2LH9A

Nmr structure of the first lotus domain of tudor domain-containing protein 7
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of Tudor domain-containing protein 7
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Tudor domain-containing protein 7
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lh9A00
3RCOA 2KZVA 2LH9A 3S93A 2KPMA 2LY1A 2LY2A
chains in the Genus database with same CATH superfamily
4PGHA 3S3OA 2GIZA 3LFUA 5H2FC 4C3HJ 4UVBA 3M8JA 1QPIA 4OWRB 3FKJA 2M8GX 1H8AC 1YW9A 5JHFA 1E3HA 2M0MA 2RAEA 3CUQA 4LB5A 1U9OA 2I5UA 3CCYA 1UMQA 3QOPA 4OMYA 1IGNA 4LJZF 1P7JA 2R7ZJ 4AUXA 3OIQA 3H36A 2ECCA 1P92A 3QPSA 4LG3A 3HGYA 4RM2A 3SXYA 1L3LA 1GUUA 1SD7A 4FE4A 5EZHA 2JWTA 4I76A 1X4PA 2EILH 3AFHA 1QPMA 4MQVA 2A61A 5LHIA 1IRGA 3L1PA 3IP4B 1EH7A 4S0HB 3DXJF 1TWCJ 4II3A 4XN3A 4RAYA 1EA3A 4U0WA 2ACJA 5D5VB 5CQGA 3LSKA 3E5QA 2EZKA 1U8RA 4XKWA 4DBQA 5KAFC 4HLYA 2J5OA 2YX7A 4JYKA 1YITI 3M07A 2AO9A 4P1WA 3DTKA 1IN5A 2XGEA 2IGKA 2VODA 2BY2A 3ZQIA 2K9NA 2WAFA 4ZJZA 2LKSA 1ZTRA 3B6AA 2OQGA 1PDNC 2R93J 4LIUA 4HPQA 3SZPA 2CGPA 1MDMB 4PJ0C 1FP1D 4HAMA 5A2QK 3MCZA 2AQEA 5J47A 1VFCA 1W0TA 4WWCA 4ZDOA 3DF8A 3DV8A 2EFOA 4J01A 1NG7A 1UG0A 4OIQF 2XB5A 1WHUA 3S2WA 3L2UA 3MKLA 1XMKA 1GDTA 4HYEA 4Y4RA 1LDDA 4IX7A 3MKWB 2ZC2A 3BC8A 1UHSA 1HF0A 2PMUA 2V1UA 2H8WA 2VBYA 1DU6A 1BM9A 1V3FA 3D5SC 3CLOA 1YE9A 2V79A 5F1RA 4TV7A 4KN7X 2E1MB 1B72B 2K9QA 3VPRA 1Y0NA 5CQEA 2K3PA 1T0FA 5LHGA 4P5OA 4ENJA 5FJ8J 1G2HA 1ULYA 2KT0A 3IAM2 2V1NA 3K7AJ 1ZREA 3L9FA 3PSFA 2PMZN 2GBYA 2ZXJA 1H88C 3Q0VA 3NQOA 3HSRA 3QRFF 1H0MA 3ZQ7A 4GYGA 3OOPA 2D45A 5EZGA 3R61A 2R4GA 1KU7A 3EUAA 2GAUA 3IL2A 1FTTA 2CH0A 3KZYA 4XRSA 1HA8A 1S7OA 4MO7A 2H1LA 1M1EB 4N4OB 2PLYA 3S15J 1Z6RA 3M3YJ 3VOEA 2E7WA 4CZCA 4XMYA 3GTKJ 1LEAA 1GV2A 1IG7A 2QQAA 1QZZA 2JTVA 1JHHA 2XHKA 3DLLF 4HDUA 1G6NA 5ERIA 4LLLA 5HLGA 2DMPA 1TWAJ 1ZQ3P 4XK4A 4E7HA 2VE9A 3WU0A 1HKQA 2X6XA 3E1SA 2ZJPF 2XRNA 4M6XA 1FTZA 2AXLA 3L00A 2JJ7A 2OC6A 2E5ZA 3ELKA 5CVUA 5KCMA 1S29A 4I02A 1MJAA 2O7OA 5J8FA 3WGHA 2HYJA 1B59A 1XGNA 2P6TA 4DBRA 2FJ1A 2VJJA 4GO1A 4B44A 4MHGA 5LD2C 3PNYA 4A3FJ 1Y1WJ 1MSEC 2JRMA 1U8BA 1XGSA 3FM3A 1LVAA 3K4CA 2LTPA 2Y0MA 2CW0F 4V2GA 3COAC 1E2XA 3J80Z 3GBGA 1BIBA 3KP5A 2PFBA 1WJCA 2X6OA 3DBRB 4L9VA 3CC2I 3TBIA 4IO9F 4KDPA 5EG0B 4CSWA 1MNMC 1VQLI 3N05A 4M9ZA 2HVQA 1ODDA 4BJ6C 4XLPF 2Q2EB 1X3UA 3I56I 3SHFA 1XCBA 3ERED 4IVNA 2O61A 3GUDA 1TNSA 5AONA 3V4GA 2BE5F 2VKHA 4NDLA 5ILSA 2ZJQF 3IRRA 4ZZLA 4RDUA 4Y13A 1LEBA 3U9GA 3Q9VA 5BMZA 3KYDB 3W6VA 4IKFA 3RQ4A 2CV1A 2QKMB 1ZKGA 4RMNA 2HZDA 2DODA 2CRGA 3PIPF 2LR8A 1TT5B 2ZO4A 1DP7P 3J81K 2BY0A 3K1PA 1MSFC 1QNTA 3Q3SA 3DPLC 1Q1VA 3K1MA 1YW8A 4M73A 3GFLA 1AKHB 2E19A 3IV5A 1IXSB 1WJFA 4ASNA 1K79A 1L0OC 1MH4A 2BZTA 1R58A 1J7KA 2CYYA 2MW8A 5J4YA 1ETWA 3D5RC 1X1DA 3HTUA 4DOZA 2M4GA 3S1QJ 1BN5A 2STTA 2FU4A 1WJDA 2ZBKA 4HA8A 3TP0A 5B5EC 5JI6A 4KYWA 1R6RA 1VQ7I 5CPRB 2CW8A 1D0ZA 3V8LA 4XLNF 1IXCA 4XLAA 5CVJA 3A01B 3P5JA 3JRBA 2Q8KA 4HEA2 2M87A 4UHTA 4CCKA 2F6CA 1QBJA 2KMUA 2KL4A 3E6DA 1IV6A 3RYPA 3FWEA 4D5FA 1Z77A 3LA2A 2W57A 3SQNA 4XLEA 3BZCA 2V6EA 4BL0B 2NS8A 1RR7A 2L5QA 3IAS2 5EGOB 1FJLA 5B3SH 3EUHC 5D5UB 5IOZA 3KEOA 4AVPA 2VQHA 3DU6A 3LSMA 4ENNA 3UNGC 3OS2A 1ITYA 4HNTA 5D8LB 1YS6A 4HX8A 2E1MC 1FMVA 4DZPA 3K4BA 3PNVA 2NRAC 4FHTA 1A04A 4AD9A 5LEJA 1ZG3A 1W7PB 4CYDA 1LQ1A 3DEWA 2EZHA 1KU2A 4XN0A 3CCRI 2JSPA 3GX4X 3TL4X 1T2KA 3S17J 1QHHD 3DFGA 4LGWA 1F43A 1IO2A 3L2RA 2GLOA 3ABUA 1AWCA 4MEYF 3K9TA 2ISZA 2GZWA 3AG1H 5FFXA 1CF7B 2EH3A 2LY1A 3EDPA 1O3RA 4A3CJ 4JX5A 4S04A 5TJJA 1XSXA 2FX0A 2E1CA 2PI0A 2XKPA 3OYHA 2JPCA 3A03A 5IT3A 3JAMK 3FHNA 1IRXA 2R7VA 3BLYA 3OR1C 3CTAA 2EB7A 1Z67A 5DCMA 4KISA 3BR3A 3LSRA 1KQ0A 4FT8A 2DFHA 4RGXA 1YX3A 1R1TA 4A0ZA 4AYBN 1MNDA 3E0JB 2BY1A 5B66C 2FNPA 1DPRA 4E7IA 2VT2A 2DJIA 3JRAA 2A6TA 3BG5A 1JT6A 4KFCA 5TGTA 1PVEA 3HB9A 1TNTA 2QCOA 2QSFX 5EEGA 2IP2A 3ESWB 5ED4A 4XRMA 3IH4A 4BEHB 2PJRB 2MD5A 4IHTA 3BTIA 2VC1A 3OIOA 3HOZJ 2K9MA 4JK1X 2IBDA 2X6WA 1XD7A 3S1RJ 1NK2P 1I27A 1E17A 2FUG2 1FP2A 2ZSHB 4A3GJ 1EJ9A 4H4KC 5LBQA 2QGUA 3G1MA 2LKXA 1WGXA 5LLQA 1LFPA 4PUSA 3RYRA 2WC2A 3X2QH 2HKOA 4I7HA 3F3XA 4EQQA 3CCEI 2R7FA 3CCLI 3RKQA 4GXOA 3G3ZA 3FXJA 5KHDA 4L0ZB 3WTZA 3CO7C 1U5TB 2GOMA 3HOWJ 3FXQA 2HQNA 1GXPA 2YR2A 3DTIA 2MH9A 3F6OA 1STZA 4GFBA 2R3SA 4UUVA 3WTYC 1R00A 2P5LC 1X3WB 2B7EA 1FT9A 2DK5A 6PAXA 3VWBA 2RQPA 1V5EA 3ZQCA 4BHBA 5TRDA 1TQIA 4PSWA 3LA3A 1JT0A 2E34A 2L7FP 1XDSA 4PDKA 3QWLA 4S05A 4G6TB 4DQ2A 3B02A 2EA2A 3RPUD 5CVVA 3FHZA 3J7AY 2F2EA 1KONA 1MIJA 4RA2A 3BTJA 1ZG1A 2CJJA 4PFPA 4ZC3A 4FTHA 3DEEA 2YUSA 5E1WA 4OOIA 2VJ5A 2JUCA 2PG4A 2O3FA 2QSHX 3DBLB 4BGDA 3OS0A 1VF9A 1VQ8I 2E7XA 4ZZDA 4WK8F 3CDHA 5FD5A 2KQRA 1SAUA 1X2MA 2VBWA 4D7NA 2P5VA 2WADA 2X9DA 4M3EA 1BJAA 4A6DA 3PQJA 2ETHA 4PJJA 5L3CA 2O8KA 4C3JJ 2OAZA 1HBXG 4ZTFA 4IHSA 3LSHA 2DPUA 1D1BA 1MW7A 1IN6A 2A5WA 4Z6YA 1MGTA 3JRIA 3T8RA 2X0LA 1MJ9A 3M9AA 1HKTA 3LA7A 3OY9A 5IYDJ 2V4JC 3SYTA 4BUPA 4YRVA 1MH3A 1W5SA 1Z9CA 5J4VA 1USTA 4WXDA 4R1HA 1DGRM 4XONA 2KZVA 2Z33A 2CO5A 2LBFB 2TDXA 4X0GA 2BHZA 1UAAA 5IYBJ 3HBLA 3F0CA 4IOAF 3JTGA 1YJ9I 1WH5A 3D0SA 3M1CA 3M7GA 2DI3A 2EZIA 2MBFA 1TC3C 1Z6TA 4BHCA 1ONVA 1O3SA 1P4AA 4N4NB 5K7FA 2E2HJ 4BNCA 1E3OC 2FMLA 1IV8A 2DTRA 1X1PA 5GPCA 2FRHA 2O03A 3BTLA 5DTDA 2OU2A 3MD2A 5D4SA 4F7ZA 2HPMA 4F92B 3BDDA 2R7UA 3L2CA 1ETOA 3DLAA 4J00A 4BE2A 3ERMA 1S8NA 2NNYA 5K7ZA 4NUBA 3IH3A 2XAJA 3KEYA 3KE2A 4HNUA 1ZRFA 4B8XA 1O57A 5D6EA 4BACA 2FOKA 3MQ0A 1WJ5A 2CQ7A 3BR0A 5GPAA 1T98A 3U2RA 1BBYA 4LLGF 3KYCB 3GZNB 1C0WA 3I71A 2HDCA 4L18B 4BY1J 4A2UA 4Q4ZF 3QYEA 3OSFA 2CQQA 4G94A 1FOWA 3ZOBA 3CQZJ 3OL4A 4Z2YA 3C7JA 3L2VA 2FMYA 1MBGA 3DEUA 4NNJA 2HDWA 4IQJA 4EVIA 3H35A 4A3KJ 1QQIA 2DQLA 1VQKI 1P7IA 2HFHA 4UB8C 1WKMA 2P5KA 5M5WJ 4RS8A 2YX4A 1U3EM 4L9TA 3CESA 5BNGA 3UKGA 3IKTA 4H0EA 2V9VA 4BQOA 2MSYA 3HKZA 2HVSA 5DM6F 3M8FA 1JKRC 1P4XA 4Y7NJ 1FNNA 1XSDA 2P0WA 2VL8A 2XUBA 4XSXF 5HS7A 3PSIA 3U1DA 1BI1A 1JHFA 1VI0A 2HTSA 1UB9A 3F8CA 4G12A 2QVOA 4V2FA 2COBA 2O0YA 4NB5A 2DJNA 3LSPA 3K2AA 1B4AA 1U0JA 2V7FA 2JA5J 4U7DA 1WWXA 1YYVA 3C18A 2KISA 4P96A 5IT9K 1SVMA 2HKXA 2E2JJ 1BIAA 1JE8A 1LUJB 3LQRA 1T0FC 4MEXF 4A3BJ 1TLHB 3BTCA 3QYFA 2G9WA 4CYCA 2XAUA 2VPRA 4C2TA 1BA5A 2EK5A 2HXOA 2RV8A 2MH2A 4NQWB 3E6MA 2DT7B 4PSXA 2EIJH 3RQIA 2ELKA 3DKWA 4RM3A 4A93J 4WX9A 5JR3A 3GLXA 2DT6A 1U5TA 4XLFA 5F6FA 1BL0A 1JXSA 5C3EJ 3FKIJ 2ZXWH 2HYGD 3W2AA 3CCQI 2HR3A 4C2MJ 3DU5A 2WV0A 2VE8A 4D5CA 3WTSC 3MVPA 4IRGA 5DCMB 1PP8F 2LF7A 4EMSA 4EV0A 4F3QA 5E17F 2W00A 1R4MB 3KEQA 2L4MA 4M3BA 2A68F 3RKYA 1YLFA 2E2IJ 1R9TJ 2DYSH 3FBNB 3F8NA 5C4JJ 2H6BA 2R7TA 2FQ3A 3PNTA 2OQRA 4F91B 1RESA 5JVGF 2CV2A 4MLOA 1R71A 3GTMJ 4FISA 1WRJA 2H6CA 1JUPA 3BR5A 3K1NA 4C9YA 5IYCJ 2RNJA 2FSWA 2EBIA 1W7PA 2NVTJ 1E0EA 3T5XA 5M3FJ 4ZYDA 3BT9A 1UHMA 3GFJA 3CUOA 2A3SA 4J19A 3K69A 2LF8A 2Z99A 4M3FA 1BC8C 3V8JA 3QQAA 2BYVE 4CCJA 4BE1A 5DV5A 5C44J 4ESJA 3BCBA 2JN6A 2MLKA 4AIJA 3S14J 4HV6A 3A4CA 4BXUA 2CQKA 4LK0F 3GLLA 3BY6A 4EJVA 3W2WA 4XOTA 3OV8A 4AIKA 1IN7A 4PK4A 3E6CC 2LD5A 4Y17A 4MFDA 2NYXA 5D6FA 5GTIC 4AU7A 2A05A 2K7LA 5C4XJ 2JA6J 1JKOC 2O8XA 4CYCB 2R5ZB 4ZDLA 1ON1A 4HQMA 3BJAA 1W0UA 3BG6A 3NRVA 2WV1A 4BY7J 2DA6A 1WFXA 1XS9A 3EUKL 2P8TA 4XORA 3LSGA 2V1DA 4IOCF 1NH3A 2E1NA 2L3DA 5TISC 1OISA 2K85A 2XPVA 3JW4A 3JCUC 4RB0A 1TW2A 2D1HA 1LE8B 4G6DA 4I0AA 2RDPA 5FLVA 1LKXA 3L2WA 2OF7A 3ZRGA 2R7QA 4N0BA 5M5YJ 4NQWA 2Y75A 5E18F 3TMOA 4MQ9F 5K1YA 2IS2A 3TO6A 1R5HA 1UG2A 5K5RA 1PUFA 4A3IJ 4BQQA 3I4PA 1SAXA 1E3PA 4HW0A 1TZLA 2NXNB 3FXMA 3HPHA 4IRHA 2X4HA 1DUXC 2DLLA 5JHUA 2F5FA 3K10A 1DGWY 4I09A 4G9YA 5KAIC 2CS3A 1ZLKA 2XGXA 1I5ZA 1I1GA 3CCVI 2VQGA 1RI7A 1I39A 2HQ5A 1LE8A 4EGYA 4CXFA 4O6JA 4U7BA 2XKOA 1R23A 3GXOA 2QLZA 3CF5F 2OJED 2M1BA 4GRIA 5L3GA 1YW7A 3LSTA 3N97A 2ESHA 2EINH 2E60A 5D4RA 1TTYA 2NAZA 2XDVA 1ZR4A 5LFAA 2VOOA 3NWTA 4MTDA 2M9HA 2Y48A 3S2HJ 4E7LA 3S3MA 4KJZA 3A01A 4XBFA 1IN4A 1ZHFA 4D1QA 4BJ5C 2H1KA 4BDZA 1XX5A 5ICEA 2DA3A 3I59B 1K78B 1AOYA 2W82A 3J7ZI 5F08A 4YFXF 2HXIA 4HF2A 3ZQHA 2IRFG 3FDYA 3KZIC 3RPUA 4RAFA 1D1CA 5J1UA 2PJPA 2DA4A 5K5OA 4DZJA 1MMDA 1HCRA 1Z3XA 5F1JA 1T33A 3NARA 4FASD 1S6LA 2XRLA 5HLIA 4XL9A 2D5VA 3PJRA 3I0TA 1TQMA 4HZFA 5EJCA 4QPOA 3KFWX 2JMWA 2EV5A 5K5QA 2Q1ZB 2VQLA 3P9CA 2V9KA 1T39A 1USSA 4R79A 1N25A 3JSOA 2IS6A 3FXLA 1ZGWA 1MKMA 1PYVA 2GXBA 1GT0C 2E35A 2A69F 4AVZA 2Y69H 3V8KA 4F55A 3WTTC 2VXDA 2XV4S 4NBQA 2ZSIB 4D0PA 2KIUA 2XPUA 2K4JA 1QZYA 1SVLA 3MFKA 1QRYA 4IJAA 3VYTB 3J7YJ 3HIFA 3FIWA 2LP0A 1O7LA 2XROA 2CFXA 1BW5A 4C30A 2B0LA 1ZK8A 2NOJB 2VT3A 5J1RA 4Y15A 2GXAA 4A5MA 1ZGAA 3HOYJ 3HHGA 4BKXA 1N77A 3CZ6A 1X4OA 4XR6A 1PUFB 3HOSA 4CA0A 3FISA 3C2HA 2JZYA 1FBUA 1UCRA 2XC7A 5DDGA 3TP3A 3OYLA 4GYIA 1F4KA 4IF4A 5LGNA 4FX4A 3IKVA 3ZMDA 3NAUA 1IDYA 2D2WA 4DYQA 1QZEA 1D8JA 1HW5A 3R0AA 4XRFA 2BW3A 1X1AA 3WTWC 1OYWA 3RCOA 2PMZA 3S32A 3Q5FA 2IAIA 1HW2A 2X6YA 3I59A 1K78A 4B3AA 3VYSB 3ZP5A 5E3MA 1XMAA 3OYEA 3CP2A 2LKPA 4UV9A 4I01A 1XMXA 2BHYA 3FXUA 3BOQA 3JAMZ 2DO7A 2MLGA 4RB3C 2UWMA 3ZPLA 5M5XJ 5E3OA 5GAEJ 5DEQA 3CCUI 1YIOA 5BOXA 5FLXZ 3GZ6A 3VODA 1ZRDA 1R4NB 5F0FA 3PO2J 1IRFA 1ETKA 2JRTA 3WTXC 3HPGA 3QU3A 1WJEA 2A6EF 4OIRF 3T1BA 3ZQFA 4II2A 4QWQA 3WGIA 5BPDA 2VKEA 2GA2A 2M30A 2CFOA 3QOEA 5IP7J 1ZRCA 2KFDA 2D1VA 3UR3C 1F9NA 2A07F 3I55I 4PGGA 3ZQLA 4UVCA 4I99C 3TOAA 2ID3A 2O9LA 3E5XA 3R60A 4O5VA 1MMNA 2IS4A 3EETA 3IUOA 3O3KA 1D5YA 2HNHA 2QEXI 1XDUA 1H9TA 2I10A 3K2ZA 2M34A 4HG2A 1R1UA 2R7OA 3BZKA 2YU3A 1QU3A 1FEXA 5BPIA 1MNEA 3DWLE 1Z1DA 2L9RA 2XB0X 2LRDA 3BWGA 4BYYA 3FMQA 3HOVJ 1A6IA 2XPWA 4F93B 5J8CA 2W4SA 2Z9OA 2OBPA 1SANA 4B1RA 4DYRA 2L7MP 4CCMA 2M7BA 2MGQA 2E5NA 1QA6A 3BG9A 1KU3A 2R7SA 2CQNA 1BOAA 4QLCU 3OYMA 3VB2A 1ZLJA 1BW6A 3RTRA 2LSOA 3EQLF 1W36D 1AA7A 2JA2A 2VKVA 2X1CA 3K0LA 4EJWA 2HOSA 4XOPA 3OYCA 4IHXA 2ZJRF 2VBXA 4PCQA 3VSLA 3KX2A 1I1SA 1FSEA 2MC3A 1OCOH 5AIQA 4ABZA 2VOPA 1R5GA 2L0KA 3DKYA 1IN8A 4ZYEA 3BR1A 3HSFA 2MFZA 1MBKA 3GW2A 3TW7A 3HGGA 2EJRA 3WGGA 3ABTA 3TKYA 3HSEA 1BR2A 5FRNA 4IL6C 2B9SA 2L9SA 3VYRB 2K3FA 4WXHA 1JGSA 3Q0UA 3G1OA 2UXNA 2NVYJ 4KA4A 5FB2A 4HX7A 1OCCH 1WVRA 2OPTA 5E3LA 4A69C 4L5EA 5E8IA 2HPIA 4E6KG 1S7AA 2QA4I 1PJRA 2BVMA 4A3MJ 4LK1F 9ANTA 4I6ZA 2R92J 2EIKH 2K40A 2NNNA 3I9V2 1DP3A 4BJTA 3SFZA 3AKZA 1X58A 4XKBA 4OMZA 2DTZA 3VSKA 5EG0A 2V1XA 1S72I 2LREA 2NOGA 5CVRA 3CO6C 1XPXA 2DMTA 3ZCOA 1NTCA 3V7RA 1HLVA 2PJRA 2DQRA 3SZGA 5E3NA 1B8IB 2QBYB 2DMNA 2ICWG 3MN2A 1F5TA 2TCTA 3HKZN 4B43A 4Y52J 4EM2A 1ON2A 1KZHA 2RN7A 4DW6A 5F27A 2IS1A 3PO3J 4LMYA 3HOUJ 4RBOA 2GQQA 3M4OJ 2IGNA 3A02A 1R7JA 2ZFWA 5K7HA 1KQ8A 2Z1DA 3CMEI 1MD0A 5BS6A 2JPBA 2HGCA 4BE0A 1J9IA 3GYHX 3WE2A 2GA1A 2XF5A 2VB6A 2QUFA 3C2BA 4HNVA 1Z7UA 1LDJA 4B47A 4Q5SF 3BJOA 1U6GA 3D1NI 1SFOJ 4CHUA 4LLNA 1TL8A 3I58A 1Z3YA 3H9GA 2STWA 2E36A 4LOCA 3LFKA 1ZELA 3GVAA 3G2BA 5FD6A 2MABA 5CLSA 1Y1VJ 2XGDA 1HOMA 1R5ID 2DFFA 2DA5A 3LAJA 1GVJA 4BXFA 2RC4A 1I3QJ 3C2GA 4F52A 2M3AA 2L9NA 1VTNC 4NC8A 3H3ZA 4R8HA 4FQGA 1FYLA 2OCEA 3ML6A 4EEFG 1XTAA 4PJLA 3BJ6A 1SFEA 2F48A 4KN4X 1EH8A 2JSCA 1VQ5I 1LVKA 2XVCA 3S8PA 3QPLA 5FLMJ 2Z3YA 3K4LA 2WWYA 4XSZF 3TEDA 2RKHA 3SDBA 2WB1N 3CUQC 2EFWA 3HC7A 3R6SA 3K4KA 3JREA 2EFQA 2MC4A 3FK7A 3RSNA 5FGMA 4EJUA 1IZ1A 4YEJA 3WHBA 1ETQA 3HDDA 3AL0C 2G7UA 5F0CA 1W7PD 2EZLA 2UV1A 4Y3OA 1AHDP 3F21A 1U78A 3RPQA 5JVTA 2Y0SN 2HI3A 3I53A 4AC0A 2F5DA 1X1CA 2FA5A 1LB2A 1G59A 3CP8A 4M6YA 4OU0A 2OZUA 3K4NA 3S93A 1T38A 4FETA 5HNFA 1CF7A 2LY9A 1HC8A 2KDOA 5KNLA 1FLIA 5EEAA 1BI2A 4M74A 4ZTJA 3F72A 2P4WA 1QO0D 4GGGA 4ZH4F 4C2UA 3MZHA 2PQ8A 4WXCA 3JRCA 2DMUA 3BR2A 2CQXA 1Y56A 1A35A 1JUMA 2DFEA 3PQKA 1KYZA 2QWWA 2R0QC 2LC2A 1ZN2A 1IUYA 1I50J 2KZGA 3IWFA 3ZMVA 1FYKA 2JVGA 5FLXK 3BQYA 4XICA 4A3JJ 2AHQA 1ZH5A 1NG6A 2DFIA 1LFUP 3GO5A 2FNAA 2DMQA 3HHHA 4M72A 1I6HJ 3TDZC 4BAYA 1OJLA 3BPXA 4HV5A 3KP3A 5HOOA 2FBKA 5BQTA 1ZR2A 3J80K 2G0EA 1N75A 2KJBA 3GWZA 5HS8A 3FM5A 2BXYA 3HUGA 3IHUA 2EV0A 3V7CA 1T08B 1U2WA 4G7OF 5HLHA 5E8GA 3H92A 1D3YA 2UUZA 3AG2H 5EF6A 1XCVA 4OIOF 1SMTA 1KA8A 2HDDA 2VIXA 2BVLA 4KIGA 2N8GA 4PJMA 1JUSA 2BW3B 3I64A 2VBZA 1EKEA 3WG7H 3ZMTA 2ZMEB 3OYFA 1KQ9A 1XN7A 2M0CA 2WBMA 2X51A 4CUGA 3TDUC 2EV6A 3H3UA 4A5NA 3PUBA 3CMAI 2R7DA 2ZXHA 2H09A 1Z0XA 3Q0WA 3G6EI 4X1EA 4W1UA 4Y33A 2L2OA 3TO9A 4ITVA 4XLCA 4M9XA 2FXAA 4KMFA 3GTGJ 2F4IA 1V4RA 4KUMA 2L9VA 1JGGA 4RLFA 3DPUA 1BOBA 3L2QA 2GXGA 1RUNA 4N9IA 2PEXA 3ZR8X 3OYNA 4AIHA 4XNFA 4IPAA 1VQ6I 3JRDA 1A36A 3ISPA 2LMDA 3KLOA 4HLXA 4U88A 3V42A 1SD6A 2L02A 4K2EA 3LAPA 1HW1A 2IJLA 4IXAA 4V19K 1BJZA 1YRNA 2EFNA 2MYSA 1QVUA 2CWEA 3CJQB 2P7CB 4YIIA 4G7HF 1IC8A 4DIQA 3C1DA 4QPQA 3VDXA 3I54A 2K27A 1BC7C 1RUOA 3NEUA 4B4CA 2DPDA 1WCMJ 4OAYA 1OCZH 2QQ9A 1POGA 3H5NA 4HBLA 3QODA 4P9FA 5LRRA 2XAFA 3CUQB 2DT5A 2ZCWA 3SEZA 3KPHA 3OS1A 4BH9A 1FOXA 1VQ4I 2A5YB 1FWZA 3DPTA 3I4NJ 4ZYGA 3RIRA 1RNLA 3TW6A 5GAHJ 1PP7U 3BZ6A 3JRFA 1T6SA 2W7NA 2KIMA 1O3QA 4M9SA 1GXQA 1RETA 3O6BB 3Q9SA 3GZ5A 3G71I 3A1YA 3J81Z 3KIOA 4RAGA 1K4TA 1Y39A 4NC7A 3ZN1A 1XB4A 1YX5A 3NWSA 3REOA 3S2DJ 3IRQA 3F6VA 2L7ZA 4KIFA 3FXRA 3OL3A 2IA1A 5DD4A 1YIJI 1ZG5A 2F4OB 3CCSI 4HX4A 3FXKA 2CUFA 3JTHA 3V7SA 2WAQA 2GOXB 5CKTA 3OYAA 1TBXA 4XLHA 2LK2A 1WSUA 2WA0A 4BU2A 2M45A 4YFKF 3H3VK 2LVSA 3K4JA 2VN2A 4LD5A 4BQAA 2Y30A 5CVIA 1WZ2A 1APLC 4L0YB 3M1EA 3WG9A 4ZYAA 1J2XA 2DN0A 2KJCA 3L09A 3GMEA 3D5LA 4HRIA 3LNQA 4KIBA 4UV8A 3DTEA 1IAWA 3OIPA 3ECOA 3CJNA 5JLWA 2IVMA 2W48A 3BQZA 3MZ8A 4L5IA 1OCPA 2ZNYA 1VQNI 1RZ4A 2PMHA 2X1DA 3RDIA 2X1EA 2QSGX 2H8RA 3DCFA 4WCGA 4EATA 4M71A 1SEUA 5GTHC 1SMYF 1TW3A 5J40A 1NK3P 3P9IA 1H9GA 4GCVA 4PFOA 3ZGKA 2EA4A 2F5EA 1X2NA 3OYDA 3SEQA 2XSJC 2RVCA 1REPC 3LWFA 2R5YA 3PM1A 4RGUA 3E6BA 1QVTA 2AQFA 2A6HF 2AXTC 3KP4A 4YG2F 2R7RA 3EYIA 2DDBA 2HWVA 3OYIA 4I98B 1QGPA 5DS9A 2QM3A 3FX3A 1X19A 4CCOA 3WTUC 2YS9A 2QQBA 4BHPA 1Z7LA 5H6QA 1CQTA 1O3TA 1YS7A 1SC7A 2PN6A 3WU2C 1X1BA 2LYCA 1U9NA 3E5UA 3MZYA 1WPKA 3KP2A 1HXDA 3CDIA 1P4WA 3MMYB 1S7EA 1D1AA 4KITB 3T8TA 3MWMA 3H9QA 4D9JA 1V55H 2MD0A 2JUGA 4B3XA 1K6OA 2PBIA 2NVUB 5FKLA 5L3EA 1VQPI 4Q48A 2LY2A 4FX0A 5H20A 5D5WB 1VQ9I 5IPAA 3ULQB 1BR4A 1ZAOA 2CUZA 3PFIA 3CMYA 1SFXA 3O8HA 3F23A 4PJNA 2DOFA 1UELB 1TP4A 5ICCA 2HZTA 4O3MA 3GTJJ 3CC7I 3GTOJ 3RI4A 3RJPA 2QQ8A 2DA1A 3R0JA 2B63J 2LFBA 1VQMI 4LG0A 4B09A 2MA3A 1WQ2A 1MJBA 1MBJA 1ORKA 4XIDA 1IUFA 5L3DA 5E1XA 4QIWN 3MEXA 2F5CA 1YRNB 4A0YA 2AS5F 2QENA 1TWGJ 1DDNA 3I4MJ 3R4KA 3MKZA 3B6CA 2H27A 3H1CA 4QSHA 3KETA 2UZKA 4BEHA 1MBHA 1Y8QB 4I0BA 1R49A 2QYOA 3ZN0A 1VZ0A 2BY3A 1Z91A 1HDPA 4G7ZF 2VQCA 1P2FA 3AG4H 1D0XA 2WAQN 2FBHA 3RKXA 3G4SI 1OMIA 4FE7A 4QTRA 4BBRJ 2KPMA 4BS9A 1K61A 3HUGB 2DXIA 3E97A 1HSJA 2K5CA 2R5ZA 3W6KB 4I2OA 2Z2SB 2M4KA 2OD5A 2GM4A 3QP6A 2VJ4A 1Z05A 4P9UA 1YFHA 2VKDA 1A31A 2XIGA 4IHWA 4G6QA 2R7WA 3ASNH 1OKRA 1YG2A 3FK6A 5LGTA 3W2VA 2Y9ZA 1MDMA 4RAZA 3ZQQA 3S16J 4MNUA 1IJWC 3O2PE 3OOUA 5AIPA 1S9HA 4IEJA 4XKVA 1J5YA 3QPTA 3FF5A 5J3LA 4U0YA 2Y9YA 3ZXSA 2NS0A 3QU6A 1F36A 2COMA 1Y8RB 4DYCA 1G3SA 1ETYA 3JR9A 2OUMA 2LLKA 1W1WE 2L7KA 4IHVA 1ACIA 1VQOI 3K4MA 2OTLI 1YQAA 2DDAA 3K70C 2KLOA 1JTYA 1TWHJ 2HTJA 3SZTA 3AAFA 3WTVC 1J0RA 4ESFA 2NS7A 4BXXJ 2OCCH 3LSIA 1DQUA 4UUSA 2E1OA 3KCCA 1FBSA 3HXLA 2WTEA 4OIPF 1F1ZA 2DA2A 3LMMA 5J1YA 3ABKH 1Q1HA 5HDNA 3K70D 3FBIB 3LSJA 4HDVA 3HYIA 2FE3A 2HVRA 3OYJA 2JA8J 3BROA 3GCMA 2Q2EA 4BBSJ 1FZPB 3HOXJ 1ZYRF 2LOOA 2WY7Q 3H0GJ 1W4MA 5JLXA 4YIRX 1B1BA 4YELA 4UVAA 1N78A 2VONA 2FF4A 3ECHA 2W25A 2NVQJ 2HQRA 3I3LA 2R5YB 2O5RA 3K6GA 4A0XA 2FBIA 4HF0A 1ZGJA 3PFYA 3OSGA 4LG0B 1JI8A 2LBFA 5IP6A 3HRSA 3BCAA 4KNYA 1K7AA 3HTSB 2K02A 4JX6A 1GV5A 4AYBA 4IHYA 5HS9A 2Y31A 1AKHA 5FKNA 1O7FA 2Y2ZA 3BG7A 3FMSA 5F0HA 1D8KA 3L7WA 1SFUA 1RKWA 4HQEA 4E7JA 3W6JB 5ILVA 4JBAA 2ZB9A 1WH7A 2IGOA 1A6QA 4D7MA 2JT1A 1OFCX 1PUEE 4ESBA 3S3NA 5B1BH 2JQ7A 2KDZA 3QPHA 1IF1A 1YJNI 2I8DA 3HL2A 1XGMA 4KMUX 2HOTA 2K4BA 3PIOF 2W85A 4IQ4A 2C6YA 3H5AA 2IA2A 3HZJA 3AL0B 2DU9A 2BXZA 5HVQC 2DOEA 2FOWA 2KIQA 4RGRA 5KVRA 2YU9J 5CYVA 3EPZA 1OLTA 4E70A 1VNDA 3KYLA 1YJWI 3CMMA 1G8XA 4HF1A 1FSHA 3U21A 3ONQA 4EM1A 1J75A 2IXSA 4XKCA 5FFZA 1H89C 1FC3A 2M2EA 2QKLB 2LDUA 1FYMA 2L4AA 1SVOA 4A12A 1OPCA 4UXNA 5HLTA 2EFPA 2W84A 4UB6C 2KKOA 5ICFA 2E71A 4B48A 2VUMJ 2FEZA 4ON0A 2HOEA 5FROA 1UZCA 3VEPA 3ASOH 3ZMUA 1MMSA 1GVDA 2F5VA 5F04A 4IZZA 1G3WA 1EH6A 1GHCA 4KICA 1IDZA 1DU0A 1JKPC 4IRIA 3DKXA 4ENMA 3WHCA 2IEKA 2RQQA 4XRSG 1BR1A 1S5LC 4OAZA 3M8EA 5JFRA 1RKTA 1I3AA 3F8MA 3ZQGA 4Q47A 5FRMA 2XAGA 3P9KA 2X48A 4E4HA 3KP7A 2ZFUA 3TO7A 1FMWA 3LQQA 4UUTA 4CZZA 1YI2I 3CCMI 2ELJA 1LJ9A 5GADJ 2RNGA 3BG3A 2LNBA 2P7VB 2ZJ2A 3HM5A 4BDYA 5IT9Z 4NHJA 2L54A 5HODA 3H5RA 2O6GE 1YHQI 3CJTB 3OR2C 3PL8A 1SD4A 2W24A 2DAOA 2M8EA 3S1NJ 2H94A 3QP5A 1RPWA 1UHWA 2EWNA 3WU1B 1FOKA 3GTLJ 5DUKA 3OMYA 2OTJI 4A6EA 1TQPA 2DBBA 2ZMEC 2CUJA 5F64A 2ELHA 4E7SA 1FY7A 3IH2A 1EF4A 1IRZA 1SFKA 2YPRA 1ENHA 4JX4A 3F22A 1OR7A 1J59A 1IXRC 3GF2A 1B9MA 2QZ8A 3JRHA 4L5JA 2FD5A 1JTXA 4M6VA 4E7KA 1WI3A 1G3YA 4OINF 5DD8A 1B6AA 3B73A 1FPQA 5J6XA 3DBHB 3CJRB 3HJEA 1W5CC 2TRTA 2LH9A 1V5GA 4NC6A 3JRGA 5D8KB 1OR7C 1YTYA 4PZJA 2ISYA 3FMRA 1OYYA 3HRUA 2UXXA 1RR8C 3WE3A 3GTPJ 2VI6A 3DP7A 1I6XA 2K9LA 4WF2A 3S1MJ 5GAGJ 3CDLA 3ZMZA 2CUEA 2HQAA 3G1LA 3A0HC 2HS5A 4G8XA 3DQVC 1QHGA 2CW7A 2RREA 2GIVA 4RGSA 4ZYHA 5L3FA 5A2QZ 2XASA 1X3ZB 3VYUB 5KK1A 1KYWA 4U87A 3TOBA 2XSDC 4RB1A 5E79C 2V26A 2BBYA 4YFNF 1JJ8C 1BI3A 1TT0A 4HSTA 5M3MJ 1JJ6C 4W97A 4ZDPA 1ETVA 3J7AO 4A3EJ 4EM0B 3SJMA 3RZDJ 1RC9A 4U0VA 4CGZA 2ECBA 2VPLA 1WJAA 3O8GA 2ESNA 2IT0A 3OYKA 1LDKB 3MAJA 3QYBA 2VC0A 4JOMA 5LRSA 2R7XA 1XGOA 3RKWA 3G73A 4DGWB 2ZMEA 5B1AH 2JA7J 2X85A 2FQ4A 3IWZA 2G7HA 5IP9J 4ENKA 2IGMA 2Q0OA 1P6RA 2XAQA 3HRMA 5EGOA 2VASA 1XC5A 1W36C 1FIPA 2V6CA 3AG3H 2P6SA 1FBQA 3ABLH 4MTEA 1K6YA 2GWRA 4UNOA 3WODF 1G4DA 2RGVA 5E1ZB 3TGNA 5HDKA 2VJIA 2OA4A 3SDGA 2J5PA 3IC7A 5DUIA 3HRTA 2W1OA 2KHMA 4FCYA 1HSTA 4CO8A 1Y0UA 2EQRA 3PUFA 5D5XB 2NVXJ 3BR6A 3LL7A 4LIVA 1WJBA 4CCNA 2KRFA 3VFZA 4HSRA 2EIMH 4JQFA 1R1VA 3EUHA 1Z21A 3C3WA 4L9JA 4M3DA 2K9SA 4RLQA 5DYMA 1K4SA 4AWXB 5FKMA 1HQCA 3E7LA 1KGSA 3ZMSA 3CCJI 3KZZA 3H9JA 4AM3A 2Z5UA 2ADUA 1HDDC 1SD5A 2DA7A 1RIOH 2ZXIA 3OYGA 2OZ6A 1LNWA 2CMPA 1R36A 4GDFA 4CCLA 2CG4A 5CJ9A 1GLNA 4MFEA 4RB2C 1UFMA 3GFIA 3F8BA 2WY8Q 4XM3A 4JP0A 4KT6A 3GEZA 2BEOA 2WAEA 2ID6A 2KP6A 4P55A 2BOLA 2P81A 4EGZA 4X6AJ 5DM7F 3BP8A 1P9QC 1XG1A 2DW4A 1FX7A 5FO5A 1MBFA 4LB6B 4N9HA 2DK8A 4HOBA 1J09A 1YOVB 1ETXA 1FIAA 3LOCA 2DOAA 3CF2A 2HEOA 1T95A 4UY8I 1TWFJ 1CGPA 1MBEA 2ME0A 4EJOA 1LFBA 5LEKA 4L9NA 2HYFA 4DJAA 1U5TC 1BI0A 2XF6A 2VLAA 2LG4A 2V9PA 1WI9A 2WB1A 3I5UA 2DCEA 2DYRH 2HU9A 3CC4I 1B9NA 1MMGA 1G3TA 2XF7A 4MGRA 4C3IJ 1ERDA 2CV0A 3HG9A 4AIDA 5E20A 1NHAA 1UJ8A 3F9KA 2M5WA 2YSRA 3OYBA 5ICGA 2BV6A 4A3DJ 3JSPA 2OV7A 3CD6I 3ABMH 1S3JA 5GP9A 1KU9A 3CLQA 2IW5A 2CU7A 1FOYA 1OQYA 1XSVA 2IPQX 1ZARA 2JK3A 1LPQA 3FXOA 5DCFA 5HDGA 4ANJA 3U1KA 2ZKZA 2CSOA 3T0YA 3F8FA 4M3GA 3A2KA 1T56A 2VXZA 5L3BA 5LHHA 3TQNA 5LGUA 3HOTA 3P7NA 4CDGA 1R22A 3A0BC 3HEFA 2EPFA 3OWTA 2KRCA 4EJTA 5IOYA 1RRJA 1MZBA 1MMAA 3W3CA 4CH7A 5IY5H 2KIFA 3N4MA 2KRHA 2IA0A 4UUSB 3GFMA 3KP6A 2BGCA 1JKQC 1T8IA 1OCTC 1W5TA 5FKOA 3GTQJ 2K86A 3BPVA 1Y6IA 2M7AA 2JVHA 3EYYA 5FKKA 4CICA 5EDNA 2PX9A 4XQFA 3SFIA 1OYIA 2F4MB 2XAHA 1D5VA 1AU7A 2QF7A 2XGCA 4KT5C 1HKSA 4LITA 4E7ZA 3QAHA 1D0YA 2Z16A 1B72A 3ROUA 1A5JA 4MIMA 1V54H 5ILUA 5HNHA 3E3VA 4BQNA 1YO5C 5H6RA 3KLNA 1IW7F 2HOAA 1B8IA 2QBYA 5EYRA 2ZNZA 2L01A 4DNCA 1K83J 2Y0SA 3MKYB 4LFUA 1OCRH 3FZVA 4YIFA 1O4XA 1EV7A 5EEHA 1V5FA 2ME6A 4ETSA 1DPUA 3RZOJ 4A3LJ 3H0DA 2MG4A
chains in the Genus database with same CATH topology
2VKDA 3S3OA 3LFUA 2R7WA 3M1CA 3M8JA 4OWRB 3FKJA 1BR2A 5FRNA 3W2VA 2L9SA 3VYRB 4N4NB 3ZQQA 5JHFA 2M0MA 3OOUA 1S9HA 4XKVA 3MD2A 3ZXSA 2HPMA 2HPIA 4E6KG 4F92B 2R7UA 1PJRA 2BVMA 3OIQA 4J00A 3DLAA 4BE2A 3I9V2 1DP3A 4BJTA 4LG3A 4RM2A 4XKBA 3AKZA 2OUMA 4NUBA 3VSKA 2L7KA 2LREA 1X4PA 3KEYA 4HNUA 3AFHA 3K4MA 3K70C 2KLOA 4BACA 3IP4B 3ZCOA 2PJRA 1WJ5A 4II3A 4XN3A 3SZGA 1EA3A 3LSIA 5CQGA 3LSKA 1DQUA 4XKWA 3HXLA 4B43A 4DBQA 3LMMA 3QYEA 3K70D 3FBIB 2IS1A 2HVRA 4P1WA 3DTKA 3OYJA 3OL4A 2IGKA 3L2VA 2WAFA 4NNJA 2HDWA 4ZJZA 2LOOA 2WY7Q 4IQJA 2IGNA 3H35A 4LIUA 2Z1DA 4HPQA 4BE0A 4YELA 1N78A 2XF5A 2VB6A 3CESA 3I3LA 2AQEA 2O5RA 4B47A 4BQOA 3K6GA 4ZDOA 4J01A 1NG7A 3HKZA 1UG0A 3PFYA 2HVSA 3L2UA 1JI8A 1Z3YA 2LBFA 2P0WA 2VL8A 3H9GA 3BCAA 4Y4RA 4IX7A 3MKWB 3BC8A 3PSIA 1ZELA 3G2BA 4AYBA 2MABA 1U0JA 3D5SC 2V7FA 1YE9A 3BG7A 4BXFA 3C2GA 2E1MB 4F52A 4E7JA 2M3AA 2L9NA 1T0FC 4NC8A 5CQEA 2K3PA 2IGOA 4P5OA 3QYFA 4PJLA 3IAM2 2V1NA 2XAUA 3PSFA 4C2TA 3S3NA 4E7HA 4NQWB 2DT7B 4PSXA 4RM3A 2I8DA 1LVKA 3HL2A 3S8PA 3K4LA 2DT6A 4XLFA 4IQ4A 3H5AA 3AL0B 5HVQC 3SDBA 3HC7A 3W2AA 3K4KA 3EPZA 1OLTA 2MC4A 3KYLA 2R4GA 3CMMA 1G8XA 3EUAA 3RSNA 3U21A 3DU5A 3ONQA 4YEJA 2IXSA 3AL0C 4XKCA 2CH0A 1HA8A 2UV1A 4Y3OA 2QKLB 4F3QA 4N4OB 2W00A 1X1CA 1G59A 3CP8A 5HLTA 3FBNB 3K4NA 2R7TA 3PNTA 4CZCA 3S93A 4F91B 4FETA 4XMYA 5HNFA 4MLOA 2CV2A 4B48A 2KDOA 5KNLA 4C9YA 5FROA 4ZTJA 1E0EA 2F5VA 4IZZA 2X6XA 3E1SA 4C2UA 3DKXA 4CCJA 2OC6A 2E5ZA 5KCMA 1Y56A 4BE1A 3BCBA 2LC2A 2RQQA 1BR1A 2JVGA 4OAZA 4DBRA 3A4CA 1NG6A 2VJJA 4B44A 5FRMA 3W2WA 5LD2C 3PNYA 4XOTA 4E4HA 4PK4A 2ZFUA 5HOOA 3K4CA 1FMWA 4AU7A 1N75A 2ELJA 3GBGA 1WJCA 2RNGA 4ZDLA 4BDYA 3BG6A 3TBIA 3H5RA 3OR2C 1WFXA 3PL8A 4CSWA 3N05A 3EUKL 2HVQA 4XORA 3LSGA 4BJ6C 2UUZA 3OMYA 2Q2EB 2CUJA 4E7SA 2VKHA 1SFKA 2VIXA 2BVLA 4PJMA 2BW3B 1LKXA 3OYFA 3L2WA 3ZRGA 2R7QA 4IKFA 2WBMA 2X51A 2QKMB 3RQ4A 4CUGA 2CV1A 4RMNA 4E7KA 2HZDA 3PUBA 2ZXHA 3TMOA 2IS2A 4Y33A 2L2OA 4ITVA 4XLCA 4BQQA 3CJRB 2F4IA 2LH9A 1V5GA 1TZLA 3DPLC 4RLFA 1OR7C 3HPHA 3DPUA 1BOBA 3L2QA 3K10A 1DGWY 1WJFA 2K9LA 3ZR8X 3OYNA 4XNFA 2CS3A 2HQAA 2VQGA 3D5RC 1X1DA 3DQVC 1QHGA 2CW7A 2RREA 4U7BA 3V42A 4DOZA 2M4GA 3VYUB 1WJDA 4U87A 4GRIA 2V26A 2MYSA 1TT0A 4HSTA 1R6RA 3CJQB 5CPRB 2E60A 2CW8A 1D0ZA 4ZDPA 4DIQA 2XDVA 4QPQA 5LFAA 4XLAA 3VDXA 3NWTA 2VPLA 1WJAA 3OYKA 1LDKB 4HEA2 4CCKA 4KJZA 4E7LA 4OAYA 2F6CA 3S3MA 3QYBA 2KMUA 2KL4A 3H5NA 4JOMA 4BJ5C 4D1QA 3QODA 2R7XA 4BDZA 4DGWB 3SEZA 4XLEA 2X85A 2V6EA 3OS1A 4BL0B 2W82A 2L5QA 3IAS2 3EUHC 2IGMA 3FDYA 3DPTA 1D1CA 2VASA 1W36C 2VQHA 3DU6A 1K6YA 2W7NA 3LSMA 3UNGC 3OS2A 1MMDA 4HNTA 1Z3XA 2VJIA 3A1YA 4FASD 2E1MC 1FMVA 3K4BA 4NC7A 3PNVA 4XL9A 1YX5A 2W1OA 3NWSA 3PJRA 2KHMA 4QPOA 2Q1ZB 2VQLA 2V9KA 3OL3A 4R79A 2IS6A 4XN0A 1PYVA 3LL7A 2JSPA 4LIVA 1WJBA 4CCNA 3TL4X 4HSRA 4AVZA 1QHHD 4F55A 4JQFA 1Z21A 2GOXB 2WAQA 4RLQA 5CKTA 3OYAA 3L2RA 2VXDA 4XLHA 2ZSIB 2WA0A 4BU2A 3K4JA 3VYTB 3H9JA 2LY1A 4ZYAA 2ZXIA 3OYGA 3OYHA 4C30A 2CMPA 3D5LA 3FHNA 1IRXA 4CCLA 2NOJB 4HRIA 2R7VA 1GLNA 3BLYA 3OR1C 2WY8Q 3DTEA 4XM3A 4KISA 4KT6A 3OIPA 2WAEA 2KP6A 1YX3A 2BOLA 1MNDA 3E0JB 1N77A 3CZ6A 4E7IA 1X4OA 2DJIA 2X1DA 1P9QC 4XR6A 3HOSA 2A6TA 2X1EA 4CA0A 5TGTA 3C2HA 2XC7A 4EATA 4BEHB 1J09A 3OYLA 2PJRB 2DOAA 3CF2A 1T95A 4PFOA 2K9MA 3ZGKA 2BW3A 2X6WA 1X1AA 3OYDA 3RCOA 2PMZA 3SEQA 2XSJC 3S32A 2FUG2 2X6YA 2ZSHB 4H4KC 3VYSB 2AQFA 3OYEA 4DJAA 3CP2A 2R7RA 2XF6A 2VLAA 1LFPA 4PUSA 3OYIA 2LG4A 1X19A 2WB1A 4CCOA 2UWMA 2DCEA 2HU9A 1Z7LA 5KHDA 1MMGA 1ERDA 2XF7A 2CV0A 2GOMA 3HG9A 1X1BA 2LYCA 3F9KA 3DTIA 3OYBA 3MMYB 2OV7A 1D1AA 4KITB 3HPGA 1WJEA 3H9QA 4D9JA 4II2A 3VWBA 1V5EA 2MD0A 2JUGA 4B3XA 4PSWA 2CFOA 3QOEA 4ANJA 4G6TB 3UR3C 3RPUD 3J7AY 2LY2A 3A2KA 2VXZA 1KONA 1BR4A 2CUZA 4PFPA 4ZC3A 4PJNA 3HOTA 1MMNA 1UELB 3DEEA 2IS4A 3IUOA 2VJ5A 2HNHA 3OWTA 2KRCA 3W3CA 1MMAA 4HG2A 4CH7A 4BGDA 3OS0A 2R7OA 1QU3A 2KRHA 2KQRA 1SAUA 2WADA 1MNEA 3DWLE 2LRDA 4PJJA 4F93B 1Y6IA 2M7AA 2JVHA 2W4SA 3MKZA 4ZTFA 3LSHA 4CCMA 4XQFA 2M7BA 1D1BA 1MW7A 2E5NA 2A5WA 2R7SA 4BEHA 3OYMA 4E7ZA 4LITA 1D0YA 2Z16A 3OY9A 1VZ0A 3RTRA 5HNHA 2V4JC 3SYTA 2VQCA 1W36D 1AA7A 2JA2A 2X1CA 4BUPA 4BQNA 4YRVA 1D0XA 4XOPA 3OYCA 2KPMA 4BS9A 1DGRM 2Y0SA 3HUGB 3MKYB 2DXIA 4XONA 2K5CA 2KZVA 3KX2A 2Z2SB 2M4KA 3VSLA 1V5FA 2VJ4A 2LBFB 3DKYA 4X0GA 3H0DA 1UAAA 2MFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCO A;  2KZV A;  2LH9 A;  3S93 A;  2KPM A;  2LY1 A;  2LY2 A; 
#chains in the Genus database with same CATH topology
 4PGH A;  3S3O A;  2GIZ A;  3LFU A;  5H2F C;  4C3H J;  4UVB A;  3M8J A;  1QPI A;  4OWR B;  3FKJ A;  2M8G X;  1H8A C;  1YW9 A;  5JHF A;  1E3H A;  2M0M A;  2RAE A;  3CUQ A;  4LB5 A;  1U9O A;  2I5U A;  3CCY A;  1UMQ A;  3QOP A;  4OMY A;  1IGN A;  4LJZ F;  1P7J A;  2R7Z J;  4AUX A;  3OIQ A;  3H36 A;  2ECC A;  1P92 A;  3QPS A;  4LG3 A;  3HGY A;  4RM2 A;  3SXY A;  1L3L A;  1GUU A;  1SD7 A;  4FE4 A;  5EZH A;  2JWT A;  4I76 A;  1X4P A;  2EIL H;  3AFH A;  1QPM A;  4MQV A;  2A61 A;  5LHI A;  1IRG A;  3L1P A;  3IP4 B;  1EH7 A;  4S0H B;  3DXJ F;  1TWC J;  4II3 A;  4XN3 A;  4RAY A;  1EA3 A;  4U0W A;  2ACJ A;  5D5V B;  5CQG A;  3LSK A;  3E5Q A;  2EZK A;  1U8R A;  4XKW A;  4DBQ A;  5KAF C;  4HLY A;  2J5O A;  2YX7 A;  4JYK A;  1YIT I;  3M07 A;  2AO9 A;  4P1W A;  3DTK A;  1IN5 A;  2XGE A;  2IGK A;  2VOD A;  2BY2 A;  3ZQI A;  2K9N A;  2WAF A;  4ZJZ A;  2LKS A;  1ZTR A;  3B6A A;  2OQG A;  1PDN C;  2R93 J;  4LIU A;  4HPQ A;  3SZP A;  2CGP A;  1MDM B;  4PJ0 C;  1FP1 D;  4HAM A;  5A2Q K;  3MCZ A;  2AQE A;  5J47 A;  1VFC A;  1W0T A;  4WWC A;  4ZDO A;  3DF8 A;  3DV8 A;  2EFO A;  4J01 A;  1NG7 A;  1UG0 A;  4OIQ F;  2XB5 A;  1WHU A;  3S2W A;  3L2U A;  3MKL A;  1XMK A;  1GDT A;  4HYE A;  4Y4R A;  1LDD A;  4IX7 A;  3MKW B;  2ZC2 A;  3BC8 A;  1UHS A;  1HF0 A;  2PMU A;  2V1U A;  2H8W A;  2VBY A;  1DU6 A;  1BM9 A;  1V3F A;  3D5S C;  3CLO A;  1YE9 A;  2V79 A;  5F1R A;  4TV7 A;  4KN7 X;  2E1M B;  1B72 B;  2K9Q A;  3VPR A;  1Y0N A;  5CQE A;  2K3P A;  1T0F A;  5LHG A;  4P5O A;  4ENJ A;  5FJ8 J;  1G2H A;  1ULY A;  2KT0 A;  3IAM 2;  2V1N A;  3K7A J;  1ZRE A;  3L9F A;  3PSF A;  2PMZ N;  2GBY A;  2ZXJ A;  1H88 C;  3Q0V A;  3NQO A;  3HSR A;  3QRF F;  1H0M A;  3ZQ7 A;  4GYG A;  3OOP A;  2D45 A;  5EZG A;  3R61 A;  2R4G A;  1KU7 A;  3EUA A;  2GAU A;  3IL2 A;  1FTT A;  2CH0 A;  3KZY A;  4XRS A;  1HA8 A;  1S7O A;  4MO7 A;  2H1L A;  1M1E B;  4N4O B;  2PLY A;  3S15 J;  1Z6R A;  3M3Y J;  3VOE A;  2E7W A;  4CZC A;  4XMY A;  3GTK J;  1LEA A;  1GV2 A;  1IG7 A;  2QQA A;  1QZZ A;  2JTV A;  1JHH A;  2XHK A;  3DLL F;  4HDU A;  1G6N A;  5ERI A;  4LLL A;  5HLG A;  2DMP A;  1TWA J;  1ZQ3 P;  4XK4 A;  4E7H A;  2VE9 A;  3WU0 A;  1HKQ A;  2X6X A;  3E1S A;  2ZJP F;  2XRN A;  4M6X A;  1FTZ A;  2AXL A;  3L00 A;  2JJ7 A;  2OC6 A;  2E5Z A;  3ELK A;  5CVU A;  5KCM A;  1S29 A;  4I02 A;  1MJA A;  2O7O A;  5J8F A;  3WGH A;  2HYJ A;  1B59 A;  1XGN A;  2P6T A;  4DBR A;  2FJ1 A;  2VJJ A;  4GO1 A;  4B44 A;  4MHG A;  5LD2 C;  3PNY A;  4A3F J;  1Y1W J;  1MSE C;  2JRM A;  1U8B A;  1XGS A;  3FM3 A;  1LVA A;  3K4C A;  2LTP A;  2Y0M A;  2CW0 F;  4V2G A;  3COA C;  1E2X A;  3J80 Z;  3GBG A;  1BIB A;  3KP5 A;  2PFB A;  1WJC A;  2X6O A;  3DBR B;  4L9V A;  3CC2 I;  3TBI A;  4IO9 F;  4KDP A;  5EG0 B;  4CSW A;  1MNM C;  1VQL I;  3N05 A;  4M9Z A;  2HVQ A;  1ODD A;  4BJ6 C;  4XLP F;  2Q2E B;  1X3U A;  3I56 I;  3SHF A;  1XCB A;  3ERE D;  4IVN A;  2O61 A;  3GUD A;  1TNS A;  5AON A;  3V4G A;  2BE5 F;  2VKH A;  4NDL A;  5ILS A;  2ZJQ F;  3IRR A;  4ZZL A;  4RDU A;  4Y13 A;  1LEB A;  3U9G A;  3Q9V A;  5BMZ A;  3KYD B;  3W6V A;  4IKF A;  3RQ4 A;  2CV1 A;  2QKM B;  1ZKG A;  4RMN A;  2HZD A;  2DOD A;  2CRG A;  3PIP F;  2LR8 A;  1TT5 B;  2ZO4 A;  1DP7 P;  3J81 K;  2BY0 A;  3K1P A;  1MSF C;  1QNT A;  3Q3S A;  3DPL C;  1Q1V A;  3K1M A;  1YW8 A;  4M73 A;  3GFL A;  1AKH B;  2E19 A;  3IV5 A;  1IXS B;  1WJF A;  4ASN A;  1K79 A;  1L0O C;  1MH4 A;  2BZT A;  1R58 A;  1J7K A;  2CYY A;  2MW8 A;  5J4Y A;  1ETW A;  3D5R C;  1X1D A;  3HTU A;  4DOZ A;  2M4G A;  3S1Q J;  1BN5 A;  2STT A;  2FU4 A;  1WJD A;  2ZBK A;  4HA8 A;  3TP0 A;  5B5E C;  5JI6 A;  4KYW A;  1R6R A;  1VQ7 I;  5CPR B;  2CW8 A;  1D0Z A;  3V8L A;  4XLN F;  1IXC A;  4XLA A;  5CVJ A;  3A01 B;  3P5J A;  3JRB A;  2Q8K A;  4HEA 2;  2M87 A;  4UHT A;  4CCK A;  2F6C A;  1QBJ A;  2KMU A;  2KL4 A;  3E6D A;  1IV6 A;  3RYP A;  3FWE A;  4D5F A;  1Z77 A;  3LA2 A;  2W57 A;  3SQN A;  4XLE A;  3BZC A;  2V6E A;  4BL0 B;  2NS8 A;  1RR7 A;  2L5Q A;  3IAS 2;  5EGO B;  1FJL A;  5B3S H;  3EUH C;  5D5U B;  5IOZ A;  3KEO A;  4AVP A;  2VQH A;  3DU6 A;  3LSM A;  4ENN A;  3UNG C;  3OS2 A;  1ITY A;  4HNT A;  5D8L B;  1YS6 A;  4HX8 A;  2E1M C;  1FMV A;  4DZP A;  3K4B A;  3PNV A;  2NRA C;  4FHT A;  1A04 A;  4AD9 A;  5LEJ A;  1ZG3 A;  1W7P B;  4CYD A;  1LQ1 A;  3DEW A;  2EZH A;  1KU2 A;  4XN0 A;  3CCR I;  2JSP A;  3GX4 X;  3TL4 X;  1T2K A;  3S17 J;  1QHH D;  3DFG A;  4LGW A;  1F43 A;  1IO2 A;  3L2R A;  2GLO A;  3ABU A;  1AWC A;  4MEY F;  3K9T A;  2ISZ A;  2GZW A;  3AG1 H;  5FFX A;  1CF7 B;  2EH3 A;  2LY1 A;  3EDP A;  1O3R A;  4A3C J;  4JX5 A;  4S04 A;  5TJJ A;  1XSX A;  2FX0 A;  2E1C A;  2PI0 A;  2XKP A;  3OYH A;  2JPC A;  3A03 A;  5IT3 A;  3JAM K;  3FHN A;  1IRX A;  2R7V A;  3BLY A;  3OR1 C;  3CTA A;  2EB7 A;  1Z67 A;  5DCM A;  4KIS A;  3BR3 A;  3LSR A;  1KQ0 A;  4FT8 A;  2DFH A;  4RGX A;  1YX3 A;  1R1T A;  4A0Z A;  4AYB N;  1MND A;  3E0J B;  2BY1 A;  5B66 C;  2FNP A;  1DPR A;  4E7I A;  2VT2 A;  2DJI A;  3JRA A;  2A6T A;  3BG5 A;  1JT6 A;  4KFC A;  5TGT A;  1PVE A;  3HB9 A;  1TNT A;  2QCO A;  2QSF X;  5EEG A;  2IP2 A;  3ESW B;  5ED4 A;  4XRM A;  3IH4 A;  4BEH B;  2PJR B;  2MD5 A;  4IHT A;  3BTI A;  2VC1 A;  3OIO A;  3HOZ J;  2K9M A;  4JK1 X;  2IBD A;  2X6W A;  1XD7 A;  3S1R J;  1NK2 P;  1I27 A;  1E17 A;  2FUG 2;  1FP2 A;  2ZSH B;  4A3G J;  1EJ9 A;  4H4K C;  5LBQ A;  2QGU A;  3G1M A;  2LKX A;  1WGX A;  5LLQ A;  1LFP A;  4PUS A;  3RYR A;  2WC2 A;  3X2Q H;  2HKO A;  4I7H A;  3F3X A;  4EQQ A;  3CCE I;  2R7F A;  3CCL I;  3RKQ A;  4GXO A;  3G3Z A;  3FXJ A;  5KHD A;  4L0Z B;  3WTZ A;  3CO7 C;  1U5T B;  2GOM A;  3HOW J;  3FXQ A;  2HQN A;  1GXP A;  2YR2 A;  3DTI A;  2MH9 A;  3F6O A;  1STZ A;  4GFB A;  2R3S A;  4UUV A;  3WTY C;  1R00 A;  2P5L C;  1X3W B;  2B7E A;  1FT9 A;  2DK5 A;  6PAX A;  3VWB A;  2RQP A;  1V5E A;  3ZQC A;  4BHB A;  5TRD A;  1TQI A;  4PSW A;  3LA3 A;  1JT0 A;  2E34 A;  2L7F P;  1XDS A;  4PDK A;  3QWL A;  4S05 A;  4G6T B;  4DQ2 A;  3B02 A;  2EA2 A;  3RPU D;  5CVV A;  3FHZ A;  3J7A Y;  2F2E A;  1KON A;  1MIJ A;  4RA2 A;  3BTJ A;  1ZG1 A;  2CJJ A;  4PFP A;  4ZC3 A;  4FTH A;  3DEE A;  2YUS A;  5E1W A;  4OOI A;  2VJ5 A;  2JUC A;  2PG4 A;  2O3F A;  2QSH X;  3DBL B;  4BGD A;  3OS0 A;  1VF9 A;  1VQ8 I;  2E7X A;  4ZZD A;  4WK8 F;  3CDH A;  5FD5 A;  2KQR A;  1SAU A;  1X2M A;  2VBW A;  4D7N A;  2P5V A;  2WAD A;  2X9D A;  4M3E A;  1BJA A;  4A6D A;  3PQJ A;  2ETH A;  4PJJ A;  5L3C A;  2O8K A;  4C3J J;  2OAZ A;  1HBX G;  4ZTF A;  4IHS A;  3LSH A;  2DPU A;  1D1B A;  1MW7 A;  1IN6 A;  2A5W A;  4Z6Y A;  1MGT A;  3JRI A;  3T8R A;  2X0L A;  1MJ9 A;  3M9A A;  1HKT A;  3LA7 A;  3OY9 A;  5IYD J;  2V4J C;  3SYT A;  4BUP A;  4YRV A;  1MH3 A;  1W5S A;  1Z9C A;  5J4V A;  1UST A;  4WXD A;  4R1H A;  1DGR M;  4XON A;  2KZV A;  2Z33 A;  2CO5 A;  2LBF B;  2TDX A;  4X0G A;  2BHZ A;  1UAA A;  5IYB J;  3HBL A;  3F0C A;  4IOA F;  3JTG A;  1YJ9 I;  1WH5 A;  3D0S A;  3M1C A;  3M7G A;  2DI3 A;  2EZI A;  2MBF A;  1TC3 C;  1Z6T A;  4BHC A;  1ONV A;  1O3S A;  1P4A A;  4N4N B;  5K7F A;  2E2H J;  4BNC A;  1E3O C;  2FML A;  1IV8 A;  2DTR A;  1X1P A;  5GPC A;  2FRH A;  2O03 A;  3BTL A;  5DTD A;  2OU2 A;  3MD2 A;  5D4S A;  4F7Z A;  2HPM A;  4F92 B;  3BDD A;  2R7U A;  3L2C A;  1ETO A;  3DLA A;  4J00 A;  4BE2 A;  3ERM A;  1S8N A;  2NNY A;  5K7Z A;  4NUB A;  3IH3 A;  2XAJ A;  3KEY A;  3KE2 A;  4HNU A;  1ZRF A;  4B8X A;  1O57 A;  5D6E A;  4BAC A;  2FOK A;  3MQ0 A;  1WJ5 A;  2CQ7 A;  3BR0 A;  5GPA A;  1T98 A;  3U2R A;  1BBY A;  4LLG F;  3KYC B;  3GZN B;  1C0W A;  3I71 A;  2HDC A;  4L18 B;  4BY1 J;  4A2U A;  4Q4Z F;  3QYE A;  3OSF A;  2CQQ A;  4G94 A;  1FOW A;  3ZOB A;  3CQZ J;  3OL4 A;  4Z2Y A;  3C7J A;  3L2V A;  2FMY A;  1MBG A;  3DEU A;  4NNJ A;  2HDW A;  4IQJ A;  4EVI A;  3H35 A;  4A3K J;  1QQI A;  2DQL A;  1VQK I;  1P7I A;  2HFH A;  4UB8 C;  1WKM A;  2P5K A;  5M5W J;  4RS8 A;  2YX4 A;  1U3E M;  4L9T A;  3CES A;  5BNG A;  3UKG A;  3IKT A;  4H0E A;  2V9V A;  4BQO A;  2MSY A;  3HKZ A;  2HVS A;  5DM6 F;  3M8F A;  1JKR C;  1P4X A;  4Y7N J;  1FNN A;  1XSD A;  2P0W A;  2VL8 A;  2XUB A;  4XSX F;  5HS7 A;  3PSI A;  3U1D A;  1BI1 A;  1JHF A;  1VI0 A;  2HTS A;  1UB9 A;  3F8C A;  4G12 A;  2QVO A;  4V2F A;  2COB A;  2O0Y A;  4NB5 A;  2DJN A;  3LSP A;  3K2A A;  1B4A A;  1U0J A;  2V7F A;  2JA5 J;  4U7D A;  1WWX A;  1YYV A;  3C18 A;  2KIS A;  4P96 A;  5IT9 K;  1SVM A;  2HKX A;  2E2J J;  1BIA A;  1JE8 A;  1LUJ B;  3LQR A;  1T0F C;  4MEX F;  4A3B J;  1TLH B;  3BTC A;  3QYF A;  2G9W A;  4CYC A;  2XAU A;  2VPR A;  4C2T A;  1BA5 A;  2EK5 A;  2HXO A;  2RV8 A;  2MH2 A;  4NQW B;  3E6M A;  2DT7 B;  4PSX A;  2EIJ H;  3RQI A;  2ELK A;  3DKW A;  4RM3 A;  4A93 J;  4WX9 A;  5JR3 A;  3GLX A;  2DT6 A;  1U5T A;  4XLF A;  5F6F A;  1BL0 A;  1JXS A;  5C3E J;  3FKI J;  2ZXW H;  2HYG D;  3W2A A;  3CCQ I;  2HR3 A;  4C2M J;  3DU5 A;  2WV0 A;  2VE8 A;  4D5C A;  3WTS C;  3MVP A;  4IRG A;  5DCM B;  1PP8 F;  2LF7 A;  4EMS A;  4EV0 A;  4F3Q A;  5E17 F;  2W00 A;  1R4M B;  3KEQ A;  2L4M A;  4M3B A;  2A68 F;  3RKY A;  1YLF A;  2E2I J;  1R9T J;  2DYS H;  3FBN B;  3F8N A;  5C4J J;  2H6B A;  2R7T A;  2FQ3 A;  3PNT A;  2OQR A;  4F91 B;  1RES A;  5JVG F;  2CV2 A;  4MLO A;  1R71 A;  3GTM J;  4FIS A;  1WRJ A;  2H6C A;  1JUP A;  3BR5 A;  3K1N A;  4C9Y A;  5IYC J;  2RNJ A;  2FSW A;  2EBI A;  1W7P A;  2NVT J;  1E0E A;  3T5X A;  5M3F J;  4ZYD A;  3BT9 A;  1UHM A;  3GFJ A;  3CUO A;  2A3S A;  4J19 A;  3K69 A;  2LF8 A;  2Z99 A;  4M3F A;  1BC8 C;  3V8J A;  3QQA A;  2BYV E;  4CCJ A;  4BE1 A;  5DV5 A;  5C44 J;  4ESJ A;  3BCB A;  2JN6 A;  2MLK A;  4AIJ A;  3S14 J;  4HV6 A;  3A4C A;  4BXU A;  2CQK A;  4LK0 F;  3GLL A;  3BY6 A;  4EJV A;  3W2W A;  4XOT A;  3OV8 A;  4AIK A;  1IN7 A;  4PK4 A;  3E6C C;  2LD5 A;  4Y17 A;  4MFD A;  2NYX A;  5D6F A;  5GTI C;  4AU7 A;  2A05 A;  2K7L A;  5C4X J;  2JA6 J;  1JKO C;  2O8X A;  4CYC B;  2R5Z B;  4ZDL A;  1ON1 A;  4HQM A;  3BJA A;  1W0U A;  3BG6 A;  3NRV A;  2WV1 A;  4BY7 J;  2DA6 A;  1WFX A;  1XS9 A;  3EUK L;  2P8T A;  4XOR A;  3LSG A;  2V1D A;  4IOC F;  1NH3 A;  2E1N A;  2L3D A;  5TIS C;  1OIS A;  2K85 A;  2XPV A;  3JW4 A;  3JCU C;  4RB0 A;  1TW2 A;  2D1H A;  1LE8 B;  4G6D A;  4I0A A;  2RDP A;  5FLV A;  1LKX A;  3L2W A;  2OF7 A;  3ZRG A;  2R7Q A;  4N0B A;  5M5Y J;  4NQW A;  2Y75 A;  5E18 F;  3TMO A;  4MQ9 F;  5K1Y A;  2IS2 A;  3TO6 A;  1R5H A;  1UG2 A;  5K5R A;  1PUF A;  4A3I J;  4BQQ A;  3I4P A;  1SAX A;  1E3P A;  4HW0 A;  1TZL A;  2NXN B;  3FXM A;  3HPH A;  4IRH A;  2X4H A;  1DUX C;  2DLL A;  5JHU A;  2F5F A;  3K10 A;  1DGW Y;  4I09 A;  4G9Y A;  5KAI C;  2CS3 A;  1ZLK A;  2XGX A;  1I5Z A;  1I1G A;  3CCV I;  2VQG A;  1RI7 A;  1I39 A;  2HQ5 A;  1LE8 A;  4EGY A;  4CXF A;  4O6J A;  4U7B A;  2XKO A;  1R23 A;  3GXO A;  2QLZ A;  3CF5 F;  2OJE D;  2M1B A;  4GRI A;  5L3G A;  1YW7 A;  3LST A;  3N97 A;  2ESH A;  2EIN H;  2E60 A;  5D4R A;  1TTY A;  2NAZ A;  2XDV A;  1ZR4 A;  5LFA A;  2VOO A;  3NWT A;  4MTD A;  2M9H A;  2Y48 A;  3S2H J;  4E7L A;  3S3M A;  4KJZ A;  3A01 A;  4XBF A;  1IN4 A;  1ZHF A;  4D1Q A;  4BJ5 C;  2H1K A;  4BDZ A;  1XX5 A;  5ICE A;  2DA3 A;  3I59 B;  1K78 B;  1AOY A;  2W82 A;  3J7Z I;  5F08 A;  4YFX F;  2HXI A;  4HF2 A;  3ZQH A;  2IRF G;  3FDY A;  3KZI C;  3RPU A;  4RAF A;  1D1C A;  5J1U A;  2PJP A;  2DA4 A;  5K5O A;  4DZJ A;  1MMD A;  1HCR A;  1Z3X A;  5F1J A;  1T33 A;  3NAR A;  4FAS D;  1S6L A;  2XRL A;  5HLI A;  4XL9 A;  2D5V A;  3PJR A;  3I0T A;  1TQM A;  4HZF A;  5EJC A;  4QPO A;  3KFW X;  2JMW A;  2EV5 A;  5K5Q A;  2Q1Z B;  2VQL A;  3P9C A;  2V9K A;  1T39 A;  1USS A;  4R79 A;  1N25 A;  3JSO A;  2IS6 A;  3FXL A;  1ZGW A;  1MKM A;  1PYV A;  2GXB A;  1GT0 C;  2E35 A;  2A69 F;  4AVZ A;  2Y69 H;  3V8K A;  4F55 A;  3WTT C;  2VXD A;  2XV4 S;  4NBQ A;  2ZSI B;  4D0P A;  2KIU A;  2XPU A;  2K4J A;  1QZY A;  1SVL A;  3MFK A;  1QRY A;  4IJA A;  3VYT B;  3J7Y J;  3HIF A;  3FIW A;  2LP0 A;  1O7L A;  2XRO A;  2CFX A;  1BW5 A;  4C30 A;  2B0L A;  1ZK8 A;  2NOJ B;  2VT3 A;  5J1R A;  4Y15 A;  2GXA A;  4A5M A;  1ZGA A;  3HOY J;  3HHG A;  4BKX A;  1N77 A;  3CZ6 A;  1X4O A;  4XR6 A;  1PUF B;  3HOS A;  4CA0 A;  3FIS A;  3C2H A;  2JZY A;  1FBU A;  1UCR A;  2XC7 A;  5DDG A;  3TP3 A;  3OYL A;  4GYI A;  1F4K A;  4IF4 A;  5LGN A;  4FX4 A;  3IKV A;  3ZMD A;  3NAU A;  1IDY A;  2D2W A;  4DYQ A;  1QZE A;  1D8J A;  1HW5 A;  3R0A A;  4XRF A;  2BW3 A;  1X1A A;  3WTW C;  1OYW A;  3RCO A;  2PMZ A;  3S32 A;  3Q5F A;  2IAI A;  1HW2 A;  2X6Y A;  3I59 A;  1K78 A;  4B3A A;  3VYS B;  3ZP5 A;  5E3M A;  1XMA A;  3OYE A;  3CP2 A;  2LKP A;  4UV9 A;  4I01 A;  1XMX A;  2BHY A;  3FXU A;  3BOQ A;  3JAM Z;  2DO7 A;  2MLG A;  4RB3 C;  2UWM A;  3ZPL A;  5M5X J;  5E3O A;  5GAE J;  5DEQ A;  3CCU I;  1YIO A;  5BOX A;  5FLX Z;  3GZ6 A;  3VOD A;  1ZRD A;  1R4N B;  5F0F A;  3PO2 J;  1IRF A;  1ETK A;  2JRT A;  3WTX C;  3HPG A;  3QU3 A;  1WJE A;  2A6E F;  4OIR F;  3T1B A;  3ZQF A;  4II2 A;  4QWQ A;  3WGI A;  5BPD A;  2VKE A;  2GA2 A;  2M30 A;  2CFO A;  3QOE A;  5IP7 J;  1ZRC A;  2KFD A;  2D1V A;  3UR3 C;  1F9N A;  2A07 F;  3I55 I;  4PGG A;  3ZQL A;  4UVC A;  4I99 C;  3TOA A;  2ID3 A;  2O9L A;  3E5X A;  3R60 A;  4O5V A;  1MMN A;  2IS4 A;  3EET A;  3IUO A;  3O3K A;  1D5Y A;  2HNH A;  2QEX I;  1XDU A;  1H9T A;  2I10 A;  3K2Z A;  2M34 A;  4HG2 A;  1R1U A;  2R7O A;  3BZK A;  2YU3 A;  1QU3 A;  1FEX A;  5BPI A;  1MNE A;  3DWL E;  1Z1D A;  2L9R A;  2XB0 X;  2LRD A;  3BWG A;  4BYY A;  3FMQ A;  3HOV J;  1A6I A;  2XPW A;  4F93 B;  5J8C A;  2W4S A;  2Z9O A;  2OBP A;  1SAN A;  4B1R A;  4DYR A;  2L7M P;  4CCM A;  2M7B A;  2MGQ A;  2E5N A;  1QA6 A;  3BG9 A;  1KU3 A;  2R7S A;  2CQN A;  1BOA A;  4QLC U;  3OYM A;  3VB2 A;  1ZLJ A;  1BW6 A;  3RTR A;  2LSO A;  3EQL F;  1W36 D;  1AA7 A;  2JA2 A;  2VKV A;  2X1C A;  3K0L A;  4EJW A;  2HOS A;  4XOP A;  3OYC A;  4IHX A;  2ZJR F;  2VBX A;  4PCQ A;  3VSL A;  3KX2 A;  1I1S A;  1FSE A;  2MC3 A;  1OCO H;  5AIQ A;  4ABZ A;  2VOP A;  1R5G A;  2L0K A;  3DKY A;  1IN8 A;  4ZYE A;  3BR1 A;  3HSF A;  2MFZ A;  1MBK A;  3GW2 A;  3TW7 A;  3HGG A;  2EJR A;  3WGG A;  3ABT A;  3TKY A;  3HSE A;  1BR2 A;  5FRN A;  4IL6 C;  2B9S A;  2L9S A;  3VYR B;  2K3F A;  4WXH A;  1JGS A;  3Q0U A;  3G1O A;  2UXN A;  2NVY J;  4KA4 A;  5FB2 A;  4HX7 A;  1OCC H;  1WVR A;  2OPT A;  5E3L A;  4A69 C;  4L5E A;  5E8I A;  2HPI A;  4E6K G;  1S7A A;  2QA4 I;  1PJR A;  2BVM A;  4A3M J;  4LK1 F;  9ANT A;  4I6Z A;  2R92 J;  2EIK H;  2K40 A;  2NNN A;  3I9V 2;  1DP3 A;  4BJT A;  3SFZ A;  3AKZ A;  1X58 A;  4XKB A;  4OMZ A;  2DTZ A;  3VSK A;  5EG0 A;  2V1X A;  1S72 I;  2LRE A;  2NOG A;  5CVR A;  3CO6 C;  1XPX A;  2DMT A;  3ZCO A;  1NTC A;  3V7R A;  1HLV A;  2PJR A;  2DQR A;  3SZG A;  5E3N A;  1B8I B;  2QBY B;  2DMN A;  2ICW G;  3MN2 A;  1F5T A;  2TCT A;  3HKZ N;  4B43 A;  4Y52 J;  4EM2 A;  1ON2 A;  1KZH A;  2RN7 A;  4DW6 A;  5F27 A;  2IS1 A;  3PO3 J;  4LMY A;  3HOU J;  4RBO A;  2GQQ A;  3M4O J;  2IGN A;  3A02 A;  1R7J A;  2ZFW A;  5K7H A;  1KQ8 A;  2Z1D A;  3CME I;  1MD0 A;  5BS6 A;  2JPB A;  2HGC A;  4BE0 A;  1J9I A;  3GYH X;  3WE2 A;  2GA1 A;  2XF5 A;  2VB6 A;  2QUF A;  3C2B A;  4HNV A;  1Z7U A;  1LDJ A;  4B47 A;  4Q5S F;  3BJO A;  1U6G A;  3D1N I;  1SFO J;  4CHU A;  4LLN A;  1TL8 A;  3I58 A;  1Z3Y A;  3H9G A;  2STW A;  2E36 A;  4LOC A;  3LFK A;  1ZEL A;  3GVA A;  3G2B A;  5FD6 A;  2MAB A;  5CLS A;  1Y1V J;  2XGD A;  1HOM A;  1R5I D;  2DFF A;  2DA5 A;  3LAJ A;  1GVJ A;  4BXF A;  2RC4 A;  1I3Q J;  3C2G A;  4F52 A;  2M3A A;  2L9N A;  1VTN C;  4NC8 A;  3H3Z A;  4R8H A;  4FQG A;  1FYL A;  2OCE A;  3ML6 A;  4EEF G;  1XTA A;  4PJL A;  3BJ6 A;  1SFE A;  2F48 A;  4KN4 X;  1EH8 A;  2JSC A;  1VQ5 I;  1LVK A;  2XVC A;  3S8P A;  3QPL A;  5FLM J;  2Z3Y A;  3K4L A;  2WWY A;  4XSZ F;  3TED A;  2RKH A;  3SDB A;  2WB1 N;  3CUQ C;  2EFW A;  3HC7 A;  3R6S A;  3K4K A;  3JRE A;  2EFQ A;  2MC4 A;  3FK7 A;  3RSN A;  5FGM A;  4EJU A;  1IZ1 A;  4YEJ A;  3WHB A;  1ETQ A;  3HDD A;  3AL0 C;  2G7U A;  5F0C A;  1W7P D;  2EZL A;  2UV1 A;  4Y3O A;  1AHD P;  3F21 A;  1U78 A;  3RPQ A;  5JVT A;  2Y0S N;  2HI3 A;  3I53 A;  4AC0 A;  2F5D A;  1X1C A;  2FA5 A;  1LB2 A;  1G59 A;  3CP8 A;  4M6Y A;  4OU0 A;  2OZU A;  3K4N A;  3S93 A;  1T38 A;  4FET A;  5HNF A;  1CF7 A;  2LY9 A;  1HC8 A;  2KDO A;  5KNL A;  1FLI A;  5EEA A;  1BI2 A;  4M74 A;  4ZTJ A;  3F72 A;  2P4W A;  1QO0 D;  4GGG A;  4ZH4 F;  4C2U A;  3MZH A;  2PQ8 A;  4WXC A;  3JRC A;  2DMU A;  3BR2 A;  2CQX A;  1Y56 A;  1A35 A;  1JUM A;  2DFE A;  3PQK A;  1KYZ A;  2QWW A;  2R0Q C;  2LC2 A;  1ZN2 A;  1IUY A;  1I50 J;  2KZG A;  3IWF A;  3ZMV A;  1FYK A;  2JVG A;  5FLX K;  3BQY A;  4XIC A;  4A3J J;  2AHQ A;  1ZH5 A;  1NG6 A;  2DFI A;  1LFU P;  3GO5 A;  2FNA A;  2DMQ A;  3HHH A;  4M72 A;  1I6H J;  3TDZ C;  4BAY A;  1OJL A;  3BPX A;  4HV5 A;  3KP3 A;  5HOO A;  2FBK A;  5BQT A;  1ZR2 A;  3J80 K;  2G0E A;  1N75 A;  2KJB A;  3GWZ A;  5HS8 A;  3FM5 A;  2BXY A;  3HUG A;  3IHU A;  2EV0 A;  3V7C A;  1T08 B;  1U2W A;  4G7O F;  5HLH A;  5E8G A;  3H92 A;  1D3Y A;  2UUZ A;  3AG2 H;  5EF6 A;  1XCV A;  4OIO F;  1SMT A;  1KA8 A;  2HDD A;  2VIX A;  2BVL A;  4KIG A;  2N8G A;  4PJM A;  1JUS A;  2BW3 B;  3I64 A;  2VBZ A;  1EKE A;  3WG7 H;  3ZMT A;  2ZME B;  3OYF A;  1KQ9 A;  1XN7 A;  2M0C A;  2WBM A;  2X51 A;  4CUG A;  3TDU C;  2EV6 A;  3H3U A;  4A5N A;  3PUB A;  3CMA I;  2R7D A;  2ZXH A;  2H09 A;  1Z0X A;  3Q0W A;  3G6E I;  4X1E A;  4W1U A;  4Y33 A;  2L2O A;  3TO9 A;  4ITV A;  4XLC A;  4M9X A;  2FXA A;  4KMF A;  3GTG J;  2F4I A;  1V4R A;  4KUM A;  2L9V A;  1JGG A;  4RLF A;  3DPU A;  1BOB A;  3L2Q A;  2GXG A;  1RUN A;  4N9I A;  2PEX A;  3ZR8 X;  3OYN A;  4AIH A;  4XNF A;  4IPA A;  1VQ6 I;  3JRD A;  1A36 A;  3ISP A;  2LMD A;  3KLO A;  4HLX A;  4U88 A;  3V42 A;  1SD6 A;  2L02 A;  4K2E A;  3LAP A;  1HW1 A;  2IJL A;  4IXA A;  4V19 K;  1BJZ A;  1YRN A;  2EFN A;  2MYS A;  1QVU A;  2CWE A;  3CJQ B;  2P7C B;  4YII A;  4G7H F;  1IC8 A;  4DIQ A;  3C1D A;  4QPQ A;  3VDX A;  3I54 A;  2K27 A;  1BC7 C;  1RUO A;  3NEU A;  4B4C A;  2DPD A;  1WCM J;  4OAY A;  1OCZ H;  2QQ9 A;  1POG A;  3H5N A;  4HBL A;  3QOD A;  4P9F A;  5LRR A;  2XAF A;  3CUQ B;  2DT5 A;  2ZCW A;  3SEZ A;  3KPH A;  3OS1 A;  4BH9 A;  1FOX A;  1VQ4 I;  2A5Y B;  1FWZ A;  3DPT A;  3I4N J;  4ZYG A;  3RIR A;  1RNL A;  3TW6 A;  5GAH J;  1PP7 U;  3BZ6 A;  3JRF A;  1T6S A;  2W7N A;  2KIM A;  1O3Q A;  4M9S A;  1GXQ A;  1RET A;  3O6B B;  3Q9S A;  3GZ5 A;  3G71 I;  3A1Y A;  3J81 Z;  3KIO A;  4RAG A;  1K4T A;  1Y39 A;  4NC7 A;  3ZN1 A;  1XB4 A;  1YX5 A;  3NWS A;  3REO A;  3S2D J;  3IRQ A;  3F6V A;  2L7Z A;  4KIF A;  3FXR A;  3OL3 A;  2IA1 A;  5DD4 A;  1YIJ I;  1ZG5 A;  2F4O B;  3CCS I;  4HX4 A;  3FXK A;  2CUF A;  3JTH A;  3V7S A;  2WAQ A;  2GOX B;  5CKT A;  3OYA A;  1TBX A;  4XLH A;  2LK2 A;  1WSU A;  2WA0 A;  4BU2 A;  2M45 A;  4YFK F;  3H3V K;  2LVS A;  3K4J A;  2VN2 A;  4LD5 A;  4BQA A;  2Y30 A;  5CVI A;  1WZ2 A;  1APL C;  4L0Y B;  3M1E A;  3WG9 A;  4ZYA A;  1J2X A;  2DN0 A;  2KJC A;  3L09 A;  3GME A;  3D5L A;  4HRI A;  3LNQ A;  4KIB A;  4UV8 A;  3DTE A;  1IAW A;  3OIP A;  3ECO A;  3CJN A;  5JLW A;  2IVM A;  2W48 A;  3BQZ A;  3MZ8 A;  4L5I A;  1OCP A;  2ZNY A;  1VQN I;  1RZ4 A;  2PMH A;  2X1D A;  3RDI A;  2X1E A;  2QSG X;  2H8R A;  3DCF A;  4WCG A;  4EAT A;  4M71 A;  1SEU A;  5GTH C;  1SMY F;  1TW3 A;  5J40 A;  1NK3 P;  3P9I A;  1H9G A;  4GCV A;  4PFO A;  3ZGK A;  2EA4 A;  2F5E A;  1X2N A;  3OYD A;  3SEQ A;  2XSJ C;  2RVC A;  1REP C;  3LWF A;  2R5Y A;  3PM1 A;  4RGU A;  3E6B A;  1QVT A;  2AQF A;  2A6H F;  2AXT C;  3KP4 A;  4YG2 F;  2R7R A;  3EYI A;  2DDB A;  2HWV A;  3OYI A;  4I98 B;  1QGP A;  5DS9 A;  2QM3 A;  3FX3 A;  1X19 A;  4CCO A;  3WTU C;  2YS9 A;  2QQB A;  4BHP A;  1Z7L A;  5H6Q A;  1CQT A;  1O3T A;  1YS7 A;  1SC7 A;  2PN6 A;  3WU2 C;  1X1B A;  2LYC A;  1U9N A;  3E5U A;  3MZY A;  1WPK A;  3KP2 A;  1HXD A;  3CDI A;  1P4W A;  3MMY B;  1S7E A;  1D1A A;  4KIT B;  3T8T A;  3MWM A;  3H9Q A;  4D9J A;  1V55 H;  2MD0 A;  2JUG A;  4B3X A;  1K6O A;  2PBI A;  2NVU B;  5FKL A;  5L3E A;  1VQP I;  4Q48 A;  2LY2 A;  4FX0 A;  5H20 A;  5D5W B;  1VQ9 I;  5IPA A;  3ULQ B;  1BR4 A;  1ZAO A;  2CUZ A;  3PFI A;  3CMY A;  1SFX A;  3O8H A;  3F23 A;  4PJN A;  2DOF A;  1UEL B;  1TP4 A;  5ICC A;  2HZT A;  4O3M A;  3GTJ J;  3CC7 I;  3GTO J;  3RI4 A;  3RJP A;  2QQ8 A;  2DA1 A;  3R0J A;  2B63 J;  2LFB A;  1VQM I;  4LG0 A;  4B09 A;  2MA3 A;  1WQ2 A;  1MJB A;  1MBJ A;  1ORK A;  4XID A;  1IUF A;  5L3D A;  5E1X A;  4QIW N;  3MEX A;  2F5C A;  1YRN B;  4A0Y A;  2AS5 F;  2QEN A;  1TWG J;  1DDN A;  3I4M J;  3R4K A;  3MKZ A;  3B6C A;  2H27 A;  3H1C A;  4QSH A;  3KET A;  2UZK A;  4BEH A;  1MBH A;  1Y8Q B;  4I0B A;  1R49 A;  2QYO A;  3ZN0 A;  1VZ0 A;  2BY3 A;  1Z91 A;  1HDP A;  4G7Z F;  2VQC A;  1P2F A;  3AG4 H;  1D0X A;  2WAQ N;  2FBH A;  3RKX A;  3G4S I;  1OMI A;  4FE7 A;  4QTR A;  4BBR J;  2KPM A;  4BS9 A;  1K61 A;  3HUG B;  2DXI A;  3E97 A;  1HSJ A;  2K5C A;  2R5Z A;  3W6K B;  4I2O A;  2Z2S B;  2M4K A;  2OD5 A;  2GM4 A;  3QP6 A;  2VJ4 A;  1Z05 A;  4P9U A;  1YFH A;  2VKD A;  1A31 A;  2XIG A;  4IHW A;  4G6Q A;  2R7W A;  3ASN H;  1OKR A;  1YG2 A;  3FK6 A;  5LGT A;  3W2V A;  2Y9Z A;  1MDM A;  4RAZ A;  3ZQQ A;  3S16 J;  4MNU A;  1IJW C;  3O2P E;  3OOU A;  5AIP A;  1S9H A;  4IEJ A;  4XKV A;  1J5Y A;  3QPT A;  3FF5 A;  5J3L A;  4U0Y A;  2Y9Y A;  3ZXS A;  2NS0 A;  3QU6 A;  1F36 A;  2COM A;  1Y8R B;  4DYC A;  1G3S A;  1ETY A;  3JR9 A;  2OUM A;  2LLK A;  1W1W E;  2L7K A;  4IHV A;  1ACI A;  1VQO I;  3K4M A;  2OTL I;  1YQA A;  2DDA A;  3K70 C;  2KLO A;  1JTY A;  1TWH J;  2HTJ A;  3SZT A;  3AAF A;  3WTV C;  1J0R A;  4ESF A;  2NS7 A;  4BXX J;  2OCC H;  3LSI A;  1DQU A;  4UUS A;  2E1O A;  3KCC A;  1FBS A;  3HXL A;  2WTE A;  4OIP F;  1F1Z A;  2DA2 A;  3LMM A;  5J1Y A;  3ABK H;  1Q1H A;  5HDN A;  3K70 D;  3FBI B;  3LSJ A;  4HDV A;  3HYI A;  2FE3 A;  2HVR A;  3OYJ A;  2JA8 J;  3BRO A;  3GCM A;  2Q2E A;  4BBS J;  1FZP B;  3HOX J;  1ZYR F;  2LOO A;  2WY7 Q;  3H0G J;  1W4M A;  5JLX A;  4YIR X;  1B1B A;  4YEL A;  4UVA A;  1N78 A;  2VON A;  2FF4 A;  3ECH A;  2W25 A;  2NVQ J;  2HQR A;  3I3L A;  2R5Y B;  2O5R A;  3K6G A;  4A0X A;  2FBI A;  4HF0 A;  1ZGJ A;  3PFY A;  3OSG A;  4LG0 B;  1JI8 A;  2LBF A;  5IP6 A;  3HRS A;  3BCA A;  4KNY A;  1K7A A;  3HTS B;  2K02 A;  4JX6 A;  1GV5 A;  4AYB A;  4IHY A;  5HS9 A;  2Y31 A;  1AKH A;  5FKN A;  1O7F A;  2Y2Z A;  3BG7 A;  3FMS A;  5F0H A;  1D8K A;  3L7W A;  1SFU A;  1RKW A;  4HQE A;  4E7J A;  3W6J B;  5ILV A;  4JBA A;  2ZB9 A;  1WH7 A;  2IGO A;  1A6Q A;  4D7M A;  2JT1 A;  1OFC X;  1PUE E;  4ESB A;  3S3N A;  5B1B H;  2JQ7 A;  2KDZ A;  3QPH A;  1IF1 A;  1YJN I;  2I8D A;  3HL2 A;  1XGM A;  4KMU X;  2HOT A;  2K4B A;  3PIO F;  2W85 A;  4IQ4 A;  2C6Y A;  3H5A A;  2IA2 A;  3HZJ A;  3AL0 B;  2DU9 A;  2BXZ A;  5HVQ C;  2DOE A;  2FOW A;  2KIQ A;  4RGR A;  5KVR A;  2YU9 J;  5CYV A;  3EPZ A;  1OLT A;  4E70 A;  1VND A;  3KYL A;  1YJW I;  3CMM A;  1G8X A;  4HF1 A;  1FSH A;  3U21 A;  3ONQ A;  4EM1 A;  1J75 A;  2IXS A;  4XKC A;  5FFZ A;  1H89 C;  1FC3 A;  2M2E A;  2QKL B;  2LDU A;  1FYM A;  2L4A A;  1SVO A;  4A12 A;  1OPC A;  4UXN A;  5HLT A;  2EFP A;  2W84 A;  4UB6 C;  2KKO A;  5ICF A;  2E71 A;  4B48 A;  2VUM J;  2FEZ A;  4ON0 A;  2HOE A;  5FRO A;  1UZC A;  3VEP A;  3ASO H;  3ZMU A;  1MMS A;  1GVD A;  2F5V A;  5F04 A;  4IZZ A;  1G3W A;  1EH6 A;  1GHC A;  4KIC A;  1IDZ A;  1DU0 A;  1JKP C;  4IRI A;  3DKX A;  4ENM A;  3WHC A;  2IEK A;  2RQQ A;  4XRS G;  1BR1 A;  1S5L C;  4OAZ A;  3M8E A;  5JFR A;  1RKT A;  1I3A A;  3F8M A;  3ZQG A;  4Q47 A;  5FRM A;  2XAG A;  3P9K A;  2X48 A;  4E4H A;  3KP7 A;  2ZFU A;  3TO7 A;  1FMW A;  3LQQ A;  4UUT A;  4CZZ A;  1YI2 I;  3CCM I;  2ELJ A;  1LJ9 A;  5GAD J;  2RNG A;  3BG3 A;  2LNB A;  2P7V B;  2ZJ2 A;  3HM5 A;  4BDY A;  5IT9 Z;  4NHJ A;  2L54 A;  5HOD A;  3H5R A;  2O6G E;  1YHQ I;  3CJT B;  3OR2 C;  3PL8 A;  1SD4 A;  2W24 A;  2DAO A;  2M8E A;  3S1N J;  2H94 A;  3QP5 A;  1RPW A;  1UHW A;  2EWN A;  3WU1 B;  1FOK A;  3GTL J;  5DUK A;  3OMY A;  2OTJ I;  4A6E A;  1TQP A;  2DBB A;  2ZME C;  2CUJ A;  5F64 A;  2ELH A;  4E7S A;  1FY7 A;  3IH2 A;  1EF4 A;  1IRZ A;  1SFK A;  2YPR A;  1ENH A;  4JX4 A;  3F22 A;  1OR7 A;  1J59 A;  1IXR C;  3GF2 A;  1B9M A;  2QZ8 A;  3JRH A;  4L5J A;  2FD5 A;  1JTX A;  4M6V A;  4E7K A;  1WI3 A;  1G3Y A;  4OIN F;  5DD8 A;  1B6A A;  3B73 A;  1FPQ A;  5J6X A;  3DBH B;  3CJR B;  3HJE A;  1W5C C;  2TRT A;  2LH9 A;  1V5G A;  4NC6 A;  3JRG A;  5D8K B;  1OR7 C;  1YTY A;  4PZJ A;  2ISY A;  3FMR A;  1OYY A;  3HRU A;  2UXX A;  1RR8 C;  3WE3 A;  3GTP J;  2VI6 A;  3DP7 A;  1I6X A;  2K9L A;  4WF2 A;  3S1M J;  5GAG J;  3CDL A;  3ZMZ A;  2CUE A;  2HQA A;  3G1L A;  3A0H C;  2HS5 A;  4G8X A;  3DQV C;  1QHG A;  2CW7 A;  2RRE A;  2GIV A;  4RGS A;  4ZYH A;  5L3F A;  5A2Q Z;  2XAS A;  1X3Z B;  3VYU B;  5KK1 A;  1KYW A;  4U87 A;  3TOB A;  2XSD C;  4RB1 A;  5E79 C;  2V26 A;  2BBY A;  4YFN F;  1JJ8 C;  1BI3 A;  1TT0 A;  4HST A;  5M3M J;  1JJ6 C;  4W97 A;  4ZDP A;  1ETV A;  3J7A O;  4A3E J;  4EM0 B;  3SJM A;  3RZD J;  1RC9 A;  4U0V A;  4CGZ A;  2ECB A;  2VPL A;  1WJA A;  3O8G A;  2ESN A;  2IT0 A;  3OYK A;  1LDK B;  3MAJ A;  3QYB A;  2VC0 A;  4JOM A;  5LRS A;  2R7X A;  1XGO A;  3RKW A;  3G73 A;  4DGW B;  2ZME A;  5B1A H;  2JA7 J;  2X85 A;  2FQ4 A;  3IWZ A;  2G7H A;  5IP9 J;  4ENK A;  2IGM A;  2Q0O A;  1P6R A;  2XAQ A;  3HRM A;  5EGO A;  2VAS A;  1XC5 A;  1W36 C;  1FIP A;  2V6C A;  3AG3 H;  2P6S A;  1FBQ A;  3ABL H;  4MTE A;  1K6Y A;  2GWR A;  4UNO A;  3WOD F;  1G4D A;  2RGV A;  5E1Z B;  3TGN A;  5HDK A;  2VJI A;  2OA4 A;  3SDG A;  2J5P A;  3IC7 A;  5DUI A;  3HRT A;  2W1O A;  2KHM A;  4FCY A;  1HST A;  4CO8 A;  1Y0U A;  2EQR A;  3PUF A;  5D5X B;  2NVX J;  3BR6 A;  3LL7 A;  4LIV A;  1WJB A;  4CCN A;  2KRF A;  3VFZ A;  4HSR A;  2EIM H;  4JQF A;  1R1V A;  3EUH A;  1Z21 A;  3C3W A;  4L9J A;  4M3D A;  2K9S A;  4RLQ A;  5DYM A;  1K4S A;  4AWX B;  5FKM A;  1HQC A;  3E7L A;  1KGS A;  3ZMS A;  3CCJ I;  3KZZ A;  3H9J A;  4AM3 A;  2Z5U A;  2ADU A;  1HDD C;  1SD5 A;  2DA7 A;  1RIO H;  2ZXI A;  3OYG A;  2OZ6 A;  1LNW A;  2CMP A;  1R36 A;  4GDF A;  4CCL A;  2CG4 A;  5CJ9 A;  1GLN A;  4MFE A;  4RB2 C;  1UFM A;  3GFI A;  3F8B A;  2WY8 Q;  4XM3 A;  4JP0 A;  4KT6 A;  3GEZ A;  2BEO A;  2WAE A;  2ID6 A;  2KP6 A;  4P55 A;  2BOL A;  2P81 A;  4EGZ A;  4X6A J;  5DM7 F;  3BP8 A;  1P9Q C;  1XG1 A;  2DW4 A;  1FX7 A;  5FO5 A;  1MBF A;  4LB6 B;  4N9H A;  2DK8 A;  4HOB A;  1J09 A;  1YOV B;  1ETX A;  1FIA A;  3LOC A;  2DOA A;  3CF2 A;  2HEO A;  1T95 A;  4UY8 I;  1TWF J;  1CGP A;  1MBE A;  2ME0 A;  4EJO A;  1LFB A;  5LEK A;  4L9N A;  2HYF A;  4DJA A;  1U5T C;  1BI0 A;  2XF6 A;  2VLA A;  2LG4 A;  2V9P A;  1WI9 A;  2WB1 A;  3I5U A;  2DCE A;  2DYR H;  2HU9 A;  3CC4 I;  1B9N A;  1MMG A;  1G3T A;  2XF7 A;  4MGR A;  4C3I J;  1ERD A;  2CV0 A;  3HG9 A;  4AID A;  5E20 A;  1NHA A;  1UJ8 A;  3F9K A;  2M5W A;  2YSR A;  3OYB A;  5ICG A;  2BV6 A;  4A3D J;  3JSP A;  2OV7 A;  3CD6 I;  3ABM H;  1S3J A;  5GP9 A;  1KU9 A;  3CLQ A;  2IW5 A;  2CU7 A;  1FOY A;  1OQY A;  1XSV A;  2IPQ X;  1ZAR A;  2JK3 A;  1LPQ A;  3FXO A;  5DCF A;  5HDG A;  4ANJ A;  3U1K A;  2ZKZ A;  2CSO A;  3T0Y A;  3F8F A;  4M3G A;  3A2K A;  1T56 A;  2VXZ A;  5L3B A;  5LHH A;  3TQN A;  5LGU A;  3HOT A;  3P7N A;  4CDG A;  1R22 A;  3A0B C;  3HEF A;  2EPF A;  3OWT A;  2KRC A;  4EJT A;  5IOY A;  1RRJ A;  1MZB A;  1MMA A;  3W3C A;  4CH7 A;  5IY5 H;  2KIF A;  3N4M A;  2KRH A;  2IA0 A;  4UUS B;  3GFM A;  3KP6 A;  2BGC A;  1JKQ C;  1T8I A;  1OCT C;  1W5T A;  5FKO A;  3GTQ J;  2K86 A;  3BPV A;  1Y6I A;  2M7A A;  2JVH A;  3EYY A;  5FKK A;  4CIC A;  5EDN A;  2PX9 A;  4XQF A;  3SFI A;  1OYI A;  2F4M B;  2XAH A;  1D5V A;  1AU7 A;  2QF7 A;  2XGC A;  4KT5 C;  1HKS A;  4LIT A;  4E7Z A;  3QAH A;  1D0Y A;  2Z16 A;  1B72 A;  3ROU A;  1A5J A;  4MIM A;  1V54 H;  5ILU A;  5HNH A;  3E3V A;  4BQN A;  1YO5 C;  5H6R A;  3KLN A;  1IW7 F;  2HOA A;  1B8I A;  2QBY A;  5EYR A;  2ZNZ A;  2L01 A;  4DNC A;  1K83 J;  2Y0S A;  3MKY B;  4LFU A;  1OCR H;  3FZV A;  4YIF A;  1O4X A;  1EV7 A;  5EEH A;  1V5F A;  2ME6 A;  4ETS A;  1DPU A;  3RZO J;  4A3L J;  3H0D A;  2MG4 A; 
#chains in the Genus database with same CATH homology
 2VKD A;  3S3O A;  3LFU A;  2R7W A;  3M1C A;  3M8J A;  4OWR B;  3FKJ A;  1BR2 A;  5FRN A;  3W2V A;  2L9S A;  3VYR B;  4N4N B;  3ZQQ A;  5JHF A;  2M0M A;  3OOU A;  1S9H A;  4XKV A;  3MD2 A;  3ZXS A;  2HPM A;  2HPI A;  4E6K G;  4F92 B;  2R7U A;  1PJR A;  2BVM A;  3OIQ A;  4J00 A;  3DLA A;  4BE2 A;  3I9V 2;  1DP3 A;  4BJT A;  4LG3 A;  4RM2 A;  4XKB A;  3AKZ A;  2OUM A;  4NUB A;  3VSK A;  2L7K A;  2LRE A;  1X4P A;  3KEY A;  4HNU A;  3AFH A;  3K4M A;  3K70 C;  2KLO A;  4BAC A;  3IP4 B;  3ZCO A;  2PJR A;  1WJ5 A;  4II3 A;  4XN3 A;  3SZG A;  1EA3 A;  3LSI A;  5CQG A;  3LSK A;  1DQU A;  4XKW A;  3HXL A;  4B43 A;  4DBQ A;  3LMM A;  3QYE A;  3K70 D;  3FBI B;  2IS1 A;  2HVR A;  4P1W A;  3DTK A;  3OYJ A;  3OL4 A;  2IGK A;  3L2V A;  2WAF A;  4NNJ A;  2HDW A;  4ZJZ A;  2LOO A;  2WY7 Q;  4IQJ A;  2IGN A;  3H35 A;  4LIU A;  2Z1D A;  4HPQ A;  4BE0 A;  4YEL A;  1N78 A;  2XF5 A;  2VB6 A;  3CES A;  3I3L A;  2AQE A;  2O5R A;  4B47 A;  4BQO A;  3K6G A;  4ZDO A;  4J01 A;  1NG7 A;  3HKZ A;  1UG0 A;  3PFY A;  2HVS A;  3L2U A;  1JI8 A;  1Z3Y A;  2LBF A;  2P0W A;  2VL8 A;  3H9G A;  3BCA A;  4Y4R A;  4IX7 A;  3MKW B;  3BC8 A;  3PSI A;  1ZEL A;  3G2B A;  4AYB A;  2MAB A;  1U0J A;  3D5S C;  2V7F A;  1YE9 A;  3BG7 A;  4BXF A;  3C2G A;  2E1M B;  4F52 A;  4E7J A;  2M3A A;  2L9N A;  1T0F C;  4NC8 A;  5CQE A;  2K3P A;  2IGO A;  4P5O A;  3QYF A;  4PJL A;  3IAM 2;  2V1N A;  2XAU A;  3PSF A;  4C2T A;  3S3N A;  4E7H A;  4NQW B;  2DT7 B;  4PSX A;  4RM3 A;  2I8D A;  1LVK A;  3HL2 A;  3S8P A;  3K4L A;  2DT6 A;  4XLF A;  4IQ4 A;  3H5A A;  3AL0 B;  5HVQ C;  3SDB A;  3HC7 A;  3W2A A;  3K4K A;  3EPZ A;  1OLT A;  2MC4 A;  3KYL A;  2R4G A;  3CMM A;  1G8X A;  3EUA A;  3RSN A;  3U21 A;  3DU5 A;  3ONQ A;  4YEJ A;  2IXS A;  3AL0 C;  4XKC A;  2CH0 A;  1HA8 A;  2UV1 A;  4Y3O A;  2QKL B;  4F3Q A;  4N4O B;  2W00 A;  1X1C A;  1G59 A;  3CP8 A;  5HLT A;  3FBN B;  3K4N A;  2R7T A;  3PNT A;  4CZC A;  3S93 A;  4F91 B;  4FET A;  4XMY A;  5HNF A;  4MLO A;  2CV2 A;  4B48 A;  2KDO A;  5KNL A;  4C9Y A;  5FRO A;  4ZTJ A;  1E0E A;  2F5V A;  4IZZ A;  2X6X A;  3E1S A;  4C2U A;  3DKX A;  4CCJ A;  2OC6 A;  2E5Z A;  5KCM A;  1Y56 A;  4BE1 A;  3BCB A;  2LC2 A;  2RQQ A;  1BR1 A;  2JVG A;  4OAZ A;  4DBR A;  3A4C A;  1NG6 A;  2VJJ A;  4B44 A;  5FRM A;  3W2W A;  5LD2 C;  3PNY A;  4XOT A;  4E4H A;  4PK4 A;  2ZFU A;  5HOO A;  3K4C A;  1FMW A;  4AU7 A;  1N75 A;  2ELJ A;  3GBG A;  1WJC A;  2RNG A;  4ZDL A;  4BDY A;  3BG6 A;  3TBI A;  3H5R A;  3OR2 C;  1WFX A;  3PL8 A;  4CSW A;  3N05 A;  3EUK L;  2HVQ A;  4XOR A;  3LSG A;  4BJ6 C;  2UUZ A;  3OMY A;  2Q2E B;  2CUJ A;  4E7S A;  2VKH A;  1SFK A;  2VIX A;  2BVL A;  4PJM A;  2BW3 B;  1LKX A;  3OYF A;  3L2W A;  3ZRG A;  2R7Q A;  4IKF A;  2WBM A;  2X51 A;  2QKM B;  3RQ4 A;  4CUG A;  2CV1 A;  4RMN A;  4E7K A;  2HZD A;  3PUB A;  2ZXH A;  3TMO A;  2IS2 A;  4Y33 A;  2L2O A;  4ITV A;  4XLC A;  4BQQ A;  3CJR B;  2F4I A;  2LH9 A;  1V5G A;  1TZL A;  3DPL C;  4RLF A;  1OR7 C;  3HPH A;  3DPU A;  1BOB A;  3L2Q A;  3K10 A;  1DGW Y;  1WJF A;  2K9L A;  3ZR8 X;  3OYN A;  4XNF A;  2CS3 A;  2HQA A;  2VQG A;  3D5R C;  1X1D A;  3DQV C;  1QHG A;  2CW7 A;  2RRE A;  4U7B A;  3V42 A;  4DOZ A;  2M4G A;  3VYU B;  1WJD A;  4U87 A;  4GRI A;  2V26 A;  2MYS A;  1TT0 A;  4HST A;  1R6R A;  3CJQ B;  5CPR B;  2E60 A;  2CW8 A;  1D0Z A;  4ZDP A;  4DIQ A;  2XDV A;  4QPQ A;  5LFA A;  4XLA A;  3VDX A;  3NWT A;  2VPL A;  1WJA A;  3OYK A;  1LDK B;  4HEA 2;  4CCK A;  4KJZ A;  4E7L A;  4OAY A;  2F6C A;  3S3M A;  3QYB A;  2KMU A;  2KL4 A;  3H5N A;  4JOM A;  4BJ5 C;  4D1Q A;  3QOD A;  2R7X A;  4BDZ A;  4DGW B;  3SEZ A;  4XLE A;  2X85 A;  2V6E A;  3OS1 A;  4BL0 B;  2W82 A;  2L5Q A;  3IAS 2;  3EUH C;  2IGM A;  3FDY A;  3DPT A;  1D1C A;  2VAS A;  1W36 C;  2VQH A;  3DU6 A;  1K6Y A;  2W7N A;  3LSM A;  3UNG C;  3OS2 A;  1MMD A;  4HNT A;  1Z3X A;  2VJI A;  3A1Y A;  4FAS D;  2E1M C;  1FMV A;  3K4B A;  4NC7 A;  3PNV A;  4XL9 A;  1YX5 A;  2W1O A;  3NWS A;  3PJR A;  2KHM A;  4QPO A;  2Q1Z B;  2VQL A;  2V9K A;  3OL3 A;  4R79 A;  2IS6 A;  4XN0 A;  1PYV A;  3LL7 A;  2JSP A;  4LIV A;  1WJB A;  4CCN A;  3TL4 X;  4HSR A;  4AVZ A;  1QHH D;  4F55 A;  4JQF A;  1Z21 A;  2GOX B;  2WAQ A;  4RLQ A;  5CKT A;  3OYA A;  3L2R A;  2VXD A;  4XLH A;  2ZSI B;  2WA0 A;  4BU2 A;  3K4J A;  3VYT B;  3H9J A;  2LY1 A;  4ZYA A;  2ZXI A;  3OYG A;  3OYH A;  4C30 A;  2CMP A;  3D5L A;  3FHN A;  1IRX A;  4CCL A;  2NOJ B;  4HRI A;  2R7V A;  1GLN A;  3BLY A;  3OR1 C;  2WY8 Q;  3DTE A;  4XM3 A;  4KIS A;  4KT6 A;  3OIP A;  2WAE A;  2KP6 A;  1YX3 A;  2BOL A;  1MND A;  3E0J B;  1N77 A;  3CZ6 A;  4E7I A;  1X4O A;  2DJI A;  2X1D A;  1P9Q C;  4XR6 A;  3HOS A;  2A6T A;  2X1E A;  4CA0 A;  5TGT A;  3C2H A;  2XC7 A;  4EAT A;  4BEH B;  1J09 A;  3OYL A;  2PJR B;  2DOA A;  3CF2 A;  1T95 A;  4PFO A;  2K9M A;  3ZGK A;  2BW3 A;  2X6W A;  1X1A A;  3OYD A;  3RCO A;  2PMZ A;  3SEQ A;  2XSJ C;  3S32 A;  2FUG 2;  2X6Y A;  2ZSH B;  4H4K C;  3VYS B;  2AQF A;  3OYE A;  4DJA A;  3CP2 A;  2R7R A;  2XF6 A;  2VLA A;  1LFP A;  4PUS A;  3OYI A;  2LG4 A;  1X19 A;  2WB1 A;  4CCO A;  2UWM A;  2DCE A;  2HU9 A;  1Z7L A;  5KHD A;  1MMG A;  1ERD A;  2XF7 A;  2CV0 A;  2GOM A;  3HG9 A;  1X1B A;  2LYC A;  3F9K A;  3DTI A;  3OYB A;  3MMY B;  2OV7 A;  1D1A A;  4KIT B;  3HPG A;  1WJE A;  3H9Q A;  4D9J A;  4II2 A;  3VWB A;  1V5E A;  2MD0 A;  2JUG A;  4B3X A;  4PSW A;  2CFO A;  3QOE A;  4ANJ A;  4G6T B;  3UR3 C;  3RPU D;  3J7A Y;  2LY2 A;  3A2K A;  2VXZ A;  1KON A;  1BR4 A;  2CUZ A;  4PFP A;  4ZC3 A;  4PJN A;  3HOT A;  1MMN A;  1UEL B;  3DEE A;  2IS4 A;  3IUO A;  2VJ5 A;  2HNH A;  3OWT A;  2KRC A;  3W3C A;  1MMA A;  4HG2 A;  4CH7 A;  4BGD A;  3OS0 A;  2R7O A;  1QU3 A;  2KRH A;  2KQR A;  1SAU A;  2WAD A;  1MNE A;  3DWL E;  2LRD A;  4PJJ A;  4F93 B;  1Y6I A;  2M7A A;  2JVH A;  2W4S A;  3MKZ A;  4ZTF A;  3LSH A;  4CCM A;  4XQF A;  2M7B A;  1D1B A;  1MW7 A;  2E5N A;  2A5W A;  2R7S A;  4BEH A;  3OYM A;  4E7Z A;  4LIT A;  1D0Y A;  2Z16 A;  3OY9 A;  1VZ0 A;  3RTR A;  5HNH A;  2V4J C;  3SYT A;  2VQC A;  1W36 D;  1AA7 A;  2JA2 A;  2X1C A;  4BUP A;  4BQN A;  4YRV A;  1D0X A;  4XOP A;  3OYC A;  2KPM A;  4BS9 A;  1DGR M;  2Y0S A;  3HUG B;  3MKY B;  2DXI A;  4XON A;  2K5C A;  2KZV A;  3KX2 A;  2Z2S B;  2M4K A;  3VSL A;  1V5F A;  2VJ4 A;  2LBF B;  3DKY A;  4X0G A;  3H0D A;  1UAA A;  2MFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...