2LH9A

Nmr structure of the first lotus domain of tudor domain-containing protein 7
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor domain-containing protein 7
publication title NMR structure of Tudor domain-containing protein 7
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lh9A00
2LY2A 2KZVA 2KPMA 3S93A 2LY1A 2LH9A 3RCOA
chains in the Genus database with same CATH superfamily
2YX7A 2BV6A 4JX4A 1N77A 1N75A 4HSTA 3H5AA 1FP2A 4V2FA 5IT3A 1VQKI 2ZMEA 1K6YA 3D0SA 3W2VA 1REPC 2MABA 3T0YA 2D2WA 4HLYA 1IV8A 5K1YA 3OIPA 1P6RA 2Z3YA 3DV8A 2CQXA 5J1RA 3K4LA 3MAJA 2HOTA 2NVQJ 5DCMB 2L9VA 4P9FA 3CF5F 4W1UA 5J8FA 1IN8A 2VL8A 3TW6A 5F1RA 2ZNYA 1P4XA 3GTJJ 2IJLA 2VBZA 4IX7A 2LLKA 4EVIA 3OYDA 3N05A 4IOCF 4ETSA 5B66C 4ZTFA 2XIGA 3V7RA 3DQVC 3BTJA 2NVXJ 1T98A 3I4MJ 1R22A 1FTTA 3OOPA 3PNTA 2K3PA 3ZMVA 4XLEA 3SZGA 2MGQA 1YITI 1A36A 4P9UA 2PJPA 3OYAA 1U6GA 2IS2A 1JKQC 3RQIA 2G0EA 4YIRX 4XLAA 5LGTA 1SAXA 1K83J 1MBEA 2V9PA 3ABTA 2IA1A 3WHBA 3LA7A 5F04A 3OSFA 4CH7A 4S0HB 1MIJA 1X19A 1UB9A 3L2CA 3PSIA 3DEEA 2IGNA 1T6SA 1E3HA 1Z0XA 2V9KA 3VSLA 2L9RA 4ZYGA 3G2BA 1QHHD 1B59A 1FTZA 1LJ9A 3DEUA 1IN5A 1S6LA 3BR2A 1Y1WJ 3ASOH 3FM5A 4TV7A 3T8RA 4CDGA 1LVKA 2ZNZA 3L2QA 4A3DJ 2BEOA 1IXRC 4BEHA 1WGXA 4Y13A 1X3ZB 3IP4B 4XKCA 1IXCA 4DOZA 2FBKA 5LGUA 5DTDA 1WJBA 2GXBA 2QCOA 2F4MB 1BR1A 3OMYA 4XORA 2VJIA 4BNCA 2DMPA 3LA3A 3HXLA 5CQEA 3LAPA 2DK5A 4A3KJ 2DJNA 4I09A 4DBQA 3ECOA 2Q8KA 3EQLF 3K4JA 2COBA 3D5RC 1OPCA 2HI3A 1XC5A 3DWLE 1Q1HA 4XKVA 2LKPA 1Z7UA 3OYKA 3SHFA 3G1OA 3F21A 2LF7A 3CDIA 4NUBA 3F6OA 3SYTA 1XMAA 3FXKA 3GZNB 1Z77A 3H0GJ 5DV5A 4ZH4F 5L3BA 4KN4X 2Y0MA 1GLNA 3DEWA 3OYLA 2M8GX 5FKKA 1FMVA 5DYMA 3FDYA 3IRRA 5E18F 2WWYA 2LY9A 2GOMA 1BIBA 2NS0A 1EV7A 3DFGA 2JSPA 1O7FA 2P6SA 5CVVA 1SEUA 2H09A 5FROA 2QYOA 5JI6A 3V8KA 1YS7A 3K2ZA 4XQFA 2NS8A 1T2KA 2A05A 3LOCA 4N4NB 1SAUA 1LFPA 1VQMI 2L01A 3F0CA 5BPDA 2LY2A 4Y17A 4KMUX 1MKMA 2K9SA 4D5FA 5J6XA 1R1TA 2V79A 3KPHA 4MFEA 5L3GA 3ZR8X 4AIHA 1F4KA 2LTPA 1JUSA 2XAQA 2PBIA 5FFXA 2QM3A 5H6QA 2H8RA 2WY8Q 3FXUA 4HPQA 2XAJA 2E1MB 2O9LA 2K85A 1V5EA 4LIVA 1O7LA 1I1GA 2ELHA 1FT9A 3JTHA 3K4CA 5J40A 1D0YA 1YW7A 5D8LB 3G4SI 2E5NA 3AG3H 2CUJA 4M3GA 2YR2A 4PDKA 2LVSA 4HF0A 2RNGA 5K5QA 2DJIA 4KITB 2BZTA 1YX5A 1X3WB 3BJAA 4BHPA 5EF6A 3OR1C 3NARA 4OMZA 4XSXF 1KU2A 1MBJA 2QSFX 2GLOA 1IW7F 1PDNC 4BQNA 5TJJA 4L0ZB 5ILSA 2E35A 4XMYA 4Y52J 1DGRM 2L02A 4ITVA 4B48A 4DIQA 4OIQF 1MBGA 2HQNA 2VPLA 2G7UA 4RMNA 4IEJA 3QOEA 5E3OA 4OWRB 5EDNA 2DW4A 4YRVA 1TTYA 2FJ1A 4GCVA 4RDUA 4X6AJ 3MFKA 1L0OC 4Y7NJ 3HUGB 3KP3A 4L5EA 4EATA 3DTIA 2ZB9A 3Q0VA 3CLOA 4AYBA 5HLTA 4HZFA 3LSPA 2DI3A 1U5TC 3QYEA 1V5FA 1FIAA 1HF0A 3PM1A 2XF6A 5FKLA 1VQPI 1R5ID 1IUFA 2COMA 5FFZA 1FSHA 3LFUA 1EJ9A 4C2TA 5A2QK 2XB5A 1TW2A 2R3SA 1YW8A 2KISA 2Y30A 3BTLA 1W0UA 1PUFA 2D1VA 1JXSA 2KHMA 3NRVA 3L09A 1KQ9A 2PQ8A 1TZLA 1WI9A 3OYIA 2LF8A 1T38A 1CF7B 3QP6A 3VOEA 5BS6A 2GOXB 5J1YA 5GTIC 3J80Z 3E7LA 2EIKH 1SFXA 4ZYHA 3QU6A 5ED4A 2ZJ2A 3CF2A 3I59B 1B9NA 3HOTA 3R60A 4RAGA 2QSGX 4AIKA 3ZQLA 2BY1A 4CYDA 4HSRA 4DNCA 3BG6A 3PNVA 1X4PA 2P5KA 4EM2A 3F72A 3HGGA 3BQYA 5KAIC 4R79A 2XGXA 3K70D 3JRHA 3HGYA 2E5ZA 3FF5A 1LNWA 2ELKA 3HRTA 2VLAA 4ZJZA 2KT0A 1BI3A 4CA0A 4RB0A 2EFWA 3IWZA 3P9CA 1XCVA 2HR3A 2XVCA 1TW3A 3GZ5A 3I54A 4DZPA 3A01B 5LBQA 1FOYA 3ONQA 3MZHA 2Y2ZA 1T08B 3A03A 2IRFG 1RRJA 1B4AA 3KEOA 1IN4A 3JRBA 2PJRB 4E4HA 1V3FA 2ZMEC 4B3XA 2DA6A 2W84A 3FWEA 4C3HJ 1U9NA 1XN7A 2E1OA 3TP3A 2O3FA 2I5UA 2YU9J 3CUQA 2LRDA 3KP4A 1SMYF 2EH3A 2P81A 4B43A 4KT6A 4M73A 2PN6A 1LKXA 5HDGA 4I0BA 4UVCA 2DMTA 3OYJA 2B7EA 1FYMA 4ZTJA 4QWQA 4HW0A 2K9LA 1WSUA 1DU0A 4E7SA 1I50J 2IGOA 2YUSA 1DP7P 3K69A 4CGZA 2IS6A 1SD4A 2LBFB 4OOIA 3QPLA 1TQIA 2X6YA 4OAYA 5H2FC 4KT5C 2XAFA 3ZRGA 2A69F 2HS5A 1GT0C 2F5DA 3DLLF 4XRFA 3ZPLA 4UUVA 2O8XA 2R7ZJ 4M6YA 2H6BA 1UHMA 2IGMA 3DXJF 2M9HA 4UNOA 2QEXI 3MN2A 5CVJA 1MH4A 4WWCA 3GFIA 2M8EA 1JKPC 4O6JA 4I01A 4RAZA 3FHZA 2FQ4A 5F27A 4BQAA 2HKOA 3LSKA 4A2UA 2FBIA 2LP0A 2EZIA 1T56A 1HDDC 2DFEA 4LG3A 2FA5A 3E1SA 2FXAA 2JTVA 3QPHA 4N4OB 4ESJA 3GTOJ 3U9GA 5HODA 1A6IA 2R7SA 4J00A 3C1DA 1WJEA 3GWZA 4UVAA 4BGDA 1LUJB 2M0MA 4RBOA 1S72I 2GBYA 2BXZA 1SD5A 3BY6A 1Q1VA 4HOBA 2A3SA 3CCMI 5IYBJ 3M7GA 1R5HA 3GCMA 2XASA 1OKRA 4YFNF 1WFXA 5JLWA 4MTDA 2RREA 3HKZN 2L7ZA 2HEOA 2R7DA 3QYBA 3ROUA 3N97A 2PFBA 4LMYA 5J47A 5HLHA 3IAS2 3EETA 1MW7A 4F91B 2CFOA 1RESA 2FUG2 3M3YJ 2GIZA 4A3BJ 3F6VA 2VB6A 4M9ZA 4F93B 3BROA 1DPUA 1XCBA 3ZMSA 2N8GA 4PZJA 2VOOA 2NNNA 4XL9A 3F8MA 1IC8A 2NVUB 1FPQA 1X1DA 1EH6A 4M74A 5LEJA 3UKGA 2VIXA 1AOYA 2VXDA 3CCEI 1L3LA 1ZYRF 4YELA 2VT3A 4MGRA 3BG3A 3J81Z 3I0TA 1OISA 4IL6C 1UHSA 2MH2A 1BA5A 1I5ZA 2OZ6A 2W82A 1YIOA 2GXAA 1Y39A 1FYLA 1HSJA 1MDMA 3OYEA 4M3DA 4CZCA 3HSFA 4XR6A 3OYGA 2DT7B 3H36A 4V2GA 4FHTA 5KNLA 2OA4A 1Z1DA 4MQVA 4RB2C 3S93A 1JT0A 4CCKA 2W57A 3K4BA 1NK2P 3M1EA 4HBLA 1U8RA 1IZ1A 2NYXA 2QWWA 3PUBA 2CUZA 3G6EI 1FMWA 2BXYA 3ZQCA 1X1BA 3CJTB 3GVAA 3RYRA 2XKOA 3KYLA 3ULQB 3E5XA 4C9YA 1QZEA 3DKYA 4FISA 2Z5UA 4BJTA 2XAHA 3Q9SA 3VFZA 1ETWA 2C6YA 1S7OA 4NNJA 3TO9A 5IY5H 3LAJA 3HTUA 4Q4ZF 1TL8A 2LOOA 2X1CA 1JE8A 1VQ5I 2JN6A 2HPMA 2VODA 2EK5A 1B9MA 1W5TA 1YRNB 4DYCA 2Y0SN 3D5LA 3PFIA 1R71A 4WX9A 1OCCH 3GFLA 1YO5C 1JTXA 2RC4A 2LY1A 2BW3B 1HOMA 2UZKA 4HG2A 1YFHA 1E3OC 2WTEA 4BHBA 4G7HF 2Z99A 2QQAA 4EV0A 5CVIA 2Z16A 2DQLA 2QENA 3PO2J 4NC6A 4HNTA 5EYRA 4U0WA 3FHNA 2MYSA 3L00A 5L3EA 2DTRA 1NG7A 4ZDLA 4JQFA 2F5CA 2RDPA 2VXZA 3DCFA 3GLXA 4ASNA 5HOOA 2GA1A 1MNDA 5E3NA 3M8JA 3K7AJ 2Z33A 5FGMA 3OL4A 4N9HA 4Q48A 2CJJA 2DFFA 3CMYA 2NXNB 2E60A 4HRIA 3CJNA 4G6DA 3K6GA 4WXCA 3FBIB 2YPRA 1R4NB 4RS8A 4UY8I 1MGTA 1LFBA 4ON0A 5K5RA 1Z9CA 3G3ZA 5CPRB 3FXMA 4HX8A 4PJLA 4U7DA 1W36C 3BZ6A 5LFAA 3RCOA 4LG0B 2IXSA 4MQ9F 4LGWA 4L0YB 2JSCA 1XB4A 3VB2A 4DYQA 2K5CA 2R7OA 4E6KG 1BC8C 1J0RA 1Z7LA 4BDZA 3K10A 3VODA 4FETA 1O3QA 3PO3J 3WTSC 4XONA 3CMEI 1JT6A 5CLSA 2CMPA 3HSRA 4XM3A 3WTYC 2FMLA 3HBLA 3S3NA 4I7HA 4HV5A 2Q2EA 2R7RA 4KNYA 1OCRH 5DS9A 1R23A 1W36D 1ZREA 5ERIA 2LD5A 3O8GA 1DU6A 2CG4A 2W85A 3RPUA 2M3AA 1M1EB 2R4GA 2OZUA 4MHGA 1I27A 4ZYEA 1IO2A 2R5ZA 1KU3A 5E20A 5K7HA 3H1CA 3MEXA 1K4TA 2DA1A 3BQZA 4LD5A 4XICA 1ETKA 5E1WA 3LWFA 4E7LA 1R58A 3KP7A 4LB6B 2DYRH 2V1UA 4F92B 2DPUA 1WJAA 4OAZA 1D5VA 1Y0UA 2Z9OA 3OWTA 2ZKZA 2IVMA 1LPQA 1MBHA 3HOSA 1X3UA 2BYVE 3I5UA 4YIFA 2Y69H 2ZJPF 1Y6IA 1ZARA 4JBAA 3I56I 1Z3YA 2W1OA 3BJOA 4UV8A 1RZ4A 3CUQC 3VWBA 4XLHA 1XGMA 2M4KA 2CGPA 5BOXA 4KISA 3EUHA 3AL0C 3BPXA 1WJDA 1UJ8A 2M45A 3SEQA 2QKMB 1HSTA 3HG9A 1ORKA 2ECBA 3IH4A 2MW8A 2L9SA 1A6QA 2HZDA 4Q47A 3CC2I 4GYGA 2P6TA 5GPAA 5D5XB 1GVJA 2BE5F 4AD9A 3S3OA 3T5XA 4M9SA 4PFPA 4I76A 2JUCA 2LSOA 3LSGA 4PUSA 4Q5SF 2QKLB 3KFWX 3F8NA 3MZYA 3S8PA 4KMFA 1CQTA 4IZZA 5BQTA 2HOEA 5JVGF 4NQWA 1ON1A 3F8BA 3LSMA 2L7MP 2Q1ZB 1FBSA 1AA7A 3PQJA 4IXAA 3RYPA 1I1SA 3HOUJ 2KIMA 4NC8A 4CCOA 4FTHA 2QSHX 1GXQA 3IC7A 3A02A 3I53A 2DTZA 1N25A 3IL2A 1IUYA 3CESA 3QU3A 2M5WA 4JX5A 1E2XA 1MD0A 2WV1A 1K79A 3BR6A 2DAOA 3Q3SA 4YIIA 3WE2A 2MC4A 2NVTJ 2CH0A 2ISYA 1QZZA 2DDAA 3FKIJ 3IH3A 3H3VK 2MD0A 2VKVA 1XGNA 4YFXF 2KQRA 5L3FA 3C7JA 4YEJA 1O3SA 4CYCA 1DUXC 3AKZA 5LD2C 1A31A 2EA4A 4ENNA 3OYHA 3P9IA 3RI4A 3ZQQA 1ZGWA 3DU6A 2NVYJ 3KYDB 5KCMA 1S5LC 3TGNA 1IRZA 3ZMTA 2TRTA 5E1ZB 2DCEA 3RQ4A 4BXXJ 4IHWA 1U8BA 3DPTA 4LFUA 5CQGA 2KIFA 5DUIA 3QODA 3H35A 3LL7A 2XB0X 2XV4S 1UHWA 3S2DJ 1BW5A 2IAIA 4EJUA 2KZVA 1IJWC 5FLMJ 4EEFG 1R5GA 2BY2A 3VYSB 4I99C 1MMDA 3R0JA 4IRGA 2K3FA 1K78B 1RPWA 3H9QA 4B44A 5FRMA 3CP2A 4A12A 4RM3A 1A04A 3OSGA 4LLLA 5CYVA 5LGNA 4OU0A 2LC2A 4FASD 2GQQA 4KJZA 1EH7A 2R5YA 5D5VB 2JA8J 4XRSA 5ILVA 4A3LJ 3HKZA 1TP4A 2X0LA 3CJQB 2V1DA 4WF2A 2HGCA 3V42A 1XG1A 2IT0A 2VE9A 1YOVB 2NOJB 4U7BA 1WH5A 3CCLI 3BTIA 1JKOC 4UUSA 4ZDOA 1GUUA 1FWZA 1HKSA 4QSHA 1WJFA 2ID6A 3J80K 3I55I 5EJCA 2X4HA 3RTRA 5JLXA 5E79C 2XAGA 4K2EA 4IHYA 3MKYB 3DU5A 2D45A 1JJ8C 4R8HA 4C3IJ 2VJJA 1P7IA 2G7HA 3BR1A 1Z67A 2BOLA 3FK6A 1PUFB 5B5EC 2K4JA 4ESFA 2P7CB 1BIAA 1NH3A 3DBHB 4I98B 1H89C 3FKJA 5EG0B 1IAWA 1S7AA 2I10A 1APLC 2AO9A 1X2NA 4II2A 4MIMA 5DCMA 3FZVA 3HC7A 5F0HA 3CO6C 2R7QA 2JPCA 3L2UA 3D5SC 2E36A 2UUZA 4G94A 4L9NA 2OF7A 4PGHA 4L18B 2HFHA 2BY3A 2IW5A 1I3AA 2ZXIA 3GTLJ 1SANA 1FLIA 2KDOA 3MWMA 2KKOA 2ZSIB 2WAFA 4U88A 5F6FA 1LDJA 2NRAC 3H5NA 5F08A 5D4RA 2A68F 2CWEA 5HLIA 2F5VA 1VTNC 4M72A 1YHQI 2ZCWA 1V5GA 5IP6A 1SD7A 2Z2SB 2OV7A 2RVCA 2M0CA 1FIPA 2P4WA 3KLNA 4E70A 2CW0F 3MVPA 3JCUC 3HYIA 1YTYA 3IUOA 1YI2I 5GP9A 4EM0B 2M34A 3C2BA 3KIOA 2DMUA 2IA0A 5E17F 2XSJC 2Y0SA 2DMNA 3MCZA 3G1LA 2ZFWA 4CUGA 1HA8A 4GO1A 2QF7A 2W24A 4HDUA 3A4CA 1P2FA 2FQ3A 2OD5A 2R93J 2OQRA 3LMMA 2ZXHA 1USTA 4CCMA 1UG2A 2XDVA 5GADJ 4IHVA 1P4WA 3NQOA 3CO7C 1ETOA 4C2UA 3TL4X 2LKXA 1T0FA 2JZYA 2MC3A 1WJCA 3ISPA 4D7MA 5C4JJ 4XRSG 4LK0F 2WB1N 1P9QC 1Z6RA 2G9WA 1BN5A 1YJNI 4IRIA 1R1VA 2LYCA 4RGXA 4ZZLA 2UWMA 2LFBA 5BNGA 1ZAOA 4EM1A 4IKFA 3BC8A 1ZG1A 1ZGAA 2VBXA 2Y75A 4JX6A 2FNPA 2LH9A 1G3TA 1K7AA 3S1RJ 3K4NA 3M8EA 2ZO4A 2KJBA 3P9KA 2CO5A 2VASA 3WTXC 3CCJI 3TO6A 1IRFA 3J7ZI 2FOWA 4G6TB 2RV8A 3FK7A 3TO7A 3I3LA 2F5FA 2EPFA 2PEXA 4YG2F 3K70C 1AU7A 1TQPA 1WI3A 4BU2A 2IGKA 3I9V2 1PYVA 4MTEA 1HKQA 1SD6A 1IF1A 3S1MJ 3OYMA 1UAAA 3OL3A 3VYRB 3SDGA 2Y31A 4EJTA 3RZOJ 3AAFA 2H6CA 3BTCA 3E6BA 1D1CA 2O5RA 1FX7A 2V4JC 4P96A 1F5TA 3I4NJ 2JRTA 1JUPA 1QA6A 4PCQA 1U2WA 3P5JA 5EEHA 2M2EA 2W00A 1G4DA 4C3JJ 2VBWA 4L5IA 5FLXZ 3JSOA 2X6OA 4U87A 3ML6A 3HSEA 1SVOA 2ETHA 1BI1A 1EA3A 4CCLA 3ZMDA 4XIDA 3T8TA 4GGGA 1X1CA 4UXNA 3PIOF 3FMSA 3RPUD 2FSWA 3DBLB 5F1JA 3OYFA 1FY7A 1X4OA 4DBRA 3GO5A 5BMZA 3M8FA 3EUHC 2HVQA 3CCUI 4BL0B 3CCYA 4NB5A 4B09A 4BY1J 1ONVA 1B8IB 2LKSA 4BE0A 4IQJA 3O8HA 3J81K 2XRLA 1QQIA 4RB3C 1ZRDA 2HYGD 3I64A 2JMWA 1TWAJ 2I8DA 2HTSA 3DF8A 1ZLKA 3WG9A 2KZGA 2LDUA 4BE1A 3QP5A 2KPMA 2DA4A 3WGHA 4C2MJ 1SFEA 2LR8A 2DK8A 4KA4A 1XD7A 3ZGKA 3ZCOA 3LNQA 2VQCA 2ELJA 5JFRA 2CQNA 2RAEA 3TMOA 3TDZC 2JT1A 2A61A 2BGCA 1O3RA 2R7FA 1XDUA 2R0QC 1ETQA 2QLZA 5LHHA 1ITYA 2DA2A 1S3JA 1UFMA 1A35A 2EFOA 5TRDA 1X1AA 4LOCA 2KFDA 1YG2A 1C0WA 1IDYA 1QVTA 3WTWC 2J5PA 3RSNA 3HUGA 2PMZN 4XK4A 4ABZA 1HKTA 2L5QA 2HXIA 4IHSA 1P7JA 1MDMB 1B6AA 3CC4I 4NC7A 1OMIA 4RAYA 4AWXB 4HF1A 4A3MJ 2HOAA 3K4KA 3MKLA 3BG7A 5EGOB 1MJ9A 2ZBKA 3K9TA 2RNJA 3WTVC 1K61A 2RKHA 3FM3A 2BBYA 3IKTA 2GWRA 2JUGA 2M7AA 5KK1A 4RGUA 5E8GA 3FMQA 3G1MA 3S2WA 1JHHA 2KP6A 4HQMA 1V55H 2WBMA 3BDDA 1G59A 2YS9A 4Y4RA 3S14J 3FX3A 4F7ZA 1ZGJA 3RPQA 2KJCA 5CKTA 3IWFA 2E7WA 4GYIA 2MBFA 2L3DA 1AWCA 1U0JA 1CF7A 1P92A 3O2PE 1K6OA 3H5RA 5H6RA 3BJ6A 1YJWI 2MG4A 4JOMA 3ABUA 1W5SA 4BQQA 5KHDA 3HOZJ 2DOAA 2HPIA 3TKYA 1HQCA 3CMAI 3I59A 5LHIA 4BH9A 5FJ8J 3EYIA 1KZHA 4M3FA 5D5WB 5J4VA 4IHTA 3GXOA 1FJLA 2FF4A 4IVNA 2GM4A 3CD6I 5IT9Z 2DU9A 4S05A 1E0EA 1BJAA 1KYZA 3A0HC 1HW1A 4MEXF 4PSXA 2VJ4A 2F2EA 1YYVA 2IP2A 1G3SA 4B1RA 3QWLA 3L2WA 2WAEA 1OCOH 3ZP5A 2DFIA 4PJ0C 3SFIA 2P5LC 1MNMC 1OYWA 2X1DA 3L7WA 4Y33A 5B3SH 4OMYA 4UV9A 1RUNA 4OIOF 5HNFA 4RA2A 4BBSJ 4JYKA 3A01A 2FNAA 2BHYA 1BOBA 2DN0A 5AIQA 4PSWA 3J7YJ 5HS9A 2IPQX 1GVDA 3V8LA 4BJ5C 5IPAA 4BUPA 2QBYB 1VQNI 4XKBA 1GXPA 1I6HJ 2XC7A 3JTGA 2CQKA 2EA2A 1XMKA 5FKMA 3VYTB 2PJRA 4AVPA 5DCFA 2EB7A 1EH8A 4BXUA 3F9KA 2Z1DA 2XHKA 1ZH5A 1HBXG 2VUMJ 1ZR4A 1R7JA 1SFOJ 3Q9VA 3AG2H 1K4SA 3EYYA 1U5TB 2F4IA 4A3IJ 5FD5A 2BY0A 5FO5A 2VC1A 4X1EA 3GTKJ 5LRSA 2HDWA 1LEBA 1PUEE 5IOYA 5F0CA 3HOYJ 1JHFA 3EDPA 3LQQA 3LSRA 1OQYA 2K4BA 3BT9A 5LEKA 4DJAA 1W7PA 2K40A 3CJRB 3S16J 3OY9A 2X1EA 3WGIA 2JVGA 3U21A 2UV1A 2D1HA 2DMQA 4KIBA 3S32A 1R00A 2LBFA 1JKRC 2WADA 1D0XA 2V6EA 4XN3A 2JA7J 5HS8A 2D5VA 2A5WA 2H1KA 4PFOA 2AXLA 5FKOA 3F3XA 1JGGA 2L0KA 3J7AO 1T95A 3F8FA 4IQ4A 2CV2A 2AXTC 2CW8A 5IP7J 1WH7A 3HOWJ 1SVMA 2DFHA 4EQQA 4H4KC 9ANTA 1KA8A 1BI0A 1G8XA 5GPCA 1TLHB 1TT5B 2B0LA 3SDBA 1T8IA 4NBQA 1RNLA 1FBUA 2CS3A 5CVRA 3JAMZ 1H88C 1R4MB 4GXOA 3OYBA 2DA5A 1U78A 4AVZA 4A5MA 2E19A 2EZKA 4A5NA 2E2IJ 1X58A 5DD8A 3CCVI 3DTKA 1LQ1A 3BZKA 3TQNA 1MMNA 1Y8QB 1YE9A 2K9MA 4IOAF 2ME6A 5M3MJ 1BI2A 4DW6A 3ABLH 2X9DA 3BOQA 2GXGA 4M6XA 1T0FC 1I39A 2FX0A 1ULYA 3LSIA 3W6VA 2EZLA 3FXQA 3IV5A 1GV5A 2XRNA 2HTJA 4BDYA 3FBNB 5GAGJ 2ZMEB 2K86A 1OCTC 2VT2A 2BVMA 3PQKA 3FIWA 3K1PA 3U2RA 3JSPA 2F48A 4HNUA 3B73A 1STZA 4HYEA 5C4XJ 3TOBA 3HOVJ 3SJMA 6PAXA 4A3GJ 1PVEA 3CP8A 1SVLA 1NK3P 3DPLC 1ZN2A 2FD5A 4AIJA 1AKHA 2XF7A 2X48A 1BR4A 3H3ZA 2F6CA 2DODA 4XKWA 2BVLA 4I0AA 4HF2A 4GFBA 2OBPA 4P5OA 1ZRFA 4IO9F 1YW9A 4E7ZA 1MNEA 3SEZA 2DT6A 2W25A 1R36A 2H8WA 1QNTA 1VQ8I 2L7KA 1XTAA 1XPXA 4L9TA 4RGSA 1G3WA 4ENJA 2XGDA 3QOPA 1WKMA 4ZYDA 3MD2A 4N0BA 3CLQA 1ACIA 4D9JA 4F52A 1D8KA 5HS7A 1R49A 3A1YA 5AIPA 1OLTA 1XMXA 3C18A 3SQNA 1ZLJA 3OS1A 3EUKL 2M87A 4FCYA 3K1NA 4J19A 2QQ8A 3NWTA 2O7OA 3WU1B 4EMSA 1S7EA 1HXDA 1P4AA 3FXOA 5EZGA 3R6SA 3TW7A 4HEA2 3MKWB 5BPIA 1Z05A 3OOUA 1YJ9I 2VQLA 1ZG3A 1VQLI 2KIQA 2VKHA 4O3MA 4IRHA 2H27A 4ZYAA 5M5XJ 4NHJA 2KIUA 4A0XA 2RGVA 3U1KA 2E1MC 2A6TA 2EINH 4XLFA 3HEFA 2DDBA 1MMGA 2K02A 2PX9A 4Z6YA 1V54H 3JRGA 4BEHB 2EILH 2LREA 3JRFA 2E1CA 1XSDA 2R5YB 3REOA 3CQZJ 3AFHA 1WRJA 3JRIA 3JRCA 2ZJQF 2IA2A 4A3JJ 2IBDA 5D5UB 4A3FJ 1KYWA 1QPMA 2DO7A 2E1NA 1ON2A 2CQQA 2VJ5A 1HW2A 4LLGF 2X51A 3LSJA 3QPSA 1ZR2A 2X6WA 4FT8A 3R4KA 4A6DA 3HRUA 4FX0A 2Y48A 1YS6A 1H9TA 4PK4A 4X0GA 2FMYA 4Z2YA 3ABKH 3HB9A 4CHUA 1UMQA 3UNGC 2Y9YA 4ZC3A 2L4AA 3CTAA 4IHXA 1UZCA 3TEDA 3SZPA 2GIVA 2RQQA 1YIJI 2OU2A 5D6EA 5B1BH 4BYYA 5ICFA 4C30A 4P1WA 3ERED 3S3MA 3BCBA 3MKZA 2PMZA 5K7FA 2UXNA 5LLQA 1IRXA 2E7XA 2GZWA 2R7TA 4AU7A 1HC8A 4E7JA 2JJ7A 1IN6A 5D6FA 4RGRA 1RC9A 2EV6A 4W97A 4LG0A 1DQUA 2DT5A 1JGSA 2YU3A 1KU7A 1G3YA 4KUMA 3BG5A 1DDNA 1F1ZA 3G73A 2HQAA 5JHUA 1PP8F 1TWHJ 2FU4A 2XGEA 1VFCA 2B63J 2R92J 3SZTA 2K27A 1MZBA 1R6RA 1XS9A 3K1MA 3BR0A 1BL0A 1W0TA 1MMAA 3SFZA 3CZ6A 2P5VA 1U3EM 3NEUA 3P7NA 1RR8C 1MBKA 1O57A 2LMDA 1B72A 3KCCA 4XOTA 4Y15A 1IV6A 3QYFA 3TDUC 4PJNA 3CMMA 3W2AA 3MZ8A 1FYKA 2GAUA 3L9FA 5DD4A 3HPGA 3HRMA 3KZZA 2F4OB 2VOPA 3LSHA 4YFKF 4XLNF 4HNVA 2XSDC 2OPTA 2ZJRF 4XSZF 3D1NI 4WXHA 1LE8A 4E7KA 3HHHA 2RN7A 2XPUA 1MSEC 2R7UA 2M4GA 1OYIA 3ERMA 3E3VA 3IAM2 5E1XA 4S04A 4BJ6C 4G6QA 1S8NA 2EWNA 3IH2A 3V4GA 3HJEA 1AHDP 4BKXA 1D1AA 1TT0A 4CCJA 2MLGA 1BM9A 1PJRA 3LFKA 1HCRA 3OIOA 1TWCJ 3DBRB 1J7KA 2E2HJ 4HAMA 4PJJA 2QGUA 4FX4A 1JI8A 2V1NA 1QVUA 3X2QH 3H92A 4CICA 2EZHA 4GDFA 2OCEA 1Y56A 4KFCA 2R7XA 4M6VA 3KP5A 3LSTA 4EJWA 1OR7A 5IYCJ 4CO8A 5DM7F 2VPRA 5JR3A 5FKNA 1FSEA 4EJOA 3E97A 3PL8A 4G7OF 3WU0A 4FE7A 3S15J 3JR9A 2JA2A 3ZXSA 4CXFA 5FLXK 5J1UA 5D4SA 4XOPA 3G71I 3EUAA 4N9IA 2JVHA 1ZQ3P 1KONA 5HNHA 3GTGJ 3LA2A 4MNUA 5CVUA 3DPUA 1J2XA 3JRAA 3U1DA 2O03A 4KICA 2PMHA 5J4YA 5GTHC 3IKVA 3S2HJ 4DYRA 3KZIC 4F3QA 2VI6A 2ZFUA 3DP7A 3VDXA 2WA0A 2KRFA 1RR7A 2WC2A 3FXLA 1W7PD 4KN7X 3NAUA 1QZYA 4A6EA 1QO0D 4FE4A 2CSOA 2ZSHB 5CJ9A 2E34A 3HL2A 2K9QA 1QRYA 3H3UA 2W7NA 2ZXJA 5C3EJ 1YQAA 4IF4A 2QA4I 1TBXA 3CDHA 4LK1F 2CV1A 1FOWA 4WCGA 2F5EA 1XDSA 1TQMA 1H0MA 2MH9A 2KLOA 2DPDA 4F55A 4QPOA 2O6GE 1S9HA 1ZKGA 4BS9A 3F8CA 4BY7J 1SC7A 1SMTA 2TCTA 3BR3A 2EIMH 1Y0NA 3GMEA 4MO7A 2VQGA 3TP0A 2ME0A 3R0AA 3CCRI 2H94A 3RKWA 1NG6A 1FZPB 3CUQB 3FXJA 4QPQA 4A0ZA 1KGSA 4G7ZF 1K78A 5GAEJ 4JP0A 1QBJA 2CFXA 2ICWG 3KP6A 5J3LA 3RKQA 2HKXA 2NS7A 2XAUA 3AL0B 5H20A 1RETA 3H9JA 2XGCA 4HX4A 2VBYA 2XROA 4BACA 5HVQC 1J75A 2L54A 2FBHA 2HDDA 1LFUP 1ZHFA 1OJLA 3DLAA 2FOKA 4Y3OA 2PG4A 1LVAA 2HQ5A 1LDKB 4LJZF 3BWGA 1XSXA 1ZELA 2A5YB 4HA8A 1JJ6C 3BZCA 3E5UA 3BG9A 3HIFA 3JREA 1WZ2A 1N78A 2LNBA 3KETA 2PMUA 5JVTA 1H8AC 4KDPA 2MD5A 2X6XA 3QQAA 3GTPJ 4U0VA 1NHAA 1UG0A 4XNFA 2V9VA 3RJPA 1BOAA 4AM3A 1YLFA 2JPBA 3W2WA 1O3TA 2L4MA 2VN2A 3GYHX 2STWA 4OIPF 2EQRA 2EBIA 5LHGA 1WCMJ 5FLVA 2DOEA 3QRFF 4L9VA 4RLQA 5L3DA 3OS2A 3J7AY 2TDXA 3OYNA 1TWFJ 1D0ZA 5HDNA 4G9YA 4DZJA 4IJAA 5IT9K 2HWVA 2ADUA 1ZTRA 5JHFA 4GRIA 3UR3C 3A0BC 4D0PA 5EG0A 2JA6J 4M3EA 5E3MA 2HVRA 1F9NA 2NOGA 3O6BB 3QAHA 2GA2A 1MSFC 3BP8A 1J59A 4MLOA 2DYSH 2OJED 3I4PA 3V8JA 2R7VA 2P0WA 3B6CA 1X1PA 1G6NA 2A07F 1VQ6I 4ESBA 3GF2A 4KIGA 5DDGA 2STTA 4OIRF 4XN0A 2AS5F 2IEKA 4UHTA 3W6KB 1MMSA 1ETVA 3S1NJ 3CCSI 2OC6A 1HLVA 1EKEA 2O8KA 3KYCB 3GZ6A 1T33A 1PP7U 2ID3A 2E71A 2QZ8A 3ZQFA 2VKEA 2VQHA 2ZC2A 4G8XA 2JRMA 4M71A 4QLCU 3ECHA 3CUOA 2V26A 4MEYF 2WAQN 3DKWA 2OTLI 1J9IA 4NDLA 4I6ZA 3FXRA 3ZN0A 1F43A 2HXOA 3RIRA 4UUTA 4KYWA 1XSVA 2OQGA 4RAFA 1IGNA 3F23A 2EFNA 3B6AA 4E7HA 2KL4A 3V7SA 3W6JB 1UELB 2HZTA 5C44J 2FRHA 3AG4H 3HOXJ 1S29A 3M1CA 2JA5J 4LITA 2HQRA 2XF5A 4B8XA 2MSYA 1TC3C 2EJRA 3PJRA 1F36A 3MMYB 1FOXA 2CV0A 3CDLA 4HQEA 3E5QA 1ERDA 5KAFC 5FB2A 2HU9A 2V1XA 3JAMK 2CRGA 4ANJA 1W7PB 4WXDA 1H9GA 1MJBA 1J09A 4XLPF 2BHZA 2CUEA 2ISZA 2VKDA 2CW7A 5KVRA 4LIUA 5DUKA 4PJMA 2UXXA 3W3CA 1XX5A 2QUFA 1QU3A 3SXYA 1WQ2A 3ABMH 4D1QA 4G12A 1LB2A 1YX3A 5GAHJ 1FP1D 1WHUA 4B4CA 2V6CA 5B1AH 1MBFA 5F0FA 4BAYA 2FEZA 1EF4A 5EZHA 3S1QJ 3RDIA 2DOFA 1ZK8A 1WPKA 2ZXWH 3HHGA 4I2OA 3RZDJ 1Y8RB 5E3LA 5ILUA 2PI0A 4CCNA 5J8CA 1KU9A 2IS1A 5M3FJ 2LG4A 4II3A 2L2OA 5TGTA 3RKYA 3HTSB 1D8JA 1DP3A 1QPIA 1DPRA 4ENMA 1VQ7I 1OFCX 2HNHA 1Z21A 3K4MA 2M1BA 5DEQA 3VPRA 3GFJA 2OCCH 5TISC 3BLYA 4H0EA 2YSRA 5A2QZ 4ENKA 3OV8A 1RUOA 3WE3A 2IS4A 5EEGA 4RLFA 1SFUA 1KQ8A 2MLKA 1HDPA 1XGSA 4AIDA 2HVSA 2DBBA 3L2RA 1G2HA 3ASNH 1BJZA 1CGPA 1BR2A 1GHCA 2EIJH 1B1BA 3ESWB 4ZDPA 4AC0A 1GV2A 2O0YA 2WV0A 3L2VA 1D3YA 5IOZA 4CZZA 3KEYA 2DLLA 2AHQA 3PFYA 5K5OA 1TNSA 1HW5A 2H1LA 3H9GA 2RQPA 2ACJA 2EV5A 1OR7C 3ZMUA 3PSFA 1IG7A 1ETYA 4JK1X 3Q0UA 4M3BA 3VEPA 4RB1A 1B8IA 2MA3A 3WODF 3M07A 2OUMA 1OCPA 4XRMA 1ODDA 2MFZA 1ZRCA 3OYCA 1QGPA 1AKHB 1RIOH 3E6MA 2W4SA 3CCQI 2VE8A 3VYUB 3HZJA 3WGGA 4D7NA 4A69C 1GDTA 1VZ0A 2P8TA 2EFPA 3GFMA 4UB6C 4P55A 2L9NA 1RKTA 1QHGA 2DA3A 4A3EJ 1X2MA 3GTMJ 2QVOA 4HLXA 4BXFA 2KRCA 1LDDA 1TWGJ 3GBGA 1VQOI 3NWSA 1Y1VJ 5M5WJ 3N4MA 4IPAA 3JRDA 3ZQ7A 2FE3A 3I71A 2HYFA 1IN7A 1I6XA 2Q2EB 1E3PA 3OR2C 3RKXA 1FEXA 4HV6A 3Q0WA 3I58A 3VSKA 2HDCA 3ZQIA 3COAC 5HDKA 4HDVA 2JK3A 1E17A 2EFQA 3K2AA 3KEQA 3R61A 4U0YA 2R5ZB 1IRGA 2NAZA 3GTQJ 5EGOA 3HDDA 3JW4A 3KLOA 2W48A 1VQ9I 2KDZA 2X85A 2ESHA 5IP9J 1WWXA 1Z6TA 2L7FP 3HPHA 2DXIA 1MH3A 3CC7I 1VNDA 3E0JB 4I02A 3V7CA 3WG7H 1ZG5A 1W4MA 2ESNA 4LLNA 1V4RA 4A93J 4M9XA 4B3AA 3L1PA 4B47A 5IYDJ 4A0YA 3ELKA 3ZQGA 1FNNA 1KQ0A 3BCAA 1I3QJ 2P7VB 5D8KB 2XPVA 1FOKA 1W5CC 3FMRA 1USSA 4XBFA 3KZYA 4BHCA 5E8IA 2V7FA 3A2KA 2XPWA 2A6EF 1T39A 3F22A 3ZOBA 3FISA 2VONA 5K7ZA 3WTUC 2Y9ZA 3GEZA 3H0DA 2DQRA 4BE2A 1ETXA 1VQ4I 1A5JA 4CSWA 5LRRA 1BBYA 2YX4A 3EPZA 2EV0A 4J01A 4L5JA 3GUDA 1FBQA 2WB1A 3OS0A 2M7BA 3PNYA 1J5YA 1TNTA 2WY7Q 2KMUA 4OINF 3BR5A 1Z3XA 2Q0OA 3C3WA 3C2GA 1IXSB 4L9JA 2JQ7A 3TOAA 4NQWB 5EEAA 3MQ0A 3KP2A 2CUFA 4XLCA 4PGGA 4O5VA 1FC3A 3LQRA 1DGWY 4MFDA 4AYBN 1R1UA 2QBYA 2K7LA 2QQ9A 2LK2A 4HX7A 3DKXA 3PIPF 5L3CA 1JTYA 2OAZA 1WVRA 3ZN1A 4ZZDA 4E7IA 1Z91A 2CQ7A 4UVBA 4D5CA 4EJVA 2PLYA 1D5YA 2KRHA 2A6HF 4WK8F 3HM5A 4RM2A 3WTZA 5M5YJ 2AQEA 3WTTC 1U5TA 3O3KA 1BW6A 1OYYA 4CYCB 2XKPA 3KE2A 3WU2C 5FD6A 3AG1H 3M4OJ 4BQOA 4QIWN 3BPVA 4FQGA 3Q5FA 3S17J 2R7WA 5ICCA 3T1BA 1ENHA 3ZMZA 2DA7A 1VF9A 5DM6F 1U9OA 1D1BA 2HYJA 4KIFA 4R1HA 3OIQA 2QQBA 4DGWB 1RKWA 3TBIA 1VI0A 2B9SA 2CYYA 4EGZA 1POGA 2AQFA 3HRSA 4V19K 3DTEA 2OTJI 1XGOA 3ZQHA 1JUMA 4BBRJ 2NNYA 1B72B 5ICEA 2E2JJ 3GLLA 1OCZH 4QTRA 2VC0A 4AUXA 3E6CC 4LB5A 1UCRA 1SFKA 1RI7A 5FRNA 1MJAA 3WHCA 5HLGA 3QPTA 3C2HA 1IDZA 1LE8B 3B02A 3GX4X 2K9NA 1WJ5A 3IRQA 2O61A 3M9AA 3K0LA 1YRNA 2WAQA 5F64A 1O4XA 3GW2A 1BC7C 1NTCA 2JWTA 3KX2A 3PUFA 4UUSB 2BW3A 2HOSA 4UB8C 4EGYA 2ECCA 2M30A 1R9TJ 2CU7A 2XUBA 5ICGA 4DQ2A 4A3CJ 3E6DA 1W1WE 2J5OA 3IHUA 5AONA 1LEAA
chains in the Genus database with same CATH topology
3ZGKA 3ZCOA 2VQCA 2ELJA 1FMWA 1N77A 1X1BA 1N75A 4HSTA 3TMOA 3H5AA 2ZSHB 3KYLA 3HL2A 1K6YA 2W7NA 3W2VA 2MABA 4C9YA 3DKYA 2CV1A 3OIPA 4BJTA 1X1AA 3K4LA 2KLOA 4NNJA 4F55A 3RSNA 4QPOA 2LOOA 1S9HA 2X1CA 4BS9A 2HPMA 2L5QA 2VL8A 4NC7A 4IX7A 3D5LA 2VQGA 3OYDA 3N05A 2LY1A 2BW3B 3K4KA 3BG7A 4ZTFA 1NG6A 3DQVC 4HG2A 4QPQA 2Z16A 3PNTA 2JUGA 2K3PA 2M7AA 2XAUA 4XLEA 3SZGA 4HNTA 3FHNA 2MYSA 3AL0B 2KP6A 3H9JA 2WBMA 1G59A 1NG7A 4BACA 5HVQC 4ZDLA 3OYAA 4Y4RA 4JQFA 5HOOA 2VXZA 2IS2A 3DLAA 1MNDA 4Y3OA 3M8JA 4XLAA 5CKTA 3OL4A 1U0JA 1LDKB 2E60A 1ZELA 3H5RA 4HRIA 3K6GA 4JOMA 3FBIB 4CH7A 1X19A 4BQQA 5KHDA 1N78A 2DOAA 3PSIA 2HPIA 3DEEA 5CPRB 2IGNA 2X6XA 4PJLA 1W36C 2V9KA 3VSLA 5LFAA 3RCOA 2IXSA 1QHHD 3G2BA 1UG0A 4XNFA 2K5CA 2R7OA 4E6KG 3W2WA 1Z7LA 4BDZA 3K10A 1E0EA 4FETA 4PSXA 2VJ4A 1LVKA 4RLQA 4XONA 3OS2A 3J7AY 3OYNA 3L2WA 2WAEA 1D0ZA 3L2QA 2CMPA 4BEHA 2X1DA 4Y33A 3IP4B 4XKCA 4XM3A 4DOZA 5JHFA 4GRIA 1WJBA 3UR3C 5HNFA 1BR1A 3OMYA 3S3NA 4XORA 2R7RA 2VJIA 1BOBA 2HVRA 4PSWA 1W36D 4BJ5C 3HXLA 5CQEA 4BUPA 4MLOA 4XKBA 2M3AA 2XC7A 2PJRA 2R4GA 4DBQA 2P0WA 3VYTB 2R7VA 3K4JA 3D5RC 3DWLE 3F9KA 2Z1DA 4XKVA 4E7LA 3OYKA 4XN0A 2F4IA 4F92B 1WJAA 4OAZA 4NUBA 2OC6A 3SYTA 2HDWA 3OWTA 2VQHA 1GLNA 3OYLA 3HOSA 1FMVA 3FDYA 2V26A 2GOMA 1Y6IA 4DJAA 2JSPA 3CJRB 1Z3YA 2W1OA 3OY9A 2X1EA 2JVGA 5FROA 2UV1A 3U21A 4XQFA 3VWBA 4XLHA 3S32A 2M4KA 2LBFA 2WADA 1D0XA 4N4NB 1SAUA 1LFPA 4XN3A 2V6EA 4KISA 3AL0C 2A5WA 1WJDA 4PFOA 2LY2A 1T95A 3SEQA 2QKMB 4IQ4A 2KL4A 3HG9A 2CW8A 4E7HA 2CV2A 1UELB 4H4KC 2L9SA 2HZDA 1G8XA 3M1CA 4LITA 3ZR8X 3SDBA 2XF5A 2CS3A 3S3OA 4PFPA 3PJRA 2WY8Q 4HPQA 3LSGA 4PUSA 2E1MB 2QKLB 3OYBA 3S8PA 3MMYB 4IZZA 2CV0A 4AVZA 1V5EA 4LIVA 3LSMA 2Q1ZB 3K4CA 1D0YA 1ERDA 1AA7A 2HU9A 3DTKA 4NC8A 4CCOA 2E5NA 4ANJA 1MMNA 1YE9A 2CUJA 1J09A 2K9MA 2VKDA 2CW7A 3CESA 4LIUA 2RNGA 4PJMA 2DJIA 1T0FC 3W3CA 4KITB 1YX5A 1QU3A 4D1QA 2MC4A 3OR1C 3LSIA 1YX3A 2CH0A 4BDYA 4BQNA 3FBNB 2MD0A 4XMYA 1DGRM 2KQRA 2BVMA 4ITVA 4YEJA 4B48A 4DIQA 4HNUA 2VPLA 4RMNA 3AKZA 3QOEA 4CCNA 4OWRB 5LD2C 3OYHA 2IS1A 3ZQQA 4YRVA 3DU6A 2LG4A 5KCMA 4II3A 2L2OA 5TGTA 3CP8A 1DP3A 3RQ4A 2DCEA 3DPLC 3HUGB 4EATA 3DPTA 3K4MA 2HNHA 1Z21A 5CQGA 2XF7A 3DTIA 4AYBA 5HLTA 1BR4A 3BLYA 3QODA 2F6CA 3H35A 3LL7A 4XKWA 2BVLA 3QYEA 4P5OA 1V5FA 4E7ZA 2XF6A 4RLFA 2IS4A 1MNEA 3SEZA 2DT6A 2KZVA 2HVSA 3L2RA 3VYSB 1MMDA 1BR2A 4ZDPA 3LFUA 4C2TA 2L7KA 3H9QA 4B44A 5FRMA 3CP2A 3L2VA 4RM3A 3KEYA 2LC2A 3MD2A 4FASD 4D9JA 4F52A 4KJZA 2KHMA 3PFYA 3A1YA 1OLTA 3HKZA 1TZLA 3H9GA 3OS1A 3EUKL 3OYIA 3CJQB 1OR7C 3PSFA 2GOXB 3NWTA 3V42A 2NOJB 4U7BA 4HEA2 3MKWB 2OUMA 3CF2A 4ZDOA 2MFZA 3OOUA 3OYCA 3HOTA 2VQLA 4HSRA 2W4SA 3BG6A 3PNVA 1X4PA 3VYUB 1WJFA 2VKHA 1VZ0A 4ZYAA 3RTRA 2L9NA 1QHGA 4R79A 2E1MC 3K70D 2A6TA 3MKYB 3DU5A 4XLFA 2E5ZA 2VJJA 2KRCA 1MMGA 4BXFA 2VLAA 4ZJZA 2BOLA 3GBGA 3NWSA 4BEHB 4CA0A 2LREA 3FKJA 3AFHA 2Q2EB 3ONQA 3OR2C 4II2A 3HC7A 3VSKA 2R7QA 3L2UA 3D5SC 2UUZA 2PJRB 2VJ5A 2ZXIA 4E4HA 2X51A 4B3XA 2KDOA 2X6WA 2ZSIB 2WAFA 3H5NA 4PK4A 2LRDA 4X0GA 2X85A 4B43A 2F5VA 4KT6A 3HPHA 3UNGC 2DXIA 4ZC3A 1V5GA 2Z2SB 1LKXA 2OV7A 3E0JB 3OYJA 2RQQA 4ZTJA 4C30A 2K9LA 4P1WA 4B47A 3S3MA 3IUOA 3BCBA 3BCAA 4E7SA 3MKZA 2IGOA 2PMZA 1IRXA 2IS6A 2LBFB 2X6YA 4OAYA 2V7FA 2XSJC 4AU7A 2R7TA 2Y0SA 3ZRGA 4E7JA 3A2KA 4CUGA 1HA8A 3H0DA 1DQUA 4BE2A 4CSWA 3A4CA 3LMMA 2IGMA 2ZXHA 3EPZA 4CCMA 2XDVA 4J01A 2WB1A 2HQAA 3OS0A 2M7BA 3PNYA 4C2UA 2WY7Q 3TL4X 2KMUA 1Z3XA 1WJCA 1R6RA 3C2GA 1P9QC 3LSKA 1MMAA 4NQWB 2LYCA 2UWMA 3CZ6A 4XLCA 4IKFA 3BC8A 4LG3A 1DGWY 3E1SA 2LH9A 4XOTA 3QYFA 4PJNA 4N4OB 3CMMA 3W2AA 3K4NA 3DKXA 4E7IA 2R7SA 2VASA 3HPGA 4J00A 1WJEA 4G6TB 3LSHA 2KRHA 4BGDA 3I3LA 2M0MA 3K70C 4RM2A 2AQEA 4BU2A 2IGKA 4E7KA 3I9V2 1PYVA 2R7UA 2M4GA 1WFXA 3IAM2 4BQOA 4BJ6C 3OYMA 1UAAA 3OL3A 2RREA 3VYRB 2R7WA 3QYBA 1TT0A 1D1AA 4CCJA 1D1CA 1PJRA 2O5RA 3IAS2 4F91B 1MW7A 2CFOA 1D1BA 2V4JC 2FUG2 3OIQA 4PJJA 4DGWB 3TBIA 2VB6A 1JI8A 2V1NA 2W00A 2AQFA 4F93B 1Y56A 2R7XA 3DTEA 4U87A 4XL9A 3PL8A 1EA3A 4CCLA 1X1DA 2JA2A 2VIXA 1SFKA 1X1CA 2VXDA 3ZXSA 3RPUD 4YELA 4XOPA 5FRNA 3EUAA 3C2HA 3OYFA 2JVHA 1KONA 1X4OA 5HNHA 4DBRA 1WJ5A 3EUHC 2W82A 3DPUA 2HVQA 4BL0B 2WAQA 3OYEA 4CZCA 4BE0A 4IQJA 4XR6A 3KX2A 3OYGA 2DT7B 5KNLA 2BW3A 4F3QA 3S93A 2I8DA 4CCKA 3K4BA 2ZFUA 3VDXA 4BE1A 2KPMA 2WA0A 3PUBA 2CUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY2 A;  2KZV A;  2KPM A;  3S93 A;  2LY1 A;  2LH9 A;  3RCO A; 
#chains in the Genus database with same CATH topology
 2YX7 A;  2BV6 A;  4JX4 A;  1N77 A;  1N75 A;  4HST A;  3H5A A;  1FP2 A;  4V2F A;  5IT3 A;  1VQK I;  2ZME A;  1K6Y A;  3D0S A;  3W2V A;  1REP C;  2MAB A;  3T0Y A;  2D2W A;  4HLY A;  1IV8 A;  5K1Y A;  3OIP A;  1P6R A;  2Z3Y A;  3DV8 A;  2CQX A;  5J1R A;  3K4L A;  3MAJ A;  2HOT A;  2NVQ J;  5DCM B;  2L9V A;  4P9F A;  3CF5 F;  4W1U A;  5J8F A;  1IN8 A;  2VL8 A;  3TW6 A;  5F1R A;  2ZNY A;  1P4X A;  3GTJ J;  2IJL A;  2VBZ A;  4IX7 A;  2LLK A;  4EVI A;  3OYD A;  3N05 A;  4IOC F;  4ETS A;  5B66 C;  4ZTF A;  2XIG A;  3V7R A;  3DQV C;  3BTJ A;  2NVX J;  1T98 A;  3I4M J;  1R22 A;  1FTT A;  3OOP A;  3PNT A;  2K3P A;  3ZMV A;  4XLE A;  3SZG A;  2MGQ A;  1YIT I;  1A36 A;  4P9U A;  2PJP A;  3OYA A;  1U6G A;  2IS2 A;  1JKQ C;  3RQI A;  2G0E A;  4YIR X;  4XLA A;  5LGT A;  1SAX A;  1K83 J;  1MBE A;  2V9P A;  3ABT A;  2IA1 A;  3WHB A;  3LA7 A;  5F04 A;  3OSF A;  4CH7 A;  4S0H B;  1MIJ A;  1X19 A;  1UB9 A;  3L2C A;  3PSI A;  3DEE A;  2IGN A;  1T6S A;  1E3H A;  1Z0X A;  2V9K A;  3VSL A;  2L9R A;  4ZYG A;  3G2B A;  1QHH D;  1B59 A;  1FTZ A;  1LJ9 A;  3DEU A;  1IN5 A;  1S6L A;  3BR2 A;  1Y1W J;  3ASO H;  3FM5 A;  4TV7 A;  3T8R A;  4CDG A;  1LVK A;  2ZNZ A;  3L2Q A;  4A3D J;  2BEO A;  1IXR C;  4BEH A;  1WGX A;  4Y13 A;  1X3Z B;  3IP4 B;  4XKC A;  1IXC A;  4DOZ A;  2FBK A;  5LGU A;  5DTD A;  1WJB A;  2GXB A;  2QCO A;  2F4M B;  1BR1 A;  3OMY A;  4XOR A;  2VJI A;  4BNC A;  2DMP A;  3LA3 A;  3HXL A;  5CQE A;  3LAP A;  2DK5 A;  4A3K J;  2DJN A;  4I09 A;  4DBQ A;  3ECO A;  2Q8K A;  3EQL F;  3K4J A;  2COB A;  3D5R C;  1OPC A;  2HI3 A;  1XC5 A;  3DWL E;  1Q1H A;  4XKV A;  2LKP A;  1Z7U A;  3OYK A;  3SHF A;  3G1O A;  3F21 A;  2LF7 A;  3CDI A;  4NUB A;  3F6O A;  3SYT A;  1XMA A;  3FXK A;  3GZN B;  1Z77 A;  3H0G J;  5DV5 A;  4ZH4 F;  5L3B A;  4KN4 X;  2Y0M A;  1GLN A;  3DEW A;  3OYL A;  2M8G X;  5FKK A;  1FMV A;  5DYM A;  3FDY A;  3IRR A;  5E18 F;  2WWY A;  2LY9 A;  2GOM A;  1BIB A;  2NS0 A;  1EV7 A;  3DFG A;  2JSP A;  1O7F A;  2P6S A;  5CVV A;  1SEU A;  2H09 A;  5FRO A;  2QYO A;  5JI6 A;  3V8K A;  1YS7 A;  3K2Z A;  4XQF A;  2NS8 A;  1T2K A;  2A05 A;  3LOC A;  4N4N B;  1SAU A;  1LFP A;  1VQM I;  2L01 A;  3F0C A;  5BPD A;  2LY2 A;  4Y17 A;  4KMU X;  1MKM A;  2K9S A;  4D5F A;  5J6X A;  1R1T A;  2V79 A;  3KPH A;  4MFE A;  5L3G A;  3ZR8 X;  4AIH A;  1F4K A;  2LTP A;  1JUS A;  2XAQ A;  2PBI A;  5FFX A;  2QM3 A;  5H6Q A;  2H8R A;  2WY8 Q;  3FXU A;  4HPQ A;  2XAJ A;  2E1M B;  2O9L A;  2K85 A;  1V5E A;  4LIV A;  1O7L A;  1I1G A;  2ELH A;  1FT9 A;  3JTH A;  3K4C A;  5J40 A;  1D0Y A;  1YW7 A;  5D8L B;  3G4S I;  2E5N A;  3AG3 H;  2CUJ A;  4M3G A;  2YR2 A;  4PDK A;  2LVS A;  4HF0 A;  2RNG A;  5K5Q A;  2DJI A;  4KIT B;  2BZT A;  1YX5 A;  1X3W B;  3BJA A;  4BHP A;  5EF6 A;  3OR1 C;  3NAR A;  4OMZ A;  4XSX F;  1KU2 A;  1MBJ A;  2QSF X;  2GLO A;  1IW7 F;  1PDN C;  4BQN A;  5TJJ A;  4L0Z B;  5ILS A;  2E35 A;  4XMY A;  4Y52 J;  1DGR M;  2L02 A;  4ITV A;  4B48 A;  4DIQ A;  4OIQ F;  1MBG A;  2HQN A;  2VPL A;  2G7U A;  4RMN A;  4IEJ A;  3QOE A;  5E3O A;  4OWR B;  5EDN A;  2DW4 A;  4YRV A;  1TTY A;  2FJ1 A;  4GCV A;  4RDU A;  4X6A J;  3MFK A;  1L0O C;  4Y7N J;  3HUG B;  3KP3 A;  4L5E A;  4EAT A;  3DTI A;  2ZB9 A;  3Q0V A;  3CLO A;  4AYB A;  5HLT A;  4HZF A;  3LSP A;  2DI3 A;  1U5T C;  3QYE A;  1V5F A;  1FIA A;  1HF0 A;  3PM1 A;  2XF6 A;  5FKL A;  1VQP I;  1R5I D;  1IUF A;  2COM A;  5FFZ A;  1FSH A;  3LFU A;  1EJ9 A;  4C2T A;  5A2Q K;  2XB5 A;  1TW2 A;  2R3S A;  1YW8 A;  2KIS A;  2Y30 A;  3BTL A;  1W0U A;  1PUF A;  2D1V A;  1JXS A;  2KHM A;  3NRV A;  3L09 A;  1KQ9 A;  2PQ8 A;  1TZL A;  1WI9 A;  3OYI A;  2LF8 A;  1T38 A;  1CF7 B;  3QP6 A;  3VOE A;  5BS6 A;  2GOX B;  5J1Y A;  5GTI C;  3J80 Z;  3E7L A;  2EIK H;  1SFX A;  4ZYH A;  3QU6 A;  5ED4 A;  2ZJ2 A;  3CF2 A;  3I59 B;  1B9N A;  3HOT A;  3R60 A;  4RAG A;  2QSG X;  4AIK A;  3ZQL A;  2BY1 A;  4CYD A;  4HSR A;  4DNC A;  3BG6 A;  3PNV A;  1X4P A;  2P5K A;  4EM2 A;  3F72 A;  3HGG A;  3BQY A;  5KAI C;  4R79 A;  2XGX A;  3K70 D;  3JRH A;  3HGY A;  2E5Z A;  3FF5 A;  1LNW A;  2ELK A;  3HRT A;  2VLA A;  4ZJZ A;  2KT0 A;  1BI3 A;  4CA0 A;  4RB0 A;  2EFW A;  3IWZ A;  3P9C A;  1XCV A;  2HR3 A;  2XVC A;  1TW3 A;  3GZ5 A;  3I54 A;  4DZP A;  3A01 B;  5LBQ A;  1FOY A;  3ONQ A;  3MZH A;  2Y2Z A;  1T08 B;  3A03 A;  2IRF G;  1RRJ A;  1B4A A;  3KEO A;  1IN4 A;  3JRB A;  2PJR B;  4E4H A;  1V3F A;  2ZME C;  4B3X A;  2DA6 A;  2W84 A;  3FWE A;  4C3H J;  1U9N A;  1XN7 A;  2E1O A;  3TP3 A;  2O3F A;  2I5U A;  2YU9 J;  3CUQ A;  2LRD A;  3KP4 A;  1SMY F;  2EH3 A;  2P81 A;  4B43 A;  4KT6 A;  4M73 A;  2PN6 A;  1LKX A;  5HDG A;  4I0B A;  4UVC A;  2DMT A;  3OYJ A;  2B7E A;  1FYM A;  4ZTJ A;  4QWQ A;  4HW0 A;  2K9L A;  1WSU A;  1DU0 A;  4E7S A;  1I50 J;  2IGO A;  2YUS A;  1DP7 P;  3K69 A;  4CGZ A;  2IS6 A;  1SD4 A;  2LBF B;  4OOI A;  3QPL A;  1TQI A;  2X6Y A;  4OAY A;  5H2F C;  4KT5 C;  2XAF A;  3ZRG A;  2A69 F;  2HS5 A;  1GT0 C;  2F5D A;  3DLL F;  4XRF A;  3ZPL A;  4UUV A;  2O8X A;  2R7Z J;  4M6Y A;  2H6B A;  1UHM A;  2IGM A;  3DXJ F;  2M9H A;  4UNO A;  2QEX I;  3MN2 A;  5CVJ A;  1MH4 A;  4WWC A;  3GFI A;  2M8E A;  1JKP C;  4O6J A;  4I01 A;  4RAZ A;  3FHZ A;  2FQ4 A;  5F27 A;  4BQA A;  2HKO A;  3LSK A;  4A2U A;  2FBI A;  2LP0 A;  2EZI A;  1T56 A;  1HDD C;  2DFE A;  4LG3 A;  2FA5 A;  3E1S A;  2FXA A;  2JTV A;  3QPH A;  4N4O B;  4ESJ A;  3GTO J;  3U9G A;  5HOD A;  1A6I A;  2R7S A;  4J00 A;  3C1D A;  1WJE A;  3GWZ A;  4UVA A;  4BGD A;  1LUJ B;  2M0M A;  4RBO A;  1S72 I;  2GBY A;  2BXZ A;  1SD5 A;  3BY6 A;  1Q1V A;  4HOB A;  2A3S A;  3CCM I;  5IYB J;  3M7G A;  1R5H A;  3GCM A;  2XAS A;  1OKR A;  4YFN F;  1WFX A;  5JLW A;  4MTD A;  2RRE A;  3HKZ N;  2L7Z A;  2HEO A;  2R7D A;  3QYB A;  3ROU A;  3N97 A;  2PFB A;  4LMY A;  5J47 A;  5HLH A;  3IAS 2;  3EET A;  1MW7 A;  4F91 B;  2CFO A;  1RES A;  2FUG 2;  3M3Y J;  2GIZ A;  4A3B J;  3F6V A;  2VB6 A;  4M9Z A;  4F93 B;  3BRO A;  1DPU A;  1XCB A;  3ZMS A;  2N8G A;  4PZJ A;  2VOO A;  2NNN A;  4XL9 A;  3F8M A;  1IC8 A;  2NVU B;  1FPQ A;  1X1D A;  1EH6 A;  4M74 A;  5LEJ A;  3UKG A;  2VIX A;  1AOY A;  2VXD A;  3CCE I;  1L3L A;  1ZYR F;  4YEL A;  2VT3 A;  4MGR A;  3BG3 A;  3J81 Z;  3I0T A;  1OIS A;  4IL6 C;  1UHS A;  2MH2 A;  1BA5 A;  1I5Z A;  2OZ6 A;  2W82 A;  1YIO A;  2GXA A;  1Y39 A;  1FYL A;  1HSJ A;  1MDM A;  3OYE A;  4M3D A;  4CZC A;  3HSF A;  4XR6 A;  3OYG A;  2DT7 B;  3H36 A;  4V2G A;  4FHT A;  5KNL A;  2OA4 A;  1Z1D A;  4MQV A;  4RB2 C;  3S93 A;  1JT0 A;  4CCK A;  2W57 A;  3K4B A;  1NK2 P;  3M1E A;  4HBL A;  1U8R A;  1IZ1 A;  2NYX A;  2QWW A;  3PUB A;  2CUZ A;  3G6E I;  1FMW A;  2BXY A;  3ZQC A;  1X1B A;  3CJT B;  3GVA A;  3RYR A;  2XKO A;  3KYL A;  3ULQ B;  3E5X A;  4C9Y A;  1QZE A;  3DKY A;  4FIS A;  2Z5U A;  4BJT A;  2XAH A;  3Q9S A;  3VFZ A;  1ETW A;  2C6Y A;  1S7O A;  4NNJ A;  3TO9 A;  5IY5 H;  3LAJ A;  3HTU A;  4Q4Z F;  1TL8 A;  2LOO A;  2X1C A;  1JE8 A;  1VQ5 I;  2JN6 A;  2HPM A;  2VOD A;  2EK5 A;  1B9M A;  1W5T A;  1YRN B;  4DYC A;  2Y0S N;  3D5L A;  3PFI A;  1R71 A;  4WX9 A;  1OCC H;  3GFL A;  1YO5 C;  1JTX A;  2RC4 A;  2LY1 A;  2BW3 B;  1HOM A;  2UZK A;  4HG2 A;  1YFH A;  1E3O C;  2WTE A;  4BHB A;  4G7H F;  2Z99 A;  2QQA A;  4EV0 A;  5CVI A;  2Z16 A;  2DQL A;  2QEN A;  3PO2 J;  4NC6 A;  4HNT A;  5EYR A;  4U0W A;  3FHN A;  2MYS A;  3L00 A;  5L3E A;  2DTR A;  1NG7 A;  4ZDL A;  4JQF A;  2F5C A;  2RDP A;  2VXZ A;  3DCF A;  3GLX A;  4ASN A;  5HOO A;  2GA1 A;  1MND A;  5E3N A;  3M8J A;  3K7A J;  2Z33 A;  5FGM A;  3OL4 A;  4N9H A;  4Q48 A;  2CJJ A;  2DFF A;  3CMY A;  2NXN B;  2E60 A;  4HRI A;  3CJN A;  4G6D A;  3K6G A;  4WXC A;  3FBI B;  2YPR A;  1R4N B;  4RS8 A;  4UY8 I;  1MGT A;  1LFB A;  4ON0 A;  5K5R A;  1Z9C A;  3G3Z A;  5CPR B;  3FXM A;  4HX8 A;  4PJL A;  4U7D A;  1W36 C;  3BZ6 A;  5LFA A;  3RCO A;  4LG0 B;  2IXS A;  4MQ9 F;  4LGW A;  4L0Y B;  2JSC A;  1XB4 A;  3VB2 A;  4DYQ A;  2K5C A;  2R7O A;  4E6K G;  1BC8 C;  1J0R A;  1Z7L A;  4BDZ A;  3K10 A;  3VOD A;  4FET A;  1O3Q A;  3PO3 J;  3WTS C;  4XON A;  3CME I;  1JT6 A;  5CLS A;  2CMP A;  3HSR A;  4XM3 A;  3WTY C;  2FML A;  3HBL A;  3S3N A;  4I7H A;  4HV5 A;  2Q2E A;  2R7R A;  4KNY A;  1OCR H;  5DS9 A;  1R23 A;  1W36 D;  1ZRE A;  5ERI A;  2LD5 A;  3O8G A;  1DU6 A;  2CG4 A;  2W85 A;  3RPU A;  2M3A A;  1M1E B;  2R4G A;  2OZU A;  4MHG A;  1I27 A;  4ZYE A;  1IO2 A;  2R5Z A;  1KU3 A;  5E20 A;  5K7H A;  3H1C A;  3MEX A;  1K4T A;  2DA1 A;  3BQZ A;  4LD5 A;  4XIC A;  1ETK A;  5E1W A;  3LWF A;  4E7L A;  1R58 A;  3KP7 A;  4LB6 B;  2DYR H;  2V1U A;  4F92 B;  2DPU A;  1WJA A;  4OAZ A;  1D5V A;  1Y0U A;  2Z9O A;  3OWT A;  2ZKZ A;  2IVM A;  1LPQ A;  1MBH A;  3HOS A;  1X3U A;  2BYV E;  3I5U A;  4YIF A;  2Y69 H;  2ZJP F;  1Y6I A;  1ZAR A;  4JBA A;  3I56 I;  1Z3Y A;  2W1O A;  3BJO A;  4UV8 A;  1RZ4 A;  3CUQ C;  3VWB A;  4XLH A;  1XGM A;  2M4K A;  2CGP A;  5BOX A;  4KIS A;  3EUH A;  3AL0 C;  3BPX A;  1WJD A;  1UJ8 A;  2M45 A;  3SEQ A;  2QKM B;  1HST A;  3HG9 A;  1ORK A;  2ECB A;  3IH4 A;  2MW8 A;  2L9S A;  1A6Q A;  2HZD A;  4Q47 A;  3CC2 I;  4GYG A;  2P6T A;  5GPA A;  5D5X B;  1GVJ A;  2BE5 F;  4AD9 A;  3S3O A;  3T5X A;  4M9S A;  4PFP A;  4I76 A;  2JUC A;  2LSO A;  3LSG A;  4PUS A;  4Q5S F;  2QKL B;  3KFW X;  3F8N A;  3MZY A;  3S8P A;  4KMF A;  1CQT A;  4IZZ A;  5BQT A;  2HOE A;  5JVG F;  4NQW A;  1ON1 A;  3F8B A;  3LSM A;  2L7M P;  2Q1Z B;  1FBS A;  1AA7 A;  3PQJ A;  4IXA A;  3RYP A;  1I1S A;  3HOU J;  2KIM A;  4NC8 A;  4CCO A;  4FTH A;  2QSH X;  1GXQ A;  3IC7 A;  3A02 A;  3I53 A;  2DTZ A;  1N25 A;  3IL2 A;  1IUY A;  3CES A;  3QU3 A;  2M5W A;  4JX5 A;  1E2X A;  1MD0 A;  2WV1 A;  1K79 A;  3BR6 A;  2DAO A;  3Q3S A;  4YII A;  3WE2 A;  2MC4 A;  2NVT J;  2CH0 A;  2ISY A;  1QZZ A;  2DDA A;  3FKI J;  3IH3 A;  3H3V K;  2MD0 A;  2VKV A;  1XGN A;  4YFX F;  2KQR A;  5L3F A;  3C7J A;  4YEJ A;  1O3S A;  4CYC A;  1DUX C;  3AKZ A;  5LD2 C;  1A31 A;  2EA4 A;  4ENN A;  3OYH A;  3P9I A;  3RI4 A;  3ZQQ A;  1ZGW A;  3DU6 A;  2NVY J;  3KYD B;  5KCM A;  1S5L C;  3TGN A;  1IRZ A;  3ZMT A;  2TRT A;  5E1Z B;  2DCE A;  3RQ4 A;  4BXX J;  4IHW A;  1U8B A;  3DPT A;  4LFU A;  5CQG A;  2KIF A;  5DUI A;  3QOD A;  3H35 A;  3LL7 A;  2XB0 X;  2XV4 S;  1UHW A;  3S2D J;  1BW5 A;  2IAI A;  4EJU A;  2KZV A;  1IJW C;  5FLM J;  4EEF G;  1R5G A;  2BY2 A;  3VYS B;  4I99 C;  1MMD A;  3R0J A;  4IRG A;  2K3F A;  1K78 B;  1RPW A;  3H9Q A;  4B44 A;  5FRM A;  3CP2 A;  4A12 A;  4RM3 A;  1A04 A;  3OSG A;  4LLL A;  5CYV A;  5LGN A;  4OU0 A;  2LC2 A;  4FAS D;  2GQQ A;  4KJZ A;  1EH7 A;  2R5Y A;  5D5V B;  2JA8 J;  4XRS A;  5ILV A;  4A3L J;  3HKZ A;  1TP4 A;  2X0L A;  3CJQ B;  2V1D A;  4WF2 A;  2HGC A;  3V42 A;  1XG1 A;  2IT0 A;  2VE9 A;  1YOV B;  2NOJ B;  4U7B A;  1WH5 A;  3CCL I;  3BTI A;  1JKO C;  4UUS A;  4ZDO A;  1GUU A;  1FWZ A;  1HKS A;  4QSH A;  1WJF A;  2ID6 A;  3J80 K;  3I55 I;  5EJC A;  2X4H A;  3RTR A;  5JLX A;  5E79 C;  2XAG A;  4K2E A;  4IHY A;  3MKY B;  3DU5 A;  2D45 A;  1JJ8 C;  4R8H A;  4C3I J;  2VJJ A;  1P7I A;  2G7H A;  3BR1 A;  1Z67 A;  2BOL A;  3FK6 A;  1PUF B;  5B5E C;  2K4J A;  4ESF A;  2P7C B;  1BIA A;  1NH3 A;  3DBH B;  4I98 B;  1H89 C;  3FKJ A;  5EG0 B;  1IAW A;  1S7A A;  2I10 A;  1APL C;  2AO9 A;  1X2N A;  4II2 A;  4MIM A;  5DCM A;  3FZV A;  3HC7 A;  5F0H A;  3CO6 C;  2R7Q A;  2JPC A;  3L2U A;  3D5S C;  2E36 A;  2UUZ A;  4G94 A;  4L9N A;  2OF7 A;  4PGH A;  4L18 B;  2HFH A;  2BY3 A;  2IW5 A;  1I3A A;  2ZXI A;  3GTL J;  1SAN A;  1FLI A;  2KDO A;  3MWM A;  2KKO A;  2ZSI B;  2WAF A;  4U88 A;  5F6F A;  1LDJ A;  2NRA C;  3H5N A;  5F08 A;  5D4R A;  2A68 F;  2CWE A;  5HLI A;  2F5V A;  1VTN C;  4M72 A;  1YHQ I;  2ZCW A;  1V5G A;  5IP6 A;  1SD7 A;  2Z2S B;  2OV7 A;  2RVC A;  2M0C A;  1FIP A;  2P4W A;  3KLN A;  4E70 A;  2CW0 F;  3MVP A;  3JCU C;  3HYI A;  1YTY A;  3IUO A;  1YI2 I;  5GP9 A;  4EM0 B;  2M34 A;  3C2B A;  3KIO A;  2DMU A;  2IA0 A;  5E17 F;  2XSJ C;  2Y0S A;  2DMN A;  3MCZ A;  3G1L A;  2ZFW A;  4CUG A;  1HA8 A;  4GO1 A;  2QF7 A;  2W24 A;  4HDU A;  3A4C A;  1P2F A;  2FQ3 A;  2OD5 A;  2R93 J;  2OQR A;  3LMM A;  2ZXH A;  1UST A;  4CCM A;  1UG2 A;  2XDV A;  5GAD J;  4IHV A;  1P4W A;  3NQO A;  3CO7 C;  1ETO A;  4C2U A;  3TL4 X;  2LKX A;  1T0F A;  2JZY A;  2MC3 A;  1WJC A;  3ISP A;  4D7M A;  5C4J J;  4XRS G;  4LK0 F;  2WB1 N;  1P9Q C;  1Z6R A;  2G9W A;  1BN5 A;  1YJN I;  4IRI A;  1R1V A;  2LYC A;  4RGX A;  4ZZL A;  2UWM A;  2LFB A;  5BNG A;  1ZAO A;  4EM1 A;  4IKF A;  3BC8 A;  1ZG1 A;  1ZGA A;  2VBX A;  2Y75 A;  4JX6 A;  2FNP A;  2LH9 A;  1G3T A;  1K7A A;  3S1R J;  3K4N A;  3M8E A;  2ZO4 A;  2KJB A;  3P9K A;  2CO5 A;  2VAS A;  3WTX C;  3CCJ I;  3TO6 A;  1IRF A;  3J7Z I;  2FOW A;  4G6T B;  2RV8 A;  3FK7 A;  3TO7 A;  3I3L A;  2F5F A;  2EPF A;  2PEX A;  4YG2 F;  3K70 C;  1AU7 A;  1TQP A;  1WI3 A;  4BU2 A;  2IGK A;  3I9V 2;  1PYV A;  4MTE A;  1HKQ A;  1SD6 A;  1IF1 A;  3S1M J;  3OYM A;  1UAA A;  3OL3 A;  3VYR B;  3SDG A;  2Y31 A;  4EJT A;  3RZO J;  3AAF A;  2H6C A;  3BTC A;  3E6B A;  1D1C A;  2O5R A;  1FX7 A;  2V4J C;  4P96 A;  1F5T A;  3I4N J;  2JRT A;  1JUP A;  1QA6 A;  4PCQ A;  1U2W A;  3P5J A;  5EEH A;  2M2E A;  2W00 A;  1G4D A;  4C3J J;  2VBW A;  4L5I A;  5FLX Z;  3JSO A;  2X6O A;  4U87 A;  3ML6 A;  3HSE A;  1SVO A;  2ETH A;  1BI1 A;  1EA3 A;  4CCL A;  3ZMD A;  4XID A;  3T8T A;  4GGG A;  1X1C A;  4UXN A;  3PIO F;  3FMS A;  3RPU D;  2FSW A;  3DBL B;  5F1J A;  3OYF A;  1FY7 A;  1X4O A;  4DBR A;  3GO5 A;  5BMZ A;  3M8F A;  3EUH C;  2HVQ A;  3CCU I;  4BL0 B;  3CCY A;  4NB5 A;  4B09 A;  4BY1 J;  1ONV A;  1B8I B;  2LKS A;  4BE0 A;  4IQJ A;  3O8H A;  3J81 K;  2XRL A;  1QQI A;  4RB3 C;  1ZRD A;  2HYG D;  3I64 A;  2JMW A;  1TWA J;  2I8D A;  2HTS A;  3DF8 A;  1ZLK A;  3WG9 A;  2KZG A;  2LDU A;  4BE1 A;  3QP5 A;  2KPM A;  2DA4 A;  3WGH A;  4C2M J;  1SFE A;  2LR8 A;  2DK8 A;  4KA4 A;  1XD7 A;  3ZGK A;  3ZCO A;  3LNQ A;  2VQC A;  2ELJ A;  5JFR A;  2CQN A;  2RAE A;  3TMO A;  3TDZ C;  2JT1 A;  2A61 A;  2BGC A;  1O3R A;  2R7F A;  1XDU A;  2R0Q C;  1ETQ A;  2QLZ A;  5LHH A;  1ITY A;  2DA2 A;  1S3J A;  1UFM A;  1A35 A;  2EFO A;  5TRD A;  1X1A A;  4LOC A;  2KFD A;  1YG2 A;  1C0W A;  1IDY A;  1QVT A;  3WTW C;  2J5P A;  3RSN A;  3HUG A;  2PMZ N;  4XK4 A;  4ABZ A;  1HKT A;  2L5Q A;  2HXI A;  4IHS A;  1P7J A;  1MDM B;  1B6A A;  3CC4 I;  4NC7 A;  1OMI A;  4RAY A;  4AWX B;  4HF1 A;  4A3M J;  2HOA A;  3K4K A;  3MKL A;  3BG7 A;  5EGO B;  1MJ9 A;  2ZBK A;  3K9T A;  2RNJ A;  3WTV C;  1K61 A;  2RKH A;  3FM3 A;  2BBY A;  3IKT A;  2GWR A;  2JUG A;  2M7A A;  5KK1 A;  4RGU A;  5E8G A;  3FMQ A;  3G1M A;  3S2W A;  1JHH A;  2KP6 A;  4HQM A;  1V55 H;  2WBM A;  3BDD A;  1G59 A;  2YS9 A;  4Y4R A;  3S14 J;  3FX3 A;  4F7Z A;  1ZGJ A;  3RPQ A;  2KJC A;  5CKT A;  3IWF A;  2E7W A;  4GYI A;  2MBF A;  2L3D A;  1AWC A;  1U0J A;  1CF7 A;  1P92 A;  3O2P E;  1K6O A;  3H5R A;  5H6R A;  3BJ6 A;  1YJW I;  2MG4 A;  4JOM A;  3ABU A;  1W5S A;  4BQQ A;  5KHD A;  3HOZ J;  2DOA A;  2HPI A;  3TKY A;  1HQC A;  3CMA I;  3I59 A;  5LHI A;  4BH9 A;  5FJ8 J;  3EYI A;  1KZH A;  4M3F A;  5D5W B;  5J4V A;  4IHT A;  3GXO A;  1FJL A;  2FF4 A;  4IVN A;  2GM4 A;  3CD6 I;  5IT9 Z;  2DU9 A;  4S05 A;  1E0E A;  1BJA A;  1KYZ A;  3A0H C;  1HW1 A;  4MEX F;  4PSX A;  2VJ4 A;  2F2E A;  1YYV A;  2IP2 A;  1G3S A;  4B1R A;  3QWL A;  3L2W A;  2WAE A;  1OCO H;  3ZP5 A;  2DFI A;  4PJ0 C;  3SFI A;  2P5L C;  1MNM C;  1OYW A;  2X1D A;  3L7W A;  4Y33 A;  5B3S H;  4OMY A;  4UV9 A;  1RUN A;  4OIO F;  5HNF A;  4RA2 A;  4BBS J;  4JYK A;  3A01 A;  2FNA A;  2BHY A;  1BOB A;  2DN0 A;  5AIQ A;  4PSW A;  3J7Y J;  5HS9 A;  2IPQ X;  1GVD A;  3V8L A;  4BJ5 C;  5IPA A;  4BUP A;  2QBY B;  1VQN I;  4XKB A;  1GXP A;  1I6H J;  2XC7 A;  3JTG A;  2CQK A;  2EA2 A;  1XMK A;  5FKM A;  3VYT B;  2PJR A;  4AVP A;  5DCF A;  2EB7 A;  1EH8 A;  4BXU A;  3F9K A;  2Z1D A;  2XHK A;  1ZH5 A;  1HBX G;  2VUM J;  1ZR4 A;  1R7J A;  1SFO J;  3Q9V A;  3AG2 H;  1K4S A;  3EYY A;  1U5T B;  2F4I A;  4A3I J;  5FD5 A;  2BY0 A;  5FO5 A;  2VC1 A;  4X1E A;  3GTK J;  5LRS A;  2HDW A;  1LEB A;  1PUE E;  5IOY A;  5F0C A;  3HOY J;  1JHF A;  3EDP A;  3LQQ A;  3LSR A;  1OQY A;  2K4B A;  3BT9 A;  5LEK A;  4DJA A;  1W7P A;  2K40 A;  3CJR B;  3S16 J;  3OY9 A;  2X1E A;  3WGI A;  2JVG A;  3U21 A;  2UV1 A;  2D1H A;  2DMQ A;  4KIB A;  3S32 A;  1R00 A;  2LBF A;  1JKR C;  2WAD A;  1D0X A;  2V6E A;  4XN3 A;  2JA7 J;  5HS8 A;  2D5V A;  2A5W A;  2H1K A;  4PFO A;  2AXL A;  5FKO A;  3F3X A;  1JGG A;  2L0K A;  3J7A O;  1T95 A;  3F8F A;  4IQ4 A;  2CV2 A;  2AXT C;  2CW8 A;  5IP7 J;  1WH7 A;  3HOW J;  1SVM A;  2DFH A;  4EQQ A;  4H4K C;  9ANT A;  1KA8 A;  1BI0 A;  1G8X A;  5GPC A;  1TLH B;  1TT5 B;  2B0L A;  3SDB A;  1T8I A;  4NBQ A;  1RNL A;  1FBU A;  2CS3 A;  5CVR A;  3JAM Z;  1H88 C;  1R4M B;  4GXO A;  3OYB A;  2DA5 A;  1U78 A;  4AVZ A;  4A5M A;  2E19 A;  2EZK A;  4A5N A;  2E2I J;  1X58 A;  5DD8 A;  3CCV I;  3DTK A;  1LQ1 A;  3BZK A;  3TQN A;  1MMN A;  1Y8Q B;  1YE9 A;  2K9M A;  4IOA F;  2ME6 A;  5M3M J;  1BI2 A;  4DW6 A;  3ABL H;  2X9D A;  3BOQ A;  2GXG A;  4M6X A;  1T0F C;  1I39 A;  2FX0 A;  1ULY A;  3LSI A;  3W6V A;  2EZL A;  3FXQ A;  3IV5 A;  1GV5 A;  2XRN A;  2HTJ A;  4BDY A;  3FBN B;  5GAG J;  2ZME B;  2K86 A;  1OCT C;  2VT2 A;  2BVM A;  3PQK A;  3FIW A;  3K1P A;  3U2R A;  3JSP A;  2F48 A;  4HNU A;  3B73 A;  1STZ A;  4HYE A;  5C4X J;  3TOB A;  3HOV J;  3SJM A;  6PAX A;  4A3G J;  1PVE A;  3CP8 A;  1SVL A;  1NK3 P;  3DPL C;  1ZN2 A;  2FD5 A;  4AIJ A;  1AKH A;  2XF7 A;  2X48 A;  1BR4 A;  3H3Z A;  2F6C A;  2DOD A;  4XKW A;  2BVL A;  4I0A A;  4HF2 A;  4GFB A;  2OBP A;  4P5O A;  1ZRF A;  4IO9 F;  1YW9 A;  4E7Z A;  1MNE A;  3SEZ A;  2DT6 A;  2W25 A;  1R36 A;  2H8W A;  1QNT A;  1VQ8 I;  2L7K A;  1XTA A;  1XPX A;  4L9T A;  4RGS A;  1G3W A;  4ENJ A;  2XGD A;  3QOP A;  1WKM A;  4ZYD A;  3MD2 A;  4N0B A;  3CLQ A;  1ACI A;  4D9J A;  4F52 A;  1D8K A;  5HS7 A;  1R49 A;  3A1Y A;  5AIP A;  1OLT A;  1XMX A;  3C18 A;  3SQN A;  1ZLJ A;  3OS1 A;  3EUK L;  2M87 A;  4FCY A;  3K1N A;  4J19 A;  2QQ8 A;  3NWT A;  2O7O A;  3WU1 B;  4EMS A;  1S7E A;  1HXD A;  1P4A A;  3FXO A;  5EZG A;  3R6S A;  3TW7 A;  4HEA 2;  3MKW B;  5BPI A;  1Z05 A;  3OOU A;  1YJ9 I;  2VQL A;  1ZG3 A;  1VQL I;  2KIQ A;  2VKH A;  4O3M A;  4IRH A;  2H27 A;  4ZYA A;  5M5X J;  4NHJ A;  2KIU A;  4A0X A;  2RGV A;  3U1K A;  2E1M C;  2A6T A;  2EIN H;  4XLF A;  3HEF A;  2DDB A;  1MMG A;  2K02 A;  2PX9 A;  4Z6Y A;  1V54 H;  3JRG A;  4BEH B;  2EIL H;  2LRE A;  3JRF A;  2E1C A;  1XSD A;  2R5Y B;  3REO A;  3CQZ J;  3AFH A;  1WRJ A;  3JRI A;  3JRC A;  2ZJQ F;  2IA2 A;  4A3J J;  2IBD A;  5D5U B;  4A3F J;  1KYW A;  1QPM A;  2DO7 A;  2E1N A;  1ON2 A;  2CQQ A;  2VJ5 A;  1HW2 A;  4LLG F;  2X51 A;  3LSJ A;  3QPS A;  1ZR2 A;  2X6W A;  4FT8 A;  3R4K A;  4A6D A;  3HRU A;  4FX0 A;  2Y48 A;  1YS6 A;  1H9T A;  4PK4 A;  4X0G A;  2FMY A;  4Z2Y A;  3ABK H;  3HB9 A;  4CHU A;  1UMQ A;  3UNG C;  2Y9Y A;  4ZC3 A;  2L4A A;  3CTA A;  4IHX A;  1UZC A;  3TED A;  3SZP A;  2GIV A;  2RQQ A;  1YIJ I;  2OU2 A;  5D6E A;  5B1B H;  4BYY A;  5ICF A;  4C30 A;  4P1W A;  3ERE D;  3S3M A;  3BCB A;  3MKZ A;  2PMZ A;  5K7F A;  2UXN A;  5LLQ A;  1IRX A;  2E7X A;  2GZW A;  2R7T A;  4AU7 A;  1HC8 A;  4E7J A;  2JJ7 A;  1IN6 A;  5D6F A;  4RGR A;  1RC9 A;  2EV6 A;  4W97 A;  4LG0 A;  1DQU A;  2DT5 A;  1JGS A;  2YU3 A;  1KU7 A;  1G3Y A;  4KUM A;  3BG5 A;  1DDN A;  1F1Z A;  3G73 A;  2HQA A;  5JHU A;  1PP8 F;  1TWH J;  2FU4 A;  2XGE A;  1VFC A;  2B63 J;  2R92 J;  3SZT A;  2K27 A;  1MZB A;  1R6R A;  1XS9 A;  3K1M A;  3BR0 A;  1BL0 A;  1W0T A;  1MMA A;  3SFZ A;  3CZ6 A;  2P5V A;  1U3E M;  3NEU A;  3P7N A;  1RR8 C;  1MBK A;  1O57 A;  2LMD A;  1B72 A;  3KCC A;  4XOT A;  4Y15 A;  1IV6 A;  3QYF A;  3TDU C;  4PJN A;  3CMM A;  3W2A A;  3MZ8 A;  1FYK A;  2GAU A;  3L9F A;  5DD4 A;  3HPG A;  3HRM A;  3KZZ A;  2F4O B;  2VOP A;  3LSH A;  4YFK F;  4XLN F;  4HNV A;  2XSD C;  2OPT A;  2ZJR F;  4XSZ F;  3D1N I;  4WXH A;  1LE8 A;  4E7K A;  3HHH A;  2RN7 A;  2XPU A;  1MSE C;  2R7U A;  2M4G A;  1OYI A;  3ERM A;  3E3V A;  3IAM 2;  5E1X A;  4S04 A;  4BJ6 C;  4G6Q A;  1S8N A;  2EWN A;  3IH2 A;  3V4G A;  3HJE A;  1AHD P;  4BKX A;  1D1A A;  1TT0 A;  4CCJ A;  2MLG A;  1BM9 A;  1PJR A;  3LFK A;  1HCR A;  3OIO A;  1TWC J;  3DBR B;  1J7K A;  2E2H J;  4HAM A;  4PJJ A;  2QGU A;  4FX4 A;  1JI8 A;  2V1N A;  1QVU A;  3X2Q H;  3H92 A;  4CIC A;  2EZH A;  4GDF A;  2OCE A;  1Y56 A;  4KFC A;  2R7X A;  4M6V A;  3KP5 A;  3LST A;  4EJW A;  1OR7 A;  5IYC J;  4CO8 A;  5DM7 F;  2VPR A;  5JR3 A;  5FKN A;  1FSE A;  4EJO A;  3E97 A;  3PL8 A;  4G7O F;  3WU0 A;  4FE7 A;  3S15 J;  3JR9 A;  2JA2 A;  3ZXS A;  4CXF A;  5FLX K;  5J1U A;  5D4S A;  4XOP A;  3G71 I;  3EUA A;  4N9I A;  2JVH A;  1ZQ3 P;  1KON A;  5HNH A;  3GTG J;  3LA2 A;  4MNU A;  5CVU A;  3DPU A;  1J2X A;  3JRA A;  3U1D A;  2O03 A;  4KIC A;  2PMH A;  5J4Y A;  5GTH C;  3IKV A;  3S2H J;  4DYR A;  3KZI C;  4F3Q A;  2VI6 A;  2ZFU A;  3DP7 A;  3VDX A;  2WA0 A;  2KRF A;  1RR7 A;  2WC2 A;  3FXL A;  1W7P D;  4KN7 X;  3NAU A;  1QZY A;  4A6E A;  1QO0 D;  4FE4 A;  2CSO A;  2ZSH B;  5CJ9 A;  2E34 A;  3HL2 A;  2K9Q A;  1QRY A;  3H3U A;  2W7N A;  2ZXJ A;  5C3E J;  1YQA A;  4IF4 A;  2QA4 I;  1TBX A;  3CDH A;  4LK1 F;  2CV1 A;  1FOW A;  4WCG A;  2F5E A;  1XDS A;  1TQM A;  1H0M A;  2MH9 A;  2KLO A;  2DPD A;  4F55 A;  4QPO A;  2O6G E;  1S9H A;  1ZKG A;  4BS9 A;  3F8C A;  4BY7 J;  1SC7 A;  1SMT A;  2TCT A;  3BR3 A;  2EIM H;  1Y0N A;  3GME A;  4MO7 A;  2VQG A;  3TP0 A;  2ME0 A;  3R0A A;  3CCR I;  2H94 A;  3RKW A;  1NG6 A;  1FZP B;  3CUQ B;  3FXJ A;  4QPQ A;  4A0Z A;  1KGS A;  4G7Z F;  1K78 A;  5GAE J;  4JP0 A;  1QBJ A;  2CFX A;  2ICW G;  3KP6 A;  5J3L A;  3RKQ A;  2HKX A;  2NS7 A;  2XAU A;  3AL0 B;  5H20 A;  1RET A;  3H9J A;  2XGC A;  4HX4 A;  2VBY A;  2XRO A;  4BAC A;  5HVQ C;  1J75 A;  2L54 A;  2FBH A;  2HDD A;  1LFU P;  1ZHF A;  1OJL A;  3DLA A;  2FOK A;  4Y3O A;  2PG4 A;  1LVA A;  2HQ5 A;  1LDK B;  4LJZ F;  3BWG A;  1XSX A;  1ZEL A;  2A5Y B;  4HA8 A;  1JJ6 C;  3BZC A;  3E5U A;  3BG9 A;  3HIF A;  3JRE A;  1WZ2 A;  1N78 A;  2LNB A;  3KET A;  2PMU A;  5JVT A;  1H8A C;  4KDP A;  2MD5 A;  2X6X A;  3QQA A;  3GTP J;  4U0V A;  1NHA A;  1UG0 A;  4XNF A;  2V9V A;  3RJP A;  1BOA A;  4AM3 A;  1YLF A;  2JPB A;  3W2W A;  1O3T A;  2L4M A;  2VN2 A;  3GYH X;  2STW A;  4OIP F;  2EQR A;  2EBI A;  5LHG A;  1WCM J;  5FLV A;  2DOE A;  3QRF F;  4L9V A;  4RLQ A;  5L3D A;  3OS2 A;  3J7A Y;  2TDX A;  3OYN A;  1TWF J;  1D0Z A;  5HDN A;  4G9Y A;  4DZJ A;  4IJA A;  5IT9 K;  2HWV A;  2ADU A;  1ZTR A;  5JHF A;  4GRI A;  3UR3 C;  3A0B C;  4D0P A;  5EG0 A;  2JA6 J;  4M3E A;  5E3M A;  2HVR A;  1F9N A;  2NOG A;  3O6B B;  3QAH A;  2GA2 A;  1MSF C;  3BP8 A;  1J59 A;  4MLO A;  2DYS H;  2OJE D;  3I4P A;  3V8J A;  2R7V A;  2P0W A;  3B6C A;  1X1P A;  1G6N A;  2A07 F;  1VQ6 I;  4ESB A;  3GF2 A;  4KIG A;  5DDG A;  2STT A;  4OIR F;  4XN0 A;  2AS5 F;  2IEK A;  4UHT A;  3W6K B;  1MMS A;  1ETV A;  3S1N J;  3CCS I;  2OC6 A;  1HLV A;  1EKE A;  2O8K A;  3KYC B;  3GZ6 A;  1T33 A;  1PP7 U;  2ID3 A;  2E71 A;  2QZ8 A;  3ZQF A;  2VKE A;  2VQH A;  2ZC2 A;  4G8X A;  2JRM A;  4M71 A;  4QLC U;  3ECH A;  3CUO A;  2V26 A;  4MEY F;  2WAQ N;  3DKW A;  2OTL I;  1J9I A;  4NDL A;  4I6Z A;  3FXR A;  3ZN0 A;  1F43 A;  2HXO A;  3RIR A;  4UUT A;  4KYW A;  1XSV A;  2OQG A;  4RAF A;  1IGN A;  3F23 A;  2EFN A;  3B6A A;  4E7H A;  2KL4 A;  3V7S A;  3W6J B;  1UEL B;  2HZT A;  5C44 J;  2FRH A;  3AG4 H;  3HOX J;  1S29 A;  3M1C A;  2JA5 J;  4LIT A;  2HQR A;  2XF5 A;  4B8X A;  2MSY A;  1TC3 C;  2EJR A;  3PJR A;  1F36 A;  3MMY B;  1FOX A;  2CV0 A;  3CDL A;  4HQE A;  3E5Q A;  1ERD A;  5KAF C;  5FB2 A;  2HU9 A;  2V1X A;  3JAM K;  2CRG A;  4ANJ A;  1W7P B;  4WXD A;  1H9G A;  1MJB A;  1J09 A;  4XLP F;  2BHZ A;  2CUE A;  2ISZ A;  2VKD A;  2CW7 A;  5KVR A;  4LIU A;  5DUK A;  4PJM A;  2UXX A;  3W3C A;  1XX5 A;  2QUF A;  1QU3 A;  3SXY A;  1WQ2 A;  3ABM H;  4D1Q A;  4G12 A;  1LB2 A;  1YX3 A;  5GAH J;  1FP1 D;  1WHU A;  4B4C A;  2V6C A;  5B1A H;  1MBF A;  5F0F A;  4BAY A;  2FEZ A;  1EF4 A;  5EZH A;  3S1Q J;  3RDI A;  2DOF A;  1ZK8 A;  1WPK A;  2ZXW H;  3HHG A;  4I2O A;  3RZD J;  1Y8R B;  5E3L A;  5ILU A;  2PI0 A;  4CCN A;  5J8C A;  1KU9 A;  2IS1 A;  5M3F J;  2LG4 A;  4II3 A;  2L2O A;  5TGT A;  3RKY A;  3HTS B;  1D8J A;  1DP3 A;  1QPI A;  1DPR A;  4ENM A;  1VQ7 I;  1OFC X;  2HNH A;  1Z21 A;  3K4M A;  2M1B A;  5DEQ A;  3VPR A;  3GFJ A;  2OCC H;  5TIS C;  3BLY A;  4H0E A;  2YSR A;  5A2Q Z;  4ENK A;  3OV8 A;  1RUO A;  3WE3 A;  2IS4 A;  5EEG A;  4RLF A;  1SFU A;  1KQ8 A;  2MLK A;  1HDP A;  1XGS A;  4AID A;  2HVS A;  2DBB A;  3L2R A;  1G2H A;  3ASN H;  1BJZ A;  1CGP A;  1BR2 A;  1GHC A;  2EIJ H;  1B1B A;  3ESW B;  4ZDP A;  4AC0 A;  1GV2 A;  2O0Y A;  2WV0 A;  3L2V A;  1D3Y A;  5IOZ A;  4CZZ A;  3KEY A;  2DLL A;  2AHQ A;  3PFY A;  5K5O A;  1TNS A;  1HW5 A;  2H1L A;  3H9G A;  2RQP A;  2ACJ A;  2EV5 A;  1OR7 C;  3ZMU A;  3PSF A;  1IG7 A;  1ETY A;  4JK1 X;  3Q0U A;  4M3B A;  3VEP A;  4RB1 A;  1B8I A;  2MA3 A;  3WOD F;  3M07 A;  2OUM A;  1OCP A;  4XRM A;  1ODD A;  2MFZ A;  1ZRC A;  3OYC A;  1QGP A;  1AKH B;  1RIO H;  3E6M A;  2W4S A;  3CCQ I;  2VE8 A;  3VYU B;  3HZJ A;  3WGG A;  4D7N A;  4A69 C;  1GDT A;  1VZ0 A;  2P8T A;  2EFP A;  3GFM A;  4UB6 C;  4P55 A;  2L9N A;  1RKT A;  1QHG A;  2DA3 A;  4A3E J;  1X2M A;  3GTM J;  2QVO A;  4HLX A;  4BXF A;  2KRC A;  1LDD A;  1TWG J;  3GBG A;  1VQO I;  3NWS A;  1Y1V J;  5M5W J;  3N4M A;  4IPA A;  3JRD A;  3ZQ7 A;  2FE3 A;  3I71 A;  2HYF A;  1IN7 A;  1I6X A;  2Q2E B;  1E3P A;  3OR2 C;  3RKX A;  1FEX A;  4HV6 A;  3Q0W A;  3I58 A;  3VSK A;  2HDC A;  3ZQI A;  3COA C;  5HDK A;  4HDV A;  2JK3 A;  1E17 A;  2EFQ A;  3K2A A;  3KEQ A;  3R61 A;  4U0Y A;  2R5Z B;  1IRG A;  2NAZ A;  3GTQ J;  5EGO A;  3HDD A;  3JW4 A;  3KLO A;  2W48 A;  1VQ9 I;  2KDZ A;  2X85 A;  2ESH A;  5IP9 J;  1WWX A;  1Z6T A;  2L7F P;  3HPH A;  2DXI A;  1MH3 A;  3CC7 I;  1VND A;  3E0J B;  4I02 A;  3V7C A;  3WG7 H;  1ZG5 A;  1W4M A;  2ESN A;  4LLN A;  1V4R A;  4A93 J;  4M9X A;  4B3A A;  3L1P A;  4B47 A;  5IYD J;  4A0Y A;  3ELK A;  3ZQG A;  1FNN A;  1KQ0 A;  3BCA A;  1I3Q J;  2P7V B;  5D8K B;  2XPV A;  1FOK A;  1W5C C;  3FMR A;  1USS A;  4XBF A;  3KZY A;  4BHC A;  5E8I A;  2V7F A;  3A2K A;  2XPW A;  2A6E F;  1T39 A;  3F22 A;  3ZOB A;  3FIS A;  2VON A;  5K7Z A;  3WTU C;  2Y9Z A;  3GEZ A;  3H0D A;  2DQR A;  4BE2 A;  1ETX A;  1VQ4 I;  1A5J A;  4CSW A;  5LRR A;  1BBY A;  2YX4 A;  3EPZ A;  2EV0 A;  4J01 A;  4L5J A;  3GUD A;  1FBQ A;  2WB1 A;  3OS0 A;  2M7B A;  3PNY A;  1J5Y A;  1TNT A;  2WY7 Q;  2KMU A;  4OIN F;  3BR5 A;  1Z3X A;  2Q0O A;  3C3W A;  3C2G A;  1IXS B;  4L9J A;  2JQ7 A;  3TOA A;  4NQW B;  5EEA A;  3MQ0 A;  3KP2 A;  2CUF A;  4XLC A;  4PGG A;  4O5V A;  1FC3 A;  3LQR A;  1DGW Y;  4MFD A;  4AYB N;  1R1U A;  2QBY A;  2K7L A;  2QQ9 A;  2LK2 A;  4HX7 A;  3DKX A;  3PIP F;  5L3C A;  1JTY A;  2OAZ A;  1WVR A;  3ZN1 A;  4ZZD A;  4E7I A;  1Z91 A;  2CQ7 A;  4UVB A;  4D5C A;  4EJV A;  2PLY A;  1D5Y A;  2KRH A;  2A6H F;  4WK8 F;  3HM5 A;  4RM2 A;  3WTZ A;  5M5Y J;  2AQE A;  3WTT C;  1U5T A;  3O3K A;  1BW6 A;  1OYY A;  4CYC B;  2XKP A;  3KE2 A;  3WU2 C;  5FD6 A;  3AG1 H;  3M4O J;  4BQO A;  4QIW N;  3BPV A;  4FQG A;  3Q5F A;  3S17 J;  2R7W A;  5ICC A;  3T1B A;  1ENH A;  3ZMZ A;  2DA7 A;  1VF9 A;  5DM6 F;  1U9O A;  1D1B A;  2HYJ A;  4KIF A;  4R1H A;  3OIQ A;  2QQB A;  4DGW B;  1RKW A;  3TBI A;  1VI0 A;  2B9S A;  2CYY A;  4EGZ A;  1POG A;  2AQF A;  3HRS A;  4V19 K;  3DTE A;  2OTJ I;  1XGO A;  3ZQH A;  1JUM A;  4BBR J;  2NNY A;  1B72 B;  5ICE A;  2E2J J;  3GLL A;  1OCZ H;  4QTR A;  2VC0 A;  4AUX A;  3E6C C;  4LB5 A;  1UCR A;  1SFK A;  1RI7 A;  5FRN A;  1MJA A;  3WHC A;  5HLG A;  3QPT A;  3C2H A;  1IDZ A;  1LE8 B;  3B02 A;  3GX4 X;  2K9N A;  1WJ5 A;  3IRQ A;  2O61 A;  3M9A A;  3K0L A;  1YRN A;  2WAQ A;  5F64 A;  1O4X A;  3GW2 A;  1BC7 C;  1NTC A;  2JWT A;  3KX2 A;  3PUF A;  4UUS B;  2BW3 A;  2HOS A;  4UB8 C;  4EGY A;  2ECC A;  2M30 A;  1R9T J;  2CU7 A;  2XUB A;  5ICG A;  4DQ2 A;  4A3C J;  3E6D A;  1W1W E;  2J5O A;  3IHU A;  5AON A;  1LEA A; 
#chains in the Genus database with same CATH homology
 3ZGK A;  3ZCO A;  2VQC A;  2ELJ A;  1FMW A;  1N77 A;  1X1B A;  1N75 A;  4HST A;  3TMO A;  3H5A A;  2ZSH B;  3KYL A;  3HL2 A;  1K6Y A;  2W7N A;  3W2V A;  2MAB A;  4C9Y A;  3DKY A;  2CV1 A;  3OIP A;  4BJT A;  1X1A A;  3K4L A;  2KLO A;  4NNJ A;  4F55 A;  3RSN A;  4QPO A;  2LOO A;  1S9H A;  2X1C A;  4BS9 A;  2HPM A;  2L5Q A;  2VL8 A;  4NC7 A;  4IX7 A;  3D5L A;  2VQG A;  3OYD A;  3N05 A;  2LY1 A;  2BW3 B;  3K4K A;  3BG7 A;  4ZTF A;  1NG6 A;  3DQV C;  4HG2 A;  4QPQ A;  2Z16 A;  3PNT A;  2JUG A;  2K3P A;  2M7A A;  2XAU A;  4XLE A;  3SZG A;  4HNT A;  3FHN A;  2MYS A;  3AL0 B;  2KP6 A;  3H9J A;  2WBM A;  1G59 A;  1NG7 A;  4BAC A;  5HVQ C;  4ZDL A;  3OYA A;  4Y4R A;  4JQF A;  5HOO A;  2VXZ A;  2IS2 A;  3DLA A;  1MND A;  4Y3O A;  3M8J A;  4XLA A;  5CKT A;  3OL4 A;  1U0J A;  1LDK B;  2E60 A;  1ZEL A;  3H5R A;  4HRI A;  3K6G A;  4JOM A;  3FBI B;  4CH7 A;  1X19 A;  4BQQ A;  5KHD A;  1N78 A;  2DOA A;  3PSI A;  2HPI A;  3DEE A;  5CPR B;  2IGN A;  2X6X A;  4PJL A;  1W36 C;  2V9K A;  3VSL A;  5LFA A;  3RCO A;  2IXS A;  1QHH D;  3G2B A;  1UG0 A;  4XNF A;  2K5C A;  2R7O A;  4E6K G;  3W2W A;  1Z7L A;  4BDZ A;  3K10 A;  1E0E A;  4FET A;  4PSX A;  2VJ4 A;  1LVK A;  4RLQ A;  4XON A;  3OS2 A;  3J7A Y;  3OYN A;  3L2W A;  2WAE A;  1D0Z A;  3L2Q A;  2CMP A;  4BEH A;  2X1D A;  4Y33 A;  3IP4 B;  4XKC A;  4XM3 A;  4DOZ A;  5JHF A;  4GRI A;  1WJB A;  3UR3 C;  5HNF A;  1BR1 A;  3OMY A;  3S3N A;  4XOR A;  2R7R A;  2VJI A;  1BOB A;  2HVR A;  4PSW A;  1W36 D;  4BJ5 C;  3HXL A;  5CQE A;  4BUP A;  4MLO A;  4XKB A;  2M3A A;  2XC7 A;  2PJR A;  2R4G A;  4DBQ A;  2P0W A;  3VYT B;  2R7V A;  3K4J A;  3D5R C;  3DWL E;  3F9K A;  2Z1D A;  4XKV A;  4E7L A;  3OYK A;  4XN0 A;  2F4I A;  4F92 B;  1WJA A;  4OAZ A;  4NUB A;  2OC6 A;  3SYT A;  2HDW A;  3OWT A;  2VQH A;  1GLN A;  3OYL A;  3HOS A;  1FMV A;  3FDY A;  2V26 A;  2GOM A;  1Y6I A;  4DJA A;  2JSP A;  3CJR B;  1Z3Y A;  2W1O A;  3OY9 A;  2X1E A;  2JVG A;  5FRO A;  2UV1 A;  3U21 A;  4XQF A;  3VWB A;  4XLH A;  3S32 A;  2M4K A;  2LBF A;  2WAD A;  1D0X A;  4N4N B;  1SAU A;  1LFP A;  4XN3 A;  2V6E A;  4KIS A;  3AL0 C;  2A5W A;  1WJD A;  4PFO A;  2LY2 A;  1T95 A;  3SEQ A;  2QKM B;  4IQ4 A;  2KL4 A;  3HG9 A;  2CW8 A;  4E7H A;  2CV2 A;  1UEL B;  4H4K C;  2L9S A;  2HZD A;  1G8X A;  3M1C A;  4LIT A;  3ZR8 X;  3SDB A;  2XF5 A;  2CS3 A;  3S3O A;  4PFP A;  3PJR A;  2WY8 Q;  4HPQ A;  3LSG A;  4PUS A;  2E1M B;  2QKL B;  3OYB A;  3S8P A;  3MMY B;  4IZZ A;  2CV0 A;  4AVZ A;  1V5E A;  4LIV A;  3LSM A;  2Q1Z B;  3K4C A;  1D0Y A;  1ERD A;  1AA7 A;  2HU9 A;  3DTK A;  4NC8 A;  4CCO A;  2E5N A;  4ANJ A;  1MMN A;  1YE9 A;  2CUJ A;  1J09 A;  2K9M A;  2VKD A;  2CW7 A;  3CES A;  4LIU A;  2RNG A;  4PJM A;  2DJI A;  1T0F C;  3W3C A;  4KIT B;  1YX5 A;  1QU3 A;  4D1Q A;  2MC4 A;  3OR1 C;  3LSI A;  1YX3 A;  2CH0 A;  4BDY A;  4BQN A;  3FBN B;  2MD0 A;  4XMY A;  1DGR M;  2KQR A;  2BVM A;  4ITV A;  4YEJ A;  4B48 A;  4DIQ A;  4HNU A;  2VPL A;  4RMN A;  3AKZ A;  3QOE A;  4CCN A;  4OWR B;  5LD2 C;  3OYH A;  2IS1 A;  3ZQQ A;  4YRV A;  3DU6 A;  2LG4 A;  5KCM A;  4II3 A;  2L2O A;  5TGT A;  3CP8 A;  1DP3 A;  3RQ4 A;  2DCE A;  3DPL C;  3HUG B;  4EAT A;  3DPT A;  3K4M A;  2HNH A;  1Z21 A;  5CQG A;  2XF7 A;  3DTI A;  4AYB A;  5HLT A;  1BR4 A;  3BLY A;  3QOD A;  2F6C A;  3H35 A;  3LL7 A;  4XKW A;  2BVL A;  3QYE A;  4P5O A;  1V5F A;  4E7Z A;  2XF6 A;  4RLF A;  2IS4 A;  1MNE A;  3SEZ A;  2DT6 A;  2KZV A;  2HVS A;  3L2R A;  3VYS B;  1MMD A;  1BR2 A;  4ZDP A;  3LFU A;  4C2T A;  2L7K A;  3H9Q A;  4B44 A;  5FRM A;  3CP2 A;  3L2V A;  4RM3 A;  3KEY A;  2LC2 A;  3MD2 A;  4FAS D;  4D9J A;  4F52 A;  4KJZ A;  2KHM A;  3PFY A;  3A1Y A;  1OLT A;  3HKZ A;  1TZL A;  3H9G A;  3OS1 A;  3EUK L;  3OYI A;  3CJQ B;  1OR7 C;  3PSF A;  2GOX B;  3NWT A;  3V42 A;  2NOJ B;  4U7B A;  4HEA 2;  3MKW B;  2OUM A;  3CF2 A;  4ZDO A;  2MFZ A;  3OOU A;  3OYC A;  3HOT A;  2VQL A;  4HSR A;  2W4S A;  3BG6 A;  3PNV A;  1X4P A;  3VYU B;  1WJF A;  2VKH A;  1VZ0 A;  4ZYA A;  3RTR A;  2L9N A;  1QHG A;  4R79 A;  2E1M C;  3K70 D;  2A6T A;  3MKY B;  3DU5 A;  4XLF A;  2E5Z A;  2VJJ A;  2KRC A;  1MMG A;  4BXF A;  2VLA A;  4ZJZ A;  2BOL A;  3GBG A;  3NWS A;  4BEH B;  4CA0 A;  2LRE A;  3FKJ A;  3AFH A;  2Q2E B;  3ONQ A;  3OR2 C;  4II2 A;  3HC7 A;  3VSK A;  2R7Q A;  3L2U A;  3D5S C;  2UUZ A;  2PJR B;  2VJ5 A;  2ZXI A;  4E4H A;  2X51 A;  4B3X A;  2KDO A;  2X6W A;  2ZSI B;  2WAF A;  3H5N A;  4PK4 A;  2LRD A;  4X0G A;  2X85 A;  4B43 A;  2F5V A;  4KT6 A;  3HPH A;  3UNG C;  2DXI A;  4ZC3 A;  1V5G A;  2Z2S B;  1LKX A;  2OV7 A;  3E0J B;  3OYJ A;  2RQQ A;  4ZTJ A;  4C30 A;  2K9L A;  4P1W A;  4B47 A;  3S3M A;  3IUO A;  3BCB A;  3BCA A;  4E7S A;  3MKZ A;  2IGO A;  2PMZ A;  1IRX A;  2IS6 A;  2LBF B;  2X6Y A;  4OAY A;  2V7F A;  2XSJ C;  4AU7 A;  2R7T A;  2Y0S A;  3ZRG A;  4E7J A;  3A2K A;  4CUG A;  1HA8 A;  3H0D A;  1DQU A;  4BE2 A;  4CSW A;  3A4C A;  3LMM A;  2IGM A;  2ZXH A;  3EPZ A;  4CCM A;  2XDV A;  4J01 A;  2WB1 A;  2HQA A;  3OS0 A;  2M7B A;  3PNY A;  4C2U A;  2WY7 Q;  3TL4 X;  2KMU A;  1Z3X A;  1WJC A;  1R6R A;  3C2G A;  1P9Q C;  3LSK A;  1MMA A;  4NQW B;  2LYC A;  2UWM A;  3CZ6 A;  4XLC A;  4IKF A;  3BC8 A;  4LG3 A;  1DGW Y;  3E1S A;  2LH9 A;  4XOT A;  3QYF A;  4PJN A;  4N4O B;  3CMM A;  3W2A A;  3K4N A;  3DKX A;  4E7I A;  2R7S A;  2VAS A;  3HPG A;  4J00 A;  1WJE A;  4G6T B;  3LSH A;  2KRH A;  4BGD A;  3I3L A;  2M0M A;  3K70 C;  4RM2 A;  2AQE A;  4BU2 A;  2IGK A;  4E7K A;  3I9V 2;  1PYV A;  2R7U A;  2M4G A;  1WFX A;  3IAM 2;  4BQO A;  4BJ6 C;  3OYM A;  1UAA A;  3OL3 A;  2RRE A;  3VYR B;  2R7W A;  3QYB A;  1TT0 A;  1D1A A;  4CCJ A;  1D1C A;  1PJR A;  2O5R A;  3IAS 2;  4F91 B;  1MW7 A;  2CFO A;  1D1B A;  2V4J C;  2FUG 2;  3OIQ A;  4PJJ A;  4DGW B;  3TBI A;  2VB6 A;  1JI8 A;  2V1N A;  2W00 A;  2AQF A;  4F93 B;  1Y56 A;  2R7X A;  3DTE A;  4U87 A;  4XL9 A;  3PL8 A;  1EA3 A;  4CCL A;  1X1D A;  2JA2 A;  2VIX A;  1SFK A;  1X1C A;  2VXD A;  3ZXS A;  3RPU D;  4YEL A;  4XOP A;  5FRN A;  3EUA A;  3C2H A;  3OYF A;  2JVH A;  1KON A;  1X4O A;  5HNH A;  4DBR A;  1WJ5 A;  3EUH C;  2W82 A;  3DPU A;  2HVQ A;  4BL0 B;  2WAQ A;  3OYE A;  4CZC A;  4BE0 A;  4IQJ A;  4XR6 A;  3KX2 A;  3OYG A;  2DT7 B;  5KNL A;  2BW3 A;  4F3Q A;  3S93 A;  2I8D A;  4CCK A;  3K4B A;  2ZFU A;  3VDX A;  4BE1 A;  2KPM A;  2WA0 A;  3PUB A;  2CUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...