2HZDA

Nmr structure of the dna-binding tea domain and insights into tef-1 function
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional enhancer factor TEF-1
publication title Insights into transcription enhancer factor 1 (TEF-1) activity from the solution structure of the TEA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01285 TEA TEA/ATTS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hzdA00
2HZDA
chains in the Genus database with same CATH superfamily
4MLOA 3ABTA 2MSYA 2LY1A 2NOGA 2XKPA 4EQQA 3A2KA 2ZMEB 2ADUA 1PUEE 1X58A 1BI0A 2LC2A 1GXPA 3H5NA 3NWTA 1TT0A 1EF4A 2XGDA 3ABMH 3LAPA 1MD0A 3KYLA 1I3QJ 3WGGA 5CVRA 1R1UA 2KRCA 1YW8A 4LG0A 3S17J 3FMRA 3RQ4A 3I58A 1NH3A 3OL3A 3IKTA 2CQKA 3OR1C 4R1HA 2V1XA 1LVKA 4XMYA 5HS8A 3PO2J 4BHPA 1S72I 3A03A 1RR8C 2Z9OA 3T8RA 2IBDA 2DJIA 3TO7A 1FP1D 4D5CA 2L4AA 1WI9A 4B43A 1XCBA 3LAJA 3ZCOA 4LFUA 2COBA 5EDNA 3F3XA 1JHFA 3K0LA 2QSFX 1YLFA 1RRJA 2E7XA 5LHHA 3HOTA 4OAZA 1OR7C 3M7GA 3E97A 2ME6A 4FTHA 1QGPA 2X1DA 1VNDA 1VZ0A 5GAGJ 1ZN2A 3FKIJ 1MBGA 1AHDP 4F52A 2HQ5A 2VQHA 2VT2A 3P5JA 1RUNA 1J0RA 4U87A 4Y33A 1Y8RB 4NNJA 2XUBA 5HVQC 3NEUA 3NWSA 4RMNA 5L3DA 2UV1A 1D8JA 2GIZA 3QPTA 4IXAA 3V7CA 3CMAI 1W36D 2ESNA 3V8KA 2KDZA 3JSPA 2P81A 4AC0A 1B6AA 1U78A 3WE3A 1ACIA 2KT0A 3E7LA 3JRIA 1A6QA 5M5WJ 4HQEA 4CHUA 3PQKA 2MC4A 3QPLA 4WWCA 1KYWA 4AYBN 3DBHB 1ZGWA 4U7DA 4J00A 3M3YJ 2VIXA 2P8TA 4R79A 2ZJRF 2ZSHB 2F5CA 3B73A 1OCPA 2V6CA 1LEAA 1WGXA 3FZVA 5DV5A 2H6CA 1YO5C 4CDGA 1QPIA 4NC8A 2RVCA 1D0ZA 1H9GA 1B8IB 1UG0A 2FJ1A 2EFPA 2MFZA 3K4CA 1T33A 1VQLI 5CPRB 3LMMA 3ONQA 4PGHA 2Q0OA 1JT0A 5FD6A 2VASA 2K9LA 2O8XA 2JUGA 3C2GA 2EIKH 3CDIA 4QPQA 3ZMVA 3TKYA 4E7HA 3LWFA 2BVLA 4CA0A 2XSDC 2XRLA 3ZQ7A 4ZYAA 2LD5A 1DPUA 4IF4A 2A69F 4EJTA 3ROUA 4XBFA 1G3YA 3BPVA 2DFIA 1R4MB 3V8JA 1MMSA 1BW5A 1TWHJ 2KIFA 2NS0A 1Q1VA 2EWNA 2R7DA 2CUJA 1K78B 5DS9A 1WH7A 4MFEA 1SD5A 2FSWA 3U1KA 4PUSA 3Q5FA 3P9KA 5D4RA 3F0CA 3ZQHA 1F5TA 2DPDA 1VTNC 3OYKA 4BQAA 1P4AA 1MBFA 4IHWA 2EH3A 2JZYA 1BIAA 1WCMJ 4LITA 5HLGA 1HQCA 4G7ZF 1QRYA 4DW6A 3OYGA 4F55A 1APLC 4L0YB 1BIBA 1TW3A 2W84A 4DZJA 4PSXA 3ZQGA 4L0ZB 3LSJA 1FIPA 2DA7A 3KP7A 1FNNA 1FMVA 1Z67A 3BZ6A 3BC8A 1JUSA 5CLSA 2FMLA 4HA8A 4A0YA 1U3EM 3MKYB 1SFOJ 1XSXA 4KN4X 2IP2A 3S32A 4A3DJ 3L1PA 4UVCA 2H6BA 2VBXA 4KMFA 2UWMA 1GV5A 2K85A 3E5QA 4KIFA 3H9JA 1ETQA 2YU3A 2W00A 1TQPA 4BBSJ 1RPWA 3BT9A 5F1JA 1Z1DA 4C9YA 4AWXB 3L2CA 2CV1A 2E5NA 3LSHA 3S8PA 1VQMI 2CYYA 1FOKA 3ZQIA 5L3EA 3PNVA 1WWXA 3ZN0A 1S7AA 4P1WA 4UVBA 2R7FA 2VKVA 3BG7A 3IRRA 2IAIA 3L7WA 3WU2C 2QSHX 1I6HJ 1X2MA 2FNAA 5HDGA 3ASOH 2MBFA 4UUSB 3MCZA 2W25A 4XLEA 5A2QZ 4MTEA 2WC2A 3H5RA 4HF1A 3HEFA 4ZYEA 3BWGA 4L5EA 2MG4A 4I7HA 4A3CJ 2H1KA 3JAMZ 5KVRA 4JYKA 3HL2A 1PP7U 3KP2A 3NARA 3RZOJ 2Z5UA 1ORKA 2PJPA 3DEUA 3VEPA 2XDVA 3PNTA 3CJRB 2R7VA 1U5TA 1D3YA 1YIJI 3I3LA 1QPMA 3VFZA 1R9TJ 1OCZH 1R5ID 2DA2A 4EV0A 2DDAA 3K1NA 2G7UA 1R00A 5ILUA 2CUZA 1I50J 2K5CA 1LDKB 2RAEA 1G3SA 4KT6A 5E79C 5C3EJ 1E3PA 1IRFA 3ERED 1WVRA 2X0LA 1VQ6I 2DOAA 2KJBA 3IAS2 1YTYA 1K4TA 4N4OB 3HOVJ 3HUGB 1HDPA 3DXJF 4IRGA 3ESWB 3J80K 1MSFC 1PP8F 3K10A 3SQNA 1MBHA 3FIWA 1LEBA 3FXQA 3DPUA 4ZH4F 4F3QA 1DQUA 4KISA 3F9KA 2RGVA 1KQ9A 1G8XA 2HWVA 1F1ZA 4ZTJA 2R5ZA 3J7ZI 3O3KA 1AOYA 1IO2A 2QYOA 1BL0A 1UZCA 3I53A 3AFHA 3ZR8X 3OYLA 4BACA 1MJBA 3Q0WA 3I4PA 1QBJA 3ZOBA 1MGTA 3CD6I 5H2FC 4F7ZA 2P5KA 1MNEA 4BJ6C 1T56A 3FHZA 1K79A 4YFXF 4M3EA 2IVMA 3HC7A 4NQWB 4IRIA 5DYMA 4RGRA 1ZELA 2GXAA 3D0SA 4XRFA 2F6CA 1WJDA 1O3QA 1QHGA 2RKHA 4C2MJ 1JKRC 5LEKA 3MZHA 1B9MA 4HRIA 2BOLA 3E5UA 1DU0A 3TO6A 5BPDA 1YJWI 2ZNYA 4ESFA 2CU7A 1Z3XA 4LB6B 2AO9A 5DM7F 1KU3A 2CRGA 4XLNF 2DT6A 2L02A 1Y0UA 3BY6A 2B0LA 1TQIA 3A4CA 4A0ZA 5CQEA 2QLZA 2FOWA 5LRRA 3GTMJ 3CO6C 3DV8A 1VFCA 5IT3A 4RGXA 3CUQA 1FOYA 2BV6A 4UY8I 3S3NA 3C2HA 1JXSA 2FXAA 4DGWB 2M9HA 3OYHA 3RTRA 4MGRA 4O3MA 1MBKA 2Y0SA 3LSMA 4ABZA 1ETXA 2DT5A 4M6VA 2QENA 1Y39A 4OIQF 3H1CA 3QYEA 3AKZA 3BJ6A 2YUSA 1IN6A 1UG2A 1XMAA 1X3WB 3H5AA 4RAFA 2YSRA 5TRDA 4DQ2A 1YE9A 1R49A 2M4KA 2I8DA 4LB5A 3HPHA 1DGWY 1RI7A 4RB0A 1IV6A 3VWBA 1BR4A 5IP7J 1BC7C 3WTZA 3TEDA 4BHBA 2W4SA 3KLNA 4F93B 2HZTA 2X1EA 2OU2A 1MH4A 1SVMA 3LA2A 4OWRB 4D7NA 2JA8J 5JI6A 5LGNA 1IRGA 2GXBA 1R4NB 4X6AJ 2LLKA 2QBYA 1TWGJ 1YHQI 4GYIA 3JSOA 1TNSA 5K7FA 3QODA 1R6RA 1K83J 1ZTRA 5K5OA 5CYVA 5EYRA 1BC8C 4KDPA 1SANA 1HCRA 2M5WA 3P7NA 4DZPA 2OA4A 2VN2A 3A01A 2DCEA 1STZA 2KPMA 5F27A 2HXOA 3MFKA 1W4MA 2ISZA 4NHJA 3BG6A 2DI3A 3KIOA 2CUFA 3WTWC 4A93J 2M8EA 4BJ5C 4I09A 1ITYA 4ENKA 3GZNB 4WXHA 2OZUA 2KZGA 4M3BA 3TDUC 3GTJJ 2D2WA 2PN6A 4PGGA 1VQPI 3FBNB 4L5JA 3QOPA 1TWAJ 4PJNA 1SAUA 4A69C 2DU9A 3T5XA 3C2BA 1MKMA 1P2FA 3AG1H 2P4WA 4YFNF 5ICEA 3W6KB 3NQOA 2CWEA 2ECCA 4XORA 2K02A 5L3FA 3VYRB 2FQ4A 2KKOA 1N77A 1HW1A 4IQ4A 1OISA 3A1YA 1FT9A 2NOJB 3P9CA 5H6QA 2LKXA 1LFUP 1B72A 4NC6A 1E2XA 1HA8A 1ZG3A 3K4NA 3C18A 4PFOA 2HR3A 5KAFC 2RQQA 3C7JA 5D5XB 4A5NA 2OCEA 5JHUA 3Q0VA 4HX4A 4QSHA 3MKWB 2OBPA 2DA3A 3CMMA 2EV0A 2E2HJ 1ETKA 5FLMJ 4CYDA 2VOPA 4YIIA 1X3UA 4ZDPA 1XSVA 3LFKA 1G2HA 2XASA 1T2KA 5DUKA 1O3TA 3OOUA 1GLNA 2HOAA 3G71I 4C3HJ 3LOCA 1E0EA 2VPRA 1QO0D 3CCRI 2OV7A 2MA3A 5AIQA 2WB1N 1FBSA 2MGQA 1REPC 1HSTA 2A07F 3AAFA 2HKXA 1X1CA 4M3FA 4BJTA 1UFMA 2PBIA 4ZJZA 4RB3C 5F6FA 3A0BC 2DFHA 1O7LA 2HS5A 5GAHJ 1MBEA 3SJMA 1AKHB 4X1EA 3OYAA 1SD6A 2GZWA 1J2XA 2LTPA 2HI3A 1R5HA 2XF6A 3GTLJ 2DN0A 4NB5A 3HGGA 4I0AA 3K4JA 5HLTA 3WE2A 1NG7A 4CCMA 4EGZA 1EH8A 2L0KA 1ZYRF 2E34A 5EJCA 1K61A 1LQ1A 1PVEA 3KYDB 2LRDA 4II3A 4IL6C 3I4NJ 3IH3A 1XDSA 1MJAA 3F8BA 2E2JJ 2A68F 3T1BA 1TWCJ 3H3UA 1F4KA 4HLXA 4HNVA 5CKTA 2V6EA 3I4MJ 3G1LA 2K4BA 1JJ8C 4PDKA 5IYDJ 1BR2A 5TJJA 3HSEA 4ZZLA 2NVQJ 1OKRA 1KONA 2DMPA 4M9ZA 4AM3A 2JA2A 2QA4I 1IZ1A 1UB9A 4RA2A 4C3IJ 2R7WA 1KA8A 1I39A 2BGCA 4MEXF 2AXLA 2WWYA 4JQFA 2VXZA 2VXDA 2BY3A 2FU4A 5ICGA 1V54H 3QU6A 1HW2A 4PJLA 2M4GA 3HKZA 3GF2A 1H88C 5EG0B 2DMQA 2IT0A 1CGPA 4BKXA 4IRHA 4HYEA 3HOUJ 1Y1WJ 4LIUA 3ZMSA 4XIDA 1W0TA 3E0JB 4TV7A 3EUHA 1W5SA 1IGNA 3SZPA 3LQQA 3TBIA 3BTCA 3I59A 1V5EA 2A6TA 5M3MJ 3OIPA 5BS6A 2VE9A 1X1BA 5E3LA 1D5YA 4A3MJ 1ETYA 4BS9A 1T39A 4A5MA 1UHSA 1LPQA 1IV8A 2EILH 3BCAA 3RKYA 4E4HA 2LOOA 1FSHA 3WTSC 2M1BA 1R1VA 3IH2A 2W82A 3PIPF 2L4MA 3WGHA 2K27A 4WK8F 1VI0A 4LLLA 2R5YB 2HVQA 2PMZN 4PJ0C 5JFRA 1GUUA 3CZ6A 3K7AJ 2FF4A 4OIRF 2WADA 2AS5F 1HLVA 1WZ2A 2O0YA 4MNUA 1MZBA 4MTDA 1BJAA 2FBIA 4ZDOA 4BU2A 1X3ZB 2EV5A 2R5ZB 1OPCA 4YELA 1RKWA 2Z2SB 4OU0A 2R92J 3GTQJ 5ILVA 1YX5A 3PFIA 2V1NA 1XCVA 4DOZA 2IA0A 4B1RA 4EJOA 5BMZA 4CH7A 5JLWA 1QHHD 3I55I 3SXYA 4OMYA 4EATA 3GFMA 1YQAA 2E5ZA 5B5EC 4ETSA 2EA4A 3DLAA 4XKCA 5M3FJ 3DPTA 1OCTC 2ACJA 4RS8A 2LNBA 3GLLA 2RN7A 5JR3A 2W57A 2QQ9A 2V26A 5F0HA 2X85A 1SMTA 2EFNA 3FKJA 1YITI 4UNOA 4G7HF 1E3HA 2L7MP 5F0CA 1JGGA 5EF6A 1HKSA 3G1MA 2IPQX 4ESBA 4AIDA 5M5XJ 2DA4A 3HOZJ 1MMDA 3IWFA 1OYWA 4P9UA 2CV0A 4HZFA 3QQAA 2JSPA 4FISA 3AG4H 4Y3OA 5IYCJ 2HQNA 1UAAA 1WPKA 4KIGA 1V4RA 3CJQB 2L7FP 1YFHA 3VB2A 3BPXA 2KIMA 3BR2A 4QWQA 2XROA 1ON1A 3HB9A 3RQIA 4Q47A 2Q2EA 2B7EA 4IHXA 3S14J 2H09A 1BW6A 2DW4A 3L00A 2DXIA 1FEXA 2CSOA 1MMAA 2KZVA 2HDDA 4RLQA 3F6OA 1WJBA 3CC4I 2QQBA 2PFBA 1O3RA 1YW7A 2FEZA 4ZYDA 2R93J 2BHYA 4JX4A 5J6XA 2M30A 1M1EB 5LBQA 2ZXIA 1Y1VJ 1LFPA 2IA1A 3FHNA 3K70C 4FX0A 2EV6A 2L2OA 2E1MC 3I9V2 4NC7A 1QA6A 1FZPB 2QCOA 1FC3A 3HSFA 3LQRA 5JVTA 1CF7B 3MZ8A 3T8TA 5FKNA 2OTJI 1IW7F 3K1PA 2NXNB 3HTUA 4MO7A 1XS9A 1Z21A 4V2GA 3WG9A 1FP2A 3MKLA 3E3VA 1ZR2A 1R58A 3GFLA 4FHTA 4E7JA 5J8FA 2TCTA 3GMEA 3QOEA 2QBYB 3ZGKA 4RB1A 4CYCB 1K7AA 2HVRA 1QQIA 1TNTA 4EM2A 3FMSA 3OMYA 4M74A 3S3OA 3CCYA 3MD2A 3F72A 2Z33A 2BY2A 3V7SA 1YYVA 3Q3SA 4ITVA 2DAOA 1IUYA 1UHWA 1AA7A 1YX3A 4ZDLA 2EZKA 3CTAA 1OCRH 4C2UA 1DP3A 2DA5A 1OQYA 2LDUA 5D5VB 1MDMB 5DEQA 4HAMA 4BQOA 2WA0A 1R1TA 1VQNI 3ABKH 3DLLF 2KRFA 2GOMA 4RDUA 1WQ2A 4MQVA 1IDYA 3SZTA 2V9KA 2VJ4A 2A05A 2BHZA 2ESHA 4I6ZA 3J7AY 3VYUB 4XSXF 5IP9J 2B63J 4Z6YA 4U7BA 1FTZA 3C3WA 3HRTA 1ETOA 4KICA 1V55H 3CCLI 3S1QJ 4BL0B 1PUFB 4A3LJ 1IXRC 2Q1ZB 3DU5A 4EJWA 4FT8A 4BQQA 3M8JA 4GO1A 3FXOA 4A0XA 2VC0A 5FJ8J 1XD7A 2L9RA 3HYIA 2PJRA 3F8MA 2UUZA 2OCCH 3E1SA 4FQGA 4BY7J 1BA5A 5H6RA 4AU7A 2BZTA 3N4MA 1MMNA 1ZG5A 1EKEA 4BXXJ 1USTA 4XQFA 3ZMUA 3IP4B 3TP0A 2CQNA 2M3AA 3H36A 1U9OA 4GYGA 2N8GA 2ELJA 2YR2A 2JQ7A 4EM1A 1WH5A 3BOQA 3S15J 4GCVA 2R7QA 4E7KA 4EEFG 5K1YA 5F04A 4PJJA 1B9NA 3H0GJ 3RYPA 3TW6A 5GTHC 3JRGA 3IHUA 3SZGA 4YRVA 1LE8A 1W7PD 4V2FA 2E60A 2O5RA 3L9FA 5HODA 1Z9CA 3L2VA 2GM4A 1V3FA 2BXYA 3FDYA 1U0JA 4U0YA 2F48A 2L7KA 1W7PA 3GYHX 3SEZA 1TLHB 2CW8A 1DUXC 2BW3A 1ZAOA 5FKOA 1MMGA 2EFWA 4RM3A 3PO3J 1HF0A 2XKOA 3I56I 1XGOA 4CO8A 4BXUA 4DNCA 4CCNA 1MNMC 3KYCB 2HNHA 4Y17A 1UMQA 3P9IA 3R60A 4DYRA 3HRUA 4IPAA 1IN7A 1XGNA 3EQLF 4XOPA 2LF7A 4XLFA 3MQ0A 3PUBA 1SFXA 2LBFA 4A3BJ 1T08B 3UNGC 1FIAA 1T8IA 2R7TA 3HG9A 3LSTA 3I54A 3O6BB 4MHGA 1H8AC 3JTHA 2X51A 2F5VA 2K3PA 2PQ8A 3IAM2 4XSZF 3S1MJ 1ZRFA 3CQZJ 1T38A 3L2UA 3VPRA 2F5FA 4ZYGA 5IT9K 3RSNA 1V5FA 1S8NA 2KIQA 4G6TB 4DYQA 4CCJA 1Z6TA 4G12A 3TGNA 2E1MB 2YPRA 1W36C 4UB6C 2DOFA 1FJLA 2F5DA 3ASNH 2EPFA 2HYFA 4HBLA 1ERDA 1S9HA 3FXUA 2JSCA 4BE0A 3LSPA 1XGSA 2MD0A 4P55A 4D7MA 2X6OA 1YRNB 2NS7A 1XC5A 2GOXB 4GFBA 2X6WA 1O57A 1YS7A 4HX8A 2B9SA 2FQ3A 1EA3A 1T95A 2XAHA 1HXDA 3OYFA 3CUOA 3TL4X 2HQRA 3W2WA 3WU0A 3CCMI 3LA7A 1EH6A 4XNFA 5FGMA 1YJ9I 4G7OF 4XN3A 1D1AA 2RC4A 5K5RA 3G3ZA 2HZDA 1XTAA 3OS0A 2EA2A 2X9DA 3A0HC 5KNLA 4DBRA 3K6GA 2VODA 4BHCA 2A5YB 2DK8A 3IUOA 4MIMA 2VKHA 1ZRCA 2IGMA 1UHMA 2O3FA 2QM3A 1X1DA 5CJ9A 4WX9A 5C4XJ 1I27A 1K4SA 1TBXA 5B1AH 2ME0A 4RM2A 2V9PA 3CCSI 3LNQA 4CXFA 2HTJA 2JRMA 3BR1A 4NDLA 2WV1A 4EMSA 4G6DA 4YEJA 3FX3A 2Z99A 5FKMA 3SDBA 1ZK8A 4BUPA 2IS6A 1JUMA 2ZNZA 2VBZA 2LY9A 4FETA 1G3WA 2FOKA 4CICA 4YG2F 2NRAC 1SEUA 4ZC3A 3RPQA 1WI3A 3PJRA 2BE5F 4OINF 1DU6A 1FMWA 4KNYA 3GVAA 3EUKL 2Y0SN 2Y0MA 4RAGA 5GAEJ 2JVGA 1P7JA 3BZCA 1K6OA 4XN0A 2JVHA 1FBQA 2OJED 2DTZA 4AVZA 2HQAA 4UV9A 4C30A 3BQZA 4BGDA 2K3FA 1VQKI 3J7YJ 3J7AO 2EZLA 5LGUA 4RLFA 5FFXA 2IXSA 3LSIA 1RC9A 3WTTC 2O8KA 3HDDA 2NAZA 1XN7A 2FA5A 1J7KA 2ZC2A 2K4JA 4AVPA 2DA1A 1LDJA 2FRHA 2XGEA 5EEAA 5E8IA 3JRDA 3K69A 4BEHA 3KX2A 2XB5A 2Y2ZA 3G73A 4E7IA 2Q8KA 4LG0B 2CQXA 1R5GA 3R61A 5DD8A 3FXRA 3H9QA 3OYEA 3OIQA 1GVDA 2IJLA 2A3SA 3VSKA 2MLGA 1U5TC 3S16J 4UUVA 3SDGA 1I6XA 4M3GA 5BQTA 2VONA 3OY9A 2OAZA 3CLQA 3DTKA 1YIOA 1RETA 3RCOA 2LYCA 4QIWN 3E6CC 3BROA 5BNGA 5LLQA 1JGSA 2QKMB 3QP6A 3RZDJ 2VE8A 5EEGA 3BG3A 3E5XA 1O3SA 4D1QA 3HHGA 2LFBA 3R0AA 2M34A 2JRTA 2DFEA 3ZMTA 2LVSA 2QVOA 2ZXJA 1HSJA 2OUMA 3L09A 5FKKA 5FB2A 1X1AA 5L3GA 1OYYA 2ZMEA 2ZXWH 2R7ZJ 9ANTA 3FXJA 3R0JA 3HOXJ 1QU3A 4L9VA 1CQTA 3KP3A 4G8XA 4I02A 2QGUA 5EEHA 4S04A 4PFPA 2X6XA 2WAQA 1HOMA 1BJZA 4CSWA 4BE2A 1XPXA 1PJRA 2LY2A 4EVIA 3V4GA 2VC1A 3BTLA 1H0MA 3MAJA 1P7IA 2STWA 4U88A 1R22A 5LD2C 2JJ7A 1MNDA 3Q9SA 2X1CA 2M7BA 3L2QA 1AU7A 1SFUA 1F9NA 4IHYA 2PMUA 1S7OA 3RYRA 3S93A 2E1NA 4RBOA 1EJ9A 4HV5A 1TZLA 5B3SH 2GIVA 3Q0UA 4HSTA 2VQGA 4Q48A 5HNFA 2P0WA 1R36A 4I99C 2XPVA 5IPAA 2WY7Q 4N4NB 5J1RA 2WAEA 3CF5F 4A3GJ 1BBYA 3W2VA 1IXCA 3CMYA 2L01A 4IEJA 2CJJA 1BOBA 5E1XA 2Y9ZA 3F21A 3DEWA 1DDNA 2VJJA 2PJRB 2P6SA 5M5YJ 1A35A 2HFHA 3KP6A 5CVVA 4C3JJ 4O6JA 3V8LA 3W6VA 5HS7A 2HOSA 1OLTA 2L5QA 2V1DA 3NAUA 4S0HB 1TTYA 2E19A 4L9NA 3ZRGA 3CP8A 6PAXA 3V7RA 3PFYA 4DJAA 3GFJA 4FCYA 2GA2A 3OSFA 1TC3C 3I5UA 2EZIA 1A04A 2QZ8A 3JW4A 1JUPA 3HOSA 2PEXA 4YIRX 4A12A 2QEXI 5D8LB 5TISC 3K4KA 4HOBA 4D5FA 4LMYA 3QYFA 4BYYA 2XF7A 1SD7A 3F22A 3RKQA 2IRFG 3TW7A 3CUQC 1BI1A 1QNTA 4IHVA 2G7HA 4AD9A 2PMHA 4CGZA 1R7JA 2ZSIB 4K2EA 2LK2A 1O4XA 4F91B 1S5LC 4UXNA 2V7FA 4W97A 1U6GA 2BW3B 1RIOH 1B8IA 2IGOA 1S3JA 3TMOA 2MH2A 3RDIA 4MQ9F 1VQ5I 3PM1A 1USSA 1HDDC 4M9XA 1QZEA 3VSLA 2XAJA 5HDNA 5DUIA 2ZCWA 2Y30A 3D5LA 4M6YA 3HKZN 3KP4A 5TGTA 1Y0NA 1IJWC 4BXFA 1B4AA 5KK1A 2VJIA 4LK1F 5D5WB 2MH9A 4E7ZA 4IO9F 5DCMA 3K2AA 4II2A 2CFXA 2DLLA 3K9TA 2JA7J 1WJEA 2E2IJ 4KJZA 3HM5A 1K78A 2VOOA 3HRSA 1RUOA 5FRNA 1Y6IA 1X4PA 3DKXA 3KZYA 4XONA 3ISPA 3PIOF 4BNCA 1D1BA 2QF7A 5A2QK 1FYKA 2ZJQF 2HYJA 2DOEA 4OMZA 5FROA 1A6IA 4B8XA 5K7ZA 1YJNI 3O2PE 3JAMK 3D1NI 3KETA 2M87A 1P4XA 4M9SA 3Q9VA 3DF8A 1HW5A 1S6LA 5CVJA 5CQGA 3FXMA 3CDLA 3ZXSA 3WGIA 1D0YA 1U5TB 4XLAA 3CC7I 3OOPA 2XAUA 1SFKA 4FE7A 1F43A 2XHKA 3IC7A 2W85A 3WU1B 4KA4A 2JK3A 1HBXG 1T0FA 4LGWA 2EIMH 2KHMA 1WJCA 2WB1A 3ABLH 3S2WA 5FRMA 2YS9A 2KL4A 4UV8A 2BY0A 3DU6A 4BQNA 1JKOC 5AONA 3H3ZA 2H8RA 3RJPA 4GDFA 3K70D 4HEA2 4Y15A 1DP7P 3UR3C 3LSRA 5CVUA 1ONVA 2RREA 1S29A 4A3EJ 3DWLE 3HXLA 5E8GA 4XRSA 2A61A 1OYIA 1KU2A 1J09A 3ZQCA 3U9GA 3ELKA 1G4DA 2WTEA 1ZKGA 3PSIA 5HLIA 3EYIA 4KFCA 1FLIA 1UJ8A 3W6JB 3MKZA 2DJNA 1P6RA 2O6GE 3U21A 1TWFJ 2NVTJ 2F2EA 4A3IJ 4HF2A 3DBRB 2LF8A 3PNYA 5B66C 4O5VA 3V42A 3J81K 2VPLA 4HDUA 5D6EA 3IL2A 3HBLA 1D5VA 4XICA 1OCCH 2JWTA 3RI4A 4PK4A 5J47A 2Z16A 1FYMA 3TDZC 4JK1X 1XX5A 2W7NA 1QZZA 2CV2A 2M45A 1XGMA 3R4KA 2WBMA 1OR7A 2DBBA 5E17F 1MH3A 3ABUA 2RNJA 4L9JA 3VODA 4FASD 3ULQB 5ED4A 4CZCA 3HTSB 4CZZA 3G2BA 2IS4A 5LEJA 1RNLA 3BR6A 3HUGA 1JTXA 4HLYA 2EINH 3L2WA 1MW7A 2CMPA 2M7AA 4Q4ZF 1QVUA 1X19A 4P96A 4DBQA 4I0BA 4RGSA 3LFUA 1J9IA 5J40A 5D6FA 3FMQA 3GO5A 5ERIA 1NK2P 1IN4A 3O8HA 2OC6A 2R3SA 3J80Z 3G4SI 5FFZA 2VKDA 3BQYA 1IXSB 5ILSA 2DTRA 2YU9J 4LLGF 1O7FA 3W2AA 3HJEA 4X0GA 5F0FA 4XRMA 2E7WA 4OOIA 4J01A 1JT6A 3CCVI 4ESJA 3F23A 2ELKA 2ZBKA 2ID6A 4EM0B 5HLHA 3CUQB 3BTJA 4ENJA 4EJUA 1SFEA 2I10A 3BR5A 3HOWJ 5EZHA 2RQPA 4GRIA 1C0WA 1GHCA 4NQWA 2EQRA 4KUMA 4A3FJ 3DKYA 1TL8A 1UELB 3VYTB 2G0EA 3C1DA 4UB8C 1VQ4I 3EUHC 1MBJA 2W1OA 5FD5A 4HW0A 1U2WA 3WTVC 4ENMA 5JLXA 4L9TA 1SVLA 1A36A 2IGNA 2LKPA 2CH0A 2HDWA 4B47A 1BM9A 5E1ZB 3M8FA 5HOOA 2VKEA 2QWWA 3MZYA 4U0WA 3RIRA 1U8BA 1WJFA 2V9VA 3JRBA 2CS3A 3CJTB 2I5UA 4YFKF 2EK5A 3CO7C 4I01A 3IV5A 2CG4A 1Z7LA 4ASNA 2DMNA 4XM3A 3L2RA 2O7OA 2V1UA 3ECOA 1F36A 2KFDA 5FLXK 3A01B 5CVIA 3DCFA 5J3LA 4HQMA 2DFFA 2O9LA 3ZPLA 4E70A 2DPUA 2L9VA 2HKOA 1KQ8A 2AQFA 4XL9A 1I1GA 2OZ6A 3CDHA 2QSGX 2BY1A 2CW0F 4XKVA 1WJ5A 4BDYA 2K9QA 2FD5A 2Y9YA 2F4OB 2XAQA 2KIUA 2R7XA 3GW2A 2CFOA 1QZYA 1UCRA 3BR3A 5F64A 4KIBA 1LB2A 2JMWA 5IYBJ 2AHQA 2X6YA 3FM5A 2WV0A 1P4WA 1HKTA 4IHTA 3ZQFA 3SEQA 2MYSA 1I5ZA 2Y75A 3FXLA 1SAXA 3E6MA 3RKWA 5D4SA 1B72B 4IKFA 3HOYJ 2CO5A 3EPZA 3IWZA 3H3VK 4B3XA 2CQQA 1N75A 1Y56A 1LKXA 2K40A 2BXZA 3B02A 3CC2I 5FO5A 2Y69H 3HZJA 4CCLA 3PSFA 2DDBA 2TRTA 3DKWA 4QLCU 3OYDA 2KJCA 3GFIA 3SHFA 4L5IA 3CESA 1H9TA 1JI8A 2VT3A 5E3OA 4ENNA 2K86A 3OYMA 4ANJA 3GCMA 2OQGA 3TOBA 3H92A 3FM3A 4RAYA 2EB7A 3OSGA 2F4IA 1LFBA 4IOCF 2PI0A 1WHUA 2EBIA 4H4KC 1N25A 4AUXA 2MW8A 3H0DA 2IGKA 3F8NA 3WHCA 2FUG2 2NVXJ 3REOA 2JPCA 3F8CA 1VQ8I 1KYZA 2XVCA 2KDOA 4IQJA 4XR6A 3WHBA 1P9QC 3B6AA 3WTXC 2R0QC 4HG2A 4QPOA 1ZH5A 1GXQA 1EH7A 2XV4S 2AXTC 2H8WA 1W1WE 2IW5A 3MEXA 2MD5A 3D5RC 5K5QA 2UXXA 2OTLI 5DTDA 2DQRA 2J5PA 5DCMB 4JOMA 1E17A 3BG9A 2BBYA 3PUFA 2P6TA 4BAYA 4YIFA 3BZKA 5E3MA 2XPWA 1HC8A 2XGXA 2GLOA 3S1NJ 2ZKZA 3WTUC 4BDZA 1JKPC 4ZYHA 2UZKA 5GPCA 1GDTA 5E1WA 2XC7A 4AYBA 4A2UA 2JUCA 1ENHA 3I71A 2LKSA 1U9NA 2VUMJ 1S7EA 2BYVE 2ECBA 3QWLA 5DM6F 4XLPF 2DO7A 1Z0XA 4XLHA 3AG2H 4IVNA 1ZLKA 4BY1J 1WKMA 1JHHA 1IRZA 2XGCA 1YW9A 2XAGA 3N97A 2X48A 2H1LA 3DPLC 4M3DA 2TDXA 2M0MA 5JVGF 2GWRA 1A5JA 1PDNC 4LOCA 4WXCA 5FLVA 5IY5H 3ZQLA 4W1UA 2RV8A 1GT0C 2KRHA 4B09A 3UKGA 1AKHA 2V4JC 1WSUA 2EFOA 2H94A 5EGOA 4G6QA 3BP8A 2KISA 3F6VA 2E1OA 3BR0A 3I59B 1KZHA 1XDUA 2CUEA 2DT7B 3M07A 1IUFA 2LH9A 4WF2A 1GV2A 1K6YA 2P5VA 2R7SA 1Z91A 1BOAA 1XG1A 2GBYA 2VBWA 4U0VA 1FOWA 4P5OA 4H0EA 5IOZA 2K7LA 4IZZA 5K7HA 3S2HJ 3OYIA 2XPUA 3JRAA 1G59A 4XOTA 1ON2A 5E20A 4XRSG 1KU7A 5F08A 2M0CA 1ZARA 4BH9A 4IHSA 1LVAA 4CCKA 2VL8A 3BDDA 3KFWX 4V19K 4PJMA 4RGUA 5L3BA 3BLYA 1XB4A 3COAC 5EG0A 2C6YA 3TOAA 3VDXA 2OD5A 1ZRDA 1X2NA 3O8GA 4LK0F 2D45A 1BN5A 4A6EA 4N0BA 3W3CA 3CP2A 2FX0A 3EETA 3CMEI 2HGCA 1EV7A 4LD5A 3R6SA 2BVMA 1TP4A 3GTOJ 3B6CA 2D5VA 3DFGA 3QAHA 3EDPA 1XMXA 2J5OA 2IS1A 1W5TA 2M8GX 4Z2YA 1J5YA 2O03A 4E7LA 4M6XA 2H27A 3SYTA 2ELHA 1DPRA 1LUJB 2R5YA 1FSEA 2EZHA 2RNGA 1T6SA 3M4OJ 2OPTA 2ZFWA 2G9WA 3SFZA 1FOXA 5ICCA 2L3DA 3M8EA 5H20A 1LDDA 3HIFA 3BJOA 2DQLA 4B4CA 2MABA 4KT5C 2XIGA 4KMUX 4XKWA 5LGTA 4NUBA 4PCQA 4N9IA 3MMYB 2QUFA 4PZJA 4HDVA 2LREA 3MN2A 4ON0A 4ZZDA 3GTGJ 3PQJA 2L54A 3OYNA 2CGPA 2R7OA 3VOEA 1RKTA 3TO9A 2LSOA 4RAZA 2Q2EB 3BG5A 3H35A 2IS2A 5LHGA 3J81Z 1SC7A 1A31A 5BOXA 2NNNA 2VB6A 3KCCA 3GBGA 4XKBA 1IAWA 1DGRM 1NG6A 1KU9A 2WAQN 2JT1A 3QU3A 4RB2C 4C2TA 2ZB9A 5J4VA 1POGA 4AIJA 3EYYA 1T98A 1BI3A 3KP5A 5IP6A 3DP7A 3K4LA 3KEQA 2HPMA 5GTIC 2F5EA 3K1MA 2P5LC 4B44A 3JRHA 1TQMA 2JPBA 4J19A 5IOYA 2KQRA 1RR7A 2V79A 2R4GA 2HOTA 2YX4A 1RESA 1W0UA 4KYWA 2DK5A 4OIOF 5E18F 3QRFF 1FY7A 3FISA 3HHHA 3LSKA 4QTRA 2PG4A 4M72A 5LHIA 5GPAA 2HU9A 3OS2A 3KLOA 1JTYA 3CCJI 3CCUI 1FPQA 4JP0A 1G6NA 2AQEA 2HTSA 4JBAA 4KITB 4G94A 4UUTA 1PYVA 1IF1A 5DDGA 1OMIA 2Y31A 4A3KJ 2JA6J 1N78A 3AL0C 4OAYA 3DQVC 4MFDA 3GUDA 2DMTA 4XK4A 5J1UA 3OR2C 2CQ7A 4PSWA 1BI2A 1FTTA 2YX7A 5HNHA 3U1DA 1CF7A 2OF7A 3KZIC 4Y4RA 2O61A 2L7ZA 2XF5A 3WG7H 3NRVA 3QP5A 1YI2I 2HDCA 2RDPA 5HDKA 2XB0X 4L18B 4B3AA 3OWTA 4F92B 5F1RA 3U2RA 1D1CA 4AIHA 2P7CB 1OFCX 2KP6A 2NNYA 3JRCA 2COMA 2VQLA 1B59A 1JKQC 2R7RA 1SVOA 4CYCA 1L3LA 4LLNA 4LIVA 4P9FA 3WTYC 5DCFA 2EJRA 2A5WA 2L9NA 2VI6A 2VJ5A 3ZMDA 2JTVA 4D0PA 2NVYJ 5GP9A 3S2DJ 2CW7A 3RKXA 3E6DA 1QVTA 3JREA 5L3CA 2D1HA 3JCUC 3T0YA 5J4YA 1IC8A 4JX5A 1MDMA 1FX7A 5D5UB 5FLXZ 4HV6A 4FX4A 1ZQ3P 2IEKA 5DD4A 4CUGA 4IX7A 1XSDA 2LR8A 1X1PA 2EIJH 3RPUD 4CCOA 5LRSA 2GA1A 3H9GA 1WFXA 3OYCA 3BJAA 3I0TA 3OYBA 3KZZA 3JR9A 4Y13A 1D8KA 3RPUA 3S1RJ 3N05A 1JJ6C 1LE8B 3ZMZA 1PUFA 3CLOA 4AIKA 4WCGA 1NK3P 4GXOA 2UXNA 1L0OC 1FWZA 2P7VB 3K4BA 1W7PB 2HPIA 3GX4X 1IN8A 2QQ8A 4ZTFA 4DIQA 3M1EA 3ML6A 1XMKA 2D1VA 1FYLA 1D0XA 3K2ZA 2K9NA 4D9JA 3BTIA 4R8HA 1Z3YA 2XRNA 3OV8A 1E3OC 2FMYA 1G3TA 1MJ9A 3DTIA 4EJVA 4UHTA 1RZ4A 3G6EI 4OIPF 5KHDA 3KPHA 5B1BH 3G1OA 5FKLA 4I2OA 2KLOA 2W48A 3ZQQA 4I76A 2MC3A 2ZMEC 2LG4A 1ETWA 2EFQA 1LNWA 1NTCA 3OL4A 3GTKJ 2LBFB 2K9MA 3QYBA 1ZLJA 2E71A 2ZO4A 2NYXA 1JE8A 1ETVA 2KMUA 2FNPA 3F8FA 3BCBA 3KEYA 4LG3A 5JHFA 2MLKA 3ZN1A 3LL7A 1ZHFA 4A6DA 1TW2A 3DEEA 1MSEC 2Z1DA 3FK7A 1WJAA 4XLCA 3JTGA 3EUAA 5EGOB 2M2EA 4HPQA 1FBUA 1WRJA 4Q5SF 3GLXA 3FF5A 2DODA 3FK6A 1YS6A 5J8CA 3I64A 1OCOH 4M73A 5AIPA 2ICWG 3E6BA 4G9YA 1J75A 1HKQA 2Z3YA 2QKLB 1H89C 2GXGA 3SFIA 3FXKA 3FBIB 3M9AA 2GQQA 4MEYF 3S3MA 3DTEA 1ZR4A 1YG2A 1ZGAA 3HSRA 3CJNA 4HNUA 4HF0A 1U8RA 3DBLB 3TQNA 2HEOA 4JX6A 3GZ6A 4WXDA 1ZG1A 2ETHA 1OJLA 3D5SC 3GXOA 3KE2A 4GGGA 2Y48A 3OYJA 4IOAF 1VQ9I 2K9SA 3M1CA 2FE3A 4UUSA 1X4OA 2DYRH 2DA6A 1P92A 3AL0B 2JN6A 1KGSA 1I3AA 1Y8QB 2JA5J 5IT9Z 1Z7UA 5ICFA 2XSJC 4KN7X 1Z6RA 3TP3A 4N9HA 3WODF 2ZXHA 5GADJ 1Z77A 2L9SA 2E35A 1SD4A 4I98B 2NVUB 1VQ7I 1YRNA 2BEOA 4B48A 3K4MA 1BR1A 3GEZA 2ZJ2A 5C44J 5EZGA 1IDZA 3JRFA 1ULYA 4M71A 1B1BA 2WY8Q 2HXIA 3ECHA 1I1SA 1ZGJA 3X2QH 3KEOA 3HPGA 3CF2A 4LJZF 3HGYA 1LJ9A 1Z05A 4NBQA 3OIOA 2DMUA 3LSGA 1IN5A 2LP0A 5KCMA 5D8KB 2HYGD 2QQAA 2A6HF 4HX7A 4E6KG 4BE1A 2NS8A 1TT5B 2GAUA 2W24A 2ID3A 4Y52J 3GTPJ 3ZP5A 1YOVB 3LA3A 4HSRA 2F4MB 1W5CC 3VYSB 3GZ5A 2E36A 2WAFA 1AWCA 1R71A 3PL8A 2ZFUA 4Y7NJ 2ZJPF 5LFAA 2PLYA 3CCQI 1IRXA 4FE4A 2VQCA 4BEHB 3IKVA 2E1CA 4IJAA 1KQ0A 2PMZA 2PX9A 3A02A 2R7UA 1J59A 1VF9A 1VQOI 2IA2A 1MIJA 3IRQA 2VBYA 3QPSA 1ODDA 3QPHA 5HS9A 4UVAA 5KAIC 2FBKA 3AG3H 4DYCA 2LMDA 2OQRA 2XAFA 3MVPA 1V5GA 4EGYA 1GVJA 1ZREA 3CCEI 3HRMA 2HVSA 4A3JJ 3ERMA 5C4JJ 1SMYF 4E7SA 1IG7A 1T0FC 4HNTA 2STTA 3FWEA 1R23A 3MWMA 2VLAA 2DYSH 2A6EF 4S05A 3GWZA 5BPIA 2ISYA 1Q1HA 2X4HA 1NHAA 3IH4A 3OS1A 4BBRJ 5J1YA 5E3NA 2HOEA 2FBHA
chains in the Genus database with same CATH topology
4MLOA 2LY1A 3VSKA 3K4JA 5HLTA 4CCMA 1NG7A 3A2KA 2LC2A 3H5NA 3DPLC 3NWTA 1TT0A 3OY9A 3DTKA 2M0MA 3RCOA 2LRDA 4II3A 2LYCA 3KYLA 2KRCA 2QKMB 4D1QA 3RQ4A 2V6EA 5CKTA 2KRHA 2V4JC 3OL3A 3OR1C 1LVKA 4XMYA 1BR2A 2OUMA 1KONA 1X1AA 2DJIA 2JA2A 2DT7B 2R7WA 1QU3A 2LH9A 2R7SA 1K6YA 4JQFA 2VXZA 2VXDA 4B43A 3ZCOA 4PFPA 2X6XA 2WAQA 4PJLA 4P5OA 2M4GA 3HKZA 4IZZA 4CSWA 3OYIA 4LIUA 4BE2A 1PJRA 2LY2A 1G59A 3E0JB 3HOTA 4XOTA 1OR7C 3TBIA 5LD2C 1V5EA 1MNDA 2A6TA 2X1CA 2M7BA 3L2QA 2X1DA 1VZ0A 3OIPA 4CCKA 2VL8A 1X1BA 3S93A 4BS9A 1TZLA 4F52A 2VQHA 4PJMA 4HSTA 2VQGA 3BCAA 4E4HA 2LOOA 5HNFA 2P0WA 3BLYA 4U87A 4Y33A 4NNJA 3VDXA 2W82A 2WY7Q 4N4NB 5HVQC 2WAEA 4RMNA 3NWSA 2HVQA 2UV1A 3W2VA 3CZ6A 2WADA 3W3CA 3CP2A 1W36D 1BOBA 2VJJA 2PJRB 2BVMA 4ZDOA 4BU2A 4YELA 2Z2SB 1OLTA 1YX5A 2L5QA 2MC4A 2IS1A 2V1NA 4E7LA 3ZRGA 4DOZA 3SYTA 3CP8A 4J00A 2VIXA 4CH7A 2RNGA 4R79A 1QHHD 3PFYA 4DJAA 2ZSHB 4EATA 2E5ZA 4NC8A 3DLAA 1D0ZA 4XKCA 1UG0A 3HOSA 3DPTA 2MFZA 3K4CA 2MABA 5CPRB 4XKWA 3LMMA 3ONQA 3K4KA 4NUBA 3MMYB 3QYFA 2V26A 2VASA 2K9LA 2X85A 2XF7A 2JUGA 3C2GA 3FKJA 2LREA 4QPQA 4E7HA 2BVLA 2ZSIB 4CA0A 4F91B 4ZYAA 3OYNA 2R7OA 2Q2EB 2V7FA 3H35A 2IS2A 1MMDA 2BW3B 2IGOA 3TMOA 2CV0A 2CUJA 2JSPA 4Y3OA 4PUSA 2VB6A 3GBGA 1UAAA 3OYKA 4XKBA 3VSLA 1DGRM 1NG6A 3CJQB 4LITA 3D5LA 3OYGA 4C2TA 4F55A 5TGTA 4BXFA 4PSXA 2VJIA 4E7ZA 3K4LA 4II2A 2HPMA 2DXIA 1FMVA 1MMAA 2KZVA 1WJEA 4RLQA 3BC8A 4KJZA 1WJBA 4B44A 3MKYB 5FRNA 2KQRA 1Y6IA 1X4PA 3DKXA 3S32A 2R4GA 4XONA 2UWMA 1D1BA 2ZXIA 3H9JA 1LFPA 3FHNA 5FROA 2W00A 3K70C 3LSKA 2L2OA 4C9YA 2E1MC 2CV1A 2HU9A 3I9V2 4NC7A 3OS2A 2E5NA 3LSHA 3S8PA 2AQEA 3PNVA 4KITB 1Z21A 4P1WA 1PYVA 3BG7A 5CQGA 3ZXSA 1D0YA 4XLAA 1N78A 4E7JA 4OAYA 3DQVC 3AL0C 2XAUA 1SFKA 3QOEA 3ZGKA 3OR2C 2HVRA 4PSWA 4XLEA 3OMYA 5HNHA 3S3OA 3MD2A 3H5RA 4Y4RA 2KHMA 2XF5A 1WJCA 4ITVA 2WB1A 5FRMA 1AA7A 1YX3A 3HL2A 2KL4A 4ZDLA 2XDVA 3DU6A 3PNTA 4BQNA 4C2UA 1DP3A 3CJRB 3OWTA 4F92B 2R7VA 4XLHA 1D1CA 3I3LA 2KP6A 3K70D 4HEA2 4BQOA 2VQLA 2WA0A 3UR3C 2R7RA 2RREA 2GOMA 4LIVA 3DWLE 3HXLA 2A5WA 2L9NA 1J09A 2CUZA 2VJ5A 2K5CA 2V9KA 1LDKB 2VJ4A 3J7AY 4KT6A 2CW7A 3VYUB 3PSIA 4U7BA 3MKZA 3U21A 4BL0B 3PNYA 2Q1ZB 2DOAA 3DU5A 3IAS2 3V42A 2VPLA 4BQQA 4N4OB 4CUGA 3M8JA 4IX7A 3HUGB 4PK4A 2Z16A 2W7NA 3RPUD 2CV2A 3K10A 4CCOA 3DPUA 2PJRA 3H9GA 1WFXA 3OYCA 2WBMA 4F3QA 2UUZA 1DQUA 3E1SA 3F9KA 3OYBA 4KISA 1G8XA 4AU7A 4ZTJA 4FASD 1MMNA 4CZCA 3N05A 4XQFA 3G2BA 2IS4A 3IP4B 3OYEA 2M3AA 3AFHA 3ZR8X 3OYLA 3L2WA 4BACA 2ELJA 1MW7A 3K4BA 2CMPA 2M7AA 2HPIA 1X19A 4DBQA 4ZTFA 4DIQA 3LFUA 2R7QA 4E7KA 1D0XA 1MNEA 4BJ6C 4D9JA 4PJJA 1Z3YA 2OC6A 3HC7A 4NQWB 2VKDA 3SZGA 4YRVA 1ZELA 3DTIA 3W2AA 4X0GA 4J01A 5KHDA 2F6CA 1WJDA 1QHGA 2E60A 2O5RA 2KLOA 3ZQQA 3L2VA 4HRIA 3FDYA 1U0JA 2LG4A 2BOLA 2L7KA 3OL4A 3SEZA 2CW8A 2K9MA 2LBFB 3QYBA 2BW3A 1Z3XA 1MMGA 4GRIA 4RM3A 2KMUA 3KEYA 4LG3A 3BCBA 5JHFA 2DT6A 4CCNA 3DKYA 3LL7A 1UELB 3VYTB 2HNHA 3A4CA 3DEEA 5CQEA 3EUHC 2Z1DA 2W1OA 1WJAA 4XLCA 3EUAA 4XOPA 4XLFA 3S3NA 3C2HA 3PUBA 2LBFA 4DGWB 4HPQA 3OYHA 3UNGC 3RTRA 2R7TA 2IGNA 3HG9A 2Y0SA 2CH0A 3LSMA 2HDWA 2X51A 2F5VA 4B47A 2K3PA 3IAM2 5HOOA 3QYEA 3AKZA 1WJFA 3L2UA 2QKLB 2CS3A 3H5AA 3FBIB 3RSNA 1V5FA 3S3MA 4G6TB 1YE9A 1Z7LA 3DTEA 2M4KA 4XM3A 3L2RA 2I8DA 3HPHA 1DGWY 4CCJA 3VWBA 1BR4A 2E1MB 1W36C 4HNUA 2W4SA 4F93B 2X1EA 4OWRB 3D5SC 1ERDA 1S9HA 2AQFA 4XL9A 3OYJA 4BE0A 3M1CA 2MD0A 4XKVA 1WJ5A 1X4OA 3QODA 4BDYA 1R6RA 3AL0B 2GOXB 2X6WA 1EA3A 1T95A 3OYFA 2XSJC 3TL4X 2R7XA 2CFOA 2DCEA 2KPMA 3W2WA 4XNFA 4XN3A 1D1AA 2ZXHA 2X6YA 2HZDA 3BG6A 2L9SA 3OS0A 4BJ5C 5KNLA 4DBRA 3K6GA 3SEQA 2MYSA 3IUOA 4IKFA 3EPZA 2VKHA 2IGMA 4B48A 3K4MA 1BR1A 1X1DA 3FBNB 4B3XA 1N75A 1Y56A 1LKXA 4PJNA 1SAUA 2WY8Q 4RM2A 4CCLA 3PSFA 3OYDA 3HPGA 3CF2A 4XORA 3CESA 3VYRB 3LSGA 1N77A 1JI8A 4YEJA 4IQ4A 5KCMA 4ANJA 3OYMA 4BE1A 3A1YA 4E6KG 3SDBA 2NOJB 4BUPA 2IS6A 2F4IA 1HA8A 3K4NA 4FETA 4PFOA 4H4KC 4ZC3A 4HSRA 3VYSB 3PJRA 3H0DA 2RQQA 2IGKA 2WAFA 2FUG2 1FMWA 3PL8A 3MKWB 2ZFUA 3CMMA 3EUKL 2JVGA 2KDOA 4IQJA 4XR6A 5LFAA 1P9QC 4HG2A 4QPOA 1IRXA 4XN0A 2JVHA 4ZDPA 2VQCA 4BEHB 4AVZA 3D5RC 2HQAA 4C30A 4BGDA 2PMZA 3OOUA 1GLNA 2R7UA 4RLFA 4JOMA 2IXSA 1E0EA 3LSIA 2OV7A 1V5GA 2HVSA 1X1CA 4BJTA 4BDZA 4E7SA 1T0FC 4ZJZA 4HNTA 4BEHA 2VLAA 3KX2A 2XC7A 4AYBA 4E7IA 3OS1A 3OYAA 3H9QA 4OAZA 2XF6A 3OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZD A; 
#chains in the Genus database with same CATH topology
 4MLO A;  3ABT A;  2MSY A;  2LY1 A;  2NOG A;  2XKP A;  4EQQ A;  3A2K A;  2ZME B;  2ADU A;  1PUE E;  1X58 A;  1BI0 A;  2LC2 A;  1GXP A;  3H5N A;  3NWT A;  1TT0 A;  1EF4 A;  2XGD A;  3ABM H;  3LAP A;  1MD0 A;  3KYL A;  1I3Q J;  3WGG A;  5CVR A;  1R1U A;  2KRC A;  1YW8 A;  4LG0 A;  3S17 J;  3FMR A;  3RQ4 A;  3I58 A;  1NH3 A;  3OL3 A;  3IKT A;  2CQK A;  3OR1 C;  4R1H A;  2V1X A;  1LVK A;  4XMY A;  5HS8 A;  3PO2 J;  4BHP A;  1S72 I;  3A03 A;  1RR8 C;  2Z9O A;  3T8R A;  2IBD A;  2DJI A;  3TO7 A;  1FP1 D;  4D5C A;  2L4A A;  1WI9 A;  4B43 A;  1XCB A;  3LAJ A;  3ZCO A;  4LFU A;  2COB A;  5EDN A;  3F3X A;  1JHF A;  3K0L A;  2QSF X;  1YLF A;  1RRJ A;  2E7X A;  5LHH A;  3HOT A;  4OAZ A;  1OR7 C;  3M7G A;  3E97 A;  2ME6 A;  4FTH A;  1QGP A;  2X1D A;  1VND A;  1VZ0 A;  5GAG J;  1ZN2 A;  3FKI J;  1MBG A;  1AHD P;  4F52 A;  2HQ5 A;  2VQH A;  2VT2 A;  3P5J A;  1RUN A;  1J0R A;  4U87 A;  4Y33 A;  1Y8R B;  4NNJ A;  2XUB A;  5HVQ C;  3NEU A;  3NWS A;  4RMN A;  5L3D A;  2UV1 A;  1D8J A;  2GIZ A;  3QPT A;  4IXA A;  3V7C A;  3CMA I;  1W36 D;  2ESN A;  3V8K A;  2KDZ A;  3JSP A;  2P81 A;  4AC0 A;  1B6A A;  1U78 A;  3WE3 A;  1ACI A;  2KT0 A;  3E7L A;  3JRI A;  1A6Q A;  5M5W J;  4HQE A;  4CHU A;  3PQK A;  2MC4 A;  3QPL A;  4WWC A;  1KYW A;  4AYB N;  3DBH B;  1ZGW A;  4U7D A;  4J00 A;  3M3Y J;  2VIX A;  2P8T A;  4R79 A;  2ZJR F;  2ZSH B;  2F5C A;  3B73 A;  1OCP A;  2V6C A;  1LEA A;  1WGX A;  3FZV A;  5DV5 A;  2H6C A;  1YO5 C;  4CDG A;  1QPI A;  4NC8 A;  2RVC A;  1D0Z A;  1H9G A;  1B8I B;  1UG0 A;  2FJ1 A;  2EFP A;  2MFZ A;  3K4C A;  1T33 A;  1VQL I;  5CPR B;  3LMM A;  3ONQ A;  4PGH A;  2Q0O A;  1JT0 A;  5FD6 A;  2VAS A;  2K9L A;  2O8X A;  2JUG A;  3C2G A;  2EIK H;  3CDI A;  4QPQ A;  3ZMV A;  3TKY A;  4E7H A;  3LWF A;  2BVL A;  4CA0 A;  2XSD C;  2XRL A;  3ZQ7 A;  4ZYA A;  2LD5 A;  1DPU A;  4IF4 A;  2A69 F;  4EJT A;  3ROU A;  4XBF A;  1G3Y A;  3BPV A;  2DFI A;  1R4M B;  3V8J A;  1MMS A;  1BW5 A;  1TWH J;  2KIF A;  2NS0 A;  1Q1V A;  2EWN A;  2R7D A;  2CUJ A;  1K78 B;  5DS9 A;  1WH7 A;  4MFE A;  1SD5 A;  2FSW A;  3U1K A;  4PUS A;  3Q5F A;  3P9K A;  5D4R A;  3F0C A;  3ZQH A;  1F5T A;  2DPD A;  1VTN C;  3OYK A;  4BQA A;  1P4A A;  1MBF A;  4IHW A;  2EH3 A;  2JZY A;  1BIA A;  1WCM J;  4LIT A;  5HLG A;  1HQC A;  4G7Z F;  1QRY A;  4DW6 A;  3OYG A;  4F55 A;  1APL C;  4L0Y B;  1BIB A;  1TW3 A;  2W84 A;  4DZJ A;  4PSX A;  3ZQG A;  4L0Z B;  3LSJ A;  1FIP A;  2DA7 A;  3KP7 A;  1FNN A;  1FMV A;  1Z67 A;  3BZ6 A;  3BC8 A;  1JUS A;  5CLS A;  2FML A;  4HA8 A;  4A0Y A;  1U3E M;  3MKY B;  1SFO J;  1XSX A;  4KN4 X;  2IP2 A;  3S32 A;  4A3D J;  3L1P A;  4UVC A;  2H6B A;  2VBX A;  4KMF A;  2UWM A;  1GV5 A;  2K85 A;  3E5Q A;  4KIF A;  3H9J A;  1ETQ A;  2YU3 A;  2W00 A;  1TQP A;  4BBS J;  1RPW A;  3BT9 A;  5F1J A;  1Z1D A;  4C9Y A;  4AWX B;  3L2C A;  2CV1 A;  2E5N A;  3LSH A;  3S8P A;  1VQM I;  2CYY A;  1FOK A;  3ZQI A;  5L3E A;  3PNV A;  1WWX A;  3ZN0 A;  1S7A A;  4P1W A;  4UVB A;  2R7F A;  2VKV A;  3BG7 A;  3IRR A;  2IAI A;  3L7W A;  3WU2 C;  2QSH X;  1I6H J;  1X2M A;  2FNA A;  5HDG A;  3ASO H;  2MBF A;  4UUS B;  3MCZ A;  2W25 A;  4XLE A;  5A2Q Z;  4MTE A;  2WC2 A;  3H5R A;  4HF1 A;  3HEF A;  4ZYE A;  3BWG A;  4L5E A;  2MG4 A;  4I7H A;  4A3C J;  2H1K A;  3JAM Z;  5KVR A;  4JYK A;  3HL2 A;  1PP7 U;  3KP2 A;  3NAR A;  3RZO J;  2Z5U A;  1ORK A;  2PJP A;  3DEU A;  3VEP A;  2XDV A;  3PNT A;  3CJR B;  2R7V A;  1U5T A;  1D3Y A;  1YIJ I;  3I3L A;  1QPM A;  3VFZ A;  1R9T J;  1OCZ H;  1R5I D;  2DA2 A;  4EV0 A;  2DDA A;  3K1N A;  2G7U A;  1R00 A;  5ILU A;  2CUZ A;  1I50 J;  2K5C A;  1LDK B;  2RAE A;  1G3S A;  4KT6 A;  5E79 C;  5C3E J;  1E3P A;  1IRF A;  3ERE D;  1WVR A;  2X0L A;  1VQ6 I;  2DOA A;  2KJB A;  3IAS 2;  1YTY A;  1K4T A;  4N4O B;  3HOV J;  3HUG B;  1HDP A;  3DXJ F;  4IRG A;  3ESW B;  3J80 K;  1MSF C;  1PP8 F;  3K10 A;  3SQN A;  1MBH A;  3FIW A;  1LEB A;  3FXQ A;  3DPU A;  4ZH4 F;  4F3Q A;  1DQU A;  4KIS A;  3F9K A;  2RGV A;  1KQ9 A;  1G8X A;  2HWV A;  1F1Z A;  4ZTJ A;  2R5Z A;  3J7Z I;  3O3K A;  1AOY A;  1IO2 A;  2QYO A;  1BL0 A;  1UZC A;  3I53 A;  3AFH A;  3ZR8 X;  3OYL A;  4BAC A;  1MJB A;  3Q0W A;  3I4P A;  1QBJ A;  3ZOB A;  1MGT A;  3CD6 I;  5H2F C;  4F7Z A;  2P5K A;  1MNE A;  4BJ6 C;  1T56 A;  3FHZ A;  1K79 A;  4YFX F;  4M3E A;  2IVM A;  3HC7 A;  4NQW B;  4IRI A;  5DYM A;  4RGR A;  1ZEL A;  2GXA A;  3D0S A;  4XRF A;  2F6C A;  1WJD A;  1O3Q A;  1QHG A;  2RKH A;  4C2M J;  1JKR C;  5LEK A;  3MZH A;  1B9M A;  4HRI A;  2BOL A;  3E5U A;  1DU0 A;  3TO6 A;  5BPD A;  1YJW I;  2ZNY A;  4ESF A;  2CU7 A;  1Z3X A;  4LB6 B;  2AO9 A;  5DM7 F;  1KU3 A;  2CRG A;  4XLN F;  2DT6 A;  2L02 A;  1Y0U A;  3BY6 A;  2B0L A;  1TQI A;  3A4C A;  4A0Z A;  5CQE A;  2QLZ A;  2FOW A;  5LRR A;  3GTM J;  3CO6 C;  3DV8 A;  1VFC A;  5IT3 A;  4RGX A;  3CUQ A;  1FOY A;  2BV6 A;  4UY8 I;  3S3N A;  3C2H A;  1JXS A;  2FXA A;  4DGW B;  2M9H A;  3OYH A;  3RTR A;  4MGR A;  4O3M A;  1MBK A;  2Y0S A;  3LSM A;  4ABZ A;  1ETX A;  2DT5 A;  4M6V A;  2QEN A;  1Y39 A;  4OIQ F;  3H1C A;  3QYE A;  3AKZ A;  3BJ6 A;  2YUS A;  1IN6 A;  1UG2 A;  1XMA A;  1X3W B;  3H5A A;  4RAF A;  2YSR A;  5TRD A;  4DQ2 A;  1YE9 A;  1R49 A;  2M4K A;  2I8D A;  4LB5 A;  3HPH A;  1DGW Y;  1RI7 A;  4RB0 A;  1IV6 A;  3VWB A;  1BR4 A;  5IP7 J;  1BC7 C;  3WTZ A;  3TED A;  4BHB A;  2W4S A;  3KLN A;  4F93 B;  2HZT A;  2X1E A;  2OU2 A;  1MH4 A;  1SVM A;  3LA2 A;  4OWR B;  4D7N A;  2JA8 J;  5JI6 A;  5LGN A;  1IRG A;  2GXB A;  1R4N B;  4X6A J;  2LLK A;  2QBY A;  1TWG J;  1YHQ I;  4GYI A;  3JSO A;  1TNS A;  5K7F A;  3QOD A;  1R6R A;  1K83 J;  1ZTR A;  5K5O A;  5CYV A;  5EYR A;  1BC8 C;  4KDP A;  1SAN A;  1HCR A;  2M5W A;  3P7N A;  4DZP A;  2OA4 A;  2VN2 A;  3A01 A;  2DCE A;  1STZ A;  2KPM A;  5F27 A;  2HXO A;  3MFK A;  1W4M A;  2ISZ A;  4NHJ A;  3BG6 A;  2DI3 A;  3KIO A;  2CUF A;  3WTW C;  4A93 J;  2M8E A;  4BJ5 C;  4I09 A;  1ITY A;  4ENK A;  3GZN B;  4WXH A;  2OZU A;  2KZG A;  4M3B A;  3TDU C;  3GTJ J;  2D2W A;  2PN6 A;  4PGG A;  1VQP I;  3FBN B;  4L5J A;  3QOP A;  1TWA J;  4PJN A;  1SAU A;  4A69 C;  2DU9 A;  3T5X A;  3C2B A;  1MKM A;  1P2F A;  3AG1 H;  2P4W A;  4YFN F;  5ICE A;  3W6K B;  3NQO A;  2CWE A;  2ECC A;  4XOR A;  2K02 A;  5L3F A;  3VYR B;  2FQ4 A;  2KKO A;  1N77 A;  1HW1 A;  4IQ4 A;  1OIS A;  3A1Y A;  1FT9 A;  2NOJ B;  3P9C A;  5H6Q A;  2LKX A;  1LFU P;  1B72 A;  4NC6 A;  1E2X A;  1HA8 A;  1ZG3 A;  3K4N A;  3C18 A;  4PFO A;  2HR3 A;  5KAF C;  2RQQ A;  3C7J A;  5D5X B;  4A5N A;  2OCE A;  5JHU A;  3Q0V A;  4HX4 A;  4QSH A;  3MKW B;  2OBP A;  2DA3 A;  3CMM A;  2EV0 A;  2E2H J;  1ETK A;  5FLM J;  4CYD A;  2VOP A;  4YII A;  1X3U A;  4ZDP A;  1XSV A;  3LFK A;  1G2H A;  2XAS A;  1T2K A;  5DUK A;  1O3T A;  3OOU A;  1GLN A;  2HOA A;  3G71 I;  4C3H J;  3LOC A;  1E0E A;  2VPR A;  1QO0 D;  3CCR I;  2OV7 A;  2MA3 A;  5AIQ A;  2WB1 N;  1FBS A;  2MGQ A;  1REP C;  1HST A;  2A07 F;  3AAF A;  2HKX A;  1X1C A;  4M3F A;  4BJT A;  1UFM A;  2PBI A;  4ZJZ A;  4RB3 C;  5F6F A;  3A0B C;  2DFH A;  1O7L A;  2HS5 A;  5GAH J;  1MBE A;  3SJM A;  1AKH B;  4X1E A;  3OYA A;  1SD6 A;  2GZW A;  1J2X A;  2LTP A;  2HI3 A;  1R5H A;  2XF6 A;  3GTL J;  2DN0 A;  4NB5 A;  3HGG A;  4I0A A;  3K4J A;  5HLT A;  3WE2 A;  1NG7 A;  4CCM A;  4EGZ A;  1EH8 A;  2L0K A;  1ZYR F;  2E34 A;  5EJC A;  1K61 A;  1LQ1 A;  1PVE A;  3KYD B;  2LRD A;  4II3 A;  4IL6 C;  3I4N J;  3IH3 A;  1XDS A;  1MJA A;  3F8B A;  2E2J J;  2A68 F;  3T1B A;  1TWC J;  3H3U A;  1F4K A;  4HLX A;  4HNV A;  5CKT A;  2V6E A;  3I4M J;  3G1L A;  2K4B A;  1JJ8 C;  4PDK A;  5IYD J;  1BR2 A;  5TJJ A;  3HSE A;  4ZZL A;  2NVQ J;  1OKR A;  1KON A;  2DMP A;  4M9Z A;  4AM3 A;  2JA2 A;  2QA4 I;  1IZ1 A;  1UB9 A;  4RA2 A;  4C3I J;  2R7W A;  1KA8 A;  1I39 A;  2BGC A;  4MEX F;  2AXL A;  2WWY A;  4JQF A;  2VXZ A;  2VXD A;  2BY3 A;  2FU4 A;  5ICG A;  1V54 H;  3QU6 A;  1HW2 A;  4PJL A;  2M4G A;  3HKZ A;  3GF2 A;  1H88 C;  5EG0 B;  2DMQ A;  2IT0 A;  1CGP A;  4BKX A;  4IRH A;  4HYE A;  3HOU J;  1Y1W J;  4LIU A;  3ZMS A;  4XID A;  1W0T A;  3E0J B;  4TV7 A;  3EUH A;  1W5S A;  1IGN A;  3SZP A;  3LQQ A;  3TBI A;  3BTC A;  3I59 A;  1V5E A;  2A6T A;  5M3M J;  3OIP A;  5BS6 A;  2VE9 A;  1X1B A;  5E3L A;  1D5Y A;  4A3M J;  1ETY A;  4BS9 A;  1T39 A;  4A5M A;  1UHS A;  1LPQ A;  1IV8 A;  2EIL H;  3BCA A;  3RKY A;  4E4H A;  2LOO A;  1FSH A;  3WTS C;  2M1B A;  1R1V A;  3IH2 A;  2W82 A;  3PIP F;  2L4M A;  3WGH A;  2K27 A;  4WK8 F;  1VI0 A;  4LLL A;  2R5Y B;  2HVQ A;  2PMZ N;  4PJ0 C;  5JFR A;  1GUU A;  3CZ6 A;  3K7A J;  2FF4 A;  4OIR F;  2WAD A;  2AS5 F;  1HLV A;  1WZ2 A;  2O0Y A;  4MNU A;  1MZB A;  4MTD A;  1BJA A;  2FBI A;  4ZDO A;  4BU2 A;  1X3Z B;  2EV5 A;  2R5Z B;  1OPC A;  4YEL A;  1RKW A;  2Z2S B;  4OU0 A;  2R92 J;  3GTQ J;  5ILV A;  1YX5 A;  3PFI A;  2V1N A;  1XCV A;  4DOZ A;  2IA0 A;  4B1R A;  4EJO A;  5BMZ A;  4CH7 A;  5JLW A;  1QHH D;  3I55 I;  3SXY A;  4OMY A;  4EAT A;  3GFM A;  1YQA A;  2E5Z A;  5B5E C;  4ETS A;  2EA4 A;  3DLA A;  4XKC A;  5M3F J;  3DPT A;  1OCT C;  2ACJ A;  4RS8 A;  2LNB A;  3GLL A;  2RN7 A;  5JR3 A;  2W57 A;  2QQ9 A;  2V26 A;  5F0H A;  2X85 A;  1SMT A;  2EFN A;  3FKJ A;  1YIT I;  4UNO A;  4G7H F;  1E3H A;  2L7M P;  5F0C A;  1JGG A;  5EF6 A;  1HKS A;  3G1M A;  2IPQ X;  4ESB A;  4AID A;  5M5X J;  2DA4 A;  3HOZ J;  1MMD A;  3IWF A;  1OYW A;  4P9U A;  2CV0 A;  4HZF A;  3QQA A;  2JSP A;  4FIS A;  3AG4 H;  4Y3O A;  5IYC J;  2HQN A;  1UAA A;  1WPK A;  4KIG A;  1V4R A;  3CJQ B;  2L7F P;  1YFH A;  3VB2 A;  3BPX A;  2KIM A;  3BR2 A;  4QWQ A;  2XRO A;  1ON1 A;  3HB9 A;  3RQI A;  4Q47 A;  2Q2E A;  2B7E A;  4IHX A;  3S14 J;  2H09 A;  1BW6 A;  2DW4 A;  3L00 A;  2DXI A;  1FEX A;  2CSO A;  1MMA A;  2KZV A;  2HDD A;  4RLQ A;  3F6O A;  1WJB A;  3CC4 I;  2QQB A;  2PFB A;  1O3R A;  1YW7 A;  2FEZ A;  4ZYD A;  2R93 J;  2BHY A;  4JX4 A;  5J6X A;  2M30 A;  1M1E B;  5LBQ A;  2ZXI A;  1Y1V J;  1LFP A;  2IA1 A;  3FHN A;  3K70 C;  4FX0 A;  2EV6 A;  2L2O A;  2E1M C;  3I9V 2;  4NC7 A;  1QA6 A;  1FZP B;  2QCO A;  1FC3 A;  3HSF A;  3LQR A;  5JVT A;  1CF7 B;  3MZ8 A;  3T8T A;  5FKN A;  2OTJ I;  1IW7 F;  3K1P A;  2NXN B;  3HTU A;  4MO7 A;  1XS9 A;  1Z21 A;  4V2G A;  3WG9 A;  1FP2 A;  3MKL A;  3E3V A;  1ZR2 A;  1R58 A;  3GFL A;  4FHT A;  4E7J A;  5J8F A;  2TCT A;  3GME A;  3QOE A;  2QBY B;  3ZGK A;  4RB1 A;  4CYC B;  1K7A A;  2HVR A;  1QQI A;  1TNT A;  4EM2 A;  3FMS A;  3OMY A;  4M74 A;  3S3O A;  3CCY A;  3MD2 A;  3F72 A;  2Z33 A;  2BY2 A;  3V7S A;  1YYV A;  3Q3S A;  4ITV A;  2DAO A;  1IUY A;  1UHW A;  1AA7 A;  1YX3 A;  4ZDL A;  2EZK A;  3CTA A;  1OCR H;  4C2U A;  1DP3 A;  2DA5 A;  1OQY A;  2LDU A;  5D5V B;  1MDM B;  5DEQ A;  4HAM A;  4BQO A;  2WA0 A;  1R1T A;  1VQN I;  3ABK H;  3DLL F;  2KRF A;  2GOM A;  4RDU A;  1WQ2 A;  4MQV A;  1IDY A;  3SZT A;  2V9K A;  2VJ4 A;  2A05 A;  2BHZ A;  2ESH A;  4I6Z A;  3J7A Y;  3VYU B;  4XSX F;  5IP9 J;  2B63 J;  4Z6Y A;  4U7B A;  1FTZ A;  3C3W A;  3HRT A;  1ETO A;  4KIC A;  1V55 H;  3CCL I;  3S1Q J;  4BL0 B;  1PUF B;  4A3L J;  1IXR C;  2Q1Z B;  3DU5 A;  4EJW A;  4FT8 A;  4BQQ A;  3M8J A;  4GO1 A;  3FXO A;  4A0X A;  2VC0 A;  5FJ8 J;  1XD7 A;  2L9R A;  3HYI A;  2PJR A;  3F8M A;  2UUZ A;  2OCC H;  3E1S A;  4FQG A;  4BY7 J;  1BA5 A;  5H6R A;  4AU7 A;  2BZT A;  3N4M A;  1MMN A;  1ZG5 A;  1EKE A;  4BXX J;  1UST A;  4XQF A;  3ZMU A;  3IP4 B;  3TP0 A;  2CQN A;  2M3A A;  3H36 A;  1U9O A;  4GYG A;  2N8G A;  2ELJ A;  2YR2 A;  2JQ7 A;  4EM1 A;  1WH5 A;  3BOQ A;  3S15 J;  4GCV A;  2R7Q A;  4E7K A;  4EEF G;  5K1Y A;  5F04 A;  4PJJ A;  1B9N A;  3H0G J;  3RYP A;  3TW6 A;  5GTH C;  3JRG A;  3IHU A;  3SZG A;  4YRV A;  1LE8 A;  1W7P D;  4V2F A;  2E60 A;  2O5R A;  3L9F A;  5HOD A;  1Z9C A;  3L2V A;  2GM4 A;  1V3F A;  2BXY A;  3FDY A;  1U0J A;  4U0Y A;  2F48 A;  2L7K A;  1W7P A;  3GYH X;  3SEZ A;  1TLH B;  2CW8 A;  1DUX C;  2BW3 A;  1ZAO A;  5FKO A;  1MMG A;  2EFW A;  4RM3 A;  3PO3 J;  1HF0 A;  2XKO A;  3I56 I;  1XGO A;  4CO8 A;  4BXU A;  4DNC A;  4CCN A;  1MNM C;  3KYC B;  2HNH A;  4Y17 A;  1UMQ A;  3P9I A;  3R60 A;  4DYR A;  3HRU A;  4IPA A;  1IN7 A;  1XGN A;  3EQL F;  4XOP A;  2LF7 A;  4XLF A;  3MQ0 A;  3PUB A;  1SFX A;  2LBF A;  4A3B J;  1T08 B;  3UNG C;  1FIA A;  1T8I A;  2R7T A;  3HG9 A;  3LST A;  3I54 A;  3O6B B;  4MHG A;  1H8A C;  3JTH A;  2X51 A;  2F5V A;  2K3P A;  2PQ8 A;  3IAM 2;  4XSZ F;  3S1M J;  1ZRF A;  3CQZ J;  1T38 A;  3L2U A;  3VPR A;  2F5F A;  4ZYG A;  5IT9 K;  3RSN A;  1V5F A;  1S8N A;  2KIQ A;  4G6T B;  4DYQ A;  4CCJ A;  1Z6T A;  4G12 A;  3TGN A;  2E1M B;  2YPR A;  1W36 C;  4UB6 C;  2DOF A;  1FJL A;  2F5D A;  3ASN H;  2EPF A;  2HYF A;  4HBL A;  1ERD A;  1S9H A;  3FXU A;  2JSC A;  4BE0 A;  3LSP A;  1XGS A;  2MD0 A;  4P55 A;  4D7M A;  2X6O A;  1YRN B;  2NS7 A;  1XC5 A;  2GOX B;  4GFB A;  2X6W A;  1O57 A;  1YS7 A;  4HX8 A;  2B9S A;  2FQ3 A;  1EA3 A;  1T95 A;  2XAH A;  1HXD A;  3OYF A;  3CUO A;  3TL4 X;  2HQR A;  3W2W A;  3WU0 A;  3CCM I;  3LA7 A;  1EH6 A;  4XNF A;  5FGM A;  1YJ9 I;  4G7O F;  4XN3 A;  1D1A A;  2RC4 A;  5K5R A;  3G3Z A;  2HZD A;  1XTA A;  3OS0 A;  2EA2 A;  2X9D A;  3A0H C;  5KNL A;  4DBR A;  3K6G A;  2VOD A;  4BHC A;  2A5Y B;  2DK8 A;  3IUO A;  4MIM A;  2VKH A;  1ZRC A;  2IGM A;  1UHM A;  2O3F A;  2QM3 A;  1X1D A;  5CJ9 A;  4WX9 A;  5C4X J;  1I27 A;  1K4S A;  1TBX A;  5B1A H;  2ME0 A;  4RM2 A;  2V9P A;  3CCS I;  3LNQ A;  4CXF A;  2HTJ A;  2JRM A;  3BR1 A;  4NDL A;  2WV1 A;  4EMS A;  4G6D A;  4YEJ A;  3FX3 A;  2Z99 A;  5FKM A;  3SDB A;  1ZK8 A;  4BUP A;  2IS6 A;  1JUM A;  2ZNZ A;  2VBZ A;  2LY9 A;  4FET A;  1G3W A;  2FOK A;  4CIC A;  4YG2 F;  2NRA C;  1SEU A;  4ZC3 A;  3RPQ A;  1WI3 A;  3PJR A;  2BE5 F;  4OIN F;  1DU6 A;  1FMW A;  4KNY A;  3GVA A;  3EUK L;  2Y0S N;  2Y0M A;  4RAG A;  5GAE J;  2JVG A;  1P7J A;  3BZC A;  1K6O A;  4XN0 A;  2JVH A;  1FBQ A;  2OJE D;  2DTZ A;  4AVZ A;  2HQA A;  4UV9 A;  4C30 A;  3BQZ A;  4BGD A;  2K3F A;  1VQK I;  3J7Y J;  3J7A O;  2EZL A;  5LGU A;  4RLF A;  5FFX A;  2IXS A;  3LSI A;  1RC9 A;  3WTT C;  2O8K A;  3HDD A;  2NAZ A;  1XN7 A;  2FA5 A;  1J7K A;  2ZC2 A;  2K4J A;  4AVP A;  2DA1 A;  1LDJ A;  2FRH A;  2XGE A;  5EEA A;  5E8I A;  3JRD A;  3K69 A;  4BEH A;  3KX2 A;  2XB5 A;  2Y2Z A;  3G73 A;  4E7I A;  2Q8K A;  4LG0 B;  2CQX A;  1R5G A;  3R61 A;  5DD8 A;  3FXR A;  3H9Q A;  3OYE A;  3OIQ A;  1GVD A;  2IJL A;  2A3S A;  3VSK A;  2MLG A;  1U5T C;  3S16 J;  4UUV A;  3SDG A;  1I6X A;  4M3G A;  5BQT A;  2VON A;  3OY9 A;  2OAZ A;  3CLQ A;  3DTK A;  1YIO A;  1RET A;  3RCO A;  2LYC A;  4QIW N;  3E6C C;  3BRO A;  5BNG A;  5LLQ A;  1JGS A;  2QKM B;  3QP6 A;  3RZD J;  2VE8 A;  5EEG A;  3BG3 A;  3E5X A;  1O3S A;  4D1Q A;  3HHG A;  2LFB A;  3R0A A;  2M34 A;  2JRT A;  2DFE A;  3ZMT A;  2LVS A;  2QVO A;  2ZXJ A;  1HSJ A;  2OUM A;  3L09 A;  5FKK A;  5FB2 A;  1X1A A;  5L3G A;  1OYY A;  2ZME A;  2ZXW H;  2R7Z J;  9ANT A;  3FXJ A;  3R0J A;  3HOX J;  1QU3 A;  4L9V A;  1CQT A;  3KP3 A;  4G8X A;  4I02 A;  2QGU A;  5EEH A;  4S04 A;  4PFP A;  2X6X A;  2WAQ A;  1HOM A;  1BJZ A;  4CSW A;  4BE2 A;  1XPX A;  1PJR A;  2LY2 A;  4EVI A;  3V4G A;  2VC1 A;  3BTL A;  1H0M A;  3MAJ A;  1P7I A;  2STW A;  4U88 A;  1R22 A;  5LD2 C;  2JJ7 A;  1MND A;  3Q9S A;  2X1C A;  2M7B A;  3L2Q A;  1AU7 A;  1SFU A;  1F9N A;  4IHY A;  2PMU A;  1S7O A;  3RYR A;  3S93 A;  2E1N A;  4RBO A;  1EJ9 A;  4HV5 A;  1TZL A;  5B3S H;  2GIV A;  3Q0U A;  4HST A;  2VQG A;  4Q48 A;  5HNF A;  2P0W A;  1R36 A;  4I99 C;  2XPV A;  5IPA A;  2WY7 Q;  4N4N B;  5J1R A;  2WAE A;  3CF5 F;  4A3G J;  1BBY A;  3W2V A;  1IXC A;  3CMY A;  2L01 A;  4IEJ A;  2CJJ A;  1BOB A;  5E1X A;  2Y9Z A;  3F21 A;  3DEW A;  1DDN A;  2VJJ A;  2PJR B;  2P6S A;  5M5Y J;  1A35 A;  2HFH A;  3KP6 A;  5CVV A;  4C3J J;  4O6J A;  3V8L A;  3W6V A;  5HS7 A;  2HOS A;  1OLT A;  2L5Q A;  2V1D A;  3NAU A;  4S0H B;  1TTY A;  2E19 A;  4L9N A;  3ZRG A;  3CP8 A;  6PAX A;  3V7R A;  3PFY A;  4DJA A;  3GFJ A;  4FCY A;  2GA2 A;  3OSF A;  1TC3 C;  3I5U A;  2EZI A;  1A04 A;  2QZ8 A;  3JW4 A;  1JUP A;  3HOS A;  2PEX A;  4YIR X;  4A12 A;  2QEX I;  5D8L B;  5TIS C;  3K4K A;  4HOB A;  4D5F A;  4LMY A;  3QYF A;  4BYY A;  2XF7 A;  1SD7 A;  3F22 A;  3RKQ A;  2IRF G;  3TW7 A;  3CUQ C;  1BI1 A;  1QNT A;  4IHV A;  2G7H A;  4AD9 A;  2PMH A;  4CGZ A;  1R7J A;  2ZSI B;  4K2E A;  2LK2 A;  1O4X A;  4F91 B;  1S5L C;  4UXN A;  2V7F A;  4W97 A;  1U6G A;  2BW3 B;  1RIO H;  1B8I A;  2IGO A;  1S3J A;  3TMO A;  2MH2 A;  3RDI A;  4MQ9 F;  1VQ5 I;  3PM1 A;  1USS A;  1HDD C;  4M9X A;  1QZE A;  3VSL A;  2XAJ A;  5HDN A;  5DUI A;  2ZCW A;  2Y30 A;  3D5L A;  4M6Y A;  3HKZ N;  3KP4 A;  5TGT A;  1Y0N A;  1IJW C;  4BXF A;  1B4A A;  5KK1 A;  2VJI A;  4LK1 F;  5D5W B;  2MH9 A;  4E7Z A;  4IO9 F;  5DCM A;  3K2A A;  4II2 A;  2CFX A;  2DLL A;  3K9T A;  2JA7 J;  1WJE A;  2E2I J;  4KJZ A;  3HM5 A;  1K78 A;  2VOO A;  3HRS A;  1RUO A;  5FRN A;  1Y6I A;  1X4P A;  3DKX A;  3KZY A;  4XON A;  3ISP A;  3PIO F;  4BNC A;  1D1B A;  2QF7 A;  5A2Q K;  1FYK A;  2ZJQ F;  2HYJ A;  2DOE A;  4OMZ A;  5FRO A;  1A6I A;  4B8X A;  5K7Z A;  1YJN I;  3O2P E;  3JAM K;  3D1N I;  3KET A;  2M87 A;  1P4X A;  4M9S A;  3Q9V A;  3DF8 A;  1HW5 A;  1S6L A;  5CVJ A;  5CQG A;  3FXM A;  3CDL A;  3ZXS A;  3WGI A;  1D0Y A;  1U5T B;  4XLA A;  3CC7 I;  3OOP A;  2XAU A;  1SFK A;  4FE7 A;  1F43 A;  2XHK A;  3IC7 A;  2W85 A;  3WU1 B;  4KA4 A;  2JK3 A;  1HBX G;  1T0F A;  4LGW A;  2EIM H;  2KHM A;  1WJC A;  2WB1 A;  3ABL H;  3S2W A;  5FRM A;  2YS9 A;  2KL4 A;  4UV8 A;  2BY0 A;  3DU6 A;  4BQN A;  1JKO C;  5AON A;  3H3Z A;  2H8R A;  3RJP A;  4GDF A;  3K70 D;  4HEA 2;  4Y15 A;  1DP7 P;  3UR3 C;  3LSR A;  5CVU A;  1ONV A;  2RRE A;  1S29 A;  4A3E J;  3DWL E;  3HXL A;  5E8G A;  4XRS A;  2A61 A;  1OYI A;  1KU2 A;  1J09 A;  3ZQC A;  3U9G A;  3ELK A;  1G4D A;  2WTE A;  1ZKG A;  3PSI A;  5HLI A;  3EYI A;  4KFC A;  1FLI A;  1UJ8 A;  3W6J B;  3MKZ A;  2DJN A;  1P6R A;  2O6G E;  3U21 A;  1TWF J;  2NVT J;  2F2E A;  4A3I J;  4HF2 A;  3DBR B;  2LF8 A;  3PNY A;  5B66 C;  4O5V A;  3V42 A;  3J81 K;  2VPL A;  4HDU A;  5D6E A;  3IL2 A;  3HBL A;  1D5V A;  4XIC A;  1OCC H;  2JWT A;  3RI4 A;  4PK4 A;  5J47 A;  2Z16 A;  1FYM A;  3TDZ C;  4JK1 X;  1XX5 A;  2W7N A;  1QZZ A;  2CV2 A;  2M45 A;  1XGM A;  3R4K A;  2WBM A;  1OR7 A;  2DBB A;  5E17 F;  1MH3 A;  3ABU A;  2RNJ A;  4L9J A;  3VOD A;  4FAS D;  3ULQ B;  5ED4 A;  4CZC A;  3HTS B;  4CZZ A;  3G2B A;  2IS4 A;  5LEJ A;  1RNL A;  3BR6 A;  3HUG A;  1JTX A;  4HLY A;  2EIN H;  3L2W A;  1MW7 A;  2CMP A;  2M7A A;  4Q4Z F;  1QVU A;  1X19 A;  4P96 A;  4DBQ A;  4I0B A;  4RGS A;  3LFU A;  1J9I A;  5J40 A;  5D6F A;  3FMQ A;  3GO5 A;  5ERI A;  1NK2 P;  1IN4 A;  3O8H A;  2OC6 A;  2R3S A;  3J80 Z;  3G4S I;  5FFZ A;  2VKD A;  3BQY A;  1IXS B;  5ILS A;  2DTR A;  2YU9 J;  4LLG F;  1O7F A;  3W2A A;  3HJE A;  4X0G A;  5F0F A;  4XRM A;  2E7W A;  4OOI A;  4J01 A;  1JT6 A;  3CCV I;  4ESJ A;  3F23 A;  2ELK A;  2ZBK A;  2ID6 A;  4EM0 B;  5HLH A;  3CUQ B;  3BTJ A;  4ENJ A;  4EJU A;  1SFE A;  2I10 A;  3BR5 A;  3HOW J;  5EZH A;  2RQP A;  4GRI A;  1C0W A;  1GHC A;  4NQW A;  2EQR A;  4KUM A;  4A3F J;  3DKY A;  1TL8 A;  1UEL B;  3VYT B;  2G0E A;  3C1D A;  4UB8 C;  1VQ4 I;  3EUH C;  1MBJ A;  2W1O A;  5FD5 A;  4HW0 A;  1U2W A;  3WTV C;  4ENM A;  5JLX A;  4L9T A;  1SVL A;  1A36 A;  2IGN A;  2LKP A;  2CH0 A;  2HDW A;  4B47 A;  1BM9 A;  5E1Z B;  3M8F A;  5HOO A;  2VKE A;  2QWW A;  3MZY A;  4U0W A;  3RIR A;  1U8B A;  1WJF A;  2V9V A;  3JRB A;  2CS3 A;  3CJT B;  2I5U A;  4YFK F;  2EK5 A;  3CO7 C;  4I01 A;  3IV5 A;  2CG4 A;  1Z7L A;  4ASN A;  2DMN A;  4XM3 A;  3L2R A;  2O7O A;  2V1U A;  3ECO A;  1F36 A;  2KFD A;  5FLX K;  3A01 B;  5CVI A;  3DCF A;  5J3L A;  4HQM A;  2DFF A;  2O9L A;  3ZPL A;  4E70 A;  2DPU A;  2L9V A;  2HKO A;  1KQ8 A;  2AQF A;  4XL9 A;  1I1G A;  2OZ6 A;  3CDH A;  2QSG X;  2BY1 A;  2CW0 F;  4XKV A;  1WJ5 A;  4BDY A;  2K9Q A;  2FD5 A;  2Y9Y A;  2F4O B;  2XAQ A;  2KIU A;  2R7X A;  3GW2 A;  2CFO A;  1QZY A;  1UCR A;  3BR3 A;  5F64 A;  4KIB A;  1LB2 A;  2JMW A;  5IYB J;  2AHQ A;  2X6Y A;  3FM5 A;  2WV0 A;  1P4W A;  1HKT A;  4IHT A;  3ZQF A;  3SEQ A;  2MYS A;  1I5Z A;  2Y75 A;  3FXL A;  1SAX A;  3E6M A;  3RKW A;  5D4S A;  1B72 B;  4IKF A;  3HOY J;  2CO5 A;  3EPZ A;  3IWZ A;  3H3V K;  4B3X A;  2CQQ A;  1N75 A;  1Y56 A;  1LKX A;  2K40 A;  2BXZ A;  3B02 A;  3CC2 I;  5FO5 A;  2Y69 H;  3HZJ A;  4CCL A;  3PSF A;  2DDB A;  2TRT A;  3DKW A;  4QLC U;  3OYD A;  2KJC A;  3GFI A;  3SHF A;  4L5I A;  3CES A;  1H9T A;  1JI8 A;  2VT3 A;  5E3O A;  4ENN A;  2K86 A;  3OYM A;  4ANJ A;  3GCM A;  2OQG A;  3TOB A;  3H92 A;  3FM3 A;  4RAY A;  2EB7 A;  3OSG A;  2F4I A;  1LFB A;  4IOC F;  2PI0 A;  1WHU A;  2EBI A;  4H4K C;  1N25 A;  4AUX A;  2MW8 A;  3H0D A;  2IGK A;  3F8N A;  3WHC A;  2FUG 2;  2NVX J;  3REO A;  2JPC A;  3F8C A;  1VQ8 I;  1KYZ A;  2XVC A;  2KDO A;  4IQJ A;  4XR6 A;  3WHB A;  1P9Q C;  3B6A A;  3WTX C;  2R0Q C;  4HG2 A;  4QPO A;  1ZH5 A;  1GXQ A;  1EH7 A;  2XV4 S;  2AXT C;  2H8W A;  1W1W E;  2IW5 A;  3MEX A;  2MD5 A;  3D5R C;  5K5Q A;  2UXX A;  2OTL I;  5DTD A;  2DQR A;  2J5P A;  5DCM B;  4JOM A;  1E17 A;  3BG9 A;  2BBY A;  3PUF A;  2P6T A;  4BAY A;  4YIF A;  3BZK A;  5E3M A;  2XPW A;  1HC8 A;  2XGX A;  2GLO A;  3S1N J;  2ZKZ A;  3WTU C;  4BDZ A;  1JKP C;  4ZYH A;  2UZK A;  5GPC A;  1GDT A;  5E1W A;  2XC7 A;  4AYB A;  4A2U A;  2JUC A;  1ENH A;  3I71 A;  2LKS A;  1U9N A;  2VUM J;  1S7E A;  2BYV E;  2ECB A;  3QWL A;  5DM6 F;  4XLP F;  2DO7 A;  1Z0X A;  4XLH A;  3AG2 H;  4IVN A;  1ZLK A;  4BY1 J;  1WKM A;  1JHH A;  1IRZ A;  2XGC A;  1YW9 A;  2XAG A;  3N97 A;  2X48 A;  2H1L A;  3DPL C;  4M3D A;  2TDX A;  2M0M A;  5JVG F;  2GWR A;  1A5J A;  1PDN C;  4LOC A;  4WXC A;  5FLV A;  5IY5 H;  3ZQL A;  4W1U A;  2RV8 A;  1GT0 C;  2KRH A;  4B09 A;  3UKG A;  1AKH A;  2V4J C;  1WSU A;  2EFO A;  2H94 A;  5EGO A;  4G6Q A;  3BP8 A;  2KIS A;  3F6V A;  2E1O A;  3BR0 A;  3I59 B;  1KZH A;  1XDU A;  2CUE A;  2DT7 B;  3M07 A;  1IUF A;  2LH9 A;  4WF2 A;  1GV2 A;  1K6Y A;  2P5V A;  2R7S A;  1Z91 A;  1BOA A;  1XG1 A;  2GBY A;  2VBW A;  4U0V A;  1FOW A;  4P5O A;  4H0E A;  5IOZ A;  2K7L A;  4IZZ A;  5K7H A;  3S2H J;  3OYI A;  2XPU A;  3JRA A;  1G59 A;  4XOT A;  1ON2 A;  5E20 A;  4XRS G;  1KU7 A;  5F08 A;  2M0C A;  1ZAR A;  4BH9 A;  4IHS A;  1LVA A;  4CCK A;  2VL8 A;  3BDD A;  3KFW X;  4V19 K;  4PJM A;  4RGU A;  5L3B A;  3BLY A;  1XB4 A;  3COA C;  5EG0 A;  2C6Y A;  3TOA A;  3VDX A;  2OD5 A;  1ZRD A;  1X2N A;  3O8G A;  4LK0 F;  2D45 A;  1BN5 A;  4A6E A;  4N0B A;  3W3C A;  3CP2 A;  2FX0 A;  3EET A;  3CME I;  2HGC A;  1EV7 A;  4LD5 A;  3R6S A;  2BVM A;  1TP4 A;  3GTO J;  3B6C A;  2D5V A;  3DFG A;  3QAH A;  3EDP A;  1XMX A;  2J5O A;  2IS1 A;  1W5T A;  2M8G X;  4Z2Y A;  1J5Y A;  2O03 A;  4E7L A;  4M6X A;  2H27 A;  3SYT A;  2ELH A;  1DPR A;  1LUJ B;  2R5Y A;  1FSE A;  2EZH A;  2RNG A;  1T6S A;  3M4O J;  2OPT A;  2ZFW A;  2G9W A;  3SFZ A;  1FOX A;  5ICC A;  2L3D A;  3M8E A;  5H20 A;  1LDD A;  3HIF A;  3BJO A;  2DQL A;  4B4C A;  2MAB A;  4KT5 C;  2XIG A;  4KMU X;  4XKW A;  5LGT A;  4NUB A;  4PCQ A;  4N9I A;  3MMY B;  2QUF A;  4PZJ A;  4HDV A;  2LRE A;  3MN2 A;  4ON0 A;  4ZZD A;  3GTG J;  3PQJ A;  2L54 A;  3OYN A;  2CGP A;  2R7O A;  3VOE A;  1RKT A;  3TO9 A;  2LSO A;  4RAZ A;  2Q2E B;  3BG5 A;  3H35 A;  2IS2 A;  5LHG A;  3J81 Z;  1SC7 A;  1A31 A;  5BOX A;  2NNN A;  2VB6 A;  3KCC A;  3GBG A;  4XKB A;  1IAW A;  1DGR M;  1NG6 A;  1KU9 A;  2WAQ N;  2JT1 A;  3QU3 A;  4RB2 C;  4C2T A;  2ZB9 A;  5J4V A;  1POG A;  4AIJ A;  3EYY A;  1T98 A;  1BI3 A;  3KP5 A;  5IP6 A;  3DP7 A;  3K4L A;  3KEQ A;  2HPM A;  5GTI C;  2F5E A;  3K1M A;  2P5L C;  4B44 A;  3JRH A;  1TQM A;  2JPB A;  4J19 A;  5IOY A;  2KQR A;  1RR7 A;  2V79 A;  2R4G A;  2HOT A;  2YX4 A;  1RES A;  1W0U A;  4KYW A;  2DK5 A;  4OIO F;  5E18 F;  3QRF F;  1FY7 A;  3FIS A;  3HHH A;  3LSK A;  4QTR A;  2PG4 A;  4M72 A;  5LHI A;  5GPA A;  2HU9 A;  3OS2 A;  3KLO A;  1JTY A;  3CCJ I;  3CCU I;  1FPQ A;  4JP0 A;  1G6N A;  2AQE A;  2HTS A;  4JBA A;  4KIT B;  4G94 A;  4UUT A;  1PYV A;  1IF1 A;  5DDG A;  1OMI A;  2Y31 A;  4A3K J;  2JA6 J;  1N78 A;  3AL0 C;  4OAY A;  3DQV C;  4MFD A;  3GUD A;  2DMT A;  4XK4 A;  5J1U A;  3OR2 C;  2CQ7 A;  4PSW A;  1BI2 A;  1FTT A;  2YX7 A;  5HNH A;  3U1D A;  1CF7 A;  2OF7 A;  3KZI C;  4Y4R A;  2O61 A;  2L7Z A;  2XF5 A;  3WG7 H;  3NRV A;  3QP5 A;  1YI2 I;  2HDC A;  2RDP A;  5HDK A;  2XB0 X;  4L18 B;  4B3A A;  3OWT A;  4F92 B;  5F1R A;  3U2R A;  1D1C A;  4AIH A;  2P7C B;  1OFC X;  2KP6 A;  2NNY A;  3JRC A;  2COM A;  2VQL A;  1B59 A;  1JKQ C;  2R7R A;  1SVO A;  4CYC A;  1L3L A;  4LLN A;  4LIV A;  4P9F A;  3WTY C;  5DCF A;  2EJR A;  2A5W A;  2L9N A;  2VI6 A;  2VJ5 A;  3ZMD A;  2JTV A;  4D0P A;  2NVY J;  5GP9 A;  3S2D J;  2CW7 A;  3RKX A;  3E6D A;  1QVT A;  3JRE A;  5L3C A;  2D1H A;  3JCU C;  3T0Y A;  5J4Y A;  1IC8 A;  4JX5 A;  1MDM A;  1FX7 A;  5D5U B;  5FLX Z;  4HV6 A;  4FX4 A;  1ZQ3 P;  2IEK A;  5DD4 A;  4CUG A;  4IX7 A;  1XSD A;  2LR8 A;  1X1P A;  2EIJ H;  3RPU D;  4CCO A;  5LRS A;  2GA1 A;  3H9G A;  1WFX A;  3OYC A;  3BJA A;  3I0T A;  3OYB A;  3KZZ A;  3JR9 A;  4Y13 A;  1D8K A;  3RPU A;  3S1R J;  3N05 A;  1JJ6 C;  1LE8 B;  3ZMZ A;  1PUF A;  3CLO A;  4AIK A;  4WCG A;  1NK3 P;  4GXO A;  2UXN A;  1L0O C;  1FWZ A;  2P7V B;  3K4B A;  1W7P B;  2HPI A;  3GX4 X;  1IN8 A;  2QQ8 A;  4ZTF A;  4DIQ A;  3M1E A;  3ML6 A;  1XMK A;  2D1V A;  1FYL A;  1D0X A;  3K2Z A;  2K9N A;  4D9J A;  3BTI A;  4R8H A;  1Z3Y A;  2XRN A;  3OV8 A;  1E3O C;  2FMY A;  1G3T A;  1MJ9 A;  3DTI A;  4EJV A;  4UHT A;  1RZ4 A;  3G6E I;  4OIP F;  5KHD A;  3KPH A;  5B1B H;  3G1O A;  5FKL A;  4I2O A;  2KLO A;  2W48 A;  3ZQQ A;  4I76 A;  2MC3 A;  2ZME C;  2LG4 A;  1ETW A;  2EFQ A;  1LNW A;  1NTC A;  3OL4 A;  3GTK J;  2LBF B;  2K9M A;  3QYB A;  1ZLJ A;  2E71 A;  2ZO4 A;  2NYX A;  1JE8 A;  1ETV A;  2KMU A;  2FNP A;  3F8F A;  3BCB A;  3KEY A;  4LG3 A;  5JHF A;  2MLK A;  3ZN1 A;  3LL7 A;  1ZHF A;  4A6D A;  1TW2 A;  3DEE A;  1MSE C;  2Z1D A;  3FK7 A;  1WJA A;  4XLC A;  3JTG A;  3EUA A;  5EGO B;  2M2E A;  4HPQ A;  1FBU A;  1WRJ A;  4Q5S F;  3GLX A;  3FF5 A;  2DOD A;  3FK6 A;  1YS6 A;  5J8C A;  3I64 A;  1OCO H;  4M73 A;  5AIP A;  2ICW G;  3E6B A;  4G9Y A;  1J75 A;  1HKQ A;  2Z3Y A;  2QKL B;  1H89 C;  2GXG A;  3SFI A;  3FXK A;  3FBI B;  3M9A A;  2GQQ A;  4MEY F;  3S3M A;  3DTE A;  1ZR4 A;  1YG2 A;  1ZGA A;  3HSR A;  3CJN A;  4HNU A;  4HF0 A;  1U8R A;  3DBL B;  3TQN A;  2HEO A;  4JX6 A;  3GZ6 A;  4WXD A;  1ZG1 A;  2ETH A;  1OJL A;  3D5S C;  3GXO A;  3KE2 A;  4GGG A;  2Y48 A;  3OYJ A;  4IOA F;  1VQ9 I;  2K9S A;  3M1C A;  2FE3 A;  4UUS A;  1X4O A;  2DYR H;  2DA6 A;  1P92 A;  3AL0 B;  2JN6 A;  1KGS A;  1I3A A;  1Y8Q B;  2JA5 J;  5IT9 Z;  1Z7U A;  5ICF A;  2XSJ C;  4KN7 X;  1Z6R A;  3TP3 A;  4N9H A;  3WOD F;  2ZXH A;  5GAD J;  1Z77 A;  2L9S A;  2E35 A;  1SD4 A;  4I98 B;  2NVU B;  1VQ7 I;  1YRN A;  2BEO A;  4B48 A;  3K4M A;  1BR1 A;  3GEZ A;  2ZJ2 A;  5C44 J;  5EZG A;  1IDZ A;  3JRF A;  1ULY A;  4M71 A;  1B1B A;  2WY8 Q;  2HXI A;  3ECH A;  1I1S A;  1ZGJ A;  3X2Q H;  3KEO A;  3HPG A;  3CF2 A;  4LJZ F;  3HGY A;  1LJ9 A;  1Z05 A;  4NBQ A;  3OIO A;  2DMU A;  3LSG A;  1IN5 A;  2LP0 A;  5KCM A;  5D8K B;  2HYG D;  2QQA A;  2A6H F;  4HX7 A;  4E6K G;  4BE1 A;  2NS8 A;  1TT5 B;  2GAU A;  2W24 A;  2ID3 A;  4Y52 J;  3GTP J;  3ZP5 A;  1YOV B;  3LA3 A;  4HSR A;  2F4M B;  1W5C C;  3VYS B;  3GZ5 A;  2E36 A;  2WAF A;  1AWC A;  1R71 A;  3PL8 A;  2ZFU A;  4Y7N J;  2ZJP F;  5LFA A;  2PLY A;  3CCQ I;  1IRX A;  4FE4 A;  2VQC A;  4BEH B;  3IKV A;  2E1C A;  4IJA A;  1KQ0 A;  2PMZ A;  2PX9 A;  3A02 A;  2R7U A;  1J59 A;  1VF9 A;  1VQO I;  2IA2 A;  1MIJ A;  3IRQ A;  2VBY A;  3QPS A;  1ODD A;  3QPH A;  5HS9 A;  4UVA A;  5KAI C;  2FBK A;  3AG3 H;  4DYC A;  2LMD A;  2OQR A;  2XAF A;  3MVP A;  1V5G A;  4EGY A;  1GVJ A;  1ZRE A;  3CCE I;  3HRM A;  2HVS A;  4A3J J;  3ERM A;  5C4J J;  1SMY F;  4E7S A;  1IG7 A;  1T0F C;  4HNT A;  2STT A;  3FWE A;  1R23 A;  3MWM A;  2VLA A;  2DYS H;  2A6E F;  4S05 A;  3GWZ A;  5BPI A;  2ISY A;  1Q1H A;  2X4H A;  1NHA A;  3IH4 A;  3OS1 A;  4BBR J;  5J1Y A;  5E3N A;  2HOE A;  2FBH A; 
#chains in the Genus database with same CATH homology
 4MLO A;  2LY1 A;  3VSK A;  3K4J A;  5HLT A;  4CCM A;  1NG7 A;  3A2K A;  2LC2 A;  3H5N A;  3DPL C;  3NWT A;  1TT0 A;  3OY9 A;  3DTK A;  2M0M A;  3RCO A;  2LRD A;  4II3 A;  2LYC A;  3KYL A;  2KRC A;  2QKM B;  4D1Q A;  3RQ4 A;  2V6E A;  5CKT A;  2KRH A;  2V4J C;  3OL3 A;  3OR1 C;  1LVK A;  4XMY A;  1BR2 A;  2OUM A;  1KON A;  1X1A A;  2DJI A;  2JA2 A;  2DT7 B;  2R7W A;  1QU3 A;  2LH9 A;  2R7S A;  1K6Y A;  4JQF A;  2VXZ A;  2VXD A;  4B43 A;  3ZCO A;  4PFP A;  2X6X A;  2WAQ A;  4PJL A;  4P5O A;  2M4G A;  3HKZ A;  4IZZ A;  4CSW A;  3OYI A;  4LIU A;  4BE2 A;  1PJR A;  2LY2 A;  1G59 A;  3E0J B;  3HOT A;  4XOT A;  1OR7 C;  3TBI A;  5LD2 C;  1V5E A;  1MND A;  2A6T A;  2X1C A;  2M7B A;  3L2Q A;  2X1D A;  1VZ0 A;  3OIP A;  4CCK A;  2VL8 A;  1X1B A;  3S93 A;  4BS9 A;  1TZL A;  4F52 A;  2VQH A;  4PJM A;  4HST A;  2VQG A;  3BCA A;  4E4H A;  2LOO A;  5HNF A;  2P0W A;  3BLY A;  4U87 A;  4Y33 A;  4NNJ A;  3VDX A;  2W82 A;  2WY7 Q;  4N4N B;  5HVQ C;  2WAE A;  4RMN A;  3NWS A;  2HVQ A;  2UV1 A;  3W2V A;  3CZ6 A;  2WAD A;  3W3C A;  3CP2 A;  1W36 D;  1BOB A;  2VJJ A;  2PJR B;  2BVM A;  4ZDO A;  4BU2 A;  4YEL A;  2Z2S B;  1OLT A;  1YX5 A;  2L5Q A;  2MC4 A;  2IS1 A;  2V1N A;  4E7L A;  3ZRG A;  4DOZ A;  3SYT A;  3CP8 A;  4J00 A;  2VIX A;  4CH7 A;  2RNG A;  4R79 A;  1QHH D;  3PFY A;  4DJA A;  2ZSH B;  4EAT A;  2E5Z A;  4NC8 A;  3DLA A;  1D0Z A;  4XKC A;  1UG0 A;  3HOS A;  3DPT A;  2MFZ A;  3K4C A;  2MAB A;  5CPR B;  4XKW A;  3LMM A;  3ONQ A;  3K4K A;  4NUB A;  3MMY B;  3QYF A;  2V26 A;  2VAS A;  2K9L A;  2X85 A;  2XF7 A;  2JUG A;  3C2G A;  3FKJ A;  2LRE A;  4QPQ A;  4E7H A;  2BVL A;  2ZSI B;  4CA0 A;  4F91 B;  4ZYA A;  3OYN A;  2R7O A;  2Q2E B;  2V7F A;  3H35 A;  2IS2 A;  1MMD A;  2BW3 B;  2IGO A;  3TMO A;  2CV0 A;  2CUJ A;  2JSP A;  4Y3O A;  4PUS A;  2VB6 A;  3GBG A;  1UAA A;  3OYK A;  4XKB A;  3VSL A;  1DGR M;  1NG6 A;  3CJQ B;  4LIT A;  3D5L A;  3OYG A;  4C2T A;  4F55 A;  5TGT A;  4BXF A;  4PSX A;  2VJI A;  4E7Z A;  3K4L A;  4II2 A;  2HPM A;  2DXI A;  1FMV A;  1MMA A;  2KZV A;  1WJE A;  4RLQ A;  3BC8 A;  4KJZ A;  1WJB A;  4B44 A;  3MKY B;  5FRN A;  2KQR A;  1Y6I A;  1X4P A;  3DKX A;  3S32 A;  2R4G A;  4XON A;  2UWM A;  1D1B A;  2ZXI A;  3H9J A;  1LFP A;  3FHN A;  5FRO A;  2W00 A;  3K70 C;  3LSK A;  2L2O A;  4C9Y A;  2E1M C;  2CV1 A;  2HU9 A;  3I9V 2;  4NC7 A;  3OS2 A;  2E5N A;  3LSH A;  3S8P A;  2AQE A;  3PNV A;  4KIT B;  1Z21 A;  4P1W A;  1PYV A;  3BG7 A;  5CQG A;  3ZXS A;  1D0Y A;  4XLA A;  1N78 A;  4E7J A;  4OAY A;  3DQV C;  3AL0 C;  2XAU A;  1SFK A;  3QOE A;  3ZGK A;  3OR2 C;  2HVR A;  4PSW A;  4XLE A;  3OMY A;  5HNH A;  3S3O A;  3MD2 A;  3H5R A;  4Y4R A;  2KHM A;  2XF5 A;  1WJC A;  4ITV A;  2WB1 A;  5FRM A;  1AA7 A;  1YX3 A;  3HL2 A;  2KL4 A;  4ZDL A;  2XDV A;  3DU6 A;  3PNT A;  4BQN A;  4C2U A;  1DP3 A;  3CJR B;  3OWT A;  4F92 B;  2R7V A;  4XLH A;  1D1C A;  3I3L A;  2KP6 A;  3K70 D;  4HEA 2;  4BQO A;  2VQL A;  2WA0 A;  3UR3 C;  2R7R A;  2RRE A;  2GOM A;  4LIV A;  3DWL E;  3HXL A;  2A5W A;  2L9N A;  1J09 A;  2CUZ A;  2VJ5 A;  2K5C A;  2V9K A;  1LDK B;  2VJ4 A;  3J7A Y;  4KT6 A;  2CW7 A;  3VYU B;  3PSI A;  4U7B A;  3MKZ A;  3U21 A;  4BL0 B;  3PNY A;  2Q1Z B;  2DOA A;  3DU5 A;  3IAS 2;  3V42 A;  2VPL A;  4BQQ A;  4N4O B;  4CUG A;  3M8J A;  4IX7 A;  3HUG B;  4PK4 A;  2Z16 A;  2W7N A;  3RPU D;  2CV2 A;  3K10 A;  4CCO A;  3DPU A;  2PJR A;  3H9G A;  1WFX A;  3OYC A;  2WBM A;  4F3Q A;  2UUZ A;  1DQU A;  3E1S A;  3F9K A;  3OYB A;  4KIS A;  1G8X A;  4AU7 A;  4ZTJ A;  4FAS D;  1MMN A;  4CZC A;  3N05 A;  4XQF A;  3G2B A;  2IS4 A;  3IP4 B;  3OYE A;  2M3A A;  3AFH A;  3ZR8 X;  3OYL A;  3L2W A;  4BAC A;  2ELJ A;  1MW7 A;  3K4B A;  2CMP A;  2M7A A;  2HPI A;  1X19 A;  4DBQ A;  4ZTF A;  4DIQ A;  3LFU A;  2R7Q A;  4E7K A;  1D0X A;  1MNE A;  4BJ6 C;  4D9J A;  4PJJ A;  1Z3Y A;  2OC6 A;  3HC7 A;  4NQW B;  2VKD A;  3SZG A;  4YRV A;  1ZEL A;  3DTI A;  3W2A A;  4X0G A;  4J01 A;  5KHD A;  2F6C A;  1WJD A;  1QHG A;  2E60 A;  2O5R A;  2KLO A;  3ZQQ A;  3L2V A;  4HRI A;  3FDY A;  1U0J A;  2LG4 A;  2BOL A;  2L7K A;  3OL4 A;  3SEZ A;  2CW8 A;  2K9M A;  2LBF B;  3QYB A;  2BW3 A;  1Z3X A;  1MMG A;  4GRI A;  4RM3 A;  2KMU A;  3KEY A;  4LG3 A;  3BCB A;  5JHF A;  2DT6 A;  4CCN A;  3DKY A;  3LL7 A;  1UEL B;  3VYT B;  2HNH A;  3A4C A;  3DEE A;  5CQE A;  3EUH C;  2Z1D A;  2W1O A;  1WJA A;  4XLC A;  3EUA A;  4XOP A;  4XLF A;  3S3N A;  3C2H A;  3PUB A;  2LBF A;  4DGW B;  4HPQ A;  3OYH A;  3UNG C;  3RTR A;  2R7T A;  2IGN A;  3HG9 A;  2Y0S A;  2CH0 A;  3LSM A;  2HDW A;  2X51 A;  2F5V A;  4B47 A;  2K3P A;  3IAM 2;  5HOO A;  3QYE A;  3AKZ A;  1WJF A;  3L2U A;  2QKL B;  2CS3 A;  3H5A A;  3FBI B;  3RSN A;  1V5F A;  3S3M A;  4G6T B;  1YE9 A;  1Z7L A;  3DTE A;  2M4K A;  4XM3 A;  3L2R A;  2I8D A;  3HPH A;  1DGW Y;  4CCJ A;  3VWB A;  1BR4 A;  2E1M B;  1W36 C;  4HNU A;  2W4S A;  4F93 B;  2X1E A;  4OWR B;  3D5S C;  1ERD A;  1S9H A;  2AQF A;  4XL9 A;  3OYJ A;  4BE0 A;  3M1C A;  2MD0 A;  4XKV A;  1WJ5 A;  1X4O A;  3QOD A;  4BDY A;  1R6R A;  3AL0 B;  2GOX B;  2X6W A;  1EA3 A;  1T95 A;  3OYF A;  2XSJ C;  3TL4 X;  2R7X A;  2CFO A;  2DCE A;  2KPM A;  3W2W A;  4XNF A;  4XN3 A;  1D1A A;  2ZXH A;  2X6Y A;  2HZD A;  3BG6 A;  2L9S A;  3OS0 A;  4BJ5 C;  5KNL A;  4DBR A;  3K6G A;  3SEQ A;  2MYS A;  3IUO A;  4IKF A;  3EPZ A;  2VKH A;  2IGM A;  4B48 A;  3K4M A;  1BR1 A;  1X1D A;  3FBN B;  4B3X A;  1N75 A;  1Y56 A;  1LKX A;  4PJN A;  1SAU A;  2WY8 Q;  4RM2 A;  4CCL A;  3PSF A;  3OYD A;  3HPG A;  3CF2 A;  4XOR A;  3CES A;  3VYR B;  3LSG A;  1N77 A;  1JI8 A;  4YEJ A;  4IQ4 A;  5KCM A;  4ANJ A;  3OYM A;  4BE1 A;  3A1Y A;  4E6K G;  3SDB A;  2NOJ B;  4BUP A;  2IS6 A;  2F4I A;  1HA8 A;  3K4N A;  4FET A;  4PFO A;  4H4K C;  4ZC3 A;  4HSR A;  3VYS B;  3PJR A;  3H0D A;  2RQQ A;  2IGK A;  2WAF A;  2FUG 2;  1FMW A;  3PL8 A;  3MKW B;  2ZFU A;  3CMM A;  3EUK L;  2JVG A;  2KDO A;  4IQJ A;  4XR6 A;  5LFA A;  1P9Q C;  4HG2 A;  4QPO A;  1IRX A;  4XN0 A;  2JVH A;  4ZDP A;  2VQC A;  4BEH B;  4AVZ A;  3D5R C;  2HQA A;  4C30 A;  4BGD A;  2PMZ A;  3OOU A;  1GLN A;  2R7U A;  4RLF A;  4JOM A;  2IXS A;  1E0E A;  3LSI A;  2OV7 A;  1V5G A;  2HVS A;  1X1C A;  4BJT A;  4BDZ A;  4E7S A;  1T0F C;  4ZJZ A;  4HNT A;  4BEH A;  2VLA A;  3KX2 A;  2XC7 A;  4AYB A;  4E7I A;  3OS1 A;  3OYA A;  3H9Q A;  4OAZ A;  2XF6 A;  3OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...