1ETYA

The crystal structure of e. coli wild-type fis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
74
Chain Sequence
b'VLTVKPLRDSVKQALKNYFAQLVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 26
structure length 74
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etyA00
4ABZA 2HXIA 3FISA 1T33A 2MG4A 1MNMC 3G1LA 4A3KJ 2R7ZJ 3M4OJ 4MLOA 2MW8A 4UUTA 1EF4A 3GTOJ 1U8BA 3S1RJ 1BA5A 4MO7A 3Q3SA 1NK3P 1MBKA 1VI0A 1SFOJ 1ETOA 4Y7NJ 4DYCA 4XICA 2VUMJ 2WAQN 2MSYA 1WCMJ 1QRYA 4C3JJ 4X6AJ 5M5WJ 3WHCA 2IEKA 2XPVA 4D5CA 4FCYA 3FK6A 1JKPC 4CYCB 1H8AC 3K2AA 1Y1VJ 4C3IJ 1IC8A 4AC0A 1GVDA 2JA5J 1U9OA 2L0KA 2NS8A 2R5YA 2Y2ZA 4DW6A 5EEAA 1XC5A 3S1MJ 2ME6A 1H89C 2X6OA 2IAIA 3TP0A 4M3FA 2K40A 4XRSG 2VI6A 3PM1A 3GTKJ 5F0CA 2K9QA 2JA8J 5C44J 1XG1A 1RETA 1Z0XA 1QVTA 1ZK8A 3HB9A 2E1OA 3BR1A 3TEDA 2LK2A 2O8KA 3SDGA 3FK7A 3GTJJ 3BTCA 4A3JJ 1UG2A 4LOCA 3A01A 1A6IA 1AKHA 4L5EA 2K9SA 2XGCA 2R5ZB 1NTCA 3ZQLA 1Q1VA 2JMWA 4DZPA 3LSRA 4A3FJ 1VFCA 1IV6A 2E2IJ 4B4CA 1ENHA 3JRDA 1U78A 1W0UA 1BL0A 1DU6A 4DZJA 1GDTA 4A3IJ 2FQ4A 4NDLA 5FKKA 4BY1J 4XK4A 5F08A 1R9TJ 2JA6J 2FJ1A 3RKQA 1CQTA 1X2MA 1HLVA 1B72B 2NVXJ 3HGGA 2M8GX 1HOMA 1HDPA 5K7ZA 2EZIA 2DA2A 3BTIA 2CUEA 3HEFA 2HYJA 3NAUA 2EZHA 2Y9YA 1ETWA 3HOUJ 2YUSA 4IEJA 3HOVJ 5BNGA 1MH4A 5F0HA 5EGOA 1QVUA 2DA3A 1ZTRA 2TRTA 4JX6A 1APLC 5IYDJ 1RPWA 2ID6A 4D5FA 4JYKA 3HM5A 1FIAA 1AU7A 1TWCJ 5M3FJ 1HDDC 5IP6A 1ETXA 3S16J 3HOYJ 4I76A 3S2HJ 1FIPA 1GV5A 5JLWA 3HOZJ 1B8IA 4QSHA 2HOAA 3ZOBA 3HBLA 3BG9A 4V2GA 4A3DJ 4B3AA 2K9NA 1H88C 1S7EA 1MSEC 3JRIA 2G0EA 3JRGA 4DYRA 1TWAJ 4X1EA 5F0FA 2LKXA 3GBGA 3BR0A 3S2DJ 5IP9J 1X2NA 4A3MJ 2E2JJ 4J19A 2GBYA 1T56A 5EG0A 1ORKA 5EF6A 4S0HB 5FJ8J 4MFDA 1Y1WJ 3LNQA 4JX5A 4D7NA 4FISA 1UMQA 3VPRA 1HCRA 3GTQJ 5EDNA 4Y52J 2CQQA 3BR5A 3I4MJ 3BG5A 2KT0A 3BTJA 2XGEA 2I10A 3ZQGA 2XB0X 3JR9A 2L7FP 2DA1A 1JGGA 1QPIA 3BR2A 3RQIA 5FKOA 3L1PA 4GFBA 1MBFA 2R5YB 1WI3A 2LY9A 2DTZA 1ETKA 4AUXA 2VKVA 5GPCA 3JRBA 2IBDA 1W0TA 2EBIA 3O8HA 4EEFG 4FE4A 3ZQHA 1IG7A 2YU9J 2HI3A 3BQYA 2O9LA 1RR7A 2M34A 3ZQCA 5E3MA 1JUMA 4M3BA 2CRGA 2ID3A 3S1QJ 2ECBA 2DMUA 2E2HJ 3SFIA 1ZR2A 5EZGA 3A01B 1LE8A 1FJLA 5IOYA 2COBA 1AKHB 4A93J 1JTYA 2DMQA 4UUSA 3QQAA 1IDZA 3I4NJ 2HQ5A 3BG3A 3BT9A 3OOUA 2DMNA 1MBGA 1SANA 3TW6A 5M5XJ 1ETYA 1TWGJ 5C4XJ 1JKQC 4FE7A 1I6HJ 1LFBA 2VKEA 2VPRA 1MBJA 1U9NA 1ETQA 1JJ6C 1E3OC 5EZHA 3IH3A 1I50J 2CU7A 3HOXJ 3IV5A 4IHXA 2H8RA 2LP0A 2HOTA 2DJNA 2XPUA 3BTLA 5J1YA 3ZQIA 1TWHJ 2DMTA 5E3LA 1YRNA 2EH3A 5M5YJ 3HDDA 2X48A 3GTGJ 5IYBJ 2LR8A 1X58A 3FKIJ 1AHDP 1DU0A 1WPKA 4QTRA 4M6VA 2XB5A 1FTTA 2R92J 4W1UA 3IH4A 1F36A 2WV1A 2DMPA 2OPTA 4XRSA 2B63J 3C2BA 5J3LA 5EGOB 4IHWA 2YS9A 2OF7A 1P7IA 3E7LA 5EYRA 2JA7J 3M3YJ 1PUFA 1OFCX 5GPAA 4A3EJ 4DYQA 1WGXA 1TC3C 4A3GJ 1P7JA 2XPWA 2QCOA 2ECCA 3G1MA 2GLOA 1FEXA 1B8IB 3HGYA 1IGNA 3LSGA 3MN2A 2M0CA 2L7MP 1ETVA 1JTXA 4MIMA 3JRHA 3FIWA 3QPLA 5J1UA 3NARA 2MGQA 1O4XA 1VNDA 2NVQJ 2AO9A 2PMZN 1JKOC 3BR3A 2M2EA 3S1NJ 2W48A 4C2MJ 3OSGA 2FX0A 3OSFA 3A02A 4XRMA 2GM4A 3S14J 3JRFA 4BBRJ 2AHQA 4I6ZA 1XS9A 2JK3A 5EG0B 1OCTC 4HNVA 3DEWA 3DCFA 3BR6A 4C3HJ 4IHYA 5C4JJ 3B6AA 3PO2J 2JJ7A 3Q0UA 4A3LJ 1G2HA 1Z77A 4V2FA 1JT6A 2HOSA 1WH7A 1IRZA 3PO3J 4BBSJ 1ITYA 4M3EA 3LSJA 5IYCJ 2KDZA 3HOWJ 1IDYA 2EQRA 3F0CA 2HXOA 3RZOJ 5FLVA 1NK2P 4MFEA 1ZR4A 2LTPA 3K7AJ 3GTMJ 3OIOA 2LVSA 3TW7A 5FLMJ 1IJWC 3HKZN 4G12A 3GTLJ 3MVPA 2WB1N 2EZLA 1UHSA 2R93J 4CYCA 3CQZJ 2NOGA 4XIDA 1GUUA 2RAEA 5JLXA 3UKGA 1HF0A 1LE8B 2Y9ZA 3JRAA 3B6CA 5K7FA 2N8GA 2CQXA 3G1OA 4UUSB 5M3MJ 1MBEA 5FKNA 5FKMA 1ZGWA 1RKWA 2CUFA 2X9DA 1JUSA 3SJMA 2HDDA 3A03A 2E19A 5E3OA 3S17J 1VF9A 2EZKA 1JJ8C 1K61A 3W6VA 2CJJA 2ELKA 2FD5A 2XRLA 3H0GJ 2DA4A 2Y31A 4RBOA 4RDUA 2JWTA 2TCTA 2NS7A 4BKXA 3JREA 1MBHA 1YRNB 3CMYA 2H1KA 9ANTA 3H3VK 2DA7A 2D5VA 2ZB9A 1A5JA 1RKTA 2R5ZA 3LOCA 2JN6A 3D1NI 5F04A 5GP9A 1POGA 2LFBA 3CDLA 4JP0A 3JRCA 4M3GA 4BY7J 1ZKGA 4A3CJ 4BXXJ 3RZDJ 2Y30A 5DS9A 1OJLA 5J1RA 2XGDA 1WH5A 4A69C 1D5YA 5IP7J 3CCYA 5FKLA 3TP3A 2QF7A 3ZQFA 5K7HA 1JUPA 4FTHA 1OCPA 2XSDC 3GTPJ 1RESA 1BW6A 3S15J 2DN0A 1PUFB 1B72A 1TWFJ 1LFUP 1BW5A 1BJZA 1I3QJ 5E3NA 3MKLA 2NVYJ 2M9HA 3BQZA 4QIWN 1JKRC 2O7OA 5F1JA 4D7MA 4JX4A 5IPAA 3LSPA 2LD5A 1JT0A 3QPSA 5IOZA 4M3DA 3Q0WA 4AYBN 4IHVA 2L9RA 4A3BJ 3Q0VA 2DA6A 3WHBA 1GT0C 1FTZA 2L7ZA 2DA5A 1ZQ3P 3IH2A 1MH3A 4B1RA 5DTDA 3O8GA 2ME0A 4W97A 2NVTJ 2P81A 2R0QC 1F43A 1MSFC 5C3EJ 1K83J 2LLKA 2Y0SN 1IUFA 5F27A 1GV2A 5HODA
chains in the Genus database with same CATH superfamily
3JTHA 5J4VA 1NG6A 2VODA 2CG4A 2H1LA 1I6XA 3U1DA 2MG4A 1TZLA 2GXGA 1MNMC 4KFCA 4A5NA 4Q5SF 3N4MA 1OCOH 2R7ZJ 1PYVA 3OYBA 4NC7A 2EWNA 2CUJA 2MW8A 3ZMVA 4DQ2A 4YFXF 1EF4A 2JSCA 1JHFA 1W5SA 2BY0A 5L3GA 1ZLKA 1D1BA 1TW3A 2FF4A 1BA5A 1CF7A 1MBKA 1VI0A 5HS7A 2LMDA 4Y7NJ 3E5UA 5AONA 4IRIA 3GFMA 2X1DA 4PJJA 1LPQA 4X6AJ 3WHCA 1LFPA 2IEKA 3ISPA 3L7WA 2DQLA 2VBYA 4CSWA 2DXIA 4MQVA 1Y1VJ 1IC8A 3TBIA 4AVPA 4E70A 1GVDA 1AA7A 3FMQA 1U9OA 4A6EA 1H0MA 2NS8A 2QLZA 2ZFUA 2P4WA 4HOBA 5EEAA 2OQGA 1SEUA 2ESNA 2Q2EA 4N9HA 2ME6A 1H89C 2F5CA 2X6XA 1EA3A 4YFKF 2AXTC 1DP3A 5A2QK 4IHSA 2FXAA 3PM1A 5E1WA 2WAEA 1SD7A 4BAYA 1MNDA 3BDDA 4LK1F 1RETA 3J81Z 4CCLA 2HQAA 1KA8A 3V8LA 2O8XA 4IJAA 1QVTA 4LK0F 2DOFA 2ZBKA 3DBLB 3HB9A 2E1OA 4ZYDA 3TEDA 2LK2A 2X51A 4L9JA 2WC2A 4A6DA 4KT5C 4A12A 2Q0OA 3T8TA 1A6IA 4J00A 2OAZA 2A68F 2EIMH 3EETA 5L3BA 3S2WA 5K5OA 2M4KA 1HSJA 4A3FJ 3GO5A 1IV6A 4LJZF 5DYMA 3T8RA 2OD5A 1W36D 4IQ4A 3TO6A 1U78A 1YG2A 1FOYA 4QPQA 5GADJ 3FZVA 1GDTA 2L9NA 2OCEA 3FHZA 1DUXC 5FKKA 1XX5A 2ZFWA 4XKCA 4GGGA 5CVVA 2W7NA 4MGRA 1D1AA 3J7AY 2GIVA 3EQLF 2F4MB 1HLVA 4G6TB 1RUOA 3HGGA 3N05A 4U87A 2EZIA 3BTIA 4FX4A 1SC7A 5ILUA 1XPXA 3R61A 5JFRA 4JBAA 1WJ5A 3DWLE 1HW2A 5E1ZB 3IKVA 1T0FC 2XASA 3WGIA 2K4BA 4HW0A 5HDNA 2JRMA 4E4HA 1BI1A 5KK1A 3SEQA 2DA3A 3H3UA 1APLC 4JX6A 2E7XA 3DTEA 1RPWA 2HNHA 3KEYA 1FX7A 3ABLH 3M9AA 1TLHB 4BXUA 2WWYA 4ETSA 5M3FJ 4M9SA 2EJRA 4ENJA 3GXOA 5IP6A 2STTA 2OTLI 2KZGA 3OYMA 5CYVA 3Q9VA 3GFJA 1F1ZA 4HNTA 1B8IA 3ASNH 3RCOA 3ZOBA 3HBLA 2FBIA 5D5UB 1NG7A 4IXAA 1MSEC 2OZUA 3HJEA 3PFYA 4DYRA 3K4NA 2M7AA 4L9VA 3BR0A 4GXOA 2RGVA 4XKVA 2E2JJ 4N0BA 1ORKA 1TT0A 2VBZA 4S0HB 4OWRB 5KHDA 2HPMA 3K70D 3GLLA 4IVNA 1YIOA 4BS9A 1VZ0A 2M45A 1WQ2A 2JZYA 3H5RA 4M74A 1UMQA 1WI9A 3J7YJ 2LKSA 1HCRA 2JPCA 2QBYB 4Y52J 3I4MJ 2XAQA 3U21A 2FU4A 3LFKA 2V1DA 3VODA 2I10A 3ZQGA 3GX4X 2XB0X 1PP7U 5D8KB 2L7FP 2L9SA 1QU3A 5CQEA 3PNYA 3DPLC 3L1PA 1R1TA 4YEJA 1MBFA 4BQQA 3I58A 2ZKZA 3I54A 1IXRC 4U0YA 3NWSA 3O8HA 2E5ZA 3NWTA 2YU3A 4MEXF 3FM5A 3ZQHA 3GF2A 2YU9J 2HI3A 3OOPA 1JI8A 5FRMA 2XHKA 2LG4A 2VASA 3IC7A 4N4NB 5E3MA 1AWCA 3C7JA 5BQTA 2IS6A 2A05A 2JT1A 3OYNA 1RC9A 2UXXA 1Z67A 2HU9A 2OQRA 2HGCA 2ECBA 1LQ1A 5CVJA 2CWEA 1ZR2A 2Z1DA 3E97A 3S8PA 5EZGA 3QOEA 5IOYA 3C2HA 3GUDA 2ZMEA 4PJ0C 1U2WA 2EINH 2HQ5A 3TW6A 3GFLA 5M5XJ 4BQNA 2QENA 5C4XJ 3CDIA 4V19K 1JKQC 3RTRA 3A0BC 5DCMA 2NRAC 3RJPA 2VPRA 4KN4X 2YPRA 1YTYA 1O7LA 3SYTA 4G7OF 1XTAA 2W25A 2KLOA 2KRFA 2JUGA 3AL0C 1FMWA 3GYHX 4IKFA 2LP0A 4CA0A 4OIRF 3BTLA 5F64A 4Y17A 5IT3A 1TWHJ 1YRNA 5D6EA 3BCBA 5M5YJ 2FBHA 2KJBA 5IYBJ 3F22A 4UY8I 1ZRDA 2L7KA 3HPHA 1WPKA 2D2WA 2GAUA 2K5CA 4M6VA 2XB5A 4HLXA 5CPRB 3I3LA 1FTTA 4W1UA 4IZZA 3CCUI 3K4CA 2OPTA 2M1BA 4BEHB 3ZCOA 5KVRA 4CCJA 4JK1X 5J3LA 2J5OA 3JAMZ 2YS9A 3CCQI 2XAGA 1XN7A 1P7IA 1IN8A 1Y0UA 2EFNA 4FHTA 4L0ZB 2JA7J 4CICA 2R4GA 3M3YJ 1SD4A 1FMVA 1OFCX 2KIQA 5TRDA 2X1CA 3HSFA 1PP8F 4DYQA 4GO1A 1TC3C 2GXBA 3CP2A 2VE9A 4DOZA 3F23A 1QBJA 2GLOA 2PJRB 3H3ZA 1G6NA 1S5LC 4BE2A 4CZZA 1R5ID 2L7MP 1G3SA 1X1AA 2MGQA 2EK5A 1UG0A 3J81K 5K5RA 2AO9A 2FOWA 3BR3A 5HLGA 3M7GA 1SVMA 2M2EA 1E17A 2LH9A 2FX0A 4KNYA 1R23A 2BBYA 5CJ9A 4XRMA 3CJTB 3P5JA 2E1MC 4BBRJ 1Q1HA 2LY2A 3R0JA 3FBIB 2ACJA 2JK3A 2D1HA 2DT7B 4PUSA 3VSKA 3VYSB 4HNVA 3COAC 4OAZA 1V3FA 3BR6A 4WCGA 4IX7A 1XGSA 2JJ7A 3L09A 4HX4A 2Q1ZB 2XGXA 3GEZA 1KYWA 3CO7C 2DJIA 1XD7A 4V2FA 1IN5A 1O3QA 2DFEA 1FOWA 1SAUA 3VFZA 4RGSA 3ZRGA 2EILH 3CJNA 3F3XA 1KZHA 2A5WA 2QKLB 3P9CA 3GCMA 5HVQC 2YX4A 1Z6TA 2M8EA 4I0AA 5IYCJ 3CTAA 3KP6A 1GXQA 1GVJA 1U5TC 2HXOA 4RB0A 2KIUA 2P0WA 2XAHA 3CCVI 3PL8A 2ICWG 1DPRA 2V6CA 4ZTFA 4KMFA 4MFEA 2LREA 1ZR4A 3CCMI 3I4PA 5DV5A 2PMUA 3KZZA 2V4JC 4HF1A 2FMLA 2R7OA 4KIBA 3LSMA 4XLCA 4E7HA 3KP2A 2W24A 5ERIA 3OYGA 4XIDA 4U7BA 5JLXA 2LBFB 4HRIA 5ED4A 2CQXA 2IXSA 2EPFA 2G9WA 2RKHA 1K79A 2A07F 3TOBA 5FKNA 3KEOA 1QA6A 1SFKA 4FASD 3J7ZI 4JQFA 2DO7A 3ZMUA 2X9DA 4HAMA 3I59A 1JUSA 1S8NA 2WTEA 2W85A 2E19A 2Z2SB 4LB5A 2FQ3A 4Y13A 1WHUA 5B5EC 5GAHJ 1W5CC 2NYXA 4ZYGA 1I27A 1T98A 2ELKA 4ZDPA 2Y31A 4MHGA 4ZYAA 1MDMB 3ZGKA 4BKXA 3MZHA 1LJ9A 5GAGJ 3WGGA 1BIBA 3H3VK 2ZXIA 2A6TA 1A5JA 1UELB 4II2A 2PLYA 4Y33A 1JHHA 2DYSH 3EPZA 1SD5A 2HYGD 3D1NI 5F04A 4E6KG 2MABA 1POGA 3A0HC 1LNWA 1Z6RA 3OYLA 4M3GA 2PMHA 1WJAA 3MAJA 3RZDJ 1NH3A 2R7UA 1OJLA 3BG6A 4RLQA 1SMYF 3V4GA 3I64A 2BXYA 1FBUA 2E5NA 5FGMA 1B9NA 3ZQFA 5D8LB 1UAAA 4HV5A 4M9XA 1UHWA 2XSDC 1BW6A 2XF6A 4RS8A 3K1NA 3K70C 3KYCB 2V9KA 1YOVB 2G7UA 2BHYA 2HVRA 1OYIA 4UXNA 3BQZA 1JKRC 3IAM2 1VTNC 5FROA 5IPAA 1J75A 3HYIA 2LD5A 5FD5A 3QPSA 3DBHB 4QWQA 1WFXA 2P5KA 3HRUA 3TKYA 2L9RA 1P92A 2F4IA 3MKZA 1FTZA 3CJQB 3K2ZA 3C3WA 3WHBA 4CCOA 1T39A 5E8IA 1W7PA 3HZJA 2BGCA 3BG7A 3PFIA 1Z3XA 3O8GA 4W97A 4LD5A 1ZYRF 1ZGAA 4M72A 2UZKA 4OINF 5C3EJ 3CUQC 4NC6A 2LLKA 1R49A 2NNNA 3FDYA 4P96A 4EVIA 2GOMA 4BJ6C 2LF7A 5F27A 2CV0A 2NNYA 4DBQA 3CCEI 1S9HA 3DPTA 1OCRH 3G1LA 3OS1A 3PNVA 5E20A 1X1PA 1K4SA 1G4DA 1Y39A 4LLGF 1YI2I 3S1RJ 2EFOA 2OU2A 3HXLA 1EH7A 3R4KA 5HS8A 4MO7A 3Q3SA 1NK3P 1A04A 2FRHA 3HRMA 4HNUA 1I39A 3OL4A 2PMZA 3HOTA 1QHHD 2MD5A 2WAQN 2DFHA 2HEOA 3LSHA 1R4MB 5M5WJ 1D0YA 1S7AA 1UFMA 2NS0A 2R3SA 2XPVA 4D5CA 1JKPC 1H8AC 3U1KA 2GA2A 3JAMK 2DK5A 1K78B 2JUCA 2MH9A 2F5DA 4KIGA 2L0KA 3VEPA 4KISA 4LB6B 1CGPA 4I0BA 2Y2ZA 3V8KA 4BXFA 3MQ0A 4DW6A 3S1MJ 3DXJF 2M5WA 2DYRH 2X6OA 3TP0A 2CW7A 2RDPA 1QNTA 1QZYA 3GTKJ 3WTVC 2JA8J 5C44J 5HLTA 3VDXA 2PQ8A 1KQ0A 4P9FA 2OCCH 4HPQA 4I99C 3CLQA 5DM7F 3SDGA 3G2BA 2ESHA 3MEXA 1RZ4A 4H4KC 3GTJJ 4A3JJ 1MW7A 4UB8C 2R7QA 4CZCA 4XNFA 2LSOA 2XDVA 3LA2A 4LITA 1SFEA 2XGCA 1NTCA 3VSLA 4UB6C 1Q1VA 2BOLA 2JMWA 3WTYC 2W1OA 2BW3B 1Z7UA 3LA3A 3FKJA 1HC8A 1MMSA 3HKZA 1BI3A 2VOPA 2ZXJA 1W0UA 1BL0A 4M9ZA 2WB1A 3DF8A 4B09A 1LDJA 3QYBA 4XLNF 4NDLA 1NHAA 5L3EA 1G3TA 4BY1J 5F08A 4HSTA 4ZJZA 4YRVA 4Y15A 1W1WE 2FJ1A 5H20A 5J47A 3F8MA 1X2MA 2F5EA 1B72B 3EUAA 1H9TA 2BZTA 2E36A 3R0AA 2DA2A 2BEOA 4ENKA 1Y56A 3HEFA 4TV7A 1R00A 2HYJA 4YELA 2VC1A 1YJNI 2EZHA 3Q9SA 5J8FA 3MKYB 3RDIA 3HOUJ 2DAOA 1U8RA 4IEJA 1D5VA 5D4SA 2PEXA 2HOEA 2CYYA 2DW4A 3IHUA 5BNGA 3ZMSA 1N75A 2LDUA 4R1HA 5F0HA 2JPBA 3EUHA 1UCRA 4L5JA 4AU7A 3E1SA 1USSA 2TRTA 5IYDJ 4N9IA 2ID6A 5BS6A 1YIJI 3E6DA 4C9YA 3HM5A 4RAGA 2LC2A 5FB2A 1YX3A 5DD4A 1AU7A 2IGOA 5LGNA 1Y0NA 1O3SA 4RA2A 1L0OC 3KETA 3L00A 1LVKA 2ZXHA 1KU2A 4ZC3A 4ON0A 4EQQA 3HOYJ 2B7EA 5BOXA 2QQAA 3JW4A 2MD0A 4QSHA 2HOAA 2EV5A 5HNHA 4V2GA 3WG7H 4A3DJ 2K9NA 1ZAOA 2MH2A 2W00A 4EJTA 3JRIA 2G0EA 5LEKA 3JRGA 4F7ZA 1WSUA 4PSWA 2ZCWA 2IPQX 2VQCA 1MMAA 2IGKA 1OCZH 2V1UA 3G3ZA 2P6SA 5IP9J 1SVOA 3KZIC 4IOAF 2JQ7A 2WAFA 2KIFA 2V9VA 1D8KA 1KQ9A 2GBYA 1FLIA 3LAJA 2CV1A 4EATA 4AIDA 3CUOA 3ONQA 1YW9A 1PJRA 2CFOA 1LB2A 3CCRI 3CMEI 1SAXA 1REPC 3VPRA 3MZYA 2ZNZA 2OTJI 5EDNA 4BH9A 3DTKA 3RPUD 5JR3A 3JSPA 3BTJA 2IS2A 2HR3A 4XN0A 1R4NB 2DOEA 2KJCA 4ZH4F 2CMPA 2XF7A 1BOBA 3ASOH 3K10A 2KP6A 1EJ9A 1O3RA 1WI3A 3HTSB 1MNEA 2DTZA 5GPCA 3JRBA 2IBDA 2Q2EB 2QVOA 3HSRA 1W0TA 3M8FA 3JSOA 4IL6C 4EEFG 2BY1A 3BQYA 2DDAA 2O9LA 1RR7A 1FSEA 1HW1A 2QUFA 1ZGJA 1TQPA 3WE2A 3T1BA 1FYLA 2RNGA 4Z2YA 1JUMA 4YFNF 1OLTA 2CRGA 2ID3A 4RMNA 1IN6A 3TO7A 1YLFA 3QU3A 4O6JA 3A1YA 3DU5A 1BI0A 5TISC 4BQAA 1FJLA 3SHFA 1JGSA 1OYYA 1BR1A 1I5ZA 4UUSA 3IP4B 3QQAA 5KCMA 5LBQA 3G73A 3I4NJ 3DV8A 2W82A 3IAS2 2F5VA 1I6HJ 3OR2C 3GZNB 1U9NA 1E3OC 2CV2A 5EZHA 4FT8A 4PSXA 3DKXA 1FY7A 4RGRA 1HKQA 3NRVA 4IHXA 1P9QC 5KNLA 1YYVA 4I09A 3ZMTA 3K4BA 4BYYA 2DJNA 3QOPA 5FLXZ 1H9GA 4AD9A 4AIKA 3OWTA 5LRRA 5E3LA 1FOXA 1SFXA 1XCVA 2EH3A 3HDDA 3HSEA 3M07A 1X58A 1X4OA 2MC3A 3FKIJ 4QTRA 1X4PA 2COMA 2HTJA 2PX9A 1X1BA 2K4JA 2VT2A 1XCBA 4XORA 2R92J 1W4MA 3KP4A 2WV1A 3ERMA 4LG0A 3KLNA 4HF0A 2XVCA 5H2FC 3S3NA 1IRGA 3E7LA 1KGSA 4AIJA 1R36A 5HLIA 4ASNA 4C2TA 3CZ6A 3BC8A 3H5NA 1K6OA 1ODDA 1U3EM 1J5YA 3BWGA 3ERED 4BDZA 5GPAA 2ZJRF 4A3EJ 1XDSA 1WGXA 3DKYA 3F8FA 1X3WB 2OJED 4A3GJ 1ZREA 4KT6A 5ILSA 4J01A 2PG4A 3PQJA 1B8IB 2QEXI 3MN2A 2M0CA 1SD6A 1UHMA 1XMXA 1ZG3A 3W3CA 1E0EA 3JRHA 3FIWA 3H35A 3QPLA 4MQ9F 2NVQJ 2PMZN 2L4AA 1JKOC 2Y0MA 2R7FA 2LRDA 3IRRA 1IXCA 3S1NJ 4C2MJ 1QO0D 1DP7P 1V5EA 4IHTA 4YIFA 3K1MA 4IOCF 2H6BA 1T0FA 2VXDA 2DQRA 3WTZA 5HDGA 4OOIA 1XDUA 3Q0UA 2CGPA 1V54H 2VOOA 1W7PD 1E3PA 3HHHA 1X3ZB 3CCSI 2W57A 1DPUA 3S3MA 2KQRA 1PDNC 1IRZA 3QP6A 4ZYHA 5KAFC 1K7AA 1VQKI 3PO3J 4ZTJA 4BBSJ 2QQ8A 4M3EA 3LSJA 4U88A 4GYIA 3LQRA 1IDYA 5E8GA 5ICGA 4BNCA 4OU0A 5D5VB 2CQNA 1LDDA 2Y69H 1SMTA 1TNSA 1WVRA 2HQRA 3B02A 1IN4A 4A0YA 4UHTA 2ZMEC 4EJOA 3GFIA 2VB6A 4OIOF 1KU9A 3D0SA 3D5LA 3U9GA 4EGZA 2R7SA 4EJWA 1IJWC 4G6DA 3HKZN 3MCZA 1OCCH 4X0GA 3MVPA 4HEA2 2PI0A 2WB1N 3I0TA 4WF2A 4EGYA 1UHSA 5BMZA 1WWXA 4CYCA 1B4AA 1J9IA 2KMUA 3E5QA 4F91B 5JVTA 1GUUA 4XOPA 3O2PE 1HF0A 1BIAA 2HZTA 3RKYA 2Y9ZA 3B6CA 4XBFA 5F1RA 5K7FA 2ZMEB 2N8GA 4B44A 1X3UA 5M3MJ 1XGNA 2A69F 2Z33A 3R60A 1EH6A 1ZGWA 4HBLA 4A0ZA 4HSRA 3DLLF 5DCMB 2NAZA 2EIJH 2XKPA 3KYDB 4G6QA 3QYFA 3RIRA 2WAQA 2XRNA 3W2WA 2IGMA 5GTIC 5HS9A 1K61A 2EB7A 2CJJA 2XRLA 3H0GJ 3J80Z 1IF1A 2DA4A 2I8DA 3FMRA 4RDUA 4HDUA 1VQ6I 2FEZA 3JCUC 2ZC2A 3KP5A 1R22A 2GIZA 1YRNB 2R7XA 4ZYEA 9ANTA 4KN7X 3M8JA 2VQGA 2XKOA 3CDHA 2FMYA 4R79A 2R5ZA 3HL2A 3WTSC 4H0EA 2QKMB 3CDLA 5B66C 4L0YB 4A3CJ 1ZKGA 2CW0F 2P6TA 4WXHA 4BU2A 1G3WA 4A69C 4LLLA 3CCYA 3H0DA 2QF7A 5K7HA 1XGMA 1OCPA 1FNNA 2X85A 1RESA 3C2GA 1VQMI 4BL0B 3OS2A 1VQ5I 5CQGA 2IW5A 3S15J 3ABKH 2DN0A 3QAHA 4EMSA 2OA4A 3ZMDA 1FP2A 1HXDA 2EFQA 4RM2A 3CO6C 1YS6A 1VQ8I 1ZH5A 2IJLA 1I3QJ 5E3NA 1OR7C 4AWXB 2NVYJ 3ML6A 3O6BB 2EIKH 1IV8A 2MA3A 3IUOA 4JX4A 4D0PA 3LSTA 4KICA 2F4OB 4GCVA 2OZ6A 5JVGF 4M3DA 2DK8A 2P8TA 4Y3OA 3MD2A 2R7DA 2K85A 3AKZA 3W2VA 1J59A 3PJRA 3FXMA 5L3FA 2RQQA 3IH2A 3K4KA 4XLEA 2L02A 3L2VA 1OMIA 5DTDA 2X6YA 2NVTJ 3TL4X 3S3OA 1A6QA 1F43A 2LF8A 4PJMA 5B1AH 3LSKA 2E34A 3ZN0A 2PJPA 3BCAA 1WJEA 2OC6A 4G9YA 5FFXA 1YW8A 5TJJA 2JRTA 3ZR8X 4IRHA 4JOMA 1J7KA 2HXIA 2PN6A 2DPDA 4B3XA 1HKSA 2RC4A 5FLXK 4IRGA 4MLOA 1Y8QB 4UUTA 2H94A 2HQNA 3GTOJ 5L3DA 4BQOA 4WWCA 1YQAA 1E3HA 2VJIA 2JSPA 3DEUA 1YFHA 1W36C 1LUJB 2ELHA 2M7BA 4DYCA 4XICA 2ADUA 3BY6A 2VUMJ 2MSYA 4EV0A 3WU1B 2XC7A 1WCMJ 2YR2A 4HLYA 5EJCA 4WXCA 1VQ7I 3FK6A 2V1NA 2IRFG 1TBXA 4C3IJ 2HWVA 5LGUA 2FSWA 1WJBA 2KIMA 2JA5J 1Z05A 2LKPA 1M1EB 2Z99A 3TMOA 2R5YA 3CC2I 4G8XA 1XC5A 4RLFA 5IY5H 2QZ8A 4M3FA 4LGWA 2DT6A 2K40A 4L9NA 4P5OA 4F93B 3I59B 4FETA 2VI6A 5F0CA 4HA8A 1XG1A 2JA2A 2BVLA 3OYFA 1R58A 5LD2C 2IA2A 3OYHA 1Z0XA 2JTVA 3GW2A 1FWZA 1ZK8A 2ZXWH 3FWEA 4GDFA 1U5TA 5D5XB 1A35A 2O8KA 2JVHA 3FK7A 3AG4H 3K0LA 3BTCA 4HQEA 2VBXA 2IS4A 3KZYA 4LOCA 2WADA 3A01A 2V1XA 3DPUA 3KCCA 2LOOA 1AKHA 3OYIA 2AQEA 4E7KA 1UZCA 4CYDA 4IPAA 1XSXA 2HYFA 4PFOA 2E7WA 3ZQLA 5D4RA 2F2EA 3LSRA 3GMEA 2E2IJ 2O5RA 5D6FA 4B4CA 1ENHA 5E18F 2VXZA 3FXLA 4FQGA 3E0JB 1PUEE 1DU6A 1V4RA 3R6SA 5JHUA 4A5MA 4WK8F 4XK4A 4XR6A 2XROA 1MDMA 4M6XA 1BC7C 4KDPA 2JA6J 3KLOA 3RKQA 3AG3H 4E7ZA 1CQTA 2ZJ2A 3F8NA 5K7ZA 1FT9A 2X0LA 2CUEA 1TNTA 3ABMH 3WTTC 1S7OA 2Y9YA 4XLFA 3BROA 2K02A 3EYIA 2YUSA 4XOTA 2J5PA 3HOVJ 3GVAA 4RAYA 1BN5A 4BHPA 2VQHA 2FNAA 1B59A 3SZTA 3FMSA 2O03A 5EGOA 2OBPA 1QVUA 1ZTRA 2GQQA 2VBWA 1FIAA 2FBKA 3KP7A 1O57A 1W7PB 1TWCJ 1HDDC 1FOKA 3VYRB 2VJ4A 1ETXA 1J0RA 1EKEA 1R6RA 3CJRB 4I76A 4BHBA 1BR2A 5JLWA 4CGZA 2ZJQF 2VLAA 3BLYA 3HOZJ 2CSOA 1XSVA 3BG9A 1HA8A 2EV0A 3H1CA 1S7EA 3IWZA 2TDXA 4G7HF 1TWAJ 3QODA 4BJTA 5F0FA 3KYLA 3K6GA 3GBGA 2HDWA 4XLAA 2PFBA 1X2NA 2HVQA 4BJ5C 3CC7I 4CO8A 3VYTB 4J19A 5EG0A 4BGDA 1WKMA 1FC3A 1BJAA 4PFPA 3LAPA 1ACIA 3PIPF 4MFDA 3DFGA 4CH7A 4JX5A 1P4AA 1HW5A 2V9PA 5DCFA 4FISA 3I53A 4OAYA 1FYKA 2IP2A 3VOEA 4BHCA 1O7FA 1QHGA 3BZ6A 3BPXA 2ISZA 2KT0A 1A31A 1HSTA 1K6YA 3BJOA 1W5TA 1ZRFA 2L5QA 3ULQB 1QPIA 3HUGA 4GFBA 2LY9A 4PZJA 1ETKA 3CUQA 1G3YA 3LL7A 4AUXA 3OYCA 2AXLA 2EBIA 1T08B 3UR3C 3LQQA 2RN7A 2XUBA 5H6QA 3AAFA 1IG7A 2RV8A 1VQ4I 4RB1A 2A5YB 2DTRA 2VPLA 3SEZA 1TW2A 2KKOA 3L2QA 1D8JA 4CCNA 2E1NA 4E7SA 1RR8C 3LSIA 3V8JA 2Z5UA 4C2UA 2DMUA 2ETHA 3TDZC 4ZZDA 3SFIA 4N4OB 2MFZA 1LE8A 4A93J 1T95A 3L2RA 1JTYA 1IDZA 1MBGA 2QGUA 4Y4RA 1ETYA 1TWGJ 3FXQA 1YITI 4D9JA 2ZJPF 1LFBA 1IW7F 4PGGA 1FYMA 2A61A 2Z9OA 2IVMA 1QPMA 2MC4A 1ZELA 1R1UA 4P9UA 3IH3A 1O3TA 1OISA 1I50J 3IV5A 4UUVA 2L4MA 2MYSA 3K69A 3CCLI 2HOTA 5AIQA 2AS5F 1RUNA 3FBNB 4U0VA 4OIPF 2IS1A 2HKXA 5B1BH 5J6XA 4I98B 4NC8A 3H9JA 1BM9A 3ECOA 4HV6A 2WY8Q 3E3VA 1LEBA 4GYGA 3A2KA 2PBIA 3RQ4A 2VIXA 3IH4A 3D5RC 4YIRX 1MIJA 2DMPA 3LFUA 3P7NA 3GWZA 3W6KB 4BUPA 4IHWA 1FSHA 4F3QA 2OF7A 2KHMA 5J4YA 2P5LC 5EYRA 4EM1A 1PUFA 1UJ8A 2FE3A 1P7JA 2XPWA 2QCOA 2ECCA 1FEXA 2RNJA 3BJ6A 2BVMA 3OYKA 2QQBA 1IGNA 3LSGA 4NQWB 5JHFA 3IL2A 2HZDA 1ETVA 1FBSA 1Y6IA 2MLKA 4M6YA 1O4XA 3P9KA 1UB9A 4HYEA 2F5FA 4L9TA 3V42A 3OSGA 2H09A 3OSFA 2XAUA 2XSJC 3MFKA 2GOXB 3S14J 1VQNI 2CS3A 3H5AA 1XS9A 1LVAA 1OPCA 3F8CA 3DEWA 2EFWA 3ZMZA 3CD6I 4C3HJ 1YJ9I 4IHYA 4C30A 3K9TA 5C4JJ 1Z3YA 2EA2A 3PO2J 4A3LJ 4U7DA 2BHZA 1CF7B 5E17F 1YX5A 1T38A 2KDOA 4MTEA 1WH7A 4LG3A 3WG9A 4YIIA 3SDBA 4DIQA 4AVZA 3TGNA 1ITYA 2A6EF 2L2OA 3HOWJ 2HVSA 1HKTA 1FPQA 5GTHC 2K27A 3IRQA 4U0WA 3L2UA 2F6CA 4G7ZF 2V79A 2VC0A 2IA1A 5K5QA 4BE0A 3KIOA 3WE3A 2VL8A 1NK2P 5FLVA 2K9MA 3K7AJ 3GTMJ 2LVSA 5FLMJ 3V7CA 4G12A 5LLQA 1X1CA 1KONA 2I5UA 3I55I 5FO5A 3FM3A 3GTLJ 1N78A 1LDKB 1Z9CA 3HIFA 2EZLA 2QWWA 4I7HA 3F72A 3CQZJ 1B9MA 5HOOA 4YG2F 4DJAA 2RAEA 4XKWA 3ELKA 3O3KA 4GRIA 1VQOI 3F6OA 3G1OA 4UUSB 2FNPA 1BBYA 4EJVA 2KL4A 1P6RA 1U0JA 1MBEA 1R1VA 1ZG1A 5B3SH 2CUFA 4HDVA 2D1VA 3TDUC 1X1DA 2HDDA 5E3OA 1MMGA 1VF9A 2EZKA 3UNGC 3ZQ7A 3MZ8A 4F55A 2AQFA 2GZWA 2LY1A 3FHNA 3W6VA 1BI2A 2FD5A 3PSIA 3F21A 5EEHA 2M3AA 3QYEA 2E60A 2TCTA 3K1PA 4NHJA 4RAZA 2NS7A 1XB4A 4KUMA 1Z91A 2W84A 4II3A 2CW8A 3JREA 1MJBA 1XMAA 4K2EA 3HOSA 5ICEA 1ZARA 6PAXA 2DA7A 2ZB9A 3GZ6A 3E6CC 1RKTA 3MWMA 3LOCA 2IT0A 2JN6A 5GP9A 4I2OA 3I71A 1KQ8A 1Z7LA 3ABTA 4BXXJ 2P5VA 1GXPA 3H9QA 1WH5A 4LG0B 2CO5A 1JUPA 4FTHA 2E35A 4UV9A 3ESWB 1D0XA 1MJ9A 3OS0A 1QZEA 4S04A 2WA0A 3E6BA 3PUFA 2HFHA 3K4JA 1LFUP 1BR4A 1BJZA 3T5XA 2O0YA 2R7VA 3NEUA 1V55H 2M9HA 3F8BA 4O5VA 4F52A 4CDGA 4QIWN 1D1CA 4D7MA 1HBXG 5FFZA 4ZZLA 4XLHA 3G71I 3LSPA 3NQOA 3OIQA 2CUZA 3Q0WA 3TOAA 4L5IA 4IHVA 2H8WA 4OMYA 2DPUA 2DA6A 2ZO4A 1GT0C 2DA5A 1OYWA 3AG2H 2L3DA 5DUKA 3N97A 2DI3A 3QPTA 4UVBA 4B1RA 4E7IA 2ME0A 4CCKA 5K1YA 2P81A 4R8HA 2R0QC 2DBBA 4I02A 2QA4I 5LEJA 4UV8A 2DOAA 2FUG2 3TO9A 3AG1H 3DEEA 2DU9A 2KRCA 1IUFA 3RPQA 3QU6A 4KYWA 2MLGA 2K9LA 1DDNA 4LLNA 1ON2A 4ABZA 3FISA 1T33A 4OMZA 5CVRA 3ZQQA 4A3KJ 3M4OJ 1DGRM 3KEQA 3KX2A 2QSHX 3RKXA 2OV7A 1IAWA 1U8BA 3SXYA 4ESJA 1USTA 1DQUA 4E7LA 1SFOJ 3V7RA 1ETOA 1YE9A 3BJAA 4NB5A 4CHUA 3TQNA 1QRYA 4C3JJ 4A0XA 2QBYA 3Q5FA 4FCYA 4CYCB 3L2CA 3K2AA 4LMYA 4PJNA 4AC0A 4BE1A 4RGXA 3LWFA 3ROUA 1IN7A 4ENMA 2STWA 5JI6A 1JXSA 2EA4A 2NXNB 4HX7A 2IAIA 3CP8A 2O6GE 4XRSG 4CCMA 2K9QA 3G4SI 1ZHFA 4LFUA 2GXAA 5H6RA 1KU7A 1IO2A 2C6YA 1RIOH 2F48A 4XQFA 3BOQA 2B0LA 4XMYA 3SQNA 3BR1A 1UG2A 1PVEA 4L5EA 5HLHA 4XL9A 2K9SA 4QPOA 2HKOA 3RKWA 5IT9Z 4E7JA 3PNTA 3LMMA 2R5ZB 1S6LA 3I56I 1N77A 1JE8A 4DZPA 5LHIA 2UWMA 1VFCA 2UUZA 4UVAA 3BP8A 3CC4I 5D5WB 2X6WA 3M8EA 3JRDA 2O3FA 4ESFA 4CUGA 3C18A 1VQLI 1MGTA 4DZJA 4A3IJ 2FQ4A 3BZCA 3J7AO 3F6VA 5CLSA 4NUBA 1R9TJ 2X4HA 1T2KA 3B73A 2KISA 3IWFA 4M73A 1ZG5A 1GHCA 3CF2A 4A2UA 3RI4A 4XLPF 3OYAA 4ZDOA 2WV0A 3HC7A 2M8GX 2NVXJ 1HOMA 4P1WA 1HDPA 4L18B 2Z16A 1FZPB 2XF5A 1A36A 4WXDA 3AL0B 3H9GA 2V26A 3NAUA 1ETWA 1J09A 2DT5A 1P4WA 2NOJB 3KFWX 1ULYA 3S32A 1BOAA 2VKDA 4BEHA 1MH4A 5EEGA 1TP4A 3D5SC 4OIQF 1D3YA 2VT3A 1B6AA 4D5FA 3E6MA 4JYKA 3GZ5A 3OY9A 3S93A 4BACA 4KIFA 4DBRA 2HDCA 1XGOA 1KYZA 1WZ2A 3S16J 3S2HJ 2PJRA 2QSGX 1FIPA 1GV5A 3HRTA 2FA5A 3HG9A 1F5TA 1F9NA 2CQ7A 5DD8A 4B47A 2QYOA 1EV7A 5LRSA 4B3AA 1H88C 5FD6A 2D45A 1X19A 3ZP5A 1K4TA 4PJLA 4XONA 4X1EA 1YO5C 2ZSHB 2DODA 2LKXA 1RI7A 2WBMA 4Q48A 3S2DJ 3VWBA 4A3MJ 1OR7A 3PIOF 1T56A 2H6CA 4EJUA 5EF6A 4B48A 3RPUA 2DCEA 3W6JB 5FJ8J 2QM3A 2R7RA 2CFXA 2UXNA 3LNQA 1Y1WJ 2FOKA 4D7NA 2K7LA 3KE2A 1S72I 3GTQJ 2E1MB 1L3LA 2CQQA 2ZSIB 3BR5A 4AYBA 3BG5A 4RM3A 3LA7A 4B43A 4WX9A 2XGEA 1HQCA 3JR9A 1P4XA 2DA1A 1JGGA 3OL3A 3BR2A 4IF4A 3P9IA 3RQIA 5FKOA 5CKTA 4MEYF 3EDPA 4PDKA 5E79C 2R5YB 4M71A 1R5HA 2VKVA 5DM6F 2VJ5A 4XSXF 1BC8C 4HG2A 2P7VB 3SFZA 4FE4A 3C1DA 4XM3A 2Y0SA 4Q47A 1T6SA 2M34A 3ZQCA 5DDGA 3EUKL 1IXSB 2Y75A 2EFPA 1YHQI 1YJWI 3CCJI 1RRJA 3QP5A 4M3BA 1T8IA 1B1BA 3OYEA 3S1QJ 2L01A 1U5TB 5E1XA 2E2HJ 2K3PA 4ITVA 2ELJA 3A01B 2LBFA 2KPMA 2M87A 2COBA 3JTGA 1AKHB 4XKBA 4ZDLA 3ABUA 2DMQA 2Z3YA 3BG3A 3BT9A 3OOUA 2DMNA 1SANA 2DFIA 4FE7A 1ZRCA 2VKEA 4Z6YA 1MBJA 1ETQA 2IGNA 4G94A 1JJ6C 3PQKA 1KU3A 5DUIA 1S29A 2DLLA 1VQPI 4F92B 2CU7A 3HOXJ 1Z1DA 1E2XA 4PGHA 2H8RA 2BY2A 1J2XA 3M1EA 5BPIA 4ESBA 4IQJA 2XPUA 4RGUA 2K86A 5J1YA 3K4LA 2DMTA 2VQLA 3VYUB 3ZQIA 3G6EI 3WTUC 2X48A 2HPIA 3E5XA 3FXOA 1MKMA 1WJCA 2LR8A 3GTGJ 2ISYA 2LNBA 1AHDP 2V7FA 2CQKA 3KPHA 1DU0A 3OR1C 5CVUA 2QQ9A 4UVCA 3ZPLA 5AIPA 1OKRA 2OUMA 4EM0B 1F36A 1IRXA 3SZPA 1FP1D 2VJJA 4XRSA 1IUYA 4KJZA 3DBRB 2B63J 1Z21A 3C2BA 3HTUA 1TQIA 5EGOB 2XV4S 2DDBA 5ILVA 2NVUB 4XN3A 1IZ1A 4S05A 3L9FA 1MMDA 1RNLA 3MMYB 5A2QZ 2B9SA 3IKTA 1ZLJA 3OYDA 3G1MA 3DP7A 5J40A 2H27A 2E1CA 3HGYA 3OV8A 3VB2A 5LGTA 1JTXA 2VKHA 4MIMA 3U2RA 5FRNA 5J1UA 3SZGA 2KRHA 3NARA 1DGWY 1VNDA 4LIUA 5HDKA 3HRSA 3CESA 2E71A 2W48A 1G8XA 3K4MA 3M1CA 3J80K 3EYYA 3A02A 2GM4A 3BZKA 1TQMA 5L3CA 3JRFA 1C0WA 2A3SA 2AHQA 3HHGA 3QPHA 4PCQA 5J8CA 4I6ZA 2V6EA 3MKWB 4KA4A 3H36A 3A4CA 5EG0B 1OCTC 3W2AA 1MJAA 5CVIA 3DCFA 1U6GA 5IT9K 1SVLA 2KZVA 3B6AA 3WTXC 4LIVA 2R7TA 1G2HA 3ZXSA 2XAFA 4ENNA 1Z77A 2HS5A 5KAIC 3BPVA 3WU2C 1JT6A 2HOSA 4P55A 4NNJA 4B8XA 1R5GA 4HQMA 3HUGB 4CXFA 2KDZA 4AM3A 5HNFA 1IRFA 5LHGA 1TTYA 3T0YA 2BE5F 3CUQB 3WODF 2EQRA 4XSZF 4ANJA 3F0CA 5LFAA 3RZOJ 3RYRA 3RYPA 1LKXA 1WJFA 2LTPA 2DFFA 3OIOA 4NBQA 1N25A 1XSDA 3QRFF 3TW7A 3L2WA 1GLNA 1QZZA 3F9KA 4RAFA 3PUBA 2R93J 2MBFA 4KMUX 2NOGA 3FX3A 2JVGA 5LHHA 5GAEJ 1I1GA 2VE8A 3WU0A 2R7WA 1K78A 3UKGA 5F6FA 1LE8B 3JRAA 1V5GA 4MNUA 3X2QH 5FKMA 2P7CB 1G59A 1RKWA 1ON1A 2RQPA 4KITB 4FX0A 2G7HA 3CF5F 3SJMA 3A03A 1Y8RB 2IA0A 2LYCA 3S17J 2Y48A 1JJ8C 1FBQA 2UV1A 5BPDA 4RBOA 3HPGA 2JWTA 1ONVA 1LEAA 1STZA 2EV6A 1S3JA 1MMNA 3DQVC 3H92A 1TT5B 1TL8A 3FXRA 4QLCU 2O61A 4DGWB 1MBHA 4HZFA 2WY7Q 3WTWC 3CMYA 2H1KA 3KP3A 3EUHC 3RSNA 3PSFA 2D5VA 4IO9F 4RB2C 3I9V2 3AFHA 3GLXA 2LFBA 2BW3A 4JP0A 3JRCA 1XMKA 3FF5A 4BY7J 3I5UA 2YSRA 2Y30A 5DS9A 1AOYA 5J1RA 2XGDA 2M0MA 2XAJA 1D5YA 1MZBA 5IP7J 5FKLA 3TP3A 1SFUA 4BDYA 3CMMA 4D1QA 2ZNYA 3GTPJ 5DEQA 3OYJA 4HX8A 4MTDA 1I3AA 1D0ZA 3DU6A 1PUFB 3FXJA 1YW7A 3DLAA 1TWFJ 2BXZA 1B72A 1R7JA 2CH0A 4I01A 4EM2A 2BY3A 2RREA 4XRFA 1BW5A 1WJDA 2RVCA 3DKWA 3FXKA 3MKLA 1VQ9I 2M4GA 3V7SA 2L54A 2O7OA 1WRJA 3CLOA 3OMYA 1V5FA 5F1JA 4HF2A 2A6HF 1ZN2A 2L9VA 2YX7A 3OIPA 1JT0A 2BYVE 5IOZA 1QQIA 2Q8KA 2GWRA 2M30A 4AIHA 3WGHA 2VN2A 4AYBN 1QGPA 3ZN1A 3DTIA 4A3BJ 3Q0VA 1OQYA 2X1EA 2L7ZA 1ZQ3P 2BV6A 1I1SA 5ICCA 1EH8A 2QSFX 3ECHA 1R71A 4DNCA 1MH3A 2K3FA 1YS7A 3REOA 4Q4ZF 5TGTA 1P2FA 2W4SA 4O3MA 1F4KA 1ERDA 4NQWA 2HTSA 3QWLA 1MSFC 2VONA 3CMAI 4PK4A 1K83J 1MD0A 2KFDA 3FXUA 4RB3C 2GA1A 2Y0SN 5ICFA 1GV2A 4UNOA 5HODA 2XIGA
chains in the Genus database with same CATH topology
4ABZA 2HXIA 3FISA 1T33A 2MG4A 1MNMC 3G1LA 4A3KJ 2R7ZJ 3M4OJ 4MLOA 2MW8A 4UUTA 1EF4A 3GTOJ 1U8BA 3S1RJ 1BA5A 4MO7A 3Q3SA 1NK3P 1MBKA 1VI0A 1SFOJ 1ETOA 4Y7NJ 4DYCA 4XICA 2VUMJ 2WAQN 2MSYA 1WCMJ 1QRYA 4C3JJ 4X6AJ 5M5WJ 3WHCA 2IEKA 2XPVA 4D5CA 4FCYA 3FK6A 1JKPC 4CYCB 1H8AC 3K2AA 1Y1VJ 4C3IJ 1IC8A 4AC0A 1GVDA 2JA5J 1U9OA 2L0KA 2NS8A 2R5YA 2Y2ZA 4DW6A 5EEAA 1XC5A 3S1MJ 2ME6A 1H89C 2X6OA 2IAIA 3TP0A 4M3FA 2K40A 4XRSG 2VI6A 3PM1A 3GTKJ 5F0CA 2K9QA 2JA8J 5C44J 1XG1A 1RETA 1Z0XA 1QVTA 1ZK8A 3HB9A 2E1OA 3BR1A 3TEDA 2LK2A 2O8KA 3SDGA 3FK7A 3GTJJ 3BTCA 4A3JJ 1UG2A 4LOCA 3A01A 1A6IA 1AKHA 4L5EA 2K9SA 2XGCA 2R5ZB 1NTCA 3ZQLA 1Q1VA 2JMWA 4DZPA 3LSRA 4A3FJ 1VFCA 1IV6A 2E2IJ 4B4CA 1ENHA 3JRDA 1U78A 1W0UA 1BL0A 1DU6A 4DZJA 1GDTA 4A3IJ 2FQ4A 4NDLA 5FKKA 4BY1J 4XK4A 5F08A 1R9TJ 2JA6J 2FJ1A 3RKQA 1CQTA 1X2MA 1HLVA 1B72B 2NVXJ 3HGGA 2M8GX 1HOMA 1HDPA 5K7ZA 2EZIA 2DA2A 3BTIA 2CUEA 3HEFA 2HYJA 3NAUA 2EZHA 2Y9YA 1ETWA 3HOUJ 2YUSA 4IEJA 3HOVJ 5BNGA 1MH4A 5F0HA 5EGOA 1QVUA 2DA3A 1ZTRA 2TRTA 4JX6A 1APLC 5IYDJ 1RPWA 2ID6A 4D5FA 4JYKA 3HM5A 1FIAA 1AU7A 1TWCJ 5M3FJ 1HDDC 5IP6A 1ETXA 3S16J 3HOYJ 4I76A 3S2HJ 1FIPA 1GV5A 5JLWA 3HOZJ 1B8IA 4QSHA 2HOAA 3ZOBA 3HBLA 3BG9A 4V2GA 4A3DJ 4B3AA 2K9NA 1H88C 1S7EA 1MSEC 3JRIA 2G0EA 3JRGA 4DYRA 1TWAJ 4X1EA 5F0FA 2LKXA 3GBGA 3BR0A 3S2DJ 5IP9J 1X2NA 4A3MJ 2E2JJ 4J19A 2GBYA 1T56A 5EG0A 1ORKA 5EF6A 4S0HB 5FJ8J 4MFDA 1Y1WJ 3LNQA 4JX5A 4D7NA 4FISA 1UMQA 3VPRA 1HCRA 3GTQJ 5EDNA 4Y52J 2CQQA 3BR5A 3I4MJ 3BG5A 2KT0A 3BTJA 2XGEA 2I10A 3ZQGA 2XB0X 3JR9A 2L7FP 2DA1A 1JGGA 1QPIA 3BR2A 3RQIA 5FKOA 3L1PA 4GFBA 1MBFA 2R5YB 1WI3A 2LY9A 2DTZA 1ETKA 4AUXA 2VKVA 5GPCA 3JRBA 2IBDA 1W0TA 2EBIA 3O8HA 4EEFG 4FE4A 3ZQHA 1IG7A 2YU9J 2HI3A 3BQYA 2O9LA 1RR7A 2M34A 3ZQCA 5E3MA 1JUMA 4M3BA 2CRGA 2ID3A 3S1QJ 2ECBA 2DMUA 2E2HJ 3SFIA 1ZR2A 5EZGA 3A01B 1LE8A 1FJLA 5IOYA 2COBA 1AKHB 4A93J 1JTYA 2DMQA 4UUSA 3QQAA 1IDZA 3I4NJ 2HQ5A 3BG3A 3BT9A 3OOUA 2DMNA 1MBGA 1SANA 3TW6A 5M5XJ 1ETYA 1TWGJ 5C4XJ 1JKQC 4FE7A 1I6HJ 1LFBA 2VKEA 2VPRA 1MBJA 1U9NA 1ETQA 1JJ6C 1E3OC 5EZHA 3IH3A 1I50J 2CU7A 3HOXJ 3IV5A 4IHXA 2H8RA 2LP0A 2HOTA 2DJNA 2XPUA 3BTLA 5J1YA 3ZQIA 1TWHJ 2DMTA 5E3LA 1YRNA 2EH3A 5M5YJ 3HDDA 2X48A 3GTGJ 5IYBJ 2LR8A 1X58A 3FKIJ 1AHDP 1DU0A 1WPKA 4QTRA 4M6VA 2XB5A 1FTTA 2R92J 4W1UA 3IH4A 1F36A 2WV1A 2DMPA 2OPTA 4XRSA 2B63J 3C2BA 5J3LA 5EGOB 4IHWA 2YS9A 2OF7A 1P7IA 3E7LA 5EYRA 2JA7J 3M3YJ 1PUFA 1OFCX 5GPAA 4A3EJ 4DYQA 1WGXA 1TC3C 4A3GJ 1P7JA 2XPWA 2QCOA 2ECCA 3G1MA 2GLOA 1FEXA 1B8IB 3HGYA 1IGNA 3LSGA 3MN2A 2M0CA 2L7MP 1ETVA 1JTXA 4MIMA 3JRHA 3FIWA 3QPLA 5J1UA 3NARA 2MGQA 1O4XA 1VNDA 2NVQJ 2AO9A 2PMZN 1JKOC 3BR3A 2M2EA 3S1NJ 2W48A 4C2MJ 3OSGA 2FX0A 3OSFA 3A02A 4XRMA 2GM4A 3S14J 3JRFA 4BBRJ 2AHQA 4I6ZA 1XS9A 2JK3A 5EG0B 1OCTC 4HNVA 3DEWA 3DCFA 3BR6A 4C3HJ 4IHYA 5C4JJ 3B6AA 3PO2J 2JJ7A 3Q0UA 4A3LJ 1G2HA 1Z77A 4V2FA 1JT6A 2HOSA 1WH7A 1IRZA 3PO3J 4BBSJ 1ITYA 4M3EA 3LSJA 5IYCJ 2KDZA 3HOWJ 1IDYA 2EQRA 3F0CA 2HXOA 3RZOJ 5FLVA 1NK2P 4MFEA 1ZR4A 2LTPA 3K7AJ 3GTMJ 3OIOA 2LVSA 3TW7A 5FLMJ 1IJWC 3HKZN 4G12A 3GTLJ 3MVPA 2WB1N 2EZLA 1UHSA 2R93J 4CYCA 3CQZJ 2NOGA 4XIDA 1GUUA 2RAEA 5JLXA 3UKGA 1HF0A 1LE8B 2Y9ZA 3JRAA 3B6CA 5K7FA 2N8GA 2CQXA 3G1OA 4UUSB 5M3MJ 1MBEA 5FKNA 5FKMA 1ZGWA 1RKWA 2CUFA 2X9DA 1JUSA 3SJMA 2HDDA 3A03A 2E19A 5E3OA 3S17J 1VF9A 2EZKA 1JJ8C 1K61A 3W6VA 2CJJA 2ELKA 2FD5A 2XRLA 3H0GJ 2DA4A 2Y31A 4RBOA 4RDUA 2JWTA 2TCTA 2NS7A 4BKXA 3JREA 1MBHA 1YRNB 3CMYA 2H1KA 9ANTA 3H3VK 2DA7A 2D5VA 2ZB9A 1A5JA 1RKTA 2R5ZA 3LOCA 2JN6A 3D1NI 5F04A 5GP9A 1POGA 2LFBA 3CDLA 4JP0A 3JRCA 4M3GA 4BY7J 1ZKGA 4A3CJ 4BXXJ 3RZDJ 2Y30A 5DS9A 1OJLA 5J1RA 2XGDA 1WH5A 4A69C 1D5YA 5IP7J 3CCYA 5FKLA 3TP3A 2QF7A 3ZQFA 5K7HA 1JUPA 4FTHA 1OCPA 2XSDC 3GTPJ 1RESA 1BW6A 3S15J 2DN0A 1PUFB 1B72A 1TWFJ 1LFUP 1BW5A 1BJZA 1I3QJ 5E3NA 3MKLA 2NVYJ 2M9HA 3BQZA 4QIWN 1JKRC 2O7OA 5F1JA 4D7MA 4JX4A 5IPAA 3LSPA 2LD5A 1JT0A 3QPSA 5IOZA 4M3DA 3Q0WA 4AYBN 4IHVA 2L9RA 4A3BJ 3Q0VA 2DA6A 3WHBA 1GT0C 1FTZA 2L7ZA 2DA5A 1ZQ3P 3IH2A 1MH3A 4B1RA 5DTDA 3O8GA 2ME0A 4W97A 2NVTJ 2P81A 2R0QC 1F43A 1MSFC 5C3EJ 1K83J 2LLKA 2Y0SN 1IUFA 5F27A 1GV2A 5HODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABZ A;  2HXI A;  3FIS A;  1T33 A;  2MG4 A;  1MNM C;  3G1L A;  4A3K J;  2R7Z J;  3M4O J;  4MLO A;  2MW8 A;  4UUT A;  1EF4 A;  3GTO J;  1U8B A;  3S1R J;  1BA5 A;  4MO7 A;  3Q3S A;  1NK3 P;  1MBK A;  1VI0 A;  1SFO J;  1ETO A;  4Y7N J;  4DYC A;  4XIC A;  2VUM J;  2WAQ N;  2MSY A;  1WCM J;  1QRY A;  4C3J J;  4X6A J;  5M5W J;  3WHC A;  2IEK A;  2XPV A;  4D5C A;  4FCY A;  3FK6 A;  1JKP C;  4CYC B;  1H8A C;  3K2A A;  1Y1V J;  4C3I J;  1IC8 A;  4AC0 A;  1GVD A;  2JA5 J;  1U9O A;  2L0K A;  2NS8 A;  2R5Y A;  2Y2Z A;  4DW6 A;  5EEA A;  1XC5 A;  3S1M J;  2ME6 A;  1H89 C;  2X6O A;  2IAI A;  3TP0 A;  4M3F A;  2K40 A;  4XRS G;  2VI6 A;  3PM1 A;  3GTK J;  5F0C A;  2K9Q A;  2JA8 J;  5C44 J;  1XG1 A;  1RET A;  1Z0X A;  1QVT A;  1ZK8 A;  3HB9 A;  2E1O A;  3BR1 A;  3TED A;  2LK2 A;  2O8K A;  3SDG A;  3FK7 A;  3GTJ J;  3BTC A;  4A3J J;  1UG2 A;  4LOC A;  3A01 A;  1A6I A;  1AKH A;  4L5E A;  2K9S A;  2XGC A;  2R5Z B;  1NTC A;  3ZQL A;  1Q1V A;  2JMW A;  4DZP A;  3LSR A;  4A3F J;  1VFC A;  1IV6 A;  2E2I J;  4B4C A;  1ENH A;  3JRD A;  1U78 A;  1W0U A;  1BL0 A;  1DU6 A;  4DZJ A;  1GDT A;  4A3I J;  2FQ4 A;  4NDL A;  5FKK A;  4BY1 J;  4XK4 A;  5F08 A;  1R9T J;  2JA6 J;  2FJ1 A;  3RKQ A;  1CQT A;  1X2M A;  1HLV A;  1B72 B;  2NVX J;  3HGG A;  2M8G X;  1HOM A;  1HDP A;  5K7Z A;  2EZI A;  2DA2 A;  3BTI A;  2CUE A;  3HEF A;  2HYJ A;  3NAU A;  2EZH A;  2Y9Y A;  1ETW A;  3HOU J;  2YUS A;  4IEJ A;  3HOV J;  5BNG A;  1MH4 A;  5F0H A;  5EGO A;  1QVU A;  2DA3 A;  1ZTR A;  2TRT A;  4JX6 A;  1APL C;  5IYD J;  1RPW A;  2ID6 A;  4D5F A;  4JYK A;  3HM5 A;  1FIA A;  1AU7 A;  1TWC J;  5M3F J;  1HDD C;  5IP6 A;  1ETX A;  3S16 J;  3HOY J;  4I76 A;  3S2H J;  1FIP A;  1GV5 A;  5JLW A;  3HOZ J;  1B8I A;  4QSH A;  2HOA A;  3ZOB A;  3HBL A;  3BG9 A;  4V2G A;  4A3D J;  4B3A A;  2K9N A;  1H88 C;  1S7E A;  1MSE C;  3JRI A;  2G0E A;  3JRG A;  4DYR A;  1TWA J;  4X1E A;  5F0F A;  2LKX A;  3GBG A;  3BR0 A;  3S2D J;  5IP9 J;  1X2N A;  4A3M J;  2E2J J;  4J19 A;  2GBY A;  1T56 A;  5EG0 A;  1ORK A;  5EF6 A;  4S0H B;  5FJ8 J;  4MFD A;  1Y1W J;  3LNQ A;  4JX5 A;  4D7N A;  4FIS A;  1UMQ A;  3VPR A;  1HCR A;  3GTQ J;  5EDN A;  4Y52 J;  2CQQ A;  3BR5 A;  3I4M J;  3BG5 A;  2KT0 A;  3BTJ A;  2XGE A;  2I10 A;  3ZQG A;  2XB0 X;  3JR9 A;  2L7F P;  2DA1 A;  1JGG A;  1QPI A;  3BR2 A;  3RQI A;  5FKO A;  3L1P A;  4GFB A;  1MBF A;  2R5Y B;  1WI3 A;  2LY9 A;  2DTZ A;  1ETK A;  4AUX A;  2VKV A;  5GPC A;  3JRB A;  2IBD A;  1W0T A;  2EBI A;  3O8H A;  4EEF G;  4FE4 A;  3ZQH A;  1IG7 A;  2YU9 J;  2HI3 A;  3BQY A;  2O9L A;  1RR7 A;  2M34 A;  3ZQC A;  5E3M A;  1JUM A;  4M3B A;  2CRG A;  2ID3 A;  3S1Q J;  2ECB A;  2DMU A;  2E2H J;  3SFI A;  1ZR2 A;  5EZG A;  3A01 B;  1LE8 A;  1FJL A;  5IOY A;  2COB A;  1AKH B;  4A93 J;  1JTY A;  2DMQ A;  4UUS A;  3QQA A;  1IDZ A;  3I4N J;  2HQ5 A;  3BG3 A;  3BT9 A;  3OOU A;  2DMN A;  1MBG A;  1SAN A;  3TW6 A;  5M5X J;  1ETY A;  1TWG J;  5C4X J;  1JKQ C;  4FE7 A;  1I6H J;  1LFB A;  2VKE A;  2VPR A;  1MBJ A;  1U9N A;  1ETQ A;  1JJ6 C;  1E3O C;  5EZH A;  3IH3 A;  1I50 J;  2CU7 A;  3HOX J;  3IV5 A;  4IHX A;  2H8R A;  2LP0 A;  2HOT A;  2DJN A;  2XPU A;  3BTL A;  5J1Y A;  3ZQI A;  1TWH J;  2DMT A;  5E3L A;  1YRN A;  2EH3 A;  5M5Y J;  3HDD A;  2X48 A;  3GTG J;  5IYB J;  2LR8 A;  1X58 A;  3FKI J;  1AHD P;  1DU0 A;  1WPK A;  4QTR A;  4M6V A;  2XB5 A;  1FTT A;  2R92 J;  4W1U A;  3IH4 A;  1F36 A;  2WV1 A;  2DMP A;  2OPT A;  4XRS A;  2B63 J;  3C2B A;  5J3L A;  5EGO B;  4IHW A;  2YS9 A;  2OF7 A;  1P7I A;  3E7L A;  5EYR A;  2JA7 J;  3M3Y J;  1PUF A;  1OFC X;  5GPA A;  4A3E J;  4DYQ A;  1WGX A;  1TC3 C;  4A3G J;  1P7J A;  2XPW A;  2QCO A;  2ECC A;  3G1M A;  2GLO A;  1FEX A;  1B8I B;  3HGY A;  1IGN A;  3LSG A;  3MN2 A;  2M0C A;  2L7M P;  1ETV A;  1JTX A;  4MIM A;  3JRH A;  3FIW A;  3QPL A;  5J1U A;  3NAR A;  2MGQ A;  1O4X A;  1VND A;  2NVQ J;  2AO9 A;  2PMZ N;  1JKO C;  3BR3 A;  2M2E A;  3S1N J;  2W48 A;  4C2M J;  3OSG A;  2FX0 A;  3OSF A;  3A02 A;  4XRM A;  2GM4 A;  3S14 J;  3JRF A;  4BBR J;  2AHQ A;  4I6Z A;  1XS9 A;  2JK3 A;  5EG0 B;  1OCT C;  4HNV A;  3DEW A;  3DCF A;  3BR6 A;  4C3H J;  4IHY A;  5C4J J;  3B6A A;  3PO2 J;  2JJ7 A;  3Q0U A;  4A3L J;  1G2H A;  1Z77 A;  4V2F A;  1JT6 A;  2HOS A;  1WH7 A;  1IRZ A;  3PO3 J;  4BBS J;  1ITY A;  4M3E A;  3LSJ A;  5IYC J;  2KDZ A;  3HOW J;  1IDY A;  2EQR A;  3F0C A;  2HXO A;  3RZO J;  5FLV A;  1NK2 P;  4MFE A;  1ZR4 A;  2LTP A;  3K7A J;  3GTM J;  3OIO A;  2LVS A;  3TW7 A;  5FLM J;  1IJW C;  3HKZ N;  4G12 A;  3GTL J;  3MVP A;  2WB1 N;  2EZL A;  1UHS A;  2R93 J;  4CYC A;  3CQZ J;  2NOG A;  4XID A;  1GUU A;  2RAE A;  5JLX A;  3UKG A;  1HF0 A;  1LE8 B;  2Y9Z A;  3JRA A;  3B6C A;  5K7F A;  2N8G A;  2CQX A;  3G1O A;  4UUS B;  5M3M J;  1MBE A;  5FKN A;  5FKM A;  1ZGW A;  1RKW A;  2CUF A;  2X9D A;  1JUS A;  3SJM A;  2HDD A;  3A03 A;  2E19 A;  5E3O A;  3S17 J;  1VF9 A;  2EZK A;  1JJ8 C;  1K61 A;  3W6V A;  2CJJ A;  2ELK A;  2FD5 A;  2XRL A;  3H0G J;  2DA4 A;  2Y31 A;  4RBO A;  4RDU A;  2JWT A;  2TCT A;  2NS7 A;  4BKX A;  3JRE A;  1MBH A;  1YRN B;  3CMY A;  2H1K A;  9ANT A;  3H3V K;  2DA7 A;  2D5V A;  2ZB9 A;  1A5J A;  1RKT A;  2R5Z A;  3LOC A;  2JN6 A;  3D1N I;  5F04 A;  5GP9 A;  1POG A;  2LFB A;  3CDL A;  4JP0 A;  3JRC A;  4M3G A;  4BY7 J;  1ZKG A;  4A3C J;  4BXX J;  3RZD J;  2Y30 A;  5DS9 A;  1OJL A;  5J1R A;  2XGD A;  1WH5 A;  4A69 C;  1D5Y A;  5IP7 J;  3CCY A;  5FKL A;  3TP3 A;  2QF7 A;  3ZQF A;  5K7H A;  1JUP A;  4FTH A;  1OCP A;  2XSD C;  3GTP J;  1RES A;  1BW6 A;  3S15 J;  2DN0 A;  1PUF B;  1B72 A;  1TWF J;  1LFU P;  1BW5 A;  1BJZ A;  1I3Q J;  5E3N A;  3MKL A;  2NVY J;  2M9H A;  3BQZ A;  4QIW N;  1JKR C;  2O7O A;  5F1J A;  4D7M A;  4JX4 A;  5IPA A;  3LSP A;  2LD5 A;  1JT0 A;  3QPS A;  5IOZ A;  4M3D A;  3Q0W A;  4AYB N;  4IHV A;  2L9R A;  4A3B J;  3Q0V A;  2DA6 A;  3WHB A;  1GT0 C;  1FTZ A;  2L7Z A;  2DA5 A;  1ZQ3 P;  3IH2 A;  1MH3 A;  4B1R A;  5DTD A;  3O8G A;  2ME0 A;  4W97 A;  2NVT J;  2P81 A;  2R0Q C;  1F43 A;  1MSF C;  5C3E J;  1K83 J;  2LLK A;  2Y0S N;  1IUF A;  5F27 A;  1GV2 A;  5HOD A; 
#chains in the Genus database with same CATH topology
 3JTH A;  5J4V A;  1NG6 A;  2VOD A;  2CG4 A;  2H1L A;  1I6X A;  3U1D A;  2MG4 A;  1TZL A;  2GXG A;  1MNM C;  4KFC A;  4A5N A;  4Q5S F;  3N4M A;  1OCO H;  2R7Z J;  1PYV A;  3OYB A;  4NC7 A;  2EWN A;  2CUJ A;  2MW8 A;  3ZMV A;  4DQ2 A;  4YFX F;  1EF4 A;  2JSC A;  1JHF A;  1W5S A;  2BY0 A;  5L3G A;  1ZLK A;  1D1B A;  1TW3 A;  2FF4 A;  1BA5 A;  1CF7 A;  1MBK A;  1VI0 A;  5HS7 A;  2LMD A;  4Y7N J;  3E5U A;  5AON A;  4IRI A;  3GFM A;  2X1D A;  4PJJ A;  1LPQ A;  4X6A J;  3WHC A;  1LFP A;  2IEK A;  3ISP A;  3L7W A;  2DQL A;  2VBY A;  4CSW A;  2DXI A;  4MQV A;  1Y1V J;  1IC8 A;  3TBI A;  4AVP A;  4E70 A;  1GVD A;  1AA7 A;  3FMQ A;  1U9O A;  4A6E A;  1H0M A;  2NS8 A;  2QLZ A;  2ZFU A;  2P4W A;  4HOB A;  5EEA A;  2OQG A;  1SEU A;  2ESN A;  2Q2E A;  4N9H A;  2ME6 A;  1H89 C;  2F5C A;  2X6X A;  1EA3 A;  4YFK F;  2AXT C;  1DP3 A;  5A2Q K;  4IHS A;  2FXA A;  3PM1 A;  5E1W A;  2WAE A;  1SD7 A;  4BAY A;  1MND A;  3BDD A;  4LK1 F;  1RET A;  3J81 Z;  4CCL A;  2HQA A;  1KA8 A;  3V8L A;  2O8X A;  4IJA A;  1QVT A;  4LK0 F;  2DOF A;  2ZBK A;  3DBL B;  3HB9 A;  2E1O A;  4ZYD A;  3TED A;  2LK2 A;  2X51 A;  4L9J A;  2WC2 A;  4A6D A;  4KT5 C;  4A12 A;  2Q0O A;  3T8T A;  1A6I A;  4J00 A;  2OAZ A;  2A68 F;  2EIM H;  3EET A;  5L3B A;  3S2W A;  5K5O A;  2M4K A;  1HSJ A;  4A3F J;  3GO5 A;  1IV6 A;  4LJZ F;  5DYM A;  3T8R A;  2OD5 A;  1W36 D;  4IQ4 A;  3TO6 A;  1U78 A;  1YG2 A;  1FOY A;  4QPQ A;  5GAD J;  3FZV A;  1GDT A;  2L9N A;  2OCE A;  3FHZ A;  1DUX C;  5FKK A;  1XX5 A;  2ZFW A;  4XKC A;  4GGG A;  5CVV A;  2W7N A;  4MGR A;  1D1A A;  3J7A Y;  2GIV A;  3EQL F;  2F4M B;  1HLV A;  4G6T B;  1RUO A;  3HGG A;  3N05 A;  4U87 A;  2EZI A;  3BTI A;  4FX4 A;  1SC7 A;  5ILU A;  1XPX A;  3R61 A;  5JFR A;  4JBA A;  1WJ5 A;  3DWL E;  1HW2 A;  5E1Z B;  3IKV A;  1T0F C;  2XAS A;  3WGI A;  2K4B A;  4HW0 A;  5HDN A;  2JRM A;  4E4H A;  1BI1 A;  5KK1 A;  3SEQ A;  2DA3 A;  3H3U A;  1APL C;  4JX6 A;  2E7X A;  3DTE A;  1RPW A;  2HNH A;  3KEY A;  1FX7 A;  3ABL H;  3M9A A;  1TLH B;  4BXU A;  2WWY A;  4ETS A;  5M3F J;  4M9S A;  2EJR A;  4ENJ A;  3GXO A;  5IP6 A;  2STT A;  2OTL I;  2KZG A;  3OYM A;  5CYV A;  3Q9V A;  3GFJ A;  1F1Z A;  4HNT A;  1B8I A;  3ASN H;  3RCO A;  3ZOB A;  3HBL A;  2FBI A;  5D5U B;  1NG7 A;  4IXA A;  1MSE C;  2OZU A;  3HJE A;  3PFY A;  4DYR A;  3K4N A;  2M7A A;  4L9V A;  3BR0 A;  4GXO A;  2RGV A;  4XKV A;  2E2J J;  4N0B A;  1ORK A;  1TT0 A;  2VBZ A;  4S0H B;  4OWR B;  5KHD A;  2HPM A;  3K70 D;  3GLL A;  4IVN A;  1YIO A;  4BS9 A;  1VZ0 A;  2M45 A;  1WQ2 A;  2JZY A;  3H5R A;  4M74 A;  1UMQ A;  1WI9 A;  3J7Y J;  2LKS A;  1HCR A;  2JPC A;  2QBY B;  4Y52 J;  3I4M J;  2XAQ A;  3U21 A;  2FU4 A;  3LFK A;  2V1D A;  3VOD A;  2I10 A;  3ZQG A;  3GX4 X;  2XB0 X;  1PP7 U;  5D8K B;  2L7F P;  2L9S A;  1QU3 A;  5CQE A;  3PNY A;  3DPL C;  3L1P A;  1R1T A;  4YEJ A;  1MBF A;  4BQQ A;  3I58 A;  2ZKZ A;  3I54 A;  1IXR C;  4U0Y A;  3NWS A;  3O8H A;  2E5Z A;  3NWT A;  2YU3 A;  4MEX F;  3FM5 A;  3ZQH A;  3GF2 A;  2YU9 J;  2HI3 A;  3OOP A;  1JI8 A;  5FRM A;  2XHK A;  2LG4 A;  2VAS A;  3IC7 A;  4N4N B;  5E3M A;  1AWC A;  3C7J A;  5BQT A;  2IS6 A;  2A05 A;  2JT1 A;  3OYN A;  1RC9 A;  2UXX A;  1Z67 A;  2HU9 A;  2OQR A;  2HGC A;  2ECB A;  1LQ1 A;  5CVJ A;  2CWE A;  1ZR2 A;  2Z1D A;  3E97 A;  3S8P A;  5EZG A;  3QOE A;  5IOY A;  3C2H A;  3GUD A;  2ZME A;  4PJ0 C;  1U2W A;  2EIN H;  2HQ5 A;  3TW6 A;  3GFL A;  5M5X J;  4BQN A;  2QEN A;  5C4X J;  3CDI A;  4V19 K;  1JKQ C;  3RTR A;  3A0B C;  5DCM A;  2NRA C;  3RJP A;  2VPR A;  4KN4 X;  2YPR A;  1YTY A;  1O7L A;  3SYT A;  4G7O F;  1XTA A;  2W25 A;  2KLO A;  2KRF A;  2JUG A;  3AL0 C;  1FMW A;  3GYH X;  4IKF A;  2LP0 A;  4CA0 A;  4OIR F;  3BTL A;  5F64 A;  4Y17 A;  5IT3 A;  1TWH J;  1YRN A;  5D6E A;  3BCB A;  5M5Y J;  2FBH A;  2KJB A;  5IYB J;  3F22 A;  4UY8 I;  1ZRD A;  2L7K A;  3HPH A;  1WPK A;  2D2W A;  2GAU A;  2K5C A;  4M6V A;  2XB5 A;  4HLX A;  5CPR B;  3I3L A;  1FTT A;  4W1U A;  4IZZ A;  3CCU I;  3K4C A;  2OPT A;  2M1B A;  4BEH B;  3ZCO A;  5KVR A;  4CCJ A;  4JK1 X;  5J3L A;  2J5O A;  3JAM Z;  2YS9 A;  3CCQ I;  2XAG A;  1XN7 A;  1P7I A;  1IN8 A;  1Y0U A;  2EFN A;  4FHT A;  4L0Z B;  2JA7 J;  4CIC A;  2R4G A;  3M3Y J;  1SD4 A;  1FMV A;  1OFC X;  2KIQ A;  5TRD A;  2X1C A;  3HSF A;  1PP8 F;  4DYQ A;  4GO1 A;  1TC3 C;  2GXB A;  3CP2 A;  2VE9 A;  4DOZ A;  3F23 A;  1QBJ A;  2GLO A;  2PJR B;  3H3Z A;  1G6N A;  1S5L C;  4BE2 A;  4CZZ A;  1R5I D;  2L7M P;  1G3S A;  1X1A A;  2MGQ A;  2EK5 A;  1UG0 A;  3J81 K;  5K5R A;  2AO9 A;  2FOW A;  3BR3 A;  5HLG A;  3M7G A;  1SVM A;  2M2E A;  1E17 A;  2LH9 A;  2FX0 A;  4KNY A;  1R23 A;  2BBY A;  5CJ9 A;  4XRM A;  3CJT B;  3P5J A;  2E1M C;  4BBR J;  1Q1H A;  2LY2 A;  3R0J A;  3FBI B;  2ACJ A;  2JK3 A;  2D1H A;  2DT7 B;  4PUS A;  3VSK A;  3VYS B;  4HNV A;  3COA C;  4OAZ A;  1V3F A;  3BR6 A;  4WCG A;  4IX7 A;  1XGS A;  2JJ7 A;  3L09 A;  4HX4 A;  2Q1Z B;  2XGX A;  3GEZ A;  1KYW A;  3CO7 C;  2DJI A;  1XD7 A;  4V2F A;  1IN5 A;  1O3Q A;  2DFE A;  1FOW A;  1SAU A;  3VFZ A;  4RGS A;  3ZRG A;  2EIL H;  3CJN A;  3F3X A;  1KZH A;  2A5W A;  2QKL B;  3P9C A;  3GCM A;  5HVQ C;  2YX4 A;  1Z6T A;  2M8E A;  4I0A A;  5IYC J;  3CTA A;  3KP6 A;  1GXQ A;  1GVJ A;  1U5T C;  2HXO A;  4RB0 A;  2KIU A;  2P0W A;  2XAH A;  3CCV I;  3PL8 A;  2ICW G;  1DPR A;  2V6C A;  4ZTF A;  4KMF A;  4MFE A;  2LRE A;  1ZR4 A;  3CCM I;  3I4P A;  5DV5 A;  2PMU A;  3KZZ A;  2V4J C;  4HF1 A;  2FML A;  2R7O A;  4KIB A;  3LSM A;  4XLC A;  4E7H A;  3KP2 A;  2W24 A;  5ERI A;  3OYG A;  4XID A;  4U7B A;  5JLX A;  2LBF B;  4HRI A;  5ED4 A;  2CQX A;  2IXS A;  2EPF A;  2G9W A;  2RKH A;  1K79 A;  2A07 F;  3TOB A;  5FKN A;  3KEO A;  1QA6 A;  1SFK A;  4FAS D;  3J7Z I;  4JQF A;  2DO7 A;  3ZMU A;  2X9D A;  4HAM A;  3I59 A;  1JUS A;  1S8N A;  2WTE A;  2W85 A;  2E19 A;  2Z2S B;  4LB5 A;  2FQ3 A;  4Y13 A;  1WHU A;  5B5E C;  5GAH J;  1W5C C;  2NYX A;  4ZYG A;  1I27 A;  1T98 A;  2ELK A;  4ZDP A;  2Y31 A;  4MHG A;  4ZYA A;  1MDM B;  3ZGK A;  4BKX A;  3MZH A;  1LJ9 A;  5GAG J;  3WGG A;  1BIB A;  3H3V K;  2ZXI A;  2A6T A;  1A5J A;  1UEL B;  4II2 A;  2PLY A;  4Y33 A;  1JHH A;  2DYS H;  3EPZ A;  1SD5 A;  2HYG D;  3D1N I;  5F04 A;  4E6K G;  2MAB A;  1POG A;  3A0H C;  1LNW A;  1Z6R A;  3OYL A;  4M3G A;  2PMH A;  1WJA A;  3MAJ A;  3RZD J;  1NH3 A;  2R7U A;  1OJL A;  3BG6 A;  4RLQ A;  1SMY F;  3V4G A;  3I64 A;  2BXY A;  1FBU A;  2E5N A;  5FGM A;  1B9N A;  3ZQF A;  5D8L B;  1UAA A;  4HV5 A;  4M9X A;  1UHW A;  2XSD C;  1BW6 A;  2XF6 A;  4RS8 A;  3K1N A;  3K70 C;  3KYC B;  2V9K A;  1YOV B;  2G7U A;  2BHY A;  2HVR A;  1OYI A;  4UXN A;  3BQZ A;  1JKR C;  3IAM 2;  1VTN C;  5FRO A;  5IPA A;  1J75 A;  3HYI A;  2LD5 A;  5FD5 A;  3QPS A;  3DBH B;  4QWQ A;  1WFX A;  2P5K A;  3HRU A;  3TKY A;  2L9R A;  1P92 A;  2F4I A;  3MKZ A;  1FTZ A;  3CJQ B;  3K2Z A;  3C3W A;  3WHB A;  4CCO A;  1T39 A;  5E8I A;  1W7P A;  3HZJ A;  2BGC A;  3BG7 A;  3PFI A;  1Z3X A;  3O8G A;  4W97 A;  4LD5 A;  1ZYR F;  1ZGA A;  4M72 A;  2UZK A;  4OIN F;  5C3E J;  3CUQ C;  4NC6 A;  2LLK A;  1R49 A;  2NNN A;  3FDY A;  4P96 A;  4EVI A;  2GOM A;  4BJ6 C;  2LF7 A;  5F27 A;  2CV0 A;  2NNY A;  4DBQ A;  3CCE I;  1S9H A;  3DPT A;  1OCR H;  3G1L A;  3OS1 A;  3PNV A;  5E20 A;  1X1P A;  1K4S A;  1G4D A;  1Y39 A;  4LLG F;  1YI2 I;  3S1R J;  2EFO A;  2OU2 A;  3HXL A;  1EH7 A;  3R4K A;  5HS8 A;  4MO7 A;  3Q3S A;  1NK3 P;  1A04 A;  2FRH A;  3HRM A;  4HNU A;  1I39 A;  3OL4 A;  2PMZ A;  3HOT A;  1QHH D;  2MD5 A;  2WAQ N;  2DFH A;  2HEO A;  3LSH A;  1R4M B;  5M5W J;  1D0Y A;  1S7A A;  1UFM A;  2NS0 A;  2R3S A;  2XPV A;  4D5C A;  1JKP C;  1H8A C;  3U1K A;  2GA2 A;  3JAM K;  2DK5 A;  1K78 B;  2JUC A;  2MH9 A;  2F5D A;  4KIG A;  2L0K A;  3VEP A;  4KIS A;  4LB6 B;  1CGP A;  4I0B A;  2Y2Z A;  3V8K A;  4BXF A;  3MQ0 A;  4DW6 A;  3S1M J;  3DXJ F;  2M5W A;  2DYR H;  2X6O A;  3TP0 A;  2CW7 A;  2RDP A;  1QNT A;  1QZY A;  3GTK J;  3WTV C;  2JA8 J;  5C44 J;  5HLT A;  3VDX A;  2PQ8 A;  1KQ0 A;  4P9F A;  2OCC H;  4HPQ A;  4I99 C;  3CLQ A;  5DM7 F;  3SDG A;  3G2B A;  2ESH A;  3MEX A;  1RZ4 A;  4H4K C;  3GTJ J;  4A3J J;  1MW7 A;  4UB8 C;  2R7Q A;  4CZC A;  4XNF A;  2LSO A;  2XDV A;  3LA2 A;  4LIT A;  1SFE A;  2XGC A;  1NTC A;  3VSL A;  4UB6 C;  1Q1V A;  2BOL A;  2JMW A;  3WTY C;  2W1O A;  2BW3 B;  1Z7U A;  3LA3 A;  3FKJ A;  1HC8 A;  1MMS A;  3HKZ A;  1BI3 A;  2VOP A;  2ZXJ A;  1W0U A;  1BL0 A;  4M9Z A;  2WB1 A;  3DF8 A;  4B09 A;  1LDJ A;  3QYB A;  4XLN F;  4NDL A;  1NHA A;  5L3E A;  1G3T A;  4BY1 J;  5F08 A;  4HST A;  4ZJZ A;  4YRV A;  4Y15 A;  1W1W E;  2FJ1 A;  5H20 A;  5J47 A;  3F8M A;  1X2M A;  2F5E A;  1B72 B;  3EUA A;  1H9T A;  2BZT A;  2E36 A;  3R0A A;  2DA2 A;  2BEO A;  4ENK A;  1Y56 A;  3HEF A;  4TV7 A;  1R00 A;  2HYJ A;  4YEL A;  2VC1 A;  1YJN I;  2EZH A;  3Q9S A;  5J8F A;  3MKY B;  3RDI A;  3HOU J;  2DAO A;  1U8R A;  4IEJ A;  1D5V A;  5D4S A;  2PEX A;  2HOE A;  2CYY A;  2DW4 A;  3IHU A;  5BNG A;  3ZMS A;  1N75 A;  2LDU A;  4R1H A;  5F0H A;  2JPB A;  3EUH A;  1UCR A;  4L5J A;  4AU7 A;  3E1S A;  1USS A;  2TRT A;  5IYD J;  4N9I A;  2ID6 A;  5BS6 A;  1YIJ I;  3E6D A;  4C9Y A;  3HM5 A;  4RAG A;  2LC2 A;  5FB2 A;  1YX3 A;  5DD4 A;  1AU7 A;  2IGO A;  5LGN A;  1Y0N A;  1O3S A;  4RA2 A;  1L0O C;  3KET A;  3L00 A;  1LVK A;  2ZXH A;  1KU2 A;  4ZC3 A;  4ON0 A;  4EQQ A;  3HOY J;  2B7E A;  5BOX A;  2QQA A;  3JW4 A;  2MD0 A;  4QSH A;  2HOA A;  2EV5 A;  5HNH A;  4V2G A;  3WG7 H;  4A3D J;  2K9N A;  1ZAO A;  2MH2 A;  2W00 A;  4EJT A;  3JRI A;  2G0E A;  5LEK A;  3JRG A;  4F7Z A;  1WSU A;  4PSW A;  2ZCW A;  2IPQ X;  2VQC A;  1MMA A;  2IGK A;  1OCZ H;  2V1U A;  3G3Z A;  2P6S A;  5IP9 J;  1SVO A;  3KZI C;  4IOA F;  2JQ7 A;  2WAF A;  2KIF A;  2V9V A;  1D8K A;  1KQ9 A;  2GBY A;  1FLI A;  3LAJ A;  2CV1 A;  4EAT A;  4AID A;  3CUO A;  3ONQ A;  1YW9 A;  1PJR A;  2CFO A;  1LB2 A;  3CCR I;  3CME I;  1SAX A;  1REP C;  3VPR A;  3MZY A;  2ZNZ A;  2OTJ I;  5EDN A;  4BH9 A;  3DTK A;  3RPU D;  5JR3 A;  3JSP A;  3BTJ A;  2IS2 A;  2HR3 A;  4XN0 A;  1R4N B;  2DOE A;  2KJC A;  4ZH4 F;  2CMP A;  2XF7 A;  1BOB A;  3ASO H;  3K10 A;  2KP6 A;  1EJ9 A;  1O3R A;  1WI3 A;  3HTS B;  1MNE A;  2DTZ A;  5GPC A;  3JRB A;  2IBD A;  2Q2E B;  2QVO A;  3HSR A;  1W0T A;  3M8F A;  3JSO A;  4IL6 C;  4EEF G;  2BY1 A;  3BQY A;  2DDA A;  2O9L A;  1RR7 A;  1FSE A;  1HW1 A;  2QUF A;  1ZGJ A;  1TQP A;  3WE2 A;  3T1B A;  1FYL A;  2RNG A;  4Z2Y A;  1JUM A;  4YFN F;  1OLT A;  2CRG A;  2ID3 A;  4RMN A;  1IN6 A;  3TO7 A;  1YLF A;  3QU3 A;  4O6J A;  3A1Y A;  3DU5 A;  1BI0 A;  5TIS C;  4BQA A;  1FJL A;  3SHF A;  1JGS A;  1OYY A;  1BR1 A;  1I5Z A;  4UUS A;  3IP4 B;  3QQA A;  5KCM A;  5LBQ A;  3G73 A;  3I4N J;  3DV8 A;  2W82 A;  3IAS 2;  2F5V A;  1I6H J;  3OR2 C;  3GZN B;  1U9N A;  1E3O C;  2CV2 A;  5EZH A;  4FT8 A;  4PSX A;  3DKX A;  1FY7 A;  4RGR A;  1HKQ A;  3NRV A;  4IHX A;  1P9Q C;  5KNL A;  1YYV A;  4I09 A;  3ZMT A;  3K4B A;  4BYY A;  2DJN A;  3QOP A;  5FLX Z;  1H9G A;  4AD9 A;  4AIK A;  3OWT A;  5LRR A;  5E3L A;  1FOX A;  1SFX A;  1XCV A;  2EH3 A;  3HDD A;  3HSE A;  3M07 A;  1X58 A;  1X4O A;  2MC3 A;  3FKI J;  4QTR A;  1X4P A;  2COM A;  2HTJ A;  2PX9 A;  1X1B A;  2K4J A;  2VT2 A;  1XCB A;  4XOR A;  2R92 J;  1W4M A;  3KP4 A;  2WV1 A;  3ERM A;  4LG0 A;  3KLN A;  4HF0 A;  2XVC A;  5H2F C;  3S3N A;  1IRG A;  3E7L A;  1KGS A;  4AIJ A;  1R36 A;  5HLI A;  4ASN A;  4C2T A;  3CZ6 A;  3BC8 A;  3H5N A;  1K6O A;  1ODD A;  1U3E M;  1J5Y A;  3BWG A;  3ERE D;  4BDZ A;  5GPA A;  2ZJR F;  4A3E J;  1XDS A;  1WGX A;  3DKY A;  3F8F A;  1X3W B;  2OJE D;  4A3G J;  1ZRE A;  4KT6 A;  5ILS A;  4J01 A;  2PG4 A;  3PQJ A;  1B8I B;  2QEX I;  3MN2 A;  2M0C A;  1SD6 A;  1UHM A;  1XMX A;  1ZG3 A;  3W3C A;  1E0E A;  3JRH A;  3FIW A;  3H35 A;  3QPL A;  4MQ9 F;  2NVQ J;  2PMZ N;  2L4A A;  1JKO C;  2Y0M A;  2R7F A;  2LRD A;  3IRR A;  1IXC A;  3S1N J;  4C2M J;  1QO0 D;  1DP7 P;  1V5E A;  4IHT A;  4YIF A;  3K1M A;  4IOC F;  2H6B A;  1T0F A;  2VXD A;  2DQR A;  3WTZ A;  5HDG A;  4OOI A;  1XDU A;  3Q0U A;  2CGP A;  1V54 H;  2VOO A;  1W7P D;  1E3P A;  3HHH A;  1X3Z B;  3CCS I;  2W57 A;  1DPU A;  3S3M A;  2KQR A;  1PDN C;  1IRZ A;  3QP6 A;  4ZYH A;  5KAF C;  1K7A A;  1VQK I;  3PO3 J;  4ZTJ A;  4BBS J;  2QQ8 A;  4M3E A;  3LSJ A;  4U88 A;  4GYI A;  3LQR A;  1IDY A;  5E8G A;  5ICG A;  4BNC A;  4OU0 A;  5D5V B;  2CQN A;  1LDD A;  2Y69 H;  1SMT A;  1TNS A;  1WVR A;  2HQR A;  3B02 A;  1IN4 A;  4A0Y A;  4UHT A;  2ZME C;  4EJO A;  3GFI A;  2VB6 A;  4OIO F;  1KU9 A;  3D0S A;  3D5L A;  3U9G A;  4EGZ A;  2R7S A;  4EJW A;  1IJW C;  4G6D A;  3HKZ N;  3MCZ A;  1OCC H;  4X0G A;  3MVP A;  4HEA 2;  2PI0 A;  2WB1 N;  3I0T A;  4WF2 A;  4EGY A;  1UHS A;  5BMZ A;  1WWX A;  4CYC A;  1B4A A;  1J9I A;  2KMU A;  3E5Q A;  4F91 B;  5JVT A;  1GUU A;  4XOP A;  3O2P E;  1HF0 A;  1BIA A;  2HZT A;  3RKY A;  2Y9Z A;  3B6C A;  4XBF A;  5F1R A;  5K7F A;  2ZME B;  2N8G A;  4B44 A;  1X3U A;  5M3M J;  1XGN A;  2A69 F;  2Z33 A;  3R60 A;  1EH6 A;  1ZGW A;  4HBL A;  4A0Z A;  4HSR A;  3DLL F;  5DCM B;  2NAZ A;  2EIJ H;  2XKP A;  3KYD B;  4G6Q A;  3QYF A;  3RIR A;  2WAQ A;  2XRN A;  3W2W A;  2IGM A;  5GTI C;  5HS9 A;  1K61 A;  2EB7 A;  2CJJ A;  2XRL A;  3H0G J;  3J80 Z;  1IF1 A;  2DA4 A;  2I8D A;  3FMR A;  4RDU A;  4HDU A;  1VQ6 I;  2FEZ A;  3JCU C;  2ZC2 A;  3KP5 A;  1R22 A;  2GIZ A;  1YRN B;  2R7X A;  4ZYE A;  9ANT A;  4KN7 X;  3M8J A;  2VQG A;  2XKO A;  3CDH A;  2FMY A;  4R79 A;  2R5Z A;  3HL2 A;  3WTS C;  4H0E A;  2QKM B;  3CDL A;  5B66 C;  4L0Y B;  4A3C J;  1ZKG A;  2CW0 F;  2P6T A;  4WXH A;  4BU2 A;  1G3W A;  4A69 C;  4LLL A;  3CCY A;  3H0D A;  2QF7 A;  5K7H A;  1XGM A;  1OCP A;  1FNN A;  2X85 A;  1RES A;  3C2G A;  1VQM I;  4BL0 B;  3OS2 A;  1VQ5 I;  5CQG A;  2IW5 A;  3S15 J;  3ABK H;  2DN0 A;  3QAH A;  4EMS A;  2OA4 A;  3ZMD A;  1FP2 A;  1HXD A;  2EFQ A;  4RM2 A;  3CO6 C;  1YS6 A;  1VQ8 I;  1ZH5 A;  2IJL A;  1I3Q J;  5E3N A;  1OR7 C;  4AWX B;  2NVY J;  3ML6 A;  3O6B B;  2EIK H;  1IV8 A;  2MA3 A;  3IUO A;  4JX4 A;  4D0P A;  3LST A;  4KIC A;  2F4O B;  4GCV A;  2OZ6 A;  5JVG F;  4M3D A;  2DK8 A;  2P8T A;  4Y3O A;  3MD2 A;  2R7D A;  2K85 A;  3AKZ A;  3W2V A;  1J59 A;  3PJR A;  3FXM A;  5L3F A;  2RQQ A;  3IH2 A;  3K4K A;  4XLE A;  2L02 A;  3L2V A;  1OMI A;  5DTD A;  2X6Y A;  2NVT J;  3TL4 X;  3S3O A;  1A6Q A;  1F43 A;  2LF8 A;  4PJM A;  5B1A H;  3LSK A;  2E34 A;  3ZN0 A;  2PJP A;  3BCA A;  1WJE A;  2OC6 A;  4G9Y A;  5FFX A;  1YW8 A;  5TJJ A;  2JRT A;  3ZR8 X;  4IRH A;  4JOM A;  1J7K A;  2HXI A;  2PN6 A;  2DPD A;  4B3X A;  1HKS A;  2RC4 A;  5FLX K;  4IRG A;  4MLO A;  1Y8Q B;  4UUT A;  2H94 A;  2HQN A;  3GTO J;  5L3D A;  4BQO A;  4WWC A;  1YQA A;  1E3H A;  2VJI A;  2JSP A;  3DEU A;  1YFH A;  1W36 C;  1LUJ B;  2ELH A;  2M7B A;  4DYC A;  4XIC A;  2ADU A;  3BY6 A;  2VUM J;  2MSY A;  4EV0 A;  3WU1 B;  2XC7 A;  1WCM J;  2YR2 A;  4HLY A;  5EJC A;  4WXC A;  1VQ7 I;  3FK6 A;  2V1N A;  2IRF G;  1TBX A;  4C3I J;  2HWV A;  5LGU A;  2FSW A;  1WJB A;  2KIM A;  2JA5 J;  1Z05 A;  2LKP A;  1M1E B;  2Z99 A;  3TMO A;  2R5Y A;  3CC2 I;  4G8X A;  1XC5 A;  4RLF A;  5IY5 H;  2QZ8 A;  4M3F A;  4LGW A;  2DT6 A;  2K40 A;  4L9N A;  4P5O A;  4F93 B;  3I59 B;  4FET A;  2VI6 A;  5F0C A;  4HA8 A;  1XG1 A;  2JA2 A;  2BVL A;  3OYF A;  1R58 A;  5LD2 C;  2IA2 A;  3OYH A;  1Z0X A;  2JTV A;  3GW2 A;  1FWZ A;  1ZK8 A;  2ZXW H;  3FWE A;  4GDF A;  1U5T A;  5D5X B;  1A35 A;  2O8K A;  2JVH A;  3FK7 A;  3AG4 H;  3K0L A;  3BTC A;  4HQE A;  2VBX A;  2IS4 A;  3KZY A;  4LOC A;  2WAD A;  3A01 A;  2V1X A;  3DPU A;  3KCC A;  2LOO A;  1AKH A;  3OYI A;  2AQE A;  4E7K A;  1UZC A;  4CYD A;  4IPA A;  1XSX A;  2HYF A;  4PFO A;  2E7W A;  3ZQL A;  5D4R A;  2F2E A;  3LSR A;  3GME A;  2E2I J;  2O5R A;  5D6F A;  4B4C A;  1ENH A;  5E18 F;  2VXZ A;  3FXL A;  4FQG A;  3E0J B;  1PUE E;  1DU6 A;  1V4R A;  3R6S A;  5JHU A;  4A5M A;  4WK8 F;  4XK4 A;  4XR6 A;  2XRO A;  1MDM A;  4M6X A;  1BC7 C;  4KDP A;  2JA6 J;  3KLO A;  3RKQ A;  3AG3 H;  4E7Z A;  1CQT A;  2ZJ2 A;  3F8N A;  5K7Z A;  1FT9 A;  2X0L A;  2CUE A;  1TNT A;  3ABM H;  3WTT C;  1S7O A;  2Y9Y A;  4XLF A;  3BRO A;  2K02 A;  3EYI A;  2YUS A;  4XOT A;  2J5P A;  3HOV J;  3GVA A;  4RAY A;  1BN5 A;  4BHP A;  2VQH A;  2FNA A;  1B59 A;  3SZT A;  3FMS A;  2O03 A;  5EGO A;  2OBP A;  1QVU A;  1ZTR A;  2GQQ A;  2VBW A;  1FIA A;  2FBK A;  3KP7 A;  1O57 A;  1W7P B;  1TWC J;  1HDD C;  1FOK A;  3VYR B;  2VJ4 A;  1ETX A;  1J0R A;  1EKE A;  1R6R A;  3CJR B;  4I76 A;  4BHB A;  1BR2 A;  5JLW A;  4CGZ A;  2ZJQ F;  2VLA A;  3BLY A;  3HOZ J;  2CSO A;  1XSV A;  3BG9 A;  1HA8 A;  2EV0 A;  3H1C A;  1S7E A;  3IWZ A;  2TDX A;  4G7H F;  1TWA J;  3QOD A;  4BJT A;  5F0F A;  3KYL A;  3K6G A;  3GBG A;  2HDW A;  4XLA A;  2PFB A;  1X2N A;  2HVQ A;  4BJ5 C;  3CC7 I;  4CO8 A;  3VYT B;  4J19 A;  5EG0 A;  4BGD A;  1WKM A;  1FC3 A;  1BJA A;  4PFP A;  3LAP A;  1ACI A;  3PIP F;  4MFD A;  3DFG A;  4CH7 A;  4JX5 A;  1P4A A;  1HW5 A;  2V9P A;  5DCF A;  4FIS A;  3I53 A;  4OAY A;  1FYK A;  2IP2 A;  3VOE A;  4BHC A;  1O7F A;  1QHG A;  3BZ6 A;  3BPX A;  2ISZ A;  2KT0 A;  1A31 A;  1HST A;  1K6Y A;  3BJO A;  1W5T A;  1ZRF A;  2L5Q A;  3ULQ B;  1QPI A;  3HUG A;  4GFB A;  2LY9 A;  4PZJ A;  1ETK A;  3CUQ A;  1G3Y A;  3LL7 A;  4AUX A;  3OYC A;  2AXL A;  2EBI A;  1T08 B;  3UR3 C;  3LQQ A;  2RN7 A;  2XUB A;  5H6Q A;  3AAF A;  1IG7 A;  2RV8 A;  1VQ4 I;  4RB1 A;  2A5Y B;  2DTR A;  2VPL A;  3SEZ A;  1TW2 A;  2KKO A;  3L2Q A;  1D8J A;  4CCN A;  2E1N A;  4E7S A;  1RR8 C;  3LSI A;  3V8J A;  2Z5U A;  4C2U A;  2DMU A;  2ETH A;  3TDZ C;  4ZZD A;  3SFI A;  4N4O B;  2MFZ A;  1LE8 A;  4A93 J;  1T95 A;  3L2R A;  1JTY A;  1IDZ A;  1MBG A;  2QGU A;  4Y4R A;  1ETY A;  1TWG J;  3FXQ A;  1YIT I;  4D9J A;  2ZJP F;  1LFB A;  1IW7 F;  4PGG A;  1FYM A;  2A61 A;  2Z9O A;  2IVM A;  1QPM A;  2MC4 A;  1ZEL A;  1R1U A;  4P9U A;  3IH3 A;  1O3T A;  1OIS A;  1I50 J;  3IV5 A;  4UUV A;  2L4M A;  2MYS A;  3K69 A;  3CCL I;  2HOT A;  5AIQ A;  2AS5 F;  1RUN A;  3FBN B;  4U0V A;  4OIP F;  2IS1 A;  2HKX A;  5B1B H;  5J6X A;  4I98 B;  4NC8 A;  3H9J A;  1BM9 A;  3ECO A;  4HV6 A;  2WY8 Q;  3E3V A;  1LEB A;  4GYG A;  3A2K A;  2PBI A;  3RQ4 A;  2VIX A;  3IH4 A;  3D5R C;  4YIR X;  1MIJ A;  2DMP A;  3LFU A;  3P7N A;  3GWZ A;  3W6K B;  4BUP A;  4IHW A;  1FSH A;  4F3Q A;  2OF7 A;  2KHM A;  5J4Y A;  2P5L C;  5EYR A;  4EM1 A;  1PUF A;  1UJ8 A;  2FE3 A;  1P7J A;  2XPW A;  2QCO A;  2ECC A;  1FEX A;  2RNJ A;  3BJ6 A;  2BVM A;  3OYK A;  2QQB A;  1IGN A;  3LSG A;  4NQW B;  5JHF A;  3IL2 A;  2HZD A;  1ETV A;  1FBS A;  1Y6I A;  2MLK A;  4M6Y A;  1O4X A;  3P9K A;  1UB9 A;  4HYE A;  2F5F A;  4L9T A;  3V42 A;  3OSG A;  2H09 A;  3OSF A;  2XAU A;  2XSJ C;  3MFK A;  2GOX B;  3S14 J;  1VQN I;  2CS3 A;  3H5A A;  1XS9 A;  1LVA A;  1OPC A;  3F8C A;  3DEW A;  2EFW A;  3ZMZ A;  3CD6 I;  4C3H J;  1YJ9 I;  4IHY A;  4C30 A;  3K9T A;  5C4J J;  1Z3Y A;  2EA2 A;  3PO2 J;  4A3L J;  4U7D A;  2BHZ A;  1CF7 B;  5E17 F;  1YX5 A;  1T38 A;  2KDO A;  4MTE A;  1WH7 A;  4LG3 A;  3WG9 A;  4YII A;  3SDB A;  4DIQ A;  4AVZ A;  3TGN A;  1ITY A;  2A6E F;  2L2O A;  3HOW J;  2HVS A;  1HKT A;  1FPQ A;  5GTH C;  2K27 A;  3IRQ A;  4U0W A;  3L2U A;  2F6C A;  4G7Z F;  2V79 A;  2VC0 A;  2IA1 A;  5K5Q A;  4BE0 A;  3KIO A;  3WE3 A;  2VL8 A;  1NK2 P;  5FLV A;  2K9M A;  3K7A J;  3GTM J;  2LVS A;  5FLM J;  3V7C A;  4G12 A;  5LLQ A;  1X1C A;  1KON A;  2I5U A;  3I55 I;  5FO5 A;  3FM3 A;  3GTL J;  1N78 A;  1LDK B;  1Z9C A;  3HIF A;  2EZL A;  2QWW A;  4I7H A;  3F72 A;  3CQZ J;  1B9M A;  5HOO A;  4YG2 F;  4DJA A;  2RAE A;  4XKW A;  3ELK A;  3O3K A;  4GRI A;  1VQO I;  3F6O A;  3G1O A;  4UUS B;  2FNP A;  1BBY A;  4EJV A;  2KL4 A;  1P6R A;  1U0J A;  1MBE A;  1R1V A;  1ZG1 A;  5B3S H;  2CUF A;  4HDV A;  2D1V A;  3TDU C;  1X1D A;  2HDD A;  5E3O A;  1MMG A;  1VF9 A;  2EZK A;  3UNG C;  3ZQ7 A;  3MZ8 A;  4F55 A;  2AQF A;  2GZW A;  2LY1 A;  3FHN A;  3W6V A;  1BI2 A;  2FD5 A;  3PSI A;  3F21 A;  5EEH A;  2M3A A;  3QYE A;  2E60 A;  2TCT A;  3K1P A;  4NHJ A;  4RAZ A;  2NS7 A;  1XB4 A;  4KUM A;  1Z91 A;  2W84 A;  4II3 A;  2CW8 A;  3JRE A;  1MJB A;  1XMA A;  4K2E A;  3HOS A;  5ICE A;  1ZAR A;  6PAX A;  2DA7 A;  2ZB9 A;  3GZ6 A;  3E6C C;  1RKT A;  3MWM A;  3LOC A;  2IT0 A;  2JN6 A;  5GP9 A;  4I2O A;  3I71 A;  1KQ8 A;  1Z7L A;  3ABT A;  4BXX J;  2P5V A;  1GXP A;  3H9Q A;  1WH5 A;  4LG0 B;  2CO5 A;  1JUP A;  4FTH A;  2E35 A;  4UV9 A;  3ESW B;  1D0X A;  1MJ9 A;  3OS0 A;  1QZE A;  4S04 A;  2WA0 A;  3E6B A;  3PUF A;  2HFH A;  3K4J A;  1LFU P;  1BR4 A;  1BJZ A;  3T5X A;  2O0Y A;  2R7V A;  3NEU A;  1V55 H;  2M9H A;  3F8B A;  4O5V A;  4F52 A;  4CDG A;  4QIW N;  1D1C A;  4D7M A;  1HBX G;  5FFZ A;  4ZZL A;  4XLH A;  3G71 I;  3LSP A;  3NQO A;  3OIQ A;  2CUZ A;  3Q0W A;  3TOA A;  4L5I A;  4IHV A;  2H8W A;  4OMY A;  2DPU A;  2DA6 A;  2ZO4 A;  1GT0 C;  2DA5 A;  1OYW A;  3AG2 H;  2L3D A;  5DUK A;  3N97 A;  2DI3 A;  3QPT A;  4UVB A;  4B1R A;  4E7I A;  2ME0 A;  4CCK A;  5K1Y A;  2P81 A;  4R8H A;  2R0Q C;  2DBB A;  4I02 A;  2QA4 I;  5LEJ A;  4UV8 A;  2DOA A;  2FUG 2;  3TO9 A;  3AG1 H;  3DEE A;  2DU9 A;  2KRC A;  1IUF A;  3RPQ A;  3QU6 A;  4KYW A;  2MLG A;  2K9L A;  1DDN A;  4LLN A;  1ON2 A;  4ABZ A;  3FIS A;  1T33 A;  4OMZ A;  5CVR A;  3ZQQ A;  4A3K J;  3M4O J;  1DGR M;  3KEQ A;  3KX2 A;  2QSH X;  3RKX A;  2OV7 A;  1IAW A;  1U8B A;  3SXY A;  4ESJ A;  1UST A;  1DQU A;  4E7L A;  1SFO J;  3V7R A;  1ETO A;  1YE9 A;  3BJA A;  4NB5 A;  4CHU A;  3TQN A;  1QRY A;  4C3J J;  4A0X A;  2QBY A;  3Q5F A;  4FCY A;  4CYC B;  3L2C A;  3K2A A;  4LMY A;  4PJN A;  4AC0 A;  4BE1 A;  4RGX A;  3LWF A;  3ROU A;  1IN7 A;  4ENM A;  2STW A;  5JI6 A;  1JXS A;  2EA4 A;  2NXN B;  4HX7 A;  2IAI A;  3CP8 A;  2O6G E;  4XRS G;  4CCM A;  2K9Q A;  3G4S I;  1ZHF A;  4LFU A;  2GXA A;  5H6R A;  1KU7 A;  1IO2 A;  2C6Y A;  1RIO H;  2F48 A;  4XQF A;  3BOQ A;  2B0L A;  4XMY A;  3SQN A;  3BR1 A;  1UG2 A;  1PVE A;  4L5E A;  5HLH A;  4XL9 A;  2K9S A;  4QPO A;  2HKO A;  3RKW A;  5IT9 Z;  4E7J A;  3PNT A;  3LMM A;  2R5Z B;  1S6L A;  3I56 I;  1N77 A;  1JE8 A;  4DZP A;  5LHI A;  2UWM A;  1VFC A;  2UUZ A;  4UVA A;  3BP8 A;  3CC4 I;  5D5W B;  2X6W A;  3M8E A;  3JRD A;  2O3F A;  4ESF A;  4CUG A;  3C18 A;  1VQL I;  1MGT A;  4DZJ A;  4A3I J;  2FQ4 A;  3BZC A;  3J7A O;  3F6V A;  5CLS A;  4NUB A;  1R9T J;  2X4H A;  1T2K A;  3B73 A;  2KIS A;  3IWF A;  4M73 A;  1ZG5 A;  1GHC A;  3CF2 A;  4A2U A;  3RI4 A;  4XLP F;  3OYA A;  4ZDO A;  2WV0 A;  3HC7 A;  2M8G X;  2NVX J;  1HOM A;  4P1W A;  1HDP A;  4L18 B;  2Z16 A;  1FZP B;  2XF5 A;  1A36 A;  4WXD A;  3AL0 B;  3H9G A;  2V26 A;  3NAU A;  1ETW A;  1J09 A;  2DT5 A;  1P4W A;  2NOJ B;  3KFW X;  1ULY A;  3S32 A;  1BOA A;  2VKD A;  4BEH A;  1MH4 A;  5EEG A;  1TP4 A;  3D5S C;  4OIQ F;  1D3Y A;  2VT3 A;  1B6A A;  4D5F A;  3E6M A;  4JYK A;  3GZ5 A;  3OY9 A;  3S93 A;  4BAC A;  4KIF A;  4DBR A;  2HDC A;  1XGO A;  1KYZ A;  1WZ2 A;  3S16 J;  3S2H J;  2PJR A;  2QSG X;  1FIP A;  1GV5 A;  3HRT A;  2FA5 A;  3HG9 A;  1F5T A;  1F9N A;  2CQ7 A;  5DD8 A;  4B47 A;  2QYO A;  1EV7 A;  5LRS A;  4B3A A;  1H88 C;  5FD6 A;  2D45 A;  1X19 A;  3ZP5 A;  1K4T A;  4PJL A;  4XON A;  4X1E A;  1YO5 C;  2ZSH B;  2DOD A;  2LKX A;  1RI7 A;  2WBM A;  4Q48 A;  3S2D J;  3VWB A;  4A3M J;  1OR7 A;  3PIO F;  1T56 A;  2H6C A;  4EJU A;  5EF6 A;  4B48 A;  3RPU A;  2DCE A;  3W6J B;  5FJ8 J;  2QM3 A;  2R7R A;  2CFX A;  2UXN A;  3LNQ A;  1Y1W J;  2FOK A;  4D7N A;  2K7L A;  3KE2 A;  1S72 I;  3GTQ J;  2E1M B;  1L3L A;  2CQQ A;  2ZSI B;  3BR5 A;  4AYB A;  3BG5 A;  4RM3 A;  3LA7 A;  4B43 A;  4WX9 A;  2XGE A;  1HQC A;  3JR9 A;  1P4X A;  2DA1 A;  1JGG A;  3OL3 A;  3BR2 A;  4IF4 A;  3P9I A;  3RQI A;  5FKO A;  5CKT A;  4MEY F;  3EDP A;  4PDK A;  5E79 C;  2R5Y B;  4M71 A;  1R5H A;  2VKV A;  5DM6 F;  2VJ5 A;  4XSX F;  1BC8 C;  4HG2 A;  2P7V B;  3SFZ A;  4FE4 A;  3C1D A;  4XM3 A;  2Y0S A;  4Q47 A;  1T6S A;  2M34 A;  3ZQC A;  5DDG A;  3EUK L;  1IXS B;  2Y75 A;  2EFP A;  1YHQ I;  1YJW I;  3CCJ I;  1RRJ A;  3QP5 A;  4M3B A;  1T8I A;  1B1B A;  3OYE A;  3S1Q J;  2L01 A;  1U5T B;  5E1X A;  2E2H J;  2K3P A;  4ITV A;  2ELJ A;  3A01 B;  2LBF A;  2KPM A;  2M87 A;  2COB A;  3JTG A;  1AKH B;  4XKB A;  4ZDL A;  3ABU A;  2DMQ A;  2Z3Y A;  3BG3 A;  3BT9 A;  3OOU A;  2DMN A;  1SAN A;  2DFI A;  4FE7 A;  1ZRC A;  2VKE A;  4Z6Y A;  1MBJ A;  1ETQ A;  2IGN A;  4G94 A;  1JJ6 C;  3PQK A;  1KU3 A;  5DUI A;  1S29 A;  2DLL A;  1VQP I;  4F92 B;  2CU7 A;  3HOX J;  1Z1D A;  1E2X A;  4PGH A;  2H8R A;  2BY2 A;  1J2X A;  3M1E A;  5BPI A;  4ESB A;  4IQJ A;  2XPU A;  4RGU A;  2K86 A;  5J1Y A;  3K4L A;  2DMT A;  2VQL A;  3VYU B;  3ZQI A;  3G6E I;  3WTU C;  2X48 A;  2HPI A;  3E5X A;  3FXO A;  1MKM A;  1WJC A;  2LR8 A;  3GTG J;  2ISY A;  2LNB A;  1AHD P;  2V7F A;  2CQK A;  3KPH A;  1DU0 A;  3OR1 C;  5CVU A;  2QQ9 A;  4UVC A;  3ZPL A;  5AIP A;  1OKR A;  2OUM A;  4EM0 B;  1F36 A;  1IRX A;  3SZP A;  1FP1 D;  2VJJ A;  4XRS A;  1IUY A;  4KJZ A;  3DBR B;  2B63 J;  1Z21 A;  3C2B A;  3HTU A;  1TQI A;  5EGO B;  2XV4 S;  2DDB A;  5ILV A;  2NVU B;  4XN3 A;  1IZ1 A;  4S05 A;  3L9F A;  1MMD A;  1RNL A;  3MMY B;  5A2Q Z;  2B9S A;  3IKT A;  1ZLJ A;  3OYD A;  3G1M A;  3DP7 A;  5J40 A;  2H27 A;  2E1C A;  3HGY A;  3OV8 A;  3VB2 A;  5LGT A;  1JTX A;  2VKH A;  4MIM A;  3U2R A;  5FRN A;  5J1U A;  3SZG A;  2KRH A;  3NAR A;  1DGW Y;  1VND A;  4LIU A;  5HDK A;  3HRS A;  3CES A;  2E71 A;  2W48 A;  1G8X A;  3K4M A;  3M1C A;  3J80 K;  3EYY A;  3A02 A;  2GM4 A;  3BZK A;  1TQM A;  5L3C A;  3JRF A;  1C0W A;  2A3S A;  2AHQ A;  3HHG A;  3QPH A;  4PCQ A;  5J8C A;  4I6Z A;  2V6E A;  3MKW B;  4KA4 A;  3H36 A;  3A4C A;  5EG0 B;  1OCT C;  3W2A A;  1MJA A;  5CVI A;  3DCF A;  1U6G A;  5IT9 K;  1SVL A;  2KZV A;  3B6A A;  3WTX C;  4LIV A;  2R7T A;  1G2H A;  3ZXS A;  2XAF A;  4ENN A;  1Z77 A;  2HS5 A;  5KAI C;  3BPV A;  3WU2 C;  1JT6 A;  2HOS A;  4P55 A;  4NNJ A;  4B8X A;  1R5G A;  4HQM A;  3HUG B;  4CXF A;  2KDZ A;  4AM3 A;  5HNF A;  1IRF A;  5LHG A;  1TTY A;  3T0Y A;  2BE5 F;  3CUQ B;  3WOD F;  2EQR A;  4XSZ F;  4ANJ A;  3F0C A;  5LFA A;  3RZO J;  3RYR A;  3RYP A;  1LKX A;  1WJF A;  2LTP A;  2DFF A;  3OIO A;  4NBQ A;  1N25 A;  1XSD A;  3QRF F;  3TW7 A;  3L2W A;  1GLN A;  1QZZ A;  3F9K A;  4RAF A;  3PUB A;  2R93 J;  2MBF A;  4KMU X;  2NOG A;  3FX3 A;  2JVG A;  5LHH A;  5GAE J;  1I1G A;  2VE8 A;  3WU0 A;  2R7W A;  1K78 A;  3UKG A;  5F6F A;  1LE8 B;  3JRA A;  1V5G A;  4MNU A;  3X2Q H;  5FKM A;  2P7C B;  1G59 A;  1RKW A;  1ON1 A;  2RQP A;  4KIT B;  4FX0 A;  2G7H A;  3CF5 F;  3SJM A;  3A03 A;  1Y8R B;  2IA0 A;  2LYC A;  3S17 J;  2Y48 A;  1JJ8 C;  1FBQ A;  2UV1 A;  5BPD A;  4RBO A;  3HPG A;  2JWT A;  1ONV A;  1LEA A;  1STZ A;  2EV6 A;  1S3J A;  1MMN A;  3DQV C;  3H92 A;  1TT5 B;  1TL8 A;  3FXR A;  4QLC U;  2O61 A;  4DGW B;  1MBH A;  4HZF A;  2WY7 Q;  3WTW C;  3CMY A;  2H1K A;  3KP3 A;  3EUH C;  3RSN A;  3PSF A;  2D5V A;  4IO9 F;  4RB2 C;  3I9V 2;  3AFH A;  3GLX A;  2LFB A;  2BW3 A;  4JP0 A;  3JRC A;  1XMK A;  3FF5 A;  4BY7 J;  3I5U A;  2YSR A;  2Y30 A;  5DS9 A;  1AOY A;  5J1R A;  2XGD A;  2M0M A;  2XAJ A;  1D5Y A;  1MZB A;  5IP7 J;  5FKL A;  3TP3 A;  1SFU A;  4BDY A;  3CMM A;  4D1Q A;  2ZNY A;  3GTP J;  5DEQ A;  3OYJ A;  4HX8 A;  4MTD A;  1I3A A;  1D0Z A;  3DU6 A;  1PUF B;  3FXJ A;  1YW7 A;  3DLA A;  1TWF J;  2BXZ A;  1B72 A;  1R7J A;  2CH0 A;  4I01 A;  4EM2 A;  2BY3 A;  2RRE A;  4XRF A;  1BW5 A;  1WJD A;  2RVC A;  3DKW A;  3FXK A;  3MKL A;  1VQ9 I;  2M4G A;  3V7S A;  2L54 A;  2O7O A;  1WRJ A;  3CLO A;  3OMY A;  1V5F A;  5F1J A;  4HF2 A;  2A6H F;  1ZN2 A;  2L9V A;  2YX7 A;  3OIP A;  1JT0 A;  2BYV E;  5IOZ A;  1QQI A;  2Q8K A;  2GWR A;  2M30 A;  4AIH A;  3WGH A;  2VN2 A;  4AYB N;  1QGP A;  3ZN1 A;  3DTI A;  4A3B J;  3Q0V A;  1OQY A;  2X1E A;  2L7Z A;  1ZQ3 P;  2BV6 A;  1I1S A;  5ICC A;  1EH8 A;  2QSF X;  3ECH A;  1R71 A;  4DNC A;  1MH3 A;  2K3F A;  1YS7 A;  3REO A;  4Q4Z F;  5TGT A;  1P2F A;  2W4S A;  4O3M A;  1F4K A;  1ERD A;  4NQW A;  2HTS A;  3QWL A;  1MSF C;  2VON A;  3CMA I;  4PK4 A;  1K83 J;  1MD0 A;  2KFD A;  3FXU A;  4RB3 C;  2GA1 A;  2Y0S N;  5ICF A;  1GV2 A;  4UNO A;  5HOD A;  2XIG A; 
#chains in the Genus database with same CATH homology
 4ABZ A;  2HXI A;  3FIS A;  1T33 A;  2MG4 A;  1MNM C;  3G1L A;  4A3K J;  2R7Z J;  3M4O J;  4MLO A;  2MW8 A;  4UUT A;  1EF4 A;  3GTO J;  1U8B A;  3S1R J;  1BA5 A;  4MO7 A;  3Q3S A;  1NK3 P;  1MBK A;  1VI0 A;  1SFO J;  1ETO A;  4Y7N J;  4DYC A;  4XIC A;  2VUM J;  2WAQ N;  2MSY A;  1WCM J;  1QRY A;  4C3J J;  4X6A J;  5M5W J;  3WHC A;  2IEK A;  2XPV A;  4D5C A;  4FCY A;  3FK6 A;  1JKP C;  4CYC B;  1H8A C;  3K2A A;  1Y1V J;  4C3I J;  1IC8 A;  4AC0 A;  1GVD A;  2JA5 J;  1U9O A;  2L0K A;  2NS8 A;  2R5Y A;  2Y2Z A;  4DW6 A;  5EEA A;  1XC5 A;  3S1M J;  2ME6 A;  1H89 C;  2X6O A;  2IAI A;  3TP0 A;  4M3F A;  2K40 A;  4XRS G;  2VI6 A;  3PM1 A;  3GTK J;  5F0C A;  2K9Q A;  2JA8 J;  5C44 J;  1XG1 A;  1RET A;  1Z0X A;  1QVT A;  1ZK8 A;  3HB9 A;  2E1O A;  3BR1 A;  3TED A;  2LK2 A;  2O8K A;  3SDG A;  3FK7 A;  3GTJ J;  3BTC A;  4A3J J;  1UG2 A;  4LOC A;  3A01 A;  1A6I A;  1AKH A;  4L5E A;  2K9S A;  2XGC A;  2R5Z B;  1NTC A;  3ZQL A;  1Q1V A;  2JMW A;  4DZP A;  3LSR A;  4A3F J;  1VFC A;  1IV6 A;  2E2I J;  4B4C A;  1ENH A;  3JRD A;  1U78 A;  1W0U A;  1BL0 A;  1DU6 A;  4DZJ A;  1GDT A;  4A3I J;  2FQ4 A;  4NDL A;  5FKK A;  4BY1 J;  4XK4 A;  5F08 A;  1R9T J;  2JA6 J;  2FJ1 A;  3RKQ A;  1CQT A;  1X2M A;  1HLV A;  1B72 B;  2NVX J;  3HGG A;  2M8G X;  1HOM A;  1HDP A;  5K7Z A;  2EZI A;  2DA2 A;  3BTI A;  2CUE A;  3HEF A;  2HYJ A;  3NAU A;  2EZH A;  2Y9Y A;  1ETW A;  3HOU J;  2YUS A;  4IEJ A;  3HOV J;  5BNG A;  1MH4 A;  5F0H A;  5EGO A;  1QVU A;  2DA3 A;  1ZTR A;  2TRT A;  4JX6 A;  1APL C;  5IYD J;  1RPW A;  2ID6 A;  4D5F A;  4JYK A;  3HM5 A;  1FIA A;  1AU7 A;  1TWC J;  5M3F J;  1HDD C;  5IP6 A;  1ETX A;  3S16 J;  3HOY J;  4I76 A;  3S2H J;  1FIP A;  1GV5 A;  5JLW A;  3HOZ J;  1B8I A;  4QSH A;  2HOA A;  3ZOB A;  3HBL A;  3BG9 A;  4V2G A;  4A3D J;  4B3A A;  2K9N A;  1H88 C;  1S7E A;  1MSE C;  3JRI A;  2G0E A;  3JRG A;  4DYR A;  1TWA J;  4X1E A;  5F0F A;  2LKX A;  3GBG A;  3BR0 A;  3S2D J;  5IP9 J;  1X2N A;  4A3M J;  2E2J J;  4J19 A;  2GBY A;  1T56 A;  5EG0 A;  1ORK A;  5EF6 A;  4S0H B;  5FJ8 J;  4MFD A;  1Y1W J;  3LNQ A;  4JX5 A;  4D7N A;  4FIS A;  1UMQ A;  3VPR A;  1HCR A;  3GTQ J;  5EDN A;  4Y52 J;  2CQQ A;  3BR5 A;  3I4M J;  3BG5 A;  2KT0 A;  3BTJ A;  2XGE A;  2I10 A;  3ZQG A;  2XB0 X;  3JR9 A;  2L7F P;  2DA1 A;  1JGG A;  1QPI A;  3BR2 A;  3RQI A;  5FKO A;  3L1P A;  4GFB A;  1MBF A;  2R5Y B;  1WI3 A;  2LY9 A;  2DTZ A;  1ETK A;  4AUX A;  2VKV A;  5GPC A;  3JRB A;  2IBD A;  1W0T A;  2EBI A;  3O8H A;  4EEF G;  4FE4 A;  3ZQH A;  1IG7 A;  2YU9 J;  2HI3 A;  3BQY A;  2O9L A;  1RR7 A;  2M34 A;  3ZQC A;  5E3M A;  1JUM A;  4M3B A;  2CRG A;  2ID3 A;  3S1Q J;  2ECB A;  2DMU A;  2E2H J;  3SFI A;  1ZR2 A;  5EZG A;  3A01 B;  1LE8 A;  1FJL A;  5IOY A;  2COB A;  1AKH B;  4A93 J;  1JTY A;  2DMQ A;  4UUS A;  3QQA A;  1IDZ A;  3I4N J;  2HQ5 A;  3BG3 A;  3BT9 A;  3OOU A;  2DMN A;  1MBG A;  1SAN A;  3TW6 A;  5M5X J;  1ETY A;  1TWG J;  5C4X J;  1JKQ C;  4FE7 A;  1I6H J;  1LFB A;  2VKE A;  2VPR A;  1MBJ A;  1U9N A;  1ETQ A;  1JJ6 C;  1E3O C;  5EZH A;  3IH3 A;  1I50 J;  2CU7 A;  3HOX J;  3IV5 A;  4IHX A;  2H8R A;  2LP0 A;  2HOT A;  2DJN A;  2XPU A;  3BTL A;  5J1Y A;  3ZQI A;  1TWH J;  2DMT A;  5E3L A;  1YRN A;  2EH3 A;  5M5Y J;  3HDD A;  2X48 A;  3GTG J;  5IYB J;  2LR8 A;  1X58 A;  3FKI J;  1AHD P;  1DU0 A;  1WPK A;  4QTR A;  4M6V A;  2XB5 A;  1FTT A;  2R92 J;  4W1U A;  3IH4 A;  1F36 A;  2WV1 A;  2DMP A;  2OPT A;  4XRS A;  2B63 J;  3C2B A;  5J3L A;  5EGO B;  4IHW A;  2YS9 A;  2OF7 A;  1P7I A;  3E7L A;  5EYR A;  2JA7 J;  3M3Y J;  1PUF A;  1OFC X;  5GPA A;  4A3E J;  4DYQ A;  1WGX A;  1TC3 C;  4A3G J;  1P7J A;  2XPW A;  2QCO A;  2ECC A;  3G1M A;  2GLO A;  1FEX A;  1B8I B;  3HGY A;  1IGN A;  3LSG A;  3MN2 A;  2M0C A;  2L7M P;  1ETV A;  1JTX A;  4MIM A;  3JRH A;  3FIW A;  3QPL A;  5J1U A;  3NAR A;  2MGQ A;  1O4X A;  1VND A;  2NVQ J;  2AO9 A;  2PMZ N;  1JKO C;  3BR3 A;  2M2E A;  3S1N J;  2W48 A;  4C2M J;  3OSG A;  2FX0 A;  3OSF A;  3A02 A;  4XRM A;  2GM4 A;  3S14 J;  3JRF A;  4BBR J;  2AHQ A;  4I6Z A;  1XS9 A;  2JK3 A;  5EG0 B;  1OCT C;  4HNV A;  3DEW A;  3DCF A;  3BR6 A;  4C3H J;  4IHY A;  5C4J J;  3B6A A;  3PO2 J;  2JJ7 A;  3Q0U A;  4A3L J;  1G2H A;  1Z77 A;  4V2F A;  1JT6 A;  2HOS A;  1WH7 A;  1IRZ A;  3PO3 J;  4BBS J;  1ITY A;  4M3E A;  3LSJ A;  5IYC J;  2KDZ A;  3HOW J;  1IDY A;  2EQR A;  3F0C A;  2HXO A;  3RZO J;  5FLV A;  1NK2 P;  4MFE A;  1ZR4 A;  2LTP A;  3K7A J;  3GTM J;  3OIO A;  2LVS A;  3TW7 A;  5FLM J;  1IJW C;  3HKZ N;  4G12 A;  3GTL J;  3MVP A;  2WB1 N;  2EZL A;  1UHS A;  2R93 J;  4CYC A;  3CQZ J;  2NOG A;  4XID A;  1GUU A;  2RAE A;  5JLX A;  3UKG A;  1HF0 A;  1LE8 B;  2Y9Z A;  3JRA A;  3B6C A;  5K7F A;  2N8G A;  2CQX A;  3G1O A;  4UUS B;  5M3M J;  1MBE A;  5FKN A;  5FKM A;  1ZGW A;  1RKW A;  2CUF A;  2X9D A;  1JUS A;  3SJM A;  2HDD A;  3A03 A;  2E19 A;  5E3O A;  3S17 J;  1VF9 A;  2EZK A;  1JJ8 C;  1K61 A;  3W6V A;  2CJJ A;  2ELK A;  2FD5 A;  2XRL A;  3H0G J;  2DA4 A;  2Y31 A;  4RBO A;  4RDU A;  2JWT A;  2TCT A;  2NS7 A;  4BKX A;  3JRE A;  1MBH A;  1YRN B;  3CMY A;  2H1K A;  9ANT A;  3H3V K;  2DA7 A;  2D5V A;  2ZB9 A;  1A5J A;  1RKT A;  2R5Z A;  3LOC A;  2JN6 A;  3D1N I;  5F04 A;  5GP9 A;  1POG A;  2LFB A;  3CDL A;  4JP0 A;  3JRC A;  4M3G A;  4BY7 J;  1ZKG A;  4A3C J;  4BXX J;  3RZD J;  2Y30 A;  5DS9 A;  1OJL A;  5J1R A;  2XGD A;  1WH5 A;  4A69 C;  1D5Y A;  5IP7 J;  3CCY A;  5FKL A;  3TP3 A;  2QF7 A;  3ZQF A;  5K7H A;  1JUP A;  4FTH A;  1OCP A;  2XSD C;  3GTP J;  1RES A;  1BW6 A;  3S15 J;  2DN0 A;  1PUF B;  1B72 A;  1TWF J;  1LFU P;  1BW5 A;  1BJZ A;  1I3Q J;  5E3N A;  3MKL A;  2NVY J;  2M9H A;  3BQZ A;  4QIW N;  1JKR C;  2O7O A;  5F1J A;  4D7M A;  4JX4 A;  5IPA A;  3LSP A;  2LD5 A;  1JT0 A;  3QPS A;  5IOZ A;  4M3D A;  3Q0W A;  4AYB N;  4IHV A;  2L9R A;  4A3B J;  3Q0V A;  2DA6 A;  3WHB A;  1GT0 C;  1FTZ A;  2L7Z A;  2DA5 A;  1ZQ3 P;  3IH2 A;  1MH3 A;  4B1R A;  5DTD A;  3O8G A;  2ME0 A;  4W97 A;  2NVT J;  2P81 A;  2R0Q C;  1F43 A;  1MSF C;  5C3E J;  1K83 J;  2LLK A;  2Y0S N;  1IUF A;  5F27 A;  1GV2 A;  5HOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...