2LH9A

Nmr structure of the first lotus domain of tudor domain-containing protein 7
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of Tudor domain-containing protein 7
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Tudor domain-containing protein 7
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lh9A00
2LY2A 2KPMA 2LY1A 2LH9A 2KZVA 3RCOA 3S93A
chains in the Genus database with same CATH superfamily
4NQWB 2PMZA 2EIKH 3BG7A 3ZXSA 2CUEA 3GO5A 5J1UA 2ME6A 3MKWB 5BMZA 2W82A 5HDNA 3OSFA 1X1CA 2MC4A 2HQNA 2LVSA 1TWGJ 3E6BA 1F43A 1IXCA 2FMYA 2BY1A 3CC2I 1TT0A 1X3ZB 4I2OA 1WJAA 3OYGA 4TV7A 4PZJA 3I4NJ 1UB9A 1T0FA 2L5QA 2HZDA 3NARA 2JA8J 2QENA 5IY5H 1IF1A 2OQGA 1MBFA 3HOZJ 3LWFA 4IKFA 1UHMA 2HTJA 3OYNA 1CGPA 2PMUA 1XG1A 3WU1B 2VKHA 1R9TJ 1I27A 3GW2A 2ACJA 3HSEA 2IS1A 2B0LA 2X51A 1FEXA 3I71A 2VLAA 1B8IA 1FIAA 2P0WA 1JHHA 4NBQA 2JUGA 2NS7A 3CCMI 4A3KJ 2YSRA 1U6GA 2ZSIB 5D6FA 4HAMA 2QKLB 4CCMA 2L9VA 3S1QJ 1E2XA 1X4PA 3HGGA 1Z21A 1ETQA 3Q0WA 2IBDA 2P5VA 2F6CA 1JKQC 2A3SA 3GFJA 4S04A 1MNDA 1BI3A 4PFPA 2R7VA 1X2MA 1P92A 3WHCA 3TO9A 2EV5A 3JSOA 2JA6J 2KZGA 4I98B 5FFZA 2L4MA 2B63J 4A2UA 1ONVA 1POGA 2LSOA 2V26A 1BN5A 1MNMC 1LVKA 3RPUA 1T2KA 3T8RA 2GZWA 4AWXB 4XLPF 4KT6A 3CCLI 5D4SA 1P4XA 4Z2YA 2JA7J 1NTCA 1GV5A 1B72B 3TOAA 5EZGA 2R4GA 2CQQA 3WG7H 2IP2A 3ZMDA 2CV2A 2R7SA 1FLIA 3T8TA 4CCNA 1YRNA 1V3FA 4BHCA 2ID3A 3F3XA 2VQCA 1RZ4A 4R79A 3W6JB 2AXLA 1W7PA 2DDBA 1X1AA 4EMSA 4LLNA 4PJJA 1MDMA 1R5GA 2IGKA 3IKVA 3PNVA 3E5QA 2Z3YA 4KFCA 2RC4A 1SFOJ 4W97A 4RLFA 5HS7A 4CA0A 3H5NA 4R8HA 1KQ0A 2VKDA 1OLTA 1LUJB 2DPUA 4ENNA 2HQ5A 2PFBA 2AXTC 3R60A 3I59A 4EJVA 4L9TA 2KIMA 1P6RA 1P7IA 5HOOA 1FWZA 2ZO4A 5DV5A 1DUXC 2KRHA 2XKPA 3ZP5A 5IT9Z 4J01A 3F6OA 3M1EA 4XLEA 4HV5A 5KK1A 4KNYA 3N97A 2OQRA 4Y17A 3H0DA 2OTJI 3CO7C 3F6VA 2R7XA 2DJNA 2F5EA 2UXNA 3GCMA 2FRHA 1GT0C 1J9IA 3ISPA 4FT8A 3C3WA 1ZGJA 3LNQA 2H8WA 2ETHA 2QWWA 1MBKA 4AIJA 1FBQA 3T0YA 3UKGA 5JHFA 2XV4S 2ZJ2A 4DW6A 2W48A 2E7XA 4RM3A 5TRDA 2CJJA 2G0EA 4HOBA 4BXUA 4O3MA 4RAZA 1R5ID 1OISA 2XUBA 1OCTC 1RI7A 1GDTA 1D1AA 3ASNH 2JVHA 2P7CB 5D5VB 1XGSA 2JRMA 1IRXA 1IV6A 3E3VA 4XKCA 4YELA 5B3SH 2LR8A 3L2QA 2EFNA 2DA4A 1S29A 2D1HA 3E6DA 1J09A 1IO2A 1ENHA 5AIQA 2RAEA 2VE8A 1VQPI 3MKZA 5IP9J 4BS9A 3MEXA 2KKOA 2IVMA 2L9SA 1JGSA 1ZHFA 2ZMEC 1YQAA 4LLGF 5EZHA 3LA2A 1XB4A 3J7AY 4EJUA 3C7JA 3X2QH 2LREA 2L7KA 1W5CC 3BR1A 2CV1A 5FKMA 3OOPA 3VYRB 2EZIA 3K6GA 1RKWA 2FX0A 2L9NA 3I64A 5L3DA 5E3MA 3JW4A 4BJ5C 3Q0VA 5LLQA 3HPHA 4QPOA 3ERED 2W7NA 2HDWA 1Y8QB 4R1HA 4CH7A 1K78B 1HLVA 3WTYC 3CC7I 4XM3A 4AU7A 2DK5A 2OJED 1JTXA 3IH3A 4Q5SF 3DU6A 5HDKA 2A6HF 4MEYF 3MKLA 2BVLA 3AL0C 2OCEA 3LOCA 5HDGA 3LAPA 4P9FA 3W2VA 1OJLA 5M5XJ 1JT0A 2HVQA 2XAJA 4JX6A 5CQGA 3CCQI 4NHJA 2VPLA 4Q4ZF 3CCJI 3ZCOA 3IKTA 3DTEA 2P8TA 4WF2A 1D3YA 1B6AA 4GFBA 2OPTA 3ML6A 3A01A 4RGSA 3VYTB 2H8RA 1PP7U 1YG2A 4U7DA 4E7SA 2UZKA 2V1DA 3A03A 5KCMA 3EUKL 3GZ6A 2FQ4A 3QYFA 2F5CA 2R5YA 3HUGA 4ZYAA 5K5RA 1ITYA 3KP5A 2OAZA 1YJNI 4A6DA 3M8EA 3J80Z 3ZN1A 5J1YA 2DN0A 3S1NJ 2IT0A 1HW5A 3M7GA 4Q47A 3DCFA 2H94A 1SFKA 3OYAA 5LHIA 3ABTA 2ZXWH 2DCEA 3K1NA 4RMNA 2E5ZA 3GTQJ 3QPHA 3H1CA 2W57A 1R1VA 5LRSA 2VL8A 4JBAA 2K5CA 3CCEI 2QZ8A 2GAUA 2LFBA 1A31A 3TW6A 4HLYA 3D5RC 1X2NA 3GFIA 4CYCA 2DQLA 3RIRA 3JAMZ 3GWZA 1RR8C 2R5ZB 3FX3A 4CXFA 1TL8A 4GCVA 3HHHA 1IRGA 2YUSA 3K7AJ 2EIJH 1BA5A 3G73A 2Y30A 2IAIA 3RJPA 1QGPA 3P9IA 3KIOA 4HA8A 2EZLA 2WC2A 1R5HA 1G3TA 1Y1VJ 2OBPA 3TO7A 1YW8A 1JKOC 1AHDP 3CJTB 1ZG1A 9ANTA 4MQVA 1ON1A 2KZVA 1PJRA 5ED4A 3BTLA 3MWMA 3IRQA 3GFMA 5DCFA 2MD0A 1RUNA 5E1ZB 4UNOA 3H5AA 2E7WA 2YR2A 2UUZA 4N9HA 5GTHC 5EYRA 2X4HA 1FT9A 4IHSA 4FTHA 2G9WA 4U7BA 4UHTA 4MLOA 3G2BA 1RC9A 1WI9A 2EB7A 4M9ZA 4BUPA 5ICFA 3KPHA 1W0TA 5EGOA 4OIOF 3FM3A 1H8AC 4LK1F 2STWA 3L2CA 1W0UA 1YIOA 4Y33A 2YU9J 2DMPA 1SVMA 2KJCA 3OV8A 3TBIA 1VTNC 4AVZA 3HYIA 2MFZA 4WXCA 1ETWA 1LDKB 4HW0A 1XCBA 2NS0A 4BBRJ 4G8XA 1GHCA 2OUMA 1TW2A 1IN8A 2G7UA 4EATA 5D5XB 4B3XA 1OQYA 3FISA 5CQEA 2VOOA 4GRIA 2OCCH 1U5TC 2JZYA 3DLAA 1O3TA 3BR3A 3F8MA 2IXSA 3TDUC 1XGNA 4WXDA 4IO9F 2Y69H 1S6LA 1ZK8A 2Z16A 3F72A 1SC7A 5CJ9A 4OAYA 2A69F 1Y0NA 3CDLA 3DKYA 2NNYA 4NDLA 3CJNA 3MN2A 3QP5A 1I39A 4F3QA 1XSDA 4DJAA 4DQ2A 4KIGA 2K9LA 3GF2A 3CP2A 1HF0A 2O8XA 3SXYA 4ASNA 2ZJQF 5E17F 2Y9YA 3CCYA 1JTYA 4L5JA 3D5LA 5E8GA 4KIBA 2VXDA 5A2QZ 3MZ8A 4ON0A 3L2UA 2QA4I 1W36C 1G3SA 4P9UA 1KU9A 4M3FA 3FWEA 2XGXA 2M34A 3VDXA 3DQVC 1QZEA 3NAUA 5FB2A 3OYBA 3H35A 4LLLA 4WWCA 2LBFB 2O8KA 2Z99A 1FC3A 2EA2A 2XGCA 1O7FA 4RB1A 2K02A 2KDOA 4LJZF 4V2GA 2ECCA 4ABZA 1LPQA 1WH7A 2Q2EA 1B9NA 2F5VA 4DBQA 1DP7P 2ZKZA 2K40A 3DEUA 4OIQF 2V79A 3L2RA 2DT5A 1ETYA 2Z33A 3OYFA 3BTCA 3ZQHA 3CDHA 3E5XA 4BXXJ 3QPSA 3OY9A 3AAFA 2BW3B 1WPKA 4UV9A 3P9KA 3JRHA 1EJ9A 3S93A 3NRVA 1TZLA 2JT1A 3A02A 3FKJA 1VI0A 2PBIA 2X6XA 3C2HA 2D2WA 3VODA 4P55A 4KMUX 3BCBA 4O6JA 5EEHA 1T39A 2BVMA 4S0HB 1B4AA 3FXMA 2V9VA 4HQMA 3OIOA 2DPDA 3GLXA 2HXIA 4WXHA 1YW7A 2HR3A 3MCZA 5HLGA 4KDPA 3UR3C 2XF7A 1DPRA 2VODA 3W6VA 2VJ5A 3KZIC 3U21A 1CQTA 1PVEA 5LFAA 4KMFA 3QYBA 4JQFA 1QNTA 1VQ5I 3K4NA 4LIUA 5CKTA 2CMPA 1FMVA 2PN6A 3ONQA 3ZRGA 1L3LA 2Q1ZB 4A3DJ 1O4XA 1U0JA 4DIQA 1HXDA 1B8IB 2A68F 4YFXF 1YO5C 2M0CA 4J19A 3GTOJ 4ENJA 4F92B 4L18B 3HOTA 4HF2A 2LBFA 3L9FA 5AIPA 2NNNA 2BHYA 1FP2A 4OIPF 2QSHX 1ZKGA 3KP7A 4A3CJ 1QZZA 4YIIA 1IN6A 2R7OA 2CQNA 2Y2ZA 3TP0A 3ZMUA 2XRLA 3HC7A 1JT6A 4P1WA 3W2WA 1Y56A 3FMSA 1ZRFA 3U1DA 4D7MA 3K10A 4Q48A 3WGIA 3KZZA 1ULYA 3OYKA 2QF7A 4G12A 1JGGA 2XAUA 2LP0A 3HTUA 3LFUA 2WAQA 4N0BA 4IZZA 1OMIA 2VB6A 2LTPA 3EDPA 1ZR4A 2NVQJ 3EYIA 5FKOA 2IJLA 1FOWA 3G4SI 1ZTRA 1FSEA 4OU0A 1RESA 4OMYA 2YPRA 1R1TA 1SANA 3CJQB 4AIDA 1Z1DA 3OYIA 2H1KA 4HX7A 1PUEE 1ETOA 1BC8C 2DTRA 1Z7LA 2HYJA 1XN7A 3ZR8X 1U8BA 1LJ9A 1LKXA 3KP2A 4OWRB 2FNAA 3KE2A 3I4PA 1UMQA 2BY2A 4PFOA 4RM2A 3A1YA 4RLQA 3K4CA 3SFIA 3ECHA 3WU2C 5IYCJ 4A12A 5KAFC 2B9SA 3I9V2 3J81K 5DYMA 2LG4A 2ZMEB 1S7EA 5IT9K 3OYMA 3PM1A 5HS9A 2P5KA 2VI6A 2HXOA 4MTDA 5HVQC 1ZQ3P 1RUOA 4GO1A 1F1ZA 1R58A 4Y13A 3J7YJ 4BE1A 3BG3A 2A5WA 3FMRA 2RNGA 4XKVA 1XSVA 5H20A 4DZPA 2HTSA 3V4GA 1W7PB 2B7EA 2KPMA 3FK6A 1JKPC 5B5EC 4IHVA 4BAYA 3HOWJ 4FE7A 2JJ7A 1YJWI 3Q9VA 3N05A 4I02A 1YX3A 2JRTA 4BY1J 3LSIA 3PNTA 3BR5A 2NXNB 5ILUA 4FX4A 3F8BA 4BY7J 3RQIA 3K2AA 3BC8A 3OYLA 2M3AA 4HRIA 1TTYA 5TISC 3PSIA 1B72A 1F9NA 3ASOH 4ZYEA 5FLXK 2MGQA 2X0LA 1HDDC 1TWHJ 2HI3A 3H5RA 3CUOA 2OD5A 5HS8A 2BGCA 1HW2A 4PGGA 3LQRA 1E17A 2ZFUA 2VJJA 4P96A 1IXSB 4ZDLA 1WCMJ 2X1EA 1SVOA 1WI3A 2A05A 1UFMA 1STZA 1GXQA 2LY9A 1K6YA 1XTAA 5IPAA 2X1CA 3ZN0A 2NRAC 2DJIA 4L0YB 4CCKA 3T5XA 4BDYA 4MQ9F 5FLMJ 3DFGA 1I3QJ 4XSZF 5D8KB 3V7RA 3OIQA 4E7IA 1T38A 2FOWA 2VJ4A 4XIDA 1TP4A 4EEFG 5E18F 1REPC 2OC6A 4RAGA 4C30A 4HSRA 1LE8A 2H09A 3I0TA 4M9XA 1HBXG 2DA2A 2VPRA 3AG1H 3E7LA 1MW7A 2EPFA 1S3JA 2XDVA 2HYGD 1Y1WJ 2IW5A 2XPWA 3K2ZA 4LB6B 3BZ6A 2A6TA 3SEZA 3CUQC 5FROA 3J81Z 4IJAA 1T08B 1XMKA 3FHZA 3GEZA 2BXYA 3JRAA 3OL3A 4IRGA 2KFDA 3E6MA 3OL4A 2F4IA 2QQ9A 3TL4X 4YG2F 1O3SA 5ERIA 1BOBA 3OMYA 3RZOJ 1Z67A 2BZTA 4HF1A 4H4KC 2VOPA 3B73A 2MSYA 1K6OA 3CZ6A 1BI1A 1J0RA 4BQNA 3I53A 2CGPA 2OV7A 3NWTA 2RQQA 3MKYB 2P5LC 2F2EA 1D1CA 2NVTJ 4JOMA 1BIAA 3V8KA 5IYBJ 1XGOA 3H9QA 1W1WE 1Z3XA 2XAQA 3J80K 2FJ1A 3DKXA 2I8DA 2L3DA 4F91B 4MIMA 1R71A 4UVAA 4Y52J 5D6EA 2ZSHB 4AIHA 1QA6A 3SZPA 4BE2A 4RA2A 3HZJA 5BPIA 2F48A 2FXAA 2OZ6A 4YIRX 3CLQA 4A3GJ 3LSRA 1VNDA 3A4CA 2XF6A 1WRJA 3H3VK 4XRSG 2CW0F 4LITA 1KZHA 3HRUA 4Y4RA 3JRFA 4S05A 3H36A 2TCTA 4B44A 4IOCF 5HLHA 2E1NA 4M74A 2PJPA 3WU0A 1JJ6C 2LDUA 4XRMA 3O3KA 3BTJA 2XROA 3DBRB 2R5YB 2R93J 2FA5A 4BGDA 2CFOA 3BY6A 5EEGA 1R4NB 1UAAA 2QLZA 1PUFA 3WE3A 2F4MB 2XB0X 3H92A 5LEJA 2VC1A 3G3ZA 5J40A 4LG0B 3AG2H 3DTKA 5GP9A 4L9NA 3OYEA 1EH8A 4M3EA 3OYCA 4FCYA 3IC7A 1I1GA 3PL8A 4ITVA 1R4MB 5TJJA 3ZGKA 3HDDA 3SHFA 1OPCA 2BOLA 3H3ZA 3AFHA 2V4JC 4GXOA 2VIXA 5JLXA 3COAC 3NWSA 2H1LA 1OCPA 2L0KA 2XSDC 1XD7A 4FQGA 3CCVI 2HDCA 4CCOA 4BQAA 3KP6A 2IA1A 3ZQ7A 2KIUA 1WFXA 2JN6A 2YX4A 3M3YJ 5M3FJ 5BOXA 2CW7A 4PUSA 1UG2A 2WV1A 5CVVA 2DMQA 2BV6A 1UELB 3GXOA 5JHUA 4M72A 1X58A 2X1DA 3OS0A 3OYDA 1LE8B 2Y0SN 2ESHA 4DZJA 4LGWA 1VQ9I 2XRNA 3JCUC 4QWQA 3ZMVA 2V1UA 3ELKA 4A3FJ 2HQAA 4D5CA 1MJAA 3P7NA 5EEAA 2JUCA 1VQKI 3RKWA 1ZLJA 2DK8A 2CYYA 5B1AH 2VE9A 5K7ZA 2P7VB 3BT9A 3M4OJ 2LRDA 4QLCU 2E34A 1VQNI 2LF7A 1X19A 3LSKA 1TBXA 2FSWA 2O7OA 2WWYA 4HNUA 1MBJA 4ETSA 3S17J 4WCGA 5F1JA 3FXOA 4HDVA 3RCOA 4A5MA 1QPMA 1V5GA 1EF4A 1Z91A 2X6OA 3IV5A 4I99C 1WQ2A 1USSA 2LLKA 2H27A 2M8EA 2Z9OA 3M8FA 4XN0A 2MW8A 4PJMA 1Y0UA 2M9HA 3E97A 4AYBA 2A6EF 1N75A 3OR2C 3K4MA 2BY3A 2FF4A 2CG4A 2R7TA 2CW8A 1IN7A 4II2A 2MH9A 1T0FC 3DPLC 5K5OA 5FD5A 5LHHA 2JMWA 3ABLH 1LEAA 2VT2A 2VBZA 2M87A 1MMNA 2QUFA 2L9RA 1YYVA 3FXJA 3VYUB 1XS9A 3GVAA 2HPMA 1H9GA 1U8RA 3GTKJ 3S1MJ 5F0HA 3GTMJ 3CTAA 4CZZA 2MA3A 2RDPA 4AUXA 4HPQA 1GVJA 4X1EA 1XPXA 3MZYA 2VQHA 4PSWA 2HVSA 2MABA 3GYHX 3CMYA 2XIGA 4AM3A 3H0GJ 4BHBA 4D5FA 1SFEA 4E70A 4M6VA 4CYDA 2QBYB 5FRNA 1TQIA 2L2OA 1W36D 3M07A 1KGSA 2FQ3A 1HC8A 5F6FA 1BJAA 1YHQI 5FKKA 4EJOA 2W84A 1A5JA 3HKZN 1GUUA 4KA4A 5HODA 5L3EA 2FBKA 3V8LA 1QHHD 1H0MA 4K2EA 4YRVA 4DOZA 3G1LA 1T6SA 3CMMA 3W6KB 2M7AA 1AKHA 3KEYA 1OFCX 2DMUA 1BI2A 3H9GA 4XLCA 2STTA 2CV0A 3L09A 4IRHA 1A6QA 5J1RA 2VJIA 4PCQA 3G1MA 3B6AA 2HPIA 1I5ZA 1UHSA 1SD7A 3LAJA 1P4AA 1SMTA 1S7OA 3LL7A 1Z77A 4XONA 3PFYA 2X85A 1YX5A 4WX9A 3ABUA 2FMLA 2ZXIA 5DUIA 1U9NA 2DT6A 4D9JA 5LHGA 3SYTA 1ZLKA 1YOVB 3FXUA 1PP8F 2OF7A 3DPUA 3RI4A 3CC4I 6PAXA 1T95A 2VUMJ 1TNTA 3K4JA 3LA3A 4AC0A 1A6IA 3BTIA 1OCZH 3QODA 3JTHA 1FTZA 2Z5UA 4IPAA 4UUSB 4JK1X 2KHMA 2MLKA 2QSFX 4RB3C 3RKXA 4U0YA 1Z7UA 4UVCA 2VKVA 4GGGA 3ABKH 4NC7A 1MH4A 3TDZC 1HKQA 3WE2A 1FTTA 1MD0A 2HDDA 1K83J 4BEHA 1KYZA 3DEEA 4A3EJ 4I09A 2DA5A 4CO8A 1IRZA 2UV1A 4UB8C 4EV0A 5EDNA 2HOEA 1O3RA 3DP7A 3L7WA 4KN4X 1NK3P 1ETVA 2XVCA 3F22A 2RNJA 4MGRA 2XAHA 2GBYA 2EILH 4QSHA 4M6XA 2V1XA 2JPBA 4Z6YA 2M4KA 3VWBA 2AS5F 4IL6C 5IP7J 1H89C 4IHYA 2ADUA 2PG4A 2WTEA 4DYQA 5LGUA 1HSTA 2E5NA 4L9JA 4L9VA 4NC8A 1HW1A 2M0MA 3SJMA 1Z9CA 1J7KA 3K1MA 1T8IA 3RPQA 2A07F 2VBWA 5F04A 1AA7A 1VFCA 2DU9A 2R7DA 3GMEA 2EA4A 3GLLA 2K7LA 1R1UA 5E20A 3TKYA 1V4RA 2H6CA 1G6NA 5E3NA 1MBEA 1MJ9A 3VYSB 2XGEA 2HS5A 5BS6A 3IRRA 3V42A 1VZ0A 3FXKA 3TP3A 4C9YA 2IA2A 3HSFA 2WAQN 4BE0A 4D0PA 1PDNC 4LFUA 1YRNB 1S5LC 4A69C 3HSRA 1MZBA 2EFWA 3L00A 3OYHA 2K85A 3Q9SA 4V2FA 2LY1A 3HOXJ 3JTGA 3E6CC 4YFNF 3DXJF 1ZYRF 3JR9A 1YFHA 2V9PA 3K69A 4XLAA 4DYCA 2ISYA 3IH4A 1OCCH 1R49A 1Y39A 2PX9A 4M73A 2LMDA 2LNBA 3LSMA 1X1DA 4C2TA 2ECBA 3V7SA 4XK4A 3D5SC 3K4BA 2PEXA 1HA8A 5M5YJ 2IGMA 2WB1N 2XSJC 4KN7X 1FX7A 4G6QA 1CF7B 2KIFA 1MNEA 1ERDA 2ELJA 3QRFF 3F23A 1W7PD 2EFQA 4MEXF 4UV8A 2LKSA 3ZMZA 2DFFA 1BW6A 3MMYB 3W2AA 5J8CA 3GTJJ 4FETA 1TWAJ 1W4MA 2BW3A 3S3OA 3K4KA 3PUBA 4XOTA 4JX4A 2J5OA 2QVOA 4AIKA 1EA3A 1JXSA 4B8XA 1P4WA 2CSOA 2QQ8A 4DGWB 1AOYA 1EH6A 3F8NA 5DM7F 2HQRA 1D5YA 2VONA 1X4OA 3A0BC 1Z0XA 4DNCA 3BR6A 4PK4A 3WTSC 2KP6A 1N78A 3RPUD 5GADJ 4A3LJ 2DYSH 1FOKA 1FMWA 1TQMA 2O5RA 1IZ1A 4I0AA 1V5FA 2CRGA 4CDGA 3OIPA 1NG7A 2GOXB 5E3LA 1YE9A 1HSJA 2DOFA 4OAZA 4XOPA 1OR7C 2HWVA 1FOXA 3OWTA 4KT5C 1MGTA 2ZFWA 4M3DA 3SDBA 5JVTA 4JX5A 2DI3A 1M1EB 4BEHB 1BL0A 2O03A 1RIOH 2DTZA 2BE5F 4C3HJ 4ESJA 2CFXA 4BBSJ 2WY7Q 1LVAA 4KJZA 1VQ8I 4Y7NJ 1ZGWA 1RKTA 3KLOA 3TW7A 5H6QA 1S7AA 5B1BH 2FE3A 2GWRA 4WK8F 2EIMH 3Q3SA 3QYEA 1ZRDA 4M3GA 3BCAA 3ZMTA 2RV8A 5FRMA 1B9MA 1GLNA 3J7AO 3CUQB 4XORA 2E2JJ 2R7ZJ 2IEKA 4PGHA 4A93J 5J3LA 4EM2A 4U0VA 3S3MA 2IS2A 4A3BJ 4PJLA 3PO2J 4IQ4A 1MSFC 2DBBA 3LSTA 3ZQQA 2QKMB 1UJ8A 2GM4A 3S2HJ 1IUYA 2N8GA 2K4JA 1TC3C 5ICCA 3WG9A 4B4CA 2DA7A 4E4HA 1IG7A 1SFXA 3HIFA 4N4NB 2DFHA 3D1NI 3I59B 3C1DA 5GPCA 1MJBA 1JUSA 4IVNA 3FIWA 1D0YA 3IAS2 3T1BA 2KIQA 4ENMA 2BXZA 3I58A 4BACA 2ISZA 3R61A 2JA5J 2X9DA 3GTPJ 5GPAA 2DMTA 1LEBA 1WJFA 1XCVA 2X6YA 3FMQA 4CSWA 3BDDA 3RKYA 1YITI 2BYVE 4BQOA 3GTLJ 1YW9A 2V1NA 2IRFG 1VQ6I 1IDYA 4ZTJA 3LSGA 4UUTA 3I3LA 3SZGA 3LSHA 1KU7A 4ZDOA 3R6SA 3KP4A 3EYYA 2XB5A 2C6YA 1KONA 4MFEA 5HNHA 3M9AA 4CZCA 3WTZA 2K3FA 2FEZA 1G59A 4OMZA 5F0FA 3VSLA 4ZYGA 5D4RA 2FU4A 3FK7A 1NHAA 1MDMB 1ZAOA 1QQIA 2KDZA 2EWNA 4M6YA 2DOAA 3BJ6A 3EUAA 2ZNYA 1S9HA 3BWGA 1P7JA 1TT5B 3OS2A 3AG4H 2DOEA 5JR3A 3W3CA 1K4TA 2DYRH 2DFIA 1OYIA 2FBHA 1OCRH 3OR1C 4RB0A 3QOPA 3BQZA 3Q0UA 5C3EJ 1QBJA 2EK5A 1WWXA 4AVPA 4ZZLA 4BU2A 1H88C 3ROUA 1JUMA 2GA1A 3CP8A 1U78A 3PNYA 4HF0A 3K0LA 4KYWA 2IPQX 3HRTA 3CO6C 2IS4A 3G1OA 1TNSA 1QPIA 5GAEJ 2EJRA 2YX7A 2RGVA 3C18A 3MD2A 1D5VA 3ZQLA 3QPTA 4G9YA 4XL9A 4ZC3A 4HNVA 4FISA 2LKXA 2IS6A 1UG0A 3FBIB 3WGHA 1J2XA 2V9KA 2W85A 4I7HA 5L3FA 5KNLA 2LYCA 1K78A 4IF4A 1DPUA 3CCUI 1Q1HA 1C0WA 4RAYA 4RS8A 1X3WB 2P81A 3NEUA 4G7HF 4IHWA 2LOOA 3JRCA 3LSJA 3FDYA 5LD2C 3LA7A 4BXFA 4KICA 4B09A 5DS9A 2Y48A 4IXAA 3F8FA 3RSNA 1R22A 4BQQA 4UUSA 1JJ8C 1B1BA 1TQPA 1JKRC 2RVCA 2R7WA 2L7MP 2X48A 1DU0A 4M3BA 5H2FC 4PDKA 3O6BB 2ESNA 2FOKA 4D7NA 4EM1A 5KAIC 2F5DA 3CLOA 1WKMA 4NB5A 2BBYA 5BNGA 2DA3A 2A5YB 2GXBA 2XHKA 2LKPA 2VQLA 4W1UA 4XLNF 1MBGA 4A0XA 4G7ZF 1J5YA 3HUGB 1RRJA 1YS7A 3F9KA 1E0EA 1B59A 2EH3A 4YEJA 3G6EI 1R7JA 5FGMA 3RTRA 3V7CA 2IGOA 4N9IA 2ZNZA 3L1PA 5A2QK 3HL2A 2DFEA 1BIBA 2NOJB 4UB6C 4L0ZB 3RDIA 2R7UA 4X6AJ 3HHGA 3VPRA 2CUJA 2PLYA 2NYXA 2WAFA 3HOVJ 4LK0F 2ME0A 1QVUA 2HZTA 1F5TA 3ZQCA 3BZKA 1XMXA 4G6DA 4RAFA 4XLFA 1ZARA 4HX8A 3QWLA 1EH7A 4NC6A 4UUVA 2R7RA 5CVJA 2CQKA 1IW7F 2HFHA 2PMHA 3IP4B 1QU3A 3J7ZI 4IEJA 4L5IA 2ZBKA 4U0WA 5HNFA 1APLC 2L7ZA 3C2GA 3BPVA 5J8FA 4MHGA 1YLFA 5FLXZ 2M8GX 3B02A 4ZZDA 3M1CA 5EGOB 4KISA 3DBLB 1G4DA 1Y6IA 3GZNB 4RGXA 1SD5A 1LDDA 2QGUA 3EQLF 3PQJA 2ZB9A 2MBFA 1OR7A 1W5TA 2CWEA 1FOYA 3RYPA 4B43A 4I76A 1ZELA 2KISA 1AWCA 3HBLA 4UXNA 2CU7A 3BJOA 3GZ5A 4UY8I 2QBYA 2XGDA 4ANJA 1I6HJ 5E3OA 4HSTA 2E1CA 1LNWA 2RN7A 1BC7C 2ICWG 4LIVA 2HGCA 3IAM2 2HOAA 1A35A 2ZJPF 2DXIA 2L7FP 4YFKF 1TWCJ 3RYRA 4IHXA 1LDJA 3LFKA 4E7JA 2MLGA 3OSGA 3HOYJ 1U3EM 5GAGJ 1OYYA 1ETKA 2JPCA 2W24A 3K70D 1IN5A 2EV6A 4I6ZA 1HCRA 4LG0A 1IRFA 1BW5A 3MZHA 3HXLA 1MIJA 3D0SA 3TEDA 3WTTC 1SAUA 4G7OF 3VEPA 2VT3A 5E79C 2MD5A 4F93B 1SD4A 3HB9A 1MSEC 4LD5A 1DGRM 3GX4X 1QHGA 2CUZA 3HM5A 2V6EA 1PYVA 5K5QA 5CYVA 1I1SA 2HYFA 3F0CA 1VQOI 2DO7A 1R6RA 2GOMA 3K70C 2Y75A 1H9TA 3S16J 1XMAA 2AQEA 2PJRB 1EV7A 3JSPA 3WGGA 1CF7A 2PI0A 3U2RA 2BHZA 5BPDA 2VQGA 3P5JA 4QIWN 2JVGA 1ETXA 1HOMA 4L5EA 3KEOA 3PQKA 4Y3OA 1WHUA 2CUFA 3BPXA 4C3JJ 2ZJRF 2WAEA 2JSPA 2M4GA 4A3JJ 1ZRCA 2EZHA 3N4MA 4FHTA 4CUGA 5DDGA 5LGNA 1LB2A 3VB2A 4QTRA 1GXPA 4ZDPA 1NH3A 3JREA 5CPRB 4FX0A 3PIPF 3CDIA 2E35A 4RGUA 5JLWA 5FLVA 2L01A 4XICA 1VQ4I 5JVGF 1IN4A 3HOSA 3S8PA 4HG2A 3RZDJ 1F4KA 3FKIJ 2FD5A 2NAZA 5FKLA 1FP1D 2NVYJ 2YU3A 1UHWA 2K9NA 3CCSI 2X6WA 3TMOA 3CESA 5IP6A 3DV8A 4ZH4F 4U87A 5HLIA 3TOBA 4G6TB 1QVTA 3G71I 1TWFJ 1FZPB 1JUPA 4M9SA 4C3IJ 5L3GA 2L4AA 3BG5A 3JRIA 2WV0A 3M8JA 2Y31A 4HX4A 1DDNA 4EVIA 3R0JA 2ZCWA 1WZ2A 3K1PA 5TGTA 2ZXHA 3WHBA 4EGYA 3DTIA 3BZCA 3HRMA 1Z6TA 3P9CA 4XLHA 3BR0A 5AONA 4BH9A 2WB1A 4NQWA 1FBSA 2QCOA 1WVRA 2HNHA 2I10A 1XSXA 2GQQA 3BLYA 1G3WA 4P5OA 2R3SA 1TW3A 5J47A 2K9QA 1K4SA 2HOSA 1IXRC 2Z1DA 2FBIA 3IL2A 4PSXA 3CUQA 1LFBA 2DLLA 3FBNB 5C44J 1WJBA 3GUDA 4PJ0C 3FZVA 3ZMSA 3SQNA 2F4OB 1ZREA 3HGYA 1X1PA 4OOIA 5HLTA 5FO5A 2H6BA 3ZQGA 3DBHB 2OTLI 1FY7A 2ELKA 2OZUA 5ILSA 2P4WA 2CQ7A 5D8LB 1G2HA 4NUBA 5DTDA 2PQ8A 2D5VA 3BR2A 1U2WA 3QAHA 3AL0B 1TLHB 2DODA 2E60A 2V6CA 1IAWA 4RB2C 5J4VA 2A61A 4BKXA 1E3HA 1A04A 2XAFA 2XAGA 5F0CA 1NK2P 2E36A 4ENKA 1DP3A 3O8HA 2WA0A 2XC7A 2ZC2A 1SAXA 2E1MB 2QQAA 1RETA 3IWZA 1Z05A 2XF5A 1SMYF 1RPWA 3ECOA 1DU6A 2K27A 1UZCA 3MQ0A 4AYBN 1D8KA 4RGRA 1LFUP 4EGZA 1WJEA 1I50J 3CQZJ 4A3IJ 3R0AA 3A0HC 1NG6A 1GV2A 2EZKA 2W4SA 5CVIA 4CGZA 4RDUA 2DAOA 1T56A 3SEQA 1O7LA 1WGXA 5L3BA 4EQQA 3O2PE 2J5PA 2NS8A 1RR7A 4XSXF 3I54A 4EM0B 5GTIC 2V7FA 5KHDA 3CCRI 4LMYA 5DUKA 4XRSA 4B48A 2ZMEA 3FF5A 1X3UA 3WTVC 2EINH 3HTSB 5IOZA 1I3AA 3BG9A 3WTXC 1ON2A 4HBLA 1VQMI 2EBIA 3E1SA 3KCCA 1FBUA 4HEA2 2VASA 3B6CA 5LBQA 2Q0OA 3TQNA 4HDUA 4H0EA 4AD9A 1ZH5A 3F8CA 3BJAA 2R7FA 2F5FA 2KMUA 5JFRA 5EG0A 2E2HJ 1BR2A 2XASA 1OKRA 4EJWA 4IOAF 2EFPA 2JA2A 2HKXA 1MMDA 2DQRA 4A0ZA 5K1YA 1J75A 2E1OA 4OIRF 3BROA 1BI0A 1WH5A 5C4JJ 1ZGAA 4MTEA 1XDSA 3VSKA 4ZYDA 3GBGA 2AO9A 1MH3A 2QM3A 4V19K 4XNFA 5C4XJ 1HDPA 1T33A 1VQ7I 2I5UA 1ORKA 2BY0A 3IHUA 1SEUA 1QZYA 2AQFA 5B66C 1FYMA 2OA4A 3PJRA 1YI2I 1FIPA 4HQEA 1E3OC 1X1BA 3CD6I 4CCLA 2L54A 3FXLA 1R36A 1R00A 5EF6A 2EV0A 3S2DJ 2Z2SB 4N4OB 3KETA 1KQ8A 1SD6A 2IA0A 4XKBA 2VBXA 1F36A 1KYWA 1YJ9I 5D5UB 3JRDA 3RKQA 1EKEA 3HKZA 2OU2A 1I6XA 2DA1A 2LH9A 2M1BA 2LK2A 4BDZA 1XGMA 3ESWB 4I0BA 3WTUC 3GFLA 1ZG3A 3S14J 2ELHA 4KITB 4QPQA 3E5UA 4Y15A 3K4LA 1RNLA 2CO5A 4E6KG 2DDAA 1D0ZA 3KFWX 4GYIA 2E2IJ 3HOUJ 4CHUA 4X0GA 5LRRA 1T98A 2LF8A 3HEFA 3JRBA 3ZQIA 5IYDJ 1IDZA 2Y0MA 3PFIA 1S72I 3A2KA 2G7HA 3JAMK 2JWTA 1VF9A 2HOTA 3S1RJ 2HKOA 4F55A 1W5SA 4BYYA 1XC5A 3OS1A 2W1OA 4KUMA 3EPZA 4CCJA 5IOYA 5M5WJ 1HKTA 2KL4A 2KQRA 2CH0A 3KYCB 3UNGC 2XPUA 3DLLF 1QRYA 1E3PA 1SFUA 3DKWA 3QP6A 2LC2A 5L3CA 4XKWA 3O8GA 1SVLA 4A5NA 1JHFA 3CMEI 1O3QA 2NVXJ 3U9GA 3ERMA 5DD8A 3LQQA 3FM5A 3MVPA 4XN3A 4B47A 5DD4A 3DPTA 5EG0B 2MC3A 4XQFA 3SZTA 2GXAA 4BJTA 3K9TA 4E7KA 5E1WA 5CLSA 4ZTFA 2O3FA 4J00A 2E71A 4CYCB 4BHPA 3S15J 5K7FA 2CQXA 1IV8A 2Y0SA 4PJNA 2QQBA 2Q8KA 1IUFA 2KLOA 3FXRA 3PUFA 1FNNA 1WJDA 2E19A 3AG3H 4E7ZA 3ZPLA 1V54H 3DWLE 5FKNA 4II3A 5GAHJ 1KU2A 4UVBA 2M45A 1P2FA 3DF8A 1P9QC 4CICA 1HKSA 5KVRA 4ESBA 3QU6A 1WJ5A 2R0QC 4F7ZA 1WSUA 4HV6A 1BJZA 3IWFA 1ACIA 4JP0A 1FYKA 2K3PA 3GTGJ 1YS6A 2AHQA 2M7BA 3AKZA 2VN2A 3KEQA 1MMAA 5CVUA 1FJLA 5J4YA 1ZG5A 1D1BA 2HVRA 2WBMA 2M2EA 4KIFA 2CS3A 1BM9A 5F08A 3LSPA 1MBHA 4A3MJ 1IJWC 2NVUB 2TRTA 1U5TA 1Z6RA 5DCMB 4C2MJ 3WTWC 2KRCA 2DMNA 5J6XA 5CVRA 2VXZA 2LY2A 4ZYHA 1FYLA 5K7HA 4FASD 2R5ZA 2GIVA 3KLNA 4HYEA 1J59A 1KU3A 2KJBA 3KYDB 2PJRA 1UCRA 1V55H 2M30A 1K79A 1BOAA 1L0OC 1YTYA 3CF2A 2DW4A 4LOCA 5F64A 3ZOBA 3REOA 1YIJI 3PSFA 2TDXA 1MKMA 1OYWA 5FD6A 2QYOA 2QEXI 3A01B 1ZN2A 2HEOA 4ZJZA 4MO7A 3H9JA 2JQ7A 2UXXA 3I55I 3PIOF 1QO0D 2KT0A 3FHNA 4LB5A 4A6EA 1IC8A 3CMAI 2O61A 2RREA 3CJRB 5DEQA 2LD5A 1A36A 3U1KA 4GDFA 3R4KA 1N25A 3OYJA 2W00A 3MFKA 1VQLI 4XRFA 2PMZN 5M3MJ 3L2WA 2XKOA 3KYLA 3KX2A 3MAJA 4LG3A 1JE8A 1Q1VA 4DBRA 4ESFA 1MMSA 2O0YA 2RKHA 4U88A 2NOGA 4XMYA 1MMGA 3WODF 1WJCA 4IQJA 3S2WA 1BBYA 2FUG2 2WY8Q 1Z3YA 2O9LA 2GLOA 3SDGA 2BEOA 2ZXJA 2D1VA 2HU9A 2KRFA 3HG9A 5ILVA 3L2VA 2QSGX 4O5VA 3ULQB 5BQTA 1XX5A 1ODDA 3OOUA 3E0JB 2K9SA 4NNJA 4HNTA 2Y9ZA 2JK3A 2COBA 4HLXA 2RQPA 3S32A 3QPLA 2JSCA 1DGWY 3PO3J 4MNUA 4BJ6C 1U9OA 1V5EA 3IH2A 3HRSA 1R23A 3BG6A 3EUHA 1O57A 1U5TB 1XDUA 5DCMA 4I01A 5E1XA 5IT3A 1BR4A 5E8IA 1KQ9A 3QQAA 2DT7B 3C2BA 3LMMA 3CF5F 3HPGA 3JRGA 1K61A 1PUFB 4GYGA 2GXGA 5D5WB 3F21A 1IGNA 2P6SA 4XR6A 5ICGA 4M71A 1DQUA 1AU7A 1FPQA 1GVDA 2K9MA 3QOEA 5DM6F 1K7AA 3DU5A 2P6TA 4OINF 3BOQA 3HJEA 2GIZA 3TO6A 3NQOA 1OCOH 3RQ4A 4RBOA 2D45A 2Q2EB 4HZFA 3EETA 2VKEA 1S8NA 5ICEA 2ID6A 5F1RA 5LEKA 4D1QA 3VOEA 5FJ8J 1G3YA 3I5UA 1HQCA 2XPVA 2MH2A 3TGNA 2COMA 5FFXA 2MG4A 2M5WA 2W25A 4E7LA 1LQ1A 4EJTA 5F27A 1JI8A 3ABMH 5H6RA 4B3AA 3EUHC 2VBYA 3KP3A 3QU3A 2IGNA 4C2UA 5EJCA 1BR1A 2EQRA 2O6GE 3V8JA 3I56I 1KA8A 2MYSA 3VFZA 4DYRA 5LGTA 3SFZA 1LFPA 3DEWA 4IHTA 2DA6A 4IX7A 2JTVA 2R7QA 3I4MJ 1N77A 1D0XA 4MFDA 3Q5FA 2YS9A 3S3NA 1ZR2A 3BQYA 3IUOA 2L02A 4YIFA 2EFOA 2UWMA 2E1MC 3H3UA 4XBFA 4B1RA 4BL0B 4E7HA 4BNCA 1Y8RB 1G8XA 2VC0A 2R92J 1D8JA 4F52A 4FE4A 4A0YA 4G94A 5JI6A 3KZYA 2K86A 2K4BA 1FSHA 3BP8A 2FNPA 3ZQFA 4JYKA 3FXQA 1AKHB 4IRIA 2GA2A 1USTA 2WADA
chains in the Genus database with same CATH topology
3ZRGA 4NQWB 4NC7A 2Q1ZB 2PMZA 3BG7A 3ZXSA 1U0JA 4DIQA 3S8PA 3MKWB 5CKTA 3HOSA 2W82A 4BEHA 4HG2A 3DEEA 1X1CA 2MC4A 4F92B 2UV1A 3HOTA 1TT0A 2LBFA 2X6WA 1WJAA 3CESA 3TMOA 4U87A 3OYGA 4G6TB 2L5QA 2HZDA 2M4KA 3VWBA 2R7OA 3M8JA 4IKFA 3HC7A 3OYNA 4P1WA 5TGTA 3W2WA 1Y56A 2VKHA 2ZXHA 2IS1A 2E5NA 2X51A 3K10A 3DTIA 2VLAA 2P0WA 4NC8A 4XLHA 2JUGA 2M0MA 3OYKA 2WB1A 2XAUA 2ZSIB 3LFUA 2WAQA 1AA7A 4IZZA 2VB6A 2QKLB 2HNHA 4CCMA 3BLYA 1X4PA 1Z21A 4P5OA 3VYSB 2F6CA 3V42A 1VZ0A 4C9YA 3CJQB 1MNDA 4PFPA 4BE0A 3OYIA 2R7VA 2Z1DA 1Z7LA 4PSXA 3FBNB 3ZR8X 1WJBA 1LKXA 4OWRB 3OYHA 5HLTA 2LY1A 2V26A 4PFOA 4RM2A 4XLAA 3A1YA 4RLQA 3K4CA 1LVKA 3I9V2 3LSMA 4NUBA 4KT6A 2LG4A 1X1DA 4C2TA 3D5SC 3K4BA 3AL0B 2E60A 1HA8A 2IGMA 3OYMA 2XSJC 2R4GA 1DP3A 5HVQC 2WA0A 2CV2A 2R7SA 2XC7A 1MNEA 1ERDA 2E1MB 4CCNA 2ELJA 4BE1A 2XF5A 2A5WA 2RNGA 4XKVA 3MMYB 3W2AA 2VQCA 4R79A 4FETA 2KPMA 1X1AA 4PJJA 1WJEA 2BW3A 2IGKA 3PNVA 3S3OA 3N05A 1NG6A 1YX3A 2W4SA 3K4KA 3PUBA 4XOTA 3LSIA 3PNTA 1EA3A 4RLFA 3SEQA 4CA0A 3H5NA 4DGWB 3OYLA 4HRIA 3BC8A 2M3AA 2VKDA 1OLTA 1X4OA 3PSIA 2V7FA 4PK4A 5KHDA 2KP6A 1N78A 3RPUD 5HOOA 4B48A 3H5RA 1FMWA 2KRHA 2O5RA 4J01A 4XLEA 1V5FA 2VJJA 2ZFUA 3E1SA 4ZDLA 3H0DA 2X1EA 3OIPA 4HEA2 1NG7A 2GOXB 2VASA 1YE9A 2R7XA 4OAZA 4XOPA 1OR7C 1K6YA 3OWTA 2X1CA 2KMUA 2DJIA 3SDBA 1BR2A 2JA2A 4CCKA 4BEHB 1MMDA 5JHFA 4BDYA 4RM3A 2WY7Q 4KJZA 3OIQA 4E7IA 2VJ4A 3VSKA 3GBGA 4XNFA 2OC6A 4C30A 4HSRA 1D1AA 2JVHA 2AQFA 1IRXA 3PJRA 4XKCA 1MW7A 3QYEA 1X1BA 2XDVA 4YELA 4CCLA 3BCAA 3L2QA 5FRMA 1GLNA 2Z2SB 1J09A 2A6TA 3SEZA 4XORA 5FROA 4N4OB 4XKBA 3MKZA 3S3MA 3OL3A 4BS9A 2IS2A 4PJLA 3HKZA 4IQ4A 3OL4A 2F4IA 2LH9A 3TL4X 2L9SA 3ZQQA 2QKMB 4BDZA 1BOBA 3OMYA 3J7AY 4KITB 4QPQA 2LREA 4E4HA 4H4KC 3K4LA 4E6KG 2L7KA 4N4NB 1D0ZA 3CZ6A 2CV1A 4BQNA 3VYRB 3K6GA 4X0GA 1D0YA 2OV7A 2L9NA 3NWTA 3IAS2 2RQQA 3MKYB 1D1CA 4JOMA 4BACA 3A2KA 3H9QA 4BJ5C 3HPHA 4QPOA 1Z3XA 2W7NA 2HDWA 4CH7A 4F55A 3DKXA 1WJFA 2I8DA 2X6YA 4F91B 4XM3A 4AU7A 3OS1A 4CSWA 2W1OA 3DU6A 2ZSHB 3EPZA 4CCJA 4BQOA 2KL4A 2KQRA 2V1NA 2BVLA 2CH0A 3UNGC 4BE2A 4ZTJA 3AL0C 3LSGA 3I3LA 3SZGA 3LSHA 2LC2A 4XKWA 3W2VA 4ZDOA 2HVQA 5CQGA 2VPLA 3A4CA 1KONA 2XF6A 5HNHA 4CZCA 4LITA 4Y4RA 4LIUA 3ZCOA 3DTEA 4B47A 4XN3A 1G59A 3VSLA 3DPTA 4B44A 3VYTB 4XQFA 4E7SA 4BJTA 4E7KA 4ZTFA 2DOAA 3EUAA 4J00A 5KCMA 3EUKL 1S9HA 3QYFA 4BGDA 3OS2A 2CFOA 2Y0SA 4PJNA 1UAAA 3W3CA 2KLOA 4ZYAA 1WJDA 4E7ZA 3OR1C 3DWLE 4II3A 1P9QC 3OYAA 3DTKA 1SFKA 3OYEA 1WJ5A 2DCEA 4BU2A 4RMNA 2E5ZA 3OYCA 3CP8A 3PNYA 2K3PA 3PL8A 4ITVA 3AKZA 2M7BA 3ZGKA 1MMAA 2VL8A 2K5CA 2BOLA 2IS4A 3AFHA 1D1BA 2HVRA 2V4JC 3MD2A 2VIXA 2WBMA 3D5RC 4XL9A 4ZC3A 2CS3A 3NWSA 2IS6A 1UG0A 3FBIB 4CCOA 2V9KA 5KNLA 2LYCA 2KRCA 1WFXA 2VXZA 2LY2A 4FASD 2CW7A 4PUSA 2PJRA 2LOOA 1UELB 3FDYA 5LD2C 1FMVA 4BXFA 2X1DA 3OS0A 3OYDA 3RSNA 3CF2A 4BQQA 2KZVA 2R7WA 1PJRA 3PSFA 2HQAA 2MD0A 4ZJZA 3H5AA 3H9JA 2UUZA 4U7BA 4MLOA 3G2BA 3FHNA 2LRDA 4BUPA 2RREA 3CJRB 1X19A 2VQLA 3LSKA 3OYJA 3HUGB 2W00A 4HNUA 4Y33A 3F9KA 3TBIA 4AVZA 1E0EA 4YEJA 2MFZA 1LDKB 3RCOA 3RTRA 3L2WA 2IGOA 3KYLA 3KX2A 4LG3A 2OUMA 1V5GA 3HL2A 2NOJB 4DBRA 4EATA 4B3XA 2R7UA 5CQEA 4GRIA 2CUJA 2WAFA 4XMYA 1MMGA 4XN0A 3DLAA 4PJMA 1WJCA 4IQJA 2IXSA 4XLFA 4AYBA 2WY8Q 2FUG2 2R7RA 1Z3YA 1N75A 3OR2C 2Z16A 3K4MA 4OAYA 2HU9A 3IP4B 1QU3A 2R7TA 3DKYA 2CW8A 3HG9A 3L2VA 5HNFA 4II2A 1T0FC 3DPLC 3OOUA 4F3QA 3C2GA 3E0JB 4DJAA 4NNJA 4HNTA 2K9LA 3CP2A 3M1CA 3S32A 1MMNA 4KISA 3VYUB 2HPMA 1DGWY 1Y6IA 4BJ6C 1V5EA 3D5LA 3BG6A 4HPQA 1W36C 2VXDA 3L2UA 2VQHA 4PSWA 4B43A 1BR4A 2MABA 2HVSA 1ZELA 2DT7B 3LMMA 3HPGA 3VDXA 3DQVC 4ANJA 3OYBA 5FRNA 4HSTA 3H35A 2L2OA 1W36D 4XR6A 1DQUA 4LIVA 2K9MA 3IAM2 2DXIA 2LBFB 3QOEA 3DU5A 4E7JA 2KDOA 3K70D 3RQ4A 2F5VA 2Q2EB 4DBQA 3HXLA 1QHHD 3L2RA 4YRVA 4DOZA 4D1QA 1SAUA 3CMMA 2M7AA 3KEYA 3OYFA 4F93B 1DGRM 3H9GA 3OY9A 4XLCA 4E7LA 2CV0A 1QHGA 2BW3B 2CUZA 2V6EA 1JI8A 2VJIA 1PYVA 3EUHC 3S93A 2HPIA 4C2UA 2IGNA 1BR1A 1TZLA 3FKJA 2X6XA 1R6RA 2GOMA 3C2HA 3LL7A 4XONA 3PFYA 2X85A 3K70C 2MYSA 1YX5A 2AQEA 2PJRB 1LFPA 3BCBA 4IX7A 2ZXIA 2R7QA 2BVMA 2DT6A 4D9JA 3SYTA 1N77A 1D0XA 3DPUA 2VQGA 3S3NA 2JVGA 3IUOA 1T95A 2UWMA 4Y3OA 2E1MC 3K4JA 4BL0B 4E7HA 2WAEA 2JSPA 2M4GA 3QODA 3UR3C 1G8XA 2XF7A 4CUGA 2VJ5A 3U21A 4F52A 5LFAA 2KHMA 4ZDPA 3QYBA 4JQFA 5CPRB 3K4NA 2CMPA 2WADA 3ONQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY2 A;  2KPM A;  2LY1 A;  2LH9 A;  2KZV A;  3RCO A;  3S93 A; 
#chains in the Genus database with same CATH topology
 4NQW B;  2PMZ A;  2EIK H;  3BG7 A;  3ZXS A;  2CUE A;  3GO5 A;  5J1U A;  2ME6 A;  3MKW B;  5BMZ A;  2W82 A;  5HDN A;  3OSF A;  1X1C A;  2MC4 A;  2HQN A;  2LVS A;  1TWG J;  3E6B A;  1F43 A;  1IXC A;  2FMY A;  2BY1 A;  3CC2 I;  1TT0 A;  1X3Z B;  4I2O A;  1WJA A;  3OYG A;  4TV7 A;  4PZJ A;  3I4N J;  1UB9 A;  1T0F A;  2L5Q A;  2HZD A;  3NAR A;  2JA8 J;  2QEN A;  5IY5 H;  1IF1 A;  2OQG A;  1MBF A;  3HOZ J;  3LWF A;  4IKF A;  1UHM A;  2HTJ A;  3OYN A;  1CGP A;  2PMU A;  1XG1 A;  3WU1 B;  2VKH A;  1R9T J;  1I27 A;  3GW2 A;  2ACJ A;  3HSE A;  2IS1 A;  2B0L A;  2X51 A;  1FEX A;  3I71 A;  2VLA A;  1B8I A;  1FIA A;  2P0W A;  1JHH A;  4NBQ A;  2JUG A;  2NS7 A;  3CCM I;  4A3K J;  2YSR A;  1U6G A;  2ZSI B;  5D6F A;  4HAM A;  2QKL B;  4CCM A;  2L9V A;  3S1Q J;  1E2X A;  1X4P A;  3HGG A;  1Z21 A;  1ETQ A;  3Q0W A;  2IBD A;  2P5V A;  2F6C A;  1JKQ C;  2A3S A;  3GFJ A;  4S04 A;  1MND A;  1BI3 A;  4PFP A;  2R7V A;  1X2M A;  1P92 A;  3WHC A;  3TO9 A;  2EV5 A;  3JSO A;  2JA6 J;  2KZG A;  4I98 B;  5FFZ A;  2L4M A;  2B63 J;  4A2U A;  1ONV A;  1POG A;  2LSO A;  2V26 A;  1BN5 A;  1MNM C;  1LVK A;  3RPU A;  1T2K A;  3T8R A;  2GZW A;  4AWX B;  4XLP F;  4KT6 A;  3CCL I;  5D4S A;  1P4X A;  4Z2Y A;  2JA7 J;  1NTC A;  1GV5 A;  1B72 B;  3TOA A;  5EZG A;  2R4G A;  2CQQ A;  3WG7 H;  2IP2 A;  3ZMD A;  2CV2 A;  2R7S A;  1FLI A;  3T8T A;  4CCN A;  1YRN A;  1V3F A;  4BHC A;  2ID3 A;  3F3X A;  2VQC A;  1RZ4 A;  4R79 A;  3W6J B;  2AXL A;  1W7P A;  2DDB A;  1X1A A;  4EMS A;  4LLN A;  4PJJ A;  1MDM A;  1R5G A;  2IGK A;  3IKV A;  3PNV A;  3E5Q A;  2Z3Y A;  4KFC A;  2RC4 A;  1SFO J;  4W97 A;  4RLF A;  5HS7 A;  4CA0 A;  3H5N A;  4R8H A;  1KQ0 A;  2VKD A;  1OLT A;  1LUJ B;  2DPU A;  4ENN A;  2HQ5 A;  2PFB A;  2AXT C;  3R60 A;  3I59 A;  4EJV A;  4L9T A;  2KIM A;  1P6R A;  1P7I A;  5HOO A;  1FWZ A;  2ZO4 A;  5DV5 A;  1DUX C;  2KRH A;  2XKP A;  3ZP5 A;  5IT9 Z;  4J01 A;  3F6O A;  3M1E A;  4XLE A;  4HV5 A;  5KK1 A;  4KNY A;  3N97 A;  2OQR A;  4Y17 A;  3H0D A;  2OTJ I;  3CO7 C;  3F6V A;  2R7X A;  2DJN A;  2F5E A;  2UXN A;  3GCM A;  2FRH A;  1GT0 C;  1J9I A;  3ISP A;  4FT8 A;  3C3W A;  1ZGJ A;  3LNQ A;  2H8W A;  2ETH A;  2QWW A;  1MBK A;  4AIJ A;  1FBQ A;  3T0Y A;  3UKG A;  5JHF A;  2XV4 S;  2ZJ2 A;  4DW6 A;  2W48 A;  2E7X A;  4RM3 A;  5TRD A;  2CJJ A;  2G0E A;  4HOB A;  4BXU A;  4O3M A;  4RAZ A;  1R5I D;  1OIS A;  2XUB A;  1OCT C;  1RI7 A;  1GDT A;  1D1A A;  3ASN H;  2JVH A;  2P7C B;  5D5V B;  1XGS A;  2JRM A;  1IRX A;  1IV6 A;  3E3V A;  4XKC A;  4YEL A;  5B3S H;  2LR8 A;  3L2Q A;  2EFN A;  2DA4 A;  1S29 A;  2D1H A;  3E6D A;  1J09 A;  1IO2 A;  1ENH A;  5AIQ A;  2RAE A;  2VE8 A;  1VQP I;  3MKZ A;  5IP9 J;  4BS9 A;  3MEX A;  2KKO A;  2IVM A;  2L9S A;  1JGS A;  1ZHF A;  2ZME C;  1YQA A;  4LLG F;  5EZH A;  3LA2 A;  1XB4 A;  3J7A Y;  4EJU A;  3C7J A;  3X2Q H;  2LRE A;  2L7K A;  1W5C C;  3BR1 A;  2CV1 A;  5FKM A;  3OOP A;  3VYR B;  2EZI A;  3K6G A;  1RKW A;  2FX0 A;  2L9N A;  3I64 A;  5L3D A;  5E3M A;  3JW4 A;  4BJ5 C;  3Q0V A;  5LLQ A;  3HPH A;  4QPO A;  3ERE D;  2W7N A;  2HDW A;  1Y8Q B;  4R1H A;  4CH7 A;  1K78 B;  1HLV A;  3WTY C;  3CC7 I;  4XM3 A;  4AU7 A;  2DK5 A;  2OJE D;  1JTX A;  3IH3 A;  4Q5S F;  3DU6 A;  5HDK A;  2A6H F;  4MEY F;  3MKL A;  2BVL A;  3AL0 C;  2OCE A;  3LOC A;  5HDG A;  3LAP A;  4P9F A;  3W2V A;  1OJL A;  5M5X J;  1JT0 A;  2HVQ A;  2XAJ A;  4JX6 A;  5CQG A;  3CCQ I;  4NHJ A;  2VPL A;  4Q4Z F;  3CCJ I;  3ZCO A;  3IKT A;  3DTE A;  2P8T A;  4WF2 A;  1D3Y A;  1B6A A;  4GFB A;  2OPT A;  3ML6 A;  3A01 A;  4RGS A;  3VYT B;  2H8R A;  1PP7 U;  1YG2 A;  4U7D A;  4E7S A;  2UZK A;  2V1D A;  3A03 A;  5KCM A;  3EUK L;  3GZ6 A;  2FQ4 A;  3QYF A;  2F5C A;  2R5Y A;  3HUG A;  4ZYA A;  5K5R A;  1ITY A;  3KP5 A;  2OAZ A;  1YJN I;  4A6D A;  3M8E A;  3J80 Z;  3ZN1 A;  5J1Y A;  2DN0 A;  3S1N J;  2IT0 A;  1HW5 A;  3M7G A;  4Q47 A;  3DCF A;  2H94 A;  1SFK A;  3OYA A;  5LHI A;  3ABT A;  2ZXW H;  2DCE A;  3K1N A;  4RMN A;  2E5Z A;  3GTQ J;  3QPH A;  3H1C A;  2W57 A;  1R1V A;  5LRS A;  2VL8 A;  4JBA A;  2K5C A;  3CCE I;  2QZ8 A;  2GAU A;  2LFB A;  1A31 A;  3TW6 A;  4HLY A;  3D5R C;  1X2N A;  3GFI A;  4CYC A;  2DQL A;  3RIR A;  3JAM Z;  3GWZ A;  1RR8 C;  2R5Z B;  3FX3 A;  4CXF A;  1TL8 A;  4GCV A;  3HHH A;  1IRG A;  2YUS A;  3K7A J;  2EIJ H;  1BA5 A;  3G73 A;  2Y30 A;  2IAI A;  3RJP A;  1QGP A;  3P9I A;  3KIO A;  4HA8 A;  2EZL A;  2WC2 A;  1R5H A;  1G3T A;  1Y1V J;  2OBP A;  3TO7 A;  1YW8 A;  1JKO C;  1AHD P;  3CJT B;  1ZG1 A;  9ANT A;  4MQV A;  1ON1 A;  2KZV A;  1PJR A;  5ED4 A;  3BTL A;  3MWM A;  3IRQ A;  3GFM A;  5DCF A;  2MD0 A;  1RUN A;  5E1Z B;  4UNO A;  3H5A A;  2E7W A;  2YR2 A;  2UUZ A;  4N9H A;  5GTH C;  5EYR A;  2X4H A;  1FT9 A;  4IHS A;  4FTH A;  2G9W A;  4U7B A;  4UHT A;  4MLO A;  3G2B A;  1RC9 A;  1WI9 A;  2EB7 A;  4M9Z A;  4BUP A;  5ICF A;  3KPH A;  1W0T A;  5EGO A;  4OIO F;  3FM3 A;  1H8A C;  4LK1 F;  2STW A;  3L2C A;  1W0U A;  1YIO A;  4Y33 A;  2YU9 J;  2DMP A;  1SVM A;  2KJC A;  3OV8 A;  3TBI A;  1VTN C;  4AVZ A;  3HYI A;  2MFZ A;  4WXC A;  1ETW A;  1LDK B;  4HW0 A;  1XCB A;  2NS0 A;  4BBR J;  4G8X A;  1GHC A;  2OUM A;  1TW2 A;  1IN8 A;  2G7U A;  4EAT A;  5D5X B;  4B3X A;  1OQY A;  3FIS A;  5CQE A;  2VOO A;  4GRI A;  2OCC H;  1U5T C;  2JZY A;  3DLA A;  1O3T A;  3BR3 A;  3F8M A;  2IXS A;  3TDU C;  1XGN A;  4WXD A;  4IO9 F;  2Y69 H;  1S6L A;  1ZK8 A;  2Z16 A;  3F72 A;  1SC7 A;  5CJ9 A;  4OAY A;  2A69 F;  1Y0N A;  3CDL A;  3DKY A;  2NNY A;  4NDL A;  3CJN A;  3MN2 A;  3QP5 A;  1I39 A;  4F3Q A;  1XSD A;  4DJA A;  4DQ2 A;  4KIG A;  2K9L A;  3GF2 A;  3CP2 A;  1HF0 A;  2O8X A;  3SXY A;  4ASN A;  2ZJQ F;  5E17 F;  2Y9Y A;  3CCY A;  1JTY A;  4L5J A;  3D5L A;  5E8G A;  4KIB A;  2VXD A;  5A2Q Z;  3MZ8 A;  4ON0 A;  3L2U A;  2QA4 I;  1W36 C;  1G3S A;  4P9U A;  1KU9 A;  4M3F A;  3FWE A;  2XGX A;  2M34 A;  3VDX A;  3DQV C;  1QZE A;  3NAU A;  5FB2 A;  3OYB A;  3H35 A;  4LLL A;  4WWC A;  2LBF B;  2O8K A;  2Z99 A;  1FC3 A;  2EA2 A;  2XGC A;  1O7F A;  4RB1 A;  2K02 A;  2KDO A;  4LJZ F;  4V2G A;  2ECC A;  4ABZ A;  1LPQ A;  1WH7 A;  2Q2E A;  1B9N A;  2F5V A;  4DBQ A;  1DP7 P;  2ZKZ A;  2K40 A;  3DEU A;  4OIQ F;  2V79 A;  3L2R A;  2DT5 A;  1ETY A;  2Z33 A;  3OYF A;  3BTC A;  3ZQH A;  3CDH A;  3E5X A;  4BXX J;  3QPS A;  3OY9 A;  3AAF A;  2BW3 B;  1WPK A;  4UV9 A;  3P9K A;  3JRH A;  1EJ9 A;  3S93 A;  3NRV A;  1TZL A;  2JT1 A;  3A02 A;  3FKJ A;  1VI0 A;  2PBI A;  2X6X A;  3C2H A;  2D2W A;  3VOD A;  4P55 A;  4KMU X;  3BCB A;  4O6J A;  5EEH A;  1T39 A;  2BVM A;  4S0H B;  1B4A A;  3FXM A;  2V9V A;  4HQM A;  3OIO A;  2DPD A;  3GLX A;  2HXI A;  4WXH A;  1YW7 A;  2HR3 A;  3MCZ A;  5HLG A;  4KDP A;  3UR3 C;  2XF7 A;  1DPR A;  2VOD A;  3W6V A;  2VJ5 A;  3KZI C;  3U21 A;  1CQT A;  1PVE A;  5LFA A;  4KMF A;  3QYB A;  4JQF A;  1QNT A;  1VQ5 I;  3K4N A;  4LIU A;  5CKT A;  2CMP A;  1FMV A;  2PN6 A;  3ONQ A;  3ZRG A;  1L3L A;  2Q1Z B;  4A3D J;  1O4X A;  1U0J A;  4DIQ A;  1HXD A;  1B8I B;  2A68 F;  4YFX F;  1YO5 C;  2M0C A;  4J19 A;  3GTO J;  4ENJ A;  4F92 B;  4L18 B;  3HOT A;  4HF2 A;  2LBF A;  3L9F A;  5AIP A;  2NNN A;  2BHY A;  1FP2 A;  4OIP F;  2QSH X;  1ZKG A;  3KP7 A;  4A3C J;  1QZZ A;  4YII A;  1IN6 A;  2R7O A;  2CQN A;  2Y2Z A;  3TP0 A;  3ZMU A;  2XRL A;  3HC7 A;  1JT6 A;  4P1W A;  3W2W A;  1Y56 A;  3FMS A;  1ZRF A;  3U1D A;  4D7M A;  3K10 A;  4Q48 A;  3WGI A;  3KZZ A;  1ULY A;  3OYK A;  2QF7 A;  4G12 A;  1JGG A;  2XAU A;  2LP0 A;  3HTU A;  3LFU A;  2WAQ A;  4N0B A;  4IZZ A;  1OMI A;  2VB6 A;  2LTP A;  3EDP A;  1ZR4 A;  2NVQ J;  3EYI A;  5FKO A;  2IJL A;  1FOW A;  3G4S I;  1ZTR A;  1FSE A;  4OU0 A;  1RES A;  4OMY A;  2YPR A;  1R1T A;  1SAN A;  3CJQ B;  4AID A;  1Z1D A;  3OYI A;  2H1K A;  4HX7 A;  1PUE E;  1ETO A;  1BC8 C;  2DTR A;  1Z7L A;  2HYJ A;  1XN7 A;  3ZR8 X;  1U8B A;  1LJ9 A;  1LKX A;  3KP2 A;  4OWR B;  2FNA A;  3KE2 A;  3I4P A;  1UMQ A;  2BY2 A;  4PFO A;  4RM2 A;  3A1Y A;  4RLQ A;  3K4C A;  3SFI A;  3ECH A;  3WU2 C;  5IYC J;  4A12 A;  5KAF C;  2B9S A;  3I9V 2;  3J81 K;  5DYM A;  2LG4 A;  2ZME B;  1S7E A;  5IT9 K;  3OYM A;  3PM1 A;  5HS9 A;  2P5K A;  2VI6 A;  2HXO A;  4MTD A;  5HVQ C;  1ZQ3 P;  1RUO A;  4GO1 A;  1F1Z A;  1R58 A;  4Y13 A;  3J7Y J;  4BE1 A;  3BG3 A;  2A5W A;  3FMR A;  2RNG A;  4XKV A;  1XSV A;  5H20 A;  4DZP A;  2HTS A;  3V4G A;  1W7P B;  2B7E A;  2KPM A;  3FK6 A;  1JKP C;  5B5E C;  4IHV A;  4BAY A;  3HOW J;  4FE7 A;  2JJ7 A;  1YJW I;  3Q9V A;  3N05 A;  4I02 A;  1YX3 A;  2JRT A;  4BY1 J;  3LSI A;  3PNT A;  3BR5 A;  2NXN B;  5ILU A;  4FX4 A;  3F8B A;  4BY7 J;  3RQI A;  3K2A A;  3BC8 A;  3OYL A;  2M3A A;  4HRI A;  1TTY A;  5TIS C;  3PSI A;  1B72 A;  1F9N A;  3ASO H;  4ZYE A;  5FLX K;  2MGQ A;  2X0L A;  1HDD C;  1TWH J;  2HI3 A;  3H5R A;  3CUO A;  2OD5 A;  5HS8 A;  2BGC A;  1HW2 A;  4PGG A;  3LQR A;  1E17 A;  2ZFU A;  2VJJ A;  4P96 A;  1IXS B;  4ZDL A;  1WCM J;  2X1E A;  1SVO A;  1WI3 A;  2A05 A;  1UFM A;  1STZ A;  1GXQ A;  2LY9 A;  1K6Y A;  1XTA A;  5IPA A;  2X1C A;  3ZN0 A;  2NRA C;  2DJI A;  4L0Y B;  4CCK A;  3T5X A;  4BDY A;  4MQ9 F;  5FLM J;  3DFG A;  1I3Q J;  4XSZ F;  5D8K B;  3V7R A;  3OIQ A;  4E7I A;  1T38 A;  2FOW A;  2VJ4 A;  4XID A;  1TP4 A;  4EEF G;  5E18 F;  1REP C;  2OC6 A;  4RAG A;  4C30 A;  4HSR A;  1LE8 A;  2H09 A;  3I0T A;  4M9X A;  1HBX G;  2DA2 A;  2VPR A;  3AG1 H;  3E7L A;  1MW7 A;  2EPF A;  1S3J A;  2XDV A;  2HYG D;  1Y1W J;  2IW5 A;  2XPW A;  3K2Z A;  4LB6 B;  3BZ6 A;  2A6T A;  3SEZ A;  3CUQ C;  5FRO A;  3J81 Z;  4IJA A;  1T08 B;  1XMK A;  3FHZ A;  3GEZ A;  2BXY A;  3JRA A;  3OL3 A;  4IRG A;  2KFD A;  3E6M A;  3OL4 A;  2F4I A;  2QQ9 A;  3TL4 X;  4YG2 F;  1O3S A;  5ERI A;  1BOB A;  3OMY A;  3RZO J;  1Z67 A;  2BZT A;  4HF1 A;  4H4K C;  2VOP A;  3B73 A;  2MSY A;  1K6O A;  3CZ6 A;  1BI1 A;  1J0R A;  4BQN A;  3I53 A;  2CGP A;  2OV7 A;  3NWT A;  2RQQ A;  3MKY B;  2P5L C;  2F2E A;  1D1C A;  2NVT J;  4JOM A;  1BIA A;  3V8K A;  5IYB J;  1XGO A;  3H9Q A;  1W1W E;  1Z3X A;  2XAQ A;  3J80 K;  2FJ1 A;  3DKX A;  2I8D A;  2L3D A;  4F91 B;  4MIM A;  1R71 A;  4UVA A;  4Y52 J;  5D6E A;  2ZSH B;  4AIH A;  1QA6 A;  3SZP A;  4BE2 A;  4RA2 A;  3HZJ A;  5BPI A;  2F48 A;  2FXA A;  2OZ6 A;  4YIR X;  3CLQ A;  4A3G J;  3LSR A;  1VND A;  3A4C A;  2XF6 A;  1WRJ A;  3H3V K;  4XRS G;  2CW0 F;  4LIT A;  1KZH A;  3HRU A;  4Y4R A;  3JRF A;  4S05 A;  3H36 A;  2TCT A;  4B44 A;  4IOC F;  5HLH A;  2E1N A;  4M74 A;  2PJP A;  3WU0 A;  1JJ6 C;  2LDU A;  4XRM A;  3O3K A;  3BTJ A;  2XRO A;  3DBR B;  2R5Y B;  2R93 J;  2FA5 A;  4BGD A;  2CFO A;  3BY6 A;  5EEG A;  1R4N B;  1UAA A;  2QLZ A;  1PUF A;  3WE3 A;  2F4M B;  2XB0 X;  3H92 A;  5LEJ A;  2VC1 A;  3G3Z A;  5J40 A;  4LG0 B;  3AG2 H;  3DTK A;  5GP9 A;  4L9N A;  3OYE A;  1EH8 A;  4M3E A;  3OYC A;  4FCY A;  3IC7 A;  1I1G A;  3PL8 A;  4ITV A;  1R4M B;  5TJJ A;  3ZGK A;  3HDD A;  3SHF A;  1OPC A;  2BOL A;  3H3Z A;  3AFH A;  2V4J C;  4GXO A;  2VIX A;  5JLX A;  3COA C;  3NWS A;  2H1L A;  1OCP A;  2L0K A;  2XSD C;  1XD7 A;  4FQG A;  3CCV I;  2HDC A;  4CCO A;  4BQA A;  3KP6 A;  2IA1 A;  3ZQ7 A;  2KIU A;  1WFX A;  2JN6 A;  2YX4 A;  3M3Y J;  5M3F J;  5BOX A;  2CW7 A;  4PUS A;  1UG2 A;  2WV1 A;  5CVV A;  2DMQ A;  2BV6 A;  1UEL B;  3GXO A;  5JHU A;  4M72 A;  1X58 A;  2X1D A;  3OS0 A;  3OYD A;  1LE8 B;  2Y0S N;  2ESH A;  4DZJ A;  4LGW A;  1VQ9 I;  2XRN A;  3JCU C;  4QWQ A;  3ZMV A;  2V1U A;  3ELK A;  4A3F J;  2HQA A;  4D5C A;  1MJA A;  3P7N A;  5EEA A;  2JUC A;  1VQK I;  3RKW A;  1ZLJ A;  2DK8 A;  2CYY A;  5B1A H;  2VE9 A;  5K7Z A;  2P7V B;  3BT9 A;  3M4O J;  2LRD A;  4QLC U;  2E34 A;  1VQN I;  2LF7 A;  1X19 A;  3LSK A;  1TBX A;  2FSW A;  2O7O A;  2WWY A;  4HNU A;  1MBJ A;  4ETS A;  3S17 J;  4WCG A;  5F1J A;  3FXO A;  4HDV A;  3RCO A;  4A5M A;  1QPM A;  1V5G A;  1EF4 A;  1Z91 A;  2X6O A;  3IV5 A;  4I99 C;  1WQ2 A;  1USS A;  2LLK A;  2H27 A;  2M8E A;  2Z9O A;  3M8F A;  4XN0 A;  2MW8 A;  4PJM A;  1Y0U A;  2M9H A;  3E97 A;  4AYB A;  2A6E F;  1N75 A;  3OR2 C;  3K4M A;  2BY3 A;  2FF4 A;  2CG4 A;  2R7T A;  2CW8 A;  1IN7 A;  4II2 A;  2MH9 A;  1T0F C;  3DPL C;  5K5O A;  5FD5 A;  5LHH A;  2JMW A;  3ABL H;  1LEA A;  2VT2 A;  2VBZ A;  2M87 A;  1MMN A;  2QUF A;  2L9R A;  1YYV A;  3FXJ A;  3VYU B;  1XS9 A;  3GVA A;  2HPM A;  1H9G A;  1U8R A;  3GTK J;  3S1M J;  5F0H A;  3GTM J;  3CTA A;  4CZZ A;  2MA3 A;  2RDP A;  4AUX A;  4HPQ A;  1GVJ A;  4X1E A;  1XPX A;  3MZY A;  2VQH A;  4PSW A;  2HVS A;  2MAB A;  3GYH X;  3CMY A;  2XIG A;  4AM3 A;  3H0G J;  4BHB A;  4D5F A;  1SFE A;  4E70 A;  4M6V A;  4CYD A;  2QBY B;  5FRN A;  1TQI A;  2L2O A;  1W36 D;  3M07 A;  1KGS A;  2FQ3 A;  1HC8 A;  5F6F A;  1BJA A;  1YHQ I;  5FKK A;  4EJO A;  2W84 A;  1A5J A;  3HKZ N;  1GUU A;  4KA4 A;  5HOD A;  5L3E A;  2FBK A;  3V8L A;  1QHH D;  1H0M A;  4K2E A;  4YRV A;  4DOZ A;  3G1L A;  1T6S A;  3CMM A;  3W6K B;  2M7A A;  1AKH A;  3KEY A;  1OFC X;  2DMU A;  1BI2 A;  3H9G A;  4XLC A;  2STT A;  2CV0 A;  3L09 A;  4IRH A;  1A6Q A;  5J1R A;  2VJI A;  4PCQ A;  3G1M A;  3B6A A;  2HPI A;  1I5Z A;  1UHS A;  1SD7 A;  3LAJ A;  1P4A A;  1SMT A;  1S7O A;  3LL7 A;  1Z77 A;  4XON A;  3PFY A;  2X85 A;  1YX5 A;  4WX9 A;  3ABU A;  2FML A;  2ZXI A;  5DUI A;  1U9N A;  2DT6 A;  4D9J A;  5LHG A;  3SYT A;  1ZLK A;  1YOV B;  3FXU A;  1PP8 F;  2OF7 A;  3DPU A;  3RI4 A;  3CC4 I;  6PAX A;  1T95 A;  2VUM J;  1TNT A;  3K4J A;  3LA3 A;  4AC0 A;  1A6I A;  3BTI A;  1OCZ H;  3QOD A;  3JTH A;  1FTZ A;  2Z5U A;  4IPA A;  4UUS B;  4JK1 X;  2KHM A;  2MLK A;  2QSF X;  4RB3 C;  3RKX A;  4U0Y A;  1Z7U A;  4UVC A;  2VKV A;  4GGG A;  3ABK H;  4NC7 A;  1MH4 A;  3TDZ C;  1HKQ A;  3WE2 A;  1FTT A;  1MD0 A;  2HDD A;  1K83 J;  4BEH A;  1KYZ A;  3DEE A;  4A3E J;  4I09 A;  2DA5 A;  4CO8 A;  1IRZ A;  2UV1 A;  4UB8 C;  4EV0 A;  5EDN A;  2HOE A;  1O3R A;  3DP7 A;  3L7W A;  4KN4 X;  1NK3 P;  1ETV A;  2XVC A;  3F22 A;  2RNJ A;  4MGR A;  2XAH A;  2GBY A;  2EIL H;  4QSH A;  4M6X A;  2V1X A;  2JPB A;  4Z6Y A;  2M4K A;  3VWB A;  2AS5 F;  4IL6 C;  5IP7 J;  1H89 C;  4IHY A;  2ADU A;  2PG4 A;  2WTE A;  4DYQ A;  5LGU A;  1HST A;  2E5N A;  4L9J A;  4L9V A;  4NC8 A;  1HW1 A;  2M0M A;  3SJM A;  1Z9C A;  1J7K A;  3K1M A;  1T8I A;  3RPQ A;  2A07 F;  2VBW A;  5F04 A;  1AA7 A;  1VFC A;  2DU9 A;  2R7D A;  3GME A;  2EA4 A;  3GLL A;  2K7L A;  1R1U A;  5E20 A;  3TKY A;  1V4R A;  2H6C A;  1G6N A;  5E3N A;  1MBE A;  1MJ9 A;  3VYS B;  2XGE A;  2HS5 A;  5BS6 A;  3IRR A;  3V42 A;  1VZ0 A;  3FXK A;  3TP3 A;  4C9Y A;  2IA2 A;  3HSF A;  2WAQ N;  4BE0 A;  4D0P A;  1PDN C;  4LFU A;  1YRN B;  1S5L C;  4A69 C;  3HSR A;  1MZB A;  2EFW A;  3L00 A;  3OYH A;  2K85 A;  3Q9S A;  4V2F A;  2LY1 A;  3HOX J;  3JTG A;  3E6C C;  4YFN F;  3DXJ F;  1ZYR F;  3JR9 A;  1YFH A;  2V9P A;  3K69 A;  4XLA A;  4DYC A;  2ISY A;  3IH4 A;  1OCC H;  1R49 A;  1Y39 A;  2PX9 A;  4M73 A;  2LMD A;  2LNB A;  3LSM A;  1X1D A;  4C2T A;  2ECB A;  3V7S A;  4XK4 A;  3D5S C;  3K4B A;  2PEX A;  1HA8 A;  5M5Y J;  2IGM A;  2WB1 N;  2XSJ C;  4KN7 X;  1FX7 A;  4G6Q A;  1CF7 B;  2KIF A;  1MNE A;  1ERD A;  2ELJ A;  3QRF F;  3F23 A;  1W7P D;  2EFQ A;  4MEX F;  4UV8 A;  2LKS A;  3ZMZ A;  2DFF A;  1BW6 A;  3MMY B;  3W2A A;  5J8C A;  3GTJ J;  4FET A;  1TWA J;  1W4M A;  2BW3 A;  3S3O A;  3K4K A;  3PUB A;  4XOT A;  4JX4 A;  2J5O A;  2QVO A;  4AIK A;  1EA3 A;  1JXS A;  4B8X A;  1P4W A;  2CSO A;  2QQ8 A;  4DGW B;  1AOY A;  1EH6 A;  3F8N A;  5DM7 F;  2HQR A;  1D5Y A;  2VON A;  1X4O A;  3A0B C;  1Z0X A;  4DNC A;  3BR6 A;  4PK4 A;  3WTS C;  2KP6 A;  1N78 A;  3RPU D;  5GAD J;  4A3L J;  2DYS H;  1FOK A;  1FMW A;  1TQM A;  2O5R A;  1IZ1 A;  4I0A A;  1V5F A;  2CRG A;  4CDG A;  3OIP A;  1NG7 A;  2GOX B;  5E3L A;  1YE9 A;  1HSJ A;  2DOF A;  4OAZ A;  4XOP A;  1OR7 C;  2HWV A;  1FOX A;  3OWT A;  4KT5 C;  1MGT A;  2ZFW A;  4M3D A;  3SDB A;  5JVT A;  4JX5 A;  2DI3 A;  1M1E B;  4BEH B;  1BL0 A;  2O03 A;  1RIO H;  2DTZ A;  2BE5 F;  4C3H J;  4ESJ A;  2CFX A;  4BBS J;  2WY7 Q;  1LVA A;  4KJZ A;  1VQ8 I;  4Y7N J;  1ZGW A;  1RKT A;  3KLO A;  3TW7 A;  5H6Q A;  1S7A A;  5B1B H;  2FE3 A;  2GWR A;  4WK8 F;  2EIM H;  3Q3S A;  3QYE A;  1ZRD A;  4M3G A;  3BCA A;  3ZMT A;  2RV8 A;  5FRM A;  1B9M A;  1GLN A;  3J7A O;  3CUQ B;  4XOR A;  2E2J J;  2R7Z J;  2IEK A;  4PGH A;  4A93 J;  5J3L A;  4EM2 A;  4U0V A;  3S3M A;  2IS2 A;  4A3B J;  4PJL A;  3PO2 J;  4IQ4 A;  1MSF C;  2DBB A;  3LST A;  3ZQQ A;  2QKM B;  1UJ8 A;  2GM4 A;  3S2H J;  1IUY A;  2N8G A;  2K4J A;  1TC3 C;  5ICC A;  3WG9 A;  4B4C A;  2DA7 A;  4E4H A;  1IG7 A;  1SFX A;  3HIF A;  4N4N B;  2DFH A;  3D1N I;  3I59 B;  3C1D A;  5GPC A;  1MJB A;  1JUS A;  4IVN A;  3FIW A;  1D0Y A;  3IAS 2;  3T1B A;  2KIQ A;  4ENM A;  2BXZ A;  3I58 A;  4BAC A;  2ISZ A;  3R61 A;  2JA5 J;  2X9D A;  3GTP J;  5GPA A;  2DMT A;  1LEB A;  1WJF A;  1XCV A;  2X6Y A;  3FMQ A;  4CSW A;  3BDD A;  3RKY A;  1YIT I;  2BYV E;  4BQO A;  3GTL J;  1YW9 A;  2V1N A;  2IRF G;  1VQ6 I;  1IDY A;  4ZTJ A;  3LSG A;  4UUT A;  3I3L A;  3SZG A;  3LSH A;  1KU7 A;  4ZDO A;  3R6S A;  3KP4 A;  3EYY A;  2XB5 A;  2C6Y A;  1KON A;  4MFE A;  5HNH A;  3M9A A;  4CZC A;  3WTZ A;  2K3F A;  2FEZ A;  1G59 A;  4OMZ A;  5F0F A;  3VSL A;  4ZYG A;  5D4R A;  2FU4 A;  3FK7 A;  1NHA A;  1MDM B;  1ZAO A;  1QQI A;  2KDZ A;  2EWN A;  4M6Y A;  2DOA A;  3BJ6 A;  3EUA A;  2ZNY A;  1S9H A;  3BWG A;  1P7J A;  1TT5 B;  3OS2 A;  3AG4 H;  2DOE A;  5JR3 A;  3W3C A;  1K4T A;  2DYR H;  2DFI A;  1OYI A;  2FBH A;  1OCR H;  3OR1 C;  4RB0 A;  3QOP A;  3BQZ A;  3Q0U A;  5C3E J;  1QBJ A;  2EK5 A;  1WWX A;  4AVP A;  4ZZL A;  4BU2 A;  1H88 C;  3ROU A;  1JUM A;  2GA1 A;  3CP8 A;  1U78 A;  3PNY A;  4HF0 A;  3K0L A;  4KYW A;  2IPQ X;  3HRT A;  3CO6 C;  2IS4 A;  3G1O A;  1TNS A;  1QPI A;  5GAE J;  2EJR A;  2YX7 A;  2RGV A;  3C18 A;  3MD2 A;  1D5V A;  3ZQL A;  3QPT A;  4G9Y A;  4XL9 A;  4ZC3 A;  4HNV A;  4FIS A;  2LKX A;  2IS6 A;  1UG0 A;  3FBI B;  3WGH A;  1J2X A;  2V9K A;  2W85 A;  4I7H A;  5L3F A;  5KNL A;  2LYC A;  1K78 A;  4IF4 A;  1DPU A;  3CCU I;  1Q1H A;  1C0W A;  4RAY A;  4RS8 A;  1X3W B;  2P81 A;  3NEU A;  4G7H F;  4IHW A;  2LOO A;  3JRC A;  3LSJ A;  3FDY A;  5LD2 C;  3LA7 A;  4BXF A;  4KIC A;  4B09 A;  5DS9 A;  2Y48 A;  4IXA A;  3F8F A;  3RSN A;  1R22 A;  4BQQ A;  4UUS A;  1JJ8 C;  1B1B A;  1TQP A;  1JKR C;  2RVC A;  2R7W A;  2L7M P;  2X48 A;  1DU0 A;  4M3B A;  5H2F C;  4PDK A;  3O6B B;  2ESN A;  2FOK A;  4D7N A;  4EM1 A;  5KAI C;  2F5D A;  3CLO A;  1WKM A;  4NB5 A;  2BBY A;  5BNG A;  2DA3 A;  2A5Y B;  2GXB A;  2XHK A;  2LKP A;  2VQL A;  4W1U A;  4XLN F;  1MBG A;  4A0X A;  4G7Z F;  1J5Y A;  3HUG B;  1RRJ A;  1YS7 A;  3F9K A;  1E0E A;  1B59 A;  2EH3 A;  4YEJ A;  3G6E I;  1R7J A;  5FGM A;  3RTR A;  3V7C A;  2IGO A;  4N9I A;  2ZNZ A;  3L1P A;  5A2Q K;  3HL2 A;  2DFE A;  1BIB A;  2NOJ B;  4UB6 C;  4L0Z B;  3RDI A;  2R7U A;  4X6A J;  3HHG A;  3VPR A;  2CUJ A;  2PLY A;  2NYX A;  2WAF A;  3HOV J;  4LK0 F;  2ME0 A;  1QVU A;  2HZT A;  1F5T A;  3ZQC A;  3BZK A;  1XMX A;  4G6D A;  4RAF A;  4XLF A;  1ZAR A;  4HX8 A;  3QWL A;  1EH7 A;  4NC6 A;  4UUV A;  2R7R A;  5CVJ A;  2CQK A;  1IW7 F;  2HFH A;  2PMH A;  3IP4 B;  1QU3 A;  3J7Z I;  4IEJ A;  4L5I A;  2ZBK A;  4U0W A;  5HNF A;  1APL C;  2L7Z A;  3C2G A;  3BPV A;  5J8F A;  4MHG A;  1YLF A;  5FLX Z;  2M8G X;  3B02 A;  4ZZD A;  3M1C A;  5EGO B;  4KIS A;  3DBL B;  1G4D A;  1Y6I A;  3GZN B;  4RGX A;  1SD5 A;  1LDD A;  2QGU A;  3EQL F;  3PQJ A;  2ZB9 A;  2MBF A;  1OR7 A;  1W5T A;  2CWE A;  1FOY A;  3RYP A;  4B43 A;  4I76 A;  1ZEL A;  2KIS A;  1AWC A;  3HBL A;  4UXN A;  2CU7 A;  3BJO A;  3GZ5 A;  4UY8 I;  2QBY A;  2XGD A;  4ANJ A;  1I6H J;  5E3O A;  4HST A;  2E1C A;  1LNW A;  2RN7 A;  1BC7 C;  2ICW G;  4LIV A;  2HGC A;  3IAM 2;  2HOA A;  1A35 A;  2ZJP F;  2DXI A;  2L7F P;  4YFK F;  1TWC J;  3RYR A;  4IHX A;  1LDJ A;  3LFK A;  4E7J A;  2MLG A;  3OSG A;  3HOY J;  1U3E M;  5GAG J;  1OYY A;  1ETK A;  2JPC A;  2W24 A;  3K70 D;  1IN5 A;  2EV6 A;  4I6Z A;  1HCR A;  4LG0 A;  1IRF A;  1BW5 A;  3MZH A;  3HXL A;  1MIJ A;  3D0S A;  3TED A;  3WTT C;  1SAU A;  4G7O F;  3VEP A;  2VT3 A;  5E79 C;  2MD5 A;  4F93 B;  1SD4 A;  3HB9 A;  1MSE C;  4LD5 A;  1DGR M;  3GX4 X;  1QHG A;  2CUZ A;  3HM5 A;  2V6E A;  1PYV A;  5K5Q A;  5CYV A;  1I1S A;  2HYF A;  3F0C A;  1VQO I;  2DO7 A;  1R6R A;  2GOM A;  3K70 C;  2Y75 A;  1H9T A;  3S16 J;  1XMA A;  2AQE A;  2PJR B;  1EV7 A;  3JSP A;  3WGG A;  1CF7 A;  2PI0 A;  3U2R A;  2BHZ A;  5BPD A;  2VQG A;  3P5J A;  4QIW N;  2JVG A;  1ETX A;  1HOM A;  4L5E A;  3KEO A;  3PQK A;  4Y3O A;  1WHU A;  2CUF A;  3BPX A;  4C3J J;  2ZJR F;  2WAE A;  2JSP A;  2M4G A;  4A3J J;  1ZRC A;  2EZH A;  3N4M A;  4FHT A;  4CUG A;  5DDG A;  5LGN A;  1LB2 A;  3VB2 A;  4QTR A;  1GXP A;  4ZDP A;  1NH3 A;  3JRE A;  5CPR B;  4FX0 A;  3PIP F;  3CDI A;  2E35 A;  4RGU A;  5JLW A;  5FLV A;  2L01 A;  4XIC A;  1VQ4 I;  5JVG F;  1IN4 A;  3HOS A;  3S8P A;  4HG2 A;  3RZD J;  1F4K A;  3FKI J;  2FD5 A;  2NAZ A;  5FKL A;  1FP1 D;  2NVY J;  2YU3 A;  1UHW A;  2K9N A;  3CCS I;  2X6W A;  3TMO A;  3CES A;  5IP6 A;  3DV8 A;  4ZH4 F;  4U87 A;  5HLI A;  3TOB A;  4G6T B;  1QVT A;  3G71 I;  1TWF J;  1FZP B;  1JUP A;  4M9S A;  4C3I J;  5L3G A;  2L4A A;  3BG5 A;  3JRI A;  2WV0 A;  3M8J A;  2Y31 A;  4HX4 A;  1DDN A;  4EVI A;  3R0J A;  2ZCW A;  1WZ2 A;  3K1P A;  5TGT A;  2ZXH A;  3WHB A;  4EGY A;  3DTI A;  3BZC A;  3HRM A;  1Z6T A;  3P9C A;  4XLH A;  3BR0 A;  5AON A;  4BH9 A;  2WB1 A;  4NQW A;  1FBS A;  2QCO A;  1WVR A;  2HNH A;  2I10 A;  1XSX A;  2GQQ A;  3BLY A;  1G3W A;  4P5O A;  2R3S A;  1TW3 A;  5J47 A;  2K9Q A;  1K4S A;  2HOS A;  1IXR C;  2Z1D A;  2FBI A;  3IL2 A;  4PSX A;  3CUQ A;  1LFB A;  2DLL A;  3FBN B;  5C44 J;  1WJB A;  3GUD A;  4PJ0 C;  3FZV A;  3ZMS A;  3SQN A;  2F4O B;  1ZRE A;  3HGY A;  1X1P A;  4OOI A;  5HLT A;  5FO5 A;  2H6B A;  3ZQG A;  3DBH B;  2OTL I;  1FY7 A;  2ELK A;  2OZU A;  5ILS A;  2P4W A;  2CQ7 A;  5D8L B;  1G2H A;  4NUB A;  5DTD A;  2PQ8 A;  2D5V A;  3BR2 A;  1U2W A;  3QAH A;  3AL0 B;  1TLH B;  2DOD A;  2E60 A;  2V6C A;  1IAW A;  4RB2 C;  5J4V A;  2A61 A;  4BKX A;  1E3H A;  1A04 A;  2XAF A;  2XAG A;  5F0C A;  1NK2 P;  2E36 A;  4ENK A;  1DP3 A;  3O8H A;  2WA0 A;  2XC7 A;  2ZC2 A;  1SAX A;  2E1M B;  2QQA A;  1RET A;  3IWZ A;  1Z05 A;  2XF5 A;  1SMY F;  1RPW A;  3ECO A;  1DU6 A;  2K27 A;  1UZC A;  3MQ0 A;  4AYB N;  1D8K A;  4RGR A;  1LFU P;  4EGZ A;  1WJE A;  1I50 J;  3CQZ J;  4A3I J;  3R0A A;  3A0H C;  1NG6 A;  1GV2 A;  2EZK A;  2W4S A;  5CVI A;  4CGZ A;  4RDU A;  2DAO A;  1T56 A;  3SEQ A;  1O7L A;  1WGX A;  5L3B A;  4EQQ A;  3O2P E;  2J5P A;  2NS8 A;  1RR7 A;  4XSX F;  3I54 A;  4EM0 B;  5GTI C;  2V7F A;  5KHD A;  3CCR I;  4LMY A;  5DUK A;  4XRS A;  4B48 A;  2ZME A;  3FF5 A;  1X3U A;  3WTV C;  2EIN H;  3HTS B;  5IOZ A;  1I3A A;  3BG9 A;  3WTX C;  1ON2 A;  4HBL A;  1VQM I;  2EBI A;  3E1S A;  3KCC A;  1FBU A;  4HEA 2;  2VAS A;  3B6C A;  5LBQ A;  2Q0O A;  3TQN A;  4HDU A;  4H0E A;  4AD9 A;  1ZH5 A;  3F8C A;  3BJA A;  2R7F A;  2F5F A;  2KMU A;  5JFR A;  5EG0 A;  2E2H J;  1BR2 A;  2XAS A;  1OKR A;  4EJW A;  4IOA F;  2EFP A;  2JA2 A;  2HKX A;  1MMD A;  2DQR A;  4A0Z A;  5K1Y A;  1J75 A;  2E1O A;  4OIR F;  3BRO A;  1BI0 A;  1WH5 A;  5C4J J;  1ZGA A;  4MTE A;  1XDS A;  3VSK A;  4ZYD A;  3GBG A;  2AO9 A;  1MH3 A;  2QM3 A;  4V19 K;  4XNF A;  5C4X J;  1HDP A;  1T33 A;  1VQ7 I;  2I5U A;  1ORK A;  2BY0 A;  3IHU A;  1SEU A;  1QZY A;  2AQF A;  5B66 C;  1FYM A;  2OA4 A;  3PJR A;  1YI2 I;  1FIP A;  4HQE A;  1E3O C;  1X1B A;  3CD6 I;  4CCL A;  2L54 A;  3FXL A;  1R36 A;  1R00 A;  5EF6 A;  2EV0 A;  3S2D J;  2Z2S B;  4N4O B;  3KET A;  1KQ8 A;  1SD6 A;  2IA0 A;  4XKB A;  2VBX A;  1F36 A;  1KYW A;  1YJ9 I;  5D5U B;  3JRD A;  3RKQ A;  1EKE A;  3HKZ A;  2OU2 A;  1I6X A;  2DA1 A;  2LH9 A;  2M1B A;  2LK2 A;  4BDZ A;  1XGM A;  3ESW B;  4I0B A;  3WTU C;  3GFL A;  1ZG3 A;  3S14 J;  2ELH A;  4KIT B;  4QPQ A;  3E5U A;  4Y15 A;  3K4L A;  1RNL A;  2CO5 A;  4E6K G;  2DDA A;  1D0Z A;  3KFW X;  4GYI A;  2E2I J;  3HOU J;  4CHU A;  4X0G A;  5LRR A;  1T98 A;  2LF8 A;  3HEF A;  3JRB A;  3ZQI A;  5IYD J;  1IDZ A;  2Y0M A;  3PFI A;  1S72 I;  3A2K A;  2G7H A;  3JAM K;  2JWT A;  1VF9 A;  2HOT A;  3S1R J;  2HKO A;  4F55 A;  1W5S A;  4BYY A;  1XC5 A;  3OS1 A;  2W1O A;  4KUM A;  3EPZ A;  4CCJ A;  5IOY A;  5M5W J;  1HKT A;  2KL4 A;  2KQR A;  2CH0 A;  3KYC B;  3UNG C;  2XPU A;  3DLL F;  1QRY A;  1E3P A;  1SFU A;  3DKW A;  3QP6 A;  2LC2 A;  5L3C A;  4XKW A;  3O8G A;  1SVL A;  4A5N A;  1JHF A;  3CME I;  1O3Q A;  2NVX J;  3U9G A;  3ERM A;  5DD8 A;  3LQQ A;  3FM5 A;  3MVP A;  4XN3 A;  4B47 A;  5DD4 A;  3DPT A;  5EG0 B;  2MC3 A;  4XQF A;  3SZT A;  2GXA A;  4BJT A;  3K9T A;  4E7K A;  5E1W A;  5CLS A;  4ZTF A;  2O3F A;  4J00 A;  2E71 A;  4CYC B;  4BHP A;  3S15 J;  5K7F A;  2CQX A;  1IV8 A;  2Y0S A;  4PJN A;  2QQB A;  2Q8K A;  1IUF A;  2KLO A;  3FXR A;  3PUF A;  1FNN A;  1WJD A;  2E19 A;  3AG3 H;  4E7Z A;  3ZPL A;  1V54 H;  3DWL E;  5FKN A;  4II3 A;  5GAH J;  1KU2 A;  4UVB A;  2M45 A;  1P2F A;  3DF8 A;  1P9Q C;  4CIC A;  1HKS A;  5KVR A;  4ESB A;  3QU6 A;  1WJ5 A;  2R0Q C;  4F7Z A;  1WSU A;  4HV6 A;  1BJZ A;  3IWF A;  1ACI A;  4JP0 A;  1FYK A;  2K3P A;  3GTG J;  1YS6 A;  2AHQ A;  2M7B A;  3AKZ A;  2VN2 A;  3KEQ A;  1MMA A;  5CVU A;  1FJL A;  5J4Y A;  1ZG5 A;  1D1B A;  2HVR A;  2WBM A;  2M2E A;  4KIF A;  2CS3 A;  1BM9 A;  5F08 A;  3LSP A;  1MBH A;  4A3M J;  1IJW C;  2NVU B;  2TRT A;  1U5T A;  1Z6R A;  5DCM B;  4C2M J;  3WTW C;  2KRC A;  2DMN A;  5J6X A;  5CVR A;  2VXZ A;  2LY2 A;  4ZYH A;  1FYL A;  5K7H A;  4FAS D;  2R5Z A;  2GIV A;  3KLN A;  4HYE A;  1J59 A;  1KU3 A;  2KJB A;  3KYD B;  2PJR A;  1UCR A;  1V55 H;  2M30 A;  1K79 A;  1BOA A;  1L0O C;  1YTY A;  3CF2 A;  2DW4 A;  4LOC A;  5F64 A;  3ZOB A;  3REO A;  1YIJ I;  3PSF A;  2TDX A;  1MKM A;  1OYW A;  5FD6 A;  2QYO A;  2QEX I;  3A01 B;  1ZN2 A;  2HEO A;  4ZJZ A;  4MO7 A;  3H9J A;  2JQ7 A;  2UXX A;  3I55 I;  3PIO F;  1QO0 D;  2KT0 A;  3FHN A;  4LB5 A;  4A6E A;  1IC8 A;  3CMA I;  2O61 A;  2RRE A;  3CJR B;  5DEQ A;  2LD5 A;  1A36 A;  3U1K A;  4GDF A;  3R4K A;  1N25 A;  3OYJ A;  2W00 A;  3MFK A;  1VQL I;  4XRF A;  2PMZ N;  5M3M J;  3L2W A;  2XKO A;  3KYL A;  3KX2 A;  3MAJ A;  4LG3 A;  1JE8 A;  1Q1V A;  4DBR A;  4ESF A;  1MMS A;  2O0Y A;  2RKH A;  4U88 A;  2NOG A;  4XMY A;  1MMG A;  3WOD F;  1WJC A;  4IQJ A;  3S2W A;  1BBY A;  2FUG 2;  2WY8 Q;  1Z3Y A;  2O9L A;  2GLO A;  3SDG A;  2BEO A;  2ZXJ A;  2D1V A;  2HU9 A;  2KRF A;  3HG9 A;  5ILV A;  3L2V A;  2QSG X;  4O5V A;  3ULQ B;  5BQT A;  1XX5 A;  1ODD A;  3OOU A;  3E0J B;  2K9S A;  4NNJ A;  4HNT A;  2Y9Z A;  2JK3 A;  2COB A;  4HLX A;  2RQP A;  3S32 A;  3QPL A;  2JSC A;  1DGW Y;  3PO3 J;  4MNU A;  4BJ6 C;  1U9O A;  1V5E A;  3IH2 A;  3HRS A;  1R23 A;  3BG6 A;  3EUH A;  1O57 A;  1U5T B;  1XDU A;  5DCM A;  4I01 A;  5E1X A;  5IT3 A;  1BR4 A;  5E8I A;  1KQ9 A;  3QQA A;  2DT7 B;  3C2B A;  3LMM A;  3CF5 F;  3HPG A;  3JRG A;  1K61 A;  1PUF B;  4GYG A;  2GXG A;  5D5W B;  3F21 A;  1IGN A;  2P6S A;  4XR6 A;  5ICG A;  4M71 A;  1DQU A;  1AU7 A;  1FPQ A;  1GVD A;  2K9M A;  3QOE A;  5DM6 F;  1K7A A;  3DU5 A;  2P6T A;  4OIN F;  3BOQ A;  3HJE A;  2GIZ A;  3TO6 A;  3NQO A;  1OCO H;  3RQ4 A;  4RBO A;  2D45 A;  2Q2E B;  4HZF A;  3EET A;  2VKE A;  1S8N A;  5ICE A;  2ID6 A;  5F1R A;  5LEK A;  4D1Q A;  3VOE A;  5FJ8 J;  1G3Y A;  3I5U A;  1HQC A;  2XPV A;  2MH2 A;  3TGN A;  2COM A;  5FFX A;  2MG4 A;  2M5W A;  2W25 A;  4E7L A;  1LQ1 A;  4EJT A;  5F27 A;  1JI8 A;  3ABM H;  5H6R A;  4B3A A;  3EUH C;  2VBY A;  3KP3 A;  3QU3 A;  2IGN A;  4C2U A;  5EJC A;  1BR1 A;  2EQR A;  2O6G E;  3V8J A;  3I56 I;  1KA8 A;  2MYS A;  3VFZ A;  4DYR A;  5LGT A;  3SFZ A;  1LFP A;  3DEW A;  4IHT A;  2DA6 A;  4IX7 A;  2JTV A;  2R7Q A;  3I4M J;  1N77 A;  1D0X A;  4MFD A;  3Q5F A;  2YS9 A;  3S3N A;  1ZR2 A;  3BQY A;  3IUO A;  2L02 A;  4YIF A;  2EFO A;  2UWM A;  2E1M C;  3H3U A;  4XBF A;  4B1R A;  4BL0 B;  4E7H A;  4BNC A;  1Y8R B;  1G8X A;  2VC0 A;  2R92 J;  1D8J A;  4F52 A;  4FE4 A;  4A0Y A;  4G94 A;  5JI6 A;  3KZY A;  2K86 A;  2K4B A;  1FSH A;  3BP8 A;  2FNP A;  3ZQF A;  4JYK A;  3FXQ A;  1AKH B;  4IRI A;  2GA2 A;  1UST A;  2WAD A; 
#chains in the Genus database with same CATH homology
 3ZRG A;  4NQW B;  4NC7 A;  2Q1Z B;  2PMZ A;  3BG7 A;  3ZXS A;  1U0J A;  4DIQ A;  3S8P A;  3MKW B;  5CKT A;  3HOS A;  2W82 A;  4BEH A;  4HG2 A;  3DEE A;  1X1C A;  2MC4 A;  4F92 B;  2UV1 A;  3HOT A;  1TT0 A;  2LBF A;  2X6W A;  1WJA A;  3CES A;  3TMO A;  4U87 A;  3OYG A;  4G6T B;  2L5Q A;  2HZD A;  2M4K A;  3VWB A;  2R7O A;  3M8J A;  4IKF A;  3HC7 A;  3OYN A;  4P1W A;  5TGT A;  3W2W A;  1Y56 A;  2VKH A;  2ZXH A;  2IS1 A;  2E5N A;  2X51 A;  3K10 A;  3DTI A;  2VLA A;  2P0W A;  4NC8 A;  4XLH A;  2JUG A;  2M0M A;  3OYK A;  2WB1 A;  2XAU A;  2ZSI B;  3LFU A;  2WAQ A;  1AA7 A;  4IZZ A;  2VB6 A;  2QKL B;  2HNH A;  4CCM A;  3BLY A;  1X4P A;  1Z21 A;  4P5O A;  3VYS B;  2F6C A;  3V42 A;  1VZ0 A;  4C9Y A;  3CJQ B;  1MND A;  4PFP A;  4BE0 A;  3OYI A;  2R7V A;  2Z1D A;  1Z7L A;  4PSX A;  3FBN B;  3ZR8 X;  1WJB A;  1LKX A;  4OWR B;  3OYH A;  5HLT A;  2LY1 A;  2V26 A;  4PFO A;  4RM2 A;  4XLA A;  3A1Y A;  4RLQ A;  3K4C A;  1LVK A;  3I9V 2;  3LSM A;  4NUB A;  4KT6 A;  2LG4 A;  1X1D A;  4C2T A;  3D5S C;  3K4B A;  3AL0 B;  2E60 A;  1HA8 A;  2IGM A;  3OYM A;  2XSJ C;  2R4G A;  1DP3 A;  5HVQ C;  2WA0 A;  2CV2 A;  2R7S A;  2XC7 A;  1MNE A;  1ERD A;  2E1M B;  4CCN A;  2ELJ A;  4BE1 A;  2XF5 A;  2A5W A;  2RNG A;  4XKV A;  3MMY B;  3W2A A;  2VQC A;  4R79 A;  4FET A;  2KPM A;  1X1A A;  4PJJ A;  1WJE A;  2BW3 A;  2IGK A;  3PNV A;  3S3O A;  3N05 A;  1NG6 A;  1YX3 A;  2W4S A;  3K4K A;  3PUB A;  4XOT A;  3LSI A;  3PNT A;  1EA3 A;  4RLF A;  3SEQ A;  4CA0 A;  3H5N A;  4DGW B;  3OYL A;  4HRI A;  3BC8 A;  2M3A A;  2VKD A;  1OLT A;  1X4O A;  3PSI A;  2V7F A;  4PK4 A;  5KHD A;  2KP6 A;  1N78 A;  3RPU D;  5HOO A;  4B48 A;  3H5R A;  1FMW A;  2KRH A;  2O5R A;  4J01 A;  4XLE A;  1V5F A;  2VJJ A;  2ZFU A;  3E1S A;  4ZDL A;  3H0D A;  2X1E A;  3OIP A;  4HEA 2;  1NG7 A;  2GOX B;  2VAS A;  1YE9 A;  2R7X A;  4OAZ A;  4XOP A;  1OR7 C;  1K6Y A;  3OWT A;  2X1C A;  2KMU A;  2DJI A;  3SDB A;  1BR2 A;  2JA2 A;  4CCK A;  4BEH B;  1MMD A;  5JHF A;  4BDY A;  4RM3 A;  2WY7 Q;  4KJZ A;  3OIQ A;  4E7I A;  2VJ4 A;  3VSK A;  3GBG A;  4XNF A;  2OC6 A;  4C30 A;  4HSR A;  1D1A A;  2JVH A;  2AQF A;  1IRX A;  3PJR A;  4XKC A;  1MW7 A;  3QYE A;  1X1B A;  2XDV A;  4YEL A;  4CCL A;  3BCA A;  3L2Q A;  5FRM A;  1GLN A;  2Z2S B;  1J09 A;  2A6T A;  3SEZ A;  4XOR A;  5FRO A;  4N4O B;  4XKB A;  3MKZ A;  3S3M A;  3OL3 A;  4BS9 A;  2IS2 A;  4PJL A;  3HKZ A;  4IQ4 A;  3OL4 A;  2F4I A;  2LH9 A;  3TL4 X;  2L9S A;  3ZQQ A;  2QKM B;  4BDZ A;  1BOB A;  3OMY A;  3J7A Y;  4KIT B;  4QPQ A;  2LRE A;  4E4H A;  4H4K C;  3K4L A;  4E6K G;  2L7K A;  4N4N B;  1D0Z A;  3CZ6 A;  2CV1 A;  4BQN A;  3VYR B;  3K6G A;  4X0G A;  1D0Y A;  2OV7 A;  2L9N A;  3NWT A;  3IAS 2;  2RQQ A;  3MKY B;  1D1C A;  4JOM A;  4BAC A;  3A2K A;  3H9Q A;  4BJ5 C;  3HPH A;  4QPO A;  1Z3X A;  2W7N A;  2HDW A;  4CH7 A;  4F55 A;  3DKX A;  1WJF A;  2I8D A;  2X6Y A;  4F91 B;  4XM3 A;  4AU7 A;  3OS1 A;  4CSW A;  2W1O A;  3DU6 A;  2ZSH B;  3EPZ A;  4CCJ A;  4BQO A;  2KL4 A;  2KQR A;  2V1N A;  2BVL A;  2CH0 A;  3UNG C;  4BE2 A;  4ZTJ A;  3AL0 C;  3LSG A;  3I3L A;  3SZG A;  3LSH A;  2LC2 A;  4XKW A;  3W2V A;  4ZDO A;  2HVQ A;  5CQG A;  2VPL A;  3A4C A;  1KON A;  2XF6 A;  5HNH A;  4CZC A;  4LIT A;  4Y4R A;  4LIU A;  3ZCO A;  3DTE A;  4B47 A;  4XN3 A;  1G59 A;  3VSL A;  3DPT A;  4B44 A;  3VYT B;  4XQF A;  4E7S A;  4BJT A;  4E7K A;  4ZTF A;  2DOA A;  3EUA A;  4J00 A;  5KCM A;  3EUK L;  1S9H A;  3QYF A;  4BGD A;  3OS2 A;  2CFO A;  2Y0S A;  4PJN A;  1UAA A;  3W3C A;  2KLO A;  4ZYA A;  1WJD A;  4E7Z A;  3OR1 C;  3DWL E;  4II3 A;  1P9Q C;  3OYA A;  3DTK A;  1SFK A;  3OYE A;  1WJ5 A;  2DCE A;  4BU2 A;  4RMN A;  2E5Z A;  3OYC A;  3CP8 A;  3PNY A;  2K3P A;  3PL8 A;  4ITV A;  3AKZ A;  2M7B A;  3ZGK A;  1MMA A;  2VL8 A;  2K5C A;  2BOL A;  2IS4 A;  3AFH A;  1D1B A;  2HVR A;  2V4J C;  3MD2 A;  2VIX A;  2WBM A;  3D5R C;  4XL9 A;  4ZC3 A;  2CS3 A;  3NWS A;  2IS6 A;  1UG0 A;  3FBI B;  4CCO A;  2V9K A;  5KNL A;  2LYC A;  2KRC A;  1WFX A;  2VXZ A;  2LY2 A;  4FAS D;  2CW7 A;  4PUS A;  2PJR A;  2LOO A;  1UEL B;  3FDY A;  5LD2 C;  1FMV A;  4BXF A;  2X1D A;  3OS0 A;  3OYD A;  3RSN A;  3CF2 A;  4BQQ A;  2KZV A;  2R7W A;  1PJR A;  3PSF A;  2HQA A;  2MD0 A;  4ZJZ A;  3H5A A;  3H9J A;  2UUZ A;  4U7B A;  4MLO A;  3G2B A;  3FHN A;  2LRD A;  4BUP A;  2RRE A;  3CJR B;  1X19 A;  2VQL A;  3LSK A;  3OYJ A;  3HUG B;  2W00 A;  4HNU A;  4Y33 A;  3F9K A;  3TBI A;  4AVZ A;  1E0E A;  4YEJ A;  2MFZ A;  1LDK B;  3RCO A;  3RTR A;  3L2W A;  2IGO A;  3KYL A;  3KX2 A;  4LG3 A;  2OUM A;  1V5G A;  3HL2 A;  2NOJ B;  4DBR A;  4EAT A;  4B3X A;  2R7U A;  5CQE A;  4GRI A;  2CUJ A;  2WAF A;  4XMY A;  1MMG A;  4XN0 A;  3DLA A;  4PJM A;  1WJC A;  4IQJ A;  2IXS A;  4XLF A;  4AYB A;  2WY8 Q;  2FUG 2;  2R7R A;  1Z3Y A;  1N75 A;  3OR2 C;  2Z16 A;  3K4M A;  4OAY A;  2HU9 A;  3IP4 B;  1QU3 A;  2R7T A;  3DKY A;  2CW8 A;  3HG9 A;  3L2V A;  5HNF A;  4II2 A;  1T0F C;  3DPL C;  3OOU A;  4F3Q A;  3C2G A;  3E0J B;  4DJA A;  4NNJ A;  4HNT A;  2K9L A;  3CP2 A;  3M1C A;  3S32 A;  1MMN A;  4KIS A;  3VYU B;  2HPM A;  1DGW Y;  1Y6I A;  4BJ6 C;  1V5E A;  3D5L A;  3BG6 A;  4HPQ A;  1W36 C;  2VXD A;  3L2U A;  2VQH A;  4PSW A;  4B43 A;  1BR4 A;  2MAB A;  2HVS A;  1ZEL A;  2DT7 B;  3LMM A;  3HPG A;  3VDX A;  3DQV C;  4ANJ A;  3OYB A;  5FRN A;  4HST A;  3H35 A;  2L2O A;  1W36 D;  4XR6 A;  1DQU A;  4LIV A;  2K9M A;  3IAM 2;  2DXI A;  2LBF B;  3QOE A;  3DU5 A;  4E7J A;  2KDO A;  3K70 D;  3RQ4 A;  2F5V A;  2Q2E B;  4DBQ A;  3HXL A;  1QHH D;  3L2R A;  4YRV A;  4DOZ A;  4D1Q A;  1SAU A;  3CMM A;  2M7A A;  3KEY A;  3OYF A;  4F93 B;  1DGR M;  3H9G A;  3OY9 A;  4XLC A;  4E7L A;  2CV0 A;  1QHG A;  2BW3 B;  2CUZ A;  2V6E A;  1JI8 A;  2VJI A;  1PYV A;  3EUH C;  3S93 A;  2HPI A;  4C2U A;  2IGN A;  1BR1 A;  1TZL A;  3FKJ A;  2X6X A;  1R6R A;  2GOM A;  3C2H A;  3LL7 A;  4XON A;  3PFY A;  2X85 A;  3K70 C;  2MYS A;  1YX5 A;  2AQE A;  2PJR B;  1LFP A;  3BCB A;  4IX7 A;  2ZXI A;  2R7Q A;  2BVM A;  2DT6 A;  4D9J A;  3SYT A;  1N77 A;  1D0X A;  3DPU A;  2VQG A;  3S3N A;  2JVG A;  3IUO A;  1T95 A;  2UWM A;  4Y3O A;  2E1M C;  3K4J A;  4BL0 B;  4E7H A;  2WAE A;  2JSP A;  2M4G A;  3QOD A;  3UR3 C;  1G8X A;  2XF7 A;  4CUG A;  2VJ5 A;  3U21 A;  4F52 A;  5LFA A;  2KHM A;  4ZDP A;  3QYB A;  4JQF A;  5CPR B;  3K4N A;  2CMP A;  2WAD A;  3ONQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...