 2LFBA 3E7LA 3A01B 2DOEA 1MKMA 4IRIA 4ZYDA 3ZMDA 4Y13A 4A3KJ 3RPUA 2MLGA 1BR4A 2L4AA 1F1ZA 5B1BH 5H20A 3A03A 5JVTA 3WTSC 3ZRGA 4A5NA 1XSDA 2D1VA 5CYVA 1Y39A 4OMYA 1H88C 2BEOA 1JUSA 4GYIA 5FKOA 4XR6A 2R7XA 2DT6A 4M74A 4C2TA 1YW9A 3E0JB 5KHDA 3OYDA 4ZTFA 4WWCA 1IN5A 2GA1A 1TC3C 2MC3A 4PDKA 4PFOA 4KUMA 3CJTB 3WG7H 2XASA 3EDPA 3G4SI 2UWMA 3S2HJ 2LF8A 2H27A 1R49A 4PJLA 1REPC 2HFHA 3FDYA 5D6EA 5BPIA 3DBRB 1FT9A 3ZQLA 4EATA 1TLHB 1AA7A 1TZLA 3L2WA 3C1DA 4L5IA 1U2WA 5CVVA 5M3MJ 3S3OA 3ZCOA 2PMUA 3FK7A 1Z67A 2TRTA 5F1JA 3QOEA 1MBEA 3NRVA 2EV6A 3Q3SA 4KMFA 3VWBA 1ZGAA 2VLAA 3KX2A 2OTLI 1HW1A 1TWGJ 5HS7A 1I1SA 3MCZA 1E3HA 1XX5A 1JTYA 1MJBA 2O03A 2UV1A 3QU3A 5HDGA 2GZWA 2V1XA 5FD6A 3QPHA 2MH2A 4CHUA 2DI3A 5J4YA 3E5QA 3S1NJ 4L5JA 4I7HA 1JE8A 3OS2A 2QWWA 1FBQA 5DEQA 1P4XA 2RN7A 5LGNA 3BJAA 3W6VA 2H6BA 3BG5A 3FISA 4KISA 1MH4A 3BG7A 5FKNA 2BXYA 3M9AA 2P7VB 4A3EJ 1XCBA 5D5XB 4C3JJ 5LEJA 3BCBA 3CUQA 1PP7U 2CU7A 2EB7A 2KIUA 3BY6A 4LGWA 4F92B 1RRJA 3ZQHA 1GT0C 1FEXA 5D5UB 4WF2A 1J2XA 3T8RA 1TWFJ 2I10A 3ROUA 2XV4S 3JRGA 3GFIA 3H9GA 3PNYA 2K9LA 3JRAA 2J5OA 3GTLJ 3HZJA 1R71A 5GTIC 5KVRA 4ZDOA 3GLLA 3QYFA 3UNGC 4XBFA 2EA4A 2JZYA 2P4WA 1ZGJA 4Y4RA 2AHQA 4HEA2 4DNCA 1HKTA 1B8IB 3S14J 2V4JC 2KJBA 3KCCA 3TL4X 1ZREA 1T0FA 3CF5F 2K9SA 4AYBN 3H3ZA 3K70D 2WAQA 3GF2A 3GZ6A 2KDOA 2B7EA 2ZMEA 3BTCA 2R5ZB 3K9TA 3MAJA 1K79A 4IOAF 1ACIA 1ZTRA 2CV1A 4EVIA 4J01A 2LLKA 3IRQA 2M8GX 4UVAA 3IAS2 1R6RA 1BR1A 4RDUA 2Z33A 4A3MJ 4QSHA 2CQQA 4FE4A 4F91B 5JI6A 2R7RA 4XRSG 3Q0VA 2XSDC 2ZMEB 1MIJA 2DOAA 3HUGA 4HG2A 1ZHFA 4IVNA 3HSRA 1BI2A 1OMIA 2E2IJ 2X1CA 4A0ZA 1R58A 3OSGA 4HBLA 5K5OA 1EF4A 1WJFA 5TJJA 2EZIA 4IQJA 3V42A 3E6CC 1ETQA 1D8KA 4RGUA 1YHQI 4A6EA 1QO0D 5DV5A 1SMTA 3HRTA 2ID3A 4FETA 4E70A 1VQ8I 2XF7A 4EQQA 1U8RA 3BQZA 1MMDA 4BJ5C 3BG6A 3OYLA 2RKHA 3TDZC 3K1NA 3OYIA 3SFZA 4N9IA 2WTEA 1WJAA 3H9QA 1P7JA 1R5ID 4BE2A 4BS9A 1SC7A 2VC1A 5FD5A 3DFGA 1I3AA 3S2DJ 1RKTA 3CUOA 4BBRJ 3ESWB 4XKCA 2DA5A 1W7PA 2F5CA 1UHWA 1MJAA 3OYNA 4UB6C 3GO5A 2X1EA 2CW8A 4P5OA 3VEPA 3ZMUA 4BHCA 2QQBA 3LFUA 1LB2A 1UG0A 4UUVA 1H89C 3TO6A 2MYSA 3BROA 2KZVA 3BG3A 1IUFA 5B1AH 2CJJA 3LNQA 2P5KA 3F8CA 4BXFA 4A93J 3K69A 3WTXC 1Y8RB 4IHTA 1P4WA 3CLQA 2F5EA 4G7ZF 1F4KA 1STZA 2EZKA 2LK2A 2WBMA 1SD7A 2VBXA 1Z7LA 3MKLA 2HVQA 3WGHA 1A6IA 1HOMA 4BBSJ 3HRMA 3KP7A 1BOBA 1NG6A 4Q48A 3VDXA 1VQMI 1J75A 3GMEA 4OIOF 3I9V2 3HGYA 5KCMA 4AIDA 4BXXJ 3PO3J 4ENJA 5F0HA 3CCLI 1IW7F 2YUSA
chains in the Genus database with same CATH topology
2JA8J 3G1MA 1R9TJ 2B63J 3H0GJ 1XS9A 2R92J 3GTKJ 4M3DA 2DN0A 1B8IA 2LD5A 5EGOA 1OCPA 3BR3A 1ZGWA 2L9RA 4FE7A 2NS8A 3BT9A 1B72B 1W0TA 3A02A 1SFOJ 5F04A 4Y52J 2R5ZA 1WI3A 1HCRA 3GTOJ 5FKLA 1ETXA 1XG1A 3B6AA 2XPVA 5IP9J 5IOYA 2CQXA 5J1UA 3OSFA 3HOVJ 3LSJA 3JRCA 5IPAA 3ZQGA 1IV6A 3HB9A 1D5YA 2JK3A 3GTQJ 3FK6A 2KDZA 1RETA 1ETKA 1F36A 2ME6A 4RBOA 3HEFA 2EZLA 2LP0A 4M3BA 1MH3A 5C3EJ 4J19A 2DA2A 3CMYA 1WCMJ 1X2NA 3HGGA 1NK2P 4IEJA 2R5YA 1JTXA 1WH7A 1JT6A 3GTGJ 5GP9A 1PUFB 2WB1N 1AKHA 1I50J 3MVPA 1JKPC 3CCYA 1IRZA 3F0CA 3S1MJ 2O7OA 2XRLA 1VF9A 3G1LA 4DW6A 3JRDA 1GV2A 3CDLA 2G0EA 3S1QJ 3BR2A 5F27A 2Y2ZA 1T33A 4DYCA 2MW8A 2QCOA 3O8GA 2O9LA 2NVTJ 4X1EA 1Y1WJ 1JUMA 1G2HA 1ORKA 4A3BJ 2VUMJ 1ETYA 2RAEA 2DMNA 3CQZJ 1LFUP 2ZB9A 1JKOC 5JLWA 3RZOJ 5C44J 5DS9A 1YRNB 4XK4A 2HI3A 3BR0A 5M5WJ 3PM1A 3G1OA 1OCTC 1X2MA 3K2AA 1X58A 4FTHA 2Y9ZA 3O8HA 3FKIJ 2ECBA 2O8KA 1JKQC 2E19A 2Y0SN 3S1RJ 4A3JJ 1IC8A 1BA5A 2AO9A 2GBYA 1UMQA 5IP6A 3RKQA 3IV5A 3GBGA 3WHBA 4I76A 4W97A 1ITYA 3OIOA 3BR5A 2HXOA 1HF0A 2XGDA 3JRBA 4C3IJ 3C2BA 2Y30A 4MIMA 5HODA 2OPTA 2GM4A 2NVXJ 2HOSA 1MNMC 4X6AJ 2ELKA 3SFIA 3TP3A 2L7FP 1QRYA 3S15J 3DCFA 2YU9J 4NDLA 2DMPA 2M9HA 1ETVA 1ETOA 1GUUA 1IGNA 5C4JJ 4A3GJ 3BG9A 5F0FA 5DTDA 1S7EA 4BKXA 4M3EA 4CYCB 3S17J 1WPKA 3GTMJ 1B72A 2CRGA 4C2MJ 1MBGA 2MGQA 2X48A 4QIWN 4JX6A 2LR8A 2NOGA 4ABZA 1MBKA 4BY7J 2DA7A 1MBJA 1ENHA 4B4CA 5K7ZA 1GVDA 3HOUJ 2Y31A 2JA5J 5FLVA 1FIAA 1GV5A 3TW6A 9ANTA 3K7AJ 1JJ8C 2LKXA 4IHXA 2DA4A 1VI0A 3LSRA 2FJ1A 5EYRA 4GFBA 3JRIA 1PUFA 4M6VA 3ZOBA 3VPRA 5K7FA 5JLXA 4UUTA 1JKRC 2R93J 5M5XJ 4AC0A 4XIDA 1K61A 1JT0A 3BQYA 1NTCA 3IH3A 1K83J 3PO2J 3IH4A 4XICA 1ZK8A 4B3AA 4LOCA 4FCYA 2NS7A 3H3VK 2EQRA 2WAQN 3RZDJ 3ZQIA 3HKZN 3TEDA 3BR6A 5IP7J 3BR1A 2XPWA 1AHDP 1QPIA 1HLVA 2R7ZJ 1I3QJ 1YRNA 2XB0X 2JA6J 2XGCA 3JRHA 3JRFA 1MSEC 1TWHJ 3M4OJ 3IH2A 3FIWA 4W1UA 4DYRA 3QQAA 4MLOA 4M3GA 2EBIA 4A3FJ 2EH3A 2LFBA 3E7LA 4S0HB 5EZHA 5F08A 5IYCJ 3A01B 3HOZJ 2R0QC 1HDDC 2H1KA 3JREA 3BTIA 4A3KJ 2HXIA 2X6OA 2HYJA 3A03A 5K7HA 1IJWC 1IDYA 1JGGA 4XRSA 1FJLA 1H88C 2IAIA 2FX0A 1DU0A 2X9DA 5IYBJ 1JUSA 5FKOA 1MSFC 4JP0A 1FTZA 4V2FA 1DU6A 3LSPA 2CUEA 4A3CJ 4FISA 3D1NI 1ZQ3P 1TC3C 3GTPJ 1VNDA 2HDDA 4M3FA 5J3LA 3S2HJ 5FLMJ 5EZGA 2M2EA 3ZQLA 2JMWA 4MFDA 2E2HJ 4D5FA 4CYCA 2DMQA 4XRMA 1BL0A 5J1YA 5M3MJ 2XPUA 3HM5A 5E3LA 3FK7A 2TRTA 1I6HJ 5F1JA 1MBEA 1GDTA 3Q3SA 3L1PA 2MSYA 1ZR2A 3RQIA 1TWGJ 1QVTA 1IG7A 2L7ZA 2LTPA 2OF7A 1U9NA 5EG0B 1JTYA 3I4NJ 4UUSB 1T56A 3DEWA 1O4XA 3HDDA 5FKMA 1IDZA 2IBDA 1Z77A 3S1NJ 3ZQFA 4G12A 1P7IA 4D7NA 4DZJA 2VI6A 1WGXA 2JA7J 1APLC 3LOCA 3BTJA 3W6VA 3FISA 3BG5A 1BW6A 4EEFG 1AU7A 2DA1A 1BJZA 1MH4A 2M34A 2CUFA 2ME0A 5FKNA 5EEAA 5E3MA 2HOAA 1POGA 3NARA 4A3EJ 1ETWA 2VKEA 2DA3A 4C3HJ 2Y9YA 2E1OA 2P81A 5E3NA 4C3JJ 1HDPA 3ZQCA 4IHWA 4A3DJ 3JR9A 2CU7A 5FJ8J 3ZQHA 4Y7NJ 1GT0C 1FEXA 3LSGA 1TWFJ 2I10A 3JRGA 5GPAA 1MBHA 1RPWA 3JRAA 2K40A 2JJ7A 3HBLA 3GTLJ 2ID6A 4JYKA 1U9OA 2VKVA 4QTRA 1LE8B 1WH5A 3M3YJ 1SANA 1RESA 2TCTA 2K9QA 2AHQA 2JN6A 1F43A 1B8IB 3S14J 5EGOB 2XB5A 5M3FJ 5C4XJ 4B1RA 2K9SA 2DTZA 3A01A 4AYBN 3OOUA 3WHCA 1BW5A 3NAUA 2NVQJ 3I4MJ 3QPSA 3BTCA 5BNGA 2R5ZB 1FIPA 2ECCA 3TW7A 1ZTRA 2FD5A 1U78A 2LLKA 2M8GX 1RKWA 1Z0XA 4RDUA 2YS9A 2N8GA 4D7MA 4A3MJ 4QSHA 3S16J 2CQQA 4FE4A 4XRSG 2QF7A 2D5VA 3Q0VA 2DMTA 2NVYJ 1QVUA 2W48A 4MFEA 2XSDC 1VFCA 2L0KA 4I6ZA 5IYDJ 4DZPA 4BY1J 2E2IJ 2PMZN 4MO7A 4HNVA 2R5YB 2HOTA 3B6CA 1NK3P 2M0CA 1Q1VA 3OSGA 5FKKA 1AKHB 1EF4A 2DJNA 1E3OC 2EZIA 1JUPA 2JWTA 1ETQA 2H8RA 1FTTA 2MG4A 4A69C 1JJ6C 1U8BA 2VPRA 2K9NA 4D5CA 4IHYA 1OFCX 4JX5A 5F0CA 2ID3A 1ZR4A 3BQZA 1TWAJ 2HQ5A 1CQTA 2LVSA 3HOWJ 1W0UA 5EF6A 4A3IJ 2WV1A 2DMUA 3MN2A 5EG0A 5E3OA 1P7JA 1RR7A 2IEKA 4UUSA 3HOXJ 3HOYJ 3S2DJ 1RKTA 4BBRJ 2FQ4A 5J1RA 2DA5A 3Q0WA 1UHSA 3TP0A 5EDNA 5M5YJ 4AUXA 2EZHA 1H89C 2COBA 3BG3A 1IUFA 4L5EA 3GTJJ 4A3LJ 2KT0A 2CJJA 3LNQA 1H8AC 4JX4A 4A93J 5GPCA 1TWCJ 1UG2A 1LFBA 1ZKGA 3UKGA 3BTLA 1MBFA 2EZKA 1OJLA 2L7MP 2LK2A 3QPLA 4DYQA 2LY9A 3MKLA 2XGEA 1A6IA 1HOMA 4BBSJ 2DA6A 3SJMA 3SDGA 1XC5A 2E2JJ 3HGYA 4BXXJ 3Q0UA 2GLOA 3PO3J 4V2GA 5IOZA 5F0HA 4IHVA 1Y1VJ 1LE8A 1A5JA 2YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 J;  3G1M A;  1R9T J;  2B63 J;  3H0G J;  1XS9 A;  2R92 J;  3GTK J;  4M3D A;  2DN0 A;  1B8I A;  2LD5 A;  5EGO A;  1OCP A;  3BR3 A;  1ZGW A;  2L9R A;  4FE7 A;  2NS8 A;  3BT9 A;  1B72 B;  1W0T A;  3A02 A;  1SFO J;  5F04 A;  4Y52 J;  2R5Z A;  1WI3 A;  1HCR A;  3GTO J;  5FKL A;  1ETX A;  1XG1 A;  3B6A A;  2XPV A;  5IP9 J;  5IOY A;  2CQX A;  5J1U A;  3OSF A;  3HOV J;  3LSJ A;  3JRC A;  5IPA A;  3ZQG A;  1IV6 A;  3HB9 A;  1D5Y A;  2JK3 A;  3GTQ J;  3FK6 A;  2KDZ A;  1RET A;  1ETK A;  1F36 A;  2ME6 A;  4RBO A;  3HEF A;  2EZL A;  2LP0 A;  4M3B A;  1MH3 A;  5C3E J;  4J19 A;  2DA2 A;  3CMY A;  1WCM J;  1X2N A;  3HGG A;  1NK2 P;  4IEJ A;  2R5Y A;  1JTX A;  1WH7 A;  1JT6 A;  3GTG J;  5GP9 A;  1PUF B;  2WB1 N;  1AKH A;  1I50 J;  3MVP A;  1JKP C;  3CCY A;  1IRZ A;  3F0C A;  3S1M J;  2O7O A;  2XRL A;  1VF9 A;  3G1L A;  4DW6 A;  3JRD A;  1GV2 A;  3CDL A;  2G0E A;  3S1Q J;  3BR2 A;  5F27 A;  2Y2Z A;  1T33 A;  4DYC A;  2MW8 A;  2QCO A;  3O8G A;  2O9L A;  2NVT J;  4X1E A;  1Y1W J;  1JUM A;  1G2H A;  1ORK A;  4A3B J;  2VUM J;  1ETY A;  2RAE A;  2DMN A;  3CQZ J;  1LFU P;  2ZB9 A;  1JKO C;  5JLW A;  3RZO J;  5C44 J;  5DS9 A;  1YRN B;  4XK4 A;  2HI3 A;  3BR0 A;  5M5W J;  3PM1 A;  3G1O A;  1OCT C;  1X2M A;  3K2A A;  1X58 A;  4FTH A;  2Y9Z A;  3O8H A;  3FKI J;  2ECB A;  2O8K A;  1JKQ C;  2E19 A;  2Y0S N;  3S1R J;  4A3J J;  1IC8 A;  1BA5 A;  2AO9 A;  2GBY A;  1UMQ A;  5IP6 A;  3RKQ A;  3IV5 A;  3GBG A;  3WHB A;  4I76 A;  4W97 A;  1ITY A;  3OIO A;  3BR5 A;  2HXO A;  1HF0 A;  2XGD A;  3JRB A;  4C3I J;  3C2B A;  2Y30 A;  4MIM A;  5HOD A;  2OPT A;  2GM4 A;  2NVX J;  2HOS A;  1MNM C;  4X6A J;  2ELK A;  3SFI A;  3TP3 A;  2L7F P;  1QRY A;  3S15 J;  3DCF A;  2YU9 J;  4NDL A;  2DMP A;  2M9H A;  1ETV A;  1ETO A;  1GUU A;  1IGN A;  5C4J J;  4A3G J;  3BG9 A;  5F0F A;  5DTD A;  1S7E A;  4BKX A;  4M3E A;  4CYC B;  3S17 J;  1WPK A;  3GTM J;  1B72 A;  2CRG A;  4C2M J;  1MBG A;  2MGQ A;  2X48 A;  4QIW N;  4JX6 A;  2LR8 A;  2NOG A;  4ABZ A;  1MBK A;  4BY7 J;  2DA7 A;  1MBJ A;  1ENH A;  4B4C A;  5K7Z A;  1GVD A;  3HOU J;  2Y31 A;  2JA5 J;  5FLV A;  1FIA A;  1GV5 A;  3TW6 A;  9ANT A;  3K7A J;  1JJ8 C;  2LKX A;  4IHX A;  2DA4 A;  1VI0 A;  3LSR A;  2FJ1 A;  5EYR A;  4GFB A;  3JRI A;  1PUF A;  4M6V A;  3ZOB A;  3VPR A;  5K7F A;  5JLX A;  4UUT A;  1JKR C;  2R93 J;  5M5X J;  4AC0 A;  4XID A;  1K61 A;  1JT0 A;  3BQY A;  1NTC A;  3IH3 A;  1K83 J;  3PO2 J;  3IH4 A;  4XIC A;  1ZK8 A;  4B3A A;  4LOC A;  4FCY A;  2NS7 A;  3H3V K;  2EQR A;  2WAQ N;  3RZD J;  3ZQI A;  3HKZ N;  3TED A;  3BR6 A;  5IP7 J;  3BR1 A;  2XPW A;  1AHD P;  1QPI A;  1HLV A;  2R7Z J;  1I3Q J;  1YRN A;  2XB0 X;  2JA6 J;  2XGC A;  3JRH A;  3JRF A;  1MSE C;  1TWH J;  3M4O J;  3IH2 A;  3FIW A;  4W1U A;  4DYR A;  3QQA A;  4MLO A;  4M3G A;  2EBI A;  4A3F J;  2EH3 A;  2LFB A;  3E7L A;  4S0H B;  5EZH A;  5F08 A;  5IYC J;  3A01 B;  3HOZ J;  2R0Q C;  1HDD C;  2H1K A;  3JRE A;  3BTI A;  4A3K J;  2HXI A;  2X6O A;  2HYJ A;  3A03 A;  5K7H A;  1IJW C;  1IDY A;  1JGG A;  4XRS A;  1FJL A;  1H88 C;  2IAI A;  2FX0 A;  1DU0 A;  2X9D A;  5IYB J;  1JUS A;  5FKO A;  1MSF C;  4JP0 A;  1FTZ A;  4V2F A;  1DU6 A;  3LSP A;  2CUE A;  4A3C J;  4FIS A;  3D1N I;  1ZQ3 P;  1TC3 C;  3GTP J;  1VND A;  2HDD A;  4M3F A;  5J3L A;  3S2H J;  5FLM J;  5EZG A;  2M2E A;  3ZQL A;  2JMW A;  4MFD A;  2E2H J;  4D5F A;  4CYC A;  2DMQ A;  4XRM A;  1BL0 A;  5J1Y A;  5M3M J;  2XPU A;  3HM5 A;  5E3L A;  3FK7 A;  2TRT A;  1I6H J;  5F1J A;  1MBE A;  1GDT A;  3Q3S A;  3L1P A;  2MSY A;  1ZR2 A;  3RQI A;  1TWG J;  1QVT A;  1IG7 A;  2L7Z A;  2LTP A;  2OF7 A;  1U9N A;  5EG0 B;  1JTY A;  3I4N J;  4UUS B;  1T56 A;  3DEW A;  1O4X A;  3HDD A;  5FKM A;  1IDZ A;  2IBD A;  1Z77 A;  3S1N J;  3ZQF A;  4G12 A;  1P7I A;  4D7N A;  4DZJ A;  2VI6 A;  1WGX A;  2JA7 J;  1APL C;  3LOC A;  3BTJ A;  3W6V A;  3FIS A;  3BG5 A;  1BW6 A;  4EEF G;  1AU7 A;  2DA1 A;  1BJZ A;  1MH4 A;  2M34 A;  2CUF A;  2ME0 A;  5FKN A;  5EEA A;  5E3M A;  2HOA A;  1POG A;  3NAR A;  4A3E J;  1ETW A;  2VKE A;  2DA3 A;  4C3H J;  2Y9Y A;  2E1O A;  2P81 A;  5E3N A;  4C3J J;  1HDP A;  3ZQC A;  4IHW A;  4A3D J;  3JR9 A;  2CU7 A;  5FJ8 J;  3ZQH A;  4Y7N J;  1GT0 C;  1FEX A;  3LSG A;  1TWF J;  2I10 A;  3JRG A;  5GPA A;  1MBH A;  1RPW A;  3JRA A;  2K40 A;  2JJ7 A;  3HBL A;  3GTL J;  2ID6 A;  4JYK A;  1U9O A;  2VKV A;  4QTR A;  1LE8 B;  1WH5 A;  3M3Y J;  1SAN A;  1RES A;  2TCT A;  2K9Q A;  2AHQ A;  2JN6 A;  1F43 A;  1B8I B;  3S14 J;  5EGO B;  2XB5 A;  5M3F J;  5C4X J;  4B1R A;  2K9S A;  2DTZ A;  3A01 A;  4AYB N;  3OOU A;  3WHC A;  1BW5 A;  3NAU A;  2NVQ J;  3I4M J;  3QPS A;  3BTC A;  5BNG A;  2R5Z B;  1FIP A;  2ECC A;  3TW7 A;  1ZTR A;  2FD5 A;  1U78 A;  2LLK A;  2M8G X;  1RKW A;  1Z0X A;  4RDU A;  2YS9 A;  2N8G A;  4D7M A;  4A3M J;  4QSH A;  3S16 J;  2CQQ A;  4FE4 A;  4XRS G;  2QF7 A;  2D5V A;  3Q0V A;  2DMT A;  2NVY J;  1QVU A;  2W48 A;  4MFE A;  2XSD C;  1VFC A;  2L0K A;  4I6Z A;  5IYD J;  4DZP A;  4BY1 J;  2E2I J;  2PMZ N;  4MO7 A;  4HNV A;  2R5Y B;  2HOT A;  3B6C A;  1NK3 P;  2M0C A;  1Q1V A;  3OSG A;  5FKK A;  1AKH B;  1EF4 A;  2DJN A;  1E3O C;  2EZI A;  1JUP A;  2JWT A;  1ETQ A;  2H8R A;  1FTT A;  2MG4 A;  4A69 C;  1JJ6 C;  1U8B A;  2VPR A;  2K9N A;  4D5C A;  4IHY A;  1OFC X;  4JX5 A;  5F0C A;  2ID3 A;  1ZR4 A;  3BQZ A;  1TWA J;  2HQ5 A;  1CQT A;  2LVS A;  3HOW J;  1W0U A;  5EF6 A;  4A3I J;  2WV1 A;  2DMU A;  3MN2 A;  5EG0 A;  5E3O A;  1P7J A;  1RR7 A;  2IEK A;  4UUS A;  3HOX J;  3HOY J;  3S2D J;  1RKT A;  4BBR J;  2FQ4 A;  5J1R A;  2DA5 A;  3Q0W A;  1UHS A;  3TP0 A;  5EDN A;  5M5Y J;  4AUX A;  2EZH A;  1H89 C;  2COB A;  3BG3 A;  1IUF A;  4L5E A;  3GTJ J;  4A3L J;  2KT0 A;  2CJJ A;  3LNQ A;  1H8A C;  4JX4 A;  4A93 J;  5GPC A;  1TWC J;  1UG2 A;  1LFB A;  1ZKG A;  3UKG A;  3BTL A;  1MBF A;  2EZK A;  1OJL A;  2L7M P;  2LK2 A;  3QPL A;  4DYQ A;  2LY9 A;  3MKL A;  2XGE A;  1A6I A;  1HOM A;  4BBS J;  2DA6 A;  3SJM A;  3SDG A;  1XC5 A;  2E2J J;  3HGY A;  4BXX J;  3Q0U A;  2GLO A;  3PO3 J;  4V2G A;  5IOZ A;  5F0H A;  4IHV A;  1Y1V J;  1LE8 A;  1A5J A;  2YUS A; 
#chains in the Genus database with same CATH topology
 1MMA A;  3CMM A;  2B63 J;  2R92 J;  4P9U A;  2RDP A;  2OU2 A;  3LMM A;  2LD5 A;  1VQO I;  1JXS A;  2COM A;  3KP2 A;  4DBQ A;  1H0M A;  2E60 A;  2EWN A;  4BE0 A;  2A3S A;  1H9T A;  1D0X A;  2BW3 A;  2W25 A;  1L0O C;  1FSE A;  4A12 A;  1SFO J;  1P6R A;  1WI3 A;  4PJ0 C;  3WTY C;  3GTO J;  2HGC A;  2H1L A;  1XG1 A;  1SD4 A;  5IP9 J;  2JPB A;  5IOY A;  2DTR A;  4GYG A;  1D5V A;  5J1U A;  4EM0 B;  5IPA A;  1IV6 A;  3HB9 A;  3OOP A;  2JK3 A;  4EV0 A;  2IGM A;  5GTH C;  3GTQ J;  2BW3 B;  4FX0 A;  2VT2 A;  3E6B A;  1W5T A;  1ETK A;  1ZYR F;  4RBO A;  3WE3 A;  4ZTJ A;  1K7A A;  3SZG A;  3CMY A;  1WCM J;  1X2N A;  2HZT A;  1JTX A;  3JTH A;  3J81 K;  2BHZ A;  2ZO4 A;  3GTG J;  1A6Q A;  1UFM A;  1PUF B;  2RNJ A;  2KRC A;  2O0Y A;  5FFX A;  2HS5 A;  4XLA A;  3S93 A;  2LC2 A;  3GYH X;  1AKH A;  1E17 A;  1JKP C;  1T6S A;  2O7O A;  2BVL A;  2DFE A;  1Z7U A;  2E7X A;  2MD5 A;  2R7Q A;  3KEO A;  1T39 A;  4LG0 B;  2WB1 A;  5CJ9 A;  3HIF A;  2MD0 A;  2MW8 A;  2QCO A;  4X1E A;  4MGR A;  1JUM A;  2CYY A;  1G3T A;  2EIN H;  2DPU A;  1ETY A;  3W6K B;  3F23 A;  2NAZ A;  4XNF A;  3R4K A;  1S9H A;  2PMZ A;  2DMN A;  3OV8 A;  5CKT A;  2QLZ A;  4N4O B;  5JLW A;  4CCL A;  4KT5 C;  1HBX G;  4EGY A;  4RB0 A;  2IS4 A;  5M5W J;  1XPX A;  5DCM B;  4EJV A;  3OL3 A;  5DM6 F;  3K2A A;  2V6C A;  1W1W E;  1X58 A;  4FTH A;  2UXX A;  1KU7 A;  3FKI J;  2ECB A;  3F6V A;  1KU9 A;  2O8K A;  3FBN B;  1VQ9 I;  2VKH A;  3H3U A;  2OJE D;  3PIP F;  3S1R J;  2PJR B;  3K0L A;  1K78 A;  2AO9 A;  3LQR A;  5IP6 A;  4OU0 A;  1ZEL A;  2FBK A;  4W97 A;  3U1D A;  3DPL C;  4F93 B;  3OIO A;  3BR5 A;  3L09 A;  3GEZ A;  3DTI A;  3SQN A;  2NS0 A;  4B09 A;  1XTA A;  2E7W A;  2LSO A;  4BQN A;  4D9J A;  4I0B A;  2M4G A;  1MND A;  2NVX J;  2V7F A;  3CDI A;  5FRM A;  4LIV A;  4X6A J;  2ELK A;  3OR1 C;  3SEQ A;  4IPA A;  2Z2S B;  4MQV A;  4YEJ A;  2L7F P;  3F8B A;  4U0W A;  3WU0 A;  1B9M A;  5KAF C;  3G6E I;  1PDN C;  4CUG A;  3DCF A;  3A0H C;  3ZPL A;  4XOT A;  2ICW G;  2DMP A;  1PP8 F;  1C0W A;  2O61 A;  4U7B A;  5DCF A;  1MD0 A;  1GUU A;  1IGN A;  3T8T A;  3BG9 A;  1IF1 A;  1LNW A;  3I4P A;  4JBA A;  3TDU C;  3VYT B;  5J8F A;  1K4S A;  1FYL A;  2DDB A;  2XVC A;  3WTV C;  1B72 A;  2CRG A;  1A04 A;  2Q0O A;  2LY2 A;  1KU3 A;  3IL2 A;  2CFO A;  3WGG A;  2LR8 A;  2NOG A;  4ZC3 A;  3RCO A;  1VQN I;  1MBJ A;  2GAU A;  1PVE A;  3HOU J;  2FRH A;  2LDU A;  2QM3 A;  5FLV A;  4R8H A;  1GV5 A;  2M1B A;  4R1H A;  4KFC A;  9ANT A;  3UR3 C;  2PEX A;  1ZLJ A;  1G4D A;  2CGP A;  2K3P A;  4AIH A;  2WAF A;  1LKX A;  3LSI A;  4ZDP A;  3QRF F;  4XL9 A;  4ENK A;  3CD6 I;  2V79 A;  3LSR A;  2L01 A;  1PYV A;  4PK4 A;  2R3S A;  5EYR A;  4A2U A;  1VQ7 I;  1R1V A;  3ZMS A;  5JLX A;  4U7D A;  1VQL I;  2DOD A;  1JT0 A;  3BQY A;  4S04 A;  2Q2E B;  4Y15 A;  2XAQ A;  2ZXW H;  2Z99 A;  2IA0 A;  1J59 A;  1FYK A;  2QSH X;  3BR1 A;  3N97 A;  2XPW A;  1R22 A;  1YI2 I;  2OQG A;  1AHD P;  1HLV A;  3GFM A;  3VSL A;  2H6C A;  3CCQ I;  4HF1 A;  1YRN A;  4RLF A;  3W6J B;  3HKZ A;  2XGC A;  4EJT A;  3JRH A;  3JRF A;  2FSW A;  3FIW A;  3IH2 A;  2A07 F;  1PJR A;  5IT3 A;  5HS9 A;  4M3G A;  2OZU A;  2EBI A;  4S0H B;  4O3M A;  1XGO A;  2H1K A;  2LYC A;  4D1Q A;  4CA0 A;  4II3 A;  1U5T B;  1N77 A;  3BTI A;  2ISZ A;  2HXI A;  2PI0 A;  2HYJ A;  2HWV A;  3H1C A;  4CCJ A;  2VOO A;  1YYV A;  3DU6 A;  3QP6 A;  1IJW C;  3K4N A;  1IDY A;  1OR7 C;  2BY1 A;  4CCM A;  5ED4 A;  2QGU A;  4XOP A;  3DKY A;  5J4V A;  2PN6 A;  4G94 A;  1HQC A;  2IAI A;  2OZ6 A;  4XLN F;  3MKZ A;  1IV8 A;  2X9D A;  3IP4 B;  5IYB J;  2ZJQ F;  4XSX F;  1RUN A;  1HA8 A;  4HSR A;  1I1G A;  4V2F A;  1BM9 A;  3LSP A;  2V9V A;  1LEB A;  1IZ1 A;  3ASN H;  2ZNY A;  3N05 A;  4GXO A;  1V5F A;  1R5G A;  3ONQ A;  2OC6 A;  1ZN2 A;  2VAS A;  3GFJ A;  3L7W A;  1DGW Y;  1BC8 C;  3LA7 A;  4IF4 A;  5J3L A;  3J80 Z;  2KZG A;  1OYY A;  3H0D A;  2F4I A;  1G59 A;  5CVJ A;  4OIR F;  3E6M A;  3FBI B;  2CWE A;  4A5M A;  2CQK A;  4L9N A;  3PSF A;  5E18 F;  1I6H J;  1S5L C;  2Z9O A;  5GAH J;  1TNS A;  5AIQ A;  1WWX A;  2M5W A;  3L1P A;  2P7C B;  3RQI A;  3CP2 A;  2HDC A;  1QVT A;  3KPH A;  3TMO A;  2FUG 2;  2OF7 A;  5H6Q A;  1U9N A;  1I6X A;  5L3B A;  3I4N J;  3MZ8 A;  2B9S A;  1XSV A;  2L3D A;  5FKM A;  5FO5 A;  4NC8 A;  4IQ4 A;  1W5S A;  2DFH A;  4DZJ A;  2VI6 A;  3AAF A;  3E3V A;  1GXP A;  3OYM A;  2JA7 J;  3ZN0 A;  2WWY A;  3LAJ A;  2OV7 A;  3LOC A;  1RUO A;  3D5L A;  3BTJ A;  1W5C C;  1MW7 A;  2G7U A;  1BW6 A;  4EEF G;  3GFL A;  2M34 A;  2ME0 A;  2XC7 A;  2HOA A;  2DOF A;  4KN7 X;  4A6D A;  1YX3 A;  1SVM A;  4C3H J;  5B66 C;  1Y6I A;  3MQ0 A;  2CQN A;  4XMY A;  5E3N A;  2E71 A;  3ZQC A;  4A3D J;  1O3T A;  3KP4 A;  3NWS A;  1FY7 A;  3ELK A;  5HNF A;  4LG3 A;  1Z21 A;  5E20 A;  3WTT C;  4C9Y A;  4N4N B;  5LHH A;  3C2G A;  3CLO A;  1PUE E;  1B59 A;  1IN7 A;  4Z6Y A;  3W2A A;  1MBH A;  4BQA A;  5J40 A;  3K4M A;  3ZGK A;  1U9O A;  4QTR A;  1LE8 B;  3M3Y J;  1RI7 A;  1EH6 A;  4HRI A;  3FZV A;  2VL8 A;  3GZN B;  4UV8 A;  2JN6 A;  3N4M A;  5J6X A;  3AKZ A;  2DDA A;  5ILU A;  2EFN A;  1OKR A;  3G3Z A;  2XB5 A;  4HF0 A;  3PUF A;  4P1W A;  1BI1 A;  4RA2 A;  4RAZ A;  1T38 A;  5C4X J;  3A01 A;  3V8K A;  5HNH A;  3LSH A;  1BW5 A;  1WJC A;  4NQW B;  3NAU A;  3I4M J;  2JUG A;  2A6T A;  3QPS A;  2CMP A;  2UUZ A;  5IT9 K;  1MNE A;  4UVC A;  2V1N A;  2IGN A;  4AYB A;  1Z0X A;  2KFD A;  2YS9 A;  2N8G A;  1GVJ A;  2Z5U A;  3C2H A;  3ZN1 A;  2D5V A;  3LST A;  2DMT A;  2DO7 A;  4PSW A;  1JI8 A;  1QVU A;  2W48 A;  1QZY A;  3CCS I;  1T08 B;  5F64 A;  2L0K A;  3T1B A;  2HQN A;  4DZP A;  1LPQ A;  4HNV A;  2X85 A;  2VE9 A;  2HOT A;  5FRN A;  1IXS B;  1YFH A;  2WC2 A;  3O6B B;  1TQP A;  1P92 A;  1A36 A;  1MZB A;  2X0L A;  5IT9 Z;  5LGU A;  4P55 A;  2JWT A;  3FKJ A;  5CVU A;  2H8R A;  4A0X A;  1IXC A;  1WHU A;  2BZT A;  2MG4 A;  1JJ6 C;  4HPQ A;  2VPR A;  1EH8 A;  1OFC X;  4JX5 A;  5F0C A;  3SYT A;  3KYL A;  1DPR A;  2L02 A;  3P7N A;  2ZFU A;  2LVS A;  1CQT A;  2FXA A;  1KA8 A;  4A3I J;  2WV1 A;  5E3O A;  4XLP F;  1Y8Q B;  2ZKZ A;  4CYD A;  3ABU A;  3QYB A;  2Q1Z B;  2OCC H;  3MD2 A;  4MQ9 F;  2HR3 A;  2EIK H;  4KNY A;  4WXH A;  1QZZ A;  2HYF A;  3BZC A;  4G6T B;  2XKP A;  1IN4 A;  1O7L A;  3TP0 A;  2X6W A;  4S05 A;  2W7N A;  3M8F A;  1KON A;  3IKV A;  1BI3 A;  2EZH A;  2XKO A;  3FXR A;  3IUO A;  2COB A;  3HSF A;  4L5E A;  3ZMT A;  4HDU A;  1H8A C;  1T8I A;  3PJR A;  1LVK A;  1TWC J;  1SFK A;  2K85 A;  5GPC A;  5LRS A;  5JHU A;  3S2W A;  1ZKG A;  1YS6 A;  4AU7 A;  3UKG A;  2IT0 A;  4DJA A;  5CVR A;  1MBF A;  3RKY A;  4XOR A;  3QPL A;  3KEQ A;  4DYQ A;  3F22 A;  4BAY A;  1S29 A;  2MAB A;  2IW5 A;  4JQF A;  2QEX I;  2XGE A;  3NWT A;  1KZH A;  2DA6 A;  4EJU A;  2R7F A;  3FF5 A;  1WZ2 A;  3SDG A;  1XC5 A;  4HST A;  1XMX A;  2CSO A;  3WG9 A;  5IOZ A;  1NH3 A;  1N78 A;  1Y1V J;  2LBF B;  5HOO A;  3O2P E;  3VOE A;  3GTK J;  5E8I A;  2KRH A;  1B8I A;  2JTV A;  3KZZ A;  1LDJ A;  3ABL H;  3BR3 A;  3V7C A;  4CCO A;  1O57 A;  4FE7 A;  3KET A;  1AOY A;  2EFP A;  2XGX A;  3BZK A;  5LGT A;  1ZG1 A;  2K86 A;  1HW2 A;  1W0T A;  3A02 A;  2GXA A;  3F72 A;  3F9K A;  4Y52 J;  2R5Z A;  3DP7 A;  5D8K B;  2NXN B;  2WAD A;  5FKL A;  1P2F A;  1I27 A;  2DQL A;  2CQX A;  4NB5 A;  3SZP A;  3V4G A;  2HU9 A;  1P4A A;  3L9F A;  3I55 I;  3JRC A;  3PUB A;  3Q5F A;  5HLG A;  3KP3 A;  2HQA A;  4LK0 F;  3CJR B;  4KJZ A;  4LJZ F;  3QOD A;  3AL0 C;  5JHF A;  2LP0 A;  4ASN A;  1MH3 A;  5C3E J;  2CO5 A;  2GXG A;  2IA2 A;  4RGR A;  2KPM A;  3KP6 A;  1LQ1 A;  4IEJ A;  2FMY A;  4CH7 A;  2KKO A;  4YFN F;  3G73 A;  3K4L A;  5E1W A;  2E34 A;  2R7D A;  2R7U A;  4QPO A;  3I56 I;  1I50 J;  1YW7 A;  3MVP A;  5GAG J;  1IRZ A;  2FE3 A;  2L2O A;  4XSZ F;  1VF9 A;  3G1L A;  3T5X A;  3HOT A;  3IC7 A;  2KMU A;  3FHN A;  3OYJ A;  4KIF A;  3JRD A;  1GV2 A;  2G0E A;  3S1Q J;  1SD5 A;  5HLH A;  2STW A;  4FT8 A;  2VT3 A;  4CZC A;  3JSP A;  2DJI A;  2GIV A;  1J0R A;  2BGC A;  2VN2 A;  1TBX A;  1G2H A;  1ORK A;  3PFI A;  3R6S A;  3ULQ B;  1TQM A;  4BEH B;  2RAE A;  3WTZ A;  2DT5 A;  4LD5 A;  2F2E A;  2ZB9 A;  2CV0 A;  2ADU A;  2XUB A;  5C44 J;  3MZH A;  4C30 A;  3CO7 C;  4ZH4 F;  5F6F A;  1R5H A;  2HI3 A;  1UZC A;  2LMD A;  2H8W A;  4L9J A;  1WJD A;  3W2V A;  3G1O A;  1O3S A;  4XLH A;  1X2M A;  1ON2 A;  5DYM A;  5DDG A;  5LLQ A;  2EJR A;  2Y9Z A;  2ZSH B;  2L54 A;  2QSG X;  5KK1 A;  3RQ4 A;  1JKQ C;  4KIG A;  3GX4 X;  3DPT A;  1HC8 A;  2MBF A;  5D8L B;  4HQM A;  2EV0 A;  3TGN A;  1XDS A;  2DK5 A;  1IC8 A;  2P6S A;  1BA5 A;  1DQU A;  2RGV A;  3CCU I;  2ZXH A;  3VYU B;  3RKQ A;  2JA2 A;  2HNH A;  3RKX A;  3GLX A;  4IRG A;  3OL4 A;  2QA4 I;  4CCN A;  1HF0 A;  2XGD A;  3KZY A;  3JRB A;  3I64 A;  4C3I J;  3C2B A;  2QBY B;  4KIT B;  3OYC A;  2OPT A;  3M7G A;  1H9G A;  1LJ9 A;  2WA0 A;  3HTU A;  1VQ4 I;  3ZXS A;  1MNM C;  3AG2 H;  3I58 A;  2XSJ C;  4CXF A;  2NYX A;  3FWE A;  1QRY A;  3S15 J;  2A6E F;  1ULY A;  4DQ2 A;  3KEY A;  2IS6 A;  4XLE A;  1T2K A;  3DEU A;  5JVG F;  1YQA A;  2GXB A;  3VSK A;  5TRD A;  4G7H F;  2GWR A;  3PQJ A;  5F0F A;  4A3G J;  5DTD A;  2DFI A;  3DLA A;  4OOI A;  4M3E A;  4CYC B;  3P5J A;  1QHG A;  2XHK A;  4C2U A;  3GTM J;  1N75 A;  1HXD A;  5EEH A;  1V5G A;  2MGQ A;  3WU1 B;  1IO2 A;  1TNT A;  5DUK A;  1Z91 A;  3GCM A;  4QIW N;  1BIB A;  4JX6 A;  4PJM A;  1QU3 A;  3ASO H;  3BWG A;  4BY7 J;  2KL4 A;  2DA7 A;  3O3K A;  1D1A A;  3K4B A;  3CUQ C;  4ITV A;  1GVD A;  2CW0 F;  2XDV A;  2EFQ A;  2JA5 J;  2V26 A;  4HZF A;  1OPC A;  1XB4 A;  2IJL A;  2VOD A;  3M1C A;  3D5R C;  2QSF X;  3K1M A;  2DA4 A;  3MEX A;  3QWL A;  3B73 A;  1VI0 A;  3IAM 2;  4PJJ A;  4HAM A;  2QVO A;  1MJ9 A;  1PUF A;  4AM3 A;  3VPR A;  5K7F A;  5AON A;  1IUY A;  4AC0 A;  1K61 A;  3FXU A;  4RM2 A;  4BJT A;  3IH3 A;  2DBB A;  4PSX A;  1LVA A;  2NVU B;  4CZZ A;  3SEZ A;  1UAA A;  3EPZ A;  4LG0 A;  3CMA I;  2HQR A;  1WFX A;  2KIQ A;  3ERE D;  3OS1 A;  2WAQ N;  1X19 A;  2KIF A;  3ZQQ A;  3TED A;  1ERD A;  2F5F A;  2VQC A;  3HC7 A;  4LMY A;  2A68 F;  3BPX A;  2UZK A;  4IO9 F;  1QPI A;  4UY8 I;  2R7Z J;  1R4M B;  2K7L A;  2E36 A;  1FPQ A;  2JUC A;  4K2E A;  2XB0 X;  4UNO A;  2JA6 J;  1BBY A;  2X51 A;  4BAC A;  1MSE C;  3QYE A;  3C7J A;  5DCM A;  3M4O J;  1EH7 A;  3ECO A;  3V7R A;  1ZRC A;  4MLO A;  4XN0 A;  4A3F J;  3CCE I;  2HKO A;  3RPQ A;  5IYC J;  2FOW A;  2NNY A;  2ELJ A;  3J81 Z;  2PX9 A;  2PJR A;  3RYR A;  2QQA A;  4WK8 F;  4M71 A;  1Z1D A;  2X6O A;  4E7H A;  2EK5 A;  4YG2 F;  4II2 A;  4B44 A;  2D2W A;  4XRS A;  4ZDL A;  3K4K A;  2CG4 A;  3HRS A;  2FX0 A;  4LK1 F;  3BCA A;  4BUP A;  1DU0 A;  3HXL A;  1HSJ A;  3PNV A;  4WXD A;  5LBQ A;  3D5S C;  3OY9 A;  3WGI A;  1Y0U A;  1FTZ A;  2EIM H;  4M72 A;  4HNT A;  1BIA A;  1Z6T A;  2FQ3 A;  4A3C J;  3WE2 A;  4FIS A;  4HF2 A;  2Y0S A;  2F6C A;  3DLL F;  2HDD A;  3GTP J;  3W3C A;  2ETH A;  4M3F A;  4F3Q A;  1WJE A;  5GAE J;  2CW7 A;  2FU4 A;  3K4J A;  1DP7 P;  2M4K A;  4EM2 A;  4E7S A;  3CDH A;  3R60 A;  2JMW A;  4MFD A;  1YJN I;  1DUX C;  4D5F A;  2DMQ A;  3H36 A;  4XRM A;  2IVM A;  3L2V A;  3EUA A;  3GW2 A;  3HL2 A;  3VB2 A;  2P5L C;  3J7A Y;  2ZXJ A;  3HM5 A;  2ZJ2 A;  1GDT A;  1L3L A;  2MSY A;  4AIJ A;  1LFP A;  2OTJ I;  1S6L A;  3CF2 A;  4DGW B;  2LTP A;  2DYS H;  4YFX F;  2VE8 A;  5EG0 B;  1OCO H;  4XQF A;  3VFZ A;  3HHG A;  4UUS B;  3DEW A;  2O8X A;  1V55 H;  2NRA C;  4F7Z A;  3HDD A;  1IDZ A;  3H9J A;  1TQI A;  4D7N A;  1S72 I;  3OYB A;  1TW2 A;  2J5P A;  4Q5S F;  4NUB A;  1IRF A;  1WKM A;  2Z1D A;  1APL C;  4BU2 A;  2W4S A;  1T98 A;  4QLC U;  1JHH A;  4BQO A;  2DA1 A;  3CO6 C;  4BE1 A;  3MWM A;  3K2Z A;  2CUF A;  4KDP A;  5EEA A;  5E3M A;  1POG A;  4D0P A;  2FNA A;  1UHM A;  2BY0 A;  1BOA A;  2DA3 A;  5D6F A;  2STT A;  3V8J A;  3GZ5 A;  4ON0 A;  5BOX A;  2JSP A;  2Q2E A;  4IHW A;  3DTE A;  1W4M A;  5CVI A;  4RB3 C;  4HOB A;  5FJ8 J;  2QUF A;  4F55 A;  4ESJ A;  3LSG A;  5ICF A;  3TQN A;  3RPU D;  2YX4 A;  1VQP I;  3PFY A;  1IAW A;  1FOX A;  1RPW A;  3I0T A;  3HBL A;  5IY5 H;  1FX7 A;  1WJ5 A;  2RVC A;  3EUH C;  3I3L A;  3F8N A;  2ID6 A;  1S8N A;  2M7A A;  3KE2 A;  4LIU A;  4NHJ A;  1ODD A;  5KNL A;  4AWX B;  2TCT A;  4CIC A;  1D8J A;  5EGO B;  4LLN A;  2XAU A;  2F48 A;  3RKW A;  2K4B A;  5M3F J;  4EJW A;  5BS6 A;  1ONV A;  3F8F A;  4HLX A;  3WHC A;  1U5T A;  3OYA A;  2LRE A;  1FIP A;  2ECC A;  2OAZ A;  1YO5 C;  2FD5 A;  1U78 A;  5FLX K;  4E7Z A;  3PQK A;  1IRG A;  1OCC H;  5ICE A;  3AG3 H;  1J5Y A;  3COA C;  4KN4 X;  1DP3 A;  4D7M A;  1G3S A;  1OLT A;  2QF7 A;  3PIO F;  4IRH A;  1E0E A;  1TP4 A;  4G9Y A;  4HV5 A;  3KP5 A;  4B8X A;  1VFC A;  4I6Z A;  2RQQ A;  5IYD J;  5TGT A;  1YLF A;  4E7J A;  4BY1 J;  2PMZ N;  2JSC A;  3IRR A;  2R5Y B;  2VON A;  1KGS A;  3K4C A;  4HW0 A;  4HX4 A;  5E8G A;  5FKK A;  4IZZ A;  5D5V B;  2ZXI A;  4XLC A;  2QQ9 A;  5FLX Z;  3OS0 A;  2DJN A;  5GAD J;  3FMS A;  4HQE A;  4MEY F;  2JVG A;  4TV7 A;  1FTT A;  1KQ9 A;  3MKW B;  1U8B A;  2K9N A;  1V5E A;  1RC9 A;  1Z9C A;  2VBY A;  1FMV A;  4DOZ A;  5JR3 A;  5E79 C;  4L9V A;  3I59 B;  1U6G A;  4LIT A;  1TT0 A;  4B3X A;  4BJ6 C;  2Y48 A;  1TWA J;  3HOW J;  4Y17 A;  2RNG A;  4OWR B;  5EF6 A;  2LF7 A;  1CF7 B;  2DMU A;  2WV0 A;  3MN2 A;  2DPD A;  1J9I A;  2XAH A;  5L3D A;  1RR7 A;  3EET A;  4YEL A;  2G7H A;  1SAX A;  3HOX J;  1D1C A;  5K5Q A;  3HOY J;  3DBH B;  2ZJP F;  1V4R A;  5FRO A;  5J1R A;  3DQV C;  4BYY A;  1YE9 A;  2HTJ A;  3K10 A;  2F5V A;  5LFA A;  1UHS A;  4R79 A;  3JSO A;  1X1C A;  5M5Y J;  4OIQ F;  4HX8 A;  4AUX A;  3NQO A;  4RMN A;  3PL8 A;  5H6R A;  5A2Q K;  1MGT A;  3PSI A;  2LKP A;  1R1U A;  2W85 A;  2VJI A;  3G2B A;  2KT0 A;  2Z16 A;  4ZYE A;  1IN6 A;  3P9I A;  4P9F A;  3T0Y A;  3KIO A;  3ZMV A;  3KLO A;  2V9P A;  2E1C A;  4PJN A;  4L0Y B;  1SFU A;  2FML A;  3TKY A;  3FXQ A;  2IS2 A;  3MMY B;  4NBQ A;  2L7M P;  3CTA A;  1OJL A;  1LUJ B;  5CQG A;  2LY9 A;  3VYR B;  1O7F A;  2M3A A;  2O5R A;  1FSH A;  2I5U A;  1TL8 A;  4GCV A;  2E2J J;  2PFB A;  2X6X A;  3SHF A;  5J8C A;  1LE8 A;  3KYD B;  1FP2 A;  1ZH5 A;  1A5J A;  1BC7 C;  4G6D A;  4M3D A;  5JFR A;  3LAP A;  3I53 A;  3LFK A;  1HW5 A;  4U0Y A;  1IRX A;  5DD4 A;  2MC4 A;  2L9R A;  2FOK A;  2NS8 A;  3BT9 A;  5HLI A;  2K5C A;  2LRD A;  2DW4 A;  3L2U A;  4NQW A;  2W1O A;  5F04 A;  2XRN A;  3TBI A;  4HNU A;  4GO1 A;  1TTY A;  1HCR A;  2XPV A;  1FP1 D;  2KQR A;  1YS7 A;  5CPR B;  2AS5 F;  4PGG A;  3X2Q H;  3LSJ A;  2K27 A;  1D5Y A;  1QZE A;  2A5W A;  3FXL A;  1ZLK A;  1LDD A;  2VC0 A;  5CQE A;  1JGS A;  3FK6 A;  4UB8 C;  1RET A;  1F5T A;  1F36 A;  1WRJ A;  2EZL A;  3HEF A;  1XDU A;  4JK1 X;  1HKQ A;  3BJ6 A;  4N0B A;  3W2W A;  3L00 A;  1UB9 A;  3HGG A;  2O3F A;  3VYS B;  4KT6 A;  2E35 A;  3IKT A;  4YRV A;  2YU3 A;  4RAG A;  1X1A A;  1QNT A;  2OQR A;  5B5E C;  3S1M J;  4PFP A;  4B48 A;  2DQR A;  4DW6 A;  3FXK A;  3RJP A;  3LWF A;  3OYE A;  2VOP A;  3M8E A;  1W7P D;  3GXO A;  3I54 A;  1A35 A;  2DAO A;  1MMN A;  2KP6 A;  4YIF A;  4ANJ A;  3F6O A;  3L2C A;  2L9V A;  4F52 A;  5EJC A;  2ACJ A;  2O9L A;  2YX7 A;  3S3M A;  2GOX B;  4CGZ A;  3AL0 B;  1QGP A;  3CC2 I;  3HRU A;  1MDM B;  4B47 A;  1LFU P;  3QP5 A;  5ICC A;  5DS9 A;  2CUZ A;  1LDK B;  1YOV B;  3BR0 A;  4I0A A;  3CJN A;  4J00 A;  3PM1 A;  4BH9 A;  2ZJR F;  1OCT C;  2PBI A;  1W36 C;  4RLQ A;  3O8H A;  3U2R A;  4NNJ A;  4RAY A;  2D45 A;  2W84 A;  2E19 A;  1WSU A;  2IGO A;  1QQI A;  2A61 A;  3DKW A;  4A3J J;  4M6X A;  1J09 A;  1I5Z A;  3DU5 A;  4ZYH A;  1UMQ A;  2EIL H;  3BP8 A;  3GBG A;  3HTS B;  5D4S A;  1FBU A;  1ITY A;  1EJ9 A;  4CDG A;  4I98 B;  5E1Z B;  5BMZ A;  2H09 A;  2M7B A;  1BJA A;  4HA8 A;  1R23 A;  1QBJ A;  4MIM A;  1ZG3 A;  2BVM A;  4FQG A;  4P96 A;  5EEG A;  2P6T A;  3HHH A;  5HOD A;  1HKS A;  1YJW I;  3DWL E;  4MTE A;  3REO A;  4E7L A;  2HOS A;  3U9G A;  3SFI A;  4XLF A;  2L9N A;  2AQF A;  2M30 A;  1R36 A;  2VPL A;  4FX4 A;  2VQL A;  3ZMZ A;  3BJO A;  2PG4 A;  2LG4 A;  2W00 A;  1OIS A;  2HZD A;  4OAZ A;  3SZT A;  1B9N A;  2LBF A;  4MNU A;  4NDL A;  1SFE A;  3J7Y J;  1ETO A;  2P0W A;  5C4J J;  2P8T A;  4ENM A;  4KIC A;  2M45 A;  1XD7 A;  3CES A;  3S17 J;  1WPK A;  2D1H A;  1MBG A;  2W57 A;  3RSN A;  3AG4 H;  2EFW A;  2Y0M A;  2TDX A;  2YR2 A;  2GQQ A;  5D4R A;  1CGP A;  3OIP A;  3MFK A;  2C6Y A;  1MBK A;  3A0B C;  2ISY A;  4IL6 C;  2QQ8 A;  5K7Z A;  1E3P A;  3H5N A;  1IN8 A;  1FIA A;  1UEL B;  2DYR H;  1P9Q C;  3TW6 A;  3S8P A;  1E2X A;  1QHH D;  1QA6 A;  1D0Z A;  2LKX A;  1BN5 A;  1ON1 A;  3HG9 A;  1OCR H;  3Q9V A;  4UVB A;  3MZY A;  6PAX A;  1R00 A;  5KAI C;  2CS3 A;  1FBS A;  2L7K A;  4YFK F;  5D5W B;  3ABM H;  1K6O A;  4GFB A;  4HV6 A;  1MMG A;  5LHG A;  1S7A A;  4ESF A;  3CCJ I;  4HYE A;  1D0Y A;  4UUT A;  1JKR C;  3BDD A;  2IXS A;  4CCK A;  1O3Q A;  3IWF A;  3R0J A;  4U0V A;  3PO2 J;  3CUQ B;  2W24 A;  4KIB A;  5H2F C;  4B3A A;  2IRF G;  4FCY A;  2NS7 A;  3H3V K;  2EQR A;  1S7O A;  3RZD J;  3E5X A;  2XRO A;  1BR2 A;  3J7Z I;  3BR6 A;  2LY1 A;  4GRI A;  1XCV A;  2VB6 A;  4BEH A;  3AG1 H;  1V54 H;  5HDK A;  2XAJ A;  1YIO A;  4Y3O A;  3CP8 A;  4MHG A;  3VOD A;  1I3Q J;  4N9H A;  3FXM A;  4KA4 A;  4AIK A;  2BOL A;  1TWH J;  1Z3Y A;  2EIJ H;  1YX5 A;  2E5N A;  3QQA A;  4RS8 A;  5EZH A;  5F08 A;  5L3C A;  3JAM K;  3HOZ J;  3LL7 A;  2R0Q C;  1HDD C;  2R7V A;  1R4N B;  3JRE A;  3GWZ A;  3S32 A;  2ELH A;  3EQL F;  4UXN A;  3TOB A;  2EV5 A;  5DD8 A;  3A2K A;  1X4O A;  5DM7 F;  2B0L A;  3OMY A;  5K7H A;  3IWZ A;  1DPU A;  1SVL A;  1JGG A;  1DGR M;  1V3F A;  2FA5 A;  4M9Z A;  1FJL A;  4L18 B;  2KHM A;  2WAE A;  2QBY A;  2R7O A;  4NC6 A;  2ZNZ A;  3B02 A;  3WOD F;  4EM1 A;  3A1Y A;  2JRM A;  1MSF C;  4JP0 A;  2RRE A;  3HUG B;  1XGM A;  1DU6 A;  1XN7 A;  2CUE A;  4O5V A;  3JAM Z;  2CUJ A;  3D1N I;  2H94 A;  5HDN A;  1ZQ3 P;  3E1S A;  1U3E M;  3F3X A;  2NOJ B;  1VND A;  3OR2 C;  3K6G A;  3RIR A;  3DV8 A;  2ZBK A;  2ESH A;  3FM3 A;  1LEA A;  2MA3 A;  5FLM J;  1K6Y A;  2K9M A;  5FFZ A;  3CCM I;  5EZG A;  2BE5 F;  2M2E A;  3JW4 A;  1M1E B;  2E2H J;  4CYC A;  3QU6 A;  1G8X A;  2IA1 A;  1BL0 A;  5J1Y A;  4LFU A;  1YJ9 I;  5ILS A;  3TOA A;  2R7T A;  2XPU A;  5E3L A;  3CC7 I;  1EV7 A;  1ZR2 A;  1IG7 A;  4YII A;  2L7Z A;  3MKY B;  4IKF A;  1X1P A;  4OIN F;  3E6D A;  1Z3X A;  4E6K G;  3Q9S A;  2DK8 A;  1T56 A;  4GGG A;  1O4X A;  4BQQ A;  1FOW A;  1VZ0 A;  4HLY A;  2OUM A;  2XAF A;  4YIR X;  1SVO A;  1Z77 A;  2IBD A;  3ZQF A;  2F4M B;  4G12 A;  1P7I A;  4LLL A;  1NG7 A;  1W7P B;  1WGX A;  2E1N A;  3C3W A;  2HEO A;  3BPV A;  4BDY A;  1F9N A;  2HVR A;  1Y0N A;  4LB6 B;  2R7S A;  3RYP A;  1AU7 A;  4IX7 A;  3QOP A;  1SAU A;  1BJZ A;  1Z6R A;  2K3F A;  1TW3 A;  3NAR A;  4XKW A;  4MEX F;  3S3N A;  2HOE A;  1ETW A;  1KQ8 A;  2VKE A;  2YPR A;  2X6Y A;  2QKM B;  2Y9Y A;  2E1O A;  2P81 A;  3L2R A;  3BC8 A;  1HDP A;  3GVA A;  3HJE A;  3KFW X;  2AXL A;  2Z3Y A;  2PMH A;  4Y33 A;  3JR9 A;  2VKD A;  2PJP A;  4Y7N J;  1G3W A;  4I01 A;  1X3U A;  3H5R A;  3QAH A;  1KYW A;  3RTR A;  5LRR A;  5GPA A;  1B6A A;  1R1T A;  1ZG5 A;  1T0F C;  1QPM A;  2K40 A;  2JJ7 A;  3OIQ A;  4BDZ A;  4JYK A;  3HPG A;  2VKV A;  3SXY A;  3P9K A;  2JVH A;  1WH5 A;  1SAN A;  1RES A;  2ZME C;  3R61 A;  2FF4 A;  2K9Q A;  4WXC A;  3EYI A;  5L3E A;  3P9C A;  2GIZ A;  3RDI A;  1F43 A;  2BY3 A;  5L3F A;  3NEU A;  4MTD A;  1FLI A;  2QKL B;  1FC3 A;  4B1R A;  4ZJZ A;  2DTZ A;  2AQE A;  3EUH A;  1D1B A;  1W36 D;  3OOU A;  4OIP F;  2NVQ J;  5BNG A;  4ZYG A;  2ZCW A;  3H35 A;  3TW7 A;  4QWQ A;  2L5Q A;  5LD2 C;  2VQH A;  4A0Y A;  4BGD A;  2F5D A;  4ETS A;  1RKW A;  4IXA A;  4V19 K;  3S16 J;  1RR8 C;  1KQ0 A;  3U21 A;  1K4T A;  2NVY J;  2MH9 A;  3FX3 A;  2P5V A;  4M9S A;  4MFE A;  3EYY A;  4UHT A;  5AIP A;  1KYZ A;  3DEE A;  3TO9 A;  1XMA A;  2JT1 A;  4HDV A;  4MO7 A;  2LH9 A;  3B6C A;  1NK3 P;  4DBR A;  3G71 I;  4BNC A;  1X3W B;  2M0C A;  1Q1V A;  2YSR A;  2L9S A;  1AKH B;  2I8D A;  4E7I A;  1A31 A;  2DT7 B;  1OQY A;  1FYM A;  4RB1 A;  1E3O C;  1JUP A;  2Q8K A;  2CQ7 A;  4A69 C;  2HVS A;  2VBZ A;  1OR7 A;  3CC4 I;  4D5C A;  4DIQ A;  4IHY A;  2DCE A;  3FHZ A;  3ABT A;  2E1M B;  1B1B A;  1FNN A;  1ZR4 A;  2HQ5 A;  2ESN A;  5ILV A;  1W0U A;  4G6Q A;  4ZYA A;  2HDW A;  4EMS A;  2VJJ A;  2M0M A;  1VQ5 I;  1SFX A;  2W82 A;  2IPQ X;  2VXD A;  5EG0 A;  2A6H F;  1D3Y A;  2FBI A;  2IEK A;  3HOS A;  1RZ4 A;  1X3Z B;  4UUS A;  1O3R A;  4LB5 A;  2QEN A;  1FOY A;  5F1R A;  2BYV E;  2FQ4 A;  3Q0W A;  1X4P A;  2X1D A;  5EDN A;  3LQQ A;  3E5U A;  4EJO A;  1OCZ H;  2WY8 Q;  2EA2 A;  2XF5 A;  5DUI A;  1Y56 A;  3U1K A;  4G7O F;  3V7S A;  1WJB A;  1K78 B;  1UJ8 A;  2ZSI B;  4XN3 A;  3SDB A;  3GTJ J;  4A3L J;  4H0E A;  2OD5 A;  4HX7 A;  1J7K A;  1G3Y A;  2KIM A;  3CME I;  4JX4 A;  3OYH A;  1UG2 A;  1LFB A;  4OAY A;  3ABK H;  2OA4 A;  3BTL A;  3FM5 A;  3V8L A;  1JHF A;  3WTW C;  4QPQ A;  4ESB A;  5TIS C;  2ZC2 A;  2VJ4 A;  1I39 A;  3FXJ A;  3R0A A;  3DF8 A;  4I02 A;  2R4G A;  4FHT A;  3SJM A;  3LA3 A;  2GOM A;  3Q0U A;  2R7W A;  2GLO A;  5E17 F;  4V2G A;  4E7K A;  1Z05 A;  5CLS A;  4IHV A;  2KJC A;  2BBY A;  2BY2 A;  2JA8 J;  3G1M A;  4LLG F;  1R9T J;  1ZRF A;  3BZ6 A;  3H0G J;  1XS9 A;  3FMQ A;  2DN0 A;  2QYO A;  2XF6 A;  3ISP A;  4Q47 A;  1YW8 A;  1OCP A;  5EGO A;  3OYF A;  1ZGW A;  4RAF A;  3FMR A;  4G8X A;  4NC7 A;  2Y69 H;  1B72 B;  1GXQ A;  5J47 A;  2KIS A;  1XSX A;  2F4O B;  3OWT A;  5LEK A;  4CO8 A;  1ETX A;  3B6A A;  3I71 A;  4CSW A;  2XAG A;  3OSF A;  3HOV J;  5ERI A;  5HVQ C;  3ZQG A;  3C18 A;  4WCG A;  2ZFW A;  3M8J A;  2JRT A;  1YTY A;  3EUK L;  4FAS D;  2KDZ A;  1X1B A;  3DBL B;  4L9T A;  4XM3 A;  1YIJ I;  3J7A O;  2ME6 A;  2DFF A;  4RGX A;  3LA2 A;  4M3B A;  3H5A A;  2XIG A;  4M6Y A;  3M1E A;  4Z2Y A;  5ICG A;  4J19 A;  2DA2 A;  1TT5 B;  2OCE A;  1G6N A;  2V9K A;  1NK2 P;  2R5Y A;  3F8M A;  1WH7 A;  1JT6 A;  2MLK A;  4UV9 A;  5GP9 A;  3WU2 C;  2FBH A;  2WB1 N;  3ZR8 X;  2E1M C;  2DXI A;  4L0Z B;  3CCY A;  1X1D A;  2WY7 Q;  3F0C A;  1OYW A;  1USS A;  2XRL A;  3LSK A;  2VJ5 A;  4XKB A;  4Q4Z F;  3OYG A;  2FEZ A;  1WQ2 A;  2QZ8 A;  3HPH A;  3CDL A;  5BPD A;  1HST A;  3BR2 A;  5F27 A;  2Y2Z A;  2LKS A;  4IOC F;  1T33 A;  1Q1H A;  3O8G A;  4M73 A;  3I59 A;  4DYC A;  2NVT J;  3L2Q A;  1GLN A;  1Y1W J;  1YG2 A;  4A3B J;  1NHA A;  2VUM J;  4XON A;  3D0S A;  1CF7 A;  3CQZ J;  2DU9 A;  3KZI C;  1JKO C;  3RZO J;  2VIX A;  4I99 C;  2VBW A;  2KLO A;  3JTG A;  3HYI A;  4XK4 A;  4XRF A;  1YRN B;  1MMS A;  1BI0 A;  4PGH A;  3J80 K;  2V1U A;  1AWC A;  4PZJ A;  1SD6 A;  3CJQ B;  3K70 C;  1OYI A;  1ZAO A;  1UST A;  1WI9 A;  2Y0S N;  3FXO A;  3OYK A;  2MFZ A;  5B3S H;  1SMY F;  2X4H A;  4U87 A;  2DLL A;  3WTU C;  2GBY A;  1IXR C;  2CFX A;  3GUD A;  2V1D A;  3WHB A;  3IV5 A;  4BHP A;  2PLY A;  4I76 A;  3K1P A;  3QPT A;  2HXO A;  1N25 A;  4X0G A;  5E1X A;  2Y30 A;  3DPU A;  1VQ6 I;  2RV8 A;  1XMK A;  2GM4 A;  2V6E A;  3DTK A;  4RGS A;  1GHC A;  5HS8 A;  4E4H A;  2IP2 A;  2K4J A;  4PCQ A;  5HLT A;  1FWZ A;  2HKX A;  3TP3 A;  3IHU A;  2O6G E;  4U88 A;  1EA3 A;  3CZ6 A;  1SEU A;  2GA2 A;  3ECH A;  2A5Y B;  1FZP B;  1RNL A;  3H92 A;  2L4M A;  4ENN A;  2CV2 A;  4GDF A;  2YU9 J;  2EFO A;  2M9H A;  1ETV A;  1ZRD A;  3LSM A;  4AD9 A;  3CCR I;  2KRF A;  1S7E A;  1VTN C;  1S3J A;  4BKX A;  3ERM A;  3ZP5 A;  4I09 A;  1WVR A;  3A4C A;  5A2Q Z;  1UCR A;  4C2M J;  3F21 A;  2BHY A;  2K02 A;  2X48 A;  1KU2 A;  4M9X A;  4B43 A;  3DXJ F;  1YIT I;  4WX9 A;  4H4K C;  4ABZ A;  2PQ8 A;  2RQP A;  2E5Z A;  1ENH A;  2RC4 A;  4B4C A;  1EKE A;  4AVZ A;  1T95 A;  2Y31 A;  5K5R A;  4IJA A;  4O6J A;  4XKV A;  2VQG A;  1RIO H;  3TO7 A;  3K7A J;  2JPC A;  1JJ8 C;  3M07 A;  4RB2 C;  4JOM A;  4IHX A;  3RI4 A;  3E97 A;  5FB2 A;  1ZAR A;  4ZZL A;  5FGM A;  2A69 F;  3BOQ A;  1B4A A;  5L3G A;  2FJ1 A;  2Y75 A;  3KLN A;  2HTS A;  4OMZ A;  4BHB A;  3JRI A;  4AVP A;  4M6V A;  2HYG D;  3ZOB A;  2JQ7 A;  3I5U A;  2VXZ A;  3HSE A;  2M87 A;  4BXU A;  2LNB A;  2R93 J;  2LOO A;  5M5X J;  3AFH A;  2CH0 A;  4XID A;  5LHI A;  3JCU C;  5BQT A;  1NTC A;  1K83 J;  3DKX A;  2M8E A;  4I2O A;  4BL0 B;  3IH4 A;  1XGN A;  2AXT C;  1U5T C;  4XIC A;  1ZK8 A;  2OBP A;  4LOC A;  2HPM A;  2BV6 A;  3ZQI A;  5K1Y A;  4PUS A;  4IHS A;  3HKZ N;  2UXN A;  1FMW A;  1U0J A;  2EPF A;  3ML6 A;  5IP7 J;  3CCV I;  2NNN A;  4EGZ A;  1MDM A;  1VQK I;  4KYW A;  2FNP A;  2G9W A;  2IS1 A;  4KMU X;  2IGK A;  3BLY A;  3PNT A;  4ZZD A;  1R7J A;  1FOK A;  2HPI A;  3KYC B;  1XGS A;  4RM3 A;  3ZQ7 A;  4W1U A;  4DYR A;  2A05 A;  2BXZ A;  1DDN A;  2EH3 A;  2LFB A;  3E7L A;  3A01 B;  2DOE A;  1MKM A;  4IRI A;  4ZYD A;  3ZMD A;  4Y13 A;  4A3K J;  3RPU A;  2MLG A;  1BR4 A;  2L4A A;  1F1Z A;  5B1B H;  5H20 A;  3A03 A;  5JVT A;  3WTS C;  3ZRG A;  4A5N A;  1XSD A;  2D1V A;  5CYV A;  1Y39 A;  4OMY A;  1H88 C;  2BEO A;  1JUS A;  4GYI A;  5FKO A;  4XR6 A;  2R7X A;  2DT6 A;  4M74 A;  4C2T A;  1YW9 A;  3E0J B;  5KHD A;  3OYD A;  4ZTF A;  4WWC A;  1IN5 A;  2GA1 A;  1TC3 C;  2MC3 A;  4PDK A;  4PFO A;  4KUM A;  3CJT B;  3WG7 H;  2XAS A;  3EDP A;  3G4S I;  2UWM A;  3S2H J;  2LF8 A;  2H27 A;  1R49 A;  4PJL A;  1REP C;  2HFH A;  3FDY A;  5D6E A;  5BPI A;  3DBR B;  1FT9 A;  3ZQL A;  4EAT A;  1TLH B;  1AA7 A;  1TZL A;  3L2W A;  3C1D A;  4L5I A;  1U2W A;  5CVV A;  5M3M J;  3S3O A;  3ZCO A;  2PMU A;  3FK7 A;  1Z67 A;  2TRT A;  5F1J A;  3QOE A;  1MBE A;  3NRV A;  2EV6 A;  3Q3S A;  4KMF A;  3VWB A;  1ZGA A;  2VLA A;  3KX2 A;  2OTL I;  1HW1 A;  1TWG J;  5HS7 A;  1I1S A;  3MCZ A;  1E3H A;  1XX5 A;  1JTY A;  1MJB A;  2O03 A;  2UV1 A;  3QU3 A;  5HDG A;  2GZW A;  2V1X A;  5FD6 A;  3QPH A;  2MH2 A;  4CHU A;  2DI3 A;  5J4Y A;  3E5Q A;  3S1N J;  4L5J A;  4I7H A;  1JE8 A;  3OS2 A;  2QWW A;  1FBQ A;  5DEQ A;  1P4X A;  2RN7 A;  5LGN A;  3BJA A;  3W6V A;  2H6B A;  3BG5 A;  3FIS A;  4KIS A;  1MH4 A;  3BG7 A;  5FKN A;  2BXY A;  3M9A A;  2P7V B;  4A3E J;  1XCB A;  5D5X B;  4C3J J;  5LEJ A;  3BCB A;  3CUQ A;  1PP7 U;  2CU7 A;  2EB7 A;  2KIU A;  3BY6 A;  4LGW A;  4F92 B;  1RRJ A;  3ZQH A;  1GT0 C;  1FEX A;  5D5U B;  4WF2 A;  1J2X A;  3T8R A;  1TWF J;  2I10 A;  3ROU A;  2XV4 S;  3JRG A;  3GFI A;  3H9G A;  3PNY A;  2K9L A;  3JRA A;  2J5O A;  3GTL J;  3HZJ A;  1R71 A;  5GTI C;  5KVR A;  4ZDO A;  3GLL A;  3QYF A;  3UNG C;  4XBF A;  2EA4 A;  2JZY A;  2P4W A;  1ZGJ A;  4Y4R A;  2AHQ A;  4HEA 2;  4DNC A;  1HKT A;  1B8I B;  3S14 J;  2V4J C;  2KJB A;  3KCC A;  3TL4 X;  1ZRE A;  1T0F A;  3CF5 F;  2K9S A;  4AYB N;  3H3Z A;  3K70 D;  2WAQ A;  3GF2 A;  3GZ6 A;  2KDO A;  2B7E A;  2ZME A;  3BTC A;  2R5Z B;  3K9T A;  3MAJ A;  1K79 A;  4IOA F;  1ACI A;  1ZTR A;  2CV1 A;  4EVI A;  4J01 A;  2LLK A;  3IRQ A;  2M8G X;  4UVA A;  3IAS 2;  1R6R A;  1BR1 A;  4RDU A;  2Z33 A;  4A3M J;  4QSH A;  2CQQ A;  4FE4 A;  4F91 B;  5JI6 A;  2R7R A;  4XRS G;  3Q0V A;  2XSD C;  2ZME B;  1MIJ A;  2DOA A;  3HUG A;  4HG2 A;  1ZHF A;  4IVN A;  3HSR A;  1BI2 A;  1OMI A;  2E2I J;  2X1C A;  4A0Z A;  1R58 A;  3OSG A;  4HBL A;  5K5O A;  1EF4 A;  1WJF A;  5TJJ A;  2EZI A;  4IQJ A;  3V42 A;  3E6C C;  1ETQ A;  1D8K A;  4RGU A;  1YHQ I;  4A6E A;  1QO0 D;  5DV5 A;  1SMT A;  3HRT A;  2ID3 A;  4FET A;  4E70 A;  1VQ8 I;  2XF7 A;  4EQQ A;  1U8R A;  3BQZ A;  1MMD A;  4BJ5 C;  3BG6 A;  3OYL A;  2RKH A;  3TDZ C;  3K1N A;  3OYI A;  3SFZ A;  4N9I A;  2WTE A;  1WJA A;  3H9Q A;  1P7J A;  1R5I D;  4BE2 A;  4BS9 A;  1SC7 A;  2VC1 A;  5FD5 A;  3DFG A;  1I3A A;  3S2D J;  1RKT A;  3CUO A;  4BBR J;  3ESW B;  4XKC A;  2DA5 A;  1W7P A;  2F5C A;  1UHW A;  1MJA A;  3OYN A;  4UB6 C;  3GO5 A;  2X1E A;  2CW8 A;  4P5O A;  3VEP A;  3ZMU A;  4BHC A;  2QQB A;  3LFU A;  1LB2 A;  1UG0 A;  4UUV A;  1H89 C;  3TO6 A;  2MYS A;  3BRO A;  2KZV A;  3BG3 A;  1IUF A;  5B1A H;  2CJJ A;  3LNQ A;  2P5K A;  3F8C A;  4BXF A;  4A93 J;  3K69 A;  3WTX C;  1Y8R B;  4IHT A;  1P4W A;  3CLQ A;  2F5E A;  4G7Z F;  1F4K A;  1STZ A;  2EZK A;  2LK2 A;  2WBM A;  1SD7 A;  2VBX A;  1Z7L A;  3MKL A;  2HVQ A;  3WGH A;  1A6I A;  1HOM A;  4BBS J;  3HRM A;  3KP7 A;  1BOB A;  1NG6 A;  4Q48 A;  3VDX A;  1VQM I;  1J75 A;  3GME A;  4OIO F;  3I9V 2;  3HGY A;  5KCM A;  4AID A;  4BXX J;  3PO3 J;  4ENJ A;  5F0H A;  3CCL I;  1IW7 F;  2YUS A; 
#chains in the Genus database with same CATH homology
 2JA8 J;  3G1M A;  1R9T J;  2B63 J;  3H0G J;  1XS9 A;  2R92 J;  3GTK J;  4M3D A;  2DN0 A;  1B8I A;  2LD5 A;  5EGO A;  1OCP A;  3BR3 A;  1ZGW A;  2L9R A;  4FE7 A;  2NS8 A;  3BT9 A;  1B72 B;  1W0T A;  3A02 A;  1SFO J;  5F04 A;  4Y52 J;  2R5Z A;  1WI3 A;  1HCR A;  3GTO J;  5FKL A;  1ETX A;  1XG1 A;  3B6A A;  2XPV A;  5IP9 J;  5IOY A;  2CQX A;  5J1U A;  3OSF A;  3HOV J;  3LSJ A;  3JRC A;  5IPA A;  3ZQG A;  1IV6 A;  3HB9 A;  1D5Y A;  2JK3 A;  3GTQ J;  3FK6 A;  2KDZ A;  1RET A;  1ETK A;  1F36 A;  2ME6 A;  4RBO A;  3HEF A;  2EZL A;  2LP0 A;  4M3B A;  1MH3 A;  5C3E J;  4J19 A;  2DA2 A;  3CMY A;  1WCM J;  1X2N A;  3HGG A;  1NK2 P;  4IEJ A;  2R5Y A;  1JTX A;  1WH7 A;  1JT6 A;  3GTG J;  5GP9 A;  1PUF B;  2WB1 N;  1AKH A;  1I50 J;  3MVP A;  1JKP C;  3CCY A;  1IRZ A;  3F0C A;  3S1M J;  2O7O A;  2XRL A;  1VF9 A;  3G1L A;  4DW6 A;  3JRD A;  1GV2 A;  3CDL A;  2G0E A;  3S1Q J;  3BR2 A;  5F27 A;  2Y2Z A;  1T33 A;  4DYC A;  2MW8 A;  2QCO A;  3O8G A;  2O9L A;  2NVT J;  4X1E A;  1Y1W J;  1JUM A;  1G2H A;  1ORK A;  4A3B J;  2VUM J;  1ETY A;  2RAE A;  2DMN A;  3CQZ J;  1LFU P;  2ZB9 A;  1JKO C;  5JLW A;  3RZO J;  5C44 J;  5DS9 A;  1YRN B;  4XK4 A;  2HI3 A;  3BR0 A;  5M5W J;  3PM1 A;  3G1O A;  1OCT C;  1X2M A;  3K2A A;  1X58 A;  4FTH A;  2Y9Z A;  3O8H A;  3FKI J;  2ECB A;  2O8K A;  1JKQ C;  2E19 A;  2Y0S N;  3S1R J;  4A3J J;  1IC8 A;  1BA5 A;  2AO9 A;  2GBY A;  1UMQ A;  5IP6 A;  3RKQ A;  3IV5 A;  3GBG A;  3WHB A;  4I76 A;  4W97 A;  1ITY A;  3OIO A;  3BR5 A;  2HXO A;  1HF0 A;  2XGD A;  3JRB A;  4C3I J;  3C2B A;  2Y30 A;  4MIM A;  5HOD A;  2OPT A;  2GM4 A;  2NVX J;  2HOS A;  1MNM C;  4X6A J;  2ELK A;  3SFI A;  3TP3 A;  2L7F P;  1QRY A;  3S15 J;  3DCF A;  2YU9 J;  4NDL A;  2DMP A;  2M9H A;  1ETV A;  1ETO A;  1GUU A;  1IGN A;  5C4J J;  4A3G J;  3BG9 A;  5F0F A;  5DTD A;  1S7E A;  4BKX A;  4M3E A;  4CYC B;  3S17 J;  1WPK A;  3GTM J;  1B72 A;  2CRG A;  4C2M J;  1MBG A;  2MGQ A;  2X48 A;  4QIW N;  4JX6 A;  2LR8 A;  2NOG A;  4ABZ A;  1MBK A;  4BY7 J;  2DA7 A;  1MBJ A;  1ENH A;  4B4C A;  5K7Z A;  1GVD A;  3HOU J;  2Y31 A;  2JA5 J;  5FLV A;  1FIA A;  1GV5 A;  3TW6 A;  9ANT A;  3K7A J;  1JJ8 C;  2LKX A;  4IHX A;  2DA4 A;  1VI0 A;  3LSR A;  2FJ1 A;  5EYR A;  4GFB A;  3JRI A;  1PUF A;  4M6V A;  3ZOB A;  3VPR A;  5K7F A;  5JLX A;  4UUT A;  1JKR C;  2R93 J;  5M5X J;  4AC0 A;  4XID A;  1K61 A;  1JT0 A;  3BQY A;  1NTC A;  3IH3 A;  1K83 J;  3PO2 J;  3IH4 A;  4XIC A;  1ZK8 A;  4B3A A;  4LOC A;  4FCY A;  2NS7 A;  3H3V K;  2EQR A;  2WAQ N;  3RZD J;  3ZQI A;  3HKZ N;  3TED A;  3BR6 A;  5IP7 J;  3BR1 A;  2XPW A;  1AHD P;  1QPI A;  1HLV A;  2R7Z J;  1I3Q J;  1YRN A;  2XB0 X;  2JA6 J;  2XGC A;  3JRH A;  3JRF A;  1MSE C;  1TWH J;  3M4O J;  3IH2 A;  3FIW A;  4W1U A;  4DYR A;  3QQA A;  4MLO A;  4M3G A;  2EBI A;  4A3F J;  2EH3 A;  2LFB A;  3E7L A;  4S0H B;  5EZH A;  5F08 A;  5IYC J;  3A01 B;  3HOZ J;  2R0Q C;  1HDD C;  2H1K A;  3JRE A;  3BTI A;  4A3K J;  2HXI A;  2X6O A;  2HYJ A;  3A03 A;  5K7H A;  1IJW C;  1IDY A;  1JGG A;  4XRS A;  1FJL A;  1H88 C;  2IAI A;  2FX0 A;  1DU0 A;  2X9D A;  5IYB J;  1JUS A;  5FKO A;  1MSF C;  4JP0 A;  1FTZ A;  4V2F A;  1DU6 A;  3LSP A;  2CUE A;  4A3C J;  4FIS A;  3D1N I;  1ZQ3 P;  1TC3 C;  3GTP J;  1VND A;  2HDD A;  4M3F A;  5J3L A;  3S2H J;  5FLM J;  5EZG A;  2M2E A;  3ZQL A;  2JMW A;  4MFD A;  2E2H J;  4D5F A;  4CYC A;  2DMQ A;  4XRM A;  1BL0 A;  5J1Y A;  5M3M J;  2XPU A;  3HM5 A;  5E3L A;  3FK7 A;  2TRT A;  1I6H J;  5F1J A;  1MBE A;  1GDT A;  3Q3S A;  3L1P A;  2MSY A;  1ZR2 A;  3RQI A;  1TWG J;  1QVT A;  1IG7 A;  2L7Z A;  2LTP A;  2OF7 A;  1U9N A;  5EG0 B;  1JTY A;  3I4N J;  4UUS B;  1T56 A;  3DEW A;  1O4X A;  3HDD A;  5FKM A;  1IDZ A;  2IBD A;  1Z77 A;  3S1N J;  3ZQF A;  4G12 A;  1P7I A;  4D7N A;  4DZJ A;  2VI6 A;  1WGX A;  2JA7 J;  1APL C;  3LOC A;  3BTJ A;  3W6V A;  3FIS A;  3BG5 A;  1BW6 A;  4EEF G;  1AU7 A;  2DA1 A;  1BJZ A;  1MH4 A;  2M34 A;  2CUF A;  2ME0 A;  5FKN A;  5EEA A;  5E3M A;  2HOA A;  1POG A;  3NAR A;  4A3E J;  1ETW A;  2VKE A;  2DA3 A;  4C3H J;  2Y9Y A;  2E1O A;  2P81 A;  5E3N A;  4C3J J;  1HDP A;  3ZQC A;  4IHW A;  4A3D J;  3JR9 A;  2CU7 A;  5FJ8 J;  3ZQH A;  4Y7N J;  1GT0 C;  1FEX A;  3LSG A;  1TWF J;  2I10 A;  3JRG A;  5GPA A;  1MBH A;  1RPW A;  3JRA A;  2K40 A;  2JJ7 A;  3HBL A;  3GTL J;  2ID6 A;  4JYK A;  1U9O A;  2VKV A;  4QTR A;  1LE8 B;  1WH5 A;  3M3Y J;  1SAN A;  1RES A;  2TCT A;  2K9Q A;  2AHQ A;  2JN6 A;  1F43 A;  1B8I B;  3S14 J;  5EGO B;  2XB5 A;  5M3F J;  5C4X J;  4B1R A;  2K9S A;  2DTZ A;  3A01 A;  4AYB N;  3OOU A;  3WHC A;  1BW5 A;  3NAU A;  2NVQ J;  3I4M J;  3QPS A;  3BTC A;  5BNG A;  2R5Z B;  1FIP A;  2ECC A;  3TW7 A;  1ZTR A;  2FD5 A;  1U78 A;  2LLK A;  2M8G X;  1RKW A;  1Z0X A;  4RDU A;  2YS9 A;  2N8G A;  4D7M A;  4A3M J;  4QSH A;  3S16 J;  2CQQ A;  4FE4 A;  4XRS G;  2QF7 A;  2D5V A;  3Q0V A;  2DMT A;  2NVY J;  1QVU A;  2W48 A;  4MFE A;  2XSD C;  1VFC A;  2L0K A;  4I6Z A;  5IYD J;  4DZP A;  4BY1 J;  2E2I J;  2PMZ N;  4MO7 A;  4HNV A;  2R5Y B;  2HOT A;  3B6C A;  1NK3 P;  2M0C A;  1Q1V A;  3OSG A;  5FKK A;  1AKH B;  1EF4 A;  2DJN A;  1E3O C;  2EZI A;  1JUP A;  2JWT A;  1ETQ A;  2H8R A;  1FTT A;  2MG4 A;  4A69 C;  1JJ6 C;  1U8B A;  2VPR A;  2K9N A;  4D5C A;  4IHY A;  1OFC X;  4JX5 A;  5F0C A;  2ID3 A;  1ZR4 A;  3BQZ A;  1TWA J;  2HQ5 A;  1CQT A;  2LVS A;  3HOW J;  1W0U A;  5EF6 A;  4A3I J;  2WV1 A;  2DMU A;  3MN2 A;  5EG0 A;  5E3O A;  1P7J A;  1RR7 A;  2IEK A;  4UUS A;  3HOX J;  3HOY J;  3S2D J;  1RKT A;  4BBR J;  2FQ4 A;  5J1R A;  2DA5 A;  3Q0W A;  1UHS A;  3TP0 A;  5EDN A;  5M5Y J;  4AUX A;  2EZH A;  1H89 C;  2COB A;  3BG3 A;  1IUF A;  4L5E A;  3GTJ J;  4A3L J;  2KT0 A;  2CJJ A;  3LNQ A;  1H8A C;  4JX4 A;  4A93 J;  5GPC A;  1TWC J;  1UG2 A;  1LFB A;  1ZKG A;  3UKG A;  3BTL A;  1MBF A;  2EZK A;  1OJL A;  2L7M P;  2LK2 A;  3QPL A;  4DYQ A;  2LY9 A;  3MKL A;  2XGE A;  1A6I A;  1HOM A;  4BBS J;  2DA6 A;  3SJM A;  3SDG A;  1XC5 A;  2E2J J;  3HGY A;  4BXX J;  3Q0U A;  2GLO A;  3PO3 J;  4V2G A;  5IOZ A;  5F0H A;  4IHV A;  1Y1V J;  1LE8 A;  1A5J A;  2YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...