2LH9A

Nmr structure of the first lotus domain of tudor domain-containing protein 7
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
b'GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor domain-containing protein 7
publication title NMR structure of Tudor domain-containing protein 7
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lh9A00
2KZVA 2KPMA 2LY1A 3RCOA 2LH9A 2LY2A 3S93A
chains in the Genus database with same CATH superfamily
2DFIA 2D45A 2A6EF 3A02A 3CLOA 2XPWA 1WJDA 2O0YA 1JKOC 3FXLA 1WJ5A 3IHUA 1WQ2A 3I3LA 2ZMEC 3C2BA 1FMVA 4KITB 4KT5C 4XOTA 2KZGA 4NC7A 2QYOA 4F55A 4I6ZA 1SMTA 1UB9A 2VUMJ 2Y0SA 5JVTA 2IA2A 4BUPA 2QA4I 1ZG1A 2XGEA 2CH0A 3REOA 3H9GA 3ZMTA 3OOUA 1TLHB 1VNDA 2M4KA 2B9SA 4M9ZA 2EV0A 5EJCA 1N77A 3MCZA 4I76A 1SFKA 5C44J 3WGGA 4XRSG 2AXLA 3I4MJ 4EM2A 4RLQA 5EDNA 2Q1ZB 3PUBA 1BI1A 3V8JA 3OYLA 1C0WA 4M9SA 5EEGA 4EGZA 1YW8A 3HGGA 4HV6A 1ITYA 1K6YA 3TDZC 2QQBA 1JUMA 1MBGA 2MD0A 2VJ5A 4BXFA 1BOBA 1HSJA 1VQKI 2KRFA 2GLOA 3A4CA 1IF1A 5ERIA 1AOYA 4LGWA 4ZTFA 2O8KA 4E7SA 5HDGA 3L2RA 4XKVA 1QPIA 3BT9A 3S1MJ 2E34A 2DMQA 2XAHA 2DT7B 3E5UA 2ETHA 4UB8C 1LE8B 2OQRA 4OWRB 2B7EA 4XSZF 1XC5A 2HR3A 4N9HA 4JX5A 4BKXA 4A0ZA 5EEAA 1BW5A 4HV5A 4Y33A 3H3ZA 3DEWA 4YFNF 4LG0A 1D8JA 2M45A 3O2PE 3I64A 4PGHA 2BEOA 4AVPA 1ZGWA 3GBGA 3L9FA 4BBSJ 3I0TA 5FRNA 3HRTA 4NB5A 4QWQA 3FZVA 4UVBA 2D5VA 4IRGA 4ZYEA 3ELKA 1REPC 2CV2A 4LLLA 3E0JB 1NK2P 4OAZA 5KHDA 3O6BB 2L02A 5DCMB 3RYRA 2Q2EA 5E3MA 3V7RA 1V4RA 2BBYA 3T5XA 1E17A 1Z7UA 5CQEA 2QENA 1ZREA 3QYFA 3PSFA 2QWWA 1OCRH 1SD7A 1GDTA 5D5XB 1FSHA 1ZRCA 5TGTA 4A5NA 3LSPA 1QVUA 4Y52J 3M4OJ 4ZZLA 1HSTA 2A69F 4ITVA 1PP7U 2B0LA 4ZYDA 1X58A 3V8LA 1HLVA 1RR7A 4AWXB 1FIPA 3LQQA 2EFQA 2P6TA 2PMHA 5IOZA 3W3CA 2F5FA 2DA3A 1X19A 2R7OA 3ZN0A 1KQ0A 4IRIA 3VWBA 2WAQN 3HOTA 2WWYA 3K4JA 3LFUA 5EF6A 3PSIA 1W36C 4OAYA 3ASOH 4BEHA 2V7FA 2YX4A 1J0RA 4A6EA 3MKWB 1YO5C 4E7KA 5EZGA 1U2WA 3FXMA 3OIQA 2OU2A 4ZC3A 4I99C 1VQ6I 1IN6A 3ABTA 3DWLE 4KIGA 4LIVA 4RAYA 5GTIC 2IS1A 4BBRJ 4I02A 3ZPLA 4AD9A 2KL4A 4CCKA 2Q0OA 1ON2A 4A0XA 2XVCA 1YW7A 2VOOA 4OMYA 1BC8C 3PQKA 3PQJA 2IPQX 1Y8RB 2Z2SB 2R3SA 5JHFA 3SQNA 3C7JA 3ZQIA 1ZHFA 4EJOA 1VQ9I 2XSDC 2H09A 1CF7B 3GLLA 1F4KA 3BY6A 5LD2C 1H0MA 2EFPA 4EJUA 4IXAA 2DOAA 4KN4X 1YQAA 2F4MB 3TO9A 5E79C 1LB2A 4CCJA 5HLGA 1WHUA 2DPUA 1K4TA 2V1NA 1WSUA 3O3KA 5FKNA 5DD4A 1JJ8C 1X3ZB 3EDPA 3KCCA 1QVTA 1QU3A 1TQIA 2FJ1A 5L3EA 1WZ2A 4IEJA 2MA3A 1T39A 1VQ7I 3CC2I 2Y75A 3SDGA 5K1YA 4BE2A 3E1SA 3BLYA 3LAJA 4OMZA 1T95A 5LGNA 1H9GA 3CCRI 2HPMA 2O9LA 2I8DA 4KT6A 4DZJA 3FBNB 2DDAA 1RUNA 3BG7A 3D5LA 1UHWA 3ZXSA 2F4IA 3G1OA 3QP5A 3JTHA 2WTEA 3ZQFA 1VI0A 4LK0F 5ICCA 2NVYJ 2PX9A 5K5QA 1BR1A 4HPQA 1KZHA 2N8GA 2DA5A 3HOZJ 4IHWA 4O5VA 5IYDJ 1AHDP 3CESA 3JAMZ 3OR1C 3K0LA 4BDYA 5LLQA 1WJAA 4HYEA 1Y6IA 2XHKA 1O3TA 3JRCA 2IEKA 1ETYA 1KU9A 1GHCA 5HVQC 3FK6A 1SVLA 4PCQA 4D9JA 2GAUA 4BGDA 2EWNA 2YR2A 3JRAA 2DCEA 2XB0X 1GUUA 2Y30A 3LFKA 3EUHC 2RGVA 4KMUX 2NNYA 1S7AA 3HB9A 1D1CA 1P7JA 4N9IA 1T0FC 4HX7A 3IL2A 2VPRA 4NC6A 4AIKA 4C2TA 3HKZN 5HS9A 3ECOA 1W4MA 2KHMA 1NH3A 3CDLA 1ZTRA 4XKCA 3CCJI 3OYKA 2O03A 4B43A 4B8XA 4IPAA 3IWFA 5JI6A 1MZBA 2O5RA 3DKWA 2EA4A 2V6CA 2Y48A 1XPXA 1W5TA 2CWEA 4OINF 4A69C 5H6RA 3IKVA 4A3LJ 2JSCA 3VFZA 1E3OC 4R8HA 3FM5A 3K1MA 2V9PA 4BNCA 4CUGA 2DQLA 3S3MA 3CLQA 4GYIA 2R5YA 4CCMA 3K70D 3F22A 2FSWA 1YYVA 3OOPA 3HOXJ 2HYGD 1J5YA 2MGQA 3OYAA 3LSRA 2X9DA 1R7JA 3OYDA 3CZ6A 1F9NA 4P96A 3LSKA 2LREA 4BE1A 3CQZJ 3HYIA 3W2VA 3HRUA 4IHYA 5E3LA 2LMDA 4U7BA 2R5YB 1VQPI 5AIPA 1ZG3A 1JHHA 2EB7A 3HZJA 3PNVA 2W25A 3AG1H 1WGXA 4CA0A 2EH3A 4DW6A 2DMNA 3FIWA 3OL4A 3S2WA 4UB6C 3SZPA 5CVRA 2EQRA 2FBIA 3ASNH 1FYLA 3LMMA 3BWGA 5DS9A 4EGYA 4KMFA 2YUSA 3I71A 5FLXZ 4PFPA 1W36D 1Q1VA 1D3YA 2X1CA 3WTZA 2FX0A 3SEQA 5FD6A 2X48A 3K1PA 2E35A 3W6KB 2X1EA 2R7WA 1XSDA 2ZXHA 4IOAF 4Q5SF 1FOWA 2V9VA 4RS8A 2LNBA 2O8XA 5DV5A 4GDFA 2CUJA 3GF2A 3S15J 3FBIB 2ZC2A 1BR2A 4DBQA 3E5QA 3T8RA 1WPKA 1BI2A 1LNWA 1Z67A 3KP2A 4RGSA 3A01A 4M6VA 4Z6YA 2R0QC 3GTGJ 3A2KA 4KA4A 1WWXA 2XDVA 1OR7C 2V6EA 1STZA 2E7WA 5ILSA 2WY8Q 2X85A 3ROUA 4KJZA 2ZNYA 3DPUA 4EJTA 2CQQA 3LSJA 5ILVA 4LK1F 1V55H 1Y1WJ 4W1UA 1BC7C 3H5NA 1KA8A 2XAUA 4Y3OA 3QAHA 2QVOA 2NOJB 3E3VA 1Z3XA 3AL0C 3PIPF 1ZYRF 2IGNA 3RQIA 2K9QA 5F0FA 3T8TA 3M9AA 2JT1A 3DTEA 4IRHA 3CP2A 4RAFA 2ZB9A 3D5SC 4LOCA 3CDHA 3U21A 5FKMA 2RC4A 4S04A 2UXNA 4UV8A 3A1YA 5ICGA 4CSWA 1XGOA 3BG6A 4F93B 2V1DA 1APLC 1K78B 1TWFJ 3E6BA 2HOAA 5CLSA 2FMLA 1MSEC 4LJZF 2HNHA 3G3ZA 3IRQA 2JZYA 1B9NA 1IXSB 2R7RA 3ULQB 4FETA 2JA6J 1S3JA 1SAUA 4YG2F 3Q0UA 2Z1DA 1JE8A 3SYTA 4MTDA 1OISA 4L5EA 3KP3A 2XV4S 1NHAA 3I58A 3R4KA 2VI6A 4LIUA 4BE0A 1NK3P 2ESHA 4IL6C 4C2MJ 3CCLI 1S5LC 1IG7A 2WAFA 3J7AO 1WFXA 1O57A 3S32A 1DQUA 5DUKA 1O3QA 2LKPA 5L3CA 1R22A 2KPMA 3MMYB 3LNQA 3DU6A 3RKXA 1RIOH 2RN7A 2D1HA 3F8MA 3HUGA 1B72A 1DUXC 2KLOA 1IUYA 2QQ8A 4RA2A 1R36A 4HF1A 2IAIA 1WH7A 2NS7A 2BY2A 3BR5A 4NBQA 4HLYA 3L09A 2A05A 3I53A 4OIRF 3T0YA 3PFYA 1E2XA 1QZZA 2NS0A 3LL7A 2NAZA 4BQQA 2Y9ZA 3HDDA 3HOVJ 2HDDA 1S7EA 3GVAA 2ZMEA 4NC8A 5K7ZA 3L00A 2ID6A 3O8GA 4XNFA 2ME6A 2LRDA 5B1BH 2K4JA 5M3MJ 3JRDA 4LB5A 2FBHA 2ECBA 4M6YA 3FMRA 1HOMA 3AFHA 3BQYA 4BJ6C 5E1ZB 3K1NA 3CCSI 3MVPA 4XQFA 1UHMA 3HSRA 3L2WA 4WWCA 1XX5A 1FBQA 4P5OA 1HBXG 4YELA 1WVRA 3R61A 3VYTB 1N78A 2LG4A 4PJLA 5D6FA 3FHNA 2TDXA 2XAQA 2BW3B 1UMQA 4MQ9F 1DPRA 3R6SA 1YIOA 3L7WA 1F5TA 3CO7C 3LA7A 2VJ4A 4KISA 1VQNI 5E3NA 5LHHA 5M5XJ 2JPCA 4B09A 4H4KC 4GXOA 3J80K 1IN8A 3DXJF 3HSFA 4N0BA 4IHXA 4FE4A 2IA0A 4LLGF 1YX3A 2XASA 3JR9A 3TL4X 3ZMZA 3WGIA 4V19K 2B63J 4I7HA 5GADJ 3TO7A 4Q4ZF 1A35A 2HPIA 2PEXA 5B5EC 2J5OA 2VC0A 2IS6A 2HFHA 2R5ZB 4FHTA 2VKVA 2HZTA 4MHGA 5HDNA 1MGTA 3K4CA 4GO1A 2KRHA 4XOPA 4XONA 1TT5B 3CUOA 4WX9A 3COAC 3S93A 4U7DA 3C1DA 4XMYA 2CQKA 1RRJA 3LSTA 1FC3A 3FXUA 3RKYA 2Z5UA 2L7FP 3K4NA 2CRGA 1EH6A 5C3EJ 3PIOF 1MNEA 1TW3A 3EQLF 4YRVA 3FXKA 3J7ZI 4ZTJA 4XN3A 2WB1A 3H35A 3NWTA 3GZNB 2BOLA 2EFWA 2DA7A 2DFEA 2IBDA 3AG4H 1OCZH 1OQYA 1FMWA 2WAEA 3JW4A 3ZQCA 2KMUA 4Y17A 3BR1A 1UELB 3QP6A 1JKRC 5BNGA 3OS1A 3DLAA 4L0YB 1LFUP 2NOGA 2NNNA 3C2HA 1IRFA 2MC4A 4E7ZA 4HG2A 2VQCA 3TP0A 1MBFA 3N97A 3B6AA 4BHCA 3HIFA 4QSHA 3CC4I 2CFXA 3ZMSA 1SANA 3H3VK 3WU2C 1OMIA 4AUXA 4HF0A 2EZHA 2F5EA 5JR3A 2BE5F 3ZP5A 2WV0A 2HKOA 5FKOA 3ZN1A 1D1BA 3MN2A 2EIJH 5IT3A 2LLKA 1MMGA 2Z3YA 2M4GA 2RREA 3WTVC 2M1BA 3DBRB 2KDZA 4KN7X 1UFMA 3PO3J 3CTAA 1RR8C 2XRLA 4F91B 3JRFA 2OBPA 3PJRA 2D1VA 2VE9A 2L2OA 1R49A 4HX4A 3JREA 4IHSA 1Z3YA 2JA2A 3ISPA 4RB0A 2LVSA 1D5YA 2PJRA 2BZTA 3VSLA 1MBHA 1ZGAA 2VONA 1HKTA 3HRMA 2QBYA 1MH3A 3JTGA 2K9LA 2VT3A 1V3FA 5E1WA 1IUFA 4YIRX 2DI3A 3HC7A 5IT9K 4P1WA 4HF2A 2ZBKA 1MIJA 4B47A 4Z2YA 4G6DA 2Y2ZA 2NXNB 3UR3C 3NAUA 9ANTA 1ENHA 4BHPA 1ZRFA 1MBEA 1TL8A 1KYWA 3HRSA 1K7AA 1DP3A 3M8JA 4PSWA 4D1QA 4P55A 1N25A 1IRXA 2MSYA 2P5LC 1OLTA 1BL0A 2OQGA 2JTVA 5LGUA 2M0CA 4IQ4A 3TOBA 1ETOA 3OR2C 4G12A 1QA6A 2UWMA 4ESJA 1D0XA 4F52A 3LSHA 4BAYA 2CJJA 2VKEA 2BY3A 4JBAA 1J09A 2IJLA 1MW7A 4M3DA 4NUBA 2VXDA 1QNTA 3SFZA 4I2OA 1B59A 1RI7A 2OTJI 1I1SA 4N4NB 4X0GA 3RI4A 1KU3A 1OYWA 2DW4A 2XC7A 2CUFA 5IP7J 1U3EM 2Z33A 1PUFA 1X1CA 4IOCF 1P6RA 4BHBA 1J59A 1Y0UA 3DPLC 5F08A 3RPQA 5KVRA 4ZJZA 1U5TC 2CV1A 1YE9A 1LDKB 3K2AA 1YITI 1IDZA 2M87A 2GIZA 5JHUA 3OYNA 1Z0XA 1HKQA 1OPCA 1P2FA 3RTRA 5IY5H 3WGHA 1BIBA 3TBIA 2IP2A 5BOXA 4B3XA 4XSXF 1UG0A 2DXIA 3GWZA 1MMAA 1JHFA 2LR8A 3BPVA 1DGRM 1Z7LA 2X51A 5HODA 3D1NI 3Q0VA 1EF4A 1LKXA 1Z05A 2IGOA 2VC1A 4WXDA 4HQMA 1VFCA 1X1PA 1U78A 1SFEA 1IGNA 2DA4A 2YX7A 3PL8A 1I5ZA 2M2EA 4U88A 5K7HA 4RGRA 3EUHA 4C2UA 5IYCJ 3DQVC 3F6VA 4ZH4F 5IPAA 1IXRC 1T0FA 2DFHA 2HQAA 1VQLI 2C6YA 1Y8QB 5E8GA 1KU7A 2DTZA 2F4OB 2XB5A 4ENJA 3UKGA 4RB2C 4RDUA 3QOPA 1V5EA 4LG0B 4LB6B 4BQAA 2ISYA 3HOWJ 5GAEJ 4IJAA 2KJCA 2M8GX 3B6CA 3K2ZA 1USSA 4A3DJ 1HW2A 1R1UA 4S0HB 2X6OA 2FOWA 3BTIA 1KQ8A 1L3LA 4BJTA 4UHTA 2P5KA 1S72I 4WXHA 1W7PA 1RZ4A 3WTUC 4BL0B 4JOMA 1XCBA 5EG0A 2IRFG 1RKTA 2CQ7A 1P4WA 2Q2EB 2I10A 2ZKZA 3JRIA 3E6CC 2XAFA 2JA7J 2EINH 3PNTA 4BU2A 1P4XA 3KP5A 2K3FA 3F9KA 1VQ4I 4HW0A 3OMYA 3S3NA 2IGKA 4HAMA 1U9OA 4E70A 3IH4A 4HX8A 2QSHX 3Q9VA 2EA2A 1OJLA 3TDUC 4ABZA 1TP4A 3E5XA 3WU0A 1LFBA 4AIHA 3ZMVA 1S8NA 4FCYA 3G6EI 1R1VA 3L2UA 2KZVA 3GTJJ 4A3JJ 4KFCA 1SMYF 2HZDA 3C2GA 4R1HA 1FY7A 3TGNA 2R7UA 2PMZA 5H20A 3GFIA 2FXAA 2HTJA 4PGGA 3U1DA 1FYMA 3PNYA 4XRFA 1EJ9A 4BEHB 5C4JJ 1HDPA 3F6OA 1AKHA 2MC3A 1X3UA 2L4MA 1TNSA 3TKYA 5HDKA 3BTLA 1ZRDA 1XTAA 4AIDA 3RPUD 3WHCA 3BZCA 3IH2A 1IV6A 5JLXA 1MJBA 3BR0A 2JPBA 2KJBA 1G59A 1YRNA 4IQJA 2MG4A 4BQOA 3K10A 3IH3A 4EQQA 1TBXA 3JRBA 3TMOA 4G7ZF 4IX7A 4E4HA 2EZIA 4FX0A 3KP6A 3ZQ7A 2HDCA 1U8RA 3SDBA 1RC9A 3C3WA 4F7ZA 2CW7A 5D6EA 3BPXA 4FX4A 1GVJA 2DYRH 1OR7A 3HGYA 2AXTC 4XBFA 3CCQI 1YRNB 4CCNA 2OCEA 3ZQQA 3BCBA 1G8XA 2R7SA 2GQQA 1OCCH 3MZ8A 3TW6A 4DJAA 4JK1X 2OA4A 3GZ6A 1QBJA 3GZ5A 2WA0A 3I55I 1KYZA 3TW7A 1DP7P 4ESBA 4H0EA 4C3JJ 1QGPA 2PLYA 3E6MA 2CW0F 2WADA 3HEFA 4I09A 3NRVA 4M9XA 2L7KA 3LQRA 3S3OA 2IGMA 1J2XA 1DPUA 4A3KJ 4OIOF 4PUSA 4MIMA 3F0CA 1I39A 2H1LA 3ZQGA 3S1QJ 4P9FA 2K9NA 2HS5A 5DCFA 3GTLJ 4PSXA 3F21A 5J1UA 1LDDA 5TISC 3WE3A 2JQ7A 4I01A 1TWGJ 5B66C 2ISZA 2QKMB 5J1RA 3ECHA 2L4AA 4CCLA 2NVXJ 1ONVA 1IO2A 1D5VA 4MQVA 1LEBA 2MYSA 2L0KA 1ODDA 3A0BC 3D0SA 1XCVA 2CQXA 2W85A 3J81K 4G6QA 1FYKA 2BV6A 1NTCA 2PMUA 3S8PA 4C9YA 2E2JJ 2EFOA 2FF4A 2H8WA 4AVZA 2VPLA 3OYCA 2K02A 3SFIA 4GCVA 3BR6A 5L3GA 2O3FA 2QQ9A 1BBYA 1S6LA 1TQMA 3GX4X 3SJMA 1MMSA 2VJIA 1TC3C 2LKXA 1KQ9A 2MH2A 4UVCA 3NARA 4UVAA 5D5WB 2V9KA 4FISA 1RPWA 4XLPF 3CF5F 3GW2A 4QTRA 2A3SA 2K5CA 1JKPC 1BJAA 3LOCA 1Q1HA 4M71A 1O3SA 2ZJPF 3GLXA 2K9MA 2VLAA 4EJVA 3FXQA 2ZFUA 3CUQC 3F8CA 3GCMA 4P9UA 4CXFA 3I59A 4DYRA 1FBSA 4HSTA 3QU6A 1LDJA 3DEUA 1T38A 1GXPA 2OUMA 1IN5A 4B44A 1I27A 3F23A 2YPRA 2EFNA 4G9YA 4AYBN 2HU9A 1EV7A 4R79A 2TCTA 1SFUA 4B1RA 2VXZA 2QGUA 3K4BA 2ICWG 1I1GA 2PQ8A 2QZ8A 3HPHA 3EUAA 3V42A 1DGWY 1ZLJA 4YFKF 2R7TA 1HCRA 4ZZDA 5FB2A 4CCOA 1DU6A 2LY1A 3GTOJ 2CG4A 1PYVA 2XKOA 3F8NA 1JUPA 3IC7A 3VDXA 1LVKA 2WAQA 2DYSH 2PG4A 1BI3A 2RNGA 3OYEA 4YIIA 1T08B 1T98A 3QQAA 2M5WA 1CGPA 3M07A 3M1CA 5EEHA 3UNGC 4HZFA 1YJNI 1VF9A 4MEYF 5EGOA 2EJRA 2E1CA 1WJFA 3WG9A 3AAFA 3F8FA 1RESA 3EYYA 5E20A 3AG2H 3F8BA 3ML6A 1JT6A 1V5FA 5K7FA 2E1MC 2LBFA 4B4CA 2VQGA 4G7OF 3AG3H 5A2QK 1Z6RA 1MNDA 2Z16A 2L5QA 3GTQJ 1KGSA 2ID3A 2W00A 4HBLA 4M72A 3CD6I 2LY9A 1VQ8I 5EGOB 1FBUA 4WK8F 2ME0A 4CDGA 4XK4A 5J4VA 2OD5A 1X1DA 3NQOA 1B8IA 4J00A 4HNVA 3I56I 4F92B 2CGPA 2YU3A 2FE3A 4KDPA 5ICFA 3DLLF 2FBKA 2DO7A 2H1KA 5HS7A 4RGUA 4BDZA 1IN7A 2R7FA 5J6XA 2LSOA 5LRRA 5GAHJ 4QPOA 1XDSA 2KQRA 3A01B 1B8IB 3GUDA 4XL9A 1TW2A 4A3FJ 3BP8A 3U2RA 3H9JA 3MKLA 3O8HA 3DBLB 2UV1A 1ZAOA 3HHHA 2CV0A 4EJWA 4ENMA 3S1NJ 2IS4A 2RAEA 3QWLA 2A5YB 3RCOA 3I4NJ 3DPTA 5KCMA 4DYCA 2FA5A 4JP0A 3CCMI 3Q0WA 2E5NA 2JK3A 3NWSA 1LUJB 2M7BA 3CJQB 4RM2A 3CCYA 3RPUA 5AONA 3DCFA 4HQEA 5D5UB 1YFHA 4CYCA 3HOUJ 4S05A 3BJAA 2DAOA 4V2GA 2VASA 4W97A 3VYRB 3J7YJ 1USTA 3G4SI 3DU5A 3OS0A 2BY0A 3QPHA 3MKYB 3GFMA 5HNHA 2IS2A 1ZR2A 2KT0A 4HDUA 1X2MA 2RVCA 1N75A 2FD5A 3FHZA 3DTIA 3MEXA 3HHGA 2OZUA 5EYRA 2Q8KA 2COBA 1PUEE 3QPLA 4KIBA 2VQLA 3KZZA 4TV7A 4D7MA 3EPZA 5LBQA 1ETWA 5FGMA 1HA8A 4DBRA 2DTRA 5HS8A 3RZOJ 1DDNA 2R7XA 2GIVA 1A5JA 3PUFA 2HGCA 3BTJA 2A07F 3BJOA 2ESNA 3CJNA 2R7DA 4XLFA 2E60A 3DEEA 2DK8A 4LITA 1D8KA 1P7IA 1VZ0A 3K7AJ 2CFOA 4MLOA 1R4NB 2P81A 3H5RA 2KRCA 3R60A 4PK4A 3DKYA 4ANJA 5J47A 1ZG5A 1RKWA 2AHQA 5KAFC 3CMMA 3HUGB 1B72B 2L9SA 5J40A 4QPQA 3VEPA 5TRDA 3MZHA 2ADUA 1TNTA 1FPQA 4YIFA 4UUSA 1QZYA 5DM7F 1B4AA 4DYQA 4AU7A 3WHBA 4EATA 1HW5A 4FASD 4PJ0C 2CSOA 4HEA2 1GVDA 2Y0SN 5BQTA 2ZMEB 5F0HA 3OYJA 3Q3SA 3DF8A 5BPIA 2KDOA 1BI0A 2MW8A 3X2QH 4DGWB 1LQ1A 3CMYA 1FIAA 2V26A 1A36A 3CO6C 1POGA 1U5TA 4D5FA 5DEQA 4ZDOA 3QODA 4L9NA 4L5JA 1W7PD 5HOOA 3WU1B 2XAJA 2NVUB 2GXBA 5D4SA 1LEAA 4X1EA 1T56A 2V1XA 2QUFA 1R23A 2MH9A 3EETA 5IP6A 3IKTA 3QRFF 4L18B 1I6HJ 2XIGA 2AQEA 5FRMA 5GPAA 1D0ZA 2F5DA 3VYUB 1FTTA 1SFOJ 5F6FA 5CVJA 2CUZA 2M7AA 3P5JA 1IRGA 3IWZA 4ENNA 3M8EA 1SEUA 3J80Z 4LMYA 2L54A 3K69A 1B6AA 4M74A 1RUOA 4IKFA 1D0YA 2XGXA 1MJ9A 5LHGA 2DODA 4RBOA 3WTXC 3E97A 1BM9A 2VKDA 1SD4A 4CZZA 2LP0A 4RMNA 4A3EJ 4CZCA 5GTHC 1BW6A 1MKMA 1WCMJ 2FNAA 2VBYA 1YX5A 2Y0MA 1OFCX 3I54A 3K4KA 4C3IJ 2IT0A 1PJRA 5H6QA 2W1OA 4A2UA 2A61A 3GTMJ 2YU9J 3F3XA 2E1NA 2ECCA 2M30A 4D5CA 2XUBA 5D8LB 4MGRA 1X3WB 2V4JC 4JYKA 3CCVI 3QOEA 1FX7A 2GWRA 2IA1A 4G8XA 5GPCA 4C3HJ 3Q9SA 4E6KG 3QPTA 2L7MP 3I5UA 2CW8A 1J7KA 2XPVA 1GT0C 5HLTA 3L2CA 5IYBJ 2LD5A 3E7LA 2OCCH 4B3AA 2DA6A 4M3FA 1WJBA 2QM3A 4IZZA 1MDMA 5J3LA 3WODF 5L3FA 2E1OA 1XD7A 2GA2A 3H3UA 1XB4A 5ICEA 1X1AA 4QLCU 2P4WA 1XS9A 1IV8A 2Z9OA 1M1EB 4O3MA 5FO5A 4DZPA 2ZNZA 4KNYA 3JRGA 1V5GA 2HQNA 4RAGA 1T6SA 1VQMI 1QQIA 2DA2A 4L5IA 2DDBA 1I6XA 2KKOA 4ESFA 1P4AA 1SAXA 3GO5A 2QF7A 1H89C 3FMSA 1MH4A 1QRYA 5DD8A 1ZR4A 1JTYA 1F36A 2TRTA 2VBWA 5FROA 1OYIA 2VBXA 3S14J 3DTKA 2PJRB 1IRZA 4FQGA 1OKRA 1PVEA 5F1RA 1YW9A 2D2WA 1K79A 5KK1A 4XLEA 2ZCWA 1Y0NA 2QBYB 1JT0A 4HNTA 3H36A 2HYJA 5IT9Z 1Y56A 1TWCJ 4BJ5C 3T1BA 4PDKA 2G7HA 1QPMA 2PBIA 2H27A 5J1YA 1W0UA 1D1AA 1UCRA 2UUZA 4DNCA 1FEXA 1FP1D 3BROA 2XF5A 1WKMA 1L0OC 2EIMH 5FKKA 4XRSA 1X4PA 4O6JA 2H6CA 2K9SA 2MBFA 4XLAA 2MLKA 3JSOA 1ERDA 3FXJA 1YHQI 1BJZA 2JJ7A 2GBYA 1SFXA 2OC6A 2ZSHB 3OWTA 2O61A 2DT6A 4A93J 1QZEA 1KONA 3OSGA 2KIQA 3KE2A 5M5YJ 1O4XA 2DU9A 2QSGX 1H9TA 1OCTC 1ACIA 4F3QA 1FZPB 3S2DJ 2W84A 3TO6A 4OIPF 3GXOA 1R9TJ 4WF2A 3A0HC 1PUFB 3OL3A 2AS5F 3ERED 3DP7A 1YG2A 2DBBA 4Y13A 5CPRB 1JGSA 1UZCA 4HRIA 2LF7A 2DJNA 1WH5A 2RDPA 3K6GA 1LE8A 2OPTA 2STWA 4BY7J 4CO8A 2F2EA 1AA7A 1P92A 2DN0A 1Y1VJ 1Z91A 3D5RC 4QIWN 4XORA 2ELHA 4M3GA 1BR4A 4UY8I 4A6DA 3FF5A 1MJAA 2NS8A 2XSJC 1YJWI 1K6OA 4PJMA 3SHFA 3ZRGA 2JWTA 2F5VA 4MFEA 3HG9A 3U1KA 3LWFA 2IXSA 2W24A 2L9RA 4N4OB 4C30A 3IAM2 2EPFA 2EZLA 3CF2A 2HOTA 3CUQA 2VOPA 2BVLA 4YEJA 4IO9F 2DMUA 4RM3A 3OYBA 1K61A 5DCMA 1W5CC 1KU2A 5DYMA 2HI3A 5E8IA 4PFOA 2X0LA 4DOZA 3HXLA 1G2HA 4U0YA 2CMPA 2VN2A 2CYYA 2RV8A 3I9V2 4PJJA 4XLCA 4RAZA 3CUQB 3MD2A 3FWEA 3KPHA 3ZOBA 2P6SA 2QCOA 2YSRA 3TEDA 3DKXA 2BGCA 3K70C 1HXDA 1XG1A 2O6GE 4EV0A 2PN6A 3DBHB 3G1MA 3KZIC 1W7PB 2LH9A 1HF0A 5EG0B 4RLFA 2X6XA 3K4LA 4DQ2A 2R7QA 3OIPA 4II2A 3S17J 2K3PA 4XLNF 4XICA 3GFJA 1IJWC 1R00A 3OYHA 2K86A 2EBIA 4FE7A 4MTEA 4UUVA 4PJNA 1QHGA 5J8FA 2K40A 1WI9A 4I0AA 3MKZA 5K5OA 2OJED 1JTXA 2HTSA 2O7OA 1W0TA 1FTZA 3W6VA 1OYYA 5F1JA 4A3GJ 1NG7A 1MBJA 3KZYA 1O7LA 5FFZA 1TZLA 2L9NA 2YS9A 1HQCA 2XAGA 2LY2A 1BOAA 5IP9J 2AQFA 3FXOA 1YOVB 4I98B 1G3WA 3DFGA 3V8KA 4LLNA 1GXQA 2GOXB 1IAWA 1H8AC 3L1PA 3ESWB 2EILH 2MFZA 4ZDPA 3BR2A 4MO7A 4PZJA 5J4YA 2DMPA 3CDIA 3KIOA 5BPDA 3WTYC 1A04A 3FKJA 2JRTA 4A3CJ 2E71A 1SD6A 4EM1A 3BG5A 1UG2A 2CO5A 1AKHB 2EV5A 2ZJQF 2CU7A 2E19A 2VIXA 2FEZA 2VE8A 3PO2J 2PJPA 4BXXJ 1XSVA 2CQNA 2RQQA 4JX4A 1ZARA 2F6CA 3LA3A 3ZMDA 1CF7A 2NRAC 2K27A 2E1MB 4E7HA 1JUSA 1ZKGA 2ZSIB 3BCAA 2NVQJ 1TT0A 1X1BA 1IN4A 4RGXA 1E0EA 3PFIA 3TP3A 5GP9A 1YIJI 3VOEA 2VT2A 2E7XA 4NNJA 2GZWA 3RJPA 3VODA 2PI0A 3N05A 3SEZA 3QU3A 4G7HF 4BQNA 3PM1A 3CMAI 2JVGA 1OCPA 5HLIA 3FISA 1G3SA 2DLLA 3KEQA 3ABUA 2E2HJ 4U87A 3ONQA 3W6JB 4BY1J 5CQGA 2XF6A 2FQ4A 2DT5A 2L3DA 3AL0B 3RQ4A 1SD5A 3HM5A 3HOYJ 2QEXI 4IVNA 1XMKA 3ZQLA 5H2FC 1LVAA 1TWAJ 5L3DA 3BZKA 2HVQA 3KETA 5E3OA 2K4BA 2VL8A 3SZGA 4ZYGA 1Z21A 2A68F 2HQ5A 3WG7H 3FMQA 1FP2A 1LPQA 1WJCA 2WC2A 2Z99A 5M3FJ 2X1DA 5DTDA 3KX2A 3BZ6A 5FLMJ 5KNLA 5KAIC 3S2HJ 3JAMK 2OV7A 4XIDA 1U6GA 2LC2A 2P0WA 2FUG2 2KISA 2M9HA 3G73A 2ZJ2A 2AO9A 2A6TA 2LKSA 2JVHA 1IC8A 1ETQA 1BIAA 1XGSA 3J81Z 3H0DA 4A3IJ 3OIOA 1FWZA 2XRNA 4GGGA 2NVTJ 4EMSA 5F04A 3GTKJ 3VPRA 5FLVA 2E5ZA 2ELJA 1UHSA 1YTYA 1DU0A 5JFRA 3CJRB 3KYDB 1PP8F 2W4SA 2V79A 2P8TA 1R1TA 5M5WJ 4UV9A 3KYCB 3GEZA 2IW5A 1Z1DA 2VODA 2GM4A 1FOYA 1H88C 4Q48A 4OIQF 1MBKA 3RYPA 2LDUA 1XN7A 2W82A 4U0WA 4IHTA 2F5CA 1R4MB 1MD0A 1QHHD 2X4HA 5K5RA 1EH7A 2H94A 3M8FA 4MEXF 3HPGA 2LOOA 4Y15A 1ZN2A 3H92A 3I59B 2BHZA 2P5VA 3W2AA 3V7CA 3ABKH 4RB3C 1X4OA 1B1BA 4ZYAA 4A3MJ 3FXRA 2LF8A 1ZELA 2HEOA 5LFAA 2EV6A 2JMWA 5C4XJ 3KP4A 3E6DA 1P9QC 2X6YA 1J9IA 3MFKA 4J01A 3CJTB 3F72A 4MNUA 2COMA 4KICA 1ZK8A 5TJJA 3ZMUA 1G4DA 1MNMC 1S9HA 2RKHA 5JVGF 5CVUA 3EYIA 2HVSA 2LYCA 3BR3A 1Z9CA 3JCUC 3ZGKA 3CCUI 2MABA 4EM0B 5D4RA 1T2KA 3VB2A 1G3YA 1YI2I 1U9NA 3A03A 5CKTA 4A5MA 3RKQA 5E17F 3FK7A 1YS7A 2FU4A 2JUGA 3CC7I 1R6RA 4D7NA 4LD5A 5FLXK 3W2WA 3RZDJ 2FOKA 5CVIA 3HOSA 3TQNA 4CYDA 3MQ0A 5B3SH 1BA5A 1ULYA 3SXYA 3ZCOA 4NQWA 3HJEA 1O3RA 2OZ6A 5B1AH 1AWCA 3M3YJ 5F0CA 3B02A 1ZH5A 3BC8A 1A6IA 1FOXA 2LBFB 5A2QZ 4ON0A 5CJ9A 4CHUA 3DV8A 2R93J 2ZXIA 2OF7A 2HWVA 2OTLI 2H6BA 3KFWX 2ZO4A 3ABLH 4BYYA 2H8RA 4E7JA 2WY7Q 2GA1A 1IDYA 4NQWB 5FJ8J 3OSFA 2XGDA 4ETSA 3ZR8X 4KYWA 2A6HF 2XGCA 2WB1N 3KEOA 3MZYA 4RB1A 1FSEA 1WJEA 2BY1A 3L2QA 1VQOI 3I4PA 1LJ9A 4XR6A 1G6NA 2UXXA 3BDDA 1FNNA 4GRIA 2GOMA 4M6XA 2QLZA 5JLWA 4M3EA 3LA2A 1EA3A 2KIUA 1Z77A 4L9JA 1JI8A 3IRRA 1R5HA 2IVMA 3CMEI 1U8BA 2ELKA 4WCGA 4CGZA 1PDNC 3Q5FA 3IUOA 1U0JA 2DA1A 3ZQHA 3V7SA 4XRMA 2DFFA 1T8IA 4UNOA 1JKQC 2M34A 1GLNA 1IW7F 1R5GA 1CQTA 4UUTA 3H9QA 2BHYA 4ENKA 1K78A 2GXAA 1ETKA 3HBLA 4OU0A 1SVMA 1FOKA 1R5ID 2ZXJA 3SZTA 5BS6A 3K9TA 3C18A 3IV5A 2G0EA 2V1UA 4GFBA 4AM3A 2VJJA 2MD5A 3QYEA 3NEUA 1QO0D 2ACJA 2M3AA 1MMDA 1S7OA 1E3PA 2FRHA 3FX3A 4CYCB 4I0BA 3OYMA 1AU7A 3QYBA 2JA8J 3B73A 3HTUA 1TQPA 1HKSA 3FM3A 1ETXA 4HDVA 2F48A 3N4MA 3LSGA 4Y7NJ 5E18F 3JRHA 1W5SA 2UZKA 3FKIJ 2Y31A 1J75A 2KFDA 4L0ZB 2X6WA 1A6QA 2KIFA 2BVMA 4BS9A 4OOIA 2DOFA 4X6AJ 1S29A 4V2FA 4DIQA 4WXCA 5D8KB 4NHJA 3GMEA 3P9CA 1V54H 1WRJA 3K4MA 2J5PA 2W7NA 3HKZA 2JN6A 3QPSA 1JGGA 2R4GA 2FNPA 1MSFC 4G94A 2LTPA 2M0MA 4G6TB 3G1LA 4GYGA 4IHVA 2DK5A 6PAXA 4HSRA 1TTYA 3BQZA 1GV2A 2XF7A 3HL2A 1GV5A 2WV1A 4Q47A 3HSEA 5F27A 1XGNA 2I5UA 3FDYA 4JX6A 1K4SA 1X2NA 3KLOA 5L3BA 3HTSB 4BH9A 3M7GA 4UUSB 1ON1A 4AIJA 2G7UA 2R7ZJ 4BXUA 4D0PA 3OYIA 2CS3A 3AKZA 1ZLKA 1LFPA 3KLNA 4J19A 5CVVA 4M73A 4AYBA 2BW3A 5DDGA 2HOEA 4JQFA 3ABMH 1HW1A 3OYFA 3TOAA 4XKWA 1Y39A 3OS2A 1U5TB 1TWHJ 1HC8A 1UAAA 4A3BJ 1G3TA 4EEFG 3WE2A 3P9KA 3U9GA 2VKHA 4KUMA 2HXOA 1SVOA 2CUEA 5AIQA 5LHIA 3GYHX 1ETVA 1UJ8A 4MFDA 5FFXA 3RKWA 2HXIA 3RIRA 3WTTC 3M1EA 1FJLA 1EH8A 3LAPA 2ZXWH 1WI3A 1HDDC 3OY9A 3OYGA 2E36A 2JRMA 2PFBA 1RETA 3H0GJ 2G9WA 3P7NA 1MMNA 3R0AA 3VYSB 1K83J 2QQAA 2R5ZA 5ILUA 2DJIA 2EZKA 2KP6A 3KEYA 4II3A 4E7LA 2NYXA 2KIMA 2HQRA 2P7VB 2VBZA 3H5AA 5DUIA 5LEJA 4ZDLA 3BG9A 3WTSC 2M8EA 2LK2A 2XPUA 2Y69H 4Y4RA 4HLXA 4BACA 5D5VB 1A31A 2HOSA 4HNUA 3MAJA 4XKBA 4UXNA 2W48A 1NG6A 3G2BA 5LRSA 4KIFA 3R0JA 3S1RJ 3MWMA 4EVIA 2HKXA 3LSIA 3IAS2 3JSPA 4E7IA 5HNFA 4A12A 3ERMA 2RQPA 4ASNA 4ZYHA 2K85A 2VQHA 1XSXA 3WTWC 2OAZA 3BJ6A 3RDIA 2L9VA 1XMXA 4L9TA 2JUCA 2K7LA 5CYVA 1ZQ3P 2FMYA 1I3QJ 3OV8A 4CH7A 4K2EA 1SC7A 3BTCA 4NDLA 4XN0A 3G71I 4FTHA 2R92J 1FT9A 2RNJA 1F43A 2BXZA 1R71A 5J8CA 1Z6TA 3BG3A 2QSFX 1BN5A 3RSNA 2DMTA 1F1ZA 4L9VA 1MDMB 2STTA 1IZ1A 4XLHA 2XKPA 2HYFA 3GTPJ 1ORKA 4CICA 3GFLA 3VSKA 1FLIA 1R58A 1YJ9I 2PMZN 4B48A 2VB6A 1RNLA 1YS6A 2BXYA 3LSMA 2DPDA 2EIKH 2R7VA 3CCEI 4LFUA 3KP7A 3EUKL 4FT8A 3IP4B 1YLFA 2W57A 1ZGJA 2HVRA 2ZJRF 5DM6F 3S16J 1VQ5I 5IOYA 4LG3A 2XROA 2WBMA 4HOBA 1JXSA 5FD5A 2GXGA 4XM3A 2P7CB 3H1CA 1XMAA 1JJ6C 2FQ3A 2MLGA 1B9MA 2ZFWA 3P9IA 1IXCA 3CP8A 2BYVE 2E2IJ 1EKEA 5ED4A 1T33A 1E3HA 1XGMA 2DQRA 5LEKA 3J7AY 5BMZA 5HLHA 2L01A 3BOQA 5LGTA 2QKLB 2JA5J 4U0VA 1OCOH 3V4GA 4YFXF 4AC0A 1VTNC 1XDUA 3L2VA 4A0YA 4M3BA 5GAGJ 5E1XA 5EZHA 2EK5A 3KYLA 5F64A 2Y9YA 1I3AA 2A5WA 2DOEA 4HA8A 2JSPA 4IF4A 5FKLA 1O7FA 1W1WE 2HDWA 1I50J 2LFBA 2L7ZA
chains in the Genus database with same CATH topology
2RNGA 2RQQA 3OYEA 2F6CA 4P5OA 4YELA 2E1MB 3VYTB 1N78A 2LG4A 3M1CA 4PJLA 3UNGC 3FHNA 4E7HA 1WJDA 2ZSIB 3BCAA 2BW3B 1TT0A 1WJ5A 1X1BA 1E0EA 1WJFA 3I3LA 1FMVA 4KITB 4XOTA 2VJ4A 4NC7A 4KISA 4F55A 1V5FA 4H4KC 2E1MC 2LBFA 2VQGA 4NNJA 2Y0SA 3N05A 1MNDA 3SEZA 2Z16A 4BUPA 2L5QA 2CH0A 4BQNA 1YX3A 3H9GA 2W00A 3OOUA 3TL4X 2JVGA 2M4KA 4U87A 1N77A 1SFKA 3ONQA 5CQGA 2XF6A 1X1DA 4RLQA 4J00A 2Q1ZB 3PUBA 4F92B 2HPIA 3OYLA 3AL0B 2IS6A 1K6YA 4BDZA 3RQ4A 2MD0A 2VJ5A 4BXFA 1BOBA 3K4CA 2KRHA 3A4CA 4XONA 4XOPA 4QPOA 2HVQA 2KQRA 4ZTFA 3S93A 4E7SA 2VL8A 4XL9A 3SZGA 1Z21A 3L2RA 4XKVA 4XMYA 3H9JA 1WJCA 2DT7B 2X1DA 4OWRB 2UV1A 3KX2A 3K4NA 5KNLA 4Y33A 2CV0A 2OV7A 2IS4A 1MNEA 4YRVA 2LC2A 3RCOA 3DPTA 2P0WA 2FUG2 5KCMA 4ZTJA 4XN3A 2WB1A 3H35A 2E5NA 3NWTA 3NWSA 2BOLA 2M7BA 3CJQB 3GBGA 4RM2A 1FMWA 2WAEA 2A6TA 5FRNA 2JVHA 2KMUA 1UELB 3H0DA 2VASA 3VYRB 3OS1A 3DLAA 2CV2A 3DU5A 3E0JB 3C2HA 3OS0A 2E5ZA 4OAZA 5KHDA 2MC4A 4E7ZA 2ELJA 3MKYB 4HG2A 2VQCA 5HNHA 2IS2A 3CJRB 1N75A 5CQEA 2W4SA 3DTIA 3QYFA 3PSFA 2VQLA 5TGTA 3EPZA 1HA8A 4DBRA 4ITVA 2R7XA 2W82A 1D1BA 1QHHD 1MMGA 2M4GA 2RREA 4XLFA 2E60A 3W3CA 3DEEA 3HPGA 4LITA 1VZ0A 2LOOA 1X19A 2R7OA 2CFOA 4MLOA 4ANJA 3H5RA 2KRCA 4PK4A 3W2AA 3DKYA 4F91B 3VWBA 3HOTA 3K4JA 3PJRA 2L2OA 1X4OA 4ZYAA 1Z3YA 2JA2A 3LFUA 1ZELA 3PSIA 3CMMA 4OAYA 3HUGB 5LFAA 1W36C 2PJRA 2L9SA 3VSLA 4BEHA 2V7FA 4QPQA 3MKWB 1P9QC 4E7KA 2X6YA 3OIQA 2K9LA 4ZC3A 4J01A 3DWLE 3HC7A 4LIVA 4AU7A 4P1WA 2IS1A 4EATA 1S9HA 4B47A 4FASD 2KL4A 4HEA2 4CCKA 3UR3C 3OYJA 2HVSA 2LYCA 2KDOA 4DGWB 1DP3A 3ZGKA 2V26A 3M8JA 2MABA 4PSWA 4D1QA 1IRXA 1OLTA 2Z2SB 5CKTA 4ZDOA 3QODA 4IQ4A 2JUGA 3OR2C 1R6RA 5HOOA 5JHFA 3W2WA 2UWMA 1D0XA 4F52A 3HOSA 3LSHA 1J09A 2AQEA 4NUBA 1MW7A 5LD2C 5FRMA 1D0ZA 2VXDA 3VYUB 2DOAA 3ZCOA 4N4NB 4X0GA 2CUZA 2M7AA 2XC7A 4CCJA 3BC8A 1X1CA 2LBFB 2V1NA 3DPLC 2ZXIA 4ZJZA 4IKFA 1D0YA 2CV1A 1YE9A 1LDKB 1QU3A 4E7JA 2VKDA 2WY7Q 4NQWB 3OYNA 4RMNA 3ZR8X 3RTRA 4CZCA 3TBIA 3L2QA 1WJEA 1YX5A 3K4KA 4B3XA 1PJRA 2W1OA 4XR6A 4BE2A 3E1SA 1UG0A 2DXIA 1MMAA 4GRIA 2GOMA 3BLYA 1DGRM 1T95A 1Z7LA 2X51A 2HPMA 2I8DA 4KT6A 3FBNB 1LKXA 2IGOA 1EA3A 3BG7A 3D5LA 3ZXSA 2F4IA 1JI8A 3PL8A 2V4JC 4C2UA 3QOEA 3DQVC 3IUOA 1BR1A 1U0JA 4HPQA 2HQAA 1GLNA 4E6KG 3CESA 3H9QA 3OR1C 4BDYA 1V5EA 2CW8A 1WJAA 5HLTA 1Y6IA 5HVQC 4D9JA 4BGDA 1WJBA 2VJJA 3QYEA 4IZZA 2M3AA 1MMDA 2DCEA 4BJTA 3OYMA 3QYBA 3EUHC 1X1AA 4BL0B 1D1CA 4JOMA 1T0FC 3LSGA 2Q2EB 4C2TA 1V5GA 3PNTA 4BU2A 2KHMA 3F9KA 3OMYA 3S3NA 2IGKA 2X6WA 2BVMA 4BS9A 4XKCA 3OYKA 4B43A 4DIQA 2O5RA 3K4MA 2W7NA 3HKZA 2R4GA 5FROA 3L2UA 2KZVA 2M0MA 4G6TB 2HZDA 3C2GA 2R7UA 4CUGA 3S3MA 2PMZA 4HSRA 4CCMA 3K70D 3DTKA 2PJRB 2XF7A 3HL2A 3PNYA 4BEHB 3FDYA 4XLEA 3OYAA 3OYDA 3CZ6A 4HNTA 3LSKA 2LREA 4BE1A 1Y56A 3W2VA 4BJ5C 2CS3A 3RPUD 3AKZA 1LFPA 3OYIA 4U7BA 4AYBA 2BW3A 3PNVA 4JQFA 1D1AA 4CA0A 1G59A 3OL4A 2UUZA 4IQJA 4BQOA 3K10A 3OYFA 3TMOA 4XKWA 2XF5A 4IX7A 4E4HA 3OS2A 3LMMA 1UAAA 3SDBA 1X4PA 2VKHA 2CW7A 4XLAA 1ERDA 4PFPA 1W36D 2X1CA 3SEQA 2OC6A 2ZSHB 3OWTA 4CCNA 2DT6A 2X1EA 3ZQQA 2R7WA 3BCBA 1G8XA 1KONA 2ZXHA 3OY9A 2R7SA 3OYGA 4DJAA 4F3QA 2CUJA 1MMNA 2WA0A 3VYSB 3FBIB 1BR2A 3OL3A 4DBQA 2DJIA 2KP6A 2WADA 3KEYA 4II3A 4E7LA 3H5AA 5CPRB 2L7KA 3S3OA 4ZDLA 2IGMA 4HRIA 4Y4RA 3A2KA 4PUSA 2XDVA 1OR7C 4BACA 2V6EA 3K6GA 2WY8Q 2X85A 4KJZA 3DPUA 1AA7A 4HNUA 4XKBA 4PSXA 3G2BA 1NG6A 2QKMB 3D5RC 3H5NA 2XAUA 4Y3OA 3LSIA 3IAS2 4XORA 4E7IA 1BR4A 4CCLA 5HNFA 2NOJB 3AL0C 1Z3XA 2XSJC 2IGNA 2VQHA 4PJMA 2MYSA 3ZRGA 2F5VA 3DTEA 3HG9A 3CP2A 3D5SC 4N4OB 2IXSA 4C30A 3U21A 3IAM2 3CF2A 4C9YA 3S8PA 3A1YA 2BVLA 4YEJA 4CSWA 2VPLA 4AVZA 4CH7A 4RM3A 3OYBA 3OYCA 3BG6A 4F93B 4XN0A 4PFOA 4DOZA 3HXLA 2HNHA 2R7RA 2CMPA 4FETA 2VJIA 3I9V2 1SAUA 2Z1DA 4PJJA 3RSNA 4XLCA 3SYTA 3MD2A 2V9KA 4XLHA 3DKXA 3K70C 2K5CA 3VSKA 2LH9A 4LIUA 4BE0A 2K9MA 4B48A 2VB6A 2WAFA 2X6XA 3K4LA 1WFXA 4RLFA 2ZFUA 3S32A 3LSMA 2VLAA 1DQUA 2R7QA 3OIPA 4II2A 2R7VA 2K3PA 3EUKL 4HSTA 3OYHA 3IP4B 2KPMA 3MMYB 2HVRA 3DU6A 2OUMA 4PJNA 4B44A 1QHGA 4LG3A 2WBMA 2KLOA 4XM3A 3MKZA 2HU9A 4R79A 2VXZA 3K4BA 1NG7A 1TZLA 2L9NA 2LY2A 3CP8A 2AQFA 3PFYA 3LL7A 4BQQA 3J7AY 3HPHA 3EUAA 3V42A 2GOXB 4NC8A 2QKLB 1DGWY 2MFZA 4ZDPA 2R7TA 4XNFA 2LRDA 4CCOA 2LY1A 3FKJA 3L2VA 1PYVA 3AFHA 4BJ6C 3VDXA 3KYLA 1LVKA 2WAQA 4XQFA 2A5WA 2VIXA 2JSPA 3L2WA 2HDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZV A;  2KPM A;  2LY1 A;  3RCO A;  2LH9 A;  2LY2 A;  3S93 A; 
#chains in the Genus database with same CATH topology
 2DFI A;  2D45 A;  2A6E F;  3A02 A;  3CLO A;  2XPW A;  1WJD A;  2O0Y A;  1JKO C;  3FXL A;  1WJ5 A;  3IHU A;  1WQ2 A;  3I3L A;  2ZME C;  3C2B A;  1FMV A;  4KIT B;  4KT5 C;  4XOT A;  2KZG A;  4NC7 A;  2QYO A;  4F55 A;  4I6Z A;  1SMT A;  1UB9 A;  2VUM J;  2Y0S A;  5JVT A;  2IA2 A;  4BUP A;  2QA4 I;  1ZG1 A;  2XGE A;  2CH0 A;  3REO A;  3H9G A;  3ZMT A;  3OOU A;  1TLH B;  1VND A;  2M4K A;  2B9S A;  4M9Z A;  2EV0 A;  5EJC A;  1N77 A;  3MCZ A;  4I76 A;  1SFK A;  5C44 J;  3WGG A;  4XRS G;  2AXL A;  3I4M J;  4EM2 A;  4RLQ A;  5EDN A;  2Q1Z B;  3PUB A;  1BI1 A;  3V8J A;  3OYL A;  1C0W A;  4M9S A;  5EEG A;  4EGZ A;  1YW8 A;  3HGG A;  4HV6 A;  1ITY A;  1K6Y A;  3TDZ C;  2QQB A;  1JUM A;  1MBG A;  2MD0 A;  2VJ5 A;  4BXF A;  1BOB A;  1HSJ A;  1VQK I;  2KRF A;  2GLO A;  3A4C A;  1IF1 A;  5ERI A;  1AOY A;  4LGW A;  4ZTF A;  2O8K A;  4E7S A;  5HDG A;  3L2R A;  4XKV A;  1QPI A;  3BT9 A;  3S1M J;  2E34 A;  2DMQ A;  2XAH A;  2DT7 B;  3E5U A;  2ETH A;  4UB8 C;  1LE8 B;  2OQR A;  4OWR B;  2B7E A;  4XSZ F;  1XC5 A;  2HR3 A;  4N9H A;  4JX5 A;  4BKX A;  4A0Z A;  5EEA A;  1BW5 A;  4HV5 A;  4Y33 A;  3H3Z A;  3DEW A;  4YFN F;  4LG0 A;  1D8J A;  2M45 A;  3O2P E;  3I64 A;  4PGH A;  2BEO A;  4AVP A;  1ZGW A;  3GBG A;  3L9F A;  4BBS J;  3I0T A;  5FRN A;  3HRT A;  4NB5 A;  4QWQ A;  3FZV A;  4UVB A;  2D5V A;  4IRG A;  4ZYE A;  3ELK A;  1REP C;  2CV2 A;  4LLL A;  3E0J B;  1NK2 P;  4OAZ A;  5KHD A;  3O6B B;  2L02 A;  5DCM B;  3RYR A;  2Q2E A;  5E3M A;  3V7R A;  1V4R A;  2BBY A;  3T5X A;  1E17 A;  1Z7U A;  5CQE A;  2QEN A;  1ZRE A;  3QYF A;  3PSF A;  2QWW A;  1OCR H;  1SD7 A;  1GDT A;  5D5X B;  1FSH A;  1ZRC A;  5TGT A;  4A5N A;  3LSP A;  1QVU A;  4Y52 J;  3M4O J;  4ZZL A;  1HST A;  2A69 F;  4ITV A;  1PP7 U;  2B0L A;  4ZYD A;  1X58 A;  3V8L A;  1HLV A;  1RR7 A;  4AWX B;  1FIP A;  3LQQ A;  2EFQ A;  2P6T A;  2PMH A;  5IOZ A;  3W3C A;  2F5F A;  2DA3 A;  1X19 A;  2R7O A;  3ZN0 A;  1KQ0 A;  4IRI A;  3VWB A;  2WAQ N;  3HOT A;  2WWY A;  3K4J A;  3LFU A;  5EF6 A;  3PSI A;  1W36 C;  4OAY A;  3ASO H;  4BEH A;  2V7F A;  2YX4 A;  1J0R A;  4A6E A;  3MKW B;  1YO5 C;  4E7K A;  5EZG A;  1U2W A;  3FXM A;  3OIQ A;  2OU2 A;  4ZC3 A;  4I99 C;  1VQ6 I;  1IN6 A;  3ABT A;  3DWL E;  4KIG A;  4LIV A;  4RAY A;  5GTI C;  2IS1 A;  4BBR J;  4I02 A;  3ZPL A;  4AD9 A;  2KL4 A;  4CCK A;  2Q0O A;  1ON2 A;  4A0X A;  2XVC A;  1YW7 A;  2VOO A;  4OMY A;  1BC8 C;  3PQK A;  3PQJ A;  2IPQ X;  1Y8R B;  2Z2S B;  2R3S A;  5JHF A;  3SQN A;  3C7J A;  3ZQI A;  1ZHF A;  4EJO A;  1VQ9 I;  2XSD C;  2H09 A;  1CF7 B;  3GLL A;  1F4K A;  3BY6 A;  5LD2 C;  1H0M A;  2EFP A;  4EJU A;  4IXA A;  2DOA A;  4KN4 X;  1YQA A;  2F4M B;  3TO9 A;  5E79 C;  1LB2 A;  4CCJ A;  5HLG A;  1WHU A;  2DPU A;  1K4T A;  2V1N A;  1WSU A;  3O3K A;  5FKN A;  5DD4 A;  1JJ8 C;  1X3Z B;  3EDP A;  3KCC A;  1QVT A;  1QU3 A;  1TQI A;  2FJ1 A;  5L3E A;  1WZ2 A;  4IEJ A;  2MA3 A;  1T39 A;  1VQ7 I;  3CC2 I;  2Y75 A;  3SDG A;  5K1Y A;  4BE2 A;  3E1S A;  3BLY A;  3LAJ A;  4OMZ A;  1T95 A;  5LGN A;  1H9G A;  3CCR I;  2HPM A;  2O9L A;  2I8D A;  4KT6 A;  4DZJ A;  3FBN B;  2DDA A;  1RUN A;  3BG7 A;  3D5L A;  1UHW A;  3ZXS A;  2F4I A;  3G1O A;  3QP5 A;  3JTH A;  2WTE A;  3ZQF A;  1VI0 A;  4LK0 F;  5ICC A;  2NVY J;  2PX9 A;  5K5Q A;  1BR1 A;  4HPQ A;  1KZH A;  2N8G A;  2DA5 A;  3HOZ J;  4IHW A;  4O5V A;  5IYD J;  1AHD P;  3CES A;  3JAM Z;  3OR1 C;  3K0L A;  4BDY A;  5LLQ A;  1WJA A;  4HYE A;  1Y6I A;  2XHK A;  1O3T A;  3JRC A;  2IEK A;  1ETY A;  1KU9 A;  1GHC A;  5HVQ C;  3FK6 A;  1SVL A;  4PCQ A;  4D9J A;  2GAU A;  4BGD A;  2EWN A;  2YR2 A;  3JRA A;  2DCE A;  2XB0 X;  1GUU A;  2Y30 A;  3LFK A;  3EUH C;  2RGV A;  4KMU X;  2NNY A;  1S7A A;  3HB9 A;  1D1C A;  1P7J A;  4N9I A;  1T0F C;  4HX7 A;  3IL2 A;  2VPR A;  4NC6 A;  4AIK A;  4C2T A;  3HKZ N;  5HS9 A;  3ECO A;  1W4M A;  2KHM A;  1NH3 A;  3CDL A;  1ZTR A;  4XKC A;  3CCJ I;  3OYK A;  2O03 A;  4B43 A;  4B8X A;  4IPA A;  3IWF A;  5JI6 A;  1MZB A;  2O5R A;  3DKW A;  2EA4 A;  2V6C A;  2Y48 A;  1XPX A;  1W5T A;  2CWE A;  4OIN F;  4A69 C;  5H6R A;  3IKV A;  4A3L J;  2JSC A;  3VFZ A;  1E3O C;  4R8H A;  3FM5 A;  3K1M A;  2V9P A;  4BNC A;  4CUG A;  2DQL A;  3S3M A;  3CLQ A;  4GYI A;  2R5Y A;  4CCM A;  3K70 D;  3F22 A;  2FSW A;  1YYV A;  3OOP A;  3HOX J;  2HYG D;  1J5Y A;  2MGQ A;  3OYA A;  3LSR A;  2X9D A;  1R7J A;  3OYD A;  3CZ6 A;  1F9N A;  4P96 A;  3LSK A;  2LRE A;  4BE1 A;  3CQZ J;  3HYI A;  3W2V A;  3HRU A;  4IHY A;  5E3L A;  2LMD A;  4U7B A;  2R5Y B;  1VQP I;  5AIP A;  1ZG3 A;  1JHH A;  2EB7 A;  3HZJ A;  3PNV A;  2W25 A;  3AG1 H;  1WGX A;  4CA0 A;  2EH3 A;  4DW6 A;  2DMN A;  3FIW A;  3OL4 A;  3S2W A;  4UB6 C;  3SZP A;  5CVR A;  2EQR A;  2FBI A;  3ASN H;  1FYL A;  3LMM A;  3BWG A;  5DS9 A;  4EGY A;  4KMF A;  2YUS A;  3I71 A;  5FLX Z;  4PFP A;  1W36 D;  1Q1V A;  1D3Y A;  2X1C A;  3WTZ A;  2FX0 A;  3SEQ A;  5FD6 A;  2X48 A;  3K1P A;  2E35 A;  3W6K B;  2X1E A;  2R7W A;  1XSD A;  2ZXH A;  4IOA F;  4Q5S F;  1FOW A;  2V9V A;  4RS8 A;  2LNB A;  2O8X A;  5DV5 A;  4GDF A;  2CUJ A;  3GF2 A;  3S15 J;  3FBI B;  2ZC2 A;  1BR2 A;  4DBQ A;  3E5Q A;  3T8R A;  1WPK A;  1BI2 A;  1LNW A;  1Z67 A;  3KP2 A;  4RGS A;  3A01 A;  4M6V A;  4Z6Y A;  2R0Q C;  3GTG J;  3A2K A;  4KA4 A;  1WWX A;  2XDV A;  1OR7 C;  2V6E A;  1STZ A;  2E7W A;  5ILS A;  2WY8 Q;  2X85 A;  3ROU A;  4KJZ A;  2ZNY A;  3DPU A;  4EJT A;  2CQQ A;  3LSJ A;  5ILV A;  4LK1 F;  1V55 H;  1Y1W J;  4W1U A;  1BC7 C;  3H5N A;  1KA8 A;  2XAU A;  4Y3O A;  3QAH A;  2QVO A;  2NOJ B;  3E3V A;  1Z3X A;  3AL0 C;  3PIP F;  1ZYR F;  2IGN A;  3RQI A;  2K9Q A;  5F0F A;  3T8T A;  3M9A A;  2JT1 A;  3DTE A;  4IRH A;  3CP2 A;  4RAF A;  2ZB9 A;  3D5S C;  4LOC A;  3CDH A;  3U21 A;  5FKM A;  2RC4 A;  4S04 A;  2UXN A;  4UV8 A;  3A1Y A;  5ICG A;  4CSW A;  1XGO A;  3BG6 A;  4F93 B;  2V1D A;  1APL C;  1K78 B;  1TWF J;  3E6B A;  2HOA A;  5CLS A;  2FML A;  1MSE C;  4LJZ F;  2HNH A;  3G3Z A;  3IRQ A;  2JZY A;  1B9N A;  1IXS B;  2R7R A;  3ULQ B;  4FET A;  2JA6 J;  1S3J A;  1SAU A;  4YG2 F;  3Q0U A;  2Z1D A;  1JE8 A;  3SYT A;  4MTD A;  1OIS A;  4L5E A;  3KP3 A;  2XV4 S;  1NHA A;  3I58 A;  3R4K A;  2VI6 A;  4LIU A;  4BE0 A;  1NK3 P;  2ESH A;  4IL6 C;  4C2M J;  3CCL I;  1S5L C;  1IG7 A;  2WAF A;  3J7A O;  1WFX A;  1O57 A;  3S32 A;  1DQU A;  5DUK A;  1O3Q A;  2LKP A;  5L3C A;  1R22 A;  2KPM A;  3MMY B;  3LNQ A;  3DU6 A;  3RKX A;  1RIO H;  2RN7 A;  2D1H A;  3F8M A;  3HUG A;  1B72 A;  1DUX C;  2KLO A;  1IUY A;  2QQ8 A;  4RA2 A;  1R36 A;  4HF1 A;  2IAI A;  1WH7 A;  2NS7 A;  2BY2 A;  3BR5 A;  4NBQ A;  4HLY A;  3L09 A;  2A05 A;  3I53 A;  4OIR F;  3T0Y A;  3PFY A;  1E2X A;  1QZZ A;  2NS0 A;  3LL7 A;  2NAZ A;  4BQQ A;  2Y9Z A;  3HDD A;  3HOV J;  2HDD A;  1S7E A;  3GVA A;  2ZME A;  4NC8 A;  5K7Z A;  3L00 A;  2ID6 A;  3O8G A;  4XNF A;  2ME6 A;  2LRD A;  5B1B H;  2K4J A;  5M3M J;  3JRD A;  4LB5 A;  2FBH A;  2ECB A;  4M6Y A;  3FMR A;  1HOM A;  3AFH A;  3BQY A;  4BJ6 C;  5E1Z B;  3K1N A;  3CCS I;  3MVP A;  4XQF A;  1UHM A;  3HSR A;  3L2W A;  4WWC A;  1XX5 A;  1FBQ A;  4P5O A;  1HBX G;  4YEL A;  1WVR A;  3R61 A;  3VYT B;  1N78 A;  2LG4 A;  4PJL A;  5D6F A;  3FHN A;  2TDX A;  2XAQ A;  2BW3 B;  1UMQ A;  4MQ9 F;  1DPR A;  3R6S A;  1YIO A;  3L7W A;  1F5T A;  3CO7 C;  3LA7 A;  2VJ4 A;  4KIS A;  1VQN I;  5E3N A;  5LHH A;  5M5X J;  2JPC A;  4B09 A;  4H4K C;  4GXO A;  3J80 K;  1IN8 A;  3DXJ F;  3HSF A;  4N0B A;  4IHX A;  4FE4 A;  2IA0 A;  4LLG F;  1YX3 A;  2XAS A;  3JR9 A;  3TL4 X;  3ZMZ A;  3WGI A;  4V19 K;  2B63 J;  4I7H A;  5GAD J;  3TO7 A;  4Q4Z F;  1A35 A;  2HPI A;  2PEX A;  5B5E C;  2J5O A;  2VC0 A;  2IS6 A;  2HFH A;  2R5Z B;  4FHT A;  2VKV A;  2HZT A;  4MHG A;  5HDN A;  1MGT A;  3K4C A;  4GO1 A;  2KRH A;  4XOP A;  4XON A;  1TT5 B;  3CUO A;  4WX9 A;  3COA C;  3S93 A;  4U7D A;  3C1D A;  4XMY A;  2CQK A;  1RRJ A;  3LST A;  1FC3 A;  3FXU A;  3RKY A;  2Z5U A;  2L7F P;  3K4N A;  2CRG A;  1EH6 A;  5C3E J;  3PIO F;  1MNE A;  1TW3 A;  3EQL F;  4YRV A;  3FXK A;  3J7Z I;  4ZTJ A;  4XN3 A;  2WB1 A;  3H35 A;  3NWT A;  3GZN B;  2BOL A;  2EFW A;  2DA7 A;  2DFE A;  2IBD A;  3AG4 H;  1OCZ H;  1OQY A;  1FMW A;  2WAE A;  3JW4 A;  3ZQC A;  2KMU A;  4Y17 A;  3BR1 A;  1UEL B;  3QP6 A;  1JKR C;  5BNG A;  3OS1 A;  3DLA A;  4L0Y B;  1LFU P;  2NOG A;  2NNN A;  3C2H A;  1IRF A;  2MC4 A;  4E7Z A;  4HG2 A;  2VQC A;  3TP0 A;  1MBF A;  3N97 A;  3B6A A;  4BHC A;  3HIF A;  4QSH A;  3CC4 I;  2CFX A;  3ZMS A;  1SAN A;  3H3V K;  3WU2 C;  1OMI A;  4AUX A;  4HF0 A;  2EZH A;  2F5E A;  5JR3 A;  2BE5 F;  3ZP5 A;  2WV0 A;  2HKO A;  5FKO A;  3ZN1 A;  1D1B A;  3MN2 A;  2EIJ H;  5IT3 A;  2LLK A;  1MMG A;  2Z3Y A;  2M4G A;  2RRE A;  3WTV C;  2M1B A;  3DBR B;  2KDZ A;  4KN7 X;  1UFM A;  3PO3 J;  3CTA A;  1RR8 C;  2XRL A;  4F91 B;  3JRF A;  2OBP A;  3PJR A;  2D1V A;  2VE9 A;  2L2O A;  1R49 A;  4HX4 A;  3JRE A;  4IHS A;  1Z3Y A;  2JA2 A;  3ISP A;  4RB0 A;  2LVS A;  1D5Y A;  2PJR A;  2BZT A;  3VSL A;  1MBH A;  1ZGA A;  2VON A;  1HKT A;  3HRM A;  2QBY A;  1MH3 A;  3JTG A;  2K9L A;  2VT3 A;  1V3F A;  5E1W A;  1IUF A;  4YIR X;  2DI3 A;  3HC7 A;  5IT9 K;  4P1W A;  4HF2 A;  2ZBK A;  1MIJ A;  4B47 A;  4Z2Y A;  4G6D A;  2Y2Z A;  2NXN B;  3UR3 C;  3NAU A;  9ANT A;  1ENH A;  4BHP A;  1ZRF A;  1MBE A;  1TL8 A;  1KYW A;  3HRS A;  1K7A A;  1DP3 A;  3M8J A;  4PSW A;  4D1Q A;  4P55 A;  1N25 A;  1IRX A;  2MSY A;  2P5L C;  1OLT A;  1BL0 A;  2OQG A;  2JTV A;  5LGU A;  2M0C A;  4IQ4 A;  3TOB A;  1ETO A;  3OR2 C;  4G12 A;  1QA6 A;  2UWM A;  4ESJ A;  1D0X A;  4F52 A;  3LSH A;  4BAY A;  2CJJ A;  2VKE A;  2BY3 A;  4JBA A;  1J09 A;  2IJL A;  1MW7 A;  4M3D A;  4NUB A;  2VXD A;  1QNT A;  3SFZ A;  4I2O A;  1B59 A;  1RI7 A;  2OTJ I;  1I1S A;  4N4N B;  4X0G A;  3RI4 A;  1KU3 A;  1OYW A;  2DW4 A;  2XC7 A;  2CUF A;  5IP7 J;  1U3E M;  2Z33 A;  1PUF A;  1X1C A;  4IOC F;  1P6R A;  4BHB A;  1J59 A;  1Y0U A;  3DPL C;  5F08 A;  3RPQ A;  5KVR A;  4ZJZ A;  1U5T C;  2CV1 A;  1YE9 A;  1LDK B;  3K2A A;  1YIT I;  1IDZ A;  2M87 A;  2GIZ A;  5JHU A;  3OYN A;  1Z0X A;  1HKQ A;  1OPC A;  1P2F A;  3RTR A;  5IY5 H;  3WGH A;  1BIB A;  3TBI A;  2IP2 A;  5BOX A;  4B3X A;  4XSX F;  1UG0 A;  2DXI A;  3GWZ A;  1MMA A;  1JHF A;  2LR8 A;  3BPV A;  1DGR M;  1Z7L A;  2X51 A;  5HOD A;  3D1N I;  3Q0V A;  1EF4 A;  1LKX A;  1Z05 A;  2IGO A;  2VC1 A;  4WXD A;  4HQM A;  1VFC A;  1X1P A;  1U78 A;  1SFE A;  1IGN A;  2DA4 A;  2YX7 A;  3PL8 A;  1I5Z A;  2M2E A;  4U88 A;  5K7H A;  4RGR A;  3EUH A;  4C2U A;  5IYC J;  3DQV C;  3F6V A;  4ZH4 F;  5IPA A;  1IXR C;  1T0F A;  2DFH A;  2HQA A;  1VQL I;  2C6Y A;  1Y8Q B;  5E8G A;  1KU7 A;  2DTZ A;  2F4O B;  2XB5 A;  4ENJ A;  3UKG A;  4RB2 C;  4RDU A;  3QOP A;  1V5E A;  4LG0 B;  4LB6 B;  4BQA A;  2ISY A;  3HOW J;  5GAE J;  4IJA A;  2KJC A;  2M8G X;  3B6C A;  3K2Z A;  1USS A;  4A3D J;  1HW2 A;  1R1U A;  4S0H B;  2X6O A;  2FOW A;  3BTI A;  1KQ8 A;  1L3L A;  4BJT A;  4UHT A;  2P5K A;  1S72 I;  4WXH A;  1W7P A;  1RZ4 A;  3WTU C;  4BL0 B;  4JOM A;  1XCB A;  5EG0 A;  2IRF G;  1RKT A;  2CQ7 A;  1P4W A;  2Q2E B;  2I10 A;  2ZKZ A;  3JRI A;  3E6C C;  2XAF A;  2JA7 J;  2EIN H;  3PNT A;  4BU2 A;  1P4X A;  3KP5 A;  2K3F A;  3F9K A;  1VQ4 I;  4HW0 A;  3OMY A;  3S3N A;  2IGK A;  4HAM A;  1U9O A;  4E70 A;  3IH4 A;  4HX8 A;  2QSH X;  3Q9V A;  2EA2 A;  1OJL A;  3TDU C;  4ABZ A;  1TP4 A;  3E5X A;  3WU0 A;  1LFB A;  4AIH A;  3ZMV A;  1S8N A;  4FCY A;  3G6E I;  1R1V A;  3L2U A;  2KZV A;  3GTJ J;  4A3J J;  4KFC A;  1SMY F;  2HZD A;  3C2G A;  4R1H A;  1FY7 A;  3TGN A;  2R7U A;  2PMZ A;  5H20 A;  3GFI A;  2FXA A;  2HTJ A;  4PGG A;  3U1D A;  1FYM A;  3PNY A;  4XRF A;  1EJ9 A;  4BEH B;  5C4J J;  1HDP A;  3F6O A;  1AKH A;  2MC3 A;  1X3U A;  2L4M A;  1TNS A;  3TKY A;  5HDK A;  3BTL A;  1ZRD A;  1XTA A;  4AID A;  3RPU D;  3WHC A;  3BZC A;  3IH2 A;  1IV6 A;  5JLX A;  1MJB A;  3BR0 A;  2JPB A;  2KJB A;  1G59 A;  1YRN A;  4IQJ A;  2MG4 A;  4BQO A;  3K10 A;  3IH3 A;  4EQQ A;  1TBX A;  3JRB A;  3TMO A;  4G7Z F;  4IX7 A;  4E4H A;  2EZI A;  4FX0 A;  3KP6 A;  3ZQ7 A;  2HDC A;  1U8R A;  3SDB A;  1RC9 A;  3C3W A;  4F7Z A;  2CW7 A;  5D6E A;  3BPX A;  4FX4 A;  1GVJ A;  2DYR H;  1OR7 A;  3HGY A;  2AXT C;  4XBF A;  3CCQ I;  1YRN B;  4CCN A;  2OCE A;  3ZQQ A;  3BCB A;  1G8X A;  2R7S A;  2GQQ A;  1OCC H;  3MZ8 A;  3TW6 A;  4DJA A;  4JK1 X;  2OA4 A;  3GZ6 A;  1QBJ A;  3GZ5 A;  2WA0 A;  3I55 I;  1KYZ A;  3TW7 A;  1DP7 P;  4ESB A;  4H0E A;  4C3J J;  1QGP A;  2PLY A;  3E6M A;  2CW0 F;  2WAD A;  3HEF A;  4I09 A;  3NRV A;  4M9X A;  2L7K A;  3LQR A;  3S3O A;  2IGM A;  1J2X A;  1DPU A;  4A3K J;  4OIO F;  4PUS A;  4MIM A;  3F0C A;  1I39 A;  2H1L A;  3ZQG A;  3S1Q J;  4P9F A;  2K9N A;  2HS5 A;  5DCF A;  3GTL J;  4PSX A;  3F21 A;  5J1U A;  1LDD A;  5TIS C;  3WE3 A;  2JQ7 A;  4I01 A;  1TWG J;  5B66 C;  2ISZ A;  2QKM B;  5J1R A;  3ECH A;  2L4A A;  4CCL A;  2NVX J;  1ONV A;  1IO2 A;  1D5V A;  4MQV A;  1LEB A;  2MYS A;  2L0K A;  1ODD A;  3A0B C;  3D0S A;  1XCV A;  2CQX A;  2W85 A;  3J81 K;  4G6Q A;  1FYK A;  2BV6 A;  1NTC A;  2PMU A;  3S8P A;  4C9Y A;  2E2J J;  2EFO A;  2FF4 A;  2H8W A;  4AVZ A;  2VPL A;  3OYC A;  2K02 A;  3SFI A;  4GCV A;  3BR6 A;  5L3G A;  2O3F A;  2QQ9 A;  1BBY A;  1S6L A;  1TQM A;  3GX4 X;  3SJM A;  1MMS A;  2VJI A;  1TC3 C;  2LKX A;  1KQ9 A;  2MH2 A;  4UVC A;  3NAR A;  4UVA A;  5D5W B;  2V9K A;  4FIS A;  1RPW A;  4XLP F;  3CF5 F;  3GW2 A;  4QTR A;  2A3S A;  2K5C A;  1JKP C;  1BJA A;  3LOC A;  1Q1H A;  4M71 A;  1O3S A;  2ZJP F;  3GLX A;  2K9M A;  2VLA A;  4EJV A;  3FXQ A;  2ZFU A;  3CUQ C;  3F8C A;  3GCM A;  4P9U A;  4CXF A;  3I59 A;  4DYR A;  1FBS A;  4HST A;  3QU6 A;  1LDJ A;  3DEU A;  1T38 A;  1GXP A;  2OUM A;  1IN5 A;  4B44 A;  1I27 A;  3F23 A;  2YPR A;  2EFN A;  4G9Y A;  4AYB N;  2HU9 A;  1EV7 A;  4R79 A;  2TCT A;  1SFU A;  4B1R A;  2VXZ A;  2QGU A;  3K4B A;  2ICW G;  1I1G A;  2PQ8 A;  2QZ8 A;  3HPH A;  3EUA A;  3V42 A;  1DGW Y;  1ZLJ A;  4YFK F;  2R7T A;  1HCR A;  4ZZD A;  5FB2 A;  4CCO A;  1DU6 A;  2LY1 A;  3GTO J;  2CG4 A;  1PYV A;  2XKO A;  3F8N A;  1JUP A;  3IC7 A;  3VDX A;  1LVK A;  2WAQ A;  2DYS H;  2PG4 A;  1BI3 A;  2RNG A;  3OYE A;  4YII A;  1T08 B;  1T98 A;  3QQA A;  2M5W A;  1CGP A;  3M07 A;  3M1C A;  5EEH A;  3UNG C;  4HZF A;  1YJN I;  1VF9 A;  4MEY F;  5EGO A;  2EJR A;  2E1C A;  1WJF A;  3WG9 A;  3AAF A;  3F8F A;  1RES A;  3EYY A;  5E20 A;  3AG2 H;  3F8B A;  3ML6 A;  1JT6 A;  1V5F A;  5K7F A;  2E1M C;  2LBF A;  4B4C A;  2VQG A;  4G7O F;  3AG3 H;  5A2Q K;  1Z6R A;  1MND A;  2Z16 A;  2L5Q A;  3GTQ J;  1KGS A;  2ID3 A;  2W00 A;  4HBL A;  4M72 A;  3CD6 I;  2LY9 A;  1VQ8 I;  5EGO B;  1FBU A;  4WK8 F;  2ME0 A;  4CDG A;  4XK4 A;  5J4V A;  2OD5 A;  1X1D A;  3NQO A;  1B8I A;  4J00 A;  4HNV A;  3I56 I;  4F92 B;  2CGP A;  2YU3 A;  2FE3 A;  4KDP A;  5ICF A;  3DLL F;  2FBK A;  2DO7 A;  2H1K A;  5HS7 A;  4RGU A;  4BDZ A;  1IN7 A;  2R7F A;  5J6X A;  2LSO A;  5LRR A;  5GAH J;  4QPO A;  1XDS A;  2KQR A;  3A01 B;  1B8I B;  3GUD A;  4XL9 A;  1TW2 A;  4A3F J;  3BP8 A;  3U2R A;  3H9J A;  3MKL A;  3O8H A;  3DBL B;  2UV1 A;  1ZAO A;  3HHH A;  2CV0 A;  4EJW A;  4ENM A;  3S1N J;  2IS4 A;  2RAE A;  3QWL A;  2A5Y B;  3RCO A;  3I4N J;  3DPT A;  5KCM A;  4DYC A;  2FA5 A;  4JP0 A;  3CCM I;  3Q0W A;  2E5N A;  2JK3 A;  3NWS A;  1LUJ B;  2M7B A;  3CJQ B;  4RM2 A;  3CCY A;  3RPU A;  5AON A;  3DCF A;  4HQE A;  5D5U B;  1YFH A;  4CYC A;  3HOU J;  4S05 A;  3BJA A;  2DAO A;  4V2G A;  2VAS A;  4W97 A;  3VYR B;  3J7Y J;  1UST A;  3G4S I;  3DU5 A;  3OS0 A;  2BY0 A;  3QPH A;  3MKY B;  3GFM A;  5HNH A;  2IS2 A;  1ZR2 A;  2KT0 A;  4HDU A;  1X2M A;  2RVC A;  1N75 A;  2FD5 A;  3FHZ A;  3DTI A;  3MEX A;  3HHG A;  2OZU A;  5EYR A;  2Q8K A;  2COB A;  1PUE E;  3QPL A;  4KIB A;  2VQL A;  3KZZ A;  4TV7 A;  4D7M A;  3EPZ A;  5LBQ A;  1ETW A;  5FGM A;  1HA8 A;  4DBR A;  2DTR A;  5HS8 A;  3RZO J;  1DDN A;  2R7X A;  2GIV A;  1A5J A;  3PUF A;  2HGC A;  3BTJ A;  2A07 F;  3BJO A;  2ESN A;  3CJN A;  2R7D A;  4XLF A;  2E60 A;  3DEE A;  2DK8 A;  4LIT A;  1D8K A;  1P7I A;  1VZ0 A;  3K7A J;  2CFO A;  4MLO A;  1R4N B;  2P81 A;  3H5R A;  2KRC A;  3R60 A;  4PK4 A;  3DKY A;  4ANJ A;  5J47 A;  1ZG5 A;  1RKW A;  2AHQ A;  5KAF C;  3CMM A;  3HUG B;  1B72 B;  2L9S A;  5J40 A;  4QPQ A;  3VEP A;  5TRD A;  3MZH A;  2ADU A;  1TNT A;  1FPQ A;  4YIF A;  4UUS A;  1QZY A;  5DM7 F;  1B4A A;  4DYQ A;  4AU7 A;  3WHB A;  4EAT A;  1HW5 A;  4FAS D;  4PJ0 C;  2CSO A;  4HEA 2;  1GVD A;  2Y0S N;  5BQT A;  2ZME B;  5F0H A;  3OYJ A;  3Q3S A;  3DF8 A;  5BPI A;  2KDO A;  1BI0 A;  2MW8 A;  3X2Q H;  4DGW B;  1LQ1 A;  3CMY A;  1FIA A;  2V26 A;  1A36 A;  3CO6 C;  1POG A;  1U5T A;  4D5F A;  5DEQ A;  4ZDO A;  3QOD A;  4L9N A;  4L5J A;  1W7P D;  5HOO A;  3WU1 B;  2XAJ A;  2NVU B;  2GXB A;  5D4S A;  1LEA A;  4X1E A;  1T56 A;  2V1X A;  2QUF A;  1R23 A;  2MH9 A;  3EET A;  5IP6 A;  3IKT A;  3QRF F;  4L18 B;  1I6H J;  2XIG A;  2AQE A;  5FRM A;  5GPA A;  1D0Z A;  2F5D A;  3VYU B;  1FTT A;  1SFO J;  5F6F A;  5CVJ A;  2CUZ A;  2M7A A;  3P5J A;  1IRG A;  3IWZ A;  4ENN A;  3M8E A;  1SEU A;  3J80 Z;  4LMY A;  2L54 A;  3K69 A;  1B6A A;  4M74 A;  1RUO A;  4IKF A;  1D0Y A;  2XGX A;  1MJ9 A;  5LHG A;  2DOD A;  4RBO A;  3WTX C;  3E97 A;  1BM9 A;  2VKD A;  1SD4 A;  4CZZ A;  2LP0 A;  4RMN A;  4A3E J;  4CZC A;  5GTH C;  1BW6 A;  1MKM A;  1WCM J;  2FNA A;  2VBY A;  1YX5 A;  2Y0M A;  1OFC X;  3I54 A;  3K4K A;  4C3I J;  2IT0 A;  1PJR A;  5H6Q A;  2W1O A;  4A2U A;  2A61 A;  3GTM J;  2YU9 J;  3F3X A;  2E1N A;  2ECC A;  2M30 A;  4D5C A;  2XUB A;  5D8L B;  4MGR A;  1X3W B;  2V4J C;  4JYK A;  3CCV I;  3QOE A;  1FX7 A;  2GWR A;  2IA1 A;  4G8X A;  5GPC A;  4C3H J;  3Q9S A;  4E6K G;  3QPT A;  2L7M P;  3I5U A;  2CW8 A;  1J7K A;  2XPV A;  1GT0 C;  5HLT A;  3L2C A;  5IYB J;  2LD5 A;  3E7L A;  2OCC H;  4B3A A;  2DA6 A;  4M3F A;  1WJB A;  2QM3 A;  4IZZ A;  1MDM A;  5J3L A;  3WOD F;  5L3F A;  2E1O A;  1XD7 A;  2GA2 A;  3H3U A;  1XB4 A;  5ICE A;  1X1A A;  4QLC U;  2P4W A;  1XS9 A;  1IV8 A;  2Z9O A;  1M1E B;  4O3M A;  5FO5 A;  4DZP A;  2ZNZ A;  4KNY A;  3JRG A;  1V5G A;  2HQN A;  4RAG A;  1T6S A;  1VQM I;  1QQI A;  2DA2 A;  4L5I A;  2DDB A;  1I6X A;  2KKO A;  4ESF A;  1P4A A;  1SAX A;  3GO5 A;  2QF7 A;  1H89 C;  3FMS A;  1MH4 A;  1QRY A;  5DD8 A;  1ZR4 A;  1JTY A;  1F36 A;  2TRT A;  2VBW A;  5FRO A;  1OYI A;  2VBX A;  3S14 J;  3DTK A;  2PJR B;  1IRZ A;  4FQG A;  1OKR A;  1PVE A;  5F1R A;  1YW9 A;  2D2W A;  1K79 A;  5KK1 A;  4XLE A;  2ZCW A;  1Y0N A;  2QBY B;  1JT0 A;  4HNT A;  3H36 A;  2HYJ A;  5IT9 Z;  1Y56 A;  1TWC J;  4BJ5 C;  3T1B A;  4PDK A;  2G7H A;  1QPM A;  2PBI A;  2H27 A;  5J1Y A;  1W0U A;  1D1A A;  1UCR A;  2UUZ A;  4DNC A;  1FEX A;  1FP1 D;  3BRO A;  2XF5 A;  1WKM A;  1L0O C;  2EIM H;  5FKK A;  4XRS A;  1X4P A;  4O6J A;  2H6C A;  2K9S A;  2MBF A;  4XLA A;  2MLK A;  3JSO A;  1ERD A;  3FXJ A;  1YHQ I;  1BJZ A;  2JJ7 A;  2GBY A;  1SFX A;  2OC6 A;  2ZSH B;  3OWT A;  2O61 A;  2DT6 A;  4A93 J;  1QZE A;  1KON A;  3OSG A;  2KIQ A;  3KE2 A;  5M5Y J;  1O4X A;  2DU9 A;  2QSG X;  1H9T A;  1OCT C;  1ACI A;  4F3Q A;  1FZP B;  3S2D J;  2W84 A;  3TO6 A;  4OIP F;  3GXO A;  1R9T J;  4WF2 A;  3A0H C;  1PUF B;  3OL3 A;  2AS5 F;  3ERE D;  3DP7 A;  1YG2 A;  2DBB A;  4Y13 A;  5CPR B;  1JGS A;  1UZC A;  4HRI A;  2LF7 A;  2DJN A;  1WH5 A;  2RDP A;  3K6G A;  1LE8 A;  2OPT A;  2STW A;  4BY7 J;  4CO8 A;  2F2E A;  1AA7 A;  1P92 A;  2DN0 A;  1Y1V J;  1Z91 A;  3D5R C;  4QIW N;  4XOR A;  2ELH A;  4M3G A;  1BR4 A;  4UY8 I;  4A6D A;  3FF5 A;  1MJA A;  2NS8 A;  2XSJ C;  1YJW I;  1K6O A;  4PJM A;  3SHF A;  3ZRG A;  2JWT A;  2F5V A;  4MFE A;  3HG9 A;  3U1K A;  3LWF A;  2IXS A;  2W24 A;  2L9R A;  4N4O B;  4C30 A;  3IAM 2;  2EPF A;  2EZL A;  3CF2 A;  2HOT A;  3CUQ A;  2VOP A;  2BVL A;  4YEJ A;  4IO9 F;  2DMU A;  4RM3 A;  3OYB A;  1K61 A;  5DCM A;  1W5C C;  1KU2 A;  5DYM A;  2HI3 A;  5E8I A;  4PFO A;  2X0L A;  4DOZ A;  3HXL A;  1G2H A;  4U0Y A;  2CMP A;  2VN2 A;  2CYY A;  2RV8 A;  3I9V 2;  4PJJ A;  4XLC A;  4RAZ A;  3CUQ B;  3MD2 A;  3FWE A;  3KPH A;  3ZOB A;  2P6S A;  2QCO A;  2YSR A;  3TED A;  3DKX A;  2BGC A;  3K70 C;  1HXD A;  1XG1 A;  2O6G E;  4EV0 A;  2PN6 A;  3DBH B;  3G1M A;  3KZI C;  1W7P B;  2LH9 A;  1HF0 A;  5EG0 B;  4RLF A;  2X6X A;  3K4L A;  4DQ2 A;  2R7Q A;  3OIP A;  4II2 A;  3S17 J;  2K3P A;  4XLN F;  4XIC A;  3GFJ A;  1IJW C;  1R00 A;  3OYH A;  2K86 A;  2EBI A;  4FE7 A;  4MTE A;  4UUV A;  4PJN A;  1QHG A;  5J8F A;  2K40 A;  1WI9 A;  4I0A A;  3MKZ A;  5K5O A;  2OJE D;  1JTX A;  2HTS A;  2O7O A;  1W0T A;  1FTZ A;  3W6V A;  1OYY A;  5F1J A;  4A3G J;  1NG7 A;  1MBJ A;  3KZY A;  1O7L A;  5FFZ A;  1TZL A;  2L9N A;  2YS9 A;  1HQC A;  2XAG A;  2LY2 A;  1BOA A;  5IP9 J;  2AQF A;  3FXO A;  1YOV B;  4I98 B;  1G3W A;  3DFG A;  3V8K A;  4LLN A;  1GXQ A;  2GOX B;  1IAW A;  1H8A C;  3L1P A;  3ESW B;  2EIL H;  2MFZ A;  4ZDP A;  3BR2 A;  4MO7 A;  4PZJ A;  5J4Y A;  2DMP A;  3CDI A;  3KIO A;  5BPD A;  3WTY C;  1A04 A;  3FKJ A;  2JRT A;  4A3C J;  2E71 A;  1SD6 A;  4EM1 A;  3BG5 A;  1UG2 A;  2CO5 A;  1AKH B;  2EV5 A;  2ZJQ F;  2CU7 A;  2E19 A;  2VIX A;  2FEZ A;  2VE8 A;  3PO2 J;  2PJP A;  4BXX J;  1XSV A;  2CQN A;  2RQQ A;  4JX4 A;  1ZAR A;  2F6C A;  3LA3 A;  3ZMD A;  1CF7 A;  2NRA C;  2K27 A;  2E1M B;  4E7H A;  1JUS A;  1ZKG A;  2ZSI B;  3BCA A;  2NVQ J;  1TT0 A;  1X1B A;  1IN4 A;  4RGX A;  1E0E A;  3PFI A;  3TP3 A;  5GP9 A;  1YIJ I;  3VOE A;  2VT2 A;  2E7X A;  4NNJ A;  2GZW A;  3RJP A;  3VOD A;  2PI0 A;  3N05 A;  3SEZ A;  3QU3 A;  4G7H F;  4BQN A;  3PM1 A;  3CMA I;  2JVG A;  1OCP A;  5HLI A;  3FIS A;  1G3S A;  2DLL A;  3KEQ A;  3ABU A;  2E2H J;  4U87 A;  3ONQ A;  3W6J B;  4BY1 J;  5CQG A;  2XF6 A;  2FQ4 A;  2DT5 A;  2L3D A;  3AL0 B;  3RQ4 A;  1SD5 A;  3HM5 A;  3HOY J;  2QEX I;  4IVN A;  1XMK A;  3ZQL A;  5H2F C;  1LVA A;  1TWA J;  5L3D A;  3BZK A;  2HVQ A;  3KET A;  5E3O A;  2K4B A;  2VL8 A;  3SZG A;  4ZYG A;  1Z21 A;  2A68 F;  2HQ5 A;  3WG7 H;  3FMQ A;  1FP2 A;  1LPQ A;  1WJC A;  2WC2 A;  2Z99 A;  5M3F J;  2X1D A;  5DTD A;  3KX2 A;  3BZ6 A;  5FLM J;  5KNL A;  5KAI C;  3S2H J;  3JAM K;  2OV7 A;  4XID A;  1U6G A;  2LC2 A;  2P0W A;  2FUG 2;  2KIS A;  2M9H A;  3G73 A;  2ZJ2 A;  2AO9 A;  2A6T A;  2LKS A;  2JVH A;  1IC8 A;  1ETQ A;  1BIA A;  1XGS A;  3J81 Z;  3H0D A;  4A3I J;  3OIO A;  1FWZ A;  2XRN A;  4GGG A;  2NVT J;  4EMS A;  5F04 A;  3GTK J;  3VPR A;  5FLV A;  2E5Z A;  2ELJ A;  1UHS A;  1YTY A;  1DU0 A;  5JFR A;  3CJR B;  3KYD B;  1PP8 F;  2W4S A;  2V79 A;  2P8T A;  1R1T A;  5M5W J;  4UV9 A;  3KYC B;  3GEZ A;  2IW5 A;  1Z1D A;  2VOD A;  2GM4 A;  1FOY A;  1H88 C;  4Q48 A;  4OIQ F;  1MBK A;  3RYP A;  2LDU A;  1XN7 A;  2W82 A;  4U0W A;  4IHT A;  2F5C A;  1R4M B;  1MD0 A;  1QHH D;  2X4H A;  5K5R A;  1EH7 A;  2H94 A;  3M8F A;  4MEX F;  3HPG A;  2LOO A;  4Y15 A;  1ZN2 A;  3H92 A;  3I59 B;  2BHZ A;  2P5V A;  3W2A A;  3V7C A;  3ABK H;  4RB3 C;  1X4O A;  1B1B A;  4ZYA A;  4A3M J;  3FXR A;  2LF8 A;  1ZEL A;  2HEO A;  5LFA A;  2EV6 A;  2JMW A;  5C4X J;  3KP4 A;  3E6D A;  1P9Q C;  2X6Y A;  1J9I A;  3MFK A;  4J01 A;  3CJT B;  3F72 A;  4MNU A;  2COM A;  4KIC A;  1ZK8 A;  5TJJ A;  3ZMU A;  1G4D A;  1MNM C;  1S9H A;  2RKH A;  5JVG F;  5CVU A;  3EYI A;  2HVS A;  2LYC A;  3BR3 A;  1Z9C A;  3JCU C;  3ZGK A;  3CCU I;  2MAB A;  4EM0 B;  5D4R A;  1T2K A;  3VB2 A;  1G3Y A;  1YI2 I;  1U9N A;  3A03 A;  5CKT A;  4A5M A;  3RKQ A;  5E17 F;  3FK7 A;  1YS7 A;  2FU4 A;  2JUG A;  3CC7 I;  1R6R A;  4D7N A;  4LD5 A;  5FLX K;  3W2W A;  3RZD J;  2FOK A;  5CVI A;  3HOS A;  3TQN A;  4CYD A;  3MQ0 A;  5B3S H;  1BA5 A;  1ULY A;  3SXY A;  3ZCO A;  4NQW A;  3HJE A;  1O3R A;  2OZ6 A;  5B1A H;  1AWC A;  3M3Y J;  5F0C A;  3B02 A;  1ZH5 A;  3BC8 A;  1A6I A;  1FOX A;  2LBF B;  5A2Q Z;  4ON0 A;  5CJ9 A;  4CHU A;  3DV8 A;  2R93 J;  2ZXI A;  2OF7 A;  2HWV A;  2OTL I;  2H6B A;  3KFW X;  2ZO4 A;  3ABL H;  4BYY A;  2H8R A;  4E7J A;  2WY7 Q;  2GA1 A;  1IDY A;  4NQW B;  5FJ8 J;  3OSF A;  2XGD A;  4ETS A;  3ZR8 X;  4KYW A;  2A6H F;  2XGC A;  2WB1 N;  3KEO A;  3MZY A;  4RB1 A;  1FSE A;  1WJE A;  2BY1 A;  3L2Q A;  1VQO I;  3I4P A;  1LJ9 A;  4XR6 A;  1G6N A;  2UXX A;  3BDD A;  1FNN A;  4GRI A;  2GOM A;  4M6X A;  2QLZ A;  5JLW A;  4M3E A;  3LA2 A;  1EA3 A;  2KIU A;  1Z77 A;  4L9J A;  1JI8 A;  3IRR A;  1R5H A;  2IVM A;  3CME I;  1U8B A;  2ELK A;  4WCG A;  4CGZ A;  1PDN C;  3Q5F A;  3IUO A;  1U0J A;  2DA1 A;  3ZQH A;  3V7S A;  4XRM A;  2DFF A;  1T8I A;  4UNO A;  1JKQ C;  2M34 A;  1GLN A;  1IW7 F;  1R5G A;  1CQT A;  4UUT A;  3H9Q A;  2BHY A;  4ENK A;  1K78 A;  2GXA A;  1ETK A;  3HBL A;  4OU0 A;  1SVM A;  1FOK A;  1R5I D;  2ZXJ A;  3SZT A;  5BS6 A;  3K9T A;  3C18 A;  3IV5 A;  2G0E A;  2V1U A;  4GFB A;  4AM3 A;  2VJJ A;  2MD5 A;  3QYE A;  3NEU A;  1QO0 D;  2ACJ A;  2M3A A;  1MMD A;  1S7O A;  1E3P A;  2FRH A;  3FX3 A;  4CYC B;  4I0B A;  3OYM A;  1AU7 A;  3QYB A;  2JA8 J;  3B73 A;  3HTU A;  1TQP A;  1HKS A;  3FM3 A;  1ETX A;  4HDV A;  2F48 A;  3N4M A;  3LSG A;  4Y7N J;  5E18 F;  3JRH A;  1W5S A;  2UZK A;  3FKI J;  2Y31 A;  1J75 A;  2KFD A;  4L0Z B;  2X6W A;  1A6Q A;  2KIF A;  2BVM A;  4BS9 A;  4OOI A;  2DOF A;  4X6A J;  1S29 A;  4V2F A;  4DIQ A;  4WXC A;  5D8K B;  4NHJ A;  3GME A;  3P9C A;  1V54 H;  1WRJ A;  3K4M A;  2J5P A;  2W7N A;  3HKZ A;  2JN6 A;  3QPS A;  1JGG A;  2R4G A;  2FNP A;  1MSF C;  4G94 A;  2LTP A;  2M0M A;  4G6T B;  3G1L A;  4GYG A;  4IHV A;  2DK5 A;  6PAX A;  4HSR A;  1TTY A;  3BQZ A;  1GV2 A;  2XF7 A;  3HL2 A;  1GV5 A;  2WV1 A;  4Q47 A;  3HSE A;  5F27 A;  1XGN A;  2I5U A;  3FDY A;  4JX6 A;  1K4S A;  1X2N A;  3KLO A;  5L3B A;  3HTS B;  4BH9 A;  3M7G A;  4UUS B;  1ON1 A;  4AIJ A;  2G7U A;  2R7Z J;  4BXU A;  4D0P A;  3OYI A;  2CS3 A;  3AKZ A;  1ZLK A;  1LFP A;  3KLN A;  4J19 A;  5CVV A;  4M73 A;  4AYB A;  2BW3 A;  5DDG A;  2HOE A;  4JQF A;  3ABM H;  1HW1 A;  3OYF A;  3TOA A;  4XKW A;  1Y39 A;  3OS2 A;  1U5T B;  1TWH J;  1HC8 A;  1UAA A;  4A3B J;  1G3T A;  4EEF G;  3WE2 A;  3P9K A;  3U9G A;  2VKH A;  4KUM A;  2HXO A;  1SVO A;  2CUE A;  5AIQ A;  5LHI A;  3GYH X;  1ETV A;  1UJ8 A;  4MFD A;  5FFX A;  3RKW A;  2HXI A;  3RIR A;  3WTT C;  3M1E A;  1FJL A;  1EH8 A;  3LAP A;  2ZXW H;  1WI3 A;  1HDD C;  3OY9 A;  3OYG A;  2E36 A;  2JRM A;  2PFB A;  1RET A;  3H0G J;  2G9W A;  3P7N A;  1MMN A;  3R0A A;  3VYS B;  1K83 J;  2QQA A;  2R5Z A;  5ILU A;  2DJI A;  2EZK A;  2KP6 A;  3KEY A;  4II3 A;  4E7L A;  2NYX A;  2KIM A;  2HQR A;  2P7V B;  2VBZ A;  3H5A A;  5DUI A;  5LEJ A;  4ZDL A;  3BG9 A;  3WTS C;  2M8E A;  2LK2 A;  2XPU A;  2Y69 H;  4Y4R A;  4HLX A;  4BAC A;  5D5V B;  1A31 A;  2HOS A;  4HNU A;  3MAJ A;  4XKB A;  4UXN A;  2W48 A;  1NG6 A;  3G2B A;  5LRS A;  4KIF A;  3R0J A;  3S1R J;  3MWM A;  4EVI A;  2HKX A;  3LSI A;  3IAS 2;  3JSP A;  4E7I A;  5HNF A;  4A12 A;  3ERM A;  2RQP A;  4ASN A;  4ZYH A;  2K85 A;  2VQH A;  1XSX A;  3WTW C;  2OAZ A;  3BJ6 A;  3RDI A;  2L9V A;  1XMX A;  4L9T A;  2JUC A;  2K7L A;  5CYV A;  1ZQ3 P;  2FMY A;  1I3Q J;  3OV8 A;  4CH7 A;  4K2E A;  1SC7 A;  3BTC A;  4NDL A;  4XN0 A;  3G71 I;  4FTH A;  2R92 J;  1FT9 A;  2RNJ A;  1F43 A;  2BXZ A;  1R71 A;  5J8C A;  1Z6T A;  3BG3 A;  2QSF X;  1BN5 A;  3RSN A;  2DMT A;  1F1Z A;  4L9V A;  1MDM B;  2STT A;  1IZ1 A;  4XLH A;  2XKP A;  2HYF A;  3GTP J;  1ORK A;  4CIC A;  3GFL A;  3VSK A;  1FLI A;  1R58 A;  1YJ9 I;  2PMZ N;  4B48 A;  2VB6 A;  1RNL A;  1YS6 A;  2BXY A;  3LSM A;  2DPD A;  2EIK H;  2R7V A;  3CCE I;  4LFU A;  3KP7 A;  3EUK L;  4FT8 A;  3IP4 B;  1YLF A;  2W57 A;  1ZGJ A;  2HVR A;  2ZJR F;  5DM6 F;  3S16 J;  1VQ5 I;  5IOY A;  4LG3 A;  2XRO A;  2WBM A;  4HOB A;  1JXS A;  5FD5 A;  2GXG A;  4XM3 A;  2P7C B;  3H1C A;  1XMA A;  1JJ6 C;  2FQ3 A;  2MLG A;  1B9M A;  2ZFW A;  3P9I A;  1IXC A;  3CP8 A;  2BYV E;  2E2I J;  1EKE A;  5ED4 A;  1T33 A;  1E3H A;  1XGM A;  2DQR A;  5LEK A;  3J7A Y;  5BMZ A;  5HLH A;  2L01 A;  3BOQ A;  5LGT A;  2QKL B;  2JA5 J;  4U0V A;  1OCO H;  3V4G A;  4YFX F;  4AC0 A;  1VTN C;  1XDU A;  3L2V A;  4A0Y A;  4M3B A;  5GAG J;  5E1X A;  5EZH A;  2EK5 A;  3KYL A;  5F64 A;  2Y9Y A;  1I3A A;  2A5W A;  2DOE A;  4HA8 A;  2JSP A;  4IF4 A;  5FKL A;  1O7F A;  1W1W E;  2HDW A;  1I50 J;  2LFB A;  2L7Z A; 
#chains in the Genus database with same CATH homology
 2RNG A;  2RQQ A;  3OYE A;  2F6C A;  4P5O A;  4YEL A;  2E1M B;  3VYT B;  1N78 A;  2LG4 A;  3M1C A;  4PJL A;  3UNG C;  3FHN A;  4E7H A;  1WJD A;  2ZSI B;  3BCA A;  2BW3 B;  1TT0 A;  1WJ5 A;  1X1B A;  1E0E A;  1WJF A;  3I3L A;  1FMV A;  4KIT B;  4XOT A;  2VJ4 A;  4NC7 A;  4KIS A;  4F55 A;  1V5F A;  4H4K C;  2E1M C;  2LBF A;  2VQG A;  4NNJ A;  2Y0S A;  3N05 A;  1MND A;  3SEZ A;  2Z16 A;  4BUP A;  2L5Q A;  2CH0 A;  4BQN A;  1YX3 A;  3H9G A;  2W00 A;  3OOU A;  3TL4 X;  2JVG A;  2M4K A;  4U87 A;  1N77 A;  1SFK A;  3ONQ A;  5CQG A;  2XF6 A;  1X1D A;  4RLQ A;  4J00 A;  2Q1Z B;  3PUB A;  4F92 B;  2HPI A;  3OYL A;  3AL0 B;  2IS6 A;  1K6Y A;  4BDZ A;  3RQ4 A;  2MD0 A;  2VJ5 A;  4BXF A;  1BOB A;  3K4C A;  2KRH A;  3A4C A;  4XON A;  4XOP A;  4QPO A;  2HVQ A;  2KQR A;  4ZTF A;  3S93 A;  4E7S A;  2VL8 A;  4XL9 A;  3SZG A;  1Z21 A;  3L2R A;  4XKV A;  4XMY A;  3H9J A;  1WJC A;  2DT7 B;  2X1D A;  4OWR B;  2UV1 A;  3KX2 A;  3K4N A;  5KNL A;  4Y33 A;  2CV0 A;  2OV7 A;  2IS4 A;  1MNE A;  4YRV A;  2LC2 A;  3RCO A;  3DPT A;  2P0W A;  2FUG 2;  5KCM A;  4ZTJ A;  4XN3 A;  2WB1 A;  3H35 A;  2E5N A;  3NWT A;  3NWS A;  2BOL A;  2M7B A;  3CJQ B;  3GBG A;  4RM2 A;  1FMW A;  2WAE A;  2A6T A;  5FRN A;  2JVH A;  2KMU A;  1UEL B;  3H0D A;  2VAS A;  3VYR B;  3OS1 A;  3DLA A;  2CV2 A;  3DU5 A;  3E0J B;  3C2H A;  3OS0 A;  2E5Z A;  4OAZ A;  5KHD A;  2MC4 A;  4E7Z A;  2ELJ A;  3MKY B;  4HG2 A;  2VQC A;  5HNH A;  2IS2 A;  3CJR B;  1N75 A;  5CQE A;  2W4S A;  3DTI A;  3QYF A;  3PSF A;  2VQL A;  5TGT A;  3EPZ A;  1HA8 A;  4DBR A;  4ITV A;  2R7X A;  2W82 A;  1D1B A;  1QHH D;  1MMG A;  2M4G A;  2RRE A;  4XLF A;  2E60 A;  3W3C A;  3DEE A;  3HPG A;  4LIT A;  1VZ0 A;  2LOO A;  1X19 A;  2R7O A;  2CFO A;  4MLO A;  4ANJ A;  3H5R A;  2KRC A;  4PK4 A;  3W2A A;  3DKY A;  4F91 B;  3VWB A;  3HOT A;  3K4J A;  3PJR A;  2L2O A;  1X4O A;  4ZYA A;  1Z3Y A;  2JA2 A;  3LFU A;  1ZEL A;  3PSI A;  3CMM A;  4OAY A;  3HUG B;  5LFA A;  1W36 C;  2PJR A;  2L9S A;  3VSL A;  4BEH A;  2V7F A;  4QPQ A;  3MKW B;  1P9Q C;  4E7K A;  2X6Y A;  3OIQ A;  2K9L A;  4ZC3 A;  4J01 A;  3DWL E;  3HC7 A;  4LIV A;  4AU7 A;  4P1W A;  2IS1 A;  4EAT A;  1S9H A;  4B47 A;  4FAS D;  2KL4 A;  4HEA 2;  4CCK A;  3UR3 C;  3OYJ A;  2HVS A;  2LYC A;  2KDO A;  4DGW B;  1DP3 A;  3ZGK A;  2V26 A;  3M8J A;  2MAB A;  4PSW A;  4D1Q A;  1IRX A;  1OLT A;  2Z2S B;  5CKT A;  4ZDO A;  3QOD A;  4IQ4 A;  2JUG A;  3OR2 C;  1R6R A;  5HOO A;  5JHF A;  3W2W A;  2UWM A;  1D0X A;  4F52 A;  3HOS A;  3LSH A;  1J09 A;  2AQE A;  4NUB A;  1MW7 A;  5LD2 C;  5FRM A;  1D0Z A;  2VXD A;  3VYU B;  2DOA A;  3ZCO A;  4N4N B;  4X0G A;  2CUZ A;  2M7A A;  2XC7 A;  4CCJ A;  3BC8 A;  1X1C A;  2LBF B;  2V1N A;  3DPL C;  2ZXI A;  4ZJZ A;  4IKF A;  1D0Y A;  2CV1 A;  1YE9 A;  1LDK B;  1QU3 A;  4E7J A;  2VKD A;  2WY7 Q;  4NQW B;  3OYN A;  4RMN A;  3ZR8 X;  3RTR A;  4CZC A;  3TBI A;  3L2Q A;  1WJE A;  1YX5 A;  3K4K A;  4B3X A;  1PJR A;  2W1O A;  4XR6 A;  4BE2 A;  3E1S A;  1UG0 A;  2DXI A;  1MMA A;  4GRI A;  2GOM A;  3BLY A;  1DGR M;  1T95 A;  1Z7L A;  2X51 A;  2HPM A;  2I8D A;  4KT6 A;  3FBN B;  1LKX A;  2IGO A;  1EA3 A;  3BG7 A;  3D5L A;  3ZXS A;  2F4I A;  1JI8 A;  3PL8 A;  2V4J C;  4C2U A;  3QOE A;  3DQV C;  3IUO A;  1BR1 A;  1U0J A;  4HPQ A;  2HQA A;  1GLN A;  4E6K G;  3CES A;  3H9Q A;  3OR1 C;  4BDY A;  1V5E A;  2CW8 A;  1WJA A;  5HLT A;  1Y6I A;  5HVQ C;  4D9J A;  4BGD A;  1WJB A;  2VJJ A;  3QYE A;  4IZZ A;  2M3A A;  1MMD A;  2DCE A;  4BJT A;  3OYM A;  3QYB A;  3EUH C;  1X1A A;  4BL0 B;  1D1C A;  4JOM A;  1T0F C;  3LSG A;  2Q2E B;  4C2T A;  1V5G A;  3PNT A;  4BU2 A;  2KHM A;  3F9K A;  3OMY A;  3S3N A;  2IGK A;  2X6W A;  2BVM A;  4BS9 A;  4XKC A;  3OYK A;  4B43 A;  4DIQ A;  2O5R A;  3K4M A;  2W7N A;  3HKZ A;  2R4G A;  5FRO A;  3L2U A;  2KZV A;  2M0M A;  4G6T B;  2HZD A;  3C2G A;  2R7U A;  4CUG A;  3S3M A;  2PMZ A;  4HSR A;  4CCM A;  3K70 D;  3DTK A;  2PJR B;  2XF7 A;  3HL2 A;  3PNY A;  4BEH B;  3FDY A;  4XLE A;  3OYA A;  3OYD A;  3CZ6 A;  4HNT A;  3LSK A;  2LRE A;  4BE1 A;  1Y56 A;  3W2V A;  4BJ5 C;  2CS3 A;  3RPU D;  3AKZ A;  1LFP A;  3OYI A;  4U7B A;  4AYB A;  2BW3 A;  3PNV A;  4JQF A;  1D1A A;  4CA0 A;  1G59 A;  3OL4 A;  2UUZ A;  4IQJ A;  4BQO A;  3K10 A;  3OYF A;  3TMO A;  4XKW A;  2XF5 A;  4IX7 A;  4E4H A;  3OS2 A;  3LMM A;  1UAA A;  3SDB A;  1X4P A;  2VKH A;  2CW7 A;  4XLA A;  1ERD A;  4PFP A;  1W36 D;  2X1C A;  3SEQ A;  2OC6 A;  2ZSH B;  3OWT A;  4CCN A;  2DT6 A;  2X1E A;  3ZQQ A;  2R7W A;  3BCB A;  1G8X A;  1KON A;  2ZXH A;  3OY9 A;  2R7S A;  3OYG A;  4DJA A;  4F3Q A;  2CUJ A;  1MMN A;  2WA0 A;  3VYS B;  3FBI B;  1BR2 A;  3OL3 A;  4DBQ A;  2DJI A;  2KP6 A;  2WAD A;  3KEY A;  4II3 A;  4E7L A;  3H5A A;  5CPR B;  2L7K A;  3S3O A;  4ZDL A;  2IGM A;  4HRI A;  4Y4R A;  3A2K A;  4PUS A;  2XDV A;  1OR7 C;  4BAC A;  2V6E A;  3K6G A;  2WY8 Q;  2X85 A;  4KJZ A;  3DPU A;  1AA7 A;  4HNU A;  4XKB A;  4PSX A;  3G2B A;  1NG6 A;  2QKM B;  3D5R C;  3H5N A;  2XAU A;  4Y3O A;  3LSI A;  3IAS 2;  4XOR A;  4E7I A;  1BR4 A;  4CCL A;  5HNF A;  2NOJ B;  3AL0 C;  1Z3X A;  2XSJ C;  2IGN A;  2VQH A;  4PJM A;  2MYS A;  3ZRG A;  2F5V A;  3DTE A;  3HG9 A;  3CP2 A;  3D5S C;  4N4O B;  2IXS A;  4C30 A;  3U21 A;  3IAM 2;  3CF2 A;  4C9Y A;  3S8P A;  3A1Y A;  2BVL A;  4YEJ A;  4CSW A;  2VPL A;  4AVZ A;  4CH7 A;  4RM3 A;  3OYB A;  3OYC A;  3BG6 A;  4F93 B;  4XN0 A;  4PFO A;  4DOZ A;  3HXL A;  2HNH A;  2R7R A;  2CMP A;  4FET A;  2VJI A;  3I9V 2;  1SAU A;  2Z1D A;  4PJJ A;  3RSN A;  4XLC A;  3SYT A;  3MD2 A;  2V9K A;  4XLH A;  3DKX A;  3K70 C;  2K5C A;  3VSK A;  2LH9 A;  4LIU A;  4BE0 A;  2K9M A;  4B48 A;  2VB6 A;  2WAF A;  2X6X A;  3K4L A;  1WFX A;  4RLF A;  2ZFU A;  3S32 A;  3LSM A;  2VLA A;  1DQU A;  2R7Q A;  3OIP A;  4II2 A;  2R7V A;  2K3P A;  3EUK L;  4HST A;  3OYH A;  3IP4 B;  2KPM A;  3MMY B;  2HVR A;  3DU6 A;  2OUM A;  4PJN A;  4B44 A;  1QHG A;  4LG3 A;  2WBM A;  2KLO A;  4XM3 A;  3MKZ A;  2HU9 A;  4R79 A;  2VXZ A;  3K4B A;  1NG7 A;  1TZL A;  2L9N A;  2LY2 A;  3CP8 A;  2AQF A;  3PFY A;  3LL7 A;  4BQQ A;  3J7A Y;  3HPH A;  3EUA A;  3V42 A;  2GOX B;  4NC8 A;  2QKL B;  1DGW Y;  2MFZ A;  4ZDP A;  2R7T A;  4XNF A;  2LRD A;  4CCO A;  2LY1 A;  3FKJ A;  3L2V A;  1PYV A;  3AFH A;  4BJ6 C;  3VDX A;  3KYL A;  1LVK A;  2WAQ A;  4XQF A;  2A5W A;  2VIX A;  2JSP A;  3L2W A;  2HDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...