2HZDA

Nmr structure of the dna-binding tea domain and insights into tef-1 function
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional enhancer factor TEF-1
publication title Insights into transcription enhancer factor 1 (TEF-1) activity from the solution structure of the TEA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01285 TEA TEA/ATTS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hzdA00
2HZDA
chains in the Genus database with same CATH superfamily
3TEDA 3W6KB 4UY8I 3DBHB 1SMTA 3BR5A 3CP2A 2HDCA 3OR2C 2NS8A 3CO7C 3SZPA 2ZJPF 4KIBA 2ZFWA 1PDNC 1BOBA 3WGGA 4XQFA 1HDDC 4M6YA 1FBQA 2ZCWA 5KAIC 4IHXA 2KIQA 9ANTA 2Y48A 4BXUA 2JSPA 4LLGF 5LHGA 1KQ9A 2HEOA 4KNYA 1ZHFA 5HS8A 2HXOA 2LD5A 2HVRA 1SVLA 4BKXA 1QVUA 2JTVA 2DT5A 1FOYA 1X4OA 3E7LA 3K1MA 2R7UA 3JSOA 3HZJA 1HXDA 1YG2A 2EQRA 1S6LA 2XB5A 2ECBA 2HU9A 1TW2A 1VQ6I 2ZO4A 3HBLA 2XRLA 1AKHB 4F93B 2RQPA 1IRGA 2RC4A 3KPHA 3WTTC 2IVMA 5LRRA 2E2IJ 3ZMZA 3HKZA 3KZIC 1QPIA 1DUXC 5CYVA 4ZTJA 1R00A 1N25A 2MFZA 1EH8A 1I3AA 3JAMK 1UG0A 1P7JA 2DODA 5GPAA 4L5JA 1EA3A 5ERIA 1W5SA 2GA1A 4M3BA 4OMZA 5BS6A 2R92J 2ELJA 2W82A 1LPQA 2XROA 1NK2P 4RGRA 1XDSA 4F92B 4UNOA 4P9FA 4I76A 2UV1A 4Z6YA 3CUQC 1T08B 3I53A 5FO5A 1IRXA 2ZC2A 2XAJA 3PSFA 5JHUA 4EJVA 1QBJA 2GLOA 5KK1A 3HC7A 4U0WA 1Z3XA 4I7HA 1KGSA 3LA3A 3PSIA 1MMAA 5F27A 2Q2EA 2ZJQF 1SVOA 1R4NB 2BEOA 3P9IA 1LVKA 1W36C 2STTA 2HOEA 1ZG3A 1XMAA 4A5MA 2H1LA 1XGNA 4BBSJ 2HQ5A 3QPHA 2JN6A 4N9HA 1QHHD 2EK5A 3BQZA 3HL2A 1TZLA 2CV2A 2VB6A 1IC8A 1T2KA 2XKOA 5F08A 3JRGA 1HLVA 1YFHA 3JRBA 4E7IA 1OCCH 1JXSA 1XC5A 1USTA 3F72A 2DA1A 4C9YA 1VQOI 1DGWY 1Z6TA 3S32A 5ICEA 1SEUA 3TGNA 1ITYA 3OYLA 5EF6A 1BR4A 2WB1A 1KU7A 1R9TJ 1Y39A 1YO5C 2WTEA 2OD5A 3L2VA 3OYAA 5FD6A 2DFHA 3WHBA 3S1MJ 3W3CA 4ON0A 3B02A 4KYWA 1FOWA 2ISYA 4XSZF 3JAMZ 2D5VA 1G3WA 2YX4A 3BY6A 2EA4A 4HQMA 2VN2A 2BY1A 1O3QA 2Z9OA 4FX4A 1O7FA 2ICWG 3HOTA 1QO0D 2O5RA 5E1XA 1B4AA 1TTYA 2VQGA 2XAFA 1GDTA 2F48A 3ROUA 4CCMA 2CUEA 2CQNA 1R58A 1CF7A 2CRGA 2K4BA 4KIGA 3DQVC 1TNTA 2E5ZA 1U5TA 3V7CA 3BJAA 4CZZA 3OYFA 1GHCA 5EYRA 3RYPA 3VODA 1YOVB 2ETHA 2VE8A 4BE1A 3KEQA 3PL8A 2L7MP 2VKVA 2CMPA 1HKSA 1B1BA 2EA2A 3R0JA 3FMSA 3T0YA 4F7ZA 2DOFA 2E34A 2HWVA 2FBHA 4RB3C 1ZRFA 4XSXF 4PUSA 1U6GA 1R6RA 3WG9A 3IUOA 4PJLA 4WXCA 4L0ZB 1S72I 4EVIA 2E19A 2LF8A 2VJJA 5F0CA 3KLNA 5B1AH 2DYSH 2I5UA 3ZQIA 3GTLJ 3H5NA 3FKIJ 2Z99A 4A93J 4WWCA 2Z2SB 3OWTA 2DPDA 5E3MA 1OKRA 1D0YA 2E1OA 3C18A 3QYBA 3QU3A 5KVRA 3GFJA 3S2DJ 4GRIA 3BZCA 3EUKL 3TO9A 3S3OA 1U8BA 2W4SA 2JA7J 4QTRA 1D1CA 1SAUA 5AONA 3L1PA 3HHGA 3QPTA 1VQ4I 2HGCA 2IGMA 2K86A 2LVSA 2VJ4A 4N0BA 1P92A 4G7HF 1F4KA 1Y56A 3F8NA 1UMQA 4XMYA 4O6JA 2IGKA 5L3FA 4LFUA 2ZSHB 2VIXA 4M6XA 5D8LB 3K9TA 4HV6A 3FBIB 5JFRA 1ERDA 5DM6F 4M71A 2LBFA 2QSGX 4BBRJ 5H20A 3IRQA 2EFNA 2ZNZA 2L7ZA 3CMAI 3S15J 3S16J 4XRFA 4ZZLA 1HW1A 4OIRF 4E7SA 4Y7NJ 3CO6C 2F5CA 1DP3A 4E6KG 2E71A 3ML6A 2XAHA 4I02A 3OYMA 2R93J 2E5NA 4A3KJ 2KZGA 2V6EA 2CJJA 1W7PD 1I6XA 4CCKA 1WJCA 4Y33A 3S2WA 3HOXJ 1XD7A 3V7SA 3LSIA 2DQRA 3LSJA 1TBXA 2YR2A 1ZG5A 3E5XA 4I99C 2JPBA 3W2WA 4BAYA 4FHTA 1JKRC 1CF7B 4FQGA 3ZMUA 1YW7A 4UUTA 3LSKA 4D1QA 3S14J 2B63J 2IA2A 1ULYA 2XPVA 2BY0A 1U5TB 1TP4A 1HW5A 3MKWB 4IHYA 2CUJA 2X6XA 2CW7A 5LFAA 3H5AA 3JRHA 3IP4B 3FX3A 2IW5A 2K02A 2ZJRF 2DDBA 5CVJA 3KE2A 2YS9A 2JK3A 2M3AA 4IQ4A 5GPCA 1KZHA 2Q1ZB 3DPTA 3H92A 2L7KA 2M2EA 3IH4A 3RCOA 3ABLH 3P5JA 4CYCA 1UHMA 1J75A 5K7ZA 2CH0A 4IHWA 3BJ6A 3CF5F 4QSHA 3U21A 2QCOA 3C7JA 2O3FA 3ZMDA 3PUBA 1Y8QB 4JP0A 5K5OA 1T38A 1VNDA 2JJ7A 2OJED 3NARA 5EJCA 3GZ5A 2Q0OA 5HDGA 4KMUX 2DK5A 3LAJA 3G71I 1MW7A 1ZR2A 3R6SA 1R7JA 4D5CA 3WTVC 3M8EA 1D1BA 1A5JA 1Z0XA 2CYYA 2ID3A 2PEXA 3K69A 2HZDA 1V4RA 5FD5A 4CYDA 4GO1A 2LREA 1EJ9A 1IRFA 5ILUA 2EV6A 3TL4X 3KFWX 1V54H 5GTIC 5IYBJ 3R4KA 1OR7A 1QA6A 2JVGA 1JUPA 3M07A 2V1XA 3S1QJ 1BI3A 5CVRA 5F0HA 3EQLF 4FE7A 3ZN1A 2HPIA 4EATA 3GTPJ 2WAFA 2MSYA 4G6QA 1P4WA 5HOOA 2AQFA 3SEQA 5E3LA 3K4LA 4LIUA 3OYGA 1ENHA 3Q0WA 3Q3SA 1YX3A 3WU0A 2OZ6A 4GYGA 1HCRA 3J7AO 3BZ6A 5GADJ 2P6TA 1RR8C 1BBYA 1FSEA 2G7UA 5J8FA 3CCQI 1AWCA 4P1WA 4ZTFA 5J1YA 2AXLA 5M5XJ 1W5TA 4MGRA 2X6OA 1JUSA 3EUHC 1G6NA 2ME0A 3CCYA 2DPUA 3E6DA 1RPWA 3E6MA 2HTSA 1XSXA 5J3LA 2DI3A 5DD4A 1Y0NA 2KQRA 4AC0A 1NG7A 3DPLC 1IN7A 3PO2J 2ZMEA 1D1AA 3HSEA 1KU3A 3M7GA 5JVGF 1UAAA 2PX9A 1IXCA 3F6VA 3GYHX 3HM5A 3OYNA 1ON2A 3V4GA 3JR9A 4HG2A 2RQQA 4A3CJ 4RAFA 3WTWC 1OFCX 3E5UA 2DA5A 3G1OA 1KQ0A 2K40A 1FT9A 2V7FA 1MMNA 2M30A 2VPLA 3WTUC 1FP1D 2WAQA 2CS3A 1RR7A 4NUBA 3EDPA 3QOPA 4BU2A 4ZH4F 4CYCB 1FJLA 4CSWA 1HA8A 3AFHA 4DOZA 3BCBA 3MKZA 2E7WA 3BR2A 3HDDA 1LE8A 3IRRA 1FTZA 1E3PA 2R5YA 4JOMA 3TOAA 1GV2A 3LA2A 4DZPA 1S7AA 2X85A 2RGVA 3MZYA 1SMYF 1B8IA 3FXUA 1VQ5I 1DPRA 5D5WB 1LQ1A 4YELA 2UUZA 2XF7A 2VASA 2LY2A 3CDIA 2GM4A 1OJLA 2F6CA 1V5GA 2H09A 3VDXA 3A01B 1IV8A 3S2HJ 1YLFA 4HPQA 3SDBA 2B7EA 3FXQA 4UXNA 1H9GA 3JRAA 3RKWA 3ZP5A 1J09A 1LDKB 1MH3A 4HEA2 4B09A 3QYEA 4F91B 4IPAA 2JMWA 3DKWA 4B4CA 1IRZA 4RMNA 1BW5A 2P0WA 4IRHA 4C3HJ 4ABZA 3CESA 2IS2A 3RZDJ 2GOMA 4EMSA 4YFKF 3MN2A 4XICA 1O3TA 1N77A 1P4AA 1ZELA 2EZKA 2QZ8A 4PJ0C 4ZJZA 2KDOA 2CU7A 4NC8A 2RN7A 5EG0A 4HRIA 1JE8A 4M72A 1A36A 3CD6I 1LEAA 4HLXA 1U78A 1BC8C 2IEKA 5CQEA 2DFIA 2A3SA 4U87A 1D0ZA 2O03A 2O0YA 1FX7A 2V6CA 3ABTA 4XRMA 5FRMA 2F4OB 1KYWA 2O8KA 3SQNA 1QGPA 2HYGD 2F5FA 1Z7LA 3M1CA 4RGSA 3WG7H 4Y15A 3FK7A 3JW4A 3VYUB 4IQJA 2A6EF 1TWGJ 3K0LA 2BXYA 3O3KA 4CCOA 4M73A 2NAZA 3J7ZI 4NQWB 1QZEA 4RM3A 1UHWA 3I54A 2L9SA 1T98A 5J4YA 1Z6RA 2BVMA 3WTXC 3X2QH 3ABKH 4BACA 4IF4A 1LDDA 1MNEA 3F8FA 5C44J 2MC3A 4PCQA 5F64A 3J81K 3NWSA 1YTYA 2M1BA 4BDYA 2HS5A 1SD5A 3V8LA 4PFOA 3HRTA 2QEXI 5LEJA 4A6DA 1MBEA 1QZYA 5CKTA 3ZQQA 3JRFA 5J47A 1W7PB 4AUXA 1VQLI 1R1TA 2M7AA 1GT0C 2K5CA 4LIVA 3H9JA 4M3DA 3JREA 1LE8B 1WJEA 1MSEC 4EEFG 2R7DA 4KN4X 2R5YB 2MA3A 5IP7J 2A6TA 2VONA 5FLXK 3VSKA 1B8IB 1MD0A 3TOBA 2EV0A 3TO7A 1J0RA 2M87A 2DLLA 3TMOA 3PUFA 4HNTA 1ETOA 4YIIA 4C3JJ 3KZYA 1D0XA 3BT9A 4Y52J 3Q0VA 4HX8A 4KUMA 4UB8C 1KA8A 1S8NA 5L3GA 2VPRA 1G3TA 2QF7A 2L0KA 3F3XA 5F0FA 4EM1A 2DA7A 2XV4S 3D0SA 3QP6A 2A5YB 4BY1J 1R71A 3CCJI 3BG7A 1ZQ3P 3K70C 3IHUA 2COMA 2K9QA 3ZGKA 1Z7UA 4GGGA 4I0AA 1IDZA 1W1WE 1MMDA 1L0OC 1SFKA 1EV7A 1USSA 2WAEA 2QKLB 2XKPA 5CPRB 4UVBA 3VEPA 2W48A 3ZMTA 4G8XA 4M9SA 3MVPA 3O8GA 3Q0UA 1IN4A 5EG0B 1IF1A 3SHFA 3IKVA 3OYDA 3MQ0A 5LEKA 4KJZA 1DDNA 1A6IA 3JSPA 1O57A 3OS0A 2IJLA 5CVUA 3BC8A 2DFFA 3A2KA 3VB2A 1VZ0A 1LFBA 4DYCA 3WTYC 1FBSA 2XHKA 5DEQA 1R5ID 4MTDA 5CLSA 2L9VA 1R49A 2EIMH 3GBGA 1WRJA 2ID6A 1ZYRF 4BHPA 4EGYA 1RI7A 4M3EA 5JHFA 3CCRI 2AQEA 2WWYA 4KA4A 5K5RA 3C2HA 3NQOA 3RPUD 2KJCA 4P5OA 3DEWA 4BEHA 5E17F 3A1YA 2CSOA 2DT7B 2L02A 5F6FA 1XGOA 5J6XA 2VT3A 3ZQHA 4NC7A 3CUQA 2B0LA 2B9SA 2W1OA 3K4CA 3TDZC 2FF4A 2Y75A 3DEUA 2JUCA 3BR1A 1G8XA 4RA2A 6PAXA 2JVHA 2EZHA 3KEYA 2PN6A 2WBMA 5LBQA 1RIOH 2V26A 1IXRC 3M8JA 3WGIA 4PJJA 2FMYA 3V42A 1MBFA 1WWXA 2BOLA 3OYIA 4HV5A 3TDUC 2HFHA 1X4PA 1MMGA 2LFBA 2L4MA 4HDUA 2QA4I 3S3NA 3LMMA 2UZKA 5FKMA 1YW9A 4Z2YA 5L3CA 1UZCA 2RNGA 2HTJA 3QP5A 3I59A 3IH3A 5M3FJ 1H88C 4AVPA 2NS7A 4L5EA 3ZQGA 5H2FC 2K3PA 4ZYEA 3TQNA 2NXNB 5D5UB 3COAC 3V8KA 3UNGC 4YIRX 3A0BC 4CCJA 2DT6A 3AG4H 1Z67A 3MWMA 3NAUA 3HEFA 1MNMC 3PFIA 1JT0A 3KYCB 1TWFJ 4F52A 4I98B 1WHUA 2LKSA 4R79A 3QYFA 2ZXHA 4DIQA 4XONA 2GWRA 1RZ4A 3QWLA 2BZTA 1BR2A 1QPMA 2IBDA 3HRUA 1SFUA 2ESHA 2X1DA 2ME6A 4Q4ZF 4MLOA 1ETYA 2HKXA 2LY9A 1R22A 2X0LA 5EEAA 4EJOA 1Z91A 4J00A 1U9OA 1IUYA 2KMUA 3DKXA 2PJPA 1PYVA 2HVSA 4CO8A 2VLAA 4OWRB 4QPQA 4DYQA 1TT0A 4X1EA 4A0XA 3MZHA 1E0EA 5H6QA 1ZREA 1NG6A 5E8GA 1S3JA 4LLLA 3RPQA 4Y13A 2K9SA 3PFYA 3NRVA 5E79C 2VUMJ 4HBLA 2IGOA 3TKYA 1VQPI 4A3IJ 3R60A 1BOAA 2Y0MA 4D5FA 4MFDA 3FXOA 4JBAA 2UXNA 4XKWA 2CQKA 1KU9A 2VBXA 4JX6A 1I5ZA 2RKHA 4OIOF 2R7OA 4QLCU 4PGGA 3DPUA 3ULQB 4MHGA 3K4KA 4BEHB 2DN0A 2Z3YA 1WJ5A 3OS1A 1X2NA 1J5YA 3ZMVA 3LQQA 1FWZA 2D1HA 4J19A 3CC4I 2H1KA 2JA6J 3I4NJ 1GUUA 3CUQB 1QQIA 2FXAA 2M4KA 4CH7A 3CMEI 2FD5A 2PBIA 2R7FA 3E6CC 2BBYA 3GTMJ 3SJMA 1O7LA 1N75A 2IA1A 2XAUA 3HHHA 4ZC3A 4JQFA 1ZGJA 3F9KA 2KFDA 3OIPA 1ON1A 1WQ2A 1PVEA 5B66C 2R7ZJ 2R7VA 4LGWA 1CQTA 1LFUP 3LSPA 3RPUA 5ED4A 3I5UA 1JGSA 4RBOA 3QRFF 2Q8KA 3WTZA 1ZR4A 3I59B 3RI4A 2WV1A 3BP8A 2EV5A 1H89C 1JUMA 2Y69H 1K4TA 2BY2A 1RUOA 1I1SA 5J4VA 2AHQA 5D6EA 2DMPA 1BIAA 2M4GA 2J5OA 2RDPA 5BNGA 4XRSA 2IT0A 3IWZA 1HSJA 2HOAA 2DA3A 1U3EM 1W5CC 3RQIA 3ZQCA 4E70A 4M74A 2M5WA 4JK1X 1Y1WJ 3HSFA 4BHCA 1G59A 4P9UA 3UR3C 5K1YA 2YU3A 2IS4A 1YIJI 1FZPB 2ELKA 5DM7F 3E0JB 3EUAA 2IS1A 1VQMI 2L5QA 5ICGA 2XC7A 2H27A 2BXZA 4A3BJ 2J5PA 5GP9A 4XLCA 1R5HA 1AHDP 5IPAA 1ACIA 2V1UA 3VYSB 2MC4A 2F4MB 5E3OA 3V7RA 5LRSA 2JRMA 3BTLA 3P7NA 1JKQC 4XNFA 3ZR8X 4UV9A 2JQ7A 3S17J 5LD2C 1FMWA 5FKNA 1T8IA 4KN7X 3ERMA 4Q48A 3BG9A 2KIMA 3RKQA 2LLKA 2GXGA 4ZYGA 4OU0A 1V3FA 2XIGA 1YS7A 4I0BA 1FTTA 3NEUA 1GXPA 1FYKA 4WK8F 1WJFA 4HLYA 4DBQA 5AIQA 5C4JJ 2VODA 1LNWA 1IV6A 2KKOA 3E6BA 3TW6A 4HNUA 3OY9A 1KU2A 1ONVA 4N9IA 3ZQ7A 1HKTA 1D8KA 2A68F 1X19A 1K83J 5DS9A 3G6EI 2VKEA 3RZOJ 2LF7A 2FJ1A 1LVAA 2TDXA 5BQTA 4KT5C 4ZDPA 4I6ZA 3RSNA 3U1DA 1SANA 1MBHA 2P6SA 3BTCA 3BPVA 1BJZA 3ABUA 2F2EA 2P5VA 3H1CA 4XKBA 5C4XJ 3VOEA 2HXIA 4B47A 2CFOA 3E1SA 3OL3A 5IY5H 4RGXA 4C30A 3OYJA 1BL0A 4BQQA 4E7KA 3FK6A 3PJRA 2FRHA 3MZ8A 4B3XA 2H6BA 4P96A 1YYVA 3MAJA 3S3MA 4YEJA 2DBBA 3K4BA 1LKXA 2W57A 3RYRA 3HOSA 1ETKA 2OZUA 2E7XA 4OAZA 1V5FA 1ZGAA 2FEZA 4EJUA 3WE3A 3CCEI 2E1MB 2FSWA 1C0WA 4BGDA 2X6YA 1DPUA 2KHMA 1VF9A 2M8EA 3FZVA 1O4XA 3TBIA 2CQXA 3RDIA 4CCNA 5IOYA 4OMYA 1QVTA 1RKTA 1K4SA 4A0YA 3PQKA 3VSLA 5DDGA 3M3YJ 1U5TC 4CUGA 5M5YJ 1ZH5A 2Y30A 2R3SA 3AL0C 4JX5A 2EFPA 1XS9A 2EFOA 4I2OA 2RVCA 1FIPA 4XOPA 2GXBA 2E1CA 2OAZA 3EUHA 1APLC 1MNDA 2VJ5A 2X1CA 4AIDA 2MH9A 2NOGA 5TISC 1AOYA 3KP3A 4OIPF 4FTHA 3T1BA 2H8WA 3IH2A 4EQQA 2DDAA 2L7FP 4HX4A 3OIQA 1YI2I 2DYRH 2OQRA 2VQCA 1IW7F 2XGCA 5D8KB 1A6QA 4XLPF 5EGOB 1KQ8A 3R61A 3OR1C 2EFQA 4CXFA 4IHVA 3HG9A 1HSTA 3CCLI 2EPFA 2LRDA 4XM3A 5HLHA 2DXIA 1B9NA 3HGYA 2M0MA 3A01A 3L2RA 2PMZN 1QHGA 4II3A 4A2UA 5M5WJ 3AAFA 3HSRA 3KETA 2V9VA 2UWMA 3K70D 1MJAA 3GFLA 4JYKA 3K6GA 2MG4A 1RNLA 5BOXA 5CJ9A 3GMEA 3H35A 1HDPA 2E35A 3ZPLA 1BI2A 4RB1A 5E1WA 3HJEA 4XN0A 3IC7A 3K4JA 2IRFG 5LGUA 4FCYA 2M7BA 1S9HA 2KRFA 5CQGA 2HNHA 2XASA 2NVYJ 2Y31A 3H36A 2ELHA 4A3LJ 4L9TA 2HYJA 5BPDA 1TW3A 2DK8A 3BG3A 2FQ4A 2TRTA 3LNQA 3CZ6A 4L18B 1JTYA 3AG1H 5L3BA 4CDGA 2PLYA 1ZARA 3ZXSA 1B6AA 2L01A 1ODDA 3O6BB 3S8PA 4S0HB 4WX9A 4A12A 2Z5UA 2DMUA 2ADUA 4V2GA 2EH3A 5JLXA 2E36A 5GAEJ 1H9TA 3N97A 2AO9A 3A02A 3VYTB 1SVMA 3ZMSA 2CG4A 2M34A 2OUMA 2X9DA 2PMUA 4WXDA 4XORA 2CV1A 4NQWA 4CZCA 1R1UA 4A3EJ 4RS8A 3GO5A 2K4JA 3K7AJ 1LFPA 4HNVA 3QOEA 2VQLA 2OQGA 1OMIA 2N8GA 2R7SA 4C2UA 1SFOJ 1PUEE 1K6OA 3TW7A 4BXXJ 5EDNA 1IUFA 3RQ4A 4BDZA 4KMFA 5JLWA 5L3EA 4QWQA 3C2GA 2A69F 3IKTA 2ZKZA 1IXSB 1S5LC 4QIWN 2VXZA 3AG2H 4LK0F 4LJZF 5FFZA 3KLOA 4MTEA 2KDZA 1T6SA 2HQAA 5ILVA 5IYCJ 1W7PA 5B1BH 4F55A 1SFEA 1T95A 3N4MA 3HTSB 5DCMB 5JI6A 4AD9A 3I55I 1N78A 3KX2A 2EB7A 4N4NB 3HGGA 3A4CA 4CA0A 3GFIA 3BROA 2R0QC 4IX7A 2ZB9A 2DOAA 1VQ7I 1D5VA 1OCPA 5J40A 1X1PA 1G3YA 2P5KA 3GVAA 1R1VA 3FKJA 4XK4A 5LGNA 2OBPA 1V5EA 1JHFA 3LSMA 1PP8F 1LB2A 1Z1DA 1UFMA 3JCUC 4PDKA 4A3JJ 3VPRA 1I27A 1GLNA 2KJBA 2OF7A 3M9AA 3DFGA 4BS9A 2XAQA 1CGPA 1A31A 4KDPA 3S1NJ 4A3GJ 3J7AY 3GUDA 5K7HA 2MYSA 3PNTA 3G1MA 4A0ZA 1I6HJ 3LWFA 3OSFA 2W7NA 1Y0UA 1OR7C 2PFBA 2DOEA 2P7VB 3AG3H 2QLZA 3MCZA 5GAHJ 1D5YA 2PMHA 4R8HA 5LHHA 1X1CA 4HZFA 2ZNYA 4Y17A 4LG3A 3WODF 3F8MA 2JRTA 2PI0A 2VT2A 3BZKA 1B9MA 2LYCA 4LMYA 2K9MA 2X6WA 5F04A 2STWA 3LFUA 3H9GA 3T5XA 1JJ6C 4G94A 5FKKA 5D5VB 3GWZA 3PNVA 2RV8A 2K27A 2FMLA 1JKPC 5EEGA 3KYLA 2X48A 3QPLA 4DYRA 2GQQA 1QU3A 4DW6A 3E5QA 1OCRH 2FA5A 2MGQA 1VQNI 2LDUA 1XX5A 1WVRA 1YW8A 3GW2A 1MBKA 5BMZA 3DF8A 2MLGA 1IN5A 3H3UA 1UJ8A 4A5NA 5JR3A 3G4SI 4ENNA 5D6FA 1W36D 1FBUA 1FP2A 3LSGA 2PJRA 2ZMEC 2O9LA 1J7KA 3A0HC 1ZTRA 1T39A 4S04A 3FMQA 3F22A 1DP7P 3VWBA 4FISA 2H8RA 1DQUA 2LMDA 1FIAA 2EZIA 2Y0SN 1H8AC 4Y3OA 1BC7C 1B72A 1ZK8A 4UB6C 4IJAA 3D1NI 1FYLA 1JKOC 5TRDA 2Y9YA 3BTJA 2QBYA 3DWLE 5D5XB 3HTUA 3MKYB 3OIOA 4YIFA 2QM3A 2XGDA 3ZQLA 2F4IA 1FPQA 4R1HA 1FEXA 3BG6A 3ASOH 4M3GA 3DBRB 2ZFUA 5EEHA 3LSRA 3WTSC 2NNYA 1RRJA 4HQEA 2FX0A 3U9GA 2M45A 4GXOA 1O3RA 5GAGJ 2W85A 4LLNA 1VI0A 4LOCA 4NB5A 5DD8A 3I71A 4E4HA 4HSRA 2V9KA 1XCBA 5K7FA 3J80K 4U0YA 1MBGA 4B43A 2XPWA 1YJ9I 4A6EA 2XF6A 3T8TA 2CWEA 4F3QA 4L9VA 2K9LA 1PJRA 3HOVJ 5TGTA 3JRCA 4AU7A 4MFEA 4ZYHA 1P4XA 2CO5A 3C1DA 2LKXA 3G73A 2EILH 4BE0A 1K78B 1P6RA 1KONA 2DA4A 1T33A 2P8TA 1HKQA 3HPHA 3E97A 1STZA 2VJIA 1ETQA 2EIKH 1BW6A 4OAYA 3J81Z 2BW3A 2Y2ZA 2FE3A 1W0UA 3HKZN 1WI9A 3U1KA 4EM2A 2LNBA 2BY3A 2VOPA 1YIOA 2YSRA 1F5TA 1TQPA 4KICA 2A5WA 3G3ZA 4YFNF 3QAHA 1WI3A 5LHIA 3L9FA 1IN6A 2D2WA 3I4PA 5HS7A 1E3OC 3S93A 4KISA 2PQ8A 2EWNA 4ENKA 2WA0A 3IV5A 2NS0A 3M8FA 2H94A 4HF0A 2GA2A 3H9QA 1Y1VJ 5CVIA 2PJRB 1U0JA 2KPMA 5FLXZ 4MQVA 1I39A 4YRVA 2CV0A 1GXQA 2M8GX 2WV0A 2KLOA 2KIUA 1JTXA 2VC0A 3FXJA 4IO9F 1U8RA 2ACJA 4ESFA 2Z1DA 5B5EC 3GZ6A 3J80Z 1FYMA 1S29A 1B72B 5D4RA 2Y9ZA 3G1LA 2W25A 2MBFA 3BPXA 1K7AA 4BYYA 1DGRM 4UV8A 1RC9A 2YU9J 2QBYB 3CDLA 4D0PA 3DTKA 5D4SA 4NBQA 5FJ8J 4XLNF 2CUFA 4PGHA 2GZWA 1ETWA 1LEBA 4A3FJ 1WH7A 2JPCA 1YX5A 2XVCA 2P7CB 2XGXA 3LQRA 5BPIA 4S05A 2LSOA 1JJ8C 3K4MA 2JT1A 3L2WA 3KYDB 4EM0B 3ZRGA 2LP0A 1B59A 2IAIA 3QU6A 2LK2A 1TNSA 1YJNI 3HXLA 1FSHA 3RJPA 1F1ZA 5HODA 2JA8J 1K79A 3H0GJ 2XUBA 2W00A 1MH4A 4BJ6C 4HAMA 1FC3A 1DU0A 2FBIA 3L09A 3LSTA 3GX4X 1IDYA 1T0FC 2E60A 2MW8A 1UCRA 2NOJB 3QQAA 3WU1B 3BQYA 4G6DA 4G7ZF 1WH5A 1RUNA 4E7HA 2HDDA 2QQ9A 3SFIA 1VQ9I 3HUGB 2P4WA 2ZSIB 3O8HA 5DV5A 1XPXA 4GYIA 3OYCA 4XLFA 3FWEA 4X6AJ 1TWHJ 4XKVA 4LG0B 3GFMA 1YE9A 5DYMA 2LR8A 2A61A 3EPZA 3CCVI 3Q5FA 4IRIA 4UUSB 1OCOH 1FY7A 2BW3B 4IEJA 1SFXA 1XCVA 2EIJH 4U7DA 1K61A 1AU7A 1TC3C 3BR3A 4LK1F 1R36A 4D9JA 3S1RJ 3SYTA 2HR3A 3CLQA 2NVTJ 2DU9A 4XRSG 1XGMA 2OCEA 3PNYA 4RGUA 3L2QA 4XOTA 2DMTA 3FIWA 5JVTA 4FX0A 4I01A 1WPKA 3L7WA 4RM2A 4D7NA 1BIBA 1EKEA 2FQ3A 2ZXIA 1IGNA 2MD5A 4AIJA 4BUPA 1ZRCA 1H0MA 1OISA 3K2ZA 2CQ7A 5HDKA 4M6VA 2E2HJ 2NYXA 1R4MB 2GAUA 4G12A 4UUVA 4IHTA 3OOUA 2DJNA 3H5RA 1Z9CA 4QPOA 3KP6A 3F23A 1REPC 4WCGA 3BDDA 5DUIA 3BR6A 1X1DA 4UVCA 2V9PA 1YRNA 1YS6A 1HC8A 1MJBA 2VBYA 3BR0A 4PJMA 1IAWA 1TL8A 1HBXG 3CLOA 4AWXB 2W84A 2ZXJA 1XMKA 4KITB 4IOCF 3ECOA 1X2MA 4BJTA 3HRMA 2A07F 2KRHA 2WY8Q 4RDUA 1VFCA 2FU4A 4MEYF 2CGPA 1JGGA 2I10A 1NHAA 1F43A 4C2MJ 1MGTA 4ZZDA 2XGEA 3GLXA 4MQ9F 1XDUA 1OLTA 1FOKA 3UKGA 4OINF 4II2A 1RETA 3ELKA 1JT6A 1OYWA 3KP7A 2V4JC 2VBWA 3A03A 1W0TA 1ETXA 5B3SH 4B3AA 2CFXA 3I64A 2DMQA 1BI0A 1GVDA 4A3MJ 1Z77A 5GTHC 1MDMA 1XSDA 2D1VA 2G7HA 3LSHA 5J1RA 4U7BA 2BHZA 1W4MA 4M9XA 1XG1A 2EBIA 1VQ8I 3JRIA 5FRNA 2HPMA 3SZGA 3KP2A 3ZCOA 3CJTB 4PK4A 2RNJA 4BL0B 2MD0A 2QQAA 3KCCA 3OL4A 4B8XA 3BCAA 3SEZA 4L0YB 5IP6A 2QWWA 4L5IA 4PZJA 5DUKA 1FOXA 3W2VA 2LOOA 2KISA 5HLTA 3CCMI 3LFKA 1P9QC 2JZYA 2VQHA 1BN5A 2WC2A 1ZRDA 3K1NA 1UHSA 1PUFA 3IAM2 4BJ5C 3OS2A 4XLAA 3FISA 2DQLA 2G0EA 3B6AA 4LITA 2XDVA 3B6CA 5EGOA 3H3VK 5DCFA 3ABMH 4CICA 2VBZA 2OV7A 2M0CA 4ENJA 3GTGJ 3I9V2 2HDWA 2R5ZA 3CF2A 1Q1VA 3CUOA 3OYBA 4Q5SF 3WU2C 4OOIA 2OU2A 1X1BA 2FNPA 2KL4A 2K7LA 3CP8A 3M1EA 4DNCA 4FT8A 4IVNA 4ZYDA 1A04A 2L4AA 3FHNA 2HKOA 4XL9A 5E20A 4IOAF 2FOWA 1YRNB 2L9NA 3DEEA 3DLAA 1D8JA 5EZHA 2DO7A 5FFXA 2Q2EB 3PQJA 3K1PA 3BJOA 4HOBA 2DTRA 2ZBKA 4NC6A 3RIRA 2OA4A 3CC2I 3CTAA 3DTIA 3V8JA 4EGZA 4GFBA 4RB0A 2RREA 5CVVA 3I0TA 4BE2A 4E7LA 2O6GE 2R7RA 4W1UA 1EH6A 3IWFA 3WGHA 1TQIA 4IRGA 3D5SC 4P55A 2F5VA 5E1ZB 2E1MC 4YFXF 1YITI 4C3IJ 4KFCA 1LUJB 3F8CA 2MABA 2ISZA 1ETVA 2K85A 3TO6A 3ERED 2Z33A 4EJWA 1FMVA 4Q47A 3W6VA 2DTZA 3LOCA 2ECCA 1GVJA 2LTPA 2X1EA 5J1UA 1SC7A 2OC6A 5H6RA 2I8DA 3SFZA 1MDMB 3HB9A 4LB5A 3HOWJ 2BE5F 3SZTA 4E7ZA 5A2QK 4H4KC 2VOOA 2VC1A 2QKMB 4U0VA 2QSHX 3KP4A 5ICFA 4I09A 4ETSA 5KCMA 1P7IA 2IS6A 3HOZJ 4K2EA 4AYBN 1ZKGA 1JHHA 1U9NA 1YHQI 3P9CA 2OCCH 1AA7A 1Z21A 1O3SA 3BG5A 5IOZA 2AS5F 4XR6A 2EFWA 3I56I 3H0DA 5J8CA 3Q9SA 3GZNB 3KZZA 4XIDA 1XTAA 1UELB 2WAQN 5DCMA 4HYEA 2QYOA 4RAGA 4G6TB 3F21A 4MEXF 3EYYA 3AL0B 1R5GA 4IHSA 3QPSA 1PUFB 1ZLJA 3CCUI 1HOMA 4HX7A 5FLMJ 1TWCJ 1ZN2A 3L00A 3D5LA 1L3LA 3U2RA 4O3MA 1V55H 5C3EJ 2V1NA 2XSDC 1X3UA 2F5EA 1Y6IA 5HVQC 4N4OB 5ICCA 3B73A 2L9RA 1HW2A 5E8IA 2R5ZB 4V19K 2NVQJ 1QNTA 1LDJA 1HF0A 4WXHA 1NH3A 3HOYJ 2XAGA 2L2OA 3ZN0A 3M4OJ 4DZJA 3DCFA 3PO3J 4H0EA 2OTLI 3F0CA 4BH9A 5K5QA 2JSCA 2X4HA 2GXAA 2E1NA 3TP3A 3BLYA 5FROA 3WE2A 4XBFA 4XLHA 2KZVA 4A69C 4L9JA 2GOXB 1I50J 2BV6A 4V2FA 1MBJA 1MKMA 3C2BA 4AIHA 2XRNA 3JTGA 5A2QZ 3ISPA 4X0GA 5FLVA 2G9WA 3D5RC 2HZTA 1PP7U 3CC7I 3R0AA 5FKOA 4CCLA 4RAZA 5KNLA 1IZ1A 2QSFX 1J59A 3GTKJ 3JRDA 4JX4A 4ESJA 5FKLA 2BVLA 4B1RA 5F1RA 3Q9VA 3GCMA 2DA6A 1X3WB 3ZOBA 4PSXA 4RLQA 4IZZA 1OYIA 1TLHB 3PIOF 2LBFB 3IAS2 4M3FA 3I4MJ 4EV0A 1BR1A 4MO7A 2VKHA 5LGTA 3HIFA 2R4GA 2V79A 2EINH 2W24A 4DGWB 5LLQA 1ZLKA 1A35A 1YJWI 1BM9A 2QQBA 3FMRA 3HPGA 3CMYA 1F36A 4CGZA 3KP5A 1RKWA 1EH7A 2IA0A 3FF5A 4A3DJ 1FNNA 1BA5A 5IT3A 5FGMA 2MLKA 5HS9A 2BGCA 2HQRA 1HQCA 1KYZA 1VTNC 5E3NA 2F5DA 2CW8A 2VL8A 4LB6B 2D45A 1MIJA 3BWGA 2VI6A 2L3DA 1IN8A 2ZXWH 4Y4RA 5AIPA 5HLIA 4IKFA 3K10A 5E18F 3E3VA 1G2HA 3HRSA 2YUSA 3PM1A 4GDFA 4AYBA 4CHUA 1DU6A 1UG2A 4DQ2A 2O61A 2FBKA 2JWTA 4NNJA 1XMXA 2FNAA 3CJNA 1I1GA 3P9KA 2LH9A 1POGA 1IJWC 4ZYAA 2DMNA 1VQKI 1ZGWA 4AM3A 1X58A 3OMYA 2HI3A 3DU5A 4O5VA 4B44A 2FUG2 3MFKA 2DCEA 4UVAA 4U88A 2LC2A 3FHZA 2IP2A 3ECHA 1JI8A 3DP7A 1TQMA 3CQZJ 3ASNH 1WJDA 3MMYB 3BTIA 3I3LA 2OTJI 2P5LC 1K78A 2KRCA 4YG2F 5TJJA 2PMZA 1F9NA 3DTEA 5IT9K 1J9IA 2A05A 3GXOA 2H6CA 3N05A 4OIQF 2GBYA 2YPRA 2QQ8A 4ANJA 2IGNA 5HNFA 2XPUA 3I58A 4G7OF 3FBNB 1X3ZB 2DJIA 3ZQFA 1XSVA 1ZAOA 1ZG1A 3LL7A 4G9YA 1SD6A 2A6HF 4NHJA 3IL2A 1OCZH 1RESA 2CQQA 4AVZA 2BHYA 1WZ2A 5F1JA 5ILSA 1Q1HA 3QODA 3OSGA 2O7OA 5IYDJ 2PG4A 2OPTA 4HDVA 2L54A 3H3ZA 1Y8RB 1WCMJ 1WGXA 5L3DA 3RKYA 2ZJ2A 1OQYA 2DA2A 3HOUJ 4FASD 4XKCA 2QUFA 2WADA 4DBRA 4ZDOA 3DV8A 3FXLA 4IL6C 4J01A 2NRAC 3F6OA 5EZGA 1T56A 3DBLB 3AKZA 2HOSA 1ORKA 3DU6A 3W6JB 3NWTA 1TWAJ 4B48A 2VKDA 4BQOA 2LKPA 2CUZA 3OYKA 2DW4A 1QRYA 1NTCA 3CDHA 4FE4A 2KIFA 3TP0A 1G4DA 1OCTC 1OYYA 3EETA 3EYIA 1MJ9A 2NVUB 1IG7A 4ESBA 5HNHA 4DJAA 1BI1A 3OOPA 3ONQA 5KAFC 2VXDA 2ZMEB 2RAEA 1BJAA 2AXTC 2GIVA 3SDGA 4ASNA 3GTJJ 1XB4A 2Z16A 3MKLA 1FLIA 2DFEA 5IT9Z 3JTHA 1I3QJ 3CMMA 3F8BA 3FM3A 3GEZA 4LD5A 3K2AA 2GIZA 3FXKA 2K3FA 2LY1A 2R7XA 4MNUA 2COBA 4XN3A 1K6YA 3DKYA 3GTOJ 4PFPA 3OYEA 3GTQJ 2EZLA 1IO2A 1U2WA 2LG4A 3FXMA 2C6YA 1D3YA 1LJ9A 3DLLF 1G3SA 4KIFA 2CW0F 4FETA 3GLLA 1QZZA 3O2PE 5M3MJ 2JUGA 2IPQX 4HSTA 5DTDA 1Z3YA 3HUGA 4HA8A 1MZBA 4PSWA 3BOQA 1R23A 4C2TA 1WJBA 3CJRB 5FB2A 1MMSA 3OYHA 3MEXA 1GV5A 2BYVE 4LG0A 4RAYA 3OV8A 3MD2A 3RKXA 1WJAA 1J2XA 2JA2A 4UUSA 4M9ZA 5KHDA 3KIOA 1OPCA 1T0FA 2YX7A 4W97A 3J7YJ 2V1DA 4E7JA 2WY7Q 1SD7A 2M9HA 1S7OA 2MH2A 3SXYA 2R7WA 4HW0A 4XLEA 4ZDLA 4D7MA 4BQNA 2NVXJ 3T8RA 2IXSA 3FDYA 2E2JJ 2FOKA 1AKHA 1Z05A 3GF2A 4UHTA 1MSFC 3C3WA 4RLFA 2VE9A 3WHCA 4BQAA 1E2XA 5HDNA 3REOA 3CCSI 1EF4A 1X1AA 4RB2C 4BHBA 3G2BA 3VYRB 2NNNA 4HF2A 1UB9A 2O8XA 1M1EB 2P81A 1TT5B 1WFXA 4NDLA 4ITVA 2UXXA 2HOTA 2EJRA 2R7QA 2QVOA 5HLGA 3L2UA 3HYIA 4BNCA 4PJNA 4EJTA 2HYFA 1E17A 2K9NA 2TCTA 2X51A 3PIPF 1P2FA 3CJQB 2XB0X 3L2CA 3DXJF 4BXFA 1YQAA 1NK3P 5IP9J 3LAPA 4TV7A 4IXAA 4KT6A 1XGSA 2Y0SA 2R7TA 1E3HA 4L9NA 2XF5A 3RTRA 1XN7A 4ENMA 2KP6A 1WSUA 1WKMA 3KEOA 4AIKA 4MIMA 2KT0A 3FXRA 2JA5J 2DAOA 1SD4A 3ESWB 4HF1A 2HQNA 1SAXA 2WB1N 4BY7J 3W2AA 2HVQA 3K4NA 4WF2A 2QENA 3VFZA 4GCVA 2XSJC 3LA7A 3FM5A 2ESNA 1S7EA 2QGUA
chains in the Genus database with same CATH topology
3BCAA 3K70D 3SEZA 3K6GA 3VYUB 4IQJA 3CP2A 3W2VA 3OR2C 4CCOA 2LOOA 3H35A 5HLTA 1P9QC 4NQWB 2VQHA 4XN0A 1BOBA 3K4JA 4RM3A 2L9SA 4XQFA 3IAM2 2BVMA 2M7BA 1S9HA 4BJ5C 3OS2A 4XLAA 4BACA 5CQGA 2HNHA 1MNEA 4LITA 2XDVA 3NWSA 2OV7A 4BDYA 2JSPA 4PFOA 3I9V2 2HDWA 3CF2A 3CZ6A 3OYBA 2HVRA 1X1BA 2KL4A 3ZXSA 5CKTA 3ZQQA 3CP8A 3S8PA 2M7AA 1X4OA 2R7UA 2K5CA 4LIVA 3H9JA 3FHNA 4XL9A 1WJEA 2HU9A 2L9NA 3DEEA 3VYTB 3DLAA 2OUMA 4F93B 2Q2EB 2CV1A 4XORA 2A6TA 4CZCA 3VSKA 3HKZA 1LFPA 3QOEA 3TMOA 4ZTJA 2VQLA 3DTIA 2MFZA 4HNTA 2R7SA 4C2UA 2RREA 1UG0A 3RQ4A 4BDZA 1D0XA 4BE2A 4E7LA 1EA3A 3C2GA 2R7RA 2ELJA 2W82A 2VXZA 4F92B 3D5SC 2F5VA 2UV1A 2E1MC 1IRXA 2HQAA 3PSFA 4F55A 1T95A 3BG7A 2MABA 3K70C 3HC7A 1N78A 3KX2A 4N4NB 1Z3XA 3ZGKA 1FMVA 3A4CA 3PSIA 4CA0A 1MMAA 1MMDA 1SFKA 2QKLB 2WAEA 5CPRB 2X1EA 4IX7A 1LVKA 2DOAA 2OC6A 2I8DA 1W36C 4E7ZA 1QHHD 4H4KC 3FKJA 3HL2A 1TZLA 2CV2A 3OYDA 2QKMB 2VB6A 1V5EA 3LSMA 4KJZA 5KCMA 2IS6A 3OS0A 3BC8A 4E7IA 1GLNA 3A2KA 1VZ0A 4BS9A 1AA7A 1Z21A 3J7AY 4C9YA 4XR6A 2MYSA 3GBGA 3PNTA 3H0DA 1DGWY 3S32A 2W7NA 1OR7C 1UELB 3OYLA 1BR4A 4G6TB 2WB1A 5JHFA 3AL0B 2AQEA 1X1CA 4LG3A 3L2VA 3C2HA 3OYAA 3RPUD 4P5OA 3W3CA 3D5LA 4BEHA 2LYCA 2K9MA 2X6WA 2V1NA 3LFUA 3A1YA 2DT7B 3H9GA 1Y6IA 5HVQC 4N4OB 3PNVA 4NC7A 3KYLA 3HOTA 2O5RA 2VQGA 1QU3A 2W1OA 3K4CA 2L2OA 1G8XA 2JVHA 3KEYA 2WBMA 4CCMA 2V26A 3M8JA 4PJJA 3BLYA 5FROA 3DQVC 4XLHA 3V42A 1W36D 2KZVA 2PJRA 2BOLA 2E5ZA 2GOXB 3LSGA 3OYIA 3OYFA 1X4PA 1MMGA 3VWBA 3S3NA 1DQUA 3LMMA 4BE1A 3PL8A 4X0GA 2RNGA 4Y3OA 3D5RC 2CMPA 4CCLA 2K3PA 5KNLA 3UNGC 4PUSA 4CCJA 2DT6A 1R6RA 2BVLA 3DWLE 3IUOA 4PJLA 3MKYB 4F52A 2F4IA 2VJJA 4R79A 3QYFA 3BG6A 2ZXHA 4PSXA 4RLQA 4XONA 4DIQA 4IZZA 2ZFUA 3H5NA 2LBFB 3IAS2 1BR2A 2X1DA 4MLOA 2Z2SB 3OWTA 1BR1A 2VKHA 2R4GA 1D0YA 4DGWB 3QYBA 4J00A 3HPGA 2KMUA 4E4HA 3DKXA 4HSRA 2V9KA 1PYVA 4GRIA 2HVSA 3EUKL 4B43A 4OWRB 4QPQA 2VLAA 3S3OA 2W4SA 1D1CA 1TT0A 1SAUA 2XF6A 1E0EA 4F3QA 1NG6A 2K9LA 1PJRA 3PFYA 2IGMA 5TGTA 2VJ4A 4AU7A 1Y56A 2CW8A 2IGOA 2VL8A 4XMYA 2IGKA 2ZSHB 2VIXA 3FBIB 1ERDA 4Y4RA 4IKFA 3K10A 4XKWA 4BE0A 2LBFA 1KONA 2R7OA 4AYBA 3DPUA 3HPHA 2VJIA 3K4KA 4E7SA 4BEHB 4NNJA 1WJ5A 3OS1A 1DP3A 4E6KG 4OAYA 2BW3A 2LH9A 3OYMA 4ZYAA 2E5NA 2V6EA 2M4KA 3OMYA 4CH7A 3DU5A 4B44A 2FUG2 2A5WA 4CCKA 1WJCA 4Y33A 2DCEA 2LC2A 3LSIA 1JI8A 1N75A 3W2WA 2XAUA 3S93A 4ZC3A 4JQFA 4KISA 4D1QA 3LSKA 2WA0A 1WJDA 3F9KA 3I3LA 3MMYB 3OIPA 3H9QA 2PJRB 1U0JA 2KPMA 2KRCA 2R7VA 2PMZA 3DTEA 4YRVA 2CV0A 3MKWB 2CUJA 2X6XA 2CW7A 2KLOA 5LFAA 3H5AA 3N05A 3IP4B 2Z1DA 4ANJA 2IGNA 5HNFA 2M3AA 4IQ4A 3FBNB 2DJIA 3LL7A 2Q1ZB 3DPTA 2L7KA 3RCOA 4AVZA 1DGRM 3DTKA 2CH0A 2M4GA 3QODA 3U21A 3PUBA 1YX5A 4FASD 4XKCA 1G59A 2WADA 3UR3C 4DBRA 4ZDOA 3K4MA 2IS4A 3M1CA 3L2WA 1MW7A 4J01A 3ZRGA 3E0JB 3EUAA 2IS1A 3AKZA 1D1BA 2L5QA 3DU6A 3NWTA 4B48A 2XC7A 3HXLA 2VKDA 4BQOA 2HZDA 2CUZA 4XLCA 3OYKA 2LREA 3VYSB 2W00A 2MC4A 4BJ6C 3TL4X 1T0FC 2E60A 5HNHA 2NOJB 4DJAA 3ONQA 4XNFA 2JVGA 2VXDA 3ZR8X 4E7HA 5LD2C 1FMWA 3HUGB 2ZSIB 2HPIA 4EATA 2WAFA 2Z16A 3OYCA 4XLFA 5HOOA 2AQFA 4XKVA 3SEQA 3CMMA 1YE9A 3K4LA 4LIUA 1WJFA 4DBQA 2LY1A 2R7XA 3EPZA 1YX3A 4XN3A 3DKYA 1K6YA 2BW3B 3OY9A 4HNUA 4PFPA 3OYEA 4P1WA 4D9JA 4ZTFA 2LG4A 3SYTA 1X19A 3EUHC 4ZDPA 3RSNA 4FETA 3PNYA 2KQRA 3L2QA 1NG7A 3DPLC 4XKBA 4XOTA 2JUGA 4HSTA 1D1AA 1Z3YA 1UAAA 4B47A 4C2TA 4PSWA 2CFOA 3E1SA 3OL3A 1WJBA 3CJRB 3OYHA 4C30A 3OYNA 4RM2A 3OYJA 4BQQA 4E7KA 3PJRA 2ZXIA 4HG2A 2RQQA 4B3XA 4BUPA 3S3MA 4YEJA 3MD2A 1WJAA 3K4BA 1LKXA 2JA2A 2V7FA 1MMNA 3HOSA 5KHDA 2VPLA 3OOUA 4OAZA 1V5FA 3H5RA 2WAQA 2CS3A 4E7JA 4NUBA 2WY7Q 4QPOA 4BU2A 2E1MB 4BGDA 2X6YA 4CSWA 1HA8A 2KHMA 3AFHA 2R7WA 4DOZA 4XLEA 3BCBA 4ZDLA 3MKZA 1X1DA 4BQNA 3TBIA 4CCNA 2IXSA 3FDYA 4JOMA 4PJMA 4RLFA 2X85A 3VSLA 4CUGA 4YELA 2UUZA 2XF7A 2VASA 2LY2A 3AL0C 1X1AA 2F6CA 1V5GA 4KITB 3VDXA 3G2BA 3VYRB 4BJTA 2KRHA 2WY8Q 1WFXA 4HPQA 4XOPA 3SDBA 4ITVA 2R7QA 3L2UA 1MNDA 1J09A 1LDKB 4PJNA 2VJ5A 2X1CA 4HEA2 1OLTA 2X51A 3QYEA 4F91B 3CJQB 4II2A 4RMNA 2P0WA 4BXFA 3CESA 2V4JC 4KT6A 2IS2A 2Y0SA 2R7TA 2GOMA 3OIQA 1N77A 2XF5A 3RTRA 1ZELA 4ZJZA 2VQCA 2KDOA 2KP6A 4NC8A 3OR1C 3HG9A 3LSHA 4HRIA 4U7BA 5FRNA 4XM3A 2LRDA 2DXIA 2M0MA 2HPMA 5CQEA 3SZGA 3ZCOA 3L2RA 4U87A 3W2AA 2HVQA 1QHGA 1D0ZA 3K4NA 4PK4A 4II3A 5FRMA 4BL0B 2MD0A 2XSJC 3OL4A 2UWMA 3OYGA 1Z7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZD A; 
#chains in the Genus database with same CATH topology
 3TED A;  3W6K B;  4UY8 I;  3DBH B;  1SMT A;  3BR5 A;  3CP2 A;  2HDC A;  3OR2 C;  2NS8 A;  3CO7 C;  3SZP A;  2ZJP F;  4KIB A;  2ZFW A;  1PDN C;  1BOB A;  3WGG A;  4XQF A;  1HDD C;  4M6Y A;  1FBQ A;  2ZCW A;  5KAI C;  4IHX A;  2KIQ A;  9ANT A;  2Y48 A;  4BXU A;  2JSP A;  4LLG F;  5LHG A;  1KQ9 A;  2HEO A;  4KNY A;  1ZHF A;  5HS8 A;  2HXO A;  2LD5 A;  2HVR A;  1SVL A;  4BKX A;  1QVU A;  2JTV A;  2DT5 A;  1FOY A;  1X4O A;  3E7L A;  3K1M A;  2R7U A;  3JSO A;  3HZJ A;  1HXD A;  1YG2 A;  2EQR A;  1S6L A;  2XB5 A;  2ECB A;  2HU9 A;  1TW2 A;  1VQ6 I;  2ZO4 A;  3HBL A;  2XRL A;  1AKH B;  4F93 B;  2RQP A;  1IRG A;  2RC4 A;  3KPH A;  3WTT C;  2IVM A;  5LRR A;  2E2I J;  3ZMZ A;  3HKZ A;  3KZI C;  1QPI A;  1DUX C;  5CYV A;  4ZTJ A;  1R00 A;  1N25 A;  2MFZ A;  1EH8 A;  1I3A A;  3JAM K;  1UG0 A;  1P7J A;  2DOD A;  5GPA A;  4L5J A;  1EA3 A;  5ERI A;  1W5S A;  2GA1 A;  4M3B A;  4OMZ A;  5BS6 A;  2R92 J;  2ELJ A;  2W82 A;  1LPQ A;  2XRO A;  1NK2 P;  4RGR A;  1XDS A;  4F92 B;  4UNO A;  4P9F A;  4I76 A;  2UV1 A;  4Z6Y A;  3CUQ C;  1T08 B;  3I53 A;  5FO5 A;  1IRX A;  2ZC2 A;  2XAJ A;  3PSF A;  5JHU A;  4EJV A;  1QBJ A;  2GLO A;  5KK1 A;  3HC7 A;  4U0W A;  1Z3X A;  4I7H A;  1KGS A;  3LA3 A;  3PSI A;  1MMA A;  5F27 A;  2Q2E A;  2ZJQ F;  1SVO A;  1R4N B;  2BEO A;  3P9I A;  1LVK A;  1W36 C;  2STT A;  2HOE A;  1ZG3 A;  1XMA A;  4A5M A;  2H1L A;  1XGN A;  4BBS J;  2HQ5 A;  3QPH A;  2JN6 A;  4N9H A;  1QHH D;  2EK5 A;  3BQZ A;  3HL2 A;  1TZL A;  2CV2 A;  2VB6 A;  1IC8 A;  1T2K A;  2XKO A;  5F08 A;  3JRG A;  1HLV A;  1YFH A;  3JRB A;  4E7I A;  1OCC H;  1JXS A;  1XC5 A;  1UST A;  3F72 A;  2DA1 A;  4C9Y A;  1VQO I;  1DGW Y;  1Z6T A;  3S32 A;  5ICE A;  1SEU A;  3TGN A;  1ITY A;  3OYL A;  5EF6 A;  1BR4 A;  2WB1 A;  1KU7 A;  1R9T J;  1Y39 A;  1YO5 C;  2WTE A;  2OD5 A;  3L2V A;  3OYA A;  5FD6 A;  2DFH A;  3WHB A;  3S1M J;  3W3C A;  4ON0 A;  3B02 A;  4KYW A;  1FOW A;  2ISY A;  4XSZ F;  3JAM Z;  2D5V A;  1G3W A;  2YX4 A;  3BY6 A;  2EA4 A;  4HQM A;  2VN2 A;  2BY1 A;  1O3Q A;  2Z9O A;  4FX4 A;  1O7F A;  2ICW G;  3HOT A;  1QO0 D;  2O5R A;  5E1X A;  1B4A A;  1TTY A;  2VQG A;  2XAF A;  1GDT A;  2F48 A;  3ROU A;  4CCM A;  2CUE A;  2CQN A;  1R58 A;  1CF7 A;  2CRG A;  2K4B A;  4KIG A;  3DQV C;  1TNT A;  2E5Z A;  1U5T A;  3V7C A;  3BJA A;  4CZZ A;  3OYF A;  1GHC A;  5EYR A;  3RYP A;  3VOD A;  1YOV B;  2ETH A;  2VE8 A;  4BE1 A;  3KEQ A;  3PL8 A;  2L7M P;  2VKV A;  2CMP A;  1HKS A;  1B1B A;  2EA2 A;  3R0J A;  3FMS A;  3T0Y A;  4F7Z A;  2DOF A;  2E34 A;  2HWV A;  2FBH A;  4RB3 C;  1ZRF A;  4XSX F;  4PUS A;  1U6G A;  1R6R A;  3WG9 A;  3IUO A;  4PJL A;  4WXC A;  4L0Z B;  1S72 I;  4EVI A;  2E19 A;  2LF8 A;  2VJJ A;  5F0C A;  3KLN A;  5B1A H;  2DYS H;  2I5U A;  3ZQI A;  3GTL J;  3H5N A;  3FKI J;  2Z99 A;  4A93 J;  4WWC A;  2Z2S B;  3OWT A;  2DPD A;  5E3M A;  1OKR A;  1D0Y A;  2E1O A;  3C18 A;  3QYB A;  3QU3 A;  5KVR A;  3GFJ A;  3S2D J;  4GRI A;  3BZC A;  3EUK L;  3TO9 A;  3S3O A;  1U8B A;  2W4S A;  2JA7 J;  4QTR A;  1D1C A;  1SAU A;  5AON A;  3L1P A;  3HHG A;  3QPT A;  1VQ4 I;  2HGC A;  2IGM A;  2K86 A;  2LVS A;  2VJ4 A;  4N0B A;  1P92 A;  4G7H F;  1F4K A;  1Y56 A;  3F8N A;  1UMQ A;  4XMY A;  4O6J A;  2IGK A;  5L3F A;  4LFU A;  2ZSH B;  2VIX A;  4M6X A;  5D8L B;  3K9T A;  4HV6 A;  3FBI B;  5JFR A;  1ERD A;  5DM6 F;  4M71 A;  2LBF A;  2QSG X;  4BBR J;  5H20 A;  3IRQ A;  2EFN A;  2ZNZ A;  2L7Z A;  3CMA I;  3S15 J;  3S16 J;  4XRF A;  4ZZL A;  1HW1 A;  4OIR F;  4E7S A;  4Y7N J;  3CO6 C;  2F5C A;  1DP3 A;  4E6K G;  2E71 A;  3ML6 A;  2XAH A;  4I02 A;  3OYM A;  2R93 J;  2E5N A;  4A3K J;  2KZG A;  2V6E A;  2CJJ A;  1W7P D;  1I6X A;  4CCK A;  1WJC A;  4Y33 A;  3S2W A;  3HOX J;  1XD7 A;  3V7S A;  3LSI A;  2DQR A;  3LSJ A;  1TBX A;  2YR2 A;  1ZG5 A;  3E5X A;  4I99 C;  2JPB A;  3W2W A;  4BAY A;  4FHT A;  1JKR C;  1CF7 B;  4FQG A;  3ZMU A;  1YW7 A;  4UUT A;  3LSK A;  4D1Q A;  3S14 J;  2B63 J;  2IA2 A;  1ULY A;  2XPV A;  2BY0 A;  1U5T B;  1TP4 A;  1HW5 A;  3MKW B;  4IHY A;  2CUJ A;  2X6X A;  2CW7 A;  5LFA A;  3H5A A;  3JRH A;  3IP4 B;  3FX3 A;  2IW5 A;  2K02 A;  2ZJR F;  2DDB A;  5CVJ A;  3KE2 A;  2YS9 A;  2JK3 A;  2M3A A;  4IQ4 A;  5GPC A;  1KZH A;  2Q1Z B;  3DPT A;  3H92 A;  2L7K A;  2M2E A;  3IH4 A;  3RCO A;  3ABL H;  3P5J A;  4CYC A;  1UHM A;  1J75 A;  5K7Z A;  2CH0 A;  4IHW A;  3BJ6 A;  3CF5 F;  4QSH A;  3U21 A;  2QCO A;  3C7J A;  2O3F A;  3ZMD A;  3PUB A;  1Y8Q B;  4JP0 A;  5K5O A;  1T38 A;  1VND A;  2JJ7 A;  2OJE D;  3NAR A;  5EJC A;  3GZ5 A;  2Q0O A;  5HDG A;  4KMU X;  2DK5 A;  3LAJ A;  3G71 I;  1MW7 A;  1ZR2 A;  3R6S A;  1R7J A;  4D5C A;  3WTV C;  3M8E A;  1D1B A;  1A5J A;  1Z0X A;  2CYY A;  2ID3 A;  2PEX A;  3K69 A;  2HZD A;  1V4R A;  5FD5 A;  4CYD A;  4GO1 A;  2LRE A;  1EJ9 A;  1IRF A;  5ILU A;  2EV6 A;  3TL4 X;  3KFW X;  1V54 H;  5GTI C;  5IYB J;  3R4K A;  1OR7 A;  1QA6 A;  2JVG A;  1JUP A;  3M07 A;  2V1X A;  3S1Q J;  1BI3 A;  5CVR A;  5F0H A;  3EQL F;  4FE7 A;  3ZN1 A;  2HPI A;  4EAT A;  3GTP J;  2WAF A;  2MSY A;  4G6Q A;  1P4W A;  5HOO A;  2AQF A;  3SEQ A;  5E3L A;  3K4L A;  4LIU A;  3OYG A;  1ENH A;  3Q0W A;  3Q3S A;  1YX3 A;  3WU0 A;  2OZ6 A;  4GYG A;  1HCR A;  3J7A O;  3BZ6 A;  5GAD J;  2P6T A;  1RR8 C;  1BBY A;  1FSE A;  2G7U A;  5J8F A;  3CCQ I;  1AWC A;  4P1W A;  4ZTF A;  5J1Y A;  2AXL A;  5M5X J;  1W5T A;  4MGR A;  2X6O A;  1JUS A;  3EUH C;  1G6N A;  2ME0 A;  3CCY A;  2DPU A;  3E6D A;  1RPW A;  3E6M A;  2HTS A;  1XSX A;  5J3L A;  2DI3 A;  5DD4 A;  1Y0N A;  2KQR A;  4AC0 A;  1NG7 A;  3DPL C;  1IN7 A;  3PO2 J;  2ZME A;  1D1A A;  3HSE A;  1KU3 A;  3M7G A;  5JVG F;  1UAA A;  2PX9 A;  1IXC A;  3F6V A;  3GYH X;  3HM5 A;  3OYN A;  1ON2 A;  3V4G A;  3JR9 A;  4HG2 A;  2RQQ A;  4A3C J;  4RAF A;  3WTW C;  1OFC X;  3E5U A;  2DA5 A;  3G1O A;  1KQ0 A;  2K40 A;  1FT9 A;  2V7F A;  1MMN A;  2M30 A;  2VPL A;  3WTU C;  1FP1 D;  2WAQ A;  2CS3 A;  1RR7 A;  4NUB A;  3EDP A;  3QOP A;  4BU2 A;  4ZH4 F;  4CYC B;  1FJL A;  4CSW A;  1HA8 A;  3AFH A;  4DOZ A;  3BCB A;  3MKZ A;  2E7W A;  3BR2 A;  3HDD A;  1LE8 A;  3IRR A;  1FTZ A;  1E3P A;  2R5Y A;  4JOM A;  3TOA A;  1GV2 A;  3LA2 A;  4DZP A;  1S7A A;  2X85 A;  2RGV A;  3MZY A;  1SMY F;  1B8I A;  3FXU A;  1VQ5 I;  1DPR A;  5D5W B;  1LQ1 A;  4YEL A;  2UUZ A;  2XF7 A;  2VAS A;  2LY2 A;  3CDI A;  2GM4 A;  1OJL A;  2F6C A;  1V5G A;  2H09 A;  3VDX A;  3A01 B;  1IV8 A;  3S2H J;  1YLF A;  4HPQ A;  3SDB A;  2B7E A;  3FXQ A;  4UXN A;  1H9G A;  3JRA A;  3RKW A;  3ZP5 A;  1J09 A;  1LDK B;  1MH3 A;  4HEA 2;  4B09 A;  3QYE A;  4F91 B;  4IPA A;  2JMW A;  3DKW A;  4B4C A;  1IRZ A;  4RMN A;  1BW5 A;  2P0W A;  4IRH A;  4C3H J;  4ABZ A;  3CES A;  2IS2 A;  3RZD J;  2GOM A;  4EMS A;  4YFK F;  3MN2 A;  4XIC A;  1O3T A;  1N77 A;  1P4A A;  1ZEL A;  2EZK A;  2QZ8 A;  4PJ0 C;  4ZJZ A;  2KDO A;  2CU7 A;  4NC8 A;  2RN7 A;  5EG0 A;  4HRI A;  1JE8 A;  4M72 A;  1A36 A;  3CD6 I;  1LEA A;  4HLX A;  1U78 A;  1BC8 C;  2IEK A;  5CQE A;  2DFI A;  2A3S A;  4U87 A;  1D0Z A;  2O03 A;  2O0Y A;  1FX7 A;  2V6C A;  3ABT A;  4XRM A;  5FRM A;  2F4O B;  1KYW A;  2O8K A;  3SQN A;  1QGP A;  2HYG D;  2F5F A;  1Z7L A;  3M1C A;  4RGS A;  3WG7 H;  4Y15 A;  3FK7 A;  3JW4 A;  3VYU B;  4IQJ A;  2A6E F;  1TWG J;  3K0L A;  2BXY A;  3O3K A;  4CCO A;  4M73 A;  2NAZ A;  3J7Z I;  4NQW B;  1QZE A;  4RM3 A;  1UHW A;  3I54 A;  2L9S A;  1T98 A;  5J4Y A;  1Z6R A;  2BVM A;  3WTX C;  3X2Q H;  3ABK H;  4BAC A;  4IF4 A;  1LDD A;  1MNE A;  3F8F A;  5C44 J;  2MC3 A;  4PCQ A;  5F64 A;  3J81 K;  3NWS A;  1YTY A;  2M1B A;  4BDY A;  2HS5 A;  1SD5 A;  3V8L A;  4PFO A;  3HRT A;  2QEX I;  5LEJ A;  4A6D A;  1MBE A;  1QZY A;  5CKT A;  3ZQQ A;  3JRF A;  5J47 A;  1W7P B;  4AUX A;  1VQL I;  1R1T A;  2M7A A;  1GT0 C;  2K5C A;  4LIV A;  3H9J A;  4M3D A;  3JRE A;  1LE8 B;  1WJE A;  1MSE C;  4EEF G;  2R7D A;  4KN4 X;  2R5Y B;  2MA3 A;  5IP7 J;  2A6T A;  2VON A;  5FLX K;  3VSK A;  1B8I B;  1MD0 A;  3TOB A;  2EV0 A;  3TO7 A;  1J0R A;  2M87 A;  2DLL A;  3TMO A;  3PUF A;  4HNT A;  1ETO A;  4YII A;  4C3J J;  3KZY A;  1D0X A;  3BT9 A;  4Y52 J;  3Q0V A;  4HX8 A;  4KUM A;  4UB8 C;  1KA8 A;  1S8N A;  5L3G A;  2VPR A;  1G3T A;  2QF7 A;  2L0K A;  3F3X A;  5F0F A;  4EM1 A;  2DA7 A;  2XV4 S;  3D0S A;  3QP6 A;  2A5Y B;  4BY1 J;  1R71 A;  3CCJ I;  3BG7 A;  1ZQ3 P;  3K70 C;  3IHU A;  2COM A;  2K9Q A;  3ZGK A;  1Z7U A;  4GGG A;  4I0A A;  1IDZ A;  1W1W E;  1MMD A;  1L0O C;  1SFK A;  1EV7 A;  1USS A;  2WAE A;  2QKL B;  2XKP A;  5CPR B;  4UVB A;  3VEP A;  2W48 A;  3ZMT A;  4G8X A;  4M9S A;  3MVP A;  3O8G A;  3Q0U A;  1IN4 A;  5EG0 B;  1IF1 A;  3SHF A;  3IKV A;  3OYD A;  3MQ0 A;  5LEK A;  4KJZ A;  1DDN A;  1A6I A;  3JSP A;  1O57 A;  3OS0 A;  2IJL A;  5CVU A;  3BC8 A;  2DFF A;  3A2K A;  3VB2 A;  1VZ0 A;  1LFB A;  4DYC A;  3WTY C;  1FBS A;  2XHK A;  5DEQ A;  1R5I D;  4MTD A;  5CLS A;  2L9V A;  1R49 A;  2EIM H;  3GBG A;  1WRJ A;  2ID6 A;  1ZYR F;  4BHP A;  4EGY A;  1RI7 A;  4M3E A;  5JHF A;  3CCR I;  2AQE A;  2WWY A;  4KA4 A;  5K5R A;  3C2H A;  3NQO A;  3RPU D;  2KJC A;  4P5O A;  3DEW A;  4BEH A;  5E17 F;  3A1Y A;  2CSO A;  2DT7 B;  2L02 A;  5F6F A;  1XGO A;  5J6X A;  2VT3 A;  3ZQH A;  4NC7 A;  3CUQ A;  2B0L A;  2B9S A;  2W1O A;  3K4C A;  3TDZ C;  2FF4 A;  2Y75 A;  3DEU A;  2JUC A;  3BR1 A;  1G8X A;  4RA2 A;  6PAX A;  2JVH A;  2EZH A;  3KEY A;  2PN6 A;  2WBM A;  5LBQ A;  1RIO H;  2V26 A;  1IXR C;  3M8J A;  3WGI A;  4PJJ A;  2FMY A;  3V42 A;  1MBF A;  1WWX A;  2BOL A;  3OYI A;  4HV5 A;  3TDU C;  2HFH A;  1X4P A;  1MMG A;  2LFB A;  2L4M A;  4HDU A;  2QA4 I;  3S3N A;  3LMM A;  2UZK A;  5FKM A;  1YW9 A;  4Z2Y A;  5L3C A;  1UZC A;  2RNG A;  2HTJ A;  3QP5 A;  3I59 A;  3IH3 A;  5M3F J;  1H88 C;  4AVP A;  2NS7 A;  4L5E A;  3ZQG A;  5H2F C;  2K3P A;  4ZYE A;  3TQN A;  2NXN B;  5D5U B;  3COA C;  3V8K A;  3UNG C;  4YIR X;  3A0B C;  4CCJ A;  2DT6 A;  3AG4 H;  1Z67 A;  3MWM A;  3NAU A;  3HEF A;  1MNM C;  3PFI A;  1JT0 A;  3KYC B;  1TWF J;  4F52 A;  4I98 B;  1WHU A;  2LKS A;  4R79 A;  3QYF A;  2ZXH A;  4DIQ A;  4XON A;  2GWR A;  1RZ4 A;  3QWL A;  2BZT A;  1BR2 A;  1QPM A;  2IBD A;  3HRU A;  1SFU A;  2ESH A;  2X1D A;  2ME6 A;  4Q4Z F;  4MLO A;  1ETY A;  2HKX A;  2LY9 A;  1R22 A;  2X0L A;  5EEA A;  4EJO A;  1Z91 A;  4J00 A;  1U9O A;  1IUY A;  2KMU A;  3DKX A;  2PJP A;  1PYV A;  2HVS A;  4CO8 A;  2VLA A;  4OWR B;  4QPQ A;  4DYQ A;  1TT0 A;  4X1E A;  4A0X A;  3MZH A;  1E0E A;  5H6Q A;  1ZRE A;  1NG6 A;  5E8G A;  1S3J A;  4LLL A;  3RPQ A;  4Y13 A;  2K9S A;  3PFY A;  3NRV A;  5E79 C;  2VUM J;  4HBL A;  2IGO A;  3TKY A;  1VQP I;  4A3I J;  3R60 A;  1BOA A;  2Y0M A;  4D5F A;  4MFD A;  3FXO A;  4JBA A;  2UXN A;  4XKW A;  2CQK A;  1KU9 A;  2VBX A;  4JX6 A;  1I5Z A;  2RKH A;  4OIO F;  2R7O A;  4QLC U;  4PGG A;  3DPU A;  3ULQ B;  4MHG A;  3K4K A;  4BEH B;  2DN0 A;  2Z3Y A;  1WJ5 A;  3OS1 A;  1X2N A;  1J5Y A;  3ZMV A;  3LQQ A;  1FWZ A;  2D1H A;  4J19 A;  3CC4 I;  2H1K A;  2JA6 J;  3I4N J;  1GUU A;  3CUQ B;  1QQI A;  2FXA A;  2M4K A;  4CH7 A;  3CME I;  2FD5 A;  2PBI A;  2R7F A;  3E6C C;  2BBY A;  3GTM J;  3SJM A;  1O7L A;  1N75 A;  2IA1 A;  2XAU A;  3HHH A;  4ZC3 A;  4JQF A;  1ZGJ A;  3F9K A;  2KFD A;  3OIP A;  1ON1 A;  1WQ2 A;  1PVE A;  5B66 C;  2R7Z J;  2R7V A;  4LGW A;  1CQT A;  1LFU P;  3LSP A;  3RPU A;  5ED4 A;  3I5U A;  1JGS A;  4RBO A;  3QRF F;  2Q8K A;  3WTZ A;  1ZR4 A;  3I59 B;  3RI4 A;  2WV1 A;  3BP8 A;  2EV5 A;  1H89 C;  1JUM A;  2Y69 H;  1K4T A;  2BY2 A;  1RUO A;  1I1S A;  5J4V A;  2AHQ A;  5D6E A;  2DMP A;  1BIA A;  2M4G A;  2J5O A;  2RDP A;  5BNG A;  4XRS A;  2IT0 A;  3IWZ A;  1HSJ A;  2HOA A;  2DA3 A;  1U3E M;  1W5C C;  3RQI A;  3ZQC A;  4E70 A;  4M74 A;  2M5W A;  4JK1 X;  1Y1W J;  3HSF A;  4BHC A;  1G59 A;  4P9U A;  3UR3 C;  5K1Y A;  2YU3 A;  2IS4 A;  1YIJ I;  1FZP B;  2ELK A;  5DM7 F;  3E0J B;  3EUA A;  2IS1 A;  1VQM I;  2L5Q A;  5ICG A;  2XC7 A;  2H27 A;  2BXZ A;  4A3B J;  2J5P A;  5GP9 A;  4XLC A;  1R5H A;  1AHD P;  5IPA A;  1ACI A;  2V1U A;  3VYS B;  2MC4 A;  2F4M B;  5E3O A;  3V7R A;  5LRS A;  2JRM A;  3BTL A;  3P7N A;  1JKQ C;  4XNF A;  3ZR8 X;  4UV9 A;  2JQ7 A;  3S17 J;  5LD2 C;  1FMW A;  5FKN A;  1T8I A;  4KN7 X;  3ERM A;  4Q48 A;  3BG9 A;  2KIM A;  3RKQ A;  2LLK A;  2GXG A;  4ZYG A;  4OU0 A;  1V3F A;  2XIG A;  1YS7 A;  4I0B A;  1FTT A;  3NEU A;  1GXP A;  1FYK A;  4WK8 F;  1WJF A;  4HLY A;  4DBQ A;  5AIQ A;  5C4J J;  2VOD A;  1LNW A;  1IV6 A;  2KKO A;  3E6B A;  3TW6 A;  4HNU A;  3OY9 A;  1KU2 A;  1ONV A;  4N9I A;  3ZQ7 A;  1HKT A;  1D8K A;  2A68 F;  1X19 A;  1K83 J;  5DS9 A;  3G6E I;  2VKE A;  3RZO J;  2LF7 A;  2FJ1 A;  1LVA A;  2TDX A;  5BQT A;  4KT5 C;  4ZDP A;  4I6Z A;  3RSN A;  3U1D A;  1SAN A;  1MBH A;  2P6S A;  3BTC A;  3BPV A;  1BJZ A;  3ABU A;  2F2E A;  2P5V A;  3H1C A;  4XKB A;  5C4X J;  3VOE A;  2HXI A;  4B47 A;  2CFO A;  3E1S A;  3OL3 A;  5IY5 H;  4RGX A;  4C30 A;  3OYJ A;  1BL0 A;  4BQQ A;  4E7K A;  3FK6 A;  3PJR A;  2FRH A;  3MZ8 A;  4B3X A;  2H6B A;  4P96 A;  1YYV A;  3MAJ A;  3S3M A;  4YEJ A;  2DBB A;  3K4B A;  1LKX A;  2W57 A;  3RYR A;  3HOS A;  1ETK A;  2OZU A;  2E7X A;  4OAZ A;  1V5F A;  1ZGA A;  2FEZ A;  4EJU A;  3WE3 A;  3CCE I;  2E1M B;  2FSW A;  1C0W A;  4BGD A;  2X6Y A;  1DPU A;  2KHM A;  1VF9 A;  2M8E A;  3FZV A;  1O4X A;  3TBI A;  2CQX A;  3RDI A;  4CCN A;  5IOY A;  4OMY A;  1QVT A;  1RKT A;  1K4S A;  4A0Y A;  3PQK A;  3VSL A;  5DDG A;  3M3Y J;  1U5T C;  4CUG A;  5M5Y J;  1ZH5 A;  2Y30 A;  2R3S A;  3AL0 C;  4JX5 A;  2EFP A;  1XS9 A;  2EFO A;  4I2O A;  2RVC A;  1FIP A;  4XOP A;  2GXB A;  2E1C A;  2OAZ A;  3EUH A;  1APL C;  1MND A;  2VJ5 A;  2X1C A;  4AID A;  2MH9 A;  2NOG A;  5TIS C;  1AOY A;  3KP3 A;  4OIP F;  4FTH A;  3T1B A;  2H8W A;  3IH2 A;  4EQQ A;  2DDA A;  2L7F P;  4HX4 A;  3OIQ A;  1YI2 I;  2DYR H;  2OQR A;  2VQC A;  1IW7 F;  2XGC A;  5D8K B;  1A6Q A;  4XLP F;  5EGO B;  1KQ8 A;  3R61 A;  3OR1 C;  2EFQ A;  4CXF A;  4IHV A;  3HG9 A;  1HST A;  3CCL I;  2EPF A;  2LRD A;  4XM3 A;  5HLH A;  2DXI A;  1B9N A;  3HGY A;  2M0M A;  3A01 A;  3L2R A;  2PMZ N;  1QHG A;  4II3 A;  4A2U A;  5M5W J;  3AAF A;  3HSR A;  3KET A;  2V9V A;  2UWM A;  3K70 D;  1MJA A;  3GFL A;  4JYK A;  3K6G A;  2MG4 A;  1RNL A;  5BOX A;  5CJ9 A;  3GME A;  3H35 A;  1HDP A;  2E35 A;  3ZPL A;  1BI2 A;  4RB1 A;  5E1W A;  3HJE A;  4XN0 A;  3IC7 A;  3K4J A;  2IRF G;  5LGU A;  4FCY A;  2M7B A;  1S9H A;  2KRF A;  5CQG A;  2HNH A;  2XAS A;  2NVY J;  2Y31 A;  3H36 A;  2ELH A;  4A3L J;  4L9T A;  2HYJ A;  5BPD A;  1TW3 A;  2DK8 A;  3BG3 A;  2FQ4 A;  2TRT A;  3LNQ A;  3CZ6 A;  4L18 B;  1JTY A;  3AG1 H;  5L3B A;  4CDG A;  2PLY A;  1ZAR A;  3ZXS A;  1B6A A;  2L01 A;  1ODD A;  3O6B B;  3S8P A;  4S0H B;  4WX9 A;  4A12 A;  2Z5U A;  2DMU A;  2ADU A;  4V2G A;  2EH3 A;  5JLX A;  2E36 A;  5GAE J;  1H9T A;  3N97 A;  2AO9 A;  3A02 A;  3VYT B;  1SVM A;  3ZMS A;  2CG4 A;  2M34 A;  2OUM A;  2X9D A;  2PMU A;  4WXD A;  4XOR A;  2CV1 A;  4NQW A;  4CZC A;  1R1U A;  4A3E J;  4RS8 A;  3GO5 A;  2K4J A;  3K7A J;  1LFP A;  4HNV A;  3QOE A;  2VQL A;  2OQG A;  1OMI A;  2N8G A;  2R7S A;  4C2U A;  1SFO J;  1PUE E;  1K6O A;  3TW7 A;  4BXX J;  5EDN A;  1IUF A;  3RQ4 A;  4BDZ A;  4KMF A;  5JLW A;  5L3E A;  4QWQ A;  3C2G A;  2A69 F;  3IKT A;  2ZKZ A;  1IXS B;  1S5L C;  4QIW N;  2VXZ A;  3AG2 H;  4LK0 F;  4LJZ F;  5FFZ A;  3KLO A;  4MTE A;  2KDZ A;  1T6S A;  2HQA A;  5ILV A;  5IYC J;  1W7P A;  5B1B H;  4F55 A;  1SFE A;  1T95 A;  3N4M A;  3HTS B;  5DCM B;  5JI6 A;  4AD9 A;  3I55 I;  1N78 A;  3KX2 A;  2EB7 A;  4N4N B;  3HGG A;  3A4C A;  4CA0 A;  3GFI A;  3BRO A;  2R0Q C;  4IX7 A;  2ZB9 A;  2DOA A;  1VQ7 I;  1D5V A;  1OCP A;  5J40 A;  1X1P A;  1G3Y A;  2P5K A;  3GVA A;  1R1V A;  3FKJ A;  4XK4 A;  5LGN A;  2OBP A;  1V5E A;  1JHF A;  3LSM A;  1PP8 F;  1LB2 A;  1Z1D A;  1UFM A;  3JCU C;  4PDK A;  4A3J J;  3VPR A;  1I27 A;  1GLN A;  2KJB A;  2OF7 A;  3M9A A;  3DFG A;  4BS9 A;  2XAQ A;  1CGP A;  1A31 A;  4KDP A;  3S1N J;  4A3G J;  3J7A Y;  3GUD A;  5K7H A;  2MYS A;  3PNT A;  3G1M A;  4A0Z A;  1I6H J;  3LWF A;  3OSF A;  2W7N A;  1Y0U A;  1OR7 C;  2PFB A;  2DOE A;  2P7V B;  3AG3 H;  2QLZ A;  3MCZ A;  5GAH J;  1D5Y A;  2PMH A;  4R8H A;  5LHH A;  1X1C A;  4HZF A;  2ZNY A;  4Y17 A;  4LG3 A;  3WOD F;  3F8M A;  2JRT A;  2PI0 A;  2VT2 A;  3BZK A;  1B9M A;  2LYC A;  4LMY A;  2K9M A;  2X6W A;  5F04 A;  2STW A;  3LFU A;  3H9G A;  3T5X A;  1JJ6 C;  4G94 A;  5FKK A;  5D5V B;  3GWZ A;  3PNV A;  2RV8 A;  2K27 A;  2FML A;  1JKP C;  5EEG A;  3KYL A;  2X48 A;  3QPL A;  4DYR A;  2GQQ A;  1QU3 A;  4DW6 A;  3E5Q A;  1OCR H;  2FA5 A;  2MGQ A;  1VQN I;  2LDU A;  1XX5 A;  1WVR A;  1YW8 A;  3GW2 A;  1MBK A;  5BMZ A;  3DF8 A;  2MLG A;  1IN5 A;  3H3U A;  1UJ8 A;  4A5N A;  5JR3 A;  3G4S I;  4ENN A;  5D6F A;  1W36 D;  1FBU A;  1FP2 A;  3LSG A;  2PJR A;  2ZME C;  2O9L A;  1J7K A;  3A0H C;  1ZTR A;  1T39 A;  4S04 A;  3FMQ A;  3F22 A;  1DP7 P;  3VWB A;  4FIS A;  2H8R A;  1DQU A;  2LMD A;  1FIA A;  2EZI A;  2Y0S N;  1H8A C;  4Y3O A;  1BC7 C;  1B72 A;  1ZK8 A;  4UB6 C;  4IJA A;  3D1N I;  1FYL A;  1JKO C;  5TRD A;  2Y9Y A;  3BTJ A;  2QBY A;  3DWL E;  5D5X B;  3HTU A;  3MKY B;  3OIO A;  4YIF A;  2QM3 A;  2XGD A;  3ZQL A;  2F4I A;  1FPQ A;  4R1H A;  1FEX A;  3BG6 A;  3ASO H;  4M3G A;  3DBR B;  2ZFU A;  5EEH A;  3LSR A;  3WTS C;  2NNY A;  1RRJ A;  4HQE A;  2FX0 A;  3U9G A;  2M45 A;  4GXO A;  1O3R A;  5GAG J;  2W85 A;  4LLN A;  1VI0 A;  4LOC A;  4NB5 A;  5DD8 A;  3I71 A;  4E4H A;  4HSR A;  2V9K A;  1XCB A;  5K7F A;  3J80 K;  4U0Y A;  1MBG A;  4B43 A;  2XPW A;  1YJ9 I;  4A6E A;  2XF6 A;  3T8T A;  2CWE A;  4F3Q A;  4L9V A;  2K9L A;  1PJR A;  3HOV J;  5TGT A;  3JRC A;  4AU7 A;  4MFE A;  4ZYH A;  1P4X A;  2CO5 A;  3C1D A;  2LKX A;  3G73 A;  2EIL H;  4BE0 A;  1K78 B;  1P6R A;  1KON A;  2DA4 A;  1T33 A;  2P8T A;  1HKQ A;  3HPH A;  3E97 A;  1STZ A;  2VJI A;  1ETQ A;  2EIK H;  1BW6 A;  4OAY A;  3J81 Z;  2BW3 A;  2Y2Z A;  2FE3 A;  1W0U A;  3HKZ N;  1WI9 A;  3U1K A;  4EM2 A;  2LNB A;  2BY3 A;  2VOP A;  1YIO A;  2YSR A;  1F5T A;  1TQP A;  4KIC A;  2A5W A;  3G3Z A;  4YFN F;  3QAH A;  1WI3 A;  5LHI A;  3L9F A;  1IN6 A;  2D2W A;  3I4P A;  5HS7 A;  1E3O C;  3S93 A;  4KIS A;  2PQ8 A;  2EWN A;  4ENK A;  2WA0 A;  3IV5 A;  2NS0 A;  3M8F A;  2H94 A;  4HF0 A;  2GA2 A;  3H9Q A;  1Y1V J;  5CVI A;  2PJR B;  1U0J A;  2KPM A;  5FLX Z;  4MQV A;  1I39 A;  4YRV A;  2CV0 A;  1GXQ A;  2M8G X;  2WV0 A;  2KLO A;  2KIU A;  1JTX A;  2VC0 A;  3FXJ A;  4IO9 F;  1U8R A;  2ACJ A;  4ESF A;  2Z1D A;  5B5E C;  3GZ6 A;  3J80 Z;  1FYM A;  1S29 A;  1B72 B;  5D4R A;  2Y9Z A;  3G1L A;  2W25 A;  2MBF A;  3BPX A;  1K7A A;  4BYY A;  1DGR M;  4UV8 A;  1RC9 A;  2YU9 J;  2QBY B;  3CDL A;  4D0P A;  3DTK A;  5D4S A;  4NBQ A;  5FJ8 J;  4XLN F;  2CUF A;  4PGH A;  2GZW A;  1ETW A;  1LEB A;  4A3F J;  1WH7 A;  2JPC A;  1YX5 A;  2XVC A;  2P7C B;  2XGX A;  3LQR A;  5BPI A;  4S05 A;  2LSO A;  1JJ8 C;  3K4M A;  2JT1 A;  3L2W A;  3KYD B;  4EM0 B;  3ZRG A;  2LP0 A;  1B59 A;  2IAI A;  3QU6 A;  2LK2 A;  1TNS A;  1YJN I;  3HXL A;  1FSH A;  3RJP A;  1F1Z A;  5HOD A;  2JA8 J;  1K79 A;  3H0G J;  2XUB A;  2W00 A;  1MH4 A;  4BJ6 C;  4HAM A;  1FC3 A;  1DU0 A;  2FBI A;  3L09 A;  3LST A;  3GX4 X;  1IDY A;  1T0F C;  2E60 A;  2MW8 A;  1UCR A;  2NOJ B;  3QQA A;  3WU1 B;  3BQY A;  4G6D A;  4G7Z F;  1WH5 A;  1RUN A;  4E7H A;  2HDD A;  2QQ9 A;  3SFI A;  1VQ9 I;  3HUG B;  2P4W A;  2ZSI B;  3O8H A;  5DV5 A;  1XPX A;  4GYI A;  3OYC A;  4XLF A;  3FWE A;  4X6A J;  1TWH J;  4XKV A;  4LG0 B;  3GFM A;  1YE9 A;  5DYM A;  2LR8 A;  2A61 A;  3EPZ A;  3CCV I;  3Q5F A;  4IRI A;  4UUS B;  1OCO H;  1FY7 A;  2BW3 B;  4IEJ A;  1SFX A;  1XCV A;  2EIJ H;  4U7D A;  1K61 A;  1AU7 A;  1TC3 C;  3BR3 A;  4LK1 F;  1R36 A;  4D9J A;  3S1R J;  3SYT A;  2HR3 A;  3CLQ A;  2NVT J;  2DU9 A;  4XRS G;  1XGM A;  2OCE A;  3PNY A;  4RGU A;  3L2Q A;  4XOT A;  2DMT A;  3FIW A;  5JVT A;  4FX0 A;  4I01 A;  1WPK A;  3L7W A;  4RM2 A;  4D7N A;  1BIB A;  1EKE A;  2FQ3 A;  2ZXI A;  1IGN A;  2MD5 A;  4AIJ A;  4BUP A;  1ZRC A;  1H0M A;  1OIS A;  3K2Z A;  2CQ7 A;  5HDK A;  4M6V A;  2E2H J;  2NYX A;  1R4M B;  2GAU A;  4G12 A;  4UUV A;  4IHT A;  3OOU A;  2DJN A;  3H5R A;  1Z9C A;  4QPO A;  3KP6 A;  3F23 A;  1REP C;  4WCG A;  3BDD A;  5DUI A;  3BR6 A;  1X1D A;  4UVC A;  2V9P A;  1YRN A;  1YS6 A;  1HC8 A;  1MJB A;  2VBY A;  3BR0 A;  4PJM A;  1IAW A;  1TL8 A;  1HBX G;  3CLO A;  4AWX B;  2W84 A;  2ZXJ A;  1XMK A;  4KIT B;  4IOC F;  3ECO A;  1X2M A;  4BJT A;  3HRM A;  2A07 F;  2KRH A;  2WY8 Q;  4RDU A;  1VFC A;  2FU4 A;  4MEY F;  2CGP A;  1JGG A;  2I10 A;  1NHA A;  1F43 A;  4C2M J;  1MGT A;  4ZZD A;  2XGE A;  3GLX A;  4MQ9 F;  1XDU A;  1OLT A;  1FOK A;  3UKG A;  4OIN F;  4II2 A;  1RET A;  3ELK A;  1JT6 A;  1OYW A;  3KP7 A;  2V4J C;  2VBW A;  3A03 A;  1W0T A;  1ETX A;  5B3S H;  4B3A A;  2CFX A;  3I64 A;  2DMQ A;  1BI0 A;  1GVD A;  4A3M J;  1Z77 A;  5GTH C;  1MDM A;  1XSD A;  2D1V A;  2G7H A;  3LSH A;  5J1R A;  4U7B A;  2BHZ A;  1W4M A;  4M9X A;  1XG1 A;  2EBI A;  1VQ8 I;  3JRI A;  5FRN A;  2HPM A;  3SZG A;  3KP2 A;  3ZCO A;  3CJT B;  4PK4 A;  2RNJ A;  4BL0 B;  2MD0 A;  2QQA A;  3KCC A;  3OL4 A;  4B8X A;  3BCA A;  3SEZ A;  4L0Y B;  5IP6 A;  2QWW A;  4L5I A;  4PZJ A;  5DUK A;  1FOX A;  3W2V A;  2LOO A;  2KIS A;  5HLT A;  3CCM I;  3LFK A;  1P9Q C;  2JZY A;  2VQH A;  1BN5 A;  2WC2 A;  1ZRD A;  3K1N A;  1UHS A;  1PUF A;  3IAM 2;  4BJ5 C;  3OS2 A;  4XLA A;  3FIS A;  2DQL A;  2G0E A;  3B6A A;  4LIT A;  2XDV A;  3B6C A;  5EGO A;  3H3V K;  5DCF A;  3ABM H;  4CIC A;  2VBZ A;  2OV7 A;  2M0C A;  4ENJ A;  3GTG J;  3I9V 2;  2HDW A;  2R5Z A;  3CF2 A;  1Q1V A;  3CUO A;  3OYB A;  4Q5S F;  3WU2 C;  4OOI A;  2OU2 A;  1X1B A;  2FNP A;  2KL4 A;  2K7L A;  3CP8 A;  3M1E A;  4DNC A;  4FT8 A;  4IVN A;  4ZYD A;  1A04 A;  2L4A A;  3FHN A;  2HKO A;  4XL9 A;  5E20 A;  4IOA F;  2FOW A;  1YRN B;  2L9N A;  3DEE A;  3DLA A;  1D8J A;  5EZH A;  2DO7 A;  5FFX A;  2Q2E B;  3PQJ A;  3K1P A;  3BJO A;  4HOB A;  2DTR A;  2ZBK A;  4NC6 A;  3RIR A;  2OA4 A;  3CC2 I;  3CTA A;  3DTI A;  3V8J A;  4EGZ A;  4GFB A;  4RB0 A;  2RRE A;  5CVV A;  3I0T A;  4BE2 A;  4E7L A;  2O6G E;  2R7R A;  4W1U A;  1EH6 A;  3IWF A;  3WGH A;  1TQI A;  4IRG A;  3D5S C;  4P55 A;  2F5V A;  5E1Z B;  2E1M C;  4YFX F;  1YIT I;  4C3I J;  4KFC A;  1LUJ B;  3F8C A;  2MAB A;  2ISZ A;  1ETV A;  2K85 A;  3TO6 A;  3ERE D;  2Z33 A;  4EJW A;  1FMV A;  4Q47 A;  3W6V A;  2DTZ A;  3LOC A;  2ECC A;  1GVJ A;  2LTP A;  2X1E A;  5J1U A;  1SC7 A;  2OC6 A;  5H6R A;  2I8D A;  3SFZ A;  1MDM B;  3HB9 A;  4LB5 A;  3HOW J;  2BE5 F;  3SZT A;  4E7Z A;  5A2Q K;  4H4K C;  2VOO A;  2VC1 A;  2QKM B;  4U0V A;  2QSH X;  3KP4 A;  5ICF A;  4I09 A;  4ETS A;  5KCM A;  1P7I A;  2IS6 A;  3HOZ J;  4K2E A;  4AYB N;  1ZKG A;  1JHH A;  1U9N A;  1YHQ I;  3P9C A;  2OCC H;  1AA7 A;  1Z21 A;  1O3S A;  3BG5 A;  5IOZ A;  2AS5 F;  4XR6 A;  2EFW A;  3I56 I;  3H0D A;  5J8C A;  3Q9S A;  3GZN B;  3KZZ A;  4XID A;  1XTA A;  1UEL B;  2WAQ N;  5DCM A;  4HYE A;  2QYO A;  4RAG A;  4G6T B;  3F21 A;  4MEX F;  3EYY A;  3AL0 B;  1R5G A;  4IHS A;  3QPS A;  1PUF B;  1ZLJ A;  3CCU I;  1HOM A;  4HX7 A;  5FLM J;  1TWC J;  1ZN2 A;  3L00 A;  3D5L A;  1L3L A;  3U2R A;  4O3M A;  1V55 H;  5C3E J;  2V1N A;  2XSD C;  1X3U A;  2F5E A;  1Y6I A;  5HVQ C;  4N4O B;  5ICC A;  3B73 A;  2L9R A;  1HW2 A;  5E8I A;  2R5Z B;  4V19 K;  2NVQ J;  1QNT A;  1LDJ A;  1HF0 A;  4WXH A;  1NH3 A;  3HOY J;  2XAG A;  2L2O A;  3ZN0 A;  3M4O J;  4DZJ A;  3DCF A;  3PO3 J;  4H0E A;  2OTL I;  3F0C A;  4BH9 A;  5K5Q A;  2JSC A;  2X4H A;  2GXA A;  2E1N A;  3TP3 A;  3BLY A;  5FRO A;  3WE2 A;  4XBF A;  4XLH A;  2KZV A;  4A69 C;  4L9J A;  2GOX B;  1I50 J;  2BV6 A;  4V2F A;  1MBJ A;  1MKM A;  3C2B A;  4AIH A;  2XRN A;  3JTG A;  5A2Q Z;  3ISP A;  4X0G A;  5FLV A;  2G9W A;  3D5R C;  2HZT A;  1PP7 U;  3CC7 I;  3R0A A;  5FKO A;  4CCL A;  4RAZ A;  5KNL A;  1IZ1 A;  2QSF X;  1J59 A;  3GTK J;  3JRD A;  4JX4 A;  4ESJ A;  5FKL A;  2BVL A;  4B1R A;  5F1R A;  3Q9V A;  3GCM A;  2DA6 A;  1X3W B;  3ZOB A;  4PSX A;  4RLQ A;  4IZZ A;  1OYI A;  1TLH B;  3PIO F;  2LBF B;  3IAS 2;  4M3F A;  3I4M J;  4EV0 A;  1BR1 A;  4MO7 A;  2VKH A;  5LGT A;  3HIF A;  2R4G A;  2V79 A;  2EIN H;  2W24 A;  4DGW B;  5LLQ A;  1ZLK A;  1A35 A;  1YJW I;  1BM9 A;  2QQB A;  3FMR A;  3HPG A;  3CMY A;  1F36 A;  4CGZ A;  3KP5 A;  1RKW A;  1EH7 A;  2IA0 A;  3FF5 A;  4A3D J;  1FNN A;  1BA5 A;  5IT3 A;  5FGM A;  2MLK A;  5HS9 A;  2BGC A;  2HQR A;  1HQC A;  1KYZ A;  1VTN C;  5E3N A;  2F5D A;  2CW8 A;  2VL8 A;  4LB6 B;  2D45 A;  1MIJ A;  3BWG A;  2VI6 A;  2L3D A;  1IN8 A;  2ZXW H;  4Y4R A;  5AIP A;  5HLI A;  4IKF A;  3K10 A;  5E18 F;  3E3V A;  1G2H A;  3HRS A;  2YUS A;  3PM1 A;  4GDF A;  4AYB A;  4CHU A;  1DU6 A;  1UG2 A;  4DQ2 A;  2O61 A;  2FBK A;  2JWT A;  4NNJ A;  1XMX A;  2FNA A;  3CJN A;  1I1G A;  3P9K A;  2LH9 A;  1POG A;  1IJW C;  4ZYA A;  2DMN A;  1VQK I;  1ZGW A;  4AM3 A;  1X58 A;  3OMY A;  2HI3 A;  3DU5 A;  4O5V A;  4B44 A;  2FUG 2;  3MFK A;  2DCE A;  4UVA A;  4U88 A;  2LC2 A;  3FHZ A;  2IP2 A;  3ECH A;  1JI8 A;  3DP7 A;  1TQM A;  3CQZ J;  3ASN H;  1WJD A;  3MMY B;  3BTI A;  3I3L A;  2OTJ I;  2P5L C;  1K78 A;  2KRC A;  4YG2 F;  5TJJ A;  2PMZ A;  1F9N A;  3DTE A;  5IT9 K;  1J9I A;  2A05 A;  3GXO A;  2H6C A;  3N05 A;  4OIQ F;  2GBY A;  2YPR A;  2QQ8 A;  4ANJ A;  2IGN A;  5HNF A;  2XPU A;  3I58 A;  4G7O F;  3FBN B;  1X3Z B;  2DJI A;  3ZQF A;  1XSV A;  1ZAO A;  1ZG1 A;  3LL7 A;  4G9Y A;  1SD6 A;  2A6H F;  4NHJ A;  3IL2 A;  1OCZ H;  1RES A;  2CQQ A;  4AVZ A;  2BHY A;  1WZ2 A;  5F1J A;  5ILS A;  1Q1H A;  3QOD A;  3OSG A;  2O7O A;  5IYD J;  2PG4 A;  2OPT A;  4HDV A;  2L54 A;  3H3Z A;  1Y8R B;  1WCM J;  1WGX A;  5L3D A;  3RKY A;  2ZJ2 A;  1OQY A;  2DA2 A;  3HOU J;  4FAS D;  4XKC A;  2QUF A;  2WAD A;  4DBR A;  4ZDO A;  3DV8 A;  3FXL A;  4IL6 C;  4J01 A;  2NRA C;  3F6O A;  5EZG A;  1T56 A;  3DBL B;  3AKZ A;  2HOS A;  1ORK A;  3DU6 A;  3W6J B;  3NWT A;  1TWA J;  4B48 A;  2VKD A;  4BQO A;  2LKP A;  2CUZ A;  3OYK A;  2DW4 A;  1QRY A;  1NTC A;  3CDH A;  4FE4 A;  2KIF A;  3TP0 A;  1G4D A;  1OCT C;  1OYY A;  3EET A;  3EYI A;  1MJ9 A;  2NVU B;  1IG7 A;  4ESB A;  5HNH A;  4DJA A;  1BI1 A;  3OOP A;  3ONQ A;  5KAF C;  2VXD A;  2ZME B;  2RAE A;  1BJA A;  2AXT C;  2GIV A;  3SDG A;  4ASN A;  3GTJ J;  1XB4 A;  2Z16 A;  3MKL A;  1FLI A;  2DFE A;  5IT9 Z;  3JTH A;  1I3Q J;  3CMM A;  3F8B A;  3FM3 A;  3GEZ A;  4LD5 A;  3K2A A;  2GIZ A;  3FXK A;  2K3F A;  2LY1 A;  2R7X A;  4MNU A;  2COB A;  4XN3 A;  1K6Y A;  3DKY A;  3GTO J;  4PFP A;  3OYE A;  3GTQ J;  2EZL A;  1IO2 A;  1U2W A;  2LG4 A;  3FXM A;  2C6Y A;  1D3Y A;  1LJ9 A;  3DLL F;  1G3S A;  4KIF A;  2CW0 F;  4FET A;  3GLL A;  1QZZ A;  3O2P E;  5M3M J;  2JUG A;  2IPQ X;  4HST A;  5DTD A;  1Z3Y A;  3HUG A;  4HA8 A;  1MZB A;  4PSW A;  3BOQ A;  1R23 A;  4C2T A;  1WJB A;  3CJR B;  5FB2 A;  1MMS A;  3OYH A;  3MEX A;  1GV5 A;  2BYV E;  4LG0 A;  4RAY A;  3OV8 A;  3MD2 A;  3RKX A;  1WJA A;  1J2X A;  2JA2 A;  4UUS A;  4M9Z A;  5KHD A;  3KIO A;  1OPC A;  1T0F A;  2YX7 A;  4W97 A;  3J7Y J;  2V1D A;  4E7J A;  2WY7 Q;  1SD7 A;  2M9H A;  1S7O A;  2MH2 A;  3SXY A;  2R7W A;  4HW0 A;  4XLE A;  4ZDL A;  4D7M A;  4BQN A;  2NVX J;  3T8R A;  2IXS A;  3FDY A;  2E2J J;  2FOK A;  1AKH A;  1Z05 A;  3GF2 A;  4UHT A;  1MSF C;  3C3W A;  4RLF A;  2VE9 A;  3WHC A;  4BQA A;  1E2X A;  5HDN A;  3REO A;  3CCS I;  1EF4 A;  1X1A A;  4RB2 C;  4BHB A;  3G2B A;  3VYR B;  2NNN A;  4HF2 A;  1UB9 A;  2O8X A;  1M1E B;  2P81 A;  1TT5 B;  1WFX A;  4NDL A;  4ITV A;  2UXX A;  2HOT A;  2EJR A;  2R7Q A;  2QVO A;  5HLG A;  3L2U A;  3HYI A;  4BNC A;  4PJN A;  4EJT A;  2HYF A;  1E17 A;  2K9N A;  2TCT A;  2X51 A;  3PIP F;  1P2F A;  3CJQ B;  2XB0 X;  3L2C A;  3DXJ F;  4BXF A;  1YQA A;  1NK3 P;  5IP9 J;  3LAP A;  4TV7 A;  4IXA A;  4KT6 A;  1XGS A;  2Y0S A;  2R7T A;  1E3H A;  4L9N A;  2XF5 A;  3RTR A;  1XN7 A;  4ENM A;  2KP6 A;  1WSU A;  1WKM A;  3KEO A;  4AIK A;  4MIM A;  2KT0 A;  3FXR A;  2JA5 J;  2DAO A;  1SD4 A;  3ESW B;  4HF1 A;  2HQN A;  1SAX A;  2WB1 N;  4BY7 J;  3W2A A;  2HVQ A;  3K4N A;  4WF2 A;  2QEN A;  3VFZ A;  4GCV A;  2XSJ C;  3LA7 A;  3FM5 A;  2ESN A;  1S7E A;  2QGU A; 
#chains in the Genus database with same CATH homology
 3BCA A;  3K70 D;  3SEZ A;  3K6G A;  3VYU B;  4IQJ A;  3CP2 A;  3W2V A;  3OR2 C;  4CCO A;  2LOO A;  3H35 A;  5HLT A;  1P9Q C;  4NQW B;  2VQH A;  4XN0 A;  1BOB A;  3K4J A;  4RM3 A;  2L9S A;  4XQF A;  3IAM 2;  2BVM A;  2M7B A;  1S9H A;  4BJ5 C;  3OS2 A;  4XLA A;  4BAC A;  5CQG A;  2HNH A;  1MNE A;  4LIT A;  2XDV A;  3NWS A;  2OV7 A;  4BDY A;  2JSP A;  4PFO A;  3I9V 2;  2HDW A;  3CF2 A;  3CZ6 A;  3OYB A;  2HVR A;  1X1B A;  2KL4 A;  3ZXS A;  5CKT A;  3ZQQ A;  3CP8 A;  3S8P A;  2M7A A;  1X4O A;  2R7U A;  2K5C A;  4LIV A;  3H9J A;  3FHN A;  4XL9 A;  1WJE A;  2HU9 A;  2L9N A;  3DEE A;  3VYT B;  3DLA A;  2OUM A;  4F93 B;  2Q2E B;  2CV1 A;  4XOR A;  2A6T A;  4CZC A;  3VSK A;  3HKZ A;  1LFP A;  3QOE A;  3TMO A;  4ZTJ A;  2VQL A;  3DTI A;  2MFZ A;  4HNT A;  2R7S A;  4C2U A;  2RRE A;  1UG0 A;  3RQ4 A;  4BDZ A;  1D0X A;  4BE2 A;  4E7L A;  1EA3 A;  3C2G A;  2R7R A;  2ELJ A;  2W82 A;  2VXZ A;  4F92 B;  3D5S C;  2F5V A;  2UV1 A;  2E1M C;  1IRX A;  2HQA A;  3PSF A;  4F55 A;  1T95 A;  3BG7 A;  2MAB A;  3K70 C;  3HC7 A;  1N78 A;  3KX2 A;  4N4N B;  1Z3X A;  3ZGK A;  1FMV A;  3A4C A;  3PSI A;  4CA0 A;  1MMA A;  1MMD A;  1SFK A;  2QKL B;  2WAE A;  5CPR B;  2X1E A;  4IX7 A;  1LVK A;  2DOA A;  2OC6 A;  2I8D A;  1W36 C;  4E7Z A;  1QHH D;  4H4K C;  3FKJ A;  3HL2 A;  1TZL A;  2CV2 A;  3OYD A;  2QKM B;  2VB6 A;  1V5E A;  3LSM A;  4KJZ A;  5KCM A;  2IS6 A;  3OS0 A;  3BC8 A;  4E7I A;  1GLN A;  3A2K A;  1VZ0 A;  4BS9 A;  1AA7 A;  1Z21 A;  3J7A Y;  4C9Y A;  4XR6 A;  2MYS A;  3GBG A;  3PNT A;  3H0D A;  1DGW Y;  3S32 A;  2W7N A;  1OR7 C;  1UEL B;  3OYL A;  1BR4 A;  4G6T B;  2WB1 A;  5JHF A;  3AL0 B;  2AQE A;  1X1C A;  4LG3 A;  3L2V A;  3C2H A;  3OYA A;  3RPU D;  4P5O A;  3W3C A;  3D5L A;  4BEH A;  2LYC A;  2K9M A;  2X6W A;  2V1N A;  3LFU A;  3A1Y A;  2DT7 B;  3H9G A;  1Y6I A;  5HVQ C;  4N4O B;  3PNV A;  4NC7 A;  3KYL A;  3HOT A;  2O5R A;  2VQG A;  1QU3 A;  2W1O A;  3K4C A;  2L2O A;  1G8X A;  2JVH A;  3KEY A;  2WBM A;  4CCM A;  2V26 A;  3M8J A;  4PJJ A;  3BLY A;  5FRO A;  3DQV C;  4XLH A;  3V42 A;  1W36 D;  2KZV A;  2PJR A;  2BOL A;  2E5Z A;  2GOX B;  3LSG A;  3OYI A;  3OYF A;  1X4P A;  1MMG A;  3VWB A;  3S3N A;  1DQU A;  3LMM A;  4BE1 A;  3PL8 A;  4X0G A;  2RNG A;  4Y3O A;  3D5R C;  2CMP A;  4CCL A;  2K3P A;  5KNL A;  3UNG C;  4PUS A;  4CCJ A;  2DT6 A;  1R6R A;  2BVL A;  3DWL E;  3IUO A;  4PJL A;  3MKY B;  4F52 A;  2F4I A;  2VJJ A;  4R79 A;  3QYF A;  3BG6 A;  2ZXH A;  4PSX A;  4RLQ A;  4XON A;  4DIQ A;  4IZZ A;  2ZFU A;  3H5N A;  2LBF B;  3IAS 2;  1BR2 A;  2X1D A;  4MLO A;  2Z2S B;  3OWT A;  1BR1 A;  2VKH A;  2R4G A;  1D0Y A;  4DGW B;  3QYB A;  4J00 A;  3HPG A;  2KMU A;  4E4H A;  3DKX A;  4HSR A;  2V9K A;  1PYV A;  4GRI A;  2HVS A;  3EUK L;  4B43 A;  4OWR B;  4QPQ A;  2VLA A;  3S3O A;  2W4S A;  1D1C A;  1TT0 A;  1SAU A;  2XF6 A;  1E0E A;  4F3Q A;  1NG6 A;  2K9L A;  1PJR A;  3PFY A;  2IGM A;  5TGT A;  2VJ4 A;  4AU7 A;  1Y56 A;  2CW8 A;  2IGO A;  2VL8 A;  4XMY A;  2IGK A;  2ZSH B;  2VIX A;  3FBI B;  1ERD A;  4Y4R A;  4IKF A;  3K10 A;  4XKW A;  4BE0 A;  2LBF A;  1KON A;  2R7O A;  4AYB A;  3DPU A;  3HPH A;  2VJI A;  3K4K A;  4E7S A;  4BEH B;  4NNJ A;  1WJ5 A;  3OS1 A;  1DP3 A;  4E6K G;  4OAY A;  2BW3 A;  2LH9 A;  3OYM A;  4ZYA A;  2E5N A;  2V6E A;  2M4K A;  3OMY A;  4CH7 A;  3DU5 A;  4B44 A;  2FUG 2;  2A5W A;  4CCK A;  1WJC A;  4Y33 A;  2DCE A;  2LC2 A;  3LSI A;  1JI8 A;  1N75 A;  3W2W A;  2XAU A;  3S93 A;  4ZC3 A;  4JQF A;  4KIS A;  4D1Q A;  3LSK A;  2WA0 A;  1WJD A;  3F9K A;  3I3L A;  3MMY B;  3OIP A;  3H9Q A;  2PJR B;  1U0J A;  2KPM A;  2KRC A;  2R7V A;  2PMZ A;  3DTE A;  4YRV A;  2CV0 A;  3MKW B;  2CUJ A;  2X6X A;  2CW7 A;  2KLO A;  5LFA A;  3H5A A;  3N05 A;  3IP4 B;  2Z1D A;  4ANJ A;  2IGN A;  5HNF A;  2M3A A;  4IQ4 A;  3FBN B;  2DJI A;  3LL7 A;  2Q1Z B;  3DPT A;  2L7K A;  3RCO A;  4AVZ A;  1DGR M;  3DTK A;  2CH0 A;  2M4G A;  3QOD A;  3U21 A;  3PUB A;  1YX5 A;  4FAS D;  4XKC A;  1G59 A;  2WAD A;  3UR3 C;  4DBR A;  4ZDO A;  3K4M A;  2IS4 A;  3M1C A;  3L2W A;  1MW7 A;  4J01 A;  3ZRG A;  3E0J B;  3EUA A;  2IS1 A;  3AKZ A;  1D1B A;  2L5Q A;  3DU6 A;  3NWT A;  4B48 A;  2XC7 A;  3HXL A;  2VKD A;  4BQO A;  2HZD A;  2CUZ A;  4XLC A;  3OYK A;  2LRE A;  3VYS B;  2W00 A;  2MC4 A;  4BJ6 C;  3TL4 X;  1T0F C;  2E60 A;  5HNH A;  2NOJ B;  4DJA A;  3ONQ A;  4XNF A;  2JVG A;  2VXD A;  3ZR8 X;  4E7H A;  5LD2 C;  1FMW A;  3HUG B;  2ZSI B;  2HPI A;  4EAT A;  2WAF A;  2Z16 A;  3OYC A;  4XLF A;  5HOO A;  2AQF A;  4XKV A;  3SEQ A;  3CMM A;  1YE9 A;  3K4L A;  4LIU A;  1WJF A;  4DBQ A;  2LY1 A;  2R7X A;  3EPZ A;  1YX3 A;  4XN3 A;  3DKY A;  1K6Y A;  2BW3 B;  3OY9 A;  4HNU A;  4PFP A;  3OYE A;  4P1W A;  4D9J A;  4ZTF A;  2LG4 A;  3SYT A;  1X19 A;  3EUH C;  4ZDP A;  3RSN A;  4FET A;  3PNY A;  2KQR A;  3L2Q A;  1NG7 A;  3DPL C;  4XKB A;  4XOT A;  2JUG A;  4HST A;  1D1A A;  1Z3Y A;  1UAA A;  4B47 A;  4C2T A;  4PSW A;  2CFO A;  3E1S A;  3OL3 A;  1WJB A;  3CJR B;  3OYH A;  4C30 A;  3OYN A;  4RM2 A;  3OYJ A;  4BQQ A;  4E7K A;  3PJR A;  2ZXI A;  4HG2 A;  2RQQ A;  4B3X A;  4BUP A;  3S3M A;  4YEJ A;  3MD2 A;  1WJA A;  3K4B A;  1LKX A;  2JA2 A;  2V7F A;  1MMN A;  3HOS A;  5KHD A;  2VPL A;  3OOU A;  4OAZ A;  1V5F A;  3H5R A;  2WAQ A;  2CS3 A;  4E7J A;  4NUB A;  2WY7 Q;  4QPO A;  4BU2 A;  2E1M B;  4BGD A;  2X6Y A;  4CSW A;  1HA8 A;  2KHM A;  3AFH A;  2R7W A;  4DOZ A;  4XLE A;  3BCB A;  4ZDL A;  3MKZ A;  1X1D A;  4BQN A;  3TBI A;  4CCN A;  2IXS A;  3FDY A;  4JOM A;  4PJM A;  4RLF A;  2X85 A;  3VSL A;  4CUG A;  4YEL A;  2UUZ A;  2XF7 A;  2VAS A;  2LY2 A;  3AL0 C;  1X1A A;  2F6C A;  1V5G A;  4KIT B;  3VDX A;  3G2B A;  3VYR B;  4BJT A;  2KRH A;  2WY8 Q;  1WFX A;  4HPQ A;  4XOP A;  3SDB A;  4ITV A;  2R7Q A;  3L2U A;  1MND A;  1J09 A;  1LDK B;  4PJN A;  2VJ5 A;  2X1C A;  4HEA 2;  1OLT A;  2X51 A;  3QYE A;  4F91 B;  3CJQ B;  4II2 A;  4RMN A;  2P0W A;  4BXF A;  3CES A;  2V4J C;  4KT6 A;  2IS2 A;  2Y0S A;  2R7T A;  2GOM A;  3OIQ A;  1N77 A;  2XF5 A;  3RTR A;  1ZEL A;  4ZJZ A;  2VQC A;  2KDO A;  2KP6 A;  4NC8 A;  3OR1 C;  3HG9 A;  3LSH A;  4HRI A;  4U7B A;  5FRN A;  4XM3 A;  2LRD A;  2DXI A;  2M0M A;  2HPM A;  5CQE A;  3SZG A;  3ZCO A;  3L2R A;  4U87 A;  3W2A A;  2HVQ A;  1QHG A;  1D0Z A;  3K4N A;  4PK4 A;  4II3 A;  5FRM A;  4BL0 B;  2MD0 A;  2XSJ C;  3OL4 A;  2UWM A;  3OYG A;  1Z7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...