4UNOA

Crystal structure of the ets domain of human etv5 in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords ETS TRANSLOCATION VARIANT 5
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4unoA00
4DQ2A 2FSWA 2R3SA 1EH6A 2IP2A 4MTDA 1F9NA 4GO1A 3V8KA 1QGPA 2P4WA 3DXJF 1UCRA 2F5DA 2VONA 3WGIA 2G7HA 4M72A 4ASNA 1B4AA 4U0WA 3K2ZA 1PUEE 2IA0A 4R8HA 5AONA 2JT1A 4CO8A 4KIGA 1NHAA 2HWVA 4CGZA 2IRFG 4N9HA 1SAXA 4LMYA 3E6MA 2W25A 4G6QA 1O7LA 1PP7U 2DK8A 3COAC 3J80Z 4ESJA 4RAYA 3REOA 2H27A 2JSCA 5DD4A 3HSEA 2D45A 3HRTA 3AAFA 5BS6A 1XMKA 1QZYA 3GFLA 3QAHA 2GXBA 1MZBA 3L7WA 2ZKZA 4E70A 2HYFA 1R00A 4L18B 2XV4S 1ZG3A 4BYYA 5KVRA 5JFRA 5BPIA 3T1BA 2H09A 2RDPA 5KK1A 2FBHA 3VEPA 5ERIA 2XAFA 3Q5FA 5DCMA 2YX4A 2MLGA 2PEXA 1TNTA 1GXQA 1TBXA 2ZCWA 3CJNA 4JBAA 5ILUA 3HTUA 4EJTA 2KJBA 1IN8A 2RC4A 3IL2A 1MGTA 1ZG1A 4HQEA 2ESNA 2LF7A 3I59B 1MJBA 3VFZA 1ODDA 2M30A 2RN7A 2WWYA 2WTEA 2B0LA 2WC2A 2NAZA 4UHTA 3GX4X 4I0AA 1RUOA 1P92A 2LNBA 2P6TA 2P5LC 3WTWC 4BHPA 4M74A 1FYLA 4OOIA 4GCVA 2O03A 3CUQA 4G8XA 5H6QA 2IA2A 3E5QA 2HKXA 3VODA 3FMRA 3TO9A 4Q4ZF 4GGGA 1KYWA 2RV8A 4FT8A 3WGHA 3LAJA 5K5QA 2PI0A 2GIVA 4LB6B 2NNYA 3F21A 3TKYA 1TLHB 5ICGA 1YIOA 4S05A 3J81K 3DKWA 4CHUA 3ECOA 2VN2A 2CSOA 1JE8A 1FT9A 3JTHA 5ILSA 1YW9A 3FF5A 4QWQA 1YW8A 5LEJA 2ZBKA 3J81Z 1XN7A 1LVAA 2RGVA 4CICA 5DCMB 3QU6A 5E18F 2FQ3A 2M87A 3WGGA 4IHSA 1FBSA 1T0FA 1HBXG 3F8FA 3DEUA 1AWCA 3LQRA 1I1SA 4Y15A 3FXRA 5JVTA 4JQFA 3ZMDA 4EJOA 3SZPA 4LJZF 1R5HA 3OV8A 3KZYA 4D0PA 1SD7A 1AOYA 3I5UA 2J5PA 1T2KA 2E1CA 3MFKA 3HHHA 2K02A 1FYKA 4OU0A 4EJVA 1O3TA 1P6RA 2HR3A 2Q2EA 2R7DA 3ZN0A 2H6BA 3MWMA 4ZZDA 4EJWA 2ZMEB 2HQRA 4U7BA 2MLKA 1YO5C 3SQNA 2YU3A 4HX8A 2VXZA 2QUFA 4LD5A 4M9XA 2JPBA 3KEQA 2VC0A 3WE3A 1XGSA 4LLLA 2QBYA 4ON0A 3SZTA 2Z33A 2FMLA 3D0SA 3IWZA 2FBKA 2VT3A 1BI1A 1LQ1A 3T5XA 3FXQA 3T8TA 5DDGA 4GYGA 4Q48A 3RI4A 3FMQA 3MQ0A 4B8XA 3JSOA 3ECHA 2DLLA 1DPUA 1ONVA 1UFMA 4NB5A 3CO6C 4EV0A 3HRSA 1TQIA 2YPRA 5LLQA 1K78A 2OBPA 4MQ9F 1MDMA 1P4WA 4AWXB 1D8JA 2UZKA 2JTVA 4XBFA 5CVVA 3V7CA 1SMYF 5HLIA 1LDDA 1ZG5A 2XROA 5CVJA 1ZREA 3L9FA 2V1UA 2P5KA 3I64A 4YFNF 5FB2A 1V3FA 3ABUA 5BQTA 3IC7A 1G6NA 3P9IA 1KU2A 2MA3A 3F8NA 1OR7A 1WKMA 2HYGD 2DI3A 2HTJA 2IA1A 3F8MA 5CVUA 3EYYA 4ZZLA 1UHMA 1BC7C 5A2QZ 2QQAA 3H92A 1E2XA 1SFXA 1D5VA 4BHBA 4I09A 5FFXA 2Y48A 2UXNA 2K86A 4G7HF 1W4MA 3T8RA 2MH9A 1R1TA 3KEOA 2BV6A 1YG2A 3C1DA 4LG0A 3BJ6A 4ETSA 2Q8KA 1BI2A 3PFIA 1XGMA 3HRUA 3B73A 3RYPA 2XHKA 1USSA 3G3ZA 4L9VA 5L3DA 1IXCA 1HXDA 4ENJA 3C3WA 1FYMA 2FOKA 5AIPA 1QPMA 5LGTA 1J7KA 1ON2A 4HF1A 4AD9A 1VTNC 2VE8A 2FF4A 2FXAA 1WSUA 1U5TC 4WF2A 4HW0A 3DFGA 5EEGA 2F5EA 3MCZA 4M9ZA 3WODF 5IT9Z 2ZJ2A 4IF4A 2DO7A 2HKOA 4K2EA 4KDPA 1U3EM 1ON1A 4IRHA 3KP5A 2OA4A 4HA8A 2VOPA 5HLHA 1MD0A 1FP1D 1ZRCA 4HF2A 1WWXA 4MEYF 1O7FA 2FA5A 3KFWX 4UNOA 1FX7A 3WU1B 2ZNYA 1HSJA 2A68F 4B09A 5TJJA 1KU3A 2BBYA 3P9KA 5DV5A 3C7JA 3ROUA 1YW7A 2XAGA 4GXOA 1TW3A 3GYHX 3N4MA 1LJ9A 1IRFA 1BN5A 2KIMA 4YIFA 1MJAA 3BOQA 4A0ZA 4HQMA 1IN7A 1CGPA 2P6SA 2XKOA 5D6FA 3VOEA 3SHFA 1W5SA 3WG9A 1BJAA 4A5MA 4OIPF 4NQWA 1R1VA 4PGGA 2YR2A 2FU4A 4CZZA 3DPLC 2QENA 2X4HA 1R5GA 4IVNA 4ZYDA 4QLCU 1R36A 4WCGA 1FZPB 5ILVA 5J8CA 2NNNA 1QQIA 4UV8A 3V7RA 2HGCA 2BEOA 1Z1DA 2QM3A 2KRFA 4WWCA 4S04A 3U2RA 3WE2A 2O8XA 5D4SA 2PBIA 2W57A 3VB2A 1BBYA 3O2PE 2O3FA 1E17A 3F8BA 2EFPA 1XGNA 1Z7UA 3V7SA 4O5VA 3M1EA 4MTEA 3LSTA 3RKYA 5E8GA 2AXLA 3BP8A 4GYIA 4DNCA 4PGHA 3HUGA 1KU9A 1G3SA 2L4MA 4P55A 1J2XA 4BQAA 3HYIA 4MHGA 3ZQ7A 4OMZA 4XLNF 2HDCA 5ICFA 5HLGA 3BJOA 1J9IA 4H0EA 1MKMA 3E5XA 3HRMA 1YYVA 1U5TB 2V6CA 3S2WA 2CO5A 4ZYHA 3W6KB 4FX4A 3O3KA 4Z2YA 4HLXA 4G94A 2K4JA 1HKSA 3BWGA 4U0YA 3R0JA 5LRRA 2Y75A 3JAMK 5FGMA 3LQQA 3K1PA 1ZRDA 2CWEA 4M9SA 5L3BA 3GVAA 5HDKA 5D5XB 2OD5A 3FX3A 5DD8A 3WTUC 2G9WA 5CLSA 2V1XA 2Z3YA 5CJ9A 3V8JA 1HSTA 2WV0A 1IF1A 1B9NA 1SD6A 1JHFA 5ICCA 4G7ZF 2LF8A 5K1YA 1KQ0A 4UV9A 4L0ZB 1STZA 3CDHA 2VE9A 1KQ9A 5IT3A 4PDKA 1J59A 2ZFWA 1O3SA 1LDKB 2ZXJA 5E1ZB 2MH2A 1DUXC 2PMHA 1JHHA 3ERED 1OYIA 4A6EA 4JK1X 3RKXA 4RAZA 1OMIA 4BHCA 3KCCA 3WTTC 2QBYB 5FD6A 2HTSA 3DPTA 2EV6A 2OU2A 4U88A 4CDGA 1Q1HA 5HDNA 2XAJA 4OIRF 3QP5A 3IKTA 3FM5A 2PJPA 3TOBA 3RKWA 2GA1A 3FMSA 3TDZC 2VBXA 3HOTA 5E1WA 3ZMSA 2A6HF 5E20A 1UB9A 2QZ8A 2VOOA 1O3RA 4Q47A 5DEQA 4EGZA 4IPAA 2CFXA 3KP6A 2C6YA 2Q0OA 4WK8F 3I71A 3EYIA 1A04A 4AIKA 1FBUA 5FD5A 1EV7A 4KIFA 5CVRA 1GHCA 1ZLKA 4KN7X 1T98A 1XSXA 3RPQA 5JR3A 1ULYA 4IHTA 1JGSA 1Z9CA 4CYDA 1U6GA 1ZLJA 2EA4A 3JTGA 2OZUA 1W7PB 2GWRA 1T38A 3HOSA 5LGNA 3H3ZA 2X0LA 3R60A 3K1NA 2EA2A 3ABTA 1FSEA 4ENMA 3U1DA 2OZ6A 5E1XA 3MZYA 1SFEA 5LEKA 3F8CA 2FNAA 3J7AO 3CUQC 4LG0B 4OIQF 1DP7P 1CF7A 4M71A 3IKVA 2GZWA 4HLYA 5LHIA 4FHTA 2QVOA 1W5TA 3EDPA 1RZ4A 4ZYGA 2ZMEA 3D5LA 5HS8A 1LB2A 4KT5C 3F22A 2XKPA 4MEXF 3BPXA 3K0LA 1IRGA 3HSRA 2JRTA 1HQCA 2D2WA 3DV8A 5E17F 4OINF 2XGXA 2O61A 1B59A 3I54A 4A2UA 3BPVA 1IAWA 4YFXF 4KIBA 1ZGAA 3CO7C 2Z99A 3QOPA 3EETA 4EM2A 1FWZA 3CUQB 2DPUA 3QU3A 3BDDA 3ZMTA 4BXUA 1KGSA 5J6XA 4I98B 2XIGA 3BZ6A 1L3LA 2A3SA 1XSDA 5F1RA 5H20A 1B6AA 1HW2A 2PQ8A 2A5YB 2UWMA 4AIHA 2VBWA 2F5FA 1GVJA 4IJAA 1EH7A 4WXHA 5FLXK 1S7OA 1REPC 4EM1A 4LLGF 2FRHA 3K9TA 4AIJA 3KP3A 4XSZF 2LKPA 5D8LB 2J5OA 3Q9VA 3ELKA 4P9FA 3WTZA 4WX9A 2A69F 3WTYC 1K79A 4A0XA 4XSXF 2XUBA 3RTRA 3QPHA 1ZGJA 2QWWA 3CUOA 2HZTA 3RYRA 3V8LA 4KUMA 1QNTA 2ESHA 1V4RA 3FZVA 2MD5A 5LHGA 3KP2A 3R4KA 1XCBA 3NEUA 1FP2A 2EFWA 2OQRA 3SFZA 5H6RA 1P2FA 3U9GA 4M6XA 1U8RA 3PQJA 3TQNA 1U2WA 1SD5A 3BY6A 1YQAA 3TO7A 1Z91A 2A07F 3HSFA 2G7UA 4F7ZA 1IXSB 1RUNA 1XDSA 4G7OF 2QQ9A 4EGYA 1ZYRF 1HKQA 3EQLF 1RNLA 2L3DA 4G9YA 5FFZA 3KETA 2DU9A 3P9CA 5HS9A 4IRGA 4RGSA 1QZZA 2CQKA 4OIOF 1IXRC 3B02A 2EWNA 4I2OA 1F4KA 1T39A 4I0BA 2EV5A 2E1NA 1J5YA 2CW0F 5D8KB 1R1UA 3FHZA 4PZJA 2IT0A 3WTSC 1YS7A 2DQLA 3FWEA 3GF2A 4WXCA 3MAJA 2Z9OA 5ED4A 3NQOA 5BPDA 3TDUC 3HHGA 2EJRA 5JI6A 1MDMB 2RKHA 1O3QA 3F6OA 3RJPA 1DDNA 1XSVA 1XDUA 2STTA 1S8NA 3LA2A 2NRAC 4RGXA 2HEOA 2M8EA 1D8KA 2XASA 1BOAA 3OOPA 3NRVA 4MQVA 2VODA 2L01A 2L02A 3E6CC 4HAMA 4KFCA 3KLNA 2W85A 4L5JA 3GFIA 1FBQA 4RGUA 5E8IA 4R79A 1OPCA 5HS7A 3KE2A 4HF0A 4MNUA 3GFMA 4HV5A 2PFBA 1PDNC 2KIUA 2DPDA 4PCQA 2RVCA 1R22A 2KKOA 3V4GA 1KYZA 1QBJA 3E3VA 2ZO4A 4M6YA 3ULQB 4Y13A 1FNNA 3LA7A 1EH8A 2QLZA 1XGOA 4AVPA 1Z6RA 4UXNA 4HBLA 1FPQA 1YTYA 1X3UA 2V79A 3ZPLA 3ZP5A 3M8EA 2IPQX 4KMFA 1TQPA 3E6DA 4L9NA 4XLPF 2BGCA 2COMA 2PG4A 3LWFA 5F64A 3WTVC 2HFHA 2E7XA 3E6BA 1S3JA 4A6DA 2ELHA 5L3EA 1DPRA 4OMYA 4UVBA 3TGNA 3C18A 1FSHA 4ENNA 3I59A 3H3UA 2Y0MA 5LRSA 3EUHA 2STWA 4L0YB 3CLOA 1QO0D 5HOOA 2ISZA 1IN4A 4Y17A 3MEXA 3F3XA 1R23A 4ESBA 4XRFA 1H9TA 5HDGA 2DAOA 1GXPA 2DW4A 6PAXA 5L3FA 2D1VA 4RB2C 3N97A 4I7HA 1K7AA 2OQGA 2GA2A 1XCVA 4UVCA 3F23A 4HYEA 2H6CA 3ISPA 1J0RA 1B1BA 3QPTA 2P7VB 2Z5UA 4CXFA 1WQ2A 1I5ZA 3WU0A 5DYMA 3ZN1A 3QRFF 4Q5SF 4R1HA 3O6BB 4EVIA 3R0AA 4LK1F 2M1BA 1H0MA 2VBZA 2A6EF 4LK0F 1FLIA 4ENKA 3I4PA 5LHHA 2HOEA 1KA8A 1SMTA 3GFJA 1TNSA 2IW5A 3P7NA 4P5OA 1ZHFA 1HW1A 3E5UA 2AS5F 2GAUA 1S6LA 3IRQA 1JXSA 1BIAA 3IWFA 2JZYA 3M8FA 1R58A 2CG4A 2DQRA 1TTYA 4O6JA 5L3GA 4U7DA 5ICEA 2RNJA 5D5UB 1Y0UA 2FBIA 2PMUA 2KJCA 1HW5A 1YS6A 2VT2A 3TOAA 1OYWA 1WI9A 3DF8A 1O57A 1C0WA 4A0YA 1ZARA 4RS8A 3T0YA 5D5WB 1FOKA 4G6DA 3L2CA 2DTRA 2EFOA 4BNCA 2P8TA 3JW4A 3DP7A 3LA3A 2YX7A 1T6SA 1RI7A 4IRIA 1P4XA 3FXUA 2MBFA 2FE3A 4P96A 2NS0A 2TDXA 1FY7A 5F6FA 1I27A 2M5WA 5DUIA 3KZZA 1K6OA 3K1MA 2IJLA 3RIRA 3GWZA 1YLFA 2P7CB 2XAQA 4L9JA 4L5IA 1Z6TA 3DQVC 3ZMUA 3KP4A 1LEBA 1ZH5A 2EV0A 4HDVA 2QQBA 2O6GE 4HV6A 2NYXA 2YSRA 4N9IA 5D5VB 1H9GA 3M7GA 2KIFA 4FX0A 1SFUA 2GQQA 5FLXZ 1I6XA 2FMYA 3GZ6A 1U5TA 1MJ9A 1IZ1A 2DBBA 3GLXA 2BE5F 4KA4A 4L9TA 2D1HA 3RPUA 5BMZA 2M45A 3RDIA 4ZH4F 2EFNA 1LDJA 1G3TA 4EQQA 4A12A 4EMSA 3GW2A 1KQ8A 4KICA 1LEAA 3J80K 5JHUA 4O3MA 4KYWA 1BI3A 1L0OC 4HX7A 3PQKA 1F1ZA 2XVCA 4YIIA 3GEZA 3IHUA 1KU7A 2GXGA 3QP6A 1P4AA 2IVMA 3K69A 2R7FA 3FM3A 2LSOA 3ZMVA 4LFUA 4LLNA 1RIOH 2ZNZA 3MZHA 4IXAA 3L00A 2ISYA 3TO6A 1BI0A 1F5TA 4HOBA 3HTSB 1UHWA 5EEHA 1IN5A 3R6SA 4I01A 3F72A 2W24A 3CTAA 1IUYA 4U0VA 1R7JA 1CF7B 2CGPA 4MGRA 2EB7A 5IT9K 2PLYA 4P9UA 2A61A 1USTA 1W7PD 2K7LA 5D6EA 2K4BA 2CYYA 1SD4A 1U78A 4LB5A 2K27A 2HQNA 2O0YA 3IRRA 1G3YA 5DUKA 3I53A 2BYVE 2FEZA 4KN4X 1OYYA 3GUDA 2EFQA 2L4AA 4KNYA 4HZFA 5FO5A 3R61A 4M73A 3BROA 1ZAOA 1TQMA 1ZN2A 2VBYA 1PP8F 2H94A 5K5RA 4HX4A 2UXXA 2ADUA 1S29A 5DCFA 1XD7A 5AIQA 3GO5A 4RB0A 1ZRFA 4EJUA 3KP7A 2HS5A 2XAHA 3KLOA 4RB1A 2RQPA 1IN6A 4TV7A 5CYVA 3Q9SA 3M9AA 1OKRA 4ESFA 5A2QK 4RB3C 4BAYA 2MC3A 1K78B 3ZMZA 4UUVA 5L3CA 1BIBA 5J8FA 4EM0B 5BOXA 3JSPA 1S7AA 3BJAA 1W7PA 5HVQC 2JPCA 2F2EA 2LDUA 3E97A 3ML6A 5LBQA 2FNPA 3LAPA 1I1GA 1XMAA 4ZYEA 3GZ5A 3LFKA 5TRDA 3HIFA 1J75A 2OAZA 4YFKF 1LNWA 2DFIA 2ETHA 1YFHA 3WTXC 2F5CA 5D4RA 2W84A 4RGRA 1BC8C 1BM9A 1IW7F 2DT5A 5LGUA 2VC1A 3G73A 1Z05A 1D3YA 4BH9A 2ACJA 2V1DA 4KMUX 1XB4A 4LGWA 5CVIA 5K5OA 1G4DA 3L09A 2EK5A 4WXDA 2QYOA 4N0BA 4YG2F 2E7WA 2PN6A 2P5VA 2DK5A 1TW2A 3JAMZ 4NHJA 1WRJA 2XRNA 4UVAA 3GXOA 3I58A 3I0TA 1G3WA 1HKTA 1FC3A 4I02A 2V9VA 3F6VA 3W6JB 3SXYA 2L54A 1B9MA 4HDUA 4A5NA
chains in the Genus database with same CATH superfamily
4RM3A 3OYDA 2R0QC 1BR4A 1QHHD 1VZ0A 4DQ2A 2ELJA 1H8AC 4A3KJ 4CZCA 3GTOJ 2FSWA 2R3SA 1EH6A 2IP2A 4MTDA 2F4IA 3RPUD 1F9NA 3DLLF 4GO1A 2KDOA 3FXOA 3V8KA 5EDNA 4V19K 3KYDB 1QGPA 2P4WA 3DXJF 1UCRA 2F5DA 3AG4H 5EZHA 2VONA 4XL9A 3WGIA 1GLNA 2G7HA 4M72A 1R9TJ 5GTHC 3NWTA 4ASNA 1B4AA 3MKLA 4U0WA 2WAFA 2O5RA 4ZDLA 1TWGJ 3K2ZA 1PUEE 1R5ID 3F0CA 1FOXA 2IA0A 4Y33A 3Q0UA 4R8HA 5AONA 4XR6A 2JT1A 4LOCA 4CO8A 4KIGA 4B43A 1HOMA 2BZTA 1NHAA 2HWVA 3HZJA 4CGZA 1JTXA 2BY2A 4OAYA 4N9HA 2IRFG 1SAXA 1X3WB 1YE9A 1YITI 4LMYA 2L7MP 2W25A 3E6MA 3ZOBA 1I39A 1HC8A 4G6QA 5FKMA 1O7LA 1X1BA 1PP7U 2PJRA 2DK8A 3COAC 4V2FA 3J80Z 4E6KG 2LFBA 4ESJA 4RAYA 3REOA 2H27A 2R7XA 1RR8C 2JSCA 3TP0A 5DD4A 2MFZA 3HSEA 2D45A 4XONA 1IUFA 3H35A 3HRTA 3Q0WA 5KAFC 5BS6A 3AAFA 1XMKA 3KEYA 2K9QA 1QZYA 1SVLA 3GFLA 3QAHA 2GXBA 1MZBA 3L7WA 2ZKZA 3RSNA 4E70A 2CMPA 1RC9A 2HYFA 2WA0A 3O8GA 2MSYA 1R00A 4CCJA 1YJNI 4L18B 2OC6A 2XV4S 1ZG3A 4BYYA 3S2DJ 2JSPA 3JRDA 5KVRA 2AHQA 5JFRA 2X85A 5BPIA 3T1BA 3OYEA 2R5ZB 2H09A 5FRMA 2ZXIA 2RDPA 5KK1A 2FBHA 2VQCA 3VEPA 1PUFB 5ERIA 3S1QJ 2F4MB 2XAFA 3L1PA 5JLWA 5DCMA 3Q5FA 2YX4A 3ZGKA 2MLGA 4D9JA 1PVEA 3RCOA 2PEXA 1TNTA 2ZSHB 5C4XJ 1GXQA 1TBXA 2ZCWA 2V1NA 3CJNA 1SANA 4JBAA 5ILUA 4IHVA 4NQWB 4A3BJ 3ABLH 5HLTA 3HTUA 1ZELA 4EJTA 2KJBA 1IN8A 2RC4A 2VKHA 3IL2A 1MGTA 1ZR4A 1ZG1A 4II3A 4HNVA 4HQEA 2O8KA 2ESNA 4RMNA 2XF6A 2K85A 2LF7A 3I59B 2CUEA 1MJBA 3VFZA 1ODDA 5IP6A 2M30A 2RN7A 3A0BC 3LOCA 2WWYA 2DDBA 5C44J 2WTEA 1JJ8C 2B0LA 2WC2A 4PFPA 2NAZA 4IO9F 4UHTA 3HOUJ 4E7IA 1LFUP 3A4CA 3GX4X 4I0AA 2CV0A 4HNTA 4BACA 1RUOA 1P92A 1AHDP 2LNBA 2P6TA 2P5LC 3KYCB 1MNMC 3WTWC 4XKWA 3BR6A 2CS3A 2CRGA 2LLKA 4BHPA 3GTKJ 1DU0A 5F27A 4M74A 1FYLA 2LY2A 4OOIA 4GCVA 2O03A 3CUQA 4G8XA 3I9V2 5H6QA 2IA2A 1UG2A 3K70D 1E3HA 3E5QA 4JX6A 2HKXA 3VODA 4MLOA 4QIWN 3FMRA 3TO9A 4Q4ZF 2NVUB 2X6OA 4GGGA 3UKGA 3GTMJ 2XGCA 4C3HJ 1KYWA 1WI3A 2IGMA 3ZQHA 1DGRM 4ZTJA 2RV8A 2I5UA 4FT8A 3WGHA 3LAJA 1ACIA 5K5QA 3OYGA 2PI0A 2GIVA 4LB6B 2NNYA 3F21A 5B1AH 3TKYA 1VQOI 1TLHB 5ICGA 1YIOA 4S05A 2EH3A 5E3MA 2HYJA 3J81K 3DKWA 3IUOA 4CHUA 2FJ1A 2K9MA 3ECOA 4ZC3A 4BBSJ 2H8WA 2VN2A 2GOXB 2CSOA 3G1LA 3WHBA 1JE8A 4CH7A 3KIOA 4DYCA 4Z6YA 4UUSB 1FT9A 2OV7A 3JTHA 1TP4A 2QQ8A 5ILSA 1YW9A 5TGTA 3FF5A 4F3QA 4A3IJ 3KZIC 5F08A 1YJ9I 2RREA 1MSEC 4M3DA 4QWQA 1YW8A 4BXFA 5LEJA 2ZBKA 3J81Z 2BXZA 1XN7A 3GTGJ 1LVAA 3LL7A 1Z3YA 2W48A 3BTCA 1YHQI 2RGVA 4CICA 1P9QC 1F43A 5DCMB 2KP6A 4PJNA 2X1CA 1U9OA 1HLVA 3QU6A 4B48A 5E18F 2FQ3A 2M87A 3WGGA 1WJBA 4PSXA 4IHSA 2LC2A 1FBSA 1T0FA 1HBXG 3Q0VA 3F8FA 3DEUA 4BS9A 4AVZA 3LQRA 1AWCA 1I1SA 4Y15A 3FXRA 4I99C 5JVTA 4F52A 1WVRA 1MH4A 2R92J 5F0HA 4JQFA 1Y56A 3K70C 2R7UA 4BEHA 1FTZA 3ZMDA 4EJOA 2WY7Q 3SZPA 4LJZF 4MFDA 2PMZA 4XLAA 1R5HA 4RAGA 3OV8A 3KZYA 4PUSA 4Y52J 3CCUI 1VI0A 4D0PA 1SD7A 2VJJA 1AOYA 3I5UA 1D5YA 2J5PA 3E1SA 2NXNB 1T2KA 2E1CA 3PL8A 2MGQA 3MFKA 1S7EA 3HHHA 2K02A 1FYKA 2VKEA 4OU0A 1JT0A 2L0KA 4EJVA 1O3TA 2KL4A 1Y8RB 1UHSA 1A6QA 1P6RA 2HR3A 2Q2EA 2R7DA 2TCTA 3ZN0A 2H6BA 3MWMA 2X48A 4ZZDA 1IJWC 1TWHJ 4EJWA 5GAGJ 2ZMEB 1GV2A 1JTYA 2HQRA 3U1KA 2NS7A 4U7BA 2MLKA 3I55I 2MW8A 2M34A 3SQNA 4BY7J 1YO5C 2YU3A 4AYBN 1DP3A 4HX8A 2VXZA 2QUFA 4LD5A 3TW6A 1JKOC 2XB0X 2E2IJ 1GV5A 4M9XA 4X1EA 3H3VK 2JPBA 3BZKA 3KEQA 2VC0A 3WE3A 1XGSA 3MKYB 2VQGA 2CW8A 4LLLA 2EIMH 2QBYA 4ON0A 3SZTA 2Z33A 2FMLA 3D0SA 3IWZA 4IL6C 5EEAA 2FBKA 2VT3A 5J40A 2XGEA 1BI1A 1LQ1A 2LBFB 3T5XA 3FXQA 1R49A 5FKLA 3T8TA 2GIZA 5DDGA 2JRMA 4QTRA 4GYGA 4Q48A 3RI4A 2LY9A 3FMQA 3MQ0A 4B8XA 3JSOA 3ECHA 2DLLA 4DW6A 2XF7A 2RAEA 1DPUA 1ONVA 1UFMA 3F9KA 3MN2A 4NB5A 3I56I 3CO6C 3K4CA 1A5JA 4EV0A 3HRSA 3ASNH 1TQIA 2YPRA 5LLQA 2ECBA 1D1BA 3HPGA 1K78A 4CYCB 2OBPA 3Q3SA 3VYRB 4MQ9F 1K83J 4E4HA 3JRCA 3S2HJ 1MMDA 3S14J 1MDMA 1P4WA 2G0EA 2LMDA 2M3AA 4MFEA 4AWXB 2LY1A 1D8JA 2UZKA 2JTVA 4XBFA 2M9HA 5CVVA 3OL3A 3MKZA 1RRJA 1NH3A 3V7CA 2KMUA 1SMYF 5HLIA 2NVXJ 1FMWA 1LDDA 1ZG5A 2XROA 5CVJA 4RAFA 1ZREA 2WADA 3L9FA 2V1UA 2P5KA 3I64A 4YFNF 5FB2A 1V3FA 2B9SA 1RETA 3ABUA 3H9GA 5BQTA 3HL2A 2R5YA 4BJTA 3IC7A 1G6NA 3P9IA 1KU2A 4B4CA 2MA3A 1T08B 4FE4A 3F8NA 5JLXA 1OR7A 2DJNA 4F55A 1WKMA 1TWAJ 2EZHA 2HYGD 2DI3A 1D0ZA 2OTJI 2BY3A 2HTJA 2IA1A 3F8MA 3QYFA 5CVUA 3OYMA 2VUMJ 5B3SH 5EG0A 1P7JA 3AG1H 3EYYA 4ZZLA 1UHMA 2B7EA 1BC7C 3QPLA 2QCOA 3C2HA 2DA2A 5A2QZ 2QQAA 4XKCA 3H92A 1QRYA 1E2XA 1SFXA 3MD2A 1D5VA 4BHBA 4I09A 1ETYA 4EEFG 5FFXA 2Y48A 2UXNA 3JRAA 2K86A 4N4OB 1CQTA 4G7HF 1W4MA 2NVYJ 3T8RA 1E3OC 3BG5A 3FK7A 2MH9A 3L2UA 5CKTA 2VJIA 1OCTC 3CDIA 1R1TA 2MC4A 3KEOA 2BV6A 1YG2A 3C1DA 2HOTA 1EA3A 4Y7NJ 3M1CA 4LG0A 2JWTA 3BJ6A 4ETSA 2Q8KA 1BI2A 3PFIA 4E7SA 1XGMA 4E7KA 2W82A 2VXDA 3HRUA 3PJRA 3B73A 3CZ6A 3RYPA 1V5EA 4HG2A 2XHKA 1USSA 2UV1A 2R7SA 3G3ZA 4L9VA 1Z21A 5L3DA 3X2QH 2V26A 1IXCA 1HXDA 3DKYA 2DOAA 3C3WA 4ENJA 2E1MB 4XOTA 4UY8I 1FYMA 4M6VA 2HDWA 4J01A 2ZFUA 1U9NA 5LFAA 4XRSA 5B66C 2A6TA 2FOKA 5AIPA 2EQRA 5TISC 2LTPA 1QPMA 5GP9A 1GT0C 1Z3XA 2FQ4A 2Y9YA 4CCKA 5IYBJ 2VIXA 5LGTA 2ECCA 3TBIA 1J7KA 1ON2A 3HOVJ 4HF1A 4AD9A 3OYFA 3NAUA 3L2VA 3QPSA 3FXMA 1VTNC 2VE8A 2FF4A 3TW7A 4ZJZA 2FXAA 1WSUA 1A35A 1U5TC 4WF2A 4HW0A 3AL0C 3DFGA 5EEGA 4BJ6C 1XG1A 1X58A 3OYHA 1D1AA 2F5EA 4EATA 3MCZA 4M9ZA 3WODF 5IT9Z 2ZJ2A 4IF4A 3DBRB 2Y31A 1K61A 2DO7A 5EGOA 2JVGA 4PJJA 4E7LA 2HKOA 1M1EB 1YOVB 3SEZA 4K2EA 1A31A 4KDPA 1U3EM 1ON1A 4IRHA 3KP5A 2LRDA 2OA4A 2HU9A 3HUGB 4HA8A 3S17J 1JJ6C 2VOPA 4KJZA 1LPQA 5F0CA 5HLHA 1VFCA 2R7ZJ 1MD0A 1UG0A 4PSWA 3ZCOA 1FP1D 1ZRCA 4HF2A 1TWFJ 4OAZA 1WWXA 3G2BA 4IQ4A 3EUHC 4MEYF 1O7FA 1ETQA 2FA5A 1T8IA 3KFWX 2R7TA 4UNOA 4A3DJ 1FX7A 4RM2A 3WU1B 2ZNYA 4I6ZA 2WB1N 3DU5A 5DTDA 4JOMA 2WAEA 2JA5J 1HSJA 2A68F 2HQAA 4B09A 5TJJA 1O4XA 3RZOJ 3FK6A 1UZCA 1KU3A 2BBYA 4NBQA 3P9KA 2ELKA 5DV5A 2Y9ZA 3C7JA 3ROUA 1YW7A 1KONA 3A1YA 2XAGA 4GXOA 1TW3A 1D1CA 2WAQN 1LJ9A 1IRFA 1BN5A 2KIMA 2L7KA 3KX2A 4F91B 4YIFA 1MJAA 5F0FA 3J7YJ 2R5ZA 1F36A 3BOQA 3M3YJ 4A0ZA 2D5VA 4HQMA 3PNVA 3DCFA 1IN7A 3K4MA 1U0JA 5CQEA 2R7RA 4IKFA 1CGPA 2P6SA 4GFBA 2XKOA 5D6FA 3VOEA 4FE7A 3SHFA 4X6AJ 1OFCX 4IHXA 1W5SA 2HVQA 2EIKH 1ETXA 1SVOA 1WH7A 3WG9A 1Y1WJ 1B72B 1BJAA 3GTLJ 2E36A 3G1OA 3M8JA 4LIVA 4A5MA 1WPKA 4OIPF 4NQWA 4D5FA 4XKVA 1ETWA 1R1VA 2CQ7A 2YR2A 4PGGA 2FU4A 1X4OA 4CZZA 3DPLC 2QENA 5CPRB 3CDLA 2X4HA 1R5GA 4IVNA 4ZYDA 2BHZA 1R36A 4QLCU 3H9QA 2MD0A 4WCGA 1FZPB 4BY1J 2R93J 5ILVA 2V9KA 5J8CA 2NNNA 2XB5A 1QQIA 4UV8A 3WG7H 3H5RA 3V7RA 2DMQA 3JRHA 2QSHX 3FXJA 2HGCA 2BEOA 1Z1DA 1BOBA 5HNFA 3BZCA 4XM3A 2QM3A 1MNEA 2ZJQF 3VYTB 4NNJA 4BL0B 3G4SI 2KRFA 1IRZA 4WWCA 2COBA 2LP0A 2L2OA 2M8GX 3K2AA 3U2RA 3WE2A 4S04A 2LD5A 2GBYA 3OYCA 3LSPA 2BW3B 2O8XA 5FKKA 3W2VA 5D4SA 2PBIA 1PJRA 2R7QA 2W57A 3VB2A 1IRXA 1BBYA 3O2PE 2IXSA 1OCPA 2A05A 2O3FA 1IC8A 1E17A 1SFKA 1RR7A 3F8BA 2EFPA 2DMTA 4FISA 1XGNA 3S3OA 3OYBA 1Z7UA 3V7SA 4O5VA 3M1EA 4MTEA 1MBFA 4PFOA 2CJJA 3LSTA 3RKYA 5E8GA 2AXLA 3CP2A 3BP8A 3JREA 4GYIA 4DNCA 5C4JJ 1VQNI 5LD2C 1S9HA 4PGHA 3HUGA 1KU9A 3QQAA 1G3SA 2L4MA 1TT5B 4P55A 1J2XA 4XQFA 3LFUA 4BQAA 3HYIA 4H4KC 2WY8Q 4MHGA 3ZQ7A 2DA7A 1XTAA 3BQZA 4OMZA 4XLNF 4S0HB 2HDCA 5ICFA 5HLGA 3BJOA 1J9IA 4H0EA 2KIQA 1MKMA 3E5XA 3HRMA 1R4NB 1YYVA 1LFBA 2BY0A 2L7ZA 4AYBA 2QEXI 1U5TB 1ETVA 4JX4A 4PK4A 1QA6A 1FEXA 4RBOA 2V6CA 5IOZA 1Z77A 1DQUA 2E2HJ 3K4KA 1BR1A 3EUAA 3S2WA 2CO5A 1KZHA 4ZYHA 3W6KB 4FX4A 1YX3A 3O3KA 4Z2YA 2K3FA 2ZMEC 1AKHA 4HLXA 4G94A 1N25A 1ORKA 2K4JA 1T95A 3CC2I 4F93B 4YRVA 1HKSA 3RQ4A 3BWGA 4U0YA 2X6YA 3R0JA 2CW7A 2DT7B 1MMAA 5LRRA 3ZQLA 4ZDOA 2Y75A 4XLEA 2QF7A 5FGMA 3JAMK 3LQQA 3K1PA 1SC7A 1YI2I 1ZRDA 3OYIA 3OWTA 3FKJA 2CWEA 4M9SA 5L3BA 3CCVI 2EINH 3GVAA 5HDKA 5D5XB 4XIDA 1MMGA 2OD5A 3FX3A 4PJLA 1V5GA 2OTLI 4II2A 5DD8A 5FLVA 2M4GA 3JR9A 2LKXA 3WTUC 2W00A 2G9WA 5CLSA 5EJCA 2V1XA 1TL8A 2KFDA 4BEHB 2Z3YA 2KZVA 1QPIA 1WJFA 1W36D 4MIMA 5CJ9A 1ETKA 2DMNA 3V8JA 1HSTA 2WV0A 1IF1A 1Z67A 1B9NA 4XRMA 1SD6A 1IGNA 1JHFA 1R4MB 5ICCA 4HEA2 5M3MJ 4G7ZF 2LF8A 5K1YA 3MKWB 3O8HA 1KQ0A 2EZIA 1JKRC 4ZDPA 1HCRA 4UV9A 3TMOA 4L0ZB 1STZA 5J1RA 3CDHA 2QSFX 4DOZA 1APLC 2Q2EB 2VE9A 1KQ9A 5IT3A 4PDKA 4QPQA 3C2BA 1J59A 3A0HC 3BTLA 2ZFWA 5DM6F 1O3SA 1VQ4I 3AG3H 1LDKB 2ZXJA 3CESA 5E1ZB 2MH2A 1V55H 1DUXC 4HPQA 3UNGC 1ETOA 1JUMA 2PMHA 5IYDJ 1JHHA 2AXTC 4C2TA 3ZQGA 1SEUA 3CCRI 3ERED 3ZRGA 4ABZA 1OYIA 2L5QA 4HSRA 4BE2A 4A6EA 4BU2A 4JK1X 3RKXA 4RAZA 1OMIA 3ZR8X 2OF7A 4BHCA 3BG7A 3BTIA 3KCCA 3WTTC 1ENHA 4C2UA 4BJ5C 3PIOF 2QBYB 4YIRX 3HOXJ 5FD6A 2HTSA 3CJQB 3DPTA 4L5EA 2EV6A 2OU2A 3GLLA 4U88A 2BVLA 1Y6IA 4CDGA 2F6CA 1Q1HA 1IDZA 4CA0A 2LBFA 5HDNA 2XAJA 3A01B 3E7LA 4NUBA 3PUBA 2JJ7A 4OIRF 1DU6A 3QP5A 3IKTA 1V5FA 2DFHA 4A3MJ 2WB1A 3FM5A 2PJPA 4KISA 4KITB 4BXXJ 1MMNA 1R6RA 2DT6A 3RKWA 3TOBA 1OCOH 1G8XA 2XRLA 2GA1A 3FMSA 3LSGA 2XAUA 3TDZC 4FTHA 2VBXA 4CUGA 3HOTA 5E1WA 2VJ4A 3ZMSA 5B5EC 1Y39A 2DMPA 3FDYA 2A6HF 3JCUC 2QKMB 5E20A 4DBQA 1UB9A 3OYAA 3A02A 2QZ8A 5JHFA 2VOOA 2VPRA 1O3RA 3I4NJ 4Q47A 5DEQA 2UUZA 4EGZA 4IPAA 2CFXA 3KP6A 2C6YA 2K9NA 2Q0OA 1WGXA 1Z0XA 4M3EA 4WK8F 3I71A 1IDYA 2CU7A 3CCEI 5GTIC 1T0FC 3EYIA 1A04A 1LUJB 4AIKA 2IGNA 3BR1A 1FBUA 5J47A 2E1OA 5FD5A 4E7ZA 2DA5A 1EV7A 2H8RA 4KIFA 2HVSA 2L7FP 5CVRA 1GHCA 2DA4A 3OIQA 1IV8A 5IP9J 3CCLI 1ZLKA 4BDYA 1RKWA 4KN7X 1T98A 1XSXA 3RPQA 5JR3A 1ULYA 2YU9J 4IHTA 3S93A 1JGSA 1OR7C 3OOUA 1Z9CA 2IS2A 3DKXA 4CYDA 1X2NA 2LR8A 2VL8A 2E1MC 3S3NA 2KQRA 2KLOA 3RQIA 1U6GA 4A3CJ 1ITYA 1ZLJA 1JUSA 2EA4A 4M3BA 3JTGA 1YRNA 4OWRB 2OZUA 1MBEA 1W7PB 2GWRA 1JUPA 1T38A 3HOSA 1YIJI 2I8DA 3H3ZA 5LGNA 2GM4A 1K6YA 2X0LA 3CC7I 2IGKA 3R60A 1ZQ3P 3K1NA 2EA2A 3EPZA 3ABTA 1FSEA 1GUUA 3HXLA 3FXLA 3PM1A 4ENMA 3LSRA 3U1DA 2ZXHA 2OZ6A 2DA1A 5E1XA 3MZYA 1SFEA 2Y30A 5LEKA 1PUFA 3F8CA 1E3PA 2FNAA 3N4MA 1MBJA 2CUJA 4A3JJ 2B63J 3OIPA 3J7AO 3CUQC 4PJMA 3FIWA 4LG0B 1IG7A 4DJAA 3D5RC 4BDZA 2GOMA 2X1DA 1XS9A 1WJ5A 1ZGWA 4OIQF 1DP7P 3K4BA 1CF7A 4M71A 1QU3A 1IO2A 3IKVA 1FMVA 3W2AA 2GZWA 3NWSA 1Y1VJ 4HLYA 1LVKA 4NC6A 3K4JA 1EJ9A 5LHIA 4A93J 3OSFA 2JA2A 2QVOA 3CF2A 4FHTA 1S72I 1W5TA 2R7WA 5FKNA 3EDPA 1RZ4A 2K9SA 2E5NA 4ZYGA 3J7AY 3ZQIA 2ZMEA 1BJZA 3D5LA 5HS8A 1LB2A 4KT5C 3F22A 2XKPA 4MEXF 3BPXA 3K0LA 2X1EA 2DYRH 1IRGA 3HSRA 2JRTA 1HQCA 1IV6A 2D2WA 3DV8A 4CCLA 4RLFA 3H1CA 5E17F 2ID3A 4OINF 2XGXA 2O61A 2QKLB 4I76A 4XNFA 5GPCA 4A3FJ 1B59A 3I54A 4A2UA 3H5NA 3BPVA 1IAWA 4YFXF 1U8BA 1MH3A 4KIBA 2X51A 4LITA 1Y0NA 1ZGAA 1NK3P 2DXIA 5J1YA 3CO7C 3KYLA 2Z99A 3QOPA 3BR2A 3EETA 3SEQA 4EM2A 1FWZA 2ZSIB 3CUQB 2DDAA 2RQQA 1XMXA 4A3EJ 2DPUA 3QU3A 1BW5A 1EF4A 1JI8A 1P7IA 3BDDA 3ZMTA 4C3JJ 4BXUA 1KGSA 3HKZA 5J6XA 2LG4A 1HDPA 4I98B 3DBHB 2JN6A 3ZQFA 5E3NA 1YJWI 2XIGA 2VJ5A 3BZ6A 1RESA 3D5SC 4XN3A 1L3LA 2A3SA 3FISA 1XSDA 3DTIA 5F1RA 4J19A 5H20A 1B6AA 1HW2A 3BT9A 3DPUA 5M5YJ 2PQ8A 2A5YB 4UB6C 4HSTA 2UWMA 5BNGA 3S8PA 4E7JA 2IS1A 2K9LA 4IEJA 1BR2A 2VBWA 4AIHA 2F5FA 5E3LA 1GVJA 1YRNB 3I3LA 4IJAA 1EH7A 4WXHA 5FLXK 4XN0A 1S7OA 2DYSH 9ANTA 2E5ZA 4M3FA 1REPC 4EM1A 4LLGF 2FRHA 4GRIA 3K9TA 4AIJA 4IHWA 3KP3A 4ZTFA 4B3XA 1WJEA 4XSZF 2X6XA 5FJ8J 1VQ5I 2LKPA 3H9JA 5D8LB 2J5OA 3Q9VA 3VPRA 3ELKA 4P9FA 3MZ8A 3WTZA 4WX9A 2A69F 4BQNA 3HBLA 3WTYC 4PJ0C 4A0XA 4XSXF 1K79A 2XUBA 2Y0SA 3RTRA 1T33A 3QPHA 4IQJA 1WFXA 1ZGJA 1VQPI 3JRIA 3IH2A 2HPIA 2QWWA 3CUOA 2HZTA 3RYRA 1OCCH 3LMMA 3TEDA 3V8LA 4KUMA 1QNTA 2ESHA 5EYRA 3U21A 1V4RA 3FZVA 3FBIB 2MD5A 5C3EJ 5LHGA 3KP2A 3R4KA 1XCBA 2RNGA 3NEUA 3VWBA 1FP2A 2EBIA 2VQLA 2EFWA 1HDDC 2H1LA 2OQRA 4XKBA 3SFZA 3LSMA 5H6RA 4JYKA 4NC8A 3GTPJ 1P2FA 3U9GA 5F1JA 2JA6J 4M6XA 4B1RA 1U8RA 3A2KA 2MG4A 1X4PA 3PQJA 3TQNA 3S1RJ 4Y3OA 1U2WA 1SD5A 2I10A 2EIJH 3ZQCA 3BY6A 2IBDA 2KPMA 1YQAA 3TO7A 1Z91A 2A07F 3HSFA 3BTJA 2G7UA 4F7ZA 1IXSB 3SDGA 4A3LJ 1RUNA 4YELA 1XDSA 1H88C 4G7OF 4JP0A 1N75A 2QQ9A 4EGYA 3OS2A 1VQMI 1ZYRF 4XLHA 1HKQA 3EQLF 2A5WA 2DA3A 5FLMJ 1RNLA 4HNUA 5M5XJ 2L3DA 3DBLB 4G9YA 5FFZA 3KETA 2DU9A 3P9CA 5IPAA 1VQ9I 5HS9A 4IRGA 4RGSA 1QZZA 2Q1ZB 4G12A 2CQKA 4OIOF 3PSIA 1IXRC 2W4SA 5CQGA 2ZXWH 3B02A 2EWNA 4I2OA 5FROA 1K4SA 1F4KA 1T56A 1VQ7I 1T39A 4I0BA 2EV5A 2LH9A 2E1NA 4W97A 1J5YA 2CW0F 2Y69H 5B1BH 5D8KB 1R1UA 3FHZA 4PZJA 2IT0A 3HC7A 1QVUA 3WTSC 1YS7A 2DQLA 2HQ5A 3FWEA 3GF2A 4WXCA 5J4YA 2BXYA 2EILH 3J7ZI 4UB8C 2EZLA 3MAJA 2Z9OA 5ED4A 1LE8A 3NQOA 5BPDA 4BQOA 3TDUC 2IEKA 3HHGA 4B3AA 2XF5A 2EJRA 5JI6A 1MDMB 2RKHA 1GVDA 1O3QA 3F6OA 3RJPA 2F48A 3W2WA 3OS0A 1DDNA 1MNDA 1XSVA 1X1DA 2KHMA 3IH4A 1XDUA 4F92B 2STTA 1S8NA 3KPHA 3LA2A 2NRAC 4RGXA 2HEOA 2M8EA 1D8KA 2XASA 1BOAA 3OOPA 1J09A 3NRVA 4MQVA 2VODA 3OYKA 3LSJA 5K7ZA 2L01A 2MABA 2FUG2 2CFOA 2L02A 3OL4A 4HAMA 3E6CC 4FASD 4JX5A 3E0JB 4KFCA 3OYJA 1YX5A 2VB6A 3KLNA 2W85A 4L5JA 2P81A 3BC8A 3GFIA 1FBQA 4RGUA 2PX9A 2AQFA 5E8IA 4R79A 3AG2H 1OPCA 5HS7A 3KE2A 2LYCA 4HF0A 2WBMA 4MNUA 4DZJA 3CMAI 3GFMA 1JKQC 4HV5A 2PFBA 1PDNC 4BQQA 2KIUA 2DPDA 1B8IA 2DA6A 4CCMA 5EG0B 4PCQA 2RVCA 4D7NA 5M5WJ 1R22A 1ZR2A 2KKOA 3V4GA 1KYZA 5DM7F 1QBJA 3E3VA 2ZO4A 4M6YA 2CUZA 3CJTB 3ULQB 4NC7A 4DIQA 1Y8QB 4Y13A 1FNNA 3LA7A 3V42A 5EZGA 2YS9A 3S32A 1EH8A 2QLZA 5FRNA 2OPTA 1XGOA 3HGGA 4AVPA 1Z6RA 4UXNA 4HBLA 2ME6A 1FPQA 3CLQA 1YTYA 1X3UA 3M4OJ 2TRTA 2V4JC 2V79A 3ZPLA 4C3IJ 3ZP5A 2E19A 3SDBA 3M8EA 2XPWA 3QWLA 1JGGA 2IPQX 4KMFA 1TQPA 3E6DA 2NVTJ 3GTQJ 3SJMA 2VQHA 4J00A 4L9NA 4XLPF 1OLTA 2BGCA 3S16J 2COMA 2PG4A 2EZKA 3LSKA 3QYBA 3LWFA 5F64A 2L9NA 3HB9A 3WTVC 2HFHA 2E7XA 1VNDA 3E6BA 4MO7A 1S3JA 4A6DA 2ELHA 5GPAA 3MVPA 3H0DA 2LREA 5L3EA 1Q1VA 1DPRA 1MBKA 2L9RA 4OMYA 2KISA 4AUXA 1XX5A 4ITVA 4UVBA 2JA8J 3TGNA 3C18A 2JQ7A 1FSHA 2NS8A 2XPUA 4ENNA 3I59A 5HNHA 3H3UA 2Y0MA 3A01A 5LRSA 1G59A 2NOJB 3H0GJ 3CMEI 3EUHA 1FIPA 4IZZA 2L9SA 2STWA 4L0YB 3HM5A 3CLOA 1QO0D 5HOOA 1IN4A 2ISZA 4Y17A 3GTJJ 3MEXA 3F3XA 5DS9A 1R23A 2CH0A 4ESBA 4XRFA 4LG3A 1H9TA 5HDGA 2DAOA 1GXPA 2M7BA 2DW4A 2FX0A 2YUSA 3LNQA 3G71I 6PAXA 4BE1A 3CQZJ 5KHDA 3VYUB 2PMZN 5L3FA 2D1VA 3IV5A 4RB2C 3HGYA 3N97A 1WJAA 4I7HA 1K7AA 2OQGA 1N78A 1RPWA 2GA2A 1UAAA 1DGWY 1XCVA 4UVCA 3F23A 4HYEA 2H6CA 3ISPA 3L2RA 1J0RA 2GXAA 1B1BA 3ABMH 3H36A 3QPTA 3CMMA 2M7AA 2P7VB 2KZGA 2Z5UA 4CXFA 1WQ2A 1I5ZA 2WAQA 3S1MJ 1AA7A 2FD5A 3WU0A 3CC4I 2HXOA 2ZB9A 2V9PA 3BCAA 4AU7A 5DYMA 3ZN1A 3DU6A 3QRFF 1ZK8A 4Q5SF 3MMYB 4R1HA 3O6BB 1VQKI 2QSGX 1LFPA 5GAEJ 3DWLE 4EVIA 3R0AA 4LK1F 2M1BA 1H0MA 2VBZA 1NK2P 2A6EF 2WV1A 4LK0F 1FLIA 4ENKA 1MW7A 3I4PA 2HZDA 5IP7J 4QSHA 3S3MA 5LHHA 4CYCA 2HOEA 3BR3A 1KA8A 3GBGA 1TWCJ 3BG9A 1SMTA 3GFJA 3B6CA 3GMEA 1TNSA 2IW5A 1PYVA 3P7NA 2Z1DA 3AL0B 4P5OA 1UELB 1ZHFA 1HW1A 3GYHX 3E5UA 1FOYA 2AS5F 3QOEA 2GAUA 3VDXA 1S6LA 2Y2ZA 5F04A 3IRQA 1NG7A 2JVHA 1JXSA 1BIAA 3DEEA 2M0CA 3IWFA 2N8GA 2JZYA 3M8FA 5KCMA 3VYSB 1R58A 2CG4A 2DQRA 3W3CA 1TTYA 1TZLA 4O6JA 4AIDA 3QYEA 2F4OB 3OR2C 5L3GA 4U7DA 1NG6A 3CCJI 1QHGA 1N77A 2PJRB 5ICEA 2RNJA 5H2FC 2HOAA 3SFIA 5D5UB 1Y0UA 2FBIA 2PMUA 2KJCA 1HW5A 1YS6A 3NARA 2VT2A 3TOAA 4U87A 1VQLI 1OYWA 1WI9A 4XK4A 3LSHA 3DF8A 4IX7A 1O57A 1C0WA 1VQ6I 4A0YA 1ZARA 4RS8A 2FOWA 3T0YA 5D5WB 1FOKA 1I50J 1WHUA 4G6DA 3HDDA 4HRIA 5E79C 3L2CA 2IAIA 2EPFA 3BG3A 2DTRA 2EFOA 2XSDC 2OCCH 4BNCA 2P8TA 3JW4A 3DP7A 3LA3A 1W5CC 3ERMA 2YX7A 1T6SA 1RI7A 3GCMA 4IRIA 1WCMJ 1P4XA 3FXUA 2MBFA 2FE3A 4P96A 4BGDA 2NS0A 2TDXA 3CCMI 1UMQA 1FY7A 5F6FA 1I27A 2E2JJ 2IS6A 2M5WA 5K7HA 5DUIA 3KZZA 1K6OA 1MMSA 3BLYA 4IOAF 3K1MA 3CF5F 3JRFA 3M07A 3G6EI 4DGWB 2IJLA 3RIRA 3GWZA 3FBNB 4CSWA 1YLFA 2P7CB 1FOWA 2VKVA 1OCRH 2XAQA 3IAS2 3A03A 4L9JA 4P1WA 2BW3A 5K7FA 1JKPC 4L5IA 1Z7LA 1Z6TA 4DZPA 1XC5A 3AKZA 3DQVC 3ZMUA 1E0EA 3KP4A 1LEBA 1ZH5A 1SVMA 2EV0A 4N4NB 5IY5H 4HDVA 3OSGA 5GAHJ 2QQBA 2R7VA 2X6WA 1X1AA 4D1QA 3PO3J 2O6GE 2CUFA 3DLAA 2ID6A 4D7MA 3EUKL 4C30A 4HV6A 2NYXA 2BY1A 2YSRA 4N9IA 4AC0A 5D5VB 1H9GA 2L9VA 3M7GA 2KIFA 4FX0A 1SFUA 2VPLA 2GQQA 5FLXZ 2W7NA 2O9LA 4NDLA 1OISA 3OYNA 1I6XA 4RLQA 2CQNA 2FMYA 2LK2A 1K4TA 1X3ZB 2M4KA 3ZXSA 3GZ6A 3G1MA 4QPOA 1U5TA 2OJED 3HOWJ 1MJ9A 1IZ1A 2DBBA 1FJLA 1W0UA 3GLXA 3WHCA 2M2EA 1WJCA 2BE5F 4KA4A 1X1CA 2Z2SB 4L9TA 2V7FA 2D1HA 1WZ2A 3RPUA 5GADJ 1JT6A 5BMZA 2M45A 3RDIA 3PFYA 2P0WA 4ZH4F 3CCSI 2EFNA 1LDJA 1G3TA 4M3GA 4EQQA 4A12A 1OQYA 2JUCA 4V2GA 4EMSA 5E3OA 3GW2A 3CCYA 2ZJPF 3N05A 1KQ8A 1SAUA 4KICA 1LEAA 3J80K 5JHUA 3W6VA 5EF6A 4O3MA 3S15J 1MSFC 4KYWA 1BI3A 4FQGA 1L0OC 4HX7A 4CCNA 2K3PA 3PQKA 1F1ZA 2XVCA 4YIIA 3GEZA 3IHUA 3IH3A 4XORA 1KU7A 3HOZJ 2GXGA 3QP6A 2KT0A 2KRCA 2KRHA 1P4AA 2IS4A 4C9YA 2LOOA 2IVMA 3HEFA 2BVMA 3K69A 1W0TA 1R71A 2R7FA 3FM3A 2LSOA 2XSJC 3OR1C 3PUFA 3ZMVA 2JUGA 4FCYA 2R4GA 2ME0A 2DCEA 3BR5A 5KAIC 3BCBA 4UUSA 4LFUA 3K7AJ 2JA7J 4LLNA 1W36C 4XMYA 3VSLA 1H89C 1RIOH 2ZNZA 2HVRA 4IXAA 3SYTA 3MZHA 3L00A 2ISYA 3TO6A 1BI0A 1F5TA 2MYSA 4RA2A 3FHNA 4HOBA 3HTSB 4FETA 1UHWA 5EEHA 1IN5A 1V54H 3R6SA 2XGDA 2OCEA 4I01A 2E34A 3F72A 2W24A 3CTAA 2ZJRF 2QA4I 1EKEA 5J3LA 1IUYA 4U0VA 2CV2A 1R7JA 3TP3A 1CF7B 5FKOA 2CGPA 4XOPA 2ICWG 3DEWA 2K40A 3OIOA 4MGRA 2EB7A 3WU2C 3HPHA 1QZEA 5IT9K 4A3GJ 2XC7A 1FIAA 2DFEA 2HPMA 2PLYA 4P9UA 3ESWB 3OYLA 2A61A 1USTA 2VLAA 1W7PD 2K7LA 5D6EA 2K4BA 1TC3C 3K6GA 3S1NJ 2E35A 3PO2J 2CYYA 2E60A 1S5LC 1SD4A 2V6EA 3P5JA 1U78A 2E71A 4LB5A 2VASA 1I3AA 3IP4B 2K27A 2BOLA 4AM3A 4LIUA 2HQNA 3FKIJ 2O0YA 1ZKGA 4YEJA 3IRRA 1G3YA 3L2QA 4XLFA 4ANJA 2AQEA 3I53A 2ZC2A 3PNYA 5DUKA 4XRSG 2BYVE 2FEZA 4KN4X 5J4VA 1OYYA 3GUDA 4B44A 2M0MA 2EFQA 2L4AA 3RKQA 2AO9A 4ZYAA 2OUMA 4KNYA 1RKTA 4HZFA 2CQXA 5FO5A 1WJDA 3SZGA 3B6AA 3R61A 1LE8B 1BW6A 3AFHA 2XDVA 1TT0A 4M73A 3BROA 1ZAOA 1TQMA 3JRGA 4Y4RA 2DJIA 1ZN2A 4D5CA 2VBYA 1MIJA 4W1UA 5M3FJ 1PP8F 2H1KA 2H94A 3PNTA 5K5RA 4CCOA 4HX4A 2UXXA 1VQ8I 2ADUA 2O7OA 2CQQA 4KT6A 1S29A 2DN0A 1I6HJ 2R7OA 1GDTA 2DOEA 2X9DA 5DCFA 1XD7A 5AIQA 3GO5A 3D1NI 4UUTA 4RB0A 5EGOB 2LVSA 4EJUA 1ZRFA 3KP7A 3VSKA 2HS5A 3TL4X 3BQYA 3RZDJ 2XAHA 3KLOA 4RB1A 3JRBA 2KDZA 5IOYA 1POGA 3QODA 2RQPA 1IN6A 3PIPF 4TV7A 1ZTRA 2JMWA 5CYVA 3Q9SA 4BUPA 3K4LA 3M9AA 4C2MJ 1OKRA 4ESFA 3UR3C 1B8IB 5A2QK 1W1WE 4BAYA 2MC3A 4RB3C 1QVTA 2VKDA 3ZMZA 1K78B 5L3CA 4UUVA 1BIBA 5J8FA 4XLCA 1X1PA 1AKHB 4EM0B 4BE0A 5BOXA 1HF0A 2Z16A 3JSPA 1S7AA 3L2WA 2QGUA 4DYQA 3BJAA 1W7PA 1SFOJ 3CD6I 2VI6A 1MBHA 1OJLA 3FXKA 5HVQC 3HJEA 2JPCA 2F2EA 2F5VA 2DMUA 3CP8A 3H5AA 3OY9A 2LDUA 3E97A 3ML6A 5LBQA 2FNPA 3CJRB 3LAPA 2R5YB 3C2GA 4BKXA 1I1GA 1XMAA 4ZYEA 5JVGF 4IHYA 2HOSA 4X0GA 3GZ5A 2DODA 3LFKA 5TRDA 4G6TB 3HIFA 1J75A 3ONQA 4GDFA 2OAZA 4YFKF 2K5CA 3ASOH 1LNWA 2DFIA 2ETHA 1XPXA 1LKXA 4RDUA 1B72A 1YFHA 3WTXC 3PSFA 1MBGA 1BL0A 4BBRJ 5IYCJ 2F5CA 5HODA 3DTKA 5D4RA 2W84A 2DTZA 4RGRA 1NTCA 3HG9A 2HDDA 1I3QJ 1BC8C 1BM9A 2LKSA 1IW7F 2DT5A 5LGUA 4DBRA 2VC1A 3G73A 1Z05A 2DFFA 1D3YA 4BH9A 1G2HA 2ACJA 1A36A 3HKZN 3I4MJ 3K10A 1D0YA 1VF9A 3K4NA 1ERDA 3LSIA 2V1DA 2HXIA 2Y0SN 1XB4A 4KMUX 3CMYA 2XPVA 4LGWA 1HA8A 3OS1A 5CVIA 2BHYA 4B47A 5KNLA 2GLOA 1X19A 3GZNB 1X2MA 1D0XA 5K5OA 1G4DA 1A6IA 1WH5A 3L09A 2NVQJ 3CCQI 2CV1A 1UJ8A 2EK5A 4WXDA 2QYOA 4N0BA 4YG2F 2E7WA 2PN6A 4XICA 2P5VA 2HI3A 2IGOA 2DK5A 3IAM2 4E7HA 1TW2A 3JAMZ 4NHJA 3ABKH 3ZQQA 2JK3A 1WRJA 2XRNA 4IOCF 1FTTA 2W1OA 1BA5A 3OMYA 4UVAA 5J1UA 3BR0A 2HNHA 3DTEA 2DOFA 3GXOA 3I58A 3I0TA 1G3WA 1HKTA 1FC3A 4I02A 2V9VA 1AU7A 3F6VA 3W6JB 3SXYA 3HOYJ 2NOGA 2L54A 3BG6A 4A69C 1B9MA 4HDUA 4DYRA 1OCZH 4A5NA
chains in the Genus database with same CATH topology
4DQ2A 2FSWA 2R3SA 1EH6A 2IP2A 4MTDA 1F9NA 4GO1A 3V8KA 1QGPA 2P4WA 3DXJF 1UCRA 2F5DA 2VONA 3WGIA 2G7HA 4M72A 4ASNA 1B4AA 4U0WA 3K2ZA 1PUEE 2IA0A 4R8HA 5AONA 2JT1A 4CO8A 4KIGA 1NHAA 2HWVA 4CGZA 2IRFG 4N9HA 1SAXA 4LMYA 3E6MA 2W25A 4G6QA 1O7LA 1PP7U 2DK8A 3COAC 3J80Z 4ESJA 4RAYA 3REOA 2H27A 2JSCA 5DD4A 3HSEA 2D45A 3HRTA 3AAFA 5BS6A 1XMKA 1QZYA 3GFLA 3QAHA 2GXBA 1MZBA 3L7WA 2ZKZA 4E70A 2HYFA 1R00A 4L18B 2XV4S 1ZG3A 4BYYA 5KVRA 5JFRA 5BPIA 3T1BA 2H09A 2RDPA 5KK1A 2FBHA 3VEPA 5ERIA 2XAFA 3Q5FA 5DCMA 2YX4A 2MLGA 2PEXA 1TNTA 1GXQA 1TBXA 2ZCWA 3CJNA 4JBAA 5ILUA 3HTUA 4EJTA 2KJBA 1IN8A 2RC4A 3IL2A 1MGTA 1ZG1A 4HQEA 2ESNA 2LF7A 3I59B 1MJBA 3VFZA 1ODDA 2M30A 2RN7A 2WWYA 2WTEA 2B0LA 2WC2A 2NAZA 4UHTA 3GX4X 4I0AA 1RUOA 1P92A 2LNBA 2P6TA 2P5LC 3WTWC 4BHPA 4M74A 1FYLA 4OOIA 4GCVA 2O03A 3CUQA 4G8XA 5H6QA 2IA2A 3E5QA 2HKXA 3VODA 3FMRA 3TO9A 4Q4ZF 4GGGA 1KYWA 2RV8A 4FT8A 3WGHA 3LAJA 5K5QA 2PI0A 2GIVA 4LB6B 2NNYA 3F21A 3TKYA 1TLHB 5ICGA 1YIOA 4S05A 3J81K 3DKWA 4CHUA 3ECOA 2VN2A 2CSOA 1JE8A 1FT9A 3JTHA 5ILSA 1YW9A 3FF5A 4QWQA 1YW8A 5LEJA 2ZBKA 3J81Z 1XN7A 1LVAA 2RGVA 4CICA 5DCMB 3QU6A 5E18F 2FQ3A 2M87A 3WGGA 4IHSA 1FBSA 1T0FA 1HBXG 3F8FA 3DEUA 1AWCA 3LQRA 1I1SA 4Y15A 3FXRA 5JVTA 4JQFA 3ZMDA 4EJOA 3SZPA 4LJZF 1R5HA 3OV8A 3KZYA 4D0PA 1SD7A 1AOYA 3I5UA 2J5PA 1T2KA 2E1CA 3MFKA 3HHHA 2K02A 1FYKA 4OU0A 4EJVA 1O3TA 1P6RA 2HR3A 2Q2EA 2R7DA 3ZN0A 2H6BA 3MWMA 4ZZDA 4EJWA 2ZMEB 2HQRA 4U7BA 2MLKA 1YO5C 3SQNA 2YU3A 4HX8A 2VXZA 2QUFA 4LD5A 4M9XA 2JPBA 3KEQA 2VC0A 3WE3A 1XGSA 4LLLA 2QBYA 4ON0A 3SZTA 2Z33A 2FMLA 3D0SA 3IWZA 2FBKA 2VT3A 1BI1A 1LQ1A 3T5XA 3FXQA 3T8TA 5DDGA 4GYGA 4Q48A 3RI4A 3FMQA 3MQ0A 4B8XA 3JSOA 3ECHA 2DLLA 1DPUA 1ONVA 1UFMA 4NB5A 3CO6C 4EV0A 3HRSA 1TQIA 2YPRA 5LLQA 1K78A 2OBPA 4MQ9F 1MDMA 1P4WA 4AWXB 1D8JA 2UZKA 2JTVA 4XBFA 5CVVA 3V7CA 1SMYF 5HLIA 1LDDA 1ZG5A 2XROA 5CVJA 1ZREA 3L9FA 2V1UA 2P5KA 3I64A 4YFNF 5FB2A 1V3FA 3ABUA 5BQTA 3IC7A 1G6NA 3P9IA 1KU2A 2MA3A 3F8NA 1OR7A 1WKMA 2HYGD 2DI3A 2HTJA 2IA1A 3F8MA 5CVUA 3EYYA 4ZZLA 1UHMA 1BC7C 5A2QZ 2QQAA 3H92A 1E2XA 1SFXA 1D5VA 4BHBA 4I09A 5FFXA 2Y48A 2UXNA 2K86A 4G7HF 1W4MA 3T8RA 2MH9A 1R1TA 3KEOA 2BV6A 1YG2A 3C1DA 4LG0A 3BJ6A 4ETSA 2Q8KA 1BI2A 3PFIA 1XGMA 3HRUA 3B73A 3RYPA 2XHKA 1USSA 3G3ZA 4L9VA 5L3DA 1IXCA 1HXDA 4ENJA 3C3WA 1FYMA 2FOKA 5AIPA 1QPMA 5LGTA 1J7KA 1ON2A 4HF1A 4AD9A 1VTNC 2VE8A 2FF4A 2FXAA 1WSUA 1U5TC 4WF2A 4HW0A 3DFGA 5EEGA 2F5EA 3MCZA 4M9ZA 3WODF 5IT9Z 2ZJ2A 4IF4A 2DO7A 2HKOA 4K2EA 4KDPA 1U3EM 1ON1A 4IRHA 3KP5A 2OA4A 4HA8A 2VOPA 5HLHA 1MD0A 1FP1D 1ZRCA 4HF2A 1WWXA 4MEYF 1O7FA 2FA5A 3KFWX 4UNOA 1FX7A 3WU1B 2ZNYA 1HSJA 2A68F 4B09A 5TJJA 1KU3A 2BBYA 3P9KA 5DV5A 3C7JA 3ROUA 1YW7A 2XAGA 4GXOA 1TW3A 3GYHX 3N4MA 1LJ9A 1IRFA 1BN5A 2KIMA 4YIFA 1MJAA 3BOQA 4A0ZA 4HQMA 1IN7A 1CGPA 2P6SA 2XKOA 5D6FA 3VOEA 3SHFA 1W5SA 3WG9A 1BJAA 4A5MA 4OIPF 4NQWA 1R1VA 4PGGA 2YR2A 2FU4A 4CZZA 3DPLC 2QENA 2X4HA 1R5GA 4IVNA 4ZYDA 4QLCU 1R36A 4WCGA 1FZPB 5ILVA 5J8CA 2NNNA 1QQIA 4UV8A 3V7RA 2HGCA 2BEOA 1Z1DA 2QM3A 2KRFA 4WWCA 4S04A 3U2RA 3WE2A 2O8XA 5D4SA 2PBIA 2W57A 3VB2A 1BBYA 3O2PE 2O3FA 1E17A 3F8BA 2EFPA 1XGNA 1Z7UA 3V7SA 4O5VA 3M1EA 4MTEA 3LSTA 3RKYA 5E8GA 2AXLA 3BP8A 4GYIA 4DNCA 4PGHA 3HUGA 1KU9A 1G3SA 2L4MA 4P55A 1J2XA 4BQAA 3HYIA 4MHGA 3ZQ7A 4OMZA 4XLNF 2HDCA 5ICFA 5HLGA 3BJOA 1J9IA 4H0EA 1MKMA 3E5XA 3HRMA 1YYVA 1U5TB 2V6CA 3S2WA 2CO5A 4ZYHA 3W6KB 4FX4A 3O3KA 4Z2YA 4HLXA 4G94A 2K4JA 1HKSA 3BWGA 4U0YA 3R0JA 5LRRA 2Y75A 3JAMK 5FGMA 3LQQA 3K1PA 1ZRDA 2CWEA 4M9SA 5L3BA 3GVAA 5HDKA 5D5XB 2OD5A 3FX3A 5DD8A 3WTUC 2G9WA 5CLSA 2V1XA 2Z3YA 5CJ9A 3V8JA 1HSTA 2WV0A 1IF1A 1B9NA 1SD6A 1JHFA 5ICCA 4G7ZF 2LF8A 5K1YA 1KQ0A 4UV9A 4L0ZB 1STZA 3CDHA 2VE9A 1KQ9A 5IT3A 4PDKA 1J59A 2ZFWA 1O3SA 1LDKB 2ZXJA 5E1ZB 2MH2A 1DUXC 2PMHA 1JHHA 3ERED 1OYIA 4A6EA 4JK1X 3RKXA 4RAZA 1OMIA 4BHCA 3KCCA 3WTTC 2QBYB 5FD6A 2HTSA 3DPTA 2EV6A 2OU2A 4U88A 4CDGA 1Q1HA 5HDNA 2XAJA 4OIRF 3QP5A 3IKTA 3FM5A 2PJPA 3TOBA 3RKWA 2GA1A 3FMSA 3TDZC 2VBXA 3HOTA 5E1WA 3ZMSA 2A6HF 5E20A 1UB9A 2QZ8A 2VOOA 1O3RA 4Q47A 5DEQA 4EGZA 4IPAA 2CFXA 3KP6A 2C6YA 2Q0OA 4WK8F 3I71A 3EYIA 1A04A 4AIKA 1FBUA 5FD5A 1EV7A 4KIFA 5CVRA 1GHCA 1ZLKA 4KN7X 1T98A 1XSXA 3RPQA 5JR3A 1ULYA 4IHTA 1JGSA 1Z9CA 4CYDA 1U6GA 1ZLJA 2EA4A 3JTGA 2OZUA 1W7PB 2GWRA 1T38A 3HOSA 5LGNA 3H3ZA 2X0LA 3R60A 3K1NA 2EA2A 3ABTA 1FSEA 4ENMA 3U1DA 2OZ6A 5E1XA 3MZYA 1SFEA 5LEKA 3F8CA 2FNAA 3J7AO 3CUQC 4LG0B 4OIQF 1DP7P 1CF7A 4M71A 3IKVA 2GZWA 4HLYA 5LHIA 4FHTA 2QVOA 1W5TA 3EDPA 1RZ4A 4ZYGA 2ZMEA 3D5LA 5HS8A 1LB2A 4KT5C 3F22A 2XKPA 4MEXF 3BPXA 3K0LA 1IRGA 3HSRA 2JRTA 1HQCA 2D2WA 3DV8A 5E17F 4OINF 2XGXA 2O61A 1B59A 3I54A 4A2UA 3BPVA 1IAWA 4YFXF 4KIBA 1ZGAA 3CO7C 2Z99A 3QOPA 3EETA 4EM2A 1FWZA 3CUQB 2DPUA 3QU3A 3BDDA 3ZMTA 4BXUA 1KGSA 5J6XA 4I98B 2XIGA 3BZ6A 1L3LA 2A3SA 1XSDA 5F1RA 5H20A 1B6AA 1HW2A 2PQ8A 2A5YB 2UWMA 4AIHA 2VBWA 2F5FA 1GVJA 4IJAA 1EH7A 4WXHA 5FLXK 1S7OA 1REPC 4EM1A 4LLGF 2FRHA 3K9TA 4AIJA 3KP3A 4XSZF 2LKPA 5D8LB 2J5OA 3Q9VA 3ELKA 4P9FA 3WTZA 4WX9A 2A69F 3WTYC 1K79A 4A0XA 4XSXF 2XUBA 3RTRA 3QPHA 1ZGJA 2QWWA 3CUOA 2HZTA 3RYRA 3V8LA 4KUMA 1QNTA 2ESHA 1V4RA 3FZVA 2MD5A 5LHGA 3KP2A 3R4KA 1XCBA 3NEUA 1FP2A 2EFWA 2OQRA 3SFZA 5H6RA 1P2FA 3U9GA 4M6XA 1U8RA 3PQJA 3TQNA 1U2WA 1SD5A 3BY6A 1YQAA 3TO7A 1Z91A 2A07F 3HSFA 2G7UA 4F7ZA 1IXSB 1RUNA 1XDSA 4G7OF 2QQ9A 4EGYA 1ZYRF 1HKQA 3EQLF 1RNLA 2L3DA 4G9YA 5FFZA 3KETA 2DU9A 3P9CA 5HS9A 4IRGA 4RGSA 1QZZA 2CQKA 4OIOF 1IXRC 3B02A 2EWNA 4I2OA 1F4KA 1T39A 4I0BA 2EV5A 2E1NA 1J5YA 2CW0F 5D8KB 1R1UA 3FHZA 4PZJA 2IT0A 3WTSC 1YS7A 2DQLA 3FWEA 3GF2A 4WXCA 3MAJA 2Z9OA 5ED4A 3NQOA 5BPDA 3TDUC 3HHGA 2EJRA 5JI6A 1MDMB 2RKHA 1O3QA 3F6OA 3RJPA 1DDNA 1XSVA 1XDUA 2STTA 1S8NA 3LA2A 2NRAC 4RGXA 2HEOA 2M8EA 1D8KA 2XASA 1BOAA 3OOPA 3NRVA 4MQVA 2VODA 2L01A 2L02A 3E6CC 4HAMA 4KFCA 3KLNA 2W85A 4L5JA 3GFIA 1FBQA 4RGUA 5E8IA 4R79A 1OPCA 5HS7A 3KE2A 4HF0A 4MNUA 3GFMA 4HV5A 2PFBA 1PDNC 2KIUA 2DPDA 4PCQA 2RVCA 1R22A 2KKOA 3V4GA 1KYZA 1QBJA 3E3VA 2ZO4A 4M6YA 3ULQB 4Y13A 1FNNA 3LA7A 1EH8A 2QLZA 1XGOA 4AVPA 1Z6RA 4UXNA 4HBLA 1FPQA 1YTYA 1X3UA 2V79A 3ZPLA 3ZP5A 3M8EA 2IPQX 4KMFA 1TQPA 3E6DA 4L9NA 4XLPF 2BGCA 2COMA 2PG4A 3LWFA 5F64A 3WTVC 2HFHA 2E7XA 3E6BA 1S3JA 4A6DA 2ELHA 5L3EA 1DPRA 4OMYA 4UVBA 3TGNA 3C18A 1FSHA 4ENNA 3I59A 3H3UA 2Y0MA 5LRSA 3EUHA 2STWA 4L0YB 3CLOA 1QO0D 5HOOA 2ISZA 1IN4A 4Y17A 3MEXA 3F3XA 1R23A 4ESBA 4XRFA 1H9TA 5HDGA 2DAOA 1GXPA 2DW4A 6PAXA 5L3FA 2D1VA 4RB2C 3N97A 4I7HA 1K7AA 2OQGA 2GA2A 1XCVA 4UVCA 3F23A 4HYEA 2H6CA 3ISPA 1J0RA 1B1BA 3QPTA 2P7VB 2Z5UA 4CXFA 1WQ2A 1I5ZA 3WU0A 5DYMA 3ZN1A 3QRFF 4Q5SF 4R1HA 3O6BB 4EVIA 3R0AA 4LK1F 2M1BA 1H0MA 2VBZA 2A6EF 4LK0F 1FLIA 4ENKA 3I4PA 5LHHA 2HOEA 1KA8A 1SMTA 3GFJA 1TNSA 2IW5A 3P7NA 4P5OA 1ZHFA 1HW1A 3E5UA 2AS5F 2GAUA 1S6LA 3IRQA 1JXSA 1BIAA 3IWFA 2JZYA 3M8FA 1R58A 2CG4A 2DQRA 1TTYA 4O6JA 5L3GA 4U7DA 5ICEA 2RNJA 5D5UB 1Y0UA 2FBIA 2PMUA 2KJCA 1HW5A 1YS6A 2VT2A 3TOAA 1OYWA 1WI9A 3DF8A 1O57A 1C0WA 4A0YA 1ZARA 4RS8A 3T0YA 5D5WB 1FOKA 4G6DA 3L2CA 2DTRA 2EFOA 4BNCA 2P8TA 3JW4A 3DP7A 3LA3A 2YX7A 1T6SA 1RI7A 4IRIA 1P4XA 3FXUA 2MBFA 2FE3A 4P96A 2NS0A 2TDXA 1FY7A 5F6FA 1I27A 2M5WA 5DUIA 3KZZA 1K6OA 3K1MA 2IJLA 3RIRA 3GWZA 1YLFA 2P7CB 2XAQA 4L9JA 4L5IA 1Z6TA 3DQVC 3ZMUA 3KP4A 1LEBA 1ZH5A 2EV0A 4HDVA 2QQBA 2O6GE 4HV6A 2NYXA 2YSRA 4N9IA 5D5VB 1H9GA 3M7GA 2KIFA 4FX0A 1SFUA 2GQQA 5FLXZ 1I6XA 2FMYA 3GZ6A 1U5TA 1MJ9A 1IZ1A 2DBBA 3GLXA 2BE5F 4KA4A 4L9TA 2D1HA 3RPUA 5BMZA 2M45A 3RDIA 4ZH4F 2EFNA 1LDJA 1G3TA 4EQQA 4A12A 4EMSA 3GW2A 1KQ8A 4KICA 1LEAA 3J80K 5JHUA 4O3MA 4KYWA 1BI3A 1L0OC 4HX7A 3PQKA 1F1ZA 2XVCA 4YIIA 3GEZA 3IHUA 1KU7A 2GXGA 3QP6A 1P4AA 2IVMA 3K69A 2R7FA 3FM3A 2LSOA 3ZMVA 4LFUA 4LLNA 1RIOH 2ZNZA 3MZHA 4IXAA 3L00A 2ISYA 3TO6A 1BI0A 1F5TA 4HOBA 3HTSB 1UHWA 5EEHA 1IN5A 3R6SA 4I01A 3F72A 2W24A 3CTAA 1IUYA 4U0VA 1R7JA 1CF7B 2CGPA 4MGRA 2EB7A 5IT9K 2PLYA 4P9UA 2A61A 1USTA 1W7PD 2K7LA 5D6EA 2K4BA 2CYYA 1SD4A 1U78A 4LB5A 2K27A 2HQNA 2O0YA 3IRRA 1G3YA 5DUKA 3I53A 2BYVE 2FEZA 4KN4X 1OYYA 3GUDA 2EFQA 2L4AA 4KNYA 4HZFA 5FO5A 3R61A 4M73A 3BROA 1ZAOA 1TQMA 1ZN2A 2VBYA 1PP8F 2H94A 5K5RA 4HX4A 2UXXA 2ADUA 1S29A 5DCFA 1XD7A 5AIQA 3GO5A 4RB0A 1ZRFA 4EJUA 3KP7A 2HS5A 2XAHA 3KLOA 4RB1A 2RQPA 1IN6A 4TV7A 5CYVA 3Q9SA 3M9AA 1OKRA 4ESFA 5A2QK 4RB3C 4BAYA 2MC3A 1K78B 3ZMZA 4UUVA 5L3CA 1BIBA 5J8FA 4EM0B 5BOXA 3JSPA 1S7AA 3BJAA 1W7PA 5HVQC 2JPCA 2F2EA 2LDUA 3E97A 3ML6A 5LBQA 2FNPA 3LAPA 1I1GA 1XMAA 4ZYEA 3GZ5A 3LFKA 5TRDA 3HIFA 1J75A 2OAZA 4YFKF 1LNWA 2DFIA 2ETHA 1YFHA 3WTXC 2F5CA 5D4RA 2W84A 4RGRA 1BC8C 1BM9A 1IW7F 2DT5A 5LGUA 2VC1A 3G73A 1Z05A 1D3YA 4BH9A 2ACJA 2V1DA 4KMUX 1XB4A 4LGWA 5CVIA 5K5OA 1G4DA 3L09A 2EK5A 4WXDA 2QYOA 4N0BA 4YG2F 2E7WA 2PN6A 2P5VA 2DK5A 1TW2A 3JAMZ 4NHJA 1WRJA 2XRNA 4UVAA 3GXOA 3I58A 3I0TA 1G3WA 1HKTA 1FC3A 4I02A 2V9VA 3F6VA 3W6JB 3SXYA 2L54A 1B9MA 4HDUA 4A5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQ2 A;  2FSW A;  2R3S A;  1EH6 A;  2IP2 A;  4MTD A;  1F9N A;  4GO1 A;  3V8K A;  1QGP A;  2P4W A;  3DXJ F;  1UCR A;  2F5D A;  2VON A;  3WGI A;  2G7H A;  4M72 A;  4ASN A;  1B4A A;  4U0W A;  3K2Z A;  1PUE E;  2IA0 A;  4R8H A;  5AON A;  2JT1 A;  4CO8 A;  4KIG A;  1NHA A;  2HWV A;  4CGZ A;  2IRF G;  4N9H A;  1SAX A;  4LMY A;  3E6M A;  2W25 A;  4G6Q A;  1O7L A;  1PP7 U;  2DK8 A;  3COA C;  3J80 Z;  4ESJ A;  4RAY A;  3REO A;  2H27 A;  2JSC A;  5DD4 A;  3HSE A;  2D45 A;  3HRT A;  3AAF A;  5BS6 A;  1XMK A;  1QZY A;  3GFL A;  3QAH A;  2GXB A;  1MZB A;  3L7W A;  2ZKZ A;  4E70 A;  2HYF A;  1R00 A;  4L18 B;  2XV4 S;  1ZG3 A;  4BYY A;  5KVR A;  5JFR A;  5BPI A;  3T1B A;  2H09 A;  2RDP A;  5KK1 A;  2FBH A;  3VEP A;  5ERI A;  2XAF A;  3Q5F A;  5DCM A;  2YX4 A;  2MLG A;  2PEX A;  1TNT A;  1GXQ A;  1TBX A;  2ZCW A;  3CJN A;  4JBA A;  5ILU A;  3HTU A;  4EJT A;  2KJB A;  1IN8 A;  2RC4 A;  3IL2 A;  1MGT A;  1ZG1 A;  4HQE A;  2ESN A;  2LF7 A;  3I59 B;  1MJB A;  3VFZ A;  1ODD A;  2M30 A;  2RN7 A;  2WWY A;  2WTE A;  2B0L A;  2WC2 A;  2NAZ A;  4UHT A;  3GX4 X;  4I0A A;  1RUO A;  1P92 A;  2LNB A;  2P6T A;  2P5L C;  3WTW C;  4BHP A;  4M74 A;  1FYL A;  4OOI A;  4GCV A;  2O03 A;  3CUQ A;  4G8X A;  5H6Q A;  2IA2 A;  3E5Q A;  2HKX A;  3VOD A;  3FMR A;  3TO9 A;  4Q4Z F;  4GGG A;  1KYW A;  2RV8 A;  4FT8 A;  3WGH A;  3LAJ A;  5K5Q A;  2PI0 A;  2GIV A;  4LB6 B;  2NNY A;  3F21 A;  3TKY A;  1TLH B;  5ICG A;  1YIO A;  4S05 A;  3J81 K;  3DKW A;  4CHU A;  3ECO A;  2VN2 A;  2CSO A;  1JE8 A;  1FT9 A;  3JTH A;  5ILS A;  1YW9 A;  3FF5 A;  4QWQ A;  1YW8 A;  5LEJ A;  2ZBK A;  3J81 Z;  1XN7 A;  1LVA A;  2RGV A;  4CIC A;  5DCM B;  3QU6 A;  5E18 F;  2FQ3 A;  2M87 A;  3WGG A;  4IHS A;  1FBS A;  1T0F A;  1HBX G;  3F8F A;  3DEU A;  1AWC A;  3LQR A;  1I1S A;  4Y15 A;  3FXR A;  5JVT A;  4JQF A;  3ZMD A;  4EJO A;  3SZP A;  4LJZ F;  1R5H A;  3OV8 A;  3KZY A;  4D0P A;  1SD7 A;  1AOY A;  3I5U A;  2J5P A;  1T2K A;  2E1C A;  3MFK A;  3HHH A;  2K02 A;  1FYK A;  4OU0 A;  4EJV A;  1O3T A;  1P6R A;  2HR3 A;  2Q2E A;  2R7D A;  3ZN0 A;  2H6B A;  3MWM A;  4ZZD A;  4EJW A;  2ZME B;  2HQR A;  4U7B A;  2MLK A;  1YO5 C;  3SQN A;  2YU3 A;  4HX8 A;  2VXZ A;  2QUF A;  4LD5 A;  4M9X A;  2JPB A;  3KEQ A;  2VC0 A;  3WE3 A;  1XGS A;  4LLL A;  2QBY A;  4ON0 A;  3SZT A;  2Z33 A;  2FML A;  3D0S A;  3IWZ A;  2FBK A;  2VT3 A;  1BI1 A;  1LQ1 A;  3T5X A;  3FXQ A;  3T8T A;  5DDG A;  4GYG A;  4Q48 A;  3RI4 A;  3FMQ A;  3MQ0 A;  4B8X A;  3JSO A;  3ECH A;  2DLL A;  1DPU A;  1ONV A;  1UFM A;  4NB5 A;  3CO6 C;  4EV0 A;  3HRS A;  1TQI A;  2YPR A;  5LLQ A;  1K78 A;  2OBP A;  4MQ9 F;  1MDM A;  1P4W A;  4AWX B;  1D8J A;  2UZK A;  2JTV A;  4XBF A;  5CVV A;  3V7C A;  1SMY F;  5HLI A;  1LDD A;  1ZG5 A;  2XRO A;  5CVJ A;  1ZRE A;  3L9F A;  2V1U A;  2P5K A;  3I64 A;  4YFN F;  5FB2 A;  1V3F A;  3ABU A;  5BQT A;  3IC7 A;  1G6N A;  3P9I A;  1KU2 A;  2MA3 A;  3F8N A;  1OR7 A;  1WKM A;  2HYG D;  2DI3 A;  2HTJ A;  2IA1 A;  3F8M A;  5CVU A;  3EYY A;  4ZZL A;  1UHM A;  1BC7 C;  5A2Q Z;  2QQA A;  3H92 A;  1E2X A;  1SFX A;  1D5V A;  4BHB A;  4I09 A;  5FFX A;  2Y48 A;  2UXN A;  2K86 A;  4G7H F;  1W4M A;  3T8R A;  2MH9 A;  1R1T A;  3KEO A;  2BV6 A;  1YG2 A;  3C1D A;  4LG0 A;  3BJ6 A;  4ETS A;  2Q8K A;  1BI2 A;  3PFI A;  1XGM A;  3HRU A;  3B73 A;  3RYP A;  2XHK A;  1USS A;  3G3Z A;  4L9V A;  5L3D A;  1IXC A;  1HXD A;  4ENJ A;  3C3W A;  1FYM A;  2FOK A;  5AIP A;  1QPM A;  5LGT A;  1J7K A;  1ON2 A;  4HF1 A;  4AD9 A;  1VTN C;  2VE8 A;  2FF4 A;  2FXA A;  1WSU A;  1U5T C;  4WF2 A;  4HW0 A;  3DFG A;  5EEG A;  2F5E A;  3MCZ A;  4M9Z A;  3WOD F;  5IT9 Z;  2ZJ2 A;  4IF4 A;  2DO7 A;  2HKO A;  4K2E A;  4KDP A;  1U3E M;  1ON1 A;  4IRH A;  3KP5 A;  2OA4 A;  4HA8 A;  2VOP A;  5HLH A;  1MD0 A;  1FP1 D;  1ZRC A;  4HF2 A;  1WWX A;  4MEY F;  1O7F A;  2FA5 A;  3KFW X;  4UNO A;  1FX7 A;  3WU1 B;  2ZNY A;  1HSJ A;  2A68 F;  4B09 A;  5TJJ A;  1KU3 A;  2BBY A;  3P9K A;  5DV5 A;  3C7J A;  3ROU A;  1YW7 A;  2XAG A;  4GXO A;  1TW3 A;  3GYH X;  3N4M A;  1LJ9 A;  1IRF A;  1BN5 A;  2KIM A;  4YIF A;  1MJA A;  3BOQ A;  4A0Z A;  4HQM A;  1IN7 A;  1CGP A;  2P6S A;  2XKO A;  5D6F A;  3VOE A;  3SHF A;  1W5S A;  3WG9 A;  1BJA A;  4A5M A;  4OIP F;  4NQW A;  1R1V A;  4PGG A;  2YR2 A;  2FU4 A;  4CZZ A;  3DPL C;  2QEN A;  2X4H A;  1R5G A;  4IVN A;  4ZYD A;  4QLC U;  1R36 A;  4WCG A;  1FZP B;  5ILV A;  5J8C A;  2NNN A;  1QQI A;  4UV8 A;  3V7R A;  2HGC A;  2BEO A;  1Z1D A;  2QM3 A;  2KRF A;  4WWC A;  4S04 A;  3U2R A;  3WE2 A;  2O8X A;  5D4S A;  2PBI A;  2W57 A;  3VB2 A;  1BBY A;  3O2P E;  2O3F A;  1E17 A;  3F8B A;  2EFP A;  1XGN A;  1Z7U A;  3V7S A;  4O5V A;  3M1E A;  4MTE A;  3LST A;  3RKY A;  5E8G A;  2AXL A;  3BP8 A;  4GYI A;  4DNC A;  4PGH A;  3HUG A;  1KU9 A;  1G3S A;  2L4M A;  4P55 A;  1J2X A;  4BQA A;  3HYI A;  4MHG A;  3ZQ7 A;  4OMZ A;  4XLN F;  2HDC A;  5ICF A;  5HLG A;  3BJO A;  1J9I A;  4H0E A;  1MKM A;  3E5X A;  3HRM A;  1YYV A;  1U5T B;  2V6C A;  3S2W A;  2CO5 A;  4ZYH A;  3W6K B;  4FX4 A;  3O3K A;  4Z2Y A;  4HLX A;  4G94 A;  2K4J A;  1HKS A;  3BWG A;  4U0Y A;  3R0J A;  5LRR A;  2Y75 A;  3JAM K;  5FGM A;  3LQQ A;  3K1P A;  1ZRD A;  2CWE A;  4M9S A;  5L3B A;  3GVA A;  5HDK A;  5D5X B;  2OD5 A;  3FX3 A;  5DD8 A;  3WTU C;  2G9W A;  5CLS A;  2V1X A;  2Z3Y A;  5CJ9 A;  3V8J A;  1HST A;  2WV0 A;  1IF1 A;  1B9N A;  1SD6 A;  1JHF A;  5ICC A;  4G7Z F;  2LF8 A;  5K1Y A;  1KQ0 A;  4UV9 A;  4L0Z B;  1STZ A;  3CDH A;  2VE9 A;  1KQ9 A;  5IT3 A;  4PDK A;  1J59 A;  2ZFW A;  1O3S A;  1LDK B;  2ZXJ A;  5E1Z B;  2MH2 A;  1DUX C;  2PMH A;  1JHH A;  3ERE D;  1OYI A;  4A6E A;  4JK1 X;  3RKX A;  4RAZ A;  1OMI A;  4BHC A;  3KCC A;  3WTT C;  2QBY B;  5FD6 A;  2HTS A;  3DPT A;  2EV6 A;  2OU2 A;  4U88 A;  4CDG A;  1Q1H A;  5HDN A;  2XAJ A;  4OIR F;  3QP5 A;  3IKT A;  3FM5 A;  2PJP A;  3TOB A;  3RKW A;  2GA1 A;  3FMS A;  3TDZ C;  2VBX A;  3HOT A;  5E1W A;  3ZMS A;  2A6H F;  5E20 A;  1UB9 A;  2QZ8 A;  2VOO A;  1O3R A;  4Q47 A;  5DEQ A;  4EGZ A;  4IPA A;  2CFX A;  3KP6 A;  2C6Y A;  2Q0O A;  4WK8 F;  3I71 A;  3EYI A;  1A04 A;  4AIK A;  1FBU A;  5FD5 A;  1EV7 A;  4KIF A;  5CVR A;  1GHC A;  1ZLK A;  4KN7 X;  1T98 A;  1XSX A;  3RPQ A;  5JR3 A;  1ULY A;  4IHT A;  1JGS A;  1Z9C A;  4CYD A;  1U6G A;  1ZLJ A;  2EA4 A;  3JTG A;  2OZU A;  1W7P B;  2GWR A;  1T38 A;  3HOS A;  5LGN A;  3H3Z A;  2X0L A;  3R60 A;  3K1N A;  2EA2 A;  3ABT A;  1FSE A;  4ENM A;  3U1D A;  2OZ6 A;  5E1X A;  3MZY A;  1SFE A;  5LEK A;  3F8C A;  2FNA A;  3J7A O;  3CUQ C;  4LG0 B;  4OIQ F;  1DP7 P;  1CF7 A;  4M71 A;  3IKV A;  2GZW A;  4HLY A;  5LHI A;  4FHT A;  2QVO A;  1W5T A;  3EDP A;  1RZ4 A;  4ZYG A;  2ZME A;  3D5L A;  5HS8 A;  1LB2 A;  4KT5 C;  3F22 A;  2XKP A;  4MEX F;  3BPX A;  3K0L A;  1IRG A;  3HSR A;  2JRT A;  1HQC A;  2D2W A;  3DV8 A;  5E17 F;  4OIN F;  2XGX A;  2O61 A;  1B59 A;  3I54 A;  4A2U A;  3BPV A;  1IAW A;  4YFX F;  4KIB A;  1ZGA A;  3CO7 C;  2Z99 A;  3QOP A;  3EET A;  4EM2 A;  1FWZ A;  3CUQ B;  2DPU A;  3QU3 A;  3BDD A;  3ZMT A;  4BXU A;  1KGS A;  5J6X A;  4I98 B;  2XIG A;  3BZ6 A;  1L3L A;  2A3S A;  1XSD A;  5F1R A;  5H20 A;  1B6A A;  1HW2 A;  2PQ8 A;  2A5Y B;  2UWM A;  4AIH A;  2VBW A;  2F5F A;  1GVJ A;  4IJA A;  1EH7 A;  4WXH A;  5FLX K;  1S7O A;  1REP C;  4EM1 A;  4LLG F;  2FRH A;  3K9T A;  4AIJ A;  3KP3 A;  4XSZ F;  2LKP A;  5D8L B;  2J5O A;  3Q9V A;  3ELK A;  4P9F A;  3WTZ A;  4WX9 A;  2A69 F;  3WTY C;  1K79 A;  4A0X A;  4XSX F;  2XUB A;  3RTR A;  3QPH A;  1ZGJ A;  2QWW A;  3CUO A;  2HZT A;  3RYR A;  3V8L A;  4KUM A;  1QNT A;  2ESH A;  1V4R A;  3FZV A;  2MD5 A;  5LHG A;  3KP2 A;  3R4K A;  1XCB A;  3NEU A;  1FP2 A;  2EFW A;  2OQR A;  3SFZ A;  5H6R A;  1P2F A;  3U9G A;  4M6X A;  1U8R A;  3PQJ A;  3TQN A;  1U2W A;  1SD5 A;  3BY6 A;  1YQA A;  3TO7 A;  1Z91 A;  2A07 F;  3HSF A;  2G7U A;  4F7Z A;  1IXS B;  1RUN A;  1XDS A;  4G7O F;  2QQ9 A;  4EGY A;  1ZYR F;  1HKQ A;  3EQL F;  1RNL A;  2L3D A;  4G9Y A;  5FFZ A;  3KET A;  2DU9 A;  3P9C A;  5HS9 A;  4IRG A;  4RGS A;  1QZZ A;  2CQK A;  4OIO F;  1IXR C;  3B02 A;  2EWN A;  4I2O A;  1F4K A;  1T39 A;  4I0B A;  2EV5 A;  2E1N A;  1J5Y A;  2CW0 F;  5D8K B;  1R1U A;  3FHZ A;  4PZJ A;  2IT0 A;  3WTS C;  1YS7 A;  2DQL A;  3FWE A;  3GF2 A;  4WXC A;  3MAJ A;  2Z9O A;  5ED4 A;  3NQO A;  5BPD A;  3TDU C;  3HHG A;  2EJR A;  5JI6 A;  1MDM B;  2RKH A;  1O3Q A;  3F6O A;  3RJP A;  1DDN A;  1XSV A;  1XDU A;  2STT A;  1S8N A;  3LA2 A;  2NRA C;  4RGX A;  2HEO A;  2M8E A;  1D8K A;  2XAS A;  1BOA A;  3OOP A;  3NRV A;  4MQV A;  2VOD A;  2L01 A;  2L02 A;  3E6C C;  4HAM A;  4KFC A;  3KLN A;  2W85 A;  4L5J A;  3GFI A;  1FBQ A;  4RGU A;  5E8I A;  4R79 A;  1OPC A;  5HS7 A;  3KE2 A;  4HF0 A;  4MNU A;  3GFM A;  4HV5 A;  2PFB A;  1PDN C;  2KIU A;  2DPD A;  4PCQ A;  2RVC A;  1R22 A;  2KKO A;  3V4G A;  1KYZ A;  1QBJ A;  3E3V A;  2ZO4 A;  4M6Y A;  3ULQ B;  4Y13 A;  1FNN A;  3LA7 A;  1EH8 A;  2QLZ A;  1XGO A;  4AVP A;  1Z6R A;  4UXN A;  4HBL A;  1FPQ A;  1YTY A;  1X3U A;  2V79 A;  3ZPL A;  3ZP5 A;  3M8E A;  2IPQ X;  4KMF A;  1TQP A;  3E6D A;  4L9N A;  4XLP F;  2BGC A;  2COM A;  2PG4 A;  3LWF A;  5F64 A;  3WTV C;  2HFH A;  2E7X A;  3E6B A;  1S3J A;  4A6D A;  2ELH A;  5L3E A;  1DPR A;  4OMY A;  4UVB A;  3TGN A;  3C18 A;  1FSH A;  4ENN A;  3I59 A;  3H3U A;  2Y0M A;  5LRS A;  3EUH A;  2STW A;  4L0Y B;  3CLO A;  1QO0 D;  5HOO A;  2ISZ A;  1IN4 A;  4Y17 A;  3MEX A;  3F3X A;  1R23 A;  4ESB A;  4XRF A;  1H9T A;  5HDG A;  2DAO A;  1GXP A;  2DW4 A;  6PAX A;  5L3F A;  2D1V A;  4RB2 C;  3N97 A;  4I7H A;  1K7A A;  2OQG A;  2GA2 A;  1XCV A;  4UVC A;  3F23 A;  4HYE A;  2H6C A;  3ISP A;  1J0R A;  1B1B A;  3QPT A;  2P7V B;  2Z5U A;  4CXF A;  1WQ2 A;  1I5Z A;  3WU0 A;  5DYM A;  3ZN1 A;  3QRF F;  4Q5S F;  4R1H A;  3O6B B;  4EVI A;  3R0A A;  4LK1 F;  2M1B A;  1H0M A;  2VBZ A;  2A6E F;  4LK0 F;  1FLI A;  4ENK A;  3I4P A;  5LHH A;  2HOE A;  1KA8 A;  1SMT A;  3GFJ A;  1TNS A;  2IW5 A;  3P7N A;  4P5O A;  1ZHF A;  1HW1 A;  3E5U A;  2AS5 F;  2GAU A;  1S6L A;  3IRQ A;  1JXS A;  1BIA A;  3IWF A;  2JZY A;  3M8F A;  1R58 A;  2CG4 A;  2DQR A;  1TTY A;  4O6J A;  5L3G A;  4U7D A;  5ICE A;  2RNJ A;  5D5U B;  1Y0U A;  2FBI A;  2PMU A;  2KJC A;  1HW5 A;  1YS6 A;  2VT2 A;  3TOA A;  1OYW A;  1WI9 A;  3DF8 A;  1O57 A;  1C0W A;  4A0Y A;  1ZAR A;  4RS8 A;  3T0Y A;  5D5W B;  1FOK A;  4G6D A;  3L2C A;  2DTR A;  2EFO A;  4BNC A;  2P8T A;  3JW4 A;  3DP7 A;  3LA3 A;  2YX7 A;  1T6S A;  1RI7 A;  4IRI A;  1P4X A;  3FXU A;  2MBF A;  2FE3 A;  4P96 A;  2NS0 A;  2TDX A;  1FY7 A;  5F6F A;  1I27 A;  2M5W A;  5DUI A;  3KZZ A;  1K6O A;  3K1M A;  2IJL A;  3RIR A;  3GWZ A;  1YLF A;  2P7C B;  2XAQ A;  4L9J A;  4L5I A;  1Z6T A;  3DQV C;  3ZMU A;  3KP4 A;  1LEB A;  1ZH5 A;  2EV0 A;  4HDV A;  2QQB A;  2O6G E;  4HV6 A;  2NYX A;  2YSR A;  4N9I A;  5D5V B;  1H9G A;  3M7G A;  2KIF A;  4FX0 A;  1SFU A;  2GQQ A;  5FLX Z;  1I6X A;  2FMY A;  3GZ6 A;  1U5T A;  1MJ9 A;  1IZ1 A;  2DBB A;  3GLX A;  2BE5 F;  4KA4 A;  4L9T A;  2D1H A;  3RPU A;  5BMZ A;  2M45 A;  3RDI A;  4ZH4 F;  2EFN A;  1LDJ A;  1G3T A;  4EQQ A;  4A12 A;  4EMS A;  3GW2 A;  1KQ8 A;  4KIC A;  1LEA A;  3J80 K;  5JHU A;  4O3M A;  4KYW A;  1BI3 A;  1L0O C;  4HX7 A;  3PQK A;  1F1Z A;  2XVC A;  4YII A;  3GEZ A;  3IHU A;  1KU7 A;  2GXG A;  3QP6 A;  1P4A A;  2IVM A;  3K69 A;  2R7F A;  3FM3 A;  2LSO A;  3ZMV A;  4LFU A;  4LLN A;  1RIO H;  2ZNZ A;  3MZH A;  4IXA A;  3L00 A;  2ISY A;  3TO6 A;  1BI0 A;  1F5T A;  4HOB A;  3HTS B;  1UHW A;  5EEH A;  1IN5 A;  3R6S A;  4I01 A;  3F72 A;  2W24 A;  3CTA A;  1IUY A;  4U0V A;  1R7J A;  1CF7 B;  2CGP A;  4MGR A;  2EB7 A;  5IT9 K;  2PLY A;  4P9U A;  2A61 A;  1UST A;  1W7P D;  2K7L A;  5D6E A;  2K4B A;  2CYY A;  1SD4 A;  1U78 A;  4LB5 A;  2K27 A;  2HQN A;  2O0Y A;  3IRR A;  1G3Y A;  5DUK A;  3I53 A;  2BYV E;  2FEZ A;  4KN4 X;  1OYY A;  3GUD A;  2EFQ A;  2L4A A;  4KNY A;  4HZF A;  5FO5 A;  3R61 A;  4M73 A;  3BRO A;  1ZAO A;  1TQM A;  1ZN2 A;  2VBY A;  1PP8 F;  2H94 A;  5K5R A;  4HX4 A;  2UXX A;  2ADU A;  1S29 A;  5DCF A;  1XD7 A;  5AIQ A;  3GO5 A;  4RB0 A;  1ZRF A;  4EJU A;  3KP7 A;  2HS5 A;  2XAH A;  3KLO A;  4RB1 A;  2RQP A;  1IN6 A;  4TV7 A;  5CYV A;  3Q9S A;  3M9A A;  1OKR A;  4ESF A;  5A2Q K;  4RB3 C;  4BAY A;  2MC3 A;  1K78 B;  3ZMZ A;  4UUV A;  5L3C A;  1BIB A;  5J8F A;  4EM0 B;  5BOX A;  3JSP A;  1S7A A;  3BJA A;  1W7P A;  5HVQ C;  2JPC A;  2F2E A;  2LDU A;  3E97 A;  3ML6 A;  5LBQ A;  2FNP A;  3LAP A;  1I1G A;  1XMA A;  4ZYE A;  3GZ5 A;  3LFK A;  5TRD A;  3HIF A;  1J75 A;  2OAZ A;  4YFK F;  1LNW A;  2DFI A;  2ETH A;  1YFH A;  3WTX C;  2F5C A;  5D4R A;  2W84 A;  4RGR A;  1BC8 C;  1BM9 A;  1IW7 F;  2DT5 A;  5LGU A;  2VC1 A;  3G73 A;  1Z05 A;  1D3Y A;  4BH9 A;  2ACJ A;  2V1D A;  4KMU X;  1XB4 A;  4LGW A;  5CVI A;  5K5O A;  1G4D A;  3L09 A;  2EK5 A;  4WXD A;  2QYO A;  4N0B A;  4YG2 F;  2E7W A;  2PN6 A;  2P5V A;  2DK5 A;  1TW2 A;  3JAM Z;  4NHJ A;  1WRJ A;  2XRN A;  4UVA A;  3GXO A;  3I58 A;  3I0T A;  1G3W A;  1HKT A;  1FC3 A;  4I02 A;  2V9V A;  3F6V A;  3W6J B;  3SXY A;  2L54 A;  1B9M A;  4HDU A;  4A5N A; 
#chains in the Genus database with same CATH topology
 4RM3 A;  3OYD A;  2R0Q C;  1BR4 A;  1QHH D;  1VZ0 A;  4DQ2 A;  2ELJ A;  1H8A C;  4A3K J;  4CZC A;  3GTO J;  2FSW A;  2R3S A;  1EH6 A;  2IP2 A;  4MTD A;  2F4I A;  3RPU D;  1F9N A;  3DLL F;  4GO1 A;  2KDO A;  3FXO A;  3V8K A;  5EDN A;  4V19 K;  3KYD B;  1QGP A;  2P4W A;  3DXJ F;  1UCR A;  2F5D A;  3AG4 H;  5EZH A;  2VON A;  4XL9 A;  3WGI A;  1GLN A;  2G7H A;  4M72 A;  1R9T J;  5GTH C;  3NWT A;  4ASN A;  1B4A A;  3MKL A;  4U0W A;  2WAF A;  2O5R A;  4ZDL A;  1TWG J;  3K2Z A;  1PUE E;  1R5I D;  3F0C A;  1FOX A;  2IA0 A;  4Y33 A;  3Q0U A;  4R8H A;  5AON A;  4XR6 A;  2JT1 A;  4LOC A;  4CO8 A;  4KIG A;  4B43 A;  1HOM A;  2BZT A;  1NHA A;  2HWV A;  3HZJ A;  4CGZ A;  1JTX A;  2BY2 A;  4OAY A;  4N9H A;  2IRF G;  1SAX A;  1X3W B;  1YE9 A;  1YIT I;  4LMY A;  2L7M P;  2W25 A;  3E6M A;  3ZOB A;  1I39 A;  1HC8 A;  4G6Q A;  5FKM A;  1O7L A;  1X1B A;  1PP7 U;  2PJR A;  2DK8 A;  3COA C;  4V2F A;  3J80 Z;  4E6K G;  2LFB A;  4ESJ A;  4RAY A;  3REO A;  2H27 A;  2R7X A;  1RR8 C;  2JSC A;  3TP0 A;  5DD4 A;  2MFZ A;  3HSE A;  2D45 A;  4XON A;  1IUF A;  3H35 A;  3HRT A;  3Q0W A;  5KAF C;  5BS6 A;  3AAF A;  1XMK A;  3KEY A;  2K9Q A;  1QZY A;  1SVL A;  3GFL A;  3QAH A;  2GXB A;  1MZB A;  3L7W A;  2ZKZ A;  3RSN A;  4E70 A;  2CMP A;  1RC9 A;  2HYF A;  2WA0 A;  3O8G A;  2MSY A;  1R00 A;  4CCJ A;  1YJN I;  4L18 B;  2OC6 A;  2XV4 S;  1ZG3 A;  4BYY A;  3S2D J;  2JSP A;  3JRD A;  5KVR A;  2AHQ A;  5JFR A;  2X85 A;  5BPI A;  3T1B A;  3OYE A;  2R5Z B;  2H09 A;  5FRM A;  2ZXI A;  2RDP A;  5KK1 A;  2FBH A;  2VQC A;  3VEP A;  1PUF B;  5ERI A;  3S1Q J;  2F4M B;  2XAF A;  3L1P A;  5JLW A;  5DCM A;  3Q5F A;  2YX4 A;  3ZGK A;  2MLG A;  4D9J A;  1PVE A;  3RCO A;  2PEX A;  1TNT A;  2ZSH B;  5C4X J;  1GXQ A;  1TBX A;  2ZCW A;  2V1N A;  3CJN A;  1SAN A;  4JBA A;  5ILU A;  4IHV A;  4NQW B;  4A3B J;  3ABL H;  5HLT A;  3HTU A;  1ZEL A;  4EJT A;  2KJB A;  1IN8 A;  2RC4 A;  2VKH A;  3IL2 A;  1MGT A;  1ZR4 A;  1ZG1 A;  4II3 A;  4HNV A;  4HQE A;  2O8K A;  2ESN A;  4RMN A;  2XF6 A;  2K85 A;  2LF7 A;  3I59 B;  2CUE A;  1MJB A;  3VFZ A;  1ODD A;  5IP6 A;  2M30 A;  2RN7 A;  3A0B C;  3LOC A;  2WWY A;  2DDB A;  5C44 J;  2WTE A;  1JJ8 C;  2B0L A;  2WC2 A;  4PFP A;  2NAZ A;  4IO9 F;  4UHT A;  3HOU J;  4E7I A;  1LFU P;  3A4C A;  3GX4 X;  4I0A A;  2CV0 A;  4HNT A;  4BAC A;  1RUO A;  1P92 A;  1AHD P;  2LNB A;  2P6T A;  2P5L C;  3KYC B;  1MNM C;  3WTW C;  4XKW A;  3BR6 A;  2CS3 A;  2CRG A;  2LLK A;  4BHP A;  3GTK J;  1DU0 A;  5F27 A;  4M74 A;  1FYL A;  2LY2 A;  4OOI A;  4GCV A;  2O03 A;  3CUQ A;  4G8X A;  3I9V 2;  5H6Q A;  2IA2 A;  1UG2 A;  3K70 D;  1E3H A;  3E5Q A;  4JX6 A;  2HKX A;  3VOD A;  4MLO A;  4QIW N;  3FMR A;  3TO9 A;  4Q4Z F;  2NVU B;  2X6O A;  4GGG A;  3UKG A;  3GTM J;  2XGC A;  4C3H J;  1KYW A;  1WI3 A;  2IGM A;  3ZQH A;  1DGR M;  4ZTJ A;  2RV8 A;  2I5U A;  4FT8 A;  3WGH A;  3LAJ A;  1ACI A;  5K5Q A;  3OYG A;  2PI0 A;  2GIV A;  4LB6 B;  2NNY A;  3F21 A;  5B1A H;  3TKY A;  1VQO I;  1TLH B;  5ICG A;  1YIO A;  4S05 A;  2EH3 A;  5E3M A;  2HYJ A;  3J81 K;  3DKW A;  3IUO A;  4CHU A;  2FJ1 A;  2K9M A;  3ECO A;  4ZC3 A;  4BBS J;  2H8W A;  2VN2 A;  2GOX B;  2CSO A;  3G1L A;  3WHB A;  1JE8 A;  4CH7 A;  3KIO A;  4DYC A;  4Z6Y A;  4UUS B;  1FT9 A;  2OV7 A;  3JTH A;  1TP4 A;  2QQ8 A;  5ILS A;  1YW9 A;  5TGT A;  3FF5 A;  4F3Q A;  4A3I J;  3KZI C;  5F08 A;  1YJ9 I;  2RRE A;  1MSE C;  4M3D A;  4QWQ A;  1YW8 A;  4BXF A;  5LEJ A;  2ZBK A;  3J81 Z;  2BXZ A;  1XN7 A;  3GTG J;  1LVA A;  3LL7 A;  1Z3Y A;  2W48 A;  3BTC A;  1YHQ I;  2RGV A;  4CIC A;  1P9Q C;  1F43 A;  5DCM B;  2KP6 A;  4PJN A;  2X1C A;  1U9O A;  1HLV A;  3QU6 A;  4B48 A;  5E18 F;  2FQ3 A;  2M87 A;  3WGG A;  1WJB A;  4PSX A;  4IHS A;  2LC2 A;  1FBS A;  1T0F A;  1HBX G;  3Q0V A;  3F8F A;  3DEU A;  4BS9 A;  4AVZ A;  3LQR A;  1AWC A;  1I1S A;  4Y15 A;  3FXR A;  4I99 C;  5JVT A;  4F52 A;  1WVR A;  1MH4 A;  2R92 J;  5F0H A;  4JQF A;  1Y56 A;  3K70 C;  2R7U A;  4BEH A;  1FTZ A;  3ZMD A;  4EJO A;  2WY7 Q;  3SZP A;  4LJZ F;  4MFD A;  2PMZ A;  4XLA A;  1R5H A;  4RAG A;  3OV8 A;  3KZY A;  4PUS A;  4Y52 J;  3CCU I;  1VI0 A;  4D0P A;  1SD7 A;  2VJJ A;  1AOY A;  3I5U A;  1D5Y A;  2J5P A;  3E1S A;  2NXN B;  1T2K A;  2E1C A;  3PL8 A;  2MGQ A;  3MFK A;  1S7E A;  3HHH A;  2K02 A;  1FYK A;  2VKE A;  4OU0 A;  1JT0 A;  2L0K A;  4EJV A;  1O3T A;  2KL4 A;  1Y8R B;  1UHS A;  1A6Q A;  1P6R A;  2HR3 A;  2Q2E A;  2R7D A;  2TCT A;  3ZN0 A;  2H6B A;  3MWM A;  2X48 A;  4ZZD A;  1IJW C;  1TWH J;  4EJW A;  5GAG J;  2ZME B;  1GV2 A;  1JTY A;  2HQR A;  3U1K A;  2NS7 A;  4U7B A;  2MLK A;  3I55 I;  2MW8 A;  2M34 A;  3SQN A;  4BY7 J;  1YO5 C;  2YU3 A;  4AYB N;  1DP3 A;  4HX8 A;  2VXZ A;  2QUF A;  4LD5 A;  3TW6 A;  1JKO C;  2XB0 X;  2E2I J;  1GV5 A;  4M9X A;  4X1E A;  3H3V K;  2JPB A;  3BZK A;  3KEQ A;  2VC0 A;  3WE3 A;  1XGS A;  3MKY B;  2VQG A;  2CW8 A;  4LLL A;  2EIM H;  2QBY A;  4ON0 A;  3SZT A;  2Z33 A;  2FML A;  3D0S A;  3IWZ A;  4IL6 C;  5EEA A;  2FBK A;  2VT3 A;  5J40 A;  2XGE A;  1BI1 A;  1LQ1 A;  2LBF B;  3T5X A;  3FXQ A;  1R49 A;  5FKL A;  3T8T A;  2GIZ A;  5DDG A;  2JRM A;  4QTR A;  4GYG A;  4Q48 A;  3RI4 A;  2LY9 A;  3FMQ A;  3MQ0 A;  4B8X A;  3JSO A;  3ECH A;  2DLL A;  4DW6 A;  2XF7 A;  2RAE A;  1DPU A;  1ONV A;  1UFM A;  3F9K A;  3MN2 A;  4NB5 A;  3I56 I;  3CO6 C;  3K4C A;  1A5J A;  4EV0 A;  3HRS A;  3ASN H;  1TQI A;  2YPR A;  5LLQ A;  2ECB A;  1D1B A;  3HPG A;  1K78 A;  4CYC B;  2OBP A;  3Q3S A;  3VYR B;  4MQ9 F;  1K83 J;  4E4H A;  3JRC A;  3S2H J;  1MMD A;  3S14 J;  1MDM A;  1P4W A;  2G0E A;  2LMD A;  2M3A A;  4MFE A;  4AWX B;  2LY1 A;  1D8J A;  2UZK A;  2JTV A;  4XBF A;  2M9H A;  5CVV A;  3OL3 A;  3MKZ A;  1RRJ A;  1NH3 A;  3V7C A;  2KMU A;  1SMY F;  5HLI A;  2NVX J;  1FMW A;  1LDD A;  1ZG5 A;  2XRO A;  5CVJ A;  4RAF A;  1ZRE A;  2WAD A;  3L9F A;  2V1U A;  2P5K A;  3I64 A;  4YFN F;  5FB2 A;  1V3F A;  2B9S A;  1RET A;  3ABU A;  3H9G A;  5BQT A;  3HL2 A;  2R5Y A;  4BJT A;  3IC7 A;  1G6N A;  3P9I A;  1KU2 A;  4B4C A;  2MA3 A;  1T08 B;  4FE4 A;  3F8N A;  5JLX A;  1OR7 A;  2DJN A;  4F55 A;  1WKM A;  1TWA J;  2EZH A;  2HYG D;  2DI3 A;  1D0Z A;  2OTJ I;  2BY3 A;  2HTJ A;  2IA1 A;  3F8M A;  3QYF A;  5CVU A;  3OYM A;  2VUM J;  5B3S H;  5EG0 A;  1P7J A;  3AG1 H;  3EYY A;  4ZZL A;  1UHM A;  2B7E A;  1BC7 C;  3QPL A;  2QCO A;  3C2H A;  2DA2 A;  5A2Q Z;  2QQA A;  4XKC A;  3H92 A;  1QRY A;  1E2X A;  1SFX A;  3MD2 A;  1D5V A;  4BHB A;  4I09 A;  1ETY A;  4EEF G;  5FFX A;  2Y48 A;  2UXN A;  3JRA A;  2K86 A;  4N4O B;  1CQT A;  4G7H F;  1W4M A;  2NVY J;  3T8R A;  1E3O C;  3BG5 A;  3FK7 A;  2MH9 A;  3L2U A;  5CKT A;  2VJI A;  1OCT C;  3CDI A;  1R1T A;  2MC4 A;  3KEO A;  2BV6 A;  1YG2 A;  3C1D A;  2HOT A;  1EA3 A;  4Y7N J;  3M1C A;  4LG0 A;  2JWT A;  3BJ6 A;  4ETS A;  2Q8K A;  1BI2 A;  3PFI A;  4E7S A;  1XGM A;  4E7K A;  2W82 A;  2VXD A;  3HRU A;  3PJR A;  3B73 A;  3CZ6 A;  3RYP A;  1V5E A;  4HG2 A;  2XHK A;  1USS A;  2UV1 A;  2R7S A;  3G3Z A;  4L9V A;  1Z21 A;  5L3D A;  3X2Q H;  2V26 A;  1IXC A;  1HXD A;  3DKY A;  2DOA A;  3C3W A;  4ENJ A;  2E1M B;  4XOT A;  4UY8 I;  1FYM A;  4M6V A;  2HDW A;  4J01 A;  2ZFU A;  1U9N A;  5LFA A;  4XRS A;  5B66 C;  2A6T A;  2FOK A;  5AIP A;  2EQR A;  5TIS C;  2LTP A;  1QPM A;  5GP9 A;  1GT0 C;  1Z3X A;  2FQ4 A;  2Y9Y A;  4CCK A;  5IYB J;  2VIX A;  5LGT A;  2ECC A;  3TBI A;  1J7K A;  1ON2 A;  3HOV J;  4HF1 A;  4AD9 A;  3OYF A;  3NAU A;  3L2V A;  3QPS A;  3FXM A;  1VTN C;  2VE8 A;  2FF4 A;  3TW7 A;  4ZJZ A;  2FXA A;  1WSU A;  1A35 A;  1U5T C;  4WF2 A;  4HW0 A;  3AL0 C;  3DFG A;  5EEG A;  4BJ6 C;  1XG1 A;  1X58 A;  3OYH A;  1D1A A;  2F5E A;  4EAT A;  3MCZ A;  4M9Z A;  3WOD F;  5IT9 Z;  2ZJ2 A;  4IF4 A;  3DBR B;  2Y31 A;  1K61 A;  2DO7 A;  5EGO A;  2JVG A;  4PJJ A;  4E7L A;  2HKO A;  1M1E B;  1YOV B;  3SEZ A;  4K2E A;  1A31 A;  4KDP A;  1U3E M;  1ON1 A;  4IRH A;  3KP5 A;  2LRD A;  2OA4 A;  2HU9 A;  3HUG B;  4HA8 A;  3S17 J;  1JJ6 C;  2VOP A;  4KJZ A;  1LPQ A;  5F0C A;  5HLH A;  1VFC A;  2R7Z J;  1MD0 A;  1UG0 A;  4PSW A;  3ZCO A;  1FP1 D;  1ZRC A;  4HF2 A;  1TWF J;  4OAZ A;  1WWX A;  3G2B A;  4IQ4 A;  3EUH C;  4MEY F;  1O7F A;  1ETQ A;  2FA5 A;  1T8I A;  3KFW X;  2R7T A;  4UNO A;  4A3D J;  1FX7 A;  4RM2 A;  3WU1 B;  2ZNY A;  4I6Z A;  2WB1 N;  3DU5 A;  5DTD A;  4JOM A;  2WAE A;  2JA5 J;  1HSJ A;  2A68 F;  2HQA A;  4B09 A;  5TJJ A;  1O4X A;  3RZO J;  3FK6 A;  1UZC A;  1KU3 A;  2BBY A;  4NBQ A;  3P9K A;  2ELK A;  5DV5 A;  2Y9Z A;  3C7J A;  3ROU A;  1YW7 A;  1KON A;  3A1Y A;  2XAG A;  4GXO A;  1TW3 A;  1D1C A;  2WAQ N;  1LJ9 A;  1IRF A;  1BN5 A;  2KIM A;  2L7K A;  3KX2 A;  4F91 B;  4YIF A;  1MJA A;  5F0F A;  3J7Y J;  2R5Z A;  1F36 A;  3BOQ A;  3M3Y J;  4A0Z A;  2D5V A;  4HQM A;  3PNV A;  3DCF A;  1IN7 A;  3K4M A;  1U0J A;  5CQE A;  2R7R A;  4IKF A;  1CGP A;  2P6S A;  4GFB A;  2XKO A;  5D6F A;  3VOE A;  4FE7 A;  3SHF A;  4X6A J;  1OFC X;  4IHX A;  1W5S A;  2HVQ A;  2EIK H;  1ETX A;  1SVO A;  1WH7 A;  3WG9 A;  1Y1W J;  1B72 B;  1BJA A;  3GTL J;  2E36 A;  3G1O A;  3M8J A;  4LIV A;  4A5M A;  1WPK A;  4OIP F;  4NQW A;  4D5F A;  4XKV A;  1ETW A;  1R1V A;  2CQ7 A;  2YR2 A;  4PGG A;  2FU4 A;  1X4O A;  4CZZ A;  3DPL C;  2QEN A;  5CPR B;  3CDL A;  2X4H A;  1R5G A;  4IVN A;  4ZYD A;  2BHZ A;  1R36 A;  4QLC U;  3H9Q A;  2MD0 A;  4WCG A;  1FZP B;  4BY1 J;  2R93 J;  5ILV A;  2V9K A;  5J8C A;  2NNN A;  2XB5 A;  1QQI A;  4UV8 A;  3WG7 H;  3H5R A;  3V7R A;  2DMQ A;  3JRH A;  2QSH X;  3FXJ A;  2HGC A;  2BEO A;  1Z1D A;  1BOB A;  5HNF A;  3BZC A;  4XM3 A;  2QM3 A;  1MNE A;  2ZJQ F;  3VYT B;  4NNJ A;  4BL0 B;  3G4S I;  2KRF A;  1IRZ A;  4WWC A;  2COB A;  2LP0 A;  2L2O A;  2M8G X;  3K2A A;  3U2R A;  3WE2 A;  4S04 A;  2LD5 A;  2GBY A;  3OYC A;  3LSP A;  2BW3 B;  2O8X A;  5FKK A;  3W2V A;  5D4S A;  2PBI A;  1PJR A;  2R7Q A;  2W57 A;  3VB2 A;  1IRX A;  1BBY A;  3O2P E;  2IXS A;  1OCP A;  2A05 A;  2O3F A;  1IC8 A;  1E17 A;  1SFK A;  1RR7 A;  3F8B A;  2EFP A;  2DMT A;  4FIS A;  1XGN A;  3S3O A;  3OYB A;  1Z7U A;  3V7S A;  4O5V A;  3M1E A;  4MTE A;  1MBF A;  4PFO A;  2CJJ A;  3LST A;  3RKY A;  5E8G A;  2AXL A;  3CP2 A;  3BP8 A;  3JRE A;  4GYI A;  4DNC A;  5C4J J;  1VQN I;  5LD2 C;  1S9H A;  4PGH A;  3HUG A;  1KU9 A;  3QQA A;  1G3S A;  2L4M A;  1TT5 B;  4P55 A;  1J2X A;  4XQF A;  3LFU A;  4BQA A;  3HYI A;  4H4K C;  2WY8 Q;  4MHG A;  3ZQ7 A;  2DA7 A;  1XTA A;  3BQZ A;  4OMZ A;  4XLN F;  4S0H B;  2HDC A;  5ICF A;  5HLG A;  3BJO A;  1J9I A;  4H0E A;  2KIQ A;  1MKM A;  3E5X A;  3HRM A;  1R4N B;  1YYV A;  1LFB A;  2BY0 A;  2L7Z A;  4AYB A;  2QEX I;  1U5T B;  1ETV A;  4JX4 A;  4PK4 A;  1QA6 A;  1FEX A;  4RBO A;  2V6C A;  5IOZ A;  1Z77 A;  1DQU A;  2E2H J;  3K4K A;  1BR1 A;  3EUA A;  3S2W A;  2CO5 A;  1KZH A;  4ZYH A;  3W6K B;  4FX4 A;  1YX3 A;  3O3K A;  4Z2Y A;  2K3F A;  2ZME C;  1AKH A;  4HLX A;  4G94 A;  1N25 A;  1ORK A;  2K4J A;  1T95 A;  3CC2 I;  4F93 B;  4YRV A;  1HKS A;  3RQ4 A;  3BWG A;  4U0Y A;  2X6Y A;  3R0J A;  2CW7 A;  2DT7 B;  1MMA A;  5LRR A;  3ZQL A;  4ZDO A;  2Y75 A;  4XLE A;  2QF7 A;  5FGM A;  3JAM K;  3LQQ A;  3K1P A;  1SC7 A;  1YI2 I;  1ZRD A;  3OYI A;  3OWT A;  3FKJ A;  2CWE A;  4M9S A;  5L3B A;  3CCV I;  2EIN H;  3GVA A;  5HDK A;  5D5X B;  4XID A;  1MMG A;  2OD5 A;  3FX3 A;  4PJL A;  1V5G A;  2OTL I;  4II2 A;  5DD8 A;  5FLV A;  2M4G A;  3JR9 A;  2LKX A;  3WTU C;  2W00 A;  2G9W A;  5CLS A;  5EJC A;  2V1X A;  1TL8 A;  2KFD A;  4BEH B;  2Z3Y A;  2KZV A;  1QPI A;  1WJF A;  1W36 D;  4MIM A;  5CJ9 A;  1ETK A;  2DMN A;  3V8J A;  1HST A;  2WV0 A;  1IF1 A;  1Z67 A;  1B9N A;  4XRM A;  1SD6 A;  1IGN A;  1JHF A;  1R4M B;  5ICC A;  4HEA 2;  5M3M J;  4G7Z F;  2LF8 A;  5K1Y A;  3MKW B;  3O8H A;  1KQ0 A;  2EZI A;  1JKR C;  4ZDP A;  1HCR A;  4UV9 A;  3TMO A;  4L0Z B;  1STZ A;  5J1R A;  3CDH A;  2QSF X;  4DOZ A;  1APL C;  2Q2E B;  2VE9 A;  1KQ9 A;  5IT3 A;  4PDK A;  4QPQ A;  3C2B A;  1J59 A;  3A0H C;  3BTL A;  2ZFW A;  5DM6 F;  1O3S A;  1VQ4 I;  3AG3 H;  1LDK B;  2ZXJ A;  3CES A;  5E1Z B;  2MH2 A;  1V55 H;  1DUX C;  4HPQ A;  3UNG C;  1ETO A;  1JUM A;  2PMH A;  5IYD J;  1JHH A;  2AXT C;  4C2T A;  3ZQG A;  1SEU A;  3CCR I;  3ERE D;  3ZRG A;  4ABZ A;  1OYI A;  2L5Q A;  4HSR A;  4BE2 A;  4A6E A;  4BU2 A;  4JK1 X;  3RKX A;  4RAZ A;  1OMI A;  3ZR8 X;  2OF7 A;  4BHC A;  3BG7 A;  3BTI A;  3KCC A;  3WTT C;  1ENH A;  4C2U A;  4BJ5 C;  3PIO F;  2QBY B;  4YIR X;  3HOX J;  5FD6 A;  2HTS A;  3CJQ B;  3DPT A;  4L5E A;  2EV6 A;  2OU2 A;  3GLL A;  4U88 A;  2BVL A;  1Y6I A;  4CDG A;  2F6C A;  1Q1H A;  1IDZ A;  4CA0 A;  2LBF A;  5HDN A;  2XAJ A;  3A01 B;  3E7L A;  4NUB A;  3PUB A;  2JJ7 A;  4OIR F;  1DU6 A;  3QP5 A;  3IKT A;  1V5F A;  2DFH A;  4A3M J;  2WB1 A;  3FM5 A;  2PJP A;  4KIS A;  4KIT B;  4BXX J;  1MMN A;  1R6R A;  2DT6 A;  3RKW A;  3TOB A;  1OCO H;  1G8X A;  2XRL A;  2GA1 A;  3FMS A;  3LSG A;  2XAU A;  3TDZ C;  4FTH A;  2VBX A;  4CUG A;  3HOT A;  5E1W A;  2VJ4 A;  3ZMS A;  5B5E C;  1Y39 A;  2DMP A;  3FDY A;  2A6H F;  3JCU C;  2QKM B;  5E20 A;  4DBQ A;  1UB9 A;  3OYA A;  3A02 A;  2QZ8 A;  5JHF A;  2VOO A;  2VPR A;  1O3R A;  3I4N J;  4Q47 A;  5DEQ A;  2UUZ A;  4EGZ A;  4IPA A;  2CFX A;  3KP6 A;  2C6Y A;  2K9N A;  2Q0O A;  1WGX A;  1Z0X A;  4M3E A;  4WK8 F;  3I71 A;  1IDY A;  2CU7 A;  3CCE I;  5GTI C;  1T0F C;  3EYI A;  1A04 A;  1LUJ B;  4AIK A;  2IGN A;  3BR1 A;  1FBU A;  5J47 A;  2E1O A;  5FD5 A;  4E7Z A;  2DA5 A;  1EV7 A;  2H8R A;  4KIF A;  2HVS A;  2L7F P;  5CVR A;  1GHC A;  2DA4 A;  3OIQ A;  1IV8 A;  5IP9 J;  3CCL I;  1ZLK A;  4BDY A;  1RKW A;  4KN7 X;  1T98 A;  1XSX A;  3RPQ A;  5JR3 A;  1ULY A;  2YU9 J;  4IHT A;  3S93 A;  1JGS A;  1OR7 C;  3OOU A;  1Z9C A;  2IS2 A;  3DKX A;  4CYD A;  1X2N A;  2LR8 A;  2VL8 A;  2E1M C;  3S3N A;  2KQR A;  2KLO A;  3RQI A;  1U6G A;  4A3C J;  1ITY A;  1ZLJ A;  1JUS A;  2EA4 A;  4M3B A;  3JTG A;  1YRN A;  4OWR B;  2OZU A;  1MBE A;  1W7P B;  2GWR A;  1JUP A;  1T38 A;  3HOS A;  1YIJ I;  2I8D A;  3H3Z A;  5LGN A;  2GM4 A;  1K6Y A;  2X0L A;  3CC7 I;  2IGK A;  3R60 A;  1ZQ3 P;  3K1N A;  2EA2 A;  3EPZ A;  3ABT A;  1FSE A;  1GUU A;  3HXL A;  3FXL A;  3PM1 A;  4ENM A;  3LSR A;  3U1D A;  2ZXH A;  2OZ6 A;  2DA1 A;  5E1X A;  3MZY A;  1SFE A;  2Y30 A;  5LEK A;  1PUF A;  3F8C A;  1E3P A;  2FNA A;  3N4M A;  1MBJ A;  2CUJ A;  4A3J J;  2B63 J;  3OIP A;  3J7A O;  3CUQ C;  4PJM A;  3FIW A;  4LG0 B;  1IG7 A;  4DJA A;  3D5R C;  4BDZ A;  2GOM A;  2X1D A;  1XS9 A;  1WJ5 A;  1ZGW A;  4OIQ F;  1DP7 P;  3K4B A;  1CF7 A;  4M71 A;  1QU3 A;  1IO2 A;  3IKV A;  1FMV A;  3W2A A;  2GZW A;  3NWS A;  1Y1V J;  4HLY A;  1LVK A;  4NC6 A;  3K4J A;  1EJ9 A;  5LHI A;  4A93 J;  3OSF A;  2JA2 A;  2QVO A;  3CF2 A;  4FHT A;  1S72 I;  1W5T A;  2R7W A;  5FKN A;  3EDP A;  1RZ4 A;  2K9S A;  2E5N A;  4ZYG A;  3J7A Y;  3ZQI A;  2ZME A;  1BJZ A;  3D5L A;  5HS8 A;  1LB2 A;  4KT5 C;  3F22 A;  2XKP A;  4MEX F;  3BPX A;  3K0L A;  2X1E A;  2DYR H;  1IRG A;  3HSR A;  2JRT A;  1HQC A;  1IV6 A;  2D2W A;  3DV8 A;  4CCL A;  4RLF A;  3H1C A;  5E17 F;  2ID3 A;  4OIN F;  2XGX A;  2O61 A;  2QKL B;  4I76 A;  4XNF A;  5GPC A;  4A3F J;  1B59 A;  3I54 A;  4A2U A;  3H5N A;  3BPV A;  1IAW A;  4YFX F;  1U8B A;  1MH3 A;  4KIB A;  2X51 A;  4LIT A;  1Y0N A;  1ZGA A;  1NK3 P;  2DXI A;  5J1Y A;  3CO7 C;  3KYL A;  2Z99 A;  3QOP A;  3BR2 A;  3EET A;  3SEQ A;  4EM2 A;  1FWZ A;  2ZSI B;  3CUQ B;  2DDA A;  2RQQ A;  1XMX A;  4A3E J;  2DPU A;  3QU3 A;  1BW5 A;  1EF4 A;  1JI8 A;  1P7I A;  3BDD A;  3ZMT A;  4C3J J;  4BXU A;  1KGS A;  3HKZ A;  5J6X A;  2LG4 A;  1HDP A;  4I98 B;  3DBH B;  2JN6 A;  3ZQF A;  5E3N A;  1YJW I;  2XIG A;  2VJ5 A;  3BZ6 A;  1RES A;  3D5S C;  4XN3 A;  1L3L A;  2A3S A;  3FIS A;  1XSD A;  3DTI A;  5F1R A;  4J19 A;  5H20 A;  1B6A A;  1HW2 A;  3BT9 A;  3DPU A;  5M5Y J;  2PQ8 A;  2A5Y B;  4UB6 C;  4HST A;  2UWM A;  5BNG A;  3S8P A;  4E7J A;  2IS1 A;  2K9L A;  4IEJ A;  1BR2 A;  2VBW A;  4AIH A;  2F5F A;  5E3L A;  1GVJ A;  1YRN B;  3I3L A;  4IJA A;  1EH7 A;  4WXH A;  5FLX K;  4XN0 A;  1S7O A;  2DYS H;  9ANT A;  2E5Z A;  4M3F A;  1REP C;  4EM1 A;  4LLG F;  2FRH A;  4GRI A;  3K9T A;  4AIJ A;  4IHW A;  3KP3 A;  4ZTF A;  4B3X A;  1WJE A;  4XSZ F;  2X6X A;  5FJ8 J;  1VQ5 I;  2LKP A;  3H9J A;  5D8L B;  2J5O A;  3Q9V A;  3VPR A;  3ELK A;  4P9F A;  3MZ8 A;  3WTZ A;  4WX9 A;  2A69 F;  4BQN A;  3HBL A;  3WTY C;  4PJ0 C;  4A0X A;  4XSX F;  1K79 A;  2XUB A;  2Y0S A;  3RTR A;  1T33 A;  3QPH A;  4IQJ A;  1WFX A;  1ZGJ A;  1VQP I;  3JRI A;  3IH2 A;  2HPI A;  2QWW A;  3CUO A;  2HZT A;  3RYR A;  1OCC H;  3LMM A;  3TED A;  3V8L A;  4KUM A;  1QNT A;  2ESH A;  5EYR A;  3U21 A;  1V4R A;  3FZV A;  3FBI B;  2MD5 A;  5C3E J;  5LHG A;  3KP2 A;  3R4K A;  1XCB A;  2RNG A;  3NEU A;  3VWB A;  1FP2 A;  2EBI A;  2VQL A;  2EFW A;  1HDD C;  2H1L A;  2OQR A;  4XKB A;  3SFZ A;  3LSM A;  5H6R A;  4JYK A;  4NC8 A;  3GTP J;  1P2F A;  3U9G A;  5F1J A;  2JA6 J;  4M6X A;  4B1R A;  1U8R A;  3A2K A;  2MG4 A;  1X4P A;  3PQJ A;  3TQN A;  3S1R J;  4Y3O A;  1U2W A;  1SD5 A;  2I10 A;  2EIJ H;  3ZQC A;  3BY6 A;  2IBD A;  2KPM A;  1YQA A;  3TO7 A;  1Z91 A;  2A07 F;  3HSF A;  3BTJ A;  2G7U A;  4F7Z A;  1IXS B;  3SDG A;  4A3L J;  1RUN A;  4YEL A;  1XDS A;  1H88 C;  4G7O F;  4JP0 A;  1N75 A;  2QQ9 A;  4EGY A;  3OS2 A;  1VQM I;  1ZYR F;  4XLH A;  1HKQ A;  3EQL F;  2A5W A;  2DA3 A;  5FLM J;  1RNL A;  4HNU A;  5M5X J;  2L3D A;  3DBL B;  4G9Y A;  5FFZ A;  3KET A;  2DU9 A;  3P9C A;  5IPA A;  1VQ9 I;  5HS9 A;  4IRG A;  4RGS A;  1QZZ A;  2Q1Z B;  4G12 A;  2CQK A;  4OIO F;  3PSI A;  1IXR C;  2W4S A;  5CQG A;  2ZXW H;  3B02 A;  2EWN A;  4I2O A;  5FRO A;  1K4S A;  1F4K A;  1T56 A;  1VQ7 I;  1T39 A;  4I0B A;  2EV5 A;  2LH9 A;  2E1N A;  4W97 A;  1J5Y A;  2CW0 F;  2Y69 H;  5B1B H;  5D8K B;  1R1U A;  3FHZ A;  4PZJ A;  2IT0 A;  3HC7 A;  1QVU A;  3WTS C;  1YS7 A;  2DQL A;  2HQ5 A;  3FWE A;  3GF2 A;  4WXC A;  5J4Y A;  2BXY A;  2EIL H;  3J7Z I;  4UB8 C;  2EZL A;  3MAJ A;  2Z9O A;  5ED4 A;  1LE8 A;  3NQO A;  5BPD A;  4BQO A;  3TDU C;  2IEK A;  3HHG A;  4B3A A;  2XF5 A;  2EJR A;  5JI6 A;  1MDM B;  2RKH A;  1GVD A;  1O3Q A;  3F6O A;  3RJP A;  2F48 A;  3W2W A;  3OS0 A;  1DDN A;  1MND A;  1XSV A;  1X1D A;  2KHM A;  3IH4 A;  1XDU A;  4F92 B;  2STT A;  1S8N A;  3KPH A;  3LA2 A;  2NRA C;  4RGX A;  2HEO A;  2M8E A;  1D8K A;  2XAS A;  1BOA A;  3OOP A;  1J09 A;  3NRV A;  4MQV A;  2VOD A;  3OYK A;  3LSJ A;  5K7Z A;  2L01 A;  2MAB A;  2FUG 2;  2CFO A;  2L02 A;  3OL4 A;  4HAM A;  3E6C C;  4FAS D;  4JX5 A;  3E0J B;  4KFC A;  3OYJ A;  1YX5 A;  2VB6 A;  3KLN A;  2W85 A;  4L5J A;  2P81 A;  3BC8 A;  3GFI A;  1FBQ A;  4RGU A;  2PX9 A;  2AQF A;  5E8I A;  4R79 A;  3AG2 H;  1OPC A;  5HS7 A;  3KE2 A;  2LYC A;  4HF0 A;  2WBM A;  4MNU A;  4DZJ A;  3CMA I;  3GFM A;  1JKQ C;  4HV5 A;  2PFB A;  1PDN C;  4BQQ A;  2KIU A;  2DPD A;  1B8I A;  2DA6 A;  4CCM A;  5EG0 B;  4PCQ A;  2RVC A;  4D7N A;  5M5W J;  1R22 A;  1ZR2 A;  2KKO A;  3V4G A;  1KYZ A;  5DM7 F;  1QBJ A;  3E3V A;  2ZO4 A;  4M6Y A;  2CUZ A;  3CJT B;  3ULQ B;  4NC7 A;  4DIQ A;  1Y8Q B;  4Y13 A;  1FNN A;  3LA7 A;  3V42 A;  5EZG A;  2YS9 A;  3S32 A;  1EH8 A;  2QLZ A;  5FRN A;  2OPT A;  1XGO A;  3HGG A;  4AVP A;  1Z6R A;  4UXN A;  4HBL A;  2ME6 A;  1FPQ A;  3CLQ A;  1YTY A;  1X3U A;  3M4O J;  2TRT A;  2V4J C;  2V79 A;  3ZPL A;  4C3I J;  3ZP5 A;  2E19 A;  3SDB A;  3M8E A;  2XPW A;  3QWL A;  1JGG A;  2IPQ X;  4KMF A;  1TQP A;  3E6D A;  2NVT J;  3GTQ J;  3SJM A;  2VQH A;  4J00 A;  4L9N A;  4XLP F;  1OLT A;  2BGC A;  3S16 J;  2COM A;  2PG4 A;  2EZK A;  3LSK A;  3QYB A;  3LWF A;  5F64 A;  2L9N A;  3HB9 A;  3WTV C;  2HFH A;  2E7X A;  1VND A;  3E6B A;  4MO7 A;  1S3J A;  4A6D A;  2ELH A;  5GPA A;  3MVP A;  3H0D A;  2LRE A;  5L3E A;  1Q1V A;  1DPR A;  1MBK A;  2L9R A;  4OMY A;  2KIS A;  4AUX A;  1XX5 A;  4ITV A;  4UVB A;  2JA8 J;  3TGN A;  3C18 A;  2JQ7 A;  1FSH A;  2NS8 A;  2XPU A;  4ENN A;  3I59 A;  5HNH A;  3H3U A;  2Y0M A;  3A01 A;  5LRS A;  1G59 A;  2NOJ B;  3H0G J;  3CME I;  3EUH A;  1FIP A;  4IZZ A;  2L9S A;  2STW A;  4L0Y B;  3HM5 A;  3CLO A;  1QO0 D;  5HOO A;  1IN4 A;  2ISZ A;  4Y17 A;  3GTJ J;  3MEX A;  3F3X A;  5DS9 A;  1R23 A;  2CH0 A;  4ESB A;  4XRF A;  4LG3 A;  1H9T A;  5HDG A;  2DAO A;  1GXP A;  2M7B A;  2DW4 A;  2FX0 A;  2YUS A;  3LNQ A;  3G71 I;  6PAX A;  4BE1 A;  3CQZ J;  5KHD A;  3VYU B;  2PMZ N;  5L3F A;  2D1V A;  3IV5 A;  4RB2 C;  3HGY A;  3N97 A;  1WJA A;  4I7H A;  1K7A A;  2OQG A;  1N78 A;  1RPW A;  2GA2 A;  1UAA A;  1DGW Y;  1XCV A;  4UVC A;  3F23 A;  4HYE A;  2H6C A;  3ISP A;  3L2R A;  1J0R A;  2GXA A;  1B1B A;  3ABM H;  3H36 A;  3QPT A;  3CMM A;  2M7A A;  2P7V B;  2KZG A;  2Z5U A;  4CXF A;  1WQ2 A;  1I5Z A;  2WAQ A;  3S1M J;  1AA7 A;  2FD5 A;  3WU0 A;  3CC4 I;  2HXO A;  2ZB9 A;  2V9P A;  3BCA A;  4AU7 A;  5DYM A;  3ZN1 A;  3DU6 A;  3QRF F;  1ZK8 A;  4Q5S F;  3MMY B;  4R1H A;  3O6B B;  1VQK I;  2QSG X;  1LFP A;  5GAE J;  3DWL E;  4EVI A;  3R0A A;  4LK1 F;  2M1B A;  1H0M A;  2VBZ A;  1NK2 P;  2A6E F;  2WV1 A;  4LK0 F;  1FLI A;  4ENK A;  1MW7 A;  3I4P A;  2HZD A;  5IP7 J;  4QSH A;  3S3M A;  5LHH A;  4CYC A;  2HOE A;  3BR3 A;  1KA8 A;  3GBG A;  1TWC J;  3BG9 A;  1SMT A;  3GFJ A;  3B6C A;  3GME A;  1TNS A;  2IW5 A;  1PYV A;  3P7N A;  2Z1D A;  3AL0 B;  4P5O A;  1UEL B;  1ZHF A;  1HW1 A;  3GYH X;  3E5U A;  1FOY A;  2AS5 F;  3QOE A;  2GAU A;  3VDX A;  1S6L A;  2Y2Z A;  5F04 A;  3IRQ A;  1NG7 A;  2JVH A;  1JXS A;  1BIA A;  3DEE A;  2M0C A;  3IWF A;  2N8G A;  2JZY A;  3M8F A;  5KCM A;  3VYS B;  1R58 A;  2CG4 A;  2DQR A;  3W3C A;  1TTY A;  1TZL A;  4O6J A;  4AID A;  3QYE A;  2F4O B;  3OR2 C;  5L3G A;  4U7D A;  1NG6 A;  3CCJ I;  1QHG A;  1N77 A;  2PJR B;  5ICE A;  2RNJ A;  5H2F C;  2HOA A;  3SFI A;  5D5U B;  1Y0U A;  2FBI A;  2PMU A;  2KJC A;  1HW5 A;  1YS6 A;  3NAR A;  2VT2 A;  3TOA A;  4U87 A;  1VQL I;  1OYW A;  1WI9 A;  4XK4 A;  3LSH A;  3DF8 A;  4IX7 A;  1O57 A;  1C0W A;  1VQ6 I;  4A0Y A;  1ZAR A;  4RS8 A;  2FOW A;  3T0Y A;  5D5W B;  1FOK A;  1I50 J;  1WHU A;  4G6D A;  3HDD A;  4HRI A;  5E79 C;  3L2C A;  2IAI A;  2EPF A;  3BG3 A;  2DTR A;  2EFO A;  2XSD C;  2OCC H;  4BNC A;  2P8T A;  3JW4 A;  3DP7 A;  3LA3 A;  1W5C C;  3ERM A;  2YX7 A;  1T6S A;  1RI7 A;  3GCM A;  4IRI A;  1WCM J;  1P4X A;  3FXU A;  2MBF A;  2FE3 A;  4P96 A;  4BGD A;  2NS0 A;  2TDX A;  3CCM I;  1UMQ A;  1FY7 A;  5F6F A;  1I27 A;  2E2J J;  2IS6 A;  2M5W A;  5K7H A;  5DUI A;  3KZZ A;  1K6O A;  1MMS A;  3BLY A;  4IOA F;  3K1M A;  3CF5 F;  3JRF A;  3M07 A;  3G6E I;  4DGW B;  2IJL A;  3RIR A;  3GWZ A;  3FBN B;  4CSW A;  1YLF A;  2P7C B;  1FOW A;  2VKV A;  1OCR H;  2XAQ A;  3IAS 2;  3A03 A;  4L9J A;  4P1W A;  2BW3 A;  5K7F A;  1JKP C;  4L5I A;  1Z7L A;  1Z6T A;  4DZP A;  1XC5 A;  3AKZ A;  3DQV C;  3ZMU A;  1E0E A;  3KP4 A;  1LEB A;  1ZH5 A;  1SVM A;  2EV0 A;  4N4N B;  5IY5 H;  4HDV A;  3OSG A;  5GAH J;  2QQB A;  2R7V A;  2X6W A;  1X1A A;  4D1Q A;  3PO3 J;  2O6G E;  2CUF A;  3DLA A;  2ID6 A;  4D7M A;  3EUK L;  4C30 A;  4HV6 A;  2NYX A;  2BY1 A;  2YSR A;  4N9I A;  4AC0 A;  5D5V B;  1H9G A;  2L9V A;  3M7G A;  2KIF A;  4FX0 A;  1SFU A;  2VPL A;  2GQQ A;  5FLX Z;  2W7N A;  2O9L A;  4NDL A;  1OIS A;  3OYN A;  1I6X A;  4RLQ A;  2CQN A;  2FMY A;  2LK2 A;  1K4T A;  1X3Z B;  2M4K A;  3ZXS A;  3GZ6 A;  3G1M A;  4QPO A;  1U5T A;  2OJE D;  3HOW J;  1MJ9 A;  1IZ1 A;  2DBB A;  1FJL A;  1W0U A;  3GLX A;  3WHC A;  2M2E A;  1WJC A;  2BE5 F;  4KA4 A;  1X1C A;  2Z2S B;  4L9T A;  2V7F A;  2D1H A;  1WZ2 A;  3RPU A;  5GAD J;  1JT6 A;  5BMZ A;  2M45 A;  3RDI A;  3PFY A;  2P0W A;  4ZH4 F;  3CCS I;  2EFN A;  1LDJ A;  1G3T A;  4M3G A;  4EQQ A;  4A12 A;  1OQY A;  2JUC A;  4V2G A;  4EMS A;  5E3O A;  3GW2 A;  3CCY A;  2ZJP F;  3N05 A;  1KQ8 A;  1SAU A;  4KIC A;  1LEA A;  3J80 K;  5JHU A;  3W6V A;  5EF6 A;  4O3M A;  3S15 J;  1MSF C;  4KYW A;  1BI3 A;  4FQG A;  1L0O C;  4HX7 A;  4CCN A;  2K3P A;  3PQK A;  1F1Z A;  2XVC A;  4YII A;  3GEZ A;  3IHU A;  3IH3 A;  4XOR A;  1KU7 A;  3HOZ J;  2GXG A;  3QP6 A;  2KT0 A;  2KRC A;  2KRH A;  1P4A A;  2IS4 A;  4C9Y A;  2LOO A;  2IVM A;  3HEF A;  2BVM A;  3K69 A;  1W0T A;  1R71 A;  2R7F A;  3FM3 A;  2LSO A;  2XSJ C;  3OR1 C;  3PUF A;  3ZMV A;  2JUG A;  4FCY A;  2R4G A;  2ME0 A;  2DCE A;  3BR5 A;  5KAI C;  3BCB A;  4UUS A;  4LFU A;  3K7A J;  2JA7 J;  4LLN A;  1W36 C;  4XMY A;  3VSL A;  1H89 C;  1RIO H;  2ZNZ A;  2HVR A;  4IXA A;  3SYT A;  3MZH A;  3L00 A;  2ISY A;  3TO6 A;  1BI0 A;  1F5T A;  2MYS A;  4RA2 A;  3FHN A;  4HOB A;  3HTS B;  4FET A;  1UHW A;  5EEH A;  1IN5 A;  1V54 H;  3R6S A;  2XGD A;  2OCE A;  4I01 A;  2E34 A;  3F72 A;  2W24 A;  3CTA A;  2ZJR F;  2QA4 I;  1EKE A;  5J3L A;  1IUY A;  4U0V A;  2CV2 A;  1R7J A;  3TP3 A;  1CF7 B;  5FKO A;  2CGP A;  4XOP A;  2ICW G;  3DEW A;  2K40 A;  3OIO A;  4MGR A;  2EB7 A;  3WU2 C;  3HPH A;  1QZE A;  5IT9 K;  4A3G J;  2XC7 A;  1FIA A;  2DFE A;  2HPM A;  2PLY A;  4P9U A;  3ESW B;  3OYL A;  2A61 A;  1UST A;  2VLA A;  1W7P D;  2K7L A;  5D6E A;  2K4B A;  1TC3 C;  3K6G A;  3S1N J;  2E35 A;  3PO2 J;  2CYY A;  2E60 A;  1S5L C;  1SD4 A;  2V6E A;  3P5J A;  1U78 A;  2E71 A;  4LB5 A;  2VAS A;  1I3A A;  3IP4 B;  2K27 A;  2BOL A;  4AM3 A;  4LIU A;  2HQN A;  3FKI J;  2O0Y A;  1ZKG A;  4YEJ A;  3IRR A;  1G3Y A;  3L2Q A;  4XLF A;  4ANJ A;  2AQE A;  3I53 A;  2ZC2 A;  3PNY A;  5DUK A;  4XRS G;  2BYV E;  2FEZ A;  4KN4 X;  5J4V A;  1OYY A;  3GUD A;  4B44 A;  2M0M A;  2EFQ A;  2L4A A;  3RKQ A;  2AO9 A;  4ZYA A;  2OUM A;  4KNY A;  1RKT A;  4HZF A;  2CQX A;  5FO5 A;  1WJD A;  3SZG A;  3B6A A;  3R61 A;  1LE8 B;  1BW6 A;  3AFH A;  2XDV A;  1TT0 A;  4M73 A;  3BRO A;  1ZAO A;  1TQM A;  3JRG A;  4Y4R A;  2DJI A;  1ZN2 A;  4D5C A;  2VBY A;  1MIJ A;  4W1U A;  5M3F J;  1PP8 F;  2H1K A;  2H94 A;  3PNT A;  5K5R A;  4CCO A;  4HX4 A;  2UXX A;  1VQ8 I;  2ADU A;  2O7O A;  2CQQ A;  4KT6 A;  1S29 A;  2DN0 A;  1I6H J;  2R7O A;  1GDT A;  2DOE A;  2X9D A;  5DCF A;  1XD7 A;  5AIQ A;  3GO5 A;  3D1N I;  4UUT A;  4RB0 A;  5EGO B;  2LVS A;  4EJU A;  1ZRF A;  3KP7 A;  3VSK A;  2HS5 A;  3TL4 X;  3BQY A;  3RZD J;  2XAH A;  3KLO A;  4RB1 A;  3JRB A;  2KDZ A;  5IOY A;  1POG A;  3QOD A;  2RQP A;  1IN6 A;  3PIP F;  4TV7 A;  1ZTR A;  2JMW A;  5CYV A;  3Q9S A;  4BUP A;  3K4L A;  3M9A A;  4C2M J;  1OKR A;  4ESF A;  3UR3 C;  1B8I B;  5A2Q K;  1W1W E;  4BAY A;  2MC3 A;  4RB3 C;  1QVT A;  2VKD A;  3ZMZ A;  1K78 B;  5L3C A;  4UUV A;  1BIB A;  5J8F A;  4XLC A;  1X1P A;  1AKH B;  4EM0 B;  4BE0 A;  5BOX A;  1HF0 A;  2Z16 A;  3JSP A;  1S7A A;  3L2W A;  2QGU A;  4DYQ A;  3BJA A;  1W7P A;  1SFO J;  3CD6 I;  2VI6 A;  1MBH A;  1OJL A;  3FXK A;  5HVQ C;  3HJE A;  2JPC A;  2F2E A;  2F5V A;  2DMU A;  3CP8 A;  3H5A A;  3OY9 A;  2LDU A;  3E97 A;  3ML6 A;  5LBQ A;  2FNP A;  3CJR B;  3LAP A;  2R5Y B;  3C2G A;  4BKX A;  1I1G A;  1XMA A;  4ZYE A;  5JVG F;  4IHY A;  2HOS A;  4X0G A;  3GZ5 A;  2DOD A;  3LFK A;  5TRD A;  4G6T B;  3HIF A;  1J75 A;  3ONQ A;  4GDF A;  2OAZ A;  4YFK F;  2K5C A;  3ASO H;  1LNW A;  2DFI A;  2ETH A;  1XPX A;  1LKX A;  4RDU A;  1B72 A;  1YFH A;  3WTX C;  3PSF A;  1MBG A;  1BL0 A;  4BBR J;  5IYC J;  2F5C A;  5HOD A;  3DTK A;  5D4R A;  2W84 A;  2DTZ A;  4RGR A;  1NTC A;  3HG9 A;  2HDD A;  1I3Q J;  1BC8 C;  1BM9 A;  2LKS A;  1IW7 F;  2DT5 A;  5LGU A;  4DBR A;  2VC1 A;  3G73 A;  1Z05 A;  2DFF A;  1D3Y A;  4BH9 A;  1G2H A;  2ACJ A;  1A36 A;  3HKZ N;  3I4M J;  3K10 A;  1D0Y A;  1VF9 A;  3K4N A;  1ERD A;  3LSI A;  2V1D A;  2HXI A;  2Y0S N;  1XB4 A;  4KMU X;  3CMY A;  2XPV A;  4LGW A;  1HA8 A;  3OS1 A;  5CVI A;  2BHY A;  4B47 A;  5KNL A;  2GLO A;  1X19 A;  3GZN B;  1X2M A;  1D0X A;  5K5O A;  1G4D A;  1A6I A;  1WH5 A;  3L09 A;  2NVQ J;  3CCQ I;  2CV1 A;  1UJ8 A;  2EK5 A;  4WXD A;  2QYO A;  4N0B A;  4YG2 F;  2E7W A;  2PN6 A;  4XIC A;  2P5V A;  2HI3 A;  2IGO A;  2DK5 A;  3IAM 2;  4E7H A;  1TW2 A;  3JAM Z;  4NHJ A;  3ABK H;  3ZQQ A;  2JK3 A;  1WRJ A;  2XRN A;  4IOC F;  1FTT A;  2W1O A;  1BA5 A;  3OMY A;  4UVA A;  5J1U A;  3BR0 A;  2HNH A;  3DTE A;  2DOF A;  3GXO A;  3I58 A;  3I0T A;  1G3W A;  1HKT A;  1FC3 A;  4I02 A;  2V9V A;  1AU7 A;  3F6V A;  3W6J B;  3SXY A;  3HOY J;  2NOG A;  2L54 A;  3BG6 A;  4A69 C;  1B9M A;  4HDU A;  4DYR A;  1OCZ H;  4A5N A; 
#chains in the Genus database with same CATH homology
 4DQ2 A;  2FSW A;  2R3S A;  1EH6 A;  2IP2 A;  4MTD A;  1F9N A;  4GO1 A;  3V8K A;  1QGP A;  2P4W A;  3DXJ F;  1UCR A;  2F5D A;  2VON A;  3WGI A;  2G7H A;  4M72 A;  4ASN A;  1B4A A;  4U0W A;  3K2Z A;  1PUE E;  2IA0 A;  4R8H A;  5AON A;  2JT1 A;  4CO8 A;  4KIG A;  1NHA A;  2HWV A;  4CGZ A;  2IRF G;  4N9H A;  1SAX A;  4LMY A;  3E6M A;  2W25 A;  4G6Q A;  1O7L A;  1PP7 U;  2DK8 A;  3COA C;  3J80 Z;  4ESJ A;  4RAY A;  3REO A;  2H27 A;  2JSC A;  5DD4 A;  3HSE A;  2D45 A;  3HRT A;  3AAF A;  5BS6 A;  1XMK A;  1QZY A;  3GFL A;  3QAH A;  2GXB A;  1MZB A;  3L7W A;  2ZKZ A;  4E70 A;  2HYF A;  1R00 A;  4L18 B;  2XV4 S;  1ZG3 A;  4BYY A;  5KVR A;  5JFR A;  5BPI A;  3T1B A;  2H09 A;  2RDP A;  5KK1 A;  2FBH A;  3VEP A;  5ERI A;  2XAF A;  3Q5F A;  5DCM A;  2YX4 A;  2MLG A;  2PEX A;  1TNT A;  1GXQ A;  1TBX A;  2ZCW A;  3CJN A;  4JBA A;  5ILU A;  3HTU A;  4EJT A;  2KJB A;  1IN8 A;  2RC4 A;  3IL2 A;  1MGT A;  1ZG1 A;  4HQE A;  2ESN A;  2LF7 A;  3I59 B;  1MJB A;  3VFZ A;  1ODD A;  2M30 A;  2RN7 A;  2WWY A;  2WTE A;  2B0L A;  2WC2 A;  2NAZ A;  4UHT A;  3GX4 X;  4I0A A;  1RUO A;  1P92 A;  2LNB A;  2P6T A;  2P5L C;  3WTW C;  4BHP A;  4M74 A;  1FYL A;  4OOI A;  4GCV A;  2O03 A;  3CUQ A;  4G8X A;  5H6Q A;  2IA2 A;  3E5Q A;  2HKX A;  3VOD A;  3FMR A;  3TO9 A;  4Q4Z F;  4GGG A;  1KYW A;  2RV8 A;  4FT8 A;  3WGH A;  3LAJ A;  5K5Q A;  2PI0 A;  2GIV A;  4LB6 B;  2NNY A;  3F21 A;  3TKY A;  1TLH B;  5ICG A;  1YIO A;  4S05 A;  3J81 K;  3DKW A;  4CHU A;  3ECO A;  2VN2 A;  2CSO A;  1JE8 A;  1FT9 A;  3JTH A;  5ILS A;  1YW9 A;  3FF5 A;  4QWQ A;  1YW8 A;  5LEJ A;  2ZBK A;  3J81 Z;  1XN7 A;  1LVA A;  2RGV A;  4CIC A;  5DCM B;  3QU6 A;  5E18 F;  2FQ3 A;  2M87 A;  3WGG A;  4IHS A;  1FBS A;  1T0F A;  1HBX G;  3F8F A;  3DEU A;  1AWC A;  3LQR A;  1I1S A;  4Y15 A;  3FXR A;  5JVT A;  4JQF A;  3ZMD A;  4EJO A;  3SZP A;  4LJZ F;  1R5H A;  3OV8 A;  3KZY A;  4D0P A;  1SD7 A;  1AOY A;  3I5U A;  2J5P A;  1T2K A;  2E1C A;  3MFK A;  3HHH A;  2K02 A;  1FYK A;  4OU0 A;  4EJV A;  1O3T A;  1P6R A;  2HR3 A;  2Q2E A;  2R7D A;  3ZN0 A;  2H6B A;  3MWM A;  4ZZD A;  4EJW A;  2ZME B;  2HQR A;  4U7B A;  2MLK A;  1YO5 C;  3SQN A;  2YU3 A;  4HX8 A;  2VXZ A;  2QUF A;  4LD5 A;  4M9X A;  2JPB A;  3KEQ A;  2VC0 A;  3WE3 A;  1XGS A;  4LLL A;  2QBY A;  4ON0 A;  3SZT A;  2Z33 A;  2FML A;  3D0S A;  3IWZ A;  2FBK A;  2VT3 A;  1BI1 A;  1LQ1 A;  3T5X A;  3FXQ A;  3T8T A;  5DDG A;  4GYG A;  4Q48 A;  3RI4 A;  3FMQ A;  3MQ0 A;  4B8X A;  3JSO A;  3ECH A;  2DLL A;  1DPU A;  1ONV A;  1UFM A;  4NB5 A;  3CO6 C;  4EV0 A;  3HRS A;  1TQI A;  2YPR A;  5LLQ A;  1K78 A;  2OBP A;  4MQ9 F;  1MDM A;  1P4W A;  4AWX B;  1D8J A;  2UZK A;  2JTV A;  4XBF A;  5CVV A;  3V7C A;  1SMY F;  5HLI A;  1LDD A;  1ZG5 A;  2XRO A;  5CVJ A;  1ZRE A;  3L9F A;  2V1U A;  2P5K A;  3I64 A;  4YFN F;  5FB2 A;  1V3F A;  3ABU A;  5BQT A;  3IC7 A;  1G6N A;  3P9I A;  1KU2 A;  2MA3 A;  3F8N A;  1OR7 A;  1WKM A;  2HYG D;  2DI3 A;  2HTJ A;  2IA1 A;  3F8M A;  5CVU A;  3EYY A;  4ZZL A;  1UHM A;  1BC7 C;  5A2Q Z;  2QQA A;  3H92 A;  1E2X A;  1SFX A;  1D5V A;  4BHB A;  4I09 A;  5FFX A;  2Y48 A;  2UXN A;  2K86 A;  4G7H F;  1W4M A;  3T8R A;  2MH9 A;  1R1T A;  3KEO A;  2BV6 A;  1YG2 A;  3C1D A;  4LG0 A;  3BJ6 A;  4ETS A;  2Q8K A;  1BI2 A;  3PFI A;  1XGM A;  3HRU A;  3B73 A;  3RYP A;  2XHK A;  1USS A;  3G3Z A;  4L9V A;  5L3D A;  1IXC A;  1HXD A;  4ENJ A;  3C3W A;  1FYM A;  2FOK A;  5AIP A;  1QPM A;  5LGT A;  1J7K A;  1ON2 A;  4HF1 A;  4AD9 A;  1VTN C;  2VE8 A;  2FF4 A;  2FXA A;  1WSU A;  1U5T C;  4WF2 A;  4HW0 A;  3DFG A;  5EEG A;  2F5E A;  3MCZ A;  4M9Z A;  3WOD F;  5IT9 Z;  2ZJ2 A;  4IF4 A;  2DO7 A;  2HKO A;  4K2E A;  4KDP A;  1U3E M;  1ON1 A;  4IRH A;  3KP5 A;  2OA4 A;  4HA8 A;  2VOP A;  5HLH A;  1MD0 A;  1FP1 D;  1ZRC A;  4HF2 A;  1WWX A;  4MEY F;  1O7F A;  2FA5 A;  3KFW X;  4UNO A;  1FX7 A;  3WU1 B;  2ZNY A;  1HSJ A;  2A68 F;  4B09 A;  5TJJ A;  1KU3 A;  2BBY A;  3P9K A;  5DV5 A;  3C7J A;  3ROU A;  1YW7 A;  2XAG A;  4GXO A;  1TW3 A;  3GYH X;  3N4M A;  1LJ9 A;  1IRF A;  1BN5 A;  2KIM A;  4YIF A;  1MJA A;  3BOQ A;  4A0Z A;  4HQM A;  1IN7 A;  1CGP A;  2P6S A;  2XKO A;  5D6F A;  3VOE A;  3SHF A;  1W5S A;  3WG9 A;  1BJA A;  4A5M A;  4OIP F;  4NQW A;  1R1V A;  4PGG A;  2YR2 A;  2FU4 A;  4CZZ A;  3DPL C;  2QEN A;  2X4H A;  1R5G A;  4IVN A;  4ZYD A;  4QLC U;  1R36 A;  4WCG A;  1FZP B;  5ILV A;  5J8C A;  2NNN A;  1QQI A;  4UV8 A;  3V7R A;  2HGC A;  2BEO A;  1Z1D A;  2QM3 A;  2KRF A;  4WWC A;  4S04 A;  3U2R A;  3WE2 A;  2O8X A;  5D4S A;  2PBI A;  2W57 A;  3VB2 A;  1BBY A;  3O2P E;  2O3F A;  1E17 A;  3F8B A;  2EFP A;  1XGN A;  1Z7U A;  3V7S A;  4O5V A;  3M1E A;  4MTE A;  3LST A;  3RKY A;  5E8G A;  2AXL A;  3BP8 A;  4GYI A;  4DNC A;  4PGH A;  3HUG A;  1KU9 A;  1G3S A;  2L4M A;  4P55 A;  1J2X A;  4BQA A;  3HYI A;  4MHG A;  3ZQ7 A;  4OMZ A;  4XLN F;  2HDC A;  5ICF A;  5HLG A;  3BJO A;  1J9I A;  4H0E A;  1MKM A;  3E5X A;  3HRM A;  1YYV A;  1U5T B;  2V6C A;  3S2W A;  2CO5 A;  4ZYH A;  3W6K B;  4FX4 A;  3O3K A;  4Z2Y A;  4HLX A;  4G94 A;  2K4J A;  1HKS A;  3BWG A;  4U0Y A;  3R0J A;  5LRR A;  2Y75 A;  3JAM K;  5FGM A;  3LQQ A;  3K1P A;  1ZRD A;  2CWE A;  4M9S A;  5L3B A;  3GVA A;  5HDK A;  5D5X B;  2OD5 A;  3FX3 A;  5DD8 A;  3WTU C;  2G9W A;  5CLS A;  2V1X A;  2Z3Y A;  5CJ9 A;  3V8J A;  1HST A;  2WV0 A;  1IF1 A;  1B9N A;  1SD6 A;  1JHF A;  5ICC A;  4G7Z F;  2LF8 A;  5K1Y A;  1KQ0 A;  4UV9 A;  4L0Z B;  1STZ A;  3CDH A;  2VE9 A;  1KQ9 A;  5IT3 A;  4PDK A;  1J59 A;  2ZFW A;  1O3S A;  1LDK B;  2ZXJ A;  5E1Z B;  2MH2 A;  1DUX C;  2PMH A;  1JHH A;  3ERE D;  1OYI A;  4A6E A;  4JK1 X;  3RKX A;  4RAZ A;  1OMI A;  4BHC A;  3KCC A;  3WTT C;  2QBY B;  5FD6 A;  2HTS A;  3DPT A;  2EV6 A;  2OU2 A;  4U88 A;  4CDG A;  1Q1H A;  5HDN A;  2XAJ A;  4OIR F;  3QP5 A;  3IKT A;  3FM5 A;  2PJP A;  3TOB A;  3RKW A;  2GA1 A;  3FMS A;  3TDZ C;  2VBX A;  3HOT A;  5E1W A;  3ZMS A;  2A6H F;  5E20 A;  1UB9 A;  2QZ8 A;  2VOO A;  1O3R A;  4Q47 A;  5DEQ A;  4EGZ A;  4IPA A;  2CFX A;  3KP6 A;  2C6Y A;  2Q0O A;  4WK8 F;  3I71 A;  3EYI A;  1A04 A;  4AIK A;  1FBU A;  5FD5 A;  1EV7 A;  4KIF A;  5CVR A;  1GHC A;  1ZLK A;  4KN7 X;  1T98 A;  1XSX A;  3RPQ A;  5JR3 A;  1ULY A;  4IHT A;  1JGS A;  1Z9C A;  4CYD A;  1U6G A;  1ZLJ A;  2EA4 A;  3JTG A;  2OZU A;  1W7P B;  2GWR A;  1T38 A;  3HOS A;  5LGN A;  3H3Z A;  2X0L A;  3R60 A;  3K1N A;  2EA2 A;  3ABT A;  1FSE A;  4ENM A;  3U1D A;  2OZ6 A;  5E1X A;  3MZY A;  1SFE A;  5LEK A;  3F8C A;  2FNA A;  3J7A O;  3CUQ C;  4LG0 B;  4OIQ F;  1DP7 P;  1CF7 A;  4M71 A;  3IKV A;  2GZW A;  4HLY A;  5LHI A;  4FHT A;  2QVO A;  1W5T A;  3EDP A;  1RZ4 A;  4ZYG A;  2ZME A;  3D5L A;  5HS8 A;  1LB2 A;  4KT5 C;  3F22 A;  2XKP A;  4MEX F;  3BPX A;  3K0L A;  1IRG A;  3HSR A;  2JRT A;  1HQC A;  2D2W A;  3DV8 A;  5E17 F;  4OIN F;  2XGX A;  2O61 A;  1B59 A;  3I54 A;  4A2U A;  3BPV A;  1IAW A;  4YFX F;  4KIB A;  1ZGA A;  3CO7 C;  2Z99 A;  3QOP A;  3EET A;  4EM2 A;  1FWZ A;  3CUQ B;  2DPU A;  3QU3 A;  3BDD A;  3ZMT A;  4BXU A;  1KGS A;  5J6X A;  4I98 B;  2XIG A;  3BZ6 A;  1L3L A;  2A3S A;  1XSD A;  5F1R A;  5H20 A;  1B6A A;  1HW2 A;  2PQ8 A;  2A5Y B;  2UWM A;  4AIH A;  2VBW A;  2F5F A;  1GVJ A;  4IJA A;  1EH7 A;  4WXH A;  5FLX K;  1S7O A;  1REP C;  4EM1 A;  4LLG F;  2FRH A;  3K9T A;  4AIJ A;  3KP3 A;  4XSZ F;  2LKP A;  5D8L B;  2J5O A;  3Q9V A;  3ELK A;  4P9F A;  3WTZ A;  4WX9 A;  2A69 F;  3WTY C;  1K79 A;  4A0X A;  4XSX F;  2XUB A;  3RTR A;  3QPH A;  1ZGJ A;  2QWW A;  3CUO A;  2HZT A;  3RYR A;  3V8L A;  4KUM A;  1QNT A;  2ESH A;  1V4R A;  3FZV A;  2MD5 A;  5LHG A;  3KP2 A;  3R4K A;  1XCB A;  3NEU A;  1FP2 A;  2EFW A;  2OQR A;  3SFZ A;  5H6R A;  1P2F A;  3U9G A;  4M6X A;  1U8R A;  3PQJ A;  3TQN A;  1U2W A;  1SD5 A;  3BY6 A;  1YQA A;  3TO7 A;  1Z91 A;  2A07 F;  3HSF A;  2G7U A;  4F7Z A;  1IXS B;  1RUN A;  1XDS A;  4G7O F;  2QQ9 A;  4EGY A;  1ZYR F;  1HKQ A;  3EQL F;  1RNL A;  2L3D A;  4G9Y A;  5FFZ A;  3KET A;  2DU9 A;  3P9C A;  5HS9 A;  4IRG A;  4RGS A;  1QZZ A;  2CQK A;  4OIO F;  1IXR C;  3B02 A;  2EWN A;  4I2O A;  1F4K A;  1T39 A;  4I0B A;  2EV5 A;  2E1N A;  1J5Y A;  2CW0 F;  5D8K B;  1R1U A;  3FHZ A;  4PZJ A;  2IT0 A;  3WTS C;  1YS7 A;  2DQL A;  3FWE A;  3GF2 A;  4WXC A;  3MAJ A;  2Z9O A;  5ED4 A;  3NQO A;  5BPD A;  3TDU C;  3HHG A;  2EJR A;  5JI6 A;  1MDM B;  2RKH A;  1O3Q A;  3F6O A;  3RJP A;  1DDN A;  1XSV A;  1XDU A;  2STT A;  1S8N A;  3LA2 A;  2NRA C;  4RGX A;  2HEO A;  2M8E A;  1D8K A;  2XAS A;  1BOA A;  3OOP A;  3NRV A;  4MQV A;  2VOD A;  2L01 A;  2L02 A;  3E6C C;  4HAM A;  4KFC A;  3KLN A;  2W85 A;  4L5J A;  3GFI A;  1FBQ A;  4RGU A;  5E8I A;  4R79 A;  1OPC A;  5HS7 A;  3KE2 A;  4HF0 A;  4MNU A;  3GFM A;  4HV5 A;  2PFB A;  1PDN C;  2KIU A;  2DPD A;  4PCQ A;  2RVC A;  1R22 A;  2KKO A;  3V4G A;  1KYZ A;  1QBJ A;  3E3V A;  2ZO4 A;  4M6Y A;  3ULQ B;  4Y13 A;  1FNN A;  3LA7 A;  1EH8 A;  2QLZ A;  1XGO A;  4AVP A;  1Z6R A;  4UXN A;  4HBL A;  1FPQ A;  1YTY A;  1X3U A;  2V79 A;  3ZPL A;  3ZP5 A;  3M8E A;  2IPQ X;  4KMF A;  1TQP A;  3E6D A;  4L9N A;  4XLP F;  2BGC A;  2COM A;  2PG4 A;  3LWF A;  5F64 A;  3WTV C;  2HFH A;  2E7X A;  3E6B A;  1S3J A;  4A6D A;  2ELH A;  5L3E A;  1DPR A;  4OMY A;  4UVB A;  3TGN A;  3C18 A;  1FSH A;  4ENN A;  3I59 A;  3H3U A;  2Y0M A;  5LRS A;  3EUH A;  2STW A;  4L0Y B;  3CLO A;  1QO0 D;  5HOO A;  2ISZ A;  1IN4 A;  4Y17 A;  3MEX A;  3F3X A;  1R23 A;  4ESB A;  4XRF A;  1H9T A;  5HDG A;  2DAO A;  1GXP A;  2DW4 A;  6PAX A;  5L3F A;  2D1V A;  4RB2 C;  3N97 A;  4I7H A;  1K7A A;  2OQG A;  2GA2 A;  1XCV A;  4UVC A;  3F23 A;  4HYE A;  2H6C A;  3ISP A;  1J0R A;  1B1B A;  3QPT A;  2P7V B;  2Z5U A;  4CXF A;  1WQ2 A;  1I5Z A;  3WU0 A;  5DYM A;  3ZN1 A;  3QRF F;  4Q5S F;  4R1H A;  3O6B B;  4EVI A;  3R0A A;  4LK1 F;  2M1B A;  1H0M A;  2VBZ A;  2A6E F;  4LK0 F;  1FLI A;  4ENK A;  3I4P A;  5LHH A;  2HOE A;  1KA8 A;  1SMT A;  3GFJ A;  1TNS A;  2IW5 A;  3P7N A;  4P5O A;  1ZHF A;  1HW1 A;  3E5U A;  2AS5 F;  2GAU A;  1S6L A;  3IRQ A;  1JXS A;  1BIA A;  3IWF A;  2JZY A;  3M8F A;  1R58 A;  2CG4 A;  2DQR A;  1TTY A;  4O6J A;  5L3G A;  4U7D A;  5ICE A;  2RNJ A;  5D5U B;  1Y0U A;  2FBI A;  2PMU A;  2KJC A;  1HW5 A;  1YS6 A;  2VT2 A;  3TOA A;  1OYW A;  1WI9 A;  3DF8 A;  1O57 A;  1C0W A;  4A0Y A;  1ZAR A;  4RS8 A;  3T0Y A;  5D5W B;  1FOK A;  4G6D A;  3L2C A;  2DTR A;  2EFO A;  4BNC A;  2P8T A;  3JW4 A;  3DP7 A;  3LA3 A;  2YX7 A;  1T6S A;  1RI7 A;  4IRI A;  1P4X A;  3FXU A;  2MBF A;  2FE3 A;  4P96 A;  2NS0 A;  2TDX A;  1FY7 A;  5F6F A;  1I27 A;  2M5W A;  5DUI A;  3KZZ A;  1K6O A;  3K1M A;  2IJL A;  3RIR A;  3GWZ A;  1YLF A;  2P7C B;  2XAQ A;  4L9J A;  4L5I A;  1Z6T A;  3DQV C;  3ZMU A;  3KP4 A;  1LEB A;  1ZH5 A;  2EV0 A;  4HDV A;  2QQB A;  2O6G E;  4HV6 A;  2NYX A;  2YSR A;  4N9I A;  5D5V B;  1H9G A;  3M7G A;  2KIF A;  4FX0 A;  1SFU A;  2GQQ A;  5FLX Z;  1I6X A;  2FMY A;  3GZ6 A;  1U5T A;  1MJ9 A;  1IZ1 A;  2DBB A;  3GLX A;  2BE5 F;  4KA4 A;  4L9T A;  2D1H A;  3RPU A;  5BMZ A;  2M45 A;  3RDI A;  4ZH4 F;  2EFN A;  1LDJ A;  1G3T A;  4EQQ A;  4A12 A;  4EMS A;  3GW2 A;  1KQ8 A;  4KIC A;  1LEA A;  3J80 K;  5JHU A;  4O3M A;  4KYW A;  1BI3 A;  1L0O C;  4HX7 A;  3PQK A;  1F1Z A;  2XVC A;  4YII A;  3GEZ A;  3IHU A;  1KU7 A;  2GXG A;  3QP6 A;  1P4A A;  2IVM A;  3K69 A;  2R7F A;  3FM3 A;  2LSO A;  3ZMV A;  4LFU A;  4LLN A;  1RIO H;  2ZNZ A;  3MZH A;  4IXA A;  3L00 A;  2ISY A;  3TO6 A;  1BI0 A;  1F5T A;  4HOB A;  3HTS B;  1UHW A;  5EEH A;  1IN5 A;  3R6S A;  4I01 A;  3F72 A;  2W24 A;  3CTA A;  1IUY A;  4U0V A;  1R7J A;  1CF7 B;  2CGP A;  4MGR A;  2EB7 A;  5IT9 K;  2PLY A;  4P9U A;  2A61 A;  1UST A;  1W7P D;  2K7L A;  5D6E A;  2K4B A;  2CYY A;  1SD4 A;  1U78 A;  4LB5 A;  2K27 A;  2HQN A;  2O0Y A;  3IRR A;  1G3Y A;  5DUK A;  3I53 A;  2BYV E;  2FEZ A;  4KN4 X;  1OYY A;  3GUD A;  2EFQ A;  2L4A A;  4KNY A;  4HZF A;  5FO5 A;  3R61 A;  4M73 A;  3BRO A;  1ZAO A;  1TQM A;  1ZN2 A;  2VBY A;  1PP8 F;  2H94 A;  5K5R A;  4HX4 A;  2UXX A;  2ADU A;  1S29 A;  5DCF A;  1XD7 A;  5AIQ A;  3GO5 A;  4RB0 A;  1ZRF A;  4EJU A;  3KP7 A;  2HS5 A;  2XAH A;  3KLO A;  4RB1 A;  2RQP A;  1IN6 A;  4TV7 A;  5CYV A;  3Q9S A;  3M9A A;  1OKR A;  4ESF A;  5A2Q K;  4RB3 C;  4BAY A;  2MC3 A;  1K78 B;  3ZMZ A;  4UUV A;  5L3C A;  1BIB A;  5J8F A;  4EM0 B;  5BOX A;  3JSP A;  1S7A A;  3BJA A;  1W7P A;  5HVQ C;  2JPC A;  2F2E A;  2LDU A;  3E97 A;  3ML6 A;  5LBQ A;  2FNP A;  3LAP A;  1I1G A;  1XMA A;  4ZYE A;  3GZ5 A;  3LFK A;  5TRD A;  3HIF A;  1J75 A;  2OAZ A;  4YFK F;  1LNW A;  2DFI A;  2ETH A;  1YFH A;  3WTX C;  2F5C A;  5D4R A;  2W84 A;  4RGR A;  1BC8 C;  1BM9 A;  1IW7 F;  2DT5 A;  5LGU A;  2VC1 A;  3G73 A;  1Z05 A;  1D3Y A;  4BH9 A;  2ACJ A;  2V1D A;  4KMU X;  1XB4 A;  4LGW A;  5CVI A;  5K5O A;  1G4D A;  3L09 A;  2EK5 A;  4WXD A;  2QYO A;  4N0B A;  4YG2 F;  2E7W A;  2PN6 A;  2P5V A;  2DK5 A;  1TW2 A;  3JAM Z;  4NHJ A;  1WRJ A;  2XRN A;  4UVA A;  3GXO A;  3I58 A;  3I0T A;  1G3W A;  1HKT A;  1FC3 A;  4I02 A;  2V9V A;  3F6V A;  3W6J B;  3SXY A;  2L54 A;  1B9M A;  4HDU A;  4A5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...