4C9YA

Structural basis for the microtubule binding of the human kinetochore ska complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
SIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPINDLE AND KINETOCHORE-ASSOCIATED PROTEIN 1
publication title Structural Basis for Microtubule Recognition by the Human Kinetochore Ska Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1890 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4c9yA00
2LYCA 4CA0A 4C9YA
chains in the Genus database with same CATH superfamily
2HOSA 2JN6A 1R9TJ 5CYVA 2QSHX 3B6AA 3OYEA 2K7LA 2ISYA 1IRGA 4CYDA 2CW8A 5TGTA 3HHHA 1TW2A 2X9DA 2F48A 2QENA 5LRSA 1FP2A 1V5FA 4M72A 3HBLA 5E3OA 2Q0OA 3CQZJ 3AFHA 4XLAA 3VOEA 4WXHA 2VQGA 2Y69H 4ZZDA 1P4XA 5JFRA 3SFIA 3A2KA 1S7OA 4M3EA 4XR6A 2B9SA 1DPRA 3DPTA 1Z3XA 5K7ZA 4UY8I 3WE2A 3ZN1A 3LOCA 2OC6A 2UXNA 2WV1A 2ZNYA 3ELKA 3OV8A 3UR3C 3SEZA 3KYLA 3A0HC 1R5HA 1KGSA 3P9IA 4B4CA 1K7AA 2FA5A 5J3LA 2QF7A 5LHHA 2FBKA 2X4HA 4ZTFA 1HC8A 2G7HA 3K7AJ 1P2FA 4EQQA 2MYSA 3MZ8A 3L2CA 3GBGA 4DBRA 1OCCH 2KIMA 5GPAA 4E6KG 1TC3C 4XK4A 1I50J 2WB1N 2NS7A 5B1BH 4LG3A 3HPGA 3WTYC 1UAAA 2L3DA 2YX4A 1BI0A 4LB6B 4XN0A 1O3RA 1D1CA 2JTVA 5E1ZB 3PNYA 3I3LA 4X6AJ 2OCEA 1H89C 1B6AA 3S2HJ 3CCJI 2V4JC 4BEHB 4UUTA 2D2WA 1UCRA 2XAJA 5HS8A 3DU6A 5DTDA 4L18B 3GXOA 4I09A 2DXIA 4U88A 1LEAA 1ETXA 1LJ9A 4A69C 5J8FA 1W0TA 1WHUA 4F3QA 2V79A 2A05A 1ZN2A 3PO3J 4I98B 1X4OA 4A3GJ 3GTJJ 3CCVI 1MJBA 3H1CA 5DM7F 2M87A 2KQRA 5FGMA 3SHFA 1X1PA 4KYWA 2K40A 2MW8A 3K0LA 4HV6A 2M4KA 1QGPA 1LB2A 3W6VA 1H88C 2YX7A 4XLNF 1KYWA 1FWZA 2CW7A 4E7ZA 4M9ZA 3IKTA 2Q2EB 1S6LA 2LBFA 3ECOA 3EDPA 2LNBA 4UUSB 1P7IA 2DCEA 1R7JA 1R5ID 3OL4A 4NHJA 4L5IA 1YW8A 1YITI 4J01A 3T1BA 1SAXA 2IGNA 3WU2C 2BVMA 1OCZH 4LITA 1MW7A 3DV8A 4BUPA 4UNOA 3HOUJ 2W84A 4FX4A 3BJOA 5DUKA 2XRLA 2Z2SB 2UWMA 2DBBA 2OU2A 3QPHA 5KVRA 5CQEA 5M5XJ 3ABKH 4KIGA 2H8WA 2K3PA 5JHUA 3D5RC 2CQQA 1P4AA 4CCKA 2IS1A 4L5EA 5K1YA 4ENMA 4A2UA 4JYKA 1YJ9I 2LR8A 3ISPA 3E1SA 5LGTA 4E7IA 3TO6A 3Q5FA 2V1UA 2ZXWH 2E2IJ 2JVHA 3BZ6A 3OOUA 3EQLF 2P81A 4IJAA 3JRDA 1TL8A 5BPIA 1BOAA 3ULQB 2BZTA 3IV5A 2VLAA 4AVPA 4FISA 1Z0XA 5FB2A 3RKQA 2M45A 4L9JA 3FXQA 2NXNB 3KCCA 3PSFA 3PJRA 2MG4A 4CUGA 2N8GA 2XF7A 3BLYA 5DD4A 5GPCA 1WCMJ 1N25A 4A5NA 3L7WA 2V7FA 2TCTA 4R79A 2F5VA 4DYCA 3WODF 2XF6A 2IGKA 2VXDA 3ZMZA 3FWEA 2H1LA 4HX4A 1J7KA 3OYGA 1YOVB 2WAFA 3GVAA 1LNWA 2R93J 2HTJA 4M9SA 4S05A 3CC7I 2DYRH 2JQ7A 1U0JA 5EJCA 1XDSA 4EM1A 4RMNA 1UG0A 4GYIA 1ZH5A 5CKTA 2VJ5A 4AD9A 2R7FA 4CO8A 2K9SA 2VJIA 3ZQQA 1DP7P 4OIPF 2RQPA 2X1EA 2MD0A 1XMAA 1ZG1A 2XAHA 2LH9A 2KT0A 3AG2H 3J81Z 2FQ3A 1Y1WJ 4IHVA 1HKTA 3J7AO 2O9LA 1ZLJA 5K5OA 2YPRA 1X3ZB 4XSXF 4C2UA 3MEXA 2Y9ZA 3L2UA 2AXLA 3S8PA 1D1AA 4M71A 3AL0B 1MBKA 2KL4A 3CUQB 1MIJA 4F52A 2R5YB 4BY1J 3QP5A 2AO9A 1LFPA 2EV5A 2M4GA 2VB6A 2XB5A 3HOTA 2HI3A 2K27A 1IDZA 5IY5H 3E6BA 5AIPA 2LKPA 1WJEA 3WHCA 3TKYA 2HKXA 1TT0A 4HSRA 1AA7A 2M0CA 3H5NA 3BCAA 4RAZA 3S14J 3D0SA 1T6SA 2K4BA 4G94A 3BDDA 2DA3A 2X6OA 4L9NA 4XM3A 1U78A 4X1EA 2W48A 2MH2A 3C2GA 4NQWA 4CGZA 1TWHJ 1LKXA 3RCOA 2L0KA 2J5OA 3DP7A 1I1SA 2WA0A 2WAQN 4LIVA 2Z5UA 5ERIA 3K10A 2K9LA 4Y3OA 4HDUA 1MMAA 4KFCA 4KICA 1RNLA 4HX7A 4BACA 2XAQA 3BR0A 3LSIA 4Q47A 2NOJB 3IP4B 3ML6A 5LFAA 2HYJA 1IW7F 3FXMA 3HKZA 4M73A 1F9NA 5E3MA 1T56A 1APLC 1IGNA 5E1XA 3BG5A 1WJDA 1UHMA 2COBA 1TQMA 1Y0NA 3G3ZA 3I54A 4PCQA 3VDXA 3W6JB 4U0YA 3O2PE 4ITVA 3O8HA 1XGSA 4JX5A 4JQFA 4ENJA 5L3BA 2F5EA 2R7VA 4CXFA 2L7FP 4XONA 3PM1A 4MNUA 2W24A 3RQIA 4CDGA 1K79A 3HC7A 1PJRA 3PQJA 5LHIA 1FSEA 2DOFA 3K4KA 1VQKI 2KIQA 3TL4X 2VONA 5D5VB 4ZTJA 3GFJA 4E4HA 1CQTA 3AL0C 4E7KA 2FX0A 1W0UA 3CUQC 1USSA 3QQAA 2HR3A 2HKOA 1HOMA 3FZVA 1QHGA 1IN6A 2P5KA 3LSJA 3O6BB 1IG7A 3ABUA 1BM9A 1DGWY 1XC5A 2K3FA 1G3SA 1X2NA 5IT9K 2BOLA 3G1MA 2BW3A 2DQLA 2RREA 4P96A 3ABTA 3JRFA 2MD5A 1Z1DA 3ZXSA 4RB2C 2CV2A 2NVYJ 1ENHA 2A6TA 4A0YA 5HLHA 4PK4A 1X19A 1FOWA 1X3WB 4HF1A 2OBPA 3WHBA 3BG6A 1BJAA 3ESWB 3QWLA 4KJZA 2OV7A 4CZCA 3TMOA 1NK2P 3ASNH 3SJMA 1Y39A 3QODA 2L9VA 2DA6A 3LFUA 1FJLA 1TW3A 1YJNI 3EETA 1GV5A 2IXSA 2RVCA 5CVRA 4XBFA 4KNYA 4M6XA 2XUBA 1STZA 3HXLA 2R4GA 2JSCA 1XMXA 1J75A 2G7UA 2VJJA 1ZAOA 1KQ8A 5AIQA 1MMSA 1HLVA 1A5JA 1IO2A 1ACIA 1I3QJ 2V9VA 2W25A 4OIQF 3T5XA 1K78A 1ERDA 1Y1VJ 2K85A 5JLWA 3SZTA 1EJ9A 2ZJPF 3MKZA 3GTLJ 1IN5A 1WGXA 1T2KA 3HHGA 1RUNA 4V2FA 2M30A 4ENKA 3WE3A 1BW5A 1IV8A 3VODA 4I99C 2P6TA 3CUOA 3V8KA 3WTZA 2HVRA 2O61A 5F64A 3HOXJ 2GOMA 1JKQC 2RC4A 2PMZN 4A3BJ 3K2AA 2EFNA 2CUEA 2Y48A 5D4RA 3K1NA 3ZQIA 1R4NB 5IP6A 2PLYA 4PFOA 4Y17A 5HNFA 3WTWC 3MKYB 5EGOB 3DKXA 3MKLA 3CF2A 3DBRB 3JR9A 3OR2C 3E5QA 1X3UA 4XLHA 2CQXA 4UVCA 1G3YA 4PSWA 1MDMA 3IAS2 2A5YB 2PJRB 2PI0A 2HQAA 4P1WA 1J5YA 3QU3A 3F23A 1S72I 2L4AA 2XAUA 3ASOH 3BTIA 3W2WA 1YW7A 2YS9A 3TBIA 4OIOF 4RGXA 1OFCX 3RYRA 4FE4A 2VBYA 3WU0A 3OYAA 1O7FA 1OMIA 2QQ9A 1OR7A 3F6VA 1B9MA 1MMDA 2FU4A 2K9QA 3GEZA 4IKFA 1BI2A 2K5CA 4MQVA 2R7WA 1ETVA 2GQQA 4D5FA 2P7VB 1KA8A 4BBRJ 2CGPA 3FXLA 2FOWA 3F8MA 2VPRA 1SANA 3BR6A 3FXUA 4XLFA 2BXYA 3KX2A 5DS9A 2IBDA 1K6OA 4IEJA 2B63J 1O4XA 3QAHA 4DBQA 4F93B 2DTZA 5ICFA 9ANTA 5FKOA 4M3DA 3OY9A 2HWVA 1ZRDA 2L7KA 4A3JJ 4LMYA 3A01A 5F0CA 3LL7A 2C6YA 4EGYA 1D0ZA 3OR1C 3H92A 3QOEA 2E36A 2ZJQF 3BR3A 2XC7A 5IT9Z 3LSTA 3F21A 3BTCA 1BR1A 4KT5C 3EUKL 1WRJA 3F3XA 4BXUA 3I53A 3PIPF 1T95A 3EUHC 3JTGA 1XGMA 1SD4A 2FOKA 3OWTA 3GYHX 1A6QA 2WAEA 4RLQA 2JA7J 1MZBA 1Z6TA 3KE2A 1MMGA 3NAUA 5F0FA 3JAMZ 4XOPA 3A03A 3F8BA 4NB5A 1WJBA 1Y6IA 1JKPC 5CLSA 4X0GA 3K4MA 1TWCJ 4G9YA 3TO7A 2JPBA 3GWZA 3M07A 5FRMA 3UNGC 2VASA 4DYRA 3PFIA 2R0QC 3PUFA 3CO6C 1BR4A 4BY7J 4M6VA 3RTRA 1VQ5I 4NDLA 5LHGA 1ZYRF 1QHHD 3W6KB 5ICEA 1MNEA 2FXAA 3BR2A 4KN4X 2HOEA 1MMNA 3RPUA 3S2DJ 3C2BA 4B3AA 1HW1A 2PMZA 5GP9A 4KISA 1UELB 2CO5A 2HQ5A 1XSVA 1X1DA 2HDWA 1U8BA 1JTXA 4QPQA 5J1YA 1J9IA 2GM4A 3HGYA 2O7OA 3OYIA 3QYBA 2A3SA 1PYVA 3W3CA 1HDPA 1ZR4A 1NG6A 1DU0A 5BMZA 1LVKA 1R00A 1JGSA 1ZG3A 5LGUA 3HTUA 1XS9A 2L01A 3JRHA 4CH7A 1GUUA 4HQMA 2JZYA 5BOXA 4ENNA 1S5LC 2TRTA 4HOBA 4WXDA 1LQ1A 1OKRA 2VODA 1LUJB 4WF2A 1FLIA 3V8JA 4OINF 3KEYA 3C1DA 2CQNA 3PL8A 4L9VA 2STWA 1BOBA 5DCMA 1HDDC 1I6HJ 1FBQA 1X1AA 5EZHA 4G12A 1RKTA 5B1AH 3KEOA 2Y9YA 1OLTA 3CLOA 2IPQX 3H0GJ 3P7NA 4CCNA 3S1NJ 3BQZA 2K9MA 4GRIA 2OTJI 1X2MA 2FUG2 2VI6A 3BPXA 4ON0A 4MLOA 1Z3YA 4DJAA 4XLEA 2DFEA 2ME0A 2IS4A 3BQYA 2Q1ZB 1MSFC 3K4JA 2X51A 1E17A 2RN7A 2R7UA 2IVMA 3BP8A 4I7HA 4N0BA 3F8NA 4ZJZA 2LY2A 5FLMJ 2K86A 2CU7A 4HF2A 3CMAI 4BQAA 3VYSB 2M34A 4A3MJ 2OAZA 3HSEA 1FEXA 3IKVA 4ZYAA 2K9NA 3N05A 3OYKA 1XSXA 4OU0A 3U1KA 4Q5SF 3RKXA 2DODA 1Z6RA 2ZC2A 1QVUA 2HXOA 4UB6C 5DD8A 3VYUB 2BV6A 3VEPA 4B1RA 4WCGA 3G2BA 2L02A 2DI3A 4XRSG 1P92A 1ON1A 3HGGA 1BJZA 5EG0A 2GLOA 1XCBA 1ETWA 2X1DA 3ZMSA 5C4JJ 2QEXI 1KYZA 4NUBA 4PJMA 2HXIA 4AYBA 5FFZA 2VUMJ 1JI8A 1TWGJ 4DIQA 3CESA 4KT6A 2DMTA 2LSOA 3CP2A 4PSXA 3HB9A 4IRGA 4A3KJ 2X0LA 4BJTA 4YRVA 4Y7NJ 1UHSA 3ZQLA 3RZDJ 3RI4A 4A3DJ 2IA0A 4BQOA 4AVZA 2EFOA 2ZSHB 3WTVC 2DAOA 2VE8A 1YQAA 4ANJA 1B72A 4QIWN 2BHYA 2WY8Q 3TW6A 2R7OA 2XF5A 2QBYA 3L2VA 5DUIA 1W4MA 1MKMA 4HA8A 3T8RA 3S17J 5GAEJ 4XIDA 2CW0F 1KQ0A 5GADJ 2Y2ZA 5EEAA 1USTA 3VYRB 1SVLA 3IWFA 4LGWA 4HZFA 2F4MB 4RAFA 4LD5A 4RBOA 3IAM2 1D5VA 4I76A 2JUCA 2KJBA 3LSGA 4GYGA 1ETOA 1YG2A 3I59A 2W1OA 1Q1HA 3N4MA 1RKWA 3TP0A 3QYFA 2B7EA 2CUZA 2BHZA 4MIMA 4MGRA 2EBIA 1LE8B 3GMEA 1DP3A 2A61A 4DZJA 2QGUA 2ESNA 4CCMA 2KKOA 1VQ7I 2EZIA 2KZVA 2VE9A 5FKNA 4MFEA 1TZLA 3K4CA 5L3DA 4D5CA 2V26A 3DEWA 4DZPA 3DKYA 1JTYA 4P5OA 4RM2A 2R5ZB 1YTYA 1VNDA 5EZGA 5JLXA 2QQAA 1J59A 1TNTA 1P9QC 2PN6A 2HEOA 5H6QA 2OQRA 4A6DA 2M7AA 2E2HJ 2F4IA 2ZO4A 1FBUA 1UFMA 2K02A 3H9JA 2MABA 1Z7LA 2LBFB 3DCFA 3E97A 4IHYA 1HSJA 3BJAA 2VN2A 3BTJA 3LMMA 3G1LA 2JA6J 3CCMI 5FKMA 2EQRA 4II2A 3KFWX 3LSMA 2NVUB 4LJZF 3P9CA 3RZOJ 4KITB 4L0ZB 2XPWA 2XRNA 1A04A 1T0FA 4I0AA 2W85A 4MEXF 2HYFA 2VC1A 1BN5A 1WKMA 2KRFA 3DWLE 1O7LA 4FT8A 4M74A 3GF2A 3U2RA 1D5YA 1O57A 4PGHA 2MC4A 2QUFA 2R7XA 2L2OA 4HV5A 1R71A 2M0MA 1RPWA 2BGCA 3IH4A 2HS5A 1IN4A 3FIWA 5EEHA 2P6SA 1B4AA 5HS9A 3RJPA 4EJOA 1RIOH 2CQKA 4A3CJ 4BE2A 1P6RA 1RETA 1WVRA 2CG4A 2ESHA 2YSRA 3JSPA 4YIIA 5DV5A 4BXXJ 2AHQA 3DTKA 2LOOA 1R22A 2LY1A 2E71A 2KISA 2X6WA 1ZG5A 2J5PA 4XLPF 1JKRC 3W2VA 4RM3A 2OCCH 4A6EA 4HNVA 1VTNC 3HKZN 4D1QA 4M3BA 5HLIA 2D1VA 3S3MA 4GO1A 1ZRFA 3RKWA 4ZYEA 2W00A 3MN2A 1XG1A 3KPHA 5AONA 4QLCU 2V6CA 4IVNA 2MLKA 2P8TA 2RNGA 3HRSA 1EH8A 4OMYA 2DYSH 1T39A 3REOA 3M9AA 5E18F 3B6CA 1WJAA 1OCOH 5E79C 3I4NJ 3M7GA 2DK8A 3S1MJ 3E6DA 1PP7U 2EFPA 3HM5A 4HYEA 1D0XA 4C3JJ 4I0BA 2ZJ2A 4PJNA 1FZPB 3FBIB 1D8KA 2UZKA 2E1OA 2Q2EA 4PJJA 4YFKF 4IHWA 2A07F 2LK2A 1YIOA 2EFQA 3H35A 3PIOF 4IQJA 4UUVA 3BG3A 2LLKA 5D8LB 3ONQA 3V4GA 3CJQB 3DXJF 1L0OC 4BS9A 2WADA 1RESA 3F72A 5FROA 2EZKA 3G4SI 1WWXA 4WWCA 3NRVA 2HPMA 4Y13A 1G2HA 4KDPA 2DDBA 5DEQA 4A93J 1HQCA 4HBLA 1MGTA 1F4KA 4ZH4F 5L3GA 4ETSA 1QPMA 2DU9A 1G3WA 2LC2A 1BIBA 3KZIC 4C2TA 3VFZA 4CSWA 3VWBA 4BL0B 3I0TA 3BZKA 4NQWB 3V8LA 2E5ZA 4LIUA 5F6FA 4RS8A 5J6XA 3JTHA 3A0BC 5H2FC 4BAYA 4C3HJ 4E70A 2PG4A 4JX4A 1ON2A 2Z9OA 3GX4X 3ZMDA 4HNTA 1K6YA 1QZYA 4ZYHA 3WU1B 3GW2A 3H9GA 1DU6A 5D8KB 1YO5C 3HSRA 4LLLA 4IHXA 4EEFG 3JW4A 4EGZA 1FBSA 3K2ZA 2Z3YA 3IH3A 2DPDA 2ELHA 4LG0A 3RQ4A 2IGOA 4H4KC 2I8DA 3Q0UA 3GFIA 1MH4A 4EATA 1B9NA 3S3NA 3G1OA 1W5TA 2ZXIA 4FASD 1AU7A 1Z77A 4BE1A 4Q48A 2Q8KA 1R1TA 2GA1A 1C0WA 2M8EA 1MBHA 2DT5A 3HOSA 1JJ6C 1IC8A 3F9KA 3IHUA 2JWTA 5FFXA 3RPUD 1SC7A 1MJAA 2F4OB 2MGQA 3V7RA 2HGCA 4PUSA 2LKSA 1SEUA 3M8JA 1U5TA 3DKWA 4DQ2A 1M1EB 3KP7A 3ZRGA 5LRRA 5TISC 3M1EA 3CUQA 2Y30A 1HW5A 2BW3B 2R5YA 1JHFA 2XHKA 3AG3H 2G9WA 4BQQA 4AIKA 5IYCJ 3SYTA 2BEOA 2XPVA 4WK8F 5GTIC 2HZDA 2E35A 4KMFA 2ISZA 1KU2A 2E1MB 3WTXC 2RAEA 2ZSIB 3OSGA 1TBXA 2H6CA 2VC0A 2E1NA 4Q4ZF 2NOGA 2RQQA 2PFBA 3FHZA 2E7XA 1G4DA 4I01A 2NNYA 2BY2A 3MD2A 3C18A 3CMYA 5F27A 3KYDB 1ZTRA 5B66C 4E7HA 4N9HA 2ZJRF 4LFUA 4V19K 4CICA 1R36A 3FK7A 4HX8A 4YG2F 4BDZA 5M3MJ 2ZNZA 2VKDA 2QLZA 3F0CA 3CCSI 3H5RA 4FCYA 2GOXB 3OYJA 4N4NB 1U9NA 1ZLKA 1RZ4A 1SFUA 2EZHA 1KONA 1YE9A 2DTRA 3HJEA 5JHFA 1REPC 3H3VK 3OS0A 2RKHA 1UZCA 1GLNA 2DT7B 1V3FA 1FT9A 1I39A 1VQLI 3OYMA 5IT3A 1BL0A 2LF7A 3VSLA 1K83J 1QPIA 2DA7A 2QWWA 4PFPA 4ABZA 4AU7A 1R1VA 4IHSA 3RYPA 3PNVA 5M5YJ 3K1MA 3WG7H 5F1RA 1R5GA 3FXJA 2EA4A 4DNCA 2FE3A 5B3SH 3ZQCA 1SVMA 1T98A 3E6CC 2FEZA 5KCMA 1LFUP 4AIJA 1BW6A 1BIAA 2QCOA 1S8NA 1BI3A 2L7MP 5BS6A 3HG9A 5IYDJ 2EV0A 1GT0C 3K70D 4KIFA 4BE0A 4JK1X 4ZYDA 3H5AA 1POGA 1Y8RB 2EWNA 1QA6A 5H20A 4P9UA 2AQEA 4MTEA 3S1QJ 3FM3A 2VJ4A 1K61A 2WV0A 2ZCWA 3HUGA 3VSKA 1NHAA 2H09A 2E1MC 3DEUA 5HNHA 2KLOA 1HKSA 3COAC 3KZZA 2BY3A 3AG4H 2HZTA 4YIFA 1GHCA 2XV4S 1VFCA 2Z1DA 4BHCA 4C9YA 3HDDA 3BTLA 2CH0A 4BHBA 4EM2A 1RRJA 4E7LA 3IH2A 5E20A 1VQ4I 5J1UA 1B59A 5IYBJ 3K6GA 2VBZA 3S93A 4V2GA 2XKOA 3R4KA 4G8XA 2OQGA 1UB9A 3FISA 2GXGA 1LDDA 2EIKH 2OPTA 3A01B 3F6OA 1JT6A 1IN7A 3MMYB 1Z91A 1GVDA 2ZKZA 1LFBA 5E8GA 1HKQA 2KDZA 3PQKA 3OOPA 2UUZA 4CZZA 2ELKA 1OISA 4S0HB 3TQNA 3PSIA 2VT2A 4CYCB 4KUMA 3GTKJ 3BG9A 3BG7A 4YFXF 3EYYA 3I55I 1IJWC 2KZGA 1SFKA 4M6YA 3E3VA 3HOZJ 3RKYA 1TNSA 5K5RA 3HOVJ 2RNJA 4XSZF 2CV1A 5FLXK 4LK1F 2DFHA 1Z7UA 1KQ9A 2LVSA 3BZCA 4B43A 4XOTA 4A0ZA 2HFHA 3G71I 2LP0A 2W4SA 5J47A 2HU9A 1MBEA 3EUHA 2CUFA 2GIZA 1W7PA 4U87A 3R0JA 4BKXA 3CD6I 3ZMUA 1T38A 2W82A 5EGOA 4ZDPA 2ZFWA 1JUMA 4JOMA 2LDUA 1NTCA 2PX9A 3KYCB 5KK1A 3LSHA 5IP7J 3PUBA 1RC9A 2IGMA 3I4MJ 2ID6A 2O0YA 5LGNA 1IXSB 2X1CA 4HF0A 3MWMA 4RLFA 1YRNA 2OTLI 2NNNA 3DPLC 1IRXA 5BQTA 4BNCA 3ABMH 1XGNA 4AYBN 4JP0A 2RGVA 3V42A 1W5SA 3B02A 2BXZA 4EJWA 4WXCA 3BR5A 4HW0A 2CS3A 1QNTA 1RUOA 4FHTA 1YJWI 1IUYA 1SFEA 1ZRCA 2KIUA 5BNGA 1DQUA 2CUJA 3DLLF 3CF5F 4IZZA 2R7ZJ 5ED4A 2Y75A 3CZ6A 1CF7A 4XN3A 5D6EA 4G6TB 3SZPA 2MBFA 3FBNB 3CCQI 1TTYA 1WH7A 2DDAA 2ZMEA 1PUFA 4QTRA 3FDYA 1A6IA 5FD6A 2V9KA 2O03A 3EUAA 1B8IB 5CPRB 2KDOA 4P55A 3OS2A 1J0RA 1SD7A 2ID3A 2L4MA 1IDYA 1YHQI 1E3HA 1SMYF 2L9NA 4JBAA 4PJ0C 5FKKA 2CSOA 2MC3A 1O3QA 4IXAA 4KIBA 4PZJA 4E7SA 2DLLA 4RDUA 1GV2A 1U3EM 1F1ZA 3EPZA 3O8GA 1I3AA 3O3KA 4I02A 1F43A 4XRSA 5JVGF 4CHUA 1J2XA 1LDKB 2VQCA 1UJ8A 2X85A 2FMLA 2XGDA 4U0VA 4BHPA 3M8EA 1DPUA 1VQMI 5IPAA 2GA2A 2V6EA 1IN8A 4A12A 1D8JA 1EH6A 2BE5F 4O5VA 1FSHA 3M1CA 3NWSA 3GFMA 4NC8A 4MHGA 2EFWA 2HVQA 3TDZC 3C3WA 5CVUA 2LTPA 2XASA 1AKHB 2E19A 3SEQA 2NRAC 3MVPA 1ZR2A 2XB0X 2E34A 3TOBA 1ZKGA 3D5SC 5FLVA 2X48A 2EIMH 5C4XJ 2KHMA 4UV9A 3RSNA 4NC7A 1SAUA 2ME6A 3OYNA 3EYIA 4P9FA 1FYMA 2LMDA 4RB0A 4EJTA 4LLGF 5CVIA 5J40A 4FETA 4BJ6C 3E5XA 3CCYA 1ONVA 5DYMA 3CCUI 2FJ1A 4N4OB 2E7WA 2Y31A 3OIQA 4M3GA 1FOXA 4RGRA 5K7FA 5HLTA 2V1DA 4IQ4A 3ZQ7A 1BBYA 3OYFA 4BBSJ 4AIHA 4A3LJ 3T8TA 3I58A 3GUDA 5KHDA 1F5TA 4IRHA 1R58A 4OOIA 1ETKA 1PVEA 5FLXZ 3GZNB 4RA2A 3IL2A 3Q3SA 2BYVE 1Q1VA 1YS6A 3G73A 5E17F 1EA3A 2L9RA 3ZQGA 3CLQA 2XKPA 3Q0VA 1B72B 2FQ4A 2HDDA 1XGOA 3JRAA 2O5RA 5EYRA 3SFZA 2BY0A 4Y15A 1R23A 5CVVA 4HRIA 1VQ8I 2EJRA 1ZELA 2HPIA 2Y0MA 3KP6A 3OYDA 2FRHA 2ZB9A 1H8AC 3NEUA 2VKEA 4IRIA 3ABLH 1FIPA 4BXFA 1TT5B 3H36A 3X2QH 2KP6A 1TLHB 4XORA 3HL2A 5TJJA 5HDNA 1OCPA 4J19A 4ASNA 3QPTA 3I5UA 4Z6YA 1JUPA 4K2EA 2QQ8A 3OYHA 1OJLA 1A36A 2EK5A 3GCMA 2BBYA 1BC8C 2CFXA 4GGGA 4HLXA 1T33A 3HSFA 1HSTA 3DFGA 3MCZA 3WG9A 4RAGA 3KP2A 2OJED 4MQ9F 2HOTA 2BVLA 4E7JA 2DOEA 3FF5A 1T08B 3K1PA 3KZYA 3UKGA 3KP4A 1OCRH 3KLOA 3CMEI 1V55H 3PFYA 3HRUA 3CCEI 1SFXA 1G3TA 2CFOA 3LA2A 2EB7A 3SDBA 1FMVA 2ECBA 1KU9A 2HVSA 4OIRF 3VPRA 2DMQA 1A35A 1YLFA 3KIOA 2GAUA 3LFKA 3M3YJ 5E1WA 4D9JA 3K4LA 1RI7A 2FSWA 3LQQA 4HDVA 1SFOJ 3CDIA 2KFDA 3J7ZI 2DQRA 3A4CA 1JT0A 6PAXA 1U2WA 3K70C 4FQGA 4PDKA 4DYQA 1V5GA 1PDNC 1Y8QB 2R3SA 2VT3A 2KRHA 1UHWA 3QP6A 3I9V2 1OCTC 2JVGA 2VQHA 2O3FA 3L1PA 4DW6A 2XSJC 2VOOA 1KU3A 1JGGA 3BT9A 3HTSB 2DA4A 3ERED 3FX3A 3KLNA 1JJ8C 1DDNA 2FD5A 2DW4A 4Y4RA 5JR3A 1ETYA 2A69F 2YR2A 2M3AA 3Q9SA 2HTSA 2NVXJ 1BA5A 3TEDA 5IOYA 3QPLA 1R1UA 1MBJA 3V7CA 2IA1A 4AWXB 3LA3A 1R49A 5H6RA 2LD5A 3GTQJ 2UXXA 3IRRA 3J81K 4O3MA 4BYYA 4EM0B 5E3NA 2IW5A 3JCUC 4FTHA 1I1GA 2JRMA 1WI9A 5D4SA 2IS6A 5B5EC 3I4PA 2ZBKA 2COMA 3LA7A 2QKMB 3KP3A 3QRFF 4A3EJ 1FTZA 5KAFC 1ULYA 1LE8A 2XIGA 2GZWA 3K4BA 4ZC3A 3MAJA 5GTHC 2DO7A 3NWTA 3ZR8X 1QU3A 2Y0SN 3ROUA 3HOWJ 5HS7A 4M3FA 3RIRA 3RPQA 4AM3A 2EA2A 5HOOA 1FY7A 1X58A 1IAWA 1H9GA 3AKZA 5E3LA 2R5ZA 1VF9A 2I5UA 4NBQA 3DBHB 3DTIA 4G7HF 2GXBA 3DPUA 1WJCA 1LDJA 4IHTA 1BR2A 2BY1A 5CJ9A 1SD6A 1SVOA 3KP5A 3L2WA 5D5XB 1TWFJ 3BR1A 3DU5A 2LYCA 2OZUA 2DMUA 1XB4A 1ODDA 4BEHA 2HQNA 1FPQA 1S7EA 3GTOJ 1EH7A 1QVTA 5EEGA 3TOAA 2E2JJ 2R7TA 1JHHA 3IC7A 2FMYA 1W36D 2H27A 1T0FC 4OAZA 1PUEE 4UVBA 3Q0WA 2ETHA 1HXDA 2IJLA 3LWFA 1JE8A 4HEA2 1T8IA 4G6QA 5D6FA 2ECCA 3TDUC 1I27A 2F5FA 4NNJA 5JI6A 3JREA 2R7QA 3ERMA 4LLNA 1IRFA 3ECHA 3FMSA 3F8CA 1XSDA 2NAZA 4IPAA 5ILSA 4YEJA 1Y0UA 5J4VA 4WX9A 1WH5A 4BQNA 3S3OA 4UUSA 2CJJA 1OYWA 3ZQHA 4Y52J 5M3FJ 2L7ZA 1E0EA 3LSPA 3K4NA 3JRCA 4A3IJ 3U21A 2F5DA 2DOAA 1FOKA 2R92J 5HLGA 3HRMA 3SDGA 1S29A 1AHDP 3GLXA 3S16J 2VOPA 1DGRM 2QSGX 2OA4A 2JJ7A 2M8GX 2DJIA 1EV7A 2ADUA 4AC0A 2P4WA 2WC2A 2G0EA 4ZYGA 5F1JA 1ETQA 1QQIA 4B8XA 4QWQA 4GDFA 4CCLA 3AAFA 2RDPA 5F04A 1FYKA 2I10A 2NYXA 4F92B 1PP8F 3OIPA 3QPSA 1QRYA 1W7PD 4LG0B 2M1BA 4EVIA 2KPMA 4RGSA 5IOZA 2O6GE 1VQNI 3GZ6A 1AWCA 3AG1H 5L3EA 3P9KA 2IRFG 1ZGJA 1MJ9A 2W57A 3H3UA 3NARA 2H1KA 1VQ9I 1GVJA 3K9TA 2Z99A 4NC6A 4IOAF 3GTGJ 2WB1A 2WY7Q 3DQVC 3GTPJ 1G8XA 1U9OA 1YYVA 2AXTC 4KMUX 2CQ7A 1XTAA 5D5WB 3KETA 3OIOA 2FBIA 4XL9A 2K4JA 1YW9A 4C30A 2JSPA 2NVTJ 4FE7A 4GCVA 3ZP5A 4MFDA 1FNNA 1E3PA 4HG2A 2DMPA 4PGGA 5EF6A 5DM6F 1U5TB 2EINH 3SZGA 2E5NA 1XPXA 1JUSA 2STTA 2A6HF 2GIVA 5HODA 2VKHA 1TQIA 2MA3A 1VZ0A 2P5LC 1YX5A 4ZZLA 2Y0SA 5A2QK 5D5UB 1MNDA 3RDIA 4EMSA 3CC4I 4U7DA 3ZCOA 1ZHFA 2XGEA 3FMQA 2YU3A 3DEEA 5L3FA 5TRDA 2WTEA 2B0LA 4B47A 3HIFA 2DA5A 1WPKA 2VKVA 4CCJA 4XMYA 3BC8A 3L09A 2W7NA 1B1BA 3HRTA 1XD7A 2IEKA 2HQRA 3FM5A 2DN0A 3TW7A 3LAPA 4XICA 2O8KA 2AS5F 4GXOA 2CWEA 1IXRC 2V1NA 2A6EF 4MEYF 3V7SA 4EV0A 2O8XA 1IV6A 1N78A 1S7AA 1ITYA 4H0EA 4D7MA 2FF4A 1NG7A 3S2WA 1V54H 5C3EJ 3FXKA 2JRTA 3P5JA 3FXRA 3R6SA 1VQPI 5HDKA 3LAJA 4Z2YA 3L2QA 3T0YA 5M5WJ 3IRQA 3WTUC 1KU7A 3R61A 2FNAA 5J4YA 1MBGA 1V4RA 1Z05A 4XKVA 5KNLA 3K69A 4XNFA 4DGWB 3C7JA 5LBQA 2DMNA 3OL3A 4KN7X 1A31A 4EJUA 3S32A 1IF1A 2D45A 3JRBA 1WI3A 5F08A 4CA0A 2V1XA 1W1WE 1FYLA 2QA4I 1XCVA 1OYIA 3CMMA 2VBXA 3BJ6A 2L9SA 2ZXHA 2F5CA 2DA1A 4MTDA 3I56I 3U9GA 4JX6A 2GBYA 3L2RA 4S04A 5LLQA 1H9TA 2QSFX 3CCLI 3SXYA 5GAGJ 3WGIA 2YU9J 2P7CB 4U0WA 5LEJA 2M5WA 1P4WA 3GO5A 3E5UA 4W97A 3WTTC 3L00A 2LRDA 3FKJA 2XAFA 1U5TC 4L9TA 5FO5A 1K78B 2IT0A 2JA5J 2YUSA 2QZ8A 2FBHA 1YX3A 2WWYA 2XDVA 2QVOA 3U1DA 3E6MA 1EF4A 1WSUA 2XGCA 4B48A 1VI0A 4RB3C 2XAGA 5FKLA 5J1RA 4UB8C 3CDLA 4G7ZF 2CRGA 5LEKA 2EV6A 3F8FA 5E8IA 4G7OF 4I6ZA 1ORKA 1EKEA 3HUGB 4F7ZA 2XSDC 2ACJA 4ESBA 5IP9J 2EIJH 3ZN0A 3DLAA 2QYOA 2DJNA 3CJTB 4II3A 2DFIA 4UV8A 2LF8A 2HOAA 2HNHA 1QBJA 1Y56A 2GWRA 5CVJA 2VPLA 3FHNA 3J7AY 2KMUA 4HSTA 4BJ5C 3OMYA 3JAMK 4IL6C 1ZARA 2P0WA 2MLGA 3MZYA 3I64A 1MDMB 2X6XA 1R6RA 3N97A 3E7LA 3E0JB 3PO2J 5BPDA 3R60A 4HAMA 4HPQA 1U8RA 4ESFA 3G6EI 3CJRB 5ILVA 1J09A 1Z67A 2P5VA 2VXZA 4GFBA 1VQOI 4C2MJ 4F91B 1YFHA 1D1BA 4KA4A 4PJLA 5HVQC 3D1NI 1QO0D 2QM3A 1BI1A 4AUXA 3HYIA 3DTEA 3HEFA 2X6YA 1LPQA 5A2QZ 2AQFA 1FX7A 4R8HA 3GTMJ 1E3OC 1HCRA 4U7BA 3FK6A 5ICGA 4A0XA 3SQNA 2HDCA 1JKOC 1MSEC 4EJVA 1IXCA 4N9IA 1X1CA 2R7DA 3KEQA 4XQFA 1X4PA 3CJNA 5J8CA 3F22A 1X1BA 1W7PB 2CMPA 2D5VA 5K7HA 1UG2A 1GXPA 3R0AA 1R4MB 2OD5A 4I2OA 1SD5A 2LG4A 3J7YJ 4LOCA 3LSKA 1SMTA 2WAQA 2LKXA 4HLYA 4BU2A 3LQRA 1H0MA 2VIXA 1Z21A 4MO7A 2VQLA 1QZZA 1YIJI 1ZREA 4C3IJ 2EILH 2E60A 4F55A 3FKIJ 1OPCA 2JMWA 2JA2A 1YRNB 1GXQA 3M8FA 3IUOA 2Z33A 1IRZA 2R7SA 1TWAJ 4R1HA 1WZ2A 3WGHA 1FTTA 1W36C 3MQ0A 1DUXC 2GXAA 3S1RJ 2M9HA 2M2EA 1XDUA 5EDNA 1N75A 2H94A 2V9PA 4HQEA 4O6JA 1I5ZA 4IF4A 1F36A 3HPHA 3OYLA 2XVCA 1AOYA 2L5QA 1ZK8A 5FD5A 3LNQA 1S9HA 2F2EA 1OQYA 2XGXA 3VYTB 1CF7B 3ZMTA 3BCBA 3BWGA 3ZMVA 1G6NA 3QOPA 1RR7A 1KZHA 4B44A 1TQPA 2ZMEB 3MKWB 1PUFB 2PJRA 3CDHA 4XRMA 2Z16A 1IUFA 2RV8A 1S3JA 2EZLA 1XN7A 2PMUA 3TGNA 3W2AA 1HA8A 1OR7C 2IS2A 4OWRB 3S15J 1WJ5A 2LREA 1WJFA 2OF7A 3H9QA 2HYGD 3J80K 1TP4A 2XROA 1CGPA 2DFFA 3D5LA 2OZ6A 3JSOA 2LFBA 3CCRI 1FP1D 2NS8A 4CYCA 5KAIC 4XKCA 3MFKA 5ICCA 3B73A 2H8RA 2WBMA 2MH9A 4UXNA 4LB5A 4ESJA 5ILUA 3Q9VA 2H6BA 4CCOA 3BY6A 4B3XA 3FMRA 4XKWA 4D0PA 4QPOA 2CV0A 1QZEA 3PNTA 3GLLA 3CP8A 1YS7A 3OSFA 5K5QA 1HBXG 4A3FJ 2EPFA 3ZPLA 4ZDOA 2DT6A 1JXSA 5F0HA 4OAYA 1RR8C 4TV7A 2F6CA 3WGGA 2QQBA 2VL8A 4L5JA 3M4OJ 3H3ZA 3QU6A 4XKBA 2NS0A 3OYCA 4AIDA 4YIRX 2ZFUA 1L3LA 3JRGA 2IAIA 5DCMB 2PMHA 1D3YA 4ZDLA 2E1CA 4UHTA 1XMKA 4BH9A 2ICWG 1O3SA 1E2XA 3QYEA 1NH3A 3BPVA 4IO9F 3H0DA 1ZGWA 2XPUA 3TP3A 4XLCA 1MBFA 1WQ2A 4L0YB 1W5CC 1V5EA 1UMQA 3I71A 4BDYA 3IWZA 2NVQJ 4Y33A 1OYYA 1XX5A 2KRCA 2PQ8A 4IOCF 2MFZA 3DF8A 5DDGA 3HOYJ 1ZQ3P 3FXOA 5DCFA 2M7BA 3C2HA 3ZOBA 2ZMEC 4QSHA 4RGUA 1N77A 3ZGKA 4IX7A 5FJ8J 2KIFA 5HDGA 3VB2A 2R7RA 1HF0A 2PJPA 2JUGA 2JPCA 1MH3A 3A1YA 5EG0B 3BROA 2A5WA 1D0YA 2TDXA 2FNPA 1B8IA 2DPUA 2IP2A 1LVAA 3WTSC 3L9FA 5GAHJ 3CTAA 2JA8J 1FC3A 2L54A 5LD2C 2JT1A 1Z9CA 1P7JA 1U6GA 4RB1A 4UVAA 4A5MA 4DOZA 4RAYA 5L3CA 3ZQFA 3DBLB 1FOYA 2MSYA 1LEBA 2QKLB 3OYBA 1K4TA 1IZ1A 4BGDA 3CO7C 2PEXA 3BOQA 2QBYB 1BC7C 1MD0A 2PBIA 2KJCA 1VQ6I 2D1HA 4HNUA 1FMWA 4M9XA 1WFXA 1YI2I 3HZJA 4J00A 1MNMC 1I6XA 2JK3A 2LY9A 3A02A 3GFLA 1O3TA 1AKHA 1GDTA 2DK5A 5CQGA 2EH3A 2OUMA 1HW2A 3I59B 4G6DA 2UV1A 3GZ5A 4YELA 2ZXJA 1K4SA 1G59A 1FIAA 4FX0A 5FRNA 1NK3P 2ELJA 4D7NA 2VBWA 4LK0F 3CC2I 3NQOA 2CYYA 3J80Z 3MZHA 5JVTA 5C44J 4OMZA 3JRIA 4YFNF 2IA2A 2A68F 2DA2A 4W1UA 1ZGAA 3TO9A 4B09A 3OS1A 4XRFA 3LSRA
chains in the Genus database with same CATH topology
1T95A 4BQNA 3S3OA 4BDZA 3EUHC 2VKDA 3OYEA 1E0EA 3OWTA 3K4NA 3U21A 3H5RA 2CW8A 2DOAA 2GOXB 5TGTA 3OYJA 2WAEA 4N4NB 4RLQA 1DGRM 1MMGA 1KONA 1YE9A 5JHFA 4XOPA 3OS0A 1V5FA 1WJBA 1Y6IA 2DJIA 1GLNA 2DT7B 3AFHA 4XLAA 3K4MA 4X0GA 2VQGA 3A2KA 3OYMA 5FRMA 4CCLA 4XR6A 3UNGC 2VASA 3DPTA 1Z3XA 3VSLA 1BR4A 2OC6A 4PFPA 4F92B 3RTRA 3OIPA 4AU7A 3PNVA 1QHHD 2KPMA 3UR3C 1MNEA 3SEZA 3KYLA 1MMNA 5KCMA 4ZTFA 2WB1A 2WY7Q 3DQVC 2PMZA 3HG9A 2MYSA 1G8XA 1UELB 4KISA 3GBGA 4DBRA 3K70D 4BE0A 1X1DA 2HDWA 4XL9A 4C30A 3H5AA 4E6KG 4QPQA 2JSPA 2AQEA 4LG3A 3HPGA 1UAAA 4HG2A 3OYIA 3QYBA 2VJ4A 4XN0A 3SZGA 1D1CA 3VSKA 1PYVA 2E5NA 3W3CA 2E1MC 1NG6A 3PNYA 2VKHA 5HNHA 1VZ0A 3I3LA 1LVKA 1YX5A 2KLOA 2Y0SA 2V4JC 4BEHB 1MNDA 3ZCOA 2Z1DA 4C9YA 3DEEA 3DU6A 4CH7A 2CH0A 2DXIA 4E7LA 4B47A 3K6GA 3S93A 4F3QA 3KEYA 4CCJA 3PL8A 1BOBA 1X4OA 3BC8A 4XMYA 2W7NA 1X1AA 3MMYB 2KQRA 1OLTA 4CCNA 2UUZA 2V1NA 2K9MA 4GRIA 1N78A 2FUG2 3PSIA 2M4KA 4MLOA 1Z3YA 1NG7A 4XLEA 4DJAA 2IS4A 3BG7A 2Q1ZB 3K4JA 2X51A 2CW7A 2R7UA 4E7ZA 1SFKA 2Q2EB 4ZJZA 2LBFA 2LY2A 3L2QA 2CV1A 2DCEA 3VYSB 3OL4A 4J01A 4B43A 4XOTA 2IGNA 4XKVA 4ZYAA 5KNLA 4XNFA 4DGWB 2BVMA 2W4SA 3N05A 3OL3A 4LITA 2HU9A 3OYKA 1MW7A 3S32A 4BUPA 4CA0A 3VYUB 2Z2SB 3CMMA 2UWMA 4U87A 3G2BA 5CQEA 2L9SA 2W82A 2ZXHA 2K3PA 4ZDPA 3D5RC 2IS1A 4CCKA 2X1DA 4JOMA 3L2RA 3LSHA 3E1SA 3PUBA 4NUBA 2IGMA 4E7IA 4PJMA 4AYBA 2JVHA 1JI8A 3OOUA 2X1CA 4DIQA 3CESA 4KT6A 4RLFA 3CP2A 4PSXA 2LRDA 3FKJA 3DPLC 2VLAA 1IRXA 4BJTA 4YRVA 4BQOA 3V42A 4AVZA 1YX3A 2ZSHB 4ANJA 2XDVA 2WY8Q 2R7OA 2XF5A 4B48A 3L2VA 2CS3A 3PSFA 3PJRA 4CUGA 3BLYA 2XF7A 2V7FA 4R79A 2F5VA 3VYRB 2XF6A 2IGKA 2VXDA 1DQUA 2CUJA 3OYGA 4IZZA 3HUGB 3CZ6A 2WAFA 3IAM2 4XN3A 4G6TB 3DLAA 3LSGA 4II3A 3FBNB 2HNHA 2W1OA 1Y56A 3FDYA 3QYFA 2VPLA 3FHNA 2CUZA 2KMUA 3J7AY 1U0JA 2V9KA 4HSTA 3OMYA 4BJ5C 3EUAA 4RMNA 1UG0A 5CPRB 2KDOA 3OS2A 1DP3A 5CKTA 2VJ5A 2P0WA 2VJIA 2L9NA 3ZQQA 4CCMA 2X6XA 2KZVA 1R6RA 2X1EA 4E7SA 2MD0A 3E0JB 1TZLA 4HPQA 3K4CA 3EPZA 2LH9A 2V26A 3DKYA 4P5OA 3CJRB 4RM2A 1LDKB 2VQCA 2X85A 1J09A 2VXZA 1P9QC 4F91B 2V6EA 4C2UA 1D1BA 4PJLA 5HVQC 3L2UA 3M1CA 2M7AA 3NWSA 4NC8A 1D1AA 2F4IA 3S8PA 3AL0B 2KL4A 3DTEA 2HVQA 2X6YA 4F52A 3H9JA 2AQFA 2MABA 1Z7LA 1LFPA 2LBFB 2M4GA 3LMMA 2VB6A 3HOTA 4U7BA 3SEQA 4II2A 3LSMA 1X1CA 1WJEA 3D5SC 2KHMA 4XQFA 1X4PA 3RSNA 4NC7A 1SAUA 1TT0A 4KITB 3OYNA 4HSRA 1AA7A 1X1BA 2CMPA 4BJ6C 4FETA 3DWLE 3H5NA 3BCAA 2LG4A 4N4OB 3LSKA 3OIQA 2WAQA 5HLTA 4IQ4A 4BU2A 4XM3A 3OYFA 2VIXA 1Z21A 2MC4A 2VQLA 2R7XA 2L2OA 5KHDA 2M0MA 3C2GA 2E60A 4F55A 1LKXA 3RCOA 2JA2A 2WA0A 4LIVA 3IUOA 3K10A 2K9LA 2R7SA 4Y3OA 1MMAA 1W36C 4BACA 4BE2A 1EA3A 3LSIA 1N75A 2NOJB 3IP4B 5LFAA 3HPHA 3OYLA 2O5RA 3DTKA 3HKZA 2LOOA 2LY1A 2L5QA 2X6WA 4HRIA 1ZELA 1WJDA 3W2VA 1S9HA 2HPIA 4RM3A 3OYDA 3VDXA 3VYTB 3BCBA 4ITVA 4D1QA 4BXFA 2KP6A 4JQFA 3S3MA 4XORA 4B44A 3MKWB 2PJRA 2R7VA 3HL2A 2W00A 4XONA 2Z16A 3HC7A 1PJRA 2RNGA 3W2AA 1HA8A 1OR7C 3K4KA 2IS2A 3OYHA 4OWRB 3TL4X 2LREA 1WJ5A 4ZTJA 1WJFA 4E4HA 1WJAA 3AL0C 3H9QA 4E7KA 3D5LA 1QHGA 4XKCA 1DGWY 2BVLA 4E7JA 1D0XA 2BOLA 2WBMA 4PJNA 2BW3A 3FBIB 2RREA 4PJJA 3PFYA 3ZXSA 4CCOA 2CV2A 2CFOA 4B3XA 4XKWA 3H35A 4IQJA 2A6TA 3SDBA 1FMVA 4QPOA 2CV0A 3PNTA 4PK4A 1X19A 3CP8A 2HVSA 3ONQA 4ZDOA 3CJQB 2DT6A 4BS9A 2WADA 4OAYA 3BG6A 5FROA 2F6CA 4KJZA 2VL8A 2OV7A 4CZCA 3TMOA 4D9JA 4XKBA 2HPMA 3K4LA 3QODA 3OYCA 2ZFUA 3LFUA 3A4CA 3K70C 2IXSA 1V5GA 4ZDLA 2KRHA 3HXLA 2R4GA 2VJJA 3I9V2 2JVGA 2VQHA 2LC2A 2XSJC 3QYEA 4C2TA 3H0DA 4CSWA 3VWBA 4XLCA 4BL0B 1ERDA 4Y4RA 4NQWB 2E5ZA 4LIUA 2M3AA 1V5EA 3MKZA 4BDYA 4Y33A 2KRCA 4HNTA 1K6YA 2MFZA 3H9GA 2HVRA 2GOMA 2M7BA 3C2HA 1N77A 3ZGKA 4IX7A 2IS6A 2R7RA 3RQ4A 4PFOA 5HNFA 2JUGA 2IGOA 3MKYB 3DKXA 3A1YA 2I8DA 4H4KC 2QKMB 4EATA 3CF2A 2A5WA 3S3NA 1D0YA 3OR2C 2ZXIA 4FASD 4XLHA 4BE1A 3K4BA 4ZC3A 4PSWA 2PJRB 3IAS2 3NWTA 3ZR8X 1QU3A 2HQAA 3HOSA 5LD2C 4P1WA 2XAUA 3F9KA 3W2WA 5HOOA 3TBIA 4DOZA 3RPUD 3AKZA 2QKLB 3OYBA 4BGDA 3OYAA 3DTIA 4PUSA 3DPUA 1WJCA 3M8JA 1BR2A 1MMDA 3L2WA 4IKFA 3ZRGA 2K5CA 2R7WA 4HNUA 3DU5A 1FMWA 2BW3B 2LYCA 1WFXA 4BEHA 4BQQA 4J00A 2R7TA 3SYTA 5CQGA 1W36D 4XLFA 1T0FC 4OAZA 2OUMA 2HZDA 3KX2A 2UV1A 4DBQA 4YELA 4F93B 1G59A 2E1MB 5FRNA 2ZSIB 3OY9A 2ELJA 4HEA2 2L7KA 3LL7A 1D0ZA 3OR1C 2RQQA 4NNJA 3QOEA 2R7QA 2XC7A 3MD2A 1BR1A 3OS1A 4YEJA 4E7HA 3EUKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYC A;  4CA0 A;  4C9Y A; 
#chains in the Genus database with same CATH topology
 2HOS A;  2JN6 A;  1R9T J;  5CYV A;  2QSH X;  3B6A A;  3OYE A;  2K7L A;  2ISY A;  1IRG A;  4CYD A;  2CW8 A;  5TGT A;  3HHH A;  1TW2 A;  2X9D A;  2F48 A;  2QEN A;  5LRS A;  1FP2 A;  1V5F A;  4M72 A;  3HBL A;  5E3O A;  2Q0O A;  3CQZ J;  3AFH A;  4XLA A;  3VOE A;  4WXH A;  2VQG A;  2Y69 H;  4ZZD A;  1P4X A;  5JFR A;  3SFI A;  3A2K A;  1S7O A;  4M3E A;  4XR6 A;  2B9S A;  1DPR A;  3DPT A;  1Z3X A;  5K7Z A;  4UY8 I;  3WE2 A;  3ZN1 A;  3LOC A;  2OC6 A;  2UXN A;  2WV1 A;  2ZNY A;  3ELK A;  3OV8 A;  3UR3 C;  3SEZ A;  3KYL A;  3A0H C;  1R5H A;  1KGS A;  3P9I A;  4B4C A;  1K7A A;  2FA5 A;  5J3L A;  2QF7 A;  5LHH A;  2FBK A;  2X4H A;  4ZTF A;  1HC8 A;  2G7H A;  3K7A J;  1P2F A;  4EQQ A;  2MYS A;  3MZ8 A;  3L2C A;  3GBG A;  4DBR A;  1OCC H;  2KIM A;  5GPA A;  4E6K G;  1TC3 C;  4XK4 A;  1I50 J;  2WB1 N;  2NS7 A;  5B1B H;  4LG3 A;  3HPG A;  3WTY C;  1UAA A;  2L3D A;  2YX4 A;  1BI0 A;  4LB6 B;  4XN0 A;  1O3R A;  1D1C A;  2JTV A;  5E1Z B;  3PNY A;  3I3L A;  4X6A J;  2OCE A;  1H89 C;  1B6A A;  3S2H J;  3CCJ I;  2V4J C;  4BEH B;  4UUT A;  2D2W A;  1UCR A;  2XAJ A;  5HS8 A;  3DU6 A;  5DTD A;  4L18 B;  3GXO A;  4I09 A;  2DXI A;  4U88 A;  1LEA A;  1ETX A;  1LJ9 A;  4A69 C;  5J8F A;  1W0T A;  1WHU A;  4F3Q A;  2V79 A;  2A05 A;  1ZN2 A;  3PO3 J;  4I98 B;  1X4O A;  4A3G J;  3GTJ J;  3CCV I;  1MJB A;  3H1C A;  5DM7 F;  2M87 A;  2KQR A;  5FGM A;  3SHF A;  1X1P A;  4KYW A;  2K40 A;  2MW8 A;  3K0L A;  4HV6 A;  2M4K A;  1QGP A;  1LB2 A;  3W6V A;  1H88 C;  2YX7 A;  4XLN F;  1KYW A;  1FWZ A;  2CW7 A;  4E7Z A;  4M9Z A;  3IKT A;  2Q2E B;  1S6L A;  2LBF A;  3ECO A;  3EDP A;  2LNB A;  4UUS B;  1P7I A;  2DCE A;  1R7J A;  1R5I D;  3OL4 A;  4NHJ A;  4L5I A;  1YW8 A;  1YIT I;  4J01 A;  3T1B A;  1SAX A;  2IGN A;  3WU2 C;  2BVM A;  1OCZ H;  4LIT A;  1MW7 A;  3DV8 A;  4BUP A;  4UNO A;  3HOU J;  2W84 A;  4FX4 A;  3BJO A;  5DUK A;  2XRL A;  2Z2S B;  2UWM A;  2DBB A;  2OU2 A;  3QPH A;  5KVR A;  5CQE A;  5M5X J;  3ABK H;  4KIG A;  2H8W A;  2K3P A;  5JHU A;  3D5R C;  2CQQ A;  1P4A A;  4CCK A;  2IS1 A;  4L5E A;  5K1Y A;  4ENM A;  4A2U A;  4JYK A;  1YJ9 I;  2LR8 A;  3ISP A;  3E1S A;  5LGT A;  4E7I A;  3TO6 A;  3Q5F A;  2V1U A;  2ZXW H;  2E2I J;  2JVH A;  3BZ6 A;  3OOU A;  3EQL F;  2P81 A;  4IJA A;  3JRD A;  1TL8 A;  5BPI A;  1BOA A;  3ULQ B;  2BZT A;  3IV5 A;  2VLA A;  4AVP A;  4FIS A;  1Z0X A;  5FB2 A;  3RKQ A;  2M45 A;  4L9J A;  3FXQ A;  2NXN B;  3KCC A;  3PSF A;  3PJR A;  2MG4 A;  4CUG A;  2N8G A;  2XF7 A;  3BLY A;  5DD4 A;  5GPC A;  1WCM J;  1N25 A;  4A5N A;  3L7W A;  2V7F A;  2TCT A;  4R79 A;  2F5V A;  4DYC A;  3WOD F;  2XF6 A;  2IGK A;  2VXD A;  3ZMZ A;  3FWE A;  2H1L A;  4HX4 A;  1J7K A;  3OYG A;  1YOV B;  2WAF A;  3GVA A;  1LNW A;  2R93 J;  2HTJ A;  4M9S A;  4S05 A;  3CC7 I;  2DYR H;  2JQ7 A;  1U0J A;  5EJC A;  1XDS A;  4EM1 A;  4RMN A;  1UG0 A;  4GYI A;  1ZH5 A;  5CKT A;  2VJ5 A;  4AD9 A;  2R7F A;  4CO8 A;  2K9S A;  2VJI A;  3ZQQ A;  1DP7 P;  4OIP F;  2RQP A;  2X1E A;  2MD0 A;  1XMA A;  1ZG1 A;  2XAH A;  2LH9 A;  2KT0 A;  3AG2 H;  3J81 Z;  2FQ3 A;  1Y1W J;  4IHV A;  1HKT A;  3J7A O;  2O9L A;  1ZLJ A;  5K5O A;  2YPR A;  1X3Z B;  4XSX F;  4C2U A;  3MEX A;  2Y9Z A;  3L2U A;  2AXL A;  3S8P A;  1D1A A;  4M71 A;  3AL0 B;  1MBK A;  2KL4 A;  3CUQ B;  1MIJ A;  4F52 A;  2R5Y B;  4BY1 J;  3QP5 A;  2AO9 A;  1LFP A;  2EV5 A;  2M4G A;  2VB6 A;  2XB5 A;  3HOT A;  2HI3 A;  2K27 A;  1IDZ A;  5IY5 H;  3E6B A;  5AIP A;  2LKP A;  1WJE A;  3WHC A;  3TKY A;  2HKX A;  1TT0 A;  4HSR A;  1AA7 A;  2M0C A;  3H5N A;  3BCA A;  4RAZ A;  3S14 J;  3D0S A;  1T6S A;  2K4B A;  4G94 A;  3BDD A;  2DA3 A;  2X6O A;  4L9N A;  4XM3 A;  1U78 A;  4X1E A;  2W48 A;  2MH2 A;  3C2G A;  4NQW A;  4CGZ A;  1TWH J;  1LKX A;  3RCO A;  2L0K A;  2J5O A;  3DP7 A;  1I1S A;  2WA0 A;  2WAQ N;  4LIV A;  2Z5U A;  5ERI A;  3K10 A;  2K9L A;  4Y3O A;  4HDU A;  1MMA A;  4KFC A;  4KIC A;  1RNL A;  4HX7 A;  4BAC A;  2XAQ A;  3BR0 A;  3LSI A;  4Q47 A;  2NOJ B;  3IP4 B;  3ML6 A;  5LFA A;  2HYJ A;  1IW7 F;  3FXM A;  3HKZ A;  4M73 A;  1F9N A;  5E3M A;  1T56 A;  1APL C;  1IGN A;  5E1X A;  3BG5 A;  1WJD A;  1UHM A;  2COB A;  1TQM A;  1Y0N A;  3G3Z A;  3I54 A;  4PCQ A;  3VDX A;  3W6J B;  4U0Y A;  3O2P E;  4ITV A;  3O8H A;  1XGS A;  4JX5 A;  4JQF A;  4ENJ A;  5L3B A;  2F5E A;  2R7V A;  4CXF A;  2L7F P;  4XON A;  3PM1 A;  4MNU A;  2W24 A;  3RQI A;  4CDG A;  1K79 A;  3HC7 A;  1PJR A;  3PQJ A;  5LHI A;  1FSE A;  2DOF A;  3K4K A;  1VQK I;  2KIQ A;  3TL4 X;  2VON A;  5D5V B;  4ZTJ A;  3GFJ A;  4E4H A;  1CQT A;  3AL0 C;  4E7K A;  2FX0 A;  1W0U A;  3CUQ C;  1USS A;  3QQA A;  2HR3 A;  2HKO A;  1HOM A;  3FZV A;  1QHG A;  1IN6 A;  2P5K A;  3LSJ A;  3O6B B;  1IG7 A;  3ABU A;  1BM9 A;  1DGW Y;  1XC5 A;  2K3F A;  1G3S A;  1X2N A;  5IT9 K;  2BOL A;  3G1M A;  2BW3 A;  2DQL A;  2RRE A;  4P96 A;  3ABT A;  3JRF A;  2MD5 A;  1Z1D A;  3ZXS A;  4RB2 C;  2CV2 A;  2NVY J;  1ENH A;  2A6T A;  4A0Y A;  5HLH A;  4PK4 A;  1X19 A;  1FOW A;  1X3W B;  4HF1 A;  2OBP A;  3WHB A;  3BG6 A;  1BJA A;  3ESW B;  3QWL A;  4KJZ A;  2OV7 A;  4CZC A;  3TMO A;  1NK2 P;  3ASN H;  3SJM A;  1Y39 A;  3QOD A;  2L9V A;  2DA6 A;  3LFU A;  1FJL A;  1TW3 A;  1YJN I;  3EET A;  1GV5 A;  2IXS A;  2RVC A;  5CVR A;  4XBF A;  4KNY A;  4M6X A;  2XUB A;  1STZ A;  3HXL A;  2R4G A;  2JSC A;  1XMX A;  1J75 A;  2G7U A;  2VJJ A;  1ZAO A;  1KQ8 A;  5AIQ A;  1MMS A;  1HLV A;  1A5J A;  1IO2 A;  1ACI A;  1I3Q J;  2V9V A;  2W25 A;  4OIQ F;  3T5X A;  1K78 A;  1ERD A;  1Y1V J;  2K85 A;  5JLW A;  3SZT A;  1EJ9 A;  2ZJP F;  3MKZ A;  3GTL J;  1IN5 A;  1WGX A;  1T2K A;  3HHG A;  1RUN A;  4V2F A;  2M30 A;  4ENK A;  3WE3 A;  1BW5 A;  1IV8 A;  3VOD A;  4I99 C;  2P6T A;  3CUO A;  3V8K A;  3WTZ A;  2HVR A;  2O61 A;  5F64 A;  3HOX J;  2GOM A;  1JKQ C;  2RC4 A;  2PMZ N;  4A3B J;  3K2A A;  2EFN A;  2CUE A;  2Y48 A;  5D4R A;  3K1N A;  3ZQI A;  1R4N B;  5IP6 A;  2PLY A;  4PFO A;  4Y17 A;  5HNF A;  3WTW C;  3MKY B;  5EGO B;  3DKX A;  3MKL A;  3CF2 A;  3DBR B;  3JR9 A;  3OR2 C;  3E5Q A;  1X3U A;  4XLH A;  2CQX A;  4UVC A;  1G3Y A;  4PSW A;  1MDM A;  3IAS 2;  2A5Y B;  2PJR B;  2PI0 A;  2HQA A;  4P1W A;  1J5Y A;  3QU3 A;  3F23 A;  1S72 I;  2L4A A;  2XAU A;  3ASO H;  3BTI A;  3W2W A;  1YW7 A;  2YS9 A;  3TBI A;  4OIO F;  4RGX A;  1OFC X;  3RYR A;  4FE4 A;  2VBY A;  3WU0 A;  3OYA A;  1O7F A;  1OMI A;  2QQ9 A;  1OR7 A;  3F6V A;  1B9M A;  1MMD A;  2FU4 A;  2K9Q A;  3GEZ A;  4IKF A;  1BI2 A;  2K5C A;  4MQV A;  2R7W A;  1ETV A;  2GQQ A;  4D5F A;  2P7V B;  1KA8 A;  4BBR J;  2CGP A;  3FXL A;  2FOW A;  3F8M A;  2VPR A;  1SAN A;  3BR6 A;  3FXU A;  4XLF A;  2BXY A;  3KX2 A;  5DS9 A;  2IBD A;  1K6O A;  4IEJ A;  2B63 J;  1O4X A;  3QAH A;  4DBQ A;  4F93 B;  2DTZ A;  5ICF A;  9ANT A;  5FKO A;  4M3D A;  3OY9 A;  2HWV A;  1ZRD A;  2L7K A;  4A3J J;  4LMY A;  3A01 A;  5F0C A;  3LL7 A;  2C6Y A;  4EGY A;  1D0Z A;  3OR1 C;  3H92 A;  3QOE A;  2E36 A;  2ZJQ F;  3BR3 A;  2XC7 A;  5IT9 Z;  3LST A;  3F21 A;  3BTC A;  1BR1 A;  4KT5 C;  3EUK L;  1WRJ A;  3F3X A;  4BXU A;  3I53 A;  3PIP F;  1T95 A;  3EUH C;  3JTG A;  1XGM A;  1SD4 A;  2FOK A;  3OWT A;  3GYH X;  1A6Q A;  2WAE A;  4RLQ A;  2JA7 J;  1MZB A;  1Z6T A;  3KE2 A;  1MMG A;  3NAU A;  5F0F A;  3JAM Z;  4XOP A;  3A03 A;  3F8B A;  4NB5 A;  1WJB A;  1Y6I A;  1JKP C;  5CLS A;  4X0G A;  3K4M A;  1TWC J;  4G9Y A;  3TO7 A;  2JPB A;  3GWZ A;  3M07 A;  5FRM A;  3UNG C;  2VAS A;  4DYR A;  3PFI A;  2R0Q C;  3PUF A;  3CO6 C;  1BR4 A;  4BY7 J;  4M6V A;  3RTR A;  1VQ5 I;  4NDL A;  5LHG A;  1ZYR F;  1QHH D;  3W6K B;  5ICE A;  1MNE A;  2FXA A;  3BR2 A;  4KN4 X;  2HOE A;  1MMN A;  3RPU A;  3S2D J;  3C2B A;  4B3A A;  1HW1 A;  2PMZ A;  5GP9 A;  4KIS A;  1UEL B;  2CO5 A;  2HQ5 A;  1XSV A;  1X1D A;  2HDW A;  1U8B A;  1JTX A;  4QPQ A;  5J1Y A;  1J9I A;  2GM4 A;  3HGY A;  2O7O A;  3OYI A;  3QYB A;  2A3S A;  1PYV A;  3W3C A;  1HDP A;  1ZR4 A;  1NG6 A;  1DU0 A;  5BMZ A;  1LVK A;  1R00 A;  1JGS A;  1ZG3 A;  5LGU A;  3HTU A;  1XS9 A;  2L01 A;  3JRH A;  4CH7 A;  1GUU A;  4HQM A;  2JZY A;  5BOX A;  4ENN A;  1S5L C;  2TRT A;  4HOB A;  4WXD A;  1LQ1 A;  1OKR A;  2VOD A;  1LUJ B;  4WF2 A;  1FLI A;  3V8J A;  4OIN F;  3KEY A;  3C1D A;  2CQN A;  3PL8 A;  4L9V A;  2STW A;  1BOB A;  5DCM A;  1HDD C;  1I6H J;  1FBQ A;  1X1A A;  5EZH A;  4G12 A;  1RKT A;  5B1A H;  3KEO A;  2Y9Y A;  1OLT A;  3CLO A;  2IPQ X;  3H0G J;  3P7N A;  4CCN A;  3S1N J;  3BQZ A;  2K9M A;  4GRI A;  2OTJ I;  1X2M A;  2FUG 2;  2VI6 A;  3BPX A;  4ON0 A;  4MLO A;  1Z3Y A;  4DJA A;  4XLE A;  2DFE A;  2ME0 A;  2IS4 A;  3BQY A;  2Q1Z B;  1MSF C;  3K4J A;  2X51 A;  1E17 A;  2RN7 A;  2R7U A;  2IVM A;  3BP8 A;  4I7H A;  4N0B A;  3F8N A;  4ZJZ A;  2LY2 A;  5FLM J;  2K86 A;  2CU7 A;  4HF2 A;  3CMA I;  4BQA A;  3VYS B;  2M34 A;  4A3M J;  2OAZ A;  3HSE A;  1FEX A;  3IKV A;  4ZYA A;  2K9N A;  3N05 A;  3OYK A;  1XSX A;  4OU0 A;  3U1K A;  4Q5S F;  3RKX A;  2DOD A;  1Z6R A;  2ZC2 A;  1QVU A;  2HXO A;  4UB6 C;  5DD8 A;  3VYU B;  2BV6 A;  3VEP A;  4B1R A;  4WCG A;  3G2B A;  2L02 A;  2DI3 A;  4XRS G;  1P92 A;  1ON1 A;  3HGG A;  1BJZ A;  5EG0 A;  2GLO A;  1XCB A;  1ETW A;  2X1D A;  3ZMS A;  5C4J J;  2QEX I;  1KYZ A;  4NUB A;  4PJM A;  2HXI A;  4AYB A;  5FFZ A;  2VUM J;  1JI8 A;  1TWG J;  4DIQ A;  3CES A;  4KT6 A;  2DMT A;  2LSO A;  3CP2 A;  4PSX A;  3HB9 A;  4IRG A;  4A3K J;  2X0L A;  4BJT A;  4YRV A;  4Y7N J;  1UHS A;  3ZQL A;  3RZD J;  3RI4 A;  4A3D J;  2IA0 A;  4BQO A;  4AVZ A;  2EFO A;  2ZSH B;  3WTV C;  2DAO A;  2VE8 A;  1YQA A;  4ANJ A;  1B72 A;  4QIW N;  2BHY A;  2WY8 Q;  3TW6 A;  2R7O A;  2XF5 A;  2QBY A;  3L2V A;  5DUI A;  1W4M A;  1MKM A;  4HA8 A;  3T8R A;  3S17 J;  5GAE J;  4XID A;  2CW0 F;  1KQ0 A;  5GAD J;  2Y2Z A;  5EEA A;  1UST A;  3VYR B;  1SVL A;  3IWF A;  4LGW A;  4HZF A;  2F4M B;  4RAF A;  4LD5 A;  4RBO A;  3IAM 2;  1D5V A;  4I76 A;  2JUC A;  2KJB A;  3LSG A;  4GYG A;  1ETO A;  1YG2 A;  3I59 A;  2W1O A;  1Q1H A;  3N4M A;  1RKW A;  3TP0 A;  3QYF A;  2B7E A;  2CUZ A;  2BHZ A;  4MIM A;  4MGR A;  2EBI A;  1LE8 B;  3GME A;  1DP3 A;  2A61 A;  4DZJ A;  2QGU A;  2ESN A;  4CCM A;  2KKO A;  1VQ7 I;  2EZI A;  2KZV A;  2VE9 A;  5FKN A;  4MFE A;  1TZL A;  3K4C A;  5L3D A;  4D5C A;  2V26 A;  3DEW A;  4DZP A;  3DKY A;  1JTY A;  4P5O A;  4RM2 A;  2R5Z B;  1YTY A;  1VND A;  5EZG A;  5JLX A;  2QQA A;  1J59 A;  1TNT A;  1P9Q C;  2PN6 A;  2HEO A;  5H6Q A;  2OQR A;  4A6D A;  2M7A A;  2E2H J;  2F4I A;  2ZO4 A;  1FBU A;  1UFM A;  2K02 A;  3H9J A;  2MAB A;  1Z7L A;  2LBF B;  3DCF A;  3E97 A;  4IHY A;  1HSJ A;  3BJA A;  2VN2 A;  3BTJ A;  3LMM A;  3G1L A;  2JA6 J;  3CCM I;  5FKM A;  2EQR A;  4II2 A;  3KFW X;  3LSM A;  2NVU B;  4LJZ F;  3P9C A;  3RZO J;  4KIT B;  4L0Z B;  2XPW A;  2XRN A;  1A04 A;  1T0F A;  4I0A A;  2W85 A;  4MEX F;  2HYF A;  2VC1 A;  1BN5 A;  1WKM A;  2KRF A;  3DWL E;  1O7L A;  4FT8 A;  4M74 A;  3GF2 A;  3U2R A;  1D5Y A;  1O57 A;  4PGH A;  2MC4 A;  2QUF A;  2R7X A;  2L2O A;  4HV5 A;  1R71 A;  2M0M A;  1RPW A;  2BGC A;  3IH4 A;  2HS5 A;  1IN4 A;  3FIW A;  5EEH A;  2P6S A;  1B4A A;  5HS9 A;  3RJP A;  4EJO A;  1RIO H;  2CQK A;  4A3C J;  4BE2 A;  1P6R A;  1RET A;  1WVR A;  2CG4 A;  2ESH A;  2YSR A;  3JSP A;  4YII A;  5DV5 A;  4BXX J;  2AHQ A;  3DTK A;  2LOO A;  1R22 A;  2LY1 A;  2E71 A;  2KIS A;  2X6W A;  1ZG5 A;  2J5P A;  4XLP F;  1JKR C;  3W2V A;  4RM3 A;  2OCC H;  4A6E A;  4HNV A;  1VTN C;  3HKZ N;  4D1Q A;  4M3B A;  5HLI A;  2D1V A;  3S3M A;  4GO1 A;  1ZRF A;  3RKW A;  4ZYE A;  2W00 A;  3MN2 A;  1XG1 A;  3KPH A;  5AON A;  4QLC U;  2V6C A;  4IVN A;  2MLK A;  2P8T A;  2RNG A;  3HRS A;  1EH8 A;  4OMY A;  2DYS H;  1T39 A;  3REO A;  3M9A A;  5E18 F;  3B6C A;  1WJA A;  1OCO H;  5E79 C;  3I4N J;  3M7G A;  2DK8 A;  3S1M J;  3E6D A;  1PP7 U;  2EFP A;  3HM5 A;  4HYE A;  1D0X A;  4C3J J;  4I0B A;  2ZJ2 A;  4PJN A;  1FZP B;  3FBI B;  1D8K A;  2UZK A;  2E1O A;  2Q2E A;  4PJJ A;  4YFK F;  4IHW A;  2A07 F;  2LK2 A;  1YIO A;  2EFQ A;  3H35 A;  3PIO F;  4IQJ A;  4UUV A;  3BG3 A;  2LLK A;  5D8L B;  3ONQ A;  3V4G A;  3CJQ B;  3DXJ F;  1L0O C;  4BS9 A;  2WAD A;  1RES A;  3F72 A;  5FRO A;  2EZK A;  3G4S I;  1WWX A;  4WWC A;  3NRV A;  2HPM A;  4Y13 A;  1G2H A;  4KDP A;  2DDB A;  5DEQ A;  4A93 J;  1HQC A;  4HBL A;  1MGT A;  1F4K A;  4ZH4 F;  5L3G A;  4ETS A;  1QPM A;  2DU9 A;  1G3W A;  2LC2 A;  1BIB A;  3KZI C;  4C2T A;  3VFZ A;  4CSW A;  3VWB A;  4BL0 B;  3I0T A;  3BZK A;  4NQW B;  3V8L A;  2E5Z A;  4LIU A;  5F6F A;  4RS8 A;  5J6X A;  3JTH A;  3A0B C;  5H2F C;  4BAY A;  4C3H J;  4E70 A;  2PG4 A;  4JX4 A;  1ON2 A;  2Z9O A;  3GX4 X;  3ZMD A;  4HNT A;  1K6Y A;  1QZY A;  4ZYH A;  3WU1 B;  3GW2 A;  3H9G A;  1DU6 A;  5D8K B;  1YO5 C;  3HSR A;  4LLL A;  4IHX A;  4EEF G;  3JW4 A;  4EGZ A;  1FBS A;  3K2Z A;  2Z3Y A;  3IH3 A;  2DPD A;  2ELH A;  4LG0 A;  3RQ4 A;  2IGO A;  4H4K C;  2I8D A;  3Q0U A;  3GFI A;  1MH4 A;  4EAT A;  1B9N A;  3S3N A;  3G1O A;  1W5T A;  2ZXI A;  4FAS D;  1AU7 A;  1Z77 A;  4BE1 A;  4Q48 A;  2Q8K A;  1R1T A;  2GA1 A;  1C0W A;  2M8E A;  1MBH A;  2DT5 A;  3HOS A;  1JJ6 C;  1IC8 A;  3F9K A;  3IHU A;  2JWT A;  5FFX A;  3RPU D;  1SC7 A;  1MJA A;  2F4O B;  2MGQ A;  3V7R A;  2HGC A;  4PUS A;  2LKS A;  1SEU A;  3M8J A;  1U5T A;  3DKW A;  4DQ2 A;  1M1E B;  3KP7 A;  3ZRG A;  5LRR A;  5TIS C;  3M1E A;  3CUQ A;  2Y30 A;  1HW5 A;  2BW3 B;  2R5Y A;  1JHF A;  2XHK A;  3AG3 H;  2G9W A;  4BQQ A;  4AIK A;  5IYC J;  3SYT A;  2BEO A;  2XPV A;  4WK8 F;  5GTI C;  2HZD A;  2E35 A;  4KMF A;  2ISZ A;  1KU2 A;  2E1M B;  3WTX C;  2RAE A;  2ZSI B;  3OSG A;  1TBX A;  2H6C A;  2VC0 A;  2E1N A;  4Q4Z F;  2NOG A;  2RQQ A;  2PFB A;  3FHZ A;  2E7X A;  1G4D A;  4I01 A;  2NNY A;  2BY2 A;  3MD2 A;  3C18 A;  3CMY A;  5F27 A;  3KYD B;  1ZTR A;  5B66 C;  4E7H A;  4N9H A;  2ZJR F;  4LFU A;  4V19 K;  4CIC A;  1R36 A;  3FK7 A;  4HX8 A;  4YG2 F;  4BDZ A;  5M3M J;  2ZNZ A;  2VKD A;  2QLZ A;  3F0C A;  3CCS I;  3H5R A;  4FCY A;  2GOX B;  3OYJ A;  4N4N B;  1U9N A;  1ZLK A;  1RZ4 A;  1SFU A;  2EZH A;  1KON A;  1YE9 A;  2DTR A;  3HJE A;  5JHF A;  1REP C;  3H3V K;  3OS0 A;  2RKH A;  1UZC A;  1GLN A;  2DT7 B;  1V3F A;  1FT9 A;  1I39 A;  1VQL I;  3OYM A;  5IT3 A;  1BL0 A;  2LF7 A;  3VSL A;  1K83 J;  1QPI A;  2DA7 A;  2QWW A;  4PFP A;  4ABZ A;  4AU7 A;  1R1V A;  4IHS A;  3RYP A;  3PNV A;  5M5Y J;  3K1M A;  3WG7 H;  5F1R A;  1R5G A;  3FXJ A;  2EA4 A;  4DNC A;  2FE3 A;  5B3S H;  3ZQC A;  1SVM A;  1T98 A;  3E6C C;  2FEZ A;  5KCM A;  1LFU P;  4AIJ A;  1BW6 A;  1BIA A;  2QCO A;  1S8N A;  1BI3 A;  2L7M P;  5BS6 A;  3HG9 A;  5IYD J;  2EV0 A;  1GT0 C;  3K70 D;  4KIF A;  4BE0 A;  4JK1 X;  4ZYD A;  3H5A A;  1POG A;  1Y8R B;  2EWN A;  1QA6 A;  5H20 A;  4P9U A;  2AQE A;  4MTE A;  3S1Q J;  3FM3 A;  2VJ4 A;  1K61 A;  2WV0 A;  2ZCW A;  3HUG A;  3VSK A;  1NHA A;  2H09 A;  2E1M C;  3DEU A;  5HNH A;  2KLO A;  1HKS A;  3COA C;  3KZZ A;  2BY3 A;  3AG4 H;  2HZT A;  4YIF A;  1GHC A;  2XV4 S;  1VFC A;  2Z1D A;  4BHC A;  4C9Y A;  3HDD A;  3BTL A;  2CH0 A;  4BHB A;  4EM2 A;  1RRJ A;  4E7L A;  3IH2 A;  5E20 A;  1VQ4 I;  5J1U A;  1B59 A;  5IYB J;  3K6G A;  2VBZ A;  3S93 A;  4V2G A;  2XKO A;  3R4K A;  4G8X A;  2OQG A;  1UB9 A;  3FIS A;  2GXG A;  1LDD A;  2EIK H;  2OPT A;  3A01 B;  3F6O A;  1JT6 A;  1IN7 A;  3MMY B;  1Z91 A;  1GVD A;  2ZKZ A;  1LFB A;  5E8G A;  1HKQ A;  2KDZ A;  3PQK A;  3OOP A;  2UUZ A;  4CZZ A;  2ELK A;  1OIS A;  4S0H B;  3TQN A;  3PSI A;  2VT2 A;  4CYC B;  4KUM A;  3GTK J;  3BG9 A;  3BG7 A;  4YFX F;  3EYY A;  3I55 I;  1IJW C;  2KZG A;  1SFK A;  4M6Y A;  3E3V A;  3HOZ J;  3RKY A;  1TNS A;  5K5R A;  3HOV J;  2RNJ A;  4XSZ F;  2CV1 A;  5FLX K;  4LK1 F;  2DFH A;  1Z7U A;  1KQ9 A;  2LVS A;  3BZC A;  4B43 A;  4XOT A;  4A0Z A;  2HFH A;  3G71 I;  2LP0 A;  2W4S A;  5J47 A;  2HU9 A;  1MBE A;  3EUH A;  2CUF A;  2GIZ A;  1W7P A;  4U87 A;  3R0J A;  4BKX A;  3CD6 I;  3ZMU A;  1T38 A;  2W82 A;  5EGO A;  4ZDP A;  2ZFW A;  1JUM A;  4JOM A;  2LDU A;  1NTC A;  2PX9 A;  3KYC B;  5KK1 A;  3LSH A;  5IP7 J;  3PUB A;  1RC9 A;  2IGM A;  3I4M J;  2ID6 A;  2O0Y A;  5LGN A;  1IXS B;  2X1C A;  4HF0 A;  3MWM A;  4RLF A;  1YRN A;  2OTL I;  2NNN A;  3DPL C;  1IRX A;  5BQT A;  4BNC A;  3ABM H;  1XGN A;  4AYB N;  4JP0 A;  2RGV A;  3V42 A;  1W5S A;  3B02 A;  2BXZ A;  4EJW A;  4WXC A;  3BR5 A;  4HW0 A;  2CS3 A;  1QNT A;  1RUO A;  4FHT A;  1YJW I;  1IUY A;  1SFE A;  1ZRC A;  2KIU A;  5BNG A;  1DQU A;  2CUJ A;  3DLL F;  3CF5 F;  4IZZ A;  2R7Z J;  5ED4 A;  2Y75 A;  3CZ6 A;  1CF7 A;  4XN3 A;  5D6E A;  4G6T B;  3SZP A;  2MBF A;  3FBN B;  3CCQ I;  1TTY A;  1WH7 A;  2DDA A;  2ZME A;  1PUF A;  4QTR A;  3FDY A;  1A6I A;  5FD6 A;  2V9K A;  2O03 A;  3EUA A;  1B8I B;  5CPR B;  2KDO A;  4P55 A;  3OS2 A;  1J0R A;  1SD7 A;  2ID3 A;  2L4M A;  1IDY A;  1YHQ I;  1E3H A;  1SMY F;  2L9N A;  4JBA A;  4PJ0 C;  5FKK A;  2CSO A;  2MC3 A;  1O3Q A;  4IXA A;  4KIB A;  4PZJ A;  4E7S A;  2DLL A;  4RDU A;  1GV2 A;  1U3E M;  1F1Z A;  3EPZ A;  3O8G A;  1I3A A;  3O3K A;  4I02 A;  1F43 A;  4XRS A;  5JVG F;  4CHU A;  1J2X A;  1LDK B;  2VQC A;  1UJ8 A;  2X85 A;  2FML A;  2XGD A;  4U0V A;  4BHP A;  3M8E A;  1DPU A;  1VQM I;  5IPA A;  2GA2 A;  2V6E A;  1IN8 A;  4A12 A;  1D8J A;  1EH6 A;  2BE5 F;  4O5V A;  1FSH A;  3M1C A;  3NWS A;  3GFM A;  4NC8 A;  4MHG A;  2EFW A;  2HVQ A;  3TDZ C;  3C3W A;  5CVU A;  2LTP A;  2XAS A;  1AKH B;  2E19 A;  3SEQ A;  2NRA C;  3MVP A;  1ZR2 A;  2XB0 X;  2E34 A;  3TOB A;  1ZKG A;  3D5S C;  5FLV A;  2X48 A;  2EIM H;  5C4X J;  2KHM A;  4UV9 A;  3RSN A;  4NC7 A;  1SAU A;  2ME6 A;  3OYN A;  3EYI A;  4P9F A;  1FYM A;  2LMD A;  4RB0 A;  4EJT A;  4LLG F;  5CVI A;  5J40 A;  4FET A;  4BJ6 C;  3E5X A;  3CCY A;  1ONV A;  5DYM A;  3CCU I;  2FJ1 A;  4N4O B;  2E7W A;  2Y31 A;  3OIQ A;  4M3G A;  1FOX A;  4RGR A;  5K7F A;  5HLT A;  2V1D A;  4IQ4 A;  3ZQ7 A;  1BBY A;  3OYF A;  4BBS J;  4AIH A;  4A3L J;  3T8T A;  3I58 A;  3GUD A;  5KHD A;  1F5T A;  4IRH A;  1R58 A;  4OOI A;  1ETK A;  1PVE A;  5FLX Z;  3GZN B;  4RA2 A;  3IL2 A;  3Q3S A;  2BYV E;  1Q1V A;  1YS6 A;  3G73 A;  5E17 F;  1EA3 A;  2L9R A;  3ZQG A;  3CLQ A;  2XKP A;  3Q0V A;  1B72 B;  2FQ4 A;  2HDD A;  1XGO A;  3JRA A;  2O5R A;  5EYR A;  3SFZ A;  2BY0 A;  4Y15 A;  1R23 A;  5CVV A;  4HRI A;  1VQ8 I;  2EJR A;  1ZEL A;  2HPI A;  2Y0M A;  3KP6 A;  3OYD A;  2FRH A;  2ZB9 A;  1H8A C;  3NEU A;  2VKE A;  4IRI A;  3ABL H;  1FIP A;  4BXF A;  1TT5 B;  3H36 A;  3X2Q H;  2KP6 A;  1TLH B;  4XOR A;  3HL2 A;  5TJJ A;  5HDN A;  1OCP A;  4J19 A;  4ASN A;  3QPT A;  3I5U A;  4Z6Y A;  1JUP A;  4K2E A;  2QQ8 A;  3OYH A;  1OJL A;  1A36 A;  2EK5 A;  3GCM A;  2BBY A;  1BC8 C;  2CFX A;  4GGG A;  4HLX A;  1T33 A;  3HSF A;  1HST A;  3DFG A;  3MCZ A;  3WG9 A;  4RAG A;  3KP2 A;  2OJE D;  4MQ9 F;  2HOT A;  2BVL A;  4E7J A;  2DOE A;  3FF5 A;  1T08 B;  3K1P A;  3KZY A;  3UKG A;  3KP4 A;  1OCR H;  3KLO A;  3CME I;  1V55 H;  3PFY A;  3HRU A;  3CCE I;  1SFX A;  1G3T A;  2CFO A;  3LA2 A;  2EB7 A;  3SDB A;  1FMV A;  2ECB A;  1KU9 A;  2HVS A;  4OIR F;  3VPR A;  2DMQ A;  1A35 A;  1YLF A;  3KIO A;  2GAU A;  3LFK A;  3M3Y J;  5E1W A;  4D9J A;  3K4L A;  1RI7 A;  2FSW A;  3LQQ A;  4HDV A;  1SFO J;  3CDI A;  2KFD A;  3J7Z I;  2DQR A;  3A4C A;  1JT0 A;  6PAX A;  1U2W A;  3K70 C;  4FQG A;  4PDK A;  4DYQ A;  1V5G A;  1PDN C;  1Y8Q B;  2R3S A;  2VT3 A;  2KRH A;  1UHW A;  3QP6 A;  3I9V 2;  1OCT C;  2JVG A;  2VQH A;  2O3F A;  3L1P A;  4DW6 A;  2XSJ C;  2VOO A;  1KU3 A;  1JGG A;  3BT9 A;  3HTS B;  2DA4 A;  3ERE D;  3FX3 A;  3KLN A;  1JJ8 C;  1DDN A;  2FD5 A;  2DW4 A;  4Y4R A;  5JR3 A;  1ETY A;  2A69 F;  2YR2 A;  2M3A A;  3Q9S A;  2HTS A;  2NVX J;  1BA5 A;  3TED A;  5IOY A;  3QPL A;  1R1U A;  1MBJ A;  3V7C A;  2IA1 A;  4AWX B;  3LA3 A;  1R49 A;  5H6R A;  2LD5 A;  3GTQ J;  2UXX A;  3IRR A;  3J81 K;  4O3M A;  4BYY A;  4EM0 B;  5E3N A;  2IW5 A;  3JCU C;  4FTH A;  1I1G A;  2JRM A;  1WI9 A;  5D4S A;  2IS6 A;  5B5E C;  3I4P A;  2ZBK A;  2COM A;  3LA7 A;  2QKM B;  3KP3 A;  3QRF F;  4A3E J;  1FTZ A;  5KAF C;  1ULY A;  1LE8 A;  2XIG A;  2GZW A;  3K4B A;  4ZC3 A;  3MAJ A;  5GTH C;  2DO7 A;  3NWT A;  3ZR8 X;  1QU3 A;  2Y0S N;  3ROU A;  3HOW J;  5HS7 A;  4M3F A;  3RIR A;  3RPQ A;  4AM3 A;  2EA2 A;  5HOO A;  1FY7 A;  1X58 A;  1IAW A;  1H9G A;  3AKZ A;  5E3L A;  2R5Z A;  1VF9 A;  2I5U A;  4NBQ A;  3DBH B;  3DTI A;  4G7H F;  2GXB A;  3DPU A;  1WJC A;  1LDJ A;  4IHT A;  1BR2 A;  2BY1 A;  5CJ9 A;  1SD6 A;  1SVO A;  3KP5 A;  3L2W A;  5D5X B;  1TWF J;  3BR1 A;  3DU5 A;  2LYC A;  2OZU A;  2DMU A;  1XB4 A;  1ODD A;  4BEH A;  2HQN A;  1FPQ A;  1S7E A;  3GTO J;  1EH7 A;  1QVT A;  5EEG A;  3TOA A;  2E2J J;  2R7T A;  1JHH A;  3IC7 A;  2FMY A;  1W36 D;  2H27 A;  1T0F C;  4OAZ A;  1PUE E;  4UVB A;  3Q0W A;  2ETH A;  1HXD A;  2IJL A;  3LWF A;  1JE8 A;  4HEA 2;  1T8I A;  4G6Q A;  5D6F A;  2ECC A;  3TDU C;  1I27 A;  2F5F A;  4NNJ A;  5JI6 A;  3JRE A;  2R7Q A;  3ERM A;  4LLN A;  1IRF A;  3ECH A;  3FMS A;  3F8C A;  1XSD A;  2NAZ A;  4IPA A;  5ILS A;  4YEJ A;  1Y0U A;  5J4V A;  4WX9 A;  1WH5 A;  4BQN A;  3S3O A;  4UUS A;  2CJJ A;  1OYW A;  3ZQH A;  4Y52 J;  5M3F J;  2L7Z A;  1E0E A;  3LSP A;  3K4N A;  3JRC A;  4A3I J;  3U21 A;  2F5D A;  2DOA A;  1FOK A;  2R92 J;  5HLG A;  3HRM A;  3SDG A;  1S29 A;  1AHD P;  3GLX A;  3S16 J;  2VOP A;  1DGR M;  2QSG X;  2OA4 A;  2JJ7 A;  2M8G X;  2DJI A;  1EV7 A;  2ADU A;  4AC0 A;  2P4W A;  2WC2 A;  2G0E A;  4ZYG A;  5F1J A;  1ETQ A;  1QQI A;  4B8X A;  4QWQ A;  4GDF A;  4CCL A;  3AAF A;  2RDP A;  5F04 A;  1FYK A;  2I10 A;  2NYX A;  4F92 B;  1PP8 F;  3OIP A;  3QPS A;  1QRY A;  1W7P D;  4LG0 B;  2M1B A;  4EVI A;  2KPM A;  4RGS A;  5IOZ A;  2O6G E;  1VQN I;  3GZ6 A;  1AWC A;  3AG1 H;  5L3E A;  3P9K A;  2IRF G;  1ZGJ A;  1MJ9 A;  2W57 A;  3H3U A;  3NAR A;  2H1K A;  1VQ9 I;  1GVJ A;  3K9T A;  2Z99 A;  4NC6 A;  4IOA F;  3GTG J;  2WB1 A;  2WY7 Q;  3DQV C;  3GTP J;  1G8X A;  1U9O A;  1YYV A;  2AXT C;  4KMU X;  2CQ7 A;  1XTA A;  5D5W B;  3KET A;  3OIO A;  2FBI A;  4XL9 A;  2K4J A;  1YW9 A;  4C30 A;  2JSP A;  2NVT J;  4FE7 A;  4GCV A;  3ZP5 A;  4MFD A;  1FNN A;  1E3P A;  4HG2 A;  2DMP A;  4PGG A;  5EF6 A;  5DM6 F;  1U5T B;  2EIN H;  3SZG A;  2E5N A;  1XPX A;  1JUS A;  2STT A;  2A6H F;  2GIV A;  5HOD A;  2VKH A;  1TQI A;  2MA3 A;  1VZ0 A;  2P5L C;  1YX5 A;  4ZZL A;  2Y0S A;  5A2Q K;  5D5U B;  1MND A;  3RDI A;  4EMS A;  3CC4 I;  4U7D A;  3ZCO A;  1ZHF A;  2XGE A;  3FMQ A;  2YU3 A;  3DEE A;  5L3F A;  5TRD A;  2WTE A;  2B0L A;  4B47 A;  3HIF A;  2DA5 A;  1WPK A;  2VKV A;  4CCJ A;  4XMY A;  3BC8 A;  3L09 A;  2W7N A;  1B1B A;  3HRT A;  1XD7 A;  2IEK A;  2HQR A;  3FM5 A;  2DN0 A;  3TW7 A;  3LAP A;  4XIC A;  2O8K A;  2AS5 F;  4GXO A;  2CWE A;  1IXR C;  2V1N A;  2A6E F;  4MEY F;  3V7S A;  4EV0 A;  2O8X A;  1IV6 A;  1N78 A;  1S7A A;  1ITY A;  4H0E A;  4D7M A;  2FF4 A;  1NG7 A;  3S2W A;  1V54 H;  5C3E J;  3FXK A;  2JRT A;  3P5J A;  3FXR A;  3R6S A;  1VQP I;  5HDK A;  3LAJ A;  4Z2Y A;  3L2Q A;  3T0Y A;  5M5W J;  3IRQ A;  3WTU C;  1KU7 A;  3R61 A;  2FNA A;  5J4Y A;  1MBG A;  1V4R A;  1Z05 A;  4XKV A;  5KNL A;  3K69 A;  4XNF A;  4DGW B;  3C7J A;  5LBQ A;  2DMN A;  3OL3 A;  4KN7 X;  1A31 A;  4EJU A;  3S32 A;  1IF1 A;  2D45 A;  3JRB A;  1WI3 A;  5F08 A;  4CA0 A;  2V1X A;  1W1W E;  1FYL A;  2QA4 I;  1XCV A;  1OYI A;  3CMM A;  2VBX A;  3BJ6 A;  2L9S A;  2ZXH A;  2F5C A;  2DA1 A;  4MTD A;  3I56 I;  3U9G A;  4JX6 A;  2GBY A;  3L2R A;  4S04 A;  5LLQ A;  1H9T A;  2QSF X;  3CCL I;  3SXY A;  5GAG J;  3WGI A;  2YU9 J;  2P7C B;  4U0W A;  5LEJ A;  2M5W A;  1P4W A;  3GO5 A;  3E5U A;  4W97 A;  3WTT C;  3L00 A;  2LRD A;  3FKJ A;  2XAF A;  1U5T C;  4L9T A;  5FO5 A;  1K78 B;  2IT0 A;  2JA5 J;  2YUS A;  2QZ8 A;  2FBH A;  1YX3 A;  2WWY A;  2XDV A;  2QVO A;  3U1D A;  3E6M A;  1EF4 A;  1WSU A;  2XGC A;  4B48 A;  1VI0 A;  4RB3 C;  2XAG A;  5FKL A;  5J1R A;  4UB8 C;  3CDL A;  4G7Z F;  2CRG A;  5LEK A;  2EV6 A;  3F8F A;  5E8I A;  4G7O F;  4I6Z A;  1ORK A;  1EKE A;  3HUG B;  4F7Z A;  2XSD C;  2ACJ A;  4ESB A;  5IP9 J;  2EIJ H;  3ZN0 A;  3DLA A;  2QYO A;  2DJN A;  3CJT B;  4II3 A;  2DFI A;  4UV8 A;  2LF8 A;  2HOA A;  2HNH A;  1QBJ A;  1Y56 A;  2GWR A;  5CVJ A;  2VPL A;  3FHN A;  3J7A Y;  2KMU A;  4HST A;  4BJ5 C;  3OMY A;  3JAM K;  4IL6 C;  1ZAR A;  2P0W A;  2MLG A;  3MZY A;  3I64 A;  1MDM B;  2X6X A;  1R6R A;  3N97 A;  3E7L A;  3E0J B;  3PO2 J;  5BPD A;  3R60 A;  4HAM A;  4HPQ A;  1U8R A;  4ESF A;  3G6E I;  3CJR B;  5ILV A;  1J09 A;  1Z67 A;  2P5V A;  2VXZ A;  4GFB A;  1VQO I;  4C2M J;  4F91 B;  1YFH A;  1D1B A;  4KA4 A;  4PJL A;  5HVQ C;  3D1N I;  1QO0 D;  2QM3 A;  1BI1 A;  4AUX A;  3HYI A;  3DTE A;  3HEF A;  2X6Y A;  1LPQ A;  5A2Q Z;  2AQF A;  1FX7 A;  4R8H A;  3GTM J;  1E3O C;  1HCR A;  4U7B A;  3FK6 A;  5ICG A;  4A0X A;  3SQN A;  2HDC A;  1JKO C;  1MSE C;  4EJV A;  1IXC A;  4N9I A;  1X1C A;  2R7D A;  3KEQ A;  4XQF A;  1X4P A;  3CJN A;  5J8C A;  3F22 A;  1X1B A;  1W7P B;  2CMP A;  2D5V A;  5K7H A;  1UG2 A;  1GXP A;  3R0A A;  1R4M B;  2OD5 A;  4I2O A;  1SD5 A;  2LG4 A;  3J7Y J;  4LOC A;  3LSK A;  1SMT A;  2WAQ A;  2LKX A;  4HLY A;  4BU2 A;  3LQR A;  1H0M A;  2VIX A;  1Z21 A;  4MO7 A;  2VQL A;  1QZZ A;  1YIJ I;  1ZRE A;  4C3I J;  2EIL H;  2E60 A;  4F55 A;  3FKI J;  1OPC A;  2JMW A;  2JA2 A;  1YRN B;  1GXQ A;  3M8F A;  3IUO A;  2Z33 A;  1IRZ A;  2R7S A;  1TWA J;  4R1H A;  1WZ2 A;  3WGH A;  1FTT A;  1W36 C;  3MQ0 A;  1DUX C;  2GXA A;  3S1R J;  2M9H A;  2M2E A;  1XDU A;  5EDN A;  1N75 A;  2H94 A;  2V9P A;  4HQE A;  4O6J A;  1I5Z A;  4IF4 A;  1F36 A;  3HPH A;  3OYL A;  2XVC A;  1AOY A;  2L5Q A;  1ZK8 A;  5FD5 A;  3LNQ A;  1S9H A;  2F2E A;  1OQY A;  2XGX A;  3VYT B;  1CF7 B;  3ZMT A;  3BCB A;  3BWG A;  3ZMV A;  1G6N A;  3QOP A;  1RR7 A;  1KZH A;  4B44 A;  1TQP A;  2ZME B;  3MKW B;  1PUF B;  2PJR A;  3CDH A;  4XRM A;  2Z16 A;  1IUF A;  2RV8 A;  1S3J A;  2EZL A;  1XN7 A;  2PMU A;  3TGN A;  3W2A A;  1HA8 A;  1OR7 C;  2IS2 A;  4OWR B;  3S15 J;  1WJ5 A;  2LRE A;  1WJF A;  2OF7 A;  3H9Q A;  2HYG D;  3J80 K;  1TP4 A;  2XRO A;  1CGP A;  2DFF A;  3D5L A;  2OZ6 A;  3JSO A;  2LFB A;  3CCR I;  1FP1 D;  2NS8 A;  4CYC A;  5KAI C;  4XKC A;  3MFK A;  5ICC A;  3B73 A;  2H8R A;  2WBM A;  2MH9 A;  4UXN A;  4LB5 A;  4ESJ A;  5ILU A;  3Q9V A;  2H6B A;  4CCO A;  3BY6 A;  4B3X A;  3FMR A;  4XKW A;  4D0P A;  4QPO A;  2CV0 A;  1QZE A;  3PNT A;  3GLL A;  3CP8 A;  1YS7 A;  3OSF A;  5K5Q A;  1HBX G;  4A3F J;  2EPF A;  3ZPL A;  4ZDO A;  2DT6 A;  1JXS A;  5F0H A;  4OAY A;  1RR8 C;  4TV7 A;  2F6C A;  3WGG A;  2QQB A;  2VL8 A;  4L5J A;  3M4O J;  3H3Z A;  3QU6 A;  4XKB A;  2NS0 A;  3OYC A;  4AID A;  4YIR X;  2ZFU A;  1L3L A;  3JRG A;  2IAI A;  5DCM B;  2PMH A;  1D3Y A;  4ZDL A;  2E1C A;  4UHT A;  1XMK A;  4BH9 A;  2ICW G;  1O3S A;  1E2X A;  3QYE A;  1NH3 A;  3BPV A;  4IO9 F;  3H0D A;  1ZGW A;  2XPU A;  3TP3 A;  4XLC A;  1MBF A;  1WQ2 A;  4L0Y B;  1W5C C;  1V5E A;  1UMQ A;  3I71 A;  4BDY A;  3IWZ A;  2NVQ J;  4Y33 A;  1OYY A;  1XX5 A;  2KRC A;  2PQ8 A;  4IOC F;  2MFZ A;  3DF8 A;  5DDG A;  3HOY J;  1ZQ3 P;  3FXO A;  5DCF A;  2M7B A;  3C2H A;  3ZOB A;  2ZME C;  4QSH A;  4RGU A;  1N77 A;  3ZGK A;  4IX7 A;  5FJ8 J;  2KIF A;  5HDG A;  3VB2 A;  2R7R A;  1HF0 A;  2PJP A;  2JUG A;  2JPC A;  1MH3 A;  3A1Y A;  5EG0 B;  3BRO A;  2A5W A;  1D0Y A;  2TDX A;  2FNP A;  1B8I A;  2DPU A;  2IP2 A;  1LVA A;  3WTS C;  3L9F A;  5GAH J;  3CTA A;  2JA8 J;  1FC3 A;  2L54 A;  5LD2 C;  2JT1 A;  1Z9C A;  1P7J A;  1U6G A;  4RB1 A;  4UVA A;  4A5M A;  4DOZ A;  4RAY A;  5L3C A;  3ZQF A;  3DBL B;  1FOY A;  2MSY A;  1LEB A;  2QKL B;  3OYB A;  1K4T A;  1IZ1 A;  4BGD A;  3CO7 C;  2PEX A;  3BOQ A;  2QBY B;  1BC7 C;  1MD0 A;  2PBI A;  2KJC A;  1VQ6 I;  2D1H A;  4HNU A;  1FMW A;  4M9X A;  1WFX A;  1YI2 I;  3HZJ A;  4J00 A;  1MNM C;  1I6X A;  2JK3 A;  2LY9 A;  3A02 A;  3GFL A;  1O3T A;  1AKH A;  1GDT A;  2DK5 A;  5CQG A;  2EH3 A;  2OUM A;  1HW2 A;  3I59 B;  4G6D A;  2UV1 A;  3GZ5 A;  4YEL A;  2ZXJ A;  1K4S A;  1G59 A;  1FIA A;  4FX0 A;  5FRN A;  1NK3 P;  2ELJ A;  4D7N A;  2VBW A;  4LK0 F;  3CC2 I;  3NQO A;  2CYY A;  3J80 Z;  3MZH A;  5JVT A;  5C44 J;  4OMZ A;  3JRI A;  4YFN F;  2IA2 A;  2A68 F;  2DA2 A;  4W1U A;  1ZGA A;  3TO9 A;  4B09 A;  3OS1 A;  4XRF A;  3LSR A; 
#chains in the Genus database with same CATH homology
 1T95 A;  4BQN A;  3S3O A;  4BDZ A;  3EUH C;  2VKD A;  3OYE A;  1E0E A;  3OWT A;  3K4N A;  3U21 A;  3H5R A;  2CW8 A;  2DOA A;  2GOX B;  5TGT A;  3OYJ A;  2WAE A;  4N4N B;  4RLQ A;  1DGR M;  1MMG A;  1KON A;  1YE9 A;  5JHF A;  4XOP A;  3OS0 A;  1V5F A;  1WJB A;  1Y6I A;  2DJI A;  1GLN A;  2DT7 B;  3AFH A;  4XLA A;  3K4M A;  4X0G A;  2VQG A;  3A2K A;  3OYM A;  5FRM A;  4CCL A;  4XR6 A;  3UNG C;  2VAS A;  3DPT A;  1Z3X A;  3VSL A;  1BR4 A;  2OC6 A;  4PFP A;  4F92 B;  3RTR A;  3OIP A;  4AU7 A;  3PNV A;  1QHH D;  2KPM A;  3UR3 C;  1MNE A;  3SEZ A;  3KYL A;  1MMN A;  5KCM A;  4ZTF A;  2WB1 A;  2WY7 Q;  3DQV C;  2PMZ A;  3HG9 A;  2MYS A;  1G8X A;  1UEL B;  4KIS A;  3GBG A;  4DBR A;  3K70 D;  4BE0 A;  1X1D A;  2HDW A;  4XL9 A;  4C30 A;  3H5A A;  4E6K G;  4QPQ A;  2JSP A;  2AQE A;  4LG3 A;  3HPG A;  1UAA A;  4HG2 A;  3OYI A;  3QYB A;  2VJ4 A;  4XN0 A;  3SZG A;  1D1C A;  3VSK A;  1PYV A;  2E5N A;  3W3C A;  2E1M C;  1NG6 A;  3PNY A;  2VKH A;  5HNH A;  1VZ0 A;  3I3L A;  1LVK A;  1YX5 A;  2KLO A;  2Y0S A;  2V4J C;  4BEH B;  1MND A;  3ZCO A;  2Z1D A;  4C9Y A;  3DEE A;  3DU6 A;  4CH7 A;  2CH0 A;  2DXI A;  4E7L A;  4B47 A;  3K6G A;  3S93 A;  4F3Q A;  3KEY A;  4CCJ A;  3PL8 A;  1BOB A;  1X4O A;  3BC8 A;  4XMY A;  2W7N A;  1X1A A;  3MMY B;  2KQR A;  1OLT A;  4CCN A;  2UUZ A;  2V1N A;  2K9M A;  4GRI A;  1N78 A;  2FUG 2;  3PSI A;  2M4K A;  4MLO A;  1Z3Y A;  1NG7 A;  4XLE A;  4DJA A;  2IS4 A;  3BG7 A;  2Q1Z B;  3K4J A;  2X51 A;  2CW7 A;  2R7U A;  4E7Z A;  1SFK A;  2Q2E B;  4ZJZ A;  2LBF A;  2LY2 A;  3L2Q A;  2CV1 A;  2DCE A;  3VYS B;  3OL4 A;  4J01 A;  4B43 A;  4XOT A;  2IGN A;  4XKV A;  4ZYA A;  5KNL A;  4XNF A;  4DGW B;  2BVM A;  2W4S A;  3N05 A;  3OL3 A;  4LIT A;  2HU9 A;  3OYK A;  1MW7 A;  3S32 A;  4BUP A;  4CA0 A;  3VYU B;  2Z2S B;  3CMM A;  2UWM A;  4U87 A;  3G2B A;  5CQE A;  2L9S A;  2W82 A;  2ZXH A;  2K3P A;  4ZDP A;  3D5R C;  2IS1 A;  4CCK A;  2X1D A;  4JOM A;  3L2R A;  3LSH A;  3E1S A;  3PUB A;  4NUB A;  2IGM A;  4E7I A;  4PJM A;  4AYB A;  2JVH A;  1JI8 A;  3OOU A;  2X1C A;  4DIQ A;  3CES A;  4KT6 A;  4RLF A;  3CP2 A;  4PSX A;  2LRD A;  3FKJ A;  3DPL C;  2VLA A;  1IRX A;  4BJT A;  4YRV A;  4BQO A;  3V42 A;  4AVZ A;  1YX3 A;  2ZSH B;  4ANJ A;  2XDV A;  2WY8 Q;  2R7O A;  2XF5 A;  4B48 A;  3L2V A;  2CS3 A;  3PSF A;  3PJR A;  4CUG A;  3BLY A;  2XF7 A;  2V7F A;  4R79 A;  2F5V A;  3VYR B;  2XF6 A;  2IGK A;  2VXD A;  1DQU A;  2CUJ A;  3OYG A;  4IZZ A;  3HUG B;  3CZ6 A;  2WAF A;  3IAM 2;  4XN3 A;  4G6T B;  3DLA A;  3LSG A;  4II3 A;  3FBN B;  2HNH A;  2W1O A;  1Y56 A;  3FDY A;  3QYF A;  2VPL A;  3FHN A;  2CUZ A;  2KMU A;  3J7A Y;  1U0J A;  2V9K A;  4HST A;  3OMY A;  4BJ5 C;  3EUA A;  4RMN A;  1UG0 A;  5CPR B;  2KDO A;  3OS2 A;  1DP3 A;  5CKT A;  2VJ5 A;  2P0W A;  2VJI A;  2L9N A;  3ZQQ A;  4CCM A;  2X6X A;  2KZV A;  1R6R A;  2X1E A;  4E7S A;  2MD0 A;  3E0J B;  1TZL A;  4HPQ A;  3K4C A;  3EPZ A;  2LH9 A;  2V26 A;  3DKY A;  4P5O A;  3CJR B;  4RM2 A;  1LDK B;  2VQC A;  2X85 A;  1J09 A;  2VXZ A;  1P9Q C;  4F91 B;  2V6E A;  4C2U A;  1D1B A;  4PJL A;  5HVQ C;  3L2U A;  3M1C A;  2M7A A;  3NWS A;  4NC8 A;  1D1A A;  2F4I A;  3S8P A;  3AL0 B;  2KL4 A;  3DTE A;  2HVQ A;  2X6Y A;  4F52 A;  3H9J A;  2AQF A;  2MAB A;  1Z7L A;  1LFP A;  2LBF B;  2M4G A;  3LMM A;  2VB6 A;  3HOT A;  4U7B A;  3SEQ A;  4II2 A;  3LSM A;  1X1C A;  1WJE A;  3D5S C;  2KHM A;  4XQF A;  1X4P A;  3RSN A;  4NC7 A;  1SAU A;  1TT0 A;  4KIT B;  3OYN A;  4HSR A;  1AA7 A;  1X1B A;  2CMP A;  4BJ6 C;  4FET A;  3DWL E;  3H5N A;  3BCA A;  2LG4 A;  4N4O B;  3LSK A;  3OIQ A;  2WAQ A;  5HLT A;  4IQ4 A;  4BU2 A;  4XM3 A;  3OYF A;  2VIX A;  1Z21 A;  2MC4 A;  2VQL A;  2R7X A;  2L2O A;  5KHD A;  2M0M A;  3C2G A;  2E60 A;  4F55 A;  1LKX A;  3RCO A;  2JA2 A;  2WA0 A;  4LIV A;  3IUO A;  3K10 A;  2K9L A;  2R7S A;  4Y3O A;  1MMA A;  1W36 C;  4BAC A;  4BE2 A;  1EA3 A;  3LSI A;  1N75 A;  2NOJ B;  3IP4 B;  5LFA A;  3HPH A;  3OYL A;  2O5R A;  3DTK A;  3HKZ A;  2LOO A;  2LY1 A;  2L5Q A;  2X6W A;  4HRI A;  1ZEL A;  1WJD A;  3W2V A;  1S9H A;  2HPI A;  4RM3 A;  3OYD A;  3VDX A;  3VYT B;  3BCB A;  4ITV A;  4D1Q A;  4BXF A;  2KP6 A;  4JQF A;  3S3M A;  4XOR A;  4B44 A;  3MKW B;  2PJR A;  2R7V A;  3HL2 A;  2W00 A;  4XON A;  2Z16 A;  3HC7 A;  1PJR A;  2RNG A;  3W2A A;  1HA8 A;  1OR7 C;  3K4K A;  2IS2 A;  3OYH A;  4OWR B;  3TL4 X;  2LRE A;  1WJ5 A;  4ZTJ A;  1WJF A;  4E4H A;  1WJA A;  3AL0 C;  3H9Q A;  4E7K A;  3D5L A;  1QHG A;  4XKC A;  1DGW Y;  2BVL A;  4E7J A;  1D0X A;  2BOL A;  2WBM A;  4PJN A;  2BW3 A;  3FBI B;  2RRE A;  4PJJ A;  3PFY A;  3ZXS A;  4CCO A;  2CV2 A;  2CFO A;  4B3X A;  4XKW A;  3H35 A;  4IQJ A;  2A6T A;  3SDB A;  1FMV A;  4QPO A;  2CV0 A;  3PNT A;  4PK4 A;  1X19 A;  3CP8 A;  2HVS A;  3ONQ A;  4ZDO A;  3CJQ B;  2DT6 A;  4BS9 A;  2WAD A;  4OAY A;  3BG6 A;  5FRO A;  2F6C A;  4KJZ A;  2VL8 A;  2OV7 A;  4CZC A;  3TMO A;  4D9J A;  4XKB A;  2HPM A;  3K4L A;  3QOD A;  3OYC A;  2ZFU A;  3LFU A;  3A4C A;  3K70 C;  2IXS A;  1V5G A;  4ZDL A;  2KRH A;  3HXL A;  2R4G A;  2VJJ A;  3I9V 2;  2JVG A;  2VQH A;  2LC2 A;  2XSJ C;  3QYE A;  4C2T A;  3H0D A;  4CSW A;  3VWB A;  4XLC A;  4BL0 B;  1ERD A;  4Y4R A;  4NQW B;  2E5Z A;  4LIU A;  2M3A A;  1V5E A;  3MKZ A;  4BDY A;  4Y33 A;  2KRC A;  4HNT A;  1K6Y A;  2MFZ A;  3H9G A;  2HVR A;  2GOM A;  2M7B A;  3C2H A;  1N77 A;  3ZGK A;  4IX7 A;  2IS6 A;  2R7R A;  3RQ4 A;  4PFO A;  5HNF A;  2JUG A;  2IGO A;  3MKY B;  3DKX A;  3A1Y A;  2I8D A;  4H4K C;  2QKM B;  4EAT A;  3CF2 A;  2A5W A;  3S3N A;  1D0Y A;  3OR2 C;  2ZXI A;  4FAS D;  4XLH A;  4BE1 A;  3K4B A;  4ZC3 A;  4PSW A;  2PJR B;  3IAS 2;  3NWT A;  3ZR8 X;  1QU3 A;  2HQA A;  3HOS A;  5LD2 C;  4P1W A;  2XAU A;  3F9K A;  3W2W A;  5HOO A;  3TBI A;  4DOZ A;  3RPU D;  3AKZ A;  2QKL B;  3OYB A;  4BGD A;  3OYA A;  3DTI A;  4PUS A;  3DPU A;  1WJC A;  3M8J A;  1BR2 A;  1MMD A;  3L2W A;  4IKF A;  3ZRG A;  2K5C A;  2R7W A;  4HNU A;  3DU5 A;  1FMW A;  2BW3 B;  2LYC A;  1WFX A;  4BEH A;  4BQQ A;  4J00 A;  2R7T A;  3SYT A;  5CQG A;  1W36 D;  4XLF A;  1T0F C;  4OAZ A;  2OUM A;  2HZD A;  3KX2 A;  2UV1 A;  4DBQ A;  4YEL A;  4F93 B;  1G59 A;  2E1M B;  5FRN A;  2ZSI B;  3OY9 A;  2ELJ A;  4HEA 2;  2L7K A;  3LL7 A;  1D0Z A;  3OR1 C;  2RQQ A;  4NNJ A;  3QOE A;  2R7Q A;  2XC7 A;  3MD2 A;  1BR1 A;  3OS1 A;  4YEJ A;  4E7H A;  3EUK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...