4UNOA

Crystal structure of the ets domain of human etv5 in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords ETS TRANSLOCATION VARIANT 5
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4unoA00
2FA5A 1IAWA 5DCMB 2UXNA 2DPUA 3QOPA 4I2OA 5IT3A 3HOTA 5ILSA 3Q5FA 1BJAA 2HOEA 3ZMDA 4BXUA 2R3SA 3BOQA 2AXLA 1REPC 2KKOA 3GWZA 3WE3A 5J8FA 3B73A 1EV7A 2ZMEA 1ZYRF 2EFOA 1KU9A 5TJJA 3DP7A 3QPTA 1SD5A 1UHWA 2FE3A 5IT9K 2VBZA 3E5XA 3GZ6A 2ISZA 3WGGA 1W4MA 3WTXC 3GFMA 5E20A 2VE9A 3KCCA 1MJAA 4AIHA 1XD7A 3GLXA 3SZPA 4GCVA 4MEXF 2P5LC 3L9FA 1O3QA 2ZCWA 4P96A 4BHCA 3BDDA 2HDCA 5D6EA 2O0YA 2H6BA 4MGRA 5FB2A 3HUGA 1LB2A 1E17A 4HV6A 3H92A 4PGGA 3ZMTA 5E8IA 1H9GA 1QZZA 4UV9A 4K2EA 1V3FA 3E5UA 2EK5A 1KU3A 2A5YB 3H3ZA 2YR2A 1L0OC 2FNAA 3WE2A 3FWEA 1OPCA 3D0SA 5JFRA 2V9VA 4HX4A 2D1HA 5FLXK 2E7WA 4HDUA 5HOOA 4OIOF 2V79A 1KQ9A 3F8CA 5FLXZ 5KVRA 2HTJA 1OYIA 2O61A 4DNCA 2P5KA 3F8NA 4XLNF 4FX0A 3DPLC 3IHUA 4MQVA 5HVQC 1ZG1A 3HRTA 2NAZA 4LD5A 3ERED 2Z5UA 3G3ZA 4PCQA 1IN4A 2ACJA 1LDDA 1T6SA 4RGUA 1P4WA 3AAFA 2M5WA 1IZ1A 1X3UA 3HHHA 1TQIA 2MLGA 5F1RA 4OMZA 2KJCA 3W6KB 4CHUA 3PQKA 4MQ9F 1FC3A 3ZP5A 2RNJA 4HV5A 3LA2A 2K86A 2ADUA 1SD7A 1Z1DA 2XUBA 4QWQA 5CYVA 3V7CA 4L9TA 1GHCA 3FXUA 2DBBA 2Q0OA 4HBLA 4B8XA 3GW2A 1SMYF 4WF2A 1YW8A 2A3SA 4YIFA 1YQAA 4OINF 3RDIA 3F21A 3T1BA 2IA1A 3Q9VA 5LHGA 3QRFF 2CWEA 4Q5SF 4OIRF 2FU4A 3K1NA 2ZJ2A 3IRRA 2IT0A 3FHZA 2A61A 2IVMA 5HDNA 3BY6A 5IT9Z 5DD4A 3ZMUA 1WI9A 2COMA 3FM3A 2DQRA 5DCMA 2V1DA 4I98B 5HLIA 3CDHA 3RIRA 2OQRA 1ZLJA 1B9MA 2VXZA 3M1EA 4L9VA 2FBHA 4IRGA 1XSDA 1YLFA 3DEUA 4IRHA 2PN6A 2KRFA 3U9GA 1WSUA 1SFXA 3I58A 2MH2A 4BHBA 2BEOA 4U7DA 1USSA 2KIUA 2EB7A 3IKTA 4LB5A 4O6JA 2PG4A 4EJUA 4YG2F 3HTUA 5DUIA 4L5JA 4HQMA 4HYEA 2FF4A 1CF7A 2V1UA 4KT5C 2W84A 4GXOA 2ZBKA 1G3WA 4Y13A 2BGCA 2QYOA 1MKMA 3BROA 1T39A 5DUKA 2PMUA 2QLZA 2HKOA 2EV5A 3TKYA 4N9IA 4CDGA 5BS6A 4LK0F 4L0ZB 1P92A 2HZTA 2EFNA 4UUVA 4S05A 1IN8A 4R1HA 3SFZA 2JRTA 4P55A 3F6VA 2A07F 3JSPA 2R7FA 3ZMSA 1B1BA 4LJZF 2G7UA 5ICEA 3DV8A 4RS8A 5K5OA 4AVPA 1I1GA 4H0EA 3LA3A 1FYMA 1W5TA 1XDUA 1XDSA 4GGGA 5LGTA 3K1MA 5LRSA 4AIJA 1ZRDA 2GIVA 3MWMA 1ZLKA 3ZMZA 2EA4A 3KZYA 4OU0A 3HHGA 4GYGA 1TNTA 1S29A 2DK8A 1YIOA 2F2EA 4FHTA 1XMKA 5L3CA 2L54A 1RZ4A 2P5VA 2FBIA 3GFIA 3KLOA 3WTSC 4M74A 3V4GA 3BJ6A 3KETA 1GXPA 4G7ZF 3F23A 1SD4A 1K6OA 3G73A 3IL2A 3ZPLA 3RPQA 1O3SA 1IXCA 1YW7A 3I0TA 2QBYA 4EJTA 5DD8A 1FBSA 5HLGA 5K5RA 4LG0B 2XAJA 1O7LA 1MDMA 3T8RA 4F7ZA 4A2UA 2JPBA 1YG2A 5A2QK 2XV4S 2GWRA 3LAJA 4KDPA 1R23A 2EV0A 1XCVA 4HLXA 3F22A 1FYKA 4JK1X 3DKWA 4KUMA 3MZYA 2VOOA 3RPUA 2VT3A 3U1DA 4L9JA 2IA2A 3FXQA 4G6QA 1HQCA 1KYWA 2Q2EA 1LEBA 4HQEA 3W6JB 1R5HA 1C0WA 2DTRA 2HWVA 4ZYGA 3U2RA 1HW2A 1STZA 1FP2A 1IW7F 2DK5A 3PFIA 4EM1A 1J5YA 3BPVA 3C7JA 3IWZA 3R0AA 2HS5A 2O6GE 3SHFA 2BE5F 2PEXA 2AS5F 1QGPA 2RV8A 1TQPA 4LLGF 1XMAA 3L2CA 1XB4A 3HIFA 3IC7A 1FT9A 2GA2A 4XBFA 5LEJA 2ZNZA 2G7HA 4ZZDA 5HLHA 4L9NA 5DCFA 4EJWA 2RN7A 2M8EA 2NNNA 3KP3A 2P6SA 2A6HF 5AIPA 1Z9CA 3FZVA 4M73A 4ZYEA 4M72A 5ERIA 1KU2A 1SAXA 4HLYA 3HRMA 2HR3A 2P8TA 1QBJA 1JHHA 4EJOA 4LMYA 2X0LA 4ENNA 3K69A 2K4JA 3E6MA 4UVAA 3S2WA 3GVAA 4RB2C 2F5CA 1XGNA 3IKVA 4PZJA 3WTTC 2H27A 2EA2A 1QZYA 2NNYA 3B02A 3GO5A 2XIGA 5CVRA 4FX4A 2W24A 1MJ9A 3VFZA 4GYIA 4WCGA 4NHJA 3GFJA 2YX4A 3RKXA 5E1ZB 2L3DA 4YFKF 5H6RA 4I02A 4RAZA 1USTA 1BM9A 4HF1A 1O57A 3HSRA 3QP5A 3HSFA 4XRFA 2BYVE 4EQQA 1H9TA 4A6EA 1J59A 1GVJA 5F6FA 3F72A 3BJAA 5E18F 1RIOH 5FFZA 2JT1A 4KA4A 2OAZA 1FX7A 3RTRA 1PDNC 4KN4X 2VBYA 1B9NA 3WTUC 3E6CC 2UWMA 1TNSA 2GQQA 1ZREA 2FEZA 2M30A 4Y17A 2P4WA 2QENA 3TGNA 4HZFA 1ZRFA 1HSJA 1BIAA 3FMSA 4MHGA 2JSCA 2YSRA 3CO6C 2MC3A 1FBQA 4Q48A 2G9WA 5E1XA 1BI1A 4ENKA 1HBXG 3KP6A 4RB1A 1G3TA 2P7VB 2GZWA 5AIQA 4ZH4F 5D6FA 1VTNC 1RNLA 2BV6A 2HTSA 1R36A 2LKPA 1YFHA 2K7LA 1LQ1A 2MBFA 4WWCA 1ULYA 1W7PD 4UNOA 5ILVA 2PLYA 3ZN0A 2HKXA 2NS0A 1MZBA 3LQRA 5FFXA 3SXYA 4UVBA 3N97A 2R7DA 2CGPA 3C3WA 4GO1A 3GF2A 1JXSA 2OZUA 1PUEE 3RKYA 5CVUA 4LFUA 1SMTA 1WRJA 2L4MA 2VE8A 2CQKA 2CG4A 4MTEA 4S04A 1U8RA 2JTVA 1B6AA 2XASA 4A0YA 3EDPA 1KYZA 4EGZA 1EH6A 1DDNA 3RI4A 4BH9A 4XSZF 1DPRA 3KP2A 4IHSA 1U5TC 2RKHA 2MLKA 1ON1A 2HQRA 3TO9A 2VBWA 2OZ6A 2F5FA 1H0MA 1I27A 1E2XA 2D45A 3F8FA 4KNYA 3ABTA 1AOYA 4N0BA 2K4BA 1LJ9A 2ZNYA 5K1YA 3OOPA 4G94A 3KE2A 3CJNA 5D8KB 3ELKA 1YS6A 5F64A 4L18B 1WKMA 1IXRC 1G6NA 3WG9A 4KMUX 1FP1D 2IPQX 1ZAOA 4IPAA 5DV5A 4G8XA 3FM5A 2DAOA 4M9XA 3O2PE 3IWFA 1W5SA 1XN7A 2LF7A 1YTYA 4IF4A 3CUQB 5L3FA 3RYRA 3ECOA 1SD6A 5A2QZ 4OIQF 4AIKA 4NQWA 2P6TA 3VEPA 3EUHA 3KLNA 1FNNA 5L3GA 2J5PA 4EMSA 3V8KA 1T0FA 3I71A 4YFNF 2E1NA 2QZ8A 3CUOA 1FOKA 4AWXB 3KFWX 2JZYA 1FZPB 2VN2A 1XGSA 2A6EF 1R22A 5LRRA 3FX3A 4TV7A 1YW9A 4KIBA 3ABUA 3E3VA 2Y75A 1BI2A 2FOKA 1MD0A 5DYMA 2VOPA 1IN7A 1I1SA 4ASNA 2NYXA 3TDUC 4KICA 4HDVA 1W7PA 4LK1F 3LFKA 2QBYB 4HF0A 4PGHA 2D2WA 1L3LA 5H6QA 1K78A 2Z33A 1XCBA 3GZ5A 5JVTA 1G3YA 3ZMVA 1I5ZA 3KZZA 3I59B 3R60A 3GX4X 2PMHA 2H09A 2Q8KA 3NEUA 1S7AA 5L3BA 4ENJA 3I5UA 4RB3C 1ZHFA 5E8GA 3K2ZA 2BBYA 1J7KA 4A5NA 1MDMB 2PQ8A 3KEOA 2PJPA 2TDXA 4IRIA 4G7OF 3WTVC 4MNUA 1R5GA 1QPMA 3WGIA 3RJPA 1FPQA 1U2WA 1A04A 2E1CA 4L0YB 3LSTA 2Y48A 4YIIA 3PQJA 3KP7A 4OMYA 4QLCU 4RB0A 5E17F 3RKWA 4P9FA 2YU3A 4NB5A 5FD6A 2V1XA 2QM3A 1CGPA 2UXXA 2XGXA 1XGMA 1O3RA 3TOAA 4B09A 3VODA 5ICFA 3E5QA 4KN7X 2O03A 1LEAA 2ESNA 4Z2YA 5CJ9A 2VC0A 2MD5A 2UZKA 1OYYA 3K1PA 4HW0A 3N4MA 2KIMA 1WQ2A 4M71A 4M9SA 1AWCA 1R1TA 1CF7B 2Z3YA 1GXQA 4BQAA 3VB2A 2EFQA 3T0YA 1OKRA 5HDGA 2IA0A 4IVNA 1EH8A 1BC8C 3ZQ7A 4MTDA 4ETSA 1F4KA 2ELHA 2XAGA 2F5DA 2MH9A 1FY7A 3GYHX 3E6DA 3D5LA 2ETHA 1JHFA 4AD9A 1FSHA 4OIPF 1O3TA 4JBAA 2HQNA 1BBYA 1XGOA 2HGCA 5LEKA 2WTEA 5BPDA 1T38A 1BOAA 3GUDA 2GXGA 2QQAA 1UHMA 3RYPA 1XSVA 2DQLA 1ZG3A 3L7WA 1U5TB 5DDGA 1G3SA 2RDPA 1BN5A 2STWA 4BYYA 2LF8A 2DO7A 1HSTA 2XAFA 2STTA 4IJAA 3WTYC 4CZZA 4KFCA 2W57A 6PAXA 1R58A 4RGRA 3ECHA 1T2KA 3R61A 3COAC 1D8JA 4UV8A 3WTZA 3GEZA 1XSXA 4ZZLA 4ESBA 1S6LA 4A12A 1QNTA 1V4RA 5LBQA 5J6XA 5H20A 1DP7P 3JW4A 4KYWA 5BMZA 2XAHA 2GA1A 4I01A 1YS7A 4EM2A 2DT5A 1ODDA 3F6OA 5CVIA 1D8KA 3M7GA 2GAUA 5K5QA 3R0JA 3LAPA 4ENMA 3TO7A 3CUQC 2IP2A 1PP7U 1RUNA 4Q47A 2HEOA 3M9AA 5HS8A 2YX7A 3HTSB 2XKPA 4U0VA 5TRDA 3F8MA 4U0YA 2ZKZA 3DPTA 1FWZA 4G7HF 2F5EA 2RVCA 5LGUA 3JSOA 3BWGA 3IRQA 2KIFA 2LSOA 2XAQA 1OMIA 3EQLF 1J75A 1DUXC 2RC4A 2DLLA 1TW3A 2YPRA 3TOBA 4HA8A 3JAMK 4Y15A 1O7FA 3MQ0A 4A6DA 1W7PB 4YFXF 3JAMZ 4G6DA 4UHTA 2QVOA 2FNPA 3J81K 2IRFG 1FBUA 4WK8F 3P7NA 2QWWA 3DQVC 1NHAA 2XVCA 5BQTA 2ZXJA 1HKSA 4E70A 3HOSA 3K9TA 4U88A 1ONVA 1J9IA 2Y0MA 2KJBA 1Z05A 4OOIA 5ED4A 1QO0D 2HYGD 1IN6A 4UXNA 3F8BA 3KP5A 1HW5A 4ESJA 3ISPA 2OBPA 4CGZA 3HRUA 1YO5C 2OA4A 5E1WA 2L01A 5LHIA 4HX7A 4Q4ZF 2O3FA 1P4XA 5D4SA 2WV0A 2V6CA 3I53A 4CYDA 4KMFA 3LQQA 2DI3A 1IN5A 3LWFA 3V8JA 1K79A 3SQNA 4HAMA 2WWYA 1F9NA 2M87A 3E6BA 4WXCA 1TLHB 2GXBA 1RUOA 5LGNA 3J80Z 1UCRA 3BJOA 3J80K 4EV0A 2EWNA 5D4RA 5JI6A 3J7AO 2P7CB 4M6XA 3F3XA 4N9HA 1G4DA 1KQ8A 1ON2A 1KA8A 4BNCA 4KIGA 1OR7A 4EM0B 3CLOA 1BC7C 1IF1A 2C6YA 3ROUA 3L09A 5AONA 2X4HA 1IRFA 5HDKA 1UB9A 4BAYA 5HS9A 2M1BA 2A68F 1F1ZA 4LGWA 3MFKA 3WU1B 5BPIA 1B59A 4CO8A 4O5VA 3JTHA 2DW4A 1FYLA 3R6SA 3V7SA 2ISYA 3VOEA 2JPCA 3QAHA 1R7JA 5L3DA 2VBXA 4ZYDA 4LG0A 3M8FA 3SZTA 1BIBA 1D3YA 2QQ9A 3QP6A 2MA3A 1BI3A 1LNWA 2H6CA 2XROA 3K0LA 3FXRA 1S7OA 5EEGA 5FO5A 3NQOA 3QU3A 4HOBA 4IHTA 1IUYA 2CW0F 2M45A 5D5XB 3MCZA 3T8TA 2NRAC 1LVAA 4HF2A 5L3EA 1U3EM 3C18A 3QPHA 1ZG5A 4UVCA 5J8CA 2FXAA 2XKOA 2ESHA 3CUQA 1ZH5A 4LLLA 3P9KA 5JR3A 3DXJF 4XSXF 1S8NA 5BOXA 2CO5A 3I64A 3H3UA 4I0AA 3J81Z 1FLIA 3M8EA 5LLQA 3OV8A 4M9ZA 1K78B 1KGSA 1IRGA 1SFUA 2VONA 3O3KA 2W85A 3CTAA 4FT8A 1UFMA 2OQGA 4WXHA 1HXDA 3NRVA 3R4KA 3REOA 5D5UB 1KU7A 2HFHA 3WU0A 1HW1A 1Z7UA 1HKTA 4WX9A 1ZGJA 2VT2A 3O6BB 2L4AA 2O8XA 1YYVA 4CXFA 4ESFA 1U5TA 2W25A 4R8HA 2H94A 5FD5A 4P5OA 1MGTA 1HKQA 1J0RA 3TDZC 1Z91A 2ZFWA 2B0LA 5CVJA 5HS7A 2QQBA 4DQ2A 2OU2A 4EJVA 2FBKA 1R1VA 3DF8A 4M6YA 3C1DA 2EV6A 2EJRA 1D5VA 1P4AA 2LDUA 1LDKB 2VODA 1J2XA 3EETA 2HYFA 2K02A 2FMLA 4I09A 5CVVA 4ZYHA 2ZO4A 3I54A 5JHUA 2K27A 2IW5A 2PI0A 4P9UA 1TQMA 1KQ0A 3EYIA 1Z6TA 1SFEA 3MEXA 1WWXA 1MJBA 1Z6RA 5ICCA 1I6XA 4EGYA 3ULQB 3LA7A 1IXSB 4JQFA 1ZN2A 3ZN1A 2DFIA 2PFBA 4KIFA 3WTWC 2QUFA 3BPXA 2PBIA 3WODF 1BI0A 2OD5A 4PDKA 1R00A 1RI7A 5DEQA 4I7HA 1OYWA 4LLNA 5D8LB 3BZ6A 4RAYA 3I59A 3KEQA 3Q9SA 3CO7C 4U0WA 1FSEA 4EVIA 1P2FA 2D1VA 5LHHA 3QU6A 3FF5A 1EH7A 2CSOA 2XHKA 2RQPA 1U78A 3TQNA 1TBXA 2FSWA 2Z99A 1S3JA 5ICGA 3P9CA 4O3MA 4U7BA 3E97A 3GFLA 2CYYA 1LDJA 2IJLA 2EFPA 2L02A 4D0PA 5CLSA 2WC2A 1DPUA 4I0BA 1JGSA 3HRSA 4RGSA 3P9IA 4LB6B 5D5VB 2XRNA 1U6GA 4ON0A 3DFGA 1ZARA 1TTYA 3FMQA 2FMYA 1R1UA 2FRHA 3WGHA 2DU9A 1Q1HA 4BHPA 2FQ3A 2EFWA 5EEHA 1B4AA 3GXOA 3MAJA 1QQIA 1F5TA 3FMRA 3BP8A 3HYIA 4XLPF 1JE8A 2RGVA 3MZHA 2DPDA 3HSEA 4IXAA 3EYYA 3V8LA 2LNBA 4WXDA 4A0XA 1PP8F 2Z9OA 2ZMEB 3KP4A 3V7RA 4HX8A 3L00A 5KK1A 2CFXA 4L5IA 5ILUA 2VC1A 1TW2A 4RGXA 3TO6A 5FGMA 3ML6A 1K7AA 1ZGAA 4G9YA 3JTGA 1P6RA 3T5XA 3I4PA 4CICA 1Y0UA 5D5WB 2J5OA 4A0ZA 2E7XA 4R79A 2A69F 1T98A 4MEYF 4A5MA 1ZRCA
chains in the Genus database with same CATH superfamily
2FA5A 1IAWA 2F5VA 1H89C 5DCMB 5HODA 4BXFA 2E34A 2UXNA 2DPUA 3QOPA 1IG7A 4I2OA 2JQ7A 5IT3A 3ZQQA 3MZ8A 3HOTA 5ILSA 3Q5FA 4B3AA 1BJAA 1SVLA 2HOEA 4IEJA 3ZMDA 4V2FA 4BXUA 2R3SA 2A05A 2H1LA 3M1CA 4I99C 3WG7H 2Y0SN 3BOQA 4V19K 4DYQA 1LFBA 2AXLA 1REPC 2KKOA 4XQFA 3K4LA 3GWZA 2OTLI 3BCBA 3WE3A 5J8FA 2E2JJ 3OL3A 2JK3A 1WJBA 3B73A 1VQNI 1EV7A 4LITA 3BG6A 2ZMEA 1P7IA 1KZHA 1JTXA 1ZYRF 2EFOA 4NBQA 1G59A 1KU9A 2EINH 2FD5A 5TJJA 3DP7A 3QPTA 4BBSJ 1SD5A 1UHWA 4XRMA 3GTPJ 2FE3A 5IT9K 1BOBA 3H0DA 2VBZA 5FJ8J 4FISA 3E5XA 3SDGA 3GZ6A 2GM4A 3A01B 1FOWA 1W4MA 3WGGA 2ISZA 3WTXC 3ZQHA 2CV2A 3GFMA 2LRDA 5KAIC 2L9VA 5K7FA 2DMPA 2X6YA 5E20A 1LE8B 3FBNB 2VE9A 2L7MP 1MBGA 3KCCA 1MJAA 1XD7A 4AIHA 3GLXA 1R4MB 3SZPA 2Z2SB 4GCVA 4IHXA 4MEXF 3M3YJ 4BU2A 3L9FA 3L2UA 2P5LC 1O3QA 1QZEA 2ZCWA 4P96A 4BHCA 3BDDA 1R49A 4CCOA 2HDCA 5IOYA 2KZGA 5BNGA 5E3MA 5D6EA 3DKYA 2O0YA 2JJ7A 2ZJPF 2H6BA 1AKHB 4MGRA 3RCOA 2F4OB 4CCJA 5FB2A 1DU6A 2V7FA 3HUGA 1LB2A 3BG5A 3DCFA 2COBA 1V55H 1E17A 4HV6A 3UR3C 3H92A 1NG6A 2XPWA 4PGGA 3ZMTA 3DPUA 5E8IA 3U1KA 4A3BJ 2BW3B 3DBHB 1JGGA 1H9GA 1X2MA 2CUJA 1RKTA 4B43A 1QZZA 4UV9A 4II2A 4K2EA 2KDZA 1V3FA 3W2AA 1IV6A 3E5UA 2EK5A 1KU3A 2A5YB 1ETOA 3FBIB 3H3ZA 3VSLA 2YR2A 1L0OC 2FNAA 4JOMA 3CCYA 3FWEA 3WE2A 5GAGJ 4PJMA 1OPCA 3D0SA 5JFRA 4QPOA 2V9VA 4HX4A 1MMGA 3SEQA 2D1HA 1MNEA 5FLXK 2E7WA 2R7OA 4HDUA 2ZXHA 5HOOA 4OIOF 2V79A 1JKPC 1KQ9A 3AG1H 3F8CA 5FLXZ 4PSWA 5KVRA 2HTJA 3OS2A 4NC6A 1OYIA 2L9NA 4RMNA 5M3MJ 2VIXA 4CYCB 4DNCA 2O61A 3OR2C 2P5KA 2QQ8A 3F8NA 4XLNF 4FX0A 1VQKI 3DPLC 2Q2EB 3IHUA 5GP9A 5B3SH 4MQVA 2LP0A 5HVQC 1ZG1A 1Z7LA 2BZTA 1VQOI 3HRTA 1SVOA 2NAZA 2V4JC 1R71A 3MD2A 3RSNA 4LD5A 3ERED 4A93J 2Z5UA 1X4OA 3G3ZA 4PCQA 3VYRB 2NS8A 2O7OA 1IN4A 2ACJA 1LDDA 5CQGA 1T6SA 1Y1VJ 4RGUA 1YX3A 1P4WA 3AAFA 2M5WA 1IZ1A 1X3UA 2W00A 2X51A 3HHHA 3BR0A 1SANA 1TQIA 1MIJA 2MLGA 5FKNA 5F1RA 4OMZA 4CCMA 1B8IA 2KJCA 2YS9A 3IP4B 3W6KB 4CHUA 1OCPA 3K4KA 3PQKA 3W2WA 3CCQI 4MQ9F 4GFBA 1FC3A 3ZP5A 2LD5A 2RNJA 4CCLA 4HV5A 4IHVA 1TZLA 3LA2A 2K86A 2ADUA 2ZXIA 1SD7A 2ID3A 2HU9A 1Z1DA 2XUBA 2EZIA 1RPWA 4QWQA 3GCMA 5CYVA 2KRHA 3CCEI 1VQLI 3CMAI 3AL0C 3V7CA 4BACA 1QRYA 4HPQA 4L9TA 2Y2ZA 1GHCA 2LR8A 3FXUA 3OYIA 1WHUA 2DBBA 2Q0OA 4HBLA 4B8XA 3GW2A 4F55A 1SMYF 4WF2A 4HSTA 1YW8A 3LFUA 2A3SA 4YIFA 1YQAA 4OINF 3RDIA 3F21A 1Y8RB 2XAUA 2IA1A 3T1BA 4MIMA 2JMWA 3Q9VA 5LHGA 1XPXA 4A5MA 3QRFF 5GAHJ 2CWEA 4Q5SF 4OIRF 3ZQIA 2FU4A 3K1NA 2ZJ2A 3IRRA 2IT0A 3FHZA 3JR9A 2A61A 3FKIJ 2IVMA 2HOSA 3OYKA 5HDNA 3BY6A 4IO9F 4XKVA 4BL0B 5IT9Z 3GTOJ 2N8GA 5DD4A 1MNMC 2K9LA 3CP2A 3ZMUA 1WI9A 2DMUA 2COMA 2HVRA 3FM3A 2WAQN 2DQRA 5DCMA 1Z3XA 3ZQFA 2V1DA 4I98B 5HLIA 4Z6YA 3HPHA 3CDHA 4C2TA 2M0CA 2NOGA 3RIRA 2OQRA 1ZLJA 1B9MA 5EEAA 2VXZA 3M1EA 4L9VA 2FBHA 1BW5A 4IRGA 1HDDC 2CQNA 1XSDA 1YLFA 3DEUA 4IRHA 2PN6A 1P7JA 2BVLA 2KT0A 1ZR2A 4MO7A 2V9PA 1D1AA 2KRFA 2VPRA 1WVRA 3U9GA 4A69C 3C2GA 1VQ7I 1WSUA 1SFXA 2HPMA 3I58A 2MH2A 4BHBA 1YJNI 1XX5A 2BEOA 4U7DA 1USSA 2KIUA 2EB7A 3N05A 3IKTA 1MH3A 4LB5A 4QIWN 4O6JA 2PG4A 4EJUA 2NS7A 4X1EA 2D5VA 4YG2F 3SJMA 2X6OA 3HTUA 3NARA 5DUIA 4L5JA 4HQMA 4HYEA 2FF4A 1N77A 5GTHC 1CF7A 2V1UA 4KT5C 2W84A 2JA2A 4GXOA 2ZBKA 5EGOA 2BXYA 1WJDA 5F0CA 1G3WA 4Y13A 2BGCA 2QYOA 1VQPI 1MKMA 1U9NA 3BROA 2CUZA 5DUKA 1T39A 2DA2A 1SAUA 3KIOA 2PMUA 2QLZA 2HKOA 3I56I 3L1PA 2EV5A 3TKYA 4N9IA 3GZNB 4CDGA 5IP9J 3AFHA 2E35A 5BS6A 4LK0F 3E1SA 3NAUA 4L0ZB 1P92A 3BR1A 2HZTA 2EFNA 2HQAA 4UUVA 4S05A 1IN8A 2JN6A 3DTIA 4R1HA 3SFZA 5KHDA 2JRTA 1PJRA 3F6VA 3GLLA 4P55A 2A07F 3JSPA 1YHQI 2R7FA 4E7ZA 3ZMSA 2HI3A 2IGOA 1B1BA 4LJZF 2G7UA 5ICEA 5M3FJ 4XRSG 3DV8A 4DBRA 1IRXA 2BY3A 4XICA 4RS8A 5K5OA 4AVPA 1I1GA 4H0EA 3LA3A 2XF7A 3H5NA 1FYMA 5M5WJ 3HOWJ 4UUSB 3S15J 1W5TA 1UZCA 1I3QJ 1XDUA 3CF5F 1WJAA 4XKWA 1XDSA 4GGGA 3OYCA 1JTYA 5LGTA 4ZTJA 2WB1A 3K1MA 1RR8C 4XRSA 5LRSA 2IS4A 3TW7A 4AIJA 5C3EJ 2DMNA 1ZRDA 3BQYA 3S16J 2GIVA 3MWMA 1HA8A 3QYBA 1SC7A 3ZMZA 1ZLKA 2BW3A 2EA4A 3KZYA 2NVYJ 1FIAA 4OU0A 3HHGA 2ZXWH 4GYGA 2K9NA 1MBHA 2KHMA 1TNTA 2Y0SA 1S29A 2DK8A 4C30A 1FTTA 1YIOA 2F2EA 2WB1N 1DU0A 4FHTA 1XMKA 1MMSA 5L3CA 2A6TA 1LPQA 2L54A 1RZ4A 3KPHA 2P5VA 2FBIA 5FKMA 2VJ5A 3GFIA 3KLOA 3I3LA 3WTSC 4M74A 3V4GA 3BJ6A 3KETA 1GXPA 2MYSA 3BG9A 4PFOA 3F23A 4G7ZF 1SD4A 1K6OA 2R7RA 3VDXA 3G73A 5HNFA 2LTPA 2M34A 3CF2A 3LSIA 3IL2A 3ZPLA 4PK4A 3RPQA 3FISA 1IXCA 1YW7A 2RNGA 3I0TA 1O3SA 4ITVA 2XPUA 2QBYA 4EJTA 4AU7A 5DD8A 1FBSA 2O9LA 4RBOA 5FRNA 1ZELA 5HLGA 5K5RA 5FKLA 4LG0B 3BTJA 3K2AA 5E79C 2XAJA 1O7LA 1MDMA 1K4SA 2KZVA 2AO9A 3HB9A 3T8RA 4S0HB 3RKQA 2O8KA 3EPZA 1W1WE 2DA3A 4F7ZA 4A2UA 3QPSA 2W1OA 2HDDA 2JPBA 1YG2A 1NK2P 3I4MJ 5E3OA 3IH3A 1TWCJ 5LFAA 5A2QK 2XV4S 2GWRA 2CU7A 2R5ZA 3LAJA 5EZHA 4KDPA 1OCCH 4XIDA 1R23A 2EV0A 1XCVA 3CJTB 2XGEA 4HLXA 5EJCA 3L2QA 3F22A 1FYKA 2CUEA 1IUFA 2AXTC 4JK1X 3DKWA 4KUMA 4Y4RA 4BJ6C 3H1CA 3MZYA 2VOOA 2E5ZA 1K61A 3ASNH 3RPUA 3K4NA 2VT3A 3U1DA 4L9JA 4F91B 2IA2A 3A0HC 3FXQA 4G6QA 5JHFA 4E7JA 1HQCA 2ID6A 4BE0A 2FOWA 2LY9A 5J4VA 2E5NA 1KYWA 2PMZN 3JRGA 2Q2EA 3HC7A 1LEBA 3CC4I 4L5EA 1QVTA 3BT9A 4HQEA 3K6GA 3W6JB 1R5HA 1JJ6C 2DTRA 2HWVA 1C0WA 1UJ8A 1G8XA 4ZYGA 4FCYA 3U2RA 1HW2A 3CMYA 1STZA 3KYCB 4HSRA 1FP2A 1XC5A 1IW7F 3JRAA 2DK5A 4Y3OA 3PFIA 4EM1A 2B7EA 2QSGX 1Y39A 1J5YA 1K83J 3BPVA 3C7JA 2E71A 3IWZA 3DTEA 4XONA 2BHYA 2HS5A 3R0AA 2O6GE 2OCEA 2KMUA 2MGQA 3SHFA 2X9DA 3LSPA 2BE5F 2PEXA 1X4PA 2AS5F 3AKZA 2XF5A 4B1RA 1QGPA 3AG2H 2BXZA 1TQPA 2RV8A 3K4JA 4LLGF 1QVUA 2UUZA 2B63J 2HVSA 2F6CA 3CLQA 3LSRA 3LSHA 2LKXA 1XMAA 3L2CA 1OCTC 1XB4A 3HIFA 2K9MA 5IYBJ 3IC7A 1DP3A 1FT9A 1ETVA 1WJFA 2GA2A 1GUUA 2Y9YA 1OISA 4UB6C 3A01A 4XBFA 4BQNA 2DN0A 5LEJA 2ZNZA 2G7HA 4ZZDA 1E3HA 4Y7NJ 2F4IA 1LKXA 2DFHA 4IHWA 2WAEA 5HLHA 1B8IB 2CQ7A 4CA0A 4CSWA 4L9NA 5DCFA 5JLXA 4EJWA 2JA5J 2RN7A 1W5CC 2M8EA 2NNNA 1JKOC 2G0EA 3KP3A 2P6SA 2A6HF 3LSMA 5AIPA 2VQGA 4YELA 1Z9CA 5F04A 1R6RA 3FZVA 4AC0A 4M73A 4ZYEA 2B9SA 4M72A 1OQYA 2MG4A 2Y30A 1KU2A 5ERIA 1SAXA 4HLYA 3HRMA 2HR3A 3W6VA 1MNDA 2P8TA 1QBJA 2Z1DA 3BTIA 1GV2A 1JHHA 1Q1VA 4HEA2 4EJOA 2X1CA 2EIKH 2WY8Q 2L9RA 3CCLI 3K4CA 4LMYA 2X0LA 1X2NA 4ENNA 2CFOA 3K69A 1JKQC 2K4JA 3E6MA 4UVAA 3S2WA 3GVAA 3SEZA 3BC8A 4RB2C 4MFEA 3LSGA 2F5CA 2LY1A 3PM1A 2VUMJ 1XGNA 3LMMA 2X85A 2JWTA 3IKVA 4PZJA 4BUPA 4E7LA 3K10A 3WTTC 2M3AA 2H27A 2EA2A 3DWLE 5FKKA 1QZYA 1BR1A 1ITYA 5J3LA 2NNYA 3B02A 3GO5A 2XIGA 5CVRA 3G1LA 4FX4A 2R5YA 2W24A 2VASA 1MJ9A 3ABMH 3VFZA 4HNTA 4GYIA 4WCGA 3FHNA 3CDLA 2DTZA 2GBYA 3HOVJ 4NHJA 3IH4A 3GFJA 2YX4A 3RKXA 5E1ZB 3G71I 4HNVA 3S3NA 1X3WB 2L0KA 2L3DA 4YFKF 1T8IA 1FMVA 2CS3A 4I02A 5H6RA 3TEDA 4RAZA 4BBRJ 1USTA 1BM9A 4IL6C 1O57A 3HSRA 3QP5A 4HF1A 3MN2A 3HSFA 4XRFA 3SFIA 3S1QJ 2R7XA 2M4KA 2BYVE 4EQQA 3TBIA 1H9TA 4A6EA 1J59A 1T33A 1GVJA 5F6FA 3F72A 3BJAA 3VYUB 5E18F 2X48A 1SFKA 1RIOH 3KZIC 5IYDJ 5FFZA 3OMYA 2FQ4A 2JT1A 4KA4A 2OAZA 1FX7A 3M8JA 3RTRA 1PDNC 2LOOA 1VQ5I 4F92B 4KN4X 3H3VK 2VBYA 2E36A 1B9NA 3WTUC 2CV0A 1N75A 2K9SA 3E6CC 3VWBA 3LNQA 2UWMA 3Q0WA 2JVGA 1T08B 1TNSA 2GQQA 4JX5A 3L2RA 4XKBA 1ZREA 2FEZA 4NC7A 5EGOB 3OYDA 3FXJA 2M30A 4UY8I 4Y17A 1ZR4A 2P4WA 2F48A 2QENA 5C44J 3BLYA 3TGNA 4HZFA 1ZRFA 4XNFA 4NQWB 1HSJA 3CD6I 3CJQB 1BIAA 3FMSA 4HNUA 4MHGA 3MMYB 1MMAA 3PIPF 4QTRA 1FTZA 1SVMA 5K7HA 2JSCA 3BR2A 2YSRA 4XK4A 1AA7A 2WV1A 1G2HA 3CO6C 2MC3A 2R7WA 3FDYA 1FBQA 4Q48A 2G9WA 5E1XA 3EUHC 4DYRA 1BI1A 1ETQA 3CC2I 4ENKA 1HBXG 3KP6A 2R7TA 1GVDA 3SZGA 2CW8A 3BCAA 3S93A 4RB1A 1TWHJ 4PFPA 1G3TA 2L9SA 2P7VB 2GZWA 4ABZA 5AIQA 4ZH4F 5D6FA 1VTNC 1RNLA 2FUG2 2BV6A 2BY1A 5C4XJ 1ZKGA 3GMEA 2HTSA 1R36A 2LKPA 2OUMA 2PMZA 4LIVA 3TMOA 1Z3YA 5J4YA 1YFHA 1OR7C 1V5FA 2K7LA 1LQ1A 1WZ2A 2LH9A 2MBFA 2XGDA 4WWCA 1ULYA 1VFCA 1W7PD 1Z77A 4UNOA 5ILVA 2PLYA 3ZN0A 2DA6A 4CCKA 3HM5A 2HKXA 2VKEA 2NS0A 1MZBA 3C2HA 3LQRA 5FFXA 3IH2A 3PL8A 3SXYA 2ICWG 5IPAA 4UVBA 5J40A 3N97A 2R7DA 2CGPA 3C3WA 4GO1A 1I3AA 4IQJA 3GF2A 1JXSA 4A3KJ 2OZUA 4G12A 1FOYA 4EEFG 1PUEE 4U87A 3RKYA 3ZQGA 5CVUA 4LFUA 3MKWB 5KNLA 1SMTA 1WRJA 2L4MA 2LYCA 2VE8A 1U0JA 4A3IJ 2CQKA 2KQRA 2CG4A 1P9QC 4MTEA 4S04A 1U8RA 2JTVA 1U8BA 1B6AA 4D7MA 2XASA 1YI2I 3NWTA 4A0YA 2GXAA 4QPQA 3CCMI 2DYSH 3EDPA 3K70D 1KYZA 1EH6A 4EGZA 1V5EA 4PUSA 2QSFX 1DDNA 3OSFA 4UUTA 2LFBA 3O8GA 3RI4A 4BH9A 3HDDA 2DJIA 4XSZF 2ZJQF 5FKOA 4XLCA 1DPRA 3KP2A 3G2BA 2QKMB 4IHSA 2W4SA 1MBEA 1U5TC 4FASD 3GTJJ 2RKHA 2MLKA 1ON1A 1WH7A 2BY2A 2HQRA 2EPFA 1VQ4I 2XF6A 3PNTA 3TO9A 4F3QA 2K85A 1GLNA 2VBWA 4C2MJ 4Y52J 2R5YB 2OZ6A 2F5FA 5EDNA 1LE8A 3TL4X 1H0MA 1I27A 1Y8QB 2VB6A 1E2XA 2LREA 1V54H 1YRNA 2D45A 3F8FA 4KNYA 1WPKA 3ABTA 1AOYA 4N0BA 2K4BA 4E6KG 1LJ9A 4PJNA 2ZNYA 5K1YA 2V6EA 2JSPA 3OOPA 4FETA 4G94A 3KE2A 3CJNA 1A6QA 3GBGA 5D8KB 1E3OC 3ELKA 5DTDA 3TP3A 1YS6A 1H88C 3CDIA 3H36A 5F64A 2M4GA 4L18B 1WKMA 4N4OB 3CC7I 1DGRM 1S9HA 4N4NB 2XC7A 1IXRC 3OWTA 1G6NA 3WG9A 4C9YA 4KISA 4KMUX 2IGMA 4NNJA 5B1AH 1FP1D 2IPQX 3S3MA 4DBQA 1ZAOA 3L2VA 4IPAA 2PJRB 4B47A 2VKHA 1MSFC 2JVHA 5DV5A 4HRIA 3CZ6A 3M07A 4G8XA 2W48A 2R5ZB 3ZGKA 3FM5A 2DAOA 4RA2A 2QKLB 2DA7A 3DEEA 4M9XA 1VNDA 3O2PE 4NDLA 1D1BA 3B6AA 3P5JA 3IWFA 3DTKA 2E1MB 1W5SA 1XN7A 3PJRA 3S2DJ 2LF7A 1YTYA 1X19A 4IF4A 2XSJC 3CUQB 5L3FA 3RZDJ 3LOCA 4D7NA 3SDBA 3RYRA 3ECOA 1SD6A 4MFDA 5A2QZ 3DLLF 4OIQF 2A5WA 4AIKA 1Z67A 4NQWA 2ZSIB 3K4MA 1HLVA 1MW7A 5EYRA 3C2BA 4FTHA 4E7IA 2CUFA 2P6TA 4OWRB 3EUHA 3VEPA 3KLNA 3RQ4A 5JLWA 1FNNA 3U21A 5L3GA 3DU6A 4RAFA 2DT6A 2J5PA 1RRJA 2CMPA 3A4CA 3OOUA 1NH3A 3QODA 1MMNA 4EMSA 3V8KA 1T0FA 4BEHB 4D5FA 2DXIA 3I71A 4YFNF 2E1NA 2QZ8A 3CUOA 1FOKA 2LBFA 1F36A 2BY0A 4AWXB 2DOEA 3KFWX 2JZYA 1FZPB 2Y69H 4CYCA 3G4SI 3EUAA 2VN2A 2Q1ZB 1M1EB 1XGSA 2A6EF 3FXMA 1R22A 5EG0B 5LRRA 3FX3A 4TV7A 2Z16A 1LFPA 2HNHA 3JCUC 4W97A 1YW9A 4KIBA 3ABUA 3LSKA 3E3VA 2CH0A 2Y75A 1BI2A 2YUSA 2FOKA 1MD0A 5DYMA 5F08A 2VOPA 1IN7A 1I1SA 2HZDA 4ASNA 1WJEA 2NOJB 4W1UA 2NYXA 3TDUC 1TWFJ 3E0JB 4KICA 4HDVA 3QYFA 2E1OA 1W7PA 3NWSA 4LK1F 3LFKA 3PIOF 3HOUJ 2QBYB 4BEHA 4HF0A 4PGHA 2D2WA 3V42A 1L3LA 2KDOA 5H6QA 3IAM2 1K78A 4D1QA 2Z33A 3DEWA 1MBJA 1XCBA 3OIQA 3GZ5A 2OTJI 5JVTA 3SYTA 2DFFA 1G3YA 4IZZA 1JUMA 3ZMVA 1TL8A 2KLOA 1I5ZA 5EG0A 3KZZA 3I59B 2VQLA 4BQOA 1MMDA 5JVGF 3R60A 1ETKA 3GX4X 5K7ZA 2PMHA 4NC8A 4RM2A 2H09A 2Q8KA 3NEUA 1S7AA 4RLFA 5L3BA 4ENJA 3I5UA 4RB3C 1ZHFA 5E8GA 3K2ZA 2BBYA 1J7KA 2VJIA 4A5NA 3CCSI 1MDMB 2MSYA 2PQ8A 2RAEA 2WADA 3KEOA 2PJPA 2TDXA 2BHZA 1T56A 4IRIA 4G7OF 3WTVC 4MNUA 1R5GA 1QPMA 3WGIA 3RJPA 2WA0A 1FPQA 3AG3H 1U2WA 1A04A 3ZXSA 2IAIA 2E1CA 3L2WA 2QSHX 4L0YB 2AQEA 3LSTA 2Y48A 4YIIA 2DMQA 1K4TA 3H0GJ 3PQJA 2MABA 3KP7A 1JT0A 4OMYA 4QLCU 4RB0A 2HPIA 5E17F 3RKWA 5IY5H 4IOAF 2OC6A 1FEXA 4KJZA 1POGA 1VQ6I 2LLKA 4P9FA 3PFYA 2YU3A 4NB5A 5FD6A 1AU7A 5E3LA 2ECBA 2QM3A 2V1XA 1CGPA 2CV1A 2QA4I 2UXXA 3OYEA 4JX4A 2XGXA 3LL7A 1XGMA 4PJJA 1O3RA 3RZOJ 3TOAA 3HGGA 4B09A 3JRCA 2ZMEC 1IJWC 3VODA 2FX0A 5ICFA 2KP6A 3HBLA 2R7UA 3E5QA 1VF9A 1ORKA 2WAQA 4CZCA 4KN7X 3QWLA 4G6TB 2O03A 1LEAA 2ESNA 4XORA 4Z2YA 5CJ9A 3GTLJ 2L2OA 4M3BA 5J1UA 4C3JJ 3I55I 3OYAA 2VC0A 2GOXB 2MD5A 2UZKA 3OSGA 2BVMA 1OYYA 3FIWA 2M7BA 1Y56A 3K1PA 4HW0A 4OAYA 3OS0A 4FQGA 4PJLA 3N4MA 2KIMA 1RESA 1WQ2A 2DOAA 4M71A 4M9SA 1AWCA 1R1TA 1CF7B 2CRGA 1GXQA 2Z3YA 4BQAA 3VB2A 4D5CA 2EFQA 1YOVB 3T0YA 2LG4A 1OKRA 4B4CA 4PJ0C 5HDGA 2IA0A 1HC8A 2ELKA 2PX9A 4IVNA 1EH8A 1BC8C 1R4NB 2I10A 2VI6A 2OF7A 4XLHA 3ZQ7A 4MTDA 3WHCA 2WY7Q 4ETSA 1F4KA 3WU2C 2ELHA 2XAGA 2F5DA 3ERMA 2MH9A 1FY7A 3DBLB 3FXKA 3GYHX 1QPIA 4KITB 3ZR8X 2K5CA 1V5GA 5HLTA 3E6DA 4MLOA 4DJAA 4ZC3A 3D5LA 2ETHA 1JHFA 1X1DA 2OCCH 4AD9A 1ZQ3P 1FSHA 2M0MA 4OIPF 1O3TA 2IGKA 3HG9A 1CQTA 1PVEA 4JBAA 4ZJZA 3ASOH 4AIDA 2HQNA 1BBYA 1XGOA 2HGCA 5LEKA 3HOZJ 2DYRH 2WTEA 3HZJA 3OYLA 1Z0XA 5BPDA 1VQ9I 2Y31A 4C2UA 2HOTA 2E19A 2EZKA 2XRLA 2XDVA 2LKSA 2DMTA 2DCEA 1T38A 1BOAA 3GUDA 3HEFA 4ZDLA 1S5LC 3HUGB 3W3CA 2L7KA 4I76A 1BJZA 2GXGA 2QQAA 1UHMA 3ZRGA 4M3DA 1MH4A 2ECCA 4AUXA 1JUSA 3RYPA 1XSVA 2DQLA 1ZG3A 3L7WA 1U5TB 5DDGA 1G3SA 1BR2A 2RDPA 3QOEA 1BN5A 3Q3SA 2STWA 1ZTRA 1HF0A 4BYYA 2L5QA 2ZFUA 3A1YA 2LF8A 3LSJA 4A3JJ 1VQMI 2DO7A 1NK3P 2DDAA 1HSTA 2XAFA 1VQ8I 2AQFA 1EA3A 2R92J 2STTA 4IJAA 3WTYC 4CZZA 3RQIA 2W57A 4KFCA 6PAXA 1R58A 4RGRA 4BE1A 3ECHA 1IV8A 1T2KA 3S17J 4BGDA 3R61A 3COAC 1D8JA 1OJLA 4UV8A 2VKDA 2TCTA 3HPGA 1ACIA 3WTZA 3GEZA 3GTMJ 1XSXA 3FXOA 4ZZLA 2UV1A 4ESBA 3KEYA 2EH3A 4QSHA 1JI8A 2FJ1A 2NVUB 1U9OA 1VZ0A 1S6LA 4A12A 3OIOA 1QNTA 1EJ9A 2ZSHB 4ANJA 3ZQCA 1Z21A 1V4RA 2LMDA 3JREA 3B6CA 5LBQA 2LVSA 5IYCJ 5J6XA 5H20A 3OYMA 1ZGWA 1DP7P 3JW4A 4KYWA 5BMZA 2XAHA 4JP0A 2GA1A 1X3ZB 4I01A 1YS7A 1MBFA 4EM2A 3FK6A 2DT5A 1ODDA 2IXSA 3F6OA 3S1RJ 3M7GA 1D8KA 5CVIA 1LVKA 2GAUA 1S72I 5K5QA 3MKZA 2E1MC 3R0JA 3LAPA 2ME6A 1B72A 2F4MB 2XGCA 4ENMA 3TO7A 3CUQC 2IP2A 1PP7U 4AYBA 1RUNA 3F9KA 4DYCA 2R0QC 2O5RA 2X6WA 5LD2C 4Q47A 2HEOA 1YJWI 3HOYJ 3M9AA 2XPVA 5HS8A 2YX7A 1WH5A 3HTSB 2XKPA 3UKGA 4U0VA 5TRDA 3F8MA 5J47A 4U0YA 2ZKZA 3DPTA 1FWZA 4G7HF 3O8HA 3W2VA 2F5EA 3J7AY 2EBIA 2RVCA 3E7LA 1XS9A 5LGUA 1GDTA 3JSOA 1A35A 4XLFA 1S7EA 2IS1A 4M3GA 2VQHA 4KT6A 4F52A 3I9V2 4H4KC 2V26A 3BWGA 1YE9A 1ETWA 2KPMA 3IRQA 2KIFA 3K70C 1AHDP 2LSOA 2XAQA 1OMIA 3EQLF 3AL0B 5KCMA 3PO2J 4ZTFA 1ETXA 2DA4A 2VXDA 1J75A 3GTQJ 1HCRA 4LG3A 1I39A 2IS2A 1NG7A 1DUXC 2RC4A 2DLLA 2QCOA 4J19A 1H8AC 1A36A 2GOMA 2JA8J 1TW3A 1X1AA 2YPRA 3OY9A 1ZK8A 3TOBA 5J1RA 3Q0VA 4HA8A 1LFUP 1QU3A 4A3GJ 3CCJI 4X6AJ 4M3FA 4Y15A 3JAMK 4RLQA 1O7FA 3MQ0A 3H35A 4YIRX 2W82A 3VYSB 4A6DA 1W7PB 4BY1J 4YFXF 3JAMZ 4G6DA 1K6YA 4UHTA 2QVOA 2MC4A 2FNPA 3DU5A 3J81K 3S14J 2IRFG 3MKLA 5DM6F 1FBUA 4WK8F 2M9HA 4J01A 1WGXA 3P7NA 4XMYA 3M4OJ 1IRZA 2QWWA 3JRIA 3DQVC 1NHAA 2XVCA 5BQTA 4A3MJ 1HOMA 3D5SC 1AKHA 2ZXJA 1HKSA 3TW6A 3ABLH 3ZQLA 1TT0A 4E70A 3HOSA 3K9TA 2ZJRF 3JRDA 4UB8C 4U88A 1ONVA 2K40A 4RM3A 1E3PA 1D0ZA 1B72B 1J9IA 3WHBA 2Y0MA 2KJBA 1Z05A 4OOIA 5ED4A 1QO0D 2HYGD 4XKCA 4BJ5C 1KONA 1IN6A 4UXNA 3F8BA 1XTAA 3KP5A 1HW5A 2K3FA 1BR4A 4ESJA 1D5YA 2M2EA 3ISPA 3OYJA 5CQEA 2OBPA 2NXNB 3A2KA 1IDYA 4CGZA 2WAFA 2P81A 4JYKA 2ZB9A 3G6EI 3HRUA 1DQUA 2KFDA 1YO5C 3G1OA 2OA4A 5E1WA 3ZCOA 1WFXA 2L01A 5LHIA 1Y0NA 3VPRA 2X1EA 4HX7A 4Q4ZF 2O3FA 2R7SA 2EIJH 1P4XA 5D4SA 2WV0A 2V6CA 3I53A 4CYDA 4KMFA 3LQQA 1EKEA 2DI3A 2R7VA 1IN5A 3LWFA 1UMQA 3ONQA 3CP8A 3V8JA 2DFEA 1K79A 3SQNA 1BA5A 4HAMA 2WWYA 1Y1WJ 3DKXA 3PSFA 1F9NA 1ETYA 1SFOJ 2M87A 2TRTA 3E6BA 4WXCA 1TLHB 4V2GA 4IOCF 2GXBA 3FKJA 1RUOA 5LGNA 3DLAA 3JRFA 1RKWA 4XL9A 4M3EA 3CCRI 1ERDA 4XOTA 3CESA 3J80Z 3BR6A 1UCRA 1FJLA 4CUGA 3HKZN 3BJOA 2EZLA 5F27A 4E4HA 5H2FC 1WJ5A 2M8GX 3J80K 2ME0A 4EV0A 2EWNA 5D4RA 5JI6A 3J7AO 2P7CB 3OYGA 3MKYB 4M6XA 4BS9A 2KIQA 3F3XA 1GT0C 1D0XA 5CKTA 4N9HA 1HDPA 2HVQA 4LIUA 1G4DA 2JUGA 1KQ8A 1ON2A 1KA8A 2VKVA 4BNCA 1QHHD 4KIGA 2X6XA 1OR7A 1UG0A 4EM0B 3CLOA 1X1PA 4XN3A 1BC7C 1IF1A 4XM3A 4C3IJ 2CQQA 2DJNA 2L7FP 4A3CJ 2C6YA 3ROUA 3BR3A 3L09A 5AONA 2QEXI 2X4HA 1TWAJ 1IRFA 4F93B 1FIPA 5TGTA 5HDKA 1BW6A 2KRCA 1UB9A 2YU9J 3S2HJ 3BZCA 4DIQA 1A5JA 4XR6A 1I50J 2LY2A 2P0WA 2DT7B 1UAAA 4BAYA 2QF7A 5HS9A 1YIJI 2M1BA 2A68F 3PUFA 1F1ZA 2H8WA 2DA5A 4LGWA 3MFKA 3WU1B 5BPIA 1B59A 3FXLA 4CO8A 4O5VA 3JTHA 2DW4A 4YEJA 2Y9ZA 3QPLA 1FYLA 3R6SA 2CQXA 1IDZA 3V7SA 2ISYA 3VOEA 2JPCA 5KAFC 3QAHA 1R7JA 1TWGJ 2NVQJ 4XOPA 2EZHA 2IBDA 2R4GA 5L3DA 4BQQA 4IX7A 3EUKL 4A3FJ 2PJRA 2HXIA 2VBXA 4ZYDA 4LG0A 3OYHA 3M8FA 2JA7J 3SZTA 2LBFB 1UG2A 1BIBA 1D3YA 2QQ9A 3OR1C 3QP6A 2MA3A 1BI3A 1LNWA 2H6CA 2XSDC 2EQRA 4A3LJ 2XROA 1IGNA 3K0LA 1TC3C 3FXRA 1S7OA 5F0HA 5EEGA 4A3EJ 3ZOBA 5FO5A 5B66C 3BG7A 3NQOA 3QU3A 4HOBA 4IHTA 3BTCA 1IUYA 2CW0F 1D1CA 2M45A 2R7ZJ 5IOZA 5D5XB 3H5AA 3MCZA 3T8TA 2NRAC 1LVAA 4HF2A 5L3EA 1W0UA 1U3EM 2RQQA 3C18A 2XB0X 3QPHA 1APLC 1ZG5A 4UVCA 5J8CA 2MD0A 2FXAA 5CPRB 2XKOA 2ESHA 3CUQA 4FE7A 3VYTB 1ZH5A 4LLLA 2K9QA 3P9KA 5JR3A 3OYBA 3DXJF 4XSXF 3KYDB 3A0BC 1S8NA 5BOXA 2JRMA 1VI0A 3ABKH 2CO5A 3S3OA 3I64A 1TP4A 2HDWA 1ENHA 3MVPA 5FLMJ 3H9GA 3KX2A 3H3UA 4I0AA 1RC9A 4FE4A 3J81Z 2I5UA 4M6VA 3CCVI 1FLIA 2JUCA 3M8EA 5LLQA 2AHQA 4E7SA 1OLTA 3OV8A 4M9ZA 1K78B 1KGSA 1R9TJ 1IRGA 1SFUA 5GPAA 2VONA 3O3KA 2W85A 3CTAA 2E60A 1LUJB 2DA1A 1TT5B 4FT8A 1UFMA 4EATA 4GRIA 2OQGA 1WCMJ 4WXHA 4E7HA 1HXDA 3NRVA 3R4KA 3REOA 5D5UB 1MBKA 1JKRC 1KU7A 2DODA 2HFHA 3WU0A 1JJ8C 2R7QA 3K7AJ 1HW1A 4CH7A 1W36C 1DGWY 1F43A 2ELJA 5HNHA 1Z7UA 2OV7A 3VSKA 5GADJ 2QGUA 4DZPA 3D1NI 1HKTA 3IUOA 5C4JJ 4WX9A 1ZGJA 1OCOH 3X2QH 3JRBA 2VT2A 3O6BB 2L4AA 2O8XA 1YYVA 4JX6A 2EILH 4CXFA 4ESFA 3BZKA 1O4XA 1XMXA 2IS6A 4D9JA 1U5TA 2W25A 2XB5A 4R8HA 2H94A 5FD5A 4P5OA 3QQAA 1MGTA 1HKQA 1J0RA 4DOZA 1N25A 5GPCA 3TDZC 1Z91A 2ZFWA 4C3HJ 3UNGC 1X1BA 2B0LA 5CVJA 3J7ZI 1IC8A 2KL4A 5HS7A 2QQBA 2RREA 5B1BH 4DQ2A 4IKFA 2OU2A 1PUFA 4RAGA 1W36D 4ZDOA 4CCNA 1JUPA 2FBKA 1R1VA 4EJVA 3DF8A 2EIMH 2OPTA 4M6YA 3C1DA 2HOAA 3OL4A 2EV6A 3S1MJ 2EJRA 2V1NA 3BG3A 1D5VA 2NVTJ 5EF6A 1W0TA 1P4AA 1QHGA 1YX5A 2LDUA 1LDKB 4ZDPA 2VODA 3I4NJ 1J2XA 3EETA 2R93J 2HYFA 2K02A 2H8RA 2FMLA 4I09A 5CVVA 4ZYHA 2ZO4A 2L7ZA 3I54A 5FLVA 1Y6IA 5JHUA 2K27A 3CMMA 3HOXJ 2IW5A 1YRNB 2PI0A 2K3PA 1FOXA 2MFZA 4P9UA 3OYNA 2E2HJ 1FMWA 1T95A 1TQMA 2VJJA 1PUFB 1KQ0A 5FROA 3EYIA 4BJTA 1Z6TA 3PO3J 1SFEA 4BE2A 3MEXA 1WWXA 2GIZA 1MJBA 1Z6RA 5ICCA 3CJRB 1D0YA 1I6XA 1EF4A 4EGYA 4XN0A 3ULQB 3LA7A 3Q0UA 5EZGA 4UUSA 3HKZA 3K4BA 1IXSB 3A03A 4DGWB 2LK2A 4JQFA 1ZN2A 3ZN1A 5DS9A 2DFIA 2HXOA 5FRMA 1QA6A 4B44A 2PFBA 3KYLA 1N78A 4BXXJ 4KIFA 3WTWC 2NVXJ 2QUFA 3FK7A 3BPXA 2VJ4A 5B5EC 2IEKA 2PBIA 2HYJA 1BI0A 3WODF 2OD5A 4PDKA 1NTCA 2WBMA 3BR5A 1R00A 1RI7A 5DEQA 4IHYA 4I7HA 2H1KA 1JT6A 1OYWA 4LLNA 2CW7A 5D8LB 3BZ6A 2VLAA 4RAYA 3I59A 3OYFA 2DOFA 4XLEA 3KEQA 2VPLA 5TISC 3Q9SA 5J1YA 5M5XJ 2M7AA 3CO7C 4U0WA 1FSEA 3CQZJ 4EVIA 3AG4H 1OCZH 1UELB 2CJJA 1P2FA 3IV5A 2MW8A 3HJEA 2D1VA 2VQCA 5LHHA 3QU6A 1A6IA 1OFCX 1PYVA 5GTIC 1X1CA 3FF5A 1EH7A 2CSOA 1RR7A 2XHKA 3RPUD 2RQPA 1U78A 3TQNA 1TBXA 2FSWA 2Z99A 1S3JA 5ICGA 1RETA 3P9CA 4O3MA 4U7BA 3PNVA 4BY7J 3HL2A 3E97A 3GFLA 5E3NA 2JA6J 2CYYA 1LDJA 3BQZA 1XG1A 2IJLA 2EFPA 4DW6A 5F1JA 1R5ID 2L02A 4D0PA 3S1NJ 4E7KA 4IQ4A 5CLSA 9ANTA 2WC2A 3IAS2 1DPUA 4I0BA 1JGSA 3OIPA 5F0FA 1GV5A 3A02A 4ZYAA 3J7YJ 3HRSA 3PNYA 4RGSA 3P9IA 4LB6B 5D5VB 2XRNA 1U6GA 2ZC2A 4ON0A 4BDZA 3H9QA 3DFGA 3CMEI 5IP7J 1J09A 4BDYA 1E0EA 4A3DJ 1ZARA 4AVZA 5M5YJ 4OAZA 1TTYA 3FMQA 1R1UA 2FMYA 1YJ9I 5GAEJ 1A31A 3BTLA 3DBRB 2FRHA 4XLAA 3WGHA 3H5RA 3D5RC 2KISA 2DU9A 1Q1HA 4BHPA 4LOCA 1X58A 4NUBA 2FQ3A 4B48A 2EFWA 4II3A 3HGYA 2OJED 5EEHA 4I6ZA 1B4AA 2BOLA 3S8PA 3GXOA 3MAJA 3CCUI 1QQIA 1F5TA 3FMRA 3BP8A 3HYIA 4DZJA 4XLPF 2RGVA 3S32A 2V9KA 4B3XA 1JE8A 3MZHA 3HXLA 2DPDA 3QYEA 4J00A 2DDBA 4X0GA 1BL0A 3HSEA 4IXAA 3EYYA 3V8LA 2LNBA 5IP6A 5DM7F 2HQ5A 4WXDA 1SEUA 4A0XA 4Y33A 3H9JA 3F0CA 1PP8F 4AYBN 2Z9OA 2ZMEB 3ESWB 3KP4A 1OCRH 3V7RA 4HX8A 3L00A 2E2IJ 4HG2A 5KK1A 2X1DA 2CFXA 4YRVA 4P1WA 4L5IA 4RDUA 5ILUA 2VC1A 4AM3A 1TW2A 2LC2A 3G1MA 1WJCA 4RGXA 5FGMA 3TO6A 3ML6A 1WI3A 1ZGAA 3PUBA 1YITI 1K7AA 4G9YA 3JTGA 1P6RA 2VL8A 3JRHA 3T5XA 1T0FC 2GLOA 1MSEC 3I4PA 4GDFA 4CICA 1Y0UA 3GTGJ 5D5WB 4BKXA 3GTKJ 1I6HJ 2J5OA 4A0ZA 2I8DA 2E7XA 4R79A 1IO2A 1UHSA 2A69F 1T98A 4MEYF 4PSXA 3PSIA 3OS1A 2W7NA 2IGNA 1ZRCA 3TP0A
chains in the Genus database with same CATH topology
2FA5A 1IAWA 5DCMB 2UXNA 2DPUA 3QOPA 4I2OA 5IT3A 3HOTA 5ILSA 3Q5FA 1BJAA 2HOEA 3ZMDA 4BXUA 2R3SA 3BOQA 2AXLA 1REPC 2KKOA 3GWZA 3WE3A 5J8FA 3B73A 1EV7A 2ZMEA 1ZYRF 2EFOA 1KU9A 5TJJA 3DP7A 3QPTA 1SD5A 1UHWA 2FE3A 5IT9K 2VBZA 3E5XA 3GZ6A 2ISZA 3WGGA 1W4MA 3WTXC 3GFMA 5E20A 2VE9A 3KCCA 1MJAA 4AIHA 1XD7A 3GLXA 3SZPA 4GCVA 4MEXF 2P5LC 3L9FA 1O3QA 2ZCWA 4P96A 4BHCA 3BDDA 2HDCA 5D6EA 2O0YA 2H6BA 4MGRA 5FB2A 3HUGA 1LB2A 1E17A 4HV6A 3H92A 4PGGA 3ZMTA 5E8IA 1H9GA 1QZZA 4UV9A 4K2EA 1V3FA 3E5UA 2EK5A 1KU3A 2A5YB 3H3ZA 2YR2A 1L0OC 2FNAA 3WE2A 3FWEA 1OPCA 3D0SA 5JFRA 2V9VA 4HX4A 2D1HA 5FLXK 2E7WA 4HDUA 5HOOA 4OIOF 2V79A 1KQ9A 3F8CA 5FLXZ 5KVRA 2HTJA 1OYIA 2O61A 4DNCA 2P5KA 3F8NA 4XLNF 4FX0A 3DPLC 3IHUA 4MQVA 5HVQC 1ZG1A 3HRTA 2NAZA 4LD5A 3ERED 2Z5UA 3G3ZA 4PCQA 1IN4A 2ACJA 1LDDA 1T6SA 4RGUA 1P4WA 3AAFA 2M5WA 1IZ1A 1X3UA 3HHHA 1TQIA 2MLGA 5F1RA 4OMZA 2KJCA 3W6KB 4CHUA 3PQKA 4MQ9F 1FC3A 3ZP5A 2RNJA 4HV5A 3LA2A 2K86A 2ADUA 1SD7A 1Z1DA 2XUBA 4QWQA 5CYVA 3V7CA 4L9TA 1GHCA 3FXUA 2DBBA 2Q0OA 4HBLA 4B8XA 3GW2A 1SMYF 4WF2A 1YW8A 2A3SA 4YIFA 1YQAA 4OINF 3RDIA 3F21A 3T1BA 2IA1A 3Q9VA 5LHGA 3QRFF 2CWEA 4Q5SF 4OIRF 2FU4A 3K1NA 2ZJ2A 3IRRA 2IT0A 3FHZA 2A61A 2IVMA 5HDNA 3BY6A 5IT9Z 5DD4A 3ZMUA 1WI9A 2COMA 3FM3A 2DQRA 5DCMA 2V1DA 4I98B 5HLIA 3CDHA 3RIRA 2OQRA 1ZLJA 1B9MA 2VXZA 3M1EA 4L9VA 2FBHA 4IRGA 1XSDA 1YLFA 3DEUA 4IRHA 2PN6A 2KRFA 3U9GA 1WSUA 1SFXA 3I58A 2MH2A 4BHBA 2BEOA 4U7DA 1USSA 2KIUA 2EB7A 3IKTA 4LB5A 4O6JA 2PG4A 4EJUA 4YG2F 3HTUA 5DUIA 4L5JA 4HQMA 4HYEA 2FF4A 1CF7A 2V1UA 4KT5C 2W84A 4GXOA 2ZBKA 1G3WA 4Y13A 2BGCA 2QYOA 1MKMA 3BROA 1T39A 5DUKA 2PMUA 2QLZA 2HKOA 2EV5A 3TKYA 4N9IA 4CDGA 5BS6A 4LK0F 4L0ZB 1P92A 2HZTA 2EFNA 4UUVA 4S05A 1IN8A 4R1HA 3SFZA 2JRTA 4P55A 3F6VA 2A07F 3JSPA 2R7FA 3ZMSA 1B1BA 4LJZF 2G7UA 5ICEA 3DV8A 4RS8A 5K5OA 4AVPA 1I1GA 4H0EA 3LA3A 1FYMA 1W5TA 1XDUA 1XDSA 4GGGA 5LGTA 3K1MA 5LRSA 4AIJA 1ZRDA 2GIVA 3MWMA 1ZLKA 3ZMZA 2EA4A 3KZYA 4OU0A 3HHGA 4GYGA 1TNTA 1S29A 2DK8A 1YIOA 2F2EA 4FHTA 1XMKA 5L3CA 2L54A 1RZ4A 2P5VA 2FBIA 3GFIA 3KLOA 3WTSC 4M74A 3V4GA 3BJ6A 3KETA 1GXPA 4G7ZF 3F23A 1SD4A 1K6OA 3G73A 3IL2A 3ZPLA 3RPQA 1O3SA 1IXCA 1YW7A 3I0TA 2QBYA 4EJTA 5DD8A 1FBSA 5HLGA 5K5RA 4LG0B 2XAJA 1O7LA 1MDMA 3T8RA 4F7ZA 4A2UA 2JPBA 1YG2A 5A2QK 2XV4S 2GWRA 3LAJA 4KDPA 1R23A 2EV0A 1XCVA 4HLXA 3F22A 1FYKA 4JK1X 3DKWA 4KUMA 3MZYA 2VOOA 3RPUA 2VT3A 3U1DA 4L9JA 2IA2A 3FXQA 4G6QA 1HQCA 1KYWA 2Q2EA 1LEBA 4HQEA 3W6JB 1R5HA 1C0WA 2DTRA 2HWVA 4ZYGA 3U2RA 1HW2A 1STZA 1FP2A 1IW7F 2DK5A 3PFIA 4EM1A 1J5YA 3BPVA 3C7JA 3IWZA 3R0AA 2HS5A 2O6GE 3SHFA 2BE5F 2PEXA 2AS5F 1QGPA 2RV8A 1TQPA 4LLGF 1XMAA 3L2CA 1XB4A 3HIFA 3IC7A 1FT9A 2GA2A 4XBFA 5LEJA 2ZNZA 2G7HA 4ZZDA 5HLHA 4L9NA 5DCFA 4EJWA 2RN7A 2M8EA 2NNNA 3KP3A 2P6SA 2A6HF 5AIPA 1Z9CA 3FZVA 4M73A 4ZYEA 4M72A 5ERIA 1KU2A 1SAXA 4HLYA 3HRMA 2HR3A 2P8TA 1QBJA 1JHHA 4EJOA 4LMYA 2X0LA 4ENNA 3K69A 2K4JA 3E6MA 4UVAA 3S2WA 3GVAA 4RB2C 2F5CA 1XGNA 3IKVA 4PZJA 3WTTC 2H27A 2EA2A 1QZYA 2NNYA 3B02A 3GO5A 2XIGA 5CVRA 4FX4A 2W24A 1MJ9A 3VFZA 4GYIA 4WCGA 4NHJA 3GFJA 2YX4A 3RKXA 5E1ZB 2L3DA 4YFKF 5H6RA 4I02A 4RAZA 1USTA 1BM9A 4HF1A 1O57A 3HSRA 3QP5A 3HSFA 4XRFA 2BYVE 4EQQA 1H9TA 4A6EA 1J59A 1GVJA 5F6FA 3F72A 3BJAA 5E18F 1RIOH 5FFZA 2JT1A 4KA4A 2OAZA 1FX7A 3RTRA 1PDNC 4KN4X 2VBYA 1B9NA 3WTUC 3E6CC 2UWMA 1TNSA 2GQQA 1ZREA 2FEZA 2M30A 4Y17A 2P4WA 2QENA 3TGNA 4HZFA 1ZRFA 1HSJA 1BIAA 3FMSA 4MHGA 2JSCA 2YSRA 3CO6C 2MC3A 1FBQA 4Q48A 2G9WA 5E1XA 1BI1A 4ENKA 1HBXG 3KP6A 4RB1A 1G3TA 2P7VB 2GZWA 5AIQA 4ZH4F 5D6FA 1VTNC 1RNLA 2BV6A 2HTSA 1R36A 2LKPA 1YFHA 2K7LA 1LQ1A 2MBFA 4WWCA 1ULYA 1W7PD 4UNOA 5ILVA 2PLYA 3ZN0A 2HKXA 2NS0A 1MZBA 3LQRA 5FFXA 3SXYA 4UVBA 3N97A 2R7DA 2CGPA 3C3WA 4GO1A 3GF2A 1JXSA 2OZUA 1PUEE 3RKYA 5CVUA 4LFUA 1SMTA 1WRJA 2L4MA 2VE8A 2CQKA 2CG4A 4MTEA 4S04A 1U8RA 2JTVA 1B6AA 2XASA 4A0YA 3EDPA 1KYZA 4EGZA 1EH6A 1DDNA 3RI4A 4BH9A 4XSZF 1DPRA 3KP2A 4IHSA 1U5TC 2RKHA 2MLKA 1ON1A 2HQRA 3TO9A 2VBWA 2OZ6A 2F5FA 1H0MA 1I27A 1E2XA 2D45A 3F8FA 4KNYA 3ABTA 1AOYA 4N0BA 2K4BA 1LJ9A 2ZNYA 5K1YA 3OOPA 4G94A 3KE2A 3CJNA 5D8KB 3ELKA 1YS6A 5F64A 4L18B 1WKMA 1IXRC 1G6NA 3WG9A 4KMUX 1FP1D 2IPQX 1ZAOA 4IPAA 5DV5A 4G8XA 3FM5A 2DAOA 4M9XA 3O2PE 3IWFA 1W5SA 1XN7A 2LF7A 1YTYA 4IF4A 3CUQB 5L3FA 3RYRA 3ECOA 1SD6A 5A2QZ 4OIQF 4AIKA 4NQWA 2P6TA 3VEPA 3EUHA 3KLNA 1FNNA 5L3GA 2J5PA 4EMSA 3V8KA 1T0FA 3I71A 4YFNF 2E1NA 2QZ8A 3CUOA 1FOKA 4AWXB 3KFWX 2JZYA 1FZPB 2VN2A 1XGSA 2A6EF 1R22A 5LRRA 3FX3A 4TV7A 1YW9A 4KIBA 3ABUA 3E3VA 2Y75A 1BI2A 2FOKA 1MD0A 5DYMA 2VOPA 1IN7A 1I1SA 4ASNA 2NYXA 3TDUC 4KICA 4HDVA 1W7PA 4LK1F 3LFKA 2QBYB 4HF0A 4PGHA 2D2WA 1L3LA 5H6QA 1K78A 2Z33A 1XCBA 3GZ5A 5JVTA 1G3YA 3ZMVA 1I5ZA 3KZZA 3I59B 3R60A 3GX4X 2PMHA 2H09A 2Q8KA 3NEUA 1S7AA 5L3BA 4ENJA 3I5UA 4RB3C 1ZHFA 5E8GA 3K2ZA 2BBYA 1J7KA 4A5NA 1MDMB 2PQ8A 3KEOA 2PJPA 2TDXA 4IRIA 4G7OF 3WTVC 4MNUA 1R5GA 1QPMA 3WGIA 3RJPA 1FPQA 1U2WA 1A04A 2E1CA 4L0YB 3LSTA 2Y48A 4YIIA 3PQJA 3KP7A 4OMYA 4QLCU 4RB0A 5E17F 3RKWA 4P9FA 2YU3A 4NB5A 5FD6A 2V1XA 2QM3A 1CGPA 2UXXA 2XGXA 1XGMA 1O3RA 3TOAA 4B09A 3VODA 5ICFA 3E5QA 4KN7X 2O03A 1LEAA 2ESNA 4Z2YA 5CJ9A 2VC0A 2MD5A 2UZKA 1OYYA 3K1PA 4HW0A 3N4MA 2KIMA 1WQ2A 4M71A 4M9SA 1AWCA 1R1TA 1CF7B 2Z3YA 1GXQA 4BQAA 3VB2A 2EFQA 3T0YA 1OKRA 5HDGA 2IA0A 4IVNA 1EH8A 1BC8C 3ZQ7A 4MTDA 4ETSA 1F4KA 2ELHA 2XAGA 2F5DA 2MH9A 1FY7A 3GYHX 3E6DA 3D5LA 2ETHA 1JHFA 4AD9A 1FSHA 4OIPF 1O3TA 4JBAA 2HQNA 1BBYA 1XGOA 2HGCA 5LEKA 2WTEA 5BPDA 1T38A 1BOAA 3GUDA 2GXGA 2QQAA 1UHMA 3RYPA 1XSVA 2DQLA 1ZG3A 3L7WA 1U5TB 5DDGA 1G3SA 2RDPA 1BN5A 2STWA 4BYYA 2LF8A 2DO7A 1HSTA 2XAFA 2STTA 4IJAA 3WTYC 4CZZA 4KFCA 2W57A 6PAXA 1R58A 4RGRA 3ECHA 1T2KA 3R61A 3COAC 1D8JA 4UV8A 3WTZA 3GEZA 1XSXA 4ZZLA 4ESBA 1S6LA 4A12A 1QNTA 1V4RA 5LBQA 5J6XA 5H20A 1DP7P 3JW4A 4KYWA 5BMZA 2XAHA 2GA1A 4I01A 1YS7A 4EM2A 2DT5A 1ODDA 3F6OA 5CVIA 1D8KA 3M7GA 2GAUA 5K5QA 3R0JA 3LAPA 4ENMA 3TO7A 3CUQC 2IP2A 1PP7U 1RUNA 4Q47A 2HEOA 3M9AA 5HS8A 2YX7A 3HTSB 2XKPA 4U0VA 5TRDA 3F8MA 4U0YA 2ZKZA 3DPTA 1FWZA 4G7HF 2F5EA 2RVCA 5LGUA 3JSOA 3BWGA 3IRQA 2KIFA 2LSOA 2XAQA 1OMIA 3EQLF 1J75A 1DUXC 2RC4A 2DLLA 1TW3A 2YPRA 3TOBA 4HA8A 3JAMK 4Y15A 1O7FA 3MQ0A 4A6DA 1W7PB 4YFXF 3JAMZ 4G6DA 4UHTA 2QVOA 2FNPA 3J81K 2IRFG 1FBUA 4WK8F 3P7NA 2QWWA 3DQVC 1NHAA 2XVCA 5BQTA 2ZXJA 1HKSA 4E70A 3HOSA 3K9TA 4U88A 1ONVA 1J9IA 2Y0MA 2KJBA 1Z05A 4OOIA 5ED4A 1QO0D 2HYGD 1IN6A 4UXNA 3F8BA 3KP5A 1HW5A 4ESJA 3ISPA 2OBPA 4CGZA 3HRUA 1YO5C 2OA4A 5E1WA 2L01A 5LHIA 4HX7A 4Q4ZF 2O3FA 1P4XA 5D4SA 2WV0A 2V6CA 3I53A 4CYDA 4KMFA 3LQQA 2DI3A 1IN5A 3LWFA 3V8JA 1K79A 3SQNA 4HAMA 2WWYA 1F9NA 2M87A 3E6BA 4WXCA 1TLHB 2GXBA 1RUOA 5LGNA 3J80Z 1UCRA 3BJOA 3J80K 4EV0A 2EWNA 5D4RA 5JI6A 3J7AO 2P7CB 4M6XA 3F3XA 4N9HA 1G4DA 1KQ8A 1ON2A 1KA8A 4BNCA 4KIGA 1OR7A 4EM0B 3CLOA 1BC7C 1IF1A 2C6YA 3ROUA 3L09A 5AONA 2X4HA 1IRFA 5HDKA 1UB9A 4BAYA 5HS9A 2M1BA 2A68F 1F1ZA 4LGWA 3MFKA 3WU1B 5BPIA 1B59A 4CO8A 4O5VA 3JTHA 2DW4A 1FYLA 3R6SA 3V7SA 2ISYA 3VOEA 2JPCA 3QAHA 1R7JA 5L3DA 2VBXA 4ZYDA 4LG0A 3M8FA 3SZTA 1BIBA 1D3YA 2QQ9A 3QP6A 2MA3A 1BI3A 1LNWA 2H6CA 2XROA 3K0LA 3FXRA 1S7OA 5EEGA 5FO5A 3NQOA 3QU3A 4HOBA 4IHTA 1IUYA 2CW0F 2M45A 5D5XB 3MCZA 3T8TA 2NRAC 1LVAA 4HF2A 5L3EA 1U3EM 3C18A 3QPHA 1ZG5A 4UVCA 5J8CA 2FXAA 2XKOA 2ESHA 3CUQA 1ZH5A 4LLLA 3P9KA 5JR3A 3DXJF 4XSXF 1S8NA 5BOXA 2CO5A 3I64A 3H3UA 4I0AA 3J81Z 1FLIA 3M8EA 5LLQA 3OV8A 4M9ZA 1K78B 1KGSA 1IRGA 1SFUA 2VONA 3O3KA 2W85A 3CTAA 4FT8A 1UFMA 2OQGA 4WXHA 1HXDA 3NRVA 3R4KA 3REOA 5D5UB 1KU7A 2HFHA 3WU0A 1HW1A 1Z7UA 1HKTA 4WX9A 1ZGJA 2VT2A 3O6BB 2L4AA 2O8XA 1YYVA 4CXFA 4ESFA 1U5TA 2W25A 4R8HA 2H94A 5FD5A 4P5OA 1MGTA 1HKQA 1J0RA 3TDZC 1Z91A 2ZFWA 2B0LA 5CVJA 5HS7A 2QQBA 4DQ2A 2OU2A 4EJVA 2FBKA 1R1VA 3DF8A 4M6YA 3C1DA 2EV6A 2EJRA 1D5VA 1P4AA 2LDUA 1LDKB 2VODA 1J2XA 3EETA 2HYFA 2K02A 2FMLA 4I09A 5CVVA 4ZYHA 2ZO4A 3I54A 5JHUA 2K27A 2IW5A 2PI0A 4P9UA 1TQMA 1KQ0A 3EYIA 1Z6TA 1SFEA 3MEXA 1WWXA 1MJBA 1Z6RA 5ICCA 1I6XA 4EGYA 3ULQB 3LA7A 1IXSB 4JQFA 1ZN2A 3ZN1A 2DFIA 2PFBA 4KIFA 3WTWC 2QUFA 3BPXA 2PBIA 3WODF 1BI0A 2OD5A 4PDKA 1R00A 1RI7A 5DEQA 4I7HA 1OYWA 4LLNA 5D8LB 3BZ6A 4RAYA 3I59A 3KEQA 3Q9SA 3CO7C 4U0WA 1FSEA 4EVIA 1P2FA 2D1VA 5LHHA 3QU6A 3FF5A 1EH7A 2CSOA 2XHKA 2RQPA 1U78A 3TQNA 1TBXA 2FSWA 2Z99A 1S3JA 5ICGA 3P9CA 4O3MA 4U7BA 3E97A 3GFLA 2CYYA 1LDJA 2IJLA 2EFPA 2L02A 4D0PA 5CLSA 2WC2A 1DPUA 4I0BA 1JGSA 3HRSA 4RGSA 3P9IA 4LB6B 5D5VB 2XRNA 1U6GA 4ON0A 3DFGA 1ZARA 1TTYA 3FMQA 2FMYA 1R1UA 2FRHA 3WGHA 2DU9A 1Q1HA 4BHPA 2FQ3A 2EFWA 5EEHA 1B4AA 3GXOA 3MAJA 1QQIA 1F5TA 3FMRA 3BP8A 3HYIA 4XLPF 1JE8A 2RGVA 3MZHA 2DPDA 3HSEA 4IXAA 3EYYA 3V8LA 2LNBA 4WXDA 4A0XA 1PP8F 2Z9OA 2ZMEB 3KP4A 3V7RA 4HX8A 3L00A 5KK1A 2CFXA 4L5IA 5ILUA 2VC1A 1TW2A 4RGXA 3TO6A 5FGMA 3ML6A 1K7AA 1ZGAA 4G9YA 3JTGA 1P6RA 3T5XA 3I4PA 4CICA 1Y0UA 5D5WB 2J5OA 4A0ZA 2E7XA 4R79A 2A69F 1T98A 4MEYF 4A5MA 1ZRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FA5 A;  1IAW A;  5DCM B;  2UXN A;  2DPU A;  3QOP A;  4I2O A;  5IT3 A;  3HOT A;  5ILS A;  3Q5F A;  1BJA A;  2HOE A;  3ZMD A;  4BXU A;  2R3S A;  3BOQ A;  2AXL A;  1REP C;  2KKO A;  3GWZ A;  3WE3 A;  5J8F A;  3B73 A;  1EV7 A;  2ZME A;  1ZYR F;  2EFO A;  1KU9 A;  5TJJ A;  3DP7 A;  3QPT A;  1SD5 A;  1UHW A;  2FE3 A;  5IT9 K;  2VBZ A;  3E5X A;  3GZ6 A;  2ISZ A;  3WGG A;  1W4M A;  3WTX C;  3GFM A;  5E20 A;  2VE9 A;  3KCC A;  1MJA A;  4AIH A;  1XD7 A;  3GLX A;  3SZP A;  4GCV A;  4MEX F;  2P5L C;  3L9F A;  1O3Q A;  2ZCW A;  4P96 A;  4BHC A;  3BDD A;  2HDC A;  5D6E A;  2O0Y A;  2H6B A;  4MGR A;  5FB2 A;  3HUG A;  1LB2 A;  1E17 A;  4HV6 A;  3H92 A;  4PGG A;  3ZMT A;  5E8I A;  1H9G A;  1QZZ A;  4UV9 A;  4K2E A;  1V3F A;  3E5U A;  2EK5 A;  1KU3 A;  2A5Y B;  3H3Z A;  2YR2 A;  1L0O C;  2FNA A;  3WE2 A;  3FWE A;  1OPC A;  3D0S A;  5JFR A;  2V9V A;  4HX4 A;  2D1H A;  5FLX K;  2E7W A;  4HDU A;  5HOO A;  4OIO F;  2V79 A;  1KQ9 A;  3F8C A;  5FLX Z;  5KVR A;  2HTJ A;  1OYI A;  2O61 A;  4DNC A;  2P5K A;  3F8N A;  4XLN F;  4FX0 A;  3DPL C;  3IHU A;  4MQV A;  5HVQ C;  1ZG1 A;  3HRT A;  2NAZ A;  4LD5 A;  3ERE D;  2Z5U A;  3G3Z A;  4PCQ A;  1IN4 A;  2ACJ A;  1LDD A;  1T6S A;  4RGU A;  1P4W A;  3AAF A;  2M5W A;  1IZ1 A;  1X3U A;  3HHH A;  1TQI A;  2MLG A;  5F1R A;  4OMZ A;  2KJC A;  3W6K B;  4CHU A;  3PQK A;  4MQ9 F;  1FC3 A;  3ZP5 A;  2RNJ A;  4HV5 A;  3LA2 A;  2K86 A;  2ADU A;  1SD7 A;  1Z1D A;  2XUB A;  4QWQ A;  5CYV A;  3V7C A;  4L9T A;  1GHC A;  3FXU A;  2DBB A;  2Q0O A;  4HBL A;  4B8X A;  3GW2 A;  1SMY F;  4WF2 A;  1YW8 A;  2A3S A;  4YIF A;  1YQA A;  4OIN F;  3RDI A;  3F21 A;  3T1B A;  2IA1 A;  3Q9V A;  5LHG A;  3QRF F;  2CWE A;  4Q5S F;  4OIR F;  2FU4 A;  3K1N A;  2ZJ2 A;  3IRR A;  2IT0 A;  3FHZ A;  2A61 A;  2IVM A;  5HDN A;  3BY6 A;  5IT9 Z;  5DD4 A;  3ZMU A;  1WI9 A;  2COM A;  3FM3 A;  2DQR A;  5DCM A;  2V1D A;  4I98 B;  5HLI A;  3CDH A;  3RIR A;  2OQR A;  1ZLJ A;  1B9M A;  2VXZ A;  3M1E A;  4L9V A;  2FBH A;  4IRG A;  1XSD A;  1YLF A;  3DEU A;  4IRH A;  2PN6 A;  2KRF A;  3U9G A;  1WSU A;  1SFX A;  3I58 A;  2MH2 A;  4BHB A;  2BEO A;  4U7D A;  1USS A;  2KIU A;  2EB7 A;  3IKT A;  4LB5 A;  4O6J A;  2PG4 A;  4EJU A;  4YG2 F;  3HTU A;  5DUI A;  4L5J A;  4HQM A;  4HYE A;  2FF4 A;  1CF7 A;  2V1U A;  4KT5 C;  2W84 A;  4GXO A;  2ZBK A;  1G3W A;  4Y13 A;  2BGC A;  2QYO A;  1MKM A;  3BRO A;  1T39 A;  5DUK A;  2PMU A;  2QLZ A;  2HKO A;  2EV5 A;  3TKY A;  4N9I A;  4CDG A;  5BS6 A;  4LK0 F;  4L0Z B;  1P92 A;  2HZT A;  2EFN A;  4UUV A;  4S05 A;  1IN8 A;  4R1H A;  3SFZ A;  2JRT A;  4P55 A;  3F6V A;  2A07 F;  3JSP A;  2R7F A;  3ZMS A;  1B1B A;  4LJZ F;  2G7U A;  5ICE A;  3DV8 A;  4RS8 A;  5K5O A;  4AVP A;  1I1G A;  4H0E A;  3LA3 A;  1FYM A;  1W5T A;  1XDU A;  1XDS A;  4GGG A;  5LGT A;  3K1M A;  5LRS A;  4AIJ A;  1ZRD A;  2GIV A;  3MWM A;  1ZLK A;  3ZMZ A;  2EA4 A;  3KZY A;  4OU0 A;  3HHG A;  4GYG A;  1TNT A;  1S29 A;  2DK8 A;  1YIO A;  2F2E A;  4FHT A;  1XMK A;  5L3C A;  2L54 A;  1RZ4 A;  2P5V A;  2FBI A;  3GFI A;  3KLO A;  3WTS C;  4M74 A;  3V4G A;  3BJ6 A;  3KET A;  1GXP A;  4G7Z F;  3F23 A;  1SD4 A;  1K6O A;  3G73 A;  3IL2 A;  3ZPL A;  3RPQ A;  1O3S A;  1IXC A;  1YW7 A;  3I0T A;  2QBY A;  4EJT A;  5DD8 A;  1FBS A;  5HLG A;  5K5R A;  4LG0 B;  2XAJ A;  1O7L A;  1MDM A;  3T8R A;  4F7Z A;  4A2U A;  2JPB A;  1YG2 A;  5A2Q K;  2XV4 S;  2GWR A;  3LAJ A;  4KDP A;  1R23 A;  2EV0 A;  1XCV A;  4HLX A;  3F22 A;  1FYK A;  4JK1 X;  3DKW A;  4KUM A;  3MZY A;  2VOO A;  3RPU A;  2VT3 A;  3U1D A;  4L9J A;  2IA2 A;  3FXQ A;  4G6Q A;  1HQC A;  1KYW A;  2Q2E A;  1LEB A;  4HQE A;  3W6J B;  1R5H A;  1C0W A;  2DTR A;  2HWV A;  4ZYG A;  3U2R A;  1HW2 A;  1STZ A;  1FP2 A;  1IW7 F;  2DK5 A;  3PFI A;  4EM1 A;  1J5Y A;  3BPV A;  3C7J A;  3IWZ A;  3R0A A;  2HS5 A;  2O6G E;  3SHF A;  2BE5 F;  2PEX A;  2AS5 F;  1QGP A;  2RV8 A;  1TQP A;  4LLG F;  1XMA A;  3L2C A;  1XB4 A;  3HIF A;  3IC7 A;  1FT9 A;  2GA2 A;  4XBF A;  5LEJ A;  2ZNZ A;  2G7H A;  4ZZD A;  5HLH A;  4L9N A;  5DCF A;  4EJW A;  2RN7 A;  2M8E A;  2NNN A;  3KP3 A;  2P6S A;  2A6H F;  5AIP A;  1Z9C A;  3FZV A;  4M73 A;  4ZYE A;  4M72 A;  5ERI A;  1KU2 A;  1SAX A;  4HLY A;  3HRM A;  2HR3 A;  2P8T A;  1QBJ A;  1JHH A;  4EJO A;  4LMY A;  2X0L A;  4ENN A;  3K69 A;  2K4J A;  3E6M A;  4UVA A;  3S2W A;  3GVA A;  4RB2 C;  2F5C A;  1XGN A;  3IKV A;  4PZJ A;  3WTT C;  2H27 A;  2EA2 A;  1QZY A;  2NNY A;  3B02 A;  3GO5 A;  2XIG A;  5CVR A;  4FX4 A;  2W24 A;  1MJ9 A;  3VFZ A;  4GYI A;  4WCG A;  4NHJ A;  3GFJ A;  2YX4 A;  3RKX A;  5E1Z B;  2L3D A;  4YFK F;  5H6R A;  4I02 A;  4RAZ A;  1UST A;  1BM9 A;  4HF1 A;  1O57 A;  3HSR A;  3QP5 A;  3HSF A;  4XRF A;  2BYV E;  4EQQ A;  1H9T A;  4A6E A;  1J59 A;  1GVJ A;  5F6F A;  3F72 A;  3BJA A;  5E18 F;  1RIO H;  5FFZ A;  2JT1 A;  4KA4 A;  2OAZ A;  1FX7 A;  3RTR A;  1PDN C;  4KN4 X;  2VBY A;  1B9N A;  3WTU C;  3E6C C;  2UWM A;  1TNS A;  2GQQ A;  1ZRE A;  2FEZ A;  2M30 A;  4Y17 A;  2P4W A;  2QEN A;  3TGN A;  4HZF A;  1ZRF A;  1HSJ A;  1BIA A;  3FMS A;  4MHG A;  2JSC A;  2YSR A;  3CO6 C;  2MC3 A;  1FBQ A;  4Q48 A;  2G9W A;  5E1X A;  1BI1 A;  4ENK A;  1HBX G;  3KP6 A;  4RB1 A;  1G3T A;  2P7V B;  2GZW A;  5AIQ A;  4ZH4 F;  5D6F A;  1VTN C;  1RNL A;  2BV6 A;  2HTS A;  1R36 A;  2LKP A;  1YFH A;  2K7L A;  1LQ1 A;  2MBF A;  4WWC A;  1ULY A;  1W7P D;  4UNO A;  5ILV A;  2PLY A;  3ZN0 A;  2HKX A;  2NS0 A;  1MZB A;  3LQR A;  5FFX A;  3SXY A;  4UVB A;  3N97 A;  2R7D A;  2CGP A;  3C3W A;  4GO1 A;  3GF2 A;  1JXS A;  2OZU A;  1PUE E;  3RKY A;  5CVU A;  4LFU A;  1SMT A;  1WRJ A;  2L4M A;  2VE8 A;  2CQK A;  2CG4 A;  4MTE A;  4S04 A;  1U8R A;  2JTV A;  1B6A A;  2XAS A;  4A0Y A;  3EDP A;  1KYZ A;  4EGZ A;  1EH6 A;  1DDN A;  3RI4 A;  4BH9 A;  4XSZ F;  1DPR A;  3KP2 A;  4IHS A;  1U5T C;  2RKH A;  2MLK A;  1ON1 A;  2HQR A;  3TO9 A;  2VBW A;  2OZ6 A;  2F5F A;  1H0M A;  1I27 A;  1E2X A;  2D45 A;  3F8F A;  4KNY A;  3ABT A;  1AOY A;  4N0B A;  2K4B A;  1LJ9 A;  2ZNY A;  5K1Y A;  3OOP A;  4G94 A;  3KE2 A;  3CJN A;  5D8K B;  3ELK A;  1YS6 A;  5F64 A;  4L18 B;  1WKM A;  1IXR C;  1G6N A;  3WG9 A;  4KMU X;  1FP1 D;  2IPQ X;  1ZAO A;  4IPA A;  5DV5 A;  4G8X A;  3FM5 A;  2DAO A;  4M9X A;  3O2P E;  3IWF A;  1W5S A;  1XN7 A;  2LF7 A;  1YTY A;  4IF4 A;  3CUQ B;  5L3F A;  3RYR A;  3ECO A;  1SD6 A;  5A2Q Z;  4OIQ F;  4AIK A;  4NQW A;  2P6T A;  3VEP A;  3EUH A;  3KLN A;  1FNN A;  5L3G A;  2J5P A;  4EMS A;  3V8K A;  1T0F A;  3I71 A;  4YFN F;  2E1N A;  2QZ8 A;  3CUO A;  1FOK A;  4AWX B;  3KFW X;  2JZY A;  1FZP B;  2VN2 A;  1XGS A;  2A6E F;  1R22 A;  5LRR A;  3FX3 A;  4TV7 A;  1YW9 A;  4KIB A;  3ABU A;  3E3V A;  2Y75 A;  1BI2 A;  2FOK A;  1MD0 A;  5DYM A;  2VOP A;  1IN7 A;  1I1S A;  4ASN A;  2NYX A;  3TDU C;  4KIC A;  4HDV A;  1W7P A;  4LK1 F;  3LFK A;  2QBY B;  4HF0 A;  4PGH A;  2D2W A;  1L3L A;  5H6Q A;  1K78 A;  2Z33 A;  1XCB A;  3GZ5 A;  5JVT A;  1G3Y A;  3ZMV A;  1I5Z A;  3KZZ A;  3I59 B;  3R60 A;  3GX4 X;  2PMH A;  2H09 A;  2Q8K A;  3NEU A;  1S7A A;  5L3B A;  4ENJ A;  3I5U A;  4RB3 C;  1ZHF A;  5E8G A;  3K2Z A;  2BBY A;  1J7K A;  4A5N A;  1MDM B;  2PQ8 A;  3KEO A;  2PJP A;  2TDX A;  4IRI A;  4G7O F;  3WTV C;  4MNU A;  1R5G A;  1QPM A;  3WGI A;  3RJP A;  1FPQ A;  1U2W A;  1A04 A;  2E1C A;  4L0Y B;  3LST A;  2Y48 A;  4YII A;  3PQJ A;  3KP7 A;  4OMY A;  4QLC U;  4RB0 A;  5E17 F;  3RKW A;  4P9F A;  2YU3 A;  4NB5 A;  5FD6 A;  2V1X A;  2QM3 A;  1CGP A;  2UXX A;  2XGX A;  1XGM A;  1O3R A;  3TOA A;  4B09 A;  3VOD A;  5ICF A;  3E5Q A;  4KN7 X;  2O03 A;  1LEA A;  2ESN A;  4Z2Y A;  5CJ9 A;  2VC0 A;  2MD5 A;  2UZK A;  1OYY A;  3K1P A;  4HW0 A;  3N4M A;  2KIM A;  1WQ2 A;  4M71 A;  4M9S A;  1AWC A;  1R1T A;  1CF7 B;  2Z3Y A;  1GXQ A;  4BQA A;  3VB2 A;  2EFQ A;  3T0Y A;  1OKR A;  5HDG A;  2IA0 A;  4IVN A;  1EH8 A;  1BC8 C;  3ZQ7 A;  4MTD A;  4ETS A;  1F4K A;  2ELH A;  2XAG A;  2F5D A;  2MH9 A;  1FY7 A;  3GYH X;  3E6D A;  3D5L A;  2ETH A;  1JHF A;  4AD9 A;  1FSH A;  4OIP F;  1O3T A;  4JBA A;  2HQN A;  1BBY A;  1XGO A;  2HGC A;  5LEK A;  2WTE A;  5BPD A;  1T38 A;  1BOA A;  3GUD A;  2GXG A;  2QQA A;  1UHM A;  3RYP A;  1XSV A;  2DQL A;  1ZG3 A;  3L7W A;  1U5T B;  5DDG A;  1G3S A;  2RDP A;  1BN5 A;  2STW A;  4BYY A;  2LF8 A;  2DO7 A;  1HST A;  2XAF A;  2STT A;  4IJA A;  3WTY C;  4CZZ A;  4KFC A;  2W57 A;  6PAX A;  1R58 A;  4RGR A;  3ECH A;  1T2K A;  3R61 A;  3COA C;  1D8J A;  4UV8 A;  3WTZ A;  3GEZ A;  1XSX A;  4ZZL A;  4ESB A;  1S6L A;  4A12 A;  1QNT A;  1V4R A;  5LBQ A;  5J6X A;  5H20 A;  1DP7 P;  3JW4 A;  4KYW A;  5BMZ A;  2XAH A;  2GA1 A;  4I01 A;  1YS7 A;  4EM2 A;  2DT5 A;  1ODD A;  3F6O A;  5CVI A;  1D8K A;  3M7G A;  2GAU A;  5K5Q A;  3R0J A;  3LAP A;  4ENM A;  3TO7 A;  3CUQ C;  2IP2 A;  1PP7 U;  1RUN A;  4Q47 A;  2HEO A;  3M9A A;  5HS8 A;  2YX7 A;  3HTS B;  2XKP A;  4U0V A;  5TRD A;  3F8M A;  4U0Y A;  2ZKZ A;  3DPT A;  1FWZ A;  4G7H F;  2F5E A;  2RVC A;  5LGU A;  3JSO A;  3BWG A;  3IRQ A;  2KIF A;  2LSO A;  2XAQ A;  1OMI A;  3EQL F;  1J75 A;  1DUX C;  2RC4 A;  2DLL A;  1TW3 A;  2YPR A;  3TOB A;  4HA8 A;  3JAM K;  4Y15 A;  1O7F A;  3MQ0 A;  4A6D A;  1W7P B;  4YFX F;  3JAM Z;  4G6D A;  4UHT A;  2QVO A;  2FNP A;  3J81 K;  2IRF G;  1FBU A;  4WK8 F;  3P7N A;  2QWW A;  3DQV C;  1NHA A;  2XVC A;  5BQT A;  2ZXJ A;  1HKS A;  4E70 A;  3HOS A;  3K9T A;  4U88 A;  1ONV A;  1J9I A;  2Y0M A;  2KJB A;  1Z05 A;  4OOI A;  5ED4 A;  1QO0 D;  2HYG D;  1IN6 A;  4UXN A;  3F8B A;  3KP5 A;  1HW5 A;  4ESJ A;  3ISP A;  2OBP A;  4CGZ A;  3HRU A;  1YO5 C;  2OA4 A;  5E1W A;  2L01 A;  5LHI A;  4HX7 A;  4Q4Z F;  2O3F A;  1P4X A;  5D4S A;  2WV0 A;  2V6C A;  3I53 A;  4CYD A;  4KMF A;  3LQQ A;  2DI3 A;  1IN5 A;  3LWF A;  3V8J A;  1K79 A;  3SQN A;  4HAM A;  2WWY A;  1F9N A;  2M87 A;  3E6B A;  4WXC A;  1TLH B;  2GXB A;  1RUO A;  5LGN A;  3J80 Z;  1UCR A;  3BJO A;  3J80 K;  4EV0 A;  2EWN A;  5D4R A;  5JI6 A;  3J7A O;  2P7C B;  4M6X A;  3F3X A;  4N9H A;  1G4D A;  1KQ8 A;  1ON2 A;  1KA8 A;  4BNC A;  4KIG A;  1OR7 A;  4EM0 B;  3CLO A;  1BC7 C;  1IF1 A;  2C6Y A;  3ROU A;  3L09 A;  5AON A;  2X4H A;  1IRF A;  5HDK A;  1UB9 A;  4BAY A;  5HS9 A;  2M1B A;  2A68 F;  1F1Z A;  4LGW A;  3MFK A;  3WU1 B;  5BPI A;  1B59 A;  4CO8 A;  4O5V A;  3JTH A;  2DW4 A;  1FYL A;  3R6S A;  3V7S A;  2ISY A;  3VOE A;  2JPC A;  3QAH A;  1R7J A;  5L3D A;  2VBX A;  4ZYD A;  4LG0 A;  3M8F A;  3SZT A;  1BIB A;  1D3Y A;  2QQ9 A;  3QP6 A;  2MA3 A;  1BI3 A;  1LNW A;  2H6C A;  2XRO A;  3K0L A;  3FXR A;  1S7O A;  5EEG A;  5FO5 A;  3NQO A;  3QU3 A;  4HOB A;  4IHT A;  1IUY A;  2CW0 F;  2M45 A;  5D5X B;  3MCZ A;  3T8T A;  2NRA C;  1LVA A;  4HF2 A;  5L3E A;  1U3E M;  3C18 A;  3QPH A;  1ZG5 A;  4UVC A;  5J8C A;  2FXA A;  2XKO A;  2ESH A;  3CUQ A;  1ZH5 A;  4LLL A;  3P9K A;  5JR3 A;  3DXJ F;  4XSX F;  1S8N A;  5BOX A;  2CO5 A;  3I64 A;  3H3U A;  4I0A A;  3J81 Z;  1FLI A;  3M8E A;  5LLQ A;  3OV8 A;  4M9Z A;  1K78 B;  1KGS A;  1IRG A;  1SFU A;  2VON A;  3O3K A;  2W85 A;  3CTA A;  4FT8 A;  1UFM A;  2OQG A;  4WXH A;  1HXD A;  3NRV A;  3R4K A;  3REO A;  5D5U B;  1KU7 A;  2HFH A;  3WU0 A;  1HW1 A;  1Z7U A;  1HKT A;  4WX9 A;  1ZGJ A;  2VT2 A;  3O6B B;  2L4A A;  2O8X A;  1YYV A;  4CXF A;  4ESF A;  1U5T A;  2W25 A;  4R8H A;  2H94 A;  5FD5 A;  4P5O A;  1MGT A;  1HKQ A;  1J0R A;  3TDZ C;  1Z91 A;  2ZFW A;  2B0L A;  5CVJ A;  5HS7 A;  2QQB A;  4DQ2 A;  2OU2 A;  4EJV A;  2FBK A;  1R1V A;  3DF8 A;  4M6Y A;  3C1D A;  2EV6 A;  2EJR A;  1D5V A;  1P4A A;  2LDU A;  1LDK B;  2VOD A;  1J2X A;  3EET A;  2HYF A;  2K02 A;  2FML A;  4I09 A;  5CVV A;  4ZYH A;  2ZO4 A;  3I54 A;  5JHU A;  2K27 A;  2IW5 A;  2PI0 A;  4P9U A;  1TQM A;  1KQ0 A;  3EYI A;  1Z6T A;  1SFE A;  3MEX A;  1WWX A;  1MJB A;  1Z6R A;  5ICC A;  1I6X A;  4EGY A;  3ULQ B;  3LA7 A;  1IXS B;  4JQF A;  1ZN2 A;  3ZN1 A;  2DFI A;  2PFB A;  4KIF A;  3WTW C;  2QUF A;  3BPX A;  2PBI A;  3WOD F;  1BI0 A;  2OD5 A;  4PDK A;  1R00 A;  1RI7 A;  5DEQ A;  4I7H A;  1OYW A;  4LLN A;  5D8L B;  3BZ6 A;  4RAY A;  3I59 A;  3KEQ A;  3Q9S A;  3CO7 C;  4U0W A;  1FSE A;  4EVI A;  1P2F A;  2D1V A;  5LHH A;  3QU6 A;  3FF5 A;  1EH7 A;  2CSO A;  2XHK A;  2RQP A;  1U78 A;  3TQN A;  1TBX A;  2FSW A;  2Z99 A;  1S3J A;  5ICG A;  3P9C A;  4O3M A;  4U7B A;  3E97 A;  3GFL A;  2CYY A;  1LDJ A;  2IJL A;  2EFP A;  2L02 A;  4D0P A;  5CLS A;  2WC2 A;  1DPU A;  4I0B A;  1JGS A;  3HRS A;  4RGS A;  3P9I A;  4LB6 B;  5D5V B;  2XRN A;  1U6G A;  4ON0 A;  3DFG A;  1ZAR A;  1TTY A;  3FMQ A;  2FMY A;  1R1U A;  2FRH A;  3WGH A;  2DU9 A;  1Q1H A;  4BHP A;  2FQ3 A;  2EFW A;  5EEH A;  1B4A A;  3GXO A;  3MAJ A;  1QQI A;  1F5T A;  3FMR A;  3BP8 A;  3HYI A;  4XLP F;  1JE8 A;  2RGV A;  3MZH A;  2DPD A;  3HSE A;  4IXA A;  3EYY A;  3V8L A;  2LNB A;  4WXD A;  4A0X A;  1PP8 F;  2Z9O A;  2ZME B;  3KP4 A;  3V7R A;  4HX8 A;  3L00 A;  5KK1 A;  2CFX A;  4L5I A;  5ILU A;  2VC1 A;  1TW2 A;  4RGX A;  3TO6 A;  5FGM A;  3ML6 A;  1K7A A;  1ZGA A;  4G9Y A;  3JTG A;  1P6R A;  3T5X A;  3I4P A;  4CIC A;  1Y0U A;  5D5W B;  2J5O A;  4A0Z A;  2E7X A;  4R79 A;  2A69 F;  1T98 A;  4MEY F;  4A5M A;  1ZRC A; 
#chains in the Genus database with same CATH topology
 2FA5 A;  1IAW A;  2F5V A;  1H89 C;  5DCM B;  5HOD A;  4BXF A;  2E34 A;  2UXN A;  2DPU A;  3QOP A;  1IG7 A;  4I2O A;  2JQ7 A;  5IT3 A;  3ZQQ A;  3MZ8 A;  3HOT A;  5ILS A;  3Q5F A;  4B3A A;  1BJA A;  1SVL A;  2HOE A;  4IEJ A;  3ZMD A;  4V2F A;  4BXU A;  2R3S A;  2A05 A;  2H1L A;  3M1C A;  4I99 C;  3WG7 H;  2Y0S N;  3BOQ A;  4V19 K;  4DYQ A;  1LFB A;  2AXL A;  1REP C;  2KKO A;  4XQF A;  3K4L A;  3GWZ A;  2OTL I;  3BCB A;  3WE3 A;  5J8F A;  2E2J J;  3OL3 A;  2JK3 A;  1WJB A;  3B73 A;  1VQN I;  1EV7 A;  4LIT A;  3BG6 A;  2ZME A;  1P7I A;  1KZH A;  1JTX A;  1ZYR F;  2EFO A;  4NBQ A;  1G59 A;  1KU9 A;  2EIN H;  2FD5 A;  5TJJ A;  3DP7 A;  3QPT A;  4BBS J;  1SD5 A;  1UHW A;  4XRM A;  3GTP J;  2FE3 A;  5IT9 K;  1BOB A;  3H0D A;  2VBZ A;  5FJ8 J;  4FIS A;  3E5X A;  3SDG A;  3GZ6 A;  2GM4 A;  3A01 B;  1FOW A;  1W4M A;  3WGG A;  2ISZ A;  3WTX C;  3ZQH A;  2CV2 A;  3GFM A;  2LRD A;  5KAI C;  2L9V A;  5K7F A;  2DMP A;  2X6Y A;  5E20 A;  1LE8 B;  3FBN B;  2VE9 A;  2L7M P;  1MBG A;  3KCC A;  1MJA A;  1XD7 A;  4AIH A;  3GLX A;  1R4M B;  3SZP A;  2Z2S B;  4GCV A;  4IHX A;  4MEX F;  3M3Y J;  4BU2 A;  3L9F A;  3L2U A;  2P5L C;  1O3Q A;  1QZE A;  2ZCW A;  4P96 A;  4BHC A;  3BDD A;  1R49 A;  4CCO A;  2HDC A;  5IOY A;  2KZG A;  5BNG A;  5E3M A;  5D6E A;  3DKY A;  2O0Y A;  2JJ7 A;  2ZJP F;  2H6B A;  1AKH B;  4MGR A;  3RCO A;  2F4O B;  4CCJ A;  5FB2 A;  1DU6 A;  2V7F A;  3HUG A;  1LB2 A;  3BG5 A;  3DCF A;  2COB A;  1V55 H;  1E17 A;  4HV6 A;  3UR3 C;  3H92 A;  1NG6 A;  2XPW A;  4PGG A;  3ZMT A;  3DPU A;  5E8I A;  3U1K A;  4A3B J;  2BW3 B;  3DBH B;  1JGG A;  1H9G A;  1X2M A;  2CUJ A;  1RKT A;  4B43 A;  1QZZ A;  4UV9 A;  4II2 A;  4K2E A;  2KDZ A;  1V3F A;  3W2A A;  1IV6 A;  3E5U A;  2EK5 A;  1KU3 A;  2A5Y B;  1ETO A;  3FBI B;  3H3Z A;  3VSL A;  2YR2 A;  1L0O C;  2FNA A;  4JOM A;  3CCY A;  3FWE A;  3WE2 A;  5GAG J;  4PJM A;  1OPC A;  3D0S A;  5JFR A;  4QPO A;  2V9V A;  4HX4 A;  1MMG A;  3SEQ A;  2D1H A;  1MNE A;  5FLX K;  2E7W A;  2R7O A;  4HDU A;  2ZXH A;  5HOO A;  4OIO F;  2V79 A;  1JKP C;  1KQ9 A;  3AG1 H;  3F8C A;  5FLX Z;  4PSW A;  5KVR A;  2HTJ A;  3OS2 A;  4NC6 A;  1OYI A;  2L9N A;  4RMN A;  5M3M J;  2VIX A;  4CYC B;  4DNC A;  2O61 A;  3OR2 C;  2P5K A;  2QQ8 A;  3F8N A;  4XLN F;  4FX0 A;  1VQK I;  3DPL C;  2Q2E B;  3IHU A;  5GP9 A;  5B3S H;  4MQV A;  2LP0 A;  5HVQ C;  1ZG1 A;  1Z7L A;  2BZT A;  1VQO I;  3HRT A;  1SVO A;  2NAZ A;  2V4J C;  1R71 A;  3MD2 A;  3RSN A;  4LD5 A;  3ERE D;  4A93 J;  2Z5U A;  1X4O A;  3G3Z A;  4PCQ A;  3VYR B;  2NS8 A;  2O7O A;  1IN4 A;  2ACJ A;  1LDD A;  5CQG A;  1T6S A;  1Y1V J;  4RGU A;  1YX3 A;  1P4W A;  3AAF A;  2M5W A;  1IZ1 A;  1X3U A;  2W00 A;  2X51 A;  3HHH A;  3BR0 A;  1SAN A;  1TQI A;  1MIJ A;  2MLG A;  5FKN A;  5F1R A;  4OMZ A;  4CCM A;  1B8I A;  2KJC A;  2YS9 A;  3IP4 B;  3W6K B;  4CHU A;  1OCP A;  3K4K A;  3PQK A;  3W2W A;  3CCQ I;  4MQ9 F;  4GFB A;  1FC3 A;  3ZP5 A;  2LD5 A;  2RNJ A;  4CCL A;  4HV5 A;  4IHV A;  1TZL A;  3LA2 A;  2K86 A;  2ADU A;  2ZXI A;  1SD7 A;  2ID3 A;  2HU9 A;  1Z1D A;  2XUB A;  2EZI A;  1RPW A;  4QWQ A;  3GCM A;  5CYV A;  2KRH A;  3CCE I;  1VQL I;  3CMA I;  3AL0 C;  3V7C A;  4BAC A;  1QRY A;  4HPQ A;  4L9T A;  2Y2Z A;  1GHC A;  2LR8 A;  3FXU A;  3OYI A;  1WHU A;  2DBB A;  2Q0O A;  4HBL A;  4B8X A;  3GW2 A;  4F55 A;  1SMY F;  4WF2 A;  4HST A;  1YW8 A;  3LFU A;  2A3S A;  4YIF A;  1YQA A;  4OIN F;  3RDI A;  3F21 A;  1Y8R B;  2XAU A;  2IA1 A;  3T1B A;  4MIM A;  2JMW A;  3Q9V A;  5LHG A;  1XPX A;  4A5M A;  3QRF F;  5GAH J;  2CWE A;  4Q5S F;  4OIR F;  3ZQI A;  2FU4 A;  3K1N A;  2ZJ2 A;  3IRR A;  2IT0 A;  3FHZ A;  3JR9 A;  2A61 A;  3FKI J;  2IVM A;  2HOS A;  3OYK A;  5HDN A;  3BY6 A;  4IO9 F;  4XKV A;  4BL0 B;  5IT9 Z;  3GTO J;  2N8G A;  5DD4 A;  1MNM C;  2K9L A;  3CP2 A;  3ZMU A;  1WI9 A;  2DMU A;  2COM A;  2HVR A;  3FM3 A;  2WAQ N;  2DQR A;  5DCM A;  1Z3X A;  3ZQF A;  2V1D A;  4I98 B;  5HLI A;  4Z6Y A;  3HPH A;  3CDH A;  4C2T A;  2M0C A;  2NOG A;  3RIR A;  2OQR A;  1ZLJ A;  1B9M A;  5EEA A;  2VXZ A;  3M1E A;  4L9V A;  2FBH A;  1BW5 A;  4IRG A;  1HDD C;  2CQN A;  1XSD A;  1YLF A;  3DEU A;  4IRH A;  2PN6 A;  1P7J A;  2BVL A;  2KT0 A;  1ZR2 A;  4MO7 A;  2V9P A;  1D1A A;  2KRF A;  2VPR A;  1WVR A;  3U9G A;  4A69 C;  3C2G A;  1VQ7 I;  1WSU A;  1SFX A;  2HPM A;  3I58 A;  2MH2 A;  4BHB A;  1YJN I;  1XX5 A;  2BEO A;  4U7D A;  1USS A;  2KIU A;  2EB7 A;  3N05 A;  3IKT A;  1MH3 A;  4LB5 A;  4QIW N;  4O6J A;  2PG4 A;  4EJU A;  2NS7 A;  4X1E A;  2D5V A;  4YG2 F;  3SJM A;  2X6O A;  3HTU A;  3NAR A;  5DUI A;  4L5J A;  4HQM A;  4HYE A;  2FF4 A;  1N77 A;  5GTH C;  1CF7 A;  2V1U A;  4KT5 C;  2W84 A;  2JA2 A;  4GXO A;  2ZBK A;  5EGO A;  2BXY A;  1WJD A;  5F0C A;  1G3W A;  4Y13 A;  2BGC A;  2QYO A;  1VQP I;  1MKM A;  1U9N A;  3BRO A;  2CUZ A;  5DUK A;  1T39 A;  2DA2 A;  1SAU A;  3KIO A;  2PMU A;  2QLZ A;  2HKO A;  3I56 I;  3L1P A;  2EV5 A;  3TKY A;  4N9I A;  3GZN B;  4CDG A;  5IP9 J;  3AFH A;  2E35 A;  5BS6 A;  4LK0 F;  3E1S A;  3NAU A;  4L0Z B;  1P92 A;  3BR1 A;  2HZT A;  2EFN A;  2HQA A;  4UUV A;  4S05 A;  1IN8 A;  2JN6 A;  3DTI A;  4R1H A;  3SFZ A;  5KHD A;  2JRT A;  1PJR A;  3F6V A;  3GLL A;  4P55 A;  2A07 F;  3JSP A;  1YHQ I;  2R7F A;  4E7Z A;  3ZMS A;  2HI3 A;  2IGO A;  1B1B A;  4LJZ F;  2G7U A;  5ICE A;  5M3F J;  4XRS G;  3DV8 A;  4DBR A;  1IRX A;  2BY3 A;  4XIC A;  4RS8 A;  5K5O A;  4AVP A;  1I1G A;  4H0E A;  3LA3 A;  2XF7 A;  3H5N A;  1FYM A;  5M5W J;  3HOW J;  4UUS B;  3S15 J;  1W5T A;  1UZC A;  1I3Q J;  1XDU A;  3CF5 F;  1WJA A;  4XKW A;  1XDS A;  4GGG A;  3OYC A;  1JTY A;  5LGT A;  4ZTJ A;  2WB1 A;  3K1M A;  1RR8 C;  4XRS A;  5LRS A;  2IS4 A;  3TW7 A;  4AIJ A;  5C3E J;  2DMN A;  1ZRD A;  3BQY A;  3S16 J;  2GIV A;  3MWM A;  1HA8 A;  3QYB A;  1SC7 A;  3ZMZ A;  1ZLK A;  2BW3 A;  2EA4 A;  3KZY A;  2NVY J;  1FIA A;  4OU0 A;  3HHG A;  2ZXW H;  4GYG A;  2K9N A;  1MBH A;  2KHM A;  1TNT A;  2Y0S A;  1S29 A;  2DK8 A;  4C30 A;  1FTT A;  1YIO A;  2F2E A;  2WB1 N;  1DU0 A;  4FHT A;  1XMK A;  1MMS A;  5L3C A;  2A6T A;  1LPQ A;  2L54 A;  1RZ4 A;  3KPH A;  2P5V A;  2FBI A;  5FKM A;  2VJ5 A;  3GFI A;  3KLO A;  3I3L A;  3WTS C;  4M74 A;  3V4G A;  3BJ6 A;  3KET A;  1GXP A;  2MYS A;  3BG9 A;  4PFO A;  3F23 A;  4G7Z F;  1SD4 A;  1K6O A;  2R7R A;  3VDX A;  3G73 A;  5HNF A;  2LTP A;  2M34 A;  3CF2 A;  3LSI A;  3IL2 A;  3ZPL A;  4PK4 A;  3RPQ A;  3FIS A;  1IXC A;  1YW7 A;  2RNG A;  3I0T A;  1O3S A;  4ITV A;  2XPU A;  2QBY A;  4EJT A;  4AU7 A;  5DD8 A;  1FBS A;  2O9L A;  4RBO A;  5FRN A;  1ZEL A;  5HLG A;  5K5R A;  5FKL A;  4LG0 B;  3BTJ A;  3K2A A;  5E79 C;  2XAJ A;  1O7L A;  1MDM A;  1K4S A;  2KZV A;  2AO9 A;  3HB9 A;  3T8R A;  4S0H B;  3RKQ A;  2O8K A;  3EPZ A;  1W1W E;  2DA3 A;  4F7Z A;  4A2U A;  3QPS A;  2W1O A;  2HDD A;  2JPB A;  1YG2 A;  1NK2 P;  3I4M J;  5E3O A;  3IH3 A;  1TWC J;  5LFA A;  5A2Q K;  2XV4 S;  2GWR A;  2CU7 A;  2R5Z A;  3LAJ A;  5EZH A;  4KDP A;  1OCC H;  4XID A;  1R23 A;  2EV0 A;  1XCV A;  3CJT B;  2XGE A;  4HLX A;  5EJC A;  3L2Q A;  3F22 A;  1FYK A;  2CUE A;  1IUF A;  2AXT C;  4JK1 X;  3DKW A;  4KUM A;  4Y4R A;  4BJ6 C;  3H1C A;  3MZY A;  2VOO A;  2E5Z A;  1K61 A;  3ASN H;  3RPU A;  3K4N A;  2VT3 A;  3U1D A;  4L9J A;  4F91 B;  2IA2 A;  3A0H C;  3FXQ A;  4G6Q A;  5JHF A;  4E7J A;  1HQC A;  2ID6 A;  4BE0 A;  2FOW A;  2LY9 A;  5J4V A;  2E5N A;  1KYW A;  2PMZ N;  3JRG A;  2Q2E A;  3HC7 A;  1LEB A;  3CC4 I;  4L5E A;  1QVT A;  3BT9 A;  4HQE A;  3K6G A;  3W6J B;  1R5H A;  1JJ6 C;  2DTR A;  2HWV A;  1C0W A;  1UJ8 A;  1G8X A;  4ZYG A;  4FCY A;  3U2R A;  1HW2 A;  3CMY A;  1STZ A;  3KYC B;  4HSR A;  1FP2 A;  1XC5 A;  1IW7 F;  3JRA A;  2DK5 A;  4Y3O A;  3PFI A;  4EM1 A;  2B7E A;  2QSG X;  1Y39 A;  1J5Y A;  1K83 J;  3BPV A;  3C7J A;  2E71 A;  3IWZ A;  3DTE A;  4XON A;  2BHY A;  2HS5 A;  3R0A A;  2O6G E;  2OCE A;  2KMU A;  2MGQ A;  3SHF A;  2X9D A;  3LSP A;  2BE5 F;  2PEX A;  1X4P A;  2AS5 F;  3AKZ A;  2XF5 A;  4B1R A;  1QGP A;  3AG2 H;  2BXZ A;  1TQP A;  2RV8 A;  3K4J A;  4LLG F;  1QVU A;  2UUZ A;  2B63 J;  2HVS A;  2F6C A;  3CLQ A;  3LSR A;  3LSH A;  2LKX A;  1XMA A;  3L2C A;  1OCT C;  1XB4 A;  3HIF A;  2K9M A;  5IYB J;  3IC7 A;  1DP3 A;  1FT9 A;  1ETV A;  1WJF A;  2GA2 A;  1GUU A;  2Y9Y A;  1OIS A;  4UB6 C;  3A01 A;  4XBF A;  4BQN A;  2DN0 A;  5LEJ A;  2ZNZ A;  2G7H A;  4ZZD A;  1E3H A;  4Y7N J;  2F4I A;  1LKX A;  2DFH A;  4IHW A;  2WAE A;  5HLH A;  1B8I B;  2CQ7 A;  4CA0 A;  4CSW A;  4L9N A;  5DCF A;  5JLX A;  4EJW A;  2JA5 J;  2RN7 A;  1W5C C;  2M8E A;  2NNN A;  1JKO C;  2G0E A;  3KP3 A;  2P6S A;  2A6H F;  3LSM A;  5AIP A;  2VQG A;  4YEL A;  1Z9C A;  5F04 A;  1R6R A;  3FZV A;  4AC0 A;  4M73 A;  4ZYE A;  2B9S A;  4M72 A;  1OQY A;  2MG4 A;  2Y30 A;  1KU2 A;  5ERI A;  1SAX A;  4HLY A;  3HRM A;  2HR3 A;  3W6V A;  1MND A;  2P8T A;  1QBJ A;  2Z1D A;  3BTI A;  1GV2 A;  1JHH A;  1Q1V A;  4HEA 2;  4EJO A;  2X1C A;  2EIK H;  2WY8 Q;  2L9R A;  3CCL I;  3K4C A;  4LMY A;  2X0L A;  1X2N A;  4ENN A;  2CFO A;  3K69 A;  1JKQ C;  2K4J A;  3E6M A;  4UVA A;  3S2W A;  3GVA A;  3SEZ A;  3BC8 A;  4RB2 C;  4MFE A;  3LSG A;  2F5C A;  2LY1 A;  3PM1 A;  2VUM J;  1XGN A;  3LMM A;  2X85 A;  2JWT A;  3IKV A;  4PZJ A;  4BUP A;  4E7L A;  3K10 A;  3WTT C;  2M3A A;  2H27 A;  2EA2 A;  3DWL E;  5FKK A;  1QZY A;  1BR1 A;  1ITY A;  5J3L A;  2NNY A;  3B02 A;  3GO5 A;  2XIG A;  5CVR A;  3G1L A;  4FX4 A;  2R5Y A;  2W24 A;  2VAS A;  1MJ9 A;  3ABM H;  3VFZ A;  4HNT A;  4GYI A;  4WCG A;  3FHN A;  3CDL A;  2DTZ A;  2GBY A;  3HOV J;  4NHJ A;  3IH4 A;  3GFJ A;  2YX4 A;  3RKX A;  5E1Z B;  3G71 I;  4HNV A;  3S3N A;  1X3W B;  2L0K A;  2L3D A;  4YFK F;  1T8I A;  1FMV A;  2CS3 A;  4I02 A;  5H6R A;  3TED A;  4RAZ A;  4BBR J;  1UST A;  1BM9 A;  4IL6 C;  1O57 A;  3HSR A;  3QP5 A;  4HF1 A;  3MN2 A;  3HSF A;  4XRF A;  3SFI A;  3S1Q J;  2R7X A;  2M4K A;  2BYV E;  4EQQ A;  3TBI A;  1H9T A;  4A6E A;  1J59 A;  1T33 A;  1GVJ A;  5F6F A;  3F72 A;  3BJA A;  3VYU B;  5E18 F;  2X48 A;  1SFK A;  1RIO H;  3KZI C;  5IYD J;  5FFZ A;  3OMY A;  2FQ4 A;  2JT1 A;  4KA4 A;  2OAZ A;  1FX7 A;  3M8J A;  3RTR A;  1PDN C;  2LOO A;  1VQ5 I;  4F92 B;  4KN4 X;  3H3V K;  2VBY A;  2E36 A;  1B9N A;  3WTU C;  2CV0 A;  1N75 A;  2K9S A;  3E6C C;  3VWB A;  3LNQ A;  2UWM A;  3Q0W A;  2JVG A;  1T08 B;  1TNS A;  2GQQ A;  4JX5 A;  3L2R A;  4XKB A;  1ZRE A;  2FEZ A;  4NC7 A;  5EGO B;  3OYD A;  3FXJ A;  2M30 A;  4UY8 I;  4Y17 A;  1ZR4 A;  2P4W A;  2F48 A;  2QEN A;  5C44 J;  3BLY A;  3TGN A;  4HZF A;  1ZRF A;  4XNF A;  4NQW B;  1HSJ A;  3CD6 I;  3CJQ B;  1BIA A;  3FMS A;  4HNU A;  4MHG A;  3MMY B;  1MMA A;  3PIP F;  4QTR A;  1FTZ A;  1SVM A;  5K7H A;  2JSC A;  3BR2 A;  2YSR A;  4XK4 A;  1AA7 A;  2WV1 A;  1G2H A;  3CO6 C;  2MC3 A;  2R7W A;  3FDY A;  1FBQ A;  4Q48 A;  2G9W A;  5E1X A;  3EUH C;  4DYR A;  1BI1 A;  1ETQ A;  3CC2 I;  4ENK A;  1HBX G;  3KP6 A;  2R7T A;  1GVD A;  3SZG A;  2CW8 A;  3BCA A;  3S93 A;  4RB1 A;  1TWH J;  4PFP A;  1G3T A;  2L9S A;  2P7V B;  2GZW A;  4ABZ A;  5AIQ A;  4ZH4 F;  5D6F A;  1VTN C;  1RNL A;  2FUG 2;  2BV6 A;  2BY1 A;  5C4X J;  1ZKG A;  3GME A;  2HTS A;  1R36 A;  2LKP A;  2OUM A;  2PMZ A;  4LIV A;  3TMO A;  1Z3Y A;  5J4Y A;  1YFH A;  1OR7 C;  1V5F A;  2K7L A;  1LQ1 A;  1WZ2 A;  2LH9 A;  2MBF A;  2XGD A;  4WWC A;  1ULY A;  1VFC A;  1W7P D;  1Z77 A;  4UNO A;  5ILV A;  2PLY A;  3ZN0 A;  2DA6 A;  4CCK A;  3HM5 A;  2HKX A;  2VKE A;  2NS0 A;  1MZB A;  3C2H A;  3LQR A;  5FFX A;  3IH2 A;  3PL8 A;  3SXY A;  2ICW G;  5IPA A;  4UVB A;  5J40 A;  3N97 A;  2R7D A;  2CGP A;  3C3W A;  4GO1 A;  1I3A A;  4IQJ A;  3GF2 A;  1JXS A;  4A3K J;  2OZU A;  4G12 A;  1FOY A;  4EEF G;  1PUE E;  4U87 A;  3RKY A;  3ZQG A;  5CVU A;  4LFU A;  3MKW B;  5KNL A;  1SMT A;  1WRJ A;  2L4M A;  2LYC A;  2VE8 A;  1U0J A;  4A3I J;  2CQK A;  2KQR A;  2CG4 A;  1P9Q C;  4MTE A;  4S04 A;  1U8R A;  2JTV A;  1U8B A;  1B6A A;  4D7M A;  2XAS A;  1YI2 I;  3NWT A;  4A0Y A;  2GXA A;  4QPQ A;  3CCM I;  2DYS H;  3EDP A;  3K70 D;  1KYZ A;  1EH6 A;  4EGZ A;  1V5E A;  4PUS A;  2QSF X;  1DDN A;  3OSF A;  4UUT A;  2LFB A;  3O8G A;  3RI4 A;  4BH9 A;  3HDD A;  2DJI A;  4XSZ F;  2ZJQ F;  5FKO A;  4XLC A;  1DPR A;  3KP2 A;  3G2B A;  2QKM B;  4IHS A;  2W4S A;  1MBE A;  1U5T C;  4FAS D;  3GTJ J;  2RKH A;  2MLK A;  1ON1 A;  1WH7 A;  2BY2 A;  2HQR A;  2EPF A;  1VQ4 I;  2XF6 A;  3PNT A;  3TO9 A;  4F3Q A;  2K85 A;  1GLN A;  2VBW A;  4C2M J;  4Y52 J;  2R5Y B;  2OZ6 A;  2F5F A;  5EDN A;  1LE8 A;  3TL4 X;  1H0M A;  1I27 A;  1Y8Q B;  2VB6 A;  1E2X A;  2LRE A;  1V54 H;  1YRN A;  2D45 A;  3F8F A;  4KNY A;  1WPK A;  3ABT A;  1AOY A;  4N0B A;  2K4B A;  4E6K G;  1LJ9 A;  4PJN A;  2ZNY A;  5K1Y A;  2V6E A;  2JSP A;  3OOP A;  4FET A;  4G94 A;  3KE2 A;  3CJN A;  1A6Q A;  3GBG A;  5D8K B;  1E3O C;  3ELK A;  5DTD A;  3TP3 A;  1YS6 A;  1H88 C;  3CDI A;  3H36 A;  5F64 A;  2M4G A;  4L18 B;  1WKM A;  4N4O B;  3CC7 I;  1DGR M;  1S9H A;  4N4N B;  2XC7 A;  1IXR C;  3OWT A;  1G6N A;  3WG9 A;  4C9Y A;  4KIS A;  4KMU X;  2IGM A;  4NNJ A;  5B1A H;  1FP1 D;  2IPQ X;  3S3M A;  4DBQ A;  1ZAO A;  3L2V A;  4IPA A;  2PJR B;  4B47 A;  2VKH A;  1MSF C;  2JVH A;  5DV5 A;  4HRI A;  3CZ6 A;  3M07 A;  4G8X A;  2W48 A;  2R5Z B;  3ZGK A;  3FM5 A;  2DAO A;  4RA2 A;  2QKL B;  2DA7 A;  3DEE A;  4M9X A;  1VND A;  3O2P E;  4NDL A;  1D1B A;  3B6A A;  3P5J A;  3IWF A;  3DTK A;  2E1M B;  1W5S A;  1XN7 A;  3PJR A;  3S2D J;  2LF7 A;  1YTY A;  1X19 A;  4IF4 A;  2XSJ C;  3CUQ B;  5L3F A;  3RZD J;  3LOC A;  4D7N A;  3SDB A;  3RYR A;  3ECO A;  1SD6 A;  4MFD A;  5A2Q Z;  3DLL F;  4OIQ F;  2A5W A;  4AIK A;  1Z67 A;  4NQW A;  2ZSI B;  3K4M A;  1HLV A;  1MW7 A;  5EYR A;  3C2B A;  4FTH A;  4E7I A;  2CUF A;  2P6T A;  4OWR B;  3EUH A;  3VEP A;  3KLN A;  3RQ4 A;  5JLW A;  1FNN A;  3U21 A;  5L3G A;  3DU6 A;  4RAF A;  2DT6 A;  2J5P A;  1RRJ A;  2CMP A;  3A4C A;  3OOU A;  1NH3 A;  3QOD A;  1MMN A;  4EMS A;  3V8K A;  1T0F A;  4BEH B;  4D5F A;  2DXI A;  3I71 A;  4YFN F;  2E1N A;  2QZ8 A;  3CUO A;  1FOK A;  2LBF A;  1F36 A;  2BY0 A;  4AWX B;  2DOE A;  3KFW X;  2JZY A;  1FZP B;  2Y69 H;  4CYC A;  3G4S I;  3EUA A;  2VN2 A;  2Q1Z B;  1M1E B;  1XGS A;  2A6E F;  3FXM A;  1R22 A;  5EG0 B;  5LRR A;  3FX3 A;  4TV7 A;  2Z16 A;  1LFP A;  2HNH A;  3JCU C;  4W97 A;  1YW9 A;  4KIB A;  3ABU A;  3LSK A;  3E3V A;  2CH0 A;  2Y75 A;  1BI2 A;  2YUS A;  2FOK A;  1MD0 A;  5DYM A;  5F08 A;  2VOP A;  1IN7 A;  1I1S A;  2HZD A;  4ASN A;  1WJE A;  2NOJ B;  4W1U A;  2NYX A;  3TDU C;  1TWF J;  3E0J B;  4KIC A;  4HDV A;  3QYF A;  2E1O A;  1W7P A;  3NWS A;  4LK1 F;  3LFK A;  3PIO F;  3HOU J;  2QBY B;  4BEH A;  4HF0 A;  4PGH A;  2D2W A;  3V42 A;  1L3L A;  2KDO A;  5H6Q A;  3IAM 2;  1K78 A;  4D1Q A;  2Z33 A;  3DEW A;  1MBJ A;  1XCB A;  3OIQ A;  3GZ5 A;  2OTJ I;  5JVT A;  3SYT A;  2DFF A;  1G3Y A;  4IZZ A;  1JUM A;  3ZMV A;  1TL8 A;  2KLO A;  1I5Z A;  5EG0 A;  3KZZ A;  3I59 B;  2VQL A;  4BQO A;  1MMD A;  5JVG F;  3R60 A;  1ETK A;  3GX4 X;  5K7Z A;  2PMH A;  4NC8 A;  4RM2 A;  2H09 A;  2Q8K A;  3NEU A;  1S7A A;  4RLF A;  5L3B A;  4ENJ A;  3I5U A;  4RB3 C;  1ZHF A;  5E8G A;  3K2Z A;  2BBY A;  1J7K A;  2VJI A;  4A5N A;  3CCS I;  1MDM B;  2MSY A;  2PQ8 A;  2RAE A;  2WAD A;  3KEO A;  2PJP A;  2TDX A;  2BHZ A;  1T56 A;  4IRI A;  4G7O F;  3WTV C;  4MNU A;  1R5G A;  1QPM A;  3WGI A;  3RJP A;  2WA0 A;  1FPQ A;  3AG3 H;  1U2W A;  1A04 A;  3ZXS A;  2IAI A;  2E1C A;  3L2W A;  2QSH X;  4L0Y B;  2AQE A;  3LST A;  2Y48 A;  4YII A;  2DMQ A;  1K4T A;  3H0G J;  3PQJ A;  2MAB A;  3KP7 A;  1JT0 A;  4OMY A;  4QLC U;  4RB0 A;  2HPI A;  5E17 F;  3RKW A;  5IY5 H;  4IOA F;  2OC6 A;  1FEX A;  4KJZ A;  1POG A;  1VQ6 I;  2LLK A;  4P9F A;  3PFY A;  2YU3 A;  4NB5 A;  5FD6 A;  1AU7 A;  5E3L A;  2ECB A;  2QM3 A;  2V1X A;  1CGP A;  2CV1 A;  2QA4 I;  2UXX A;  3OYE A;  4JX4 A;  2XGX A;  3LL7 A;  1XGM A;  4PJJ A;  1O3R A;  3RZO J;  3TOA A;  3HGG A;  4B09 A;  3JRC A;  2ZME C;  1IJW C;  3VOD A;  2FX0 A;  5ICF A;  2KP6 A;  3HBL A;  2R7U A;  3E5Q A;  1VF9 A;  1ORK A;  2WAQ A;  4CZC A;  4KN7 X;  3QWL A;  4G6T B;  2O03 A;  1LEA A;  2ESN A;  4XOR A;  4Z2Y A;  5CJ9 A;  3GTL J;  2L2O A;  4M3B A;  5J1U A;  4C3J J;  3I55 I;  3OYA A;  2VC0 A;  2GOX B;  2MD5 A;  2UZK A;  3OSG A;  2BVM A;  1OYY A;  3FIW A;  2M7B A;  1Y56 A;  3K1P A;  4HW0 A;  4OAY A;  3OS0 A;  4FQG A;  4PJL A;  3N4M A;  2KIM A;  1RES A;  1WQ2 A;  2DOA A;  4M71 A;  4M9S A;  1AWC A;  1R1T A;  1CF7 B;  2CRG A;  1GXQ A;  2Z3Y A;  4BQA A;  3VB2 A;  4D5C A;  2EFQ A;  1YOV B;  3T0Y A;  2LG4 A;  1OKR A;  4B4C A;  4PJ0 C;  5HDG A;  2IA0 A;  1HC8 A;  2ELK A;  2PX9 A;  4IVN A;  1EH8 A;  1BC8 C;  1R4N B;  2I10 A;  2VI6 A;  2OF7 A;  4XLH A;  3ZQ7 A;  4MTD A;  3WHC A;  2WY7 Q;  4ETS A;  1F4K A;  3WU2 C;  2ELH A;  2XAG A;  2F5D A;  3ERM A;  2MH9 A;  1FY7 A;  3DBL B;  3FXK A;  3GYH X;  1QPI A;  4KIT B;  3ZR8 X;  2K5C A;  1V5G A;  5HLT A;  3E6D A;  4MLO A;  4DJA A;  4ZC3 A;  3D5L A;  2ETH A;  1JHF A;  1X1D A;  2OCC H;  4AD9 A;  1ZQ3 P;  1FSH A;  2M0M A;  4OIP F;  1O3T A;  2IGK A;  3HG9 A;  1CQT A;  1PVE A;  4JBA A;  4ZJZ A;  3ASO H;  4AID A;  2HQN A;  1BBY A;  1XGO A;  2HGC A;  5LEK A;  3HOZ J;  2DYR H;  2WTE A;  3HZJ A;  3OYL A;  1Z0X A;  5BPD A;  1VQ9 I;  2Y31 A;  4C2U A;  2HOT A;  2E19 A;  2EZK A;  2XRL A;  2XDV A;  2LKS A;  2DMT A;  2DCE A;  1T38 A;  1BOA A;  3GUD A;  3HEF A;  4ZDL A;  1S5L C;  3HUG B;  3W3C A;  2L7K A;  4I76 A;  1BJZ A;  2GXG A;  2QQA A;  1UHM A;  3ZRG A;  4M3D A;  1MH4 A;  2ECC A;  4AUX A;  1JUS A;  3RYP A;  1XSV A;  2DQL A;  1ZG3 A;  3L7W A;  1U5T B;  5DDG A;  1G3S A;  1BR2 A;  2RDP A;  3QOE A;  1BN5 A;  3Q3S A;  2STW A;  1ZTR A;  1HF0 A;  4BYY A;  2L5Q A;  2ZFU A;  3A1Y A;  2LF8 A;  3LSJ A;  4A3J J;  1VQM I;  2DO7 A;  1NK3 P;  2DDA A;  1HST A;  2XAF A;  1VQ8 I;  2AQF A;  1EA3 A;  2R92 J;  2STT A;  4IJA A;  3WTY C;  4CZZ A;  3RQI A;  2W57 A;  4KFC A;  6PAX A;  1R58 A;  4RGR A;  4BE1 A;  3ECH A;  1IV8 A;  1T2K A;  3S17 J;  4BGD A;  3R61 A;  3COA C;  1D8J A;  1OJL A;  4UV8 A;  2VKD A;  2TCT A;  3HPG A;  1ACI A;  3WTZ A;  3GEZ A;  3GTM J;  1XSX A;  3FXO A;  4ZZL A;  2UV1 A;  4ESB A;  3KEY A;  2EH3 A;  4QSH A;  1JI8 A;  2FJ1 A;  2NVU B;  1U9O A;  1VZ0 A;  1S6L A;  4A12 A;  3OIO A;  1QNT A;  1EJ9 A;  2ZSH B;  4ANJ A;  3ZQC A;  1Z21 A;  1V4R A;  2LMD A;  3JRE A;  3B6C A;  5LBQ A;  2LVS A;  5IYC J;  5J6X A;  5H20 A;  3OYM A;  1ZGW A;  1DP7 P;  3JW4 A;  4KYW A;  5BMZ A;  2XAH A;  4JP0 A;  2GA1 A;  1X3Z B;  4I01 A;  1YS7 A;  1MBF A;  4EM2 A;  3FK6 A;  2DT5 A;  1ODD A;  2IXS A;  3F6O A;  3S1R J;  3M7G A;  1D8K A;  5CVI A;  1LVK A;  2GAU A;  1S72 I;  5K5Q A;  3MKZ A;  2E1M C;  3R0J A;  3LAP A;  2ME6 A;  1B72 A;  2F4M B;  2XGC A;  4ENM A;  3TO7 A;  3CUQ C;  2IP2 A;  1PP7 U;  4AYB A;  1RUN A;  3F9K A;  4DYC A;  2R0Q C;  2O5R A;  2X6W A;  5LD2 C;  4Q47 A;  2HEO A;  1YJW I;  3HOY J;  3M9A A;  2XPV A;  5HS8 A;  2YX7 A;  1WH5 A;  3HTS B;  2XKP A;  3UKG A;  4U0V A;  5TRD A;  3F8M A;  5J47 A;  4U0Y A;  2ZKZ A;  3DPT A;  1FWZ A;  4G7H F;  3O8H A;  3W2V A;  2F5E A;  3J7A Y;  2EBI A;  2RVC A;  3E7L A;  1XS9 A;  5LGU A;  1GDT A;  3JSO A;  1A35 A;  4XLF A;  1S7E A;  2IS1 A;  4M3G A;  2VQH A;  4KT6 A;  4F52 A;  3I9V 2;  4H4K C;  2V26 A;  3BWG A;  1YE9 A;  1ETW A;  2KPM A;  3IRQ A;  2KIF A;  3K70 C;  1AHD P;  2LSO A;  2XAQ A;  1OMI A;  3EQL F;  3AL0 B;  5KCM A;  3PO2 J;  4ZTF A;  1ETX A;  2DA4 A;  2VXD A;  1J75 A;  3GTQ J;  1HCR A;  4LG3 A;  1I39 A;  2IS2 A;  1NG7 A;  1DUX C;  2RC4 A;  2DLL A;  2QCO A;  4J19 A;  1H8A C;  1A36 A;  2GOM A;  2JA8 J;  1TW3 A;  1X1A A;  2YPR A;  3OY9 A;  1ZK8 A;  3TOB A;  5J1R A;  3Q0V A;  4HA8 A;  1LFU P;  1QU3 A;  4A3G J;  3CCJ I;  4X6A J;  4M3F A;  4Y15 A;  3JAM K;  4RLQ A;  1O7F A;  3MQ0 A;  3H35 A;  4YIR X;  2W82 A;  3VYS B;  4A6D A;  1W7P B;  4BY1 J;  4YFX F;  3JAM Z;  4G6D A;  1K6Y A;  4UHT A;  2QVO A;  2MC4 A;  2FNP A;  3DU5 A;  3J81 K;  3S14 J;  2IRF G;  3MKL A;  5DM6 F;  1FBU A;  4WK8 F;  2M9H A;  4J01 A;  1WGX A;  3P7N A;  4XMY A;  3M4O J;  1IRZ A;  2QWW A;  3JRI A;  3DQV C;  1NHA A;  2XVC A;  5BQT A;  4A3M J;  1HOM A;  3D5S C;  1AKH A;  2ZXJ A;  1HKS A;  3TW6 A;  3ABL H;  3ZQL A;  1TT0 A;  4E70 A;  3HOS A;  3K9T A;  2ZJR F;  3JRD A;  4UB8 C;  4U88 A;  1ONV A;  2K40 A;  4RM3 A;  1E3P A;  1D0Z A;  1B72 B;  1J9I A;  3WHB A;  2Y0M A;  2KJB A;  1Z05 A;  4OOI A;  5ED4 A;  1QO0 D;  2HYG D;  4XKC A;  4BJ5 C;  1KON A;  1IN6 A;  4UXN A;  3F8B A;  1XTA A;  3KP5 A;  1HW5 A;  2K3F A;  1BR4 A;  4ESJ A;  1D5Y A;  2M2E A;  3ISP A;  3OYJ A;  5CQE A;  2OBP A;  2NXN B;  3A2K A;  1IDY A;  4CGZ A;  2WAF A;  2P81 A;  4JYK A;  2ZB9 A;  3G6E I;  3HRU A;  1DQU A;  2KFD A;  1YO5 C;  3G1O A;  2OA4 A;  5E1W A;  3ZCO A;  1WFX A;  2L01 A;  5LHI A;  1Y0N A;  3VPR A;  2X1E A;  4HX7 A;  4Q4Z F;  2O3F A;  2R7S A;  2EIJ H;  1P4X A;  5D4S A;  2WV0 A;  2V6C A;  3I53 A;  4CYD A;  4KMF A;  3LQQ A;  1EKE A;  2DI3 A;  2R7V A;  1IN5 A;  3LWF A;  1UMQ A;  3ONQ A;  3CP8 A;  3V8J A;  2DFE A;  1K79 A;  3SQN A;  1BA5 A;  4HAM A;  2WWY A;  1Y1W J;  3DKX A;  3PSF A;  1F9N A;  1ETY A;  1SFO J;  2M87 A;  2TRT A;  3E6B A;  4WXC A;  1TLH B;  4V2G A;  4IOC F;  2GXB A;  3FKJ A;  1RUO A;  5LGN A;  3DLA A;  3JRF A;  1RKW A;  4XL9 A;  4M3E A;  3CCR I;  1ERD A;  4XOT A;  3CES A;  3J80 Z;  3BR6 A;  1UCR A;  1FJL A;  4CUG A;  3HKZ N;  3BJO A;  2EZL A;  5F27 A;  4E4H A;  5H2F C;  1WJ5 A;  2M8G X;  3J80 K;  2ME0 A;  4EV0 A;  2EWN A;  5D4R A;  5JI6 A;  3J7A O;  2P7C B;  3OYG A;  3MKY B;  4M6X A;  4BS9 A;  2KIQ A;  3F3X A;  1GT0 C;  1D0X A;  5CKT A;  4N9H A;  1HDP A;  2HVQ A;  4LIU A;  1G4D A;  2JUG A;  1KQ8 A;  1ON2 A;  1KA8 A;  2VKV A;  4BNC A;  1QHH D;  4KIG A;  2X6X A;  1OR7 A;  1UG0 A;  4EM0 B;  3CLO A;  1X1P A;  4XN3 A;  1BC7 C;  1IF1 A;  4XM3 A;  4C3I J;  2CQQ A;  2DJN A;  2L7F P;  4A3C J;  2C6Y A;  3ROU A;  3BR3 A;  3L09 A;  5AON A;  2QEX I;  2X4H A;  1TWA J;  1IRF A;  4F93 B;  1FIP A;  5TGT A;  5HDK A;  1BW6 A;  2KRC A;  1UB9 A;  2YU9 J;  3S2H J;  3BZC A;  4DIQ A;  1A5J A;  4XR6 A;  1I50 J;  2LY2 A;  2P0W A;  2DT7 B;  1UAA A;  4BAY A;  2QF7 A;  5HS9 A;  1YIJ I;  2M1B A;  2A68 F;  3PUF A;  1F1Z A;  2H8W A;  2DA5 A;  4LGW A;  3MFK A;  3WU1 B;  5BPI A;  1B59 A;  3FXL A;  4CO8 A;  4O5V A;  3JTH A;  2DW4 A;  4YEJ A;  2Y9Z A;  3QPL A;  1FYL A;  3R6S A;  2CQX A;  1IDZ A;  3V7S A;  2ISY A;  3VOE A;  2JPC A;  5KAF C;  3QAH A;  1R7J A;  1TWG J;  2NVQ J;  4XOP A;  2EZH A;  2IBD A;  2R4G A;  5L3D A;  4BQQ A;  4IX7 A;  3EUK L;  4A3F J;  2PJR A;  2HXI A;  2VBX A;  4ZYD A;  4LG0 A;  3OYH A;  3M8F A;  2JA7 J;  3SZT A;  2LBF B;  1UG2 A;  1BIB A;  1D3Y A;  2QQ9 A;  3OR1 C;  3QP6 A;  2MA3 A;  1BI3 A;  1LNW A;  2H6C A;  2XSD C;  2EQR A;  4A3L J;  2XRO A;  1IGN A;  3K0L A;  1TC3 C;  3FXR A;  1S7O A;  5F0H A;  5EEG A;  4A3E J;  3ZOB A;  5FO5 A;  5B66 C;  3BG7 A;  3NQO A;  3QU3 A;  4HOB A;  4IHT A;  3BTC A;  1IUY A;  2CW0 F;  1D1C A;  2M45 A;  2R7Z J;  5IOZ A;  5D5X B;  3H5A A;  3MCZ A;  3T8T A;  2NRA C;  1LVA A;  4HF2 A;  5L3E A;  1W0U A;  1U3E M;  2RQQ A;  3C18 A;  2XB0 X;  3QPH A;  1APL C;  1ZG5 A;  4UVC A;  5J8C A;  2MD0 A;  2FXA A;  5CPR B;  2XKO A;  2ESH A;  3CUQ A;  4FE7 A;  3VYT B;  1ZH5 A;  4LLL A;  2K9Q A;  3P9K A;  5JR3 A;  3OYB A;  3DXJ F;  4XSX F;  3KYD B;  3A0B C;  1S8N A;  5BOX A;  2JRM A;  1VI0 A;  3ABK H;  2CO5 A;  3S3O A;  3I64 A;  1TP4 A;  2HDW A;  1ENH A;  3MVP A;  5FLM J;  3H9G A;  3KX2 A;  3H3U A;  4I0A A;  1RC9 A;  4FE4 A;  3J81 Z;  2I5U A;  4M6V A;  3CCV I;  1FLI A;  2JUC A;  3M8E A;  5LLQ A;  2AHQ A;  4E7S A;  1OLT A;  3OV8 A;  4M9Z A;  1K78 B;  1KGS A;  1R9T J;  1IRG A;  1SFU A;  5GPA A;  2VON A;  3O3K A;  2W85 A;  3CTA A;  2E60 A;  1LUJ B;  2DA1 A;  1TT5 B;  4FT8 A;  1UFM A;  4EAT A;  4GRI A;  2OQG A;  1WCM J;  4WXH A;  4E7H A;  1HXD A;  3NRV A;  3R4K A;  3REO A;  5D5U B;  1MBK A;  1JKR C;  1KU7 A;  2DOD A;  2HFH A;  3WU0 A;  1JJ8 C;  2R7Q A;  3K7A J;  1HW1 A;  4CH7 A;  1W36 C;  1DGW Y;  1F43 A;  2ELJ A;  5HNH A;  1Z7U A;  2OV7 A;  3VSK A;  5GAD J;  2QGU A;  4DZP A;  3D1N I;  1HKT A;  3IUO A;  5C4J J;  4WX9 A;  1ZGJ A;  1OCO H;  3X2Q H;  3JRB A;  2VT2 A;  3O6B B;  2L4A A;  2O8X A;  1YYV A;  4JX6 A;  2EIL H;  4CXF A;  4ESF A;  3BZK A;  1O4X A;  1XMX A;  2IS6 A;  4D9J A;  1U5T A;  2W25 A;  2XB5 A;  4R8H A;  2H94 A;  5FD5 A;  4P5O A;  3QQA A;  1MGT A;  1HKQ A;  1J0R A;  4DOZ A;  1N25 A;  5GPC A;  3TDZ C;  1Z91 A;  2ZFW A;  4C3H J;  3UNG C;  1X1B A;  2B0L A;  5CVJ A;  3J7Z I;  1IC8 A;  2KL4 A;  5HS7 A;  2QQB A;  2RRE A;  5B1B H;  4DQ2 A;  4IKF A;  2OU2 A;  1PUF A;  4RAG A;  1W36 D;  4ZDO A;  4CCN A;  1JUP A;  2FBK A;  1R1V A;  4EJV A;  3DF8 A;  2EIM H;  2OPT A;  4M6Y A;  3C1D A;  2HOA A;  3OL4 A;  2EV6 A;  3S1M J;  2EJR A;  2V1N A;  3BG3 A;  1D5V A;  2NVT J;  5EF6 A;  1W0T A;  1P4A A;  1QHG A;  1YX5 A;  2LDU A;  1LDK B;  4ZDP A;  2VOD A;  3I4N J;  1J2X A;  3EET A;  2R93 J;  2HYF A;  2K02 A;  2H8R A;  2FML A;  4I09 A;  5CVV A;  4ZYH A;  2ZO4 A;  2L7Z A;  3I54 A;  5FLV A;  1Y6I A;  5JHU A;  2K27 A;  3CMM A;  3HOX J;  2IW5 A;  1YRN B;  2PI0 A;  2K3P A;  1FOX A;  2MFZ A;  4P9U A;  3OYN A;  2E2H J;  1FMW A;  1T95 A;  1TQM A;  2VJJ A;  1PUF B;  1KQ0 A;  5FRO A;  3EYI A;  4BJT A;  1Z6T A;  3PO3 J;  1SFE A;  4BE2 A;  3MEX A;  1WWX A;  2GIZ A;  1MJB A;  1Z6R A;  5ICC A;  3CJR B;  1D0Y A;  1I6X A;  1EF4 A;  4EGY A;  4XN0 A;  3ULQ B;  3LA7 A;  3Q0U A;  5EZG A;  4UUS A;  3HKZ A;  3K4B A;  1IXS B;  3A03 A;  4DGW B;  2LK2 A;  4JQF A;  1ZN2 A;  3ZN1 A;  5DS9 A;  2DFI A;  2HXO A;  5FRM A;  1QA6 A;  4B44 A;  2PFB A;  3KYL A;  1N78 A;  4BXX J;  4KIF A;  3WTW C;  2NVX J;  2QUF A;  3FK7 A;  3BPX A;  2VJ4 A;  5B5E C;  2IEK A;  2PBI A;  2HYJ A;  1BI0 A;  3WOD F;  2OD5 A;  4PDK A;  1NTC A;  2WBM A;  3BR5 A;  1R00 A;  1RI7 A;  5DEQ A;  4IHY A;  4I7H A;  2H1K A;  1JT6 A;  1OYW A;  4LLN A;  2CW7 A;  5D8L B;  3BZ6 A;  2VLA A;  4RAY A;  3I59 A;  3OYF A;  2DOF A;  4XLE A;  3KEQ A;  2VPL A;  5TIS C;  3Q9S A;  5J1Y A;  5M5X J;  2M7A A;  3CO7 C;  4U0W A;  1FSE A;  3CQZ J;  4EVI A;  3AG4 H;  1OCZ H;  1UEL B;  2CJJ A;  1P2F A;  3IV5 A;  2MW8 A;  3HJE A;  2D1V A;  2VQC A;  5LHH A;  3QU6 A;  1A6I A;  1OFC X;  1PYV A;  5GTI C;  1X1C A;  3FF5 A;  1EH7 A;  2CSO A;  1RR7 A;  2XHK A;  3RPU D;  2RQP A;  1U78 A;  3TQN A;  1TBX A;  2FSW A;  2Z99 A;  1S3J A;  5ICG A;  1RET A;  3P9C A;  4O3M A;  4U7B A;  3PNV A;  4BY7 J;  3HL2 A;  3E97 A;  3GFL A;  5E3N A;  2JA6 J;  2CYY A;  1LDJ A;  3BQZ A;  1XG1 A;  2IJL A;  2EFP A;  4DW6 A;  5F1J A;  1R5I D;  2L02 A;  4D0P A;  3S1N J;  4E7K A;  4IQ4 A;  5CLS A;  9ANT A;  2WC2 A;  3IAS 2;  1DPU A;  4I0B A;  1JGS A;  3OIP A;  5F0F A;  1GV5 A;  3A02 A;  4ZYA A;  3J7Y J;  3HRS A;  3PNY A;  4RGS A;  3P9I A;  4LB6 B;  5D5V B;  2XRN A;  1U6G A;  2ZC2 A;  4ON0 A;  4BDZ A;  3H9Q A;  3DFG A;  3CME I;  5IP7 J;  1J09 A;  4BDY A;  1E0E A;  4A3D J;  1ZAR A;  4AVZ A;  5M5Y J;  4OAZ A;  1TTY A;  3FMQ A;  1R1U A;  2FMY A;  1YJ9 I;  5GAE J;  1A31 A;  3BTL A;  3DBR B;  2FRH A;  4XLA A;  3WGH A;  3H5R A;  3D5R C;  2KIS A;  2DU9 A;  1Q1H A;  4BHP A;  4LOC A;  1X58 A;  4NUB A;  2FQ3 A;  4B48 A;  2EFW A;  4II3 A;  3HGY A;  2OJE D;  5EEH A;  4I6Z A;  1B4A A;  2BOL A;  3S8P A;  3GXO A;  3MAJ A;  3CCU I;  1QQI A;  1F5T A;  3FMR A;  3BP8 A;  3HYI A;  4DZJ A;  4XLP F;  2RGV A;  3S32 A;  2V9K A;  4B3X A;  1JE8 A;  3MZH A;  3HXL A;  2DPD A;  3QYE A;  4J00 A;  2DDB A;  4X0G A;  1BL0 A;  3HSE A;  4IXA A;  3EYY A;  3V8L A;  2LNB A;  5IP6 A;  5DM7 F;  2HQ5 A;  4WXD A;  1SEU A;  4A0X A;  4Y33 A;  3H9J A;  3F0C A;  1PP8 F;  4AYB N;  2Z9O A;  2ZME B;  3ESW B;  3KP4 A;  1OCR H;  3V7R A;  4HX8 A;  3L00 A;  2E2I J;  4HG2 A;  5KK1 A;  2X1D A;  2CFX A;  4YRV A;  4P1W A;  4L5I A;  4RDU A;  5ILU A;  2VC1 A;  4AM3 A;  1TW2 A;  2LC2 A;  3G1M A;  1WJC A;  4RGX A;  5FGM A;  3TO6 A;  3ML6 A;  1WI3 A;  1ZGA A;  3PUB A;  1YIT I;  1K7A A;  4G9Y A;  3JTG A;  1P6R A;  2VL8 A;  3JRH A;  3T5X A;  1T0F C;  2GLO A;  1MSE C;  3I4P A;  4GDF A;  4CIC A;  1Y0U A;  3GTG J;  5D5W B;  4BKX A;  3GTK J;  1I6H J;  2J5O A;  4A0Z A;  2I8D A;  2E7X A;  4R79 A;  1IO2 A;  1UHS A;  2A69 F;  1T98 A;  4MEY F;  4PSX A;  3PSI A;  3OS1 A;  2W7N A;  2IGN A;  1ZRC A;  3TP0 A; 
#chains in the Genus database with same CATH homology
 2FA5 A;  1IAW A;  5DCM B;  2UXN A;  2DPU A;  3QOP A;  4I2O A;  5IT3 A;  3HOT A;  5ILS A;  3Q5F A;  1BJA A;  2HOE A;  3ZMD A;  4BXU A;  2R3S A;  3BOQ A;  2AXL A;  1REP C;  2KKO A;  3GWZ A;  3WE3 A;  5J8F A;  3B73 A;  1EV7 A;  2ZME A;  1ZYR F;  2EFO A;  1KU9 A;  5TJJ A;  3DP7 A;  3QPT A;  1SD5 A;  1UHW A;  2FE3 A;  5IT9 K;  2VBZ A;  3E5X A;  3GZ6 A;  2ISZ A;  3WGG A;  1W4M A;  3WTX C;  3GFM A;  5E20 A;  2VE9 A;  3KCC A;  1MJA A;  4AIH A;  1XD7 A;  3GLX A;  3SZP A;  4GCV A;  4MEX F;  2P5L C;  3L9F A;  1O3Q A;  2ZCW A;  4P96 A;  4BHC A;  3BDD A;  2HDC A;  5D6E A;  2O0Y A;  2H6B A;  4MGR A;  5FB2 A;  3HUG A;  1LB2 A;  1E17 A;  4HV6 A;  3H92 A;  4PGG A;  3ZMT A;  5E8I A;  1H9G A;  1QZZ A;  4UV9 A;  4K2E A;  1V3F A;  3E5U A;  2EK5 A;  1KU3 A;  2A5Y B;  3H3Z A;  2YR2 A;  1L0O C;  2FNA A;  3WE2 A;  3FWE A;  1OPC A;  3D0S A;  5JFR A;  2V9V A;  4HX4 A;  2D1H A;  5FLX K;  2E7W A;  4HDU A;  5HOO A;  4OIO F;  2V79 A;  1KQ9 A;  3F8C A;  5FLX Z;  5KVR A;  2HTJ A;  1OYI A;  2O61 A;  4DNC A;  2P5K A;  3F8N A;  4XLN F;  4FX0 A;  3DPL C;  3IHU A;  4MQV A;  5HVQ C;  1ZG1 A;  3HRT A;  2NAZ A;  4LD5 A;  3ERE D;  2Z5U A;  3G3Z A;  4PCQ A;  1IN4 A;  2ACJ A;  1LDD A;  1T6S A;  4RGU A;  1P4W A;  3AAF A;  2M5W A;  1IZ1 A;  1X3U A;  3HHH A;  1TQI A;  2MLG A;  5F1R A;  4OMZ A;  2KJC A;  3W6K B;  4CHU A;  3PQK A;  4MQ9 F;  1FC3 A;  3ZP5 A;  2RNJ A;  4HV5 A;  3LA2 A;  2K86 A;  2ADU A;  1SD7 A;  1Z1D A;  2XUB A;  4QWQ A;  5CYV A;  3V7C A;  4L9T A;  1GHC A;  3FXU A;  2DBB A;  2Q0O A;  4HBL A;  4B8X A;  3GW2 A;  1SMY F;  4WF2 A;  1YW8 A;  2A3S A;  4YIF A;  1YQA A;  4OIN F;  3RDI A;  3F21 A;  3T1B A;  2IA1 A;  3Q9V A;  5LHG A;  3QRF F;  2CWE A;  4Q5S F;  4OIR F;  2FU4 A;  3K1N A;  2ZJ2 A;  3IRR A;  2IT0 A;  3FHZ A;  2A61 A;  2IVM A;  5HDN A;  3BY6 A;  5IT9 Z;  5DD4 A;  3ZMU A;  1WI9 A;  2COM A;  3FM3 A;  2DQR A;  5DCM A;  2V1D A;  4I98 B;  5HLI A;  3CDH A;  3RIR A;  2OQR A;  1ZLJ A;  1B9M A;  2VXZ A;  3M1E A;  4L9V A;  2FBH A;  4IRG A;  1XSD A;  1YLF A;  3DEU A;  4IRH A;  2PN6 A;  2KRF A;  3U9G A;  1WSU A;  1SFX A;  3I58 A;  2MH2 A;  4BHB A;  2BEO A;  4U7D A;  1USS A;  2KIU A;  2EB7 A;  3IKT A;  4LB5 A;  4O6J A;  2PG4 A;  4EJU A;  4YG2 F;  3HTU A;  5DUI A;  4L5J A;  4HQM A;  4HYE A;  2FF4 A;  1CF7 A;  2V1U A;  4KT5 C;  2W84 A;  4GXO A;  2ZBK A;  1G3W A;  4Y13 A;  2BGC A;  2QYO A;  1MKM A;  3BRO A;  1T39 A;  5DUK A;  2PMU A;  2QLZ A;  2HKO A;  2EV5 A;  3TKY A;  4N9I A;  4CDG A;  5BS6 A;  4LK0 F;  4L0Z B;  1P92 A;  2HZT A;  2EFN A;  4UUV A;  4S05 A;  1IN8 A;  4R1H A;  3SFZ A;  2JRT A;  4P55 A;  3F6V A;  2A07 F;  3JSP A;  2R7F A;  3ZMS A;  1B1B A;  4LJZ F;  2G7U A;  5ICE A;  3DV8 A;  4RS8 A;  5K5O A;  4AVP A;  1I1G A;  4H0E A;  3LA3 A;  1FYM A;  1W5T A;  1XDU A;  1XDS A;  4GGG A;  5LGT A;  3K1M A;  5LRS A;  4AIJ A;  1ZRD A;  2GIV A;  3MWM A;  1ZLK A;  3ZMZ A;  2EA4 A;  3KZY A;  4OU0 A;  3HHG A;  4GYG A;  1TNT A;  1S29 A;  2DK8 A;  1YIO A;  2F2E A;  4FHT A;  1XMK A;  5L3C A;  2L54 A;  1RZ4 A;  2P5V A;  2FBI A;  3GFI A;  3KLO A;  3WTS C;  4M74 A;  3V4G A;  3BJ6 A;  3KET A;  1GXP A;  4G7Z F;  3F23 A;  1SD4 A;  1K6O A;  3G73 A;  3IL2 A;  3ZPL A;  3RPQ A;  1O3S A;  1IXC A;  1YW7 A;  3I0T A;  2QBY A;  4EJT A;  5DD8 A;  1FBS A;  5HLG A;  5K5R A;  4LG0 B;  2XAJ A;  1O7L A;  1MDM A;  3T8R A;  4F7Z A;  4A2U A;  2JPB A;  1YG2 A;  5A2Q K;  2XV4 S;  2GWR A;  3LAJ A;  4KDP A;  1R23 A;  2EV0 A;  1XCV A;  4HLX A;  3F22 A;  1FYK A;  4JK1 X;  3DKW A;  4KUM A;  3MZY A;  2VOO A;  3RPU A;  2VT3 A;  3U1D A;  4L9J A;  2IA2 A;  3FXQ A;  4G6Q A;  1HQC A;  1KYW A;  2Q2E A;  1LEB A;  4HQE A;  3W6J B;  1R5H A;  1C0W A;  2DTR A;  2HWV A;  4ZYG A;  3U2R A;  1HW2 A;  1STZ A;  1FP2 A;  1IW7 F;  2DK5 A;  3PFI A;  4EM1 A;  1J5Y A;  3BPV A;  3C7J A;  3IWZ A;  3R0A A;  2HS5 A;  2O6G E;  3SHF A;  2BE5 F;  2PEX A;  2AS5 F;  1QGP A;  2RV8 A;  1TQP A;  4LLG F;  1XMA A;  3L2C A;  1XB4 A;  3HIF A;  3IC7 A;  1FT9 A;  2GA2 A;  4XBF A;  5LEJ A;  2ZNZ A;  2G7H A;  4ZZD A;  5HLH A;  4L9N A;  5DCF A;  4EJW A;  2RN7 A;  2M8E A;  2NNN A;  3KP3 A;  2P6S A;  2A6H F;  5AIP A;  1Z9C A;  3FZV A;  4M73 A;  4ZYE A;  4M72 A;  5ERI A;  1KU2 A;  1SAX A;  4HLY A;  3HRM A;  2HR3 A;  2P8T A;  1QBJ A;  1JHH A;  4EJO A;  4LMY A;  2X0L A;  4ENN A;  3K69 A;  2K4J A;  3E6M A;  4UVA A;  3S2W A;  3GVA A;  4RB2 C;  2F5C A;  1XGN A;  3IKV A;  4PZJ A;  3WTT C;  2H27 A;  2EA2 A;  1QZY A;  2NNY A;  3B02 A;  3GO5 A;  2XIG A;  5CVR A;  4FX4 A;  2W24 A;  1MJ9 A;  3VFZ A;  4GYI A;  4WCG A;  4NHJ A;  3GFJ A;  2YX4 A;  3RKX A;  5E1Z B;  2L3D A;  4YFK F;  5H6R A;  4I02 A;  4RAZ A;  1UST A;  1BM9 A;  4HF1 A;  1O57 A;  3HSR A;  3QP5 A;  3HSF A;  4XRF A;  2BYV E;  4EQQ A;  1H9T A;  4A6E A;  1J59 A;  1GVJ A;  5F6F A;  3F72 A;  3BJA A;  5E18 F;  1RIO H;  5FFZ A;  2JT1 A;  4KA4 A;  2OAZ A;  1FX7 A;  3RTR A;  1PDN C;  4KN4 X;  2VBY A;  1B9N A;  3WTU C;  3E6C C;  2UWM A;  1TNS A;  2GQQ A;  1ZRE A;  2FEZ A;  2M30 A;  4Y17 A;  2P4W A;  2QEN A;  3TGN A;  4HZF A;  1ZRF A;  1HSJ A;  1BIA A;  3FMS A;  4MHG A;  2JSC A;  2YSR A;  3CO6 C;  2MC3 A;  1FBQ A;  4Q48 A;  2G9W A;  5E1X A;  1BI1 A;  4ENK A;  1HBX G;  3KP6 A;  4RB1 A;  1G3T A;  2P7V B;  2GZW A;  5AIQ A;  4ZH4 F;  5D6F A;  1VTN C;  1RNL A;  2BV6 A;  2HTS A;  1R36 A;  2LKP A;  1YFH A;  2K7L A;  1LQ1 A;  2MBF A;  4WWC A;  1ULY A;  1W7P D;  4UNO A;  5ILV A;  2PLY A;  3ZN0 A;  2HKX A;  2NS0 A;  1MZB A;  3LQR A;  5FFX A;  3SXY A;  4UVB A;  3N97 A;  2R7D A;  2CGP A;  3C3W A;  4GO1 A;  3GF2 A;  1JXS A;  2OZU A;  1PUE E;  3RKY A;  5CVU A;  4LFU A;  1SMT A;  1WRJ A;  2L4M A;  2VE8 A;  2CQK A;  2CG4 A;  4MTE A;  4S04 A;  1U8R A;  2JTV A;  1B6A A;  2XAS A;  4A0Y A;  3EDP A;  1KYZ A;  4EGZ A;  1EH6 A;  1DDN A;  3RI4 A;  4BH9 A;  4XSZ F;  1DPR A;  3KP2 A;  4IHS A;  1U5T C;  2RKH A;  2MLK A;  1ON1 A;  2HQR A;  3TO9 A;  2VBW A;  2OZ6 A;  2F5F A;  1H0M A;  1I27 A;  1E2X A;  2D45 A;  3F8F A;  4KNY A;  3ABT A;  1AOY A;  4N0B A;  2K4B A;  1LJ9 A;  2ZNY A;  5K1Y A;  3OOP A;  4G94 A;  3KE2 A;  3CJN A;  5D8K B;  3ELK A;  1YS6 A;  5F64 A;  4L18 B;  1WKM A;  1IXR C;  1G6N A;  3WG9 A;  4KMU X;  1FP1 D;  2IPQ X;  1ZAO A;  4IPA A;  5DV5 A;  4G8X A;  3FM5 A;  2DAO A;  4M9X A;  3O2P E;  3IWF A;  1W5S A;  1XN7 A;  2LF7 A;  1YTY A;  4IF4 A;  3CUQ B;  5L3F A;  3RYR A;  3ECO A;  1SD6 A;  5A2Q Z;  4OIQ F;  4AIK A;  4NQW A;  2P6T A;  3VEP A;  3EUH A;  3KLN A;  1FNN A;  5L3G A;  2J5P A;  4EMS A;  3V8K A;  1T0F A;  3I71 A;  4YFN F;  2E1N A;  2QZ8 A;  3CUO A;  1FOK A;  4AWX B;  3KFW X;  2JZY A;  1FZP B;  2VN2 A;  1XGS A;  2A6E F;  1R22 A;  5LRR A;  3FX3 A;  4TV7 A;  1YW9 A;  4KIB A;  3ABU A;  3E3V A;  2Y75 A;  1BI2 A;  2FOK A;  1MD0 A;  5DYM A;  2VOP A;  1IN7 A;  1I1S A;  4ASN A;  2NYX A;  3TDU C;  4KIC A;  4HDV A;  1W7P A;  4LK1 F;  3LFK A;  2QBY B;  4HF0 A;  4PGH A;  2D2W A;  1L3L A;  5H6Q A;  1K78 A;  2Z33 A;  1XCB A;  3GZ5 A;  5JVT A;  1G3Y A;  3ZMV A;  1I5Z A;  3KZZ A;  3I59 B;  3R60 A;  3GX4 X;  2PMH A;  2H09 A;  2Q8K A;  3NEU A;  1S7A A;  5L3B A;  4ENJ A;  3I5U A;  4RB3 C;  1ZHF A;  5E8G A;  3K2Z A;  2BBY A;  1J7K A;  4A5N A;  1MDM B;  2PQ8 A;  3KEO A;  2PJP A;  2TDX A;  4IRI A;  4G7O F;  3WTV C;  4MNU A;  1R5G A;  1QPM A;  3WGI A;  3RJP A;  1FPQ A;  1U2W A;  1A04 A;  2E1C A;  4L0Y B;  3LST A;  2Y48 A;  4YII A;  3PQJ A;  3KP7 A;  4OMY A;  4QLC U;  4RB0 A;  5E17 F;  3RKW A;  4P9F A;  2YU3 A;  4NB5 A;  5FD6 A;  2V1X A;  2QM3 A;  1CGP A;  2UXX A;  2XGX A;  1XGM A;  1O3R A;  3TOA A;  4B09 A;  3VOD A;  5ICF A;  3E5Q A;  4KN7 X;  2O03 A;  1LEA A;  2ESN A;  4Z2Y A;  5CJ9 A;  2VC0 A;  2MD5 A;  2UZK A;  1OYY A;  3K1P A;  4HW0 A;  3N4M A;  2KIM A;  1WQ2 A;  4M71 A;  4M9S A;  1AWC A;  1R1T A;  1CF7 B;  2Z3Y A;  1GXQ A;  4BQA A;  3VB2 A;  2EFQ A;  3T0Y A;  1OKR A;  5HDG A;  2IA0 A;  4IVN A;  1EH8 A;  1BC8 C;  3ZQ7 A;  4MTD A;  4ETS A;  1F4K A;  2ELH A;  2XAG A;  2F5D A;  2MH9 A;  1FY7 A;  3GYH X;  3E6D A;  3D5L A;  2ETH A;  1JHF A;  4AD9 A;  1FSH A;  4OIP F;  1O3T A;  4JBA A;  2HQN A;  1BBY A;  1XGO A;  2HGC A;  5LEK A;  2WTE A;  5BPD A;  1T38 A;  1BOA A;  3GUD A;  2GXG A;  2QQA A;  1UHM A;  3RYP A;  1XSV A;  2DQL A;  1ZG3 A;  3L7W A;  1U5T B;  5DDG A;  1G3S A;  2RDP A;  1BN5 A;  2STW A;  4BYY A;  2LF8 A;  2DO7 A;  1HST A;  2XAF A;  2STT A;  4IJA A;  3WTY C;  4CZZ A;  4KFC A;  2W57 A;  6PAX A;  1R58 A;  4RGR A;  3ECH A;  1T2K A;  3R61 A;  3COA C;  1D8J A;  4UV8 A;  3WTZ A;  3GEZ A;  1XSX A;  4ZZL A;  4ESB A;  1S6L A;  4A12 A;  1QNT A;  1V4R A;  5LBQ A;  5J6X A;  5H20 A;  1DP7 P;  3JW4 A;  4KYW A;  5BMZ A;  2XAH A;  2GA1 A;  4I01 A;  1YS7 A;  4EM2 A;  2DT5 A;  1ODD A;  3F6O A;  5CVI A;  1D8K A;  3M7G A;  2GAU A;  5K5Q A;  3R0J A;  3LAP A;  4ENM A;  3TO7 A;  3CUQ C;  2IP2 A;  1PP7 U;  1RUN A;  4Q47 A;  2HEO A;  3M9A A;  5HS8 A;  2YX7 A;  3HTS B;  2XKP A;  4U0V A;  5TRD A;  3F8M A;  4U0Y A;  2ZKZ A;  3DPT A;  1FWZ A;  4G7H F;  2F5E A;  2RVC A;  5LGU A;  3JSO A;  3BWG A;  3IRQ A;  2KIF A;  2LSO A;  2XAQ A;  1OMI A;  3EQL F;  1J75 A;  1DUX C;  2RC4 A;  2DLL A;  1TW3 A;  2YPR A;  3TOB A;  4HA8 A;  3JAM K;  4Y15 A;  1O7F A;  3MQ0 A;  4A6D A;  1W7P B;  4YFX F;  3JAM Z;  4G6D A;  4UHT A;  2QVO A;  2FNP A;  3J81 K;  2IRF G;  1FBU A;  4WK8 F;  3P7N A;  2QWW A;  3DQV C;  1NHA A;  2XVC A;  5BQT A;  2ZXJ A;  1HKS A;  4E70 A;  3HOS A;  3K9T A;  4U88 A;  1ONV A;  1J9I A;  2Y0M A;  2KJB A;  1Z05 A;  4OOI A;  5ED4 A;  1QO0 D;  2HYG D;  1IN6 A;  4UXN A;  3F8B A;  3KP5 A;  1HW5 A;  4ESJ A;  3ISP A;  2OBP A;  4CGZ A;  3HRU A;  1YO5 C;  2OA4 A;  5E1W A;  2L01 A;  5LHI A;  4HX7 A;  4Q4Z F;  2O3F A;  1P4X A;  5D4S A;  2WV0 A;  2V6C A;  3I53 A;  4CYD A;  4KMF A;  3LQQ A;  2DI3 A;  1IN5 A;  3LWF A;  3V8J A;  1K79 A;  3SQN A;  4HAM A;  2WWY A;  1F9N A;  2M87 A;  3E6B A;  4WXC A;  1TLH B;  2GXB A;  1RUO A;  5LGN A;  3J80 Z;  1UCR A;  3BJO A;  3J80 K;  4EV0 A;  2EWN A;  5D4R A;  5JI6 A;  3J7A O;  2P7C B;  4M6X A;  3F3X A;  4N9H A;  1G4D A;  1KQ8 A;  1ON2 A;  1KA8 A;  4BNC A;  4KIG A;  1OR7 A;  4EM0 B;  3CLO A;  1BC7 C;  1IF1 A;  2C6Y A;  3ROU A;  3L09 A;  5AON A;  2X4H A;  1IRF A;  5HDK A;  1UB9 A;  4BAY A;  5HS9 A;  2M1B A;  2A68 F;  1F1Z A;  4LGW A;  3MFK A;  3WU1 B;  5BPI A;  1B59 A;  4CO8 A;  4O5V A;  3JTH A;  2DW4 A;  1FYL A;  3R6S A;  3V7S A;  2ISY A;  3VOE A;  2JPC A;  3QAH A;  1R7J A;  5L3D A;  2VBX A;  4ZYD A;  4LG0 A;  3M8F A;  3SZT A;  1BIB A;  1D3Y A;  2QQ9 A;  3QP6 A;  2MA3 A;  1BI3 A;  1LNW A;  2H6C A;  2XRO A;  3K0L A;  3FXR A;  1S7O A;  5EEG A;  5FO5 A;  3NQO A;  3QU3 A;  4HOB A;  4IHT A;  1IUY A;  2CW0 F;  2M45 A;  5D5X B;  3MCZ A;  3T8T A;  2NRA C;  1LVA A;  4HF2 A;  5L3E A;  1U3E M;  3C18 A;  3QPH A;  1ZG5 A;  4UVC A;  5J8C A;  2FXA A;  2XKO A;  2ESH A;  3CUQ A;  1ZH5 A;  4LLL A;  3P9K A;  5JR3 A;  3DXJ F;  4XSX F;  1S8N A;  5BOX A;  2CO5 A;  3I64 A;  3H3U A;  4I0A A;  3J81 Z;  1FLI A;  3M8E A;  5LLQ A;  3OV8 A;  4M9Z A;  1K78 B;  1KGS A;  1IRG A;  1SFU A;  2VON A;  3O3K A;  2W85 A;  3CTA A;  4FT8 A;  1UFM A;  2OQG A;  4WXH A;  1HXD A;  3NRV A;  3R4K A;  3REO A;  5D5U B;  1KU7 A;  2HFH A;  3WU0 A;  1HW1 A;  1Z7U A;  1HKT A;  4WX9 A;  1ZGJ A;  2VT2 A;  3O6B B;  2L4A A;  2O8X A;  1YYV A;  4CXF A;  4ESF A;  1U5T A;  2W25 A;  4R8H A;  2H94 A;  5FD5 A;  4P5O A;  1MGT A;  1HKQ A;  1J0R A;  3TDZ C;  1Z91 A;  2ZFW A;  2B0L A;  5CVJ A;  5HS7 A;  2QQB A;  4DQ2 A;  2OU2 A;  4EJV A;  2FBK A;  1R1V A;  3DF8 A;  4M6Y A;  3C1D A;  2EV6 A;  2EJR A;  1D5V A;  1P4A A;  2LDU A;  1LDK B;  2VOD A;  1J2X A;  3EET A;  2HYF A;  2K02 A;  2FML A;  4I09 A;  5CVV A;  4ZYH A;  2ZO4 A;  3I54 A;  5JHU A;  2K27 A;  2IW5 A;  2PI0 A;  4P9U A;  1TQM A;  1KQ0 A;  3EYI A;  1Z6T A;  1SFE A;  3MEX A;  1WWX A;  1MJB A;  1Z6R A;  5ICC A;  1I6X A;  4EGY A;  3ULQ B;  3LA7 A;  1IXS B;  4JQF A;  1ZN2 A;  3ZN1 A;  2DFI A;  2PFB A;  4KIF A;  3WTW C;  2QUF A;  3BPX A;  2PBI A;  3WOD F;  1BI0 A;  2OD5 A;  4PDK A;  1R00 A;  1RI7 A;  5DEQ A;  4I7H A;  1OYW A;  4LLN A;  5D8L B;  3BZ6 A;  4RAY A;  3I59 A;  3KEQ A;  3Q9S A;  3CO7 C;  4U0W A;  1FSE A;  4EVI A;  1P2F A;  2D1V A;  5LHH A;  3QU6 A;  3FF5 A;  1EH7 A;  2CSO A;  2XHK A;  2RQP A;  1U78 A;  3TQN A;  1TBX A;  2FSW A;  2Z99 A;  1S3J A;  5ICG A;  3P9C A;  4O3M A;  4U7B A;  3E97 A;  3GFL A;  2CYY A;  1LDJ A;  2IJL A;  2EFP A;  2L02 A;  4D0P A;  5CLS A;  2WC2 A;  1DPU A;  4I0B A;  1JGS A;  3HRS A;  4RGS A;  3P9I A;  4LB6 B;  5D5V B;  2XRN A;  1U6G A;  4ON0 A;  3DFG A;  1ZAR A;  1TTY A;  3FMQ A;  2FMY A;  1R1U A;  2FRH A;  3WGH A;  2DU9 A;  1Q1H A;  4BHP A;  2FQ3 A;  2EFW A;  5EEH A;  1B4A A;  3GXO A;  3MAJ A;  1QQI A;  1F5T A;  3FMR A;  3BP8 A;  3HYI A;  4XLP F;  1JE8 A;  2RGV A;  3MZH A;  2DPD A;  3HSE A;  4IXA A;  3EYY A;  3V8L A;  2LNB A;  4WXD A;  4A0X A;  1PP8 F;  2Z9O A;  2ZME B;  3KP4 A;  3V7R A;  4HX8 A;  3L00 A;  5KK1 A;  2CFX A;  4L5I A;  5ILU A;  2VC1 A;  1TW2 A;  4RGX A;  3TO6 A;  5FGM A;  3ML6 A;  1K7A A;  1ZGA A;  4G9Y A;  3JTG A;  1P6R A;  3T5X A;  3I4P A;  4CIC A;  1Y0U A;  5D5W B;  2J5O A;  4A0Z A;  2E7X A;  4R79 A;  2A69 F;  1T98 A;  4MEY F;  4A5M A;  1ZRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...