4EJTA

Staphylococcus epidermidis tcar in complex with rna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
140
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/rna
molecule keywords Transcriptional regulator TcaR
publication title Functional studies of ssDNA binding ability of MarR family protein TcaR from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 42
structure length 140
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejtA00
4KT5C 3GX4X 5H6RA 2E7WA 2ESHA 4GCVA 4JBAA 5HS7A 1W5SA 4MNUA 4YFKF 4ZZLA 1KGSA 3WU0A 4BH9A 4EVIA 4IF4A 1G3WA 2HKXA 1BBYA 5CVUA 2QZ8A 1GXPA 1B9MA 3FF5A 4A6DA 3EYIA 2P7VB 5KVRA 2HKOA 3OOPA 4JQFA 4N0BA 4UVBA 3FMQA 5ED4A 1I6XA 1STZA 4MQVA 2PFBA 2P6SA 2UXXA 3F8NA 1RZ4A 5J8CA 1WWXA 3R0AA 4IHSA 5LEJA 4EJTA 1ODDA 3ECHA 1R1TA 2R3SA 1ZRCA 3ZN0A 4MQ9F 2GAUA 3ZN1A 1AWCA 1P6RA 3DPTA 2K27A 2NYXA 3DFGA 1YIOA 1GHCA 1W5TA 2Q8KA 3JTGA 2YX4A 1V4RA 1XGNA 1YW8A 5D5UB 3P7NA 1U2WA 1XDUA 5D5VB 1BI0A 4A0YA 5BQTA 3ZMDA 4CDGA 1MDMA 2VOOA 3M8EA 2ZXJA 3KP7A 1BJAA 3HSEA 2UWMA 4A0XA 5FD6A 2CO5A 5HVQC 2JRTA 2MBFA 2A6HF 4P9UA 3TDUC 1S8NA 4I02A 4HYEA 1TBXA 4IXAA 4YG2F 1B9NA 3HRTA 2V1UA 2IRFG 2KJBA 3HRSA 2DAOA 3GWZA 4WXCA 3GXOA 3HHGA 3HHHA 3O2PE 5D4SA 4K2EA 4U0VA 3I59B 5A2QZ 2PJPA 1USSA 3JSPA 3I53A 2XRNA 4NQWA 2V1DA 4AIKA 3DEUA 3J80Z 3GVAA 3GUDA 3ZMZA 4IHTA 2VE8A 2O8XA 2O6GE 3CUQC 3H3ZA 3RIRA 2EV0A 3KLOA 1ZG3A 4G6DA 4RAZA 3KFWX 1REPC 3EUHA 4OIOF 2QWWA 3P9CA 3CUQA 4EJWA 2M8EA 1KQ9A 1DP7P 3JSOA 1CF7B 4LG0B 3ZPLA 4ESFA 3DF8A 1MZBA 4CXFA 4FT8A 3ZMVA 2DPUA 1Z7UA 1FYLA 2CQKA 2H94A 4S04A 1XDSA 3HIFA 2W84A 4Q4ZF 1KYZA 1ZGJA 3LQQA 2IA1A 1UHMA 1QQIA 3E6DA 4DQ2A 3E6CC 1WQ2A 5DYMA 3WTYC 1R00A 4A2UA 2IPQX 1BC8C 4YIIA 5HLGA 4ZZDA 2YX7A 2Y0MA 2EK5A 3ZMTA 2XKPA 2YR2A 1HW1A 1C0WA 1MJ9A 3V7CA 1Z6TA 5L3DA 4PGGA 1FBQA 2L4AA 5E8IA 3C3WA 3H3UA 1J9IA 2K02A 5D6EA 3EETA 4R1HA 5K5OA 3RYPA 1B6AA 4O3MA 4UNOA 5HOOA 2RNJA 1XGSA 2EA2A 5BPIA 3V4GA 4KUMA 5IT9Z 5FD5A 2ZFWA 5FLXZ 1LDJA 2EFWA 2AS5F 1FC3A 3WGHA 5BPDA 3B73A 2NAZA 4Y15A 3B02A 2CWEA 2O3FA 1KQ0A 3CJNA 1R36A 5LBQA 4MTDA 3KP2A 5CVJA 1FT9A 2EJRA 1Z91A 3DP7A 3U1DA 1SFEA 3NEUA 4B09A 4R8HA 4KIGA 2A68F 4AWXB 1B59A 2DLLA 4HV6A 4Y17A 5DD8A 2DQRA 5DCFA 2HGCA 3BPXA 4L18B 1I1SA 3GEZA 2EV6A 3HSRA 2GXGA 2DK5A 1Y0UA 3KP6A 4GGGA 2Y75A 2JT1A 1TW2A 1XCBA 3SQNA 4ETSA 3PFIA 4Y13A 2M87A 3HTSB 4L9TA 1T39A 4F7ZA 3IRQA 3IHUA 3ABUA 5E18F 3RKYA 1F4KA 4Q5SF 1USTA 3E6MA 2RN7A 3KCCA 1IAWA 3GFJA 3RI4A 4U0YA 5LRSA 3N97A 1XB4A 1OYIA 1YFHA 4WCGA 3U2RA 1HKTA 3MZHA 5HS9A 1FBSA 5L3EA 3TGNA 1IN8A 2F5EA 5K5RA 3E3VA 2PG4A 3K0LA 2MA3A 4M6XA 1WRJA 3RDIA 1HW5A 1TQMA 3BY6A 3T0YA 3I64A 4Z2YA 4MEYF 4HF0A 2RQPA 3JAMK 2VC0A 3KE2A 3WG9A 3F8CA 1HKQA 1W7PD 2NRAC 2FNPA 3JW4A 2IVMA 3ZMUA 3C7JA 2AXLA 3J80K 4U88A 5CLSA 4ZH4F 3Q9VA 4I0BA 2RV8A 1K78A 3BROA 1ZRFA 3E6BA 4HOBA 3V7RA 3L09A 3P9IA 1OYYA 3F8BA 5E1WA 3SFZA 3LWFA 4UUVA 2VT2A 1BC7C 4HAMA 3FMRA 3GO5A 5CYVA 1R1UA 3I5UA 4IPAA 2XAFA 2KIFA 3KLNA 4G8XA 3L00A 1K6OA 2IA2A 2FBHA 1TNTA 5JHUA 2HFHA 2A69F 5LRRA 1YW7A 2KKOA 4OU0A 1GXQA 2M30A 5J8FA 1Z6RA 2LDUA 2ZCWA 1J2XA 3ULQB 2XAGA 2K4JA 5KK1A 2E1CA 2QYOA 4RB3C 2V1XA 2ETHA 5H6QA 2VN2A 5CJ9A 4EMSA 2ISZA 3I59A 2XAHA 1MJBA 5ICGA 3FXQA 1ZH5A 2QBYB 1UB9A 1XN7A 3ZP5A 1W7PA 4EGYA 3WE3A 2DBBA 4KMFA 2PBIA 3RYRA 3SZPA 1B4AA 3ZQ7A 1KYWA 1K7AA 2ZBKA 1DUXC 4EGZA 1HBXG 1FSHA 5J6XA 4LJZF 3U9GA 1PP8F 2BGCA 1CF7A 5D6FA 1FX7A 1QGPA 1Z1DA 2KIMA 4LG0A 1O3SA 2EFPA 4M73A 2ZNZA 4FX4A 4PDKA 3I54A 1TQIA 2BBYA 2CGPA 1PUEE 5IT9K 1G4DA 1KU7A 3TO9A 5FLXK 3ZMSA 2FSWA 2RVCA 2LKPA 1O3QA 4A0ZA 2LNBA 3K2ZA 1P4XA 3MZYA 2HEOA 2ZMEB 4UVAA 4EM2A 4EQQA 3T5XA 4LLGF 2FXAA 4OMZA 2ISYA 2OZ6A 5D4RA 2M45A 3R61A 3PQKA 4L9JA 4L0YB 1TQPA 2BV6A 5HLHA 4OOIA 2Q2EA 4ESJA 5ICCA 1S7AA 2F5DA 1JHHA 3F8FA 1HW2A 2P5KA 3QU3A 1BIBA 5D8LB 5AIQA 4H0EA 3RJPA 4L9NA 1E2XA 2VBXA 1FY7A 3KP5A 2A5YB 3G3ZA 4CICA 1L0OC 1SD7A 4BYYA 1ULYA 1QZZA 2P5VA 2COMA 2V79A 2P6TA 2MC3A 1V3FA 5DD4A 4NB5A 4Q47A 3M8FA 3WTSC 4IJAA 1IXSB 1MJAA 3QRFF 4MHGA 3RKXA 3DV8A 2E7XA 4GO1A 3V8JA 2TDXA 3M9AA 4OIRF 4HLYA 1J75A 1P2FA 2PMUA 2QVOA 3C1DA 2WTEA 4BQAA 4G9YA 2WC2A 4I09A 4HF2A 4KDPA 4MGRA 1KQ8A 1IN4A 1R22A 2Z5UA 3VFZA 3BDDA 3IWZA 1J59A 2P8TA 3D0SA 2IW5A 1YO5C 4HW0A 1ZAOA 2PLYA 1EH6A 4G94A 3I0TA 2W85A 4RS8A 1GVJA 1P4AA 2VODA 5BOXA 1R5GA 1T38A 3KEQA 5EEGA 4RB2C 3TOAA 4BHPA 3K1MA 5ERIA 3RPUA 3COAC 4MTEA 2OD5A 3ML6A 3RPQA 2DTRA 2HYFA 3ROUA 3BZ6A 1J5YA 5D5XB 5LGNA 4PZJA 1FOKA 3GF2A 1HSTA 4L5IA 2ZO4A 1BM9A 1WKMA 4B8XA 4WWCA 5BMZA 2FBIA 1D8JA 3FMSA 1D5VA 1SMYF 1ZLJA 4HV5A 1HQCA 4LB6B 2R7FA 3EYYA 2O61A 1KA8A 2Z9OA 2H6BA 1R7JA 4EJUA 2L4MA 1FNNA 1VTNC 2G7HA 2FOKA 3WTUC 3QPHA 1O57A 1BIAA 2QQ9A 3GFLA 3PQJA 1T0FA 4CYDA 2OZUA 5AONA 4WXDA 2QENA 4OIQF 1SAXA 4HDVA 4EM0B 2STTA 2VONA 3HOSA 4IRIA 1O7LA 2OQGA 1W4MA 5TJJA 2D1HA 2A07F 1U6GA 2F2EA 1ZLKA 2B0LA 4M72A 4IRHA 2FNAA 3T8TA 2VT3A 5LGUA 1MDMB 3WODF 3BJ6A 5E1ZB 1NHAA 1SFUA 3I58A 5BS6A 4JK1X 3KP3A 3G73A 3FHZA 4N9IA 2VE9A 3CTAA 3FM5A 2Z3YA 3OV8A 3N4MA 1S3JA 3WTTC 2FU4A 4KNYA 4EJVA 3ISPA 5DUKA 5IT3A 5F64A 3IRRA 2ZKZA 2DW4A 4L5JA 1ZG5A 1LQ1A 1FP2A 4LFUA 1U78A 4CO8A 1IN6A 2JTVA 4I0AA 3VODA 3ELKA 2F5CA 3Q5FA 3LA3A 3WGIA 4M9SA 2LF7A 3LA2A 1S7OA 1ON1A 1H0MA 2XHKA 2LSOA 5D5WB 1BI2A 5LHGA 4OINF 5CVIA 3GFIA 2DU9A 2PI0A 3K9TA 1JXSA 1F9NA 2FA5A 1LB2A 4XLPF 1JHFA 1LNWA 4ENNA 2GZWA 3REOA 3BJOA 2V6CA 2O03A 1EH8A 4HBLA 3SHFA 2RDPA 4A5NA 1DPRA 2MLKA 4ZYDA 1T6SA 1EV7A 3QP6A 3GLXA 2FEZA 2GQQA 3O3KA 2JZYA 5DCMB 4E70A 2XIGA 5E17F 4XLNF 4U7BA 3QP5A 2HWVA 2FRHA 3SXYA 3E5XA 3L9FA 2DQLA 3ERED 2HR3A 2JPCA 2OU2A 1SMTA 4ZYHA 3O6BB 3V8LA 4HDUA 4KYWA 2UXNA 4KFCA 1TW3A 3QOPA 4BNCA 1IRFA 3KETA 5A2QK 1ON2A 4M9ZA 2GXBA 2W24A 2XVCA 4CZZA 1J0RA 3TKYA 5H20A 1BI3A 1ZG1A 2ZMEA 2QM3A 2C6YA 1LJ9A 2ESNA 2QQBA 4XSXF 1F5TA 1YYVA 4UHTA 1ZRDA 2RGVA 3NQOA 1SFXA 1UHWA 5LGTA 4MEXF 3LAPA 4LD5A 5FFXA 4HF1A 5EEHA 4LB5A 2D2WA 1YG2A 1OMIA 5ILVA 5L3GA 2O0YA 1O3RA 3WTVC 4TV7A 4ZYGA 1G3YA 1ZHFA 5ILSA 4WXHA 1P92A 2L54A 4ON0A 2LF8A 1U8RA 3J81Z 1XD7A 1KU9A 1ONVA 3F6VA 4KMUX 1LVAA 4KN4X 5HLIA 2EFOA 2WV0A 1IUYA 2WWYA 1KU2A 4LK1F 3KEOA 4NHJA 1Z05A 3W6JB 1R5HA 4RB1A 3NRVA 1QBJA 4DNCA 3M7GA 3DXJF 1OYWA 4BAYA 1ZARA 3GFMA 3RTRA 2EB7A 2A61A 2G9WA 4WK8F 2Z33A 2V9VA 1J7KA 2VBZA 4P9FA 3LSTA 2L3DA 1LDKB 3FM3A 1OPCA 3HTUA 2ZNYA 3AAFA 4GXOA 4G7ZF 4AVPA 3GZ6A 2PN6A 1G6NA 4KA4A 3E5UA 4QLCU 1G3SA 1XGMA 2FBKA 2W25A 2H09A 3T1BA 4P55A 2Y48A 1S6LA 2L01A 5HS8A 3F8MA 1FWZA 2CSOA 5AIPA 1QPMA 4IVNA 5E20A 1KU3A 2OBPA 1R23A 4P96A 2VC1A 4LLLA 1YQAA 1B1BA 1SD5A 2PEXA 3HSFA 4IRGA 3HUGA 4EV0A 4BXUA 2KJCA 2J5OA 2QQAA 2P7CB 3R60A 3F21A 2NS0A 1JE8A 4D0PA 1WI9A 5E1XA 4WX9A 5DDGA 2P4WA 2YPRA 3MQ0A 4LGWA 1QZYA 3K1PA 3BP8A 3MEXA 1RUOA 2OAZA 5L3CA 4G6QA 3E5QA 4GYIA 1XSDA 3RKWA 3FZVA 2NNYA 1Q1HA 1IN7A 2IJLA 2E1NA 3WGGA 1K78B 3WU1B 3F3XA 4O5VA 1L3LA 3S2WA 1K79A 1BI1A 3LQRA 4OIPF 5FFZA 2HZTA 3LAJA 3CO7C 1D3YA 4XRFA 2JSCA 2L02A 1H9TA 4HA8A 2F5FA 4ENKA 1D8KA 1LDDA 4OMYA 3VEPA 4M6YA 3IL2A 1R58A 4KIBA 1AOYA 1I5ZA 3R0JA 2H27A 5D8KB 1R1VA 5HDKA 1ZGAA 2RC4A 1A04A 5JR3A 2DPDA 5JI6A 3VOEA 4ZYEA 1P4WA 3L7WA 1BOAA 1MKMA 4P5OA 2EWNA 4Q48A 4U7DA 1MGTA 3GYHX 1ZREA 3JAMZ 4L0ZB 2ELHA 3IC7A 5CVVA 2DI3A 2IP2A 5HDGA 2R7DA 1XCVA 4HQEA 3HRMA 2GIVA 1U5TB 3TO7A 1SD6A 2XUBA 2PQ8A 3L2CA 2Z99A 1W7PB 1T98A 5ICEA 5FO5A 3QAHA 2CG4A 1DPUA 1IF1A 4HX7A 3IKTA 1FP1D 1LEAA 3WTWC 3R4KA 1IXCA 2EV5A 4A6EA 2QLZA 5L3BA 2W57A 1YTYA 2HYGD 1ZYRF 2HTJA 3J7AO 2EFQA 3JTHA 1FPQA 4AIHA 3Q9SA 1XSXA 1G3TA 5DV5A 6PAXA 4CHUA 5LHIA 3M1EA 4GYGA 5DCMA 3J81K 4I01A 4R79A 3HRUA 4LLNA 2RKHA 5E8GA 2ADUA 4CGZA 4I98B 1XMKA 5K1YA 2MLGA 1MD0A 2ZJ2A 2YU3A 2D45A 3MCZA 5JFRA 4EM1A 3QPTA 5LHHA 2XAQA 4FX0A 1RNLA 3I4PA 1JGSA 1IW7F 2BE5F 3TOBA 2MH2A 2X0LA 1WSUA 2YSRA 4FHTA 2XGXA 3QU6A 2K4BA 2KRFA 2HS5A 2D1VA 4EJOA 2J5PA 3T8RA 1BN5A 3FX3A 1YW9A 4YFXF 4BHCA 4M71A 1OKRA 2BYVE 2IA0A 5L3FA 4HQMA 1PP7U 5LEKA 2X4HA 1FYMA 4O6JA 4KN7X 2XAJA 3C18A 3E97A 4RGSA 1PDNC 1YS6A 1UCRA 4RGRA 3FXUA 2CFXA 2STWA 3HYIA 4HX8A 4KICA 2UZKA 1TNSA 1HSJA 2K86A 1LEBA 4L9VA 4YIFA 2FMYA 3WTXC 3CO6C 4ENJA 3P9KA 3CLOA 4AD9A 1FLIA 1O3TA 3WTZA 2DFIA 4YFNF 3EDPA 1DDNA 2XROA 2QUFA 1E17A 3MAJA 4KIFA 2XV4S 1IN5A 5JVTA 1IXRC 2VXZA 3ABTA 4A12A 1SD4A 2VBWA 2NNNA 2QBYA 5FGMA 1HXDA 3GW2A 3I71A 2XASA 3IWFA 4ENMA 1FZPB 1HKSA 1RUNA 2CYYA 3F72A 2CW0F 2P5LC 3K69A 1T2KA 1RIOH 3MFKA 3K1NA 3WE2A 2VOPA 3KZZA 3CUQB 5LLQA 3D5LA 1FYKA 2DT5A 1I1GA 3GZ5A 4UVCA 4AIJA 1H9GA 2FE3A 2EFNA 2HDCA 5TRDA 5DEQA 1FSEA 4RAYA 1IZ1A 3V8KA 2GA2A 2HOEA 2JPBA 4RB0A 2BEOA 5ICFA 1EH7A 3IKVA 1ZN2A 1RI7A 3BOQA 1YS7A 1S29A 1F1ZA 2HTSA 3R6SA 4HX4A 4UV9A 4A5MA 3F23A 2EA4A 4S05A 3LFKA 2OQRA 2GWRA 3BWGA 1U3EM 5F6FA 5ILUA 2MH9A 4WF2A 1XMAA 3VB2A 2ACJA 3DQVC 2Q0OA 1XGOA 2OA4A 1Z9CA 2XKOA 1OR7A 3FXRA 3LA7A 3SZTA 2A3SA 4PCQA 4G7OF 1QO0D 4M74A 1QNTA 3DKWA 5FB2A 3F6OA 3CDHA 1IRGA 4I2OA 3TO6A 2M5WA 2HQRA 2G7UA 2VBYA 2MD5A 2KIUA 3ECOA 3W6KB 2FQ3A 4XSZF 1I27A 3BJAA 3DPLC 2PMHA 4UXNA 3CUOA 4N9HA 2DO7A 3KZYA 4LMYA 3EQLF 4HZFA 4PGHA 3V7SA 5DUIA 3KP4A 4I7HA 3TDZC 2HQNA 1XSVA 3H92A 3MWMA 4HLXA 1O7FA 4RGUA 2DK8A 1TLHB 3TQNA 5HDNA 5F1RA 4ESBA 3HOTA 2K7LA 4G7HF 2GA1A 4M9XA 4QWQA 4LK0F 1X3UA 4XBFA 3BPVA 4ASNA 1U5TC 1CGPA 1UFMA 2A6EF 4BHBA 1TTYA 5CVRA 4UV8A 2FF4A 2H6CA 3F22A 1FBUA 2FMLA 4RGXA 5K5QA 1U5TA 4U0WA 2M1BA 1YLFA 3FWEA 2IT0A
chains in the Genus database with same CATH superfamily
4KT5C 3GX4X 5H6RA 2E7WA 2ESHA 1S72I 4GCVA 4Y52J 5GADJ 4JBAA 5HS7A 1W5SA 2I10A 1X58A 4MNUA 2BVLA 4YFKF 2VQGA 4ZZLA 3HPGA 1KGSA 3SDBA 3WU0A 3F9KA 3HKZA 4BH9A 1DGWY 4EVIA 2KL4A 4IF4A 3OIQA 4BJ6C 5EYRA 1RETA 1A6IA 1G3WA 4A3IJ 2KHMA 2HKXA 1BBYA 5CVUA 2GIZA 2DA2A 2QZ8A 1GXPA 2VI6A 1X1BA 2WB1A 5FKKA 3LFUA 1B9MA 3FF5A 4A6DA 3EYIA 2LRDA 2P7VB 5B66C 2EILH 3ZQCA 5KVRA 3DEWA 1UG0A 4IX7A 2HKOA 3OOPA 2LOOA 4JQFA 4N0BA 4UVBA 3FMQA 3A2KA 4X1EA 4PSWA 3Q0WA 2EINH 5ED4A 1I6XA 1STZA 2VPRA 4MQVA 4XONA 2PFBA 2P6SA 2VLAA 1MBHA 3K4KA 2F48A 2DT7B 2UXXA 2UUZA 3F8NA 1RZ4A 1QU3A 5J1UA 5J8CA 1WWXA 3R0AA 3IAS2 4IHSA 5LEJA 3IUOA 4EJTA 1GUUA 4ZDOA 3JRCA 1ODDA 3ECHA 4BY1J 3PNYA 2QSFX 1R1TA 2R3SA 4JOMA 1TZLA 3ZN0A 1ZRCA 1VF9A 4MQ9F 5GP9A 2GAUA 4F3QA 3ZN1A 4YELA 1AWCA 1P6RA 4XRSG 3DPTA 1K83J 2K27A 2NYXA 3DFGA 1GLNA 5GTIC 3GTLJ 1FJLA 1D1BA 3MN2A 1YIOA 1GHCA 1BOBA 1W5TA 5C4JJ 3S1MJ 2Q8KA 4Y4RA 2YX4A 3JTGA 1LKXA 3OYHA 2V9PA 1V4RA 5CPRB 1XGNA 1PJRA 3ASOH 1YW8A 5D5UB 3P7NA 1U2WA 1XDUA 5D5VB 3SFIA 1BI0A 2XDVA 2Z1DA 3HPHA 4A0YA 2WV1A 2V26A 1XPXA 5M3FJ 5BQTA 3OL3A 3ZMDA 4CDGA 2QQ8A 1MDMA 1R4NB 2VOOA 3M8EA 2XPWA 2ZXJA 3KP7A 1BJAA 2R4GA 3HSEA 4IHWA 2UWMA 4BUPA 1JKRC 4H4KC 2X1CA 2DA6A 3SJMA 2KRHA 1W5CC 4A0XA 5LFAA 2R5YA 5FD6A 2CO5A 5F08A 3ZQFA 3N05A 5HVQC 2JRTA 2MBFA 2A6HF 4P9UA 2E1MB 3TDUC 3GTQJ 1ITYA 2E5ZA 1S8NA 2Z16A 4I02A 2KMUA 2WAQA 2Y9ZA 1QVUA 4HYEA 3TP0A 1TBXA 4IXAA 4YG2F 3S1NJ 3VYSB 5B1AH 3BCBA 4J00A 5M5XJ 3S3MA 1B9NA 3HRTA 5F27A 3LSJA 5E3OA 2YU9J 2V1UA 1N75A 1OLTA 1BJZA 2KJBA 2IRFG 3HRSA 2DAOA 3GWZA 1TWCJ 4WXCA 3BCAA 1BR4A 3GXOA 3HHGA 3QWLA 4CCMA 3MVPA 3HHHA 3O2PE 3FIWA 3DKXA 5D4SA 4C9YA 1JTYA 4K2EA 3S14J 4JX5A 4C2TA 2N8GA 2CUZA 1T56A 5IP7J 3H3VK 4U0VA 3I59B 4XKVA 5A2QZ 3HJEA 2Y2ZA 3H0GJ 2PJPA 2MG4A 1ZQ3P 1USSA 3JSPA 2TRTA 1T8IA 1WH5A 3I53A 2XRNA 3CC7I 1F36A 3BG9A 4NQWA 3ZR8X 2V1DA 3DEUA 3J80Z 4AIKA 3VPRA 4ANJA 4M6VA 3GVAA 3GUDA 2CUEA 3M4OJ 1IC8A 1AA7A 1F43A 2H1LA 1UG2A 4ZTJA 2HPMA 3ZMZA 4C30A 3OYBA 4IHTA 3TP3A 3EUHC 1IG7A 2VE8A 2O8XA 5K7HA 2IEKA 2O6GE 3BTCA 3CUQC 1PVEA 1OCPA 3H3ZA 2MFZA 1MW7A 2BY1A 3RIRA 2ELKA 3JRGA 2EV0A 3K7AJ 3KLOA 1ZG3A 1S7EA 4G6DA 4RAZA 3LMMA 4Y33A 2AQFA 3KFWX 1P7JA 2CQNA 2L5QA 1REPC 3EUHA 3SEZA 4OIOF 2VXDA 4C3HJ 2QWWA 2L7ZA 3P9CA 3CUQA 3RZDJ 4EJWA 2M8EA 3GTGJ 1KQ9A 4BE1A 1DP7P 2M4KA 3CCJI 3JSOA 1CF7B 3CCMI 5EG0B 2NXNB 4LG0B 2QA4I 4A3GJ 3G6EI 2HYJA 3ZPLA 4ESFA 3MKZA 5JLWA 1W0TA 1X1PA 4PFPA 3K4MA 3GCMA 1MIJA 3OMYA 1TL8A 3GBGA 3DF8A 1MZBA 4CXFA 3VWBA 4FT8A 3CCSI 3I55I 3ZMVA 2DPUA 1D1CA 1Z7UA 1FYLA 2CQKA 5FRMA 2H94A 4S04A 1XDSA 4CCOA 3HIFA 2W84A 3NWTA 4Q4ZF 1KYZA 2CV2A 3DTKA 1ZGJA 1V5EA 3CC4I 2YS9A 3LQQA 2IA1A 1QHGA 1UHMA 2W7NA 1QQIA 3E6DA 4DQ2A 3E6CC 1I39A 1WQ2A 4LOCA 5DYMA 2DTZA 3WTYC 1R00A 1OCOH 4A2UA 1JGGA 2IPQX 1BC8C 3MKWB 2HOAA 2ME6A 4YIIA 3CCLI 2D5VA 3S1RJ 2JUGA 2Y69H 3OYGA 4DZPA 1VQLI 3CQZJ 1RRJA 4Y3OA 3BR3A 5HLGA 2PJRA 4LIUA 2JMWA 4CUGA 4ZZDA 2K40A 2YX7A 2Y0MA 2EK5A 2KIQA 3AL0B 2Q2EB 3ZMTA 3DCFA 2XKPA 2YR2A 2ZJQF 2JQ7A 3FBIB 4BJTA 4CZCA 1ETKA 2JA8J 1HW1A 3A0BC 1YRNA 4HSRA 3ZCOA 3KEYA 1C0WA 1BA5A 2EZHA 1MJ9A 1D0YA 4XLFA 3V7CA 1Z6TA 2DJNA 5IYCJ 1ETOA 4E7IA 2KZVA 2RQQA 1TT0A 4PGGA 5L3DA 4II3A 2JVHA 4RM3A 1FBQA 3JRAA 2L4AA 5E8IA 3C3WA 3H3UA 1J9IA 2K02A 5HNHA 5D6EA 2LREA 3CC2I 5FJ8J 3EETA 4R1HA 5K5OA 4CYCB 2ZJPF 3ZGKA 3RYPA 1B6AA 2H8WA 3H0DA 1WJCA 1K6YA 2LKXA 3IP4B 4O3MA 4UNOA 5HOOA 2RNJA 3RKQA 1GDTA 1XGSA 2E5NA 2EA2A 2L7FP 5BPIA 1OCZH 3V4GA 2JWTA 4KUMA 5IT9Z 4IEJA 3PUFA 2FQ4A 5FD5A 2ZFWA 4XOPA 5FLXZ 4LG3A 2HI3A 1LDJA 2EFWA 3VSKA 2AS5F 1FC3A 3WGHA 5BPDA 3B73A 3H5AA 2NAZA 1SVLA 3IH4A 2M0CA 4Y15A 3CCUI 3B02A 5EGOB 2R0QC 4GDFA 4KJZA 2DN0A 3PJRA 2CWEA 2O3FA 1KQ0A 2O7OA 3CJNA 1R36A 5LBQA 4MTDA 4CA0A 1AKHB 3SDGA 3OSFA 3KP2A 5CVJA 4DYQA 1FT9A 3UNGC 1OISA 2EJRA 1VQ9I 1Z91A 2NVTJ 3DP7A 2RAEA 4EEFG 3U1DA 1SFEA 2V4JC 3NEUA 4B09A 4HSTA 4R8HA 4KIGA 2A68F 5JVGF 2ZFUA 2CRGA 2BW3B 4BGDA 4AWXB 4F93B 1B59A 2DLLA 1Y56A 4HV6A 4Y17A 5DD8A 1ZR2A 3DTEA 2DQRA 5DCFA 2HGCA 3BPXA 4L18B 2R5ZA 1I1SA 1Z3YA 2EV6A 3GEZA 1P9QC 2A6TA 2GXGA 3HSRA 5E3MA 1HLVA 2DK5A 4BU2A 1Y0UA 2HU9A 3KP6A 4GGGA 2Y75A 1MBKA 1WGXA 2JT1A 3K70D 1TW2A 4RA2A 1XCBA 2AHQA 2LLKA 1UJ8A 3SQNA 4E7JA 4XORA 2ME0A 4ETSA 3PFIA 4Y13A 2M87A 3HTSB 4L9TA 4XN3A 2K9QA 1T39A 3ZQLA 3PNVA 4F7ZA 3IRQA 4XRSA 2EBIA 3IHUA 2KRCA 4UY8I 1SFOJ 5HODA 2VQLA 4GFBA 3ABUA 5CQGA 2NVQJ 5E18F 3RKYA 1F4KA 4Q5SF 2WY7Q 3RSNA 1USTA 3E6MA 5GTHC 3L1PA 2RN7A 3KCCA 1IAWA 3GFJA 3RI4A 2ID6A 4U0YA 5LRSA 3N97A 3A02A 1XB4A 1OYIA 1V5GA 3DWLE 3I9V2 1VQ7I 2JA5J 1YFHA 4AM3A 3OS0A 4WCGA 3U2RA 4E7HA 1HKTA 3MZHA 2O8KA 1DU0A 2E71A 5HS9A 1CQTA 1FBSA 4HEA2 5EZHA 3DBHB 5L3EA 3L2WA 3TGNA 2QEXI 2LY1A 1IN8A 2E34A 2F5EA 4AU7A 4HNUA 5C3EJ 3TBIA 1Z21A 5K5RA 3E3VA 2PG4A 3A4CA 3QQAA 3G4SI 1XMXA 1Z0XA 3K0LA 3ZRGA 1Z7LA 2V7FA 2MA3A 4M6XA 1MMGA 2E36A 1WRJA 3RDIA 1HW5A 1TQMA 1RKTA 4XLCA 4BQQA 3BY6A 3T0YA 1NG7A 5H2FC 4YIRX 3I64A 4Z2YA 4MEYF 2EZKA 1Y0NA 4HF0A 2RQPA 3MKYB 2ELJA 3JAMK 2XF6A 4JX4A 1EF4A 2VC0A 1YX5A 3KE2A 3NARA 3WG9A 4G6TB 3F8CA 1HKQA 2ID3A 3OYJA 1G2HA 2DFFA 1W7PD 3OYEA 2EIJH 2NRAC 2BY3A 2FNPA 3JW4A 2IVMA 3ZMUA 3C7JA 2AXLA 3CP8A 1MSFC 1VQNI 3J80K 3K70C 4U88A 5CLSA 4UB8C 4ZH4F 1R6RA 2LY9A 3Q9VA 4I0BA 2RV8A 1K78A 3BROA 1ZRFA 5E79C 1IRXA 5EZGA 1JT0A 3OYFA 1ETVA 3E6BA 4HOBA 3S32A 3V7RA 2XGEA 3L09A 3HOXJ 4D5CA 4B3XA 3P9IA 1OYYA 3F8BA 2XB0X 3I56I 5E1WA 1ACIA 3SFZA 3S3NA 2L9VA 3LWFA 5IYDJ 2E1MC 4UUVA 4PJJA 1FOXA 4IHVA 4BQNA 2VT2A 2CW7A 1BC7C 4HAMA 3FMRA 3GO5A 5CYVA 3GTMJ 1R1UA 3I5UA 4IPAA 2XAFA 1FIAA 5CQEA 2KIFA 3KLNA 1GV2A 3DTIA 3L00A 4G8XA 4V2GA 1K6OA 1JTXA 1WFXA 2IA2A 2XF5A 2FBHA 4NUBA 3QPLA 5FKNA 4F55A 2QSGX 1UELB 1I3QJ 2OTJI 1TNTA 2L9SA 5JHUA 3D5RC 1LFPA 2HFHA 2A69F 1G59A 5LRRA 2CV0A 4XIDA 1TWHJ 1YW7A 2UV1A 4JX6A 1WJDA 2KKOA 4OU0A 2K3FA 1GXQA 2M30A 3SZGA 4DJAA 3A0HC 4D7NA 3CDLA 2KDOA 5J8FA 1Z6RA 2LDUA 2ZCWA 1J2XA 3ULQB 2XAGA 2K4JA 5KK1A 1XX5A 2IS4A 2E1CA 1QRYA 2QYOA 3A03A 4OAYA 3HL2A 4QTRA 1ETWA 1TWGJ 2Y31A 2VKEA 2V1XA 4XK4A 4RB3C 2TCTA 5KHDA 2ETHA 5H6QA 3V42A 2VN2A 5CJ9A 4EMSA 2ISZA 1EJ9A 3I59A 2XAHA 4XKCA 4C2UA 1MJBA 1JUSA 5ICGA 3H5RA 3RCOA 3FXQA 3B6AA 4B48A 5GPAA 1ZH5A 2QBYB 4ZJZA 1JI8A 4DYRA 1UB9A 2QKMB 2Y0SA 2IGOA 2MYSA 3K2AA 1XN7A 1MBJA 3ZP5A 2MC4A 4CCNA 1E3PA 3CF2A 1W7PA 2JK3A 4EGYA 3WE3A 4IOCF 2DBBA 2DA1A 1ZR4A 5J3LA 1E3HA 3S2HJ 4A3CJ 4KMFA 3J7ZI 2PBIA 3RYRA 3TW7A 2F4OB 3SZPA 4BDYA 1B4AA 3ZQ7A 1VQKI 1YJNI 2IS6A 1KYWA 4D9JA 1K7AA 4FISA 1RESA 4E7SA 2BOLA 2ZBKA 1DUXC 4EGZA 1A6QA 1HBXG 1FSHA 1Y8QB 5J6XA 1XC5A 4LJZF 1B72B 1U9OA 3U9GA 1DGRM 1PP8F 2BGCA 3HDDA 3SEQA 1CF7A 4YEJA 5D6FA 1FX7A 1QGPA 1Z1DA 2KIMA 4LG0A 2KT0A 1APLC 1O3SA 1HC8A 3H9GA 2DMQA 2EFPA 1VNDA 2W00A 2AXTC 3EUAA 1VZ0A 4M73A 1WJFA 2ZNZA 4FX4A 1KZHA 1X2MA 1ORKA 4PDKA 3I54A 1TQIA 2BBYA 2CGPA 2B7EA 1PUEE 2DCEA 3BR1A 3W3CA 4UB6C 2BY2A 3DLAA 3OYDA 5IT9K 1G4DA 1E3OC 1KU7A 3TO9A 5FLXK 3ZMSA 2FSWA 1HCRA 1BL0A 1MH4A 4E6KG 2RVCA 2LKPA 1O3QA 4A0ZA 5K7FA 3D5SC 1X4OA 2LNBA 1W36D 2X48A 2ZXHA 2NS8A 3K2ZA 1P4XA 3MZYA 4IL6C 2HEOA 2X1DA 3S2DJ 3WU2C 2GOMA 3K4JA 3MMYB 2ZMEB 4UVAA 1XS9A 1ETYA 4EM2A 3EUKL 4EQQA 3T5XA 4LLGF 2FXAA 4OMZA 1YITI 2ISYA 1X1CA 2OZ6A 4CCJA 5D4RA 2M45A 3R61A 2QKLB 1VI0A 3PQKA 4L9JA 1MH3A 4L0YB 4RLQA 1TQPA 2BV6A 5HLHA 4OOIA 4FQGA 2Q2EA 4ESJA 5ICCA 3LSHA 1S7AA 2KISA 2F5DA 3OYMA 4DYCA 1JHHA 1AHDP 3F8FA 1HW2A 2P5KA 3QU3A 1BIBA 1XG1A 2DMUA 5D8LB 1RR7A 5AIQA 2LK2A 2ZC2A 3RPUD 2R7XA 4H0EA 1LUJB 2NS7A 3H5NA 4L9NA 1E2XA 2VBXA 3RJPA 5E3LA 4YRVA 1X19A 1FY7A 3PSIA 3L2VA 5FKMA 5J47A 3KP5A 1LE8B 3CZ6A 2A5YB 4XL9A 3G3ZA 2K9LA 1VFCA 4CICA 4E7KA 2GXAA 1L0OC 1SD7A 1GT0C 1NTCA 2LG4A 4BYYA 3OS2A 3TW6A 1A36A 1ULYA 3QYFA 3O8HA 1QZZA 2P5VA 1NK3P 2GM4A 2COMA 3M07A 2V79A 2XB5A 2P6TA 3PUBA 2MC3A 1V3FA 5DD4A 4NB5A 4XRMA 2Z2SB 2DFHA 3S15J 4Q47A 1OCRH 4BXXJ 2F4IA 3M8FA 3WTSC 4IJAA 1IXSB 1MJAA 3QRFF 1WJAA 4MHGA 1YE9A 3DV8A 3RKXA 4RAGA 3FXLA 2ZXIA 2E7XA 4GO1A 3V8JA 3OYIA 2R7RA 1W36C 2TDXA 2CV1A 3M9AA 4OIRF 3OR1C 1UHSA 4HLYA 3FXKA 1P2FA 1J75A 1WZ2A 2PMUA 5F0HA 4V2FA 3JRDA 2QVOA 4PJLA 3C1DA 2WTEA 4BQAA 1HA8A 4G9YA 2WC2A 4I09A 3KPHA 4HF2A 1FOWA 1UAAA 1R5ID 4KDPA 2XSDC 4MGRA 2FX0A 4KT6A 1KQ8A 3K4BA 1IN4A 1AKHA 1R22A 4I99C 2L9NA 2Z5UA 3VFZA 3BDDA 3IWZA 1J59A 2P8TA 1RPWA 3D0SA 5CKTA 2O5RA 2E60A 2ZSIB 3C2GA 2IW5A 1AU7A 1YO5C 4HW0A 4F52A 2VJ4A 2BW3A 1ZAOA 2GLOA 2PLYA 1EH6A 2DA4A 4CH7A 2OUMA 3S1QJ 5JLXA 2ZB9A 1BR2A 4G94A 3I0TA 2W85A 4RS8A 1WH7A 1GVJA 1P4AA 2VODA 5BOXA 3W2WA 1ERDA 4ZDPA 1ETQA 1R5GA 1I3AA 1T38A 3GTJJ 3KEQA 4G12A 1I6HJ 4DGWB 2AO9A 5EEGA 4NC7A 3CF5F 4RB2C 3TOAA 4BHPA 3K1MA 5ERIA 3RPUA 1R71A 1VQOI 2HNHA 4AYBN 2B9SA 4XM3A 3COAC 1TWFJ 5KAIC 3CLQA 2OD5A 4MTEA 3ML6A 1JT6A 3RPQA 2DTRA 2HYFA 3ROUA 3BZ6A 1JUMA 1J5YA 4DIQA 3ZQIA 5D5XB 5LGNA 2EZLA 4PZJA 1N25A 1SVOA 1FOKA 2LR8A 3GF2A 3I4MJ 1TP4A 1HSTA 4L5IA 4M3FA 2ZO4A 1JJ6C 1NK2P 3HUGB 1ZKGA 1BM9A 1WKMA 1GV5A 5FROA 3VYRB 4B8XA 4D1QA 2NOJB 4BACA 4WWCA 5BMZA 2FBIA 1D8JA 3BTIA 3FMSA 4BBRJ 1D5VA 1IV6A 1SMYF 1ZLJA 2DOFA 4HV5A 1HQCA 2OC6A 4LB6B 2R7FA 3EYYA 2O61A 1KA8A 1RKWA 2Z9OA 1T0FC 2W48A 3OY9A 2H6BA 2E2JJ 1R7JA 2XGDA 1IDYA 4EJUA 4FASD 2L4MA 1FNNA 5IY5H 1VTNC 2G7HA 2L9RA 2FOKA 3WTUC 3QPHA 2E2IJ 1O57A 1BIAA 2A5WA 2QQ9A 3GFLA 2I8DA 5K7ZA 2CUFA 1IUFA 2DODA 2KQRA 3AG2H 3LSIA 1PUFA 2M4GA 3PQJA 3AG4H 1T0FA 4FTHA 2ZJRF 4CYDA 1VQPI 3PM1A 2OZUA 3HXLA 4LIVA 5AONA 3BTLA 4WXDA 3WHBA 2G0EA 3CP2A 2QENA 4OIQF 1SAXA 4CSWA 4HDVA 4EM0B 2STTA 3LSRA 2VONA 2RREA 3HOSA 1GVDA 4IRIA 1WHUA 1O7LA 2OQGA 1W4MA 5TJJA 2D1HA 1OFCX 2A07F 3GTOJ 1T33A 1U6GA 1FMVA 5DTDA 2IS1A 2F2EA 1ZLKA 4B3AA 2O9LA 2M34A 3DPUA 2R7VA 2B0LA 2W4SA 4M72A 3Q0VA 4IRHA 3PO2J 2FNAA 3T8TA 4XKWA 5C44J 1D1AA 2VT3A 3IAM2 3FXMA 5LGUA 3IH3A 3BC8A 1MDMB 4BBSJ 3WODF 3BJ6A 5E1ZB 2KLOA 1NHAA 2K9SA 1SFUA 3I58A 5BS6A 4JK1X 3KP3A 3G73A 2Y0SN 4XMYA 3FHZA 4N9IA 2VE9A 1V54H 3CTAA 3FM5A 1HF0A 2Z3YA 1FIPA 3OV8A 1P7IA 3N4MA 1SC7A 3AFHA 2DJIA 1S3JA 5IOYA 4RDUA 3WTTC 2FU4A 2M7BA 4XR6A 3W2VA 4A3FJ 5J4YA 1Y8RB 4KNYA 3H9JA 4EJVA 3JR9A 3E0JB 3ISPA 4RAFA 1UMQA 5DUKA 5IT3A 5F64A 3IRRA 2ZKZA 4IKFA 2DW4A 4L5JA 1ZG5A 4BQOA 2JSPA 2DOAA 4QPOA 1LQ1A 1FP2A 2F4MB 4LFUA 1U78A 3ZOBA 4CO8A 1IN6A 2FUG2 3QODA 2JTVA 4I0AA 3VODA 3ELKA 2HVQA 2F5CA 3S93A 4XKBA 3CMEI 2Y9YA 4UUSA 2FOWA 2DA3A 3HBLA 3Q5FA 3CJQB 1YOVB 2XPVA 3E1SA 3FXOA 3LA3A 4MFEA 4IHXA 3J7AY 3WGIA 4M9SA 1DQUA 2LF7A 3LA2A 5HLTA 4A3MJ 1S5LC 2HVRA 2DFEA 1S7OA 2E35A 1ON1A 3FXJA 1Y39A 3BT9A 1H0MA 2XHKA 2LSOA 5D5WB 1BI2A 2WAEA 9ANTA 2R7TA 5LHGA 1H89C 2X6YA 2OV7A 2E19A 2VQHA 3OOUA 4OINF 3D1NI 2QSHX 2NVXJ 5CVIA 3GFIA 3IH2A 2DU9A 2V6EA 4U87A 3G2BA 1W0UA 2PI0A 3K9TA 1JXSA 1F9NA 2FA5A 5LD2C 1M1EB 2LH9A 1LB2A 4XLPF 4II2A 1JHFA 1LNWA 4ENNA 2GZWA 3REOA 4PK4A 1Z77A 3E7LA 3BJOA 2V6CA 2O03A 5J4VA 1BR1A 1EH8A 4HBLA 3Q3SA 3SHFA 2RDPA 4A5NA 1DPRA 5DS9A 2HQ5A 1X3WB 3BR2A 2MLKA 4ZYDA 3CMAI 1T6SA 1W1WE 2R93J 1EV7A 1UZCA 3OYAA 3QP6A 2QCOA 3KX2A 1YJWI 1OQYA 1MNEA 2LD5A 2IS2A 3GLXA 2FEZA 2GQQA 1B8IB 5FRNA 3O3KA 3PO3J 2JZYA 5DCMB 4E70A 3GMEA 2XF7A 2XIGA 5F04A 5E17F 4XLNF 4U7BA 3QP5A 4ZC3A 4J01A 4GRIA 4QSHA 2HWVA 4BE2A 3PL8A 2FRHA 5F0CA 3SXYA 1QPIA 3E5XA 2CW8A 2HOTA 3L9FA 2DQLA 2LYCA 3ERED 3G71I 1WCMJ 2HR3A 2JPCA 3I4NJ 2OU2A 1SMTA 4ZYHA 3O6BB 2WBMA 3V8LA 4HDUA 3MKLA 3VDXA 3G1OA 4KYWA 2UXNA 4KFCA 1TW3A 2ZMEC 3QOPA 5E3NA 4BNCA 4M3DA 4MFDA 1IRFA 1YHQI 3KETA 2VKDA 4AYBA 5KAFC 3W6VA 5A2QK 1ON2A 4M9ZA 4BDZA 2GXBA 5FLVA 2W24A 2V1NA 2XVCA 4N4OB 1J0RA 3VSLA 3OWTA 4CZZA 4XNFA 3TKYA 5H20A 1BI3A 1ZG1A 2KPMA 2ZMEA 2QM3A 3DKYA 2R7OA 1LJ9A 2ESNA 2C6YA 2IGMA 2QQBA 1A5JA 4XSXF 4BS9A 1F5TA 1YYVA 2K85A 4UHTA 5J1YA 1ZRDA 2RGVA 3NQOA 1SFXA 1UHWA 2LY2A 5LGTA 4MEXF 4PJNA 3LAPA 3BZKA 4LD5A 5FFXA 4HF1A 3C2HA 2VL8A 5EEHA 4LB5A 2D2WA 1J09A 2MD0A 4X6AJ 1YG2A 1OMIA 1X3ZB 4IOAF 1MNMC 3AG1H 2BHZA 3BG5A 2BY0A 4C3JJ 5ILVA 1R9TJ 5L3GA 2O0YA 3OR2C 4PJMA 1O3RA 3ABKH 3WTVC 2P0WA 4PFOA 3O8GA 4ITVA 4A93J 4TV7A 4ZYGA 1G3YA 2GBYA 4JP0A 1MBFA 2ZSHB 4AVZA 1ZHFA 5ILSA 4WXHA 2COBA 3LL7A 1P92A 4D7MA 2JA7J 2NVYJ 2L54A 3BQYA 1KONA 4ON0A 2LF8A 2EIMH 1U8RA 1TC3C 3J81Z 2CH0A 1XD7A 3OIPA 3ASNH 4B44A 1KU9A 1ONVA 2EPFA 3F6VA 2VUMJ 4P1WA 4KMUX 1RR8C 1LVAA 2H1KA 3L2QA 1DP3A 3EPZA 5GAGJ 4KN4X 5HLIA 2EFOA 1U0JA 1EKEA 1EA3A 2WV0A 1IUYA 4CCKA 2WWYA 1KU2A 4LK1F 2CQQA 3UKGA 1YI2I 1D0ZA 4B1RA 1MSEC 2JUCA 2MABA 3KEOA 3KYDB 4NHJA 1S9HA 1Z05A 3W6JB 1R5HA 4RB1A 1IRZA 3NRVA 2MW8A 2LTPA 1QBJA 4DNCA 3M7GA 3DXJF 1OYWA 4BAYA 4EATA 1ZARA 3GFMA 3RTRA 1MMSA 4HNTA 2EB7A 3JCUC 4B4CA 1ZELA 2A61A 2G9WA 4WK8F 2Z33A 4D5FA 1K4TA 4E4HA 2CU7A 3OYCA 5IOZA 3ERMA 2V9VA 4ZYAA 1J7KA 1WI3A 2VBZA 4IHYA 3HB9A 4RLFA 2VKVA 4P9FA 3CJTB 3HG9A 1X2NA 3LSTA 2L3DA 5HNFA 2VIXA 1LDKB 3HOZJ 3FM3A 3WG7H 1OPCA 2LVSA 3HTUA 2ZNYA 3CCYA 3TMOA 3AAFA 2XSJC 2CQXA 3GTKJ 4GXOA 4G7ZF 4E7LA 5IP9J 4AVPA 1ENHA 3GZ6A 3OL4A 2PN6A 1G6NA 5GAHJ 3PNTA 4KA4A 3E5UA 4FE7A 3PIPF 2XPUA 4IQJA 3DU5A 4QLCU 4RBOA 1G3SA 1XGMA 2FBKA 2W25A 2H09A 3T1BA 4P55A 1H88C 1Q1VA 5KNLA 3GZNB 3M1CA 2Y48A 5EDNA 1S6LA 2L01A 5HS8A 4NDLA 3F8MA 1FWZA 3FKIJ 2CSOA 5AIPA 1QPMA 2QF7A 3FHNA 4IVNA 5E20A 1KU3A 5EG0A 1G8XA 3OIOA 2OBPA 1R23A 1X1DA 4P96A 2VC1A 5IP6A 2JRMA 4A69C 4LLLA 1YQAA 1B1BA 1SD5A 4A3EJ 2WAFA 3K4LA 5EF6A 2M7AA 2PEXA 3HSFA 4F91B 2HQAA 4DW6A 4IRGA 1V5FA 1WJ5A 1JKOC 3HUGA 4NC8A 4EV0A 4BXUA 3CD6I 4M3GA 2KJCA 2J5OA 4M3BA 4W97A 2JA2A 2QQAA 3S16J 2P7CB 3R60A 3JRBA 3BG7A 2EH3A 3F21A 2X85A 4F92B 1Y1WJ 2IAIA 2NS0A 1JE8A 4D0PA 2XC7A 1WI9A 5E1XA 2M8GX 4XOTA 3K4CA 4WX9A 5DDGA 2P4WA 1I50J 2JVGA 4A3BJ 1HOMA 2YPRA 3H1CA 3MQ0A 4LGWA 3M8JA 2CS3A 3AL0C 1QZYA 3K1PA 3BP8A 3MEXA 4IQ4A 5KCMA 2R7SA 2E1OA 1RUOA 2CQ7A 2OAZA 2EZIA 5L3CA 4BJ5C 4G6QA 3E5QA 2R7WA 3QYBA 2LBFB 4GYIA 5FLMJ 2OJED 3DEEA 1SVMA 4BE0A 3L2RA 3FDYA 2XGCA 2QGUA 3GTPJ 1XSDA 3RKWA 3FZVA 2NNYA 5C4XJ 1YX3A 1Q1HA 1IN7A 2KFDA 1SAUA 4XLAA 2IJLA 4BEHB 2E1NA 3WGGA 1K78B 3WU1B 4XLHA 2VQCA 1TT5B 3F3XA 2BXZA 4O5VA 2IGNA 3ONQA 2DT6A 2KZGA 3A01B 1L3LA 3S2WA 1K79A 2F6CA 1BI1A 3LQRA 2HOSA 2K9NA 4OIPF 3DU6A 4B43A 3RQ4A 4CYCA 2IBDA 5FFZA 2P81A 2Q1ZB 2HZTA 4OAZA 3I3LA 4Y7NJ 3LAJA 3KIOA 3HC7A 1HDDC 1T08B 3CO7C 1D3YA 4XRFA 1Y1VJ 2JSCA 1IGNA 2OPTA 4B47A 2L02A 2MSYA 3ZQGA 5F1JA 1H9TA 4HA8A 2F5FA 4XN0A 2JN6A 3WHCA 4DOZA 3FWEA 4ENKA 3G1LA 1D8KA 1LDDA 3AKZA 4RM2A 4OMYA 3VEPA 4MLOA 4M6YA 1R58A 3LSMA 4KIBA 3IL2A 1AOYA 1I5ZA 3R0JA 2H27A 4AC0A 5D8KB 1R1VA 5EGOA 5HDKA 5J40A 3CCRI 1ZGAA 4ZTFA 2Y30A 1N77A 2RC4A 1A04A 1D5YA 5JR3A 2DPDA 2FD5A 5JI6A 3VOEA 4ZYEA 5IPAA 1P4WA 3L7WA 1BOAA 1MKMA 4DBRA 2VKHA 2BVMA 1IDZA 4P5OA 2EWNA 1MMNA 1DU6A 4Q48A 2M2EA 4V19K 4U7DA 1MGTA 2XRLA 3SYTA 3GYHX 1ZREA 2NVUB 3JAMZ 1VQMI 1N78A 4MIMA 3S8PA 2DMPA 2ELHA 3IC7A 4L0ZB 1V55H 5CVVA 2DI3A 2IP2A 3G1MA 2R7DA 5HDGA 3KYLA 1XCVA 1VQ5I 4X0GA 4HQEA 3ESWB 3HRMA 2GIVA 1U5TB 3TO7A 1SD6A 1MMAA 2XUBA 2PQ8A 3L2CA 2Z99A 1K61A 1W7PB 2CFOA 1T98A 2FJ1A 3PFYA 1T95A 5B3SH 2VJ5A 5ICEA 5FO5A 4M3EA 1SEUA 4AUXA 2LP0A 3QAHA 1YJ9I 2CG4A 1DPUA 1IF1A 4HX7A 5JHFA 3IKTA 1FP1D 1LEAA 3WTWC 3R4KA 1IXCA 2EV5A 4A6EA 3P5JA 2QLZA 5L3BA 2R7ZJ 2W57A 4PUSA 1YTYA 3F0CA 2HYGD 1ZYRF 2HTJA 3J7AO 2EFQA 3JTHA 1FPQA 2PMZN 2LMDA 2WY8Q 4UUTA 2M3AA 4AIHA 1IV8A 2H8RA 1BW5A 4OWRB 2K5CA 4IO9F 3Q9SA 4ZDLA 1XSXA 1VQ8I 1OCTC 2X6WA 3BTJA 3ZXSA 4ABZA 1G3TA 5J1RA 1B8IA 4HRIA 5DV5A 6PAXA 4CHUA 5LHIA 3M1EA 4GYGA 3CDIA 5DCMA 4I01A 3J81K 4R79A 3HRUA 4LLNA 3H36A 2RKHA 2WADA 5E8GA 2ADUA 3JRHA 4I98B 4CGZA 2R7QA 4S0HB 4PSXA 1XMKA 5K1YA 1ZK8A 2ECCA 3FBNB 2MLGA 2BXYA 3HZJA 2VPLA 1MD0A 3HEFA 2ZJ2A 1WJBA 2YU3A 2D45A 4A3JJ 3MCZA 5JFRA 1U8BA 3BR5A 4EM1A 2DDBA 3S3OA 3JREA 3CCEI 3QPTA 2W1OA 3NWSA 5LHHA 2DXIA 4BXFA 2XAQA 4FX0A 1IJWC 1RNLA 3I4PA 3KYCB 1JGSA 2R92J 3B6CA 4XICA 1QHHD 3RZOJ 3PIOF 2DYSH 4BKXA 1POGA 2HXIA 4HPQA 3BR0A 3MD2A 1IW7F 2BE5F 1R4MB 4NNJA 3TOBA 5EEAA 4N4NB 2MH2A 2DYRH 2X0LA 3HGGA 1WSUA 1K4SA 3FK7A 2YSRA 1QZEA 3U21A 2I5UA 3FK6A 2L7KA 1SANA 4FHTA 2CMPA 2XGXA 3QU6A 2K4BA 4A3LJ 3QOEA 2KRFA 2HS5A 2D1VA 4EJOA 2J5PA 3T8RA 3M3YJ 3BQZA 4NBQA 1LFBA 2DOEA 3Q0UA 1BN5A 3HOYJ 4QPQA 3FX3A 1YW9A 3PSFA 4BHCA 4YFXF 3H9QA 2GOXB 4M71A 1OKRA 2BYVE 2IA0A 5L3FA 5B5EC 3CMMA 5FKLA 4HQMA 3QPSA 1LPQA 1JUPA 5F0FA 1PP7U 5LEKA 1WVRA 2M0MA 2X4HA 4NC6A 2ECBA 1FYMA 4O6JA 1NH3A 3HGYA 4KN7X 2R5YB 2XAJA 3C18A 3E97A 1QA6A 2HPIA 4RGSA 1PDNC 1YS6A 1UCRA 1O4XA 3OYLA 4RGRA 2JA6J 3FXUA 2CFXA 2STWA 3HYIA 4HX8A 1TWAJ 4KICA 2LKSA 2LC2A 1ETXA 2UZKA 1FEXA 1TNSA 1HSJA 1RC9A 2K86A 3X2QH 2HDDA 1LEBA 2ZXWH 2L2OA 4L9VA 4YIFA 2FMYA 3OYNA 3WTXC 3TL4X 3CO6C 3P9KA 2X6OA 4ENJA 3CLOA 1H8AC 3VYUB 4AD9A 5DM7F 1FLIA 1O3TA 4L5EA 2OF7A 2VB6A 3WTZA 2DFIA 1A35A 2HXOA 1FMWA 1Y6IA 3HKZN 4YFNF 3S17J 5M3MJ 2K9MA 3EDPA 1FTZA 4XQFA 2VASA 1DDNA 2XROA 3OSGA 1R49A 2QUFA 2DA5A 2X1EA 3CCQI 1E17A 3MAJA 4KIFA 3CESA 2XV4S 1IN5A 5JVTA 2WB1N 1IXRC 2VXZA 2F5VA 3LSGA 3ABTA 4NQWB 4A12A 1SD4A 2VBWA 2NNNA 2QBYA 5FGMA 4BL0B 3ZQQA 1HXDA 3GW2A 3I71A 2XASA 3IWFA 5GAEJ 3RQIA 4ENMA 5DM6F 1BW6A 3TEDA 1FZPB 1HKSA 1RUNA 2CYYA 3BZCA 3F72A 4BY7J 2CW0F 1JKQC 2P5LC 3LOCA 3CCVI 1LFUP 2IGKA 3K69A 1FOYA 1T2KA 2DMTA 2YUSA 5FKOA 1RIOH 3MFKA 1X4PA 2WA0A 3QYEA 3K1NA 1Z3XA 4FCYA 3WE2A 2VOPA 3KZZA 5M5YJ 2DA7A 4A3DJ 3CUQB 5LLQA 3H35A 2V9KA 1ZGWA 2X9DA 3D5LA 3GLLA 3OS1A 1FYKA 2DT5A 1I1GA 3GZ5A 1QVTA 2NOGA 4UVCA 4CCLA 4AIJA 1B72A 1H9GA 2FE3A 3HOVJ 3HOUJ 2EFNA 4J19A 2HDCA 5TRDA 1JJ8C 5DEQA 1FSEA 4RAYA 1IZ1A 3V8KA 2GA2A 2HOEA 2JPBA 4RB0A 2BEOA 3JRIA 5ICFA 3L2UA 5BNGA 3LSPA 2EIKH 1Z67A 1WPKA 1EH7A 2W82A 3IKVA 1ZN2A 3IV5A 1RI7A 3BOQA 1VQ6I 1YS7A 1HDPA 1S29A 1F1ZA 1SFKA 2HTSA 3K4NA 4HX4A 4UV9A 3R6SA 4A5MA 3F23A 2EA4A 5TGTA 4S05A 4DZJA 1MNDA 3ZQHA 2BHYA 5M5WJ 3LSKA 2CJJA 3LFKA 2OQRA 2GWRA 3BWGA 2LFBA 1JKPC 2IXSA 1OR7C 1U3EM 3AG3H 5F6FA 5ILUA 4C2MJ 4KISA 3U1KA 4Z6YA 2X51A 3UR3C 4RMNA 2OTLI 2MH9A 1D0XA 4WF2A 3K10A 1XMAA 3VB2A 5EJCA 2ACJA 3DBLB 2DMNA 3DQVC 2Q0OA 1E0EA 1XGOA 2OA4A 1IO2A 4XLEA 2M9HA 1Z9CA 1PUFB 2L0KA 2XKOA 3NAUA 4IZZA 1OR7A 2PMZA 2PJRB 3FXRA 3LA7A 3OYKA 5GPCA 3SZTA 2WAQN 2PX9A 2DDAA 2A3SA 4PCQA 4G7OF 2VJJA 1MBGA 3FISA 1QO0D 4M74A 1QNTA 3DKWA 5FB2A 1XTAA 3VYTB 3F6OA 3FKJA 2LBFA 3CDHA 1IRGA 3LNQA 3JRFA 4I2OA 3ABLH 1YRNB 1VQ4I 3TO6A 4HG2A 2M5WA 3W2AA 2HQRA 2G7UA 2VBYA 4I76A 2MD5A 4FETA 4BEHA 3HOWJ 2KIUA 3ECOA 3W6KB 2FQ3A 2XAUA 3J7YJ 4XSZF 4C3IJ 2VJIA 3A1YA 1I27A 5B1BH 3BJAA 3DPLC 2HDWA 2MGQA 2HVSA 2RNGA 2PMHA 2BZTA 4UXNA 1LE8A 3CMYA 2OCCH 1YIJI 3A01A 4E7ZA 3ABMH 3CUOA 4DBQA 4N9HA 2DO7A 1FTTA 3KZYA 4AIDA 4LMYA 2JJ7A 3EQLF 1WJEA 2A05A 3MZ8A 1LVKA 4HZFA 3C2BA 4PGHA 3V7SA 5DUIA 4JYKA 1ZTRA 3KP4A 4MO7A 4LITA 1U9NA 4I7HA 2HZDA 3TDZC 4HNVA 2OCEA 2HQNA 2E2HJ 1XSVA 3CJRB 1A31A 4I6ZA 3BG3A 4W1UA 3HM5A 5TISC 3BG6A 3H92A 3MWMA 4QIWN 5IYBJ 4HLXA 1O7FA 1OJLA 4RGUA 3DLLF 2DK8A 2CUJA 1TLHB 2K3PA 2AQEA 3BLYA 3TQNA 2R7UA 4KITB 5HDNA 2L7MP 5F1RA 4ESBA 3HOTA 2K7LA 4G7HF 4FE4A 2GA1A 1X1AA 4M9XA 4QWQA 3K6GA 3KZIC 4UUSB 4LK0F 1X3UA 2X6XA 4XBFA 1PYVA 2B63J 3BPVA 4ASNA 1U5TC 4A3KJ 1MMDA 1CGPA 1UFMA 2A6EF 4BHBA 1TTYA 5CVRA 4UV8A 2FF4A 2H6CA 3F22A 1FBUA 1OCCH 2FMLA 4RGXA 4PJ0C 2KDZA 2R5ZB 1NG6A 5K5QA 1U5TA 3DBRB 2EQRA 4U0WA 2M1BA 1YLFA 2KP6A 2ICWG 1MBEA 3BR6A 2IT0A
chains in the Genus database with same CATH topology
4KT5C 3GX4X 5H6RA 2E7WA 2ESHA 4GCVA 4JBAA 5HS7A 1W5SA 4MNUA 4YFKF 4ZZLA 1KGSA 3WU0A 4BH9A 4EVIA 4IF4A 1G3WA 2HKXA 1BBYA 5CVUA 2QZ8A 1GXPA 1B9MA 3FF5A 4A6DA 3EYIA 2P7VB 5KVRA 2HKOA 3OOPA 4JQFA 4N0BA 4UVBA 3FMQA 5ED4A 1I6XA 1STZA 4MQVA 2PFBA 2P6SA 2UXXA 3F8NA 1RZ4A 5J8CA 1WWXA 3R0AA 4IHSA 5LEJA 4EJTA 1ODDA 3ECHA 1R1TA 2R3SA 1ZRCA 3ZN0A 4MQ9F 2GAUA 3ZN1A 1AWCA 1P6RA 3DPTA 2K27A 2NYXA 3DFGA 1YIOA 1GHCA 1W5TA 2Q8KA 3JTGA 2YX4A 1V4RA 1XGNA 1YW8A 5D5UB 3P7NA 1U2WA 1XDUA 5D5VB 1BI0A 4A0YA 5BQTA 3ZMDA 4CDGA 1MDMA 2VOOA 3M8EA 2ZXJA 3KP7A 1BJAA 3HSEA 2UWMA 4A0XA 5FD6A 2CO5A 5HVQC 2JRTA 2MBFA 2A6HF 4P9UA 3TDUC 1S8NA 4I02A 4HYEA 1TBXA 4IXAA 4YG2F 1B9NA 3HRTA 2V1UA 2IRFG 2KJBA 3HRSA 2DAOA 3GWZA 4WXCA 3GXOA 3HHGA 3HHHA 3O2PE 5D4SA 4K2EA 4U0VA 3I59B 5A2QZ 2PJPA 1USSA 3JSPA 3I53A 2XRNA 4NQWA 2V1DA 4AIKA 3DEUA 3J80Z 3GVAA 3GUDA 3ZMZA 4IHTA 2VE8A 2O8XA 2O6GE 3CUQC 3H3ZA 3RIRA 2EV0A 3KLOA 1ZG3A 4G6DA 4RAZA 3KFWX 1REPC 3EUHA 4OIOF 2QWWA 3P9CA 3CUQA 4EJWA 2M8EA 1KQ9A 1DP7P 3JSOA 1CF7B 4LG0B 3ZPLA 4ESFA 3DF8A 1MZBA 4CXFA 4FT8A 3ZMVA 2DPUA 1Z7UA 1FYLA 2CQKA 2H94A 4S04A 1XDSA 3HIFA 2W84A 4Q4ZF 1KYZA 1ZGJA 3LQQA 2IA1A 1UHMA 1QQIA 3E6DA 4DQ2A 3E6CC 1WQ2A 5DYMA 3WTYC 1R00A 4A2UA 2IPQX 1BC8C 4YIIA 5HLGA 4ZZDA 2YX7A 2Y0MA 2EK5A 3ZMTA 2XKPA 2YR2A 1HW1A 1C0WA 1MJ9A 3V7CA 1Z6TA 5L3DA 4PGGA 1FBQA 2L4AA 5E8IA 3C3WA 3H3UA 1J9IA 2K02A 5D6EA 3EETA 4R1HA 5K5OA 3RYPA 1B6AA 4O3MA 4UNOA 5HOOA 2RNJA 1XGSA 2EA2A 5BPIA 3V4GA 4KUMA 5IT9Z 5FD5A 2ZFWA 5FLXZ 1LDJA 2EFWA 2AS5F 1FC3A 3WGHA 5BPDA 3B73A 2NAZA 4Y15A 3B02A 2CWEA 2O3FA 1KQ0A 3CJNA 1R36A 5LBQA 4MTDA 3KP2A 5CVJA 1FT9A 2EJRA 1Z91A 3DP7A 3U1DA 1SFEA 3NEUA 4B09A 4R8HA 4KIGA 2A68F 4AWXB 1B59A 2DLLA 4HV6A 4Y17A 5DD8A 2DQRA 5DCFA 2HGCA 3BPXA 4L18B 1I1SA 3GEZA 2EV6A 3HSRA 2GXGA 2DK5A 1Y0UA 3KP6A 4GGGA 2Y75A 2JT1A 1TW2A 1XCBA 3SQNA 4ETSA 3PFIA 4Y13A 2M87A 3HTSB 4L9TA 1T39A 4F7ZA 3IRQA 3IHUA 3ABUA 5E18F 3RKYA 1F4KA 4Q5SF 1USTA 3E6MA 2RN7A 3KCCA 1IAWA 3GFJA 3RI4A 4U0YA 5LRSA 3N97A 1XB4A 1OYIA 1YFHA 4WCGA 3U2RA 1HKTA 3MZHA 5HS9A 1FBSA 5L3EA 3TGNA 1IN8A 2F5EA 5K5RA 3E3VA 2PG4A 3K0LA 2MA3A 4M6XA 1WRJA 3RDIA 1HW5A 1TQMA 3BY6A 3T0YA 3I64A 4Z2YA 4MEYF 4HF0A 2RQPA 3JAMK 2VC0A 3KE2A 3WG9A 3F8CA 1HKQA 1W7PD 2NRAC 2FNPA 3JW4A 2IVMA 3ZMUA 3C7JA 2AXLA 3J80K 4U88A 5CLSA 4ZH4F 3Q9VA 4I0BA 2RV8A 1K78A 3BROA 1ZRFA 3E6BA 4HOBA 3V7RA 3L09A 3P9IA 1OYYA 3F8BA 5E1WA 3SFZA 3LWFA 4UUVA 2VT2A 1BC7C 4HAMA 3FMRA 3GO5A 5CYVA 1R1UA 3I5UA 4IPAA 2XAFA 2KIFA 3KLNA 4G8XA 3L00A 1K6OA 2IA2A 2FBHA 1TNTA 5JHUA 2HFHA 2A69F 5LRRA 1YW7A 2KKOA 4OU0A 1GXQA 2M30A 5J8FA 1Z6RA 2LDUA 2ZCWA 1J2XA 3ULQB 2XAGA 2K4JA 5KK1A 2E1CA 2QYOA 4RB3C 2V1XA 2ETHA 5H6QA 2VN2A 5CJ9A 4EMSA 2ISZA 3I59A 2XAHA 1MJBA 5ICGA 3FXQA 1ZH5A 2QBYB 1UB9A 1XN7A 3ZP5A 1W7PA 4EGYA 3WE3A 2DBBA 4KMFA 2PBIA 3RYRA 3SZPA 1B4AA 3ZQ7A 1KYWA 1K7AA 2ZBKA 1DUXC 4EGZA 1HBXG 1FSHA 5J6XA 4LJZF 3U9GA 1PP8F 2BGCA 1CF7A 5D6FA 1FX7A 1QGPA 1Z1DA 2KIMA 4LG0A 1O3SA 2EFPA 4M73A 2ZNZA 4FX4A 4PDKA 3I54A 1TQIA 2BBYA 2CGPA 1PUEE 5IT9K 1G4DA 1KU7A 3TO9A 5FLXK 3ZMSA 2FSWA 2RVCA 2LKPA 1O3QA 4A0ZA 2LNBA 3K2ZA 1P4XA 3MZYA 2HEOA 2ZMEB 4UVAA 4EM2A 4EQQA 3T5XA 4LLGF 2FXAA 4OMZA 2ISYA 2OZ6A 5D4RA 2M45A 3R61A 3PQKA 4L9JA 4L0YB 1TQPA 2BV6A 5HLHA 4OOIA 2Q2EA 4ESJA 5ICCA 1S7AA 2F5DA 1JHHA 3F8FA 1HW2A 2P5KA 3QU3A 1BIBA 5D8LB 5AIQA 4H0EA 3RJPA 4L9NA 1E2XA 2VBXA 1FY7A 3KP5A 2A5YB 3G3ZA 4CICA 1L0OC 1SD7A 4BYYA 1ULYA 1QZZA 2P5VA 2COMA 2V79A 2P6TA 2MC3A 1V3FA 5DD4A 4NB5A 4Q47A 3M8FA 3WTSC 4IJAA 1IXSB 1MJAA 3QRFF 4MHGA 3RKXA 3DV8A 2E7XA 4GO1A 3V8JA 2TDXA 3M9AA 4OIRF 4HLYA 1J75A 1P2FA 2PMUA 2QVOA 3C1DA 2WTEA 4BQAA 4G9YA 2WC2A 4I09A 4HF2A 4KDPA 4MGRA 1KQ8A 1IN4A 1R22A 2Z5UA 3VFZA 3BDDA 3IWZA 1J59A 2P8TA 3D0SA 2IW5A 1YO5C 4HW0A 1ZAOA 2PLYA 1EH6A 4G94A 3I0TA 2W85A 4RS8A 1GVJA 1P4AA 2VODA 5BOXA 1R5GA 1T38A 3KEQA 5EEGA 4RB2C 3TOAA 4BHPA 3K1MA 5ERIA 3RPUA 3COAC 4MTEA 2OD5A 3ML6A 3RPQA 2DTRA 2HYFA 3ROUA 3BZ6A 1J5YA 5D5XB 5LGNA 4PZJA 1FOKA 3GF2A 1HSTA 4L5IA 2ZO4A 1BM9A 1WKMA 4B8XA 4WWCA 5BMZA 2FBIA 1D8JA 3FMSA 1D5VA 1SMYF 1ZLJA 4HV5A 1HQCA 4LB6B 2R7FA 3EYYA 2O61A 1KA8A 2Z9OA 2H6BA 1R7JA 4EJUA 2L4MA 1FNNA 1VTNC 2G7HA 2FOKA 3WTUC 3QPHA 1O57A 1BIAA 2QQ9A 3GFLA 3PQJA 1T0FA 4CYDA 2OZUA 5AONA 4WXDA 2QENA 4OIQF 1SAXA 4HDVA 4EM0B 2STTA 2VONA 3HOSA 4IRIA 1O7LA 2OQGA 1W4MA 5TJJA 2D1HA 2A07F 1U6GA 2F2EA 1ZLKA 2B0LA 4M72A 4IRHA 2FNAA 3T8TA 2VT3A 5LGUA 1MDMB 3WODF 3BJ6A 5E1ZB 1NHAA 1SFUA 3I58A 5BS6A 4JK1X 3KP3A 3G73A 3FHZA 4N9IA 2VE9A 3CTAA 3FM5A 2Z3YA 3OV8A 3N4MA 1S3JA 3WTTC 2FU4A 4KNYA 4EJVA 3ISPA 5DUKA 5IT3A 5F64A 3IRRA 2ZKZA 2DW4A 4L5JA 1ZG5A 1LQ1A 1FP2A 4LFUA 1U78A 4CO8A 1IN6A 2JTVA 4I0AA 3VODA 3ELKA 2F5CA 3Q5FA 3LA3A 3WGIA 4M9SA 2LF7A 3LA2A 1S7OA 1ON1A 1H0MA 2XHKA 2LSOA 5D5WB 1BI2A 5LHGA 4OINF 5CVIA 3GFIA 2DU9A 2PI0A 3K9TA 1JXSA 1F9NA 2FA5A 1LB2A 4XLPF 1JHFA 1LNWA 4ENNA 2GZWA 3REOA 3BJOA 2V6CA 2O03A 1EH8A 4HBLA 3SHFA 2RDPA 4A5NA 1DPRA 2MLKA 4ZYDA 1T6SA 1EV7A 3QP6A 3GLXA 2FEZA 2GQQA 3O3KA 2JZYA 5DCMB 4E70A 2XIGA 5E17F 4XLNF 4U7BA 3QP5A 2HWVA 2FRHA 3SXYA 3E5XA 3L9FA 2DQLA 3ERED 2HR3A 2JPCA 2OU2A 1SMTA 4ZYHA 3O6BB 3V8LA 4HDUA 4KYWA 2UXNA 4KFCA 1TW3A 3QOPA 4BNCA 1IRFA 3KETA 5A2QK 1ON2A 4M9ZA 2GXBA 2W24A 2XVCA 4CZZA 1J0RA 3TKYA 5H20A 1BI3A 1ZG1A 2ZMEA 2QM3A 2C6YA 1LJ9A 2ESNA 2QQBA 4XSXF 1F5TA 1YYVA 4UHTA 1ZRDA 2RGVA 3NQOA 1SFXA 1UHWA 5LGTA 4MEXF 3LAPA 4LD5A 5FFXA 4HF1A 5EEHA 4LB5A 2D2WA 1YG2A 1OMIA 5ILVA 5L3GA 2O0YA 1O3RA 3WTVC 4TV7A 4ZYGA 1G3YA 1ZHFA 5ILSA 4WXHA 1P92A 2L54A 4ON0A 2LF8A 1U8RA 3J81Z 1XD7A 1KU9A 1ONVA 3F6VA 4KMUX 1LVAA 4KN4X 5HLIA 2EFOA 2WV0A 1IUYA 2WWYA 1KU2A 4LK1F 3KEOA 4NHJA 1Z05A 3W6JB 1R5HA 4RB1A 3NRVA 1QBJA 4DNCA 3M7GA 3DXJF 1OYWA 4BAYA 1ZARA 3GFMA 3RTRA 2EB7A 2A61A 2G9WA 4WK8F 2Z33A 2V9VA 1J7KA 2VBZA 4P9FA 3LSTA 2L3DA 1LDKB 3FM3A 1OPCA 3HTUA 2ZNYA 3AAFA 4GXOA 4G7ZF 4AVPA 3GZ6A 2PN6A 1G6NA 4KA4A 3E5UA 4QLCU 1G3SA 1XGMA 2FBKA 2W25A 2H09A 3T1BA 4P55A 2Y48A 1S6LA 2L01A 5HS8A 3F8MA 1FWZA 2CSOA 5AIPA 1QPMA 4IVNA 5E20A 1KU3A 2OBPA 1R23A 4P96A 2VC1A 4LLLA 1YQAA 1B1BA 1SD5A 2PEXA 3HSFA 4IRGA 3HUGA 4EV0A 4BXUA 2KJCA 2J5OA 2QQAA 2P7CB 3R60A 3F21A 2NS0A 1JE8A 4D0PA 1WI9A 5E1XA 4WX9A 5DDGA 2P4WA 2YPRA 3MQ0A 4LGWA 1QZYA 3K1PA 3BP8A 3MEXA 1RUOA 2OAZA 5L3CA 4G6QA 3E5QA 4GYIA 1XSDA 3RKWA 3FZVA 2NNYA 1Q1HA 1IN7A 2IJLA 2E1NA 3WGGA 1K78B 3WU1B 3F3XA 4O5VA 1L3LA 3S2WA 1K79A 1BI1A 3LQRA 4OIPF 5FFZA 2HZTA 3LAJA 3CO7C 1D3YA 4XRFA 2JSCA 2L02A 1H9TA 4HA8A 2F5FA 4ENKA 1D8KA 1LDDA 4OMYA 3VEPA 4M6YA 3IL2A 1R58A 4KIBA 1AOYA 1I5ZA 3R0JA 2H27A 5D8KB 1R1VA 5HDKA 1ZGAA 2RC4A 1A04A 5JR3A 2DPDA 5JI6A 3VOEA 4ZYEA 1P4WA 3L7WA 1BOAA 1MKMA 4P5OA 2EWNA 4Q48A 4U7DA 1MGTA 3GYHX 1ZREA 3JAMZ 4L0ZB 2ELHA 3IC7A 5CVVA 2DI3A 2IP2A 5HDGA 2R7DA 1XCVA 4HQEA 3HRMA 2GIVA 1U5TB 3TO7A 1SD6A 2XUBA 2PQ8A 3L2CA 2Z99A 1W7PB 1T98A 5ICEA 5FO5A 3QAHA 2CG4A 1DPUA 1IF1A 4HX7A 3IKTA 1FP1D 1LEAA 3WTWC 3R4KA 1IXCA 2EV5A 4A6EA 2QLZA 5L3BA 2W57A 1YTYA 2HYGD 1ZYRF 2HTJA 3J7AO 2EFQA 3JTHA 1FPQA 4AIHA 3Q9SA 1XSXA 1G3TA 5DV5A 6PAXA 4CHUA 5LHIA 3M1EA 4GYGA 5DCMA 3J81K 4I01A 4R79A 3HRUA 4LLNA 2RKHA 5E8GA 2ADUA 4CGZA 4I98B 1XMKA 5K1YA 2MLGA 1MD0A 2ZJ2A 2YU3A 2D45A 3MCZA 5JFRA 4EM1A 3QPTA 5LHHA 2XAQA 4FX0A 1RNLA 3I4PA 1JGSA 1IW7F 2BE5F 3TOBA 2MH2A 2X0LA 1WSUA 2YSRA 4FHTA 2XGXA 3QU6A 2K4BA 2KRFA 2HS5A 2D1VA 4EJOA 2J5PA 3T8RA 1BN5A 3FX3A 1YW9A 4YFXF 4BHCA 4M71A 1OKRA 2BYVE 2IA0A 5L3FA 4HQMA 1PP7U 5LEKA 2X4HA 1FYMA 4O6JA 4KN7X 2XAJA 3C18A 3E97A 4RGSA 1PDNC 1YS6A 1UCRA 4RGRA 3FXUA 2CFXA 2STWA 3HYIA 4HX8A 4KICA 2UZKA 1TNSA 1HSJA 2K86A 1LEBA 4L9VA 4YIFA 2FMYA 3WTXC 3CO6C 4ENJA 3P9KA 3CLOA 4AD9A 1FLIA 1O3TA 3WTZA 2DFIA 4YFNF 3EDPA 1DDNA 2XROA 2QUFA 1E17A 3MAJA 4KIFA 2XV4S 1IN5A 5JVTA 1IXRC 2VXZA 3ABTA 4A12A 1SD4A 2VBWA 2NNNA 2QBYA 5FGMA 1HXDA 3GW2A 3I71A 2XASA 3IWFA 4ENMA 1FZPB 1HKSA 1RUNA 2CYYA 3F72A 2CW0F 2P5LC 3K69A 1T2KA 1RIOH 3MFKA 3K1NA 3WE2A 2VOPA 3KZZA 3CUQB 5LLQA 3D5LA 1FYKA 2DT5A 1I1GA 3GZ5A 4UVCA 4AIJA 1H9GA 2FE3A 2EFNA 2HDCA 5TRDA 5DEQA 1FSEA 4RAYA 1IZ1A 3V8KA 2GA2A 2HOEA 2JPBA 4RB0A 2BEOA 5ICFA 1EH7A 3IKVA 1ZN2A 1RI7A 3BOQA 1YS7A 1S29A 1F1ZA 2HTSA 3R6SA 4HX4A 4UV9A 4A5MA 3F23A 2EA4A 4S05A 3LFKA 2OQRA 2GWRA 3BWGA 1U3EM 5F6FA 5ILUA 2MH9A 4WF2A 1XMAA 3VB2A 2ACJA 3DQVC 2Q0OA 1XGOA 2OA4A 1Z9CA 2XKOA 1OR7A 3FXRA 3LA7A 3SZTA 2A3SA 4PCQA 4G7OF 1QO0D 4M74A 1QNTA 3DKWA 5FB2A 3F6OA 3CDHA 1IRGA 4I2OA 3TO6A 2M5WA 2HQRA 2G7UA 2VBYA 2MD5A 2KIUA 3ECOA 3W6KB 2FQ3A 4XSZF 1I27A 3BJAA 3DPLC 2PMHA 4UXNA 3CUOA 4N9HA 2DO7A 3KZYA 4LMYA 3EQLF 4HZFA 4PGHA 3V7SA 5DUIA 3KP4A 4I7HA 3TDZC 2HQNA 1XSVA 3H92A 3MWMA 4HLXA 1O7FA 4RGUA 2DK8A 1TLHB 3TQNA 5HDNA 5F1RA 4ESBA 3HOTA 2K7LA 4G7HF 2GA1A 4M9XA 4QWQA 4LK0F 1X3UA 4XBFA 3BPVA 4ASNA 1U5TC 1CGPA 1UFMA 2A6EF 4BHBA 1TTYA 5CVRA 4UV8A 2FF4A 2H6CA 3F22A 1FBUA 2FMLA 4RGXA 5K5QA 1U5TA 4U0WA 2M1BA 1YLFA 3FWEA 2IT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT5 C;  3GX4 X;  5H6R A;  2E7W A;  2ESH A;  4GCV A;  4JBA A;  5HS7 A;  1W5S A;  4MNU A;  4YFK F;  4ZZL A;  1KGS A;  3WU0 A;  4BH9 A;  4EVI A;  4IF4 A;  1G3W A;  2HKX A;  1BBY A;  5CVU A;  2QZ8 A;  1GXP A;  1B9M A;  3FF5 A;  4A6D A;  3EYI A;  2P7V B;  5KVR A;  2HKO A;  3OOP A;  4JQF A;  4N0B A;  4UVB A;  3FMQ A;  5ED4 A;  1I6X A;  1STZ A;  4MQV A;  2PFB A;  2P6S A;  2UXX A;  3F8N A;  1RZ4 A;  5J8C A;  1WWX A;  3R0A A;  4IHS A;  5LEJ A;  4EJT A;  1ODD A;  3ECH A;  1R1T A;  2R3S A;  1ZRC A;  3ZN0 A;  4MQ9 F;  2GAU A;  3ZN1 A;  1AWC A;  1P6R A;  3DPT A;  2K27 A;  2NYX A;  3DFG A;  1YIO A;  1GHC A;  1W5T A;  2Q8K A;  3JTG A;  2YX4 A;  1V4R A;  1XGN A;  1YW8 A;  5D5U B;  3P7N A;  1U2W A;  1XDU A;  5D5V B;  1BI0 A;  4A0Y A;  5BQT A;  3ZMD A;  4CDG A;  1MDM A;  2VOO A;  3M8E A;  2ZXJ A;  3KP7 A;  1BJA A;  3HSE A;  2UWM A;  4A0X A;  5FD6 A;  2CO5 A;  5HVQ C;  2JRT A;  2MBF A;  2A6H F;  4P9U A;  3TDU C;  1S8N A;  4I02 A;  4HYE A;  1TBX A;  4IXA A;  4YG2 F;  1B9N A;  3HRT A;  2V1U A;  2IRF G;  2KJB A;  3HRS A;  2DAO A;  3GWZ A;  4WXC A;  3GXO A;  3HHG A;  3HHH A;  3O2P E;  5D4S A;  4K2E A;  4U0V A;  3I59 B;  5A2Q Z;  2PJP A;  1USS A;  3JSP A;  3I53 A;  2XRN A;  4NQW A;  2V1D A;  4AIK A;  3DEU A;  3J80 Z;  3GVA A;  3GUD A;  3ZMZ A;  4IHT A;  2VE8 A;  2O8X A;  2O6G E;  3CUQ C;  3H3Z A;  3RIR A;  2EV0 A;  3KLO A;  1ZG3 A;  4G6D A;  4RAZ A;  3KFW X;  1REP C;  3EUH A;  4OIO F;  2QWW A;  3P9C A;  3CUQ A;  4EJW A;  2M8E A;  1KQ9 A;  1DP7 P;  3JSO A;  1CF7 B;  4LG0 B;  3ZPL A;  4ESF A;  3DF8 A;  1MZB A;  4CXF A;  4FT8 A;  3ZMV A;  2DPU A;  1Z7U A;  1FYL A;  2CQK A;  2H94 A;  4S04 A;  1XDS A;  3HIF A;  2W84 A;  4Q4Z F;  1KYZ A;  1ZGJ A;  3LQQ A;  2IA1 A;  1UHM A;  1QQI A;  3E6D A;  4DQ2 A;  3E6C C;  1WQ2 A;  5DYM A;  3WTY C;  1R00 A;  4A2U A;  2IPQ X;  1BC8 C;  4YII A;  5HLG A;  4ZZD A;  2YX7 A;  2Y0M A;  2EK5 A;  3ZMT A;  2XKP A;  2YR2 A;  1HW1 A;  1C0W A;  1MJ9 A;  3V7C A;  1Z6T A;  5L3D A;  4PGG A;  1FBQ A;  2L4A A;  5E8I A;  3C3W A;  3H3U A;  1J9I A;  2K02 A;  5D6E A;  3EET A;  4R1H A;  5K5O A;  3RYP A;  1B6A A;  4O3M A;  4UNO A;  5HOO A;  2RNJ A;  1XGS A;  2EA2 A;  5BPI A;  3V4G A;  4KUM A;  5IT9 Z;  5FD5 A;  2ZFW A;  5FLX Z;  1LDJ A;  2EFW A;  2AS5 F;  1FC3 A;  3WGH A;  5BPD A;  3B73 A;  2NAZ A;  4Y15 A;  3B02 A;  2CWE A;  2O3F A;  1KQ0 A;  3CJN A;  1R36 A;  5LBQ A;  4MTD A;  3KP2 A;  5CVJ A;  1FT9 A;  2EJR A;  1Z91 A;  3DP7 A;  3U1D A;  1SFE A;  3NEU A;  4B09 A;  4R8H A;  4KIG A;  2A68 F;  4AWX B;  1B59 A;  2DLL A;  4HV6 A;  4Y17 A;  5DD8 A;  2DQR A;  5DCF A;  2HGC A;  3BPX A;  4L18 B;  1I1S A;  3GEZ A;  2EV6 A;  3HSR A;  2GXG A;  2DK5 A;  1Y0U A;  3KP6 A;  4GGG A;  2Y75 A;  2JT1 A;  1TW2 A;  1XCB A;  3SQN A;  4ETS A;  3PFI A;  4Y13 A;  2M87 A;  3HTS B;  4L9T A;  1T39 A;  4F7Z A;  3IRQ A;  3IHU A;  3ABU A;  5E18 F;  3RKY A;  1F4K A;  4Q5S F;  1UST A;  3E6M A;  2RN7 A;  3KCC A;  1IAW A;  3GFJ A;  3RI4 A;  4U0Y A;  5LRS A;  3N97 A;  1XB4 A;  1OYI A;  1YFH A;  4WCG A;  3U2R A;  1HKT A;  3MZH A;  5HS9 A;  1FBS A;  5L3E A;  3TGN A;  1IN8 A;  2F5E A;  5K5R A;  3E3V A;  2PG4 A;  3K0L A;  2MA3 A;  4M6X A;  1WRJ A;  3RDI A;  1HW5 A;  1TQM A;  3BY6 A;  3T0Y A;  3I64 A;  4Z2Y A;  4MEY F;  4HF0 A;  2RQP A;  3JAM K;  2VC0 A;  3KE2 A;  3WG9 A;  3F8C A;  1HKQ A;  1W7P D;  2NRA C;  2FNP A;  3JW4 A;  2IVM A;  3ZMU A;  3C7J A;  2AXL A;  3J80 K;  4U88 A;  5CLS A;  4ZH4 F;  3Q9V A;  4I0B A;  2RV8 A;  1K78 A;  3BRO A;  1ZRF A;  3E6B A;  4HOB A;  3V7R A;  3L09 A;  3P9I A;  1OYY A;  3F8B A;  5E1W A;  3SFZ A;  3LWF A;  4UUV A;  2VT2 A;  1BC7 C;  4HAM A;  3FMR A;  3GO5 A;  5CYV A;  1R1U A;  3I5U A;  4IPA A;  2XAF A;  2KIF A;  3KLN A;  4G8X A;  3L00 A;  1K6O A;  2IA2 A;  2FBH A;  1TNT A;  5JHU A;  2HFH A;  2A69 F;  5LRR A;  1YW7 A;  2KKO A;  4OU0 A;  1GXQ A;  2M30 A;  5J8F A;  1Z6R A;  2LDU A;  2ZCW A;  1J2X A;  3ULQ B;  2XAG A;  2K4J A;  5KK1 A;  2E1C A;  2QYO A;  4RB3 C;  2V1X A;  2ETH A;  5H6Q A;  2VN2 A;  5CJ9 A;  4EMS A;  2ISZ A;  3I59 A;  2XAH A;  1MJB A;  5ICG A;  3FXQ A;  1ZH5 A;  2QBY B;  1UB9 A;  1XN7 A;  3ZP5 A;  1W7P A;  4EGY A;  3WE3 A;  2DBB A;  4KMF A;  2PBI A;  3RYR A;  3SZP A;  1B4A A;  3ZQ7 A;  1KYW A;  1K7A A;  2ZBK A;  1DUX C;  4EGZ A;  1HBX G;  1FSH A;  5J6X A;  4LJZ F;  3U9G A;  1PP8 F;  2BGC A;  1CF7 A;  5D6F A;  1FX7 A;  1QGP A;  1Z1D A;  2KIM A;  4LG0 A;  1O3S A;  2EFP A;  4M73 A;  2ZNZ A;  4FX4 A;  4PDK A;  3I54 A;  1TQI A;  2BBY A;  2CGP A;  1PUE E;  5IT9 K;  1G4D A;  1KU7 A;  3TO9 A;  5FLX K;  3ZMS A;  2FSW A;  2RVC A;  2LKP A;  1O3Q A;  4A0Z A;  2LNB A;  3K2Z A;  1P4X A;  3MZY A;  2HEO A;  2ZME B;  4UVA A;  4EM2 A;  4EQQ A;  3T5X A;  4LLG F;  2FXA A;  4OMZ A;  2ISY A;  2OZ6 A;  5D4R A;  2M45 A;  3R61 A;  3PQK A;  4L9J A;  4L0Y B;  1TQP A;  2BV6 A;  5HLH A;  4OOI A;  2Q2E A;  4ESJ A;  5ICC A;  1S7A A;  2F5D A;  1JHH A;  3F8F A;  1HW2 A;  2P5K A;  3QU3 A;  1BIB A;  5D8L B;  5AIQ A;  4H0E A;  3RJP A;  4L9N A;  1E2X A;  2VBX A;  1FY7 A;  3KP5 A;  2A5Y B;  3G3Z A;  4CIC A;  1L0O C;  1SD7 A;  4BYY A;  1ULY A;  1QZZ A;  2P5V A;  2COM A;  2V79 A;  2P6T A;  2MC3 A;  1V3F A;  5DD4 A;  4NB5 A;  4Q47 A;  3M8F A;  3WTS C;  4IJA A;  1IXS B;  1MJA A;  3QRF F;  4MHG A;  3RKX A;  3DV8 A;  2E7X A;  4GO1 A;  3V8J A;  2TDX A;  3M9A A;  4OIR F;  4HLY A;  1J75 A;  1P2F A;  2PMU A;  2QVO A;  3C1D A;  2WTE A;  4BQA A;  4G9Y A;  2WC2 A;  4I09 A;  4HF2 A;  4KDP A;  4MGR A;  1KQ8 A;  1IN4 A;  1R22 A;  2Z5U A;  3VFZ A;  3BDD A;  3IWZ A;  1J59 A;  2P8T A;  3D0S A;  2IW5 A;  1YO5 C;  4HW0 A;  1ZAO A;  2PLY A;  1EH6 A;  4G94 A;  3I0T A;  2W85 A;  4RS8 A;  1GVJ A;  1P4A A;  2VOD A;  5BOX A;  1R5G A;  1T38 A;  3KEQ A;  5EEG A;  4RB2 C;  3TOA A;  4BHP A;  3K1M A;  5ERI A;  3RPU A;  3COA C;  4MTE A;  2OD5 A;  3ML6 A;  3RPQ A;  2DTR A;  2HYF A;  3ROU A;  3BZ6 A;  1J5Y A;  5D5X B;  5LGN A;  4PZJ A;  1FOK A;  3GF2 A;  1HST A;  4L5I A;  2ZO4 A;  1BM9 A;  1WKM A;  4B8X A;  4WWC A;  5BMZ A;  2FBI A;  1D8J A;  3FMS A;  1D5V A;  1SMY F;  1ZLJ A;  4HV5 A;  1HQC A;  4LB6 B;  2R7F A;  3EYY A;  2O61 A;  1KA8 A;  2Z9O A;  2H6B A;  1R7J A;  4EJU A;  2L4M A;  1FNN A;  1VTN C;  2G7H A;  2FOK A;  3WTU C;  3QPH A;  1O57 A;  1BIA A;  2QQ9 A;  3GFL A;  3PQJ A;  1T0F A;  4CYD A;  2OZU A;  5AON A;  4WXD A;  2QEN A;  4OIQ F;  1SAX A;  4HDV A;  4EM0 B;  2STT A;  2VON A;  3HOS A;  4IRI A;  1O7L A;  2OQG A;  1W4M A;  5TJJ A;  2D1H A;  2A07 F;  1U6G A;  2F2E A;  1ZLK A;  2B0L A;  4M72 A;  4IRH A;  2FNA A;  3T8T A;  2VT3 A;  5LGU A;  1MDM B;  3WOD F;  3BJ6 A;  5E1Z B;  1NHA A;  1SFU A;  3I58 A;  5BS6 A;  4JK1 X;  3KP3 A;  3G73 A;  3FHZ A;  4N9I A;  2VE9 A;  3CTA A;  3FM5 A;  2Z3Y A;  3OV8 A;  3N4M A;  1S3J A;  3WTT C;  2FU4 A;  4KNY A;  4EJV A;  3ISP A;  5DUK A;  5IT3 A;  5F64 A;  3IRR A;  2ZKZ A;  2DW4 A;  4L5J A;  1ZG5 A;  1LQ1 A;  1FP2 A;  4LFU A;  1U78 A;  4CO8 A;  1IN6 A;  2JTV A;  4I0A A;  3VOD A;  3ELK A;  2F5C A;  3Q5F A;  3LA3 A;  3WGI A;  4M9S A;  2LF7 A;  3LA2 A;  1S7O A;  1ON1 A;  1H0M A;  2XHK A;  2LSO A;  5D5W B;  1BI2 A;  5LHG A;  4OIN F;  5CVI A;  3GFI A;  2DU9 A;  2PI0 A;  3K9T A;  1JXS A;  1F9N A;  2FA5 A;  1LB2 A;  4XLP F;  1JHF A;  1LNW A;  4ENN A;  2GZW A;  3REO A;  3BJO A;  2V6C A;  2O03 A;  1EH8 A;  4HBL A;  3SHF A;  2RDP A;  4A5N A;  1DPR A;  2MLK A;  4ZYD A;  1T6S A;  1EV7 A;  3QP6 A;  3GLX A;  2FEZ A;  2GQQ A;  3O3K A;  2JZY A;  5DCM B;  4E70 A;  2XIG A;  5E17 F;  4XLN F;  4U7B A;  3QP5 A;  2HWV A;  2FRH A;  3SXY A;  3E5X A;  3L9F A;  2DQL A;  3ERE D;  2HR3 A;  2JPC A;  2OU2 A;  1SMT A;  4ZYH A;  3O6B B;  3V8L A;  4HDU A;  4KYW A;  2UXN A;  4KFC A;  1TW3 A;  3QOP A;  4BNC A;  1IRF A;  3KET A;  5A2Q K;  1ON2 A;  4M9Z A;  2GXB A;  2W24 A;  2XVC A;  4CZZ A;  1J0R A;  3TKY A;  5H20 A;  1BI3 A;  1ZG1 A;  2ZME A;  2QM3 A;  2C6Y A;  1LJ9 A;  2ESN A;  2QQB A;  4XSX F;  1F5T A;  1YYV A;  4UHT A;  1ZRD A;  2RGV A;  3NQO A;  1SFX A;  1UHW A;  5LGT A;  4MEX F;  3LAP A;  4LD5 A;  5FFX A;  4HF1 A;  5EEH A;  4LB5 A;  2D2W A;  1YG2 A;  1OMI A;  5ILV A;  5L3G A;  2O0Y A;  1O3R A;  3WTV C;  4TV7 A;  4ZYG A;  1G3Y A;  1ZHF A;  5ILS A;  4WXH A;  1P92 A;  2L54 A;  4ON0 A;  2LF8 A;  1U8R A;  3J81 Z;  1XD7 A;  1KU9 A;  1ONV A;  3F6V A;  4KMU X;  1LVA A;  4KN4 X;  5HLI A;  2EFO A;  2WV0 A;  1IUY A;  2WWY A;  1KU2 A;  4LK1 F;  3KEO A;  4NHJ A;  1Z05 A;  3W6J B;  1R5H A;  4RB1 A;  3NRV A;  1QBJ A;  4DNC A;  3M7G A;  3DXJ F;  1OYW A;  4BAY A;  1ZAR A;  3GFM A;  3RTR A;  2EB7 A;  2A61 A;  2G9W A;  4WK8 F;  2Z33 A;  2V9V A;  1J7K A;  2VBZ A;  4P9F A;  3LST A;  2L3D A;  1LDK B;  3FM3 A;  1OPC A;  3HTU A;  2ZNY A;  3AAF A;  4GXO A;  4G7Z F;  4AVP A;  3GZ6 A;  2PN6 A;  1G6N A;  4KA4 A;  3E5U A;  4QLC U;  1G3S A;  1XGM A;  2FBK A;  2W25 A;  2H09 A;  3T1B A;  4P55 A;  2Y48 A;  1S6L A;  2L01 A;  5HS8 A;  3F8M A;  1FWZ A;  2CSO A;  5AIP A;  1QPM A;  4IVN A;  5E20 A;  1KU3 A;  2OBP A;  1R23 A;  4P96 A;  2VC1 A;  4LLL A;  1YQA A;  1B1B A;  1SD5 A;  2PEX A;  3HSF A;  4IRG A;  3HUG A;  4EV0 A;  4BXU A;  2KJC A;  2J5O A;  2QQA A;  2P7C B;  3R60 A;  3F21 A;  2NS0 A;  1JE8 A;  4D0P A;  1WI9 A;  5E1X A;  4WX9 A;  5DDG A;  2P4W A;  2YPR A;  3MQ0 A;  4LGW A;  1QZY A;  3K1P A;  3BP8 A;  3MEX A;  1RUO A;  2OAZ A;  5L3C A;  4G6Q A;  3E5Q A;  4GYI A;  1XSD A;  3RKW A;  3FZV A;  2NNY A;  1Q1H A;  1IN7 A;  2IJL A;  2E1N A;  3WGG A;  1K78 B;  3WU1 B;  3F3X A;  4O5V A;  1L3L A;  3S2W A;  1K79 A;  1BI1 A;  3LQR A;  4OIP F;  5FFZ A;  2HZT A;  3LAJ A;  3CO7 C;  1D3Y A;  4XRF A;  2JSC A;  2L02 A;  1H9T A;  4HA8 A;  2F5F A;  4ENK A;  1D8K A;  1LDD A;  4OMY A;  3VEP A;  4M6Y A;  3IL2 A;  1R58 A;  4KIB A;  1AOY A;  1I5Z A;  3R0J A;  2H27 A;  5D8K B;  1R1V A;  5HDK A;  1ZGA A;  2RC4 A;  1A04 A;  5JR3 A;  2DPD A;  5JI6 A;  3VOE A;  4ZYE A;  1P4W A;  3L7W A;  1BOA A;  1MKM A;  4P5O A;  2EWN A;  4Q48 A;  4U7D A;  1MGT A;  3GYH X;  1ZRE A;  3JAM Z;  4L0Z B;  2ELH A;  3IC7 A;  5CVV A;  2DI3 A;  2IP2 A;  5HDG A;  2R7D A;  1XCV A;  4HQE A;  3HRM A;  2GIV A;  1U5T B;  3TO7 A;  1SD6 A;  2XUB A;  2PQ8 A;  3L2C A;  2Z99 A;  1W7P B;  1T98 A;  5ICE A;  5FO5 A;  3QAH A;  2CG4 A;  1DPU A;  1IF1 A;  4HX7 A;  3IKT A;  1FP1 D;  1LEA A;  3WTW C;  3R4K A;  1IXC A;  2EV5 A;  4A6E A;  2QLZ A;  5L3B A;  2W57 A;  1YTY A;  2HYG D;  1ZYR F;  2HTJ A;  3J7A O;  2EFQ A;  3JTH A;  1FPQ A;  4AIH A;  3Q9S A;  1XSX A;  1G3T A;  5DV5 A;  6PAX A;  4CHU A;  5LHI A;  3M1E A;  4GYG A;  5DCM A;  3J81 K;  4I01 A;  4R79 A;  3HRU A;  4LLN A;  2RKH A;  5E8G A;  2ADU A;  4CGZ A;  4I98 B;  1XMK A;  5K1Y A;  2MLG A;  1MD0 A;  2ZJ2 A;  2YU3 A;  2D45 A;  3MCZ A;  5JFR A;  4EM1 A;  3QPT A;  5LHH A;  2XAQ A;  4FX0 A;  1RNL A;  3I4P A;  1JGS A;  1IW7 F;  2BE5 F;  3TOB A;  2MH2 A;  2X0L A;  1WSU A;  2YSR A;  4FHT A;  2XGX A;  3QU6 A;  2K4B A;  2KRF A;  2HS5 A;  2D1V A;  4EJO A;  2J5P A;  3T8R A;  1BN5 A;  3FX3 A;  1YW9 A;  4YFX F;  4BHC A;  4M71 A;  1OKR A;  2BYV E;  2IA0 A;  5L3F A;  4HQM A;  1PP7 U;  5LEK A;  2X4H A;  1FYM A;  4O6J A;  4KN7 X;  2XAJ A;  3C18 A;  3E97 A;  4RGS A;  1PDN C;  1YS6 A;  1UCR A;  4RGR A;  3FXU A;  2CFX A;  2STW A;  3HYI A;  4HX8 A;  4KIC A;  2UZK A;  1TNS A;  1HSJ A;  2K86 A;  1LEB A;  4L9V A;  4YIF A;  2FMY A;  3WTX C;  3CO6 C;  4ENJ A;  3P9K A;  3CLO A;  4AD9 A;  1FLI A;  1O3T A;  3WTZ A;  2DFI A;  4YFN F;  3EDP A;  1DDN A;  2XRO A;  2QUF A;  1E17 A;  3MAJ A;  4KIF A;  2XV4 S;  1IN5 A;  5JVT A;  1IXR C;  2VXZ A;  3ABT A;  4A12 A;  1SD4 A;  2VBW A;  2NNN A;  2QBY A;  5FGM A;  1HXD A;  3GW2 A;  3I71 A;  2XAS A;  3IWF A;  4ENM A;  1FZP B;  1HKS A;  1RUN A;  2CYY A;  3F72 A;  2CW0 F;  2P5L C;  3K69 A;  1T2K A;  1RIO H;  3MFK A;  3K1N A;  3WE2 A;  2VOP A;  3KZZ A;  3CUQ B;  5LLQ A;  3D5L A;  1FYK A;  2DT5 A;  1I1G A;  3GZ5 A;  4UVC A;  4AIJ A;  1H9G A;  2FE3 A;  2EFN A;  2HDC A;  5TRD A;  5DEQ A;  1FSE A;  4RAY A;  1IZ1 A;  3V8K A;  2GA2 A;  2HOE A;  2JPB A;  4RB0 A;  2BEO A;  5ICF A;  1EH7 A;  3IKV A;  1ZN2 A;  1RI7 A;  3BOQ A;  1YS7 A;  1S29 A;  1F1Z A;  2HTS A;  3R6S A;  4HX4 A;  4UV9 A;  4A5M A;  3F23 A;  2EA4 A;  4S05 A;  3LFK A;  2OQR A;  2GWR A;  3BWG A;  1U3E M;  5F6F A;  5ILU A;  2MH9 A;  4WF2 A;  1XMA A;  3VB2 A;  2ACJ A;  3DQV C;  2Q0O A;  1XGO A;  2OA4 A;  1Z9C A;  2XKO A;  1OR7 A;  3FXR A;  3LA7 A;  3SZT A;  2A3S A;  4PCQ A;  4G7O F;  1QO0 D;  4M74 A;  1QNT A;  3DKW A;  5FB2 A;  3F6O A;  3CDH A;  1IRG A;  4I2O A;  3TO6 A;  2M5W A;  2HQR A;  2G7U A;  2VBY A;  2MD5 A;  2KIU A;  3ECO A;  3W6K B;  2FQ3 A;  4XSZ F;  1I27 A;  3BJA A;  3DPL C;  2PMH A;  4UXN A;  3CUO A;  4N9H A;  2DO7 A;  3KZY A;  4LMY A;  3EQL F;  4HZF A;  4PGH A;  3V7S A;  5DUI A;  3KP4 A;  4I7H A;  3TDZ C;  2HQN A;  1XSV A;  3H92 A;  3MWM A;  4HLX A;  1O7F A;  4RGU A;  2DK8 A;  1TLH B;  3TQN A;  5HDN A;  5F1R A;  4ESB A;  3HOT A;  2K7L A;  4G7H F;  2GA1 A;  4M9X A;  4QWQ A;  4LK0 F;  1X3U A;  4XBF A;  3BPV A;  4ASN A;  1U5T C;  1CGP A;  1UFM A;  2A6E F;  4BHB A;  1TTY A;  5CVR A;  4UV8 A;  2FF4 A;  2H6C A;  3F22 A;  1FBU A;  2FML A;  4RGX A;  5K5Q A;  1U5T A;  4U0W A;  2M1B A;  1YLF A;  3FWE A;  2IT0 A; 
#chains in the Genus database with same CATH topology
 4KT5 C;  3GX4 X;  5H6R A;  2E7W A;  2ESH A;  1S72 I;  4GCV A;  4Y52 J;  5GAD J;  4JBA A;  5HS7 A;  1W5S A;  2I10 A;  1X58 A;  4MNU A;  2BVL A;  4YFK F;  2VQG A;  4ZZL A;  3HPG A;  1KGS A;  3SDB A;  3WU0 A;  3F9K A;  3HKZ A;  4BH9 A;  1DGW Y;  4EVI A;  2KL4 A;  4IF4 A;  3OIQ A;  4BJ6 C;  5EYR A;  1RET A;  1A6I A;  1G3W A;  4A3I J;  2KHM A;  2HKX A;  1BBY A;  5CVU A;  2GIZ A;  2DA2 A;  2QZ8 A;  1GXP A;  2VI6 A;  1X1B A;  2WB1 A;  5FKK A;  3LFU A;  1B9M A;  3FF5 A;  4A6D A;  3EYI A;  2LRD A;  2P7V B;  5B66 C;  2EIL H;  3ZQC A;  5KVR A;  3DEW A;  1UG0 A;  4IX7 A;  2HKO A;  3OOP A;  2LOO A;  4JQF A;  4N0B A;  4UVB A;  3FMQ A;  3A2K A;  4X1E A;  4PSW A;  3Q0W A;  2EIN H;  5ED4 A;  1I6X A;  1STZ A;  2VPR A;  4MQV A;  4XON A;  2PFB A;  2P6S A;  2VLA A;  1MBH A;  3K4K A;  2F48 A;  2DT7 B;  2UXX A;  2UUZ A;  3F8N A;  1RZ4 A;  1QU3 A;  5J1U A;  5J8C A;  1WWX A;  3R0A A;  3IAS 2;  4IHS A;  5LEJ A;  3IUO A;  4EJT A;  1GUU A;  4ZDO A;  3JRC A;  1ODD A;  3ECH A;  4BY1 J;  3PNY A;  2QSF X;  1R1T A;  2R3S A;  4JOM A;  1TZL A;  3ZN0 A;  1ZRC A;  1VF9 A;  4MQ9 F;  5GP9 A;  2GAU A;  4F3Q A;  3ZN1 A;  4YEL A;  1AWC A;  1P6R A;  4XRS G;  3DPT A;  1K83 J;  2K27 A;  2NYX A;  3DFG A;  1GLN A;  5GTI C;  3GTL J;  1FJL A;  1D1B A;  3MN2 A;  1YIO A;  1GHC A;  1BOB A;  1W5T A;  5C4J J;  3S1M J;  2Q8K A;  4Y4R A;  2YX4 A;  3JTG A;  1LKX A;  3OYH A;  2V9P A;  1V4R A;  5CPR B;  1XGN A;  1PJR A;  3ASO H;  1YW8 A;  5D5U B;  3P7N A;  1U2W A;  1XDU A;  5D5V B;  3SFI A;  1BI0 A;  2XDV A;  2Z1D A;  3HPH A;  4A0Y A;  2WV1 A;  2V26 A;  1XPX A;  5M3F J;  5BQT A;  3OL3 A;  3ZMD A;  4CDG A;  2QQ8 A;  1MDM A;  1R4N B;  2VOO A;  3M8E A;  2XPW A;  2ZXJ A;  3KP7 A;  1BJA A;  2R4G A;  3HSE A;  4IHW A;  2UWM A;  4BUP A;  1JKR C;  4H4K C;  2X1C A;  2DA6 A;  3SJM A;  2KRH A;  1W5C C;  4A0X A;  5LFA A;  2R5Y A;  5FD6 A;  2CO5 A;  5F08 A;  3ZQF A;  3N05 A;  5HVQ C;  2JRT A;  2MBF A;  2A6H F;  4P9U A;  2E1M B;  3TDU C;  3GTQ J;  1ITY A;  2E5Z A;  1S8N A;  2Z16 A;  4I02 A;  2KMU A;  2WAQ A;  2Y9Z A;  1QVU A;  4HYE A;  3TP0 A;  1TBX A;  4IXA A;  4YG2 F;  3S1N J;  3VYS B;  5B1A H;  3BCB A;  4J00 A;  5M5X J;  3S3M A;  1B9N A;  3HRT A;  5F27 A;  3LSJ A;  5E3O A;  2YU9 J;  2V1U A;  1N75 A;  1OLT A;  1BJZ A;  2KJB A;  2IRF G;  3HRS A;  2DAO A;  3GWZ A;  1TWC J;  4WXC A;  3BCA A;  1BR4 A;  3GXO A;  3HHG A;  3QWL A;  4CCM A;  3MVP A;  3HHH A;  3O2P E;  3FIW A;  3DKX A;  5D4S A;  4C9Y A;  1JTY A;  4K2E A;  3S14 J;  4JX5 A;  4C2T A;  2N8G A;  2CUZ A;  1T56 A;  5IP7 J;  3H3V K;  4U0V A;  3I59 B;  4XKV A;  5A2Q Z;  3HJE A;  2Y2Z A;  3H0G J;  2PJP A;  2MG4 A;  1ZQ3 P;  1USS A;  3JSP A;  2TRT A;  1T8I A;  1WH5 A;  3I53 A;  2XRN A;  3CC7 I;  1F36 A;  3BG9 A;  4NQW A;  3ZR8 X;  2V1D A;  3DEU A;  3J80 Z;  4AIK A;  3VPR A;  4ANJ A;  4M6V A;  3GVA A;  3GUD A;  2CUE A;  3M4O J;  1IC8 A;  1AA7 A;  1F43 A;  2H1L A;  1UG2 A;  4ZTJ A;  2HPM A;  3ZMZ A;  4C30 A;  3OYB A;  4IHT A;  3TP3 A;  3EUH C;  1IG7 A;  2VE8 A;  2O8X A;  5K7H A;  2IEK A;  2O6G E;  3BTC A;  3CUQ C;  1PVE A;  1OCP A;  3H3Z A;  2MFZ A;  1MW7 A;  2BY1 A;  3RIR A;  2ELK A;  3JRG A;  2EV0 A;  3K7A J;  3KLO A;  1ZG3 A;  1S7E A;  4G6D A;  4RAZ A;  3LMM A;  4Y33 A;  2AQF A;  3KFW X;  1P7J A;  2CQN A;  2L5Q A;  1REP C;  3EUH A;  3SEZ A;  4OIO F;  2VXD A;  4C3H J;  2QWW A;  2L7Z A;  3P9C A;  3CUQ A;  3RZD J;  4EJW A;  2M8E A;  3GTG J;  1KQ9 A;  4BE1 A;  1DP7 P;  2M4K A;  3CCJ I;  3JSO A;  1CF7 B;  3CCM I;  5EG0 B;  2NXN B;  4LG0 B;  2QA4 I;  4A3G J;  3G6E I;  2HYJ A;  3ZPL A;  4ESF A;  3MKZ A;  5JLW A;  1W0T A;  1X1P A;  4PFP A;  3K4M A;  3GCM A;  1MIJ A;  3OMY A;  1TL8 A;  3GBG A;  3DF8 A;  1MZB A;  4CXF A;  3VWB A;  4FT8 A;  3CCS I;  3I55 I;  3ZMV A;  2DPU A;  1D1C A;  1Z7U A;  1FYL A;  2CQK A;  5FRM A;  2H94 A;  4S04 A;  1XDS A;  4CCO A;  3HIF A;  2W84 A;  3NWT A;  4Q4Z F;  1KYZ A;  2CV2 A;  3DTK A;  1ZGJ A;  1V5E A;  3CC4 I;  2YS9 A;  3LQQ A;  2IA1 A;  1QHG A;  1UHM A;  2W7N A;  1QQI A;  3E6D A;  4DQ2 A;  3E6C C;  1I39 A;  1WQ2 A;  4LOC A;  5DYM A;  2DTZ A;  3WTY C;  1R00 A;  1OCO H;  4A2U A;  1JGG A;  2IPQ X;  1BC8 C;  3MKW B;  2HOA A;  2ME6 A;  4YII A;  3CCL I;  2D5V A;  3S1R J;  2JUG A;  2Y69 H;  3OYG A;  4DZP A;  1VQL I;  3CQZ J;  1RRJ A;  4Y3O A;  3BR3 A;  5HLG A;  2PJR A;  4LIU A;  2JMW A;  4CUG A;  4ZZD A;  2K40 A;  2YX7 A;  2Y0M A;  2EK5 A;  2KIQ A;  3AL0 B;  2Q2E B;  3ZMT A;  3DCF A;  2XKP A;  2YR2 A;  2ZJQ F;  2JQ7 A;  3FBI B;  4BJT A;  4CZC A;  1ETK A;  2JA8 J;  1HW1 A;  3A0B C;  1YRN A;  4HSR A;  3ZCO A;  3KEY A;  1C0W A;  1BA5 A;  2EZH A;  1MJ9 A;  1D0Y A;  4XLF A;  3V7C A;  1Z6T A;  2DJN A;  5IYC J;  1ETO A;  4E7I A;  2KZV A;  2RQQ A;  1TT0 A;  4PGG A;  5L3D A;  4II3 A;  2JVH A;  4RM3 A;  1FBQ A;  3JRA A;  2L4A A;  5E8I A;  3C3W A;  3H3U A;  1J9I A;  2K02 A;  5HNH A;  5D6E A;  2LRE A;  3CC2 I;  5FJ8 J;  3EET A;  4R1H A;  5K5O A;  4CYC B;  2ZJP F;  3ZGK A;  3RYP A;  1B6A A;  2H8W A;  3H0D A;  1WJC A;  1K6Y A;  2LKX A;  3IP4 B;  4O3M A;  4UNO A;  5HOO A;  2RNJ A;  3RKQ A;  1GDT A;  1XGS A;  2E5N A;  2EA2 A;  2L7F P;  5BPI A;  1OCZ H;  3V4G A;  2JWT A;  4KUM A;  5IT9 Z;  4IEJ A;  3PUF A;  2FQ4 A;  5FD5 A;  2ZFW A;  4XOP A;  5FLX Z;  4LG3 A;  2HI3 A;  1LDJ A;  2EFW A;  3VSK A;  2AS5 F;  1FC3 A;  3WGH A;  5BPD A;  3B73 A;  3H5A A;  2NAZ A;  1SVL A;  3IH4 A;  2M0C A;  4Y15 A;  3CCU I;  3B02 A;  5EGO B;  2R0Q C;  4GDF A;  4KJZ A;  2DN0 A;  3PJR A;  2CWE A;  2O3F A;  1KQ0 A;  2O7O A;  3CJN A;  1R36 A;  5LBQ A;  4MTD A;  4CA0 A;  1AKH B;  3SDG A;  3OSF A;  3KP2 A;  5CVJ A;  4DYQ A;  1FT9 A;  3UNG C;  1OIS A;  2EJR A;  1VQ9 I;  1Z91 A;  2NVT J;  3DP7 A;  2RAE A;  4EEF G;  3U1D A;  1SFE A;  2V4J C;  3NEU A;  4B09 A;  4HST A;  4R8H A;  4KIG A;  2A68 F;  5JVG F;  2ZFU A;  2CRG A;  2BW3 B;  4BGD A;  4AWX B;  4F93 B;  1B59 A;  2DLL A;  1Y56 A;  4HV6 A;  4Y17 A;  5DD8 A;  1ZR2 A;  3DTE A;  2DQR A;  5DCF A;  2HGC A;  3BPX A;  4L18 B;  2R5Z A;  1I1S A;  1Z3Y A;  2EV6 A;  3GEZ A;  1P9Q C;  2A6T A;  2GXG A;  3HSR A;  5E3M A;  1HLV A;  2DK5 A;  4BU2 A;  1Y0U A;  2HU9 A;  3KP6 A;  4GGG A;  2Y75 A;  1MBK A;  1WGX A;  2JT1 A;  3K70 D;  1TW2 A;  4RA2 A;  1XCB A;  2AHQ A;  2LLK A;  1UJ8 A;  3SQN A;  4E7J A;  4XOR A;  2ME0 A;  4ETS A;  3PFI A;  4Y13 A;  2M87 A;  3HTS B;  4L9T A;  4XN3 A;  2K9Q A;  1T39 A;  3ZQL A;  3PNV A;  4F7Z A;  3IRQ A;  4XRS A;  2EBI A;  3IHU A;  2KRC A;  4UY8 I;  1SFO J;  5HOD A;  2VQL A;  4GFB A;  3ABU A;  5CQG A;  2NVQ J;  5E18 F;  3RKY A;  1F4K A;  4Q5S F;  2WY7 Q;  3RSN A;  1UST A;  3E6M A;  5GTH C;  3L1P A;  2RN7 A;  3KCC A;  1IAW A;  3GFJ A;  3RI4 A;  2ID6 A;  4U0Y A;  5LRS A;  3N97 A;  3A02 A;  1XB4 A;  1OYI A;  1V5G A;  3DWL E;  3I9V 2;  1VQ7 I;  2JA5 J;  1YFH A;  4AM3 A;  3OS0 A;  4WCG A;  3U2R A;  4E7H A;  1HKT A;  3MZH A;  2O8K A;  1DU0 A;  2E71 A;  5HS9 A;  1CQT A;  1FBS A;  4HEA 2;  5EZH A;  3DBH B;  5L3E A;  3L2W A;  3TGN A;  2QEX I;  2LY1 A;  1IN8 A;  2E34 A;  2F5E A;  4AU7 A;  4HNU A;  5C3E J;  3TBI A;  1Z21 A;  5K5R A;  3E3V A;  2PG4 A;  3A4C A;  3QQA A;  3G4S I;  1XMX A;  1Z0X A;  3K0L A;  3ZRG A;  1Z7L A;  2V7F A;  2MA3 A;  4M6X A;  1MMG A;  2E36 A;  1WRJ A;  3RDI A;  1HW5 A;  1TQM A;  1RKT A;  4XLC A;  4BQQ A;  3BY6 A;  3T0Y A;  1NG7 A;  5H2F C;  4YIR X;  3I64 A;  4Z2Y A;  4MEY F;  2EZK A;  1Y0N A;  4HF0 A;  2RQP A;  3MKY B;  2ELJ A;  3JAM K;  2XF6 A;  4JX4 A;  1EF4 A;  2VC0 A;  1YX5 A;  3KE2 A;  3NAR A;  3WG9 A;  4G6T B;  3F8C A;  1HKQ A;  2ID3 A;  3OYJ A;  1G2H A;  2DFF A;  1W7P D;  3OYE A;  2EIJ H;  2NRA C;  2BY3 A;  2FNP A;  3JW4 A;  2IVM A;  3ZMU A;  3C7J A;  2AXL A;  3CP8 A;  1MSF C;  1VQN I;  3J80 K;  3K70 C;  4U88 A;  5CLS A;  4UB8 C;  4ZH4 F;  1R6R A;  2LY9 A;  3Q9V A;  4I0B A;  2RV8 A;  1K78 A;  3BRO A;  1ZRF A;  5E79 C;  1IRX A;  5EZG A;  1JT0 A;  3OYF A;  1ETV A;  3E6B A;  4HOB A;  3S32 A;  3V7R A;  2XGE A;  3L09 A;  3HOX J;  4D5C A;  4B3X A;  3P9I A;  1OYY A;  3F8B A;  2XB0 X;  3I56 I;  5E1W A;  1ACI A;  3SFZ A;  3S3N A;  2L9V A;  3LWF A;  5IYD J;  2E1M C;  4UUV A;  4PJJ A;  1FOX A;  4IHV A;  4BQN A;  2VT2 A;  2CW7 A;  1BC7 C;  4HAM A;  3FMR A;  3GO5 A;  5CYV A;  3GTM J;  1R1U A;  3I5U A;  4IPA A;  2XAF A;  1FIA A;  5CQE A;  2KIF A;  3KLN A;  1GV2 A;  3DTI A;  3L00 A;  4G8X A;  4V2G A;  1K6O A;  1JTX A;  1WFX A;  2IA2 A;  2XF5 A;  2FBH A;  4NUB A;  3QPL A;  5FKN A;  4F55 A;  2QSG X;  1UEL B;  1I3Q J;  2OTJ I;  1TNT A;  2L9S A;  5JHU A;  3D5R C;  1LFP A;  2HFH A;  2A69 F;  1G59 A;  5LRR A;  2CV0 A;  4XID A;  1TWH J;  1YW7 A;  2UV1 A;  4JX6 A;  1WJD A;  2KKO A;  4OU0 A;  2K3F A;  1GXQ A;  2M30 A;  3SZG A;  4DJA A;  3A0H C;  4D7N A;  3CDL A;  2KDO A;  5J8F A;  1Z6R A;  2LDU A;  2ZCW A;  1J2X A;  3ULQ B;  2XAG A;  2K4J A;  5KK1 A;  1XX5 A;  2IS4 A;  2E1C A;  1QRY A;  2QYO A;  3A03 A;  4OAY A;  3HL2 A;  4QTR A;  1ETW A;  1TWG J;  2Y31 A;  2VKE A;  2V1X A;  4XK4 A;  4RB3 C;  2TCT A;  5KHD A;  2ETH A;  5H6Q A;  3V42 A;  2VN2 A;  5CJ9 A;  4EMS A;  2ISZ A;  1EJ9 A;  3I59 A;  2XAH A;  4XKC A;  4C2U A;  1MJB A;  1JUS A;  5ICG A;  3H5R A;  3RCO A;  3FXQ A;  3B6A A;  4B48 A;  5GPA A;  1ZH5 A;  2QBY B;  4ZJZ A;  1JI8 A;  4DYR A;  1UB9 A;  2QKM B;  2Y0S A;  2IGO A;  2MYS A;  3K2A A;  1XN7 A;  1MBJ A;  3ZP5 A;  2MC4 A;  4CCN A;  1E3P A;  3CF2 A;  1W7P A;  2JK3 A;  4EGY A;  3WE3 A;  4IOC F;  2DBB A;  2DA1 A;  1ZR4 A;  5J3L A;  1E3H A;  3S2H J;  4A3C J;  4KMF A;  3J7Z I;  2PBI A;  3RYR A;  3TW7 A;  2F4O B;  3SZP A;  4BDY A;  1B4A A;  3ZQ7 A;  1VQK I;  1YJN I;  2IS6 A;  1KYW A;  4D9J A;  1K7A A;  4FIS A;  1RES A;  4E7S A;  2BOL A;  2ZBK A;  1DUX C;  4EGZ A;  1A6Q A;  1HBX G;  1FSH A;  1Y8Q B;  5J6X A;  1XC5 A;  4LJZ F;  1B72 B;  1U9O A;  3U9G A;  1DGR M;  1PP8 F;  2BGC A;  3HDD A;  3SEQ A;  1CF7 A;  4YEJ A;  5D6F A;  1FX7 A;  1QGP A;  1Z1D A;  2KIM A;  4LG0 A;  2KT0 A;  1APL C;  1O3S A;  1HC8 A;  3H9G A;  2DMQ A;  2EFP A;  1VND A;  2W00 A;  2AXT C;  3EUA A;  1VZ0 A;  4M73 A;  1WJF A;  2ZNZ A;  4FX4 A;  1KZH A;  1X2M A;  1ORK A;  4PDK A;  3I54 A;  1TQI A;  2BBY A;  2CGP A;  2B7E A;  1PUE E;  2DCE A;  3BR1 A;  3W3C A;  4UB6 C;  2BY2 A;  3DLA A;  3OYD A;  5IT9 K;  1G4D A;  1E3O C;  1KU7 A;  3TO9 A;  5FLX K;  3ZMS A;  2FSW A;  1HCR A;  1BL0 A;  1MH4 A;  4E6K G;  2RVC A;  2LKP A;  1O3Q A;  4A0Z A;  5K7F A;  3D5S C;  1X4O A;  2LNB A;  1W36 D;  2X48 A;  2ZXH A;  2NS8 A;  3K2Z A;  1P4X A;  3MZY A;  4IL6 C;  2HEO A;  2X1D A;  3S2D J;  3WU2 C;  2GOM A;  3K4J A;  3MMY B;  2ZME B;  4UVA A;  1XS9 A;  1ETY A;  4EM2 A;  3EUK L;  4EQQ A;  3T5X A;  4LLG F;  2FXA A;  4OMZ A;  1YIT I;  2ISY A;  1X1C A;  2OZ6 A;  4CCJ A;  5D4R A;  2M45 A;  3R61 A;  2QKL B;  1VI0 A;  3PQK A;  4L9J A;  1MH3 A;  4L0Y B;  4RLQ A;  1TQP A;  2BV6 A;  5HLH A;  4OOI A;  4FQG A;  2Q2E A;  4ESJ A;  5ICC A;  3LSH A;  1S7A A;  2KIS A;  2F5D A;  3OYM A;  4DYC A;  1JHH A;  1AHD P;  3F8F A;  1HW2 A;  2P5K A;  3QU3 A;  1BIB A;  1XG1 A;  2DMU A;  5D8L B;  1RR7 A;  5AIQ A;  2LK2 A;  2ZC2 A;  3RPU D;  2R7X A;  4H0E A;  1LUJ B;  2NS7 A;  3H5N A;  4L9N A;  1E2X A;  2VBX A;  3RJP A;  5E3L A;  4YRV A;  1X19 A;  1FY7 A;  3PSI A;  3L2V A;  5FKM A;  5J47 A;  3KP5 A;  1LE8 B;  3CZ6 A;  2A5Y B;  4XL9 A;  3G3Z A;  2K9L A;  1VFC A;  4CIC A;  4E7K A;  2GXA A;  1L0O C;  1SD7 A;  1GT0 C;  1NTC A;  2LG4 A;  4BYY A;  3OS2 A;  3TW6 A;  1A36 A;  1ULY A;  3QYF A;  3O8H A;  1QZZ A;  2P5V A;  1NK3 P;  2GM4 A;  2COM A;  3M07 A;  2V79 A;  2XB5 A;  2P6T A;  3PUB A;  2MC3 A;  1V3F A;  5DD4 A;  4NB5 A;  4XRM A;  2Z2S B;  2DFH A;  3S15 J;  4Q47 A;  1OCR H;  4BXX J;  2F4I A;  3M8F A;  3WTS C;  4IJA A;  1IXS B;  1MJA A;  3QRF F;  1WJA A;  4MHG A;  1YE9 A;  3DV8 A;  3RKX A;  4RAG A;  3FXL A;  2ZXI A;  2E7X A;  4GO1 A;  3V8J A;  3OYI A;  2R7R A;  1W36 C;  2TDX A;  2CV1 A;  3M9A A;  4OIR F;  3OR1 C;  1UHS A;  4HLY A;  3FXK A;  1P2F A;  1J75 A;  1WZ2 A;  2PMU A;  5F0H A;  4V2F A;  3JRD A;  2QVO A;  4PJL A;  3C1D A;  2WTE A;  4BQA A;  1HA8 A;  4G9Y A;  2WC2 A;  4I09 A;  3KPH A;  4HF2 A;  1FOW A;  1UAA A;  1R5I D;  4KDP A;  2XSD C;  4MGR A;  2FX0 A;  4KT6 A;  1KQ8 A;  3K4B A;  1IN4 A;  1AKH A;  1R22 A;  4I99 C;  2L9N A;  2Z5U A;  3VFZ A;  3BDD A;  3IWZ A;  1J59 A;  2P8T A;  1RPW A;  3D0S A;  5CKT A;  2O5R A;  2E60 A;  2ZSI B;  3C2G A;  2IW5 A;  1AU7 A;  1YO5 C;  4HW0 A;  4F52 A;  2VJ4 A;  2BW3 A;  1ZAO A;  2GLO A;  2PLY A;  1EH6 A;  2DA4 A;  4CH7 A;  2OUM A;  3S1Q J;  5JLX A;  2ZB9 A;  1BR2 A;  4G94 A;  3I0T A;  2W85 A;  4RS8 A;  1WH7 A;  1GVJ A;  1P4A A;  2VOD A;  5BOX A;  3W2W A;  1ERD A;  4ZDP A;  1ETQ A;  1R5G A;  1I3A A;  1T38 A;  3GTJ J;  3KEQ A;  4G12 A;  1I6H J;  4DGW B;  2AO9 A;  5EEG A;  4NC7 A;  3CF5 F;  4RB2 C;  3TOA A;  4BHP A;  3K1M A;  5ERI A;  3RPU A;  1R71 A;  1VQO I;  2HNH A;  4AYB N;  2B9S A;  4XM3 A;  3COA C;  1TWF J;  5KAI C;  3CLQ A;  2OD5 A;  4MTE A;  3ML6 A;  1JT6 A;  3RPQ A;  2DTR A;  2HYF A;  3ROU A;  3BZ6 A;  1JUM A;  1J5Y A;  4DIQ A;  3ZQI A;  5D5X B;  5LGN A;  2EZL A;  4PZJ A;  1N25 A;  1SVO A;  1FOK A;  2LR8 A;  3GF2 A;  3I4M J;  1TP4 A;  1HST A;  4L5I A;  4M3F A;  2ZO4 A;  1JJ6 C;  1NK2 P;  3HUG B;  1ZKG A;  1BM9 A;  1WKM A;  1GV5 A;  5FRO A;  3VYR B;  4B8X A;  4D1Q A;  2NOJ B;  4BAC A;  4WWC A;  5BMZ A;  2FBI A;  1D8J A;  3BTI A;  3FMS A;  4BBR J;  1D5V A;  1IV6 A;  1SMY F;  1ZLJ A;  2DOF A;  4HV5 A;  1HQC A;  2OC6 A;  4LB6 B;  2R7F A;  3EYY A;  2O61 A;  1KA8 A;  1RKW A;  2Z9O A;  1T0F C;  2W48 A;  3OY9 A;  2H6B A;  2E2J J;  1R7J A;  2XGD A;  1IDY A;  4EJU A;  4FAS D;  2L4M A;  1FNN A;  5IY5 H;  1VTN C;  2G7H A;  2L9R A;  2FOK A;  3WTU C;  3QPH A;  2E2I J;  1O57 A;  1BIA A;  2A5W A;  2QQ9 A;  3GFL A;  2I8D A;  5K7Z A;  2CUF A;  1IUF A;  2DOD A;  2KQR A;  3AG2 H;  3LSI A;  1PUF A;  2M4G A;  3PQJ A;  3AG4 H;  1T0F A;  4FTH A;  2ZJR F;  4CYD A;  1VQP I;  3PM1 A;  2OZU A;  3HXL A;  4LIV A;  5AON A;  3BTL A;  4WXD A;  3WHB A;  2G0E A;  3CP2 A;  2QEN A;  4OIQ F;  1SAX A;  4CSW A;  4HDV A;  4EM0 B;  2STT A;  3LSR A;  2VON A;  2RRE A;  3HOS A;  1GVD A;  4IRI A;  1WHU A;  1O7L A;  2OQG A;  1W4M A;  5TJJ A;  2D1H A;  1OFC X;  2A07 F;  3GTO J;  1T33 A;  1U6G A;  1FMV A;  5DTD A;  2IS1 A;  2F2E A;  1ZLK A;  4B3A A;  2O9L A;  2M34 A;  3DPU A;  2R7V A;  2B0L A;  2W4S A;  4M72 A;  3Q0V A;  4IRH A;  3PO2 J;  2FNA A;  3T8T A;  4XKW A;  5C44 J;  1D1A A;  2VT3 A;  3IAM 2;  3FXM A;  5LGU A;  3IH3 A;  3BC8 A;  1MDM B;  4BBS J;  3WOD F;  3BJ6 A;  5E1Z B;  2KLO A;  1NHA A;  2K9S A;  1SFU A;  3I58 A;  5BS6 A;  4JK1 X;  3KP3 A;  3G73 A;  2Y0S N;  4XMY A;  3FHZ A;  4N9I A;  2VE9 A;  1V54 H;  3CTA A;  3FM5 A;  1HF0 A;  2Z3Y A;  1FIP A;  3OV8 A;  1P7I A;  3N4M A;  1SC7 A;  3AFH A;  2DJI A;  1S3J A;  5IOY A;  4RDU A;  3WTT C;  2FU4 A;  2M7B A;  4XR6 A;  3W2V A;  4A3F J;  5J4Y A;  1Y8R B;  4KNY A;  3H9J A;  4EJV A;  3JR9 A;  3E0J B;  3ISP A;  4RAF A;  1UMQ A;  5DUK A;  5IT3 A;  5F64 A;  3IRR A;  2ZKZ A;  4IKF A;  2DW4 A;  4L5J A;  1ZG5 A;  4BQO A;  2JSP A;  2DOA A;  4QPO A;  1LQ1 A;  1FP2 A;  2F4M B;  4LFU A;  1U78 A;  3ZOB A;  4CO8 A;  1IN6 A;  2FUG 2;  3QOD A;  2JTV A;  4I0A A;  3VOD A;  3ELK A;  2HVQ A;  2F5C A;  3S93 A;  4XKB A;  3CME I;  2Y9Y A;  4UUS A;  2FOW A;  2DA3 A;  3HBL A;  3Q5F A;  3CJQ B;  1YOV B;  2XPV A;  3E1S A;  3FXO A;  3LA3 A;  4MFE A;  4IHX A;  3J7A Y;  3WGI A;  4M9S A;  1DQU A;  2LF7 A;  3LA2 A;  5HLT A;  4A3M J;  1S5L C;  2HVR A;  2DFE A;  1S7O A;  2E35 A;  1ON1 A;  3FXJ A;  1Y39 A;  3BT9 A;  1H0M A;  2XHK A;  2LSO A;  5D5W B;  1BI2 A;  2WAE A;  9ANT A;  2R7T A;  5LHG A;  1H89 C;  2X6Y A;  2OV7 A;  2E19 A;  2VQH A;  3OOU A;  4OIN F;  3D1N I;  2QSH X;  2NVX J;  5CVI A;  3GFI A;  3IH2 A;  2DU9 A;  2V6E A;  4U87 A;  3G2B A;  1W0U A;  2PI0 A;  3K9T A;  1JXS A;  1F9N A;  2FA5 A;  5LD2 C;  1M1E B;  2LH9 A;  1LB2 A;  4XLP F;  4II2 A;  1JHF A;  1LNW A;  4ENN A;  2GZW A;  3REO A;  4PK4 A;  1Z77 A;  3E7L A;  3BJO A;  2V6C A;  2O03 A;  5J4V A;  1BR1 A;  1EH8 A;  4HBL A;  3Q3S A;  3SHF A;  2RDP A;  4A5N A;  1DPR A;  5DS9 A;  2HQ5 A;  1X3W B;  3BR2 A;  2MLK A;  4ZYD A;  3CMA I;  1T6S A;  1W1W E;  2R93 J;  1EV7 A;  1UZC A;  3OYA A;  3QP6 A;  2QCO A;  3KX2 A;  1YJW I;  1OQY A;  1MNE A;  2LD5 A;  2IS2 A;  3GLX A;  2FEZ A;  2GQQ A;  1B8I B;  5FRN A;  3O3K A;  3PO3 J;  2JZY A;  5DCM B;  4E70 A;  3GME A;  2XF7 A;  2XIG A;  5F04 A;  5E17 F;  4XLN F;  4U7B A;  3QP5 A;  4ZC3 A;  4J01 A;  4GRI A;  4QSH A;  2HWV A;  4BE2 A;  3PL8 A;  2FRH A;  5F0C A;  3SXY A;  1QPI A;  3E5X A;  2CW8 A;  2HOT A;  3L9F A;  2DQL A;  2LYC A;  3ERE D;  3G71 I;  1WCM J;  2HR3 A;  2JPC A;  3I4N J;  2OU2 A;  1SMT A;  4ZYH A;  3O6B B;  2WBM A;  3V8L A;  4HDU A;  3MKL A;  3VDX A;  3G1O A;  4KYW A;  2UXN A;  4KFC A;  1TW3 A;  2ZME C;  3QOP A;  5E3N A;  4BNC A;  4M3D A;  4MFD A;  1IRF A;  1YHQ I;  3KET A;  2VKD A;  4AYB A;  5KAF C;  3W6V A;  5A2Q K;  1ON2 A;  4M9Z A;  4BDZ A;  2GXB A;  5FLV A;  2W24 A;  2V1N A;  2XVC A;  4N4O B;  1J0R A;  3VSL A;  3OWT A;  4CZZ A;  4XNF A;  3TKY A;  5H20 A;  1BI3 A;  1ZG1 A;  2KPM A;  2ZME A;  2QM3 A;  3DKY A;  2R7O A;  1LJ9 A;  2ESN A;  2C6Y A;  2IGM A;  2QQB A;  1A5J A;  4XSX F;  4BS9 A;  1F5T A;  1YYV A;  2K85 A;  4UHT A;  5J1Y A;  1ZRD A;  2RGV A;  3NQO A;  1SFX A;  1UHW A;  2LY2 A;  5LGT A;  4MEX F;  4PJN A;  3LAP A;  3BZK A;  4LD5 A;  5FFX A;  4HF1 A;  3C2H A;  2VL8 A;  5EEH A;  4LB5 A;  2D2W A;  1J09 A;  2MD0 A;  4X6A J;  1YG2 A;  1OMI A;  1X3Z B;  4IOA F;  1MNM C;  3AG1 H;  2BHZ A;  3BG5 A;  2BY0 A;  4C3J J;  5ILV A;  1R9T J;  5L3G A;  2O0Y A;  3OR2 C;  4PJM A;  1O3R A;  3ABK H;  3WTV C;  2P0W A;  4PFO A;  3O8G A;  4ITV A;  4A93 J;  4TV7 A;  4ZYG A;  1G3Y A;  2GBY A;  4JP0 A;  1MBF A;  2ZSH B;  4AVZ A;  1ZHF A;  5ILS A;  4WXH A;  2COB A;  3LL7 A;  1P92 A;  4D7M A;  2JA7 J;  2NVY J;  2L54 A;  3BQY A;  1KON A;  4ON0 A;  2LF8 A;  2EIM H;  1U8R A;  1TC3 C;  3J81 Z;  2CH0 A;  1XD7 A;  3OIP A;  3ASN H;  4B44 A;  1KU9 A;  1ONV A;  2EPF A;  3F6V A;  2VUM J;  4P1W A;  4KMU X;  1RR8 C;  1LVA A;  2H1K A;  3L2Q A;  1DP3 A;  3EPZ A;  5GAG J;  4KN4 X;  5HLI A;  2EFO A;  1U0J A;  1EKE A;  1EA3 A;  2WV0 A;  1IUY A;  4CCK A;  2WWY A;  1KU2 A;  4LK1 F;  2CQQ A;  3UKG A;  1YI2 I;  1D0Z A;  4B1R A;  1MSE C;  2JUC A;  2MAB A;  3KEO A;  3KYD B;  4NHJ A;  1S9H A;  1Z05 A;  3W6J B;  1R5H A;  4RB1 A;  1IRZ A;  3NRV A;  2MW8 A;  2LTP A;  1QBJ A;  4DNC A;  3M7G A;  3DXJ F;  1OYW A;  4BAY A;  4EAT A;  1ZAR A;  3GFM A;  3RTR A;  1MMS A;  4HNT A;  2EB7 A;  3JCU C;  4B4C A;  1ZEL A;  2A61 A;  2G9W A;  4WK8 F;  2Z33 A;  4D5F A;  1K4T A;  4E4H A;  2CU7 A;  3OYC A;  5IOZ A;  3ERM A;  2V9V A;  4ZYA A;  1J7K A;  1WI3 A;  2VBZ A;  4IHY A;  3HB9 A;  4RLF A;  2VKV A;  4P9F A;  3CJT B;  3HG9 A;  1X2N A;  3LST A;  2L3D A;  5HNF A;  2VIX A;  1LDK B;  3HOZ J;  3FM3 A;  3WG7 H;  1OPC A;  2LVS A;  3HTU A;  2ZNY A;  3CCY A;  3TMO A;  3AAF A;  2XSJ C;  2CQX A;  3GTK J;  4GXO A;  4G7Z F;  4E7L A;  5IP9 J;  4AVP A;  1ENH A;  3GZ6 A;  3OL4 A;  2PN6 A;  1G6N A;  5GAH J;  3PNT A;  4KA4 A;  3E5U A;  4FE7 A;  3PIP F;  2XPU A;  4IQJ A;  3DU5 A;  4QLC U;  4RBO A;  1G3S A;  1XGM A;  2FBK A;  2W25 A;  2H09 A;  3T1B A;  4P55 A;  1H88 C;  1Q1V A;  5KNL A;  3GZN B;  3M1C A;  2Y48 A;  5EDN A;  1S6L A;  2L01 A;  5HS8 A;  4NDL A;  3F8M A;  1FWZ A;  3FKI J;  2CSO A;  5AIP A;  1QPM A;  2QF7 A;  3FHN A;  4IVN A;  5E20 A;  1KU3 A;  5EG0 A;  1G8X A;  3OIO A;  2OBP A;  1R23 A;  1X1D A;  4P96 A;  2VC1 A;  5IP6 A;  2JRM A;  4A69 C;  4LLL A;  1YQA A;  1B1B A;  1SD5 A;  4A3E J;  2WAF A;  3K4L A;  5EF6 A;  2M7A A;  2PEX A;  3HSF A;  4F91 B;  2HQA A;  4DW6 A;  4IRG A;  1V5F A;  1WJ5 A;  1JKO C;  3HUG A;  4NC8 A;  4EV0 A;  4BXU A;  3CD6 I;  4M3G A;  2KJC A;  2J5O A;  4M3B A;  4W97 A;  2JA2 A;  2QQA A;  3S16 J;  2P7C B;  3R60 A;  3JRB A;  3BG7 A;  2EH3 A;  3F21 A;  2X85 A;  4F92 B;  1Y1W J;  2IAI A;  2NS0 A;  1JE8 A;  4D0P A;  2XC7 A;  1WI9 A;  5E1X A;  2M8G X;  4XOT A;  3K4C A;  4WX9 A;  5DDG A;  2P4W A;  1I50 J;  2JVG A;  4A3B J;  1HOM A;  2YPR A;  3H1C A;  3MQ0 A;  4LGW A;  3M8J A;  2CS3 A;  3AL0 C;  1QZY A;  3K1P A;  3BP8 A;  3MEX A;  4IQ4 A;  5KCM A;  2R7S A;  2E1O A;  1RUO A;  2CQ7 A;  2OAZ A;  2EZI A;  5L3C A;  4BJ5 C;  4G6Q A;  3E5Q A;  2R7W A;  3QYB A;  2LBF B;  4GYI A;  5FLM J;  2OJE D;  3DEE A;  1SVM A;  4BE0 A;  3L2R A;  3FDY A;  2XGC A;  2QGU A;  3GTP J;  1XSD A;  3RKW A;  3FZV A;  2NNY A;  5C4X J;  1YX3 A;  1Q1H A;  1IN7 A;  2KFD A;  1SAU A;  4XLA A;  2IJL A;  4BEH B;  2E1N A;  3WGG A;  1K78 B;  3WU1 B;  4XLH A;  2VQC A;  1TT5 B;  3F3X A;  2BXZ A;  4O5V A;  2IGN A;  3ONQ A;  2DT6 A;  2KZG A;  3A01 B;  1L3L A;  3S2W A;  1K79 A;  2F6C A;  1BI1 A;  3LQR A;  2HOS A;  2K9N A;  4OIP F;  3DU6 A;  4B43 A;  3RQ4 A;  4CYC A;  2IBD A;  5FFZ A;  2P81 A;  2Q1Z B;  2HZT A;  4OAZ A;  3I3L A;  4Y7N J;  3LAJ A;  3KIO A;  3HC7 A;  1HDD C;  1T08 B;  3CO7 C;  1D3Y A;  4XRF A;  1Y1V J;  2JSC A;  1IGN A;  2OPT A;  4B47 A;  2L02 A;  2MSY A;  3ZQG A;  5F1J A;  1H9T A;  4HA8 A;  2F5F A;  4XN0 A;  2JN6 A;  3WHC A;  4DOZ A;  3FWE A;  4ENK A;  3G1L A;  1D8K A;  1LDD A;  3AKZ A;  4RM2 A;  4OMY A;  3VEP A;  4MLO A;  4M6Y A;  1R58 A;  3LSM A;  4KIB A;  3IL2 A;  1AOY A;  1I5Z A;  3R0J A;  2H27 A;  4AC0 A;  5D8K B;  1R1V A;  5EGO A;  5HDK A;  5J40 A;  3CCR I;  1ZGA A;  4ZTF A;  2Y30 A;  1N77 A;  2RC4 A;  1A04 A;  1D5Y A;  5JR3 A;  2DPD A;  2FD5 A;  5JI6 A;  3VOE A;  4ZYE A;  5IPA A;  1P4W A;  3L7W A;  1BOA A;  1MKM A;  4DBR A;  2VKH A;  2BVM A;  1IDZ A;  4P5O A;  2EWN A;  1MMN A;  1DU6 A;  4Q48 A;  2M2E A;  4V19 K;  4U7D A;  1MGT A;  2XRL A;  3SYT A;  3GYH X;  1ZRE A;  2NVU B;  3JAM Z;  1VQM I;  1N78 A;  4MIM A;  3S8P A;  2DMP A;  2ELH A;  3IC7 A;  4L0Z B;  1V55 H;  5CVV A;  2DI3 A;  2IP2 A;  3G1M A;  2R7D A;  5HDG A;  3KYL A;  1XCV A;  1VQ5 I;  4X0G A;  4HQE A;  3ESW B;  3HRM A;  2GIV A;  1U5T B;  3TO7 A;  1SD6 A;  1MMA A;  2XUB A;  2PQ8 A;  3L2C A;  2Z99 A;  1K61 A;  1W7P B;  2CFO A;  1T98 A;  2FJ1 A;  3PFY A;  1T95 A;  5B3S H;  2VJ5 A;  5ICE A;  5FO5 A;  4M3E A;  1SEU A;  4AUX A;  2LP0 A;  3QAH A;  1YJ9 I;  2CG4 A;  1DPU A;  1IF1 A;  4HX7 A;  5JHF A;  3IKT A;  1FP1 D;  1LEA A;  3WTW C;  3R4K A;  1IXC A;  2EV5 A;  4A6E A;  3P5J A;  2QLZ A;  5L3B A;  2R7Z J;  2W57 A;  4PUS A;  1YTY A;  3F0C A;  2HYG D;  1ZYR F;  2HTJ A;  3J7A O;  2EFQ A;  3JTH A;  1FPQ A;  2PMZ N;  2LMD A;  2WY8 Q;  4UUT A;  2M3A A;  4AIH A;  1IV8 A;  2H8R A;  1BW5 A;  4OWR B;  2K5C A;  4IO9 F;  3Q9S A;  4ZDL A;  1XSX A;  1VQ8 I;  1OCT C;  2X6W A;  3BTJ A;  3ZXS A;  4ABZ A;  1G3T A;  5J1R A;  1B8I A;  4HRI A;  5DV5 A;  6PAX A;  4CHU A;  5LHI A;  3M1E A;  4GYG A;  3CDI A;  5DCM A;  4I01 A;  3J81 K;  4R79 A;  3HRU A;  4LLN A;  3H36 A;  2RKH A;  2WAD A;  5E8G A;  2ADU A;  3JRH A;  4I98 B;  4CGZ A;  2R7Q A;  4S0H B;  4PSX A;  1XMK A;  5K1Y A;  1ZK8 A;  2ECC A;  3FBN B;  2MLG A;  2BXY A;  3HZJ A;  2VPL A;  1MD0 A;  3HEF A;  2ZJ2 A;  1WJB A;  2YU3 A;  2D45 A;  4A3J J;  3MCZ A;  5JFR A;  1U8B A;  3BR5 A;  4EM1 A;  2DDB A;  3S3O A;  3JRE A;  3CCE I;  3QPT A;  2W1O A;  3NWS A;  5LHH A;  2DXI A;  4BXF A;  2XAQ A;  4FX0 A;  1IJW C;  1RNL A;  3I4P A;  3KYC B;  1JGS A;  2R92 J;  3B6C A;  4XIC A;  1QHH D;  3RZO J;  3PIO F;  2DYS H;  4BKX A;  1POG A;  2HXI A;  4HPQ A;  3BR0 A;  3MD2 A;  1IW7 F;  2BE5 F;  1R4M B;  4NNJ A;  3TOB A;  5EEA A;  4N4N B;  2MH2 A;  2DYR H;  2X0L A;  3HGG A;  1WSU A;  1K4S A;  3FK7 A;  2YSR A;  1QZE A;  3U21 A;  2I5U A;  3FK6 A;  2L7K A;  1SAN A;  4FHT A;  2CMP A;  2XGX A;  3QU6 A;  2K4B A;  4A3L J;  3QOE A;  2KRF A;  2HS5 A;  2D1V A;  4EJO A;  2J5P A;  3T8R A;  3M3Y J;  3BQZ A;  4NBQ A;  1LFB A;  2DOE A;  3Q0U A;  1BN5 A;  3HOY J;  4QPQ A;  3FX3 A;  1YW9 A;  3PSF A;  4BHC A;  4YFX F;  3H9Q A;  2GOX B;  4M71 A;  1OKR A;  2BYV E;  2IA0 A;  5L3F A;  5B5E C;  3CMM A;  5FKL A;  4HQM A;  3QPS A;  1LPQ A;  1JUP A;  5F0F A;  1PP7 U;  5LEK A;  1WVR A;  2M0M A;  2X4H A;  4NC6 A;  2ECB A;  1FYM A;  4O6J A;  1NH3 A;  3HGY A;  4KN7 X;  2R5Y B;  2XAJ A;  3C18 A;  3E97 A;  1QA6 A;  2HPI A;  4RGS A;  1PDN C;  1YS6 A;  1UCR A;  1O4X A;  3OYL A;  4RGR A;  2JA6 J;  3FXU A;  2CFX A;  2STW A;  3HYI A;  4HX8 A;  1TWA J;  4KIC A;  2LKS A;  2LC2 A;  1ETX A;  2UZK A;  1FEX A;  1TNS A;  1HSJ A;  1RC9 A;  2K86 A;  3X2Q H;  2HDD A;  1LEB A;  2ZXW H;  2L2O A;  4L9V A;  4YIF A;  2FMY A;  3OYN A;  3WTX C;  3TL4 X;  3CO6 C;  3P9K A;  2X6O A;  4ENJ A;  3CLO A;  1H8A C;  3VYU B;  4AD9 A;  5DM7 F;  1FLI A;  1O3T A;  4L5E A;  2OF7 A;  2VB6 A;  3WTZ A;  2DFI A;  1A35 A;  2HXO A;  1FMW A;  1Y6I A;  3HKZ N;  4YFN F;  3S17 J;  5M3M J;  2K9M A;  3EDP A;  1FTZ A;  4XQF A;  2VAS A;  1DDN A;  2XRO A;  3OSG A;  1R49 A;  2QUF A;  2DA5 A;  2X1E A;  3CCQ I;  1E17 A;  3MAJ A;  4KIF A;  3CES A;  2XV4 S;  1IN5 A;  5JVT A;  2WB1 N;  1IXR C;  2VXZ A;  2F5V A;  3LSG A;  3ABT A;  4NQW B;  4A12 A;  1SD4 A;  2VBW A;  2NNN A;  2QBY A;  5FGM A;  4BL0 B;  3ZQQ A;  1HXD A;  3GW2 A;  3I71 A;  2XAS A;  3IWF A;  5GAE J;  3RQI A;  4ENM A;  5DM6 F;  1BW6 A;  3TED A;  1FZP B;  1HKS A;  1RUN A;  2CYY A;  3BZC A;  3F72 A;  4BY7 J;  2CW0 F;  1JKQ C;  2P5L C;  3LOC A;  3CCV I;  1LFU P;  2IGK A;  3K69 A;  1FOY A;  1T2K A;  2DMT A;  2YUS A;  5FKO A;  1RIO H;  3MFK A;  1X4P A;  2WA0 A;  3QYE A;  3K1N A;  1Z3X A;  4FCY A;  3WE2 A;  2VOP A;  3KZZ A;  5M5Y J;  2DA7 A;  4A3D J;  3CUQ B;  5LLQ A;  3H35 A;  2V9K A;  1ZGW A;  2X9D A;  3D5L A;  3GLL A;  3OS1 A;  1FYK A;  2DT5 A;  1I1G A;  3GZ5 A;  1QVT A;  2NOG A;  4UVC A;  4CCL A;  4AIJ A;  1B72 A;  1H9G A;  2FE3 A;  3HOV J;  3HOU J;  2EFN A;  4J19 A;  2HDC A;  5TRD A;  1JJ8 C;  5DEQ A;  1FSE A;  4RAY A;  1IZ1 A;  3V8K A;  2GA2 A;  2HOE A;  2JPB A;  4RB0 A;  2BEO A;  3JRI A;  5ICF A;  3L2U A;  5BNG A;  3LSP A;  2EIK H;  1Z67 A;  1WPK A;  1EH7 A;  2W82 A;  3IKV A;  1ZN2 A;  3IV5 A;  1RI7 A;  3BOQ A;  1VQ6 I;  1YS7 A;  1HDP A;  1S29 A;  1F1Z A;  1SFK A;  2HTS A;  3K4N A;  4HX4 A;  4UV9 A;  3R6S A;  4A5M A;  3F23 A;  2EA4 A;  5TGT A;  4S05 A;  4DZJ A;  1MND A;  3ZQH A;  2BHY A;  5M5W J;  3LSK A;  2CJJ A;  3LFK A;  2OQR A;  2GWR A;  3BWG A;  2LFB A;  1JKP C;  2IXS A;  1OR7 C;  1U3E M;  3AG3 H;  5F6F A;  5ILU A;  4C2M J;  4KIS A;  3U1K A;  4Z6Y A;  2X51 A;  3UR3 C;  4RMN A;  2OTL I;  2MH9 A;  1D0X A;  4WF2 A;  3K10 A;  1XMA A;  3VB2 A;  5EJC A;  2ACJ A;  3DBL B;  2DMN A;  3DQV C;  2Q0O A;  1E0E A;  1XGO A;  2OA4 A;  1IO2 A;  4XLE A;  2M9H A;  1Z9C A;  1PUF B;  2L0K A;  2XKO A;  3NAU A;  4IZZ A;  1OR7 A;  2PMZ A;  2PJR B;  3FXR A;  3LA7 A;  3OYK A;  5GPC A;  3SZT A;  2WAQ N;  2PX9 A;  2DDA A;  2A3S A;  4PCQ A;  4G7O F;  2VJJ A;  1MBG A;  3FIS A;  1QO0 D;  4M74 A;  1QNT A;  3DKW A;  5FB2 A;  1XTA A;  3VYT B;  3F6O A;  3FKJ A;  2LBF A;  3CDH A;  1IRG A;  3LNQ A;  3JRF A;  4I2O A;  3ABL H;  1YRN B;  1VQ4 I;  3TO6 A;  4HG2 A;  2M5W A;  3W2A A;  2HQR A;  2G7U A;  2VBY A;  4I76 A;  2MD5 A;  4FET A;  4BEH A;  3HOW J;  2KIU A;  3ECO A;  3W6K B;  2FQ3 A;  2XAU A;  3J7Y J;  4XSZ F;  4C3I J;  2VJI A;  3A1Y A;  1I27 A;  5B1B H;  3BJA A;  3DPL C;  2HDW A;  2MGQ A;  2HVS A;  2RNG A;  2PMH A;  2BZT A;  4UXN A;  1LE8 A;  3CMY A;  2OCC H;  1YIJ I;  3A01 A;  4E7Z A;  3ABM H;  3CUO A;  4DBQ A;  4N9H A;  2DO7 A;  1FTT A;  3KZY A;  4AID A;  4LMY A;  2JJ7 A;  3EQL F;  1WJE A;  2A05 A;  3MZ8 A;  1LVK A;  4HZF A;  3C2B A;  4PGH A;  3V7S A;  5DUI A;  4JYK A;  1ZTR A;  3KP4 A;  4MO7 A;  4LIT A;  1U9N A;  4I7H A;  2HZD A;  3TDZ C;  4HNV A;  2OCE A;  2HQN A;  2E2H J;  1XSV A;  3CJR B;  1A31 A;  4I6Z A;  3BG3 A;  4W1U A;  3HM5 A;  5TIS C;  3BG6 A;  3H92 A;  3MWM A;  4QIW N;  5IYB J;  4HLX A;  1O7F A;  1OJL A;  4RGU A;  3DLL F;  2DK8 A;  2CUJ A;  1TLH B;  2K3P A;  2AQE A;  3BLY A;  3TQN A;  2R7U A;  4KIT B;  5HDN A;  2L7M P;  5F1R A;  4ESB A;  3HOT A;  2K7L A;  4G7H F;  4FE4 A;  2GA1 A;  1X1A A;  4M9X A;  4QWQ A;  3K6G A;  3KZI C;  4UUS B;  4LK0 F;  1X3U A;  2X6X A;  4XBF A;  1PYV A;  2B63 J;  3BPV A;  4ASN A;  1U5T C;  4A3K J;  1MMD A;  1CGP A;  1UFM A;  2A6E F;  4BHB A;  1TTY A;  5CVR A;  4UV8 A;  2FF4 A;  2H6C A;  3F22 A;  1FBU A;  1OCC H;  2FML A;  4RGX A;  4PJ0 C;  2KDZ A;  2R5Z B;  1NG6 A;  5K5Q A;  1U5T A;  3DBR B;  2EQR A;  4U0W A;  2M1B A;  1YLF A;  2KP6 A;  2ICW G;  1MBE A;  3BR6 A;  2IT0 A; 
#chains in the Genus database with same CATH homology
 4KT5 C;  3GX4 X;  5H6R A;  2E7W A;  2ESH A;  4GCV A;  4JBA A;  5HS7 A;  1W5S A;  4MNU A;  4YFK F;  4ZZL A;  1KGS A;  3WU0 A;  4BH9 A;  4EVI A;  4IF4 A;  1G3W A;  2HKX A;  1BBY A;  5CVU A;  2QZ8 A;  1GXP A;  1B9M A;  3FF5 A;  4A6D A;  3EYI A;  2P7V B;  5KVR A;  2HKO A;  3OOP A;  4JQF A;  4N0B A;  4UVB A;  3FMQ A;  5ED4 A;  1I6X A;  1STZ A;  4MQV A;  2PFB A;  2P6S A;  2UXX A;  3F8N A;  1RZ4 A;  5J8C A;  1WWX A;  3R0A A;  4IHS A;  5LEJ A;  4EJT A;  1ODD A;  3ECH A;  1R1T A;  2R3S A;  1ZRC A;  3ZN0 A;  4MQ9 F;  2GAU A;  3ZN1 A;  1AWC A;  1P6R A;  3DPT A;  2K27 A;  2NYX A;  3DFG A;  1YIO A;  1GHC A;  1W5T A;  2Q8K A;  3JTG A;  2YX4 A;  1V4R A;  1XGN A;  1YW8 A;  5D5U B;  3P7N A;  1U2W A;  1XDU A;  5D5V B;  1BI0 A;  4A0Y A;  5BQT A;  3ZMD A;  4CDG A;  1MDM A;  2VOO A;  3M8E A;  2ZXJ A;  3KP7 A;  1BJA A;  3HSE A;  2UWM A;  4A0X A;  5FD6 A;  2CO5 A;  5HVQ C;  2JRT A;  2MBF A;  2A6H F;  4P9U A;  3TDU C;  1S8N A;  4I02 A;  4HYE A;  1TBX A;  4IXA A;  4YG2 F;  1B9N A;  3HRT A;  2V1U A;  2IRF G;  2KJB A;  3HRS A;  2DAO A;  3GWZ A;  4WXC A;  3GXO A;  3HHG A;  3HHH A;  3O2P E;  5D4S A;  4K2E A;  4U0V A;  3I59 B;  5A2Q Z;  2PJP A;  1USS A;  3JSP A;  3I53 A;  2XRN A;  4NQW A;  2V1D A;  4AIK A;  3DEU A;  3J80 Z;  3GVA A;  3GUD A;  3ZMZ A;  4IHT A;  2VE8 A;  2O8X A;  2O6G E;  3CUQ C;  3H3Z A;  3RIR A;  2EV0 A;  3KLO A;  1ZG3 A;  4G6D A;  4RAZ A;  3KFW X;  1REP C;  3EUH A;  4OIO F;  2QWW A;  3P9C A;  3CUQ A;  4EJW A;  2M8E A;  1KQ9 A;  1DP7 P;  3JSO A;  1CF7 B;  4LG0 B;  3ZPL A;  4ESF A;  3DF8 A;  1MZB A;  4CXF A;  4FT8 A;  3ZMV A;  2DPU A;  1Z7U A;  1FYL A;  2CQK A;  2H94 A;  4S04 A;  1XDS A;  3HIF A;  2W84 A;  4Q4Z F;  1KYZ A;  1ZGJ A;  3LQQ A;  2IA1 A;  1UHM A;  1QQI A;  3E6D A;  4DQ2 A;  3E6C C;  1WQ2 A;  5DYM A;  3WTY C;  1R00 A;  4A2U A;  2IPQ X;  1BC8 C;  4YII A;  5HLG A;  4ZZD A;  2YX7 A;  2Y0M A;  2EK5 A;  3ZMT A;  2XKP A;  2YR2 A;  1HW1 A;  1C0W A;  1MJ9 A;  3V7C A;  1Z6T A;  5L3D A;  4PGG A;  1FBQ A;  2L4A A;  5E8I A;  3C3W A;  3H3U A;  1J9I A;  2K02 A;  5D6E A;  3EET A;  4R1H A;  5K5O A;  3RYP A;  1B6A A;  4O3M A;  4UNO A;  5HOO A;  2RNJ A;  1XGS A;  2EA2 A;  5BPI A;  3V4G A;  4KUM A;  5IT9 Z;  5FD5 A;  2ZFW A;  5FLX Z;  1LDJ A;  2EFW A;  2AS5 F;  1FC3 A;  3WGH A;  5BPD A;  3B73 A;  2NAZ A;  4Y15 A;  3B02 A;  2CWE A;  2O3F A;  1KQ0 A;  3CJN A;  1R36 A;  5LBQ A;  4MTD A;  3KP2 A;  5CVJ A;  1FT9 A;  2EJR A;  1Z91 A;  3DP7 A;  3U1D A;  1SFE A;  3NEU A;  4B09 A;  4R8H A;  4KIG A;  2A68 F;  4AWX B;  1B59 A;  2DLL A;  4HV6 A;  4Y17 A;  5DD8 A;  2DQR A;  5DCF A;  2HGC A;  3BPX A;  4L18 B;  1I1S A;  3GEZ A;  2EV6 A;  3HSR A;  2GXG A;  2DK5 A;  1Y0U A;  3KP6 A;  4GGG A;  2Y75 A;  2JT1 A;  1TW2 A;  1XCB A;  3SQN A;  4ETS A;  3PFI A;  4Y13 A;  2M87 A;  3HTS B;  4L9T A;  1T39 A;  4F7Z A;  3IRQ A;  3IHU A;  3ABU A;  5E18 F;  3RKY A;  1F4K A;  4Q5S F;  1UST A;  3E6M A;  2RN7 A;  3KCC A;  1IAW A;  3GFJ A;  3RI4 A;  4U0Y A;  5LRS A;  3N97 A;  1XB4 A;  1OYI A;  1YFH A;  4WCG A;  3U2R A;  1HKT A;  3MZH A;  5HS9 A;  1FBS A;  5L3E A;  3TGN A;  1IN8 A;  2F5E A;  5K5R A;  3E3V A;  2PG4 A;  3K0L A;  2MA3 A;  4M6X A;  1WRJ A;  3RDI A;  1HW5 A;  1TQM A;  3BY6 A;  3T0Y A;  3I64 A;  4Z2Y A;  4MEY F;  4HF0 A;  2RQP A;  3JAM K;  2VC0 A;  3KE2 A;  3WG9 A;  3F8C A;  1HKQ A;  1W7P D;  2NRA C;  2FNP A;  3JW4 A;  2IVM A;  3ZMU A;  3C7J A;  2AXL A;  3J80 K;  4U88 A;  5CLS A;  4ZH4 F;  3Q9V A;  4I0B A;  2RV8 A;  1K78 A;  3BRO A;  1ZRF A;  3E6B A;  4HOB A;  3V7R A;  3L09 A;  3P9I A;  1OYY A;  3F8B A;  5E1W A;  3SFZ A;  3LWF A;  4UUV A;  2VT2 A;  1BC7 C;  4HAM A;  3FMR A;  3GO5 A;  5CYV A;  1R1U A;  3I5U A;  4IPA A;  2XAF A;  2KIF A;  3KLN A;  4G8X A;  3L00 A;  1K6O A;  2IA2 A;  2FBH A;  1TNT A;  5JHU A;  2HFH A;  2A69 F;  5LRR A;  1YW7 A;  2KKO A;  4OU0 A;  1GXQ A;  2M30 A;  5J8F A;  1Z6R A;  2LDU A;  2ZCW A;  1J2X A;  3ULQ B;  2XAG A;  2K4J A;  5KK1 A;  2E1C A;  2QYO A;  4RB3 C;  2V1X A;  2ETH A;  5H6Q A;  2VN2 A;  5CJ9 A;  4EMS A;  2ISZ A;  3I59 A;  2XAH A;  1MJB A;  5ICG A;  3FXQ A;  1ZH5 A;  2QBY B;  1UB9 A;  1XN7 A;  3ZP5 A;  1W7P A;  4EGY A;  3WE3 A;  2DBB A;  4KMF A;  2PBI A;  3RYR A;  3SZP A;  1B4A A;  3ZQ7 A;  1KYW A;  1K7A A;  2ZBK A;  1DUX C;  4EGZ A;  1HBX G;  1FSH A;  5J6X A;  4LJZ F;  3U9G A;  1PP8 F;  2BGC A;  1CF7 A;  5D6F A;  1FX7 A;  1QGP A;  1Z1D A;  2KIM A;  4LG0 A;  1O3S A;  2EFP A;  4M73 A;  2ZNZ A;  4FX4 A;  4PDK A;  3I54 A;  1TQI A;  2BBY A;  2CGP A;  1PUE E;  5IT9 K;  1G4D A;  1KU7 A;  3TO9 A;  5FLX K;  3ZMS A;  2FSW A;  2RVC A;  2LKP A;  1O3Q A;  4A0Z A;  2LNB A;  3K2Z A;  1P4X A;  3MZY A;  2HEO A;  2ZME B;  4UVA A;  4EM2 A;  4EQQ A;  3T5X A;  4LLG F;  2FXA A;  4OMZ A;  2ISY A;  2OZ6 A;  5D4R A;  2M45 A;  3R61 A;  3PQK A;  4L9J A;  4L0Y B;  1TQP A;  2BV6 A;  5HLH A;  4OOI A;  2Q2E A;  4ESJ A;  5ICC A;  1S7A A;  2F5D A;  1JHH A;  3F8F A;  1HW2 A;  2P5K A;  3QU3 A;  1BIB A;  5D8L B;  5AIQ A;  4H0E A;  3RJP A;  4L9N A;  1E2X A;  2VBX A;  1FY7 A;  3KP5 A;  2A5Y B;  3G3Z A;  4CIC A;  1L0O C;  1SD7 A;  4BYY A;  1ULY A;  1QZZ A;  2P5V A;  2COM A;  2V79 A;  2P6T A;  2MC3 A;  1V3F A;  5DD4 A;  4NB5 A;  4Q47 A;  3M8F A;  3WTS C;  4IJA A;  1IXS B;  1MJA A;  3QRF F;  4MHG A;  3RKX A;  3DV8 A;  2E7X A;  4GO1 A;  3V8J A;  2TDX A;  3M9A A;  4OIR F;  4HLY A;  1J75 A;  1P2F A;  2PMU A;  2QVO A;  3C1D A;  2WTE A;  4BQA A;  4G9Y A;  2WC2 A;  4I09 A;  4HF2 A;  4KDP A;  4MGR A;  1KQ8 A;  1IN4 A;  1R22 A;  2Z5U A;  3VFZ A;  3BDD A;  3IWZ A;  1J59 A;  2P8T A;  3D0S A;  2IW5 A;  1YO5 C;  4HW0 A;  1ZAO A;  2PLY A;  1EH6 A;  4G94 A;  3I0T A;  2W85 A;  4RS8 A;  1GVJ A;  1P4A A;  2VOD A;  5BOX A;  1R5G A;  1T38 A;  3KEQ A;  5EEG A;  4RB2 C;  3TOA A;  4BHP A;  3K1M A;  5ERI A;  3RPU A;  3COA C;  4MTE A;  2OD5 A;  3ML6 A;  3RPQ A;  2DTR A;  2HYF A;  3ROU A;  3BZ6 A;  1J5Y A;  5D5X B;  5LGN A;  4PZJ A;  1FOK A;  3GF2 A;  1HST A;  4L5I A;  2ZO4 A;  1BM9 A;  1WKM A;  4B8X A;  4WWC A;  5BMZ A;  2FBI A;  1D8J A;  3FMS A;  1D5V A;  1SMY F;  1ZLJ A;  4HV5 A;  1HQC A;  4LB6 B;  2R7F A;  3EYY A;  2O61 A;  1KA8 A;  2Z9O A;  2H6B A;  1R7J A;  4EJU A;  2L4M A;  1FNN A;  1VTN C;  2G7H A;  2FOK A;  3WTU C;  3QPH A;  1O57 A;  1BIA A;  2QQ9 A;  3GFL A;  3PQJ A;  1T0F A;  4CYD A;  2OZU A;  5AON A;  4WXD A;  2QEN A;  4OIQ F;  1SAX A;  4HDV A;  4EM0 B;  2STT A;  2VON A;  3HOS A;  4IRI A;  1O7L A;  2OQG A;  1W4M A;  5TJJ A;  2D1H A;  2A07 F;  1U6G A;  2F2E A;  1ZLK A;  2B0L A;  4M72 A;  4IRH A;  2FNA A;  3T8T A;  2VT3 A;  5LGU A;  1MDM B;  3WOD F;  3BJ6 A;  5E1Z B;  1NHA A;  1SFU A;  3I58 A;  5BS6 A;  4JK1 X;  3KP3 A;  3G73 A;  3FHZ A;  4N9I A;  2VE9 A;  3CTA A;  3FM5 A;  2Z3Y A;  3OV8 A;  3N4M A;  1S3J A;  3WTT C;  2FU4 A;  4KNY A;  4EJV A;  3ISP A;  5DUK A;  5IT3 A;  5F64 A;  3IRR A;  2ZKZ A;  2DW4 A;  4L5J A;  1ZG5 A;  1LQ1 A;  1FP2 A;  4LFU A;  1U78 A;  4CO8 A;  1IN6 A;  2JTV A;  4I0A A;  3VOD A;  3ELK A;  2F5C A;  3Q5F A;  3LA3 A;  3WGI A;  4M9S A;  2LF7 A;  3LA2 A;  1S7O A;  1ON1 A;  1H0M A;  2XHK A;  2LSO A;  5D5W B;  1BI2 A;  5LHG A;  4OIN F;  5CVI A;  3GFI A;  2DU9 A;  2PI0 A;  3K9T A;  1JXS A;  1F9N A;  2FA5 A;  1LB2 A;  4XLP F;  1JHF A;  1LNW A;  4ENN A;  2GZW A;  3REO A;  3BJO A;  2V6C A;  2O03 A;  1EH8 A;  4HBL A;  3SHF A;  2RDP A;  4A5N A;  1DPR A;  2MLK A;  4ZYD A;  1T6S A;  1EV7 A;  3QP6 A;  3GLX A;  2FEZ A;  2GQQ A;  3O3K A;  2JZY A;  5DCM B;  4E70 A;  2XIG A;  5E17 F;  4XLN F;  4U7B A;  3QP5 A;  2HWV A;  2FRH A;  3SXY A;  3E5X A;  3L9F A;  2DQL A;  3ERE D;  2HR3 A;  2JPC A;  2OU2 A;  1SMT A;  4ZYH A;  3O6B B;  3V8L A;  4HDU A;  4KYW A;  2UXN A;  4KFC A;  1TW3 A;  3QOP A;  4BNC A;  1IRF A;  3KET A;  5A2Q K;  1ON2 A;  4M9Z A;  2GXB A;  2W24 A;  2XVC A;  4CZZ A;  1J0R A;  3TKY A;  5H20 A;  1BI3 A;  1ZG1 A;  2ZME A;  2QM3 A;  2C6Y A;  1LJ9 A;  2ESN A;  2QQB A;  4XSX F;  1F5T A;  1YYV A;  4UHT A;  1ZRD A;  2RGV A;  3NQO A;  1SFX A;  1UHW A;  5LGT A;  4MEX F;  3LAP A;  4LD5 A;  5FFX A;  4HF1 A;  5EEH A;  4LB5 A;  2D2W A;  1YG2 A;  1OMI A;  5ILV A;  5L3G A;  2O0Y A;  1O3R A;  3WTV C;  4TV7 A;  4ZYG A;  1G3Y A;  1ZHF A;  5ILS A;  4WXH A;  1P92 A;  2L54 A;  4ON0 A;  2LF8 A;  1U8R A;  3J81 Z;  1XD7 A;  1KU9 A;  1ONV A;  3F6V A;  4KMU X;  1LVA A;  4KN4 X;  5HLI A;  2EFO A;  2WV0 A;  1IUY A;  2WWY A;  1KU2 A;  4LK1 F;  3KEO A;  4NHJ A;  1Z05 A;  3W6J B;  1R5H A;  4RB1 A;  3NRV A;  1QBJ A;  4DNC A;  3M7G A;  3DXJ F;  1OYW A;  4BAY A;  1ZAR A;  3GFM A;  3RTR A;  2EB7 A;  2A61 A;  2G9W A;  4WK8 F;  2Z33 A;  2V9V A;  1J7K A;  2VBZ A;  4P9F A;  3LST A;  2L3D A;  1LDK B;  3FM3 A;  1OPC A;  3HTU A;  2ZNY A;  3AAF A;  4GXO A;  4G7Z F;  4AVP A;  3GZ6 A;  2PN6 A;  1G6N A;  4KA4 A;  3E5U A;  4QLC U;  1G3S A;  1XGM A;  2FBK A;  2W25 A;  2H09 A;  3T1B A;  4P55 A;  2Y48 A;  1S6L A;  2L01 A;  5HS8 A;  3F8M A;  1FWZ A;  2CSO A;  5AIP A;  1QPM A;  4IVN A;  5E20 A;  1KU3 A;  2OBP A;  1R23 A;  4P96 A;  2VC1 A;  4LLL A;  1YQA A;  1B1B A;  1SD5 A;  2PEX A;  3HSF A;  4IRG A;  3HUG A;  4EV0 A;  4BXU A;  2KJC A;  2J5O A;  2QQA A;  2P7C B;  3R60 A;  3F21 A;  2NS0 A;  1JE8 A;  4D0P A;  1WI9 A;  5E1X A;  4WX9 A;  5DDG A;  2P4W A;  2YPR A;  3MQ0 A;  4LGW A;  1QZY A;  3K1P A;  3BP8 A;  3MEX A;  1RUO A;  2OAZ A;  5L3C A;  4G6Q A;  3E5Q A;  4GYI A;  1XSD A;  3RKW A;  3FZV A;  2NNY A;  1Q1H A;  1IN7 A;  2IJL A;  2E1N A;  3WGG A;  1K78 B;  3WU1 B;  3F3X A;  4O5V A;  1L3L A;  3S2W A;  1K79 A;  1BI1 A;  3LQR A;  4OIP F;  5FFZ A;  2HZT A;  3LAJ A;  3CO7 C;  1D3Y A;  4XRF A;  2JSC A;  2L02 A;  1H9T A;  4HA8 A;  2F5F A;  4ENK A;  1D8K A;  1LDD A;  4OMY A;  3VEP A;  4M6Y A;  3IL2 A;  1R58 A;  4KIB A;  1AOY A;  1I5Z A;  3R0J A;  2H27 A;  5D8K B;  1R1V A;  5HDK A;  1ZGA A;  2RC4 A;  1A04 A;  5JR3 A;  2DPD A;  5JI6 A;  3VOE A;  4ZYE A;  1P4W A;  3L7W A;  1BOA A;  1MKM A;  4P5O A;  2EWN A;  4Q48 A;  4U7D A;  1MGT A;  3GYH X;  1ZRE A;  3JAM Z;  4L0Z B;  2ELH A;  3IC7 A;  5CVV A;  2DI3 A;  2IP2 A;  5HDG A;  2R7D A;  1XCV A;  4HQE A;  3HRM A;  2GIV A;  1U5T B;  3TO7 A;  1SD6 A;  2XUB A;  2PQ8 A;  3L2C A;  2Z99 A;  1W7P B;  1T98 A;  5ICE A;  5FO5 A;  3QAH A;  2CG4 A;  1DPU A;  1IF1 A;  4HX7 A;  3IKT A;  1FP1 D;  1LEA A;  3WTW C;  3R4K A;  1IXC A;  2EV5 A;  4A6E A;  2QLZ A;  5L3B A;  2W57 A;  1YTY A;  2HYG D;  1ZYR F;  2HTJ A;  3J7A O;  2EFQ A;  3JTH A;  1FPQ A;  4AIH A;  3Q9S A;  1XSX A;  1G3T A;  5DV5 A;  6PAX A;  4CHU A;  5LHI A;  3M1E A;  4GYG A;  5DCM A;  3J81 K;  4I01 A;  4R79 A;  3HRU A;  4LLN A;  2RKH A;  5E8G A;  2ADU A;  4CGZ A;  4I98 B;  1XMK A;  5K1Y A;  2MLG A;  1MD0 A;  2ZJ2 A;  2YU3 A;  2D45 A;  3MCZ A;  5JFR A;  4EM1 A;  3QPT A;  5LHH A;  2XAQ A;  4FX0 A;  1RNL A;  3I4P A;  1JGS A;  1IW7 F;  2BE5 F;  3TOB A;  2MH2 A;  2X0L A;  1WSU A;  2YSR A;  4FHT A;  2XGX A;  3QU6 A;  2K4B A;  2KRF A;  2HS5 A;  2D1V A;  4EJO A;  2J5P A;  3T8R A;  1BN5 A;  3FX3 A;  1YW9 A;  4YFX F;  4BHC A;  4M71 A;  1OKR A;  2BYV E;  2IA0 A;  5L3F A;  4HQM A;  1PP7 U;  5LEK A;  2X4H A;  1FYM A;  4O6J A;  4KN7 X;  2XAJ A;  3C18 A;  3E97 A;  4RGS A;  1PDN C;  1YS6 A;  1UCR A;  4RGR A;  3FXU A;  2CFX A;  2STW A;  3HYI A;  4HX8 A;  4KIC A;  2UZK A;  1TNS A;  1HSJ A;  2K86 A;  1LEB A;  4L9V A;  4YIF A;  2FMY A;  3WTX C;  3CO6 C;  4ENJ A;  3P9K A;  3CLO A;  4AD9 A;  1FLI A;  1O3T A;  3WTZ A;  2DFI A;  4YFN F;  3EDP A;  1DDN A;  2XRO A;  2QUF A;  1E17 A;  3MAJ A;  4KIF A;  2XV4 S;  1IN5 A;  5JVT A;  1IXR C;  2VXZ A;  3ABT A;  4A12 A;  1SD4 A;  2VBW A;  2NNN A;  2QBY A;  5FGM A;  1HXD A;  3GW2 A;  3I71 A;  2XAS A;  3IWF A;  4ENM A;  1FZP B;  1HKS A;  1RUN A;  2CYY A;  3F72 A;  2CW0 F;  2P5L C;  3K69 A;  1T2K A;  1RIO H;  3MFK A;  3K1N A;  3WE2 A;  2VOP A;  3KZZ A;  3CUQ B;  5LLQ A;  3D5L A;  1FYK A;  2DT5 A;  1I1G A;  3GZ5 A;  4UVC A;  4AIJ A;  1H9G A;  2FE3 A;  2EFN A;  2HDC A;  5TRD A;  5DEQ A;  1FSE A;  4RAY A;  1IZ1 A;  3V8K A;  2GA2 A;  2HOE A;  2JPB A;  4RB0 A;  2BEO A;  5ICF A;  1EH7 A;  3IKV A;  1ZN2 A;  1RI7 A;  3BOQ A;  1YS7 A;  1S29 A;  1F1Z A;  2HTS A;  3R6S A;  4HX4 A;  4UV9 A;  4A5M A;  3F23 A;  2EA4 A;  4S05 A;  3LFK A;  2OQR A;  2GWR A;  3BWG A;  1U3E M;  5F6F A;  5ILU A;  2MH9 A;  4WF2 A;  1XMA A;  3VB2 A;  2ACJ A;  3DQV C;  2Q0O A;  1XGO A;  2OA4 A;  1Z9C A;  2XKO A;  1OR7 A;  3FXR A;  3LA7 A;  3SZT A;  2A3S A;  4PCQ A;  4G7O F;  1QO0 D;  4M74 A;  1QNT A;  3DKW A;  5FB2 A;  3F6O A;  3CDH A;  1IRG A;  4I2O A;  3TO6 A;  2M5W A;  2HQR A;  2G7U A;  2VBY A;  2MD5 A;  2KIU A;  3ECO A;  3W6K B;  2FQ3 A;  4XSZ F;  1I27 A;  3BJA A;  3DPL C;  2PMH A;  4UXN A;  3CUO A;  4N9H A;  2DO7 A;  3KZY A;  4LMY A;  3EQL F;  4HZF A;  4PGH A;  3V7S A;  5DUI A;  3KP4 A;  4I7H A;  3TDZ C;  2HQN A;  1XSV A;  3H92 A;  3MWM A;  4HLX A;  1O7F A;  4RGU A;  2DK8 A;  1TLH B;  3TQN A;  5HDN A;  5F1R A;  4ESB A;  3HOT A;  2K7L A;  4G7H F;  2GA1 A;  4M9X A;  4QWQ A;  4LK0 F;  1X3U A;  4XBF A;  3BPV A;  4ASN A;  1U5T C;  1CGP A;  1UFM A;  2A6E F;  4BHB A;  1TTY A;  5CVR A;  4UV8 A;  2FF4 A;  2H6C A;  3F22 A;  1FBU A;  2FML A;  4RGX A;  5K5Q A;  1U5T A;  4U0W A;  2M1B A;  1YLF A;  3FWE A;  2IT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...