2M8EA

Nmr structure of the pai subdomain of sleeping beauty transposase
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
ASMGKSKEISQDLRKKIVDLHKSGSSLGAISKRLKVPRSSVQTIVRKYKHHGTTQHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords SLEEPING BEAUTY TRANSPOSASE
publication title NMR structural analysis of Sleeping Beauty transposase binding to DNA.
pubmed doi rcsb
source organism Synthetic construct
total genus 17
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m8eA00
3TO9A 3RI4A 3R61A 5DYMA 2HZTA 4HV5A 2AXLA 2JSCA 3GFIA 1P6RA 1BM9A 4HLYA 5BMZA 3F6OA 3I53A 4PGGA 3R0AA 3ERED 2WV0A 2EFNA 5HVQC 3E6BA 3N97A 4IRIA 5F64A 2C6YA 1JGSA 4UVCA 1RNLA 4GCVA 3ELKA 4ZYEA 2H6CA 2LF8A 3GFMA 3NEUA 5HDGA 3BJAA 1IF1A 4EVIA 2MBFA 3ZN1A 3ABUA 1FBSA 3E5QA 2HQNA 1XCBA 3L09A 5IT9Z 5FFXA 3F22A 4M6XA 1HW5A 1PUEE 2ESNA 5J8FA 2DAOA 3R6SA 3BROA 1W5SA 4M74A 5ERIA 2L01A 1K6OA 2CW0F 4UVBA 1G3WA 1XGNA 5LRRA 3FMSA 2WWYA 4I7HA 4HF1A 1ZRDA 3V8KA 2JZYA 3LAPA 1HXDA 2BYVE 2VT3A 5BPIA 5J6XA 3R60A 2E1CA 3ECOA 3K0LA 3FM5A 2PG4A 4GYGA 4ZYDA 4CHUA 2RVCA 4O5VA 1FSEA 2PEXA 4HDVA 1FOKA 3F8CA 1F4KA 2QENA 1IAWA 4I2OA 1S7OA 1HQCA 4O6JA 1AWCA 4NHJA 1QO0D 1IXRC 1CGPA 2XIGA 2GA2A 3L7WA 3J81Z 3WE3A 3E3VA 4KIFA 3M9AA 2QLZA 1EH7A 2VN2A 5BPDA 4G7HF 3M7GA 3QRFF 3HSFA 1USTA 5KK1A 4M71A 4KIGA 3TKYA 4DNCA 1R22A 4KMUX 5FB2A 4I01A 4Z2YA 4ZZDA 1MDMA 1R58A 3WTSC 3K1PA 2G9WA 1BI2A 1XGOA 3CTAA 2P5VA 4EM0B 1IUYA 4KIBA 2MD5A 5D6FA 1WSUA 2EFOA 2IA2A 2Z99A 5L3CA 3P9KA 5K5OA 2BV6A 3MAJA 3VEPA 4OIQF 3C3WA 3F8FA 4KN4X 3ZN0A 1H0MA 4IF4A 2O3FA 1TW3A 2EV5A 3DV8A 4RGXA 3Q5FA 2VC1A 3HUGA 4O3MA 4YFNF 4P9FA 1SFEA 2EV6A 4LMYA 1YTYA 1MJBA 1HSJA 3F23A 2HDCA 3J80Z 3QP5A 1TQIA 1BJAA 1SAXA 1ZRCA 3JW4A 3CO6C 2IA0A 4U7BA 3KZZA 3BJ6A 3WODF 2CYYA 1LDDA 2FQ3A 2DU9A 4UVAA 1T6SA 3LFKA 3CUQC 1ODDA 1YS6A 4XBFA 2FOKA 2GWRA 1J0RA 4Y13A 4L0YB 4MGRA 2PBIA 3U1DA 2CG4A 3FXUA 1V4RA 3E5XA 3WGGA 1ZLJA 4YG2F 5LLQA 2ESHA 2Q8KA 2YX7A 4B8XA 2V1UA 4YFKF 3WTXC 2LF7A 2ISYA 2QBYA 5IT9K 1FLIA 1ON1A 5D5XB 5ED4A 3COAC 2IPQX 2M1BA 1BN5A 1UFMA 6PAXA 3GWZA 2STWA 1GVJA 5TRDA 1O3SA 4U0WA 1FPQA 3MWMA 1XGMA 4AIJA 4EJUA 3FWEA 1GHCA 2PMHA 1SD6A 3ZMVA 2YX4A 1EH6A 2M5WA 1IXSB 3V4GA 2L02A 4R8HA 2HS5A 3C7JA 2KIMA 1IW7F 4YIIA 4A0YA 4HF0A 4LLNA 2O0YA 4LJZF 3OOPA 1MDMB 5L3GA 5D8LB 5DCFA 4PCQA 3T0YA 4R79A 3BDDA 1G3YA 1W7PA 5HS7A 4HX7A 2KRFA 3LQRA 4IXAA 1HKTA 4LGWA 2YPRA 3REOA 3I54A 1BIBA 2BBYA 2VOPA 4A12A 3AAFA 4G6QA 1YW8A 3GEZA 4UNOA 1J2XA 5EEGA 3TO7A 3TDUC 3J81K 1OMIA 2VBYA 4OIOF 2XASA 2PQ8A 2MH2A 3GO5A 2HR3A 1STZA 2R3SA 2P4WA 1L0OC 1BIAA 4EJOA 1ZG1A 4ZYGA 2PN6A 3I4PA 1K7AA 2P7VB 2FNAA 1B9MA 5LGTA 2NRAC 2OU2A 3F21A 4ASNA 3KLNA 4YFXF 3VB2A 1UHWA 1K79A 2KIFA 1ZAOA 4ETSA 4L9VA 1E2XA 3KP3A 2E7XA 2DPUA 1U8RA 3GX4X 3QPHA 4EGYA 3FM3A 1BC7C 1XMAA 1ZREA 3FXQA 4Q47A 2L54A 1YW9A 3QU3A 3IKVA 4FX0A 4GO1A 1XSDA 3F8NA 5D6EA 2Z3YA 2OD5A 1BI1A 1R7JA 1I27A 2QQBA 1Z91A 4QWQA 4A2UA 2IRFG 5HDNA 3CUOA 2ZO4A 3MZYA 2QBYB 3V7CA 1SFXA 2FMLA 5DUKA 3IRQA 2FEZA 1LEAA 1OYYA 3KCCA 5E1XA 4I09A 3IRRA 2R7FA 2M30A 3WTWC 3ZMUA 2LSOA 5H6QA 2UXNA 2ZMEA 2VC0A 1LQ1A 4WF2A 1G6NA 2A07F 5CJ9A 2M8EA 3HHHA 1WRJA 4WXDA 5FD5A 2DK5A 2P6TA 1R00A 3E5UA 2HOEA 4XSXF 2GA1A 1KYWA 1T0FA 3ZMZA 5LBQA 1AOYA 1USSA 1SD4A 5K5RA 4EQQA 4CO8A 2WC2A 3RYRA 2ZXJA 2UZKA 4MHGA 3JAMZ 4WCGA 1W7PB 2EFWA 3BPVA 5HLHA 4I0BA 4P5OA 2FBIA 3ML6A 1QGPA 2NS0A 1ZARA 2V1XA 2P8TA 2PJPA 4EJWA 1YFHA 2KKOA 2HGCA 3HTUA 2PFBA 2OZUA 2PLYA 1W5TA 4FX4A 4G9YA 1MD0A 2ELHA 1F1ZA 5L3EA 3TDZC 1ON2A 4IVNA 5E1ZB 1ZH5A 4UXNA 5DCMA 4CGZA 1P2FA 2JT1A 1SMYF 1V3FA 1XDUA 1EV7A 1F5TA 3O3KA 1MGTA 2ZNZA 2VE8A 2A69F 2JPCA 1IN4A 2QQAA 5LGNA 1DPRA 5EEHA 1BI0A 2A6EF 3P9IA 2EB7A 1TQMA 3F6VA 5JVTA 2P7CB 1U5TA 1WKMA 2Q0OA 1S3JA 5FGMA 1GXPA 3HRSA 2OZ6A 4OINF 2CWEA 2TDXA 5D4RA 3P9CA 2D45A 2VONA 4KN7X 4CICA 1UHMA 2DQLA 3KP7A 5ICGA 1YQAA 3T5XA 1S7AA 4GYIA 2ZMEB 3DXJF 2B0LA 2OBPA 2DT5A 4R1HA 1MJ9A 2G7HA 2P6SA 3PQJA 2V1DA 2F5DA 1R5GA 5CVRA 3BOQA 4LLGF 4PGHA 3I5UA 4U0VA 4WX9A 2VT2A 3R4KA 2ZFWA 4M9XA 2VE9A 3VFZA 2E7WA 5H6RA 2ZCWA 4ENMA 2MH9A 2A6HF 1KU7A 1J9IA 2FF4A 3SHFA 1W7PD 5LEJA 2DQRA 4LD5A 3GYHX 2VBWA 1ZG5A 1XDSA 1KU2A 1G4DA 1XCVA 1DPUA 2W85A 2XRNA 2YR2A 3Q9VA 2ETHA 3SZTA 3DF8A 4HBLA 1QZZA 2FRHA 2D2WA 2QM3A 1ZN2A 2XAFA 3GXOA 4Y17A 2XGXA 2RKHA 2CQKA 2RDPA 5DCMB 2HKXA 5LHGA 1PP7U 4HX8A 1FP2A 2HWVA 3WU1B 4LK0F 1R5HA 1X3UA 1TTYA 4OOIA 3SFZA 4Q5SF 2VBXA 3JAMK 5LHIA 5D5UB 3IL2A 1A04A 4BHBA 5DD8A 2F5CA 3M8FA 3JSPA 4KYWA 2GQQA 2Z5UA 4B09A 2IVMA 4LLLA 3MCZA 1B6AA 3GF2A 4I02A 1K78B 3SXYA 2K02A 1U5TB 1I6XA 2DLLA 3IC7A 4M6YA 1KQ0A 2NYXA 1TNSA 1HW1A 1TQPA 2CGPA 4EM2A 1S29A 1NHAA 2HFHA 3C18A 2Y0MA 3KZYA 3ZP5A 1OR7A 2AS5F 1RIOH 1QQIA 4ESFA 1O3QA 3K69A 4LFUA 3GW2A 5ILVA 4MTEA 4U0YA 3JTGA 2H94A 2DPDA 1D8JA 1JXSA 4M9SA 1J5YA 2FXAA 1LNWA 1PDNC 3RKYA 1QNTA 2VODA 2EJRA 2EFQA 2ZNYA 2P5LC 3G3ZA 3HHGA 4XRFA 2FSWA 3BZ6A 1F9NA 3ROUA 3QP6A 4KNYA 1Q1HA 3N4MA 2RNJA 5AIQA 4I98B 1B4AA 2HTSA 1ZYRF 4L9NA 2CSOA 3HRUA 3RKXA 4FHTA 3IKTA 1XGSA 2GXGA 1L3LA 1B9NA 4GXOA 1SD5A 3RKWA 5D5VB 3M1EA 1WI9A 1YYVA 4MTDA 2FMYA 3BWGA 4MNUA 3WE2A 1O7FA 3PQKA 4EJVA 4EJTA 3I0TA 3VOEA 5CYVA 3TOBA 3DPTA 1H9TA 2XAQA 2LNBA 3NQOA 4CZZA 4EM1A 3R0JA 2EV0A 2A5YB 1IXCA 2H27A 4L9TA 1GXQA 5LEKA 4KICA 3RJPA 2XVCA 1BI3A 2QYOA 3U9GA 4RS8A 2ISZA 3MFKA 3GZ6A 4HYEA 4A6DA 1D5VA 2QWWA 4I0AA 5DD4A 2UXXA 2QVOA 3CO7C 2EA4A 4RB3C 3U2RA 2XROA 2MLKA 4S05A 3V7SA 3GFLA 5E18F 1FBQA 4UHTA 1IN8A 2V9VA 3ZMTA 4LG0A 1OKRA 4TV7A 1JE8A 1KA8A 2HKOA 4L5IA 2MA3A 2H6BA 1T98A 3V7RA 5KVRA 4IRHA 2G7UA 4K2EA 1ZLKA 3WTYC 2P5KA 5ILUA 1SD7A 3L2CA 2HQRA 2J5OA 2FBHA 3DKWA 2JPBA 2R7DA 5E20A 4ESJA 3BPXA 4N9IA 4MQ9F 3WU0A 4WK8F 4QLCU 2FBKA 2L3DA 4P96A 4KA4A 4G6DA 4N0BA 4L0ZB 2XAHA 1MZBA 2D1VA 1XSXA 4JK1X 3B73A 4ZH4F 4HOBA 2Q2EA 1G3TA 4IHTA 3E6CC 2V6CA 1KQ9A 2F2EA 3KFWX 5CLSA 3LWFA 3RPQA 1FNNA 1FYMA 4YIFA 2O6GE 2DI3A 3T8RA 3RPUA 3HTSB 4EGZA 1LVAA 5LRSA 2GZWA 2DO7A 2DW4A 2OA4A 3E6MA 3KP6A 5F6FA 3HSRA 5HOOA 4RGUA 2FU4A 5IT3A 2EK5A 1O3TA 5HS8A 4OMYA 1T39A 3J80K 2NAZA 1IRGA 3LA7A 3FXRA 1I1GA 3IWZA 4RGRA 2NNNA 4HA8A 2YU3A 4RGSA 2OQGA 3LAJA 2W24A 4BAYA 4RB1A 5BS6A 5DEQA 2IJLA 2JTVA 3GFJA 3F3XA 5FLXZ 3GVAA 1P4AA 1D3YA 3KEOA 2O03A 5BQTA 1BOAA 3D0SA 2K86A 4WXHA 3HOSA 5L3BA 4L9JA 5ICCA 4WWCA 3HSEA 4A6EA 2M45A 1HKSA 2ZBKA 1P92A 2KIUA 2K4BA 3K1NA 2L4AA 1JHFA 2COMA 2J5PA 5D5WB 2KJCA 3QPTA 4LG0B 4WXCA 1HBXG 3JTHA 3HOTA 1WQ2A 1RUNA 2HYFA 3I59A 2BE5F 3ZMDA 1S8NA 1Z1DA 3RDIA 3O6BB 4EMSA 2Y48A 2BGCA 3B02A 3HRTA 1KU3A 5JR3A 3PFIA 4HW0A 5JHUA 5HLIA 2OAZA 3W6JB 2O8XA 2YSRA 2EA2A 2IT0A 4F7ZA 3WTTC 2RGVA 3V8JA 1K78A 3HRMA 3S2WA 2D1HA 2FA5A 4MQVA 3I71A 4P9UA 1FYKA 4DQ2A 3GLXA 4ZYHA 2MC3A 3DQVC 1LDKB 3ECHA 1YS7A 4RAYA 4PDKA 1LEBA 5CVVA 1LJ9A 3ZQ7A 1YIOA 5ILSA 4JBAA 1Y0UA 3K2ZA 4HZFA 4BQAA 4MEXF 5LGUA 4HF2A 1FBUA 3EDPA 3ISPA 1FYLA 1MKMA 2A3SA 1BBYA 4HV6A 3O2PE 1REPC 3F8MA 1P4WA 3I58A 3TQNA 1RI7A 2K4JA 3G73A 1FY7A 1FSHA 1O7LA 4ENJA 1ZGJA 5CVIA 1HSTA 4IHSA 2F5FA 2XHKA 3CUQA 5FO5A 2VBZA 4CYDA 3OV8A 1Z6RA 3QOPA 3BP8A 3ZPLA 2QUFA 3E97A 4NQWA 1IZ1A 1QBJA 1OPCA 5J8CA 5DV5A 4AWXB 2MLGA 4AIHA 1YW7A 1G3SA 4FT8A 2NNYA 2KJBA 1CF7A 2FNPA 2X0LA 1I1SA 2VOOA 5JI6A 2VXZA 4G7OF 1HW2A 4IJAA 3FZVA 5E8IA 1ONVA 4L5JA 4HDUA 1VTNC 4BH9A 2OQRA 1FZPB 2EWNA 5DUIA 5D8KB 3E6DA 1SFUA 3I59B 3WG9A 4UV9A 2IW5A 5FLXK 3EYYA 5ICFA 2A61A 4LK1F 3TGNA 2QQ9A 2Z33A 1QZYA 3KP2A 3K1MA 3WTVC 5L3DA 2HYGD 1XSVA 1O57A 4OMZA 1SMTA 1DDNA 5JFRA 1I5ZA 3T8TA 3CJNA 1U2WA 2DFIA 1U5TC 5A2QZ 3DFGA 2LDUA 4IPAA 4M9ZA 4IRGA 4ENKA 1YO5C 2Z9OA 1J7KA 1KYZA 1YLFA 3RTRA 1W4MA 3Q9SA 4N9HA 3H3ZA 2XV4S 2K7LA 1UCRA 1ZG3A 3RIRA 4HQEA 5CVJA 3L00A 3BY6A 4D0PA 4RB0A 3FMQA 4ZZLA 2O61A 2H09A 5HDKA 2ACJA 1LB2A 3EQLF 1T2KA 1U3EM 4G94A 1TNTA 2XUBA 2STTA 3KE2A 3MEXA 3MZHA 1WWXA 4MEYF 2XAGA 3KEQA 4UV8A 1Z9CA 1FX7A 3DP7A 1R1VA 2DK8A 2XKOA 3CUQB 3QAHA 3SQNA 5D4SA 3TO6A 1BC8C 4KMFA 4AVPA 4Q48A 1R23A 2XAJA 2RV8A 4HLXA 1JHHA 2RN7A 5FFZA 3D5LA 3QU6A 4RB2C 3L9FA 4OIRF 4KFCA 2W57A 1CF7B 3JSOA 3KP4A 1XB4A 2M87A 1MJAA 1R36A 2A68F 4ESBA 2DTRA 3FHZA 1XD7A 4KT5C 4GGGA 5H20A 4EV0A 4U88A 3EETA 3WGHA 3WTZA 1IN6A 4L18B 5BOXA 5E17F 3GZ5A 3CLOA 3DPLC 4HQMA 1H9GA 3HYIA 1QPMA 1RZ4A 5FD6A 5K1YA 5L3FA 1DP7P 3T1BA 3MQ0A 4G8XA 3WGIA 3WTUC 4UUVA 2E1NA 2JRTA 1PP8F 3ZMSA 4XLNF 2PI0A 5ICEA 4ON0A 1ZGAA 2HEOA 2L4MA 4Q4ZF 4A0ZA 3SZPA 2W25A 1UB9A 2IP2A 1ZHFA 2CO5A 4OU0A 3LSTA 4BNCA 4RAZA 2EFPA 5HS9A 4BXUA 1XMKA 5AONA 4BYYA 1ULYA 3F72A 1Z7UA 4A0XA 1U78A 1R1TA 1C0WA 4A5NA 4LB6B 1FWZA 1E17A 1FC3A 1D8KA 3FF5A 4LB5A 1B1BA 3J7AO 1R1UA 4M72A 3FX3A 2PMUA 1KU9A 5K5QA 4H0EA 3ULQB 3F8BA 3IWFA 5CVUA 1DUXC 3ABTA 2BEOA 2DBBA 4XSZF 4U7DA 2FE3A 2Y75A 1ZRFA 3H3UA 4KDPA 5LHHA 2HTJA 4S04A 4E70A 3NRVA 4JQFA 2CFXA 2WTEA 2ZKZA 1YG2A 3C1DA 4Y15A 2ADUA 2UWMA 5A2QK 3DEUA 3LQQA 4XLPF 3V8LA 2LKPA 2F5EA 3I64A 1U6GA 4NB5A 4HX4A 3FMRA 5E8GA 1IRFA 4CDGA 2XKPA 4BHCA 3LA3A 3W6KB 1J59A 5DDGA 1FP1D 1FT9A 3BJOA 4M73A 1TW2A 3KLOA 1IN7A 1LDJA 4AIKA 3LA2A 2RC4A 2GIVA 1OYIA 2ZJ2A 4CXFA 2QZ8A 2W84A 4AD9A 1XN7A 1KGSA 3GUDA 4PZJA 4BHPA 1S6LA 3H92A 1Z6TA 1B59A 2V79A 1RUOA 1TBXA 5F1RA 2GXBA 5TJJA 1IN5A 1T38A 4OIPF 2GAUA 3CDHA 1HKQA 5AIPA 3M8EA 4A5MA 3EUHA 3VODA 1Z05A 4G7ZF 1O3RA 1J75A 4KUMA 1P4XA 1TLHB 2IA1A 2K27A 3KETA 2X4HA 1KQ8A 5HLGA 3K9TA 3P7NA 3KP5A 1OYWA 4P55A 5E1WA 3EYIA 3HIFA 2RQPA 3TOAA 3RYPA 3IHUA 4ENNA 4HAMA 1EH8A
chains in the Genus database with same CATH superfamily
2CU7A 2L7ZA 3TO9A 3RI4A 2H1KA 3H9JA 4E7ZA 2XPWA 3R61A 5DYMA 2HVSA 1WCMJ 5IP7J 2M7BA 2L9NA 5IYDJ 2HZTA 4HV5A 3JREA 2AXLA 2DA4A 2JSCA 1Q1VA 3GFIA 3ZQIA 1P6RA 5H2FC 1BM9A 4HLYA 5BMZA 4BL0B 3F6OA 4B4CA 3I53A 4PGGA 3OS0A 3HEFA 3O8HA 3R0AA 3K4NA 1GDTA 2LVSA 3A01A 3ERED 2WV0A 3CQZJ 2Y0SA 2EFNA 2RREA 5HVQC 4MO7A 3CDLA 2LREA 3E6BA 3N97A 2VPLA 2M4KA 1Y39A 5HNHA 3B6CA 4IRIA 1WHUA 2E5NA 2R0QC 5F64A 2C6YA 4AU7A 1JGSA 4UVCA 3BTIA 1RNLA 4GCVA 3ELKA 3BR2A 4ZYEA 3CCUI 2H6CA 3L2VA 2LF8A 2E2HJ 1T95A 4BJ5C 3GFMA 2W48A 1IC8A 3NEUA 1VZ0A 5HDGA 3BJAA 1IF1A 2LKSA 5E79C 3W2AA 4EVIA 5GAGJ 4C2UA 2MBFA 3ZN1A 3ABUA 4BQQA 1FBSA 4A3GJ 3E5QA 2HQNA 1XCBA 2EQRA 3L09A 3IH2A 5IT9Z 5FFXA 3K4CA 5FKMA 5GADJ 3F22A 2E19A 4M6XA 3G6EI 2K40A 1HW5A 4QPQA 1PUEE 2ESNA 2PMZN 2VPRA 3IAM2 1WGXA 5J8FA 2DAOA 2M8GX 3R6SA 1K4SA 5GAEJ 2IEKA 3BROA 1W5SA 1D1CA 4M74A 5ERIA 2L01A 1K6OA 4IX7A 2CW0F 5LFAA 3SJMA 1POGA 4BGDA 3PUBA 5IYBJ 4UVBA 3EUKL 5GPCA 1YIJI 1SEUA 2BHYA 1G3WA 1XGNA 5LRRA 1N78A 2OCEA 3BG9A 3FMSA 2WWYA 3FXKA 4I7HA 4HF1A 4Y3OA 3MKLA 4HG2A 1ZRDA 1NH3A 2DA3A 3V8KA 1ACIA 4E7SA 2JZYA 3LAPA 1HXDA 1LFPA 1YX5A 2XF7A 2V9KA 2BYVE 1WJFA 2VT3A 5BPIA 5J47A 3EUHC 5J6XA 3OSGA 2F6CA 2NOJB 2EBIA 3R60A 2VKVA 1YITI 2E1CA 2HYJA 3RZOJ 3CESA 3ECOA 2WA0A 3BZCA 2IXSA 3K0LA 1ETYA 1AU7A 1A6QA 3RCOA 4X1EA 3FM5A 4J19A 2PG4A 3ABKH 3AFHA 4GYGA 4ZYDA 4FCYA 3TW7A 1RPWA 3PNTA 4D7MA 4CHUA 2NVTJ 1EA3A 2RVCA 2Y9YA 1OQYA 2F4OB 3G1LA 2OTJI 2Z16A 1YI2I 2L9RA 2BY2A 1Z0XA 1ETVA 3FBNB 3MVPA 4O5VA 2E2IJ 1FSEA 4XORA 2PEXA 4HDVA 1VFCA 1IGNA 4IKFA 1FOKA 3F8CA 3CMMA 3CCYA 4C3JJ 2QENA 1F4KA 1IAWA 1I3AA 4I2OA 1S7OA 1HQCA 2N8GA 4O6JA 1AWCA 2DOEA 4NHJA 1QO0D 2K9QA 1IXRC 1CGPA 2K85A 4IZZA 2XIGA 1WPKA 2GA2A 2NVQJ 3L7WA 2JA2A 5F0CA 3J81Z 1TT0A 3PJRA 2EZIA 3WE3A 4CCMA 1E3OC 3E3VA 3RZDJ 3PIOF 4KIFA 3M9AA 2YS9A 2QLZA 2P0WA 2YUSA 1EH7A 1YOVB 2VN2A 5BPDA 1T33A 4I6ZA 3CD6I 3HG9A 4G7HF 3M7GA 3QRFF 1QHGA 3HSFA 1USTA 4NBQA 5KK1A 4M71A 3PSIA 5FROA 4KIGA 4ABZA 1LFUP 3TKYA 3HOWJ 4DNCA 3OIPA 1R22A 4DW6A 1XS9A 4KMUX 5FB2A 2CW7A 4I01A 2QA4I 3PNYA 4Z2YA 4ZZDA 3Q0WA 2XPVA 1R58A 1MDMA 3WTSC 3VWBA 3A01B 2DCEA 3VYUB 5EZGA 2PMZA 2CV1A 3K1PA 3ESWB 3JRDA 2G9WA 2UUZA 2X51A 1QVUA 3IP4B 2W00A 1BI2A 2BHZA 3BR5A 1MH4A 1XGOA 4RBOA 3CTAA 2BW3A 4LITA 3BR0A 5HODA 2P5VA 4EM0B 1IUYA 4KIBA 2MD5A 5D6FA 2KT0A 3CF2A 1WH7A 1WSUA 2EFOA 2IA2A 2Z99A 2E1OA 4A3EJ 5IP6A 5L3CA 3P9KA 5K5OA 2BV6A 3KIOA 3MAJA 3VEPA 4OIQF 3E1SA 1WJ5A 3C3WA 4CYCB 3F8FA 4KN4X 3ZN0A 4XRMA 1H0MA 3VPRA 5B1AH 5DM7F 4IF4A 2O3FA 4XNFA 1PJRA 1QZEA 1TW3A 3X2QH 2EV5A 3GTPJ 3DV8A 1T08B 4RGXA 3Q5FA 1R4MB 2LD5A 5M5WJ 5J1RA 2VC1A 3HUGA 1VQ8I 4O3MA 1IV6A 2GOXB 4YFNF 5JLWA 4P9FA 1MNDA 3HGYA 1SFEA 2EV6A 4MIMA 4LMYA 5EJCA 1YTYA 2Y31A 3OYKA 1ZTRA 2W4SA 1MJBA 1HSJA 2LH9A 3F23A 2LG4A 2HDCA 4BACA 4E6KG 3J80Z 3DU5A 3QP5A 3VSKA 1TQIA 1BJAA 1SAXA 1ZRCA 2DN0A 3JW4A 3CO6C 2IA0A 4U7BA 3KZZA 1MBHA 3BJ6A 3WODF 2R7VA 2DJIA 2CYYA 3G1OA 3MD2A 5EGOA 3CDIA 1LDDA 1RESA 3SFIA 2FQ3A 4XQFA 2HOSA 2JSPA 4Y33A 3NAUA 2DU9A 2HI3A 2CH0A 4UVAA 1T6SA 3LFKA 3CUQC 5DM6F 1ODDA 1YS6A 4XBFA 2NOGA 3FIWA 2FOKA 2GWRA 4D5FA 2GIZA 3LSJA 1VQPI 1J0RA 3RQ4A 5FLVA 4Y13A 4L0YB 4MGRA 2PBIA 3U1DA 3QOEA 2CG4A 4IHXA 2FX0A 3FXUA 1SC7A 1V4RA 2BY1A 5GTHC 2FOWA 4A3FJ 3E5XA 4JX6A 1GUUA 3WGGA 1ZLJA 3LSHA 5K7ZA 3U1KA 4YG2F 4BDZA 5LLQA 2ESHA 2EZKA 2Q8KA 2WBMA 4NC7A 2YX7A 4B48A 3J7ZI 4B8XA 2V1UA 4YFKF 3WTXC 2LF7A 2ISYA 1R49A 1S9HA 2QBYA 5IT9K 3GCMA 1FLIA 1ON1A 5D5XB 2DXIA 3LSPA 1HDDC 2VJIA 5ED4A 3COAC 4C30A 2IPQX 2M1BA 1BN5A 3ZCOA 1OCCH 1UFMA 6PAXA 3VYSB 3GWZA 3PFYA 1EKEA 1GVJA 2STWA 2GLOA 5TRDA 3QYBA 4A3DJ 2K9MA 2QSHX 1O3SA 4U0WA 4GFBA 1FPQA 2R5YA 3MWMA 1XGMA 4AIJA 3V42A 1WZ2A 4EJUA 2R7QA 2V26A 3FWEA 4NC6A 1GHCA 2PMHA 3S93A 3HB9A 1SD6A 3ZMVA 2YX4A 2HPIA 1EH6A 2M5WA 1IXSB 1WVRA 3V4GA 3HKZN 4AYBN 2L02A 2HNHA 2TCTA 4R8HA 3EPZA 1VI0A 2HS5A 3C7JA 2KIMA 2DFEA 1IW7F 3H0GJ 4YIIA 4A0YA 4HF0A 4BE0A 1JKOC 3S1QJ 4LLNA 2O0YA 4LJZF 2MABA 2KFDA 4V2GA 3OOPA 1MDMB 2LTPA 3ZQGA 5L3GA 1JT0A 5D8LB 5DCFA 1H89C 4PCQA 3T0YA 4R79A 4ZTJA 3BDDA 3BG5A 4U87A 3H9GA 1IG7A 3DWLE 1G3YA 1W7PA 2R5ZA 5HS7A 4BEHA 3W6VA 4HX7A 3TBIA 2KRFA 3LQRA 2MYSA 3G71I 4IXAA 2BW3B 1HKTA 3E0JB 4LGWA 4II3A 2YPRA 3L2UA 3REOA 3I54A 3G1MA 4Y7NJ 5FJ8J 4M6VA 3S16J 1VQOI 1BIBA 4DOZA 2BBYA 1X4OA 4W1UA 1BOBA 3PNVA 2VOPA 5IOZA 1UAAA 2R7WA 4A12A 3AAFA 3I4NJ 2B63J 3MKYB 4G6QA 4PJMA 3OYCA 1YW8A 3GEZA 4UNOA 4M3FA 1F43A 1OISA 3DKXA 2R7OA 3CCLI 3HZJA 1FMVA 1J2XA 5EEGA 3TO7A 2CUEA 3TDUC 3ZQHA 2VIXA 3J81K 2V9PA 1MBJA 5BNGA 3HUGB 1JKPC 1OMIA 2DA1A 2VBYA 1X4PA 2UV1A 4RLFA 4OIOF 2KP6A 2XASA 2PQ8A 2Y69H 2MH2A 3GO5A 3LSMA 2HR3A 1STZA 2R3SA 2P4WA 1FEXA 1L0OC 1BIAA 1I3QJ 1TWHJ 4EJOA 1ZG1A 3CC2I 4ZYGA 3BR1A 2PN6A 3BZKA 2X1CA 3I4PA 4XRSG 1K7AA 2P7VB 2FNAA 1B9MA 5LGTA 4OWRB 5EEAA 3VYTB 2NRAC 2OU2A 3F21A 4CCLA 2CRGA 3OYEA 4ASNA 1JI8A 1WJAA 3KLNA 1MSEC 4YFXF 3KYLA 3VB2A 1UHWA 4CA0A 1GT0C 1K79A 2KIFA 3KPHA 1ZAOA 4ETSA 3L1PA 4L9VA 1E2XA 5CQEA 3KP3A 1DP3A 1CQTA 1RR8C 1FOWA 2E7XA 2DPUA 4BQOA 1U8RA 3GX4X 3QPHA 2R7RA 4EGYA 3UKGA 3FM3A 1BC7C 2YU9J 1XMAA 1ZREA 3FXQA 4Q47A 2L54A 1YW9A 1V5FA 1IDYA 3IAS2 2XRLA 4RAGA 2DA6A 3QU3A 3IKVA 4FX0A 4GO1A 4F93B 2LC2A 1XSDA 3F8NA 1K6YA 5D6EA 2Z3YA 3U21A 2OD5A 1Z3YA 1BI1A 1R7JA 1QVTA 1I27A 3H5NA 4AYBA 2QQBA 1Z91A 4QWQA 4A2UA 2IRFG 1H8AC 5HDNA 3CUOA 3OYBA 4M3DA 2ZO4A 3MZYA 2QBYB 3DEEA 3V7CA 1SFXA 3HOVJ 2FMLA 3ASNH 5DUKA 3IRQA 3OMYA 2OTLI 2FEZA 4ZC3A 1LEAA 1D1AA 1OYYA 3KCCA 5E1XA 4CCJA 4UUSA 2DJNA 4FE7A 3BLYA 4I09A 3WHCA 1WJBA 3QPLA 3IRRA 4A3KJ 2R7FA 4HNUA 2M30A 3WTWC 3ZMUA 2LSOA 1DGWY 2L0KA 5H6QA 2E2JJ 2UXNA 2ZMEA 1QHHD 4DZJA 2VC0A 4XM3A 1LQ1A 4WF2A 1G6NA 2X1DA 2HDWA 2A07F 5CJ9A 3NARA 1WJEA 4YEJA 2R5YB 4D9JA 2M8EA 1FMWA 3HHHA 1WRJA 4XLEA 2ICWG 4WXDA 5FD5A 2DK5A 2P6TA 2AQEA 3HXLA 3CC7I 1R00A 3E5UA 1SFKA 3H5RA 3GLLA 4OAYA 3ZQCA 2HOEA 1SVOA 3E7LA 2W1OA 2WAQA 2VQCA 4XSXF 4W97A 2GA1A 3S14J 1KYWA 1T0FA 4UY8I 3ZMZA 1Y0NA 2QKMB 2E36A 5LBQA 2XB0X 1AOYA 2ELKA 1USSA 1SD4A 3A0BC 5K5RA 3OYAA 4EQQA 2RAEA 2NXNB 1ZQ3P 4PJNA 2WC2A 4CO8A 3RYRA 2JJ7A 5CKTA 2XAUA 3HOUJ 2ZXJA 4XLCA 3UR3C 2UZKA 4HNVA 2Y2ZA 4MHGA 3JAMZ 2VXDA 3FISA 4WCGA 2Q1ZB 2ZXWH 5F0HA 1W7PB 2EFWA 2R5ZB 2QSFX 4BEHB 1ZR4A 2K9LA 3DTKA 3BPVA 3QODA 1FTTA 4CSWA 5HLHA 4I0BA 2IS6A 1A5JA 4P5OA 2FBIA 2R93J 3ML6A 3MZ8A 1QGPA 3FKJA 2NS0A 1ZARA 5K7HA 2V1XA 2E1MB 2P8TA 4B3XA 2PJPA 2GXAA 2A05A 4EJWA 1YFHA 2KKOA 2O9LA 5IY5H 5M5XJ 1D0ZA 2HGCA 3DBHB 2X6WA 2EZLA 3HTUA 4YRVA 2PFBA 2OZUA 2PLYA 1JTXA 1W5TA 4FX4A 1K4TA 3BG7A 1ETWA 4G9YA 1MD0A 2ELHA 5K7FA 2XGCA 1F1ZA 4NNJA 5HNFA 5L3EA 3BTLA 2CJJA 2BOLA 2DDBA 3TDZC 1BR4A 1ON2A 4IVNA 5E1ZB 1ZH5A 3W2WA 1P7JA 2E34A 4UXNA 5DCMA 5F27A 2CUZA 1QU3A 4CGZA 1P2FA 2JT1A 2OV7A 4AIDA 4A3MJ 1V5EA 5J40A 1SMYF 1V3FA 1LVKA 3S2HJ 3EUAA 3SYTA 4PJJA 4ZYAA 2WV1A 1XDUA 1EV7A 3H1CA 1LE8A 3O3KA 1F5TA 1MGTA 2ZNZA 3AL0C 1X1PA 2VE8A 1SFOJ 3MMYB 5FKOA 3ZXSA 2A69F 2JPCA 3AL0B 1EJ9A 1IN4A 5CQGA 2QQAA 3QQAA 3DKYA 1B72B 2XGEA 2CQNA 3FXLA 5LGNA 1DPRA 4FE4A 5EEHA 1BI0A 2A6EF 3P9IA 4BJ6C 4CYCA 4LOCA 2HXIA 2EB7A 1B8IA 2R7UA 1TQMA 5EDNA 3F6VA 4BXFA 2JUGA 2KISA 3G2BA 5JVTA 4BXXJ 4BBRJ 4D5CA 2P7CB 4IOCF 2E5ZA 2XPUA 1U5TA 1WKMA 2Q0OA 2VQLA 4XK4A 5JVGF 2M4GA 4XLAA 4G12A 1QA6A 1S3JA 5TGTA 3JRAA 2CW8A 5FGMA 1GXPA 3HRSA 3ERMA 4UUSB 2OZ6A 4M3GA 4OINF 5EG0A 2CWEA 2DOFA 2W7NA 2TDXA 5D4RA 3P9CA 2D45A 2Z2SB 2VONA 4KN7X 4CICA 1UHMA 2DQLA 3AG3H 3KP7A 5ICGA 1YQAA 3T5XA 1S7AA 4GYIA 3K70C 3DTEA 2ZMEB 3DXJF 2B0LA 2OBPA 2DT5A 4OIPF 3K4JA 2JVHA 1MJ9A 4R1HA 4QSHA 2G7HA 1WFXA 2X6XA 2P6SA 3RKQA 3PQJA 2WY7Q 4F91B 2V1DA 3BCBA 3ZR8X 2F5DA 1R5GA 1N75A 1T0FC 3BOQA 4LLGF 4PGHA 5CVRA 4PJ0C 4AM3A 1V54H 3K6GA 3I5UA 4U0VA 4WX9A 2VT2A 1S7EA 4IO9F 3R4KA 2ZFWA 2FUG2 4M9XA 1JGGA 2VE9A 2L9SA 3VFZA 1U0JA 3GTQJ 4HRIA 4RM2A 1E0EA 3PSFA 2E7WA 4OAZA 5H6RA 2ZCWA 4GRIA 3A2KA 4ENMA 2MH9A 2EIKH 2QGUA 3WHBA 2I5UA 3CCRI 1X3ZB 2A6HF 1KU7A 1J9IA 3CZ6A 3JRHA 2FF4A 3SHFA 1W7PD 5LEJA 2DQRA 2M3AA 4LD5A 2VB6A 3GYHX 1FOXA 2MC4A 2VBWA 1ZG5A 1YRNA 1XDSA 3OL4A 1KU2A 1G4DA 1XCVA 2PJRA 2QEXI 1DPUA 1W5CC 2DFFA 1TWFJ 4M3BA 1AKHA 2W85A 2XRNA 2YR2A 1MNEA 4F92B 3BC8A 3Q9VA 2ETHA 2COBA 2LY2A 3SZTA 3DF8A 4HBLA 1QZZA 2FRHA 2L7KA 2D2WA 4QTRA 2QM3A 1RRJA 2LP0A 1ZN2A 2XAFA 3GXOA 3S3NA 3QYEA 4Y17A 3MKWB 2XGXA 1JKRC 2RKHA 3TMOA 2CQKA 2RDPA 3LFUA 5DCMB 3AG1H 2HKXA 5LHGA 1TWGJ 1PP7U 3OS1A 3JRGA 4HX8A 1JJ8C 1FP2A 3GTMJ 1PVEA 2HWVA 3WU1B 4LK0F 1R5HA 4A3CJ 1X3UA 2F4MB 3CP2A 5FLMJ 1TTYA 4OOIA 1LE8B 3SFZA 4Q5SF 2VBXA 3OR2C 3JAMK 5LHIA 5D5UB 1IV8A 3IL2A 1A04A 1ZGWA 4BHBA 5DD8A 2B7EA 2F5CA 3M8FA 3JSPA 1JKQC 4KYWA 3FK7A 2GQQA 3DBLB 2Z5UA 4B09A 1JUMA 2IVMA 3PL8A 4MFEA 3OYHA 4AC0A 4LLLA 1B8IB 3MCZA 1E3HA 2TRTA 3Q0VA 1B6AA 3GF2A 3OYLA 3GZNB 3HL2A 1NG7A 3DBRB 5J4YA 4I02A 2AO9A 1MIJA 1R71A 1K61A 1K78B 2DOAA 3SXYA 1ERDA 2K02A 4DYRA 1U5TB 3CCMI 2VKHA 1I6XA 2DLLA 3IC7A 4M6YA 4XN0A 1KQ0A 2NYXA 4XOPA 1TNSA 1HW1A 1TQPA 2CFOA 3LSRA 2CGPA 4EM2A 1S29A 1NHAA 3OR1C 4Y4RA 3LMMA 4KITB 1DU0A 2HVRA 4RLQA 1MNMC 2HFHA 5EG0B 3C18A 1N25A 2CUFA 2Y0MA 1H88C 3KZYA 4QIWN 3ZP5A 1BR2A 3RPUD 1OR7A 3H5AA 3CJRB 3PO3J 3HOYJ 2AS5F 3OIOA 1RIOH 1QQIA 4CUGA 4ESFA 3K4KA 5C44J 1BR1A 2OJED 1WH5A 3VYRB 1O3QA 3K69A 3S2DJ 4LFUA 3ASOH 2QKLB 3GW2A 1TC3C 5ILVA 1VQKI 4MTEA 2KHMA 2HU9A 4U0YA 3JTGA 2H94A 4FETA 2DPDA 1BJZA 4BUPA 5KNLA 1D8JA 1JXSA 1IJWC 3F0CA 1RETA 4M9SA 4BBSJ 3OWTA 1J5YA 4RAFA 2DFHA 3CMYA 2FXAA 1LNWA 4YIRX 1PDNC 3BG6A 2DODA 3RKYA 1YX3A 1QNTA 3JCUC 2EJRA 2VODA 5E3MA 3CCVI 1MMSA 3OYDA 2EFQA 2ZNYA 4X6AJ 2EINH 2P5LC 3G3ZA 3HHGA 4XRFA 2FSWA 1OJLA 3BZ6A 1F9NA 2LBFA 3ROUA 2VASA 3QP6A 4ITVA 3I3LA 4KNYA 1Q1HA 3N4MA 3A0HC 2RNJA 1AHDP 1MBGA 3OIQA 1VQ6I 5AIQA 4I98B 2MD0A 1BW5A 1B4AA 2HTSA 1ZYRF 3DLLF 4L9NA 4KISA 2CSOA 2HOTA 3HRUA 2KZVA 3CJTB 3RKXA 1Z77A 4FHTA 5JLXA 4NDLA 1XGSA 3IKTA 2IS1A 2GXGA 1L3LA 1B9NA 2ZJRF 3L2WA 3NWSA 4GXOA 1SD5A 2KZGA 3S15J 3RKWA 5D5VB 1YRNB 3M1EA 3S8PA 2PJRB 2IGMA 2H8RA 2AQFA 1WI9A 1YYVA 4MTDA 1HA8A 2FMYA 3BWGA 1AKHB 2E60A 2EH3A 2M7AA 3FKIJ 4MNUA 3WE2A 3GTOJ 1OCTC 1O7FA 3PQKA 4ZDOA 4EJVA 1RKWA 4EJTA 3I0TA 3K2AA 3VOEA 1ZKGA 4IQ4A 5CYVA 4RMNA 5KCMA 5B5EC 4XKCA 3TOBA 3DPTA 1VQ7I 4JP0A 4N4OB 4E7JA 2XAQA 1H9TA 2LNBA 3FXMA 3TP0A 3NQOA 4CZZA 4EM1A 3R0JA 4S0HB 3S32A 2EV0A 2A5YB 1IXCA 1OCPA 4PFOA 2H27A 4ZDPA 4NC8A 4L9TA 1GXQA 1Z7LA 5LEKA 4KICA 3GMEA 1SVLA 2XVCA 1XTAA 3RJPA 1S5LC 1BI3A 3KEYA 2DT6A 1JT6A 2QYOA 3U9GA 4RS8A 2IAIA 3A03A 2ISZA 1TWAJ 3MFKA 3BTCA 3GZ6A 4HYEA 4A6DA 2LYCA 1D5VA 2QWWA 4I0AA 5DD4A 4H4KC 2WB1N 2QF7A 5CPRB 1XX5A 1JJ6C 1VQ4I 2IS4A 2UXXA 4HNTA 2QVOA 3ZOBA 3CO7C 2EA4A 4RB3C 1GV2A 3U2RA 5KHDA 2XROA 2MLKA 4S05A 3V7SA 3GFLA 5E18F 1FBQA 2M9HA 1OCOH 4UHTA 3HGGA 2L9VA 3FXJA 3ABLH 1IN8A 2V9VA 5FKKA 3SDBA 4LG0A 3ZMTA 1XPXA 1OKRA 1JTYA 1ORKA 1MBEA 3P5JA 4TV7A 1VQ9I 4XOTA 1JE8A 4KT6A 1KA8A 4N4NB 2WY8Q 4C9YA 1P7IA 2HKOA 4XONA 3PUFA 1OR7C 2MA3A 4L5IA 2H6BA 1T98A 3BQYA 2F48A 4UB6C 3V7RA 1V55H 5KVRA 2K3FA 4IRHA 2G7UA 4K2EA 1ZLKA 3WTYC 2P5KA 5ILUA 1SD7A 3L2CA 2HQRA 2O7OA 2J5OA 2FBHA 3DKWA 4XLHA 3IH3A 1X19A 2MGQA 3OY9A 3HDDA 1AA7A 2JPBA 2R7DA 5E20A 3RQIA 1VF9A 4ESJA 4DZPA 3TW6A 1J09A 3BPXA 1XC5A 1LUJB 2ZXHA 4MQ9F 4N9IA 3WU0A 4WK8F 3CCSI 2NS8A 3H36A 4QLCU 3DCFA 2ME6A 3S1MJ 2FBKA 5LD2C 4B47A 2L3DA 4P96A 1W0UA 4KA4A 2KLOA 4G6DA 1A31A 4N0BA 4L0ZB 1B72A 1HCRA 1A35A 2XAHA 4LIVA 1MZBA 2D1VA 4XLFA 3TP3A 1HLVA 1XSXA 3C2GA 2JQ7A 4JK1X 3B6AA 3B73A 5HLTA 4ZH4F 4HOBA 4I76A 2BY3A 2Q2EA 1G3TA 2K5CA 4IHTA 4M3EA 3F9KA 2LBFB 3M3YJ 4D1QA 3E6CC 2V6CA 1KQ9A 2F2EA 3KFWX 5CLSA 3LWFA 3HKZA 3RPQA 1FNNA 2HPMA 1FYMA 4YIFA 2O6GE 4BKXA 3LNQA 2DI3A 3T8RA 3RPUA 1ETOA 3HTSB 4EGZA 2V7FA 1LVAA 3HBLA 1T56A 5LRSA 2VQGA 2MFZA 2GZWA 1Y8QB 2DO7A 2DW4A 2OA4A 3E6MA 3KP6A 5F6FA 3HSRA 5GPAA 5HOOA 2VLAA 5DS9A 4HSRA 4RGUA 1UG2A 1I39A 2FU4A 5IT3A 1MMDA 2EK5A 2HZDA 1YJNI 1O3TA 5HS8A 4IHVA 3ZQQA 3L2RA 2JMWA 4A3JJ 4OMYA 1T39A 3J80K 2NAZA 1D1BA 1IRGA 3LA7A 3OYFA 3FXRA 1WJDA 1I1GA 1NG6A 3IWZA 3AG4H 3D5SC 4RGRA 2AHQA 2NNNA 4HA8A 2YU3A 4RGSA 2KDOA 4RDUA 2OQGA 2R92J 3MKZA 5GTIC 3LAJA 2DTZA 2W24A 4BAYA 2X6YA 4RB1A 5BS6A 5DEQA 4HEA2 2ZJPF 2IJLA 2JTVA 3RSNA 3GFJA 1LKXA 1YHQI 3BQZA 2DT7B 2LY9A 3F3XA 1R5ID 3L2QA 1X2NA 2LOOA 1BL0A 5FLXZ 3GVAA 2ZJQF 3M1CA 1P4AA 4DBQA 1D3YA 3KEOA 3BR6A 2M34A 3DLAA 2R7XA 4BU2A 2O03A 2DA5A 5BQTA 2NVUB 5IPAA 1BOAA 3D0SA 4UB8C 2ELJA 2K86A 4WXHA 3HOSA 5L3BA 1T8IA 1TT5B 4MLOA 2E1MC 4YELA 4L9JA 2BVMA 2KIQA 4XL9A 4J00A 5ICCA 3ZRGA 4WWCA 4C2MJ 3HSEA 4A6EA 5KAFC 2M45A 5FKLA 3J7AY 1HKSA 3FDYA 4IQJA 2VJJA 2ZBKA 1D0YA 1P92A 2KIUA 2K4BA 3Q0UA 3K1NA 3CMEI 2L4AA 2ZXIA 3BG3A 1JHFA 4QPOA 1D5YA 4IHYA 2COMA 2J5PA 5D5WB 4BE2A 2KJCA 3QPTA 1LPQA 1MMNA 1U9OA 4LG0B 2A5WA 3WG7H 3IUOA 4WXCA 5C3EJ 1HBXG 3PIPF 3JTHA 3H35A 2ID6A 3BR3A 3HOTA 4XR6A 1WQ2A 1MSFC 3CJQB 3CCQI 1RUNA 2DMTA 1R4NB 2HYFA 3I59A 2BE5F 2R7TA 2KMUA 1UELB 3J7YJ 2CUJA 3ZMDA 3IV5A 3I9V2 3KX2A 2JA6J 1S8NA 1Z1DA 5F0FA 3CP8A 3RDIA 2IGNA 3O6BB 4PK4A 4XKVA 1G59A 4EMSA 2Y48A 2KQRA 2BGCA 3B02A 3HRTA 4G6TB 2LRDA 2HQAA 1KU3A 5JR3A 2BVLA 5EF6A 3PFIA 2A6TA 4HW0A 2ECCA 3KYCB 5JHUA 5HLIA 2OAZA 3W6JB 2O8XA 2JA5J 2YSRA 1M1EB 2EA2A 2IT0A 3QWLA 4F7ZA 3WTTC 3OYGA 2LKXA 2RGVA 1W36D 3V8JA 1ITYA 3HC7A 2Q2EB 1K78A 3HRMA 1UZCA 3S2WA 2DA2A 1IRZA 3DU6A 1G2HA 2D1HA 1X1CA 5E3NA 2FA5A 4A69C 4MQVA 4A93J 3I71A 3JRFA 2LMDA 4P9UA 1FYKA 4DQ2A 3FK6A 3GLXA 4ZYHA 2JA8J 2FQ4A 2MC3A 3DQVC 2VI6A 3PO2J 1LDKB 3ECHA 1VNDA 3W3CA 2ZC2A 3HM5A 1YS7A 4JX4A 4RAYA 4PDKA 1LEBA 5CVVA 5J1UA 4DGWB 1LJ9A 3OYNA 3ZQ7A 1YIOA 2VKEA 5KAIC 1NK3P 2ZMEC 5ILSA 3A1YA 1NTCA 1OFCX 3I4MJ 4JBAA 5EZHA 1Y0UA 3K2ZA 4HZFA 4PSXA 3JRIA 1S72I 2W82A 4BQAA 4MEXF 5LGUA 1RR7A 4HF2A 1FBUA 3EDPA 2Z1DA 1MMAA 2XF5A 3ISPA 5GP9A 1FYLA 4DYQA 2L5QA 1MKMA 4AVZA 2A3SA 1RC9A 2H1LA 1UHSA 1BBYA 4HV6A 3H0DA 3O2PE 4L5EA 1REPC 1Z21A 1P4WA 3F8MA 4B44A 3I58A 3TQNA 1RI7A 2K4JA 3N05A 3CCJI 3G73A 1FY7A 2CV0A 1FSHA 1O7LA 4ENJA 1ZGJA 5CVIA 1VQNI 1HSTA 4IHSA 2CQXA 2F5FA 2XHKA 1X1AA 3CLQA 1IRXA 1JUPA 4A3LJ 3CUQA 5FO5A 5E3OA 2O8KA 2VBZA 3O8GA 4CYDA 3OV8A 1Z6RA 3M07A 1FOYA 3QOPA 1FIAA 3BP8A 5B1BH 3ZPLA 2QUFA 3E97A 4NQWA 2JRMA 2X6OA 3D1NI 1IZ1A 5DTDA 1QBJA 1VQLI 1OPCA 5J8CA 5DV5A 2GM4A 4AWXB 2MLGA 2NVYJ 4AIHA 1YW7A 1G3SA 4FT8A 2NNYA 2KJBA 2L7FP 1CF7A 4B1RA 2FNPA 2X0LA 4AUXA 2O5RA 3LSIA 4BS9A 5B3SH 2V1NA 1I1SA 1IDZA 2VOOA 5JI6A 3NWTA 2VXZA 4G7OF 2XSJC 1UMQA 1HW2A 4IJAA 2CQ7A 4XKBA 5M5YJ 3FZVA 5E8IA 1ONVA 4L5JA 4HDUA 1VTNC 3GTLJ 5F08A 5E3LA 2WADA 3VDXA 4BH9A 3CF5F 2P81A 2DYRH 2OQRA 3DEWA 2EWNA 3TL4X 1FZPB 2ZB9A 4C3HJ 5DUIA 5D8KB 3E6DA 1R6RA 4BJTA 1Z67A 3I59B 1SFUA 3WG9A 4UV9A 2E71A 1BW6A 5JHFA 4F55A 4BY1J 4IOAF 2IW5A 5FLXK 3EYYA 5ICFA 3GBGA 1R9TJ 2XGDA 1X2MA 2A61A 4LK1F 3TGNA 4A3BJ 3TEDA 2MW8A 2CV2A 2BXZA 1SANA 2QQ9A 1UG0A 3QYFA 2Z33A 5IOYA 1QZYA 3KP2A 2XF6A 3K1MA 3WTVC 5L3DA 3GTGJ 2JK3A 3S1RJ 2HYGD 1XSVA 2HVQA 1I6HJ 2EZHA 4IL6C 2K3PA 2B9SA 1F36A 1GVDA 1O57A 4OMZA 1SMTA 1DDNA 5JFRA 1I5ZA 3T8TA 3CJNA 1U2WA 5M3FJ 2IS2A 2DFIA 1FIPA 4MFDA 4PSWA 3AKZA 4E7HA 4NUBA 1U5TC 5A2QZ 1QPIA 2OUMA 3DFGA 1ETKA 2X1EA 2MG4A 4DJAA 1YJWI 2LDUA 2FD5A 1I50J 4IPAA 4M9ZA 4E4HA 2KRCA 4JOMA 3DPUA 4IRGA 2LFBA 3HOZJ 4ENKA 1D0XA 2EILH 2VJ5A 4DYCA 1A36A 3OYJA 1YO5C 2Z9OA 1DQUA 1PYVA 4ZTFA 1HF0A 1J7KA 4KJZA 4BY7J 1Y8RB 3LSKA 1KYZA 2M0MA 2K9NA 1YLFA 2ME0A 4JX5A 4ZDLA 3RTRA 3KZIC 1W4MA 3Q9SA 4N9HA 3H3ZA 2XV4S 2KL4A 3OYMA 2DDAA 3ABMH 2E35A 2K7LA 1UCRA 1SVMA 1ZG3A 3RIRA 2VJ4A 3K7AJ 4HQEA 5CVJA 5J1YA 3L00A 3BY6A 3OYIA 3FHNA 4RB0A 4D0PA 3FMQA 2G0EA 4ZZLA 3SZGA 2OPTA 2O61A 2H09A 5HDKA 2ACJA 1LB2A 2K9SA 3EQLF 1VQMI 1U8BA 1T2KA 1HC8A 2IBDA 5FRMA 2Y9ZA 1U3EM 2R7SA 4G94A 3ZQFA 1TNTA 2XUBA 1PUFA 2STTA 2BZTA 3KE2A 2GOMA 3MEXA 2QQ8A 2V4JC 3HJEA 3MZHA 1WWXA 4E7KA 1TL8A 2R7ZJ 4MEYF 4J01A 2XAGA 3KEQA 4UV8A 3S3OA 1Z9CA 1FX7A 4C2TA 3DP7A 4I99C 1MH3A 1R1VA 2DK8A 2XB5A 2XKOA 3DTIA 4V2FA 3CUQB 3JR9A 3K70D 3QAHA 3BTJA 3K4MA 3SQNA 5D4SA 3TO6A 3MN2A 4EATA 2VKDA 1BC8C 2DYSH 4AVPA 4KMFA 4Q48A 1R23A 5B66C 5FKNA 4NQWB 2JVGA 2XAJA 1Y6IA 2RV8A 4XN3A 4HLXA 3ONQA 1JHHA 3LL7A 2RN7A 5FFZA 3D5LA 3K4BA 2CQQA 3QU6A 4RB2C 3L9FA 4OIRF 4KFCA 2W57A 4XICA 3WU2C 1CF7B 4FISA 1XG1A 3JSOA 3KP4A 1MBFA 2F4IA 1XB4A 3CMAI 2M87A 1MJAA 1R36A 2D5VA 2NVXJ 2A68F 1DGRM 2BXYA 4ESBA 1EF4A 2IGKA 2DTRA 2DA7A 3JRCA 2JA7J 3FHZA 3IH4A 2ECBA 1XD7A 4BE1A 2JWTA 1GLNA 4KT5C 4GGGA 2L7MP 3Q3SA 5H20A 4EV0A 4U88A 3EETA 2L2OA 3UNGC 1IN6A 1IO2A 3WGHA 3WTZA 4B43A 5BOXA 4IHWA 4L18B 2VUMJ 5E17F 2JN6A 3SEZA 3GZ5A 1Y1VJ 3CLOA 3DPLC 4HQMA 4LG3A 3FXOA 1IUFA 1H9GA 3HYIA 4II2A 1QPMA 1RZ4A 4ZJZA 1RKTA 2KPMA 5TISC 1ZK8A 4PFPA 4XKWA 5FD6A 5K1YA 1Y1WJ 2DMNA 5L3FA 1DP7P 3T1BA 3MQ0A 4G8XA 4D7NA 4BDYA 2H8WA 3WGIA 4XIDA 3I56I 3WTUC 4UUVA 1ETXA 2E1NA 1OCRH 2JRTA 3C2HA 1PP8F 3ZMSA 1V5GA 1HDPA 4XLNF 2PI0A 1UJ8A 5ICEA 4ON0A 1ZGAA 2HEOA 2L4MA 4Q4ZF 4A0ZA 2M0CA 3SZPA 1E3PA 2W25A 3G4SI 1UB9A 3SEQA 1BA5A 1SAUA 2CS3A 2IP2A 3M8JA 1ZHFA 2CO5A 4OU0A 3LSTA 4BNCA 4RAZA 2EFPA 2KDZA 1N77A 5EYRA 1TWCJ 5HS9A 4BXUA 2FJ1A 1XMKA 1A6IA 3PM1A 4RA2A 1OLTA 3BCAA 5AONA 4BYYA 1ULYA 3F72A 2NS7A 1Z7UA 1FJLA 1W1WE 4A0XA 4IEJA 4F3QA 2OCCH 4DBRA 2IGOA 5IP9J 4XRSA 1U78A 1DU6A 4FASD 5M3MJ 1R1TA 1C0WA 1X1DA 5C4JJ 4A5NA 4LB6B 1FWZA 1E17A 1FC3A 1X58A 1D8KA 4E7IA 4F52A 3FF5A 2WAQN 4LB5A 2QCOA 1O4XA 2ID3A 1B1BA 3OL3A 3J7AO 1WI3A 4UUTA 2I8DA 1R1UA 2ZSIB 3VSLA 3I55I 4PJLA 2DMUA 4LIUA 4M72A 3JRBA 3FX3A 4HPQA 4DIQA 2PMUA 4ANJA 1KU9A 3OS2A 9ANTA 5K5QA 4H0EA 4CCKA 3ULQB 2VQHA 3F8BA 3IWFA 5CVUA 4C3IJ 4X0GA 3KYDB 1DUXC 3ABTA 2XSDC 2BEOA 3A02A 1G8XA 1W36C 2MSYA 3ZGKA 1OCZH 3LOCA 1VQ5I 2DBBA 4XSZF 1ZELA 4HSTA 1APLC 4U7DA 1PUFB 2XC7A 1FTZA 2FE3A 2Y75A 1KZHA 1ZRFA 1WJCA 3H3UA 5EGOB 4KDPA 5LHHA 2RNGA 2CMPA 2RQQA 3LSGA 2HTJA 4JYKA 4S04A 4P1WA 4E70A 3M4OJ 3NRVA 4JQFA 2CFXA 2WTEA 1W0TA 4BQNA 2ZKZA 3H9QA 3HOXJ 2OF7A 2WAEA 1YG2A 3C1DA 4Y15A 2ADUA 1Y56A 2UWMA 5A2QK 4XMYA 3DEUA 3LQQA 2KRHA 5C4XJ 4XLPF 1YE9A 2V6EA 5IYCJ 1Z3XA 3V8LA 2LKPA 2HXOA 2F5EA 3I64A 1U6GA 4NB5A 4HX4A 3FMRA 1QRYA 5E8GA 4CCNA 2BY0A 1IRFA 4CDGA 5F1JA 2XKPA 1MBKA 4BHCA 3LA3A 3FBIB 2X85A 3W6KB 3CC4I 1TZLA 1J59A 2Y0SN 5F04A 5DDGA 1FP1D 1FT9A 3BJOA 4M73A 1TW2A 3S17J 3KLOA 3D5RC 1IN7A 1LFBA 1LDJA 2OC6A 2R4GA 3C2BA 4AIKA 1ZR2A 3LA2A 2RC4A 2ZSHB 3GTKJ 2GIVA 1OYIA 2ZJ2A 2I10A 4CXFA 2QZ8A 2W84A 4FTHA 1XMXA 4AD9A 2DMPA 2WB1A 1ETQA 1MMGA 1XN7A 1KGSA 2EIJH 3GUDA 4PZJA 4BHPA 2LY1A 2VL8A 2XDVA 2ZFUA 1S6LA 3H92A 1Z6TA 3S3MA 4GDFA 4Y52J 1YJ9I 5GAHJ 1B59A 1K83J 1P9QC 3CCEI 5FRNA 4RM3A 2M2EA 2V79A 2X9DA 4CH7A 2LR8A 1RUOA 1TBXA 5F1RA 3W2VA 2GXBA 5TJJA 2PX9A 3GTJJ 1IN5A 3HPHA 2EIMH 2EPFA 2GAUA 1T38A 2HOAA 3CDHA 1HKQA 2GBYA 5AIPA 3M8EA 4A5MA 2Y30A 3BT9A 3EUHA 2JUCA 3VODA 1Z05A 3SDGA 4G7ZF 1O3RA 2X48A 2F5VA 1J75A 4KUMA 2HDDA 1P4XA 1TLHB 3ZQLA 3H3VK 2IA1A 2K27A 1U9NA 3KETA 2X4HA 1KQ8A 3OSFA 1ENHA 5HLGA 1X1BA 3K9TA 1MW7A 5J4VA 3P7NA 3KP5A 1JUSA 3AG2H 2DMQA 1OYWA 4P55A 4V19K 3K10A 3K4LA 2AXTC 1TP4A 1KONA 4PUSA 1HOMA 4A3IJ 5E1WA 3EYIA 3A4CA 4CCOA 4B3AA 3HIFA 2RQPA 1NK2P 3TOAA 2QSGX 3RYPA 4FQGA 3IHUA 4CZCA 5J3LA 1GV5A 3HPGA 4Z6YA 3OOUA 4E7LA 3QPSA 4ENNA 4EEFG 2HQ5A 2WAFA 4HAMA 1X3WB 2LLKA 1EH8A 3S1NJ 2LK2A
chains in the Genus database with same CATH topology
3TO9A 3RI4A 3R61A 5DYMA 2HZTA 4HV5A 2AXLA 2JSCA 3GFIA 1P6RA 1BM9A 4HLYA 5BMZA 3F6OA 3I53A 4PGGA 3R0AA 3ERED 2WV0A 2EFNA 5HVQC 3E6BA 3N97A 4IRIA 5F64A 2C6YA 1JGSA 4UVCA 1RNLA 4GCVA 3ELKA 4ZYEA 2H6CA 2LF8A 3GFMA 3NEUA 5HDGA 3BJAA 1IF1A 4EVIA 2MBFA 3ZN1A 3ABUA 1FBSA 3E5QA 2HQNA 1XCBA 3L09A 5IT9Z 5FFXA 3F22A 4M6XA 1HW5A 1PUEE 2ESNA 5J8FA 2DAOA 3R6SA 3BROA 1W5SA 4M74A 5ERIA 2L01A 1K6OA 2CW0F 4UVBA 1G3WA 1XGNA 5LRRA 3FMSA 2WWYA 4I7HA 4HF1A 1ZRDA 3V8KA 2JZYA 3LAPA 1HXDA 2BYVE 2VT3A 5BPIA 5J6XA 3R60A 2E1CA 3ECOA 3K0LA 3FM5A 2PG4A 4GYGA 4ZYDA 4CHUA 2RVCA 4O5VA 1FSEA 2PEXA 4HDVA 1FOKA 3F8CA 1F4KA 2QENA 1IAWA 4I2OA 1S7OA 1HQCA 4O6JA 1AWCA 4NHJA 1QO0D 1IXRC 1CGPA 2XIGA 2GA2A 3L7WA 3J81Z 3WE3A 3E3VA 4KIFA 3M9AA 2QLZA 1EH7A 2VN2A 5BPDA 4G7HF 3M7GA 3QRFF 3HSFA 1USTA 5KK1A 4M71A 4KIGA 3TKYA 4DNCA 1R22A 4KMUX 5FB2A 4I01A 4Z2YA 4ZZDA 1MDMA 1R58A 3WTSC 3K1PA 2G9WA 1BI2A 1XGOA 3CTAA 2P5VA 4EM0B 1IUYA 4KIBA 2MD5A 5D6FA 1WSUA 2EFOA 2IA2A 2Z99A 5L3CA 3P9KA 5K5OA 2BV6A 3MAJA 3VEPA 4OIQF 3C3WA 3F8FA 4KN4X 3ZN0A 1H0MA 4IF4A 2O3FA 1TW3A 2EV5A 3DV8A 4RGXA 3Q5FA 2VC1A 3HUGA 4O3MA 4YFNF 4P9FA 1SFEA 2EV6A 4LMYA 1YTYA 1MJBA 1HSJA 3F23A 2HDCA 3J80Z 3QP5A 1TQIA 1BJAA 1SAXA 1ZRCA 3JW4A 3CO6C 2IA0A 4U7BA 3KZZA 3BJ6A 3WODF 2CYYA 1LDDA 2FQ3A 2DU9A 4UVAA 1T6SA 3LFKA 3CUQC 1ODDA 1YS6A 4XBFA 2FOKA 2GWRA 1J0RA 4Y13A 4L0YB 4MGRA 2PBIA 3U1DA 2CG4A 3FXUA 1V4RA 3E5XA 3WGGA 1ZLJA 4YG2F 5LLQA 2ESHA 2Q8KA 2YX7A 4B8XA 2V1UA 4YFKF 3WTXC 2LF7A 2ISYA 2QBYA 5IT9K 1FLIA 1ON1A 5D5XB 5ED4A 3COAC 2IPQX 2M1BA 1BN5A 1UFMA 6PAXA 3GWZA 2STWA 1GVJA 5TRDA 1O3SA 4U0WA 1FPQA 3MWMA 1XGMA 4AIJA 4EJUA 3FWEA 1GHCA 2PMHA 1SD6A 3ZMVA 2YX4A 1EH6A 2M5WA 1IXSB 3V4GA 2L02A 4R8HA 2HS5A 3C7JA 2KIMA 1IW7F 4YIIA 4A0YA 4HF0A 4LLNA 2O0YA 4LJZF 3OOPA 1MDMB 5L3GA 5D8LB 5DCFA 4PCQA 3T0YA 4R79A 3BDDA 1G3YA 1W7PA 5HS7A 4HX7A 2KRFA 3LQRA 4IXAA 1HKTA 4LGWA 2YPRA 3REOA 3I54A 1BIBA 2BBYA 2VOPA 4A12A 3AAFA 4G6QA 1YW8A 3GEZA 4UNOA 1J2XA 5EEGA 3TO7A 3TDUC 3J81K 1OMIA 2VBYA 4OIOF 2XASA 2PQ8A 2MH2A 3GO5A 2HR3A 1STZA 2R3SA 2P4WA 1L0OC 1BIAA 4EJOA 1ZG1A 4ZYGA 2PN6A 3I4PA 1K7AA 2P7VB 2FNAA 1B9MA 5LGTA 2NRAC 2OU2A 3F21A 4ASNA 3KLNA 4YFXF 3VB2A 1UHWA 1K79A 2KIFA 1ZAOA 4ETSA 4L9VA 1E2XA 3KP3A 2E7XA 2DPUA 1U8RA 3GX4X 3QPHA 4EGYA 3FM3A 1BC7C 1XMAA 1ZREA 3FXQA 4Q47A 2L54A 1YW9A 3QU3A 3IKVA 4FX0A 4GO1A 1XSDA 3F8NA 5D6EA 2Z3YA 2OD5A 1BI1A 1R7JA 1I27A 2QQBA 1Z91A 4QWQA 4A2UA 2IRFG 5HDNA 3CUOA 2ZO4A 3MZYA 2QBYB 3V7CA 1SFXA 2FMLA 5DUKA 3IRQA 2FEZA 1LEAA 1OYYA 3KCCA 5E1XA 4I09A 3IRRA 2R7FA 2M30A 3WTWC 3ZMUA 2LSOA 5H6QA 2UXNA 2ZMEA 2VC0A 1LQ1A 4WF2A 1G6NA 2A07F 5CJ9A 2M8EA 3HHHA 1WRJA 4WXDA 5FD5A 2DK5A 2P6TA 1R00A 3E5UA 2HOEA 4XSXF 2GA1A 1KYWA 1T0FA 3ZMZA 5LBQA 1AOYA 1USSA 1SD4A 5K5RA 4EQQA 4CO8A 2WC2A 3RYRA 2ZXJA 2UZKA 4MHGA 3JAMZ 4WCGA 1W7PB 2EFWA 3BPVA 5HLHA 4I0BA 4P5OA 2FBIA 3ML6A 1QGPA 2NS0A 1ZARA 2V1XA 2P8TA 2PJPA 4EJWA 1YFHA 2KKOA 2HGCA 3HTUA 2PFBA 2OZUA 2PLYA 1W5TA 4FX4A 4G9YA 1MD0A 2ELHA 1F1ZA 5L3EA 3TDZC 1ON2A 4IVNA 5E1ZB 1ZH5A 4UXNA 5DCMA 4CGZA 1P2FA 2JT1A 1SMYF 1V3FA 1XDUA 1EV7A 1F5TA 3O3KA 1MGTA 2ZNZA 2VE8A 2A69F 2JPCA 1IN4A 2QQAA 5LGNA 1DPRA 5EEHA 1BI0A 2A6EF 3P9IA 2EB7A 1TQMA 3F6VA 5JVTA 2P7CB 1U5TA 1WKMA 2Q0OA 1S3JA 5FGMA 1GXPA 3HRSA 2OZ6A 4OINF 2CWEA 2TDXA 5D4RA 3P9CA 2D45A 2VONA 4KN7X 4CICA 1UHMA 2DQLA 3KP7A 5ICGA 1YQAA 3T5XA 1S7AA 4GYIA 2ZMEB 3DXJF 2B0LA 2OBPA 2DT5A 4R1HA 1MJ9A 2G7HA 2P6SA 3PQJA 2V1DA 2F5DA 1R5GA 5CVRA 3BOQA 4LLGF 4PGHA 3I5UA 4U0VA 4WX9A 2VT2A 3R4KA 2ZFWA 4M9XA 2VE9A 3VFZA 2E7WA 5H6RA 2ZCWA 4ENMA 2MH9A 2A6HF 1KU7A 1J9IA 2FF4A 3SHFA 1W7PD 5LEJA 2DQRA 4LD5A 3GYHX 2VBWA 1ZG5A 1XDSA 1KU2A 1G4DA 1XCVA 1DPUA 2W85A 2XRNA 2YR2A 3Q9VA 2ETHA 3SZTA 3DF8A 4HBLA 1QZZA 2FRHA 2D2WA 2QM3A 1ZN2A 2XAFA 3GXOA 4Y17A 2XGXA 2RKHA 2CQKA 2RDPA 5DCMB 2HKXA 5LHGA 1PP7U 4HX8A 1FP2A 2HWVA 3WU1B 4LK0F 1R5HA 1X3UA 1TTYA 4OOIA 3SFZA 4Q5SF 2VBXA 3JAMK 5LHIA 5D5UB 3IL2A 1A04A 4BHBA 5DD8A 2F5CA 3M8FA 3JSPA 4KYWA 2GQQA 2Z5UA 4B09A 2IVMA 4LLLA 3MCZA 1B6AA 3GF2A 4I02A 1K78B 3SXYA 2K02A 1U5TB 1I6XA 2DLLA 3IC7A 4M6YA 1KQ0A 2NYXA 1TNSA 1HW1A 1TQPA 2CGPA 4EM2A 1S29A 1NHAA 2HFHA 3C18A 2Y0MA 3KZYA 3ZP5A 1OR7A 2AS5F 1RIOH 1QQIA 4ESFA 1O3QA 3K69A 4LFUA 3GW2A 5ILVA 4MTEA 4U0YA 3JTGA 2H94A 2DPDA 1D8JA 1JXSA 4M9SA 1J5YA 2FXAA 1LNWA 1PDNC 3RKYA 1QNTA 2VODA 2EJRA 2EFQA 2ZNYA 2P5LC 3G3ZA 3HHGA 4XRFA 2FSWA 3BZ6A 1F9NA 3ROUA 3QP6A 4KNYA 1Q1HA 3N4MA 2RNJA 5AIQA 4I98B 1B4AA 2HTSA 1ZYRF 4L9NA 2CSOA 3HRUA 3RKXA 4FHTA 3IKTA 1XGSA 2GXGA 1L3LA 1B9NA 4GXOA 1SD5A 3RKWA 5D5VB 3M1EA 1WI9A 1YYVA 4MTDA 2FMYA 3BWGA 4MNUA 3WE2A 1O7FA 3PQKA 4EJVA 4EJTA 3I0TA 3VOEA 5CYVA 3TOBA 3DPTA 1H9TA 2XAQA 2LNBA 3NQOA 4CZZA 4EM1A 3R0JA 2EV0A 2A5YB 1IXCA 2H27A 4L9TA 1GXQA 5LEKA 4KICA 3RJPA 2XVCA 1BI3A 2QYOA 3U9GA 4RS8A 2ISZA 3MFKA 3GZ6A 4HYEA 4A6DA 1D5VA 2QWWA 4I0AA 5DD4A 2UXXA 2QVOA 3CO7C 2EA4A 4RB3C 3U2RA 2XROA 2MLKA 4S05A 3V7SA 3GFLA 5E18F 1FBQA 4UHTA 1IN8A 2V9VA 3ZMTA 4LG0A 1OKRA 4TV7A 1JE8A 1KA8A 2HKOA 4L5IA 2MA3A 2H6BA 1T98A 3V7RA 5KVRA 4IRHA 2G7UA 4K2EA 1ZLKA 3WTYC 2P5KA 5ILUA 1SD7A 3L2CA 2HQRA 2J5OA 2FBHA 3DKWA 2JPBA 2R7DA 5E20A 4ESJA 3BPXA 4N9IA 4MQ9F 3WU0A 4WK8F 4QLCU 2FBKA 2L3DA 4P96A 4KA4A 4G6DA 4N0BA 4L0ZB 2XAHA 1MZBA 2D1VA 1XSXA 4JK1X 3B73A 4ZH4F 4HOBA 2Q2EA 1G3TA 4IHTA 3E6CC 2V6CA 1KQ9A 2F2EA 3KFWX 5CLSA 3LWFA 3RPQA 1FNNA 1FYMA 4YIFA 2O6GE 2DI3A 3T8RA 3RPUA 3HTSB 4EGZA 1LVAA 5LRSA 2GZWA 2DO7A 2DW4A 2OA4A 3E6MA 3KP6A 5F6FA 3HSRA 5HOOA 4RGUA 2FU4A 5IT3A 2EK5A 1O3TA 5HS8A 4OMYA 1T39A 3J80K 2NAZA 1IRGA 3LA7A 3FXRA 1I1GA 3IWZA 4RGRA 2NNNA 4HA8A 2YU3A 4RGSA 2OQGA 3LAJA 2W24A 4BAYA 4RB1A 5BS6A 5DEQA 2IJLA 2JTVA 3GFJA 3F3XA 5FLXZ 3GVAA 1P4AA 1D3YA 3KEOA 2O03A 5BQTA 1BOAA 3D0SA 2K86A 4WXHA 3HOSA 5L3BA 4L9JA 5ICCA 4WWCA 3HSEA 4A6EA 2M45A 1HKSA 2ZBKA 1P92A 2KIUA 2K4BA 3K1NA 2L4AA 1JHFA 2COMA 2J5PA 5D5WB 2KJCA 3QPTA 4LG0B 4WXCA 1HBXG 3JTHA 3HOTA 1WQ2A 1RUNA 2HYFA 3I59A 2BE5F 3ZMDA 1S8NA 1Z1DA 3RDIA 3O6BB 4EMSA 2Y48A 2BGCA 3B02A 3HRTA 1KU3A 5JR3A 3PFIA 4HW0A 5JHUA 5HLIA 2OAZA 3W6JB 2O8XA 2YSRA 2EA2A 2IT0A 4F7ZA 3WTTC 2RGVA 3V8JA 1K78A 3HRMA 3S2WA 2D1HA 2FA5A 4MQVA 3I71A 4P9UA 1FYKA 4DQ2A 3GLXA 4ZYHA 2MC3A 3DQVC 1LDKB 3ECHA 1YS7A 4RAYA 4PDKA 1LEBA 5CVVA 1LJ9A 3ZQ7A 1YIOA 5ILSA 4JBAA 1Y0UA 3K2ZA 4HZFA 4BQAA 4MEXF 5LGUA 4HF2A 1FBUA 3EDPA 3ISPA 1FYLA 1MKMA 2A3SA 1BBYA 4HV6A 3O2PE 1REPC 3F8MA 1P4WA 3I58A 3TQNA 1RI7A 2K4JA 3G73A 1FY7A 1FSHA 1O7LA 4ENJA 1ZGJA 5CVIA 1HSTA 4IHSA 2F5FA 2XHKA 3CUQA 5FO5A 2VBZA 4CYDA 3OV8A 1Z6RA 3QOPA 3BP8A 3ZPLA 2QUFA 3E97A 4NQWA 1IZ1A 1QBJA 1OPCA 5J8CA 5DV5A 4AWXB 2MLGA 4AIHA 1YW7A 1G3SA 4FT8A 2NNYA 2KJBA 1CF7A 2FNPA 2X0LA 1I1SA 2VOOA 5JI6A 2VXZA 4G7OF 1HW2A 4IJAA 3FZVA 5E8IA 1ONVA 4L5JA 4HDUA 1VTNC 4BH9A 2OQRA 1FZPB 2EWNA 5DUIA 5D8KB 3E6DA 1SFUA 3I59B 3WG9A 4UV9A 2IW5A 5FLXK 3EYYA 5ICFA 2A61A 4LK1F 3TGNA 2QQ9A 2Z33A 1QZYA 3KP2A 3K1MA 3WTVC 5L3DA 2HYGD 1XSVA 1O57A 4OMZA 1SMTA 1DDNA 5JFRA 1I5ZA 3T8TA 3CJNA 1U2WA 2DFIA 1U5TC 5A2QZ 3DFGA 2LDUA 4IPAA 4M9ZA 4IRGA 4ENKA 1YO5C 2Z9OA 1J7KA 1KYZA 1YLFA 3RTRA 1W4MA 3Q9SA 4N9HA 3H3ZA 2XV4S 2K7LA 1UCRA 1ZG3A 3RIRA 4HQEA 5CVJA 3L00A 3BY6A 4D0PA 4RB0A 3FMQA 4ZZLA 2O61A 2H09A 5HDKA 2ACJA 1LB2A 3EQLF 1T2KA 1U3EM 4G94A 1TNTA 2XUBA 2STTA 3KE2A 3MEXA 3MZHA 1WWXA 4MEYF 2XAGA 3KEQA 4UV8A 1Z9CA 1FX7A 3DP7A 1R1VA 2DK8A 2XKOA 3CUQB 3QAHA 3SQNA 5D4SA 3TO6A 1BC8C 4KMFA 4AVPA 4Q48A 1R23A 2XAJA 2RV8A 4HLXA 1JHHA 2RN7A 5FFZA 3D5LA 3QU6A 4RB2C 3L9FA 4OIRF 4KFCA 2W57A 1CF7B 3JSOA 3KP4A 1XB4A 2M87A 1MJAA 1R36A 2A68F 4ESBA 2DTRA 3FHZA 1XD7A 4KT5C 4GGGA 5H20A 4EV0A 4U88A 3EETA 3WGHA 3WTZA 1IN6A 4L18B 5BOXA 5E17F 3GZ5A 3CLOA 3DPLC 4HQMA 1H9GA 3HYIA 1QPMA 1RZ4A 5FD6A 5K1YA 5L3FA 1DP7P 3T1BA 3MQ0A 4G8XA 3WGIA 3WTUC 4UUVA 2E1NA 2JRTA 1PP8F 3ZMSA 4XLNF 2PI0A 5ICEA 4ON0A 1ZGAA 2HEOA 2L4MA 4Q4ZF 4A0ZA 3SZPA 2W25A 1UB9A 2IP2A 1ZHFA 2CO5A 4OU0A 3LSTA 4BNCA 4RAZA 2EFPA 5HS9A 4BXUA 1XMKA 5AONA 4BYYA 1ULYA 3F72A 1Z7UA 4A0XA 1U78A 1R1TA 1C0WA 4A5NA 4LB6B 1FWZA 1E17A 1FC3A 1D8KA 3FF5A 4LB5A 1B1BA 3J7AO 1R1UA 4M72A 3FX3A 2PMUA 1KU9A 5K5QA 4H0EA 3ULQB 3F8BA 3IWFA 5CVUA 1DUXC 3ABTA 2BEOA 2DBBA 4XSZF 4U7DA 2FE3A 2Y75A 1ZRFA 3H3UA 4KDPA 5LHHA 2HTJA 4S04A 4E70A 3NRVA 4JQFA 2CFXA 2WTEA 2ZKZA 1YG2A 3C1DA 4Y15A 2ADUA 2UWMA 5A2QK 3DEUA 3LQQA 4XLPF 3V8LA 2LKPA 2F5EA 3I64A 1U6GA 4NB5A 4HX4A 3FMRA 5E8GA 1IRFA 4CDGA 2XKPA 4BHCA 3LA3A 3W6KB 1J59A 5DDGA 1FP1D 1FT9A 3BJOA 4M73A 1TW2A 3KLOA 1IN7A 1LDJA 4AIKA 3LA2A 2RC4A 2GIVA 1OYIA 2ZJ2A 4CXFA 2QZ8A 2W84A 4AD9A 1XN7A 1KGSA 3GUDA 4PZJA 4BHPA 1S6LA 3H92A 1Z6TA 1B59A 2V79A 1RUOA 1TBXA 5F1RA 2GXBA 5TJJA 1IN5A 1T38A 4OIPF 2GAUA 3CDHA 1HKQA 5AIPA 3M8EA 4A5MA 3EUHA 3VODA 1Z05A 4G7ZF 1O3RA 1J75A 4KUMA 1P4XA 1TLHB 2IA1A 2K27A 3KETA 2X4HA 1KQ8A 5HLGA 3K9TA 3P7NA 3KP5A 1OYWA 4P55A 5E1WA 3EYIA 3HIFA 2RQPA 3TOAA 3RYPA 3IHUA 4ENNA 4HAMA 1EH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO9 A;  3RI4 A;  3R61 A;  5DYM A;  2HZT A;  4HV5 A;  2AXL A;  2JSC A;  3GFI A;  1P6R A;  1BM9 A;  4HLY A;  5BMZ A;  3F6O A;  3I53 A;  4PGG A;  3R0A A;  3ERE D;  2WV0 A;  2EFN A;  5HVQ C;  3E6B A;  3N97 A;  4IRI A;  5F64 A;  2C6Y A;  1JGS A;  4UVC A;  1RNL A;  4GCV A;  3ELK A;  4ZYE A;  2H6C A;  2LF8 A;  3GFM A;  3NEU A;  5HDG A;  3BJA A;  1IF1 A;  4EVI A;  2MBF A;  3ZN1 A;  3ABU A;  1FBS A;  3E5Q A;  2HQN A;  1XCB A;  3L09 A;  5IT9 Z;  5FFX A;  3F22 A;  4M6X A;  1HW5 A;  1PUE E;  2ESN A;  5J8F A;  2DAO A;  3R6S A;  3BRO A;  1W5S A;  4M74 A;  5ERI A;  2L01 A;  1K6O A;  2CW0 F;  4UVB A;  1G3W A;  1XGN A;  5LRR A;  3FMS A;  2WWY A;  4I7H A;  4HF1 A;  1ZRD A;  3V8K A;  2JZY A;  3LAP A;  1HXD A;  2BYV E;  2VT3 A;  5BPI A;  5J6X A;  3R60 A;  2E1C A;  3ECO A;  3K0L A;  3FM5 A;  2PG4 A;  4GYG A;  4ZYD A;  4CHU A;  2RVC A;  4O5V A;  1FSE A;  2PEX A;  4HDV A;  1FOK A;  3F8C A;  1F4K A;  2QEN A;  1IAW A;  4I2O A;  1S7O A;  1HQC A;  4O6J A;  1AWC A;  4NHJ A;  1QO0 D;  1IXR C;  1CGP A;  2XIG A;  2GA2 A;  3L7W A;  3J81 Z;  3WE3 A;  3E3V A;  4KIF A;  3M9A A;  2QLZ A;  1EH7 A;  2VN2 A;  5BPD A;  4G7H F;  3M7G A;  3QRF F;  3HSF A;  1UST A;  5KK1 A;  4M71 A;  4KIG A;  3TKY A;  4DNC A;  1R22 A;  4KMU X;  5FB2 A;  4I01 A;  4Z2Y A;  4ZZD A;  1MDM A;  1R58 A;  3WTS C;  3K1P A;  2G9W A;  1BI2 A;  1XGO A;  3CTA A;  2P5V A;  4EM0 B;  1IUY A;  4KIB A;  2MD5 A;  5D6F A;  1WSU A;  2EFO A;  2IA2 A;  2Z99 A;  5L3C A;  3P9K A;  5K5O A;  2BV6 A;  3MAJ A;  3VEP A;  4OIQ F;  3C3W A;  3F8F A;  4KN4 X;  3ZN0 A;  1H0M A;  4IF4 A;  2O3F A;  1TW3 A;  2EV5 A;  3DV8 A;  4RGX A;  3Q5F A;  2VC1 A;  3HUG A;  4O3M A;  4YFN F;  4P9F A;  1SFE A;  2EV6 A;  4LMY A;  1YTY A;  1MJB A;  1HSJ A;  3F23 A;  2HDC A;  3J80 Z;  3QP5 A;  1TQI A;  1BJA A;  1SAX A;  1ZRC A;  3JW4 A;  3CO6 C;  2IA0 A;  4U7B A;  3KZZ A;  3BJ6 A;  3WOD F;  2CYY A;  1LDD A;  2FQ3 A;  2DU9 A;  4UVA A;  1T6S A;  3LFK A;  3CUQ C;  1ODD A;  1YS6 A;  4XBF A;  2FOK A;  2GWR A;  1J0R A;  4Y13 A;  4L0Y B;  4MGR A;  2PBI A;  3U1D A;  2CG4 A;  3FXU A;  1V4R A;  3E5X A;  3WGG A;  1ZLJ A;  4YG2 F;  5LLQ A;  2ESH A;  2Q8K A;  2YX7 A;  4B8X A;  2V1U A;  4YFK F;  3WTX C;  2LF7 A;  2ISY A;  2QBY A;  5IT9 K;  1FLI A;  1ON1 A;  5D5X B;  5ED4 A;  3COA C;  2IPQ X;  2M1B A;  1BN5 A;  1UFM A;  6PAX A;  3GWZ A;  2STW A;  1GVJ A;  5TRD A;  1O3S A;  4U0W A;  1FPQ A;  3MWM A;  1XGM A;  4AIJ A;  4EJU A;  3FWE A;  1GHC A;  2PMH A;  1SD6 A;  3ZMV A;  2YX4 A;  1EH6 A;  2M5W A;  1IXS B;  3V4G A;  2L02 A;  4R8H A;  2HS5 A;  3C7J A;  2KIM A;  1IW7 F;  4YII A;  4A0Y A;  4HF0 A;  4LLN A;  2O0Y A;  4LJZ F;  3OOP A;  1MDM B;  5L3G A;  5D8L B;  5DCF A;  4PCQ A;  3T0Y A;  4R79 A;  3BDD A;  1G3Y A;  1W7P A;  5HS7 A;  4HX7 A;  2KRF A;  3LQR A;  4IXA A;  1HKT A;  4LGW A;  2YPR A;  3REO A;  3I54 A;  1BIB A;  2BBY A;  2VOP A;  4A12 A;  3AAF A;  4G6Q A;  1YW8 A;  3GEZ A;  4UNO A;  1J2X A;  5EEG A;  3TO7 A;  3TDU C;  3J81 K;  1OMI A;  2VBY A;  4OIO F;  2XAS A;  2PQ8 A;  2MH2 A;  3GO5 A;  2HR3 A;  1STZ A;  2R3S A;  2P4W A;  1L0O C;  1BIA A;  4EJO A;  1ZG1 A;  4ZYG A;  2PN6 A;  3I4P A;  1K7A A;  2P7V B;  2FNA A;  1B9M A;  5LGT A;  2NRA C;  2OU2 A;  3F21 A;  4ASN A;  3KLN A;  4YFX F;  3VB2 A;  1UHW A;  1K79 A;  2KIF A;  1ZAO A;  4ETS A;  4L9V A;  1E2X A;  3KP3 A;  2E7X A;  2DPU A;  1U8R A;  3GX4 X;  3QPH A;  4EGY A;  3FM3 A;  1BC7 C;  1XMA A;  1ZRE A;  3FXQ A;  4Q47 A;  2L54 A;  1YW9 A;  3QU3 A;  3IKV A;  4FX0 A;  4GO1 A;  1XSD A;  3F8N A;  5D6E A;  2Z3Y A;  2OD5 A;  1BI1 A;  1R7J A;  1I27 A;  2QQB A;  1Z91 A;  4QWQ A;  4A2U A;  2IRF G;  5HDN A;  3CUO A;  2ZO4 A;  3MZY A;  2QBY B;  3V7C A;  1SFX A;  2FML A;  5DUK A;  3IRQ A;  2FEZ A;  1LEA A;  1OYY A;  3KCC A;  5E1X A;  4I09 A;  3IRR A;  2R7F A;  2M30 A;  3WTW C;  3ZMU A;  2LSO A;  5H6Q A;  2UXN A;  2ZME A;  2VC0 A;  1LQ1 A;  4WF2 A;  1G6N A;  2A07 F;  5CJ9 A;  2M8E A;  3HHH A;  1WRJ A;  4WXD A;  5FD5 A;  2DK5 A;  2P6T A;  1R00 A;  3E5U A;  2HOE A;  4XSX F;  2GA1 A;  1KYW A;  1T0F A;  3ZMZ A;  5LBQ A;  1AOY A;  1USS A;  1SD4 A;  5K5R A;  4EQQ A;  4CO8 A;  2WC2 A;  3RYR A;  2ZXJ A;  2UZK A;  4MHG A;  3JAM Z;  4WCG A;  1W7P B;  2EFW A;  3BPV A;  5HLH A;  4I0B A;  4P5O A;  2FBI A;  3ML6 A;  1QGP A;  2NS0 A;  1ZAR A;  2V1X A;  2P8T A;  2PJP A;  4EJW A;  1YFH A;  2KKO A;  2HGC A;  3HTU A;  2PFB A;  2OZU A;  2PLY A;  1W5T A;  4FX4 A;  4G9Y A;  1MD0 A;  2ELH A;  1F1Z A;  5L3E A;  3TDZ C;  1ON2 A;  4IVN A;  5E1Z B;  1ZH5 A;  4UXN A;  5DCM A;  4CGZ A;  1P2F A;  2JT1 A;  1SMY F;  1V3F A;  1XDU A;  1EV7 A;  1F5T A;  3O3K A;  1MGT A;  2ZNZ A;  2VE8 A;  2A69 F;  2JPC A;  1IN4 A;  2QQA A;  5LGN A;  1DPR A;  5EEH A;  1BI0 A;  2A6E F;  3P9I A;  2EB7 A;  1TQM A;  3F6V A;  5JVT A;  2P7C B;  1U5T A;  1WKM A;  2Q0O A;  1S3J A;  5FGM A;  1GXP A;  3HRS A;  2OZ6 A;  4OIN F;  2CWE A;  2TDX A;  5D4R A;  3P9C A;  2D45 A;  2VON A;  4KN7 X;  4CIC A;  1UHM A;  2DQL A;  3KP7 A;  5ICG A;  1YQA A;  3T5X A;  1S7A A;  4GYI A;  2ZME B;  3DXJ F;  2B0L A;  2OBP A;  2DT5 A;  4R1H A;  1MJ9 A;  2G7H A;  2P6S A;  3PQJ A;  2V1D A;  2F5D A;  1R5G A;  5CVR A;  3BOQ A;  4LLG F;  4PGH A;  3I5U A;  4U0V A;  4WX9 A;  2VT2 A;  3R4K A;  2ZFW A;  4M9X A;  2VE9 A;  3VFZ A;  2E7W A;  5H6R A;  2ZCW A;  4ENM A;  2MH9 A;  2A6H F;  1KU7 A;  1J9I A;  2FF4 A;  3SHF A;  1W7P D;  5LEJ A;  2DQR A;  4LD5 A;  3GYH X;  2VBW A;  1ZG5 A;  1XDS A;  1KU2 A;  1G4D A;  1XCV A;  1DPU A;  2W85 A;  2XRN A;  2YR2 A;  3Q9V A;  2ETH A;  3SZT A;  3DF8 A;  4HBL A;  1QZZ A;  2FRH A;  2D2W A;  2QM3 A;  1ZN2 A;  2XAF A;  3GXO A;  4Y17 A;  2XGX A;  2RKH A;  2CQK A;  2RDP A;  5DCM B;  2HKX A;  5LHG A;  1PP7 U;  4HX8 A;  1FP2 A;  2HWV A;  3WU1 B;  4LK0 F;  1R5H A;  1X3U A;  1TTY A;  4OOI A;  3SFZ A;  4Q5S F;  2VBX A;  3JAM K;  5LHI A;  5D5U B;  3IL2 A;  1A04 A;  4BHB A;  5DD8 A;  2F5C A;  3M8F A;  3JSP A;  4KYW A;  2GQQ A;  2Z5U A;  4B09 A;  2IVM A;  4LLL A;  3MCZ A;  1B6A A;  3GF2 A;  4I02 A;  1K78 B;  3SXY A;  2K02 A;  1U5T B;  1I6X A;  2DLL A;  3IC7 A;  4M6Y A;  1KQ0 A;  2NYX A;  1TNS A;  1HW1 A;  1TQP A;  2CGP A;  4EM2 A;  1S29 A;  1NHA A;  2HFH A;  3C18 A;  2Y0M A;  3KZY A;  3ZP5 A;  1OR7 A;  2AS5 F;  1RIO H;  1QQI A;  4ESF A;  1O3Q A;  3K69 A;  4LFU A;  3GW2 A;  5ILV A;  4MTE A;  4U0Y A;  3JTG A;  2H94 A;  2DPD A;  1D8J A;  1JXS A;  4M9S A;  1J5Y A;  2FXA A;  1LNW A;  1PDN C;  3RKY A;  1QNT A;  2VOD A;  2EJR A;  2EFQ A;  2ZNY A;  2P5L C;  3G3Z A;  3HHG A;  4XRF A;  2FSW A;  3BZ6 A;  1F9N A;  3ROU A;  3QP6 A;  4KNY A;  1Q1H A;  3N4M A;  2RNJ A;  5AIQ A;  4I98 B;  1B4A A;  2HTS A;  1ZYR F;  4L9N A;  2CSO A;  3HRU A;  3RKX A;  4FHT A;  3IKT A;  1XGS A;  2GXG A;  1L3L A;  1B9N A;  4GXO A;  1SD5 A;  3RKW A;  5D5V B;  3M1E A;  1WI9 A;  1YYV A;  4MTD A;  2FMY A;  3BWG A;  4MNU A;  3WE2 A;  1O7F A;  3PQK A;  4EJV A;  4EJT A;  3I0T A;  3VOE A;  5CYV A;  3TOB A;  3DPT A;  1H9T A;  2XAQ A;  2LNB A;  3NQO A;  4CZZ A;  4EM1 A;  3R0J A;  2EV0 A;  2A5Y B;  1IXC A;  2H27 A;  4L9T A;  1GXQ A;  5LEK A;  4KIC A;  3RJP A;  2XVC A;  1BI3 A;  2QYO A;  3U9G A;  4RS8 A;  2ISZ A;  3MFK A;  3GZ6 A;  4HYE A;  4A6D A;  1D5V A;  2QWW A;  4I0A A;  5DD4 A;  2UXX A;  2QVO A;  3CO7 C;  2EA4 A;  4RB3 C;  3U2R A;  2XRO A;  2MLK A;  4S05 A;  3V7S A;  3GFL A;  5E18 F;  1FBQ A;  4UHT A;  1IN8 A;  2V9V A;  3ZMT A;  4LG0 A;  1OKR A;  4TV7 A;  1JE8 A;  1KA8 A;  2HKO A;  4L5I A;  2MA3 A;  2H6B A;  1T98 A;  3V7R A;  5KVR A;  4IRH A;  2G7U A;  4K2E A;  1ZLK A;  3WTY C;  2P5K A;  5ILU A;  1SD7 A;  3L2C A;  2HQR A;  2J5O A;  2FBH A;  3DKW A;  2JPB A;  2R7D A;  5E20 A;  4ESJ A;  3BPX A;  4N9I A;  4MQ9 F;  3WU0 A;  4WK8 F;  4QLC U;  2FBK A;  2L3D A;  4P96 A;  4KA4 A;  4G6D A;  4N0B A;  4L0Z B;  2XAH A;  1MZB A;  2D1V A;  1XSX A;  4JK1 X;  3B73 A;  4ZH4 F;  4HOB A;  2Q2E A;  1G3T A;  4IHT A;  3E6C C;  2V6C A;  1KQ9 A;  2F2E A;  3KFW X;  5CLS A;  3LWF A;  3RPQ A;  1FNN A;  1FYM A;  4YIF A;  2O6G E;  2DI3 A;  3T8R A;  3RPU A;  3HTS B;  4EGZ A;  1LVA A;  5LRS A;  2GZW A;  2DO7 A;  2DW4 A;  2OA4 A;  3E6M A;  3KP6 A;  5F6F A;  3HSR A;  5HOO A;  4RGU A;  2FU4 A;  5IT3 A;  2EK5 A;  1O3T A;  5HS8 A;  4OMY A;  1T39 A;  3J80 K;  2NAZ A;  1IRG A;  3LA7 A;  3FXR A;  1I1G A;  3IWZ A;  4RGR A;  2NNN A;  4HA8 A;  2YU3 A;  4RGS A;  2OQG A;  3LAJ A;  2W24 A;  4BAY A;  4RB1 A;  5BS6 A;  5DEQ A;  2IJL A;  2JTV A;  3GFJ A;  3F3X A;  5FLX Z;  3GVA A;  1P4A A;  1D3Y A;  3KEO A;  2O03 A;  5BQT A;  1BOA A;  3D0S A;  2K86 A;  4WXH A;  3HOS A;  5L3B A;  4L9J A;  5ICC A;  4WWC A;  3HSE A;  4A6E A;  2M45 A;  1HKS A;  2ZBK A;  1P92 A;  2KIU A;  2K4B A;  3K1N A;  2L4A A;  1JHF A;  2COM A;  2J5P A;  5D5W B;  2KJC A;  3QPT A;  4LG0 B;  4WXC A;  1HBX G;  3JTH A;  3HOT A;  1WQ2 A;  1RUN A;  2HYF A;  3I59 A;  2BE5 F;  3ZMD A;  1S8N A;  1Z1D A;  3RDI A;  3O6B B;  4EMS A;  2Y48 A;  2BGC A;  3B02 A;  3HRT A;  1KU3 A;  5JR3 A;  3PFI A;  4HW0 A;  5JHU A;  5HLI A;  2OAZ A;  3W6J B;  2O8X A;  2YSR A;  2EA2 A;  2IT0 A;  4F7Z A;  3WTT C;  2RGV A;  3V8J A;  1K78 A;  3HRM A;  3S2W A;  2D1H A;  2FA5 A;  4MQV A;  3I71 A;  4P9U A;  1FYK A;  4DQ2 A;  3GLX A;  4ZYH A;  2MC3 A;  3DQV C;  1LDK B;  3ECH A;  1YS7 A;  4RAY A;  4PDK A;  1LEB A;  5CVV A;  1LJ9 A;  3ZQ7 A;  1YIO A;  5ILS A;  4JBA A;  1Y0U A;  3K2Z A;  4HZF A;  4BQA A;  4MEX F;  5LGU A;  4HF2 A;  1FBU A;  3EDP A;  3ISP A;  1FYL A;  1MKM A;  2A3S A;  1BBY A;  4HV6 A;  3O2P E;  1REP C;  3F8M A;  1P4W A;  3I58 A;  3TQN A;  1RI7 A;  2K4J A;  3G73 A;  1FY7 A;  1FSH A;  1O7L A;  4ENJ A;  1ZGJ A;  5CVI A;  1HST A;  4IHS A;  2F5F A;  2XHK A;  3CUQ A;  5FO5 A;  2VBZ A;  4CYD A;  3OV8 A;  1Z6R A;  3QOP A;  3BP8 A;  3ZPL A;  2QUF A;  3E97 A;  4NQW A;  1IZ1 A;  1QBJ A;  1OPC A;  5J8C A;  5DV5 A;  4AWX B;  2MLG A;  4AIH A;  1YW7 A;  1G3S A;  4FT8 A;  2NNY A;  2KJB A;  1CF7 A;  2FNP A;  2X0L A;  1I1S A;  2VOO A;  5JI6 A;  2VXZ A;  4G7O F;  1HW2 A;  4IJA A;  3FZV A;  5E8I A;  1ONV A;  4L5J A;  4HDU A;  1VTN C;  4BH9 A;  2OQR A;  1FZP B;  2EWN A;  5DUI A;  5D8K B;  3E6D A;  1SFU A;  3I59 B;  3WG9 A;  4UV9 A;  2IW5 A;  5FLX K;  3EYY A;  5ICF A;  2A61 A;  4LK1 F;  3TGN A;  2QQ9 A;  2Z33 A;  1QZY A;  3KP2 A;  3K1M A;  3WTV C;  5L3D A;  2HYG D;  1XSV A;  1O57 A;  4OMZ A;  1SMT A;  1DDN A;  5JFR A;  1I5Z A;  3T8T A;  3CJN A;  1U2W A;  2DFI A;  1U5T C;  5A2Q Z;  3DFG A;  2LDU A;  4IPA A;  4M9Z A;  4IRG A;  4ENK A;  1YO5 C;  2Z9O A;  1J7K A;  1KYZ A;  1YLF A;  3RTR A;  1W4M A;  3Q9S A;  4N9H A;  3H3Z A;  2XV4 S;  2K7L A;  1UCR A;  1ZG3 A;  3RIR A;  4HQE A;  5CVJ A;  3L00 A;  3BY6 A;  4D0P A;  4RB0 A;  3FMQ A;  4ZZL A;  2O61 A;  2H09 A;  5HDK A;  2ACJ A;  1LB2 A;  3EQL F;  1T2K A;  1U3E M;  4G94 A;  1TNT A;  2XUB A;  2STT A;  3KE2 A;  3MEX A;  3MZH A;  1WWX A;  4MEY F;  2XAG A;  3KEQ A;  4UV8 A;  1Z9C A;  1FX7 A;  3DP7 A;  1R1V A;  2DK8 A;  2XKO A;  3CUQ B;  3QAH A;  3SQN A;  5D4S A;  3TO6 A;  1BC8 C;  4KMF A;  4AVP A;  4Q48 A;  1R23 A;  2XAJ A;  2RV8 A;  4HLX A;  1JHH A;  2RN7 A;  5FFZ A;  3D5L A;  3QU6 A;  4RB2 C;  3L9F A;  4OIR F;  4KFC A;  2W57 A;  1CF7 B;  3JSO A;  3KP4 A;  1XB4 A;  2M87 A;  1MJA A;  1R36 A;  2A68 F;  4ESB A;  2DTR A;  3FHZ A;  1XD7 A;  4KT5 C;  4GGG A;  5H20 A;  4EV0 A;  4U88 A;  3EET A;  3WGH A;  3WTZ A;  1IN6 A;  4L18 B;  5BOX A;  5E17 F;  3GZ5 A;  3CLO A;  3DPL C;  4HQM A;  1H9G A;  3HYI A;  1QPM A;  1RZ4 A;  5FD6 A;  5K1Y A;  5L3F A;  1DP7 P;  3T1B A;  3MQ0 A;  4G8X A;  3WGI A;  3WTU C;  4UUV A;  2E1N A;  2JRT A;  1PP8 F;  3ZMS A;  4XLN F;  2PI0 A;  5ICE A;  4ON0 A;  1ZGA A;  2HEO A;  2L4M A;  4Q4Z F;  4A0Z A;  3SZP A;  2W25 A;  1UB9 A;  2IP2 A;  1ZHF A;  2CO5 A;  4OU0 A;  3LST A;  4BNC A;  4RAZ A;  2EFP A;  5HS9 A;  4BXU A;  1XMK A;  5AON A;  4BYY A;  1ULY A;  3F72 A;  1Z7U A;  4A0X A;  1U78 A;  1R1T A;  1C0W A;  4A5N A;  4LB6 B;  1FWZ A;  1E17 A;  1FC3 A;  1D8K A;  3FF5 A;  4LB5 A;  1B1B A;  3J7A O;  1R1U A;  4M72 A;  3FX3 A;  2PMU A;  1KU9 A;  5K5Q A;  4H0E A;  3ULQ B;  3F8B A;  3IWF A;  5CVU A;  1DUX C;  3ABT A;  2BEO A;  2DBB A;  4XSZ F;  4U7D A;  2FE3 A;  2Y75 A;  1ZRF A;  3H3U A;  4KDP A;  5LHH A;  2HTJ A;  4S04 A;  4E70 A;  3NRV A;  4JQF A;  2CFX A;  2WTE A;  2ZKZ A;  1YG2 A;  3C1D A;  4Y15 A;  2ADU A;  2UWM A;  5A2Q K;  3DEU A;  3LQQ A;  4XLP F;  3V8L A;  2LKP A;  2F5E A;  3I64 A;  1U6G A;  4NB5 A;  4HX4 A;  3FMR A;  5E8G A;  1IRF A;  4CDG A;  2XKP A;  4BHC A;  3LA3 A;  3W6K B;  1J59 A;  5DDG A;  1FP1 D;  1FT9 A;  3BJO A;  4M73 A;  1TW2 A;  3KLO A;  1IN7 A;  1LDJ A;  4AIK A;  3LA2 A;  2RC4 A;  2GIV A;  1OYI A;  2ZJ2 A;  4CXF A;  2QZ8 A;  2W84 A;  4AD9 A;  1XN7 A;  1KGS A;  3GUD A;  4PZJ A;  4BHP A;  1S6L A;  3H92 A;  1Z6T A;  1B59 A;  2V79 A;  1RUO A;  1TBX A;  5F1R A;  2GXB A;  5TJJ A;  1IN5 A;  1T38 A;  4OIP F;  2GAU A;  3CDH A;  1HKQ A;  5AIP A;  3M8E A;  4A5M A;  3EUH A;  3VOD A;  1Z05 A;  4G7Z F;  1O3R A;  1J75 A;  4KUM A;  1P4X A;  1TLH B;  2IA1 A;  2K27 A;  3KET A;  2X4H A;  1KQ8 A;  5HLG A;  3K9T A;  3P7N A;  3KP5 A;  1OYW A;  4P55 A;  5E1W A;  3EYI A;  3HIF A;  2RQP A;  3TOA A;  3RYP A;  3IHU A;  4ENN A;  4HAM A;  1EH8 A; 
#chains in the Genus database with same CATH topology
 2CU7 A;  2L7Z A;  3TO9 A;  3RI4 A;  2H1K A;  3H9J A;  4E7Z A;  2XPW A;  3R61 A;  5DYM A;  2HVS A;  1WCM J;  5IP7 J;  2M7B A;  2L9N A;  5IYD J;  2HZT A;  4HV5 A;  3JRE A;  2AXL A;  2DA4 A;  2JSC A;  1Q1V A;  3GFI A;  3ZQI A;  1P6R A;  5H2F C;  1BM9 A;  4HLY A;  5BMZ A;  4BL0 B;  3F6O A;  4B4C A;  3I53 A;  4PGG A;  3OS0 A;  3HEF A;  3O8H A;  3R0A A;  3K4N A;  1GDT A;  2LVS A;  3A01 A;  3ERE D;  2WV0 A;  3CQZ J;  2Y0S A;  2EFN A;  2RRE A;  5HVQ C;  4MO7 A;  3CDL A;  2LRE A;  3E6B A;  3N97 A;  2VPL A;  2M4K A;  1Y39 A;  5HNH A;  3B6C A;  4IRI A;  1WHU A;  2E5N A;  2R0Q C;  5F64 A;  2C6Y A;  4AU7 A;  1JGS A;  4UVC A;  3BTI A;  1RNL A;  4GCV A;  3ELK A;  3BR2 A;  4ZYE A;  3CCU I;  2H6C A;  3L2V A;  2LF8 A;  2E2H J;  1T95 A;  4BJ5 C;  3GFM A;  2W48 A;  1IC8 A;  3NEU A;  1VZ0 A;  5HDG A;  3BJA A;  1IF1 A;  2LKS A;  5E79 C;  3W2A A;  4EVI A;  5GAG J;  4C2U A;  2MBF A;  3ZN1 A;  3ABU A;  4BQQ A;  1FBS A;  4A3G J;  3E5Q A;  2HQN A;  1XCB A;  2EQR A;  3L09 A;  3IH2 A;  5IT9 Z;  5FFX A;  3K4C A;  5FKM A;  5GAD J;  3F22 A;  2E19 A;  4M6X A;  3G6E I;  2K40 A;  1HW5 A;  4QPQ A;  1PUE E;  2ESN A;  2PMZ N;  2VPR A;  3IAM 2;  1WGX A;  5J8F A;  2DAO A;  2M8G X;  3R6S A;  1K4S A;  5GAE J;  2IEK A;  3BRO A;  1W5S A;  1D1C A;  4M74 A;  5ERI A;  2L01 A;  1K6O A;  4IX7 A;  2CW0 F;  5LFA A;  3SJM A;  1POG A;  4BGD A;  3PUB A;  5IYB J;  4UVB A;  3EUK L;  5GPC A;  1YIJ I;  1SEU A;  2BHY A;  1G3W A;  1XGN A;  5LRR A;  1N78 A;  2OCE A;  3BG9 A;  3FMS A;  2WWY A;  3FXK A;  4I7H A;  4HF1 A;  4Y3O A;  3MKL A;  4HG2 A;  1ZRD A;  1NH3 A;  2DA3 A;  3V8K A;  1ACI A;  4E7S A;  2JZY A;  3LAP A;  1HXD A;  1LFP A;  1YX5 A;  2XF7 A;  2V9K A;  2BYV E;  1WJF A;  2VT3 A;  5BPI A;  5J47 A;  3EUH C;  5J6X A;  3OSG A;  2F6C A;  2NOJ B;  2EBI A;  3R60 A;  2VKV A;  1YIT I;  2E1C A;  2HYJ A;  3RZO J;  3CES A;  3ECO A;  2WA0 A;  3BZC A;  2IXS A;  3K0L A;  1ETY A;  1AU7 A;  1A6Q A;  3RCO A;  4X1E A;  3FM5 A;  4J19 A;  2PG4 A;  3ABK H;  3AFH A;  4GYG A;  4ZYD A;  4FCY A;  3TW7 A;  1RPW A;  3PNT A;  4D7M A;  4CHU A;  2NVT J;  1EA3 A;  2RVC A;  2Y9Y A;  1OQY A;  2F4O B;  3G1L A;  2OTJ I;  2Z16 A;  1YI2 I;  2L9R A;  2BY2 A;  1Z0X A;  1ETV A;  3FBN B;  3MVP A;  4O5V A;  2E2I J;  1FSE A;  4XOR A;  2PEX A;  4HDV A;  1VFC A;  1IGN A;  4IKF A;  1FOK A;  3F8C A;  3CMM A;  3CCY A;  4C3J J;  2QEN A;  1F4K A;  1IAW A;  1I3A A;  4I2O A;  1S7O A;  1HQC A;  2N8G A;  4O6J A;  1AWC A;  2DOE A;  4NHJ A;  1QO0 D;  2K9Q A;  1IXR C;  1CGP A;  2K85 A;  4IZZ A;  2XIG A;  1WPK A;  2GA2 A;  2NVQ J;  3L7W A;  2JA2 A;  5F0C A;  3J81 Z;  1TT0 A;  3PJR A;  2EZI A;  3WE3 A;  4CCM A;  1E3O C;  3E3V A;  3RZD J;  3PIO F;  4KIF A;  3M9A A;  2YS9 A;  2QLZ A;  2P0W A;  2YUS A;  1EH7 A;  1YOV B;  2VN2 A;  5BPD A;  1T33 A;  4I6Z A;  3CD6 I;  3HG9 A;  4G7H F;  3M7G A;  3QRF F;  1QHG A;  3HSF A;  1UST A;  4NBQ A;  5KK1 A;  4M71 A;  3PSI A;  5FRO A;  4KIG A;  4ABZ A;  1LFU P;  3TKY A;  3HOW J;  4DNC A;  3OIP A;  1R22 A;  4DW6 A;  1XS9 A;  4KMU X;  5FB2 A;  2CW7 A;  4I01 A;  2QA4 I;  3PNY A;  4Z2Y A;  4ZZD A;  3Q0W A;  2XPV A;  1R58 A;  1MDM A;  3WTS C;  3VWB A;  3A01 B;  2DCE A;  3VYU B;  5EZG A;  2PMZ A;  2CV1 A;  3K1P A;  3ESW B;  3JRD A;  2G9W A;  2UUZ A;  2X51 A;  1QVU A;  3IP4 B;  2W00 A;  1BI2 A;  2BHZ A;  3BR5 A;  1MH4 A;  1XGO A;  4RBO A;  3CTA A;  2BW3 A;  4LIT A;  3BR0 A;  5HOD A;  2P5V A;  4EM0 B;  1IUY A;  4KIB A;  2MD5 A;  5D6F A;  2KT0 A;  3CF2 A;  1WH7 A;  1WSU A;  2EFO A;  2IA2 A;  2Z99 A;  2E1O A;  4A3E J;  5IP6 A;  5L3C A;  3P9K A;  5K5O A;  2BV6 A;  3KIO A;  3MAJ A;  3VEP A;  4OIQ F;  3E1S A;  1WJ5 A;  3C3W A;  4CYC B;  3F8F A;  4KN4 X;  3ZN0 A;  4XRM A;  1H0M A;  3VPR A;  5B1A H;  5DM7 F;  4IF4 A;  2O3F A;  4XNF A;  1PJR A;  1QZE A;  1TW3 A;  3X2Q H;  2EV5 A;  3GTP J;  3DV8 A;  1T08 B;  4RGX A;  3Q5F A;  1R4M B;  2LD5 A;  5M5W J;  5J1R A;  2VC1 A;  3HUG A;  1VQ8 I;  4O3M A;  1IV6 A;  2GOX B;  4YFN F;  5JLW A;  4P9F A;  1MND A;  3HGY A;  1SFE A;  2EV6 A;  4MIM A;  4LMY A;  5EJC A;  1YTY A;  2Y31 A;  3OYK A;  1ZTR A;  2W4S A;  1MJB A;  1HSJ A;  2LH9 A;  3F23 A;  2LG4 A;  2HDC A;  4BAC A;  4E6K G;  3J80 Z;  3DU5 A;  3QP5 A;  3VSK A;  1TQI A;  1BJA A;  1SAX A;  1ZRC A;  2DN0 A;  3JW4 A;  3CO6 C;  2IA0 A;  4U7B A;  3KZZ A;  1MBH A;  3BJ6 A;  3WOD F;  2R7V A;  2DJI A;  2CYY A;  3G1O A;  3MD2 A;  5EGO A;  3CDI A;  1LDD A;  1RES A;  3SFI A;  2FQ3 A;  4XQF A;  2HOS A;  2JSP A;  4Y33 A;  3NAU A;  2DU9 A;  2HI3 A;  2CH0 A;  4UVA A;  1T6S A;  3LFK A;  3CUQ C;  5DM6 F;  1ODD A;  1YS6 A;  4XBF A;  2NOG A;  3FIW A;  2FOK A;  2GWR A;  4D5F A;  2GIZ A;  3LSJ A;  1VQP I;  1J0R A;  3RQ4 A;  5FLV A;  4Y13 A;  4L0Y B;  4MGR A;  2PBI A;  3U1D A;  3QOE A;  2CG4 A;  4IHX A;  2FX0 A;  3FXU A;  1SC7 A;  1V4R A;  2BY1 A;  5GTH C;  2FOW A;  4A3F J;  3E5X A;  4JX6 A;  1GUU A;  3WGG A;  1ZLJ A;  3LSH A;  5K7Z A;  3U1K A;  4YG2 F;  4BDZ A;  5LLQ A;  2ESH A;  2EZK A;  2Q8K A;  2WBM A;  4NC7 A;  2YX7 A;  4B48 A;  3J7Z I;  4B8X A;  2V1U A;  4YFK F;  3WTX C;  2LF7 A;  2ISY A;  1R49 A;  1S9H A;  2QBY A;  5IT9 K;  3GCM A;  1FLI A;  1ON1 A;  5D5X B;  2DXI A;  3LSP A;  1HDD C;  2VJI A;  5ED4 A;  3COA C;  4C30 A;  2IPQ X;  2M1B A;  1BN5 A;  3ZCO A;  1OCC H;  1UFM A;  6PAX A;  3VYS B;  3GWZ A;  3PFY A;  1EKE A;  1GVJ A;  2STW A;  2GLO A;  5TRD A;  3QYB A;  4A3D J;  2K9M A;  2QSH X;  1O3S A;  4U0W A;  4GFB A;  1FPQ A;  2R5Y A;  3MWM A;  1XGM A;  4AIJ A;  3V42 A;  1WZ2 A;  4EJU A;  2R7Q A;  2V26 A;  3FWE A;  4NC6 A;  1GHC A;  2PMH A;  3S93 A;  3HB9 A;  1SD6 A;  3ZMV A;  2YX4 A;  2HPI A;  1EH6 A;  2M5W A;  1IXS B;  1WVR A;  3V4G A;  3HKZ N;  4AYB N;  2L02 A;  2HNH A;  2TCT A;  4R8H A;  3EPZ A;  1VI0 A;  2HS5 A;  3C7J A;  2KIM A;  2DFE A;  1IW7 F;  3H0G J;  4YII A;  4A0Y A;  4HF0 A;  4BE0 A;  1JKO C;  3S1Q J;  4LLN A;  2O0Y A;  4LJZ F;  2MAB A;  2KFD A;  4V2G A;  3OOP A;  1MDM B;  2LTP A;  3ZQG A;  5L3G A;  1JT0 A;  5D8L B;  5DCF A;  1H89 C;  4PCQ A;  3T0Y A;  4R79 A;  4ZTJ A;  3BDD A;  3BG5 A;  4U87 A;  3H9G A;  1IG7 A;  3DWL E;  1G3Y A;  1W7P A;  2R5Z A;  5HS7 A;  4BEH A;  3W6V A;  4HX7 A;  3TBI A;  2KRF A;  3LQR A;  2MYS A;  3G71 I;  4IXA A;  2BW3 B;  1HKT A;  3E0J B;  4LGW A;  4II3 A;  2YPR A;  3L2U A;  3REO A;  3I54 A;  3G1M A;  4Y7N J;  5FJ8 J;  4M6V A;  3S16 J;  1VQO I;  1BIB A;  4DOZ A;  2BBY A;  1X4O A;  4W1U A;  1BOB A;  3PNV A;  2VOP A;  5IOZ A;  1UAA A;  2R7W A;  4A12 A;  3AAF A;  3I4N J;  2B63 J;  3MKY B;  4G6Q A;  4PJM A;  3OYC A;  1YW8 A;  3GEZ A;  4UNO A;  4M3F A;  1F43 A;  1OIS A;  3DKX A;  2R7O A;  3CCL I;  3HZJ A;  1FMV A;  1J2X A;  5EEG A;  3TO7 A;  2CUE A;  3TDU C;  3ZQH A;  2VIX A;  3J81 K;  2V9P A;  1MBJ A;  5BNG A;  3HUG B;  1JKP C;  1OMI A;  2DA1 A;  2VBY A;  1X4P A;  2UV1 A;  4RLF A;  4OIO F;  2KP6 A;  2XAS A;  2PQ8 A;  2Y69 H;  2MH2 A;  3GO5 A;  3LSM A;  2HR3 A;  1STZ A;  2R3S A;  2P4W A;  1FEX A;  1L0O C;  1BIA A;  1I3Q J;  1TWH J;  4EJO A;  1ZG1 A;  3CC2 I;  4ZYG A;  3BR1 A;  2PN6 A;  3BZK A;  2X1C A;  3I4P A;  4XRS G;  1K7A A;  2P7V B;  2FNA A;  1B9M A;  5LGT A;  4OWR B;  5EEA A;  3VYT B;  2NRA C;  2OU2 A;  3F21 A;  4CCL A;  2CRG A;  3OYE A;  4ASN A;  1JI8 A;  1WJA A;  3KLN A;  1MSE C;  4YFX F;  3KYL A;  3VB2 A;  1UHW A;  4CA0 A;  1GT0 C;  1K79 A;  2KIF A;  3KPH A;  1ZAO A;  4ETS A;  3L1P A;  4L9V A;  1E2X A;  5CQE A;  3KP3 A;  1DP3 A;  1CQT A;  1RR8 C;  1FOW A;  2E7X A;  2DPU A;  4BQO A;  1U8R A;  3GX4 X;  3QPH A;  2R7R A;  4EGY A;  3UKG A;  3FM3 A;  1BC7 C;  2YU9 J;  1XMA A;  1ZRE A;  3FXQ A;  4Q47 A;  2L54 A;  1YW9 A;  1V5F A;  1IDY A;  3IAS 2;  2XRL A;  4RAG A;  2DA6 A;  3QU3 A;  3IKV A;  4FX0 A;  4GO1 A;  4F93 B;  2LC2 A;  1XSD A;  3F8N A;  1K6Y A;  5D6E A;  2Z3Y A;  3U21 A;  2OD5 A;  1Z3Y A;  1BI1 A;  1R7J A;  1QVT A;  1I27 A;  3H5N A;  4AYB A;  2QQB A;  1Z91 A;  4QWQ A;  4A2U A;  2IRF G;  1H8A C;  5HDN A;  3CUO A;  3OYB A;  4M3D A;  2ZO4 A;  3MZY A;  2QBY B;  3DEE A;  3V7C A;  1SFX A;  3HOV J;  2FML A;  3ASN H;  5DUK A;  3IRQ A;  3OMY A;  2OTL I;  2FEZ A;  4ZC3 A;  1LEA A;  1D1A A;  1OYY A;  3KCC A;  5E1X A;  4CCJ A;  4UUS A;  2DJN A;  4FE7 A;  3BLY A;  4I09 A;  3WHC A;  1WJB A;  3QPL A;  3IRR A;  4A3K J;  2R7F A;  4HNU A;  2M30 A;  3WTW C;  3ZMU A;  2LSO A;  1DGW Y;  2L0K A;  5H6Q A;  2E2J J;  2UXN A;  2ZME A;  1QHH D;  4DZJ A;  2VC0 A;  4XM3 A;  1LQ1 A;  4WF2 A;  1G6N A;  2X1D A;  2HDW A;  2A07 F;  5CJ9 A;  3NAR A;  1WJE A;  4YEJ A;  2R5Y B;  4D9J A;  2M8E A;  1FMW A;  3HHH A;  1WRJ A;  4XLE A;  2ICW G;  4WXD A;  5FD5 A;  2DK5 A;  2P6T A;  2AQE A;  3HXL A;  3CC7 I;  1R00 A;  3E5U A;  1SFK A;  3H5R A;  3GLL A;  4OAY A;  3ZQC A;  2HOE A;  1SVO A;  3E7L A;  2W1O A;  2WAQ A;  2VQC A;  4XSX F;  4W97 A;  2GA1 A;  3S14 J;  1KYW A;  1T0F A;  4UY8 I;  3ZMZ A;  1Y0N A;  2QKM B;  2E36 A;  5LBQ A;  2XB0 X;  1AOY A;  2ELK A;  1USS A;  1SD4 A;  3A0B C;  5K5R A;  3OYA A;  4EQQ A;  2RAE A;  2NXN B;  1ZQ3 P;  4PJN A;  2WC2 A;  4CO8 A;  3RYR A;  2JJ7 A;  5CKT A;  2XAU A;  3HOU J;  2ZXJ A;  4XLC A;  3UR3 C;  2UZK A;  4HNV A;  2Y2Z A;  4MHG A;  3JAM Z;  2VXD A;  3FIS A;  4WCG A;  2Q1Z B;  2ZXW H;  5F0H A;  1W7P B;  2EFW A;  2R5Z B;  2QSF X;  4BEH B;  1ZR4 A;  2K9L A;  3DTK A;  3BPV A;  3QOD A;  1FTT A;  4CSW A;  5HLH A;  4I0B A;  2IS6 A;  1A5J A;  4P5O A;  2FBI A;  2R93 J;  3ML6 A;  3MZ8 A;  1QGP A;  3FKJ A;  2NS0 A;  1ZAR A;  5K7H A;  2V1X A;  2E1M B;  2P8T A;  4B3X A;  2PJP A;  2GXA A;  2A05 A;  4EJW A;  1YFH A;  2KKO A;  2O9L A;  5IY5 H;  5M5X J;  1D0Z A;  2HGC A;  3DBH B;  2X6W A;  2EZL A;  3HTU A;  4YRV A;  2PFB A;  2OZU A;  2PLY A;  1JTX A;  1W5T A;  4FX4 A;  1K4T A;  3BG7 A;  1ETW A;  4G9Y A;  1MD0 A;  2ELH A;  5K7F A;  2XGC A;  1F1Z A;  4NNJ A;  5HNF A;  5L3E A;  3BTL A;  2CJJ A;  2BOL A;  2DDB A;  3TDZ C;  1BR4 A;  1ON2 A;  4IVN A;  5E1Z B;  1ZH5 A;  3W2W A;  1P7J A;  2E34 A;  4UXN A;  5DCM A;  5F27 A;  2CUZ A;  1QU3 A;  4CGZ A;  1P2F A;  2JT1 A;  2OV7 A;  4AID A;  4A3M J;  1V5E A;  5J40 A;  1SMY F;  1V3F A;  1LVK A;  3S2H J;  3EUA A;  3SYT A;  4PJJ A;  4ZYA A;  2WV1 A;  1XDU A;  1EV7 A;  3H1C A;  1LE8 A;  3O3K A;  1F5T A;  1MGT A;  2ZNZ A;  3AL0 C;  1X1P A;  2VE8 A;  1SFO J;  3MMY B;  5FKO A;  3ZXS A;  2A69 F;  2JPC A;  3AL0 B;  1EJ9 A;  1IN4 A;  5CQG A;  2QQA A;  3QQA A;  3DKY A;  1B72 B;  2XGE A;  2CQN A;  3FXL A;  5LGN A;  1DPR A;  4FE4 A;  5EEH A;  1BI0 A;  2A6E F;  3P9I A;  4BJ6 C;  4CYC A;  4LOC A;  2HXI A;  2EB7 A;  1B8I A;  2R7U A;  1TQM A;  5EDN A;  3F6V A;  4BXF A;  2JUG A;  2KIS A;  3G2B A;  5JVT A;  4BXX J;  4BBR J;  4D5C A;  2P7C B;  4IOC F;  2E5Z A;  2XPU A;  1U5T A;  1WKM A;  2Q0O A;  2VQL A;  4XK4 A;  5JVG F;  2M4G A;  4XLA A;  4G12 A;  1QA6 A;  1S3J A;  5TGT A;  3JRA A;  2CW8 A;  5FGM A;  1GXP A;  3HRS A;  3ERM A;  4UUS B;  2OZ6 A;  4M3G A;  4OIN F;  5EG0 A;  2CWE A;  2DOF A;  2W7N A;  2TDX A;  5D4R A;  3P9C A;  2D45 A;  2Z2S B;  2VON A;  4KN7 X;  4CIC A;  1UHM A;  2DQL A;  3AG3 H;  3KP7 A;  5ICG A;  1YQA A;  3T5X A;  1S7A A;  4GYI A;  3K70 C;  3DTE A;  2ZME B;  3DXJ F;  2B0L A;  2OBP A;  2DT5 A;  4OIP F;  3K4J A;  2JVH A;  1MJ9 A;  4R1H A;  4QSH A;  2G7H A;  1WFX A;  2X6X A;  2P6S A;  3RKQ A;  3PQJ A;  2WY7 Q;  4F91 B;  2V1D A;  3BCB A;  3ZR8 X;  2F5D A;  1R5G A;  1N75 A;  1T0F C;  3BOQ A;  4LLG F;  4PGH A;  5CVR A;  4PJ0 C;  4AM3 A;  1V54 H;  3K6G A;  3I5U A;  4U0V A;  4WX9 A;  2VT2 A;  1S7E A;  4IO9 F;  3R4K A;  2ZFW A;  2FUG 2;  4M9X A;  1JGG A;  2VE9 A;  2L9S A;  3VFZ A;  1U0J A;  3GTQ J;  4HRI A;  4RM2 A;  1E0E A;  3PSF A;  2E7W A;  4OAZ A;  5H6R A;  2ZCW A;  4GRI A;  3A2K A;  4ENM A;  2MH9 A;  2EIK H;  2QGU A;  3WHB A;  2I5U A;  3CCR I;  1X3Z B;  2A6H F;  1KU7 A;  1J9I A;  3CZ6 A;  3JRH A;  2FF4 A;  3SHF A;  1W7P D;  5LEJ A;  2DQR A;  2M3A A;  4LD5 A;  2VB6 A;  3GYH X;  1FOX A;  2MC4 A;  2VBW A;  1ZG5 A;  1YRN A;  1XDS A;  3OL4 A;  1KU2 A;  1G4D A;  1XCV A;  2PJR A;  2QEX I;  1DPU A;  1W5C C;  2DFF A;  1TWF J;  4M3B A;  1AKH A;  2W85 A;  2XRN A;  2YR2 A;  1MNE A;  4F92 B;  3BC8 A;  3Q9V A;  2ETH A;  2COB A;  2LY2 A;  3SZT A;  3DF8 A;  4HBL A;  1QZZ A;  2FRH A;  2L7K A;  2D2W A;  4QTR A;  2QM3 A;  1RRJ A;  2LP0 A;  1ZN2 A;  2XAF A;  3GXO A;  3S3N A;  3QYE A;  4Y17 A;  3MKW B;  2XGX A;  1JKR C;  2RKH A;  3TMO A;  2CQK A;  2RDP A;  3LFU A;  5DCM B;  3AG1 H;  2HKX A;  5LHG A;  1TWG J;  1PP7 U;  3OS1 A;  3JRG A;  4HX8 A;  1JJ8 C;  1FP2 A;  3GTM J;  1PVE A;  2HWV A;  3WU1 B;  4LK0 F;  1R5H A;  4A3C J;  1X3U A;  2F4M B;  3CP2 A;  5FLM J;  1TTY A;  4OOI A;  1LE8 B;  3SFZ A;  4Q5S F;  2VBX A;  3OR2 C;  3JAM K;  5LHI A;  5D5U B;  1IV8 A;  3IL2 A;  1A04 A;  1ZGW A;  4BHB A;  5DD8 A;  2B7E A;  2F5C A;  3M8F A;  3JSP A;  1JKQ C;  4KYW A;  3FK7 A;  2GQQ A;  3DBL B;  2Z5U A;  4B09 A;  1JUM A;  2IVM A;  3PL8 A;  4MFE A;  3OYH A;  4AC0 A;  4LLL A;  1B8I B;  3MCZ A;  1E3H A;  2TRT A;  3Q0V A;  1B6A A;  3GF2 A;  3OYL A;  3GZN B;  3HL2 A;  1NG7 A;  3DBR B;  5J4Y A;  4I02 A;  2AO9 A;  1MIJ A;  1R71 A;  1K61 A;  1K78 B;  2DOA A;  3SXY A;  1ERD A;  2K02 A;  4DYR A;  1U5T B;  3CCM I;  2VKH A;  1I6X A;  2DLL A;  3IC7 A;  4M6Y A;  4XN0 A;  1KQ0 A;  2NYX A;  4XOP A;  1TNS A;  1HW1 A;  1TQP A;  2CFO A;  3LSR A;  2CGP A;  4EM2 A;  1S29 A;  1NHA A;  3OR1 C;  4Y4R A;  3LMM A;  4KIT B;  1DU0 A;  2HVR A;  4RLQ A;  1MNM C;  2HFH A;  5EG0 B;  3C18 A;  1N25 A;  2CUF A;  2Y0M A;  1H88 C;  3KZY A;  4QIW N;  3ZP5 A;  1BR2 A;  3RPU D;  1OR7 A;  3H5A A;  3CJR B;  3PO3 J;  3HOY J;  2AS5 F;  3OIO A;  1RIO H;  1QQI A;  4CUG A;  4ESF A;  3K4K A;  5C44 J;  1BR1 A;  2OJE D;  1WH5 A;  3VYR B;  1O3Q A;  3K69 A;  3S2D J;  4LFU A;  3ASO H;  2QKL B;  3GW2 A;  1TC3 C;  5ILV A;  1VQK I;  4MTE A;  2KHM A;  2HU9 A;  4U0Y A;  3JTG A;  2H94 A;  4FET A;  2DPD A;  1BJZ A;  4BUP A;  5KNL A;  1D8J A;  1JXS A;  1IJW C;  3F0C A;  1RET A;  4M9S A;  4BBS J;  3OWT A;  1J5Y A;  4RAF A;  2DFH A;  3CMY A;  2FXA A;  1LNW A;  4YIR X;  1PDN C;  3BG6 A;  2DOD A;  3RKY A;  1YX3 A;  1QNT A;  3JCU C;  2EJR A;  2VOD A;  5E3M A;  3CCV I;  1MMS A;  3OYD A;  2EFQ A;  2ZNY A;  4X6A J;  2EIN H;  2P5L C;  3G3Z A;  3HHG A;  4XRF A;  2FSW A;  1OJL A;  3BZ6 A;  1F9N A;  2LBF A;  3ROU A;  2VAS A;  3QP6 A;  4ITV A;  3I3L A;  4KNY A;  1Q1H A;  3N4M A;  3A0H C;  2RNJ A;  1AHD P;  1MBG A;  3OIQ A;  1VQ6 I;  5AIQ A;  4I98 B;  2MD0 A;  1BW5 A;  1B4A A;  2HTS A;  1ZYR F;  3DLL F;  4L9N A;  4KIS A;  2CSO A;  2HOT A;  3HRU A;  2KZV A;  3CJT B;  3RKX A;  1Z77 A;  4FHT A;  5JLX A;  4NDL A;  1XGS A;  3IKT A;  2IS1 A;  2GXG A;  1L3L A;  1B9N A;  2ZJR F;  3L2W A;  3NWS A;  4GXO A;  1SD5 A;  2KZG A;  3S15 J;  3RKW A;  5D5V B;  1YRN B;  3M1E A;  3S8P A;  2PJR B;  2IGM A;  2H8R A;  2AQF A;  1WI9 A;  1YYV A;  4MTD A;  1HA8 A;  2FMY A;  3BWG A;  1AKH B;  2E60 A;  2EH3 A;  2M7A A;  3FKI J;  4MNU A;  3WE2 A;  3GTO J;  1OCT C;  1O7F A;  3PQK A;  4ZDO A;  4EJV A;  1RKW A;  4EJT A;  3I0T A;  3K2A A;  3VOE A;  1ZKG A;  4IQ4 A;  5CYV A;  4RMN A;  5KCM A;  5B5E C;  4XKC A;  3TOB A;  3DPT A;  1VQ7 I;  4JP0 A;  4N4O B;  4E7J A;  2XAQ A;  1H9T A;  2LNB A;  3FXM A;  3TP0 A;  3NQO A;  4CZZ A;  4EM1 A;  3R0J A;  4S0H B;  3S32 A;  2EV0 A;  2A5Y B;  1IXC A;  1OCP A;  4PFO A;  2H27 A;  4ZDP A;  4NC8 A;  4L9T A;  1GXQ A;  1Z7L A;  5LEK A;  4KIC A;  3GME A;  1SVL A;  2XVC A;  1XTA A;  3RJP A;  1S5L C;  1BI3 A;  3KEY A;  2DT6 A;  1JT6 A;  2QYO A;  3U9G A;  4RS8 A;  2IAI A;  3A03 A;  2ISZ A;  1TWA J;  3MFK A;  3BTC A;  3GZ6 A;  4HYE A;  4A6D A;  2LYC A;  1D5V A;  2QWW A;  4I0A A;  5DD4 A;  4H4K C;  2WB1 N;  2QF7 A;  5CPR B;  1XX5 A;  1JJ6 C;  1VQ4 I;  2IS4 A;  2UXX A;  4HNT A;  2QVO A;  3ZOB A;  3CO7 C;  2EA4 A;  4RB3 C;  1GV2 A;  3U2R A;  5KHD A;  2XRO A;  2MLK A;  4S05 A;  3V7S A;  3GFL A;  5E18 F;  1FBQ A;  2M9H A;  1OCO H;  4UHT A;  3HGG A;  2L9V A;  3FXJ A;  3ABL H;  1IN8 A;  2V9V A;  5FKK A;  3SDB A;  4LG0 A;  3ZMT A;  1XPX A;  1OKR A;  1JTY A;  1ORK A;  1MBE A;  3P5J A;  4TV7 A;  1VQ9 I;  4XOT A;  1JE8 A;  4KT6 A;  1KA8 A;  4N4N B;  2WY8 Q;  4C9Y A;  1P7I A;  2HKO A;  4XON A;  3PUF A;  1OR7 C;  2MA3 A;  4L5I A;  2H6B A;  1T98 A;  3BQY A;  2F48 A;  4UB6 C;  3V7R A;  1V55 H;  5KVR A;  2K3F A;  4IRH A;  2G7U A;  4K2E A;  1ZLK A;  3WTY C;  2P5K A;  5ILU A;  1SD7 A;  3L2C A;  2HQR A;  2O7O A;  2J5O A;  2FBH A;  3DKW A;  4XLH A;  3IH3 A;  1X19 A;  2MGQ A;  3OY9 A;  3HDD A;  1AA7 A;  2JPB A;  2R7D A;  5E20 A;  3RQI A;  1VF9 A;  4ESJ A;  4DZP A;  3TW6 A;  1J09 A;  3BPX A;  1XC5 A;  1LUJ B;  2ZXH A;  4MQ9 F;  4N9I A;  3WU0 A;  4WK8 F;  3CCS I;  2NS8 A;  3H36 A;  4QLC U;  3DCF A;  2ME6 A;  3S1M J;  2FBK A;  5LD2 C;  4B47 A;  2L3D A;  4P96 A;  1W0U A;  4KA4 A;  2KLO A;  4G6D A;  1A31 A;  4N0B A;  4L0Z B;  1B72 A;  1HCR A;  1A35 A;  2XAH A;  4LIV A;  1MZB A;  2D1V A;  4XLF A;  3TP3 A;  1HLV A;  1XSX A;  3C2G A;  2JQ7 A;  4JK1 X;  3B6A A;  3B73 A;  5HLT A;  4ZH4 F;  4HOB A;  4I76 A;  2BY3 A;  2Q2E A;  1G3T A;  2K5C A;  4IHT A;  4M3E A;  3F9K A;  2LBF B;  3M3Y J;  4D1Q A;  3E6C C;  2V6C A;  1KQ9 A;  2F2E A;  3KFW X;  5CLS A;  3LWF A;  3HKZ A;  3RPQ A;  1FNN A;  2HPM A;  1FYM A;  4YIF A;  2O6G E;  4BKX A;  3LNQ A;  2DI3 A;  3T8R A;  3RPU A;  1ETO A;  3HTS B;  4EGZ A;  2V7F A;  1LVA A;  3HBL A;  1T56 A;  5LRS A;  2VQG A;  2MFZ A;  2GZW A;  1Y8Q B;  2DO7 A;  2DW4 A;  2OA4 A;  3E6M A;  3KP6 A;  5F6F A;  3HSR A;  5GPA A;  5HOO A;  2VLA A;  5DS9 A;  4HSR A;  4RGU A;  1UG2 A;  1I39 A;  2FU4 A;  5IT3 A;  1MMD A;  2EK5 A;  2HZD A;  1YJN I;  1O3T A;  5HS8 A;  4IHV A;  3ZQQ A;  3L2R A;  2JMW A;  4A3J J;  4OMY A;  1T39 A;  3J80 K;  2NAZ A;  1D1B A;  1IRG A;  3LA7 A;  3OYF A;  3FXR A;  1WJD A;  1I1G A;  1NG6 A;  3IWZ A;  3AG4 H;  3D5S C;  4RGR A;  2AHQ A;  2NNN A;  4HA8 A;  2YU3 A;  4RGS A;  2KDO A;  4RDU A;  2OQG A;  2R92 J;  3MKZ A;  5GTI C;  3LAJ A;  2DTZ A;  2W24 A;  4BAY A;  2X6Y A;  4RB1 A;  5BS6 A;  5DEQ A;  4HEA 2;  2ZJP F;  2IJL A;  2JTV A;  3RSN A;  3GFJ A;  1LKX A;  1YHQ I;  3BQZ A;  2DT7 B;  2LY9 A;  3F3X A;  1R5I D;  3L2Q A;  1X2N A;  2LOO A;  1BL0 A;  5FLX Z;  3GVA A;  2ZJQ F;  3M1C A;  1P4A A;  4DBQ A;  1D3Y A;  3KEO A;  3BR6 A;  2M34 A;  3DLA A;  2R7X A;  4BU2 A;  2O03 A;  2DA5 A;  5BQT A;  2NVU B;  5IPA A;  1BOA A;  3D0S A;  4UB8 C;  2ELJ A;  2K86 A;  4WXH A;  3HOS A;  5L3B A;  1T8I A;  1TT5 B;  4MLO A;  2E1M C;  4YEL A;  4L9J A;  2BVM A;  2KIQ A;  4XL9 A;  4J00 A;  5ICC A;  3ZRG A;  4WWC A;  4C2M J;  3HSE A;  4A6E A;  5KAF C;  2M45 A;  5FKL A;  3J7A Y;  1HKS A;  3FDY A;  4IQJ A;  2VJJ A;  2ZBK A;  1D0Y A;  1P92 A;  2KIU A;  2K4B A;  3Q0U A;  3K1N A;  3CME I;  2L4A A;  2ZXI A;  3BG3 A;  1JHF A;  4QPO A;  1D5Y A;  4IHY A;  2COM A;  2J5P A;  5D5W B;  4BE2 A;  2KJC A;  3QPT A;  1LPQ A;  1MMN A;  1U9O A;  4LG0 B;  2A5W A;  3WG7 H;  3IUO A;  4WXC A;  5C3E J;  1HBX G;  3PIP F;  3JTH A;  3H35 A;  2ID6 A;  3BR3 A;  3HOT A;  4XR6 A;  1WQ2 A;  1MSF C;  3CJQ B;  3CCQ I;  1RUN A;  2DMT A;  1R4N B;  2HYF A;  3I59 A;  2BE5 F;  2R7T A;  2KMU A;  1UEL B;  3J7Y J;  2CUJ A;  3ZMD A;  3IV5 A;  3I9V 2;  3KX2 A;  2JA6 J;  1S8N A;  1Z1D A;  5F0F A;  3CP8 A;  3RDI A;  2IGN A;  3O6B B;  4PK4 A;  4XKV A;  1G59 A;  4EMS A;  2Y48 A;  2KQR A;  2BGC A;  3B02 A;  3HRT A;  4G6T B;  2LRD A;  2HQA A;  1KU3 A;  5JR3 A;  2BVL A;  5EF6 A;  3PFI A;  2A6T A;  4HW0 A;  2ECC A;  3KYC B;  5JHU A;  5HLI A;  2OAZ A;  3W6J B;  2O8X A;  2JA5 J;  2YSR A;  1M1E B;  2EA2 A;  2IT0 A;  3QWL A;  4F7Z A;  3WTT C;  3OYG A;  2LKX A;  2RGV A;  1W36 D;  3V8J A;  1ITY A;  3HC7 A;  2Q2E B;  1K78 A;  3HRM A;  1UZC A;  3S2W A;  2DA2 A;  1IRZ A;  3DU6 A;  1G2H A;  2D1H A;  1X1C A;  5E3N A;  2FA5 A;  4A69 C;  4MQV A;  4A93 J;  3I71 A;  3JRF A;  2LMD A;  4P9U A;  1FYK A;  4DQ2 A;  3FK6 A;  3GLX A;  4ZYH A;  2JA8 J;  2FQ4 A;  2MC3 A;  3DQV C;  2VI6 A;  3PO2 J;  1LDK B;  3ECH A;  1VND A;  3W3C A;  2ZC2 A;  3HM5 A;  1YS7 A;  4JX4 A;  4RAY A;  4PDK A;  1LEB A;  5CVV A;  5J1U A;  4DGW B;  1LJ9 A;  3OYN A;  3ZQ7 A;  1YIO A;  2VKE A;  5KAI C;  1NK3 P;  2ZME C;  5ILS A;  3A1Y A;  1NTC A;  1OFC X;  3I4M J;  4JBA A;  5EZH A;  1Y0U A;  3K2Z A;  4HZF A;  4PSX A;  3JRI A;  1S72 I;  2W82 A;  4BQA A;  4MEX F;  5LGU A;  1RR7 A;  4HF2 A;  1FBU A;  3EDP A;  2Z1D A;  1MMA A;  2XF5 A;  3ISP A;  5GP9 A;  1FYL A;  4DYQ A;  2L5Q A;  1MKM A;  4AVZ A;  2A3S A;  1RC9 A;  2H1L A;  1UHS A;  1BBY A;  4HV6 A;  3H0D A;  3O2P E;  4L5E A;  1REP C;  1Z21 A;  1P4W A;  3F8M A;  4B44 A;  3I58 A;  3TQN A;  1RI7 A;  2K4J A;  3N05 A;  3CCJ I;  3G73 A;  1FY7 A;  2CV0 A;  1FSH A;  1O7L A;  4ENJ A;  1ZGJ A;  5CVI A;  1VQN I;  1HST A;  4IHS A;  2CQX A;  2F5F A;  2XHK A;  1X1A A;  3CLQ A;  1IRX A;  1JUP A;  4A3L J;  3CUQ A;  5FO5 A;  5E3O A;  2O8K A;  2VBZ A;  3O8G A;  4CYD A;  3OV8 A;  1Z6R A;  3M07 A;  1FOY A;  3QOP A;  1FIA A;  3BP8 A;  5B1B H;  3ZPL A;  2QUF A;  3E97 A;  4NQW A;  2JRM A;  2X6O A;  3D1N I;  1IZ1 A;  5DTD A;  1QBJ A;  1VQL I;  1OPC A;  5J8C A;  5DV5 A;  2GM4 A;  4AWX B;  2MLG A;  2NVY J;  4AIH A;  1YW7 A;  1G3S A;  4FT8 A;  2NNY A;  2KJB A;  2L7F P;  1CF7 A;  4B1R A;  2FNP A;  2X0L A;  4AUX A;  2O5R A;  3LSI A;  4BS9 A;  5B3S H;  2V1N A;  1I1S A;  1IDZ A;  2VOO A;  5JI6 A;  3NWT A;  2VXZ A;  4G7O F;  2XSJ C;  1UMQ A;  1HW2 A;  4IJA A;  2CQ7 A;  4XKB A;  5M5Y J;  3FZV A;  5E8I A;  1ONV A;  4L5J A;  4HDU A;  1VTN C;  3GTL J;  5F08 A;  5E3L A;  2WAD A;  3VDX A;  4BH9 A;  3CF5 F;  2P81 A;  2DYR H;  2OQR A;  3DEW A;  2EWN A;  3TL4 X;  1FZP B;  2ZB9 A;  4C3H J;  5DUI A;  5D8K B;  3E6D A;  1R6R A;  4BJT A;  1Z67 A;  3I59 B;  1SFU A;  3WG9 A;  4UV9 A;  2E71 A;  1BW6 A;  5JHF A;  4F55 A;  4BY1 J;  4IOA F;  2IW5 A;  5FLX K;  3EYY A;  5ICF A;  3GBG A;  1R9T J;  2XGD A;  1X2M A;  2A61 A;  4LK1 F;  3TGN A;  4A3B J;  3TED A;  2MW8 A;  2CV2 A;  2BXZ A;  1SAN A;  2QQ9 A;  1UG0 A;  3QYF A;  2Z33 A;  5IOY A;  1QZY A;  3KP2 A;  2XF6 A;  3K1M A;  3WTV C;  5L3D A;  3GTG J;  2JK3 A;  3S1R J;  2HYG D;  1XSV A;  2HVQ A;  1I6H J;  2EZH A;  4IL6 C;  2K3P A;  2B9S A;  1F36 A;  1GVD A;  1O57 A;  4OMZ A;  1SMT A;  1DDN A;  5JFR A;  1I5Z A;  3T8T A;  3CJN A;  1U2W A;  5M3F J;  2IS2 A;  2DFI A;  1FIP A;  4MFD A;  4PSW A;  3AKZ A;  4E7H A;  4NUB A;  1U5T C;  5A2Q Z;  1QPI A;  2OUM A;  3DFG A;  1ETK A;  2X1E A;  2MG4 A;  4DJA A;  1YJW I;  2LDU A;  2FD5 A;  1I50 J;  4IPA A;  4M9Z A;  4E4H A;  2KRC A;  4JOM A;  3DPU A;  4IRG A;  2LFB A;  3HOZ J;  4ENK A;  1D0X A;  2EIL H;  2VJ5 A;  4DYC A;  1A36 A;  3OYJ A;  1YO5 C;  2Z9O A;  1DQU A;  1PYV A;  4ZTF A;  1HF0 A;  1J7K A;  4KJZ A;  4BY7 J;  1Y8R B;  3LSK A;  1KYZ A;  2M0M A;  2K9N A;  1YLF A;  2ME0 A;  4JX5 A;  4ZDL A;  3RTR A;  3KZI C;  1W4M A;  3Q9S A;  4N9H A;  3H3Z A;  2XV4 S;  2KL4 A;  3OYM A;  2DDA A;  3ABM H;  2E35 A;  2K7L A;  1UCR A;  1SVM A;  1ZG3 A;  3RIR A;  2VJ4 A;  3K7A J;  4HQE A;  5CVJ A;  5J1Y A;  3L00 A;  3BY6 A;  3OYI A;  3FHN A;  4RB0 A;  4D0P A;  3FMQ A;  2G0E A;  4ZZL A;  3SZG A;  2OPT A;  2O61 A;  2H09 A;  5HDK A;  2ACJ A;  1LB2 A;  2K9S A;  3EQL F;  1VQM I;  1U8B A;  1T2K A;  1HC8 A;  2IBD A;  5FRM A;  2Y9Z A;  1U3E M;  2R7S A;  4G94 A;  3ZQF A;  1TNT A;  2XUB A;  1PUF A;  2STT A;  2BZT A;  3KE2 A;  2GOM A;  3MEX A;  2QQ8 A;  2V4J C;  3HJE A;  3MZH A;  1WWX A;  4E7K A;  1TL8 A;  2R7Z J;  4MEY F;  4J01 A;  2XAG A;  3KEQ A;  4UV8 A;  3S3O A;  1Z9C A;  1FX7 A;  4C2T A;  3DP7 A;  4I99 C;  1MH3 A;  1R1V A;  2DK8 A;  2XB5 A;  2XKO A;  3DTI A;  4V2F A;  3CUQ B;  3JR9 A;  3K70 D;  3QAH A;  3BTJ A;  3K4M A;  3SQN A;  5D4S A;  3TO6 A;  3MN2 A;  4EAT A;  2VKD A;  1BC8 C;  2DYS H;  4AVP A;  4KMF A;  4Q48 A;  1R23 A;  5B66 C;  5FKN A;  4NQW B;  2JVG A;  2XAJ A;  1Y6I A;  2RV8 A;  4XN3 A;  4HLX A;  3ONQ A;  1JHH A;  3LL7 A;  2RN7 A;  5FFZ A;  3D5L A;  3K4B A;  2CQQ A;  3QU6 A;  4RB2 C;  3L9F A;  4OIR F;  4KFC A;  2W57 A;  4XIC A;  3WU2 C;  1CF7 B;  4FIS A;  1XG1 A;  3JSO A;  3KP4 A;  1MBF A;  2F4I A;  1XB4 A;  3CMA I;  2M87 A;  1MJA A;  1R36 A;  2D5V A;  2NVX J;  2A68 F;  1DGR M;  2BXY A;  4ESB A;  1EF4 A;  2IGK A;  2DTR A;  2DA7 A;  3JRC A;  2JA7 J;  3FHZ A;  3IH4 A;  2ECB A;  1XD7 A;  4BE1 A;  2JWT A;  1GLN A;  4KT5 C;  4GGG A;  2L7M P;  3Q3S A;  5H20 A;  4EV0 A;  4U88 A;  3EET A;  2L2O A;  3UNG C;  1IN6 A;  1IO2 A;  3WGH A;  3WTZ A;  4B43 A;  5BOX A;  4IHW A;  4L18 B;  2VUM J;  5E17 F;  2JN6 A;  3SEZ A;  3GZ5 A;  1Y1V J;  3CLO A;  3DPL C;  4HQM A;  4LG3 A;  3FXO A;  1IUF A;  1H9G A;  3HYI A;  4II2 A;  1QPM A;  1RZ4 A;  4ZJZ A;  1RKT A;  2KPM A;  5TIS C;  1ZK8 A;  4PFP A;  4XKW A;  5FD6 A;  5K1Y A;  1Y1W J;  2DMN A;  5L3F A;  1DP7 P;  3T1B A;  3MQ0 A;  4G8X A;  4D7N A;  4BDY A;  2H8W A;  3WGI A;  4XID A;  3I56 I;  3WTU C;  4UUV A;  1ETX A;  2E1N A;  1OCR H;  2JRT A;  3C2H A;  1PP8 F;  3ZMS A;  1V5G A;  1HDP A;  4XLN F;  2PI0 A;  1UJ8 A;  5ICE A;  4ON0 A;  1ZGA A;  2HEO A;  2L4M A;  4Q4Z F;  4A0Z A;  2M0C A;  3SZP A;  1E3P A;  2W25 A;  3G4S I;  1UB9 A;  3SEQ A;  1BA5 A;  1SAU A;  2CS3 A;  2IP2 A;  3M8J A;  1ZHF A;  2CO5 A;  4OU0 A;  3LST A;  4BNC A;  4RAZ A;  2EFP A;  2KDZ A;  1N77 A;  5EYR A;  1TWC J;  5HS9 A;  4BXU A;  2FJ1 A;  1XMK A;  1A6I A;  3PM1 A;  4RA2 A;  1OLT A;  3BCA A;  5AON A;  4BYY A;  1ULY A;  3F72 A;  2NS7 A;  1Z7U A;  1FJL A;  1W1W E;  4A0X A;  4IEJ A;  4F3Q A;  2OCC H;  4DBR A;  2IGO A;  5IP9 J;  4XRS A;  1U78 A;  1DU6 A;  4FAS D;  5M3M J;  1R1T A;  1C0W A;  1X1D A;  5C4J J;  4A5N A;  4LB6 B;  1FWZ A;  1E17 A;  1FC3 A;  1X58 A;  1D8K A;  4E7I A;  4F52 A;  3FF5 A;  2WAQ N;  4LB5 A;  2QCO A;  1O4X A;  2ID3 A;  1B1B A;  3OL3 A;  3J7A O;  1WI3 A;  4UUT A;  2I8D A;  1R1U A;  2ZSI B;  3VSL A;  3I55 I;  4PJL A;  2DMU A;  4LIU A;  4M72 A;  3JRB A;  3FX3 A;  4HPQ A;  4DIQ A;  2PMU A;  4ANJ A;  1KU9 A;  3OS2 A;  9ANT A;  5K5Q A;  4H0E A;  4CCK A;  3ULQ B;  2VQH A;  3F8B A;  3IWF A;  5CVU A;  4C3I J;  4X0G A;  3KYD B;  1DUX C;  3ABT A;  2XSD C;  2BEO A;  3A02 A;  1G8X A;  1W36 C;  2MSY A;  3ZGK A;  1OCZ H;  3LOC A;  1VQ5 I;  2DBB A;  4XSZ F;  1ZEL A;  4HST A;  1APL C;  4U7D A;  1PUF B;  2XC7 A;  1FTZ A;  2FE3 A;  2Y75 A;  1KZH A;  1ZRF A;  1WJC A;  3H3U A;  5EGO B;  4KDP A;  5LHH A;  2RNG A;  2CMP A;  2RQQ A;  3LSG A;  2HTJ A;  4JYK A;  4S04 A;  4P1W A;  4E70 A;  3M4O J;  3NRV A;  4JQF A;  2CFX A;  2WTE A;  1W0T A;  4BQN A;  2ZKZ A;  3H9Q A;  3HOX J;  2OF7 A;  2WAE A;  1YG2 A;  3C1D A;  4Y15 A;  2ADU A;  1Y56 A;  2UWM A;  5A2Q K;  4XMY A;  3DEU A;  3LQQ A;  2KRH A;  5C4X J;  4XLP F;  1YE9 A;  2V6E A;  5IYC J;  1Z3X A;  3V8L A;  2LKP A;  2HXO A;  2F5E A;  3I64 A;  1U6G A;  4NB5 A;  4HX4 A;  3FMR A;  1QRY A;  5E8G A;  4CCN A;  2BY0 A;  1IRF A;  4CDG A;  5F1J A;  2XKP A;  1MBK A;  4BHC A;  3LA3 A;  3FBI B;  2X85 A;  3W6K B;  3CC4 I;  1TZL A;  1J59 A;  2Y0S N;  5F04 A;  5DDG A;  1FP1 D;  1FT9 A;  3BJO A;  4M73 A;  1TW2 A;  3S17 J;  3KLO A;  3D5R C;  1IN7 A;  1LFB A;  1LDJ A;  2OC6 A;  2R4G A;  3C2B A;  4AIK A;  1ZR2 A;  3LA2 A;  2RC4 A;  2ZSH B;  3GTK J;  2GIV A;  1OYI A;  2ZJ2 A;  2I10 A;  4CXF A;  2QZ8 A;  2W84 A;  4FTH A;  1XMX A;  4AD9 A;  2DMP A;  2WB1 A;  1ETQ A;  1MMG A;  1XN7 A;  1KGS A;  2EIJ H;  3GUD A;  4PZJ A;  4BHP A;  2LY1 A;  2VL8 A;  2XDV A;  2ZFU A;  1S6L A;  3H92 A;  1Z6T A;  3S3M A;  4GDF A;  4Y52 J;  1YJ9 I;  5GAH J;  1B59 A;  1K83 J;  1P9Q C;  3CCE I;  5FRN A;  4RM3 A;  2M2E A;  2V79 A;  2X9D A;  4CH7 A;  2LR8 A;  1RUO A;  1TBX A;  5F1R A;  3W2V A;  2GXB A;  5TJJ A;  2PX9 A;  3GTJ J;  1IN5 A;  3HPH A;  2EIM H;  2EPF A;  2GAU A;  1T38 A;  2HOA A;  3CDH A;  1HKQ A;  2GBY A;  5AIP A;  3M8E A;  4A5M A;  2Y30 A;  3BT9 A;  3EUH A;  2JUC A;  3VOD A;  1Z05 A;  3SDG A;  4G7Z F;  1O3R A;  2X48 A;  2F5V A;  1J75 A;  4KUM A;  2HDD A;  1P4X A;  1TLH B;  3ZQL A;  3H3V K;  2IA1 A;  2K27 A;  1U9N A;  3KET A;  2X4H A;  1KQ8 A;  3OSF A;  1ENH A;  5HLG A;  1X1B A;  3K9T A;  1MW7 A;  5J4V A;  3P7N A;  3KP5 A;  1JUS A;  3AG2 H;  2DMQ A;  1OYW A;  4P55 A;  4V19 K;  3K10 A;  3K4L A;  2AXT C;  1TP4 A;  1KON A;  4PUS A;  1HOM A;  4A3I J;  5E1W A;  3EYI A;  3A4C A;  4CCO A;  4B3A A;  3HIF A;  2RQP A;  1NK2 P;  3TOA A;  2QSG X;  3RYP A;  4FQG A;  3IHU A;  4CZC A;  5J3L A;  1GV5 A;  3HPG A;  4Z6Y A;  3OOU A;  4E7L A;  3QPS A;  4ENN A;  4EEF G;  2HQ5 A;  2WAF A;  4HAM A;  1X3W B;  2LLK A;  1EH8 A;  3S1N J;  2LK2 A; 
#chains in the Genus database with same CATH homology
 3TO9 A;  3RI4 A;  3R61 A;  5DYM A;  2HZT A;  4HV5 A;  2AXL A;  2JSC A;  3GFI A;  1P6R A;  1BM9 A;  4HLY A;  5BMZ A;  3F6O A;  3I53 A;  4PGG A;  3R0A A;  3ERE D;  2WV0 A;  2EFN A;  5HVQ C;  3E6B A;  3N97 A;  4IRI A;  5F64 A;  2C6Y A;  1JGS A;  4UVC A;  1RNL A;  4GCV A;  3ELK A;  4ZYE A;  2H6C A;  2LF8 A;  3GFM A;  3NEU A;  5HDG A;  3BJA A;  1IF1 A;  4EVI A;  2MBF A;  3ZN1 A;  3ABU A;  1FBS A;  3E5Q A;  2HQN A;  1XCB A;  3L09 A;  5IT9 Z;  5FFX A;  3F22 A;  4M6X A;  1HW5 A;  1PUE E;  2ESN A;  5J8F A;  2DAO A;  3R6S A;  3BRO A;  1W5S A;  4M74 A;  5ERI A;  2L01 A;  1K6O A;  2CW0 F;  4UVB A;  1G3W A;  1XGN A;  5LRR A;  3FMS A;  2WWY A;  4I7H A;  4HF1 A;  1ZRD A;  3V8K A;  2JZY A;  3LAP A;  1HXD A;  2BYV E;  2VT3 A;  5BPI A;  5J6X A;  3R60 A;  2E1C A;  3ECO A;  3K0L A;  3FM5 A;  2PG4 A;  4GYG A;  4ZYD A;  4CHU A;  2RVC A;  4O5V A;  1FSE A;  2PEX A;  4HDV A;  1FOK A;  3F8C A;  1F4K A;  2QEN A;  1IAW A;  4I2O A;  1S7O A;  1HQC A;  4O6J A;  1AWC A;  4NHJ A;  1QO0 D;  1IXR C;  1CGP A;  2XIG A;  2GA2 A;  3L7W A;  3J81 Z;  3WE3 A;  3E3V A;  4KIF A;  3M9A A;  2QLZ A;  1EH7 A;  2VN2 A;  5BPD A;  4G7H F;  3M7G A;  3QRF F;  3HSF A;  1UST A;  5KK1 A;  4M71 A;  4KIG A;  3TKY A;  4DNC A;  1R22 A;  4KMU X;  5FB2 A;  4I01 A;  4Z2Y A;  4ZZD A;  1MDM A;  1R58 A;  3WTS C;  3K1P A;  2G9W A;  1BI2 A;  1XGO A;  3CTA A;  2P5V A;  4EM0 B;  1IUY A;  4KIB A;  2MD5 A;  5D6F A;  1WSU A;  2EFO A;  2IA2 A;  2Z99 A;  5L3C A;  3P9K A;  5K5O A;  2BV6 A;  3MAJ A;  3VEP A;  4OIQ F;  3C3W A;  3F8F A;  4KN4 X;  3ZN0 A;  1H0M A;  4IF4 A;  2O3F A;  1TW3 A;  2EV5 A;  3DV8 A;  4RGX A;  3Q5F A;  2VC1 A;  3HUG A;  4O3M A;  4YFN F;  4P9F A;  1SFE A;  2EV6 A;  4LMY A;  1YTY A;  1MJB A;  1HSJ A;  3F23 A;  2HDC A;  3J80 Z;  3QP5 A;  1TQI A;  1BJA A;  1SAX A;  1ZRC A;  3JW4 A;  3CO6 C;  2IA0 A;  4U7B A;  3KZZ A;  3BJ6 A;  3WOD F;  2CYY A;  1LDD A;  2FQ3 A;  2DU9 A;  4UVA A;  1T6S A;  3LFK A;  3CUQ C;  1ODD A;  1YS6 A;  4XBF A;  2FOK A;  2GWR A;  1J0R A;  4Y13 A;  4L0Y B;  4MGR A;  2PBI A;  3U1D A;  2CG4 A;  3FXU A;  1V4R A;  3E5X A;  3WGG A;  1ZLJ A;  4YG2 F;  5LLQ A;  2ESH A;  2Q8K A;  2YX7 A;  4B8X A;  2V1U A;  4YFK F;  3WTX C;  2LF7 A;  2ISY A;  2QBY A;  5IT9 K;  1FLI A;  1ON1 A;  5D5X B;  5ED4 A;  3COA C;  2IPQ X;  2M1B A;  1BN5 A;  1UFM A;  6PAX A;  3GWZ A;  2STW A;  1GVJ A;  5TRD A;  1O3S A;  4U0W A;  1FPQ A;  3MWM A;  1XGM A;  4AIJ A;  4EJU A;  3FWE A;  1GHC A;  2PMH A;  1SD6 A;  3ZMV A;  2YX4 A;  1EH6 A;  2M5W A;  1IXS B;  3V4G A;  2L02 A;  4R8H A;  2HS5 A;  3C7J A;  2KIM A;  1IW7 F;  4YII A;  4A0Y A;  4HF0 A;  4LLN A;  2O0Y A;  4LJZ F;  3OOP A;  1MDM B;  5L3G A;  5D8L B;  5DCF A;  4PCQ A;  3T0Y A;  4R79 A;  3BDD A;  1G3Y A;  1W7P A;  5HS7 A;  4HX7 A;  2KRF A;  3LQR A;  4IXA A;  1HKT A;  4LGW A;  2YPR A;  3REO A;  3I54 A;  1BIB A;  2BBY A;  2VOP A;  4A12 A;  3AAF A;  4G6Q A;  1YW8 A;  3GEZ A;  4UNO A;  1J2X A;  5EEG A;  3TO7 A;  3TDU C;  3J81 K;  1OMI A;  2VBY A;  4OIO F;  2XAS A;  2PQ8 A;  2MH2 A;  3GO5 A;  2HR3 A;  1STZ A;  2R3S A;  2P4W A;  1L0O C;  1BIA A;  4EJO A;  1ZG1 A;  4ZYG A;  2PN6 A;  3I4P A;  1K7A A;  2P7V B;  2FNA A;  1B9M A;  5LGT A;  2NRA C;  2OU2 A;  3F21 A;  4ASN A;  3KLN A;  4YFX F;  3VB2 A;  1UHW A;  1K79 A;  2KIF A;  1ZAO A;  4ETS A;  4L9V A;  1E2X A;  3KP3 A;  2E7X A;  2DPU A;  1U8R A;  3GX4 X;  3QPH A;  4EGY A;  3FM3 A;  1BC7 C;  1XMA A;  1ZRE A;  3FXQ A;  4Q47 A;  2L54 A;  1YW9 A;  3QU3 A;  3IKV A;  4FX0 A;  4GO1 A;  1XSD A;  3F8N A;  5D6E A;  2Z3Y A;  2OD5 A;  1BI1 A;  1R7J A;  1I27 A;  2QQB A;  1Z91 A;  4QWQ A;  4A2U A;  2IRF G;  5HDN A;  3CUO A;  2ZO4 A;  3MZY A;  2QBY B;  3V7C A;  1SFX A;  2FML A;  5DUK A;  3IRQ A;  2FEZ A;  1LEA A;  1OYY A;  3KCC A;  5E1X A;  4I09 A;  3IRR A;  2R7F A;  2M30 A;  3WTW C;  3ZMU A;  2LSO A;  5H6Q A;  2UXN A;  2ZME A;  2VC0 A;  1LQ1 A;  4WF2 A;  1G6N A;  2A07 F;  5CJ9 A;  2M8E A;  3HHH A;  1WRJ A;  4WXD A;  5FD5 A;  2DK5 A;  2P6T A;  1R00 A;  3E5U A;  2HOE A;  4XSX F;  2GA1 A;  1KYW A;  1T0F A;  3ZMZ A;  5LBQ A;  1AOY A;  1USS A;  1SD4 A;  5K5R A;  4EQQ A;  4CO8 A;  2WC2 A;  3RYR A;  2ZXJ A;  2UZK A;  4MHG A;  3JAM Z;  4WCG A;  1W7P B;  2EFW A;  3BPV A;  5HLH A;  4I0B A;  4P5O A;  2FBI A;  3ML6 A;  1QGP A;  2NS0 A;  1ZAR A;  2V1X A;  2P8T A;  2PJP A;  4EJW A;  1YFH A;  2KKO A;  2HGC A;  3HTU A;  2PFB A;  2OZU A;  2PLY A;  1W5T A;  4FX4 A;  4G9Y A;  1MD0 A;  2ELH A;  1F1Z A;  5L3E A;  3TDZ C;  1ON2 A;  4IVN A;  5E1Z B;  1ZH5 A;  4UXN A;  5DCM A;  4CGZ A;  1P2F A;  2JT1 A;  1SMY F;  1V3F A;  1XDU A;  1EV7 A;  1F5T A;  3O3K A;  1MGT A;  2ZNZ A;  2VE8 A;  2A69 F;  2JPC A;  1IN4 A;  2QQA A;  5LGN A;  1DPR A;  5EEH A;  1BI0 A;  2A6E F;  3P9I A;  2EB7 A;  1TQM A;  3F6V A;  5JVT A;  2P7C B;  1U5T A;  1WKM A;  2Q0O A;  1S3J A;  5FGM A;  1GXP A;  3HRS A;  2OZ6 A;  4OIN F;  2CWE A;  2TDX A;  5D4R A;  3P9C A;  2D45 A;  2VON A;  4KN7 X;  4CIC A;  1UHM A;  2DQL A;  3KP7 A;  5ICG A;  1YQA A;  3T5X A;  1S7A A;  4GYI A;  2ZME B;  3DXJ F;  2B0L A;  2OBP A;  2DT5 A;  4R1H A;  1MJ9 A;  2G7H A;  2P6S A;  3PQJ A;  2V1D A;  2F5D A;  1R5G A;  5CVR A;  3BOQ A;  4LLG F;  4PGH A;  3I5U A;  4U0V A;  4WX9 A;  2VT2 A;  3R4K A;  2ZFW A;  4M9X A;  2VE9 A;  3VFZ A;  2E7W A;  5H6R A;  2ZCW A;  4ENM A;  2MH9 A;  2A6H F;  1KU7 A;  1J9I A;  2FF4 A;  3SHF A;  1W7P D;  5LEJ A;  2DQR A;  4LD5 A;  3GYH X;  2VBW A;  1ZG5 A;  1XDS A;  1KU2 A;  1G4D A;  1XCV A;  1DPU A;  2W85 A;  2XRN A;  2YR2 A;  3Q9V A;  2ETH A;  3SZT A;  3DF8 A;  4HBL A;  1QZZ A;  2FRH A;  2D2W A;  2QM3 A;  1ZN2 A;  2XAF A;  3GXO A;  4Y17 A;  2XGX A;  2RKH A;  2CQK A;  2RDP A;  5DCM B;  2HKX A;  5LHG A;  1PP7 U;  4HX8 A;  1FP2 A;  2HWV A;  3WU1 B;  4LK0 F;  1R5H A;  1X3U A;  1TTY A;  4OOI A;  3SFZ A;  4Q5S F;  2VBX A;  3JAM K;  5LHI A;  5D5U B;  3IL2 A;  1A04 A;  4BHB A;  5DD8 A;  2F5C A;  3M8F A;  3JSP A;  4KYW A;  2GQQ A;  2Z5U A;  4B09 A;  2IVM A;  4LLL A;  3MCZ A;  1B6A A;  3GF2 A;  4I02 A;  1K78 B;  3SXY A;  2K02 A;  1U5T B;  1I6X A;  2DLL A;  3IC7 A;  4M6Y A;  1KQ0 A;  2NYX A;  1TNS A;  1HW1 A;  1TQP A;  2CGP A;  4EM2 A;  1S29 A;  1NHA A;  2HFH A;  3C18 A;  2Y0M A;  3KZY A;  3ZP5 A;  1OR7 A;  2AS5 F;  1RIO H;  1QQI A;  4ESF A;  1O3Q A;  3K69 A;  4LFU A;  3GW2 A;  5ILV A;  4MTE A;  4U0Y A;  3JTG A;  2H94 A;  2DPD A;  1D8J A;  1JXS A;  4M9S A;  1J5Y A;  2FXA A;  1LNW A;  1PDN C;  3RKY A;  1QNT A;  2VOD A;  2EJR A;  2EFQ A;  2ZNY A;  2P5L C;  3G3Z A;  3HHG A;  4XRF A;  2FSW A;  3BZ6 A;  1F9N A;  3ROU A;  3QP6 A;  4KNY A;  1Q1H A;  3N4M A;  2RNJ A;  5AIQ A;  4I98 B;  1B4A A;  2HTS A;  1ZYR F;  4L9N A;  2CSO A;  3HRU A;  3RKX A;  4FHT A;  3IKT A;  1XGS A;  2GXG A;  1L3L A;  1B9N A;  4GXO A;  1SD5 A;  3RKW A;  5D5V B;  3M1E A;  1WI9 A;  1YYV A;  4MTD A;  2FMY A;  3BWG A;  4MNU A;  3WE2 A;  1O7F A;  3PQK A;  4EJV A;  4EJT A;  3I0T A;  3VOE A;  5CYV A;  3TOB A;  3DPT A;  1H9T A;  2XAQ A;  2LNB A;  3NQO A;  4CZZ A;  4EM1 A;  3R0J A;  2EV0 A;  2A5Y B;  1IXC A;  2H27 A;  4L9T A;  1GXQ A;  5LEK A;  4KIC A;  3RJP A;  2XVC A;  1BI3 A;  2QYO A;  3U9G A;  4RS8 A;  2ISZ A;  3MFK A;  3GZ6 A;  4HYE A;  4A6D A;  1D5V A;  2QWW A;  4I0A A;  5DD4 A;  2UXX A;  2QVO A;  3CO7 C;  2EA4 A;  4RB3 C;  3U2R A;  2XRO A;  2MLK A;  4S05 A;  3V7S A;  3GFL A;  5E18 F;  1FBQ A;  4UHT A;  1IN8 A;  2V9V A;  3ZMT A;  4LG0 A;  1OKR A;  4TV7 A;  1JE8 A;  1KA8 A;  2HKO A;  4L5I A;  2MA3 A;  2H6B A;  1T98 A;  3V7R A;  5KVR A;  4IRH A;  2G7U A;  4K2E A;  1ZLK A;  3WTY C;  2P5K A;  5ILU A;  1SD7 A;  3L2C A;  2HQR A;  2J5O A;  2FBH A;  3DKW A;  2JPB A;  2R7D A;  5E20 A;  4ESJ A;  3BPX A;  4N9I A;  4MQ9 F;  3WU0 A;  4WK8 F;  4QLC U;  2FBK A;  2L3D A;  4P96 A;  4KA4 A;  4G6D A;  4N0B A;  4L0Z B;  2XAH A;  1MZB A;  2D1V A;  1XSX A;  4JK1 X;  3B73 A;  4ZH4 F;  4HOB A;  2Q2E A;  1G3T A;  4IHT A;  3E6C C;  2V6C A;  1KQ9 A;  2F2E A;  3KFW X;  5CLS A;  3LWF A;  3RPQ A;  1FNN A;  1FYM A;  4YIF A;  2O6G E;  2DI3 A;  3T8R A;  3RPU A;  3HTS B;  4EGZ A;  1LVA A;  5LRS A;  2GZW A;  2DO7 A;  2DW4 A;  2OA4 A;  3E6M A;  3KP6 A;  5F6F A;  3HSR A;  5HOO A;  4RGU A;  2FU4 A;  5IT3 A;  2EK5 A;  1O3T A;  5HS8 A;  4OMY A;  1T39 A;  3J80 K;  2NAZ A;  1IRG A;  3LA7 A;  3FXR A;  1I1G A;  3IWZ A;  4RGR A;  2NNN A;  4HA8 A;  2YU3 A;  4RGS A;  2OQG A;  3LAJ A;  2W24 A;  4BAY A;  4RB1 A;  5BS6 A;  5DEQ A;  2IJL A;  2JTV A;  3GFJ A;  3F3X A;  5FLX Z;  3GVA A;  1P4A A;  1D3Y A;  3KEO A;  2O03 A;  5BQT A;  1BOA A;  3D0S A;  2K86 A;  4WXH A;  3HOS A;  5L3B A;  4L9J A;  5ICC A;  4WWC A;  3HSE A;  4A6E A;  2M45 A;  1HKS A;  2ZBK A;  1P92 A;  2KIU A;  2K4B A;  3K1N A;  2L4A A;  1JHF A;  2COM A;  2J5P A;  5D5W B;  2KJC A;  3QPT A;  4LG0 B;  4WXC A;  1HBX G;  3JTH A;  3HOT A;  1WQ2 A;  1RUN A;  2HYF A;  3I59 A;  2BE5 F;  3ZMD A;  1S8N A;  1Z1D A;  3RDI A;  3O6B B;  4EMS A;  2Y48 A;  2BGC A;  3B02 A;  3HRT A;  1KU3 A;  5JR3 A;  3PFI A;  4HW0 A;  5JHU A;  5HLI A;  2OAZ A;  3W6J B;  2O8X A;  2YSR A;  2EA2 A;  2IT0 A;  4F7Z A;  3WTT C;  2RGV A;  3V8J A;  1K78 A;  3HRM A;  3S2W A;  2D1H A;  2FA5 A;  4MQV A;  3I71 A;  4P9U A;  1FYK A;  4DQ2 A;  3GLX A;  4ZYH A;  2MC3 A;  3DQV C;  1LDK B;  3ECH A;  1YS7 A;  4RAY A;  4PDK A;  1LEB A;  5CVV A;  1LJ9 A;  3ZQ7 A;  1YIO A;  5ILS A;  4JBA A;  1Y0U A;  3K2Z A;  4HZF A;  4BQA A;  4MEX F;  5LGU A;  4HF2 A;  1FBU A;  3EDP A;  3ISP A;  1FYL A;  1MKM A;  2A3S A;  1BBY A;  4HV6 A;  3O2P E;  1REP C;  3F8M A;  1P4W A;  3I58 A;  3TQN A;  1RI7 A;  2K4J A;  3G73 A;  1FY7 A;  1FSH A;  1O7L A;  4ENJ A;  1ZGJ A;  5CVI A;  1HST A;  4IHS A;  2F5F A;  2XHK A;  3CUQ A;  5FO5 A;  2VBZ A;  4CYD A;  3OV8 A;  1Z6R A;  3QOP A;  3BP8 A;  3ZPL A;  2QUF A;  3E97 A;  4NQW A;  1IZ1 A;  1QBJ A;  1OPC A;  5J8C A;  5DV5 A;  4AWX B;  2MLG A;  4AIH A;  1YW7 A;  1G3S A;  4FT8 A;  2NNY A;  2KJB A;  1CF7 A;  2FNP A;  2X0L A;  1I1S A;  2VOO A;  5JI6 A;  2VXZ A;  4G7O F;  1HW2 A;  4IJA A;  3FZV A;  5E8I A;  1ONV A;  4L5J A;  4HDU A;  1VTN C;  4BH9 A;  2OQR A;  1FZP B;  2EWN A;  5DUI A;  5D8K B;  3E6D A;  1SFU A;  3I59 B;  3WG9 A;  4UV9 A;  2IW5 A;  5FLX K;  3EYY A;  5ICF A;  2A61 A;  4LK1 F;  3TGN A;  2QQ9 A;  2Z33 A;  1QZY A;  3KP2 A;  3K1M A;  3WTV C;  5L3D A;  2HYG D;  1XSV A;  1O57 A;  4OMZ A;  1SMT A;  1DDN A;  5JFR A;  1I5Z A;  3T8T A;  3CJN A;  1U2W A;  2DFI A;  1U5T C;  5A2Q Z;  3DFG A;  2LDU A;  4IPA A;  4M9Z A;  4IRG A;  4ENK A;  1YO5 C;  2Z9O A;  1J7K A;  1KYZ A;  1YLF A;  3RTR A;  1W4M A;  3Q9S A;  4N9H A;  3H3Z A;  2XV4 S;  2K7L A;  1UCR A;  1ZG3 A;  3RIR A;  4HQE A;  5CVJ A;  3L00 A;  3BY6 A;  4D0P A;  4RB0 A;  3FMQ A;  4ZZL A;  2O61 A;  2H09 A;  5HDK A;  2ACJ A;  1LB2 A;  3EQL F;  1T2K A;  1U3E M;  4G94 A;  1TNT A;  2XUB A;  2STT A;  3KE2 A;  3MEX A;  3MZH A;  1WWX A;  4MEY F;  2XAG A;  3KEQ A;  4UV8 A;  1Z9C A;  1FX7 A;  3DP7 A;  1R1V A;  2DK8 A;  2XKO A;  3CUQ B;  3QAH A;  3SQN A;  5D4S A;  3TO6 A;  1BC8 C;  4KMF A;  4AVP A;  4Q48 A;  1R23 A;  2XAJ A;  2RV8 A;  4HLX A;  1JHH A;  2RN7 A;  5FFZ A;  3D5L A;  3QU6 A;  4RB2 C;  3L9F A;  4OIR F;  4KFC A;  2W57 A;  1CF7 B;  3JSO A;  3KP4 A;  1XB4 A;  2M87 A;  1MJA A;  1R36 A;  2A68 F;  4ESB A;  2DTR A;  3FHZ A;  1XD7 A;  4KT5 C;  4GGG A;  5H20 A;  4EV0 A;  4U88 A;  3EET A;  3WGH A;  3WTZ A;  1IN6 A;  4L18 B;  5BOX A;  5E17 F;  3GZ5 A;  3CLO A;  3DPL C;  4HQM A;  1H9G A;  3HYI A;  1QPM A;  1RZ4 A;  5FD6 A;  5K1Y A;  5L3F A;  1DP7 P;  3T1B A;  3MQ0 A;  4G8X A;  3WGI A;  3WTU C;  4UUV A;  2E1N A;  2JRT A;  1PP8 F;  3ZMS A;  4XLN F;  2PI0 A;  5ICE A;  4ON0 A;  1ZGA A;  2HEO A;  2L4M A;  4Q4Z F;  4A0Z A;  3SZP A;  2W25 A;  1UB9 A;  2IP2 A;  1ZHF A;  2CO5 A;  4OU0 A;  3LST A;  4BNC A;  4RAZ A;  2EFP A;  5HS9 A;  4BXU A;  1XMK A;  5AON A;  4BYY A;  1ULY A;  3F72 A;  1Z7U A;  4A0X A;  1U78 A;  1R1T A;  1C0W A;  4A5N A;  4LB6 B;  1FWZ A;  1E17 A;  1FC3 A;  1D8K A;  3FF5 A;  4LB5 A;  1B1B A;  3J7A O;  1R1U A;  4M72 A;  3FX3 A;  2PMU A;  1KU9 A;  5K5Q A;  4H0E A;  3ULQ B;  3F8B A;  3IWF A;  5CVU A;  1DUX C;  3ABT A;  2BEO A;  2DBB A;  4XSZ F;  4U7D A;  2FE3 A;  2Y75 A;  1ZRF A;  3H3U A;  4KDP A;  5LHH A;  2HTJ A;  4S04 A;  4E70 A;  3NRV A;  4JQF A;  2CFX A;  2WTE A;  2ZKZ A;  1YG2 A;  3C1D A;  4Y15 A;  2ADU A;  2UWM A;  5A2Q K;  3DEU A;  3LQQ A;  4XLP F;  3V8L A;  2LKP A;  2F5E A;  3I64 A;  1U6G A;  4NB5 A;  4HX4 A;  3FMR A;  5E8G A;  1IRF A;  4CDG A;  2XKP A;  4BHC A;  3LA3 A;  3W6K B;  1J59 A;  5DDG A;  1FP1 D;  1FT9 A;  3BJO A;  4M73 A;  1TW2 A;  3KLO A;  1IN7 A;  1LDJ A;  4AIK A;  3LA2 A;  2RC4 A;  2GIV A;  1OYI A;  2ZJ2 A;  4CXF A;  2QZ8 A;  2W84 A;  4AD9 A;  1XN7 A;  1KGS A;  3GUD A;  4PZJ A;  4BHP A;  1S6L A;  3H92 A;  1Z6T A;  1B59 A;  2V79 A;  1RUO A;  1TBX A;  5F1R A;  2GXB A;  5TJJ A;  1IN5 A;  1T38 A;  4OIP F;  2GAU A;  3CDH A;  1HKQ A;  5AIP A;  3M8E A;  4A5M A;  3EUH A;  3VOD A;  1Z05 A;  4G7Z F;  1O3R A;  1J75 A;  4KUM A;  1P4X A;  1TLH B;  2IA1 A;  2K27 A;  3KET A;  2X4H A;  1KQ8 A;  5HLG A;  3K9T A;  3P7N A;  3KP5 A;  1OYW A;  4P55 A;  5E1W A;  3EYI A;  3HIF A;  2RQP A;  3TOA A;  3RYP A;  3IHU A;  4ENN A;  4HAM A;  1EH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...