4UNOA

Crystal structure of the ets domain of human etv5 in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
b'SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 5
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4unoA00
5D8LB 3MFKA 1KU9A 4MGRA 2QVOA 2O6GE 2BGCA 3Q5FA 5CVVA 1KA8A 5HS9A 1U6GA 1R5GA 2OZUA 1O7LA 4OIPF 2OQRA 2EWNA 2FQ3A 3J81Z 4NHJA 1T98A 2A07F 4KFCA 1O3RA 1KU3A 3DQVC 3LQQA 3C1DA 4HDUA 2PN6A 2EFPA 1P92A 3GYHX 2OD5A 4A5NA 2YR2A 3VEPA 2HR3A 5E8IA 1XMKA 3GEZA 1JHFA 4L9VA 4M71A 5K5QA 1JHHA 1IN4A 2FU4A 2VC1A 4L9TA 4I7HA 2W85A 4FT8A 5ICEA 3BPXA 3J80K 5DD4A 1L3LA 1Z91A 3FM5A 3HSRA 4IXAA 5CLSA 3WGGA 1JE8A 2B0LA 2H6CA 3U9GA 3EDPA 2PMHA 2M5WA 3HSFA 5ILVA 4ZZLA 2O3FA 3TOBA 2E7WA 3NRVA 5HLGA 1IXCA 5E1WA 1R1TA 5IT9Z 1IZ1A 2MLKA 3FMSA 1O7FA 1IN6A 2WV0A 3R0JA 2W24A 4U7DA 1KQ0A 4KUMA 2D2WA 2L02A 3RPQA 3QPTA 2HZTA 4L5JA 2CYYA 3U2RA 1WSUA 2A68F 4NB5A 3RKYA 2BBYA 2M1BA 2ZNYA 2F5DA 5IT3A 4KDPA 5TJJA 2VE9A 1MGTA 4EGZA 3KETA 1YS7A 3W6JB 2K4BA 2GAUA 3LQRA 3T5XA 2ZMEA 2O03A 5HS7A 2P8TA 4IRIA 3O6BB 1R00A 4DNCA 2FBKA 4U0YA 2G7UA 4L9NA 2PEXA 3RI4A 4Q47A 3TDUC 1YS6A 1QZYA 3E5QA 2EV0A 4HQEA 4AWXB 1BI3A 5FB2A 2QM3A 4EVIA 2DPUA 3VB2A 1VTNC 2P6TA 4QLCU 4LLNA 3C3WA 1G4DA 1K79A 4HV6A 1MJ9A 1XSXA 2LDUA 2EV5A 5FD6A 1PP8F 3ELKA 1ZRDA 4M74A 4P9FA 3KP6A 1LDJA 2HTJA 1BC8C 4L5IA 4G8XA 5KVRA 2F5CA 2YX4A 3ABTA 1G3YA 1E2XA 2RNJA 3L9FA 3M1EA 4CYDA 1U3EM 2D1VA 3IRRA 3I64A 2FSWA 2HYFA 3V7CA 1B6AA 2H94A 4YIFA 3GZ5A 2G7HA 3NQOA 1FP2A 4R8HA 3RYPA 1OPCA 3HTSB 2XGXA 5JI6A 3HTUA 1HXDA 2VONA 4EQQA 3K9TA 4YG2F 5D6FA 2CSOA 2YX7A 4GGGA 3RDIA 1BI2A 5ICFA 4MTDA 4BNCA 1Z6RA 3R61A 4F7ZA 4I01A 3ZN1A 5HLHA 1A04A 3QPHA 2A6EF 5E18F 2TDXA 1TNTA 1YIOA 3COAC 4HLXA 2KJCA 4OIQF 3N97A 5FFZA 1USTA 2A6HF 2FMLA 3K2ZA 3Q9SA 1STZA 2EA4A 3KFWX 4KIFA 3CLOA 3TDZC 3CUOA 4WXDA 1REPC 3ZP5A 2FA5A 4LMYA 1ZGJA 4ZYEA 4PGHA 3I54A 5ICGA 1HW5A 2ELHA 2DO7A 2IP2A 4YFKF 4HQMA 4RB2C 3MZHA 4N9IA 1H0MA 2CGPA 4G7ZF 4CHUA 4KN7X 5LHGA 3H3UA 5DCMB 2RDPA 2STWA 5KK1A 2L3DA 3HHHA 2KJBA 4U0WA 4CICA 2IA0A 2OA4A 1IXRC 1YW7A 3J81K 2HWVA 3FM3A 1XSDA 4HZFA 5E17F 4MHGA 1DP7P 3J80Z 2VXZA 4OIRF 3ZMDA 2K86A 2HDCA 4Y13A 4RGUA 4XBFA 4RB1A 2HEOA 1ZH5A 3TO9A 1WRJA 2VN2A 5BOXA 3QOPA 1ZAOA 2WC2A 3M8FA 1H9TA 1LJ9A 2QWWA 2PG4A 5D8KB 4HW0A 2GWRA 5D5XB 3ZPLA 3LSTA 1T0FA 4OINF 4BHBA 5IT9K 3HHGA 2IW5A 2ZNZA 1FYKA 1B9NA 3MCZA 4LG0A 3E97A 2XUBA 4AIJA 3CUQA 4B09A 1J9IA 3FWEA 4MEYF 1SD7A 1FBUA 1P4XA 4GO1A 1RI7A 2LKPA 4KYWA 3GFJA 5JHUA 1BI1A 1TQMA 3WTVC 2DI3A 1DDNA 2RN7A 2V79A 5DYMA 3K1NA 4P55A 1V3FA 1BBYA 5JR3A 2M30A 1P4AA 2FEZA 2L01A 2LNBA 5EEHA 2LSOA 1H9GA 1CGPA 1SD4A 3WTXC 4LG0B 3LA7A 5E20A 2ZCWA 2Q2EA 5D6EA 1ZG5A 2GZWA 2HS5A 2ZJ2A 3ROUA 5D4RA 2QYOA 4XSXF 2A3SA 3FMQA 1G3TA 2XHKA 1HKQA 1ZHFA 3FF5A 1FP1D 3V8KA 3HRSA 2LF7A 2F5EA 2H09A 4L0ZB 2EFQA 3KCCA 4EJWA 2QZ8A 5F6FA 1FT9A 3ECOA 1TTYA 5J8FA 4Q4ZF 3T8RA 1ON2A 4P5OA 3WGHA 2G9WA 1IAWA 3E5UA 3FHZA 5DD8A 2QUFA 4G9YA 2UXXA 3OOPA 1ZLKA 2XAGA 2GQQA 3KP2A 5TRDA 1U5TA 2P5KA 3LA3A 4RAZA 3BJOA 2IA1A 4L9JA 1OR7A 1U8RA 2Y75A 1FSHA 5BMZA 1T6SA 1YQAA 1UCRA 4UVAA 4L0YB 3GUDA 1FYLA 4M6XA 1OYYA 1U78A 1JXSA 2O0YA 4R79A 1IF1A 3LFKA 3B73A 3FXUA 4LLLA 4RAYA 3K0LA 2V1XA 2EFWA 5FGMA 4A12A 1B59A 1YO5C 5BPDA 2W84A 1ODDA 1O3SA 2KIFA 5AIQA 2JSCA 3ZMTA 1ZRCA 1ZREA 1SD6A 1IN7A 2JZYA 4D0PA 3WTTC 3LAPA 2ZXJA 2XAJA 1QO0D 5CYVA 3KP7A 5F1RA 1ZRFA 2IA2A 3HOSA 5LHIA 3GFLA 2GXGA 2ZKZA 1FBSA 4EJVA 3R4KA 2FF4A 4I09A 4IRHA 4M9XA 4EM2A 2QBYA 1KYZA 4G7OF 5H6QA 3ZMUA 1RZ4A 2NNNA 3HOTA 1B1BA 1B4AA 2OQGA 3ZN0A 4TV7A 2STTA 1XGNA 2UWMA 4CXFA 1LDKB 2EK5A 3O3KA 4HYEA 3GZ6A 1YTYA 2F5FA 1BC7C 1LB2A 1IUYA 3KE2A 2HOEA 1J0RA 3JSPA 5L3CA 2FMYA 2Z9OA 5DUIA 4UV9A 3RTRA 2H6BA 1Y0UA 1EH6A 5FD5A 3BJAA 5AONA 4IJAA 1F9NA 3G3ZA 3CJNA 4BH9A 3F21A 1HSTA 3VODA 2JRTA 1YYVA 3WG9A 4YFXF 2QBYB 4JBAA 2EA2A 2BV6A 5LGNA 3D5LA 4BAYA 4XLPF 1Q1HA 1YLFA 1XN7A 5BPIA 1ZG3A 1J5YA 2DT5A 5J6XA 5F64A 1QBJA 4ESJA 4MEXF 4WF2A 4LFUA 1ZLJA 4L18B 3EYIA 2NYXA 1OYWA 3RYRA 1K6OA 2NRAC 4IHSA 1JGSA 4ETSA 1W4MA 5DV5A 4UNOA 1QNTA 3JAMK 4WK8F 2DPDA 3L7WA 5LHHA 4M72A 1D5VA 2DW4A 1FBQA 1AWCA 2FBHA 4ZYGA 2P4WA 4LK0F 2ZBKA 4ESBA 2X0LA 4Y15A 4MTEA 5K1YA 1SFXA 1YG2A 2ESHA 1MD0A 3JTHA 3C18A 4XLNF 3ULQB 2R3SA 3BOQA 3SXYA 1S29A 5CVJA 2DTRA 1D8KA 5E1ZB 1QGPA 2PJPA 2XROA 1QZZA 2WWYA 2V1UA 4Q5SF 3T8TA 1IRFA 1WKMA 4PCQA 4KIGA 2EV6A 4GCVA 1HW1A 5DDGA 3F8NA 1HSJA 4BYYA 5ERIA 3V7SA 3E3VA 4ENKA 2YPRA 3TO7A 1C0WA 2CWEA 3L00A 1LDDA 2XV4S 2HTSA 2GIVA 1O3QA 1W7PB 1HQCA 2DQLA 3PQJA 1S7AA 2BEOA 3CUQC 3FZVA 3WTYC 5CJ9A 4WXCA 3WODF 3M9AA 1FZPB 3WE2A 2F2EA 4O6JA 4JQFA 2D1HA 1K7AA 4MNUA 5LGUA 4KT5C 2CG4A 5DCMA 1LQ1A 3BPVA 1IN5A 6PAXA 4FX0A 1FWZA 4A5MA 4N9HA 1TBXA 4EV0A 3C7JA 3FMRA 3S2WA 5HVQC 3U1DA 4WWCA 4HX7A 3ZMSA 5HDKA 5ED4A 3I58A 1SMYF 1ZYRF 2HFHA 2J5PA 1LEBA 4S04A 3V8LA 3TO6A 1ZGAA 3I4PA 1Z7UA 4KN4X 4M73A 3NEUA 2AS5F 5K5OA 3KP4A 3ISPA 4ENNA 2V6CA 4IHTA 2QENA 4G7HF 3QU3A 4PGGA 2RGVA 4IPAA 1F1ZA 3E5XA 2V9VA 2Y48A 1YFHA 2OBPA 1TQIA 3E6BA 5BQTA 4HX8A 1R7JA 2DFIA 1S7OA 4CO8A 2ETHA 4HX4A 5E8GA 2ADUA 2FNPA 2HQNA 4YFNF 4BQAA 3HIFA 3DXJF 3FXRA 1U5TC 3DF8A 4Z2YA 3MQ0A 2DU9A 4GXOA 2FE3A 1PP7U 5H20A 4UHTA 3ZMVA 1Z1DA 1Z9CA 4I0AA 5ILUA 2H27A 3HRMA 4OOIA 2NS0A 4KIBA 1HKSA 4ON0A 2VOPA 4LD5A 1BN5A 2MH9A 1DPUA 3R6SA 1SFUA 4AVPA 2IRFG 2DLLA 5JFRA 4ENMA 3IRQA 4A0XA 1KU7A 3PFIA 2FBIA 3M8EA 2DK5A 1IRGA 3JTGA 3ABUA 1ULYA 2MLGA 3LA2A 3AAFA 3JAMZ 4I98B 3F3XA 3HUGA 3M7GA 5LRSA 2HKXA 1UHMA 1FY7A 2CFXA 2A61A 1R5HA 2VC0A 5L3GA 1SMTA 2KIMA 2RV8A 2MA3A 1XDUA 3K69A 5D5WB 4RS8A 2PLYA 1FX7A 1G3WA 1KQ9A 2IPQX 2R7FA 1HBXG 1BI0A 2X4HA 2GA1A 3KEQA 2E7XA 3BJ6A 2KKOA 3IWZA 1J2XA 3D0SA 3KZZA 2JTVA 3FXQA 1F4KA 1TW3A 4KNYA 3V7RA 3BZ6A 2C6YA 4LJZF 4IVNA 2XAHA 4N0BA 3BWGA 3TQNA 4EMSA 1Z05A 1OYIA 2HKOA 2VODA 4S05A 1FSEA 3OV8A 1OMIA 5DUKA 4UUVA 2O8XA 1EH8A 4OIOF 2DAOA 2EJRA 3T1BA 3KEOA 4UVBA 1HW2A 4O3MA 2L4AA 4Q48A 1XGSA 1I27A 4AIHA 3GLXA 4G6DA 4A6EA 3I53A 2Y0MA 2M87A 1XD7A 4RGXA 3G73A 5DEQA 3SZPA 1KYWA 2PMUA 1GHCA 2Z33A 2QQ9A 4UVCA 2XIGA 4P9UA 3T0YA 4EJOA 2VBWA 3IKTA 3DP7A 5HOOA 2FRHA 3DPTA 3CDHA 2HQRA 1AOYA 1TQPA 2Q8KA 3HRTA 1O57A 3IHUA 2YU3A 2ZFWA 3B02A 1PDNC 3H92A 1HKTA 1XMAA 4PZJA 3KP3A 2RVCA 1WI9A 4PDKA 3ML6A 5HDNA 2EFOA 1GXPA 1GVJA 3KP5A 1TLHB 1L0OC 1ONVA 3F22A 3GW2A 5A2QK 5D5UB 2P6SA 3RKWA 3HRUA 4RGSA 3SFZA 5LLQA 3I59A 1S6LA 1RUNA 4I2OA 2AXLA 2K4JA 2OU2A 4HF1A 4WCGA 1B9MA 1XB4A 4M9ZA 4XSZF 3GVAA 5DCFA 2GA2A 4BHCA 1YW8A 4WX9A 2RC4A 4FHTA 2ACJA 4KICA 1DPRA 3IL2A 4HAMA 3LWFA 5D4SA 1FNNA 2CQKA 4EJUA 4QWQA 3FX3A 3I59B 3KLNA 3P9IA 5ICCA 3GX4X 1R23A 2O61A 2YSRA 3JW4A 3DV8A 5AIPA 1FYMA 3WU1B 3GFIA 2V1DA 1UB9A 4BXUA 1BJAA 1I1SA 3ZQ7A 5HDGA 2COMA 2UZKA 3CO6C 2GXBA 2VBXA 4IRGA 3F72A 2XKOA 4U0VA 2NNYA 4GYGA 2Z99A 1X3UA 2CW0F 3F8BA 5FLXZ 3ERED 4AD9A 5CVIA 1ON1A 1Z6TA 5LEJA 5D5VB 3BY6A 1RIOH 2M8EA 1DUXC 1LNWA 2Z3YA 3RPUA 1T38A 2ISZA 2HYGD 1PUEE 4KMFA 2JT1A 3SHFA 2L54A 1P2FA 1LEAA 4O5VA 3HSEA 4CZZA 1W7PA 4A6DA 4CDGA 4HOBA 4HLYA 4G94A 3BROA 1SFEA 3GF2A 4U88A 2CO5A 4HA8A 4HDVA 3EYYA 1XSVA 2P5LC 4LLGF 5CVRA 4ENJA 3QU6A 1P4WA 4MQVA 3E6MA 2ZMEB 3F8MA 4UXNA 5K5RA 1EH7A 1BOAA 4ESFA 4ZYHA 1XCVA 1R22A 2HGCA 2J5OA 2PBIA 2WTEA 1XGMA 3DPLC 1XCBA 3CO7C 1R58A 3DKWA 1S8NA 3QP5A 2K27A 2A5YB 1ZN2A 3SZTA 4EM1A 2E1CA 1BIAA 3WTWC 4H0EA 3IC7A 4A0ZA 2OAZA 3F23A 3IWFA 5FFXA 1U2WA 4ASNA 1USSA 3VFZA 1KGSA 3DEUA 1W7PD 3VOEA 2VBZA 2PQ8A 2KIUA 3QRFF 5H6RA 3GXOA 1CF7A 2VT2A 5FO5A 2L4MA 1S3JA 4HV5A 1ZG1A 5LEKA 4LB6B 4EJTA 4I02A 1WQ2A 1RNLA 4AIKA 1BM9A 3P7NA 3P9KA 4KMUX 4ZH4F 3L2CA 4HF0A 1KQ8A 3EQLF 2LF8A 3CTAA 1MDMA 3EETA 2K7LA 2OZ6A 2QQAA 1O3TA 3I0TA 1OKRA 2NAZA 3GFMA 2IJLA 3R0AA 4WXHA 1W5SA 2VT3A 1I1GA 5A2QZ 3BP8A 2FNAA 1J59A 1CF7B 4M9SA 3HYIA 2XASA 3MWMA 5J8CA 1T2KA 4E70A 1SAXA 5E1XA 3F6OA 2QLZA 2P7CB 3WU0A 2JPCA 2MBFA 3DFGA 1MDMB 2XAQA 1R36A 1LVAA 4GYIA 2RQPA 2VBYA 3WTZA 1UFMA 2VE8A 1W5TA 3ZMZA 1XDSA 3RKXA 2XRNA 1IW7F 3F8FA 4XRFA 2BYVE 3Q9VA 3TGNA 1K78A 2E1NA 1I6XA 2K02A 3I5UA 4IF4A 1R1VA 3W6KB 2DBBA 1QPMA 3E6CC 3V4GA 5HS8A 4FX4A 3JSOA 4RB0A 3R60A 1D3YA 2ZO4A 2Z5UA 4M6YA 1J75A 2RKHA 1FC3A 3E6DA 3K1MA 1T39A 3V8JA 3P9CA 4OMYA 1R1UA 4R1HA 1F5TA 3KZYA 1V4RA 2XVCA 3O2PE 1E17A 1MJBA 4I0BA 1K78B 4A2UA 5ILSA 3WE3A 1BIBA 4EGYA 4EM0B 1MKMA 3N4MA 4ZYDA 2P7VB 3MAJA 4RGRA 1FPQA 5LRRA 2MD5A 5JVTA 4UV8A 5FLXK 1P6RA 4LB5A 4A0YA 2XAFA 4HF2A 3F8CA 2PI0A 1SD5A 1QQIA 4B8XA 4HBLA 1GXQA 3ECHA 4ZZDA 3CUQB 2M45A 5L3FA 3TKYA 3GWZA 4JK1X 4NQWA 3LAJA 4G6QA 1WWXA 4KA4A 3PQKA 2KRFA 5EEGA 1MZBA 4LK1F 3BDDA 4BHPA 2W25A 3QAHA 2ISYA 3F6VA 1RUOA 1UHWA 5L3DA 1EV7A 1MJAA 3RIRA 3WGIA 5HLIA 2MC3A 1IN8A 2XKPA 1YW9A 1NHAA 2QQBA 1XGOA 2FOKA 3H3ZA 5L3BA 4LGWA 2JPBA 3WTUC 1J7KA 4MQ9F 4CGZA 3L09A 4Y17A 2R7DA 2UXNA 4K2EA 3EUHA 1IXSB 3GO5A 3RJPA 2ESNA 2PFBA 4P96A 5L3EA 2VOOA 2W57A 3TOAA 1KU2A 2DK8A 1I5ZA 5BS6A 1FLIA 4OMZA 4RB3C 2IT0A 4DQ2A 2EB7A 3IKVA 1ZARA 1G3SA 1TNSA 3MEXA 5CVUA 2P5VA 2IVMA 4U7BA 4YIIA 3K1PA 1U5TB 4OU0A 3WTSC 2A69F 5LGTA 1G6NA 3MZYA 3SQNA 5LBQA 3J7AO 3REOA 1D8JA 2EFNA 3I71A 2Q0OA 2D45A 1FOKA 1TW2A 3KLOA 2MH2A 2BE5F 2DQRA 2FXAA 3QP6A
chains in the Genus database with same CATH superfamily
5D8LB 3MFKA 1KU9A 3PNTA 4MGRA 2R7UA 2QVOA 2O6GE 2BGCA 3Q5FA 2G0EA 1AHDP 5CVVA 3H9QA 1KA8A 5HS9A 3AL0C 3O8GA 4BKXA 3K4BA 1U6GA 1R5GA 4JP0A 2OZUA 1O7LA 4A69C 2V6EA 4OIPF 4RA2A 4MFDA 1WFXA 2OQRA 5C4JJ 3CD6I 2EWNA 2FQ3A 3J81Z 4NHJA 4I76A 3PUBA 1T98A 2KZVA 2A07F 4RLQA 4KFCA 1O3RA 3K4MA 3QODA 1KU3A 1I3AA 5KAIC 3DQVC 4Y3OA 3LQQA 3C1DA 4HDUA 2PN6A 2EFPA 4B3AA 2CUEA 3LSIA 1MMNA 1P92A 4D7NA 1MBFA 3GYHX 2OD5A 4RMNA 4A5NA 2YR2A 3VEPA 2HR3A 5E8IA 3OYGA 1XMKA 9ANTA 3GEZA 3HGYA 3G1MA 1JHFA 2X85A 2ZJPF 4L9VA 4M71A 5K5QA 1JHHA 1IN4A 2FU4A 2VC1A 4L9TA 2MABA 2DT6A 4I7HA 1D1CA 2W85A 4M3DA 5HNHA 3I55I 2HPMA 3PUFA 4FT8A 5ICEA 3BPXA 3J80K 5DD4A 1L3LA 1Z91A 3FM5A 3HSRA 4IXAA 5CLSA 2V9KA 2F4MB 3IH3A 5BNGA 3WGGA 4QPOA 3DKYA 1JE8A 2KPMA 3ZQQA 2B0LA 2H6CA 3U9GA 3EDPA 4IOAF 1FTZA 4ZJZA 1WPKA 2PMHA 2M5WA 4Y52J 4FETA 1E0EA 2L7ZA 2NVYJ 3HSFA 2LFBA 5ILVA 4ZZLA 2O3FA 3TOBA 2E7WA 3NRVA 5HLGA 2R5YA 1IXCA 4QPQA 1ETXA 5E1WA 1WJEA 1R1TA 5IT9Z 3S2HJ 4GRIA 1IZ1A 2MLKA 4EEFG 5EF6A 3FMSA 1O7FA 3UKGA 1VFCA 1IN6A 2XPVA 1IV8A 4IQJA 2WV0A 3R0JA 2W24A 4U7DA 3K70D 4MO7A 1KQ0A 4M6VA 4DYRA 4KUMA 3OYNA 2LREA 2D2WA 1YITI 2L02A 3RPQA 3QPTA 3A01A 3CMYA 4D7MA 2HZTA 4L5JA 1D1AA 4BGDA 1TWHJ 2CYYA 1RKTA 3U2RA 3OR1C 1WSUA 1KONA 2A68F 4NB5A 1S7EA 3RKYA 2W48A 3ZOBA 1XC5A 4E7LA 2BBYA 3BG5A 3BTIA 1FEXA 2M1BA 1Z0XA 2ICWG 2IGNA 2ZNYA 2RQQA 2F5DA 1TT5B 5IT3A 1B8IA 4KDPA 2F5VA 5CQGA 1QHGA 2R5YB 1JKQC 2LVSA 5TJJA 2VE9A 4I99C 1MGTA 4EGZA 3KETA 1YS7A 3A1YA 3KYCB 4BDZA 2DA4A 3W6JB 2KHMA 2K4BA 2GAUA 3PIOF 3LQRA 4KISA 3T5XA 2DYRH 4LIUA 3GLLA 2ZMEA 3SJMA 4AC0A 2O03A 2OJED 2LH9A 2P8TA 5HS7A 3CP2A 4IRIA 1MBKA 3O6BB 1BW5A 1R00A 4DNCA 2FBKA 3RSNA 3A01B 3BTCA 2G7UA 4U0YA 2GXAA 2LTPA 4L9NA 2OCEA 2PEXA 5J1YA 2LY2A 4PK4A 3RI4A 4Q47A 4IKFA 3ABKH 3TDUC 1YS6A 1QZYA 3E5QA 2EV0A 4HQEA 4AWXB 1BI3A 1DU0A 5FB2A 3OS2A 2QM3A 4EVIA 2DPUA 2CW7A 3VB2A 1VTNC 2B9SA 2P6TA 4QLCU 4LLNA 3C3WA 1G4DA 2E36A 1B8IB 1K79A 3Q0UA 4HV6A 5EGOA 1MJ9A 1XSXA 2LDUA 4BBSJ 2EV5A 5FD6A 1PP8F 3ELKA 5FRMA 1ZRDA 5GTHC 4M74A 2DODA 1MBGA 5M5WJ 3GTGJ 4P9FA 3H5RA 3KP6A 4XKBA 1LDJA 2HTJA 1BC8C 4L5IA 1T56A 2BOLA 4AYBN 2V4JC 4G8XA 5KVRA 4XONA 2ZSIB 4A3MJ 2M0CA 2F5CA 2YX4A 3A0BC 3ABTA 4E7HA 1G3YA 5FROA 1POGA 1E2XA 2RNJA 3L9FA 3M1EA 4CYDA 1U3EM 3WG7H 2PX9A 2D1VA 3OWTA 3IRRA 3I64A 2FSWA 2AQFA 2HYFA 2Y0SA 3GCMA 3V7CA 1B6AA 1TWFJ 2H94A 1UG0A 4YIFA 3GZ5A 2G7HA 3NQOA 3OYIA 2M34A 1FP2A 3BT9A 4R8HA 3RYPA 5GAGJ 1YI2I 2CMPA 2Y31A 2WADA 1OPCA 3HTSB 2VQLA 4PFPA 2XGXA 2MFZA 5GAEJ 5JI6A 2M7AA 3CCYA 3HTUA 2JA8J 1SVOA 1HXDA 2VONA 3LSKA 2OF7A 3OYEA 4EQQA 3K9TA 4YG2F 5D6FA 3NWSA 3H5NA 2CSOA 2YX7A 3CCJI 2H1KA 4GGGA 5H2FC 2DFEA 2LKSA 3S15J 3RDIA 4E7ZA 1BI2A 5ICFA 4MTDA 2GM4A 4BNCA 4C2TA 3PNVA 1LUJB 1Z6RA 4ZC3A 3HKZN 3R61A 3CCEI 4A3EJ 2JUCA 3HZJA 1CQTA 4XN3A 1G8XA 1LFPA 2K9NA 2YU9J 3M07A 4F7ZA 4I01A 2L7KA 2Y30A 1V55H 3ZN1A 5JHFA 5HLHA 1ZR2A 1A04A 3OIPA 3S2DJ 4M3GA 3DWLE 3QPHA 2A6EF 5E18F 1R9TJ 1MIJA 2TDXA 2M0MA 2FD5A 1TNTA 3DU6A 1YIOA 2ZXIA 3COAC 3OOUA 4HLXA 2KJCA 4OIQF 1BOBA 3VYRB 3N97A 5FFZA 1USTA 2A6HF 4XQFA 2FMLA 3CMEI 4PJMA 3K2ZA 3Q9SA 2NXNB 1STZA 2EA4A 3KFWX 2JQ7A 1SFKA 4KIFA 3CLOA 4PJLA 3TDZC 3CUOA 2EZHA 4WXDA 1HCRA 1ACIA 1REPC 3S3NA 3KZIC 2FA5A 3ZP5A 4IHXA 4LMYA 2R7VA 4PSWA 4XKCA 1ZGJA 2VUMJ 2CS3A 3DLAA 4ZYEA 1G59A 3W6VA 4PGHA 3I54A 2EIMH 5ICGA 5IYDJ 1HW5A 2ELHA 2DO7A 2IP2A 4YFKF 3AFHA 4HQMA 3I9V2 4RB2C 1BR1A 3Q0WA 3MZHA 1I6HJ 4N9IA 1H0MA 2CGPA 4G7ZF 4CHUA 4KN7X 2BY1A 5LHGA 2BHZA 1BL0A 2CFOA 3H3UA 2IBDA 4MFEA 5DCMB 2RDPA 2STWA 1ENHA 5KK1A 4FTHA 2DOEA 2L3DA 3HHHA 2KJBA 2E19A 4U0WA 5FKMA 4CICA 2IA0A 3DCFA 4BXFA 2OA4A 1IXRC 1RR7A 3JREA 1YW7A 1NK2P 2JUGA 2L9RA 4BEHA 3J81K 1XX5A 2HWVA 3FM3A 4J01A 1X1BA 1XSDA 4HZFA 5E17F 3MKZA 5FKOA 3OL3A 4MHGA 2KP6A 1DP7P 1UMQA 3J80Z 2VXZA 4NBQA 4OIRF 2K86A 3ZMDA 2HDCA 4Y13A 4RGUA 4XBFA 2WAQN 4RB1A 2HEOA 3TW7A 4N4OB 1AA7A 3BCBA 1ZH5A 2K5CA 2EINH 2MD0A 3E1SA 5F04A 3CC7I 3EUHC 3TO9A 1WRJA 1ETVA 3G4SI 2VN2A 5BOXA 1TZLA 5E3LA 3QOPA 3MKWB 1OCTC 3H36A 1ZAOA 3G1OA 4XR6A 2WC2A 3M8FA 1H9TA 1LJ9A 2QWWA 3I56I 2PG4A 2HYJA 5D8KB 4HW0A 2GWRA 4BEHB 4C2MJ 5D5XB 3ZPLA 4C3HJ 5IYCJ 2E1MC 3LSTA 1T0FA 5B1AH 2HNHA 2DJIA 4CCNA 4OINF 4BHBA 5IT9K 3HHGA 2JN6A 2PMZN 2IW5A 2ZNZA 3K4LA 1FYKA 1DQUA 5M3MJ 1B9NA 3MCZA 1H8AC 4LG0A 3E97A 1JJ6C 2XUBA 4AIJA 2KDZA 3CUQA 3H0GJ 4XOTA 4B09A 4RAFA 1J9IA 1YE9A 3FWEA 5CPRB 4MEYF 1SD7A 1FBUA 1P4XA 3VYUB 2DA7A 4XLEA 4GO1A 1RI7A 4QSHA 2LKPA 5EDNA 3D5RC 4KYWA 3S1NJ 2E2IJ 3GFJA 5JHUA 1BI1A 1TQMA 3WTVC 2IS6A 3KYDB 2DI3A 4AYBA 2VKVA 1DDNA 2K85A 1W0TA 2RN7A 2V79A 1A36A 3L2VA 5DYMA 3K1NA 4P55A 1V3FA 3H0DA 4BBRJ 2A6TA 1BBYA 5JR3A 4W97A 2M30A 2FUG2 1EA3A 1P4AA 1TWGJ 3LFUA 3AG4H 5JLWA 4RLFA 5B5EC 2FEZA 2L01A 3BG3A 2LNBA 1WGXA 5EEHA 1IO2A 1WVRA 2X6OA 2LSOA 1H9GA 1CGPA 1SD4A 2M9HA 4N4NB 3WTXC 2ZSHB 4LG0B 3LA7A 3OYMA 5E20A 2MW8A 2ZCWA 2E1OA 2Q2EA 5D6EA 2O8KA 2BXYA 1TWAJ 1ZG5A 2GZWA 2HS5A 2ZJ2A 3ROUA 5D4RA 2QYOA 3GTPJ 4HEA2 4XSXF 2A3SA 3FMQA 1G3TA 2XHKA 2XPUA 1HKQA 1ZHFA 3S3OA 3DEWA 3HKZA 2Y9YA 3FF5A 1FP1D 1OCCH 3JRIA 5IP7J 1B72A 3V8KA 3HRSA 1GVDA 3MVPA 4B44A 2LF7A 2F5EA 2H09A 3IH4A 4A3GJ 4L0ZB 2EFQA 4BJTA 1X4OA 3KCCA 2QCOA 3E0JB 3S93A 4EJWA 2QZ8A 5F6FA 1FT9A 3ECOA 3QYBA 2H8WA 1TTYA 4DYQA 5J8FA 4Q4ZF 3T8RA 1ON2A 2W82A 5C4XJ 1T8IA 4P5OA 2DT7B 3WGHA 2G9WA 3P5JA 4IHWA 1ETWA 1IAWA 3E5UA 2Q2EB 1BA5A 3FHZA 5DD8A 1MNMC 1MBHA 2QUFA 4G9YA 1JKOC 2X1DA 2UXXA 4II2A 2X6WA 3OOPA 2EPFA 3C2GA 2OTLI 1ZLKA 5EG0A 2D5VA 2Y69H 2OCCH 1X2MA 4A3JJ 3RZOJ 2XAGA 2GQQA 3KP2A 5TRDA 3DTEA 4JX4A 1U5TA 2P5KA 3LA3A 3IH2A 3LSHA 3HOYJ 2OC6A 4RAZA 3SDBA 4BACA 3BJOA 2IA1A 4L9JA 3WHBA 3L2RA 1WH7A 1OR7A 1H89C 4H4KC 4LG3A 4C3JJ 1Y6IA 1GT0C 2XB5A 4XNFA 1U8RA 2Y75A 4DIQA 3CCRI 1A35A 1FSHA 1IC8A 5BMZA 2CU7A 3ZXSA 1MMGA 1T6SA 1YQAA 1UCRA 1KZHA 1A31A 2RAEA 4UVAA 1WJDA 3Q3SA 1D0YA 5CKTA 4L0YB 3NWTA 3GUDA 4Y7NJ 1FYLA 1UG2A 2P0WA 4M6XA 1VQ5I 5J47A 4XMYA 4DBRA 3D1NI 2XB0X 1U0JA 2DFFA 4II3A 4X0GA 1MBEA 1OYYA 4PUSA 1WJBA 3JCUC 1U78A 1JXSA 2O0YA 4R79A 1IF1A 5C3EJ 3BG9A 3PJRA 3BR1A 3LFKA 3B73A 3OYCA 4D9JA 1OQYA 3CJTB 3FXUA 3MKLA 1ETKA 4LLLA 4RAYA 3K0LA 2ZMEC 2V1XA 2DA3A 3OSFA 2EFWA 5FGMA 1X2NA 2JA7J 4A12A 1B59A 2WAQA 4BS9A 1YO5C 4NC6A 1SEUA 5JLXA 2DXIA 5BPDA 2LK2A 2W84A 1ODDA 1O3SA 4XM3A 2KIFA 5AIQA 2JSCA 3FK6A 3ZMTA 1ZRCA 1ZREA 2GOMA 1QRYA 1SC7A 2VQGA 1IDZA 5IOYA 2XSJC 2F4OB 1FTTA 1SD6A 4NC7A 1IN7A 1VQMI 1AU7A 2GOXB 2JZYA 2B63J 2HVSA 2IGOA 4V2GA 4D0PA 3FXLA 4BE0A 4BDYA 1TP4A 2KFDA 3MD2A 3WTTC 3LAPA 2HU9A 4XRSA 2ZXJA 3OIOA 2XAJA 1QO0D 3BTLA 5CYVA 3KP7A 5F1RA 1ZRFA 2AXTC 2IA2A 2LBFB 4FCYA 3I4NJ 2PMZA 3HOSA 2XRLA 3ASNH 5LHIA 3GFLA 2GXGA 2ZKZA 1FBSA 4EJVA 3R4KA 5M3FJ 2FF4A 4I09A 4IRHA 4AU7A 2MGQA 2W00A 1UAAA 4M9XA 4EM2A 2QBYA 1KYZA 4G7OF 5H6QA 3ZMUA 2VQCA 3RCOA 1RZ4A 2NNNA 4YRVA 3HOTA 1B1BA 2K9MA 1X19A 4P1WA 1TT0A 1B4AA 2OQGA 4A3IJ 2R93J 3ZN0A 3U21A 4TV7A 5F27A 1X3ZB 2STTA 5HLTA 1XGNA 2UWMA 4CXFA 1LDKB 2EK5A 5KNLA 4ANJA 3O3KA 4HYEA 3GZ6A 1QZEA 1YTYA 2F5FA 2E2HJ 3CDLA 1BC7C 1LB2A 4UB6C 3JRCA 1IUYA 3KE2A 2HOEA 3A2KA 1J0RA 4OWRB 3HPHA 1OISA 2F4IA 3JSPA 5L3CA 3GTMJ 2FMYA 2Z9OA 3LL7A 4C3IJ 5DUIA 4UV9A 3RTRA 1O4XA 2HI3A 2H6BA 1Y0UA 3OYHA 1EH6A 2DMNA 5FD5A 3BLYA 3BJAA 5AONA 2R7ZJ 2F6CA 5DM7F 4IJAA 3C2HA 3LNQA 2XSDC 2LD5A 1F9NA 3HOUJ 3G3ZA 3CJNA 1JUSA 4BH9A 3F21A 1HSTA 3VODA 2JRTA 1IGNA 1YYVA 4DJAA 3WG9A 3HBLA 4YFXF 2QBYB 4A3CJ 4JBAA 2X51A 1EJ9A 3WHCA 2EA2A 2NOJB 3W3CA 1W1WE 2QSGX 2BV6A 5LGNA 3D5LA 4BAYA 4XLPF 4CYCA 1TL8A 3DBHB 3HB9A 1W36D 5FRNA 1Q1HA 1YLFA 1E3OC 1XN7A 5BPIA 1GUUA 1BW6A 3S1MJ 1ZG3A 3E7LA 1J5YA 2DT5A 5IOZA 5J6XA 5F64A 1ZQ3P 2WY7Q 1QBJA 2VKDA 4ESJA 4MEXF 4WF2A 3F9KA 4LFUA 1K6YA 1ZLJA 4OAYA 1YJ9I 4L18B 2R5ZA 4UB8C 3EYIA 4XIDA 4JX6A 1K4TA 2FOWA 3K4KA 3VWBA 2NYXA 2R4GA 5TISC 1N75A 1OYWA 1LFUP 3RYRA 3HPGA 1K6OA 3CQZJ 5J4VA 1WJFA 4IHYA 2NRAC 4IHSA 3OS0A 1JGSA 3TP3A 1W4MA 4ETSA 5DV5A 4UNOA 1QNTA 4CSWA 3JAMK 1Y1WJ 2HDDA 4WK8F 3PO3J 1DP3A 2DPDA 3L7WA 4JOMA 5LHHA 1VQPI 4M72A 1D5VA 1UELB 3A02A 1MH4A 2DW4A 3LMMA 2X1EA 1FBQA 1AWCA 5GAHJ 1P9QC 4CYCB 2FBHA 2QA4I 2XF7A 4ZYGA 2P4WA 4E4HA 2LRDA 4YIRX 4LK0F 2ZBKA 2I8DA 2R7TA 1UHSA 5HNFA 4ESBA 2X0LA 4Y15A 4MTEA 5K1YA 2Z16A 3S14J 4IO9F 1SFXA 2FQ4A 3MN2A 3JRAA 2R5ZB 1YG2A 1X58A 3GBGA 3QWLA 2ESHA 1MD0A 1JTYA 3JTHA 4BQQA 3C18A 4Y4RA 4XLNF 3OYFA 4A3LJ 2R7OA 3ULQB 3A03A 5J1RA 3LSPA 3PL8A 3K4CA 2R3SA 2KLOA 3BOQA 3SXYA 2UUZA 4BUPA 1S29A 5CVJA 2HPIA 2DTRA 1D8KA 2HXOA 3GMEA 2L5QA 2R92J 5E1ZB 1QGPA 3ZR8X 2PJPA 2XROA 1QZZA 2XPWA 4BXXJ 1FOYA 2WWYA 2CQQA 2JA2A 1U9OA 3Q0VA 2V1UA 4Q5SF 2JSPA 3T8TA 4B48A 1IRFA 2V7FA 1WKMA 1WI3A 4PCQA 4A3FJ 4KIGA 1WHUA 3FK7A 1JUMA 4AM3A 3RQ4A 2KMUA 2EV6A 4GCVA 3VSLA 1HW1A 1PJRA 5DDGA 2ID6A 1R49A 1I3QJ 2L9SA 3F8NA 1PUFB 1I50J 1HSJA 2RNGA 3CJRB 1X1CA 2EZKA 4BYYA 1Z77A 2GBYA 5ERIA 3V7SA 2HOTA 3E3VA 2V26A 3BTJA 1PYVA 4ENKA 2YPRA 3TO7A 1NK3P 1C0WA 2CWEA 4ITVA 3L00A 1LDDA 1GDTA 1QPIA 2XV4S 2HTSA 3HOZJ 2GIVA 1O3QA 1ORKA 4RDUA 1W7PB 2ZC2A 3ESWB 1HQCA 2DQLA 3BCAA 4IEJA 3A0HC 3PQJA 1E3PA 1S7AA 2DDAA 2ID3A 4FASD 2FJ1A 1JKPC 1QVTA 2BEOA 3CUQC 3FZVA 4F91B 1H88C 1R5ID 3WTYC 1VZ0A 5CJ9A 4WXCA 1K83J 2OPTA 3WODF 3M9AA 1LE8A 5EYRA 1FZPB 2CH0A 2QEXI 3RZDJ 5F0HA 3WE2A 2F2EA 3QYEA 4O6JA 1DGWY 3DTIA 4JQFA 2D1HA 4YELA 2EILH 5J3LA 1E3HA 3BR2A 1K7AA 3FHNA 4MNUA 5LGUA 3G1LA 3EUKL 4FQGA 4KT5C 2CG4A 5DCMA 1LQ1A 1X4PA 4KJZA 3BPVA 2VIXA 5FLMJ 1IN5A 1T08B 1U9NA 2ME6A 5FJ8J 3M3YJ 6PAXA 2DFHA 4XRSG 2ELKA 4FX0A 5M5YJ 1FWZA 2NS7A 2BY3A 3OS1A 2P81A 4A5MA 2VJ5A 4N9HA 1TBXA 4NDLA 4EV0A 1XS9A 3C7JA 3FMRA 3S2WA 5HVQC 1HDDC 3U1DA 3AG2H 4WWCA 4HX7A 3ZMSA 1UZCA 1X1PA 2O7OA 5HDKA 4XLAA 5ED4A 3OMYA 3I58A 5FKLA 1LE8B 1SMYF 1ZYRF 3JRDA 5GPAA 2HFHA 2J5PA 2MG4A 4S04A 4ZTJA 1LEBA 3V8LA 3TO6A 3J7YJ 1ZGAA 4NUBA 1FMWA 2EZLA 2NOGA 3I4PA 1VF9A 1S72I 1Z7UA 1ZK8A 4F93B 3GTOJ 3S16J 4KN4X 2GLOA 4M73A 3NEUA 2AS5F 5K5OA 3KP4A 1A6QA 2CUZA 3ISPA 4ENNA 2V6CA 4IHTA 4PJ0C 1K61A 3BR5A 3K2AA 3CLQA 3G71I 4KITB 2JA5J 2LG4A 2QENA 3OSGA 1OJLA 2WAEA 4G7HF 4DYCA 1F36A 2VB6A 3B6AA 3QU3A 2R0QC 1MMDA 4PGGA 2RGVA 2XGDA 4IPAA 1MNDA 4GDFA 1F1ZA 3VSKA 3E5XA 2V9VA 2Y48A 3X2QH 1ITYA 2VXDA 1YFHA 2ECBA 2OBPA 1TQIA 4FE4A 3HC7A 3AKZA 4B43A 1ZTRA 1VNDA 3E6BA 5BQTA 2K40A 4HX8A 1R7JA 1XMXA 2DFIA 2X48A 1S7OA 3GTQJ 4CO8A 2ETHA 2LC2A 4XLFA 4XOPA 1VQ4I 4HX4A 5E8GA 2ADUA 2FNPA 2HQNA 2DMQA 4IL6C 4YFNF 2LKXA 4BQAA 3HIFA 4X1EA 1VQOI 1ETYA 5J1UA 3DXJF 3FXRA 2KDOA 1U5TC 1QVUA 2X6YA 3DF8A 3VYTB 4Z2YA 3J7AY 3MQ0A 1QA6A 2DU9A 4GXOA 2W4SA 2FE3A 1OR7C 3DBRB 2NS8A 1PP7U 3NARA 1GLNA 5H20A 2R7QA 2E5ZA 4UHTA 1IUFA 3ZMVA 4E7JA 1Z1DA 3VYSB 3L2WA 1Z9CA 2OUMA 4I0AA 5ILUA 2H27A 3HRMA 4OOIA 4HRIA 3H35A 2NS0A 1W5CC 4KIBA 1I39A 2K3FA 1HKSA 4ON0A 3DPUA 4ZYAA 1X3WB 4LD5A 2VOPA 1BN5A 4XORA 2MH9A 4PJJA 1DPUA 3BQYA 3HOVJ 3R6SA 1SFUA 3DU5A 4AVPA 2IRFG 2DLLA 5JFRA 3FISA 2NVXJ 4ENMA 3IRQA 4A0XA 2LOOA 1KU7A 3PFIA 2FBIA 3M8EA 4XICA 2Y9ZA 5HODA 2ZXWH 1T95A 4CCJA 1OCOH 1EKEA 2DK5A 1IRGA 3JTGA 3ABUA 3MZ8A 1FMVA 3EUAA 4GFBA 1ULYA 1LVKA 2WY8Q 2MLGA 3U1KA 3OYLA 3GZNB 4BY7J 1VQLI 3LA2A 3AAFA 3KYLA 3JAMZ 4I98B 3F3XA 2TCTA 3HUGA 3M7GA 2JMWA 5LRSA 5E3NA 3S8PA 2HKXA 3VDXA 1UHMA 1FY7A 2E5NA 2CFXA 3BR0A 3ZQCA 2E2JJ 2O9LA 2A61A 2HOSA 3MMYB 4ZTFA 5GTIC 3HOXJ 1R5HA 2VC0A 1SAUA 3FKJA 4XLCA 5DM6F 2L2OA 2VJJA 2XGCA 2DMTA 5L3GA 1SMTA 3K70C 2BZTA 2KIMA 1V54H 2DJNA 2RV8A 2MA3A 1YIJI 3SFIA 4F3QA 1XDUA 1RPWA 1W36C 3K69A 5D5WB 4RS8A 2PLYA 1MW7A 2RREA 2VKHA 1FX7A 1APLC 2K3PA 2VASA 1G3WA 5TGTA 1KQ9A 2IPQX 3CP8A 2R7FA 4BQOA 1HBXG 1YX5A 4S0HB 1BI0A 1R4MB 2X4HA 2GA1A 3KEQA 2GIZA 3H9JA 2E7XA 2WA0A 3BJ6A 2KKOA 4B4CA 3HUGB 4BU2A 2PJRA 2DA5A 1N77A 3LOCA 2Z1DA 3IWZA 1J2XA 3OIQA 3D0SA 3KZZA 2NVUB 5KAFC 2JTVA 3FXQA 1F4KA 1TW3A 4KNYA 3V7RA 1J09A 1A6IA 2M8GX 3BZ6A 2C6YA 1V5GA 4BY1J 4LJZF 4IVNA 2XAHA 4N0BA 3BWGA 5J4YA 5B66C 1WJ5A 3TQNA 4EMSA 5IP9J 1NTCA 1Z05A 3JRHA 1OYIA 4C2UA 2QKLB 3LSGA 2HKOA 2YUSA 2VODA 4LOCA 4ZDLA 4S05A 1FSEA 5F0CA 3OV8A 4C30A 3BZCA 1OMIA 2BHYA 5DUKA 4UUSA 2W1OA 1JT6A 2KZGA 2PJRB 4UUVA 3BG7A 4HNVA 2O8XA 5B1BH 2VL8A 1EH8A 4OIOF 3GTKJ 2DAOA 2EJRA 2FX0A 4FE7A 3T1BA 2LP0A 3KEOA 3TW6A 4UVBA 3KPHA 1HW2A 2ME0A 1WJCA 1OCPA 1VQ8I 2L4AA 4O3MA 2CW8A 1VQ7I 4BJ5C 2Y2ZA 2E34A 4Q48A 1XGSA 1I27A 5GADJ 4AUXA 2LY1A 4AIHA 3GLXA 3L2UA 4G6DA 4A6EA 3I53A 3UR3C 3PIPF 1Y8QB 2R7XA 1BJZA 2Y0MA 2M87A 1JI8A 1XD7A 2BVLA 4RGXA 3G73A 3OYDA 5DEQA 2MC4A 3SZPA 3CCLI 1IV6A 1KYWA 2PMUA 4UUSB 3H9GA 2LBFA 1TC3C 2IS2A 2Z33A 1GHCA 2QQ9A 4CUGA 3K10A 4UVCA 3VPRA 2XIGA 1HLVA 3FKIJ 3FXKA 2LYCA 4P9UA 3T0YA 4EJOA 2VBWA 3IKTA 3DP7A 5HOOA 2CRGA 2FRHA 3DPTA 3CJQB 2DTZA 3CDHA 2HQRA 2IGKA 1TQPA 2Q8KA 3HGGA 3HRTA 2EH3A 3OY9A 1AOYA 1O57A 3IHUA 2YU3A 4F52A 2ZFWA 4KT6A 2CUJA 4D5CA 2QF7A 4XRMA 4PJNA 3CF2A 3LSJA 3B02A 3DEEA 1ERDA 3W2AA 1PDNC 3H92A 3DBLB 2CV1A 1YRNB 3JRFA 1HKTA 1XMAA 4PZJA 3HDDA 4ABZA 3HJEA 3KP3A 2RVCA 1WI9A 2IXSA 2L7FP 3ML6A 4PDKA 1ZR4A 1Z3YA 5HDNA 2EFOA 3FBNB 1HDPA 1WZ2A 5FKKA 1GXPA 1FIPA 1GVJA 2E1MB 4QTRA 2X6XA 4J00A 3PO2J 2IGMA 3ZQIA 3KP5A 1YJWI 4IX7A 1TLHB 1VQ9I 1L0OC 1ONVA 3F22A 3K4NA 3CMMA 2M2EA 3GW2A 3FDYA 5A2QK 5D5UB 2CUFA 3BG6A 4HSRA 4M3EA 2P6SA 2XF6A 3RKWA 5KCMA 4CCOA 3HRUA 1V5EA 2ZXHA 1D0ZA 4RGSA 3SFZA 2X9DA 5LLQA 3I59A 1JGGA 1S6LA 1RUNA 3CCUI 4I2OA 2AXLA 3JRBA 3S32A 2COBA 2KRCA 4JX5A 4IQ4A 2K4JA 2HOAA 1X1AA 2VLAA 1TWCJ 1BR2A 2OU2A 4U87A 2M4GA 4W1UA 4HF1A 3OYKA 1B9MA 1XB4A 4WCGA 4M9ZA 2XF5A 3W2VA 3ABLH 2XGEA 4XSZF 3BC8A 3GVAA 1N25A 2CV2A 3K7AJ 5DCFA 2GA2A 3A4CA 2KL4A 4BHCA 1YW8A 2A05A 4WX9A 1HC8A 2RC4A 1VI0A 4FHTA 2ACJA 4KICA 1DPRA 3S1QJ 3V42A 4RAGA 5GPCA 3M4OJ 4XKVA 1RR8C 4Y33A 1YHQI 3IV5A 3IL2A 4HAMA 1OLTA 3KX2A 3LWFA 4A3DJ 1D0XA 5DS9A 5D4SA 3JR9A 2Z2SB 3ABMH 1W0UA 1JKRC 1FNNA 2CQKA 3FXMA 4EJUA 1WH5A 5J40A 4QWQA 3HOWJ 3KEYA 3FX3A 3I59B 4CH7A 1OCZH 4CZCA 2ZJQF 1S5LC 2TRTA 5EEAA 1DU6A 1SVLA 3KLNA 1FIAA 4E7SA 3P9IA 4A3BJ 1Y56A 2LY9A 5ICCA 3GX4X 1R23A 2O61A 2YSRA 2QSFX 3JW4A 2NVQJ 3DV8A 3CF5F 2HQAA 4XK4A 5AIPA 1FYMA 3WU1B 1V5FA 3GFIA 2V1DA 1UB9A 4MIMA 4BXUA 1VQKI 3ZQHA 1BJAA 2X1CA 1I1SA 3CC4I 5E3MA 3ZQ7A 1ZELA 5FKNA 2HXIA 2COMA 5HDGA 2UZKA 2W7NA 3PM1A 3PFYA 3CO6C 2GXBA 2VBXA 4IRGA 4IZZA 3F72A 2XKOA 4U0VA 4J19A 1IG7A 3ONQA 2NNYA 2WBMA 4GYGA 2Z99A 3EPZA 1X3UA 4RM2A 4QIWN 2CW0F 4HG2A 3F8BA 2K9QA 4CCLA 3CCMI 2L7MP 1XTAA 4D1QA 5FLXZ 3ERED 3IAM2 1R71A 4AD9A 1M1EB 5CVIA 1ON1A 3ASOH 1Z6TA 2KT0A 5LEJA 5KHDA 2EBIA 3AG1H 1SFOJ 3SEZA 3L2QA 5D5VB 3BY6A 1RIOH 2M8EA 3HM5A 1EF4A 3MKYB 1DUXC 3F0CA 1LNWA 2OTJI 1PUFA 3BQZA 2DMUA 2Z3YA 3RPUA 1T38A 2B7EA 2ISZA 3DLLF 1XPXA 2HYGD 1PUEE 4KMFA 2JT1A 5EJCA 5K7FA 3OYAA 1OFCX 1WCMJ 2L54A 2Q1ZB 3SHFA 1PVEA 1P2FA 2JWTA 3HL2A 1LEAA 2E60A 3C2BA 4O5VA 3HSEA 1K4SA 2NVTJ 4CZZA 1W7PA 4A6DA 4CDGA 4HOBA 1N78A 4HLYA 3BR6A 4G94A 3BROA 2DA1A 1SFEA 2H1LA 3ZRGA 2L9NA 3GF2A 4U88A 2CO5A 4HA8A 4FISA 2DA6A 4HDVA 3ERMA 3EYYA 2CJJA 2E35A 1XSVA 2P5LC 4LLGF 2H8RA 1LKXA 1SVMA 5CVRA 4ZDOA 4ENJA 2XDVA 3QU6A 4DBQA 1OCRH 1P4WA 4MQVA 3E6MA 3RQIA 2VPRA 2ZMEB 1GV2A 2OV7A 3F8MA 4UXNA 5K5RA 1EH7A 1BOAA 4ESFA 4ZYHA 1XCVA 1R22A 5F0FA 1U8BA 2CQNA 2HGCA 2J5OA 1T0FC 2PBIA 2IEKA 2WTEA 1XGMA 3DPLC 1XCBA 3CO7C 3TL4X 1R58A 4RBOA 3DKWA 1S8NA 3QP5A 1YX3A 2K27A 3GTLJ 2A5YB 1ZN2A 3SZTA 4EM1A 2E1CA 3ZQLA 1BIAA 2DMPA 3HG9A 3WTWC 3AL0B 1QU3A 3RPUD 3SDGA 3IC7A 4H0EA 4HSTA 2MYSA 3ZQGA 3S1RJ 4A0ZA 5EGOB 2OAZA 3F23A 4X6AJ 3OL4A 3SEQA 3SZGA 3IWFA 4E7IA 5FFXA 1U2WA 4ASNA 1JT0A 1USSA 3VFZA 1KGSA 5K7ZA 1MMAA 3CZ6A 3DEUA 3QPLA 1W7PD 3CCSI 4V2FA 3VOEA 2HVRA 3L1PA 2VBZA 1VQNI 1G2HA 2PQ8A 3H3VK 2KIUA 3QRFF 2VPLA 2KIQA 2KISA 5H6RA 3BZKA 3GXOA 4PSXA 2ZFUA 1CF7A 4AVZA 2VT2A 5FO5A 3W2WA 2I10A 2O5RA 2L4MA 3OYJA 1S3JA 4DZPA 4HV5A 4B3XA 4LIVA 1ZG1A 1Y8RB 5LEKA 4LB6B 5LD2C 4EJTA 4I02A 1WQ2A 1RNLA 4AIKA 1BM9A 3P7NA 1YJNI 3P9KA 4KMUX 4ZH4F 3L2CA 2JK3A 4HF0A 5EZHA 3J7ZI 1KQ8A 1RESA 3EQLF 1NG6A 2KRHA 2IAIA 2LF8A 3CTAA 3H5AA 1MDMA 3EETA 2K7LA 5K7HA 4I6ZA 2OZ6A 2HDWA 3TBIA 2QQAA 1UJ8A 2YS9A 2HZDA 2JRMA 3I0TA 1OKRA 1O3TA 1MSEC 3I4MJ 3IAS2 2NAZA 4BE1A 3S17J 2EQRA 3GFMA 2IJLA 2KQRA 2ZB9A 3R0AA 3SYTA 3CCVI 3LSMA 4WXHA 1W5SA 3FIWA 4LITA 1Z7LA 2BVMA 2VT3A 1I1GA 4MLOA 5A2QZ 3KIOA 4A3KJ 3BP8A 3NAUA 2FNAA 1Z21A 1J59A 1CF7B 5E3OA 1IJWC 4M9SA 3HYIA 2CQXA 4L5EA 2XASA 1Y39A 3MWMA 5J8CA 1T2KA 2R7RA 4E70A 1SAXA 5E1XA 4PFOA 2WB1N 3F6OA 4A93J 4BJ6C 2QLZA 2P7CB 1MBJA 3WU0A 5B3SH 2JPCA 2MBFA 4XN0A 3DFGA 2MSYA 1MDMB 2XAQA 1R36A 3LSRA 4BE2A 5LFAA 5GP9A 4AIDA 1P7JA 2R7WA 1LVAA 2AQEA 4GYIA 2RQPA 2JA6J 2VBYA 3CDIA 3WTZA 2ECCA 1MH3A 5EZGA 4IHVA 5IP6A 1UFMA 3TEDA 2VE8A 2F48A 2AO9A 3WU2C 1YOVB 1W5TA 3ZMZA 1JJ8C 1QHHD 4C9YA 3PNYA 1XDSA 3RKXA 2XRNA 4XL9A 4M3BA 1IW7F 1JTXA 2DOFA 5DTDA 3F8FA 4XRFA 5FLVA 2BYVE 3RKQA 3Q9VA 3TGNA 1K78A 2QGUA 2AHQA 2L9VA 1Q1VA 1I6XA 2E1NA 2BY2A 2M7BA 4CCMA 4F92B 3CESA 2K02A 3QOEA 3I5UA 4IF4A 1R1VA 2WV1A 4DGWB 2BW3A 1Z67A 3W6KB 2DBBA 1QPMA 2BY0A 3QPSA 3S3MA 1XG1A 3OR2C 3E6CC 3V4GA 1MMSA 5HS8A 4FX4A 5CQEA 1F43A 3AG3H 1BR4A 4YEJA 1IRZA 1HOMA 1LFBA 3JSOA 1P7IA 2DDBA 4RB0A 3R60A 1D3YA 1RRJA 1ZGWA 1IRXA 5C44J 4V19K 1IDYA 1RETA 2ZO4A 2LR8A 2Z5UA 4M6YA 5M5XJ 2RKHA 3ZCOA 1FC3A 4EATA 1J75A 3E6DA 3K1MA 3M1CA 2L0KA 1D1BA 3P9CA 3V8JA 1T39A 3CC2I 4OMYA 1R1UA 2N8GA 3O8HA 2EIKH 4R1HA 4G12A 2EZIA 1F5TA 4DW6A 2R7SA 1Y0NA 3KZYA 1V4RA 3HXLA 2QKMB 2XVCA 3O2PE 1E17A 1MJBA 4E6KG 4I0BA 1K78B 3UNGC 4A2UA 3TP0A 2E71A 5F08A 5ILSA 3WE3A 1BIBA 3CMAI 1R6RA 4NNJA 3BR3A 2BW3B 4EGYA 2I5UA 4G6TB 3DKXA 4EM0B 4B1RA 1DGRM 1MKMA 1VQ6I 3N4MA 2JVGA 4HNTA 4ZYDA 2P7VB 3MAJA 4RGRA 1FPQA 5LRRA 2MD5A 5JVTA 4UV8A 1Y1VJ 5FLXK 2JVHA 3IP4B 1P6RA 4M3FA 2IS1A 2VI6A 4LB5A 4A0YA 2XAFA 4HF2A 3F8CA 2PI0A 1SD5A 1QQIA 2M4KA 1ETOA 4B8XA 2WAFA 4HBLA 1GXQA 3ECHA 4ZZDA 3CUQB 2BXZA 2M45A 4CCKA 3PSIA 4NC8A 4DOZA 4E7KA 5L3FA 3TKYA 3GWZA 3K6GA 4JK1X 4NQWA 2QQ8A 5JVGF 2DN0A 2JJ7A 3LAJA 3G2BA 4G6QA 2LLKA 4HNUA 1FJLA 1SANA 2DCEA 1WWXA 4KA4A 3PQKA 2KRFA 5EEGA 1MZBA 2DYSH 4LK1F 2CQ7A 2LMDA 4D5FA 2HQ5A 3BDDA 3QYFA 2IS4A 2XAUA 4BHPA 2W25A 2UV1A 2EIJH 3HEFA 2ISYA 3QAHA 3GTJJ 3FBIB 3G6EI 1T33A 3F6VA 1RUOA 3FXOA 4JYKA 3ZQFA 3OYBA 1UHWA 4Z6YA 5L3DA 2DA2A 1EV7A 1MJAA 5E79C 1RKWA 3RIRA 1JUPA 3WGIA 1NH3A 1X1DA 5HLIA 2MC3A 1IN8A 2DOAA 2VKEA 1YW9A 2XKPA 4XKWA 1NHAA 2QQBA 1XGOA 3DTKA 2FOKA 1S9HA 2A5WA 4F55A 5F1JA 5IY5H 1AKHA 5IPAA 1D5YA 4DZJA 3H1CA 3H3ZA 4NQWB 5L3BA 4LGWA 2JPBA 5IYBJ 3WTUC 1J7KA 1A5JA 1FOXA 4BL0B 4MQ9F 4RM3A 2M3AA 1ETQA 2HVQA 4CGZA 3L09A 1GV5A 2R7DA 4Y17A 2UXNA 1B72B 4K2EA 3JRGA 3EUHA 1IXSB 3GO5A 3RJPA 1NG7A 4IOCF 3N05A 2ESNA 2V9PA 4CA0A 1HA8A 1Z3XA 2PFBA 4P96A 5L3EA 2VOOA 3IUOA 1YRNA 2W57A 3TOAA 3FXJA 1KU2A 1R4NB 2DK8A 4ZDPA 1I5ZA 4XLHA 5BS6A 2ELJA 2V1NA 4B47A 1FLIA 1LPQA 4OMZA 1ZKGA 2XC7A 2WB1A 4RB3C 3QQAA 2IT0A 4DQ2A 3CCQI 1WJAA 2K9SA 1AKHB 2CV0A 1MSFC 2EB7A 3IKVA 1HF0A 1ZARA 3PSFA 3TMOA 1G3SA 4UY8I 1TNSA 1MNEA 3MEXA 1FOWA 2K9LA 5CVUA 2P5VA 3B6CA 5EG0B 2IVMA 2VJ4A 4U7BA 4HPQA 2Y0SN 3ZGKA 3K4JA 4YIIA 3K1PA 1U5TB 4OU0A 2VJIA 3WTSC 2A69F 5LGTA 1G6NA 3MZYA 3SQNA 3I3LA 5LBQA 1RC9A 3REOA 3J7AO 2EFNA 1D8JA 4UUTA 3I71A 2Q0OA 2D45A 4OAZA 1FOKA 3M8JA 1TW2A 3KLOA 2MH2A 4BQNA 2QSHX 2BE5F 2DQRA 2FXAA 3QP6A 2ZJRF 2VQHA 3D5SC
chains in the Genus database with same CATH topology
5D8LB 3MFKA 1KU9A 4MGRA 2QVOA 2O6GE 2BGCA 3Q5FA 5CVVA 1KA8A 5HS9A 1U6GA 1R5GA 2OZUA 1O7LA 4OIPF 2OQRA 2EWNA 2FQ3A 3J81Z 4NHJA 1T98A 2A07F 4KFCA 1O3RA 1KU3A 3DQVC 3LQQA 3C1DA 4HDUA 2PN6A 2EFPA 1P92A 3GYHX 2OD5A 4A5NA 2YR2A 3VEPA 2HR3A 5E8IA 1XMKA 3GEZA 1JHFA 4L9VA 4M71A 5K5QA 1JHHA 1IN4A 2FU4A 2VC1A 4L9TA 4I7HA 2W85A 4FT8A 5ICEA 3BPXA 3J80K 5DD4A 1L3LA 1Z91A 3FM5A 3HSRA 4IXAA 5CLSA 3WGGA 1JE8A 2B0LA 2H6CA 3U9GA 3EDPA 2PMHA 2M5WA 3HSFA 5ILVA 4ZZLA 2O3FA 3TOBA 2E7WA 3NRVA 5HLGA 1IXCA 5E1WA 1R1TA 5IT9Z 1IZ1A 2MLKA 3FMSA 1O7FA 1IN6A 2WV0A 3R0JA 2W24A 4U7DA 1KQ0A 4KUMA 2D2WA 2L02A 3RPQA 3QPTA 2HZTA 4L5JA 2CYYA 3U2RA 1WSUA 2A68F 4NB5A 3RKYA 2BBYA 2M1BA 2ZNYA 2F5DA 5IT3A 4KDPA 5TJJA 2VE9A 1MGTA 4EGZA 3KETA 1YS7A 3W6JB 2K4BA 2GAUA 3LQRA 3T5XA 2ZMEA 2O03A 5HS7A 2P8TA 4IRIA 3O6BB 1R00A 4DNCA 2FBKA 4U0YA 2G7UA 4L9NA 2PEXA 3RI4A 4Q47A 3TDUC 1YS6A 1QZYA 3E5QA 2EV0A 4HQEA 4AWXB 1BI3A 5FB2A 2QM3A 4EVIA 2DPUA 3VB2A 1VTNC 2P6TA 4QLCU 4LLNA 3C3WA 1G4DA 1K79A 4HV6A 1MJ9A 1XSXA 2LDUA 2EV5A 5FD6A 1PP8F 3ELKA 1ZRDA 4M74A 4P9FA 3KP6A 1LDJA 2HTJA 1BC8C 4L5IA 4G8XA 5KVRA 2F5CA 2YX4A 3ABTA 1G3YA 1E2XA 2RNJA 3L9FA 3M1EA 4CYDA 1U3EM 2D1VA 3IRRA 3I64A 2FSWA 2HYFA 3V7CA 1B6AA 2H94A 4YIFA 3GZ5A 2G7HA 3NQOA 1FP2A 4R8HA 3RYPA 1OPCA 3HTSB 2XGXA 5JI6A 3HTUA 1HXDA 2VONA 4EQQA 3K9TA 4YG2F 5D6FA 2CSOA 2YX7A 4GGGA 3RDIA 1BI2A 5ICFA 4MTDA 4BNCA 1Z6RA 3R61A 4F7ZA 4I01A 3ZN1A 5HLHA 1A04A 3QPHA 2A6EF 5E18F 2TDXA 1TNTA 1YIOA 3COAC 4HLXA 2KJCA 4OIQF 3N97A 5FFZA 1USTA 2A6HF 2FMLA 3K2ZA 3Q9SA 1STZA 2EA4A 3KFWX 4KIFA 3CLOA 3TDZC 3CUOA 4WXDA 1REPC 3ZP5A 2FA5A 4LMYA 1ZGJA 4ZYEA 4PGHA 3I54A 5ICGA 1HW5A 2ELHA 2DO7A 2IP2A 4YFKF 4HQMA 4RB2C 3MZHA 4N9IA 1H0MA 2CGPA 4G7ZF 4CHUA 4KN7X 5LHGA 3H3UA 5DCMB 2RDPA 2STWA 5KK1A 2L3DA 3HHHA 2KJBA 4U0WA 4CICA 2IA0A 2OA4A 1IXRC 1YW7A 3J81K 2HWVA 3FM3A 1XSDA 4HZFA 5E17F 4MHGA 1DP7P 3J80Z 2VXZA 4OIRF 3ZMDA 2K86A 2HDCA 4Y13A 4RGUA 4XBFA 4RB1A 2HEOA 1ZH5A 3TO9A 1WRJA 2VN2A 5BOXA 3QOPA 1ZAOA 2WC2A 3M8FA 1H9TA 1LJ9A 2QWWA 2PG4A 5D8KB 4HW0A 2GWRA 5D5XB 3ZPLA 3LSTA 1T0FA 4OINF 4BHBA 5IT9K 3HHGA 2IW5A 2ZNZA 1FYKA 1B9NA 3MCZA 4LG0A 3E97A 2XUBA 4AIJA 3CUQA 4B09A 1J9IA 3FWEA 4MEYF 1SD7A 1FBUA 1P4XA 4GO1A 1RI7A 2LKPA 4KYWA 3GFJA 5JHUA 1BI1A 1TQMA 3WTVC 2DI3A 1DDNA 2RN7A 2V79A 5DYMA 3K1NA 4P55A 1V3FA 1BBYA 5JR3A 2M30A 1P4AA 2FEZA 2L01A 2LNBA 5EEHA 2LSOA 1H9GA 1CGPA 1SD4A 3WTXC 4LG0B 3LA7A 5E20A 2ZCWA 2Q2EA 5D6EA 1ZG5A 2GZWA 2HS5A 2ZJ2A 3ROUA 5D4RA 2QYOA 4XSXF 2A3SA 3FMQA 1G3TA 2XHKA 1HKQA 1ZHFA 3FF5A 1FP1D 3V8KA 3HRSA 2LF7A 2F5EA 2H09A 4L0ZB 2EFQA 3KCCA 4EJWA 2QZ8A 5F6FA 1FT9A 3ECOA 1TTYA 5J8FA 4Q4ZF 3T8RA 1ON2A 4P5OA 3WGHA 2G9WA 1IAWA 3E5UA 3FHZA 5DD8A 2QUFA 4G9YA 2UXXA 3OOPA 1ZLKA 2XAGA 2GQQA 3KP2A 5TRDA 1U5TA 2P5KA 3LA3A 4RAZA 3BJOA 2IA1A 4L9JA 1OR7A 1U8RA 2Y75A 1FSHA 5BMZA 1T6SA 1YQAA 1UCRA 4UVAA 4L0YB 3GUDA 1FYLA 4M6XA 1OYYA 1U78A 1JXSA 2O0YA 4R79A 1IF1A 3LFKA 3B73A 3FXUA 4LLLA 4RAYA 3K0LA 2V1XA 2EFWA 5FGMA 4A12A 1B59A 1YO5C 5BPDA 2W84A 1ODDA 1O3SA 2KIFA 5AIQA 2JSCA 3ZMTA 1ZRCA 1ZREA 1SD6A 1IN7A 2JZYA 4D0PA 3WTTC 3LAPA 2ZXJA 2XAJA 1QO0D 5CYVA 3KP7A 5F1RA 1ZRFA 2IA2A 3HOSA 5LHIA 3GFLA 2GXGA 2ZKZA 1FBSA 4EJVA 3R4KA 2FF4A 4I09A 4IRHA 4M9XA 4EM2A 2QBYA 1KYZA 4G7OF 5H6QA 3ZMUA 1RZ4A 2NNNA 3HOTA 1B1BA 1B4AA 2OQGA 3ZN0A 4TV7A 2STTA 1XGNA 2UWMA 4CXFA 1LDKB 2EK5A 3O3KA 4HYEA 3GZ6A 1YTYA 2F5FA 1BC7C 1LB2A 1IUYA 3KE2A 2HOEA 1J0RA 3JSPA 5L3CA 2FMYA 2Z9OA 5DUIA 4UV9A 3RTRA 2H6BA 1Y0UA 1EH6A 5FD5A 3BJAA 5AONA 4IJAA 1F9NA 3G3ZA 3CJNA 4BH9A 3F21A 1HSTA 3VODA 2JRTA 1YYVA 3WG9A 4YFXF 2QBYB 4JBAA 2EA2A 2BV6A 5LGNA 3D5LA 4BAYA 4XLPF 1Q1HA 1YLFA 1XN7A 5BPIA 1ZG3A 1J5YA 2DT5A 5J6XA 5F64A 1QBJA 4ESJA 4MEXF 4WF2A 4LFUA 1ZLJA 4L18B 3EYIA 2NYXA 1OYWA 3RYRA 1K6OA 2NRAC 4IHSA 1JGSA 4ETSA 1W4MA 5DV5A 4UNOA 1QNTA 3JAMK 4WK8F 2DPDA 3L7WA 5LHHA 4M72A 1D5VA 2DW4A 1FBQA 1AWCA 2FBHA 4ZYGA 2P4WA 4LK0F 2ZBKA 4ESBA 2X0LA 4Y15A 4MTEA 5K1YA 1SFXA 1YG2A 2ESHA 1MD0A 3JTHA 3C18A 4XLNF 3ULQB 2R3SA 3BOQA 3SXYA 1S29A 5CVJA 2DTRA 1D8KA 5E1ZB 1QGPA 2PJPA 2XROA 1QZZA 2WWYA 2V1UA 4Q5SF 3T8TA 1IRFA 1WKMA 4PCQA 4KIGA 2EV6A 4GCVA 1HW1A 5DDGA 3F8NA 1HSJA 4BYYA 5ERIA 3V7SA 3E3VA 4ENKA 2YPRA 3TO7A 1C0WA 2CWEA 3L00A 1LDDA 2XV4S 2HTSA 2GIVA 1O3QA 1W7PB 1HQCA 2DQLA 3PQJA 1S7AA 2BEOA 3CUQC 3FZVA 3WTYC 5CJ9A 4WXCA 3WODF 3M9AA 1FZPB 3WE2A 2F2EA 4O6JA 4JQFA 2D1HA 1K7AA 4MNUA 5LGUA 4KT5C 2CG4A 5DCMA 1LQ1A 3BPVA 1IN5A 6PAXA 4FX0A 1FWZA 4A5MA 4N9HA 1TBXA 4EV0A 3C7JA 3FMRA 3S2WA 5HVQC 3U1DA 4WWCA 4HX7A 3ZMSA 5HDKA 5ED4A 3I58A 1SMYF 1ZYRF 2HFHA 2J5PA 1LEBA 4S04A 3V8LA 3TO6A 1ZGAA 3I4PA 1Z7UA 4KN4X 4M73A 3NEUA 2AS5F 5K5OA 3KP4A 3ISPA 4ENNA 2V6CA 4IHTA 2QENA 4G7HF 3QU3A 4PGGA 2RGVA 4IPAA 1F1ZA 3E5XA 2V9VA 2Y48A 1YFHA 2OBPA 1TQIA 3E6BA 5BQTA 4HX8A 1R7JA 2DFIA 1S7OA 4CO8A 2ETHA 4HX4A 5E8GA 2ADUA 2FNPA 2HQNA 4YFNF 4BQAA 3HIFA 3DXJF 3FXRA 1U5TC 3DF8A 4Z2YA 3MQ0A 2DU9A 4GXOA 2FE3A 1PP7U 5H20A 4UHTA 3ZMVA 1Z1DA 1Z9CA 4I0AA 5ILUA 2H27A 3HRMA 4OOIA 2NS0A 4KIBA 1HKSA 4ON0A 2VOPA 4LD5A 1BN5A 2MH9A 1DPUA 3R6SA 1SFUA 4AVPA 2IRFG 2DLLA 5JFRA 4ENMA 3IRQA 4A0XA 1KU7A 3PFIA 2FBIA 3M8EA 2DK5A 1IRGA 3JTGA 3ABUA 1ULYA 2MLGA 3LA2A 3AAFA 3JAMZ 4I98B 3F3XA 3HUGA 3M7GA 5LRSA 2HKXA 1UHMA 1FY7A 2CFXA 2A61A 1R5HA 2VC0A 5L3GA 1SMTA 2KIMA 2RV8A 2MA3A 1XDUA 3K69A 5D5WB 4RS8A 2PLYA 1FX7A 1G3WA 1KQ9A 2IPQX 2R7FA 1HBXG 1BI0A 2X4HA 2GA1A 3KEQA 2E7XA 3BJ6A 2KKOA 3IWZA 1J2XA 3D0SA 3KZZA 2JTVA 3FXQA 1F4KA 1TW3A 4KNYA 3V7RA 3BZ6A 2C6YA 4LJZF 4IVNA 2XAHA 4N0BA 3BWGA 3TQNA 4EMSA 1Z05A 1OYIA 2HKOA 2VODA 4S05A 1FSEA 3OV8A 1OMIA 5DUKA 4UUVA 2O8XA 1EH8A 4OIOF 2DAOA 2EJRA 3T1BA 3KEOA 4UVBA 1HW2A 4O3MA 2L4AA 4Q48A 1XGSA 1I27A 4AIHA 3GLXA 4G6DA 4A6EA 3I53A 2Y0MA 2M87A 1XD7A 4RGXA 3G73A 5DEQA 3SZPA 1KYWA 2PMUA 1GHCA 2Z33A 2QQ9A 4UVCA 2XIGA 4P9UA 3T0YA 4EJOA 2VBWA 3IKTA 3DP7A 5HOOA 2FRHA 3DPTA 3CDHA 2HQRA 1AOYA 1TQPA 2Q8KA 3HRTA 1O57A 3IHUA 2YU3A 2ZFWA 3B02A 1PDNC 3H92A 1HKTA 1XMAA 4PZJA 3KP3A 2RVCA 1WI9A 4PDKA 3ML6A 5HDNA 2EFOA 1GXPA 1GVJA 3KP5A 1TLHB 1L0OC 1ONVA 3F22A 3GW2A 5A2QK 5D5UB 2P6SA 3RKWA 3HRUA 4RGSA 3SFZA 5LLQA 3I59A 1S6LA 1RUNA 4I2OA 2AXLA 2K4JA 2OU2A 4HF1A 4WCGA 1B9MA 1XB4A 4M9ZA 4XSZF 3GVAA 5DCFA 2GA2A 4BHCA 1YW8A 4WX9A 2RC4A 4FHTA 2ACJA 4KICA 1DPRA 3IL2A 4HAMA 3LWFA 5D4SA 1FNNA 2CQKA 4EJUA 4QWQA 3FX3A 3I59B 3KLNA 3P9IA 5ICCA 3GX4X 1R23A 2O61A 2YSRA 3JW4A 3DV8A 5AIPA 1FYMA 3WU1B 3GFIA 2V1DA 1UB9A 4BXUA 1BJAA 1I1SA 3ZQ7A 5HDGA 2COMA 2UZKA 3CO6C 2GXBA 2VBXA 4IRGA 3F72A 2XKOA 4U0VA 2NNYA 4GYGA 2Z99A 1X3UA 2CW0F 3F8BA 5FLXZ 3ERED 4AD9A 5CVIA 1ON1A 1Z6TA 5LEJA 5D5VB 3BY6A 1RIOH 2M8EA 1DUXC 1LNWA 2Z3YA 3RPUA 1T38A 2ISZA 2HYGD 1PUEE 4KMFA 2JT1A 3SHFA 2L54A 1P2FA 1LEAA 4O5VA 3HSEA 4CZZA 1W7PA 4A6DA 4CDGA 4HOBA 4HLYA 4G94A 3BROA 1SFEA 3GF2A 4U88A 2CO5A 4HA8A 4HDVA 3EYYA 1XSVA 2P5LC 4LLGF 5CVRA 4ENJA 3QU6A 1P4WA 4MQVA 3E6MA 2ZMEB 3F8MA 4UXNA 5K5RA 1EH7A 1BOAA 4ESFA 4ZYHA 1XCVA 1R22A 2HGCA 2J5OA 2PBIA 2WTEA 1XGMA 3DPLC 1XCBA 3CO7C 1R58A 3DKWA 1S8NA 3QP5A 2K27A 2A5YB 1ZN2A 3SZTA 4EM1A 2E1CA 1BIAA 3WTWC 4H0EA 3IC7A 4A0ZA 2OAZA 3F23A 3IWFA 5FFXA 1U2WA 4ASNA 1USSA 3VFZA 1KGSA 3DEUA 1W7PD 3VOEA 2VBZA 2PQ8A 2KIUA 3QRFF 5H6RA 3GXOA 1CF7A 2VT2A 5FO5A 2L4MA 1S3JA 4HV5A 1ZG1A 5LEKA 4LB6B 4EJTA 4I02A 1WQ2A 1RNLA 4AIKA 1BM9A 3P7NA 3P9KA 4KMUX 4ZH4F 3L2CA 4HF0A 1KQ8A 3EQLF 2LF8A 3CTAA 1MDMA 3EETA 2K7LA 2OZ6A 2QQAA 1O3TA 3I0TA 1OKRA 2NAZA 3GFMA 2IJLA 3R0AA 4WXHA 1W5SA 2VT3A 1I1GA 5A2QZ 3BP8A 2FNAA 1J59A 1CF7B 4M9SA 3HYIA 2XASA 3MWMA 5J8CA 1T2KA 4E70A 1SAXA 5E1XA 3F6OA 2QLZA 2P7CB 3WU0A 2JPCA 2MBFA 3DFGA 1MDMB 2XAQA 1R36A 1LVAA 4GYIA 2RQPA 2VBYA 3WTZA 1UFMA 2VE8A 1W5TA 3ZMZA 1XDSA 3RKXA 2XRNA 1IW7F 3F8FA 4XRFA 2BYVE 3Q9VA 3TGNA 1K78A 2E1NA 1I6XA 2K02A 3I5UA 4IF4A 1R1VA 3W6KB 2DBBA 1QPMA 3E6CC 3V4GA 5HS8A 4FX4A 3JSOA 4RB0A 3R60A 1D3YA 2ZO4A 2Z5UA 4M6YA 1J75A 2RKHA 1FC3A 3E6DA 3K1MA 1T39A 3V8JA 3P9CA 4OMYA 1R1UA 4R1HA 1F5TA 3KZYA 1V4RA 2XVCA 3O2PE 1E17A 1MJBA 4I0BA 1K78B 4A2UA 5ILSA 3WE3A 1BIBA 4EGYA 4EM0B 1MKMA 3N4MA 4ZYDA 2P7VB 3MAJA 4RGRA 1FPQA 5LRRA 2MD5A 5JVTA 4UV8A 5FLXK 1P6RA 4LB5A 4A0YA 2XAFA 4HF2A 3F8CA 2PI0A 1SD5A 1QQIA 4B8XA 4HBLA 1GXQA 3ECHA 4ZZDA 3CUQB 2M45A 5L3FA 3TKYA 3GWZA 4JK1X 4NQWA 3LAJA 4G6QA 1WWXA 4KA4A 3PQKA 2KRFA 5EEGA 1MZBA 4LK1F 3BDDA 4BHPA 2W25A 3QAHA 2ISYA 3F6VA 1RUOA 1UHWA 5L3DA 1EV7A 1MJAA 3RIRA 3WGIA 5HLIA 2MC3A 1IN8A 2XKPA 1YW9A 1NHAA 2QQBA 1XGOA 2FOKA 3H3ZA 5L3BA 4LGWA 2JPBA 3WTUC 1J7KA 4MQ9F 4CGZA 3L09A 4Y17A 2R7DA 2UXNA 4K2EA 3EUHA 1IXSB 3GO5A 3RJPA 2ESNA 2PFBA 4P96A 5L3EA 2VOOA 2W57A 3TOAA 1KU2A 2DK8A 1I5ZA 5BS6A 1FLIA 4OMZA 4RB3C 2IT0A 4DQ2A 2EB7A 3IKVA 1ZARA 1G3SA 1TNSA 3MEXA 5CVUA 2P5VA 2IVMA 4U7BA 4YIIA 3K1PA 1U5TB 4OU0A 3WTSC 2A69F 5LGTA 1G6NA 3MZYA 3SQNA 5LBQA 3J7AO 3REOA 1D8JA 2EFNA 3I71A 2Q0OA 2D45A 1FOKA 1TW2A 3KLOA 2MH2A 2BE5F 2DQRA 2FXAA 3QP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8L B;  3MFK A;  1KU9 A;  4MGR A;  2QVO A;  2O6G E;  2BGC A;  3Q5F A;  5CVV A;  1KA8 A;  5HS9 A;  1U6G A;  1R5G A;  2OZU A;  1O7L A;  4OIP F;  2OQR A;  2EWN A;  2FQ3 A;  3J81 Z;  4NHJ A;  1T98 A;  2A07 F;  4KFC A;  1O3R A;  1KU3 A;  3DQV C;  3LQQ A;  3C1D A;  4HDU A;  2PN6 A;  2EFP A;  1P92 A;  3GYH X;  2OD5 A;  4A5N A;  2YR2 A;  3VEP A;  2HR3 A;  5E8I A;  1XMK A;  3GEZ A;  1JHF A;  4L9V A;  4M71 A;  5K5Q A;  1JHH A;  1IN4 A;  2FU4 A;  2VC1 A;  4L9T A;  4I7H A;  2W85 A;  4FT8 A;  5ICE A;  3BPX A;  3J80 K;  5DD4 A;  1L3L A;  1Z91 A;  3FM5 A;  3HSR A;  4IXA A;  5CLS A;  3WGG A;  1JE8 A;  2B0L A;  2H6C A;  3U9G A;  3EDP A;  2PMH A;  2M5W A;  3HSF A;  5ILV A;  4ZZL A;  2O3F A;  3TOB A;  2E7W A;  3NRV A;  5HLG A;  1IXC A;  5E1W A;  1R1T A;  5IT9 Z;  1IZ1 A;  2MLK A;  3FMS A;  1O7F A;  1IN6 A;  2WV0 A;  3R0J A;  2W24 A;  4U7D A;  1KQ0 A;  4KUM A;  2D2W A;  2L02 A;  3RPQ A;  3QPT A;  2HZT A;  4L5J A;  2CYY A;  3U2R A;  1WSU A;  2A68 F;  4NB5 A;  3RKY A;  2BBY A;  2M1B A;  2ZNY A;  2F5D A;  5IT3 A;  4KDP A;  5TJJ A;  2VE9 A;  1MGT A;  4EGZ A;  3KET A;  1YS7 A;  3W6J B;  2K4B A;  2GAU A;  3LQR A;  3T5X A;  2ZME A;  2O03 A;  5HS7 A;  2P8T A;  4IRI A;  3O6B B;  1R00 A;  4DNC A;  2FBK A;  4U0Y A;  2G7U A;  4L9N A;  2PEX A;  3RI4 A;  4Q47 A;  3TDU C;  1YS6 A;  1QZY A;  3E5Q A;  2EV0 A;  4HQE A;  4AWX B;  1BI3 A;  5FB2 A;  2QM3 A;  4EVI A;  2DPU A;  3VB2 A;  1VTN C;  2P6T A;  4QLC U;  4LLN A;  3C3W A;  1G4D A;  1K79 A;  4HV6 A;  1MJ9 A;  1XSX A;  2LDU A;  2EV5 A;  5FD6 A;  1PP8 F;  3ELK A;  1ZRD A;  4M74 A;  4P9F A;  3KP6 A;  1LDJ A;  2HTJ A;  1BC8 C;  4L5I A;  4G8X A;  5KVR A;  2F5C A;  2YX4 A;  3ABT A;  1G3Y A;  1E2X A;  2RNJ A;  3L9F A;  3M1E A;  4CYD A;  1U3E M;  2D1V A;  3IRR A;  3I64 A;  2FSW A;  2HYF A;  3V7C A;  1B6A A;  2H94 A;  4YIF A;  3GZ5 A;  2G7H A;  3NQO A;  1FP2 A;  4R8H A;  3RYP A;  1OPC A;  3HTS B;  2XGX A;  5JI6 A;  3HTU A;  1HXD A;  2VON A;  4EQQ A;  3K9T A;  4YG2 F;  5D6F A;  2CSO A;  2YX7 A;  4GGG A;  3RDI A;  1BI2 A;  5ICF A;  4MTD A;  4BNC A;  1Z6R A;  3R61 A;  4F7Z A;  4I01 A;  3ZN1 A;  5HLH A;  1A04 A;  3QPH A;  2A6E F;  5E18 F;  2TDX A;  1TNT A;  1YIO A;  3COA C;  4HLX A;  2KJC A;  4OIQ F;  3N97 A;  5FFZ A;  1UST A;  2A6H F;  2FML A;  3K2Z A;  3Q9S A;  1STZ A;  2EA4 A;  3KFW X;  4KIF A;  3CLO A;  3TDZ C;  3CUO A;  4WXD A;  1REP C;  3ZP5 A;  2FA5 A;  4LMY A;  1ZGJ A;  4ZYE A;  4PGH A;  3I54 A;  5ICG A;  1HW5 A;  2ELH A;  2DO7 A;  2IP2 A;  4YFK F;  4HQM A;  4RB2 C;  3MZH A;  4N9I A;  1H0M A;  2CGP A;  4G7Z F;  4CHU A;  4KN7 X;  5LHG A;  3H3U A;  5DCM B;  2RDP A;  2STW A;  5KK1 A;  2L3D A;  3HHH A;  2KJB A;  4U0W A;  4CIC A;  2IA0 A;  2OA4 A;  1IXR C;  1YW7 A;  3J81 K;  2HWV A;  3FM3 A;  1XSD A;  4HZF A;  5E17 F;  4MHG A;  1DP7 P;  3J80 Z;  2VXZ A;  4OIR F;  3ZMD A;  2K86 A;  2HDC A;  4Y13 A;  4RGU A;  4XBF A;  4RB1 A;  2HEO A;  1ZH5 A;  3TO9 A;  1WRJ A;  2VN2 A;  5BOX A;  3QOP A;  1ZAO A;  2WC2 A;  3M8F A;  1H9T A;  1LJ9 A;  2QWW A;  2PG4 A;  5D8K B;  4HW0 A;  2GWR A;  5D5X B;  3ZPL A;  3LST A;  1T0F A;  4OIN F;  4BHB A;  5IT9 K;  3HHG A;  2IW5 A;  2ZNZ A;  1FYK A;  1B9N A;  3MCZ A;  4LG0 A;  3E97 A;  2XUB A;  4AIJ A;  3CUQ A;  4B09 A;  1J9I A;  3FWE A;  4MEY F;  1SD7 A;  1FBU A;  1P4X A;  4GO1 A;  1RI7 A;  2LKP A;  4KYW A;  3GFJ A;  5JHU A;  1BI1 A;  1TQM A;  3WTV C;  2DI3 A;  1DDN A;  2RN7 A;  2V79 A;  5DYM A;  3K1N A;  4P55 A;  1V3F A;  1BBY A;  5JR3 A;  2M30 A;  1P4A A;  2FEZ A;  2L01 A;  2LNB A;  5EEH A;  2LSO A;  1H9G A;  1CGP A;  1SD4 A;  3WTX C;  4LG0 B;  3LA7 A;  5E20 A;  2ZCW A;  2Q2E A;  5D6E A;  1ZG5 A;  2GZW A;  2HS5 A;  2ZJ2 A;  3ROU A;  5D4R A;  2QYO A;  4XSX F;  2A3S A;  3FMQ A;  1G3T A;  2XHK A;  1HKQ A;  1ZHF A;  3FF5 A;  1FP1 D;  3V8K A;  3HRS A;  2LF7 A;  2F5E A;  2H09 A;  4L0Z B;  2EFQ A;  3KCC A;  4EJW A;  2QZ8 A;  5F6F A;  1FT9 A;  3ECO A;  1TTY A;  5J8F A;  4Q4Z F;  3T8R A;  1ON2 A;  4P5O A;  3WGH A;  2G9W A;  1IAW A;  3E5U A;  3FHZ A;  5DD8 A;  2QUF A;  4G9Y A;  2UXX A;  3OOP A;  1ZLK A;  2XAG A;  2GQQ A;  3KP2 A;  5TRD A;  1U5T A;  2P5K A;  3LA3 A;  4RAZ A;  3BJO A;  2IA1 A;  4L9J A;  1OR7 A;  1U8R A;  2Y75 A;  1FSH A;  5BMZ A;  1T6S A;  1YQA A;  1UCR A;  4UVA A;  4L0Y B;  3GUD A;  1FYL A;  4M6X A;  1OYY A;  1U78 A;  1JXS A;  2O0Y A;  4R79 A;  1IF1 A;  3LFK A;  3B73 A;  3FXU A;  4LLL A;  4RAY A;  3K0L A;  2V1X A;  2EFW A;  5FGM A;  4A12 A;  1B59 A;  1YO5 C;  5BPD A;  2W84 A;  1ODD A;  1O3S A;  2KIF A;  5AIQ A;  2JSC A;  3ZMT A;  1ZRC A;  1ZRE A;  1SD6 A;  1IN7 A;  2JZY A;  4D0P A;  3WTT C;  3LAP A;  2ZXJ A;  2XAJ A;  1QO0 D;  5CYV A;  3KP7 A;  5F1R A;  1ZRF A;  2IA2 A;  3HOS A;  5LHI A;  3GFL A;  2GXG A;  2ZKZ A;  1FBS A;  4EJV A;  3R4K A;  2FF4 A;  4I09 A;  4IRH A;  4M9X A;  4EM2 A;  2QBY A;  1KYZ A;  4G7O F;  5H6Q A;  3ZMU A;  1RZ4 A;  2NNN A;  3HOT A;  1B1B A;  1B4A A;  2OQG A;  3ZN0 A;  4TV7 A;  2STT A;  1XGN A;  2UWM A;  4CXF A;  1LDK B;  2EK5 A;  3O3K A;  4HYE A;  3GZ6 A;  1YTY A;  2F5F A;  1BC7 C;  1LB2 A;  1IUY A;  3KE2 A;  2HOE A;  1J0R A;  3JSP A;  5L3C A;  2FMY A;  2Z9O A;  5DUI A;  4UV9 A;  3RTR A;  2H6B A;  1Y0U A;  1EH6 A;  5FD5 A;  3BJA A;  5AON A;  4IJA A;  1F9N A;  3G3Z A;  3CJN A;  4BH9 A;  3F21 A;  1HST A;  3VOD A;  2JRT A;  1YYV A;  3WG9 A;  4YFX F;  2QBY B;  4JBA A;  2EA2 A;  2BV6 A;  5LGN A;  3D5L A;  4BAY A;  4XLP F;  1Q1H A;  1YLF A;  1XN7 A;  5BPI A;  1ZG3 A;  1J5Y A;  2DT5 A;  5J6X A;  5F64 A;  1QBJ A;  4ESJ A;  4MEX F;  4WF2 A;  4LFU A;  1ZLJ A;  4L18 B;  3EYI A;  2NYX A;  1OYW A;  3RYR A;  1K6O A;  2NRA C;  4IHS A;  1JGS A;  4ETS A;  1W4M A;  5DV5 A;  4UNO A;  1QNT A;  3JAM K;  4WK8 F;  2DPD A;  3L7W A;  5LHH A;  4M72 A;  1D5V A;  2DW4 A;  1FBQ A;  1AWC A;  2FBH A;  4ZYG A;  2P4W A;  4LK0 F;  2ZBK A;  4ESB A;  2X0L A;  4Y15 A;  4MTE A;  5K1Y A;  1SFX A;  1YG2 A;  2ESH A;  1MD0 A;  3JTH A;  3C18 A;  4XLN F;  3ULQ B;  2R3S A;  3BOQ A;  3SXY A;  1S29 A;  5CVJ A;  2DTR A;  1D8K A;  5E1Z B;  1QGP A;  2PJP A;  2XRO A;  1QZZ A;  2WWY A;  2V1U A;  4Q5S F;  3T8T A;  1IRF A;  1WKM A;  4PCQ A;  4KIG A;  2EV6 A;  4GCV A;  1HW1 A;  5DDG A;  3F8N A;  1HSJ A;  4BYY A;  5ERI A;  3V7S A;  3E3V A;  4ENK A;  2YPR A;  3TO7 A;  1C0W A;  2CWE A;  3L00 A;  1LDD A;  2XV4 S;  2HTS A;  2GIV A;  1O3Q A;  1W7P B;  1HQC A;  2DQL A;  3PQJ A;  1S7A A;  2BEO A;  3CUQ C;  3FZV A;  3WTY C;  5CJ9 A;  4WXC A;  3WOD F;  3M9A A;  1FZP B;  3WE2 A;  2F2E A;  4O6J A;  4JQF A;  2D1H A;  1K7A A;  4MNU A;  5LGU A;  4KT5 C;  2CG4 A;  5DCM A;  1LQ1 A;  3BPV A;  1IN5 A;  6PAX A;  4FX0 A;  1FWZ A;  4A5M A;  4N9H A;  1TBX A;  4EV0 A;  3C7J A;  3FMR A;  3S2W A;  5HVQ C;  3U1D A;  4WWC A;  4HX7 A;  3ZMS A;  5HDK A;  5ED4 A;  3I58 A;  1SMY F;  1ZYR F;  2HFH A;  2J5P A;  1LEB A;  4S04 A;  3V8L A;  3TO6 A;  1ZGA A;  3I4P A;  1Z7U A;  4KN4 X;  4M73 A;  3NEU A;  2AS5 F;  5K5O A;  3KP4 A;  3ISP A;  4ENN A;  2V6C A;  4IHT A;  2QEN A;  4G7H F;  3QU3 A;  4PGG A;  2RGV A;  4IPA A;  1F1Z A;  3E5X A;  2V9V A;  2Y48 A;  1YFH A;  2OBP A;  1TQI A;  3E6B A;  5BQT A;  4HX8 A;  1R7J A;  2DFI A;  1S7O A;  4CO8 A;  2ETH A;  4HX4 A;  5E8G A;  2ADU A;  2FNP A;  2HQN A;  4YFN F;  4BQA A;  3HIF A;  3DXJ F;  3FXR A;  1U5T C;  3DF8 A;  4Z2Y A;  3MQ0 A;  2DU9 A;  4GXO A;  2FE3 A;  1PP7 U;  5H20 A;  4UHT A;  3ZMV A;  1Z1D A;  1Z9C A;  4I0A A;  5ILU A;  2H27 A;  3HRM A;  4OOI A;  2NS0 A;  4KIB A;  1HKS A;  4ON0 A;  2VOP A;  4LD5 A;  1BN5 A;  2MH9 A;  1DPU A;  3R6S A;  1SFU A;  4AVP A;  2IRF G;  2DLL A;  5JFR A;  4ENM A;  3IRQ A;  4A0X A;  1KU7 A;  3PFI A;  2FBI A;  3M8E A;  2DK5 A;  1IRG A;  3JTG A;  3ABU A;  1ULY A;  2MLG A;  3LA2 A;  3AAF A;  3JAM Z;  4I98 B;  3F3X A;  3HUG A;  3M7G A;  5LRS A;  2HKX A;  1UHM A;  1FY7 A;  2CFX A;  2A61 A;  1R5H A;  2VC0 A;  5L3G A;  1SMT A;  2KIM A;  2RV8 A;  2MA3 A;  1XDU A;  3K69 A;  5D5W B;  4RS8 A;  2PLY A;  1FX7 A;  1G3W A;  1KQ9 A;  2IPQ X;  2R7F A;  1HBX G;  1BI0 A;  2X4H A;  2GA1 A;  3KEQ A;  2E7X A;  3BJ6 A;  2KKO A;  3IWZ A;  1J2X A;  3D0S A;  3KZZ A;  2JTV A;  3FXQ A;  1F4K A;  1TW3 A;  4KNY A;  3V7R A;  3BZ6 A;  2C6Y A;  4LJZ F;  4IVN A;  2XAH A;  4N0B A;  3BWG A;  3TQN A;  4EMS A;  1Z05 A;  1OYI A;  2HKO A;  2VOD A;  4S05 A;  1FSE A;  3OV8 A;  1OMI A;  5DUK A;  4UUV A;  2O8X A;  1EH8 A;  4OIO F;  2DAO A;  2EJR A;  3T1B A;  3KEO A;  4UVB A;  1HW2 A;  4O3M A;  2L4A A;  4Q48 A;  1XGS A;  1I27 A;  4AIH A;  3GLX A;  4G6D A;  4A6E A;  3I53 A;  2Y0M A;  2M87 A;  1XD7 A;  4RGX A;  3G73 A;  5DEQ A;  3SZP A;  1KYW A;  2PMU A;  1GHC A;  2Z33 A;  2QQ9 A;  4UVC A;  2XIG A;  4P9U A;  3T0Y A;  4EJO A;  2VBW A;  3IKT A;  3DP7 A;  5HOO A;  2FRH A;  3DPT A;  3CDH A;  2HQR A;  1AOY A;  1TQP A;  2Q8K A;  3HRT A;  1O57 A;  3IHU A;  2YU3 A;  2ZFW A;  3B02 A;  1PDN C;  3H92 A;  1HKT A;  1XMA A;  4PZJ A;  3KP3 A;  2RVC A;  1WI9 A;  4PDK A;  3ML6 A;  5HDN A;  2EFO A;  1GXP A;  1GVJ A;  3KP5 A;  1TLH B;  1L0O C;  1ONV A;  3F22 A;  3GW2 A;  5A2Q K;  5D5U B;  2P6S A;  3RKW A;  3HRU A;  4RGS A;  3SFZ A;  5LLQ A;  3I59 A;  1S6L A;  1RUN A;  4I2O A;  2AXL A;  2K4J A;  2OU2 A;  4HF1 A;  4WCG A;  1B9M A;  1XB4 A;  4M9Z A;  4XSZ F;  3GVA A;  5DCF A;  2GA2 A;  4BHC A;  1YW8 A;  4WX9 A;  2RC4 A;  4FHT A;  2ACJ A;  4KIC A;  1DPR A;  3IL2 A;  4HAM A;  3LWF A;  5D4S A;  1FNN A;  2CQK A;  4EJU A;  4QWQ A;  3FX3 A;  3I59 B;  3KLN A;  3P9I A;  5ICC A;  3GX4 X;  1R23 A;  2O61 A;  2YSR A;  3JW4 A;  3DV8 A;  5AIP A;  1FYM A;  3WU1 B;  3GFI A;  2V1D A;  1UB9 A;  4BXU A;  1BJA A;  1I1S A;  3ZQ7 A;  5HDG A;  2COM A;  2UZK A;  3CO6 C;  2GXB A;  2VBX A;  4IRG A;  3F72 A;  2XKO A;  4U0V A;  2NNY A;  4GYG A;  2Z99 A;  1X3U A;  2CW0 F;  3F8B A;  5FLX Z;  3ERE D;  4AD9 A;  5CVI A;  1ON1 A;  1Z6T A;  5LEJ A;  5D5V B;  3BY6 A;  1RIO H;  2M8E A;  1DUX C;  1LNW A;  2Z3Y A;  3RPU A;  1T38 A;  2ISZ A;  2HYG D;  1PUE E;  4KMF A;  2JT1 A;  3SHF A;  2L54 A;  1P2F A;  1LEA A;  4O5V A;  3HSE A;  4CZZ A;  1W7P A;  4A6D A;  4CDG A;  4HOB A;  4HLY A;  4G94 A;  3BRO A;  1SFE A;  3GF2 A;  4U88 A;  2CO5 A;  4HA8 A;  4HDV A;  3EYY A;  1XSV A;  2P5L C;  4LLG F;  5CVR A;  4ENJ A;  3QU6 A;  1P4W A;  4MQV A;  3E6M A;  2ZME B;  3F8M A;  4UXN A;  5K5R A;  1EH7 A;  1BOA A;  4ESF A;  4ZYH A;  1XCV A;  1R22 A;  2HGC A;  2J5O A;  2PBI A;  2WTE A;  1XGM A;  3DPL C;  1XCB A;  3CO7 C;  1R58 A;  3DKW A;  1S8N A;  3QP5 A;  2K27 A;  2A5Y B;  1ZN2 A;  3SZT A;  4EM1 A;  2E1C A;  1BIA A;  3WTW C;  4H0E A;  3IC7 A;  4A0Z A;  2OAZ A;  3F23 A;  3IWF A;  5FFX A;  1U2W A;  4ASN A;  1USS A;  3VFZ A;  1KGS A;  3DEU A;  1W7P D;  3VOE A;  2VBZ A;  2PQ8 A;  2KIU A;  3QRF F;  5H6R A;  3GXO A;  1CF7 A;  2VT2 A;  5FO5 A;  2L4M A;  1S3J A;  4HV5 A;  1ZG1 A;  5LEK A;  4LB6 B;  4EJT A;  4I02 A;  1WQ2 A;  1RNL A;  4AIK A;  1BM9 A;  3P7N A;  3P9K A;  4KMU X;  4ZH4 F;  3L2C A;  4HF0 A;  1KQ8 A;  3EQL F;  2LF8 A;  3CTA A;  1MDM A;  3EET A;  2K7L A;  2OZ6 A;  2QQA A;  1O3T A;  3I0T A;  1OKR A;  2NAZ A;  3GFM A;  2IJL A;  3R0A A;  4WXH A;  1W5S A;  2VT3 A;  1I1G A;  5A2Q Z;  3BP8 A;  2FNA A;  1J59 A;  1CF7 B;  4M9S A;  3HYI A;  2XAS A;  3MWM A;  5J8C A;  1T2K A;  4E70 A;  1SAX A;  5E1X A;  3F6O A;  2QLZ A;  2P7C B;  3WU0 A;  2JPC A;  2MBF A;  3DFG A;  1MDM B;  2XAQ A;  1R36 A;  1LVA A;  4GYI A;  2RQP A;  2VBY A;  3WTZ A;  1UFM A;  2VE8 A;  1W5T A;  3ZMZ A;  1XDS A;  3RKX A;  2XRN A;  1IW7 F;  3F8F A;  4XRF A;  2BYV E;  3Q9V A;  3TGN A;  1K78 A;  2E1N A;  1I6X A;  2K02 A;  3I5U A;  4IF4 A;  1R1V A;  3W6K B;  2DBB A;  1QPM A;  3E6C C;  3V4G A;  5HS8 A;  4FX4 A;  3JSO A;  4RB0 A;  3R60 A;  1D3Y A;  2ZO4 A;  2Z5U A;  4M6Y A;  1J75 A;  2RKH A;  1FC3 A;  3E6D A;  3K1M A;  1T39 A;  3V8J A;  3P9C A;  4OMY A;  1R1U A;  4R1H A;  1F5T A;  3KZY A;  1V4R A;  2XVC A;  3O2P E;  1E17 A;  1MJB A;  4I0B A;  1K78 B;  4A2U A;  5ILS A;  3WE3 A;  1BIB A;  4EGY A;  4EM0 B;  1MKM A;  3N4M A;  4ZYD A;  2P7V B;  3MAJ A;  4RGR A;  1FPQ A;  5LRR A;  2MD5 A;  5JVT A;  4UV8 A;  5FLX K;  1P6R A;  4LB5 A;  4A0Y A;  2XAF A;  4HF2 A;  3F8C A;  2PI0 A;  1SD5 A;  1QQI A;  4B8X A;  4HBL A;  1GXQ A;  3ECH A;  4ZZD A;  3CUQ B;  2M45 A;  5L3F A;  3TKY A;  3GWZ A;  4JK1 X;  4NQW A;  3LAJ A;  4G6Q A;  1WWX A;  4KA4 A;  3PQK A;  2KRF A;  5EEG A;  1MZB A;  4LK1 F;  3BDD A;  4BHP A;  2W25 A;  3QAH A;  2ISY A;  3F6V A;  1RUO A;  1UHW A;  5L3D A;  1EV7 A;  1MJA A;  3RIR A;  3WGI A;  5HLI A;  2MC3 A;  1IN8 A;  2XKP A;  1YW9 A;  1NHA A;  2QQB A;  1XGO A;  2FOK A;  3H3Z A;  5L3B A;  4LGW A;  2JPB A;  3WTU C;  1J7K A;  4MQ9 F;  4CGZ A;  3L09 A;  4Y17 A;  2R7D A;  2UXN A;  4K2E A;  3EUH A;  1IXS B;  3GO5 A;  3RJP A;  2ESN A;  2PFB A;  4P96 A;  5L3E A;  2VOO A;  2W57 A;  3TOA A;  1KU2 A;  2DK8 A;  1I5Z A;  5BS6 A;  1FLI A;  4OMZ A;  4RB3 C;  2IT0 A;  4DQ2 A;  2EB7 A;  3IKV A;  1ZAR A;  1G3S A;  1TNS A;  3MEX A;  5CVU A;  2P5V A;  2IVM A;  4U7B A;  4YII A;  3K1P A;  1U5T B;  4OU0 A;  3WTS C;  2A69 F;  5LGT A;  1G6N A;  3MZY A;  3SQN A;  5LBQ A;  3J7A O;  3REO A;  1D8J A;  2EFN A;  3I71 A;  2Q0O A;  2D45 A;  1FOK A;  1TW2 A;  3KLO A;  2MH2 A;  2BE5 F;  2DQR A;  2FXA A;  3QP6 A; 
#chains in the Genus database with same CATH topology
 5D8L B;  3MFK A;  1KU9 A;  3PNT A;  4MGR A;  2R7U A;  2QVO A;  2O6G E;  2BGC A;  3Q5F A;  2G0E A;  1AHD P;  5CVV A;  3H9Q A;  1KA8 A;  5HS9 A;  3AL0 C;  3O8G A;  4BKX A;  3K4B A;  1U6G A;  1R5G A;  4JP0 A;  2OZU A;  1O7L A;  4A69 C;  2V6E A;  4OIP F;  4RA2 A;  4MFD A;  1WFX A;  2OQR A;  5C4J J;  3CD6 I;  2EWN A;  2FQ3 A;  3J81 Z;  4NHJ A;  4I76 A;  3PUB A;  1T98 A;  2KZV A;  2A07 F;  4RLQ A;  4KFC A;  1O3R A;  3K4M A;  3QOD A;  1KU3 A;  1I3A A;  5KAI C;  3DQV C;  4Y3O A;  3LQQ A;  3C1D A;  4HDU A;  2PN6 A;  2EFP A;  4B3A A;  2CUE A;  3LSI A;  1MMN A;  1P92 A;  4D7N A;  1MBF A;  3GYH X;  2OD5 A;  4RMN A;  4A5N A;  2YR2 A;  3VEP A;  2HR3 A;  5E8I A;  3OYG A;  1XMK A;  9ANT A;  3GEZ A;  3HGY A;  3G1M A;  1JHF A;  2X85 A;  2ZJP F;  4L9V A;  4M71 A;  5K5Q A;  1JHH A;  1IN4 A;  2FU4 A;  2VC1 A;  4L9T A;  2MAB A;  2DT6 A;  4I7H A;  1D1C A;  2W85 A;  4M3D A;  5HNH A;  3I55 I;  2HPM A;  3PUF A;  4FT8 A;  5ICE A;  3BPX A;  3J80 K;  5DD4 A;  1L3L A;  1Z91 A;  3FM5 A;  3HSR A;  4IXA A;  5CLS A;  2V9K A;  2F4M B;  3IH3 A;  5BNG A;  3WGG A;  4QPO A;  3DKY A;  1JE8 A;  2KPM A;  3ZQQ A;  2B0L A;  2H6C A;  3U9G A;  3EDP A;  4IOA F;  1FTZ A;  4ZJZ A;  1WPK A;  2PMH A;  2M5W A;  4Y52 J;  4FET A;  1E0E A;  2L7Z A;  2NVY J;  3HSF A;  2LFB A;  5ILV A;  4ZZL A;  2O3F A;  3TOB A;  2E7W A;  3NRV A;  5HLG A;  2R5Y A;  1IXC A;  4QPQ A;  1ETX A;  5E1W A;  1WJE A;  1R1T A;  5IT9 Z;  3S2H J;  4GRI A;  1IZ1 A;  2MLK A;  4EEF G;  5EF6 A;  3FMS A;  1O7F A;  3UKG A;  1VFC A;  1IN6 A;  2XPV A;  1IV8 A;  4IQJ A;  2WV0 A;  3R0J A;  2W24 A;  4U7D A;  3K70 D;  4MO7 A;  1KQ0 A;  4M6V A;  4DYR A;  4KUM A;  3OYN A;  2LRE A;  2D2W A;  1YIT I;  2L02 A;  3RPQ A;  3QPT A;  3A01 A;  3CMY A;  4D7M A;  2HZT A;  4L5J A;  1D1A A;  4BGD A;  1TWH J;  2CYY A;  1RKT A;  3U2R A;  3OR1 C;  1WSU A;  1KON A;  2A68 F;  4NB5 A;  1S7E A;  3RKY A;  2W48 A;  3ZOB A;  1XC5 A;  4E7L A;  2BBY A;  3BG5 A;  3BTI A;  1FEX A;  2M1B A;  1Z0X A;  2ICW G;  2IGN A;  2ZNY A;  2RQQ A;  2F5D A;  1TT5 B;  5IT3 A;  1B8I A;  4KDP A;  2F5V A;  5CQG A;  1QHG A;  2R5Y B;  1JKQ C;  2LVS A;  5TJJ A;  2VE9 A;  4I99 C;  1MGT A;  4EGZ A;  3KET A;  1YS7 A;  3A1Y A;  3KYC B;  4BDZ A;  2DA4 A;  3W6J B;  2KHM A;  2K4B A;  2GAU A;  3PIO F;  3LQR A;  4KIS A;  3T5X A;  2DYR H;  4LIU A;  3GLL A;  2ZME A;  3SJM A;  4AC0 A;  2O03 A;  2OJE D;  2LH9 A;  2P8T A;  5HS7 A;  3CP2 A;  4IRI A;  1MBK A;  3O6B B;  1BW5 A;  1R00 A;  4DNC A;  2FBK A;  3RSN A;  3A01 B;  3BTC A;  2G7U A;  4U0Y A;  2GXA A;  2LTP A;  4L9N A;  2OCE A;  2PEX A;  5J1Y A;  2LY2 A;  4PK4 A;  3RI4 A;  4Q47 A;  4IKF A;  3ABK H;  3TDU C;  1YS6 A;  1QZY A;  3E5Q A;  2EV0 A;  4HQE A;  4AWX B;  1BI3 A;  1DU0 A;  5FB2 A;  3OS2 A;  2QM3 A;  4EVI A;  2DPU A;  2CW7 A;  3VB2 A;  1VTN C;  2B9S A;  2P6T A;  4QLC U;  4LLN A;  3C3W A;  1G4D A;  2E36 A;  1B8I B;  1K79 A;  3Q0U A;  4HV6 A;  5EGO A;  1MJ9 A;  1XSX A;  2LDU A;  4BBS J;  2EV5 A;  5FD6 A;  1PP8 F;  3ELK A;  5FRM A;  1ZRD A;  5GTH C;  4M74 A;  2DOD A;  1MBG A;  5M5W J;  3GTG J;  4P9F A;  3H5R A;  3KP6 A;  4XKB A;  1LDJ A;  2HTJ A;  1BC8 C;  4L5I A;  1T56 A;  2BOL A;  4AYB N;  2V4J C;  4G8X A;  5KVR A;  4XON A;  2ZSI B;  4A3M J;  2M0C A;  2F5C A;  2YX4 A;  3A0B C;  3ABT A;  4E7H A;  1G3Y A;  5FRO A;  1POG A;  1E2X A;  2RNJ A;  3L9F A;  3M1E A;  4CYD A;  1U3E M;  3WG7 H;  2PX9 A;  2D1V A;  3OWT A;  3IRR A;  3I64 A;  2FSW A;  2AQF A;  2HYF A;  2Y0S A;  3GCM A;  3V7C A;  1B6A A;  1TWF J;  2H94 A;  1UG0 A;  4YIF A;  3GZ5 A;  2G7H A;  3NQO A;  3OYI A;  2M34 A;  1FP2 A;  3BT9 A;  4R8H A;  3RYP A;  5GAG J;  1YI2 I;  2CMP A;  2Y31 A;  2WAD A;  1OPC A;  3HTS B;  2VQL A;  4PFP A;  2XGX A;  2MFZ A;  5GAE J;  5JI6 A;  2M7A A;  3CCY A;  3HTU A;  2JA8 J;  1SVO A;  1HXD A;  2VON A;  3LSK A;  2OF7 A;  3OYE A;  4EQQ A;  3K9T A;  4YG2 F;  5D6F A;  3NWS A;  3H5N A;  2CSO A;  2YX7 A;  3CCJ I;  2H1K A;  4GGG A;  5H2F C;  2DFE A;  2LKS A;  3S15 J;  3RDI A;  4E7Z A;  1BI2 A;  5ICF A;  4MTD A;  2GM4 A;  4BNC A;  4C2T A;  3PNV A;  1LUJ B;  1Z6R A;  4ZC3 A;  3HKZ N;  3R61 A;  3CCE I;  4A3E J;  2JUC A;  3HZJ A;  1CQT A;  4XN3 A;  1G8X A;  1LFP A;  2K9N A;  2YU9 J;  3M07 A;  4F7Z A;  4I01 A;  2L7K A;  2Y30 A;  1V55 H;  3ZN1 A;  5JHF A;  5HLH A;  1ZR2 A;  1A04 A;  3OIP A;  3S2D J;  4M3G A;  3DWL E;  3QPH A;  2A6E F;  5E18 F;  1R9T J;  1MIJ A;  2TDX A;  2M0M A;  2FD5 A;  1TNT A;  3DU6 A;  1YIO A;  2ZXI A;  3COA C;  3OOU A;  4HLX A;  2KJC A;  4OIQ F;  1BOB A;  3VYR B;  3N97 A;  5FFZ A;  1UST A;  2A6H F;  4XQF A;  2FML A;  3CME I;  4PJM A;  3K2Z A;  3Q9S A;  2NXN B;  1STZ A;  2EA4 A;  3KFW X;  2JQ7 A;  1SFK A;  4KIF A;  3CLO A;  4PJL A;  3TDZ C;  3CUO A;  2EZH A;  4WXD A;  1HCR A;  1ACI A;  1REP C;  3S3N A;  3KZI C;  2FA5 A;  3ZP5 A;  4IHX A;  4LMY A;  2R7V A;  4PSW A;  4XKC A;  1ZGJ A;  2VUM J;  2CS3 A;  3DLA A;  4ZYE A;  1G59 A;  3W6V A;  4PGH A;  3I54 A;  2EIM H;  5ICG A;  5IYD J;  1HW5 A;  2ELH A;  2DO7 A;  2IP2 A;  4YFK F;  3AFH A;  4HQM A;  3I9V 2;  4RB2 C;  1BR1 A;  3Q0W A;  3MZH A;  1I6H J;  4N9I A;  1H0M A;  2CGP A;  4G7Z F;  4CHU A;  4KN7 X;  2BY1 A;  5LHG A;  2BHZ A;  1BL0 A;  2CFO A;  3H3U A;  2IBD A;  4MFE A;  5DCM B;  2RDP A;  2STW A;  1ENH A;  5KK1 A;  4FTH A;  2DOE A;  2L3D A;  3HHH A;  2KJB A;  2E19 A;  4U0W A;  5FKM A;  4CIC A;  2IA0 A;  3DCF A;  4BXF A;  2OA4 A;  1IXR C;  1RR7 A;  3JRE A;  1YW7 A;  1NK2 P;  2JUG A;  2L9R A;  4BEH A;  3J81 K;  1XX5 A;  2HWV A;  3FM3 A;  4J01 A;  1X1B A;  1XSD A;  4HZF A;  5E17 F;  3MKZ A;  5FKO A;  3OL3 A;  4MHG A;  2KP6 A;  1DP7 P;  1UMQ A;  3J80 Z;  2VXZ A;  4NBQ A;  4OIR F;  2K86 A;  3ZMD A;  2HDC A;  4Y13 A;  4RGU A;  4XBF A;  2WAQ N;  4RB1 A;  2HEO A;  3TW7 A;  4N4O B;  1AA7 A;  3BCB A;  1ZH5 A;  2K5C A;  2EIN H;  2MD0 A;  3E1S A;  5F04 A;  3CC7 I;  3EUH C;  3TO9 A;  1WRJ A;  1ETV A;  3G4S I;  2VN2 A;  5BOX A;  1TZL A;  5E3L A;  3QOP A;  3MKW B;  1OCT C;  3H36 A;  1ZAO A;  3G1O A;  4XR6 A;  2WC2 A;  3M8F A;  1H9T A;  1LJ9 A;  2QWW A;  3I56 I;  2PG4 A;  2HYJ A;  5D8K B;  4HW0 A;  2GWR A;  4BEH B;  4C2M J;  5D5X B;  3ZPL A;  4C3H J;  5IYC J;  2E1M C;  3LST A;  1T0F A;  5B1A H;  2HNH A;  2DJI A;  4CCN A;  4OIN F;  4BHB A;  5IT9 K;  3HHG A;  2JN6 A;  2PMZ N;  2IW5 A;  2ZNZ A;  3K4L A;  1FYK A;  1DQU A;  5M3M J;  1B9N A;  3MCZ A;  1H8A C;  4LG0 A;  3E97 A;  1JJ6 C;  2XUB A;  4AIJ A;  2KDZ A;  3CUQ A;  3H0G J;  4XOT A;  4B09 A;  4RAF A;  1J9I A;  1YE9 A;  3FWE A;  5CPR B;  4MEY F;  1SD7 A;  1FBU A;  1P4X A;  3VYU B;  2DA7 A;  4XLE A;  4GO1 A;  1RI7 A;  4QSH A;  2LKP A;  5EDN A;  3D5R C;  4KYW A;  3S1N J;  2E2I J;  3GFJ A;  5JHU A;  1BI1 A;  1TQM A;  3WTV C;  2IS6 A;  3KYD B;  2DI3 A;  4AYB A;  2VKV A;  1DDN A;  2K85 A;  1W0T A;  2RN7 A;  2V79 A;  1A36 A;  3L2V A;  5DYM A;  3K1N A;  4P55 A;  1V3F A;  3H0D A;  4BBR J;  2A6T A;  1BBY A;  5JR3 A;  4W97 A;  2M30 A;  2FUG 2;  1EA3 A;  1P4A A;  1TWG J;  3LFU A;  3AG4 H;  5JLW A;  4RLF A;  5B5E C;  2FEZ A;  2L01 A;  3BG3 A;  2LNB A;  1WGX A;  5EEH A;  1IO2 A;  1WVR A;  2X6O A;  2LSO A;  1H9G A;  1CGP A;  1SD4 A;  2M9H A;  4N4N B;  3WTX C;  2ZSH B;  4LG0 B;  3LA7 A;  3OYM A;  5E20 A;  2MW8 A;  2ZCW A;  2E1O A;  2Q2E A;  5D6E A;  2O8K A;  2BXY A;  1TWA J;  1ZG5 A;  2GZW A;  2HS5 A;  2ZJ2 A;  3ROU A;  5D4R A;  2QYO A;  3GTP J;  4HEA 2;  4XSX F;  2A3S A;  3FMQ A;  1G3T A;  2XHK A;  2XPU A;  1HKQ A;  1ZHF A;  3S3O A;  3DEW A;  3HKZ A;  2Y9Y A;  3FF5 A;  1FP1 D;  1OCC H;  3JRI A;  5IP7 J;  1B72 A;  3V8K A;  3HRS A;  1GVD A;  3MVP A;  4B44 A;  2LF7 A;  2F5E A;  2H09 A;  3IH4 A;  4A3G J;  4L0Z B;  2EFQ A;  4BJT A;  1X4O A;  3KCC A;  2QCO A;  3E0J B;  3S93 A;  4EJW A;  2QZ8 A;  5F6F A;  1FT9 A;  3ECO A;  3QYB A;  2H8W A;  1TTY A;  4DYQ A;  5J8F A;  4Q4Z F;  3T8R A;  1ON2 A;  2W82 A;  5C4X J;  1T8I A;  4P5O A;  2DT7 B;  3WGH A;  2G9W A;  3P5J A;  4IHW A;  1ETW A;  1IAW A;  3E5U A;  2Q2E B;  1BA5 A;  3FHZ A;  5DD8 A;  1MNM C;  1MBH A;  2QUF A;  4G9Y A;  1JKO C;  2X1D A;  2UXX A;  4II2 A;  2X6W A;  3OOP A;  2EPF A;  3C2G A;  2OTL I;  1ZLK A;  5EG0 A;  2D5V A;  2Y69 H;  2OCC H;  1X2M A;  4A3J J;  3RZO J;  2XAG A;  2GQQ A;  3KP2 A;  5TRD A;  3DTE A;  4JX4 A;  1U5T A;  2P5K A;  3LA3 A;  3IH2 A;  3LSH A;  3HOY J;  2OC6 A;  4RAZ A;  3SDB A;  4BAC A;  3BJO A;  2IA1 A;  4L9J A;  3WHB A;  3L2R A;  1WH7 A;  1OR7 A;  1H89 C;  4H4K C;  4LG3 A;  4C3J J;  1Y6I A;  1GT0 C;  2XB5 A;  4XNF A;  1U8R A;  2Y75 A;  4DIQ A;  3CCR I;  1A35 A;  1FSH A;  1IC8 A;  5BMZ A;  2CU7 A;  3ZXS A;  1MMG A;  1T6S A;  1YQA A;  1UCR A;  1KZH A;  1A31 A;  2RAE A;  4UVA A;  1WJD A;  3Q3S A;  1D0Y A;  5CKT A;  4L0Y B;  3NWT A;  3GUD A;  4Y7N J;  1FYL A;  1UG2 A;  2P0W A;  4M6X A;  1VQ5 I;  5J47 A;  4XMY A;  4DBR A;  3D1N I;  2XB0 X;  1U0J A;  2DFF A;  4II3 A;  4X0G A;  1MBE A;  1OYY A;  4PUS A;  1WJB A;  3JCU C;  1U78 A;  1JXS A;  2O0Y A;  4R79 A;  1IF1 A;  5C3E J;  3BG9 A;  3PJR A;  3BR1 A;  3LFK A;  3B73 A;  3OYC A;  4D9J A;  1OQY A;  3CJT B;  3FXU A;  3MKL A;  1ETK A;  4LLL A;  4RAY A;  3K0L A;  2ZME C;  2V1X A;  2DA3 A;  3OSF A;  2EFW A;  5FGM A;  1X2N A;  2JA7 J;  4A12 A;  1B59 A;  2WAQ A;  4BS9 A;  1YO5 C;  4NC6 A;  1SEU A;  5JLX A;  2DXI A;  5BPD A;  2LK2 A;  2W84 A;  1ODD A;  1O3S A;  4XM3 A;  2KIF A;  5AIQ A;  2JSC A;  3FK6 A;  3ZMT A;  1ZRC A;  1ZRE A;  2GOM A;  1QRY A;  1SC7 A;  2VQG A;  1IDZ A;  5IOY A;  2XSJ C;  2F4O B;  1FTT A;  1SD6 A;  4NC7 A;  1IN7 A;  1VQM I;  1AU7 A;  2GOX B;  2JZY A;  2B63 J;  2HVS A;  2IGO A;  4V2G A;  4D0P A;  3FXL A;  4BE0 A;  4BDY A;  1TP4 A;  2KFD A;  3MD2 A;  3WTT C;  3LAP A;  2HU9 A;  4XRS A;  2ZXJ A;  3OIO A;  2XAJ A;  1QO0 D;  3BTL A;  5CYV A;  3KP7 A;  5F1R A;  1ZRF A;  2AXT C;  2IA2 A;  2LBF B;  4FCY A;  3I4N J;  2PMZ A;  3HOS A;  2XRL A;  3ASN H;  5LHI A;  3GFL A;  2GXG A;  2ZKZ A;  1FBS A;  4EJV A;  3R4K A;  5M3F J;  2FF4 A;  4I09 A;  4IRH A;  4AU7 A;  2MGQ A;  2W00 A;  1UAA A;  4M9X A;  4EM2 A;  2QBY A;  1KYZ A;  4G7O F;  5H6Q A;  3ZMU A;  2VQC A;  3RCO A;  1RZ4 A;  2NNN A;  4YRV A;  3HOT A;  1B1B A;  2K9M A;  1X19 A;  4P1W A;  1TT0 A;  1B4A A;  2OQG A;  4A3I J;  2R93 J;  3ZN0 A;  3U21 A;  4TV7 A;  5F27 A;  1X3Z B;  2STT A;  5HLT A;  1XGN A;  2UWM A;  4CXF A;  1LDK B;  2EK5 A;  5KNL A;  4ANJ A;  3O3K A;  4HYE A;  3GZ6 A;  1QZE A;  1YTY A;  2F5F A;  2E2H J;  3CDL A;  1BC7 C;  1LB2 A;  4UB6 C;  3JRC A;  1IUY A;  3KE2 A;  2HOE A;  3A2K A;  1J0R A;  4OWR B;  3HPH A;  1OIS A;  2F4I A;  3JSP A;  5L3C A;  3GTM J;  2FMY A;  2Z9O A;  3LL7 A;  4C3I J;  5DUI A;  4UV9 A;  3RTR A;  1O4X A;  2HI3 A;  2H6B A;  1Y0U A;  3OYH A;  1EH6 A;  2DMN A;  5FD5 A;  3BLY A;  3BJA A;  5AON A;  2R7Z J;  2F6C A;  5DM7 F;  4IJA A;  3C2H A;  3LNQ A;  2XSD C;  2LD5 A;  1F9N A;  3HOU J;  3G3Z A;  3CJN A;  1JUS A;  4BH9 A;  3F21 A;  1HST A;  3VOD A;  2JRT A;  1IGN A;  1YYV A;  4DJA A;  3WG9 A;  3HBL A;  4YFX F;  2QBY B;  4A3C J;  4JBA A;  2X51 A;  1EJ9 A;  3WHC A;  2EA2 A;  2NOJ B;  3W3C A;  1W1W E;  2QSG X;  2BV6 A;  5LGN A;  3D5L A;  4BAY A;  4XLP F;  4CYC A;  1TL8 A;  3DBH B;  3HB9 A;  1W36 D;  5FRN A;  1Q1H A;  1YLF A;  1E3O C;  1XN7 A;  5BPI A;  1GUU A;  1BW6 A;  3S1M J;  1ZG3 A;  3E7L A;  1J5Y A;  2DT5 A;  5IOZ A;  5J6X A;  5F64 A;  1ZQ3 P;  2WY7 Q;  1QBJ A;  2VKD A;  4ESJ A;  4MEX F;  4WF2 A;  3F9K A;  4LFU A;  1K6Y A;  1ZLJ A;  4OAY A;  1YJ9 I;  4L18 B;  2R5Z A;  4UB8 C;  3EYI A;  4XID A;  4JX6 A;  1K4T A;  2FOW A;  3K4K A;  3VWB A;  2NYX A;  2R4G A;  5TIS C;  1N75 A;  1OYW A;  1LFU P;  3RYR A;  3HPG A;  1K6O A;  3CQZ J;  5J4V A;  1WJF A;  4IHY A;  2NRA C;  4IHS A;  3OS0 A;  1JGS A;  3TP3 A;  1W4M A;  4ETS A;  5DV5 A;  4UNO A;  1QNT A;  4CSW A;  3JAM K;  1Y1W J;  2HDD A;  4WK8 F;  3PO3 J;  1DP3 A;  2DPD A;  3L7W A;  4JOM A;  5LHH A;  1VQP I;  4M72 A;  1D5V A;  1UEL B;  3A02 A;  1MH4 A;  2DW4 A;  3LMM A;  2X1E A;  1FBQ A;  1AWC A;  5GAH J;  1P9Q C;  4CYC B;  2FBH A;  2QA4 I;  2XF7 A;  4ZYG A;  2P4W A;  4E4H A;  2LRD A;  4YIR X;  4LK0 F;  2ZBK A;  2I8D A;  2R7T A;  1UHS A;  5HNF A;  4ESB A;  2X0L A;  4Y15 A;  4MTE A;  5K1Y A;  2Z16 A;  3S14 J;  4IO9 F;  1SFX A;  2FQ4 A;  3MN2 A;  3JRA A;  2R5Z B;  1YG2 A;  1X58 A;  3GBG A;  3QWL A;  2ESH A;  1MD0 A;  1JTY A;  3JTH A;  4BQQ A;  3C18 A;  4Y4R A;  4XLN F;  3OYF A;  4A3L J;  2R7O A;  3ULQ B;  3A03 A;  5J1R A;  3LSP A;  3PL8 A;  3K4C A;  2R3S A;  2KLO A;  3BOQ A;  3SXY A;  2UUZ A;  4BUP A;  1S29 A;  5CVJ A;  2HPI A;  2DTR A;  1D8K A;  2HXO A;  3GME A;  2L5Q A;  2R92 J;  5E1Z B;  1QGP A;  3ZR8 X;  2PJP A;  2XRO A;  1QZZ A;  2XPW A;  4BXX J;  1FOY A;  2WWY A;  2CQQ A;  2JA2 A;  1U9O A;  3Q0V A;  2V1U A;  4Q5S F;  2JSP A;  3T8T A;  4B48 A;  1IRF A;  2V7F A;  1WKM A;  1WI3 A;  4PCQ A;  4A3F J;  4KIG A;  1WHU A;  3FK7 A;  1JUM A;  4AM3 A;  3RQ4 A;  2KMU A;  2EV6 A;  4GCV A;  3VSL A;  1HW1 A;  1PJR A;  5DDG A;  2ID6 A;  1R49 A;  1I3Q J;  2L9S A;  3F8N A;  1PUF B;  1I50 J;  1HSJ A;  2RNG A;  3CJR B;  1X1C A;  2EZK A;  4BYY A;  1Z77 A;  2GBY A;  5ERI A;  3V7S A;  2HOT A;  3E3V A;  2V26 A;  3BTJ A;  1PYV A;  4ENK A;  2YPR A;  3TO7 A;  1NK3 P;  1C0W A;  2CWE A;  4ITV A;  3L00 A;  1LDD A;  1GDT A;  1QPI A;  2XV4 S;  2HTS A;  3HOZ J;  2GIV A;  1O3Q A;  1ORK A;  4RDU A;  1W7P B;  2ZC2 A;  3ESW B;  1HQC A;  2DQL A;  3BCA A;  4IEJ A;  3A0H C;  3PQJ A;  1E3P A;  1S7A A;  2DDA A;  2ID3 A;  4FAS D;  2FJ1 A;  1JKP C;  1QVT A;  2BEO A;  3CUQ C;  3FZV A;  4F91 B;  1H88 C;  1R5I D;  3WTY C;  1VZ0 A;  5CJ9 A;  4WXC A;  1K83 J;  2OPT A;  3WOD F;  3M9A A;  1LE8 A;  5EYR A;  1FZP B;  2CH0 A;  2QEX I;  3RZD J;  5F0H A;  3WE2 A;  2F2E A;  3QYE A;  4O6J A;  1DGW Y;  3DTI A;  4JQF A;  2D1H A;  4YEL A;  2EIL H;  5J3L A;  1E3H A;  3BR2 A;  1K7A A;  3FHN A;  4MNU A;  5LGU A;  3G1L A;  3EUK L;  4FQG A;  4KT5 C;  2CG4 A;  5DCM A;  1LQ1 A;  1X4P A;  4KJZ A;  3BPV A;  2VIX A;  5FLM J;  1IN5 A;  1T08 B;  1U9N A;  2ME6 A;  5FJ8 J;  3M3Y J;  6PAX A;  2DFH A;  4XRS G;  2ELK A;  4FX0 A;  5M5Y J;  1FWZ A;  2NS7 A;  2BY3 A;  3OS1 A;  2P81 A;  4A5M A;  2VJ5 A;  4N9H A;  1TBX A;  4NDL A;  4EV0 A;  1XS9 A;  3C7J A;  3FMR A;  3S2W A;  5HVQ C;  1HDD C;  3U1D A;  3AG2 H;  4WWC A;  4HX7 A;  3ZMS A;  1UZC A;  1X1P A;  2O7O A;  5HDK A;  4XLA A;  5ED4 A;  3OMY A;  3I58 A;  5FKL A;  1LE8 B;  1SMY F;  1ZYR F;  3JRD A;  5GPA A;  2HFH A;  2J5P A;  2MG4 A;  4S04 A;  4ZTJ A;  1LEB A;  3V8L A;  3TO6 A;  3J7Y J;  1ZGA A;  4NUB A;  1FMW A;  2EZL A;  2NOG A;  3I4P A;  1VF9 A;  1S72 I;  1Z7U A;  1ZK8 A;  4F93 B;  3GTO J;  3S16 J;  4KN4 X;  2GLO A;  4M73 A;  3NEU A;  2AS5 F;  5K5O A;  3KP4 A;  1A6Q A;  2CUZ A;  3ISP A;  4ENN A;  2V6C A;  4IHT A;  4PJ0 C;  1K61 A;  3BR5 A;  3K2A A;  3CLQ A;  3G71 I;  4KIT B;  2JA5 J;  2LG4 A;  2QEN A;  3OSG A;  1OJL A;  2WAE A;  4G7H F;  4DYC A;  1F36 A;  2VB6 A;  3B6A A;  3QU3 A;  2R0Q C;  1MMD A;  4PGG A;  2RGV A;  2XGD A;  4IPA A;  1MND A;  4GDF A;  1F1Z A;  3VSK A;  3E5X A;  2V9V A;  2Y48 A;  3X2Q H;  1ITY A;  2VXD A;  1YFH A;  2ECB A;  2OBP A;  1TQI A;  4FE4 A;  3HC7 A;  3AKZ A;  4B43 A;  1ZTR A;  1VND A;  3E6B A;  5BQT A;  2K40 A;  4HX8 A;  1R7J A;  1XMX A;  2DFI A;  2X48 A;  1S7O A;  3GTQ J;  4CO8 A;  2ETH A;  2LC2 A;  4XLF A;  4XOP A;  1VQ4 I;  4HX4 A;  5E8G A;  2ADU A;  2FNP A;  2HQN A;  2DMQ A;  4IL6 C;  4YFN F;  2LKX A;  4BQA A;  3HIF A;  4X1E A;  1VQO I;  1ETY A;  5J1U A;  3DXJ F;  3FXR A;  2KDO A;  1U5T C;  1QVU A;  2X6Y A;  3DF8 A;  3VYT B;  4Z2Y A;  3J7A Y;  3MQ0 A;  1QA6 A;  2DU9 A;  4GXO A;  2W4S A;  2FE3 A;  1OR7 C;  3DBR B;  2NS8 A;  1PP7 U;  3NAR A;  1GLN A;  5H20 A;  2R7Q A;  2E5Z A;  4UHT A;  1IUF A;  3ZMV A;  4E7J A;  1Z1D A;  3VYS B;  3L2W A;  1Z9C A;  2OUM A;  4I0A A;  5ILU A;  2H27 A;  3HRM A;  4OOI A;  4HRI A;  3H35 A;  2NS0 A;  1W5C C;  4KIB A;  1I39 A;  2K3F A;  1HKS A;  4ON0 A;  3DPU A;  4ZYA A;  1X3W B;  4LD5 A;  2VOP A;  1BN5 A;  4XOR A;  2MH9 A;  4PJJ A;  1DPU A;  3BQY A;  3HOV J;  3R6S A;  1SFU A;  3DU5 A;  4AVP A;  2IRF G;  2DLL A;  5JFR A;  3FIS A;  2NVX J;  4ENM A;  3IRQ A;  4A0X A;  2LOO A;  1KU7 A;  3PFI A;  2FBI A;  3M8E A;  4XIC A;  2Y9Z A;  5HOD A;  2ZXW H;  1T95 A;  4CCJ A;  1OCO H;  1EKE A;  2DK5 A;  1IRG A;  3JTG A;  3ABU A;  3MZ8 A;  1FMV A;  3EUA A;  4GFB A;  1ULY A;  1LVK A;  2WY8 Q;  2MLG A;  3U1K A;  3OYL A;  3GZN B;  4BY7 J;  1VQL I;  3LA2 A;  3AAF A;  3KYL A;  3JAM Z;  4I98 B;  3F3X A;  2TCT A;  3HUG A;  3M7G A;  2JMW A;  5LRS A;  5E3N A;  3S8P A;  2HKX A;  3VDX A;  1UHM A;  1FY7 A;  2E5N A;  2CFX A;  3BR0 A;  3ZQC A;  2E2J J;  2O9L A;  2A61 A;  2HOS A;  3MMY B;  4ZTF A;  5GTI C;  3HOX J;  1R5H A;  2VC0 A;  1SAU A;  3FKJ A;  4XLC A;  5DM6 F;  2L2O A;  2VJJ A;  2XGC A;  2DMT A;  5L3G A;  1SMT A;  3K70 C;  2BZT A;  2KIM A;  1V54 H;  2DJN A;  2RV8 A;  2MA3 A;  1YIJ I;  3SFI A;  4F3Q A;  1XDU A;  1RPW A;  1W36 C;  3K69 A;  5D5W B;  4RS8 A;  2PLY A;  1MW7 A;  2RRE A;  2VKH A;  1FX7 A;  1APL C;  2K3P A;  2VAS A;  1G3W A;  5TGT A;  1KQ9 A;  2IPQ X;  3CP8 A;  2R7F A;  4BQO A;  1HBX G;  1YX5 A;  4S0H B;  1BI0 A;  1R4M B;  2X4H A;  2GA1 A;  3KEQ A;  2GIZ A;  3H9J A;  2E7X A;  2WA0 A;  3BJ6 A;  2KKO A;  4B4C A;  3HUG B;  4BU2 A;  2PJR A;  2DA5 A;  1N77 A;  3LOC A;  2Z1D A;  3IWZ A;  1J2X A;  3OIQ A;  3D0S A;  3KZZ A;  2NVU B;  5KAF C;  2JTV A;  3FXQ A;  1F4K A;  1TW3 A;  4KNY A;  3V7R A;  1J09 A;  1A6I A;  2M8G X;  3BZ6 A;  2C6Y A;  1V5G A;  4BY1 J;  4LJZ F;  4IVN A;  2XAH A;  4N0B A;  3BWG A;  5J4Y A;  5B66 C;  1WJ5 A;  3TQN A;  4EMS A;  5IP9 J;  1NTC A;  1Z05 A;  3JRH A;  1OYI A;  4C2U A;  2QKL B;  3LSG A;  2HKO A;  2YUS A;  2VOD A;  4LOC A;  4ZDL A;  4S05 A;  1FSE A;  5F0C A;  3OV8 A;  4C30 A;  3BZC A;  1OMI A;  2BHY A;  5DUK A;  4UUS A;  2W1O A;  1JT6 A;  2KZG A;  2PJR B;  4UUV A;  3BG7 A;  4HNV A;  2O8X A;  5B1B H;  2VL8 A;  1EH8 A;  4OIO F;  3GTK J;  2DAO A;  2EJR A;  2FX0 A;  4FE7 A;  3T1B A;  2LP0 A;  3KEO A;  3TW6 A;  4UVB A;  3KPH A;  1HW2 A;  2ME0 A;  1WJC A;  1OCP A;  1VQ8 I;  2L4A A;  4O3M A;  2CW8 A;  1VQ7 I;  4BJ5 C;  2Y2Z A;  2E34 A;  4Q48 A;  1XGS A;  1I27 A;  5GAD J;  4AUX A;  2LY1 A;  4AIH A;  3GLX A;  3L2U A;  4G6D A;  4A6E A;  3I53 A;  3UR3 C;  3PIP F;  1Y8Q B;  2R7X A;  1BJZ A;  2Y0M A;  2M87 A;  1JI8 A;  1XD7 A;  2BVL A;  4RGX A;  3G73 A;  3OYD A;  5DEQ A;  2MC4 A;  3SZP A;  3CCL I;  1IV6 A;  1KYW A;  2PMU A;  4UUS B;  3H9G A;  2LBF A;  1TC3 C;  2IS2 A;  2Z33 A;  1GHC A;  2QQ9 A;  4CUG A;  3K10 A;  4UVC A;  3VPR A;  2XIG A;  1HLV A;  3FKI J;  3FXK A;  2LYC A;  4P9U A;  3T0Y A;  4EJO A;  2VBW A;  3IKT A;  3DP7 A;  5HOO A;  2CRG A;  2FRH A;  3DPT A;  3CJQ B;  2DTZ A;  3CDH A;  2HQR A;  2IGK A;  1TQP A;  2Q8K A;  3HGG A;  3HRT A;  2EH3 A;  3OY9 A;  1AOY A;  1O57 A;  3IHU A;  2YU3 A;  4F52 A;  2ZFW A;  4KT6 A;  2CUJ A;  4D5C A;  2QF7 A;  4XRM A;  4PJN A;  3CF2 A;  3LSJ A;  3B02 A;  3DEE A;  1ERD A;  3W2A A;  1PDN C;  3H92 A;  3DBL B;  2CV1 A;  1YRN B;  3JRF A;  1HKT A;  1XMA A;  4PZJ A;  3HDD A;  4ABZ A;  3HJE A;  3KP3 A;  2RVC A;  1WI9 A;  2IXS A;  2L7F P;  3ML6 A;  4PDK A;  1ZR4 A;  1Z3Y A;  5HDN A;  2EFO A;  3FBN B;  1HDP A;  1WZ2 A;  5FKK A;  1GXP A;  1FIP A;  1GVJ A;  2E1M B;  4QTR A;  2X6X A;  4J00 A;  3PO2 J;  2IGM A;  3ZQI A;  3KP5 A;  1YJW I;  4IX7 A;  1TLH B;  1VQ9 I;  1L0O C;  1ONV A;  3F22 A;  3K4N A;  3CMM A;  2M2E A;  3GW2 A;  3FDY A;  5A2Q K;  5D5U B;  2CUF A;  3BG6 A;  4HSR A;  4M3E A;  2P6S A;  2XF6 A;  3RKW A;  5KCM A;  4CCO A;  3HRU A;  1V5E A;  2ZXH A;  1D0Z A;  4RGS A;  3SFZ A;  2X9D A;  5LLQ A;  3I59 A;  1JGG A;  1S6L A;  1RUN A;  3CCU I;  4I2O A;  2AXL A;  3JRB A;  3S32 A;  2COB A;  2KRC A;  4JX5 A;  4IQ4 A;  2K4J A;  2HOA A;  1X1A A;  2VLA A;  1TWC J;  1BR2 A;  2OU2 A;  4U87 A;  2M4G A;  4W1U A;  4HF1 A;  3OYK A;  1B9M A;  1XB4 A;  4WCG A;  4M9Z A;  2XF5 A;  3W2V A;  3ABL H;  2XGE A;  4XSZ F;  3BC8 A;  3GVA A;  1N25 A;  2CV2 A;  3K7A J;  5DCF A;  2GA2 A;  3A4C A;  2KL4 A;  4BHC A;  1YW8 A;  2A05 A;  4WX9 A;  1HC8 A;  2RC4 A;  1VI0 A;  4FHT A;  2ACJ A;  4KIC A;  1DPR A;  3S1Q J;  3V42 A;  4RAG A;  5GPC A;  3M4O J;  4XKV A;  1RR8 C;  4Y33 A;  1YHQ I;  3IV5 A;  3IL2 A;  4HAM A;  1OLT A;  3KX2 A;  3LWF A;  4A3D J;  1D0X A;  5DS9 A;  5D4S A;  3JR9 A;  2Z2S B;  3ABM H;  1W0U A;  1JKR C;  1FNN A;  2CQK A;  3FXM A;  4EJU A;  1WH5 A;  5J40 A;  4QWQ A;  3HOW J;  3KEY A;  3FX3 A;  3I59 B;  4CH7 A;  1OCZ H;  4CZC A;  2ZJQ F;  1S5L C;  2TRT A;  5EEA A;  1DU6 A;  1SVL A;  3KLN A;  1FIA A;  4E7S A;  3P9I A;  4A3B J;  1Y56 A;  2LY9 A;  5ICC A;  3GX4 X;  1R23 A;  2O61 A;  2YSR A;  2QSF X;  3JW4 A;  2NVQ J;  3DV8 A;  3CF5 F;  2HQA A;  4XK4 A;  5AIP A;  1FYM A;  3WU1 B;  1V5F A;  3GFI A;  2V1D A;  1UB9 A;  4MIM A;  4BXU A;  1VQK I;  3ZQH A;  1BJA A;  2X1C A;  1I1S A;  3CC4 I;  5E3M A;  3ZQ7 A;  1ZEL A;  5FKN A;  2HXI A;  2COM A;  5HDG A;  2UZK A;  2W7N A;  3PM1 A;  3PFY A;  3CO6 C;  2GXB A;  2VBX A;  4IRG A;  4IZZ A;  3F72 A;  2XKO A;  4U0V A;  4J19 A;  1IG7 A;  3ONQ A;  2NNY A;  2WBM A;  4GYG A;  2Z99 A;  3EPZ A;  1X3U A;  4RM2 A;  4QIW N;  2CW0 F;  4HG2 A;  3F8B A;  2K9Q A;  4CCL A;  3CCM I;  2L7M P;  1XTA A;  4D1Q A;  5FLX Z;  3ERE D;  3IAM 2;  1R71 A;  4AD9 A;  1M1E B;  5CVI A;  1ON1 A;  3ASO H;  1Z6T A;  2KT0 A;  5LEJ A;  5KHD A;  2EBI A;  3AG1 H;  1SFO J;  3SEZ A;  3L2Q A;  5D5V B;  3BY6 A;  1RIO H;  2M8E A;  3HM5 A;  1EF4 A;  3MKY B;  1DUX C;  3F0C A;  1LNW A;  2OTJ I;  1PUF A;  3BQZ A;  2DMU A;  2Z3Y A;  3RPU A;  1T38 A;  2B7E A;  2ISZ A;  3DLL F;  1XPX A;  2HYG D;  1PUE E;  4KMF A;  2JT1 A;  5EJC A;  5K7F A;  3OYA A;  1OFC X;  1WCM J;  2L54 A;  2Q1Z B;  3SHF A;  1PVE A;  1P2F A;  2JWT A;  3HL2 A;  1LEA A;  2E60 A;  3C2B A;  4O5V A;  3HSE A;  1K4S A;  2NVT J;  4CZZ A;  1W7P A;  4A6D A;  4CDG A;  4HOB A;  1N78 A;  4HLY A;  3BR6 A;  4G94 A;  3BRO A;  2DA1 A;  1SFE A;  2H1L A;  3ZRG A;  2L9N A;  3GF2 A;  4U88 A;  2CO5 A;  4HA8 A;  4FIS A;  2DA6 A;  4HDV A;  3ERM A;  3EYY A;  2CJJ A;  2E35 A;  1XSV A;  2P5L C;  4LLG F;  2H8R A;  1LKX A;  1SVM A;  5CVR A;  4ZDO A;  4ENJ A;  2XDV A;  3QU6 A;  4DBQ A;  1OCR H;  1P4W A;  4MQV A;  3E6M A;  3RQI A;  2VPR A;  2ZME B;  1GV2 A;  2OV7 A;  3F8M A;  4UXN A;  5K5R A;  1EH7 A;  1BOA A;  4ESF A;  4ZYH A;  1XCV A;  1R22 A;  5F0F A;  1U8B A;  2CQN A;  2HGC A;  2J5O A;  1T0F C;  2PBI A;  2IEK A;  2WTE A;  1XGM A;  3DPL C;  1XCB A;  3CO7 C;  3TL4 X;  1R58 A;  4RBO A;  3DKW A;  1S8N A;  3QP5 A;  1YX3 A;  2K27 A;  3GTL J;  2A5Y B;  1ZN2 A;  3SZT A;  4EM1 A;  2E1C A;  3ZQL A;  1BIA A;  2DMP A;  3HG9 A;  3WTW C;  3AL0 B;  1QU3 A;  3RPU D;  3SDG A;  3IC7 A;  4H0E A;  4HST A;  2MYS A;  3ZQG A;  3S1R J;  4A0Z A;  5EGO B;  2OAZ A;  3F23 A;  4X6A J;  3OL4 A;  3SEQ A;  3SZG A;  3IWF A;  4E7I A;  5FFX A;  1U2W A;  4ASN A;  1JT0 A;  1USS A;  3VFZ A;  1KGS A;  5K7Z A;  1MMA A;  3CZ6 A;  3DEU A;  3QPL A;  1W7P D;  3CCS I;  4V2F A;  3VOE A;  2HVR A;  3L1P A;  2VBZ A;  1VQN I;  1G2H A;  2PQ8 A;  3H3V K;  2KIU A;  3QRF F;  2VPL A;  2KIQ A;  2KIS A;  5H6R A;  3BZK A;  3GXO A;  4PSX A;  2ZFU A;  1CF7 A;  4AVZ A;  2VT2 A;  5FO5 A;  3W2W A;  2I10 A;  2O5R A;  2L4M A;  3OYJ A;  1S3J A;  4DZP A;  4HV5 A;  4B3X A;  4LIV A;  1ZG1 A;  1Y8R B;  5LEK A;  4LB6 B;  5LD2 C;  4EJT A;  4I02 A;  1WQ2 A;  1RNL A;  4AIK A;  1BM9 A;  3P7N A;  1YJN I;  3P9K A;  4KMU X;  4ZH4 F;  3L2C A;  2JK3 A;  4HF0 A;  5EZH A;  3J7Z I;  1KQ8 A;  1RES A;  3EQL F;  1NG6 A;  2KRH A;  2IAI A;  2LF8 A;  3CTA A;  3H5A A;  1MDM A;  3EET A;  2K7L A;  5K7H A;  4I6Z A;  2OZ6 A;  2HDW A;  3TBI A;  2QQA A;  1UJ8 A;  2YS9 A;  2HZD A;  2JRM A;  3I0T A;  1OKR A;  1O3T A;  1MSE C;  3I4M J;  3IAS 2;  2NAZ A;  4BE1 A;  3S17 J;  2EQR A;  3GFM A;  2IJL A;  2KQR A;  2ZB9 A;  3R0A A;  3SYT A;  3CCV I;  3LSM A;  4WXH A;  1W5S A;  3FIW A;  4LIT A;  1Z7L A;  2BVM A;  2VT3 A;  1I1G A;  4MLO A;  5A2Q Z;  3KIO A;  4A3K J;  3BP8 A;  3NAU A;  2FNA A;  1Z21 A;  1J59 A;  1CF7 B;  5E3O A;  1IJW C;  4M9S A;  3HYI A;  2CQX A;  4L5E A;  2XAS A;  1Y39 A;  3MWM A;  5J8C A;  1T2K A;  2R7R A;  4E70 A;  1SAX A;  5E1X A;  4PFO A;  2WB1 N;  3F6O A;  4A93 J;  4BJ6 C;  2QLZ A;  2P7C B;  1MBJ A;  3WU0 A;  5B3S H;  2JPC A;  2MBF A;  4XN0 A;  3DFG A;  2MSY A;  1MDM B;  2XAQ A;  1R36 A;  3LSR A;  4BE2 A;  5LFA A;  5GP9 A;  4AID A;  1P7J A;  2R7W A;  1LVA A;  2AQE A;  4GYI A;  2RQP A;  2JA6 J;  2VBY A;  3CDI A;  3WTZ A;  2ECC A;  1MH3 A;  5EZG A;  4IHV A;  5IP6 A;  1UFM A;  3TED A;  2VE8 A;  2F48 A;  2AO9 A;  3WU2 C;  1YOV B;  1W5T A;  3ZMZ A;  1JJ8 C;  1QHH D;  4C9Y A;  3PNY A;  1XDS A;  3RKX A;  2XRN A;  4XL9 A;  4M3B A;  1IW7 F;  1JTX A;  2DOF A;  5DTD A;  3F8F A;  4XRF A;  5FLV A;  2BYV E;  3RKQ A;  3Q9V A;  3TGN A;  1K78 A;  2QGU A;  2AHQ A;  2L9V A;  1Q1V A;  1I6X A;  2E1N A;  2BY2 A;  2M7B A;  4CCM A;  4F92 B;  3CES A;  2K02 A;  3QOE A;  3I5U A;  4IF4 A;  1R1V A;  2WV1 A;  4DGW B;  2BW3 A;  1Z67 A;  3W6K B;  2DBB A;  1QPM A;  2BY0 A;  3QPS A;  3S3M A;  1XG1 A;  3OR2 C;  3E6C C;  3V4G A;  1MMS A;  5HS8 A;  4FX4 A;  5CQE A;  1F43 A;  3AG3 H;  1BR4 A;  4YEJ A;  1IRZ A;  1HOM A;  1LFB A;  3JSO A;  1P7I A;  2DDB A;  4RB0 A;  3R60 A;  1D3Y A;  1RRJ A;  1ZGW A;  1IRX A;  5C44 J;  4V19 K;  1IDY A;  1RET A;  2ZO4 A;  2LR8 A;  2Z5U A;  4M6Y A;  5M5X J;  2RKH A;  3ZCO A;  1FC3 A;  4EAT A;  1J75 A;  3E6D A;  3K1M A;  3M1C A;  2L0K A;  1D1B A;  3P9C A;  3V8J A;  1T39 A;  3CC2 I;  4OMY A;  1R1U A;  2N8G A;  3O8H A;  2EIK H;  4R1H A;  4G12 A;  2EZI A;  1F5T A;  4DW6 A;  2R7S A;  1Y0N A;  3KZY A;  1V4R A;  3HXL A;  2QKM B;  2XVC A;  3O2P E;  1E17 A;  1MJB A;  4E6K G;  4I0B A;  1K78 B;  3UNG C;  4A2U A;  3TP0 A;  2E71 A;  5F08 A;  5ILS A;  3WE3 A;  1BIB A;  3CMA I;  1R6R A;  4NNJ A;  3BR3 A;  2BW3 B;  4EGY A;  2I5U A;  4G6T B;  3DKX A;  4EM0 B;  4B1R A;  1DGR M;  1MKM A;  1VQ6 I;  3N4M A;  2JVG A;  4HNT A;  4ZYD A;  2P7V B;  3MAJ A;  4RGR A;  1FPQ A;  5LRR A;  2MD5 A;  5JVT A;  4UV8 A;  1Y1V J;  5FLX K;  2JVH A;  3IP4 B;  1P6R A;  4M3F A;  2IS1 A;  2VI6 A;  4LB5 A;  4A0Y A;  2XAF A;  4HF2 A;  3F8C A;  2PI0 A;  1SD5 A;  1QQI A;  2M4K A;  1ETO A;  4B8X A;  2WAF A;  4HBL A;  1GXQ A;  3ECH A;  4ZZD A;  3CUQ B;  2BXZ A;  2M45 A;  4CCK A;  3PSI A;  4NC8 A;  4DOZ A;  4E7K A;  5L3F A;  3TKY A;  3GWZ A;  3K6G A;  4JK1 X;  4NQW A;  2QQ8 A;  5JVG F;  2DN0 A;  2JJ7 A;  3LAJ A;  3G2B A;  4G6Q A;  2LLK A;  4HNU A;  1FJL A;  1SAN A;  2DCE A;  1WWX A;  4KA4 A;  3PQK A;  2KRF A;  5EEG A;  1MZB A;  2DYS H;  4LK1 F;  2CQ7 A;  2LMD A;  4D5F A;  2HQ5 A;  3BDD A;  3QYF A;  2IS4 A;  2XAU A;  4BHP A;  2W25 A;  2UV1 A;  2EIJ H;  3HEF A;  2ISY A;  3QAH A;  3GTJ J;  3FBI B;  3G6E I;  1T33 A;  3F6V A;  1RUO A;  3FXO A;  4JYK A;  3ZQF A;  3OYB A;  1UHW A;  4Z6Y A;  5L3D A;  2DA2 A;  1EV7 A;  1MJA A;  5E79 C;  1RKW A;  3RIR A;  1JUP A;  3WGI A;  1NH3 A;  1X1D A;  5HLI A;  2MC3 A;  1IN8 A;  2DOA A;  2VKE A;  1YW9 A;  2XKP A;  4XKW A;  1NHA A;  2QQB A;  1XGO A;  3DTK A;  2FOK A;  1S9H A;  2A5W A;  4F55 A;  5F1J A;  5IY5 H;  1AKH A;  5IPA A;  1D5Y A;  4DZJ A;  3H1C A;  3H3Z A;  4NQW B;  5L3B A;  4LGW A;  2JPB A;  5IYB J;  3WTU C;  1J7K A;  1A5J A;  1FOX A;  4BL0 B;  4MQ9 F;  4RM3 A;  2M3A A;  1ETQ A;  2HVQ A;  4CGZ A;  3L09 A;  1GV5 A;  2R7D A;  4Y17 A;  2UXN A;  1B72 B;  4K2E A;  3JRG A;  3EUH A;  1IXS B;  3GO5 A;  3RJP A;  1NG7 A;  4IOC F;  3N05 A;  2ESN A;  2V9P A;  4CA0 A;  1HA8 A;  1Z3X A;  2PFB A;  4P96 A;  5L3E A;  2VOO A;  3IUO A;  1YRN A;  2W57 A;  3TOA A;  3FXJ A;  1KU2 A;  1R4N B;  2DK8 A;  4ZDP A;  1I5Z A;  4XLH A;  5BS6 A;  2ELJ A;  2V1N A;  4B47 A;  1FLI A;  1LPQ A;  4OMZ A;  1ZKG A;  2XC7 A;  2WB1 A;  4RB3 C;  3QQA A;  2IT0 A;  4DQ2 A;  3CCQ I;  1WJA A;  2K9S A;  1AKH B;  2CV0 A;  1MSF C;  2EB7 A;  3IKV A;  1HF0 A;  1ZAR A;  3PSF A;  3TMO A;  1G3S A;  4UY8 I;  1TNS A;  1MNE A;  3MEX A;  1FOW A;  2K9L A;  5CVU A;  2P5V A;  3B6C A;  5EG0 B;  2IVM A;  2VJ4 A;  4U7B A;  4HPQ A;  2Y0S N;  3ZGK A;  3K4J A;  4YII A;  3K1P A;  1U5T B;  4OU0 A;  2VJI A;  3WTS C;  2A69 F;  5LGT A;  1G6N A;  3MZY A;  3SQN A;  3I3L A;  5LBQ A;  1RC9 A;  3REO A;  3J7A O;  2EFN A;  1D8J A;  4UUT A;  3I71 A;  2Q0O A;  2D45 A;  4OAZ A;  1FOK A;  3M8J A;  1TW2 A;  3KLO A;  2MH2 A;  4BQN A;  2QSH X;  2BE5 F;  2DQR A;  2FXA A;  3QP6 A;  2ZJR F;  2VQH A;  3D5S C; 
#chains in the Genus database with same CATH homology
 5D8L B;  3MFK A;  1KU9 A;  4MGR A;  2QVO A;  2O6G E;  2BGC A;  3Q5F A;  5CVV A;  1KA8 A;  5HS9 A;  1U6G A;  1R5G A;  2OZU A;  1O7L A;  4OIP F;  2OQR A;  2EWN A;  2FQ3 A;  3J81 Z;  4NHJ A;  1T98 A;  2A07 F;  4KFC A;  1O3R A;  1KU3 A;  3DQV C;  3LQQ A;  3C1D A;  4HDU A;  2PN6 A;  2EFP A;  1P92 A;  3GYH X;  2OD5 A;  4A5N A;  2YR2 A;  3VEP A;  2HR3 A;  5E8I A;  1XMK A;  3GEZ A;  1JHF A;  4L9V A;  4M71 A;  5K5Q A;  1JHH A;  1IN4 A;  2FU4 A;  2VC1 A;  4L9T A;  4I7H A;  2W85 A;  4FT8 A;  5ICE A;  3BPX A;  3J80 K;  5DD4 A;  1L3L A;  1Z91 A;  3FM5 A;  3HSR A;  4IXA A;  5CLS A;  3WGG A;  1JE8 A;  2B0L A;  2H6C A;  3U9G A;  3EDP A;  2PMH A;  2M5W A;  3HSF A;  5ILV A;  4ZZL A;  2O3F A;  3TOB A;  2E7W A;  3NRV A;  5HLG A;  1IXC A;  5E1W A;  1R1T A;  5IT9 Z;  1IZ1 A;  2MLK A;  3FMS A;  1O7F A;  1IN6 A;  2WV0 A;  3R0J A;  2W24 A;  4U7D A;  1KQ0 A;  4KUM A;  2D2W A;  2L02 A;  3RPQ A;  3QPT A;  2HZT A;  4L5J A;  2CYY A;  3U2R A;  1WSU A;  2A68 F;  4NB5 A;  3RKY A;  2BBY A;  2M1B A;  2ZNY A;  2F5D A;  5IT3 A;  4KDP A;  5TJJ A;  2VE9 A;  1MGT A;  4EGZ A;  3KET A;  1YS7 A;  3W6J B;  2K4B A;  2GAU A;  3LQR A;  3T5X A;  2ZME A;  2O03 A;  5HS7 A;  2P8T A;  4IRI A;  3O6B B;  1R00 A;  4DNC A;  2FBK A;  4U0Y A;  2G7U A;  4L9N A;  2PEX A;  3RI4 A;  4Q47 A;  3TDU C;  1YS6 A;  1QZY A;  3E5Q A;  2EV0 A;  4HQE A;  4AWX B;  1BI3 A;  5FB2 A;  2QM3 A;  4EVI A;  2DPU A;  3VB2 A;  1VTN C;  2P6T A;  4QLC U;  4LLN A;  3C3W A;  1G4D A;  1K79 A;  4HV6 A;  1MJ9 A;  1XSX A;  2LDU A;  2EV5 A;  5FD6 A;  1PP8 F;  3ELK A;  1ZRD A;  4M74 A;  4P9F A;  3KP6 A;  1LDJ A;  2HTJ A;  1BC8 C;  4L5I A;  4G8X A;  5KVR A;  2F5C A;  2YX4 A;  3ABT A;  1G3Y A;  1E2X A;  2RNJ A;  3L9F A;  3M1E A;  4CYD A;  1U3E M;  2D1V A;  3IRR A;  3I64 A;  2FSW A;  2HYF A;  3V7C A;  1B6A A;  2H94 A;  4YIF A;  3GZ5 A;  2G7H A;  3NQO A;  1FP2 A;  4R8H A;  3RYP A;  1OPC A;  3HTS B;  2XGX A;  5JI6 A;  3HTU A;  1HXD A;  2VON A;  4EQQ A;  3K9T A;  4YG2 F;  5D6F A;  2CSO A;  2YX7 A;  4GGG A;  3RDI A;  1BI2 A;  5ICF A;  4MTD A;  4BNC A;  1Z6R A;  3R61 A;  4F7Z A;  4I01 A;  3ZN1 A;  5HLH A;  1A04 A;  3QPH A;  2A6E F;  5E18 F;  2TDX A;  1TNT A;  1YIO A;  3COA C;  4HLX A;  2KJC A;  4OIQ F;  3N97 A;  5FFZ A;  1UST A;  2A6H F;  2FML A;  3K2Z A;  3Q9S A;  1STZ A;  2EA4 A;  3KFW X;  4KIF A;  3CLO A;  3TDZ C;  3CUO A;  4WXD A;  1REP C;  3ZP5 A;  2FA5 A;  4LMY A;  1ZGJ A;  4ZYE A;  4PGH A;  3I54 A;  5ICG A;  1HW5 A;  2ELH A;  2DO7 A;  2IP2 A;  4YFK F;  4HQM A;  4RB2 C;  3MZH A;  4N9I A;  1H0M A;  2CGP A;  4G7Z F;  4CHU A;  4KN7 X;  5LHG A;  3H3U A;  5DCM B;  2RDP A;  2STW A;  5KK1 A;  2L3D A;  3HHH A;  2KJB A;  4U0W A;  4CIC A;  2IA0 A;  2OA4 A;  1IXR C;  1YW7 A;  3J81 K;  2HWV A;  3FM3 A;  1XSD A;  4HZF A;  5E17 F;  4MHG A;  1DP7 P;  3J80 Z;  2VXZ A;  4OIR F;  3ZMD A;  2K86 A;  2HDC A;  4Y13 A;  4RGU A;  4XBF A;  4RB1 A;  2HEO A;  1ZH5 A;  3TO9 A;  1WRJ A;  2VN2 A;  5BOX A;  3QOP A;  1ZAO A;  2WC2 A;  3M8F A;  1H9T A;  1LJ9 A;  2QWW A;  2PG4 A;  5D8K B;  4HW0 A;  2GWR A;  5D5X B;  3ZPL A;  3LST A;  1T0F A;  4OIN F;  4BHB A;  5IT9 K;  3HHG A;  2IW5 A;  2ZNZ A;  1FYK A;  1B9N A;  3MCZ A;  4LG0 A;  3E97 A;  2XUB A;  4AIJ A;  3CUQ A;  4B09 A;  1J9I A;  3FWE A;  4MEY F;  1SD7 A;  1FBU A;  1P4X A;  4GO1 A;  1RI7 A;  2LKP A;  4KYW A;  3GFJ A;  5JHU A;  1BI1 A;  1TQM A;  3WTV C;  2DI3 A;  1DDN A;  2RN7 A;  2V79 A;  5DYM A;  3K1N A;  4P55 A;  1V3F A;  1BBY A;  5JR3 A;  2M30 A;  1P4A A;  2FEZ A;  2L01 A;  2LNB A;  5EEH A;  2LSO A;  1H9G A;  1CGP A;  1SD4 A;  3WTX C;  4LG0 B;  3LA7 A;  5E20 A;  2ZCW A;  2Q2E A;  5D6E A;  1ZG5 A;  2GZW A;  2HS5 A;  2ZJ2 A;  3ROU A;  5D4R A;  2QYO A;  4XSX F;  2A3S A;  3FMQ A;  1G3T A;  2XHK A;  1HKQ A;  1ZHF A;  3FF5 A;  1FP1 D;  3V8K A;  3HRS A;  2LF7 A;  2F5E A;  2H09 A;  4L0Z B;  2EFQ A;  3KCC A;  4EJW A;  2QZ8 A;  5F6F A;  1FT9 A;  3ECO A;  1TTY A;  5J8F A;  4Q4Z F;  3T8R A;  1ON2 A;  4P5O A;  3WGH A;  2G9W A;  1IAW A;  3E5U A;  3FHZ A;  5DD8 A;  2QUF A;  4G9Y A;  2UXX A;  3OOP A;  1ZLK A;  2XAG A;  2GQQ A;  3KP2 A;  5TRD A;  1U5T A;  2P5K A;  3LA3 A;  4RAZ A;  3BJO A;  2IA1 A;  4L9J A;  1OR7 A;  1U8R A;  2Y75 A;  1FSH A;  5BMZ A;  1T6S A;  1YQA A;  1UCR A;  4UVA A;  4L0Y B;  3GUD A;  1FYL A;  4M6X A;  1OYY A;  1U78 A;  1JXS A;  2O0Y A;  4R79 A;  1IF1 A;  3LFK A;  3B73 A;  3FXU A;  4LLL A;  4RAY A;  3K0L A;  2V1X A;  2EFW A;  5FGM A;  4A12 A;  1B59 A;  1YO5 C;  5BPD A;  2W84 A;  1ODD A;  1O3S A;  2KIF A;  5AIQ A;  2JSC A;  3ZMT A;  1ZRC A;  1ZRE A;  1SD6 A;  1IN7 A;  2JZY A;  4D0P A;  3WTT C;  3LAP A;  2ZXJ A;  2XAJ A;  1QO0 D;  5CYV A;  3KP7 A;  5F1R A;  1ZRF A;  2IA2 A;  3HOS A;  5LHI A;  3GFL A;  2GXG A;  2ZKZ A;  1FBS A;  4EJV A;  3R4K A;  2FF4 A;  4I09 A;  4IRH A;  4M9X A;  4EM2 A;  2QBY A;  1KYZ A;  4G7O F;  5H6Q A;  3ZMU A;  1RZ4 A;  2NNN A;  3HOT A;  1B1B A;  1B4A A;  2OQG A;  3ZN0 A;  4TV7 A;  2STT A;  1XGN A;  2UWM A;  4CXF A;  1LDK B;  2EK5 A;  3O3K A;  4HYE A;  3GZ6 A;  1YTY A;  2F5F A;  1BC7 C;  1LB2 A;  1IUY A;  3KE2 A;  2HOE A;  1J0R A;  3JSP A;  5L3C A;  2FMY A;  2Z9O A;  5DUI A;  4UV9 A;  3RTR A;  2H6B A;  1Y0U A;  1EH6 A;  5FD5 A;  3BJA A;  5AON A;  4IJA A;  1F9N A;  3G3Z A;  3CJN A;  4BH9 A;  3F21 A;  1HST A;  3VOD A;  2JRT A;  1YYV A;  3WG9 A;  4YFX F;  2QBY B;  4JBA A;  2EA2 A;  2BV6 A;  5LGN A;  3D5L A;  4BAY A;  4XLP F;  1Q1H A;  1YLF A;  1XN7 A;  5BPI A;  1ZG3 A;  1J5Y A;  2DT5 A;  5J6X A;  5F64 A;  1QBJ A;  4ESJ A;  4MEX F;  4WF2 A;  4LFU A;  1ZLJ A;  4L18 B;  3EYI A;  2NYX A;  1OYW A;  3RYR A;  1K6O A;  2NRA C;  4IHS A;  1JGS A;  4ETS A;  1W4M A;  5DV5 A;  4UNO A;  1QNT A;  3JAM K;  4WK8 F;  2DPD A;  3L7W A;  5LHH A;  4M72 A;  1D5V A;  2DW4 A;  1FBQ A;  1AWC A;  2FBH A;  4ZYG A;  2P4W A;  4LK0 F;  2ZBK A;  4ESB A;  2X0L A;  4Y15 A;  4MTE A;  5K1Y A;  1SFX A;  1YG2 A;  2ESH A;  1MD0 A;  3JTH A;  3C18 A;  4XLN F;  3ULQ B;  2R3S A;  3BOQ A;  3SXY A;  1S29 A;  5CVJ A;  2DTR A;  1D8K A;  5E1Z B;  1QGP A;  2PJP A;  2XRO A;  1QZZ A;  2WWY A;  2V1U A;  4Q5S F;  3T8T A;  1IRF A;  1WKM A;  4PCQ A;  4KIG A;  2EV6 A;  4GCV A;  1HW1 A;  5DDG A;  3F8N A;  1HSJ A;  4BYY A;  5ERI A;  3V7S A;  3E3V A;  4ENK A;  2YPR A;  3TO7 A;  1C0W A;  2CWE A;  3L00 A;  1LDD A;  2XV4 S;  2HTS A;  2GIV A;  1O3Q A;  1W7P B;  1HQC A;  2DQL A;  3PQJ A;  1S7A A;  2BEO A;  3CUQ C;  3FZV A;  3WTY C;  5CJ9 A;  4WXC A;  3WOD F;  3M9A A;  1FZP B;  3WE2 A;  2F2E A;  4O6J A;  4JQF A;  2D1H A;  1K7A A;  4MNU A;  5LGU A;  4KT5 C;  2CG4 A;  5DCM A;  1LQ1 A;  3BPV A;  1IN5 A;  6PAX A;  4FX0 A;  1FWZ A;  4A5M A;  4N9H A;  1TBX A;  4EV0 A;  3C7J A;  3FMR A;  3S2W A;  5HVQ C;  3U1D A;  4WWC A;  4HX7 A;  3ZMS A;  5HDK A;  5ED4 A;  3I58 A;  1SMY F;  1ZYR F;  2HFH A;  2J5P A;  1LEB A;  4S04 A;  3V8L A;  3TO6 A;  1ZGA A;  3I4P A;  1Z7U A;  4KN4 X;  4M73 A;  3NEU A;  2AS5 F;  5K5O A;  3KP4 A;  3ISP A;  4ENN A;  2V6C A;  4IHT A;  2QEN A;  4G7H F;  3QU3 A;  4PGG A;  2RGV A;  4IPA A;  1F1Z A;  3E5X A;  2V9V A;  2Y48 A;  1YFH A;  2OBP A;  1TQI A;  3E6B A;  5BQT A;  4HX8 A;  1R7J A;  2DFI A;  1S7O A;  4CO8 A;  2ETH A;  4HX4 A;  5E8G A;  2ADU A;  2FNP A;  2HQN A;  4YFN F;  4BQA A;  3HIF A;  3DXJ F;  3FXR A;  1U5T C;  3DF8 A;  4Z2Y A;  3MQ0 A;  2DU9 A;  4GXO A;  2FE3 A;  1PP7 U;  5H20 A;  4UHT A;  3ZMV A;  1Z1D A;  1Z9C A;  4I0A A;  5ILU A;  2H27 A;  3HRM A;  4OOI A;  2NS0 A;  4KIB A;  1HKS A;  4ON0 A;  2VOP A;  4LD5 A;  1BN5 A;  2MH9 A;  1DPU A;  3R6S A;  1SFU A;  4AVP A;  2IRF G;  2DLL A;  5JFR A;  4ENM A;  3IRQ A;  4A0X A;  1KU7 A;  3PFI A;  2FBI A;  3M8E A;  2DK5 A;  1IRG A;  3JTG A;  3ABU A;  1ULY A;  2MLG A;  3LA2 A;  3AAF A;  3JAM Z;  4I98 B;  3F3X A;  3HUG A;  3M7G A;  5LRS A;  2HKX A;  1UHM A;  1FY7 A;  2CFX A;  2A61 A;  1R5H A;  2VC0 A;  5L3G A;  1SMT A;  2KIM A;  2RV8 A;  2MA3 A;  1XDU A;  3K69 A;  5D5W B;  4RS8 A;  2PLY A;  1FX7 A;  1G3W A;  1KQ9 A;  2IPQ X;  2R7F A;  1HBX G;  1BI0 A;  2X4H A;  2GA1 A;  3KEQ A;  2E7X A;  3BJ6 A;  2KKO A;  3IWZ A;  1J2X A;  3D0S A;  3KZZ A;  2JTV A;  3FXQ A;  1F4K A;  1TW3 A;  4KNY A;  3V7R A;  3BZ6 A;  2C6Y A;  4LJZ F;  4IVN A;  2XAH A;  4N0B A;  3BWG A;  3TQN A;  4EMS A;  1Z05 A;  1OYI A;  2HKO A;  2VOD A;  4S05 A;  1FSE A;  3OV8 A;  1OMI A;  5DUK A;  4UUV A;  2O8X A;  1EH8 A;  4OIO F;  2DAO A;  2EJR A;  3T1B A;  3KEO A;  4UVB A;  1HW2 A;  4O3M A;  2L4A A;  4Q48 A;  1XGS A;  1I27 A;  4AIH A;  3GLX A;  4G6D A;  4A6E A;  3I53 A;  2Y0M A;  2M87 A;  1XD7 A;  4RGX A;  3G73 A;  5DEQ A;  3SZP A;  1KYW A;  2PMU A;  1GHC A;  2Z33 A;  2QQ9 A;  4UVC A;  2XIG A;  4P9U A;  3T0Y A;  4EJO A;  2VBW A;  3IKT A;  3DP7 A;  5HOO A;  2FRH A;  3DPT A;  3CDH A;  2HQR A;  1AOY A;  1TQP A;  2Q8K A;  3HRT A;  1O57 A;  3IHU A;  2YU3 A;  2ZFW A;  3B02 A;  1PDN C;  3H92 A;  1HKT A;  1XMA A;  4PZJ A;  3KP3 A;  2RVC A;  1WI9 A;  4PDK A;  3ML6 A;  5HDN A;  2EFO A;  1GXP A;  1GVJ A;  3KP5 A;  1TLH B;  1L0O C;  1ONV A;  3F22 A;  3GW2 A;  5A2Q K;  5D5U B;  2P6S A;  3RKW A;  3HRU A;  4RGS A;  3SFZ A;  5LLQ A;  3I59 A;  1S6L A;  1RUN A;  4I2O A;  2AXL A;  2K4J A;  2OU2 A;  4HF1 A;  4WCG A;  1B9M A;  1XB4 A;  4M9Z A;  4XSZ F;  3GVA A;  5DCF A;  2GA2 A;  4BHC A;  1YW8 A;  4WX9 A;  2RC4 A;  4FHT A;  2ACJ A;  4KIC A;  1DPR A;  3IL2 A;  4HAM A;  3LWF A;  5D4S A;  1FNN A;  2CQK A;  4EJU A;  4QWQ A;  3FX3 A;  3I59 B;  3KLN A;  3P9I A;  5ICC A;  3GX4 X;  1R23 A;  2O61 A;  2YSR A;  3JW4 A;  3DV8 A;  5AIP A;  1FYM A;  3WU1 B;  3GFI A;  2V1D A;  1UB9 A;  4BXU A;  1BJA A;  1I1S A;  3ZQ7 A;  5HDG A;  2COM A;  2UZK A;  3CO6 C;  2GXB A;  2VBX A;  4IRG A;  3F72 A;  2XKO A;  4U0V A;  2NNY A;  4GYG A;  2Z99 A;  1X3U A;  2CW0 F;  3F8B A;  5FLX Z;  3ERE D;  4AD9 A;  5CVI A;  1ON1 A;  1Z6T A;  5LEJ A;  5D5V B;  3BY6 A;  1RIO H;  2M8E A;  1DUX C;  1LNW A;  2Z3Y A;  3RPU A;  1T38 A;  2ISZ A;  2HYG D;  1PUE E;  4KMF A;  2JT1 A;  3SHF A;  2L54 A;  1P2F A;  1LEA A;  4O5V A;  3HSE A;  4CZZ A;  1W7P A;  4A6D A;  4CDG A;  4HOB A;  4HLY A;  4G94 A;  3BRO A;  1SFE A;  3GF2 A;  4U88 A;  2CO5 A;  4HA8 A;  4HDV A;  3EYY A;  1XSV A;  2P5L C;  4LLG F;  5CVR A;  4ENJ A;  3QU6 A;  1P4W A;  4MQV A;  3E6M A;  2ZME B;  3F8M A;  4UXN A;  5K5R A;  1EH7 A;  1BOA A;  4ESF A;  4ZYH A;  1XCV A;  1R22 A;  2HGC A;  2J5O A;  2PBI A;  2WTE A;  1XGM A;  3DPL C;  1XCB A;  3CO7 C;  1R58 A;  3DKW A;  1S8N A;  3QP5 A;  2K27 A;  2A5Y B;  1ZN2 A;  3SZT A;  4EM1 A;  2E1C A;  1BIA A;  3WTW C;  4H0E A;  3IC7 A;  4A0Z A;  2OAZ A;  3F23 A;  3IWF A;  5FFX A;  1U2W A;  4ASN A;  1USS A;  3VFZ A;  1KGS A;  3DEU A;  1W7P D;  3VOE A;  2VBZ A;  2PQ8 A;  2KIU A;  3QRF F;  5H6R A;  3GXO A;  1CF7 A;  2VT2 A;  5FO5 A;  2L4M A;  1S3J A;  4HV5 A;  1ZG1 A;  5LEK A;  4LB6 B;  4EJT A;  4I02 A;  1WQ2 A;  1RNL A;  4AIK A;  1BM9 A;  3P7N A;  3P9K A;  4KMU X;  4ZH4 F;  3L2C A;  4HF0 A;  1KQ8 A;  3EQL F;  2LF8 A;  3CTA A;  1MDM A;  3EET A;  2K7L A;  2OZ6 A;  2QQA A;  1O3T A;  3I0T A;  1OKR A;  2NAZ A;  3GFM A;  2IJL A;  3R0A A;  4WXH A;  1W5S A;  2VT3 A;  1I1G A;  5A2Q Z;  3BP8 A;  2FNA A;  1J59 A;  1CF7 B;  4M9S A;  3HYI A;  2XAS A;  3MWM A;  5J8C A;  1T2K A;  4E70 A;  1SAX A;  5E1X A;  3F6O A;  2QLZ A;  2P7C B;  3WU0 A;  2JPC A;  2MBF A;  3DFG A;  1MDM B;  2XAQ A;  1R36 A;  1LVA A;  4GYI A;  2RQP A;  2VBY A;  3WTZ A;  1UFM A;  2VE8 A;  1W5T A;  3ZMZ A;  1XDS A;  3RKX A;  2XRN A;  1IW7 F;  3F8F A;  4XRF A;  2BYV E;  3Q9V A;  3TGN A;  1K78 A;  2E1N A;  1I6X A;  2K02 A;  3I5U A;  4IF4 A;  1R1V A;  3W6K B;  2DBB A;  1QPM A;  3E6C C;  3V4G A;  5HS8 A;  4FX4 A;  3JSO A;  4RB0 A;  3R60 A;  1D3Y A;  2ZO4 A;  2Z5U A;  4M6Y A;  1J75 A;  2RKH A;  1FC3 A;  3E6D A;  3K1M A;  1T39 A;  3V8J A;  3P9C A;  4OMY A;  1R1U A;  4R1H A;  1F5T A;  3KZY A;  1V4R A;  2XVC A;  3O2P E;  1E17 A;  1MJB A;  4I0B A;  1K78 B;  4A2U A;  5ILS A;  3WE3 A;  1BIB A;  4EGY A;  4EM0 B;  1MKM A;  3N4M A;  4ZYD A;  2P7V B;  3MAJ A;  4RGR A;  1FPQ A;  5LRR A;  2MD5 A;  5JVT A;  4UV8 A;  5FLX K;  1P6R A;  4LB5 A;  4A0Y A;  2XAF A;  4HF2 A;  3F8C A;  2PI0 A;  1SD5 A;  1QQI A;  4B8X A;  4HBL A;  1GXQ A;  3ECH A;  4ZZD A;  3CUQ B;  2M45 A;  5L3F A;  3TKY A;  3GWZ A;  4JK1 X;  4NQW A;  3LAJ A;  4G6Q A;  1WWX A;  4KA4 A;  3PQK A;  2KRF A;  5EEG A;  1MZB A;  4LK1 F;  3BDD A;  4BHP A;  2W25 A;  3QAH A;  2ISY A;  3F6V A;  1RUO A;  1UHW A;  5L3D A;  1EV7 A;  1MJA A;  3RIR A;  3WGI A;  5HLI A;  2MC3 A;  1IN8 A;  2XKP A;  1YW9 A;  1NHA A;  2QQB A;  1XGO A;  2FOK A;  3H3Z A;  5L3B A;  4LGW A;  2JPB A;  3WTU C;  1J7K A;  4MQ9 F;  4CGZ A;  3L09 A;  4Y17 A;  2R7D A;  2UXN A;  4K2E A;  3EUH A;  1IXS B;  3GO5 A;  3RJP A;  2ESN A;  2PFB A;  4P96 A;  5L3E A;  2VOO A;  2W57 A;  3TOA A;  1KU2 A;  2DK8 A;  1I5Z A;  5BS6 A;  1FLI A;  4OMZ A;  4RB3 C;  2IT0 A;  4DQ2 A;  2EB7 A;  3IKV A;  1ZAR A;  1G3S A;  1TNS A;  3MEX A;  5CVU A;  2P5V A;  2IVM A;  4U7B A;  4YII A;  3K1P A;  1U5T B;  4OU0 A;  3WTS C;  2A69 F;  5LGT A;  1G6N A;  3MZY A;  3SQN A;  5LBQ A;  3J7A O;  3REO A;  1D8J A;  2EFN A;  3I71 A;  2Q0O A;  2D45 A;  1FOK A;  1TW2 A;  3KLO A;  2MH2 A;  2BE5 F;  2DQR A;  2FXA A;  3QP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...