4RGRA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
b'REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP
rcsb
molecule keywords Repressor protein
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 42
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgrA00
1IN5A 2GA2A 2CW0F 2BYVE 1YW8A 2PQ8A 5D6EA 4BQAA 3S2WA 3RKXA 4L0YB 1GHCA 4G6DA 3DXJF 4LLNA 5HLGA 4U0YA 2AS5F 1XGNA 1P4XA 2M1BA 3IWFA 2FEZA 1CF7B 4IPAA 1B59A 2DQLA 4QWQA 5IT3A 1EV7A 3GX4X 3LAPA 1YIOA 5H6RA 4JBAA 4EJOA 3LA2A 4BYYA 4UHTA 3J81Z 3IKTA 5ICFA 2PN6A 2R7DA 3WGIA 1XGMA 2HEOA 3HUGA 1ZRCA 5K5QA 4BNCA 3RIRA 2LKPA 4O3MA 5D8KB 2W25A 1USSA 4YG2F 2PG4A 4OIRF 4AVPA 2XASA 4HLYA 3IWZA 3R61A 1BI2A 3MFKA 4A5MA 1P4AA 2X4HA 5A2QZ 1ZG1A 1UB9A 4G9YA 3M8EA 1OYWA 1IXSB 3I53A 1B6AA 2YR2A 2OZ6A 4L18B 4ZH4F 3HOTA 3ZMZA 4OIQF 5K5OA 5J8CA 1FPQA 2FOKA 5E8GA 1IXCA 4EQQA 1SFEA 3LQQA 2LNBA 1ZN2A 2PJPA 5D5WB 3F8CA 2BGCA 1V3FA 4UV8A 4DNCA 3CUQC 2KIFA 4KYWA 4U7DA 3L09A 3SZPA 1IUYA 3RPUA 3ZMSA 3FMRA 4P55A 2VT3A 2KRFA 3TQNA 3NQOA 3D5LA 3WGHA 2VBWA 4H0EA 3H3UA 2ZNYA 2ISZA 2MLGA 4HZFA 3QRFF 2EFPA 2FMYA 3FXRA 3NEUA 4LLGF 3JTGA 2Q8KA 1ULYA 3HRMA 4P5OA 3B02A 3KLOA 1BM9A 1Z91A 1P4WA 1J7KA 1J2XA 4ASNA 1T6SA 3K0LA 1ZLKA 1FYMA 5HDNA 4UVCA 4Y13A 1XSXA 4LGWA 3ZMDA 1YQAA 5H6QA 5D5XB 5L3CA 4KA4A 5BQTA 3NRVA 1HSJA 2RVCA 4A6DA 2FNPA 2FE3A 1ZLJA 3N4MA 2YU3A 3J80Z 1OKRA 5ILSA 2EFOA 4AWXB 1K6OA 3RKYA 4XLPF 4B8XA 5EEHA 4K2EA 3TO7A 2A3SA 2EJRA 3U1DA 3G73A 4L9JA 4Q4ZF 1XDSA 1LB2A 2C6YA 1HSTA 2EA2A 5TJJA 2DI3A 4WWCA 1RUOA 5K5RA 2PFBA 3V7CA 1HW5A 1KU7A 1XDUA 3ZPLA 3E6BA 3R4KA 3ZP5A 2ZCWA 1I5ZA 3K1PA 1J0RA 2EWNA 2XAJA 3ERED 5JHUA 1AOYA 1WWXA 4BHCA 2OBPA 4IRGA 2DBBA 3GFJA 1S29A 5CVUA 2ACJA 2FNAA 2UXNA 2ZBKA 1USTA 3JW4A 5HS8A 1FYKA 1ON1A 3LFKA 4UUVA 2QQ9A 3KLNA 1KU9A 1REPC 3F22A 4U0VA 3DV8A 4YIIA 4S04A 2MC3A 2P5LC 3HSFA 3T0YA 1BI0A 2FBHA 4OINF 1Q1HA 2UXXA 5IT9K 5LHGA 5ICCA 1XD7A 1T2KA 4IHTA 1DPUA 3GWZA 1RUNA 1G4DA 4RAYA 3GEZA 1JXSA 3CTAA 3KP7A 2DFIA 1BJAA 1IN6A 3DQVC 1FBQA 3F8MA 1W7PB 1R1TA 3IC7A 3EYIA 4IJAA 3FXQA 2NYXA 3I59A 1BI3A 1O3SA 2DQRA 4BHBA 2P8TA 1QBJA 2OQGA 4EJTA 2IA2A 2PI0A 2TDXA 3L00A 4M6YA 2PEXA 4I09A 4RGRA 2D1HA 2VC0A 4PCQA 2YX4A 3SZTA 4MGRA 2Y75A 1MD0A 2COMA 3DKWA 5E1WA 1I1SA 4WF2A 5HS7A 2UWMA 1UFMA 4EM1A 3F21A 2FXAA 3KP5A 4I02A 1RNLA 4CYDA 2M5WA 2HQRA 4RS8A 4CHUA 2H6BA 2DAOA 3AAFA 1LDDA 3I54A 1W7PA 1SMTA 3ML6A 4EJUA 4YIFA 4I01A 1ZYRF 1MJAA 2HWVA 3C1DA 2PMHA 2STWA 1BC8C 1IZ1A 1JGSA 4LB6B 5FGMA 2BBYA 3V7SA 2WTEA 3OOPA 1K7AA 2KJBA 4L9NA 3CUOA 1LDKB 1W7PD 2RQPA 3KP4A 2ETHA 5LEJA 4OIOF 1JHFA 3VODA 3DFGA 2Z5UA 4RGUA 4HF1A 1WRJA 3F8FA 5DCMA 3C7JA 2G7UA 1F4KA 1SD6A 2V79A 4ETSA 1R58A 1TBXA 5HLHA 4GCVA 4DQ2A 5KVRA 2H6CA 1X3UA 2IVMA 5FFXA 3T1BA 4G6QA 1UCRA 3M8FA 2VE9A 4UVAA 1D3YA 2DPDA 2HKXA 5F64A 1XB4A 1R1UA 4IF4A 4JK1X 1BOAA 4KFCA 1O57A 3E3VA 2GXGA 1ZRDA 3FWEA 1W4MA 5J6XA 2RKHA 5LGUA 1ODDA 2HDCA 1XN7A 2F5FA 2QUFA 1B9NA 4I7HA 1SAXA 1HQCA 5D5UB 2O8XA 3REOA 4LJZF 2Z3YA 1B4AA 2WWYA 2UZKA 1FP2A 3K2ZA 2OU2A 1J75A 3K1NA 2EFWA 2L54A 3GUDA 2EA4A 4RB3C 4KMUX 4LFUA 5DD4A 1YYVA 5LGNA 3LQRA 3FMSA 3ISPA 2RNJA 4ESBA 3LAJA 1DPRA 3DF8A 2MLKA 1R36A 4KN4X 2MA3A 1IXRC 1GVJA 5LRRA 3C18A 4MEXF 2OZUA 3HRUA 1ZRFA 1RIOH 3PQKA 1EH8A 4MTDA 3RI4A 4HAMA 2IJLA 2W84A 2ZFWA 5DCFA 4O6JA 5TRDA 5DEQA 2ZKZA 3CO7C 2IRFG 2QENA 2K4BA 4EJWA 2RC4A 2GAUA 3KP6A 5LRSA 3EETA 1O7FA 1BIBA 1OPCA 2YSRA 1B1BA 1U78A 5BMZA 4R8HA 1L3LA 4QLCU 4L9VA 4EGYA 1HKQA 1KU3A 1LEAA 4CGZA 3GXOA 5H20A 1H9GA 2LSOA 2L02A 2DU9A 2FMLA 5HLIA 5FD6A 4A2UA 3K9TA 4N9HA 2O03A 4IRIA 2W24A 5LLQA 1TNTA 2BEOA 5HVQC 4KDPA 4MTEA 4YFKF 3BOQA 3JSOA 1FP1D 5CVRA 1A04A 4MEYF 3JAMK 1KQ8A 4HF2A 2DT5A 2HR3A 5D5VB 3T8RA 4WXCA 3JTHA 4HW0A 1XSDA 4EM2A 3JSPA 3J81K 1U8RA 2A69F 4ZZDA 1SFUA 4NQWA 2L4MA 3QU3A 3ELKA 4ZZLA 1SD7A 2IP2A 2HZTA 3IKVA 3KE2A 3GVAA 4EGZA 4I0BA 3F8BA 3ECHA 2ZMEA 1XGSA 3E97A 4FX0A 3R0JA 3K69A 4HDVA 5LGTA 2JRTA 3F6VA 3KCCA 2M30A 3BWGA 3BDDA 1Z9CA 3ZMUA 5L3EA 3WTTC 5A2QK 2Y48A 4KNYA 2HYGD 1I6XA 2F2EA 4FX4A 1WI9A 2VBXA 1TLHB 2FU4A 4JQFA 3MAJA 1MGTA 4EM0B 4WXHA 3RPQA 3KFWX 2J5OA 5EEGA 1FSHA 2H09A 2OQRA 1KYZA 4GGGA 2RN7A 2HGCA 2IPQX 2XROA 1G3SA 2VT2A 3GYHX 1EH6A 4IXAA 1U2WA 5E20A 2XKOA 3EYYA 1K78A 5E1XA 5L3GA 3J7AO 1MJBA 4XSXF 2XUBA 1PDNC 2O6GE 2XAFA 1D8KA 2BE5F 3G3ZA 2CYYA 2A5YB 3QP5A 2HKOA 2XV4S 2QM3A 3P9KA 2IA1A 4R1HA 4RGSA 2P6SA 4UNOA 5AONA 1STZA 2XAQA 4ZYDA 2P7VB 5DYMA 1HKTA 3RYRA 2WC2A 3P7NA 3E5UA 2JZYA 2M8EA 1ON2A 1IRFA 3E6DA 4Q48A 5IT9Z 2D1VA 4D0PA 3ZMVA 2K86A 5BOXA 2LF7A 1MDMB 3FHZA 3J80K 1U5TA 1RI7A 3B73A 1FZPB 3SQNA 3MZYA 3ZN1A 1P92A 2QBYA 1L0OC 4EVIA 1R7JA 3I59B 3MEXA 3V4GA 1YTYA 4A5NA 3H92A 4ENNA 2VODA 3GFMA 2KJCA 3WU0A 5JVTA 3V8KA 4EV0A 4PGGA 3WTZA 2IT0A 3ABTA 1TW3A 3U2RA 1QPMA 4ESFA 1CGPA 2H94A 1MDMA 2E7WA 3BPVA 2JTVA 3HHHA 2V9VA 3SHFA 3WG9A 2L01A 3V8LA 4TV7A 2CWEA 1XGOA 2RV8A 3ECOA 3IRQA 4LLLA 2OAZA 3GFIA 1LQ1A 2DTRA 1S6LA 3HSRA 3TDUC 5D6FA 5K1YA 1YS6A 3WU1B 2LDUA 5DD8A 3KEQA 4M74A 3K1MA 3GF2A 3N97A 2R7FA 2GXBA 2QWWA 3QU6A 4KICA 1J9IA 2R3SA 1BIAA 1DP7P 2K27A 4R79A 2GIVA 5BPDA 2FA5A 1XCBA 4AD9A 2QLZA 3GZ5A 4CO8A 3M7GA 4MHGA 1G3WA 5DCMB 3IRRA 3BJOA 2G9WA 1YG2A 3BJAA 2XIGA 3W6JB 2NS0A 2VONA 2EB7A 2ZXJA 3WTXC 1S7AA 3EUHA 2KKOA 4G7ZF 1FY7A 3C3WA 2HTSA 3V7RA 3HTUA 1T0FA 5E17F 3RTRA 3ZQ7A 2LF8A 3HHGA 2DLLA 3HSEA 5FD5A 3FMQA 3MWMA 5KK1A 1F5TA 4A0XA 4Y17A 1K79A 1YFHA 1PUEE 2XKPA 3VOEA 3WE3A 4CICA 1IAWA 4HF0A 5AIQA 4AIHA 2D2WA 2CG4A 3ABUA 2O3FA 4I2OA 3WTUC 1OYYA 2V6CA 1I1GA 4ENMA 1JHHA 2OA4A 3KZZA 4FT8A 2A6EF 5L3FA 2GA1A 1VTNC 4ON0A 3DPLC 1KGSA 1Z7UA 4P9UA 2ESNA 4EMSA 5CVIA 1FSEA 1BI1A 3W6KB 1F9NA 5FLXZ 4UV9A 2X0LA 3HRSA 4ENKA 1DUXC 1QQIA 4FHTA 4KN7X 2YPRA 1WQ2A 3KP2A 5F6FA 2ZO4A 4M73A 3I4PA 5FO5A 4MQ9F 3CJNA 2VXZA 4MQVA 3COAC 2P7CB 1R5GA 5D4SA 4I98B 5LBQA 4ENJA 4P9FA 2EK5A 5JFRA 4UXNA 3PFIA 1OYIA 2M87A 2KIMA 2Q0OA 3LA3A 2DPUA 1MJ9A 3BROA 2IW5A 2GWRA 4HX7A 1FBSA 5DUKA 2HTJA 1U3EM 4LMYA 2V1UA 4YFXF 3FXUA 3QOPA 1G6NA 3M1EA 2XVCA 4RAZA 4ZYHA 3ZN0A 2Q2EA 3I0TA 5D8LB 1R00A 4XRFA 3EQLF 3I71A 4I0AA 1FLIA 2MH2A 3VFZA 2FSWA 3MQ0A 2K4JA 4WXDA 4Z2YA 2MBFA 3RYPA 2L3DA 4IHSA 1SD4A 4XSZF 3Q9SA 3R0AA 1O3RA 5LHIA 2CGPA 1F1ZA 3CDHA 2MD5A 4G7HF 3QP6A 4BAYA 4F7ZA 2XAHA 3GW2A 4L5IA 5L3BA 2VN2A 3JAMZ 1XMKA 2FF4A 3CUQA 4A0YA 1WSUA 1FBUA 1ZREA 2FQ3A 5F1RA 4M9XA 1T39A 1TQIA 1XMAA 3CO6C 4M71A 4HQMA 1O3QA 4KIBA 1YW7A 1H9TA 3FM3A 2ZMEB 5HS9A 1HW1A 2J5PA 1FOKA 2V1XA 1J5YA 3O3KA 2ZNZA 4GYIA 2NAZA 4Y15A 5HOOA 4PGHA 5AIPA 3R6SA 4IRHA 1CF7A 1IW7F 1E2XA 4Q47A 4U88A 2VOOA 3PQJA 5E8IA 5ICEA 2QZ8A 1XSVA 3BZ6A 2VBYA 1HKSA 4KIGA 3RDIA 2STTA 3VB2A 4M6XA 2L4AA 2W85A 3RKWA 4OIPF 1TW2A 2MH9A 1YO5C 3QPHA 3P9CA 1FNNA 2QQBA 3TOAA 3L2CA 1TQMA 2YX7A 1HBXG 3FX3A 1K78B 1XCVA 4LD5A 3QPTA 3U9GA 2FBIA 2JPBA 4CXFA 3WODF 1AWCA 1EH7A 1QGPA 2FBKA 1P6RA 1E17A 4U7BA 1S3JA 2JPCA 2O61A 1GXQA 2JT1A 4RB0A 3WTSC 4XLNF 5D4RA 1R22A 3F3XA 4Q5SF 2CSOA 4ZYGA 1HXDA 1BN5A 4KIFA 2PLYA 2ADUA 5ERIA 5DDGA 4ESJA 4WX9A 3P9IA 1KQ0A 2K7LA 4RB2C 5ED4A 2PMUA 4A12A 1YS7A 3WGGA 4B09A 5JI6A 4YFNF 3V8JA 1DDNA 1S8NA 5DV5A 1ZGJA 2WV0A 4WCGA 1PP7U 1PP8F 4L0ZB 1R1VA 3TGNA 3DP7A 2EV5A 1TQPA 1Z6TA 3WTVC 2M45A 2EFQA 1D5VA 2VBZA 4PZJA 1FT9A 2JSCA 1U5TB 2W57A 1D8JA 5ICGA 3SXYA 1O7LA 1TTYA 2QBYB 1BBYA 2Z33A 3O2PE 4GXOA 3BJ6A 3M9AA 3RJPA 2PBIA 4HV6A 2NRAC 4S05A 1V4RA 5E18F 2P6TA 3EDPA 1FX7A 3WTWC 2VC1A 2A68F 3CLOA 4KUMA 1Y0UA 3D0SA 1ONVA 5E1ZB 1FYLA 1Z6RA 4A0ZA 2NNYA 1UHMA 3TOBA 3E6CC 2VOPA 4OMYA 3L7WA 4LB5A 4HOBA 1ZHFA 4OMZA 4HBLA 3MZHA 3TDZC 1Z1DA 2DO7A 1ZGAA 1YLFA 4RGXA 3T8TA 3LWFA 2QYOA 4GYGA 1H0MA 4GO1A 5HDGA 5HDKA 4HYEA 2Z9OA 4P96A 5BS6A 4G8XA 3KZYA 1KU2A 3OV8A 3TO6A 2D45A 1R5HA 2AXLA 1U6GA 5DUIA 1LDJA 3WTYC 1Z05A 2QQAA 2F5DA 3GLXA 3I64A 4M9ZA 1LJ9A 2RGVA 3E5QA 3F23A 4KMFA 3FZVA 3HOSA 3Q9VA 3IL2A 1QNTA 2P5KA 4M72A 3HTSB 5BPIA 2Z99A 5ILUA 5CYVA 2XHKA 1G3TA 3GO5A 3HRTA 4UVBA 2CO5A 2GQQA 4XBFA 2F5EA 2E7XA 3FF5A 2HS5A 4HDUA 3I58A 2XAGA 1IF1A 1LNWA 2F5CA 3WE2A 1HW2A 2ELHA 3Q5FA 2HOEA 1TNSA 3QAHA 1B9MA 3BPXA 1J59A 1SFXA 3O6BB 3TKYA 4G94A 1NHAA 1MZBA 1SD5A 5L3DA 2HYFA 5LHHA 3LSTA 3E6MA 1W5SA 3T5XA 2Y0MA 3F72A 1U5TC 4L9TA 4CZZA 5CJ9A 2V1DA 1FC3A 3BP8A 1UHWA 3H3ZA 3SFZA 4BH9A 3ROUA 2P4WA 4HX8A 1P2FA 1IN4A 3DPTA 4HV5A 2OD5A 1G3YA 4E70A 1IN8A 2HQNA 3KEOA 3GZ6A 4WK8F 2A61A 2CFXA 4CDGA 3MCZA 4A6EA 2A07F 1IN7A 1KA8A 3DEUA 4BXUA 3GFLA 2KIUA 2XRNA 4HX4A 4G7OF 2G7HA 4LK1F 4OOIA 1KQ9A 1GXPA 1KYWA 4HA8A 4LG0B 2ISYA 2BV6A 3ULQB 3KETA 2EV0A 1QO0D 1QZYA 4IVNA 2DK8A 2E1NA 5J8FA 1S7OA 4O5VA 1BC7C 1ZARA 4EJVA 2ZJ2A 1C0WA 4MNUA 4KT5C 5FB2A 1T98A 3HIFA 1SMYF 4PDKA 3ZMTA 2P5VA 6PAXA 2O0YA 1OR7A 1W5TA 2A6HF 3LA7A 4L5JA 3I5UA 4HLXA 4N9IA 3R60A 3IHUA 4LG0A 1MKMA 4NB5A 2DK5A 4LK0F 2EFNA 2EV6A 2H27A 5LEKA 1ZG5A 1ZAOA 4U0WA 1RZ4A 3KP3A 1LVAA 4BHPA 5CLSA 2ESHA 4OU0A 3F8NA 4N0BA 1IRGA 4RB1A 2GZWA 2B0LA 5ILVA 2RDPA 4AIJA 3VEPA 4M9SA 5CVJA 1JE8A 5FFZA 5CVVA 2E1CA 1I27A 4HQEA 2QVOA 1ZH5A 5JR3A 1WKMA 3CUQB 1LEBA 1ZG3A 1QZZA 2FRHA 2K02A 1O3TA 1YW9A 5FLXK 3E5XA 3BY6A 3HYIA 3F6OA 2DW4A 3FM5A 1OMIA 4ZYEA 3TO9A 2NNNA 4AIKA 4NHJA 2HFHA 2CQKA 2IA0A 1FWZA 3L9FA 2VE8A 1R23A 1T38A 2XGXA
chains in the Genus database with same CATH superfamily
1OCPA 1IN5A 2GA2A 1ZR4A 4W97A 5EJCA 2CW0F 2L9VA 3ABLH 3HXLA 2BYVE 2DOEA 1R9TJ 1CQTA 1YW8A 1UG0A 2PQ8A 5CKTA 2L9NA 2CV0A 5D6EA 4BQAA 2COBA 3S2WA 3RKXA 5EZGA 1MMDA 4L0YB 1GHCA 2HOAA 4G6DA 1VFCA 3DXJF 4LLNA 5HLGA 4U0YA 2AS5F 1Y1VJ 1XGNA 3BR2A 2E1MB 2A5WA 1P4XA 2M1BA 3IWFA 3PL8A 3PSIA 2FEZA 1CF7B 4IPAA 1B59A 4MFEA 2DQLA 3S3NA 4QWQA 5IT3A 1EV7A 3IV5A 3GX4X 4FCYA 2K3FA 2NVYJ 4XKBA 3ZQLA 2O7OA 3KZIC 3LAPA 1YIJI 2JA7J 1YIOA 5H6RA 4JBAA 1R4MB 1TT5B 2DT6A 4EJOA 3KX2A 3LA2A 4BYYA 4UHTA 3FISA 2AO9A 4JP0A 3J81Z 3BT9A 4XN0A 5FKLA 1FIPA 4A3MJ 3IKTA 5ICFA 4CYCA 2PN6A 2R7DA 3SEZA 5GADJ 2R0QC 2LY1A 1WZ2A 4D7NA 1LE8A 3WGIA 1ZELA 1XGMA 2HEOA 3HUGA 1ZRCA 5K5QA 1Z3XA 3O8HA 4BNCA 5J47A 3DPUA 3VYSB 3QYEA 3RIRA 2LKPA 1T56A 4O3MA 5D8KB 3OYLA 2W25A 1S7EA 2CUFA 2H1LA 2M7AA 1USSA 4YG2F 2PG4A 4CCMA 4OIRF 4AVPA 2XASA 4C9YA 4HLYA 3IWZA 1JUSA 1MNMC 3R61A 1BI2A 3MFKA 5DM7F 4A5MA 1P4AA 3SJMA 3CJRB 1YE9A 2X4HA 1Z77A 2KPMA 5A2QZ 1ZG1A 1UB9A 4U87A 2EILH 4G9YA 3M8EA 1OYWA 3EUAA 2X6OA 5J1UA 1IXSB 3I53A 2ME6A 1B6AA 2LVSA 2YR2A 2OZ6A 5B1AH 4L18B 1OFCX 4ZH4F 3S17J 3BG7A 2JVHA 3HOTA 3ZMZA 5IOYA 4OIQF 2DYSH 2DOAA 4CA0A 1LFPA 1IGNA 3J7AY 1GUUA 1T95A 2DA1A 3HKZN 5FRNA 3BZKA 5K5OA 1ERDA 5J8CA 1FPQA 2FOKA 1NH3A 5E8GA 1IXCA 3GLLA 4EQQA 2VJIA 1SFEA 2NS7A 2L5QA 3LQQA 1HLVA 2X85A 2LNBA 3BG6A 4BE2A 1ZN2A 2PJPA 5D5WB 1AKHA 3F8CA 2VQHA 3SFIA 1U9OA 2BGCA 3OYJA 1V3FA 2QCOA 2M0CA 4UV8A 4DNCA 3CUQC 2KIFA 3QODA 4KYWA 2PMZN 5GAEJ 2VUMJ 4HNUA 3OIQA 4U7DA 4BXFA 3LSMA 3CDLA 3L09A 3BC8A 2BY2A 4II2A 1ZKGA 3SZPA 4AC0A 1IUYA 3RPUA 2JN6A 3L1PA 2VJJA 3ZMSA 3FMRA 1RC9A 1WH5A 4P55A 2VT3A 4BKXA 2KRFA 3TQNA 5M5WJ 3NQOA 3D5LA 2BOLA 3WGHA 2VBWA 4I99C 4DBQA 4H0EA 3H3UA 2ZNYA 3W2AA 2L9RA 2Z1DA 2M4KA 3MKWB 2ISZA 4PJJA 4A93J 2MLGA 4HZFA 3QRFF 4UUTA 2EFPA 2FMYA 3CCSI 1QPIA 2ME0A 1WPKA 3FXRA 1HDDC 2MFZA 3NEUA 4Y7NJ 4LLGF 1X1BA 1AA7A 3JTGA 1JKOC 1Y6IA 3PO2J 2Q8KA 1ULYA 3HRMA 4P5OA 5JVGF 3B02A 2LG4A 3KLOA 1BM9A 1D5YA 4BU2A 4A3CJ 2E1MC 2QF7A 2B7EA 1Z91A 1P4WA 1J7KA 1J2XA 2L7MP 2QGUA 2Y9ZA 3BCAA 2HXIA 4ASNA 5GAHJ 1T6SA 3K0LA 3NARA 1ZLKA 5HNFA 4UUSB 1FYMA 2M2EA 2KISA 5HDNA 2DXIA 3HG9A 4UVCA 3JREA 4Y13A 2HPIA 1D1CA 1XSXA 4LGWA 2EBIA 2ZC2A 3ZMDA 2IS2A 2R4GA 1YQAA 3HOXJ 2WB1A 5H6QA 5D5XB 5L3CA 4KA4A 5M5XJ 5IP7J 5BQTA 2OCCH 1R5ID 1X1CA 1W0TA 3NRVA 1HSJA 2RVCA 4A6DA 1RR8C 2FNPA 4DZPA 4XQFA 4C30A 2FE3A 1ZLJA 3H35A 3N4MA 4NC6A 2YU3A 2BXYA 4F92B 3J80Z 1OKRA 5ILSA 2XDVA 2QSFX 2EFOA 4AWXB 3FXOA 1K6OA 3RKYA 4XLPF 3PO3J 4B8XA 3S3MA 5EEHA 2KP6A 2N8GA 4XLHA 3ZQHA 3W2WA 3L2VA 1SANA 4K2EA 3TO7A 1TWFJ 4XMYA 2VL8A 1OISA 2A3SA 4C3HJ 2EJRA 1LPQA 3U1DA 2DA4A 3G73A 4L9JA 4Q4ZF 1XDSA 5BNGA 3G1MA 2ELJA 5FKOA 1LB2A 2C6YA 4A3GJ 3DEEA 1HSTA 2EA2A 5TJJA 3CCEI 2DI3A 2P0WA 1FMVA 2X1CA 4WWCA 1RUOA 2IEKA 2PFBA 3LSJA 3V7CA 4B4CA 5K5RA 3FBNB 1K83J 1XTAA 1HW5A 1TZLA 3IH2A 1KU7A 2WAFA 2HQAA 1XDUA 3K2AA 2L2OA 3ZPLA 3E6BA 3R4KA 3ZP5A 1W36D 3JRCA 3PIPF 1YOVB 2YU9J 3E0JB 2ZCWA 1I5ZA 3K1PA 1J0RA 3O8GA 4B44A 2EWNA 2ZXIA 2XAJA 3AG2H 3ERED 2ECBA 5JHUA 4RM3A 1AOYA 1WWXA 4BHCA 2OBPA 4IRGA 2DBBA 2EZIA 2W48A 3GFJA 1S29A 1A5JA 3S16J 5CVUA 2PX9A 3JRBA 2ACJA 1JUMA 2LD5A 2FNAA 2UXNA 2ZBKA 3BR1A 1MMSA 2M3AA 4HNTA 3PIOF 3HOVJ 1USTA 3JW4A 4QSHA 5HS8A 4A3KJ 1FYKA 5FRMA 1ON1A 3LFKA 4UUVA 3PFYA 2QQ9A 4FETA 3PM1A 2NS8A 2DA2A 3KLNA 5HODA 1TL8A 2DMQA 3HBLA 1KU9A 1NK3P 1REPC 1WI3A 3F22A 2VKEA 4U0VA 1AHDP 3DV8A 4YIIA 2QA4I 4F55A 3LSKA 2E35A 4S04A 2MC3A 2R7QA 5C4XJ 2P5LC 1U8BA 4F3QA 2ZSIB 3HSFA 4QIWN 4E6KG 4HG2A 3CQZJ 3T0YA 3LFUA 1BI0A 1WJFA 5EG0A 2FBHA 1WHUA 1UJ8A 1FEXA 4OINF 2BVLA 1Q1HA 2UXXA 5IT9K 4RAFA 1MSFC 2Y9YA 5LHGA 5ICCA 3E1SA 1XD7A 1W36C 4OAZA 2E71A 1JT6A 2DA5A 3MN2A 4CCNA 1T2KA 3ZQIA 1VNDA 4IHTA 2E36A 4JX4A 1DPUA 3GWZA 1RUNA 1G4DA 4RAYA 1Y0NA 1IC8A 1GLNA 3GEZA 2K9MA 1JXSA 3CTAA 3KP7A 2KDZA 1WGXA 2DFIA 1BJAA 5FROA 2CW8A 3CJQB 2CFOA 1IN6A 3DQVC 1KONA 1FBQA 3F8MA 3CMYA 1W7PB 1R1TA 1WJEA 3HC7A 4UB8C 3HDDA 2RQQA 3IC7A 4KITB 1VQ7I 5DS9A 4F93B 3EYIA 2XF6A 2OCEA 4IJAA 3FXQA 4BY1J 1W5CC 2NYXA 3I59A 1BI3A 1T08B 3BZCA 9ANTA 1O3SA 1N77A 2DQRA 2L9SA 4BHBA 2GXAA 2P8TA 1QBJA 2OQGA 4EJTA 2IA2A 2PI0A 3CCUI 2TDXA 3L00A 1PUFA 4M6YA 4PFPA 4S0HB 3ZGKA 2H1KA 2PEXA 4I09A 3CF5F 1R4NB 4RGRA 2D1HA 1DGWY 2VC0A 4Y52J 4PCQA 2YX4A 3SZTA 3LSHA 1IRXA 4MGRA 2Y75A 3HGGA 5LFAA 4LIUA 1MD0A 4CSWA 2COMA 3DKWA 3CCJI 5E1WA 1I1SA 4WF2A 1TP4A 5HS7A 2UWMA 1UFMA 4EM1A 3FK6A 4EEFG 3CZ6A 3H9GA 3F21A 2FXAA 4XOPA 3KP5A 4I02A 1RNLA 2HZDA 3ZCOA 4CYDA 2M5WA 4I76A 1WJBA 2HQRA 4RS8A 4CHUA 2H6BA 2DAOA 2LP0A 3AAFA 1LDDA 3M3YJ 1QA6A 3I54A 1T8IA 1W7PA 4BS9A 2JJ7A 2XPWA 1SMTA 3ML6A 3I56I 1JKQC 3DBRB 3DKYA 3JRIA 4EJUA 3OWTA 2ZFUA 3ZR8X 1GV2A 4M3GA 4YIFA 2DTZA 2L0KA 4I01A 1ZYRF 2JRMA 4A69C 1MJAA 1JTYA 4IOAF 2HWVA 3C1DA 2PMHA 1FTZA 2STWA 1BC8C 1IZ1A 1JGSA 1D1BA 3GZNB 4FASD 2K9SA 1OCTC 4LB6B 5FGMA 2BBYA 1F36A 2HDDA 1RPWA 5IYCJ 3LSGA 4BBSJ 3LSRA 2HYJA 2K5CA 3V7SA 4D1QA 2WTEA 1H8AC 2X9DA 2VI6A 2KHMA 3AG3H 2W4SA 3OOPA 3CCLI 1K7AA 2KJBA 4L9NA 3CUOA 1LDKB 4IOCF 4ZC3A 1DU0A 4MLOA 4PJLA 2MYSA 1W7PD 2RQPA 3KP4A 2ETHA 2VASA 5TGTA 5LEJA 1F43A 2DFFA 2F4OB 3OYIA 2W82A 4OIOF 1VQKI 4PJMA 1JHFA 1E3OC 3VODA 2DJIA 2E34A 3DFGA 5IY5H 2Z5UA 4RGUA 3DBHB 1WRJA 4HF1A 3F8FA 3K4MA 5DCMA 1A6QA 2M4GA 2OV7A 3C7JA 2G7UA 1F4KA 1SD6A 2V79A 4ETSA 4BJTA 1JUPA 1R58A 1TBXA 2XPUA 4ITVA 5HLHA 3AKZA 4GCVA 4DQ2A 5KVRA 5B1BH 2H6CA 1X3UA 1R71A 2IVMA 5FFXA 2HQ5A 3T1BA 4G6QA 1JJ6C 5CPRB 1UCRA 1P7IA 2QKMB 3BR5A 4V2FA 1A35A 3M8FA 2VE9A 1P7JA 5EZHA 4UVAA 1D3YA 2DDBA 3UKGA 3GTOJ 2DPDA 4C3JJ 2HKXA 2PJRB 4LG3A 5F64A 1XB4A 1R1UA 4IF4A 3S8PA 1WJCA 4JK1X 1BOAA 1VQNI 4KFCA 3A01A 2L7KA 3RZOJ 3K6GA 1O57A 5J4YA 1WH7A 3E3VA 2GXGA 1OCZH 1ZRDA 3FWEA 2EIKH 4PFOA 1W4MA 1WJDA 5J6XA 2RKHA 2Y2ZA 5LGUA 4QPQA 2ZJQF 1I3QJ 1ODDA 3ZQFA 2HDCA 1XN7A 2F5FA 1GV5A 2QUFA 3CDIA 1B9NA 4I7HA 5GPAA 4XRSA 4BJ5C 5EEAA 1SAXA 4X0GA 2XAUA 2DMTA 1HQCA 2Y30A 4E7JA 4AYBA 5D5UB 2O8XA 3REOA 4LJZF 3OYBA 3L2QA 2Z3YA 1B4AA 3QPLA 2WWYA 2UZKA 1FP2A 3DCFA 3K2ZA 4LITA 2OU2A 4ABZA 1J75A 3K1NA 2EFWA 3F9KA 3NAUA 2QEXI 2L54A 1MMGA 3GUDA 2EA4A 3OSGA 4RB3C 4KMUX 4LFUA 2R5ZA 5DD4A 1YJ9I 2RAEA 2CJJA 2VKDA 1YYVA 2V26A 4CCKA 5LGNA 3LQRA 3FMSA 3H0DA 1RESA 3ISPA 2RNJA 4ESBA 2R5YA 1M1EB 4E7LA 1X1PA 2XB0X 2BW3A 2DFEA 3LAJA 1DPRA 4M3EA 3ZRGA 1APLC 3DF8A 5J1RA 2MLKA 1R36A 2LREA 2OUMA 4KN4X 2MA3A 1IV8A 2KDOA 4DYRA 1IXRC 4Y33A 2G0EA 4KT6A 3CJTB 5IYDJ 4CYCB 1GVJA 5LRRA 1MNDA 2JK3A 2QSGX 3C18A 4MEXF 2OZUA 1BR1A 1LE8B 4ZTJA 3HRUA 4B48A 3HOZJ 5IP9J 1ZRFA 3AL0C 1RIOH 2HVSA 3PQKA 2JA6J 1EH8A 1NTCA 4MTDA 1OR7C 4HAMA 3RI4A 4FE4A 2IJLA 4XORA 2W84A 2ZFWA 5DCFA 4O6JA 2Y69H 5TRDA 5DEQA 1VQPI 2ZKZA 4DW6A 5K7HA 3CO7C 2IRFG 2QENA 2K4BA 4EJWA 1U0JA 2RC4A 1MMAA 2GAUA 3KP6A 5LRSA 5IPAA 3EETA 4V2GA 4JX5A 3CP2A 1O7FA 1BIBA 5KNLA 4D7MA 5DM6F 1FOXA 4II3A 2NVQJ 1OPCA 1HDPA 2YSRA 2KQRA 3U1KA 2M34A 1B1BA 2BZTA 1U78A 5BMZA 1Z67A 4IL6C 4R8HA 1MW7A 3JR9A 1L3LA 2IGKA 3BG3A 4QLCU 4L9VA 2WV1A 4EGYA 1HKQA 2FJ1A 2E19A 1WJ5A 1KU3A 1LEAA 4CGZA 3GXOA 3K4LA 1K6YA 4A3IJ 5H20A 1H9GA 3KYLA 2LSOA 2L02A 2LYCA 1SFOJ 2DU9A 2FMLA 4E7KA 4PJNA 5HLIA 3OR2C 3GTKJ 5FD6A 2DYRH 4F52A 1UAAA 4A2UA 2ZJPF 3ABKH 3K9TA 4KISA 4BQQA 1AKHB 2R7VA 4N9HA 3DLLF 2O03A 4PUSA 2CQXA 2W24A 4IRIA 3HGYA 1RRJA 2B63J 2OF7A 5LLQA 1TNTA 1EF4A 1V5EA 2BEOA 5HVQC 3HUGB 4KDPA 4MTEA 4YFKF 3BOQA 3JSOA 1FP1D 3M8JA 5CVRA 1A04A 3OS1A 4MEYF 3JAMK 3MD2A 2A6TA 1FMWA 1KQ8A 2XGEA 4ANJA 4HF2A 3VWBA 2EZLA 1E0EA 2DT5A 2HR3A 5D5VB 3T8RA 3C2GA 2JA8J 4WXCA 3JTHA 2DOFA 1ENHA 1RR7A 2K85A 4HW0A 1XSDA 2P81A 1IJWC 4EM2A 1V54H 3CCRI 3JSPA 2RREA 4XNFA 3VYTB 3WU2C 4GDFA 3J81K 2FUG2 1U8RA 3GTMJ 4XLEA 2A69F 2YUSA 4ZZDA 1SFUA 4NQWA 1WJAA 2L4MA 3QU3A 4IX7A 3ELKA 2GBYA 4ZZLA 2K3PA 1XC5A 3ZQGA 1SD7A 4AVZA 2IP2A 2XGDA 1JKRC 2HVRA 3LNQA 2HZTA 3IKVA 2IS4A 2MSYA 3KE2A 3M07A 5DTDA 2DJNA 3GVAA 3MZ8A 4EGZA 2VPLA 4I0BA 1DQUA 3F8BA 1ETXA 3ECHA 2ZMEA 1XGSA 3E97A 4FX0A 3R0JA 1QHGA 4B43A 2EINH 3K69A 4HDVA 2ZSHB 5LGTA 2JRTA 3F6VA 3FKJA 2X48A 1YHQI 3KCCA 1D0XA 1TC3C 2M30A 2F4IA 3BWGA 3BDDA 1Z9CA 3ZMUA 4IZZA 4KJZA 1B8IA 3ASOH 5L3EA 3WTTC 2R7OA 2D5VA 2VQLA 2O5RA 3G1LA 3S3OA 5A2QK 2Y48A 3WHCA 4KNYA 4JOMA 1TWHJ 2MD0A 3SDBA 2ZXHA 2HYGD 1I6XA 3GTPJ 2F2EA 4FX4A 1WI9A 2VBXA 3ZXSA 1VQLI 2UV1A 1TLHB 2FU4A 4JQFA 1Y1WJ 3JRAA 4C2MJ 3MAJA 1MGTA 4EM0B 4WXHA 2E5NA 3AFHA 3RPQA 3KFWX 2J5OA 1HOMA 3OYHA 1ORKA 5EEGA 1DU6A 1FSHA 3H9JA 2H09A 2OQRA 1KYZA 4GGGA 4N4OB 3L2RA 1YX3A 4J01A 4J19A 5B5EC 2RN7A 2HGCA 3PJRA 2IPQX 2XROA 1G3SA 1O4XA 2VT2A 3VYRB 3CF2A 3GYHX 4ZDOA 1EH6A 4IXAA 1U2WA 1OQYA 5E20A 3RPUD 3A0HC 3OYDA 1ITYA 2F5VA 2XKOA 3EYYA 1XG1A 3VDXA 2CH0A 3GTJJ 1G2HA 1BR4A 2X1DA 3PNTA 1K78A 5KAIC 5E1XA 5L3GA 3J7AO 4IQ4A 2ELKA 1MJBA 1HC8A 2R92J 2QQ8A 2V4JC 1WCMJ 4XSXF 1Y39A 3OR1C 2XUBA 1NG6A 3SZGA 4B3AA 1PDNC 2O6GE 2NOJB 2XAFA 1D8KA 2E60A 4PSWA 2E1OA 2BE5F 3C2HA 3G3ZA 4JX6A 3HKZA 2CYYA 2A5YB 2NXNB 3QP5A 3GBGA 3SEQA 2HKOA 2XV4S 2QM3A 3EPZA 3P9KA 2IA1A 4R1HA 4X6AJ 4RGSA 1GVDA 2P6SA 4UNOA 5AONA 4XRMA 1STZA 3MKYB 4A3BJ 1IDZA 2XAQA 4ZYDA 2CV1A 1D1AA 1PYVA 1YI2I 1MBGA 2P7VB 2IS1A 2WADA 2R7TA 2NOGA 2PMZA 4ZJZA 5DYMA 1HKTA 3H1CA 3RYRA 3QQAA 5EG0B 2Y0SN 3IH4A 2WC2A 4J00A 2CW7A 2DDAA 3P7NA 2HOTA 3E5UA 2JZYA 2M8EA 3CESA 1ON2A 4ZDPA 1IRFA 3E6DA 3FKIJ 5E3MA 2EQRA 1PJRA 2VQCA 4Q48A 5H2FC 1S9HA 4YEJA 5IT9Z 4M3BA 2D1VA 4D0PA 1VQ8I 2R93J 3ZMVA 1GT0C 1H88C 2K86A 5BOXA 2LF7A 1MDMB 3FHZA 3K4NA 2CMPA 3J80K 4XIDA 2OPTA 1U5TA 1RI7A 1DP3A 3B73A 1FZPB 3SQNA 3JRHA 4RDUA 3MZYA 3ZN1A 3GTLJ 1P92A 2QBYA 3OIPA 1L0OC 1NG7A 4EVIA 1R7JA 2WY7Q 3I59B 3MEXA 3V4GA 3K70D 1YTYA 3ZOBA 1X2NA 4A5NA 3H92A 5TISC 2JUCA 4ENNA 3L2WA 3A1YA 3GMEA 1X4OA 1PUFB 2VODA 1I3AA 3GFMA 5C4JJ 2KJCA 3WU0A 2IBDA 1V5FA 5JVTA 4CCLA 3V8KA 2HU9A 3I55I 3DEWA 4EV0A 2HXOA 2VPRA 2ZB9A 3I9V2 4PGGA 4G6TB 1IDYA 3WTZA 2IT0A 1K61A 3ABTA 1TW3A 3U2RA 3VSKA 3FK7A 2KRCA 3B6AA 3SDGA 4I6ZA 1QU3A 1QPMA 4ESFA 2ID6A 1CGPA 3CC7I 2H94A 4HSTA 1MDMA 2E7WA 3BPVA 2JTVA 3HHHA 3K7AJ 3PNYA 4A3FJ 1RKWA 2V9VA 1YJWI 3JCUC 1Y8RB 3SHFA 3WG9A 2L01A 5M3MJ 3IAM2 1FOYA 4Y3OA 2IS6A 3HL2A 2GOMA 1AU7A 2WAQN 3V8LA 1ETWA 4TV7A 2CWEA 3H5AA 1YRNA 2ECCA 1XGOA 3B6CA 3OS2A 2RV8A 3ECOA 4NNJA 3IRQA 1FOWA 2DA7A 4LLLA 2AXTC 3I4NJ 1Z0XA 2IGNA 3K70C 3KYDB 2OAZA 4MIMA 3GFIA 1UHSA 3WG7H 1LQ1A 3K4JA 4DGWB 4P1WA 1MH4A 2DTRA 4CH7A 1S6LA 2JSPA 2DMPA 3ONQA 3HSRA 3TDUC 3D5RC 3A4CA 2E2HJ 1X2MA 4FTHA 4FISA 5D6FA 5K1YA 1YS6A 3WU1B 2LDUA 5DD8A 3KEQA 4M74A 1J09A 5K7ZA 3K1MA 3GF2A 5CQEA 3N97A 2R7FA 3X2QH 2GXBA 2QWWA 3QU6A 4KICA 1J9IA 2OTJI 2BVMA 2R3SA 2BHZA 1BIAA 1DP7P 1LFUP 3CMMA 1QVUA 4DOZA 2K27A 4RLQA 4R79A 2GIVA 5BPDA 2FA5A 2KT0A 3OYAA 1ZTRA 4W1UA 1XCBA 1S72I 1Y8QB 5F0CA 2QLZA 3GZ5A 4AD9A 2O9LA 2JUGA 4CO8A 3M7GA 4MHGA 1G3WA 4XKVA 5J1YA 3FBIB 5DCMB 3ASNH 3IRRA 3BJOA 2G9WA 1YG2A 3BJAA 2XIGA 3W6JB 3KYCB 2NS0A 2VONA 2BY0A 5JLXA 3LL7A 1I50J 2EB7A 2EH3A 1V55H 2ZXJA 1POGA 3WTXC 1S7AA 3EUHA 1X1DA 2TCTA 2KKOA 4G7ZF 1FY7A 3C3WA 2HTSA 4D5CA 3V7RA 2NVXJ 5F04A 3HTUA 5F0HA 1B72A 1BL0A 1T0FA 5E17F 5KCMA 5IYBJ 3RTRA 2XGCA 1E3PA 4AM3A 3A01B 3ZQ7A 2HPMA 2LF8A 3HHGA 3FIWA 1D0YA 1SEUA 2DLLA 5JHFA 3HSEA 5FD5A 3FMQA 3MWMA 5KK1A 1OCCH 1F5TA 4A0XA 2LH9A 4Y17A 5FLVA 4E4HA 1K79A 2V9KA 1YFHA 3CC2I 1PUEE 4OAYA 2XKPA 4MFDA 3G6EI 3VOEA 3WE3A 4CICA 1IAWA 4HF0A 5AIQA 4AIHA 2D2WA 2LK2A 2CG4A 3ABUA 2O3FA 4I2OA 3WTUC 1OYYA 2V6CA 2X6XA 1I1GA 4ENMA 1JHHA 2OA4A 3KZZA 4FT8A 2A6EF 2KMUA 2AHQA 2DA6A 2GA1A 5L3FA 2I8DA 2R5ZB 4A3JJ 1VTNC 3BCBA 4ON0A 3DPLC 4IO9F 1KGSA 3DWLE 5F08A 4RLFA 2R5YB 4HSRA 2WBMA 2AQFA 3HOWJ 2V6EA 4BQNA 2BW3B 3K4CA 1Z7UA 4P9UA 2ESNA 4EMSA 1LUJB 2DCEA 1ACIA 5CVIA 1FSEA 1BI1A 3W6KB 1F9NA 3G2BA 3TP3A 5FLXZ 1MBFA 2EIJH 2F48A 3G4SI 4UV9A 1HA8A 3QWLA 2X0LA 2BXZA 1SFKA 2MABA 3HRSA 4ENKA 1N25A 1QQIA 1DUXC 4FHTA 4KN7X 2YPRA 1WQ2A 3KP2A 5F6FA 1MBHA 2ZO4A 4M73A 3I4PA 4NUBA 4MQ9F 5FO5A 3CJNA 1EA3A 2VXZA 1QRYA 4Y4RA 4MQVA 2LBFA 3OYNA 3COAC 2P7CB 2JMWA 4HRIA 4D5FA 2IGOA 1R5GA 4RM2A 5D4SA 4I98B 2DFHA 3BR0A 5LBQA 3A03A 4ENJA 4P9FA 1Z7LA 3EUHC 2EK5A 3ESWB 5JFRA 4UXNA 2XF5A 2DA3A 3PFIA 1OYIA 2M87A 4XRSG 2I10A 1W0UA 5EGOA 2K40A 3BQYA 3PNVA 5GTIC 2KIMA 2Q0OA 3LA3A 3M1CA 3I4MJ 2DPUA 3MKZA 1MJ9A 5FKNA 3BROA 3H36A 2IW5A 2GWRA 4HX7A 1FBSA 5DUKA 1S5LC 2HTJA 3H0GJ 1U3EM 4YIRX 4LMYA 2V1UA 2OTLI 4IHXA 4YFXF 3FXUA 3BR6A 3GCMA 3KPHA 4M3DA 4XKWA 2H8WA 3QOPA 1G6NA 2VB6A 1H89C 2NVTJ 3M1EA 1EKEA 4NDLA 1YITI 2XVCA 3J7YJ 4XLFA 5GAGJ 4RAZA 3NWTA 4ZYHA 1P9QC 3ZN0A 1GDTA 2Q2EA 3I0TA 5D8LB 1R00A 1QVTA 2HDWA 4PK4A 4DYQA 4XR6A 4XRFA 3EQLF 3I71A 4I0AA 3FXMA 1FLIA 2MH2A 3VFZA 3IAS2 2FSWA 3MQ0A 5FJ8J 2K4JA 3FDYA 3HOUJ 1UG2A 4WXDA 4Z2YA 3S15J 2MBFA 1D0ZA 3RYPA 2ZJRF 2L3DA 5KAFC 4IHSA 4BEHA 4BBRJ 3CLQA 4BL0B 1SD4A 3S1MJ 4XSZF 3Q9SA 4PJ0C 3OY9A 3D1NI 2V9PA 3R0AA 1O3RA 4ZYAA 3FXJA 4AIDA 3VPRA 5LHIA 2R7ZJ 2CGPA 1F1ZA 3CDHA 2MD5A 4UY8I 1EJ9A 4G7HF 3QP6A 4BAYA 3PSFA 4G12A 5GTHC 4F7ZA 1ETVA 2XAHA 3GW2A 4L5IA 5L3BA 2VN2A 3JAMZ 1XMKA 2FF4A 1IO2A 2GOXB 3CUQA 4HNVA 4A0YA 1WSUA 1QZEA 1FBUA 4IEJA 2DMUA 1ZREA 2FQ3A 4NQWB 2NVUB 2BHYA 5F1RA 3BG5A 4M9XA 2XSDC 1T39A 4DIQA 2O8KA 2EZKA 1T33A 2F6CA 1TQIA 2AQEA 3DTKA 3K4BA 1XMAA 2FX0A 4M71A 3CO6C 4HQMA 1Z21A 1X1AA 1O3QA 2ZXWH 3QYBA 4KIBA 1YW7A 1H9TA 3FM3A 2UUZA 4M3FA 4CZCA 4E7SA 2ZMEB 3NWSA 5HS9A 3RSNA 4BACA 2XB5A 1HW1A 2J5PA 3BTJA 3KIOA 4X1EA 2EIMH 1FOKA 4B1RA 4B3XA 3MVPA 2V1XA 2KLOA 2GIZA 2XPVA 1J5YA 3O3KA 2CUZA 2R7WA 2M0MA 3Q0WA 3DKXA 3H9QA 2ZNZA 1B8IB 3RQ4A 2I5UA 1TWAJ 4GYIA 4E7ZA 2NAZA 4BDZA 4Y15A 5HOOA 3BTCA 4PGHA 3A02A 3L2UA 4RA2A 5AIPA 3R6SA 4IRHA 5IP6A 1G8XA 3CCVI 5J4VA 1RETA 2K9LA 1SAUA 2Z2SB 3I3LA 1CF7A 1ETYA 2VLAA 1R6RA 2M8GX 1IW7F 2E2IJ 2WB1N 1E2XA 3S32A 4Q47A 4U88A 4QPOA 2VOOA 2B9SA 2HOSA 3S1QJ 2CQ7A 4XKCA 3PQJA 4H4KC 5E8IA 1BW5A 5ICEA 2QZ8A 4XK4A 1XSVA 3BZ6A 2VBYA 1HKSA 4KIGA 1UZCA 2ICWG 3RDIA 2STTA 3VB2A 2R7SA 4B47A 4M6XA 4C3IJ 2L4AA 2W85A 1I39A 4XL9A 4DYCA 2WA0A 1YJNI 3RKWA 1I6HJ 3CCQI 4OIPF 1SVOA 1TW2A 2MH9A 1YO5C 3QPHA 3P9CA 3G71I 1SC7A 3PUFA 1KZHA 1FNNA 2QQBA 2VKVA 4RAGA 2Q1ZB 3TOAA 3L2CA 1TQMA 2YX7A 1HBXG 3FX3A 1K78B 2XF7A 2ID3A 1XCVA 3CMAI 4LD5A 4A3DJ 1IRZA 2KIQA 3QPTA 4GRIA 3U9GA 2FBIA 2WAEA 4LIVA 2JPBA 4N4NB 4CXFA 2QSHX 2VKHA 2Z16A 3WODF 1JT0A 1AWCA 3CD6I 2LFBA 1EH7A 5B3SH 2CUEA 1QGPA 1MBJA 2FBKA 1P6RA 1E17A 3WHBA 4U7BA 1S3JA 3HM5A 2JPCA 2A05A 3U21A 2O61A 1GXQA 2JT1A 3HEFA 4RB0A 3WTSC 2LKSA 3K4KA 2JVGA 3OYFA 4XLNF 1BR2A 2MW8A 5D4RA 1R22A 2DODA 3F3XA 4V19K 2W1OA 3RKQA 2CRGA 3VYUB 4Q5SF 2H8RA 1VI0A 2CSOA 3UR3C 3M4OJ 4ZYGA 3UNGC 4E7IA 2LTPA 2VJ4A 3S2HJ 4C2UA 1HXDA 1BN5A 2LOOA 3IH3A 4IHYA 4KIFA 2PLYA 2ADUA 3CP8A 4BUPA 5ERIA 1UELB 4DBRA 5DDGA 4A3EJ 2MG4A 4ESJA 4WX9A 4QTRA 2KRHA 4CCJA 3TMOA 3P9IA 4ZTFA 1KQ0A 2K7LA 3A2KA 4RB2C 3IUOA 5ED4A 2XC7A 2PMUA 4A12A 1FJLA 1YS7A 3WGGA 4E7HA 4B09A 5JI6A 1FIAA 4YFNF 2LRDA 2VJ5A 1S8NA 3CCYA 3V8JA 1DDNA 5DV5A 1ZGJA 2WV0A 4WCGA 1PP7U 1OJLA 4BXXJ 1PP8F 1A6IA 4L0ZB 1R1VA 3TP0A 2W7NA 5F27A 3TGNA 2OJED 3DP7A 2EV5A 1TQPA 1Z6TA 3WTVC 2M45A 2EFQA 5E79C 1D5VA 1WFXA 1SVMA 2VBZA 2KZGA 1ZGWA 4PZJA 1FT9A 4C2TA 2JSCA 4M6VA 1U5TB 2W57A 1IUFA 1D8JA 5ICGA 3SXYA 4HEA2 2ZMEC 1O7LA 3W3CA 1TTYA 2QBYB 1BBYA 2Z33A 3O2PE 1ZK8A 4GXOA 3GTQJ 3BJ6A 5K7FA 1LKXA 3M9AA 3RJPA 3C2BA 3W2VA 2PBIA 4HV6A 2NRAC 4S05A 1V5GA 1V4RA 1BA5A 5E18F 2P6TA 3EDPA 4F91B 1FX7A 2LLKA 3WTWC 3EUKL 2VC1A 4BJ6C 2A68F 2KZVA 2VXDA 3F0CA 4IQJA 3CLOA 4XM3A 4KUMA 1Y0UA 4BGDA 3D0SA 1ONVA 5E1ZB 1FYLA 1Z6RA 3CCMI 4A0ZA 2NNYA 2JA5J 3S1NJ 1UHMA 3TOBA 3E6CC 1ETOA 2VOPA 2CS3A 3OS0A 4OMYA 1UMQA 1XS9A 1SVLA 2K9QA 1XMXA 3L7WA 4LB5A 4DJAA 4UUSA 3QPSA 1MIJA 4HOBA 5IOZA 3OOUA 1ZHFA 3S93A 5GP9A 4OMZA 5J3LA 4HBLA 1N75A 3OL3A 3MZHA 3H3VK 1ETKA 4FQGA 4YRVA 3ZQCA 3TDZC 1Z1DA 4DZJA 3BG9A 2DO7A 1ZGAA 3A0BC 3CC4I 2M7BA 1IG7A 1YLFA 1ETQA 5B66C 4RGXA 3T8TA 3LWFA 2X6YA 1X58A 2QYOA 4YELA 4GYGA 4OWRB 1H0MA 1VF9A 2IAIA 4GO1A 1YRNB 4JYKA 2Y31A 3W6VA 4XOTA 1Z3YA 5HDGA 5HDKA 4HYEA 2Z9OA 2DMNA 1VQMI 4P96A 3HJEA 5BS6A 5C44J 4G8XA 1VQ9I 3K10A 3JRDA 1TT0A 4BE1A 3KZYA 3ERMA 1KU2A 1ZR2A 2BY1A 3OV8A 4AU7A 3TO6A 2D45A 4D9JA 3ABMH 4RMNA 1R5HA 2AXLA 1U6GA 5DUIA 2HVQA 1LDJA 3WTYC 2MC4A 1Z05A 2FD5A 2QQAA 3OYMA 2F5DA 3GLXA 3I64A 3N05A 3TL4X 3FXLA 4M9ZA 1LJ9A 5GPCA 2E5ZA 3TW7A 3D5SC 2RGVA 3E5QA 1RKTA 2KFDA 2V1NA 2X6WA 3F23A 4KMFA 3FZVA 1MBEA 3DTEA 3HOSA 5EDNA 1X19A 3S1RJ 3Q9VA 3BTIA 1QHHD 3PUBA 2CQQA 3IL2A 1QNTA 2P5KA 4M72A 2LY2A 3HTSB 5BPIA 2Z99A 2YS9A 5ILUA 3OL4A 5JLWA 2CUJA 2VQGA 5CYVA 1VZ0A 2XHKA 1BW6A 1G3TA 3GO5A 3HRTA 4UVBA 2CO5A 2GQQA 1OCRH 1LFBA 2EPFA 3DTIA 4XBFA 5M5YJ 2F5EA 2E7XA 3FF5A 1JTXA 3HOYJ 1MSEC 2HS5A 4HDUA 3I58A 2XAGA 4ZDLA 5C3EJ 1IF1A 4BE0A 1LNWA 1X3ZB 4NC7A 4XICA 1MH3A 2F5CA 1N78A 3WE2A 1HW2A 3BLYA 2ELHA 3Q5FA 2FOWA 2HOEA 3OYEA 1TNSA 3RQIA 1VQ5I 2CU7A 1MBKA 3QAHA 1B72B 2Y0SA 1B9MA 3BPXA 3G1OA 3Q0UA 4IHWA 1E3HA 5HLTA 1J59A 3MKLA 2X51A 1SFXA 3O6BB 3TKYA 4G94A 1NHAA 1MZBA 3LOCA 1SD5A 4NC8A 5L3DA 2HYFA 5LHHA 3LSTA 3E6MA 5M3FJ 1W5SA 1A36A 4L5EA 3T5XA 2Y0MA 3F72A 1U5TC 3LSIA 3Q3SA 3OMYA 1TWGJ 4L9TA 4CZZA 2R7UA 1JI8A 3BQZA 5CJ9A 2V1DA 3SYTA 5FKKA 2L7FP 1FC3A 5E3OA 3BP8A 3DU6A 1UHWA 3H3ZA 1DGRM 1XPXA 4IHVA 3SFZA 2M9HA 4BH9A 1IV6A 3OYCA 2IXSA 1FTTA 2L7ZA 3ROUA 2P4WA 4HX8A 1P2FA 1IN4A 3DPTA 2WY8Q 4HV5A 1OCOH 2OD5A 3FXKA 4AYBN 4EATA 2OC6A 1G3YA 4E70A 1IN8A 2HQNA 3V42A 3KEOA 3GZ6A 2A61A 2CFXA 3FHNA 4WK8F 2CV2A 4CDGA 3MCZA 2LKXA 4XLAA 4A6EA 2IGMA 2A07F 1IN7A 3AL0B 2V7FA 3JRFA 1KA8A 3JRGA 3DEUA 3IP4B 4BXUA 2R7XA 2TRTA 3GFLA 2KIUA 2XRNA 4HX4A 4G7OF 2G7HA 2HI3A 3HPGA 4LK1F 4OOIA 2LMDA 1KQ9A 1G59A 1GXPA 4XN3A 1KYWA 3DU5A 3HPHA 2KL4A 1PVEA 4HA8A 4LG0B 5F0FA 1VQ4I 2ISYA 2BV6A 3ULQB 3KETA 4HPQA 4XLCA 4BY7J 3RZDJ 3HB9A 2EV0A 2BY3A 2DN0A 1X3WB 1QO0D 2LBFB 1QZYA 2W00A 4IVNA 2DK8A 1A31A 1BJZA 2WAQA 2E1NA 5LD2C 3TBIA 4BQOA 2K9NA 1S7OA 5J8FA 5KHDA 2GLOA 1X4PA 1LVKA 3BTLA 4O5VA 1HF0A 2E2JJ 1BC7C 1ZARA 3OIOA 2ZJ2A 4EJVA 1VQOI 4MNUA 1C0WA 4BDYA 4KT5C 5FB2A 1T98A 5FKMA 3ZQQA 5FLMJ 3HIFA 2JQ7A 5EGOB 4AUXA 2F4MB 1SMYF 3RCOA 5J40A 1JJ8C 4PDKA 3ZMTA 2P5VA 3H5NA 2MGQA 6PAXA 2O0YA 3LMMA 1OR7A 1W5TA 2QKLB 4MO7A 3S2DJ 3TEDA 2A6HF 3LA7A 1K4TA 5E3NA 1Q1VA 1YX5A 4L5JA 3I5UA 4HLXA 4UB6C 3OYGA 4N9IA 1WVRA 3R60A 1TWCJ 3IHUA 1JGGA 2EZHA 4LG0A 1MKMA 3QYFA 4NB5A 2DK5A 4LK0F 4CUGA 2VIXA 3HZJA 2JWTA 5CQGA 2EFNA 4PSXA 4CCOA 2Q2EB 2LC2A 3OYKA 2EV6A 2H27A 5LEKA 1ZG5A 3E7LA 1ZAOA 4U0WA 4A3LJ 4RBOA 2X1EA 4GFBA 4NBQA 1RZ4A 3KP3A 1LVAA 4BHPA 5CLSA 3VSLA 2ESHA 4OU0A 3F8NA 4N0BA 1IRGA 3S14J 4RB1A 2GZWA 1NK2P 2B0LA 5EF6A 5E3LA 3P5JA 5ILVA 5F1JA 3H5RA 4BEHB 1T0FC 2RDPA 4AIJA 4XONA 1JKPC 3MMYB 3CMEI 2XRLA 4M9SA 3VEPA 2RNGA 1U9NA 5CVJA 1JE8A 5FFZA 2HNHA 3OSFA 5CVVA 2E1CA 1VQ6I 1OLTA 2FQ4A 1I27A 1ZQ3P 3AG1H 4HQEA 2QVOA 4FE7A 1ZH5A 3LSPA 5JR3A 2LY9A 1WKMA 3CUQB 1Y56A 1LEBA 5HNHA 1ZG3A 1QZZA 2FRHA 2K02A 5EYRA 2XSJC 1O3TA 1YW9A 2GM4A 5FLXK 3E5XA 3AG4H 3DLAA 3KEYA 3BY6A 3HYIA 3F6OA 2DW4A 1R49A 3FM5A 1OMIA 2LR8A 4LOCA 1XX5A 2JA2A 3BR3A 4ZYEA 2PJRA 3TO9A 2R7RA 2NNNA 1MMNA 1K4SA 4AIKA 1BOBA 3DBLB 4NHJA 4Z6YA 3TW6A 3QOEA 3GTGJ 4IKFA 2HFHA 1W1WE 1MNEA 2CQKA 2IA0A 1HCRA 1FWZA 3L9FA 2VE8A 1R23A 1T38A 3Q0VA 2CQNA 2XGXA 3J7ZI 2DT7B
chains in the Genus database with same CATH topology
1IN5A 2GA2A 2CW0F 2BYVE 1YW8A 2PQ8A 5D6EA 4BQAA 3S2WA 3RKXA 4L0YB 1GHCA 4G6DA 3DXJF 4LLNA 5HLGA 4U0YA 2AS5F 1XGNA 1P4XA 2M1BA 3IWFA 2FEZA 1CF7B 4IPAA 1B59A 2DQLA 4QWQA 5IT3A 1EV7A 3GX4X 3LAPA 1YIOA 5H6RA 4JBAA 4EJOA 3LA2A 4BYYA 4UHTA 3J81Z 3IKTA 5ICFA 2PN6A 2R7DA 3WGIA 1XGMA 2HEOA 3HUGA 1ZRCA 5K5QA 4BNCA 3RIRA 2LKPA 4O3MA 5D8KB 2W25A 1USSA 4YG2F 2PG4A 4OIRF 4AVPA 2XASA 4HLYA 3IWZA 3R61A 1BI2A 3MFKA 4A5MA 1P4AA 2X4HA 5A2QZ 1ZG1A 1UB9A 4G9YA 3M8EA 1OYWA 1IXSB 3I53A 1B6AA 2YR2A 2OZ6A 4L18B 4ZH4F 3HOTA 3ZMZA 4OIQF 5K5OA 5J8CA 1FPQA 2FOKA 5E8GA 1IXCA 4EQQA 1SFEA 3LQQA 2LNBA 1ZN2A 2PJPA 5D5WB 3F8CA 2BGCA 1V3FA 4UV8A 4DNCA 3CUQC 2KIFA 4KYWA 4U7DA 3L09A 3SZPA 1IUYA 3RPUA 3ZMSA 3FMRA 4P55A 2VT3A 2KRFA 3TQNA 3NQOA 3D5LA 3WGHA 2VBWA 4H0EA 3H3UA 2ZNYA 2ISZA 2MLGA 4HZFA 3QRFF 2EFPA 2FMYA 3FXRA 3NEUA 4LLGF 3JTGA 2Q8KA 1ULYA 3HRMA 4P5OA 3B02A 3KLOA 1BM9A 1Z91A 1P4WA 1J7KA 1J2XA 4ASNA 1T6SA 3K0LA 1ZLKA 1FYMA 5HDNA 4UVCA 4Y13A 1XSXA 4LGWA 3ZMDA 1YQAA 5H6QA 5D5XB 5L3CA 4KA4A 5BQTA 3NRVA 1HSJA 2RVCA 4A6DA 2FNPA 2FE3A 1ZLJA 3N4MA 2YU3A 3J80Z 1OKRA 5ILSA 2EFOA 4AWXB 1K6OA 3RKYA 4XLPF 4B8XA 5EEHA 4K2EA 3TO7A 2A3SA 2EJRA 3U1DA 3G73A 4L9JA 4Q4ZF 1XDSA 1LB2A 2C6YA 1HSTA 2EA2A 5TJJA 2DI3A 4WWCA 1RUOA 5K5RA 2PFBA 3V7CA 1HW5A 1KU7A 1XDUA 3ZPLA 3E6BA 3R4KA 3ZP5A 2ZCWA 1I5ZA 3K1PA 1J0RA 2EWNA 2XAJA 3ERED 5JHUA 1AOYA 1WWXA 4BHCA 2OBPA 4IRGA 2DBBA 3GFJA 1S29A 5CVUA 2ACJA 2FNAA 2UXNA 2ZBKA 1USTA 3JW4A 5HS8A 1FYKA 1ON1A 3LFKA 4UUVA 2QQ9A 3KLNA 1KU9A 1REPC 3F22A 4U0VA 3DV8A 4YIIA 4S04A 2MC3A 2P5LC 3HSFA 3T0YA 1BI0A 2FBHA 4OINF 1Q1HA 2UXXA 5IT9K 5LHGA 5ICCA 1XD7A 1T2KA 4IHTA 1DPUA 3GWZA 1RUNA 1G4DA 4RAYA 3GEZA 1JXSA 3CTAA 3KP7A 2DFIA 1BJAA 1IN6A 3DQVC 1FBQA 3F8MA 1W7PB 1R1TA 3IC7A 3EYIA 4IJAA 3FXQA 2NYXA 3I59A 1BI3A 1O3SA 2DQRA 4BHBA 2P8TA 1QBJA 2OQGA 4EJTA 2IA2A 2PI0A 2TDXA 3L00A 4M6YA 2PEXA 4I09A 4RGRA 2D1HA 2VC0A 4PCQA 2YX4A 3SZTA 4MGRA 2Y75A 1MD0A 2COMA 3DKWA 5E1WA 1I1SA 4WF2A 5HS7A 2UWMA 1UFMA 4EM1A 3F21A 2FXAA 3KP5A 4I02A 1RNLA 4CYDA 2M5WA 2HQRA 4RS8A 4CHUA 2H6BA 2DAOA 3AAFA 1LDDA 3I54A 1W7PA 1SMTA 3ML6A 4EJUA 4YIFA 4I01A 1ZYRF 1MJAA 2HWVA 3C1DA 2PMHA 2STWA 1BC8C 1IZ1A 1JGSA 4LB6B 5FGMA 2BBYA 3V7SA 2WTEA 3OOPA 1K7AA 2KJBA 4L9NA 3CUOA 1LDKB 1W7PD 2RQPA 3KP4A 2ETHA 5LEJA 4OIOF 1JHFA 3VODA 3DFGA 2Z5UA 4RGUA 4HF1A 1WRJA 3F8FA 5DCMA 3C7JA 2G7UA 1F4KA 1SD6A 2V79A 4ETSA 1R58A 1TBXA 5HLHA 4GCVA 4DQ2A 5KVRA 2H6CA 1X3UA 2IVMA 5FFXA 3T1BA 4G6QA 1UCRA 3M8FA 2VE9A 4UVAA 1D3YA 2DPDA 2HKXA 5F64A 1XB4A 1R1UA 4IF4A 4JK1X 1BOAA 4KFCA 1O57A 3E3VA 2GXGA 1ZRDA 3FWEA 1W4MA 5J6XA 2RKHA 5LGUA 1ODDA 2HDCA 1XN7A 2F5FA 2QUFA 1B9NA 4I7HA 1SAXA 1HQCA 5D5UB 2O8XA 3REOA 4LJZF 2Z3YA 1B4AA 2WWYA 2UZKA 1FP2A 3K2ZA 2OU2A 1J75A 3K1NA 2EFWA 2L54A 3GUDA 2EA4A 4RB3C 4KMUX 4LFUA 5DD4A 1YYVA 5LGNA 3LQRA 3FMSA 3ISPA 2RNJA 4ESBA 3LAJA 1DPRA 3DF8A 2MLKA 1R36A 4KN4X 2MA3A 1IXRC 1GVJA 5LRRA 3C18A 4MEXF 2OZUA 3HRUA 1ZRFA 1RIOH 3PQKA 1EH8A 4MTDA 3RI4A 4HAMA 2IJLA 2W84A 2ZFWA 5DCFA 4O6JA 5TRDA 5DEQA 2ZKZA 3CO7C 2IRFG 2QENA 2K4BA 4EJWA 2RC4A 2GAUA 3KP6A 5LRSA 3EETA 1O7FA 1BIBA 1OPCA 2YSRA 1B1BA 1U78A 5BMZA 4R8HA 1L3LA 4QLCU 4L9VA 4EGYA 1HKQA 1KU3A 1LEAA 4CGZA 3GXOA 5H20A 1H9GA 2LSOA 2L02A 2DU9A 2FMLA 5HLIA 5FD6A 4A2UA 3K9TA 4N9HA 2O03A 4IRIA 2W24A 5LLQA 1TNTA 2BEOA 5HVQC 4KDPA 4MTEA 4YFKF 3BOQA 3JSOA 1FP1D 5CVRA 1A04A 4MEYF 3JAMK 1KQ8A 4HF2A 2DT5A 2HR3A 5D5VB 3T8RA 4WXCA 3JTHA 4HW0A 1XSDA 4EM2A 3JSPA 3J81K 1U8RA 2A69F 4ZZDA 1SFUA 4NQWA 2L4MA 3QU3A 3ELKA 4ZZLA 1SD7A 2IP2A 2HZTA 3IKVA 3KE2A 3GVAA 4EGZA 4I0BA 3F8BA 3ECHA 2ZMEA 1XGSA 3E97A 4FX0A 3R0JA 3K69A 4HDVA 5LGTA 2JRTA 3F6VA 3KCCA 2M30A 3BWGA 3BDDA 1Z9CA 3ZMUA 5L3EA 3WTTC 5A2QK 2Y48A 4KNYA 2HYGD 1I6XA 2F2EA 4FX4A 1WI9A 2VBXA 1TLHB 2FU4A 4JQFA 3MAJA 1MGTA 4EM0B 4WXHA 3RPQA 3KFWX 2J5OA 5EEGA 1FSHA 2H09A 2OQRA 1KYZA 4GGGA 2RN7A 2HGCA 2IPQX 2XROA 1G3SA 2VT2A 3GYHX 1EH6A 4IXAA 1U2WA 5E20A 2XKOA 3EYYA 1K78A 5E1XA 5L3GA 3J7AO 1MJBA 4XSXF 2XUBA 1PDNC 2O6GE 2XAFA 1D8KA 2BE5F 3G3ZA 2CYYA 2A5YB 3QP5A 2HKOA 2XV4S 2QM3A 3P9KA 2IA1A 4R1HA 4RGSA 2P6SA 4UNOA 5AONA 1STZA 2XAQA 4ZYDA 2P7VB 5DYMA 1HKTA 3RYRA 2WC2A 3P7NA 3E5UA 2JZYA 2M8EA 1ON2A 1IRFA 3E6DA 4Q48A 5IT9Z 2D1VA 4D0PA 3ZMVA 2K86A 5BOXA 2LF7A 1MDMB 3FHZA 3J80K 1U5TA 1RI7A 3B73A 1FZPB 3SQNA 3MZYA 3ZN1A 1P92A 2QBYA 1L0OC 4EVIA 1R7JA 3I59B 3MEXA 3V4GA 1YTYA 4A5NA 3H92A 4ENNA 2VODA 3GFMA 2KJCA 3WU0A 5JVTA 3V8KA 4EV0A 4PGGA 3WTZA 2IT0A 3ABTA 1TW3A 3U2RA 1QPMA 4ESFA 1CGPA 2H94A 1MDMA 2E7WA 3BPVA 2JTVA 3HHHA 2V9VA 3SHFA 3WG9A 2L01A 3V8LA 4TV7A 2CWEA 1XGOA 2RV8A 3ECOA 3IRQA 4LLLA 2OAZA 3GFIA 1LQ1A 2DTRA 1S6LA 3HSRA 3TDUC 5D6FA 5K1YA 1YS6A 3WU1B 2LDUA 5DD8A 3KEQA 4M74A 3K1MA 3GF2A 3N97A 2R7FA 2GXBA 2QWWA 3QU6A 4KICA 1J9IA 2R3SA 1BIAA 1DP7P 2K27A 4R79A 2GIVA 5BPDA 2FA5A 1XCBA 4AD9A 2QLZA 3GZ5A 4CO8A 3M7GA 4MHGA 1G3WA 5DCMB 3IRRA 3BJOA 2G9WA 1YG2A 3BJAA 2XIGA 3W6JB 2NS0A 2VONA 2EB7A 2ZXJA 3WTXC 1S7AA 3EUHA 2KKOA 4G7ZF 1FY7A 3C3WA 2HTSA 3V7RA 3HTUA 1T0FA 5E17F 3RTRA 3ZQ7A 2LF8A 3HHGA 2DLLA 3HSEA 5FD5A 3FMQA 3MWMA 5KK1A 1F5TA 4A0XA 4Y17A 1K79A 1YFHA 1PUEE 2XKPA 3VOEA 3WE3A 4CICA 1IAWA 4HF0A 5AIQA 4AIHA 2D2WA 2CG4A 3ABUA 2O3FA 4I2OA 3WTUC 1OYYA 2V6CA 1I1GA 4ENMA 1JHHA 2OA4A 3KZZA 4FT8A 2A6EF 5L3FA 2GA1A 1VTNC 4ON0A 3DPLC 1KGSA 1Z7UA 4P9UA 2ESNA 4EMSA 5CVIA 1FSEA 1BI1A 3W6KB 1F9NA 5FLXZ 4UV9A 2X0LA 3HRSA 4ENKA 1DUXC 1QQIA 4FHTA 4KN7X 2YPRA 1WQ2A 3KP2A 5F6FA 2ZO4A 4M73A 3I4PA 5FO5A 4MQ9F 3CJNA 2VXZA 4MQVA 3COAC 2P7CB 1R5GA 5D4SA 4I98B 5LBQA 4ENJA 4P9FA 2EK5A 5JFRA 4UXNA 3PFIA 1OYIA 2M87A 2KIMA 2Q0OA 3LA3A 2DPUA 1MJ9A 3BROA 2IW5A 2GWRA 4HX7A 1FBSA 5DUKA 2HTJA 1U3EM 4LMYA 2V1UA 4YFXF 3FXUA 3QOPA 1G6NA 3M1EA 2XVCA 4RAZA 4ZYHA 3ZN0A 2Q2EA 3I0TA 5D8LB 1R00A 4XRFA 3EQLF 3I71A 4I0AA 1FLIA 2MH2A 3VFZA 2FSWA 3MQ0A 2K4JA 4WXDA 4Z2YA 2MBFA 3RYPA 2L3DA 4IHSA 1SD4A 4XSZF 3Q9SA 3R0AA 1O3RA 5LHIA 2CGPA 1F1ZA 3CDHA 2MD5A 4G7HF 3QP6A 4BAYA 4F7ZA 2XAHA 3GW2A 4L5IA 5L3BA 2VN2A 3JAMZ 1XMKA 2FF4A 3CUQA 4A0YA 1WSUA 1FBUA 1ZREA 2FQ3A 5F1RA 4M9XA 1T39A 1TQIA 1XMAA 3CO6C 4M71A 4HQMA 1O3QA 4KIBA 1YW7A 1H9TA 3FM3A 2ZMEB 5HS9A 1HW1A 2J5PA 1FOKA 2V1XA 1J5YA 3O3KA 2ZNZA 4GYIA 2NAZA 4Y15A 5HOOA 4PGHA 5AIPA 3R6SA 4IRHA 1CF7A 1IW7F 1E2XA 4Q47A 4U88A 2VOOA 3PQJA 5E8IA 5ICEA 2QZ8A 1XSVA 3BZ6A 2VBYA 1HKSA 4KIGA 3RDIA 2STTA 3VB2A 4M6XA 2L4AA 2W85A 3RKWA 4OIPF 1TW2A 2MH9A 1YO5C 3QPHA 3P9CA 1FNNA 2QQBA 3TOAA 3L2CA 1TQMA 2YX7A 1HBXG 3FX3A 1K78B 1XCVA 4LD5A 3QPTA 3U9GA 2FBIA 2JPBA 4CXFA 3WODF 1AWCA 1EH7A 1QGPA 2FBKA 1P6RA 1E17A 4U7BA 1S3JA 2JPCA 2O61A 1GXQA 2JT1A 4RB0A 3WTSC 4XLNF 5D4RA 1R22A 3F3XA 4Q5SF 2CSOA 4ZYGA 1HXDA 1BN5A 4KIFA 2PLYA 2ADUA 5ERIA 5DDGA 4ESJA 4WX9A 3P9IA 1KQ0A 2K7LA 4RB2C 5ED4A 2PMUA 4A12A 1YS7A 3WGGA 4B09A 5JI6A 4YFNF 3V8JA 1DDNA 1S8NA 5DV5A 1ZGJA 2WV0A 4WCGA 1PP7U 1PP8F 4L0ZB 1R1VA 3TGNA 3DP7A 2EV5A 1TQPA 1Z6TA 3WTVC 2M45A 2EFQA 1D5VA 2VBZA 4PZJA 1FT9A 2JSCA 1U5TB 2W57A 1D8JA 5ICGA 3SXYA 1O7LA 1TTYA 2QBYB 1BBYA 2Z33A 3O2PE 4GXOA 3BJ6A 3M9AA 3RJPA 2PBIA 4HV6A 2NRAC 4S05A 1V4RA 5E18F 2P6TA 3EDPA 1FX7A 3WTWC 2VC1A 2A68F 3CLOA 4KUMA 1Y0UA 3D0SA 1ONVA 5E1ZB 1FYLA 1Z6RA 4A0ZA 2NNYA 1UHMA 3TOBA 3E6CC 2VOPA 4OMYA 3L7WA 4LB5A 4HOBA 1ZHFA 4OMZA 4HBLA 3MZHA 3TDZC 1Z1DA 2DO7A 1ZGAA 1YLFA 4RGXA 3T8TA 3LWFA 2QYOA 4GYGA 1H0MA 4GO1A 5HDGA 5HDKA 4HYEA 2Z9OA 4P96A 5BS6A 4G8XA 3KZYA 1KU2A 3OV8A 3TO6A 2D45A 1R5HA 2AXLA 1U6GA 5DUIA 1LDJA 3WTYC 1Z05A 2QQAA 2F5DA 3GLXA 3I64A 4M9ZA 1LJ9A 2RGVA 3E5QA 3F23A 4KMFA 3FZVA 3HOSA 3Q9VA 3IL2A 1QNTA 2P5KA 4M72A 3HTSB 5BPIA 2Z99A 5ILUA 5CYVA 2XHKA 1G3TA 3GO5A 3HRTA 4UVBA 2CO5A 2GQQA 4XBFA 2F5EA 2E7XA 3FF5A 2HS5A 4HDUA 3I58A 2XAGA 1IF1A 1LNWA 2F5CA 3WE2A 1HW2A 2ELHA 3Q5FA 2HOEA 1TNSA 3QAHA 1B9MA 3BPXA 1J59A 1SFXA 3O6BB 3TKYA 4G94A 1NHAA 1MZBA 1SD5A 5L3DA 2HYFA 5LHHA 3LSTA 3E6MA 1W5SA 3T5XA 2Y0MA 3F72A 1U5TC 4L9TA 4CZZA 5CJ9A 2V1DA 1FC3A 3BP8A 1UHWA 3H3ZA 3SFZA 4BH9A 3ROUA 2P4WA 4HX8A 1P2FA 1IN4A 3DPTA 4HV5A 2OD5A 1G3YA 4E70A 1IN8A 2HQNA 3KEOA 3GZ6A 4WK8F 2A61A 2CFXA 4CDGA 3MCZA 4A6EA 2A07F 1IN7A 1KA8A 3DEUA 4BXUA 3GFLA 2KIUA 2XRNA 4HX4A 4G7OF 2G7HA 4LK1F 4OOIA 1KQ9A 1GXPA 1KYWA 4HA8A 4LG0B 2ISYA 2BV6A 3ULQB 3KETA 2EV0A 1QO0D 1QZYA 4IVNA 2DK8A 2E1NA 5J8FA 1S7OA 4O5VA 1BC7C 1ZARA 4EJVA 2ZJ2A 1C0WA 4MNUA 4KT5C 5FB2A 1T98A 3HIFA 1SMYF 4PDKA 3ZMTA 2P5VA 6PAXA 2O0YA 1OR7A 1W5TA 2A6HF 3LA7A 4L5JA 3I5UA 4HLXA 4N9IA 3R60A 3IHUA 4LG0A 1MKMA 4NB5A 2DK5A 4LK0F 2EFNA 2EV6A 2H27A 5LEKA 1ZG5A 1ZAOA 4U0WA 1RZ4A 3KP3A 1LVAA 4BHPA 5CLSA 2ESHA 4OU0A 3F8NA 4N0BA 1IRGA 4RB1A 2GZWA 2B0LA 5ILVA 2RDPA 4AIJA 3VEPA 4M9SA 5CVJA 1JE8A 5FFZA 5CVVA 2E1CA 1I27A 4HQEA 2QVOA 1ZH5A 5JR3A 1WKMA 3CUQB 1LEBA 1ZG3A 1QZZA 2FRHA 2K02A 1O3TA 1YW9A 5FLXK 3E5XA 3BY6A 3HYIA 3F6OA 2DW4A 3FM5A 1OMIA 4ZYEA 3TO9A 2NNNA 4AIKA 4NHJA 2HFHA 2CQKA 2IA0A 1FWZA 3L9FA 2VE8A 1R23A 1T38A 2XGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IN5 A;  2GA2 A;  2CW0 F;  2BYV E;  1YW8 A;  2PQ8 A;  5D6E A;  4BQA A;  3S2W A;  3RKX A;  4L0Y B;  1GHC A;  4G6D A;  3DXJ F;  4LLN A;  5HLG A;  4U0Y A;  2AS5 F;  1XGN A;  1P4X A;  2M1B A;  3IWF A;  2FEZ A;  1CF7 B;  4IPA A;  1B59 A;  2DQL A;  4QWQ A;  5IT3 A;  1EV7 A;  3GX4 X;  3LAP A;  1YIO A;  5H6R A;  4JBA A;  4EJO A;  3LA2 A;  4BYY A;  4UHT A;  3J81 Z;  3IKT A;  5ICF A;  2PN6 A;  2R7D A;  3WGI A;  1XGM A;  2HEO A;  3HUG A;  1ZRC A;  5K5Q A;  4BNC A;  3RIR A;  2LKP A;  4O3M A;  5D8K B;  2W25 A;  1USS A;  4YG2 F;  2PG4 A;  4OIR F;  4AVP A;  2XAS A;  4HLY A;  3IWZ A;  3R61 A;  1BI2 A;  3MFK A;  4A5M A;  1P4A A;  2X4H A;  5A2Q Z;  1ZG1 A;  1UB9 A;  4G9Y A;  3M8E A;  1OYW A;  1IXS B;  3I53 A;  1B6A A;  2YR2 A;  2OZ6 A;  4L18 B;  4ZH4 F;  3HOT A;  3ZMZ A;  4OIQ F;  5K5O A;  5J8C A;  1FPQ A;  2FOK A;  5E8G A;  1IXC A;  4EQQ A;  1SFE A;  3LQQ A;  2LNB A;  1ZN2 A;  2PJP A;  5D5W B;  3F8C A;  2BGC A;  1V3F A;  4UV8 A;  4DNC A;  3CUQ C;  2KIF A;  4KYW A;  4U7D A;  3L09 A;  3SZP A;  1IUY A;  3RPU A;  3ZMS A;  3FMR A;  4P55 A;  2VT3 A;  2KRF A;  3TQN A;  3NQO A;  3D5L A;  3WGH A;  2VBW A;  4H0E A;  3H3U A;  2ZNY A;  2ISZ A;  2MLG A;  4HZF A;  3QRF F;  2EFP A;  2FMY A;  3FXR A;  3NEU A;  4LLG F;  3JTG A;  2Q8K A;  1ULY A;  3HRM A;  4P5O A;  3B02 A;  3KLO A;  1BM9 A;  1Z91 A;  1P4W A;  1J7K A;  1J2X A;  4ASN A;  1T6S A;  3K0L A;  1ZLK A;  1FYM A;  5HDN A;  4UVC A;  4Y13 A;  1XSX A;  4LGW A;  3ZMD A;  1YQA A;  5H6Q A;  5D5X B;  5L3C A;  4KA4 A;  5BQT A;  3NRV A;  1HSJ A;  2RVC A;  4A6D A;  2FNP A;  2FE3 A;  1ZLJ A;  3N4M A;  2YU3 A;  3J80 Z;  1OKR A;  5ILS A;  2EFO A;  4AWX B;  1K6O A;  3RKY A;  4XLP F;  4B8X A;  5EEH A;  4K2E A;  3TO7 A;  2A3S A;  2EJR A;  3U1D A;  3G73 A;  4L9J A;  4Q4Z F;  1XDS A;  1LB2 A;  2C6Y A;  1HST A;  2EA2 A;  5TJJ A;  2DI3 A;  4WWC A;  1RUO A;  5K5R A;  2PFB A;  3V7C A;  1HW5 A;  1KU7 A;  1XDU A;  3ZPL A;  3E6B A;  3R4K A;  3ZP5 A;  2ZCW A;  1I5Z A;  3K1P A;  1J0R A;  2EWN A;  2XAJ A;  3ERE D;  5JHU A;  1AOY A;  1WWX A;  4BHC A;  2OBP A;  4IRG A;  2DBB A;  3GFJ A;  1S29 A;  5CVU A;  2ACJ A;  2FNA A;  2UXN A;  2ZBK A;  1UST A;  3JW4 A;  5HS8 A;  1FYK A;  1ON1 A;  3LFK A;  4UUV A;  2QQ9 A;  3KLN A;  1KU9 A;  1REP C;  3F22 A;  4U0V A;  3DV8 A;  4YII A;  4S04 A;  2MC3 A;  2P5L C;  3HSF A;  3T0Y A;  1BI0 A;  2FBH A;  4OIN F;  1Q1H A;  2UXX A;  5IT9 K;  5LHG A;  5ICC A;  1XD7 A;  1T2K A;  4IHT A;  1DPU A;  3GWZ A;  1RUN A;  1G4D A;  4RAY A;  3GEZ A;  1JXS A;  3CTA A;  3KP7 A;  2DFI A;  1BJA A;  1IN6 A;  3DQV C;  1FBQ A;  3F8M A;  1W7P B;  1R1T A;  3IC7 A;  3EYI A;  4IJA A;  3FXQ A;  2NYX A;  3I59 A;  1BI3 A;  1O3S A;  2DQR A;  4BHB A;  2P8T A;  1QBJ A;  2OQG A;  4EJT A;  2IA2 A;  2PI0 A;  2TDX A;  3L00 A;  4M6Y A;  2PEX A;  4I09 A;  4RGR A;  2D1H A;  2VC0 A;  4PCQ A;  2YX4 A;  3SZT A;  4MGR A;  2Y75 A;  1MD0 A;  2COM A;  3DKW A;  5E1W A;  1I1S A;  4WF2 A;  5HS7 A;  2UWM A;  1UFM A;  4EM1 A;  3F21 A;  2FXA A;  3KP5 A;  4I02 A;  1RNL A;  4CYD A;  2M5W A;  2HQR A;  4RS8 A;  4CHU A;  2H6B A;  2DAO A;  3AAF A;  1LDD A;  3I54 A;  1W7P A;  1SMT A;  3ML6 A;  4EJU A;  4YIF A;  4I01 A;  1ZYR F;  1MJA A;  2HWV A;  3C1D A;  2PMH A;  2STW A;  1BC8 C;  1IZ1 A;  1JGS A;  4LB6 B;  5FGM A;  2BBY A;  3V7S A;  2WTE A;  3OOP A;  1K7A A;  2KJB A;  4L9N A;  3CUO A;  1LDK B;  1W7P D;  2RQP A;  3KP4 A;  2ETH A;  5LEJ A;  4OIO F;  1JHF A;  3VOD A;  3DFG A;  2Z5U A;  4RGU A;  4HF1 A;  1WRJ A;  3F8F A;  5DCM A;  3C7J A;  2G7U A;  1F4K A;  1SD6 A;  2V79 A;  4ETS A;  1R58 A;  1TBX A;  5HLH A;  4GCV A;  4DQ2 A;  5KVR A;  2H6C A;  1X3U A;  2IVM A;  5FFX A;  3T1B A;  4G6Q A;  1UCR A;  3M8F A;  2VE9 A;  4UVA A;  1D3Y A;  2DPD A;  2HKX A;  5F64 A;  1XB4 A;  1R1U A;  4IF4 A;  4JK1 X;  1BOA A;  4KFC A;  1O57 A;  3E3V A;  2GXG A;  1ZRD A;  3FWE A;  1W4M A;  5J6X A;  2RKH A;  5LGU A;  1ODD A;  2HDC A;  1XN7 A;  2F5F A;  2QUF A;  1B9N A;  4I7H A;  1SAX A;  1HQC A;  5D5U B;  2O8X A;  3REO A;  4LJZ F;  2Z3Y A;  1B4A A;  2WWY A;  2UZK A;  1FP2 A;  3K2Z A;  2OU2 A;  1J75 A;  3K1N A;  2EFW A;  2L54 A;  3GUD A;  2EA4 A;  4RB3 C;  4KMU X;  4LFU A;  5DD4 A;  1YYV A;  5LGN A;  3LQR A;  3FMS A;  3ISP A;  2RNJ A;  4ESB A;  3LAJ A;  1DPR A;  3DF8 A;  2MLK A;  1R36 A;  4KN4 X;  2MA3 A;  1IXR C;  1GVJ A;  5LRR A;  3C18 A;  4MEX F;  2OZU A;  3HRU A;  1ZRF A;  1RIO H;  3PQK A;  1EH8 A;  4MTD A;  3RI4 A;  4HAM A;  2IJL A;  2W84 A;  2ZFW A;  5DCF A;  4O6J A;  5TRD A;  5DEQ A;  2ZKZ A;  3CO7 C;  2IRF G;  2QEN A;  2K4B A;  4EJW A;  2RC4 A;  2GAU A;  3KP6 A;  5LRS A;  3EET A;  1O7F A;  1BIB A;  1OPC A;  2YSR A;  1B1B A;  1U78 A;  5BMZ A;  4R8H A;  1L3L A;  4QLC U;  4L9V A;  4EGY A;  1HKQ A;  1KU3 A;  1LEA A;  4CGZ A;  3GXO A;  5H20 A;  1H9G A;  2LSO A;  2L02 A;  2DU9 A;  2FML A;  5HLI A;  5FD6 A;  4A2U A;  3K9T A;  4N9H A;  2O03 A;  4IRI A;  2W24 A;  5LLQ A;  1TNT A;  2BEO A;  5HVQ C;  4KDP A;  4MTE A;  4YFK F;  3BOQ A;  3JSO A;  1FP1 D;  5CVR A;  1A04 A;  4MEY F;  3JAM K;  1KQ8 A;  4HF2 A;  2DT5 A;  2HR3 A;  5D5V B;  3T8R A;  4WXC A;  3JTH A;  4HW0 A;  1XSD A;  4EM2 A;  3JSP A;  3J81 K;  1U8R A;  2A69 F;  4ZZD A;  1SFU A;  4NQW A;  2L4M A;  3QU3 A;  3ELK A;  4ZZL A;  1SD7 A;  2IP2 A;  2HZT A;  3IKV A;  3KE2 A;  3GVA A;  4EGZ A;  4I0B A;  3F8B A;  3ECH A;  2ZME A;  1XGS A;  3E97 A;  4FX0 A;  3R0J A;  3K69 A;  4HDV A;  5LGT A;  2JRT A;  3F6V A;  3KCC A;  2M30 A;  3BWG A;  3BDD A;  1Z9C A;  3ZMU A;  5L3E A;  3WTT C;  5A2Q K;  2Y48 A;  4KNY A;  2HYG D;  1I6X A;  2F2E A;  4FX4 A;  1WI9 A;  2VBX A;  1TLH B;  2FU4 A;  4JQF A;  3MAJ A;  1MGT A;  4EM0 B;  4WXH A;  3RPQ A;  3KFW X;  2J5O A;  5EEG A;  1FSH A;  2H09 A;  2OQR A;  1KYZ A;  4GGG A;  2RN7 A;  2HGC A;  2IPQ X;  2XRO A;  1G3S A;  2VT2 A;  3GYH X;  1EH6 A;  4IXA A;  1U2W A;  5E20 A;  2XKO A;  3EYY A;  1K78 A;  5E1X A;  5L3G A;  3J7A O;  1MJB A;  4XSX F;  2XUB A;  1PDN C;  2O6G E;  2XAF A;  1D8K A;  2BE5 F;  3G3Z A;  2CYY A;  2A5Y B;  3QP5 A;  2HKO A;  2XV4 S;  2QM3 A;  3P9K A;  2IA1 A;  4R1H A;  4RGS A;  2P6S A;  4UNO A;  5AON A;  1STZ A;  2XAQ A;  4ZYD A;  2P7V B;  5DYM A;  1HKT A;  3RYR A;  2WC2 A;  3P7N A;  3E5U A;  2JZY A;  2M8E A;  1ON2 A;  1IRF A;  3E6D A;  4Q48 A;  5IT9 Z;  2D1V A;  4D0P A;  3ZMV A;  2K86 A;  5BOX A;  2LF7 A;  1MDM B;  3FHZ A;  3J80 K;  1U5T A;  1RI7 A;  3B73 A;  1FZP B;  3SQN A;  3MZY A;  3ZN1 A;  1P92 A;  2QBY A;  1L0O C;  4EVI A;  1R7J A;  3I59 B;  3MEX A;  3V4G A;  1YTY A;  4A5N A;  3H92 A;  4ENN A;  2VOD A;  3GFM A;  2KJC A;  3WU0 A;  5JVT A;  3V8K A;  4EV0 A;  4PGG A;  3WTZ A;  2IT0 A;  3ABT A;  1TW3 A;  3U2R A;  1QPM A;  4ESF A;  1CGP A;  2H94 A;  1MDM A;  2E7W A;  3BPV A;  2JTV A;  3HHH A;  2V9V A;  3SHF A;  3WG9 A;  2L01 A;  3V8L A;  4TV7 A;  2CWE A;  1XGO A;  2RV8 A;  3ECO A;  3IRQ A;  4LLL A;  2OAZ A;  3GFI A;  1LQ1 A;  2DTR A;  1S6L A;  3HSR A;  3TDU C;  5D6F A;  5K1Y A;  1YS6 A;  3WU1 B;  2LDU A;  5DD8 A;  3KEQ A;  4M74 A;  3K1M A;  3GF2 A;  3N97 A;  2R7F A;  2GXB A;  2QWW A;  3QU6 A;  4KIC A;  1J9I A;  2R3S A;  1BIA A;  1DP7 P;  2K27 A;  4R79 A;  2GIV A;  5BPD A;  2FA5 A;  1XCB A;  4AD9 A;  2QLZ A;  3GZ5 A;  4CO8 A;  3M7G A;  4MHG A;  1G3W A;  5DCM B;  3IRR A;  3BJO A;  2G9W A;  1YG2 A;  3BJA A;  2XIG A;  3W6J B;  2NS0 A;  2VON A;  2EB7 A;  2ZXJ A;  3WTX C;  1S7A A;  3EUH A;  2KKO A;  4G7Z F;  1FY7 A;  3C3W A;  2HTS A;  3V7R A;  3HTU A;  1T0F A;  5E17 F;  3RTR A;  3ZQ7 A;  2LF8 A;  3HHG A;  2DLL A;  3HSE A;  5FD5 A;  3FMQ A;  3MWM A;  5KK1 A;  1F5T A;  4A0X A;  4Y17 A;  1K79 A;  1YFH A;  1PUE E;  2XKP A;  3VOE A;  3WE3 A;  4CIC A;  1IAW A;  4HF0 A;  5AIQ A;  4AIH A;  2D2W A;  2CG4 A;  3ABU A;  2O3F A;  4I2O A;  3WTU C;  1OYY A;  2V6C A;  1I1G A;  4ENM A;  1JHH A;  2OA4 A;  3KZZ A;  4FT8 A;  2A6E F;  5L3F A;  2GA1 A;  1VTN C;  4ON0 A;  3DPL C;  1KGS A;  1Z7U A;  4P9U A;  2ESN A;  4EMS A;  5CVI A;  1FSE A;  1BI1 A;  3W6K B;  1F9N A;  5FLX Z;  4UV9 A;  2X0L A;  3HRS A;  4ENK A;  1DUX C;  1QQI A;  4FHT A;  4KN7 X;  2YPR A;  1WQ2 A;  3KP2 A;  5F6F A;  2ZO4 A;  4M73 A;  3I4P A;  5FO5 A;  4MQ9 F;  3CJN A;  2VXZ A;  4MQV A;  3COA C;  2P7C B;  1R5G A;  5D4S A;  4I98 B;  5LBQ A;  4ENJ A;  4P9F A;  2EK5 A;  5JFR A;  4UXN A;  3PFI A;  1OYI A;  2M87 A;  2KIM A;  2Q0O A;  3LA3 A;  2DPU A;  1MJ9 A;  3BRO A;  2IW5 A;  2GWR A;  4HX7 A;  1FBS A;  5DUK A;  2HTJ A;  1U3E M;  4LMY A;  2V1U A;  4YFX F;  3FXU A;  3QOP A;  1G6N A;  3M1E A;  2XVC A;  4RAZ A;  4ZYH A;  3ZN0 A;  2Q2E A;  3I0T A;  5D8L B;  1R00 A;  4XRF A;  3EQL F;  3I71 A;  4I0A A;  1FLI A;  2MH2 A;  3VFZ A;  2FSW A;  3MQ0 A;  2K4J A;  4WXD A;  4Z2Y A;  2MBF A;  3RYP A;  2L3D A;  4IHS A;  1SD4 A;  4XSZ F;  3Q9S A;  3R0A A;  1O3R A;  5LHI A;  2CGP A;  1F1Z A;  3CDH A;  2MD5 A;  4G7H F;  3QP6 A;  4BAY A;  4F7Z A;  2XAH A;  3GW2 A;  4L5I A;  5L3B A;  2VN2 A;  3JAM Z;  1XMK A;  2FF4 A;  3CUQ A;  4A0Y A;  1WSU A;  1FBU A;  1ZRE A;  2FQ3 A;  5F1R A;  4M9X A;  1T39 A;  1TQI A;  1XMA A;  3CO6 C;  4M71 A;  4HQM A;  1O3Q A;  4KIB A;  1YW7 A;  1H9T A;  3FM3 A;  2ZME B;  5HS9 A;  1HW1 A;  2J5P A;  1FOK A;  2V1X A;  1J5Y A;  3O3K A;  2ZNZ A;  4GYI A;  2NAZ A;  4Y15 A;  5HOO A;  4PGH A;  5AIP A;  3R6S A;  4IRH A;  1CF7 A;  1IW7 F;  1E2X A;  4Q47 A;  4U88 A;  2VOO A;  3PQJ A;  5E8I A;  5ICE A;  2QZ8 A;  1XSV A;  3BZ6 A;  2VBY A;  1HKS A;  4KIG A;  3RDI A;  2STT A;  3VB2 A;  4M6X A;  2L4A A;  2W85 A;  3RKW A;  4OIP F;  1TW2 A;  2MH9 A;  1YO5 C;  3QPH A;  3P9C A;  1FNN A;  2QQB A;  3TOA A;  3L2C A;  1TQM A;  2YX7 A;  1HBX G;  3FX3 A;  1K78 B;  1XCV A;  4LD5 A;  3QPT A;  3U9G A;  2FBI A;  2JPB A;  4CXF A;  3WOD F;  1AWC A;  1EH7 A;  1QGP A;  2FBK A;  1P6R A;  1E17 A;  4U7B A;  1S3J A;  2JPC A;  2O61 A;  1GXQ A;  2JT1 A;  4RB0 A;  3WTS C;  4XLN F;  5D4R A;  1R22 A;  3F3X A;  4Q5S F;  2CSO A;  4ZYG A;  1HXD A;  1BN5 A;  4KIF A;  2PLY A;  2ADU A;  5ERI A;  5DDG A;  4ESJ A;  4WX9 A;  3P9I A;  1KQ0 A;  2K7L A;  4RB2 C;  5ED4 A;  2PMU A;  4A12 A;  1YS7 A;  3WGG A;  4B09 A;  5JI6 A;  4YFN F;  3V8J A;  1DDN A;  1S8N A;  5DV5 A;  1ZGJ A;  2WV0 A;  4WCG A;  1PP7 U;  1PP8 F;  4L0Z B;  1R1V A;  3TGN A;  3DP7 A;  2EV5 A;  1TQP A;  1Z6T A;  3WTV C;  2M45 A;  2EFQ A;  1D5V A;  2VBZ A;  4PZJ A;  1FT9 A;  2JSC A;  1U5T B;  2W57 A;  1D8J A;  5ICG A;  3SXY A;  1O7L A;  1TTY A;  2QBY B;  1BBY A;  2Z33 A;  3O2P E;  4GXO A;  3BJ6 A;  3M9A A;  3RJP A;  2PBI A;  4HV6 A;  2NRA C;  4S05 A;  1V4R A;  5E18 F;  2P6T A;  3EDP A;  1FX7 A;  3WTW C;  2VC1 A;  2A68 F;  3CLO A;  4KUM A;  1Y0U A;  3D0S A;  1ONV A;  5E1Z B;  1FYL A;  1Z6R A;  4A0Z A;  2NNY A;  1UHM A;  3TOB A;  3E6C C;  2VOP A;  4OMY A;  3L7W A;  4LB5 A;  4HOB A;  1ZHF A;  4OMZ A;  4HBL A;  3MZH A;  3TDZ C;  1Z1D A;  2DO7 A;  1ZGA A;  1YLF A;  4RGX A;  3T8T A;  3LWF A;  2QYO A;  4GYG A;  1H0M A;  4GO1 A;  5HDG A;  5HDK A;  4HYE A;  2Z9O A;  4P96 A;  5BS6 A;  4G8X A;  3KZY A;  1KU2 A;  3OV8 A;  3TO6 A;  2D45 A;  1R5H A;  2AXL A;  1U6G A;  5DUI A;  1LDJ A;  3WTY C;  1Z05 A;  2QQA A;  2F5D A;  3GLX A;  3I64 A;  4M9Z A;  1LJ9 A;  2RGV A;  3E5Q A;  3F23 A;  4KMF A;  3FZV A;  3HOS A;  3Q9V A;  3IL2 A;  1QNT A;  2P5K A;  4M72 A;  3HTS B;  5BPI A;  2Z99 A;  5ILU A;  5CYV A;  2XHK A;  1G3T A;  3GO5 A;  3HRT A;  4UVB A;  2CO5 A;  2GQQ A;  4XBF A;  2F5E A;  2E7X A;  3FF5 A;  2HS5 A;  4HDU A;  3I58 A;  2XAG A;  1IF1 A;  1LNW A;  2F5C A;  3WE2 A;  1HW2 A;  2ELH A;  3Q5F A;  2HOE A;  1TNS A;  3QAH A;  1B9M A;  3BPX A;  1J59 A;  1SFX A;  3O6B B;  3TKY A;  4G94 A;  1NHA A;  1MZB A;  1SD5 A;  5L3D A;  2HYF A;  5LHH A;  3LST A;  3E6M A;  1W5S A;  3T5X A;  2Y0M A;  3F72 A;  1U5T C;  4L9T A;  4CZZ A;  5CJ9 A;  2V1D A;  1FC3 A;  3BP8 A;  1UHW A;  3H3Z A;  3SFZ A;  4BH9 A;  3ROU A;  2P4W A;  4HX8 A;  1P2F A;  1IN4 A;  3DPT A;  4HV5 A;  2OD5 A;  1G3Y A;  4E70 A;  1IN8 A;  2HQN A;  3KEO A;  3GZ6 A;  4WK8 F;  2A61 A;  2CFX A;  4CDG A;  3MCZ A;  4A6E A;  2A07 F;  1IN7 A;  1KA8 A;  3DEU A;  4BXU A;  3GFL A;  2KIU A;  2XRN A;  4HX4 A;  4G7O F;  2G7H A;  4LK1 F;  4OOI A;  1KQ9 A;  1GXP A;  1KYW A;  4HA8 A;  4LG0 B;  2ISY A;  2BV6 A;  3ULQ B;  3KET A;  2EV0 A;  1QO0 D;  1QZY A;  4IVN A;  2DK8 A;  2E1N A;  5J8F A;  1S7O A;  4O5V A;  1BC7 C;  1ZAR A;  4EJV A;  2ZJ2 A;  1C0W A;  4MNU A;  4KT5 C;  5FB2 A;  1T98 A;  3HIF A;  1SMY F;  4PDK A;  3ZMT A;  2P5V A;  6PAX A;  2O0Y A;  1OR7 A;  1W5T A;  2A6H F;  3LA7 A;  4L5J A;  3I5U A;  4HLX A;  4N9I A;  3R60 A;  3IHU A;  4LG0 A;  1MKM A;  4NB5 A;  2DK5 A;  4LK0 F;  2EFN A;  2EV6 A;  2H27 A;  5LEK A;  1ZG5 A;  1ZAO A;  4U0W A;  1RZ4 A;  3KP3 A;  1LVA A;  4BHP A;  5CLS A;  2ESH A;  4OU0 A;  3F8N A;  4N0B A;  1IRG A;  4RB1 A;  2GZW A;  2B0L A;  5ILV A;  2RDP A;  4AIJ A;  3VEP A;  4M9S A;  5CVJ A;  1JE8 A;  5FFZ A;  5CVV A;  2E1C A;  1I27 A;  4HQE A;  2QVO A;  1ZH5 A;  5JR3 A;  1WKM A;  3CUQ B;  1LEB A;  1ZG3 A;  1QZZ A;  2FRH A;  2K02 A;  1O3T A;  1YW9 A;  5FLX K;  3E5X A;  3BY6 A;  3HYI A;  3F6O A;  2DW4 A;  3FM5 A;  1OMI A;  4ZYE A;  3TO9 A;  2NNN A;  4AIK A;  4NHJ A;  2HFH A;  2CQK A;  2IA0 A;  1FWZ A;  3L9F A;  2VE8 A;  1R23 A;  1T38 A;  2XGX A; 
#chains in the Genus database with same CATH topology
 1OCP A;  1IN5 A;  2GA2 A;  1ZR4 A;  4W97 A;  5EJC A;  2CW0 F;  2L9V A;  3ABL H;  3HXL A;  2BYV E;  2DOE A;  1R9T J;  1CQT A;  1YW8 A;  1UG0 A;  2PQ8 A;  5CKT A;  2L9N A;  2CV0 A;  5D6E A;  4BQA A;  2COB A;  3S2W A;  3RKX A;  5EZG A;  1MMD A;  4L0Y B;  1GHC A;  2HOA A;  4G6D A;  1VFC A;  3DXJ F;  4LLN A;  5HLG A;  4U0Y A;  2AS5 F;  1Y1V J;  1XGN A;  3BR2 A;  2E1M B;  2A5W A;  1P4X A;  2M1B A;  3IWF A;  3PL8 A;  3PSI A;  2FEZ A;  1CF7 B;  4IPA A;  1B59 A;  4MFE A;  2DQL A;  3S3N A;  4QWQ A;  5IT3 A;  1EV7 A;  3IV5 A;  3GX4 X;  4FCY A;  2K3F A;  2NVY J;  4XKB A;  3ZQL A;  2O7O A;  3KZI C;  3LAP A;  1YIJ I;  2JA7 J;  1YIO A;  5H6R A;  4JBA A;  1R4M B;  1TT5 B;  2DT6 A;  4EJO A;  3KX2 A;  3LA2 A;  4BYY A;  4UHT A;  3FIS A;  2AO9 A;  4JP0 A;  3J81 Z;  3BT9 A;  4XN0 A;  5FKL A;  1FIP A;  4A3M J;  3IKT A;  5ICF A;  4CYC A;  2PN6 A;  2R7D A;  3SEZ A;  5GAD J;  2R0Q C;  2LY1 A;  1WZ2 A;  4D7N A;  1LE8 A;  3WGI A;  1ZEL A;  1XGM A;  2HEO A;  3HUG A;  1ZRC A;  5K5Q A;  1Z3X A;  3O8H A;  4BNC A;  5J47 A;  3DPU A;  3VYS B;  3QYE A;  3RIR A;  2LKP A;  1T56 A;  4O3M A;  5D8K B;  3OYL A;  2W25 A;  1S7E A;  2CUF A;  2H1L A;  2M7A A;  1USS A;  4YG2 F;  2PG4 A;  4CCM A;  4OIR F;  4AVP A;  2XAS A;  4C9Y A;  4HLY A;  3IWZ A;  1JUS A;  1MNM C;  3R61 A;  1BI2 A;  3MFK A;  5DM7 F;  4A5M A;  1P4A A;  3SJM A;  3CJR B;  1YE9 A;  2X4H A;  1Z77 A;  2KPM A;  5A2Q Z;  1ZG1 A;  1UB9 A;  4U87 A;  2EIL H;  4G9Y A;  3M8E A;  1OYW A;  3EUA A;  2X6O A;  5J1U A;  1IXS B;  3I53 A;  2ME6 A;  1B6A A;  2LVS A;  2YR2 A;  2OZ6 A;  5B1A H;  4L18 B;  1OFC X;  4ZH4 F;  3S17 J;  3BG7 A;  2JVH A;  3HOT A;  3ZMZ A;  5IOY A;  4OIQ F;  2DYS H;  2DOA A;  4CA0 A;  1LFP A;  1IGN A;  3J7A Y;  1GUU A;  1T95 A;  2DA1 A;  3HKZ N;  5FRN A;  3BZK A;  5K5O A;  1ERD A;  5J8C A;  1FPQ A;  2FOK A;  1NH3 A;  5E8G A;  1IXC A;  3GLL A;  4EQQ A;  2VJI A;  1SFE A;  2NS7 A;  2L5Q A;  3LQQ A;  1HLV A;  2X85 A;  2LNB A;  3BG6 A;  4BE2 A;  1ZN2 A;  2PJP A;  5D5W B;  1AKH A;  3F8C A;  2VQH A;  3SFI A;  1U9O A;  2BGC A;  3OYJ A;  1V3F A;  2QCO A;  2M0C A;  4UV8 A;  4DNC A;  3CUQ C;  2KIF A;  3QOD A;  4KYW A;  2PMZ N;  5GAE J;  2VUM J;  4HNU A;  3OIQ A;  4U7D A;  4BXF A;  3LSM A;  3CDL A;  3L09 A;  3BC8 A;  2BY2 A;  4II2 A;  1ZKG A;  3SZP A;  4AC0 A;  1IUY A;  3RPU A;  2JN6 A;  3L1P A;  2VJJ A;  3ZMS A;  3FMR A;  1RC9 A;  1WH5 A;  4P55 A;  2VT3 A;  4BKX A;  2KRF A;  3TQN A;  5M5W J;  3NQO A;  3D5L A;  2BOL A;  3WGH A;  2VBW A;  4I99 C;  4DBQ A;  4H0E A;  3H3U A;  2ZNY A;  3W2A A;  2L9R A;  2Z1D A;  2M4K A;  3MKW B;  2ISZ A;  4PJJ A;  4A93 J;  2MLG A;  4HZF A;  3QRF F;  4UUT A;  2EFP A;  2FMY A;  3CCS I;  1QPI A;  2ME0 A;  1WPK A;  3FXR A;  1HDD C;  2MFZ A;  3NEU A;  4Y7N J;  4LLG F;  1X1B A;  1AA7 A;  3JTG A;  1JKO C;  1Y6I A;  3PO2 J;  2Q8K A;  1ULY A;  3HRM A;  4P5O A;  5JVG F;  3B02 A;  2LG4 A;  3KLO A;  1BM9 A;  1D5Y A;  4BU2 A;  4A3C J;  2E1M C;  2QF7 A;  2B7E A;  1Z91 A;  1P4W A;  1J7K A;  1J2X A;  2L7M P;  2QGU A;  2Y9Z A;  3BCA A;  2HXI A;  4ASN A;  5GAH J;  1T6S A;  3K0L A;  3NAR A;  1ZLK A;  5HNF A;  4UUS B;  1FYM A;  2M2E A;  2KIS A;  5HDN A;  2DXI A;  3HG9 A;  4UVC A;  3JRE A;  4Y13 A;  2HPI A;  1D1C A;  1XSX A;  4LGW A;  2EBI A;  2ZC2 A;  3ZMD A;  2IS2 A;  2R4G A;  1YQA A;  3HOX J;  2WB1 A;  5H6Q A;  5D5X B;  5L3C A;  4KA4 A;  5M5X J;  5IP7 J;  5BQT A;  2OCC H;  1R5I D;  1X1C A;  1W0T A;  3NRV A;  1HSJ A;  2RVC A;  4A6D A;  1RR8 C;  2FNP A;  4DZP A;  4XQF A;  4C30 A;  2FE3 A;  1ZLJ A;  3H35 A;  3N4M A;  4NC6 A;  2YU3 A;  2BXY A;  4F92 B;  3J80 Z;  1OKR A;  5ILS A;  2XDV A;  2QSF X;  2EFO A;  4AWX B;  3FXO A;  1K6O A;  3RKY A;  4XLP F;  3PO3 J;  4B8X A;  3S3M A;  5EEH A;  2KP6 A;  2N8G A;  4XLH A;  3ZQH A;  3W2W A;  3L2V A;  1SAN A;  4K2E A;  3TO7 A;  1TWF J;  4XMY A;  2VL8 A;  1OIS A;  2A3S A;  4C3H J;  2EJR A;  1LPQ A;  3U1D A;  2DA4 A;  3G73 A;  4L9J A;  4Q4Z F;  1XDS A;  5BNG A;  3G1M A;  2ELJ A;  5FKO A;  1LB2 A;  2C6Y A;  4A3G J;  3DEE A;  1HST A;  2EA2 A;  5TJJ A;  3CCE I;  2DI3 A;  2P0W A;  1FMV A;  2X1C A;  4WWC A;  1RUO A;  2IEK A;  2PFB A;  3LSJ A;  3V7C A;  4B4C A;  5K5R A;  3FBN B;  1K83 J;  1XTA A;  1HW5 A;  1TZL A;  3IH2 A;  1KU7 A;  2WAF A;  2HQA A;  1XDU A;  3K2A A;  2L2O A;  3ZPL A;  3E6B A;  3R4K A;  3ZP5 A;  1W36 D;  3JRC A;  3PIP F;  1YOV B;  2YU9 J;  3E0J B;  2ZCW A;  1I5Z A;  3K1P A;  1J0R A;  3O8G A;  4B44 A;  2EWN A;  2ZXI A;  2XAJ A;  3AG2 H;  3ERE D;  2ECB A;  5JHU A;  4RM3 A;  1AOY A;  1WWX A;  4BHC A;  2OBP A;  4IRG A;  2DBB A;  2EZI A;  2W48 A;  3GFJ A;  1S29 A;  1A5J A;  3S16 J;  5CVU A;  2PX9 A;  3JRB A;  2ACJ A;  1JUM A;  2LD5 A;  2FNA A;  2UXN A;  2ZBK A;  3BR1 A;  1MMS A;  2M3A A;  4HNT A;  3PIO F;  3HOV J;  1UST A;  3JW4 A;  4QSH A;  5HS8 A;  4A3K J;  1FYK A;  5FRM A;  1ON1 A;  3LFK A;  4UUV A;  3PFY A;  2QQ9 A;  4FET A;  3PM1 A;  2NS8 A;  2DA2 A;  3KLN A;  5HOD A;  1TL8 A;  2DMQ A;  3HBL A;  1KU9 A;  1NK3 P;  1REP C;  1WI3 A;  3F22 A;  2VKE A;  4U0V A;  1AHD P;  3DV8 A;  4YII A;  2QA4 I;  4F55 A;  3LSK A;  2E35 A;  4S04 A;  2MC3 A;  2R7Q A;  5C4X J;  2P5L C;  1U8B A;  4F3Q A;  2ZSI B;  3HSF A;  4QIW N;  4E6K G;  4HG2 A;  3CQZ J;  3T0Y A;  3LFU A;  1BI0 A;  1WJF A;  5EG0 A;  2FBH A;  1WHU A;  1UJ8 A;  1FEX A;  4OIN F;  2BVL A;  1Q1H A;  2UXX A;  5IT9 K;  4RAF A;  1MSF C;  2Y9Y A;  5LHG A;  5ICC A;  3E1S A;  1XD7 A;  1W36 C;  4OAZ A;  2E71 A;  1JT6 A;  2DA5 A;  3MN2 A;  4CCN A;  1T2K A;  3ZQI A;  1VND A;  4IHT A;  2E36 A;  4JX4 A;  1DPU A;  3GWZ A;  1RUN A;  1G4D A;  4RAY A;  1Y0N A;  1IC8 A;  1GLN A;  3GEZ A;  2K9M A;  1JXS A;  3CTA A;  3KP7 A;  2KDZ A;  1WGX A;  2DFI A;  1BJA A;  5FRO A;  2CW8 A;  3CJQ B;  2CFO A;  1IN6 A;  3DQV C;  1KON A;  1FBQ A;  3F8M A;  3CMY A;  1W7P B;  1R1T A;  1WJE A;  3HC7 A;  4UB8 C;  3HDD A;  2RQQ A;  3IC7 A;  4KIT B;  1VQ7 I;  5DS9 A;  4F93 B;  3EYI A;  2XF6 A;  2OCE A;  4IJA A;  3FXQ A;  4BY1 J;  1W5C C;  2NYX A;  3I59 A;  1BI3 A;  1T08 B;  3BZC A;  9ANT A;  1O3S A;  1N77 A;  2DQR A;  2L9S A;  4BHB A;  2GXA A;  2P8T A;  1QBJ A;  2OQG A;  4EJT A;  2IA2 A;  2PI0 A;  3CCU I;  2TDX A;  3L00 A;  1PUF A;  4M6Y A;  4PFP A;  4S0H B;  3ZGK A;  2H1K A;  2PEX A;  4I09 A;  3CF5 F;  1R4N B;  4RGR A;  2D1H A;  1DGW Y;  2VC0 A;  4Y52 J;  4PCQ A;  2YX4 A;  3SZT A;  3LSH A;  1IRX A;  4MGR A;  2Y75 A;  3HGG A;  5LFA A;  4LIU A;  1MD0 A;  4CSW A;  2COM A;  3DKW A;  3CCJ I;  5E1W A;  1I1S A;  4WF2 A;  1TP4 A;  5HS7 A;  2UWM A;  1UFM A;  4EM1 A;  3FK6 A;  4EEF G;  3CZ6 A;  3H9G A;  3F21 A;  2FXA A;  4XOP A;  3KP5 A;  4I02 A;  1RNL A;  2HZD A;  3ZCO A;  4CYD A;  2M5W A;  4I76 A;  1WJB A;  2HQR A;  4RS8 A;  4CHU A;  2H6B A;  2DAO A;  2LP0 A;  3AAF A;  1LDD A;  3M3Y J;  1QA6 A;  3I54 A;  1T8I A;  1W7P A;  4BS9 A;  2JJ7 A;  2XPW A;  1SMT A;  3ML6 A;  3I56 I;  1JKQ C;  3DBR B;  3DKY A;  3JRI A;  4EJU A;  3OWT A;  2ZFU A;  3ZR8 X;  1GV2 A;  4M3G A;  4YIF A;  2DTZ A;  2L0K A;  4I01 A;  1ZYR F;  2JRM A;  4A69 C;  1MJA A;  1JTY A;  4IOA F;  2HWV A;  3C1D A;  2PMH A;  1FTZ A;  2STW A;  1BC8 C;  1IZ1 A;  1JGS A;  1D1B A;  3GZN B;  4FAS D;  2K9S A;  1OCT C;  4LB6 B;  5FGM A;  2BBY A;  1F36 A;  2HDD A;  1RPW A;  5IYC J;  3LSG A;  4BBS J;  3LSR A;  2HYJ A;  2K5C A;  3V7S A;  4D1Q A;  2WTE A;  1H8A C;  2X9D A;  2VI6 A;  2KHM A;  3AG3 H;  2W4S A;  3OOP A;  3CCL I;  1K7A A;  2KJB A;  4L9N A;  3CUO A;  1LDK B;  4IOC F;  4ZC3 A;  1DU0 A;  4MLO A;  4PJL A;  2MYS A;  1W7P D;  2RQP A;  3KP4 A;  2ETH A;  2VAS A;  5TGT A;  5LEJ A;  1F43 A;  2DFF A;  2F4O B;  3OYI A;  2W82 A;  4OIO F;  1VQK I;  4PJM A;  1JHF A;  1E3O C;  3VOD A;  2DJI A;  2E34 A;  3DFG A;  5IY5 H;  2Z5U A;  4RGU A;  3DBH B;  1WRJ A;  4HF1 A;  3F8F A;  3K4M A;  5DCM A;  1A6Q A;  2M4G A;  2OV7 A;  3C7J A;  2G7U A;  1F4K A;  1SD6 A;  2V79 A;  4ETS A;  4BJT A;  1JUP A;  1R58 A;  1TBX A;  2XPU A;  4ITV A;  5HLH A;  3AKZ A;  4GCV A;  4DQ2 A;  5KVR A;  5B1B H;  2H6C A;  1X3U A;  1R71 A;  2IVM A;  5FFX A;  2HQ5 A;  3T1B A;  4G6Q A;  1JJ6 C;  5CPR B;  1UCR A;  1P7I A;  2QKM B;  3BR5 A;  4V2F A;  1A35 A;  3M8F A;  2VE9 A;  1P7J A;  5EZH A;  4UVA A;  1D3Y A;  2DDB A;  3UKG A;  3GTO J;  2DPD A;  4C3J J;  2HKX A;  2PJR B;  4LG3 A;  5F64 A;  1XB4 A;  1R1U A;  4IF4 A;  3S8P A;  1WJC A;  4JK1 X;  1BOA A;  1VQN I;  4KFC A;  3A01 A;  2L7K A;  3RZO J;  3K6G A;  1O57 A;  5J4Y A;  1WH7 A;  3E3V A;  2GXG A;  1OCZ H;  1ZRD A;  3FWE A;  2EIK H;  4PFO A;  1W4M A;  1WJD A;  5J6X A;  2RKH A;  2Y2Z A;  5LGU A;  4QPQ A;  2ZJQ F;  1I3Q J;  1ODD A;  3ZQF A;  2HDC A;  1XN7 A;  2F5F A;  1GV5 A;  2QUF A;  3CDI A;  1B9N A;  4I7H A;  5GPA A;  4XRS A;  4BJ5 C;  5EEA A;  1SAX A;  4X0G A;  2XAU A;  2DMT A;  1HQC A;  2Y30 A;  4E7J A;  4AYB A;  5D5U B;  2O8X A;  3REO A;  4LJZ F;  3OYB A;  3L2Q A;  2Z3Y A;  1B4A A;  3QPL A;  2WWY A;  2UZK A;  1FP2 A;  3DCF A;  3K2Z A;  4LIT A;  2OU2 A;  4ABZ A;  1J75 A;  3K1N A;  2EFW A;  3F9K A;  3NAU A;  2QEX I;  2L54 A;  1MMG A;  3GUD A;  2EA4 A;  3OSG A;  4RB3 C;  4KMU X;  4LFU A;  2R5Z A;  5DD4 A;  1YJ9 I;  2RAE A;  2CJJ A;  2VKD A;  1YYV A;  2V26 A;  4CCK A;  5LGN A;  3LQR A;  3FMS A;  3H0D A;  1RES A;  3ISP A;  2RNJ A;  4ESB A;  2R5Y A;  1M1E B;  4E7L A;  1X1P A;  2XB0 X;  2BW3 A;  2DFE A;  3LAJ A;  1DPR A;  4M3E A;  3ZRG A;  1APL C;  3DF8 A;  5J1R A;  2MLK A;  1R36 A;  2LRE A;  2OUM A;  4KN4 X;  2MA3 A;  1IV8 A;  2KDO A;  4DYR A;  1IXR C;  4Y33 A;  2G0E A;  4KT6 A;  3CJT B;  5IYD J;  4CYC B;  1GVJ A;  5LRR A;  1MND A;  2JK3 A;  2QSG X;  3C18 A;  4MEX F;  2OZU A;  1BR1 A;  1LE8 B;  4ZTJ A;  3HRU A;  4B48 A;  3HOZ J;  5IP9 J;  1ZRF A;  3AL0 C;  1RIO H;  2HVS A;  3PQK A;  2JA6 J;  1EH8 A;  1NTC A;  4MTD A;  1OR7 C;  4HAM A;  3RI4 A;  4FE4 A;  2IJL A;  4XOR A;  2W84 A;  2ZFW A;  5DCF A;  4O6J A;  2Y69 H;  5TRD A;  5DEQ A;  1VQP I;  2ZKZ A;  4DW6 A;  5K7H A;  3CO7 C;  2IRF G;  2QEN A;  2K4B A;  4EJW A;  1U0J A;  2RC4 A;  1MMA A;  2GAU A;  3KP6 A;  5LRS A;  5IPA A;  3EET A;  4V2G A;  4JX5 A;  3CP2 A;  1O7F A;  1BIB A;  5KNL A;  4D7M A;  5DM6 F;  1FOX A;  4II3 A;  2NVQ J;  1OPC A;  1HDP A;  2YSR A;  2KQR A;  3U1K A;  2M34 A;  1B1B A;  2BZT A;  1U78 A;  5BMZ A;  1Z67 A;  4IL6 C;  4R8H A;  1MW7 A;  3JR9 A;  1L3L A;  2IGK A;  3BG3 A;  4QLC U;  4L9V A;  2WV1 A;  4EGY A;  1HKQ A;  2FJ1 A;  2E19 A;  1WJ5 A;  1KU3 A;  1LEA A;  4CGZ A;  3GXO A;  3K4L A;  1K6Y A;  4A3I J;  5H20 A;  1H9G A;  3KYL A;  2LSO A;  2L02 A;  2LYC A;  1SFO J;  2DU9 A;  2FML A;  4E7K A;  4PJN A;  5HLI A;  3OR2 C;  3GTK J;  5FD6 A;  2DYR H;  4F52 A;  1UAA A;  4A2U A;  2ZJP F;  3ABK H;  3K9T A;  4KIS A;  4BQQ A;  1AKH B;  2R7V A;  4N9H A;  3DLL F;  2O03 A;  4PUS A;  2CQX A;  2W24 A;  4IRI A;  3HGY A;  1RRJ A;  2B63 J;  2OF7 A;  5LLQ A;  1TNT A;  1EF4 A;  1V5E A;  2BEO A;  5HVQ C;  3HUG B;  4KDP A;  4MTE A;  4YFK F;  3BOQ A;  3JSO A;  1FP1 D;  3M8J A;  5CVR A;  1A04 A;  3OS1 A;  4MEY F;  3JAM K;  3MD2 A;  2A6T A;  1FMW A;  1KQ8 A;  2XGE A;  4ANJ A;  4HF2 A;  3VWB A;  2EZL A;  1E0E A;  2DT5 A;  2HR3 A;  5D5V B;  3T8R A;  3C2G A;  2JA8 J;  4WXC A;  3JTH A;  2DOF A;  1ENH A;  1RR7 A;  2K85 A;  4HW0 A;  1XSD A;  2P81 A;  1IJW C;  4EM2 A;  1V54 H;  3CCR I;  3JSP A;  2RRE A;  4XNF A;  3VYT B;  3WU2 C;  4GDF A;  3J81 K;  2FUG 2;  1U8R A;  3GTM J;  4XLE A;  2A69 F;  2YUS A;  4ZZD A;  1SFU A;  4NQW A;  1WJA A;  2L4M A;  3QU3 A;  4IX7 A;  3ELK A;  2GBY A;  4ZZL A;  2K3P A;  1XC5 A;  3ZQG A;  1SD7 A;  4AVZ A;  2IP2 A;  2XGD A;  1JKR C;  2HVR A;  3LNQ A;  2HZT A;  3IKV A;  2IS4 A;  2MSY A;  3KE2 A;  3M07 A;  5DTD A;  2DJN A;  3GVA A;  3MZ8 A;  4EGZ A;  2VPL A;  4I0B A;  1DQU A;  3F8B A;  1ETX A;  3ECH A;  2ZME A;  1XGS A;  3E97 A;  4FX0 A;  3R0J A;  1QHG A;  4B43 A;  2EIN H;  3K69 A;  4HDV A;  2ZSH B;  5LGT A;  2JRT A;  3F6V A;  3FKJ A;  2X48 A;  1YHQ I;  3KCC A;  1D0X A;  1TC3 C;  2M30 A;  2F4I A;  3BWG A;  3BDD A;  1Z9C A;  3ZMU A;  4IZZ A;  4KJZ A;  1B8I A;  3ASO H;  5L3E A;  3WTT C;  2R7O A;  2D5V A;  2VQL A;  2O5R A;  3G1L A;  3S3O A;  5A2Q K;  2Y48 A;  3WHC A;  4KNY A;  4JOM A;  1TWH J;  2MD0 A;  3SDB A;  2ZXH A;  2HYG D;  1I6X A;  3GTP J;  2F2E A;  4FX4 A;  1WI9 A;  2VBX A;  3ZXS A;  1VQL I;  2UV1 A;  1TLH B;  2FU4 A;  4JQF A;  1Y1W J;  3JRA A;  4C2M J;  3MAJ A;  1MGT A;  4EM0 B;  4WXH A;  2E5N A;  3AFH A;  3RPQ A;  3KFW X;  2J5O A;  1HOM A;  3OYH A;  1ORK A;  5EEG A;  1DU6 A;  1FSH A;  3H9J A;  2H09 A;  2OQR A;  1KYZ A;  4GGG A;  4N4O B;  3L2R A;  1YX3 A;  4J01 A;  4J19 A;  5B5E C;  2RN7 A;  2HGC A;  3PJR A;  2IPQ X;  2XRO A;  1G3S A;  1O4X A;  2VT2 A;  3VYR B;  3CF2 A;  3GYH X;  4ZDO A;  1EH6 A;  4IXA A;  1U2W A;  1OQY A;  5E20 A;  3RPU D;  3A0H C;  3OYD A;  1ITY A;  2F5V A;  2XKO A;  3EYY A;  1XG1 A;  3VDX A;  2CH0 A;  3GTJ J;  1G2H A;  1BR4 A;  2X1D A;  3PNT A;  1K78 A;  5KAI C;  5E1X A;  5L3G A;  3J7A O;  4IQ4 A;  2ELK A;  1MJB A;  1HC8 A;  2R92 J;  2QQ8 A;  2V4J C;  1WCM J;  4XSX F;  1Y39 A;  3OR1 C;  2XUB A;  1NG6 A;  3SZG A;  4B3A A;  1PDN C;  2O6G E;  2NOJ B;  2XAF A;  1D8K A;  2E60 A;  4PSW A;  2E1O A;  2BE5 F;  3C2H A;  3G3Z A;  4JX6 A;  3HKZ A;  2CYY A;  2A5Y B;  2NXN B;  3QP5 A;  3GBG A;  3SEQ A;  2HKO A;  2XV4 S;  2QM3 A;  3EPZ A;  3P9K A;  2IA1 A;  4R1H A;  4X6A J;  4RGS A;  1GVD A;  2P6S A;  4UNO A;  5AON A;  4XRM A;  1STZ A;  3MKY B;  4A3B J;  1IDZ A;  2XAQ A;  4ZYD A;  2CV1 A;  1D1A A;  1PYV A;  1YI2 I;  1MBG A;  2P7V B;  2IS1 A;  2WAD A;  2R7T A;  2NOG A;  2PMZ A;  4ZJZ A;  5DYM A;  1HKT A;  3H1C A;  3RYR A;  3QQA A;  5EG0 B;  2Y0S N;  3IH4 A;  2WC2 A;  4J00 A;  2CW7 A;  2DDA A;  3P7N A;  2HOT A;  3E5U A;  2JZY A;  2M8E A;  3CES A;  1ON2 A;  4ZDP A;  1IRF A;  3E6D A;  3FKI J;  5E3M A;  2EQR A;  1PJR A;  2VQC A;  4Q48 A;  5H2F C;  1S9H A;  4YEJ A;  5IT9 Z;  4M3B A;  2D1V A;  4D0P A;  1VQ8 I;  2R93 J;  3ZMV A;  1GT0 C;  1H88 C;  2K86 A;  5BOX A;  2LF7 A;  1MDM B;  3FHZ A;  3K4N A;  2CMP A;  3J80 K;  4XID A;  2OPT A;  1U5T A;  1RI7 A;  1DP3 A;  3B73 A;  1FZP B;  3SQN A;  3JRH A;  4RDU A;  3MZY A;  3ZN1 A;  3GTL J;  1P92 A;  2QBY A;  3OIP A;  1L0O C;  1NG7 A;  4EVI A;  1R7J A;  2WY7 Q;  3I59 B;  3MEX A;  3V4G A;  3K70 D;  1YTY A;  3ZOB A;  1X2N A;  4A5N A;  3H92 A;  5TIS C;  2JUC A;  4ENN A;  3L2W A;  3A1Y A;  3GME A;  1X4O A;  1PUF B;  2VOD A;  1I3A A;  3GFM A;  5C4J J;  2KJC A;  3WU0 A;  2IBD A;  1V5F A;  5JVT A;  4CCL A;  3V8K A;  2HU9 A;  3I55 I;  3DEW A;  4EV0 A;  2HXO A;  2VPR A;  2ZB9 A;  3I9V 2;  4PGG A;  4G6T B;  1IDY A;  3WTZ A;  2IT0 A;  1K61 A;  3ABT A;  1TW3 A;  3U2R A;  3VSK A;  3FK7 A;  2KRC A;  3B6A A;  3SDG A;  4I6Z A;  1QU3 A;  1QPM A;  4ESF A;  2ID6 A;  1CGP A;  3CC7 I;  2H94 A;  4HST A;  1MDM A;  2E7W A;  3BPV A;  2JTV A;  3HHH A;  3K7A J;  3PNY A;  4A3F J;  1RKW A;  2V9V A;  1YJW I;  3JCU C;  1Y8R B;  3SHF A;  3WG9 A;  2L01 A;  5M3M J;  3IAM 2;  1FOY A;  4Y3O A;  2IS6 A;  3HL2 A;  2GOM A;  1AU7 A;  2WAQ N;  3V8L A;  1ETW A;  4TV7 A;  2CWE A;  3H5A A;  1YRN A;  2ECC A;  1XGO A;  3B6C A;  3OS2 A;  2RV8 A;  3ECO A;  4NNJ A;  3IRQ A;  1FOW A;  2DA7 A;  4LLL A;  2AXT C;  3I4N J;  1Z0X A;  2IGN A;  3K70 C;  3KYD B;  2OAZ A;  4MIM A;  3GFI A;  1UHS A;  3WG7 H;  1LQ1 A;  3K4J A;  4DGW B;  4P1W A;  1MH4 A;  2DTR A;  4CH7 A;  1S6L A;  2JSP A;  2DMP A;  3ONQ A;  3HSR A;  3TDU C;  3D5R C;  3A4C A;  2E2H J;  1X2M A;  4FTH A;  4FIS A;  5D6F A;  5K1Y A;  1YS6 A;  3WU1 B;  2LDU A;  5DD8 A;  3KEQ A;  4M74 A;  1J09 A;  5K7Z A;  3K1M A;  3GF2 A;  5CQE A;  3N97 A;  2R7F A;  3X2Q H;  2GXB A;  2QWW A;  3QU6 A;  4KIC A;  1J9I A;  2OTJ I;  2BVM A;  2R3S A;  2BHZ A;  1BIA A;  1DP7 P;  1LFU P;  3CMM A;  1QVU A;  4DOZ A;  2K27 A;  4RLQ A;  4R79 A;  2GIV A;  5BPD A;  2FA5 A;  2KT0 A;  3OYA A;  1ZTR A;  4W1U A;  1XCB A;  1S72 I;  1Y8Q B;  5F0C A;  2QLZ A;  3GZ5 A;  4AD9 A;  2O9L A;  2JUG A;  4CO8 A;  3M7G A;  4MHG A;  1G3W A;  4XKV A;  5J1Y A;  3FBI B;  5DCM B;  3ASN H;  3IRR A;  3BJO A;  2G9W A;  1YG2 A;  3BJA A;  2XIG A;  3W6J B;  3KYC B;  2NS0 A;  2VON A;  2BY0 A;  5JLX A;  3LL7 A;  1I50 J;  2EB7 A;  2EH3 A;  1V55 H;  2ZXJ A;  1POG A;  3WTX C;  1S7A A;  3EUH A;  1X1D A;  2TCT A;  2KKO A;  4G7Z F;  1FY7 A;  3C3W A;  2HTS A;  4D5C A;  3V7R A;  2NVX J;  5F04 A;  3HTU A;  5F0H A;  1B72 A;  1BL0 A;  1T0F A;  5E17 F;  5KCM A;  5IYB J;  3RTR A;  2XGC A;  1E3P A;  4AM3 A;  3A01 B;  3ZQ7 A;  2HPM A;  2LF8 A;  3HHG A;  3FIW A;  1D0Y A;  1SEU A;  2DLL A;  5JHF A;  3HSE A;  5FD5 A;  3FMQ A;  3MWM A;  5KK1 A;  1OCC H;  1F5T A;  4A0X A;  2LH9 A;  4Y17 A;  5FLV A;  4E4H A;  1K79 A;  2V9K A;  1YFH A;  3CC2 I;  1PUE E;  4OAY A;  2XKP A;  4MFD A;  3G6E I;  3VOE A;  3WE3 A;  4CIC A;  1IAW A;  4HF0 A;  5AIQ A;  4AIH A;  2D2W A;  2LK2 A;  2CG4 A;  3ABU A;  2O3F A;  4I2O A;  3WTU C;  1OYY A;  2V6C A;  2X6X A;  1I1G A;  4ENM A;  1JHH A;  2OA4 A;  3KZZ A;  4FT8 A;  2A6E F;  2KMU A;  2AHQ A;  2DA6 A;  2GA1 A;  5L3F A;  2I8D A;  2R5Z B;  4A3J J;  1VTN C;  3BCB A;  4ON0 A;  3DPL C;  4IO9 F;  1KGS A;  3DWL E;  5F08 A;  4RLF A;  2R5Y B;  4HSR A;  2WBM A;  2AQF A;  3HOW J;  2V6E A;  4BQN A;  2BW3 B;  3K4C A;  1Z7U A;  4P9U A;  2ESN A;  4EMS A;  1LUJ B;  2DCE A;  1ACI A;  5CVI A;  1FSE A;  1BI1 A;  3W6K B;  1F9N A;  3G2B A;  3TP3 A;  5FLX Z;  1MBF A;  2EIJ H;  2F48 A;  3G4S I;  4UV9 A;  1HA8 A;  3QWL A;  2X0L A;  2BXZ A;  1SFK A;  2MAB A;  3HRS A;  4ENK A;  1N25 A;  1QQI A;  1DUX C;  4FHT A;  4KN7 X;  2YPR A;  1WQ2 A;  3KP2 A;  5F6F A;  1MBH A;  2ZO4 A;  4M73 A;  3I4P A;  4NUB A;  4MQ9 F;  5FO5 A;  3CJN A;  1EA3 A;  2VXZ A;  1QRY A;  4Y4R A;  4MQV A;  2LBF A;  3OYN A;  3COA C;  2P7C B;  2JMW A;  4HRI A;  4D5F A;  2IGO A;  1R5G A;  4RM2 A;  5D4S A;  4I98 B;  2DFH A;  3BR0 A;  5LBQ A;  3A03 A;  4ENJ A;  4P9F A;  1Z7L A;  3EUH C;  2EK5 A;  3ESW B;  5JFR A;  4UXN A;  2XF5 A;  2DA3 A;  3PFI A;  1OYI A;  2M87 A;  4XRS G;  2I10 A;  1W0U A;  5EGO A;  2K40 A;  3BQY A;  3PNV A;  5GTI C;  2KIM A;  2Q0O A;  3LA3 A;  3M1C A;  3I4M J;  2DPU A;  3MKZ A;  1MJ9 A;  5FKN A;  3BRO A;  3H36 A;  2IW5 A;  2GWR A;  4HX7 A;  1FBS A;  5DUK A;  1S5L C;  2HTJ A;  3H0G J;  1U3E M;  4YIR X;  4LMY A;  2V1U A;  2OTL I;  4IHX A;  4YFX F;  3FXU A;  3BR6 A;  3GCM A;  3KPH A;  4M3D A;  4XKW A;  2H8W A;  3QOP A;  1G6N A;  2VB6 A;  1H89 C;  2NVT J;  3M1E A;  1EKE A;  4NDL A;  1YIT I;  2XVC A;  3J7Y J;  4XLF A;  5GAG J;  4RAZ A;  3NWT A;  4ZYH A;  1P9Q C;  3ZN0 A;  1GDT A;  2Q2E A;  3I0T A;  5D8L B;  1R00 A;  1QVT A;  2HDW A;  4PK4 A;  4DYQ A;  4XR6 A;  4XRF A;  3EQL F;  3I71 A;  4I0A A;  3FXM A;  1FLI A;  2MH2 A;  3VFZ A;  3IAS 2;  2FSW A;  3MQ0 A;  5FJ8 J;  2K4J A;  3FDY A;  3HOU J;  1UG2 A;  4WXD A;  4Z2Y A;  3S15 J;  2MBF A;  1D0Z A;  3RYP A;  2ZJR F;  2L3D A;  5KAF C;  4IHS A;  4BEH A;  4BBR J;  3CLQ A;  4BL0 B;  1SD4 A;  3S1M J;  4XSZ F;  3Q9S A;  4PJ0 C;  3OY9 A;  3D1N I;  2V9P A;  3R0A A;  1O3R A;  4ZYA A;  3FXJ A;  4AID A;  3VPR A;  5LHI A;  2R7Z J;  2CGP A;  1F1Z A;  3CDH A;  2MD5 A;  4UY8 I;  1EJ9 A;  4G7H F;  3QP6 A;  4BAY A;  3PSF A;  4G12 A;  5GTH C;  4F7Z A;  1ETV A;  2XAH A;  3GW2 A;  4L5I A;  5L3B A;  2VN2 A;  3JAM Z;  1XMK A;  2FF4 A;  1IO2 A;  2GOX B;  3CUQ A;  4HNV A;  4A0Y A;  1WSU A;  1QZE A;  1FBU A;  4IEJ A;  2DMU A;  1ZRE A;  2FQ3 A;  4NQW B;  2NVU B;  2BHY A;  5F1R A;  3BG5 A;  4M9X A;  2XSD C;  1T39 A;  4DIQ A;  2O8K A;  2EZK A;  1T33 A;  2F6C A;  1TQI A;  2AQE A;  3DTK A;  3K4B A;  1XMA A;  2FX0 A;  4M71 A;  3CO6 C;  4HQM A;  1Z21 A;  1X1A A;  1O3Q A;  2ZXW H;  3QYB A;  4KIB A;  1YW7 A;  1H9T A;  3FM3 A;  2UUZ A;  4M3F A;  4CZC A;  4E7S A;  2ZME B;  3NWS A;  5HS9 A;  3RSN A;  4BAC A;  2XB5 A;  1HW1 A;  2J5P A;  3BTJ A;  3KIO A;  4X1E A;  2EIM H;  1FOK A;  4B1R A;  4B3X A;  3MVP A;  2V1X A;  2KLO A;  2GIZ A;  2XPV A;  1J5Y A;  3O3K A;  2CUZ A;  2R7W A;  2M0M A;  3Q0W A;  3DKX A;  3H9Q A;  2ZNZ A;  1B8I B;  3RQ4 A;  2I5U A;  1TWA J;  4GYI A;  4E7Z A;  2NAZ A;  4BDZ A;  4Y15 A;  5HOO A;  3BTC A;  4PGH A;  3A02 A;  3L2U A;  4RA2 A;  5AIP A;  3R6S A;  4IRH A;  5IP6 A;  1G8X A;  3CCV I;  5J4V A;  1RET A;  2K9L A;  1SAU A;  2Z2S B;  3I3L A;  1CF7 A;  1ETY A;  2VLA A;  1R6R A;  2M8G X;  1IW7 F;  2E2I J;  2WB1 N;  1E2X A;  3S32 A;  4Q47 A;  4U88 A;  4QPO A;  2VOO A;  2B9S A;  2HOS A;  3S1Q J;  2CQ7 A;  4XKC A;  3PQJ A;  4H4K C;  5E8I A;  1BW5 A;  5ICE A;  2QZ8 A;  4XK4 A;  1XSV A;  3BZ6 A;  2VBY A;  1HKS A;  4KIG A;  1UZC A;  2ICW G;  3RDI A;  2STT A;  3VB2 A;  2R7S A;  4B47 A;  4M6X A;  4C3I J;  2L4A A;  2W85 A;  1I39 A;  4XL9 A;  4DYC A;  2WA0 A;  1YJN I;  3RKW A;  1I6H J;  3CCQ I;  4OIP F;  1SVO A;  1TW2 A;  2MH9 A;  1YO5 C;  3QPH A;  3P9C A;  3G71 I;  1SC7 A;  3PUF A;  1KZH A;  1FNN A;  2QQB A;  2VKV A;  4RAG A;  2Q1Z B;  3TOA A;  3L2C A;  1TQM A;  2YX7 A;  1HBX G;  3FX3 A;  1K78 B;  2XF7 A;  2ID3 A;  1XCV A;  3CMA I;  4LD5 A;  4A3D J;  1IRZ A;  2KIQ A;  3QPT A;  4GRI A;  3U9G A;  2FBI A;  2WAE A;  4LIV A;  2JPB A;  4N4N B;  4CXF A;  2QSH X;  2VKH A;  2Z16 A;  3WOD F;  1JT0 A;  1AWC A;  3CD6 I;  2LFB A;  1EH7 A;  5B3S H;  2CUE A;  1QGP A;  1MBJ A;  2FBK A;  1P6R A;  1E17 A;  3WHB A;  4U7B A;  1S3J A;  3HM5 A;  2JPC A;  2A05 A;  3U21 A;  2O61 A;  1GXQ A;  2JT1 A;  3HEF A;  4RB0 A;  3WTS C;  2LKS A;  3K4K A;  2JVG A;  3OYF A;  4XLN F;  1BR2 A;  2MW8 A;  5D4R A;  1R22 A;  2DOD A;  3F3X A;  4V19 K;  2W1O A;  3RKQ A;  2CRG A;  3VYU B;  4Q5S F;  2H8R A;  1VI0 A;  2CSO A;  3UR3 C;  3M4O J;  4ZYG A;  3UNG C;  4E7I A;  2LTP A;  2VJ4 A;  3S2H J;  4C2U A;  1HXD A;  1BN5 A;  2LOO A;  3IH3 A;  4IHY A;  4KIF A;  2PLY A;  2ADU A;  3CP8 A;  4BUP A;  5ERI A;  1UEL B;  4DBR A;  5DDG A;  4A3E J;  2MG4 A;  4ESJ A;  4WX9 A;  4QTR A;  2KRH A;  4CCJ A;  3TMO A;  3P9I A;  4ZTF A;  1KQ0 A;  2K7L A;  3A2K A;  4RB2 C;  3IUO A;  5ED4 A;  2XC7 A;  2PMU A;  4A12 A;  1FJL A;  1YS7 A;  3WGG A;  4E7H A;  4B09 A;  5JI6 A;  1FIA A;  4YFN F;  2LRD A;  2VJ5 A;  1S8N A;  3CCY A;  3V8J A;  1DDN A;  5DV5 A;  1ZGJ A;  2WV0 A;  4WCG A;  1PP7 U;  1OJL A;  4BXX J;  1PP8 F;  1A6I A;  4L0Z B;  1R1V A;  3TP0 A;  2W7N A;  5F27 A;  3TGN A;  2OJE D;  3DP7 A;  2EV5 A;  1TQP A;  1Z6T A;  3WTV C;  2M45 A;  2EFQ A;  5E79 C;  1D5V A;  1WFX A;  1SVM A;  2VBZ A;  2KZG A;  1ZGW A;  4PZJ A;  1FT9 A;  4C2T A;  2JSC A;  4M6V A;  1U5T B;  2W57 A;  1IUF A;  1D8J A;  5ICG A;  3SXY A;  4HEA 2;  2ZME C;  1O7L A;  3W3C A;  1TTY A;  2QBY B;  1BBY A;  2Z33 A;  3O2P E;  1ZK8 A;  4GXO A;  3GTQ J;  3BJ6 A;  5K7F A;  1LKX A;  3M9A A;  3RJP A;  3C2B A;  3W2V A;  2PBI A;  4HV6 A;  2NRA C;  4S05 A;  1V5G A;  1V4R A;  1BA5 A;  5E18 F;  2P6T A;  3EDP A;  4F91 B;  1FX7 A;  2LLK A;  3WTW C;  3EUK L;  2VC1 A;  4BJ6 C;  2A68 F;  2KZV A;  2VXD A;  3F0C A;  4IQJ A;  3CLO A;  4XM3 A;  4KUM A;  1Y0U A;  4BGD A;  3D0S A;  1ONV A;  5E1Z B;  1FYL A;  1Z6R A;  3CCM I;  4A0Z A;  2NNY A;  2JA5 J;  3S1N J;  1UHM A;  3TOB A;  3E6C C;  1ETO A;  2VOP A;  2CS3 A;  3OS0 A;  4OMY A;  1UMQ A;  1XS9 A;  1SVL A;  2K9Q A;  1XMX A;  3L7W A;  4LB5 A;  4DJA A;  4UUS A;  3QPS A;  1MIJ A;  4HOB A;  5IOZ A;  3OOU A;  1ZHF A;  3S93 A;  5GP9 A;  4OMZ A;  5J3L A;  4HBL A;  1N75 A;  3OL3 A;  3MZH A;  3H3V K;  1ETK A;  4FQG A;  4YRV A;  3ZQC A;  3TDZ C;  1Z1D A;  4DZJ A;  3BG9 A;  2DO7 A;  1ZGA A;  3A0B C;  3CC4 I;  2M7B A;  1IG7 A;  1YLF A;  1ETQ A;  5B66 C;  4RGX A;  3T8T A;  3LWF A;  2X6Y A;  1X58 A;  2QYO A;  4YEL A;  4GYG A;  4OWR B;  1H0M A;  1VF9 A;  2IAI A;  4GO1 A;  1YRN B;  4JYK A;  2Y31 A;  3W6V A;  4XOT A;  1Z3Y A;  5HDG A;  5HDK A;  4HYE A;  2Z9O A;  2DMN A;  1VQM I;  4P96 A;  3HJE A;  5BS6 A;  5C44 J;  4G8X A;  1VQ9 I;  3K10 A;  3JRD A;  1TT0 A;  4BE1 A;  3KZY A;  3ERM A;  1KU2 A;  1ZR2 A;  2BY1 A;  3OV8 A;  4AU7 A;  3TO6 A;  2D45 A;  4D9J A;  3ABM H;  4RMN A;  1R5H A;  2AXL A;  1U6G A;  5DUI A;  2HVQ A;  1LDJ A;  3WTY C;  2MC4 A;  1Z05 A;  2FD5 A;  2QQA A;  3OYM A;  2F5D A;  3GLX A;  3I64 A;  3N05 A;  3TL4 X;  3FXL A;  4M9Z A;  1LJ9 A;  5GPC A;  2E5Z A;  3TW7 A;  3D5S C;  2RGV A;  3E5Q A;  1RKT A;  2KFD A;  2V1N A;  2X6W A;  3F23 A;  4KMF A;  3FZV A;  1MBE A;  3DTE A;  3HOS A;  5EDN A;  1X19 A;  3S1R J;  3Q9V A;  3BTI A;  1QHH D;  3PUB A;  2CQQ A;  3IL2 A;  1QNT A;  2P5K A;  4M72 A;  2LY2 A;  3HTS B;  5BPI A;  2Z99 A;  2YS9 A;  5ILU A;  3OL4 A;  5JLW A;  2CUJ A;  2VQG A;  5CYV A;  1VZ0 A;  2XHK A;  1BW6 A;  1G3T A;  3GO5 A;  3HRT A;  4UVB A;  2CO5 A;  2GQQ A;  1OCR H;  1LFB A;  2EPF A;  3DTI A;  4XBF A;  5M5Y J;  2F5E A;  2E7X A;  3FF5 A;  1JTX A;  3HOY J;  1MSE C;  2HS5 A;  4HDU A;  3I58 A;  2XAG A;  4ZDL A;  5C3E J;  1IF1 A;  4BE0 A;  1LNW A;  1X3Z B;  4NC7 A;  4XIC A;  1MH3 A;  2F5C A;  1N78 A;  3WE2 A;  1HW2 A;  3BLY A;  2ELH A;  3Q5F A;  2FOW A;  2HOE A;  3OYE A;  1TNS A;  3RQI A;  1VQ5 I;  2CU7 A;  1MBK A;  3QAH A;  1B72 B;  2Y0S A;  1B9M A;  3BPX A;  3G1O A;  3Q0U A;  4IHW A;  1E3H A;  5HLT A;  1J59 A;  3MKL A;  2X51 A;  1SFX A;  3O6B B;  3TKY A;  4G94 A;  1NHA A;  1MZB A;  3LOC A;  1SD5 A;  4NC8 A;  5L3D A;  2HYF A;  5LHH A;  3LST A;  3E6M A;  5M3F J;  1W5S A;  1A36 A;  4L5E A;  3T5X A;  2Y0M A;  3F72 A;  1U5T C;  3LSI A;  3Q3S A;  3OMY A;  1TWG J;  4L9T A;  4CZZ A;  2R7U A;  1JI8 A;  3BQZ A;  5CJ9 A;  2V1D A;  3SYT A;  5FKK A;  2L7F P;  1FC3 A;  5E3O A;  3BP8 A;  3DU6 A;  1UHW A;  3H3Z A;  1DGR M;  1XPX A;  4IHV A;  3SFZ A;  2M9H A;  4BH9 A;  1IV6 A;  3OYC A;  2IXS A;  1FTT A;  2L7Z A;  3ROU A;  2P4W A;  4HX8 A;  1P2F A;  1IN4 A;  3DPT A;  2WY8 Q;  4HV5 A;  1OCO H;  2OD5 A;  3FXK A;  4AYB N;  4EAT A;  2OC6 A;  1G3Y A;  4E70 A;  1IN8 A;  2HQN A;  3V42 A;  3KEO A;  3GZ6 A;  2A61 A;  2CFX A;  3FHN A;  4WK8 F;  2CV2 A;  4CDG A;  3MCZ A;  2LKX A;  4XLA A;  4A6E A;  2IGM A;  2A07 F;  1IN7 A;  3AL0 B;  2V7F A;  3JRF A;  1KA8 A;  3JRG A;  3DEU A;  3IP4 B;  4BXU A;  2R7X A;  2TRT A;  3GFL A;  2KIU A;  2XRN A;  4HX4 A;  4G7O F;  2G7H A;  2HI3 A;  3HPG A;  4LK1 F;  4OOI A;  2LMD A;  1KQ9 A;  1G59 A;  1GXP A;  4XN3 A;  1KYW A;  3DU5 A;  3HPH A;  2KL4 A;  1PVE A;  4HA8 A;  4LG0 B;  5F0F A;  1VQ4 I;  2ISY A;  2BV6 A;  3ULQ B;  3KET A;  4HPQ A;  4XLC A;  4BY7 J;  3RZD J;  3HB9 A;  2EV0 A;  2BY3 A;  2DN0 A;  1X3W B;  1QO0 D;  2LBF B;  1QZY A;  2W00 A;  4IVN A;  2DK8 A;  1A31 A;  1BJZ A;  2WAQ A;  2E1N A;  5LD2 C;  3TBI A;  4BQO A;  2K9N A;  1S7O A;  5J8F A;  5KHD A;  2GLO A;  1X4P A;  1LVK A;  3BTL A;  4O5V A;  1HF0 A;  2E2J J;  1BC7 C;  1ZAR A;  3OIO A;  2ZJ2 A;  4EJV A;  1VQO I;  4MNU A;  1C0W A;  4BDY A;  4KT5 C;  5FB2 A;  1T98 A;  5FKM A;  3ZQQ A;  5FLM J;  3HIF A;  2JQ7 A;  5EGO B;  4AUX A;  2F4M B;  1SMY F;  3RCO A;  5J40 A;  1JJ8 C;  4PDK A;  3ZMT A;  2P5V A;  3H5N A;  2MGQ A;  6PAX A;  2O0Y A;  3LMM A;  1OR7 A;  1W5T A;  2QKL B;  4MO7 A;  3S2D J;  3TED A;  2A6H F;  3LA7 A;  1K4T A;  5E3N A;  1Q1V A;  1YX5 A;  4L5J A;  3I5U A;  4HLX A;  4UB6 C;  3OYG A;  4N9I A;  1WVR A;  3R60 A;  1TWC J;  3IHU A;  1JGG A;  2EZH A;  4LG0 A;  1MKM A;  3QYF A;  4NB5 A;  2DK5 A;  4LK0 F;  4CUG A;  2VIX A;  3HZJ A;  2JWT A;  5CQG A;  2EFN A;  4PSX A;  4CCO A;  2Q2E B;  2LC2 A;  3OYK A;  2EV6 A;  2H27 A;  5LEK A;  1ZG5 A;  3E7L A;  1ZAO A;  4U0W A;  4A3L J;  4RBO A;  2X1E A;  4GFB A;  4NBQ A;  1RZ4 A;  3KP3 A;  1LVA A;  4BHP A;  5CLS A;  3VSL A;  2ESH A;  4OU0 A;  3F8N A;  4N0B A;  1IRG A;  3S14 J;  4RB1 A;  2GZW A;  1NK2 P;  2B0L A;  5EF6 A;  5E3L A;  3P5J A;  5ILV A;  5F1J A;  3H5R A;  4BEH B;  1T0F C;  2RDP A;  4AIJ A;  4XON A;  1JKP C;  3MMY B;  3CME I;  2XRL A;  4M9S A;  3VEP A;  2RNG A;  1U9N A;  5CVJ A;  1JE8 A;  5FFZ A;  2HNH A;  3OSF A;  5CVV A;  2E1C A;  1VQ6 I;  1OLT A;  2FQ4 A;  1I27 A;  1ZQ3 P;  3AG1 H;  4HQE A;  2QVO A;  4FE7 A;  1ZH5 A;  3LSP A;  5JR3 A;  2LY9 A;  1WKM A;  3CUQ B;  1Y56 A;  1LEB A;  5HNH A;  1ZG3 A;  1QZZ A;  2FRH A;  2K02 A;  5EYR A;  2XSJ C;  1O3T A;  1YW9 A;  2GM4 A;  5FLX K;  3E5X A;  3AG4 H;  3DLA A;  3KEY A;  3BY6 A;  3HYI A;  3F6O A;  2DW4 A;  1R49 A;  3FM5 A;  1OMI A;  2LR8 A;  4LOC A;  1XX5 A;  2JA2 A;  3BR3 A;  4ZYE A;  2PJR A;  3TO9 A;  2R7R A;  2NNN A;  1MMN A;  1K4S A;  4AIK A;  1BOB A;  3DBL B;  4NHJ A;  4Z6Y A;  3TW6 A;  3QOE A;  3GTG J;  4IKF A;  2HFH A;  1W1W E;  1MNE A;  2CQK A;  2IA0 A;  1HCR A;  1FWZ A;  3L9F A;  2VE8 A;  1R23 A;  1T38 A;  3Q0V A;  2CQN A;  2XGX A;  3J7Z I;  2DT7 B; 
#chains in the Genus database with same CATH homology
 1IN5 A;  2GA2 A;  2CW0 F;  2BYV E;  1YW8 A;  2PQ8 A;  5D6E A;  4BQA A;  3S2W A;  3RKX A;  4L0Y B;  1GHC A;  4G6D A;  3DXJ F;  4LLN A;  5HLG A;  4U0Y A;  2AS5 F;  1XGN A;  1P4X A;  2M1B A;  3IWF A;  2FEZ A;  1CF7 B;  4IPA A;  1B59 A;  2DQL A;  4QWQ A;  5IT3 A;  1EV7 A;  3GX4 X;  3LAP A;  1YIO A;  5H6R A;  4JBA A;  4EJO A;  3LA2 A;  4BYY A;  4UHT A;  3J81 Z;  3IKT A;  5ICF A;  2PN6 A;  2R7D A;  3WGI A;  1XGM A;  2HEO A;  3HUG A;  1ZRC A;  5K5Q A;  4BNC A;  3RIR A;  2LKP A;  4O3M A;  5D8K B;  2W25 A;  1USS A;  4YG2 F;  2PG4 A;  4OIR F;  4AVP A;  2XAS A;  4HLY A;  3IWZ A;  3R61 A;  1BI2 A;  3MFK A;  4A5M A;  1P4A A;  2X4H A;  5A2Q Z;  1ZG1 A;  1UB9 A;  4G9Y A;  3M8E A;  1OYW A;  1IXS B;  3I53 A;  1B6A A;  2YR2 A;  2OZ6 A;  4L18 B;  4ZH4 F;  3HOT A;  3ZMZ A;  4OIQ F;  5K5O A;  5J8C A;  1FPQ A;  2FOK A;  5E8G A;  1IXC A;  4EQQ A;  1SFE A;  3LQQ A;  2LNB A;  1ZN2 A;  2PJP A;  5D5W B;  3F8C A;  2BGC A;  1V3F A;  4UV8 A;  4DNC A;  3CUQ C;  2KIF A;  4KYW A;  4U7D A;  3L09 A;  3SZP A;  1IUY A;  3RPU A;  3ZMS A;  3FMR A;  4P55 A;  2VT3 A;  2KRF A;  3TQN A;  3NQO A;  3D5L A;  3WGH A;  2VBW A;  4H0E A;  3H3U A;  2ZNY A;  2ISZ A;  2MLG A;  4HZF A;  3QRF F;  2EFP A;  2FMY A;  3FXR A;  3NEU A;  4LLG F;  3JTG A;  2Q8K A;  1ULY A;  3HRM A;  4P5O A;  3B02 A;  3KLO A;  1BM9 A;  1Z91 A;  1P4W A;  1J7K A;  1J2X A;  4ASN A;  1T6S A;  3K0L A;  1ZLK A;  1FYM A;  5HDN A;  4UVC A;  4Y13 A;  1XSX A;  4LGW A;  3ZMD A;  1YQA A;  5H6Q A;  5D5X B;  5L3C A;  4KA4 A;  5BQT A;  3NRV A;  1HSJ A;  2RVC A;  4A6D A;  2FNP A;  2FE3 A;  1ZLJ A;  3N4M A;  2YU3 A;  3J80 Z;  1OKR A;  5ILS A;  2EFO A;  4AWX B;  1K6O A;  3RKY A;  4XLP F;  4B8X A;  5EEH A;  4K2E A;  3TO7 A;  2A3S A;  2EJR A;  3U1D A;  3G73 A;  4L9J A;  4Q4Z F;  1XDS A;  1LB2 A;  2C6Y A;  1HST A;  2EA2 A;  5TJJ A;  2DI3 A;  4WWC A;  1RUO A;  5K5R A;  2PFB A;  3V7C A;  1HW5 A;  1KU7 A;  1XDU A;  3ZPL A;  3E6B A;  3R4K A;  3ZP5 A;  2ZCW A;  1I5Z A;  3K1P A;  1J0R A;  2EWN A;  2XAJ A;  3ERE D;  5JHU A;  1AOY A;  1WWX A;  4BHC A;  2OBP A;  4IRG A;  2DBB A;  3GFJ A;  1S29 A;  5CVU A;  2ACJ A;  2FNA A;  2UXN A;  2ZBK A;  1UST A;  3JW4 A;  5HS8 A;  1FYK A;  1ON1 A;  3LFK A;  4UUV A;  2QQ9 A;  3KLN A;  1KU9 A;  1REP C;  3F22 A;  4U0V A;  3DV8 A;  4YII A;  4S04 A;  2MC3 A;  2P5L C;  3HSF A;  3T0Y A;  1BI0 A;  2FBH A;  4OIN F;  1Q1H A;  2UXX A;  5IT9 K;  5LHG A;  5ICC A;  1XD7 A;  1T2K A;  4IHT A;  1DPU A;  3GWZ A;  1RUN A;  1G4D A;  4RAY A;  3GEZ A;  1JXS A;  3CTA A;  3KP7 A;  2DFI A;  1BJA A;  1IN6 A;  3DQV C;  1FBQ A;  3F8M A;  1W7P B;  1R1T A;  3IC7 A;  3EYI A;  4IJA A;  3FXQ A;  2NYX A;  3I59 A;  1BI3 A;  1O3S A;  2DQR A;  4BHB A;  2P8T A;  1QBJ A;  2OQG A;  4EJT A;  2IA2 A;  2PI0 A;  2TDX A;  3L00 A;  4M6Y A;  2PEX A;  4I09 A;  4RGR A;  2D1H A;  2VC0 A;  4PCQ A;  2YX4 A;  3SZT A;  4MGR A;  2Y75 A;  1MD0 A;  2COM A;  3DKW A;  5E1W A;  1I1S A;  4WF2 A;  5HS7 A;  2UWM A;  1UFM A;  4EM1 A;  3F21 A;  2FXA A;  3KP5 A;  4I02 A;  1RNL A;  4CYD A;  2M5W A;  2HQR A;  4RS8 A;  4CHU A;  2H6B A;  2DAO A;  3AAF A;  1LDD A;  3I54 A;  1W7P A;  1SMT A;  3ML6 A;  4EJU A;  4YIF A;  4I01 A;  1ZYR F;  1MJA A;  2HWV A;  3C1D A;  2PMH A;  2STW A;  1BC8 C;  1IZ1 A;  1JGS A;  4LB6 B;  5FGM A;  2BBY A;  3V7S A;  2WTE A;  3OOP A;  1K7A A;  2KJB A;  4L9N A;  3CUO A;  1LDK B;  1W7P D;  2RQP A;  3KP4 A;  2ETH A;  5LEJ A;  4OIO F;  1JHF A;  3VOD A;  3DFG A;  2Z5U A;  4RGU A;  4HF1 A;  1WRJ A;  3F8F A;  5DCM A;  3C7J A;  2G7U A;  1F4K A;  1SD6 A;  2V79 A;  4ETS A;  1R58 A;  1TBX A;  5HLH A;  4GCV A;  4DQ2 A;  5KVR A;  2H6C A;  1X3U A;  2IVM A;  5FFX A;  3T1B A;  4G6Q A;  1UCR A;  3M8F A;  2VE9 A;  4UVA A;  1D3Y A;  2DPD A;  2HKX A;  5F64 A;  1XB4 A;  1R1U A;  4IF4 A;  4JK1 X;  1BOA A;  4KFC A;  1O57 A;  3E3V A;  2GXG A;  1ZRD A;  3FWE A;  1W4M A;  5J6X A;  2RKH A;  5LGU A;  1ODD A;  2HDC A;  1XN7 A;  2F5F A;  2QUF A;  1B9N A;  4I7H A;  1SAX A;  1HQC A;  5D5U B;  2O8X A;  3REO A;  4LJZ F;  2Z3Y A;  1B4A A;  2WWY A;  2UZK A;  1FP2 A;  3K2Z A;  2OU2 A;  1J75 A;  3K1N A;  2EFW A;  2L54 A;  3GUD A;  2EA4 A;  4RB3 C;  4KMU X;  4LFU A;  5DD4 A;  1YYV A;  5LGN A;  3LQR A;  3FMS A;  3ISP A;  2RNJ A;  4ESB A;  3LAJ A;  1DPR A;  3DF8 A;  2MLK A;  1R36 A;  4KN4 X;  2MA3 A;  1IXR C;  1GVJ A;  5LRR A;  3C18 A;  4MEX F;  2OZU A;  3HRU A;  1ZRF A;  1RIO H;  3PQK A;  1EH8 A;  4MTD A;  3RI4 A;  4HAM A;  2IJL A;  2W84 A;  2ZFW A;  5DCF A;  4O6J A;  5TRD A;  5DEQ A;  2ZKZ A;  3CO7 C;  2IRF G;  2QEN A;  2K4B A;  4EJW A;  2RC4 A;  2GAU A;  3KP6 A;  5LRS A;  3EET A;  1O7F A;  1BIB A;  1OPC A;  2YSR A;  1B1B A;  1U78 A;  5BMZ A;  4R8H A;  1L3L A;  4QLC U;  4L9V A;  4EGY A;  1HKQ A;  1KU3 A;  1LEA A;  4CGZ A;  3GXO A;  5H20 A;  1H9G A;  2LSO A;  2L02 A;  2DU9 A;  2FML A;  5HLI A;  5FD6 A;  4A2U A;  3K9T A;  4N9H A;  2O03 A;  4IRI A;  2W24 A;  5LLQ A;  1TNT A;  2BEO A;  5HVQ C;  4KDP A;  4MTE A;  4YFK F;  3BOQ A;  3JSO A;  1FP1 D;  5CVR A;  1A04 A;  4MEY F;  3JAM K;  1KQ8 A;  4HF2 A;  2DT5 A;  2HR3 A;  5D5V B;  3T8R A;  4WXC A;  3JTH A;  4HW0 A;  1XSD A;  4EM2 A;  3JSP A;  3J81 K;  1U8R A;  2A69 F;  4ZZD A;  1SFU A;  4NQW A;  2L4M A;  3QU3 A;  3ELK A;  4ZZL A;  1SD7 A;  2IP2 A;  2HZT A;  3IKV A;  3KE2 A;  3GVA A;  4EGZ A;  4I0B A;  3F8B A;  3ECH A;  2ZME A;  1XGS A;  3E97 A;  4FX0 A;  3R0J A;  3K69 A;  4HDV A;  5LGT A;  2JRT A;  3F6V A;  3KCC A;  2M30 A;  3BWG A;  3BDD A;  1Z9C A;  3ZMU A;  5L3E A;  3WTT C;  5A2Q K;  2Y48 A;  4KNY A;  2HYG D;  1I6X A;  2F2E A;  4FX4 A;  1WI9 A;  2VBX A;  1TLH B;  2FU4 A;  4JQF A;  3MAJ A;  1MGT A;  4EM0 B;  4WXH A;  3RPQ A;  3KFW X;  2J5O A;  5EEG A;  1FSH A;  2H09 A;  2OQR A;  1KYZ A;  4GGG A;  2RN7 A;  2HGC A;  2IPQ X;  2XRO A;  1G3S A;  2VT2 A;  3GYH X;  1EH6 A;  4IXA A;  1U2W A;  5E20 A;  2XKO A;  3EYY A;  1K78 A;  5E1X A;  5L3G A;  3J7A O;  1MJB A;  4XSX F;  2XUB A;  1PDN C;  2O6G E;  2XAF A;  1D8K A;  2BE5 F;  3G3Z A;  2CYY A;  2A5Y B;  3QP5 A;  2HKO A;  2XV4 S;  2QM3 A;  3P9K A;  2IA1 A;  4R1H A;  4RGS A;  2P6S A;  4UNO A;  5AON A;  1STZ A;  2XAQ A;  4ZYD A;  2P7V B;  5DYM A;  1HKT A;  3RYR A;  2WC2 A;  3P7N A;  3E5U A;  2JZY A;  2M8E A;  1ON2 A;  1IRF A;  3E6D A;  4Q48 A;  5IT9 Z;  2D1V A;  4D0P A;  3ZMV A;  2K86 A;  5BOX A;  2LF7 A;  1MDM B;  3FHZ A;  3J80 K;  1U5T A;  1RI7 A;  3B73 A;  1FZP B;  3SQN A;  3MZY A;  3ZN1 A;  1P92 A;  2QBY A;  1L0O C;  4EVI A;  1R7J A;  3I59 B;  3MEX A;  3V4G A;  1YTY A;  4A5N A;  3H92 A;  4ENN A;  2VOD A;  3GFM A;  2KJC A;  3WU0 A;  5JVT A;  3V8K A;  4EV0 A;  4PGG A;  3WTZ A;  2IT0 A;  3ABT A;  1TW3 A;  3U2R A;  1QPM A;  4ESF A;  1CGP A;  2H94 A;  1MDM A;  2E7W A;  3BPV A;  2JTV A;  3HHH A;  2V9V A;  3SHF A;  3WG9 A;  2L01 A;  3V8L A;  4TV7 A;  2CWE A;  1XGO A;  2RV8 A;  3ECO A;  3IRQ A;  4LLL A;  2OAZ A;  3GFI A;  1LQ1 A;  2DTR A;  1S6L A;  3HSR A;  3TDU C;  5D6F A;  5K1Y A;  1YS6 A;  3WU1 B;  2LDU A;  5DD8 A;  3KEQ A;  4M74 A;  3K1M A;  3GF2 A;  3N97 A;  2R7F A;  2GXB A;  2QWW A;  3QU6 A;  4KIC A;  1J9I A;  2R3S A;  1BIA A;  1DP7 P;  2K27 A;  4R79 A;  2GIV A;  5BPD A;  2FA5 A;  1XCB A;  4AD9 A;  2QLZ A;  3GZ5 A;  4CO8 A;  3M7G A;  4MHG A;  1G3W A;  5DCM B;  3IRR A;  3BJO A;  2G9W A;  1YG2 A;  3BJA A;  2XIG A;  3W6J B;  2NS0 A;  2VON A;  2EB7 A;  2ZXJ A;  3WTX C;  1S7A A;  3EUH A;  2KKO A;  4G7Z F;  1FY7 A;  3C3W A;  2HTS A;  3V7R A;  3HTU A;  1T0F A;  5E17 F;  3RTR A;  3ZQ7 A;  2LF8 A;  3HHG A;  2DLL A;  3HSE A;  5FD5 A;  3FMQ A;  3MWM A;  5KK1 A;  1F5T A;  4A0X A;  4Y17 A;  1K79 A;  1YFH A;  1PUE E;  2XKP A;  3VOE A;  3WE3 A;  4CIC A;  1IAW A;  4HF0 A;  5AIQ A;  4AIH A;  2D2W A;  2CG4 A;  3ABU A;  2O3F A;  4I2O A;  3WTU C;  1OYY A;  2V6C A;  1I1G A;  4ENM A;  1JHH A;  2OA4 A;  3KZZ A;  4FT8 A;  2A6E F;  5L3F A;  2GA1 A;  1VTN C;  4ON0 A;  3DPL C;  1KGS A;  1Z7U A;  4P9U A;  2ESN A;  4EMS A;  5CVI A;  1FSE A;  1BI1 A;  3W6K B;  1F9N A;  5FLX Z;  4UV9 A;  2X0L A;  3HRS A;  4ENK A;  1DUX C;  1QQI A;  4FHT A;  4KN7 X;  2YPR A;  1WQ2 A;  3KP2 A;  5F6F A;  2ZO4 A;  4M73 A;  3I4P A;  5FO5 A;  4MQ9 F;  3CJN A;  2VXZ A;  4MQV A;  3COA C;  2P7C B;  1R5G A;  5D4S A;  4I98 B;  5LBQ A;  4ENJ A;  4P9F A;  2EK5 A;  5JFR A;  4UXN A;  3PFI A;  1OYI A;  2M87 A;  2KIM A;  2Q0O A;  3LA3 A;  2DPU A;  1MJ9 A;  3BRO A;  2IW5 A;  2GWR A;  4HX7 A;  1FBS A;  5DUK A;  2HTJ A;  1U3E M;  4LMY A;  2V1U A;  4YFX F;  3FXU A;  3QOP A;  1G6N A;  3M1E A;  2XVC A;  4RAZ A;  4ZYH A;  3ZN0 A;  2Q2E A;  3I0T A;  5D8L B;  1R00 A;  4XRF A;  3EQL F;  3I71 A;  4I0A A;  1FLI A;  2MH2 A;  3VFZ A;  2FSW A;  3MQ0 A;  2K4J A;  4WXD A;  4Z2Y A;  2MBF A;  3RYP A;  2L3D A;  4IHS A;  1SD4 A;  4XSZ F;  3Q9S A;  3R0A A;  1O3R A;  5LHI A;  2CGP A;  1F1Z A;  3CDH A;  2MD5 A;  4G7H F;  3QP6 A;  4BAY A;  4F7Z A;  2XAH A;  3GW2 A;  4L5I A;  5L3B A;  2VN2 A;  3JAM Z;  1XMK A;  2FF4 A;  3CUQ A;  4A0Y A;  1WSU A;  1FBU A;  1ZRE A;  2FQ3 A;  5F1R A;  4M9X A;  1T39 A;  1TQI A;  1XMA A;  3CO6 C;  4M71 A;  4HQM A;  1O3Q A;  4KIB A;  1YW7 A;  1H9T A;  3FM3 A;  2ZME B;  5HS9 A;  1HW1 A;  2J5P A;  1FOK A;  2V1X A;  1J5Y A;  3O3K A;  2ZNZ A;  4GYI A;  2NAZ A;  4Y15 A;  5HOO A;  4PGH A;  5AIP A;  3R6S A;  4IRH A;  1CF7 A;  1IW7 F;  1E2X A;  4Q47 A;  4U88 A;  2VOO A;  3PQJ A;  5E8I A;  5ICE A;  2QZ8 A;  1XSV A;  3BZ6 A;  2VBY A;  1HKS A;  4KIG A;  3RDI A;  2STT A;  3VB2 A;  4M6X A;  2L4A A;  2W85 A;  3RKW A;  4OIP F;  1TW2 A;  2MH9 A;  1YO5 C;  3QPH A;  3P9C A;  1FNN A;  2QQB A;  3TOA A;  3L2C A;  1TQM A;  2YX7 A;  1HBX G;  3FX3 A;  1K78 B;  1XCV A;  4LD5 A;  3QPT A;  3U9G A;  2FBI A;  2JPB A;  4CXF A;  3WOD F;  1AWC A;  1EH7 A;  1QGP A;  2FBK A;  1P6R A;  1E17 A;  4U7B A;  1S3J A;  2JPC A;  2O61 A;  1GXQ A;  2JT1 A;  4RB0 A;  3WTS C;  4XLN F;  5D4R A;  1R22 A;  3F3X A;  4Q5S F;  2CSO A;  4ZYG A;  1HXD A;  1BN5 A;  4KIF A;  2PLY A;  2ADU A;  5ERI A;  5DDG A;  4ESJ A;  4WX9 A;  3P9I A;  1KQ0 A;  2K7L A;  4RB2 C;  5ED4 A;  2PMU A;  4A12 A;  1YS7 A;  3WGG A;  4B09 A;  5JI6 A;  4YFN F;  3V8J A;  1DDN A;  1S8N A;  5DV5 A;  1ZGJ A;  2WV0 A;  4WCG A;  1PP7 U;  1PP8 F;  4L0Z B;  1R1V A;  3TGN A;  3DP7 A;  2EV5 A;  1TQP A;  1Z6T A;  3WTV C;  2M45 A;  2EFQ A;  1D5V A;  2VBZ A;  4PZJ A;  1FT9 A;  2JSC A;  1U5T B;  2W57 A;  1D8J A;  5ICG A;  3SXY A;  1O7L A;  1TTY A;  2QBY B;  1BBY A;  2Z33 A;  3O2P E;  4GXO A;  3BJ6 A;  3M9A A;  3RJP A;  2PBI A;  4HV6 A;  2NRA C;  4S05 A;  1V4R A;  5E18 F;  2P6T A;  3EDP A;  1FX7 A;  3WTW C;  2VC1 A;  2A68 F;  3CLO A;  4KUM A;  1Y0U A;  3D0S A;  1ONV A;  5E1Z B;  1FYL A;  1Z6R A;  4A0Z A;  2NNY A;  1UHM A;  3TOB A;  3E6C C;  2VOP A;  4OMY A;  3L7W A;  4LB5 A;  4HOB A;  1ZHF A;  4OMZ A;  4HBL A;  3MZH A;  3TDZ C;  1Z1D A;  2DO7 A;  1ZGA A;  1YLF A;  4RGX A;  3T8T A;  3LWF A;  2QYO A;  4GYG A;  1H0M A;  4GO1 A;  5HDG A;  5HDK A;  4HYE A;  2Z9O A;  4P96 A;  5BS6 A;  4G8X A;  3KZY A;  1KU2 A;  3OV8 A;  3TO6 A;  2D45 A;  1R5H A;  2AXL A;  1U6G A;  5DUI A;  1LDJ A;  3WTY C;  1Z05 A;  2QQA A;  2F5D A;  3GLX A;  3I64 A;  4M9Z A;  1LJ9 A;  2RGV A;  3E5Q A;  3F23 A;  4KMF A;  3FZV A;  3HOS A;  3Q9V A;  3IL2 A;  1QNT A;  2P5K A;  4M72 A;  3HTS B;  5BPI A;  2Z99 A;  5ILU A;  5CYV A;  2XHK A;  1G3T A;  3GO5 A;  3HRT A;  4UVB A;  2CO5 A;  2GQQ A;  4XBF A;  2F5E A;  2E7X A;  3FF5 A;  2HS5 A;  4HDU A;  3I58 A;  2XAG A;  1IF1 A;  1LNW A;  2F5C A;  3WE2 A;  1HW2 A;  2ELH A;  3Q5F A;  2HOE A;  1TNS A;  3QAH A;  1B9M A;  3BPX A;  1J59 A;  1SFX A;  3O6B B;  3TKY A;  4G94 A;  1NHA A;  1MZB A;  1SD5 A;  5L3D A;  2HYF A;  5LHH A;  3LST A;  3E6M A;  1W5S A;  3T5X A;  2Y0M A;  3F72 A;  1U5T C;  4L9T A;  4CZZ A;  5CJ9 A;  2V1D A;  1FC3 A;  3BP8 A;  1UHW A;  3H3Z A;  3SFZ A;  4BH9 A;  3ROU A;  2P4W A;  4HX8 A;  1P2F A;  1IN4 A;  3DPT A;  4HV5 A;  2OD5 A;  1G3Y A;  4E70 A;  1IN8 A;  2HQN A;  3KEO A;  3GZ6 A;  4WK8 F;  2A61 A;  2CFX A;  4CDG A;  3MCZ A;  4A6E A;  2A07 F;  1IN7 A;  1KA8 A;  3DEU A;  4BXU A;  3GFL A;  2KIU A;  2XRN A;  4HX4 A;  4G7O F;  2G7H A;  4LK1 F;  4OOI A;  1KQ9 A;  1GXP A;  1KYW A;  4HA8 A;  4LG0 B;  2ISY A;  2BV6 A;  3ULQ B;  3KET A;  2EV0 A;  1QO0 D;  1QZY A;  4IVN A;  2DK8 A;  2E1N A;  5J8F A;  1S7O A;  4O5V A;  1BC7 C;  1ZAR A;  4EJV A;  2ZJ2 A;  1C0W A;  4MNU A;  4KT5 C;  5FB2 A;  1T98 A;  3HIF A;  1SMY F;  4PDK A;  3ZMT A;  2P5V A;  6PAX A;  2O0Y A;  1OR7 A;  1W5T A;  2A6H F;  3LA7 A;  4L5J A;  3I5U A;  4HLX A;  4N9I A;  3R60 A;  3IHU A;  4LG0 A;  1MKM A;  4NB5 A;  2DK5 A;  4LK0 F;  2EFN A;  2EV6 A;  2H27 A;  5LEK A;  1ZG5 A;  1ZAO A;  4U0W A;  1RZ4 A;  3KP3 A;  1LVA A;  4BHP A;  5CLS A;  2ESH A;  4OU0 A;  3F8N A;  4N0B A;  1IRG A;  4RB1 A;  2GZW A;  2B0L A;  5ILV A;  2RDP A;  4AIJ A;  3VEP A;  4M9S A;  5CVJ A;  1JE8 A;  5FFZ A;  5CVV A;  2E1C A;  1I27 A;  4HQE A;  2QVO A;  1ZH5 A;  5JR3 A;  1WKM A;  3CUQ B;  1LEB A;  1ZG3 A;  1QZZ A;  2FRH A;  2K02 A;  1O3T A;  1YW9 A;  5FLX K;  3E5X A;  3BY6 A;  3HYI A;  3F6O A;  2DW4 A;  3FM5 A;  1OMI A;  4ZYE A;  3TO9 A;  2NNN A;  4AIK A;  4NHJ A;  2HFH A;  2CQK A;  2IA0 A;  1FWZ A;  3L9F A;  2VE8 A;  1R23 A;  1T38 A;  2XGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...