2HZDA

Nmr structure of the dna-binding tea domain and insights into tef-1 function
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Transcriptional enhancer factor TEF-1
publication title Insights into transcription enhancer factor 1 (TEF-1) activity from the solution structure of the TEA domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01285 TEA TEA/ATTS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hzdA00
2HZDA
chains in the Genus database with same CATH superfamily
4YFXF 1M1EB 1MZBA 2CG4A 3FBNB 2XVCA 2M5WA 2W85A 4U0WA 4KIFA 1FOXA 1LVKA 2M30A 2R4GA 1T95A 4L9TA 1Y8QB 1QZEA 2EB7A 3OOUA 1HSJA 3TDUC 4ON0A 5KAFC 1FOWA 3CJRB 2ZJPF 4PZJA 5AIQA 5BPDA 5HS7A 4G6DA 5D8LB 3ZQCA 2HYJA 3HG9A 4E70A 3U2RA 1TL8A 3DU5A 4A69C 3SDGA 2LDUA 2JMWA 5LFAA 4CYDA 3VPRA 2GA1A 3MCZA 3CC2I 4IJAA 4RAGA 1B8IA 2RGVA 3FMQA 3DLAA 3LQRA 3ABMH 1FTZA 4RAFA 3V8JA 4BS9A 4Y3OA 3J81Z 2LKPA 3BJOA 2JTVA 3GFLA 3KIOA 1I27A 4M73A 4XORA 1FIPA 1I50J 4D5CA 2PLYA 2TDXA 2E60A 1E3HA 3PL8A 4BJ5C 1D8KA 1RC9A 2OQGA 2FNPA 2IS6A 1Z6TA 4HBLA 1U8RA 5E17F 3PNTA 1DGRM 2GOXB 2XSDC 1OFCX 4PJNA 4ZDOA 5CVVA 1MBFA 4RMNA 3CP8A 5F6FA 1UG0A 3A01B 2CUZA 1ENHA 4E7JA 5IP9J 5DUIA 3GYHX 3IUOA 4Z6YA 2E19A 3OYGA 3L2CA 4QPQA 3OSGA 5DUKA 1BI2A 1Q1HA 4IOCF 2A3SA 3E6DA 4L9NA 1YRNA 2L9VA 2RQQA 1Z9CA 1UZCA 4L5JA 3L2UA 1A04A 5ILUA 5IPAA 4CCJA 2CW8A 2MLKA 1R23A 3H5RA 1HW2A 3WTXC 2VL8A 5J1YA 1BI1A 1Z3YA 3GCMA 3HB9A 2HYFA 3S1MJ 2KIQA 5L3GA 1YS7A 2ZNZA 3L9FA 1Z77A 3T1BA 4B3XA 1QU3A 1L0OC 4JX5A 1R1TA 2VKEA 5CVRA 3ROUA 1MW7A 4G6TB 2LBFB 2P4WA 4HNTA 2X6YA 4HDVA 1FOYA 2IGMA 1QVTA 4HRIA 4I0BA 2L0KA 3K4CA 3E6BA 4H0EA 4B8XA 1TWAJ 2GZWA 4BYYA 3VSLA 5M5XJ 1J0RA 1SD5A 1KZHA 4EM1A 3GTQJ 3LSRA 3FXOA 3IH3A 5JVGF 3W2VA 4V19K 4U87A 1N75A 1WVRA 5F64A 1YQAA 2NS8A 3F3XA 2YX4A 4LD5A 4EJOA 1T33A 2VONA 2O0YA 2R7QA 2FRHA 3IHUA 5KAIC 3R0AA 3WTTC 5J47A 4LB5A 3MKLA 3RIRA 2NOJB 1HF0A 4MIMA 1VQ9I 2EWNA 2L7KA 4PGHA 4FHTA 1YLFA 1IG7A 3SDBA 1G4DA 1HDDC 4MEYF 1QVUA 3D5RC 3CZ6A 2EIKH 3J7YJ 2ZJQF 1TQMA 3CESA 4M3FA 1KQ9A 3W2WA 1AOYA 1YITI 3IAM2 3O8HA 3FMRA 4HEA2 2K4BA 3W3CA 4ENMA 4IHTA 2LNBA 5AONA 5DYMA 1T39A 2OV7A 4UVBA 2MFZA 3Q0WA 4S05A 4J19A 4LOCA 4F3QA 4O6JA 1MMNA 2E7WA 2VQCA 2L7MP 3BZ6A 2P5LC 4E7IA 4BQOA 4F7ZA 2Z3YA 1BM9A 1OCCH 2VN2A 3MZYA 3O8GA 3JTHA 4V2GA 1H0MA 2K3PA 4M6VA 1ZHFA 1YHQI 2ZXHA 2W82A 3CJTB 3L09A 4PJJA 3ZN0A 3DEUA 4DOZA 2L4MA 1NK2P 1HKQA 2VJIA 4M9XA 5HNHA 1IRXA 3WODF 3E7LA 1S29A 1F9NA 1ZK8A 2Y31A 2BEOA 3F22A 2E1MC 5D5VB 2V9KA 5EEAA 1I6HJ 3JRFA 4N9HA 2LLKA 4A3FJ 3BC8A 1WJEA 3REOA 1ZG3A 2Z16A 5HS8A 2CV1A 2PJPA 3DBLB 3GEZA 3RSNA 3OYFA 3BTCA 4IHYA 2VXDA 1LFBA 1LUJB 3QQAA 2QSFX 4XK4A 5CYVA 3KYDB 1KU2A 1VQKI 3JW4A 3LSKA 1MNMC 3K1NA 1U5TC 2KPMA 5K7FA 2PEXA 1JKPC 2JVHA 1BOBA 5EGOA 3BZCA 1ZG5A 1LQ1A 1B8IB 2K27A 4U7BA 2VJJA 4AIHA 2CFXA 5DDGA 5L3CA 4NHJA 3U1DA 4BJTA 3HGYA 2VE9A 2J5OA 3WHBA 4ZYHA 2A6TA 2AXTC 3DTKA 4ITVA 3UKGA 5EJCA 4BACA 4FQGA 3HOVJ 1WH7A 3ABKH 3F8FA 5LRRA 2NVQJ 1GDTA 1OR7C 3HPHA 4XMYA 4FCYA 1GHCA 2ME6A 1SFEA 1O7LA 4QPOA 1I1SA 3SFIA 5DCFA 3C3WA 2FUG2 1X19A 1FC3A 1S7AA 4ETSA 2HFHA 5H2FC 2QKLB 4KMUX 1FYLA 5D4SA 1X2NA 4JBAA 4B1RA 3O6BB 2Q2EA 4PJ0C 4MGRA 1JTXA 2X1CA 4F92B 3CMAI 2X85A 1PVEA 1Z7UA 1ETYA 3D5LA 1P4AA 1GXQA 2HTSA 4UVCA 3RI4A 3ZOBA 2MBFA 1XPXA 1ZG1A 4LK1F 4YIFA 4XIDA 3R4KA 2BY3A 5L3FA 3L2WA 4NNJA 2O3FA 3OYDA 4C3JJ 5CVUA 2HPMA 1R9TJ 1KU3A 3KZIC 5ICFA 1NG7A 1SFXA 1V3FA 1IN6A 2KDOA 3GFJA 1WFXA 4C30A 1QPMA 1X58A 2G9WA 1ON1A 2E7XA 4O5VA 4ESBA 1I39A 2DQRA 2OCCH 1E0EA 4LJZF 1SMTA 3ZPLA 2X9DA 3OMYA 1E3PA 1TP4A 3CLQA 2WY7Q 3P9IA 5D5XB 1Y1VJ 2M0CA 2DOEA 2F4IA 3ZMTA 2WAQN 2JRTA 1K6YA 2RDPA 2ZXJA 3HHHA 2PMZN 2F4MB 2LY1A 3E97A 5EG0A 5JR3A 5HVQC 4XRSG 1B4AA 5BNGA 4MQ9F 3KYCB 4ABZA 4S0HB 3KFWX 4P5OA 5IYCJ 1YOVB 4AC0A 2IA1A 1G2HA 2HS5A 2K9MA 2CV2A 5E3MA 2QLZA 3KCCA 4XNFA 4U7DA 1D0XA 3CMEI 4HAMA 4CA0A 3LA3A 4XLNF 3S2DJ 2P6SA 2IVMA 1DU6A 3N4MA 2M3AA 1MBKA 2CUFA 2VBXA 3KEYA 4FE7A 4H4KC 4HNVA 2QQ8A 5M3MJ 1XTAA 4EQQA 1U3EM 3OYJA 4AIDA 5IP6A 3KP3A 4I99C 1JUMA 5HLIA 3CC4I 4CZZA 3DP7A 5J4VA 3PFYA 2DOFA 2QCOA 1HLVA 1P2FA 3JTGA 3SJMA 3BG6A 3LOCA 4BEHA 2O6GE 1KONA 3ABLH 4AU7A 4ZYDA 2GWRA 1YYVA 3P7NA 1OKRA 2LF8A 3HKZN 3JRAA 2KZVA 2R7UA 2EK5A 2BY2A 2M9HA 4J01A 2TCTA 4ZYEA 1WI3A 3J80K 2VODA 2HYGD 2FD5A 5LRSA 3OYIA 4N0BA 2M1BA 1OYWA 4YFNF 4FTHA 4IHSA 3LL7A 2L7ZA 4A3DJ 2EFWA 4D5FA 2B7EA 3TP3A 2CUEA 3TOAA 4A6EA 1IN5A 1G3WA 1ZAOA 2HZTA 4KN7X 3PNYA 1K61A 2KRFA 2R7SA 1WH5A 5AIPA 1MSFC 4XSXF 4XRFA 1L3LA 4A6DA 4G7ZF 5IP7J 2JUCA 4MTEA 2MC4A 4FETA 1SC7A 1W1WE 2E2IJ 4XN0A 2QKMB 2DFIA 4B47A 3ZQHA 3KETA 1ZELA 4XONA 2D1VA 2A61A 1VQOI 1TNTA 3DFGA 1BW5A 1P6RA 1N78A 1QQIA 1ZQ3P 3KLOA 3GFMA 3TOBA 3FHZA 2QBYA 4BXXJ 2QWWA 3HIFA 5E1XA 3S3OA 4WXHA 2CU7A 3BTLA 4DZJA 3OSFA 3VYTB 3OIQA 3RQ4A 1UELB 4LIVA 4XKCA 4RA2A 4ZTJA 1APLC 5HLGA 3ZMUA 4CYCA 5CPRB 4KICA 3LNQA 3DWLE 1BIAA 1BIBA 2HDDA 3JRCA 2DU9A 4XKVA 1D1BA 2QQ9A 2DDBA 3I0TA 4BXFA 4LGWA 2JA6J 5FKKA 2L02A 2X48A 1LDJA 3KZZA 4GYIA 5EGOB 2FOWA 2M4GA 3QRFF 1PP7U 3ZQGA 1IW7F 1F1ZA 4P9FA 1ZKGA 1V5FA 2EZKA 5DEQA 2QUFA 3H3VK 3DTIA 2QQBA 5F0HA 5J6XA 1BR1A 2NVTJ 2CRGA 1IN8A 2VB6A 1SFOJ 2DBBA 4II3A 4X6AJ 2O61A 4XLCA 1UHWA 2LY9A 1IRFA 2Z1DA 4GXOA 3RDIA 4XBFA 2DA6A 2VT2A 2MW8A 2DPUA 2Q2EB 1FSHA 1GXPA 2E1CA 4IQJA 2COBA 2DOAA 3CTAA 2KRCA 3A01A 3M3YJ 4RAYA 2L9RA 2O8KA 1D0YA 1YX3A 2AO9A 2DT6A 4M72A 1R5HA 2X4HA 3FBIB 1BI3A 2JA2A 3ONQA 2DFHA 1R5ID 4EM2A 3O2PE 1E3OC 2IPQX 5B66C 1HOMA 2HOEA 4HSRA 4IOAF 3FIWA 3S1RJ 3OY9A 4P55A 3L00A 2E34A 4DJAA 1O3QA 3OYKA 1HKTA 1K78A 1FZPB 4U0YA 1VI0A 1QA6A 2DTZA 2WC2A 5HODA 3CCUI 2ZFUA 3E5QA 5GP9A 2ZJ2A 3FXKA 4R8HA 2BXYA 4AWXB 2OZUA 3J7AO 5EG0B 1MDMA 2IGNA 3CDIA 3ISPA 2HWVA 3DEWA 5DCMA 3BWGA 5TGTA 2FOKA 1IXSB 2A6EF 4M6YA 2R7RA 2XIGA 5LGTA 4QLCU 3K69A 1WHUA 3F9KA 1SAUA 4WWCA 3RZDJ 4I76A 1IV8A 5FJ8J 2XB0X 4KIBA 1W0UA 3X2QH 1ETXA 4N4OB 2Z9OA 5BQTA 4IO9F 4BNCA 2DCEA 4O3MA 3R6SA 4I02A 1B9MA 4I0AA 1R36A 2L3DA 1PJRA 1HW5A 4EGZA 4UY8I 1REPC 4N9IA 2QEXI 4CSWA 4ZC3A 1J09A 2YUSA 3K7AJ 2KJBA 2ECBA 3DEEA 3IC7A 3F8CA 2JN6A 3FWEA 5GAHJ 4ASNA 2JPBA 3DTEA 5HDKA 5TRDA 1FYKA 4IHXA 3EPZA 2AXLA 3BR3A 2IJLA 3ECOA 2M8GX 2I5UA 4XN3A 1BI0A 1FP2A 3PQJA 5HS9A 4BEHB 2H8WA 5LHHA 5HLTA 1QPIA 3E1SA 3EETA 3K2AA 2Z2SB 1HSTA 4A3BJ 2Z5UA 3F23A 3GTJJ 1HBXG 1SEUA 1WJFA 4Q47A 3I4MJ 4IHWA 3V7RA 1JJ6C 3AG4H 2E5ZA 3WG9A 2HVSA 2BVLA 3FXMA 2FXAA 1S5LC 1IV6A 1D8JA 3WE3A 3TW6A 1NTCA 3SEZA 1XB4A 2M0MA 4DNCA 3DKXA 4OIOF 2MG4A 2W4SA 3WGIA 2RREA 4I09A 3M8JA 2F5CA 4BE2A 3U1KA 3CP2A 3JREA 3GWZA 1DP3A 1B59A 2NVYJ 2VE8A 4A2UA 1MMSA 1XSDA 4AYBN 1AKHA 1IXCA 2V1DA 3H5NA 4QWQA 5J1UA 1VQNI 3S15J 3H3ZA 2LTPA 3TQNA 3G1LA 5J1RA 3TO6A 1JHHA 2R7VA 1YFHA 5ICEA 1RIOH 1X2MA 1S9HA 2QBYB 5ERIA 5K5OA 1XN7A 4XLAA 1P7JA 2JSCA 2ZXWH 5B1BH 2KHMA 4XLPF 1K79A 4XSZF 2DW4A 3QYBA 4LLLA 1K4TA 1STZA 3Q0VA 3TDZC 4CYCB 3KPHA 3FK6A 2XDVA 3ESWB 1G3TA 3QPHA 3WU2C 1BJZA 1Z1DA 2FBKA 4UXNA 3RKYA 2V7FA 3GLLA 3I3LA 4C3IJ 5ILVA 5FKOA 3K70D 1YJWI 3IKTA 2VQLA 4XKBA 4IEJA 2JK3A 2LP0A 3OYHA 4RLQA 4DYRA 4ZDPA 3SHFA 1Y0UA 2LF7A 3S16J 2ZO4A 1ONVA 2CJJA 2WV1A 3KP2A 2KL4A 2DQLA 5DTDA 2CW7A 3QPTA 4HLXA 5M3FJ 2XKPA 3BLYA 1ETKA 1JUPA 1WJCA 1XSVA 1T98A 1S7OA 3HYIA 5FB2A 4WX9A 2GQQA 2VKHA 2QENA 4A93J 4CCKA 2ZBKA 5GPCA 2DMPA 3FX3A 5E1WA 4W97A 1LVAA 4BKXA 4KUMA 1MBGA 2CSOA 2A07F 2VIXA 3ZQFA 3ERED 3HC7A 3I56I 3SYTA 1Z6RA 1UJ8A 1Y39A 1RR7A 3M4OJ 1FY7A 2NVUB 3RYRA 2ID3A 2QYOA 1BJAA 3SXYA 2MA3A 4HQEA 2HXOA 5E1ZB 4QIWN 4GCVA 5D6FA 3DLLF 3H0DA 5JI6A 1IF1A 1N25A 1JXSA 2K5CA 2RAEA 4OAZA 1DDNA 4BY7J 3CCMI 5BMZA 3AG3H 1O7FA 3FHNA 3VSKA 5L3EA 3SZTA 3OYBA 1HW1A 3CUOA 1RR8C 2LOOA 1K78B 2KISA 3BTJA 2DK5A 4UUTA 2A69F 3LWFA 4B3AA 2VQGA 1ZREA 1LEAA 2IA2A 1JT0A 2DT5A 1MDMB 4WK8F 2L01A 5DCMB 2R0QC 1WCMJ 1Z3XA 3OIOA 3BQYA 3AKZA 1BW6A 2DK8A 4MFDA 2Q8KA 4BHPA 3TP0A 3BTIA 4XLEA 4U88A 3WTVC 2HOAA 4RS8A 5EF6A 2M7BA 3ZRGA 3JRBA 4FX4A 3LFUA 3JRHA 3FMSA 2M7AA 2R5YA 2DA4A 3T5XA 3BT9A 3NAUA 5K5RA 1D0ZA 5CKTA 1TNSA 3M1EA 1MJ9A 4PK4A 1RI7A 2IT0A 1X1AA 3DPTA 3V4GA 2FU4A 1JTYA 2EA2A 2R7TA 3GTGJ 4HZFA 1ZTRA 1OYYA 1YIOA 2W25A 4EATA 3K70C 1YJNI 1FJLA 4UHTA 3GTOJ 3KP6A 4WXDA 3AAFA 3MD2A 2RQPA 3BQZA 3C18A 3H36A 4CO8A 4M71A 2FSWA 4ZYGA 1YI2I 3WTWC 4BJ6C 3WGGA 4JP0A 3WTZA 5KNLA 1KU7A 3M1CA 2JSPA 3PJRA 2JJ7A 2HEOA 1VQLI 2EILH 3OR2C 4EJTA 3JSPA 1GVDA 1Y0NA 4BXUA 1LFPA 1R4MB 2V1XA 3O3KA 4RB2C 1K6OA 3KZYA 4BUPA 4PDKA 3PM1A 4PFPA 3A1YA 3LSHA 1U9OA 3F0CA 2D5VA 1U6GA 3ZQLA 2K4JA 2ZMEA 1IUYA 2MC3A 2BYVE 1O4XA 5LEJA 3DF8A 3FXLA 2R7FA 2YPRA 3K1MA 3R0JA 2KP6A 4PGGA 3M9AA 5FROA 1TC3C 5LBQA 2X6XA 2H6CA 1ZGAA 3HRUA 3A0HC 4ZYAA 4EVIA 1AKHB 3PO3J 3IWFA 3WU1B 1Y8RB 5F1RA 1RNLA 3F21A 3T0YA 5K7ZA 2IBDA 2KFDA 5JHUA 2HGCA 3IP4B 2HZDA 2HXIA 3RZOJ 4ESJA 3SQNA 3RKWA 3CCVI 2EFOA 4PSWA 4A3IJ 2F48A 2LH9A 4YG2F 1W7PD 4ZZLA 2G7HA 4A5MA 3E5XA 2DXIA 2Y48A 3R61A 2IXSA 1DU0A 5C44J 1HC8A 1SVLA 1X3UA 3CCJI 3GMEA 1DPRA 3BR5A 2BW3A 3CO6C 4B48A 4ESFA 1GUUA 3W6KB 1P9QC 5IYBJ 4OMZA 4DBQA 2F5EA 2XHKA 1JGGA 4RM2A 3WE2A 1MIJA 3Q0UA 4Y17A 1Y1WJ 2CH0A 2EA4A 3SFZA 2WB1A 4A3JJ 4CZCA 1LPQA 1UFMA 3NWSA 2JT1A 5KCMA 2X0LA 3BROA 3HXLA 2LFBA 2FQ3A 2NS0A 2OCEA 4IXAA 5L3BA 1CQTA 2EFPA 1EA3A 2R7XA 3GTMJ 3K6GA 3PIOF 2VQHA 2XRLA 2VPRA 5E18F 4BHCA 1GV5A 3GTPJ 1EJ9A 4CXFA 1OCRH 4AUXA 2FE3A 5E8IA 4BHBA 2DLLA 1T6SA 2HNHA 3Q9VA 1LE8A 2ZNYA 1D3YA 4NDLA 1U8BA 2HU9A 3BR1A 3PQKA 5J40A 2XUBA 3RPQA 3VDXA 1MNEA 1POGA 4I2OA 2EZHA 2XC7A 4LIUA 4MQVA 5H6RA 2OUMA 3IKVA 3ULQB 3LAJA 3RPUD 2XF6A 1BOAA 4XL9A 5FKMA 1Q1VA 3BCBA 2KIUA 3OS2A 4XLFA 3ABUA 3MVPA 4CICA 4HDUA 3HBLA 1XDUA 4TV7A 4IX7A 1T56A 3MFKA 2O8XA 5DM6F 4RAZA 3K1PA 4RB3C 3E6CC 1SD6A 3OWTA 4XR6A 1IXRC 1G6NA 4KFCA 2N8GA 3CCLI 2ESHA 2DN0A 2EZIA 2DJNA 4II2A 4HF1A 3SEQA 2XAGA 5F04A 4S04A 4XM3A 1T08B 2GIVA 4KT5C 2Q1ZB 5DD8A 4UV8A 2NAZA 4GO1A 5FGMA 4B09A 2OF7A 3CO7C 4W1UA 2DYRH 1FPQA 2PI0A 4IZZA 5F0FA 1ZARA 3G71I 1A6IA 4Q5SF 5DV5A 1A31A 2FBIA 2Y0SN 1ZRFA 2ADUA 1ACIA 2O03A 3R60A 2MLGA 3H92A 3P5JA 2NS7A 5JVTA 2K02A 5BPIA 4HF2A 3Q5FA 2FBHA 4NUBA 2CV0A 2O5RA 2JWTA 2R5YB 1XCVA 4EV0A 2LR8A 3RTRA 2XROA 3LSIA 2K7LA 2X51A 4ZH4F 4G7OF 3OYLA 5FRMA 3BP8A 1R22A 3NWTA 2OTJI 2XGCA 1LJ9A 1UG2A 3ZCOA 1P92A 4PJLA 2W57A 4B44A 1IN7A 2EV0A 4MEXF 4BL0B 4BQQA 4IRGA 2DODA 2K85A 2M4KA 1ORKA 1XGNA 3FM5A 2HR3A 3FK7A 2V79A 2V6CA 2Y2ZA 3K10A 4UB8C 3HHGA 2EBIA 4RGUA 4A0YA 1K4SA 3K4KA 2V6EA 1BC7C 4E7SA 4RBOA 3S1QJ 4BAYA 2EPFA 1J59A 4D7MA 2VUMJ 5IOZA 5BS6A 5HNFA 3HGGA 1ZR4A 4BQAA 4GGGA 5LHIA 2C6YA 2EIMH 1FBUA 5J8CA 1SFUA 2EJRA 2HVQA 3G3ZA 2QF7A 3F6VA 2ZFWA 1F4KA 1HQCA 2ZMEB 2P7VB 2M87A 1XGOA 3BJ6A 5FFXA 2DA7A 3RQIA 2ACJA 1J9IA 4DQ2A 2LYCA 4CCMA 2IS2A 2KIMA 1VFCA 1MMAA 3F6OA 1Y56A 2Z99A 2FMLA 1HCRA 2WTEA 4IQ4A 5EEGA 2ZXIA 1RZ4A 2LVSA 2CQXA 3ZQ7A 4EJWA 5D8KB 1T0FA 4B43A 3KEQA 1QHGA 2VOPA 4LLNA 1G3SA 1S8NA 1FX7A 1X1DA 1VQ6I 4LFUA 5M5YJ 5FO5A 2DO7A 4E7HA 2DJIA 1SVMA 1UMQA 1IJWC 2DMUA 5C4JJ 2V1UA 3KX2A 2IEKA 2HOSA 1DGWY 3HL2A 1FBQA 1ZYRF 2LSOA 4AIKA 4A3LJ 3ZMVA 3FF5A 1X4OA 2H09A 4EM0B 2GXGA 2XAUA 1JGSA 3C1DA 4OOIA 1ZRCA 1W7PA 4OU0A 4FT8A 1OJLA 3P9KA 4ZDLA 4ENJA 5DD4A 3IRRA 3JRGA 2W84A 2Y0MA 2BW3B 1OLTA 3LA2A 2LMDA 2L54A 5ICGA 3LSGA 1FIAA 1WWXA 3OS1A 4MFEA 5FLXK 3WG7H 3LQQA 4P9UA 4L0YB 2L9NA 3MZHA 4HQMA 2ZSIB 4J00A 1W5TA 3A02A 3T8TA 5IOYA 1AHDP 2VBWA 3KP7A 2GAUA 4G94A 1J2XA 1AA7A 3FM3A 5IT9K 4UV9A 1WI9A 2OU2A 4OWRB 1XD7A 2HKOA 5DS9A 3ABTA 4KISA 3FXRA 1HKSA 2HQ5A 1CF7A 2FX0A 2E35A 3KEOA 3ZQIA 1EKEA 4DW6A 3H9GA 4F93B 3S1NJ 1TQPA 3A4CA 2EH3A 4D7NA 1LE8B 1FSEA 3B6CA 4XKWA 1YIJI 4L0ZB 1LNWA 2HKXA 2VASA 4DYCA 2XF5A 2PMUA 4BQNA 1V5EA 3CF5F 2P7CB 4L18B 2DFFA 2Y30A 4CCNA 3RPUA 2DTRA 3OYNA 2ELJA 2PN6A 2R7OA 1X1PA 3IH4A 5C4XJ 2CWEA 5GAEJ 4A0XA 2VLAA 1G3YA 1R58A 4R1HA 5H6QA 1SAXA 1OYIA 2CYYA 2JRMA 1KQ0A 1ETWA 2CUJA 5E8GA 4ENNA 5EZHA 4ZTFA 2IGOA 2E2JJ 2XV4S 1OISA 2M8EA 3IH2A 2OTLI 1YE9A 2B0LA 2K3FA 5K1YA 3IRQA 1U0JA 1JHFA 3ML6A 1MJAA 1J75A 3G73A 3OL3A 1V4RA 2BHZA 3M7GA 5ILSA 1S6LA 2AQFA 4C2MJ 3K4NA 1MJBA 5HLHA 1XMKA 3WTYC 4LB6B 3JAMK 2E1OA 3C2BA 4HV6A 5ED4A 2K40A 1HDPA 3CF2A 2GIZA 1RRJA 1U78A 4KN4X 2BY1A 2PQ8A 2UXNA 4N4NB 3UR3C 1YJ9I 2ISYA 1HXDA 1UCRA 1B72A 2QM3A 4P96A 3N05A 3AFHA 2PFBA 4MTDA 4M3GA 1R4NB 3HOTA 2I8DA 3F8NA 3EYIA 2BBYA 3I59A 1OCTC 3QOPA 3EYYA 1T38A 4IPAA 2V26A 3BY6A 2VT3A 2P81A 2WAQA 3CCEI 5GADJ 1IRZA 2KIFA 2PMZA 1GV2A 2NRAC 3B02A 2L4AA 2GXBA 3S3MA 2G7UA 2K86A 3PNVA 2ZJRF 3MQ0A 1LDKB 2WA0A 3K4MA 1B6AA 3GUDA 5JLWA 5HOOA 3CCQI 2ETHA 2DMNA 1OCZH 4RLFA 3M8FA 4RM3A 1MH4A 3HOWJ 4Q4ZF 2FF4A 5CVIA 3P9CA 3QYFA 1WGXA 4GRIA 2O9LA 3I64A 1KU9A 2DAOA 3ELKA 1Z91A 3JRDA 5LGUA 2VPLA 4PUSA 3DKYA 5LHGA 1FLIA 1SVOA 2GLOA 4UUSB 4HSTA 1A6QA 3CDLA 2KMUA 3HSRA 2YR2A 3I5UA 4PFOA 4U0VA 3BR2A 4MO7A 1KQ8A 5EDNA 3RCOA 2L5QA 2IRFG 1WJBA 4EJUA 4ANJA 3PO2J 1EH8A 1IZ1A 4DYQA 2PG4A 2BVMA 2F6CA 3B73A 2D2WA 1O3RA 1FTTA 5CQEA 2GOMA 3RJPA 1JKOC 3HKZA 3MMYB 3EUAA 3TEDA 4ZZDA 2K9QA 2P0WA 1VQPI 3HZJA 4RB0A 3MKWB 3VYSB 4L5EA 2DMTA 3GXOA 1QGPA 5FLXZ 1TT5B 1TLHB 2CQ7A 2L2OA 3QYEA 5CJ9A 2H1LA 3H1CA 3L2VA 2MH2A 3GLXA 4XOTA 3UNGC 1MBHA 1P4WA 3ZN1A 2R7ZJ 4MHGA 2R3SA 3MAJA 1TTYA 5FLVA 2RNGA 1ZLJA 2HDWA 4Y7NJ 3QU3A 5IT9Z 3G2BA 2EQRA 1EH7A 4EEFG 3MN2A 2DYSH 1W7PB 2QSGX 1XCBA 3K4BA 3DCFA 4HW0A 1O3TA 1R00A 2J5PA 3H5AA 3VYRB 3HRMA 3TO9A 3HOUJ 3HM5A 3BZKA 4NB5A 1H88C 2EINH 3ZXSA 4F52A 1S3JA 4I01A 2DA5A 1TWCJ 3HRSA 3PUFA 5EZGA 3VWBA 1UHSA 3S3NA 6PAXA 2IS1A 1N77A 1XMXA 3VYUB 3S17J 2M34A 2HQRA 3KLNA 1VQ7I 1WPKA 4QTRA 3L1PA 3ZP5A 3HTSB 1I6XA 1WQ2A 1KA8A 3H9JA 3IL2A 1FT9A 4A3EJ 2H8RA 4OIPF 2X1EA 2QA4I 4CGZA 1U2WA 5LLQA 4XRMA 3LFKA 4A3CJ 4UNOA 3QP5A 3HRTA 1W36D 3HUGA 5D5WB 2DA3A 2HQNA 2XGEA 2PMHA 1CF7B 2YU3A 1K7AA 2ELHA 5L3DA 4HF0A 3I55I 2RNJA 3EQLF 5HDNA 1KGSA 3CUQA 2BGCA 4BGDA 5FD6A 3BCAA 2UXXA 2BXZA 3I58A 1FNNA 2RV8A 3N97A 2ZMEC 3CD6I 3BG7A 2BZTA 2E2HJ 3BG3A 1FP1D 2E1NA 4R79A 3BG9A 2UWMA 3GTKJ 3JAMZ 2OC6A 2M2EA 2QQAA 1PDNC 1WJDA 2YS9A 2LKSA 3H35A 3AL0B 3A0BC 4KNYA 2ELKA 3KE2A 1X4PA 4M3BA 3I4PA 1PUFA 1QBJA 2LREA 5K5QA 2MD5A 2R7WA 1XC5A 3HOZJ 4C9YA 5IT3A 1DUXC 1SMYF 1JUSA 4DBRA 4UVAA 3HEFA 3CCYA 2E5NA 2UUZA 3I71A 2V4JC 2MD0A 5F08A 3TW7A 2HOTA 2STWA 3K2ZA 4B4CA 3FXQA 1XG1A 5GTIC 4G12A 3EUHA 2LD5A 1MNDA 2DA2A 1C0WA 1F5TA 1RKWA 3VODA 4G6QA 2EIJH 4D1QA 2XKOA 1TT0A 2KT0A 4IHVA 2MYSA 1OCPA 4PJMA 4PSXA 2ZC2A 3W2AA 5ICCA 2VI6A 3RYPA 2ZCWA 3WU0A 1ZRDA 3PSFA 1YTYA 2VC1A 1B72B 3MKYB 2WV0A 4D0PA 3ASNH 1SD7A 3K9TA 3DV8A 1VQ5I 3OIPA 4HOBA 1EH6A 1PUEE 4QSHA 2G0EA 3I59B 1ZGJA 4BY1J 1W0TA 1D5YA 2KRHA 3CMYA 2R92J 3L7WA 3QP6A 2F2EA 1GVJA 5F27A 3WGHA 5FKNA 4RDUA 3J7AY 3G1MA 1MMGA 2XASA 2JZYA 3C2HA 1GT0C 3JR9A 1A5JA 1MBJA 1X1CA 3KP4A 1J7KA 1MMDA 2IW5A 4M6XA 3FKIJ 3GZNB 1R1UA 3OL4A 3FZVA 4IF4A 4M3DA 1QO0D 2IS4A 2NNNA 1MBEA 4HX7A 4WCGA 2JQ7A 3COAC 3DPLC 3W6JB 1W36C 1WRJA 1D1CA 3IAS2 2JUGA 1ZR2A 1MSEC 4BDZA 4E7ZA 5DM7F 3OYCA 2JA5J 4AIJA 2OAZA 2PBIA 2DT7B 3S8PA 4XRSA 1YW7A 4DIQA 4IVNA 5B5EC 2FNAA 5LD2C 2RN7A 3HSFA 4NQWA 4BBRJ 2WBMA 1JKRC 3RKXA 1R1VA 2P8TA 3CJQB 3K0LA 4CCOA 4BBSJ 2KDZA 3E0JB 3GX4X 2UZKA 3NEUA 4HX4A 2D1HA 2OBPA 2CMPA 2YSRA 3FISA 4RGXA 1TWFJ 1D5VA 3FKJA 1VTNC 2RVCA 1LDDA 2NVXJ 2ZB9A 1JI8A 3GVAA 3M07A 4KIGA 1XSXA 3NQOA 2EFQA 2B63J 4RB1A 3LA7A 5H20A 3H0GJ 2LK2A 1I3AA 1MGTA 2ICWG 2VOOA 2CGPA 1WJ5A 5LGNA 2ESNA 1NK3P 1DQUA 4FISA 2H1KA 1BA5A 3LSMA 4F55A 2XAQA 1Z0XA 2MH9A 1WZ2A 4I7HA 1NG6A 2A68F 2LRDA 3GFIA 1ZLKA 1TW3A 4OIRF 1BBYA 1BR4A 3PUBA 5E3OA 5FLMJ 1LB2A 4HYEA 4LG0A 2AS5F 1QZYA 2NOGA 2Q0OA 4X1EA 1I5ZA 4AYBA 3VOEA 2YU9J 2DMQA 4E4HA 1ETOA 3HOXJ 4XQFA 2JVGA 4NC6A 4A12A 4NC8A 4E7KA 2JA8J 3WHCA 2HQAA 1VQ4I 3K4LA 3JRIA 4NC7A 2XAJA 1FYMA 1RUNA 1ETVA 5CQGA 3IWZA 2NNYA 1ULYA 2HPIA 4BU2A 1IN4A 1USTA 4A0ZA 3S32A 3HUGB 2BY0A 5K7HA 4Y13A 2W1OA 2PJRA 4IRIA 4JOMA 4A3KJ 1YW8A 3DU6A 5JFRA 4BE1A 2XPVA 4YFKF 3TGNA 4IL6C 1X1BA 2KQRA 3CUQB 2GA2A 3QWLA 2KLOA 4EMSA 3TMOA 4OMYA 1ZN2A 3I53A 5LEKA 4IKFA 1IGNA 3J7ZI 3GO5A 4P1WA 4HX8A 4V2FA 2P5VA 3S2WA 9ANTA 1YW9A 2V9PA 1VNDA 1RETA 1OQYA 5HDGA 4EGYA 1IDYA 1OPCA 3OOPA 3F8MA 4NBQA 1B1BA 3G1OA 2F5DA 4M9SA 3PIPF 3MKZA 1T0FC 3M8EA 3CLOA 2X1DA 1PUFB 2W48A 2A5YB 1R7JA 1MH3A 1PYVA 2P6TA 4C2UA 2STTA 1S7EA 1T2KA 4YRVA 3A03A 3CQZJ 4Y52J 4WXCA 2LC2A 3ASOH 1YRNB 3BPXA 2BOLA 2CFOA 4JQFA 4A5NA 3QAHA 1G59A 3A2KA 1D1AA 3MWMA 5GTHC 1TZLA 2F5FA 2OZ6A 4RGRA 4MLOA 2QGUA 2VXZA 2DDAA 5F1JA 1Y6IA 1FWZA 4YELA 2EV6A 3LMMA 3E6MA 3JSOA 4G9YA 1YX5A 3ZGKA 2WY8Q 3F72A 2COMA 2E36A 1IRGA 1ODDA 2K9SA 2MSYA 2NXNB 3CC7I 3FXJA 2VBYA 3S93A 3TBIA 1YG2A 2VJ5A 1BN5A 2MGQA 5CVJA 2K9NA 4FX0A 3V8KA 1TW2A 1YS6A 4AM3A 2XAFA 4KYWA 1ZGWA 3BDDA 1W5SA 2HVRA 2W00A 5JHFA 1JJ8C 3E3VA 2XPUA 1VQ8I 4KITB 1H89C 3NRVA 5TJJA 2VKVA 2JPCA 1U5TA 4HLYA 4BE0A 5B3SH 3CJNA 3WTUC 3GBGA 3VFZA 1VF9A 3FXUA 3LSTA 2FQ4A 1V55H 5KHDA 4DGWB 1EV7A 2O7OA 2W24A 3JCUC 5E20A 3W6VA 2HTJA 2L9SA 2ISZA 3U9GA 2CO5A 3MEXA 3V42A 2KZGA 1B9NA 4L9VA 1VQMI 2VKDA 1O57A 1T8IA 1BL0A 3TKYA 1OR7A 2QVOA 1TWGJ 4UUSA 2FMYA 1YO5C 4Y4RA 5GPAA 3BOQA 5CLSA 4PCQA 1IC8A 2X6WA 2H94A 1SFKA 2UV1A 4GDFA 1E17A 1WJAA 5E79C 3OR1C 1O3SA 3QPSA 5D5UB 4ZJZA 2QZ8A 2AHQA 3BG5A 1V5GA 4I98B 4FASD 1TQIA 2R5ZA 1H8AC 4NQWB 3GTLJ 1WKMA 2BE5F 5KVRA 2A5WA 3SZGA 3AG2H 1DPUA 3AL0C 5A2QK 4KMFA 2R93J 1J5YA 1P7IA 1Z21A 4UUVA 1QNTA 4EJVA 2XRNA 1LEBA 3ECHA 3E5UA 4OINF 3QODA 1UAAA 1FEXA 2OA4A 4WF2A 2NYXA 2QSHX 1TWHJ 3V7CA 3DQVC 3HTUA 3QPLA 1X3ZB 2A6HF 2FEZA 2RC4A 2L7FP 1R49A 3HPGA 3F8BA 2IGKA 2WWYA 3ZQQA 3OS0A 3CMMA 1XS9A 1PP8F 3WTSC 3OYMA 2ME0A 4CDGA 4KT6A 4FE4A 3B6AA 2H6BA 2GM4A 1W5CC 3LAPA 4HPQA 3QU6A 3DXJF 5D4RA 2EZLA 1UHMA 1U9NA 2CQQA 4HV5A 4M74A 1H9TA 4KDPA 1ZH5A 1IUFA 1Z67A 2R7DA 5TISC 1EF4A 4L9JA 4LG0B 5JLXA 3MZ8A 1KYWA 2CQKA 3ZMSA 1QRYA 3CDHA 2Y9ZA 1FOKA 3VEPA 2PX9A 2DI3A 3FDYA 2XAHA 3HOYJ 1JE8A 2X6OA 4DZPA 4XLHA 2DA1A 3DPUA 4I6ZA 3G4SI 2LKXA 3L2RA 1Z7LA 2DPDA 2F4OB 2K9LA 2H27A 1GLNA 2A05A 3PFIA 2PJRB 3TO7A 4X0GA 3L2QA 1RUOA 3BPVA 4IRHA 4GFBA 3GZ6A 1ERDA 4BDYA 4E7LA 4ENKA 4RGSA 4OAYA 1F43A 2CS3A 1SANA 5F0CA 4Y33A 2LG4A 2XB5A 3C2GA 3EDPA 3OYEA 3G6EI 4M3EA 3LSJA 4OIQF 2W7NA 3TL4X 1R6RA 2ZKZA 2V1NA 1HA8A 3V8LA 4KA4A 2E71A 2GBYA 1R5GA 4LK0F 1ITYA 3DBHB 1FMWA 3QOEA 1ETQA 4JK1X 2ID6A 3ZR8X 5EYRA 2WAFA 1XDSA 1V54H 2D45A 2BV6A 2OJED 4Q48A 3J81K 2FA5A 1NH3A 2DFEA 1IO2A 4UB6C 1K83J 3EUKL 4AD9A 5EEHA 1MD0A 1RKTA 1RESA 3I54A 2OD5A 2Y9YA 4XOPA 4G8XA 3U21A 4LMYA 1XGSA 4HG2A 3HDDA 1A35A 1F36A 2IAIA 2XSJC 4C2TA 5C3EJ 1VZ0A 3H9QA 2VJ4A 1LFUP 3GW2A 5KK1A 4GYGA 3CCSI 3Q9SA 1AU7A 1I3QJ 2E1MB 4LG3A 3IV5A 2GXAA 5BOXA 2XF7A 2IA0A 2Y69H 1X3WB 3ERMA 3S14J 2YX7A 3BJAA 5M5WJ 4BH9A 4A3GJ 2P5KA 2LBFA 3C7JA 4AVPA 1DP7P 3D5SC 4LITA 3VB2A 4A3MJ 2MABA 2KJCA 2RKHA 1E2XA 2EFNA 1USSA 1XGMA 1A36A 3J80Z 1OMIA 2AQEA 3I9V2 2IP2A 1I1GA 3I4NJ 2BHYA 3T8RA 3OYAA 1ON2A 2KKOA 1U5TB 2VC0A 4HA8A 2F5VA 3HJEA 5J4YA 1FBSA 1QHHD 4E6KG 5A2QZ 3ZMDA 1JT6A 2JA7J 2FJ1A 3S2HJ 1Z05A 3CCRI 1H9GA 3V7SA 5D6EA 2Y0SA 5IY5H 3LSPA 2WADA 2B9SA 2WAEA 1OCOH 3KP5A 3AG1H 5J8FA 1IDZA 1AWCA 5B1AH 4C3HJ 1LKXA 3BR6A 3DKWA 4D9JA 1FMVA 4YIRX 1WSUA 3D0SA 3CUQC 3NARA 5IYDJ 2XGDA 3H3UA 1SD4A 1W4MA 5E3LA 2Y75A 2ECCA 2VBZA 3K4JA 2R5ZB 4LLGF 4AVZA 4M9ZA 4CCLA 1XX5A 3RKQA 1JKQC 4CHUA 2HI3A 2CQNA 3GZ5A 2V9VA 4CUGA 4G7HF 4KJZA 2XGXA 1G8XA 4MNUA 2I10A 4JYKA 1IAWA 1KYZA 1BR2A 3KYLA 3BR0A 2LY2A 3DBRB 2OQRA 2HDCA 1XMAA 5FRNA 2TRTA 1MKMA 2EV5A 4L5IA 4CH7A 4Y15A 4K2EA 5GAGJ 1R71A 3PSIA 4HNUA 3SZPA 1CGPA 4Z2YA 2XPWA 1RPWA 3GF2A 2CW0F 2Z33A 4YEJA 4JX4A 4YIIA 3HSEA 1UB9A 4JX6A 2OPTA 2WB1N 2ZSHB 3EUHC 1BC8C 1P4XA 1S72I 5FFZA 1NHAA 1TBXA 3OV8A 4XICA 2M45A 3HOSA 3D1NI 3Q3SA 5FD5A 5J3LA 5E3NA 3ZMZA 4F91B 5FKLA 1QZZA
chains in the Genus database with same CATH topology
4BDZA 4E7ZA 3OYCA 2Q2EB 3FBNB 4IQJA 1LVKA 2DT7B 2DOAA 2R4GA 4NUBA 1T95A 3S8PA 3OOUA 2O5RA 2CV0A 4DIQA 2KRCA 3CJRB 3RTRA 3LSIA 5LD2C 2WBMA 2X51A 3OYLA 5FRMA 1D0YA 1YX3A 3NWTA 2DT6A 3HG9A 3CJQB 3DU5A 4CCOA 3FBIB 2JA2A 3E0JB 5LFAA 3ONQA 3ZCOA 4PJLA 4B44A 2CMPA 4HSRA 4BL0B 4BQQA 3FKJA 3OY9A 1JI8A 2M4KA 3DLAA 4DJAA 3OYKA 4BS9A 4Y3OA 3K10A 2ZFUA 3K4KA 2V6EA 4E7SA 2IGNA 1WJ5A 4XORA 2E60A 5HNFA 5TGTA 1DQUA 3LSMA 3PL8A 4BJ5C 4F55A 2R7RA 1NG6A 2IS6A 2HVQA 3F9KA 1SAUA 2LRDA 3PNTA 1DGRM 2GOXB 1BR4A 3PUBA 4N4OB 2DCEA 4PJNA 4ZDOA 4RMNA 3CP8A 1PJRA 1UG0A 4AYBA 2LYCA 4CCMA 2IS2A 2CUZA 4CSWA 4E7JA 4ZC3A 1J09A 1MMAA 1Y56A 4IQ4A 4E4HA 4XQFA 3DEEA 2ZXIA 2JVGA 3IUOA 4NC8A 4E7KA 2HQAA 3K4LA 3OYGA 4NC7A 3DTEA 4B43A 1QHGA 5CQGA 3EPZA 4QPQA 2HPIA 4XN3A 4BU2A 2RQQA 4BEHB 1X1DA 3S32A 5HLTA 3L2UA 3E1SA 4E7HA 3HUGB 2DJIA 2Z2SB 2CW8A 2W1OA 3H5RA 4CCJA 4JOMA 2PJRA 3KX2A 2VL8A 3DU6A 1DGWY 1Z3YA 3HL2A 4BE1A 1X1BA 1X4OA 2KQRA 1WJFA 2KLOA 3TMOA 4B3XA 1QU3A 4IKFA 2XAUA 4P1WA 1MW7A 4G6TB 2LBFB 2E5ZA 2HVSA 2BVLA 4HNTA 4ZDLA 2X6YA 2BW3B 2IGMA 1OLTA 4HRIA 3K4CA 3SEZA 3LSGA 3VSLA 2M0MA 3DKXA 2W4SA 3OS1A 2RREA 3MKZA 1T0FC 3M8JA 2X1DA 3W2VA 4BE2A 3CP2A 4U87A 1DP3A 2L9NA 1N75A 1PYVA 2ZSIB 4J00A 4C2UA 4YRVA 3H5NA 2R7QA 2LC2A 1AA7A 2BOLA 2CFOA 2NOJB 2R7VA 4JQFA 4OWRB 1G59A 3A2KA 1D1AA 4KISA 1TZLA 1S9HA 2L7KA 4MLOA 2VXZA 4XLAA 1Y6IA 4YELA 3SDBA 3LMMA 2KHMA 3D5RC 1YX5A 3CZ6A 3H9GA 3A4CA 3QYBA 3ZGKA 2WY8Q 4F93B 4XKWA 3CESA 3W2WA 3IAM2 3S93A 3TBIA 4HEA2 2VJ5A 2XDVA 3W3CA 2VASA 2XF5A 2HVRA 4BQNA 2OV7A 2W00A 2MFZA 2V7FA 1V5EA 3I3LA 5JHFA 3K70D 4F3QA 2VQLA 4CCNA 1MMNA 2VQCA 4XKBA 3OYNA 3OYHA 4E7IA 2ELJA 4RLQA 4KITB 2R7OA 4ZDPA 4BQOA 2VLAA 4BE0A 2K3PA 3GBGA 2KL4A 2ZXHA 2CW7A 2W82A 4DGWB 5KHDA 4PJJA 2CUJA 3BLYA 4ZTFA 2IGOA 4DOZA 1WJCA 2L9SA 2VJIA 5HNHA 1YE9A 3V42A 2VKHA 1IRXA 1U0JA 2VKDA 4CCKA 3OL3A 2AQFA 2E1MC 3K4NA 2V9KA 2VIXA 4Y4RA 3HC7A 3SYTA 3BC8A 1WJEA 2X6WA 2Z16A 2CV1A 2UV1A 1SFKA 3CF2A 1WJAA 3OR1C 3RSNA 3OYFA 4ZJZA 2VXDA 4FASD 1V5GA 4N4NB 3UR3C 4NQWB 2A5WA 3SZGA 3H0DA 3N05A 3AFHA 3LSKA 3AL0C 2K5CA 3HOTA 2I8DA 4OAZA 2KPMA 1Z21A 2JVHA 1BOBA 2V26A 2WAQA 4U7BA 3FHNA 2VJJA 3VSKA 2PMZA 3QODA 3OYBA 1UAAA 4BJTA 2LOOA 3S3MA 3DQVC 3PNVA 2A6TA 3DTKA 1LDKB 2WA0A 3K4MA 4ITVA 5HOOA 4BACA 3HPGA 2IGKA 4RLFA 2VQGA 3ZQQA 4RM3A 3CMMA 3OS0A 1OR7C 3HPHA 3QYFA 4XMYA 3OYMA 4GRIA 4KT6A 1Z3XA 4QPOA 2VPLA 4PUSA 3DKYA 4HPQA 3AKZA 2FUG2 1X19A 2QKLB 4XLEA 4HSTA 2KMUA 2M7BA 4PFOA 3ZRGA 2X1CA 4F92B 3LFUA 2X85A 2M7AA 2L5QA 3RCOA 1WJBA 3D5LA 4ANJA 1D0ZA 5CKTA 2BVMA 4PK4A 2F6CA 1X1AA 3DPTA 3FDYA 3L2WA 5CQEA 2GOMA 4NNJA 3OYDA 2R7TA 4EATA 3K70C 2HPMA 3HKZA 3MMYB 3EUAA 2P0WA 4XLHA 1NG7A 2KDOA 3DPUA 1WFXA 4C30A 3MD2A 3MKWB 3VYSB 3L2RA 1Z7LA 1E0EA 2K9LA 1GLNA 3OMYA 2L2OA 3QYEA 2WY7Q 4BJ6C 2PJRB 5KNLA 4X0GA 3M1CA 3L2QA 2F4IA 2JSPA 3L2VA 3PJRA 4XOTA 3UNGC 1ERDA 1K6YA 4BDYA 4E7LA 3OR2C 2LY1A 2RNGA 4OAYA 2HDWA 2CS3A 5HVQC 4Y33A 1LFPA 2LG4A 3C2GA 3G2BA 3OYEA 4BUPA 2W7NA 4PFPA 3A1YA 3K4BA 3TL4X 1R6RA 4P5OA 3LSHA 2V1NA 3H5AA 3VYRB 1HA8A 2K9MA 2CV2A 4XNFA 3ZXSA 4F52A 1D0XA 1FMWA 3QOEA 3ZR8X 4CA0A 2WAFA 3VWBA 3S3NA 2IS1A 2KP6A 5FROA 2M3AA 3VYUB 1N77A 2X6XA 3KEYA 4H4KC 4ZYAA 3OYJA 3EUKL 3H9JA 3PFYA 2X1EA 3BG6A 4XOPA 4BEHA 1KONA 4AU7A 3U21A 3IP4B 2HZDA 4HG2A 1W36D 2XSJC 4C2TA 2KZVA 2R7UA 1VZ0A 3H9QA 2VJ4A 4J01A 4PSWA 2E1MB 4LG3A 3OYIA 2LH9A 4BGDA 2XF7A 3BCAA 3LL7A 2DXIA 2IXSA 2LBFA 3BG7A 3D5SC 4LITA 4R79A 2UWMA 2MABA 2BW3A 2OC6A 3PNYA 4B48A 2R7SA 1WJDA 1P9QC 2AQEA 3I9V2 3H35A 3AL0B 4DBQA 3OYAA 4RM2A 1X4PA 2F5VA 2MC4A 2CH0A 4FETA 2WB1A 1QHHD 4E6KG 4XN0A 4CZCA 2LREA 2QKMB 4B47A 2R7WA 4C9YA 3NWSA 1ZELA 4XONA 5KCMA 4DBRA 2Y0SA 2WADA 3HXLA 2E5NA 2UUZA 2WAEA 1N78A 2V4JC 2MD0A 1EA3A 2R7XA 3K6GA 1LKXA 2VQHA 4D9JA 1FMVA 1MNDA 3S3OA 3VYTB 2HNHA 3OIQA 3RQ4A 1UELB 4LIVA 4XKCA 4D1QA 4ZTJA 1TT0A 3K4JA 2HU9A 3VDXA 5CPRB 2MYSA 1MNEA 4PJMA 4AVZA 4CCLA 4PSXA 3DWLE 3W2AA 2XC7A 4LIUA 2OUMA 3PSFA 4XKVA 3RPUD 3MKYB 2XF6A 4XL9A 1D1BA 3BCBA 4BXFA 4CUGA 3OS2A 3OIPA 4KJZA 1G8XA 4XLFA 1BR2A 2M4GA 3KYLA 2LY2A 4IX7A 5FRNA 2KRHA 3OWTA 4XR6A 4CH7A 3J7AY 1MMGA 1V5FA 3C2HA 3PSIA 4HNUA 1X1CA 4II2A 3SEQA 3DTIA 1MMDA 4XM3A 4YEJA 1BR1A 3OL4A 2VB6A 2Q1ZB 2ZSHB 3EUHC 2IS4A 4II3A 4IZZA 4XLCA 3HOSA 3DPLC 1W36C 2Z1DA 1D1CA 3IAS2 2JUGA 4F91B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZD A; 
#chains in the Genus database with same CATH topology
 4YFX F;  1M1E B;  1MZB A;  2CG4 A;  3FBN B;  2XVC A;  2M5W A;  2W85 A;  4U0W A;  4KIF A;  1FOX A;  1LVK A;  2M30 A;  2R4G A;  1T95 A;  4L9T A;  1Y8Q B;  1QZE A;  2EB7 A;  3OOU A;  1HSJ A;  3TDU C;  4ON0 A;  5KAF C;  1FOW A;  3CJR B;  2ZJP F;  4PZJ A;  5AIQ A;  5BPD A;  5HS7 A;  4G6D A;  5D8L B;  3ZQC A;  2HYJ A;  3HG9 A;  4E70 A;  3U2R A;  1TL8 A;  3DU5 A;  4A69 C;  3SDG A;  2LDU A;  2JMW A;  5LFA A;  4CYD A;  3VPR A;  2GA1 A;  3MCZ A;  3CC2 I;  4IJA A;  4RAG A;  1B8I A;  2RGV A;  3FMQ A;  3DLA A;  3LQR A;  3ABM H;  1FTZ A;  4RAF A;  3V8J A;  4BS9 A;  4Y3O A;  3J81 Z;  2LKP A;  3BJO A;  2JTV A;  3GFL A;  3KIO A;  1I27 A;  4M73 A;  4XOR A;  1FIP A;  1I50 J;  4D5C A;  2PLY A;  2TDX A;  2E60 A;  1E3H A;  3PL8 A;  4BJ5 C;  1D8K A;  1RC9 A;  2OQG A;  2FNP A;  2IS6 A;  1Z6T A;  4HBL A;  1U8R A;  5E17 F;  3PNT A;  1DGR M;  2GOX B;  2XSD C;  1OFC X;  4PJN A;  4ZDO A;  5CVV A;  1MBF A;  4RMN A;  3CP8 A;  5F6F A;  1UG0 A;  3A01 B;  2CUZ A;  1ENH A;  4E7J A;  5IP9 J;  5DUI A;  3GYH X;  3IUO A;  4Z6Y A;  2E19 A;  3OYG A;  3L2C A;  4QPQ A;  3OSG A;  5DUK A;  1BI2 A;  1Q1H A;  4IOC F;  2A3S A;  3E6D A;  4L9N A;  1YRN A;  2L9V A;  2RQQ A;  1Z9C A;  1UZC A;  4L5J A;  3L2U A;  1A04 A;  5ILU A;  5IPA A;  4CCJ A;  2CW8 A;  2MLK A;  1R23 A;  3H5R A;  1HW2 A;  3WTX C;  2VL8 A;  5J1Y A;  1BI1 A;  1Z3Y A;  3GCM A;  3HB9 A;  2HYF A;  3S1M J;  2KIQ A;  5L3G A;  1YS7 A;  2ZNZ A;  3L9F A;  1Z77 A;  3T1B A;  4B3X A;  1QU3 A;  1L0O C;  4JX5 A;  1R1T A;  2VKE A;  5CVR A;  3ROU A;  1MW7 A;  4G6T B;  2LBF B;  2P4W A;  4HNT A;  2X6Y A;  4HDV A;  1FOY A;  2IGM A;  1QVT A;  4HRI A;  4I0B A;  2L0K A;  3K4C A;  3E6B A;  4H0E A;  4B8X A;  1TWA J;  2GZW A;  4BYY A;  3VSL A;  5M5X J;  1J0R A;  1SD5 A;  1KZH A;  4EM1 A;  3GTQ J;  3LSR A;  3FXO A;  3IH3 A;  5JVG F;  3W2V A;  4V19 K;  4U87 A;  1N75 A;  1WVR A;  5F64 A;  1YQA A;  2NS8 A;  3F3X A;  2YX4 A;  4LD5 A;  4EJO A;  1T33 A;  2VON A;  2O0Y A;  2R7Q A;  2FRH A;  3IHU A;  5KAI C;  3R0A A;  3WTT C;  5J47 A;  4LB5 A;  3MKL A;  3RIR A;  2NOJ B;  1HF0 A;  4MIM A;  1VQ9 I;  2EWN A;  2L7K A;  4PGH A;  4FHT A;  1YLF A;  1IG7 A;  3SDB A;  1G4D A;  1HDD C;  4MEY F;  1QVU A;  3D5R C;  3CZ6 A;  2EIK H;  3J7Y J;  2ZJQ F;  1TQM A;  3CES A;  4M3F A;  1KQ9 A;  3W2W A;  1AOY A;  1YIT I;  3IAM 2;  3O8H A;  3FMR A;  4HEA 2;  2K4B A;  3W3C A;  4ENM A;  4IHT A;  2LNB A;  5AON A;  5DYM A;  1T39 A;  2OV7 A;  4UVB A;  2MFZ A;  3Q0W A;  4S05 A;  4J19 A;  4LOC A;  4F3Q A;  4O6J A;  1MMN A;  2E7W A;  2VQC A;  2L7M P;  3BZ6 A;  2P5L C;  4E7I A;  4BQO A;  4F7Z A;  2Z3Y A;  1BM9 A;  1OCC H;  2VN2 A;  3MZY A;  3O8G A;  3JTH A;  4V2G A;  1H0M A;  2K3P A;  4M6V A;  1ZHF A;  1YHQ I;  2ZXH A;  2W82 A;  3CJT B;  3L09 A;  4PJJ A;  3ZN0 A;  3DEU A;  4DOZ A;  2L4M A;  1NK2 P;  1HKQ A;  2VJI A;  4M9X A;  5HNH A;  1IRX A;  3WOD F;  3E7L A;  1S29 A;  1F9N A;  1ZK8 A;  2Y31 A;  2BEO A;  3F22 A;  2E1M C;  5D5V B;  2V9K A;  5EEA A;  1I6H J;  3JRF A;  4N9H A;  2LLK A;  4A3F J;  3BC8 A;  1WJE A;  3REO A;  1ZG3 A;  2Z16 A;  5HS8 A;  2CV1 A;  2PJP A;  3DBL B;  3GEZ A;  3RSN A;  3OYF A;  3BTC A;  4IHY A;  2VXD A;  1LFB A;  1LUJ B;  3QQA A;  2QSF X;  4XK4 A;  5CYV A;  3KYD B;  1KU2 A;  1VQK I;  3JW4 A;  3LSK A;  1MNM C;  3K1N A;  1U5T C;  2KPM A;  5K7F A;  2PEX A;  1JKP C;  2JVH A;  1BOB A;  5EGO A;  3BZC A;  1ZG5 A;  1LQ1 A;  1B8I B;  2K27 A;  4U7B A;  2VJJ A;  4AIH A;  2CFX A;  5DDG A;  5L3C A;  4NHJ A;  3U1D A;  4BJT A;  3HGY A;  2VE9 A;  2J5O A;  3WHB A;  4ZYH A;  2A6T A;  2AXT C;  3DTK A;  4ITV A;  3UKG A;  5EJC A;  4BAC A;  4FQG A;  3HOV J;  1WH7 A;  3ABK H;  3F8F A;  5LRR A;  2NVQ J;  1GDT A;  1OR7 C;  3HPH A;  4XMY A;  4FCY A;  1GHC A;  2ME6 A;  1SFE A;  1O7L A;  4QPO A;  1I1S A;  3SFI A;  5DCF A;  3C3W A;  2FUG 2;  1X19 A;  1FC3 A;  1S7A A;  4ETS A;  2HFH A;  5H2F C;  2QKL B;  4KMU X;  1FYL A;  5D4S A;  1X2N A;  4JBA A;  4B1R A;  3O6B B;  2Q2E A;  4PJ0 C;  4MGR A;  1JTX A;  2X1C A;  4F92 B;  3CMA I;  2X85 A;  1PVE A;  1Z7U A;  1ETY A;  3D5L A;  1P4A A;  1GXQ A;  2HTS A;  4UVC A;  3RI4 A;  3ZOB A;  2MBF A;  1XPX A;  1ZG1 A;  4LK1 F;  4YIF A;  4XID A;  3R4K A;  2BY3 A;  5L3F A;  3L2W A;  4NNJ A;  2O3F A;  3OYD A;  4C3J J;  5CVU A;  2HPM A;  1R9T J;  1KU3 A;  3KZI C;  5ICF A;  1NG7 A;  1SFX A;  1V3F A;  1IN6 A;  2KDO A;  3GFJ A;  1WFX A;  4C30 A;  1QPM A;  1X58 A;  2G9W A;  1ON1 A;  2E7X A;  4O5V A;  4ESB A;  1I39 A;  2DQR A;  2OCC H;  1E0E A;  4LJZ F;  1SMT A;  3ZPL A;  2X9D A;  3OMY A;  1E3P A;  1TP4 A;  3CLQ A;  2WY7 Q;  3P9I A;  5D5X B;  1Y1V J;  2M0C A;  2DOE A;  2F4I A;  3ZMT A;  2WAQ N;  2JRT A;  1K6Y A;  2RDP A;  2ZXJ A;  3HHH A;  2PMZ N;  2F4M B;  2LY1 A;  3E97 A;  5EG0 A;  5JR3 A;  5HVQ C;  4XRS G;  1B4A A;  5BNG A;  4MQ9 F;  3KYC B;  4ABZ A;  4S0H B;  3KFW X;  4P5O A;  5IYC J;  1YOV B;  4AC0 A;  2IA1 A;  1G2H A;  2HS5 A;  2K9M A;  2CV2 A;  5E3M A;  2QLZ A;  3KCC A;  4XNF A;  4U7D A;  1D0X A;  3CME I;  4HAM A;  4CA0 A;  3LA3 A;  4XLN F;  3S2D J;  2P6S A;  2IVM A;  1DU6 A;  3N4M A;  2M3A A;  1MBK A;  2CUF A;  2VBX A;  3KEY A;  4FE7 A;  4H4K C;  4HNV A;  2QQ8 A;  5M3M J;  1XTA A;  4EQQ A;  1U3E M;  3OYJ A;  4AID A;  5IP6 A;  3KP3 A;  4I99 C;  1JUM A;  5HLI A;  3CC4 I;  4CZZ A;  3DP7 A;  5J4V A;  3PFY A;  2DOF A;  2QCO A;  1HLV A;  1P2F A;  3JTG A;  3SJM A;  3BG6 A;  3LOC A;  4BEH A;  2O6G E;  1KON A;  3ABL H;  4AU7 A;  4ZYD A;  2GWR A;  1YYV A;  3P7N A;  1OKR A;  2LF8 A;  3HKZ N;  3JRA A;  2KZV A;  2R7U A;  2EK5 A;  2BY2 A;  2M9H A;  4J01 A;  2TCT A;  4ZYE A;  1WI3 A;  3J80 K;  2VOD A;  2HYG D;  2FD5 A;  5LRS A;  3OYI A;  4N0B A;  2M1B A;  1OYW A;  4YFN F;  4FTH A;  4IHS A;  3LL7 A;  2L7Z A;  4A3D J;  2EFW A;  4D5F A;  2B7E A;  3TP3 A;  2CUE A;  3TOA A;  4A6E A;  1IN5 A;  1G3W A;  1ZAO A;  2HZT A;  4KN7 X;  3PNY A;  1K61 A;  2KRF A;  2R7S A;  1WH5 A;  5AIP A;  1MSF C;  4XSX F;  4XRF A;  1L3L A;  4A6D A;  4G7Z F;  5IP7 J;  2JUC A;  4MTE A;  2MC4 A;  4FET A;  1SC7 A;  1W1W E;  2E2I J;  4XN0 A;  2QKM B;  2DFI A;  4B47 A;  3ZQH A;  3KET A;  1ZEL A;  4XON A;  2D1V A;  2A61 A;  1VQO I;  1TNT A;  3DFG A;  1BW5 A;  1P6R A;  1N78 A;  1QQI A;  1ZQ3 P;  3KLO A;  3GFM A;  3TOB A;  3FHZ A;  2QBY A;  4BXX J;  2QWW A;  3HIF A;  5E1X A;  3S3O A;  4WXH A;  2CU7 A;  3BTL A;  4DZJ A;  3OSF A;  3VYT B;  3OIQ A;  3RQ4 A;  1UEL B;  4LIV A;  4XKC A;  4RA2 A;  4ZTJ A;  1APL C;  5HLG A;  3ZMU A;  4CYC A;  5CPR B;  4KIC A;  3LNQ A;  3DWL E;  1BIA A;  1BIB A;  2HDD A;  3JRC A;  2DU9 A;  4XKV A;  1D1B A;  2QQ9 A;  2DDB A;  3I0T A;  4BXF A;  4LGW A;  2JA6 J;  5FKK A;  2L02 A;  2X48 A;  1LDJ A;  3KZZ A;  4GYI A;  5EGO B;  2FOW A;  2M4G A;  3QRF F;  1PP7 U;  3ZQG A;  1IW7 F;  1F1Z A;  4P9F A;  1ZKG A;  1V5F A;  2EZK A;  5DEQ A;  2QUF A;  3H3V K;  3DTI A;  2QQB A;  5F0H A;  5J6X A;  1BR1 A;  2NVT J;  2CRG A;  1IN8 A;  2VB6 A;  1SFO J;  2DBB A;  4II3 A;  4X6A J;  2O61 A;  4XLC A;  1UHW A;  2LY9 A;  1IRF A;  2Z1D A;  4GXO A;  3RDI A;  4XBF A;  2DA6 A;  2VT2 A;  2MW8 A;  2DPU A;  2Q2E B;  1FSH A;  1GXP A;  2E1C A;  4IQJ A;  2COB A;  2DOA A;  3CTA A;  2KRC A;  3A01 A;  3M3Y J;  4RAY A;  2L9R A;  2O8K A;  1D0Y A;  1YX3 A;  2AO9 A;  2DT6 A;  4M72 A;  1R5H A;  2X4H A;  3FBI B;  1BI3 A;  2JA2 A;  3ONQ A;  2DFH A;  1R5I D;  4EM2 A;  3O2P E;  1E3O C;  2IPQ X;  5B66 C;  1HOM A;  2HOE A;  4HSR A;  4IOA F;  3FIW A;  3S1R J;  3OY9 A;  4P55 A;  3L00 A;  2E34 A;  4DJA A;  1O3Q A;  3OYK A;  1HKT A;  1K78 A;  1FZP B;  4U0Y A;  1VI0 A;  1QA6 A;  2DTZ A;  2WC2 A;  5HOD A;  3CCU I;  2ZFU A;  3E5Q A;  5GP9 A;  2ZJ2 A;  3FXK A;  4R8H A;  2BXY A;  4AWX B;  2OZU A;  3J7A O;  5EG0 B;  1MDM A;  2IGN A;  3CDI A;  3ISP A;  2HWV A;  3DEW A;  5DCM A;  3BWG A;  5TGT A;  2FOK A;  1IXS B;  2A6E F;  4M6Y A;  2R7R A;  2XIG A;  5LGT A;  4QLC U;  3K69 A;  1WHU A;  3F9K A;  1SAU A;  4WWC A;  3RZD J;  4I76 A;  1IV8 A;  5FJ8 J;  2XB0 X;  4KIB A;  1W0U A;  3X2Q H;  1ETX A;  4N4O B;  2Z9O A;  5BQT A;  4IO9 F;  4BNC A;  2DCE A;  4O3M A;  3R6S A;  4I02 A;  1B9M A;  4I0A A;  1R36 A;  2L3D A;  1PJR A;  1HW5 A;  4EGZ A;  4UY8 I;  1REP C;  4N9I A;  2QEX I;  4CSW A;  4ZC3 A;  1J09 A;  2YUS A;  3K7A J;  2KJB A;  2ECB A;  3DEE A;  3IC7 A;  3F8C A;  2JN6 A;  3FWE A;  5GAH J;  4ASN A;  2JPB A;  3DTE A;  5HDK A;  5TRD A;  1FYK A;  4IHX A;  3EPZ A;  2AXL A;  3BR3 A;  2IJL A;  3ECO A;  2M8G X;  2I5U A;  4XN3 A;  1BI0 A;  1FP2 A;  3PQJ A;  5HS9 A;  4BEH B;  2H8W A;  5LHH A;  5HLT A;  1QPI A;  3E1S A;  3EET A;  3K2A A;  2Z2S B;  1HST A;  4A3B J;  2Z5U A;  3F23 A;  3GTJ J;  1HBX G;  1SEU A;  1WJF A;  4Q47 A;  3I4M J;  4IHW A;  3V7R A;  1JJ6 C;  3AG4 H;  2E5Z A;  3WG9 A;  2HVS A;  2BVL A;  3FXM A;  2FXA A;  1S5L C;  1IV6 A;  1D8J A;  3WE3 A;  3TW6 A;  1NTC A;  3SEZ A;  1XB4 A;  2M0M A;  4DNC A;  3DKX A;  4OIO F;  2MG4 A;  2W4S A;  3WGI A;  2RRE A;  4I09 A;  3M8J A;  2F5C A;  4BE2 A;  3U1K A;  3CP2 A;  3JRE A;  3GWZ A;  1DP3 A;  1B59 A;  2NVY J;  2VE8 A;  4A2U A;  1MMS A;  1XSD A;  4AYB N;  1AKH A;  1IXC A;  2V1D A;  3H5N A;  4QWQ A;  5J1U A;  1VQN I;  3S15 J;  3H3Z A;  2LTP A;  3TQN A;  3G1L A;  5J1R A;  3TO6 A;  1JHH A;  2R7V A;  1YFH A;  5ICE A;  1RIO H;  1X2M A;  1S9H A;  2QBY B;  5ERI A;  5K5O A;  1XN7 A;  4XLA A;  1P7J A;  2JSC A;  2ZXW H;  5B1B H;  2KHM A;  4XLP F;  1K79 A;  4XSZ F;  2DW4 A;  3QYB A;  4LLL A;  1K4T A;  1STZ A;  3Q0V A;  3TDZ C;  4CYC B;  3KPH A;  3FK6 A;  2XDV A;  3ESW B;  1G3T A;  3QPH A;  3WU2 C;  1BJZ A;  1Z1D A;  2FBK A;  4UXN A;  3RKY A;  2V7F A;  3GLL A;  3I3L A;  4C3I J;  5ILV A;  5FKO A;  3K70 D;  1YJW I;  3IKT A;  2VQL A;  4XKB A;  4IEJ A;  2JK3 A;  2LP0 A;  3OYH A;  4RLQ A;  4DYR A;  4ZDP A;  3SHF A;  1Y0U A;  2LF7 A;  3S16 J;  2ZO4 A;  1ONV A;  2CJJ A;  2WV1 A;  3KP2 A;  2KL4 A;  2DQL A;  5DTD A;  2CW7 A;  3QPT A;  4HLX A;  5M3F J;  2XKP A;  3BLY A;  1ETK A;  1JUP A;  1WJC A;  1XSV A;  1T98 A;  1S7O A;  3HYI A;  5FB2 A;  4WX9 A;  2GQQ A;  2VKH A;  2QEN A;  4A93 J;  4CCK A;  2ZBK A;  5GPC A;  2DMP A;  3FX3 A;  5E1W A;  4W97 A;  1LVA A;  4BKX A;  4KUM A;  1MBG A;  2CSO A;  2A07 F;  2VIX A;  3ZQF A;  3ERE D;  3HC7 A;  3I56 I;  3SYT A;  1Z6R A;  1UJ8 A;  1Y39 A;  1RR7 A;  3M4O J;  1FY7 A;  2NVU B;  3RYR A;  2ID3 A;  2QYO A;  1BJA A;  3SXY A;  2MA3 A;  4HQE A;  2HXO A;  5E1Z B;  4QIW N;  4GCV A;  5D6F A;  3DLL F;  3H0D A;  5JI6 A;  1IF1 A;  1N25 A;  1JXS A;  2K5C A;  2RAE A;  4OAZ A;  1DDN A;  4BY7 J;  3CCM I;  5BMZ A;  3AG3 H;  1O7F A;  3FHN A;  3VSK A;  5L3E A;  3SZT A;  3OYB A;  1HW1 A;  3CUO A;  1RR8 C;  2LOO A;  1K78 B;  2KIS A;  3BTJ A;  2DK5 A;  4UUT A;  2A69 F;  3LWF A;  4B3A A;  2VQG A;  1ZRE A;  1LEA A;  2IA2 A;  1JT0 A;  2DT5 A;  1MDM B;  4WK8 F;  2L01 A;  5DCM B;  2R0Q C;  1WCM J;  1Z3X A;  3OIO A;  3BQY A;  3AKZ A;  1BW6 A;  2DK8 A;  4MFD A;  2Q8K A;  4BHP A;  3TP0 A;  3BTI A;  4XLE A;  4U88 A;  3WTV C;  2HOA A;  4RS8 A;  5EF6 A;  2M7B A;  3ZRG A;  3JRB A;  4FX4 A;  3LFU A;  3JRH A;  3FMS A;  2M7A A;  2R5Y A;  2DA4 A;  3T5X A;  3BT9 A;  3NAU A;  5K5R A;  1D0Z A;  5CKT A;  1TNS A;  3M1E A;  1MJ9 A;  4PK4 A;  1RI7 A;  2IT0 A;  1X1A A;  3DPT A;  3V4G A;  2FU4 A;  1JTY A;  2EA2 A;  2R7T A;  3GTG J;  4HZF A;  1ZTR A;  1OYY A;  1YIO A;  2W25 A;  4EAT A;  3K70 C;  1YJN I;  1FJL A;  4UHT A;  3GTO J;  3KP6 A;  4WXD A;  3AAF A;  3MD2 A;  2RQP A;  3BQZ A;  3C18 A;  3H36 A;  4CO8 A;  4M71 A;  2FSW A;  4ZYG A;  1YI2 I;  3WTW C;  4BJ6 C;  3WGG A;  4JP0 A;  3WTZ A;  5KNL A;  1KU7 A;  3M1C A;  2JSP A;  3PJR A;  2JJ7 A;  2HEO A;  1VQL I;  2EIL H;  3OR2 C;  4EJT A;  3JSP A;  1GVD A;  1Y0N A;  4BXU A;  1LFP A;  1R4M B;  2V1X A;  3O3K A;  4RB2 C;  1K6O A;  3KZY A;  4BUP A;  4PDK A;  3PM1 A;  4PFP A;  3A1Y A;  3LSH A;  1U9O A;  3F0C A;  2D5V A;  1U6G A;  3ZQL A;  2K4J A;  2ZME A;  1IUY A;  2MC3 A;  2BYV E;  1O4X A;  5LEJ A;  3DF8 A;  3FXL A;  2R7F A;  2YPR A;  3K1M A;  3R0J A;  2KP6 A;  4PGG A;  3M9A A;  5FRO A;  1TC3 C;  5LBQ A;  2X6X A;  2H6C A;  1ZGA A;  3HRU A;  3A0H C;  4ZYA A;  4EVI A;  1AKH B;  3PO3 J;  3IWF A;  3WU1 B;  1Y8R B;  5F1R A;  1RNL A;  3F21 A;  3T0Y A;  5K7Z A;  2IBD A;  2KFD A;  5JHU A;  2HGC A;  3IP4 B;  2HZD A;  2HXI A;  3RZO J;  4ESJ A;  3SQN A;  3RKW A;  3CCV I;  2EFO A;  4PSW A;  4A3I J;  2F48 A;  2LH9 A;  4YG2 F;  1W7P D;  4ZZL A;  2G7H A;  4A5M A;  3E5X A;  2DXI A;  2Y48 A;  3R61 A;  2IXS A;  1DU0 A;  5C44 J;  1HC8 A;  1SVL A;  1X3U A;  3CCJ I;  3GME A;  1DPR A;  3BR5 A;  2BW3 A;  3CO6 C;  4B48 A;  4ESF A;  1GUU A;  3W6K B;  1P9Q C;  5IYB J;  4OMZ A;  4DBQ A;  2F5E A;  2XHK A;  1JGG A;  4RM2 A;  3WE2 A;  1MIJ A;  3Q0U A;  4Y17 A;  1Y1W J;  2CH0 A;  2EA4 A;  3SFZ A;  2WB1 A;  4A3J J;  4CZC A;  1LPQ A;  1UFM A;  3NWS A;  2JT1 A;  5KCM A;  2X0L A;  3BRO A;  3HXL A;  2LFB A;  2FQ3 A;  2NS0 A;  2OCE A;  4IXA A;  5L3B A;  1CQT A;  2EFP A;  1EA3 A;  2R7X A;  3GTM J;  3K6G A;  3PIO F;  2VQH A;  2XRL A;  2VPR A;  5E18 F;  4BHC A;  1GV5 A;  3GTP J;  1EJ9 A;  4CXF A;  1OCR H;  4AUX A;  2FE3 A;  5E8I A;  4BHB A;  2DLL A;  1T6S A;  2HNH A;  3Q9V A;  1LE8 A;  2ZNY A;  1D3Y A;  4NDL A;  1U8B A;  2HU9 A;  3BR1 A;  3PQK A;  5J40 A;  2XUB A;  3RPQ A;  3VDX A;  1MNE A;  1POG A;  4I2O A;  2EZH A;  2XC7 A;  4LIU A;  4MQV A;  5H6R A;  2OUM A;  3IKV A;  3ULQ B;  3LAJ A;  3RPU D;  2XF6 A;  1BOA A;  4XL9 A;  5FKM A;  1Q1V A;  3BCB A;  2KIU A;  3OS2 A;  4XLF A;  3ABU A;  3MVP A;  4CIC A;  4HDU A;  3HBL A;  1XDU A;  4TV7 A;  4IX7 A;  1T56 A;  3MFK A;  2O8X A;  5DM6 F;  4RAZ A;  3K1P A;  4RB3 C;  3E6C C;  1SD6 A;  3OWT A;  4XR6 A;  1IXR C;  1G6N A;  4KFC A;  2N8G A;  3CCL I;  2ESH A;  2DN0 A;  2EZI A;  2DJN A;  4II2 A;  4HF1 A;  3SEQ A;  2XAG A;  5F04 A;  4S04 A;  4XM3 A;  1T08 B;  2GIV A;  4KT5 C;  2Q1Z B;  5DD8 A;  4UV8 A;  2NAZ A;  4GO1 A;  5FGM A;  4B09 A;  2OF7 A;  3CO7 C;  4W1U A;  2DYR H;  1FPQ A;  2PI0 A;  4IZZ A;  5F0F A;  1ZAR A;  3G71 I;  1A6I A;  4Q5S F;  5DV5 A;  1A31 A;  2FBI A;  2Y0S N;  1ZRF A;  2ADU A;  1ACI A;  2O03 A;  3R60 A;  2MLG A;  3H92 A;  3P5J A;  2NS7 A;  5JVT A;  2K02 A;  5BPI A;  4HF2 A;  3Q5F A;  2FBH A;  4NUB A;  2CV0 A;  2O5R A;  2JWT A;  2R5Y B;  1XCV A;  4EV0 A;  2LR8 A;  3RTR A;  2XRO A;  3LSI A;  2K7L A;  2X51 A;  4ZH4 F;  4G7O F;  3OYL A;  5FRM A;  3BP8 A;  1R22 A;  3NWT A;  2OTJ I;  2XGC A;  1LJ9 A;  1UG2 A;  3ZCO A;  1P92 A;  4PJL A;  2W57 A;  4B44 A;  1IN7 A;  2EV0 A;  4MEX F;  4BL0 B;  4BQQ A;  4IRG A;  2DOD A;  2K85 A;  2M4K A;  1ORK A;  1XGN A;  3FM5 A;  2HR3 A;  3FK7 A;  2V79 A;  2V6C A;  2Y2Z A;  3K10 A;  4UB8 C;  3HHG A;  2EBI A;  4RGU A;  4A0Y A;  1K4S A;  3K4K A;  2V6E A;  1BC7 C;  4E7S A;  4RBO A;  3S1Q J;  4BAY A;  2EPF A;  1J59 A;  4D7M A;  2VUM J;  5IOZ A;  5BS6 A;  5HNF A;  3HGG A;  1ZR4 A;  4BQA A;  4GGG A;  5LHI A;  2C6Y A;  2EIM H;  1FBU A;  5J8C A;  1SFU A;  2EJR A;  2HVQ A;  3G3Z A;  2QF7 A;  3F6V A;  2ZFW A;  1F4K A;  1HQC A;  2ZME B;  2P7V B;  2M87 A;  1XGO A;  3BJ6 A;  5FFX A;  2DA7 A;  3RQI A;  2ACJ A;  1J9I A;  4DQ2 A;  2LYC A;  4CCM A;  2IS2 A;  2KIM A;  1VFC A;  1MMA A;  3F6O A;  1Y56 A;  2Z99 A;  2FML A;  1HCR A;  2WTE A;  4IQ4 A;  5EEG A;  2ZXI A;  1RZ4 A;  2LVS A;  2CQX A;  3ZQ7 A;  4EJW A;  5D8K B;  1T0F A;  4B43 A;  3KEQ A;  1QHG A;  2VOP A;  4LLN A;  1G3S A;  1S8N A;  1FX7 A;  1X1D A;  1VQ6 I;  4LFU A;  5M5Y J;  5FO5 A;  2DO7 A;  4E7H A;  2DJI A;  1SVM A;  1UMQ A;  1IJW C;  2DMU A;  5C4J J;  2V1U A;  3KX2 A;  2IEK A;  2HOS A;  1DGW Y;  3HL2 A;  1FBQ A;  1ZYR F;  2LSO A;  4AIK A;  4A3L J;  3ZMV A;  3FF5 A;  1X4O A;  2H09 A;  4EM0 B;  2GXG A;  2XAU A;  1JGS A;  3C1D A;  4OOI A;  1ZRC A;  1W7P A;  4OU0 A;  4FT8 A;  1OJL A;  3P9K A;  4ZDL A;  4ENJ A;  5DD4 A;  3IRR A;  3JRG A;  2W84 A;  2Y0M A;  2BW3 B;  1OLT A;  3LA2 A;  2LMD A;  2L54 A;  5ICG A;  3LSG A;  1FIA A;  1WWX A;  3OS1 A;  4MFE A;  5FLX K;  3WG7 H;  3LQQ A;  4P9U A;  4L0Y B;  2L9N A;  3MZH A;  4HQM A;  2ZSI B;  4J00 A;  1W5T A;  3A02 A;  3T8T A;  5IOY A;  1AHD P;  2VBW A;  3KP7 A;  2GAU A;  4G94 A;  1J2X A;  1AA7 A;  3FM3 A;  5IT9 K;  4UV9 A;  1WI9 A;  2OU2 A;  4OWR B;  1XD7 A;  2HKO A;  5DS9 A;  3ABT A;  4KIS A;  3FXR A;  1HKS A;  2HQ5 A;  1CF7 A;  2FX0 A;  2E35 A;  3KEO A;  3ZQI A;  1EKE A;  4DW6 A;  3H9G A;  4F93 B;  3S1N J;  1TQP A;  3A4C A;  2EH3 A;  4D7N A;  1LE8 B;  1FSE A;  3B6C A;  4XKW A;  1YIJ I;  4L0Z B;  1LNW A;  2HKX A;  2VAS A;  4DYC A;  2XF5 A;  2PMU A;  4BQN A;  1V5E A;  3CF5 F;  2P7C B;  4L18 B;  2DFF A;  2Y30 A;  4CCN A;  3RPU A;  2DTR A;  3OYN A;  2ELJ A;  2PN6 A;  2R7O A;  1X1P A;  3IH4 A;  5C4X J;  2CWE A;  5GAE J;  4A0X A;  2VLA A;  1G3Y A;  1R58 A;  4R1H A;  5H6Q A;  1SAX A;  1OYI A;  2CYY A;  2JRM A;  1KQ0 A;  1ETW A;  2CUJ A;  5E8G A;  4ENN A;  5EZH A;  4ZTF A;  2IGO A;  2E2J J;  2XV4 S;  1OIS A;  2M8E A;  3IH2 A;  2OTL I;  1YE9 A;  2B0L A;  2K3F A;  5K1Y A;  3IRQ A;  1U0J A;  1JHF A;  3ML6 A;  1MJA A;  1J75 A;  3G73 A;  3OL3 A;  1V4R A;  2BHZ A;  3M7G A;  5ILS A;  1S6L A;  2AQF A;  4C2M J;  3K4N A;  1MJB A;  5HLH A;  1XMK A;  3WTY C;  4LB6 B;  3JAM K;  2E1O A;  3C2B A;  4HV6 A;  5ED4 A;  2K40 A;  1HDP A;  3CF2 A;  2GIZ A;  1RRJ A;  1U78 A;  4KN4 X;  2BY1 A;  2PQ8 A;  2UXN A;  4N4N B;  3UR3 C;  1YJ9 I;  2ISY A;  1HXD A;  1UCR A;  1B72 A;  2QM3 A;  4P96 A;  3N05 A;  3AFH A;  2PFB A;  4MTD A;  4M3G A;  1R4N B;  3HOT A;  2I8D A;  3F8N A;  3EYI A;  2BBY A;  3I59 A;  1OCT C;  3QOP A;  3EYY A;  1T38 A;  4IPA A;  2V26 A;  3BY6 A;  2VT3 A;  2P81 A;  2WAQ A;  3CCE I;  5GAD J;  1IRZ A;  2KIF A;  2PMZ A;  1GV2 A;  2NRA C;  3B02 A;  2L4A A;  2GXB A;  3S3M A;  2G7U A;  2K86 A;  3PNV A;  2ZJR F;  3MQ0 A;  1LDK B;  2WA0 A;  3K4M A;  1B6A A;  3GUD A;  5JLW A;  5HOO A;  3CCQ I;  2ETH A;  2DMN A;  1OCZ H;  4RLF A;  3M8F A;  4RM3 A;  1MH4 A;  3HOW J;  4Q4Z F;  2FF4 A;  5CVI A;  3P9C A;  3QYF A;  1WGX A;  4GRI A;  2O9L A;  3I64 A;  1KU9 A;  2DAO A;  3ELK A;  1Z91 A;  3JRD A;  5LGU A;  2VPL A;  4PUS A;  3DKY A;  5LHG A;  1FLI A;  1SVO A;  2GLO A;  4UUS B;  4HST A;  1A6Q A;  3CDL A;  2KMU A;  3HSR A;  2YR2 A;  3I5U A;  4PFO A;  4U0V A;  3BR2 A;  4MO7 A;  1KQ8 A;  5EDN A;  3RCO A;  2L5Q A;  2IRF G;  1WJB A;  4EJU A;  4ANJ A;  3PO2 J;  1EH8 A;  1IZ1 A;  4DYQ A;  2PG4 A;  2BVM A;  2F6C A;  3B73 A;  2D2W A;  1O3R A;  1FTT A;  5CQE A;  2GOM A;  3RJP A;  1JKO C;  3HKZ A;  3MMY B;  3EUA A;  3TED A;  4ZZD A;  2K9Q A;  2P0W A;  1VQP I;  3HZJ A;  4RB0 A;  3MKW B;  3VYS B;  4L5E A;  2DMT A;  3GXO A;  1QGP A;  5FLX Z;  1TT5 B;  1TLH B;  2CQ7 A;  2L2O A;  3QYE A;  5CJ9 A;  2H1L A;  3H1C A;  3L2V A;  2MH2 A;  3GLX A;  4XOT A;  3UNG C;  1MBH A;  1P4W A;  3ZN1 A;  2R7Z J;  4MHG A;  2R3S A;  3MAJ A;  1TTY A;  5FLV A;  2RNG A;  1ZLJ A;  2HDW A;  4Y7N J;  3QU3 A;  5IT9 Z;  3G2B A;  2EQR A;  1EH7 A;  4EEF G;  3MN2 A;  2DYS H;  1W7P B;  2QSG X;  1XCB A;  3K4B A;  3DCF A;  4HW0 A;  1O3T A;  1R00 A;  2J5P A;  3H5A A;  3VYR B;  3HRM A;  3TO9 A;  3HOU J;  3HM5 A;  3BZK A;  4NB5 A;  1H88 C;  2EIN H;  3ZXS A;  4F52 A;  1S3J A;  4I01 A;  2DA5 A;  1TWC J;  3HRS A;  3PUF A;  5EZG A;  3VWB A;  1UHS A;  3S3N A;  6PAX A;  2IS1 A;  1N77 A;  1XMX A;  3VYU B;  3S17 J;  2M34 A;  2HQR A;  3KLN A;  1VQ7 I;  1WPK A;  4QTR A;  3L1P A;  3ZP5 A;  3HTS B;  1I6X A;  1WQ2 A;  1KA8 A;  3H9J A;  3IL2 A;  1FT9 A;  4A3E J;  2H8R A;  4OIP F;  2X1E A;  2QA4 I;  4CGZ A;  1U2W A;  5LLQ A;  4XRM A;  3LFK A;  4A3C J;  4UNO A;  3QP5 A;  3HRT A;  1W36 D;  3HUG A;  5D5W B;  2DA3 A;  2HQN A;  2XGE A;  2PMH A;  1CF7 B;  2YU3 A;  1K7A A;  2ELH A;  5L3D A;  4HF0 A;  3I55 I;  2RNJ A;  3EQL F;  5HDN A;  1KGS A;  3CUQ A;  2BGC A;  4BGD A;  5FD6 A;  3BCA A;  2UXX A;  2BXZ A;  3I58 A;  1FNN A;  2RV8 A;  3N97 A;  2ZME C;  3CD6 I;  3BG7 A;  2BZT A;  2E2H J;  3BG3 A;  1FP1 D;  2E1N A;  4R79 A;  3BG9 A;  2UWM A;  3GTK J;  3JAM Z;  2OC6 A;  2M2E A;  2QQA A;  1PDN C;  1WJD A;  2YS9 A;  2LKS A;  3H35 A;  3AL0 B;  3A0B C;  4KNY A;  2ELK A;  3KE2 A;  1X4P A;  4M3B A;  3I4P A;  1PUF A;  1QBJ A;  2LRE A;  5K5Q A;  2MD5 A;  2R7W A;  1XC5 A;  3HOZ J;  4C9Y A;  5IT3 A;  1DUX C;  1SMY F;  1JUS A;  4DBR A;  4UVA A;  3HEF A;  3CCY A;  2E5N A;  2UUZ A;  3I71 A;  2V4J C;  2MD0 A;  5F08 A;  3TW7 A;  2HOT A;  2STW A;  3K2Z A;  4B4C A;  3FXQ A;  1XG1 A;  5GTI C;  4G12 A;  3EUH A;  2LD5 A;  1MND A;  2DA2 A;  1C0W A;  1F5T A;  1RKW A;  3VOD A;  4G6Q A;  2EIJ H;  4D1Q A;  2XKO A;  1TT0 A;  2KT0 A;  4IHV A;  2MYS A;  1OCP A;  4PJM A;  4PSX A;  2ZC2 A;  3W2A A;  5ICC A;  2VI6 A;  3RYP A;  2ZCW A;  3WU0 A;  1ZRD A;  3PSF A;  1YTY A;  2VC1 A;  1B72 B;  3MKY B;  2WV0 A;  4D0P A;  3ASN H;  1SD7 A;  3K9T A;  3DV8 A;  1VQ5 I;  3OIP A;  4HOB A;  1EH6 A;  1PUE E;  4QSH A;  2G0E A;  3I59 B;  1ZGJ A;  4BY1 J;  1W0T A;  1D5Y A;  2KRH A;  3CMY A;  2R92 J;  3L7W A;  3QP6 A;  2F2E A;  1GVJ A;  5F27 A;  3WGH A;  5FKN A;  4RDU A;  3J7A Y;  3G1M A;  1MMG A;  2XAS A;  2JZY A;  3C2H A;  1GT0 C;  3JR9 A;  1A5J A;  1MBJ A;  1X1C A;  3KP4 A;  1J7K A;  1MMD A;  2IW5 A;  4M6X A;  3FKI J;  3GZN B;  1R1U A;  3OL4 A;  3FZV A;  4IF4 A;  4M3D A;  1QO0 D;  2IS4 A;  2NNN A;  1MBE A;  4HX7 A;  4WCG A;  2JQ7 A;  3COA C;  3DPL C;  3W6J B;  1W36 C;  1WRJ A;  1D1C A;  3IAS 2;  2JUG A;  1ZR2 A;  1MSE C;  4BDZ A;  4E7Z A;  5DM7 F;  3OYC A;  2JA5 J;  4AIJ A;  2OAZ A;  2PBI A;  2DT7 B;  3S8P A;  4XRS A;  1YW7 A;  4DIQ A;  4IVN A;  5B5E C;  2FNA A;  5LD2 C;  2RN7 A;  3HSF A;  4NQW A;  4BBR J;  2WBM A;  1JKR C;  3RKX A;  1R1V A;  2P8T A;  3CJQ B;  3K0L A;  4CCO A;  4BBS J;  2KDZ A;  3E0J B;  3GX4 X;  2UZK A;  3NEU A;  4HX4 A;  2D1H A;  2OBP A;  2CMP A;  2YSR A;  3FIS A;  4RGX A;  1TWF J;  1D5V A;  3FKJ A;  1VTN C;  2RVC A;  1LDD A;  2NVX J;  2ZB9 A;  1JI8 A;  3GVA A;  3M07 A;  4KIG A;  1XSX A;  3NQO A;  2EFQ A;  2B63 J;  4RB1 A;  3LA7 A;  5H20 A;  3H0G J;  2LK2 A;  1I3A A;  1MGT A;  2ICW G;  2VOO A;  2CGP A;  1WJ5 A;  5LGN A;  2ESN A;  1NK3 P;  1DQU A;  4FIS A;  2H1K A;  1BA5 A;  3LSM A;  4F55 A;  2XAQ A;  1Z0X A;  2MH9 A;  1WZ2 A;  4I7H A;  1NG6 A;  2A68 F;  2LRD A;  3GFI A;  1ZLK A;  1TW3 A;  4OIR F;  1BBY A;  1BR4 A;  3PUB A;  5E3O A;  5FLM J;  1LB2 A;  4HYE A;  4LG0 A;  2AS5 F;  1QZY A;  2NOG A;  2Q0O A;  4X1E A;  1I5Z A;  4AYB A;  3VOE A;  2YU9 J;  2DMQ A;  4E4H A;  1ETO A;  3HOX J;  4XQF A;  2JVG A;  4NC6 A;  4A12 A;  4NC8 A;  4E7K A;  2JA8 J;  3WHC A;  2HQA A;  1VQ4 I;  3K4L A;  3JRI A;  4NC7 A;  2XAJ A;  1FYM A;  1RUN A;  1ETV A;  5CQG A;  3IWZ A;  2NNY A;  1ULY A;  2HPI A;  4BU2 A;  1IN4 A;  1UST A;  4A0Z A;  3S32 A;  3HUG B;  2BY0 A;  5K7H A;  4Y13 A;  2W1O A;  2PJR A;  4IRI A;  4JOM A;  4A3K J;  1YW8 A;  3DU6 A;  5JFR A;  4BE1 A;  2XPV A;  4YFK F;  3TGN A;  4IL6 C;  1X1B A;  2KQR A;  3CUQ B;  2GA2 A;  3QWL A;  2KLO A;  4EMS A;  3TMO A;  4OMY A;  1ZN2 A;  3I53 A;  5LEK A;  4IKF A;  1IGN A;  3J7Z I;  3GO5 A;  4P1W A;  4HX8 A;  4V2F A;  2P5V A;  3S2W A;  9ANT A;  1YW9 A;  2V9P A;  1VND A;  1RET A;  1OQY A;  5HDG A;  4EGY A;  1IDY A;  1OPC A;  3OOP A;  3F8M A;  4NBQ A;  1B1B A;  3G1O A;  2F5D A;  4M9S A;  3PIP F;  3MKZ A;  1T0F C;  3M8E A;  3CLO A;  2X1D A;  1PUF B;  2W48 A;  2A5Y B;  1R7J A;  1MH3 A;  1PYV A;  2P6T A;  4C2U A;  2STT A;  1S7E A;  1T2K A;  4YRV A;  3A03 A;  3CQZ J;  4Y52 J;  4WXC A;  2LC2 A;  3ASO H;  1YRN B;  3BPX A;  2BOL A;  2CFO A;  4JQF A;  4A5N A;  3QAH A;  1G59 A;  3A2K A;  1D1A A;  3MWM A;  5GTH C;  1TZL A;  2F5F A;  2OZ6 A;  4RGR A;  4MLO A;  2QGU A;  2VXZ A;  2DDA A;  5F1J A;  1Y6I A;  1FWZ A;  4YEL A;  2EV6 A;  3LMM A;  3E6M A;  3JSO A;  4G9Y A;  1YX5 A;  3ZGK A;  2WY8 Q;  3F72 A;  2COM A;  2E36 A;  1IRG A;  1ODD A;  2K9S A;  2MSY A;  2NXN B;  3CC7 I;  3FXJ A;  2VBY A;  3S93 A;  3TBI A;  1YG2 A;  2VJ5 A;  1BN5 A;  2MGQ A;  5CVJ A;  2K9N A;  4FX0 A;  3V8K A;  1TW2 A;  1YS6 A;  4AM3 A;  2XAF A;  4KYW A;  1ZGW A;  3BDD A;  1W5S A;  2HVR A;  2W00 A;  5JHF A;  1JJ8 C;  3E3V A;  2XPU A;  1VQ8 I;  4KIT B;  1H89 C;  3NRV A;  5TJJ A;  2VKV A;  2JPC A;  1U5T A;  4HLY A;  4BE0 A;  5B3S H;  3CJN A;  3WTU C;  3GBG A;  3VFZ A;  1VF9 A;  3FXU A;  3LST A;  2FQ4 A;  1V55 H;  5KHD A;  4DGW B;  1EV7 A;  2O7O A;  2W24 A;  3JCU C;  5E20 A;  3W6V A;  2HTJ A;  2L9S A;  2ISZ A;  3U9G A;  2CO5 A;  3MEX A;  3V42 A;  2KZG A;  1B9N A;  4L9V A;  1VQM I;  2VKD A;  1O57 A;  1T8I A;  1BL0 A;  3TKY A;  1OR7 A;  2QVO A;  1TWG J;  4UUS A;  2FMY A;  1YO5 C;  4Y4R A;  5GPA A;  3BOQ A;  5CLS A;  4PCQ A;  1IC8 A;  2X6W A;  2H94 A;  1SFK A;  2UV1 A;  4GDF A;  1E17 A;  1WJA A;  5E79 C;  3OR1 C;  1O3S A;  3QPS A;  5D5U B;  4ZJZ A;  2QZ8 A;  2AHQ A;  3BG5 A;  1V5G A;  4I98 B;  4FAS D;  1TQI A;  2R5Z A;  1H8A C;  4NQW B;  3GTL J;  1WKM A;  2BE5 F;  5KVR A;  2A5W A;  3SZG A;  3AG2 H;  1DPU A;  3AL0 C;  5A2Q K;  4KMF A;  2R93 J;  1J5Y A;  1P7I A;  1Z21 A;  4UUV A;  1QNT A;  4EJV A;  2XRN A;  1LEB A;  3ECH A;  3E5U A;  4OIN F;  3QOD A;  1UAA A;  1FEX A;  2OA4 A;  4WF2 A;  2NYX A;  2QSH X;  1TWH J;  3V7C A;  3DQV C;  3HTU A;  3QPL A;  1X3Z B;  2A6H F;  2FEZ A;  2RC4 A;  2L7F P;  1R49 A;  3HPG A;  3F8B A;  2IGK A;  2WWY A;  3ZQQ A;  3OS0 A;  3CMM A;  1XS9 A;  1PP8 F;  3WTS C;  3OYM A;  2ME0 A;  4CDG A;  4KT6 A;  4FE4 A;  3B6A A;  2H6B A;  2GM4 A;  1W5C C;  3LAP A;  4HPQ A;  3QU6 A;  3DXJ F;  5D4R A;  2EZL A;  1UHM A;  1U9N A;  2CQQ A;  4HV5 A;  4M74 A;  1H9T A;  4KDP A;  1ZH5 A;  1IUF A;  1Z67 A;  2R7D A;  5TIS C;  1EF4 A;  4L9J A;  4LG0 B;  5JLX A;  3MZ8 A;  1KYW A;  2CQK A;  3ZMS A;  1QRY A;  3CDH A;  2Y9Z A;  1FOK A;  3VEP A;  2PX9 A;  2DI3 A;  3FDY A;  2XAH A;  3HOY J;  1JE8 A;  2X6O A;  4DZP A;  4XLH A;  2DA1 A;  3DPU A;  4I6Z A;  3G4S I;  2LKX A;  3L2R A;  1Z7L A;  2DPD A;  2F4O B;  2K9L A;  2H27 A;  1GLN A;  2A05 A;  3PFI A;  2PJR B;  3TO7 A;  4X0G A;  3L2Q A;  1RUO A;  3BPV A;  4IRH A;  4GFB A;  3GZ6 A;  1ERD A;  4BDY A;  4E7L A;  4ENK A;  4RGS A;  4OAY A;  1F43 A;  2CS3 A;  1SAN A;  5F0C A;  4Y33 A;  2LG4 A;  2XB5 A;  3C2G A;  3EDP A;  3OYE A;  3G6E I;  4M3E A;  3LSJ A;  4OIQ F;  2W7N A;  3TL4 X;  1R6R A;  2ZKZ A;  2V1N A;  1HA8 A;  3V8L A;  4KA4 A;  2E71 A;  2GBY A;  1R5G A;  4LK0 F;  1ITY A;  3DBH B;  1FMW A;  3QOE A;  1ETQ A;  4JK1 X;  2ID6 A;  3ZR8 X;  5EYR A;  2WAF A;  1XDS A;  1V54 H;  2D45 A;  2BV6 A;  2OJE D;  4Q48 A;  3J81 K;  2FA5 A;  1NH3 A;  2DFE A;  1IO2 A;  4UB6 C;  1K83 J;  3EUK L;  4AD9 A;  5EEH A;  1MD0 A;  1RKT A;  1RES A;  3I54 A;  2OD5 A;  2Y9Y A;  4XOP A;  4G8X A;  3U21 A;  4LMY A;  1XGS A;  4HG2 A;  3HDD A;  1A35 A;  1F36 A;  2IAI A;  2XSJ C;  4C2T A;  5C3E J;  1VZ0 A;  3H9Q A;  2VJ4 A;  1LFU P;  3GW2 A;  5KK1 A;  4GYG A;  3CCS I;  3Q9S A;  1AU7 A;  1I3Q J;  2E1M B;  4LG3 A;  3IV5 A;  2GXA A;  5BOX A;  2XF7 A;  2IA0 A;  2Y69 H;  1X3W B;  3ERM A;  3S14 J;  2YX7 A;  3BJA A;  5M5W J;  4BH9 A;  4A3G J;  2P5K A;  2LBF A;  3C7J A;  4AVP A;  1DP7 P;  3D5S C;  4LIT A;  3VB2 A;  4A3M J;  2MAB A;  2KJC A;  2RKH A;  1E2X A;  2EFN A;  1USS A;  1XGM A;  1A36 A;  3J80 Z;  1OMI A;  2AQE A;  3I9V 2;  2IP2 A;  1I1G A;  3I4N J;  2BHY A;  3T8R A;  3OYA A;  1ON2 A;  2KKO A;  1U5T B;  2VC0 A;  4HA8 A;  2F5V A;  3HJE A;  5J4Y A;  1FBS A;  1QHH D;  4E6K G;  5A2Q Z;  3ZMD A;  1JT6 A;  2JA7 J;  2FJ1 A;  3S2H J;  1Z05 A;  3CCR I;  1H9G A;  3V7S A;  5D6E A;  2Y0S A;  5IY5 H;  3LSP A;  2WAD A;  2B9S A;  2WAE A;  1OCO H;  3KP5 A;  3AG1 H;  5J8F A;  1IDZ A;  1AWC A;  5B1A H;  4C3H J;  1LKX A;  3BR6 A;  3DKW A;  4D9J A;  1FMV A;  4YIR X;  1WSU A;  3D0S A;  3CUQ C;  3NAR A;  5IYD J;  2XGD A;  3H3U A;  1SD4 A;  1W4M A;  5E3L A;  2Y75 A;  2ECC A;  2VBZ A;  3K4J A;  2R5Z B;  4LLG F;  4AVZ A;  4M9Z A;  4CCL A;  1XX5 A;  3RKQ A;  1JKQ C;  4CHU A;  2HI3 A;  2CQN A;  3GZ5 A;  2V9V A;  4CUG A;  4G7H F;  4KJZ A;  2XGX A;  1G8X A;  4MNU A;  2I10 A;  4JYK A;  1IAW A;  1KYZ A;  1BR2 A;  3KYL A;  3BR0 A;  2LY2 A;  3DBR B;  2OQR A;  2HDC A;  1XMA A;  5FRN A;  2TRT A;  1MKM A;  2EV5 A;  4L5I A;  4CH7 A;  4Y15 A;  4K2E A;  5GAG J;  1R71 A;  3PSI A;  4HNU A;  3SZP A;  1CGP A;  4Z2Y A;  2XPW A;  1RPW A;  3GF2 A;  2CW0 F;  2Z33 A;  4YEJ A;  4JX4 A;  4YII A;  3HSE A;  1UB9 A;  4JX6 A;  2OPT A;  2WB1 N;  2ZSH B;  3EUH C;  1BC8 C;  1P4X A;  1S72 I;  5FFZ A;  1NHA A;  1TBX A;  3OV8 A;  4XIC A;  2M45 A;  3HOS A;  3D1N I;  3Q3S A;  5FD5 A;  5J3L A;  5E3N A;  3ZMZ A;  4F91 B;  5FKL A;  1QZZ A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  4E7Z A;  3OYC A;  2Q2E B;  3FBN B;  4IQJ A;  1LVK A;  2DT7 B;  2DOA A;  2R4G A;  4NUB A;  1T95 A;  3S8P A;  3OOU A;  2O5R A;  2CV0 A;  4DIQ A;  2KRC A;  3CJR B;  3RTR A;  3LSI A;  5LD2 C;  2WBM A;  2X51 A;  3OYL A;  5FRM A;  1D0Y A;  1YX3 A;  3NWT A;  2DT6 A;  3HG9 A;  3CJQ B;  3DU5 A;  4CCO A;  3FBI B;  2JA2 A;  3E0J B;  5LFA A;  3ONQ A;  3ZCO A;  4PJL A;  4B44 A;  2CMP A;  4HSR A;  4BL0 B;  4BQQ A;  3FKJ A;  3OY9 A;  1JI8 A;  2M4K A;  3DLA A;  4DJA A;  3OYK A;  4BS9 A;  4Y3O A;  3K10 A;  2ZFU A;  3K4K A;  2V6E A;  4E7S A;  2IGN A;  1WJ5 A;  4XOR A;  2E60 A;  5HNF A;  5TGT A;  1DQU A;  3LSM A;  3PL8 A;  4BJ5 C;  4F55 A;  2R7R A;  1NG6 A;  2IS6 A;  2HVQ A;  3F9K A;  1SAU A;  2LRD A;  3PNT A;  1DGR M;  2GOX B;  1BR4 A;  3PUB A;  4N4O B;  2DCE A;  4PJN A;  4ZDO A;  4RMN A;  3CP8 A;  1PJR A;  1UG0 A;  4AYB A;  2LYC A;  4CCM A;  2IS2 A;  2CUZ A;  4CSW A;  4E7J A;  4ZC3 A;  1J09 A;  1MMA A;  1Y56 A;  4IQ4 A;  4E4H A;  4XQF A;  3DEE A;  2ZXI A;  2JVG A;  3IUO A;  4NC8 A;  4E7K A;  2HQA A;  3K4L A;  3OYG A;  4NC7 A;  3DTE A;  4B43 A;  1QHG A;  5CQG A;  3EPZ A;  4QPQ A;  2HPI A;  4XN3 A;  4BU2 A;  2RQQ A;  4BEH B;  1X1D A;  3S32 A;  5HLT A;  3L2U A;  3E1S A;  4E7H A;  3HUG B;  2DJI A;  2Z2S B;  2CW8 A;  2W1O A;  3H5R A;  4CCJ A;  4JOM A;  2PJR A;  3KX2 A;  2VL8 A;  3DU6 A;  1DGW Y;  1Z3Y A;  3HL2 A;  4BE1 A;  1X1B A;  1X4O A;  2KQR A;  1WJF A;  2KLO A;  3TMO A;  4B3X A;  1QU3 A;  4IKF A;  2XAU A;  4P1W A;  1MW7 A;  4G6T B;  2LBF B;  2E5Z A;  2HVS A;  2BVL A;  4HNT A;  4ZDL A;  2X6Y A;  2BW3 B;  2IGM A;  1OLT A;  4HRI A;  3K4C A;  3SEZ A;  3LSG A;  3VSL A;  2M0M A;  3DKX A;  2W4S A;  3OS1 A;  2RRE A;  3MKZ A;  1T0F C;  3M8J A;  2X1D A;  3W2V A;  4BE2 A;  3CP2 A;  4U87 A;  1DP3 A;  2L9N A;  1N75 A;  1PYV A;  2ZSI B;  4J00 A;  4C2U A;  4YRV A;  3H5N A;  2R7Q A;  2LC2 A;  1AA7 A;  2BOL A;  2CFO A;  2NOJ B;  2R7V A;  4JQF A;  4OWR B;  1G59 A;  3A2K A;  1D1A A;  4KIS A;  1TZL A;  1S9H A;  2L7K A;  4MLO A;  2VXZ A;  4XLA A;  1Y6I A;  4YEL A;  3SDB A;  3LMM A;  2KHM A;  3D5R C;  1YX5 A;  3CZ6 A;  3H9G A;  3A4C A;  3QYB A;  3ZGK A;  2WY8 Q;  4F93 B;  4XKW A;  3CES A;  3W2W A;  3IAM 2;  3S93 A;  3TBI A;  4HEA 2;  2VJ5 A;  2XDV A;  3W3C A;  2VAS A;  2XF5 A;  2HVR A;  4BQN A;  2OV7 A;  2W00 A;  2MFZ A;  2V7F A;  1V5E A;  3I3L A;  5JHF A;  3K70 D;  4F3Q A;  2VQL A;  4CCN A;  1MMN A;  2VQC A;  4XKB A;  3OYN A;  3OYH A;  4E7I A;  2ELJ A;  4RLQ A;  4KIT B;  2R7O A;  4ZDP A;  4BQO A;  2VLA A;  4BE0 A;  2K3P A;  3GBG A;  2KL4 A;  2ZXH A;  2CW7 A;  2W82 A;  4DGW B;  5KHD A;  4PJJ A;  2CUJ A;  3BLY A;  4ZTF A;  2IGO A;  4DOZ A;  1WJC A;  2L9S A;  2VJI A;  5HNH A;  1YE9 A;  3V42 A;  2VKH A;  1IRX A;  1U0J A;  2VKD A;  4CCK A;  3OL3 A;  2AQF A;  2E1M C;  3K4N A;  2V9K A;  2VIX A;  4Y4R A;  3HC7 A;  3SYT A;  3BC8 A;  1WJE A;  2X6W A;  2Z16 A;  2CV1 A;  2UV1 A;  1SFK A;  3CF2 A;  1WJA A;  3OR1 C;  3RSN A;  3OYF A;  4ZJZ A;  2VXD A;  4FAS D;  1V5G A;  4N4N B;  3UR3 C;  4NQW B;  2A5W A;  3SZG A;  3H0D A;  3N05 A;  3AFH A;  3LSK A;  3AL0 C;  2K5C A;  3HOT A;  2I8D A;  4OAZ A;  2KPM A;  1Z21 A;  2JVH A;  1BOB A;  2V26 A;  2WAQ A;  4U7B A;  3FHN A;  2VJJ A;  3VSK A;  2PMZ A;  3QOD A;  3OYB A;  1UAA A;  4BJT A;  2LOO A;  3S3M A;  3DQV C;  3PNV A;  2A6T A;  3DTK A;  1LDK B;  2WA0 A;  3K4M A;  4ITV A;  5HOO A;  4BAC A;  3HPG A;  2IGK A;  4RLF A;  2VQG A;  3ZQQ A;  4RM3 A;  3CMM A;  3OS0 A;  1OR7 C;  3HPH A;  3QYF A;  4XMY A;  3OYM A;  4GRI A;  4KT6 A;  1Z3X A;  4QPO A;  2VPL A;  4PUS A;  3DKY A;  4HPQ A;  3AKZ A;  2FUG 2;  1X19 A;  2QKL B;  4XLE A;  4HST A;  2KMU A;  2M7B A;  4PFO A;  3ZRG A;  2X1C A;  4F92 B;  3LFU A;  2X85 A;  2M7A A;  2L5Q A;  3RCO A;  1WJB A;  3D5L A;  4ANJ A;  1D0Z A;  5CKT A;  2BVM A;  4PK4 A;  2F6C A;  1X1A A;  3DPT A;  3FDY A;  3L2W A;  5CQE A;  2GOM A;  4NNJ A;  3OYD A;  2R7T A;  4EAT A;  3K70 C;  2HPM A;  3HKZ A;  3MMY B;  3EUA A;  2P0W A;  4XLH A;  1NG7 A;  2KDO A;  3DPU A;  1WFX A;  4C30 A;  3MD2 A;  3MKW B;  3VYS B;  3L2R A;  1Z7L A;  1E0E A;  2K9L A;  1GLN A;  3OMY A;  2L2O A;  3QYE A;  2WY7 Q;  4BJ6 C;  2PJR B;  5KNL A;  4X0G A;  3M1C A;  3L2Q A;  2F4I A;  2JSP A;  3L2V A;  3PJR A;  4XOT A;  3UNG C;  1ERD A;  1K6Y A;  4BDY A;  4E7L A;  3OR2 C;  2LY1 A;  2RNG A;  4OAY A;  2HDW A;  2CS3 A;  5HVQ C;  4Y33 A;  1LFP A;  2LG4 A;  3C2G A;  3G2B A;  3OYE A;  4BUP A;  2W7N A;  4PFP A;  3A1Y A;  3K4B A;  3TL4 X;  1R6R A;  4P5O A;  3LSH A;  2V1N A;  3H5A A;  3VYR B;  1HA8 A;  2K9M A;  2CV2 A;  4XNF A;  3ZXS A;  4F52 A;  1D0X A;  1FMW A;  3QOE A;  3ZR8 X;  4CA0 A;  2WAF A;  3VWB A;  3S3N A;  2IS1 A;  2KP6 A;  5FRO A;  2M3A A;  3VYU B;  1N77 A;  2X6X A;  3KEY A;  4H4K C;  4ZYA A;  3OYJ A;  3EUK L;  3H9J A;  3PFY A;  2X1E A;  3BG6 A;  4XOP A;  4BEH A;  1KON A;  4AU7 A;  3U21 A;  3IP4 B;  2HZD A;  4HG2 A;  1W36 D;  2XSJ C;  4C2T A;  2KZV A;  2R7U A;  1VZ0 A;  3H9Q A;  2VJ4 A;  4J01 A;  4PSW A;  2E1M B;  4LG3 A;  3OYI A;  2LH9 A;  4BGD A;  2XF7 A;  3BCA A;  3LL7 A;  2DXI A;  2IXS A;  2LBF A;  3BG7 A;  3D5S C;  4LIT A;  4R79 A;  2UWM A;  2MAB A;  2BW3 A;  2OC6 A;  3PNY A;  4B48 A;  2R7S A;  1WJD A;  1P9Q C;  2AQE A;  3I9V 2;  3H35 A;  3AL0 B;  4DBQ A;  3OYA A;  4RM2 A;  1X4P A;  2F5V A;  2MC4 A;  2CH0 A;  4FET A;  2WB1 A;  1QHH D;  4E6K G;  4XN0 A;  4CZC A;  2LRE A;  2QKM B;  4B47 A;  2R7W A;  4C9Y A;  3NWS A;  1ZEL A;  4XON A;  5KCM A;  4DBR A;  2Y0S A;  2WAD A;  3HXL A;  2E5N A;  2UUZ A;  2WAE A;  1N78 A;  2V4J C;  2MD0 A;  1EA3 A;  2R7X A;  3K6G A;  1LKX A;  2VQH A;  4D9J A;  1FMV A;  1MND A;  3S3O A;  3VYT B;  2HNH A;  3OIQ A;  3RQ4 A;  1UEL B;  4LIV A;  4XKC A;  4D1Q A;  4ZTJ A;  1TT0 A;  3K4J A;  2HU9 A;  3VDX A;  5CPR B;  2MYS A;  1MNE A;  4PJM A;  4AVZ A;  4CCL A;  4PSX A;  3DWL E;  3W2A A;  2XC7 A;  4LIU A;  2OUM A;  3PSF A;  4XKV A;  3RPU D;  3MKY B;  2XF6 A;  4XL9 A;  1D1B A;  3BCB A;  4BXF A;  4CUG A;  3OS2 A;  3OIP A;  4KJZ A;  1G8X A;  4XLF A;  1BR2 A;  2M4G A;  3KYL A;  2LY2 A;  4IX7 A;  5FRN A;  2KRH A;  3OWT A;  4XR6 A;  4CH7 A;  3J7A Y;  1MMG A;  1V5F A;  3C2H A;  3PSI A;  4HNU A;  1X1C A;  4II2 A;  3SEQ A;  3DTI A;  1MMD A;  4XM3 A;  4YEJ A;  1BR1 A;  3OL4 A;  2VB6 A;  2Q1Z B;  2ZSH B;  3EUH C;  2IS4 A;  4II3 A;  4IZZ A;  4XLC A;  3HOS A;  3DPL C;  1W36 C;  2Z1D A;  1D1C A;  3IAS 2;  2JUG A;  4F91 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...