4UNOA

Crystal structure of the ets domain of human etv5 in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 5
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4unoA00
3LA3A 2MLGA 4KIFA 3I0TA 4F7ZA 1HSJA 4RGUA 1XCBA 4ASNA 1OYYA 4B8XA 2W24A 1FYKA 2TDXA 3MEXA 3V7RA 2K4JA 1TNSA 2EJRA 1LB2A 1REPC 5AIPA 3WGGA 3IL2A 5CVRA 1ZN2A 2H6BA 3WTVC 3BWGA 4KN4X 3BY6A 1IN7A 1U5TB 5D6EA 5K5OA 1FC3A 2VN2A 3LWFA 1ZGAA 3COAC 2BGCA 4HF0A 5DEQA 2ZNZA 3GW2A 1HBXG 1EH8A 5J8FA 2HOEA 1W7PB 2ZMEA 1D3YA 2RVCA 1QNTA 3M8EA 3KCCA 1XGNA 4ESFA 3V4GA 1R23A 5KVRA 1ZGJA 3D5LA 4O5VA 3H3ZA 6PAXA 4MGRA 2FNPA 4PGGA 3BZ6A 5FFXA 5TRDA 3I4PA 2JZYA 4UVBA 2HGCA 3IC7A 4UNOA 2PMUA 5LRRA 1LDDA 2E7XA 3HSEA 1A04A 4OMYA 1IXSB 1SFUA 5TJJA 1HW1A 2FEZA 4ENKA 3RPUA 1F5TA 4XSZF 2L4MA 3U9GA 2E1NA 3ABTA 4RAZA 2Q8KA 3ZN0A 2IPQX 3V8LA 4P96A 1BJAA 5F64A 3IRRA 1FLIA 1KU7A 2FQ3A 4ENJA 4Y15A 4CHUA 3CDHA 1FP1D 3WGHA 1QQIA 3OOPA 4CXFA 4EV0A 3ZMSA 4L9VA 4G8XA 2M1BA 1FX7A 3CO7C 5HLHA 1BN5A 1MGTA 3ZPLA 2ZXJA 5L3BA 1P4WA 3WE3A 1FZPB 4HLXA 5F1RA 1TQIA 2J5OA 1OR7A 2ESNA 2YPRA 5E20A 2COMA 3HRSA 4ETSA 2HKOA 3IWZA 3HIFA 5K5RA 4YIIA 4Y13A 3WTXC 2CGPA 1U6GA 3FX3A 4A0XA 5L3FA 2EWNA 2F5EA 4EVIA 2MH9A 2UXXA 1KYWA 3RI4A 3M9AA 3PQKA 3FXQA 1J9IA 1GXQA 1ZRDA 5K5QA 3DV8A 4HV6A 3GLXA 4ZZDA 1YS7A 3BOQA 1S6LA 4XSXF 1R22A 4OIPF 2P5KA 1B1BA 2D2WA 2W84A 4P55A 2B0LA 3HYIA 1U78A 4IRIA 3BPVA 3BJOA 1FSEA 2PQ8A 4ZYHA 1IUYA 2E1CA 3HOTA 1R36A 2K02A 1STZA 2PBIA 4EJWA 2ZBKA 1Z1DA 1ZAOA 3K1MA 5CLSA 2P7VB 2A07F 2VT2A 2FMYA 3RKXA 1YIOA 4OOIA 5FD5A 3I53A 3WGIA 1ULYA 1HQCA 5DCMA 3ZN1A 4TV7A 4D0PA 2QWWA 3I71A 4OMZA 3J7AO 1F4KA 1BM9A 3DEUA 3ECHA 4KYWA 3I5UA 2L01A 2D45A 2CWEA 3C7JA 2IP2A 4IHSA 1PP7U 4EQQA 4BYYA 2JRTA 1BOAA 3N97A 1HKQA 2PN6A 3DXJF 1Z6TA 1P4XA 2W85A 4IJAA 1HW5A 3ZMZA 4HLYA 3ZMDA 3WU0A 4GGGA 1J5YA 3KP3A 3EETA 4EMSA 3QPTA 1JHFA 1P2FA 2RN7A 3FMRA 4HDVA 3KZYA 3GX4X 4ENNA 2J5PA 4AVPA 3P9IA 3K0LA 4HX8A 3TO7A 3HSFA 2VBZA 1ZLKA 2HKXA 2P5VA 4UVAA 2K4BA 1MJBA 3GFIA 2DAOA 2FSWA 2MD5A 4UXNA 3GFJA 3MWMA 3V7CA 3V8JA 2HZTA 1MJ9A 3FM3A 4N9HA 2OA4A 1W7PA 2QENA 2BEOA 3TQNA 4HX7A 1Z7UA 2HWVA 2VBYA 3JSPA 1DPUA 4M9XA 3F72A 4XBFA 4WF2A 4HV5A 3NRVA 1ODDA 2YR2A 3TDZC 1B6AA 5D5WB 1GHCA 2A5YB 3R0JA 4HZFA 4A6EA 1D8JA 2ZNYA 3TOBA 1ZH5A 2XHKA 4ZYDA 4KDPA 4Y17A 4Q47A 2G7UA 2WTEA 1FSHA 2QQ9A 4HF2A 4B09A 3O2PE 2BV6A 3LSTA 3K9TA 3J80Z 1TW3A 4OIOF 3ELKA 3VFZA 1B4AA 1IAWA 1XDSA 4M9SA 2QLZA 5L3EA 1HSTA 1IN4A 2XAQA 2F5FA 4WK8F 3WTUC 2A61A 5HDGA 3CJNA 2DLLA 4BAYA 3BJAA 3KP5A 1OMIA 3R60A 3I58A 3OV8A 3KEQA 2DPUA 5ICEA 3MZYA 4DQ2A 4MQ9F 3T1BA 1USSA 3BROA 5A2QZ 3PQJA 1V4RA 3ROUA 5LGUA 2A3SA 1WSUA 2W25A 1TNTA 4RB2C 2STTA 2DI3A 4ESJA 2IA1A 1USTA 5IT3A 1L0OC 1DUXC 2GXGA 4KA4A 3GFLA 3LQQA 1IN5A 1YTYA 3KP6A 2IA2A 3VB2A 3HTSB 1MDMA 2P5LC 3I64A 3LA2A 3G73A 1KU2A 1ON2A 2Q0OA 5CVUA 2K86A 4L9JA 3GXOA 3WODF 1R7JA 2ISZA 1XSVA 4NB5A 3CUOA 1HKSA 3QU3A 5LBQA 1J0RA 2NNNA 4U0WA 5K1YA 1IF1A 2K27A 1IN6A 1R5GA 2O03A 1XN7A 1W4MA 2FBIA 1MD0A 4MEXF 1ZRFA 1R1VA 4EGYA 3NQOA 5LHIA 1MZBA 5D5VB 2VC1A 5FLXK 2JT1A 5D4SA 5E1XA 2O61A 2HTSA 2AXLA 3JTHA 4M6XA 1TW2A 2YX4A 1V3FA 3P9CA 3TDUC 1ZYRF 4I7HA 2ISYA 1FYLA 1XSDA 5EEHA 2ELHA 2CQKA 1KU9A 2X4HA 3JW4A 2DBBA 1XMKA 4Z2YA 1YQAA 2GA2A 2HYGD 4G9YA 1YG2A 4LK1F 3SQNA 3JAMK 1OYIA 1RIOH 5LRSA 4S05A 1WKMA 2XAFA 4KICA 3REOA 2Z3YA 1GXPA 3CO6C 2M87A 3E6MA 1LVAA 2JPBA 2PI0A 3QOPA 4L9TA 1LQ1A 1HXDA 1FYMA 2HEOA 5LLQA 2CSOA 2OQGA 3V8KA 4O3MA 2VC0A 3CLOA 3KFWX 2V1XA 1YW8A 2EFWA 4RGRA 2ZJ2A 4U88A 2IRFG 5LEJA 2BE5F 2QYOA 2XAHA 3HHGA 1TQPA 3SFZA 1TLHB 1SD6A 5HLIA 3IKVA 5HS7A 2AS5F 2XASA 2Y0MA 3RDIA 3FWEA 1MJAA 2P8TA 2W57A 2ESHA 2QM3A 1QO0D 2XUBA 4YFNF 3ZMVA 1SFEA 1XGMA 2RQPA 3E6CC 2IT0A 3MZHA 4G7OF 3VOEA 5CJ9A 4LB6B 2VE8A 2EV0A 2EFPA 3F8NA 4IXAA 2VBXA 2PG4A 2STWA 2Z99A 1R1UA 4GYGA 1UHWA 3KEOA 4OIRF 2OBPA 4G7HF 1RUOA 4OU0A 1SMTA 2V6CA 2IA0A 5HS8A 2PJPA 4HOBA 2Z9OA 3R61A 1ZG1A 3E97A 4LB5A 4IRHA 5D8KB 4LG0A 1HW2A 4EJOA 2H09A 1AOYA 1R5HA 4ON0A 2Y48A 4FX4A 3P9KA 1Z91A 3B73A 2F2EA 3E6BA 3HRMA 1O7FA 3T5XA 4KFCA 5L3CA 2KJCA 5HLGA 4IVNA 2M5WA 1Y0UA 1FPQA 5LGTA 1CF7B 5H6RA 4HBLA 1IXCA 1I1GA 3H3UA 1U5TC 5FB2A 3FZVA 5DCFA 2F5CA 1MKMA 3RJPA 5L3DA 1S29A 4YG2F 2UZKA 1IZ1A 1QPMA 2DT5A 3ZP5A 3ZMUA 4KMFA 2DK5A 2KIFA 2RGVA 1DPRA 4L5IA 1UFMA 5DV5A 4IRGA 1B9MA 4O6JA 2OU2A 3R0AA 5BPDA 3FMQA 1ONVA 3F23A 2GXBA 3RKWA 4XLPF 4P9UA 1W5SA 2MH2A 3F8BA 4CYDA 2FA5A 2XV4S 5BQTA 4L0YB 2DO7A 3HRTA 4EGZA 2H94A 1FBSA 2XROA 5ILSA 2BBYA 3I59B 1XDUA 2M30A 2KRFA 2D1HA 4R79A 1J75A 1EH6A 1WRJA 3CUQB 1ZHFA 3KP4A 2LF8A 4WXCA 4A5MA 2EFOA 3EUHA 3GVAA 3IHUA 1BIBA 2V1UA 4A12A 1S7AA 3CTAA 4AWXB 4G7ZF 4HQEA 2DFIA 1BIAA 2QZ8A 1B59A 3TO9A 4ZZLA 2UXNA 4HF1A 4CO8A 4BQAA 2HQRA 4A0YA 1IW7F 3EQLF 2KKOA 3L9FA 1E2XA 2P7CB 1BI3A 5ERIA 2FU4A 2F5DA 2XVCA 1EH7A 3D0SA 4DNCA 3F8CA 5JHUA 5ICCA 3W6JB 2Y75A 4UV9A 4L0ZB 1XD7A 2KJBA 4YFXF 4Q4ZF 2VONA 3WTYC 4R1HA 1U5TA 4IHTA 1XGSA 2HQNA 2V9VA 1UB9A 4CICA 1L3LA 4BHBA 2MC3A 3F6VA 2HFHA 4LD5A 5HVQC 1S7OA 3F8MA 3SZTA 1KGSA 4NQWA 1X3UA 2GQQA 2EA2A 1UHMA 4EJVA 3GYHX 2EK5A 2PLYA 5JR3A 3WTZA 4WXDA 3G3ZA 3E5XA 4EJTA 3AAFA 1D8KA 4QLCU 4FHTA 5E1ZB 3E6DA 1T38A 1F9NA 2GIVA 4AIKA 2FMLA 5E17F 2HS5A 5JVTA 2QBYB 4WCGA 2XIGA 1G3YA 3ZMTA 3F3XA 1IN8A 3P7NA 5DD8A 1Z6RA 1U3EM 3DP7A 3GZ6A 4EM2A 5HS9A 3VEPA 2FBKA 2PEXA 3QU6A 4LLGF 2OD5A 2QVOA 2QUFA 3VODA 1J7KA 3IRQA 3KP2A 5AIQA 1W5TA 2R7FA 1IRGA 3U2RA 3GFMA 3E5UA 3F8FA 1R58A 2HR3A 3KLNA 2FOKA 3S2WA 2IVMA 4XLNF 2VOPA 4I09A 4A2UA 2CFXA 2DPDA 3MCZA 4L5JA 4ENMA 4Q48A 2GAUA 1Z9CA 1CGPA 4HX4A 3MAJA 3PFIA 4I0BA 4KT5C 1LJ9A 1XSXA 3DKWA 5ICGA 1FWZA 2E7WA 5H6QA 1DP7P 5IT9Z 5FFZA 5JI6A 4Q5SF 3TGNA 1H9TA 1BC7C 1KQ8A 3EYIA 4P5OA 1R00A 4N0BA 1WQ2A 1JGSA 1P4AA 2NS0A 3LAJA 2A6HF 1KQ9A 1RZ4A 3RTRA 1RNLA 2D1VA 4G6DA 1BI1A 2VXZA 1WI9A 1LNWA 2IW5A 1D5VA 4LK0F 4BXUA 2VBWA 2FBHA 1I27A 2KIMA 3J81K 3H92A 2ZO4A 3ULQB 4CZZA 1CF7A 2OQRA 5DUIA 4S04A 5HDKA 3GF2A 1I1SA 4RGXA 1F1ZA 1XB4A 2EFQA 1FY7A 2H6CA 4MEYF 1QZZA 2Z33A 2V79A 4JQFA 3WTWC 3ISPA 4I0AA 5L3GA 2CW0F 5LGNA 4BH9A 1IXRC 3I54A 3FMSA 3F21A 1HKTA 3TOAA 4RGSA 4ESBA 4UUVA 2NRAC 4JBAA 3T0YA 1RI7A 2ZCWA 3LFKA 1BI0A 1KA8A 2HYFA 2JTVA 4KN7X 4IF4A 1K6OA 4IPAA 3BP8A 2WWYA 4XRFA 4U0VA 1ON1A 3QP6A 2YX7A 1U2WA 3O3KA 2FF4A 3WG9A 4EJUA 3I59A 4QWQA 2UWMA 1Q1HA 2IJLA 4KUMA 2DQRA 4KIGA 4RB3C 3RIRA 2WC2A 1JE8A 2LSOA 5HDNA 5CVVA 3CUQA 3DF8A 4PCQA 1VTNC 2R7DA 1AWCA 4AD9A 4N9IA 1G3SA 1W7PD 1TTYA 2L54A 2DU9A 2EB7A 3DFGA 3C18A 2O6GE 3DPLC 4ZYGA 1G4DA 2RC4A 4LGWA 1FBQA 3SHFA 4LMYA 1SFXA 4H0EA 4K2EA 5AONA 2HDCA 5E8IA 5DD4A 1UCRA 4EM1A 3TKYA 3HHHA 4R8HA 1P6RA 2M45A 3L00A 2VT3A 5D6FA 2FE3A 4HDUA 2WV0A 4LJZF 2LF7A 1K78B 3MQ0A 2FRHA 3GO5A 4KIBA 4GYIA 4MTEA 4M74A 4KNYA 1Z05A 2YU3A 2ZFWA 2LKPA 3ECOA 3ABUA 4LLLA 4UV8A 3KP7A 1SD4A 1O3RA 1NHAA 3L7WA 3QAHA 3Q5FA 3E3VA 2YSRA 1C0WA 4GCVA 1QZYA 3F6OA 2L02A 2OAZA 1O7LA 2M8EA 4WWCA 1T39A 5H20A 1RUNA 4A0ZA 4I02A 2R3SA 3FHZA 4UVCA 3RKYA 3BDDA 3GEZA 4A5NA 1MDMB 1J2XA 3LQRA 1LDJA 2EA4A 2LNBA 2XKOA 2QBYA 3DQVC 4I01A 4MTDA 4E70A 1FP2A 5FO5A 2ZKZA 3HRUA 3SXYA 2QQAA 1R1TA 1TQMA 4M6YA 3L09A 2H27A 1YYVA 5F6FA 5ICFA 4HQMA 3K1NA 4NHJA 3JTGA 5D4RA 2O3FA 1O3QA 1ZARA 2DW4A 2X0LA 4I98B 5J8CA 4YFKF 3GWZA 4MQVA 4U7BA 4AIHA 4RB1A 4OIQF 1PP8F 4L18B 1FT9A 4PDKA 4EM0B 2P6TA 2JPCA 4I2OA 4M71A 2ETHA 3K1PA 1LEBA 2P6SA 4PZJA 3DPTA 1XGOA 1OKRA 2GWRA 4MNUA 5FGMA 1G3WA 3KZZA 1SAXA 5DUKA 1ZG5A 1PDNC 4JK1X 3T8TA 2GA1A 1DDNA 5HOOA 4AIJA 2ZMEB 2RKHA 4HAMA 1JXSA 5FD6A 1YW9A 5DYMA 1TBXA 1SD5A 1EV7A 2NYXA 5CVJA 1JHHA 3WTSC 4BNCA 4M72A 1G6NA 2G7HA 1ZLJA 2P4WA 4RB0A 4M9ZA 3QP5A 2NAZA 5CYVA 5BPIA 3C1DA 3O6BB 1T2KA 3NEUA 3IWFA 3ERED 4GXOA 1T0FA 5BMZA 1IRFA 1T98A 4HW0A 1P92A 2CG4A 1YW7A 2VOOA 3U1DA 1J59A 2K7LA 4HYEA 1O3TA 2HTJA 5LHHA 1LDKB 4P9FA 3Q9SA 3FXRA 3LAPA 2MLKA 1YO5C 1FOKA 4A6DA 3M1EA 5KK1A 1XMAA 1PUEE 2XRNA 2OZUA 1K7AA 2VODA 2DQLA 1OYWA 1I5ZA 2Q2EA 1G3TA 1ZREA 3F22A 1ZG3A 1YLFA 3IKTA 2Z5UA 1S3JA 3M7GA 4LLNA 4FT8A 3C3WA 4G6QA 3TO6A 2EFNA 4KMUX 4U7DA 2GZWA 2BYVE 3GZ5A 1OPCA 3ZQ7A 2PMHA 4LFUA 2MBFA 3HTUA 4YIFA 2RNJA 2A6EF 5BOXA 3SZPA 3QRFF 2XKPA 4L9NA 2O8XA 2FXAA 3BJ6A 3KLOA 1GVJA 3N4MA 5LHGA 3KE2A 3WU1B 2A68F 2ADUA 2CO5A 1QGPA 2VE9A 2O0YA 3T8RA 5D8LB 5ILVA 4WX9A 3WE2A 2NNYA 1KQ0A 4LG0B 4RAYA 2RDPA 4CDGA 1H9GA 5BS6A 1KYZA 2XGXA 5DDGA 1H0MA 2XAGA 4G94A 2KIUA 3R4KA 2DK8A 1WWXA 5ILUA 3MFKA 2ACJA 2FNAA 3BPXA 4UHTA 2RV8A 2V1DA 3KETA 4RS8A 3K69A 4ZH4F 4MHGA 1SMYF 5EEGA 4FX0A 4CGZA 4PGHA 1K79A 3FXUA 1S8NA 1YS6A 1K78A 1BI2A 4BHPA 5LEKA 3FF5A 3HSRA 3WTTC 1LEAA 2JSCA 3RPQA 3JSOA 3R6SA 3CUQC 5CVIA 3J80K 3K2ZA 5E18F 3FM5A 3QPHA 3E5QA 3W6KB 2MA3A 1O3SA 2PFBA 3EDPA 2L4AA 2G9WA 3HUGA 1FNNA 1O57A 3J81Z 3EYYA 5J6XA 3ML6A 3HOSA 3M8FA 5D5UB 1XCVA 5E1WA 2EV5A 3L2CA 3GUDA 1E17A 1T6SA 5DCMB 5D5XB 2C6YA 3B02A 3RYRA 4GO1A 4HA8A 5FLXZ 2DTRA 1B9NA 3Q9VA 2QQBA 5ED4A 4U0YA 1FBUA 5A2QK 3V7SA 2OZ6A 5E8GA 4BHCA 2A69F 4ZYEA 3LA7A 2LDUA 2EV6A 2XAJA 1QBJA 2CYYA 4WXHA 1YFHA 5IT9K 1KU3A 4OINF 3RYPA 1I6XA 1BC8C 5JFRA 4M73A 1ZRCA 1U8RA 1SD7A 1BBYA 2L3DA 3JAMZ
chains in the Genus database with same CATH superfamily
3LA3A 2HI3A 2XDVA 2MLGA 4KIFA 3I0TA 2A5WA 4F7ZA 1HSJA 3S1MJ 1WJDA 4RGUA 1S9HA 1XCBA 2ZB9A 3DTEA 4ASNA 1OYYA 2R7XA 4B8XA 4XRSA 3G4SI 2W24A 2BVLA 3HOVJ 1FYKA 2OF7A 2TDXA 3MEXA 3V7RA 2K4JA 2ZJRF 1PUFB 1YRNB 2LH9A 1TNSA 2EJRA 1LB2A 1JUSA 1REPC 5AIPA 3WGGA 3OYDA 3K4KA 3IL2A 1Z3XA 3K6GA 2PJRB 4DOZA 5CVRA 1ZN2A 2H6BA 4C2UA 3A03A 3WTVC 3BWGA 3JRAA 4KN4X 2IS4A 3BY6A 1IN7A 3MKLA 1U5TB 2E1MB 5D6EA 2V9KA 5K5OA 2KP6A 2DA4A 1FC3A 2VN2A 5KAFC 3OIPA 3LWFA 1UJ8A 4X6AJ 2DMUA 3ABMH 1ZGAA 2K9QA 3COAC 1HF0A 2KRHA 2BGCA 3DU6A 4HF0A 1TT5B 5DEQA 5EDNA 4NDLA 2Y9ZA 2ZNZA 3GW2A 1HBXG 1EH8A 5J8FA 2HOEA 4ZTJA 1W7PB 2R7QA 3EPZA 3E1SA 5EJCA 2ZMEA 1D3YA 2RVCA 1VF9A 1QNTA 3M8EA 1G8XA 3HC7A 4NQWB 3KCCA 1FEXA 4XKVA 2HPIA 3NAUA 1XGNA 2Y69H 4ESFA 3V4GA 1R23A 1VQMI 5KVRA 1ZGJA 4Y7NJ 3D5LA 2ZFUA 4O5VA 2CJJA 3QYFA 3H3ZA 6PAXA 2MG4A 4CCKA 4MGRA 2FNPA 3ZQLA 4PGGA 3BZ6A 1G59A 1QZEA 5FFXA 2DXIA 1DQUA 2E60A 2R4GA 5TRDA 3I4PA 2JZYA 5EG0A 4UVBA 2HGCA 1PJRA 3IC7A 3SEZA 4UNOA 3IH4A 1AA7A 3HPGA 1D0ZA 2PMUA 5LRRA 1TT0A 3S32A 1LDDA 1D5YA 2R0QC 2DDAA 2E7XA 2L0KA 3HSEA 1A04A 5GADJ 4OMYA 1IXSB 1SFUA 5TJJA 4BDYA 4XM3A 1HW1A 2FEZA 4ENKA 4MIMA 2KFDA 3RPUA 1A35A 3S16J 1F5TA 3QPLA 3GTJJ 4XSZF 4DYRA 2L4MA 4NNJA 3U9GA 2E1NA 1TL8A 3ABTA 4RAZA 2Q8KA 3ZN0A 3OYHA 5IP7J 2Y0SA 2IPQX 3V8LA 4P96A 5F0HA 1CQTA 3H9JA 3OYNA 2CRGA 2DA1A 3LL7A 1BJAA 3ZQGA 2ICWG 2KHMA 5F64A 1YJNI 3IRRA 2KL4A 4E7IA 1FLIA 4XNFA 3ONQA 1KU7A 2FQ3A 3IAS2 1AHDP 2BXZA 4ENJA 4Y15A 5TGTA 4CHUA 3CDHA 1FP1D 3WGHA 1QQIA 2L7ZA 3OOPA 5FJ8J 4BY7J 4CXFA 2ZXIA 1Z21A 1KONA 4EV0A 2CUFA 4D7NA 1ETYA 2BW3A 4L9VA 4G8XA 3ZMSA 2M1BA 1FX7A 3CO7C 3PNTA 1VQLI 1SVMA 2M7AA 5HLHA 1BN5A 1MGTA 3HJEA 5C4JJ 3ZPLA 2ZXJA 5L3BA 1P4WA 3WE3A 1FZPB 1IDYA 4HLXA 5F1RA 1TQIA 2J5OA 3FHNA 4ZDPA 2I5UA 5M3MJ 1OR7A 3ABLH 3SDBA 5EEAA 2ESNA 3M07A 2YPRA 1FMVA 1ZELA 5E20A 2COMA 2DOEA 3HRSA 2HKOA 2Y31A 4ETSA 1YHQI 2O8KA 4AYBN 2H1KA 2M4KA 2E5NA 2H8WA 2CQ7A 3ERMA 3IWZA 3HIFA 5K5RA 4YIIA 2LC2A 4G12A 2X6XA 4Y13A 3WTXC 3QOEA 1X2MA 2CGPA 1DU0A 2XF6A 1U6GA 4BJ6C 3LFUA 3FX3A 1WJFA 4ZTFA 4A0XA 5L3FA 1EA3A 2EWNA 4FASD 4ZDLA 5J3LA 5JLWA 2F5EA 4EVIA 3CMYA 2MH9A 2UXXA 2ECBA 3RZOJ 1KYWA 3DTIA 3I4MJ 2XGDA 1U9OA 4IZZA 3RI4A 3M9AA 5C3EJ 3PQKA 3FXQA 1J9IA 4XIDA 3QYEA 1GXQA 2CV2A 2K9LA 2E19A 1ZRDA 5K5QA 2K85A 3DV8A 4RLQA 3MKWB 1NTCA 2NOJB 3K4CA 4HV6A 2VI6A 3D5SC 3E7LA 4BDZA 2CH0A 3GLXA 1V5FA 4ZZDA 5M3FJ 2X48A 3M1CA 3MKZA 1YS7A 5IP9J 2DN0A 1DGRM 3X2QH 3G6EI 2F6CA 2B63J 3BOQA 1S6LA 3RCOA 4XSXF 1R22A 1XG1A 2WBMA 4OIPF 4AIDA 3PIOF 1OJLA 2X6YA 5EGOB 2JUGA 2P5KA 1B1BA 2BY3A 2D2WA 2VIXA 4A3IJ 1Y1WJ 2HZDA 2W84A 2E36A 4P55A 2B0LA 2HXOA 1D1AA 3HYIA 1U78A 1LPQA 4IRIA 3ZR8X 3BPVA 1A31A 2HOAA 3FXMA 3BJOA 1OISA 3DEEA 1UELB 1FSEA 2PQ8A 4ZYHA 4PSWA 4QPQA 2LP0A 4KITB 1IUYA 2DA7A 2E1CA 1VQ9I 3HOTA 2X1EA 1MBHA 3HG9A 1R36A 2K02A 4YRVA 2JVHA 1STZA 2PBIA 4EJWA 2ZBKA 3WG7H 3UNGC 3DTKA 5IOZA 3FXOA 4BS9A 3GCMA 1Z1DA 1ZAOA 2DDBA 3K1MA 2VKDA 2R5YA 5CLSA 3A02A 2P7VB 4QPOA 1LE8A 1V5EA 2A07F 2VT2A 1VQPI 4HG2A 2FMYA 5F04A 3RKXA 1YIOA 4OOIA 3ASOH 5FD5A 3I53A 3S14J 2CW8A 3WGIA 1R71A 1ULYA 2W7NA 1HQCA 1I39A 5DCMA 3ZN1A 4DJAA 3OYGA 4TV7A 2W4SA 4C2TA 1BJZA 4RM2A 1D0XA 3RKQA 4D0PA 2QWWA 3LSJA 4LIUA 1EF4A 3I71A 4OMZA 1X1CA 3H1CA 1IRXA 3J7AO 1F36A 2MC4A 1F4KA 1BM9A 2FJ1A 3KZIC 3DEUA 3ECHA 5B66C 4KYWA 1VQNI 3I5UA 4PSXA 4IL6C 2VQCA 2L01A 2D45A 5B1BH 2DA2A 2PX9A 5J47A 2CWEA 3JR9A 3C7JA 2IP2A 4IHSA 1PP7U 4EQQA 2BXYA 5J4VA 4BYYA 2OCCH 2JRTA 1YI2I 1BOAA 3N97A 1X1DA 1HKQA 2PN6A 3DXJF 1OCOH 4YELA 4BKXA 2DT6A 1Z6TA 1ZTRA 1P4XA 4XICA 2W85A 1JKQC 4PJ0C 4BGDA 4IJAA 1HW5A 4FTHA 3ZMZA 4HLYA 2LKSA 3HGYA 2EIJH 2E71A 3ZMDA 3BTLA 3WU0A 2JA6J 3IV5A 3S3NA 4GGGA 1OLTA 1J5YA 4A3EJ 1K83J 3BQZA 3KP3A 3EETA 4EMSA 2XGEA 4PJNA 2R93J 2RAEA 3QPTA 2WA0A 1JHFA 1P2FA 1UMQA 2RN7A 5FKKA 3CD6I 3FMRA 4HDVA 3KZYA 3GX4X 2COBA 5FKMA 2J5PA 4AVPA 4ENNA 5GAGJ 3P9IA 3K0LA 3O8HA 4HX8A 3TO7A 2JMWA 3HSFA 2VBZA 1ZLKA 2QF7A 2Q1ZB 2HKXA 2P5VA 2DMPA 4UVAA 3OS2A 1YRNA 2TCTA 5CQGA 2K4BA 2W48A 3DLLF 1SC7A 1MJBA 3P5JA 3H36A 1TWAJ 3BCBA 3GFIA 2DAOA 3VDXA 2LY9A 2FSWA 2MD5A 3PNVA 1W0UA 2M7BA 4UXNA 4C3JJ 2FX0A 1I3QJ 3GFJA 3CCMI 2LKXA 3MWMA 3FK6A 1MMNA 2M34A 3V7CA 1MMGA 2WAEA 4BQQA 2E2JJ 3V8JA 2H1LA 2HZTA 1OCCH 1UG0A 1V55H 1MJ9A 2JA8J 4DYCA 3FM3A 2CQQA 4N9HA 3JRDA 2OA4A 1W7PA 2QENA 1P7IA 1X3WB 2BEOA 4XOPA 4HX7A 3TQNA 4CCJA 1Z7UA 2HWVA 1MSEC 1WPKA 1ZQ3P 2XPVA 1TP4A 3JRHA 4PJMA 2VBYA 3JSPA 3PUFA 1DPUA 4M9XA 3F72A 2Y9YA 4XBFA 4WF2A 1MMSA 3BR2A 4HV5A 3W2VA 3SZGA 3OSFA 3NRVA 5K7ZA 4A93J 1ODDA 2YR2A 3DBHB 5FKOA 3PO2J 4U87A 3TDZC 2XC7A 3AG4H 3ZQCA 1B6AA 3G2BA 5D5WB 1GHCA 2A5YB 1WJBA 2I10A 3FXLA 3R0JA 1X19A 4HZFA 4XOTA 2QSFX 5LD2C 4CSWA 2K3PA 4A6EA 1D8JA 2ZNYA 3TOBA 4LG3A 1ZH5A 2DMNA 2XHKA 4ZYDA 4KDPA 4Y17A 5B3SH 4Q47A 2G7UA 2WTEA 1FSHA 2QQ9A 2UV1A 2P0WA 4HF2A 4B09A 3CDLA 4E7SA 3F9KA 3M4OJ 3LSIA 3CJTB 3O2PE 4E7JA 2K9NA 2BV6A 4BBSJ 3LSTA 3K9TA 1HA8A 3CJQB 3J80Z 2GXAA 1TW3A 4OIOF 3ELKA 3VFZA 2KRCA 1B4AA 1IAWA 3H35A 3L1PA 1XDSA 3CC4I 3DKXA 4M9SA 2QLZA 4G6TB 5L3EA 2I8DA 1HSTA 2F48A 1GT0C 1IN4A 2O9LA 2XAQA 2F5FA 2Y30A 4P1WA 4WK8F 3WTUC 2ZMEC 1N25A 2KZVA 3LSKA 2A61A 5HDGA 2LY2A 3CJNA 2DLLA 3TL4X 4BAYA 4D5FA 3BJAA 2F4OB 3KP5A 4DBQA 1OMIA 3R60A 2L9RA 2GLOA 3I58A 3OV8A 3ZCOA 3KEQA 1YX5A 4Y3OA 2DPUA 5ICEA 3MZYA 1MBJA 4A3JJ 3OSGA 2L9NA 2L7FP 4DQ2A 3S3OA 4MQ9F 3T1BA 3GTKJ 1JTYA 1USSA 2KISA 3BROA 3FXJA 2R7RA 5A2QZ 3VYRB 3VWBA 3PQJA 1V4RA 2M8GX 4W1UA 3ROUA 1R4MB 5LGUA 5JVGF 3HXLA 3AG1H 2A3SA 4IO9F 1WSUA 2W25A 2JA7J 1TNTA 4RB2C 2STTA 3A2KA 4FQGA 2DI3A 3C2GA 4ESJA 2LBFB 2IA1A 5JLXA 1USTA 5IT3A 1L0OC 1Z7LA 2GOXB 1DUXC 2GXGA 4KA4A 5DM6F 3GFLA 3LQQA 1IN5A 3LSMA 3G71I 1YTYA 1A5JA 5KNLA 3KP6A 2CFOA 2IA2A 3CLQA 4M3FA 4A3KJ 3VB2A 4V2GA 3HTSB 1MDMA 2P5LC 3U1KA 3CCSI 3I64A 4LIVA 4NBQA 3LA2A 3G73A 1KU2A 1ON2A 1R6RA 2Q0OA 5CVUA 1OCZH 2K86A 1WJEA 4L9JA 4LITA 1YE9A 3GXOA 5GP9A 3WODF 2JWTA 1R7JA 3MN2A 1E0EA 2VKHA 4A3CJ 3GTLJ 2CQNA 1XSVA 2E35A 2M3AA 4NB5A 2BHZA 3CUOA 2ISZA 3K4NA 5FRNA 1HKSA 3JRFA 4FETA 4IHXA 5C44J 3QU3A 5LBQA 2R7VA 4II2A 3IAM2 3ZOBA 1TWHJ 1J0RA 3CZ6A 2X51A 1YOVB 1Y1VJ 3PJRA 1IRZA 2NNNA 4U0WA 5K1YA 4CUGA 1IF1A 5F0CA 2K27A 5J40A 1IN6A 4A3GJ 1BW6A 1R5GA 2O03A 1XN7A 1RR7A 1W4MA 2FBIA 3HBLA 1MD0A 3E0JB 4MEXF 4BBRJ 1V54H 1ZRFA 1R1VA 3ZQHA 4EGYA 3QWLA 3NQOA 4IOCF 5LHIA 2LK2A 3PUBA 5HNHA 1OFCX 5FROA 1MZBA 5D5VB 4I76A 1E3PA 2VC1A 5FLXK 5EGOA 2DMQA 2ZXHA 1OR7C 1QVTA 2JT1A 2K9SA 2VL8A 4ZJZA 1N77A 2OC6A 1BR2A 2MSYA 5D4SA 1MH4A 5E1XA 2O61A 2VXDA 3OYAA 2HTSA 4E7KA 1FTTA 2AXLA 2HOTA 3JTHA 3LSHA 2M2EA 4M6XA 1TW2A 2L5QA 3OY9A 3M8JA 3K4BA 4C3HJ 2Q2EB 2D5VA 3FKJA 1T33A 2YX4A 1V3FA 3P9CA 3TDUC 5GTHC 4JYKA 1ZYRF 3L2QA 4I7HA 2ISYA 1FYLA 2V7FA 1XSDA 5EEHA 2IGNA 1OCTC 4CA0A 3JREA 2CQKA 2ELHA 3SJMA 3MKYB 1X1BA 1KU9A 2X4HA 3JW4A 2DBBA 1JJ6C 1XMKA 4Z2YA 3Q0VA 1YQAA 3OS1A 2GA2A 2HYGD 5B1AH 4G9YA 3H9QA 1YG2A 4LK1F 5GTIC 1U0JA 3SQNA 4JP0A 3JAMK 5E3OA 2AXTC 1OYIA 2JA2A 1RIOH 4CH7A 1WKMA 5LRSA 4S05A 3HDDA 2XAFA 2QKMB 4KICA 2L7MP 1J09A 2WY7Q 3REOA 3RQ4A 2Z3YA 3CC2I 1GXPA 4S0HB 4YIRX 3CO6C 2M87A 3E6MA 1LVAA 3SYTA 2JPBA 4IEJA 2PI0A 3QOPA 4L9TA 3IH2A 3K4MA 1LQ1A 2M0MA 3GTGJ 2EZIA 4PUSA 3OR2C 1HXDA 1FYMA 2HEOA 3G1MA 2WAFA 4UB8C 5LLQA 3SEQA 1UHSA 2CSOA 2OQGA 3V8KA 3H0GJ 2VC0A 4O3MA 3CLOA 3KFWX 2V1XA 2DMTA 1YW8A 2EFWA 1MNDA 1P7JA 4RGRA 2RREA 1B8IA 3FXKA 2ZJ2A 4IHYA 4U88A 2IRFG 5LEJA 9ANTA 5GAHJ 3JRIA 2Y0SN 2BE5F 2QYOA 2XAHA 1IV6A 5LFAA 3HHGA 2FOWA 1TQPA 4PFOA 3DEWA 3DBLB 1Y39A 2DFHA 3SFZA 1TLHB 1SD6A 5HLIA 4E4HA 1YIJI 3IKVA 5HS7A 1ZKGA 2G0EA 1ZK8A 5HODA 2AS5F 2XASA 2Y0MA 4B4CA 2VJIA 3RDIA 3FWEA 1MJAA 2NVQJ 2P8TA 1VFCA 5M5XJ 3AL0B 3K7AJ 2LTPA 2W57A 1DP3A 2ESHA 1K4TA 2QM3A 2HVSA 4HEA2 4MLOA 1QO0D 3WHCA 1YJ9I 3C2BA 3OL3A 4IQJA 1GLNA 2XUBA 4XLFA 4YFNF 3ZMVA 1SFEA 1XGMA 2RQPA 3IUOA 3E6CC 1HOMA 2IT0A 2PMZN 3MZHA 4G7OF 2IGOA 3I9V2 2IS2A 2ID6A 3VOEA 3HOUJ 2LOOA 3I3LA 3S1NJ 2MD0A 2VJ5A 3LOCA 5HNFA 5CJ9A 1SVLA 2X1DA 4LB6B 2VE8A 4KISA 3PM1A 5H2FC 2EV0A 4Y4RA 2EFPA 3KYDB 3UKGA 3ABKH 1X2NA 3PNYA 2DFFA 3F8NA 2EINH 3BCAA 3U21A 1NK2P 4IXAA 2VBXA 4QSHA 2PG4A 3OYKA 2STWA 2ECCA 2Z99A 1W1WE 2F4MB 4D1QA 1SFKA 1R1UA 2IEKA 2L2OA 4GYGA 1UHWA 3KEOA 3FBNB 4OIRF 3TMOA 2JQ7A 2OBPA 4G7HF 1RUOA 2R7UA 1GUUA 4OU0A 1SMTA 2V6CA 2IA0A 4UB6C 1T08B 5HS8A 3HUGB 3K70C 3VYUB 4HOBA 2PJPA 2Z9OA 2JN6A 4HPQA 3R61A 1ZG1A 1HLVA 3E97A 4J19A 1SAUA 4LB5A 1VQ7I 2KPMA 2EPFA 2XGCA 4M3EA 5K7HA 2VJJA 4IRHA 5D8KB 4LG0A 1HW2A 4EJOA 2VPRA 5IYBJ 4CYCA 2CV1A 2H09A 1AOYA 1R5HA 4ON0A 3CF5F 2Y48A 3TW6A 4BU2A 4FX4A 3J7YJ 3RQIA 3P9KA 1Z91A 3B73A 4IHWA 2F2EA 1LKXA 2L7KA 2WAQA 2EQRA 3E6BA 3HRMA 4AYBA 1O7FA 2DA5A 3DKYA 1S5LC 3T5XA 4KFCA 3L2WA 2DJIA 2X9DA 5L3CA 3F0CA 2KJCA 4MFDA 5HLGA 2VUMJ 4IVNA 2M5WA 1Y0UA 4F92B 4Y52J 1FPQA 5LGTA 1B72B 5F1JA 1JJ8C 1CF7B 5H6RA 5E3LA 4HBLA 1IXCA 2E5ZA 1I1GA 3H3UA 1JT0A 2EZLA 1U5TC 1X4PA 2E1MC 3FZVA 4KJZA 2F5CA 5DCFA 4L5EA 5FB2A 1QRYA 3L2VA 1MKMA 3KYLA 3RJPA 4PK4A 1OCRH 2QCOA 5L3DA 1S29A 4YG2F 4J00A 1ETQA 2BZTA 2UZKA 1IZ1A 1QPMA 2DT5A 3ZP5A 3ZXSA 1UAAA 4DBRA 3CCRI 2ZSHB 1WCMJ 3GZNB 3ZMUA 4KMFA 2DK5A 3KX2A 2KIFA 2RGVA 3OYFA 1DPRA 4L5IA 1UFMA 5DV5A 2FQ4A 3FBIB 4IRGA 1B9MA 4O6JA 2OU2A 3R0AA 2HQAA 5BPDA 3FMQA 2FD5A 1ONVA 2HU9A 4E6KG 3OIOA 3F23A 3CF2A 1LFBA 2LRDA 2MW8A 4M6VA 4AU7A 2GXBA 4XLEA 3RKWA 2A6TA 2UUZA 4XLPF 4P9UA 1W5SA 1JKPC 4UUSB 3JRGA 4W97A 3HKZA 4NC7A 2MH2A 4XLHA 2NS8A 4BJTA 1N75A 1SANA 3F8BA 4BE1A 4CYDA 4FE7A 2FA5A 4M3DA 4B1RA 4JX4A 2DTZA 2XV4S 5BQTA 3A0HC 2YS9A 4L0YB 1H89C 2LBFA 3SFIA 3GTOJ 2DO7A 3HRTA 2VPLA 4X0GA 4EGZA 3GTPJ 2H94A 1FBSA 2WV1A 2XROA 1WVRA 4FCYA 5ILSA 2NS7A 2BBYA 3I59B 3SDGA 1XDUA 2LG4A 2XB0X 2M30A 4D5CA 2KRFA 4C9YA 2D1HA 4R79A 2LD5A 1J75A 2X6WA 3BQYA 4CZCA 1EH6A 1TWCJ 2DODA 3CMEI 4RLFA 1WRJA 3CUQB 2BHYA 1ZHFA 3ASNH 3KP4A 2LF8A 4WXCA 1AKHB 4BE2A 1A6QA 4A5MA 2EFOA 3EUHA 3GVAA 3FISA 3IHUA 1BIBA 2OTJI 2V1UA 3GMEA 3MD2A 5TISC 4A12A 5CQEA 3PSIA 1XMXA 1YX3A 1ACIA 1S7AA 2CUJA 3CTAA 5GPAA 1GDTA 4OAZA 4AWXB 4G7ZF 5EG0B 1GV5A 1T8IA 2ZC2A 3CMMA 4HQEA 2NOGA 3PL8A 2DFIA 1BIAA 3H5RA 5GAEJ 2QZ8A 2EBIA 1B59A 3K4JA 2R7OA 3TO9A 4ZZLA 3GTMJ 1I50J 2UXNA 3VSKA 4HF1A 4CO8A 4BQAA 2HQRA 4A0YA 1IW7F 3EQLF 2IS6A 4XK4A 2KKOA 3L9FA 1E2XA 5HLTA 3TP3A 3J7ZI 2IS1A 1VQ5I 3EUAA 3K4LA 2P7CB 1BI3A 5ERIA 2FU4A 4XRMA 2F5DA 2XVCA 1RR8C 1EH7A 2MFZA 2LVSA 3D0SA 3F8CA 4DNCA 5JHUA 5ICCA 3Q0UA 2Y75A 3W6JB 1PUFA 4UV9A 4L0ZB 1XD7A 2KJBA 2PJRA 2BY1A 2HYJA 4YFXF 2ZJQF 3VPRA 2EH3A 2DT7B 3IP4B 2XB5A 4N4NB 4Q4ZF 1K4SA 2VONA 3WTYC 2KZGA 2YUSA 1H8AC 4F91B 3RPUD 4R1HA 1U5TA 1Z67A 2QKLB 4F55A 3BTJA 1XGSA 2VB6A 4IHTA 2HQNA 2V9VA 1FMWA 3OYEA 3BR5A 1FIPA 1UB9A 2XF5A 4CICA 2ZSIB 1L3LA 3B6CA 3OR1C 1ETXA 4BHBA 4A3FJ 1P9QC 2MC3A 5IP6A 3F6VA 2HFHA 1Z0XA 4LD5A 4XR6A 2KT0A 5HVQC 1R4NB 1S7OA 3F8MA 3SZTA 4AVZA 3Q3SA 1NH3A 2BW3B 2LLKA 1KGSA 4NQWA 5F08A 4XRSG 1X3UA 2GQQA 2DOFA 2EA2A 1UHMA 2XF7A 3MVPA 4EJVA 2JA5J 3GYHX 2EK5A 2PLYA 1X1AA 1HDPA 5JR3A 3WTZA 4WXDA 4GRIA 3G3ZA 4ANJA 3E5XA 4EJTA 2CUZA 3AAFA 3OOUA 3BLYA 3J7AY 1U9NA 1D8KA 3S1RJ 1QU3A 2BOLA 4QLCU 5FKLA 3AG3H 4FHTA 5E1ZB 2VJ4A 3E6DA 3S3MA 1T38A 1F9NA 2GIVA 4AIKA 2FMLA 5E17F 2HS5A 1MMAA 5JVTA 3H0DA 2QBYB 2EILH 4WCGA 2XIGA 2RNGA 4MFEA 1G3YA 3ZMTA 3F3XA 3BG7A 1IN8A 2H8RA 3P7NA 2AQFA 3DBRB 5DD8A 1Z6RA 1U3EM 3KYCB 1JT6A 2JVGA 3DP7A 5CPRB 3GZ6A 2CQXA 4EM2A 2QSHX 3BR0A 2JSPA 5HS9A 3VEPA 2FBKA 2PEXA 3QU6A 4LLGF 4BXFA 2OD5A 2QVOA 4HNTA 2QUFA 4RM3A 3VODA 3NWTA 1RRJA 2L9VA 2R7ZJ 1W0TA 1J7KA 3CC7I 3IRQA 1D1BA 4HNVA 2R7SA 3LMMA 3KP2A 5AIQA 1W5TA 2R7FA 1IRGA 3U2RA 3GFMA 4DIQA 3E5UA 3F8FA 2AQEA 1Y56A 3CCLI 1R58A 3KEYA 5B5EC 2HR3A 3KLNA 2FOKA 3S2WA 2IVMA 4XLNF 4H4KC 2VOPA 4I09A 4A2UA 2CFXA 2DPDA 1DU6A 4GDFA 5J1YA 2R7TA 3VSLA 3MCZA 4L5JA 4ENMA 2DJNA 2M0CA 4Q48A 2GAUA 1R5ID 1Z9CA 1XPXA 1CGPA 4HX4A 3MAJA 3PFIA 4I0BA 4KT5C 3HPHA 1LJ9A 3LSPA 4E7LA 1XSXA 3DKWA 2M4GA 2V4JC 5ICGA 1FOWA 1FWZA 3BG9A 1IDZA 3W2AA 1W36C 1VQ6I 2X85A 4II3A 2E7WA 1T56A 5H6QA 2VLAA 4E7ZA 3PO3J 2K9MA 3D5RC 3OMYA 4B48A 1DP7P 5IT9Z 5FFZA 5JI6A 4Q5SF 2OUMA 4JX5A 1JTXA 3TGNA 1H9TA 3DCFA 1BC7C 3OYCA 1KQ8A 3EYIA 3NWSA 1ERDA 4P5OA 1ETWA 1R00A 4N0BA 4RAFA 1E3OC 1WQ2A 2Y2ZA 3H3VK 1LE8B 2RQQA 1JGSA 1M1EB 1P4AA 2AO9A 1A6IA 2NS0A 1LFPA 3LAJA 2WB1N 4ABZA 1D0YA 2A6HF 1ETVA 5M5WJ 4HRIA 1KQ9A 4XONA 1RZ4A 1MNEA 3L2UA 1D1CA 1IO2A 3QODA 3RTRA 1RNLA 1VZ0A 2D1VA 4G6DA 1QVUA 1WFXA 1BI1A 3TW7A 2A05A 2VXZA 2BY2A 1WI9A 1OQYA 3S2DJ 1LNWA 3CESA 2IW5A 1D5VA 4LK0F 4DW6A 4BXUA 2VBWA 1ORKA 2FBHA 1I27A 5FLVA 2KIMA 3J81K 3H92A 2ZO4A 1B72A 5F27A 3ULQB 4CZZA 1JUPA 1CF7A 4XKBA 2OQRA 1MIJA 5DUIA 4S04A 4HNUA 2CMPA 5HDKA 1NK3P 2IBDA 3WU2C 3GF2A 1JKOC 1I1SA 1BW5A 1FOXA 4RGXA 1HC8A 1F1ZA 1XB4A 2B9SA 2EFQA 3BR1A 1FY7A 2H6CA 4MEYF 1QZZA 2Z33A 3OYMA 2NVUB 1TWFJ 2ID3A 2V79A 1ENHA 4JQFA 3WTWC 3ISPA 4I0AA 5L3GA 2CW0F 5LGNA 3A1YA 4BH9A 5DS9A 1IXRC 2JK3A 3I54A 2GOMA 3FMSA 3K70D 2E34A 2DA6A 1ETOA 3F21A 1HKTA 1EJ9A 3TOAA 4CCNA 3BTIA 4RGSA 4FE4A 3BG5A 4ESBA 3HOWJ 2XAUA 4UUVA 3BT9A 2NRAC 1K6YA 3CP8A 4UUSA 3B6AA 4JBAA 3T0YA 1RI7A 4QIWN 2ZCWA 3LFKA 1XTAA 1BI0A 5IY5H 1KA8A 1UG2A 2HYFA 3Q0WA 1SEUA 2R5ZB 2GM4A 2LFBA 3A01B 1ZR4A 2JTVA 4KN7X 2KDZA 4IF4A 2HDWA 1K6OA 1YITI 4IPAA 3BP8A 2WWYA 3VYTB 1LVKA 4PJJA 1MBKA 4XRFA 5DM7F 3HL2A 4U0VA 1ON1A 3NARA 3QP6A 2YX7A 4XLCA 1U2WA 3O3KA 2FF4A 3WG9A 4EJUA 1UZCA 3I59A 2BVMA 4QWQA 2UWMA 1Q1HA 2IJLA 2KIQA 2DQRA 4KUMA 4KIGA 1FTZA 3RZDJ 2W1OA 3BG6A 3I4NJ 1VNDA 4M3GA 2HNHA 4RB3C 3RIRA 2WC2A 1JE8A 2DCEA 1WZ2A 4IOAF 2LSOA 5HDNA 2QQ8A 5CVVA 3CUQA 3DF8A 4PCQA 2HXIA 1VTNC 1AKHA 2GIZA 1NG6A 2OPTA 2R7DA 4AD9A 1ZGWA 4N9IA 1AWCA 2P81A 1G3SA 1W7PD 4F52A 2L54A 1TTYA 2OCEA 2DU9A 3K2AA 4DZPA 2EB7A 4M3BA 5JHFA 1RKWA 5GPCA 3BR6A 2Z2SB 3DFGA 3C18A 3MZ8A 2IAIA 2LREA 2O6GE 3DPLC 4ZYGA 1MSFC 3UR3C 1G4DA 4JX6A 2RC4A 4LGWA 1FBQA 4XN3A 3SHFA 3LSRA 3HM5A 1O4XA 1X3ZB 4LMYA 1SFXA 2ME6A 4IX7A 3HGGA 4H0EA 5J4YA 4J01A 1RESA 4NUBA 4K2EA 5AONA 2HDCA 5E8IA 4EEFG 5DD4A 5FRMA 4QTRA 1OCPA 1UCRA 4RAGA 4EM1A 3TKYA 5EZHA 3W2WA 1QA6A 3HHHA 3L2RA 4R8HA 1P6RA 1KZHA 2M45A 3L00A 2VT3A 5D6FA 3GBGA 2FE3A 3LNQA 3I55I 2QGUA 4HDUA 1VQ8I 1MH3A 3CQZJ 2WV0A 4LJZF 2LF7A 1K78B 3MQ0A 2FRHA 4BQOA 3GO5A 4KIBA 2N8GA 4GYIA 4MTEA 4B44A 4BEHB 5J1RA 4M74A 1K61A 3OYLA 4A3DJ 4KNYA 1Z05A 2YU3A 2ZFWA 2LKPA 3ECOA 3ABUA 3PIPF 4LLLA 4UV8A 3KP7A 1SD4A 1O3RA 3BC8A 3FDYA 1NHAA 1IG7A 3EUHC 2HDDA 2KQRA 3L7WA 3QAHA 1MNMC 3Q5FA 2CU7A 3DPUA 3E3VA 2YSRA 2ZJPF 1C0WA 4GCVA 1QZYA 3F6OA 2L02A 2OAZA 1VQ4I 1O7LA 2K40A 2M8EA 4WWCA 2IGMA 5IYDJ 3QYBA 3G1OA 1T39A 3CCQI 4PJLA 1ETKA 5H20A 1RUNA 4A0ZA 3OL4A 2PMZA 1T0FC 2L9SA 3A0BC 3KPHA 3H5NA 4I02A 2CW7A 1FIAA 2R3SA 2WAQN 4CCOA 4UVCA 3FHZA 1JKRC 3RKYA 3BDDA 4B3AA 3GEZA 4A5NA 4D7MA 2DOAA 1MDMB 1MMDA 1RKTA 1J2XA 1RC9A 3RSNA 3S15J 3LQRA 1LDJA 2EA4A 1WJCA 2LNBA 2XKOA 2QBYA 3DQVC 3N05A 4I01A 4MTDA 4E70A 1FP2A 3DU5A 5FO5A 2ZKZA 3HRUA 1E3HA 3SXYA 5F0FA 3CCYA 2QQAA 1R1TA 1TQMA 3LSGA 1W5CC 1Y0NA 4M6YA 1FJLA 4OWRB 2ZXWH 1AU7A 4I99C 3I56I 1R49A 3L09A 2H27A 1YYVA 5F6FA 5ICFA 1SVOA 4HQMA 3GLLA 3K1NA 4NHJA 3JTGA 5J1UA 5D4RA 2O3FA 1O3QA 2WY8Q 1ZARA 2ELJA 4UUTA 4CCLA 1Q1VA 2DW4A 2X0LA 4I98B 5J8CA 4DGWB 4YFKF 3GWZA 4X1EA 4MQVA 4B3XA 4U7BA 4AIHA 1G2HA 4RB1A 3CCVI 4BXXJ 4OIQF 3ZQQA 1PP8F 5EZGA 3WHBA 1R9TJ 5C4XJ 4L18B 1FT9A 4PDKA 1I3AA 4EM0B 3HKZN 2P6TA 3MMYB 1TZLA 2JPCA 2LR8A 4OAYA 4I2OA 4M71A 2ETHA 3K1PA 1LEBA 2P6SA 4PZJA 3DPTA 2X1CA 1ZR2A 1XGOA 1OKRA 1VI0A 2KLOA 5FLMJ 2R7WA 1WH5A 2OV7A 3BZKA 4ZC3A 2KMUA 2GWRA 4MNUA 5FGMA 1G3WA 5IPAA 3KZZA 2W00A 1SAXA 1I6HJ 2DYRH 1RETA 1Y8RB 5DUKA 1VQKI 1ZG5A 1PDNC 4JK1X 2ME0A 5E3NA 3OS0A 3T8TA 4XL9A 4Y33A 2X6OA 2GA1A 1DDNA 5HOOA 1PVEA 4RDUA 3S1QJ 3OYJA 4AIJA 4CCMA 2JJ7A 1BOBA 2RKHA 2ZMEB 3HOZJ 1IV8A 4HAMA 1JXSA 3FIWA 2XPWA 5FD6A 1MBGA 1YW9A 4V2FA 5DYMA 1TBXA 5IOYA 4XLAA 1SD5A 1EV7A 2NYXA 3O8GA 1JHHA 4NC8A 5CVJA 3ZRGA 2DFEA 3WTSC 1U8BA 4BNCA 4M72A 3H5AA 1G6NA 2G7HA 2F4IA 1ZLJA 4XORA 4F3QA 2O5RA 2P4WA 4RB0A 4JOMA 4ITVA 4M9ZA 1HDDC 3QP5A 2XSDC 2NAZA 2ELKA 4FISA 5CYVA 5BPIA 2VQGA 3C1DA 3AL0C 2E2HJ 3O6BB 1T2KA 3CCEI 3NEUA 4A3BJ 2HOSA 1XC5A 3OYBA 3IWFA 3ERED 2V9PA 2GBYA 4MO7A 4GXOA 1T0FA 5BMZA 1IRFA 1T98A 4HW0A 1P92A 2O7OA 2CG4A 2OJED 3EUKL 4XKWA 3HOXJ 1YW7A 2VOOA 3U1DA 1J59A 4BJ5C 1B8IB 2K7LA 4F93B 4HYEA 1O3TA 3DLAA 3CDIA 2HTJA 5LHHA 5KHDA 1W36D 2QEXI 1LDKB 3OIQA 4P9FA 1WH7A 3Q9SA 3ZGKA 2W82A 3BG3A 3FXRA 3LAPA 2MLKA 1YO5C 1FOKA 4A6DA 4RBOA 3M1EA 5KK1A 2QA4I 1Y6IA 2IGKA 4KT6A 1XMAA 2EIKH 4IHVA 2NVYJ 1PUEE 2XRNA 2OZUA 4BQNA 1K7AA 2CS3A 4Z6YA 2VODA 5E79C 1SFOJ 2DQLA 5KAIC 1OYWA 3HZJA 1I5ZA 4AM3A 2Q2EA 1G3TA 1T95A 3BTCA 5K7FA 2QSGX 1ZREA 3F22A 2VQHA 4YEJA 1ZG3A 2CUEA 3ESWB 4XMYA 1YLFA 1LFUP 1WGXA 1BL0A 3IKTA 2K3FA 2TRTA 2Z5UA 3GTQJ 3G1LA 1S3JA 3JRBA 1QHHD 4E7HA 3M7GA 4LLNA 4FT8A 1LUJB 3C3WA 1APLC 3PFYA 4G6QA 3TO6A 4RA2A 4BACA 2EFNA 3BR3A 4KMUX 3PSFA 2R5ZA 4U7DA 3A01A 1MBEA 4AUXA 4EATA 1BR4A 2GZWA 2NVXJ 2MABA 2BYVE 2FUG2 3GZ5A 2HVRA 1OPCA 2V26A 2PMHA 3TP0A 3ZQ7A 4LFUA 4A3LJ 3VYSB 2MBFA 1BA5A 1X58A 3HTUA 4YIFA 2RNJA 2A6EF 5BOXA 2Z1DA 2NXNB 1IJWC 3SZPA 3QRFF 2V6EA 2E1OA 2XKPA 5IYCJ 4L9NA 2O8XA 1POGA 2NVTJ 4A69C 1WHUA 2FXAA 1V5GA 3BJ6A 2VASA 3KLOA 3TEDA 3KIOA 1GVJA 5M5YJ 3N4MA 5LHGA 3KE2A 3C2HA 2A68F 3WU1B 4XN0A 2EZKA 3M3YJ 5E3MA 4BE0A 2ADUA 1WJAA 2CO5A 1QGPA 2V1NA 2VE9A 4DZJA 1Z77A 4IKFA 2O0YA 3OWTA 1ITYA 1IC8A 3IH3A 3JCUC 3T8RA 5D8LB 5ILVA 4WX9A 3FK7A 1FOYA 4XQFA 3WE2A 2NNYA 1KQ0A 1WJ5A 4LG0B 2HQ5A 4RAYA 4CYCB 4D9JA 2RDPA 1EKEA 4CDGA 2KDOA 2VKVA 5CKTA 1H9GA 2LMDA 1GV2A 5BS6A 3AFHA 1KYZA 2XGXA 5DDGA 1Y8QB 1H0MA 2Z16A 2XAGA 4G94A 2KIUA 1X1PA 1DGWY 1VQOI 3R4KA 4N4OB 2DK8A 1WWXA 5ILUA 4HSTA 2B7EA 3MFKA 2ACJA 2FNAA 1F43A 3BPXA 4UHTA 3TBIA 2RV8A 2V1DA 3KETA 4RS8A 3K69A 4ZH4F 2MGQA 4MHGA 4V19K 1N78A 4AC0A 1MBFA 1SMYF 2JUCA 5EEGA 4FX0A 3CCJI 4GFBA 3CCUI 4CGZA 4C3IJ 4PGHA 1K79A 3FXUA 3S8PA 3W6VA 1S8NA 3W3CA 4C2MJ 1YS6A 4NC6A 5KCMA 1K78A 3S17J 3AG2H 1BI2A 4BHPA 5LEKA 3QPSA 3FF5A 3HSRA 4BEHA 3WTTC 1JGGA 1LEAA 1TWGJ 1IUFA 1H88C 2XPUA 2JSCA 3HEFA 3RPQA 3JSOA 4I6ZA 1S72I 3D1NI 1YJWI 2E2IJ 3R6SA 3CUQC 2OTLI 5CVIA 1X4OA 3J80K 3K2ZA 5E18F 3FM5A 3QPHA 4C30A 1XS9A 2CV0A 3E5QA 4DYQA 3K10A 3W6KB 3CP2A 2MA3A 2EIMH 3HB9A 1O3SA 1A36A 2PFBA 2XSJC 3FKIJ 3EDPA 3HOYJ 2L4AA 2R5YB 4ZDOA 3A4CA 3ZQFA 1QPIA 1Z3YA 1JUMA 1IGNA 5BNGA 1BR1A 2EZHA 2G9WA 3HUGA 3CMAI 1FNNA 1O57A 1QHGA 4PFPA 3J81Z 4A3MJ 1MW7A 3EYYA 5J6XA 3JRCA 3ML6A 2BY0A 3OYIA 3HOSA 3M8FA 5D5UB 1XCVA 5E1WA 1HCRA 4HSRA 1S7EA 2EV5A 3L2CA 3GUDA 1E17A 1TC3C 1T6SA 5DCMB 5D5XB 2C6YA 3B02A 3RYRA 4B43A 4UY8I 4GO1A 4LOCA 4HA8A 2M9HA 5FLXZ 4B47A 2F5VA 1NG7A 2DTRA 3S93A 3ZQIA 1B9NA 3V42A 3Q9VA 5FKNA 3AKZA 2DA3A 2QQBA 5ED4A 4U0YA 2K5CA 2XRLA 4ZYAA 2IXSA 2VQLA 1RPWA 3BZCA 1FBUA 5A2QK 3V7SA 2OZ6A 1PYVA 4RMNA 1WI3A 5E8GA 4BHCA 2A69F 1XX5A 3LA7A 4ZYEA 2YU9J 3H9GA 4XKCA 5EF6A 2LDUA 2LY1A 2EV6A 2LYCA 2XAJA 4BL0B 2VKEA 1QBJA 2CYYA 4WXHA 1YFHA 5IT9K 5EYRA 3DWLE 2MYSA 1KU3A 2WB1A 4OINF 3RYPA 1I6XA 1BC8C 1GVDA 3CJRB 5JFRA 3S2HJ 4IQ4A 4M73A 1JI8A 1ZRCA 2JRMA 2HVQA 1U8RA 3QQAA 1SD7A 1BBYA 4BUPA 2DYSH 2AHQA 2WADA 2L3DA 5DTDA 2R92J 3JAMZ 4BY1J 2HPMA
chains in the Genus database with same CATH topology
3LA3A 2MLGA 4KIFA 3I0TA 4F7ZA 1HSJA 4RGUA 1XCBA 4ASNA 1OYYA 4B8XA 2W24A 1FYKA 2TDXA 3MEXA 3V7RA 2K4JA 1TNSA 2EJRA 1LB2A 1REPC 5AIPA 3WGGA 3IL2A 5CVRA 1ZN2A 2H6BA 3WTVC 3BWGA 4KN4X 3BY6A 1IN7A 1U5TB 5D6EA 5K5OA 1FC3A 2VN2A 3LWFA 1ZGAA 3COAC 2BGCA 4HF0A 5DEQA 2ZNZA 3GW2A 1HBXG 1EH8A 5J8FA 2HOEA 1W7PB 2ZMEA 1D3YA 2RVCA 1QNTA 3M8EA 3KCCA 1XGNA 4ESFA 3V4GA 1R23A 5KVRA 1ZGJA 3D5LA 4O5VA 3H3ZA 6PAXA 4MGRA 2FNPA 4PGGA 3BZ6A 5FFXA 5TRDA 3I4PA 2JZYA 4UVBA 2HGCA 3IC7A 4UNOA 2PMUA 5LRRA 1LDDA 2E7XA 3HSEA 1A04A 4OMYA 1IXSB 1SFUA 5TJJA 1HW1A 2FEZA 4ENKA 3RPUA 1F5TA 4XSZF 2L4MA 3U9GA 2E1NA 3ABTA 4RAZA 2Q8KA 3ZN0A 2IPQX 3V8LA 4P96A 1BJAA 5F64A 3IRRA 1FLIA 1KU7A 2FQ3A 4ENJA 4Y15A 4CHUA 3CDHA 1FP1D 3WGHA 1QQIA 3OOPA 4CXFA 4EV0A 3ZMSA 4L9VA 4G8XA 2M1BA 1FX7A 3CO7C 5HLHA 1BN5A 1MGTA 3ZPLA 2ZXJA 5L3BA 1P4WA 3WE3A 1FZPB 4HLXA 5F1RA 1TQIA 2J5OA 1OR7A 2ESNA 2YPRA 5E20A 2COMA 3HRSA 4ETSA 2HKOA 3IWZA 3HIFA 5K5RA 4YIIA 4Y13A 3WTXC 2CGPA 1U6GA 3FX3A 4A0XA 5L3FA 2EWNA 2F5EA 4EVIA 2MH9A 2UXXA 1KYWA 3RI4A 3M9AA 3PQKA 3FXQA 1J9IA 1GXQA 1ZRDA 5K5QA 3DV8A 4HV6A 3GLXA 4ZZDA 1YS7A 3BOQA 1S6LA 4XSXF 1R22A 4OIPF 2P5KA 1B1BA 2D2WA 2W84A 4P55A 2B0LA 3HYIA 1U78A 4IRIA 3BPVA 3BJOA 1FSEA 2PQ8A 4ZYHA 1IUYA 2E1CA 3HOTA 1R36A 2K02A 1STZA 2PBIA 4EJWA 2ZBKA 1Z1DA 1ZAOA 3K1MA 5CLSA 2P7VB 2A07F 2VT2A 2FMYA 3RKXA 1YIOA 4OOIA 5FD5A 3I53A 3WGIA 1ULYA 1HQCA 5DCMA 3ZN1A 4TV7A 4D0PA 2QWWA 3I71A 4OMZA 3J7AO 1F4KA 1BM9A 3DEUA 3ECHA 4KYWA 3I5UA 2L01A 2D45A 2CWEA 3C7JA 2IP2A 4IHSA 1PP7U 4EQQA 4BYYA 2JRTA 1BOAA 3N97A 1HKQA 2PN6A 3DXJF 1Z6TA 1P4XA 2W85A 4IJAA 1HW5A 3ZMZA 4HLYA 3ZMDA 3WU0A 4GGGA 1J5YA 3KP3A 3EETA 4EMSA 3QPTA 1JHFA 1P2FA 2RN7A 3FMRA 4HDVA 3KZYA 3GX4X 4ENNA 2J5PA 4AVPA 3P9IA 3K0LA 4HX8A 3TO7A 3HSFA 2VBZA 1ZLKA 2HKXA 2P5VA 4UVAA 2K4BA 1MJBA 3GFIA 2DAOA 2FSWA 2MD5A 4UXNA 3GFJA 3MWMA 3V7CA 3V8JA 2HZTA 1MJ9A 3FM3A 4N9HA 2OA4A 1W7PA 2QENA 2BEOA 3TQNA 4HX7A 1Z7UA 2HWVA 2VBYA 3JSPA 1DPUA 4M9XA 3F72A 4XBFA 4WF2A 4HV5A 3NRVA 1ODDA 2YR2A 3TDZC 1B6AA 5D5WB 1GHCA 2A5YB 3R0JA 4HZFA 4A6EA 1D8JA 2ZNYA 3TOBA 1ZH5A 2XHKA 4ZYDA 4KDPA 4Y17A 4Q47A 2G7UA 2WTEA 1FSHA 2QQ9A 4HF2A 4B09A 3O2PE 2BV6A 3LSTA 3K9TA 3J80Z 1TW3A 4OIOF 3ELKA 3VFZA 1B4AA 1IAWA 1XDSA 4M9SA 2QLZA 5L3EA 1HSTA 1IN4A 2XAQA 2F5FA 4WK8F 3WTUC 2A61A 5HDGA 3CJNA 2DLLA 4BAYA 3BJAA 3KP5A 1OMIA 3R60A 3I58A 3OV8A 3KEQA 2DPUA 5ICEA 3MZYA 4DQ2A 4MQ9F 3T1BA 1USSA 3BROA 5A2QZ 3PQJA 1V4RA 3ROUA 5LGUA 2A3SA 1WSUA 2W25A 1TNTA 4RB2C 2STTA 2DI3A 4ESJA 2IA1A 1USTA 5IT3A 1L0OC 1DUXC 2GXGA 4KA4A 3GFLA 3LQQA 1IN5A 1YTYA 3KP6A 2IA2A 3VB2A 3HTSB 1MDMA 2P5LC 3I64A 3LA2A 3G73A 1KU2A 1ON2A 2Q0OA 5CVUA 2K86A 4L9JA 3GXOA 3WODF 1R7JA 2ISZA 1XSVA 4NB5A 3CUOA 1HKSA 3QU3A 5LBQA 1J0RA 2NNNA 4U0WA 5K1YA 1IF1A 2K27A 1IN6A 1R5GA 2O03A 1XN7A 1W4MA 2FBIA 1MD0A 4MEXF 1ZRFA 1R1VA 4EGYA 3NQOA 5LHIA 1MZBA 5D5VB 2VC1A 5FLXK 2JT1A 5D4SA 5E1XA 2O61A 2HTSA 2AXLA 3JTHA 4M6XA 1TW2A 2YX4A 1V3FA 3P9CA 3TDUC 1ZYRF 4I7HA 2ISYA 1FYLA 1XSDA 5EEHA 2ELHA 2CQKA 1KU9A 2X4HA 3JW4A 2DBBA 1XMKA 4Z2YA 1YQAA 2GA2A 2HYGD 4G9YA 1YG2A 4LK1F 3SQNA 3JAMK 1OYIA 1RIOH 5LRSA 4S05A 1WKMA 2XAFA 4KICA 3REOA 2Z3YA 1GXPA 3CO6C 2M87A 3E6MA 1LVAA 2JPBA 2PI0A 3QOPA 4L9TA 1LQ1A 1HXDA 1FYMA 2HEOA 5LLQA 2CSOA 2OQGA 3V8KA 4O3MA 2VC0A 3CLOA 3KFWX 2V1XA 1YW8A 2EFWA 4RGRA 2ZJ2A 4U88A 2IRFG 5LEJA 2BE5F 2QYOA 2XAHA 3HHGA 1TQPA 3SFZA 1TLHB 1SD6A 5HLIA 3IKVA 5HS7A 2AS5F 2XASA 2Y0MA 3RDIA 3FWEA 1MJAA 2P8TA 2W57A 2ESHA 2QM3A 1QO0D 2XUBA 4YFNF 3ZMVA 1SFEA 1XGMA 2RQPA 3E6CC 2IT0A 3MZHA 4G7OF 3VOEA 5CJ9A 4LB6B 2VE8A 2EV0A 2EFPA 3F8NA 4IXAA 2VBXA 2PG4A 2STWA 2Z99A 1R1UA 4GYGA 1UHWA 3KEOA 4OIRF 2OBPA 4G7HF 1RUOA 4OU0A 1SMTA 2V6CA 2IA0A 5HS8A 2PJPA 4HOBA 2Z9OA 3R61A 1ZG1A 3E97A 4LB5A 4IRHA 5D8KB 4LG0A 1HW2A 4EJOA 2H09A 1AOYA 1R5HA 4ON0A 2Y48A 4FX4A 3P9KA 1Z91A 3B73A 2F2EA 3E6BA 3HRMA 1O7FA 3T5XA 4KFCA 5L3CA 2KJCA 5HLGA 4IVNA 2M5WA 1Y0UA 1FPQA 5LGTA 1CF7B 5H6RA 4HBLA 1IXCA 1I1GA 3H3UA 1U5TC 5FB2A 3FZVA 5DCFA 2F5CA 1MKMA 3RJPA 5L3DA 1S29A 4YG2F 2UZKA 1IZ1A 1QPMA 2DT5A 3ZP5A 3ZMUA 4KMFA 2DK5A 2KIFA 2RGVA 1DPRA 4L5IA 1UFMA 5DV5A 4IRGA 1B9MA 4O6JA 2OU2A 3R0AA 5BPDA 3FMQA 1ONVA 3F23A 2GXBA 3RKWA 4XLPF 4P9UA 1W5SA 2MH2A 3F8BA 4CYDA 2FA5A 2XV4S 5BQTA 4L0YB 2DO7A 3HRTA 4EGZA 2H94A 1FBSA 2XROA 5ILSA 2BBYA 3I59B 1XDUA 2M30A 2KRFA 2D1HA 4R79A 1J75A 1EH6A 1WRJA 3CUQB 1ZHFA 3KP4A 2LF8A 4WXCA 4A5MA 2EFOA 3EUHA 3GVAA 3IHUA 1BIBA 2V1UA 4A12A 1S7AA 3CTAA 4AWXB 4G7ZF 4HQEA 2DFIA 1BIAA 2QZ8A 1B59A 3TO9A 4ZZLA 2UXNA 4HF1A 4CO8A 4BQAA 2HQRA 4A0YA 1IW7F 3EQLF 2KKOA 3L9FA 1E2XA 2P7CB 1BI3A 5ERIA 2FU4A 2F5DA 2XVCA 1EH7A 3D0SA 4DNCA 3F8CA 5JHUA 5ICCA 3W6JB 2Y75A 4UV9A 4L0ZB 1XD7A 2KJBA 4YFXF 4Q4ZF 2VONA 3WTYC 4R1HA 1U5TA 4IHTA 1XGSA 2HQNA 2V9VA 1UB9A 4CICA 1L3LA 4BHBA 2MC3A 3F6VA 2HFHA 4LD5A 5HVQC 1S7OA 3F8MA 3SZTA 1KGSA 4NQWA 1X3UA 2GQQA 2EA2A 1UHMA 4EJVA 3GYHX 2EK5A 2PLYA 5JR3A 3WTZA 4WXDA 3G3ZA 3E5XA 4EJTA 3AAFA 1D8KA 4QLCU 4FHTA 5E1ZB 3E6DA 1T38A 1F9NA 2GIVA 4AIKA 2FMLA 5E17F 2HS5A 5JVTA 2QBYB 4WCGA 2XIGA 1G3YA 3ZMTA 3F3XA 1IN8A 3P7NA 5DD8A 1Z6RA 1U3EM 3DP7A 3GZ6A 4EM2A 5HS9A 3VEPA 2FBKA 2PEXA 3QU6A 4LLGF 2OD5A 2QVOA 2QUFA 3VODA 1J7KA 3IRQA 3KP2A 5AIQA 1W5TA 2R7FA 1IRGA 3U2RA 3GFMA 3E5UA 3F8FA 1R58A 2HR3A 3KLNA 2FOKA 3S2WA 2IVMA 4XLNF 2VOPA 4I09A 4A2UA 2CFXA 2DPDA 3MCZA 4L5JA 4ENMA 4Q48A 2GAUA 1Z9CA 1CGPA 4HX4A 3MAJA 3PFIA 4I0BA 4KT5C 1LJ9A 1XSXA 3DKWA 5ICGA 1FWZA 2E7WA 5H6QA 1DP7P 5IT9Z 5FFZA 5JI6A 4Q5SF 3TGNA 1H9TA 1BC7C 1KQ8A 3EYIA 4P5OA 1R00A 4N0BA 1WQ2A 1JGSA 1P4AA 2NS0A 3LAJA 2A6HF 1KQ9A 1RZ4A 3RTRA 1RNLA 2D1VA 4G6DA 1BI1A 2VXZA 1WI9A 1LNWA 2IW5A 1D5VA 4LK0F 4BXUA 2VBWA 2FBHA 1I27A 2KIMA 3J81K 3H92A 2ZO4A 3ULQB 4CZZA 1CF7A 2OQRA 5DUIA 4S04A 5HDKA 3GF2A 1I1SA 4RGXA 1F1ZA 1XB4A 2EFQA 1FY7A 2H6CA 4MEYF 1QZZA 2Z33A 2V79A 4JQFA 3WTWC 3ISPA 4I0AA 5L3GA 2CW0F 5LGNA 4BH9A 1IXRC 3I54A 3FMSA 3F21A 1HKTA 3TOAA 4RGSA 4ESBA 4UUVA 2NRAC 4JBAA 3T0YA 1RI7A 2ZCWA 3LFKA 1BI0A 1KA8A 2HYFA 2JTVA 4KN7X 4IF4A 1K6OA 4IPAA 3BP8A 2WWYA 4XRFA 4U0VA 1ON1A 3QP6A 2YX7A 1U2WA 3O3KA 2FF4A 3WG9A 4EJUA 3I59A 4QWQA 2UWMA 1Q1HA 2IJLA 4KUMA 2DQRA 4KIGA 4RB3C 3RIRA 2WC2A 1JE8A 2LSOA 5HDNA 5CVVA 3CUQA 3DF8A 4PCQA 1VTNC 2R7DA 1AWCA 4AD9A 4N9IA 1G3SA 1W7PD 1TTYA 2L54A 2DU9A 2EB7A 3DFGA 3C18A 2O6GE 3DPLC 4ZYGA 1G4DA 2RC4A 4LGWA 1FBQA 3SHFA 4LMYA 1SFXA 4H0EA 4K2EA 5AONA 2HDCA 5E8IA 5DD4A 1UCRA 4EM1A 3TKYA 3HHHA 4R8HA 1P6RA 2M45A 3L00A 2VT3A 5D6FA 2FE3A 4HDUA 2WV0A 4LJZF 2LF7A 1K78B 3MQ0A 2FRHA 3GO5A 4KIBA 4GYIA 4MTEA 4M74A 4KNYA 1Z05A 2YU3A 2ZFWA 2LKPA 3ECOA 3ABUA 4LLLA 4UV8A 3KP7A 1SD4A 1O3RA 1NHAA 3L7WA 3QAHA 3Q5FA 3E3VA 2YSRA 1C0WA 4GCVA 1QZYA 3F6OA 2L02A 2OAZA 1O7LA 2M8EA 4WWCA 1T39A 5H20A 1RUNA 4A0ZA 4I02A 2R3SA 3FHZA 4UVCA 3RKYA 3BDDA 3GEZA 4A5NA 1MDMB 1J2XA 3LQRA 1LDJA 2EA4A 2LNBA 2XKOA 2QBYA 3DQVC 4I01A 4MTDA 4E70A 1FP2A 5FO5A 2ZKZA 3HRUA 3SXYA 2QQAA 1R1TA 1TQMA 4M6YA 3L09A 2H27A 1YYVA 5F6FA 5ICFA 4HQMA 3K1NA 4NHJA 3JTGA 5D4RA 2O3FA 1O3QA 1ZARA 2DW4A 2X0LA 4I98B 5J8CA 4YFKF 3GWZA 4MQVA 4U7BA 4AIHA 4RB1A 4OIQF 1PP8F 4L18B 1FT9A 4PDKA 4EM0B 2P6TA 2JPCA 4I2OA 4M71A 2ETHA 3K1PA 1LEBA 2P6SA 4PZJA 3DPTA 1XGOA 1OKRA 2GWRA 4MNUA 5FGMA 1G3WA 3KZZA 1SAXA 5DUKA 1ZG5A 1PDNC 4JK1X 3T8TA 2GA1A 1DDNA 5HOOA 4AIJA 2ZMEB 2RKHA 4HAMA 1JXSA 5FD6A 1YW9A 5DYMA 1TBXA 1SD5A 1EV7A 2NYXA 5CVJA 1JHHA 3WTSC 4BNCA 4M72A 1G6NA 2G7HA 1ZLJA 2P4WA 4RB0A 4M9ZA 3QP5A 2NAZA 5CYVA 5BPIA 3C1DA 3O6BB 1T2KA 3NEUA 3IWFA 3ERED 4GXOA 1T0FA 5BMZA 1IRFA 1T98A 4HW0A 1P92A 2CG4A 1YW7A 2VOOA 3U1DA 1J59A 2K7LA 4HYEA 1O3TA 2HTJA 5LHHA 1LDKB 4P9FA 3Q9SA 3FXRA 3LAPA 2MLKA 1YO5C 1FOKA 4A6DA 3M1EA 5KK1A 1XMAA 1PUEE 2XRNA 2OZUA 1K7AA 2VODA 2DQLA 1OYWA 1I5ZA 2Q2EA 1G3TA 1ZREA 3F22A 1ZG3A 1YLFA 3IKTA 2Z5UA 1S3JA 3M7GA 4LLNA 4FT8A 3C3WA 4G6QA 3TO6A 2EFNA 4KMUX 4U7DA 2GZWA 2BYVE 3GZ5A 1OPCA 3ZQ7A 2PMHA 4LFUA 2MBFA 3HTUA 4YIFA 2RNJA 2A6EF 5BOXA 3SZPA 3QRFF 2XKPA 4L9NA 2O8XA 2FXAA 3BJ6A 3KLOA 1GVJA 3N4MA 5LHGA 3KE2A 3WU1B 2A68F 2ADUA 2CO5A 1QGPA 2VE9A 2O0YA 3T8RA 5D8LB 5ILVA 4WX9A 3WE2A 2NNYA 1KQ0A 4LG0B 4RAYA 2RDPA 4CDGA 1H9GA 5BS6A 1KYZA 2XGXA 5DDGA 1H0MA 2XAGA 4G94A 2KIUA 3R4KA 2DK8A 1WWXA 5ILUA 3MFKA 2ACJA 2FNAA 3BPXA 4UHTA 2RV8A 2V1DA 3KETA 4RS8A 3K69A 4ZH4F 4MHGA 1SMYF 5EEGA 4FX0A 4CGZA 4PGHA 1K79A 3FXUA 1S8NA 1YS6A 1K78A 1BI2A 4BHPA 5LEKA 3FF5A 3HSRA 3WTTC 1LEAA 2JSCA 3RPQA 3JSOA 3R6SA 3CUQC 5CVIA 3J80K 3K2ZA 5E18F 3FM5A 3QPHA 3E5QA 3W6KB 2MA3A 1O3SA 2PFBA 3EDPA 2L4AA 2G9WA 3HUGA 1FNNA 1O57A 3J81Z 3EYYA 5J6XA 3ML6A 3HOSA 3M8FA 5D5UB 1XCVA 5E1WA 2EV5A 3L2CA 3GUDA 1E17A 1T6SA 5DCMB 5D5XB 2C6YA 3B02A 3RYRA 4GO1A 4HA8A 5FLXZ 2DTRA 1B9NA 3Q9VA 2QQBA 5ED4A 4U0YA 1FBUA 5A2QK 3V7SA 2OZ6A 5E8GA 4BHCA 2A69F 4ZYEA 3LA7A 2LDUA 2EV6A 2XAJA 1QBJA 2CYYA 4WXHA 1YFHA 5IT9K 1KU3A 4OINF 3RYPA 1I6XA 1BC8C 5JFRA 4M73A 1ZRCA 1U8RA 1SD7A 1BBYA 2L3DA 3JAMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA3 A;  2MLG A;  4KIF A;  3I0T A;  4F7Z A;  1HSJ A;  4RGU A;  1XCB A;  4ASN A;  1OYY A;  4B8X A;  2W24 A;  1FYK A;  2TDX A;  3MEX A;  3V7R A;  2K4J A;  1TNS A;  2EJR A;  1LB2 A;  1REP C;  5AIP A;  3WGG A;  3IL2 A;  5CVR A;  1ZN2 A;  2H6B A;  3WTV C;  3BWG A;  4KN4 X;  3BY6 A;  1IN7 A;  1U5T B;  5D6E A;  5K5O A;  1FC3 A;  2VN2 A;  3LWF A;  1ZGA A;  3COA C;  2BGC A;  4HF0 A;  5DEQ A;  2ZNZ A;  3GW2 A;  1HBX G;  1EH8 A;  5J8F A;  2HOE A;  1W7P B;  2ZME A;  1D3Y A;  2RVC A;  1QNT A;  3M8E A;  3KCC A;  1XGN A;  4ESF A;  3V4G A;  1R23 A;  5KVR A;  1ZGJ A;  3D5L A;  4O5V A;  3H3Z A;  6PAX A;  4MGR A;  2FNP A;  4PGG A;  3BZ6 A;  5FFX A;  5TRD A;  3I4P A;  2JZY A;  4UVB A;  2HGC A;  3IC7 A;  4UNO A;  2PMU A;  5LRR A;  1LDD A;  2E7X A;  3HSE A;  1A04 A;  4OMY A;  1IXS B;  1SFU A;  5TJJ A;  1HW1 A;  2FEZ A;  4ENK A;  3RPU A;  1F5T A;  4XSZ F;  2L4M A;  3U9G A;  2E1N A;  3ABT A;  4RAZ A;  2Q8K A;  3ZN0 A;  2IPQ X;  3V8L A;  4P96 A;  1BJA A;  5F64 A;  3IRR A;  1FLI A;  1KU7 A;  2FQ3 A;  4ENJ A;  4Y15 A;  4CHU A;  3CDH A;  1FP1 D;  3WGH A;  1QQI A;  3OOP A;  4CXF A;  4EV0 A;  3ZMS A;  4L9V A;  4G8X A;  2M1B A;  1FX7 A;  3CO7 C;  5HLH A;  1BN5 A;  1MGT A;  3ZPL A;  2ZXJ A;  5L3B A;  1P4W A;  3WE3 A;  1FZP B;  4HLX A;  5F1R A;  1TQI A;  2J5O A;  1OR7 A;  2ESN A;  2YPR A;  5E20 A;  2COM A;  3HRS A;  4ETS A;  2HKO A;  3IWZ A;  3HIF A;  5K5R A;  4YII A;  4Y13 A;  3WTX C;  2CGP A;  1U6G A;  3FX3 A;  4A0X A;  5L3F A;  2EWN A;  2F5E A;  4EVI A;  2MH9 A;  2UXX A;  1KYW A;  3RI4 A;  3M9A A;  3PQK A;  3FXQ A;  1J9I A;  1GXQ A;  1ZRD A;  5K5Q A;  3DV8 A;  4HV6 A;  3GLX A;  4ZZD A;  1YS7 A;  3BOQ A;  1S6L A;  4XSX F;  1R22 A;  4OIP F;  2P5K A;  1B1B A;  2D2W A;  2W84 A;  4P55 A;  2B0L A;  3HYI A;  1U78 A;  4IRI A;  3BPV A;  3BJO A;  1FSE A;  2PQ8 A;  4ZYH A;  1IUY A;  2E1C A;  3HOT A;  1R36 A;  2K02 A;  1STZ A;  2PBI A;  4EJW A;  2ZBK A;  1Z1D A;  1ZAO A;  3K1M A;  5CLS A;  2P7V B;  2A07 F;  2VT2 A;  2FMY A;  3RKX A;  1YIO A;  4OOI A;  5FD5 A;  3I53 A;  3WGI A;  1ULY A;  1HQC A;  5DCM A;  3ZN1 A;  4TV7 A;  4D0P A;  2QWW A;  3I71 A;  4OMZ A;  3J7A O;  1F4K A;  1BM9 A;  3DEU A;  3ECH A;  4KYW A;  3I5U A;  2L01 A;  2D45 A;  2CWE A;  3C7J A;  2IP2 A;  4IHS A;  1PP7 U;  4EQQ A;  4BYY A;  2JRT A;  1BOA A;  3N97 A;  1HKQ A;  2PN6 A;  3DXJ F;  1Z6T A;  1P4X A;  2W85 A;  4IJA A;  1HW5 A;  3ZMZ A;  4HLY A;  3ZMD A;  3WU0 A;  4GGG A;  1J5Y A;  3KP3 A;  3EET A;  4EMS A;  3QPT A;  1JHF A;  1P2F A;  2RN7 A;  3FMR A;  4HDV A;  3KZY A;  3GX4 X;  4ENN A;  2J5P A;  4AVP A;  3P9I A;  3K0L A;  4HX8 A;  3TO7 A;  3HSF A;  2VBZ A;  1ZLK A;  2HKX A;  2P5V A;  4UVA A;  2K4B A;  1MJB A;  3GFI A;  2DAO A;  2FSW A;  2MD5 A;  4UXN A;  3GFJ A;  3MWM A;  3V7C A;  3V8J A;  2HZT A;  1MJ9 A;  3FM3 A;  4N9H A;  2OA4 A;  1W7P A;  2QEN A;  2BEO A;  3TQN A;  4HX7 A;  1Z7U A;  2HWV A;  2VBY A;  3JSP A;  1DPU A;  4M9X A;  3F72 A;  4XBF A;  4WF2 A;  4HV5 A;  3NRV A;  1ODD A;  2YR2 A;  3TDZ C;  1B6A A;  5D5W B;  1GHC A;  2A5Y B;  3R0J A;  4HZF A;  4A6E A;  1D8J A;  2ZNY A;  3TOB A;  1ZH5 A;  2XHK A;  4ZYD A;  4KDP A;  4Y17 A;  4Q47 A;  2G7U A;  2WTE A;  1FSH A;  2QQ9 A;  4HF2 A;  4B09 A;  3O2P E;  2BV6 A;  3LST A;  3K9T A;  3J80 Z;  1TW3 A;  4OIO F;  3ELK A;  3VFZ A;  1B4A A;  1IAW A;  1XDS A;  4M9S A;  2QLZ A;  5L3E A;  1HST A;  1IN4 A;  2XAQ A;  2F5F A;  4WK8 F;  3WTU C;  2A61 A;  5HDG A;  3CJN A;  2DLL A;  4BAY A;  3BJA A;  3KP5 A;  1OMI A;  3R60 A;  3I58 A;  3OV8 A;  3KEQ A;  2DPU A;  5ICE A;  3MZY A;  4DQ2 A;  4MQ9 F;  3T1B A;  1USS A;  3BRO A;  5A2Q Z;  3PQJ A;  1V4R A;  3ROU A;  5LGU A;  2A3S A;  1WSU A;  2W25 A;  1TNT A;  4RB2 C;  2STT A;  2DI3 A;  4ESJ A;  2IA1 A;  1UST A;  5IT3 A;  1L0O C;  1DUX C;  2GXG A;  4KA4 A;  3GFL A;  3LQQ A;  1IN5 A;  1YTY A;  3KP6 A;  2IA2 A;  3VB2 A;  3HTS B;  1MDM A;  2P5L C;  3I64 A;  3LA2 A;  3G73 A;  1KU2 A;  1ON2 A;  2Q0O A;  5CVU A;  2K86 A;  4L9J A;  3GXO A;  3WOD F;  1R7J A;  2ISZ A;  1XSV A;  4NB5 A;  3CUO A;  1HKS A;  3QU3 A;  5LBQ A;  1J0R A;  2NNN A;  4U0W A;  5K1Y A;  1IF1 A;  2K27 A;  1IN6 A;  1R5G A;  2O03 A;  1XN7 A;  1W4M A;  2FBI A;  1MD0 A;  4MEX F;  1ZRF A;  1R1V A;  4EGY A;  3NQO A;  5LHI A;  1MZB A;  5D5V B;  2VC1 A;  5FLX K;  2JT1 A;  5D4S A;  5E1X A;  2O61 A;  2HTS A;  2AXL A;  3JTH A;  4M6X A;  1TW2 A;  2YX4 A;  1V3F A;  3P9C A;  3TDU C;  1ZYR F;  4I7H A;  2ISY A;  1FYL A;  1XSD A;  5EEH A;  2ELH A;  2CQK A;  1KU9 A;  2X4H A;  3JW4 A;  2DBB A;  1XMK A;  4Z2Y A;  1YQA A;  2GA2 A;  2HYG D;  4G9Y A;  1YG2 A;  4LK1 F;  3SQN A;  3JAM K;  1OYI A;  1RIO H;  5LRS A;  4S05 A;  1WKM A;  2XAF A;  4KIC A;  3REO A;  2Z3Y A;  1GXP A;  3CO6 C;  2M87 A;  3E6M A;  1LVA A;  2JPB A;  2PI0 A;  3QOP A;  4L9T A;  1LQ1 A;  1HXD A;  1FYM A;  2HEO A;  5LLQ A;  2CSO A;  2OQG A;  3V8K A;  4O3M A;  2VC0 A;  3CLO A;  3KFW X;  2V1X A;  1YW8 A;  2EFW A;  4RGR A;  2ZJ2 A;  4U88 A;  2IRF G;  5LEJ A;  2BE5 F;  2QYO A;  2XAH A;  3HHG A;  1TQP A;  3SFZ A;  1TLH B;  1SD6 A;  5HLI A;  3IKV A;  5HS7 A;  2AS5 F;  2XAS A;  2Y0M A;  3RDI A;  3FWE A;  1MJA A;  2P8T A;  2W57 A;  2ESH A;  2QM3 A;  1QO0 D;  2XUB A;  4YFN F;  3ZMV A;  1SFE A;  1XGM A;  2RQP A;  3E6C C;  2IT0 A;  3MZH A;  4G7O F;  3VOE A;  5CJ9 A;  4LB6 B;  2VE8 A;  2EV0 A;  2EFP A;  3F8N A;  4IXA A;  2VBX A;  2PG4 A;  2STW A;  2Z99 A;  1R1U A;  4GYG A;  1UHW A;  3KEO A;  4OIR F;  2OBP A;  4G7H F;  1RUO A;  4OU0 A;  1SMT A;  2V6C A;  2IA0 A;  5HS8 A;  2PJP A;  4HOB A;  2Z9O A;  3R61 A;  1ZG1 A;  3E97 A;  4LB5 A;  4IRH A;  5D8K B;  4LG0 A;  1HW2 A;  4EJO A;  2H09 A;  1AOY A;  1R5H A;  4ON0 A;  2Y48 A;  4FX4 A;  3P9K A;  1Z91 A;  3B73 A;  2F2E A;  3E6B A;  3HRM A;  1O7F A;  3T5X A;  4KFC A;  5L3C A;  2KJC A;  5HLG A;  4IVN A;  2M5W A;  1Y0U A;  1FPQ A;  5LGT A;  1CF7 B;  5H6R A;  4HBL A;  1IXC A;  1I1G A;  3H3U A;  1U5T C;  5FB2 A;  3FZV A;  5DCF A;  2F5C A;  1MKM A;  3RJP A;  5L3D A;  1S29 A;  4YG2 F;  2UZK A;  1IZ1 A;  1QPM A;  2DT5 A;  3ZP5 A;  3ZMU A;  4KMF A;  2DK5 A;  2KIF A;  2RGV A;  1DPR A;  4L5I A;  1UFM A;  5DV5 A;  4IRG A;  1B9M A;  4O6J A;  2OU2 A;  3R0A A;  5BPD A;  3FMQ A;  1ONV A;  3F23 A;  2GXB A;  3RKW A;  4XLP F;  4P9U A;  1W5S A;  2MH2 A;  3F8B A;  4CYD A;  2FA5 A;  2XV4 S;  5BQT A;  4L0Y B;  2DO7 A;  3HRT A;  4EGZ A;  2H94 A;  1FBS A;  2XRO A;  5ILS A;  2BBY A;  3I59 B;  1XDU A;  2M30 A;  2KRF A;  2D1H A;  4R79 A;  1J75 A;  1EH6 A;  1WRJ A;  3CUQ B;  1ZHF A;  3KP4 A;  2LF8 A;  4WXC A;  4A5M A;  2EFO A;  3EUH A;  3GVA A;  3IHU A;  1BIB A;  2V1U A;  4A12 A;  1S7A A;  3CTA A;  4AWX B;  4G7Z F;  4HQE A;  2DFI A;  1BIA A;  2QZ8 A;  1B59 A;  3TO9 A;  4ZZL A;  2UXN A;  4HF1 A;  4CO8 A;  4BQA A;  2HQR A;  4A0Y A;  1IW7 F;  3EQL F;  2KKO A;  3L9F A;  1E2X A;  2P7C B;  1BI3 A;  5ERI A;  2FU4 A;  2F5D A;  2XVC A;  1EH7 A;  3D0S A;  4DNC A;  3F8C A;  5JHU A;  5ICC A;  3W6J B;  2Y75 A;  4UV9 A;  4L0Z B;  1XD7 A;  2KJB A;  4YFX F;  4Q4Z F;  2VON A;  3WTY C;  4R1H A;  1U5T A;  4IHT A;  1XGS A;  2HQN A;  2V9V A;  1UB9 A;  4CIC A;  1L3L A;  4BHB A;  2MC3 A;  3F6V A;  2HFH A;  4LD5 A;  5HVQ C;  1S7O A;  3F8M A;  3SZT A;  1KGS A;  4NQW A;  1X3U A;  2GQQ A;  2EA2 A;  1UHM A;  4EJV A;  3GYH X;  2EK5 A;  2PLY A;  5JR3 A;  3WTZ A;  4WXD A;  3G3Z A;  3E5X A;  4EJT A;  3AAF A;  1D8K A;  4QLC U;  4FHT A;  5E1Z B;  3E6D A;  1T38 A;  1F9N A;  2GIV A;  4AIK A;  2FML A;  5E17 F;  2HS5 A;  5JVT A;  2QBY B;  4WCG A;  2XIG A;  1G3Y A;  3ZMT A;  3F3X A;  1IN8 A;  3P7N A;  5DD8 A;  1Z6R A;  1U3E M;  3DP7 A;  3GZ6 A;  4EM2 A;  5HS9 A;  3VEP A;  2FBK A;  2PEX A;  3QU6 A;  4LLG F;  2OD5 A;  2QVO A;  2QUF A;  3VOD A;  1J7K A;  3IRQ A;  3KP2 A;  5AIQ A;  1W5T A;  2R7F A;  1IRG A;  3U2R A;  3GFM A;  3E5U A;  3F8F A;  1R58 A;  2HR3 A;  3KLN A;  2FOK A;  3S2W A;  2IVM A;  4XLN F;  2VOP A;  4I09 A;  4A2U A;  2CFX A;  2DPD A;  3MCZ A;  4L5J A;  4ENM A;  4Q48 A;  2GAU A;  1Z9C A;  1CGP A;  4HX4 A;  3MAJ A;  3PFI A;  4I0B A;  4KT5 C;  1LJ9 A;  1XSX A;  3DKW A;  5ICG A;  1FWZ A;  2E7W A;  5H6Q A;  1DP7 P;  5IT9 Z;  5FFZ A;  5JI6 A;  4Q5S F;  3TGN A;  1H9T A;  1BC7 C;  1KQ8 A;  3EYI A;  4P5O A;  1R00 A;  4N0B A;  1WQ2 A;  1JGS A;  1P4A A;  2NS0 A;  3LAJ A;  2A6H F;  1KQ9 A;  1RZ4 A;  3RTR A;  1RNL A;  2D1V A;  4G6D A;  1BI1 A;  2VXZ A;  1WI9 A;  1LNW A;  2IW5 A;  1D5V A;  4LK0 F;  4BXU A;  2VBW A;  2FBH A;  1I27 A;  2KIM A;  3J81 K;  3H92 A;  2ZO4 A;  3ULQ B;  4CZZ A;  1CF7 A;  2OQR A;  5DUI A;  4S04 A;  5HDK A;  3GF2 A;  1I1S A;  4RGX A;  1F1Z A;  1XB4 A;  2EFQ A;  1FY7 A;  2H6C A;  4MEY F;  1QZZ A;  2Z33 A;  2V79 A;  4JQF A;  3WTW C;  3ISP A;  4I0A A;  5L3G A;  2CW0 F;  5LGN A;  4BH9 A;  1IXR C;  3I54 A;  3FMS A;  3F21 A;  1HKT A;  3TOA A;  4RGS A;  4ESB A;  4UUV A;  2NRA C;  4JBA A;  3T0Y A;  1RI7 A;  2ZCW A;  3LFK A;  1BI0 A;  1KA8 A;  2HYF A;  2JTV A;  4KN7 X;  4IF4 A;  1K6O A;  4IPA A;  3BP8 A;  2WWY A;  4XRF A;  4U0V A;  1ON1 A;  3QP6 A;  2YX7 A;  1U2W A;  3O3K A;  2FF4 A;  3WG9 A;  4EJU A;  3I59 A;  4QWQ A;  2UWM A;  1Q1H A;  2IJL A;  4KUM A;  2DQR A;  4KIG A;  4RB3 C;  3RIR A;  2WC2 A;  1JE8 A;  2LSO A;  5HDN A;  5CVV A;  3CUQ A;  3DF8 A;  4PCQ A;  1VTN C;  2R7D A;  1AWC A;  4AD9 A;  4N9I A;  1G3S A;  1W7P D;  1TTY A;  2L54 A;  2DU9 A;  2EB7 A;  3DFG A;  3C18 A;  2O6G E;  3DPL C;  4ZYG A;  1G4D A;  2RC4 A;  4LGW A;  1FBQ A;  3SHF A;  4LMY A;  1SFX A;  4H0E A;  4K2E A;  5AON A;  2HDC A;  5E8I A;  5DD4 A;  1UCR A;  4EM1 A;  3TKY A;  3HHH A;  4R8H A;  1P6R A;  2M45 A;  3L00 A;  2VT3 A;  5D6F A;  2FE3 A;  4HDU A;  2WV0 A;  4LJZ F;  2LF7 A;  1K78 B;  3MQ0 A;  2FRH A;  3GO5 A;  4KIB A;  4GYI A;  4MTE A;  4M74 A;  4KNY A;  1Z05 A;  2YU3 A;  2ZFW A;  2LKP A;  3ECO A;  3ABU A;  4LLL A;  4UV8 A;  3KP7 A;  1SD4 A;  1O3R A;  1NHA A;  3L7W A;  3QAH A;  3Q5F A;  3E3V A;  2YSR A;  1C0W A;  4GCV A;  1QZY A;  3F6O A;  2L02 A;  2OAZ A;  1O7L A;  2M8E A;  4WWC A;  1T39 A;  5H20 A;  1RUN A;  4A0Z A;  4I02 A;  2R3S A;  3FHZ A;  4UVC A;  3RKY A;  3BDD A;  3GEZ A;  4A5N A;  1MDM B;  1J2X A;  3LQR A;  1LDJ A;  2EA4 A;  2LNB A;  2XKO A;  2QBY A;  3DQV C;  4I01 A;  4MTD A;  4E70 A;  1FP2 A;  5FO5 A;  2ZKZ A;  3HRU A;  3SXY A;  2QQA A;  1R1T A;  1TQM A;  4M6Y A;  3L09 A;  2H27 A;  1YYV A;  5F6F A;  5ICF A;  4HQM A;  3K1N A;  4NHJ A;  3JTG A;  5D4R A;  2O3F A;  1O3Q A;  1ZAR A;  2DW4 A;  2X0L A;  4I98 B;  5J8C A;  4YFK F;  3GWZ A;  4MQV A;  4U7B A;  4AIH A;  4RB1 A;  4OIQ F;  1PP8 F;  4L18 B;  1FT9 A;  4PDK A;  4EM0 B;  2P6T A;  2JPC A;  4I2O A;  4M71 A;  2ETH A;  3K1P A;  1LEB A;  2P6S A;  4PZJ A;  3DPT A;  1XGO A;  1OKR A;  2GWR A;  4MNU A;  5FGM A;  1G3W A;  3KZZ A;  1SAX A;  5DUK A;  1ZG5 A;  1PDN C;  4JK1 X;  3T8T A;  2GA1 A;  1DDN A;  5HOO A;  4AIJ A;  2ZME B;  2RKH A;  4HAM A;  1JXS A;  5FD6 A;  1YW9 A;  5DYM A;  1TBX A;  1SD5 A;  1EV7 A;  2NYX A;  5CVJ A;  1JHH A;  3WTS C;  4BNC A;  4M72 A;  1G6N A;  2G7H A;  1ZLJ A;  2P4W A;  4RB0 A;  4M9Z A;  3QP5 A;  2NAZ A;  5CYV A;  5BPI A;  3C1D A;  3O6B B;  1T2K A;  3NEU A;  3IWF A;  3ERE D;  4GXO A;  1T0F A;  5BMZ A;  1IRF A;  1T98 A;  4HW0 A;  1P92 A;  2CG4 A;  1YW7 A;  2VOO A;  3U1D A;  1J59 A;  2K7L A;  4HYE A;  1O3T A;  2HTJ A;  5LHH A;  1LDK B;  4P9F A;  3Q9S A;  3FXR A;  3LAP A;  2MLK A;  1YO5 C;  1FOK A;  4A6D A;  3M1E A;  5KK1 A;  1XMA A;  1PUE E;  2XRN A;  2OZU A;  1K7A A;  2VOD A;  2DQL A;  1OYW A;  1I5Z A;  2Q2E A;  1G3T A;  1ZRE A;  3F22 A;  1ZG3 A;  1YLF A;  3IKT A;  2Z5U A;  1S3J A;  3M7G A;  4LLN A;  4FT8 A;  3C3W A;  4G6Q A;  3TO6 A;  2EFN A;  4KMU X;  4U7D A;  2GZW A;  2BYV E;  3GZ5 A;  1OPC A;  3ZQ7 A;  2PMH A;  4LFU A;  2MBF A;  3HTU A;  4YIF A;  2RNJ A;  2A6E F;  5BOX A;  3SZP A;  3QRF F;  2XKP A;  4L9N A;  2O8X A;  2FXA A;  3BJ6 A;  3KLO A;  1GVJ A;  3N4M A;  5LHG A;  3KE2 A;  3WU1 B;  2A68 F;  2ADU A;  2CO5 A;  1QGP A;  2VE9 A;  2O0Y A;  3T8R A;  5D8L B;  5ILV A;  4WX9 A;  3WE2 A;  2NNY A;  1KQ0 A;  4LG0 B;  4RAY A;  2RDP A;  4CDG A;  1H9G A;  5BS6 A;  1KYZ A;  2XGX A;  5DDG A;  1H0M A;  2XAG A;  4G94 A;  2KIU A;  3R4K A;  2DK8 A;  1WWX A;  5ILU A;  3MFK A;  2ACJ A;  2FNA A;  3BPX A;  4UHT A;  2RV8 A;  2V1D A;  3KET A;  4RS8 A;  3K69 A;  4ZH4 F;  4MHG A;  1SMY F;  5EEG A;  4FX0 A;  4CGZ A;  4PGH A;  1K79 A;  3FXU A;  1S8N A;  1YS6 A;  1K78 A;  1BI2 A;  4BHP A;  5LEK A;  3FF5 A;  3HSR A;  3WTT C;  1LEA A;  2JSC A;  3RPQ A;  3JSO A;  3R6S A;  3CUQ C;  5CVI A;  3J80 K;  3K2Z A;  5E18 F;  3FM5 A;  3QPH A;  3E5Q A;  3W6K B;  2MA3 A;  1O3S A;  2PFB A;  3EDP A;  2L4A A;  2G9W A;  3HUG A;  1FNN A;  1O57 A;  3J81 Z;  3EYY A;  5J6X A;  3ML6 A;  3HOS A;  3M8F A;  5D5U B;  1XCV A;  5E1W A;  2EV5 A;  3L2C A;  3GUD A;  1E17 A;  1T6S A;  5DCM B;  5D5X B;  2C6Y A;  3B02 A;  3RYR A;  4GO1 A;  4HA8 A;  5FLX Z;  2DTR A;  1B9N A;  3Q9V A;  2QQB A;  5ED4 A;  4U0Y A;  1FBU A;  5A2Q K;  3V7S A;  2OZ6 A;  5E8G A;  4BHC A;  2A69 F;  4ZYE A;  3LA7 A;  2LDU A;  2EV6 A;  2XAJ A;  1QBJ A;  2CYY A;  4WXH A;  1YFH A;  5IT9 K;  1KU3 A;  4OIN F;  3RYP A;  1I6X A;  1BC8 C;  5JFR A;  4M73 A;  1ZRC A;  1U8R A;  1SD7 A;  1BBY A;  2L3D A;  3JAM Z; 
#chains in the Genus database with same CATH topology
 3LA3 A;  2HI3 A;  2XDV A;  2MLG A;  4KIF A;  3I0T A;  2A5W A;  4F7Z A;  1HSJ A;  3S1M J;  1WJD A;  4RGU A;  1S9H A;  1XCB A;  2ZB9 A;  3DTE A;  4ASN A;  1OYY A;  2R7X A;  4B8X A;  4XRS A;  3G4S I;  2W24 A;  2BVL A;  3HOV J;  1FYK A;  2OF7 A;  2TDX A;  3MEX A;  3V7R A;  2K4J A;  2ZJR F;  1PUF B;  1YRN B;  2LH9 A;  1TNS A;  2EJR A;  1LB2 A;  1JUS A;  1REP C;  5AIP A;  3WGG A;  3OYD A;  3K4K A;  3IL2 A;  1Z3X A;  3K6G A;  2PJR B;  4DOZ A;  5CVR A;  1ZN2 A;  2H6B A;  4C2U A;  3A03 A;  3WTV C;  3BWG A;  3JRA A;  4KN4 X;  2IS4 A;  3BY6 A;  1IN7 A;  3MKL A;  1U5T B;  2E1M B;  5D6E A;  2V9K A;  5K5O A;  2KP6 A;  2DA4 A;  1FC3 A;  2VN2 A;  5KAF C;  3OIP A;  3LWF A;  1UJ8 A;  4X6A J;  2DMU A;  3ABM H;  1ZGA A;  2K9Q A;  3COA C;  1HF0 A;  2KRH A;  2BGC A;  3DU6 A;  4HF0 A;  1TT5 B;  5DEQ A;  5EDN A;  4NDL A;  2Y9Z A;  2ZNZ A;  3GW2 A;  1HBX G;  1EH8 A;  5J8F A;  2HOE A;  4ZTJ A;  1W7P B;  2R7Q A;  3EPZ A;  3E1S A;  5EJC A;  2ZME A;  1D3Y A;  2RVC A;  1VF9 A;  1QNT A;  3M8E A;  1G8X A;  3HC7 A;  4NQW B;  3KCC A;  1FEX A;  4XKV A;  2HPI A;  3NAU A;  1XGN A;  2Y69 H;  4ESF A;  3V4G A;  1R23 A;  1VQM I;  5KVR A;  1ZGJ A;  4Y7N J;  3D5L A;  2ZFU A;  4O5V A;  2CJJ A;  3QYF A;  3H3Z A;  6PAX A;  2MG4 A;  4CCK A;  4MGR A;  2FNP A;  3ZQL A;  4PGG A;  3BZ6 A;  1G59 A;  1QZE A;  5FFX A;  2DXI A;  1DQU A;  2E60 A;  2R4G A;  5TRD A;  3I4P A;  2JZY A;  5EG0 A;  4UVB A;  2HGC A;  1PJR A;  3IC7 A;  3SEZ A;  4UNO A;  3IH4 A;  1AA7 A;  3HPG A;  1D0Z A;  2PMU A;  5LRR A;  1TT0 A;  3S32 A;  1LDD A;  1D5Y A;  2R0Q C;  2DDA A;  2E7X A;  2L0K A;  3HSE A;  1A04 A;  5GAD J;  4OMY A;  1IXS B;  1SFU A;  5TJJ A;  4BDY A;  4XM3 A;  1HW1 A;  2FEZ A;  4ENK A;  4MIM A;  2KFD A;  3RPU A;  1A35 A;  3S16 J;  1F5T A;  3QPL A;  3GTJ J;  4XSZ F;  4DYR A;  2L4M A;  4NNJ A;  3U9G A;  2E1N A;  1TL8 A;  3ABT A;  4RAZ A;  2Q8K A;  3ZN0 A;  3OYH A;  5IP7 J;  2Y0S A;  2IPQ X;  3V8L A;  4P96 A;  5F0H A;  1CQT A;  3H9J A;  3OYN A;  2CRG A;  2DA1 A;  3LL7 A;  1BJA A;  3ZQG A;  2ICW G;  2KHM A;  5F64 A;  1YJN I;  3IRR A;  2KL4 A;  4E7I A;  1FLI A;  4XNF A;  3ONQ A;  1KU7 A;  2FQ3 A;  3IAS 2;  1AHD P;  2BXZ A;  4ENJ A;  4Y15 A;  5TGT A;  4CHU A;  3CDH A;  1FP1 D;  3WGH A;  1QQI A;  2L7Z A;  3OOP A;  5FJ8 J;  4BY7 J;  4CXF A;  2ZXI A;  1Z21 A;  1KON A;  4EV0 A;  2CUF A;  4D7N A;  1ETY A;  2BW3 A;  4L9V A;  4G8X A;  3ZMS A;  2M1B A;  1FX7 A;  3CO7 C;  3PNT A;  1VQL I;  1SVM A;  2M7A A;  5HLH A;  1BN5 A;  1MGT A;  3HJE A;  5C4J J;  3ZPL A;  2ZXJ A;  5L3B A;  1P4W A;  3WE3 A;  1FZP B;  1IDY A;  4HLX A;  5F1R A;  1TQI A;  2J5O A;  3FHN A;  4ZDP A;  2I5U A;  5M3M J;  1OR7 A;  3ABL H;  3SDB A;  5EEA A;  2ESN A;  3M07 A;  2YPR A;  1FMV A;  1ZEL A;  5E20 A;  2COM A;  2DOE A;  3HRS A;  2HKO A;  2Y31 A;  4ETS A;  1YHQ I;  2O8K A;  4AYB N;  2H1K A;  2M4K A;  2E5N A;  2H8W A;  2CQ7 A;  3ERM A;  3IWZ A;  3HIF A;  5K5R A;  4YII A;  2LC2 A;  4G12 A;  2X6X A;  4Y13 A;  3WTX C;  3QOE A;  1X2M A;  2CGP A;  1DU0 A;  2XF6 A;  1U6G A;  4BJ6 C;  3LFU A;  3FX3 A;  1WJF A;  4ZTF A;  4A0X A;  5L3F A;  1EA3 A;  2EWN A;  4FAS D;  4ZDL A;  5J3L A;  5JLW A;  2F5E A;  4EVI A;  3CMY A;  2MH9 A;  2UXX A;  2ECB A;  3RZO J;  1KYW A;  3DTI A;  3I4M J;  2XGD A;  1U9O A;  4IZZ A;  3RI4 A;  3M9A A;  5C3E J;  3PQK A;  3FXQ A;  1J9I A;  4XID A;  3QYE A;  1GXQ A;  2CV2 A;  2K9L A;  2E19 A;  1ZRD A;  5K5Q A;  2K85 A;  3DV8 A;  4RLQ A;  3MKW B;  1NTC A;  2NOJ B;  3K4C A;  4HV6 A;  2VI6 A;  3D5S C;  3E7L A;  4BDZ A;  2CH0 A;  3GLX A;  1V5F A;  4ZZD A;  5M3F J;  2X48 A;  3M1C A;  3MKZ A;  1YS7 A;  5IP9 J;  2DN0 A;  1DGR M;  3X2Q H;  3G6E I;  2F6C A;  2B63 J;  3BOQ A;  1S6L A;  3RCO A;  4XSX F;  1R22 A;  1XG1 A;  2WBM A;  4OIP F;  4AID A;  3PIO F;  1OJL A;  2X6Y A;  5EGO B;  2JUG A;  2P5K A;  1B1B A;  2BY3 A;  2D2W A;  2VIX A;  4A3I J;  1Y1W J;  2HZD A;  2W84 A;  2E36 A;  4P55 A;  2B0L A;  2HXO A;  1D1A A;  3HYI A;  1U78 A;  1LPQ A;  4IRI A;  3ZR8 X;  3BPV A;  1A31 A;  2HOA A;  3FXM A;  3BJO A;  1OIS A;  3DEE A;  1UEL B;  1FSE A;  2PQ8 A;  4ZYH A;  4PSW A;  4QPQ A;  2LP0 A;  4KIT B;  1IUY A;  2DA7 A;  2E1C A;  1VQ9 I;  3HOT A;  2X1E A;  1MBH A;  3HG9 A;  1R36 A;  2K02 A;  4YRV A;  2JVH A;  1STZ A;  2PBI A;  4EJW A;  2ZBK A;  3WG7 H;  3UNG C;  3DTK A;  5IOZ A;  3FXO A;  4BS9 A;  3GCM A;  1Z1D A;  1ZAO A;  2DDB A;  3K1M A;  2VKD A;  2R5Y A;  5CLS A;  3A02 A;  2P7V B;  4QPO A;  1LE8 A;  1V5E A;  2A07 F;  2VT2 A;  1VQP I;  4HG2 A;  2FMY A;  5F04 A;  3RKX A;  1YIO A;  4OOI A;  3ASO H;  5FD5 A;  3I53 A;  3S14 J;  2CW8 A;  3WGI A;  1R71 A;  1ULY A;  2W7N A;  1HQC A;  1I39 A;  5DCM A;  3ZN1 A;  4DJA A;  3OYG A;  4TV7 A;  2W4S A;  4C2T A;  1BJZ A;  4RM2 A;  1D0X A;  3RKQ A;  4D0P A;  2QWW A;  3LSJ A;  4LIU A;  1EF4 A;  3I71 A;  4OMZ A;  1X1C A;  3H1C A;  1IRX A;  3J7A O;  1F36 A;  2MC4 A;  1F4K A;  1BM9 A;  2FJ1 A;  3KZI C;  3DEU A;  3ECH A;  5B66 C;  4KYW A;  1VQN I;  3I5U A;  4PSX A;  4IL6 C;  2VQC A;  2L01 A;  2D45 A;  5B1B H;  2DA2 A;  2PX9 A;  5J47 A;  2CWE A;  3JR9 A;  3C7J A;  2IP2 A;  4IHS A;  1PP7 U;  4EQQ A;  2BXY A;  5J4V A;  4BYY A;  2OCC H;  2JRT A;  1YI2 I;  1BOA A;  3N97 A;  1X1D A;  1HKQ A;  2PN6 A;  3DXJ F;  1OCO H;  4YEL A;  4BKX A;  2DT6 A;  1Z6T A;  1ZTR A;  1P4X A;  4XIC A;  2W85 A;  1JKQ C;  4PJ0 C;  4BGD A;  4IJA A;  1HW5 A;  4FTH A;  3ZMZ A;  4HLY A;  2LKS A;  3HGY A;  2EIJ H;  2E71 A;  3ZMD A;  3BTL A;  3WU0 A;  2JA6 J;  3IV5 A;  3S3N A;  4GGG A;  1OLT A;  1J5Y A;  4A3E J;  1K83 J;  3BQZ A;  3KP3 A;  3EET A;  4EMS A;  2XGE A;  4PJN A;  2R93 J;  2RAE A;  3QPT A;  2WA0 A;  1JHF A;  1P2F A;  1UMQ A;  2RN7 A;  5FKK A;  3CD6 I;  3FMR A;  4HDV A;  3KZY A;  3GX4 X;  2COB A;  5FKM A;  2J5P A;  4AVP A;  4ENN A;  5GAG J;  3P9I A;  3K0L A;  3O8H A;  4HX8 A;  3TO7 A;  2JMW A;  3HSF A;  2VBZ A;  1ZLK A;  2QF7 A;  2Q1Z B;  2HKX A;  2P5V A;  2DMP A;  4UVA A;  3OS2 A;  1YRN A;  2TCT A;  5CQG A;  2K4B A;  2W48 A;  3DLL F;  1SC7 A;  1MJB A;  3P5J A;  3H36 A;  1TWA J;  3BCB A;  3GFI A;  2DAO A;  3VDX A;  2LY9 A;  2FSW A;  2MD5 A;  3PNV A;  1W0U A;  2M7B A;  4UXN A;  4C3J J;  2FX0 A;  1I3Q J;  3GFJ A;  3CCM I;  2LKX A;  3MWM A;  3FK6 A;  1MMN A;  2M34 A;  3V7C A;  1MMG A;  2WAE A;  4BQQ A;  2E2J J;  3V8J A;  2H1L A;  2HZT A;  1OCC H;  1UG0 A;  1V55 H;  1MJ9 A;  2JA8 J;  4DYC A;  3FM3 A;  2CQQ A;  4N9H A;  3JRD A;  2OA4 A;  1W7P A;  2QEN A;  1P7I A;  1X3W B;  2BEO A;  4XOP A;  4HX7 A;  3TQN A;  4CCJ A;  1Z7U A;  2HWV A;  1MSE C;  1WPK A;  1ZQ3 P;  2XPV A;  1TP4 A;  3JRH A;  4PJM A;  2VBY A;  3JSP A;  3PUF A;  1DPU A;  4M9X A;  3F72 A;  2Y9Y A;  4XBF A;  4WF2 A;  1MMS A;  3BR2 A;  4HV5 A;  3W2V A;  3SZG A;  3OSF A;  3NRV A;  5K7Z A;  4A93 J;  1ODD A;  2YR2 A;  3DBH B;  5FKO A;  3PO2 J;  4U87 A;  3TDZ C;  2XC7 A;  3AG4 H;  3ZQC A;  1B6A A;  3G2B A;  5D5W B;  1GHC A;  2A5Y B;  1WJB A;  2I10 A;  3FXL A;  3R0J A;  1X19 A;  4HZF A;  4XOT A;  2QSF X;  5LD2 C;  4CSW A;  2K3P A;  4A6E A;  1D8J A;  2ZNY A;  3TOB A;  4LG3 A;  1ZH5 A;  2DMN A;  2XHK A;  4ZYD A;  4KDP A;  4Y17 A;  5B3S H;  4Q47 A;  2G7U A;  2WTE A;  1FSH A;  2QQ9 A;  2UV1 A;  2P0W A;  4HF2 A;  4B09 A;  3CDL A;  4E7S A;  3F9K A;  3M4O J;  3LSI A;  3CJT B;  3O2P E;  4E7J A;  2K9N A;  2BV6 A;  4BBS J;  3LST A;  3K9T A;  1HA8 A;  3CJQ B;  3J80 Z;  2GXA A;  1TW3 A;  4OIO F;  3ELK A;  3VFZ A;  2KRC A;  1B4A A;  1IAW A;  3H35 A;  3L1P A;  1XDS A;  3CC4 I;  3DKX A;  4M9S A;  2QLZ A;  4G6T B;  5L3E A;  2I8D A;  1HST A;  2F48 A;  1GT0 C;  1IN4 A;  2O9L A;  2XAQ A;  2F5F A;  2Y30 A;  4P1W A;  4WK8 F;  3WTU C;  2ZME C;  1N25 A;  2KZV A;  3LSK A;  2A61 A;  5HDG A;  2LY2 A;  3CJN A;  2DLL A;  3TL4 X;  4BAY A;  4D5F A;  3BJA A;  2F4O B;  3KP5 A;  4DBQ A;  1OMI A;  3R60 A;  2L9R A;  2GLO A;  3I58 A;  3OV8 A;  3ZCO A;  3KEQ A;  1YX5 A;  4Y3O A;  2DPU A;  5ICE A;  3MZY A;  1MBJ A;  4A3J J;  3OSG A;  2L9N A;  2L7F P;  4DQ2 A;  3S3O A;  4MQ9 F;  3T1B A;  3GTK J;  1JTY A;  1USS A;  2KIS A;  3BRO A;  3FXJ A;  2R7R A;  5A2Q Z;  3VYR B;  3VWB A;  3PQJ A;  1V4R A;  2M8G X;  4W1U A;  3ROU A;  1R4M B;  5LGU A;  5JVG F;  3HXL A;  3AG1 H;  2A3S A;  4IO9 F;  1WSU A;  2W25 A;  2JA7 J;  1TNT A;  4RB2 C;  2STT A;  3A2K A;  4FQG A;  2DI3 A;  3C2G A;  4ESJ A;  2LBF B;  2IA1 A;  5JLX A;  1UST A;  5IT3 A;  1L0O C;  1Z7L A;  2GOX B;  1DUX C;  2GXG A;  4KA4 A;  5DM6 F;  3GFL A;  3LQQ A;  1IN5 A;  3LSM A;  3G71 I;  1YTY A;  1A5J A;  5KNL A;  3KP6 A;  2CFO A;  2IA2 A;  3CLQ A;  4M3F A;  4A3K J;  3VB2 A;  4V2G A;  3HTS B;  1MDM A;  2P5L C;  3U1K A;  3CCS I;  3I64 A;  4LIV A;  4NBQ A;  3LA2 A;  3G73 A;  1KU2 A;  1ON2 A;  1R6R A;  2Q0O A;  5CVU A;  1OCZ H;  2K86 A;  1WJE A;  4L9J A;  4LIT A;  1YE9 A;  3GXO A;  5GP9 A;  3WOD F;  2JWT A;  1R7J A;  3MN2 A;  1E0E A;  2VKH A;  4A3C J;  3GTL J;  2CQN A;  1XSV A;  2E35 A;  2M3A A;  4NB5 A;  2BHZ A;  3CUO A;  2ISZ A;  3K4N A;  5FRN A;  1HKS A;  3JRF A;  4FET A;  4IHX A;  5C44 J;  3QU3 A;  5LBQ A;  2R7V A;  4II2 A;  3IAM 2;  3ZOB A;  1TWH J;  1J0R A;  3CZ6 A;  2X51 A;  1YOV B;  1Y1V J;  3PJR A;  1IRZ A;  2NNN A;  4U0W A;  5K1Y A;  4CUG A;  1IF1 A;  5F0C A;  2K27 A;  5J40 A;  1IN6 A;  4A3G J;  1BW6 A;  1R5G A;  2O03 A;  1XN7 A;  1RR7 A;  1W4M A;  2FBI A;  3HBL A;  1MD0 A;  3E0J B;  4MEX F;  4BBR J;  1V54 H;  1ZRF A;  1R1V A;  3ZQH A;  4EGY A;  3QWL A;  3NQO A;  4IOC F;  5LHI A;  2LK2 A;  3PUB A;  5HNH A;  1OFC X;  5FRO A;  1MZB A;  5D5V B;  4I76 A;  1E3P A;  2VC1 A;  5FLX K;  5EGO A;  2DMQ A;  2ZXH A;  1OR7 C;  1QVT A;  2JT1 A;  2K9S A;  2VL8 A;  4ZJZ A;  1N77 A;  2OC6 A;  1BR2 A;  2MSY A;  5D4S A;  1MH4 A;  5E1X A;  2O61 A;  2VXD A;  3OYA A;  2HTS A;  4E7K A;  1FTT A;  2AXL A;  2HOT A;  3JTH A;  3LSH A;  2M2E A;  4M6X A;  1TW2 A;  2L5Q A;  3OY9 A;  3M8J A;  3K4B A;  4C3H J;  2Q2E B;  2D5V A;  3FKJ A;  1T33 A;  2YX4 A;  1V3F A;  3P9C A;  3TDU C;  5GTH C;  4JYK A;  1ZYR F;  3L2Q A;  4I7H A;  2ISY A;  1FYL A;  2V7F A;  1XSD A;  5EEH A;  2IGN A;  1OCT C;  4CA0 A;  3JRE A;  2CQK A;  2ELH A;  3SJM A;  3MKY B;  1X1B A;  1KU9 A;  2X4H A;  3JW4 A;  2DBB A;  1JJ6 C;  1XMK A;  4Z2Y A;  3Q0V A;  1YQA A;  3OS1 A;  2GA2 A;  2HYG D;  5B1A H;  4G9Y A;  3H9Q A;  1YG2 A;  4LK1 F;  5GTI C;  1U0J A;  3SQN A;  4JP0 A;  3JAM K;  5E3O A;  2AXT C;  1OYI A;  2JA2 A;  1RIO H;  4CH7 A;  1WKM A;  5LRS A;  4S05 A;  3HDD A;  2XAF A;  2QKM B;  4KIC A;  2L7M P;  1J09 A;  2WY7 Q;  3REO A;  3RQ4 A;  2Z3Y A;  3CC2 I;  1GXP A;  4S0H B;  4YIR X;  3CO6 C;  2M87 A;  3E6M A;  1LVA A;  3SYT A;  2JPB A;  4IEJ A;  2PI0 A;  3QOP A;  4L9T A;  3IH2 A;  3K4M A;  1LQ1 A;  2M0M A;  3GTG J;  2EZI A;  4PUS A;  3OR2 C;  1HXD A;  1FYM A;  2HEO A;  3G1M A;  2WAF A;  4UB8 C;  5LLQ A;  3SEQ A;  1UHS A;  2CSO A;  2OQG A;  3V8K A;  3H0G J;  2VC0 A;  4O3M A;  3CLO A;  3KFW X;  2V1X A;  2DMT A;  1YW8 A;  2EFW A;  1MND A;  1P7J A;  4RGR A;  2RRE A;  1B8I A;  3FXK A;  2ZJ2 A;  4IHY A;  4U88 A;  2IRF G;  5LEJ A;  9ANT A;  5GAH J;  3JRI A;  2Y0S N;  2BE5 F;  2QYO A;  2XAH A;  1IV6 A;  5LFA A;  3HHG A;  2FOW A;  1TQP A;  4PFO A;  3DEW A;  3DBL B;  1Y39 A;  2DFH A;  3SFZ A;  1TLH B;  1SD6 A;  5HLI A;  4E4H A;  1YIJ I;  3IKV A;  5HS7 A;  1ZKG A;  2G0E A;  1ZK8 A;  5HOD A;  2AS5 F;  2XAS A;  2Y0M A;  4B4C A;  2VJI A;  3RDI A;  3FWE A;  1MJA A;  2NVQ J;  2P8T A;  1VFC A;  5M5X J;  3AL0 B;  3K7A J;  2LTP A;  2W57 A;  1DP3 A;  2ESH A;  1K4T A;  2QM3 A;  2HVS A;  4HEA 2;  4MLO A;  1QO0 D;  3WHC A;  1YJ9 I;  3C2B A;  3OL3 A;  4IQJ A;  1GLN A;  2XUB A;  4XLF A;  4YFN F;  3ZMV A;  1SFE A;  1XGM A;  2RQP A;  3IUO A;  3E6C C;  1HOM A;  2IT0 A;  2PMZ N;  3MZH A;  4G7O F;  2IGO A;  3I9V 2;  2IS2 A;  2ID6 A;  3VOE A;  3HOU J;  2LOO A;  3I3L A;  3S1N J;  2MD0 A;  2VJ5 A;  3LOC A;  5HNF A;  5CJ9 A;  1SVL A;  2X1D A;  4LB6 B;  2VE8 A;  4KIS A;  3PM1 A;  5H2F C;  2EV0 A;  4Y4R A;  2EFP A;  3KYD B;  3UKG A;  3ABK H;  1X2N A;  3PNY A;  2DFF A;  3F8N A;  2EIN H;  3BCA A;  3U21 A;  1NK2 P;  4IXA A;  2VBX A;  4QSH A;  2PG4 A;  3OYK A;  2STW A;  2ECC A;  2Z99 A;  1W1W E;  2F4M B;  4D1Q A;  1SFK A;  1R1U A;  2IEK A;  2L2O A;  4GYG A;  1UHW A;  3KEO A;  3FBN B;  4OIR F;  3TMO A;  2JQ7 A;  2OBP A;  4G7H F;  1RUO A;  2R7U A;  1GUU A;  4OU0 A;  1SMT A;  2V6C A;  2IA0 A;  4UB6 C;  1T08 B;  5HS8 A;  3HUG B;  3K70 C;  3VYU B;  4HOB A;  2PJP A;  2Z9O A;  2JN6 A;  4HPQ A;  3R61 A;  1ZG1 A;  1HLV A;  3E97 A;  4J19 A;  1SAU A;  4LB5 A;  1VQ7 I;  2KPM A;  2EPF A;  2XGC A;  4M3E A;  5K7H A;  2VJJ A;  4IRH A;  5D8K B;  4LG0 A;  1HW2 A;  4EJO A;  2VPR A;  5IYB J;  4CYC A;  2CV1 A;  2H09 A;  1AOY A;  1R5H A;  4ON0 A;  3CF5 F;  2Y48 A;  3TW6 A;  4BU2 A;  4FX4 A;  3J7Y J;  3RQI A;  3P9K A;  1Z91 A;  3B73 A;  4IHW A;  2F2E A;  1LKX A;  2L7K A;  2WAQ A;  2EQR A;  3E6B A;  3HRM A;  4AYB A;  1O7F A;  2DA5 A;  3DKY A;  1S5L C;  3T5X A;  4KFC A;  3L2W A;  2DJI A;  2X9D A;  5L3C A;  3F0C A;  2KJC A;  4MFD A;  5HLG A;  2VUM J;  4IVN A;  2M5W A;  1Y0U A;  4F92 B;  4Y52 J;  1FPQ A;  5LGT A;  1B72 B;  5F1J A;  1JJ8 C;  1CF7 B;  5H6R A;  5E3L A;  4HBL A;  1IXC A;  2E5Z A;  1I1G A;  3H3U A;  1JT0 A;  2EZL A;  1U5T C;  1X4P A;  2E1M C;  3FZV A;  4KJZ A;  2F5C A;  5DCF A;  4L5E A;  5FB2 A;  1QRY A;  3L2V A;  1MKM A;  3KYL A;  3RJP A;  4PK4 A;  1OCR H;  2QCO A;  5L3D A;  1S29 A;  4YG2 F;  4J00 A;  1ETQ A;  2BZT A;  2UZK A;  1IZ1 A;  1QPM A;  2DT5 A;  3ZP5 A;  3ZXS A;  1UAA A;  4DBR A;  3CCR I;  2ZSH B;  1WCM J;  3GZN B;  3ZMU A;  4KMF A;  2DK5 A;  3KX2 A;  2KIF A;  2RGV A;  3OYF A;  1DPR A;  4L5I A;  1UFM A;  5DV5 A;  2FQ4 A;  3FBI B;  4IRG A;  1B9M A;  4O6J A;  2OU2 A;  3R0A A;  2HQA A;  5BPD A;  3FMQ A;  2FD5 A;  1ONV A;  2HU9 A;  4E6K G;  3OIO A;  3F23 A;  3CF2 A;  1LFB A;  2LRD A;  2MW8 A;  4M6V A;  4AU7 A;  2GXB A;  4XLE A;  3RKW A;  2A6T A;  2UUZ A;  4XLP F;  4P9U A;  1W5S A;  1JKP C;  4UUS B;  3JRG A;  4W97 A;  3HKZ A;  4NC7 A;  2MH2 A;  4XLH A;  2NS8 A;  4BJT A;  1N75 A;  1SAN A;  3F8B A;  4BE1 A;  4CYD A;  4FE7 A;  2FA5 A;  4M3D A;  4B1R A;  4JX4 A;  2DTZ A;  2XV4 S;  5BQT A;  3A0H C;  2YS9 A;  4L0Y B;  1H89 C;  2LBF A;  3SFI A;  3GTO J;  2DO7 A;  3HRT A;  2VPL A;  4X0G A;  4EGZ A;  3GTP J;  2H94 A;  1FBS A;  2WV1 A;  2XRO A;  1WVR A;  4FCY A;  5ILS A;  2NS7 A;  2BBY A;  3I59 B;  3SDG A;  1XDU A;  2LG4 A;  2XB0 X;  2M30 A;  4D5C A;  2KRF A;  4C9Y A;  2D1H A;  4R79 A;  2LD5 A;  1J75 A;  2X6W A;  3BQY A;  4CZC A;  1EH6 A;  1TWC J;  2DOD A;  3CME I;  4RLF A;  1WRJ A;  3CUQ B;  2BHY A;  1ZHF A;  3ASN H;  3KP4 A;  2LF8 A;  4WXC A;  1AKH B;  4BE2 A;  1A6Q A;  4A5M A;  2EFO A;  3EUH A;  3GVA A;  3FIS A;  3IHU A;  1BIB A;  2OTJ I;  2V1U A;  3GME A;  3MD2 A;  5TIS C;  4A12 A;  5CQE A;  3PSI A;  1XMX A;  1YX3 A;  1ACI A;  1S7A A;  2CUJ A;  3CTA A;  5GPA A;  1GDT A;  4OAZ A;  4AWX B;  4G7Z F;  5EG0 B;  1GV5 A;  1T8I A;  2ZC2 A;  3CMM A;  4HQE A;  2NOG A;  3PL8 A;  2DFI A;  1BIA A;  3H5R A;  5GAE J;  2QZ8 A;  2EBI A;  1B59 A;  3K4J A;  2R7O A;  3TO9 A;  4ZZL A;  3GTM J;  1I50 J;  2UXN A;  3VSK A;  4HF1 A;  4CO8 A;  4BQA A;  2HQR A;  4A0Y A;  1IW7 F;  3EQL F;  2IS6 A;  4XK4 A;  2KKO A;  3L9F A;  1E2X A;  5HLT A;  3TP3 A;  3J7Z I;  2IS1 A;  1VQ5 I;  3EUA A;  3K4L A;  2P7C B;  1BI3 A;  5ERI A;  2FU4 A;  4XRM A;  2F5D A;  2XVC A;  1RR8 C;  1EH7 A;  2MFZ A;  2LVS A;  3D0S A;  3F8C A;  4DNC A;  5JHU A;  5ICC A;  3Q0U A;  2Y75 A;  3W6J B;  1PUF A;  4UV9 A;  4L0Z B;  1XD7 A;  2KJB A;  2PJR A;  2BY1 A;  2HYJ A;  4YFX F;  2ZJQ F;  3VPR A;  2EH3 A;  2DT7 B;  3IP4 B;  2XB5 A;  4N4N B;  4Q4Z F;  1K4S A;  2VON A;  3WTY C;  2KZG A;  2YUS A;  1H8A C;  4F91 B;  3RPU D;  4R1H A;  1U5T A;  1Z67 A;  2QKL B;  4F55 A;  3BTJ A;  1XGS A;  2VB6 A;  4IHT A;  2HQN A;  2V9V A;  1FMW A;  3OYE A;  3BR5 A;  1FIP A;  1UB9 A;  2XF5 A;  4CIC A;  2ZSI B;  1L3L A;  3B6C A;  3OR1 C;  1ETX A;  4BHB A;  4A3F J;  1P9Q C;  2MC3 A;  5IP6 A;  3F6V A;  2HFH A;  1Z0X A;  4LD5 A;  4XR6 A;  2KT0 A;  5HVQ C;  1R4N B;  1S7O A;  3F8M A;  3SZT A;  4AVZ A;  3Q3S A;  1NH3 A;  2BW3 B;  2LLK A;  1KGS A;  4NQW A;  5F08 A;  4XRS G;  1X3U A;  2GQQ A;  2DOF A;  2EA2 A;  1UHM A;  2XF7 A;  3MVP A;  4EJV A;  2JA5 J;  3GYH X;  2EK5 A;  2PLY A;  1X1A A;  1HDP A;  5JR3 A;  3WTZ A;  4WXD A;  4GRI A;  3G3Z A;  4ANJ A;  3E5X A;  4EJT A;  2CUZ A;  3AAF A;  3OOU A;  3BLY A;  3J7A Y;  1U9N A;  1D8K A;  3S1R J;  1QU3 A;  2BOL A;  4QLC U;  5FKL A;  3AG3 H;  4FHT A;  5E1Z B;  2VJ4 A;  3E6D A;  3S3M A;  1T38 A;  1F9N A;  2GIV A;  4AIK A;  2FML A;  5E17 F;  2HS5 A;  1MMA A;  5JVT A;  3H0D A;  2QBY B;  2EIL H;  4WCG A;  2XIG A;  2RNG A;  4MFE A;  1G3Y A;  3ZMT A;  3F3X A;  3BG7 A;  1IN8 A;  2H8R A;  3P7N A;  2AQF A;  3DBR B;  5DD8 A;  1Z6R A;  1U3E M;  3KYC B;  1JT6 A;  2JVG A;  3DP7 A;  5CPR B;  3GZ6 A;  2CQX A;  4EM2 A;  2QSH X;  3BR0 A;  2JSP A;  5HS9 A;  3VEP A;  2FBK A;  2PEX A;  3QU6 A;  4LLG F;  4BXF A;  2OD5 A;  2QVO A;  4HNT A;  2QUF A;  4RM3 A;  3VOD A;  3NWT A;  1RRJ A;  2L9V A;  2R7Z J;  1W0T A;  1J7K A;  3CC7 I;  3IRQ A;  1D1B A;  4HNV A;  2R7S A;  3LMM A;  3KP2 A;  5AIQ A;  1W5T A;  2R7F A;  1IRG A;  3U2R A;  3GFM A;  4DIQ A;  3E5U A;  3F8F A;  2AQE A;  1Y56 A;  3CCL I;  1R58 A;  3KEY A;  5B5E C;  2HR3 A;  3KLN A;  2FOK A;  3S2W A;  2IVM A;  4XLN F;  4H4K C;  2VOP A;  4I09 A;  4A2U A;  2CFX A;  2DPD A;  1DU6 A;  4GDF A;  5J1Y A;  2R7T A;  3VSL A;  3MCZ A;  4L5J A;  4ENM A;  2DJN A;  2M0C A;  4Q48 A;  2GAU A;  1R5I D;  1Z9C A;  1XPX A;  1CGP A;  4HX4 A;  3MAJ A;  3PFI A;  4I0B A;  4KT5 C;  3HPH A;  1LJ9 A;  3LSP A;  4E7L A;  1XSX A;  3DKW A;  2M4G A;  2V4J C;  5ICG A;  1FOW A;  1FWZ A;  3BG9 A;  1IDZ A;  3W2A A;  1W36 C;  1VQ6 I;  2X85 A;  4II3 A;  2E7W A;  1T56 A;  5H6Q A;  2VLA A;  4E7Z A;  3PO3 J;  2K9M A;  3D5R C;  3OMY A;  4B48 A;  1DP7 P;  5IT9 Z;  5FFZ A;  5JI6 A;  4Q5S F;  2OUM A;  4JX5 A;  1JTX A;  3TGN A;  1H9T A;  3DCF A;  1BC7 C;  3OYC A;  1KQ8 A;  3EYI A;  3NWS A;  1ERD A;  4P5O A;  1ETW A;  1R00 A;  4N0B A;  4RAF A;  1E3O C;  1WQ2 A;  2Y2Z A;  3H3V K;  1LE8 B;  2RQQ A;  1JGS A;  1M1E B;  1P4A A;  2AO9 A;  1A6I A;  2NS0 A;  1LFP A;  3LAJ A;  2WB1 N;  4ABZ A;  1D0Y A;  2A6H F;  1ETV A;  5M5W J;  4HRI A;  1KQ9 A;  4XON A;  1RZ4 A;  1MNE A;  3L2U A;  1D1C A;  1IO2 A;  3QOD A;  3RTR A;  1RNL A;  1VZ0 A;  2D1V A;  4G6D A;  1QVU A;  1WFX A;  1BI1 A;  3TW7 A;  2A05 A;  2VXZ A;  2BY2 A;  1WI9 A;  1OQY A;  3S2D J;  1LNW A;  3CES A;  2IW5 A;  1D5V A;  4LK0 F;  4DW6 A;  4BXU A;  2VBW A;  1ORK A;  2FBH A;  1I27 A;  5FLV A;  2KIM A;  3J81 K;  3H92 A;  2ZO4 A;  1B72 A;  5F27 A;  3ULQ B;  4CZZ A;  1JUP A;  1CF7 A;  4XKB A;  2OQR A;  1MIJ A;  5DUI A;  4S04 A;  4HNU A;  2CMP A;  5HDK A;  1NK3 P;  2IBD A;  3WU2 C;  3GF2 A;  1JKO C;  1I1S A;  1BW5 A;  1FOX A;  4RGX A;  1HC8 A;  1F1Z A;  1XB4 A;  2B9S A;  2EFQ A;  3BR1 A;  1FY7 A;  2H6C A;  4MEY F;  1QZZ A;  2Z33 A;  3OYM A;  2NVU B;  1TWF J;  2ID3 A;  2V79 A;  1ENH A;  4JQF A;  3WTW C;  3ISP A;  4I0A A;  5L3G A;  2CW0 F;  5LGN A;  3A1Y A;  4BH9 A;  5DS9 A;  1IXR C;  2JK3 A;  3I54 A;  2GOM A;  3FMS A;  3K70 D;  2E34 A;  2DA6 A;  1ETO A;  3F21 A;  1HKT A;  1EJ9 A;  3TOA A;  4CCN A;  3BTI A;  4RGS A;  4FE4 A;  3BG5 A;  4ESB A;  3HOW J;  2XAU A;  4UUV A;  3BT9 A;  2NRA C;  1K6Y A;  3CP8 A;  4UUS A;  3B6A A;  4JBA A;  3T0Y A;  1RI7 A;  4QIW N;  2ZCW A;  3LFK A;  1XTA A;  1BI0 A;  5IY5 H;  1KA8 A;  1UG2 A;  2HYF A;  3Q0W A;  1SEU A;  2R5Z B;  2GM4 A;  2LFB A;  3A01 B;  1ZR4 A;  2JTV A;  4KN7 X;  2KDZ A;  4IF4 A;  2HDW A;  1K6O A;  1YIT I;  4IPA A;  3BP8 A;  2WWY A;  3VYT B;  1LVK A;  4PJJ A;  1MBK A;  4XRF A;  5DM7 F;  3HL2 A;  4U0V A;  1ON1 A;  3NAR A;  3QP6 A;  2YX7 A;  4XLC A;  1U2W A;  3O3K A;  2FF4 A;  3WG9 A;  4EJU A;  1UZC A;  3I59 A;  2BVM A;  4QWQ A;  2UWM A;  1Q1H A;  2IJL A;  2KIQ A;  2DQR A;  4KUM A;  4KIG A;  1FTZ A;  3RZD J;  2W1O A;  3BG6 A;  3I4N J;  1VND A;  4M3G A;  2HNH A;  4RB3 C;  3RIR A;  2WC2 A;  1JE8 A;  2DCE A;  1WZ2 A;  4IOA F;  2LSO A;  5HDN A;  2QQ8 A;  5CVV A;  3CUQ A;  3DF8 A;  4PCQ A;  2HXI A;  1VTN C;  1AKH A;  2GIZ A;  1NG6 A;  2OPT A;  2R7D A;  4AD9 A;  1ZGW A;  4N9I A;  1AWC A;  2P81 A;  1G3S A;  1W7P D;  4F52 A;  2L54 A;  1TTY A;  2OCE A;  2DU9 A;  3K2A A;  4DZP A;  2EB7 A;  4M3B A;  5JHF A;  1RKW A;  5GPC A;  3BR6 A;  2Z2S B;  3DFG A;  3C18 A;  3MZ8 A;  2IAI A;  2LRE A;  2O6G E;  3DPL C;  4ZYG A;  1MSF C;  3UR3 C;  1G4D A;  4JX6 A;  2RC4 A;  4LGW A;  1FBQ A;  4XN3 A;  3SHF A;  3LSR A;  3HM5 A;  1O4X A;  1X3Z B;  4LMY A;  1SFX A;  2ME6 A;  4IX7 A;  3HGG A;  4H0E A;  5J4Y A;  4J01 A;  1RES A;  4NUB A;  4K2E A;  5AON A;  2HDC A;  5E8I A;  4EEF G;  5DD4 A;  5FRM A;  4QTR A;  1OCP A;  1UCR A;  4RAG A;  4EM1 A;  3TKY A;  5EZH A;  3W2W A;  1QA6 A;  3HHH A;  3L2R A;  4R8H A;  1P6R A;  1KZH A;  2M45 A;  3L00 A;  2VT3 A;  5D6F A;  3GBG A;  2FE3 A;  3LNQ A;  3I55 I;  2QGU A;  4HDU A;  1VQ8 I;  1MH3 A;  3CQZ J;  2WV0 A;  4LJZ F;  2LF7 A;  1K78 B;  3MQ0 A;  2FRH A;  4BQO A;  3GO5 A;  4KIB A;  2N8G A;  4GYI A;  4MTE A;  4B44 A;  4BEH B;  5J1R A;  4M74 A;  1K61 A;  3OYL A;  4A3D J;  4KNY A;  1Z05 A;  2YU3 A;  2ZFW A;  2LKP A;  3ECO A;  3ABU A;  3PIP F;  4LLL A;  4UV8 A;  3KP7 A;  1SD4 A;  1O3R A;  3BC8 A;  3FDY A;  1NHA A;  1IG7 A;  3EUH C;  2HDD A;  2KQR A;  3L7W A;  3QAH A;  1MNM C;  3Q5F A;  2CU7 A;  3DPU A;  3E3V A;  2YSR A;  2ZJP F;  1C0W A;  4GCV A;  1QZY A;  3F6O A;  2L02 A;  2OAZ A;  1VQ4 I;  1O7L A;  2K40 A;  2M8E A;  4WWC A;  2IGM A;  5IYD J;  3QYB A;  3G1O A;  1T39 A;  3CCQ I;  4PJL A;  1ETK A;  5H20 A;  1RUN A;  4A0Z A;  3OL4 A;  2PMZ A;  1T0F C;  2L9S A;  3A0B C;  3KPH A;  3H5N A;  4I02 A;  2CW7 A;  1FIA A;  2R3S A;  2WAQ N;  4CCO A;  4UVC A;  3FHZ A;  1JKR C;  3RKY A;  3BDD A;  4B3A A;  3GEZ A;  4A5N A;  4D7M A;  2DOA A;  1MDM B;  1MMD A;  1RKT A;  1J2X A;  1RC9 A;  3RSN A;  3S15 J;  3LQR A;  1LDJ A;  2EA4 A;  1WJC A;  2LNB A;  2XKO A;  2QBY A;  3DQV C;  3N05 A;  4I01 A;  4MTD A;  4E70 A;  1FP2 A;  3DU5 A;  5FO5 A;  2ZKZ A;  3HRU A;  1E3H A;  3SXY A;  5F0F A;  3CCY A;  2QQA A;  1R1T A;  1TQM A;  3LSG A;  1W5C C;  1Y0N A;  4M6Y A;  1FJL A;  4OWR B;  2ZXW H;  1AU7 A;  4I99 C;  3I56 I;  1R49 A;  3L09 A;  2H27 A;  1YYV A;  5F6F A;  5ICF A;  1SVO A;  4HQM A;  3GLL A;  3K1N A;  4NHJ A;  3JTG A;  5J1U A;  5D4R A;  2O3F A;  1O3Q A;  2WY8 Q;  1ZAR A;  2ELJ A;  4UUT A;  4CCL A;  1Q1V A;  2DW4 A;  2X0L A;  4I98 B;  5J8C A;  4DGW B;  4YFK F;  3GWZ A;  4X1E A;  4MQV A;  4B3X A;  4U7B A;  4AIH A;  1G2H A;  4RB1 A;  3CCV I;  4BXX J;  4OIQ F;  3ZQQ A;  1PP8 F;  5EZG A;  3WHB A;  1R9T J;  5C4X J;  4L18 B;  1FT9 A;  4PDK A;  1I3A A;  4EM0 B;  3HKZ N;  2P6T A;  3MMY B;  1TZL A;  2JPC A;  2LR8 A;  4OAY A;  4I2O A;  4M71 A;  2ETH A;  3K1P A;  1LEB A;  2P6S A;  4PZJ A;  3DPT A;  2X1C A;  1ZR2 A;  1XGO A;  1OKR A;  1VI0 A;  2KLO A;  5FLM J;  2R7W A;  1WH5 A;  2OV7 A;  3BZK A;  4ZC3 A;  2KMU A;  2GWR A;  4MNU A;  5FGM A;  1G3W A;  5IPA A;  3KZZ A;  2W00 A;  1SAX A;  1I6H J;  2DYR H;  1RET A;  1Y8R B;  5DUK A;  1VQK I;  1ZG5 A;  1PDN C;  4JK1 X;  2ME0 A;  5E3N A;  3OS0 A;  3T8T A;  4XL9 A;  4Y33 A;  2X6O A;  2GA1 A;  1DDN A;  5HOO A;  1PVE A;  4RDU A;  3S1Q J;  3OYJ A;  4AIJ A;  4CCM A;  2JJ7 A;  1BOB A;  2RKH A;  2ZME B;  3HOZ J;  1IV8 A;  4HAM A;  1JXS A;  3FIW A;  2XPW A;  5FD6 A;  1MBG A;  1YW9 A;  4V2F A;  5DYM A;  1TBX A;  5IOY A;  4XLA A;  1SD5 A;  1EV7 A;  2NYX A;  3O8G A;  1JHH A;  4NC8 A;  5CVJ A;  3ZRG A;  2DFE A;  3WTS C;  1U8B A;  4BNC A;  4M72 A;  3H5A A;  1G6N A;  2G7H A;  2F4I A;  1ZLJ A;  4XOR A;  4F3Q A;  2O5R A;  2P4W A;  4RB0 A;  4JOM A;  4ITV A;  4M9Z A;  1HDD C;  3QP5 A;  2XSD C;  2NAZ A;  2ELK A;  4FIS A;  5CYV A;  5BPI A;  2VQG A;  3C1D A;  3AL0 C;  2E2H J;  3O6B B;  1T2K A;  3CCE I;  3NEU A;  4A3B J;  2HOS A;  1XC5 A;  3OYB A;  3IWF A;  3ERE D;  2V9P A;  2GBY A;  4MO7 A;  4GXO A;  1T0F A;  5BMZ A;  1IRF A;  1T98 A;  4HW0 A;  1P92 A;  2O7O A;  2CG4 A;  2OJE D;  3EUK L;  4XKW A;  3HOX J;  1YW7 A;  2VOO A;  3U1D A;  1J59 A;  4BJ5 C;  1B8I B;  2K7L A;  4F93 B;  4HYE A;  1O3T A;  3DLA A;  3CDI A;  2HTJ A;  5LHH A;  5KHD A;  1W36 D;  2QEX I;  1LDK B;  3OIQ A;  4P9F A;  1WH7 A;  3Q9S A;  3ZGK A;  2W82 A;  3BG3 A;  3FXR A;  3LAP A;  2MLK A;  1YO5 C;  1FOK A;  4A6D A;  4RBO A;  3M1E A;  5KK1 A;  2QA4 I;  1Y6I A;  2IGK A;  4KT6 A;  1XMA A;  2EIK H;  4IHV A;  2NVY J;  1PUE E;  2XRN A;  2OZU A;  4BQN A;  1K7A A;  2CS3 A;  4Z6Y A;  2VOD A;  5E79 C;  1SFO J;  2DQL A;  5KAI C;  1OYW A;  3HZJ A;  1I5Z A;  4AM3 A;  2Q2E A;  1G3T A;  1T95 A;  3BTC A;  5K7F A;  2QSG X;  1ZRE A;  3F22 A;  2VQH A;  4YEJ A;  1ZG3 A;  2CUE A;  3ESW B;  4XMY A;  1YLF A;  1LFU P;  1WGX A;  1BL0 A;  3IKT A;  2K3F A;  2TRT A;  2Z5U A;  3GTQ J;  3G1L A;  1S3J A;  3JRB A;  1QHH D;  4E7H A;  3M7G A;  4LLN A;  4FT8 A;  1LUJ B;  3C3W A;  1APL C;  3PFY A;  4G6Q A;  3TO6 A;  4RA2 A;  4BAC A;  2EFN A;  3BR3 A;  4KMU X;  3PSF A;  2R5Z A;  4U7D A;  3A01 A;  1MBE A;  4AUX A;  4EAT A;  1BR4 A;  2GZW A;  2NVX J;  2MAB A;  2BYV E;  2FUG 2;  3GZ5 A;  2HVR A;  1OPC A;  2V26 A;  2PMH A;  3TP0 A;  3ZQ7 A;  4LFU A;  4A3L J;  3VYS B;  2MBF A;  1BA5 A;  1X58 A;  3HTU A;  4YIF A;  2RNJ A;  2A6E F;  5BOX A;  2Z1D A;  2NXN B;  1IJW C;  3SZP A;  3QRF F;  2V6E A;  2E1O A;  2XKP A;  5IYC J;  4L9N A;  2O8X A;  1POG A;  2NVT J;  4A69 C;  1WHU A;  2FXA A;  1V5G A;  3BJ6 A;  2VAS A;  3KLO A;  3TED A;  3KIO A;  1GVJ A;  5M5Y J;  3N4M A;  5LHG A;  3KE2 A;  3C2H A;  2A68 F;  3WU1 B;  4XN0 A;  2EZK A;  3M3Y J;  5E3M A;  4BE0 A;  2ADU A;  1WJA A;  2CO5 A;  1QGP A;  2V1N A;  2VE9 A;  4DZJ A;  1Z77 A;  4IKF A;  2O0Y A;  3OWT A;  1ITY A;  1IC8 A;  3IH3 A;  3JCU C;  3T8R A;  5D8L B;  5ILV A;  4WX9 A;  3FK7 A;  1FOY A;  4XQF A;  3WE2 A;  2NNY A;  1KQ0 A;  1WJ5 A;  4LG0 B;  2HQ5 A;  4RAY A;  4CYC B;  4D9J A;  2RDP A;  1EKE A;  4CDG A;  2KDO A;  2VKV A;  5CKT A;  1H9G A;  2LMD A;  1GV2 A;  5BS6 A;  3AFH A;  1KYZ A;  2XGX A;  5DDG A;  1Y8Q B;  1H0M A;  2Z16 A;  2XAG A;  4G94 A;  2KIU A;  1X1P A;  1DGW Y;  1VQO I;  3R4K A;  4N4O B;  2DK8 A;  1WWX A;  5ILU A;  4HST A;  2B7E A;  3MFK A;  2ACJ A;  2FNA A;  1F43 A;  3BPX A;  4UHT A;  3TBI A;  2RV8 A;  2V1D A;  3KET A;  4RS8 A;  3K69 A;  4ZH4 F;  2MGQ A;  4MHG A;  4V19 K;  1N78 A;  4AC0 A;  1MBF A;  1SMY F;  2JUC A;  5EEG A;  4FX0 A;  3CCJ I;  4GFB A;  3CCU I;  4CGZ A;  4C3I J;  4PGH A;  1K79 A;  3FXU A;  3S8P A;  3W6V A;  1S8N A;  3W3C A;  4C2M J;  1YS6 A;  4NC6 A;  5KCM A;  1K78 A;  3S17 J;  3AG2 H;  1BI2 A;  4BHP A;  5LEK A;  3QPS A;  3FF5 A;  3HSR A;  4BEH A;  3WTT C;  1JGG A;  1LEA A;  1TWG J;  1IUF A;  1H88 C;  2XPU A;  2JSC A;  3HEF A;  3RPQ A;  3JSO A;  4I6Z A;  1S72 I;  3D1N I;  1YJW I;  2E2I J;  3R6S A;  3CUQ C;  2OTL I;  5CVI A;  1X4O A;  3J80 K;  3K2Z A;  5E18 F;  3FM5 A;  3QPH A;  4C30 A;  1XS9 A;  2CV0 A;  3E5Q A;  4DYQ A;  3K10 A;  3W6K B;  3CP2 A;  2MA3 A;  2EIM H;  3HB9 A;  1O3S A;  1A36 A;  2PFB A;  2XSJ C;  3FKI J;  3EDP A;  3HOY J;  2L4A A;  2R5Y B;  4ZDO A;  3A4C A;  3ZQF A;  1QPI A;  1Z3Y A;  1JUM A;  1IGN A;  5BNG A;  1BR1 A;  2EZH A;  2G9W A;  3HUG A;  3CMA I;  1FNN A;  1O57 A;  1QHG A;  4PFP A;  3J81 Z;  4A3M J;  1MW7 A;  3EYY A;  5J6X A;  3JRC A;  3ML6 A;  2BY0 A;  3OYI A;  3HOS A;  3M8F A;  5D5U B;  1XCV A;  5E1W A;  1HCR A;  4HSR A;  1S7E A;  2EV5 A;  3L2C A;  3GUD A;  1E17 A;  1TC3 C;  1T6S A;  5DCM B;  5D5X B;  2C6Y A;  3B02 A;  3RYR A;  4B43 A;  4UY8 I;  4GO1 A;  4LOC A;  4HA8 A;  2M9H A;  5FLX Z;  4B47 A;  2F5V A;  1NG7 A;  2DTR A;  3S93 A;  3ZQI A;  1B9N A;  3V42 A;  3Q9V A;  5FKN A;  3AKZ A;  2DA3 A;  2QQB A;  5ED4 A;  4U0Y A;  2K5C A;  2XRL A;  4ZYA A;  2IXS A;  2VQL A;  1RPW A;  3BZC A;  1FBU A;  5A2Q K;  3V7S A;  2OZ6 A;  1PYV A;  4RMN A;  1WI3 A;  5E8G A;  4BHC A;  2A69 F;  1XX5 A;  3LA7 A;  4ZYE A;  2YU9 J;  3H9G A;  4XKC A;  5EF6 A;  2LDU A;  2LY1 A;  2EV6 A;  2LYC A;  2XAJ A;  4BL0 B;  2VKE A;  1QBJ A;  2CYY A;  4WXH A;  1YFH A;  5IT9 K;  5EYR A;  3DWL E;  2MYS A;  1KU3 A;  2WB1 A;  4OIN F;  3RYP A;  1I6X A;  1BC8 C;  1GVD A;  3CJR B;  5JFR A;  3S2H J;  4IQ4 A;  4M73 A;  1JI8 A;  1ZRC A;  2JRM A;  2HVQ A;  1U8R A;  3QQA A;  1SD7 A;  1BBY A;  4BUP A;  2DYS H;  2AHQ A;  2WAD A;  2L3D A;  5DTD A;  2R92 J;  3JAM Z;  4BY1 J;  2HPM A; 
#chains in the Genus database with same CATH homology
 3LA3 A;  2MLG A;  4KIF A;  3I0T A;  4F7Z A;  1HSJ A;  4RGU A;  1XCB A;  4ASN A;  1OYY A;  4B8X A;  2W24 A;  1FYK A;  2TDX A;  3MEX A;  3V7R A;  2K4J A;  1TNS A;  2EJR A;  1LB2 A;  1REP C;  5AIP A;  3WGG A;  3IL2 A;  5CVR A;  1ZN2 A;  2H6B A;  3WTV C;  3BWG A;  4KN4 X;  3BY6 A;  1IN7 A;  1U5T B;  5D6E A;  5K5O A;  1FC3 A;  2VN2 A;  3LWF A;  1ZGA A;  3COA C;  2BGC A;  4HF0 A;  5DEQ A;  2ZNZ A;  3GW2 A;  1HBX G;  1EH8 A;  5J8F A;  2HOE A;  1W7P B;  2ZME A;  1D3Y A;  2RVC A;  1QNT A;  3M8E A;  3KCC A;  1XGN A;  4ESF A;  3V4G A;  1R23 A;  5KVR A;  1ZGJ A;  3D5L A;  4O5V A;  3H3Z A;  6PAX A;  4MGR A;  2FNP A;  4PGG A;  3BZ6 A;  5FFX A;  5TRD A;  3I4P A;  2JZY A;  4UVB A;  2HGC A;  3IC7 A;  4UNO A;  2PMU A;  5LRR A;  1LDD A;  2E7X A;  3HSE A;  1A04 A;  4OMY A;  1IXS B;  1SFU A;  5TJJ A;  1HW1 A;  2FEZ A;  4ENK A;  3RPU A;  1F5T A;  4XSZ F;  2L4M A;  3U9G A;  2E1N A;  3ABT A;  4RAZ A;  2Q8K A;  3ZN0 A;  2IPQ X;  3V8L A;  4P96 A;  1BJA A;  5F64 A;  3IRR A;  1FLI A;  1KU7 A;  2FQ3 A;  4ENJ A;  4Y15 A;  4CHU A;  3CDH A;  1FP1 D;  3WGH A;  1QQI A;  3OOP A;  4CXF A;  4EV0 A;  3ZMS A;  4L9V A;  4G8X A;  2M1B A;  1FX7 A;  3CO7 C;  5HLH A;  1BN5 A;  1MGT A;  3ZPL A;  2ZXJ A;  5L3B A;  1P4W A;  3WE3 A;  1FZP B;  4HLX A;  5F1R A;  1TQI A;  2J5O A;  1OR7 A;  2ESN A;  2YPR A;  5E20 A;  2COM A;  3HRS A;  4ETS A;  2HKO A;  3IWZ A;  3HIF A;  5K5R A;  4YII A;  4Y13 A;  3WTX C;  2CGP A;  1U6G A;  3FX3 A;  4A0X A;  5L3F A;  2EWN A;  2F5E A;  4EVI A;  2MH9 A;  2UXX A;  1KYW A;  3RI4 A;  3M9A A;  3PQK A;  3FXQ A;  1J9I A;  1GXQ A;  1ZRD A;  5K5Q A;  3DV8 A;  4HV6 A;  3GLX A;  4ZZD A;  1YS7 A;  3BOQ A;  1S6L A;  4XSX F;  1R22 A;  4OIP F;  2P5K A;  1B1B A;  2D2W A;  2W84 A;  4P55 A;  2B0L A;  3HYI A;  1U78 A;  4IRI A;  3BPV A;  3BJO A;  1FSE A;  2PQ8 A;  4ZYH A;  1IUY A;  2E1C A;  3HOT A;  1R36 A;  2K02 A;  1STZ A;  2PBI A;  4EJW A;  2ZBK A;  1Z1D A;  1ZAO A;  3K1M A;  5CLS A;  2P7V B;  2A07 F;  2VT2 A;  2FMY A;  3RKX A;  1YIO A;  4OOI A;  5FD5 A;  3I53 A;  3WGI A;  1ULY A;  1HQC A;  5DCM A;  3ZN1 A;  4TV7 A;  4D0P A;  2QWW A;  3I71 A;  4OMZ A;  3J7A O;  1F4K A;  1BM9 A;  3DEU A;  3ECH A;  4KYW A;  3I5U A;  2L01 A;  2D45 A;  2CWE A;  3C7J A;  2IP2 A;  4IHS A;  1PP7 U;  4EQQ A;  4BYY A;  2JRT A;  1BOA A;  3N97 A;  1HKQ A;  2PN6 A;  3DXJ F;  1Z6T A;  1P4X A;  2W85 A;  4IJA A;  1HW5 A;  3ZMZ A;  4HLY A;  3ZMD A;  3WU0 A;  4GGG A;  1J5Y A;  3KP3 A;  3EET A;  4EMS A;  3QPT A;  1JHF A;  1P2F A;  2RN7 A;  3FMR A;  4HDV A;  3KZY A;  3GX4 X;  4ENN A;  2J5P A;  4AVP A;  3P9I A;  3K0L A;  4HX8 A;  3TO7 A;  3HSF A;  2VBZ A;  1ZLK A;  2HKX A;  2P5V A;  4UVA A;  2K4B A;  1MJB A;  3GFI A;  2DAO A;  2FSW A;  2MD5 A;  4UXN A;  3GFJ A;  3MWM A;  3V7C A;  3V8J A;  2HZT A;  1MJ9 A;  3FM3 A;  4N9H A;  2OA4 A;  1W7P A;  2QEN A;  2BEO A;  3TQN A;  4HX7 A;  1Z7U A;  2HWV A;  2VBY A;  3JSP A;  1DPU A;  4M9X A;  3F72 A;  4XBF A;  4WF2 A;  4HV5 A;  3NRV A;  1ODD A;  2YR2 A;  3TDZ C;  1B6A A;  5D5W B;  1GHC A;  2A5Y B;  3R0J A;  4HZF A;  4A6E A;  1D8J A;  2ZNY A;  3TOB A;  1ZH5 A;  2XHK A;  4ZYD A;  4KDP A;  4Y17 A;  4Q47 A;  2G7U A;  2WTE A;  1FSH A;  2QQ9 A;  4HF2 A;  4B09 A;  3O2P E;  2BV6 A;  3LST A;  3K9T A;  3J80 Z;  1TW3 A;  4OIO F;  3ELK A;  3VFZ A;  1B4A A;  1IAW A;  1XDS A;  4M9S A;  2QLZ A;  5L3E A;  1HST A;  1IN4 A;  2XAQ A;  2F5F A;  4WK8 F;  3WTU C;  2A61 A;  5HDG A;  3CJN A;  2DLL A;  4BAY A;  3BJA A;  3KP5 A;  1OMI A;  3R60 A;  3I58 A;  3OV8 A;  3KEQ A;  2DPU A;  5ICE A;  3MZY A;  4DQ2 A;  4MQ9 F;  3T1B A;  1USS A;  3BRO A;  5A2Q Z;  3PQJ A;  1V4R A;  3ROU A;  5LGU A;  2A3S A;  1WSU A;  2W25 A;  1TNT A;  4RB2 C;  2STT A;  2DI3 A;  4ESJ A;  2IA1 A;  1UST A;  5IT3 A;  1L0O C;  1DUX C;  2GXG A;  4KA4 A;  3GFL A;  3LQQ A;  1IN5 A;  1YTY A;  3KP6 A;  2IA2 A;  3VB2 A;  3HTS B;  1MDM A;  2P5L C;  3I64 A;  3LA2 A;  3G73 A;  1KU2 A;  1ON2 A;  2Q0O A;  5CVU A;  2K86 A;  4L9J A;  3GXO A;  3WOD F;  1R7J A;  2ISZ A;  1XSV A;  4NB5 A;  3CUO A;  1HKS A;  3QU3 A;  5LBQ A;  1J0R A;  2NNN A;  4U0W A;  5K1Y A;  1IF1 A;  2K27 A;  1IN6 A;  1R5G A;  2O03 A;  1XN7 A;  1W4M A;  2FBI A;  1MD0 A;  4MEX F;  1ZRF A;  1R1V A;  4EGY A;  3NQO A;  5LHI A;  1MZB A;  5D5V B;  2VC1 A;  5FLX K;  2JT1 A;  5D4S A;  5E1X A;  2O61 A;  2HTS A;  2AXL A;  3JTH A;  4M6X A;  1TW2 A;  2YX4 A;  1V3F A;  3P9C A;  3TDU C;  1ZYR F;  4I7H A;  2ISY A;  1FYL A;  1XSD A;  5EEH A;  2ELH A;  2CQK A;  1KU9 A;  2X4H A;  3JW4 A;  2DBB A;  1XMK A;  4Z2Y A;  1YQA A;  2GA2 A;  2HYG D;  4G9Y A;  1YG2 A;  4LK1 F;  3SQN A;  3JAM K;  1OYI A;  1RIO H;  5LRS A;  4S05 A;  1WKM A;  2XAF A;  4KIC A;  3REO A;  2Z3Y A;  1GXP A;  3CO6 C;  2M87 A;  3E6M A;  1LVA A;  2JPB A;  2PI0 A;  3QOP A;  4L9T A;  1LQ1 A;  1HXD A;  1FYM A;  2HEO A;  5LLQ A;  2CSO A;  2OQG A;  3V8K A;  4O3M A;  2VC0 A;  3CLO A;  3KFW X;  2V1X A;  1YW8 A;  2EFW A;  4RGR A;  2ZJ2 A;  4U88 A;  2IRF G;  5LEJ A;  2BE5 F;  2QYO A;  2XAH A;  3HHG A;  1TQP A;  3SFZ A;  1TLH B;  1SD6 A;  5HLI A;  3IKV A;  5HS7 A;  2AS5 F;  2XAS A;  2Y0M A;  3RDI A;  3FWE A;  1MJA A;  2P8T A;  2W57 A;  2ESH A;  2QM3 A;  1QO0 D;  2XUB A;  4YFN F;  3ZMV A;  1SFE A;  1XGM A;  2RQP A;  3E6C C;  2IT0 A;  3MZH A;  4G7O F;  3VOE A;  5CJ9 A;  4LB6 B;  2VE8 A;  2EV0 A;  2EFP A;  3F8N A;  4IXA A;  2VBX A;  2PG4 A;  2STW A;  2Z99 A;  1R1U A;  4GYG A;  1UHW A;  3KEO A;  4OIR F;  2OBP A;  4G7H F;  1RUO A;  4OU0 A;  1SMT A;  2V6C A;  2IA0 A;  5HS8 A;  2PJP A;  4HOB A;  2Z9O A;  3R61 A;  1ZG1 A;  3E97 A;  4LB5 A;  4IRH A;  5D8K B;  4LG0 A;  1HW2 A;  4EJO A;  2H09 A;  1AOY A;  1R5H A;  4ON0 A;  2Y48 A;  4FX4 A;  3P9K A;  1Z91 A;  3B73 A;  2F2E A;  3E6B A;  3HRM A;  1O7F A;  3T5X A;  4KFC A;  5L3C A;  2KJC A;  5HLG A;  4IVN A;  2M5W A;  1Y0U A;  1FPQ A;  5LGT A;  1CF7 B;  5H6R A;  4HBL A;  1IXC A;  1I1G A;  3H3U A;  1U5T C;  5FB2 A;  3FZV A;  5DCF A;  2F5C A;  1MKM A;  3RJP A;  5L3D A;  1S29 A;  4YG2 F;  2UZK A;  1IZ1 A;  1QPM A;  2DT5 A;  3ZP5 A;  3ZMU A;  4KMF A;  2DK5 A;  2KIF A;  2RGV A;  1DPR A;  4L5I A;  1UFM A;  5DV5 A;  4IRG A;  1B9M A;  4O6J A;  2OU2 A;  3R0A A;  5BPD A;  3FMQ A;  1ONV A;  3F23 A;  2GXB A;  3RKW A;  4XLP F;  4P9U A;  1W5S A;  2MH2 A;  3F8B A;  4CYD A;  2FA5 A;  2XV4 S;  5BQT A;  4L0Y B;  2DO7 A;  3HRT A;  4EGZ A;  2H94 A;  1FBS A;  2XRO A;  5ILS A;  2BBY A;  3I59 B;  1XDU A;  2M30 A;  2KRF A;  2D1H A;  4R79 A;  1J75 A;  1EH6 A;  1WRJ A;  3CUQ B;  1ZHF A;  3KP4 A;  2LF8 A;  4WXC A;  4A5M A;  2EFO A;  3EUH A;  3GVA A;  3IHU A;  1BIB A;  2V1U A;  4A12 A;  1S7A A;  3CTA A;  4AWX B;  4G7Z F;  4HQE A;  2DFI A;  1BIA A;  2QZ8 A;  1B59 A;  3TO9 A;  4ZZL A;  2UXN A;  4HF1 A;  4CO8 A;  4BQA A;  2HQR A;  4A0Y A;  1IW7 F;  3EQL F;  2KKO A;  3L9F A;  1E2X A;  2P7C B;  1BI3 A;  5ERI A;  2FU4 A;  2F5D A;  2XVC A;  1EH7 A;  3D0S A;  4DNC A;  3F8C A;  5JHU A;  5ICC A;  3W6J B;  2Y75 A;  4UV9 A;  4L0Z B;  1XD7 A;  2KJB A;  4YFX F;  4Q4Z F;  2VON A;  3WTY C;  4R1H A;  1U5T A;  4IHT A;  1XGS A;  2HQN A;  2V9V A;  1UB9 A;  4CIC A;  1L3L A;  4BHB A;  2MC3 A;  3F6V A;  2HFH A;  4LD5 A;  5HVQ C;  1S7O A;  3F8M A;  3SZT A;  1KGS A;  4NQW A;  1X3U A;  2GQQ A;  2EA2 A;  1UHM A;  4EJV A;  3GYH X;  2EK5 A;  2PLY A;  5JR3 A;  3WTZ A;  4WXD A;  3G3Z A;  3E5X A;  4EJT A;  3AAF A;  1D8K A;  4QLC U;  4FHT A;  5E1Z B;  3E6D A;  1T38 A;  1F9N A;  2GIV A;  4AIK A;  2FML A;  5E17 F;  2HS5 A;  5JVT A;  2QBY B;  4WCG A;  2XIG A;  1G3Y A;  3ZMT A;  3F3X A;  1IN8 A;  3P7N A;  5DD8 A;  1Z6R A;  1U3E M;  3DP7 A;  3GZ6 A;  4EM2 A;  5HS9 A;  3VEP A;  2FBK A;  2PEX A;  3QU6 A;  4LLG F;  2OD5 A;  2QVO A;  2QUF A;  3VOD A;  1J7K A;  3IRQ A;  3KP2 A;  5AIQ A;  1W5T A;  2R7F A;  1IRG A;  3U2R A;  3GFM A;  3E5U A;  3F8F A;  1R58 A;  2HR3 A;  3KLN A;  2FOK A;  3S2W A;  2IVM A;  4XLN F;  2VOP A;  4I09 A;  4A2U A;  2CFX A;  2DPD A;  3MCZ A;  4L5J A;  4ENM A;  4Q48 A;  2GAU A;  1Z9C A;  1CGP A;  4HX4 A;  3MAJ A;  3PFI A;  4I0B A;  4KT5 C;  1LJ9 A;  1XSX A;  3DKW A;  5ICG A;  1FWZ A;  2E7W A;  5H6Q A;  1DP7 P;  5IT9 Z;  5FFZ A;  5JI6 A;  4Q5S F;  3TGN A;  1H9T A;  1BC7 C;  1KQ8 A;  3EYI A;  4P5O A;  1R00 A;  4N0B A;  1WQ2 A;  1JGS A;  1P4A A;  2NS0 A;  3LAJ A;  2A6H F;  1KQ9 A;  1RZ4 A;  3RTR A;  1RNL A;  2D1V A;  4G6D A;  1BI1 A;  2VXZ A;  1WI9 A;  1LNW A;  2IW5 A;  1D5V A;  4LK0 F;  4BXU A;  2VBW A;  2FBH A;  1I27 A;  2KIM A;  3J81 K;  3H92 A;  2ZO4 A;  3ULQ B;  4CZZ A;  1CF7 A;  2OQR A;  5DUI A;  4S04 A;  5HDK A;  3GF2 A;  1I1S A;  4RGX A;  1F1Z A;  1XB4 A;  2EFQ A;  1FY7 A;  2H6C A;  4MEY F;  1QZZ A;  2Z33 A;  2V79 A;  4JQF A;  3WTW C;  3ISP A;  4I0A A;  5L3G A;  2CW0 F;  5LGN A;  4BH9 A;  1IXR C;  3I54 A;  3FMS A;  3F21 A;  1HKT A;  3TOA A;  4RGS A;  4ESB A;  4UUV A;  2NRA C;  4JBA A;  3T0Y A;  1RI7 A;  2ZCW A;  3LFK A;  1BI0 A;  1KA8 A;  2HYF A;  2JTV A;  4KN7 X;  4IF4 A;  1K6O A;  4IPA A;  3BP8 A;  2WWY A;  4XRF A;  4U0V A;  1ON1 A;  3QP6 A;  2YX7 A;  1U2W A;  3O3K A;  2FF4 A;  3WG9 A;  4EJU A;  3I59 A;  4QWQ A;  2UWM A;  1Q1H A;  2IJL A;  4KUM A;  2DQR A;  4KIG A;  4RB3 C;  3RIR A;  2WC2 A;  1JE8 A;  2LSO A;  5HDN A;  5CVV A;  3CUQ A;  3DF8 A;  4PCQ A;  1VTN C;  2R7D A;  1AWC A;  4AD9 A;  4N9I A;  1G3S A;  1W7P D;  1TTY A;  2L54 A;  2DU9 A;  2EB7 A;  3DFG A;  3C18 A;  2O6G E;  3DPL C;  4ZYG A;  1G4D A;  2RC4 A;  4LGW A;  1FBQ A;  3SHF A;  4LMY A;  1SFX A;  4H0E A;  4K2E A;  5AON A;  2HDC A;  5E8I A;  5DD4 A;  1UCR A;  4EM1 A;  3TKY A;  3HHH A;  4R8H A;  1P6R A;  2M45 A;  3L00 A;  2VT3 A;  5D6F A;  2FE3 A;  4HDU A;  2WV0 A;  4LJZ F;  2LF7 A;  1K78 B;  3MQ0 A;  2FRH A;  3GO5 A;  4KIB A;  4GYI A;  4MTE A;  4M74 A;  4KNY A;  1Z05 A;  2YU3 A;  2ZFW A;  2LKP A;  3ECO A;  3ABU A;  4LLL A;  4UV8 A;  3KP7 A;  1SD4 A;  1O3R A;  1NHA A;  3L7W A;  3QAH A;  3Q5F A;  3E3V A;  2YSR A;  1C0W A;  4GCV A;  1QZY A;  3F6O A;  2L02 A;  2OAZ A;  1O7L A;  2M8E A;  4WWC A;  1T39 A;  5H20 A;  1RUN A;  4A0Z A;  4I02 A;  2R3S A;  3FHZ A;  4UVC A;  3RKY A;  3BDD A;  3GEZ A;  4A5N A;  1MDM B;  1J2X A;  3LQR A;  1LDJ A;  2EA4 A;  2LNB A;  2XKO A;  2QBY A;  3DQV C;  4I01 A;  4MTD A;  4E70 A;  1FP2 A;  5FO5 A;  2ZKZ A;  3HRU A;  3SXY A;  2QQA A;  1R1T A;  1TQM A;  4M6Y A;  3L09 A;  2H27 A;  1YYV A;  5F6F A;  5ICF A;  4HQM A;  3K1N A;  4NHJ A;  3JTG A;  5D4R A;  2O3F A;  1O3Q A;  1ZAR A;  2DW4 A;  2X0L A;  4I98 B;  5J8C A;  4YFK F;  3GWZ A;  4MQV A;  4U7B A;  4AIH A;  4RB1 A;  4OIQ F;  1PP8 F;  4L18 B;  1FT9 A;  4PDK A;  4EM0 B;  2P6T A;  2JPC A;  4I2O A;  4M71 A;  2ETH A;  3K1P A;  1LEB A;  2P6S A;  4PZJ A;  3DPT A;  1XGO A;  1OKR A;  2GWR A;  4MNU A;  5FGM A;  1G3W A;  3KZZ A;  1SAX A;  5DUK A;  1ZG5 A;  1PDN C;  4JK1 X;  3T8T A;  2GA1 A;  1DDN A;  5HOO A;  4AIJ A;  2ZME B;  2RKH A;  4HAM A;  1JXS A;  5FD6 A;  1YW9 A;  5DYM A;  1TBX A;  1SD5 A;  1EV7 A;  2NYX A;  5CVJ A;  1JHH A;  3WTS C;  4BNC A;  4M72 A;  1G6N A;  2G7H A;  1ZLJ A;  2P4W A;  4RB0 A;  4M9Z A;  3QP5 A;  2NAZ A;  5CYV A;  5BPI A;  3C1D A;  3O6B B;  1T2K A;  3NEU A;  3IWF A;  3ERE D;  4GXO A;  1T0F A;  5BMZ A;  1IRF A;  1T98 A;  4HW0 A;  1P92 A;  2CG4 A;  1YW7 A;  2VOO A;  3U1D A;  1J59 A;  2K7L A;  4HYE A;  1O3T A;  2HTJ A;  5LHH A;  1LDK B;  4P9F A;  3Q9S A;  3FXR A;  3LAP A;  2MLK A;  1YO5 C;  1FOK A;  4A6D A;  3M1E A;  5KK1 A;  1XMA A;  1PUE E;  2XRN A;  2OZU A;  1K7A A;  2VOD A;  2DQL A;  1OYW A;  1I5Z A;  2Q2E A;  1G3T A;  1ZRE A;  3F22 A;  1ZG3 A;  1YLF A;  3IKT A;  2Z5U A;  1S3J A;  3M7G A;  4LLN A;  4FT8 A;  3C3W A;  4G6Q A;  3TO6 A;  2EFN A;  4KMU X;  4U7D A;  2GZW A;  2BYV E;  3GZ5 A;  1OPC A;  3ZQ7 A;  2PMH A;  4LFU A;  2MBF A;  3HTU A;  4YIF A;  2RNJ A;  2A6E F;  5BOX A;  3SZP A;  3QRF F;  2XKP A;  4L9N A;  2O8X A;  2FXA A;  3BJ6 A;  3KLO A;  1GVJ A;  3N4M A;  5LHG A;  3KE2 A;  3WU1 B;  2A68 F;  2ADU A;  2CO5 A;  1QGP A;  2VE9 A;  2O0Y A;  3T8R A;  5D8L B;  5ILV A;  4WX9 A;  3WE2 A;  2NNY A;  1KQ0 A;  4LG0 B;  4RAY A;  2RDP A;  4CDG A;  1H9G A;  5BS6 A;  1KYZ A;  2XGX A;  5DDG A;  1H0M A;  2XAG A;  4G94 A;  2KIU A;  3R4K A;  2DK8 A;  1WWX A;  5ILU A;  3MFK A;  2ACJ A;  2FNA A;  3BPX A;  4UHT A;  2RV8 A;  2V1D A;  3KET A;  4RS8 A;  3K69 A;  4ZH4 F;  4MHG A;  1SMY F;  5EEG A;  4FX0 A;  4CGZ A;  4PGH A;  1K79 A;  3FXU A;  1S8N A;  1YS6 A;  1K78 A;  1BI2 A;  4BHP A;  5LEK A;  3FF5 A;  3HSR A;  3WTT C;  1LEA A;  2JSC A;  3RPQ A;  3JSO A;  3R6S A;  3CUQ C;  5CVI A;  3J80 K;  3K2Z A;  5E18 F;  3FM5 A;  3QPH A;  3E5Q A;  3W6K B;  2MA3 A;  1O3S A;  2PFB A;  3EDP A;  2L4A A;  2G9W A;  3HUG A;  1FNN A;  1O57 A;  3J81 Z;  3EYY A;  5J6X A;  3ML6 A;  3HOS A;  3M8F A;  5D5U B;  1XCV A;  5E1W A;  2EV5 A;  3L2C A;  3GUD A;  1E17 A;  1T6S A;  5DCM B;  5D5X B;  2C6Y A;  3B02 A;  3RYR A;  4GO1 A;  4HA8 A;  5FLX Z;  2DTR A;  1B9N A;  3Q9V A;  2QQB A;  5ED4 A;  4U0Y A;  1FBU A;  5A2Q K;  3V7S A;  2OZ6 A;  5E8G A;  4BHC A;  2A69 F;  4ZYE A;  3LA7 A;  2LDU A;  2EV6 A;  2XAJ A;  1QBJ A;  2CYY A;  4WXH A;  1YFH A;  5IT9 K;  1KU3 A;  4OIN F;  3RYP A;  1I6X A;  1BC8 C;  5JFR A;  4M73 A;  1ZRC A;  1U8R A;  1SD7 A;  1BBY A;  2L3D A;  3JAM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...