4C9YA

Structural basis for the microtubule binding of the human kinetochore ska complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
SIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords SPINDLE AND KINETOCHORE-ASSOCIATED PROTEIN 1
publication title Structural Basis for Microtubule Recognition by the Human Kinetochore Ska Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1890 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4c9yA00
4CA0A 2LYCA 4C9YA
chains in the Genus database with same CATH superfamily
1BIAA 3ZGKA 3BJOA 3FWEA 4CYCA 2M0MA 2Q2EB 2OTLI 1P4WA 2R7RA 3L2VA 3BWGA 3FXOA 4ESJA 1KU7A 2KZVA 1F36A 2QM3A 3DTEA 2W24A 3ZQQA 3VYRB 1SD7A 2O6GE 2GOMA 3KEYA 2EFNA 2A61A 1HKTA 2V1UA 4UUVA 1U9NA 4YRVA 3S93A 5CKTA 3CP8A 1ZLKA 1O4XA 5IT3A 1R58A 4LG0A 2JPBA 4IOAF 4WCGA 3T0YA 2VXDA 4ZDOA 2JT1A 2QF7A 5ED4A 3G3ZA 2EZKA 4LMYA 3W2WA 2XF5A 1XGOA 3G1MA 5F1JA 3EDPA 4AIKA 2OA4A 4XLAA 4BU2A 2GXBA 2XSJC 3UKGA 2XAQA 2VASA 2EQRA 2R7XA 2X1EA 4AUXA 1KU3A 1QPIA 1DPRA 4PUSA 4KFCA 4HSTA 2K3FA 5J8CA 1X4OA 1X3ZB 1S8NA 3ZN0A 5HS7A 2FBIA 3MAJA 4IF4A 1Y6IA 3WU0A 2Y48A 2XIGA 3L09A 4PJ0C 3LFUA 4P5OA 3PSFA 3OYEA 3IP4B 4HX8A 3L9FA 4DYQA 3TW6A 3EUHA 1B72B 2NNYA 3AG3H 1ZG1A 2X48A 1KA8A 1X3WB 2VJJA 5LFAA 2JZYA 3GUDA 1KZHA 2R0QC 4ZH4F 3HOZJ 2XAUA 2NYXA 3CCUI 2ZMEA 1R36A 3MMYB 4FTHA 4G94A 1R22A 4A0YA 4M6YA 3DPTA 1XB4A 2RVCA 3QOEA 1ONVA 1XN7A 1BW6A 2Y0MA 2BBYA 3CMYA 2RQQA 1R4MB 2FA5A 1VTNC 3EPZA 3PL8A 1K6OA 4X0GA 1BR1A 4RAGA 2RNJA 4PGGA 3IL2A 3JR9A 5D6FA 4L9VA 4NC8A 3RYRA 4A93J 3H1CA 2AXLA 1XSDA 3HC7A 2WV1A 3AFHA 4G6TB 3OYIA 3S2HJ 3H9QA 3WTXC 1V5GA 3DU5A 2VUMJ 3VODA 4HRIA 3LL7A 4U87A 3J7ZI 3BPXA 2IT0A 1RPWA 4HNVA 3JREA 3FF5A 1ZK8A 3I64A 1U5TC 1OJLA 4HSRA 3HOTA 1OCPA 1ZR4A 4A3FJ 2WAQN 1R1VA 4PCQA 3E6BA 2STWA 1QVTA 5CQEA 3A0HC 2KDZA 3ECOA 1Y39A 1P9QC 2QQ8A 2DA1A 4F52A 4LB5A 4RB3C 1X2MA 1BI0A 5JLWA 3BG6A 1ZLJA 3JRHA 3GFLA 3HOVJ 4ZYGA 1IGNA 3KP5A 1GXPA 1XS9A 5DUKA 5CJ9A 1D5YA 1PYVA 3A1YA 4FE7A 4YIRX 2W1OA 1JHFA 3OL4A 3ONQA 4I09A 4C2UA 1S3JA 1BR2A 6PAXA 2VXZA 3TO6A 4F93B 4PZJA 1HDDC 1SVMA 1YQAA 2Z5UA 3DKYA 3WG9A 4B48A 1YS7A 4I7HA 1MZBA 2BHYA 1MMAA 1USTA 1MDMA 3QODA 2B0LA 3CJQB 2R7DA 3K2ZA 3PSIA 4N9IA 3MKWB 2DA2A 4HF1A 2DA7A 3MWMA 5BMZA 3CQZJ 1IO2A 1RUNA 3HGYA 2Y75A 2RC4A 4MGRA 2DLLA 2DOFA 2WB1N 2ZFUA 1MSEC 3RKWA 3CUOA 2JPCA 1OYWA 2FOWA 2H6BA 1YIOA 1YJWI 1J2XA 1RR8C 4ZYHA 5F64A 3K1MA 2ID6A 1UELB 3IUOA 4QWQA 3WGHA 1QRYA 1VZ0A 5LHHA 1G3YA 1YRNA 4KN4X 3DQVC 2H8WA 4AM3A 4DIQA 3DFGA 3F6VA 2O7OA 4HDVA 1IN4A 3GO5A 1UJ8A 2MC4A 2IA1A 2P5LC 1I3QJ 1ON2A 1T0FC 3TGNA 2ME6A 2E1MB 3H92A 4CCLA 2VPLA 2Z99A 5JVGF 4DZJA 4EJVA 1LQ1A 1OCTC 2O9LA 1R5GA 5EF6A 4XLNF 4UNOA 3TP0A 3ZMVA 2OUMA 1T95A 1A35A 3BR3A 2H09A 2AQFA 4W1UA 5DS9A 2L7ZA 4CICA 4NQWB 1L3LA 2PJPA 1FT9A 1VI0A 1BI3A 4BQNA 3F3XA 3QOPA 1IV8A 3CDLA 4XSZF 4LK1F 4L0ZB 4BE1A 4CA0A 3MD2A 2EZIA 2DMQA 5DTDA 1SFKA 2ECBA 3ZOBA 3EYYA 1RETA 1B9MA 3OR2C 1FBQA 4XONA 4M3FA 3LQQA 5ICEA 5A2QZ 1R00A 4BJ6C 1ZRCA 1QBJA 2PI0A 2M9HA 2HVQA 2WBMA 3DTKA 1JKQC 1H8AC 1IRFA 4A69C 3S14J 1S9HA 3NWTA 5C4JJ 3LSIA 2A05A 4HA8A 3LAPA 5K7ZA 4OINF 3PIOF 5KAFC 1A31A 2HPIA 1ENHA 5JVTA 2FF4A 2ELHA 1IC8A 2XAGA 1HLVA 3BTJA 5BOXA 3CC2I 5IOYA 4BDYA 1QHHD 1SAUA 2HQAA 2VIXA 1IG7A 2JMWA 3E7LA 1V54H 5D5VB 4BL0B 4XLHA 2DYSH 1E3HA 2HQRA 5D5WB 1HQCA 2NNNA 3ZMTA 1AU7A 1WJDA 4XR6A 4V19K 2LLKA 4BKXA 4M9SA 2FU4A 2E34A 1ETOA 2K5CA 1GVDA 3ZQCA 3DKWA 4U0WA 3E5QA 3T8TA 2FX0A 2LKXA 4BY1J 1LFUP 3RKQA 3HUGB 4J00A 2IS2A 4CYCB 2G9WA 3HEFA 4EM1A 3B02A 4RGRA 4IPAA 2CRGA 5DCFA 3WTTC 4MEYF 5GTHC 1T38A 4ETSA 3QU6A 1R7JA 3ASNH 3S1MJ 4JQFA 1SVLA 5FFZA 4KMFA 1Q1VA 3K4CA 1K4TA 3K4LA 3VSLA 2R5YA 2IGKA 4KT6A 2YPRA 1X1AA 3DPLC 3HRMA 1B6AA 3F21A 4LG0B 1J5YA 5HODA 1MBFA 3GLLA 2PMZA 3DEUA 3IV5A 1V5EA 2GOXB 2WAQA 1SFOJ 2OCEA 1FEXA 2CUJA 3Q0VA 4LFUA 4HLYA 3TOBA 2IS1A 3S2WA 3I56I 5F0CA 1QGPA 1FLIA 2QYOA 2VE8A 3FXJA 4ZYEA 2Y2ZA 3N97A 2W4SA 4A3JJ 3I71A 3SZGA 3RPUA 4ESFA 1VQ8I 2VQHA 2F4IA 5FLMJ 2XROA 1TL8A 3BG7A 1Y8QB 2YX4A 1F1ZA 2CFOA 3KP3A 4YEJA 1TQPA 2JA7J 2E60A 3PUFA 3G4SI 3CMAI 2XAFA 2E71A 5EJCA 5K5OA 4Y3OA 2XPVA 2QGUA 3HTSB 3HHHA 4MQVA 1F5TA 3BQZA 2LYCA 4GO1A 1UHSA 5DCMA 1S7AA 1EH7A 4XKVA 4XRFA 3GVAA 1BN5A 1G3TA 2P4WA 3HRUA 1FZPB 1P7IA 3ZN1A 3HRSA 1NG6A 5HNHA 2WB1A 2DTZA 4HNTA 4HX4A 4D1QA 2MYSA 4DYRA 5L3EA 2EFPA 1G8XA 2QCOA 3W6VA 3Q9SA 3A01B 1BI2A 1W5SA 2Z3YA 2JUGA 1U9OA 2XGCA 4BJ5C 5LGNA 1SVOA 2GZWA 1P6RA 3N05A 3SHFA 2RDPA 1IF1A 2ID3A 4O6JA 2JA2A 1X58A 3U1DA 5K5QA 1K78A 2HYJA 4FISA 2BY1A 2R5ZB 3ZMDA 5K7FA 4CGZA 3ABUA 4XKBA 2D5VA 3F0CA 3P9KA 4DW6A 3FZVA 1B72A 4IRGA 1N77A 4IVNA 2BVLA 1F43A 1FOXA 2MH9A 1FIAA 1MH3A 4G8XA 4GYGA 2VT2A 1SEUA 1ETXA 2VKDA 4XLCA 1OPCA 2ZO4A 4JBAA 4XORA 3AL0B 3R0AA 3EYIA 3J7AO 1YOVB 4PFOA 3CO7C 3JTGA 3H5RA 1D3YA 1RC9A 2FNPA 3QQAA 4WXCA 5FROA 4LLLA 1WJBA 2CW0F 1R23A 1IUFA 2Z2SB 5BQTA 4OAZA 2LREA 4EQQA 2R7ZJ 3N4MA 1STZA 2ELJA 3G1LA 1J09A 3FIWA 1Y56A 3KIOA 2TCTA 3DLAA 4M72A 5D4SA 3OYGA 3JRBA 1MD0A 1RKWA 2MG4A 2CO5A 4CO8A 2XAHA 1YTYA 1FX7A 4YFNF 5BPDA 5DM7F 1MDMB 5DEQA 4S0HB 4QPOA 1IRZA 2DW4A 1ZRDA 2YU3A 2DMPA 1FMVA 3ROUA 3FX3A 1LEAA 3B6CA 4PSWA 3RIRA 2F5VA 2IA0A 2KFDA 1Z3YA 2V9PA 2HNHA 3BG5A 4FT8A 5FD5A 3BR5A 4A0ZA 4A5NA 1OLTA 1EV7A 2K86A 2K27A 3RYPA 3CJRB 5GPAA 1E0EA 2XAJA 1OR7C 4RGUA 1WJEA 2P5VA 4BHCA 1BL0A 4YIIA 3JTHA 2OQGA 2X6OA 1LDKB 1YRNB 4FASD 3FK6A 4LGWA 2DBBA 5GAHJ 4GRIA 1X4PA 3PO3J 2V6EA 2D1VA 3A03A 1D0YA 3HKZA 2M8EA 1P2FA 2A3SA 1G3WA 2PFBA 5B1AH 2CQ7A 3PNYA 2W82A 2K9QA 4IOCF 2L01A 2IJLA 2FOKA 3VDXA 4IHVA 1O3TA 1O57A 2A6HF 3CJNA 1S29A 1LKXA 4U7DA 4B44A 2RQPA 4IQ4A 1WWXA 3CLOA 3GFJA 3I4MJ 1N78A 2EV5A 4ZTJA 3LOCA 1WH5A 2QQ9A 2O3FA 5CVUA 1G3SA 1PVEA 2NVTJ 3BZKA 4GDFA 1HSTA 1E3PA 5KNLA 1U8RA 2CW7A 2XSDC 1FWZA 4XIDA 1TWHJ 3KETA 4E7IA 3KZYA 4AVZA 1O3RA 4F55A 5KVRA 1T08B 4S05A 4XN0A 4IO9F 4FQGA 2KHMA 4L5JA 3VOEA 2NS0A 2UV1A 3TQNA 5F0FA 2HGCA 4CCOA 2JA8J 3L2CA 4C2MJ 1Z7UA 1R4NB 2IVMA 1U3EM 2P7VB 5C4XJ 1GLNA 3OYDA 4HZFA 3IC7A 3IAS2 4XQFA 5J4YA 2Y0SN 5FRMA 2MW8A 3FXKA 4E70A 1OKRA 1WKMA 2BXYA 2QSHX 2ISZA 4BNCA 3PNTA 4B8XA 1D8JA 2I8DA 4NQWA 3OV8A 2QVOA 4A6EA 1XGSA 2EBIA 1MIJA 3TOAA 3ERMA 4V2FA 3GXOA 4EV0A 1MNMC 2LVSA 3NARA 3HYIA 1DDNA 3LSJA 4QPQA 2P7CB 2BHZA 1LVKA 3K7AJ 2Q0OA 1ETKA 3P7NA 4G7ZF 4HW0A 4Y17A 4C2TA 2W00A 5IT9Z 1ZQ3P 2DQLA 4HV6A 5IYBJ 4EM2A 2NOGA 5LBQA 3J80Z 4PJNA 1JTXA 3W6KB 3DCFA 2ZJPF 4A3IJ 3S1NJ 2HYGD 4P55A 5GAGJ 3OS1A 5DD4A 5HOOA 3ABKH 1K79A 2O5RA 1ZH5A 3C2BA 2QBYA 2HYFA 2M7AA 3GTGJ 4G7OF 1ITYA 4B09A 5E1ZB 2L9RA 1H9GA 1QZEA 1ZKGA 4G12A 1ERDA 1JKOC 3R0JA 3DEEA 3CP2A 2KDOA 1J59A 3ZQFA 1IN7A 1IAWA 1R5ID 1RIOH 5J6XA 2YS9A 1Z9CA 1GV2A 2VI6A 2ADUA 2VC0A 4E7SA 1LJ9A 3R60A 3KE2A 2ZXWH 4D5FA 3H9GA 3L2QA 4II2A 4UB8C 4F7ZA 4ZDLA 4II3A 2CU7A 3HUGA 1FY7A 3E97A 3E3VA 3CLQA 4R8HA 3RKXA 1WQ2A 2OQRA 3FMRA 2DJNA 4OIRF 4BDZA 4WXDA 3ABTA 4LIUA 5E1XA 2D2WA 3BCAA 4L18B 3MEXA 1TTYA 1AOYA 2PMUA 3GTJJ 5J1YA 2Q1ZB 4HAMA 1XSVA 2CYYA 1IXCA 3ZP5A 1VQOI 4UUSB 3FHNA 1R1TA 2L9SA 3WTZA 3TBIA 3CMMA 1Y1WJ 3C18A 2JWTA 1HSJA 4IL6C 3VWBA 4KT5C 5LRRA 1OQYA 2CQQA 4HOBA 2YUSA 4BUPA 4M71A 4IQJA 1X19A 5DCMB 1OCZH 3I53A 5GPCA 3PM1A 3S17J 2Y31A 2WAEA 1G4DA 4GXOA 2XVCA 4I0AA 1XGMA 2XDVA 2B9SA 3CCEI 3LMMA 2D1HA 2UXXA 2WA0A 3PO2J 3BCBA 3SFZA 4DOZA 3F6OA 5FKKA 4HDUA 3LAJA 5C44J 4NC7A 3OS0A 4M6VA 4UXNA 2JVHA 3LSMA 4KDPA 2LY1A 2FD5A 4OIPF 2QWWA 2BW3B 1UFMA 5FKMA 1R49A 3F8BA 1UG2A 2R4GA 3RJPA 1K78B 4IHTA 1USSA 3QPSA 2D45A 3I0TA 4TV7A 2E2JJ 3JSOA 3R61A 4D7MA 2PQ8A 2NRAC 3BJAA 3HGGA 2KMUA 2M4KA 3BG3A 4A3KJ 3Q0WA 2R92J 5TRDA 1LE8B 1FP2A 4C3HJ 4HQEA 1HA8A 2TDXA 1DQUA 2VBYA 4HV5A 3KZIC 2ACJA 2L7KA 2LP0A 1HXDA 3PFYA 4KITB 3H3VK 2ZB9A 1DU6A 2R7QA 2BXZA 2AS5F 1IV6A 5FO5A 1SD6A 4MO7A 1F4KA 1MBGA 2VQCA 1QPMA 2J5OA 2P6TA 5FJ8J 1ODDA 3A01A 1FJLA 3CCYA 3CDHA 4ANJA 2CV2A 2CW8A 3CCMI 3HSFA 4Z2YA 1S7EA 3DXJF 3CD6I 1QVUA 2X6XA 5AIQA 2JSPA 4RA2A 2ELKA 2R5ZA 2NVUB 1Z3XA 5HVQC 3CC7I 2ISYA 2VONA 3RQIA 4L5IA 2NS8A 4HLXA 3QPTA 5E8IA 1TW3A 2BEOA 1MBJA 3NQOA 1JT0A 1YIJI 3NRVA 1VF9A 2TRTA 4D9JA 3OYMA 1MMDA 3CF2A 4BEHB 2KZGA 1ETYA 2OF7A 3F8NA 5B5EC 3KYLA 4G6QA 3SJMA 2QLZA 1QA6A 2OC6A 4L9NA 2Y0SA 1VQ7I 3P9IA 4CDGA 2X51A 2L54A 4F3QA 3HSRA 2LTPA 4EMSA 3IKTA 2RKHA 3BLYA 1VQ6I 2JTVA 5FLXZ 3RPUD 2J5PA 3H0GJ 1W5CC 4CZCA 1H89C 3G6EI 3HOWJ 1XDUA 1KU2A 2XPWA 1NTCA 2OZUA 2CQNA 1A6IA 4RB0A 5K7HA 4LITA 2Y69H 1Z67A 3C7JA 1UCRA 4RGXA 4X6AJ 2DDAA 3TEDA 1OCCH 5BPIA 1TQMA 1QZZA 2AHQA 4L5EA 2JA6J 2HS5A 1TWAJ 1R5HA 2KLOA 3BROA 2ZMEC 4EM0B 4MTDA 2E1NA 1HDPA 3K69A 3S1RJ 3VFZA 1VQPI 1ZR2A 3E6MA 2GBYA 5LEJA 4BXXJ 1EJ9A 2ESHA 2BVMA 4KA4A 2DOEA 1Z77A 1YE9A 3K1NA 3WTUC 2P81A 5E79C 5M5XJ 1CQTA 1T2KA 4G7HF 1FNNA 4UVAA 3K2AA 2XKOA 3GTOJ 3MN2A 1UHMA 1YO5C 1JGGA 2EIKH 4MEXF 1RESA 3IH4A 1WCMJ 3FHZA 3JRAA 3RCOA 1XG1A 4F91B 1VQKI 1HCRA 2K3PA 3F72A 3FXQA 2XUBA 3VEPA 3WTVC 5EEHA 1OFCX 2X6YA 4R1HA 5CVJA 2K4JA 1JKRC 3D5RC 2HPMA 1FMWA 1TW2A 3H36A 3K4MA 2YR2A 3GWZA 2XF6A 4M3EA 4GFBA 4PDKA 4MIMA 2HTJA 2W7NA 3S32A 3GTLJ 1MMSA 4EGZA 3Q9VA 1G6NA 2LKSA 2HOSA 4ENMA 2LK2A 3ISPA 1MNDA 2HQ5A 1QO0D 2M5WA 4ZC3A 2WAFA 3DV8A 2LBFA 2OJED 4RB1A 1IXSB 5ILUA 3M7GA 2L4MA 1U0JA 4NC6A 5GADJ 3F23A 4H4KC 5A2QK 3M07A 2STTA 4ON0A 1G59A 1O3SA 3WE2A 3QYEA 4AC0A 5JR3A 3CUQC 3QP6A 2PJRA 1I6HJ 2M87A 3DWLE 3H9JA 2KIFA 3DF8A 1SD5A 1WZ2A 3I9V2 1SFEA 1ZREA 4DBQA 5K5RA 4B3AA 2B7EA 5HLGA 4NDLA 1MH4A 5FKLA 5BNGA 3F22A 3JSPA 5KCMA 2DU9A 4A6DA 3F8CA 3JRFA 2EV6A 1OISA 2V9KA 3H35A 1O7LA 3OYHA 2F5CA 2AO9A 2ME0A 2QBYB 1QZYA 2VB6A 3V4GA 2Y9ZA 2KIQA 5LEKA 2NVXJ 1MNEA 2FBHA 1ZAOA 2DMUA 2PMHA 3CTAA 1UG0A 3I4PA 1TT5B 4WX9A 1IDYA 3FK7A 1LUJB 2CUZA 1EH8A 1LVAA 1RNLA 4C30A 2OD5A 4XKWA 5F04A 2P0WA 4JX6A 4BGDA 2MA3A 4LB6B 4EATA 1I3AA 1V4RA 1IN5A 3JRCA 1Z21A 1XD7A 2RNGA 3SQNA 3DBLB 3V8JA 2HZDA 2KRHA 3SXYA 3GZNB 3UR3C 4AIDA 3QRFF 3GFMA 4IX7A 1TC3C 4RAYA 2HR3A 4YFKF 3HZJA 4G6DA 2WY7Q 1D1CA 1TT0A 2DFHA 2HXOA 1T98A 2E5ZA 1K4SA 4OU0A 1SC7A 3A2KA 2MLGA 4CSWA 1RI7A 4KIFA 4XK4A 2EILH 1IRXA 3H5AA 2XHKA 4RGSA 3FM5A 3DBHB 1U6GA 5IY5H 5HNFA 2OPTA 2FSWA 4GGGA 3GX4X 2BZTA 1JI8A 1JT6A 3OOPA 5BS6A 1IRGA 2GAUA 4XBFA 5JHUA 3JCUC 1IN8A 3BC8A 2LH9A 5GP9A 4J19A 3E0JB 5EGOB 2HDDA 3S3NA 4QLCU 2O03A 5J4VA 1XTAA 3OL3A 3ZPLA 3S3MA 2HU9A 1W5TA 1A04A 3KP4A 4XICA 3G71I 1U78A 4B3XA 1W36D 3OS2A 4IHSA 2ZC2A 2IAIA 2ZXJA 3FKJA 4BJTA 1Y1VJ 2CQKA 2FUG2 3P9CA 3PFIA 5LGTA 2FMLA 3IWFA 2B63J 1I6XA 4QTRA 1U5TB 2VKVA 2LMDA 2X1DA 3RSNA 1JJ8C 4M3DA 3AG2H 3I3LA 4UUSA 1MW7A 4CCJA 4KMUX 1YYVA 3H0DA 2EFQA 3NEUA 1OCRH 5H2FC 3RTRA 1NK2P 1JGSA 2ZNZA 1ZTRA 1YI2I 1WSUA 3ZQ7A 2HKOA 2QSFX 1E3OC 1MSFC 2XF7A 4HNUA 3HOXJ 4XKCA 2WADA 1FTZA 3CESA 1P4AA 5EG0B 5CVIA 1LNWA 1K61A 1X3UA 2PG4A 2VKEA 4XOPA 1WHUA 4S04A 4BBSJ 1W4MA 3S1QJ 2OTJI 2CS3A 4G9YA 1HF0A 1I1GA 2HDCA 3HL2A 2BY3A 2R7OA 4BACA 2QEXI 2L4AA 3WGIA 3BPVA 3COAC 1PDNC 4IHXA 4UVCA 4IHWA 4QSHA 3BR1A 1CF7B 2H1LA 2XB5A 2F5FA 3LFKA 1IDZA 2BW3A 1TNSA 2F5EA 1FIPA 2ZSIB 3AG4H 3ZMZA 2K9NA 3C3WA 5JFRA 4BS9A 3LWFA 1BOAA 4JK1X 3V7RA 1O7FA 3FXRA 4ZYDA 3VB2A 3G73A 1U8BA 3WTSC 2L5QA 2DYRH 1I39A 2MH2A 1P4XA 4AWXB 1FBUA 4M9ZA 5D4RA 4LIVA 1LE8A 5FGMA 5DDGA 1N75A 3RDIA 1RR7A 2XGDA 2GLOA 3O8GA 1A5JA 2K7LA 3H3ZA 4OMYA 1M1EB 2DTRA 2W84A 3BZ6A 3GEZA 1ZYRF 2K9MA 2A5YB 2NVQJ 1NH3A 2M3AA 3KP2A 1WGXA 4B1RA 5M5YJ 3LNQA 2HDWA 2ZNYA 2DPDA 1H88C 3OIPA 4EGYA 2K9SA 1SMYF 2CH0A 4EJTA 1BIBA 1Z05A 4ITVA 4RLQA 2WY8Q 5IP9J 5LHGA 1I5ZA 1FSEA 2ZBKA 5GAEJ 3I55I 1W0TA 2VPRA 1APLC 2DT7B 3FM3A 1XMXA 2MD5A 3I59A 1ZGJA 2WV0A 4ESBA 1PP7U 2CWEA 3ZQGA 1SAXA 2AQEA 3K4NA 3QYFA 3U9GA 3KEQA 3BTLA 4KJZA 4BEHA 4MQ9F 2ETHA 2ECCA 3OIQA 3LSPA 4BQQA 2H6CA 1Y0UA 3BY6A 5ICGA 2VQGA 4KIGA 1YS6A 2LY9A 3HOUJ 3S16J 3CJTB 2FE3A 2HZTA 4BY7J 5AIPA 2LDUA 3Q0UA 1LFBA 2EK5A 1JHHA 1KQ8A 1ETWA 2DOAA 1OYYA 2KIMA 3NWSA 1Q1HA 5IPAA 2JK3A 4P1WA 4IXAA 2A5WA 3GTKJ 1PUFA 1SD4A 2LY2A 2OZ6A 3ABMH 5IYDJ 1J9IA 2FBKA 4I98B 3O3KA 5DYMA 4YIFA 1MBEA 1FOWA 2FMYA 2ZJ2A 3CF5F 2EFWA 2JQ7A 4XLEA 2HEOA 3CCJI 1YHQI 3BR2A 4GYIA 1D1AA 1ZGWA 5CLSA 2GXGA 2ZJRF 3A4CA 4XM3A 2XGXA 5J8FA 3J7AY 2OV7A 1EA3A 2ZXHA 1Y8RB 2VT3A 1WJ5A 2L02A 5JHFA 2LF8A 2LBFB 2PLYA 3C1DA 2JVGA 1V3FA 2ZCWA 1KU9A 3K4BA 3OR1C 2JSCA 1MMGA 3WU2C 4K2EA 3RQ4A 5M3FJ 2DK5A 2XV4S 4CXFA 2MGQA 2PJRB 3K9TA 4MFDA 3KCCA 5LRSA 1GV5A 3LA7A 3CCQI 3D1NI 4IKFA 3DKXA 2DDBA 1QQIA 4OIQF 1UZCA 1HOMA 3ZQLA 2EA2A 3I4NJ 4DJAA 1GUUA 1JXSA 2DMTA 2W85A 2CG4A 1TWGJ 4MLOA 4PSXA 4PJLA 1HW2A 1QU3A 2GXAA 2E7WA 5ICFA 2N8GA 2FQ3A 2Z33A 3GTQJ 4AIHA 1HKSA 2QQBA 2DJIA 2CMPA 2VC1A 2NVYJ 2IRFG 4LLNA 1JUSA 3ZMSA 1MJBA 4N4OB 5L3BA 1XCVA 3TDZC 5DUIA 2BGCA 1NHAA 4W97A 3S8PA 1I27A 3U1KA 1MBKA 2CGPA 3MQ0A 1C0WA 4H0EA 2YX7A 3HXLA 2P8TA 2LNBA 2XGEA 3BR0A 1XC5A 4OOIA 5IT9K 5F27A 1MJ9A 1YX3A 1YLFA 2A68F 3UNGC 5IP6A 1QHGA 3SYTA 3TDUC 4A12A 4BBRJ 3J80K 1VQLI 1YX5A 4D5CA 5M3MJ 2EIMH 1J7KA 3K1PA 4CCNA 2DT5A 5LD2C 3ZQIA 4I01A 4LG3A 3TKYA 3JRGA 1VFCA 4BQOA 3HB9A 1YJNI 5EZGA 4JOMA 2FRHA 3OYLA 4RAZA 5EZHA 3JW4A 3MFKA 3KX2A 3QWLA 3HG9A 4E6KG 3TP3A 4HQMA 1XPXA 2R7SA 1ORKA 2PEXA 2LFBA 3PQJA 5FD6A 4IEJA 3IHUA 4A3MJ 4KICA 5DD8A 2F4OB 2GQQA 3DTIA 5F6FA 1RZ4A 3ZXSA 1W0UA 2VOPA 3K10A 1B4AA 3L7WA 4KNYA 3FMQA 2UUZA 2L3DA 1JJ6C 3B73A 2MSYA 2HXIA 5CQGA 3KYDB 2F48A 2V1DA 2LSOA 3FXUA 2G7HA 3RKYA 1VQ9I 3BG9A 2CQXA 3JAMK 1LB2A 2IPQX 2V1XA 1AWCA 2E1MC 4KYWA 2A6TA 4HF0A 1MGTA 1FP1D 4E4HA 4FHTA 2NS7A 4RB2C 3TO7A 3LSGA 3JAMZ 2KRCA 4A0XA 4P9UA 1J75A 1BC8C 1ON1A 2PBIA 4KIBA 1Z6RA 1LPQA 5KAIC 2QKMB 1X2NA 3KLNA 3DLLF 1KYWA 1UMQA 3OWTA 3JRIA 3IWZA 2MC3A 1AKHA 3DBRB 1H0MA 2DAOA 2H94A 4OMZA 1SFXA 3H3UA 2NAZA 2NOJB 1WH7A 2DFEA 2M45A 1R71A 5L3DA 3L2RA 4M6XA 2KIUA 2EZHA 1IZ1A 1R9TJ 1JKPC 2M0CA 2K85A 2IGOA 1TLHB 3QAHA 3V8LA 3B6AA 3OSGA 1ZHFA 4OAYA 3BDDA 1LDDA 3BQYA 3T8RA 5EGOA 2QKLB 1BOBA 3SDGA 4A3DJ 5H6RA 5AONA 1DP7P 2LKPA 3AKZA 3RZDJ 1ZG3A 1BM9A 1WFXA 3VPRA 2QSGX 5D8LB 2VJIA 2COMA 1A36A 1X1BA 2Z9OA 2Z1DA 2V26A 5DM6F 4I99C 3E5XA 3HIFA 5IYCJ 1WI3A 3WG7H 4A2UA 1S6LA 2DT6A 5ERIA 2V4JC 5F1RA 1KGSA 1U5TA 4HF2A 4JYKA 5LGUA 2XC7A 5FB2A 2EB7A 1DGWY 1DU0A 1W7PB 3BOQA 2XRLA 4XL9A 3QPHA 3K4JA 1XSXA 4RLFA 1XDSA 4MNUA 2Z16A 2I10A 4LJZF 5L3CA 1BC7C 2H27A 2EH3A 3FXMA 3ZMUA 4HPQA 3ELKA 2JJ7A 5EG0A 4P9FA 5E8GA 3LQRA 2ZFWA 4CZZA 4A3LJ 3T1BA 3MKYB 2BY0A 4FETA 5E17F 5IP7J 3KLOA 2R7FA 2ICWG 3EQLF 5B3SH 2VKHA 2HTSA 1WVRA 1ZG5A 2DPUA 1BBYA 2DODA 1IUYA 1JUPA 4BHPA 5LHIA 3K4KA 2RREA 4AU7A 1Y0NA 4UY8I 1JUMA 5L3GA 1CF7A 2K40A 1BJZA 1REPC 2VJ4A 3TL4X 3LA2A 4E7LA 2F2EA 3ZCOA 4UV9A 3SEQA 3WHBA 2IP2A 4WF2A 2WTEA 2KPMA 4PK4A 3L2WA 3IKVA 1UAAA 2G0EA 3K6GA 3I59B 2ESNA 1R6RA 2RV8A 1N25A 2DA6A 2L2OA 1DUXC 4L9JA 3VYTB 2GIVA 2LR8A 2E7XA 4ENKA 5GTIC 4XOTA 5FLXK 2FEZA 1K83J 2E19A 2FNAA 3HBLA 5E3LA 3O8HA 4Y15A 1IJWC 1MBHA 3D0SA 3SZTA 2A07F 5JI6A 2QUFA 1YW8A 2E36A 4DYCA 2H8RA 2UXNA 4P96A 4NNJA 1T39A 2PMZN 5H6QA 1XMAA 4OIOF 4FX0A 3OYJA 3M3YJ 4DBRA 3LA3A 2L7MP 3OYKA 1T0FA 3EUHC 1PUFB 2EFOA 4C9YA 4ENNA 4BYYA 3OYAA 4I2OA 3LSTA 5D6EA 1HKQA 2HFHA 5HDKA 1LEBA 3FBIB 1FOYA 2CSOA 4XRMA 1OMIA 4I0BA 4CYDA 3CCSI 3JRDA 1TZLA 4EJOA 1XGNA 4ZYAA 3AAFA 1WJAA 2L9NA 2EPFA 2IA2A 1BJAA 1WI9A 4A3BJ 3I58A 3R6SA 2MABA 1B59A 4CH7A 4Y7NJ 5J1RA 4IHYA 4U0VA 2M4GA 4M3GA 2M34A 3S2DJ 3CUQA 1ZARA 5J40A 5HDGA 3Q5FA 5F08A 2HOTA 1OCOH 2LRDA 2XASA 3CCVI 4LLGF 4LK0F 2AXTC 2HQNA 1TNTA 3M4OJ 5J1UA 3ULQB 5FRNA 2CV1A 5HLHA 1LFPA 1X1DA 3PQKA 3REOA 1YITI 1W7PD 3CCLI 1YG2A 3MZHA 1FPQA 4ZTFA 3PNVA 4AIJA 4AYBN 1UB9A 2VBZA 1DP3A 1B8IA 3OSFA 4CUGA 2DFFA 3OYNA 5E20A 3GLXA 3AL0C 3GZ5A 3WODF 2DFIA 3FKIJ 4RBOA 3SEZA 5TGTA 4M3BA 4I02A 2JRTA 5KK1A 2JUCA 3EUAA 1ZN2A 3PUBA 4XRSG 3LSRA 4RS8A 3IAM2 4IZZA 1KONA 2HVRA 2IEKA 5E18F 3M8FA 5CVRA 3HHGA 5HS8A 1RUOA 2A6EF 2GM4A 5EEAA 4BXFA 4WWCA 4FCYA 2YU9J 2V1NA 4Q4ZF 4I6ZA 1YW7A 5CVVA 3T5XA 3K70D 4O3MA 1B1BA 4Q5SF 3WTYC 5J47A 2ZJQF 4MFEA 4UUTA 4EEFG 3DU6A 3U21A 2X9DA 2O0YA 2ZSHB 5KHDA 1EF4A 1BW5A 1FYMA 1FOKA 1BI1A 1YJ9I 1W1WE 2EINH 2IS4A 2DO7A 2K4BA 3GTPJ 3V7CA 1TWFJ 4RM3A 2VQLA 1JE8A 3HOSA 4HBLA 4E7ZA 5E3MA 1X1CA 5CPRB 1TP4A 3L2UA 4A5MA 3O2PE 2JN6A 3OY9A 3RZOJ 4XRSA 1VQ4I 4C3JJ 2W57A 2LD5A 2O8KA 1E2XA 3MKZA 3OYBA 3EUKL 3X2QH 2CJJA 4HEA2 2G7UA 1K6YA 3V8KA 2M7BA 2L7FP 3SDBA 1XMKA 3GTMJ 5ILVA 2Q8KA 3HOYJ 2FQ4A 4A3CJ 2HOAA 3GZ6A 1D1BA 2E2IJ 2IS6A 3KP7A 2X4HA 3MVPA 3ABLH 4BE0A 1UHWA 4JX4A 3HM5A 4LD5A 5FLVA 3HDDA 2M8GX 2BYVE 5HDNA 1VQMI 4ZZDA 1KYZA 2VBXA 4PFPA 3H5NA 2PN6A 2NXNB 4WXHA 3HKZN 5TJJA 1NK3P 2DMNA 4Q48A 3FBNB 1AKHB 1AHDP 1KQ9A 3GW2A 3F8FA 2R93J 4ZZLA 5D8KB 1CGPA 3W3CA 1Z6TA 2HI3A 5E3OA 1VQNI 4YFXF 1T8IA 1U2WA 1FC3A 4FX4A 2M30A 3ESWB 2VE9A 1TQIA 4Y33A 2F6CA 2DA3A 2HOEA 5D5XB 4FE4A 2RGVA 4HG2A 3I5UA 2A69F 3U2RA 1S7OA 3BTCA 4N9HA 4DZPA 1Z1DA 2CUFA 4ENJA 3K0LA 1WJFA 2IGMA 2RN7A 4QIWN 3SFIA 2R7UA 3KP6A 4Y4RA 4UV8A 4M73A 3CO6C 1FTTA 4R79A 2KKOA 2CUEA 3HPGA 3OYFA 1GVJA 4UHTA 1D8KA 3A0BC 4AVPA 1B9NA 5D5UB 3DEWA 4U88A 2VN2A 4IRIA 3RI4A 1WJCA 2GA1A 2GA2A 2KP6A 3BJ6A 3HJEA 4LOCA 3IH2A 5E3NA 5TISC 1S5LC 3VYUB 3OYCA 3M9AA 5M5WJ 4N4NB 3ZQHA 1GXQA 3BTIA 3Q3SA 2DCEA 3ZR8X 2IBDA 4C3IJ 4NUBA 4KN7X 2KRFA 2Q2EA 4NB5A 4AD9A 3QPLA 4B4CA 4BXUA 2L9VA 2Y9YA 2COBA 3KFWX 3M1CA 4ZJZA 3AG1H 1FYKA 2DA4A 5ILSA 5LLQA 2W25A 4XMYA 1XCBA 3TO9A 4B47A 4CCKA 1ZRFA 1P7JA 3BP8A 2EV0A 2E2HJ 2O61A 4O5VA 3LSHA 3HPHA 5DV5A 4Z6YA 2QA4I 1GDTA 1HBXG 4EVIA 2YSRA 3GFIA 2ZMEB 3HTUA 2IGNA 3OOUA 1I1SA 2V6CA 2LF7A 1D5VA 4I76A 1WRJA 1G2HA 4KISA 3GF2A 3GMEA 3MZ8A 4RMNA 1I50J 1W7PA 4GCVA 1NG7A 3J81K 3NAUA 1MMNA 2V9VA 1YFHA 3C2HA 3MKLA 4D0PA 4YELA 4AYBA 2DK8A 3V7SA 1JTYA 3J81Z 4L0YB 1OR7A 2PX9A 3R4KA 4B43A 3J7YJ 3QU3A 1DGRM 3VYSB 3IRQA 1GHCA 3MCZA 4RM2A 2K02A 3QYBA 4UVBA 2UWMA 1IN6A 1ZGAA 2MBFA 2KT0A 2OCCH 1EKEA 4N0BA 3PIPF 2VL8A 3GCMA 4EJWA 2R7WA 2K9LA 3BZCA 4PGHA 1R1UA 2M1BA 5ICCA 3E6CC 1D0XA 4D7NA 3WHCA 3P5JA 1T56A 2LG4A 1X1PA 2UZKA 2LC2A 2RAEA 1WPKA 1EH6A 4RAFA 4E7KA 2XPUA 2HKXA 3ML6A 1LDJA 2X85A 1YW9A 2MD0A 3BR6A 4BAYA 5K1YA 4DGWB 4Y52J 4F92B 4Q47A 3CDIA 1OYIA 2FJ1A 1F9NA 5H20A 1ACIA 3I54A 2DQRA 1L0OC 3MZYA 5FKNA 1QNTA 4NBQA 1VQ5I 4ZDPA 1BA5A 2P5KA 5HLTA 2R7TA 3PJRA 2IXSA 1HW5A 1RRJA 4BH9A 1FSHA 2ZXIA 4BHBA 3CUQB 3CMEI 2VLAA 3E1SA 4A3EJ 4HYEA 4RDUA 3M8JA 3HSEA 5HS9A 2DXIA 4HX7A 3W6JB 3ERED 4JP0A 2LOOA 2O8XA 3GBGA 4X1EA 5HLIA 2VOOA 1DPUA 1FBSA 3BT9A 3CZ6A 4NHJA 1Z91A 2KJBA 5F0HA 2L0KA 3QP5A 3ZRGA 2BY2A 3IRRA 4E7JA 2VODA 3DPUA 1SMTA 1KQ0A 5J3LA 1B8IB 1T33A 2GIZA 2OAZA 3ASOH 4IRHA 4UB6C 4ABZA 2IW5A 2OBPA 1RKTA 1ULYA 3FDYA 5CYVA 4J01A 2H1KA 4V2GA 1TWCJ 3F8MA 4Y13A 3G2BA 2WC2A 4IJAA 1A6QA 3A02A 2Y30A 3F9KA 5EYRA 4CCMA 3K70C 4E7HA 3WU1B 1POGA 2JA5J 1ZELA 2I5UA 1MKMA 3C2GA 3WTWC 5EDNA 2R3SA 2R7VA 3D5SC 3EETA 1SANA 1XX5A 2X6WA 3GYHX 1GT0C 3VSKA 3CCRI 4OWRB 1O3QA 1E17A 1TBXA 5C3EJ 3D5LA 2DN0A 3OMYA 4EJUA 2QZ8A 2KQRA 1HW1A 2JRMA 2KISA 4U0YA 2WWYA 4L9TA 3O6BB 2XB0X 4CHUA 1S72I 1Z0XA 4MHGA 2CV0A 3FXLA 3OIOA 1ETVA 2X0LA 4DQ2A 3FMSA 2E1OA 3W2VA 5L3FA 4BE2A 2E1CA 1K7AA 1V5FA 3KEOA 2E35A 9ANTA 1MJAA 4M74A 2EIJH 2M2EA 2CFXA 1SFUA 3WE3A 1H9TA 2XRNA 1PP8F 5EEGA 2BV6A 2GWRA 2DI3A 3TMOA 4XLFA 2KL4A 5FFXA 5FKOA 2EZLA 1P92A 4XSXF 5B1BH 2V79A 3ECHA 2QENA 5B66C 3FISA 2E5NA 3L1PA 1BR4A 3E5UA 2C6YA 4XNFA 2ZKZA 4XN3A 2W48A 3HRTA 2VJ5A 3SZPA 3IH3A 2MFZA 2MLKA 1D0ZA 2QQAA 3E6DA 2EWNA 2EJRA 3L00A 3M1EA 2V7FA 3LSKA 3S15J 2P6SA 2BE5F 2OU2A 1T6SA 4ASNA 4A3GJ 1VNDA 3KYCB 1IW7F 2X1CA 4PJMA 4JX5A 4XLPF 3KPHA 2XKPA 1HC8A 3CC4I 3TW7A 4BQAA 1ETQA 1V55H 1W36C 3V42A 2HVSA 3S3OA 4KUMA 1Z7LA 2DA5A 5E1WA 5IOZA 1IXRC 2R5YB 2EA4A 4DNCA 3DP7A 4M9XA 1AA7A 2FXAA 3KZZA 4YG2F 3WGGA 3W2AA 2VBWA 2KJCA 2F4MB 4MTEA 4WK8F 2BOLA 1PJRA 3M8EA 3RPQA 3G1OA 5JLXA 4PJJA 2F5DA 1FYLA 1J0RA 4U7BA 1PUEE 2HWVA
chains in the Genus database with same CATH topology
3E0JB 2M4GA 3S3NA 4GRIA 3ZGKA 1X4PA 2V6EA 1D0YA 3HKZA 3OL3A 2M0MA 2Q2EB 3S3MA 2HU9A 2LRDA 2R7RA 4B3XA 1W36D 3OS2A 3PNYA 3L2VA 2W82A 3FKJA 2KZVA 4BJTA 5FRNA 3DTEA 3VDXA 2FUG2 3ZQQA 3VYRB 2CV1A 1LFPA 1X1DA 2GOMA 3KEYA 2X1DA 3RSNA 1LKXA 3I3LA 4ZTFA 1MW7A 4CCJA 4B44A 3PNVA 3H0DA 4IQ4A 1DP3A 4YRVA 3RTRA 3S93A 5CKTA 1N78A 3CP8A 4CUGA 3OYNA 4ZTJA 2XF7A 3AL0C 4HNUA 4XKCA 2WADA 3SEZA 3CESA 5TGTA 2VXDA 5KNLA 2CW7A 4ZDOA 3EUAA 3PUBA 4IZZA 3IAM2 1KONA 4XOPA 3W2WA 2XF5A 2HVRA 4E7IA 4BU2A 4XLAA 2XSJC 2CS3A 4AVZA 2VASA 4F55A 2R7XA 4BXFA 2X1EA 2V1NA 4PUSA 4XN0A 4HSTA 3HL2A 2KHMA 2R7OA 3K70D 1X4OA 4BACA 1Y6IA 2UV1A 3DU6A 3U21A 2ZSHB 5KHDA 4CCOA 3LFUA 4P5OA 3PSFA 3OYEA 3IP4B 2BW3A 2IS4A 1GLNA 3OYDA 2ZSIB 2VJJA 3IAS2 4RM3A 4XQFA 2VQLA 5LFAA 4BS9A 3HOSA 5FRMA 4E7ZA 2XAUA 1X1CA 3MMYB 5CPRB 3L2UA 3PNTA 3DPTA 2L5QA 3QOEA 2I8DA 3OY9A 4LIVA 3MKZA 3OYBA 2RQQA 3EUKL 1N75A 3EPZA 4HEA2 1K6YA 2M7BA 3PL8A 3SDBA 4X0GA 1BR1A 4QPQA 1LVKA 4NC8A 4C2TA 2W00A 2K9MA 3HC7A 3AFHA 2M3AA 4G6TB 3OYIA 1D1BA 2IS6A 3H9QA 1V5GA 2HDWA 3DU5A 4HRIA 3LL7A 4PJNA 4U87A 4BE0A 3OIPA 3OS1A 5HOOA 2CH0A 4HSRA 3HOTA 2O5RA 4ITVA 4RLQA 5CQEA 2WY8Q 1P9QC 2M7AA 4F52A 4PFPA 3H5NA 2DT7B 3FBNB 1ERDA 3BG6A 2AQEA 3CP2A 3DEEA 3K4NA 3QYFA 2KDOA 3W3CA 4KJZA 4BEHA 1PYVA 3A1YA 3OIQA 4BQQA 4E7SA 2W1OA 3OL4A 3H9GA 3L2QA 4II2A 2VQGA 3ONQA 4ZDLA 4C2UA 1BR2A 4II3A 2VXZA 4Y33A 4F93B 2F6CA 4HG2A 3DKYA 4BDZA 4LIUA 4B48A 3BCAA 1MMAA 2DOAA 3NWSA 1WJFA 2Q1ZB 3QODA 2IGMA 3CJQB 2A5WA 3PSIA 4P1WA 3MKWB 2R7UA 4Y4RA 2LY2A 3FHNA 2L9SA 4R79A 3TBIA 3CMMA 2ZFUA 4XLEA 3HPGA 3OYFA 3VWBA 1D1AA 3A4CA 4BUPA 4IQJA 1X19A 4XM3A 1WJCA 3J7AY 1UELB 2OV7A 1EA3A 2KP6A 2WAEA 3IUOA 2ZXHA 2XDVA 1VZ0A 1WJ5A 5JHFA 2LBFB 3LMMA 2WA0A 3VYUB 3OYCA 3DQVC 3BCBA 4N4NB 2DCEA 2JVGA 3ZR8X 4DOZA 4NUBA 4DIQA 3K4BA 3OR1C 4NC7A 3OS0A 1MMGA 2JVHA 3LSMA 3RQ4A 3M1CA 2LY1A 2PJRB 4ZJZA 2MC4A 4XMYA 4B47A 4CCKA 1T0FC 2BW3B 4IKFA 2E1MB 3DKXA 4CCLA 2R4GA 2VPLA 3LSHA 3HPHA 2OUMA 1T95A 2IGNA 3OOUA 4DJAA 2AQFA 2KMUA 2M4KA 4MLOA 4PSXA 4PJLA 4NQWB 1QU3A 4BQNA 4KISA 4BE1A 4CA0A 4RMNA 1HA8A 3MD2A 1SFKA 1DQUA 1NG7A 1MMNA 2CMPA 2DJIA 2L7KA 3C2HA 4N4OB 4YELA 4AYBA 3PFYA 3S8PA 4KITB 2R7QA 3OR2C 4XONA 4B43A 3HXLA 4BJ6C 1DGRM 3VYSB 4RM2A 3QYBA 2VQCA 2HVQA 2WBMA 3DTKA 1YX3A 2UWMA 3UNGC 1S9HA 3NWTA 1QHGA 3SYTA 3LSIA 4ANJA 2CV2A 1YX5A 2CW8A 2HPIA 4CCNA 5LD2C 2VL8A 2R7WA 2K9LA 2X6XA 2JSPA 4LG3A 1Z3XA 1D0XA 4BQOA 5HVQC 4BDYA 1QHHD 1SAUA 2HQAA 2LG4A 4JOMA 2LC2A 2VIXA 3OYLA 4BL0B 3KX2A 4XLHA 4E7KA 3HG9A 4E6KG 2X85A 2R7SA 4D9JA 2MD0A 3OYMA 1MMDA 3CF2A 4BEHB 4DGWB 1WJDA 4XR6A 4F92B 3KYLA 2OC6A 2Y0SA 2K5CA 2X51A 3ZXSA 3DTIA 3K10A 4F3QA 4ZDPA 5HLTA 3BLYA 2R7TA 2UUZA 3HUGB 4U7BA 4J00A 2IXSA 3RPUD 4CZCA 3PJRA 2IS2A 5CQGA 2ZXIA 2VLAA 3E1SA 3M8JA 4LITA 2E1MC 2DXIA 2A6TA 2LOOA 4E4HA 3GBGA 3CZ6A 1LDKB 3LSGA 2KLOA 2KRCA 4JQFA 3K4CA 3ZRGA 2QKMB 3K4LA 3VSLA 4E7JA 2IGKA 3OWTA 3DPUA 4KT6A 1X1AA 3DPLC 2BVMA 1YE9A 2PMZA 1V5EA 2GOXB 2NOJB 2WAQA 4J01A 3FDYA 2CUJA 3L2RA 2IS1A 2IGOA 4OAYA 3G2BA 3RCOA 4F91B 2QKLB 3F9KA 1BOBA 4CCMA 2W4SA 2K3PA 3K70C 3SZGA 4E7HA 3AKZA 2VQHA 1ZELA 1WFXA 2F4IA 3C2GA 3BG7A 2VJIA 2X6YA 1X1BA 2Z1DA 2R7VA 2V26A 3D5SC 3D5RC 2HPMA 1FMWA 3K4MA 2CFOA 2X6WA 4YEJA 2XF6A 3VSKA 2E60A 2DT6A 2V4JC 4Y3OA 4OWRB 3S32A 2W7NA 2XC7A 2LYCA 3D5LA 1DGWY 3OMYA 4XKVA 4XL9A 1MNDA 2KQRA 3K4JA 4RLFA 4ZC3A 2Z16A 2WAFA 2LBFA 1NG6A 5HNHA 2WB1A 4HPQA 4HNTA 4D1QA 2CV0A 2MYSA 1U0JA 4H4KC 1G8XA 1G59A 3MKYB 4FETA 3W2VA 3QYEA 2JUGA 4BE2A 1V5FA 4BJ5C 2PJRA 2VKHA 3DWLE 3N05A 3H9JA 2JA2A 3I9V2 3K4KA 2RREA 4AU7A 4DBQA 3TMOA 4XLFA 2KL4A 4XKBA 5KCMA 2VJ4A 3TL4X 4E7LA 3ZCOA 2V9KA 3H35A 1N77A 2BVLA 3SEQA 3OYHA 2KPMA 4PK4A 2E5NA 1BR4A 2VB6A 3L2WA 1MNEA 1UAAA 2VKDA 3K6GA 4XLCA 4XNFA 1R6RA 4XORA 3AL0B 1UG0A 4PFOA 4XN3A 2L2OA 2CUZA 2VJ5A 3H5RA 3VYTB 4C30A 5FROA 2MFZA 4XKWA 2P0WA 1WJBA 4BGDA 2Z2SB 1D0ZA 4OAZA 2LREA 2V7FA 3LSKA 4XOTA 4EATA 2ELJA 1J09A 1Y56A 1Z21A 3DLAA 3OYGA 2RNGA 2HZDA 2KRHA 3UR3C 2X1CA 4IX7A 4NNJA 4PJMA 3OYJA 4DBRA 3OYKA 1W36C 3EUHC 2WY7Q 4QPOA 3V42A 1D1CA 3S3OA 2HVSA 1Z7LA 4C9YA 1TT0A 3OYAA 2E5ZA 1FMVA 3FBIB 3A2KA 4PSWA 4CSWA 2F5VA 1Z3YA 1AA7A 2HNHA 1IRXA 1TZLA 3H5AA 3W2AA 4ZYAA 1OLTA 2BOLA 1WJAA 2L9NA 5HNFA 1PJRA 1JI8A 3CJRB 1E0EA 1OR7C 1WJEA 4PJJA 3BC8A 2LH9A 2MABA 4CH7A 4FASD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA0 A;  2LYC A;  4C9Y A; 
#chains in the Genus database with same CATH topology
 1BIA A;  3ZGK A;  3BJO A;  3FWE A;  4CYC A;  2M0M A;  2Q2E B;  2OTL I;  1P4W A;  2R7R A;  3L2V A;  3BWG A;  3FXO A;  4ESJ A;  1KU7 A;  2KZV A;  1F36 A;  2QM3 A;  3DTE A;  2W24 A;  3ZQQ A;  3VYR B;  1SD7 A;  2O6G E;  2GOM A;  3KEY A;  2EFN A;  2A61 A;  1HKT A;  2V1U A;  4UUV A;  1U9N A;  4YRV A;  3S93 A;  5CKT A;  3CP8 A;  1ZLK A;  1O4X A;  5IT3 A;  1R58 A;  4LG0 A;  2JPB A;  4IOA F;  4WCG A;  3T0Y A;  2VXD A;  4ZDO A;  2JT1 A;  2QF7 A;  5ED4 A;  3G3Z A;  2EZK A;  4LMY A;  3W2W A;  2XF5 A;  1XGO A;  3G1M A;  5F1J A;  3EDP A;  4AIK A;  2OA4 A;  4XLA A;  4BU2 A;  2GXB A;  2XSJ C;  3UKG A;  2XAQ A;  2VAS A;  2EQR A;  2R7X A;  2X1E A;  4AUX A;  1KU3 A;  1QPI A;  1DPR A;  4PUS A;  4KFC A;  4HST A;  2K3F A;  5J8C A;  1X4O A;  1X3Z B;  1S8N A;  3ZN0 A;  5HS7 A;  2FBI A;  3MAJ A;  4IF4 A;  1Y6I A;  3WU0 A;  2Y48 A;  2XIG A;  3L09 A;  4PJ0 C;  3LFU A;  4P5O A;  3PSF A;  3OYE A;  3IP4 B;  4HX8 A;  3L9F A;  4DYQ A;  3TW6 A;  3EUH A;  1B72 B;  2NNY A;  3AG3 H;  1ZG1 A;  2X48 A;  1KA8 A;  1X3W B;  2VJJ A;  5LFA A;  2JZY A;  3GUD A;  1KZH A;  2R0Q C;  4ZH4 F;  3HOZ J;  2XAU A;  2NYX A;  3CCU I;  2ZME A;  1R36 A;  3MMY B;  4FTH A;  4G94 A;  1R22 A;  4A0Y A;  4M6Y A;  3DPT A;  1XB4 A;  2RVC A;  3QOE A;  1ONV A;  1XN7 A;  1BW6 A;  2Y0M A;  2BBY A;  3CMY A;  2RQQ A;  1R4M B;  2FA5 A;  1VTN C;  3EPZ A;  3PL8 A;  1K6O A;  4X0G A;  1BR1 A;  4RAG A;  2RNJ A;  4PGG A;  3IL2 A;  3JR9 A;  5D6F A;  4L9V A;  4NC8 A;  3RYR A;  4A93 J;  3H1C A;  2AXL A;  1XSD A;  3HC7 A;  2WV1 A;  3AFH A;  4G6T B;  3OYI A;  3S2H J;  3H9Q A;  3WTX C;  1V5G A;  3DU5 A;  2VUM J;  3VOD A;  4HRI A;  3LL7 A;  4U87 A;  3J7Z I;  3BPX A;  2IT0 A;  1RPW A;  4HNV A;  3JRE A;  3FF5 A;  1ZK8 A;  3I64 A;  1U5T C;  1OJL A;  4HSR A;  3HOT A;  1OCP A;  1ZR4 A;  4A3F J;  2WAQ N;  1R1V A;  4PCQ A;  3E6B A;  2STW A;  1QVT A;  5CQE A;  3A0H C;  2KDZ A;  3ECO A;  1Y39 A;  1P9Q C;  2QQ8 A;  2DA1 A;  4F52 A;  4LB5 A;  4RB3 C;  1X2M A;  1BI0 A;  5JLW A;  3BG6 A;  1ZLJ A;  3JRH A;  3GFL A;  3HOV J;  4ZYG A;  1IGN A;  3KP5 A;  1GXP A;  1XS9 A;  5DUK A;  5CJ9 A;  1D5Y A;  1PYV A;  3A1Y A;  4FE7 A;  4YIR X;  2W1O A;  1JHF A;  3OL4 A;  3ONQ A;  4I09 A;  4C2U A;  1S3J A;  1BR2 A;  6PAX A;  2VXZ A;  3TO6 A;  4F93 B;  4PZJ A;  1HDD C;  1SVM A;  1YQA A;  2Z5U A;  3DKY A;  3WG9 A;  4B48 A;  1YS7 A;  4I7H A;  1MZB A;  2BHY A;  1MMA A;  1UST A;  1MDM A;  3QOD A;  2B0L A;  3CJQ B;  2R7D A;  3K2Z A;  3PSI A;  4N9I A;  3MKW B;  2DA2 A;  4HF1 A;  2DA7 A;  3MWM A;  5BMZ A;  3CQZ J;  1IO2 A;  1RUN A;  3HGY A;  2Y75 A;  2RC4 A;  4MGR A;  2DLL A;  2DOF A;  2WB1 N;  2ZFU A;  1MSE C;  3RKW A;  3CUO A;  2JPC A;  1OYW A;  2FOW A;  2H6B A;  1YIO A;  1YJW I;  1J2X A;  1RR8 C;  4ZYH A;  5F64 A;  3K1M A;  2ID6 A;  1UEL B;  3IUO A;  4QWQ A;  3WGH A;  1QRY A;  1VZ0 A;  5LHH A;  1G3Y A;  1YRN A;  4KN4 X;  3DQV C;  2H8W A;  4AM3 A;  4DIQ A;  3DFG A;  3F6V A;  2O7O A;  4HDV A;  1IN4 A;  3GO5 A;  1UJ8 A;  2MC4 A;  2IA1 A;  2P5L C;  1I3Q J;  1ON2 A;  1T0F C;  3TGN A;  2ME6 A;  2E1M B;  3H92 A;  4CCL A;  2VPL A;  2Z99 A;  5JVG F;  4DZJ A;  4EJV A;  1LQ1 A;  1OCT C;  2O9L A;  1R5G A;  5EF6 A;  4XLN F;  4UNO A;  3TP0 A;  3ZMV A;  2OUM A;  1T95 A;  1A35 A;  3BR3 A;  2H09 A;  2AQF A;  4W1U A;  5DS9 A;  2L7Z A;  4CIC A;  4NQW B;  1L3L A;  2PJP A;  1FT9 A;  1VI0 A;  1BI3 A;  4BQN A;  3F3X A;  3QOP A;  1IV8 A;  3CDL A;  4XSZ F;  4LK1 F;  4L0Z B;  4BE1 A;  4CA0 A;  3MD2 A;  2EZI A;  2DMQ A;  5DTD A;  1SFK A;  2ECB A;  3ZOB A;  3EYY A;  1RET A;  1B9M A;  3OR2 C;  1FBQ A;  4XON A;  4M3F A;  3LQQ A;  5ICE A;  5A2Q Z;  1R00 A;  4BJ6 C;  1ZRC A;  1QBJ A;  2PI0 A;  2M9H A;  2HVQ A;  2WBM A;  3DTK A;  1JKQ C;  1H8A C;  1IRF A;  4A69 C;  3S14 J;  1S9H A;  3NWT A;  5C4J J;  3LSI A;  2A05 A;  4HA8 A;  3LAP A;  5K7Z A;  4OIN F;  3PIO F;  5KAF C;  1A31 A;  2HPI A;  1ENH A;  5JVT A;  2FF4 A;  2ELH A;  1IC8 A;  2XAG A;  1HLV A;  3BTJ A;  5BOX A;  3CC2 I;  5IOY A;  4BDY A;  1QHH D;  1SAU A;  2HQA A;  2VIX A;  1IG7 A;  2JMW A;  3E7L A;  1V54 H;  5D5V B;  4BL0 B;  4XLH A;  2DYS H;  1E3H A;  2HQR A;  5D5W B;  1HQC A;  2NNN A;  3ZMT A;  1AU7 A;  1WJD A;  4XR6 A;  4V19 K;  2LLK A;  4BKX A;  4M9S A;  2FU4 A;  2E34 A;  1ETO A;  2K5C A;  1GVD A;  3ZQC A;  3DKW A;  4U0W A;  3E5Q A;  3T8T A;  2FX0 A;  2LKX A;  4BY1 J;  1LFU P;  3RKQ A;  3HUG B;  4J00 A;  2IS2 A;  4CYC B;  2G9W A;  3HEF A;  4EM1 A;  3B02 A;  4RGR A;  4IPA A;  2CRG A;  5DCF A;  3WTT C;  4MEY F;  5GTH C;  1T38 A;  4ETS A;  3QU6 A;  1R7J A;  3ASN H;  3S1M J;  4JQF A;  1SVL A;  5FFZ A;  4KMF A;  1Q1V A;  3K4C A;  1K4T A;  3K4L A;  3VSL A;  2R5Y A;  2IGK A;  4KT6 A;  2YPR A;  1X1A A;  3DPL C;  3HRM A;  1B6A A;  3F21 A;  4LG0 B;  1J5Y A;  5HOD A;  1MBF A;  3GLL A;  2PMZ A;  3DEU A;  3IV5 A;  1V5E A;  2GOX B;  2WAQ A;  1SFO J;  2OCE A;  1FEX A;  2CUJ A;  3Q0V A;  4LFU A;  4HLY A;  3TOB A;  2IS1 A;  3S2W A;  3I56 I;  5F0C A;  1QGP A;  1FLI A;  2QYO A;  2VE8 A;  3FXJ A;  4ZYE A;  2Y2Z A;  3N97 A;  2W4S A;  4A3J J;  3I71 A;  3SZG A;  3RPU A;  4ESF A;  1VQ8 I;  2VQH A;  2F4I A;  5FLM J;  2XRO A;  1TL8 A;  3BG7 A;  1Y8Q B;  2YX4 A;  1F1Z A;  2CFO A;  3KP3 A;  4YEJ A;  1TQP A;  2JA7 J;  2E60 A;  3PUF A;  3G4S I;  3CMA I;  2XAF A;  2E71 A;  5EJC A;  5K5O A;  4Y3O A;  2XPV A;  2QGU A;  3HTS B;  3HHH A;  4MQV A;  1F5T A;  3BQZ A;  2LYC A;  4GO1 A;  1UHS A;  5DCM A;  1S7A A;  1EH7 A;  4XKV A;  4XRF A;  3GVA A;  1BN5 A;  1G3T A;  2P4W A;  3HRU A;  1FZP B;  1P7I A;  3ZN1 A;  3HRS A;  1NG6 A;  5HNH A;  2WB1 A;  2DTZ A;  4HNT A;  4HX4 A;  4D1Q A;  2MYS A;  4DYR A;  5L3E A;  2EFP A;  1G8X A;  2QCO A;  3W6V A;  3Q9S A;  3A01 B;  1BI2 A;  1W5S A;  2Z3Y A;  2JUG A;  1U9O A;  2XGC A;  4BJ5 C;  5LGN A;  1SVO A;  2GZW A;  1P6R A;  3N05 A;  3SHF A;  2RDP A;  1IF1 A;  2ID3 A;  4O6J A;  2JA2 A;  1X58 A;  3U1D A;  5K5Q A;  1K78 A;  2HYJ A;  4FIS A;  2BY1 A;  2R5Z B;  3ZMD A;  5K7F A;  4CGZ A;  3ABU A;  4XKB A;  2D5V A;  3F0C A;  3P9K A;  4DW6 A;  3FZV A;  1B72 A;  4IRG A;  1N77 A;  4IVN A;  2BVL A;  1F43 A;  1FOX A;  2MH9 A;  1FIA A;  1MH3 A;  4G8X A;  4GYG A;  2VT2 A;  1SEU A;  1ETX A;  2VKD A;  4XLC A;  1OPC A;  2ZO4 A;  4JBA A;  4XOR A;  3AL0 B;  3R0A A;  3EYI A;  3J7A O;  1YOV B;  4PFO A;  3CO7 C;  3JTG A;  3H5R A;  1D3Y A;  1RC9 A;  2FNP A;  3QQA A;  4WXC A;  5FRO A;  4LLL A;  1WJB A;  2CW0 F;  1R23 A;  1IUF A;  2Z2S B;  5BQT A;  4OAZ A;  2LRE A;  4EQQ A;  2R7Z J;  3N4M A;  1STZ A;  2ELJ A;  3G1L A;  1J09 A;  3FIW A;  1Y56 A;  3KIO A;  2TCT A;  3DLA A;  4M72 A;  5D4S A;  3OYG A;  3JRB A;  1MD0 A;  1RKW A;  2MG4 A;  2CO5 A;  4CO8 A;  2XAH A;  1YTY A;  1FX7 A;  4YFN F;  5BPD A;  5DM7 F;  1MDM B;  5DEQ A;  4S0H B;  4QPO A;  1IRZ A;  2DW4 A;  1ZRD A;  2YU3 A;  2DMP A;  1FMV A;  3ROU A;  3FX3 A;  1LEA A;  3B6C A;  4PSW A;  3RIR A;  2F5V A;  2IA0 A;  2KFD A;  1Z3Y A;  2V9P A;  2HNH A;  3BG5 A;  4FT8 A;  5FD5 A;  3BR5 A;  4A0Z A;  4A5N A;  1OLT A;  1EV7 A;  2K86 A;  2K27 A;  3RYP A;  3CJR B;  5GPA A;  1E0E A;  2XAJ A;  1OR7 C;  4RGU A;  1WJE A;  2P5V A;  4BHC A;  1BL0 A;  4YII A;  3JTH A;  2OQG A;  2X6O A;  1LDK B;  1YRN B;  4FAS D;  3FK6 A;  4LGW A;  2DBB A;  5GAH J;  4GRI A;  1X4P A;  3PO3 J;  2V6E A;  2D1V A;  3A03 A;  1D0Y A;  3HKZ A;  2M8E A;  1P2F A;  2A3S A;  1G3W A;  2PFB A;  5B1A H;  2CQ7 A;  3PNY A;  2W82 A;  2K9Q A;  4IOC F;  2L01 A;  2IJL A;  2FOK A;  3VDX A;  4IHV A;  1O3T A;  1O57 A;  2A6H F;  3CJN A;  1S29 A;  1LKX A;  4U7D A;  4B44 A;  2RQP A;  4IQ4 A;  1WWX A;  3CLO A;  3GFJ A;  3I4M J;  1N78 A;  2EV5 A;  4ZTJ A;  3LOC A;  1WH5 A;  2QQ9 A;  2O3F A;  5CVU A;  1G3S A;  1PVE A;  2NVT J;  3BZK A;  4GDF A;  1HST A;  1E3P A;  5KNL A;  1U8R A;  2CW7 A;  2XSD C;  1FWZ A;  4XID A;  1TWH J;  3KET A;  4E7I A;  3KZY A;  4AVZ A;  1O3R A;  4F55 A;  5KVR A;  1T08 B;  4S05 A;  4XN0 A;  4IO9 F;  4FQG A;  2KHM A;  4L5J A;  3VOE A;  2NS0 A;  2UV1 A;  3TQN A;  5F0F A;  2HGC A;  4CCO A;  2JA8 J;  3L2C A;  4C2M J;  1Z7U A;  1R4N B;  2IVM A;  1U3E M;  2P7V B;  5C4X J;  1GLN A;  3OYD A;  4HZF A;  3IC7 A;  3IAS 2;  4XQF A;  5J4Y A;  2Y0S N;  5FRM A;  2MW8 A;  3FXK A;  4E70 A;  1OKR A;  1WKM A;  2BXY A;  2QSH X;  2ISZ A;  4BNC A;  3PNT A;  4B8X A;  1D8J A;  2I8D A;  4NQW A;  3OV8 A;  2QVO A;  4A6E A;  1XGS A;  2EBI A;  1MIJ A;  3TOA A;  3ERM A;  4V2F A;  3GXO A;  4EV0 A;  1MNM C;  2LVS A;  3NAR A;  3HYI A;  1DDN A;  3LSJ A;  4QPQ A;  2P7C B;  2BHZ A;  1LVK A;  3K7A J;  2Q0O A;  1ETK A;  3P7N A;  4G7Z F;  4HW0 A;  4Y17 A;  4C2T A;  2W00 A;  5IT9 Z;  1ZQ3 P;  2DQL A;  4HV6 A;  5IYB J;  4EM2 A;  2NOG A;  5LBQ A;  3J80 Z;  4PJN A;  1JTX A;  3W6K B;  3DCF A;  2ZJP F;  4A3I J;  3S1N J;  2HYG D;  4P55 A;  5GAG J;  3OS1 A;  5DD4 A;  5HOO A;  3ABK H;  1K79 A;  2O5R A;  1ZH5 A;  3C2B A;  2QBY A;  2HYF A;  2M7A A;  3GTG J;  4G7O F;  1ITY A;  4B09 A;  5E1Z B;  2L9R A;  1H9G A;  1QZE A;  1ZKG A;  4G12 A;  1ERD A;  1JKO C;  3R0J A;  3DEE A;  3CP2 A;  2KDO A;  1J59 A;  3ZQF A;  1IN7 A;  1IAW A;  1R5I D;  1RIO H;  5J6X A;  2YS9 A;  1Z9C A;  1GV2 A;  2VI6 A;  2ADU A;  2VC0 A;  4E7S A;  1LJ9 A;  3R60 A;  3KE2 A;  2ZXW H;  4D5F A;  3H9G A;  3L2Q A;  4II2 A;  4UB8 C;  4F7Z A;  4ZDL A;  4II3 A;  2CU7 A;  3HUG A;  1FY7 A;  3E97 A;  3E3V A;  3CLQ A;  4R8H A;  3RKX A;  1WQ2 A;  2OQR A;  3FMR A;  2DJN A;  4OIR F;  4BDZ A;  4WXD A;  3ABT A;  4LIU A;  5E1X A;  2D2W A;  3BCA A;  4L18 B;  3MEX A;  1TTY A;  1AOY A;  2PMU A;  3GTJ J;  5J1Y A;  2Q1Z B;  4HAM A;  1XSV A;  2CYY A;  1IXC A;  3ZP5 A;  1VQO I;  4UUS B;  3FHN A;  1R1T A;  2L9S A;  3WTZ A;  3TBI A;  3CMM A;  1Y1W J;  3C18 A;  2JWT A;  1HSJ A;  4IL6 C;  3VWB A;  4KT5 C;  5LRR A;  1OQY A;  2CQQ A;  4HOB A;  2YUS A;  4BUP A;  4M71 A;  4IQJ A;  1X19 A;  5DCM B;  1OCZ H;  3I53 A;  5GPC A;  3PM1 A;  3S17 J;  2Y31 A;  2WAE A;  1G4D A;  4GXO A;  2XVC A;  4I0A A;  1XGM A;  2XDV A;  2B9S A;  3CCE I;  3LMM A;  2D1H A;  2UXX A;  2WA0 A;  3PO2 J;  3BCB A;  3SFZ A;  4DOZ A;  3F6O A;  5FKK A;  4HDU A;  3LAJ A;  5C44 J;  4NC7 A;  3OS0 A;  4M6V A;  4UXN A;  2JVH A;  3LSM A;  4KDP A;  2LY1 A;  2FD5 A;  4OIP F;  2QWW A;  2BW3 B;  1UFM A;  5FKM A;  1R49 A;  3F8B A;  1UG2 A;  2R4G A;  3RJP A;  1K78 B;  4IHT A;  1USS A;  3QPS A;  2D45 A;  3I0T A;  4TV7 A;  2E2J J;  3JSO A;  3R61 A;  4D7M A;  2PQ8 A;  2NRA C;  3BJA A;  3HGG A;  2KMU A;  2M4K A;  3BG3 A;  4A3K J;  3Q0W A;  2R92 J;  5TRD A;  1LE8 B;  1FP2 A;  4C3H J;  4HQE A;  1HA8 A;  2TDX A;  1DQU A;  2VBY A;  4HV5 A;  3KZI C;  2ACJ A;  2L7K A;  2LP0 A;  1HXD A;  3PFY A;  4KIT B;  3H3V K;  2ZB9 A;  1DU6 A;  2R7Q A;  2BXZ A;  2AS5 F;  1IV6 A;  5FO5 A;  1SD6 A;  4MO7 A;  1F4K A;  1MBG A;  2VQC A;  1QPM A;  2J5O A;  2P6T A;  5FJ8 J;  1ODD A;  3A01 A;  1FJL A;  3CCY A;  3CDH A;  4ANJ A;  2CV2 A;  2CW8 A;  3CCM I;  3HSF A;  4Z2Y A;  1S7E A;  3DXJ F;  3CD6 I;  1QVU A;  2X6X A;  5AIQ A;  2JSP A;  4RA2 A;  2ELK A;  2R5Z A;  2NVU B;  1Z3X A;  5HVQ C;  3CC7 I;  2ISY A;  2VON A;  3RQI A;  4L5I A;  2NS8 A;  4HLX A;  3QPT A;  5E8I A;  1TW3 A;  2BEO A;  1MBJ A;  3NQO A;  1JT0 A;  1YIJ I;  3NRV A;  1VF9 A;  2TRT A;  4D9J A;  3OYM A;  1MMD A;  3CF2 A;  4BEH B;  2KZG A;  1ETY A;  2OF7 A;  3F8N A;  5B5E C;  3KYL A;  4G6Q A;  3SJM A;  2QLZ A;  1QA6 A;  2OC6 A;  4L9N A;  2Y0S A;  1VQ7 I;  3P9I A;  4CDG A;  2X51 A;  2L54 A;  4F3Q A;  3HSR A;  2LTP A;  4EMS A;  3IKT A;  2RKH A;  3BLY A;  1VQ6 I;  2JTV A;  5FLX Z;  3RPU D;  2J5P A;  3H0G J;  1W5C C;  4CZC A;  1H89 C;  3G6E I;  3HOW J;  1XDU A;  1KU2 A;  2XPW A;  1NTC A;  2OZU A;  2CQN A;  1A6I A;  4RB0 A;  5K7H A;  4LIT A;  2Y69 H;  1Z67 A;  3C7J A;  1UCR A;  4RGX A;  4X6A J;  2DDA A;  3TED A;  1OCC H;  5BPI A;  1TQM A;  1QZZ A;  2AHQ A;  4L5E A;  2JA6 J;  2HS5 A;  1TWA J;  1R5H A;  2KLO A;  3BRO A;  2ZME C;  4EM0 B;  4MTD A;  2E1N A;  1HDP A;  3K69 A;  3S1R J;  3VFZ A;  1VQP I;  1ZR2 A;  3E6M A;  2GBY A;  5LEJ A;  4BXX J;  1EJ9 A;  2ESH A;  2BVM A;  4KA4 A;  2DOE A;  1Z77 A;  1YE9 A;  3K1N A;  3WTU C;  2P81 A;  5E79 C;  5M5X J;  1CQT A;  1T2K A;  4G7H F;  1FNN A;  4UVA A;  3K2A A;  2XKO A;  3GTO J;  3MN2 A;  1UHM A;  1YO5 C;  1JGG A;  2EIK H;  4MEX F;  1RES A;  3IH4 A;  1WCM J;  3FHZ A;  3JRA A;  3RCO A;  1XG1 A;  4F91 B;  1VQK I;  1HCR A;  2K3P A;  3F72 A;  3FXQ A;  2XUB A;  3VEP A;  3WTV C;  5EEH A;  1OFC X;  2X6Y A;  4R1H A;  5CVJ A;  2K4J A;  1JKR C;  3D5R C;  2HPM A;  1FMW A;  1TW2 A;  3H36 A;  3K4M A;  2YR2 A;  3GWZ A;  2XF6 A;  4M3E A;  4GFB A;  4PDK A;  4MIM A;  2HTJ A;  2W7N A;  3S32 A;  3GTL J;  1MMS A;  4EGZ A;  3Q9V A;  1G6N A;  2LKS A;  2HOS A;  4ENM A;  2LK2 A;  3ISP A;  1MND A;  2HQ5 A;  1QO0 D;  2M5W A;  4ZC3 A;  2WAF A;  3DV8 A;  2LBF A;  2OJE D;  4RB1 A;  1IXS B;  5ILU A;  3M7G A;  2L4M A;  1U0J A;  4NC6 A;  5GAD J;  3F23 A;  4H4K C;  5A2Q K;  3M07 A;  2STT A;  4ON0 A;  1G59 A;  1O3S A;  3WE2 A;  3QYE A;  4AC0 A;  5JR3 A;  3CUQ C;  3QP6 A;  2PJR A;  1I6H J;  2M87 A;  3DWL E;  3H9J A;  2KIF A;  3DF8 A;  1SD5 A;  1WZ2 A;  3I9V 2;  1SFE A;  1ZRE A;  4DBQ A;  5K5R A;  4B3A A;  2B7E A;  5HLG A;  4NDL A;  1MH4 A;  5FKL A;  5BNG A;  3F22 A;  3JSP A;  5KCM A;  2DU9 A;  4A6D A;  3F8C A;  3JRF A;  2EV6 A;  1OIS A;  2V9K A;  3H35 A;  1O7L A;  3OYH A;  2F5C A;  2AO9 A;  2ME0 A;  2QBY B;  1QZY A;  2VB6 A;  3V4G A;  2Y9Z A;  2KIQ A;  5LEK A;  2NVX J;  1MNE A;  2FBH A;  1ZAO A;  2DMU A;  2PMH A;  3CTA A;  1UG0 A;  3I4P A;  1TT5 B;  4WX9 A;  1IDY A;  3FK7 A;  1LUJ B;  2CUZ A;  1EH8 A;  1LVA A;  1RNL A;  4C30 A;  2OD5 A;  4XKW A;  5F04 A;  2P0W A;  4JX6 A;  4BGD A;  2MA3 A;  4LB6 B;  4EAT A;  1I3A A;  1V4R A;  1IN5 A;  3JRC A;  1Z21 A;  1XD7 A;  2RNG A;  3SQN A;  3DBL B;  3V8J A;  2HZD A;  2KRH A;  3SXY A;  3GZN B;  3UR3 C;  4AID A;  3QRF F;  3GFM A;  4IX7 A;  1TC3 C;  4RAY A;  2HR3 A;  4YFK F;  3HZJ A;  4G6D A;  2WY7 Q;  1D1C A;  1TT0 A;  2DFH A;  2HXO A;  1T98 A;  2E5Z A;  1K4S A;  4OU0 A;  1SC7 A;  3A2K A;  2MLG A;  4CSW A;  1RI7 A;  4KIF A;  4XK4 A;  2EIL H;  1IRX A;  3H5A A;  2XHK A;  4RGS A;  3FM5 A;  3DBH B;  1U6G A;  5IY5 H;  5HNF A;  2OPT A;  2FSW A;  4GGG A;  3GX4 X;  2BZT A;  1JI8 A;  1JT6 A;  3OOP A;  5BS6 A;  1IRG A;  2GAU A;  4XBF A;  5JHU A;  3JCU C;  1IN8 A;  3BC8 A;  2LH9 A;  5GP9 A;  4J19 A;  3E0J B;  5EGO B;  2HDD A;  3S3N A;  4QLC U;  2O03 A;  5J4V A;  1XTA A;  3OL3 A;  3ZPL A;  3S3M A;  2HU9 A;  1W5T A;  1A04 A;  3KP4 A;  4XIC A;  3G71 I;  1U78 A;  4B3X A;  1W36 D;  3OS2 A;  4IHS A;  2ZC2 A;  2IAI A;  2ZXJ A;  3FKJ A;  4BJT A;  1Y1V J;  2CQK A;  2FUG 2;  3P9C A;  3PFI A;  5LGT A;  2FML A;  3IWF A;  2B63 J;  1I6X A;  4QTR A;  1U5T B;  2VKV A;  2LMD A;  2X1D A;  3RSN A;  1JJ8 C;  4M3D A;  3AG2 H;  3I3L A;  4UUS A;  1MW7 A;  4CCJ A;  4KMU X;  1YYV A;  3H0D A;  2EFQ A;  3NEU A;  1OCR H;  5H2F C;  3RTR A;  1NK2 P;  1JGS A;  2ZNZ A;  1ZTR A;  1YI2 I;  1WSU A;  3ZQ7 A;  2HKO A;  2QSF X;  1E3O C;  1MSF C;  2XF7 A;  4HNU A;  3HOX J;  4XKC A;  2WAD A;  1FTZ A;  3CES A;  1P4A A;  5EG0 B;  5CVI A;  1LNW A;  1K61 A;  1X3U A;  2PG4 A;  2VKE A;  4XOP A;  1WHU A;  4S04 A;  4BBS J;  1W4M A;  3S1Q J;  2OTJ I;  2CS3 A;  4G9Y A;  1HF0 A;  1I1G A;  2HDC A;  3HL2 A;  2BY3 A;  2R7O A;  4BAC A;  2QEX I;  2L4A A;  3WGI A;  3BPV A;  3COA C;  1PDN C;  4IHX A;  4UVC A;  4IHW A;  4QSH A;  3BR1 A;  1CF7 B;  2H1L A;  2XB5 A;  2F5F A;  3LFK A;  1IDZ A;  2BW3 A;  1TNS A;  2F5E A;  1FIP A;  2ZSI B;  3AG4 H;  3ZMZ A;  2K9N A;  3C3W A;  5JFR A;  4BS9 A;  3LWF A;  1BOA A;  4JK1 X;  3V7R A;  1O7F A;  3FXR A;  4ZYD A;  3VB2 A;  3G73 A;  1U8B A;  3WTS C;  2L5Q A;  2DYR H;  1I39 A;  2MH2 A;  1P4X A;  4AWX B;  1FBU A;  4M9Z A;  5D4R A;  4LIV A;  1LE8 A;  5FGM A;  5DDG A;  1N75 A;  3RDI A;  1RR7 A;  2XGD A;  2GLO A;  3O8G A;  1A5J A;  2K7L A;  3H3Z A;  4OMY A;  1M1E B;  2DTR A;  2W84 A;  3BZ6 A;  3GEZ A;  1ZYR F;  2K9M A;  2A5Y B;  2NVQ J;  1NH3 A;  2M3A A;  3KP2 A;  1WGX A;  4B1R A;  5M5Y J;  3LNQ A;  2HDW A;  2ZNY A;  2DPD A;  1H88 C;  3OIP A;  4EGY A;  2K9S A;  1SMY F;  2CH0 A;  4EJT A;  1BIB A;  1Z05 A;  4ITV A;  4RLQ A;  2WY8 Q;  5IP9 J;  5LHG A;  1I5Z A;  1FSE A;  2ZBK A;  5GAE J;  3I55 I;  1W0T A;  2VPR A;  1APL C;  2DT7 B;  3FM3 A;  1XMX A;  2MD5 A;  3I59 A;  1ZGJ A;  2WV0 A;  4ESB A;  1PP7 U;  2CWE A;  3ZQG A;  1SAX A;  2AQE A;  3K4N A;  3QYF A;  3U9G A;  3KEQ A;  3BTL A;  4KJZ A;  4BEH A;  4MQ9 F;  2ETH A;  2ECC A;  3OIQ A;  3LSP A;  4BQQ A;  2H6C A;  1Y0U A;  3BY6 A;  5ICG A;  2VQG A;  4KIG A;  1YS6 A;  2LY9 A;  3HOU J;  3S16 J;  3CJT B;  2FE3 A;  2HZT A;  4BY7 J;  5AIP A;  2LDU A;  3Q0U A;  1LFB A;  2EK5 A;  1JHH A;  1KQ8 A;  1ETW A;  2DOA A;  1OYY A;  2KIM A;  3NWS A;  1Q1H A;  5IPA A;  2JK3 A;  4P1W A;  4IXA A;  2A5W A;  3GTK J;  1PUF A;  1SD4 A;  2LY2 A;  2OZ6 A;  3ABM H;  5IYD J;  1J9I A;  2FBK A;  4I98 B;  3O3K A;  5DYM A;  4YIF A;  1MBE A;  1FOW A;  2FMY A;  2ZJ2 A;  3CF5 F;  2EFW A;  2JQ7 A;  4XLE A;  2HEO A;  3CCJ I;  1YHQ I;  3BR2 A;  4GYI A;  1D1A A;  1ZGW A;  5CLS A;  2GXG A;  2ZJR F;  3A4C A;  4XM3 A;  2XGX A;  5J8F A;  3J7A Y;  2OV7 A;  1EA3 A;  2ZXH A;  1Y8R B;  2VT3 A;  1WJ5 A;  2L02 A;  5JHF A;  2LF8 A;  2LBF B;  2PLY A;  3C1D A;  2JVG A;  1V3F A;  2ZCW A;  1KU9 A;  3K4B A;  3OR1 C;  2JSC A;  1MMG A;  3WU2 C;  4K2E A;  3RQ4 A;  5M3F J;  2DK5 A;  2XV4 S;  4CXF A;  2MGQ A;  2PJR B;  3K9T A;  4MFD A;  3KCC A;  5LRS A;  1GV5 A;  3LA7 A;  3CCQ I;  3D1N I;  4IKF A;  3DKX A;  2DDB A;  1QQI A;  4OIQ F;  1UZC A;  1HOM A;  3ZQL A;  2EA2 A;  3I4N J;  4DJA A;  1GUU A;  1JXS A;  2DMT A;  2W85 A;  2CG4 A;  1TWG J;  4MLO A;  4PSX A;  4PJL A;  1HW2 A;  1QU3 A;  2GXA A;  2E7W A;  5ICF A;  2N8G A;  2FQ3 A;  2Z33 A;  3GTQ J;  4AIH A;  1HKS A;  2QQB A;  2DJI A;  2CMP A;  2VC1 A;  2NVY J;  2IRF G;  4LLN A;  1JUS A;  3ZMS A;  1MJB A;  4N4O B;  5L3B A;  1XCV A;  3TDZ C;  5DUI A;  2BGC A;  1NHA A;  4W97 A;  3S8P A;  1I27 A;  3U1K A;  1MBK A;  2CGP A;  3MQ0 A;  1C0W A;  4H0E A;  2YX7 A;  3HXL A;  2P8T A;  2LNB A;  2XGE A;  3BR0 A;  1XC5 A;  4OOI A;  5IT9 K;  5F27 A;  1MJ9 A;  1YX3 A;  1YLF A;  2A68 F;  3UNG C;  5IP6 A;  1QHG A;  3SYT A;  3TDU C;  4A12 A;  4BBR J;  3J80 K;  1VQL I;  1YX5 A;  4D5C A;  5M3M J;  2EIM H;  1J7K A;  3K1P A;  4CCN A;  2DT5 A;  5LD2 C;  3ZQI A;  4I01 A;  4LG3 A;  3TKY A;  3JRG A;  1VFC A;  4BQO A;  3HB9 A;  1YJN I;  5EZG A;  4JOM A;  2FRH A;  3OYL A;  4RAZ A;  5EZH A;  3JW4 A;  3MFK A;  3KX2 A;  3QWL A;  3HG9 A;  4E6K G;  3TP3 A;  4HQM A;  1XPX A;  2R7S A;  1ORK A;  2PEX A;  2LFB A;  3PQJ A;  5FD6 A;  4IEJ A;  3IHU A;  4A3M J;  4KIC A;  5DD8 A;  2F4O B;  2GQQ A;  3DTI A;  5F6F A;  1RZ4 A;  3ZXS A;  1W0U A;  2VOP A;  3K10 A;  1B4A A;  3L7W A;  4KNY A;  3FMQ A;  2UUZ A;  2L3D A;  1JJ6 C;  3B73 A;  2MSY A;  2HXI A;  5CQG A;  3KYD B;  2F48 A;  2V1D A;  2LSO A;  3FXU A;  2G7H A;  3RKY A;  1VQ9 I;  3BG9 A;  2CQX A;  3JAM K;  1LB2 A;  2IPQ X;  2V1X A;  1AWC A;  2E1M C;  4KYW A;  2A6T A;  4HF0 A;  1MGT A;  1FP1 D;  4E4H A;  4FHT A;  2NS7 A;  4RB2 C;  3TO7 A;  3LSG A;  3JAM Z;  2KRC A;  4A0X A;  4P9U A;  1J75 A;  1BC8 C;  1ON1 A;  2PBI A;  4KIB A;  1Z6R A;  1LPQ A;  5KAI C;  2QKM B;  1X2N A;  3KLN A;  3DLL F;  1KYW A;  1UMQ A;  3OWT A;  3JRI A;  3IWZ A;  2MC3 A;  1AKH A;  3DBR B;  1H0M A;  2DAO A;  2H94 A;  4OMZ A;  1SFX A;  3H3U A;  2NAZ A;  2NOJ B;  1WH7 A;  2DFE A;  2M45 A;  1R71 A;  5L3D A;  3L2R A;  4M6X A;  2KIU A;  2EZH A;  1IZ1 A;  1R9T J;  1JKP C;  2M0C A;  2K85 A;  2IGO A;  1TLH B;  3QAH A;  3V8L A;  3B6A A;  3OSG A;  1ZHF A;  4OAY A;  3BDD A;  1LDD A;  3BQY A;  3T8R A;  5EGO A;  2QKL B;  1BOB A;  3SDG A;  4A3D J;  5H6R A;  5AON A;  1DP7 P;  2LKP A;  3AKZ A;  3RZD J;  1ZG3 A;  1BM9 A;  1WFX A;  3VPR A;  2QSG X;  5D8L B;  2VJI A;  2COM A;  1A36 A;  1X1B A;  2Z9O A;  2Z1D A;  2V26 A;  5DM6 F;  4I99 C;  3E5X A;  3HIF A;  5IYC J;  1WI3 A;  3WG7 H;  4A2U A;  1S6L A;  2DT6 A;  5ERI A;  2V4J C;  5F1R A;  1KGS A;  1U5T A;  4HF2 A;  4JYK A;  5LGU A;  2XC7 A;  5FB2 A;  2EB7 A;  1DGW Y;  1DU0 A;  1W7P B;  3BOQ A;  2XRL A;  4XL9 A;  3QPH A;  3K4J A;  1XSX A;  4RLF A;  1XDS A;  4MNU A;  2Z16 A;  2I10 A;  4LJZ F;  5L3C A;  1BC7 C;  2H27 A;  2EH3 A;  3FXM A;  3ZMU A;  4HPQ A;  3ELK A;  2JJ7 A;  5EG0 A;  4P9F A;  5E8G A;  3LQR A;  2ZFW A;  4CZZ A;  4A3L J;  3T1B A;  3MKY B;  2BY0 A;  4FET A;  5E17 F;  5IP7 J;  3KLO A;  2R7F A;  2ICW G;  3EQL F;  5B3S H;  2VKH A;  2HTS A;  1WVR A;  1ZG5 A;  2DPU A;  1BBY A;  2DOD A;  1IUY A;  1JUP A;  4BHP A;  5LHI A;  3K4K A;  2RRE A;  4AU7 A;  1Y0N A;  4UY8 I;  1JUM A;  5L3G A;  1CF7 A;  2K40 A;  1BJZ A;  1REP C;  2VJ4 A;  3TL4 X;  3LA2 A;  4E7L A;  2F2E A;  3ZCO A;  4UV9 A;  3SEQ A;  3WHB A;  2IP2 A;  4WF2 A;  2WTE A;  2KPM A;  4PK4 A;  3L2W A;  3IKV A;  1UAA A;  2G0E A;  3K6G A;  3I59 B;  2ESN A;  1R6R A;  2RV8 A;  1N25 A;  2DA6 A;  2L2O A;  1DUX C;  4L9J A;  3VYT B;  2GIV A;  2LR8 A;  2E7X A;  4ENK A;  5GTI C;  4XOT A;  5FLX K;  2FEZ A;  1K83 J;  2E19 A;  2FNA A;  3HBL A;  5E3L A;  3O8H A;  4Y15 A;  1IJW C;  1MBH A;  3D0S A;  3SZT A;  2A07 F;  5JI6 A;  2QUF A;  1YW8 A;  2E36 A;  4DYC A;  2H8R A;  2UXN A;  4P96 A;  4NNJ A;  1T39 A;  2PMZ N;  5H6Q A;  1XMA A;  4OIO F;  4FX0 A;  3OYJ A;  3M3Y J;  4DBR A;  3LA3 A;  2L7M P;  3OYK A;  1T0F A;  3EUH C;  1PUF B;  2EFO A;  4C9Y A;  4ENN A;  4BYY A;  3OYA A;  4I2O A;  3LST A;  5D6E A;  1HKQ A;  2HFH A;  5HDK A;  1LEB A;  3FBI B;  1FOY A;  2CSO A;  4XRM A;  1OMI A;  4I0B A;  4CYD A;  3CCS I;  3JRD A;  1TZL A;  4EJO A;  1XGN A;  4ZYA A;  3AAF A;  1WJA A;  2L9N A;  2EPF A;  2IA2 A;  1BJA A;  1WI9 A;  4A3B J;  3I58 A;  3R6S A;  2MAB A;  1B59 A;  4CH7 A;  4Y7N J;  5J1R A;  4IHY A;  4U0V A;  2M4G A;  4M3G A;  2M34 A;  3S2D J;  3CUQ A;  1ZAR A;  5J40 A;  5HDG A;  3Q5F A;  5F08 A;  2HOT A;  1OCO H;  2LRD A;  2XAS A;  3CCV I;  4LLG F;  4LK0 F;  2AXT C;  2HQN A;  1TNT A;  3M4O J;  5J1U A;  3ULQ B;  5FRN A;  2CV1 A;  5HLH A;  1LFP A;  1X1D A;  3PQK A;  3REO A;  1YIT I;  1W7P D;  3CCL I;  1YG2 A;  3MZH A;  1FPQ A;  4ZTF A;  3PNV A;  4AIJ A;  4AYB N;  1UB9 A;  2VBZ A;  1DP3 A;  1B8I A;  3OSF A;  4CUG A;  2DFF A;  3OYN A;  5E20 A;  3GLX A;  3AL0 C;  3GZ5 A;  3WOD F;  2DFI A;  3FKI J;  4RBO A;  3SEZ A;  5TGT A;  4M3B A;  4I02 A;  2JRT A;  5KK1 A;  2JUC A;  3EUA A;  1ZN2 A;  3PUB A;  4XRS G;  3LSR A;  4RS8 A;  3IAM 2;  4IZZ A;  1KON A;  2HVR A;  2IEK A;  5E18 F;  3M8F A;  5CVR A;  3HHG A;  5HS8 A;  1RUO A;  2A6E F;  2GM4 A;  5EEA A;  4BXF A;  4WWC A;  4FCY A;  2YU9 J;  2V1N A;  4Q4Z F;  4I6Z A;  1YW7 A;  5CVV A;  3T5X A;  3K70 D;  4O3M A;  1B1B A;  4Q5S F;  3WTY C;  5J47 A;  2ZJQ F;  4MFE A;  4UUT A;  4EEF G;  3DU6 A;  3U21 A;  2X9D A;  2O0Y A;  2ZSH B;  5KHD A;  1EF4 A;  1BW5 A;  1FYM A;  1FOK A;  1BI1 A;  1YJ9 I;  1W1W E;  2EIN H;  2IS4 A;  2DO7 A;  2K4B A;  3GTP J;  3V7C A;  1TWF J;  4RM3 A;  2VQL A;  1JE8 A;  3HOS A;  4HBL A;  4E7Z A;  5E3M A;  1X1C A;  5CPR B;  1TP4 A;  3L2U A;  4A5M A;  3O2P E;  2JN6 A;  3OY9 A;  3RZO J;  4XRS A;  1VQ4 I;  4C3J J;  2W57 A;  2LD5 A;  2O8K A;  1E2X A;  3MKZ A;  3OYB A;  3EUK L;  3X2Q H;  2CJJ A;  4HEA 2;  2G7U A;  1K6Y A;  3V8K A;  2M7B A;  2L7F P;  3SDB A;  1XMK A;  3GTM J;  5ILV A;  2Q8K A;  3HOY J;  2FQ4 A;  4A3C J;  2HOA A;  3GZ6 A;  1D1B A;  2E2I J;  2IS6 A;  3KP7 A;  2X4H A;  3MVP A;  3ABL H;  4BE0 A;  1UHW A;  4JX4 A;  3HM5 A;  4LD5 A;  5FLV A;  3HDD A;  2M8G X;  2BYV E;  5HDN A;  1VQM I;  4ZZD A;  1KYZ A;  2VBX A;  4PFP A;  3H5N A;  2PN6 A;  2NXN B;  4WXH A;  3HKZ N;  5TJJ A;  1NK3 P;  2DMN A;  4Q48 A;  3FBN B;  1AKH B;  1AHD P;  1KQ9 A;  3GW2 A;  3F8F A;  2R93 J;  4ZZL A;  5D8K B;  1CGP A;  3W3C A;  1Z6T A;  2HI3 A;  5E3O A;  1VQN I;  4YFX F;  1T8I A;  1U2W A;  1FC3 A;  4FX4 A;  2M30 A;  3ESW B;  2VE9 A;  1TQI A;  4Y33 A;  2F6C A;  2DA3 A;  2HOE A;  5D5X B;  4FE4 A;  2RGV A;  4HG2 A;  3I5U A;  2A69 F;  3U2R A;  1S7O A;  3BTC A;  4N9H A;  4DZP A;  1Z1D A;  2CUF A;  4ENJ A;  3K0L A;  1WJF A;  2IGM A;  2RN7 A;  4QIW N;  3SFI A;  2R7U A;  3KP6 A;  4Y4R A;  4UV8 A;  4M73 A;  3CO6 C;  1FTT A;  4R79 A;  2KKO A;  2CUE A;  3HPG A;  3OYF A;  1GVJ A;  4UHT A;  1D8K A;  3A0B C;  4AVP A;  1B9N A;  5D5U B;  3DEW A;  4U88 A;  2VN2 A;  4IRI A;  3RI4 A;  1WJC A;  2GA1 A;  2GA2 A;  2KP6 A;  3BJ6 A;  3HJE A;  4LOC A;  3IH2 A;  5E3N A;  5TIS C;  1S5L C;  3VYU B;  3OYC A;  3M9A A;  5M5W J;  4N4N B;  3ZQH A;  1GXQ A;  3BTI A;  3Q3S A;  2DCE A;  3ZR8 X;  2IBD A;  4C3I J;  4NUB A;  4KN7 X;  2KRF A;  2Q2E A;  4NB5 A;  4AD9 A;  3QPL A;  4B4C A;  4BXU A;  2L9V A;  2Y9Y A;  2COB A;  3KFW X;  3M1C A;  4ZJZ A;  3AG1 H;  1FYK A;  2DA4 A;  5ILS A;  5LLQ A;  2W25 A;  4XMY A;  1XCB A;  3TO9 A;  4B47 A;  4CCK A;  1ZRF A;  1P7J A;  3BP8 A;  2EV0 A;  2E2H J;  2O61 A;  4O5V A;  3LSH A;  3HPH A;  5DV5 A;  4Z6Y A;  2QA4 I;  1GDT A;  1HBX G;  4EVI A;  2YSR A;  3GFI A;  2ZME B;  3HTU A;  2IGN A;  3OOU A;  1I1S A;  2V6C A;  2LF7 A;  1D5V A;  4I76 A;  1WRJ A;  1G2H A;  4KIS A;  3GF2 A;  3GME A;  3MZ8 A;  4RMN A;  1I50 J;  1W7P A;  4GCV A;  1NG7 A;  3J81 K;  3NAU A;  1MMN A;  2V9V A;  1YFH A;  3C2H A;  3MKL A;  4D0P A;  4YEL A;  4AYB A;  2DK8 A;  3V7S A;  1JTY A;  3J81 Z;  4L0Y B;  1OR7 A;  2PX9 A;  3R4K A;  4B43 A;  3J7Y J;  3QU3 A;  1DGR M;  3VYS B;  3IRQ A;  1GHC A;  3MCZ A;  4RM2 A;  2K02 A;  3QYB A;  4UVB A;  2UWM A;  1IN6 A;  1ZGA A;  2MBF A;  2KT0 A;  2OCC H;  1EKE A;  4N0B A;  3PIP F;  2VL8 A;  3GCM A;  4EJW A;  2R7W A;  2K9L A;  3BZC A;  4PGH A;  1R1U A;  2M1B A;  5ICC A;  3E6C C;  1D0X A;  4D7N A;  3WHC A;  3P5J A;  1T56 A;  2LG4 A;  1X1P A;  2UZK A;  2LC2 A;  2RAE A;  1WPK A;  1EH6 A;  4RAF A;  4E7K A;  2XPU A;  2HKX A;  3ML6 A;  1LDJ A;  2X85 A;  1YW9 A;  2MD0 A;  3BR6 A;  4BAY A;  5K1Y A;  4DGW B;  4Y52 J;  4F92 B;  4Q47 A;  3CDI A;  1OYI A;  2FJ1 A;  1F9N A;  5H20 A;  1ACI A;  3I54 A;  2DQR A;  1L0O C;  3MZY A;  5FKN A;  1QNT A;  4NBQ A;  1VQ5 I;  4ZDP A;  1BA5 A;  2P5K A;  5HLT A;  2R7T A;  3PJR A;  2IXS A;  1HW5 A;  1RRJ A;  4BH9 A;  1FSH A;  2ZXI A;  4BHB A;  3CUQ B;  3CME I;  2VLA A;  3E1S A;  4A3E J;  4HYE A;  4RDU A;  3M8J A;  3HSE A;  5HS9 A;  2DXI A;  4HX7 A;  3W6J B;  3ERE D;  4JP0 A;  2LOO A;  2O8X A;  3GBG A;  4X1E A;  5HLI A;  2VOO A;  1DPU A;  1FBS A;  3BT9 A;  3CZ6 A;  4NHJ A;  1Z91 A;  2KJB A;  5F0H A;  2L0K A;  3QP5 A;  3ZRG A;  2BY2 A;  3IRR A;  4E7J A;  2VOD A;  3DPU A;  1SMT A;  1KQ0 A;  5J3L A;  1B8I B;  1T33 A;  2GIZ A;  2OAZ A;  3ASO H;  4IRH A;  4UB6 C;  4ABZ A;  2IW5 A;  2OBP A;  1RKT A;  1ULY A;  3FDY A;  5CYV A;  4J01 A;  2H1K A;  4V2G A;  1TWC J;  3F8M A;  4Y13 A;  3G2B A;  2WC2 A;  4IJA A;  1A6Q A;  3A02 A;  2Y30 A;  3F9K A;  5EYR A;  4CCM A;  3K70 C;  4E7H A;  3WU1 B;  1POG A;  2JA5 J;  1ZEL A;  2I5U A;  1MKM A;  3C2G A;  3WTW C;  5EDN A;  2R3S A;  2R7V A;  3D5S C;  3EET A;  1SAN A;  1XX5 A;  2X6W A;  3GYH X;  1GT0 C;  3VSK A;  3CCR I;  4OWR B;  1O3Q A;  1E17 A;  1TBX A;  5C3E J;  3D5L A;  2DN0 A;  3OMY A;  4EJU A;  2QZ8 A;  2KQR A;  1HW1 A;  2JRM A;  2KIS A;  4U0Y A;  2WWY A;  4L9T A;  3O6B B;  2XB0 X;  4CHU A;  1S72 I;  1Z0X A;  4MHG A;  2CV0 A;  3FXL A;  3OIO A;  1ETV A;  2X0L A;  4DQ2 A;  3FMS A;  2E1O A;  3W2V A;  5L3F A;  4BE2 A;  2E1C A;  1K7A A;  1V5F A;  3KEO A;  2E35 A;  9ANT A;  1MJA A;  4M74 A;  2EIJ H;  2M2E A;  2CFX A;  1SFU A;  3WE3 A;  1H9T A;  2XRN A;  1PP8 F;  5EEG A;  2BV6 A;  2GWR A;  2DI3 A;  3TMO A;  4XLF A;  2KL4 A;  5FFX A;  5FKO A;  2EZL A;  1P92 A;  4XSX F;  5B1B H;  2V79 A;  3ECH A;  2QEN A;  5B66 C;  3FIS A;  2E5N A;  3L1P A;  1BR4 A;  3E5U A;  2C6Y A;  4XNF A;  2ZKZ A;  4XN3 A;  2W48 A;  3HRT A;  2VJ5 A;  3SZP A;  3IH3 A;  2MFZ A;  2MLK A;  1D0Z A;  2QQA A;  3E6D A;  2EWN A;  2EJR A;  3L00 A;  3M1E A;  2V7F A;  3LSK A;  3S15 J;  2P6S A;  2BE5 F;  2OU2 A;  1T6S A;  4ASN A;  4A3G J;  1VND A;  3KYC B;  1IW7 F;  2X1C A;  4PJM A;  4JX5 A;  4XLP F;  3KPH A;  2XKP A;  1HC8 A;  3CC4 I;  3TW7 A;  4BQA A;  1ETQ A;  1V55 H;  1W36 C;  3V42 A;  2HVS A;  3S3O A;  4KUM A;  1Z7L A;  2DA5 A;  5E1W A;  5IOZ A;  1IXR C;  2R5Y B;  2EA4 A;  4DNC A;  3DP7 A;  4M9X A;  1AA7 A;  2FXA A;  3KZZ A;  4YG2 F;  3WGG A;  3W2A A;  2VBW A;  2KJC A;  2F4M B;  4MTE A;  4WK8 F;  2BOL A;  1PJR A;  3M8E A;  3RPQ A;  3G1O A;  5JLX A;  4PJJ A;  2F5D A;  1FYL A;  1J0R A;  4U7B A;  1PUE E;  2HWV A; 
#chains in the Genus database with same CATH homology
 3E0J B;  2M4G A;  3S3N A;  4GRI A;  3ZGK A;  1X4P A;  2V6E A;  1D0Y A;  3HKZ A;  3OL3 A;  2M0M A;  2Q2E B;  3S3M A;  2HU9 A;  2LRD A;  2R7R A;  4B3X A;  1W36 D;  3OS2 A;  3PNY A;  3L2V A;  2W82 A;  3FKJ A;  2KZV A;  4BJT A;  5FRN A;  3DTE A;  3VDX A;  2FUG 2;  3ZQQ A;  3VYR B;  2CV1 A;  1LFP A;  1X1D A;  2GOM A;  3KEY A;  2X1D A;  3RSN A;  1LKX A;  3I3L A;  4ZTF A;  1MW7 A;  4CCJ A;  4B44 A;  3PNV A;  3H0D A;  4IQ4 A;  1DP3 A;  4YRV A;  3RTR A;  3S93 A;  5CKT A;  1N78 A;  3CP8 A;  4CUG A;  3OYN A;  4ZTJ A;  2XF7 A;  3AL0 C;  4HNU A;  4XKC A;  2WAD A;  3SEZ A;  3CES A;  5TGT A;  2VXD A;  5KNL A;  2CW7 A;  4ZDO A;  3EUA A;  3PUB A;  4IZZ A;  3IAM 2;  1KON A;  4XOP A;  3W2W A;  2XF5 A;  2HVR A;  4E7I A;  4BU2 A;  4XLA A;  2XSJ C;  2CS3 A;  4AVZ A;  2VAS A;  4F55 A;  2R7X A;  4BXF A;  2X1E A;  2V1N A;  4PUS A;  4XN0 A;  4HST A;  3HL2 A;  2KHM A;  2R7O A;  3K70 D;  1X4O A;  4BAC A;  1Y6I A;  2UV1 A;  3DU6 A;  3U21 A;  2ZSH B;  5KHD A;  4CCO A;  3LFU A;  4P5O A;  3PSF A;  3OYE A;  3IP4 B;  2BW3 A;  2IS4 A;  1GLN A;  3OYD A;  2ZSI B;  2VJJ A;  3IAS 2;  4RM3 A;  4XQF A;  2VQL A;  5LFA A;  4BS9 A;  3HOS A;  5FRM A;  4E7Z A;  2XAU A;  1X1C A;  3MMY B;  5CPR B;  3L2U A;  3PNT A;  3DPT A;  2L5Q A;  3QOE A;  2I8D A;  3OY9 A;  4LIV A;  3MKZ A;  3OYB A;  2RQQ A;  3EUK L;  1N75 A;  3EPZ A;  4HEA 2;  1K6Y A;  2M7B A;  3PL8 A;  3SDB A;  4X0G A;  1BR1 A;  4QPQ A;  1LVK A;  4NC8 A;  4C2T A;  2W00 A;  2K9M A;  3HC7 A;  3AFH A;  2M3A A;  4G6T B;  3OYI A;  1D1B A;  2IS6 A;  3H9Q A;  1V5G A;  2HDW A;  3DU5 A;  4HRI A;  3LL7 A;  4PJN A;  4U87 A;  4BE0 A;  3OIP A;  3OS1 A;  5HOO A;  2CH0 A;  4HSR A;  3HOT A;  2O5R A;  4ITV A;  4RLQ A;  5CQE A;  2WY8 Q;  1P9Q C;  2M7A A;  4F52 A;  4PFP A;  3H5N A;  2DT7 B;  3FBN B;  1ERD A;  3BG6 A;  2AQE A;  3CP2 A;  3DEE A;  3K4N A;  3QYF A;  2KDO A;  3W3C A;  4KJZ A;  4BEH A;  1PYV A;  3A1Y A;  3OIQ A;  4BQQ A;  4E7S A;  2W1O A;  3OL4 A;  3H9G A;  3L2Q A;  4II2 A;  2VQG A;  3ONQ A;  4ZDL A;  4C2U A;  1BR2 A;  4II3 A;  2VXZ A;  4Y33 A;  4F93 B;  2F6C A;  4HG2 A;  3DKY A;  4BDZ A;  4LIU A;  4B48 A;  3BCA A;  1MMA A;  2DOA A;  3NWS A;  1WJF A;  2Q1Z B;  3QOD A;  2IGM A;  3CJQ B;  2A5W A;  3PSI A;  4P1W A;  3MKW B;  2R7U A;  4Y4R A;  2LY2 A;  3FHN A;  2L9S A;  4R79 A;  3TBI A;  3CMM A;  2ZFU A;  4XLE A;  3HPG A;  3OYF A;  3VWB A;  1D1A A;  3A4C A;  4BUP A;  4IQJ A;  1X19 A;  4XM3 A;  1WJC A;  3J7A Y;  1UEL B;  2OV7 A;  1EA3 A;  2KP6 A;  2WAE A;  3IUO A;  2ZXH A;  2XDV A;  1VZ0 A;  1WJ5 A;  5JHF A;  2LBF B;  3LMM A;  2WA0 A;  3VYU B;  3OYC A;  3DQV C;  3BCB A;  4N4N B;  2DCE A;  2JVG A;  3ZR8 X;  4DOZ A;  4NUB A;  4DIQ A;  3K4B A;  3OR1 C;  4NC7 A;  3OS0 A;  1MMG A;  2JVH A;  3LSM A;  3RQ4 A;  3M1C A;  2LY1 A;  2PJR B;  4ZJZ A;  2MC4 A;  4XMY A;  4B47 A;  4CCK A;  1T0F C;  2BW3 B;  4IKF A;  2E1M B;  3DKX A;  4CCL A;  2R4G A;  2VPL A;  3LSH A;  3HPH A;  2OUM A;  1T95 A;  2IGN A;  3OOU A;  4DJA A;  2AQF A;  2KMU A;  2M4K A;  4MLO A;  4PSX A;  4PJL A;  4NQW B;  1QU3 A;  4BQN A;  4KIS A;  4BE1 A;  4CA0 A;  4RMN A;  1HA8 A;  3MD2 A;  1SFK A;  1DQU A;  1NG7 A;  1MMN A;  2CMP A;  2DJI A;  2L7K A;  3C2H A;  4N4O B;  4YEL A;  4AYB A;  3PFY A;  3S8P A;  4KIT B;  2R7Q A;  3OR2 C;  4XON A;  4B43 A;  3HXL A;  4BJ6 C;  1DGR M;  3VYS B;  4RM2 A;  3QYB A;  2VQC A;  2HVQ A;  2WBM A;  3DTK A;  1YX3 A;  2UWM A;  3UNG C;  1S9H A;  3NWT A;  1QHG A;  3SYT A;  3LSI A;  4ANJ A;  2CV2 A;  1YX5 A;  2CW8 A;  2HPI A;  4CCN A;  5LD2 C;  2VL8 A;  2R7W A;  2K9L A;  2X6X A;  2JSP A;  4LG3 A;  1Z3X A;  1D0X A;  4BQO A;  5HVQ C;  4BDY A;  1QHH D;  1SAU A;  2HQA A;  2LG4 A;  4JOM A;  2LC2 A;  2VIX A;  3OYL A;  4BL0 B;  3KX2 A;  4XLH A;  4E7K A;  3HG9 A;  4E6K G;  2X85 A;  2R7S A;  4D9J A;  2MD0 A;  3OYM A;  1MMD A;  3CF2 A;  4BEH B;  4DGW B;  1WJD A;  4XR6 A;  4F92 B;  3KYL A;  2OC6 A;  2Y0S A;  2K5C A;  2X51 A;  3ZXS A;  3DTI A;  3K10 A;  4F3Q A;  4ZDP A;  5HLT A;  3BLY A;  2R7T A;  2UUZ A;  3HUG B;  4U7B A;  4J00 A;  2IXS A;  3RPU D;  4CZC A;  3PJR A;  2IS2 A;  5CQG A;  2ZXI A;  2VLA A;  3E1S A;  3M8J A;  4LIT A;  2E1M C;  2DXI A;  2A6T A;  2LOO A;  4E4H A;  3GBG A;  3CZ6 A;  1LDK B;  3LSG A;  2KLO A;  2KRC A;  4JQF A;  3K4C A;  3ZRG A;  2QKM B;  3K4L A;  3VSL A;  4E7J A;  2IGK A;  3OWT A;  3DPU A;  4KT6 A;  1X1A A;  3DPL C;  2BVM A;  1YE9 A;  2PMZ A;  1V5E A;  2GOX B;  2NOJ B;  2WAQ A;  4J01 A;  3FDY A;  2CUJ A;  3L2R A;  2IS1 A;  2IGO A;  4OAY A;  3G2B A;  3RCO A;  4F91 B;  2QKL B;  3F9K A;  1BOB A;  4CCM A;  2W4S A;  2K3P A;  3K70 C;  3SZG A;  4E7H A;  3AKZ A;  2VQH A;  1ZEL A;  1WFX A;  2F4I A;  3C2G A;  3BG7 A;  2VJI A;  2X6Y A;  1X1B A;  2Z1D A;  2R7V A;  2V26 A;  3D5S C;  3D5R C;  2HPM A;  1FMW A;  3K4M A;  2CFO A;  2X6W A;  4YEJ A;  2XF6 A;  3VSK A;  2E60 A;  2DT6 A;  2V4J C;  4Y3O A;  4OWR B;  3S32 A;  2W7N A;  2XC7 A;  2LYC A;  3D5L A;  1DGW Y;  3OMY A;  4XKV A;  4XL9 A;  1MND A;  2KQR A;  3K4J A;  4RLF A;  4ZC3 A;  2Z16 A;  2WAF A;  2LBF A;  1NG6 A;  5HNH A;  2WB1 A;  4HPQ A;  4HNT A;  4D1Q A;  2CV0 A;  2MYS A;  1U0J A;  4H4K C;  1G8X A;  1G59 A;  3MKY B;  4FET A;  3W2V A;  3QYE A;  2JUG A;  4BE2 A;  1V5F A;  4BJ5 C;  2PJR A;  2VKH A;  3DWL E;  3N05 A;  3H9J A;  2JA2 A;  3I9V 2;  3K4K A;  2RRE A;  4AU7 A;  4DBQ A;  3TMO A;  4XLF A;  2KL4 A;  4XKB A;  5KCM A;  2VJ4 A;  3TL4 X;  4E7L A;  3ZCO A;  2V9K A;  3H35 A;  1N77 A;  2BVL A;  3SEQ A;  3OYH A;  2KPM A;  4PK4 A;  2E5N A;  1BR4 A;  2VB6 A;  3L2W A;  1MNE A;  1UAA A;  2VKD A;  3K6G A;  4XLC A;  4XNF A;  1R6R A;  4XOR A;  3AL0 B;  1UG0 A;  4PFO A;  4XN3 A;  2L2O A;  2CUZ A;  2VJ5 A;  3H5R A;  3VYT B;  4C30 A;  5FRO A;  2MFZ A;  4XKW A;  2P0W A;  1WJB A;  4BGD A;  2Z2S B;  1D0Z A;  4OAZ A;  2LRE A;  2V7F A;  3LSK A;  4XOT A;  4EAT A;  2ELJ A;  1J09 A;  1Y56 A;  1Z21 A;  3DLA A;  3OYG A;  2RNG A;  2HZD A;  2KRH A;  3UR3 C;  2X1C A;  4IX7 A;  4NNJ A;  4PJM A;  3OYJ A;  4DBR A;  3OYK A;  1W36 C;  3EUH C;  2WY7 Q;  4QPO A;  3V42 A;  1D1C A;  3S3O A;  2HVS A;  1Z7L A;  4C9Y A;  1TT0 A;  3OYA A;  2E5Z A;  1FMV A;  3FBI B;  3A2K A;  4PSW A;  4CSW A;  2F5V A;  1Z3Y A;  1AA7 A;  2HNH A;  1IRX A;  1TZL A;  3H5A A;  3W2A A;  4ZYA A;  1OLT A;  2BOL A;  1WJA A;  2L9N A;  5HNF A;  1PJR A;  1JI8 A;  3CJR B;  1E0E A;  1OR7 C;  1WJE A;  4PJJ A;  3BC8 A;  2LH9 A;  2MAB A;  4CH7 A;  4FAS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...