4RGRA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 42
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgrA00
4EMSA 4YIIA 5JHUA 2OAZA 1HW5A 4I02A 3L2CA 3VOEA 5FFZA 3RYPA 4CO8A 4UVAA 2LKPA 3VFZA 2VODA 1XSXA 1J5YA 3U1DA 1R7JA 1SMTA 2IA1A 4AIHA 1K7AA 4FX0A 3H92A 2OU2A 1AOYA 1G6NA 5E20A 3ZN1A 4LB6B 2IA2A 3MCZA 4Y15A 1HSJA 1UHMA 3O2PE 4HX7A 1O7FA 2DPUA 3DV8A 4ASNA 3CDHA 5CYVA 4IRHA 1ZN2A 3RIRA 1Y0UA 2YSRA 1MD0A 2IT0A 3IWFA 4OIPF 2NRAC 2F5CA 2OD5A 4L5JA 1O3QA 5F1RA 1W5TA 3MFKA 1XDSA 4JK1X 4A12A 5AIPA 3TOBA 2V79A 1LQ1A 4EJOA 3M1EA 4LLNA 2LF7A 4PGGA 1YTYA 2V1UA 3KE2A 4OIRF 1YG2A 5D6FA 2M45A 4ZZLA 4RGXA 3C3WA 3JAMZ 2MD5A 2K4BA 2HTJA 1TBXA 2EFNA 4HQMA 1KYWA 3DF8A 2YR2A 3KZYA 3GVAA 4HW0A 5AIQA 1EH6A 1SD5A 5D8LB 1FOKA 1TQMA 2DTRA 2ZMEB 1OYYA 3F72A 3U2RA 2WC2A 4ON0A 3QRFF 2M8EA 4HQEA 1KU2A 2D1HA 1R1TA 2XHKA 4OINF 3CUQC 3C7JA 1LEBA 2ZMEA 3FM5A 2P5KA 2BGCA 2NNNA 3Q9SA 4YG2F 4UHTA 4XSZF 4R1HA 1HKTA 4HV6A 2D45A 1DUXC 4RS8A 4UV8A 5LGNA 3KLOA 3KZZA 2PFBA 4MNUA 3HUGA 3WG9A 3DPTA 2J5PA 1U5TA 1MGTA 4KT5C 2UZKA 3V7SA 1BC8C 2FU4A 4RAYA 4I0BA 4IRGA 3GLXA 2GZWA 5FFXA 5HVQC 5L3FA 3HRUA 3V7RA 1PP7U 5HDNA 3EQLF 5D5VB 1B4AA 3VODA 2Y75A 5BS6A 4CICA 1T6SA 2GQQA 5CJ9A 1Z1DA 5CVRA 2K7LA 5ICGA 4LG0B 1IN7A 1FZPB 3JSOA 4IPAA 3I0TA 1GHCA 3RKXA 1QQIA 2FNAA 3J80K 1J9IA 5LGUA 1I1SA 2ZBKA 4LG0A 1YO5C 2HKOA 5E1ZB 5DEQA 4A5NA 1LB2A 1TNSA 2FMLA 4AVPA 4MTEA 2RDPA 4WF2A 2ESHA 2DK8A 4B8XA 1EH7A 1A04A 2JPBA 3QP5A 1F4KA 3TQNA 2Z5UA 3L00A 1KQ8A 5E8IA 3E6MA 2LSOA 2R7DA 3DXJF 5ED4A 1I27A 3GXOA 3WTYC 4KMFA 3G3ZA 5DUKA 3RTRA 2GA1A 2ZXJA 3ZP5A 2QZ8A 4Q48A 4WK8F 4I98B 1ZARA 3GZ6A 4IF4A 1F9NA 2Q0OA 3V4GA 4G6QA 2PN6A 2FSWA 4NB5A 2IA0A 4QWQA 2RKHA 3G73A 2L01A 3FHZA 1LEAA 3I4PA 1R5GA 1EV7A 5EEGA 3MZYA 1K78A 3RDIA 3E97A 2XROA 2YPRA 4LLGF 2RGVA 3RJPA 4BNCA 2DK5A 2NYXA 2JZYA 4B09A 1ON1A 3WE3A 3LSTA 4H0EA 1R58A 2DQLA 3N97A 3V7CA 2COMA 2FBIA 4UNOA 5J8CA 3CUOA 2VBYA 5ILUA 4N9IA 4OOIA 1FT9A 5IT3A 1T2KA 4YFNF 2A07F 4M71A 4G9YA 2XRNA 4OU0A 2W57A 1U2WA 2STTA 1H0MA 1USSA 3LQRA 3IC7A 2G7UA 3L9FA 2PJPA 3QU6A 1H9TA 1IN6A 1RNLA 4LK1F 1HBXG 1OMIA 1KQ9A 1ZGJA 1I5ZA 4UUVA 1AWCA 3F8BA 4LGWA 2P6SA 4AWXB 3E5QA 1XSVA 1E2XA 1XSDA 4ENKA 2FEZA 1Z6TA 5L3GA 2VOPA 2H09A 1Z91A 2RNJA 1XMAA 2G9WA 3HIFA 2D1VA 5BQTA 3ERED 2Q8KA 3R6SA 2FXAA 4M73A 2CGPA 4GGGA 2ISYA 1S6LA 1S7AA 1O3RA 4CXFA 1BI3A 4RB1A 3C18A 3BOQA 3P9KA 5AONA 3F8NA 3BPVA 4ESBA 4BXUA 1XB4A 2Z33A 3E3VA 3O6BB 1F5TA 2PQ8A 2XAQA 4M9XA 3U9GA 1B9NA 2F5FA 2MA3A 2PBIA 2O03A 1ULYA 2VE9A 2OZUA 3F23A 3ABUA 2MLGA 3F8FA 4HF2A 3LAJA 5K5QA 2QENA 1FX7A 1FPQA 5ERIA 4U88A 4Q4ZF 3BPXA 3I59A 1BBYA 3L7WA 2MH2A 3CLOA 4ZH4F 4RB3C 2V9VA 3GW2A 1MKMA 5BMZA 2AS5F 1XMKA 3RYRA 1BN5A 3REOA 3FX3A 4M72A 4HX8A 2E7XA 2VT3A 4IRIA 1QZYA 1E17A 1UCRA 4RAZA 5LHHA 2RV8A 3IHUA 3K69A 2FBHA 2KIMA 2P8TA 1LDJA 2L4MA 2Y48A 3M7GA 1FYMA 4ZYHA 5H20A 3BJ6A 3FMRA 5HDGA 5EEHA 4M74A 5FLXZ 1FSEA 3LAPA 4WX9A 1U78A 3ZMZA 4ZYDA 5LRRA 2UXXA 1BIBA 3F6VA 4A0XA 1LDDA 5TRDA 1B59A 1IXSB 5CVVA 1DDNA 3V8JA 3HTUA 4ENMA 3ZMUA 1XN7A 3CTAA 5IT9Z 2O0YA 2J5OA 3FWEA 2ZFWA 3ULQB 1IN4A 2F2EA 2PG4A 4JQFA 1WKMA 2EFPA 3F6OA 1B9MA 3CUQA 3GUDA 3HRSA 2A6EF 5E1WA 4CYDA 1CF7B 1SAXA 4EV0A 2RN7A 2OBPA 2FBKA 2BEOA 2BE5F 1P4WA 1ZLKA 1CF7A 3RPUA 1XGOA 3NQOA 3GYHX 2QBYA 1O7LA 2Z9OA 5HLHA 1FC3A 5FLXK 3O3KA 3OV8A 2WTEA 5HS7A 5E18F 3Q5FA 2QQAA 4O6JA 3TDZC 1H9GA 2FA5A 1MZBA 2BV6A 2DI3A 1UHWA 1D8JA 2XUBA 1SFUA 1J2XA 4M9ZA 4HLYA 2KIUA 5IT9K 1GXQA 2JRTA 4HF1A 3TDUC 2KIFA 5DDGA 1W5SA 1YQAA 3ZPLA 1FBUA 1Q1HA 3DQVC 1P92A 2D2WA 1S8NA 2XIGA 1BI1A 4U0WA 1FYLA 3HOTA 1YYVA 5FB2A 3SFZA 4CHUA 2ETHA 3NRVA 4Q5SF 4AIKA 3EYYA 2ZKZA 2HOEA 1TNTA 4LJZF 2O6GE 2STWA 1YS6A 1D3YA 3VB2A 3WTUC 2DPDA 2EA2A 4I09A 2E1CA 2GIVA 1MJAA 3I64A 1LDKB 1U5TB 3MWMA 4HDVA 4A0YA 4LB5A 1P4AA 1YW7A 3IKTA 2WV0A 1PDNC 2A6HF 2DO7A 3FXUA 3HRTA 3JAMK 4NQWA 2H6BA 1SMYF 5D4RA 4L9JA 4OMZA 2K27A 2MBFA 4G8XA 2MLKA 2E1NA 1IRFA 3F8CA 2M5WA 4MGRA 2HKXA 3WTXC 2OZ6A 4GXOA 2F5DA 1QGPA 4U7DA 2P6TA 2OQRA 3EDPA 1G4DA 4I01A 1JHFA 4Z2YA 2M1BA 1O3SA 1FBQA 1SFEA 2GXGA 1BJAA 4AD9A 2DFIA 4I7HA 2ESNA 1STZA 2IPQX 1ZRDA 1ZHFA 2NNYA 3E5XA 2QWWA 3KP4A 3HTSB 3WTZA 1S29A 1XGSA 4Y17A 3M8FA 2P5LC 3FM3A 1BOAA 4KMUX 3WGGA 3F22A 2W24A 1Z9CA 2CFXA 4EGYA 1FYKA 2EJRA 1LJ9A 1OYIA 3DPLC 5HLGA 3E6CC 1KGSA 1YIOA 3SZTA 2R3SA 2EFQA 2JTVA 3DKWA 1I6XA 2JPCA 1O57A 3GWZA 3I5UA 3KLNA 3W6JB 4G94A 2DQRA 1PUEE 3D5LA 2L02A 2EV0A 2FOKA 3N4MA 2ZO4A 1BI0A 5K1YA 3P9IA 1YW8A 1IZ1A 3ROUA 1J0RA 3B02A 2P7CB 5JVTA 1K78B 1BC7C 2W84A 1G3TA 3BY6A 3M9AA 1U3EM 1R22A 3GEZA 2QQBA 4HZFA 3R0AA 4RGSA 1HQCA 4OIOF 3ABTA 2JT1A 5ICFA 2HZTA 5CLSA 2CQKA 3V8KA 3LQQA 4I0AA 3GO5A 4ENNA 5ILVA 1WI9A 1K79A 1L0OC 1JGSA 4BAYA 3J81Z 5KK1A 4A2UA 2EFOA 4MEXF 4YIFA 2HYGD 1C0WA 3EYIA 3HYIA 3RPQA 3T8TA 3W6KB 2UXNA 5HDKA 2HWVA 2VXZA 3CJNA 1Z05A 2PEXA 2A68F 1ZG5A 1J75A 3C1DA 2XGXA 1R36A 4L18B 5E1XA 2CO5A 3IWZA 1ONVA 4RGRA 3ECHA 5FD6A 3GZ5A 5D6EA 2C6YA 1JXSA 1XCBA 3PQJA 1HXDA 3LWFA 4EJUA 5DCMA 1USTA 1O3TA 3TGNA 3ZN0A 3JW4A 4XLNF 2DW4A 3LFKA 4HOBA 1EH8A 5DD4A 1RI7A 4XSXF 2O8XA 5K5OA 1YS7A 3GFLA 3KP7A 5F6FA 3L09A 4KYWA 2L4AA 4MQ9F 1YW9A 3I54A 4KIBA 1BM9A 3J81K 3JTHA 4HLXA 4LMYA 4M6XA 3IRQA 3I53A 2MH9A 1UFMA 4F7ZA 4L9VA 1IUYA 2QQ9A 1YFHA 5CVUA 3QPHA 2A69F 4EGZA 1QBJA 4BHCA 3KEQA 4DNCA 3HRMA 1L3LA 1FY7A 2CG4A 1FP2A 2ADUA 4BHBA 2R7FA 1G3WA 2B0LA 4K2EA 1UB9A 2KJBA 5HLIA 2HQNA 3K9TA 3I58A 2LF8A 4CZZA 1R1VA 4UXNA 5KVRA 1ZLJA 5A2QZ 1KQ0A 4U0YA 4LK0F 4YFKF 4TV7A 3SZPA 2XAGA 5DCFA 1W4MA 4P96A 5LGTA 1OKRA 3FF5A 3BROA 1HKSA 1ZAOA 1SD4A 1P4XA 2Z99A 3GX4X 3I59B 5L3EA 3MQ0A 4U0VA 3P9CA 4A5MA 5FGMA 3P7NA 4KA4A 1QZZA 2FRHA 4HA8A 1IRGA 2ZNZA 3ML6A 2Q2EA 2X0LA 4PGHA 2RVCA 2HEOA 1XGMA 4BYYA 3M8EA 4BH9A 2A5YB 2ZCWA 5D4SA 1BI2A 5J8FA 1ZREA 3ISPA 3K1PA 3T0YA 1XD7A 4A0ZA 1R5HA 4NHJA 5A2QK 1Z6RA 2IJLA 4IHTA 4FHTA 2QVOA 3FZVA 3NEUA 2H27A 3QPTA 3TO6A 2CSOA 3FMQA 4U7BA 1FWZA 1V3FA 3K1NA 3LA3A 5F64A 2XV4S 2ZJ2A 2VOOA 4JBAA 5E8GA 1ZRCA 3SQNA 2H94A 2L3DA 1S7OA 5HS9A 2HS5A 1I1GA 4WXDA 2VBWA 3FXRA 2FF4A 2XAFA 3EUHA 3BWGA 2KRFA 2RC4A 2QLZA 3DFGA 4ETSA 4HAMA 4M6YA 1FBSA 2A3SA 2XKPA 3CUQB 4EJVA 1FNNA 4XBFA 3HOSA 3ZQ7A 2HDCA 3ELKA 1ZG3A 5L3DA 2DT5A 5ICEA 3CO6C 4IJAA 3FMSA 1JHHA 2W25A 3WU0A 3S2WA 1KA8A 1B6AA 5LEKA 1TW2A 2QBYB 4GYGA 5DD8A 1W7PB 2ZNYA 4KN7X 2AXLA 4EVIA 2P5VA 1IF1A 3TOAA 3D0SA 4L0ZB 2V6CA 3WE2A 1TLHB 1W7PA 3J7AO 3PFIA 1ODDA 3RKYA 2TDXA 1SD6A 1YLFA 2HQRA 3WTVC 2FMYA 3WGIA 2M30A 2NAZA 2FQ3A 4KUMA 5LEJA 1RIOH 4EM1A 4WXCA 2ISZA 4XLPF 1MJ9A 4HX4A 2UWMA 3HSRA 3SHFA 5FO5A 1G3YA 1U8RA 2Y0MA 2RQPA 1XGNA 4FT8A 1VTNC 2Z3YA 1K6OA 4N9HA 1SFXA 1D5VA 2L54A 5J6XA 1T98A 3Q9VA 2CWEA 1QPMA 3LA7A 4R79A 2O3FA 3VEPA 1XDUA 1Z7UA 4LFUA 1NHAA 4DQ2A 3WGHA 1DPUA 4KN4X 4ESFA 1J59A 5BPDA 1HKQA 2V1DA 2NS0A 2KKOA 3KEOA 3HHHA 4RGUA 3BDDA 4O3MA 1KU7A 1W7PD 2P7VB 4GO1A 5LBQA 2BYVE 4P55A 3B73A 4KFCA 4CDGA 2YX7A 3J80Z 2VT2A 4EQQA 1ZYRF 3ZMVA 1KU3A 5LRSA 1R23A 4MTDA 2OA4A 4XRFA 4EJTA 3E6DA 2F5EA 3SXYA 5DUIA 2LDUA 4L5IA 5L3CA 4BHPA 1V4RA 1ZGAA 2VONA 5H6RA 5BPIA 3F8MA 3MAJA 3TO7A 5ICCA 4ESJA 3GFIA 2PI0A 2K4JA 4S04A 2GWRA 4BQAA 4P9UA 4HF0A 4P5OA 3DP7A 2DAOA 1DPRA 4QLCU 4O5VA 5JFRA 3HSEA 4EJWA 2E7WA 4M9SA 4N0BA 2DLLA 2VBZA 1QO0D 2H6CA 3E6BA 5LHIA 3GFMA 3I71A 1RZ4A 2EV5A 1IXRC 2YU3A 3T5XA 1GVJA 3PQKA 3IRRA 3R0JA 2BBYA 3EETA 3K1MA 4FX4A 3KFWX 1ZRFA 2G7HA 5BOXA 3GFJA 4I2OA 2FE3A 2YX4A 4KIGA 4IHSA 3ZMTA 5D8KB 3CO7C 3KCCA 1OPCA 1LVAA 4MQVA 2W85A 3E5UA 4R8HA 5L3BA 2PMHA 1TTYA 1S3JA 4MHGA 3BJAA 3AAFA 2VE8A 4RB2C 2HYFA 1U5TC 1X3UA 3V8LA 4UVBA 1FLIA 2MC3A 3WTWC 2DBBA 2GAUA 4A6EA 1J7KA 4G7ZF 1LNWA 1TQPA 3OOPA 1HW1A 1U6GA 1G3SA 4OIQF 4G6DA 1FP1D 4EM2A 3QU3A 3K0LA 4UVCA 4GYIA 2IW5A 3F21A 1SD7A 4PCQA 3H3ZA 2GA2A 1TW3A 5LHGA 1DP7P 4ZYEA 1RUNA 2VC0A 4Y13A 4WXHA 5FD5A 4OMYA 5CVIA 1IW7F 3MEXA 4GCVA 4D0PA 2IRFG 1MDMB 1WRJA 3DEUA 2EB7A 5DCMB 2IVMA 2JSCA 4L0YB 3ECOA 1MDMA 3BZ6A 2EV6A 4UV9A 2A61A 2HGCA 2LNBA 2P4WA 1QNTA 4P9FA 5TJJA 1WQ2A 1KU9A 1T38A 3QAHA 3TO9A 4IVNA 2EWNA 3KP6A 4E70A 4ENJA 2PLYA 1TQIA 2EK5A 4LD5A 3IKVA 4WWCA 4RB0A 2XAJA 3K2ZA 2M87A 5CVJA 1IAWA 3WTSC 5E17F 2K86A 2DU9A 1R1UA 5JI6A 4WCGA 2EFWA 1P2FA 4S05A 2QUFA 1KYZA 2KJCA 3H3UA 3GF2A 3BJOA 3JSPA 4CGZA 1JE8A 4HV5A 5HS8A 5HOOA 4ZYGA 5D5XB 1HSTA 3R4KA 2VBXA 3ZMDA 4KNYA 4KDPA 1XCVA 2K02A 2HR3A 3R61A 4KICA 3WTTC 4ZZDA 3IL2A 3KP3A 3BP8A 4HBLA 5D5WB 3JTGA 3TKYA 2VC1A 5ILSA 1GXPA 5H6QA 1B1BA 3WU1B 3T8RA 2ELHA 3KP5A 2ACJA 5DV5A 2XKOA 2V1XA 2GXBA 2FNPA 4EM0B 4L9TA 4Q47A 5JR3A 4KIFA 4LLLA 3KETA 1WWXA 2QM3A 2O61A 4HYEA 1F1ZA 3HHGA 1ZH5A 1WSUA 5DYMA 1REPC 3LA2A 4AIJA 2XASA 1OYWA 2IP2A 3QP6A 2PMUA 3QOPA 1CGPA 2HFHA 5D5UB 3RKWA 1MJBA 5K5RA 6PAXA 1IN8A 1ON2A 4G7HF 2CW0F 1PP8F 4YFXF 4PDKA 1T0FA 2CYYA 1T39A 1D8KA 3FXQA 3COAC 4G7OF 4IXAA 1P6RA 1IXCA 4A6DA 5LLQA 3T1BA 1FSHA 1HW2A 1R00A 2EA4A 2OQGA 1OR7A 3RI4A 3MZHA 1ZG1A 1IN5A 1RUOA 4L9NA 3F3XA 2XAHA 3KP2A 2WWYA 4PZJA 2X4HA 3ZMSA 4HDUA 3R60A 2XVCA 1BIAA 2HTSA 2QYOA 4MEYF 3WODF 2VN2A 3HSFA
chains in the Genus database with same CATH superfamily
2EIKH 2HVQA 4EMSA 4H4KC 4YIIA 2HI3A 5JHUA 2OAZA 2VASA 1HW5A 4BDYA 4I02A 2HOSA 3L2CA 2BXZA 3VOEA 5FFZA 1B72A 3FXOA 3RYPA 4CO8A 2GM4A 1GV5A 2AXTC 2F4IA 4UVAA 2LKPA 4XLAA 1VZ0A 3VFZA 4LIVA 1XSXA 4B3XA 1QRYA 1J5YA 2VODA 3U1DA 1R7JA 1SMTA 2IA1A 2LMDA 4AIHA 1K7AA 1S72I 4FX0A 3JR9A 3H92A 2OU2A 1AOYA 1G6NA 2L9SA 4DJAA 5E20A 2KQRA 5J4YA 3CC7I 3ZN1A 4E7HA 4LB6B 2DA1A 5IPAA 4A3IJ 3PIOF 2KISA 1EF4A 2IA2A 3MCZA 4Y15A 5EEAA 1HSJA 1UHMA 3G1LA 3O2PE 2UV1A 2VUMJ 4HX7A 1ETXA 1O7FA 2VPLA 5H2FC 2DPUA 5M3MJ 4E7LA 3BT9A 3DV8A 4ASNA 3M8JA 4Z6YA 1NG7A 2CV0A 4NC8A 3S3OA 3CDHA 2I5UA 5CYVA 3ZQFA 4IRHA 1ZN2A 1MMNA 2CS3A 3RIRA 3CDIA 1HCRA 1X2NA 1Y0UA 2YSRA 1MD0A 1W1WE 2K9NA 2IT0A 3MD2A 2PMZA 2ME0A 3IWFA 4OIPF 2NRAC 2F5CA 2OD5A 4P1WA 3A2KA 3ABMH 4RAFA 1YITI 2OTJI 2VJ5A 1HOMA 1U9OA 2DYRH 2R7OA 4IO9F 2BHZA 2LFBA 2X1CA 5C4XJ 4FE7A 2M7BA 4L5JA 1O3QA 5F1RA 1DQUA 4C9YA 3RQ4A 1W5TA 2V7FA 3MFKA 1XDSA 2LP0A 4JK1X 4UUSB 1OISA 1PYVA 3EUKL 2VQLA 4AIDA 4A12A 4U87A 2HU9A 4FISA 3KX2A 5AIPA 3TOBA 2V79A 2KDOA 1LQ1A 4ITVA 4EJOA 3M1EA 4XQFA 4LLNA 4W1UA 3OYKA 2LF7A 4PGGA 2VJIA 1YTYA 5EJCA 2V1UA 3OWTA 3KE2A 1E0EA 2XB5A 3ZQGA 4OIRF 1YG2A 4X1EA 5D6FA 3BCBA 2M45A 1KONA 4ZZLA 4RGXA 2H1KA 3K4NA 2L7KA 1WI3A 3C3WA 3ESWB 1VQ6I 4MO7A 3JAMZ 2MD5A 2K4BA 3DTKA 2HTJA 1TBXA 2EFNA 1QVTA 4HQMA 1KYWA 3DF8A 2R93J 2CJJA 2E35A 2YR2A 3KZYA 3TP3A 3GVAA 4HW0A 5AIQA 1EH6A 1SD5A 1RKWA 1YI2I 1LUJB 3CDLA 5D8LB 2LC2A 1N25A 3C2HA 1FOKA 5EZGA 1TQMA 1WCMJ 2DTRA 1ORKA 3G2BA 2ZMEB 1OYYA 4DOZA 3F72A 2LY9A 3CZ6A 2KHMA 2JK3A 2XPVA 3U2RA 1Z3XA 2WC2A 1JTYA 3PL8A 4ON0A 3QRFF 2M8EA 4BUPA 5E3NA 4HQEA 3LSGA 1KU2A 2D1HA 1R1TA 2XHKA 4OINF 2A5WA 3CUQC 3C7JA 5DM7F 1R71A 2DODA 1LEBA 1FOWA 2ZMEA 2LREA 1X1PA 3FM5A 4CH7A 1IJWC 2P5KA 4A3EJ 1FIAA 2BGCA 2WB1A 2NNNA 3Q9SA 3CCRI 2WA0A 3GTLJ 4YG2F 2DN0A 3DBHB 2ICWG 4B3AA 4UHTA 4XSZF 1FOYA 2FD5A 2VQGA 3HUGB 4R1HA 1RPWA 2K85A 2E1OA 1HKTA 4HV6A 2D45A 1DUXC 3S1NJ 4RS8A 3PO2J 4UV8A 1R4MB 2X1DA 5LGNA 1IV6A 3SYTA 1FOXA 3ZQLA 3KLOA 3KZZA 2L9NA 3BZKA 2PFBA 2IGKA 2HZDA 3HUGA 4MNUA 3WG9A 3DPTA 4HEA2 2J5PA 4XOPA 3AG4H 1U5TA 5F0HA 1MGTA 2VXDA 3HOZJ 3S2DJ 2R5YB 4KT5C 4A3JJ 2R7XA 2P81A 4HG2A 2UZKA 3V7SA 1BC8C 1TC3C 1OLTA 5E3OA 1OCZH 3PNYA 2FU4A 2OF7A 4RAYA 4I0BA 2DA4A 4IRGA 3GLXA 2GZWA 5FFXA 1OFCX 2EIMH 5J4VA 5HVQC 5L3FA 3K7AJ 3HRUA 3V7RA 1PP7U 5K7HA 2VQCA 4BBSJ 5HDNA 3TEDA 3FDYA 1VQ5I 3EQLF 4BGDA 5D5VB 1B4AA 3VODA 2Y75A 3ERMA 4CICA 5BS6A 1T6SA 3HGYA 2R5YA 2GQQA 2IXSA 5CJ9A 1Z1DA 4RA2A 5CVRA 2K7LA 1O4XA 1TT5B 1ETWA 3H9JA 3CCLI 2JA8J 3OIQA 1AKHB 2KPMA 1MMSA 3D5SC 1JUMA 4HNVA 5ICGA 2M3AA 4LG0B 1IN7A 3I55I 3Q0VA 1FZPB 3JSOA 4IPAA 3I0TA 1GHCA 3RKXA 1SVOA 3GTPJ 1QQIA 2FNAA 3J80K 1AKHA 1J9IA 5LGUA 1WJCA 2ZBKA 2ZFUA 1I1SA 1Z67A 4LG0A 2KP6A 4XICA 2R5ZA 2CW8A 1YO5C 2HKOA 3PO3J 1ETQA 5E1ZB 5DEQA 1OCRH 2Y69H 3G1OA 5F27A 4A5NA 1DP3A 1LB2A 2DOFA 3DWLE 2EZIA 5F0FA 1TNSA 2FMLA 3FKJA 4AVPA 4KT6A 1VQOI 4MTEA 2RDPA 3W2AA 4WF2A 2ESHA 2E19A 1UELB 2DK8A 3H9GA 2VKEA 1MIJA 3UNGC 4B8XA 1EH7A 3IV5A 1A04A 2JPBA 4ABZA 3QP5A 3CCQI 1LPQA 3U21A 1F4KA 2WAQN 3TQNA 2Z5UA 3L00A 1KQ8A 2ECBA 5E8IA 3E6MA 2LSOA 2R7DA 3JRDA 3DXJF 2M8GX 2TCTA 2ZB9A 5ED4A 1I27A 2H8WA 3GXOA 4A69C 2VJ4A 3WTYC 4KMFA 2WV1A 1IV8A 2LOOA 3G3ZA 4IQ4A 5DUKA 3RTRA 2GA1A 2Z2SB 2ZXJA 3ZP5A 3SEQA 1G8XA 2QZ8A 3DLAA 4Q48A 5F08A 4WK8F 4I98B 1DU6A 1ZARA 2ID3A 4IHYA 3GZ6A 2GIZA 1YRNB 4IF4A 1AU7A 1F9NA 4D5CA 4XR6A 3L2VA 4NNJA 3A1YA 2CQQA 2Q0OA 2NOGA 3DU6A 3V4GA 4G6QA 2PN6A 5HNHA 2FSWA 4NB5A 2IA0A 1ETYA 4RLFA 4BJ5C 3PUBA 4QWQA 2JN6A 2RKHA 4UB6C 3G73A 2L01A 3FHZA 1LEAA 3DTIA 3I4PA 3L2WA 1YRNA 1R5GA 1EV7A 5EEGA 3MZYA 1K78A 3RDIA 3E97A 3HB9A 2XROA 2E2JJ 4KISA 3G71I 2YPRA 3ONQA 4LLGF 3NARA 2RGVA 3FK6A 3RJPA 1T95A 3IAS2 4BNCA 1LFBA 4OWRB 3HG9A 1T08B 2DMQA 2DK5A 3MKZA 3OYHA 2NYXA 2JZYA 4B09A 1ON1A 3WE3A 3LSTA 4H0EA 1H88C 1R58A 4RM2A 2DQLA 3N97A 3V7CA 2LTPA 1LE8A 1MBJA 2COMA 2BHYA 2DMNA 2FBIA 3QPSA 1ZELA 4UNOA 1FEXA 5J8CA 3CUOA 5FKOA 2VBYA 5ILUA 4N9IA 4KITB 1QHGA 3RSNA 4OOIA 5FROA 3G6EI 2R7QA 3GTOJ 1FT9A 5IT3A 1ZGWA 1T2KA 3AL0B 3LOCA 3SFIA 1X4PA 1MBGA 3F9KA 4YFNF 2A07F 4M71A 4G9YA 4S0HB 3HOYJ 2XRNA 3A02A 2W57A 4M3FA 4OU0A 1U2WA 4DYCA 2STTA 3S3MA 1H0MA 1LVKA 1USSA 4QIWN 3D5RC 3LQRA 1ZKGA 3MVPA 4XIDA 3IC7A 3CJRB 2QQ8A 5FLVA 2G7UA 2M4KA 3L9FA 1X19A 2PJPA 2IAIA 2W1OA 3QU6A 3PSFA 1IN6A 1RNLA 1H9TA 4LK1F 5F0CA 1HBXG 1CQTA 1X3ZB 4XM3A 1OMIA 3C2BA 3FBIB 1KQ9A 1ZGJA 2HNHA 4ZDLA 2X6YA 3JCUC 1I5ZA 4UUVA 1AWCA 3F8BA 4LGWA 2P6SA 3H9QA 4HPQA 3OYBA 1H89C 4AWXB 4IZZA 3E5QA 3CMEI 5B1BH 3HXLA 1A5JA 1XSVA 1E2XA 3A4CA 4ZJZA 3IH3A 3HOUJ 1D0YA 2KZVA 1XSDA 3W2WA 1BW5A 2FEZA 4ENKA 1Z6TA 2MG4A 2OUMA 5L3GA 2VOPA 2M7AA 2A05A 3FK7A 4DYRA 1A36A 2WAEA 2H09A 1Z91A 3OYJA 3A01B 2RNJA 5C44J 1XMAA 2G9WA 3AG3H 3HIFA 5HLTA 1WJEA 2D1VA 1MSEC 2MC4A 5BQTA 3ERED 2Q8KA 5E3MA 3LL7A 3BLYA 3R6SA 2FXAA 4C3IJ 4M73A 2CGPA 1TWHJ 4IHVA 4GGGA 2ISYA 1S6LA 1S7AA 2WBMA 2F5VA 3A01A 3V42A 1O3RA 4CXFA 1IRXA 2EZHA 2KL4A 1BI3A 4RB1A 3C18A 3BOQA 3OYNA 3P9KA 2ZC2A 5AONA 1A6IA 2BY2A 3H1CA 1R49A 3F8NA 3BPVA 4F91B 4ESBA 4BXUA 4CCOA 1HLVA 3ASNH 2KLOA 1XB4A 2Z33A 3E3VA 2VB6A 3DTEA 3O6BB 4CCMA 1VQ4I 5K7ZA 1F5TA 2XPUA 3LSJA 1Z7LA 2PQ8A 2XAQA 1Y0NA 2Z16A 2XSJC 2M0MA 4M9XA 5CPRB 2LG4A 1XTAA 4Y3OA 2F4OB 3U9GA 3ZQHA 4MLOA 1B9NA 2F5FA 4ANJA 2MA3A 2PBIA 2O03A 3MKWB 1ULYA 2VE9A 3CCJI 5M5WJ 2OZUA 2R7SA 2DA3A 2R7VA 3F23A 1SFOJ 3ABUA 3BC8A 4UUTA 2MLGA 3F8FA 4C30A 4HF2A 1XPXA 3LAJA 5K5QA 2QENA 3GTMJ 3G4SI 2ZXHA 3LSIA 1FX7A 2JQ7A 3K4KA 2JRMA 4B48A 2IEKA 3MKLA 2O9LA 1FPQA 1VQ7I 5ERIA 4U88A 1ETVA 2UUZA 5K7FA 4HNTA 4Q4ZF 3BPXA 5C4JJ 3I59A 1BBYA 3HOVJ 1E3HA 4FE4A 4BACA 5HNFA 1ZQ3P 3L7WA 1RRJA 2MH2A 3HKZN 2DFEA 3CLOA 4ZH4F 4RB3C 2V9VA 3GW2A 1MKMA 3H36A 4BJ6C 5BMZA 2AS5F 2MW8A 4CA0A 1XMKA 4PSWA 3RYRA 1RKTA 3M4OJ 1BN5A 4M3BA 3REOA 3FX3A 5F1JA 4M72A 1JKPC 4HX8A 1R6RA 1TWCJ 2B9SA 3OSFA 3PJRA 2E7XA 2KT0A 2DMPA 1MNEA 4NUBA 4AM3A 1BR2A 2VT3A 3B6CA 3P5JA 1PUFA 4IRIA 1WPKA 1QZYA 3NAUA 1E17A 1UCRA 4MFEA 2GXAA 4RAZA 3J7ZI 5LHHA 1K61A 2RV8A 1WGXA 3IHUA 2FBHA 2KIMA 3K69A 3QYFA 3E7LA 1XMXA 2P8TA 1LDJA 2L4MA 2Y48A 4Y52J 1WH5A 1W5CC 3M7GA 1WHUA 4D7MA 2DFFA 2JUCA 2X6WA 1FYMA 2DYSH 4ZYHA 1EKEA 5LFAA 5H20A 4CCLA 3BJ6A 3FMRA 5HDGA 5EEHA 1B72B 3UR3C 4II3A 4M74A 2LVSA 4XLCA 4LIUA 2I8DA 5FLXZ 1FSEA 1LFUP 3LAPA 4YELA 4WX9A 2OJED 1U78A 3ZMZA 3BG9A 3HJEA 4ZYDA 2BXYA 2E2IJ 5LRRA 2UXXA 5GADJ 1BIBA 3F6VA 4A0XA 1LDDA 5TRDA 1B59A 1SVLA 1I50J 1IXSB 5F04A 1Z77A 5CVVA 3DEWA 1DDNA 3V8JA 5GTHC 1MBHA 3ZCOA 3HTUA 4ENMA 3ZMUA 1XN7A 3CTAA 5IT9Z 2O0YA 1WZ2A 2J5OA 3W2VA 2LH9A 1NK2P 4XK4A 3FWEA 5M5XJ 2ZFWA 2AQEA 2DA7A 1WJDA 3ULQB 1IN4A 5J1RA 3OS0A 2F2EA 2O7OA 2LY1A 2PG4A 4JQFA 1WKMA 2EFPA 3F6OA 4M3EA 1B9MA 3CUQA 2GBYA 1BJZA 2E5ZA 4FQGA 5J3LA 3BTJA 3GUDA 3HRSA 1X1CA 3FIWA 1JKQC 2A6EF 5E1WA 2E60A 2KIQA 4CYDA 1CF7B 3CCVI 1JT0A 1SAXA 4BE1A 1DGWY 4XLEA 4EV0A 2RN7A 4J00A 5C3EJ 2OBPA 4F92B 1F43A 2FBKA 4NC7A 2BEOA 2BE5F 3SEZA 1P4WA 5IYCJ 3CQZJ 1ZLKA 3WHBA 1CF7A 3RPUA 1XGOA 3NQOA 3GYHX 2QBYA 1O7LA 2Z9OA 3TW7A 3OIPA 1FC3A 3K2AA 1U0JA 1OCCH 5HLHA 5FLXK 3RZOJ 3O3KA 2TRTA 3OV8A 1BW6A 2WTEA 4PK4A 5HS7A 5E18F 3Q5FA 2QQAA 4O6JA 3TDZC 1H9GA 3MZ8A 2FA5A 1FMWA 1FTTA 1ACIA 2N8GA 1HDDC 1MZBA 3H0GJ 2BV6A 2DI3A 1UHWA 3S16J 2DA6A 1D8JA 2XUBA 4M3DA 1MH4A 1SFUA 5IYDJ 1J2XA 4M9ZA 4HLYA 2HOAA 3PFYA 2KIUA 2EBIA 2MFZA 3QQAA 5IT9K 4DGWB 3CMAI 1GXQA 2JRTA 4HF1A 2JA7J 1SANA 3EUHC 2KIFA 3TDUC 1QPIA 3MMYB 3W6VA 2XGCA 5DDGA 1W5SA 1W0UA 1YQAA 3ZPLA 1IDZA 1MMAA 1FBUA 3S8PA 4N4NB 2HDDA 1Q1HA 2L2OA 3S1QJ 3DQVC 1P92A 3CMYA 2D2WA 1S8NA 3BR2A 2K9SA 2XIGA 1BI1A 2VLAA 2CQXA 2MGQA 3K4BA 4U0WA 5M3FJ 2FX0A 1FYLA 3HOTA 1YYVA 5FB2A 4QPQA 3SFZA 2VQHA 3L2QA 4CHUA 1YHQI 2L9RA 4IHXA 2ETHA 3NRVA 3LNQA 4Q5SF 4AIKA 3EYYA 4V19K 2E5NA 3OYDA 2ZKZA 1R5ID 1TNTA 2HOEA 2X6XA 5E3LA 4BY7J 4LJZF 2O6GE 2STWA 2R92J 3ZRGA 1YS6A 1D3YA 2CQ7A 4RDUA 3VB2A 4AU7A 3WTUC 2DPDA 3S2HJ 2M34A 1ETKA 2EA2A 3UKGA 4I09A 4AYBN 2E1CA 4X6AJ 1Z0XA 2GIVA 3RPUD 1MJAA 1NH3A 2K3PA 5EZHA 2EIJH 3I64A 1LDKB 1U5TB 5J40A 4NQWB 1V5EA 3I4MJ 3ASOH 4DBRA 3I4NJ 2ZXIA 3CCSI 3MWMA 3CC2I 4HDVA 4A0YA 4BL0B 2WY8Q 2E1MC 2CW7A 4C2UA 4LB5A 2HVSA 1SAUA 1P4AA 1YW7A 3IKTA 2WV0A 1PDNC 2A6HF 4YIRX 2DO7A 4B1RA 3FXUA 3HRTA 4F93B 2CU7A 3GTJJ 1SVMA 2CV1A 2W7NA 1WJFA 3JAMK 4NQWA 2H6BA 1SMYF 4L9JA 4OMZA 5D4RA 2K27A 2MBFA 3I9V2 4G8XA 2MLKA 2WAQA 4IKFA 3ZXSA 2E1NA 1IRFA 2NVXJ 3F8CA 2M5WA 3QODA 4MGRA 3O8GA 4AC0A 2HKXA 3VYSB 3WTXC 2YUSA 2JA2A 2OZ6A 2IBDA 4GXOA 4I6ZA 2EH3A 2F5DA 3GMEA 1JKRC 1QGPA 2O5RA 2P6TA 5BNGA 4U7DA 2OQRA 3EDPA 1G4DA 4I01A 4QPOA 1JHFA 4Z2YA 4C3HJ 2KZGA 2M1BA 2B63J 1O3SA 1FBQA 2R5ZB 1SFEA 2GXGA 1TP4A 1BJAA 2XSDC 1D0XA 4AD9A 2DFIA 4I7HA 2ESNA 4BBRJ 5B1AH 4A3LJ 1STZA 4ZC3A 2K40A 2HQ5A 1YOVB 2IPQX 3JRBA 1ZRDA 3DPUA 3HGGA 1ZHFA 2NNYA 3E5XA 1A6QA 2QWWA 3KP4A 4BQQA 2IGMA 3HTSB 3WTZA 1S29A 1XGSA 2ME6A 3PUFA 4Y17A 2RNGA 1V55H 1X3WB 3M8FA 1VQKI 2K9MA 2ZSIB 3FM3A 1BOAA 4KMUX 3WGGA 2P5LC 3F22A 2W24A 2R0QC 1Z9CA 4XNFA 2CFXA 1SEUA 1MMGA 3HPHA 4EGYA 1FYKA 2EJRA 2WB1N 4RBOA 3BTIA 1LJ9A 1OYIA 5KCMA 4DYQA 5FJ8J 1ZR2A 2VL8A 3DPLC 1VFCA 5HLGA 3E6CC 4J19A 4PJJA 1KGSA 1MH3A 3WU2C 1YIOA 3SZTA 1B8IA 2R3SA 5J1UA 4E7KA 2IS2A 1YIJI 2EFQA 2JTVA 3DKWA 3VYRB 1I6XA 2JPCA 1S7EA 1O57A 3GWZA 3I5UA 3KLNA 3W6JB 2OV7A 3CF5F 3NWSA 4D7NA 4G94A 3BTCA 2DQRA 4DZPA 1PUEE 3OYIA 3D5LA 2L02A 1SFKA 1R9TJ 2EV0A 2FOKA 3N4MA 4I99C 2ZO4A 4F3QA 3CCEI 1BI0A 5K1YA 1U8BA 3BR3A 2XF6A 3P9IA 1YW8A 1IZ1A 2KRHA 1J0RA 3ROUA 1G2HA 1QA6A 4HSTA 3M1CA 3B02A 2P7CB 5JVTA 4BY1J 3OYCA 1K78B 1BC7C 3LSRA 2W84A 1RC9A 1G3TA 3BY6A 3M9AA 2Y0SN 5GAGJ 2OPTA 1U3EM 3DKYA 1R22A 3GEZA 2QQBA 4E7ZA 4HZFA 3AG2H 3R0AA 4RGSA 1HQCA 4PJNA 4OIOF 1Y1WJ 3ABTA 2DT7B 2Y30A 1TWAJ 2RQQA 2JT1A 5ICFA 2L5QA 3BCAA 2BY0A 1LE8B 4ZDOA 2MD0A 4QTRA 1TT0A 3TP0A 1Q1VA 2HZTA 5CLSA 2CQKA 3V8KA 4XN3A 3LQQA 4I0AA 3GO5A 4NDLA 4ENNA 5ILVA 1WI9A 1K79A 1L0OC 1FIPA 4B4CA 4BQOA 1JGSA 3MKYB 2VJJA 4MIMA 4BAYA 3J81Z 1IGNA 5KK1A 4A2UA 2EFOA 4DIQA 1HA8A 3H5NA 3JRHA 1YJNI 4MEXF 4YIFA 2HYGD 1C0WA 1E3OC 3EYIA 5B5EC 5JHFA 3HYIA 3RPQA 4JYKA 3T8TA 3W6KB 3KYCB 2UXNA 2V6EA 1W36D 5B66C 2IS6A 1I3QJ 2QKLB 4XLHA 5FKKA 5HDKA 2HWVA 3WG7H 2A6TA 2AHQA 2VXZA 2RREA 2DOAA 2VPRA 3CJNA 3ZQQA 1YE9A 1W36C 1Z05A 2PEXA 2A68F 1TL8A 1ZG5A 1J75A 3GLLA 3C1DA 3PNVA 2XC7A 2DDBA 2XGXA 4II2A 1R36A 2AQFA 2XPWA 3ZQIA 1NK3P 4L18B 5E1XA 3L2UA 2CO5A 3IWZA 2VKHA 1ONVA 4RGRA 1WFXA 5GAEJ 3ECHA 4ZDPA 5FD6A 2HOTA 1WVRA 2LKXA 2QF7A 3DKXA 3GZ5A 1XX5A 4XONA 5D6EA 3OL4A 4Y4RA 2C6YA 1JXSA 1OJLA 1T8IA 1XCBA 4LOCA 2HPMA 3PQJA 1HXDA 3LWFA 4A3DJ 2QKMB 3KYDB 3BQYA 4EJUA 5JLXA 5DCMA 1USTA 1O3TA 3TGNA 1D0ZA 4N4OB 3ZN0A 2W4SA 3JW4A 1D1CA 4XLNF 2DW4A 4AVZA 3LFKA 4HOBA 1EH8A 5DD4A 4CCKA 1RI7A 3QYBA 2LBFB 4XSXF 1D5YA 2O8XA 4FTHA 2VKVA 3IH2A 5K5OA 1YS7A 3GFLA 1N78A 3DU5A 3KP7A 4PUSA 2QSFX 1X58A 5F6FA 1X1AA 3L09A 5EGOB 1YX3A 5IOYA 4KYWA 2L4AA 4MQ9F 4B44A 2ZJPF 1YW9A 3I54A 4KIBA 1BM9A 2LBFA 3J81K 2JA6J 2VIXA 4IOAF 3JTHA 4HLXA 4LMYA 4M6XA 3IRQA 1XC5A 3CCYA 3DCFA 3I53A 4C2MJ 4HRIA 5EGOA 2MH9A 1UFMA 4F7ZA 4L9VA 4BKXA 1IUYA 3HKZA 2L7MP 4A3GJ 2QQ9A 1YFHA 2K9LA 3GTGJ 3S14J 5CVUA 5FKLA 4ZTFA 3OR1C 3QPHA 4PJ0C 2A69F 5CQEA 4EGZA 1QBJA 4BHCA 3A03A 3KEQA 3HRMA 4DNCA 1L3LA 1FY7A 2CG4A 3VSKA 1FP2A 2ADUA 4BHBA 2R7FA 2XF7A 1G3WA 2B0LA 4K2EA 1UB9A 2KJBA 2RAEA 2HQNA 3K9TA 4XKWA 4XOTA 5HLIA 4BJTA 1JUSA 1AHDP 3K70C 3I58A 2LF8A 4CZZA 1R1VA 2XGEA 4UXNA 5KVRA 3SJMA 1ZLJA 5A2QZ 2X51A 3JRFA 1KQ0A 4U0YA 1ZR4A 4LK0F 3JRAA 1S5LC 4MFDA 4YFKF 2AO9A 4TV7A 4E7JA 3OL3A 2XAGA 5DCFA 3SZPA 1BR4A 1W4MA 3HM5A 4P96A 2JWTA 5LGTA 1OKRA 3FF5A 1JJ8C 3BROA 1HKSA 2NS8A 1RR7A 1ZAOA 1SD4A 1P4XA 2Z99A 4JOMA 3GTQJ 4E4HA 3OR2C 2X48A 3GX4X 3O8HA 1K83J 3I59B 5FKNA 4RMNA 1PJRA 5GAHJ 2Q2EB 1FJLA 5L3EA 2OTLI 5GPCA 3MQ0A 2EPFA 4U0VA 3P9CA 4A5MA 5FGMA 3KYLA 4D9JA 3P7NA 4XRMA 4D5FA 2JUGA 4KA4A 1QZZA 2FRHA 3KIOA 4HA8A 1IRGA 3IP4B 2ZNZA 3ML6A 4QSHA 2Q2EA 3QPLA 2X0LA 4A3MJ 3KPHA 4PGHA 3OMYA 2RVCA 3OIOA 4PFPA 1XGMA 2HEOA 4BYYA 3M8EA 4BH9A 3ZOBA 2A5YB 1P7JA 4C2TA 3S1MJ 1PUFB 3NWTA 2MSYA 1I3AA 4UB8C 1K6YA 1TWGJ 1BI2A 2M0CA 2ZCWA 3CJQB 5D4SA 5J8FA 1ZREA 3LSMA 5EG0A 3ISPA 2LK2A 3K1PA 3DBRB 1PVEA 2XDVA 3T0YA 1XD7A 4A0ZA 1R5HA 3X2QH 4NHJA 5A2QK 3L2RA 3JRGA 1Z6RA 2IJLA 3OS2A 3AG1H 3W3CA 4FASD 4IHTA 4FHTA 2QVOA 3HDDA 3FZVA 3NEUA 1A31A 2H27A 3IH4A 3QPTA 3TO6A 5KAFC 4XMYA 3ZQCA 2CH0A 1N77A 1WJ5A 2ZJQF 2CSOA 3FMQA 3FXJA 4U7BA 5FRMA 5IP6A 1FWZA 2DTZA 1V3FA 4CZCA 2X6OA 3OYMA 3L1PA 3K1NA 2R7UA 3FXMA 3LA3A 3D1NI 5F64A 2IS1A 2XV4S 2ZJ2A 2VOOA 1ENHA 2H1LA 4JBAA 2WADA 5E8GA 3RQIA 3VDXA 1ZRCA 4XORA 3SQNA 2H94A 2L3DA 4AUXA 1S7OA 5HS9A 3TL4X 2R4GA 2HS5A 2BY1A 5DM6F 1I1GA 1APLC 4WXDA 2VBWA 1K4SA 3FXRA 2QSHX 2FF4A 2XAFA 3E1SA 3HL2A 5B3SH 3CF2A 3EUHA 5IY5H 3BWGA 2ZXWH 2KRFA 4BXXJ 2RC4A 2QLZA 3VYTB 3DFGA 4ETSA 1RESA 4HAMA 3G1MA 4M6YA 1FBSA 2A3SA 3F0CA 4GDFA 2XKPA 3CUQB 4EJVA 1FNNA 4YRVA 4XBFA 3HOSA 1DGRM 2VI6A 3ZQ7A 2HDCA 3ELKA 1Y56A 5HODA 1ZG3A 1HDPA 5L3DA 2DT5A 5ICEA 1V54H 2DDAA 3CO6C 4IJAA 2COBA 3FMSA 3SZGA 1DU0A 1JHHA 2W25A 5IYBJ 3WU0A 1EA3A 1MMDA 3S2WA 1KA8A 2JVHA 1B6AA 5LEKA 3H35A 1TW2A 2QBYB 4GYGA 2BZTA 2E1MB 5DD8A 1W7PB 2ZNYA 3S17J 9ANTA 1VQLI 2XRLA 4KN7X 2LRDA 1BR1A 2CFOA 3Q3SA 3SDGA 2AXLA 4EVIA 2P5VA 2EZKA 1IF1A 4BU2A 2JA5J 3TOAA 5IOZA 3D0SA 2L7FP 2NS7A 4JX6A 2LR8A 2V6CA 4L0ZB 3LMMA 3WE2A 1TLHB 1W7PA 2F6CA 4IOCF 3J7AO 3PFIA 3FBNB 1ODDA 1T0FC 2M2EA 3RKYA 4AYBA 2TDXA 5TGTA 1SD6A 5KNLA 2IS4A 1YLFA 2HQRA 1IO2A 4L5EA 2ELKA 3J7AY 1VNDA 3WTVC 3CP8A 2FMYA 1TWFJ 1H8AC 2OCCH 3WGIA 2M30A 1OR7C 4IQJA 2BVLA 1GUUA 1I6HJ 3OY9A 2NAZA 2FQ3A 4KUMA 5LEJA 2QA4I 3OSGA 1RIOH 4EM1A 4A3CJ 2F48A 4FETA 4WXCA 2ISZA 4XLPF 1MJ9A 2R7ZJ 2F4MB 3CCUI 2GOXB 4HX4A 2BVMA 2I10A 3Q0UA 2UWMA 3HSRA 4IL6C 4UUSA 3FXKA 3SHFA 4V2FA 3HC7A 5FO5A 3CP2A 1G3YA 1Y6IA 1AA7A 1U8RA 2W00A 1QVUA 2Y0MA 4RAGA 3JRCA 3RKQA 2RQPA 1XGNA 4FT8A 1VTNC 1HC8A 2Z3YA 1X4OA 1K6OA 4N9HA 1SFXA 1D5VA 2FJ1A 4GRIA 2L54A 5J6XA 1T98A 3Q9VA 2EINH 2CWEA 1QPMA 3LA7A 4R79A 2O3FA 1VQ9I 3VEPA 1XDUA 1Z7UA 1MW7A 4LFUA 1Y8RB 1ERDA 2JJ7A 3HZJA 1POGA 1NHAA 4DQ2A 3WGHA 1DPUA 4CYCB 4KN4X 3I56I 1VI0A 3PIPF 4ESFA 2D5VA 3S3NA 1J59A 5BPDA 3QWLA 2DFHA 1UJ8A 1HKQA 2V1DA 2PMZN 3K4CA 2NS0A 2M9HA 4B43A 1IUFA 2KKOA 3KEOA 3HHHA 4RGUA 1XG1A 3BDDA 1GVDA 3CLQA 4O3MA 3QOEA 1F36A 2WY7Q 3CCMI 1W7PD 1KU7A 2P7VB 3OYFA 4CYCA 5DS9A 5TISC 2Y31A 4GO1A 5LBQA 2V1NA 1V5FA 2BYVE 4P55A 3B73A 4KFCA 3I3LA 4CDGA 1MBEA 2YX7A 2ZJRF 2E36A 2KRCA 2L0KA 4CCJA 3J80Z 2H8RA 4C3JJ 2VT2A 1JTXA 1UHSA 2ID6A 4EQQA 4XLFA 5EF6A 1ZYRF 3ZMVA 1KU3A 4JX4A 4KJZA 5CKTA 5LRSA 2CV2A 5JVGF 5FLMJ 3HOWJ 1R23A 4MTDA 2OA4A 2GOMA 4XRFA 2MYSA 3GZNB 1NG6A 2Y2ZA 3E6DA 4PJMA 4EJTA 2F5EA 3SXYA 2KFDA 5DUIA 2LDUA 3GBGA 2NXNB 4FCYA 4L5IA 5L3CA 3BZCA 3B6AA 4BHPA 1V4RA 1V5GA 1ZGAA 2E71A 2VONA 5H6RA 3TMOA 5BPIA 3F8MA 3LSHA 3MAJA 3TO7A 5ICCA 4ESJA 3GFIA 2PI0A 3GTKJ 2K4JA 5CQGA 4JP0A 4S04A 3VWBA 4IEJA 2GWRA 1JI8A 5EDNA 2NVYJ 5LD2C 2LYCA 2CUFA 4BQAA 3DEEA 4P9UA 2R7TA 4HF0A 4P5OA 2Y0SA 4PFOA 3DP7A 5FRNA 4HSRA 4UY8I 1YX5A 1DPRA 2DAOA 4QLCU 4O5VA 5JFRA 1VF9A 3HSEA 4EJWA 4F55A 1UAAA 4E7SA 2E7WA 3OOUA 4M9SA 2CMPA 2L7ZA 3PSIA 4N0BA 1JUPA 2DLLA 2VBZA 2M4GA 1QO0D 2H6CA 3E6BA 5LHIA 2OC6A 1T56A 3GFMA 2DA2A 2XB0X 3C2GA 1B8IB 3I71A 5E79C 3LFUA 1RZ4A 3VYUB 1GLNA 2EV5A 3OYEA 1X2MA 1IXRC 5DTDA 2HDWA 1LFPA 2DA5A 2CUEA 2YU3A 4DBQA 2HXOA 3VSLA 3T5XA 1GVJA 3PQKA 2EZLA 3IRRA 3R0JA 2BBYA 3M07A 4A3FJ 3EETA 3K1MA 4XKVA 1LKXA 1QHHD 4FX4A 3KFWX 2ZMEC 1Z3YA 2LD5A 1ZRFA 2G7HA 5BOXA 3GFJA 4I2OA 1A35A 3WHCA 1MSFC 2FE3A 3K4LA 2XGDA 3MN2A 2B7EA 3BQZA 4IHWA 2YX4A 3TW6A 2E2HJ 2DXIA 4XRSA 3AKZA 4KIGA 4IHSA 3ZMTA 5D8KB 3A0BC 3CO7C 3KCCA 1OPCA 1LVAA 4MQVA 2W85A 2Q1ZB 4XKBA 3LSPA 3BR0A 1OCOH 2DMTA 2MABA 3E5UA 4R8HA 5L3BA 2DOEA 3PM1A 4RLQA 2PMHA 1TTYA 1S3JA 2Z1DA 3CC4I 4F52A 4MHGA 1S9HA 3BJAA 4G12A 4BEHB 1Y8QB 5GTIC 3AAFA 2R7RA 2VE8A 4RB2C 2DMUA 2EQRA 3AFHA 2HYFA 2IGNA 1MNMC 3E0JB 3HBLA 1U5TC 1X3UA 3K4MA 2V9PA 3V8LA 4UVBA 5JLWA 3KZIC 1FLIA 1HF0A 2QSGX 5FKMA 3JREA 2IGOA 2NVTJ 1ZK8A 3BTLA 2Y9YA 2MC3A 4IX7A 4BEHA 4OAYA 1QZEA 3WTWC 4BQNA 2DBBA 2GAUA 4A6EA 4YEJA 2JVGA 1QU3A 2LLKA 1J7KA 4G7ZF 1LNWA 1TQPA 2YU9J 2NVQJ 1YJWI 1BOBA 3OOPA 2QEXI 1HW1A 1U6GA 1I39A 2NVUB 1G3SA 4OIQF 3CESA 4G6DA 3FXLA 4G6TB 1FP1D 4EM2A 1MBKA 2OCEA 2K9QA 3QU3A 3K0LA 4UVCA 1SC7A 4GYIA 2PJRB 3K10A 2IW5A 2XAUA 3F21A 1ITYA 1SD7A 2HXIA 1IRZA 4PCQA 4A93J 1K4TA 3H3ZA 2GA2A 1TW3A 1T33A 5LHGA 1BL0A 1DP7P 3DBLB 4ZTJA 4ZYEA 2W48A 2ECCA 2VC0A 4Y13A 1RUNA 4WXHA 1X1BA 5FD5A 1RETA 4BXFA 4OMYA 5CVIA 2PX9A 2K3FA 1IW7F 3MEXA 4GCVA 4D0PA 2IRFG 2PJRA 2CRGA 1MDMB 1WRJA 2BY3A 3CMMA 4A3KJ 1U9NA 1FTZA 3DEUA 2X85A 2EB7A 4RM3A 5DCMB 2IVMA 1NTCA 5IP7J 1GDTA 2JSCA 4DZJA 4L0YB 3ECOA 3FKIJ 5GP9A 1ZTRA 1Y39A 2HYJA 2CUZA 2ELJA 2V9KA 3KEYA 1MDMA 2DJIA 3S32A 3BZ6A 2EV6A 5J47A 1RR8C 4UV9A 3M3YJ 2A61A 2HGCA 2KMUA 3BG6A 2LNBA 2P4WA 4NC6A 1QNTA 2LKSA 1Y1VJ 4P9FA 5TJJA 1WQ2A 1KU9A 1T38A 2CUJA 3QAHA 3TO9A 3BR1A 1R4NB 4IVNA 2EWNA 4I76A 4PSXA 3KP6A 4Y7NJ 4E70A 4ENJA 1X1DA 2PLYA 3HPGA 1TQIA 3CJTB 2EK5A 4LD5A 3IKVA 2FOWA 4WWCA 5KHDA 2LY2A 4RB0A 2XAJA 3K2ZA 3BG7A 2M87A 2GLOA 4EEFG 5CVJA 1IAWA 3WTSC 5E17F 2K86A 1JT6A 2DU9A 1R1UA 1UMQA 5JI6A 4WCGA 4A3BJ 3BG3A 2EFWA 3ZR8X 2DCEA 2WAFA 3A0HC 1YJ9I 1JGGA 1P2FA 4ZYAA 2DT6A 4S05A 3DLLF 1BA5A 2QUFA 1XS9A 1KYZA 5EYRA 2DJNA 2KJCA 3H3UA 3HEFA 3GF2A 3BJOA 3JSPA 4CGZA 4BDZA 1JE8A 4HV5A 3K6GA 4V2GA 1GT0C 3K70D 4JX5A 5HS8A 3JRIA 1E3PA 3IUOA 5HOOA 1D1AA 4ZYGA 5D5XB 4E6KG 4XKCA 1HSTA 3R4KA 3QYEA 2VBXA 5GPAA 3ZMDA 4KNYA 4KDPA 3HOXJ 1UZCA 1XCVA 3EUAA 3OYGA 2K02A 3IAM2 4M6VA 1UG0A 1UG2A 2HR3A 3R61A 4D1QA 4KICA 2CQNA 2V4JC 3WTTC 2FUG2 3ABLH 1MNDA 2JSPA 3S1RJ 3J7YJ 2P0WA 1TZLA 3BG5A 3OYAA 2G0EA 2YS9A 4ZZDA 3IL2A 1VQ8I 1J09A 3KP3A 1OCTC 1VQNI 2NOJB 3S93A 4J01A 3BP8A 3GCMA 1D1BA 3RZDJ 4HBLA 5D5WB 3OYLA 3JTGA 3TKYA 2HQAA 2VC1A 4CUGA 1OQYA 5ILSA 1GXPA 5H6QA 1B1BA 3WU1B 3T8RA 3VPRA 4HNUA 4LG3A 1WJAA 2ELHA 4XRSG 3KP5A 4BE0A 2ACJA 1P7IA 5DV5A 1EJ9A 2XKOA 2O8KA 2V1XA 4BS9A 2GXBA 1VQMI 2FNPA 4EM0B 1IC8A 3H5AA 4L9TA 4Q47A 2QGUA 2ZSHB 1N75A 3AL0C 5JR3A 4KIFA 3CD6I 4LLLA 3KETA 1WWXA 5EG0B 2QM3A 1JJ6C 2E34A 2BOLA 2O61A 1WJBA 4HYEA 1F1ZA 3HHGA 1ZH5A 2VKDA 1WSUA 1G59A 1Z21A 5DYMA 1REPC 3LA2A 4Y33A 4PJLA 3Q0WA 2KDZA 3PNTA 2HPIA 3RCOA 1MBFA 4AIJA 2XASA 4EATA 3LSKA 3ABKH 1OYWA 2IP2A 5M5YJ 2R7WA 1VQPI 3FHNA 5IP9J 3BR5A 3QP6A 2FQ4A 2PMUA 4NBQA 2Y9ZA 4GFBA 2JMWA 3K4JA 3QOPA 1CGPA 2QCOA 4BE2A 2HFHA 5D5UB 4CCNA 4E7IA 3RKWA 1JKOC 4LITA 2BW3B 1MJBA 1W0TA 5K5RA 2K5CA 1KZHA 1IN8A 6PAXA 1IG7A 1ON2A 2X9DA 4B47A 4G7HF 2CW0F 1PP8F 4PDKA 1T0FA 2CYYA 3ZGKA 4YFXF 3SDBA 1T39A 1D8KA 1GV2A 3FXQA 3H5RA 4W97A 2HVRA 1OCPA 3COAC 4G7OF 1P9QC 1WH7A 3N05A 4IXAA 3BR6A 1P6RA 4DW6A 2BW3A 1IXCA 4A6DA 1M1EB 5LLQA 3U1KA 3T1BA 1ETOA 1FSHA 1HW2A 1R00A 2EA4A 3EPZA 4M3GA 4OAZA 2OQGA 4X0GA 1OR7A 3S15J 3RI4A 2XF5A 1IDYA 3MZHA 1ZG1A 3TBIA 4CSWA 3FISA 2X1EA 5KAIC 1IN5A 1RUOA 4L9NA 3F3XA 2XAHA 2L9VA 3KP2A 4XN0A 2WWYA 3OS1A 4XL9A 4PZJA 2X4HA 3ZMSA 3R60A 2EILH 2XVCA 4HDUA 1BIAA 3H3VK 3H0DA 2HTSA 2QYOA 4MEYF 3WODF 1FMVA 2W82A 2V26A 2VN2A 5J1YA 3HSFA
chains in the Genus database with same CATH topology
4EMSA 4YIIA 5JHUA 2OAZA 1HW5A 4I02A 3L2CA 3VOEA 5FFZA 3RYPA 4CO8A 4UVAA 2LKPA 3VFZA 2VODA 1XSXA 1J5YA 3U1DA 1R7JA 1SMTA 2IA1A 4AIHA 1K7AA 4FX0A 3H92A 2OU2A 1AOYA 1G6NA 5E20A 3ZN1A 4LB6B 2IA2A 3MCZA 4Y15A 1HSJA 1UHMA 3O2PE 4HX7A 1O7FA 2DPUA 3DV8A 4ASNA 3CDHA 5CYVA 4IRHA 1ZN2A 3RIRA 1Y0UA 2YSRA 1MD0A 2IT0A 3IWFA 4OIPF 2NRAC 2F5CA 2OD5A 4L5JA 1O3QA 5F1RA 1W5TA 3MFKA 1XDSA 4JK1X 4A12A 5AIPA 3TOBA 2V79A 1LQ1A 4EJOA 3M1EA 4LLNA 2LF7A 4PGGA 1YTYA 2V1UA 3KE2A 4OIRF 1YG2A 5D6FA 2M45A 4ZZLA 4RGXA 3C3WA 3JAMZ 2MD5A 2K4BA 2HTJA 1TBXA 2EFNA 4HQMA 1KYWA 3DF8A 2YR2A 3KZYA 3GVAA 4HW0A 5AIQA 1EH6A 1SD5A 5D8LB 1FOKA 1TQMA 2DTRA 2ZMEB 1OYYA 3F72A 3U2RA 2WC2A 4ON0A 3QRFF 2M8EA 4HQEA 1KU2A 2D1HA 1R1TA 2XHKA 4OINF 3CUQC 3C7JA 1LEBA 2ZMEA 3FM5A 2P5KA 2BGCA 2NNNA 3Q9SA 4YG2F 4UHTA 4XSZF 4R1HA 1HKTA 4HV6A 2D45A 1DUXC 4RS8A 4UV8A 5LGNA 3KLOA 3KZZA 2PFBA 4MNUA 3HUGA 3WG9A 3DPTA 2J5PA 1U5TA 1MGTA 4KT5C 2UZKA 3V7SA 1BC8C 2FU4A 4RAYA 4I0BA 4IRGA 3GLXA 2GZWA 5FFXA 5HVQC 5L3FA 3HRUA 3V7RA 1PP7U 5HDNA 3EQLF 5D5VB 1B4AA 3VODA 2Y75A 5BS6A 4CICA 1T6SA 2GQQA 5CJ9A 1Z1DA 5CVRA 2K7LA 5ICGA 4LG0B 1IN7A 1FZPB 3JSOA 4IPAA 3I0TA 1GHCA 3RKXA 1QQIA 2FNAA 3J80K 1J9IA 5LGUA 1I1SA 2ZBKA 4LG0A 1YO5C 2HKOA 5E1ZB 5DEQA 4A5NA 1LB2A 1TNSA 2FMLA 4AVPA 4MTEA 2RDPA 4WF2A 2ESHA 2DK8A 4B8XA 1EH7A 1A04A 2JPBA 3QP5A 1F4KA 3TQNA 2Z5UA 3L00A 1KQ8A 5E8IA 3E6MA 2LSOA 2R7DA 3DXJF 5ED4A 1I27A 3GXOA 3WTYC 4KMFA 3G3ZA 5DUKA 3RTRA 2GA1A 2ZXJA 3ZP5A 2QZ8A 4Q48A 4WK8F 4I98B 1ZARA 3GZ6A 4IF4A 1F9NA 2Q0OA 3V4GA 4G6QA 2PN6A 2FSWA 4NB5A 2IA0A 4QWQA 2RKHA 3G73A 2L01A 3FHZA 1LEAA 3I4PA 1R5GA 1EV7A 5EEGA 3MZYA 1K78A 3RDIA 3E97A 2XROA 2YPRA 4LLGF 2RGVA 3RJPA 4BNCA 2DK5A 2NYXA 2JZYA 4B09A 1ON1A 3WE3A 3LSTA 4H0EA 1R58A 2DQLA 3N97A 3V7CA 2COMA 2FBIA 4UNOA 5J8CA 3CUOA 2VBYA 5ILUA 4N9IA 4OOIA 1FT9A 5IT3A 1T2KA 4YFNF 2A07F 4M71A 4G9YA 2XRNA 4OU0A 2W57A 1U2WA 2STTA 1H0MA 1USSA 3LQRA 3IC7A 2G7UA 3L9FA 2PJPA 3QU6A 1H9TA 1IN6A 1RNLA 4LK1F 1HBXG 1OMIA 1KQ9A 1ZGJA 1I5ZA 4UUVA 1AWCA 3F8BA 4LGWA 2P6SA 4AWXB 3E5QA 1XSVA 1E2XA 1XSDA 4ENKA 2FEZA 1Z6TA 5L3GA 2VOPA 2H09A 1Z91A 2RNJA 1XMAA 2G9WA 3HIFA 2D1VA 5BQTA 3ERED 2Q8KA 3R6SA 2FXAA 4M73A 2CGPA 4GGGA 2ISYA 1S6LA 1S7AA 1O3RA 4CXFA 1BI3A 4RB1A 3C18A 3BOQA 3P9KA 5AONA 3F8NA 3BPVA 4ESBA 4BXUA 1XB4A 2Z33A 3E3VA 3O6BB 1F5TA 2PQ8A 2XAQA 4M9XA 3U9GA 1B9NA 2F5FA 2MA3A 2PBIA 2O03A 1ULYA 2VE9A 2OZUA 3F23A 3ABUA 2MLGA 3F8FA 4HF2A 3LAJA 5K5QA 2QENA 1FX7A 1FPQA 5ERIA 4U88A 4Q4ZF 3BPXA 3I59A 1BBYA 3L7WA 2MH2A 3CLOA 4ZH4F 4RB3C 2V9VA 3GW2A 1MKMA 5BMZA 2AS5F 1XMKA 3RYRA 1BN5A 3REOA 3FX3A 4M72A 4HX8A 2E7XA 2VT3A 4IRIA 1QZYA 1E17A 1UCRA 4RAZA 5LHHA 2RV8A 3IHUA 3K69A 2FBHA 2KIMA 2P8TA 1LDJA 2L4MA 2Y48A 3M7GA 1FYMA 4ZYHA 5H20A 3BJ6A 3FMRA 5HDGA 5EEHA 4M74A 5FLXZ 1FSEA 3LAPA 4WX9A 1U78A 3ZMZA 4ZYDA 5LRRA 2UXXA 1BIBA 3F6VA 4A0XA 1LDDA 5TRDA 1B59A 1IXSB 5CVVA 1DDNA 3V8JA 3HTUA 4ENMA 3ZMUA 1XN7A 3CTAA 5IT9Z 2O0YA 2J5OA 3FWEA 2ZFWA 3ULQB 1IN4A 2F2EA 2PG4A 4JQFA 1WKMA 2EFPA 3F6OA 1B9MA 3CUQA 3GUDA 3HRSA 2A6EF 5E1WA 4CYDA 1CF7B 1SAXA 4EV0A 2RN7A 2OBPA 2FBKA 2BEOA 2BE5F 1P4WA 1ZLKA 1CF7A 3RPUA 1XGOA 3NQOA 3GYHX 2QBYA 1O7LA 2Z9OA 5HLHA 1FC3A 5FLXK 3O3KA 3OV8A 2WTEA 5HS7A 5E18F 3Q5FA 2QQAA 4O6JA 3TDZC 1H9GA 2FA5A 1MZBA 2BV6A 2DI3A 1UHWA 1D8JA 2XUBA 1SFUA 1J2XA 4M9ZA 4HLYA 2KIUA 5IT9K 1GXQA 2JRTA 4HF1A 3TDUC 2KIFA 5DDGA 1W5SA 1YQAA 3ZPLA 1FBUA 1Q1HA 3DQVC 1P92A 2D2WA 1S8NA 2XIGA 1BI1A 4U0WA 1FYLA 3HOTA 1YYVA 5FB2A 3SFZA 4CHUA 2ETHA 3NRVA 4Q5SF 4AIKA 3EYYA 2ZKZA 2HOEA 1TNTA 4LJZF 2O6GE 2STWA 1YS6A 1D3YA 3VB2A 3WTUC 2DPDA 2EA2A 4I09A 2E1CA 2GIVA 1MJAA 3I64A 1LDKB 1U5TB 3MWMA 4HDVA 4A0YA 4LB5A 1P4AA 1YW7A 3IKTA 2WV0A 1PDNC 2A6HF 2DO7A 3FXUA 3HRTA 3JAMK 4NQWA 2H6BA 1SMYF 5D4RA 4L9JA 4OMZA 2K27A 2MBFA 4G8XA 2MLKA 2E1NA 1IRFA 3F8CA 2M5WA 4MGRA 2HKXA 3WTXC 2OZ6A 4GXOA 2F5DA 1QGPA 4U7DA 2P6TA 2OQRA 3EDPA 1G4DA 4I01A 1JHFA 4Z2YA 2M1BA 1O3SA 1FBQA 1SFEA 2GXGA 1BJAA 4AD9A 2DFIA 4I7HA 2ESNA 1STZA 2IPQX 1ZRDA 1ZHFA 2NNYA 3E5XA 2QWWA 3KP4A 3HTSB 3WTZA 1S29A 1XGSA 4Y17A 3M8FA 2P5LC 3FM3A 1BOAA 4KMUX 3WGGA 3F22A 2W24A 1Z9CA 2CFXA 4EGYA 1FYKA 2EJRA 1LJ9A 1OYIA 3DPLC 5HLGA 3E6CC 1KGSA 1YIOA 3SZTA 2R3SA 2EFQA 2JTVA 3DKWA 1I6XA 2JPCA 1O57A 3GWZA 3I5UA 3KLNA 3W6JB 4G94A 2DQRA 1PUEE 3D5LA 2L02A 2EV0A 2FOKA 3N4MA 2ZO4A 1BI0A 5K1YA 3P9IA 1YW8A 1IZ1A 3ROUA 1J0RA 3B02A 2P7CB 5JVTA 1K78B 1BC7C 2W84A 1G3TA 3BY6A 3M9AA 1U3EM 1R22A 3GEZA 2QQBA 4HZFA 3R0AA 4RGSA 1HQCA 4OIOF 3ABTA 2JT1A 5ICFA 2HZTA 5CLSA 2CQKA 3V8KA 3LQQA 4I0AA 3GO5A 4ENNA 5ILVA 1WI9A 1K79A 1L0OC 1JGSA 4BAYA 3J81Z 5KK1A 4A2UA 2EFOA 4MEXF 4YIFA 2HYGD 1C0WA 3EYIA 3HYIA 3RPQA 3T8TA 3W6KB 2UXNA 5HDKA 2HWVA 2VXZA 3CJNA 1Z05A 2PEXA 2A68F 1ZG5A 1J75A 3C1DA 2XGXA 1R36A 4L18B 5E1XA 2CO5A 3IWZA 1ONVA 4RGRA 3ECHA 5FD6A 3GZ5A 5D6EA 2C6YA 1JXSA 1XCBA 3PQJA 1HXDA 3LWFA 4EJUA 5DCMA 1USTA 1O3TA 3TGNA 3ZN0A 3JW4A 4XLNF 2DW4A 3LFKA 4HOBA 1EH8A 5DD4A 1RI7A 4XSXF 2O8XA 5K5OA 1YS7A 3GFLA 3KP7A 5F6FA 3L09A 4KYWA 2L4AA 4MQ9F 1YW9A 3I54A 4KIBA 1BM9A 3J81K 3JTHA 4HLXA 4LMYA 4M6XA 3IRQA 3I53A 2MH9A 1UFMA 4F7ZA 4L9VA 1IUYA 2QQ9A 1YFHA 5CVUA 3QPHA 2A69F 4EGZA 1QBJA 4BHCA 3KEQA 4DNCA 3HRMA 1L3LA 1FY7A 2CG4A 1FP2A 2ADUA 4BHBA 2R7FA 1G3WA 2B0LA 4K2EA 1UB9A 2KJBA 5HLIA 2HQNA 3K9TA 3I58A 2LF8A 4CZZA 1R1VA 4UXNA 5KVRA 1ZLJA 5A2QZ 1KQ0A 4U0YA 4LK0F 4YFKF 4TV7A 3SZPA 2XAGA 5DCFA 1W4MA 4P96A 5LGTA 1OKRA 3FF5A 3BROA 1HKSA 1ZAOA 1SD4A 1P4XA 2Z99A 3GX4X 3I59B 5L3EA 3MQ0A 4U0VA 3P9CA 4A5MA 5FGMA 3P7NA 4KA4A 1QZZA 2FRHA 4HA8A 1IRGA 2ZNZA 3ML6A 2Q2EA 2X0LA 4PGHA 2RVCA 2HEOA 1XGMA 4BYYA 3M8EA 4BH9A 2A5YB 2ZCWA 5D4SA 1BI2A 5J8FA 1ZREA 3ISPA 3K1PA 3T0YA 1XD7A 4A0ZA 1R5HA 4NHJA 5A2QK 1Z6RA 2IJLA 4IHTA 4FHTA 2QVOA 3FZVA 3NEUA 2H27A 3QPTA 3TO6A 2CSOA 3FMQA 4U7BA 1FWZA 1V3FA 3K1NA 3LA3A 5F64A 2XV4S 2ZJ2A 2VOOA 4JBAA 5E8GA 1ZRCA 3SQNA 2H94A 2L3DA 1S7OA 5HS9A 2HS5A 1I1GA 4WXDA 2VBWA 3FXRA 2FF4A 2XAFA 3EUHA 3BWGA 2KRFA 2RC4A 2QLZA 3DFGA 4ETSA 4HAMA 4M6YA 1FBSA 2A3SA 2XKPA 3CUQB 4EJVA 1FNNA 4XBFA 3HOSA 3ZQ7A 2HDCA 3ELKA 1ZG3A 5L3DA 2DT5A 5ICEA 3CO6C 4IJAA 3FMSA 1JHHA 2W25A 3WU0A 3S2WA 1KA8A 1B6AA 5LEKA 1TW2A 2QBYB 4GYGA 5DD8A 1W7PB 2ZNYA 4KN7X 2AXLA 4EVIA 2P5VA 1IF1A 3TOAA 3D0SA 4L0ZB 2V6CA 3WE2A 1TLHB 1W7PA 3J7AO 3PFIA 1ODDA 3RKYA 2TDXA 1SD6A 1YLFA 2HQRA 3WTVC 2FMYA 3WGIA 2M30A 2NAZA 2FQ3A 4KUMA 5LEJA 1RIOH 4EM1A 4WXCA 2ISZA 4XLPF 1MJ9A 4HX4A 2UWMA 3HSRA 3SHFA 5FO5A 1G3YA 1U8RA 2Y0MA 2RQPA 1XGNA 4FT8A 1VTNC 2Z3YA 1K6OA 4N9HA 1SFXA 1D5VA 2L54A 5J6XA 1T98A 3Q9VA 2CWEA 1QPMA 3LA7A 4R79A 2O3FA 3VEPA 1XDUA 1Z7UA 4LFUA 1NHAA 4DQ2A 3WGHA 1DPUA 4KN4X 4ESFA 1J59A 5BPDA 1HKQA 2V1DA 2NS0A 2KKOA 3KEOA 3HHHA 4RGUA 3BDDA 4O3MA 1KU7A 1W7PD 2P7VB 4GO1A 5LBQA 2BYVE 4P55A 3B73A 4KFCA 4CDGA 2YX7A 3J80Z 2VT2A 4EQQA 1ZYRF 3ZMVA 1KU3A 5LRSA 1R23A 4MTDA 2OA4A 4XRFA 4EJTA 3E6DA 2F5EA 3SXYA 5DUIA 2LDUA 4L5IA 5L3CA 4BHPA 1V4RA 1ZGAA 2VONA 5H6RA 5BPIA 3F8MA 3MAJA 3TO7A 5ICCA 4ESJA 3GFIA 2PI0A 2K4JA 4S04A 2GWRA 4BQAA 4P9UA 4HF0A 4P5OA 3DP7A 2DAOA 1DPRA 4QLCU 4O5VA 5JFRA 3HSEA 4EJWA 2E7WA 4M9SA 4N0BA 2DLLA 2VBZA 1QO0D 2H6CA 3E6BA 5LHIA 3GFMA 3I71A 1RZ4A 2EV5A 1IXRC 2YU3A 3T5XA 1GVJA 3PQKA 3IRRA 3R0JA 2BBYA 3EETA 3K1MA 4FX4A 3KFWX 1ZRFA 2G7HA 5BOXA 3GFJA 4I2OA 2FE3A 2YX4A 4KIGA 4IHSA 3ZMTA 5D8KB 3CO7C 3KCCA 1OPCA 1LVAA 4MQVA 2W85A 3E5UA 4R8HA 5L3BA 2PMHA 1TTYA 1S3JA 4MHGA 3BJAA 3AAFA 2VE8A 4RB2C 2HYFA 1U5TC 1X3UA 3V8LA 4UVBA 1FLIA 2MC3A 3WTWC 2DBBA 2GAUA 4A6EA 1J7KA 4G7ZF 1LNWA 1TQPA 3OOPA 1HW1A 1U6GA 1G3SA 4OIQF 4G6DA 1FP1D 4EM2A 3QU3A 3K0LA 4UVCA 4GYIA 2IW5A 3F21A 1SD7A 4PCQA 3H3ZA 2GA2A 1TW3A 5LHGA 1DP7P 4ZYEA 1RUNA 2VC0A 4Y13A 4WXHA 5FD5A 4OMYA 5CVIA 1IW7F 3MEXA 4GCVA 4D0PA 2IRFG 1MDMB 1WRJA 3DEUA 2EB7A 5DCMB 2IVMA 2JSCA 4L0YB 3ECOA 1MDMA 3BZ6A 2EV6A 4UV9A 2A61A 2HGCA 2LNBA 2P4WA 1QNTA 4P9FA 5TJJA 1WQ2A 1KU9A 1T38A 3QAHA 3TO9A 4IVNA 2EWNA 3KP6A 4E70A 4ENJA 2PLYA 1TQIA 2EK5A 4LD5A 3IKVA 4WWCA 4RB0A 2XAJA 3K2ZA 2M87A 5CVJA 1IAWA 3WTSC 5E17F 2K86A 2DU9A 1R1UA 5JI6A 4WCGA 2EFWA 1P2FA 4S05A 2QUFA 1KYZA 2KJCA 3H3UA 3GF2A 3BJOA 3JSPA 4CGZA 1JE8A 4HV5A 5HS8A 5HOOA 4ZYGA 5D5XB 1HSTA 3R4KA 2VBXA 3ZMDA 4KNYA 4KDPA 1XCVA 2K02A 2HR3A 3R61A 4KICA 3WTTC 4ZZDA 3IL2A 3KP3A 3BP8A 4HBLA 5D5WB 3JTGA 3TKYA 2VC1A 5ILSA 1GXPA 5H6QA 1B1BA 3WU1B 3T8RA 2ELHA 3KP5A 2ACJA 5DV5A 2XKOA 2V1XA 2GXBA 2FNPA 4EM0B 4L9TA 4Q47A 5JR3A 4KIFA 4LLLA 3KETA 1WWXA 2QM3A 2O61A 4HYEA 1F1ZA 3HHGA 1ZH5A 1WSUA 5DYMA 1REPC 3LA2A 4AIJA 2XASA 1OYWA 2IP2A 3QP6A 2PMUA 3QOPA 1CGPA 2HFHA 5D5UB 3RKWA 1MJBA 5K5RA 6PAXA 1IN8A 1ON2A 4G7HF 2CW0F 1PP8F 4YFXF 4PDKA 1T0FA 2CYYA 1T39A 1D8KA 3FXQA 3COAC 4G7OF 4IXAA 1P6RA 1IXCA 4A6DA 5LLQA 3T1BA 1FSHA 1HW2A 1R00A 2EA4A 2OQGA 1OR7A 3RI4A 3MZHA 1ZG1A 1IN5A 1RUOA 4L9NA 3F3XA 2XAHA 3KP2A 2WWYA 4PZJA 2X4HA 3ZMSA 4HDUA 3R60A 2XVCA 1BIAA 2HTSA 2QYOA 4MEYF 3WODF 2VN2A 3HSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMS A;  4YII A;  5JHU A;  2OAZ A;  1HW5 A;  4I02 A;  3L2C A;  3VOE A;  5FFZ A;  3RYP A;  4CO8 A;  4UVA A;  2LKP A;  3VFZ A;  2VOD A;  1XSX A;  1J5Y A;  3U1D A;  1R7J A;  1SMT A;  2IA1 A;  4AIH A;  1K7A A;  4FX0 A;  3H92 A;  2OU2 A;  1AOY A;  1G6N A;  5E20 A;  3ZN1 A;  4LB6 B;  2IA2 A;  3MCZ A;  4Y15 A;  1HSJ A;  1UHM A;  3O2P E;  4HX7 A;  1O7F A;  2DPU A;  3DV8 A;  4ASN A;  3CDH A;  5CYV A;  4IRH A;  1ZN2 A;  3RIR A;  1Y0U A;  2YSR A;  1MD0 A;  2IT0 A;  3IWF A;  4OIP F;  2NRA C;  2F5C A;  2OD5 A;  4L5J A;  1O3Q A;  5F1R A;  1W5T A;  3MFK A;  1XDS A;  4JK1 X;  4A12 A;  5AIP A;  3TOB A;  2V79 A;  1LQ1 A;  4EJO A;  3M1E A;  4LLN A;  2LF7 A;  4PGG A;  1YTY A;  2V1U A;  3KE2 A;  4OIR F;  1YG2 A;  5D6F A;  2M45 A;  4ZZL A;  4RGX A;  3C3W A;  3JAM Z;  2MD5 A;  2K4B A;  2HTJ A;  1TBX A;  2EFN A;  4HQM A;  1KYW A;  3DF8 A;  2YR2 A;  3KZY A;  3GVA A;  4HW0 A;  5AIQ A;  1EH6 A;  1SD5 A;  5D8L B;  1FOK A;  1TQM A;  2DTR A;  2ZME B;  1OYY A;  3F72 A;  3U2R A;  2WC2 A;  4ON0 A;  3QRF F;  2M8E A;  4HQE A;  1KU2 A;  2D1H A;  1R1T A;  2XHK A;  4OIN F;  3CUQ C;  3C7J A;  1LEB A;  2ZME A;  3FM5 A;  2P5K A;  2BGC A;  2NNN A;  3Q9S A;  4YG2 F;  4UHT A;  4XSZ F;  4R1H A;  1HKT A;  4HV6 A;  2D45 A;  1DUX C;  4RS8 A;  4UV8 A;  5LGN A;  3KLO A;  3KZZ A;  2PFB A;  4MNU A;  3HUG A;  3WG9 A;  3DPT A;  2J5P A;  1U5T A;  1MGT A;  4KT5 C;  2UZK A;  3V7S A;  1BC8 C;  2FU4 A;  4RAY A;  4I0B A;  4IRG A;  3GLX A;  2GZW A;  5FFX A;  5HVQ C;  5L3F A;  3HRU A;  3V7R A;  1PP7 U;  5HDN A;  3EQL F;  5D5V B;  1B4A A;  3VOD A;  2Y75 A;  5BS6 A;  4CIC A;  1T6S A;  2GQQ A;  5CJ9 A;  1Z1D A;  5CVR A;  2K7L A;  5ICG A;  4LG0 B;  1IN7 A;  1FZP B;  3JSO A;  4IPA A;  3I0T A;  1GHC A;  3RKX A;  1QQI A;  2FNA A;  3J80 K;  1J9I A;  5LGU A;  1I1S A;  2ZBK A;  4LG0 A;  1YO5 C;  2HKO A;  5E1Z B;  5DEQ A;  4A5N A;  1LB2 A;  1TNS A;  2FML A;  4AVP A;  4MTE A;  2RDP A;  4WF2 A;  2ESH A;  2DK8 A;  4B8X A;  1EH7 A;  1A04 A;  2JPB A;  3QP5 A;  1F4K A;  3TQN A;  2Z5U A;  3L00 A;  1KQ8 A;  5E8I A;  3E6M A;  2LSO A;  2R7D A;  3DXJ F;  5ED4 A;  1I27 A;  3GXO A;  3WTY C;  4KMF A;  3G3Z A;  5DUK A;  3RTR A;  2GA1 A;  2ZXJ A;  3ZP5 A;  2QZ8 A;  4Q48 A;  4WK8 F;  4I98 B;  1ZAR A;  3GZ6 A;  4IF4 A;  1F9N A;  2Q0O A;  3V4G A;  4G6Q A;  2PN6 A;  2FSW A;  4NB5 A;  2IA0 A;  4QWQ A;  2RKH A;  3G73 A;  2L01 A;  3FHZ A;  1LEA A;  3I4P A;  1R5G A;  1EV7 A;  5EEG A;  3MZY A;  1K78 A;  3RDI A;  3E97 A;  2XRO A;  2YPR A;  4LLG F;  2RGV A;  3RJP A;  4BNC A;  2DK5 A;  2NYX A;  2JZY A;  4B09 A;  1ON1 A;  3WE3 A;  3LST A;  4H0E A;  1R58 A;  2DQL A;  3N97 A;  3V7C A;  2COM A;  2FBI A;  4UNO A;  5J8C A;  3CUO A;  2VBY A;  5ILU A;  4N9I A;  4OOI A;  1FT9 A;  5IT3 A;  1T2K A;  4YFN F;  2A07 F;  4M71 A;  4G9Y A;  2XRN A;  4OU0 A;  2W57 A;  1U2W A;  2STT A;  1H0M A;  1USS A;  3LQR A;  3IC7 A;  2G7U A;  3L9F A;  2PJP A;  3QU6 A;  1H9T A;  1IN6 A;  1RNL A;  4LK1 F;  1HBX G;  1OMI A;  1KQ9 A;  1ZGJ A;  1I5Z A;  4UUV A;  1AWC A;  3F8B A;  4LGW A;  2P6S A;  4AWX B;  3E5Q A;  1XSV A;  1E2X A;  1XSD A;  4ENK A;  2FEZ A;  1Z6T A;  5L3G A;  2VOP A;  2H09 A;  1Z91 A;  2RNJ A;  1XMA A;  2G9W A;  3HIF A;  2D1V A;  5BQT A;  3ERE D;  2Q8K A;  3R6S A;  2FXA A;  4M73 A;  2CGP A;  4GGG A;  2ISY A;  1S6L A;  1S7A A;  1O3R A;  4CXF A;  1BI3 A;  4RB1 A;  3C18 A;  3BOQ A;  3P9K A;  5AON A;  3F8N A;  3BPV A;  4ESB A;  4BXU A;  1XB4 A;  2Z33 A;  3E3V A;  3O6B B;  1F5T A;  2PQ8 A;  2XAQ A;  4M9X A;  3U9G A;  1B9N A;  2F5F A;  2MA3 A;  2PBI A;  2O03 A;  1ULY A;  2VE9 A;  2OZU A;  3F23 A;  3ABU A;  2MLG A;  3F8F A;  4HF2 A;  3LAJ A;  5K5Q A;  2QEN A;  1FX7 A;  1FPQ A;  5ERI A;  4U88 A;  4Q4Z F;  3BPX A;  3I59 A;  1BBY A;  3L7W A;  2MH2 A;  3CLO A;  4ZH4 F;  4RB3 C;  2V9V A;  3GW2 A;  1MKM A;  5BMZ A;  2AS5 F;  1XMK A;  3RYR A;  1BN5 A;  3REO A;  3FX3 A;  4M72 A;  4HX8 A;  2E7X A;  2VT3 A;  4IRI A;  1QZY A;  1E17 A;  1UCR A;  4RAZ A;  5LHH A;  2RV8 A;  3IHU A;  3K69 A;  2FBH A;  2KIM A;  2P8T A;  1LDJ A;  2L4M A;  2Y48 A;  3M7G A;  1FYM A;  4ZYH A;  5H20 A;  3BJ6 A;  3FMR A;  5HDG A;  5EEH A;  4M74 A;  5FLX Z;  1FSE A;  3LAP A;  4WX9 A;  1U78 A;  3ZMZ A;  4ZYD A;  5LRR A;  2UXX A;  1BIB A;  3F6V A;  4A0X A;  1LDD A;  5TRD A;  1B59 A;  1IXS B;  5CVV A;  1DDN A;  3V8J A;  3HTU A;  4ENM A;  3ZMU A;  1XN7 A;  3CTA A;  5IT9 Z;  2O0Y A;  2J5O A;  3FWE A;  2ZFW A;  3ULQ B;  1IN4 A;  2F2E A;  2PG4 A;  4JQF A;  1WKM A;  2EFP A;  3F6O A;  1B9M A;  3CUQ A;  3GUD A;  3HRS A;  2A6E F;  5E1W A;  4CYD A;  1CF7 B;  1SAX A;  4EV0 A;  2RN7 A;  2OBP A;  2FBK A;  2BEO A;  2BE5 F;  1P4W A;  1ZLK A;  1CF7 A;  3RPU A;  1XGO A;  3NQO A;  3GYH X;  2QBY A;  1O7L A;  2Z9O A;  5HLH A;  1FC3 A;  5FLX K;  3O3K A;  3OV8 A;  2WTE A;  5HS7 A;  5E18 F;  3Q5F A;  2QQA A;  4O6J A;  3TDZ C;  1H9G A;  2FA5 A;  1MZB A;  2BV6 A;  2DI3 A;  1UHW A;  1D8J A;  2XUB A;  1SFU A;  1J2X A;  4M9Z A;  4HLY A;  2KIU A;  5IT9 K;  1GXQ A;  2JRT A;  4HF1 A;  3TDU C;  2KIF A;  5DDG A;  1W5S A;  1YQA A;  3ZPL A;  1FBU A;  1Q1H A;  3DQV C;  1P92 A;  2D2W A;  1S8N A;  2XIG A;  1BI1 A;  4U0W A;  1FYL A;  3HOT A;  1YYV A;  5FB2 A;  3SFZ A;  4CHU A;  2ETH A;  3NRV A;  4Q5S F;  4AIK A;  3EYY A;  2ZKZ A;  2HOE A;  1TNT A;  4LJZ F;  2O6G E;  2STW A;  1YS6 A;  1D3Y A;  3VB2 A;  3WTU C;  2DPD A;  2EA2 A;  4I09 A;  2E1C A;  2GIV A;  1MJA A;  3I64 A;  1LDK B;  1U5T B;  3MWM A;  4HDV A;  4A0Y A;  4LB5 A;  1P4A A;  1YW7 A;  3IKT A;  2WV0 A;  1PDN C;  2A6H F;  2DO7 A;  3FXU A;  3HRT A;  3JAM K;  4NQW A;  2H6B A;  1SMY F;  5D4R A;  4L9J A;  4OMZ A;  2K27 A;  2MBF A;  4G8X A;  2MLK A;  2E1N A;  1IRF A;  3F8C A;  2M5W A;  4MGR A;  2HKX A;  3WTX C;  2OZ6 A;  4GXO A;  2F5D A;  1QGP A;  4U7D A;  2P6T A;  2OQR A;  3EDP A;  1G4D A;  4I01 A;  1JHF A;  4Z2Y A;  2M1B A;  1O3S A;  1FBQ A;  1SFE A;  2GXG A;  1BJA A;  4AD9 A;  2DFI A;  4I7H A;  2ESN A;  1STZ A;  2IPQ X;  1ZRD A;  1ZHF A;  2NNY A;  3E5X A;  2QWW A;  3KP4 A;  3HTS B;  3WTZ A;  1S29 A;  1XGS A;  4Y17 A;  3M8F A;  2P5L C;  3FM3 A;  1BOA A;  4KMU X;  3WGG A;  3F22 A;  2W24 A;  1Z9C A;  2CFX A;  4EGY A;  1FYK A;  2EJR A;  1LJ9 A;  1OYI A;  3DPL C;  5HLG A;  3E6C C;  1KGS A;  1YIO A;  3SZT A;  2R3S A;  2EFQ A;  2JTV A;  3DKW A;  1I6X A;  2JPC A;  1O57 A;  3GWZ A;  3I5U A;  3KLN A;  3W6J B;  4G94 A;  2DQR A;  1PUE E;  3D5L A;  2L02 A;  2EV0 A;  2FOK A;  3N4M A;  2ZO4 A;  1BI0 A;  5K1Y A;  3P9I A;  1YW8 A;  1IZ1 A;  3ROU A;  1J0R A;  3B02 A;  2P7C B;  5JVT A;  1K78 B;  1BC7 C;  2W84 A;  1G3T A;  3BY6 A;  3M9A A;  1U3E M;  1R22 A;  3GEZ A;  2QQB A;  4HZF A;  3R0A A;  4RGS A;  1HQC A;  4OIO F;  3ABT A;  2JT1 A;  5ICF A;  2HZT A;  5CLS A;  2CQK A;  3V8K A;  3LQQ A;  4I0A A;  3GO5 A;  4ENN A;  5ILV A;  1WI9 A;  1K79 A;  1L0O C;  1JGS A;  4BAY A;  3J81 Z;  5KK1 A;  4A2U A;  2EFO A;  4MEX F;  4YIF A;  2HYG D;  1C0W A;  3EYI A;  3HYI A;  3RPQ A;  3T8T A;  3W6K B;  2UXN A;  5HDK A;  2HWV A;  2VXZ A;  3CJN A;  1Z05 A;  2PEX A;  2A68 F;  1ZG5 A;  1J75 A;  3C1D A;  2XGX A;  1R36 A;  4L18 B;  5E1X A;  2CO5 A;  3IWZ A;  1ONV A;  4RGR A;  3ECH A;  5FD6 A;  3GZ5 A;  5D6E A;  2C6Y A;  1JXS A;  1XCB A;  3PQJ A;  1HXD A;  3LWF A;  4EJU A;  5DCM A;  1UST A;  1O3T A;  3TGN A;  3ZN0 A;  3JW4 A;  4XLN F;  2DW4 A;  3LFK A;  4HOB A;  1EH8 A;  5DD4 A;  1RI7 A;  4XSX F;  2O8X A;  5K5O A;  1YS7 A;  3GFL A;  3KP7 A;  5F6F A;  3L09 A;  4KYW A;  2L4A A;  4MQ9 F;  1YW9 A;  3I54 A;  4KIB A;  1BM9 A;  3J81 K;  3JTH A;  4HLX A;  4LMY A;  4M6X A;  3IRQ A;  3I53 A;  2MH9 A;  1UFM A;  4F7Z A;  4L9V A;  1IUY A;  2QQ9 A;  1YFH A;  5CVU A;  3QPH A;  2A69 F;  4EGZ A;  1QBJ A;  4BHC A;  3KEQ A;  4DNC A;  3HRM A;  1L3L A;  1FY7 A;  2CG4 A;  1FP2 A;  2ADU A;  4BHB A;  2R7F A;  1G3W A;  2B0L A;  4K2E A;  1UB9 A;  2KJB A;  5HLI A;  2HQN A;  3K9T A;  3I58 A;  2LF8 A;  4CZZ A;  1R1V A;  4UXN A;  5KVR A;  1ZLJ A;  5A2Q Z;  1KQ0 A;  4U0Y A;  4LK0 F;  4YFK F;  4TV7 A;  3SZP A;  2XAG A;  5DCF A;  1W4M A;  4P96 A;  5LGT A;  1OKR A;  3FF5 A;  3BRO A;  1HKS A;  1ZAO A;  1SD4 A;  1P4X A;  2Z99 A;  3GX4 X;  3I59 B;  5L3E A;  3MQ0 A;  4U0V A;  3P9C A;  4A5M A;  5FGM A;  3P7N A;  4KA4 A;  1QZZ A;  2FRH A;  4HA8 A;  1IRG A;  2ZNZ A;  3ML6 A;  2Q2E A;  2X0L A;  4PGH A;  2RVC A;  2HEO A;  1XGM A;  4BYY A;  3M8E A;  4BH9 A;  2A5Y B;  2ZCW A;  5D4S A;  1BI2 A;  5J8F A;  1ZRE A;  3ISP A;  3K1P A;  3T0Y A;  1XD7 A;  4A0Z A;  1R5H A;  4NHJ A;  5A2Q K;  1Z6R A;  2IJL A;  4IHT A;  4FHT A;  2QVO A;  3FZV A;  3NEU A;  2H27 A;  3QPT A;  3TO6 A;  2CSO A;  3FMQ A;  4U7B A;  1FWZ A;  1V3F A;  3K1N A;  3LA3 A;  5F64 A;  2XV4 S;  2ZJ2 A;  2VOO A;  4JBA A;  5E8G A;  1ZRC A;  3SQN A;  2H94 A;  2L3D A;  1S7O A;  5HS9 A;  2HS5 A;  1I1G A;  4WXD A;  2VBW A;  3FXR A;  2FF4 A;  2XAF A;  3EUH A;  3BWG A;  2KRF A;  2RC4 A;  2QLZ A;  3DFG A;  4ETS A;  4HAM A;  4M6Y A;  1FBS A;  2A3S A;  2XKP A;  3CUQ B;  4EJV A;  1FNN A;  4XBF A;  3HOS A;  3ZQ7 A;  2HDC A;  3ELK A;  1ZG3 A;  5L3D A;  2DT5 A;  5ICE A;  3CO6 C;  4IJA A;  3FMS A;  1JHH A;  2W25 A;  3WU0 A;  3S2W A;  1KA8 A;  1B6A A;  5LEK A;  1TW2 A;  2QBY B;  4GYG A;  5DD8 A;  1W7P B;  2ZNY A;  4KN7 X;  2AXL A;  4EVI A;  2P5V A;  1IF1 A;  3TOA A;  3D0S A;  4L0Z B;  2V6C A;  3WE2 A;  1TLH B;  1W7P A;  3J7A O;  3PFI A;  1ODD A;  3RKY A;  2TDX A;  1SD6 A;  1YLF A;  2HQR A;  3WTV C;  2FMY A;  3WGI A;  2M30 A;  2NAZ A;  2FQ3 A;  4KUM A;  5LEJ A;  1RIO H;  4EM1 A;  4WXC A;  2ISZ A;  4XLP F;  1MJ9 A;  4HX4 A;  2UWM A;  3HSR A;  3SHF A;  5FO5 A;  1G3Y A;  1U8R A;  2Y0M A;  2RQP A;  1XGN A;  4FT8 A;  1VTN C;  2Z3Y A;  1K6O A;  4N9H A;  1SFX A;  1D5V A;  2L54 A;  5J6X A;  1T98 A;  3Q9V A;  2CWE A;  1QPM A;  3LA7 A;  4R79 A;  2O3F A;  3VEP A;  1XDU A;  1Z7U A;  4LFU A;  1NHA A;  4DQ2 A;  3WGH A;  1DPU A;  4KN4 X;  4ESF A;  1J59 A;  5BPD A;  1HKQ A;  2V1D A;  2NS0 A;  2KKO A;  3KEO A;  3HHH A;  4RGU A;  3BDD A;  4O3M A;  1KU7 A;  1W7P D;  2P7V B;  4GO1 A;  5LBQ A;  2BYV E;  4P55 A;  3B73 A;  4KFC A;  4CDG A;  2YX7 A;  3J80 Z;  2VT2 A;  4EQQ A;  1ZYR F;  3ZMV A;  1KU3 A;  5LRS A;  1R23 A;  4MTD A;  2OA4 A;  4XRF A;  4EJT A;  3E6D A;  2F5E A;  3SXY A;  5DUI A;  2LDU A;  4L5I A;  5L3C A;  4BHP A;  1V4R A;  1ZGA A;  2VON A;  5H6R A;  5BPI A;  3F8M A;  3MAJ A;  3TO7 A;  5ICC A;  4ESJ A;  3GFI A;  2PI0 A;  2K4J A;  4S04 A;  2GWR A;  4BQA A;  4P9U A;  4HF0 A;  4P5O A;  3DP7 A;  2DAO A;  1DPR A;  4QLC U;  4O5V A;  5JFR A;  3HSE A;  4EJW A;  2E7W A;  4M9S A;  4N0B A;  2DLL A;  2VBZ A;  1QO0 D;  2H6C A;  3E6B A;  5LHI A;  3GFM A;  3I71 A;  1RZ4 A;  2EV5 A;  1IXR C;  2YU3 A;  3T5X A;  1GVJ A;  3PQK A;  3IRR A;  3R0J A;  2BBY A;  3EET A;  3K1M A;  4FX4 A;  3KFW X;  1ZRF A;  2G7H A;  5BOX A;  3GFJ A;  4I2O A;  2FE3 A;  2YX4 A;  4KIG A;  4IHS A;  3ZMT A;  5D8K B;  3CO7 C;  3KCC A;  1OPC A;  1LVA A;  4MQV A;  2W85 A;  3E5U A;  4R8H A;  5L3B A;  2PMH A;  1TTY A;  1S3J A;  4MHG A;  3BJA A;  3AAF A;  2VE8 A;  4RB2 C;  2HYF A;  1U5T C;  1X3U A;  3V8L A;  4UVB A;  1FLI A;  2MC3 A;  3WTW C;  2DBB A;  2GAU A;  4A6E A;  1J7K A;  4G7Z F;  1LNW A;  1TQP A;  3OOP A;  1HW1 A;  1U6G A;  1G3S A;  4OIQ F;  4G6D A;  1FP1 D;  4EM2 A;  3QU3 A;  3K0L A;  4UVC A;  4GYI A;  2IW5 A;  3F21 A;  1SD7 A;  4PCQ A;  3H3Z A;  2GA2 A;  1TW3 A;  5LHG A;  1DP7 P;  4ZYE A;  1RUN A;  2VC0 A;  4Y13 A;  4WXH A;  5FD5 A;  4OMY A;  5CVI A;  1IW7 F;  3MEX A;  4GCV A;  4D0P A;  2IRF G;  1MDM B;  1WRJ A;  3DEU A;  2EB7 A;  5DCM B;  2IVM A;  2JSC A;  4L0Y B;  3ECO A;  1MDM A;  3BZ6 A;  2EV6 A;  4UV9 A;  2A61 A;  2HGC A;  2LNB A;  2P4W A;  1QNT A;  4P9F A;  5TJJ A;  1WQ2 A;  1KU9 A;  1T38 A;  3QAH A;  3TO9 A;  4IVN A;  2EWN A;  3KP6 A;  4E70 A;  4ENJ A;  2PLY A;  1TQI A;  2EK5 A;  4LD5 A;  3IKV A;  4WWC A;  4RB0 A;  2XAJ A;  3K2Z A;  2M87 A;  5CVJ A;  1IAW A;  3WTS C;  5E17 F;  2K86 A;  2DU9 A;  1R1U A;  5JI6 A;  4WCG A;  2EFW A;  1P2F A;  4S05 A;  2QUF A;  1KYZ A;  2KJC A;  3H3U A;  3GF2 A;  3BJO A;  3JSP A;  4CGZ A;  1JE8 A;  4HV5 A;  5HS8 A;  5HOO A;  4ZYG A;  5D5X B;  1HST A;  3R4K A;  2VBX A;  3ZMD A;  4KNY A;  4KDP A;  1XCV A;  2K02 A;  2HR3 A;  3R61 A;  4KIC A;  3WTT C;  4ZZD A;  3IL2 A;  3KP3 A;  3BP8 A;  4HBL A;  5D5W B;  3JTG A;  3TKY A;  2VC1 A;  5ILS A;  1GXP A;  5H6Q A;  1B1B A;  3WU1 B;  3T8R A;  2ELH A;  3KP5 A;  2ACJ A;  5DV5 A;  2XKO A;  2V1X A;  2GXB A;  2FNP A;  4EM0 B;  4L9T A;  4Q47 A;  5JR3 A;  4KIF A;  4LLL A;  3KET A;  1WWX A;  2QM3 A;  2O61 A;  4HYE A;  1F1Z A;  3HHG A;  1ZH5 A;  1WSU A;  5DYM A;  1REP C;  3LA2 A;  4AIJ A;  2XAS A;  1OYW A;  2IP2 A;  3QP6 A;  2PMU A;  3QOP A;  1CGP A;  2HFH A;  5D5U B;  3RKW A;  1MJB A;  5K5R A;  6PAX A;  1IN8 A;  1ON2 A;  4G7H F;  2CW0 F;  1PP8 F;  4YFX F;  4PDK A;  1T0F A;  2CYY A;  1T39 A;  1D8K A;  3FXQ A;  3COA C;  4G7O F;  4IXA A;  1P6R A;  1IXC A;  4A6D A;  5LLQ A;  3T1B A;  1FSH A;  1HW2 A;  1R00 A;  2EA4 A;  2OQG A;  1OR7 A;  3RI4 A;  3MZH A;  1ZG1 A;  1IN5 A;  1RUO A;  4L9N A;  3F3X A;  2XAH A;  3KP2 A;  2WWY A;  4PZJ A;  2X4H A;  3ZMS A;  4HDU A;  3R60 A;  2XVC A;  1BIA A;  2HTS A;  2QYO A;  4MEY F;  3WOD F;  2VN2 A;  3HSF A; 
#chains in the Genus database with same CATH topology
 2EIK H;  2HVQ A;  4EMS A;  4H4K C;  4YII A;  2HI3 A;  5JHU A;  2OAZ A;  2VAS A;  1HW5 A;  4BDY A;  4I02 A;  2HOS A;  3L2C A;  2BXZ A;  3VOE A;  5FFZ A;  1B72 A;  3FXO A;  3RYP A;  4CO8 A;  2GM4 A;  1GV5 A;  2AXT C;  2F4I A;  4UVA A;  2LKP A;  4XLA A;  1VZ0 A;  3VFZ A;  4LIV A;  1XSX A;  4B3X A;  1QRY A;  1J5Y A;  2VOD A;  3U1D A;  1R7J A;  1SMT A;  2IA1 A;  2LMD A;  4AIH A;  1K7A A;  1S72 I;  4FX0 A;  3JR9 A;  3H92 A;  2OU2 A;  1AOY A;  1G6N A;  2L9S A;  4DJA A;  5E20 A;  2KQR A;  5J4Y A;  3CC7 I;  3ZN1 A;  4E7H A;  4LB6 B;  2DA1 A;  5IPA A;  4A3I J;  3PIO F;  2KIS A;  1EF4 A;  2IA2 A;  3MCZ A;  4Y15 A;  5EEA A;  1HSJ A;  1UHM A;  3G1L A;  3O2P E;  2UV1 A;  2VUM J;  4HX7 A;  1ETX A;  1O7F A;  2VPL A;  5H2F C;  2DPU A;  5M3M J;  4E7L A;  3BT9 A;  3DV8 A;  4ASN A;  3M8J A;  4Z6Y A;  1NG7 A;  2CV0 A;  4NC8 A;  3S3O A;  3CDH A;  2I5U A;  5CYV A;  3ZQF A;  4IRH A;  1ZN2 A;  1MMN A;  2CS3 A;  3RIR A;  3CDI A;  1HCR A;  1X2N A;  1Y0U A;  2YSR A;  1MD0 A;  1W1W E;  2K9N A;  2IT0 A;  3MD2 A;  2PMZ A;  2ME0 A;  3IWF A;  4OIP F;  2NRA C;  2F5C A;  2OD5 A;  4P1W A;  3A2K A;  3ABM H;  4RAF A;  1YIT I;  2OTJ I;  2VJ5 A;  1HOM A;  1U9O A;  2DYR H;  2R7O A;  4IO9 F;  2BHZ A;  2LFB A;  2X1C A;  5C4X J;  4FE7 A;  2M7B A;  4L5J A;  1O3Q A;  5F1R A;  1DQU A;  4C9Y A;  3RQ4 A;  1W5T A;  2V7F A;  3MFK A;  1XDS A;  2LP0 A;  4JK1 X;  4UUS B;  1OIS A;  1PYV A;  3EUK L;  2VQL A;  4AID A;  4A12 A;  4U87 A;  2HU9 A;  4FIS A;  3KX2 A;  5AIP A;  3TOB A;  2V79 A;  2KDO A;  1LQ1 A;  4ITV A;  4EJO A;  3M1E A;  4XQF A;  4LLN A;  4W1U A;  3OYK A;  2LF7 A;  4PGG A;  2VJI A;  1YTY A;  5EJC A;  2V1U A;  3OWT A;  3KE2 A;  1E0E A;  2XB5 A;  3ZQG A;  4OIR F;  1YG2 A;  4X1E A;  5D6F A;  3BCB A;  2M45 A;  1KON A;  4ZZL A;  4RGX A;  2H1K A;  3K4N A;  2L7K A;  1WI3 A;  3C3W A;  3ESW B;  1VQ6 I;  4MO7 A;  3JAM Z;  2MD5 A;  2K4B A;  3DTK A;  2HTJ A;  1TBX A;  2EFN A;  1QVT A;  4HQM A;  1KYW A;  3DF8 A;  2R93 J;  2CJJ A;  2E35 A;  2YR2 A;  3KZY A;  3TP3 A;  3GVA A;  4HW0 A;  5AIQ A;  1EH6 A;  1SD5 A;  1RKW A;  1YI2 I;  1LUJ B;  3CDL A;  5D8L B;  2LC2 A;  1N25 A;  3C2H A;  1FOK A;  5EZG A;  1TQM A;  1WCM J;  2DTR A;  1ORK A;  3G2B A;  2ZME B;  1OYY A;  4DOZ A;  3F72 A;  2LY9 A;  3CZ6 A;  2KHM A;  2JK3 A;  2XPV A;  3U2R A;  1Z3X A;  2WC2 A;  1JTY A;  3PL8 A;  4ON0 A;  3QRF F;  2M8E A;  4BUP A;  5E3N A;  4HQE A;  3LSG A;  1KU2 A;  2D1H A;  1R1T A;  2XHK A;  4OIN F;  2A5W A;  3CUQ C;  3C7J A;  5DM7 F;  1R71 A;  2DOD A;  1LEB A;  1FOW A;  2ZME A;  2LRE A;  1X1P A;  3FM5 A;  4CH7 A;  1IJW C;  2P5K A;  4A3E J;  1FIA A;  2BGC A;  2WB1 A;  2NNN A;  3Q9S A;  3CCR I;  2WA0 A;  3GTL J;  4YG2 F;  2DN0 A;  3DBH B;  2ICW G;  4B3A A;  4UHT A;  4XSZ F;  1FOY A;  2FD5 A;  2VQG A;  3HUG B;  4R1H A;  1RPW A;  2K85 A;  2E1O A;  1HKT A;  4HV6 A;  2D45 A;  1DUX C;  3S1N J;  4RS8 A;  3PO2 J;  4UV8 A;  1R4M B;  2X1D A;  5LGN A;  1IV6 A;  3SYT A;  1FOX A;  3ZQL A;  3KLO A;  3KZZ A;  2L9N A;  3BZK A;  2PFB A;  2IGK A;  2HZD A;  3HUG A;  4MNU A;  3WG9 A;  3DPT A;  4HEA 2;  2J5P A;  4XOP A;  3AG4 H;  1U5T A;  5F0H A;  1MGT A;  2VXD A;  3HOZ J;  3S2D J;  2R5Y B;  4KT5 C;  4A3J J;  2R7X A;  2P81 A;  4HG2 A;  2UZK A;  3V7S A;  1BC8 C;  1TC3 C;  1OLT A;  5E3O A;  1OCZ H;  3PNY A;  2FU4 A;  2OF7 A;  4RAY A;  4I0B A;  2DA4 A;  4IRG A;  3GLX A;  2GZW A;  5FFX A;  1OFC X;  2EIM H;  5J4V A;  5HVQ C;  5L3F A;  3K7A J;  3HRU A;  3V7R A;  1PP7 U;  5K7H A;  2VQC A;  4BBS J;  5HDN A;  3TED A;  3FDY A;  1VQ5 I;  3EQL F;  4BGD A;  5D5V B;  1B4A A;  3VOD A;  2Y75 A;  3ERM A;  4CIC A;  5BS6 A;  1T6S A;  3HGY A;  2R5Y A;  2GQQ A;  2IXS A;  5CJ9 A;  1Z1D A;  4RA2 A;  5CVR A;  2K7L A;  1O4X A;  1TT5 B;  1ETW A;  3H9J A;  3CCL I;  2JA8 J;  3OIQ A;  1AKH B;  2KPM A;  1MMS A;  3D5S C;  1JUM A;  4HNV A;  5ICG A;  2M3A A;  4LG0 B;  1IN7 A;  3I55 I;  3Q0V A;  1FZP B;  3JSO A;  4IPA A;  3I0T A;  1GHC A;  3RKX A;  1SVO A;  3GTP J;  1QQI A;  2FNA A;  3J80 K;  1AKH A;  1J9I A;  5LGU A;  1WJC A;  2ZBK A;  2ZFU A;  1I1S A;  1Z67 A;  4LG0 A;  2KP6 A;  4XIC A;  2R5Z A;  2CW8 A;  1YO5 C;  2HKO A;  3PO3 J;  1ETQ A;  5E1Z B;  5DEQ A;  1OCR H;  2Y69 H;  3G1O A;  5F27 A;  4A5N A;  1DP3 A;  1LB2 A;  2DOF A;  3DWL E;  2EZI A;  5F0F A;  1TNS A;  2FML A;  3FKJ A;  4AVP A;  4KT6 A;  1VQO I;  4MTE A;  2RDP A;  3W2A A;  4WF2 A;  2ESH A;  2E19 A;  1UEL B;  2DK8 A;  3H9G A;  2VKE A;  1MIJ A;  3UNG C;  4B8X A;  1EH7 A;  3IV5 A;  1A04 A;  2JPB A;  4ABZ A;  3QP5 A;  3CCQ I;  1LPQ A;  3U21 A;  1F4K A;  2WAQ N;  3TQN A;  2Z5U A;  3L00 A;  1KQ8 A;  2ECB A;  5E8I A;  3E6M A;  2LSO A;  2R7D A;  3JRD A;  3DXJ F;  2M8G X;  2TCT A;  2ZB9 A;  5ED4 A;  1I27 A;  2H8W A;  3GXO A;  4A69 C;  2VJ4 A;  3WTY C;  4KMF A;  2WV1 A;  1IV8 A;  2LOO A;  3G3Z A;  4IQ4 A;  5DUK A;  3RTR A;  2GA1 A;  2Z2S B;  2ZXJ A;  3ZP5 A;  3SEQ A;  1G8X A;  2QZ8 A;  3DLA A;  4Q48 A;  5F08 A;  4WK8 F;  4I98 B;  1DU6 A;  1ZAR A;  2ID3 A;  4IHY A;  3GZ6 A;  2GIZ A;  1YRN B;  4IF4 A;  1AU7 A;  1F9N A;  4D5C A;  4XR6 A;  3L2V A;  4NNJ A;  3A1Y A;  2CQQ A;  2Q0O A;  2NOG A;  3DU6 A;  3V4G A;  4G6Q A;  2PN6 A;  5HNH A;  2FSW A;  4NB5 A;  2IA0 A;  1ETY A;  4RLF A;  4BJ5 C;  3PUB A;  4QWQ A;  2JN6 A;  2RKH A;  4UB6 C;  3G73 A;  2L01 A;  3FHZ A;  1LEA A;  3DTI A;  3I4P A;  3L2W A;  1YRN A;  1R5G A;  1EV7 A;  5EEG A;  3MZY A;  1K78 A;  3RDI A;  3E97 A;  3HB9 A;  2XRO A;  2E2J J;  4KIS A;  3G71 I;  2YPR A;  3ONQ A;  4LLG F;  3NAR A;  2RGV A;  3FK6 A;  3RJP A;  1T95 A;  3IAS 2;  4BNC A;  1LFB A;  4OWR B;  3HG9 A;  1T08 B;  2DMQ A;  2DK5 A;  3MKZ A;  3OYH A;  2NYX A;  2JZY A;  4B09 A;  1ON1 A;  3WE3 A;  3LST A;  4H0E A;  1H88 C;  1R58 A;  4RM2 A;  2DQL A;  3N97 A;  3V7C A;  2LTP A;  1LE8 A;  1MBJ A;  2COM A;  2BHY A;  2DMN A;  2FBI A;  3QPS A;  1ZEL A;  4UNO A;  1FEX A;  5J8C A;  3CUO A;  5FKO A;  2VBY A;  5ILU A;  4N9I A;  4KIT B;  1QHG A;  3RSN A;  4OOI A;  5FRO A;  3G6E I;  2R7Q A;  3GTO J;  1FT9 A;  5IT3 A;  1ZGW A;  1T2K A;  3AL0 B;  3LOC A;  3SFI A;  1X4P A;  1MBG A;  3F9K A;  4YFN F;  2A07 F;  4M71 A;  4G9Y A;  4S0H B;  3HOY J;  2XRN A;  3A02 A;  2W57 A;  4M3F A;  4OU0 A;  1U2W A;  4DYC A;  2STT A;  3S3M A;  1H0M A;  1LVK A;  1USS A;  4QIW N;  3D5R C;  3LQR A;  1ZKG A;  3MVP A;  4XID A;  3IC7 A;  3CJR B;  2QQ8 A;  5FLV A;  2G7U A;  2M4K A;  3L9F A;  1X19 A;  2PJP A;  2IAI A;  2W1O A;  3QU6 A;  3PSF A;  1IN6 A;  1RNL A;  1H9T A;  4LK1 F;  5F0C A;  1HBX G;  1CQT A;  1X3Z B;  4XM3 A;  1OMI A;  3C2B A;  3FBI B;  1KQ9 A;  1ZGJ A;  2HNH A;  4ZDL A;  2X6Y A;  3JCU C;  1I5Z A;  4UUV A;  1AWC A;  3F8B A;  4LGW A;  2P6S A;  3H9Q A;  4HPQ A;  3OYB A;  1H89 C;  4AWX B;  4IZZ A;  3E5Q A;  3CME I;  5B1B H;  3HXL A;  1A5J A;  1XSV A;  1E2X A;  3A4C A;  4ZJZ A;  3IH3 A;  3HOU J;  1D0Y A;  2KZV A;  1XSD A;  3W2W A;  1BW5 A;  2FEZ A;  4ENK A;  1Z6T A;  2MG4 A;  2OUM A;  5L3G A;  2VOP A;  2M7A A;  2A05 A;  3FK7 A;  4DYR A;  1A36 A;  2WAE A;  2H09 A;  1Z91 A;  3OYJ A;  3A01 B;  2RNJ A;  5C44 J;  1XMA A;  2G9W A;  3AG3 H;  3HIF A;  5HLT A;  1WJE A;  2D1V A;  1MSE C;  2MC4 A;  5BQT A;  3ERE D;  2Q8K A;  5E3M A;  3LL7 A;  3BLY A;  3R6S A;  2FXA A;  4C3I J;  4M73 A;  2CGP A;  1TWH J;  4IHV A;  4GGG A;  2ISY A;  1S6L A;  1S7A A;  2WBM A;  2F5V A;  3A01 A;  3V42 A;  1O3R A;  4CXF A;  1IRX A;  2EZH A;  2KL4 A;  1BI3 A;  4RB1 A;  3C18 A;  3BOQ A;  3OYN A;  3P9K A;  2ZC2 A;  5AON A;  1A6I A;  2BY2 A;  3H1C A;  1R49 A;  3F8N A;  3BPV A;  4F91 B;  4ESB A;  4BXU A;  4CCO A;  1HLV A;  3ASN H;  2KLO A;  1XB4 A;  2Z33 A;  3E3V A;  2VB6 A;  3DTE A;  3O6B B;  4CCM A;  1VQ4 I;  5K7Z A;  1F5T A;  2XPU A;  3LSJ A;  1Z7L A;  2PQ8 A;  2XAQ A;  1Y0N A;  2Z16 A;  2XSJ C;  2M0M A;  4M9X A;  5CPR B;  2LG4 A;  1XTA A;  4Y3O A;  2F4O B;  3U9G A;  3ZQH A;  4MLO A;  1B9N A;  2F5F A;  4ANJ A;  2MA3 A;  2PBI A;  2O03 A;  3MKW B;  1ULY A;  2VE9 A;  3CCJ I;  5M5W J;  2OZU A;  2R7S A;  2DA3 A;  2R7V A;  3F23 A;  1SFO J;  3ABU A;  3BC8 A;  4UUT A;  2MLG A;  3F8F A;  4C30 A;  4HF2 A;  1XPX A;  3LAJ A;  5K5Q A;  2QEN A;  3GTM J;  3G4S I;  2ZXH A;  3LSI A;  1FX7 A;  2JQ7 A;  3K4K A;  2JRM A;  4B48 A;  2IEK A;  3MKL A;  2O9L A;  1FPQ A;  1VQ7 I;  5ERI A;  4U88 A;  1ETV A;  2UUZ A;  5K7F A;  4HNT A;  4Q4Z F;  3BPX A;  5C4J J;  3I59 A;  1BBY A;  3HOV J;  1E3H A;  4FE4 A;  4BAC A;  5HNF A;  1ZQ3 P;  3L7W A;  1RRJ A;  2MH2 A;  3HKZ N;  2DFE A;  3CLO A;  4ZH4 F;  4RB3 C;  2V9V A;  3GW2 A;  1MKM A;  3H36 A;  4BJ6 C;  5BMZ A;  2AS5 F;  2MW8 A;  4CA0 A;  1XMK A;  4PSW A;  3RYR A;  1RKT A;  3M4O J;  1BN5 A;  4M3B A;  3REO A;  3FX3 A;  5F1J A;  4M72 A;  1JKP C;  4HX8 A;  1R6R A;  1TWC J;  2B9S A;  3OSF A;  3PJR A;  2E7X A;  2KT0 A;  2DMP A;  1MNE A;  4NUB A;  4AM3 A;  1BR2 A;  2VT3 A;  3B6C A;  3P5J A;  1PUF A;  4IRI A;  1WPK A;  1QZY A;  3NAU A;  1E17 A;  1UCR A;  4MFE A;  2GXA A;  4RAZ A;  3J7Z I;  5LHH A;  1K61 A;  2RV8 A;  1WGX A;  3IHU A;  2FBH A;  2KIM A;  3K69 A;  3QYF A;  3E7L A;  1XMX A;  2P8T A;  1LDJ A;  2L4M A;  2Y48 A;  4Y52 J;  1WH5 A;  1W5C C;  3M7G A;  1WHU A;  4D7M A;  2DFF A;  2JUC A;  2X6W A;  1FYM A;  2DYS H;  4ZYH A;  1EKE A;  5LFA A;  5H20 A;  4CCL A;  3BJ6 A;  3FMR A;  5HDG A;  5EEH A;  1B72 B;  3UR3 C;  4II3 A;  4M74 A;  2LVS A;  4XLC A;  4LIU A;  2I8D A;  5FLX Z;  1FSE A;  1LFU P;  3LAP A;  4YEL A;  4WX9 A;  2OJE D;  1U78 A;  3ZMZ A;  3BG9 A;  3HJE A;  4ZYD A;  2BXY A;  2E2I J;  5LRR A;  2UXX A;  5GAD J;  1BIB A;  3F6V A;  4A0X A;  1LDD A;  5TRD A;  1B59 A;  1SVL A;  1I50 J;  1IXS B;  5F04 A;  1Z77 A;  5CVV A;  3DEW A;  1DDN A;  3V8J A;  5GTH C;  1MBH A;  3ZCO A;  3HTU A;  4ENM A;  3ZMU A;  1XN7 A;  3CTA A;  5IT9 Z;  2O0Y A;  1WZ2 A;  2J5O A;  3W2V A;  2LH9 A;  1NK2 P;  4XK4 A;  3FWE A;  5M5X J;  2ZFW A;  2AQE A;  2DA7 A;  1WJD A;  3ULQ B;  1IN4 A;  5J1R A;  3OS0 A;  2F2E A;  2O7O A;  2LY1 A;  2PG4 A;  4JQF A;  1WKM A;  2EFP A;  3F6O A;  4M3E A;  1B9M A;  3CUQ A;  2GBY A;  1BJZ A;  2E5Z A;  4FQG A;  5J3L A;  3BTJ A;  3GUD A;  3HRS A;  1X1C A;  3FIW A;  1JKQ C;  2A6E F;  5E1W A;  2E60 A;  2KIQ A;  4CYD A;  1CF7 B;  3CCV I;  1JT0 A;  1SAX A;  4BE1 A;  1DGW Y;  4XLE A;  4EV0 A;  2RN7 A;  4J00 A;  5C3E J;  2OBP A;  4F92 B;  1F43 A;  2FBK A;  4NC7 A;  2BEO A;  2BE5 F;  3SEZ A;  1P4W A;  5IYC J;  3CQZ J;  1ZLK A;  3WHB A;  1CF7 A;  3RPU A;  1XGO A;  3NQO A;  3GYH X;  2QBY A;  1O7L A;  2Z9O A;  3TW7 A;  3OIP A;  1FC3 A;  3K2A A;  1U0J A;  1OCC H;  5HLH A;  5FLX K;  3RZO J;  3O3K A;  2TRT A;  3OV8 A;  1BW6 A;  2WTE A;  4PK4 A;  5HS7 A;  5E18 F;  3Q5F A;  2QQA A;  4O6J A;  3TDZ C;  1H9G A;  3MZ8 A;  2FA5 A;  1FMW A;  1FTT A;  1ACI A;  2N8G A;  1HDD C;  1MZB A;  3H0G J;  2BV6 A;  2DI3 A;  1UHW A;  3S16 J;  2DA6 A;  1D8J A;  2XUB A;  4M3D A;  1MH4 A;  1SFU A;  5IYD J;  1J2X A;  4M9Z A;  4HLY A;  2HOA A;  3PFY A;  2KIU A;  2EBI A;  2MFZ A;  3QQA A;  5IT9 K;  4DGW B;  3CMA I;  1GXQ A;  2JRT A;  4HF1 A;  2JA7 J;  1SAN A;  3EUH C;  2KIF A;  3TDU C;  1QPI A;  3MMY B;  3W6V A;  2XGC A;  5DDG A;  1W5S A;  1W0U A;  1YQA A;  3ZPL A;  1IDZ A;  1MMA A;  1FBU A;  3S8P A;  4N4N B;  2HDD A;  1Q1H A;  2L2O A;  3S1Q J;  3DQV C;  1P92 A;  3CMY A;  2D2W A;  1S8N A;  3BR2 A;  2K9S A;  2XIG A;  1BI1 A;  2VLA A;  2CQX A;  2MGQ A;  3K4B A;  4U0W A;  5M3F J;  2FX0 A;  1FYL A;  3HOT A;  1YYV A;  5FB2 A;  4QPQ A;  3SFZ A;  2VQH A;  3L2Q A;  4CHU A;  1YHQ I;  2L9R A;  4IHX A;  2ETH A;  3NRV A;  3LNQ A;  4Q5S F;  4AIK A;  3EYY A;  4V19 K;  2E5N A;  3OYD A;  2ZKZ A;  1R5I D;  1TNT A;  2HOE A;  2X6X A;  5E3L A;  4BY7 J;  4LJZ F;  2O6G E;  2STW A;  2R92 J;  3ZRG A;  1YS6 A;  1D3Y A;  2CQ7 A;  4RDU A;  3VB2 A;  4AU7 A;  3WTU C;  2DPD A;  3S2H J;  2M34 A;  1ETK A;  2EA2 A;  3UKG A;  4I09 A;  4AYB N;  2E1C A;  4X6A J;  1Z0X A;  2GIV A;  3RPU D;  1MJA A;  1NH3 A;  2K3P A;  5EZH A;  2EIJ H;  3I64 A;  1LDK B;  1U5T B;  5J40 A;  4NQW B;  1V5E A;  3I4M J;  3ASO H;  4DBR A;  3I4N J;  2ZXI A;  3CCS I;  3MWM A;  3CC2 I;  4HDV A;  4A0Y A;  4BL0 B;  2WY8 Q;  2E1M C;  2CW7 A;  4C2U A;  4LB5 A;  2HVS A;  1SAU A;  1P4A A;  1YW7 A;  3IKT A;  2WV0 A;  1PDN C;  2A6H F;  4YIR X;  2DO7 A;  4B1R A;  3FXU A;  3HRT A;  4F93 B;  2CU7 A;  3GTJ J;  1SVM A;  2CV1 A;  2W7N A;  1WJF A;  3JAM K;  4NQW A;  2H6B A;  1SMY F;  4L9J A;  4OMZ A;  5D4R A;  2K27 A;  2MBF A;  3I9V 2;  4G8X A;  2MLK A;  2WAQ A;  4IKF A;  3ZXS A;  2E1N A;  1IRF A;  2NVX J;  3F8C A;  2M5W A;  3QOD A;  4MGR A;  3O8G A;  4AC0 A;  2HKX A;  3VYS B;  3WTX C;  2YUS A;  2JA2 A;  2OZ6 A;  2IBD A;  4GXO A;  4I6Z A;  2EH3 A;  2F5D A;  3GME A;  1JKR C;  1QGP A;  2O5R A;  2P6T A;  5BNG A;  4U7D A;  2OQR A;  3EDP A;  1G4D A;  4I01 A;  4QPO A;  1JHF A;  4Z2Y A;  4C3H J;  2KZG A;  2M1B A;  2B63 J;  1O3S A;  1FBQ A;  2R5Z B;  1SFE A;  2GXG A;  1TP4 A;  1BJA A;  2XSD C;  1D0X A;  4AD9 A;  2DFI A;  4I7H A;  2ESN A;  4BBR J;  5B1A H;  4A3L J;  1STZ A;  4ZC3 A;  2K40 A;  2HQ5 A;  1YOV B;  2IPQ X;  3JRB A;  1ZRD A;  3DPU A;  3HGG A;  1ZHF A;  2NNY A;  3E5X A;  1A6Q A;  2QWW A;  3KP4 A;  4BQQ A;  2IGM A;  3HTS B;  3WTZ A;  1S29 A;  1XGS A;  2ME6 A;  3PUF A;  4Y17 A;  2RNG A;  1V55 H;  1X3W B;  3M8F A;  1VQK I;  2K9M A;  2ZSI B;  3FM3 A;  1BOA A;  4KMU X;  3WGG A;  2P5L C;  3F22 A;  2W24 A;  2R0Q C;  1Z9C A;  4XNF A;  2CFX A;  1SEU A;  1MMG A;  3HPH A;  4EGY A;  1FYK A;  2EJR A;  2WB1 N;  4RBO A;  3BTI A;  1LJ9 A;  1OYI A;  5KCM A;  4DYQ A;  5FJ8 J;  1ZR2 A;  2VL8 A;  3DPL C;  1VFC A;  5HLG A;  3E6C C;  4J19 A;  4PJJ A;  1KGS A;  1MH3 A;  3WU2 C;  1YIO A;  3SZT A;  1B8I A;  2R3S A;  5J1U A;  4E7K A;  2IS2 A;  1YIJ I;  2EFQ A;  2JTV A;  3DKW A;  3VYR B;  1I6X A;  2JPC A;  1S7E A;  1O57 A;  3GWZ A;  3I5U A;  3KLN A;  3W6J B;  2OV7 A;  3CF5 F;  3NWS A;  4D7N A;  4G94 A;  3BTC A;  2DQR A;  4DZP A;  1PUE E;  3OYI A;  3D5L A;  2L02 A;  1SFK A;  1R9T J;  2EV0 A;  2FOK A;  3N4M A;  4I99 C;  2ZO4 A;  4F3Q A;  3CCE I;  1BI0 A;  5K1Y A;  1U8B A;  3BR3 A;  2XF6 A;  3P9I A;  1YW8 A;  1IZ1 A;  2KRH A;  1J0R A;  3ROU A;  1G2H A;  1QA6 A;  4HST A;  3M1C A;  3B02 A;  2P7C B;  5JVT A;  4BY1 J;  3OYC A;  1K78 B;  1BC7 C;  3LSR A;  2W84 A;  1RC9 A;  1G3T A;  3BY6 A;  3M9A A;  2Y0S N;  5GAG J;  2OPT A;  1U3E M;  3DKY A;  1R22 A;  3GEZ A;  2QQB A;  4E7Z A;  4HZF A;  3AG2 H;  3R0A A;  4RGS A;  1HQC A;  4PJN A;  4OIO F;  1Y1W J;  3ABT A;  2DT7 B;  2Y30 A;  1TWA J;  2RQQ A;  2JT1 A;  5ICF A;  2L5Q A;  3BCA A;  2BY0 A;  1LE8 B;  4ZDO A;  2MD0 A;  4QTR A;  1TT0 A;  3TP0 A;  1Q1V A;  2HZT A;  5CLS A;  2CQK A;  3V8K A;  4XN3 A;  3LQQ A;  4I0A A;  3GO5 A;  4NDL A;  4ENN A;  5ILV A;  1WI9 A;  1K79 A;  1L0O C;  1FIP A;  4B4C A;  4BQO A;  1JGS A;  3MKY B;  2VJJ A;  4MIM A;  4BAY A;  3J81 Z;  1IGN A;  5KK1 A;  4A2U A;  2EFO A;  4DIQ A;  1HA8 A;  3H5N A;  3JRH A;  1YJN I;  4MEX F;  4YIF A;  2HYG D;  1C0W A;  1E3O C;  3EYI A;  5B5E C;  5JHF A;  3HYI A;  3RPQ A;  4JYK A;  3T8T A;  3W6K B;  3KYC B;  2UXN A;  2V6E A;  1W36 D;  5B66 C;  2IS6 A;  1I3Q J;  2QKL B;  4XLH A;  5FKK A;  5HDK A;  2HWV A;  3WG7 H;  2A6T A;  2AHQ A;  2VXZ A;  2RRE A;  2DOA A;  2VPR A;  3CJN A;  3ZQQ A;  1YE9 A;  1W36 C;  1Z05 A;  2PEX A;  2A68 F;  1TL8 A;  1ZG5 A;  1J75 A;  3GLL A;  3C1D A;  3PNV A;  2XC7 A;  2DDB A;  2XGX A;  4II2 A;  1R36 A;  2AQF A;  2XPW A;  3ZQI A;  1NK3 P;  4L18 B;  5E1X A;  3L2U A;  2CO5 A;  3IWZ A;  2VKH A;  1ONV A;  4RGR A;  1WFX A;  5GAE J;  3ECH A;  4ZDP A;  5FD6 A;  2HOT A;  1WVR A;  2LKX A;  2QF7 A;  3DKX A;  3GZ5 A;  1XX5 A;  4XON A;  5D6E A;  3OL4 A;  4Y4R A;  2C6Y A;  1JXS A;  1OJL A;  1T8I A;  1XCB A;  4LOC A;  2HPM A;  3PQJ A;  1HXD A;  3LWF A;  4A3D J;  2QKM B;  3KYD B;  3BQY A;  4EJU A;  5JLX A;  5DCM A;  1UST A;  1O3T A;  3TGN A;  1D0Z A;  4N4O B;  3ZN0 A;  2W4S A;  3JW4 A;  1D1C A;  4XLN F;  2DW4 A;  4AVZ A;  3LFK A;  4HOB A;  1EH8 A;  5DD4 A;  4CCK A;  1RI7 A;  3QYB A;  2LBF B;  4XSX F;  1D5Y A;  2O8X A;  4FTH A;  2VKV A;  3IH2 A;  5K5O A;  1YS7 A;  3GFL A;  1N78 A;  3DU5 A;  3KP7 A;  4PUS A;  2QSF X;  1X58 A;  5F6F A;  1X1A A;  3L09 A;  5EGO B;  1YX3 A;  5IOY A;  4KYW A;  2L4A A;  4MQ9 F;  4B44 A;  2ZJP F;  1YW9 A;  3I54 A;  4KIB A;  1BM9 A;  2LBF A;  3J81 K;  2JA6 J;  2VIX A;  4IOA F;  3JTH A;  4HLX A;  4LMY A;  4M6X A;  3IRQ A;  1XC5 A;  3CCY A;  3DCF A;  3I53 A;  4C2M J;  4HRI A;  5EGO A;  2MH9 A;  1UFM A;  4F7Z A;  4L9V A;  4BKX A;  1IUY A;  3HKZ A;  2L7M P;  4A3G J;  2QQ9 A;  1YFH A;  2K9L A;  3GTG J;  3S14 J;  5CVU A;  5FKL A;  4ZTF A;  3OR1 C;  3QPH A;  4PJ0 C;  2A69 F;  5CQE A;  4EGZ A;  1QBJ A;  4BHC A;  3A03 A;  3KEQ A;  3HRM A;  4DNC A;  1L3L A;  1FY7 A;  2CG4 A;  3VSK A;  1FP2 A;  2ADU A;  4BHB A;  2R7F A;  2XF7 A;  1G3W A;  2B0L A;  4K2E A;  1UB9 A;  2KJB A;  2RAE A;  2HQN A;  3K9T A;  4XKW A;  4XOT A;  5HLI A;  4BJT A;  1JUS A;  1AHD P;  3K70 C;  3I58 A;  2LF8 A;  4CZZ A;  1R1V A;  2XGE A;  4UXN A;  5KVR A;  3SJM A;  1ZLJ A;  5A2Q Z;  2X51 A;  3JRF A;  1KQ0 A;  4U0Y A;  1ZR4 A;  4LK0 F;  3JRA A;  1S5L C;  4MFD A;  4YFK F;  2AO9 A;  4TV7 A;  4E7J A;  3OL3 A;  2XAG A;  5DCF A;  3SZP A;  1BR4 A;  1W4M A;  3HM5 A;  4P96 A;  2JWT A;  5LGT A;  1OKR A;  3FF5 A;  1JJ8 C;  3BRO A;  1HKS A;  2NS8 A;  1RR7 A;  1ZAO A;  1SD4 A;  1P4X A;  2Z99 A;  4JOM A;  3GTQ J;  4E4H A;  3OR2 C;  2X48 A;  3GX4 X;  3O8H A;  1K83 J;  3I59 B;  5FKN A;  4RMN A;  1PJR A;  5GAH J;  2Q2E B;  1FJL A;  5L3E A;  2OTL I;  5GPC A;  3MQ0 A;  2EPF A;  4U0V A;  3P9C A;  4A5M A;  5FGM A;  3KYL A;  4D9J A;  3P7N A;  4XRM A;  4D5F A;  2JUG A;  4KA4 A;  1QZZ A;  2FRH A;  3KIO A;  4HA8 A;  1IRG A;  3IP4 B;  2ZNZ A;  3ML6 A;  4QSH A;  2Q2E A;  3QPL A;  2X0L A;  4A3M J;  3KPH A;  4PGH A;  3OMY A;  2RVC A;  3OIO A;  4PFP A;  1XGM A;  2HEO A;  4BYY A;  3M8E A;  4BH9 A;  3ZOB A;  2A5Y B;  1P7J A;  4C2T A;  3S1M J;  1PUF B;  3NWT A;  2MSY A;  1I3A A;  4UB8 C;  1K6Y A;  1TWG J;  1BI2 A;  2M0C A;  2ZCW A;  3CJQ B;  5D4S A;  5J8F A;  1ZRE A;  3LSM A;  5EG0 A;  3ISP A;  2LK2 A;  3K1P A;  3DBR B;  1PVE A;  2XDV A;  3T0Y A;  1XD7 A;  4A0Z A;  1R5H A;  3X2Q H;  4NHJ A;  5A2Q K;  3L2R A;  3JRG A;  1Z6R A;  2IJL A;  3OS2 A;  3AG1 H;  3W3C A;  4FAS D;  4IHT A;  4FHT A;  2QVO A;  3HDD A;  3FZV A;  3NEU A;  1A31 A;  2H27 A;  3IH4 A;  3QPT A;  3TO6 A;  5KAF C;  4XMY A;  3ZQC A;  2CH0 A;  1N77 A;  1WJ5 A;  2ZJQ F;  2CSO A;  3FMQ A;  3FXJ A;  4U7B A;  5FRM A;  5IP6 A;  1FWZ A;  2DTZ A;  1V3F A;  4CZC A;  2X6O A;  3OYM A;  3L1P A;  3K1N A;  2R7U A;  3FXM A;  3LA3 A;  3D1N I;  5F64 A;  2IS1 A;  2XV4 S;  2ZJ2 A;  2VOO A;  1ENH A;  2H1L A;  4JBA A;  2WAD A;  5E8G A;  3RQI A;  3VDX A;  1ZRC A;  4XOR A;  3SQN A;  2H94 A;  2L3D A;  4AUX A;  1S7O A;  5HS9 A;  3TL4 X;  2R4G A;  2HS5 A;  2BY1 A;  5DM6 F;  1I1G A;  1APL C;  4WXD A;  2VBW A;  1K4S A;  3FXR A;  2QSH X;  2FF4 A;  2XAF A;  3E1S A;  3HL2 A;  5B3S H;  3CF2 A;  3EUH A;  5IY5 H;  3BWG A;  2ZXW H;  2KRF A;  4BXX J;  2RC4 A;  2QLZ A;  3VYT B;  3DFG A;  4ETS A;  1RES A;  4HAM A;  3G1M A;  4M6Y A;  1FBS A;  2A3S A;  3F0C A;  4GDF A;  2XKP A;  3CUQ B;  4EJV A;  1FNN A;  4YRV A;  4XBF A;  3HOS A;  1DGR M;  2VI6 A;  3ZQ7 A;  2HDC A;  3ELK A;  1Y56 A;  5HOD A;  1ZG3 A;  1HDP A;  5L3D A;  2DT5 A;  5ICE A;  1V54 H;  2DDA A;  3CO6 C;  4IJA A;  2COB A;  3FMS A;  3SZG A;  1DU0 A;  1JHH A;  2W25 A;  5IYB J;  3WU0 A;  1EA3 A;  1MMD A;  3S2W A;  1KA8 A;  2JVH A;  1B6A A;  5LEK A;  3H35 A;  1TW2 A;  2QBY B;  4GYG A;  2BZT A;  2E1M B;  5DD8 A;  1W7P B;  2ZNY A;  3S17 J;  9ANT A;  1VQL I;  2XRL A;  4KN7 X;  2LRD A;  1BR1 A;  2CFO A;  3Q3S A;  3SDG A;  2AXL A;  4EVI A;  2P5V A;  2EZK A;  1IF1 A;  4BU2 A;  2JA5 J;  3TOA A;  5IOZ A;  3D0S A;  2L7F P;  2NS7 A;  4JX6 A;  2LR8 A;  2V6C A;  4L0Z B;  3LMM A;  3WE2 A;  1TLH B;  1W7P A;  2F6C A;  4IOC F;  3J7A O;  3PFI A;  3FBN B;  1ODD A;  1T0F C;  2M2E A;  3RKY A;  4AYB A;  2TDX A;  5TGT A;  1SD6 A;  5KNL A;  2IS4 A;  1YLF A;  2HQR A;  1IO2 A;  4L5E A;  2ELK A;  3J7A Y;  1VND A;  3WTV C;  3CP8 A;  2FMY A;  1TWF J;  1H8A C;  2OCC H;  3WGI A;  2M30 A;  1OR7 C;  4IQJ A;  2BVL A;  1GUU A;  1I6H J;  3OY9 A;  2NAZ A;  2FQ3 A;  4KUM A;  5LEJ A;  2QA4 I;  3OSG A;  1RIO H;  4EM1 A;  4A3C J;  2F48 A;  4FET A;  4WXC A;  2ISZ A;  4XLP F;  1MJ9 A;  2R7Z J;  2F4M B;  3CCU I;  2GOX B;  4HX4 A;  2BVM A;  2I10 A;  3Q0U A;  2UWM A;  3HSR A;  4IL6 C;  4UUS A;  3FXK A;  3SHF A;  4V2F A;  3HC7 A;  5FO5 A;  3CP2 A;  1G3Y A;  1Y6I A;  1AA7 A;  1U8R A;  2W00 A;  1QVU A;  2Y0M A;  4RAG A;  3JRC A;  3RKQ A;  2RQP A;  1XGN A;  4FT8 A;  1VTN C;  1HC8 A;  2Z3Y A;  1X4O A;  1K6O A;  4N9H A;  1SFX A;  1D5V A;  2FJ1 A;  4GRI A;  2L54 A;  5J6X A;  1T98 A;  3Q9V A;  2EIN H;  2CWE A;  1QPM A;  3LA7 A;  4R79 A;  2O3F A;  1VQ9 I;  3VEP A;  1XDU A;  1Z7U A;  1MW7 A;  4LFU A;  1Y8R B;  1ERD A;  2JJ7 A;  3HZJ A;  1POG A;  1NHA A;  4DQ2 A;  3WGH A;  1DPU A;  4CYC B;  4KN4 X;  3I56 I;  1VI0 A;  3PIP F;  4ESF A;  2D5V A;  3S3N A;  1J59 A;  5BPD A;  3QWL A;  2DFH A;  1UJ8 A;  1HKQ A;  2V1D A;  2PMZ N;  3K4C A;  2NS0 A;  2M9H A;  4B43 A;  1IUF A;  2KKO A;  3KEO A;  3HHH A;  4RGU A;  1XG1 A;  3BDD A;  1GVD A;  3CLQ A;  4O3M A;  3QOE A;  1F36 A;  2WY7 Q;  3CCM I;  1W7P D;  1KU7 A;  2P7V B;  3OYF A;  4CYC A;  5DS9 A;  5TIS C;  2Y31 A;  4GO1 A;  5LBQ A;  2V1N A;  1V5F A;  2BYV E;  4P55 A;  3B73 A;  4KFC A;  3I3L A;  4CDG A;  1MBE A;  2YX7 A;  2ZJR F;  2E36 A;  2KRC A;  2L0K A;  4CCJ A;  3J80 Z;  2H8R A;  4C3J J;  2VT2 A;  1JTX A;  1UHS A;  2ID6 A;  4EQQ A;  4XLF A;  5EF6 A;  1ZYR F;  3ZMV A;  1KU3 A;  4JX4 A;  4KJZ A;  5CKT A;  5LRS A;  2CV2 A;  5JVG F;  5FLM J;  3HOW J;  1R23 A;  4MTD A;  2OA4 A;  2GOM A;  4XRF A;  2MYS A;  3GZN B;  1NG6 A;  2Y2Z A;  3E6D A;  4PJM A;  4EJT A;  2F5E A;  3SXY A;  2KFD A;  5DUI A;  2LDU A;  3GBG A;  2NXN B;  4FCY A;  4L5I A;  5L3C A;  3BZC A;  3B6A A;  4BHP A;  1V4R A;  1V5G A;  1ZGA A;  2E71 A;  2VON A;  5H6R A;  3TMO A;  5BPI A;  3F8M A;  3LSH A;  3MAJ A;  3TO7 A;  5ICC A;  4ESJ A;  3GFI A;  2PI0 A;  3GTK J;  2K4J A;  5CQG A;  4JP0 A;  4S04 A;  3VWB A;  4IEJ A;  2GWR A;  1JI8 A;  5EDN A;  2NVY J;  5LD2 C;  2LYC A;  2CUF A;  4BQA A;  3DEE A;  4P9U A;  2R7T A;  4HF0 A;  4P5O A;  2Y0S A;  4PFO A;  3DP7 A;  5FRN A;  4HSR A;  4UY8 I;  1YX5 A;  1DPR A;  2DAO A;  4QLC U;  4O5V A;  5JFR A;  1VF9 A;  3HSE A;  4EJW A;  4F55 A;  1UAA A;  4E7S A;  2E7W A;  3OOU A;  4M9S A;  2CMP A;  2L7Z A;  3PSI A;  4N0B A;  1JUP A;  2DLL A;  2VBZ A;  2M4G A;  1QO0 D;  2H6C A;  3E6B A;  5LHI A;  2OC6 A;  1T56 A;  3GFM A;  2DA2 A;  2XB0 X;  3C2G A;  1B8I B;  3I71 A;  5E79 C;  3LFU A;  1RZ4 A;  3VYU B;  1GLN A;  2EV5 A;  3OYE A;  1X2M A;  1IXR C;  5DTD A;  2HDW A;  1LFP A;  2DA5 A;  2CUE A;  2YU3 A;  4DBQ A;  2HXO A;  3VSL A;  3T5X A;  1GVJ A;  3PQK A;  2EZL A;  3IRR A;  3R0J A;  2BBY A;  3M07 A;  4A3F J;  3EET A;  3K1M A;  4XKV A;  1LKX A;  1QHH D;  4FX4 A;  3KFW X;  2ZME C;  1Z3Y A;  2LD5 A;  1ZRF A;  2G7H A;  5BOX A;  3GFJ A;  4I2O A;  1A35 A;  3WHC A;  1MSF C;  2FE3 A;  3K4L A;  2XGD A;  3MN2 A;  2B7E A;  3BQZ A;  4IHW A;  2YX4 A;  3TW6 A;  2E2H J;  2DXI A;  4XRS A;  3AKZ A;  4KIG A;  4IHS A;  3ZMT A;  5D8K B;  3A0B C;  3CO7 C;  3KCC A;  1OPC A;  1LVA A;  4MQV A;  2W85 A;  2Q1Z B;  4XKB A;  3LSP A;  3BR0 A;  1OCO H;  2DMT A;  2MAB A;  3E5U A;  4R8H A;  5L3B A;  2DOE A;  3PM1 A;  4RLQ A;  2PMH A;  1TTY A;  1S3J A;  2Z1D A;  3CC4 I;  4F52 A;  4MHG A;  1S9H A;  3BJA A;  4G12 A;  4BEH B;  1Y8Q B;  5GTI C;  3AAF A;  2R7R A;  2VE8 A;  4RB2 C;  2DMU A;  2EQR A;  3AFH A;  2HYF A;  2IGN A;  1MNM C;  3E0J B;  3HBL A;  1U5T C;  1X3U A;  3K4M A;  2V9P A;  3V8L A;  4UVB A;  5JLW A;  3KZI C;  1FLI A;  1HF0 A;  2QSG X;  5FKM A;  3JRE A;  2IGO A;  2NVT J;  1ZK8 A;  3BTL A;  2Y9Y A;  2MC3 A;  4IX7 A;  4BEH A;  4OAY A;  1QZE A;  3WTW C;  4BQN A;  2DBB A;  2GAU A;  4A6E A;  4YEJ A;  2JVG A;  1QU3 A;  2LLK A;  1J7K A;  4G7Z F;  1LNW A;  1TQP A;  2YU9 J;  2NVQ J;  1YJW I;  1BOB A;  3OOP A;  2QEX I;  1HW1 A;  1U6G A;  1I39 A;  2NVU B;  1G3S A;  4OIQ F;  3CES A;  4G6D A;  3FXL A;  4G6T B;  1FP1 D;  4EM2 A;  1MBK A;  2OCE A;  2K9Q A;  3QU3 A;  3K0L A;  4UVC A;  1SC7 A;  4GYI A;  2PJR B;  3K10 A;  2IW5 A;  2XAU A;  3F21 A;  1ITY A;  1SD7 A;  2HXI A;  1IRZ A;  4PCQ A;  4A93 J;  1K4T A;  3H3Z A;  2GA2 A;  1TW3 A;  1T33 A;  5LHG A;  1BL0 A;  1DP7 P;  3DBL B;  4ZTJ A;  4ZYE A;  2W48 A;  2ECC A;  2VC0 A;  4Y13 A;  1RUN A;  4WXH A;  1X1B A;  5FD5 A;  1RET A;  4BXF A;  4OMY A;  5CVI A;  2PX9 A;  2K3F A;  1IW7 F;  3MEX A;  4GCV A;  4D0P A;  2IRF G;  2PJR A;  2CRG A;  1MDM B;  1WRJ A;  2BY3 A;  3CMM A;  4A3K J;  1U9N A;  1FTZ A;  3DEU A;  2X85 A;  2EB7 A;  4RM3 A;  5DCM B;  2IVM A;  1NTC A;  5IP7 J;  1GDT A;  2JSC A;  4DZJ A;  4L0Y B;  3ECO A;  3FKI J;  5GP9 A;  1ZTR A;  1Y39 A;  2HYJ A;  2CUZ A;  2ELJ A;  2V9K A;  3KEY A;  1MDM A;  2DJI A;  3S32 A;  3BZ6 A;  2EV6 A;  5J47 A;  1RR8 C;  4UV9 A;  3M3Y J;  2A61 A;  2HGC A;  2KMU A;  3BG6 A;  2LNB A;  2P4W A;  4NC6 A;  1QNT A;  2LKS A;  1Y1V J;  4P9F A;  5TJJ A;  1WQ2 A;  1KU9 A;  1T38 A;  2CUJ A;  3QAH A;  3TO9 A;  3BR1 A;  1R4N B;  4IVN A;  2EWN A;  4I76 A;  4PSX A;  3KP6 A;  4Y7N J;  4E70 A;  4ENJ A;  1X1D A;  2PLY A;  3HPG A;  1TQI A;  3CJT B;  2EK5 A;  4LD5 A;  3IKV A;  2FOW A;  4WWC A;  5KHD A;  2LY2 A;  4RB0 A;  2XAJ A;  3K2Z A;  3BG7 A;  2M87 A;  2GLO A;  4EEF G;  5CVJ A;  1IAW A;  3WTS C;  5E17 F;  2K86 A;  1JT6 A;  2DU9 A;  1R1U A;  1UMQ A;  5JI6 A;  4WCG A;  4A3B J;  3BG3 A;  2EFW A;  3ZR8 X;  2DCE A;  2WAF A;  3A0H C;  1YJ9 I;  1JGG A;  1P2F A;  4ZYA A;  2DT6 A;  4S05 A;  3DLL F;  1BA5 A;  2QUF A;  1XS9 A;  1KYZ A;  5EYR A;  2DJN A;  2KJC A;  3H3U A;  3HEF A;  3GF2 A;  3BJO A;  3JSP A;  4CGZ A;  4BDZ A;  1JE8 A;  4HV5 A;  3K6G A;  4V2G A;  1GT0 C;  3K70 D;  4JX5 A;  5HS8 A;  3JRI A;  1E3P A;  3IUO A;  5HOO A;  1D1A A;  4ZYG A;  5D5X B;  4E6K G;  4XKC A;  1HST A;  3R4K A;  3QYE A;  2VBX A;  5GPA A;  3ZMD A;  4KNY A;  4KDP A;  3HOX J;  1UZC A;  1XCV A;  3EUA A;  3OYG A;  2K02 A;  3IAM 2;  4M6V A;  1UG0 A;  1UG2 A;  2HR3 A;  3R61 A;  4D1Q A;  4KIC A;  2CQN A;  2V4J C;  3WTT C;  2FUG 2;  3ABL H;  1MND A;  2JSP A;  3S1R J;  3J7Y J;  2P0W A;  1TZL A;  3BG5 A;  3OYA A;  2G0E A;  2YS9 A;  4ZZD A;  3IL2 A;  1VQ8 I;  1J09 A;  3KP3 A;  1OCT C;  1VQN I;  2NOJ B;  3S93 A;  4J01 A;  3BP8 A;  3GCM A;  1D1B A;  3RZD J;  4HBL A;  5D5W B;  3OYL A;  3JTG A;  3TKY A;  2HQA A;  2VC1 A;  4CUG A;  1OQY A;  5ILS A;  1GXP A;  5H6Q A;  1B1B A;  3WU1 B;  3T8R A;  3VPR A;  4HNU A;  4LG3 A;  1WJA A;  2ELH A;  4XRS G;  3KP5 A;  4BE0 A;  2ACJ A;  1P7I A;  5DV5 A;  1EJ9 A;  2XKO A;  2O8K A;  2V1X A;  4BS9 A;  2GXB A;  1VQM I;  2FNP A;  4EM0 B;  1IC8 A;  3H5A A;  4L9T A;  4Q47 A;  2QGU A;  2ZSH B;  1N75 A;  3AL0 C;  5JR3 A;  4KIF A;  3CD6 I;  4LLL A;  3KET A;  1WWX A;  5EG0 B;  2QM3 A;  1JJ6 C;  2E34 A;  2BOL A;  2O61 A;  1WJB A;  4HYE A;  1F1Z A;  3HHG A;  1ZH5 A;  2VKD A;  1WSU A;  1G59 A;  1Z21 A;  5DYM A;  1REP C;  3LA2 A;  4Y33 A;  4PJL A;  3Q0W A;  2KDZ A;  3PNT A;  2HPI A;  3RCO A;  1MBF A;  4AIJ A;  2XAS A;  4EAT A;  3LSK A;  3ABK H;  1OYW A;  2IP2 A;  5M5Y J;  2R7W A;  1VQP I;  3FHN A;  5IP9 J;  3BR5 A;  3QP6 A;  2FQ4 A;  2PMU A;  4NBQ A;  2Y9Z A;  4GFB A;  2JMW A;  3K4J A;  3QOP A;  1CGP A;  2QCO A;  4BE2 A;  2HFH A;  5D5U B;  4CCN A;  4E7I A;  3RKW A;  1JKO C;  4LIT A;  2BW3 B;  1MJB A;  1W0T A;  5K5R A;  2K5C A;  1KZH A;  1IN8 A;  6PAX A;  1IG7 A;  1ON2 A;  2X9D A;  4B47 A;  4G7H F;  2CW0 F;  1PP8 F;  4PDK A;  1T0F A;  2CYY A;  3ZGK A;  4YFX F;  3SDB A;  1T39 A;  1D8K A;  1GV2 A;  3FXQ A;  3H5R A;  4W97 A;  2HVR A;  1OCP A;  3COA C;  4G7O F;  1P9Q C;  1WH7 A;  3N05 A;  4IXA A;  3BR6 A;  1P6R A;  4DW6 A;  2BW3 A;  1IXC A;  4A6D A;  1M1E B;  5LLQ A;  3U1K A;  3T1B A;  1ETO A;  1FSH A;  1HW2 A;  1R00 A;  2EA4 A;  3EPZ A;  4M3G A;  4OAZ A;  2OQG A;  4X0G A;  1OR7 A;  3S15 J;  3RI4 A;  2XF5 A;  1IDY A;  3MZH A;  1ZG1 A;  3TBI A;  4CSW A;  3FIS A;  2X1E A;  5KAI C;  1IN5 A;  1RUO A;  4L9N A;  3F3X A;  2XAH A;  2L9V A;  3KP2 A;  4XN0 A;  2WWY A;  3OS1 A;  4XL9 A;  4PZJ A;  2X4H A;  3ZMS A;  3R60 A;  2EIL H;  2XVC A;  4HDU A;  1BIA A;  3H3V K;  3H0D A;  2HTS A;  2QYO A;  4MEY F;  3WOD F;  1FMV A;  2W82 A;  2V26 A;  2VN2 A;  5J1Y A;  3HSF A; 
#chains in the Genus database with same CATH homology
 4EMS A;  4YII A;  5JHU A;  2OAZ A;  1HW5 A;  4I02 A;  3L2C A;  3VOE A;  5FFZ A;  3RYP A;  4CO8 A;  4UVA A;  2LKP A;  3VFZ A;  2VOD A;  1XSX A;  1J5Y A;  3U1D A;  1R7J A;  1SMT A;  2IA1 A;  4AIH A;  1K7A A;  4FX0 A;  3H92 A;  2OU2 A;  1AOY A;  1G6N A;  5E20 A;  3ZN1 A;  4LB6 B;  2IA2 A;  3MCZ A;  4Y15 A;  1HSJ A;  1UHM A;  3O2P E;  4HX7 A;  1O7F A;  2DPU A;  3DV8 A;  4ASN A;  3CDH A;  5CYV A;  4IRH A;  1ZN2 A;  3RIR A;  1Y0U A;  2YSR A;  1MD0 A;  2IT0 A;  3IWF A;  4OIP F;  2NRA C;  2F5C A;  2OD5 A;  4L5J A;  1O3Q A;  5F1R A;  1W5T A;  3MFK A;  1XDS A;  4JK1 X;  4A12 A;  5AIP A;  3TOB A;  2V79 A;  1LQ1 A;  4EJO A;  3M1E A;  4LLN A;  2LF7 A;  4PGG A;  1YTY A;  2V1U A;  3KE2 A;  4OIR F;  1YG2 A;  5D6F A;  2M45 A;  4ZZL A;  4RGX A;  3C3W A;  3JAM Z;  2MD5 A;  2K4B A;  2HTJ A;  1TBX A;  2EFN A;  4HQM A;  1KYW A;  3DF8 A;  2YR2 A;  3KZY A;  3GVA A;  4HW0 A;  5AIQ A;  1EH6 A;  1SD5 A;  5D8L B;  1FOK A;  1TQM A;  2DTR A;  2ZME B;  1OYY A;  3F72 A;  3U2R A;  2WC2 A;  4ON0 A;  3QRF F;  2M8E A;  4HQE A;  1KU2 A;  2D1H A;  1R1T A;  2XHK A;  4OIN F;  3CUQ C;  3C7J A;  1LEB A;  2ZME A;  3FM5 A;  2P5K A;  2BGC A;  2NNN A;  3Q9S A;  4YG2 F;  4UHT A;  4XSZ F;  4R1H A;  1HKT A;  4HV6 A;  2D45 A;  1DUX C;  4RS8 A;  4UV8 A;  5LGN A;  3KLO A;  3KZZ A;  2PFB A;  4MNU A;  3HUG A;  3WG9 A;  3DPT A;  2J5P A;  1U5T A;  1MGT A;  4KT5 C;  2UZK A;  3V7S A;  1BC8 C;  2FU4 A;  4RAY A;  4I0B A;  4IRG A;  3GLX A;  2GZW A;  5FFX A;  5HVQ C;  5L3F A;  3HRU A;  3V7R A;  1PP7 U;  5HDN A;  3EQL F;  5D5V B;  1B4A A;  3VOD A;  2Y75 A;  5BS6 A;  4CIC A;  1T6S A;  2GQQ A;  5CJ9 A;  1Z1D A;  5CVR A;  2K7L A;  5ICG A;  4LG0 B;  1IN7 A;  1FZP B;  3JSO A;  4IPA A;  3I0T A;  1GHC A;  3RKX A;  1QQI A;  2FNA A;  3J80 K;  1J9I A;  5LGU A;  1I1S A;  2ZBK A;  4LG0 A;  1YO5 C;  2HKO A;  5E1Z B;  5DEQ A;  4A5N A;  1LB2 A;  1TNS A;  2FML A;  4AVP A;  4MTE A;  2RDP A;  4WF2 A;  2ESH A;  2DK8 A;  4B8X A;  1EH7 A;  1A04 A;  2JPB A;  3QP5 A;  1F4K A;  3TQN A;  2Z5U A;  3L00 A;  1KQ8 A;  5E8I A;  3E6M A;  2LSO A;  2R7D A;  3DXJ F;  5ED4 A;  1I27 A;  3GXO A;  3WTY C;  4KMF A;  3G3Z A;  5DUK A;  3RTR A;  2GA1 A;  2ZXJ A;  3ZP5 A;  2QZ8 A;  4Q48 A;  4WK8 F;  4I98 B;  1ZAR A;  3GZ6 A;  4IF4 A;  1F9N A;  2Q0O A;  3V4G A;  4G6Q A;  2PN6 A;  2FSW A;  4NB5 A;  2IA0 A;  4QWQ A;  2RKH A;  3G73 A;  2L01 A;  3FHZ A;  1LEA A;  3I4P A;  1R5G A;  1EV7 A;  5EEG A;  3MZY A;  1K78 A;  3RDI A;  3E97 A;  2XRO A;  2YPR A;  4LLG F;  2RGV A;  3RJP A;  4BNC A;  2DK5 A;  2NYX A;  2JZY A;  4B09 A;  1ON1 A;  3WE3 A;  3LST A;  4H0E A;  1R58 A;  2DQL A;  3N97 A;  3V7C A;  2COM A;  2FBI A;  4UNO A;  5J8C A;  3CUO A;  2VBY A;  5ILU A;  4N9I A;  4OOI A;  1FT9 A;  5IT3 A;  1T2K A;  4YFN F;  2A07 F;  4M71 A;  4G9Y A;  2XRN A;  4OU0 A;  2W57 A;  1U2W A;  2STT A;  1H0M A;  1USS A;  3LQR A;  3IC7 A;  2G7U A;  3L9F A;  2PJP A;  3QU6 A;  1H9T A;  1IN6 A;  1RNL A;  4LK1 F;  1HBX G;  1OMI A;  1KQ9 A;  1ZGJ A;  1I5Z A;  4UUV A;  1AWC A;  3F8B A;  4LGW A;  2P6S A;  4AWX B;  3E5Q A;  1XSV A;  1E2X A;  1XSD A;  4ENK A;  2FEZ A;  1Z6T A;  5L3G A;  2VOP A;  2H09 A;  1Z91 A;  2RNJ A;  1XMA A;  2G9W A;  3HIF A;  2D1V A;  5BQT A;  3ERE D;  2Q8K A;  3R6S A;  2FXA A;  4M73 A;  2CGP A;  4GGG A;  2ISY A;  1S6L A;  1S7A A;  1O3R A;  4CXF A;  1BI3 A;  4RB1 A;  3C18 A;  3BOQ A;  3P9K A;  5AON A;  3F8N A;  3BPV A;  4ESB A;  4BXU A;  1XB4 A;  2Z33 A;  3E3V A;  3O6B B;  1F5T A;  2PQ8 A;  2XAQ A;  4M9X A;  3U9G A;  1B9N A;  2F5F A;  2MA3 A;  2PBI A;  2O03 A;  1ULY A;  2VE9 A;  2OZU A;  3F23 A;  3ABU A;  2MLG A;  3F8F A;  4HF2 A;  3LAJ A;  5K5Q A;  2QEN A;  1FX7 A;  1FPQ A;  5ERI A;  4U88 A;  4Q4Z F;  3BPX A;  3I59 A;  1BBY A;  3L7W A;  2MH2 A;  3CLO A;  4ZH4 F;  4RB3 C;  2V9V A;  3GW2 A;  1MKM A;  5BMZ A;  2AS5 F;  1XMK A;  3RYR A;  1BN5 A;  3REO A;  3FX3 A;  4M72 A;  4HX8 A;  2E7X A;  2VT3 A;  4IRI A;  1QZY A;  1E17 A;  1UCR A;  4RAZ A;  5LHH A;  2RV8 A;  3IHU A;  3K69 A;  2FBH A;  2KIM A;  2P8T A;  1LDJ A;  2L4M A;  2Y48 A;  3M7G A;  1FYM A;  4ZYH A;  5H20 A;  3BJ6 A;  3FMR A;  5HDG A;  5EEH A;  4M74 A;  5FLX Z;  1FSE A;  3LAP A;  4WX9 A;  1U78 A;  3ZMZ A;  4ZYD A;  5LRR A;  2UXX A;  1BIB A;  3F6V A;  4A0X A;  1LDD A;  5TRD A;  1B59 A;  1IXS B;  5CVV A;  1DDN A;  3V8J A;  3HTU A;  4ENM A;  3ZMU A;  1XN7 A;  3CTA A;  5IT9 Z;  2O0Y A;  2J5O A;  3FWE A;  2ZFW A;  3ULQ B;  1IN4 A;  2F2E A;  2PG4 A;  4JQF A;  1WKM A;  2EFP A;  3F6O A;  1B9M A;  3CUQ A;  3GUD A;  3HRS A;  2A6E F;  5E1W A;  4CYD A;  1CF7 B;  1SAX A;  4EV0 A;  2RN7 A;  2OBP A;  2FBK A;  2BEO A;  2BE5 F;  1P4W A;  1ZLK A;  1CF7 A;  3RPU A;  1XGO A;  3NQO A;  3GYH X;  2QBY A;  1O7L A;  2Z9O A;  5HLH A;  1FC3 A;  5FLX K;  3O3K A;  3OV8 A;  2WTE A;  5HS7 A;  5E18 F;  3Q5F A;  2QQA A;  4O6J A;  3TDZ C;  1H9G A;  2FA5 A;  1MZB A;  2BV6 A;  2DI3 A;  1UHW A;  1D8J A;  2XUB A;  1SFU A;  1J2X A;  4M9Z A;  4HLY A;  2KIU A;  5IT9 K;  1GXQ A;  2JRT A;  4HF1 A;  3TDU C;  2KIF A;  5DDG A;  1W5S A;  1YQA A;  3ZPL A;  1FBU A;  1Q1H A;  3DQV C;  1P92 A;  2D2W A;  1S8N A;  2XIG A;  1BI1 A;  4U0W A;  1FYL A;  3HOT A;  1YYV A;  5FB2 A;  3SFZ A;  4CHU A;  2ETH A;  3NRV A;  4Q5S F;  4AIK A;  3EYY A;  2ZKZ A;  2HOE A;  1TNT A;  4LJZ F;  2O6G E;  2STW A;  1YS6 A;  1D3Y A;  3VB2 A;  3WTU C;  2DPD A;  2EA2 A;  4I09 A;  2E1C A;  2GIV A;  1MJA A;  3I64 A;  1LDK B;  1U5T B;  3MWM A;  4HDV A;  4A0Y A;  4LB5 A;  1P4A A;  1YW7 A;  3IKT A;  2WV0 A;  1PDN C;  2A6H F;  2DO7 A;  3FXU A;  3HRT A;  3JAM K;  4NQW A;  2H6B A;  1SMY F;  5D4R A;  4L9J A;  4OMZ A;  2K27 A;  2MBF A;  4G8X A;  2MLK A;  2E1N A;  1IRF A;  3F8C A;  2M5W A;  4MGR A;  2HKX A;  3WTX C;  2OZ6 A;  4GXO A;  2F5D A;  1QGP A;  4U7D A;  2P6T A;  2OQR A;  3EDP A;  1G4D A;  4I01 A;  1JHF A;  4Z2Y A;  2M1B A;  1O3S A;  1FBQ A;  1SFE A;  2GXG A;  1BJA A;  4AD9 A;  2DFI A;  4I7H A;  2ESN A;  1STZ A;  2IPQ X;  1ZRD A;  1ZHF A;  2NNY A;  3E5X A;  2QWW A;  3KP4 A;  3HTS B;  3WTZ A;  1S29 A;  1XGS A;  4Y17 A;  3M8F A;  2P5L C;  3FM3 A;  1BOA A;  4KMU X;  3WGG A;  3F22 A;  2W24 A;  1Z9C A;  2CFX A;  4EGY A;  1FYK A;  2EJR A;  1LJ9 A;  1OYI A;  3DPL C;  5HLG A;  3E6C C;  1KGS A;  1YIO A;  3SZT A;  2R3S A;  2EFQ A;  2JTV A;  3DKW A;  1I6X A;  2JPC A;  1O57 A;  3GWZ A;  3I5U A;  3KLN A;  3W6J B;  4G94 A;  2DQR A;  1PUE E;  3D5L A;  2L02 A;  2EV0 A;  2FOK A;  3N4M A;  2ZO4 A;  1BI0 A;  5K1Y A;  3P9I A;  1YW8 A;  1IZ1 A;  3ROU A;  1J0R A;  3B02 A;  2P7C B;  5JVT A;  1K78 B;  1BC7 C;  2W84 A;  1G3T A;  3BY6 A;  3M9A A;  1U3E M;  1R22 A;  3GEZ A;  2QQB A;  4HZF A;  3R0A A;  4RGS A;  1HQC A;  4OIO F;  3ABT A;  2JT1 A;  5ICF A;  2HZT A;  5CLS A;  2CQK A;  3V8K A;  3LQQ A;  4I0A A;  3GO5 A;  4ENN A;  5ILV A;  1WI9 A;  1K79 A;  1L0O C;  1JGS A;  4BAY A;  3J81 Z;  5KK1 A;  4A2U A;  2EFO A;  4MEX F;  4YIF A;  2HYG D;  1C0W A;  3EYI A;  3HYI A;  3RPQ A;  3T8T A;  3W6K B;  2UXN A;  5HDK A;  2HWV A;  2VXZ A;  3CJN A;  1Z05 A;  2PEX A;  2A68 F;  1ZG5 A;  1J75 A;  3C1D A;  2XGX A;  1R36 A;  4L18 B;  5E1X A;  2CO5 A;  3IWZ A;  1ONV A;  4RGR A;  3ECH A;  5FD6 A;  3GZ5 A;  5D6E A;  2C6Y A;  1JXS A;  1XCB A;  3PQJ A;  1HXD A;  3LWF A;  4EJU A;  5DCM A;  1UST A;  1O3T A;  3TGN A;  3ZN0 A;  3JW4 A;  4XLN F;  2DW4 A;  3LFK A;  4HOB A;  1EH8 A;  5DD4 A;  1RI7 A;  4XSX F;  2O8X A;  5K5O A;  1YS7 A;  3GFL A;  3KP7 A;  5F6F A;  3L09 A;  4KYW A;  2L4A A;  4MQ9 F;  1YW9 A;  3I54 A;  4KIB A;  1BM9 A;  3J81 K;  3JTH A;  4HLX A;  4LMY A;  4M6X A;  3IRQ A;  3I53 A;  2MH9 A;  1UFM A;  4F7Z A;  4L9V A;  1IUY A;  2QQ9 A;  1YFH A;  5CVU A;  3QPH A;  2A69 F;  4EGZ A;  1QBJ A;  4BHC A;  3KEQ A;  4DNC A;  3HRM A;  1L3L A;  1FY7 A;  2CG4 A;  1FP2 A;  2ADU A;  4BHB A;  2R7F A;  1G3W A;  2B0L A;  4K2E A;  1UB9 A;  2KJB A;  5HLI A;  2HQN A;  3K9T A;  3I58 A;  2LF8 A;  4CZZ A;  1R1V A;  4UXN A;  5KVR A;  1ZLJ A;  5A2Q Z;  1KQ0 A;  4U0Y A;  4LK0 F;  4YFK F;  4TV7 A;  3SZP A;  2XAG A;  5DCF A;  1W4M A;  4P96 A;  5LGT A;  1OKR A;  3FF5 A;  3BRO A;  1HKS A;  1ZAO A;  1SD4 A;  1P4X A;  2Z99 A;  3GX4 X;  3I59 B;  5L3E A;  3MQ0 A;  4U0V A;  3P9C A;  4A5M A;  5FGM A;  3P7N A;  4KA4 A;  1QZZ A;  2FRH A;  4HA8 A;  1IRG A;  2ZNZ A;  3ML6 A;  2Q2E A;  2X0L A;  4PGH A;  2RVC A;  2HEO A;  1XGM A;  4BYY A;  3M8E A;  4BH9 A;  2A5Y B;  2ZCW A;  5D4S A;  1BI2 A;  5J8F A;  1ZRE A;  3ISP A;  3K1P A;  3T0Y A;  1XD7 A;  4A0Z A;  1R5H A;  4NHJ A;  5A2Q K;  1Z6R A;  2IJL A;  4IHT A;  4FHT A;  2QVO A;  3FZV A;  3NEU A;  2H27 A;  3QPT A;  3TO6 A;  2CSO A;  3FMQ A;  4U7B A;  1FWZ A;  1V3F A;  3K1N A;  3LA3 A;  5F64 A;  2XV4 S;  2ZJ2 A;  2VOO A;  4JBA A;  5E8G A;  1ZRC A;  3SQN A;  2H94 A;  2L3D A;  1S7O A;  5HS9 A;  2HS5 A;  1I1G A;  4WXD A;  2VBW A;  3FXR A;  2FF4 A;  2XAF A;  3EUH A;  3BWG A;  2KRF A;  2RC4 A;  2QLZ A;  3DFG A;  4ETS A;  4HAM A;  4M6Y A;  1FBS A;  2A3S A;  2XKP A;  3CUQ B;  4EJV A;  1FNN A;  4XBF A;  3HOS A;  3ZQ7 A;  2HDC A;  3ELK A;  1ZG3 A;  5L3D A;  2DT5 A;  5ICE A;  3CO6 C;  4IJA A;  3FMS A;  1JHH A;  2W25 A;  3WU0 A;  3S2W A;  1KA8 A;  1B6A A;  5LEK A;  1TW2 A;  2QBY B;  4GYG A;  5DD8 A;  1W7P B;  2ZNY A;  4KN7 X;  2AXL A;  4EVI A;  2P5V A;  1IF1 A;  3TOA A;  3D0S A;  4L0Z B;  2V6C A;  3WE2 A;  1TLH B;  1W7P A;  3J7A O;  3PFI A;  1ODD A;  3RKY A;  2TDX A;  1SD6 A;  1YLF A;  2HQR A;  3WTV C;  2FMY A;  3WGI A;  2M30 A;  2NAZ A;  2FQ3 A;  4KUM A;  5LEJ A;  1RIO H;  4EM1 A;  4WXC A;  2ISZ A;  4XLP F;  1MJ9 A;  4HX4 A;  2UWM A;  3HSR A;  3SHF A;  5FO5 A;  1G3Y A;  1U8R A;  2Y0M A;  2RQP A;  1XGN A;  4FT8 A;  1VTN C;  2Z3Y A;  1K6O A;  4N9H A;  1SFX A;  1D5V A;  2L54 A;  5J6X A;  1T98 A;  3Q9V A;  2CWE A;  1QPM A;  3LA7 A;  4R79 A;  2O3F A;  3VEP A;  1XDU A;  1Z7U A;  4LFU A;  1NHA A;  4DQ2 A;  3WGH A;  1DPU A;  4KN4 X;  4ESF A;  1J59 A;  5BPD A;  1HKQ A;  2V1D A;  2NS0 A;  2KKO A;  3KEO A;  3HHH A;  4RGU A;  3BDD A;  4O3M A;  1KU7 A;  1W7P D;  2P7V B;  4GO1 A;  5LBQ A;  2BYV E;  4P55 A;  3B73 A;  4KFC A;  4CDG A;  2YX7 A;  3J80 Z;  2VT2 A;  4EQQ A;  1ZYR F;  3ZMV A;  1KU3 A;  5LRS A;  1R23 A;  4MTD A;  2OA4 A;  4XRF A;  4EJT A;  3E6D A;  2F5E A;  3SXY A;  5DUI A;  2LDU A;  4L5I A;  5L3C A;  4BHP A;  1V4R A;  1ZGA A;  2VON A;  5H6R A;  5BPI A;  3F8M A;  3MAJ A;  3TO7 A;  5ICC A;  4ESJ A;  3GFI A;  2PI0 A;  2K4J A;  4S04 A;  2GWR A;  4BQA A;  4P9U A;  4HF0 A;  4P5O A;  3DP7 A;  2DAO A;  1DPR A;  4QLC U;  4O5V A;  5JFR A;  3HSE A;  4EJW A;  2E7W A;  4M9S A;  4N0B A;  2DLL A;  2VBZ A;  1QO0 D;  2H6C A;  3E6B A;  5LHI A;  3GFM A;  3I71 A;  1RZ4 A;  2EV5 A;  1IXR C;  2YU3 A;  3T5X A;  1GVJ A;  3PQK A;  3IRR A;  3R0J A;  2BBY A;  3EET A;  3K1M A;  4FX4 A;  3KFW X;  1ZRF A;  2G7H A;  5BOX A;  3GFJ A;  4I2O A;  2FE3 A;  2YX4 A;  4KIG A;  4IHS A;  3ZMT A;  5D8K B;  3CO7 C;  3KCC A;  1OPC A;  1LVA A;  4MQV A;  2W85 A;  3E5U A;  4R8H A;  5L3B A;  2PMH A;  1TTY A;  1S3J A;  4MHG A;  3BJA A;  3AAF A;  2VE8 A;  4RB2 C;  2HYF A;  1U5T C;  1X3U A;  3V8L A;  4UVB A;  1FLI A;  2MC3 A;  3WTW C;  2DBB A;  2GAU A;  4A6E A;  1J7K A;  4G7Z F;  1LNW A;  1TQP A;  3OOP A;  1HW1 A;  1U6G A;  1G3S A;  4OIQ F;  4G6D A;  1FP1 D;  4EM2 A;  3QU3 A;  3K0L A;  4UVC A;  4GYI A;  2IW5 A;  3F21 A;  1SD7 A;  4PCQ A;  3H3Z A;  2GA2 A;  1TW3 A;  5LHG A;  1DP7 P;  4ZYE A;  1RUN A;  2VC0 A;  4Y13 A;  4WXH A;  5FD5 A;  4OMY A;  5CVI A;  1IW7 F;  3MEX A;  4GCV A;  4D0P A;  2IRF G;  1MDM B;  1WRJ A;  3DEU A;  2EB7 A;  5DCM B;  2IVM A;  2JSC A;  4L0Y B;  3ECO A;  1MDM A;  3BZ6 A;  2EV6 A;  4UV9 A;  2A61 A;  2HGC A;  2LNB A;  2P4W A;  1QNT A;  4P9F A;  5TJJ A;  1WQ2 A;  1KU9 A;  1T38 A;  3QAH A;  3TO9 A;  4IVN A;  2EWN A;  3KP6 A;  4E70 A;  4ENJ A;  2PLY A;  1TQI A;  2EK5 A;  4LD5 A;  3IKV A;  4WWC A;  4RB0 A;  2XAJ A;  3K2Z A;  2M87 A;  5CVJ A;  1IAW A;  3WTS C;  5E17 F;  2K86 A;  2DU9 A;  1R1U A;  5JI6 A;  4WCG A;  2EFW A;  1P2F A;  4S05 A;  2QUF A;  1KYZ A;  2KJC A;  3H3U A;  3GF2 A;  3BJO A;  3JSP A;  4CGZ A;  1JE8 A;  4HV5 A;  5HS8 A;  5HOO A;  4ZYG A;  5D5X B;  1HST A;  3R4K A;  2VBX A;  3ZMD A;  4KNY A;  4KDP A;  1XCV A;  2K02 A;  2HR3 A;  3R61 A;  4KIC A;  3WTT C;  4ZZD A;  3IL2 A;  3KP3 A;  3BP8 A;  4HBL A;  5D5W B;  3JTG A;  3TKY A;  2VC1 A;  5ILS A;  1GXP A;  5H6Q A;  1B1B A;  3WU1 B;  3T8R A;  2ELH A;  3KP5 A;  2ACJ A;  5DV5 A;  2XKO A;  2V1X A;  2GXB A;  2FNP A;  4EM0 B;  4L9T A;  4Q47 A;  5JR3 A;  4KIF A;  4LLL A;  3KET A;  1WWX A;  2QM3 A;  2O61 A;  4HYE A;  1F1Z A;  3HHG A;  1ZH5 A;  1WSU A;  5DYM A;  1REP C;  3LA2 A;  4AIJ A;  2XAS A;  1OYW A;  2IP2 A;  3QP6 A;  2PMU A;  3QOP A;  1CGP A;  2HFH A;  5D5U B;  3RKW A;  1MJB A;  5K5R A;  6PAX A;  1IN8 A;  1ON2 A;  4G7H F;  2CW0 F;  1PP8 F;  4YFX F;  4PDK A;  1T0F A;  2CYY A;  1T39 A;  1D8K A;  3FXQ A;  3COA C;  4G7O F;  4IXA A;  1P6R A;  1IXC A;  4A6D A;  5LLQ A;  3T1B A;  1FSH A;  1HW2 A;  1R00 A;  2EA4 A;  2OQG A;  1OR7 A;  3RI4 A;  3MZH A;  1ZG1 A;  1IN5 A;  1RUO A;  4L9N A;  3F3X A;  2XAH A;  3KP2 A;  2WWY A;  4PZJ A;  2X4H A;  3ZMS A;  4HDU A;  3R60 A;  2XVC A;  1BIA A;  2HTS A;  2QYO A;  4MEY F;  3WOD F;  2VN2 A;  3HSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...