1ETYA

The crystal structure of e. coli wild-type fis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
74
Chain Sequence
VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 26
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etyA00
3BR0A 3FISA 2NOGA 1HLVA 2DA4A 2CJJA 2VI6A 2DMUA 3OSFA 2L9RA 1H89C 1IV6A 4CYCB 3HOVJ 4XRMA 3M3YJ 3S15J 4BBSJ 2MSYA 5C4JJ 1JT0A 1FTZA 4M3FA 2KT0A 1SFOJ 1P7JA 2NVXJ 2N8GA 3GTGJ 3IH2A 2L0KA 1NK2P 5FLMJ 1VFCA 5IPAA 1BW6A 3Q0UA 1RKWA 1QPIA 5HODA 1XS9A 2Y30A 4DYQA 3H3VK 3IV5A 4FE4A 2DA6A 2PMZN 4L5EA 3BR1A 4M6VA 1MH4A 1X2MA 5E3MA 1ENHA 1RR7A 2O8KA 2ZB9A 2FD5A 1JKRC 2QCOA 2LLKA 1A6IA 2HQ5A 1MBEA 2OPTA 3B6AA 3ZQGA 3BTCA 1TWAJ 3RKQA 3BQZA 5F08A 4A3DJ 2TCTA 3JRCA 2LP0A 4XIDA 2IBDA 2ID6A 4M3EA 3B6CA 2X48A 1EF4A 2R5YA 5EZHA 4B1RA 1MBJA 4IHYA 5FLVA 2OF7A 3DCFA 2H1KA 1I50J 4S0HB 4A3BJ 2XGEA 3PM1A 1D5YA 2M8GX 2EBIA 3BG3A 1XG1A 2JJ7A 1MSFC 4A69C 1OFCX 3CDLA 5EGOA 3A02A 1JKPC 2XB0X 3ZQFA 3GTPJ 5GPAA 1Y1VJ 3TP0A 3GBGA 4XRSG 4FE7A 3BTIA 1LFUP 1MBGA 3JREA 4A3CJ 2GLOA 5EEAA 2AO9A 4JP0A 3S14J 4XK4A 5IP9J 1HCRA 1IUFA 2AHQA 2DJNA 4A3FJ 2XGDA 2G0EA 3K2AA 2ME0A 3BG9A 1FJLA 3FK6A 1JUSA 3CQZJ 2B63J 5C4XJ 3Q3SA 2NVYJ 4C3IJ 4IHWA 2K9QA 1Z77A 2JA6J 2O9LA 3S16J 3RZDJ 3HGYA 3SJMA 2R5YB 5IOYA 5EF6A 4FISA 1AHDP 1HF0A 2M2EA 3NARA 4AUXA 3OOUA 3DEWA 4DYCA 1ITYA 2O7OA 4JX4A 1QVTA 2XPVA 2NS7A 1JKQC 1GDTA 3I4NJ 3HOUJ 1I6HJ 5EGOB 1WGXA 2DA1A 1GUUA 1E3OC 4MIMA 2E2HJ 3GTQJ 1O4XA 5F0CA 2HOSA 3ZOBA 2JA7J 4QIWN 2HXIA 1K83J 2LD5A 1WCMJ 2EZHA 3HBLA 5FJ8J 3RQIA 4IHVA 5M5XJ 1B8IA 1UG2A 3O8HA 5E3OA 3ZQCA 3CCYA 1G2HA 4V2FA 4MFEA 5EYRA 5M3MJ 2ECBA 5IOZA 4M3GA 3JRHA 5EZGA 3CMYA 4M3BA 3OSGA 4A3GJ 4G12A 1WI3A 1ZTRA 3BTJA 3TW6A 1RPWA 2QF7A 3UKGA 2JN6A 1ETVA 5F0HA 1UMQA 1HOMA 2EQRA 3LSGA 1JGGA 1IJWC 1SANA 4X1EA 3G1OA 1U78A 1JJ6C 1RETA 4C3HJ 5JLXA 1AU7A 2VUMJ 1TWGJ 3K7AJ 3BR6A 3LSPA 3BTLA 3BG5A 3FIWA 2DN0A 2CUEA 5GP9A 3BT9A 2ECCA 1PUFA 3A03A 1B8IB 1K61A 1B72B 3HOYJ 3HOZJ 5DTDA 1ZKGA 5M5WJ 4XICA 4FTHA 1IG7A 2WB1N 1U8BA 2CU7A 2NVQJ 5J1RA 3RZOJ 2L7FP 2R93J 1WH7A 4BBRJ 5J1YA 2E2JJ 3M4OJ 2DA7A 3JRAA 3BR5A 3BR3A 1ETYA 1FIAA 3MN2A 2ELKA 4RBOA 2Y9ZA 2FJ1A 1DU6A 3H0GJ 2IEKA 1Q1VA 2HXOA 5FKLA 1JUPA 1MBKA 4JYKA 4C2MJ 1AKHA 4EEFG 4BXXJ 2LKXA 5E3NA 1ETXA 2P81A 5IYBJ 2XSDC 3JRIA 1JKOC 4A3LJ 1HDPA 1YRNA 3L1PA 1JJ8C 3O8GA 1NTCA 5IP7J 4A3KJ 1DU0A 2DMQA 5EG0A 3JRBA 2HI3A 3IH4A 3G1LA 3JR9A 1PUFB 2YU9J 3LSRA 4W97A 4LOCA 3GTMJ 1JTXA 2R7ZJ 1TWFJ 2DMNA 5JLWA 1I3QJ 1U9OA 3GTKJ 3C2BA 5K7FA 2M9HA 3NAUA 2LTPA 2MG4A 4NDLA 3MVPA 2WV1A 1IDZA 1W0UA 2YUSA 2JA8J 3JRGA 4BKXA 1MSEC 3LSJA 1RKTA 1BW5A 3S1NJ 2HOAA 2XPWA 2FQ4A 4A3IJ 3TW7A 1MNMC 2IAIA 2DMTA 3JRDA 1AKHB 1GT0C 2XGCA 5F04A 1TC3C 1GVDA 1XC5A 3HOWJ 3SFIA 4M3DA 1F36A 1YRNB 5M5YJ 5IYCJ 2XPUA 1LE8A 5GPCA 2D5VA 4DW6A 5EG0B 1IC8A 2CUFA 2LY9A 1ZK8A 3WHBA 5F1JA 4I6ZA 3WHCA 2Y2ZA 4MLOA 4J19A 1IGNA 1B72A 1HDDC 2JMWA 1Z0XA 2CRGA 4MO7A 5C3EJ 5M3FJ 3W6VA 1POGA 5BNGA 1ZGWA 1IRZA 2K9SA 2EH3A 2FX0A 2LFBA 2VKEA 2I10A 1OCTC 1JTYA 1CQTA 2EZIA 1P7IA 5C44J 2X6OA 2NS8A 3ZQHA 3I4MJ 5E3LA 4HNVA 2KDZA 5FKNA 3F0CA 2ME6A 4A3JJ 2LR8A 4V2GA 2WAQN 2JK3A 4I76A 1MBHA 3S2DJ 1U9NA 3ZQIA 3HM5A 1LE8B 5J3LA 5F0FA 4B4CA 2H8RA 4JX5A 4D5FA 1ETQA 4W1UA 4B3AA 4UUSA 2DA2A 2GBYA 2JA5J 4DZJA 1F43A 4A3EJ 1NK3P 4AYBN 4BY1J 2RAEA 3LOCA 3S1MJ 3GTLJ 3FKIJ 1T56A 2Y9YA 1FIPA 2L7MP 2E2IJ 1APLC 2E19A 3S2HJ 1LFBA 1ETOA 4D7NA 3IH3A 2VKVA 1ETKA 5IYDJ 1TWCJ 1BA5A 1GV2A 1ZR4A 2XRLA 3E7LA 1Y1WJ 1VI0A 2COBA 1OCPA 2HYJA 2R0QC 1ORKA 3PO2J 3HOXJ 4A93J 3HB9A 2L7ZA 5IP6A 3TP3A 3FK7A 1QVUA 4Y7NJ 1VNDA 2Y31A 5F27A 2E1OA 4RDUA 3MKLA 3S1QJ 1A5JA 4UUSB 2EZLA 1X2NA 1X58A 1FTTA 1RESA 2M0CA 1MH3A 1OJLA 3BQYA 4C3JJ 1T33A 2EZKA 1GV5A 2VPRA 3QPLA 3TEDA 4GFBA 1ZQ3P 1ZR2A 4IEJA 3GTOJ 2MGQA 5K7HA 2GM4A 5FKKA 2X9DA 1R9TJ 3A01A 2DA3A 4AC0A 2Y0SN 3HGGA 3S1RJ 2HDDA 4JX6A 2DTZA 3HDDA 4BY7J 2LK2A 3PO3J 1H88C 4X6AJ 4MFDA 3HKZN 4UUTA 5J1UA 3HEFA 3LNQA 2R5ZA 1H8AC 3OIOA 5K7ZA 3BR2A 4QSHA 3S17J 2JWTA 3G1MA 1BL0A 1JUMA 1UHSA 1W0TA 1ETWA 3QPSA 5FKOA 2CQXA 2YS9A 4A3MJ 4CYCA 4DZPA 4Y52J 3SDGA 2NVTJ 2K9NA 1MBFA 2W48A 4IHXA 4DYRA 3GTJJ 1VF9A 3Q0WA 1S7EA 1TWHJ 2M34A 4QTRA 4XRSA 2ID3A 5FKMA 2K40A 2LVSA 4ABZA 1QRYA 2CQQA 5EDNA 2MW8A 3D1NI 2XB5A 4D7MA 1WPKA 1IDYA 1WH5A 2R92J 1JT6A 3A01B 2TRTA 3Q0VA 1BJZA 9ANTA 2DMPA 2HOTA 5DS9A 3JRFA 3ZQLA 3QQAA 3VPRA 2R5ZB 4FCYA 1FEXA 4D5CA 2DA5A
chains in the Genus database with same CATH superfamily
4RM3A 4RAZA 3CZ6A 4NQWA 5H6RA 3DKYA 2QSGX 5D5UB 2DMUA 4I7HA 4MQVA 5KAIC 2DK5A 2VL8A 2VKDA 2W25A 3BP8A 3ZCOA 5A2QZ 3VSLA 3IL2A 1SD4A 3HYIA 2PEXA 2BHZA 4BBSJ 2MSYA 2KT0A 3H1CA 5BPDA 1P7JA 4CICA 2NVXJ 3GTGJ 3C7JA 1D1AA 1K6YA 4ZYGA 1OISA 1QPIA 3ZGKA 2Y30A 3KYCB 1ON1A 4PJMA 4DYQA 2A5YB 1IN6A 4IRIA 1I1GA 3OY9A 4B8XA 1RR7A 4P55A 2O8KA 2R7OA 2HQNA 2K27A 5HLIA 2EJRA 3BG6A 1A6IA 2OPTA 2L9SA 1O3TA 3BTCA 1S3JA 3RKQA 5F08A 4U7DA 1KU3A 2KL4A 3SDBA 4GXOA 1F9NA 4IF4A 2HZDA 5DUIA 3B6CA 4KA4A 3OIPA 1BN5A 1EF4A 2LF7A 1F1ZA 4L0ZB 1S72I 5ILUA 3RPUA 4IX7A 4E7HA 4IHYA 2RV8A 3FXUA 4XLCA 5FLVA 2W85A 1R22A 2QKLB 3O2PE 1DGRM 4RB3C 3CLQA 5ICCA 1RC9A 2NYXA 2L54A 3FF5A 3FXMA 4LMYA 1MSFC 2L4MA 2RREA 4XORA 3A1YA 2CQ7A 3O6BB 1YLFA 5EGOA 4HSRA 1JKPC 2XB0X 1R7JA 1Y1VJ 1USSA 3BTIA 1TT5B 3FM5A 3B02A 1Z7UA 3CTAA 5LGNA 3RKXA 4RAFA 4JP0A 5L3BA 3LSIA 2HU9A 2STTA 1J7KA 2DJNA 4RAYA 2CYYA 1YW9A 2WADA 3CC4I 2IW5A 3K2AA 2VT3A 5DM6F 4KNYA 2JT1A 2K85A 2DXIA 1Y0UA 2W1OA 3CQZJ 3VYRB 3Q3SA 2NVYJ 4C3IJ 2K9QA 2YU3A 2JA6J 2O9LA 3S16J 1D3YA 2R5YB 5IOYA 1TL8A 4KN7X 3GLXA 3FHZA 3OYFA 3V4GA 1ZG1A 2M2EA 1ITYA 2O7OA 1CGPA 4JX4A 3ZXSA 2IVMA 2NS7A 4L5JA 5ILVA 1W5TA 4KMUX 2OCEA 3ASNH 2HQRA 1P6RA 3HOUJ 1EKEA 1V5EA 2XF6A 1D0XA 4A6EA 1FSHA 1SAXA 3GF2A 3R0AA 2FEZA 1E3OC 1HSTA 1SMYF 3J7AY 2JSCA 5TRDA 2ELJA 5LLQA 1XMKA 1UFMA 3GVAA 3CD6I 2HXIA 3HSFA 2PJRA 5D5WB 3RPQA 3HBLA 2I5UA 3BJOA 4AIJA 5JHUA 2HYFA 1BBYA 3HSRA 3RQIA 4CCKA 1C0WA 4IHVA 1Z3YA 1IAWA 1MDMA 2ETHA 1O3RA 1UG2A 1GXPA 2IS6A 4AIKA 3S2WA 4PCQA 3AL0C 4V2FA 5EYRA 2Z1DA 2ECBA 1WSUA 5IOZA 4BEHB 4M3GA 3JRHA 4EGZA 3OSGA 4A3GJ 2EV5A 2FQ3A 2ZJQF 5FRMA 1DP3A 1RUNA 2VJIA 2QUFA 4G7HF 2JTVA 3GZ5A 2QF7A 4E6KG 3UKGA 4C2TA 2JN6A 5F0HA 1ZGAA 3HSEA 1XDUA 1FX7A 4LLGF 4UY8I 3JAMZ 2ACJA 3ZN0A 1P2FA 2PMHA 3FMQA 1VQ6I 4UV9A 4XLHA 2X6YA 2QWWA 4OAYA 4N9HA 3V8KA 4FASD 3BG5A 3M8JA 2DN0A 4M73A 5DD4A 5TISC 3HC7A 2CQNA 3A03A 1B8IB 2JUCA 5KCMA 1OR7A 1ZKGA 1R4MB 2ZFWA 2BY2A 2E71A 4HDVA 4BE1A 4FTHA 3DEEA 2PLYA 3V7CA 1OYIA 2VC1A 1BI3A 3FBNB 2CU7A 2NVQJ 3WGIA 4ENMA 2F4OB 3RZOJ 4FQGA 3RKYA 3E0JB 2L7FP 2R93J 4PJ0C 5J1YA 3RCOA 2FOWA 3LAJA 2V7FA 3HXLA 1ETYA 4EJOA 1R71A 3SEQA 2CO5A 4TV7A 2ELKA 4D9JA 3CMMA 2HNHA 5CVVA 5K1YA 5FKLA 1Q1VA 4JYKA 2ZKZA 5CVJA 5D5VB 3PIPF 3IRQA 3H0DA 1MGTA 2MBFA 1T08B 1ETXA 4IRHA 3TO9A 5IYBJ 5D4RA 3JRIA 1HDPA 3QU3A 1VQ7I 2VASA 4L5IA 4L9NA 3CCVI 3QRFF 2DT6A 3I56I 1DU0A 1VQ9I 2DMQA 3P9IA 3JRBA 1MJBA 2H94A 3G1LA 3ISPA 1W7PD 1R1TA 4HV6A 3WTYC 4YIRX 2DPDA 5L3DA 2VONA 5IT9K 3FXJA 2F5VA 4XN3A 4LOCA 4CXFA 2HPIA 4P5OA 1JTXA 3F8CA 5CJ9A 3ERED 1VQ5I 5LRSA 5E18F 2M9HA 4L9VA 3KP3A 4HX4A 4E7KA 1KA8A 1EH6A 2IGMA 1Z6RA 2VLAA 2E1MB 1W0UA 4N4NB 2EIMH 3TMOA 1PYVA 3JRGA 4DIQA 2GQQA 3UNGC 3WG7H 4ZYDA 3S1NJ 2EB7A 2OA4A 3J80K 3TW7A 1MNMC 1AKHB 1K78B 2XGCA 3HRSA 2O3FA 1GVDA 1HC8A 3LA3A 1QHGA 4M3DA 1K79A 2K3FA 4C9YA 2XPUA 4PJJA 4ZTJA 4DW6A 3E6MA 3PNYA 2HVRA 4R79A 3WHCA 4MLOA 2ZBKA 1HDDC 2CRGA 3MQ0A 4MO7A 3W6VA 1R36A 5GAHJ 5BNGA 4KMFA 2XF7A 3AFHA 3I9V2 4BXUA 1MMDA 2IPQX 3HPHA 1P9QC 1S5LC 4HAMA 3G4SI 4Y33A 1UHMA 4WX9A 4IVNA 2M30A 5D6FA 5ERIA 1AOYA 4XKBA 1IRGA 4PJNA 2COMA 2P8TA 1JE8A 3ZQHA 4CO8A 2DPUA 4G7OF 3I4MJ 4BQOA 2XAHA 3F0CA 4QPOA 4U0WA 3DLLF 1X3WB 4ITVA 4CCJA 3X2QH 2LR8A 3D5SC 2RQQA 2IS4A 2HYGD 2V79A 2JK3A 1XSVA 1SFKA 2AXTC 1U9NA 2OC6A 2RC4A 3GZNB 2QQAA 3HM5A 1VQPI 3C18A 1EH7A 2IS1A 2M4GA 3HJEA 3LSHA 4D5FA 4I2OA 1G8XA 4B3AA 2ZNYA 2DA2A 2KHMA 4E7SA 2K5CA 2LY1A 4RLQA 3S1MJ 2P4WA 5GAGJ 3CCEI 5CKTA 1FYKA 1BIBA 2KMUA 1T38A 4KISA 3QP5A 3GO5A 3H92A 1APLC 2E19A 2M1BA 3GYHX 3BOQA 1XD7A 3DTEA 1ETKA 1WJAA 2CFXA 4Y4RA 3TOAA 4WWCA 2ZJPF 4XONA 2XRLA 3M8FA 3SXYA 3TL4X 3CO7C 1V5FA 1D8KA 2HYJA 1B59A 3F23A 3ELKA 3WU2C 4D0PA 3HOXJ 1D8JA 2Q8KA 4Z6YA 5HOOA 1KQ8A 5EEGA 1WRJA 3TP3A 1W5CC 3F3XA 3KEQA 3I53A 5J8FA 4LIUA 2GOXB 2ADUA 1UCRA 1VNDA 5F27A 2VQCA 4XRFA 3S1QJ 2PMZA 3RYPA 2EZLA 1X2NA 4OOIA 1QZZA 3CDIA 5D8KB 3DV8A 2LBFA 1T0FA 2MD0A 2VXDA 3BQYA 3FBIB 1T33A 4F52A 3RSNA 1GV5A 3QPLA 2EFOA 5LEJA 1ZR2A 4IEJA 2NNNA 3HOSA 1R1UA 2A3SA 2DCEA 4XNFA 1UB9A 2MGQA 5K7HA 2XROA 2GM4A 3HIFA 5BQTA 3FXRA 1BI1A 1HKSA 3M1CA 3CP2A 2KZVA 3DPUA 4ZZDA 2FUG2 4L9JA 3HDDA 4B09A 2F2EA 2DOAA 2P5KA 3BPXA 2WC2A 1H88C 4BU2A 3ZMTA 1I1SA 1U5TC 4RMNA 4UUTA 1H8AC 3DP7A 5DEQA 1LKXA 3P9CA 1LB2A 4YFXF 2NRAC 2LKSA 3TDZC 3LQRA 3LSTA 4LJZF 3CC7I 1RR8C 3G1MA 4AU7A 3K1PA 1W0TA 1ETWA 3LA2A 1P92A 3QPSA 5K5OA 2YS9A 4A3MJ 1RNLA 1QGPA 5CVRA 2DYRH 3KIOA 1D0YA 5HLTA 4Y52J 3QPTA 2KIMA 2WAEA 2X0LA 3SDGA 3GX4X 3TBIA 5BOXA 1B4AA 2P5LC 1W36C 1VF9A 3Q0WA 4XRSA 1XN7A 1LJ9A 4G94A 3D0SA 3BG7A 2OJED 1K4SA 1DUXC 2LVSA 1QRYA 4HBLA 2W4SA 1V54H 2RQPA 1WPKA 1IDYA 1WH5A 3Q0VA 1ZN2A 5HS8A 1M1EB 1YJNI 2E1NA 1X1DA 2HOTA 1XCBA 1WJDA 2HS5A 4CGZA 1PUEE 2R7XA 4CZCA 1TQPA 2VBXA 3JRFA 3J7ZI 2EFWA 3L09A 3LSKA 4UB6C 1TW2A 3CJRB 4D5CA 3WE2A 3C3WA 2DFFA 1HLVA 4IJAA 2HKXA 2LOOA 3IKVA 1G6NA 2M3AA 2GXGA 4PSXA 3OYIA 2VQGA 4S05A 4RGSA 4AIHA 3OSFA 2HKOA 2JZYA 2XSJC 2VJ5A 4G9YA 4M3FA 5E1XA 1I39A 3V8LA 1SFOJ 2N8GA 3IH2A 3OOPA 1NK2P 3K4LA 1F4KA 5HVQC 2O8XA 5IPAA 4AD9A 3HRUA 1RKWA 5HODA 1VQMI 1XS9A 1HKQA 4A2UA 1MZBA 4IHTA 3R6SA 4YIFA 3IV5A 3H3VK 2DA6A 2PMZN 2GAUA 3BR1A 4M6VA 1MH4A 4YELA 2VN2A 2UUZA 3CLOA 2BOLA 2LLKA 1WJCA 2HQ5A 4O5VA 4CZZA 2R7WA 1BOBA 2VJ4A 2ZSIB 3TOBA 2UXNA 3M9AA 4EATA 4BE2A 2FF4A 4M3EA 4L18B 3I58A 1B9NA 1B1BA 3GMEA 4GRIA 2MC3A 4II2A 2R5YA 5EZHA 4ZJZA 1GHCA 1YOVB 1MBJA 3H3ZA 3FXLA 3OYEA 1T98A 4OWRB 1I50J 4A3BJ 2VT2A 5H2FC 1TTYA 5DUKA 2A05A 1WJ5A 1XG1A 3CF5F 2IXSA 3GFLA 4A69C 2O0YA 5J40A 5DYMA 3K4NA 3M7GA 4CHUA 3ZQFA 1MNDA 3IRRA 1LUJB 3TP0A 3OYCA 5D8LB 1XCVA 2BVLA 3HRMA 3S14J 4B48A 4XK4A 2AHQA 3H35A 2V26A 3BZCA 4A3FJ 4XQFA 1YTYA 2RNGA 4JQFA 2HFHA 2ME0A 2JVGA 3EUHC 2B9SA 2WA0A 4E7JA 1MMNA 1LDDA 2B63J 2ZMEC 2FNAA 1MD0A 2M7AA 4HSTA 5D4SA 2HPMA 1Z77A 3G2BA 1TW3A 3N97A 1CF7B 1IRFA 3DLAA 4BEHA 4QPQA 4JBAA 1FOWA 4DJAA 3OYNA 3OOUA 3TGNA 4DYCA 1U0JA 3K4MA 2G7UA 1HW5A 2H27A 3SQNA 2XPVA 3WGHA 1IXRC 2X1CA 4IZZA 1V55H 3I4NJ 2OZUA 4DBQA 5ICGA 1OCOH 2EK5A 2VOPA 1D5VA 1WGXA 2DA1A 1GUUA 2WWYA 5LFAA 5IY5H 4KYWA 2E2HJ 2ZXWH 4CYDA 1Z9CA 4X0GA 4JK1X 2VPLA 3KPHA 4K2EA 2JA7J 4QIWN 3S8PA 5HLGA 1LVKA 1QZEA 1K83J 2R7FA 4XR6A 2LD5A 4CSWA 2XDVA 3OYDA 2STWA 1B8IA 5LEKA 2MFZA 4BQQA 3MKWB 5GAEJ 4ZTFA 3O8HA 5E3OA 1IN5A 4E7ZA 4V19K 2QZ8A 4Y17A 2GIVA 4MFEA 3MZHA 3CMYA 2BY1A 5EZGA 2DFIA 2BXYA 4LK1F 4MHGA 5FROA 3GZ6A 1WI3A 2KRHA 3BTJA 3GFJA 3PNTA 5DDGA 1S6LA 3LSGA 4CCNA 3H9GA 1VQOI 2KJCA 4X1EA 2A68F 1OPCA 1RETA 4Q47A 2QEXI 1IN8A 3GXOA 5LD2C 4GGGA 3K7AJ 3BC8A 3F8FA 4IOAF 5FD6A 1MIJA 5DM7F 4P96A 1K6OA 1KQ0A 2CUEA 2ECCA 1K61A 1IW7F 3HOYJ 3EPZA 4CDGA 4D1QA 1IG7A 4MEXF 4YG2F 1U8BA 2M5WA 2L9NA 3FKJA 5GTIC 3NWTA 3WTZA 4BBRJ 3HTSB 1TNSA 2ICWG 3AG4H 2WAQA 4JOMA 2E2JJ 4OIQF 2DA7A 3JRAA 4BJTA 4IXAA 4LG0B 4BH9A 5HDGA 2KIUA 3V8JA 3MN2A 5D5XB 2IT0A 3DBLB 2FJ1A 2X1DA 3H0GJ 2HXOA 3F8BA 1JUPA 1AKHA 1K78A 3D5RC 5J4VA 1U2WA 4BL0B 5FD5A 5E3NA 1XGNA 2P81A 3DPLC 2BBYA 4A3LJ 3L1PA 3WE3A 2XAFA 1JJ8C 1XSXA 4I01A 3I59B 1X3ZB 4HF2A 2QM3A 5LGUA 2PX9A 4XSZF 3ZPLA 3RYRA 2ZJRF 3AAFA 3LSRA 4NB5A 5F6FA 3ABTA 4WK8F 4LLNA 1FSEA 2O5RA 3S32A 1FOKA 1FMVA 1TWFJ 3OR1C 1O7FA 3JSPA 1N75A 3PUBA 1I3QJ 1OCRH 3GTKJ 4ZYHA 3C2BA 1R5ID 4GYIA 3NAUA 4NDLA 4FHTA 2OTLI 1D1CA 2W84A 4KT6A 2XAJA 5DCFA 2ZMEB 3RPUD 4UHTA 1OCCH 1ZHFA 3LSJA 2Z3YA 4HX7A 4FX4A 6PAXA 1BW5A 2HOAA 2XPWA 2FQ4A 3LQQA 3BROA 1FOXA 4CH7A 3JRDA 1TC3C 4XL9A 1ZG3A 3MZYA 3QP6A 3HUGB 2XKOA 1QPMA 2KLOA 4IHSA 1YRNB 2WBMA 5IYCJ 2DT7B 2DTRA 5IT9Z 4EJWA 3ERMA 4HW0A 5EG0B 2MC4A 3U21A 2XHKA 2V6CA 3KZIC 1ZREA 2ISZA 2Y2ZA 4J19A 4E7LA 1B72A 2Y0SA 2FBIA 1Z67A 1Z0XA 3IAM2 2HGCA 1BI0A 1POGA 1J2XA 2EH3A 2EFNA 2VKEA 2BW3B 4XN0A 2I10A 4EM1A 4GDFA 3ZMVA 3J80Z 3OYJA 1OCTC 1NG7A 3BJ6A 2A6EF 2PJPA 2Z99A 5FFZA 1Y8RB 3ECOA 3QYBA 4UV8A 3MCZA 1CQTA 2FXAA 1P7IA 5HLHA 2X6OA 3N05A 4XOTA 3OS2A 2UZKA 1U6GA 5FKNA 2DJIA 2K9MA 3K69A 2ME6A 3W6JB 3MAJA 3MZ8A 5D6EA 3PNVA 2QBYB 1TQIA 2WAQN 3MKYB 2Y75A 4ETSA 1MBHA 1USTA 4LB6B 2DDBA 4PSWA 5TJJA 3ZQIA 5B66C 2PI0A 1LE8B 5J3LA 4B4CA 1J5YA 2H8RA 2FA5A 4JX5A 2AXLA 2VODA 4LIVA 2D45A 5L3CA 4HPQA 4HQEA 3PSIA 1DPUA 1FMWA 2Q1ZB 4QWQA 5EJCA 1KZHA 3ZRGA 4E4HA 4RGRA 3C1DA 4B47A 3FZVA 4HX8A 2QYOA 3GTLJ 3ZMZA 3ASOH 5B1BH 4EM2A 3ECHA 5HNHA 1E3HA 1FIPA 2L7MP 3LL7A 3TDUC 4B44A 1SD6A 4WXCA 4HF1A 1Z6TA 3S2HJ 2IRFG 3IH3A 3DPTA 2HWVA 4IRGA 5J8CA 1ZG5A 1E3PA 3PUFA 1BA5A 2EPFA 3A0HC 3PFYA 4ZDLA 2R7DA 1ZR4A 1A31A 4XLFA 4C2UA 2COBA 1OCPA 3T1BA 2JVHA 5CLSA 2R0QC 1SVLA 3PO2J 4PDKA 1WFXA 2JRTA 4UVBA 5DCMB 3MWMA 2BV6A 3FK7A 2DLLA 1HQCA 4IOCF 3VODA 4Y7NJ 3DU6A 3HL2A 2Y31A 4RDUA 1ZLKA 3MKLA 2I8DA 1A5JA 1O57A 3HHHA 1T95A 4UUSB 3DXJF 2GOMA 1YX3A 1FTTA 3N4MA 1SMTA 2CH0A 3T5XA 3LSMA 3R61A 1JHFA 5L3GA 2FRHA 3K4BA 4ANJA 2VPRA 3RIRA 1ZQ3P 1OR7C 3S93A 4WCGA 3GTOJ 4CUGA 2DU9A 1GVJA 2CS3A 2X9DA 3KP7A 1VQ8I 1HSJA 2BZTA 2Y0SN 3S1RJ 3EETA 4FX0A 4EMSA 4JX6A 5JHFA 3OR2C 2L9VA 2Y48A 1J09A 4U87A 5CVUA 3LNQA 1S9HA 5AIQA 2Z33A 2F6CA 1A6QA 1Z1DA 3OIOA 2JUGA 2HZTA 4N4OB 3S3OA 4HDUA 2JWTA 4MEYF 5BMZA 1BL0A 3IHUA 1IV8A 1I6XA 1R58A 5AIPA 3H5RA 1X1PA 2CQXA 2LREA 3T8TA 2R7RA 1ODDA 2OZ6A 2K9NA 1MBFA 2R4GA 4E70A 5E17F 4IHXA 1TBXA 1DP7P 3NQOA 3H5NA 1TWHJ 2G7HA 1XB4A 4QTRA 2XAUA 4HF0A 3WG9A 2EFQA 2GIZA 2CQQA 3D1NI 4D7MA 3A01B 2HDWA 1SFEA 2HVQA 2DMPA 2Q0OA 1NH3A 3L2RA 4RGXA 3AL0B 2FMYA 5DS9A 1L3LA 1E17A 2KIQA 3ZQLA 3FWEA 3QQAA 4PGHA 3VPRA 2IS2A 4ZZLA 2DA5A 4A5MA 2IA2A 2V1NA 5LHGA 2NOGA 1LPQA 1TQMA 2CJJA 2L7KA 2VI6A 2P7VB 2L9RA 1B6AA 1SD7A 2L3DA 2QSHX 4B43A 2Y69H 4BGDA 2L2OA 4OU0A 1JT0A 2VIXA 3H5AA 4I98B 2GWRA 3RJPA 1SAUA 2ISYA 4YIIA 5ICFA 1JI8A 3A0BC 3IC7A 3WTVC 1VFCA 1MMGA 4BQAA 5J47A 3Q0UA 5LHHA 2FSWA 4AVPA 4HNTA 3KE2A 3DWLE 4L5EA 4BQNA 1FZPB 2DT5A 1X2MA 5E3MA 1ENHA 5JVTA 1WI9A 4L0YB 2FD5A 4UVAA 1R1VA 2QCOA 1JKRC 1BOAA 3ZQGA 3F22A 1KU2A 1LDJA 5J6XA 1BIAA 3LAPA 4EM0B 4YFNF 1MDMB 2GXAA 1A04A 1TWAJ 4U0YA 3BQZA 5FLXK 1KU7A 1S8NA 1ZLJA 2TCTA 3JRCA 2VXZA 3E6DA 4XIDA 4Y3OA 2BEOA 1CF7A 4GYGA 3FDYA 2CWEA 1TP4A 3K4KA 4XM3A 3ROUA 2OF7A 1FP2A 2H1KA 1SVOA 2XGEA 3PM1A 4PK4A 1D5YA 2A61A 2DDAA 2EBIA 1EJ9A 4ZDPA 3DBRB 2M8EA 4LG3A 1YHQI 3A02A 2D1HA 2X1EA 3GBGA 3HOTA 4UUVA 3PSFA 2QQ9A 2XAQA 1YX5A 1LFUP 1FOYA 1MBGA 2A5WA 1IN7A 3AG1H 4F3QA 3JREA 1W7PB 1X1AA 1BC7C 1DQUA 3CCJI 1XPXA 3P7NA 4GO1A 1IRXA 4ASNA 1E0EA 4IQ4A 4PFPA 3K1NA 3BG9A 1FJLA 2D1VA 3BZ6A 4BS9A 2ZSHB 5FFXA 1JUSA 4IHWA 1ZARA 2HQAA 1WJEA 3RZDJ 1Z7LA 3HGYA 4I02A 2MD5A 3SJMA 1X19A 4FISA 3J81Z 2LY2A 1MMSA 3NARA 1U3EM 2KFDA 3DEWA 3KX2A 2RDPA 2KP6A 1JKQC 1FNNA 1WJBA 3I4PA 1Y6IA 1MJAA 1P4AA 3DTIA 1I6HJ 3H9QA 4BE0A 5CVIA 4P9UA 4YEJA 1OCZH 3L2CA 1EA3A 3RQ4A 2L02A 2Q2EB 1YW8A 2VOOA 3GTQJ 1O4XA 3K2ZA 5F0CA 2J5OA 2YR2A 4IL6C 2MLGA 4G6TB 1WCMJ 2W7NA 1QU3A 2EZHA 1XTAA 1ZELA 4XMYA 1YJ9I 4EJTA 2MYSA 1R5HA 5M5XJ 3PFIA 4PFOA 4MNUA 3WTXC 4UNOA 2IGNA 2MA3A 1SC7A 2CGPA 1KYZA 2C6YA 1KU9A 1YFHA 1IXCA 1G2HA 1FT9A 1KYWA 3QWLA 5M3MJ 2Z16A 1PJRA 3U1KA 2LKPA 4XSXF 4BDYA 2PBIA 2OU2A 3V7RA 3CCMI 3W2WA 3CCUI 2X85A 4KDPA 1BI2A 4GCVA 1Y56A 1VQKI 1ZTRA 3SZTA 3PQJA 4LG0A 3TW6A 3OIQA 3CMAI 3CP8A 1OYYA 1UMQA 4ESJA 2EQRA 4MQ9F 3ULQB 4WF2A 1IJWC 2VBYA 3MD2A 3I54A 2HEOA 4EV0A 2MLKA 4R8HA 3DKWA 3G1OA 4C3HJ 3F6OA 2JPCA 5JLXA 2FU4A 1AU7A 1QO0D 3I71A 3VYSB 3K4CA 2DO7A 3I59A 4BJ5C 3BR6A 2AQFA 3VFZA 2XGXA 3GCMA 2DBBA 4XKCA 3BTLA 1N25A 4Q5SF 2FE3A 2RNJA 4N9IA 3BT9A 2DOFA 3DQVC 3GW2A 3OS1A 3HOZJ 2VB6A 5DTDA 3EUAA 4EJVA 4M6XA 4G7ZF 4XICA 1VQNI 3GEZA 3OYHA 2KQRA 1R00A 2OCCH 3W3CA 2H1LA 4DGWB 2CW7A 5AONA 3HRTA 3E6BA 2MH2A 4KJZA 2QSFX 2UXXA 3BJAA 1DGWY 2W24A 5GADJ 1WH7A 3NWSA 2OAZA 3F6VA 3KZYA 3M4OJ 2EA4A 4DOZA 3G6EI 3SZGA 3BR3A 1F5TA 1G3WA 2K9LA 2ZMEA 1S7AA 1FIAA 2CFOA 3Q5FA 2DFEA 4RBOA 4XLEA 4BHCA 2Y9ZA 1VQLI 3J81K 2IA0A 1MBKA 4C2MJ 4EEFG 2CG4A 5CPRB 4BXXJ 3OV8A 3HUGA 1JKOC 1Z05A 1KGSA 1YRNA 1ZAOA 3HZJA 3O8GA 5HNFA 1NTCA 2VQLA 3CCSI 4OMYA 2AQEA 2XRNA 3K9TA 5EG0A 2A6HF 1HW1A 2H8WA 1FY7A 3K70C 2WY7Q 3KEOA 3K70D 1G3SA 1PUFB 5CYVA 2JA2A 2KISA 2KRCA 4HA8A 3LMMA 2M7BA 3F9KA 4W97A 3MEXA 2X6WA 5E79C 3GTMJ 2BW3A 1GLNA 2E5NA 1IUYA 2R7ZJ 2KPMA 3IUOA 1U9OA 2A69F 4O3MA 2MG4A 2LTPA 3LFUA 3WODF 3ZQQA 1ERDA 3KZZA 2OUMA 3I0TA 4OIRF 1IDZA 3ZMUA 3WTWC 1LEBA 1U5TB 3CJNA 4BKXA 1ONVA 1QNTA 3ML6A 5KVRA 3L00A 3CUQC 3KFWX 4PZJA 2L01A 4A3IJ 3IP4B 2VKHA 3ZR8X 5F04A 2F5DA 1E2XA 3U9GA 3TO7A 2ZNZA 2ZJ2A 3ZQ7A 1XC5A 3HOWJ 1L0OC 1ACIA 2ZXJA 2PFBA 5TGTA 1LDKB 2CQKA 4M72A 1LE8A 5GPCA 2E5ZA 4NUBA 1LNWA 1IC8A 1Y39A 1HW2A 2LY9A 3K0LA 5F1JA 1D0ZA 4I6ZA 1RUOA 2JMWA 2XASA 1HA8A 1T39A 2E7WA 2K9SA 4HLXA 3CCRI 4CCOA 2WTEA 4OMZA 2B0LA 2Z5UA 1BM9A 3HKZA 1XGSA 4M71A 3E6CC 2HDCA 2EA2A 1ZRFA 2ZFUA 2E1CA 1JTYA 3OYGA 3CUOA 4BYYA 2EINH 4YFKF 2O6GE 2EZIA 5JI6A 1G59A 3VYUB 2NS8A 5KHDA 2VE9A 4P9FA 4UXNA 3OYKA 4HNVA 2K86A 1DDNA 2KDZA 2K3PA 3S3NA 4II3A 5DCMA 3PJRA 2AS5F 4BNCA 3R4KA 3CJQB 1ON2A 3G71I 1RIOH 4I76A 4UB8C 3VYTB 5F1RA 1EV7A 3GLLA 2CSOA 2KRFA 1W5SA 5F0FA 2E60A 3IKTA 3BZKA 1P4WA 3AG2H 2E35A 4W1UA 2OQGA 4I09A 2IJLA 1ZRCA 4UUSA 3L2VA 1V5GA 2DYSH 3E97A 3VOEA 1SEUA 1ZGJA 1NK3P 1XDSA 4LB5A 2RAEA 1I3AA 3LOCA 2GA2A 2GA1A 3FKIJ 1LVAA 1T56A 2Y9YA 4KIBA 1K7AA 2RN7A 3FMRA 2E2IJ 2V4JC 4XKVA 1PP7U 1AWCA 4OIPF 1ETOA 3HHGA 2LRDA 2QQ8A 2XAGA 3CESA 3TQNA 5BS6A 4R1HA 4LGWA 1TNTA 3IAS2 5IYDJ 3KP2A 2HOEA 3RDIA 1H9TA 2LMDA 3E7LA 4QLCU 4Y15A 1YW7A 3QAHA 4LK0F 3OYMA 2EWNA 3MMYB 2CUZA 4EVIA 4A93J 2L7ZA 5IP6A 3A2KA 3UR3C 3VEPA 1QVUA 1TT0A 1OLTA 2YSRA 3CCQI 4CCLA 2VC0A 3BCAA 1W1WE 4Q48A 3QOPA 2L4AA 4DBRA 2XC7A 2QLZA 1KQ9A 1U8RA 1WHUA 1OMIA 2M0CA 1YIOA 1WQ2A 3KP5A 1MH3A 1OJLA 4L9TA 5LRRA 2OBPA 4RGUA 1T6SA 3TEDA 2CW0F 2NAZA 4GFBA 2VQHA 3LWFA 2FBKA 2MABA 3E1SA 5FKKA 4ESFA 3RTRA 4NNJA 2K4JA 3QODA 2G9WA 5CQEA 4XBFA 4BACA 2F48A 2DI3A 2DA3A 3SHFA 3A01A 4AC0A 1XGMA 4IO9F 3BWGA 1RI7A 5KAFC 2HDDA 3M07A 2LK2A 3PO3J 4X6AJ 2E1MC 1SFUA 1W4MA 3GFIA 4BXFA 3HKZN 3KCCA 1YQAA 3HEFA 2R7TA 3E5QA 2B7EA 1UJ8A 4Y13A 1KONA 4I99C 3M8EA 5FKOA 5B5EC 1SFXA 4RA2A 3A4CA 3CUQB 1IN4A 2V1XA 1PP8F 3VSKA 2NVTJ 1QBJA 2BHYA 5CQGA 3FM3A 4A5NA 1VTNC 3KLNA 4RB1A 4DYRA 1A36A 3GTJJ 2V9KA 1X3UA 2IA1A 4FETA 2ID3A 5HDKA 2TDXA 5FKMA 1MKMA 3OMYA 2YX7A 5H20A 5A2QK 4AIDA 5FGMA 4ABZA 2NVUB 1YS7A 2F4IA 5EDNA 2MW8A 3WTUC 3T0YA 1OQYA 3ZMSA 3SEZA 2ZXIA 1FPQA 3OWTA 2QA4I 2ZC2A 3ZP5A 4G6DA 1Y0NA 2PMUA 4DQ2A 3JTHA 2DW4A 3H9JA 2R5ZB 1T8IA 4KN4X 4FCYA 4ON0A 4EJUA 3BR0A 3FISA 5BPIA 2H6CA 4HQMA 4HRIA 2DA4A 3Q9SA 5EEHA 1YITI 2R7SA 4XLPF 1X1BA 1UZCA 1H89C 1IV6A 2QVOA 4CYCB 3HOVJ 3EUKL 4C30A 4XRMA 2GXBA 1WZ2A 3M3YJ 3S15J 4BJ6C 5JR3A 3PQKA 5C4JJ 2DOEA 1FTZA 2CV1A 3K6GA 4U7BA 5GTHC 3L9FA 2KKOA 2L0KA 5H6QA 2OD5A 5FLMJ 2P7CB 1BW6A 2CUJA 3CMEI 3G73A 3BLYA 3KP6A 4FE4A 2DAOA 1W7PA 1MNEA 3G3ZA 4MGRA 2ESNA 1BR2A 3IWFA 2PG4A 3ABMH 4CA0A 2ZB9A 3FXOA 3OL4A 5FB2A 4M9XA 2V1UA 3EQLF 2XV4S 1MBEA 3B6AA 1G3YA 5JVGF 2NNYA 4LLLA 4A3DJ 3DBHB 4A0YA 2LP0A 4M74A 2IBDA 2ID6A 2F5FA 2Z2SB 4AWXB 2EFPA 4WXHA 2X48A 4NC6A 3C2HA 4B1RA 4NQWB 4KITB 1XMAA 3E5XA 2OQRA 3DCFA 1STZA 3F72A 4S0HB 4O6JA 1RZ4A 4PGGA 2M8GX 3BG3A 1V4RA 2JJ7A 1NG6A 2LC2A 1OFCX 2NOJB 3CDLA 3MKZA 2DK8A 3ZMDA 3VDXA 3GTPJ 2LYCA 5GPAA 2PN6A 3EDPA 2Q2EA 4XRSG 1AA7A 1OKRA 3FMSA 4FE7A 5E8GA 4B3XA 1N78A 2EV0A 1LFPA 3EYIA 5FLXZ 2WB1A 1B9MA 4PJLA 4A3CJ 3WTSC 2GLOA 5EEAA 2AO9A 5IP9J 4AM3A 1HCRA 1IUFA 1SVMA 1YIJI 5HDNA 4LD5A 4PUSA 3GUDA 2XGDA 2G0EA 3CO6C 2XKPA 2P6TA 3OYLA 4RS8A 1YI2I 3J7AO 3FK6A 3AKZA 5C4XJ 2BXZA 1TLHB 3COAC 4KT5C 5J4YA 1MMAA 1LEAA 2A07F 1X4OA 2OV7A 2EILH 5EF6A 1NHAA 1AHDP 1HF0A 1MJ9A 5KK1A 4AUXA 1QVTA 2IGKA 3NEUA 3RI4A 2NXNB 3C2GA 1GDTA 2HTJA 3CCLI 4F92B 4H0EA 4I0BA 2RVCA 1HBXG 1PDNC 3FHNA 3KP4A 2DQRA 2CV0A 2JSPA 5EGOB 3L2QA 4XLAA 4MIMA 3V7SA 2V9VA 3REOA 4KIFA 1SD5A 2HOSA 1FC3A 3ZOBA 3K1MA 3R60A 1REPC 1XGOA 1QHHD 2KIFA 2K02A 3H36A 3O3KA 4EGYA 1OYWA 3ABKH 5FJ8J 3JAMK 4U0VA 3S3MA 3BPVA 2XF5A 1UAAA 4YRVA 4ENKA 1YE9A 2M45A 1FBQA 3ZN1A 3OYAA 1FWZA 3ZQCA 4XOPA 2Z9OA 1WWXA 3CCYA 2IP2A 5DD8A 2XVCA 5IT3A 1R4NB 4LITA 4MTDA 4M3BA 1WJFA 1O7LA 1S7OA 5L3FA 1QQIA 2ZXHA 3E3VA 4G12A 1YJWI 3QYFA 1IF1A 3WGGA 1YYVA 2A6TA 1FBSA 1RPWA 4IKFA 3HTUA 3M1EA 1ETVA 1HOMA 2LF8A 3P9KA 5FO5A 1JGGA 4M6YA 1SANA 3CDHA 1U78A 1JJ6C 2EIJH 4WXDA 2QENA 4KFCA 3KLOA 1R49A 4G8XA 4HEA2 2VUMJ 4BHPA 2DQLA 3TKYA 1TWGJ 4ZYEA 3W6KB 3KETA 3LSPA 2PJRB 2E7XA 3F21A 3OL3A 3KYLA 1ZH5A 2HVSA 2FOKA 3CF2A 3HG9A 3EYYA 3FIWA 5HS7A 3GWZA 5GP9A 1PUFA 1R5GA 3J7YJ 1B72B 4ENJA 5M5WJ 2KJBA 3T8RA 2E34A 4F93B 2WB1N 5B3SH 2V9PA 1UG0A 5JFRA 3P5JA 5E1WA 2WAFA 5J1RA 1G4DA 2R7UA 2J5PA 1DPRA 2DFHA 5KNLA 3BR5A 1TZLA 1FYLA 5E8IA 1U5TA 2M4KA 1O3SA 2PQ8A 3K4JA 1PVEA 2JRMA 1DU6A 2IEKA 2VE8A 5E1ZB 2M0MA 4ENNA 2CW8A 4AYBA 2LKXA 3QOEA 2XSDC 4ESBA 1ZRDA 1X1CA 4FT8A 2WY8Q 2OTJI 1WKMA 3SFZA 2ZO4A 5IP7J 2X6XA 2WV0A 4A3KJ 3GFMA 2HI3A 3IH4A 3JR9A 3HPGA 4J01A 1A35A 2YU9J 4HG2A 2K7LA 1LQ1A 3WU0A 2BY0A 5ICEA 5JLWA 2DMNA 1YG2A 3JW4A 2NS0A 5E20A 1Y8QB 1O3QA 5K7FA 3DFGA 3MVPA 1XMXA 2WV1A 2CMPA 2ZCWA 4KICA 5ED4A 4A6DA 2YUSA 4RM2A 5K5QA 4OIOF 2JA8J 1MSEC 4RAGA 3FXKA 1RKTA 2MH9A 3V42A 2RKHA 4OINF 1VZ0A 4ZDOA 2IAIA 2DMTA 2EV6A 4J00A 1GT0C 2V6EA 1J0RA 5LBQA 1UHWA 3SFIA 1J59A 3SYTA 1F36A 1T0FC 5M5YJ 4BAYA 4A0ZA 3KYDB 2D5VA 1G3TA 4G6QA 1I27A 3MFKA 4EQQA 5B1AH 2LNBA 2CUFA 4HZFA 3DU5A 3LA7A 3U2RA 1ZK8A 3WHBA 5ILSA 3FX3A 1IGNA 4Q4ZF 3VB2A 4HLYA 1W36D 5C3EJ 1FP1D 5M3FJ 2VJJA 1ZGWA 3DKXA 1HXDA 1XSDA 3JTGA 1IRZA 2R7QA 2YPRA 2LG4A 3F8NA 4NC8A 4UVCA 1RRJA 2FX0A 2LFBA 1R23A 2UWMA 2DODA 1Z91A 2W57A 2X51A 1EH8A 1Q1HA 2FMLA 3F8MA 4KIGA 1YS6A 5LHIA 2VBWA 4U88A 3I3LA 2QGUA 5C44J 3L2WA 3ABLH 4P1WA 1R6RA 3PIOF 5E3LA 2H6BA 2YX4A 3BCBA 2ELHA 4F7ZA 2IGOA 2W00A 4A3JJ 2JPBA 4DNCA 4RLFA 2V1DA 2BYVE 4V2GA 4AVZA 1N77A 3S2DJ 3D5LA 4BUPA 4S04A 2QQBA 2R7VA 4HV5A 1ETQA 3QPHA 2GBYA 4LFUA 2BVMA 4DZJA 2JA5J 2UV1A 1Z3XA 1F43A 1YO5C 2R3SA 4A3EJ 3W2AA 4AYBN 4BY1J 3VWBA 4CCMA 2H09A 1J9IA 1ULYA 3BDDA 2Y0MA 2F4MB 3I64A 3ABUA 3CJTB 1JXSA 2FBHA 4ZYAA 1LFBA 3U1DA 3ONQA 5LGTA 4D7NA 3OYBA 2LSOA 3PL8A 3WU1B 3JSOA 2VKVA 3EUHA 4OAZA 3IWZA 3SZPA 1IXSB 1H0MA 4RB2C 1TWCJ 3E5UA 4KUMA 1GV2A 5F64A 3DEUA 1Y1WJ 1VI0A 1VQ4I 3QYEA 4BDZA 1ORKA 1XX5A 2LH9A 3R0JA 3QU6A 3HB9A 2BGCA 3AG3H 1MW7A 3BY6A 4I0AA 1D1BA 4NBQA 4HYEA 2GZWA 1GXQA 4NC7A 1X4PA 2ESHA 4M9ZA 2E1OA 3CUQA 1UELB 2XIGA 3I55I 3B73A 3TO6A 1X58A 1RESA 2D2WA 1QZYA 1JHHA 2EIKH 3H3UA 4HNUA 1QA6A 4C3JJ 3JCUC 2EZKA 3K10A 1I5ZA 2HTSA 2CV2A 4A0XA 4XKWA 4M9SA 4F55A 1BR4A 1FYMA 4RB0A 4IQJA 3CC2I 1R9TJ 3OS0A 1K4TA 2E36A 3HGGA 4HOBA 3DTKA 3LFKA 5K5RA 3L2UA 3DF8A 4NHJA 2DTZA 3L7WA 4BY7J 2O61A 4MTEA 4MFDA 2F5EA 2JQ7A 5J1UA 1S29A 2R5ZA 2KDOA 5K7ZA 4Z2YA 4N0BA 1FLIA 2QBYA 3BR2A 2L5QA 4QSHA 3S17J 3KEYA 2LDUA 1JUMA 1UHSA 2BY3A 1BR1A 2BE5F 4F91B 5FRNA 4ZC3A 4DZPA 4CYCA 1T2KA 2FNPA 3RKWA 1ZYRF 1J75A 5HS9A 4XLNF 3WTTC 2W82A 2RGVA 2VBZA 4ZH4F 1H9GA 2F5CA 2W48A 3Q9VA 4H4KC 3NRVA 2M87A 2XUBA 4A12A 2LBFB 1S7EA 2M34A 4E7IA 1JGSA 2QKMB 1WVRA 3I5UA 4BHBA 2KZGA 2K40A 4IPAA 1V3FA 5DV5A 2K4BA 2HR3A 3W2VA 2X4HA 2XB5A 2R92J 3FXQA 1JT6A 1HKTA 2TRTA 1BC8C 1BJZA 3ESWB 9ANTA 2P5VA 1Z21A 1P4XA 2P6SA 5L3EA 2P0WA 2O03A 1FBUA 1IO2A 1IZ1A 1FEXA 1BJAA
chains in the Genus database with same CATH topology
3BR0A 3FISA 2NOGA 1HLVA 2DA4A 2CJJA 2VI6A 2DMUA 3OSFA 2L9RA 1H89C 1IV6A 4CYCB 3HOVJ 4XRMA 3M3YJ 3S15J 4BBSJ 2MSYA 5C4JJ 1JT0A 1FTZA 4M3FA 2KT0A 1SFOJ 1P7JA 2NVXJ 2N8GA 3GTGJ 3IH2A 2L0KA 1NK2P 5FLMJ 1VFCA 5IPAA 1BW6A 3Q0UA 1RKWA 1QPIA 5HODA 1XS9A 2Y30A 4DYQA 3H3VK 3IV5A 4FE4A 2DA6A 2PMZN 4L5EA 3BR1A 4M6VA 1MH4A 1X2MA 5E3MA 1ENHA 1RR7A 2O8KA 2ZB9A 2FD5A 1JKRC 2QCOA 2LLKA 1A6IA 2HQ5A 1MBEA 2OPTA 3B6AA 3ZQGA 3BTCA 1TWAJ 3RKQA 3BQZA 5F08A 4A3DJ 2TCTA 3JRCA 2LP0A 4XIDA 2IBDA 2ID6A 4M3EA 3B6CA 2X48A 1EF4A 2R5YA 5EZHA 4B1RA 1MBJA 4IHYA 5FLVA 2OF7A 3DCFA 2H1KA 1I50J 4S0HB 4A3BJ 2XGEA 3PM1A 1D5YA 2M8GX 2EBIA 3BG3A 1XG1A 2JJ7A 1MSFC 4A69C 1OFCX 3CDLA 5EGOA 3A02A 1JKPC 2XB0X 3ZQFA 3GTPJ 5GPAA 1Y1VJ 3TP0A 3GBGA 4XRSG 4FE7A 3BTIA 1LFUP 1MBGA 3JREA 4A3CJ 2GLOA 5EEAA 2AO9A 4JP0A 3S14J 4XK4A 5IP9J 1HCRA 1IUFA 2AHQA 2DJNA 4A3FJ 2XGDA 2G0EA 3K2AA 2ME0A 3BG9A 1FJLA 3FK6A 1JUSA 3CQZJ 2B63J 5C4XJ 3Q3SA 2NVYJ 4C3IJ 4IHWA 2K9QA 1Z77A 2JA6J 2O9LA 3S16J 3RZDJ 3HGYA 3SJMA 2R5YB 5IOYA 5EF6A 4FISA 1AHDP 1HF0A 2M2EA 3NARA 4AUXA 3OOUA 3DEWA 4DYCA 1ITYA 2O7OA 4JX4A 1QVTA 2XPVA 2NS7A 1JKQC 1GDTA 3I4NJ 3HOUJ 1I6HJ 5EGOB 1WGXA 2DA1A 1GUUA 1E3OC 4MIMA 2E2HJ 3GTQJ 1O4XA 5F0CA 2HOSA 3ZOBA 2JA7J 4QIWN 2HXIA 1K83J 2LD5A 1WCMJ 2EZHA 3HBLA 5FJ8J 3RQIA 4IHVA 5M5XJ 1B8IA 1UG2A 3O8HA 5E3OA 3ZQCA 3CCYA 1G2HA 4V2FA 4MFEA 5EYRA 5M3MJ 2ECBA 5IOZA 4M3GA 3JRHA 5EZGA 3CMYA 4M3BA 3OSGA 4A3GJ 4G12A 1WI3A 1ZTRA 3BTJA 3TW6A 1RPWA 2QF7A 3UKGA 2JN6A 1ETVA 5F0HA 1UMQA 1HOMA 2EQRA 3LSGA 1JGGA 1IJWC 1SANA 4X1EA 3G1OA 1U78A 1JJ6C 1RETA 4C3HJ 5JLXA 1AU7A 2VUMJ 1TWGJ 3K7AJ 3BR6A 3LSPA 3BTLA 3BG5A 3FIWA 2DN0A 2CUEA 5GP9A 3BT9A 2ECCA 1PUFA 3A03A 1B8IB 1K61A 1B72B 3HOYJ 3HOZJ 5DTDA 1ZKGA 5M5WJ 4XICA 4FTHA 1IG7A 2WB1N 1U8BA 2CU7A 2NVQJ 5J1RA 3RZOJ 2L7FP 2R93J 1WH7A 4BBRJ 5J1YA 2E2JJ 3M4OJ 2DA7A 3JRAA 3BR5A 3BR3A 1ETYA 1FIAA 3MN2A 2ELKA 4RBOA 2Y9ZA 2FJ1A 1DU6A 3H0GJ 2IEKA 1Q1VA 2HXOA 5FKLA 1JUPA 1MBKA 4JYKA 4C2MJ 1AKHA 4EEFG 4BXXJ 2LKXA 5E3NA 1ETXA 2P81A 5IYBJ 2XSDC 3JRIA 1JKOC 4A3LJ 1HDPA 1YRNA 3L1PA 1JJ8C 3O8GA 1NTCA 5IP7J 4A3KJ 1DU0A 2DMQA 5EG0A 3JRBA 2HI3A 3IH4A 3G1LA 3JR9A 1PUFB 2YU9J 3LSRA 4W97A 4LOCA 3GTMJ 1JTXA 2R7ZJ 1TWFJ 2DMNA 5JLWA 1I3QJ 1U9OA 3GTKJ 3C2BA 5K7FA 2M9HA 3NAUA 2LTPA 2MG4A 4NDLA 3MVPA 2WV1A 1IDZA 1W0UA 2YUSA 2JA8J 3JRGA 4BKXA 1MSEC 3LSJA 1RKTA 1BW5A 3S1NJ 2HOAA 2XPWA 2FQ4A 4A3IJ 3TW7A 1MNMC 2IAIA 2DMTA 3JRDA 1AKHB 1GT0C 2XGCA 5F04A 1TC3C 1GVDA 1XC5A 3HOWJ 3SFIA 4M3DA 1F36A 1YRNB 5M5YJ 5IYCJ 2XPUA 1LE8A 5GPCA 2D5VA 4DW6A 5EG0B 1IC8A 2CUFA 2LY9A 1ZK8A 3WHBA 5F1JA 4I6ZA 3WHCA 2Y2ZA 4MLOA 4J19A 1IGNA 1B72A 1HDDC 2JMWA 1Z0XA 2CRGA 4MO7A 5C3EJ 5M3FJ 3W6VA 1POGA 5BNGA 1ZGWA 1IRZA 2K9SA 2EH3A 2FX0A 2LFBA 2VKEA 2I10A 1OCTC 1JTYA 1CQTA 2EZIA 1P7IA 5C44J 2X6OA 2NS8A 3ZQHA 3I4MJ 5E3LA 4HNVA 2KDZA 5FKNA 3F0CA 2ME6A 4A3JJ 2LR8A 4V2GA 2WAQN 2JK3A 4I76A 1MBHA 3S2DJ 1U9NA 3ZQIA 3HM5A 1LE8B 5J3LA 5F0FA 4B4CA 2H8RA 4JX5A 4D5FA 1ETQA 4W1UA 4B3AA 4UUSA 2DA2A 2GBYA 2JA5J 4DZJA 1F43A 4A3EJ 1NK3P 4AYBN 4BY1J 2RAEA 3LOCA 3S1MJ 3GTLJ 3FKIJ 1T56A 2Y9YA 1FIPA 2L7MP 2E2IJ 1APLC 2E19A 3S2HJ 1LFBA 1ETOA 4D7NA 3IH3A 2VKVA 1ETKA 5IYDJ 1TWCJ 1BA5A 1GV2A 1ZR4A 2XRLA 3E7LA 1Y1WJ 1VI0A 2COBA 1OCPA 2HYJA 2R0QC 1ORKA 3PO2J 3HOXJ 4A93J 3HB9A 2L7ZA 5IP6A 3TP3A 3FK7A 1QVUA 4Y7NJ 1VNDA 2Y31A 5F27A 2E1OA 4RDUA 3MKLA 3S1QJ 1A5JA 4UUSB 2EZLA 1X2NA 1X58A 1FTTA 1RESA 2M0CA 1MH3A 1OJLA 3BQYA 4C3JJ 1T33A 2EZKA 1GV5A 2VPRA 3QPLA 3TEDA 4GFBA 1ZQ3P 1ZR2A 4IEJA 3GTOJ 2MGQA 5K7HA 2GM4A 5FKKA 2X9DA 1R9TJ 3A01A 2DA3A 4AC0A 2Y0SN 3HGGA 3S1RJ 2HDDA 4JX6A 2DTZA 3HDDA 4BY7J 2LK2A 3PO3J 1H88C 4X6AJ 4MFDA 3HKZN 4UUTA 5J1UA 3HEFA 3LNQA 2R5ZA 1H8AC 3OIOA 5K7ZA 3BR2A 4QSHA 3S17J 2JWTA 3G1MA 1BL0A 1JUMA 1UHSA 1W0TA 1ETWA 3QPSA 5FKOA 2CQXA 2YS9A 4A3MJ 4CYCA 4DZPA 4Y52J 3SDGA 2NVTJ 2K9NA 1MBFA 2W48A 4IHXA 4DYRA 3GTJJ 1VF9A 3Q0WA 1S7EA 1TWHJ 2M34A 4QTRA 4XRSA 2ID3A 5FKMA 2K40A 2LVSA 4ABZA 1QRYA 2CQQA 5EDNA 2MW8A 3D1NI 2XB5A 4D7MA 1WPKA 1IDYA 1WH5A 2R92J 1JT6A 3A01B 2TRTA 3Q0VA 1BJZA 9ANTA 2DMPA 2HOTA 5DS9A 3JRFA 3ZQLA 3QQAA 3VPRA 2R5ZB 4FCYA 1FEXA 4D5CA 2DA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR0 A;  3FIS A;  2NOG A;  1HLV A;  2DA4 A;  2CJJ A;  2VI6 A;  2DMU A;  3OSF A;  2L9R A;  1H89 C;  1IV6 A;  4CYC B;  3HOV J;  4XRM A;  3M3Y J;  3S15 J;  4BBS J;  2MSY A;  5C4J J;  1JT0 A;  1FTZ A;  4M3F A;  2KT0 A;  1SFO J;  1P7J A;  2NVX J;  2N8G A;  3GTG J;  3IH2 A;  2L0K A;  1NK2 P;  5FLM J;  1VFC A;  5IPA A;  1BW6 A;  3Q0U A;  1RKW A;  1QPI A;  5HOD A;  1XS9 A;  2Y30 A;  4DYQ A;  3H3V K;  3IV5 A;  4FE4 A;  2DA6 A;  2PMZ N;  4L5E A;  3BR1 A;  4M6V A;  1MH4 A;  1X2M A;  5E3M A;  1ENH A;  1RR7 A;  2O8K A;  2ZB9 A;  2FD5 A;  1JKR C;  2QCO A;  2LLK A;  1A6I A;  2HQ5 A;  1MBE A;  2OPT A;  3B6A A;  3ZQG A;  3BTC A;  1TWA J;  3RKQ A;  3BQZ A;  5F08 A;  4A3D J;  2TCT A;  3JRC A;  2LP0 A;  4XID A;  2IBD A;  2ID6 A;  4M3E A;  3B6C A;  2X48 A;  1EF4 A;  2R5Y A;  5EZH A;  4B1R A;  1MBJ A;  4IHY A;  5FLV A;  2OF7 A;  3DCF A;  2H1K A;  1I50 J;  4S0H B;  4A3B J;  2XGE A;  3PM1 A;  1D5Y A;  2M8G X;  2EBI A;  3BG3 A;  1XG1 A;  2JJ7 A;  1MSF C;  4A69 C;  1OFC X;  3CDL A;  5EGO A;  3A02 A;  1JKP C;  2XB0 X;  3ZQF A;  3GTP J;  5GPA A;  1Y1V J;  3TP0 A;  3GBG A;  4XRS G;  4FE7 A;  3BTI A;  1LFU P;  1MBG A;  3JRE A;  4A3C J;  2GLO A;  5EEA A;  2AO9 A;  4JP0 A;  3S14 J;  4XK4 A;  5IP9 J;  1HCR A;  1IUF A;  2AHQ A;  2DJN A;  4A3F J;  2XGD A;  2G0E A;  3K2A A;  2ME0 A;  3BG9 A;  1FJL A;  3FK6 A;  1JUS A;  3CQZ J;  2B63 J;  5C4X J;  3Q3S A;  2NVY J;  4C3I J;  4IHW A;  2K9Q A;  1Z77 A;  2JA6 J;  2O9L A;  3S16 J;  3RZD J;  3HGY A;  3SJM A;  2R5Y B;  5IOY A;  5EF6 A;  4FIS A;  1AHD P;  1HF0 A;  2M2E A;  3NAR A;  4AUX A;  3OOU A;  3DEW A;  4DYC A;  1ITY A;  2O7O A;  4JX4 A;  1QVT A;  2XPV A;  2NS7 A;  1JKQ C;  1GDT A;  3I4N J;  3HOU J;  1I6H J;  5EGO B;  1WGX A;  2DA1 A;  1GUU A;  1E3O C;  4MIM A;  2E2H J;  3GTQ J;  1O4X A;  5F0C A;  2HOS A;  3ZOB A;  2JA7 J;  4QIW N;  2HXI A;  1K83 J;  2LD5 A;  1WCM J;  2EZH A;  3HBL A;  5FJ8 J;  3RQI A;  4IHV A;  5M5X J;  1B8I A;  1UG2 A;  3O8H A;  5E3O A;  3ZQC A;  3CCY A;  1G2H A;  4V2F A;  4MFE A;  5EYR A;  5M3M J;  2ECB A;  5IOZ A;  4M3G A;  3JRH A;  5EZG A;  3CMY A;  4M3B A;  3OSG A;  4A3G J;  4G12 A;  1WI3 A;  1ZTR A;  3BTJ A;  3TW6 A;  1RPW A;  2QF7 A;  3UKG A;  2JN6 A;  1ETV A;  5F0H A;  1UMQ A;  1HOM A;  2EQR A;  3LSG A;  1JGG A;  1IJW C;  1SAN A;  4X1E A;  3G1O A;  1U78 A;  1JJ6 C;  1RET A;  4C3H J;  5JLX A;  1AU7 A;  2VUM J;  1TWG J;  3K7A J;  3BR6 A;  3LSP A;  3BTL A;  3BG5 A;  3FIW A;  2DN0 A;  2CUE A;  5GP9 A;  3BT9 A;  2ECC A;  1PUF A;  3A03 A;  1B8I B;  1K61 A;  1B72 B;  3HOY J;  3HOZ J;  5DTD A;  1ZKG A;  5M5W J;  4XIC A;  4FTH A;  1IG7 A;  2WB1 N;  1U8B A;  2CU7 A;  2NVQ J;  5J1R A;  3RZO J;  2L7F P;  2R93 J;  1WH7 A;  4BBR J;  5J1Y A;  2E2J J;  3M4O J;  2DA7 A;  3JRA A;  3BR5 A;  3BR3 A;  1ETY A;  1FIA A;  3MN2 A;  2ELK A;  4RBO A;  2Y9Z A;  2FJ1 A;  1DU6 A;  3H0G J;  2IEK A;  1Q1V A;  2HXO A;  5FKL A;  1JUP A;  1MBK A;  4JYK A;  4C2M J;  1AKH A;  4EEF G;  4BXX J;  2LKX A;  5E3N A;  1ETX A;  2P81 A;  5IYB J;  2XSD C;  3JRI A;  1JKO C;  4A3L J;  1HDP A;  1YRN A;  3L1P A;  1JJ8 C;  3O8G A;  1NTC A;  5IP7 J;  4A3K J;  1DU0 A;  2DMQ A;  5EG0 A;  3JRB A;  2HI3 A;  3IH4 A;  3G1L A;  3JR9 A;  1PUF B;  2YU9 J;  3LSR A;  4W97 A;  4LOC A;  3GTM J;  1JTX A;  2R7Z J;  1TWF J;  2DMN A;  5JLW A;  1I3Q J;  1U9O A;  3GTK J;  3C2B A;  5K7F A;  2M9H A;  3NAU A;  2LTP A;  2MG4 A;  4NDL A;  3MVP A;  2WV1 A;  1IDZ A;  1W0U A;  2YUS A;  2JA8 J;  3JRG A;  4BKX A;  1MSE C;  3LSJ A;  1RKT A;  1BW5 A;  3S1N J;  2HOA A;  2XPW A;  2FQ4 A;  4A3I J;  3TW7 A;  1MNM C;  2IAI A;  2DMT A;  3JRD A;  1AKH B;  1GT0 C;  2XGC A;  5F04 A;  1TC3 C;  1GVD A;  1XC5 A;  3HOW J;  3SFI A;  4M3D A;  1F36 A;  1YRN B;  5M5Y J;  5IYC J;  2XPU A;  1LE8 A;  5GPC A;  2D5V A;  4DW6 A;  5EG0 B;  1IC8 A;  2CUF A;  2LY9 A;  1ZK8 A;  3WHB A;  5F1J A;  4I6Z A;  3WHC A;  2Y2Z A;  4MLO A;  4J19 A;  1IGN A;  1B72 A;  1HDD C;  2JMW A;  1Z0X A;  2CRG A;  4MO7 A;  5C3E J;  5M3F J;  3W6V A;  1POG A;  5BNG A;  1ZGW A;  1IRZ A;  2K9S A;  2EH3 A;  2FX0 A;  2LFB A;  2VKE A;  2I10 A;  1OCT C;  1JTY A;  1CQT A;  2EZI A;  1P7I A;  5C44 J;  2X6O A;  2NS8 A;  3ZQH A;  3I4M J;  5E3L A;  4HNV A;  2KDZ A;  5FKN A;  3F0C A;  2ME6 A;  4A3J J;  2LR8 A;  4V2G A;  2WAQ N;  2JK3 A;  4I76 A;  1MBH A;  3S2D J;  1U9N A;  3ZQI A;  3HM5 A;  1LE8 B;  5J3L A;  5F0F A;  4B4C A;  2H8R A;  4JX5 A;  4D5F A;  1ETQ A;  4W1U A;  4B3A A;  4UUS A;  2DA2 A;  2GBY A;  2JA5 J;  4DZJ A;  1F43 A;  4A3E J;  1NK3 P;  4AYB N;  4BY1 J;  2RAE A;  3LOC A;  3S1M J;  3GTL J;  3FKI J;  1T56 A;  2Y9Y A;  1FIP A;  2L7M P;  2E2I J;  1APL C;  2E19 A;  3S2H J;  1LFB A;  1ETO A;  4D7N A;  3IH3 A;  2VKV A;  1ETK A;  5IYD J;  1TWC J;  1BA5 A;  1GV2 A;  1ZR4 A;  2XRL A;  3E7L A;  1Y1W J;  1VI0 A;  2COB A;  1OCP A;  2HYJ A;  2R0Q C;  1ORK A;  3PO2 J;  3HOX J;  4A93 J;  3HB9 A;  2L7Z A;  5IP6 A;  3TP3 A;  3FK7 A;  1QVU A;  4Y7N J;  1VND A;  2Y31 A;  5F27 A;  2E1O A;  4RDU A;  3MKL A;  3S1Q J;  1A5J A;  4UUS B;  2EZL A;  1X2N A;  1X58 A;  1FTT A;  1RES A;  2M0C A;  1MH3 A;  1OJL A;  3BQY A;  4C3J J;  1T33 A;  2EZK A;  1GV5 A;  2VPR A;  3QPL A;  3TED A;  4GFB A;  1ZQ3 P;  1ZR2 A;  4IEJ A;  3GTO J;  2MGQ A;  5K7H A;  2GM4 A;  5FKK A;  2X9D A;  1R9T J;  3A01 A;  2DA3 A;  4AC0 A;  2Y0S N;  3HGG A;  3S1R J;  2HDD A;  4JX6 A;  2DTZ A;  3HDD A;  4BY7 J;  2LK2 A;  3PO3 J;  1H88 C;  4X6A J;  4MFD A;  3HKZ N;  4UUT A;  5J1U A;  3HEF A;  3LNQ A;  2R5Z A;  1H8A C;  3OIO A;  5K7Z A;  3BR2 A;  4QSH A;  3S17 J;  2JWT A;  3G1M A;  1BL0 A;  1JUM A;  1UHS A;  1W0T A;  1ETW A;  3QPS A;  5FKO A;  2CQX A;  2YS9 A;  4A3M J;  4CYC A;  4DZP A;  4Y52 J;  3SDG A;  2NVT J;  2K9N A;  1MBF A;  2W48 A;  4IHX A;  4DYR A;  3GTJ J;  1VF9 A;  3Q0W A;  1S7E A;  1TWH J;  2M34 A;  4QTR A;  4XRS A;  2ID3 A;  5FKM A;  2K40 A;  2LVS A;  4ABZ A;  1QRY A;  2CQQ A;  5EDN A;  2MW8 A;  3D1N I;  2XB5 A;  4D7M A;  1WPK A;  1IDY A;  1WH5 A;  2R92 J;  1JT6 A;  3A01 B;  2TRT A;  3Q0V A;  1BJZ A;  9ANT A;  2DMP A;  2HOT A;  5DS9 A;  3JRF A;  3ZQL A;  3QQA A;  3VPR A;  2R5Z B;  4FCY A;  1FEX A;  4D5C A;  2DA5 A; 
#chains in the Genus database with same CATH topology
 4RM3 A;  4RAZ A;  3CZ6 A;  4NQW A;  5H6R A;  3DKY A;  2QSG X;  5D5U B;  2DMU A;  4I7H A;  4MQV A;  5KAI C;  2DK5 A;  2VL8 A;  2VKD A;  2W25 A;  3BP8 A;  3ZCO A;  5A2Q Z;  3VSL A;  3IL2 A;  1SD4 A;  3HYI A;  2PEX A;  2BHZ A;  4BBS J;  2MSY A;  2KT0 A;  3H1C A;  5BPD A;  1P7J A;  4CIC A;  2NVX J;  3GTG J;  3C7J A;  1D1A A;  1K6Y A;  4ZYG A;  1OIS A;  1QPI A;  3ZGK A;  2Y30 A;  3KYC B;  1ON1 A;  4PJM A;  4DYQ A;  2A5Y B;  1IN6 A;  4IRI A;  1I1G A;  3OY9 A;  4B8X A;  1RR7 A;  4P55 A;  2O8K A;  2R7O A;  2HQN A;  2K27 A;  5HLI A;  2EJR A;  3BG6 A;  1A6I A;  2OPT A;  2L9S A;  1O3T A;  3BTC A;  1S3J A;  3RKQ A;  5F08 A;  4U7D A;  1KU3 A;  2KL4 A;  3SDB A;  4GXO A;  1F9N A;  4IF4 A;  2HZD A;  5DUI A;  3B6C A;  4KA4 A;  3OIP A;  1BN5 A;  1EF4 A;  2LF7 A;  1F1Z A;  4L0Z B;  1S72 I;  5ILU A;  3RPU A;  4IX7 A;  4E7H A;  4IHY A;  2RV8 A;  3FXU A;  4XLC A;  5FLV A;  2W85 A;  1R22 A;  2QKL B;  3O2P E;  1DGR M;  4RB3 C;  3CLQ A;  5ICC A;  1RC9 A;  2NYX A;  2L54 A;  3FF5 A;  3FXM A;  4LMY A;  1MSF C;  2L4M A;  2RRE A;  4XOR A;  3A1Y A;  2CQ7 A;  3O6B B;  1YLF A;  5EGO A;  4HSR A;  1JKP C;  2XB0 X;  1R7J A;  1Y1V J;  1USS A;  3BTI A;  1TT5 B;  3FM5 A;  3B02 A;  1Z7U A;  3CTA A;  5LGN A;  3RKX A;  4RAF A;  4JP0 A;  5L3B A;  3LSI A;  2HU9 A;  2STT A;  1J7K A;  2DJN A;  4RAY A;  2CYY A;  1YW9 A;  2WAD A;  3CC4 I;  2IW5 A;  3K2A A;  2VT3 A;  5DM6 F;  4KNY A;  2JT1 A;  2K85 A;  2DXI A;  1Y0U A;  2W1O A;  3CQZ J;  3VYR B;  3Q3S A;  2NVY J;  4C3I J;  2K9Q A;  2YU3 A;  2JA6 J;  2O9L A;  3S16 J;  1D3Y A;  2R5Y B;  5IOY A;  1TL8 A;  4KN7 X;  3GLX A;  3FHZ A;  3OYF A;  3V4G A;  1ZG1 A;  2M2E A;  1ITY A;  2O7O A;  1CGP A;  4JX4 A;  3ZXS A;  2IVM A;  2NS7 A;  4L5J A;  5ILV A;  1W5T A;  4KMU X;  2OCE A;  3ASN H;  2HQR A;  1P6R A;  3HOU J;  1EKE A;  1V5E A;  2XF6 A;  1D0X A;  4A6E A;  1FSH A;  1SAX A;  3GF2 A;  3R0A A;  2FEZ A;  1E3O C;  1HST A;  1SMY F;  3J7A Y;  2JSC A;  5TRD A;  2ELJ A;  5LLQ A;  1XMK A;  1UFM A;  3GVA A;  3CD6 I;  2HXI A;  3HSF A;  2PJR A;  5D5W B;  3RPQ A;  3HBL A;  2I5U A;  3BJO A;  4AIJ A;  5JHU A;  2HYF A;  1BBY A;  3HSR A;  3RQI A;  4CCK A;  1C0W A;  4IHV A;  1Z3Y A;  1IAW A;  1MDM A;  2ETH A;  1O3R A;  1UG2 A;  1GXP A;  2IS6 A;  4AIK A;  3S2W A;  4PCQ A;  3AL0 C;  4V2F A;  5EYR A;  2Z1D A;  2ECB A;  1WSU A;  5IOZ A;  4BEH B;  4M3G A;  3JRH A;  4EGZ A;  3OSG A;  4A3G J;  2EV5 A;  2FQ3 A;  2ZJQ F;  5FRM A;  1DP3 A;  1RUN A;  2VJI A;  2QUF A;  4G7H F;  2JTV A;  3GZ5 A;  2QF7 A;  4E6K G;  3UKG A;  4C2T A;  2JN6 A;  5F0H A;  1ZGA A;  3HSE A;  1XDU A;  1FX7 A;  4LLG F;  4UY8 I;  3JAM Z;  2ACJ A;  3ZN0 A;  1P2F A;  2PMH A;  3FMQ A;  1VQ6 I;  4UV9 A;  4XLH A;  2X6Y A;  2QWW A;  4OAY A;  4N9H A;  3V8K A;  4FAS D;  3BG5 A;  3M8J A;  2DN0 A;  4M73 A;  5DD4 A;  5TIS C;  3HC7 A;  2CQN A;  3A03 A;  1B8I B;  2JUC A;  5KCM A;  1OR7 A;  1ZKG A;  1R4M B;  2ZFW A;  2BY2 A;  2E71 A;  4HDV A;  4BE1 A;  4FTH A;  3DEE A;  2PLY A;  3V7C A;  1OYI A;  2VC1 A;  1BI3 A;  3FBN B;  2CU7 A;  2NVQ J;  3WGI A;  4ENM A;  2F4O B;  3RZO J;  4FQG A;  3RKY A;  3E0J B;  2L7F P;  2R93 J;  4PJ0 C;  5J1Y A;  3RCO A;  2FOW A;  3LAJ A;  2V7F A;  3HXL A;  1ETY A;  4EJO A;  1R71 A;  3SEQ A;  2CO5 A;  4TV7 A;  2ELK A;  4D9J A;  3CMM A;  2HNH A;  5CVV A;  5K1Y A;  5FKL A;  1Q1V A;  4JYK A;  2ZKZ A;  5CVJ A;  5D5V B;  3PIP F;  3IRQ A;  3H0D A;  1MGT A;  2MBF A;  1T08 B;  1ETX A;  4IRH A;  3TO9 A;  5IYB J;  5D4R A;  3JRI A;  1HDP A;  3QU3 A;  1VQ7 I;  2VAS A;  4L5I A;  4L9N A;  3CCV I;  3QRF F;  2DT6 A;  3I56 I;  1DU0 A;  1VQ9 I;  2DMQ A;  3P9I A;  3JRB A;  1MJB A;  2H94 A;  3G1L A;  3ISP A;  1W7P D;  1R1T A;  4HV6 A;  3WTY C;  4YIR X;  2DPD A;  5L3D A;  2VON A;  5IT9 K;  3FXJ A;  2F5V A;  4XN3 A;  4LOC A;  4CXF A;  2HPI A;  4P5O A;  1JTX A;  3F8C A;  5CJ9 A;  3ERE D;  1VQ5 I;  5LRS A;  5E18 F;  2M9H A;  4L9V A;  3KP3 A;  4HX4 A;  4E7K A;  1KA8 A;  1EH6 A;  2IGM A;  1Z6R A;  2VLA A;  2E1M B;  1W0U A;  4N4N B;  2EIM H;  3TMO A;  1PYV A;  3JRG A;  4DIQ A;  2GQQ A;  3UNG C;  3WG7 H;  4ZYD A;  3S1N J;  2EB7 A;  2OA4 A;  3J80 K;  3TW7 A;  1MNM C;  1AKH B;  1K78 B;  2XGC A;  3HRS A;  2O3F A;  1GVD A;  1HC8 A;  3LA3 A;  1QHG A;  4M3D A;  1K79 A;  2K3F A;  4C9Y A;  2XPU A;  4PJJ A;  4ZTJ A;  4DW6 A;  3E6M A;  3PNY A;  2HVR A;  4R79 A;  3WHC A;  4MLO A;  2ZBK A;  1HDD C;  2CRG A;  3MQ0 A;  4MO7 A;  3W6V A;  1R36 A;  5GAH J;  5BNG A;  4KMF A;  2XF7 A;  3AFH A;  3I9V 2;  4BXU A;  1MMD A;  2IPQ X;  3HPH A;  1P9Q C;  1S5L C;  4HAM A;  3G4S I;  4Y33 A;  1UHM A;  4WX9 A;  4IVN A;  2M30 A;  5D6F A;  5ERI A;  1AOY A;  4XKB A;  1IRG A;  4PJN A;  2COM A;  2P8T A;  1JE8 A;  3ZQH A;  4CO8 A;  2DPU A;  4G7O F;  3I4M J;  4BQO A;  2XAH A;  3F0C A;  4QPO A;  4U0W A;  3DLL F;  1X3W B;  4ITV A;  4CCJ A;  3X2Q H;  2LR8 A;  3D5S C;  2RQQ A;  2IS4 A;  2HYG D;  2V79 A;  2JK3 A;  1XSV A;  1SFK A;  2AXT C;  1U9N A;  2OC6 A;  2RC4 A;  3GZN B;  2QQA A;  3HM5 A;  1VQP I;  3C18 A;  1EH7 A;  2IS1 A;  2M4G A;  3HJE A;  3LSH A;  4D5F A;  4I2O A;  1G8X A;  4B3A A;  2ZNY A;  2DA2 A;  2KHM A;  4E7S A;  2K5C A;  2LY1 A;  4RLQ A;  3S1M J;  2P4W A;  5GAG J;  3CCE I;  5CKT A;  1FYK A;  1BIB A;  2KMU A;  1T38 A;  4KIS A;  3QP5 A;  3GO5 A;  3H92 A;  1APL C;  2E19 A;  2M1B A;  3GYH X;  3BOQ A;  1XD7 A;  3DTE A;  1ETK A;  1WJA A;  2CFX A;  4Y4R A;  3TOA A;  4WWC A;  2ZJP F;  4XON A;  2XRL A;  3M8F A;  3SXY A;  3TL4 X;  3CO7 C;  1V5F A;  1D8K A;  2HYJ A;  1B59 A;  3F23 A;  3ELK A;  3WU2 C;  4D0P A;  3HOX J;  1D8J A;  2Q8K A;  4Z6Y A;  5HOO A;  1KQ8 A;  5EEG A;  1WRJ A;  3TP3 A;  1W5C C;  3F3X A;  3KEQ A;  3I53 A;  5J8F A;  4LIU A;  2GOX B;  2ADU A;  1UCR A;  1VND A;  5F27 A;  2VQC A;  4XRF A;  3S1Q J;  2PMZ A;  3RYP A;  2EZL A;  1X2N A;  4OOI A;  1QZZ A;  3CDI A;  5D8K B;  3DV8 A;  2LBF A;  1T0F A;  2MD0 A;  2VXD A;  3BQY A;  3FBI B;  1T33 A;  4F52 A;  3RSN A;  1GV5 A;  3QPL A;  2EFO A;  5LEJ A;  1ZR2 A;  4IEJ A;  2NNN A;  3HOS A;  1R1U A;  2A3S A;  2DCE A;  4XNF A;  1UB9 A;  2MGQ A;  5K7H A;  2XRO A;  2GM4 A;  3HIF A;  5BQT A;  3FXR A;  1BI1 A;  1HKS A;  3M1C A;  3CP2 A;  2KZV A;  3DPU A;  4ZZD A;  2FUG 2;  4L9J A;  3HDD A;  4B09 A;  2F2E A;  2DOA A;  2P5K A;  3BPX A;  2WC2 A;  1H88 C;  4BU2 A;  3ZMT A;  1I1S A;  1U5T C;  4RMN A;  4UUT A;  1H8A C;  3DP7 A;  5DEQ A;  1LKX A;  3P9C A;  1LB2 A;  4YFX F;  2NRA C;  2LKS A;  3TDZ C;  3LQR A;  3LST A;  4LJZ F;  3CC7 I;  1RR8 C;  3G1M A;  4AU7 A;  3K1P A;  1W0T A;  1ETW A;  3LA2 A;  1P92 A;  3QPS A;  5K5O A;  2YS9 A;  4A3M J;  1RNL A;  1QGP A;  5CVR A;  2DYR H;  3KIO A;  1D0Y A;  5HLT A;  4Y52 J;  3QPT A;  2KIM A;  2WAE A;  2X0L A;  3SDG A;  3GX4 X;  3TBI A;  5BOX A;  1B4A A;  2P5L C;  1W36 C;  1VF9 A;  3Q0W A;  4XRS A;  1XN7 A;  1LJ9 A;  4G94 A;  3D0S A;  3BG7 A;  2OJE D;  1K4S A;  1DUX C;  2LVS A;  1QRY A;  4HBL A;  2W4S A;  1V54 H;  2RQP A;  1WPK A;  1IDY A;  1WH5 A;  3Q0V A;  1ZN2 A;  5HS8 A;  1M1E B;  1YJN I;  2E1N A;  1X1D A;  2HOT A;  1XCB A;  1WJD A;  2HS5 A;  4CGZ A;  1PUE E;  2R7X A;  4CZC A;  1TQP A;  2VBX A;  3JRF A;  3J7Z I;  2EFW A;  3L09 A;  3LSK A;  4UB6 C;  1TW2 A;  3CJR B;  4D5C A;  3WE2 A;  3C3W A;  2DFF A;  1HLV A;  4IJA A;  2HKX A;  2LOO A;  3IKV A;  1G6N A;  2M3A A;  2GXG A;  4PSX A;  3OYI A;  2VQG A;  4S05 A;  4RGS A;  4AIH A;  3OSF A;  2HKO A;  2JZY A;  2XSJ C;  2VJ5 A;  4G9Y A;  4M3F A;  5E1X A;  1I39 A;  3V8L A;  1SFO J;  2N8G A;  3IH2 A;  3OOP A;  1NK2 P;  3K4L A;  1F4K A;  5HVQ C;  2O8X A;  5IPA A;  4AD9 A;  3HRU A;  1RKW A;  5HOD A;  1VQM I;  1XS9 A;  1HKQ A;  4A2U A;  1MZB A;  4IHT A;  3R6S A;  4YIF A;  3IV5 A;  3H3V K;  2DA6 A;  2PMZ N;  2GAU A;  3BR1 A;  4M6V A;  1MH4 A;  4YEL A;  2VN2 A;  2UUZ A;  3CLO A;  2BOL A;  2LLK A;  1WJC A;  2HQ5 A;  4O5V A;  4CZZ A;  2R7W A;  1BOB A;  2VJ4 A;  2ZSI B;  3TOB A;  2UXN A;  3M9A A;  4EAT A;  4BE2 A;  2FF4 A;  4M3E A;  4L18 B;  3I58 A;  1B9N A;  1B1B A;  3GME A;  4GRI A;  2MC3 A;  4II2 A;  2R5Y A;  5EZH A;  4ZJZ A;  1GHC A;  1YOV B;  1MBJ A;  3H3Z A;  3FXL A;  3OYE A;  1T98 A;  4OWR B;  1I50 J;  4A3B J;  2VT2 A;  5H2F C;  1TTY A;  5DUK A;  2A05 A;  1WJ5 A;  1XG1 A;  3CF5 F;  2IXS A;  3GFL A;  4A69 C;  2O0Y A;  5J40 A;  5DYM A;  3K4N A;  3M7G A;  4CHU A;  3ZQF A;  1MND A;  3IRR A;  1LUJ B;  3TP0 A;  3OYC A;  5D8L B;  1XCV A;  2BVL A;  3HRM A;  3S14 J;  4B48 A;  4XK4 A;  2AHQ A;  3H35 A;  2V26 A;  3BZC A;  4A3F J;  4XQF A;  1YTY A;  2RNG A;  4JQF A;  2HFH A;  2ME0 A;  2JVG A;  3EUH C;  2B9S A;  2WA0 A;  4E7J A;  1MMN A;  1LDD A;  2B63 J;  2ZME C;  2FNA A;  1MD0 A;  2M7A A;  4HST A;  5D4S A;  2HPM A;  1Z77 A;  3G2B A;  1TW3 A;  3N97 A;  1CF7 B;  1IRF A;  3DLA A;  4BEH A;  4QPQ A;  4JBA A;  1FOW A;  4DJA A;  3OYN A;  3OOU A;  3TGN A;  4DYC A;  1U0J A;  3K4M A;  2G7U A;  1HW5 A;  2H27 A;  3SQN A;  2XPV A;  3WGH A;  1IXR C;  2X1C A;  4IZZ A;  1V55 H;  3I4N J;  2OZU A;  4DBQ A;  5ICG A;  1OCO H;  2EK5 A;  2VOP A;  1D5V A;  1WGX A;  2DA1 A;  1GUU A;  2WWY A;  5LFA A;  5IY5 H;  4KYW A;  2E2H J;  2ZXW H;  4CYD A;  1Z9C A;  4X0G A;  4JK1 X;  2VPL A;  3KPH A;  4K2E A;  2JA7 J;  4QIW N;  3S8P A;  5HLG A;  1LVK A;  1QZE A;  1K83 J;  2R7F A;  4XR6 A;  2LD5 A;  4CSW A;  2XDV A;  3OYD A;  2STW A;  1B8I A;  5LEK A;  2MFZ A;  4BQQ A;  3MKW B;  5GAE J;  4ZTF A;  3O8H A;  5E3O A;  1IN5 A;  4E7Z A;  4V19 K;  2QZ8 A;  4Y17 A;  2GIV A;  4MFE A;  3MZH A;  3CMY A;  2BY1 A;  5EZG A;  2DFI A;  2BXY A;  4LK1 F;  4MHG A;  5FRO A;  3GZ6 A;  1WI3 A;  2KRH A;  3BTJ A;  3GFJ A;  3PNT A;  5DDG A;  1S6L A;  3LSG A;  4CCN A;  3H9G A;  1VQO I;  2KJC A;  4X1E A;  2A68 F;  1OPC A;  1RET A;  4Q47 A;  2QEX I;  1IN8 A;  3GXO A;  5LD2 C;  4GGG A;  3K7A J;  3BC8 A;  3F8F A;  4IOA F;  5FD6 A;  1MIJ A;  5DM7 F;  4P96 A;  1K6O A;  1KQ0 A;  2CUE A;  2ECC A;  1K61 A;  1IW7 F;  3HOY J;  3EPZ A;  4CDG A;  4D1Q A;  1IG7 A;  4MEX F;  4YG2 F;  1U8B A;  2M5W A;  2L9N A;  3FKJ A;  5GTI C;  3NWT A;  3WTZ A;  4BBR J;  3HTS B;  1TNS A;  2ICW G;  3AG4 H;  2WAQ A;  4JOM A;  2E2J J;  4OIQ F;  2DA7 A;  3JRA A;  4BJT A;  4IXA A;  4LG0 B;  4BH9 A;  5HDG A;  2KIU A;  3V8J A;  3MN2 A;  5D5X B;  2IT0 A;  3DBL B;  2FJ1 A;  2X1D A;  3H0G J;  2HXO A;  3F8B A;  1JUP A;  1AKH A;  1K78 A;  3D5R C;  5J4V A;  1U2W A;  4BL0 B;  5FD5 A;  5E3N A;  1XGN A;  2P81 A;  3DPL C;  2BBY A;  4A3L J;  3L1P A;  3WE3 A;  2XAF A;  1JJ8 C;  1XSX A;  4I01 A;  3I59 B;  1X3Z B;  4HF2 A;  2QM3 A;  5LGU A;  2PX9 A;  4XSZ F;  3ZPL A;  3RYR A;  2ZJR F;  3AAF A;  3LSR A;  4NB5 A;  5F6F A;  3ABT A;  4WK8 F;  4LLN A;  1FSE A;  2O5R A;  3S32 A;  1FOK A;  1FMV A;  1TWF J;  3OR1 C;  1O7F A;  3JSP A;  1N75 A;  3PUB A;  1I3Q J;  1OCR H;  3GTK J;  4ZYH A;  3C2B A;  1R5I D;  4GYI A;  3NAU A;  4NDL A;  4FHT A;  2OTL I;  1D1C A;  2W84 A;  4KT6 A;  2XAJ A;  5DCF A;  2ZME B;  3RPU D;  4UHT A;  1OCC H;  1ZHF A;  3LSJ A;  2Z3Y A;  4HX7 A;  4FX4 A;  6PAX A;  1BW5 A;  2HOA A;  2XPW A;  2FQ4 A;  3LQQ A;  3BRO A;  1FOX A;  4CH7 A;  3JRD A;  1TC3 C;  4XL9 A;  1ZG3 A;  3MZY A;  3QP6 A;  3HUG B;  2XKO A;  1QPM A;  2KLO A;  4IHS A;  1YRN B;  2WBM A;  5IYC J;  2DT7 B;  2DTR A;  5IT9 Z;  4EJW A;  3ERM A;  4HW0 A;  5EG0 B;  2MC4 A;  3U21 A;  2XHK A;  2V6C A;  3KZI C;  1ZRE A;  2ISZ A;  2Y2Z A;  4J19 A;  4E7L A;  1B72 A;  2Y0S A;  2FBI A;  1Z67 A;  1Z0X A;  3IAM 2;  2HGC A;  1BI0 A;  1POG A;  1J2X A;  2EH3 A;  2EFN A;  2VKE A;  2BW3 B;  4XN0 A;  2I10 A;  4EM1 A;  4GDF A;  3ZMV A;  3J80 Z;  3OYJ A;  1OCT C;  1NG7 A;  3BJ6 A;  2A6E F;  2PJP A;  2Z99 A;  5FFZ A;  1Y8R B;  3ECO A;  3QYB A;  4UV8 A;  3MCZ A;  1CQT A;  2FXA A;  1P7I A;  5HLH A;  2X6O A;  3N05 A;  4XOT A;  3OS2 A;  2UZK A;  1U6G A;  5FKN A;  2DJI A;  2K9M A;  3K69 A;  2ME6 A;  3W6J B;  3MAJ A;  3MZ8 A;  5D6E A;  3PNV A;  2QBY B;  1TQI A;  2WAQ N;  3MKY B;  2Y75 A;  4ETS A;  1MBH A;  1UST A;  4LB6 B;  2DDB A;  4PSW A;  5TJJ A;  3ZQI A;  5B66 C;  2PI0 A;  1LE8 B;  5J3L A;  4B4C A;  1J5Y A;  2H8R A;  2FA5 A;  4JX5 A;  2AXL A;  2VOD A;  4LIV A;  2D45 A;  5L3C A;  4HPQ A;  4HQE A;  3PSI A;  1DPU A;  1FMW A;  2Q1Z B;  4QWQ A;  5EJC A;  1KZH A;  3ZRG A;  4E4H A;  4RGR A;  3C1D A;  4B47 A;  3FZV A;  4HX8 A;  2QYO A;  3GTL J;  3ZMZ A;  3ASO H;  5B1B H;  4EM2 A;  3ECH A;  5HNH A;  1E3H A;  1FIP A;  2L7M P;  3LL7 A;  3TDU C;  4B44 A;  1SD6 A;  4WXC A;  4HF1 A;  1Z6T A;  3S2H J;  2IRF G;  3IH3 A;  3DPT A;  2HWV A;  4IRG A;  5J8C A;  1ZG5 A;  1E3P A;  3PUF A;  1BA5 A;  2EPF A;  3A0H C;  3PFY A;  4ZDL A;  2R7D A;  1ZR4 A;  1A31 A;  4XLF A;  4C2U A;  2COB A;  1OCP A;  3T1B A;  2JVH A;  5CLS A;  2R0Q C;  1SVL A;  3PO2 J;  4PDK A;  1WFX A;  2JRT A;  4UVB A;  5DCM B;  3MWM A;  2BV6 A;  3FK7 A;  2DLL A;  1HQC A;  4IOC F;  3VOD A;  4Y7N J;  3DU6 A;  3HL2 A;  2Y31 A;  4RDU A;  1ZLK A;  3MKL A;  2I8D A;  1A5J A;  1O57 A;  3HHH A;  1T95 A;  4UUS B;  3DXJ F;  2GOM A;  1YX3 A;  1FTT A;  3N4M A;  1SMT A;  2CH0 A;  3T5X A;  3LSM A;  3R61 A;  1JHF A;  5L3G A;  2FRH A;  3K4B A;  4ANJ A;  2VPR A;  3RIR A;  1ZQ3 P;  1OR7 C;  3S93 A;  4WCG A;  3GTO J;  4CUG A;  2DU9 A;  1GVJ A;  2CS3 A;  2X9D A;  3KP7 A;  1VQ8 I;  1HSJ A;  2BZT A;  2Y0S N;  3S1R J;  3EET A;  4FX0 A;  4EMS A;  4JX6 A;  5JHF A;  3OR2 C;  2L9V A;  2Y48 A;  1J09 A;  4U87 A;  5CVU A;  3LNQ A;  1S9H A;  5AIQ A;  2Z33 A;  2F6C A;  1A6Q A;  1Z1D A;  3OIO A;  2JUG A;  2HZT A;  4N4O B;  3S3O A;  4HDU A;  2JWT A;  4MEY F;  5BMZ A;  1BL0 A;  3IHU A;  1IV8 A;  1I6X A;  1R58 A;  5AIP A;  3H5R A;  1X1P A;  2CQX A;  2LRE A;  3T8T A;  2R7R A;  1ODD A;  2OZ6 A;  2K9N A;  1MBF A;  2R4G A;  4E70 A;  5E17 F;  4IHX A;  1TBX A;  1DP7 P;  3NQO A;  3H5N A;  1TWH J;  2G7H A;  1XB4 A;  4QTR A;  2XAU A;  4HF0 A;  3WG9 A;  2EFQ A;  2GIZ A;  2CQQ A;  3D1N I;  4D7M A;  3A01 B;  2HDW A;  1SFE A;  2HVQ A;  2DMP A;  2Q0O A;  1NH3 A;  3L2R A;  4RGX A;  3AL0 B;  2FMY A;  5DS9 A;  1L3L A;  1E17 A;  2KIQ A;  3ZQL A;  3FWE A;  3QQA A;  4PGH A;  3VPR A;  2IS2 A;  4ZZL A;  2DA5 A;  4A5M A;  2IA2 A;  2V1N A;  5LHG A;  2NOG A;  1LPQ A;  1TQM A;  2CJJ A;  2L7K A;  2VI6 A;  2P7V B;  2L9R A;  1B6A A;  1SD7 A;  2L3D A;  2QSH X;  4B43 A;  2Y69 H;  4BGD A;  2L2O A;  4OU0 A;  1JT0 A;  2VIX A;  3H5A A;  4I98 B;  2GWR A;  3RJP A;  1SAU A;  2ISY A;  4YII A;  5ICF A;  1JI8 A;  3A0B C;  3IC7 A;  3WTV C;  1VFC A;  1MMG A;  4BQA A;  5J47 A;  3Q0U A;  5LHH A;  2FSW A;  4AVP A;  4HNT A;  3KE2 A;  3DWL E;  4L5E A;  4BQN A;  1FZP B;  2DT5 A;  1X2M A;  5E3M A;  1ENH A;  5JVT A;  1WI9 A;  4L0Y B;  2FD5 A;  4UVA A;  1R1V A;  2QCO A;  1JKR C;  1BOA A;  3ZQG A;  3F22 A;  1KU2 A;  1LDJ A;  5J6X A;  1BIA A;  3LAP A;  4EM0 B;  4YFN F;  1MDM B;  2GXA A;  1A04 A;  1TWA J;  4U0Y A;  3BQZ A;  5FLX K;  1KU7 A;  1S8N A;  1ZLJ A;  2TCT A;  3JRC A;  2VXZ A;  3E6D A;  4XID A;  4Y3O A;  2BEO A;  1CF7 A;  4GYG A;  3FDY A;  2CWE A;  1TP4 A;  3K4K A;  4XM3 A;  3ROU A;  2OF7 A;  1FP2 A;  2H1K A;  1SVO A;  2XGE A;  3PM1 A;  4PK4 A;  1D5Y A;  2A61 A;  2DDA A;  2EBI A;  1EJ9 A;  4ZDP A;  3DBR B;  2M8E A;  4LG3 A;  1YHQ I;  3A02 A;  2D1H A;  2X1E A;  3GBG A;  3HOT A;  4UUV A;  3PSF A;  2QQ9 A;  2XAQ A;  1YX5 A;  1LFU P;  1FOY A;  1MBG A;  2A5W A;  1IN7 A;  3AG1 H;  4F3Q A;  3JRE A;  1W7P B;  1X1A A;  1BC7 C;  1DQU A;  3CCJ I;  1XPX A;  3P7N A;  4GO1 A;  1IRX A;  4ASN A;  1E0E A;  4IQ4 A;  4PFP A;  3K1N A;  3BG9 A;  1FJL A;  2D1V A;  3BZ6 A;  4BS9 A;  2ZSH B;  5FFX A;  1JUS A;  4IHW A;  1ZAR A;  2HQA A;  1WJE A;  3RZD J;  1Z7L A;  3HGY A;  4I02 A;  2MD5 A;  3SJM A;  1X19 A;  4FIS A;  3J81 Z;  2LY2 A;  1MMS A;  3NAR A;  1U3E M;  2KFD A;  3DEW A;  3KX2 A;  2RDP A;  2KP6 A;  1JKQ C;  1FNN A;  1WJB A;  3I4P A;  1Y6I A;  1MJA A;  1P4A A;  3DTI A;  1I6H J;  3H9Q A;  4BE0 A;  5CVI A;  4P9U A;  4YEJ A;  1OCZ H;  3L2C A;  1EA3 A;  3RQ4 A;  2L02 A;  2Q2E B;  1YW8 A;  2VOO A;  3GTQ J;  1O4X A;  3K2Z A;  5F0C A;  2J5O A;  2YR2 A;  4IL6 C;  2MLG A;  4G6T B;  1WCM J;  2W7N A;  1QU3 A;  2EZH A;  1XTA A;  1ZEL A;  4XMY A;  1YJ9 I;  4EJT A;  2MYS A;  1R5H A;  5M5X J;  3PFI A;  4PFO A;  4MNU A;  3WTX C;  4UNO A;  2IGN A;  2MA3 A;  1SC7 A;  2CGP A;  1KYZ A;  2C6Y A;  1KU9 A;  1YFH A;  1IXC A;  1G2H A;  1FT9 A;  1KYW A;  3QWL A;  5M3M J;  2Z16 A;  1PJR A;  3U1K A;  2LKP A;  4XSX F;  4BDY A;  2PBI A;  2OU2 A;  3V7R A;  3CCM I;  3W2W A;  3CCU I;  2X85 A;  4KDP A;  1BI2 A;  4GCV A;  1Y56 A;  1VQK I;  1ZTR A;  3SZT A;  3PQJ A;  4LG0 A;  3TW6 A;  3OIQ A;  3CMA I;  3CP8 A;  1OYY A;  1UMQ A;  4ESJ A;  2EQR A;  4MQ9 F;  3ULQ B;  4WF2 A;  1IJW C;  2VBY A;  3MD2 A;  3I54 A;  2HEO A;  4EV0 A;  2MLK A;  4R8H A;  3DKW A;  3G1O A;  4C3H J;  3F6O A;  2JPC A;  5JLX A;  2FU4 A;  1AU7 A;  1QO0 D;  3I71 A;  3VYS B;  3K4C A;  2DO7 A;  3I59 A;  4BJ5 C;  3BR6 A;  2AQF A;  3VFZ A;  2XGX A;  3GCM A;  2DBB A;  4XKC A;  3BTL A;  1N25 A;  4Q5S F;  2FE3 A;  2RNJ A;  4N9I A;  3BT9 A;  2DOF A;  3DQV C;  3GW2 A;  3OS1 A;  3HOZ J;  2VB6 A;  5DTD A;  3EUA A;  4EJV A;  4M6X A;  4G7Z F;  4XIC A;  1VQN I;  3GEZ A;  3OYH A;  2KQR A;  1R00 A;  2OCC H;  3W3C A;  2H1L A;  4DGW B;  2CW7 A;  5AON A;  3HRT A;  3E6B A;  2MH2 A;  4KJZ A;  2QSF X;  2UXX A;  3BJA A;  1DGW Y;  2W24 A;  5GAD J;  1WH7 A;  3NWS A;  2OAZ A;  3F6V A;  3KZY A;  3M4O J;  2EA4 A;  4DOZ A;  3G6E I;  3SZG A;  3BR3 A;  1F5T A;  1G3W A;  2K9L A;  2ZME A;  1S7A A;  1FIA A;  2CFO A;  3Q5F A;  2DFE A;  4RBO A;  4XLE A;  4BHC A;  2Y9Z A;  1VQL I;  3J81 K;  2IA0 A;  1MBK A;  4C2M J;  4EEF G;  2CG4 A;  5CPR B;  4BXX J;  3OV8 A;  3HUG A;  1JKO C;  1Z05 A;  1KGS A;  1YRN A;  1ZAO A;  3HZJ A;  3O8G A;  5HNF A;  1NTC A;  2VQL A;  3CCS I;  4OMY A;  2AQE A;  2XRN A;  3K9T A;  5EG0 A;  2A6H F;  1HW1 A;  2H8W A;  1FY7 A;  3K70 C;  2WY7 Q;  3KEO A;  3K70 D;  1G3S A;  1PUF B;  5CYV A;  2JA2 A;  2KIS A;  2KRC A;  4HA8 A;  3LMM A;  2M7B A;  3F9K A;  4W97 A;  3MEX A;  2X6W A;  5E79 C;  3GTM J;  2BW3 A;  1GLN A;  2E5N A;  1IUY A;  2R7Z J;  2KPM A;  3IUO A;  1U9O A;  2A69 F;  4O3M A;  2MG4 A;  2LTP A;  3LFU A;  3WOD F;  3ZQQ A;  1ERD A;  3KZZ A;  2OUM A;  3I0T A;  4OIR F;  1IDZ A;  3ZMU A;  3WTW C;  1LEB A;  1U5T B;  3CJN A;  4BKX A;  1ONV A;  1QNT A;  3ML6 A;  5KVR A;  3L00 A;  3CUQ C;  3KFW X;  4PZJ A;  2L01 A;  4A3I J;  3IP4 B;  2VKH A;  3ZR8 X;  5F04 A;  2F5D A;  1E2X A;  3U9G A;  3TO7 A;  2ZNZ A;  2ZJ2 A;  3ZQ7 A;  1XC5 A;  3HOW J;  1L0O C;  1ACI A;  2ZXJ A;  2PFB A;  5TGT A;  1LDK B;  2CQK A;  4M72 A;  1LE8 A;  5GPC A;  2E5Z A;  4NUB A;  1LNW A;  1IC8 A;  1Y39 A;  1HW2 A;  2LY9 A;  3K0L A;  5F1J A;  1D0Z A;  4I6Z A;  1RUO A;  2JMW A;  2XAS A;  1HA8 A;  1T39 A;  2E7W A;  2K9S A;  4HLX A;  3CCR I;  4CCO A;  2WTE A;  4OMZ A;  2B0L A;  2Z5U A;  1BM9 A;  3HKZ A;  1XGS A;  4M71 A;  3E6C C;  2HDC A;  2EA2 A;  1ZRF A;  2ZFU A;  2E1C A;  1JTY A;  3OYG A;  3CUO A;  4BYY A;  2EIN H;  4YFK F;  2O6G E;  2EZI A;  5JI6 A;  1G59 A;  3VYU B;  2NS8 A;  5KHD A;  2VE9 A;  4P9F A;  4UXN A;  3OYK A;  4HNV A;  2K86 A;  1DDN A;  2KDZ A;  2K3P A;  3S3N A;  4II3 A;  5DCM A;  3PJR A;  2AS5 F;  4BNC A;  3R4K A;  3CJQ B;  1ON2 A;  3G71 I;  1RIO H;  4I76 A;  4UB8 C;  3VYT B;  5F1R A;  1EV7 A;  3GLL A;  2CSO A;  2KRF A;  1W5S A;  5F0F A;  2E60 A;  3IKT A;  3BZK A;  1P4W A;  3AG2 H;  2E35 A;  4W1U A;  2OQG A;  4I09 A;  2IJL A;  1ZRC A;  4UUS A;  3L2V A;  1V5G A;  2DYS H;  3E97 A;  3VOE A;  1SEU A;  1ZGJ A;  1NK3 P;  1XDS A;  4LB5 A;  2RAE A;  1I3A A;  3LOC A;  2GA2 A;  2GA1 A;  3FKI J;  1LVA A;  1T56 A;  2Y9Y A;  4KIB A;  1K7A A;  2RN7 A;  3FMR A;  2E2I J;  2V4J C;  4XKV A;  1PP7 U;  1AWC A;  4OIP F;  1ETO A;  3HHG A;  2LRD A;  2QQ8 A;  2XAG A;  3CES A;  3TQN A;  5BS6 A;  4R1H A;  4LGW A;  1TNT A;  3IAS 2;  5IYD J;  3KP2 A;  2HOE A;  3RDI A;  1H9T A;  2LMD A;  3E7L A;  4QLC U;  4Y15 A;  1YW7 A;  3QAH A;  4LK0 F;  3OYM A;  2EWN A;  3MMY B;  2CUZ A;  4EVI A;  4A93 J;  2L7Z A;  5IP6 A;  3A2K A;  3UR3 C;  3VEP A;  1QVU A;  1TT0 A;  1OLT A;  2YSR A;  3CCQ I;  4CCL A;  2VC0 A;  3BCA A;  1W1W E;  4Q48 A;  3QOP A;  2L4A A;  4DBR A;  2XC7 A;  2QLZ A;  1KQ9 A;  1U8R A;  1WHU A;  1OMI A;  2M0C A;  1YIO A;  1WQ2 A;  3KP5 A;  1MH3 A;  1OJL A;  4L9T A;  5LRR A;  2OBP A;  4RGU A;  1T6S A;  3TED A;  2CW0 F;  2NAZ A;  4GFB A;  2VQH A;  3LWF A;  2FBK A;  2MAB A;  3E1S A;  5FKK A;  4ESF A;  3RTR A;  4NNJ A;  2K4J A;  3QOD A;  2G9W A;  5CQE A;  4XBF A;  4BAC A;  2F48 A;  2DI3 A;  2DA3 A;  3SHF A;  3A01 A;  4AC0 A;  1XGM A;  4IO9 F;  3BWG A;  1RI7 A;  5KAF C;  2HDD A;  3M07 A;  2LK2 A;  3PO3 J;  4X6A J;  2E1M C;  1SFU A;  1W4M A;  3GFI A;  4BXF A;  3HKZ N;  3KCC A;  1YQA A;  3HEF A;  2R7T A;  3E5Q A;  2B7E A;  1UJ8 A;  4Y13 A;  1KON A;  4I99 C;  3M8E A;  5FKO A;  5B5E C;  1SFX A;  4RA2 A;  3A4C A;  3CUQ B;  1IN4 A;  2V1X A;  1PP8 F;  3VSK A;  2NVT J;  1QBJ A;  2BHY A;  5CQG A;  3FM3 A;  4A5N A;  1VTN C;  3KLN A;  4RB1 A;  4DYR A;  1A36 A;  3GTJ J;  2V9K A;  1X3U A;  2IA1 A;  4FET A;  2ID3 A;  5HDK A;  2TDX A;  5FKM A;  1MKM A;  3OMY A;  2YX7 A;  5H20 A;  5A2Q K;  4AID A;  5FGM A;  4ABZ A;  2NVU B;  1YS7 A;  2F4I A;  5EDN A;  2MW8 A;  3WTU C;  3T0Y A;  1OQY A;  3ZMS A;  3SEZ A;  2ZXI A;  1FPQ A;  3OWT A;  2QA4 I;  2ZC2 A;  3ZP5 A;  4G6D A;  1Y0N A;  2PMU A;  4DQ2 A;  3JTH A;  2DW4 A;  3H9J A;  2R5Z B;  1T8I A;  4KN4 X;  4FCY A;  4ON0 A;  4EJU A;  3BR0 A;  3FIS A;  5BPI A;  2H6C A;  4HQM A;  4HRI A;  2DA4 A;  3Q9S A;  5EEH A;  1YIT I;  2R7S A;  4XLP F;  1X1B A;  1UZC A;  1H89 C;  1IV6 A;  2QVO A;  4CYC B;  3HOV J;  3EUK L;  4C30 A;  4XRM A;  2GXB A;  1WZ2 A;  3M3Y J;  3S15 J;  4BJ6 C;  5JR3 A;  3PQK A;  5C4J J;  2DOE A;  1FTZ A;  2CV1 A;  3K6G A;  4U7B A;  5GTH C;  3L9F A;  2KKO A;  2L0K A;  5H6Q A;  2OD5 A;  5FLM J;  2P7C B;  1BW6 A;  2CUJ A;  3CME I;  3G73 A;  3BLY A;  3KP6 A;  4FE4 A;  2DAO A;  1W7P A;  1MNE A;  3G3Z A;  4MGR A;  2ESN A;  1BR2 A;  3IWF A;  2PG4 A;  3ABM H;  4CA0 A;  2ZB9 A;  3FXO A;  3OL4 A;  5FB2 A;  4M9X A;  2V1U A;  3EQL F;  2XV4 S;  1MBE A;  3B6A A;  1G3Y A;  5JVG F;  2NNY A;  4LLL A;  4A3D J;  3DBH B;  4A0Y A;  2LP0 A;  4M74 A;  2IBD A;  2ID6 A;  2F5F A;  2Z2S B;  4AWX B;  2EFP A;  4WXH A;  2X48 A;  4NC6 A;  3C2H A;  4B1R A;  4NQW B;  4KIT B;  1XMA A;  3E5X A;  2OQR A;  3DCF A;  1STZ A;  3F72 A;  4S0H B;  4O6J A;  1RZ4 A;  4PGG A;  2M8G X;  3BG3 A;  1V4R A;  2JJ7 A;  1NG6 A;  2LC2 A;  1OFC X;  2NOJ B;  3CDL A;  3MKZ A;  2DK8 A;  3ZMD A;  3VDX A;  3GTP J;  2LYC A;  5GPA A;  2PN6 A;  3EDP A;  2Q2E A;  4XRS G;  1AA7 A;  1OKR A;  3FMS A;  4FE7 A;  5E8G A;  4B3X A;  1N78 A;  2EV0 A;  1LFP A;  3EYI A;  5FLX Z;  2WB1 A;  1B9M A;  4PJL A;  4A3C J;  3WTS C;  2GLO A;  5EEA A;  2AO9 A;  5IP9 J;  4AM3 A;  1HCR A;  1IUF A;  1SVM A;  1YIJ I;  5HDN A;  4LD5 A;  4PUS A;  3GUD A;  2XGD A;  2G0E A;  3CO6 C;  2XKP A;  2P6T A;  3OYL A;  4RS8 A;  1YI2 I;  3J7A O;  3FK6 A;  3AKZ A;  5C4X J;  2BXZ A;  1TLH B;  3COA C;  4KT5 C;  5J4Y A;  1MMA A;  1LEA A;  2A07 F;  1X4O A;  2OV7 A;  2EIL H;  5EF6 A;  1NHA A;  1AHD P;  1HF0 A;  1MJ9 A;  5KK1 A;  4AUX A;  1QVT A;  2IGK A;  3NEU A;  3RI4 A;  2NXN B;  3C2G A;  1GDT A;  2HTJ A;  3CCL I;  4F92 B;  4H0E A;  4I0B A;  2RVC A;  1HBX G;  1PDN C;  3FHN A;  3KP4 A;  2DQR A;  2CV0 A;  2JSP A;  5EGO B;  3L2Q A;  4XLA A;  4MIM A;  3V7S A;  2V9V A;  3REO A;  4KIF A;  1SD5 A;  2HOS A;  1FC3 A;  3ZOB A;  3K1M A;  3R60 A;  1REP C;  1XGO A;  1QHH D;  2KIF A;  2K02 A;  3H36 A;  3O3K A;  4EGY A;  1OYW A;  3ABK H;  5FJ8 J;  3JAM K;  4U0V A;  3S3M A;  3BPV A;  2XF5 A;  1UAA A;  4YRV A;  4ENK A;  1YE9 A;  2M45 A;  1FBQ A;  3ZN1 A;  3OYA A;  1FWZ A;  3ZQC A;  4XOP A;  2Z9O A;  1WWX A;  3CCY A;  2IP2 A;  5DD8 A;  2XVC A;  5IT3 A;  1R4N B;  4LIT A;  4MTD A;  4M3B A;  1WJF A;  1O7L A;  1S7O A;  5L3F A;  1QQI A;  2ZXH A;  3E3V A;  4G12 A;  1YJW I;  3QYF A;  1IF1 A;  3WGG A;  1YYV A;  2A6T A;  1FBS A;  1RPW A;  4IKF A;  3HTU A;  3M1E A;  1ETV A;  1HOM A;  2LF8 A;  3P9K A;  5FO5 A;  1JGG A;  4M6Y A;  1SAN A;  3CDH A;  1U78 A;  1JJ6 C;  2EIJ H;  4WXD A;  2QEN A;  4KFC A;  3KLO A;  1R49 A;  4G8X A;  4HEA 2;  2VUM J;  4BHP A;  2DQL A;  3TKY A;  1TWG J;  4ZYE A;  3W6K B;  3KET A;  3LSP A;  2PJR B;  2E7X A;  3F21 A;  3OL3 A;  3KYL A;  1ZH5 A;  2HVS A;  2FOK A;  3CF2 A;  3HG9 A;  3EYY A;  3FIW A;  5HS7 A;  3GWZ A;  5GP9 A;  1PUF A;  1R5G A;  3J7Y J;  1B72 B;  4ENJ A;  5M5W J;  2KJB A;  3T8R A;  2E34 A;  4F93 B;  2WB1 N;  5B3S H;  2V9P A;  1UG0 A;  5JFR A;  3P5J A;  5E1W A;  2WAF A;  5J1R A;  1G4D A;  2R7U A;  2J5P A;  1DPR A;  2DFH A;  5KNL A;  3BR5 A;  1TZL A;  1FYL A;  5E8I A;  1U5T A;  2M4K A;  1O3S A;  2PQ8 A;  3K4J A;  1PVE A;  2JRM A;  1DU6 A;  2IEK A;  2VE8 A;  5E1Z B;  2M0M A;  4ENN A;  2CW8 A;  4AYB A;  2LKX A;  3QOE A;  2XSD C;  4ESB A;  1ZRD A;  1X1C A;  4FT8 A;  2WY8 Q;  2OTJ I;  1WKM A;  3SFZ A;  2ZO4 A;  5IP7 J;  2X6X A;  2WV0 A;  4A3K J;  3GFM A;  2HI3 A;  3IH4 A;  3JR9 A;  3HPG A;  4J01 A;  1A35 A;  2YU9 J;  4HG2 A;  2K7L A;  1LQ1 A;  3WU0 A;  2BY0 A;  5ICE A;  5JLW A;  2DMN A;  1YG2 A;  3JW4 A;  2NS0 A;  5E20 A;  1Y8Q B;  1O3Q A;  5K7F A;  3DFG A;  3MVP A;  1XMX A;  2WV1 A;  2CMP A;  2ZCW A;  4KIC A;  5ED4 A;  4A6D A;  2YUS A;  4RM2 A;  5K5Q A;  4OIO F;  2JA8 J;  1MSE C;  4RAG A;  3FXK A;  1RKT A;  2MH9 A;  3V42 A;  2RKH A;  4OIN F;  1VZ0 A;  4ZDO A;  2IAI A;  2DMT A;  2EV6 A;  4J00 A;  1GT0 C;  2V6E A;  1J0R A;  5LBQ A;  1UHW A;  3SFI A;  1J59 A;  3SYT A;  1F36 A;  1T0F C;  5M5Y J;  4BAY A;  4A0Z A;  3KYD B;  2D5V A;  1G3T A;  4G6Q A;  1I27 A;  3MFK A;  4EQQ A;  5B1A H;  2LNB A;  2CUF A;  4HZF A;  3DU5 A;  3LA7 A;  3U2R A;  1ZK8 A;  3WHB A;  5ILS A;  3FX3 A;  1IGN A;  4Q4Z F;  3VB2 A;  4HLY A;  1W36 D;  5C3E J;  1FP1 D;  5M3F J;  2VJJ A;  1ZGW A;  3DKX A;  1HXD A;  1XSD A;  3JTG A;  1IRZ A;  2R7Q A;  2YPR A;  2LG4 A;  3F8N A;  4NC8 A;  4UVC A;  1RRJ A;  2FX0 A;  2LFB A;  1R23 A;  2UWM A;  2DOD A;  1Z91 A;  2W57 A;  2X51 A;  1EH8 A;  1Q1H A;  2FML A;  3F8M A;  4KIG A;  1YS6 A;  5LHI A;  2VBW A;  4U88 A;  3I3L A;  2QGU A;  5C44 J;  3L2W A;  3ABL H;  4P1W A;  1R6R A;  3PIO F;  5E3L A;  2H6B A;  2YX4 A;  3BCB A;  2ELH A;  4F7Z A;  2IGO A;  2W00 A;  4A3J J;  2JPB A;  4DNC A;  4RLF A;  2V1D A;  2BYV E;  4V2G A;  4AVZ A;  1N77 A;  3S2D J;  3D5L A;  4BUP A;  4S04 A;  2QQB A;  2R7V A;  4HV5 A;  1ETQ A;  3QPH A;  2GBY A;  4LFU A;  2BVM A;  4DZJ A;  2JA5 J;  2UV1 A;  1Z3X A;  1F43 A;  1YO5 C;  2R3S A;  4A3E J;  3W2A A;  4AYB N;  4BY1 J;  3VWB A;  4CCM A;  2H09 A;  1J9I A;  1ULY A;  3BDD A;  2Y0M A;  2F4M B;  3I64 A;  3ABU A;  3CJT B;  1JXS A;  2FBH A;  4ZYA A;  1LFB A;  3U1D A;  3ONQ A;  5LGT A;  4D7N A;  3OYB A;  2LSO A;  3PL8 A;  3WU1 B;  3JSO A;  2VKV A;  3EUH A;  4OAZ A;  3IWZ A;  3SZP A;  1IXS B;  1H0M A;  4RB2 C;  1TWC J;  3E5U A;  4KUM A;  1GV2 A;  5F64 A;  3DEU A;  1Y1W J;  1VI0 A;  1VQ4 I;  3QYE A;  4BDZ A;  1ORK A;  1XX5 A;  2LH9 A;  3R0J A;  3QU6 A;  3HB9 A;  2BGC A;  3AG3 H;  1MW7 A;  3BY6 A;  4I0A A;  1D1B A;  4NBQ A;  4HYE A;  2GZW A;  1GXQ A;  4NC7 A;  1X4P A;  2ESH A;  4M9Z A;  2E1O A;  3CUQ A;  1UEL B;  2XIG A;  3I55 I;  3B73 A;  3TO6 A;  1X58 A;  1RES A;  2D2W A;  1QZY A;  1JHH A;  2EIK H;  3H3U A;  4HNU A;  1QA6 A;  4C3J J;  3JCU C;  2EZK A;  3K10 A;  1I5Z A;  2HTS A;  2CV2 A;  4A0X A;  4XKW A;  4M9S A;  4F55 A;  1BR4 A;  1FYM A;  4RB0 A;  4IQJ A;  3CC2 I;  1R9T J;  3OS0 A;  1K4T A;  2E36 A;  3HGG A;  4HOB A;  3DTK A;  3LFK A;  5K5R A;  3L2U A;  3DF8 A;  4NHJ A;  2DTZ A;  3L7W A;  4BY7 J;  2O61 A;  4MTE A;  4MFD A;  2F5E A;  2JQ7 A;  5J1U A;  1S29 A;  2R5Z A;  2KDO A;  5K7Z A;  4Z2Y A;  4N0B A;  1FLI A;  2QBY A;  3BR2 A;  2L5Q A;  4QSH A;  3S17 J;  3KEY A;  2LDU A;  1JUM A;  1UHS A;  2BY3 A;  1BR1 A;  2BE5 F;  4F91 B;  5FRN A;  4ZC3 A;  4DZP A;  4CYC A;  1T2K A;  2FNP A;  3RKW A;  1ZYR F;  1J75 A;  5HS9 A;  4XLN F;  3WTT C;  2W82 A;  2RGV A;  2VBZ A;  4ZH4 F;  1H9G A;  2F5C A;  2W48 A;  3Q9V A;  4H4K C;  3NRV A;  2M87 A;  2XUB A;  4A12 A;  2LBF B;  1S7E A;  2M34 A;  4E7I A;  1JGS A;  2QKM B;  1WVR A;  3I5U A;  4BHB A;  2KZG A;  2K40 A;  4IPA A;  1V3F A;  5DV5 A;  2K4B A;  2HR3 A;  3W2V A;  2X4H A;  2XB5 A;  2R92 J;  3FXQ A;  1JT6 A;  1HKT A;  2TRT A;  1BC8 C;  1BJZ A;  3ESW B;  9ANT A;  2P5V A;  1Z21 A;  1P4X A;  2P6S A;  5L3E A;  2P0W A;  2O03 A;  1FBU A;  1IO2 A;  1IZ1 A;  1FEX A;  1BJA A; 
#chains in the Genus database with same CATH homology
 3BR0 A;  3FIS A;  2NOG A;  1HLV A;  2DA4 A;  2CJJ A;  2VI6 A;  2DMU A;  3OSF A;  2L9R A;  1H89 C;  1IV6 A;  4CYC B;  3HOV J;  4XRM A;  3M3Y J;  3S15 J;  4BBS J;  2MSY A;  5C4J J;  1JT0 A;  1FTZ A;  4M3F A;  2KT0 A;  1SFO J;  1P7J A;  2NVX J;  2N8G A;  3GTG J;  3IH2 A;  2L0K A;  1NK2 P;  5FLM J;  1VFC A;  5IPA A;  1BW6 A;  3Q0U A;  1RKW A;  1QPI A;  5HOD A;  1XS9 A;  2Y30 A;  4DYQ A;  3H3V K;  3IV5 A;  4FE4 A;  2DA6 A;  2PMZ N;  4L5E A;  3BR1 A;  4M6V A;  1MH4 A;  1X2M A;  5E3M A;  1ENH A;  1RR7 A;  2O8K A;  2ZB9 A;  2FD5 A;  1JKR C;  2QCO A;  2LLK A;  1A6I A;  2HQ5 A;  1MBE A;  2OPT A;  3B6A A;  3ZQG A;  3BTC A;  1TWA J;  3RKQ A;  3BQZ A;  5F08 A;  4A3D J;  2TCT A;  3JRC A;  2LP0 A;  4XID A;  2IBD A;  2ID6 A;  4M3E A;  3B6C A;  2X48 A;  1EF4 A;  2R5Y A;  5EZH A;  4B1R A;  1MBJ A;  4IHY A;  5FLV A;  2OF7 A;  3DCF A;  2H1K A;  1I50 J;  4S0H B;  4A3B J;  2XGE A;  3PM1 A;  1D5Y A;  2M8G X;  2EBI A;  3BG3 A;  1XG1 A;  2JJ7 A;  1MSF C;  4A69 C;  1OFC X;  3CDL A;  5EGO A;  3A02 A;  1JKP C;  2XB0 X;  3ZQF A;  3GTP J;  5GPA A;  1Y1V J;  3TP0 A;  3GBG A;  4XRS G;  4FE7 A;  3BTI A;  1LFU P;  1MBG A;  3JRE A;  4A3C J;  2GLO A;  5EEA A;  2AO9 A;  4JP0 A;  3S14 J;  4XK4 A;  5IP9 J;  1HCR A;  1IUF A;  2AHQ A;  2DJN A;  4A3F J;  2XGD A;  2G0E A;  3K2A A;  2ME0 A;  3BG9 A;  1FJL A;  3FK6 A;  1JUS A;  3CQZ J;  2B63 J;  5C4X J;  3Q3S A;  2NVY J;  4C3I J;  4IHW A;  2K9Q A;  1Z77 A;  2JA6 J;  2O9L A;  3S16 J;  3RZD J;  3HGY A;  3SJM A;  2R5Y B;  5IOY A;  5EF6 A;  4FIS A;  1AHD P;  1HF0 A;  2M2E A;  3NAR A;  4AUX A;  3OOU A;  3DEW A;  4DYC A;  1ITY A;  2O7O A;  4JX4 A;  1QVT A;  2XPV A;  2NS7 A;  1JKQ C;  1GDT A;  3I4N J;  3HOU J;  1I6H J;  5EGO B;  1WGX A;  2DA1 A;  1GUU A;  1E3O C;  4MIM A;  2E2H J;  3GTQ J;  1O4X A;  5F0C A;  2HOS A;  3ZOB A;  2JA7 J;  4QIW N;  2HXI A;  1K83 J;  2LD5 A;  1WCM J;  2EZH A;  3HBL A;  5FJ8 J;  3RQI A;  4IHV A;  5M5X J;  1B8I A;  1UG2 A;  3O8H A;  5E3O A;  3ZQC A;  3CCY A;  1G2H A;  4V2F A;  4MFE A;  5EYR A;  5M3M J;  2ECB A;  5IOZ A;  4M3G A;  3JRH A;  5EZG A;  3CMY A;  4M3B A;  3OSG A;  4A3G J;  4G12 A;  1WI3 A;  1ZTR A;  3BTJ A;  3TW6 A;  1RPW A;  2QF7 A;  3UKG A;  2JN6 A;  1ETV A;  5F0H A;  1UMQ A;  1HOM A;  2EQR A;  3LSG A;  1JGG A;  1IJW C;  1SAN A;  4X1E A;  3G1O A;  1U78 A;  1JJ6 C;  1RET A;  4C3H J;  5JLX A;  1AU7 A;  2VUM J;  1TWG J;  3K7A J;  3BR6 A;  3LSP A;  3BTL A;  3BG5 A;  3FIW A;  2DN0 A;  2CUE A;  5GP9 A;  3BT9 A;  2ECC A;  1PUF A;  3A03 A;  1B8I B;  1K61 A;  1B72 B;  3HOY J;  3HOZ J;  5DTD A;  1ZKG A;  5M5W J;  4XIC A;  4FTH A;  1IG7 A;  2WB1 N;  1U8B A;  2CU7 A;  2NVQ J;  5J1R A;  3RZO J;  2L7F P;  2R93 J;  1WH7 A;  4BBR J;  5J1Y A;  2E2J J;  3M4O J;  2DA7 A;  3JRA A;  3BR5 A;  3BR3 A;  1ETY A;  1FIA A;  3MN2 A;  2ELK A;  4RBO A;  2Y9Z A;  2FJ1 A;  1DU6 A;  3H0G J;  2IEK A;  1Q1V A;  2HXO A;  5FKL A;  1JUP A;  1MBK A;  4JYK A;  4C2M J;  1AKH A;  4EEF G;  4BXX J;  2LKX A;  5E3N A;  1ETX A;  2P81 A;  5IYB J;  2XSD C;  3JRI A;  1JKO C;  4A3L J;  1HDP A;  1YRN A;  3L1P A;  1JJ8 C;  3O8G A;  1NTC A;  5IP7 J;  4A3K J;  1DU0 A;  2DMQ A;  5EG0 A;  3JRB A;  2HI3 A;  3IH4 A;  3G1L A;  3JR9 A;  1PUF B;  2YU9 J;  3LSR A;  4W97 A;  4LOC A;  3GTM J;  1JTX A;  2R7Z J;  1TWF J;  2DMN A;  5JLW A;  1I3Q J;  1U9O A;  3GTK J;  3C2B A;  5K7F A;  2M9H A;  3NAU A;  2LTP A;  2MG4 A;  4NDL A;  3MVP A;  2WV1 A;  1IDZ A;  1W0U A;  2YUS A;  2JA8 J;  3JRG A;  4BKX A;  1MSE C;  3LSJ A;  1RKT A;  1BW5 A;  3S1N J;  2HOA A;  2XPW A;  2FQ4 A;  4A3I J;  3TW7 A;  1MNM C;  2IAI A;  2DMT A;  3JRD A;  1AKH B;  1GT0 C;  2XGC A;  5F04 A;  1TC3 C;  1GVD A;  1XC5 A;  3HOW J;  3SFI A;  4M3D A;  1F36 A;  1YRN B;  5M5Y J;  5IYC J;  2XPU A;  1LE8 A;  5GPC A;  2D5V A;  4DW6 A;  5EG0 B;  1IC8 A;  2CUF A;  2LY9 A;  1ZK8 A;  3WHB A;  5F1J A;  4I6Z A;  3WHC A;  2Y2Z A;  4MLO A;  4J19 A;  1IGN A;  1B72 A;  1HDD C;  2JMW A;  1Z0X A;  2CRG A;  4MO7 A;  5C3E J;  5M3F J;  3W6V A;  1POG A;  5BNG A;  1ZGW A;  1IRZ A;  2K9S A;  2EH3 A;  2FX0 A;  2LFB A;  2VKE A;  2I10 A;  1OCT C;  1JTY A;  1CQT A;  2EZI A;  1P7I A;  5C44 J;  2X6O A;  2NS8 A;  3ZQH A;  3I4M J;  5E3L A;  4HNV A;  2KDZ A;  5FKN A;  3F0C A;  2ME6 A;  4A3J J;  2LR8 A;  4V2G A;  2WAQ N;  2JK3 A;  4I76 A;  1MBH A;  3S2D J;  1U9N A;  3ZQI A;  3HM5 A;  1LE8 B;  5J3L A;  5F0F A;  4B4C A;  2H8R A;  4JX5 A;  4D5F A;  1ETQ A;  4W1U A;  4B3A A;  4UUS A;  2DA2 A;  2GBY A;  2JA5 J;  4DZJ A;  1F43 A;  4A3E J;  1NK3 P;  4AYB N;  4BY1 J;  2RAE A;  3LOC A;  3S1M J;  3GTL J;  3FKI J;  1T56 A;  2Y9Y A;  1FIP A;  2L7M P;  2E2I J;  1APL C;  2E19 A;  3S2H J;  1LFB A;  1ETO A;  4D7N A;  3IH3 A;  2VKV A;  1ETK A;  5IYD J;  1TWC J;  1BA5 A;  1GV2 A;  1ZR4 A;  2XRL A;  3E7L A;  1Y1W J;  1VI0 A;  2COB A;  1OCP A;  2HYJ A;  2R0Q C;  1ORK A;  3PO2 J;  3HOX J;  4A93 J;  3HB9 A;  2L7Z A;  5IP6 A;  3TP3 A;  3FK7 A;  1QVU A;  4Y7N J;  1VND A;  2Y31 A;  5F27 A;  2E1O A;  4RDU A;  3MKL A;  3S1Q J;  1A5J A;  4UUS B;  2EZL A;  1X2N A;  1X58 A;  1FTT A;  1RES A;  2M0C A;  1MH3 A;  1OJL A;  3BQY A;  4C3J J;  1T33 A;  2EZK A;  1GV5 A;  2VPR A;  3QPL A;  3TED A;  4GFB A;  1ZQ3 P;  1ZR2 A;  4IEJ A;  3GTO J;  2MGQ A;  5K7H A;  2GM4 A;  5FKK A;  2X9D A;  1R9T J;  3A01 A;  2DA3 A;  4AC0 A;  2Y0S N;  3HGG A;  3S1R J;  2HDD A;  4JX6 A;  2DTZ A;  3HDD A;  4BY7 J;  2LK2 A;  3PO3 J;  1H88 C;  4X6A J;  4MFD A;  3HKZ N;  4UUT A;  5J1U A;  3HEF A;  3LNQ A;  2R5Z A;  1H8A C;  3OIO A;  5K7Z A;  3BR2 A;  4QSH A;  3S17 J;  2JWT A;  3G1M A;  1BL0 A;  1JUM A;  1UHS A;  1W0T A;  1ETW A;  3QPS A;  5FKO A;  2CQX A;  2YS9 A;  4A3M J;  4CYC A;  4DZP A;  4Y52 J;  3SDG A;  2NVT J;  2K9N A;  1MBF A;  2W48 A;  4IHX A;  4DYR A;  3GTJ J;  1VF9 A;  3Q0W A;  1S7E A;  1TWH J;  2M34 A;  4QTR A;  4XRS A;  2ID3 A;  5FKM A;  2K40 A;  2LVS A;  4ABZ A;  1QRY A;  2CQQ A;  5EDN A;  2MW8 A;  3D1N I;  2XB5 A;  4D7M A;  1WPK A;  1IDY A;  1WH5 A;  2R92 J;  1JT6 A;  3A01 B;  2TRT A;  3Q0V A;  1BJZ A;  9ANT A;  2DMP A;  2HOT A;  5DS9 A;  3JRF A;  3ZQL A;  3QQA A;  3VPR A;  2R5Z B;  4FCY A;  1FEX A;  4D5C A;  2DA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...