4UNOA

Crystal structure of the ets domain of human etv5 in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords ETS TRANSLOCATION VARIANT 5
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4unoA00
4P96A 3F72A 3BJAA 3TOAA 3HIFA 4M9ZA 3L9FA 1FC3A 3R0JA 2R7DA 4E70A 2H6BA 2P5LC 2KIFA 1WWXA 3Q9VA 3DP7A 4M74A 1R00A 3RKWA 4UVAA 3GFJA 3GFMA 2PFBA 3PFIA 4P5OA 4ZH4F 3E5UA 5H6RA 1F5TA 3N4MA 4M6XA 2UWMA 2D1HA 2Z3YA 5HS9A 2H94A 3LQQA 2F5FA 1RUOA 3RYPA 1QZZA 3HRTA 5K1YA 2W24A 3M8FA 1Z05A 1R1VA 4HBLA 2M5WA 4KUMA 3DQVC 3LQRA 1TBXA 3FHZA 2JT1A 3DXJF 2M30A 4RGXA 4EGZA 2IVMA 2P5KA 2Z99A 4UV9A 1H9GA 2DT5A 1Q1HA 2V1UA 2OU2A 5KVRA 4MTDA 2P5VA 1P6RA 4TV7A 3ECHA 1F9NA 2VBXA 3KEQA 4N9IA 3FM5A 3ZQ7A 1ZN2A 1O57A 2F2EA 3TDZC 1WKMA 5K5QA 5D4RA 1ZRCA 2JPBA 2YSRA 2FBIA 5A2QK 1DUXC 3E6MA 3HHGA 2NRAC 5AIQA 4EM1A 1V3FA 3ML6A 3HOSA 4Q4ZF 1S3JA 3SFZA 4R79A 5CVUA 3FX3A 4CDGA 1ZRDA 1BC8C 1TW3A 1FSHA 4HX8A 4G7OF 1G6NA 2EWNA 1KU9A 2QWWA 4O5VA 1RIOH 5FD6A 1LVAA 2QZ8A 4RB0A 5BPDA 5JHUA 2W57A 2EJRA 2BV6A 1XGSA 5LHGA 3L09A 2XVCA 4A12A 2O6GE 2FEZA 3U9GA 2JZYA 3LFKA 2MH9A 4PZJA 5E1WA 2PN6A 4HF2A 4L5IA 2ZFWA 2MD5A 1B9NA 1JGSA 3I0TA 4AIJA 4RAYA 1I27A 4O3MA 3PQKA 2KJBA 4U7DA 5HS8A 4AVPA 1ZLJA 3F6OA 4OMYA 5H6QA 3ZMDA 4Q5SF 2IA2A 3P9IA 3HSFA 1XGNA 4HDUA 3WGIA 1B9MA 2ZBKA 1LDDA 5F6FA 4OINF 2O3FA 4WXCA 5TRDA 2HEOA 2Q8KA 3ZPLA 3HRSA 2OQRA 3KCCA 2UXNA 1J75A 2C6YA 4UVBA 4LB5A 4IRIA 1D5VA 2HKXA 5EEHA 4HZFA 3HOTA 3KP4A 4MGRA 4L9JA 5EEGA 1DPUA 4LG0B 5D5XB 3V7SA 2HWVA 4I02A 5E18F 1ZH5A 2M87A 4B09A 3RJPA 4NQWA 3R60A 3GFLA 4M9SA 1NHAA 3RIRA 4XRFA 2F5EA 3SXYA 4BQAA 2MA3A 1KA8A 1R7JA 2JSCA 1R1UA 2QYOA 4U0WA 2NNYA 1FNNA 2OZUA 3MAJA 3O6BB 1XCBA 1SD4A 2ZNYA 2PBIA 5HLHA 4OIPF 2KIUA 4ASNA 2GXGA 4L5JA 2DPUA 2LSOA 3G73A 3RPQA 3U1DA 1XB4A 2EV5A 2K7LA 1LDJA 3NRVA 1EH6A 4ZYHA 2CGPA 3K2ZA 3LAJA 5JVTA 3G3ZA 4A5MA 5D6FA 5E20A 2VE9A 4A6DA 2W85A 3PQJA 1HW2A 3M7GA 2HFHA 2LKPA 4NHJA 3EETA 1D8JA 1JE8A 1R1TA 2ZKZA 4OIQF 2PG4A 2YU3A 5LEKA 4P9FA 3C7JA 4Q48A 2OA4A 5BS6A 1YIOA 4EMSA 4DQ2A 4OMZA 3TDUC 4G6QA 1FLIA 2FF4A 4D0PA 3HSEA 3SZTA 3CO7C 1BI3A 2O03A 1I1GA 4EM2A 2WC2A 4KICA 4EJVA 1S7OA 5D5UB 5J8CA 1UHWA 3L00A 3DPTA 2IJLA 3ZMUA 4YFXF 4KFCA 4G94A 2X0LA 2Y0MA 4KIGA 1QBJA 3Q5FA 1SD5A 1IN4A 1PP8F 2CYYA 4IHSA 2PI0A 4CZZA 3DKWA 1DPRA 4MQVA 1USSA 4ESFA 1K6OA 2L01A 5FLXZ 3HSRA 4LD5A 2VOOA 5DUKA 4Y15A 1IRGA 2WWYA 2BE5F 4EV0A 1H9TA 1T98A 5FFZA 1ZREA 3F8NA 1R22A 4BHBA 2HTSA 3L2CA 2VXZA 1HKQA 2V6CA 2Z9OA 3TO7A 4LMYA 4ESBA 1XCVA 3T8RA 1IXRC 3ABUA 3FMSA 3DFGA 4MEYF 2DI3A 4Q47A 3RPUA 2XROA 3EYYA 3LA2A 3MFKA 3JTHA 4U0YA 4IPAA 3J80K 3E97A 1P4WA 1OYYA 2NNNA 4EM0B 2Z5UA 3GWZA 2HQNA 1XD7A 2STTA 5E8GA 1W7PA 3I71A 5E1ZB 2FBKA 4M71A 1U8RA 1B4AA 3I64A 5HDGA 3J81Z 4G9YA 2DFIA 4CO8A 4O6JA 4IRHA 4IJAA 4HLXA 1PUEE 4L0YB 4U88A 2RV8A 3CDHA 2V79A 1BIAA 2P6SA 5K5RA 1R58A 3ZP5A 3EDPA 3T0YA 2RDPA 1VTNC 5ICCA 3NQOA 3ULQB 3BJOA 2DK5A 1USTA 2PEXA 1U3EM 4GXOA 5BOXA 4MEXF 4GCVA 4IHTA 3FF5A 3JAMK 1ZLKA 3KZYA 1RI7A 3F23A 3AAFA 3HTSB 2L54A 3WGHA 2ZCWA 3M8EA 3TGNA 4HW0A 1W5TA 1H0MA 4LK1F 1WI9A 2UXXA 2UZKA 2FQ3A 1STZA 1ON2A 2FMYA 2COMA 1O3SA 2QUFA 1MJBA 3HRUA 1KU2A 3K1PA 3ZMSA 1W7PD 1OYWA 1LB2A 3KP5A 4ENMA 4CYDA 3IHUA 2L4AA 5D8KB 3WG9A 4EJTA 1P4AA 3FWEA 2GA1A 4HOBA 1L0OC 1UFMA 1IF1A 4LGWA 1B59A 2DU9A 2XAQA 3WTTC 2WV0A 3FMQA 5IT3A 3J7AO 1SMYF 3V7CA 4KIFA 4OU0A 3HUGA 2K4JA 3BWGA 4WX9A 1TNSA 3E6BA 3GW2A 2MC3A 4OOIA 3F8CA 5ICFA 1BN5A 2W84A 3WTSC 3CUQA 2ETHA 2A69F 3F22A 3HYIA 1G4DA 1MD0A 1ZRFA 1T39A 1Z7UA 1U2WA 1E17A 1IAWA 2HTJA 1TQPA 2GQQA 1GHCA 1XGMA 4ZZLA 4IF4A 2XKOA 5D5VB 2DPDA 5FGMA 2M1BA 4GO1A 1U5TB 3GFIA 4KN4X 5DCMB 2OBPA 1MJAA 4MTEA 2GIVA 1FX7A 5BPIA 2LF7A 4I98B 5LGTA 3RDIA 3MCZA 2VC1A 1FPQA 1Z6TA 4HLYA 1SFXA 2ACJA 2MLKA 4N0BA 2RN7A 1XMKA 2DO7A 4UVCA 3T1BA 4U7BA 4BXUA 1S29A 1MDMB 3TQNA 4KMFA 5A2QZ 4BH9A 3V8LA 2IA1A 3RKYA 3ZN1A 1ZG3A 4FX4A 1WQ2A 3CUQB 5LRSA 1FZPB 4P9UA 1FYLA 1SFUA 3COAC 3K1NA 3R0AA 2CQKA 1REPC 4HV6A 3CJNA 2XAHA 1P2FA 1ZAOA 1QNTA 2BGCA 1R23A 5HDKA 2PMHA 4KA4A 2YX7A 5L3BA 3ABTA 1FSEA 5F1RA 3DEUA 2P7CB 3F21A 3WU0A 1UCRA 4B8XA 2VT3A 3WTZA 5JR3A 2ADUA 2EFPA 3HRMA 1HKTA 3QPTA 4M6YA 1B6AA 1P92A 2IRFG 3B73A 2ESNA 2P6TA 1QGPA 1I1SA 2P7VB 1E2XA 3VFZA 4MQ9F 1R36A 4ON0A 2FNAA 5DEQA 5D8LB 3RTRA 2KKOA 1UHMA 3O2PE 2IA0A 3K9TA 3K69A 1G3TA 4GGGA 2DTRA 1BI0A 4QWQA 2XASA 2F5CA 4LG0A 3FXRA 3WE2A 1XMAA 4PCQA 4BAYA 4L9NA 4LK0F 3BJ6A 1K79A 2VOPA 2VBZA 1Z1DA 2K4BA 2B0LA 4PGHA 2EFQA 3D0SA 2KJCA 2V1DA 4UXNA 3W6JB 2XIGA 3SHFA 2A68F 1HSTA 4R8HA 2RNJA 3IRQA 4RB1A 1O7LA 3QP6A 3T8TA 4HF1A 3V7RA 5HS7A 2HS5A 4MHGA 3MEXA 2WTEA 2FA5A 1LEAA 4I7HA 3REOA 4KT5C 4KIBA 5DUIA 3MWMA 3KEOA 1HSJA 2AS5F 3FM3A 3VOEA 5IT9K 1K7AA 5LBQA 3FMRA 3K1MA 5CLSA 4I2OA 3WTVC 2NYXA 2ELHA 3I4PA 4K2EA 2RKHA 2OAZA 1QZYA 3M1EA 4GYIA 2E1NA 5L3EA 3GUDA 1QO0D 5ILSA 2D2WA 4BHPA 5LHIA 2K86A 3CUQC 3IRRA 3KETA 2EV6A 2DBBA 1FT9A 1CF7A 4RS8A 1J9IA 5J8FA 1PDNC 4L9TA 1WSUA 2EFNA 1SD6A 3P9CA 3BPVA 1JXSA 1YS6A 5AIPA 4UNOA 5ICGA 2D1VA 2QVOA 1KGSA 3GYHX 2HYFA 1FBUA 4R1HA 1ON1A 3F3XA 4Y17A 1IXCA 2HKOA 2Y75A 3WTXC 4ESJA 3ZMTA 1KQ9A 1YYVA 1C0WA 5CVJA 3ZN0A 1F4KA 4ZYEA 2EFOA 2V9VA 2Z33A 5JFRA 4LFUA 2KIMA 2O61A 1CF7B 3KZZA 1Z91A 4LLNA 1HW1A 4WWCA 1J2XA 2ZJ2A 1YFHA 2DQLA 2GAUA 3U2RA 5L3GA 5E17F 2JPCA 1HQCA 4YIIA 3CO6C 3WE3A 2ISZA 1YTYA 3B02A 3QP5A 1XDSA 4A0YA 3MZHA 1ZGJA 5LRRA 2FOKA 4QLCU 4M73A 5CVVA 4ZZDA 4ETSA 5ILUA 2FRHA 3ECOA 2HZTA 5DCFA 5AONA 4AWXB 2PJPA 2XAJA 2DAOA 1YW7A 2K27A 2P8TA 4UV8A 3H92A 2A3SA 4HQMA 2L3DA 4LLGF 1RUNA 4G7ZF 4YFNF 3M9AA 1TTYA 2BYVE 1S8NA 3E3VA 2M8EA 3HHHA 1O3QA 2L4MA 4BYYA 2P4WA 3T5XA 1G3YA 1S7AA 1YLFA 1UB9A 4XSZF 1ONVA 1ZYRF 4G6DA 1FBSA 2VBWA 3TO9A 2FE3A 3KP2A 1QQIA 3IL2A 2R3SA 4A5NA 3J80Z 3MZYA 4U0VA 2BEOA 2OZ6A 2H09A 4HAMA 4DNCA 1GVJA 3V8JA 4S04A 3LA3A 2Q2EA 1I6XA 3WTWC 1O3TA 5CJ9A 5HVQC 2IPQX 3ERED 1KU3A 1R5HA 3R6SA 1TLHB 5L3DA 4CICA 4RB3C 1D8KA 3TKYA 4OIOF 5L3FA 3H3UA 1Z6RA 1BBYA 2JTVA 4YIFA 5CYVA 2DLLA 4WCGA 2NAZA 3K0LA 3BZ6A 1EH8A 4AIKA 1CGPA 4EGYA 5DD8A 4RB2C 2CW0F 3GO5A 4HDVA 4I09A 3V8KA 5H20A 4LJZF 4P55A 1LJ9A 1ZG5A 1AWCA 2EA4A 4BNCA 3TOBA 2VT2A 4HQEA 2D45A 2FU4A 2F5DA 5FB2A 3VODA 2ISYA 4AD9A 5DDGA 4JBAA 5LHHA 3RI4A 4UHTA 2QQAA 1BIBA 5E8IA 5D4SA 3EQLF 3C18A 1W5SA 4N9HA 3KP3A 1KYWA 3IC7A 3FXQA 1X3UA 2E7XA 3ROUA 4A0XA 1XSVA 2DW4A 2GA2A 1T38A 1S6LA 4WXHA 1U5TA 5DCMA 4IVNA 3WTUC 3F8MA 4HV5A 4XBFA 2H27A 2XKPA 4PGGA 4PDKA 3S2WA 4A2UA 4M9XA 2CG4A 5HLIA 1IXSB 4HF0A 3D5LA 3H3ZA 1J59A 2XGXA 4ZYGA 1SFEA 3IWZA 2MLGA 1MDMA 2K02A 2ZNZA 2R7FA 1SD7A 4WXDA 4KYWA 3KFWX 4FT8A 3KP6A 3IKTA 3BOQA 1ODDA 1A04A 3I53A 2H6CA 2FSWA 3JW4A 2HYGD 1HKSA 4YG2F 5CVRA 5CVIA 4ZYDA 2FBHA 3VEPA 1BOAA 3ELKA 2DQRA 1XSXA 1W4MA 1GXQA 1B1BA 2A6EF 2YPRA 2FXAA 2Q0OA 1LQ1A 2XAFA 1OPCA 1DDNA 3R61A 2HGCA 1RZ4A 2FMLA 1D3YA 3SQNA 3C3WA 3F6VA 1G3SA 5LLQA 5ILVA 2G9WA 3I54A 2VC0A 3DPLC 2A5YB 1OKRA 3FXUA 2RVCA 3QOPA 3GLXA 4EVIA 2G7UA 3OV8A 4L0ZB 3BP8A 1TQMA 4UUVA 2VBYA 4JQFA 3I58A 1MJ9A 3WODF 1KQ8A 3I5UA 3BY6A 1BI2A 1QPMA 1TNTA 3GVAA 2J5PA 1BC7C 1L3LA 2STWA 2QM3A 2X4HA 5KK1A 3WGGA 4OIRF 1J5YA 1RNLA 3F8FA 5K5OA 4L9VA 5L3CA 1LDKB 1TQIA 3BROA 3TO6A 1R5GA 2L02A 3GX4X 1T6SA 2VODA 4RGSA 4IRGA 1SMTA 2TDXA 2O0YA 4HX4A 1YO5C 2HQRA 1BM9A 5F64A 1IN5A 1T0FA 4HYEA 2PQ8A 3DF8A 2O8XA 3I59A 1FOKA 1V4RA 2ESHA 1ZHFA 2EK5A 2ZO4A 1I5ZA 5J6XA 1O3RA 1LNWA 2W25A 5HDNA 2RQPA 3IKVA 1EH7A 2E7WA 4EJOA 1F1ZA 1O7FA 2EB7A 1OYIA 5DD4A 3IWFA 1IUYA 1TW2A 3LSTA 4ENKA 3C1DA 2IP2A 1U78A 1YG2A 3RKXA 1U5TC 3MQ0A 3BPXA 2PLYA 5ICEA 3E5XA 1FY7A 5IT9Z 1J7KA 2GZWA 4I0BA 2QBYA 3I59B 1ZG1A 3KP7A 2QENA 5DYMA 4KNYA 5LGNA 4WK8F 3W6KB 4ENNA 2YX4A 2OQGA 6PAXA 1FP1D 2A61A 3RYRA 4EJUA 3LA7A 3SZPA 5E1XA 4Z2YA 2A07F 3E6DA 2XV4S 1K78A 3WU1B 5BQTA 3P9KA 3GEZA 4LLLA 2ZMEA 3F8BA 3VB2A 4JK1X 4A0ZA 4Y13A 3QAHA 2QBYB 2RGVA 1EV7A 5FO5A 5LGUA 2HR3A 3Q9SA 3QPHA 4BHCA 3CTAA 1LEBA 5TJJA 2QQBA 2FNPA 1YS7A 4KN7X 2XUBA 2OD5A 3E6CC 3QU3A 4CHUA 1Y0UA 5ED4A 1KU7A 4FHTA 1JHFA 2G7HA 2EV0A 5HOOA 2YR2A 3OOPA 1K78B 2PMUA 1IN8A 1FYMA 2CFXA 4G8XA 4XSXF 2ZXJA 2ZMEB 2LNBA 2M45A 4FX0A 1HXDA 1BI1A 1YW9A 1MGTA 2XHKA 5BMZA 3QRFF 3GZ6A 3FZVA 2BBYA 4YFKF 1YQAA 3L7WA 1G3WA 3V4GA 1AOYA 1GXPA 3GZ5A 2AXLA 3NEUA 2EA2A 1KQ0A 1MZBA 3LWFA 4I0AA 4AIHA 1DP7P 1XGOA 2IW5A 1ZGAA 5HLGA 4H0EA 2RC4A 3O3KA 5FLXK 4GYGA 2GWRA 1Z9CA 2GXBA 4NB5A 1ZARA 5JI6A 2EFWA 2NS0A 4LB6B 1T2KA 2V1XA 4CGZA 2CSOA 4ENJA 2MBFA 3QU6A 1XDUA 5ERIA 4G7HF 1XSDA 2E1CA 2KRFA 3ISPA 2QQ9A 2HDCA 4KMUX 3DV8A 5LEJA 2Y48A 3JSPA 4M72A 3BDDA 2VN2A 4EJWA 3ZMVA 4RGUA 1IRFA 2HOEA 4IXAA 2LDUA 3KLNA 2CWEA 2JRTA 2VONA 2XAGA 1KYZA 5D6EA 3LAPA 3GF2A 4RAZA 3KLOA 3JTGA 4EQQA 4S05A 2CO5A 1J0RA 5D5WB 3N97A 1FYKA 4A6EA 3CUOA 4XLNF 1P4XA 1IN7A 1HW5A 1MKMA 1IN6A 4HA8A 1IZ1A 3J81K 3EYIA 4CXFA 3JSOA 1ULYA 2A6HF 1SAXA 3CLOA 3EUHA 1HBXG 3P7NA 3E5QA 5DV5A 1FWZA 1YW8A 3KE2A 2DK8A 3HTUA 2VE8A 1XN7A 3JAMZ 5FD5A 4HX7A 2IT0A 4MNUA 4WF2A 2QLZA 1W7PB 3ZMZA 2XRNA 2MH2A 4KDPA 1FP2A 2LF8A 4I01A 3WTYC 1PP7U 4F7ZA 4RGRA 1OMIA 4XLPF 1IW7F 1JHHA 3R4KA 1OR7A 1WRJA 4L18B 2J5OA 1FBQA 1U6GA 3GXOA 1BJAA 5FFXA
chains in the Genus database with same CATH superfamily
2KZGA 2PMZA 1MSFC 4CH7A 4P96A 2UV1A 4C3IJ 1ZKGA 3F72A 3BJAA 1WJDA 3SEZA 3TOAA 3HIFA 3CCVI 4M9ZA 3BR0A 1U9NA 3L9FA 1FC3A 2L2OA 4DZPA 3R0JA 2R7DA 4E70A 3HDDA 2H6BA 2XB5A 2V26A 2P5LC 2KIFA 4RBOA 1I50J 1JT0A 1WWXA 3Q9VA 1MIJA 3DP7A 3KYLA 1U8BA 4M74A 1R00A 1VQ6I 3RKWA 4UVAA 2KP6A 4I99C 3GFJA 3GFMA 2Y9YA 3HBLA 4DBQA 2CUJA 2PFBA 4XOTA 1NTCA 1W5CC 3PFIA 4P5OA 4ZH4F 3HOZJ 3DBHB 3E5UA 5H6RA 4PFOA 1F5TA 2FX0A 3N4MA 4M6XA 5GAEJ 1QVUA 2UWMA 2D1HA 1U9OA 2M2EA 2LMDA 5EF6A 2Z3YA 3O8GA 5HS9A 2H94A 3LQQA 2F5FA 1RUOA 3RYPA 1YIJI 2W48A 2JSPA 1QZZA 3HRTA 5K1YA 2ME0A 1X3ZB 4MLOA 2W24A 3M8FA 3OYBA 1Z05A 2YS9A 4XLFA 1R1VA 4HBLA 1XS9A 2M5WA 2LBFB 2QA4I 4KUMA 3G6EI 3CMAI 3DQVC 1HF0A 3LQRA 2A05A 1TBXA 2ZB9A 3FHZA 1PUFB 2R5ZA 3FXMA 1D5YA 2JT1A 3DXJF 2M30A 4RGXA 5CQEA 5JLWA 4EGZA 2IVMA 1IRZA 2WAFA 3BTIA 2P5KA 2H8WA 2Z99A 2L9VA 2I8DA 4UV9A 3BG3A 3ZQIA 3Q0UA 1H9GA 3J7AY 2DT5A 2K9QA 1Q1HA 2V1UA 2OU2A 5KVRA 4MTDA 2P5VA 1P6RA 2ZC2A 2E36A 4TV7A 3ECHA 2MFZA 1F9NA 2VBXA 3KEQA 4N9IA 3FM5A 3ZQ7A 5JHFA 2M0MA 4HNVA 4LIVA 1ZN2A 2AHQA 1O57A 1IV8A 3HG9A 3Q3SA 2Y9ZA 3HUGB 2F2EA 3O8HA 3TDZC 1WKMA 2IGKA 5K5QA 5D4RA 3S16J 1ZRCA 2JPBA 4E7KA 2ZXWH 2YSRA 2OTJI 3ASOH 3D5RC 3IP4B 3PUFA 4JX4A 2FBIA 2VPRA 5A2QK 1DUXC 3E6MA 3HHGA 2NRAC 5AIQA 4EM1A 4NNJA 1V3FA 3ML6A 4BACA 1S72I 1JTXA 3GTGJ 3W3CA 3HOSA 4Q4ZF 1S3JA 3SFZA 4R79A 3HKZA 1HDDC 1UMQA 3KYDB 3BCAA 5CVUA 3FX3A 1HLVA 1BJZA 4A3DJ 4CDGA 1ZRDA 2JRMA 1BC8C 2GLOA 2M4GA 4ZC3A 2E60A 4BE1A 3EUAA 1K61A 1BL0A 1TW3A 3KEYA 1FSHA 4HX8A 1MMGA 4G7OF 2KLOA 4NC7A 1G6NA 2EWNA 2O7OA 2VIXA 1KU9A 2QWWA 4ZJZA 4BY1J 5DM6F 3PO2J 2XAUA 4O5VA 2EZIA 1RIOH 5FD6A 1LVAA 4KT6A 2QZ8A 4A3BJ 4RB0A 1MBGA 1WZ2A 5BPDA 2JA6J 1WI3A 5JHUA 2W82A 1VQ4I 4BBSJ 2W57A 4IZZA 2VASA 1YITI 2EJRA 4MIMA 2BV6A 1G2HA 2HNHA 1XGSA 4FQGA 4UB8C 4F92B 5LHGA 3L09A 3PUBA 2HOSA 2XVCA 1FTZA 4A12A 2O6GE 2X1EA 2FEZA 3MKZA 3EUHC 3U9GA 2JZYA 2IXSA 3LFKA 3QPSA 2MH9A 4PZJA 1WFXA 2B7EA 1MBFA 3HB9A 5E1WA 3AKZA 2M4KA 2PN6A 1W36C 4HF2A 4L5IA 2KDOA 2JK3A 2ZFWA 1ETOA 4MFEA 2OCCH 1VQKI 1AKHB 2MD5A 1B9NA 1R49A 3L2WA 2B63J 1JGSA 1ETVA 2MC4A 3KYCB 3I0TA 1WH5A 4PK4A 4AIJA 1XC5A 2DN0A 4PJJA 1RR7A 4RAYA 1I27A 4O3MA 3CQZJ 3PQKA 2KJBA 4ANJA 1GV5A 4U7DA 3OYHA 2E19A 5KAFC 5HS8A 4AVPA 2R0QC 3HZJA 1ZLJA 4IEJA 3F6OA 2I5UA 2DXIA 3M07A 4OMYA 5H6QA 1V54H 3ZMDA 4Q5SF 1ZGWA 2IA2A 3P9IA 3HSFA 1IG7A 2V4JC 1XGNA 5EJCA 4HDUA 3WGIA 3TEDA 1B9MA 2ZBKA 3BT9A 3CMMA 1LDDA 1OR7C 4XKBA 3WHBA 1JGGA 1DP3A 3JRGA 5F6FA 5FLMJ 2KZVA 2XPWA 4OINF 2O3FA 2XF5A 3DTEA 2DOFA 1Y1VJ 4WXCA 1MBEA 3FISA 2Q8KA 5TRDA 2K3PA 3DBRB 1QHHD 2CV2A 2HEOA 3OL4A 2L9NA 3ZPLA 3HPHA 3HRSA 2OQRA 3KCCA 2UXNA 1J75A 2M3AA 2M34A 2C6YA 4UVBA 4LB5A 4IRIA 2VXDA 1D5VA 2HKXA 5EEHA 4HZFA 1B8IB 2WBMA 3HOTA 3KP4A 4MGRA 4BDYA 4L9JA 4QSHA 3I56I 4B43A 2QKLB 2WAQA 4XORA 2CJJA 5EEGA 2CU7A 2L9SA 2XGDA 4LG0B 5D5XB 3V7SA 1DPUA 2HWVA 4XIDA 1TWHJ 4I02A 2DMTA 2OJED 1IDZA 2CQNA 5E18F 3HC7A 5J3LA 1ZH5A 4XNFA 2M87A 4B09A 3RJPA 1W1WE 2OPTA 4A93J 1JUPA 4HSRA 4NQWA 3R60A 3GFLA 4M9SA 1NHAA 4H4KC 3RIRA 1W0UA 4XRFA 2F5EA 2JA7J 3S1RJ 3SXYA 4BQAA 2CUEA 5FLVA 1A5JA 2XC7A 2MA3A 1KA8A 1R7JA 2AQFA 2JSCA 1R1UA 2QYOA 4U0WA 2NNYA 1FNNA 2OZUA 4XLHA 3MAJA 4NC6A 3MKYB 3O6BB 4F55A 2XB0X 1XCBA 2K85A 1SVOA 2ZSIB 1R6RA 1SD4A 5B66C 2ZNYA 2PBIA 5HLHA 4QTRA 4CYCA 3FXLA 4OIPF 2KIUA 3DU6A 2HU9A 4ASNA 2GXGA 1E0EA 4L5JA 1MW7A 2JWTA 2DPUA 1O4XA 2LSOA 3G73A 3OIQA 3RPQA 3U1DA 1XB4A 2EV5A 2K7LA 1LDJA 3NRVA 1EH6A 4CCJA 4ZYHA 2CGPA 3K2ZA 3LAJA 5JVTA 3RCOA 1ZTRA 3G3ZA 3S3NA 1ZELA 4HG2A 4A5MA 4X1EA 3ZQGA 5D6FA 2K5CA 4M3DA 1A6IA 5E20A 2VE9A 4A6DA 3LNQA 2W85A 3PQJA 1ACIA 1HW2A 3JRCA 3IV5A 3M7GA 3PM1A 1OFCX 2KT0A 3CCQI 2HFHA 3H9QA 2DT6A 4RLQA 2LKPA 4NHJA 3EETA 5EGOA 1D8JA 1JE8A 1TZLA 1R1TA 2ZKZA 3GZNB 4OIQF 3HJEA 4XLCA 2PG4A 2YU3A 5LEKA 2FD5A 2O5RA 1V5FA 5GP9A 4P9FA 3GTOJ 1IDYA 2WB1A 3V42A 2EIMH 2DOAA 3C7JA 4Q48A 3SDGA 2OA4A 2PMZN 5BS6A 1FEXA 2HI3A 1YIOA 4EMSA 2DOEA 4DQ2A 4OMZA 3TDUC 2CMPA 4G6QA 1FLIA 3LSHA 3OWTA 2FF4A 4D0PA 4BXXJ 3GTLJ 3HSEA 3RQ4A 3SZTA 4D7NA 3CO7C 1TL8A 2W7NA 3LSJA 5E79C 1BI3A 2HQAA 2Q1ZB 2O03A 1I1GA 4EM2A 3LSIA 2WC2A 3HOVJ 4KICA 4EJVA 1S7OA 5D5UB 3BC8A 5J8CA 1UHWA 3L00A 3DPTA 4XK4A 2IJLA 4FETA 3ZMUA 4YFXF 4KFCA 4G94A 2X0LA 3HL2A 2ELJA 1X2MA 2Y0MA 4KIGA 2KISA 3OYCA 2E71A 3Q5FA 1QBJA 1SD5A 5FRNA 4A3KJ 2XPUA 1IN4A 1PP8F 3ZQHA 2CYYA 2LP0A 2MW8A 4IHXA 3S2DJ 4IHSA 2VB6A 3BTLA 4CZZA 2PI0A 2NVYJ 1QPIA 3DKWA 3SDBA 1DPRA 4MQVA 1UAAA 2N8GA 2QQ8A 1USSA 2R7QA 4ESFA 4A3MJ 1K6OA 1OJLA 2L01A 5FLXZ 3C2BA 3HSRA 2E35A 4LD5A 2VOOA 1K4TA 2RQQA 5DUKA 4Y15A 1IRGA 1EA3A 3GTJJ 2WWYA 2BE5F 4E7SA 1R9TJ 4EV0A 2FQ4A 1UHSA 2JN6A 3A4CA 1H9TA 1T98A 3AG3H 5FFZA 2M8GX 1EJ9A 1ZREA 3F8NA 2F4MB 1R22A 3TW7A 4AYBA 2DA6A 4BHBA 2HTSA 2IS1A 3TP0A 3JRFA 3L2CA 2VXZA 1HKQA 2V6CA 2Z9OA 2VUMJ 4PSXA 3TO7A 4BJ5C 2VI6A 4LMYA 2QEXI 4ESBA 3FDYA 2KDZA 2DMPA 1XCVA 3T8RA 1FIPA 3M8JA 1IXRC 3ABUA 3DLLF 1PYVA 3FMSA 4P1WA 2GOXB 3DFGA 1MMNA 2KMUA 4MEYF 2BZTA 3OIPA 2DI3A 1RKWA 4Q47A 4HEA2 2M0CA 2LC2A 3RPUA 2XROA 5KHDA 3EYYA 2KIQA 5E3MA 3M3YJ 3LA2A 3MFKA 3OY9A 3JTHA 1LKXA 1WH7A 4FE7A 3A0BC 3CCRI 3ZR8X 2AXTC 2W00A 4U0YA 2V9PA 4IPAA 4HNTA 3J80K 1LE8B 3E97A 1P4WA 1OYYA 2NNNA 1YHQI 3TP3A 4EM0B 2DYSH 2Z5UA 5DTDA 3GWZA 2HQNA 1XD7A 1DU0A 3HKZN 2STTA 5E8GA 1W7PA 3I71A 5FFXA 5E1ZB 4PJ0C 1S5LC 2D5VA 2FBKA 4M71A 4D7MA 2XGCA 1U8RA 5J40A 3BR3A 1B4AA 1FMWA 2EQRA 4PJMA 3GLLA 2CW8A 3I64A 4DBRA 5HDGA 2DFHA 2EIKH 1SVLA 3AFHA 3AL0B 3J81Z 4G9YA 2DFIA 1QRYA 4CO8A 3OR2C 4O6JA 2JA5J 4X0GA 4IRHA 2PJRB 5DS9A 2DDBA 4IJAA 2QSFX 3F9KA 4HLXA 3BLYA 1PUEE 3PJRA 4L0YB 3FK6A 4U88A 5HNFA 2RV8A 1D0ZA 1D0YA 3CDHA 4A3CJ 2V79A 1BIAA 2P6SA 5K5RA 1R58A 5JVGF 2VL8A 3ZP5A 3BG7A 4MFDA 2IGNA 2KFDA 3EDPA 1BA5A 3T0YA 2RDPA 2H1KA 5EYRA 3B6CA 1J09A 4B4CA 5ICCA 3NQOA 1VTNC 1XPXA 1T8IA 1K4SA 4GDFA 2K9SA 1RRJA 3ULQB 3DTIA 2JUGA 3BJOA 2R7UA 1UZCA 3OOUA 2DK5A 1TWGJ 1USTA 2PEXA 4DYQA 1U3EM 4GXOA 5BOXA 4MEXF 4GCVA 4A3IJ 4IHTA 3OL3A 2DTZA 3FF5A 3JAMK 1ZLKA 3KZYA 1VFCA 1RI7A 1U0JA 3F23A 2Q2EB 3AAFA 3HTSB 2L54A 3BZKA 2DA3A 3WGHA 2ZCWA 3M8EA 3TGNA 4HW0A 1W5TA 1H0MA 3RPUD 3ONQA 4LK1F 3A2KA 1WI9A 3J7YJ 4BXFA 3CCLI 3GTMJ 5EG0B 1Y8QB 1MNDA 3OYJA 2ECCA 2UXXA 2UZKA 2FQ3A 1STZA 3QOEA 2VJ4A 1ON2A 2FMYA 2COMA 1O3SA 2QUFA 1MJBA 1A35A 4DZJA 3HRUA 2LBFA 3X2QH 1KU2A 1GT0C 3B6AA 3JRDA 2W4SA 3K1PA 3ZMSA 1W7PD 4A3EJ 1K6YA 1OYWA 1LB2A 3KP5A 4ENMA 4CYDA 2QF7A 3IHUA 2L4AA 2NOJB 5D8KB 1PUFA 3H9JA 3E0JB 3WG9A 4EJTA 1P4AA 3H36A 3P5JA 2DYRH 1QVTA 3FWEA 3OYMA 3HEFA 1N77A 4S0HB 2GA1A 4HOBA 1L0OC 1UFMA 1LUJB 3KZIC 1IF1A 1D0XA 4RA2A 4XN0A 4LGWA 1B59A 2DU9A 3L2RA 3A1YA 2XAQA 3MN2A 2L0KA 2BHZA 3WTTC 1OQYA 4OAYA 4B3AA 2WV0A 5M5YJ 3FMQA 3PSFA 5IT3A 2CUZA 3J7AO 3I4MJ 1W36D 3LSPA 4XRSG 1SMYF 4E7LA 2WAQN 1NG7A 2CQQA 3HUGA 4KIFA 4OU0A 3V7CA 2XSDC 2K4JA 3BWGA 2JA8J 4WX9A 1TNSA 3H9GA 3E6BA 3GW2A 2WAEA 1I3QJ 4LG3A 2MC3A 4OOIA 3S8PA 1TC3C 2GM4A 1UG2A 3F8CA 4BQQA 1SC7A 5ICFA 2GBYA 3BR5A 3H5NA 1BN5A 4XLAA 1R4NB 4XLEA 3OSFA 4HSTA 2VKVA 4A3GJ 1VQPI 2W84A 2CW7A 1D1AA 3CUQA 3WTSC 2ETHA 3EUKL 2A69F 3F22A 3HYIA 1G4DA 3CC4I 1MD0A 2NVQJ 1ZRFA 1T39A 1Z7UA 1U2WA 1E17A 1IAWA 1X1PA 2HTJA 1TQPA 4F93B 2GQQA 1RC9A 1XGMA 2ID3A 4ZZLA 1ETKA 1GHCA 4IF4A 2XKOA 5D5VB 2E2HJ 2DPDA 5FGMA 2YUSA 2M1BA 4GO1A 3PL8A 1U5TB 2HYJA 4KN4X 4NDLA 2CFOA 5DCMB 3GFIA 2OBPA 1MJAA 4MTEA 2GIVA 1FX7A 4M3EA 2LF7A 5BPIA 4I98B 2KHMA 4AC0A 5LGTA 3RDIA 3PO3J 3MCZA 2VC1A 1FPQA 1Z6TA 4HLYA 1SFXA 3JR9A 2ACJA 1CQTA 2MLKA 2M7AA 4N0BA 2DDAA 2RN7A 2JVGA 3CZ6A 3PIOF 1XMKA 3FKIJ 2DO7A 1LFUP 3FXKA 1A36A 3FBIB 4UVCA 3T1BA 2Y31A 4U7BA 3LSKA 4BXUA 1S29A 1G8XA 3DCFA 3AL0C 1S7EA 1MDMB 2HVRA 3TQNA 4KMFA 5A2QZ 4BH9A 4DJAA 3V8LA 2IA1A 2XSJC 3NWSA 3RKYA 3ZN1A 1ZG3A 2E2JJ 1JKPC 3I4NJ 5GPCA 4FX4A 5GTIC 4Z6YA 1WQ2A 3CUQB 5LRSA 4UUSA 1FZPB 4P9UA 1FYLA 1SFUA 3COAC 1S9HA 1AKHA 3K1NA 3R0AA 2CQKA 1N78A 3QWLA 3HOWJ 1JKQC 1REPC 2OCEA 4HV6A 3CJNA 2XAHA 2NS7A 1P2FA 4BGDA 1ZAOA 1QNTA 2BGCA 1R23A 2DT7B 2PMHA 4LOCA 5HDKA 4KA4A 2YX7A 5L3BA 2I10A 2EINH 3ABTA 2CV1A 1FSEA 5F1RA 2WB1N 1SVMA 4BEHB 4X6AJ 3CP2A 3DEUA 3UKGA 2P7CB 1QHGA 3F21A 3WU0A 1UCRA 1WGXA 3FKJA 4JYKA 3NARA 4B8XA 2VT3A 3WTZA 5JR3A 3TBIA 2ADUA 4B3XA 2EFPA 1HCRA 1Y0NA 2BY0A 3HRMA 1R5ID 1HKTA 4RLFA 2LTPA 2NVUB 3QPTA 1MH4A 4M6YA 3S14J 3H1CA 1VQLI 1B6AA 1OCRH 1P92A 4BQNA 2IRFG 4D5FA 3B73A 2ESNA 2P6TA 2X85A 2RREA 5M3FJ 1QGPA 3FBNB 1I1SA 2P7VB 2LYCA 4HRIA 1E2XA 3MVPA 4OAZA 3VFZA 4UUSB 4MQ9F 1R36A 1OCZH 5F08A 4ON0A 2Z1DA 1X3WB 2JQ7A 2FNAA 2LG4A 5DEQA 3S1NJ 1WCMJ 1P7JA 5D8LB 5FKLA 1RPWA 3RTRA 4PSWA 2KKOA 1UHMA 3O2PE 2IA0A 3K9TA 1AA7A 2K40A 3J7ZI 3K69A 1B8IA 3NAUA 1G3TA 3PNTA 4GGGA 2DTRA 2EZHA 1BI0A 4XQFA 4RDUA 4J19A 4QWQA 2XASA 1XX5A 2F5CA 4LG0A 5TGTA 5BNGA 3FXRA 3MD2A 3WE2A 1XMAA 1ETWA 4PCQA 4C30A 1QA6A 1IGNA 4BAYA 1X19A 4L9NA 4LK0F 3BJ6A 4B48A 4XRSA 4FE4A 1K79A 4L5EA 2VOPA 1MNMC 2VBZA 1Z1DA 2K4BA 2B0LA 4PGHA 4BE0A 4EEFG 2EFQA 3H0GJ 3D0SA 4AYBN 2MABA 2KJCA 3CCJI 4IHYA 2RAEA 4DW6A 4N4NB 1H89C 4M3GA 1YOVB 2CRGA 2V1DA 5EZHA 1YI2I 4UXNA 4KJZA 4XMYA 2XIGA 3SHFA 2A68F 3W6JB 1HSTA 3IH4A 4R8HA 2RNJA 1MBJA 3IRQA 3G71I 4RB1A 2P81A 1O7LA 3QP6A 3T8TA 4HF1A 2VJJA 3V7RA 5HS7A 3DEEA 2HS5A 4MHGA 3I3LA 2EZLA 3U21A 3MEXA 2XF7A 3GTQJ 3HXLA 5E3LA 2WA0A 2WY7Q 2WTEA 2FA5A 1LEAA 4I7HA 3REOA 4KT5C 1JJ6C 4KIBA 5DUIA 1ZQ3P 3MWMA 3NWTA 3KEOA 1HSJA 3PFYA 2AS5F 4C2MJ 3FM3A 1K83J 3VOEA 5IT9K 1K7AA 5LBQA 3FMRA 2QSHX 3F0CA 3ZGKA 4FASD 4CSWA 2Z2SB 3K1MA 5CLSA 4I2OA 3H35A 3WTVC 2NYXA 3ZQLA 3K4BA 2ELHA 3I4PA 2TCTA 3WU2C 4K2EA 1GLNA 2RKHA 2EILH 2OAZA 1QZYA 3CESA 2ME6A 4GRIA 3S93A 5B3SH 4A3FJ 2H8RA 1SANA 1BJAA 3H3VK 3M1EA 3OR1C 2R4GA 1SEUA 4GYIA 2E1NA 2DA5A 5L3EA 3GUDA 4CA0A 1QO0D 3A0HC 5ILSA 1KZHA 2D2WA 4BHPA 1Y6IA 1V5EA 5IOYA 5LHIA 1GDTA 1B72B 2K86A 3CUQC 3IRRA 4C2UA 3QODA 3KETA 1YX5A 2EV6A 4YELA 1I3AA 3SEQA 2DBBA 2NVTJ 3L2VA 1FT9A 1CF7A 2X9DA 4RS8A 4DGWB 3C2HA 2DA7A 5J4VA 1J9IA 2R5YB 4IOAF 5J8FA 1PDNC 4L9TA 3OYEA 1WSUA 3W6VA 3BQYA 2EFNA 1P7IA 2NVXJ 1WJEA 1SD6A 3P9CA 3OIOA 1ITYA 3BPVA 1JXSA 1YS6A 3M4OJ 3QYFA 3ZQFA 1FOYA 5AIPA 4XKVA 4UNOA 1OCOH 5ICGA 1ENHA 2EPFA 1P9QC 2D1VA 2IS2A 2QVOA 1AU7A 1BR4A 4BE2A 1KGSA 1JKOC 1VNDA 2JMWA 4KISA 3GYHX 1I6HJ 2HYFA 1FBUA 4R1HA 1ON1A 1SAUA 4II3A 3F3XA 2OF7A 3IUOA 4Y17A 1NH3A 1IXCA 2HKOA 2BVLA 2Y75A 3WTXC 4ESJA 3ZMTA 1KQ9A 1YYVA 1C0WA 5CVJA 3ZN0A 1F4KA 4PUSA 4ZYEA 2EFOA 5GAHJ 2V9VA 2Z33A 5JFRA 4ZDPA 1Y39A 1RKTA 3JRBA 1PVEA 4LFUA 5M5WJ 2KIMA 2O61A 1CF7B 3KZZA 4C2TA 1Z91A 2HVQA 1FMVA 1X4PA 4LLNA 4BDZA 1MMSA 1HW1A 2W1OA 4WWCA 2GOMA 5J4YA 2IEKA 1J2XA 3K6GA 1UG0A 1E3OC 2X48A 3DPUA 2ZJ2A 1UELB 3VYSB 1YFHA 2DQLA 2GAUA 2ZJRF 3U2RA 4JOMA 3DU5A 2RNGA 3BR6A 5L3GA 5E17F 2JPCA 4D5CA 1HQCA 4YIIA 3CO6C 3KIOA 3WE3A 2ISZA 3OYNA 2X1DA 4ITVA 2QCOA 5F04A 3B02A 4XICA 1YTYA 2R7XA 5C4JJ 1N25A 2VQCA 3QP5A 1XDSA 2IBDA 1FOWA 2Y69H 4A0YA 3MZHA 1NK3P 1ZGJA 5LRRA 3HGYA 1Y1WJ 4E6KG 3AG4H 2FOKA 4QPQA 4QLCU 4M73A 5CVVA 4ZZDA 4ETSA 1WHUA 1LE8A 5ILUA 2FRHA 3ECOA 2HZTA 2NXNB 9ANTA 2DMNA 5DCFA 5GPAA 2VKDA 5EDNA 5AONA 4AWXB 2HDDA 2PJPA 2XAJA 2DAOA 1YW7A 2K27A 2IGMA 2P8TA 4UV8A 3G1OA 4W1UA 2H1LA 2GXAA 3ERMA 2L9RA 3H92A 2A3SA 4HQMA 1FIAA 5HNHA 2L3DA 4LLGF 1RUNA 4G7ZF 3LOCA 2VLAA 2LKSA 3PSIA 4KITB 4YFNF 1Z7LA 3M9AA 4D1QA 2OUMA 4XR6A 1IRXA 2DA2A 3BTCA 1TTYA 4F52A 2BYVE 5KAIC 1S8NA 3E3VA 1N75A 2M8EA 3HHHA 4IHVA 1O3QA 4UB6C 3MMYB 2PJRA 3JREA 5GAGJ 5IYCJ 4BQOA 5IYDJ 2L4MA 3ABLH 3KPHA 4BYYA 2P4WA 3T5XA 1G3YA 2Y30A 4Y52J 1BW6A 3OYLA 1APLC 1S7AA 1YLFA 1UB9A 3BG6A 1ONVA 1ZYRF 4G6DA 4XSZF 2COBA 2DA1A 1FBSA 2L7MP 2VBWA 3TO9A 2FE3A 3DTKA 3KP2A 3CC7I 1Z0XA 1QQIA 3IL2A 3N05A 2R3SA 3E1SA 3VYUB 4A5NA 1JUSA 3J80Z 2MSYA 3MZYA 3CF5F 4U0VA 2BEOA 2OZ6A 4XRMA 2H09A 4HAMA 4BL0B 2FOWA 4DNCA 4M3BA 4RAGA 1GVJA 2HXOA 4I76A 4CCMA 4IHWA 3FIWA 2MG4A 3V8JA 4S04A 1ZK8A 3LA3A 2Q2EA 1I6XA 3WTWC 1WVRA 1O3TA 5CJ9A 4CZCA 5M5XJ 4BBRJ 2IPQX 5HVQC 1KU3A 3ERED 1R5HA 3OYKA 1X4OA 3R6SA 2EH3A 1OLTA 1TLHB 1W0TA 4GFBA 3VSLA 3IH2A 3Q0WA 5L3DA 4CICA 4RB3C 3K10A 1D8KA 5EG0A 2R7ZJ 3TKYA 4CCNA 4OIOF 2X51A 4MO7A 5L3FA 3H3UA 1Z6RA 2ZXIA 2HOTA 1BBYA 2OV7A 2JTVA 4YIFA 5CYVA 1JI8A 5J47A 2DLLA 3RSNA 4WCGA 4V19K 2NAZA 3K0LA 1ZR4A 3BZ6A 3A01A 1EH8A 4AIKA 4PJLA 5FKKA 1CGPA 4EGYA 4ZTJA 3JRIA 5DD8A 4RB2C 2R7TA 2CW0F 3GO5A 3MZ8A 3VDXA 4HDVA 1YRNB 2BXZA 1YJ9I 1V55H 3HOUJ 5C44J 4I09A 3V8KA 5H20A 2X1CA 3FHNA 4M3FA 4LJZF 4P55A 1LJ9A 4ZYAA 1ZG5A 1AWCA 4LITA 2EA4A 4BNCA 1FTTA 3TOBA 2K9MA 2VT2A 4HQEA 2D45A 2KPMA 5FKMA 5EEAA 2FU4A 2F5DA 1XG1A 4DOZA 5FB2A 2Y0SA 2F4IA 1WJBA 3VODA 3WHCA 4C3JJ 2ISYA 2EBIA 3DWLE 4AD9A 4C9YA 5DDGA 4JBAA 1VQ9I 1OCCH 3DEWA 2O8KA 5LHHA 3RI4A 2R7OA 2BW3A 4UHTA 2L5QA 2QQAA 5FKNA 1BIBA 1WJ5A 5E8IA 5D4SA 3EQLF 5K7FA 1VZ0A 3C18A 1W5SA 4N9HA 3KP3A 2YU9J 2DA4A 1KYWA 3IC7A 3L2QA 1IUFA 1VI0A 3FXQA 3ZQCA 1X3UA 4IQ4A 2E7XA 3ROUA 3ZOBA 1QZEA 3A01B 2E2IJ 2NOGA 3OYDA 4A0XA 1XSVA 2X6WA 2DW4A 2GA2A 1T38A 3CMYA 3E7LA 1VF9A 3BR2A 3CJQB 4NC8A 2L7KA 5CKTA 1S6LA 3ABKH 4WXHA 4CUGA 1U5TA 1X1BA 5DCMA 5EZGA 4IVNA 3HGGA 3WTUC 1X1AA 2LK2A 3F8MA 4HV5A 4XBFA 3TL4X 3RKQA 1DGWY 3H5RA 3PIPF 2H27A 3I9V2 2XKPA 4PGGA 1BR2A 4PDKA 3S2WA 3OYFA 5H2FC 5IP6A 4A2UA 4M9XA 2CG4A 5HLIA 2M9HA 1IXSB 1WJCA 3LSMA 4HF0A 2BW3B 3D5LA 3H3ZA 1J59A 2XGXA 4ZYGA 1SFEA 2BY3A 3IWZA 2MLGA 1MDMA 2K02A 2ZNZA 4J01A 1Q1VA 2ZJQF 2R7FA 2PX9A 3HOXJ 1SD7A 5B1AH 4WXDA 2IS4A 4RM3A 4CCLA 4KYWA 3KFWX 4FT8A 1EKEA 1G59A 2V6EA 3KP6A 1Z3YA 2CQXA 3IKTA 3BOQA 1LFBA 1ODDA 3SJMA 1DGRM 1A04A 4A3JJ 3RQIA 5KCMA 3I53A 2H6CA 2FSWA 3JW4A 3JCUC 2MYSA 2HYGD 2B9SA 1X1CA 1HKSA 4BEHA 3H5AA 4YG2F 1WJAA 4II2A 2V7FA 5CVRA 5CVIA 5IP7J 4ZYDA 2FBHA 3VEPA 2LD5A 1BOAA 3VPRA 3ELKA 2DQRA 1XSXA 1W4MA 1GXQA 2ECBA 1B1BA 2A6EF 2R7SA 4E7HA 2YPRA 1ETYA 2BY2A 2FXAA 2LOOA 3S32A 2Q0OA 2ZXHA 1RETA 2E1MB 5B1BH 1LQ1A 2XAFA 3PNYA 5F0CA 1X58A 4XN3A 1OPCA 1DDNA 1HDPA 2HGCA 1RZ4A 3FXOA 3R61A 1IO2A 2FMLA 1LPQA 1D3YA 2HPIA 3SQNA 3WG7H 3C3WA 2WY8Q 4BKXA 1GUUA 4AU7A 5FKOA 3RZOJ 3F6VA 1G3SA 2EIJH 2BHYA 3SYTA 5LLQA 5LFAA 1YJWI 4BY7J 1KONA 4CCOA 2X6YA 5ILVA 2G9WA 1A31A 3I54A 5C3EJ 2VC0A 3A02A 3DPLC 4IQJA 3VSKA 2A5YB 3LSGA 4XKCA 4EATA 1OKRA 1JUMA 4CCKA 3FXUA 2R5ZB 2RVCA 3QOPA 3GLXA 4EVIA 2G7UA 1VQ7I 1R71A 2V9KA 1H88C 1WJFA 4FCYA 3K4JA 3OV8A 4L0ZB 1Y8RB 1ERDA 2R7RA 2FUG2 3BP8A 3LFUA 1D1BA 2CV0A 1TQMA 1JTYA 2GIZA 2K3FA 1I39A 2R92J 4UUVA 2VBYA 4JQFA 1MMAA 3I58A 1MJ9A 4AIDA 3WODF 1KQ8A 3I5UA 3BY6A 1BI2A 2XGEA 4IO9F 2LY2A 1QPMA 1TNTA 1MSEC 4F3QA 4OWRB 3GVAA 2J5PA 3G1LA 1BC7C 1L3LA 2LKXA 3U1KA 2STWA 2QM3A 1E3HA 2X4HA 5KK1A 4JX5A 3UR3C 3WGGA 4OIRF 1J5YA 1RNLA 3F8FA 3S17J 3A03A 4BJTA 5K5OA 2VQGA 1TWCJ 4L9VA 3W2AA 2KQRA 3ASNH 1MMDA 4YEJA 5L3CA 1LDKB 4E7JA 1F43A 1TQIA 3CCMI 1V5GA 2LFBA 3BROA 3BG5A 5J1UA 5HLTA 3TO6A 1R5GA 1IV6A 5IP9J 2DMQA 2G0EA 4AUXA 4XKWA 3CJRB 2L02A 3CF2A 3L1PA 1ETXA 3GX4X 1T6SA 2VODA 4RGSA 3QPLA 4IRGA 4Y33A 1SMTA 2TDXA 5C4XJ 2O0YA 4HX4A 1YO5C 3W2WA 2HQRA 1BM9A 4DYRA 5F64A 1IN5A 1T0FA 4HYEA 5IPAA 2PQ8A 1VQMI 4IKFA 3D1NI 3DF8A 2O8XA 3I59A 1R4MB 3W2VA 5GTHC 3K4MA 1FOKA 3S2HJ 4QIWN 1H8AC 1V4RA 2ESHA 1GVDA 5J1RA 1ZHFA 2EK5A 4BU2A 1BW5A 3FXJA 4XOPA 5IYBJ 2ZO4A 3MKLA 1I5ZA 2ZFUA 1Y56A 2R93J 5J6XA 5K7HA 1O3RA 1LNWA 2W25A 5HDNA 2RQPA 3BTJA 3IKVA 1EH7A 2E7WA 4ZTFA 1F1ZA 1LVKA 1UJ8A 1O7FA 2EB7A 2VQHA 4D9JA 4EJOA 3K70D 2IGOA 1B72A 2FJ1A 4UUTA 4U87A 3D5SC 5CPRB 2E5ZA 1OYIA 3CJTB 2CQ7A 3IWFA 5DD4A 4E7ZA 1TWAJ 1YJNI 4Y7NJ 1IUYA 2XPVA 1TW2A 3LSTA 3CDIA 4ENKA 3C1DA 2R5YA 3S3OA 2IP2A 1U78A 1NK2P 1YG2A 4F91B 3RKXA 1U5TC 3GTKJ 1Z21A 3MQ0A 3Q0VA 3BPXA 1TP4A 2PLYA 2OC6A 5ICEA 3E5XA 1GV2A 1FY7A 5IT9Z 1J7KA 2GZWA 4N4OB 5DM7F 1ETQA 4I0BA 2BOLA 4HNUA 3LSRA 2QBYA 2LY1A 2HOAA 3I59B 4ZDLA 1ZG1A 4IOCF 2ELKA 4NBQA 2Z16A 3KP7A 2WADA 2QENA 4Y4RA 4Y3OA 5DYMA 2E1MC 2IAIA 4KNYA 3K4CA 3ZQQA 5LGNA 5JLXA 4RMNA 1JKRC 4WK8F 3W6KB 4ENNA 3BG9A 2YX4A 2OQGA 4IL6C 4DIQA 1T08B 3BR1A 6PAXA 1MBHA 4JX6A 1FP1D 2A61A 4G12A 3RYRA 1X2NA 4EJUA 1SFOJ 3CCSI 3GTPJ 1XMXA 2TRTA 3LA7A 3SZPA 3G4SI 5E1XA 4Z2YA 3OSGA 3CCYA 2QKMB 2A07F 2KRHA 3HPGA 3E6DA 2XV4S 1IJWC 1K78A 3WU1B 3CLQA 1VQOI 2JA2A 2JVHA 2LREA 1QU3A 2R7VA 2XRLA 1X1DA 4XM3A 5BQTA 1T95A 3P9KA 3QYEA 3GEZA 3FK7A 4LLLA 2L7ZA 3L2UA 1OCTC 2ZMEA 3F8BA 2HDWA 1JT6A 3VB2A 4JK1X 4BS9A 5TISC 4A0ZA 4Y13A 2EZKA 3QAHA 2QBYB 2L7FP 4V2FA 2RGVA 3H0DA 1EV7A 4LIUA 5FO5A 5HODA 2AO9A 5LGUA 2HR3A 2X6OA 3ESWB 3Q9SA 3QPHA 2DODA 4BHCA 2VPLA 4M6VA 1Z3XA 3CTAA 1LEBA 1DQUA 5TJJA 2QQBA 2Y0SN 5IY5H 2FNPA 5F27A 4B47A 1YS7A 5J1YA 4ZDOA 3OS0A 3I55I 5GADJ 2K9LA 4KN7X 4NQWB 2XUBA 2OD5A 3VYRB 1M1EB 2DJIA 3E6CC 3QU3A 4CHUA 1Y0UA 5ED4A 1KU7A 4UY8I 4FHTA 3ZXSA 3VWBA 3AG1H 3LL7A 2F6CA 2LR8A 3TW6A 3UNGC 1JHFA 2G7HA 2EV0A 2YR2A 5HOOA 3OOPA 4PJNA 1K78B 2PMUA 1IN8A 2VQLA 4ABZA 2IS6A 1FYMA 2CFXA 4G8XA 4XSXF 5K7ZA 2ZXJA 1VQ5I 5F1JA 1EF4A 2K9NA 2Y2ZA 1ZR2A 1OCPA 2ZMEB 2LNBA 2M45A 3DBLB 4FX0A 1HXDA 3OYGA 4CYCB 1BI1A 3EPZA 1YW9A 3C2GA 1MGTA 2XHKA 3K70C 5BMZA 3QRFF 1Z67A 3GZ6A 3FZVA 2BBYA 3HOYJ 2QGUA 4J00A 4YFKF 1YQAA 3L7WA 2HPMA 1FJLA 1TWFJ 4JP0A 1A6QA 4IX7A 1TT5B 1G3WA 2CH0A 3V4GA 4XL9A 1AOYA 2F5VA 1HOMA 1Z77A 5IOZA 1GXPA 3GZ5A 2ZJPF 2AXLA 2JUCA 2R7WA 2P0WA 3OS2A 2V1NA 3OS1A 3DKYA 3NEUA 5CQGA 2DMUA 2EA2A 2OTLI 1KQ0A 4FTHA 2M7BA 3VYTB 1MZBA 3LWFA 1WPKA 2DJNA 4BUPA 5EGOB 3ZCOA 4I0AA 4AIHA 1DP7P 1HC8A 3K7AJ 1XGOA 2IW5A 1ZGAA 5HLGA 3IAS2 4H0EA 2RC4A 4AM3A 3O3KA 5FLXK 4GYGA 2GWRA 1Z9CA 2GXBA 2ZSHB 4NB5A 4YRVA 3PNVA 1ZARA 5JI6A 2EFWA 3OYAA 2CS3A 1TT0A 2NS0A 2QSGX 4LB6B 1T2KA 3QQAA 2V1XA 2CUFA 1LFPA 2CSOA 4RM2A 1E3PA 4CGZA 4ENJA 4B1RA 5KNLA 2MBFA 2ID6A 3QU6A 1XDUA 1PJRA 3K4KA 5ERIA 4G7HF 3RZDJ 1XSDA 5M3MJ 1IC8A 3GCMA 1T0FC 2E1CA 2KRFA 3ISPA 2LRDA 3M1CA 2QQ9A 1T33A 3DKXA 2E5NA 3CCEI 2HVSA 2HDCA 4KMUX 4NUBA 5E3NA 3DV8A 5LEJA 2DFEA 2VKEA 2Y48A 1D1CA 3JSPA 3OMYA 2ICWG 1POGA 4M72A 3HM5A 3BDDA 2MD0A 2VN2A 1MBKA 4PFPA 2E34A 4EJWA 3ZMVA 3S1QJ 4RGUA 3CP8A 1IRFA 2HOEA 2AQEA 4IXAA 4B44A 2LDUA 3KLNA 2XDVA 1YRNA 2VJIA 2CWEA 4BJ6C 4E4HA 2JRTA 2HZDA 4E7IA 2VONA 3S1MJ 3G2BA 3OYIA 2XAGA 1KYZA 3CCUI 1BR1A 2BVMA 5D6EA 5B5EC 2HXIA 5FJ8J 3S3MA 1SFKA 3LAPA 1BOBA 3GF2A 4RAZA 2F4OB 3KLOA 1HA8A 3JTGA 4EQQA 4S05A 2CO5A 1RR8C 2LH9A 1J0RA 1OISA 2BXYA 3ABMH 5D5WB 5FRMA 1AHDP 3N97A 1FYKA 4A6EA 3CMEI 3CUOA 4XLNF 1P4XA 1MNEA 1XTAA 1JJ8C 3TMOA 3K2AA 1IN7A 3S15J 4A69C 1HW5A 4RAFA 1MKMA 4C3HJ 1IN6A 2NS8A 4HA8A 3AG2H 4V2GA 3K4LA 1IZ1A 4HPQA 3J81K 3IAM2 3EYIA 2DFFA 4CXFA 2HQ5A 2VJ5A 3JSOA 1ULYA 2A6HF 1NG6A 1SAXA 3QYBA 3CLOA 3EUHA 1HBXG 1RESA 3P7NA 2A6TA 3G1MA 4DYCA 3MKWB 1DU6A 3E5QA 4G6TB 5DV5A 2UUZA 3ZRGA 1FWZA 1YW8A 2KRCA 3JRAA 3KX2A 1YX3A 3DLAA 1ORKA 3KE2A 2X6XA 2DK8A 3HTUA 5E3OA 2DCEA 2VE8A 1XN7A 2O9LA 5F0FA 3CDLA 1VQNI 3SZGA 3JRHA 2VKHA 3SFIA 3JAMZ 2F48A 5FD5A 3CC2I 4HX7A 5LD2C 2IT0A 4MNUA 4WF2A 1FOXA 2QLZA 3IH3A 1W7PB 3ZMZA 2LY9A 3BCBA 2ZMEC 2BY1A 2XRNA 2MH2A 4KDPA 3LMMA 1FP2A 1MH3A 2LVSA 3GBGA 2LF8A 4AVZA 4I01A 2A5WA 4I6ZA 1YE9A 3WTYC 1PP7U 4F7ZA 3CD6I 2XF6A 4RGRA 1OMIA 4A3LJ 5FROA 3GMEA 1T56A 4XLPF 3K4NA 4YIRX 1IW7F 1JHHA 2WV1A 3BQZA 1VQ8I 3R4KA 1F36A 1OR7A 2E1OA 1WRJA 2JJ7A 4L18B 4FISA 2LLKA 2J5OA 4XONA 5F0HA 2MGQA 4W97A 1FBQA 1U6GA 3GXOA 4QPOA 3BZCA 2KL4A
chains in the Genus database with same CATH topology
4P96A 3F72A 3BJAA 3TOAA 3HIFA 4M9ZA 3L9FA 1FC3A 3R0JA 2R7DA 4E70A 2H6BA 2P5LC 2KIFA 1WWXA 3Q9VA 3DP7A 4M74A 1R00A 3RKWA 4UVAA 3GFJA 3GFMA 2PFBA 3PFIA 4P5OA 4ZH4F 3E5UA 5H6RA 1F5TA 3N4MA 4M6XA 2UWMA 2D1HA 2Z3YA 5HS9A 2H94A 3LQQA 2F5FA 1RUOA 3RYPA 1QZZA 3HRTA 5K1YA 2W24A 3M8FA 1Z05A 1R1VA 4HBLA 2M5WA 4KUMA 3DQVC 3LQRA 1TBXA 3FHZA 2JT1A 3DXJF 2M30A 4RGXA 4EGZA 2IVMA 2P5KA 2Z99A 4UV9A 1H9GA 2DT5A 1Q1HA 2V1UA 2OU2A 5KVRA 4MTDA 2P5VA 1P6RA 4TV7A 3ECHA 1F9NA 2VBXA 3KEQA 4N9IA 3FM5A 3ZQ7A 1ZN2A 1O57A 2F2EA 3TDZC 1WKMA 5K5QA 5D4RA 1ZRCA 2JPBA 2YSRA 2FBIA 5A2QK 1DUXC 3E6MA 3HHGA 2NRAC 5AIQA 4EM1A 1V3FA 3ML6A 3HOSA 4Q4ZF 1S3JA 3SFZA 4R79A 5CVUA 3FX3A 4CDGA 1ZRDA 1BC8C 1TW3A 1FSHA 4HX8A 4G7OF 1G6NA 2EWNA 1KU9A 2QWWA 4O5VA 1RIOH 5FD6A 1LVAA 2QZ8A 4RB0A 5BPDA 5JHUA 2W57A 2EJRA 2BV6A 1XGSA 5LHGA 3L09A 2XVCA 4A12A 2O6GE 2FEZA 3U9GA 2JZYA 3LFKA 2MH9A 4PZJA 5E1WA 2PN6A 4HF2A 4L5IA 2ZFWA 2MD5A 1B9NA 1JGSA 3I0TA 4AIJA 4RAYA 1I27A 4O3MA 3PQKA 2KJBA 4U7DA 5HS8A 4AVPA 1ZLJA 3F6OA 4OMYA 5H6QA 3ZMDA 4Q5SF 2IA2A 3P9IA 3HSFA 1XGNA 4HDUA 3WGIA 1B9MA 2ZBKA 1LDDA 5F6FA 4OINF 2O3FA 4WXCA 5TRDA 2HEOA 2Q8KA 3ZPLA 3HRSA 2OQRA 3KCCA 2UXNA 1J75A 2C6YA 4UVBA 4LB5A 4IRIA 1D5VA 2HKXA 5EEHA 4HZFA 3HOTA 3KP4A 4MGRA 4L9JA 5EEGA 1DPUA 4LG0B 5D5XB 3V7SA 2HWVA 4I02A 5E18F 1ZH5A 2M87A 4B09A 3RJPA 4NQWA 3R60A 3GFLA 4M9SA 1NHAA 3RIRA 4XRFA 2F5EA 3SXYA 4BQAA 2MA3A 1KA8A 1R7JA 2JSCA 1R1UA 2QYOA 4U0WA 2NNYA 1FNNA 2OZUA 3MAJA 3O6BB 1XCBA 1SD4A 2ZNYA 2PBIA 5HLHA 4OIPF 2KIUA 4ASNA 2GXGA 4L5JA 2DPUA 2LSOA 3G73A 3RPQA 3U1DA 1XB4A 2EV5A 2K7LA 1LDJA 3NRVA 1EH6A 4ZYHA 2CGPA 3K2ZA 3LAJA 5JVTA 3G3ZA 4A5MA 5D6FA 5E20A 2VE9A 4A6DA 2W85A 3PQJA 1HW2A 3M7GA 2HFHA 2LKPA 4NHJA 3EETA 1D8JA 1JE8A 1R1TA 2ZKZA 4OIQF 2PG4A 2YU3A 5LEKA 4P9FA 3C7JA 4Q48A 2OA4A 5BS6A 1YIOA 4EMSA 4DQ2A 4OMZA 3TDUC 4G6QA 1FLIA 2FF4A 4D0PA 3HSEA 3SZTA 3CO7C 1BI3A 2O03A 1I1GA 4EM2A 2WC2A 4KICA 4EJVA 1S7OA 5D5UB 5J8CA 1UHWA 3L00A 3DPTA 2IJLA 3ZMUA 4YFXF 4KFCA 4G94A 2X0LA 2Y0MA 4KIGA 1QBJA 3Q5FA 1SD5A 1IN4A 1PP8F 2CYYA 4IHSA 2PI0A 4CZZA 3DKWA 1DPRA 4MQVA 1USSA 4ESFA 1K6OA 2L01A 5FLXZ 3HSRA 4LD5A 2VOOA 5DUKA 4Y15A 1IRGA 2WWYA 2BE5F 4EV0A 1H9TA 1T98A 5FFZA 1ZREA 3F8NA 1R22A 4BHBA 2HTSA 3L2CA 2VXZA 1HKQA 2V6CA 2Z9OA 3TO7A 4LMYA 4ESBA 1XCVA 3T8RA 1IXRC 3ABUA 3FMSA 3DFGA 4MEYF 2DI3A 4Q47A 3RPUA 2XROA 3EYYA 3LA2A 3MFKA 3JTHA 4U0YA 4IPAA 3J80K 3E97A 1P4WA 1OYYA 2NNNA 4EM0B 2Z5UA 3GWZA 2HQNA 1XD7A 2STTA 5E8GA 1W7PA 3I71A 5E1ZB 2FBKA 4M71A 1U8RA 1B4AA 3I64A 5HDGA 3J81Z 4G9YA 2DFIA 4CO8A 4O6JA 4IRHA 4IJAA 4HLXA 1PUEE 4L0YB 4U88A 2RV8A 3CDHA 2V79A 1BIAA 2P6SA 5K5RA 1R58A 3ZP5A 3EDPA 3T0YA 2RDPA 1VTNC 5ICCA 3NQOA 3ULQB 3BJOA 2DK5A 1USTA 2PEXA 1U3EM 4GXOA 5BOXA 4MEXF 4GCVA 4IHTA 3FF5A 3JAMK 1ZLKA 3KZYA 1RI7A 3F23A 3AAFA 3HTSB 2L54A 3WGHA 2ZCWA 3M8EA 3TGNA 4HW0A 1W5TA 1H0MA 4LK1F 1WI9A 2UXXA 2UZKA 2FQ3A 1STZA 1ON2A 2FMYA 2COMA 1O3SA 2QUFA 1MJBA 3HRUA 1KU2A 3K1PA 3ZMSA 1W7PD 1OYWA 1LB2A 3KP5A 4ENMA 4CYDA 3IHUA 2L4AA 5D8KB 3WG9A 4EJTA 1P4AA 3FWEA 2GA1A 4HOBA 1L0OC 1UFMA 1IF1A 4LGWA 1B59A 2DU9A 2XAQA 3WTTC 2WV0A 3FMQA 5IT3A 3J7AO 1SMYF 3V7CA 4KIFA 4OU0A 3HUGA 2K4JA 3BWGA 4WX9A 1TNSA 3E6BA 3GW2A 2MC3A 4OOIA 3F8CA 5ICFA 1BN5A 2W84A 3WTSC 3CUQA 2ETHA 2A69F 3F22A 3HYIA 1G4DA 1MD0A 1ZRFA 1T39A 1Z7UA 1U2WA 1E17A 1IAWA 2HTJA 1TQPA 2GQQA 1GHCA 1XGMA 4ZZLA 4IF4A 2XKOA 5D5VB 2DPDA 5FGMA 2M1BA 4GO1A 1U5TB 3GFIA 4KN4X 5DCMB 2OBPA 1MJAA 4MTEA 2GIVA 1FX7A 5BPIA 2LF7A 4I98B 5LGTA 3RDIA 3MCZA 2VC1A 1FPQA 1Z6TA 4HLYA 1SFXA 2ACJA 2MLKA 4N0BA 2RN7A 1XMKA 2DO7A 4UVCA 3T1BA 4U7BA 4BXUA 1S29A 1MDMB 3TQNA 4KMFA 5A2QZ 4BH9A 3V8LA 2IA1A 3RKYA 3ZN1A 1ZG3A 4FX4A 1WQ2A 3CUQB 5LRSA 1FZPB 4P9UA 1FYLA 1SFUA 3COAC 3K1NA 3R0AA 2CQKA 1REPC 4HV6A 3CJNA 2XAHA 1P2FA 1ZAOA 1QNTA 2BGCA 1R23A 5HDKA 2PMHA 4KA4A 2YX7A 5L3BA 3ABTA 1FSEA 5F1RA 3DEUA 2P7CB 3F21A 3WU0A 1UCRA 4B8XA 2VT3A 3WTZA 5JR3A 2ADUA 2EFPA 3HRMA 1HKTA 3QPTA 4M6YA 1B6AA 1P92A 2IRFG 3B73A 2ESNA 2P6TA 1QGPA 1I1SA 2P7VB 1E2XA 3VFZA 4MQ9F 1R36A 4ON0A 2FNAA 5DEQA 5D8LB 3RTRA 2KKOA 1UHMA 3O2PE 2IA0A 3K9TA 3K69A 1G3TA 4GGGA 2DTRA 1BI0A 4QWQA 2XASA 2F5CA 4LG0A 3FXRA 3WE2A 1XMAA 4PCQA 4BAYA 4L9NA 4LK0F 3BJ6A 1K79A 2VOPA 2VBZA 1Z1DA 2K4BA 2B0LA 4PGHA 2EFQA 3D0SA 2KJCA 2V1DA 4UXNA 3W6JB 2XIGA 3SHFA 2A68F 1HSTA 4R8HA 2RNJA 3IRQA 4RB1A 1O7LA 3QP6A 3T8TA 4HF1A 3V7RA 5HS7A 2HS5A 4MHGA 3MEXA 2WTEA 2FA5A 1LEAA 4I7HA 3REOA 4KT5C 4KIBA 5DUIA 3MWMA 3KEOA 1HSJA 2AS5F 3FM3A 3VOEA 5IT9K 1K7AA 5LBQA 3FMRA 3K1MA 5CLSA 4I2OA 3WTVC 2NYXA 2ELHA 3I4PA 4K2EA 2RKHA 2OAZA 1QZYA 3M1EA 4GYIA 2E1NA 5L3EA 3GUDA 1QO0D 5ILSA 2D2WA 4BHPA 5LHIA 2K86A 3CUQC 3IRRA 3KETA 2EV6A 2DBBA 1FT9A 1CF7A 4RS8A 1J9IA 5J8FA 1PDNC 4L9TA 1WSUA 2EFNA 1SD6A 3P9CA 3BPVA 1JXSA 1YS6A 5AIPA 4UNOA 5ICGA 2D1VA 2QVOA 1KGSA 3GYHX 2HYFA 1FBUA 4R1HA 1ON1A 3F3XA 4Y17A 1IXCA 2HKOA 2Y75A 3WTXC 4ESJA 3ZMTA 1KQ9A 1YYVA 1C0WA 5CVJA 3ZN0A 1F4KA 4ZYEA 2EFOA 2V9VA 2Z33A 5JFRA 4LFUA 2KIMA 2O61A 1CF7B 3KZZA 1Z91A 4LLNA 1HW1A 4WWCA 1J2XA 2ZJ2A 1YFHA 2DQLA 2GAUA 3U2RA 5L3GA 5E17F 2JPCA 1HQCA 4YIIA 3CO6C 3WE3A 2ISZA 1YTYA 3B02A 3QP5A 1XDSA 4A0YA 3MZHA 1ZGJA 5LRRA 2FOKA 4QLCU 4M73A 5CVVA 4ZZDA 4ETSA 5ILUA 2FRHA 3ECOA 2HZTA 5DCFA 5AONA 4AWXB 2PJPA 2XAJA 2DAOA 1YW7A 2K27A 2P8TA 4UV8A 3H92A 2A3SA 4HQMA 2L3DA 4LLGF 1RUNA 4G7ZF 4YFNF 3M9AA 1TTYA 2BYVE 1S8NA 3E3VA 2M8EA 3HHHA 1O3QA 2L4MA 4BYYA 2P4WA 3T5XA 1G3YA 1S7AA 1YLFA 1UB9A 4XSZF 1ONVA 1ZYRF 4G6DA 1FBSA 2VBWA 3TO9A 2FE3A 3KP2A 1QQIA 3IL2A 2R3SA 4A5NA 3J80Z 3MZYA 4U0VA 2BEOA 2OZ6A 2H09A 4HAMA 4DNCA 1GVJA 3V8JA 4S04A 3LA3A 2Q2EA 1I6XA 3WTWC 1O3TA 5CJ9A 5HVQC 2IPQX 3ERED 1KU3A 1R5HA 3R6SA 1TLHB 5L3DA 4CICA 4RB3C 1D8KA 3TKYA 4OIOF 5L3FA 3H3UA 1Z6RA 1BBYA 2JTVA 4YIFA 5CYVA 2DLLA 4WCGA 2NAZA 3K0LA 3BZ6A 1EH8A 4AIKA 1CGPA 4EGYA 5DD8A 4RB2C 2CW0F 3GO5A 4HDVA 4I09A 3V8KA 5H20A 4LJZF 4P55A 1LJ9A 1ZG5A 1AWCA 2EA4A 4BNCA 3TOBA 2VT2A 4HQEA 2D45A 2FU4A 2F5DA 5FB2A 3VODA 2ISYA 4AD9A 5DDGA 4JBAA 5LHHA 3RI4A 4UHTA 2QQAA 1BIBA 5E8IA 5D4SA 3EQLF 3C18A 1W5SA 4N9HA 3KP3A 1KYWA 3IC7A 3FXQA 1X3UA 2E7XA 3ROUA 4A0XA 1XSVA 2DW4A 2GA2A 1T38A 1S6LA 4WXHA 1U5TA 5DCMA 4IVNA 3WTUC 3F8MA 4HV5A 4XBFA 2H27A 2XKPA 4PGGA 4PDKA 3S2WA 4A2UA 4M9XA 2CG4A 5HLIA 1IXSB 4HF0A 3D5LA 3H3ZA 1J59A 2XGXA 4ZYGA 1SFEA 3IWZA 2MLGA 1MDMA 2K02A 2ZNZA 2R7FA 1SD7A 4WXDA 4KYWA 3KFWX 4FT8A 3KP6A 3IKTA 3BOQA 1ODDA 1A04A 3I53A 2H6CA 2FSWA 3JW4A 2HYGD 1HKSA 4YG2F 5CVRA 5CVIA 4ZYDA 2FBHA 3VEPA 1BOAA 3ELKA 2DQRA 1XSXA 1W4MA 1GXQA 1B1BA 2A6EF 2YPRA 2FXAA 2Q0OA 1LQ1A 2XAFA 1OPCA 1DDNA 3R61A 2HGCA 1RZ4A 2FMLA 1D3YA 3SQNA 3C3WA 3F6VA 1G3SA 5LLQA 5ILVA 2G9WA 3I54A 2VC0A 3DPLC 2A5YB 1OKRA 3FXUA 2RVCA 3QOPA 3GLXA 4EVIA 2G7UA 3OV8A 4L0ZB 3BP8A 1TQMA 4UUVA 2VBYA 4JQFA 3I58A 1MJ9A 3WODF 1KQ8A 3I5UA 3BY6A 1BI2A 1QPMA 1TNTA 3GVAA 2J5PA 1BC7C 1L3LA 2STWA 2QM3A 2X4HA 5KK1A 3WGGA 4OIRF 1J5YA 1RNLA 3F8FA 5K5OA 4L9VA 5L3CA 1LDKB 1TQIA 3BROA 3TO6A 1R5GA 2L02A 3GX4X 1T6SA 2VODA 4RGSA 4IRGA 1SMTA 2TDXA 2O0YA 4HX4A 1YO5C 2HQRA 1BM9A 5F64A 1IN5A 1T0FA 4HYEA 2PQ8A 3DF8A 2O8XA 3I59A 1FOKA 1V4RA 2ESHA 1ZHFA 2EK5A 2ZO4A 1I5ZA 5J6XA 1O3RA 1LNWA 2W25A 5HDNA 2RQPA 3IKVA 1EH7A 2E7WA 4EJOA 1F1ZA 1O7FA 2EB7A 1OYIA 5DD4A 3IWFA 1IUYA 1TW2A 3LSTA 4ENKA 3C1DA 2IP2A 1U78A 1YG2A 3RKXA 1U5TC 3MQ0A 3BPXA 2PLYA 5ICEA 3E5XA 1FY7A 5IT9Z 1J7KA 2GZWA 4I0BA 2QBYA 3I59B 1ZG1A 3KP7A 2QENA 5DYMA 4KNYA 5LGNA 4WK8F 3W6KB 4ENNA 2YX4A 2OQGA 6PAXA 1FP1D 2A61A 3RYRA 4EJUA 3LA7A 3SZPA 5E1XA 4Z2YA 2A07F 3E6DA 2XV4S 1K78A 3WU1B 5BQTA 3P9KA 3GEZA 4LLLA 2ZMEA 3F8BA 3VB2A 4JK1X 4A0ZA 4Y13A 3QAHA 2QBYB 2RGVA 1EV7A 5FO5A 5LGUA 2HR3A 3Q9SA 3QPHA 4BHCA 3CTAA 1LEBA 5TJJA 2QQBA 2FNPA 1YS7A 4KN7X 2XUBA 2OD5A 3E6CC 3QU3A 4CHUA 1Y0UA 5ED4A 1KU7A 4FHTA 1JHFA 2G7HA 2EV0A 5HOOA 2YR2A 3OOPA 1K78B 2PMUA 1IN8A 1FYMA 2CFXA 4G8XA 4XSXF 2ZXJA 2ZMEB 2LNBA 2M45A 4FX0A 1HXDA 1BI1A 1YW9A 1MGTA 2XHKA 5BMZA 3QRFF 3GZ6A 3FZVA 2BBYA 4YFKF 1YQAA 3L7WA 1G3WA 3V4GA 1AOYA 1GXPA 3GZ5A 2AXLA 3NEUA 2EA2A 1KQ0A 1MZBA 3LWFA 4I0AA 4AIHA 1DP7P 1XGOA 2IW5A 1ZGAA 5HLGA 4H0EA 2RC4A 3O3KA 5FLXK 4GYGA 2GWRA 1Z9CA 2GXBA 4NB5A 1ZARA 5JI6A 2EFWA 2NS0A 4LB6B 1T2KA 2V1XA 4CGZA 2CSOA 4ENJA 2MBFA 3QU6A 1XDUA 5ERIA 4G7HF 1XSDA 2E1CA 2KRFA 3ISPA 2QQ9A 2HDCA 4KMUX 3DV8A 5LEJA 2Y48A 3JSPA 4M72A 3BDDA 2VN2A 4EJWA 3ZMVA 4RGUA 1IRFA 2HOEA 4IXAA 2LDUA 3KLNA 2CWEA 2JRTA 2VONA 2XAGA 1KYZA 5D6EA 3LAPA 3GF2A 4RAZA 3KLOA 3JTGA 4EQQA 4S05A 2CO5A 1J0RA 5D5WB 3N97A 1FYKA 4A6EA 3CUOA 4XLNF 1P4XA 1IN7A 1HW5A 1MKMA 1IN6A 4HA8A 1IZ1A 3J81K 3EYIA 4CXFA 3JSOA 1ULYA 2A6HF 1SAXA 3CLOA 3EUHA 1HBXG 3P7NA 3E5QA 5DV5A 1FWZA 1YW8A 3KE2A 2DK8A 3HTUA 2VE8A 1XN7A 3JAMZ 5FD5A 4HX7A 2IT0A 4MNUA 4WF2A 2QLZA 1W7PB 3ZMZA 2XRNA 2MH2A 4KDPA 1FP2A 2LF8A 4I01A 3WTYC 1PP7U 4F7ZA 4RGRA 1OMIA 4XLPF 1IW7F 1JHHA 3R4KA 1OR7A 1WRJA 4L18B 2J5OA 1FBQA 1U6GA 3GXOA 1BJAA 5FFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P96 A;  3F72 A;  3BJA A;  3TOA A;  3HIF A;  4M9Z A;  3L9F A;  1FC3 A;  3R0J A;  2R7D A;  4E70 A;  2H6B A;  2P5L C;  2KIF A;  1WWX A;  3Q9V A;  3DP7 A;  4M74 A;  1R00 A;  3RKW A;  4UVA A;  3GFJ A;  3GFM A;  2PFB A;  3PFI A;  4P5O A;  4ZH4 F;  3E5U A;  5H6R A;  1F5T A;  3N4M A;  4M6X A;  2UWM A;  2D1H A;  2Z3Y A;  5HS9 A;  2H94 A;  3LQQ A;  2F5F A;  1RUO A;  3RYP A;  1QZZ A;  3HRT A;  5K1Y A;  2W24 A;  3M8F A;  1Z05 A;  1R1V A;  4HBL A;  2M5W A;  4KUM A;  3DQV C;  3LQR A;  1TBX A;  3FHZ A;  2JT1 A;  3DXJ F;  2M30 A;  4RGX A;  4EGZ A;  2IVM A;  2P5K A;  2Z99 A;  4UV9 A;  1H9G A;  2DT5 A;  1Q1H A;  2V1U A;  2OU2 A;  5KVR A;  4MTD A;  2P5V A;  1P6R A;  4TV7 A;  3ECH A;  1F9N A;  2VBX A;  3KEQ A;  4N9I A;  3FM5 A;  3ZQ7 A;  1ZN2 A;  1O57 A;  2F2E A;  3TDZ C;  1WKM A;  5K5Q A;  5D4R A;  1ZRC A;  2JPB A;  2YSR A;  2FBI A;  5A2Q K;  1DUX C;  3E6M A;  3HHG A;  2NRA C;  5AIQ A;  4EM1 A;  1V3F A;  3ML6 A;  3HOS A;  4Q4Z F;  1S3J A;  3SFZ A;  4R79 A;  5CVU A;  3FX3 A;  4CDG A;  1ZRD A;  1BC8 C;  1TW3 A;  1FSH A;  4HX8 A;  4G7O F;  1G6N A;  2EWN A;  1KU9 A;  2QWW A;  4O5V A;  1RIO H;  5FD6 A;  1LVA A;  2QZ8 A;  4RB0 A;  5BPD A;  5JHU A;  2W57 A;  2EJR A;  2BV6 A;  1XGS A;  5LHG A;  3L09 A;  2XVC A;  4A12 A;  2O6G E;  2FEZ A;  3U9G A;  2JZY A;  3LFK A;  2MH9 A;  4PZJ A;  5E1W A;  2PN6 A;  4HF2 A;  4L5I A;  2ZFW A;  2MD5 A;  1B9N A;  1JGS A;  3I0T A;  4AIJ A;  4RAY A;  1I27 A;  4O3M A;  3PQK A;  2KJB A;  4U7D A;  5HS8 A;  4AVP A;  1ZLJ A;  3F6O A;  4OMY A;  5H6Q A;  3ZMD A;  4Q5S F;  2IA2 A;  3P9I A;  3HSF A;  1XGN A;  4HDU A;  3WGI A;  1B9M A;  2ZBK A;  1LDD A;  5F6F A;  4OIN F;  2O3F A;  4WXC A;  5TRD A;  2HEO A;  2Q8K A;  3ZPL A;  3HRS A;  2OQR A;  3KCC A;  2UXN A;  1J75 A;  2C6Y A;  4UVB A;  4LB5 A;  4IRI A;  1D5V A;  2HKX A;  5EEH A;  4HZF A;  3HOT A;  3KP4 A;  4MGR A;  4L9J A;  5EEG A;  1DPU A;  4LG0 B;  5D5X B;  3V7S A;  2HWV A;  4I02 A;  5E18 F;  1ZH5 A;  2M87 A;  4B09 A;  3RJP A;  4NQW A;  3R60 A;  3GFL A;  4M9S A;  1NHA A;  3RIR A;  4XRF A;  2F5E A;  3SXY A;  4BQA A;  2MA3 A;  1KA8 A;  1R7J A;  2JSC A;  1R1U A;  2QYO A;  4U0W A;  2NNY A;  1FNN A;  2OZU A;  3MAJ A;  3O6B B;  1XCB A;  1SD4 A;  2ZNY A;  2PBI A;  5HLH A;  4OIP F;  2KIU A;  4ASN A;  2GXG A;  4L5J A;  2DPU A;  2LSO A;  3G73 A;  3RPQ A;  3U1D A;  1XB4 A;  2EV5 A;  2K7L A;  1LDJ A;  3NRV A;  1EH6 A;  4ZYH A;  2CGP A;  3K2Z A;  3LAJ A;  5JVT A;  3G3Z A;  4A5M A;  5D6F A;  5E20 A;  2VE9 A;  4A6D A;  2W85 A;  3PQJ A;  1HW2 A;  3M7G A;  2HFH A;  2LKP A;  4NHJ A;  3EET A;  1D8J A;  1JE8 A;  1R1T A;  2ZKZ A;  4OIQ F;  2PG4 A;  2YU3 A;  5LEK A;  4P9F A;  3C7J A;  4Q48 A;  2OA4 A;  5BS6 A;  1YIO A;  4EMS A;  4DQ2 A;  4OMZ A;  3TDU C;  4G6Q A;  1FLI A;  2FF4 A;  4D0P A;  3HSE A;  3SZT A;  3CO7 C;  1BI3 A;  2O03 A;  1I1G A;  4EM2 A;  2WC2 A;  4KIC A;  4EJV A;  1S7O A;  5D5U B;  5J8C A;  1UHW A;  3L00 A;  3DPT A;  2IJL A;  3ZMU A;  4YFX F;  4KFC A;  4G94 A;  2X0L A;  2Y0M A;  4KIG A;  1QBJ A;  3Q5F A;  1SD5 A;  1IN4 A;  1PP8 F;  2CYY A;  4IHS A;  2PI0 A;  4CZZ A;  3DKW A;  1DPR A;  4MQV A;  1USS A;  4ESF A;  1K6O A;  2L01 A;  5FLX Z;  3HSR A;  4LD5 A;  2VOO A;  5DUK A;  4Y15 A;  1IRG A;  2WWY A;  2BE5 F;  4EV0 A;  1H9T A;  1T98 A;  5FFZ A;  1ZRE A;  3F8N A;  1R22 A;  4BHB A;  2HTS A;  3L2C A;  2VXZ A;  1HKQ A;  2V6C A;  2Z9O A;  3TO7 A;  4LMY A;  4ESB A;  1XCV A;  3T8R A;  1IXR C;  3ABU A;  3FMS A;  3DFG A;  4MEY F;  2DI3 A;  4Q47 A;  3RPU A;  2XRO A;  3EYY A;  3LA2 A;  3MFK A;  3JTH A;  4U0Y A;  4IPA A;  3J80 K;  3E97 A;  1P4W A;  1OYY A;  2NNN A;  4EM0 B;  2Z5U A;  3GWZ A;  2HQN A;  1XD7 A;  2STT A;  5E8G A;  1W7P A;  3I71 A;  5E1Z B;  2FBK A;  4M71 A;  1U8R A;  1B4A A;  3I64 A;  5HDG A;  3J81 Z;  4G9Y A;  2DFI A;  4CO8 A;  4O6J A;  4IRH A;  4IJA A;  4HLX A;  1PUE E;  4L0Y B;  4U88 A;  2RV8 A;  3CDH A;  2V79 A;  1BIA A;  2P6S A;  5K5R A;  1R58 A;  3ZP5 A;  3EDP A;  3T0Y A;  2RDP A;  1VTN C;  5ICC A;  3NQO A;  3ULQ B;  3BJO A;  2DK5 A;  1UST A;  2PEX A;  1U3E M;  4GXO A;  5BOX A;  4MEX F;  4GCV A;  4IHT A;  3FF5 A;  3JAM K;  1ZLK A;  3KZY A;  1RI7 A;  3F23 A;  3AAF A;  3HTS B;  2L54 A;  3WGH A;  2ZCW A;  3M8E A;  3TGN A;  4HW0 A;  1W5T A;  1H0M A;  4LK1 F;  1WI9 A;  2UXX A;  2UZK A;  2FQ3 A;  1STZ A;  1ON2 A;  2FMY A;  2COM A;  1O3S A;  2QUF A;  1MJB A;  3HRU A;  1KU2 A;  3K1P A;  3ZMS A;  1W7P D;  1OYW A;  1LB2 A;  3KP5 A;  4ENM A;  4CYD A;  3IHU A;  2L4A A;  5D8K B;  3WG9 A;  4EJT A;  1P4A A;  3FWE A;  2GA1 A;  4HOB A;  1L0O C;  1UFM A;  1IF1 A;  4LGW A;  1B59 A;  2DU9 A;  2XAQ A;  3WTT C;  2WV0 A;  3FMQ A;  5IT3 A;  3J7A O;  1SMY F;  3V7C A;  4KIF A;  4OU0 A;  3HUG A;  2K4J A;  3BWG A;  4WX9 A;  1TNS A;  3E6B A;  3GW2 A;  2MC3 A;  4OOI A;  3F8C A;  5ICF A;  1BN5 A;  2W84 A;  3WTS C;  3CUQ A;  2ETH A;  2A69 F;  3F22 A;  3HYI A;  1G4D A;  1MD0 A;  1ZRF A;  1T39 A;  1Z7U A;  1U2W A;  1E17 A;  1IAW A;  2HTJ A;  1TQP A;  2GQQ A;  1GHC A;  1XGM A;  4ZZL A;  4IF4 A;  2XKO A;  5D5V B;  2DPD A;  5FGM A;  2M1B A;  4GO1 A;  1U5T B;  3GFI A;  4KN4 X;  5DCM B;  2OBP A;  1MJA A;  4MTE A;  2GIV A;  1FX7 A;  5BPI A;  2LF7 A;  4I98 B;  5LGT A;  3RDI A;  3MCZ A;  2VC1 A;  1FPQ A;  1Z6T A;  4HLY A;  1SFX A;  2ACJ A;  2MLK A;  4N0B A;  2RN7 A;  1XMK A;  2DO7 A;  4UVC A;  3T1B A;  4U7B A;  4BXU A;  1S29 A;  1MDM B;  3TQN A;  4KMF A;  5A2Q Z;  4BH9 A;  3V8L A;  2IA1 A;  3RKY A;  3ZN1 A;  1ZG3 A;  4FX4 A;  1WQ2 A;  3CUQ B;  5LRS A;  1FZP B;  4P9U A;  1FYL A;  1SFU A;  3COA C;  3K1N A;  3R0A A;  2CQK A;  1REP C;  4HV6 A;  3CJN A;  2XAH A;  1P2F A;  1ZAO A;  1QNT A;  2BGC A;  1R23 A;  5HDK A;  2PMH A;  4KA4 A;  2YX7 A;  5L3B A;  3ABT A;  1FSE A;  5F1R A;  3DEU A;  2P7C B;  3F21 A;  3WU0 A;  1UCR A;  4B8X A;  2VT3 A;  3WTZ A;  5JR3 A;  2ADU A;  2EFP A;  3HRM A;  1HKT A;  3QPT A;  4M6Y A;  1B6A A;  1P92 A;  2IRF G;  3B73 A;  2ESN A;  2P6T A;  1QGP A;  1I1S A;  2P7V B;  1E2X A;  3VFZ A;  4MQ9 F;  1R36 A;  4ON0 A;  2FNA A;  5DEQ A;  5D8L B;  3RTR A;  2KKO A;  1UHM A;  3O2P E;  2IA0 A;  3K9T A;  3K69 A;  1G3T A;  4GGG A;  2DTR A;  1BI0 A;  4QWQ A;  2XAS A;  2F5C A;  4LG0 A;  3FXR A;  3WE2 A;  1XMA A;  4PCQ A;  4BAY A;  4L9N A;  4LK0 F;  3BJ6 A;  1K79 A;  2VOP A;  2VBZ A;  1Z1D A;  2K4B A;  2B0L A;  4PGH A;  2EFQ A;  3D0S A;  2KJC A;  2V1D A;  4UXN A;  3W6J B;  2XIG A;  3SHF A;  2A68 F;  1HST A;  4R8H A;  2RNJ A;  3IRQ A;  4RB1 A;  1O7L A;  3QP6 A;  3T8T A;  4HF1 A;  3V7R A;  5HS7 A;  2HS5 A;  4MHG A;  3MEX A;  2WTE A;  2FA5 A;  1LEA A;  4I7H A;  3REO A;  4KT5 C;  4KIB A;  5DUI A;  3MWM A;  3KEO A;  1HSJ A;  2AS5 F;  3FM3 A;  3VOE A;  5IT9 K;  1K7A A;  5LBQ A;  3FMR A;  3K1M A;  5CLS A;  4I2O A;  3WTV C;  2NYX A;  2ELH A;  3I4P A;  4K2E A;  2RKH A;  2OAZ A;  1QZY A;  3M1E A;  4GYI A;  2E1N A;  5L3E A;  3GUD A;  1QO0 D;  5ILS A;  2D2W A;  4BHP A;  5LHI A;  2K86 A;  3CUQ C;  3IRR A;  3KET A;  2EV6 A;  2DBB A;  1FT9 A;  1CF7 A;  4RS8 A;  1J9I A;  5J8F A;  1PDN C;  4L9T A;  1WSU A;  2EFN A;  1SD6 A;  3P9C A;  3BPV A;  1JXS A;  1YS6 A;  5AIP A;  4UNO A;  5ICG A;  2D1V A;  2QVO A;  1KGS A;  3GYH X;  2HYF A;  1FBU A;  4R1H A;  1ON1 A;  3F3X A;  4Y17 A;  1IXC A;  2HKO A;  2Y75 A;  3WTX C;  4ESJ A;  3ZMT A;  1KQ9 A;  1YYV A;  1C0W A;  5CVJ A;  3ZN0 A;  1F4K A;  4ZYE A;  2EFO A;  2V9V A;  2Z33 A;  5JFR A;  4LFU A;  2KIM A;  2O61 A;  1CF7 B;  3KZZ A;  1Z91 A;  4LLN A;  1HW1 A;  4WWC A;  1J2X A;  2ZJ2 A;  1YFH A;  2DQL A;  2GAU A;  3U2R A;  5L3G A;  5E17 F;  2JPC A;  1HQC A;  4YII A;  3CO6 C;  3WE3 A;  2ISZ A;  1YTY A;  3B02 A;  3QP5 A;  1XDS A;  4A0Y A;  3MZH A;  1ZGJ A;  5LRR A;  2FOK A;  4QLC U;  4M73 A;  5CVV A;  4ZZD A;  4ETS A;  5ILU A;  2FRH A;  3ECO A;  2HZT A;  5DCF A;  5AON A;  4AWX B;  2PJP A;  2XAJ A;  2DAO A;  1YW7 A;  2K27 A;  2P8T A;  4UV8 A;  3H92 A;  2A3S A;  4HQM A;  2L3D A;  4LLG F;  1RUN A;  4G7Z F;  4YFN F;  3M9A A;  1TTY A;  2BYV E;  1S8N A;  3E3V A;  2M8E A;  3HHH A;  1O3Q A;  2L4M A;  4BYY A;  2P4W A;  3T5X A;  1G3Y A;  1S7A A;  1YLF A;  1UB9 A;  4XSZ F;  1ONV A;  1ZYR F;  4G6D A;  1FBS A;  2VBW A;  3TO9 A;  2FE3 A;  3KP2 A;  1QQI A;  3IL2 A;  2R3S A;  4A5N A;  3J80 Z;  3MZY A;  4U0V A;  2BEO A;  2OZ6 A;  2H09 A;  4HAM A;  4DNC A;  1GVJ A;  3V8J A;  4S04 A;  3LA3 A;  2Q2E A;  1I6X A;  3WTW C;  1O3T A;  5CJ9 A;  5HVQ C;  2IPQ X;  3ERE D;  1KU3 A;  1R5H A;  3R6S A;  1TLH B;  5L3D A;  4CIC A;  4RB3 C;  1D8K A;  3TKY A;  4OIO F;  5L3F A;  3H3U A;  1Z6R A;  1BBY A;  2JTV A;  4YIF A;  5CYV A;  2DLL A;  4WCG A;  2NAZ A;  3K0L A;  3BZ6 A;  1EH8 A;  4AIK A;  1CGP A;  4EGY A;  5DD8 A;  4RB2 C;  2CW0 F;  3GO5 A;  4HDV A;  4I09 A;  3V8K A;  5H20 A;  4LJZ F;  4P55 A;  1LJ9 A;  1ZG5 A;  1AWC A;  2EA4 A;  4BNC A;  3TOB A;  2VT2 A;  4HQE A;  2D45 A;  2FU4 A;  2F5D A;  5FB2 A;  3VOD A;  2ISY A;  4AD9 A;  5DDG A;  4JBA A;  5LHH A;  3RI4 A;  4UHT A;  2QQA A;  1BIB A;  5E8I A;  5D4S A;  3EQL F;  3C18 A;  1W5S A;  4N9H A;  3KP3 A;  1KYW A;  3IC7 A;  3FXQ A;  1X3U A;  2E7X A;  3ROU A;  4A0X A;  1XSV A;  2DW4 A;  2GA2 A;  1T38 A;  1S6L A;  4WXH A;  1U5T A;  5DCM A;  4IVN A;  3WTU C;  3F8M A;  4HV5 A;  4XBF A;  2H27 A;  2XKP A;  4PGG A;  4PDK A;  3S2W A;  4A2U A;  4M9X A;  2CG4 A;  5HLI A;  1IXS B;  4HF0 A;  3D5L A;  3H3Z A;  1J59 A;  2XGX A;  4ZYG A;  1SFE A;  3IWZ A;  2MLG A;  1MDM A;  2K02 A;  2ZNZ A;  2R7F A;  1SD7 A;  4WXD A;  4KYW A;  3KFW X;  4FT8 A;  3KP6 A;  3IKT A;  3BOQ A;  1ODD A;  1A04 A;  3I53 A;  2H6C A;  2FSW A;  3JW4 A;  2HYG D;  1HKS A;  4YG2 F;  5CVR A;  5CVI A;  4ZYD A;  2FBH A;  3VEP A;  1BOA A;  3ELK A;  2DQR A;  1XSX A;  1W4M A;  1GXQ A;  1B1B A;  2A6E F;  2YPR A;  2FXA A;  2Q0O A;  1LQ1 A;  2XAF A;  1OPC A;  1DDN A;  3R61 A;  2HGC A;  1RZ4 A;  2FML A;  1D3Y A;  3SQN A;  3C3W A;  3F6V A;  1G3S A;  5LLQ A;  5ILV A;  2G9W A;  3I54 A;  2VC0 A;  3DPL C;  2A5Y B;  1OKR A;  3FXU A;  2RVC A;  3QOP A;  3GLX A;  4EVI A;  2G7U A;  3OV8 A;  4L0Z B;  3BP8 A;  1TQM A;  4UUV A;  2VBY A;  4JQF A;  3I58 A;  1MJ9 A;  3WOD F;  1KQ8 A;  3I5U A;  3BY6 A;  1BI2 A;  1QPM A;  1TNT A;  3GVA A;  2J5P A;  1BC7 C;  1L3L A;  2STW A;  2QM3 A;  2X4H A;  5KK1 A;  3WGG A;  4OIR F;  1J5Y A;  1RNL A;  3F8F A;  5K5O A;  4L9V A;  5L3C A;  1LDK B;  1TQI A;  3BRO A;  3TO6 A;  1R5G A;  2L02 A;  3GX4 X;  1T6S A;  2VOD A;  4RGS A;  4IRG A;  1SMT A;  2TDX A;  2O0Y A;  4HX4 A;  1YO5 C;  2HQR A;  1BM9 A;  5F64 A;  1IN5 A;  1T0F A;  4HYE A;  2PQ8 A;  3DF8 A;  2O8X A;  3I59 A;  1FOK A;  1V4R A;  2ESH A;  1ZHF A;  2EK5 A;  2ZO4 A;  1I5Z A;  5J6X A;  1O3R A;  1LNW A;  2W25 A;  5HDN A;  2RQP A;  3IKV A;  1EH7 A;  2E7W A;  4EJO A;  1F1Z A;  1O7F A;  2EB7 A;  1OYI A;  5DD4 A;  3IWF A;  1IUY A;  1TW2 A;  3LST A;  4ENK A;  3C1D A;  2IP2 A;  1U78 A;  1YG2 A;  3RKX A;  1U5T C;  3MQ0 A;  3BPX A;  2PLY A;  5ICE A;  3E5X A;  1FY7 A;  5IT9 Z;  1J7K A;  2GZW A;  4I0B A;  2QBY A;  3I59 B;  1ZG1 A;  3KP7 A;  2QEN A;  5DYM A;  4KNY A;  5LGN A;  4WK8 F;  3W6K B;  4ENN A;  2YX4 A;  2OQG A;  6PAX A;  1FP1 D;  2A61 A;  3RYR A;  4EJU A;  3LA7 A;  3SZP A;  5E1X A;  4Z2Y A;  2A07 F;  3E6D A;  2XV4 S;  1K78 A;  3WU1 B;  5BQT A;  3P9K A;  3GEZ A;  4LLL A;  2ZME A;  3F8B A;  3VB2 A;  4JK1 X;  4A0Z A;  4Y13 A;  3QAH A;  2QBY B;  2RGV A;  1EV7 A;  5FO5 A;  5LGU A;  2HR3 A;  3Q9S A;  3QPH A;  4BHC A;  3CTA A;  1LEB A;  5TJJ A;  2QQB A;  2FNP A;  1YS7 A;  4KN7 X;  2XUB A;  2OD5 A;  3E6C C;  3QU3 A;  4CHU A;  1Y0U A;  5ED4 A;  1KU7 A;  4FHT A;  1JHF A;  2G7H A;  2EV0 A;  5HOO A;  2YR2 A;  3OOP A;  1K78 B;  2PMU A;  1IN8 A;  1FYM A;  2CFX A;  4G8X A;  4XSX F;  2ZXJ A;  2ZME B;  2LNB A;  2M45 A;  4FX0 A;  1HXD A;  1BI1 A;  1YW9 A;  1MGT A;  2XHK A;  5BMZ A;  3QRF F;  3GZ6 A;  3FZV A;  2BBY A;  4YFK F;  1YQA A;  3L7W A;  1G3W A;  3V4G A;  1AOY A;  1GXP A;  3GZ5 A;  2AXL A;  3NEU A;  2EA2 A;  1KQ0 A;  1MZB A;  3LWF A;  4I0A A;  4AIH A;  1DP7 P;  1XGO A;  2IW5 A;  1ZGA A;  5HLG A;  4H0E A;  2RC4 A;  3O3K A;  5FLX K;  4GYG A;  2GWR A;  1Z9C A;  2GXB A;  4NB5 A;  1ZAR A;  5JI6 A;  2EFW A;  2NS0 A;  4LB6 B;  1T2K A;  2V1X A;  4CGZ A;  2CSO A;  4ENJ A;  2MBF A;  3QU6 A;  1XDU A;  5ERI A;  4G7H F;  1XSD A;  2E1C A;  2KRF A;  3ISP A;  2QQ9 A;  2HDC A;  4KMU X;  3DV8 A;  5LEJ A;  2Y48 A;  3JSP A;  4M72 A;  3BDD A;  2VN2 A;  4EJW A;  3ZMV A;  4RGU A;  1IRF A;  2HOE A;  4IXA A;  2LDU A;  3KLN A;  2CWE A;  2JRT A;  2VON A;  2XAG A;  1KYZ A;  5D6E A;  3LAP A;  3GF2 A;  4RAZ A;  3KLO A;  3JTG A;  4EQQ A;  4S05 A;  2CO5 A;  1J0R A;  5D5W B;  3N97 A;  1FYK A;  4A6E A;  3CUO A;  4XLN F;  1P4X A;  1IN7 A;  1HW5 A;  1MKM A;  1IN6 A;  4HA8 A;  1IZ1 A;  3J81 K;  3EYI A;  4CXF A;  3JSO A;  1ULY A;  2A6H F;  1SAX A;  3CLO A;  3EUH A;  1HBX G;  3P7N A;  3E5Q A;  5DV5 A;  1FWZ A;  1YW8 A;  3KE2 A;  2DK8 A;  3HTU A;  2VE8 A;  1XN7 A;  3JAM Z;  5FD5 A;  4HX7 A;  2IT0 A;  4MNU A;  4WF2 A;  2QLZ A;  1W7P B;  3ZMZ A;  2XRN A;  2MH2 A;  4KDP A;  1FP2 A;  2LF8 A;  4I01 A;  3WTY C;  1PP7 U;  4F7Z A;  4RGR A;  1OMI A;  4XLP F;  1IW7 F;  1JHH A;  3R4K A;  1OR7 A;  1WRJ A;  4L18 B;  2J5O A;  1FBQ A;  1U6G A;  3GXO A;  1BJA A;  5FFX A; 
#chains in the Genus database with same CATH topology
 2KZG A;  2PMZ A;  1MSF C;  4CH7 A;  4P96 A;  2UV1 A;  4C3I J;  1ZKG A;  3F72 A;  3BJA A;  1WJD A;  3SEZ A;  3TOA A;  3HIF A;  3CCV I;  4M9Z A;  3BR0 A;  1U9N A;  3L9F A;  1FC3 A;  2L2O A;  4DZP A;  3R0J A;  2R7D A;  4E70 A;  3HDD A;  2H6B A;  2XB5 A;  2V26 A;  2P5L C;  2KIF A;  4RBO A;  1I50 J;  1JT0 A;  1WWX A;  3Q9V A;  1MIJ A;  3DP7 A;  3KYL A;  1U8B A;  4M74 A;  1R00 A;  1VQ6 I;  3RKW A;  4UVA A;  2KP6 A;  4I99 C;  3GFJ A;  3GFM A;  2Y9Y A;  3HBL A;  4DBQ A;  2CUJ A;  2PFB A;  4XOT A;  1NTC A;  1W5C C;  3PFI A;  4P5O A;  4ZH4 F;  3HOZ J;  3DBH B;  3E5U A;  5H6R A;  4PFO A;  1F5T A;  2FX0 A;  3N4M A;  4M6X A;  5GAE J;  1QVU A;  2UWM A;  2D1H A;  1U9O A;  2M2E A;  2LMD A;  5EF6 A;  2Z3Y A;  3O8G A;  5HS9 A;  2H94 A;  3LQQ A;  2F5F A;  1RUO A;  3RYP A;  1YIJ I;  2W48 A;  2JSP A;  1QZZ A;  3HRT A;  5K1Y A;  2ME0 A;  1X3Z B;  4MLO A;  2W24 A;  3M8F A;  3OYB A;  1Z05 A;  2YS9 A;  4XLF A;  1R1V A;  4HBL A;  1XS9 A;  2M5W A;  2LBF B;  2QA4 I;  4KUM A;  3G6E I;  3CMA I;  3DQV C;  1HF0 A;  3LQR A;  2A05 A;  1TBX A;  2ZB9 A;  3FHZ A;  1PUF B;  2R5Z A;  3FXM A;  1D5Y A;  2JT1 A;  3DXJ F;  2M30 A;  4RGX A;  5CQE A;  5JLW A;  4EGZ A;  2IVM A;  1IRZ A;  2WAF A;  3BTI A;  2P5K A;  2H8W A;  2Z99 A;  2L9V A;  2I8D A;  4UV9 A;  3BG3 A;  3ZQI A;  3Q0U A;  1H9G A;  3J7A Y;  2DT5 A;  2K9Q A;  1Q1H A;  2V1U A;  2OU2 A;  5KVR A;  4MTD A;  2P5V A;  1P6R A;  2ZC2 A;  2E36 A;  4TV7 A;  3ECH A;  2MFZ A;  1F9N A;  2VBX A;  3KEQ A;  4N9I A;  3FM5 A;  3ZQ7 A;  5JHF A;  2M0M A;  4HNV A;  4LIV A;  1ZN2 A;  2AHQ A;  1O57 A;  1IV8 A;  3HG9 A;  3Q3S A;  2Y9Z A;  3HUG B;  2F2E A;  3O8H A;  3TDZ C;  1WKM A;  2IGK A;  5K5Q A;  5D4R A;  3S16 J;  1ZRC A;  2JPB A;  4E7K A;  2ZXW H;  2YSR A;  2OTJ I;  3ASO H;  3D5R C;  3IP4 B;  3PUF A;  4JX4 A;  2FBI A;  2VPR A;  5A2Q K;  1DUX C;  3E6M A;  3HHG A;  2NRA C;  5AIQ A;  4EM1 A;  4NNJ A;  1V3F A;  3ML6 A;  4BAC A;  1S72 I;  1JTX A;  3GTG J;  3W3C A;  3HOS A;  4Q4Z F;  1S3J A;  3SFZ A;  4R79 A;  3HKZ A;  1HDD C;  1UMQ A;  3KYD B;  3BCA A;  5CVU A;  3FX3 A;  1HLV A;  1BJZ A;  4A3D J;  4CDG A;  1ZRD A;  2JRM A;  1BC8 C;  2GLO A;  2M4G A;  4ZC3 A;  2E60 A;  4BE1 A;  3EUA A;  1K61 A;  1BL0 A;  1TW3 A;  3KEY A;  1FSH A;  4HX8 A;  1MMG A;  4G7O F;  2KLO A;  4NC7 A;  1G6N A;  2EWN A;  2O7O A;  2VIX A;  1KU9 A;  2QWW A;  4ZJZ A;  4BY1 J;  5DM6 F;  3PO2 J;  2XAU A;  4O5V A;  2EZI A;  1RIO H;  5FD6 A;  1LVA A;  4KT6 A;  2QZ8 A;  4A3B J;  4RB0 A;  1MBG A;  1WZ2 A;  5BPD A;  2JA6 J;  1WI3 A;  5JHU A;  2W82 A;  1VQ4 I;  4BBS J;  2W57 A;  4IZZ A;  2VAS A;  1YIT I;  2EJR A;  4MIM A;  2BV6 A;  1G2H A;  2HNH A;  1XGS A;  4FQG A;  4UB8 C;  4F92 B;  5LHG A;  3L09 A;  3PUB A;  2HOS A;  2XVC A;  1FTZ A;  4A12 A;  2O6G E;  2X1E A;  2FEZ A;  3MKZ A;  3EUH C;  3U9G A;  2JZY A;  2IXS A;  3LFK A;  3QPS A;  2MH9 A;  4PZJ A;  1WFX A;  2B7E A;  1MBF A;  3HB9 A;  5E1W A;  3AKZ A;  2M4K A;  2PN6 A;  1W36 C;  4HF2 A;  4L5I A;  2KDO A;  2JK3 A;  2ZFW A;  1ETO A;  4MFE A;  2OCC H;  1VQK I;  1AKH B;  2MD5 A;  1B9N A;  1R49 A;  3L2W A;  2B63 J;  1JGS A;  1ETV A;  2MC4 A;  3KYC B;  3I0T A;  1WH5 A;  4PK4 A;  4AIJ A;  1XC5 A;  2DN0 A;  4PJJ A;  1RR7 A;  4RAY A;  1I27 A;  4O3M A;  3CQZ J;  3PQK A;  2KJB A;  4ANJ A;  1GV5 A;  4U7D A;  3OYH A;  2E19 A;  5KAF C;  5HS8 A;  4AVP A;  2R0Q C;  3HZJ A;  1ZLJ A;  4IEJ A;  3F6O A;  2I5U A;  2DXI A;  3M07 A;  4OMY A;  5H6Q A;  1V54 H;  3ZMD A;  4Q5S F;  1ZGW A;  2IA2 A;  3P9I A;  3HSF A;  1IG7 A;  2V4J C;  1XGN A;  5EJC A;  4HDU A;  3WGI A;  3TED A;  1B9M A;  2ZBK A;  3BT9 A;  3CMM A;  1LDD A;  1OR7 C;  4XKB A;  3WHB A;  1JGG A;  1DP3 A;  3JRG A;  5F6F A;  5FLM J;  2KZV A;  2XPW A;  4OIN F;  2O3F A;  2XF5 A;  3DTE A;  2DOF A;  1Y1V J;  4WXC A;  1MBE A;  3FIS A;  2Q8K A;  5TRD A;  2K3P A;  3DBR B;  1QHH D;  2CV2 A;  2HEO A;  3OL4 A;  2L9N A;  3ZPL A;  3HPH A;  3HRS A;  2OQR A;  3KCC A;  2UXN A;  1J75 A;  2M3A A;  2M34 A;  2C6Y A;  4UVB A;  4LB5 A;  4IRI A;  2VXD A;  1D5V A;  2HKX A;  5EEH A;  4HZF A;  1B8I B;  2WBM A;  3HOT A;  3KP4 A;  4MGR A;  4BDY A;  4L9J A;  4QSH A;  3I56 I;  4B43 A;  2QKL B;  2WAQ A;  4XOR A;  2CJJ A;  5EEG A;  2CU7 A;  2L9S A;  2XGD A;  4LG0 B;  5D5X B;  3V7S A;  1DPU A;  2HWV A;  4XID A;  1TWH J;  4I02 A;  2DMT A;  2OJE D;  1IDZ A;  2CQN A;  5E18 F;  3HC7 A;  5J3L A;  1ZH5 A;  4XNF A;  2M87 A;  4B09 A;  3RJP A;  1W1W E;  2OPT A;  4A93 J;  1JUP A;  4HSR A;  4NQW A;  3R60 A;  3GFL A;  4M9S A;  1NHA A;  4H4K C;  3RIR A;  1W0U A;  4XRF A;  2F5E A;  2JA7 J;  3S1R J;  3SXY A;  4BQA A;  2CUE A;  5FLV A;  1A5J A;  2XC7 A;  2MA3 A;  1KA8 A;  1R7J A;  2AQF A;  2JSC A;  1R1U A;  2QYO A;  4U0W A;  2NNY A;  1FNN A;  2OZU A;  4XLH A;  3MAJ A;  4NC6 A;  3MKY B;  3O6B B;  4F55 A;  2XB0 X;  1XCB A;  2K85 A;  1SVO A;  2ZSI B;  1R6R A;  1SD4 A;  5B66 C;  2ZNY A;  2PBI A;  5HLH A;  4QTR A;  4CYC A;  3FXL A;  4OIP F;  2KIU A;  3DU6 A;  2HU9 A;  4ASN A;  2GXG A;  1E0E A;  4L5J A;  1MW7 A;  2JWT A;  2DPU A;  1O4X A;  2LSO A;  3G73 A;  3OIQ A;  3RPQ A;  3U1D A;  1XB4 A;  2EV5 A;  2K7L A;  1LDJ A;  3NRV A;  1EH6 A;  4CCJ A;  4ZYH A;  2CGP A;  3K2Z A;  3LAJ A;  5JVT A;  3RCO A;  1ZTR A;  3G3Z A;  3S3N A;  1ZEL A;  4HG2 A;  4A5M A;  4X1E A;  3ZQG A;  5D6F A;  2K5C A;  4M3D A;  1A6I A;  5E20 A;  2VE9 A;  4A6D A;  3LNQ A;  2W85 A;  3PQJ A;  1ACI A;  1HW2 A;  3JRC A;  3IV5 A;  3M7G A;  3PM1 A;  1OFC X;  2KT0 A;  3CCQ I;  2HFH A;  3H9Q A;  2DT6 A;  4RLQ A;  2LKP A;  4NHJ A;  3EET A;  5EGO A;  1D8J A;  1JE8 A;  1TZL A;  1R1T A;  2ZKZ A;  3GZN B;  4OIQ F;  3HJE A;  4XLC A;  2PG4 A;  2YU3 A;  5LEK A;  2FD5 A;  2O5R A;  1V5F A;  5GP9 A;  4P9F A;  3GTO J;  1IDY A;  2WB1 A;  3V42 A;  2EIM H;  2DOA A;  3C7J A;  4Q48 A;  3SDG A;  2OA4 A;  2PMZ N;  5BS6 A;  1FEX A;  2HI3 A;  1YIO A;  4EMS A;  2DOE A;  4DQ2 A;  4OMZ A;  3TDU C;  2CMP A;  4G6Q A;  1FLI A;  3LSH A;  3OWT A;  2FF4 A;  4D0P A;  4BXX J;  3GTL J;  3HSE A;  3RQ4 A;  3SZT A;  4D7N A;  3CO7 C;  1TL8 A;  2W7N A;  3LSJ A;  5E79 C;  1BI3 A;  2HQA A;  2Q1Z B;  2O03 A;  1I1G A;  4EM2 A;  3LSI A;  2WC2 A;  3HOV J;  4KIC A;  4EJV A;  1S7O A;  5D5U B;  3BC8 A;  5J8C A;  1UHW A;  3L00 A;  3DPT A;  4XK4 A;  2IJL A;  4FET A;  3ZMU A;  4YFX F;  4KFC A;  4G94 A;  2X0L A;  3HL2 A;  2ELJ A;  1X2M A;  2Y0M A;  4KIG A;  2KIS A;  3OYC A;  2E71 A;  3Q5F A;  1QBJ A;  1SD5 A;  5FRN A;  4A3K J;  2XPU A;  1IN4 A;  1PP8 F;  3ZQH A;  2CYY A;  2LP0 A;  2MW8 A;  4IHX A;  3S2D J;  4IHS A;  2VB6 A;  3BTL A;  4CZZ A;  2PI0 A;  2NVY J;  1QPI A;  3DKW A;  3SDB A;  1DPR A;  4MQV A;  1UAA A;  2N8G A;  2QQ8 A;  1USS A;  2R7Q A;  4ESF A;  4A3M J;  1K6O A;  1OJL A;  2L01 A;  5FLX Z;  3C2B A;  3HSR A;  2E35 A;  4LD5 A;  2VOO A;  1K4T A;  2RQQ A;  5DUK A;  4Y15 A;  1IRG A;  1EA3 A;  3GTJ J;  2WWY A;  2BE5 F;  4E7S A;  1R9T J;  4EV0 A;  2FQ4 A;  1UHS A;  2JN6 A;  3A4C A;  1H9T A;  1T98 A;  3AG3 H;  5FFZ A;  2M8G X;  1EJ9 A;  1ZRE A;  3F8N A;  2F4M B;  1R22 A;  3TW7 A;  4AYB A;  2DA6 A;  4BHB A;  2HTS A;  2IS1 A;  3TP0 A;  3JRF A;  3L2C A;  2VXZ A;  1HKQ A;  2V6C A;  2Z9O A;  2VUM J;  4PSX A;  3TO7 A;  4BJ5 C;  2VI6 A;  4LMY A;  2QEX I;  4ESB A;  3FDY A;  2KDZ A;  2DMP A;  1XCV A;  3T8R A;  1FIP A;  3M8J A;  1IXR C;  3ABU A;  3DLL F;  1PYV A;  3FMS A;  4P1W A;  2GOX B;  3DFG A;  1MMN A;  2KMU A;  4MEY F;  2BZT A;  3OIP A;  2DI3 A;  1RKW A;  4Q47 A;  4HEA 2;  2M0C A;  2LC2 A;  3RPU A;  2XRO A;  5KHD A;  3EYY A;  2KIQ A;  5E3M A;  3M3Y J;  3LA2 A;  3MFK A;  3OY9 A;  3JTH A;  1LKX A;  1WH7 A;  4FE7 A;  3A0B C;  3CCR I;  3ZR8 X;  2AXT C;  2W00 A;  4U0Y A;  2V9P A;  4IPA A;  4HNT A;  3J80 K;  1LE8 B;  3E97 A;  1P4W A;  1OYY A;  2NNN A;  1YHQ I;  3TP3 A;  4EM0 B;  2DYS H;  2Z5U A;  5DTD A;  3GWZ A;  2HQN A;  1XD7 A;  1DU0 A;  3HKZ N;  2STT A;  5E8G A;  1W7P A;  3I71 A;  5FFX A;  5E1Z B;  4PJ0 C;  1S5L C;  2D5V A;  2FBK A;  4M71 A;  4D7M A;  2XGC A;  1U8R A;  5J40 A;  3BR3 A;  1B4A A;  1FMW A;  2EQR A;  4PJM A;  3GLL A;  2CW8 A;  3I64 A;  4DBR A;  5HDG A;  2DFH A;  2EIK H;  1SVL A;  3AFH A;  3AL0 B;  3J81 Z;  4G9Y A;  2DFI A;  1QRY A;  4CO8 A;  3OR2 C;  4O6J A;  2JA5 J;  4X0G A;  4IRH A;  2PJR B;  5DS9 A;  2DDB A;  4IJA A;  2QSF X;  3F9K A;  4HLX A;  3BLY A;  1PUE E;  3PJR A;  4L0Y B;  3FK6 A;  4U88 A;  5HNF A;  2RV8 A;  1D0Z A;  1D0Y A;  3CDH A;  4A3C J;  2V79 A;  1BIA A;  2P6S A;  5K5R A;  1R58 A;  5JVG F;  2VL8 A;  3ZP5 A;  3BG7 A;  4MFD A;  2IGN A;  2KFD A;  3EDP A;  1BA5 A;  3T0Y A;  2RDP A;  2H1K A;  5EYR A;  3B6C A;  1J09 A;  4B4C A;  5ICC A;  3NQO A;  1VTN C;  1XPX A;  1T8I A;  1K4S A;  4GDF A;  2K9S A;  1RRJ A;  3ULQ B;  3DTI A;  2JUG A;  3BJO A;  2R7U A;  1UZC A;  3OOU A;  2DK5 A;  1TWG J;  1UST A;  2PEX A;  4DYQ A;  1U3E M;  4GXO A;  5BOX A;  4MEX F;  4GCV A;  4A3I J;  4IHT A;  3OL3 A;  2DTZ A;  3FF5 A;  3JAM K;  1ZLK A;  3KZY A;  1VFC A;  1RI7 A;  1U0J A;  3F23 A;  2Q2E B;  3AAF A;  3HTS B;  2L54 A;  3BZK A;  2DA3 A;  3WGH A;  2ZCW A;  3M8E A;  3TGN A;  4HW0 A;  1W5T A;  1H0M A;  3RPU D;  3ONQ A;  4LK1 F;  3A2K A;  1WI9 A;  3J7Y J;  4BXF A;  3CCL I;  3GTM J;  5EG0 B;  1Y8Q B;  1MND A;  3OYJ A;  2ECC A;  2UXX A;  2UZK A;  2FQ3 A;  1STZ A;  3QOE A;  2VJ4 A;  1ON2 A;  2FMY A;  2COM A;  1O3S A;  2QUF A;  1MJB A;  1A35 A;  4DZJ A;  3HRU A;  2LBF A;  3X2Q H;  1KU2 A;  1GT0 C;  3B6A A;  3JRD A;  2W4S A;  3K1P A;  3ZMS A;  1W7P D;  4A3E J;  1K6Y A;  1OYW A;  1LB2 A;  3KP5 A;  4ENM A;  4CYD A;  2QF7 A;  3IHU A;  2L4A A;  2NOJ B;  5D8K B;  1PUF A;  3H9J A;  3E0J B;  3WG9 A;  4EJT A;  1P4A A;  3H36 A;  3P5J A;  2DYR H;  1QVT A;  3FWE A;  3OYM A;  3HEF A;  1N77 A;  4S0H B;  2GA1 A;  4HOB A;  1L0O C;  1UFM A;  1LUJ B;  3KZI C;  1IF1 A;  1D0X A;  4RA2 A;  4XN0 A;  4LGW A;  1B59 A;  2DU9 A;  3L2R A;  3A1Y A;  2XAQ A;  3MN2 A;  2L0K A;  2BHZ A;  3WTT C;  1OQY A;  4OAY A;  4B3A A;  2WV0 A;  5M5Y J;  3FMQ A;  3PSF A;  5IT3 A;  2CUZ A;  3J7A O;  3I4M J;  1W36 D;  3LSP A;  4XRS G;  1SMY F;  4E7L A;  2WAQ N;  1NG7 A;  2CQQ A;  3HUG A;  4KIF A;  4OU0 A;  3V7C A;  2XSD C;  2K4J A;  3BWG A;  2JA8 J;  4WX9 A;  1TNS A;  3H9G A;  3E6B A;  3GW2 A;  2WAE A;  1I3Q J;  4LG3 A;  2MC3 A;  4OOI A;  3S8P A;  1TC3 C;  2GM4 A;  1UG2 A;  3F8C A;  4BQQ A;  1SC7 A;  5ICF A;  2GBY A;  3BR5 A;  3H5N A;  1BN5 A;  4XLA A;  1R4N B;  4XLE A;  3OSF A;  4HST A;  2VKV A;  4A3G J;  1VQP I;  2W84 A;  2CW7 A;  1D1A A;  3CUQ A;  3WTS C;  2ETH A;  3EUK L;  2A69 F;  3F22 A;  3HYI A;  1G4D A;  3CC4 I;  1MD0 A;  2NVQ J;  1ZRF A;  1T39 A;  1Z7U A;  1U2W A;  1E17 A;  1IAW A;  1X1P A;  2HTJ A;  1TQP A;  4F93 B;  2GQQ A;  1RC9 A;  1XGM A;  2ID3 A;  4ZZL A;  1ETK A;  1GHC A;  4IF4 A;  2XKO A;  5D5V B;  2E2H J;  2DPD A;  5FGM A;  2YUS A;  2M1B A;  4GO1 A;  3PL8 A;  1U5T B;  2HYJ A;  4KN4 X;  4NDL A;  2CFO A;  5DCM B;  3GFI A;  2OBP A;  1MJA A;  4MTE A;  2GIV A;  1FX7 A;  4M3E A;  2LF7 A;  5BPI A;  4I98 B;  2KHM A;  4AC0 A;  5LGT A;  3RDI A;  3PO3 J;  3MCZ A;  2VC1 A;  1FPQ A;  1Z6T A;  4HLY A;  1SFX A;  3JR9 A;  2ACJ A;  1CQT A;  2MLK A;  2M7A A;  4N0B A;  2DDA A;  2RN7 A;  2JVG A;  3CZ6 A;  3PIO F;  1XMK A;  3FKI J;  2DO7 A;  1LFU P;  3FXK A;  1A36 A;  3FBI B;  4UVC A;  3T1B A;  2Y31 A;  4U7B A;  3LSK A;  4BXU A;  1S29 A;  1G8X A;  3DCF A;  3AL0 C;  1S7E A;  1MDM B;  2HVR A;  3TQN A;  4KMF A;  5A2Q Z;  4BH9 A;  4DJA A;  3V8L A;  2IA1 A;  2XSJ C;  3NWS A;  3RKY A;  3ZN1 A;  1ZG3 A;  2E2J J;  1JKP C;  3I4N J;  5GPC A;  4FX4 A;  5GTI C;  4Z6Y A;  1WQ2 A;  3CUQ B;  5LRS A;  4UUS A;  1FZP B;  4P9U A;  1FYL A;  1SFU A;  3COA C;  1S9H A;  1AKH A;  3K1N A;  3R0A A;  2CQK A;  1N78 A;  3QWL A;  3HOW J;  1JKQ C;  1REP C;  2OCE A;  4HV6 A;  3CJN A;  2XAH A;  2NS7 A;  1P2F A;  4BGD A;  1ZAO A;  1QNT A;  2BGC A;  1R23 A;  2DT7 B;  2PMH A;  4LOC A;  5HDK A;  4KA4 A;  2YX7 A;  5L3B A;  2I10 A;  2EIN H;  3ABT A;  2CV1 A;  1FSE A;  5F1R A;  2WB1 N;  1SVM A;  4BEH B;  4X6A J;  3CP2 A;  3DEU A;  3UKG A;  2P7C B;  1QHG A;  3F21 A;  3WU0 A;  1UCR A;  1WGX A;  3FKJ A;  4JYK A;  3NAR A;  4B8X A;  2VT3 A;  3WTZ A;  5JR3 A;  3TBI A;  2ADU A;  4B3X A;  2EFP A;  1HCR A;  1Y0N A;  2BY0 A;  3HRM A;  1R5I D;  1HKT A;  4RLF A;  2LTP A;  2NVU B;  3QPT A;  1MH4 A;  4M6Y A;  3S14 J;  3H1C A;  1VQL I;  1B6A A;  1OCR H;  1P92 A;  4BQN A;  2IRF G;  4D5F A;  3B73 A;  2ESN A;  2P6T A;  2X85 A;  2RRE A;  5M3F J;  1QGP A;  3FBN B;  1I1S A;  2P7V B;  2LYC A;  4HRI A;  1E2X A;  3MVP A;  4OAZ A;  3VFZ A;  4UUS B;  4MQ9 F;  1R36 A;  1OCZ H;  5F08 A;  4ON0 A;  2Z1D A;  1X3W B;  2JQ7 A;  2FNA A;  2LG4 A;  5DEQ A;  3S1N J;  1WCM J;  1P7J A;  5D8L B;  5FKL A;  1RPW A;  3RTR A;  4PSW A;  2KKO A;  1UHM A;  3O2P E;  2IA0 A;  3K9T A;  1AA7 A;  2K40 A;  3J7Z I;  3K69 A;  1B8I A;  3NAU A;  1G3T A;  3PNT A;  4GGG A;  2DTR A;  2EZH A;  1BI0 A;  4XQF A;  4RDU A;  4J19 A;  4QWQ A;  2XAS A;  1XX5 A;  2F5C A;  4LG0 A;  5TGT A;  5BNG A;  3FXR A;  3MD2 A;  3WE2 A;  1XMA A;  1ETW A;  4PCQ A;  4C30 A;  1QA6 A;  1IGN A;  4BAY A;  1X19 A;  4L9N A;  4LK0 F;  3BJ6 A;  4B48 A;  4XRS A;  4FE4 A;  1K79 A;  4L5E A;  2VOP A;  1MNM C;  2VBZ A;  1Z1D A;  2K4B A;  2B0L A;  4PGH A;  4BE0 A;  4EEF G;  2EFQ A;  3H0G J;  3D0S A;  4AYB N;  2MAB A;  2KJC A;  3CCJ I;  4IHY A;  2RAE A;  4DW6 A;  4N4N B;  1H89 C;  4M3G A;  1YOV B;  2CRG A;  2V1D A;  5EZH A;  1YI2 I;  4UXN A;  4KJZ A;  4XMY A;  2XIG A;  3SHF A;  2A68 F;  3W6J B;  1HST A;  3IH4 A;  4R8H A;  2RNJ A;  1MBJ A;  3IRQ A;  3G71 I;  4RB1 A;  2P81 A;  1O7L A;  3QP6 A;  3T8T A;  4HF1 A;  2VJJ A;  3V7R A;  5HS7 A;  3DEE A;  2HS5 A;  4MHG A;  3I3L A;  2EZL A;  3U21 A;  3MEX A;  2XF7 A;  3GTQ J;  3HXL A;  5E3L A;  2WA0 A;  2WY7 Q;  2WTE A;  2FA5 A;  1LEA A;  4I7H A;  3REO A;  4KT5 C;  1JJ6 C;  4KIB A;  5DUI A;  1ZQ3 P;  3MWM A;  3NWT A;  3KEO A;  1HSJ A;  3PFY A;  2AS5 F;  4C2M J;  3FM3 A;  1K83 J;  3VOE A;  5IT9 K;  1K7A A;  5LBQ A;  3FMR A;  2QSH X;  3F0C A;  3ZGK A;  4FAS D;  4CSW A;  2Z2S B;  3K1M A;  5CLS A;  4I2O A;  3H35 A;  3WTV C;  2NYX A;  3ZQL A;  3K4B A;  2ELH A;  3I4P A;  2TCT A;  3WU2 C;  4K2E A;  1GLN A;  2RKH A;  2EIL H;  2OAZ A;  1QZY A;  3CES A;  2ME6 A;  4GRI A;  3S93 A;  5B3S H;  4A3F J;  2H8R A;  1SAN A;  1BJA A;  3H3V K;  3M1E A;  3OR1 C;  2R4G A;  1SEU A;  4GYI A;  2E1N A;  2DA5 A;  5L3E A;  3GUD A;  4CA0 A;  1QO0 D;  3A0H C;  5ILS A;  1KZH A;  2D2W A;  4BHP A;  1Y6I A;  1V5E A;  5IOY A;  5LHI A;  1GDT A;  1B72 B;  2K86 A;  3CUQ C;  3IRR A;  4C2U A;  3QOD A;  3KET A;  1YX5 A;  2EV6 A;  4YEL A;  1I3A A;  3SEQ A;  2DBB A;  2NVT J;  3L2V A;  1FT9 A;  1CF7 A;  2X9D A;  4RS8 A;  4DGW B;  3C2H A;  2DA7 A;  5J4V A;  1J9I A;  2R5Y B;  4IOA F;  5J8F A;  1PDN C;  4L9T A;  3OYE A;  1WSU A;  3W6V A;  3BQY A;  2EFN A;  1P7I A;  2NVX J;  1WJE A;  1SD6 A;  3P9C A;  3OIO A;  1ITY A;  3BPV A;  1JXS A;  1YS6 A;  3M4O J;  3QYF A;  3ZQF A;  1FOY A;  5AIP A;  4XKV A;  4UNO A;  1OCO H;  5ICG A;  1ENH A;  2EPF A;  1P9Q C;  2D1V A;  2IS2 A;  2QVO A;  1AU7 A;  1BR4 A;  4BE2 A;  1KGS A;  1JKO C;  1VND A;  2JMW A;  4KIS A;  3GYH X;  1I6H J;  2HYF A;  1FBU A;  4R1H A;  1ON1 A;  1SAU A;  4II3 A;  3F3X A;  2OF7 A;  3IUO A;  4Y17 A;  1NH3 A;  1IXC A;  2HKO A;  2BVL A;  2Y75 A;  3WTX C;  4ESJ A;  3ZMT A;  1KQ9 A;  1YYV A;  1C0W A;  5CVJ A;  3ZN0 A;  1F4K A;  4PUS A;  4ZYE A;  2EFO A;  5GAH J;  2V9V A;  2Z33 A;  5JFR A;  4ZDP A;  1Y39 A;  1RKT A;  3JRB A;  1PVE A;  4LFU A;  5M5W J;  2KIM A;  2O61 A;  1CF7 B;  3KZZ A;  4C2T A;  1Z91 A;  2HVQ A;  1FMV A;  1X4P A;  4LLN A;  4BDZ A;  1MMS A;  1HW1 A;  2W1O A;  4WWC A;  2GOM A;  5J4Y A;  2IEK A;  1J2X A;  3K6G A;  1UG0 A;  1E3O C;  2X48 A;  3DPU A;  2ZJ2 A;  1UEL B;  3VYS B;  1YFH A;  2DQL A;  2GAU A;  2ZJR F;  3U2R A;  4JOM A;  3DU5 A;  2RNG A;  3BR6 A;  5L3G A;  5E17 F;  2JPC A;  4D5C A;  1HQC A;  4YII A;  3CO6 C;  3KIO A;  3WE3 A;  2ISZ A;  3OYN A;  2X1D A;  4ITV A;  2QCO A;  5F04 A;  3B02 A;  4XIC A;  1YTY A;  2R7X A;  5C4J J;  1N25 A;  2VQC A;  3QP5 A;  1XDS A;  2IBD A;  1FOW A;  2Y69 H;  4A0Y A;  3MZH A;  1NK3 P;  1ZGJ A;  5LRR A;  3HGY A;  1Y1W J;  4E6K G;  3AG4 H;  2FOK A;  4QPQ A;  4QLC U;  4M73 A;  5CVV A;  4ZZD A;  4ETS A;  1WHU A;  1LE8 A;  5ILU A;  2FRH A;  3ECO A;  2HZT A;  2NXN B;  9ANT A;  2DMN A;  5DCF A;  5GPA A;  2VKD A;  5EDN A;  5AON A;  4AWX B;  2HDD A;  2PJP A;  2XAJ A;  2DAO A;  1YW7 A;  2K27 A;  2IGM A;  2P8T A;  4UV8 A;  3G1O A;  4W1U A;  2H1L A;  2GXA A;  3ERM A;  2L9R A;  3H92 A;  2A3S A;  4HQM A;  1FIA A;  5HNH A;  2L3D A;  4LLG F;  1RUN A;  4G7Z F;  3LOC A;  2VLA A;  2LKS A;  3PSI A;  4KIT B;  4YFN F;  1Z7L A;  3M9A A;  4D1Q A;  2OUM A;  4XR6 A;  1IRX A;  2DA2 A;  3BTC A;  1TTY A;  4F52 A;  2BYV E;  5KAI C;  1S8N A;  3E3V A;  1N75 A;  2M8E A;  3HHH A;  4IHV A;  1O3Q A;  4UB6 C;  3MMY B;  2PJR A;  3JRE A;  5GAG J;  5IYC J;  4BQO A;  5IYD J;  2L4M A;  3ABL H;  3KPH A;  4BYY A;  2P4W A;  3T5X A;  1G3Y A;  2Y30 A;  4Y52 J;  1BW6 A;  3OYL A;  1APL C;  1S7A A;  1YLF A;  1UB9 A;  3BG6 A;  1ONV A;  1ZYR F;  4G6D A;  4XSZ F;  2COB A;  2DA1 A;  1FBS A;  2L7M P;  2VBW A;  3TO9 A;  2FE3 A;  3DTK A;  3KP2 A;  3CC7 I;  1Z0X A;  1QQI A;  3IL2 A;  3N05 A;  2R3S A;  3E1S A;  3VYU B;  4A5N A;  1JUS A;  3J80 Z;  2MSY A;  3MZY A;  3CF5 F;  4U0V A;  2BEO A;  2OZ6 A;  4XRM A;  2H09 A;  4HAM A;  4BL0 B;  2FOW A;  4DNC A;  4M3B A;  4RAG A;  1GVJ A;  2HXO A;  4I76 A;  4CCM A;  4IHW A;  3FIW A;  2MG4 A;  3V8J A;  4S04 A;  1ZK8 A;  3LA3 A;  2Q2E A;  1I6X A;  3WTW C;  1WVR A;  1O3T A;  5CJ9 A;  4CZC A;  5M5X J;  4BBR J;  2IPQ X;  5HVQ C;  1KU3 A;  3ERE D;  1R5H A;  3OYK A;  1X4O A;  3R6S A;  2EH3 A;  1OLT A;  1TLH B;  1W0T A;  4GFB A;  3VSL A;  3IH2 A;  3Q0W A;  5L3D A;  4CIC A;  4RB3 C;  3K10 A;  1D8K A;  5EG0 A;  2R7Z J;  3TKY A;  4CCN A;  4OIO F;  2X51 A;  4MO7 A;  5L3F A;  3H3U A;  1Z6R A;  2ZXI A;  2HOT A;  1BBY A;  2OV7 A;  2JTV A;  4YIF A;  5CYV A;  1JI8 A;  5J47 A;  2DLL A;  3RSN A;  4WCG A;  4V19 K;  2NAZ A;  3K0L A;  1ZR4 A;  3BZ6 A;  3A01 A;  1EH8 A;  4AIK A;  4PJL A;  5FKK A;  1CGP A;  4EGY A;  4ZTJ A;  3JRI A;  5DD8 A;  4RB2 C;  2R7T A;  2CW0 F;  3GO5 A;  3MZ8 A;  3VDX A;  4HDV A;  1YRN B;  2BXZ A;  1YJ9 I;  1V55 H;  3HOU J;  5C44 J;  4I09 A;  3V8K A;  5H20 A;  2X1C A;  3FHN A;  4M3F A;  4LJZ F;  4P55 A;  1LJ9 A;  4ZYA A;  1ZG5 A;  1AWC A;  4LIT A;  2EA4 A;  4BNC A;  1FTT A;  3TOB A;  2K9M A;  2VT2 A;  4HQE A;  2D45 A;  2KPM A;  5FKM A;  5EEA A;  2FU4 A;  2F5D A;  1XG1 A;  4DOZ A;  5FB2 A;  2Y0S A;  2F4I A;  1WJB A;  3VOD A;  3WHC A;  4C3J J;  2ISY A;  2EBI A;  3DWL E;  4AD9 A;  4C9Y A;  5DDG A;  4JBA A;  1VQ9 I;  1OCC H;  3DEW A;  2O8K A;  5LHH A;  3RI4 A;  2R7O A;  2BW3 A;  4UHT A;  2L5Q A;  2QQA A;  5FKN A;  1BIB A;  1WJ5 A;  5E8I A;  5D4S A;  3EQL F;  5K7F A;  1VZ0 A;  3C18 A;  1W5S A;  4N9H A;  3KP3 A;  2YU9 J;  2DA4 A;  1KYW A;  3IC7 A;  3L2Q A;  1IUF A;  1VI0 A;  3FXQ A;  3ZQC A;  1X3U A;  4IQ4 A;  2E7X A;  3ROU A;  3ZOB A;  1QZE A;  3A01 B;  2E2I J;  2NOG A;  3OYD A;  4A0X A;  1XSV A;  2X6W A;  2DW4 A;  2GA2 A;  1T38 A;  3CMY A;  3E7L A;  1VF9 A;  3BR2 A;  3CJQ B;  4NC8 A;  2L7K A;  5CKT A;  1S6L A;  3ABK H;  4WXH A;  4CUG A;  1U5T A;  1X1B A;  5DCM A;  5EZG A;  4IVN A;  3HGG A;  3WTU C;  1X1A A;  2LK2 A;  3F8M A;  4HV5 A;  4XBF A;  3TL4 X;  3RKQ A;  1DGW Y;  3H5R A;  3PIP F;  2H27 A;  3I9V 2;  2XKP A;  4PGG A;  1BR2 A;  4PDK A;  3S2W A;  3OYF A;  5H2F C;  5IP6 A;  4A2U A;  4M9X A;  2CG4 A;  5HLI A;  2M9H A;  1IXS B;  1WJC A;  3LSM A;  4HF0 A;  2BW3 B;  3D5L A;  3H3Z A;  1J59 A;  2XGX A;  4ZYG A;  1SFE A;  2BY3 A;  3IWZ A;  2MLG A;  1MDM A;  2K02 A;  2ZNZ A;  4J01 A;  1Q1V A;  2ZJQ F;  2R7F A;  2PX9 A;  3HOX J;  1SD7 A;  5B1A H;  4WXD A;  2IS4 A;  4RM3 A;  4CCL A;  4KYW A;  3KFW X;  4FT8 A;  1EKE A;  1G59 A;  2V6E A;  3KP6 A;  1Z3Y A;  2CQX A;  3IKT A;  3BOQ A;  1LFB A;  1ODD A;  3SJM A;  1DGR M;  1A04 A;  4A3J J;  3RQI A;  5KCM A;  3I53 A;  2H6C A;  2FSW A;  3JW4 A;  3JCU C;  2MYS A;  2HYG D;  2B9S A;  1X1C A;  1HKS A;  4BEH A;  3H5A A;  4YG2 F;  1WJA A;  4II2 A;  2V7F A;  5CVR A;  5CVI A;  5IP7 J;  4ZYD A;  2FBH A;  3VEP A;  2LD5 A;  1BOA A;  3VPR A;  3ELK A;  2DQR A;  1XSX A;  1W4M A;  1GXQ A;  2ECB A;  1B1B A;  2A6E F;  2R7S A;  4E7H A;  2YPR A;  1ETY A;  2BY2 A;  2FXA A;  2LOO A;  3S32 A;  2Q0O A;  2ZXH A;  1RET A;  2E1M B;  5B1B H;  1LQ1 A;  2XAF A;  3PNY A;  5F0C A;  1X58 A;  4XN3 A;  1OPC A;  1DDN A;  1HDP A;  2HGC A;  1RZ4 A;  3FXO A;  3R61 A;  1IO2 A;  2FML A;  1LPQ A;  1D3Y A;  2HPI A;  3SQN A;  3WG7 H;  3C3W A;  2WY8 Q;  4BKX A;  1GUU A;  4AU7 A;  5FKO A;  3RZO J;  3F6V A;  1G3S A;  2EIJ H;  2BHY A;  3SYT A;  5LLQ A;  5LFA A;  1YJW I;  4BY7 J;  1KON A;  4CCO A;  2X6Y A;  5ILV A;  2G9W A;  1A31 A;  3I54 A;  5C3E J;  2VC0 A;  3A02 A;  3DPL C;  4IQJ A;  3VSK A;  2A5Y B;  3LSG A;  4XKC A;  4EAT A;  1OKR A;  1JUM A;  4CCK A;  3FXU A;  2R5Z B;  2RVC A;  3QOP A;  3GLX A;  4EVI A;  2G7U A;  1VQ7 I;  1R71 A;  2V9K A;  1H88 C;  1WJF A;  4FCY A;  3K4J A;  3OV8 A;  4L0Z B;  1Y8R B;  1ERD A;  2R7R A;  2FUG 2;  3BP8 A;  3LFU A;  1D1B A;  2CV0 A;  1TQM A;  1JTY A;  2GIZ A;  2K3F A;  1I39 A;  2R92 J;  4UUV A;  2VBY A;  4JQF A;  1MMA A;  3I58 A;  1MJ9 A;  4AID A;  3WOD F;  1KQ8 A;  3I5U A;  3BY6 A;  1BI2 A;  2XGE A;  4IO9 F;  2LY2 A;  1QPM A;  1TNT A;  1MSE C;  4F3Q A;  4OWR B;  3GVA A;  2J5P A;  3G1L A;  1BC7 C;  1L3L A;  2LKX A;  3U1K A;  2STW A;  2QM3 A;  1E3H A;  2X4H A;  5KK1 A;  4JX5 A;  3UR3 C;  3WGG A;  4OIR F;  1J5Y A;  1RNL A;  3F8F A;  3S17 J;  3A03 A;  4BJT A;  5K5O A;  2VQG A;  1TWC J;  4L9V A;  3W2A A;  2KQR A;  3ASN H;  1MMD A;  4YEJ A;  5L3C A;  1LDK B;  4E7J A;  1F43 A;  1TQI A;  3CCM I;  1V5G A;  2LFB A;  3BRO A;  3BG5 A;  5J1U A;  5HLT A;  3TO6 A;  1R5G A;  1IV6 A;  5IP9 J;  2DMQ A;  2G0E A;  4AUX A;  4XKW A;  3CJR B;  2L02 A;  3CF2 A;  3L1P A;  1ETX A;  3GX4 X;  1T6S A;  2VOD A;  4RGS A;  3QPL A;  4IRG A;  4Y33 A;  1SMT A;  2TDX A;  5C4X J;  2O0Y A;  4HX4 A;  1YO5 C;  3W2W A;  2HQR A;  1BM9 A;  4DYR A;  5F64 A;  1IN5 A;  1T0F A;  4HYE A;  5IPA A;  2PQ8 A;  1VQM I;  4IKF A;  3D1N I;  3DF8 A;  2O8X A;  3I59 A;  1R4M B;  3W2V A;  5GTH C;  3K4M A;  1FOK A;  3S2H J;  4QIW N;  1H8A C;  1V4R A;  2ESH A;  1GVD A;  5J1R A;  1ZHF A;  2EK5 A;  4BU2 A;  1BW5 A;  3FXJ A;  4XOP A;  5IYB J;  2ZO4 A;  3MKL A;  1I5Z A;  2ZFU A;  1Y56 A;  2R93 J;  5J6X A;  5K7H A;  1O3R A;  1LNW A;  2W25 A;  5HDN A;  2RQP A;  3BTJ A;  3IKV A;  1EH7 A;  2E7W A;  4ZTF A;  1F1Z A;  1LVK A;  1UJ8 A;  1O7F A;  2EB7 A;  2VQH A;  4D9J A;  4EJO A;  3K70 D;  2IGO A;  1B72 A;  2FJ1 A;  4UUT A;  4U87 A;  3D5S C;  5CPR B;  2E5Z A;  1OYI A;  3CJT B;  2CQ7 A;  3IWF A;  5DD4 A;  4E7Z A;  1TWA J;  1YJN I;  4Y7N J;  1IUY A;  2XPV A;  1TW2 A;  3LST A;  3CDI A;  4ENK A;  3C1D A;  2R5Y A;  3S3O A;  2IP2 A;  1U78 A;  1NK2 P;  1YG2 A;  4F91 B;  3RKX A;  1U5T C;  3GTK J;  1Z21 A;  3MQ0 A;  3Q0V A;  3BPX A;  1TP4 A;  2PLY A;  2OC6 A;  5ICE A;  3E5X A;  1GV2 A;  1FY7 A;  5IT9 Z;  1J7K A;  2GZW A;  4N4O B;  5DM7 F;  1ETQ A;  4I0B A;  2BOL A;  4HNU A;  3LSR A;  2QBY A;  2LY1 A;  2HOA A;  3I59 B;  4ZDL A;  1ZG1 A;  4IOC F;  2ELK A;  4NBQ A;  2Z16 A;  3KP7 A;  2WAD A;  2QEN A;  4Y4R A;  4Y3O A;  5DYM A;  2E1M C;  2IAI A;  4KNY A;  3K4C A;  3ZQQ A;  5LGN A;  5JLX A;  4RMN A;  1JKR C;  4WK8 F;  3W6K B;  4ENN A;  3BG9 A;  2YX4 A;  2OQG A;  4IL6 C;  4DIQ A;  1T08 B;  3BR1 A;  6PAX A;  1MBH A;  4JX6 A;  1FP1 D;  2A61 A;  4G12 A;  3RYR A;  1X2N A;  4EJU A;  1SFO J;  3CCS I;  3GTP J;  1XMX A;  2TRT A;  3LA7 A;  3SZP A;  3G4S I;  5E1X A;  4Z2Y A;  3OSG A;  3CCY A;  2QKM B;  2A07 F;  2KRH A;  3HPG A;  3E6D A;  2XV4 S;  1IJW C;  1K78 A;  3WU1 B;  3CLQ A;  1VQO I;  2JA2 A;  2JVH A;  2LRE A;  1QU3 A;  2R7V A;  2XRL A;  1X1D A;  4XM3 A;  5BQT A;  1T95 A;  3P9K A;  3QYE A;  3GEZ A;  3FK7 A;  4LLL A;  2L7Z A;  3L2U A;  1OCT C;  2ZME A;  3F8B A;  2HDW A;  1JT6 A;  3VB2 A;  4JK1 X;  4BS9 A;  5TIS C;  4A0Z A;  4Y13 A;  2EZK A;  3QAH A;  2QBY B;  2L7F P;  4V2F A;  2RGV A;  3H0D A;  1EV7 A;  4LIU A;  5FO5 A;  5HOD A;  2AO9 A;  5LGU A;  2HR3 A;  2X6O A;  3ESW B;  3Q9S A;  3QPH A;  2DOD A;  4BHC A;  2VPL A;  4M6V A;  1Z3X A;  3CTA A;  1LEB A;  1DQU A;  5TJJ A;  2QQB A;  2Y0S N;  5IY5 H;  2FNP A;  5F27 A;  4B47 A;  1YS7 A;  5J1Y A;  4ZDO A;  3OS0 A;  3I55 I;  5GAD J;  2K9L A;  4KN7 X;  4NQW B;  2XUB A;  2OD5 A;  3VYR B;  1M1E B;  2DJI A;  3E6C C;  3QU3 A;  4CHU A;  1Y0U A;  5ED4 A;  1KU7 A;  4UY8 I;  4FHT A;  3ZXS A;  3VWB A;  3AG1 H;  3LL7 A;  2F6C A;  2LR8 A;  3TW6 A;  3UNG C;  1JHF A;  2G7H A;  2EV0 A;  2YR2 A;  5HOO A;  3OOP A;  4PJN A;  1K78 B;  2PMU A;  1IN8 A;  2VQL A;  4ABZ A;  2IS6 A;  1FYM A;  2CFX A;  4G8X A;  4XSX F;  5K7Z A;  2ZXJ A;  1VQ5 I;  5F1J A;  1EF4 A;  2K9N A;  2Y2Z A;  1ZR2 A;  1OCP A;  2ZME B;  2LNB A;  2M45 A;  3DBL B;  4FX0 A;  1HXD A;  3OYG A;  4CYC B;  1BI1 A;  3EPZ A;  1YW9 A;  3C2G A;  1MGT A;  2XHK A;  3K70 C;  5BMZ A;  3QRF F;  1Z67 A;  3GZ6 A;  3FZV A;  2BBY A;  3HOY J;  2QGU A;  4J00 A;  4YFK F;  1YQA A;  3L7W A;  2HPM A;  1FJL A;  1TWF J;  4JP0 A;  1A6Q A;  4IX7 A;  1TT5 B;  1G3W A;  2CH0 A;  3V4G A;  4XL9 A;  1AOY A;  2F5V A;  1HOM A;  1Z77 A;  5IOZ A;  1GXP A;  3GZ5 A;  2ZJP F;  2AXL A;  2JUC A;  2R7W A;  2P0W A;  3OS2 A;  2V1N A;  3OS1 A;  3DKY A;  3NEU A;  5CQG A;  2DMU A;  2EA2 A;  2OTL I;  1KQ0 A;  4FTH A;  2M7B A;  3VYT B;  1MZB A;  3LWF A;  1WPK A;  2DJN A;  4BUP A;  5EGO B;  3ZCO A;  4I0A A;  4AIH A;  1DP7 P;  1HC8 A;  3K7A J;  1XGO A;  2IW5 A;  1ZGA A;  5HLG A;  3IAS 2;  4H0E A;  2RC4 A;  4AM3 A;  3O3K A;  5FLX K;  4GYG A;  2GWR A;  1Z9C A;  2GXB A;  2ZSH B;  4NB5 A;  4YRV A;  3PNV A;  1ZAR A;  5JI6 A;  2EFW A;  3OYA A;  2CS3 A;  1TT0 A;  2NS0 A;  2QSG X;  4LB6 B;  1T2K A;  3QQA A;  2V1X A;  2CUF A;  1LFP A;  2CSO A;  4RM2 A;  1E3P A;  4CGZ A;  4ENJ A;  4B1R A;  5KNL A;  2MBF A;  2ID6 A;  3QU6 A;  1XDU A;  1PJR A;  3K4K A;  5ERI A;  4G7H F;  3RZD J;  1XSD A;  5M3M J;  1IC8 A;  3GCM A;  1T0F C;  2E1C A;  2KRF A;  3ISP A;  2LRD A;  3M1C A;  2QQ9 A;  1T33 A;  3DKX A;  2E5N A;  3CCE I;  2HVS A;  2HDC A;  4KMU X;  4NUB A;  5E3N A;  3DV8 A;  5LEJ A;  2DFE A;  2VKE A;  2Y48 A;  1D1C A;  3JSP A;  3OMY A;  2ICW G;  1POG A;  4M72 A;  3HM5 A;  3BDD A;  2MD0 A;  2VN2 A;  1MBK A;  4PFP A;  2E34 A;  4EJW A;  3ZMV A;  3S1Q J;  4RGU A;  3CP8 A;  1IRF A;  2HOE A;  2AQE A;  4IXA A;  4B44 A;  2LDU A;  3KLN A;  2XDV A;  1YRN A;  2VJI A;  2CWE A;  4BJ6 C;  4E4H A;  2JRT A;  2HZD A;  4E7I A;  2VON A;  3S1M J;  3G2B A;  3OYI A;  2XAG A;  1KYZ A;  3CCU I;  1BR1 A;  2BVM A;  5D6E A;  5B5E C;  2HXI A;  5FJ8 J;  3S3M A;  1SFK A;  3LAP A;  1BOB A;  3GF2 A;  4RAZ A;  2F4O B;  3KLO A;  1HA8 A;  3JTG A;  4EQQ A;  4S05 A;  2CO5 A;  1RR8 C;  2LH9 A;  1J0R A;  1OIS A;  2BXY A;  3ABM H;  5D5W B;  5FRM A;  1AHD P;  3N97 A;  1FYK A;  4A6E A;  3CME I;  3CUO A;  4XLN F;  1P4X A;  1MNE A;  1XTA A;  1JJ8 C;  3TMO A;  3K2A A;  1IN7 A;  3S15 J;  4A69 C;  1HW5 A;  4RAF A;  1MKM A;  4C3H J;  1IN6 A;  2NS8 A;  4HA8 A;  3AG2 H;  4V2G A;  3K4L A;  1IZ1 A;  4HPQ A;  3J81 K;  3IAM 2;  3EYI A;  2DFF A;  4CXF A;  2HQ5 A;  2VJ5 A;  3JSO A;  1ULY A;  2A6H F;  1NG6 A;  1SAX A;  3QYB A;  3CLO A;  3EUH A;  1HBX G;  1RES A;  3P7N A;  2A6T A;  3G1M A;  4DYC A;  3MKW B;  1DU6 A;  3E5Q A;  4G6T B;  5DV5 A;  2UUZ A;  3ZRG A;  1FWZ A;  1YW8 A;  2KRC A;  3JRA A;  3KX2 A;  1YX3 A;  3DLA A;  1ORK A;  3KE2 A;  2X6X A;  2DK8 A;  3HTU A;  5E3O A;  2DCE A;  2VE8 A;  1XN7 A;  2O9L A;  5F0F A;  3CDL A;  1VQN I;  3SZG A;  3JRH A;  2VKH A;  3SFI A;  3JAM Z;  2F48 A;  5FD5 A;  3CC2 I;  4HX7 A;  5LD2 C;  2IT0 A;  4MNU A;  4WF2 A;  1FOX A;  2QLZ A;  3IH3 A;  1W7P B;  3ZMZ A;  2LY9 A;  3BCB A;  2ZME C;  2BY1 A;  2XRN A;  2MH2 A;  4KDP A;  3LMM A;  1FP2 A;  1MH3 A;  2LVS A;  3GBG A;  2LF8 A;  4AVZ A;  4I01 A;  2A5W A;  4I6Z A;  1YE9 A;  3WTY C;  1PP7 U;  4F7Z A;  3CD6 I;  2XF6 A;  4RGR A;  1OMI A;  4A3L J;  5FRO A;  3GME A;  1T56 A;  4XLP F;  3K4N A;  4YIR X;  1IW7 F;  1JHH A;  2WV1 A;  3BQZ A;  1VQ8 I;  3R4K A;  1F36 A;  1OR7 A;  2E1O A;  1WRJ A;  2JJ7 A;  4L18 B;  4FIS A;  2LLK A;  2J5O A;  4XON A;  5F0H A;  2MGQ A;  4W97 A;  1FBQ A;  1U6G A;  3GXO A;  4QPO A;  3BZC A;  2KL4 A; 
#chains in the Genus database with same CATH homology
 4P96 A;  3F72 A;  3BJA A;  3TOA A;  3HIF A;  4M9Z A;  3L9F A;  1FC3 A;  3R0J A;  2R7D A;  4E70 A;  2H6B A;  2P5L C;  2KIF A;  1WWX A;  3Q9V A;  3DP7 A;  4M74 A;  1R00 A;  3RKW A;  4UVA A;  3GFJ A;  3GFM A;  2PFB A;  3PFI A;  4P5O A;  4ZH4 F;  3E5U A;  5H6R A;  1F5T A;  3N4M A;  4M6X A;  2UWM A;  2D1H A;  2Z3Y A;  5HS9 A;  2H94 A;  3LQQ A;  2F5F A;  1RUO A;  3RYP A;  1QZZ A;  3HRT A;  5K1Y A;  2W24 A;  3M8F A;  1Z05 A;  1R1V A;  4HBL A;  2M5W A;  4KUM A;  3DQV C;  3LQR A;  1TBX A;  3FHZ A;  2JT1 A;  3DXJ F;  2M30 A;  4RGX A;  4EGZ A;  2IVM A;  2P5K A;  2Z99 A;  4UV9 A;  1H9G A;  2DT5 A;  1Q1H A;  2V1U A;  2OU2 A;  5KVR A;  4MTD A;  2P5V A;  1P6R A;  4TV7 A;  3ECH A;  1F9N A;  2VBX A;  3KEQ A;  4N9I A;  3FM5 A;  3ZQ7 A;  1ZN2 A;  1O57 A;  2F2E A;  3TDZ C;  1WKM A;  5K5Q A;  5D4R A;  1ZRC A;  2JPB A;  2YSR A;  2FBI A;  5A2Q K;  1DUX C;  3E6M A;  3HHG A;  2NRA C;  5AIQ A;  4EM1 A;  1V3F A;  3ML6 A;  3HOS A;  4Q4Z F;  1S3J A;  3SFZ A;  4R79 A;  5CVU A;  3FX3 A;  4CDG A;  1ZRD A;  1BC8 C;  1TW3 A;  1FSH A;  4HX8 A;  4G7O F;  1G6N A;  2EWN A;  1KU9 A;  2QWW A;  4O5V A;  1RIO H;  5FD6 A;  1LVA A;  2QZ8 A;  4RB0 A;  5BPD A;  5JHU A;  2W57 A;  2EJR A;  2BV6 A;  1XGS A;  5LHG A;  3L09 A;  2XVC A;  4A12 A;  2O6G E;  2FEZ A;  3U9G A;  2JZY A;  3LFK A;  2MH9 A;  4PZJ A;  5E1W A;  2PN6 A;  4HF2 A;  4L5I A;  2ZFW A;  2MD5 A;  1B9N A;  1JGS A;  3I0T A;  4AIJ A;  4RAY A;  1I27 A;  4O3M A;  3PQK A;  2KJB A;  4U7D A;  5HS8 A;  4AVP A;  1ZLJ A;  3F6O A;  4OMY A;  5H6Q A;  3ZMD A;  4Q5S F;  2IA2 A;  3P9I A;  3HSF A;  1XGN A;  4HDU A;  3WGI A;  1B9M A;  2ZBK A;  1LDD A;  5F6F A;  4OIN F;  2O3F A;  4WXC A;  5TRD A;  2HEO A;  2Q8K A;  3ZPL A;  3HRS A;  2OQR A;  3KCC A;  2UXN A;  1J75 A;  2C6Y A;  4UVB A;  4LB5 A;  4IRI A;  1D5V A;  2HKX A;  5EEH A;  4HZF A;  3HOT A;  3KP4 A;  4MGR A;  4L9J A;  5EEG A;  1DPU A;  4LG0 B;  5D5X B;  3V7S A;  2HWV A;  4I02 A;  5E18 F;  1ZH5 A;  2M87 A;  4B09 A;  3RJP A;  4NQW A;  3R60 A;  3GFL A;  4M9S A;  1NHA A;  3RIR A;  4XRF A;  2F5E A;  3SXY A;  4BQA A;  2MA3 A;  1KA8 A;  1R7J A;  2JSC A;  1R1U A;  2QYO A;  4U0W A;  2NNY A;  1FNN A;  2OZU A;  3MAJ A;  3O6B B;  1XCB A;  1SD4 A;  2ZNY A;  2PBI A;  5HLH A;  4OIP F;  2KIU A;  4ASN A;  2GXG A;  4L5J A;  2DPU A;  2LSO A;  3G73 A;  3RPQ A;  3U1D A;  1XB4 A;  2EV5 A;  2K7L A;  1LDJ A;  3NRV A;  1EH6 A;  4ZYH A;  2CGP A;  3K2Z A;  3LAJ A;  5JVT A;  3G3Z A;  4A5M A;  5D6F A;  5E20 A;  2VE9 A;  4A6D A;  2W85 A;  3PQJ A;  1HW2 A;  3M7G A;  2HFH A;  2LKP A;  4NHJ A;  3EET A;  1D8J A;  1JE8 A;  1R1T A;  2ZKZ A;  4OIQ F;  2PG4 A;  2YU3 A;  5LEK A;  4P9F A;  3C7J A;  4Q48 A;  2OA4 A;  5BS6 A;  1YIO A;  4EMS A;  4DQ2 A;  4OMZ A;  3TDU C;  4G6Q A;  1FLI A;  2FF4 A;  4D0P A;  3HSE A;  3SZT A;  3CO7 C;  1BI3 A;  2O03 A;  1I1G A;  4EM2 A;  2WC2 A;  4KIC A;  4EJV A;  1S7O A;  5D5U B;  5J8C A;  1UHW A;  3L00 A;  3DPT A;  2IJL A;  3ZMU A;  4YFX F;  4KFC A;  4G94 A;  2X0L A;  2Y0M A;  4KIG A;  1QBJ A;  3Q5F A;  1SD5 A;  1IN4 A;  1PP8 F;  2CYY A;  4IHS A;  2PI0 A;  4CZZ A;  3DKW A;  1DPR A;  4MQV A;  1USS A;  4ESF A;  1K6O A;  2L01 A;  5FLX Z;  3HSR A;  4LD5 A;  2VOO A;  5DUK A;  4Y15 A;  1IRG A;  2WWY A;  2BE5 F;  4EV0 A;  1H9T A;  1T98 A;  5FFZ A;  1ZRE A;  3F8N A;  1R22 A;  4BHB A;  2HTS A;  3L2C A;  2VXZ A;  1HKQ A;  2V6C A;  2Z9O A;  3TO7 A;  4LMY A;  4ESB A;  1XCV A;  3T8R A;  1IXR C;  3ABU A;  3FMS A;  3DFG A;  4MEY F;  2DI3 A;  4Q47 A;  3RPU A;  2XRO A;  3EYY A;  3LA2 A;  3MFK A;  3JTH A;  4U0Y A;  4IPA A;  3J80 K;  3E97 A;  1P4W A;  1OYY A;  2NNN A;  4EM0 B;  2Z5U A;  3GWZ A;  2HQN A;  1XD7 A;  2STT A;  5E8G A;  1W7P A;  3I71 A;  5E1Z B;  2FBK A;  4M71 A;  1U8R A;  1B4A A;  3I64 A;  5HDG A;  3J81 Z;  4G9Y A;  2DFI A;  4CO8 A;  4O6J A;  4IRH A;  4IJA A;  4HLX A;  1PUE E;  4L0Y B;  4U88 A;  2RV8 A;  3CDH A;  2V79 A;  1BIA A;  2P6S A;  5K5R A;  1R58 A;  3ZP5 A;  3EDP A;  3T0Y A;  2RDP A;  1VTN C;  5ICC A;  3NQO A;  3ULQ B;  3BJO A;  2DK5 A;  1UST A;  2PEX A;  1U3E M;  4GXO A;  5BOX A;  4MEX F;  4GCV A;  4IHT A;  3FF5 A;  3JAM K;  1ZLK A;  3KZY A;  1RI7 A;  3F23 A;  3AAF A;  3HTS B;  2L54 A;  3WGH A;  2ZCW A;  3M8E A;  3TGN A;  4HW0 A;  1W5T A;  1H0M A;  4LK1 F;  1WI9 A;  2UXX A;  2UZK A;  2FQ3 A;  1STZ A;  1ON2 A;  2FMY A;  2COM A;  1O3S A;  2QUF A;  1MJB A;  3HRU A;  1KU2 A;  3K1P A;  3ZMS A;  1W7P D;  1OYW A;  1LB2 A;  3KP5 A;  4ENM A;  4CYD A;  3IHU A;  2L4A A;  5D8K B;  3WG9 A;  4EJT A;  1P4A A;  3FWE A;  2GA1 A;  4HOB A;  1L0O C;  1UFM A;  1IF1 A;  4LGW A;  1B59 A;  2DU9 A;  2XAQ A;  3WTT C;  2WV0 A;  3FMQ A;  5IT3 A;  3J7A O;  1SMY F;  3V7C A;  4KIF A;  4OU0 A;  3HUG A;  2K4J A;  3BWG A;  4WX9 A;  1TNS A;  3E6B A;  3GW2 A;  2MC3 A;  4OOI A;  3F8C A;  5ICF A;  1BN5 A;  2W84 A;  3WTS C;  3CUQ A;  2ETH A;  2A69 F;  3F22 A;  3HYI A;  1G4D A;  1MD0 A;  1ZRF A;  1T39 A;  1Z7U A;  1U2W A;  1E17 A;  1IAW A;  2HTJ A;  1TQP A;  2GQQ A;  1GHC A;  1XGM A;  4ZZL A;  4IF4 A;  2XKO A;  5D5V B;  2DPD A;  5FGM A;  2M1B A;  4GO1 A;  1U5T B;  3GFI A;  4KN4 X;  5DCM B;  2OBP A;  1MJA A;  4MTE A;  2GIV A;  1FX7 A;  5BPI A;  2LF7 A;  4I98 B;  5LGT A;  3RDI A;  3MCZ A;  2VC1 A;  1FPQ A;  1Z6T A;  4HLY A;  1SFX A;  2ACJ A;  2MLK A;  4N0B A;  2RN7 A;  1XMK A;  2DO7 A;  4UVC A;  3T1B A;  4U7B A;  4BXU A;  1S29 A;  1MDM B;  3TQN A;  4KMF A;  5A2Q Z;  4BH9 A;  3V8L A;  2IA1 A;  3RKY A;  3ZN1 A;  1ZG3 A;  4FX4 A;  1WQ2 A;  3CUQ B;  5LRS A;  1FZP B;  4P9U A;  1FYL A;  1SFU A;  3COA C;  3K1N A;  3R0A A;  2CQK A;  1REP C;  4HV6 A;  3CJN A;  2XAH A;  1P2F A;  1ZAO A;  1QNT A;  2BGC A;  1R23 A;  5HDK A;  2PMH A;  4KA4 A;  2YX7 A;  5L3B A;  3ABT A;  1FSE A;  5F1R A;  3DEU A;  2P7C B;  3F21 A;  3WU0 A;  1UCR A;  4B8X A;  2VT3 A;  3WTZ A;  5JR3 A;  2ADU A;  2EFP A;  3HRM A;  1HKT A;  3QPT A;  4M6Y A;  1B6A A;  1P92 A;  2IRF G;  3B73 A;  2ESN A;  2P6T A;  1QGP A;  1I1S A;  2P7V B;  1E2X A;  3VFZ A;  4MQ9 F;  1R36 A;  4ON0 A;  2FNA A;  5DEQ A;  5D8L B;  3RTR A;  2KKO A;  1UHM A;  3O2P E;  2IA0 A;  3K9T A;  3K69 A;  1G3T A;  4GGG A;  2DTR A;  1BI0 A;  4QWQ A;  2XAS A;  2F5C A;  4LG0 A;  3FXR A;  3WE2 A;  1XMA A;  4PCQ A;  4BAY A;  4L9N A;  4LK0 F;  3BJ6 A;  1K79 A;  2VOP A;  2VBZ A;  1Z1D A;  2K4B A;  2B0L A;  4PGH A;  2EFQ A;  3D0S A;  2KJC A;  2V1D A;  4UXN A;  3W6J B;  2XIG A;  3SHF A;  2A68 F;  1HST A;  4R8H A;  2RNJ A;  3IRQ A;  4RB1 A;  1O7L A;  3QP6 A;  3T8T A;  4HF1 A;  3V7R A;  5HS7 A;  2HS5 A;  4MHG A;  3MEX A;  2WTE A;  2FA5 A;  1LEA A;  4I7H A;  3REO A;  4KT5 C;  4KIB A;  5DUI A;  3MWM A;  3KEO A;  1HSJ A;  2AS5 F;  3FM3 A;  3VOE A;  5IT9 K;  1K7A A;  5LBQ A;  3FMR A;  3K1M A;  5CLS A;  4I2O A;  3WTV C;  2NYX A;  2ELH A;  3I4P A;  4K2E A;  2RKH A;  2OAZ A;  1QZY A;  3M1E A;  4GYI A;  2E1N A;  5L3E A;  3GUD A;  1QO0 D;  5ILS A;  2D2W A;  4BHP A;  5LHI A;  2K86 A;  3CUQ C;  3IRR A;  3KET A;  2EV6 A;  2DBB A;  1FT9 A;  1CF7 A;  4RS8 A;  1J9I A;  5J8F A;  1PDN C;  4L9T A;  1WSU A;  2EFN A;  1SD6 A;  3P9C A;  3BPV A;  1JXS A;  1YS6 A;  5AIP A;  4UNO A;  5ICG A;  2D1V A;  2QVO A;  1KGS A;  3GYH X;  2HYF A;  1FBU A;  4R1H A;  1ON1 A;  3F3X A;  4Y17 A;  1IXC A;  2HKO A;  2Y75 A;  3WTX C;  4ESJ A;  3ZMT A;  1KQ9 A;  1YYV A;  1C0W A;  5CVJ A;  3ZN0 A;  1F4K A;  4ZYE A;  2EFO A;  2V9V A;  2Z33 A;  5JFR A;  4LFU A;  2KIM A;  2O61 A;  1CF7 B;  3KZZ A;  1Z91 A;  4LLN A;  1HW1 A;  4WWC A;  1J2X A;  2ZJ2 A;  1YFH A;  2DQL A;  2GAU A;  3U2R A;  5L3G A;  5E17 F;  2JPC A;  1HQC A;  4YII A;  3CO6 C;  3WE3 A;  2ISZ A;  1YTY A;  3B02 A;  3QP5 A;  1XDS A;  4A0Y A;  3MZH A;  1ZGJ A;  5LRR A;  2FOK A;  4QLC U;  4M73 A;  5CVV A;  4ZZD A;  4ETS A;  5ILU A;  2FRH A;  3ECO A;  2HZT A;  5DCF A;  5AON A;  4AWX B;  2PJP A;  2XAJ A;  2DAO A;  1YW7 A;  2K27 A;  2P8T A;  4UV8 A;  3H92 A;  2A3S A;  4HQM A;  2L3D A;  4LLG F;  1RUN A;  4G7Z F;  4YFN F;  3M9A A;  1TTY A;  2BYV E;  1S8N A;  3E3V A;  2M8E A;  3HHH A;  1O3Q A;  2L4M A;  4BYY A;  2P4W A;  3T5X A;  1G3Y A;  1S7A A;  1YLF A;  1UB9 A;  4XSZ F;  1ONV A;  1ZYR F;  4G6D A;  1FBS A;  2VBW A;  3TO9 A;  2FE3 A;  3KP2 A;  1QQI A;  3IL2 A;  2R3S A;  4A5N A;  3J80 Z;  3MZY A;  4U0V A;  2BEO A;  2OZ6 A;  2H09 A;  4HAM A;  4DNC A;  1GVJ A;  3V8J A;  4S04 A;  3LA3 A;  2Q2E A;  1I6X A;  3WTW C;  1O3T A;  5CJ9 A;  5HVQ C;  2IPQ X;  3ERE D;  1KU3 A;  1R5H A;  3R6S A;  1TLH B;  5L3D A;  4CIC A;  4RB3 C;  1D8K A;  3TKY A;  4OIO F;  5L3F A;  3H3U A;  1Z6R A;  1BBY A;  2JTV A;  4YIF A;  5CYV A;  2DLL A;  4WCG A;  2NAZ A;  3K0L A;  3BZ6 A;  1EH8 A;  4AIK A;  1CGP A;  4EGY A;  5DD8 A;  4RB2 C;  2CW0 F;  3GO5 A;  4HDV A;  4I09 A;  3V8K A;  5H20 A;  4LJZ F;  4P55 A;  1LJ9 A;  1ZG5 A;  1AWC A;  2EA4 A;  4BNC A;  3TOB A;  2VT2 A;  4HQE A;  2D45 A;  2FU4 A;  2F5D A;  5FB2 A;  3VOD A;  2ISY A;  4AD9 A;  5DDG A;  4JBA A;  5LHH A;  3RI4 A;  4UHT A;  2QQA A;  1BIB A;  5E8I A;  5D4S A;  3EQL F;  3C18 A;  1W5S A;  4N9H A;  3KP3 A;  1KYW A;  3IC7 A;  3FXQ A;  1X3U A;  2E7X A;  3ROU A;  4A0X A;  1XSV A;  2DW4 A;  2GA2 A;  1T38 A;  1S6L A;  4WXH A;  1U5T A;  5DCM A;  4IVN A;  3WTU C;  3F8M A;  4HV5 A;  4XBF A;  2H27 A;  2XKP A;  4PGG A;  4PDK A;  3S2W A;  4A2U A;  4M9X A;  2CG4 A;  5HLI A;  1IXS B;  4HF0 A;  3D5L A;  3H3Z A;  1J59 A;  2XGX A;  4ZYG A;  1SFE A;  3IWZ A;  2MLG A;  1MDM A;  2K02 A;  2ZNZ A;  2R7F A;  1SD7 A;  4WXD A;  4KYW A;  3KFW X;  4FT8 A;  3KP6 A;  3IKT A;  3BOQ A;  1ODD A;  1A04 A;  3I53 A;  2H6C A;  2FSW A;  3JW4 A;  2HYG D;  1HKS A;  4YG2 F;  5CVR A;  5CVI A;  4ZYD A;  2FBH A;  3VEP A;  1BOA A;  3ELK A;  2DQR A;  1XSX A;  1W4M A;  1GXQ A;  1B1B A;  2A6E F;  2YPR A;  2FXA A;  2Q0O A;  1LQ1 A;  2XAF A;  1OPC A;  1DDN A;  3R61 A;  2HGC A;  1RZ4 A;  2FML A;  1D3Y A;  3SQN A;  3C3W A;  3F6V A;  1G3S A;  5LLQ A;  5ILV A;  2G9W A;  3I54 A;  2VC0 A;  3DPL C;  2A5Y B;  1OKR A;  3FXU A;  2RVC A;  3QOP A;  3GLX A;  4EVI A;  2G7U A;  3OV8 A;  4L0Z B;  3BP8 A;  1TQM A;  4UUV A;  2VBY A;  4JQF A;  3I58 A;  1MJ9 A;  3WOD F;  1KQ8 A;  3I5U A;  3BY6 A;  1BI2 A;  1QPM A;  1TNT A;  3GVA A;  2J5P A;  1BC7 C;  1L3L A;  2STW A;  2QM3 A;  2X4H A;  5KK1 A;  3WGG A;  4OIR F;  1J5Y A;  1RNL A;  3F8F A;  5K5O A;  4L9V A;  5L3C A;  1LDK B;  1TQI A;  3BRO A;  3TO6 A;  1R5G A;  2L02 A;  3GX4 X;  1T6S A;  2VOD A;  4RGS A;  4IRG A;  1SMT A;  2TDX A;  2O0Y A;  4HX4 A;  1YO5 C;  2HQR A;  1BM9 A;  5F64 A;  1IN5 A;  1T0F A;  4HYE A;  2PQ8 A;  3DF8 A;  2O8X A;  3I59 A;  1FOK A;  1V4R A;  2ESH A;  1ZHF A;  2EK5 A;  2ZO4 A;  1I5Z A;  5J6X A;  1O3R A;  1LNW A;  2W25 A;  5HDN A;  2RQP A;  3IKV A;  1EH7 A;  2E7W A;  4EJO A;  1F1Z A;  1O7F A;  2EB7 A;  1OYI A;  5DD4 A;  3IWF A;  1IUY A;  1TW2 A;  3LST A;  4ENK A;  3C1D A;  2IP2 A;  1U78 A;  1YG2 A;  3RKX A;  1U5T C;  3MQ0 A;  3BPX A;  2PLY A;  5ICE A;  3E5X A;  1FY7 A;  5IT9 Z;  1J7K A;  2GZW A;  4I0B A;  2QBY A;  3I59 B;  1ZG1 A;  3KP7 A;  2QEN A;  5DYM A;  4KNY A;  5LGN A;  4WK8 F;  3W6K B;  4ENN A;  2YX4 A;  2OQG A;  6PAX A;  1FP1 D;  2A61 A;  3RYR A;  4EJU A;  3LA7 A;  3SZP A;  5E1X A;  4Z2Y A;  2A07 F;  3E6D A;  2XV4 S;  1K78 A;  3WU1 B;  5BQT A;  3P9K A;  3GEZ A;  4LLL A;  2ZME A;  3F8B A;  3VB2 A;  4JK1 X;  4A0Z A;  4Y13 A;  3QAH A;  2QBY B;  2RGV A;  1EV7 A;  5FO5 A;  5LGU A;  2HR3 A;  3Q9S A;  3QPH A;  4BHC A;  3CTA A;  1LEB A;  5TJJ A;  2QQB A;  2FNP A;  1YS7 A;  4KN7 X;  2XUB A;  2OD5 A;  3E6C C;  3QU3 A;  4CHU A;  1Y0U A;  5ED4 A;  1KU7 A;  4FHT A;  1JHF A;  2G7H A;  2EV0 A;  5HOO A;  2YR2 A;  3OOP A;  1K78 B;  2PMU A;  1IN8 A;  1FYM A;  2CFX A;  4G8X A;  4XSX F;  2ZXJ A;  2ZME B;  2LNB A;  2M45 A;  4FX0 A;  1HXD A;  1BI1 A;  1YW9 A;  1MGT A;  2XHK A;  5BMZ A;  3QRF F;  3GZ6 A;  3FZV A;  2BBY A;  4YFK F;  1YQA A;  3L7W A;  1G3W A;  3V4G A;  1AOY A;  1GXP A;  3GZ5 A;  2AXL A;  3NEU A;  2EA2 A;  1KQ0 A;  1MZB A;  3LWF A;  4I0A A;  4AIH A;  1DP7 P;  1XGO A;  2IW5 A;  1ZGA A;  5HLG A;  4H0E A;  2RC4 A;  3O3K A;  5FLX K;  4GYG A;  2GWR A;  1Z9C A;  2GXB A;  4NB5 A;  1ZAR A;  5JI6 A;  2EFW A;  2NS0 A;  4LB6 B;  1T2K A;  2V1X A;  4CGZ A;  2CSO A;  4ENJ A;  2MBF A;  3QU6 A;  1XDU A;  5ERI A;  4G7H F;  1XSD A;  2E1C A;  2KRF A;  3ISP A;  2QQ9 A;  2HDC A;  4KMU X;  3DV8 A;  5LEJ A;  2Y48 A;  3JSP A;  4M72 A;  3BDD A;  2VN2 A;  4EJW A;  3ZMV A;  4RGU A;  1IRF A;  2HOE A;  4IXA A;  2LDU A;  3KLN A;  2CWE A;  2JRT A;  2VON A;  2XAG A;  1KYZ A;  5D6E A;  3LAP A;  3GF2 A;  4RAZ A;  3KLO A;  3JTG A;  4EQQ A;  4S05 A;  2CO5 A;  1J0R A;  5D5W B;  3N97 A;  1FYK A;  4A6E A;  3CUO A;  4XLN F;  1P4X A;  1IN7 A;  1HW5 A;  1MKM A;  1IN6 A;  4HA8 A;  1IZ1 A;  3J81 K;  3EYI A;  4CXF A;  3JSO A;  1ULY A;  2A6H F;  1SAX A;  3CLO A;  3EUH A;  1HBX G;  3P7N A;  3E5Q A;  5DV5 A;  1FWZ A;  1YW8 A;  3KE2 A;  2DK8 A;  3HTU A;  2VE8 A;  1XN7 A;  3JAM Z;  5FD5 A;  4HX7 A;  2IT0 A;  4MNU A;  4WF2 A;  2QLZ A;  1W7P B;  3ZMZ A;  2XRN A;  2MH2 A;  4KDP A;  1FP2 A;  2LF8 A;  4I01 A;  3WTY C;  1PP7 U;  4F7Z A;  4RGR A;  1OMI A;  4XLP F;  1IW7 F;  1JHH A;  3R4K A;  1OR7 A;  1WRJ A;  4L18 B;  2J5O A;  1FBQ A;  1U6G A;  3GXO A;  1BJA A;  5FFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...