4RGRA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP
rcsb
source organism Acinetobacter sp. adp1
total genus 42
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgrA00
2DPDA 1G6NA 3RKXA 5ICFA 2YX4A 4P5OA 1KYWA 5CLSA 3EQLF 4MNUA 1KA8A 3DV8A 4MHGA 1OR7A 3HRSA 2H6CA 1KGSA 1X3UA 5D5WB 2QBYB 4JQFA 2O0YA 3K1NA 5KK1A 2DU9A 2HEOA 4L9TA 2Z99A 1RUOA 2M1BA 2Y0MA 1BI3A 3SZPA 2IA1A 4P55A 2NAZA 2R3SA 1E2XA 3J80Z 2CFXA 3CJNA 4A6EA 4WCGA 2YU3A 1P6RA 3CLOA 1O3QA 3ZQ7A 1S7OA 3F72A 3RTRA 3SHFA 2HDCA 2P5KA 4HOBA 3TDUC 4A6DA 5BPIA 2F5EA 1ZN2A 4R1HA 3MCZA 1F1ZA 2G7UA 4L18B 1IRFA 4U88A 2H6BA 2IT0A 3GFLA 4L9JA 2Z3YA 1J59A 2ZCWA 4LK0F 5CVRA 4FHTA 1UFMA 4E70A 4RB2C 2JPBA 2XAFA 3L7WA 3V7CA 2PQ8A 3MQ0A 1V4RA 3WU0A 4WXCA 2P5LC 2O03A 4P9FA 1KU2A 3FXRA 3I53A 4HQEA 4I98B 4ENKA 4U0WA 4BAYA 4EVIA 1P4AA 2DT5A 3U2RA 4F7ZA 4PGGA 2CGPA 2DW4A 4HX4A 3RYRA 1G4DA 2XUBA 3V8JA 4U0VA 3IHUA 1SD6A 4ETSA 4I0AA 1R5GA 5TJJA 2Y75A 2EA2A 3LA2A 2FSWA 5CVVA 4XSXF 3F6VA 5DD4A 5HOOA 3D5LA 2RN7A 3K1PA 2FRHA 3WG9A 3GEZA 5L3EA 5AIQA 3VEPA 4RAZA 4AD9A 4HF0A 3GF2A 5H6RA 1HBXG 5L3GA 1ZH5A 3LAJA 1B6AA 1XGMA 3LSTA 4BQAA 2A07F 3ML6A 4PGHA 5LBQA 2JT1A 1GHCA 2K02A 2A6HF 3FM3A 2EA4A 3V8KA 1J9IA 4OIQF 1UB9A 2QUFA 2VXZA 4IHSA 3QAHA 3M7GA 3FMSA 1A04A 2EJRA 3LFKA 4OIPF 1IUYA 1DP7P 2L54A 2EV0A 3GFJA 1ZLJA 3E5QA 4IVNA 3H92A 5LHGA 3M9AA 3U9GA 2GXGA 2JTVA 2HTJA 2OQRA 2HYFA 3TO7A 2L4AA 4O3MA 2K7LA 5J8CA 4DNCA 4UUVA 1YW8A 1OKRA 2RV8A 3BOQA 3RJPA 1LB2A 4M6XA 4D0PA 2H94A 4MEYF 5CYVA 4AIKA 4GGGA 2C6YA 2IRFG 2CO5A 3C1DA 2EV5A 4A12A 3FXUA 1YW7A 3ZP5A 2EFPA 2QVOA 3P9KA 3ABUA 2VOPA 4L0ZB 2EWNA 2NNYA 1MD0A 4QWQA 3R4KA 1FLIA 3KETA 3GXOA 3BJOA 3EUHA 1RIOH 4AIHA 3ECHA 3C7JA 2MLKA 1P4WA 3JTHA 3U1DA 3KZZA 2HS5A 4B09A 1ZARA 3QP6A 1TQPA 1U5TC 1XSVA 3TKYA 2WTEA 4HLYA 5LHHA 4KN7X 3I64A 3MEXA 5D8LB 1Z91A 4Q48A 2EFOA 1NHAA 2R7DA 3F8CA 3HYIA 3RI4A 2RC4A 4WX9A 1BJAA 2HKOA 1F5TA 1J2XA 5IT9Z 4HQMA 2VT3A 4NB5A 5TRDA 3WE2A 3FZVA 4Z2YA 3LAPA 3WTVC 1T0FA 2ESHA 2A61A 1QPMA 3KP4A 4IHTA 1HW5A 3L00A 3FMRA 1SMTA 2OAZA 5FFXA 5ILVA 1XSDA 4N9HA 3P9CA 3ZMTA 4DQ2A 1I5ZA 5FLXZ 1K79A 3E6MA 1MGTA 2CG4A 2NS0A 2HOEA 1FP1D 2VT2A 3WU1B 3L9FA 1DUXC 4HDUA 3ERED 5DCFA 3MWMA 4IRGA 3CO7C 4L5JA 5CVJA 1ZG5A 2D1HA 4KIBA 2RQPA 3IC7A 2FF4A 2MLGA 2PG4A 2GIVA 3PQJA 3M8FA 5DDGA 1ZRDA 3HHHA 1PP7U 2J5PA 1IZ1A 1YYVA 2HGCA 5ICCA 3B73A 1XN7A 1MZBA 1JGSA 2XKOA 1KQ0A 1D8KA 5J8FA 4ENMA 3B02A 3F8MA 2A6EF 3W6KB 4ON0A 3WTXC 1KU3A 1JXSA 5D4SA 2DQLA 1HW2A 4KUMA 5BQTA 3J7AO 1G3YA 4WF2A 1REPC 3VODA 3KP5A 1ULYA 3GO5A 2LF7A 2HFHA 2BGCA 1G3TA 1ODDA 2CYYA 3H3UA 2H27A 3TO6A 2XAQA 1IAWA 2GA2A 2WC2A 3V7SA 1TQIA 3R61A 3NRVA 4EJTA 1IRGA 2W57A 1QNTA 4CGZA 2EFQA 1L3LA 3BP8A 1H9GA 1FZPB 2MH9A 4R79A 5CVIA 3N97A 2BBYA 3CTAA 2FBHA 4IJAA 2MH2A 2VODA 5D5VB 1SD5A 1LDJA 1C0WA 5A2QZ 2KJCA 3REOA 3HSRA 4GO1A 4CZZA 3F23A 2HWVA 1T6SA 4L0YB 4A5NA 2K4BA 3VFZA 4PZJA 1SD7A 4Q47A 2F5FA 4G8XA 2OA4A 2NYXA 3GUDA 1K78A 4L5IA 4G7ZF 3HRTA 4M73A 1TTYA 1U6GA 5K1YA 2ISYA 2W85A 1XCBA 1HW1A 2ZNZA 3LQQA 1ONVA 2P4WA 2HTSA 2A68F 4MGRA 4HZFA 1S7AA 3MAJA 3Q9SA 4UXNA 5ICEA 1O7FA 2GXBA 1R1TA 3FX3A 3PFIA 5D5XB 3DP7A 4UNOA 4HF1A 3ZMUA 3TGNA 5HS7A 3QRFF 4B8XA 1J75A 2XV4S 1DDNA 3DXJF 4HV6A 2XASA 2QLZA 4OIOF 2V1UA 4YIIA 2COMA 1OMIA 2XIGA 4YFKF 3RIRA 1L0OC 1B9NA 1K78B 3I5UA 4A5MA 5ILSA 2Z9OA 5FB2A 4LGWA 4EM2A 3S2WA 1B4AA 2M8EA 4U7DA 4EM1A 1XMKA 2B0LA 4UV8A 3DQVC 5E1XA 5L3BA 1Z05A 2FMLA 4ZYHA 4NHJA 1IN8A 4Q4ZF 5DD8A 2EB7A 4LLNA 3SXYA 3ABTA 2UWMA 2Q2EA 2DK8A 2IPQX 4HDVA 4YFNF 2P6SA 2A5YB 2KRFA 2QQ9A 3L09A 1FX7A 1JHHA 2QQAA 3T1BA 3F21A 4KFCA 1S8NA 3ULQB 4LLGF 2EFNA 1HSJA 3F8BA 5K5RA 4LG0B 1XDUA 2XGXA 1GXQA 3MFKA 3FMQA 3GWZA 1WQ2A 1S3JA 5HLIA 4G94A 2CWEA 4KN4X 3SZTA 1D8JA 2QZ8A 2L02A 5D8KB 2WV0A 5L3FA 1I6XA 1QO0D 4IF4A 1IN6A 2DLLA 1F9NA 1XGOA 4M9ZA 3K9TA 4HF2A 2MC3A 1WI9A 3FM5A 1B59A 3H3ZA 1S6LA 2DTRA 1ZRFA 4P9UA 1LVAA 1HKQA 3TDZC 1IN7A 3K69A 4HV5A 3GVAA 1YTYA 1V3FA 3E3VA 2BV6A 2RNJA 4LD5A 3DPLC 3GZ6A 3EETA 2XVCA 3MZHA 1WSUA 2BYVE 3JTGA 4YIFA 2XAGA 4MTDA 3I59A 3MZYA 4HBLA 4O6JA 1H9TA 5JHUA 4TV7A 2X0LA 3KEQA 5BPDA 4G6QA 3TOBA 5BOXA 2ZFWA 4RB0A 3WTYC 1ZG3A 4CHUA 2IP2A 2F2EA 2HKXA 3GZ5A 4AVPA 2FXAA 1Z1DA 1HSTA 4ZYEA 2AXLA 4OMYA 2BEOA 3E97A 4OU0A 3F3XA 5DCMA 4WXHA 1P92A 3HSEA 5LLQA 3JSOA 1W5TA 2NNNA 1Z7UA 3I59B 3LQRA 3ZMSA 3JW4A 4RGUA 5F6FA 3COAC 2P7CB 3V4GA 3DEUA 1BI2A 3CUOA 2LF8A 4LFUA 4OIRF 2EV6A 1OYWA 3Q9VA 2QYOA 1UHWA 2L3DA 6PAXA 3KZYA 1D5VA 1EH8A 1GVJA 2Q0OA 4HX8A 2KKOA 3IKVA 3QU3A 3FWEA 1OPCA 5JVTA 4EGZA 3VOEA 1ZYRF 4EV0A 2P5VA 2XHKA 4LB6B 4LMYA 1SFEA 1TNTA 3OOPA 5DCMB 3WTSC 1R23A 1PUEE 4I09A 1TNSA 4RGXA 4AWXB 1LEBA 3JAMK 2XKPA 1IN5A 1IXSB 5LRRA 4GYGA 2OBPA 5LGTA 3CDHA 3GW2A 2FMYA 2GWRA 2DI3A 3QP5A 1W7PD 2V1XA 2JRTA 3TOAA 2VBXA 1J0RA 1T98A 1XB4A 3Q5FA 1O3RA 1T39A 4MQVA 4M9SA 4HX7A 4LB5A 2FA5A 4M74A 2K86A 3K1MA 1SMYF 2L01A 1I1GA 1D3YA 2YX7A 5L3CA 2RDPA 5F64A 4KIGA 1ZREA 2UXNA 1BI0A 2YSRA 1IN4A 5D6FA 1Z6RA 2Z33A 2PBIA 5CVUA 2OU2A 3BROA 1CF7A 2HR3A 3T0YA 2IVMA 4FX0A 4UVBA 1ZGAA 1BIBA 2M87A 3FXQA 3CUQA 1QGPA 1FOKA 2STTA 4WWCA 4HA8A 4CXFA 2ACJA 5FD6A 2CQKA 2GZWA 2IA0A 4ZYDA 3QPTA 2XRNA 4MQ9F 1LDKB 2O8XA 5K5OA 3QU6A 5D6EA 2VBWA 1BOAA 2JZYA 1OYYA 1CF7B 1QZYA 2QQBA 3HOTA 1YO5C 1XD7A 2DPUA 5HDGA 1SFXA 1J7KA 1IW7F 1LJ9A 1J5YA 3E6BA 5HS8A 3E5XA 3CUQB 4MEXF 2W25A 4BH9A 2OZUA 3E6DA 3ZMZA 2L4MA 1FP2A 3K0LA 4OMZA 5DUKA 1H0MA 4RS8A 5H20A 2E1CA 2MBFA 2VE8A 4ASNA 2RGVA 2UXXA 1FYMA 4BHBA 4KMUX 1USSA 4KDPA 4BXUA 1SAXA 3G3ZA 2DO7A 4RAYA 1O3TA 2ZKZA 2Q8KA 2ISZA 1R1UA 3C3WA 3KFWX 1ZRCA 3HUGA 2XAJA 2FEZA 4G9YA 2FOKA 5HDNA 3WTTC 1O57A 3RPQA 2HZTA 3EYYA 3IWZA 4A0YA 2VBYA 1T2KA 1KU7A 1KQ8A 2EK5A 1FWZA 2QWWA 3IRQA 2W84A 4O5VA 2OD5A 2CSOA 4A0XA 1G3SA 5LGUA 3K2ZA 3PQKA 1XCVA 5BS6A 2MA3A 4UV9A 4QLCU 1MDMB 1MJAA 4Y15A 4RB1A 1YQAA 3P7NA 4EJOA 2M5WA 3LA7A 3FHZA 2Y48A 1YG2A 2RKHA 5HLHA 3TO9A 1R1VA 1WWXA 5E8GA 2XROA 2ZMEB 2P6TA 5DEQA 2V9VA 4MTEA 2HQNA 3N4MA 1R22A 3R6SA 3HHGA 2XAHA 3EDPA 2GAUA 2QM3A 3DF8A 4KIFA 2QENA 4OINF 2HQRA 5ED4A 5EEHA 2VE9A 4XLNF 1HKTA 2FQ3A 3LWFA 1ON2A 1U78A 1YFHA 5DYMA 1TQMA 4LK1F 3ZPLA 3HOSA 2KIMA 5HVQC 4XRFA 2NRAC 3ISPA 1ZLKA 3O2PE 1Y0UA 4EGYA 1EH7A 2ZNYA 4PCQA 2FU4A 1BN5A 2R7FA 3HSFA 1XDSA 3IWFA 3IKTA 3NQOA 4M72A 5AONA 5BMZA 4LG0A 3QOPA 4GXOA 1W7PA 1ZG1A 1HKSA 2P8TA 5E20A 3T5XA 3ZMVA 2CW0F 5ICGA 2PJPA 4RGRA 1R58A 1EV7A 1FPQA 1ZAOA 4HLXA 2YR2A 3HTSB 1XSXA 4M6YA 2PMHA 5JR3A 1U8RA 1IXCA 2ZBKA 3CO6C 2PI0A 3M1EA 3BZ6A 3HIFA 1PDNC 1YS6A 1GXPA 2FE3A 2PMUA 2IA2A 1HQCA 1LEAA 4KT5C 3V8LA 4IRIA 3WGGA 3AAFA 1W7PB 1ZGJA 2YPRA 3KLNA 4ZZLA 1IF1A 2O61A 2STWA 1KQ9A 1T38A 2IW5A 3GYHX 3RKYA 2ELHA 3SQNA 4IPAA 1STZA 2DBBA 2E1NA 4WK8F 4RGSA 4Y13A 3DKWA 3OV8A 5F1RA 1FC3A 1BM9A 2KJBA 4HYEA 2VN2A 1K7AA 5FGMA 3KP3A 3LA3A 4L9VA 1PP8F 3C18A 4EM0B 1Q1HA 3T8TA 2G9WA 5KVRA 3GX4X 3F6OA 3KCCA 5JI6A 4CYDA 3T8RA 3DPTA 1RI7A 4S04A 4BNCA 3I58A 2ADUA 1K6OA 2VC0A 2VOOA 3WTUC 2F5DA 1O3SA 3E5UA 5L3DA 3F22A 4ESBA 2X4HA 5AIPA 4OOIA 1RZ4A 3I0TA 3SFZA 1VTNC 4XBFA 2K4JA 4BYYA 1FYLA 3BPVA 2P7VB 1XGSA 4GCVA 2DK5A 3NEUA 3I4PA 1OYIA 3ZN0A 4L9NA 5ERIA 1YS7A 2LSOA 2ESNA 2ZJ2A 2VBZA 1MKMA 2D45A 3V7RA 1MJBA 2A3SA 1P4XA 2AS5F 5JFRA 2PLYA 1FSEA 4N9IA 1FBQA 1IXRC 1R00A 2RVCA 3BDDA 1UCRA 3GFMA 5IT3A 4Q5SF 1F4KA 1FT9A 2FBKA 4HAMA 3KP2A 2HYGD 2M30A 5E1WA 3IRRA 2V1DA 3ZN1A 3BPXA 5LGNA 1WRJA 1MJ9A 4XSZF 5LRSA 3ZMDA 1R7JA 5E8IA 1YLFA 1DPRA 2FNPA 4EQQA 3CUQC 4LJZF 3F8FA 4I2OA 4CICA 2PN6A 2IJLA 4I01A 4FX4A 5FO5A 1U2WA 2W24A 1B9MA 3WE3A 1E17A 4I0BA 5E17F 5E1ZB 3O3KA 3RPUA 3IL2A 4IRHA 5IT9K 2PFBA 1O7LA 4U0YA 4JBAA 4ENNA 4KMFA 2OZ6A 4I02A 1TW3A 4U7BA 4S05A 4LLLA 4R8HA 1BI1A 1USTA 4G7OF 2KIFA 4ZZDA 2VONA 1RUNA 4UVAA 1FSHA 5FLXK 2ETHA 2D2WA 5D5UB 4IXAA 5HLGA 1W5SA 4BHPA 2ZO4A 5DUIA 2E7WA 1XGNA 4ESFA 3JAMZ 5ILUA 4G7HF 1KYZA 4AIJA 5LEKA 1KU9A 3WTZA 3E6CC 1TW2A 3J81K 3I54A 3RKWA 4XLPF 4GYIA 3RYPA 1TLHB 1QZZA 1P2FA 2D1VA 1S29A 2LDUA 4M71A 2FNAA 2M45A 1YIOA 4PDKA 1R36A 3KP7A 4UHTA 3KEOA 1Z6TA 2V79A 4N0BA 4FT8A 2K27A 3QPHA 2O6GE 1ON1A 3WODF 4ZH4F 4YG2F 2F5CA 3O6BB 1G3WA 3EYIA 3VB2A 5FFZA 4UVCA 1LQ1A 4KICA 3BWGA 5K5QA 4EJUA 4ENJA 2BE5F 5DV5A 1I1SA 1U3EM 3WTWC 1ZHFA 3RDIA 1RNLA 2EFWA 4CO8A 4M9XA 2H09A 3F8NA 1FYKA 2OQGA 2Z5UA 5H6QA 3ROUA 3BJ6A 3J81Z 5D4RA 1U5TA 2KIUA 2J5OA 1BIAA 2JPCA 1UHMA 4YFXF 4NQWA 1FBUA 4KNYA 3HRMA 3I71A 3G73A 2DFIA 2FBIA 5E18F 3DFGA 1QBJA 3BJAA 4HW0A 1I27A 2LNBA 1SD4A 3BY6A 1MDMA 2LKPA 2MD5A 1JE8A 3ELKA 5A2QK 4CDGA 2A69F 2TDXA 5FD5A 1AOYA 3KLOA 4A2UA 4K2EA 4G6DA 4ZYGA 3JSPA 2UZKA 3ECOA 4I7HA 2ZMEA 4EMSA 1R5HA 1U5TB 1WKMA 3HTUA 1FNNA 1TBXA 2DAOA 1AWCA 5J6XA 1BC8C 5HS9A 3FF5A 1FBSA 1FY7A 4Y17A 1QQIA 1DPUA 3R60A 3GLXA 4P96A 1BBYA 3M8EA 3WGIA 1HXDA 2GQQA 5LEJA 1CGPA 1YW9A 2O3FA 1EH6A 2DQRA 3W6JB 4KYWA 1SFUA 4WXDA 3WGHA 1XMAA 4ESJA 4H0EA 2V6CA 1BC7C 2JSCA 3R0AA 1JHFA 3KE2A 1LDDA 3L2CA 2PEXA 4A0ZA 3J80K 3R0JA 5LHIA 2QBYA 3P9IA 2ZXJA 4KA4A 2E7XA 3KP6A 2VC1A 5CJ9A 2GA1A 4RB3C 4BHCA 4JK1X 3D0SA 1LNWA 3TQNA 2G7HA 3GFIA 1B1BA 4EJVA 3HRUA 5EEGA 4EJWA 1W4MA 5HDKA 2WWYA 1Z9CA
chains in the Genus database with same CATH superfamily
2DPDA 3BR6A 2ELKA 1G6NA 3OYBA 2NS8A 5ICFA 2YX4A 3RKXA 4P5OA 2WBMA 1KYWA 2JSPA 5CLSA 2GLOA 3EQLF 3FXJA 4MNUA 1IC8A 1KA8A 1VQ5I 3DV8A 4MHGA 1OR7A 3HRSA 2CQNA 1EKEA 2H6CA 1KGSA 5C3EJ 1NTCA 2ZXWH 1X3UA 1WJEA 5D5WB 5DM7F 1WJ5A 2QBYB 4JQFA 2O0YA 2X1DA 1ACIA 2IGMA 3K1NA 4YIRX 1TZLA 5KK1A 2DU9A 2VPLA 2HEOA 4L9TA 2Z99A 1RUOA 2M1BA 1ETYA 1XG1A 2Y0MA 1BI3A 4JYKA 3SZPA 2ZFUA 1R4MB 2IA1A 2WY8Q 4P55A 2NAZA 2R3SA 1E2XA 1TWGJ 3J80Z 1JTYA 2W1OA 2CFXA 1IDZA 2VL8A 1Y0NA 3CJNA 4A6EA 2LRDA 4WCGA 2YU3A 2HQAA 1P6RA 3CLOA 1XC5A 3CCMI 2JA7J 2G0EA 1O3QA 5F0HA 3ZQ7A 3HOZJ 3ZQCA 3AL0C 1S7OA 3F72A 4XKBA 3RTRA 3SHFA 2P5KA 4HOBA 4N4NB 3TDUC 2HDCA 4A6DA 5BPIA 2ICWG 2F5EA 1LFBA 1ZN2A 2FD5A 5IYCJ 3FDYA 4R1HA 3MCZA 3W3CA 1F1ZA 2G7UA 5EGOA 4E7LA 1ETKA 4L18B 1IRFA 1Y6IA 1JKOC 3G1LA 4U88A 3VPRA 2H6BA 3QYBA 2IT0A 3GFLA 3DKXA 1TWFJ 3CCQI 4L9JA 2Z3YA 1J59A 2KRCA 2L9NA 1K4SA 3JCUC 2ZCWA 4LK0F 1BL0A 4XKWA 1X3WB 2H1LA 4IZZA 5CVRA 1G59A 4FHTA 1MNMC 2Y9YA 3A01A 1UFMA 4E70A 4RB2C 2JPBA 2XAFA 3L7WA 3V7CA 2Y9ZA 4CCMA 2PQ8A 3MQ0A 1V4RA 3WU0A 2DT6A 2PMZN 2COBA 3CD6I 3KZIC 4WXCA 2P5LC 5HLTA 2O03A 1MBJA 3BR5A 4P9FA 1KU2A 3VYSB 3FXRA 3M07A 3OIPA 3I53A 2K9SA 2KFDA 2GOMA 4MFEA 4HQEA 4YELA 4I98B 5EGOB 4ENKA 1NK3P 4U0WA 2Q2EB 1MBEA 2DA2A 4BAYA 4EVIA 1P4AA 2DT5A 3U2RA 1B72A 4F7ZA 3OYFA 2VUMJ 4PGGA 2CGPA 2ZSHB 2DW4A 4HX4A 1VQKI 1TWAJ 2EH3A 3PSFA 3PO2J 3RYRA 3CP8A 1G4DA 2KLOA 2XUBA 3V8JA 4U0VA 3IHUA 1SD6A 4V2GA 4ETSA 4A69C 1HCRA 3DBLB 4I0AA 1R5GA 2Y30A 5TJJA 2Y75A 2EA2A 1AHDP 2HPIA 1R4NB 3LA2A 1X1BA 2FSWA 5CVVA 2YUSA 2B63J 4XSXF 5EG0A 3F6VA 5KCMA 5DD4A 3OYHA 3A01B 5HOOA 3D5LA 3S16J 2RN7A 1QZEA 1JKRC 3ZXSA 2JA2A 3HB9A 4EATA 3K2AA 3K1PA 4CYCA 2QEXI 2FRHA 3WG9A 3GEZA 5L3EA 5FKOA 5AIQA 3VEPA 4RAZA 4AD9A 2IGOA 1YITI 4HF0A 3BTLA 3GF2A 1R9TJ 5GTHC 5KAIC 5H6RA 4ANJA 1HBXG 5IP7J 5L3GA 1ZH5A 2WB1A 3LAJA 2DA7A 3VDXA 1B6AA 2L9RA 4C2UA 3RZOJ 1XGMA 2KZVA 3LSTA 4BQAA 2A07F 1G8XA 4XICA 2LVSA 3ML6A 4PGHA 4BEHA 5LBQA 2ID6A 2JT1A 4E6KG 1APLC 1GHCA 2K02A 2A6HF 3FM3A 2V4JC 2EA4A 3V8KA 1J9IA 4OIQF 3QPLA 1UB9A 5IYDJ 2QUFA 3SEQA 3OYCA 2BW3A 1HDPA 1JTXA 2VXZA 4IHSA 2VASA 3QAHA 1RC9A 2AXTC 4M3EA 1FOYA 3S15J 2ZSIB 2O9LA 2FQ4A 5EZHA 3M7GA 1X2NA 3FMSA 4BXXJ 1YX3A 1A04A 2DYRH 1LKXA 3S1NJ 2EJRA 3LFKA 4OIPF 5IP6A 1IUYA 2ZJPF 1RESA 1DP7P 2L54A 2EV0A 3GFJA 2VJJA 5FKLA 1ZLJA 3RSNA 3SEZA 3JRCA 3W2VA 4BE0A 3Q0WA 3OYDA 3SYTA 3E5QA 4IVNA 2I8DA 3H92A 5LHGA 3M9AA 3U9GA 1I3QJ 1I6HJ 5FKNA 2VIXA 2GXGA 3BT9A 2JTVA 1D1CA 1ZK8A 3CJTB 2HTJA 4JP0A 2OQRA 5IP9J 2HYFA 3TO7A 2L4AA 4O3MA 3K4CA 2W00A 2K7LA 5J8CA 1VQNI 2WB1N 4DNCA 3LSHA 4UUVA 2M3AA 2BW3B 1YW8A 1OKRA 1X1PA 5F04A 1S72I 2RV8A 3BOQA 4EEFG 4A3GJ 3RJPA 1WZ2A 1LB2A 4M6XA 2E2HJ 4D0PA 4NC7A 2H94A 4MEYF 3BLYA 3ZQFA 1VQ4I 2OF7A 5CYVA 2V9KA 3GLLA 3GZNB 4A3CJ 1A36A 3J7ZI 1I39A 4AIKA 3S1RJ 2HOAA 1QHGA 2KIQA 3EUAA 4GGGA 3MMYB 2C6YA 2IRFG 2CO5A 3C1DA 2KP6A 1MBFA 2EV5A 4CSWA 4A12A 3BCBA 3FXUA 5KAFC 2CQQA 4F92B 3DWLE 5IOZA 1YW7A 5FROA 2EFPA 3ZP5A 2QVOA 3C2BA 1DGWY 4ITVA 3P9KA 3ABUA 3BG7A 1VQ8I 2OTLI 2VOPA 3PL8A 5E3LA 4FASD 3CC7I 4L0ZB 4XOTA 2EWNA 3IV5A 3AG2H 4ZTFA 2NNYA 1MD0A 4QWQA 2B7EA 3R4KA 1FLIA 4S0HB 3KETA 4A3DJ 3GXOA 3M1CA 4L5EA 3BJOA 3EUHA 1RIOH 5J4VA 2W48A 4AIHA 3ECHA 3HOYJ 3C7JA 2MLKA 1BJZA 1P4WA 3JTHA 1D5YA 3U1DA 2L5QA 3RCOA 3KZZA 1Y8QB 2HS5A 2HXOA 3GBGA 3MD2A 4B09A 2MC4A 4XLEA 1N25A 1ZARA 2M4GA 3H35A 5CQGA 1WH5A 3QP6A 2VQLA 3BG5A 1MBGA 1TQPA 1U5TC 1XSVA 3BG9A 3TKYA 3OSGA 2WTEA 5LHHA 4KN7X 4HLYA 2XB0X 3I64A 3MEXA 1S7EA 5D8LB 4NC6A 1UJ8A 2DMUA 1Z91A 4XONA 4QSHA 3OYLA 4Q48A 4PFOA 4PUSA 4F55A 2EFOA 1NHAA 3S8PA 4PJJA 2R7DA 3F8CA 3HYIA 3E1SA 2RC4A 3SFIA 3G71I 3RI4A 4P1WA 5JLXA 4WX9A 1BJAA 3UR3C 2H1KA 4UUSA 1E3HA 2HKOA 1F5TA 1J2XA 5IT9Z 4J19A 4HQMA 4MLOA 3TP3A 2VT3A 4NB5A 5TRDA 1EJ9A 3WE2A 1RPWA 3FZVA 4Z2YA 3S32A 2XSDC 2XPUA 5TISC 2M0CA 3A0HC 3LAPA 3WTVC 1T0FA 2ESHA 3LMMA 1JI8A 2A61A 3E7LA 3GTJJ 2XB5A 1QPMA 1J09A 3KP4A 4IHTA 1HW5A 3L00A 3FMRA 3AG4H 1MBKA 1SMTA 1HC8A 2OAZA 5FFXA 2OV7A 4IQ4A 5ILVA 2RNGA 4B3XA 1XSDA 1Z21A 1OCPA 4N9HA 3PO3J 2CH0A 3P9CA 3WHCA 3ZMTA 4DJAA 4DQ2A 1I5ZA 5FLXZ 4B3AA 1FMVA 3I9V2 4IEJA 2V7FA 4V19K 4AYBA 3DU5A 1K79A 3QQAA 3E6MA 1MGTA 2CG4A 2NS0A 1X1DA 3D5SC 2HOEA 2EZHA 4A3KJ 1FP1D 2VT2A 3WU1B 4BY7J 2MABA 3L9FA 1DUXC 5FLVA 1TP4A 2JN6A 4HDUA 3ERED 3OL4A 1E3OC 5DCFA 2EBIA 3MWMA 4IRGA 5GAHJ 3CO7C 3HJEA 2R0QC 4XMYA 1EA3A 4L5JA 5CVJA 1ZG5A 2D1HA 1K61A 4KIBA 2RQPA 2A05A 3L2QA 3IC7A 2FF4A 2DA5A 1IRXA 2MLGA 4QPOA 3JRGA 1R49A 3MN2A 2PG4A 1TWCJ 2GIVA 3PQJA 3M8FA 5DDGA 1ZRDA 2HYJA 1JJ6C 3HHHA 1PP7U 3I56I 4E7JA 2J5PA 1IZ1A 1YYVA 2HGCA 2VKDA 3HG9A 3K4MA 5ICCA 4UB8C 3TMOA 1V5GA 3B73A 1XN7A 3F0CA 1MZBA 1JGSA 2XKOA 1KQ0A 3GTGJ 1DU6A 1D8KA 5J8FA 5IYBJ 4ENMA 1D0YA 3B02A 3F8MA 2A6EF 3W6KB 4XOPA 4ON0A 3WTXC 3PUFA 1KU3A 1JXSA 1YE9A 1Z3YA 3K70D 5D4SA 2DQLA 1HW2A 4KUMA 2E1OA 5BQTA 3J7AO 1G3YA 4IKFA 2M7BA 1FJLA 1YJWI 4WF2A 2M4KA 1QPIA 1REPC 3VODA 1ITYA 5BNGA 4LIUA 1FIPA 5J47A 3KP5A 1ULYA 1WJFA 3GO5A 2LF7A 2HFHA 2BGCA 1G3TA 1ODDA 2CYYA 3H3UA 2H27A 2DDAA 3PNYA 2W4SA 3TO6A 2XAQA 5GADJ 2YS9A 1IAWA 2DA3A 4IHVA 4W1UA 1YHQI 2GA2A 2JQ7A 2WC2A 3V7SA 1TQIA 3R61A 3NRVA 4FISA 4CCLA 4EJTA 3GTPJ 1IRGA 4Y7NJ 3OR1C 2W57A 1QNTA 1OR7C 3TEDA 1ZR2A 3S1QJ 1T8IA 3U21A 4CGZA 2EFQA 1L3LA 4KITB 3BP8A 3HDDA 1H9GA 1MBHA 3BTIA 1FZPB 1YRNA 2LKXA 1LPQA 2MH9A 4ZTJA 2DOAA 4N4OB 1E0EA 4ZDPA 3K4KA 5B5EC 4R79A 3HOUJ 5CVIA 3N97A 3K7AJ 2BBYA 3CTAA 4NDLA 5J1YA 5K7FA 2FBHA 1Z3XA 1O4XA 4IJAA 2MH2A 3H36A 5J1UA 2VODA 5D5VB 2KT0A 3L2RA 1SD5A 2DN0A 1LDJA 2R92J 1C0WA 5A2QZ 2KJCA 2XF6A 4XM3A 5FJ8J 3REOA 4XNFA 3HSRA 4GO1A 4CZZA 5E3MA 3F23A 2HWVA 1T6SA 3L2WA 4A5NA 2M2EA 4L0YB 1R5ID 1X1AA 2K4BA 3UNGC 2OCEA 4BDYA 3VFZA 4PZJA 1OJLA 1SD7A 4Q47A 2F5FA 1T33A 4G8XA 2OA4A 2NYXA 4I6ZA 3GUDA 3RZDJ 2V6EA 4M3DA 2VJ4A 1SANA 3P5JA 1K78A 1UELB 1MIJA 4L5IA 3Q3SA 4G7ZF 3HRTA 4M73A 4BXFA 1TTYA 1U0JA 2MFZA 1U6GA 1YRNB 5K1YA 2ISYA 2W85A 1XCBA 2GBYA 3FK7A 3FIWA 3CMEI 1HW1A 1DP3A 2ZXIA 2F4OB 2ZNZA 3LQQA 3CP2A 1PVEA 1ONVA 1D1BA 2HTSA 2P4WA 2W82A 1KZHA 2A68F 2DYSH 4MGRA 3GTOJ 4HZFA 2LREA 1S7AA 2ME0A 3MAJA 3LSGA 3Q9SA 4UXNA 2BY0A 5ICEA 1O7FA 1WI3A 2AQFA 2CUZA 4PFPA 2GXBA 1R1TA 3FX3A 3KYLA 5IOYA 3PFIA 5D5XB 3DP7A 2R5YA 3DEWA 4UNOA 4HF1A 2L7KA 3ZMUA 3TGNA 5HS7A 3FK6A 4LG3A 4JX4A 2Q1ZB 5B66C 3QRFF 4B8XA 1J75A 3HM5A 2XV4S 3AG1H 2DTZA 2X85A 1DDNA 3DXJF 4HEA2 4XRSA 2K40A 2DMNA 1B8IB 4HV6A 2XASA 2QLZA 4E7SA 4OIOF 3G2BA 2V1UA 4YIIA 1BA5A 2COMA 3ONQA 4HG2A 3KX2A 1OMIA 3OYIA 2XIGA 1ZQ3P 4YFKF 3RIRA 1L0OC 2QQ8A 1B9NA 3C2HA 1K78B 1AU7A 3I5UA 4A5MA 2CMPA 5ILSA 2DFHA 2Z9OA 2L7ZA 5FB2A 1ETVA 3FXOA 4LGWA 2CU7A 4EM2A 3S2WA 1JJ8C 4IOAF 3DKYA 5HNFA 1B4AA 2M8EA 4U7DA 4EM1A 1SAUA 1WJDA 4D5FA 1FOXA 1XMKA 4YEJA 2GXAA 2B0LA 4UV8A 3DQVC 2QSHX 5E1XA 5L3BA 1JUMA 1Z05A 2FMLA 4ZYHA 4NHJA 1IN8A 2MG4A 4Q4ZF 3N05A 4C9YA 5DD8A 2EB7A 1FMWA 4PSXA 4LLNA 2R5YB 3SXYA 3ABTA 4OAZA 2HU9A 4MO7A 1V5EA 2UWMA 1YOVB 1FIAA 2Q2EA 2MD0A 2DK8A 2IPQX 3A02A 4HDVA 1WPKA 4YFNF 2P6SA 1ETXA 3HBLA 3K4NA 2A5YB 2EIKH 2R7ZJ 2IS2A 3Q0VA 4XKVA 5M5WJ 4Y4RA 2IS6A 2KRFA 2R5ZB 2QQ9A 3L09A 1FX7A 1JHHA 3ZQIA 2QQAA 3T1BA 2DMTA 3VSLA 3BG6A 1T95A 3F21A 4KFCA 3PM1A 2XC7A 2E36A 1S8NA 3ULQB 4LLGF 2EFNA 1HSJA 3F8BA 5K5RA 4LG0B 1XDUA 3BQYA 2XGXA 1GXQA 3MFKA 5K7HA 2ZJQF 4RM3A 2I10A 2NS7A 4PJ0C 3FMQA 3GWZA 4DBQA 1P7JA 1WQ2A 2BY3A 1S3JA 5TGTA 2NXNB 2BZTA 5HLIA 1K83J 4G94A 5B1AH 2QSFX 2LY9A 2CWEA 4KN4X 3SZTA 1D8JA 2QZ8A 2L02A 1ORKA 5D8KB 2KMUA 2WV0A 5L3FA 1I6XA 1QO0D 1U8BA 3W6VA 4IF4A 1VI0A 1IN6A 2DLLA 4I99C 3HOXJ 2LD5A 1N77A 4GDFA 2JWTA 4IHWA 1F9NA 1XX5A 4PSWA 4BE1A 2F5VA 1IJWC 1XGOA 4XLFA 3IAS2 4M9ZA 4C30A 3K9TA 4IQJA 1YI2I 4HF2A 2K85A 2MC3A 5FKMA 2L7MP 3BTJA 1PUFB 1WI9A 3FM5A 2Z1DA 1B59A 3H3ZA 3L2UA 1GLNA 3KPHA 1S6LA 1TT5B 2DTRA 1BR4A 1OQYA 3Q0UA 1ZRFA 4P9UA 1LVAA 1HKQA 3TDZC 1YJNI 1IN7A 3K69A 2BXZA 4H4KC 4E7KA 4HV5A 3GVAA 1YTYA 1V3FA 3E3VA 2BV6A 2RNJA 4LD5A 3DPLC 3GZ6A 3EETA 2XVCA 3MZHA 1WSUA 2BYVE 3JTGA 4YIFA 2XAGA 4RMNA 4MTDA 5F27A 1WCMJ 2F4IA 3OYMA 1TWHJ 3I59A 3MZYA 4HBLA 2D5VA 4O6JA 1H9TA 4HRIA 4D5CA 5JHUA 2CQ7A 1GUUA 2JUCA 1Y56A 3S2HJ 4CH7A 4TV7A 1QHHD 1PJRA 2X0LA 3KEQA 1X1CA 5BPDA 3W2AA 3AFHA 2NVTJ 4A3LJ 4G6QA 3TOBA 1IUFA 1Z77A 1NK2P 5BOXA 5DM6F 2ZFWA 3QPSA 4BKXA 2DA1A 2VJIA 4RB0A 4BGDA 3FXMA 2HDWA 3WTYC 1ZG3A 3CJQB 1HDDC 2HOTA 4CHUA 1RKTA 2IP2A 2F2EA 2HKXA 3GZ5A 2XRLA 2EIMH 4AVPA 2FXAA 4HNTA 1Z1DA 4JX6A 2KL4A 1A6QA 1HSTA 2AXLA 4ZYEA 4OMYA 1ERDA 3GTMJ 3SZGA 4I76A 2BEOA 3E97A 2Y0SA 4OU0A 1P7IA 1S9HA 2F6CA 4BUPA 4E7HA 3F3XA 5DCMA 4WXHA 4HNVA 1P92A 3HSEA 5LLQA 3JSOA 1W5TA 2NNNA 2OTJI 2VPRA 3L2VA 1Z7UA 3I59B 3LQRA 5C4XJ 3SJMA 3EUHC 3ZMSA 2K9MA 3JW4A 4RGUA 5F6FA 4ABZA 3COAC 1VZ0A 3V4GA 3DEUA 3HXLA 2P7CB 4GRIA 2Z16A 3DEEA 1BI2A 3D1NI 3HGGA 1W36C 3BQZA 3CUOA 3HEFA 4MFDA 3CCRI 2LF8A 3IUOA 4LFUA 4OIRF 2DFFA 2EV6A 2LMDA 3HL2A 4DGWB 1OYWA 3Q9VA 2IXSA 2QYOA 3CMAI 1UHWA 2L3DA 6PAXA 3BTCA 3KZYA 4NUBA 1XS9A 2M0MA 1EH8A 1D5VA 1GVJA 2Q0OA 4HX8A 2HQ5A 2KKOA 3IKVA 3QU3A 1VQOI 1VFCA 3FWEA 1OPCA 5JVTA 4EGZA 2CFOA 4BY1J 4B47A 4C3IJ 4RM2A 1K6YA 3JRHA 2K9LA 3VOEA 1ZYRF 4EV0A 2P5VA 2XHKA 4LITA 4LB6B 4II3A 4LMYA 3AG3H 3SDGA 1SFEA 3JREA 3K4BA 2WV1A 1FTTA 1TNTA 2DA6A 3OOPA 2PJRB 4BJ5C 5DCMB 3WTSC 1R23A 3ERMA 5F0CA 1PUEE 4BQQA 4I09A 1TNSA 3CCSI 4RGXA 4DIQA 2H8WA 3H5NA 4B4CA 4AWXB 4HPQA 1LEBA 3JAMK 1T08B 2XKPA 1IN5A 1IXSB 1T0FC 2CRGA 4GYGA 5LRRA 4F52A 2OBPA 5LGTA 4DZPA 3CDHA 3H3VK 3K6GA 3GW2A 2Y0SN 2FMYA 3BCAA 2GWRA 3A2KA 2GOXB 3CCJI 2DI3A 3HKZA 1N75A 3QP5A 3ASOH 1W7PD 2V1XA 2LR8A 2K3PA 2JRTA 3TOAA 3ZCOA 2VBXA 1J0RA 1T98A 1XB4A 3Q5FA 2FUG2 1O3RA 2DOEA 1T39A 2VJ5A 5M3MJ 3OIOA 4Y33A 4MQVA 4M9SA 5KNLA 4HX7A 4LB5A 1VF9A 3BR0A 2FA5A 3B6CA 3IH2A 4M74A 4XK4A 5E3OA 5FRMA 2K86A 4AM3A 3GMEA 2O7OA 3PIOF 2PX9A 4A3FJ 1WH7A 3BZCA 2X51A 3K1MA 1SMYF 2L01A 3DTEA 5GPCA 2VQHA 1IG7A 1I1GA 1D3YA 2YX7A 2P0WA 5L3CA 4XQFA 2RDPA 5F64A 1A5JA 4Y3OA 5GAEJ 4KIGA 1ZREA 2P81A 2R93J 3FKJA 2UXNA 2XPVA 5F08A 1BI0A 2YSRA 3K4JA 4ZDOA 1IN4A 1UHSA 2DMPA 3G4SI 5D6FA 3LSPA 1Z6RA 1PYVA 4C3JJ 2Z33A 2PBIA 2R7RA 1MW7A 2DODA 1BOBA 5CVUA 2RREA 4AU7A 2OU2A 3BROA 2LG4A 4RLQA 1DQUA 5JLWA 1CF7A 1MSFC 2HR3A 3T0YA 2IVMA 3CMMA 3PSIA 4FX0A 3H0DA 2EPFA 4UVBA 2CV0A 1ZGAA 2A6TA 3DBHB 1X2MA 1BIBA 3W2WA 2M87A 2DMQA 1H88C 4Y52J 2KDZA 3IH3A 2LFBA 4UY8I 3FXQA 1WJBA 4BACA 3CUQA 1QGPA 4CCJA 1FOKA 5F0FA 2STTA 2DJNA 2JUGA 1AKHA 4WWCA 3ABKH 3CLQA 4HA8A 4CXFA 2ACJA 5FD6A 2CQKA 2HVSA 4BQOA 2GZWA 2IA0A 4ZYDA 2IAIA 4J00A 3QPTA 2XRNA 1HOMA 4MQ9F 1LDKB 2IBDA 2IGNA 2O8XA 2VKEA 5K5OA 3QU6A 1D1AA 1TT0A 3OYNA 4XRMA 3MKZA 3UKGA 1MMNA 1VNDA 5JHFA 3S17J 4HSTA 5D6EA 2VBWA 4XLAA 4AVZA 4KISA 1BOAA 3JR9A 2JZYA 3TW7A 1OYYA 2OUMA 1CF7B 2NVUB 1MNEA 3BR1A 1WJCA 1QZYA 2NVYJ 2QQBA 1NH3A 1MMSA 1A6IA 3HOTA 4C2TA 1YO5C 5HODA 1XD7A 3QYEA 2DPUA 4HNUA 4BJTA 5HDGA 3U1KA 4XRSG 1SFXA 4UB6C 1J7KA 1LVKA 1IW7F 1FOWA 4RBOA 1LJ9A 3LSKA 1J5YA 2K9QA 3E6BA 1V55H 5HS8A 3E5XA 2LY1A 3CUQB 3DTKA 4MEXF 2W25A 3OR2C 4BH9A 2E34A 1AKHB 3GTQJ 2OZUA 3E6DA 3CC2I 3ZMZA 2L4MA 3M8JA 2BY1A 1FP2A 3K0LA 5LD2C 4OMZA 5DUKA 1K4TA 1H0MA 2LH9A 4RS8A 2EZIA 5H20A 2E1CA 2MBFA 2VE8A 2X1CA 3CF2A 4II2A 4ASNA 3OYKA 2RGVA 2UXXA 2X6WA 2XPWA 1FYMA 4E7ZA 1W1WE 4BHBA 1OCZH 4B43A 2Y31A 2R7UA 4KMUX 2QCOA 1USSA 4NBQA 4KDPA 4BXUA 3IAM2 1SAXA 4RAGA 3A1YA 2HNHA 3G3ZA 2DO7A 3TBIA 3PFYA 4RAYA 1O3TA 2MW8A 4BBRJ 1VQ6I 2ZKZA 2Q8KA 2ISZA 4Z6YA 2E1MB 2R7TA 1R1UA 3S1MJ 4AYBN 3C3WA 3PNVA 3KFWX 1ZRCA 2KPMA 3HUGA 3LOCA 2XAJA 2FEZA 3OL3A 4G9YA 2JA6J 2FOKA 5HDNA 3WTTC 3JRAA 1O57A 1MMGA 3CJRB 3RPQA 4A3JJ 3CDIA 4QTRA 2ELJA 3CCEI 2HZTA 3EYYA 1WGXA 3GCMA 3OYGA 5EYRA 1OCOH 3IWZA 4A0YA 2QA4I 2VBYA 4C2MJ 1T2KA 2RQQA 5B3SH 1KU7A 4X6AJ 1IO2A 2EK5A 1KQ8A 4NQWB 4XN3A 2OC6A 1OCTC 1FWZA 2QWWA 3FISA 4LOCA 3H1CA 4M3BA 3IRQA 2W84A 4O5VA 2OD5A 1EF4A 2CSOA 4A0XA 1UZCA 1G3SA 5LGUA 3K2ZA 3PQKA 4V2FA 1XCVA 1IGNA 1R71A 4RDUA 5BS6A 2MA3A 2F48A 4UV9A 4QLCU 2LTPA 1MDMB 3JRFA 1MJAA 1QU3A 2M9HA 2OJED 2Z2SB 3HUGB 1MH4A 4Y15A 1IRZA 5KHDA 5EJCA 2DFEA 1UAAA 2LYCA 4RB1A 1YQAA 3P7NA 4EJOA 2M5WA 4XORA 3LA7A 2Y69H 3FHZA 2Y48A 1BW6A 1YG2A 5GP9A 3RPUD 2RKHA 3ZOBA 5HLHA 2JK3A 3MVPA 3TO9A 1R1VA 1WWXA 1X3ZB 2JVHA 5E8GA 1UG2A 2XROA 1B8IA 2ZMEB 4IHXA 5LFAA 2P6TA 5DEQA 1F43A 2V9VA 4MTEA 2ZB9A 2HQNA 3N4MA 4RA2A 2LBFA 1R22A 2XSJC 3R6SA 2VKHA 1D0ZA 3HHGA 2XAHA 3EDPA 1U9NA 1SVLA 1X4PA 3LSIA 2GAUA 2QM3A 1RKWA 1Z7LA 3DF8A 4KIFA 3ABLH 3TL4X 2QENA 3NAUA 4OINF 2HQRA 4QPQA 4KT6A 1T56A 3H0GJ 5EEHA 4CUGA 5ED4A 2CV2A 2VE9A 1ETWA 4XLNF 1HKTA 2FQ3A 3LWFA 1ON2A 3VYTB 3ZR8X 1U78A 3S3OA 3EUKL 1W36D 1YFHA 5DYMA 3H5AA 1TQMA 3TP0A 4LK1F 3ZPLA 3HOSA 4M3FA 3OY9A 2KIMA 5EZGA 4DZJA 5HVQC 3I55I 4XRFA 4X1EA 1XPXA 2NRAC 3S3MA 3ISPA 1QVUA 1ZLKA 3O2PE 2XF7A 2WY7Q 1Y0UA 3DBRB 4EGYA 2BOLA 1EH7A 3DU6A 2XDVA 2BHZA 2L2OA 1MSEC 2FJ1A 2R5ZA 1YX5A 2I5UA 2LY2A 2KZGA 2O5RA 2ZNYA 3G1OA 4PCQA 2LBFB 4M3GA 2NOGA 2CUFA 3RQIA 5GPAA 2FU4A 1BN5A 3BG3A 3WU2C 4CCNA 2R7FA 4A3EJ 3HSFA 1XDSA 1W5CC 3IWFA 1YJ9I 1U9OA 3IKTA 3NQOA 2E2IJ 2ECCA 1SVOA 4M72A 1WJAA 4QIWN 2VB6A 5AONA 5BMZA 4LG0A 3QOPA 4IX7A 4GXOA 1IDYA 1W7PA 1ZG1A 1HKSA 2ID3A 1POGA 2P8TA 5E79C 1X4OA 5IY5H 3CCYA 5FLMJ 3S14J 2N8GA 1BR2A 2BVLA 2PMZA 5E20A 3T5XA 3HPHA 3ZMVA 2CW0F 5ICGA 2DJIA 2PJPA 4RGRA 3BR2A 4F3QA 1A31A 1R58A 5FKKA 4OAYA 1VQMI 1EV7A 1FPQA 4FCYA 2X9DA 1ZAOA 3CCLI 3G6EI 2OCCH 4HLXA 2YR2A 2E5ZA 3HTSB 1XSXA 4M6YA 2PMHA 1Y8RB 3L1PA 3QOEA 5JR3A 2B9SA 1DGRM 1IXCA 4PJMA 1U8RA 5CQEA 2ZBKA 3CO6C 2PI0A 1RETA 3M1EA 1GT0C 5M5YJ 3OS1A 1RR8C 2R7VA 3CF5F 1PUFA 4D7NA 3BZ6A 3DTIA 3CZ6A 3HIFA 1PDNC 2KRHA 1YS6A 3A4CA 2VI6A 2E2JJ 2VLAA 1GXPA 2FE3A 2PMUA 2IA2A 1HQCA 1LEAA 1FTZA 1MMDA 4KT5C 3V8LA 4IRIA 3WGGA 4ZZLA 1W7PB 1ZGJA 2YPRA 3KLNA 1XMXA 3LSJA 3AAFA 1IF1A 2O61A 2STWA 1QA6A 1LUJB 4E4HA 1KQ9A 3HC7A 1MMAA 2VKVA 1T38A 2V9PA 2LK2A 5J40A 2EILH 3PUBA 2IW5A 4DOZA 3RKYA 3GYHX 2X1EA 3MKWB 2ELHA 4ZJZA 3SQNA 1UMQA 4IPAA 4IOCF 4RAFA 3K70C 1STZA 2R7SA 4PJLA 2KDOA 5H2FC 3KEYA 2DBBA 2DA4A 2E1NA 3O8GA 4WK8F 3EPZA 4RGSA 4Y13A 3DKWA 3OV8A 5F1RA 1FC3A 5B1BH 1BM9A 1IV6A 3ABMH 3VWBA 5C4JJ 1WFXA 3LFUA 4JX5A 2KJBA 2UUZA 1D0XA 1ZKGA 4HYEA 3OYAA 1GVDA 2VN2A 1VQ7I 1K7AA 5FGMA 3ZQHA 2QSGX 3KP3A 4D1QA 3LA3A 3M3YJ 1ZTRA 2CUJA 3OMYA 4L9VA 2VQCA 3CESA 4E7IA 4IL6C 1PP8F 3C18A 3LSMA 4EM0B 1SVMA 1NG6A 4AC0A 3A0BC 4PJNA 1Q1HA 5M3FJ 3T8TA 2G9WA 2X6XA 4IHYA 5KVRA 3GX4X 4G12A 4FETA 3F6OA 2VQGA 4CCOA 4XLCA 3KYCB 3KCCA 2L9VA 5JI6A 2CUEA 4CYDA 3T8RA 3HOVJ 3DPTA 2HZDA 1RI7A 4S04A 1TC3C 4BNCA 1G2HA 1Q1VA 3I58A 4DYRA 2ADUA 3FXKA 3I4MJ 3K4LA 2HVRA 2QGUA 1K6OA 2VC0A 2YU9J 2VOOA 3WTUC 2F5DA 2OPTA 4BU2A 1W0TA 1MNDA 3KIOA 3KYDB 1O3SA 5K7ZA 1OCCH 3E5UA 1SFKA 5L3DA 4ESBA 3F22A 1RRJA 5EEAA 1KONA 2A5WA 2X4HA 5AIPA 2XGCA 4OOIA 3J7YJ 1RZ4A 4XLHA 3I0TA 5CKTA 3SFZA 1ZELA 1VTNC 1B72B 4XBFA 1ZR4A 2K4JA 4BYYA 2V1NA 1FYLA 2F4MB 2V26A 2PJRA 3BPVA 2P7VB 2BXYA 2FOWA 3HOWJ 1XGSA 4GCVA 4DBRA 2DK5A 2E5NA 3NEUA 2IS4A 3CMYA 2UV1A 1ETQA 5EG0B 1XTAA 2IS1A 1NG7A 3GTKJ 3I4PA 2LOOA 4A3MJ 3AL0B 4B1RA 2R7OA 4OWRB 2CW7A 2WA0A 5E3NA 1OYIA 3ZN0A 4L9NA 5ERIA 4ZC3A 1YS7A 2LSOA 2ESNA 2ZJ2A 2VBZA 2XF5A 1MKMA 2DOFA 2TRTA 4CYCB 2D45A 3V7RA 1MJBA 2A3SA 1P4XA 2H8RA 3AKZA 2BHYA 4D7MA 2JMWA 2AS5F 5JFRA 4DYCA 2PLYA 1FSEA 4N9IA 1FBQA 1IXRC 1R00A 2RVCA 2X6YA 2HDDA 5GAGJ 1M1EB 2MYSA 3BDDA 3TW6A 1UCRA 3GFMA 5IT3A 3OS2A 4BDZA 4F93B 2EQRA 2CS3A 3OS0A 1F4KA 3A03A 1X19A 4Q5SF 2KQRA 1FT9A 3HPGA 4B44A 4BEHB 1X58A 1I50J 2FBKA 4XR6A 5J4YA 4HAMA 3KP2A 2HYGD 2M30A 5E1WA 3IRRA 2V1DA 3ZN1A 3D5RC 3BPXA 5LGNA 1WRJA 3DCFA 1MJ9A 2X6OA 2CW8A 5IPAA 4JOMA 1OISA 3NWSA 2BVMA 4XSZF 5LRSA 3ZMDA 2NVQJ 1R7JA 5E8IA 1JGGA 2GIZA 1YLFA 1DPRA 2FNPA 3NARA 3S93A 4EQQA 3CUQC 5FRNA 4LJZF 1LFUP 3F8FA 3S2DJ 4I2OA 4CICA 2PN6A 2IJLA 3C2GA 3PIPF 4I01A 4FX4A 1JUSA 5FO5A 1U2WA 3CC4I 2W24A 1B9MA 3WE3A 1E17A 4I0BA 1F36A 1JT0A 3I4NJ 5E17F 1RR7A 1WHUA 4RLFA 5E1ZB 3O3KA 2CV1A 3RPUA 1W0UA 4DYQA 3IL2A 3OIQA 4IRHA 5IT9K 2PFBA 1O7LA 1SFOJ 2VXDA 2O8KA 3OWTA 4U0YA 2XGDA 1SEUA 3JRIA 4JBAA 2DT7B 4ENNA 4KMFA 2E1MC 2OZ6A 4I02A 3RQ4A 1TW3A 4U7BA 3DPUA 4LLLA 4R8HA 4S05A 1BR1A 1HF0A 1BI1A 1USTA 2HPMA 4G7OF 2KIFA 4ZZDA 2VONA 1RUNA 2R7WA 2HOSA 2DXIA 4UVAA 3BZKA 4X0GA 1FSHA 5FLXK 4FQGA 2ETHA 2D2WA 1HA8A 1JKQC 3IH4A 4FE7A 5D5UB 2LP0A 2M34A 1QVTA 1MH3A 4IXAA 5HLGA 2AO9A 1W5SA 4BHPA 2ZO4A 3OYJA 5DUIA 1VQPI 2E7WA 1GV2A 3B6AA 2EZKA 3IP4B 2W7NA 1XGNA 4ESFA 3JAMZ 3FHNA 5ILUA 4G7HF 1E3PA 3VSKA 1KYZA 2ZJRF 1ENHA 4B48A 4AIJA 4A3BJ 5EDNA 3HZJA 3OOUA 3QWLA 3HKZN 5LEKA 5DS9A 2M8GX 1TL8A 1KU9A 4A93J 4BBSJ 3WTZA 2CJJA 3E6CC 5EF6A 1TW2A 3J81K 3J7AY 3ZGKA 3I54A 5J1RA 3RKWA 1LFPA 4XLPF 1OLTA 4C3HJ 4GYIA 4BQNA 3GTLJ 1JUPA 3RYPA 4XIDA 1HLVA 2K9NA 1TLHB 2MGQA 3HGYA 4ZDLA 1QZZA 1P2FA 2D1VA 3CDLA 3WHBA 1S29A 1JKPC 4YRVA 2LDUA 4M71A 2LC2A 2MSYA 2FNAA 1Y1WJ 2EIJH 3ESWB 1WVRA 2E71A 2M45A 4F91B 2M7AA 4CA0A 1YIOA 4PDKA 1R36A 1H8AC 2FX0A 3LNQA 3KP7A 1GDTA 2JA8J 4IO9F 4UHTA 3KEOA 1Z6TA 2V79A 2K5CA 3H5RA 4GFBA 4N0BA 2IEKA 4FT8A 1QRYA 3MZ8A 2K27A 3QPHA 2O6GE 3I3LA 2ZMEC 1ON1A 3VYRB 3CCVI 1DU0A 3NWTA 2NVXJ 3WODF 4ZH4F 4YG2F 5F1JA 2XGEA 2F5CA 3O6BB 1G3WA 3MKYB 3EYIA 3VB2A 5FFZA 1R6RA 4UVCA 1LQ1A 3ASNH 4KICA 3SDBA 3BWGA 5K5QA 4EJUA 1OCRH 4ENJA 2BE5F 5DV5A 1I1SA 3FKIJ 1U3EM 1Z0XA 3DLAA 3ZRGA 3WTWC 4DW6A 1ZHFA 2TCTA 3RDIA 1ZGWA 5M5XJ 1RNLA 2K3FA 2L9SA 4UUSB 3DLLF 2EFWA 4CO8A 1H89C 5J3LA 4XKCA 1P9QC 2AHQA 4M9XA 3ZQLA 3V42A 2H09A 3F8NA 1FYKA 2CQXA 2OQGA 2Z5UA 3CQZJ 5H6QA 3BJ6A 3ROUA 3J81Z 5C44J 3O8HA 5D4RA 1U5TA 2KIUA 2WAFA 2J5OA 2L0KA 1BIAA 2JPCA 1UHMA 4YFXF 4NQWA 1FBUA 3M4OJ 2KISA 4AUXA 4KNYA 2QF7A 2KHMA 2ECBA 3HRMA 3I71A 4BL0B 3G73A 1N78A 2DFIA 3LSRA 1AA7A 2FBIA 4MIMA 5E18F 3DFGA 1QBJA 2HI3A 3BJAA 4HW0A 4W97A 1JT6A 3ZQGA 3FBNB 1VQ9I 2EINH 1I27A 2LNBA 3BY6A 1SD4A 1MDMA 3OYEA 4A3IJ 2ME6A 2EZLA 2LKPA 3G1MA 4LIVA 4AIDA 1YIJI 9ANTA 2R7QA 2MD5A 1ETOA 1JE8A 3FBIB 3ELKA 2WAQA 3ZQQA 1S5LC 1IV8A 5A2QK 4CDGA 2A69F 4NC8A 2LKSA 2TDXA 2E60A 2HXIA 2JVGA 2IGKA 3S3NA 2GM4A 5FD5A 1AOYA 3KLOA 3PNTA 4PK4A 4A2UA 1BW5A 2XAUA 3BC8A 2E19A 4K2EA 4G6DA 2WAEA 4ZYGA 3JSPA 2UZKA 1VQLI 4KJZA 2ZXHA 3ECOA 2ZMEA 4I7HA 4M6VA 4EMSA 1R5HA 1UG0A 1U5TB 1WKMA 4BJ6C 4BS9A 3HTUA 1FNNA 1TBXA 2DAOA 2X48A 3E0JB 4CCKA 3JRDA 1AWCA 5J6XA 1BC8C 1CQTA 5HS9A 3FF5A 1FBSA 1FY7A 1Y39A 4Y17A 2BY2A 1QQIA 1DPUA 3R60A 3RKQA 3GLXA 1LE8A 1FEXA 3JRBA 2RAEA 2DDBA 4P96A 1BBYA 3M8EA 3WGIA 1HXDA 4FE4A 2GQQA 5LEJA 1CGPA 1YW9A 2O3FA 3K10A 1EH6A 2WADA 3QODA 2AQEA 3BR3A 3LL7A 2R4GA 2ZC2A 2Y2ZA 3CCUI 2DQRA 3H9QA 1V54H 2DCEA 4BE2A 5DTDA 2QKLB 3W6JB 4KYWA 1I3AA 3QYFA 4XL9A 1SFUA 3H9JA 1SC7A 4WXDA 1Y1VJ 2QKMB 3FXLA 4G6TB 1OFCX 3WGHA 2WAQN 1XMAA 4ESJA 4D9JA 4H0EA 3OSFA 2V6CA 1BC7C 2JSCA 5GTIC 3R0AA 1JHFA 3KE2A 1Z67A 4UUTA 1LDDA 5CPRB 3L2CA 2PEXA 3PJRA 4A0ZA 4FTHA 3J80K 2JRMA 2HVQA 3R0JA 5LHIA 4CZCA 4U87A 3P9IA 2QBYA 2E35A 4XN0A 2ZXJA 4KA4A 2E7XA 2JJ7A 3KP6A 1LE8B 2VC1A 4NNJA 4J01A 5CJ9A 2GA1A 4RB3C 1A35A 4BHCA 4ZYAA 2L7FP 4JK1X 3F9KA 5JVGF 3D0SA 2LLKA 1LNWA 1GV5A 3TQNA 1V5FA 2G7HA 3WG7H 3GFIA 1B1BA 2R7XA 3VYUB 3H9GA 5HNHA 4EJVA 3MKLA 3X2QH 3HRUA 5EEGA 4EJWA 1W4MA 5HDKA 4HSRA 2JA5J 2WWYA 2NOJB 1Z9CA
chains in the Genus database with same CATH topology
2DPDA 1G6NA 3RKXA 5ICFA 2YX4A 4P5OA 1KYWA 5CLSA 3EQLF 4MNUA 1KA8A 3DV8A 4MHGA 1OR7A 3HRSA 2H6CA 1KGSA 1X3UA 5D5WB 2QBYB 4JQFA 2O0YA 3K1NA 5KK1A 2DU9A 2HEOA 4L9TA 2Z99A 1RUOA 2M1BA 2Y0MA 1BI3A 3SZPA 2IA1A 4P55A 2NAZA 2R3SA 1E2XA 3J80Z 2CFXA 3CJNA 4A6EA 4WCGA 2YU3A 1P6RA 3CLOA 1O3QA 3ZQ7A 1S7OA 3F72A 3RTRA 3SHFA 2HDCA 2P5KA 4HOBA 3TDUC 4A6DA 5BPIA 2F5EA 1ZN2A 4R1HA 3MCZA 1F1ZA 2G7UA 4L18B 1IRFA 4U88A 2H6BA 2IT0A 3GFLA 4L9JA 2Z3YA 1J59A 2ZCWA 4LK0F 5CVRA 4FHTA 1UFMA 4E70A 4RB2C 2JPBA 2XAFA 3L7WA 3V7CA 2PQ8A 3MQ0A 1V4RA 3WU0A 4WXCA 2P5LC 2O03A 4P9FA 1KU2A 3FXRA 3I53A 4HQEA 4I98B 4ENKA 4U0WA 4BAYA 4EVIA 1P4AA 2DT5A 3U2RA 4F7ZA 4PGGA 2CGPA 2DW4A 4HX4A 3RYRA 1G4DA 2XUBA 3V8JA 4U0VA 3IHUA 1SD6A 4ETSA 4I0AA 1R5GA 5TJJA 2Y75A 2EA2A 3LA2A 2FSWA 5CVVA 4XSXF 3F6VA 5DD4A 5HOOA 3D5LA 2RN7A 3K1PA 2FRHA 3WG9A 3GEZA 5L3EA 5AIQA 3VEPA 4RAZA 4AD9A 4HF0A 3GF2A 5H6RA 1HBXG 5L3GA 1ZH5A 3LAJA 1B6AA 1XGMA 3LSTA 4BQAA 2A07F 3ML6A 4PGHA 5LBQA 2JT1A 1GHCA 2K02A 2A6HF 3FM3A 2EA4A 3V8KA 1J9IA 4OIQF 1UB9A 2QUFA 2VXZA 4IHSA 3QAHA 3M7GA 3FMSA 1A04A 2EJRA 3LFKA 4OIPF 1IUYA 1DP7P 2L54A 2EV0A 3GFJA 1ZLJA 3E5QA 4IVNA 3H92A 5LHGA 3M9AA 3U9GA 2GXGA 2JTVA 2HTJA 2OQRA 2HYFA 3TO7A 2L4AA 4O3MA 2K7LA 5J8CA 4DNCA 4UUVA 1YW8A 1OKRA 2RV8A 3BOQA 3RJPA 1LB2A 4M6XA 4D0PA 2H94A 4MEYF 5CYVA 4AIKA 4GGGA 2C6YA 2IRFG 2CO5A 3C1DA 2EV5A 4A12A 3FXUA 1YW7A 3ZP5A 2EFPA 2QVOA 3P9KA 3ABUA 2VOPA 4L0ZB 2EWNA 2NNYA 1MD0A 4QWQA 3R4KA 1FLIA 3KETA 3GXOA 3BJOA 3EUHA 1RIOH 4AIHA 3ECHA 3C7JA 2MLKA 1P4WA 3JTHA 3U1DA 3KZZA 2HS5A 4B09A 1ZARA 3QP6A 1TQPA 1U5TC 1XSVA 3TKYA 2WTEA 4HLYA 5LHHA 4KN7X 3I64A 3MEXA 5D8LB 1Z91A 4Q48A 2EFOA 1NHAA 2R7DA 3F8CA 3HYIA 3RI4A 2RC4A 4WX9A 1BJAA 2HKOA 1F5TA 1J2XA 5IT9Z 4HQMA 2VT3A 4NB5A 5TRDA 3WE2A 3FZVA 4Z2YA 3LAPA 3WTVC 1T0FA 2ESHA 2A61A 1QPMA 3KP4A 4IHTA 1HW5A 3L00A 3FMRA 1SMTA 2OAZA 5FFXA 5ILVA 1XSDA 4N9HA 3P9CA 3ZMTA 4DQ2A 1I5ZA 5FLXZ 1K79A 3E6MA 1MGTA 2CG4A 2NS0A 2HOEA 1FP1D 2VT2A 3WU1B 3L9FA 1DUXC 4HDUA 3ERED 5DCFA 3MWMA 4IRGA 3CO7C 4L5JA 5CVJA 1ZG5A 2D1HA 4KIBA 2RQPA 3IC7A 2FF4A 2MLGA 2PG4A 2GIVA 3PQJA 3M8FA 5DDGA 1ZRDA 3HHHA 1PP7U 2J5PA 1IZ1A 1YYVA 2HGCA 5ICCA 3B73A 1XN7A 1MZBA 1JGSA 2XKOA 1KQ0A 1D8KA 5J8FA 4ENMA 3B02A 3F8MA 2A6EF 3W6KB 4ON0A 3WTXC 1KU3A 1JXSA 5D4SA 2DQLA 1HW2A 4KUMA 5BQTA 3J7AO 1G3YA 4WF2A 1REPC 3VODA 3KP5A 1ULYA 3GO5A 2LF7A 2HFHA 2BGCA 1G3TA 1ODDA 2CYYA 3H3UA 2H27A 3TO6A 2XAQA 1IAWA 2GA2A 2WC2A 3V7SA 1TQIA 3R61A 3NRVA 4EJTA 1IRGA 2W57A 1QNTA 4CGZA 2EFQA 1L3LA 3BP8A 1H9GA 1FZPB 2MH9A 4R79A 5CVIA 3N97A 2BBYA 3CTAA 2FBHA 4IJAA 2MH2A 2VODA 5D5VB 1SD5A 1LDJA 1C0WA 5A2QZ 2KJCA 3REOA 3HSRA 4GO1A 4CZZA 3F23A 2HWVA 1T6SA 4L0YB 4A5NA 2K4BA 3VFZA 4PZJA 1SD7A 4Q47A 2F5FA 4G8XA 2OA4A 2NYXA 3GUDA 1K78A 4L5IA 4G7ZF 3HRTA 4M73A 1TTYA 1U6GA 5K1YA 2ISYA 2W85A 1XCBA 1HW1A 2ZNZA 3LQQA 1ONVA 2P4WA 2HTSA 2A68F 4MGRA 4HZFA 1S7AA 3MAJA 3Q9SA 4UXNA 5ICEA 1O7FA 2GXBA 1R1TA 3FX3A 3PFIA 5D5XB 3DP7A 4UNOA 4HF1A 3ZMUA 3TGNA 5HS7A 3QRFF 4B8XA 1J75A 2XV4S 1DDNA 3DXJF 4HV6A 2XASA 2QLZA 4OIOF 2V1UA 4YIIA 2COMA 1OMIA 2XIGA 4YFKF 3RIRA 1L0OC 1B9NA 1K78B 3I5UA 4A5MA 5ILSA 2Z9OA 5FB2A 4LGWA 4EM2A 3S2WA 1B4AA 2M8EA 4U7DA 4EM1A 1XMKA 2B0LA 4UV8A 3DQVC 5E1XA 5L3BA 1Z05A 2FMLA 4ZYHA 4NHJA 1IN8A 4Q4ZF 5DD8A 2EB7A 4LLNA 3SXYA 3ABTA 2UWMA 2Q2EA 2DK8A 2IPQX 4HDVA 4YFNF 2P6SA 2A5YB 2KRFA 2QQ9A 3L09A 1FX7A 1JHHA 2QQAA 3T1BA 3F21A 4KFCA 1S8NA 3ULQB 4LLGF 2EFNA 1HSJA 3F8BA 5K5RA 4LG0B 1XDUA 2XGXA 1GXQA 3MFKA 3FMQA 3GWZA 1WQ2A 1S3JA 5HLIA 4G94A 2CWEA 4KN4X 3SZTA 1D8JA 2QZ8A 2L02A 5D8KB 2WV0A 5L3FA 1I6XA 1QO0D 4IF4A 1IN6A 2DLLA 1F9NA 1XGOA 4M9ZA 3K9TA 4HF2A 2MC3A 1WI9A 3FM5A 1B59A 3H3ZA 1S6LA 2DTRA 1ZRFA 4P9UA 1LVAA 1HKQA 3TDZC 1IN7A 3K69A 4HV5A 3GVAA 1YTYA 1V3FA 3E3VA 2BV6A 2RNJA 4LD5A 3DPLC 3GZ6A 3EETA 2XVCA 3MZHA 1WSUA 2BYVE 3JTGA 4YIFA 2XAGA 4MTDA 3I59A 3MZYA 4HBLA 4O6JA 1H9TA 5JHUA 4TV7A 2X0LA 3KEQA 5BPDA 4G6QA 3TOBA 5BOXA 2ZFWA 4RB0A 3WTYC 1ZG3A 4CHUA 2IP2A 2F2EA 2HKXA 3GZ5A 4AVPA 2FXAA 1Z1DA 1HSTA 4ZYEA 2AXLA 4OMYA 2BEOA 3E97A 4OU0A 3F3XA 5DCMA 4WXHA 1P92A 3HSEA 5LLQA 3JSOA 1W5TA 2NNNA 1Z7UA 3I59B 3LQRA 3ZMSA 3JW4A 4RGUA 5F6FA 3COAC 2P7CB 3V4GA 3DEUA 1BI2A 3CUOA 2LF8A 4LFUA 4OIRF 2EV6A 1OYWA 3Q9VA 2QYOA 1UHWA 2L3DA 6PAXA 3KZYA 1D5VA 1EH8A 1GVJA 2Q0OA 4HX8A 2KKOA 3IKVA 3QU3A 3FWEA 1OPCA 5JVTA 4EGZA 3VOEA 1ZYRF 4EV0A 2P5VA 2XHKA 4LB6B 4LMYA 1SFEA 1TNTA 3OOPA 5DCMB 3WTSC 1R23A 1PUEE 4I09A 1TNSA 4RGXA 4AWXB 1LEBA 3JAMK 2XKPA 1IN5A 1IXSB 5LRRA 4GYGA 2OBPA 5LGTA 3CDHA 3GW2A 2FMYA 2GWRA 2DI3A 3QP5A 1W7PD 2V1XA 2JRTA 3TOAA 2VBXA 1J0RA 1T98A 1XB4A 3Q5FA 1O3RA 1T39A 4MQVA 4M9SA 4HX7A 4LB5A 2FA5A 4M74A 2K86A 3K1MA 1SMYF 2L01A 1I1GA 1D3YA 2YX7A 5L3CA 2RDPA 5F64A 4KIGA 1ZREA 2UXNA 1BI0A 2YSRA 1IN4A 5D6FA 1Z6RA 2Z33A 2PBIA 5CVUA 2OU2A 3BROA 1CF7A 2HR3A 3T0YA 2IVMA 4FX0A 4UVBA 1ZGAA 1BIBA 2M87A 3FXQA 3CUQA 1QGPA 1FOKA 2STTA 4WWCA 4HA8A 4CXFA 2ACJA 5FD6A 2CQKA 2GZWA 2IA0A 4ZYDA 3QPTA 2XRNA 4MQ9F 1LDKB 2O8XA 5K5OA 3QU6A 5D6EA 2VBWA 1BOAA 2JZYA 1OYYA 1CF7B 1QZYA 2QQBA 3HOTA 1YO5C 1XD7A 2DPUA 5HDGA 1SFXA 1J7KA 1IW7F 1LJ9A 1J5YA 3E6BA 5HS8A 3E5XA 3CUQB 4MEXF 2W25A 4BH9A 2OZUA 3E6DA 3ZMZA 2L4MA 1FP2A 3K0LA 4OMZA 5DUKA 1H0MA 4RS8A 5H20A 2E1CA 2MBFA 2VE8A 4ASNA 2RGVA 2UXXA 1FYMA 4BHBA 4KMUX 1USSA 4KDPA 4BXUA 1SAXA 3G3ZA 2DO7A 4RAYA 1O3TA 2ZKZA 2Q8KA 2ISZA 1R1UA 3C3WA 3KFWX 1ZRCA 3HUGA 2XAJA 2FEZA 4G9YA 2FOKA 5HDNA 3WTTC 1O57A 3RPQA 2HZTA 3EYYA 3IWZA 4A0YA 2VBYA 1T2KA 1KU7A 1KQ8A 2EK5A 1FWZA 2QWWA 3IRQA 2W84A 4O5VA 2OD5A 2CSOA 4A0XA 1G3SA 5LGUA 3K2ZA 3PQKA 1XCVA 5BS6A 2MA3A 4UV9A 4QLCU 1MDMB 1MJAA 4Y15A 4RB1A 1YQAA 3P7NA 4EJOA 2M5WA 3LA7A 3FHZA 2Y48A 1YG2A 2RKHA 5HLHA 3TO9A 1R1VA 1WWXA 5E8GA 2XROA 2ZMEB 2P6TA 5DEQA 2V9VA 4MTEA 2HQNA 3N4MA 1R22A 3R6SA 3HHGA 2XAHA 3EDPA 2GAUA 2QM3A 3DF8A 4KIFA 2QENA 4OINF 2HQRA 5ED4A 5EEHA 2VE9A 4XLNF 1HKTA 2FQ3A 3LWFA 1ON2A 1U78A 1YFHA 5DYMA 1TQMA 4LK1F 3ZPLA 3HOSA 2KIMA 5HVQC 4XRFA 2NRAC 3ISPA 1ZLKA 3O2PE 1Y0UA 4EGYA 1EH7A 2ZNYA 4PCQA 2FU4A 1BN5A 2R7FA 3HSFA 1XDSA 3IWFA 3IKTA 3NQOA 4M72A 5AONA 5BMZA 4LG0A 3QOPA 4GXOA 1W7PA 1ZG1A 1HKSA 2P8TA 5E20A 3T5XA 3ZMVA 2CW0F 5ICGA 2PJPA 4RGRA 1R58A 1EV7A 1FPQA 1ZAOA 4HLXA 2YR2A 3HTSB 1XSXA 4M6YA 2PMHA 5JR3A 1U8RA 1IXCA 2ZBKA 3CO6C 2PI0A 3M1EA 3BZ6A 3HIFA 1PDNC 1YS6A 1GXPA 2FE3A 2PMUA 2IA2A 1HQCA 1LEAA 4KT5C 3V8LA 4IRIA 3WGGA 3AAFA 1W7PB 1ZGJA 2YPRA 3KLNA 4ZZLA 1IF1A 2O61A 2STWA 1KQ9A 1T38A 2IW5A 3GYHX 3RKYA 2ELHA 3SQNA 4IPAA 1STZA 2DBBA 2E1NA 4WK8F 4RGSA 4Y13A 3DKWA 3OV8A 5F1RA 1FC3A 1BM9A 2KJBA 4HYEA 2VN2A 1K7AA 5FGMA 3KP3A 3LA3A 4L9VA 1PP8F 3C18A 4EM0B 1Q1HA 3T8TA 2G9WA 5KVRA 3GX4X 3F6OA 3KCCA 5JI6A 4CYDA 3T8RA 3DPTA 1RI7A 4S04A 4BNCA 3I58A 2ADUA 1K6OA 2VC0A 2VOOA 3WTUC 2F5DA 1O3SA 3E5UA 5L3DA 3F22A 4ESBA 2X4HA 5AIPA 4OOIA 1RZ4A 3I0TA 3SFZA 1VTNC 4XBFA 2K4JA 4BYYA 1FYLA 3BPVA 2P7VB 1XGSA 4GCVA 2DK5A 3NEUA 3I4PA 1OYIA 3ZN0A 4L9NA 5ERIA 1YS7A 2LSOA 2ESNA 2ZJ2A 2VBZA 1MKMA 2D45A 3V7RA 1MJBA 2A3SA 1P4XA 2AS5F 5JFRA 2PLYA 1FSEA 4N9IA 1FBQA 1IXRC 1R00A 2RVCA 3BDDA 1UCRA 3GFMA 5IT3A 4Q5SF 1F4KA 1FT9A 2FBKA 4HAMA 3KP2A 2HYGD 2M30A 5E1WA 3IRRA 2V1DA 3ZN1A 3BPXA 5LGNA 1WRJA 1MJ9A 4XSZF 5LRSA 3ZMDA 1R7JA 5E8IA 1YLFA 1DPRA 2FNPA 4EQQA 3CUQC 4LJZF 3F8FA 4I2OA 4CICA 2PN6A 2IJLA 4I01A 4FX4A 5FO5A 1U2WA 2W24A 1B9MA 3WE3A 1E17A 4I0BA 5E17F 5E1ZB 3O3KA 3RPUA 3IL2A 4IRHA 5IT9K 2PFBA 1O7LA 4U0YA 4JBAA 4ENNA 4KMFA 2OZ6A 4I02A 1TW3A 4U7BA 4S05A 4LLLA 4R8HA 1BI1A 1USTA 4G7OF 2KIFA 4ZZDA 2VONA 1RUNA 4UVAA 1FSHA 5FLXK 2ETHA 2D2WA 5D5UB 4IXAA 5HLGA 1W5SA 4BHPA 2ZO4A 5DUIA 2E7WA 1XGNA 4ESFA 3JAMZ 5ILUA 4G7HF 1KYZA 4AIJA 5LEKA 1KU9A 3WTZA 3E6CC 1TW2A 3J81K 3I54A 3RKWA 4XLPF 4GYIA 3RYPA 1TLHB 1QZZA 1P2FA 2D1VA 1S29A 2LDUA 4M71A 2FNAA 2M45A 1YIOA 4PDKA 1R36A 3KP7A 4UHTA 3KEOA 1Z6TA 2V79A 4N0BA 4FT8A 2K27A 3QPHA 2O6GE 1ON1A 3WODF 4ZH4F 4YG2F 2F5CA 3O6BB 1G3WA 3EYIA 3VB2A 5FFZA 4UVCA 1LQ1A 4KICA 3BWGA 5K5QA 4EJUA 4ENJA 2BE5F 5DV5A 1I1SA 1U3EM 3WTWC 1ZHFA 3RDIA 1RNLA 2EFWA 4CO8A 4M9XA 2H09A 3F8NA 1FYKA 2OQGA 2Z5UA 5H6QA 3ROUA 3BJ6A 3J81Z 5D4RA 1U5TA 2KIUA 2J5OA 1BIAA 2JPCA 1UHMA 4YFXF 4NQWA 1FBUA 4KNYA 3HRMA 3I71A 3G73A 2DFIA 2FBIA 5E18F 3DFGA 1QBJA 3BJAA 4HW0A 1I27A 2LNBA 1SD4A 3BY6A 1MDMA 2LKPA 2MD5A 1JE8A 3ELKA 5A2QK 4CDGA 2A69F 2TDXA 5FD5A 1AOYA 3KLOA 4A2UA 4K2EA 4G6DA 4ZYGA 3JSPA 2UZKA 3ECOA 4I7HA 2ZMEA 4EMSA 1R5HA 1U5TB 1WKMA 3HTUA 1FNNA 1TBXA 2DAOA 1AWCA 5J6XA 1BC8C 5HS9A 3FF5A 1FBSA 1FY7A 4Y17A 1QQIA 1DPUA 3R60A 3GLXA 4P96A 1BBYA 3M8EA 3WGIA 1HXDA 2GQQA 5LEJA 1CGPA 1YW9A 2O3FA 1EH6A 2DQRA 3W6JB 4KYWA 1SFUA 4WXDA 3WGHA 1XMAA 4ESJA 4H0EA 2V6CA 1BC7C 2JSCA 3R0AA 1JHFA 3KE2A 1LDDA 3L2CA 2PEXA 4A0ZA 3J80K 3R0JA 5LHIA 2QBYA 3P9IA 2ZXJA 4KA4A 2E7XA 3KP6A 2VC1A 5CJ9A 2GA1A 4RB3C 4BHCA 4JK1X 3D0SA 1LNWA 3TQNA 2G7HA 3GFIA 1B1BA 4EJVA 3HRUA 5EEGA 4EJWA 1W4MA 5HDKA 2WWYA 1Z9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPD A;  1G6N A;  3RKX A;  5ICF A;  2YX4 A;  4P5O A;  1KYW A;  5CLS A;  3EQL F;  4MNU A;  1KA8 A;  3DV8 A;  4MHG A;  1OR7 A;  3HRS A;  2H6C A;  1KGS A;  1X3U A;  5D5W B;  2QBY B;  4JQF A;  2O0Y A;  3K1N A;  5KK1 A;  2DU9 A;  2HEO A;  4L9T A;  2Z99 A;  1RUO A;  2M1B A;  2Y0M A;  1BI3 A;  3SZP A;  2IA1 A;  4P55 A;  2NAZ A;  2R3S A;  1E2X A;  3J80 Z;  2CFX A;  3CJN A;  4A6E A;  4WCG A;  2YU3 A;  1P6R A;  3CLO A;  1O3Q A;  3ZQ7 A;  1S7O A;  3F72 A;  3RTR A;  3SHF A;  2HDC A;  2P5K A;  4HOB A;  3TDU C;  4A6D A;  5BPI A;  2F5E A;  1ZN2 A;  4R1H A;  3MCZ A;  1F1Z A;  2G7U A;  4L18 B;  1IRF A;  4U88 A;  2H6B A;  2IT0 A;  3GFL A;  4L9J A;  2Z3Y A;  1J59 A;  2ZCW A;  4LK0 F;  5CVR A;  4FHT A;  1UFM A;  4E70 A;  4RB2 C;  2JPB A;  2XAF A;  3L7W A;  3V7C A;  2PQ8 A;  3MQ0 A;  1V4R A;  3WU0 A;  4WXC A;  2P5L C;  2O03 A;  4P9F A;  1KU2 A;  3FXR A;  3I53 A;  4HQE A;  4I98 B;  4ENK A;  4U0W A;  4BAY A;  4EVI A;  1P4A A;  2DT5 A;  3U2R A;  4F7Z A;  4PGG A;  2CGP A;  2DW4 A;  4HX4 A;  3RYR A;  1G4D A;  2XUB A;  3V8J A;  4U0V A;  3IHU A;  1SD6 A;  4ETS A;  4I0A A;  1R5G A;  5TJJ A;  2Y75 A;  2EA2 A;  3LA2 A;  2FSW A;  5CVV A;  4XSX F;  3F6V A;  5DD4 A;  5HOO A;  3D5L A;  2RN7 A;  3K1P A;  2FRH A;  3WG9 A;  3GEZ A;  5L3E A;  5AIQ A;  3VEP A;  4RAZ A;  4AD9 A;  4HF0 A;  3GF2 A;  5H6R A;  1HBX G;  5L3G A;  1ZH5 A;  3LAJ A;  1B6A A;  1XGM A;  3LST A;  4BQA A;  2A07 F;  3ML6 A;  4PGH A;  5LBQ A;  2JT1 A;  1GHC A;  2K02 A;  2A6H F;  3FM3 A;  2EA4 A;  3V8K A;  1J9I A;  4OIQ F;  1UB9 A;  2QUF A;  2VXZ A;  4IHS A;  3QAH A;  3M7G A;  3FMS A;  1A04 A;  2EJR A;  3LFK A;  4OIP F;  1IUY A;  1DP7 P;  2L54 A;  2EV0 A;  3GFJ A;  1ZLJ A;  3E5Q A;  4IVN A;  3H92 A;  5LHG A;  3M9A A;  3U9G A;  2GXG A;  2JTV A;  2HTJ A;  2OQR A;  2HYF A;  3TO7 A;  2L4A A;  4O3M A;  2K7L A;  5J8C A;  4DNC A;  4UUV A;  1YW8 A;  1OKR A;  2RV8 A;  3BOQ A;  3RJP A;  1LB2 A;  4M6X A;  4D0P A;  2H94 A;  4MEY F;  5CYV A;  4AIK A;  4GGG A;  2C6Y A;  2IRF G;  2CO5 A;  3C1D A;  2EV5 A;  4A12 A;  3FXU A;  1YW7 A;  3ZP5 A;  2EFP A;  2QVO A;  3P9K A;  3ABU A;  2VOP A;  4L0Z B;  2EWN A;  2NNY A;  1MD0 A;  4QWQ A;  3R4K A;  1FLI A;  3KET A;  3GXO A;  3BJO A;  3EUH A;  1RIO H;  4AIH A;  3ECH A;  3C7J A;  2MLK A;  1P4W A;  3JTH A;  3U1D A;  3KZZ A;  2HS5 A;  4B09 A;  1ZAR A;  3QP6 A;  1TQP A;  1U5T C;  1XSV A;  3TKY A;  2WTE A;  4HLY A;  5LHH A;  4KN7 X;  3I64 A;  3MEX A;  5D8L B;  1Z91 A;  4Q48 A;  2EFO A;  1NHA A;  2R7D A;  3F8C A;  3HYI A;  3RI4 A;  2RC4 A;  4WX9 A;  1BJA A;  2HKO A;  1F5T A;  1J2X A;  5IT9 Z;  4HQM A;  2VT3 A;  4NB5 A;  5TRD A;  3WE2 A;  3FZV A;  4Z2Y A;  3LAP A;  3WTV C;  1T0F A;  2ESH A;  2A61 A;  1QPM A;  3KP4 A;  4IHT A;  1HW5 A;  3L00 A;  3FMR A;  1SMT A;  2OAZ A;  5FFX A;  5ILV A;  1XSD A;  4N9H A;  3P9C A;  3ZMT A;  4DQ2 A;  1I5Z A;  5FLX Z;  1K79 A;  3E6M A;  1MGT A;  2CG4 A;  2NS0 A;  2HOE A;  1FP1 D;  2VT2 A;  3WU1 B;  3L9F A;  1DUX C;  4HDU A;  3ERE D;  5DCF A;  3MWM A;  4IRG A;  3CO7 C;  4L5J A;  5CVJ A;  1ZG5 A;  2D1H A;  4KIB A;  2RQP A;  3IC7 A;  2FF4 A;  2MLG A;  2PG4 A;  2GIV A;  3PQJ A;  3M8F A;  5DDG A;  1ZRD A;  3HHH A;  1PP7 U;  2J5P A;  1IZ1 A;  1YYV A;  2HGC A;  5ICC A;  3B73 A;  1XN7 A;  1MZB A;  1JGS A;  2XKO A;  1KQ0 A;  1D8K A;  5J8F A;  4ENM A;  3B02 A;  3F8M A;  2A6E F;  3W6K B;  4ON0 A;  3WTX C;  1KU3 A;  1JXS A;  5D4S A;  2DQL A;  1HW2 A;  4KUM A;  5BQT A;  3J7A O;  1G3Y A;  4WF2 A;  1REP C;  3VOD A;  3KP5 A;  1ULY A;  3GO5 A;  2LF7 A;  2HFH A;  2BGC A;  1G3T A;  1ODD A;  2CYY A;  3H3U A;  2H27 A;  3TO6 A;  2XAQ A;  1IAW A;  2GA2 A;  2WC2 A;  3V7S A;  1TQI A;  3R61 A;  3NRV A;  4EJT A;  1IRG A;  2W57 A;  1QNT A;  4CGZ A;  2EFQ A;  1L3L A;  3BP8 A;  1H9G A;  1FZP B;  2MH9 A;  4R79 A;  5CVI A;  3N97 A;  2BBY A;  3CTA A;  2FBH A;  4IJA A;  2MH2 A;  2VOD A;  5D5V B;  1SD5 A;  1LDJ A;  1C0W A;  5A2Q Z;  2KJC A;  3REO A;  3HSR A;  4GO1 A;  4CZZ A;  3F23 A;  2HWV A;  1T6S A;  4L0Y B;  4A5N A;  2K4B A;  3VFZ A;  4PZJ A;  1SD7 A;  4Q47 A;  2F5F A;  4G8X A;  2OA4 A;  2NYX A;  3GUD A;  1K78 A;  4L5I A;  4G7Z F;  3HRT A;  4M73 A;  1TTY A;  1U6G A;  5K1Y A;  2ISY A;  2W85 A;  1XCB A;  1HW1 A;  2ZNZ A;  3LQQ A;  1ONV A;  2P4W A;  2HTS A;  2A68 F;  4MGR A;  4HZF A;  1S7A A;  3MAJ A;  3Q9S A;  4UXN A;  5ICE A;  1O7F A;  2GXB A;  1R1T A;  3FX3 A;  3PFI A;  5D5X B;  3DP7 A;  4UNO A;  4HF1 A;  3ZMU A;  3TGN A;  5HS7 A;  3QRF F;  4B8X A;  1J75 A;  2XV4 S;  1DDN A;  3DXJ F;  4HV6 A;  2XAS A;  2QLZ A;  4OIO F;  2V1U A;  4YII A;  2COM A;  1OMI A;  2XIG A;  4YFK F;  3RIR A;  1L0O C;  1B9N A;  1K78 B;  3I5U A;  4A5M A;  5ILS A;  2Z9O A;  5FB2 A;  4LGW A;  4EM2 A;  3S2W A;  1B4A A;  2M8E A;  4U7D A;  4EM1 A;  1XMK A;  2B0L A;  4UV8 A;  3DQV C;  5E1X A;  5L3B A;  1Z05 A;  2FML A;  4ZYH A;  4NHJ A;  1IN8 A;  4Q4Z F;  5DD8 A;  2EB7 A;  4LLN A;  3SXY A;  3ABT A;  2UWM A;  2Q2E A;  2DK8 A;  2IPQ X;  4HDV A;  4YFN F;  2P6S A;  2A5Y B;  2KRF A;  2QQ9 A;  3L09 A;  1FX7 A;  1JHH A;  2QQA A;  3T1B A;  3F21 A;  4KFC A;  1S8N A;  3ULQ B;  4LLG F;  2EFN A;  1HSJ A;  3F8B A;  5K5R A;  4LG0 B;  1XDU A;  2XGX A;  1GXQ A;  3MFK A;  3FMQ A;  3GWZ A;  1WQ2 A;  1S3J A;  5HLI A;  4G94 A;  2CWE A;  4KN4 X;  3SZT A;  1D8J A;  2QZ8 A;  2L02 A;  5D8K B;  2WV0 A;  5L3F A;  1I6X A;  1QO0 D;  4IF4 A;  1IN6 A;  2DLL A;  1F9N A;  1XGO A;  4M9Z A;  3K9T A;  4HF2 A;  2MC3 A;  1WI9 A;  3FM5 A;  1B59 A;  3H3Z A;  1S6L A;  2DTR A;  1ZRF A;  4P9U A;  1LVA A;  1HKQ A;  3TDZ C;  1IN7 A;  3K69 A;  4HV5 A;  3GVA A;  1YTY A;  1V3F A;  3E3V A;  2BV6 A;  2RNJ A;  4LD5 A;  3DPL C;  3GZ6 A;  3EET A;  2XVC A;  3MZH A;  1WSU A;  2BYV E;  3JTG A;  4YIF A;  2XAG A;  4MTD A;  3I59 A;  3MZY A;  4HBL A;  4O6J A;  1H9T A;  5JHU A;  4TV7 A;  2X0L A;  3KEQ A;  5BPD A;  4G6Q A;  3TOB A;  5BOX A;  2ZFW A;  4RB0 A;  3WTY C;  1ZG3 A;  4CHU A;  2IP2 A;  2F2E A;  2HKX A;  3GZ5 A;  4AVP A;  2FXA A;  1Z1D A;  1HST A;  4ZYE A;  2AXL A;  4OMY A;  2BEO A;  3E97 A;  4OU0 A;  3F3X A;  5DCM A;  4WXH A;  1P92 A;  3HSE A;  5LLQ A;  3JSO A;  1W5T A;  2NNN A;  1Z7U A;  3I59 B;  3LQR A;  3ZMS A;  3JW4 A;  4RGU A;  5F6F A;  3COA C;  2P7C B;  3V4G A;  3DEU A;  1BI2 A;  3CUO A;  2LF8 A;  4LFU A;  4OIR F;  2EV6 A;  1OYW A;  3Q9V A;  2QYO A;  1UHW A;  2L3D A;  6PAX A;  3KZY A;  1D5V A;  1EH8 A;  1GVJ A;  2Q0O A;  4HX8 A;  2KKO A;  3IKV A;  3QU3 A;  3FWE A;  1OPC A;  5JVT A;  4EGZ A;  3VOE A;  1ZYR F;  4EV0 A;  2P5V A;  2XHK A;  4LB6 B;  4LMY A;  1SFE A;  1TNT A;  3OOP A;  5DCM B;  3WTS C;  1R23 A;  1PUE E;  4I09 A;  1TNS A;  4RGX A;  4AWX B;  1LEB A;  3JAM K;  2XKP A;  1IN5 A;  1IXS B;  5LRR A;  4GYG A;  2OBP A;  5LGT A;  3CDH A;  3GW2 A;  2FMY A;  2GWR A;  2DI3 A;  3QP5 A;  1W7P D;  2V1X A;  2JRT A;  3TOA A;  2VBX A;  1J0R A;  1T98 A;  1XB4 A;  3Q5F A;  1O3R A;  1T39 A;  4MQV A;  4M9S A;  4HX7 A;  4LB5 A;  2FA5 A;  4M74 A;  2K86 A;  3K1M A;  1SMY F;  2L01 A;  1I1G A;  1D3Y A;  2YX7 A;  5L3C A;  2RDP A;  5F64 A;  4KIG A;  1ZRE A;  2UXN A;  1BI0 A;  2YSR A;  1IN4 A;  5D6F A;  1Z6R A;  2Z33 A;  2PBI A;  5CVU A;  2OU2 A;  3BRO A;  1CF7 A;  2HR3 A;  3T0Y A;  2IVM A;  4FX0 A;  4UVB A;  1ZGA A;  1BIB A;  2M87 A;  3FXQ A;  3CUQ A;  1QGP A;  1FOK A;  2STT A;  4WWC A;  4HA8 A;  4CXF A;  2ACJ A;  5FD6 A;  2CQK A;  2GZW A;  2IA0 A;  4ZYD A;  3QPT A;  2XRN A;  4MQ9 F;  1LDK B;  2O8X A;  5K5O A;  3QU6 A;  5D6E A;  2VBW A;  1BOA A;  2JZY A;  1OYY A;  1CF7 B;  1QZY A;  2QQB A;  3HOT A;  1YO5 C;  1XD7 A;  2DPU A;  5HDG A;  1SFX A;  1J7K A;  1IW7 F;  1LJ9 A;  1J5Y A;  3E6B A;  5HS8 A;  3E5X A;  3CUQ B;  4MEX F;  2W25 A;  4BH9 A;  2OZU A;  3E6D A;  3ZMZ A;  2L4M A;  1FP2 A;  3K0L A;  4OMZ A;  5DUK A;  1H0M A;  4RS8 A;  5H20 A;  2E1C A;  2MBF A;  2VE8 A;  4ASN A;  2RGV A;  2UXX A;  1FYM A;  4BHB A;  4KMU X;  1USS A;  4KDP A;  4BXU A;  1SAX A;  3G3Z A;  2DO7 A;  4RAY A;  1O3T A;  2ZKZ A;  2Q8K A;  2ISZ A;  1R1U A;  3C3W A;  3KFW X;  1ZRC A;  3HUG A;  2XAJ A;  2FEZ A;  4G9Y A;  2FOK A;  5HDN A;  3WTT C;  1O57 A;  3RPQ A;  2HZT A;  3EYY A;  3IWZ A;  4A0Y A;  2VBY A;  1T2K A;  1KU7 A;  1KQ8 A;  2EK5 A;  1FWZ A;  2QWW A;  3IRQ A;  2W84 A;  4O5V A;  2OD5 A;  2CSO A;  4A0X A;  1G3S A;  5LGU A;  3K2Z A;  3PQK A;  1XCV A;  5BS6 A;  2MA3 A;  4UV9 A;  4QLC U;  1MDM B;  1MJA A;  4Y15 A;  4RB1 A;  1YQA A;  3P7N A;  4EJO A;  2M5W A;  3LA7 A;  3FHZ A;  2Y48 A;  1YG2 A;  2RKH A;  5HLH A;  3TO9 A;  1R1V A;  1WWX A;  5E8G A;  2XRO A;  2ZME B;  2P6T A;  5DEQ A;  2V9V A;  4MTE A;  2HQN A;  3N4M A;  1R22 A;  3R6S A;  3HHG A;  2XAH A;  3EDP A;  2GAU A;  2QM3 A;  3DF8 A;  4KIF A;  2QEN A;  4OIN F;  2HQR A;  5ED4 A;  5EEH A;  2VE9 A;  4XLN F;  1HKT A;  2FQ3 A;  3LWF A;  1ON2 A;  1U78 A;  1YFH A;  5DYM A;  1TQM A;  4LK1 F;  3ZPL A;  3HOS A;  2KIM A;  5HVQ C;  4XRF A;  2NRA C;  3ISP A;  1ZLK A;  3O2P E;  1Y0U A;  4EGY A;  1EH7 A;  2ZNY A;  4PCQ A;  2FU4 A;  1BN5 A;  2R7F A;  3HSF A;  1XDS A;  3IWF A;  3IKT A;  3NQO A;  4M72 A;  5AON A;  5BMZ A;  4LG0 A;  3QOP A;  4GXO A;  1W7P A;  1ZG1 A;  1HKS A;  2P8T A;  5E20 A;  3T5X A;  3ZMV A;  2CW0 F;  5ICG A;  2PJP A;  4RGR A;  1R58 A;  1EV7 A;  1FPQ A;  1ZAO A;  4HLX A;  2YR2 A;  3HTS B;  1XSX A;  4M6Y A;  2PMH A;  5JR3 A;  1U8R A;  1IXC A;  2ZBK A;  3CO6 C;  2PI0 A;  3M1E A;  3BZ6 A;  3HIF A;  1PDN C;  1YS6 A;  1GXP A;  2FE3 A;  2PMU A;  2IA2 A;  1HQC A;  1LEA A;  4KT5 C;  3V8L A;  4IRI A;  3WGG A;  3AAF A;  1W7P B;  1ZGJ A;  2YPR A;  3KLN A;  4ZZL A;  1IF1 A;  2O61 A;  2STW A;  1KQ9 A;  1T38 A;  2IW5 A;  3GYH X;  3RKY A;  2ELH A;  3SQN A;  4IPA A;  1STZ A;  2DBB A;  2E1N A;  4WK8 F;  4RGS A;  4Y13 A;  3DKW A;  3OV8 A;  5F1R A;  1FC3 A;  1BM9 A;  2KJB A;  4HYE A;  2VN2 A;  1K7A A;  5FGM A;  3KP3 A;  3LA3 A;  4L9V A;  1PP8 F;  3C18 A;  4EM0 B;  1Q1H A;  3T8T A;  2G9W A;  5KVR A;  3GX4 X;  3F6O A;  3KCC A;  5JI6 A;  4CYD A;  3T8R A;  3DPT A;  1RI7 A;  4S04 A;  4BNC A;  3I58 A;  2ADU A;  1K6O A;  2VC0 A;  2VOO A;  3WTU C;  2F5D A;  1O3S A;  3E5U A;  5L3D A;  3F22 A;  4ESB A;  2X4H A;  5AIP A;  4OOI A;  1RZ4 A;  3I0T A;  3SFZ A;  1VTN C;  4XBF A;  2K4J A;  4BYY A;  1FYL A;  3BPV A;  2P7V B;  1XGS A;  4GCV A;  2DK5 A;  3NEU A;  3I4P A;  1OYI A;  3ZN0 A;  4L9N A;  5ERI A;  1YS7 A;  2LSO A;  2ESN A;  2ZJ2 A;  2VBZ A;  1MKM A;  2D45 A;  3V7R A;  1MJB A;  2A3S A;  1P4X A;  2AS5 F;  5JFR A;  2PLY A;  1FSE A;  4N9I A;  1FBQ A;  1IXR C;  1R00 A;  2RVC A;  3BDD A;  1UCR A;  3GFM A;  5IT3 A;  4Q5S F;  1F4K A;  1FT9 A;  2FBK A;  4HAM A;  3KP2 A;  2HYG D;  2M30 A;  5E1W A;  3IRR A;  2V1D A;  3ZN1 A;  3BPX A;  5LGN A;  1WRJ A;  1MJ9 A;  4XSZ F;  5LRS A;  3ZMD A;  1R7J A;  5E8I A;  1YLF A;  1DPR A;  2FNP A;  4EQQ A;  3CUQ C;  4LJZ F;  3F8F A;  4I2O A;  4CIC A;  2PN6 A;  2IJL A;  4I01 A;  4FX4 A;  5FO5 A;  1U2W A;  2W24 A;  1B9M A;  3WE3 A;  1E17 A;  4I0B A;  5E17 F;  5E1Z B;  3O3K A;  3RPU A;  3IL2 A;  4IRH A;  5IT9 K;  2PFB A;  1O7L A;  4U0Y A;  4JBA A;  4ENN A;  4KMF A;  2OZ6 A;  4I02 A;  1TW3 A;  4U7B A;  4S05 A;  4LLL A;  4R8H A;  1BI1 A;  1UST A;  4G7O F;  2KIF A;  4ZZD A;  2VON A;  1RUN A;  4UVA A;  1FSH A;  5FLX K;  2ETH A;  2D2W A;  5D5U B;  4IXA A;  5HLG A;  1W5S A;  4BHP A;  2ZO4 A;  5DUI A;  2E7W A;  1XGN A;  4ESF A;  3JAM Z;  5ILU A;  4G7H F;  1KYZ A;  4AIJ A;  5LEK A;  1KU9 A;  3WTZ A;  3E6C C;  1TW2 A;  3J81 K;  3I54 A;  3RKW A;  4XLP F;  4GYI A;  3RYP A;  1TLH B;  1QZZ A;  1P2F A;  2D1V A;  1S29 A;  2LDU A;  4M71 A;  2FNA A;  2M45 A;  1YIO A;  4PDK A;  1R36 A;  3KP7 A;  4UHT A;  3KEO A;  1Z6T A;  2V79 A;  4N0B A;  4FT8 A;  2K27 A;  3QPH A;  2O6G E;  1ON1 A;  3WOD F;  4ZH4 F;  4YG2 F;  2F5C A;  3O6B B;  1G3W A;  3EYI A;  3VB2 A;  5FFZ A;  4UVC A;  1LQ1 A;  4KIC A;  3BWG A;  5K5Q A;  4EJU A;  4ENJ A;  2BE5 F;  5DV5 A;  1I1S A;  1U3E M;  3WTW C;  1ZHF A;  3RDI A;  1RNL A;  2EFW A;  4CO8 A;  4M9X A;  2H09 A;  3F8N A;  1FYK A;  2OQG A;  2Z5U A;  5H6Q A;  3ROU A;  3BJ6 A;  3J81 Z;  5D4R A;  1U5T A;  2KIU A;  2J5O A;  1BIA A;  2JPC A;  1UHM A;  4YFX F;  4NQW A;  1FBU A;  4KNY A;  3HRM A;  3I71 A;  3G73 A;  2DFI A;  2FBI A;  5E18 F;  3DFG A;  1QBJ A;  3BJA A;  4HW0 A;  1I27 A;  2LNB A;  1SD4 A;  3BY6 A;  1MDM A;  2LKP A;  2MD5 A;  1JE8 A;  3ELK A;  5A2Q K;  4CDG A;  2A69 F;  2TDX A;  5FD5 A;  1AOY A;  3KLO A;  4A2U A;  4K2E A;  4G6D A;  4ZYG A;  3JSP A;  2UZK A;  3ECO A;  4I7H A;  2ZME A;  4EMS A;  1R5H A;  1U5T B;  1WKM A;  3HTU A;  1FNN A;  1TBX A;  2DAO A;  1AWC A;  5J6X A;  1BC8 C;  5HS9 A;  3FF5 A;  1FBS A;  1FY7 A;  4Y17 A;  1QQI A;  1DPU A;  3R60 A;  3GLX A;  4P96 A;  1BBY A;  3M8E A;  3WGI A;  1HXD A;  2GQQ A;  5LEJ A;  1CGP A;  1YW9 A;  2O3F A;  1EH6 A;  2DQR A;  3W6J B;  4KYW A;  1SFU A;  4WXD A;  3WGH A;  1XMA A;  4ESJ A;  4H0E A;  2V6C A;  1BC7 C;  2JSC A;  3R0A A;  1JHF A;  3KE2 A;  1LDD A;  3L2C A;  2PEX A;  4A0Z A;  3J80 K;  3R0J A;  5LHI A;  2QBY A;  3P9I A;  2ZXJ A;  4KA4 A;  2E7X A;  3KP6 A;  2VC1 A;  5CJ9 A;  2GA1 A;  4RB3 C;  4BHC A;  4JK1 X;  3D0S A;  1LNW A;  3TQN A;  2G7H A;  3GFI A;  1B1B A;  4EJV A;  3HRU A;  5EEG A;  4EJW A;  1W4M A;  5HDK A;  2WWY A;  1Z9C A; 
#chains in the Genus database with same CATH topology
 2DPD A;  3BR6 A;  2ELK A;  1G6N A;  3OYB A;  2NS8 A;  5ICF A;  2YX4 A;  3RKX A;  4P5O A;  2WBM A;  1KYW A;  2JSP A;  5CLS A;  2GLO A;  3EQL F;  3FXJ A;  4MNU A;  1IC8 A;  1KA8 A;  1VQ5 I;  3DV8 A;  4MHG A;  1OR7 A;  3HRS A;  2CQN A;  1EKE A;  2H6C A;  1KGS A;  5C3E J;  1NTC A;  2ZXW H;  1X3U A;  1WJE A;  5D5W B;  5DM7 F;  1WJ5 A;  2QBY B;  4JQF A;  2O0Y A;  2X1D A;  1ACI A;  2IGM A;  3K1N A;  4YIR X;  1TZL A;  5KK1 A;  2DU9 A;  2VPL A;  2HEO A;  4L9T A;  2Z99 A;  1RUO A;  2M1B A;  1ETY A;  1XG1 A;  2Y0M A;  1BI3 A;  4JYK A;  3SZP A;  2ZFU A;  1R4M B;  2IA1 A;  2WY8 Q;  4P55 A;  2NAZ A;  2R3S A;  1E2X A;  1TWG J;  3J80 Z;  1JTY A;  2W1O A;  2CFX A;  1IDZ A;  2VL8 A;  1Y0N A;  3CJN A;  4A6E A;  2LRD A;  4WCG A;  2YU3 A;  2HQA A;  1P6R A;  3CLO A;  1XC5 A;  3CCM I;  2JA7 J;  2G0E A;  1O3Q A;  5F0H A;  3ZQ7 A;  3HOZ J;  3ZQC A;  3AL0 C;  1S7O A;  3F72 A;  4XKB A;  3RTR A;  3SHF A;  2P5K A;  4HOB A;  4N4N B;  3TDU C;  2HDC A;  4A6D A;  5BPI A;  2ICW G;  2F5E A;  1LFB A;  1ZN2 A;  2FD5 A;  5IYC J;  3FDY A;  4R1H A;  3MCZ A;  3W3C A;  1F1Z A;  2G7U A;  5EGO A;  4E7L A;  1ETK A;  4L18 B;  1IRF A;  1Y6I A;  1JKO C;  3G1L A;  4U88 A;  3VPR A;  2H6B A;  3QYB A;  2IT0 A;  3GFL A;  3DKX A;  1TWF J;  3CCQ I;  4L9J A;  2Z3Y A;  1J59 A;  2KRC A;  2L9N A;  1K4S A;  3JCU C;  2ZCW A;  4LK0 F;  1BL0 A;  4XKW A;  1X3W B;  2H1L A;  4IZZ A;  5CVR A;  1G59 A;  4FHT A;  1MNM C;  2Y9Y A;  3A01 A;  1UFM A;  4E70 A;  4RB2 C;  2JPB A;  2XAF A;  3L7W A;  3V7C A;  2Y9Z A;  4CCM A;  2PQ8 A;  3MQ0 A;  1V4R A;  3WU0 A;  2DT6 A;  2PMZ N;  2COB A;  3CD6 I;  3KZI C;  4WXC A;  2P5L C;  5HLT A;  2O03 A;  1MBJ A;  3BR5 A;  4P9F A;  1KU2 A;  3VYS B;  3FXR A;  3M07 A;  3OIP A;  3I53 A;  2K9S A;  2KFD A;  2GOM A;  4MFE A;  4HQE A;  4YEL A;  4I98 B;  5EGO B;  4ENK A;  1NK3 P;  4U0W A;  2Q2E B;  1MBE A;  2DA2 A;  4BAY A;  4EVI A;  1P4A A;  2DT5 A;  3U2R A;  1B72 A;  4F7Z A;  3OYF A;  2VUM J;  4PGG A;  2CGP A;  2ZSH B;  2DW4 A;  4HX4 A;  1VQK I;  1TWA J;  2EH3 A;  3PSF A;  3PO2 J;  3RYR A;  3CP8 A;  1G4D A;  2KLO A;  2XUB A;  3V8J A;  4U0V A;  3IHU A;  1SD6 A;  4V2G A;  4ETS A;  4A69 C;  1HCR A;  3DBL B;  4I0A A;  1R5G A;  2Y30 A;  5TJJ A;  2Y75 A;  2EA2 A;  1AHD P;  2HPI A;  1R4N B;  3LA2 A;  1X1B A;  2FSW A;  5CVV A;  2YUS A;  2B63 J;  4XSX F;  5EG0 A;  3F6V A;  5KCM A;  5DD4 A;  3OYH A;  3A01 B;  5HOO A;  3D5L A;  3S16 J;  2RN7 A;  1QZE A;  1JKR C;  3ZXS A;  2JA2 A;  3HB9 A;  4EAT A;  3K2A A;  3K1P A;  4CYC A;  2QEX I;  2FRH A;  3WG9 A;  3GEZ A;  5L3E A;  5FKO A;  5AIQ A;  3VEP A;  4RAZ A;  4AD9 A;  2IGO A;  1YIT I;  4HF0 A;  3BTL A;  3GF2 A;  1R9T J;  5GTH C;  5KAI C;  5H6R A;  4ANJ A;  1HBX G;  5IP7 J;  5L3G A;  1ZH5 A;  2WB1 A;  3LAJ A;  2DA7 A;  3VDX A;  1B6A A;  2L9R A;  4C2U A;  3RZO J;  1XGM A;  2KZV A;  3LST A;  4BQA A;  2A07 F;  1G8X A;  4XIC A;  2LVS A;  3ML6 A;  4PGH A;  4BEH A;  5LBQ A;  2ID6 A;  2JT1 A;  4E6K G;  1APL C;  1GHC A;  2K02 A;  2A6H F;  3FM3 A;  2V4J C;  2EA4 A;  3V8K A;  1J9I A;  4OIQ F;  3QPL A;  1UB9 A;  5IYD J;  2QUF A;  3SEQ A;  3OYC A;  2BW3 A;  1HDP A;  1JTX A;  2VXZ A;  4IHS A;  2VAS A;  3QAH A;  1RC9 A;  2AXT C;  4M3E A;  1FOY A;  3S15 J;  2ZSI B;  2O9L A;  2FQ4 A;  5EZH A;  3M7G A;  1X2N A;  3FMS A;  4BXX J;  1YX3 A;  1A04 A;  2DYR H;  1LKX A;  3S1N J;  2EJR A;  3LFK A;  4OIP F;  5IP6 A;  1IUY A;  2ZJP F;  1RES A;  1DP7 P;  2L54 A;  2EV0 A;  3GFJ A;  2VJJ A;  5FKL A;  1ZLJ A;  3RSN A;  3SEZ A;  3JRC A;  3W2V A;  4BE0 A;  3Q0W A;  3OYD A;  3SYT A;  3E5Q A;  4IVN A;  2I8D A;  3H92 A;  5LHG A;  3M9A A;  3U9G A;  1I3Q J;  1I6H J;  5FKN A;  2VIX A;  2GXG A;  3BT9 A;  2JTV A;  1D1C A;  1ZK8 A;  3CJT B;  2HTJ A;  4JP0 A;  2OQR A;  5IP9 J;  2HYF A;  3TO7 A;  2L4A A;  4O3M A;  3K4C A;  2W00 A;  2K7L A;  5J8C A;  1VQN I;  2WB1 N;  4DNC A;  3LSH A;  4UUV A;  2M3A A;  2BW3 B;  1YW8 A;  1OKR A;  1X1P A;  5F04 A;  1S72 I;  2RV8 A;  3BOQ A;  4EEF G;  4A3G J;  3RJP A;  1WZ2 A;  1LB2 A;  4M6X A;  2E2H J;  4D0P A;  4NC7 A;  2H94 A;  4MEY F;  3BLY A;  3ZQF A;  1VQ4 I;  2OF7 A;  5CYV A;  2V9K A;  3GLL A;  3GZN B;  4A3C J;  1A36 A;  3J7Z I;  1I39 A;  4AIK A;  3S1R J;  2HOA A;  1QHG A;  2KIQ A;  3EUA A;  4GGG A;  3MMY B;  2C6Y A;  2IRF G;  2CO5 A;  3C1D A;  2KP6 A;  1MBF A;  2EV5 A;  4CSW A;  4A12 A;  3BCB A;  3FXU A;  5KAF C;  2CQQ A;  4F92 B;  3DWL E;  5IOZ A;  1YW7 A;  5FRO A;  2EFP A;  3ZP5 A;  2QVO A;  3C2B A;  1DGW Y;  4ITV A;  3P9K A;  3ABU A;  3BG7 A;  1VQ8 I;  2OTL I;  2VOP A;  3PL8 A;  5E3L A;  4FAS D;  3CC7 I;  4L0Z B;  4XOT A;  2EWN A;  3IV5 A;  3AG2 H;  4ZTF A;  2NNY A;  1MD0 A;  4QWQ A;  2B7E A;  3R4K A;  1FLI A;  4S0H B;  3KET A;  4A3D J;  3GXO A;  3M1C A;  4L5E A;  3BJO A;  3EUH A;  1RIO H;  5J4V A;  2W48 A;  4AIH A;  3ECH A;  3HOY J;  3C7J A;  2MLK A;  1BJZ A;  1P4W A;  3JTH A;  1D5Y A;  3U1D A;  2L5Q A;  3RCO A;  3KZZ A;  1Y8Q B;  2HS5 A;  2HXO A;  3GBG A;  3MD2 A;  4B09 A;  2MC4 A;  4XLE A;  1N25 A;  1ZAR A;  2M4G A;  3H35 A;  5CQG A;  1WH5 A;  3QP6 A;  2VQL A;  3BG5 A;  1MBG A;  1TQP A;  1U5T C;  1XSV A;  3BG9 A;  3TKY A;  3OSG A;  2WTE A;  5LHH A;  4KN7 X;  4HLY A;  2XB0 X;  3I64 A;  3MEX A;  1S7E A;  5D8L B;  4NC6 A;  1UJ8 A;  2DMU A;  1Z91 A;  4XON A;  4QSH A;  3OYL A;  4Q48 A;  4PFO A;  4PUS A;  4F55 A;  2EFO A;  1NHA A;  3S8P A;  4PJJ A;  2R7D A;  3F8C A;  3HYI A;  3E1S A;  2RC4 A;  3SFI A;  3G71 I;  3RI4 A;  4P1W A;  5JLX A;  4WX9 A;  1BJA A;  3UR3 C;  2H1K A;  4UUS A;  1E3H A;  2HKO A;  1F5T A;  1J2X A;  5IT9 Z;  4J19 A;  4HQM A;  4MLO A;  3TP3 A;  2VT3 A;  4NB5 A;  5TRD A;  1EJ9 A;  3WE2 A;  1RPW A;  3FZV A;  4Z2Y A;  3S32 A;  2XSD C;  2XPU A;  5TIS C;  2M0C A;  3A0H C;  3LAP A;  3WTV C;  1T0F A;  2ESH A;  3LMM A;  1JI8 A;  2A61 A;  3E7L A;  3GTJ J;  2XB5 A;  1QPM A;  1J09 A;  3KP4 A;  4IHT A;  1HW5 A;  3L00 A;  3FMR A;  3AG4 H;  1MBK A;  1SMT A;  1HC8 A;  2OAZ A;  5FFX A;  2OV7 A;  4IQ4 A;  5ILV A;  2RNG A;  4B3X A;  1XSD A;  1Z21 A;  1OCP A;  4N9H A;  3PO3 J;  2CH0 A;  3P9C A;  3WHC A;  3ZMT A;  4DJA A;  4DQ2 A;  1I5Z A;  5FLX Z;  4B3A A;  1FMV A;  3I9V 2;  4IEJ A;  2V7F A;  4V19 K;  4AYB A;  3DU5 A;  1K79 A;  3QQA A;  3E6M A;  1MGT A;  2CG4 A;  2NS0 A;  1X1D A;  3D5S C;  2HOE A;  2EZH A;  4A3K J;  1FP1 D;  2VT2 A;  3WU1 B;  4BY7 J;  2MAB A;  3L9F A;  1DUX C;  5FLV A;  1TP4 A;  2JN6 A;  4HDU A;  3ERE D;  3OL4 A;  1E3O C;  5DCF A;  2EBI A;  3MWM A;  4IRG A;  5GAH J;  3CO7 C;  3HJE A;  2R0Q C;  4XMY A;  1EA3 A;  4L5J A;  5CVJ A;  1ZG5 A;  2D1H A;  1K61 A;  4KIB A;  2RQP A;  2A05 A;  3L2Q A;  3IC7 A;  2FF4 A;  2DA5 A;  1IRX A;  2MLG A;  4QPO A;  3JRG A;  1R49 A;  3MN2 A;  2PG4 A;  1TWC J;  2GIV A;  3PQJ A;  3M8F A;  5DDG A;  1ZRD A;  2HYJ A;  1JJ6 C;  3HHH A;  1PP7 U;  3I56 I;  4E7J A;  2J5P A;  1IZ1 A;  1YYV A;  2HGC A;  2VKD A;  3HG9 A;  3K4M A;  5ICC A;  4UB8 C;  3TMO A;  1V5G A;  3B73 A;  1XN7 A;  3F0C A;  1MZB A;  1JGS A;  2XKO A;  1KQ0 A;  3GTG J;  1DU6 A;  1D8K A;  5J8F A;  5IYB J;  4ENM A;  1D0Y A;  3B02 A;  3F8M A;  2A6E F;  3W6K B;  4XOP A;  4ON0 A;  3WTX C;  3PUF A;  1KU3 A;  1JXS A;  1YE9 A;  1Z3Y A;  3K70 D;  5D4S A;  2DQL A;  1HW2 A;  4KUM A;  2E1O A;  5BQT A;  3J7A O;  1G3Y A;  4IKF A;  2M7B A;  1FJL A;  1YJW I;  4WF2 A;  2M4K A;  1QPI A;  1REP C;  3VOD A;  1ITY A;  5BNG A;  4LIU A;  1FIP A;  5J47 A;  3KP5 A;  1ULY A;  1WJF A;  3GO5 A;  2LF7 A;  2HFH A;  2BGC A;  1G3T A;  1ODD A;  2CYY A;  3H3U A;  2H27 A;  2DDA A;  3PNY A;  2W4S A;  3TO6 A;  2XAQ A;  5GAD J;  2YS9 A;  1IAW A;  2DA3 A;  4IHV A;  4W1U A;  1YHQ I;  2GA2 A;  2JQ7 A;  2WC2 A;  3V7S A;  1TQI A;  3R61 A;  3NRV A;  4FIS A;  4CCL A;  4EJT A;  3GTP J;  1IRG A;  4Y7N J;  3OR1 C;  2W57 A;  1QNT A;  1OR7 C;  3TED A;  1ZR2 A;  3S1Q J;  1T8I A;  3U21 A;  4CGZ A;  2EFQ A;  1L3L A;  4KIT B;  3BP8 A;  3HDD A;  1H9G A;  1MBH A;  3BTI A;  1FZP B;  1YRN A;  2LKX A;  1LPQ A;  2MH9 A;  4ZTJ A;  2DOA A;  4N4O B;  1E0E A;  4ZDP A;  3K4K A;  5B5E C;  4R79 A;  3HOU J;  5CVI A;  3N97 A;  3K7A J;  2BBY A;  3CTA A;  4NDL A;  5J1Y A;  5K7F A;  2FBH A;  1Z3X A;  1O4X A;  4IJA A;  2MH2 A;  3H36 A;  5J1U A;  2VOD A;  5D5V B;  2KT0 A;  3L2R A;  1SD5 A;  2DN0 A;  1LDJ A;  2R92 J;  1C0W A;  5A2Q Z;  2KJC A;  2XF6 A;  4XM3 A;  5FJ8 J;  3REO A;  4XNF A;  3HSR A;  4GO1 A;  4CZZ A;  5E3M A;  3F23 A;  2HWV A;  1T6S A;  3L2W A;  4A5N A;  2M2E A;  4L0Y B;  1R5I D;  1X1A A;  2K4B A;  3UNG C;  2OCE A;  4BDY A;  3VFZ A;  4PZJ A;  1OJL A;  1SD7 A;  4Q47 A;  2F5F A;  1T33 A;  4G8X A;  2OA4 A;  2NYX A;  4I6Z A;  3GUD A;  3RZD J;  2V6E A;  4M3D A;  2VJ4 A;  1SAN A;  3P5J A;  1K78 A;  1UEL B;  1MIJ A;  4L5I A;  3Q3S A;  4G7Z F;  3HRT A;  4M73 A;  4BXF A;  1TTY A;  1U0J A;  2MFZ A;  1U6G A;  1YRN B;  5K1Y A;  2ISY A;  2W85 A;  1XCB A;  2GBY A;  3FK7 A;  3FIW A;  3CME I;  1HW1 A;  1DP3 A;  2ZXI A;  2F4O B;  2ZNZ A;  3LQQ A;  3CP2 A;  1PVE A;  1ONV A;  1D1B A;  2HTS A;  2P4W A;  2W82 A;  1KZH A;  2A68 F;  2DYS H;  4MGR A;  3GTO J;  4HZF A;  2LRE A;  1S7A A;  2ME0 A;  3MAJ A;  3LSG A;  3Q9S A;  4UXN A;  2BY0 A;  5ICE A;  1O7F A;  1WI3 A;  2AQF A;  2CUZ A;  4PFP A;  2GXB A;  1R1T A;  3FX3 A;  3KYL A;  5IOY A;  3PFI A;  5D5X B;  3DP7 A;  2R5Y A;  3DEW A;  4UNO A;  4HF1 A;  2L7K A;  3ZMU A;  3TGN A;  5HS7 A;  3FK6 A;  4LG3 A;  4JX4 A;  2Q1Z B;  5B66 C;  3QRF F;  4B8X A;  1J75 A;  3HM5 A;  2XV4 S;  3AG1 H;  2DTZ A;  2X85 A;  1DDN A;  3DXJ F;  4HEA 2;  4XRS A;  2K40 A;  2DMN A;  1B8I B;  4HV6 A;  2XAS A;  2QLZ A;  4E7S A;  4OIO F;  3G2B A;  2V1U A;  4YII A;  1BA5 A;  2COM A;  3ONQ A;  4HG2 A;  3KX2 A;  1OMI A;  3OYI A;  2XIG A;  1ZQ3 P;  4YFK F;  3RIR A;  1L0O C;  2QQ8 A;  1B9N A;  3C2H A;  1K78 B;  1AU7 A;  3I5U A;  4A5M A;  2CMP A;  5ILS A;  2DFH A;  2Z9O A;  2L7Z A;  5FB2 A;  1ETV A;  3FXO A;  4LGW A;  2CU7 A;  4EM2 A;  3S2W A;  1JJ8 C;  4IOA F;  3DKY A;  5HNF A;  1B4A A;  2M8E A;  4U7D A;  4EM1 A;  1SAU A;  1WJD A;  4D5F A;  1FOX A;  1XMK A;  4YEJ A;  2GXA A;  2B0L A;  4UV8 A;  3DQV C;  2QSH X;  5E1X A;  5L3B A;  1JUM A;  1Z05 A;  2FML A;  4ZYH A;  4NHJ A;  1IN8 A;  2MG4 A;  4Q4Z F;  3N05 A;  4C9Y A;  5DD8 A;  2EB7 A;  1FMW A;  4PSX A;  4LLN A;  2R5Y B;  3SXY A;  3ABT A;  4OAZ A;  2HU9 A;  4MO7 A;  1V5E A;  2UWM A;  1YOV B;  1FIA A;  2Q2E A;  2MD0 A;  2DK8 A;  2IPQ X;  3A02 A;  4HDV A;  1WPK A;  4YFN F;  2P6S A;  1ETX A;  3HBL A;  3K4N A;  2A5Y B;  2EIK H;  2R7Z J;  2IS2 A;  3Q0V A;  4XKV A;  5M5W J;  4Y4R A;  2IS6 A;  2KRF A;  2R5Z B;  2QQ9 A;  3L09 A;  1FX7 A;  1JHH A;  3ZQI A;  2QQA A;  3T1B A;  2DMT A;  3VSL A;  3BG6 A;  1T95 A;  3F21 A;  4KFC A;  3PM1 A;  2XC7 A;  2E36 A;  1S8N A;  3ULQ B;  4LLG F;  2EFN A;  1HSJ A;  3F8B A;  5K5R A;  4LG0 B;  1XDU A;  3BQY A;  2XGX A;  1GXQ A;  3MFK A;  5K7H A;  2ZJQ F;  4RM3 A;  2I10 A;  2NS7 A;  4PJ0 C;  3FMQ A;  3GWZ A;  4DBQ A;  1P7J A;  1WQ2 A;  2BY3 A;  1S3J A;  5TGT A;  2NXN B;  2BZT A;  5HLI A;  1K83 J;  4G94 A;  5B1A H;  2QSF X;  2LY9 A;  2CWE A;  4KN4 X;  3SZT A;  1D8J A;  2QZ8 A;  2L02 A;  1ORK A;  5D8K B;  2KMU A;  2WV0 A;  5L3F A;  1I6X A;  1QO0 D;  1U8B A;  3W6V A;  4IF4 A;  1VI0 A;  1IN6 A;  2DLL A;  4I99 C;  3HOX J;  2LD5 A;  1N77 A;  4GDF A;  2JWT A;  4IHW A;  1F9N A;  1XX5 A;  4PSW A;  4BE1 A;  2F5V A;  1IJW C;  1XGO A;  4XLF A;  3IAS 2;  4M9Z A;  4C30 A;  3K9T A;  4IQJ A;  1YI2 I;  4HF2 A;  2K85 A;  2MC3 A;  5FKM A;  2L7M P;  3BTJ A;  1PUF B;  1WI9 A;  3FM5 A;  2Z1D A;  1B59 A;  3H3Z A;  3L2U A;  1GLN A;  3KPH A;  1S6L A;  1TT5 B;  2DTR A;  1BR4 A;  1OQY A;  3Q0U A;  1ZRF A;  4P9U A;  1LVA A;  1HKQ A;  3TDZ C;  1YJN I;  1IN7 A;  3K69 A;  2BXZ A;  4H4K C;  4E7K A;  4HV5 A;  3GVA A;  1YTY A;  1V3F A;  3E3V A;  2BV6 A;  2RNJ A;  4LD5 A;  3DPL C;  3GZ6 A;  3EET A;  2XVC A;  3MZH A;  1WSU A;  2BYV E;  3JTG A;  4YIF A;  2XAG A;  4RMN A;  4MTD A;  5F27 A;  1WCM J;  2F4I A;  3OYM A;  1TWH J;  3I59 A;  3MZY A;  4HBL A;  2D5V A;  4O6J A;  1H9T A;  4HRI A;  4D5C A;  5JHU A;  2CQ7 A;  1GUU A;  2JUC A;  1Y56 A;  3S2H J;  4CH7 A;  4TV7 A;  1QHH D;  1PJR A;  2X0L A;  3KEQ A;  1X1C A;  5BPD A;  3W2A A;  3AFH A;  2NVT J;  4A3L J;  4G6Q A;  3TOB A;  1IUF A;  1Z77 A;  1NK2 P;  5BOX A;  5DM6 F;  2ZFW A;  3QPS A;  4BKX A;  2DA1 A;  2VJI A;  4RB0 A;  4BGD A;  3FXM A;  2HDW A;  3WTY C;  1ZG3 A;  3CJQ B;  1HDD C;  2HOT A;  4CHU A;  1RKT A;  2IP2 A;  2F2E A;  2HKX A;  3GZ5 A;  2XRL A;  2EIM H;  4AVP A;  2FXA A;  4HNT A;  1Z1D A;  4JX6 A;  2KL4 A;  1A6Q A;  1HST A;  2AXL A;  4ZYE A;  4OMY A;  1ERD A;  3GTM J;  3SZG A;  4I76 A;  2BEO A;  3E97 A;  2Y0S A;  4OU0 A;  1P7I A;  1S9H A;  2F6C A;  4BUP A;  4E7H A;  3F3X A;  5DCM A;  4WXH A;  4HNV A;  1P92 A;  3HSE A;  5LLQ A;  3JSO A;  1W5T A;  2NNN A;  2OTJ I;  2VPR A;  3L2V A;  1Z7U A;  3I59 B;  3LQR A;  5C4X J;  3SJM A;  3EUH C;  3ZMS A;  2K9M A;  3JW4 A;  4RGU A;  5F6F A;  4ABZ A;  3COA C;  1VZ0 A;  3V4G A;  3DEU A;  3HXL A;  2P7C B;  4GRI A;  2Z16 A;  3DEE A;  1BI2 A;  3D1N I;  3HGG A;  1W36 C;  3BQZ A;  3CUO A;  3HEF A;  4MFD A;  3CCR I;  2LF8 A;  3IUO A;  4LFU A;  4OIR F;  2DFF A;  2EV6 A;  2LMD A;  3HL2 A;  4DGW B;  1OYW A;  3Q9V A;  2IXS A;  2QYO A;  3CMA I;  1UHW A;  2L3D A;  6PAX A;  3BTC A;  3KZY A;  4NUB A;  1XS9 A;  2M0M A;  1EH8 A;  1D5V A;  1GVJ A;  2Q0O A;  4HX8 A;  2HQ5 A;  2KKO A;  3IKV A;  3QU3 A;  1VQO I;  1VFC A;  3FWE A;  1OPC A;  5JVT A;  4EGZ A;  2CFO A;  4BY1 J;  4B47 A;  4C3I J;  4RM2 A;  1K6Y A;  3JRH A;  2K9L A;  3VOE A;  1ZYR F;  4EV0 A;  2P5V A;  2XHK A;  4LIT A;  4LB6 B;  4II3 A;  4LMY A;  3AG3 H;  3SDG A;  1SFE A;  3JRE A;  3K4B A;  2WV1 A;  1FTT A;  1TNT A;  2DA6 A;  3OOP A;  2PJR B;  4BJ5 C;  5DCM B;  3WTS C;  1R23 A;  3ERM A;  5F0C A;  1PUE E;  4BQQ A;  4I09 A;  1TNS A;  3CCS I;  4RGX A;  4DIQ A;  2H8W A;  3H5N A;  4B4C A;  4AWX B;  4HPQ A;  1LEB A;  3JAM K;  1T08 B;  2XKP A;  1IN5 A;  1IXS B;  1T0F C;  2CRG A;  4GYG A;  5LRR A;  4F52 A;  2OBP A;  5LGT A;  4DZP A;  3CDH A;  3H3V K;  3K6G A;  3GW2 A;  2Y0S N;  2FMY A;  3BCA A;  2GWR A;  3A2K A;  2GOX B;  3CCJ I;  2DI3 A;  3HKZ A;  1N75 A;  3QP5 A;  3ASO H;  1W7P D;  2V1X A;  2LR8 A;  2K3P A;  2JRT A;  3TOA A;  3ZCO A;  2VBX A;  1J0R A;  1T98 A;  1XB4 A;  3Q5F A;  2FUG 2;  1O3R A;  2DOE A;  1T39 A;  2VJ5 A;  5M3M J;  3OIO A;  4Y33 A;  4MQV A;  4M9S A;  5KNL A;  4HX7 A;  4LB5 A;  1VF9 A;  3BR0 A;  2FA5 A;  3B6C A;  3IH2 A;  4M74 A;  4XK4 A;  5E3O A;  5FRM A;  2K86 A;  4AM3 A;  3GME A;  2O7O A;  3PIO F;  2PX9 A;  4A3F J;  1WH7 A;  3BZC A;  2X51 A;  3K1M A;  1SMY F;  2L01 A;  3DTE A;  5GPC A;  2VQH A;  1IG7 A;  1I1G A;  1D3Y A;  2YX7 A;  2P0W A;  5L3C A;  4XQF A;  2RDP A;  5F64 A;  1A5J A;  4Y3O A;  5GAE J;  4KIG A;  1ZRE A;  2P81 A;  2R93 J;  3FKJ A;  2UXN A;  2XPV A;  5F08 A;  1BI0 A;  2YSR A;  3K4J A;  4ZDO A;  1IN4 A;  1UHS A;  2DMP A;  3G4S I;  5D6F A;  3LSP A;  1Z6R A;  1PYV A;  4C3J J;  2Z33 A;  2PBI A;  2R7R A;  1MW7 A;  2DOD A;  1BOB A;  5CVU A;  2RRE A;  4AU7 A;  2OU2 A;  3BRO A;  2LG4 A;  4RLQ A;  1DQU A;  5JLW A;  1CF7 A;  1MSF C;  2HR3 A;  3T0Y A;  2IVM A;  3CMM A;  3PSI A;  4FX0 A;  3H0D A;  2EPF A;  4UVB A;  2CV0 A;  1ZGA A;  2A6T A;  3DBH B;  1X2M A;  1BIB A;  3W2W A;  2M87 A;  2DMQ A;  1H88 C;  4Y52 J;  2KDZ A;  3IH3 A;  2LFB A;  4UY8 I;  3FXQ A;  1WJB A;  4BAC A;  3CUQ A;  1QGP A;  4CCJ A;  1FOK A;  5F0F A;  2STT A;  2DJN A;  2JUG A;  1AKH A;  4WWC A;  3ABK H;  3CLQ A;  4HA8 A;  4CXF A;  2ACJ A;  5FD6 A;  2CQK A;  2HVS A;  4BQO A;  2GZW A;  2IA0 A;  4ZYD A;  2IAI A;  4J00 A;  3QPT A;  2XRN A;  1HOM A;  4MQ9 F;  1LDK B;  2IBD A;  2IGN A;  2O8X A;  2VKE A;  5K5O A;  3QU6 A;  1D1A A;  1TT0 A;  3OYN A;  4XRM A;  3MKZ A;  3UKG A;  1MMN A;  1VND A;  5JHF A;  3S17 J;  4HST A;  5D6E A;  2VBW A;  4XLA A;  4AVZ A;  4KIS A;  1BOA A;  3JR9 A;  2JZY A;  3TW7 A;  1OYY A;  2OUM A;  1CF7 B;  2NVU B;  1MNE A;  3BR1 A;  1WJC A;  1QZY A;  2NVY J;  2QQB A;  1NH3 A;  1MMS A;  1A6I A;  3HOT A;  4C2T A;  1YO5 C;  5HOD A;  1XD7 A;  3QYE A;  2DPU A;  4HNU A;  4BJT A;  5HDG A;  3U1K A;  4XRS G;  1SFX A;  4UB6 C;  1J7K A;  1LVK A;  1IW7 F;  1FOW A;  4RBO A;  1LJ9 A;  3LSK A;  1J5Y A;  2K9Q A;  3E6B A;  1V55 H;  5HS8 A;  3E5X A;  2LY1 A;  3CUQ B;  3DTK A;  4MEX F;  2W25 A;  3OR2 C;  4BH9 A;  2E34 A;  1AKH B;  3GTQ J;  2OZU A;  3E6D A;  3CC2 I;  3ZMZ A;  2L4M A;  3M8J A;  2BY1 A;  1FP2 A;  3K0L A;  5LD2 C;  4OMZ A;  5DUK A;  1K4T A;  1H0M A;  2LH9 A;  4RS8 A;  2EZI A;  5H20 A;  2E1C A;  2MBF A;  2VE8 A;  2X1C A;  3CF2 A;  4II2 A;  4ASN A;  3OYK A;  2RGV A;  2UXX A;  2X6W A;  2XPW A;  1FYM A;  4E7Z A;  1W1W E;  4BHB A;  1OCZ H;  4B43 A;  2Y31 A;  2R7U A;  4KMU X;  2QCO A;  1USS A;  4NBQ A;  4KDP A;  4BXU A;  3IAM 2;  1SAX A;  4RAG A;  3A1Y A;  2HNH A;  3G3Z A;  2DO7 A;  3TBI A;  3PFY A;  4RAY A;  1O3T A;  2MW8 A;  4BBR J;  1VQ6 I;  2ZKZ A;  2Q8K A;  2ISZ A;  4Z6Y A;  2E1M B;  2R7T A;  1R1U A;  3S1M J;  4AYB N;  3C3W A;  3PNV A;  3KFW X;  1ZRC A;  2KPM A;  3HUG A;  3LOC A;  2XAJ A;  2FEZ A;  3OL3 A;  4G9Y A;  2JA6 J;  2FOK A;  5HDN A;  3WTT C;  3JRA A;  1O57 A;  1MMG A;  3CJR B;  3RPQ A;  4A3J J;  3CDI A;  4QTR A;  2ELJ A;  3CCE I;  2HZT A;  3EYY A;  1WGX A;  3GCM A;  3OYG A;  5EYR A;  1OCO H;  3IWZ A;  4A0Y A;  2QA4 I;  2VBY A;  4C2M J;  1T2K A;  2RQQ A;  5B3S H;  1KU7 A;  4X6A J;  1IO2 A;  2EK5 A;  1KQ8 A;  4NQW B;  4XN3 A;  2OC6 A;  1OCT C;  1FWZ A;  2QWW A;  3FIS A;  4LOC A;  3H1C A;  4M3B A;  3IRQ A;  2W84 A;  4O5V A;  2OD5 A;  1EF4 A;  2CSO A;  4A0X A;  1UZC A;  1G3S A;  5LGU A;  3K2Z A;  3PQK A;  4V2F A;  1XCV A;  1IGN A;  1R71 A;  4RDU A;  5BS6 A;  2MA3 A;  2F48 A;  4UV9 A;  4QLC U;  2LTP A;  1MDM B;  3JRF A;  1MJA A;  1QU3 A;  2M9H A;  2OJE D;  2Z2S B;  3HUG B;  1MH4 A;  4Y15 A;  1IRZ A;  5KHD A;  5EJC A;  2DFE A;  1UAA A;  2LYC A;  4RB1 A;  1YQA A;  3P7N A;  4EJO A;  2M5W A;  4XOR A;  3LA7 A;  2Y69 H;  3FHZ A;  2Y48 A;  1BW6 A;  1YG2 A;  5GP9 A;  3RPU D;  2RKH A;  3ZOB A;  5HLH A;  2JK3 A;  3MVP A;  3TO9 A;  1R1V A;  1WWX A;  1X3Z B;  2JVH A;  5E8G A;  1UG2 A;  2XRO A;  1B8I A;  2ZME B;  4IHX A;  5LFA A;  2P6T A;  5DEQ A;  1F43 A;  2V9V A;  4MTE A;  2ZB9 A;  2HQN A;  3N4M A;  4RA2 A;  2LBF A;  1R22 A;  2XSJ C;  3R6S A;  2VKH A;  1D0Z A;  3HHG A;  2XAH A;  3EDP A;  1U9N A;  1SVL A;  1X4P A;  3LSI A;  2GAU A;  2QM3 A;  1RKW A;  1Z7L A;  3DF8 A;  4KIF A;  3ABL H;  3TL4 X;  2QEN A;  3NAU A;  4OIN F;  2HQR A;  4QPQ A;  4KT6 A;  1T56 A;  3H0G J;  5EEH A;  4CUG A;  5ED4 A;  2CV2 A;  2VE9 A;  1ETW A;  4XLN F;  1HKT A;  2FQ3 A;  3LWF A;  1ON2 A;  3VYT B;  3ZR8 X;  1U78 A;  3S3O A;  3EUK L;  1W36 D;  1YFH A;  5DYM A;  3H5A A;  1TQM A;  3TP0 A;  4LK1 F;  3ZPL A;  3HOS A;  4M3F A;  3OY9 A;  2KIM A;  5EZG A;  4DZJ A;  5HVQ C;  3I55 I;  4XRF A;  4X1E A;  1XPX A;  2NRA C;  3S3M A;  3ISP A;  1QVU A;  1ZLK A;  3O2P E;  2XF7 A;  2WY7 Q;  1Y0U A;  3DBR B;  4EGY A;  2BOL A;  1EH7 A;  3DU6 A;  2XDV A;  2BHZ A;  2L2O A;  1MSE C;  2FJ1 A;  2R5Z A;  1YX5 A;  2I5U A;  2LY2 A;  2KZG A;  2O5R A;  2ZNY A;  3G1O A;  4PCQ A;  2LBF B;  4M3G A;  2NOG A;  2CUF A;  3RQI A;  5GPA A;  2FU4 A;  1BN5 A;  3BG3 A;  3WU2 C;  4CCN A;  2R7F A;  4A3E J;  3HSF A;  1XDS A;  1W5C C;  3IWF A;  1YJ9 I;  1U9O A;  3IKT A;  3NQO A;  2E2I J;  2ECC A;  1SVO A;  4M72 A;  1WJA A;  4QIW N;  2VB6 A;  5AON A;  5BMZ A;  4LG0 A;  3QOP A;  4IX7 A;  4GXO A;  1IDY A;  1W7P A;  1ZG1 A;  1HKS A;  2ID3 A;  1POG A;  2P8T A;  5E79 C;  1X4O A;  5IY5 H;  3CCY A;  5FLM J;  3S14 J;  2N8G A;  1BR2 A;  2BVL A;  2PMZ A;  5E20 A;  3T5X A;  3HPH A;  3ZMV A;  2CW0 F;  5ICG A;  2DJI A;  2PJP A;  4RGR A;  3BR2 A;  4F3Q A;  1A31 A;  1R58 A;  5FKK A;  4OAY A;  1VQM I;  1EV7 A;  1FPQ A;  4FCY A;  2X9D A;  1ZAO A;  3CCL I;  3G6E I;  2OCC H;  4HLX A;  2YR2 A;  2E5Z A;  3HTS B;  1XSX A;  4M6Y A;  2PMH A;  1Y8R B;  3L1P A;  3QOE A;  5JR3 A;  2B9S A;  1DGR M;  1IXC A;  4PJM A;  1U8R A;  5CQE A;  2ZBK A;  3CO6 C;  2PI0 A;  1RET A;  3M1E A;  1GT0 C;  5M5Y J;  3OS1 A;  1RR8 C;  2R7V A;  3CF5 F;  1PUF A;  4D7N A;  3BZ6 A;  3DTI A;  3CZ6 A;  3HIF A;  1PDN C;  2KRH A;  1YS6 A;  3A4C A;  2VI6 A;  2E2J J;  2VLA A;  1GXP A;  2FE3 A;  2PMU A;  2IA2 A;  1HQC A;  1LEA A;  1FTZ A;  1MMD A;  4KT5 C;  3V8L A;  4IRI A;  3WGG A;  4ZZL A;  1W7P B;  1ZGJ A;  2YPR A;  3KLN A;  1XMX A;  3LSJ A;  3AAF A;  1IF1 A;  2O61 A;  2STW A;  1QA6 A;  1LUJ B;  4E4H A;  1KQ9 A;  3HC7 A;  1MMA A;  2VKV A;  1T38 A;  2V9P A;  2LK2 A;  5J40 A;  2EIL H;  3PUB A;  2IW5 A;  4DOZ A;  3RKY A;  3GYH X;  2X1E A;  3MKW B;  2ELH A;  4ZJZ A;  3SQN A;  1UMQ A;  4IPA A;  4IOC F;  4RAF A;  3K70 C;  1STZ A;  2R7S A;  4PJL A;  2KDO A;  5H2F C;  3KEY A;  2DBB A;  2DA4 A;  2E1N A;  3O8G A;  4WK8 F;  3EPZ A;  4RGS A;  4Y13 A;  3DKW A;  3OV8 A;  5F1R A;  1FC3 A;  5B1B H;  1BM9 A;  1IV6 A;  3ABM H;  3VWB A;  5C4J J;  1WFX A;  3LFU A;  4JX5 A;  2KJB A;  2UUZ A;  1D0X A;  1ZKG A;  4HYE A;  3OYA A;  1GVD A;  2VN2 A;  1VQ7 I;  1K7A A;  5FGM A;  3ZQH A;  2QSG X;  3KP3 A;  4D1Q A;  3LA3 A;  3M3Y J;  1ZTR A;  2CUJ A;  3OMY A;  4L9V A;  2VQC A;  3CES A;  4E7I A;  4IL6 C;  1PP8 F;  3C18 A;  3LSM A;  4EM0 B;  1SVM A;  1NG6 A;  4AC0 A;  3A0B C;  4PJN A;  1Q1H A;  5M3F J;  3T8T A;  2G9W A;  2X6X A;  4IHY A;  5KVR A;  3GX4 X;  4G12 A;  4FET A;  3F6O A;  2VQG A;  4CCO A;  4XLC A;  3KYC B;  3KCC A;  2L9V A;  5JI6 A;  2CUE A;  4CYD A;  3T8R A;  3HOV J;  3DPT A;  2HZD A;  1RI7 A;  4S04 A;  1TC3 C;  4BNC A;  1G2H A;  1Q1V A;  3I58 A;  4DYR A;  2ADU A;  3FXK A;  3I4M J;  3K4L A;  2HVR A;  2QGU A;  1K6O A;  2VC0 A;  2YU9 J;  2VOO A;  3WTU C;  2F5D A;  2OPT A;  4BU2 A;  1W0T A;  1MND A;  3KIO A;  3KYD B;  1O3S A;  5K7Z A;  1OCC H;  3E5U A;  1SFK A;  5L3D A;  4ESB A;  3F22 A;  1RRJ A;  5EEA A;  1KON A;  2A5W A;  2X4H A;  5AIP A;  2XGC A;  4OOI A;  3J7Y J;  1RZ4 A;  4XLH A;  3I0T A;  5CKT A;  3SFZ A;  1ZEL A;  1VTN C;  1B72 B;  4XBF A;  1ZR4 A;  2K4J A;  4BYY A;  2V1N A;  1FYL A;  2F4M B;  2V26 A;  2PJR A;  3BPV A;  2P7V B;  2BXY A;  2FOW A;  3HOW J;  1XGS A;  4GCV A;  4DBR A;  2DK5 A;  2E5N A;  3NEU A;  2IS4 A;  3CMY A;  2UV1 A;  1ETQ A;  5EG0 B;  1XTA A;  2IS1 A;  1NG7 A;  3GTK J;  3I4P A;  2LOO A;  4A3M J;  3AL0 B;  4B1R A;  2R7O A;  4OWR B;  2CW7 A;  2WA0 A;  5E3N A;  1OYI A;  3ZN0 A;  4L9N A;  5ERI A;  4ZC3 A;  1YS7 A;  2LSO A;  2ESN A;  2ZJ2 A;  2VBZ A;  2XF5 A;  1MKM A;  2DOF A;  2TRT A;  4CYC B;  2D45 A;  3V7R A;  1MJB A;  2A3S A;  1P4X A;  2H8R A;  3AKZ A;  2BHY A;  4D7M A;  2JMW A;  2AS5 F;  5JFR A;  4DYC A;  2PLY A;  1FSE A;  4N9I A;  1FBQ A;  1IXR C;  1R00 A;  2RVC A;  2X6Y A;  2HDD A;  5GAG J;  1M1E B;  2MYS A;  3BDD A;  3TW6 A;  1UCR A;  3GFM A;  5IT3 A;  3OS2 A;  4BDZ A;  4F93 B;  2EQR A;  2CS3 A;  3OS0 A;  1F4K A;  3A03 A;  1X19 A;  4Q5S F;  2KQR A;  1FT9 A;  3HPG A;  4B44 A;  4BEH B;  1X58 A;  1I50 J;  2FBK A;  4XR6 A;  5J4Y A;  4HAM A;  3KP2 A;  2HYG D;  2M30 A;  5E1W A;  3IRR A;  2V1D A;  3ZN1 A;  3D5R C;  3BPX A;  5LGN A;  1WRJ A;  3DCF A;  1MJ9 A;  2X6O A;  2CW8 A;  5IPA A;  4JOM A;  1OIS A;  3NWS A;  2BVM A;  4XSZ F;  5LRS A;  3ZMD A;  2NVQ J;  1R7J A;  5E8I A;  1JGG A;  2GIZ A;  1YLF A;  1DPR A;  2FNP A;  3NAR A;  3S93 A;  4EQQ A;  3CUQ C;  5FRN A;  4LJZ F;  1LFU P;  3F8F A;  3S2D J;  4I2O A;  4CIC A;  2PN6 A;  2IJL A;  3C2G A;  3PIP F;  4I01 A;  4FX4 A;  1JUS A;  5FO5 A;  1U2W A;  3CC4 I;  2W24 A;  1B9M A;  3WE3 A;  1E17 A;  4I0B A;  1F36 A;  1JT0 A;  3I4N J;  5E17 F;  1RR7 A;  1WHU A;  4RLF A;  5E1Z B;  3O3K A;  2CV1 A;  3RPU A;  1W0U A;  4DYQ A;  3IL2 A;  3OIQ A;  4IRH A;  5IT9 K;  2PFB A;  1O7L A;  1SFO J;  2VXD A;  2O8K A;  3OWT A;  4U0Y A;  2XGD A;  1SEU A;  3JRI A;  4JBA A;  2DT7 B;  4ENN A;  4KMF A;  2E1M C;  2OZ6 A;  4I02 A;  3RQ4 A;  1TW3 A;  4U7B A;  3DPU A;  4LLL A;  4R8H A;  4S05 A;  1BR1 A;  1HF0 A;  1BI1 A;  1UST A;  2HPM A;  4G7O F;  2KIF A;  4ZZD A;  2VON A;  1RUN A;  2R7W A;  2HOS A;  2DXI A;  4UVA A;  3BZK A;  4X0G A;  1FSH A;  5FLX K;  4FQG A;  2ETH A;  2D2W A;  1HA8 A;  1JKQ C;  3IH4 A;  4FE7 A;  5D5U B;  2LP0 A;  2M34 A;  1QVT A;  1MH3 A;  4IXA A;  5HLG A;  2AO9 A;  1W5S A;  4BHP A;  2ZO4 A;  3OYJ A;  5DUI A;  1VQP I;  2E7W A;  1GV2 A;  3B6A A;  2EZK A;  3IP4 B;  2W7N A;  1XGN A;  4ESF A;  3JAM Z;  3FHN A;  5ILU A;  4G7H F;  1E3P A;  3VSK A;  1KYZ A;  2ZJR F;  1ENH A;  4B48 A;  4AIJ A;  4A3B J;  5EDN A;  3HZJ A;  3OOU A;  3QWL A;  3HKZ N;  5LEK A;  5DS9 A;  2M8G X;  1TL8 A;  1KU9 A;  4A93 J;  4BBS J;  3WTZ A;  2CJJ A;  3E6C C;  5EF6 A;  1TW2 A;  3J81 K;  3J7A Y;  3ZGK A;  3I54 A;  5J1R A;  3RKW A;  1LFP A;  4XLP F;  1OLT A;  4C3H J;  4GYI A;  4BQN A;  3GTL J;  1JUP A;  3RYP A;  4XID A;  1HLV A;  2K9N A;  1TLH B;  2MGQ A;  3HGY A;  4ZDL A;  1QZZ A;  1P2F A;  2D1V A;  3CDL A;  3WHB A;  1S29 A;  1JKP C;  4YRV A;  2LDU A;  4M71 A;  2LC2 A;  2MSY A;  2FNA A;  1Y1W J;  2EIJ H;  3ESW B;  1WVR A;  2E71 A;  2M45 A;  4F91 B;  2M7A A;  4CA0 A;  1YIO A;  4PDK A;  1R36 A;  1H8A C;  2FX0 A;  3LNQ A;  3KP7 A;  1GDT A;  2JA8 J;  4IO9 F;  4UHT A;  3KEO A;  1Z6T A;  2V79 A;  2K5C A;  3H5R A;  4GFB A;  4N0B A;  2IEK A;  4FT8 A;  1QRY A;  3MZ8 A;  2K27 A;  3QPH A;  2O6G E;  3I3L A;  2ZME C;  1ON1 A;  3VYR B;  3CCV I;  1DU0 A;  3NWT A;  2NVX J;  3WOD F;  4ZH4 F;  4YG2 F;  5F1J A;  2XGE A;  2F5C A;  3O6B B;  1G3W A;  3MKY B;  3EYI A;  3VB2 A;  5FFZ A;  1R6R A;  4UVC A;  1LQ1 A;  3ASN H;  4KIC A;  3SDB A;  3BWG A;  5K5Q A;  4EJU A;  1OCR H;  4ENJ A;  2BE5 F;  5DV5 A;  1I1S A;  3FKI J;  1U3E M;  1Z0X A;  3DLA A;  3ZRG A;  3WTW C;  4DW6 A;  1ZHF A;  2TCT A;  3RDI A;  1ZGW A;  5M5X J;  1RNL A;  2K3F A;  2L9S A;  4UUS B;  3DLL F;  2EFW A;  4CO8 A;  1H89 C;  5J3L A;  4XKC A;  1P9Q C;  2AHQ A;  4M9X A;  3ZQL A;  3V42 A;  2H09 A;  3F8N A;  1FYK A;  2CQX A;  2OQG A;  2Z5U A;  3CQZ J;  5H6Q A;  3BJ6 A;  3ROU A;  3J81 Z;  5C44 J;  3O8H A;  5D4R A;  1U5T A;  2KIU A;  2WAF A;  2J5O A;  2L0K A;  1BIA A;  2JPC A;  1UHM A;  4YFX F;  4NQW A;  1FBU A;  3M4O J;  2KIS A;  4AUX A;  4KNY A;  2QF7 A;  2KHM A;  2ECB A;  3HRM A;  3I71 A;  4BL0 B;  3G73 A;  1N78 A;  2DFI A;  3LSR A;  1AA7 A;  2FBI A;  4MIM A;  5E18 F;  3DFG A;  1QBJ A;  2HI3 A;  3BJA A;  4HW0 A;  4W97 A;  1JT6 A;  3ZQG A;  3FBN B;  1VQ9 I;  2EIN H;  1I27 A;  2LNB A;  3BY6 A;  1SD4 A;  1MDM A;  3OYE A;  4A3I J;  2ME6 A;  2EZL A;  2LKP A;  3G1M A;  4LIV A;  4AID A;  1YIJ I;  9ANT A;  2R7Q A;  2MD5 A;  1ETO A;  1JE8 A;  3FBI B;  3ELK A;  2WAQ A;  3ZQQ A;  1S5L C;  1IV8 A;  5A2Q K;  4CDG A;  2A69 F;  4NC8 A;  2LKS A;  2TDX A;  2E60 A;  2HXI A;  2JVG A;  2IGK A;  3S3N A;  2GM4 A;  5FD5 A;  1AOY A;  3KLO A;  3PNT A;  4PK4 A;  4A2U A;  1BW5 A;  2XAU A;  3BC8 A;  2E19 A;  4K2E A;  4G6D A;  2WAE A;  4ZYG A;  3JSP A;  2UZK A;  1VQL I;  4KJZ A;  2ZXH A;  3ECO A;  2ZME A;  4I7H A;  4M6V A;  4EMS A;  1R5H A;  1UG0 A;  1U5T B;  1WKM A;  4BJ6 C;  4BS9 A;  3HTU A;  1FNN A;  1TBX A;  2DAO A;  2X48 A;  3E0J B;  4CCK A;  3JRD A;  1AWC A;  5J6X A;  1BC8 C;  1CQT A;  5HS9 A;  3FF5 A;  1FBS A;  1FY7 A;  1Y39 A;  4Y17 A;  2BY2 A;  1QQI A;  1DPU A;  3R60 A;  3RKQ A;  3GLX A;  1LE8 A;  1FEX A;  3JRB A;  2RAE A;  2DDB A;  4P96 A;  1BBY A;  3M8E A;  3WGI A;  1HXD A;  4FE4 A;  2GQQ A;  5LEJ A;  1CGP A;  1YW9 A;  2O3F A;  3K10 A;  1EH6 A;  2WAD A;  3QOD A;  2AQE A;  3BR3 A;  3LL7 A;  2R4G A;  2ZC2 A;  2Y2Z A;  3CCU I;  2DQR A;  3H9Q A;  1V54 H;  2DCE A;  4BE2 A;  5DTD A;  2QKL B;  3W6J B;  4KYW A;  1I3A A;  3QYF A;  4XL9 A;  1SFU A;  3H9J A;  1SC7 A;  4WXD A;  1Y1V J;  2QKM B;  3FXL A;  4G6T B;  1OFC X;  3WGH A;  2WAQ N;  1XMA A;  4ESJ A;  4D9J A;  4H0E A;  3OSF A;  2V6C A;  1BC7 C;  2JSC A;  5GTI C;  3R0A A;  1JHF A;  3KE2 A;  1Z67 A;  4UUT A;  1LDD A;  5CPR B;  3L2C A;  2PEX A;  3PJR A;  4A0Z A;  4FTH A;  3J80 K;  2JRM A;  2HVQ A;  3R0J A;  5LHI A;  4CZC A;  4U87 A;  3P9I A;  2QBY A;  2E35 A;  4XN0 A;  2ZXJ A;  4KA4 A;  2E7X A;  2JJ7 A;  3KP6 A;  1LE8 B;  2VC1 A;  4NNJ A;  4J01 A;  5CJ9 A;  2GA1 A;  4RB3 C;  1A35 A;  4BHC A;  4ZYA A;  2L7F P;  4JK1 X;  3F9K A;  5JVG F;  3D0S A;  2LLK A;  1LNW A;  1GV5 A;  3TQN A;  1V5F A;  2G7H A;  3WG7 H;  3GFI A;  1B1B A;  2R7X A;  3VYU B;  3H9G A;  5HNH A;  4EJV A;  3MKL A;  3X2Q H;  3HRU A;  5EEG A;  4EJW A;  1W4M A;  5HDK A;  4HSR A;  2JA5 J;  2WWY A;  2NOJ B;  1Z9C A; 
#chains in the Genus database with same CATH homology
 2DPD A;  1G6N A;  3RKX A;  5ICF A;  2YX4 A;  4P5O A;  1KYW A;  5CLS A;  3EQL F;  4MNU A;  1KA8 A;  3DV8 A;  4MHG A;  1OR7 A;  3HRS A;  2H6C A;  1KGS A;  1X3U A;  5D5W B;  2QBY B;  4JQF A;  2O0Y A;  3K1N A;  5KK1 A;  2DU9 A;  2HEO A;  4L9T A;  2Z99 A;  1RUO A;  2M1B A;  2Y0M A;  1BI3 A;  3SZP A;  2IA1 A;  4P55 A;  2NAZ A;  2R3S A;  1E2X A;  3J80 Z;  2CFX A;  3CJN A;  4A6E A;  4WCG A;  2YU3 A;  1P6R A;  3CLO A;  1O3Q A;  3ZQ7 A;  1S7O A;  3F72 A;  3RTR A;  3SHF A;  2HDC A;  2P5K A;  4HOB A;  3TDU C;  4A6D A;  5BPI A;  2F5E A;  1ZN2 A;  4R1H A;  3MCZ A;  1F1Z A;  2G7U A;  4L18 B;  1IRF A;  4U88 A;  2H6B A;  2IT0 A;  3GFL A;  4L9J A;  2Z3Y A;  1J59 A;  2ZCW A;  4LK0 F;  5CVR A;  4FHT A;  1UFM A;  4E70 A;  4RB2 C;  2JPB A;  2XAF A;  3L7W A;  3V7C A;  2PQ8 A;  3MQ0 A;  1V4R A;  3WU0 A;  4WXC A;  2P5L C;  2O03 A;  4P9F A;  1KU2 A;  3FXR A;  3I53 A;  4HQE A;  4I98 B;  4ENK A;  4U0W A;  4BAY A;  4EVI A;  1P4A A;  2DT5 A;  3U2R A;  4F7Z A;  4PGG A;  2CGP A;  2DW4 A;  4HX4 A;  3RYR A;  1G4D A;  2XUB A;  3V8J A;  4U0V A;  3IHU A;  1SD6 A;  4ETS A;  4I0A A;  1R5G A;  5TJJ A;  2Y75 A;  2EA2 A;  3LA2 A;  2FSW A;  5CVV A;  4XSX F;  3F6V A;  5DD4 A;  5HOO A;  3D5L A;  2RN7 A;  3K1P A;  2FRH A;  3WG9 A;  3GEZ A;  5L3E A;  5AIQ A;  3VEP A;  4RAZ A;  4AD9 A;  4HF0 A;  3GF2 A;  5H6R A;  1HBX G;  5L3G A;  1ZH5 A;  3LAJ A;  1B6A A;  1XGM A;  3LST A;  4BQA A;  2A07 F;  3ML6 A;  4PGH A;  5LBQ A;  2JT1 A;  1GHC A;  2K02 A;  2A6H F;  3FM3 A;  2EA4 A;  3V8K A;  1J9I A;  4OIQ F;  1UB9 A;  2QUF A;  2VXZ A;  4IHS A;  3QAH A;  3M7G A;  3FMS A;  1A04 A;  2EJR A;  3LFK A;  4OIP F;  1IUY A;  1DP7 P;  2L54 A;  2EV0 A;  3GFJ A;  1ZLJ A;  3E5Q A;  4IVN A;  3H92 A;  5LHG A;  3M9A A;  3U9G A;  2GXG A;  2JTV A;  2HTJ A;  2OQR A;  2HYF A;  3TO7 A;  2L4A A;  4O3M A;  2K7L A;  5J8C A;  4DNC A;  4UUV A;  1YW8 A;  1OKR A;  2RV8 A;  3BOQ A;  3RJP A;  1LB2 A;  4M6X A;  4D0P A;  2H94 A;  4MEY F;  5CYV A;  4AIK A;  4GGG A;  2C6Y A;  2IRF G;  2CO5 A;  3C1D A;  2EV5 A;  4A12 A;  3FXU A;  1YW7 A;  3ZP5 A;  2EFP A;  2QVO A;  3P9K A;  3ABU A;  2VOP A;  4L0Z B;  2EWN A;  2NNY A;  1MD0 A;  4QWQ A;  3R4K A;  1FLI A;  3KET A;  3GXO A;  3BJO A;  3EUH A;  1RIO H;  4AIH A;  3ECH A;  3C7J A;  2MLK A;  1P4W A;  3JTH A;  3U1D A;  3KZZ A;  2HS5 A;  4B09 A;  1ZAR A;  3QP6 A;  1TQP A;  1U5T C;  1XSV A;  3TKY A;  2WTE A;  4HLY A;  5LHH A;  4KN7 X;  3I64 A;  3MEX A;  5D8L B;  1Z91 A;  4Q48 A;  2EFO A;  1NHA A;  2R7D A;  3F8C A;  3HYI A;  3RI4 A;  2RC4 A;  4WX9 A;  1BJA A;  2HKO A;  1F5T A;  1J2X A;  5IT9 Z;  4HQM A;  2VT3 A;  4NB5 A;  5TRD A;  3WE2 A;  3FZV A;  4Z2Y A;  3LAP A;  3WTV C;  1T0F A;  2ESH A;  2A61 A;  1QPM A;  3KP4 A;  4IHT A;  1HW5 A;  3L00 A;  3FMR A;  1SMT A;  2OAZ A;  5FFX A;  5ILV A;  1XSD A;  4N9H A;  3P9C A;  3ZMT A;  4DQ2 A;  1I5Z A;  5FLX Z;  1K79 A;  3E6M A;  1MGT A;  2CG4 A;  2NS0 A;  2HOE A;  1FP1 D;  2VT2 A;  3WU1 B;  3L9F A;  1DUX C;  4HDU A;  3ERE D;  5DCF A;  3MWM A;  4IRG A;  3CO7 C;  4L5J A;  5CVJ A;  1ZG5 A;  2D1H A;  4KIB A;  2RQP A;  3IC7 A;  2FF4 A;  2MLG A;  2PG4 A;  2GIV A;  3PQJ A;  3M8F A;  5DDG A;  1ZRD A;  3HHH A;  1PP7 U;  2J5P A;  1IZ1 A;  1YYV A;  2HGC A;  5ICC A;  3B73 A;  1XN7 A;  1MZB A;  1JGS A;  2XKO A;  1KQ0 A;  1D8K A;  5J8F A;  4ENM A;  3B02 A;  3F8M A;  2A6E F;  3W6K B;  4ON0 A;  3WTX C;  1KU3 A;  1JXS A;  5D4S A;  2DQL A;  1HW2 A;  4KUM A;  5BQT A;  3J7A O;  1G3Y A;  4WF2 A;  1REP C;  3VOD A;  3KP5 A;  1ULY A;  3GO5 A;  2LF7 A;  2HFH A;  2BGC A;  1G3T A;  1ODD A;  2CYY A;  3H3U A;  2H27 A;  3TO6 A;  2XAQ A;  1IAW A;  2GA2 A;  2WC2 A;  3V7S A;  1TQI A;  3R61 A;  3NRV A;  4EJT A;  1IRG A;  2W57 A;  1QNT A;  4CGZ A;  2EFQ A;  1L3L A;  3BP8 A;  1H9G A;  1FZP B;  2MH9 A;  4R79 A;  5CVI A;  3N97 A;  2BBY A;  3CTA A;  2FBH A;  4IJA A;  2MH2 A;  2VOD A;  5D5V B;  1SD5 A;  1LDJ A;  1C0W A;  5A2Q Z;  2KJC A;  3REO A;  3HSR A;  4GO1 A;  4CZZ A;  3F23 A;  2HWV A;  1T6S A;  4L0Y B;  4A5N A;  2K4B A;  3VFZ A;  4PZJ A;  1SD7 A;  4Q47 A;  2F5F A;  4G8X A;  2OA4 A;  2NYX A;  3GUD A;  1K78 A;  4L5I A;  4G7Z F;  3HRT A;  4M73 A;  1TTY A;  1U6G A;  5K1Y A;  2ISY A;  2W85 A;  1XCB A;  1HW1 A;  2ZNZ A;  3LQQ A;  1ONV A;  2P4W A;  2HTS A;  2A68 F;  4MGR A;  4HZF A;  1S7A A;  3MAJ A;  3Q9S A;  4UXN A;  5ICE A;  1O7F A;  2GXB A;  1R1T A;  3FX3 A;  3PFI A;  5D5X B;  3DP7 A;  4UNO A;  4HF1 A;  3ZMU A;  3TGN A;  5HS7 A;  3QRF F;  4B8X A;  1J75 A;  2XV4 S;  1DDN A;  3DXJ F;  4HV6 A;  2XAS A;  2QLZ A;  4OIO F;  2V1U A;  4YII A;  2COM A;  1OMI A;  2XIG A;  4YFK F;  3RIR A;  1L0O C;  1B9N A;  1K78 B;  3I5U A;  4A5M A;  5ILS A;  2Z9O A;  5FB2 A;  4LGW A;  4EM2 A;  3S2W A;  1B4A A;  2M8E A;  4U7D A;  4EM1 A;  1XMK A;  2B0L A;  4UV8 A;  3DQV C;  5E1X A;  5L3B A;  1Z05 A;  2FML A;  4ZYH A;  4NHJ A;  1IN8 A;  4Q4Z F;  5DD8 A;  2EB7 A;  4LLN A;  3SXY A;  3ABT A;  2UWM A;  2Q2E A;  2DK8 A;  2IPQ X;  4HDV A;  4YFN F;  2P6S A;  2A5Y B;  2KRF A;  2QQ9 A;  3L09 A;  1FX7 A;  1JHH A;  2QQA A;  3T1B A;  3F21 A;  4KFC A;  1S8N A;  3ULQ B;  4LLG F;  2EFN A;  1HSJ A;  3F8B A;  5K5R A;  4LG0 B;  1XDU A;  2XGX A;  1GXQ A;  3MFK A;  3FMQ A;  3GWZ A;  1WQ2 A;  1S3J A;  5HLI A;  4G94 A;  2CWE A;  4KN4 X;  3SZT A;  1D8J A;  2QZ8 A;  2L02 A;  5D8K B;  2WV0 A;  5L3F A;  1I6X A;  1QO0 D;  4IF4 A;  1IN6 A;  2DLL A;  1F9N A;  1XGO A;  4M9Z A;  3K9T A;  4HF2 A;  2MC3 A;  1WI9 A;  3FM5 A;  1B59 A;  3H3Z A;  1S6L A;  2DTR A;  1ZRF A;  4P9U A;  1LVA A;  1HKQ A;  3TDZ C;  1IN7 A;  3K69 A;  4HV5 A;  3GVA A;  1YTY A;  1V3F A;  3E3V A;  2BV6 A;  2RNJ A;  4LD5 A;  3DPL C;  3GZ6 A;  3EET A;  2XVC A;  3MZH A;  1WSU A;  2BYV E;  3JTG A;  4YIF A;  2XAG A;  4MTD A;  3I59 A;  3MZY A;  4HBL A;  4O6J A;  1H9T A;  5JHU A;  4TV7 A;  2X0L A;  3KEQ A;  5BPD A;  4G6Q A;  3TOB A;  5BOX A;  2ZFW A;  4RB0 A;  3WTY C;  1ZG3 A;  4CHU A;  2IP2 A;  2F2E A;  2HKX A;  3GZ5 A;  4AVP A;  2FXA A;  1Z1D A;  1HST A;  4ZYE A;  2AXL A;  4OMY A;  2BEO A;  3E97 A;  4OU0 A;  3F3X A;  5DCM A;  4WXH A;  1P92 A;  3HSE A;  5LLQ A;  3JSO A;  1W5T A;  2NNN A;  1Z7U A;  3I59 B;  3LQR A;  3ZMS A;  3JW4 A;  4RGU A;  5F6F A;  3COA C;  2P7C B;  3V4G A;  3DEU A;  1BI2 A;  3CUO A;  2LF8 A;  4LFU A;  4OIR F;  2EV6 A;  1OYW A;  3Q9V A;  2QYO A;  1UHW A;  2L3D A;  6PAX A;  3KZY A;  1D5V A;  1EH8 A;  1GVJ A;  2Q0O A;  4HX8 A;  2KKO A;  3IKV A;  3QU3 A;  3FWE A;  1OPC A;  5JVT A;  4EGZ A;  3VOE A;  1ZYR F;  4EV0 A;  2P5V A;  2XHK A;  4LB6 B;  4LMY A;  1SFE A;  1TNT A;  3OOP A;  5DCM B;  3WTS C;  1R23 A;  1PUE E;  4I09 A;  1TNS A;  4RGX A;  4AWX B;  1LEB A;  3JAM K;  2XKP A;  1IN5 A;  1IXS B;  5LRR A;  4GYG A;  2OBP A;  5LGT A;  3CDH A;  3GW2 A;  2FMY A;  2GWR A;  2DI3 A;  3QP5 A;  1W7P D;  2V1X A;  2JRT A;  3TOA A;  2VBX A;  1J0R A;  1T98 A;  1XB4 A;  3Q5F A;  1O3R A;  1T39 A;  4MQV A;  4M9S A;  4HX7 A;  4LB5 A;  2FA5 A;  4M74 A;  2K86 A;  3K1M A;  1SMY F;  2L01 A;  1I1G A;  1D3Y A;  2YX7 A;  5L3C A;  2RDP A;  5F64 A;  4KIG A;  1ZRE A;  2UXN A;  1BI0 A;  2YSR A;  1IN4 A;  5D6F A;  1Z6R A;  2Z33 A;  2PBI A;  5CVU A;  2OU2 A;  3BRO A;  1CF7 A;  2HR3 A;  3T0Y A;  2IVM A;  4FX0 A;  4UVB A;  1ZGA A;  1BIB A;  2M87 A;  3FXQ A;  3CUQ A;  1QGP A;  1FOK A;  2STT A;  4WWC A;  4HA8 A;  4CXF A;  2ACJ A;  5FD6 A;  2CQK A;  2GZW A;  2IA0 A;  4ZYD A;  3QPT A;  2XRN A;  4MQ9 F;  1LDK B;  2O8X A;  5K5O A;  3QU6 A;  5D6E A;  2VBW A;  1BOA A;  2JZY A;  1OYY A;  1CF7 B;  1QZY A;  2QQB A;  3HOT A;  1YO5 C;  1XD7 A;  2DPU A;  5HDG A;  1SFX A;  1J7K A;  1IW7 F;  1LJ9 A;  1J5Y A;  3E6B A;  5HS8 A;  3E5X A;  3CUQ B;  4MEX F;  2W25 A;  4BH9 A;  2OZU A;  3E6D A;  3ZMZ A;  2L4M A;  1FP2 A;  3K0L A;  4OMZ A;  5DUK A;  1H0M A;  4RS8 A;  5H20 A;  2E1C A;  2MBF A;  2VE8 A;  4ASN A;  2RGV A;  2UXX A;  1FYM A;  4BHB A;  4KMU X;  1USS A;  4KDP A;  4BXU A;  1SAX A;  3G3Z A;  2DO7 A;  4RAY A;  1O3T A;  2ZKZ A;  2Q8K A;  2ISZ A;  1R1U A;  3C3W A;  3KFW X;  1ZRC A;  3HUG A;  2XAJ A;  2FEZ A;  4G9Y A;  2FOK A;  5HDN A;  3WTT C;  1O57 A;  3RPQ A;  2HZT A;  3EYY A;  3IWZ A;  4A0Y A;  2VBY A;  1T2K A;  1KU7 A;  1KQ8 A;  2EK5 A;  1FWZ A;  2QWW A;  3IRQ A;  2W84 A;  4O5V A;  2OD5 A;  2CSO A;  4A0X A;  1G3S A;  5LGU A;  3K2Z A;  3PQK A;  1XCV A;  5BS6 A;  2MA3 A;  4UV9 A;  4QLC U;  1MDM B;  1MJA A;  4Y15 A;  4RB1 A;  1YQA A;  3P7N A;  4EJO A;  2M5W A;  3LA7 A;  3FHZ A;  2Y48 A;  1YG2 A;  2RKH A;  5HLH A;  3TO9 A;  1R1V A;  1WWX A;  5E8G A;  2XRO A;  2ZME B;  2P6T A;  5DEQ A;  2V9V A;  4MTE A;  2HQN A;  3N4M A;  1R22 A;  3R6S A;  3HHG A;  2XAH A;  3EDP A;  2GAU A;  2QM3 A;  3DF8 A;  4KIF A;  2QEN A;  4OIN F;  2HQR A;  5ED4 A;  5EEH A;  2VE9 A;  4XLN F;  1HKT A;  2FQ3 A;  3LWF A;  1ON2 A;  1U78 A;  1YFH A;  5DYM A;  1TQM A;  4LK1 F;  3ZPL A;  3HOS A;  2KIM A;  5HVQ C;  4XRF A;  2NRA C;  3ISP A;  1ZLK A;  3O2P E;  1Y0U A;  4EGY A;  1EH7 A;  2ZNY A;  4PCQ A;  2FU4 A;  1BN5 A;  2R7F A;  3HSF A;  1XDS A;  3IWF A;  3IKT A;  3NQO A;  4M72 A;  5AON A;  5BMZ A;  4LG0 A;  3QOP A;  4GXO A;  1W7P A;  1ZG1 A;  1HKS A;  2P8T A;  5E20 A;  3T5X A;  3ZMV A;  2CW0 F;  5ICG A;  2PJP A;  4RGR A;  1R58 A;  1EV7 A;  1FPQ A;  1ZAO A;  4HLX A;  2YR2 A;  3HTS B;  1XSX A;  4M6Y A;  2PMH A;  5JR3 A;  1U8R A;  1IXC A;  2ZBK A;  3CO6 C;  2PI0 A;  3M1E A;  3BZ6 A;  3HIF A;  1PDN C;  1YS6 A;  1GXP A;  2FE3 A;  2PMU A;  2IA2 A;  1HQC A;  1LEA A;  4KT5 C;  3V8L A;  4IRI A;  3WGG A;  3AAF A;  1W7P B;  1ZGJ A;  2YPR A;  3KLN A;  4ZZL A;  1IF1 A;  2O61 A;  2STW A;  1KQ9 A;  1T38 A;  2IW5 A;  3GYH X;  3RKY A;  2ELH A;  3SQN A;  4IPA A;  1STZ A;  2DBB A;  2E1N A;  4WK8 F;  4RGS A;  4Y13 A;  3DKW A;  3OV8 A;  5F1R A;  1FC3 A;  1BM9 A;  2KJB A;  4HYE A;  2VN2 A;  1K7A A;  5FGM A;  3KP3 A;  3LA3 A;  4L9V A;  1PP8 F;  3C18 A;  4EM0 B;  1Q1H A;  3T8T A;  2G9W A;  5KVR A;  3GX4 X;  3F6O A;  3KCC A;  5JI6 A;  4CYD A;  3T8R A;  3DPT A;  1RI7 A;  4S04 A;  4BNC A;  3I58 A;  2ADU A;  1K6O A;  2VC0 A;  2VOO A;  3WTU C;  2F5D A;  1O3S A;  3E5U A;  5L3D A;  3F22 A;  4ESB A;  2X4H A;  5AIP A;  4OOI A;  1RZ4 A;  3I0T A;  3SFZ A;  1VTN C;  4XBF A;  2K4J A;  4BYY A;  1FYL A;  3BPV A;  2P7V B;  1XGS A;  4GCV A;  2DK5 A;  3NEU A;  3I4P A;  1OYI A;  3ZN0 A;  4L9N A;  5ERI A;  1YS7 A;  2LSO A;  2ESN A;  2ZJ2 A;  2VBZ A;  1MKM A;  2D45 A;  3V7R A;  1MJB A;  2A3S A;  1P4X A;  2AS5 F;  5JFR A;  2PLY A;  1FSE A;  4N9I A;  1FBQ A;  1IXR C;  1R00 A;  2RVC A;  3BDD A;  1UCR A;  3GFM A;  5IT3 A;  4Q5S F;  1F4K A;  1FT9 A;  2FBK A;  4HAM A;  3KP2 A;  2HYG D;  2M30 A;  5E1W A;  3IRR A;  2V1D A;  3ZN1 A;  3BPX A;  5LGN A;  1WRJ A;  1MJ9 A;  4XSZ F;  5LRS A;  3ZMD A;  1R7J A;  5E8I A;  1YLF A;  1DPR A;  2FNP A;  4EQQ A;  3CUQ C;  4LJZ F;  3F8F A;  4I2O A;  4CIC A;  2PN6 A;  2IJL A;  4I01 A;  4FX4 A;  5FO5 A;  1U2W A;  2W24 A;  1B9M A;  3WE3 A;  1E17 A;  4I0B A;  5E17 F;  5E1Z B;  3O3K A;  3RPU A;  3IL2 A;  4IRH A;  5IT9 K;  2PFB A;  1O7L A;  4U0Y A;  4JBA A;  4ENN A;  4KMF A;  2OZ6 A;  4I02 A;  1TW3 A;  4U7B A;  4S05 A;  4LLL A;  4R8H A;  1BI1 A;  1UST A;  4G7O F;  2KIF A;  4ZZD A;  2VON A;  1RUN A;  4UVA A;  1FSH A;  5FLX K;  2ETH A;  2D2W A;  5D5U B;  4IXA A;  5HLG A;  1W5S A;  4BHP A;  2ZO4 A;  5DUI A;  2E7W A;  1XGN A;  4ESF A;  3JAM Z;  5ILU A;  4G7H F;  1KYZ A;  4AIJ A;  5LEK A;  1KU9 A;  3WTZ A;  3E6C C;  1TW2 A;  3J81 K;  3I54 A;  3RKW A;  4XLP F;  4GYI A;  3RYP A;  1TLH B;  1QZZ A;  1P2F A;  2D1V A;  1S29 A;  2LDU A;  4M71 A;  2FNA A;  2M45 A;  1YIO A;  4PDK A;  1R36 A;  3KP7 A;  4UHT A;  3KEO A;  1Z6T A;  2V79 A;  4N0B A;  4FT8 A;  2K27 A;  3QPH A;  2O6G E;  1ON1 A;  3WOD F;  4ZH4 F;  4YG2 F;  2F5C A;  3O6B B;  1G3W A;  3EYI A;  3VB2 A;  5FFZ A;  4UVC A;  1LQ1 A;  4KIC A;  3BWG A;  5K5Q A;  4EJU A;  4ENJ A;  2BE5 F;  5DV5 A;  1I1S A;  1U3E M;  3WTW C;  1ZHF A;  3RDI A;  1RNL A;  2EFW A;  4CO8 A;  4M9X A;  2H09 A;  3F8N A;  1FYK A;  2OQG A;  2Z5U A;  5H6Q A;  3ROU A;  3BJ6 A;  3J81 Z;  5D4R A;  1U5T A;  2KIU A;  2J5O A;  1BIA A;  2JPC A;  1UHM A;  4YFX F;  4NQW A;  1FBU A;  4KNY A;  3HRM A;  3I71 A;  3G73 A;  2DFI A;  2FBI A;  5E18 F;  3DFG A;  1QBJ A;  3BJA A;  4HW0 A;  1I27 A;  2LNB A;  1SD4 A;  3BY6 A;  1MDM A;  2LKP A;  2MD5 A;  1JE8 A;  3ELK A;  5A2Q K;  4CDG A;  2A69 F;  2TDX A;  5FD5 A;  1AOY A;  3KLO A;  4A2U A;  4K2E A;  4G6D A;  4ZYG A;  3JSP A;  2UZK A;  3ECO A;  4I7H A;  2ZME A;  4EMS A;  1R5H A;  1U5T B;  1WKM A;  3HTU A;  1FNN A;  1TBX A;  2DAO A;  1AWC A;  5J6X A;  1BC8 C;  5HS9 A;  3FF5 A;  1FBS A;  1FY7 A;  4Y17 A;  1QQI A;  1DPU A;  3R60 A;  3GLX A;  4P96 A;  1BBY A;  3M8E A;  3WGI A;  1HXD A;  2GQQ A;  5LEJ A;  1CGP A;  1YW9 A;  2O3F A;  1EH6 A;  2DQR A;  3W6J B;  4KYW A;  1SFU A;  4WXD A;  3WGH A;  1XMA A;  4ESJ A;  4H0E A;  2V6C A;  1BC7 C;  2JSC A;  3R0A A;  1JHF A;  3KE2 A;  1LDD A;  3L2C A;  2PEX A;  4A0Z A;  3J80 K;  3R0J A;  5LHI A;  2QBY A;  3P9I A;  2ZXJ A;  4KA4 A;  2E7X A;  3KP6 A;  2VC1 A;  5CJ9 A;  2GA1 A;  4RB3 C;  4BHC A;  4JK1 X;  3D0S A;  1LNW A;  3TQN A;  2G7H A;  3GFI A;  1B1B A;  4EJV A;  3HRU A;  5EEG A;  4EJW A;  1W4M A;  5HDK A;  2WWY A;  1Z9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...