2LH9A

Nmr structure of the first lotus domain of tudor domain-containing protein 7
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Tudor domain-containing protein 7
publication title NMR structure of Tudor domain-containing protein 7
rcsb
source organism Mus musculus
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lh9A00
3S93A 2LH9A 2KPMA 3RCOA 2LY1A 2LY2A 2KZVA
chains in the Genus database with same CATH superfamily
3B73A 1O3TA 1VQLI 3V8LA 2EB7A 4B44A 3K1MA 2OUMA 4EV0A 4XORA 1FLIA 3F3XA 2IPQX 4DZJA 5LHGA 1MD0A 1TWFJ 2EIJH 1B72B 2P5LC 2DT5A 5J1RA 1ITYA 3KYLA 1FTTA 3T5XA 5BNGA 4FCYA 1UZCA 1V54H 4KIBA 4ABZA 2R5YB 1JTXA 2K9MA 1XMXA 3FK7A 4HSTA 3WE3A 2K5CA 1QVTA 2R93J 5EG0B 3LSPA 1TWHJ 1QPIA 3GFJA 2GXAA 1ZGJA 3HBLA 2F4OB 2DPDA 3L9FA 2XDVA 2LTPA 2RV8A 1DPUA 4CHUA 3H9JA 2CQNA 3WGGA 3K10A 4B43A 1MJAA 4BE2A 1LE8A 2JPCA 1T8IA 3GWZA 4H0EA 4Y52J 3JRDA 3L7WA 2ZFWA 2VT2A 1K61A 3RTRA 2MBFA 2HFHA 3KLOA 4ENJA 1BR1A 3DBRB 3W6VA 1D8JA 5FKNA 3RPUD 2A07F 1PUFB 4B4CA 2GIVA 2E2JJ 4JYKA 4ZYDA 2QBYB 2MLKA 2WC2A 1R71A 1YYVA 2M0MA 3Q0VA 2DA6A 2KT0A 2VJ4A 4QWQA 4CSWA 2XRLA 2R7XA 3RSNA 3FBNB 4CYCA 4I99C 1DU6A 4G7HF 5LEJA 1R00A 1G3YA 1FTZA 1QVUA 1SANA 4G7ZF 3KZIC 1BI1A 5F27A 2DMQA 4LG3A 4HNVA 1R4MB 4ZYEA 2E7WA 3GLLA 3MVPA 3GUDA 4ASNA 4XLEA 3OYIA 4ZYAA 1HBXG 4ZDLA 5DM6F 3GFIA 1VQPI 2R4GA 3FXRA 2BY0A 3BQYA 1IN5A 1X1PA 4DBQA 4YG2F 4BAYA 5B3SH 1VI0A 3E6BA 4KFCA 1W5TA 1D8KA 3K70D 4RB1A 2R92J 2DW4A 4BDYA 4NC6A 2V6EA 3DXJF 1Z21A 3DV8A 3ZMZA 5K7HA 5E3LA 2HQ5A 1RUNA 5CVJA 2VQHA 1WJEA 3V42A 2AQFA 2L7FP 2X6WA 3DEUA 3OS0A 4A3JJ 1HW2A 4NC8A 2XSDC 2HYGD 2ZBKA 4U87A 2MA3A 3HKZN 1QZEA 3K4NA 4EM1A 3COAC 3F21A 1O3SA 2V26A 4IRIA 4W1UA 2HDCA 1R23A 5DDGA 2HOTA 4F52A 2KDOA 2E2IJ 3V7CA 4BE0A 2PN6A 2Y48A 1FIPA 3HHHA 4D9JA 5LGUA 3P7NA 3QAHA 2IT0A 2W82A 1KGSA 1EKEA 5K7ZA 1YS7A 5IP6A 3SYTA 1U9NA 1MNDA 2O0YA 2NVTJ 2K86A 3F9KA 1Y8QB 2F4IA 2Z16A 4XIDA 1FBQA 5TGTA 3ZQFA 2QF7A 3D1NI 2KMUA 2DFHA 5CVVA 3N97A 2MD0A 3I3LA 2WB1A 3PQKA 2E5ZA 2V9KA 2VKEA 1ZLKA 5J1YA 3OYMA 1NTCA 4C2TA 1FP2A 1J9IA 1XN7A 1KZHA 5B1BH 2HYFA 5D5UB 4B48A 5E79C 3JSPA 2EFWA 4RDUA 3I54A 3QODA 1ETOA 2CJJA 4XSXF 2VODA 4PJNA 1KU7A 4JQFA 4A5NA 3T8RA 1ZTRA 3HOVJ 5GAGJ 4IRHA 2QLZA 2DQLA 5LFAA 4A3EJ 3H3VK 1OLTA 4YRVA 3Q0UA 3K1PA 2O7OA 1CGPA 1XGMA 3OS1A 3GTKJ 1PP8F 4HLYA 5ICFA 3H3UA 4G6QA 1T33A 2KIMA 1P92A 3R0AA 1DGRM 2Y69H 3SFIA 4DYQA 4UV8A 5J6XA 2E1MC 2ZJQF 2WA0A 1VQ7I 2GOXB 2VJJA 1ZRFA 4A3BJ 1FOYA 4UXNA 2R5YA 3CCQI 2QQBA 5JVTA 2WY8Q 5EG0A 2R3SA 1J59A 4OAZA 1R5HA 2PLYA 4UNOA 1I50J 1TWGJ 1P4AA 3GF2A 3P9KA 5DD4A 5E3NA 3ZQIA 2OAZA 2KZGA 3R6SA 3ABUA 2Q0OA 1V55H 3LSJA 3D5SC 2DCEA 3W6JB 3SHFA 5IYBJ 4A3CJ 3Q9VA 5K5OA 5J47A 1SFOJ 4RBOA 4XLNF 1W36D 3CDIA 5IT3A 3E6DA 4DZPA 1OCRH 2IA2A 4Q48A 2IW5A 1NH3A 5M5WJ 2HNHA 2M4KA 4QPOA 4M73A 3LA2A 3CUQB 5BPDA 1IUYA 2GZWA 2E5NA 2HPIA 1IRZA 2DU9A 3GTJJ 1IF1A 3G6EI 2LDUA 4AU7A 5FKMA 3EDPA 1EF4A 4CDGA 1BC8C 3CDLA 1YHQI 2NYXA 4UY8I 1MH4A 5DCFA 2DT6A 1OQYA 4I0BA 2EWNA 4F3QA 2DOAA 2ZMEA 1RKTA 1H0MA 1JKPC 1HW5A 4D5CA 2CS3A 3GTOJ 4IEJA 3WTUC 2LP0A 5F08A 3OSFA 4L0ZB 1NK3P 3SZGA 2WWYA 2KISA 3F72A 4BQNA 2MYSA 3OYNA 3O8GA 2VBZA 3ZXSA 3MKZA 4UB8C 4BXFA 3F22A 1VFCA 3FKIJ 1WJFA 4EM0B 5K5RA 1PUEE 1OISA 3GW2A 3FM3A 4YIRX 2KHMA 4LG0B 2DA3A 1WI3A 4OWRB 2VLAA 2M30A 3I53A 5F64A 2R7RA 1Z1DA 4KN4X 1O7FA 1K6OA 4UHTA 2MC4A 3L2CA 5CPRB 3LSTA 4WXHA 4ZTJA 1MBKA 1AKHB 2VQLA 4KMFA 1R58A 4XICA 2QSGX 3U9GA 2XPVA 3I64A 5EDNA 1VQKI 2YS9A 4HDVA 4X6AJ 4XL9A 2F5EA 4WCGA 2Q2EA 1CQTA 3RPUA 2AXLA 3HOSA 1A04A 2QUFA 2XKOA 3N4MA 3QU3A 3S93A 4ZJZA 3IWZA 1XDUA 2RQPA 2VPLA 3WTTC 3HYIA 1ZG1A 2R7FA 3OWTA 1H89C 3JRHA 3L2VA 5TJJA 3NWTA 2VL8A 4EQQA 2MH9A 2KL4A 2W25A 2CFOA 3GXOA 1JGSA 4FHTA 2XAHA 3BROA 1M1EB 5H6RA 3MFKA 3L2UA 2QKLB 4KICA 3QWLA 5M3FJ 2HPMA 3HOXJ 4LLNA 1KU2A 1WFXA 2XHKA 4N4NB 1S6LA 3E5QA 2XGXA 2NS7A 1S72I 2OPTA 1POGA 2L01A 3G73A 1JHFA 3D0SA 3K4BA 4HW0A 2WB1N 2ZNYA 3FMSA 1BN5A 2PI0A 3A0HC 2HKXA 5EJCA 3FXOA 3IUOA 1KU9A 4Y3OA 5K7FA 1YRNA 4IL6C 2PX9A 4E70A 3JRBA 2TCTA 1RI7A 2ME0A 2ZB9A 3LA3A 1XGNA 1MMDA 3MN2A 2Y75A 4NQWA 2ZXIA 3A01B 3K6GA 1LUJB 2ADUA 3EUHA 3D5LA 1VQ4I 2L0KA 4MFDA 4BJ6C 4UVCA 1APLC 5IOYA 3GTLJ 4OIRF 4P5OA 1DU0A 1REPC 1A36A 5L3EA 1WKMA 4L5IA 1Q1VA 3WHCA 4DGWB 2VOOA 3CUOA 2OQGA 2Z1DA 1MMNA 1BR2A 2FOWA 2PJRA 1K4SA 1X2NA 4XLCA 4XKWA 1J75A 2L2OA 3RJPA 4EEFG 3S15J 1BIAA 2DA4A 1YI2I 1LVKA 2E71A 5BS6A 3OYHA 4LITA 4DIQA 1VQOI 2A68F 2ZXHA 1XDSA 2R7VA 2DFFA 4CH7A 3HGYA 4YIIA 4AVZA 4I2OA 2DMUA 4B1RA 4D7NA 1A35A 3SFZA 3DLLF 2P7VB 2DO7A 5DS9A 2VQGA 2BY3A 3B6AA 4HAMA 2V1UA 3CO6C 1D0XA 2VXDA 4M72A 4CO8A 1YTYA 3HHGA 1D0ZA 3EETA 3BOQA 1GLNA 4F55A 1R7JA 3DBHB 5DD8A 4A3LJ 1IRXA 2QCOA 3QOEA 4EJTA 3OYFA 1I6XA 1TW3A 1DP3A 5J1UA 1D3YA 2Y0SN 1GDTA 4C9YA 2K9SA 4J00A 3F0CA 3G4SI 3Q0WA 3LSHA 3H9GA 2DXIA 5LRRA 4CA0A 1B8IA 5D5WB 2XB5A 4I6ZA 3BTCA 1USSA 1K78B 4FX0A 5K1YA 5CKTA 3BZ6A 1ODDA 4MFEA 3V4GA 2M45A 2GXBA 3E6MA 1HXDA 3UNGC 2ELJA 3GLXA 1X1AA 3VYTB 3S3NA 3DEEA 1IN8A 3QU6A 3ZP5A 2DLLA 3JTGA 3PO3J 2NVXJ 2FBKA 4GXOA 1LVAA 1U9OA 4KMUX 3FF5A 2FBIA 4ZTFA 3IH3A 4UVAA 2HWVA 1TLHB 2DOFA 2H09A 1WPKA 2ID3A 1X4PA 2VJIA 4KA4A 3ZMSA 2JTVA 2K4JA 1Z6RA 5DM7F 1UJ8A 1O4XA 1TBXA 1AKHA 2XAJA 3A02A 2D45A 2QEXI 3K2AA 2JA6J 1O3RA 2OZUA 3MKYB 1FBSA 3RKYA 4DJAA 4U0YA 2DPUA 2OF7A 1BI2A 2UUZA 2ZMEC 4EM2A 2A6TA 1S5LC 1HSTA 4DOZA 3KETA 5HDGA 3LMMA 4I7HA 4EVIA 3EYIA 1RRJA 1BW6A 2JA8J 2KRCA 3OYLA 4RLQA 4XR6A 2YSRA 5EZHA 4XRSG 3C18A 1X1DA 2STWA 1JI8A 2DJIA 1WSUA 1I27A 3IV5A 4KIGA 4LFUA 5J4YA 1IN7A 1S3JA 1IG7A 3LWFA 5KVRA 4Q4ZF 3DCFA 1Z67A 4BUPA 3BG3A 5ILVA 2IBDA 3FXLA 2ISYA 1FPQA 3OV8A 3GMEA 3HUGB 4XNFA 3ZRGA 2V1DA 1USTA 2GQQA 2H94A 5D4RA 5AIQA 2VPRA 1NG7A 2GBYA 3K4MA 4O3MA 1R36A 3DU5A 1P9QC 2B9SA 3I4MJ 5HOOA 3LAJA 2QQ9A 4R79A 2XF7A 2ACJA 3ZQGA 2HGCA 1MMSA 4PDKA 1DUXC 3I0TA 3MZYA 2LY2A 1TC3C 4PGHA 1WJ5A 1VQ8I 2D1HA 3AG2H 1I3AA 3F6VA 4HZFA 3OY9A 1JUPA 4ZC3A 3J81Z 2EIKH 4UB6C 5J4VA 1N75A 1Z0XA 4CYDA 1VZ0A 3R61A 1BA5A 1MDMB 3SEQA 1OCOH 4JP0A 2P5KA 4IQ4A 2XRNA 3H36A 1SAUA 3KEOA 3CDHA 2AQEA 3CF2A 5D8KB 4XLHA 1D5VA 3H5NA 5IYDJ 1Y1WJ 2O6GE 4A5MA 5FLXK 4MLOA 2Y0MA 2B0LA 1PYVA 2PMZA 1ZAOA 1BR4A 2KLOA 3VEPA 2EFPA 2KQRA 4FX4A 3MKWB 1RESA 4XONA 5HNHA 1LJ9A 3VPRA 3SJMA 2L4AA 1Z91A 4BH9A 2AHQA 5FFXA 4A3DJ 2IS2A 4IOAF 2HQRA 3HGGA 2H27A 1Q1HA 3EQLF 2DI3A 3OR1C 1GV5A 1ETQA 2X4HA 1K7AA 2YPRA 3E1SA 3HTUA 4UUSA 2GOMA 5JHUA 3CMAI 4IHXA 1FX7A 2GA2A 1MH3A 3G71I 3EUHC 3J7YJ 1ETWA 1MKMA 1H8AC 3M1EA 3FM5A 3KCCA 3MZHA 2G9WA 1MNMC 4K2EA 1V5FA 4M9XA 4CCNA 2Z3YA 4DBRA 2DA1A 4M6XA 4HF1A 4FE4A 4X0GA 4QPQA 5JVGF 3PJRA 3BJOA 5IT9Z 5F6FA 2ETHA 3W2WA 1F9NA 1VF9A 2K3FA 5C3EJ 1KA8A 2LYCA 4L5JA 1G3TA 2FRHA 2UXXA 2G7HA 1OCCH 3WTVC 2TDXA 3ONQA 2VKDA 3A0BC 1ZR4A 1X3ZB 2M4GA 3CMMA 2EIMH 4P1WA 2D5VA 4HPQA 2XSJC 3BTJA 2EBIA 4LIUA 1T0FA 1YITI 3BZKA 4AD9A 2Z9OA 2KIFA 3CZ6A 2R7SA 4NC7A 1U6GA 1U2WA 3VYUB 3ESWB 1HDPA 4ZYGA 3DTEA 1SVLA 3T0YA 4D1QA 1XGSA 1W7PA 4MHGA 1QGPA 2J5PA 2L7MP 4KT5C 2VC1A 5DEQA 2W85A 4LJZF 3OIOA 3AKZA 5FLVA 2CH0A 2IS6A 4BQOA 2WY7Q 1JXSA 4A3MJ 1HA8A 2KRFA 2GAUA 1NG6A 5CVUA 1X1CA 3CF5F 3FXKA 3WTXC 2YU3A 1BL0A 3CD6I 2FNAA 3WGIA 5TISC 4OU0A 4CUGA 4BBSJ 1HKTA 4HQEA 4A3GJ 4A69C 1ZRDA 1VQNI 1YFHA 3WTZA 5BQTA 1ENHA 3TO9A 2XUBA 2XIGA 1B9MA 2FUG2 5JLXA 3L2QA 1JUSA 3O2PE 2DA5A 2QGUA 4XMYA 3J81K 1SMYF 1XC5A 4JOMA 3WHBA 1AWCA 2V79A 2VB6A 2Y9YA 4HSRA 2ZJ2A 2EILH 4PJMA 4EJUA 4BHBA 3HUGA 5TRDA 3S32A 4NBQA 1GVJA 4EATA 1MIJA 3ECOA 4RB0A 5FB2A 2R7WA 3VYRB 3VDXA 3EUKL 4M3DA 2ICWG 3SQNA 2MGQA 1FNNA 3K2ZA 4JBAA 1DGWY 4BY1J 4AWXB 2AS5F 3LQRA 4RS8A 4R8HA 3O3KA 3BY6A 2LKPA 3QQAA 4B8XA 1QPMA 2A5YB 4B3XA 2RC4A 1JKRC 1IO2A 1VQ9I 5H20A 1X19A 2RDPA 5KAFC 1YX5A 1ZELA 3H5RA 2DBBA 2ELKA 5F0HA 2CUEA 5CQGA 1YS6A 4U0VA 1E17A 2F6CA 1XS9A 2O8KA 5KHDA 2LOOA 3Q3SA 2K02A 1GHCA 2LG4A 3Q9SA 3GX4X 3A1YA 3DF8A 2CMPA 4LLLA 1T2KA 2YU9J 3CMEI 2P7CB 3A2KA 1QQIA 2LY9A 2GLOA 4H4KC 2CYYA 2KIUA 3GTQJ 4OOIA 1OCPA 2M8GX 1LNWA 4WXCA 2HVRA 2GIZA 2YR2A 1PVEA 1S8NA 2Y9ZA 1IJWC 4UUVA 2ELHA 2IJLA 1RC9A 2M1BA 4M74A 1ZK8A 1G3WA 1OKRA 3RYRA 2FJ1A 4E7IA 4KT6A 2PMZN 1U8RA 3ZQCA 3GFLA 4UV9A 3OYDA 1UCRA 3I59B 3FDYA 3JSOA 2EJRA 3VOEA 5HNFA 5E3MA 2G7UA 1RETA 3X2QH 1LEBA 2ZSHB 4IZZA 1FMVA 4E7SA 2XC7A 5E1ZB 1WZ2A 2W1OA 2MLGA 1R1VA 1R1TA 5HLGA 4G12A 1SVMA 3S1NJ 3LFUA 1SD7A 4PJLA 1X4OA 2VBWA 3DWLE 4XOPA 3P9CA 2M3AA 3RKWA 5CYVA 4IO9F 4IKFA 1D1AA 2COBA 3C2GA 3HC7A 2BGCA 3H1CA 3GZ6A 1DQUA 1K4TA 2MD5A 1B72A 1J2XA 2QKMB 2CW7A 3ISPA 5JR3A 1ZARA 1KYZA 2JSCA 5HDNA 1CF7B 1YIOA 2W24A 4IF4A 1RR8C 4IHVA 2CO5A 5FD6A 4BY7J 1K83J 2RVCA 1S7AA 4OINF 3KP4A 2JT1A 4JK1X 1YJ9I 2NXNB 3K69A 2VXZA 3DTIA 3W3CA 2OV7A 3NWSA 4M9ZA 1HF0A 3S2DJ 1U5TB 3U21A 3QOPA 2ZJRF 3OOPA 4BHCA 2WAQA 3PIOF 1SD4A 1QO0D 4HG2A 3L2RA 3BR0A 4RGUA 3HOUJ 1UFMA 3CO7C 4HA8A 2O03A 4AIDA 1ON2A 4C3IJ 4KIFA 1HCRA 2K4BA 2Y31A 3BCBA 4GGGA 3CJQB 2ME6A 2DDAA 4BL0B 5E8GA 2LMDA 1PUFA 2P81A 3GO5A 1O3QA 2Y0SA 1Z9CA 1KQ9A 2JQ7A 1SAXA 2QBYA 3PIPF 2XF5A 1WVRA 2JA5J 2P4WA 2BZTA 2CRGA 2Z33A 3FHNA 3OR2C 3LSIA 3QYFA 1T0FC 4DW6A 4M71A 3KPHA 4EGZA 2HI3A 3CCSI 3KZYA 4XOTA 5GTHC 1KYWA 4A2UA 3FWEA 2F5VA 5HODA 5L3FA 4RM3A 2XPWA 5CQEA 1P7IA 4RAYA 3RKXA 1F43A 1G59A 1E3OC 1B59A 2KZVA 3ABTA 2BBYA 2W7NA 1H9TA 4MEXF 3C1DA 3BJAA 1QRYA 5CVRA 3SEZA 1MMGA 1EA3A 2IGNA 3A03A 1B1BA 3ZR8X 1IC8A 2ZFUA 1YLFA 1Y6IA 2JUCA 2V4JC 3KP7A 4C2MJ 1D5YA 1I1SA 3LQQA 2DK5A 5JHFA 2ZKZA 2LRDA 4Y4RA 1RUOA 3MEXA 3CCRI 2BW3B 3DEWA 2E1CA 3KIOA 1WHUA 2YX4A 4HOBA 2M0CA 3WU1B 1IN6A 1A5JA 4GRIA 3JREA 3OL3A 2Q8KA 3RI4A 5E18F 2W48A 3W2AA 3ABLH 3QPTA 4OMYA 3L09A 3BZCA 3TW7A 1HKSA 2KP6A 1XPXA 2QQ8A 1IXRC 2O9LA 5F0CA 4XK4A 4P96A 2Z99A 3DKXA 4I76A 5LGTA 5ICCA 4Y7NJ 1S29A 2IA0A 2PQ8A 2DT7B 1MW7A 3KE2A 1RZ4A 2JSPA 2HS5A 3O6BB 3ABKH 3KP6A 1WGXA 3WGHA 3KX2A 2WV1A 2JRTA 1BM9A 2HYJA 2JMWA 1BW5A 3J7ZI 4E7ZA 1JHHA 4U7BA 2HXOA 3BR5A 1JT6A 4EJOA 3ASNH 4IX7A 2NVUB 3K4LA 1JTYA 2M9HA 3GBGA 2OQRA 2RKHA 3RZDJ 1MBHA 4RGSA 2OCEA 1Y1VJ 2QVOA 1BOBA 2XGDA 1UHSA 3OYCA 4M9SA 1OYYA 2VI6A 4J01A 3K4KA 3PO2J 4PGGA 2OCCH 2XGEA 2FF4A 1S7EA 3VB2A 1RKWA 4PCQA 3RCOA 4PJ0C 1TNTA 1E3PA 2O3FA 5LLQA 5FO5A 4W97A 3QPSA 1I6HJ 4EMSA 2L4MA 4RM2A 3IWFA 1XX5A 4MO7A 1BOAA 1PJRA 3R0JA 1YG2A 1AA7A 2NNNA 2LBFB 1SD5A 5JLWA 3W6KB 4CZCA 2UWMA 3BWGA 3M7GA 3M07A 1MBEA 3OYBA 3FMRA 1ZR2A 1R6RA 3BG7A 1ZG3A 2O61A 3NARA 3TDZC 1LFUP 4JX4A 1FSEA 1ZREA 1P4WA 4OMZA 2MABA 3HRUA 4Y17A 5F1JA 2ZSIB 1A6QA 3BR6A 2AO9A 2LF8A 1O57A 4LLGF 2R7QA 2OC6A 2XAFA 3FBIB 2BVLA 2NVYJ 5EEAA 4HYEA 3DFGA 1W5CC 1BBYA 2LNBA 3U1KA 3FK6A 2CWEA 3LFKA 3MQ0A 1O7LA 1OR7A 3P5JA 1XG1A 4DQ2A 5ERIA 1JE8A 2OD5A 2L9VA 4A3FJ 1K6YA 1ON1A 3D5RC 4FISA 5BPIA 1U5TA 2EINH 3ASOH 4M3FA 3REOA 1SFUA 1V3FA 2G0EA 2K3PA 2V9PA 4BKXA 3NAUA 4QLCU 4RGRA 4EJVA 5GADJ 3Q5FA 2PJPA 1NHAA 2WAQN 3QPHA 5LGNA 2EA2A 2CUJA 1WJAA 4JX5A 1J09A 5GP9A 1W0UA 2JUGA 3F8NA 4LD5A 4BXUA 5LD2C 2VKHA 2KPMA 2GWRA 3C2BA 4CCLA 2L9NA 5KNLA 3CUQA 2A69F 1DPRA 4ITVA 1BJAA 1SD6A 4XKCA 3E3VA 4YELA 4BQAA 1S7OA 1N78A 2EV0A 4ETSA 1TQPA 2FSWA 3CCUI 1Z77A 5A2QZ 1LEAA 3M3YJ 2WAFA 4PZJA 4HV6A 5LHIA 4S05A 2K9NA 1IRFA 3CP8A 1OFCX 2DODA 2VQCA 1HLVA 3VODA 4YFNF 3O8HA 1R22A 5LEKA 3RZOJ 1DDNA 3HRTA 2X0LA 4L0YB 2KKOA 3WE2A 1BJZA 4IXAA 1MBJA 3WG7H 3IH2A 4XN3A 4ENNA 4O5VA 1ETYA 2WAEA 4Z6YA 2DTZA 3K4JA 4PUSA 3QYBA 3SDGA 3LNQA 2Y2ZA 2VIXA 4LK1F 2BXZA 2LKSA 2HZTA 1QA6A 3PNVA 5IY5H 9ANTA 4U88A 2CFXA 3HSFA 3WU0A 4GYIA 3PFIA 1F5TA 3HZJA 2FXAA 4BJTA 4LG0A 3ZMUA 5M5YJ 2RN7A 3FXUA 4V2FA 5C4JJ 3OS2A 2Z5UA 3V7SA 1YW9A 2CSOA 3BCAA 4A6EA 3GTPJ 2MFZA 1FZPB 5CJ9A 4FASD 2XKPA 2IS1A 2FX0A 2HVSA 4FE7A 4IHSA 4M3BA 4NUBA 1J7KA 1ZH5A 5D5XB 2A3SA 2OA4A 5BOXA 1LE8B 3FXMA 4RLFA 2QZ8A 4OAYA 3S17J 1ZHFA 2CV2A 1GV2A 2IA1A 2OJED 3BG9A 1U8BA 1QHGA 3CLQA 2CQQA 2C6YA 2N8GA 5FFZA 3RQIA 4II3A 2VKVA 3RQ4A 1E2XA 2HDWA 4EJWA 5LBQA 4WX9A 4II2A 3CC2I 4XLPF 4CGZA 2EV6A 2X9DA 3I58A 2A61A 1Y8RB 1Z6TA 5J3LA 3H35A 1G4DA 2EK5A 1ACIA 5BMZA 3TO6A 1FYKA 2L54A 2JVHA 1TTYA 2W00A 3DPTA 3DBLB 2FU4A 4CYCB 3M8EA 2D1VA 3DKWA 3PUBA 5DV5A 5FRNA 2GA1A 3KYDB 2XAQA 4XLFA 3OYEA 4YIFA 2V7FA 4BACA 5F0FA 3BQZA 3ULQB 3S2WA 3IAS2 2YUSA 4AIKA 2H6BA 1ZG5A 4HRIA 4BGDA 4E7LA 1EH8A 2LBFA 2NS0A 1T08B 1IN4A 3E5UA 4L9JA 3G1MA 2I10A 1V5EA 2BE5F 4I01A 1SEUA 2HOSA 3QP6A 2L7ZA 1KONA 2E1NA 4BDZA 4FTHA 2XB0X 2LH9A 1ZN2A 5DUIA 3K7AJ 1JJ8C 3A01A 2P6SA 1IW7F 4XQFA 2X51A 5EYRA 1YJNI 2J5OA 5L3BA 4NHJA 1T98A 1HC8A 2IVMA 4QSHA 3AL0B 4HDUA 2L5QA 1NK2P 3CJTB 4BQQA 3M1CA 2K9QA 3F8BA 3CCLI 1WJBA 4AVPA 4D0PA 3BR2A 3CCMI 3VSKA 3FHZA 4FQGA 3IKVA 2LKXA 4RMNA 1X2MA 1TW2A 4I98B 4DYCA 5A2QK 4CICA 4HF0A 3ERMA 1VNDA 1ERDA 1ONVA 4HX4A 4WF2A 1ULYA 2DAOA 3EPZA 2F2EA 1R49A 3LL7A 3F8MA 1VQ6I 2IAIA 2IGMA 5ILSA 4MTEA 1IXSB 5EZGA 1R1UA 4IHTA 3PNYA 2Z2SB 4CCKA 3K70C 2ESHA 5KCMA 2DN0A 5IOZA 2B63J 2K85A 1Z7UA 3C2HA 1J5YA 2A6EF 3CQZJ 1LKXA 2E36A 2LSOA 4WWCA 3LSGA 4KISA 1MSEC 3ZQHA 4B3AA 4MTDA 1OR7C 5FKLA 2RGVA 3ZMVA 2FD5A 4HX7A 3CP2A 3MD2A 3GYHX 4RGXA 4V2GA 2LD5A 1TNSA 3NRVA 1XD7A 2ZO4A 3JRGA 5D8LB 2CQ7A 1U5TC 2RNGA 1K78A 1Z3XA 4E7KA 3BPXA 1R4NB 4KITB 1H9GA 3MMYB 2PFBA 1W5SA 4F92B 2ZCWA 1R5ID 4F93B 1KQ8A 1LQ1A 3IKTA 3JW4A 4IHYA 4NB5A 1BIBA 1UG0A 2X6OA 4AIHA 4CXFA 4XRMA 1UAAA 5DYMA 3E97A 2EV5A 2K9LA 5J40A 1V4RA 4ZZLA 5J8FA 2A05A 4YEJA 2VJ5A 3BTLA 3DTKA 5AONA 1OJLA 4O6JA 3PUFA 2E1OA 3G3ZA 3CUQC 3IH4A 4NNJA 2FQ3A 2L9SA 2FEZA 4F91B 4ESBA 2DQRA 4G94A 2RQQA 5FD5A 1MGTA 2BHYA 3S1QJ 5L3DA 2DOEA 3OYKA 2QM3A 3HDDA 5F04A 2NNYA 1JGGA 3M4OJ 5M3MJ 1JUMA 2CW8A 5IP7J 2VONA 5JI6A 1EV7A 2EZLA 4J19A 3WTWC 1MJ9A 5HVQC 3H9QA 3GCMA 1E3HA 3OL4A 1FEXA 5ILUA 1ZGWA 2PMUA 3NEUA 2DYRH 2JZYA 1XB4A 3S14J 4C3JJ 3L00A 1N25A 3GZ5A 3V7RA 4IVNA 5HS9A 1WCMJ 5E1XA 2X1EA 4LB6B 4P55A 1L3LA 2M5WA 2CQKA 1JKQC 1WQ2A 3TOAA 2NVQJ 3GTGJ 2DMNA 2XASA 2KJBA 5LHHA 1RNLA 3HXLA 3ZOBA 3TP0A 1Y56A 2VE8A 3M8JA 4HV5A 4BHPA 4F7ZA 4AC0A 1YOVB 3K1NA 1ZKGA 2VUMJ 1LFBA 2UXNA 3R60A 4GCVA 2LLKA 2CV1A 2EFNA 2FOKA 3CMYA 2DK8A 2EZHA 4CZZA 1F1ZA 2BYVE 1UG2A 3LSMA 3MAJA 2VBXA 3CCEI 2P8TA 3G2BA 4N4OB 2QWWA 1S9HA 4D7MA 2ZMEB 1W36C 4XRSA 1Z7LA 2CUFA 3I56I 1FY7A 2L9RA 3QYEA 4C3HJ 1SVOA 2VC0A 1R9TJ 3OMYA 2V9VA 3M8FA 1AHDP 4V19K 3CLOA 1R5GA 2KRHA 1N77A 4WXDA 4BBRJ 1MDMA 1D1CA 2HXIA 2E19A 5EEGA 3SZPA 1XSVA 3KLNA 1T39A 2JN6A 4ESFA 3TMOA 3BG5A 3HOTA 3IRQA 2ID6A 4GO1A 2VT3A 4GYGA 4RAFA 3WODF 3JR9A 1TT5B 1ZLJA 2HVQA 3G1LA 1I1GA 3ECHA 1QNTA 3IC7A 4NDLA 3UR3C 2CV0A 4A3IJ 4GFBA 2X6XA 1MBFA 4P9UA 4FT8A 1IGNA 3BG6A 3HL2A 3HPHA 1D1BA 2OZ6A 4PK4A 4MGRA 4XN0A 2R7TA 1XSDA 2ZXWH 5FKKA 2I5UA 5IT9K 1FIAA 4G6DA 2E34A 5B1AH 4BYYA 3HSRA 2HQNA 3KP3A 4ZYHA 5E3OA 2Q2EB 5H6QA 2QYOA 4BE1A 4X1EA 2DDBA 4PFOA 3RKQA 2IS4A 3DP7A 2UV1A 3IP4B 2H6CA 2R7UA 4Y13A 1IUFA 4AYBN 4UUTA 3HM5A 3HJEA 3E5XA 4JX6A 3ZN0A 5FLMJ 3JRIA 4G8XA 2ECCA 3FIWA 1Y39A 4C30A 2HTJA 2HQAA 1VQ5I 3BLYA 5FROA 4A0XA 3MKLA 3ZMDA 3FXQA 4BU2A 5DTDA 3J7AY 4M3GA 2W57A 2ESNA 3HTSB 3I4NJ 3RIRA 1I3QJ 3JAMZ 2EQRA 2XPUA 3TBIA 3ERED 1HSJA 1OCTC 3OSGA 1MMAA 1IV8A 4XBFA 1JJ6C 2EA4A 2K7LA 4S0HB 3VFZA 4ENKA 1J0RA 2DJNA 1YRNB 4KN7X 5HLTA 1HOMA 1LDDA 3M9AA 2M7AA 2XVCA 5H2FC 3P9IA 3I5UA 1IRGA 3ABMH 2XF6A 4CCOA 2IRFG 3RYPA 4NQWB 2OTLI 2EPFA 2WBMA 3H92A 1FP1D 2DFIA 4YFKF 2JA7J 3CCVI 1LDKB 2R7DA 1IDZA 3RPQA 4IHWA 2OBPA 1MJBA 2BOLA 3KEQA 4UVBA 2H1KA 1QHHD 2P5VA 4L9TA 3LSRA 3ROUA 2PJRB 2ECBA 3KZZA 3ZCOA 2KDZA 4ENMA 3HSEA 3AAFA 5HLIA 3JRCA 4ZDPA 3KYCB 3BDDA 2BY1A 1WI9A 1T38A 1ETKA 1X1BA 3TEDA 2IEKA 4IRGA 3OIPA 3U1DA 2E2HJ 2VBYA 3EYYA 2NS8A 1UB9A 5L3GA 2FMLA 2JJ7A 1FSHA 1B9NA 5HS7A 3I4PA 3UKGA 4BS9A 3ZQQA 2FE3A 1Z05A 1BI0A 5GPAA 2WTEA 2DA7A 1XGOA 3T8TA 1FBUA 2NAZA 1ZQ3P 3OOUA 4TV7A 4Y33A 2XGCA 5DCMB 1PP7U 2VN2A 2JWTA 3J80Z 3HOYJ 1OCZH 3BT9A 1TWCJ 4I09A 2K40A 3H3ZA 3QP5A 1VTNC 1P4XA 3BR3A 2WADA 3PM1A 1B8IB 1EH7A 1RR7A 2M7BA 3IAM2 3N05A 1XCVA 1OYWA 4A12A 2KJCA 3FISA 1BI3A 4HF2A 2R7ZJ 2HR3A 3ELKA 5CVIA 4N9HA 2E60A 4CCMA 1QZZA 2AXTC 3E6CC 2E7XA 1SFEA 2X6YA 1W0TA 4Z2YA 5HDKA 1UELB 5AIPA 4AIJA 1ZYRF 1A6IA 4PSXA 2QSFX 5FKOA 3BR1A 2CW0F 2VE9A 1ORKA 1VQMI 3PSFA 1FOXA 2F5CA 3H5AA 2LFBA 2VASA 1XTAA 2W84A 1MSFC 1DP7P 1EJ9A 3LAPA 4OIQF 1I5ZA 2LC2A 2Q1ZB 4A0YA 2NRAC 4ZH4F 4LK0F 1AU7A 1JKOC 2L02A 4MNUA 4XM3A 1GT0C 4L9VA 3JAMK 3TOBA 1MZBA 1BC7C 1H88C 1TQIA 3I59A 1HQCA 3IHUA 4PFPA 3SZTA 1I39A 2LVSA 2QENA 3HRSA 1W1WE 5EF6A 3H0GJ 3KP2A 4LMYA 3OYJA 4ESJA 4HNUA 2F48A 4RA2A 3LA7A 2DMTA 3PSIA 1IXCA 3AFHA 3TKYA 2BXYA 4B47A 3C7JA 3PL8A 4A93J 1WH7A 1XMAA 2QA4I 4LB5A 3FXJA 3HRMA 5L3CA 5DUKA 4A3KJ 3ZQ7A 5B66C 3S2HJ 1OYIA 1OMIA 4L5EA 1STZA 2M8EA 1SMTA 4BNCA 3AL0C 1TP4A 2HKOA 4KYWA 1TWAJ 3K4CA 3GFMA 1K79A 3IL2A 2H8WA 5E20A 4IOCF 4C2UA 4HBLA 1TQMA 1PDNC 1ZGAA 1MNEA 1UHMA 1CF7A 1FWZA 3ZPLA 4YFXF 3S8PA 2DTRA 2HZDA 1E0EA 3MWMA 2MSYA 3JCUC 4DYRA 3DPLC 1ZRCA 4OIPF 1F4KA 2EFOA 3TGNA 4KDPA 2NOGA 3H0DA 2HOAA 2UZKA 3L2WA 3F8CA 5IP9J 3F6OA 2XROA 2GM4A 4XLAA 4L18B 3WTSC 2IP2A 2M87A 1X3WB 4Q47A 1Z3YA 3KP5A 2MG4A 4RB3C 4FETA 1QBJA 4QTRA 2LF7A 4KNYA 3AG3H 3ZGKA 2YX7A 3FMQA 1WWXA 4E4HA 1SC7A 3BJ6A 3DU6A 4HNTA 4OIOF 2CG4A 2OU2A 3NQOA 1W7PD 4BEHB 2A5WA 3K0LA 3I55I 3JRFA 2H1LA 1IV6A 4KUMA 2IXSA 3HIFA 2OTJI 1P6RA 2KFDA 1GUUA 5FRMA 2DMPA 3ML6A 3J80K 2BV6A 5EEHA 2EFQA 2XAGA 2E1MB 4P9FA 4E7HA 1A31A 5EGOB 2V1NA 3CCYA 1RPWA 1P2FA 2R5ZB 3OIQA 3V8KA 4EGYA 2XAUA 2F5DA 2HU9A 1HW1A 4AUXA 5E8IA 4ZDOA 3R4KA 3G1OA 4CCJA 4LIVA 4UUSB 3LSKA 3CTAA 1XMKA 4AM3A 1C0WA 2IGKA 2X1CA 3GZNB 5LRSA 3I9V2 1IAWA 2P6TA 5IYCJ 4IQJA 3B02A 4HX8A 5FLXZ 3BPVA 3K9TA 3J7AO 4N9IA 2LR8A 2MH2A 3SDBA 4BXXJ 1T56A 1LDJA 4ANJA 1WJDA 1SFXA 5DCMA 2HEOA 3CC4I 1YO5C 1GVDA 2K27A 1YW7A 1B6AA 1P7JA 1Y0UA 4XKBA 2TRTA 2STTA 3HOWJ 2O5RA 3DQVC 5FGMA 5D6FA 1B4AA 4XSZF 2EZKA 2GXGA 3WU2C 4WK8F 5JFRA 1FMWA 3KFWX 4Y15A 3ZMTA 1SFKA 5M5XJ 3HEFA 1YQAA 3E0JB 1YJWI 4A6DA 1YW8A 1G2HA 5KK1A 1UMQA 2BW3A 2V6CA 3HOZJ 2MC3A 5FJ8J 1LPQA 4GDFA 1TZLA 2FNPA 1LB2A 2ZC2A 1G3SA 3WG9A 2FBHA 2F4MB 2HTSA 2WV0A 2BY2A 2M34A 2JVGA 4BJ5C 3PQJA 1W7PB 3S1RJ 2RNJA 2XV4S 3GEZA 2JA2A 1HKQA 4RB2C 4U0WA 1ETVA 1EH6A 1LFPA 1HDDC 2EZIA 1G8XA 3B6CA 3FZVA 4IJAA 4M6YA 3TP3A 5C44J 3W2VA 2PBIA 3CC7I 1IZ1A 1FOWA 1FYMA 2M2EA 1U0JA 2JPBA 2LY1A 3JRAA 3ZN1A 2BEOA 3E7LA 5D4SA 3GVAA 4S04A 3QRFF 4G7OF 2FA5A 5E1WA 3BC8A 3TO7A 4KJZA 3CJRB 3FX3A 2FMYA 4MEYF 3VSLA 3L1PA 2DA2A 1D0YA 3HB9A 1V5GA 3S3MA 4I02A 3PFYA 2PG4A 2NOJB 1XSXA 3C3WA 3AG1H 4M3EA 4MQVA 4HQMA 1GXPA 2A6HF 2DYSH 1U3EM 5GTIC 4B09A 5C4XJ 4PJJA 5K5QA 1F36A 2KIQA 3HPGA 1YE9A 3VYSB 2P0WA 2X48A 1FC3A 1GXQA 1UHWA 2IGOA 3DLAA 3MZ8A 1FOKA 3I71A 2COMA 2MW8A 3TQNA 5F1RA 2QQAA 3OYAA 1AOYA 3VWBA 2X85A 5B5EC 4DNCA 1XCBA 1X3UA 2CU7A 3KEYA 1QU3A 4Q5SF 4IPAA 2CGPA 2E35A 4ON0A 2BVMA 5IPAA 4MIMA 1W4MA 2W4SA 3QPLA 4N0BA 3DKYA 4ZZDA 4G6TB 2PEXA 3CCJI 2BHZA 4RAZA 4XRFA 3EUAA 1YIJI 1IDYA 2V1XA 2PMHA 5E17F 2JRMA 3S1MJ 3HKZA 2H8RA 3OYGA 1TT0A 3DPUA 2R7OA 4M6VA 2HDDA 4A0ZA 5HS8A 2ISZA 3ZQLA 3BTIA 4QIWN 2O8XA 4LOCA 1MBGA 5ED4A 2I8DA 4I0AA 2B7EA 3CESA 3FKJA 4G9YA 2X1DA 2ZJPF 2VOPA 3TL4X 5ICGA 5KAIC 4AYBA 3JTHA 2ZXJA 5GAEJ 3PNTA 2HOEA 2LK2A 3MCZA 3F8FA 3TDUC 4U7DA 2R0QC 3T1BA 4BEHA 6PAXA 5CLSA 2RREA 5ICEA 4R1HA 5D6EA 1ETXA 3S3OA 3SXYA 1WJCA 3AG4H 3BP8A 1FYLA 4MQ9F 3TW6A 5J8CA 2FQ4A 1KQ0A 1RIOH 3A4CA 1G6NA 3HG9A 1Y0NA 3LOCA 2D2WA 1WH5A 3CJNA 1JT0A 1FT9A 2ZNZA 4D5FA 3RDIA 4RAGA 4HLXA 5EGOA 2QSHX 1YX3A 5GPCA 3IRRA 2F5FA 2R5ZA 2RAEA 1WRJA 3U2RA 3V8JA 4L9NA 4XKVA 2DFEA 2CUZA 1L0OC 4HEA2 3WTYC 3S16J 5GAHJ 2CQXA 1T95A 2Y30A 1KU3A 1OPCA 1T6SA 2L3DA 4E7JA 4PSWA 1X58A 4E6KG 5HLHA 1U78A 2JK3A 3F23A 2LREA 5D5VB 2EH3A 1TL8A 1FJLA 3GTMJ 4LGWA 2L7KA 1QZYA
chains in the Genus database with same CATH topology
2JSPA 4ZTFA 3KX2A 4B44A 2OUMA 4XORA 4C30A 4E7ZA 2HQAA 3BLYA 5FROA 4U7BA 1X4PA 2VJIA 4BU2A 3J7AY 3KYLA 4IX7A 3K4LA 3GBGA 2K9MA 1BOBA 4HSTA 3TBIA 3OYCA 2K5CA 3MKYB 4J01A 3K4KA 4DJAA 1MMAA 2UUZA 2XDVA 2A6TA 3RCOA 4DOZA 3H9JA 3LMMA 5HLTA 2M7AA 3K10A 4B43A 4BE2A 4RM2A 1PJRA 2XF6A 2KRCA 4CCOA 1AA7A 3OYLA 4NQWB 4RLQA 4XR6A 2LBFB 2WBMA 4CZCA 2UWMA 1X1DA 1JI8A 2DJIA 3RTRA 1LDKB 3OYBA 1BR1A 1R6RA 3BG7A 2BOLA 4BUPA 1QHHD 3RPUD 2PJRB 3HUGB 3ZCOA 4XNFA 3ZRGA 2MABA 2ZSIB 1NG7A 3K4MA 2M0MA 2R7QA 3DU5A 1P9QC 2OC6A 3FBIB 2BVLA 5HOOA 4R79A 4ZDPA 2VJ4A 2XF7A 4CSWA 1X1BA 2R7XA 2LY2A 3RSNA 3FBNB 3OIPA 1WJ5A 3OY9A 1K6YA 4ZC3A 3D5RC 1N75A 1VZ0A 4LG3A 2K3PA 4XLEA 3SEQA 4BS9A 3OYIA 3ZQQA 4ZYAA 4ZDLA 4IQ4A 1SAUA 3OOUA 2R4GA 4Y33A 2AQEA 3CF2A 4XLHA 2CUJA 1WJAA 1J09A 3H5NA 2JUGA 4DBQA 5LD2C 2VKHA 4MLOA 2KPMA 1PYVA 2PMZA 4CCLA 1BR4A 2KLOA 2L9NA 5KNLA 3K70D 2KQRA 3MKWB 4ITVA 4XONA 4BDYA 4XKCA 2WADA 4YELA 5HNHA 2V6EA 1N78A 1Z21A 2M7BA 3IAM2 3N05A 2VQHA 1WJEA 2WAFA 3V42A 2AQFA 2X6WA 3OS0A 2IS2A 4NC8A 3CP8A 2VQCA 3OR1C 4U87A 3E1SA 3K4NA 2GOMA 2E60A 4CCMA 2V26A 4XN3A 3EUHC 4F52A 2WAEA 2KDOA 2X6YA 3K4JA 4PUSA 3QYBA 4D9JA 4BE0A 1V5FA 4CCNA 2VIXA 4DBRA 1UELB 2W82A 4X0GA 4QPQA 4PSXA 3PNVA 3PJRA 3SYTA 1MNDA 3PSFA 3W2WA 3F9KA 3H5AA 2VASA 2F4IA 2Z16A 2LYCA 5TGTA 4BJTA 2LC2A 2KMUA 2Q1ZB 2MD0A 3I3LA 2WB1A 3OS2A 2E5ZA 3BCAA 2V9KA 2MFZA 3ONQA 4FASD 2VKDA 4XM3A 2IS1A 3OYMA 4C2TA 2HVSA 2M4GA 3CMMA 4B48A 4P1WA 4NUBA 4HPQA 4PFPA 3QODA 2XSJC 4LIUA 4PJNA 4JQFA 4RLFA 3OYJA 4OAYA 2CV2A 4HNUA 3CZ6A 3PSIA 4B47A 3AFHA 1OLTA 5LFAA 2R7SA 4YRVA 4NC7A 1QHGA 3VYUB 3PL8A 3DTEA 3OS1A 4II3A 4D1QA 3RQ4A 2HDWA 4II2A 1DGRM 3AKZA 3AL0C 2CH0A 2IS6A 3H35A 4BQOA 2E1MC 2WY7Q 2WA0A 2GOXB 3K4CA 2VJJA 1HA8A 1NG6A 2WY8Q 1X1CA 2JVHA 2W00A 3DPTA 4OAZA 4C2UA 4CUGA 1MNEA 3PUBA 5FRNA 3OYEA 4XLFA 3S8PA 2V7FA 4BACA 2HZDA 1E0EA 3IAS2 3DPLC 4HRIA 3D5SC 2DCEA 3H0DA 4BGDA 2FUG2 4E7LA 2LBFA 3L2WA 3L2QA 4XLAA 1V5EA 4XMYA 1W36D 4JOMA 1Z3YA 1KONA 4BDZA 2VB6A 2LH9A 4FETA 4HSRA 3ZGKA 4E4HA 4PJMA 3DU6A 4XQFA 4HNTA 3HOSA 3S32A 4BEHB 2A5WA 2HNHA 2M4KA 4QPOA 4EATA 2R7WA 2IXSA 2X51A 3VYRB 3VDXA 3EUKL 2E5NA 2HPIA 5FRMA 1DGWY 3AL0B 2L5QA 4AU7A 4BQQA 2E1MB 3M1CA 4E7HA 1WJBA 2V1NA 3VSKA 4B3XA 3OIQA 2XAUA 2DT6A 2HU9A 4RMNA 4ZDOA 4CCJA 1X19A 4LIVA 4F3QA 2DOAA 3LSKA 2IGKA 1ERDA 1YX5A 1ZELA 3H5RA 2X1CA 2CS3A 3EPZA 3I9V2 5CQGA 3LL7A 2F6CA 4IQJA 5KHDA 2LOOA 2IGMA 3SZGA 2LG4A 3PNYA 3A1YA 3SDBA 3OYNA 2Z2SB 2MYSA 4BQNA 4CCKA 2CMPA 4ANJA 1WJDA 3K70C 3ZXSA 5KCMA 3MKZA 3A2KA 3C2HA 4BXFA 4H4KC 4XKBA 1LKXA 1WJFA 2O5RA 3DQVC 2KHMA 2HVRA 3LSGA 4KISA 4OWRB 2VLAA 2R7RA 1FMWA 1OR7C 2MC4A 5CPRB 1SFKA 4E7IA 4KT6A 3CP2A 3E0JB 3MD2A 4ZTJA 2VQLA 2BW3A 3OYDA 3FDYA 2RNGA 1Z3XA 4E7KA 5HNFA 4XL9A 4KITB 3MMYB 2ZSHB 4F92B 4IZZA 1FMVA 1TZLA 4E7SA 4F93B 2XC7A 2W1OA 1UG0A 3LFUA 2JVGA 3S93A 4BJ5C 4ZJZA 1UAAA 4PJLA 2VPLA 1X4OA 4XOPA 3DWLE 2M3AA 2K9LA 2JA2A 3OWTA 4IKFA 1D1AA 1LFPA 3C2GA 4YEJA 2VJ5A 3HC7A 3DTKA 3L2VA 3NWTA 1G8XA 2VL8A 3W2VA 4NNJA 2KL4A 2L9SA 2CFOA 4F91B 1DQUA 1U0JA 3L2UA 2LY1A 2QKLB 2RQQA 2HPMA 2QKMB 1WFXA 2CW7A 4N4NB 3OYKA 3BC8A 4KJZA 3CJRB 3VSLA 3K4BA 1D0YA 1V5GA 3S3MA 2CW8A 3PFYA 2NOJB 3IUOA 5HVQC 3H9QA 2VXZA 4Y3OA 3OL4A 3DTIA 3W3CA 2OV7A 3NWSA 4PJJA 3HPGA 3U21A 1YE9A 3VYSB 2P0WA 1MMDA 2WAQA 3DLAA 2IGOA 4HG2A 3L2RA 2ZXIA 3K6GA 3D5LA 2X1EA 4BJ6C 3OYAA 4P5OA 3VWBA 2X85A 3BCBA 3CJQB 3KEYA 1QU3A 3HXLA 4DGWB 4BL0B 1Y56A 2Z1DA 1MMNA 1BR2A 3M8JA 2PJRA 2Y0SA 2BVMA 4XLCA 4XKWA 2W4SA 2L2OA 3DKYA 2XF5A 4G6TB 2CV1A 1LVKA 3EUAA 3OYHA 4LITA 4DIQA 3LSMA 3FHNA 3OR2C 2ZXHA 3LSIA 3QYFA 1T0FC 3G2BA 4N4OB 1S9HA 3HKZA 4CH7A 2R7VA 1W36C 3OYGA 1TT0A 3DPUA 2R7OA 1Z7LA 4AVZA 4XOTA 3QYEA 2I8DA 2VQGA 3CESA 3FKJA 1D0XA 2VXDA 3OMYA 2X1DA 2KRHA 1N77A 2F5VA 3TL4X 4RM3A 4AYBA 1D0ZA 5CQEA 1G59A 1D1CA 3PNTA 1GLNA 4F55A 2KZVA 3TMOA 4BEHA 1IRXA 2W7NA 2RREA 3HOTA 3S3OA 1WJCA 3SEZA 1MMGA 3QOEA 1EA3A 3OYFA 2IGNA 2HVQA 3UR3C 1DP3A 3A4CA 3ZR8X 2CV0A 3HG9A 2ZFUA 2V4JC 1Y6IA 2X6XA 3BG6A 5JHFA 3HL2A 3HPHA 4C9YA 4J00A 1D1BA 4PK4A 2LRDA 4Y4RA 4XN0A 3LSHA 1YX3A 3H9GA 2BW3B 2DXIA 2R7TA 4CA0A 4XKVA 5CKTA 2CUZA 4GRIA 4HEA2 3OL3A 3W2AA 1T95A 2Q2EB 4BE1A 4E7JA 3UNGC 2ELJA 4PSWA 1X1AA 2KP6A 4PFOA 3VYTB 4E6KG 3S3NA 3DEEA 2LREA 2IS4A 2UV1A 3DKXA 3IP4B 2R7UA 2L7KA 2DT7B 1MW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S93 A;  2LH9 A;  2KPM A;  3RCO A;  2LY1 A;  2LY2 A;  2KZV A; 
#chains in the Genus database with same CATH topology
 3B73 A;  1O3T A;  1VQL I;  3V8L A;  2EB7 A;  4B44 A;  3K1M A;  2OUM A;  4EV0 A;  4XOR A;  1FLI A;  3F3X A;  2IPQ X;  4DZJ A;  5LHG A;  1MD0 A;  1TWF J;  2EIJ H;  1B72 B;  2P5L C;  2DT5 A;  5J1R A;  1ITY A;  3KYL A;  1FTT A;  3T5X A;  5BNG A;  4FCY A;  1UZC A;  1V54 H;  4KIB A;  4ABZ A;  2R5Y B;  1JTX A;  2K9M A;  1XMX A;  3FK7 A;  4HST A;  3WE3 A;  2K5C A;  1QVT A;  2R93 J;  5EG0 B;  3LSP A;  1TWH J;  1QPI A;  3GFJ A;  2GXA A;  1ZGJ A;  3HBL A;  2F4O B;  2DPD A;  3L9F A;  2XDV A;  2LTP A;  2RV8 A;  1DPU A;  4CHU A;  3H9J A;  2CQN A;  3WGG A;  3K10 A;  4B43 A;  1MJA A;  4BE2 A;  1LE8 A;  2JPC A;  1T8I A;  3GWZ A;  4H0E A;  4Y52 J;  3JRD A;  3L7W A;  2ZFW A;  2VT2 A;  1K61 A;  3RTR A;  2MBF A;  2HFH A;  3KLO A;  4ENJ A;  1BR1 A;  3DBR B;  3W6V A;  1D8J A;  5FKN A;  3RPU D;  2A07 F;  1PUF B;  4B4C A;  2GIV A;  2E2J J;  4JYK A;  4ZYD A;  2QBY B;  2MLK A;  2WC2 A;  1R71 A;  1YYV A;  2M0M A;  3Q0V A;  2DA6 A;  2KT0 A;  2VJ4 A;  4QWQ A;  4CSW A;  2XRL A;  2R7X A;  3RSN A;  3FBN B;  4CYC A;  4I99 C;  1DU6 A;  4G7H F;  5LEJ A;  1R00 A;  1G3Y A;  1FTZ A;  1QVU A;  1SAN A;  4G7Z F;  3KZI C;  1BI1 A;  5F27 A;  2DMQ A;  4LG3 A;  4HNV A;  1R4M B;  4ZYE A;  2E7W A;  3GLL A;  3MVP A;  3GUD A;  4ASN A;  4XLE A;  3OYI A;  4ZYA A;  1HBX G;  4ZDL A;  5DM6 F;  3GFI A;  1VQP I;  2R4G A;  3FXR A;  2BY0 A;  3BQY A;  1IN5 A;  1X1P A;  4DBQ A;  4YG2 F;  4BAY A;  5B3S H;  1VI0 A;  3E6B A;  4KFC A;  1W5T A;  1D8K A;  3K70 D;  4RB1 A;  2R92 J;  2DW4 A;  4BDY A;  4NC6 A;  2V6E A;  3DXJ F;  1Z21 A;  3DV8 A;  3ZMZ A;  5K7H A;  5E3L A;  2HQ5 A;  1RUN A;  5CVJ A;  2VQH A;  1WJE A;  3V42 A;  2AQF A;  2L7F P;  2X6W A;  3DEU A;  3OS0 A;  4A3J J;  1HW2 A;  4NC8 A;  2XSD C;  2HYG D;  2ZBK A;  4U87 A;  2MA3 A;  3HKZ N;  1QZE A;  3K4N A;  4EM1 A;  3COA C;  3F21 A;  1O3S A;  2V26 A;  4IRI A;  4W1U A;  2HDC A;  1R23 A;  5DDG A;  2HOT A;  4F52 A;  2KDO A;  2E2I J;  3V7C A;  4BE0 A;  2PN6 A;  2Y48 A;  1FIP A;  3HHH A;  4D9J A;  5LGU A;  3P7N A;  3QAH A;  2IT0 A;  2W82 A;  1KGS A;  1EKE A;  5K7Z A;  1YS7 A;  5IP6 A;  3SYT A;  1U9N A;  1MND A;  2O0Y A;  2NVT J;  2K86 A;  3F9K A;  1Y8Q B;  2F4I A;  2Z16 A;  4XID A;  1FBQ A;  5TGT A;  3ZQF A;  2QF7 A;  3D1N I;  2KMU A;  2DFH A;  5CVV A;  3N97 A;  2MD0 A;  3I3L A;  2WB1 A;  3PQK A;  2E5Z A;  2V9K A;  2VKE A;  1ZLK A;  5J1Y A;  3OYM A;  1NTC A;  4C2T A;  1FP2 A;  1J9I A;  1XN7 A;  1KZH A;  5B1B H;  2HYF A;  5D5U B;  4B48 A;  5E79 C;  3JSP A;  2EFW A;  4RDU A;  3I54 A;  3QOD A;  1ETO A;  2CJJ A;  4XSX F;  2VOD A;  4PJN A;  1KU7 A;  4JQF A;  4A5N A;  3T8R A;  1ZTR A;  3HOV J;  5GAG J;  4IRH A;  2QLZ A;  2DQL A;  5LFA A;  4A3E J;  3H3V K;  1OLT A;  4YRV A;  3Q0U A;  3K1P A;  2O7O A;  1CGP A;  1XGM A;  3OS1 A;  3GTK J;  1PP8 F;  4HLY A;  5ICF A;  3H3U A;  4G6Q A;  1T33 A;  2KIM A;  1P92 A;  3R0A A;  1DGR M;  2Y69 H;  3SFI A;  4DYQ A;  4UV8 A;  5J6X A;  2E1M C;  2ZJQ F;  2WA0 A;  1VQ7 I;  2GOX B;  2VJJ A;  1ZRF A;  4A3B J;  1FOY A;  4UXN A;  2R5Y A;  3CCQ I;  2QQB A;  5JVT A;  2WY8 Q;  5EG0 A;  2R3S A;  1J59 A;  4OAZ A;  1R5H A;  2PLY A;  4UNO A;  1I50 J;  1TWG J;  1P4A A;  3GF2 A;  3P9K A;  5DD4 A;  5E3N A;  3ZQI A;  2OAZ A;  2KZG A;  3R6S A;  3ABU A;  2Q0O A;  1V55 H;  3LSJ A;  3D5S C;  2DCE A;  3W6J B;  3SHF A;  5IYB J;  4A3C J;  3Q9V A;  5K5O A;  5J47 A;  1SFO J;  4RBO A;  4XLN F;  1W36 D;  3CDI A;  5IT3 A;  3E6D A;  4DZP A;  1OCR H;  2IA2 A;  4Q48 A;  2IW5 A;  1NH3 A;  5M5W J;  2HNH A;  2M4K A;  4QPO A;  4M73 A;  3LA2 A;  3CUQ B;  5BPD A;  1IUY A;  2GZW A;  2E5N A;  2HPI A;  1IRZ A;  2DU9 A;  3GTJ J;  1IF1 A;  3G6E I;  2LDU A;  4AU7 A;  5FKM A;  3EDP A;  1EF4 A;  4CDG A;  1BC8 C;  3CDL A;  1YHQ I;  2NYX A;  4UY8 I;  1MH4 A;  5DCF A;  2DT6 A;  1OQY A;  4I0B A;  2EWN A;  4F3Q A;  2DOA A;  2ZME A;  1RKT A;  1H0M A;  1JKP C;  1HW5 A;  4D5C A;  2CS3 A;  3GTO J;  4IEJ A;  3WTU C;  2LP0 A;  5F08 A;  3OSF A;  4L0Z B;  1NK3 P;  3SZG A;  2WWY A;  2KIS A;  3F72 A;  4BQN A;  2MYS A;  3OYN A;  3O8G A;  2VBZ A;  3ZXS A;  3MKZ A;  4UB8 C;  4BXF A;  3F22 A;  1VFC A;  3FKI J;  1WJF A;  4EM0 B;  5K5R A;  1PUE E;  1OIS A;  3GW2 A;  3FM3 A;  4YIR X;  2KHM A;  4LG0 B;  2DA3 A;  1WI3 A;  4OWR B;  2VLA A;  2M30 A;  3I53 A;  5F64 A;  2R7R A;  1Z1D A;  4KN4 X;  1O7F A;  1K6O A;  4UHT A;  2MC4 A;  3L2C A;  5CPR B;  3LST A;  4WXH A;  4ZTJ A;  1MBK A;  1AKH B;  2VQL A;  4KMF A;  1R58 A;  4XIC A;  2QSG X;  3U9G A;  2XPV A;  3I64 A;  5EDN A;  1VQK I;  2YS9 A;  4HDV A;  4X6A J;  4XL9 A;  2F5E A;  4WCG A;  2Q2E A;  1CQT A;  3RPU A;  2AXL A;  3HOS A;  1A04 A;  2QUF A;  2XKO A;  3N4M A;  3QU3 A;  3S93 A;  4ZJZ A;  3IWZ A;  1XDU A;  2RQP A;  2VPL A;  3WTT C;  3HYI A;  1ZG1 A;  2R7F A;  3OWT A;  1H89 C;  3JRH A;  3L2V A;  5TJJ A;  3NWT A;  2VL8 A;  4EQQ A;  2MH9 A;  2KL4 A;  2W25 A;  2CFO A;  3GXO A;  1JGS A;  4FHT A;  2XAH A;  3BRO A;  1M1E B;  5H6R A;  3MFK A;  3L2U A;  2QKL B;  4KIC A;  3QWL A;  5M3F J;  2HPM A;  3HOX J;  4LLN A;  1KU2 A;  1WFX A;  2XHK A;  4N4N B;  1S6L A;  3E5Q A;  2XGX A;  2NS7 A;  1S72 I;  2OPT A;  1POG A;  2L01 A;  3G73 A;  1JHF A;  3D0S A;  3K4B A;  4HW0 A;  2WB1 N;  2ZNY A;  3FMS A;  1BN5 A;  2PI0 A;  3A0H C;  2HKX A;  5EJC A;  3FXO A;  3IUO A;  1KU9 A;  4Y3O A;  5K7F A;  1YRN A;  4IL6 C;  2PX9 A;  4E70 A;  3JRB A;  2TCT A;  1RI7 A;  2ME0 A;  2ZB9 A;  3LA3 A;  1XGN A;  1MMD A;  3MN2 A;  2Y75 A;  4NQW A;  2ZXI A;  3A01 B;  3K6G A;  1LUJ B;  2ADU A;  3EUH A;  3D5L A;  1VQ4 I;  2L0K A;  4MFD A;  4BJ6 C;  4UVC A;  1APL C;  5IOY A;  3GTL J;  4OIR F;  4P5O A;  1DU0 A;  1REP C;  1A36 A;  5L3E A;  1WKM A;  4L5I A;  1Q1V A;  3WHC A;  4DGW B;  2VOO A;  3CUO A;  2OQG A;  2Z1D A;  1MMN A;  1BR2 A;  2FOW A;  2PJR A;  1K4S A;  1X2N A;  4XLC A;  4XKW A;  1J75 A;  2L2O A;  3RJP A;  4EEF G;  3S15 J;  1BIA A;  2DA4 A;  1YI2 I;  1LVK A;  2E71 A;  5BS6 A;  3OYH A;  4LIT A;  4DIQ A;  1VQO I;  2A68 F;  2ZXH A;  1XDS A;  2R7V A;  2DFF A;  4CH7 A;  3HGY A;  4YII A;  4AVZ A;  4I2O A;  2DMU A;  4B1R A;  4D7N A;  1A35 A;  3SFZ A;  3DLL F;  2P7V B;  2DO7 A;  5DS9 A;  2VQG A;  2BY3 A;  3B6A A;  4HAM A;  2V1U A;  3CO6 C;  1D0X A;  2VXD A;  4M72 A;  4CO8 A;  1YTY A;  3HHG A;  1D0Z A;  3EET A;  3BOQ A;  1GLN A;  4F55 A;  1R7J A;  3DBH B;  5DD8 A;  4A3L J;  1IRX A;  2QCO A;  3QOE A;  4EJT A;  3OYF A;  1I6X A;  1TW3 A;  1DP3 A;  5J1U A;  1D3Y A;  2Y0S N;  1GDT A;  4C9Y A;  2K9S A;  4J00 A;  3F0C A;  3G4S I;  3Q0W A;  3LSH A;  3H9G A;  2DXI A;  5LRR A;  4CA0 A;  1B8I A;  5D5W B;  2XB5 A;  4I6Z A;  3BTC A;  1USS A;  1K78 B;  4FX0 A;  5K1Y A;  5CKT A;  3BZ6 A;  1ODD A;  4MFE A;  3V4G A;  2M45 A;  2GXB A;  3E6M A;  1HXD A;  3UNG C;  2ELJ A;  3GLX A;  1X1A A;  3VYT B;  3S3N A;  3DEE A;  1IN8 A;  3QU6 A;  3ZP5 A;  2DLL A;  3JTG A;  3PO3 J;  2NVX J;  2FBK A;  4GXO A;  1LVA A;  1U9O A;  4KMU X;  3FF5 A;  2FBI A;  4ZTF A;  3IH3 A;  4UVA A;  2HWV A;  1TLH B;  2DOF A;  2H09 A;  1WPK A;  2ID3 A;  1X4P A;  2VJI A;  4KA4 A;  3ZMS A;  2JTV A;  2K4J A;  1Z6R A;  5DM7 F;  1UJ8 A;  1O4X A;  1TBX A;  1AKH A;  2XAJ A;  3A02 A;  2D45 A;  2QEX I;  3K2A A;  2JA6 J;  1O3R A;  2OZU A;  3MKY B;  1FBS A;  3RKY A;  4DJA A;  4U0Y A;  2DPU A;  2OF7 A;  1BI2 A;  2UUZ A;  2ZME C;  4EM2 A;  2A6T A;  1S5L C;  1HST A;  4DOZ A;  3KET A;  5HDG A;  3LMM A;  4I7H A;  4EVI A;  3EYI A;  1RRJ A;  1BW6 A;  2JA8 J;  2KRC A;  3OYL A;  4RLQ A;  4XR6 A;  2YSR A;  5EZH A;  4XRS G;  3C18 A;  1X1D A;  2STW A;  1JI8 A;  2DJI A;  1WSU A;  1I27 A;  3IV5 A;  4KIG A;  4LFU A;  5J4Y A;  1IN7 A;  1S3J A;  1IG7 A;  3LWF A;  5KVR A;  4Q4Z F;  3DCF A;  1Z67 A;  4BUP A;  3BG3 A;  5ILV A;  2IBD A;  3FXL A;  2ISY A;  1FPQ A;  3OV8 A;  3GME A;  3HUG B;  4XNF A;  3ZRG A;  2V1D A;  1UST A;  2GQQ A;  2H94 A;  5D4R A;  5AIQ A;  2VPR A;  1NG7 A;  2GBY A;  3K4M A;  4O3M A;  1R36 A;  3DU5 A;  1P9Q C;  2B9S A;  3I4M J;  5HOO A;  3LAJ A;  2QQ9 A;  4R79 A;  2XF7 A;  2ACJ A;  3ZQG A;  2HGC A;  1MMS A;  4PDK A;  1DUX C;  3I0T A;  3MZY A;  2LY2 A;  1TC3 C;  4PGH A;  1WJ5 A;  1VQ8 I;  2D1H A;  3AG2 H;  1I3A A;  3F6V A;  4HZF A;  3OY9 A;  1JUP A;  4ZC3 A;  3J81 Z;  2EIK H;  4UB6 C;  5J4V A;  1N75 A;  1Z0X A;  4CYD A;  1VZ0 A;  3R61 A;  1BA5 A;  1MDM B;  3SEQ A;  1OCO H;  4JP0 A;  2P5K A;  4IQ4 A;  2XRN A;  3H36 A;  1SAU A;  3KEO A;  3CDH A;  2AQE A;  3CF2 A;  5D8K B;  4XLH A;  1D5V A;  3H5N A;  5IYD J;  1Y1W J;  2O6G E;  4A5M A;  5FLX K;  4MLO A;  2Y0M A;  2B0L A;  1PYV A;  2PMZ A;  1ZAO A;  1BR4 A;  2KLO A;  3VEP A;  2EFP A;  2KQR A;  4FX4 A;  3MKW B;  1RES A;  4XON A;  5HNH A;  1LJ9 A;  3VPR A;  3SJM A;  2L4A A;  1Z91 A;  4BH9 A;  2AHQ A;  5FFX A;  4A3D J;  2IS2 A;  4IOA F;  2HQR A;  3HGG A;  2H27 A;  1Q1H A;  3EQL F;  2DI3 A;  3OR1 C;  1GV5 A;  1ETQ A;  2X4H A;  1K7A A;  2YPR A;  3E1S A;  3HTU A;  4UUS A;  2GOM A;  5JHU A;  3CMA I;  4IHX A;  1FX7 A;  2GA2 A;  1MH3 A;  3G71 I;  3EUH C;  3J7Y J;  1ETW A;  1MKM A;  1H8A C;  3M1E A;  3FM5 A;  3KCC A;  3MZH A;  2G9W A;  1MNM C;  4K2E A;  1V5F A;  4M9X A;  4CCN A;  2Z3Y A;  4DBR A;  2DA1 A;  4M6X A;  4HF1 A;  4FE4 A;  4X0G A;  4QPQ A;  5JVG F;  3PJR A;  3BJO A;  5IT9 Z;  5F6F A;  2ETH A;  3W2W A;  1F9N A;  1VF9 A;  2K3F A;  5C3E J;  1KA8 A;  2LYC A;  4L5J A;  1G3T A;  2FRH A;  2UXX A;  2G7H A;  1OCC H;  3WTV C;  2TDX A;  3ONQ A;  2VKD A;  3A0B C;  1ZR4 A;  1X3Z B;  2M4G A;  3CMM A;  2EIM H;  4P1W A;  2D5V A;  4HPQ A;  2XSJ C;  3BTJ A;  2EBI A;  4LIU A;  1T0F A;  1YIT I;  3BZK A;  4AD9 A;  2Z9O A;  2KIF A;  3CZ6 A;  2R7S A;  4NC7 A;  1U6G A;  1U2W A;  3VYU B;  3ESW B;  1HDP A;  4ZYG A;  3DTE A;  1SVL A;  3T0Y A;  4D1Q A;  1XGS A;  1W7P A;  4MHG A;  1QGP A;  2J5P A;  2L7M P;  4KT5 C;  2VC1 A;  5DEQ A;  2W85 A;  4LJZ F;  3OIO A;  3AKZ A;  5FLV A;  2CH0 A;  2IS6 A;  4BQO A;  2WY7 Q;  1JXS A;  4A3M J;  1HA8 A;  2KRF A;  2GAU A;  1NG6 A;  5CVU A;  1X1C A;  3CF5 F;  3FXK A;  3WTX C;  2YU3 A;  1BL0 A;  3CD6 I;  2FNA A;  3WGI A;  5TIS C;  4OU0 A;  4CUG A;  4BBS J;  1HKT A;  4HQE A;  4A3G J;  4A69 C;  1ZRD A;  1VQN I;  1YFH A;  3WTZ A;  5BQT A;  1ENH A;  3TO9 A;  2XUB A;  2XIG A;  1B9M A;  2FUG 2;  5JLX A;  3L2Q A;  1JUS A;  3O2P E;  2DA5 A;  2QGU A;  4XMY A;  3J81 K;  1SMY F;  1XC5 A;  4JOM A;  3WHB A;  1AWC A;  2V79 A;  2VB6 A;  2Y9Y A;  4HSR A;  2ZJ2 A;  2EIL H;  4PJM A;  4EJU A;  4BHB A;  3HUG A;  5TRD A;  3S32 A;  4NBQ A;  1GVJ A;  4EAT A;  1MIJ A;  3ECO A;  4RB0 A;  5FB2 A;  2R7W A;  3VYR B;  3VDX A;  3EUK L;  4M3D A;  2ICW G;  3SQN A;  2MGQ A;  1FNN A;  3K2Z A;  4JBA A;  1DGW Y;  4BY1 J;  4AWX B;  2AS5 F;  3LQR A;  4RS8 A;  4R8H A;  3O3K A;  3BY6 A;  2LKP A;  3QQA A;  4B8X A;  1QPM A;  2A5Y B;  4B3X A;  2RC4 A;  1JKR C;  1IO2 A;  1VQ9 I;  5H20 A;  1X19 A;  2RDP A;  5KAF C;  1YX5 A;  1ZEL A;  3H5R A;  2DBB A;  2ELK A;  5F0H A;  2CUE A;  5CQG A;  1YS6 A;  4U0V A;  1E17 A;  2F6C A;  1XS9 A;  2O8K A;  5KHD A;  2LOO A;  3Q3S A;  2K02 A;  1GHC A;  2LG4 A;  3Q9S A;  3GX4 X;  3A1Y A;  3DF8 A;  2CMP A;  4LLL A;  1T2K A;  2YU9 J;  3CME I;  2P7C B;  3A2K A;  1QQI A;  2LY9 A;  2GLO A;  4H4K C;  2CYY A;  2KIU A;  3GTQ J;  4OOI A;  1OCP A;  2M8G X;  1LNW A;  4WXC A;  2HVR A;  2GIZ A;  2YR2 A;  1PVE A;  1S8N A;  2Y9Z A;  1IJW C;  4UUV A;  2ELH A;  2IJL A;  1RC9 A;  2M1B A;  4M74 A;  1ZK8 A;  1G3W A;  1OKR A;  3RYR A;  2FJ1 A;  4E7I A;  4KT6 A;  2PMZ N;  1U8R A;  3ZQC A;  3GFL A;  4UV9 A;  3OYD A;  1UCR A;  3I59 B;  3FDY A;  3JSO A;  2EJR A;  3VOE A;  5HNF A;  5E3M A;  2G7U A;  1RET A;  3X2Q H;  1LEB A;  2ZSH B;  4IZZ A;  1FMV A;  4E7S A;  2XC7 A;  5E1Z B;  1WZ2 A;  2W1O A;  2MLG A;  1R1V A;  1R1T A;  5HLG A;  4G12 A;  1SVM A;  3S1N J;  3LFU A;  1SD7 A;  4PJL A;  1X4O A;  2VBW A;  3DWL E;  4XOP A;  3P9C A;  2M3A A;  3RKW A;  5CYV A;  4IO9 F;  4IKF A;  1D1A A;  2COB A;  3C2G A;  3HC7 A;  2BGC A;  3H1C A;  3GZ6 A;  1DQU A;  1K4T A;  2MD5 A;  1B72 A;  1J2X A;  2QKM B;  2CW7 A;  3ISP A;  5JR3 A;  1ZAR A;  1KYZ A;  2JSC A;  5HDN A;  1CF7 B;  1YIO A;  2W24 A;  4IF4 A;  1RR8 C;  4IHV A;  2CO5 A;  5FD6 A;  4BY7 J;  1K83 J;  2RVC A;  1S7A A;  4OIN F;  3KP4 A;  2JT1 A;  4JK1 X;  1YJ9 I;  2NXN B;  3K69 A;  2VXZ A;  3DTI A;  3W3C A;  2OV7 A;  3NWS A;  4M9Z A;  1HF0 A;  3S2D J;  1U5T B;  3U21 A;  3QOP A;  2ZJR F;  3OOP A;  4BHC A;  2WAQ A;  3PIO F;  1SD4 A;  1QO0 D;  4HG2 A;  3L2R A;  3BR0 A;  4RGU A;  3HOU J;  1UFM A;  3CO7 C;  4HA8 A;  2O03 A;  4AID A;  1ON2 A;  4C3I J;  4KIF A;  1HCR A;  2K4B A;  2Y31 A;  3BCB A;  4GGG A;  3CJQ B;  2ME6 A;  2DDA A;  4BL0 B;  5E8G A;  2LMD A;  1PUF A;  2P81 A;  3GO5 A;  1O3Q A;  2Y0S A;  1Z9C A;  1KQ9 A;  2JQ7 A;  1SAX A;  2QBY A;  3PIP F;  2XF5 A;  1WVR A;  2JA5 J;  2P4W A;  2BZT A;  2CRG A;  2Z33 A;  3FHN A;  3OR2 C;  3LSI A;  3QYF A;  1T0F C;  4DW6 A;  4M71 A;  3KPH A;  4EGZ A;  2HI3 A;  3CCS I;  3KZY A;  4XOT A;  5GTH C;  1KYW A;  4A2U A;  3FWE A;  2F5V A;  5HOD A;  5L3F A;  4RM3 A;  2XPW A;  5CQE A;  1P7I A;  4RAY A;  3RKX A;  1F43 A;  1G59 A;  1E3O C;  1B59 A;  2KZV A;  3ABT A;  2BBY A;  2W7N A;  1H9T A;  4MEX F;  3C1D A;  3BJA A;  1QRY A;  5CVR A;  3SEZ A;  1MMG A;  1EA3 A;  2IGN A;  3A03 A;  1B1B A;  3ZR8 X;  1IC8 A;  2ZFU A;  1YLF A;  1Y6I A;  2JUC A;  2V4J C;  3KP7 A;  4C2M J;  1D5Y A;  1I1S A;  3LQQ A;  2DK5 A;  5JHF A;  2ZKZ A;  2LRD A;  4Y4R A;  1RUO A;  3MEX A;  3CCR I;  2BW3 B;  3DEW A;  2E1C A;  3KIO A;  1WHU A;  2YX4 A;  4HOB A;  2M0C A;  3WU1 B;  1IN6 A;  1A5J A;  4GRI A;  3JRE A;  3OL3 A;  2Q8K A;  3RI4 A;  5E18 F;  2W48 A;  3W2A A;  3ABL H;  3QPT A;  4OMY A;  3L09 A;  3BZC A;  3TW7 A;  1HKS A;  2KP6 A;  1XPX A;  2QQ8 A;  1IXR C;  2O9L A;  5F0C A;  4XK4 A;  4P96 A;  2Z99 A;  3DKX A;  4I76 A;  5LGT A;  5ICC A;  4Y7N J;  1S29 A;  2IA0 A;  2PQ8 A;  2DT7 B;  1MW7 A;  3KE2 A;  1RZ4 A;  2JSP A;  2HS5 A;  3O6B B;  3ABK H;  3KP6 A;  1WGX A;  3WGH A;  3KX2 A;  2WV1 A;  2JRT A;  1BM9 A;  2HYJ A;  2JMW A;  1BW5 A;  3J7Z I;  4E7Z A;  1JHH A;  4U7B A;  2HXO A;  3BR5 A;  1JT6 A;  4EJO A;  3ASN H;  4IX7 A;  2NVU B;  3K4L A;  1JTY A;  2M9H A;  3GBG A;  2OQR A;  2RKH A;  3RZD J;  1MBH A;  4RGS A;  2OCE A;  1Y1V J;  2QVO A;  1BOB A;  2XGD A;  1UHS A;  3OYC A;  4M9S A;  1OYY A;  2VI6 A;  4J01 A;  3K4K A;  3PO2 J;  4PGG A;  2OCC H;  2XGE A;  2FF4 A;  1S7E A;  3VB2 A;  1RKW A;  4PCQ A;  3RCO A;  4PJ0 C;  1TNT A;  1E3P A;  2O3F A;  5LLQ A;  5FO5 A;  4W97 A;  3QPS A;  1I6H J;  4EMS A;  2L4M A;  4RM2 A;  3IWF A;  1XX5 A;  4MO7 A;  1BOA A;  1PJR A;  3R0J A;  1YG2 A;  1AA7 A;  2NNN A;  2LBF B;  1SD5 A;  5JLW A;  3W6K B;  4CZC A;  2UWM A;  3BWG A;  3M7G A;  3M07 A;  1MBE A;  3OYB A;  3FMR A;  1ZR2 A;  1R6R A;  3BG7 A;  1ZG3 A;  2O61 A;  3NAR A;  3TDZ C;  1LFU P;  4JX4 A;  1FSE A;  1ZRE A;  1P4W A;  4OMZ A;  2MAB A;  3HRU A;  4Y17 A;  5F1J A;  2ZSI B;  1A6Q A;  3BR6 A;  2AO9 A;  2LF8 A;  1O57 A;  4LLG F;  2R7Q A;  2OC6 A;  2XAF A;  3FBI B;  2BVL A;  2NVY J;  5EEA A;  4HYE A;  3DFG A;  1W5C C;  1BBY A;  2LNB A;  3U1K A;  3FK6 A;  2CWE A;  3LFK A;  3MQ0 A;  1O7L A;  1OR7 A;  3P5J A;  1XG1 A;  4DQ2 A;  5ERI A;  1JE8 A;  2OD5 A;  2L9V A;  4A3F J;  1K6Y A;  1ON1 A;  3D5R C;  4FIS A;  5BPI A;  1U5T A;  2EIN H;  3ASO H;  4M3F A;  3REO A;  1SFU A;  1V3F A;  2G0E A;  2K3P A;  2V9P A;  4BKX A;  3NAU A;  4QLC U;  4RGR A;  4EJV A;  5GAD J;  3Q5F A;  2PJP A;  1NHA A;  2WAQ N;  3QPH A;  5LGN A;  2EA2 A;  2CUJ A;  1WJA A;  4JX5 A;  1J09 A;  5GP9 A;  1W0U A;  2JUG A;  3F8N A;  4LD5 A;  4BXU A;  5LD2 C;  2VKH A;  2KPM A;  2GWR A;  3C2B A;  4CCL A;  2L9N A;  5KNL A;  3CUQ A;  2A69 F;  1DPR A;  4ITV A;  1BJA A;  1SD6 A;  4XKC A;  3E3V A;  4YEL A;  4BQA A;  1S7O A;  1N78 A;  2EV0 A;  4ETS A;  1TQP A;  2FSW A;  3CCU I;  1Z77 A;  5A2Q Z;  1LEA A;  3M3Y J;  2WAF A;  4PZJ A;  4HV6 A;  5LHI A;  4S05 A;  2K9N A;  1IRF A;  3CP8 A;  1OFC X;  2DOD A;  2VQC A;  1HLV A;  3VOD A;  4YFN F;  3O8H A;  1R22 A;  5LEK A;  3RZO J;  1DDN A;  3HRT A;  2X0L A;  4L0Y B;  2KKO A;  3WE2 A;  1BJZ A;  4IXA A;  1MBJ A;  3WG7 H;  3IH2 A;  4XN3 A;  4ENN A;  4O5V A;  1ETY A;  2WAE A;  4Z6Y A;  2DTZ A;  3K4J A;  4PUS A;  3QYB A;  3SDG A;  3LNQ A;  2Y2Z A;  2VIX A;  4LK1 F;  2BXZ A;  2LKS A;  2HZT A;  1QA6 A;  3PNV A;  5IY5 H;  9ANT A;  4U88 A;  2CFX A;  3HSF A;  3WU0 A;  4GYI A;  3PFI A;  1F5T A;  3HZJ A;  2FXA A;  4BJT A;  4LG0 A;  3ZMU A;  5M5Y J;  2RN7 A;  3FXU A;  4V2F A;  5C4J J;  3OS2 A;  2Z5U A;  3V7S A;  1YW9 A;  2CSO A;  3BCA A;  4A6E A;  3GTP J;  2MFZ A;  1FZP B;  5CJ9 A;  4FAS D;  2XKP A;  2IS1 A;  2FX0 A;  2HVS A;  4FE7 A;  4IHS A;  4M3B A;  4NUB A;  1J7K A;  1ZH5 A;  5D5X B;  2A3S A;  2OA4 A;  5BOX A;  1LE8 B;  3FXM A;  4RLF A;  2QZ8 A;  4OAY A;  3S17 J;  1ZHF A;  2CV2 A;  1GV2 A;  2IA1 A;  2OJE D;  3BG9 A;  1U8B A;  1QHG A;  3CLQ A;  2CQQ A;  2C6Y A;  2N8G A;  5FFZ A;  3RQI A;  4II3 A;  2VKV A;  3RQ4 A;  1E2X A;  2HDW A;  4EJW A;  5LBQ A;  4WX9 A;  4II2 A;  3CC2 I;  4XLP F;  4CGZ A;  2EV6 A;  2X9D A;  3I58 A;  2A61 A;  1Y8R B;  1Z6T A;  5J3L A;  3H35 A;  1G4D A;  2EK5 A;  1ACI A;  5BMZ A;  3TO6 A;  1FYK A;  2L54 A;  2JVH A;  1TTY A;  2W00 A;  3DPT A;  3DBL B;  2FU4 A;  4CYC B;  3M8E A;  2D1V A;  3DKW A;  3PUB A;  5DV5 A;  5FRN A;  2GA1 A;  3KYD B;  2XAQ A;  4XLF A;  3OYE A;  4YIF A;  2V7F A;  4BAC A;  5F0F A;  3BQZ A;  3ULQ B;  3S2W A;  3IAS 2;  2YUS A;  4AIK A;  2H6B A;  1ZG5 A;  4HRI A;  4BGD A;  4E7L A;  1EH8 A;  2LBF A;  2NS0 A;  1T08 B;  1IN4 A;  3E5U A;  4L9J A;  3G1M A;  2I10 A;  1V5E A;  2BE5 F;  4I01 A;  1SEU A;  2HOS A;  3QP6 A;  2L7Z A;  1KON A;  2E1N A;  4BDZ A;  4FTH A;  2XB0 X;  2LH9 A;  1ZN2 A;  5DUI A;  3K7A J;  1JJ8 C;  3A01 A;  2P6S A;  1IW7 F;  4XQF A;  2X51 A;  5EYR A;  1YJN I;  2J5O A;  5L3B A;  4NHJ A;  1T98 A;  1HC8 A;  2IVM A;  4QSH A;  3AL0 B;  4HDU A;  2L5Q A;  1NK2 P;  3CJT B;  4BQQ A;  3M1C A;  2K9Q A;  3F8B A;  3CCL I;  1WJB A;  4AVP A;  4D0P A;  3BR2 A;  3CCM I;  3VSK A;  3FHZ A;  4FQG A;  3IKV A;  2LKX A;  4RMN A;  1X2M A;  1TW2 A;  4I98 B;  4DYC A;  5A2Q K;  4CIC A;  4HF0 A;  3ERM A;  1VND A;  1ERD A;  1ONV A;  4HX4 A;  4WF2 A;  1ULY A;  2DAO A;  3EPZ A;  2F2E A;  1R49 A;  3LL7 A;  3F8M A;  1VQ6 I;  2IAI A;  2IGM A;  5ILS A;  4MTE A;  1IXS B;  5EZG A;  1R1U A;  4IHT A;  3PNY A;  2Z2S B;  4CCK A;  3K70 C;  2ESH A;  5KCM A;  2DN0 A;  5IOZ A;  2B63 J;  2K85 A;  1Z7U A;  3C2H A;  1J5Y A;  2A6E F;  3CQZ J;  1LKX A;  2E36 A;  2LSO A;  4WWC A;  3LSG A;  4KIS A;  1MSE C;  3ZQH A;  4B3A A;  4MTD A;  1OR7 C;  5FKL A;  2RGV A;  3ZMV A;  2FD5 A;  4HX7 A;  3CP2 A;  3MD2 A;  3GYH X;  4RGX A;  4V2G A;  2LD5 A;  1TNS A;  3NRV A;  1XD7 A;  2ZO4 A;  3JRG A;  5D8L B;  2CQ7 A;  1U5T C;  2RNG A;  1K78 A;  1Z3X A;  4E7K A;  3BPX A;  1R4N B;  4KIT B;  1H9G A;  3MMY B;  2PFB A;  1W5S A;  4F92 B;  2ZCW A;  1R5I D;  4F93 B;  1KQ8 A;  1LQ1 A;  3IKT A;  3JW4 A;  4IHY A;  4NB5 A;  1BIB A;  1UG0 A;  2X6O A;  4AIH A;  4CXF A;  4XRM A;  1UAA A;  5DYM A;  3E97 A;  2EV5 A;  2K9L A;  5J40 A;  1V4R A;  4ZZL A;  5J8F A;  2A05 A;  4YEJ A;  2VJ5 A;  3BTL A;  3DTK A;  5AON A;  1OJL A;  4O6J A;  3PUF A;  2E1O A;  3G3Z A;  3CUQ C;  3IH4 A;  4NNJ A;  2FQ3 A;  2L9S A;  2FEZ A;  4F91 B;  4ESB A;  2DQR A;  4G94 A;  2RQQ A;  5FD5 A;  1MGT A;  2BHY A;  3S1Q J;  5L3D A;  2DOE A;  3OYK A;  2QM3 A;  3HDD A;  5F04 A;  2NNY A;  1JGG A;  3M4O J;  5M3M J;  1JUM A;  2CW8 A;  5IP7 J;  2VON A;  5JI6 A;  1EV7 A;  2EZL A;  4J19 A;  3WTW C;  1MJ9 A;  5HVQ C;  3H9Q A;  3GCM A;  1E3H A;  3OL4 A;  1FEX A;  5ILU A;  1ZGW A;  2PMU A;  3NEU A;  2DYR H;  2JZY A;  1XB4 A;  3S14 J;  4C3J J;  3L00 A;  1N25 A;  3GZ5 A;  3V7R A;  4IVN A;  5HS9 A;  1WCM J;  5E1X A;  2X1E A;  4LB6 B;  4P55 A;  1L3L A;  2M5W A;  2CQK A;  1JKQ C;  1WQ2 A;  3TOA A;  2NVQ J;  3GTG J;  2DMN A;  2XAS A;  2KJB A;  5LHH A;  1RNL A;  3HXL A;  3ZOB A;  3TP0 A;  1Y56 A;  2VE8 A;  3M8J A;  4HV5 A;  4BHP A;  4F7Z A;  4AC0 A;  1YOV B;  3K1N A;  1ZKG A;  2VUM J;  1LFB A;  2UXN A;  3R60 A;  4GCV A;  2LLK A;  2CV1 A;  2EFN A;  2FOK A;  3CMY A;  2DK8 A;  2EZH A;  4CZZ A;  1F1Z A;  2BYV E;  1UG2 A;  3LSM A;  3MAJ A;  2VBX A;  3CCE I;  2P8T A;  3G2B A;  4N4O B;  2QWW A;  1S9H A;  4D7M A;  2ZME B;  1W36 C;  4XRS A;  1Z7L A;  2CUF A;  3I56 I;  1FY7 A;  2L9R A;  3QYE A;  4C3H J;  1SVO A;  2VC0 A;  1R9T J;  3OMY A;  2V9V A;  3M8F A;  1AHD P;  4V19 K;  3CLO A;  1R5G A;  2KRH A;  1N77 A;  4WXD A;  4BBR J;  1MDM A;  1D1C A;  2HXI A;  2E19 A;  5EEG A;  3SZP A;  1XSV A;  3KLN A;  1T39 A;  2JN6 A;  4ESF A;  3TMO A;  3BG5 A;  3HOT A;  3IRQ A;  2ID6 A;  4GO1 A;  2VT3 A;  4GYG A;  4RAF A;  3WOD F;  3JR9 A;  1TT5 B;  1ZLJ A;  2HVQ A;  3G1L A;  1I1G A;  3ECH A;  1QNT A;  3IC7 A;  4NDL A;  3UR3 C;  2CV0 A;  4A3I J;  4GFB A;  2X6X A;  1MBF A;  4P9U A;  4FT8 A;  1IGN A;  3BG6 A;  3HL2 A;  3HPH A;  1D1B A;  2OZ6 A;  4PK4 A;  4MGR A;  4XN0 A;  2R7T A;  1XSD A;  2ZXW H;  5FKK A;  2I5U A;  5IT9 K;  1FIA A;  4G6D A;  2E34 A;  5B1A H;  4BYY A;  3HSR A;  2HQN A;  3KP3 A;  4ZYH A;  5E3O A;  2Q2E B;  5H6Q A;  2QYO A;  4BE1 A;  4X1E A;  2DDB A;  4PFO A;  3RKQ A;  2IS4 A;  3DP7 A;  2UV1 A;  3IP4 B;  2H6C A;  2R7U A;  4Y13 A;  1IUF A;  4AYB N;  4UUT A;  3HM5 A;  3HJE A;  3E5X A;  4JX6 A;  3ZN0 A;  5FLM J;  3JRI A;  4G8X A;  2ECC A;  3FIW A;  1Y39 A;  4C30 A;  2HTJ A;  2HQA A;  1VQ5 I;  3BLY A;  5FRO A;  4A0X A;  3MKL A;  3ZMD A;  3FXQ A;  4BU2 A;  5DTD A;  3J7A Y;  4M3G A;  2W57 A;  2ESN A;  3HTS B;  3I4N J;  3RIR A;  1I3Q J;  3JAM Z;  2EQR A;  2XPU A;  3TBI A;  3ERE D;  1HSJ A;  1OCT C;  3OSG A;  1MMA A;  1IV8 A;  4XBF A;  1JJ6 C;  2EA4 A;  2K7L A;  4S0H B;  3VFZ A;  4ENK A;  1J0R A;  2DJN A;  1YRN B;  4KN7 X;  5HLT A;  1HOM A;  1LDD A;  3M9A A;  2M7A A;  2XVC A;  5H2F C;  3P9I A;  3I5U A;  1IRG A;  3ABM H;  2XF6 A;  4CCO A;  2IRF G;  3RYP A;  4NQW B;  2OTL I;  2EPF A;  2WBM A;  3H92 A;  1FP1 D;  2DFI A;  4YFK F;  2JA7 J;  3CCV I;  1LDK B;  2R7D A;  1IDZ A;  3RPQ A;  4IHW A;  2OBP A;  1MJB A;  2BOL A;  3KEQ A;  4UVB A;  2H1K A;  1QHH D;  2P5V A;  4L9T A;  3LSR A;  3ROU A;  2PJR B;  2ECB A;  3KZZ A;  3ZCO A;  2KDZ A;  4ENM A;  3HSE A;  3AAF A;  5HLI A;  3JRC A;  4ZDP A;  3KYC B;  3BDD A;  2BY1 A;  1WI9 A;  1T38 A;  1ETK A;  1X1B A;  3TED A;  2IEK A;  4IRG A;  3OIP A;  3U1D A;  2E2H J;  2VBY A;  3EYY A;  2NS8 A;  1UB9 A;  5L3G A;  2FML A;  2JJ7 A;  1FSH A;  1B9N A;  5HS7 A;  3I4P A;  3UKG A;  4BS9 A;  3ZQQ A;  2FE3 A;  1Z05 A;  1BI0 A;  5GPA A;  2WTE A;  2DA7 A;  1XGO A;  3T8T A;  1FBU A;  2NAZ A;  1ZQ3 P;  3OOU A;  4TV7 A;  4Y33 A;  2XGC A;  5DCM B;  1PP7 U;  2VN2 A;  2JWT A;  3J80 Z;  3HOY J;  1OCZ H;  3BT9 A;  1TWC J;  4I09 A;  2K40 A;  3H3Z A;  3QP5 A;  1VTN C;  1P4X A;  3BR3 A;  2WAD A;  3PM1 A;  1B8I B;  1EH7 A;  1RR7 A;  2M7B A;  3IAM 2;  3N05 A;  1XCV A;  1OYW A;  4A12 A;  2KJC A;  3FIS A;  1BI3 A;  4HF2 A;  2R7Z J;  2HR3 A;  3ELK A;  5CVI A;  4N9H A;  2E60 A;  4CCM A;  1QZZ A;  2AXT C;  3E6C C;  2E7X A;  1SFE A;  2X6Y A;  1W0T A;  4Z2Y A;  5HDK A;  1UEL B;  5AIP A;  4AIJ A;  1ZYR F;  1A6I A;  4PSX A;  2QSF X;  5FKO A;  3BR1 A;  2CW0 F;  2VE9 A;  1ORK A;  1VQM I;  3PSF A;  1FOX A;  2F5C A;  3H5A A;  2LFB A;  2VAS A;  1XTA A;  2W84 A;  1MSF C;  1DP7 P;  1EJ9 A;  3LAP A;  4OIQ F;  1I5Z A;  2LC2 A;  2Q1Z B;  4A0Y A;  2NRA C;  4ZH4 F;  4LK0 F;  1AU7 A;  1JKO C;  2L02 A;  4MNU A;  4XM3 A;  1GT0 C;  4L9V A;  3JAM K;  3TOB A;  1MZB A;  1BC7 C;  1H88 C;  1TQI A;  3I59 A;  1HQC A;  3IHU A;  4PFP A;  3SZT A;  1I39 A;  2LVS A;  2QEN A;  3HRS A;  1W1W E;  5EF6 A;  3H0G J;  3KP2 A;  4LMY A;  3OYJ A;  4ESJ A;  4HNU A;  2F48 A;  4RA2 A;  3LA7 A;  2DMT A;  3PSI A;  1IXC A;  3AFH A;  3TKY A;  2BXY A;  4B47 A;  3C7J A;  3PL8 A;  4A93 J;  1WH7 A;  1XMA A;  2QA4 I;  4LB5 A;  3FXJ A;  3HRM A;  5L3C A;  5DUK A;  4A3K J;  3ZQ7 A;  5B66 C;  3S2H J;  1OYI A;  1OMI A;  4L5E A;  1STZ A;  2M8E A;  1SMT A;  4BNC A;  3AL0 C;  1TP4 A;  2HKO A;  4KYW A;  1TWA J;  3K4C A;  3GFM A;  1K79 A;  3IL2 A;  2H8W A;  5E20 A;  4IOC F;  4C2U A;  4HBL A;  1TQM A;  1PDN C;  1ZGA A;  1MNE A;  1UHM A;  1CF7 A;  1FWZ A;  3ZPL A;  4YFX F;  3S8P A;  2DTR A;  2HZD A;  1E0E A;  3MWM A;  2MSY A;  3JCU C;  4DYR A;  3DPL C;  1ZRC A;  4OIP F;  1F4K A;  2EFO A;  3TGN A;  4KDP A;  2NOG A;  3H0D A;  2HOA A;  2UZK A;  3L2W A;  3F8C A;  5IP9 J;  3F6O A;  2XRO A;  2GM4 A;  4XLA A;  4L18 B;  3WTS C;  2IP2 A;  2M87 A;  1X3W B;  4Q47 A;  1Z3Y A;  3KP5 A;  2MG4 A;  4RB3 C;  4FET A;  1QBJ A;  4QTR A;  2LF7 A;  4KNY A;  3AG3 H;  3ZGK A;  2YX7 A;  3FMQ A;  1WWX A;  4E4H A;  1SC7 A;  3BJ6 A;  3DU6 A;  4HNT A;  4OIO F;  2CG4 A;  2OU2 A;  3NQO A;  1W7P D;  4BEH B;  2A5W A;  3K0L A;  3I55 I;  3JRF A;  2H1L A;  1IV6 A;  4KUM A;  2IXS A;  3HIF A;  2OTJ I;  1P6R A;  2KFD A;  1GUU A;  5FRM A;  2DMP A;  3ML6 A;  3J80 K;  2BV6 A;  5EEH A;  2EFQ A;  2XAG A;  2E1M B;  4P9F A;  4E7H A;  1A31 A;  5EGO B;  2V1N A;  3CCY A;  1RPW A;  1P2F A;  2R5Z B;  3OIQ A;  3V8K A;  4EGY A;  2XAU A;  2F5D A;  2HU9 A;  1HW1 A;  4AUX A;  5E8I A;  4ZDO A;  3R4K A;  3G1O A;  4CCJ A;  4LIV A;  4UUS B;  3LSK A;  3CTA A;  1XMK A;  4AM3 A;  1C0W A;  2IGK A;  2X1C A;  3GZN B;  5LRS A;  3I9V 2;  1IAW A;  2P6T A;  5IYC J;  4IQJ A;  3B02 A;  4HX8 A;  5FLX Z;  3BPV A;  3K9T A;  3J7A O;  4N9I A;  2LR8 A;  2MH2 A;  3SDB A;  4BXX J;  1T56 A;  1LDJ A;  4ANJ A;  1WJD A;  1SFX A;  5DCM A;  2HEO A;  3CC4 I;  1YO5 C;  1GVD A;  2K27 A;  1YW7 A;  1B6A A;  1P7J A;  1Y0U A;  4XKB A;  2TRT A;  2STT A;  3HOW J;  2O5R A;  3DQV C;  5FGM A;  5D6F A;  1B4A A;  4XSZ F;  2EZK A;  2GXG A;  3WU2 C;  4WK8 F;  5JFR A;  1FMW A;  3KFW X;  4Y15 A;  3ZMT A;  1SFK A;  5M5X J;  3HEF A;  1YQA A;  3E0J B;  1YJW I;  4A6D A;  1YW8 A;  1G2H A;  5KK1 A;  1UMQ A;  2BW3 A;  2V6C A;  3HOZ J;  2MC3 A;  5FJ8 J;  1LPQ A;  4GDF A;  1TZL A;  2FNP A;  1LB2 A;  2ZC2 A;  1G3S A;  3WG9 A;  2FBH A;  2F4M B;  2HTS A;  2WV0 A;  2BY2 A;  2M34 A;  2JVG A;  4BJ5 C;  3PQJ A;  1W7P B;  3S1R J;  2RNJ A;  2XV4 S;  3GEZ A;  2JA2 A;  1HKQ A;  4RB2 C;  4U0W A;  1ETV A;  1EH6 A;  1LFP A;  1HDD C;  2EZI A;  1G8X A;  3B6C A;  3FZV A;  4IJA A;  4M6Y A;  3TP3 A;  5C44 J;  3W2V A;  2PBI A;  3CC7 I;  1IZ1 A;  1FOW A;  1FYM A;  2M2E A;  1U0J A;  2JPB A;  2LY1 A;  3JRA A;  3ZN1 A;  2BEO A;  3E7L A;  5D4S A;  3GVA A;  4S04 A;  3QRF F;  4G7O F;  2FA5 A;  5E1W A;  3BC8 A;  3TO7 A;  4KJZ A;  3CJR B;  3FX3 A;  2FMY A;  4MEY F;  3VSL A;  3L1P A;  2DA2 A;  1D0Y A;  3HB9 A;  1V5G A;  3S3M A;  4I02 A;  3PFY A;  2PG4 A;  2NOJ B;  1XSX A;  3C3W A;  3AG1 H;  4M3E A;  4MQV A;  4HQM A;  1GXP A;  2A6H F;  2DYS H;  1U3E M;  5GTI C;  4B09 A;  5C4X J;  4PJJ A;  5K5Q A;  1F36 A;  2KIQ A;  3HPG A;  1YE9 A;  3VYS B;  2P0W A;  2X48 A;  1FC3 A;  1GXQ A;  1UHW A;  2IGO A;  3DLA A;  3MZ8 A;  1FOK A;  3I71 A;  2COM A;  2MW8 A;  3TQN A;  5F1R A;  2QQA A;  3OYA A;  1AOY A;  3VWB A;  2X85 A;  5B5E C;  4DNC A;  1XCB A;  1X3U A;  2CU7 A;  3KEY A;  1QU3 A;  4Q5S F;  4IPA A;  2CGP A;  2E35 A;  4ON0 A;  2BVM A;  5IPA A;  4MIM A;  1W4M A;  2W4S A;  3QPL A;  4N0B A;  3DKY A;  4ZZD A;  4G6T B;  2PEX A;  3CCJ I;  2BHZ A;  4RAZ A;  4XRF A;  3EUA A;  1YIJ I;  1IDY A;  2V1X A;  2PMH A;  5E17 F;  2JRM A;  3S1M J;  3HKZ A;  2H8R A;  3OYG A;  1TT0 A;  3DPU A;  2R7O A;  4M6V A;  2HDD A;  4A0Z A;  5HS8 A;  2ISZ A;  3ZQL A;  3BTI A;  4QIW N;  2O8X A;  4LOC A;  1MBG A;  5ED4 A;  2I8D A;  4I0A A;  2B7E A;  3CES A;  3FKJ A;  4G9Y A;  2X1D A;  2ZJP F;  2VOP A;  3TL4 X;  5ICG A;  5KAI C;  4AYB A;  3JTH A;  2ZXJ A;  5GAE J;  3PNT A;  2HOE A;  2LK2 A;  3MCZ A;  3F8F A;  3TDU C;  4U7D A;  2R0Q C;  3T1B A;  4BEH A;  6PAX A;  5CLS A;  2RRE A;  5ICE A;  4R1H A;  5D6E A;  1ETX A;  3S3O A;  3SXY A;  1WJC A;  3AG4 H;  3BP8 A;  1FYL A;  4MQ9 F;  3TW6 A;  5J8C A;  2FQ4 A;  1KQ0 A;  1RIO H;  3A4C A;  1G6N A;  3HG9 A;  1Y0N A;  3LOC A;  2D2W A;  1WH5 A;  3CJN A;  1JT0 A;  1FT9 A;  2ZNZ A;  4D5F A;  3RDI A;  4RAG A;  4HLX A;  5EGO A;  2QSH X;  1YX3 A;  5GPC A;  3IRR A;  2F5F A;  2R5Z A;  2RAE A;  1WRJ A;  3U2R A;  3V8J A;  4L9N A;  4XKV A;  2DFE A;  2CUZ A;  1L0O C;  4HEA 2;  3WTY C;  3S16 J;  5GAH J;  2CQX A;  1T95 A;  2Y30 A;  1KU3 A;  1OPC A;  1T6S A;  2L3D A;  4E7J A;  4PSW A;  1X58 A;  4E6K G;  5HLH A;  1U78 A;  2JK3 A;  3F23 A;  2LRE A;  5D5V B;  2EH3 A;  1TL8 A;  1FJL A;  3GTM J;  4LGW A;  2L7K A;  1QZY A; 
#chains in the Genus database with same CATH homology
 2JSP A;  4ZTF A;  3KX2 A;  4B44 A;  2OUM A;  4XOR A;  4C30 A;  4E7Z A;  2HQA A;  3BLY A;  5FRO A;  4U7B A;  1X4P A;  2VJI A;  4BU2 A;  3J7A Y;  3KYL A;  4IX7 A;  3K4L A;  3GBG A;  2K9M A;  1BOB A;  4HST A;  3TBI A;  3OYC A;  2K5C A;  3MKY B;  4J01 A;  3K4K A;  4DJA A;  1MMA A;  2UUZ A;  2XDV A;  2A6T A;  3RCO A;  4DOZ A;  3H9J A;  3LMM A;  5HLT A;  2M7A A;  3K10 A;  4B43 A;  4BE2 A;  4RM2 A;  1PJR A;  2XF6 A;  2KRC A;  4CCO A;  1AA7 A;  3OYL A;  4NQW B;  4RLQ A;  4XR6 A;  2LBF B;  2WBM A;  4CZC A;  2UWM A;  1X1D A;  1JI8 A;  2DJI A;  3RTR A;  1LDK B;  3OYB A;  1BR1 A;  1R6R A;  3BG7 A;  2BOL A;  4BUP A;  1QHH D;  3RPU D;  2PJR B;  3HUG B;  3ZCO A;  4XNF A;  3ZRG A;  2MAB A;  2ZSI B;  1NG7 A;  3K4M A;  2M0M A;  2R7Q A;  3DU5 A;  1P9Q C;  2OC6 A;  3FBI B;  2BVL A;  5HOO A;  4R79 A;  4ZDP A;  2VJ4 A;  2XF7 A;  4CSW A;  1X1B A;  2R7X A;  2LY2 A;  3RSN A;  3FBN B;  3OIP A;  1WJ5 A;  3OY9 A;  1K6Y A;  4ZC3 A;  3D5R C;  1N75 A;  1VZ0 A;  4LG3 A;  2K3P A;  4XLE A;  3SEQ A;  4BS9 A;  3OYI A;  3ZQQ A;  4ZYA A;  4ZDL A;  4IQ4 A;  1SAU A;  3OOU A;  2R4G A;  4Y33 A;  2AQE A;  3CF2 A;  4XLH A;  2CUJ A;  1WJA A;  1J09 A;  3H5N A;  2JUG A;  4DBQ A;  5LD2 C;  2VKH A;  4MLO A;  2KPM A;  1PYV A;  2PMZ A;  4CCL A;  1BR4 A;  2KLO A;  2L9N A;  5KNL A;  3K70 D;  2KQR A;  3MKW B;  4ITV A;  4XON A;  4BDY A;  4XKC A;  2WAD A;  4YEL A;  5HNH A;  2V6E A;  1N78 A;  1Z21 A;  2M7B A;  3IAM 2;  3N05 A;  2VQH A;  1WJE A;  2WAF A;  3V42 A;  2AQF A;  2X6W A;  3OS0 A;  2IS2 A;  4NC8 A;  3CP8 A;  2VQC A;  3OR1 C;  4U87 A;  3E1S A;  3K4N A;  2GOM A;  2E60 A;  4CCM A;  2V26 A;  4XN3 A;  3EUH C;  4F52 A;  2WAE A;  2KDO A;  2X6Y A;  3K4J A;  4PUS A;  3QYB A;  4D9J A;  4BE0 A;  1V5F A;  4CCN A;  2VIX A;  4DBR A;  1UEL B;  2W82 A;  4X0G A;  4QPQ A;  4PSX A;  3PNV A;  3PJR A;  3SYT A;  1MND A;  3PSF A;  3W2W A;  3F9K A;  3H5A A;  2VAS A;  2F4I A;  2Z16 A;  2LYC A;  5TGT A;  4BJT A;  2LC2 A;  2KMU A;  2Q1Z B;  2MD0 A;  3I3L A;  2WB1 A;  3OS2 A;  2E5Z A;  3BCA A;  2V9K A;  2MFZ A;  3ONQ A;  4FAS D;  2VKD A;  4XM3 A;  2IS1 A;  3OYM A;  4C2T A;  2HVS A;  2M4G A;  3CMM A;  4B48 A;  4P1W A;  4NUB A;  4HPQ A;  4PFP A;  3QOD A;  2XSJ C;  4LIU A;  4PJN A;  4JQF A;  4RLF A;  3OYJ A;  4OAY A;  2CV2 A;  4HNU A;  3CZ6 A;  3PSI A;  4B47 A;  3AFH A;  1OLT A;  5LFA A;  2R7S A;  4YRV A;  4NC7 A;  1QHG A;  3VYU B;  3PL8 A;  3DTE A;  3OS1 A;  4II3 A;  4D1Q A;  3RQ4 A;  2HDW A;  4II2 A;  1DGR M;  3AKZ A;  3AL0 C;  2CH0 A;  2IS6 A;  3H35 A;  4BQO A;  2E1M C;  2WY7 Q;  2WA0 A;  2GOX B;  3K4C A;  2VJJ A;  1HA8 A;  1NG6 A;  2WY8 Q;  1X1C A;  2JVH A;  2W00 A;  3DPT A;  4OAZ A;  4C2U A;  4CUG A;  1MNE A;  3PUB A;  5FRN A;  3OYE A;  4XLF A;  3S8P A;  2V7F A;  4BAC A;  2HZD A;  1E0E A;  3IAS 2;  3DPL C;  4HRI A;  3D5S C;  2DCE A;  3H0D A;  4BGD A;  2FUG 2;  4E7L A;  2LBF A;  3L2W A;  3L2Q A;  4XLA A;  1V5E A;  4XMY A;  1W36 D;  4JOM A;  1Z3Y A;  1KON A;  4BDZ A;  2VB6 A;  2LH9 A;  4FET A;  4HSR A;  3ZGK A;  4E4H A;  4PJM A;  3DU6 A;  4XQF A;  4HNT A;  3HOS A;  3S32 A;  4BEH B;  2A5W A;  2HNH A;  2M4K A;  4QPO A;  4EAT A;  2R7W A;  2IXS A;  2X51 A;  3VYR B;  3VDX A;  3EUK L;  2E5N A;  2HPI A;  5FRM A;  1DGW Y;  3AL0 B;  2L5Q A;  4AU7 A;  4BQQ A;  2E1M B;  3M1C A;  4E7H A;  1WJB A;  2V1N A;  3VSK A;  4B3X A;  3OIQ A;  2XAU A;  2DT6 A;  2HU9 A;  4RMN A;  4ZDO A;  4CCJ A;  1X19 A;  4LIV A;  4F3Q A;  2DOA A;  3LSK A;  2IGK A;  1ERD A;  1YX5 A;  1ZEL A;  3H5R A;  2X1C A;  2CS3 A;  3EPZ A;  3I9V 2;  5CQG A;  3LL7 A;  2F6C A;  4IQJ A;  5KHD A;  2LOO A;  2IGM A;  3SZG A;  2LG4 A;  3PNY A;  3A1Y A;  3SDB A;  3OYN A;  2Z2S B;  2MYS A;  4BQN A;  4CCK A;  2CMP A;  4ANJ A;  1WJD A;  3K70 C;  3ZXS A;  5KCM A;  3MKZ A;  3A2K A;  3C2H A;  4BXF A;  4H4K C;  4XKB A;  1LKX A;  1WJF A;  2O5R A;  3DQV C;  2KHM A;  2HVR A;  3LSG A;  4KIS A;  4OWR B;  2VLA A;  2R7R A;  1FMW A;  1OR7 C;  2MC4 A;  5CPR B;  1SFK A;  4E7I A;  4KT6 A;  3CP2 A;  3E0J B;  3MD2 A;  4ZTJ A;  2VQL A;  2BW3 A;  3OYD A;  3FDY A;  2RNG A;  1Z3X A;  4E7K A;  5HNF A;  4XL9 A;  4KIT B;  3MMY B;  2ZSH B;  4F92 B;  4IZZ A;  1FMV A;  1TZL A;  4E7S A;  4F93 B;  2XC7 A;  2W1O A;  1UG0 A;  3LFU A;  2JVG A;  3S93 A;  4BJ5 C;  4ZJZ A;  1UAA A;  4PJL A;  2VPL A;  1X4O A;  4XOP A;  3DWL E;  2M3A A;  2K9L A;  2JA2 A;  3OWT A;  4IKF A;  1D1A A;  1LFP A;  3C2G A;  4YEJ A;  2VJ5 A;  3HC7 A;  3DTK A;  3L2V A;  3NWT A;  1G8X A;  2VL8 A;  3W2V A;  4NNJ A;  2KL4 A;  2L9S A;  2CFO A;  4F91 B;  1DQU A;  1U0J A;  3L2U A;  2LY1 A;  2QKL B;  2RQQ A;  2HPM A;  2QKM B;  1WFX A;  2CW7 A;  4N4N B;  3OYK A;  3BC8 A;  4KJZ A;  3CJR B;  3VSL A;  3K4B A;  1D0Y A;  1V5G A;  3S3M A;  2CW8 A;  3PFY A;  2NOJ B;  3IUO A;  5HVQ C;  3H9Q A;  2VXZ A;  4Y3O A;  3OL4 A;  3DTI A;  3W3C A;  2OV7 A;  3NWS A;  4PJJ A;  3HPG A;  3U21 A;  1YE9 A;  3VYS B;  2P0W A;  1MMD A;  2WAQ A;  3DLA A;  2IGO A;  4HG2 A;  3L2R A;  2ZXI A;  3K6G A;  3D5L A;  2X1E A;  4BJ6 C;  3OYA A;  4P5O A;  3VWB A;  2X85 A;  3BCB A;  3CJQ B;  3KEY A;  1QU3 A;  3HXL A;  4DGW B;  4BL0 B;  1Y56 A;  2Z1D A;  1MMN A;  1BR2 A;  3M8J A;  2PJR A;  2Y0S A;  2BVM A;  4XLC A;  4XKW A;  2W4S A;  2L2O A;  3DKY A;  2XF5 A;  4G6T B;  2CV1 A;  1LVK A;  3EUA A;  3OYH A;  4LIT A;  4DIQ A;  3LSM A;  3FHN A;  3OR2 C;  2ZXH A;  3LSI A;  3QYF A;  1T0F C;  3G2B A;  4N4O B;  1S9H A;  3HKZ A;  4CH7 A;  2R7V A;  1W36 C;  3OYG A;  1TT0 A;  3DPU A;  2R7O A;  1Z7L A;  4AVZ A;  4XOT A;  3QYE A;  2I8D A;  2VQG A;  3CES A;  3FKJ A;  1D0X A;  2VXD A;  3OMY A;  2X1D A;  2KRH A;  1N77 A;  2F5V A;  3TL4 X;  4RM3 A;  4AYB A;  1D0Z A;  5CQE A;  1G59 A;  1D1C A;  3PNT A;  1GLN A;  4F55 A;  2KZV A;  3TMO A;  4BEH A;  1IRX A;  2W7N A;  2RRE A;  3HOT A;  3S3O A;  1WJC A;  3SEZ A;  1MMG A;  3QOE A;  1EA3 A;  3OYF A;  2IGN A;  2HVQ A;  3UR3 C;  1DP3 A;  3A4C A;  3ZR8 X;  2CV0 A;  3HG9 A;  2ZFU A;  2V4J C;  1Y6I A;  2X6X A;  3BG6 A;  5JHF A;  3HL2 A;  3HPH A;  4C9Y A;  4J00 A;  1D1B A;  4PK4 A;  2LRD A;  4Y4R A;  4XN0 A;  3LSH A;  1YX3 A;  3H9G A;  2BW3 B;  2DXI A;  2R7T A;  4CA0 A;  4XKV A;  5CKT A;  2CUZ A;  4GRI A;  4HEA 2;  3OL3 A;  3W2A A;  1T95 A;  2Q2E B;  4BE1 A;  4E7J A;  3UNG C;  2ELJ A;  4PSW A;  1X1A A;  2KP6 A;  4PFO A;  3VYT B;  4E6K G;  3S3N A;  3DEE A;  2LRE A;  2IS4 A;  2UV1 A;  3DKX A;  3IP4 B;  2R7U A;  2L7K A;  2DT7 B;  1MW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...