4EJTA

Staphylococcus epidermidis tcar in complex with rna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
140
Chain Sequence
RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Functional studies of ssDNA binding ability of MarR family protein TcaR from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator/rna
total genus 42
structure length 140
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejtA00
4HQMA 5E8IA 4ZYGA 4BHBA 2JSCA 1ON1A 3KP5A 1I6XA 5ILSA 5J8FA 2E1CA 2A3SA 4KICA 2XAGA 3QP6A 1RIOH 2HQRA 3GVAA 2OBPA 4U0VA 2RGVA 2F2EA 3RYPA 1YW9A 3EYIA 4R79A 2J5PA 5DYMA 3EQLF 3K1MA 1P4WA 1A04A 3RKWA 3LWFA 1D3YA 4UNOA 1HKSA 4ZH4F 1MJBA 1XSVA 2UZKA 1W5SA 3BP8A 4MEXF 3ISPA 3GEZA 3MCZA 1YFHA 2XKPA 1LDKB 5TRDA 2DPUA 1ZRFA 3K1PA 3T8RA 4EQQA 4RB2C 1BI3A 1REPC 1XGMA 5ILUA 3LQRA 1S8NA 1LEBA 1P2FA 5L3EA 4OMZA 1KQ9A 3RIRA 3ML6A 1FBUA 3I59B 1FSHA 4YFNF 2ZMEA 2FBKA 3K1NA 4I02A 1K6OA 4A5NA 3TO6A 1R00A 3JTHA 4PDKA 4ENJA 3VEPA 2GA2A 4A0XA 1ZREA 2G7UA 5FD5A 3GX4X 2O0YA 5HDGA 1FOKA 2LF8A 4IJAA 3FMSA 3PQKA 1JGSA 4RGXA 1HSJA 1FNNA 2PLYA 1FBQA 3GFLA 3LAPA 3O6BB 4YIFA 3O2PE 5D4SA 4ESBA 3QU3A 3ZMZA 4G9YA 3WU1B 4ETSA 3NRVA 3FMRA 4KN7X 2ZNYA 3L00A 1QGPA 2R7FA 3PQJA 2Q2EA 1XCVA 1F4KA 3ZN0A 4UVCA 5A2QK 3EETA 1MKMA 1QZYA 3C1DA 1O3RA 1O3SA 1P6RA 4OIPF 1P4XA 3GZ6A 2EK5A 2OU2A 5DCMB 2NAZA 2DT5A 1NHAA 4E70A 2EA4A 1W7PB 4EGZA 3AAFA 1ZG5A 1R58A 2VC0A 1RUNA 5DD8A 2KIMA 1XGNA 4AVPA 5BQTA 4LLNA 3C18A 1SD7A 4L0ZB 2EFNA 1OKRA 4CO8A 1J0RA 4MTEA 1YQAA 2ACJA 4UXNA 1C0WA 2Z99A 1ZYRF 2F5CA 5HVQC 2PQ8A 3TDZC 5LHHA 5CJ9A 4P5OA 3DPLC 3V8JA 4LB6B 3B02A 1FT9A 2ESHA 2GWRA 3DFGA 2W24A 3V8LA 3BZ6A 5L3DA 3RKYA 1T38A 4YFXF 2OQGA 2H09A 2DW4A 4JQFA 1QO0D 5JFRA 3K0LA 4UV8A 1XD7A 4KA4A 1UHWA 1G3YA 4XBFA 1EH7A 3PFIA 2ZBKA 2M1BA 3FMQA 4QWQA 1VTNC 2QQBA 1DDNA 1OYWA 3IWFA 3BJAA 5E1ZB 2P7VB 3DPTA 1YW7A 2FA5A 1BOAA 5K5OA 2EFPA 1ODDA 5D6FA 3C3WA 3MEXA 1D8JA 3FM3A 2DAOA 3BROA 4MEYF 1J75A 1OR7A 2Q8KA 2V1XA 3T8TA 1FP1D 2DQLA 2W84A 5K5QA 1T0FA 3F8MA 3QPHA 2OAZA 3BOQA 2H94A 1FX7A 1SD6A 3RPUA 1D8KA 3WTUC 2L4AA 2IA0A 4U7DA 3E97A 5IT3A 3JSOA 4IPAA 3F23A 1B1BA 2RVCA 3KLNA 4IRGA 5HLIA 3KP6A 4LD5A 2PJPA 2STTA 2VBZA 3OV8A 4AIHA 3ZMUA 4KIFA 4TV7A 3JAMZ 2BE5F 4KIGA 2XV4S 3BWGA 1K7AA 4BNCA 4MHGA 3I54A 4KYWA 1S6LA 2ISZA 1IXSB 4NB5A 2CYYA 3F22A 5JHUA 2GAUA 3WGGA 4ON0A 2HFHA 5LRRA 3N97A 1R5HA 4YFKF 2XIGA 3CTAA 4OMYA 3R61A 3H3ZA 5K5RA 1WWXA 3L2CA 1Z91A 4HDVA 3F6OA 4KIBA 4EMSA 2NNNA 4I0AA 4XRFA 3VB2A 2COMA 5D5WB 2L54A 4CGZA 3O3KA 2M45A 3RKXA 2XAQA 2OZUA 1TQMA 3CDHA 2BGCA 4ENMA 3E3VA 2XKOA 4BHPA 1HKQA 3V4GA 1R22A 1XB4A 4NQWA 1O7FA 3N4MA 5L3FA 4L5IA 1QQIA 3BJOA 5FLXZ 2RN7A 1XSDA 1J5YA 1EH6A 2GQQA 1STZA 2DBBA 3DF8A 5F6FA 2IA1A 5AIQA 2VOOA 2EB7A 2H27A 1V3FA 1J9IA 1SMTA 3WE3A 5CVJA 2ZJ2A 3WTTC 2KIFA 4CZZA 4L9VA 2PMUA 2FU4A 2A69F 4U0YA 2XRNA 5D5VB 1IN4A 3EYYA 1I5ZA 2DI3A 2MA3A 2PN6A 2O03A 4P96A 4EJVA 3SQNA 3ZMSA 3IKTA 4M72A 5HOOA 4EJUA 3CO7C 4EJWA 3HRMA 2EWNA 3RJPA 3E5QA 5DCFA 2HYFA 2PMHA 4CXFA 3M1EA 2YPRA 3H3UA 2ZNZA 2OA4A 2VOPA 4PZJA 5AIPA 2WWYA 1LDJA 1K78B 4MQ9F 5HS9A 4XSXF 3I59A 2JZYA 3GXOA 2YR2A 3F21A 4I2OA 2Z3YA 3GFJA 1Z05A 2D2WA 3M8FA 4A0ZA 4HQEA 4KNYA 1J2XA 4EM1A 3P9CA 3WTVC 2VBXA 3LFKA 1FLIA 3G73A 1USTA 4RAYA 2QLZA 2LSOA 3ABTA 2IJLA 2TDXA 3U2RA 3V7SA 4BYYA 3M8EA 5DEQA 2X0LA 1HXDA 2IW5A 4RB1A 1ZG3A 3TO7A 4AIKA 1RI7A 1AWCA 1BIBA 3RDIA 1WI9A 1SFXA 2YU3A 1TTYA 5FB2A 1SD4A 5CVRA 1J7KA 5EEGA 4HF2A 4A6EA 3HSFA 3FXRA 5L3BA 1XMAA 3T1BA 5DCMA 3VODA 2EV5A 2V6CA 4AD9A 4BHCA 5F64A 2VE9A 1W7PA 2STWA 4HF1A 5BS6A 2JT1A 4YG2F 4P9FA 4EJOA 5E18F 4Y13A 4XSZF 4OIRF 1YIOA 4S04A 2QBYB 2CQKA 4Q5SF 3REOA 2H6BA 2P5LC 5EEHA 4WXHA 2DFIA 3MFKA 1V4RA 1YG2A 3KZYA 1ON2A 4YIIA 1KU9A 2J5OA 1WKMA 1J59A 4KDPA 4MTDA 1S7AA 3ELKA 4OINF 1ZLJA 2D1VA 4M71A 3FWEA 2RNJA 4HV6A 2K4BA 4EV0A 2O61A 4ENKA 1B9NA 2L3DA 1R23A 2R7DA 3L9FA 1ZGAA 3L7WA 4KMUX 1B59A 2M87A 3I0TA 3RI4A 4WXCA 2VT3A 1H9TA 2MLKA 2LNBA 1TQIA 3GO5A 3TO9A 2A68F 2XHKA 3WTWC 2GIVA 2A07F 1BBYA 4LJZF 3WTXC 1BIAA 3KETA 1YS7A 2CSOA 1H0MA 1ZHFA 3JAMK 1IN8A 1Y0UA 3KE2A 5ICGA 2QVOA 2L02A 6PAXA 4WWCA 3JTGA 4K2EA 2Q0OA 3E5XA 1SD5A 4L9TA 5HDKA 3G3ZA 4LMYA 4FHTA 2P6TA 2F5EA 3RYRA 2HQNA 4PGHA 3J80Z 4WX9A 4I98B 1Z1DA 2ZO4A 1IXCA 1TW3A 1DUXC 2DTRA 2WC2A 4Q4ZF 2PI0A 3I58A 5HLGA 2FBIA 4BQAA 3FX3A 2A6HF 2VBWA 1KGSA 4F7ZA 3BDDA 3R0JA 2XROA 3EDPA 5LEJA 1QPMA 2P5KA 5E1WA 4RAZA 1ZGJA 2A6EF 1EV7A 2DQRA 3CLOA 2KJBA 4LK0F 4Q47A 2VXZA 4ESFA 2XVCA 4A12A 3GFMA 4UV9A 4G7OF 4EM2A 4CHUA 2LDUA 4O5VA 4U0WA 4A0YA 5FLXK 3KP7A 2P5VA 2P6SA 1XCBA 4ZYDA 3SXYA 3IRQA 3SHFA 5E20A 3WG9A 3KEOA 1B9MA 4RS8A 2HGCA 2HR3A 1HBXG 4GYGA 2DU9A 1YTYA 2FF4A 4A2UA 4HLYA 3R60A 3U1DA 5LGNA 2EV6A 3R0AA 4PCQA 1K79A 3ERED 3H92A 2HEOA 4HW0A 2Y48A 3F8FA 5D4RA 3K2ZA 1BN5A 3WODF 2Z5UA 2XASA 3DXJF 1SAXA 1XSXA 5KK1A 2KKOA 2JTVA 1HKTA 4M9XA 1UHMA 2E7XA 4CICA 1JE8A 3WTZA 2YX4A 3E6MA 2ETHA 4FX4A 1ZRCA 1TNSA 2IT0A 2QM3A 2IRFG 1GHCA 4L0YB 4KMFA 1HW1A 1LDDA 1IN6A 4WCGA 4M74A 2DK5A 1O57A 5ICCA 1XDSA 2NS0A 4CDGA 2K7LA 2C6YA 2MD5A 4NHJA 4WXDA 2L4MA 4Q48A 2VE8A 3ZQ7A 4A6DA 1MGTA 3LA3A 3NQOA 1FY7A 2ADUA 2Y75A 1FYMA 1USSA 1KQ0A 1U5TC 2RDPA 5DDGA 4GO1A 3CUQC 3KZZA 2GXBA 1ZRDA 3IL2A 2Z33A 2ESNA 2FMYA 2UXNA 1T98A 5AONA 3MQ0A 5DUKA 1PP7U 1F5TA 3KP2A 4S05A 4KFCA 3HHGA 1H9GA 4QLCU 3V7CA 2H6CA 4OOIA 2LKPA 4MQVA 1ZG1A 1YS6A 2WV0A 3TKYA 3LA7A 3DV8A 1XGSA 3KFWX 1OMIA 5FO5A 4M9ZA 2KRFA 2DO7A 1PUEE 4HYEA 5F1RA 4HDUA 1Z9CA 4HAMA 1S29A 2BYVE 1MD0A 1L3LA 2CG4A 1B4AA 1QZZA 2W85A 4RGRA 4B8XA 2FE3A 1IRFA 4LLLA 1IN7A 3BJ6A 3ULQB 2P4WA 4A5MA 3V8KA 1K78A 3S2WA 2KIUA 4Y15A 3DKWA 3LA2A 2V9VA 3LSTA 1LEAA 3T5XA 1FYKA 2EFQA 1W4MA 1KYZA 1F1ZA 3ZMVA 4I01A 2P8TA 1HW5A 5ERIA 2ISYA 1XN7A 1U8RA 3T0YA 5BPDA 3MZHA 4G6QA 5H6RA 1PDNC 1R36A 1U2WA 1FPQA 4JK1X 2CWEA 3FXQA 3ZMDA 4KT5C 2QUFA 1FSEA 1E17A 5LRSA 3ZPLA 1MJAA 3FF5A 4MNUA 4WF2A 2E7WA 4R1HA 2R3SA 2FNPA 2V1DA 5D5UB 2HKOA 2QENA 3SZPA 1S7OA 3C7JA 4IRHA 3IC7A 2MC3A 2HWVA 3LAJA 2EFOA 1R1TA 4AWXB 1L0OC 3RPQA 3GLXA 1O3QA 1YYVA 4EVIA 4Y17A 4Z2YA 2CO5A 1FYLA 3ECOA 1JXSA 4WK8F 5H6QA 3DEUA 4UHTA 1LQ1A 5H20A 1OPCA 3GZ5A 4G8XA 4UVAA 1R7JA 2RV8A 2OD5A 2QBYA 2D45A 1R1VA 2KJCA 3J80K 2F5DA 5ILVA 1WRJA 1Q1HA 1FC3A 4KUMA 4UUVA 3HYIA 1OYIA 3QP5A 2QYOA 2MH9A 3QU6A 3VOEA 1G6NA 1G4DA 1YLFA 2ZFWA 5CVIA 3DP7A 2FRHA 1CF7B 5HS7A 5JR3A 4LG0B 4CYDA 5LEKA 2O3FA 2RKHA 3Q9SA 1ZLKA 5IT9Z 3F8CA 3P9KA 1LNWA 3KP3A 4DNCA 4HLXA 2XUBA 2FNAA 2RQPA 3I5UA 2CW0F 4PGGA 5LHGA 3WTYC 3R6SA 5TJJA 4ZYHA 1ZAOA 1FWZA 3HTUA 1BI0A 5ED4A 3SFZA 2W57A 2X4HA 2E1NA 3J81Z 2DPDA 1GVJA 3KEQA 2IA2A 1LJ9A 1HQCA 3L09A 4FX0A 4EJTA 2FXAA 2MH2A 3E5UA 2ZCWA 1MJ9A 3GFIA 3P7NA 2XAJA 2NRAC 1MDMB 3SZTA 1Z7UA 3COAC 4AIJA 4DQ2A 1HSTA 3MAJA 5DD4A 4BH9A 4GYIA 1DPRA 5E1XA 2LF7A 3HHHA 3IHUA 1QNTA 4M73A 4HV5A 3F72A 3GWZA 5CVVA 3GUDA 1KYWA 1F9NA 5LLQA 3Q9VA 4H0EA 4G6DA 2HYGD 1G3WA 2JPCA 1IAWA 1IZ1A 4P55A 5DUIA 1R5GA 3HIFA 2MBFA 1U5TB 3VFZA 3CUQB 2CGPA 5HS8A 1I27A 4U7BA 1IRGA 4HA8A 2VODA 2WTEA 1UB9A 3ZP5A 1B6AA 1EH8A 2EFWA 3ZN1A 1QBJA 3ZMTA 5D6EA 2YX7A 2HOEA 4ESJA 3K9TA 2G7HA 1E2XA 4ZZLA 3LQQA 3F6VA 1Z6RA 1U6GA 3TGNA 4IRIA 4OU0A 2FQ3A 3D0SA 5L3CA 1T6SA 2M8EA 1BJAA 3HSEA 2FBHA 3FHZA 3FM5A 2AS5F 4HZFA 4IHTA 2QQAA 2ZXJA 1CGPA 4G94A 2FMLA 4ENNA 1HW2A 3I64A 2ELHA 1UCRA 3V7RA 2BEOA 2IVMA 3I53A 1U3EM 1ZN2A 3E6DA 1JHHA 3CUOA 4N9HA 2M30A 2MLGA 3FZVA 1OYYA 1RZ4A 2QWWA 4OIOF 3BPVA 2FOKA 4EGYA 2K4JA 2A61A 4RB3C 3KCCA 4U88A 1GXPA 3DQVC 5FFXA 3WE2A 1BM9A 5HLHA 2ZMEB 4HX8A 3HSRA 4HBLA 1U78A 3MZYA 4I0BA 1XGOA 4L5JA 1BI2A 4P9UA 4IXAA 3IKVA 2Y0MA 3HOSA 4EM0B 2PBIA 5KVRA 5K1YA 1WSUA 1RNLA 4M6XA 2GZWA 3F8NA 1FBSA 3F3XA 5ICEA 2BV6A 4LK1F 4XLPF 3M7GA 2YSRA 1W5TA 2EA2A 3I71A 2IP2A 1LB2A 2QZ8A 1P4AA 2UXXA 4LLGF 1DPUA 4FT8A 3ABUA 3TOAA 4G7HF 4GXOA 4M9SA 4N9IA 2PG4A 2GA1A 3HRSA 1IN5A 1SMYF 3GW2A 3WGHA 3W6JB 4IHSA 2VONA 1PP8F 2JRTA 2K86A 4XLNF 5CVUA 5LHIA 1WQ2A 5JI6A 3U9GA 1TLHB 2NNYA 2G9WA 1S3JA 3QAHA 1FP2A 4LB5A 1XDUA 3HUGA 5JVTA 1ULYA 3QPTA 2PFBA 3ECHA 3KP4A 1IW7F 3JSPA 1TQPA 2XAHA 2K27A 2B0LA 4R8HA 2IPQX 3I4PA 3ROUA 1FZPB 3R4KA 1I1SA 2NYXA 2W25A 2DLLA 2UWMA 5BMZA 1P92A 4HX4A 3GYHX 3HOTA 2HTJA 3CO6C 4LGWA 1KU3A 3K69A 2XGXA 2OQRA 5BOXA 3QOPA 5IT9K 5FFZA 3P9IA 4BAYA 2FSWA 3M9AA 3E6BA 2L01A 1O3TA 1ZH5A 5DV5A 1GXQA 2CFXA 5CYVA 5D8KB 2OZ6A 1D5VA 4L9NA 3J7AO 1IUYA 5A2QZ 3J81K 2HDCA 3MWMA 4L18B 2QQ9A 3HRUA 5FD6A 2EV0A 5CLSA 5L3GA 3WGIA 3FXUA 2F5FA 3TDUC 2HS5A 4HOBA 2D1HA 1ONVA 1W7PD 1BC8C 3CJNA 3TQNA 5E8GA 1X3UA 1T39A 4ZZDA 1KA8A 3QRFF 2PEXA 2A5YB 5LBQA 3KLOA 4RGUA 4ASNA 2VN2A 1MZBA 3W6KB 1YO5C 3GF2A 5E17F 2VT2A 3JW4A 5ICFA 1CF7A 1R1UA 4D0PA 2HTSA 1O7LA 2O6GE 4LG0A 1KU2A 2AXLA 3IWZA 2K02A 1TBXA 1DP7P 4ZYEA 3BY6A 4RB0A 1G3TA 3BPXA 3HRTA 3TOBA 4KN4X 1KQ8A 1IXRC 2M5WA 2VC1A 2EJRA 3OOPA 5LGTA 1ZARA 2XAFA 5FGMA 2V1UA 4JBAA 1UFMA 3EUHA 3Q5FA 4OIQF 1AOYA 3WU0A 4IF4A 1BI1A 1KU7A 2Z9OA 1T2KA 1MDMA 4I09A 1YW8A 5BPIA 1XMKA 3IRRA 1TW2A 4N0BA 2ZKZA 4I7HA 1G3SA 3HTSB 4O3MA 3E6CC 5D5XB 3F8BA 1Z6TA 4RGSA 4GCVA 2HZTA 2DK8A 1LVAA 4HX7A 1BC7C 2BBYA 4O6JA 1JHFA 1RUOA 4G7ZF 4LFUA 4B09A 4GGGA 1IF1A 5LGUA 2HKXA 2V79A 5HDNA 1I1GA 1TNTA 4M6YA 5D8LB 2P7CB 2GXGA 4BXUA 3RTRA 2RC4A 1U5TA 2JPBA 5J6XA 2VBYA 1SFEA 3CUQA 4IVNA 4UVBA 3WTSC 2FEZA 3D5LA 1SFUA 4L9JA 4HF0A 4MGRA 2O8XA 3NEUA 5J8CA 3B73A
chains in the Genus database with same CATH superfamily
4HQMA 5E8IA 4ZYGA 4BHBA 2Y31A 4B3XA 2JSCA 1ON1A 3KP5A 4S0HB 1W5CC 1MBKA 1I6XA 3DEWA 3HJEA 5ILSA 5J8FA 4XK4A 1Z3YA 2E1CA 2A3SA 4KICA 4CCKA 1YHQI 1ZQ3P 2XAGA 2O7OA 3QP6A 4NC8A 1BW6A 3OS0A 1RIOH 2HQRA 3GVAA 2MFZA 2OBPA 3HEFA 1VQKI 4U0VA 1NG7A 2RGVA 5GADJ 3D1NI 2F2EA 2DA7A 1P7IA 3RYPA 1YW9A 5EDNA 3EYIA 4R79A 3TMOA 4RAFA 1FIAA 2J5PA 1UZCA 3S8PA 4ZTFA 3DCFA 5DYMA 3EQLF 3K1MA 1JTXA 2HVRA 5F08A 1P4WA 5M5XJ 2A05A 1A04A 1JJ6C 3PSIA 3RKWA 3PO3J 3LWFA 3CQZJ 1D3YA 4UNOA 4ZYAA 5GPAA 1HKSA 4BEHB 4ZH4F 3H3VK 1D0YA 2ID6A 1MJBA 3IP4B 1XSVA 5LFAA 3CCVI 3A01A 2UZKA 2KRCA 1K61A 1D0XA 1W5SA 3BP8A 4XNFA 4MEXF 2Y9ZA 4A3KJ 3ISPA 3GEZA 3MCZA 2L7FP 2I8DA 1G59A 1YFHA 2XKPA 3A4CA 4HSRA 1LDKB 3HOWJ 5TRDA 1JKPC 2DCEA 5M5YJ 2DPUA 1ZRFA 3K1PA 2DYRH 4PUSA 5CKTA 3A2KA 3LMMA 3T8RA 5E3LA 3FXKA 4EQQA 3LFUA 1QHGA 2M7AA 4RB2C 4E7JA 1BI3A 1REPC 1XGMA 5ILUA 3LQRA 1S8NA 2BOLA 3VYSB 1LEBA 1P2FA 5L3EA 4OMZA 1KQ9A 3RIRA 3ML6A 3PNVA 3HDDA 1FBUA 3I59B 3Q3SA 3MD2A 3OY9A 2ICWG 1FSHA 4YFNF 3C2GA 2ZMEA 2FBKA 1AA7A 2DT7B 3K1NA 2M0CA 4I02A 5B66C 1K6OA 4A5NA 1Y0NA 4DOZA 4CYCA 1ETVA 2VI6A 2LOOA 3DBLB 3TO6A 1R00A 3JTHA 4PDKA 1GVDA 4ENJA 3VEPA 2GA2A 5B1BH 4A0XA 1ZREA 1QVTA 1ETYA 2G7UA 5FD5A 3ZQQA 4BQOA 4F55A 3GX4X 2O0YA 5HDGA 1FOKA 2HI3A 2LF8A 1XS9A 4IJAA 3FMSA 3PQKA 1N78A 2EZLA 1JGSA 3OIPA 1W36D 4RGXA 1HSJA 1FNNA 1APLC 4A3FJ 4D5CA 1JGGA 2PLYA 1FTTA 3CP2A 3GTOJ 2K40A 1FBQA 1WI3A 5GTHC 3GFLA 3LAPA 4ZDOA 3O6BB 4YIFA 3O2PE 4IO9F 5M3MJ 2WY7Q 5D4SA 4A3GJ 5IPAA 4ESBA 3VWBA 4NUBA 2JUCA 3QU3A 3BLYA 3ZMZA 1X2MA 4G9YA 3WU1B 4ETSA 3NRVA 3FMRA 4KN7X 2OCEA 2XPUA 2ZNYA 3K4CA 3PJRA 3L00A 1QGPA 2R7FA 4IL6C 3HOZJ 3PQJA 4BKXA 2Q2EA 1EKEA 1XCVA 5IP9J 1F4KA 3MN2A 2NS7A 2FQ4A 3U1KA 3ZN0A 5E1WA 1MIJA 4UVCA 1TC3C 3BZKA 1HDPA 2IS1A 5A2QK 3EETA 4XR6A 2CUEA 1MKMA 2M2EA 1QZYA 2B7EA 3C1DA 1O3RA 1DGWY 1X1DA 3FXLA 1O3SA 1P6RA 4OIPF 4PFPA 1P4XA 4AC0A 3OYHA 3GZ6A 2EK5A 1RR8C 2MABA 2OU2A 5DCMB 3BG3A 3MKYB 1PUFB 2AQEA 2NAZA 2DT5A 1NHAA 2EIJH 2DA5A 3WG7H 2BY0A 3F9KA 4E70A 2EA4A 3GTQJ 1W7PB 2QGUA 4XQFA 4E7SA 4RM2A 3AAFA 4EGZA 1ZG5A 1R58A 2VC0A 4HEA2 1U8BA 1K83J 1RUNA 5DD8A 5KNLA 4U87A 2KIMA 1XGNA 4AVPA 5BQTA 4IHXA 4Z6YA 2JQ7A 4LLNA 2R7WA 3C18A 1SD7A 4L0ZB 5J1YA 1XX5A 2EFNA 1OKRA 4XLCA 4CO8A 2TRTA 1J0RA 3CP8A 4MTEA 2QA4I 2VKHA 3DKYA 1YQAA 2ACJA 4UXNA 2NXNB 1C0WA 2Z99A 3SDBA 2OUMA 1BA5A 1OCTC 1ZYRF 2X6XA 2F5CA 3MKZA 1VI0A 1LUJB 4A3IJ 5HVQC 2PQ8A 3CF2A 3TDZC 2GOMA 3W3CA 4CYCB 3F0CA 5LHHA 4A69C 1F43A 5CJ9A 4PFOA 1MNMC 3QWLA 4P5OA 3DPLC 3V8JA 3CMMA 3MKLA 1A6IA 3B02A 4LB6B 4A3BJ 1FT9A 2ESHA 2GWRA 3DFGA 4A3EJ 2W24A 3V8LA 2AO9A 3BZ6A 2ZXHA 3S15J 3DPUA 5IOZA 5L3DA 3RKYA 3AFHA 1T38A 2V1NA 2WBMA 4YFXF 2OQGA 2CFOA 2H09A 4C9YA 4MIMA 4C3JJ 2DW4A 3L2UA 2NVXJ 4I6ZA 4JQFA 1QO0D 5JFRA 1F36A 3K0LA 2HZDA 1XD7A 3O8HA 4UV8A 4AVZA 4BBRJ 3OYNA 4KA4A 1UHWA 1G3YA 4XBFA 1EH7A 1B8IA 4JOMA 5IY5H 3PFIA 1KZHA 2ZBKA 2M1BA 4BE0A 1VQ7I 3I56I 2IS2A 3FMQA 4QWQA 1VTNC 4CSWA 3RZOJ 2QQBA 1O4XA 1DDNA 1OYWA 3IWFA 3BJAA 2M8GX 5E1ZB 4NBQA 2P7VB 3BTJA 3DPTA 3SDGA 4BS9A 1W0UA 4DBRA 2XF7A 1UJ8A 1YW7A 1RKWA 1WJDA 2FA5A 1BOAA 2OCCH 1S7EA 5K5OA 2EFPA 4AYBA 1VQ6I 2GXAA 1FMWA 1ODDA 5D6FA 4C3IJ 3C3WA 1SC7A 3MEXA 1D8JA 3FM3A 2DAOA 4ZDLA 3BROA 4MEYF 1WCMJ 3S14J 2Z16A 4E7KA 1J75A 1OR7A 2M0MA 2Q8KA 2V1XA 1NK2P 3S1NJ 4BJTA 1PVEA 1ETKA 3T8TA 1HA8A 2L2OA 1XTAA 4M3DA 1FP1D 2DQLA 2W84A 3J7ZI 5K5QA 4GFBA 1T0FA 3F8MA 4J00A 3QPHA 2OAZA 3BOQA 2H94A 1FX7A 2CV1A 1LFBA 1SD6A 1Z67A 2KT0A 3RPUA 1D8KA 3WTUC 2L4AA 2IA0A 4U7DA 3E97A 5IT3A 3BTLA 3JSOA 1N77A 3JRBA 3BG7A 1X1BA 4IPAA 2K9SA 1GV2A 4F92B 3F23A 1B1BA 4YELA 1X19A 3RQ4A 2RVCA 1WH7A 3KLNA 5JLXA 2H8RA 4IRGA 1NTCA 3BR0A 3KP6A 5HLIA 2R7UA 4LD5A 3JRIA 2PJPA 2STTA 3IAS2 4NDLA 3L1PA 2X48A 4YIRX 1ETQA 1MSEC 2VBZA 3OV8A 2NVUB 4AIHA 3ZMUA 1FOWA 4KIFA 4TV7A 5F04A 3JAMZ 2LBFB 2BE5F 4KIGA 2XV4S 2VQCA 3BWGA 3S2HJ 1K7AA 3OS2A 4BNCA 4F91B 3GTPJ 4MHGA 2V6EA 1D1BA 3I54A 4LIUA 4KYWA 1S6LA 4E7LA 2ISZA 1IXSB 1R6RA 4NB5A 1R71A 1Z21A 2CYYA 3SYTA 3F22A 5JHUA 2GAUA 4C30A 1JUPA 4NNJA 2DYSH 3IV5A 3BTIA 1Y6IA 1E3OC 3HOUJ 3WGGA 2KMUA 4ON0A 2HFHA 2BHZA 2E5ZA 3H35A 5LRRA 2R7RA 2JN6A 3S1MJ 5FRNA 1M1EB 3N97A 1R5HA 3B6CA 4PSXA 1FIPA 1MMNA 2OF7A 4YFKF 4V2GA 2DMNA 2XIGA 3KYDB 4RLFA 4IX7A 1JUSA 3CTAA 2VUMJ 4OMYA 1QVUA 3R61A 2AHQA 2ZFUA 3H3ZA 5K5RA 3TP0A 1WWXA 3L2CA 1K6YA 1Z91A 5C4JJ 4XKVA 1R4NB 4EATA 4HDVA 1J09A 3F6OA 4KIBA 3SZGA 4EMSA 2NNNA 3HB9A 4I0AA 2W1OA 2H1KA 3CCJI 4XRFA 3VB2A 3OYLA 2COMA 3H5AA 2FUG2 3ZQGA 5D5WB 3TP3A 2L54A 4CGZA 3O3KA 2M45A 4PJLA 1BW5A 1WVRA 2MW8A 2XAQA 4NC6A 3RKXA 2GIZA 2OZUA 1JT0A 1TQMA 3CDHA 2BGCA 1IRZA 2JA8J 3S3MA 2LY9A 5KCMA 3DTIA 4ENMA 3E3VA 3SEZA 3H1CA 5EJCA 1DU6A 2XKOA 4BHPA 1HKQA 1SVMA 2DFEA 3V4GA 1A6QA 2JK3A 1R22A 1XB4A 1GUUA 2XF6A 4NQWA 1O7FA 4FCYA 2KHMA 2R5YA 3N4MA 2X6WA 5EG0B 4HSTA 5L3FA 1MBGA 3BG6A 4L5IA 1QQIA 3BJOA 5FLXZ 1VZ0A 2RN7A 1XSDA 1J5YA 3FBIB 1EH6A 2XB0X 2X85A 1TP4A 2GQQA 4XLAA 4C2MJ 1STZA 2L9NA 2DBBA 3DF8A 3PIPF 2LP0A 4LITA 2IA1A 5F6FA 5AIQA 2VOOA 1ACIA 3ZRGA 1LE8B 1IC8A 2EB7A 2H27A 1V3FA 1J9IA 5EEAA 1SMTA 3WE3A 5CVJA 2ZJ2A 1Y1VJ 3WTTC 2KIFA 4YEJA 4L9VA 4CZZA 2PMUA 2FU4A 2ZJPF 2A69F 4U0YA 2F4OB 1WJ5A 2XRNA 1VQ4I 5F0FA 5D5VB 1IN4A 4X0GA 3ZXSA 1RESA 2VJ5A 3EYYA 4II3A 2VL8A 4RBOA 1I5ZA 2DI3A 2MA3A 1RPWA 1RR7A 2PN6A 4FASD 4XICA 2O03A 4P96A 4EJVA 3K2AA 3SQNA 4PJNA 4BEHA 3ZMSA 3IKTA 1VQ9I 1WJBA 4M72A 4B43A 5HOOA 4EJUA 1TWAJ 1IUFA 2KIQA 3CO7C 4FISA 1XPXA 3QPSA 1HOMA 3NWSA 4EJWA 4HNVA 1YI2I 3HRMA 2EWNA 3FXJA 5F1JA 3RJPA 3E5QA 5DCFA 2HYFA 2KP6A 2PMHA 4CXFA 1NH3A 1MBJA 3M1EA 3ZOBA 3OR1C 2YPRA 2IS4A 2KL4A 4XN0A 3K70D 3H3UA 1X1AA 3K4LA 2L5QA 3B6AA 2ZNZA 2OA4A 1I50J 4MFDA 2VOPA 3K4JA 5EYRA 3CMAI 4PZJA 5AIPA 1MH3A 2WWYA 1LDJA 1K78B 4MQ9F 4E6KG 5B5EC 5HS9A 4XSXF 3I59A 2JZYA 3GXOA 1WFXA 2YR2A 3DTEA 2DODA 3BG9A 4BJ6C 3F21A 1T08B 3KPHA 3SEQA 2ECBA 2LLKA 4I2OA 1A31A 2R7ZJ 2Z3YA 3GFJA 5IP6A 1Z05A 2D2WA 3M8FA 3AG1H 3OYIA 2BVLA 4A0ZA 3LSPA 1K4SA 1WJAA 1FJLA 2M4KA 1BR1A 4HQEA 3E0JB 4KNYA 2CUJA 1J2XA 2W82A 4EM1A 2IGMA 3P9CA 3WTVC 1BL0A 2VBXA 3GTJJ 3LFKA 3PO2J 2E36A 1FLIA 3G73A 2F6CA 1USTA 3OYKA 3OYAA 4RAYA 2QLZA 2XPWA 2LFBA 1OCCH 2LSOA 3ABTA 2IJLA 2TDXA 2E60A 3U2RA 3KIOA 3V7SA 4BYYA 3M8EA 1X2NA 5DEQA 2X0LA 4DGWB 2UUZA 4D1QA 4JYKA 3LSHA 1HXDA 2IW5A 4RB1A 5BNGA 2XSDC 2LVSA 4B4CA 3TL4X 1ZG3A 3HXLA 1MNEA 3TO7A 4AIKA 1RI7A 2LREA 1AWCA 1BIBA 3RDIA 1WI9A 2E34A 2YUSA 4BDZA 1SFXA 2YU3A 3AG2H 4CZCA 2NOJB 1TTYA 5FB2A 1SD4A 4H4KC 2K9MA 2JA5J 2IS6A 5CVRA 3IUOA 1J7KA 5EEGA 4HF2A 5KAIC 1AU7A 3BG5A 4A6EA 2E2IJ 3HSFA 1WHUA 1XG1A 3FXRA 1ETWA 2RQQA 3DU5A 5L3BA 1XMAA 3T1BA 4CCMA 5DCMA 1VQ8I 2IGNA 3VODA 2EV5A 1PUFA 3NWTA 4Y3OA 3O8GA 2V6CA 4AD9A 4BHCA 3DWLE 5F64A 2VE9A 1W7PA 4OWRB 2STWA 1VQPI 5K7ZA 3QPLA 4HF1A 5BS6A 2JT1A 4YG2F 4P9FA 3D5RC 2BZTA 2K9QA 2D5VA 1MBFA 4EJOA 5E18F 2WB1A 4XOPA 1PJRA 3V42A 4Y13A 3GLLA 2DOFA 3CJTB 3Q0VA 4XSZF 4OIRF 3QYEA 1YIOA 4S04A 1FOXA 3HGGA 3BCBA 2QBYB 3AL0C 1UELB 2CQKA 3JRDA 4Q5SF 3OR2C 2H6BA 3REOA 2P5LC 5EEHA 2CQQA 4WXHA 3I9V2 2DFIA 3MFKA 2L9VA 4UB6C 1V4RA 1YG2A 3KZYA 5FROA 4DJAA 3G71I 1ON2A 3K10A 1R4MB 2FJ1A 4XL9A 1KU9A 2J5OA 1WKMA 4YIIA 1J59A 2XSJC 4KDPA 2XAUA 4MTDA 1ENHA 2R7TA 1S7AA 2F5VA 3KYCB 3ELKA 5E3MA 3LSRA 3L2VA 2HU9A 4OINF 5J1RA 1ZLJA 2D1VA 2LRDA 4M71A 1HC8A 2JA2A 3HOVJ 3DU6A 3FWEA 2RNJA 1A5JA 4HV6A 2K4BA 1T95A 4EV0A 2O61A 4ENKA 1B9NA 2L3DA 2I10A 3L2QA 3FHNA 4Y7NJ 1R23A 2B63J 2R7DA 3L9FA 4XKWA 1LFUP 1ZGAA 3A0HC 3L7WA 4E7HA 3HPHA 4KMUX 1B59A 2M87A 3I0TA 3RI4A 4N4OB 3G4SI 4WXCA 2VT3A 2CV2A 1H9TA 3AG3H 2MLKA 1P7JA 2VQLA 2LNBA 2XDVA 2VJIA 1W36C 1TQIA 3GO5A 3TO9A 2A68F 2XHKA 3WTWC 2GIVA 3CCQI 2A07F 1YX3A 1BBYA 4LJZF 3I55I 5E3NA 3WTXC 1BIAA 1X1CA 3PNTA 3KETA 3H5NA 1E0EA 5GAEJ 4B3AA 1YS7A 5K7HA 2CSOA 1H0MA 1UMQA 1ZHFA 2LY2A 4LG3A 1U9OA 3JAMK 1IN8A 2CQ7A 4D5FA 5JHFA 1Y0UA 3KE2A 2M3AA 5ICGA 5TGTA 1LVKA 2QVOA 2L02A 5GTIC 6PAXA 4C2TA 1UG2A 4WWCA 3JTGA 2CMPA 4K2EA 3DBRB 2Q0OA 4AUXA 3E5XA 1SD5A 3D5SC 4L9TA 5HDKA 2BXYA 3G3ZA 2CV0A 5FKOA 3M4OJ 4LMYA 2E19A 4FHTA 2P6TA 2F5EA 3RYRA 2H8WA 3CC2I 2HQNA 2KZGA 4XN3A 4PGHA 3AKZA 1D5YA 1T33A 1AKHB 3J80Z 4WX9A 4I98B 2KRHA 1Z1DA 2ZO4A 2DXIA 4XORA 1IXCA 1TW3A 1DUXC 1ZK8A 2DOAA 1R9TJ 3G6EI 2DTRA 2WC2A 3C2BA 4Q4ZF 2OTLI 1YE9A 2PI0A 1IG7A 3CC7I 2EZHA 2XRLA 4XOTA 3I58A 1VQ5I 5HLGA 2PJRB 2WV1A 1OQYA 2GOXB 2FBIA 4BQAA 3ZQCA 5FLVA 3PL8A 3BR1A 3FX3A 2A6HF 2QEXI 2VBWA 1KGSA 4XRSG 4F7ZA 2DA2A 3K4NA 2CH0A 2NVQJ 3BDDA 3R0JA 2XROA 3EDPA 5LEJA 2RAEA 4CA0A 1X3WB 1QPMA 5EZHA 3J7YJ 3GTKJ 4IKFA 1E3HA 2P5KA 4FETA 1ZGJA 2A6EF 1EV7A 3CLOA 2DQRA 2JRMA 2M4GA 2KJBA 4LK0F 4Q47A 3ZCOA 2Q1ZB 1POGA 3HBLA 3OYFA 2Z2SB 1OCZH 3GTLJ 4AYBN 2VXZA 4ESFA 2XVCA 4A12A 3GFMA 1UAAA 2YS9A 4UV9A 2ME6A 1N25A 4JX5A 2K3FA 4G7OF 2WAEA 4EM2A 4CHUA 4M6VA 2O9LA 2PX9A 2EIMH 4LOCA 2LDUA 2HDWA 4O5VA 4U0WA 1FOYA 1X4OA 4A0YA 4IZZA 2ZSIB 5FLXK 3KP7A 3CDIA 1YX5A 3W2WA 1MNDA 2P5VA 2QKLB 2P6SA 3BTCA 1XCBA 4ZYDA 3HOXJ 3SXYA 2XC7A 3IRQA 3TEDA 3SHFA 2LBFA 3RQIA 1DU0A 5E20A 3WG9A 2KFDA 3KEOA 3JRGA 3FXOA 1IRXA 1B9MA 4RS8A 2HGCA 2HR3A 1HBXG 4GYGA 5DM7F 2R7XA 2DU9A 1YTYA 2FF4A 3H36A 4DYCA 4A3LJ 4A2UA 3K4MA 4HLYA 1EJ9A 3U21A 3VYRB 3ONQA 1EF4A 3R60A 3U1DA 5LGNA 3SFIA 2EV6A 3LSJA 3R0AA 4PCQA 4IOCF 1K79A 3ERED 4C2UA 3H92A 2WY8Q 3OSFA 2L7ZA 2Z1DA 3L2WA 2HXIA 4DYQA 4HW0A 2Y48A 1TT0A 2HEOA 3EUHC 3F8FA 1ETXA 5D4RA 3K2ZA 1BN5A 3WODF 2Z5UA 2XASA 3VYTB 3DXJF 1SAXA 1XSXA 3ASNH 5KK1A 3S2DJ 2KKOA 2VPRA 4D9JA 2Y0SN 4Y33A 1ZGWA 4BUPA 2EIKH 2JTVA 4DZJA 1YJ9I 1HKTA 4M9XA 2DMPA 2E5NA 2E1MC 2ZB9A 3I4NJ 3X2QH 1UHMA 2E7XA 3QQAA 4CICA 1JE8A 2GLOA 4IOAF 1OISA 2YX4A 3WTZA 3E6MA 2ETHA 4FX4A 2A6TA 2NVTJ 1IO2A 1ZRCA 1TNSA 2IT0A 2QM3A 2IRFG 2LH9A 1GHCA 4L0YB 5F27A 1HW1A 1LDDA 1XC5A 4KMFA 4PJ0C 4CCJA 4RAGA 2E71A 1IN6A 4ZC3A 1RETA 4WCGA 2X1CA 4M74A 5E79C 2DK5A 4XRSA 1O57A 5ICCA 5GAGJ 1XDSA 4BDYA 1WJCA 2NS0A 4CDGA 2K7LA 4A3CJ 2C6YA 2MD5A 2Y9YA 3OL3A 3VYUB 4A3DJ 1RC9A 3FIWA 5EG0A 3HOYJ 3HM5A 2KZVA 3OSGA 4NHJA 4WXDA 2NS8A 4BL0B 2L4MA 4XMYA 1SAUA 4Q48A 1FTZA 2VE8A 3ESWB 1Z7LA 4D7NA 3ZQ7A 1S72I 4A6DA 1D1CA 1MGTA 3LA3A 3NQOA 1FY7A 2ADUA 2Y75A 1FYMA 1X3ZB 1USSA 1KQ0A 1U5TC 2RDPA 4F3QA 3W2AA 1LE8A 5DDGA 4UUSB 4GO1A 2Y2ZA 3LNQA 3CUQC 4AIDA 3I4MJ 3MVPA 3WHCA 1DP3A 3KZZA 1I6HJ 2HQ5A 2GXBA 3CCLI 1JKQC 4FQGA 2KQRA 3OYBA 1ZRDA 3IL2A 2Z33A 2ESNA 2ZJRF 2FMYA 3CMEI 4RLQA 4MFEA 2Y0SA 2UXNA 4BQNA 1BJZA 1T98A 5AONA 2QSFX 3MQ0A 5DUKA 1PP7U 2K3PA 3BR5A 3KP2A 4S05A 1F5TA 4KFCA 2V9KA 1JT6A 3HHGA 1H9GA 3BT9A 5KHDA 4QLCU 1BR4A 3V7CA 3G1LA 4IHYA 2H6CA 2BVMA 4OOIA 2KISA 3OYEA 2LKPA 4UB8C 4MQVA 4DBQA 1ZG1A 5GPCA 1YS6A 2WV0A 3TKYA 3LA7A 5M5WJ 2OPTA 3DV8A 2GM4A 4PSWA 1XGSA 3CCUI 3KFWX 2HNHA 2JJ7A 1OMIA 5FO5A 4M9ZA 1YRNB 4A93J 2KRFA 1U0JA 1JI8A 3CCEI 2DO7A 1PUEE 4HYEA 5F1RA 2P0WA 4HDUA 2R7QA 1Z9CA 2BXZA 4HAMA 1S29A 2KPMA 2M9HA 4CH7A 2BYVE 1MD0A 1L3LA 2CG4A 1B4AA 1QZZA 2DN0A 2MG4A 2W85A 4B47A 3FXMA 1DQUA 4RGRA 5B3SH 3LSMA 1QRYA 3E7LA 4B8XA 2FE3A 1IRFA 4LLLA 1IN7A 3BJ6A 4PJJA 2LD5A 1JKOC 3ULQB 1BR2A 4M3FA 3OIQA 3RZDJ 2KLOA 2P4WA 4J19A 4A5MA 4D7MA 3V8KA 1K78A 3S2WA 2VJJA 2KIUA 1A36A 5GP9A 4Y15A 2XGDA 3DKWA 4G12A 3LA2A 2V9VA 1MMSA 3LSTA 2JVHA 1GDTA 1LEAA 2A5WA 4E7IA 3T5XA 1FYKA 3VDXA 2EFQA 5DM6F 3AL0B 3LSIA 1W4MA 1KYZA 4BACA 4QPQA 5IYDJ 4PJMA 4XLEA 1F1ZA 2F48A 3ZMVA 2P81A 4I01A 2P8TA 2AXTC 2KDZA 1JUMA 1HW5A 3HUGB 4X1EA 2CQXA 5ERIA 2ISYA 4E4HA 1XN7A 3K4KA 1U8RA 3T0YA 5BPDA 3MZHA 5IOYA 4G6QA 2JWTA 3TW7A 2W48A 5H6RA 1XMXA 2ZMEC 1QPIA 1PDNC 4ZJZA 1R36A 1U2WA 1D0ZA 1FPQA 1P9QC 2VASA 4IHWA 4JK1X 2CWEA 3FXQA 3ZMDA 1FMVA 2VB6A 4KT5C 2QUFA 1FSEA 1D1AA 3PFYA 1E17A 5EGOB 4M3BA 5LRSA 4BE1A 2CRGA 3DTKA 3ZPLA 1MJAA 3FF5A 4II2A 4MNUA 4WF2A 2E7WA 4R1HA 2R3SA 3W6VA 5C3EJ 2ZSHB 2BW3B 4FTHA 2FNPA 2V1DA 4KITB 5D5UB 2HKOA 3ABLH 1GLNA 2M34A 2V26A 2QENA 3SZPA 4MO7A 1S7OA 2OJED 2AQFA 3C7JA 4IRHA 3OIOA 2DJIA 3IC7A 2TCTA 1S5LC 2DOEA 1MH4A 2MC3A 2HWVA 2EFOA 3LAJA 1R1TA 2RNGA 4AWXB 1T8IA 1L0OC 4IQ4A 2G0EA 3RPQA 3GLXA 1O3QA 1YYVA 2EZIA 3OL4A 3GTGJ 4EVIA 2OV7A 4FE4A 3S3NA 4Y17A 1WJFA 4Z2YA 4HPQA 2CO5A 5DTDA 1FYLA 3ECOA 1JXSA 2X9DA 2R7SA 4WK8F 3RSNA 1QA6A 5H6QA 3ZQFA 1DGRM 4CUGA 3W2VA 3FISA 2FD5A 3DEUA 1KONA 4BJ5C 2M7BA 2ME0A 1RKTA 4UHTA 1LQ1A 5H20A 1U9NA 5KAFC 2W4SA 3UNGC 5C4XJ 1OPCA 3GZ5A 4G8XA 4UVAA 5H2FC 1R7JA 3FKJA 2IEKA 4ZDPA 3RCOA 2RV8A 2OD5A 2QBYA 3LL7A 2D45A 3CCYA 3K70C 3QODA 3ZR8X 1R1VA 2KJCA 3J80K 3JRCA 2F5DA 5ILVA 5JVGF 5FRMA 1WRJA 3N05A 1Q1HA 3PM1A 3UR3C 3PUBA 1SEUA 1K4TA 3DBHB 1FC3A 3ASOH 4KUMA 2QQ8A 4UUVA 1H8AC 4XKBA 3HYIA 1OYIA 2IAIA 3QP5A 2QYOA 2MH9A 4XM3A 3H0GJ 3QU6A 3VOEA 1WZ2A 3IH2A 3QYBA 1G6NA 3OOUA 1G4DA 4LIVA 1YLFA 5FKMA 2E2JJ 3L2RA 2ZFWA 2HOAA 1FEXA 2ZJQF 5CVIA 3DP7A 3CJQB 4X6AJ 5HODA 1TT5B 4W97A 2FRHA 9ANTA 2JA6J 1CF7B 1UHSA 4BXXJ 1V54H 5HS7A 2LR8A 5JR3A 4OAYA 4LG0B 4BBSJ 4CYDA 5K7FA 5LEKA 1Z3XA 4F52A 2O3FA 2WB1N 2RKHA 4B48A 3M1CA 3Q9SA 3IAM2 3A1YA 1ZLKA 5IT9Z 5HNFA 1ZR4A 3PIOF 3F8CA 3P9KA 1LNWA 3KP3A 4BY1J 2ELKA 3CCSI 4DNCA 2K85A 4HLXA 3PSFA 3CLQA 2XUBA 5J40A 2FNAA 2Y30A 2RQPA 3I5UA 2CW0F 4JX6A 4PGGA 5LHGA 3WTYC 2X6YA 4V2FA 1VNDA 3R6SA 5TJJA 2BY2A 4ZYHA 1ZAOA 1FWZA 2LC2A 4BQQA 3HTUA 3CF5F 1BI0A 2L9RA 5ED4A 3SFZA 2W57A 2DT6A 2X4HA 2E1NA 1MW7A 3EUAA 2HPIA 3AG4H 3J81Z 2DPDA 3WU2C 1GVJA 3TW6A 3MKWB 3KEQA 4RAZA 5EZGA 2IA2A 1LJ9A 1HQCA 4ITVA 2HOSA 2JUGA 3L09A 5J47A 2R93J 1OCOH 4FX0A 2V4JC 2HDDA 4KISA 4EJTA 2FXAA 2MH2A 3E5UA 2ECCA 4IEJA 3S3OA 1AKHA 2ZCWA 1MJ9A 3GFIA 4RDUA 5HLTA 3P7NA 2XAJA 2NRAC 1MDMB 3SZTA 2HOTA 1Z7UA 2VXDA 3COAC 4AIJA 1HLVA 1SVLA 3FK6A 2R5ZB 2PJRA 5J4YA 2XPVA 2WAFA 4DQ2A 3KYLA 3HL2A 1HSTA 3MAJA 5DD4A 4ANJA 2R7VA 4BH9A 2E1MB 2IGOA 4GYIA 4XIDA 4A3JJ 4GDFA 1DPRA 2H1LA 5E1XA 2O5RA 1TL8A 2LF7A 3HHHA 5E3OA 4RMNA 1LFPA 2K5CA 3IHUA 1QNTA 2DFHA 4M73A 4HV5A 3F72A 3Q0WA 1Y8QB 4G6TB 3LSKA 2F4IA 2ID3A 3GWZA 5CVVA 2VQHA 3GUDA 1IV8A 3HG9A 1KYWA 1OR7C 1F9NA 2W00A 5LLQA 3DLLF 3Q9VA 4H0EA 5LD2C 1LPQA 3QOEA 4G6DA 3H0DA 2HYGD 1G3WA 2JPCA 3ZQHA 1IAWA 3ZGKA 1A35A 1IZ1A 4P55A 5DUIA 1R5GA 3HIFA 4EEFG 3RPUD 1TWGJ 1T0FC 2MBFA 2QKMB 2CUFA 3IH3A 1GV5A 1U5TB 3OYJA 3VFZA 1WGXA 3CUQB 2CGPA 4IHVA 2L7KA 3CZ6A 3SJMA 5HS8A 4B44A 1I27A 2EQRA 1MMGA 4U7BA 1CQTA 4A3MJ 5FLMJ 1IRGA 4XRMA 4HA8A 1JJ8C 2DMTA 2VODA 2WTEA 1UB9A 3ZP5A 2ZC2A 1B6AA 1EH8A 2EFWA 2DTZA 3BQZA 4DZPA 3ZN1A 4NC7A 1QBJA 2OTJI 3ZMTA 3GZNB 1W0TA 3CESA 3JR9A 2R92J 2VKVA 3S93A 4HNTA 4PK4A 5D6EA 2YX7A 3GTMJ 2HOEA 3DKXA 1SFKA 4W1UA 3EUKL 1Y1WJ 2XF5A 4CCOA 1S9HA 4ESJA 1QZEA 3H9JA 3HKZN 5CQGA 1X58A 3K9TA 2G7HA 2V7FA 3ZQIA 1WJEA 1E2XA 4ZZLA 4QIWN 3TBIA 3LQQA 3F6VA 1Z6RA 1U6GA 3TGNA 2CW8A 4RA2A 4XLHA 4IRIA 4OU0A 1B72A 4JP0A 2FQ3A 5F0HA 3D0SA 3DEEA 3KX2A 5L3CA 5TISC 1T6SA 2M8EA 5B1AH 3S1RJ 1BJAA 2VQGA 3HSEA 3JRHA 4M3GA 2FBHA 1QU3A 1UG0A 3FHZA 4JX4A 3FM5A 4QTRA 2AS5F 4HZFA 4IHTA 2QQAA 4B1RA 2E1OA 2ZXJA 3BC8A 1CGPA 4G94A 2FMLA 4ENNA 5IP7J 3I64A 2EH3A 1HW2A 2ELHA 3CD6I 1UCRA 3V7RA 2BEOA 2IVMA 3I53A 1U3EM 1ZN2A 3E6DA 4DW6A 3A01B 2IXSA 4DYRA 1JHHA 1TWFJ 3CUOA 4N9HA 2M30A 3P5JA 5FKNA 2MLGA 3FZVA 1OYYA 1RZ4A 2QWWA 4YRVA 4MLOA 3M8JA 4OIOF 1TZLA 4C3HJ 3BPVA 2FOKA 2X51A 4EGYA 2K4JA 2A61A 3OS1A 2HYJA 4RB3C 2VPLA 3KCCA 1MMAA 4U88A 1GXPA 3HKZA 2XGCA 3OYGA 2MD0A 1MBEA 1IGNA 3DQVC 2MYSA 5FFXA 2ZXIA 1HF0A 4UUSA 2E2HJ 5M3FJ 3JREA 3MZ8A 3M07A 3HZJA 1BM9A 3WE2A 3UKGA 5HLHA 2ZMEB 4HX8A 2ELJA 1JTYA 3HSRA 4HBLA 1U78A 2MC4A 1YITI 3MZYA 4I0BA 1YJNI 2X1EA 1XGOA 1HCRA 4L5JA 2CJJA 1BI2A 2V9PA 4ABZA 4P9UA 4IXAA 2ZXWH 3IKVA 2CW7A 2Y0MA 3HOSA 4I76A 2XGEA 4EM0B 4ZTJA 2VKDA 5IYBJ 3CJRB 3HC7A 2PBIA 5KVRA 5K1YA 3JRFA 2QSHX 1WSUA 3J7AY 2VKEA 1RNLA 3C2HA 1Y56A 3BR2A 4M6XA 2GZWA 3F8NA 1AHDP 1FBSA 4UUTA 3PNYA 4OAZA 3A02A 3F3XA 3H5RA 1VQNI 2FOWA 3HGYA 1JKRC 5ICEA 2BV6A 4LK1F 2VIXA 1YRNA 1ITYA 4XLPF 5J3LA 1PYVA 3M7GA 2IGKA 2JMWA 2LMDA 2E35A 3IH4A 2YSRA 1W5TA 2EA2A 2JVGA 1N75A 3I71A 3BQYA 3VSLA 5FJ8J 2WAQN 2IP2A 1LB2A 4KJZA 2DDAA 1VQLI 2QZ8A 2K9LA 2VJ4A 1P4AA 2UXXA 3PUFA 4LLGF 1DPUA 4FT8A 1B72B 3ABUA 2HVSA 2RREA 3H9GA 2Y69H 3TOAA 2Q2EB 1R5ID 2VLAA 4G7HF 3K7AJ 4GXOA 4M9SA 3VSKA 4N9IA 2PG4A 2QF7A 3NARA 1Y39A 1YIJI 2GA1A 1VF9A 3ZQLA 5GAHJ 2WADA 3HRSA 1IN5A 2NOGA 4AU7A 2QSGX 1SMYF 3GW2A 3WGHA 3W6JB 1SVOA 1WH5A 3ABMH 4IHSA 2VONA 1SANA 1PP8F 3CC4I 2JRTA 2K86A 3BR6A 4XLNF 5CVUA 5LHIA 1WQ2A 1ZELA 5JI6A 3U9GA 1TLHB 1V5GA 1ZKGA 2DA3A 3GMEA 2NNYA 2G9WA 1IV6A 3H9QA 2YU9J 1I3QJ 1S3JA 3QAHA 1FP2A 4LB5A 3OMYA 1XDUA 4F93B 3BZCA 3HUGA 3QPTA 1ULYA 4CCNA 2PFBA 3ECHA 3KP4A 5JVTA 1OFCX 3HPGA 1IW7F 3JSPA 1TQPA 1EA3A 2DDBA 2XAHA 4IQJA 1OLTA 2N8GA 1VQOI 2K27A 2MSYA 2B0LA 1VQMI 3OYDA 2DMUA 3GBGA 1Y8RB 4R8HA 2IPQX 3I4PA 3ROUA 1HDDC 1FZPB 3S16J 3R4KA 2R4GA 1I1SA 2WAQA 2NYXA 2W25A 4BU2A 3S32A 1T56A 5J1UA 1YJWI 5EGOA 2DLLA 1H88C 1WPKA 2UWMA 3WHBA 5BMZA 1P92A 4HX4A 3GYHX 3HOTA 2HTJA 3CO6C 2EPFA 2HVQA 1OJLA 4LGWA 4GRIA 4FE7A 4HG2A 1SFOJ 1KU3A 3JCUC 3NAUA 2BW3A 3K69A 2XB5A 2XGXA 2OQRA 5FKKA 2L9SA 5BOXA 1ERDA 3ABKH 3EPZA 2EINH 4M3EA 3QOPA 5IT9K 1V5FA 5FFZA 3G1OA 3P9IA 4BAYA 2FSWA 3M9AA 3E6BA 1RRJA 2L01A 1O3TA 1Z77A 1ZH5A 1V55H 3CDLA 5J4VA 5EF6A 5DV5A 1LKXA 1GXQA 5CQEA 2CFXA 5CYVA 2DA6A 1MMDA 1B8IB 3M3YJ 5D8KB 2OZ6A 1D5VA 4L9NA 3J7AO 1IUYA 5A2QZ 3J81K 1Z0XA 3MWMA 5C44J 2HDCA 1I3AA 4KT6A 4L18B 4XONA 2QQ9A 3HRUA 5FD6A 2EV0A 5CLSA 5L3GA 2R0QC 3WGIA 1YOVB 4RM3A 3FXUA 2F5FA 3OYMA 3TDUC 2HS5A 3LOCA 1X1PA 3KEYA 4HOBA 1MBHA 2D1HA 1ONVA 1OCPA 1W7PD 1BC8C 2LYCA 3MMYB 3CJNA 3TQNA 5E8GA 2LG4A 2EZKA 2BHYA 1X3UA 3G1MA 2JA7J 3VPRA 2PMZN 2QCOA 1T39A 3S1QJ 4ZZDA 1KA8A 3QRFF 2PEXA 4HNUA 5HNHA 2NVYJ 4BE2A 4P1WA 2IBDA 3KZIC 2A5YB 1MSFC 5LBQA 3KLOA 4RGUA 4ASNA 2VN2A 1MZBA 2K9NA 2DFFA 3W6KB 1YO5C 2CU7A 3GF2A 5E17F 3FDYA 1IDYA 2CS3A 3QYFA 2VT2A 4V19K 1ETOA 3JW4A 5ICFA 2LK2A 3Q0UA 1CF7A 1R1UA 4D0PA 4J01A 2HTSA 1O7LA 2O6GE 4LG0A 1KU2A 5JLWA 2OC6A 3LSGA 1X4PA 3A0BC 4N4NB 2HPMA 2AXLA 4AM3A 3DLAA 1OCRH 1IDZA 1Q1VA 3IWZA 3CCRI 1VFCA 3G2BA 2K02A 1G2HA 1TBXA 1DP7P 4ZYEA 1NK3P 4XLFA 2LY1A 2UV1A 5DS9A 3BY6A 4RB0A 1G3TA 3BPXA 2LKSA 3HRTA 3TOBA 2DA4A 3ERMA 3GCMA 4KN4X 3I3LA 1BOBA 1KQ8A 4XKCA 5FKLA 1IXRC 2X6OA 3FK7A 2M5WA 2GBYA 2L0KA 4E7ZA 1ZTRA 1V5EA 2DJNA 2VC1A 2X1DA 2EJRA 3OOPA 5LGTA 2DA1A 5F0CA 1ZARA 2CUZA 2PMZA 1R49A 2XAFA 5FGMA 2R7OA 1NG6A 2V1UA 4JBAA 2EBIA 1TWHJ 1UFMA 3FBNB 3OYCA 3EUHA 3Q5FA 2WA0A 2O8KA 4OIQF 1AOYA 3WU0A 4IF4A 1BI1A 1KU7A 2BY1A 2Z9OA 1T2KA 1MDMA 4I09A 3RKQA 1YW8A 5BPIA 1XMKA 3IRRA 5CPRB 4I99C 1TW2A 4N0BA 2JSPA 2ZKZA 4I7HA 2R5ZA 2LKXA 1G3SA 2KDOA 4QPOA 3BCAA 3CCMI 4DIQA 3HTSB 4BY7J 4O3MA 2I5UA 3E6CC 2B9SA 3OWTA 4BGDA 5D5XB 4BXFA 3F8BA 1Z6TA 4RGSA 4GCVA 2HZTA 2DK8A 1LVAA 4HX7A 1H89C 1BC7C 3S17J 1TWCJ 2BBYA 2LTPA 1JHFA 4O6JA 1RUOA 3E1SA 1GT0C 3CMYA 4G7ZF 3A03A 4LFUA 2W7NA 4B09A 4GGGA 4HRIA 2HQAA 2COBA 3K6GA 1IF1A 5LGUA 2HKXA 2V79A 5HDNA 1I1GA 3JRAA 1TNTA 4L5EA 2CQNA 1E3PA 1W1WE 2L7MP 4M6YA 5D8LB 4CCLA 2P7CB 2F4MB 3FKIJ 2GXGA 4BXUA 3RTRA 2MGQA 2RC4A 4UY8I 4Y4RA 1U5TA 4QSHA 2JPBA 2VBYA 2EILH 3K4BA 1SFEA 1ORKA 3CUQA 4IVNA 4UVBA 5J6XA 3WTSC 1I39A 2FEZA 2HXOA 3D5LA 5IYCJ 1SFUA 4L9JA 4HF0A 4MGRA 3BR3A 1ZR2A 2O8XA 1G8XA 2DMQA 3NEUA 2FX0A 4Y52J 5J8CA 3B73A 4NQWB 1IJWC 2BY3A 2R5YB 1QHHD
chains in the Genus database with same CATH topology
4HQMA 5E8IA 4ZYGA 4BHBA 2JSCA 1ON1A 3KP5A 1I6XA 5ILSA 5J8FA 2E1CA 2A3SA 4KICA 2XAGA 3QP6A 1RIOH 2HQRA 3GVAA 2OBPA 4U0VA 2RGVA 2F2EA 3RYPA 1YW9A 3EYIA 4R79A 2J5PA 5DYMA 3EQLF 3K1MA 1P4WA 1A04A 3RKWA 3LWFA 1D3YA 4UNOA 1HKSA 4ZH4F 1MJBA 1XSVA 2UZKA 1W5SA 3BP8A 4MEXF 3ISPA 3GEZA 3MCZA 1YFHA 2XKPA 1LDKB 5TRDA 2DPUA 1ZRFA 3K1PA 3T8RA 4EQQA 4RB2C 1BI3A 1REPC 1XGMA 5ILUA 3LQRA 1S8NA 1LEBA 1P2FA 5L3EA 4OMZA 1KQ9A 3RIRA 3ML6A 1FBUA 3I59B 1FSHA 4YFNF 2ZMEA 2FBKA 3K1NA 4I02A 1K6OA 4A5NA 3TO6A 1R00A 3JTHA 4PDKA 4ENJA 3VEPA 2GA2A 4A0XA 1ZREA 2G7UA 5FD5A 3GX4X 2O0YA 5HDGA 1FOKA 2LF8A 4IJAA 3FMSA 3PQKA 1JGSA 4RGXA 1HSJA 1FNNA 2PLYA 1FBQA 3GFLA 3LAPA 3O6BB 4YIFA 3O2PE 5D4SA 4ESBA 3QU3A 3ZMZA 4G9YA 3WU1B 4ETSA 3NRVA 3FMRA 4KN7X 2ZNYA 3L00A 1QGPA 2R7FA 3PQJA 2Q2EA 1XCVA 1F4KA 3ZN0A 4UVCA 5A2QK 3EETA 1MKMA 1QZYA 3C1DA 1O3RA 1O3SA 1P6RA 4OIPF 1P4XA 3GZ6A 2EK5A 2OU2A 5DCMB 2NAZA 2DT5A 1NHAA 4E70A 2EA4A 1W7PB 4EGZA 3AAFA 1ZG5A 1R58A 2VC0A 1RUNA 5DD8A 2KIMA 1XGNA 4AVPA 5BQTA 4LLNA 3C18A 1SD7A 4L0ZB 2EFNA 1OKRA 4CO8A 1J0RA 4MTEA 1YQAA 2ACJA 4UXNA 1C0WA 2Z99A 1ZYRF 2F5CA 5HVQC 2PQ8A 3TDZC 5LHHA 5CJ9A 4P5OA 3DPLC 3V8JA 4LB6B 3B02A 1FT9A 2ESHA 2GWRA 3DFGA 2W24A 3V8LA 3BZ6A 5L3DA 3RKYA 1T38A 4YFXF 2OQGA 2H09A 2DW4A 4JQFA 1QO0D 5JFRA 3K0LA 4UV8A 1XD7A 4KA4A 1UHWA 1G3YA 4XBFA 1EH7A 3PFIA 2ZBKA 2M1BA 3FMQA 4QWQA 1VTNC 2QQBA 1DDNA 1OYWA 3IWFA 3BJAA 5E1ZB 2P7VB 3DPTA 1YW7A 2FA5A 1BOAA 5K5OA 2EFPA 1ODDA 5D6FA 3C3WA 3MEXA 1D8JA 3FM3A 2DAOA 3BROA 4MEYF 1J75A 1OR7A 2Q8KA 2V1XA 3T8TA 1FP1D 2DQLA 2W84A 5K5QA 1T0FA 3F8MA 3QPHA 2OAZA 3BOQA 2H94A 1FX7A 1SD6A 3RPUA 1D8KA 3WTUC 2L4AA 2IA0A 4U7DA 3E97A 5IT3A 3JSOA 4IPAA 3F23A 1B1BA 2RVCA 3KLNA 4IRGA 5HLIA 3KP6A 4LD5A 2PJPA 2STTA 2VBZA 3OV8A 4AIHA 3ZMUA 4KIFA 4TV7A 3JAMZ 2BE5F 4KIGA 2XV4S 3BWGA 1K7AA 4BNCA 4MHGA 3I54A 4KYWA 1S6LA 2ISZA 1IXSB 4NB5A 2CYYA 3F22A 5JHUA 2GAUA 3WGGA 4ON0A 2HFHA 5LRRA 3N97A 1R5HA 4YFKF 2XIGA 3CTAA 4OMYA 3R61A 3H3ZA 5K5RA 1WWXA 3L2CA 1Z91A 4HDVA 3F6OA 4KIBA 4EMSA 2NNNA 4I0AA 4XRFA 3VB2A 2COMA 5D5WB 2L54A 4CGZA 3O3KA 2M45A 3RKXA 2XAQA 2OZUA 1TQMA 3CDHA 2BGCA 4ENMA 3E3VA 2XKOA 4BHPA 1HKQA 3V4GA 1R22A 1XB4A 4NQWA 1O7FA 3N4MA 5L3FA 4L5IA 1QQIA 3BJOA 5FLXZ 2RN7A 1XSDA 1J5YA 1EH6A 2GQQA 1STZA 2DBBA 3DF8A 5F6FA 2IA1A 5AIQA 2VOOA 2EB7A 2H27A 1V3FA 1J9IA 1SMTA 3WE3A 5CVJA 2ZJ2A 3WTTC 2KIFA 4CZZA 4L9VA 2PMUA 2FU4A 2A69F 4U0YA 2XRNA 5D5VB 1IN4A 3EYYA 1I5ZA 2DI3A 2MA3A 2PN6A 2O03A 4P96A 4EJVA 3SQNA 3ZMSA 3IKTA 4M72A 5HOOA 4EJUA 3CO7C 4EJWA 3HRMA 2EWNA 3RJPA 3E5QA 5DCFA 2HYFA 2PMHA 4CXFA 3M1EA 2YPRA 3H3UA 2ZNZA 2OA4A 2VOPA 4PZJA 5AIPA 2WWYA 1LDJA 1K78B 4MQ9F 5HS9A 4XSXF 3I59A 2JZYA 3GXOA 2YR2A 3F21A 4I2OA 2Z3YA 3GFJA 1Z05A 2D2WA 3M8FA 4A0ZA 4HQEA 4KNYA 1J2XA 4EM1A 3P9CA 3WTVC 2VBXA 3LFKA 1FLIA 3G73A 1USTA 4RAYA 2QLZA 2LSOA 3ABTA 2IJLA 2TDXA 3U2RA 3V7SA 4BYYA 3M8EA 5DEQA 2X0LA 1HXDA 2IW5A 4RB1A 1ZG3A 3TO7A 4AIKA 1RI7A 1AWCA 1BIBA 3RDIA 1WI9A 1SFXA 2YU3A 1TTYA 5FB2A 1SD4A 5CVRA 1J7KA 5EEGA 4HF2A 4A6EA 3HSFA 3FXRA 5L3BA 1XMAA 3T1BA 5DCMA 3VODA 2EV5A 2V6CA 4AD9A 4BHCA 5F64A 2VE9A 1W7PA 2STWA 4HF1A 5BS6A 2JT1A 4YG2F 4P9FA 4EJOA 5E18F 4Y13A 4XSZF 4OIRF 1YIOA 4S04A 2QBYB 2CQKA 4Q5SF 3REOA 2H6BA 2P5LC 5EEHA 4WXHA 2DFIA 3MFKA 1V4RA 1YG2A 3KZYA 1ON2A 4YIIA 1KU9A 2J5OA 1WKMA 1J59A 4KDPA 4MTDA 1S7AA 3ELKA 4OINF 1ZLJA 2D1VA 4M71A 3FWEA 2RNJA 4HV6A 2K4BA 4EV0A 2O61A 4ENKA 1B9NA 2L3DA 1R23A 2R7DA 3L9FA 1ZGAA 3L7WA 4KMUX 1B59A 2M87A 3I0TA 3RI4A 4WXCA 2VT3A 1H9TA 2MLKA 2LNBA 1TQIA 3GO5A 3TO9A 2A68F 2XHKA 3WTWC 2GIVA 2A07F 1BBYA 4LJZF 3WTXC 1BIAA 3KETA 1YS7A 2CSOA 1H0MA 1ZHFA 3JAMK 1IN8A 1Y0UA 3KE2A 5ICGA 2QVOA 2L02A 6PAXA 4WWCA 3JTGA 4K2EA 2Q0OA 3E5XA 1SD5A 4L9TA 5HDKA 3G3ZA 4LMYA 4FHTA 2P6TA 2F5EA 3RYRA 2HQNA 4PGHA 3J80Z 4WX9A 4I98B 1Z1DA 2ZO4A 1IXCA 1TW3A 1DUXC 2DTRA 2WC2A 4Q4ZF 2PI0A 3I58A 5HLGA 2FBIA 4BQAA 3FX3A 2A6HF 2VBWA 1KGSA 4F7ZA 3BDDA 3R0JA 2XROA 3EDPA 5LEJA 1QPMA 2P5KA 5E1WA 4RAZA 1ZGJA 2A6EF 1EV7A 2DQRA 3CLOA 2KJBA 4LK0F 4Q47A 2VXZA 4ESFA 2XVCA 4A12A 3GFMA 4UV9A 4G7OF 4EM2A 4CHUA 2LDUA 4O5VA 4U0WA 4A0YA 5FLXK 3KP7A 2P5VA 2P6SA 1XCBA 4ZYDA 3SXYA 3IRQA 3SHFA 5E20A 3WG9A 3KEOA 1B9MA 4RS8A 2HGCA 2HR3A 1HBXG 4GYGA 2DU9A 1YTYA 2FF4A 4A2UA 4HLYA 3R60A 3U1DA 5LGNA 2EV6A 3R0AA 4PCQA 1K79A 3ERED 3H92A 2HEOA 4HW0A 2Y48A 3F8FA 5D4RA 3K2ZA 1BN5A 3WODF 2Z5UA 2XASA 3DXJF 1SAXA 1XSXA 5KK1A 2KKOA 2JTVA 1HKTA 4M9XA 1UHMA 2E7XA 4CICA 1JE8A 3WTZA 2YX4A 3E6MA 2ETHA 4FX4A 1ZRCA 1TNSA 2IT0A 2QM3A 2IRFG 1GHCA 4L0YB 4KMFA 1HW1A 1LDDA 1IN6A 4WCGA 4M74A 2DK5A 1O57A 5ICCA 1XDSA 2NS0A 4CDGA 2K7LA 2C6YA 2MD5A 4NHJA 4WXDA 2L4MA 4Q48A 2VE8A 3ZQ7A 4A6DA 1MGTA 3LA3A 3NQOA 1FY7A 2ADUA 2Y75A 1FYMA 1USSA 1KQ0A 1U5TC 2RDPA 5DDGA 4GO1A 3CUQC 3KZZA 2GXBA 1ZRDA 3IL2A 2Z33A 2ESNA 2FMYA 2UXNA 1T98A 5AONA 3MQ0A 5DUKA 1PP7U 1F5TA 3KP2A 4S05A 4KFCA 3HHGA 1H9GA 4QLCU 3V7CA 2H6CA 4OOIA 2LKPA 4MQVA 1ZG1A 1YS6A 2WV0A 3TKYA 3LA7A 3DV8A 1XGSA 3KFWX 1OMIA 5FO5A 4M9ZA 2KRFA 2DO7A 1PUEE 4HYEA 5F1RA 4HDUA 1Z9CA 4HAMA 1S29A 2BYVE 1MD0A 1L3LA 2CG4A 1B4AA 1QZZA 2W85A 4RGRA 4B8XA 2FE3A 1IRFA 4LLLA 1IN7A 3BJ6A 3ULQB 2P4WA 4A5MA 3V8KA 1K78A 3S2WA 2KIUA 4Y15A 3DKWA 3LA2A 2V9VA 3LSTA 1LEAA 3T5XA 1FYKA 2EFQA 1W4MA 1KYZA 1F1ZA 3ZMVA 4I01A 2P8TA 1HW5A 5ERIA 2ISYA 1XN7A 1U8RA 3T0YA 5BPDA 3MZHA 4G6QA 5H6RA 1PDNC 1R36A 1U2WA 1FPQA 4JK1X 2CWEA 3FXQA 3ZMDA 4KT5C 2QUFA 1FSEA 1E17A 5LRSA 3ZPLA 1MJAA 3FF5A 4MNUA 4WF2A 2E7WA 4R1HA 2R3SA 2FNPA 2V1DA 5D5UB 2HKOA 2QENA 3SZPA 1S7OA 3C7JA 4IRHA 3IC7A 2MC3A 2HWVA 3LAJA 2EFOA 1R1TA 4AWXB 1L0OC 3RPQA 3GLXA 1O3QA 1YYVA 4EVIA 4Y17A 4Z2YA 2CO5A 1FYLA 3ECOA 1JXSA 4WK8F 5H6QA 3DEUA 4UHTA 1LQ1A 5H20A 1OPCA 3GZ5A 4G8XA 4UVAA 1R7JA 2RV8A 2OD5A 2QBYA 2D45A 1R1VA 2KJCA 3J80K 2F5DA 5ILVA 1WRJA 1Q1HA 1FC3A 4KUMA 4UUVA 3HYIA 1OYIA 3QP5A 2QYOA 2MH9A 3QU6A 3VOEA 1G6NA 1G4DA 1YLFA 2ZFWA 5CVIA 3DP7A 2FRHA 1CF7B 5HS7A 5JR3A 4LG0B 4CYDA 5LEKA 2O3FA 2RKHA 3Q9SA 1ZLKA 5IT9Z 3F8CA 3P9KA 1LNWA 3KP3A 4DNCA 4HLXA 2XUBA 2FNAA 2RQPA 3I5UA 2CW0F 4PGGA 5LHGA 3WTYC 3R6SA 5TJJA 4ZYHA 1ZAOA 1FWZA 3HTUA 1BI0A 5ED4A 3SFZA 2W57A 2X4HA 2E1NA 3J81Z 2DPDA 1GVJA 3KEQA 2IA2A 1LJ9A 1HQCA 3L09A 4FX0A 4EJTA 2FXAA 2MH2A 3E5UA 2ZCWA 1MJ9A 3GFIA 3P7NA 2XAJA 2NRAC 1MDMB 3SZTA 1Z7UA 3COAC 4AIJA 4DQ2A 1HSTA 3MAJA 5DD4A 4BH9A 4GYIA 1DPRA 5E1XA 2LF7A 3HHHA 3IHUA 1QNTA 4M73A 4HV5A 3F72A 3GWZA 5CVVA 3GUDA 1KYWA 1F9NA 5LLQA 3Q9VA 4H0EA 4G6DA 2HYGD 1G3WA 2JPCA 1IAWA 1IZ1A 4P55A 5DUIA 1R5GA 3HIFA 2MBFA 1U5TB 3VFZA 3CUQB 2CGPA 5HS8A 1I27A 4U7BA 1IRGA 4HA8A 2VODA 2WTEA 1UB9A 3ZP5A 1B6AA 1EH8A 2EFWA 3ZN1A 1QBJA 3ZMTA 5D6EA 2YX7A 2HOEA 4ESJA 3K9TA 2G7HA 1E2XA 4ZZLA 3LQQA 3F6VA 1Z6RA 1U6GA 3TGNA 4IRIA 4OU0A 2FQ3A 3D0SA 5L3CA 1T6SA 2M8EA 1BJAA 3HSEA 2FBHA 3FHZA 3FM5A 2AS5F 4HZFA 4IHTA 2QQAA 2ZXJA 1CGPA 4G94A 2FMLA 4ENNA 1HW2A 3I64A 2ELHA 1UCRA 3V7RA 2BEOA 2IVMA 3I53A 1U3EM 1ZN2A 3E6DA 1JHHA 3CUOA 4N9HA 2M30A 2MLGA 3FZVA 1OYYA 1RZ4A 2QWWA 4OIOF 3BPVA 2FOKA 4EGYA 2K4JA 2A61A 4RB3C 3KCCA 4U88A 1GXPA 3DQVC 5FFXA 3WE2A 1BM9A 5HLHA 2ZMEB 4HX8A 3HSRA 4HBLA 1U78A 3MZYA 4I0BA 1XGOA 4L5JA 1BI2A 4P9UA 4IXAA 3IKVA 2Y0MA 3HOSA 4EM0B 2PBIA 5KVRA 5K1YA 1WSUA 1RNLA 4M6XA 2GZWA 3F8NA 1FBSA 3F3XA 5ICEA 2BV6A 4LK1F 4XLPF 3M7GA 2YSRA 1W5TA 2EA2A 3I71A 2IP2A 1LB2A 2QZ8A 1P4AA 2UXXA 4LLGF 1DPUA 4FT8A 3ABUA 3TOAA 4G7HF 4GXOA 4M9SA 4N9IA 2PG4A 2GA1A 3HRSA 1IN5A 1SMYF 3GW2A 3WGHA 3W6JB 4IHSA 2VONA 1PP8F 2JRTA 2K86A 4XLNF 5CVUA 5LHIA 1WQ2A 5JI6A 3U9GA 1TLHB 2NNYA 2G9WA 1S3JA 3QAHA 1FP2A 4LB5A 1XDUA 3HUGA 5JVTA 1ULYA 3QPTA 2PFBA 3ECHA 3KP4A 1IW7F 3JSPA 1TQPA 2XAHA 2K27A 2B0LA 4R8HA 2IPQX 3I4PA 3ROUA 1FZPB 3R4KA 1I1SA 2NYXA 2W25A 2DLLA 2UWMA 5BMZA 1P92A 4HX4A 3GYHX 3HOTA 2HTJA 3CO6C 4LGWA 1KU3A 3K69A 2XGXA 2OQRA 5BOXA 3QOPA 5IT9K 5FFZA 3P9IA 4BAYA 2FSWA 3M9AA 3E6BA 2L01A 1O3TA 1ZH5A 5DV5A 1GXQA 2CFXA 5CYVA 5D8KB 2OZ6A 1D5VA 4L9NA 3J7AO 1IUYA 5A2QZ 3J81K 2HDCA 3MWMA 4L18B 2QQ9A 3HRUA 5FD6A 2EV0A 5CLSA 5L3GA 3WGIA 3FXUA 2F5FA 3TDUC 2HS5A 4HOBA 2D1HA 1ONVA 1W7PD 1BC8C 3CJNA 3TQNA 5E8GA 1X3UA 1T39A 4ZZDA 1KA8A 3QRFF 2PEXA 2A5YB 5LBQA 3KLOA 4RGUA 4ASNA 2VN2A 1MZBA 3W6KB 1YO5C 3GF2A 5E17F 2VT2A 3JW4A 5ICFA 1CF7A 1R1UA 4D0PA 2HTSA 1O7LA 2O6GE 4LG0A 1KU2A 2AXLA 3IWZA 2K02A 1TBXA 1DP7P 4ZYEA 3BY6A 4RB0A 1G3TA 3BPXA 3HRTA 3TOBA 4KN4X 1KQ8A 1IXRC 2M5WA 2VC1A 2EJRA 3OOPA 5LGTA 1ZARA 2XAFA 5FGMA 2V1UA 4JBAA 1UFMA 3EUHA 3Q5FA 4OIQF 1AOYA 3WU0A 4IF4A 1BI1A 1KU7A 2Z9OA 1T2KA 1MDMA 4I09A 1YW8A 5BPIA 1XMKA 3IRRA 1TW2A 4N0BA 2ZKZA 4I7HA 1G3SA 3HTSB 4O3MA 3E6CC 5D5XB 3F8BA 1Z6TA 4RGSA 4GCVA 2HZTA 2DK8A 1LVAA 4HX7A 1BC7C 2BBYA 4O6JA 1JHFA 1RUOA 4G7ZF 4LFUA 4B09A 4GGGA 1IF1A 5LGUA 2HKXA 2V79A 5HDNA 1I1GA 1TNTA 4M6YA 5D8LB 2P7CB 2GXGA 4BXUA 3RTRA 2RC4A 1U5TA 2JPBA 5J6XA 2VBYA 1SFEA 3CUQA 4IVNA 4UVBA 3WTSC 2FEZA 3D5LA 1SFUA 4L9JA 4HF0A 4MGRA 2O8XA 3NEUA 5J8CA 3B73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQM A;  5E8I A;  4ZYG A;  4BHB A;  2JSC A;  1ON1 A;  3KP5 A;  1I6X A;  5ILS A;  5J8F A;  2E1C A;  2A3S A;  4KIC A;  2XAG A;  3QP6 A;  1RIO H;  2HQR A;  3GVA A;  2OBP A;  4U0V A;  2RGV A;  2F2E A;  3RYP A;  1YW9 A;  3EYI A;  4R79 A;  2J5P A;  5DYM A;  3EQL F;  3K1M A;  1P4W A;  1A04 A;  3RKW A;  3LWF A;  1D3Y A;  4UNO A;  1HKS A;  4ZH4 F;  1MJB A;  1XSV A;  2UZK A;  1W5S A;  3BP8 A;  4MEX F;  3ISP A;  3GEZ A;  3MCZ A;  1YFH A;  2XKP A;  1LDK B;  5TRD A;  2DPU A;  1ZRF A;  3K1P A;  3T8R A;  4EQQ A;  4RB2 C;  1BI3 A;  1REP C;  1XGM A;  5ILU A;  3LQR A;  1S8N A;  1LEB A;  1P2F A;  5L3E A;  4OMZ A;  1KQ9 A;  3RIR A;  3ML6 A;  1FBU A;  3I59 B;  1FSH A;  4YFN F;  2ZME A;  2FBK A;  3K1N A;  4I02 A;  1K6O A;  4A5N A;  3TO6 A;  1R00 A;  3JTH A;  4PDK A;  4ENJ A;  3VEP A;  2GA2 A;  4A0X A;  1ZRE A;  2G7U A;  5FD5 A;  3GX4 X;  2O0Y A;  5HDG A;  1FOK A;  2LF8 A;  4IJA A;  3FMS A;  3PQK A;  1JGS A;  4RGX A;  1HSJ A;  1FNN A;  2PLY A;  1FBQ A;  3GFL A;  3LAP A;  3O6B B;  4YIF A;  3O2P E;  5D4S A;  4ESB A;  3QU3 A;  3ZMZ A;  4G9Y A;  3WU1 B;  4ETS A;  3NRV A;  3FMR A;  4KN7 X;  2ZNY A;  3L00 A;  1QGP A;  2R7F A;  3PQJ A;  2Q2E A;  1XCV A;  1F4K A;  3ZN0 A;  4UVC A;  5A2Q K;  3EET A;  1MKM A;  1QZY A;  3C1D A;  1O3R A;  1O3S A;  1P6R A;  4OIP F;  1P4X A;  3GZ6 A;  2EK5 A;  2OU2 A;  5DCM B;  2NAZ A;  2DT5 A;  1NHA A;  4E70 A;  2EA4 A;  1W7P B;  4EGZ A;  3AAF A;  1ZG5 A;  1R58 A;  2VC0 A;  1RUN A;  5DD8 A;  2KIM A;  1XGN A;  4AVP A;  5BQT A;  4LLN A;  3C18 A;  1SD7 A;  4L0Z B;  2EFN A;  1OKR A;  4CO8 A;  1J0R A;  4MTE A;  1YQA A;  2ACJ A;  4UXN A;  1C0W A;  2Z99 A;  1ZYR F;  2F5C A;  5HVQ C;  2PQ8 A;  3TDZ C;  5LHH A;  5CJ9 A;  4P5O A;  3DPL C;  3V8J A;  4LB6 B;  3B02 A;  1FT9 A;  2ESH A;  2GWR A;  3DFG A;  2W24 A;  3V8L A;  3BZ6 A;  5L3D A;  3RKY A;  1T38 A;  4YFX F;  2OQG A;  2H09 A;  2DW4 A;  4JQF A;  1QO0 D;  5JFR A;  3K0L A;  4UV8 A;  1XD7 A;  4KA4 A;  1UHW A;  1G3Y A;  4XBF A;  1EH7 A;  3PFI A;  2ZBK A;  2M1B A;  3FMQ A;  4QWQ A;  1VTN C;  2QQB A;  1DDN A;  1OYW A;  3IWF A;  3BJA A;  5E1Z B;  2P7V B;  3DPT A;  1YW7 A;  2FA5 A;  1BOA A;  5K5O A;  2EFP A;  1ODD A;  5D6F A;  3C3W A;  3MEX A;  1D8J A;  3FM3 A;  2DAO A;  3BRO A;  4MEY F;  1J75 A;  1OR7 A;  2Q8K A;  2V1X A;  3T8T A;  1FP1 D;  2DQL A;  2W84 A;  5K5Q A;  1T0F A;  3F8M A;  3QPH A;  2OAZ A;  3BOQ A;  2H94 A;  1FX7 A;  1SD6 A;  3RPU A;  1D8K A;  3WTU C;  2L4A A;  2IA0 A;  4U7D A;  3E97 A;  5IT3 A;  3JSO A;  4IPA A;  3F23 A;  1B1B A;  2RVC A;  3KLN A;  4IRG A;  5HLI A;  3KP6 A;  4LD5 A;  2PJP A;  2STT A;  2VBZ A;  3OV8 A;  4AIH A;  3ZMU A;  4KIF A;  4TV7 A;  3JAM Z;  2BE5 F;  4KIG A;  2XV4 S;  3BWG A;  1K7A A;  4BNC A;  4MHG A;  3I54 A;  4KYW A;  1S6L A;  2ISZ A;  1IXS B;  4NB5 A;  2CYY A;  3F22 A;  5JHU A;  2GAU A;  3WGG A;  4ON0 A;  2HFH A;  5LRR A;  3N97 A;  1R5H A;  4YFK F;  2XIG A;  3CTA A;  4OMY A;  3R61 A;  3H3Z A;  5K5R A;  1WWX A;  3L2C A;  1Z91 A;  4HDV A;  3F6O A;  4KIB A;  4EMS A;  2NNN A;  4I0A A;  4XRF A;  3VB2 A;  2COM A;  5D5W B;  2L54 A;  4CGZ A;  3O3K A;  2M45 A;  3RKX A;  2XAQ A;  2OZU A;  1TQM A;  3CDH A;  2BGC A;  4ENM A;  3E3V A;  2XKO A;  4BHP A;  1HKQ A;  3V4G A;  1R22 A;  1XB4 A;  4NQW A;  1O7F A;  3N4M A;  5L3F A;  4L5I A;  1QQI A;  3BJO A;  5FLX Z;  2RN7 A;  1XSD A;  1J5Y A;  1EH6 A;  2GQQ A;  1STZ A;  2DBB A;  3DF8 A;  5F6F A;  2IA1 A;  5AIQ A;  2VOO A;  2EB7 A;  2H27 A;  1V3F A;  1J9I A;  1SMT A;  3WE3 A;  5CVJ A;  2ZJ2 A;  3WTT C;  2KIF A;  4CZZ A;  4L9V A;  2PMU A;  2FU4 A;  2A69 F;  4U0Y A;  2XRN A;  5D5V B;  1IN4 A;  3EYY A;  1I5Z A;  2DI3 A;  2MA3 A;  2PN6 A;  2O03 A;  4P96 A;  4EJV A;  3SQN A;  3ZMS A;  3IKT A;  4M72 A;  5HOO A;  4EJU A;  3CO7 C;  4EJW A;  3HRM A;  2EWN A;  3RJP A;  3E5Q A;  5DCF A;  2HYF A;  2PMH A;  4CXF A;  3M1E A;  2YPR A;  3H3U A;  2ZNZ A;  2OA4 A;  2VOP A;  4PZJ A;  5AIP A;  2WWY A;  1LDJ A;  1K78 B;  4MQ9 F;  5HS9 A;  4XSX F;  3I59 A;  2JZY A;  3GXO A;  2YR2 A;  3F21 A;  4I2O A;  2Z3Y A;  3GFJ A;  1Z05 A;  2D2W A;  3M8F A;  4A0Z A;  4HQE A;  4KNY A;  1J2X A;  4EM1 A;  3P9C A;  3WTV C;  2VBX A;  3LFK A;  1FLI A;  3G73 A;  1UST A;  4RAY A;  2QLZ A;  2LSO A;  3ABT A;  2IJL A;  2TDX A;  3U2R A;  3V7S A;  4BYY A;  3M8E A;  5DEQ A;  2X0L A;  1HXD A;  2IW5 A;  4RB1 A;  1ZG3 A;  3TO7 A;  4AIK A;  1RI7 A;  1AWC A;  1BIB A;  3RDI A;  1WI9 A;  1SFX A;  2YU3 A;  1TTY A;  5FB2 A;  1SD4 A;  5CVR A;  1J7K A;  5EEG A;  4HF2 A;  4A6E A;  3HSF A;  3FXR A;  5L3B A;  1XMA A;  3T1B A;  5DCM A;  3VOD A;  2EV5 A;  2V6C A;  4AD9 A;  4BHC A;  5F64 A;  2VE9 A;  1W7P A;  2STW A;  4HF1 A;  5BS6 A;  2JT1 A;  4YG2 F;  4P9F A;  4EJO A;  5E18 F;  4Y13 A;  4XSZ F;  4OIR F;  1YIO A;  4S04 A;  2QBY B;  2CQK A;  4Q5S F;  3REO A;  2H6B A;  2P5L C;  5EEH A;  4WXH A;  2DFI A;  3MFK A;  1V4R A;  1YG2 A;  3KZY A;  1ON2 A;  4YII A;  1KU9 A;  2J5O A;  1WKM A;  1J59 A;  4KDP A;  4MTD A;  1S7A A;  3ELK A;  4OIN F;  1ZLJ A;  2D1V A;  4M71 A;  3FWE A;  2RNJ A;  4HV6 A;  2K4B A;  4EV0 A;  2O61 A;  4ENK A;  1B9N A;  2L3D A;  1R23 A;  2R7D A;  3L9F A;  1ZGA A;  3L7W A;  4KMU X;  1B59 A;  2M87 A;  3I0T A;  3RI4 A;  4WXC A;  2VT3 A;  1H9T A;  2MLK A;  2LNB A;  1TQI A;  3GO5 A;  3TO9 A;  2A68 F;  2XHK A;  3WTW C;  2GIV A;  2A07 F;  1BBY A;  4LJZ F;  3WTX C;  1BIA A;  3KET A;  1YS7 A;  2CSO A;  1H0M A;  1ZHF A;  3JAM K;  1IN8 A;  1Y0U A;  3KE2 A;  5ICG A;  2QVO A;  2L02 A;  6PAX A;  4WWC A;  3JTG A;  4K2E A;  2Q0O A;  3E5X A;  1SD5 A;  4L9T A;  5HDK A;  3G3Z A;  4LMY A;  4FHT A;  2P6T A;  2F5E A;  3RYR A;  2HQN A;  4PGH A;  3J80 Z;  4WX9 A;  4I98 B;  1Z1D A;  2ZO4 A;  1IXC A;  1TW3 A;  1DUX C;  2DTR A;  2WC2 A;  4Q4Z F;  2PI0 A;  3I58 A;  5HLG A;  2FBI A;  4BQA A;  3FX3 A;  2A6H F;  2VBW A;  1KGS A;  4F7Z A;  3BDD A;  3R0J A;  2XRO A;  3EDP A;  5LEJ A;  1QPM A;  2P5K A;  5E1W A;  4RAZ A;  1ZGJ A;  2A6E F;  1EV7 A;  2DQR A;  3CLO A;  2KJB A;  4LK0 F;  4Q47 A;  2VXZ A;  4ESF A;  2XVC A;  4A12 A;  3GFM A;  4UV9 A;  4G7O F;  4EM2 A;  4CHU A;  2LDU A;  4O5V A;  4U0W A;  4A0Y A;  5FLX K;  3KP7 A;  2P5V A;  2P6S A;  1XCB A;  4ZYD A;  3SXY A;  3IRQ A;  3SHF A;  5E20 A;  3WG9 A;  3KEO A;  1B9M A;  4RS8 A;  2HGC A;  2HR3 A;  1HBX G;  4GYG A;  2DU9 A;  1YTY A;  2FF4 A;  4A2U A;  4HLY A;  3R60 A;  3U1D A;  5LGN A;  2EV6 A;  3R0A A;  4PCQ A;  1K79 A;  3ERE D;  3H92 A;  2HEO A;  4HW0 A;  2Y48 A;  3F8F A;  5D4R A;  3K2Z A;  1BN5 A;  3WOD F;  2Z5U A;  2XAS A;  3DXJ F;  1SAX A;  1XSX A;  5KK1 A;  2KKO A;  2JTV A;  1HKT A;  4M9X A;  1UHM A;  2E7X A;  4CIC A;  1JE8 A;  3WTZ A;  2YX4 A;  3E6M A;  2ETH A;  4FX4 A;  1ZRC A;  1TNS A;  2IT0 A;  2QM3 A;  2IRF G;  1GHC A;  4L0Y B;  4KMF A;  1HW1 A;  1LDD A;  1IN6 A;  4WCG A;  4M74 A;  2DK5 A;  1O57 A;  5ICC A;  1XDS A;  2NS0 A;  4CDG A;  2K7L A;  2C6Y A;  2MD5 A;  4NHJ A;  4WXD A;  2L4M A;  4Q48 A;  2VE8 A;  3ZQ7 A;  4A6D A;  1MGT A;  3LA3 A;  3NQO A;  1FY7 A;  2ADU A;  2Y75 A;  1FYM A;  1USS A;  1KQ0 A;  1U5T C;  2RDP A;  5DDG A;  4GO1 A;  3CUQ C;  3KZZ A;  2GXB A;  1ZRD A;  3IL2 A;  2Z33 A;  2ESN A;  2FMY A;  2UXN A;  1T98 A;  5AON A;  3MQ0 A;  5DUK A;  1PP7 U;  1F5T A;  3KP2 A;  4S05 A;  4KFC A;  3HHG A;  1H9G A;  4QLC U;  3V7C A;  2H6C A;  4OOI A;  2LKP A;  4MQV A;  1ZG1 A;  1YS6 A;  2WV0 A;  3TKY A;  3LA7 A;  3DV8 A;  1XGS A;  3KFW X;  1OMI A;  5FO5 A;  4M9Z A;  2KRF A;  2DO7 A;  1PUE E;  4HYE A;  5F1R A;  4HDU A;  1Z9C A;  4HAM A;  1S29 A;  2BYV E;  1MD0 A;  1L3L A;  2CG4 A;  1B4A A;  1QZZ A;  2W85 A;  4RGR A;  4B8X A;  2FE3 A;  1IRF A;  4LLL A;  1IN7 A;  3BJ6 A;  3ULQ B;  2P4W A;  4A5M A;  3V8K A;  1K78 A;  3S2W A;  2KIU A;  4Y15 A;  3DKW A;  3LA2 A;  2V9V A;  3LST A;  1LEA A;  3T5X A;  1FYK A;  2EFQ A;  1W4M A;  1KYZ A;  1F1Z A;  3ZMV A;  4I01 A;  2P8T A;  1HW5 A;  5ERI A;  2ISY A;  1XN7 A;  1U8R A;  3T0Y A;  5BPD A;  3MZH A;  4G6Q A;  5H6R A;  1PDN C;  1R36 A;  1U2W A;  1FPQ A;  4JK1 X;  2CWE A;  3FXQ A;  3ZMD A;  4KT5 C;  2QUF A;  1FSE A;  1E17 A;  5LRS A;  3ZPL A;  1MJA A;  3FF5 A;  4MNU A;  4WF2 A;  2E7W A;  4R1H A;  2R3S A;  2FNP A;  2V1D A;  5D5U B;  2HKO A;  2QEN A;  3SZP A;  1S7O A;  3C7J A;  4IRH A;  3IC7 A;  2MC3 A;  2HWV A;  3LAJ A;  2EFO A;  1R1T A;  4AWX B;  1L0O C;  3RPQ A;  3GLX A;  1O3Q A;  1YYV A;  4EVI A;  4Y17 A;  4Z2Y A;  2CO5 A;  1FYL A;  3ECO A;  1JXS A;  4WK8 F;  5H6Q A;  3DEU A;  4UHT A;  1LQ1 A;  5H20 A;  1OPC A;  3GZ5 A;  4G8X A;  4UVA A;  1R7J A;  2RV8 A;  2OD5 A;  2QBY A;  2D45 A;  1R1V A;  2KJC A;  3J80 K;  2F5D A;  5ILV A;  1WRJ A;  1Q1H A;  1FC3 A;  4KUM A;  4UUV A;  3HYI A;  1OYI A;  3QP5 A;  2QYO A;  2MH9 A;  3QU6 A;  3VOE A;  1G6N A;  1G4D A;  1YLF A;  2ZFW A;  5CVI A;  3DP7 A;  2FRH A;  1CF7 B;  5HS7 A;  5JR3 A;  4LG0 B;  4CYD A;  5LEK A;  2O3F A;  2RKH A;  3Q9S A;  1ZLK A;  5IT9 Z;  3F8C A;  3P9K A;  1LNW A;  3KP3 A;  4DNC A;  4HLX A;  2XUB A;  2FNA A;  2RQP A;  3I5U A;  2CW0 F;  4PGG A;  5LHG A;  3WTY C;  3R6S A;  5TJJ A;  4ZYH A;  1ZAO A;  1FWZ A;  3HTU A;  1BI0 A;  5ED4 A;  3SFZ A;  2W57 A;  2X4H A;  2E1N A;  3J81 Z;  2DPD A;  1GVJ A;  3KEQ A;  2IA2 A;  1LJ9 A;  1HQC A;  3L09 A;  4FX0 A;  4EJT A;  2FXA A;  2MH2 A;  3E5U A;  2ZCW A;  1MJ9 A;  3GFI A;  3P7N A;  2XAJ A;  2NRA C;  1MDM B;  3SZT A;  1Z7U A;  3COA C;  4AIJ A;  4DQ2 A;  1HST A;  3MAJ A;  5DD4 A;  4BH9 A;  4GYI A;  1DPR A;  5E1X A;  2LF7 A;  3HHH A;  3IHU A;  1QNT A;  4M73 A;  4HV5 A;  3F72 A;  3GWZ A;  5CVV A;  3GUD A;  1KYW A;  1F9N A;  5LLQ A;  3Q9V A;  4H0E A;  4G6D A;  2HYG D;  1G3W A;  2JPC A;  1IAW A;  1IZ1 A;  4P55 A;  5DUI A;  1R5G A;  3HIF A;  2MBF A;  1U5T B;  3VFZ A;  3CUQ B;  2CGP A;  5HS8 A;  1I27 A;  4U7B A;  1IRG A;  4HA8 A;  2VOD A;  2WTE A;  1UB9 A;  3ZP5 A;  1B6A A;  1EH8 A;  2EFW A;  3ZN1 A;  1QBJ A;  3ZMT A;  5D6E A;  2YX7 A;  2HOE A;  4ESJ A;  3K9T A;  2G7H A;  1E2X A;  4ZZL A;  3LQQ A;  3F6V A;  1Z6R A;  1U6G A;  3TGN A;  4IRI A;  4OU0 A;  2FQ3 A;  3D0S A;  5L3C A;  1T6S A;  2M8E A;  1BJA A;  3HSE A;  2FBH A;  3FHZ A;  3FM5 A;  2AS5 F;  4HZF A;  4IHT A;  2QQA A;  2ZXJ A;  1CGP A;  4G94 A;  2FML A;  4ENN A;  1HW2 A;  3I64 A;  2ELH A;  1UCR A;  3V7R A;  2BEO A;  2IVM A;  3I53 A;  1U3E M;  1ZN2 A;  3E6D A;  1JHH A;  3CUO A;  4N9H A;  2M30 A;  2MLG A;  3FZV A;  1OYY A;  1RZ4 A;  2QWW A;  4OIO F;  3BPV A;  2FOK A;  4EGY A;  2K4J A;  2A61 A;  4RB3 C;  3KCC A;  4U88 A;  1GXP A;  3DQV C;  5FFX A;  3WE2 A;  1BM9 A;  5HLH A;  2ZME B;  4HX8 A;  3HSR A;  4HBL A;  1U78 A;  3MZY A;  4I0B A;  1XGO A;  4L5J A;  1BI2 A;  4P9U A;  4IXA A;  3IKV A;  2Y0M A;  3HOS A;  4EM0 B;  2PBI A;  5KVR A;  5K1Y A;  1WSU A;  1RNL A;  4M6X A;  2GZW A;  3F8N A;  1FBS A;  3F3X A;  5ICE A;  2BV6 A;  4LK1 F;  4XLP F;  3M7G A;  2YSR A;  1W5T A;  2EA2 A;  3I71 A;  2IP2 A;  1LB2 A;  2QZ8 A;  1P4A A;  2UXX A;  4LLG F;  1DPU A;  4FT8 A;  3ABU A;  3TOA A;  4G7H F;  4GXO A;  4M9S A;  4N9I A;  2PG4 A;  2GA1 A;  3HRS A;  1IN5 A;  1SMY F;  3GW2 A;  3WGH A;  3W6J B;  4IHS A;  2VON A;  1PP8 F;  2JRT A;  2K86 A;  4XLN F;  5CVU A;  5LHI A;  1WQ2 A;  5JI6 A;  3U9G A;  1TLH B;  2NNY A;  2G9W A;  1S3J A;  3QAH A;  1FP2 A;  4LB5 A;  1XDU A;  3HUG A;  5JVT A;  1ULY A;  3QPT A;  2PFB A;  3ECH A;  3KP4 A;  1IW7 F;  3JSP A;  1TQP A;  2XAH A;  2K27 A;  2B0L A;  4R8H A;  2IPQ X;  3I4P A;  3ROU A;  1FZP B;  3R4K A;  1I1S A;  2NYX A;  2W25 A;  2DLL A;  2UWM A;  5BMZ A;  1P92 A;  4HX4 A;  3GYH X;  3HOT A;  2HTJ A;  3CO6 C;  4LGW A;  1KU3 A;  3K69 A;  2XGX A;  2OQR A;  5BOX A;  3QOP A;  5IT9 K;  5FFZ A;  3P9I A;  4BAY A;  2FSW A;  3M9A A;  3E6B A;  2L01 A;  1O3T A;  1ZH5 A;  5DV5 A;  1GXQ A;  2CFX A;  5CYV A;  5D8K B;  2OZ6 A;  1D5V A;  4L9N A;  3J7A O;  1IUY A;  5A2Q Z;  3J81 K;  2HDC A;  3MWM A;  4L18 B;  2QQ9 A;  3HRU A;  5FD6 A;  2EV0 A;  5CLS A;  5L3G A;  3WGI A;  3FXU A;  2F5F A;  3TDU C;  2HS5 A;  4HOB A;  2D1H A;  1ONV A;  1W7P D;  1BC8 C;  3CJN A;  3TQN A;  5E8G A;  1X3U A;  1T39 A;  4ZZD A;  1KA8 A;  3QRF F;  2PEX A;  2A5Y B;  5LBQ A;  3KLO A;  4RGU A;  4ASN A;  2VN2 A;  1MZB A;  3W6K B;  1YO5 C;  3GF2 A;  5E17 F;  2VT2 A;  3JW4 A;  5ICF A;  1CF7 A;  1R1U A;  4D0P A;  2HTS A;  1O7L A;  2O6G E;  4LG0 A;  1KU2 A;  2AXL A;  3IWZ A;  2K02 A;  1TBX A;  1DP7 P;  4ZYE A;  3BY6 A;  4RB0 A;  1G3T A;  3BPX A;  3HRT A;  3TOB A;  4KN4 X;  1KQ8 A;  1IXR C;  2M5W A;  2VC1 A;  2EJR A;  3OOP A;  5LGT A;  1ZAR A;  2XAF A;  5FGM A;  2V1U A;  4JBA A;  1UFM A;  3EUH A;  3Q5F A;  4OIQ F;  1AOY A;  3WU0 A;  4IF4 A;  1BI1 A;  1KU7 A;  2Z9O A;  1T2K A;  1MDM A;  4I09 A;  1YW8 A;  5BPI A;  1XMK A;  3IRR A;  1TW2 A;  4N0B A;  2ZKZ A;  4I7H A;  1G3S A;  3HTS B;  4O3M A;  3E6C C;  5D5X B;  3F8B A;  1Z6T A;  4RGS A;  4GCV A;  2HZT A;  2DK8 A;  1LVA A;  4HX7 A;  1BC7 C;  2BBY A;  4O6J A;  1JHF A;  1RUO A;  4G7Z F;  4LFU A;  4B09 A;  4GGG A;  1IF1 A;  5LGU A;  2HKX A;  2V79 A;  5HDN A;  1I1G A;  1TNT A;  4M6Y A;  5D8L B;  2P7C B;  2GXG A;  4BXU A;  3RTR A;  2RC4 A;  1U5T A;  2JPB A;  5J6X A;  2VBY A;  1SFE A;  3CUQ A;  4IVN A;  4UVB A;  3WTS C;  2FEZ A;  3D5L A;  1SFU A;  4L9J A;  4HF0 A;  4MGR A;  2O8X A;  3NEU A;  5J8C A;  3B73 A; 
#chains in the Genus database with same CATH topology
 4HQM A;  5E8I A;  4ZYG A;  4BHB A;  2Y31 A;  4B3X A;  2JSC A;  1ON1 A;  3KP5 A;  4S0H B;  1W5C C;  1MBK A;  1I6X A;  3DEW A;  3HJE A;  5ILS A;  5J8F A;  4XK4 A;  1Z3Y A;  2E1C A;  2A3S A;  4KIC A;  4CCK A;  1YHQ I;  1ZQ3 P;  2XAG A;  2O7O A;  3QP6 A;  4NC8 A;  1BW6 A;  3OS0 A;  1RIO H;  2HQR A;  3GVA A;  2MFZ A;  2OBP A;  3HEF A;  1VQK I;  4U0V A;  1NG7 A;  2RGV A;  5GAD J;  3D1N I;  2F2E A;  2DA7 A;  1P7I A;  3RYP A;  1YW9 A;  5EDN A;  3EYI A;  4R79 A;  3TMO A;  4RAF A;  1FIA A;  2J5P A;  1UZC A;  3S8P A;  4ZTF A;  3DCF A;  5DYM A;  3EQL F;  3K1M A;  1JTX A;  2HVR A;  5F08 A;  1P4W A;  5M5X J;  2A05 A;  1A04 A;  1JJ6 C;  3PSI A;  3RKW A;  3PO3 J;  3LWF A;  3CQZ J;  1D3Y A;  4UNO A;  4ZYA A;  5GPA A;  1HKS A;  4BEH B;  4ZH4 F;  3H3V K;  1D0Y A;  2ID6 A;  1MJB A;  3IP4 B;  1XSV A;  5LFA A;  3CCV I;  3A01 A;  2UZK A;  2KRC A;  1K61 A;  1D0X A;  1W5S A;  3BP8 A;  4XNF A;  4MEX F;  2Y9Z A;  4A3K J;  3ISP A;  3GEZ A;  3MCZ A;  2L7F P;  2I8D A;  1G59 A;  1YFH A;  2XKP A;  3A4C A;  4HSR A;  1LDK B;  3HOW J;  5TRD A;  1JKP C;  2DCE A;  5M5Y J;  2DPU A;  1ZRF A;  3K1P A;  2DYR H;  4PUS A;  5CKT A;  3A2K A;  3LMM A;  3T8R A;  5E3L A;  3FXK A;  4EQQ A;  3LFU A;  1QHG A;  2M7A A;  4RB2 C;  4E7J A;  1BI3 A;  1REP C;  1XGM A;  5ILU A;  3LQR A;  1S8N A;  2BOL A;  3VYS B;  1LEB A;  1P2F A;  5L3E A;  4OMZ A;  1KQ9 A;  3RIR A;  3ML6 A;  3PNV A;  3HDD A;  1FBU A;  3I59 B;  3Q3S A;  3MD2 A;  3OY9 A;  2ICW G;  1FSH A;  4YFN F;  3C2G A;  2ZME A;  2FBK A;  1AA7 A;  2DT7 B;  3K1N A;  2M0C A;  4I02 A;  5B66 C;  1K6O A;  4A5N A;  1Y0N A;  4DOZ A;  4CYC A;  1ETV A;  2VI6 A;  2LOO A;  3DBL B;  3TO6 A;  1R00 A;  3JTH A;  4PDK A;  1GVD A;  4ENJ A;  3VEP A;  2GA2 A;  5B1B H;  4A0X A;  1ZRE A;  1QVT A;  1ETY A;  2G7U A;  5FD5 A;  3ZQQ A;  4BQO A;  4F55 A;  3GX4 X;  2O0Y A;  5HDG A;  1FOK A;  2HI3 A;  2LF8 A;  1XS9 A;  4IJA A;  3FMS A;  3PQK A;  1N78 A;  2EZL A;  1JGS A;  3OIP A;  1W36 D;  4RGX A;  1HSJ A;  1FNN A;  1APL C;  4A3F J;  4D5C A;  1JGG A;  2PLY A;  1FTT A;  3CP2 A;  3GTO J;  2K40 A;  1FBQ A;  1WI3 A;  5GTH C;  3GFL A;  3LAP A;  4ZDO A;  3O6B B;  4YIF A;  3O2P E;  4IO9 F;  5M3M J;  2WY7 Q;  5D4S A;  4A3G J;  5IPA A;  4ESB A;  3VWB A;  4NUB A;  2JUC A;  3QU3 A;  3BLY A;  3ZMZ A;  1X2M A;  4G9Y A;  3WU1 B;  4ETS A;  3NRV A;  3FMR A;  4KN7 X;  2OCE A;  2XPU A;  2ZNY A;  3K4C A;  3PJR A;  3L00 A;  1QGP A;  2R7F A;  4IL6 C;  3HOZ J;  3PQJ A;  4BKX A;  2Q2E A;  1EKE A;  1XCV A;  5IP9 J;  1F4K A;  3MN2 A;  2NS7 A;  2FQ4 A;  3U1K A;  3ZN0 A;  5E1W A;  1MIJ A;  4UVC A;  1TC3 C;  3BZK A;  1HDP A;  2IS1 A;  5A2Q K;  3EET A;  4XR6 A;  2CUE A;  1MKM A;  2M2E A;  1QZY A;  2B7E A;  3C1D A;  1O3R A;  1DGW Y;  1X1D A;  3FXL A;  1O3S A;  1P6R A;  4OIP F;  4PFP A;  1P4X A;  4AC0 A;  3OYH A;  3GZ6 A;  2EK5 A;  1RR8 C;  2MAB A;  2OU2 A;  5DCM B;  3BG3 A;  3MKY B;  1PUF B;  2AQE A;  2NAZ A;  2DT5 A;  1NHA A;  2EIJ H;  2DA5 A;  3WG7 H;  2BY0 A;  3F9K A;  4E70 A;  2EA4 A;  3GTQ J;  1W7P B;  2QGU A;  4XQF A;  4E7S A;  4RM2 A;  3AAF A;  4EGZ A;  1ZG5 A;  1R58 A;  2VC0 A;  4HEA 2;  1U8B A;  1K83 J;  1RUN A;  5DD8 A;  5KNL A;  4U87 A;  2KIM A;  1XGN A;  4AVP A;  5BQT A;  4IHX A;  4Z6Y A;  2JQ7 A;  4LLN A;  2R7W A;  3C18 A;  1SD7 A;  4L0Z B;  5J1Y A;  1XX5 A;  2EFN A;  1OKR A;  4XLC A;  4CO8 A;  2TRT A;  1J0R A;  3CP8 A;  4MTE A;  2QA4 I;  2VKH A;  3DKY A;  1YQA A;  2ACJ A;  4UXN A;  2NXN B;  1C0W A;  2Z99 A;  3SDB A;  2OUM A;  1BA5 A;  1OCT C;  1ZYR F;  2X6X A;  2F5C A;  3MKZ A;  1VI0 A;  1LUJ B;  4A3I J;  5HVQ C;  2PQ8 A;  3CF2 A;  3TDZ C;  2GOM A;  3W3C A;  4CYC B;  3F0C A;  5LHH A;  4A69 C;  1F43 A;  5CJ9 A;  4PFO A;  1MNM C;  3QWL A;  4P5O A;  3DPL C;  3V8J A;  3CMM A;  3MKL A;  1A6I A;  3B02 A;  4LB6 B;  4A3B J;  1FT9 A;  2ESH A;  2GWR A;  3DFG A;  4A3E J;  2W24 A;  3V8L A;  2AO9 A;  3BZ6 A;  2ZXH A;  3S15 J;  3DPU A;  5IOZ A;  5L3D A;  3RKY A;  3AFH A;  1T38 A;  2V1N A;  2WBM A;  4YFX F;  2OQG A;  2CFO A;  2H09 A;  4C9Y A;  4MIM A;  4C3J J;  2DW4 A;  3L2U A;  2NVX J;  4I6Z A;  4JQF A;  1QO0 D;  5JFR A;  1F36 A;  3K0L A;  2HZD A;  1XD7 A;  3O8H A;  4UV8 A;  4AVZ A;  4BBR J;  3OYN A;  4KA4 A;  1UHW A;  1G3Y A;  4XBF A;  1EH7 A;  1B8I A;  4JOM A;  5IY5 H;  3PFI A;  1KZH A;  2ZBK A;  2M1B A;  4BE0 A;  1VQ7 I;  3I56 I;  2IS2 A;  3FMQ A;  4QWQ A;  1VTN C;  4CSW A;  3RZO J;  2QQB A;  1O4X A;  1DDN A;  1OYW A;  3IWF A;  3BJA A;  2M8G X;  5E1Z B;  4NBQ A;  2P7V B;  3BTJ A;  3DPT A;  3SDG A;  4BS9 A;  1W0U A;  4DBR A;  2XF7 A;  1UJ8 A;  1YW7 A;  1RKW A;  1WJD A;  2FA5 A;  1BOA A;  2OCC H;  1S7E A;  5K5O A;  2EFP A;  4AYB A;  1VQ6 I;  2GXA A;  1FMW A;  1ODD A;  5D6F A;  4C3I J;  3C3W A;  1SC7 A;  3MEX A;  1D8J A;  3FM3 A;  2DAO A;  4ZDL A;  3BRO A;  4MEY F;  1WCM J;  3S14 J;  2Z16 A;  4E7K A;  1J75 A;  1OR7 A;  2M0M A;  2Q8K A;  2V1X A;  1NK2 P;  3S1N J;  4BJT A;  1PVE A;  1ETK A;  3T8T A;  1HA8 A;  2L2O A;  1XTA A;  4M3D A;  1FP1 D;  2DQL A;  2W84 A;  3J7Z I;  5K5Q A;  4GFB A;  1T0F A;  3F8M A;  4J00 A;  3QPH A;  2OAZ A;  3BOQ A;  2H94 A;  1FX7 A;  2CV1 A;  1LFB A;  1SD6 A;  1Z67 A;  2KT0 A;  3RPU A;  1D8K A;  3WTU C;  2L4A A;  2IA0 A;  4U7D A;  3E97 A;  5IT3 A;  3BTL A;  3JSO A;  1N77 A;  3JRB A;  3BG7 A;  1X1B A;  4IPA A;  2K9S A;  1GV2 A;  4F92 B;  3F23 A;  1B1B A;  4YEL A;  1X19 A;  3RQ4 A;  2RVC A;  1WH7 A;  3KLN A;  5JLX A;  2H8R A;  4IRG A;  1NTC A;  3BR0 A;  3KP6 A;  5HLI A;  2R7U A;  4LD5 A;  3JRI A;  2PJP A;  2STT A;  3IAS 2;  4NDL A;  3L1P A;  2X48 A;  4YIR X;  1ETQ A;  1MSE C;  2VBZ A;  3OV8 A;  2NVU B;  4AIH A;  3ZMU A;  1FOW A;  4KIF A;  4TV7 A;  5F04 A;  3JAM Z;  2LBF B;  2BE5 F;  4KIG A;  2XV4 S;  2VQC A;  3BWG A;  3S2H J;  1K7A A;  3OS2 A;  4BNC A;  4F91 B;  3GTP J;  4MHG A;  2V6E A;  1D1B A;  3I54 A;  4LIU A;  4KYW A;  1S6L A;  4E7L A;  2ISZ A;  1IXS B;  1R6R A;  4NB5 A;  1R71 A;  1Z21 A;  2CYY A;  3SYT A;  3F22 A;  5JHU A;  2GAU A;  4C30 A;  1JUP A;  4NNJ A;  2DYS H;  3IV5 A;  3BTI A;  1Y6I A;  1E3O C;  3HOU J;  3WGG A;  2KMU A;  4ON0 A;  2HFH A;  2BHZ A;  2E5Z A;  3H35 A;  5LRR A;  2R7R A;  2JN6 A;  3S1M J;  5FRN A;  1M1E B;  3N97 A;  1R5H A;  3B6C A;  4PSX A;  1FIP A;  1MMN A;  2OF7 A;  4YFK F;  4V2G A;  2DMN A;  2XIG A;  3KYD B;  4RLF A;  4IX7 A;  1JUS A;  3CTA A;  2VUM J;  4OMY A;  1QVU A;  3R61 A;  2AHQ A;  2ZFU A;  3H3Z A;  5K5R A;  3TP0 A;  1WWX A;  3L2C A;  1K6Y A;  1Z91 A;  5C4J J;  4XKV A;  1R4N B;  4EAT A;  4HDV A;  1J09 A;  3F6O A;  4KIB A;  3SZG A;  4EMS A;  2NNN A;  3HB9 A;  4I0A A;  2W1O A;  2H1K A;  3CCJ I;  4XRF A;  3VB2 A;  3OYL A;  2COM A;  3H5A A;  2FUG 2;  3ZQG A;  5D5W B;  3TP3 A;  2L54 A;  4CGZ A;  3O3K A;  2M45 A;  4PJL A;  1BW5 A;  1WVR A;  2MW8 A;  2XAQ A;  4NC6 A;  3RKX A;  2GIZ A;  2OZU A;  1JT0 A;  1TQM A;  3CDH A;  2BGC A;  1IRZ A;  2JA8 J;  3S3M A;  2LY9 A;  5KCM A;  3DTI A;  4ENM A;  3E3V A;  3SEZ A;  3H1C A;  5EJC A;  1DU6 A;  2XKO A;  4BHP A;  1HKQ A;  1SVM A;  2DFE A;  3V4G A;  1A6Q A;  2JK3 A;  1R22 A;  1XB4 A;  1GUU A;  2XF6 A;  4NQW A;  1O7F A;  4FCY A;  2KHM A;  2R5Y A;  3N4M A;  2X6W A;  5EG0 B;  4HST A;  5L3F A;  1MBG A;  3BG6 A;  4L5I A;  1QQI A;  3BJO A;  5FLX Z;  1VZ0 A;  2RN7 A;  1XSD A;  1J5Y A;  3FBI B;  1EH6 A;  2XB0 X;  2X85 A;  1TP4 A;  2GQQ A;  4XLA A;  4C2M J;  1STZ A;  2L9N A;  2DBB A;  3DF8 A;  3PIP F;  2LP0 A;  4LIT A;  2IA1 A;  5F6F A;  5AIQ A;  2VOO A;  1ACI A;  3ZRG A;  1LE8 B;  1IC8 A;  2EB7 A;  2H27 A;  1V3F A;  1J9I A;  5EEA A;  1SMT A;  3WE3 A;  5CVJ A;  2ZJ2 A;  1Y1V J;  3WTT C;  2KIF A;  4YEJ A;  4L9V A;  4CZZ A;  2PMU A;  2FU4 A;  2ZJP F;  2A69 F;  4U0Y A;  2F4O B;  1WJ5 A;  2XRN A;  1VQ4 I;  5F0F A;  5D5V B;  1IN4 A;  4X0G A;  3ZXS A;  1RES A;  2VJ5 A;  3EYY A;  4II3 A;  2VL8 A;  4RBO A;  1I5Z A;  2DI3 A;  2MA3 A;  1RPW A;  1RR7 A;  2PN6 A;  4FAS D;  4XIC A;  2O03 A;  4P96 A;  4EJV A;  3K2A A;  3SQN A;  4PJN A;  4BEH A;  3ZMS A;  3IKT A;  1VQ9 I;  1WJB A;  4M72 A;  4B43 A;  5HOO A;  4EJU A;  1TWA J;  1IUF A;  2KIQ A;  3CO7 C;  4FIS A;  1XPX A;  3QPS A;  1HOM A;  3NWS A;  4EJW A;  4HNV A;  1YI2 I;  3HRM A;  2EWN A;  3FXJ A;  5F1J A;  3RJP A;  3E5Q A;  5DCF A;  2HYF A;  2KP6 A;  2PMH A;  4CXF A;  1NH3 A;  1MBJ A;  3M1E A;  3ZOB A;  3OR1 C;  2YPR A;  2IS4 A;  2KL4 A;  4XN0 A;  3K70 D;  3H3U A;  1X1A A;  3K4L A;  2L5Q A;  3B6A A;  2ZNZ A;  2OA4 A;  1I50 J;  4MFD A;  2VOP A;  3K4J A;  5EYR A;  3CMA I;  4PZJ A;  5AIP A;  1MH3 A;  2WWY A;  1LDJ A;  1K78 B;  4MQ9 F;  4E6K G;  5B5E C;  5HS9 A;  4XSX F;  3I59 A;  2JZY A;  3GXO A;  1WFX A;  2YR2 A;  3DTE A;  2DOD A;  3BG9 A;  4BJ6 C;  3F21 A;  1T08 B;  3KPH A;  3SEQ A;  2ECB A;  2LLK A;  4I2O A;  1A31 A;  2R7Z J;  2Z3Y A;  3GFJ A;  5IP6 A;  1Z05 A;  2D2W A;  3M8F A;  3AG1 H;  3OYI A;  2BVL A;  4A0Z A;  3LSP A;  1K4S A;  1WJA A;  1FJL A;  2M4K A;  1BR1 A;  4HQE A;  3E0J B;  4KNY A;  2CUJ A;  1J2X A;  2W82 A;  4EM1 A;  2IGM A;  3P9C A;  3WTV C;  1BL0 A;  2VBX A;  3GTJ J;  3LFK A;  3PO2 J;  2E36 A;  1FLI A;  3G73 A;  2F6C A;  1UST A;  3OYK A;  3OYA A;  4RAY A;  2QLZ A;  2XPW A;  2LFB A;  1OCC H;  2LSO A;  3ABT A;  2IJL A;  2TDX A;  2E60 A;  3U2R A;  3KIO A;  3V7S A;  4BYY A;  3M8E A;  1X2N A;  5DEQ A;  2X0L A;  4DGW B;  2UUZ A;  4D1Q A;  4JYK A;  3LSH A;  1HXD A;  2IW5 A;  4RB1 A;  5BNG A;  2XSD C;  2LVS A;  4B4C A;  3TL4 X;  1ZG3 A;  3HXL A;  1MNE A;  3TO7 A;  4AIK A;  1RI7 A;  2LRE A;  1AWC A;  1BIB A;  3RDI A;  1WI9 A;  2E34 A;  2YUS A;  4BDZ A;  1SFX A;  2YU3 A;  3AG2 H;  4CZC A;  2NOJ B;  1TTY A;  5FB2 A;  1SD4 A;  4H4K C;  2K9M A;  2JA5 J;  2IS6 A;  5CVR A;  3IUO A;  1J7K A;  5EEG A;  4HF2 A;  5KAI C;  1AU7 A;  3BG5 A;  4A6E A;  2E2I J;  3HSF A;  1WHU A;  1XG1 A;  3FXR A;  1ETW A;  2RQQ A;  3DU5 A;  5L3B A;  1XMA A;  3T1B A;  4CCM A;  5DCM A;  1VQ8 I;  2IGN A;  3VOD A;  2EV5 A;  1PUF A;  3NWT A;  4Y3O A;  3O8G A;  2V6C A;  4AD9 A;  4BHC A;  3DWL E;  5F64 A;  2VE9 A;  1W7P A;  4OWR B;  2STW A;  1VQP I;  5K7Z A;  3QPL A;  4HF1 A;  5BS6 A;  2JT1 A;  4YG2 F;  4P9F A;  3D5R C;  2BZT A;  2K9Q A;  2D5V A;  1MBF A;  4EJO A;  5E18 F;  2WB1 A;  4XOP A;  1PJR A;  3V42 A;  4Y13 A;  3GLL A;  2DOF A;  3CJT B;  3Q0V A;  4XSZ F;  4OIR F;  3QYE A;  1YIO A;  4S04 A;  1FOX A;  3HGG A;  3BCB A;  2QBY B;  3AL0 C;  1UEL B;  2CQK A;  3JRD A;  4Q5S F;  3OR2 C;  2H6B A;  3REO A;  2P5L C;  5EEH A;  2CQQ A;  4WXH A;  3I9V 2;  2DFI A;  3MFK A;  2L9V A;  4UB6 C;  1V4R A;  1YG2 A;  3KZY A;  5FRO A;  4DJA A;  3G71 I;  1ON2 A;  3K10 A;  1R4M B;  2FJ1 A;  4XL9 A;  1KU9 A;  2J5O A;  1WKM A;  4YII A;  1J59 A;  2XSJ C;  4KDP A;  2XAU A;  4MTD A;  1ENH A;  2R7T A;  1S7A A;  2F5V A;  3KYC B;  3ELK A;  5E3M A;  3LSR A;  3L2V A;  2HU9 A;  4OIN F;  5J1R A;  1ZLJ A;  2D1V A;  2LRD A;  4M71 A;  1HC8 A;  2JA2 A;  3HOV J;  3DU6 A;  3FWE A;  2RNJ A;  1A5J A;  4HV6 A;  2K4B A;  1T95 A;  4EV0 A;  2O61 A;  4ENK A;  1B9N A;  2L3D A;  2I10 A;  3L2Q A;  3FHN A;  4Y7N J;  1R23 A;  2B63 J;  2R7D A;  3L9F A;  4XKW A;  1LFU P;  1ZGA A;  3A0H C;  3L7W A;  4E7H A;  3HPH A;  4KMU X;  1B59 A;  2M87 A;  3I0T A;  3RI4 A;  4N4O B;  3G4S I;  4WXC A;  2VT3 A;  2CV2 A;  1H9T A;  3AG3 H;  2MLK A;  1P7J A;  2VQL A;  2LNB A;  2XDV A;  2VJI A;  1W36 C;  1TQI A;  3GO5 A;  3TO9 A;  2A68 F;  2XHK A;  3WTW C;  2GIV A;  3CCQ I;  2A07 F;  1YX3 A;  1BBY A;  4LJZ F;  3I55 I;  5E3N A;  3WTX C;  1BIA A;  1X1C A;  3PNT A;  3KET A;  3H5N A;  1E0E A;  5GAE J;  4B3A A;  1YS7 A;  5K7H A;  2CSO A;  1H0M A;  1UMQ A;  1ZHF A;  2LY2 A;  4LG3 A;  1U9O A;  3JAM K;  1IN8 A;  2CQ7 A;  4D5F A;  5JHF A;  1Y0U A;  3KE2 A;  2M3A A;  5ICG A;  5TGT A;  1LVK A;  2QVO A;  2L02 A;  5GTI C;  6PAX A;  4C2T A;  1UG2 A;  4WWC A;  3JTG A;  2CMP A;  4K2E A;  3DBR B;  2Q0O A;  4AUX A;  3E5X A;  1SD5 A;  3D5S C;  4L9T A;  5HDK A;  2BXY A;  3G3Z A;  2CV0 A;  5FKO A;  3M4O J;  4LMY A;  2E19 A;  4FHT A;  2P6T A;  2F5E A;  3RYR A;  2H8W A;  3CC2 I;  2HQN A;  2KZG A;  4XN3 A;  4PGH A;  3AKZ A;  1D5Y A;  1T33 A;  1AKH B;  3J80 Z;  4WX9 A;  4I98 B;  2KRH A;  1Z1D A;  2ZO4 A;  2DXI A;  4XOR A;  1IXC A;  1TW3 A;  1DUX C;  1ZK8 A;  2DOA A;  1R9T J;  3G6E I;  2DTR A;  2WC2 A;  3C2B A;  4Q4Z F;  2OTL I;  1YE9 A;  2PI0 A;  1IG7 A;  3CC7 I;  2EZH A;  2XRL A;  4XOT A;  3I58 A;  1VQ5 I;  5HLG A;  2PJR B;  2WV1 A;  1OQY A;  2GOX B;  2FBI A;  4BQA A;  3ZQC A;  5FLV A;  3PL8 A;  3BR1 A;  3FX3 A;  2A6H F;  2QEX I;  2VBW A;  1KGS A;  4XRS G;  4F7Z A;  2DA2 A;  3K4N A;  2CH0 A;  2NVQ J;  3BDD A;  3R0J A;  2XRO A;  3EDP A;  5LEJ A;  2RAE A;  4CA0 A;  1X3W B;  1QPM A;  5EZH A;  3J7Y J;  3GTK J;  4IKF A;  1E3H A;  2P5K A;  4FET A;  1ZGJ A;  2A6E F;  1EV7 A;  3CLO A;  2DQR A;  2JRM A;  2M4G A;  2KJB A;  4LK0 F;  4Q47 A;  3ZCO A;  2Q1Z B;  1POG A;  3HBL A;  3OYF A;  2Z2S B;  1OCZ H;  3GTL J;  4AYB N;  2VXZ A;  4ESF A;  2XVC A;  4A12 A;  3GFM A;  1UAA A;  2YS9 A;  4UV9 A;  2ME6 A;  1N25 A;  4JX5 A;  2K3F A;  4G7O F;  2WAE A;  4EM2 A;  4CHU A;  4M6V A;  2O9L A;  2PX9 A;  2EIM H;  4LOC A;  2LDU A;  2HDW A;  4O5V A;  4U0W A;  1FOY A;  1X4O A;  4A0Y A;  4IZZ A;  2ZSI B;  5FLX K;  3KP7 A;  3CDI A;  1YX5 A;  3W2W A;  1MND A;  2P5V A;  2QKL B;  2P6S A;  3BTC A;  1XCB A;  4ZYD A;  3HOX J;  3SXY A;  2XC7 A;  3IRQ A;  3TED A;  3SHF A;  2LBF A;  3RQI A;  1DU0 A;  5E20 A;  3WG9 A;  2KFD A;  3KEO A;  3JRG A;  3FXO A;  1IRX A;  1B9M A;  4RS8 A;  2HGC A;  2HR3 A;  1HBX G;  4GYG A;  5DM7 F;  2R7X A;  2DU9 A;  1YTY A;  2FF4 A;  3H36 A;  4DYC A;  4A3L J;  4A2U A;  3K4M A;  4HLY A;  1EJ9 A;  3U21 A;  3VYR B;  3ONQ A;  1EF4 A;  3R60 A;  3U1D A;  5LGN A;  3SFI A;  2EV6 A;  3LSJ A;  3R0A A;  4PCQ A;  4IOC F;  1K79 A;  3ERE D;  4C2U A;  3H92 A;  2WY8 Q;  3OSF A;  2L7Z A;  2Z1D A;  3L2W A;  2HXI A;  4DYQ A;  4HW0 A;  2Y48 A;  1TT0 A;  2HEO A;  3EUH C;  3F8F A;  1ETX A;  5D4R A;  3K2Z A;  1BN5 A;  3WOD F;  2Z5U A;  2XAS A;  3VYT B;  3DXJ F;  1SAX A;  1XSX A;  3ASN H;  5KK1 A;  3S2D J;  2KKO A;  2VPR A;  4D9J A;  2Y0S N;  4Y33 A;  1ZGW A;  4BUP A;  2EIK H;  2JTV A;  4DZJ A;  1YJ9 I;  1HKT A;  4M9X A;  2DMP A;  2E5N A;  2E1M C;  2ZB9 A;  3I4N J;  3X2Q H;  1UHM A;  2E7X A;  3QQA A;  4CIC A;  1JE8 A;  2GLO A;  4IOA F;  1OIS A;  2YX4 A;  3WTZ A;  3E6M A;  2ETH A;  4FX4 A;  2A6T A;  2NVT J;  1IO2 A;  1ZRC A;  1TNS A;  2IT0 A;  2QM3 A;  2IRF G;  2LH9 A;  1GHC A;  4L0Y B;  5F27 A;  1HW1 A;  1LDD A;  1XC5 A;  4KMF A;  4PJ0 C;  4CCJ A;  4RAG A;  2E71 A;  1IN6 A;  4ZC3 A;  1RET A;  4WCG A;  2X1C A;  4M74 A;  5E79 C;  2DK5 A;  4XRS A;  1O57 A;  5ICC A;  5GAG J;  1XDS A;  4BDY A;  1WJC A;  2NS0 A;  4CDG A;  2K7L A;  4A3C J;  2C6Y A;  2MD5 A;  2Y9Y A;  3OL3 A;  3VYU B;  4A3D J;  1RC9 A;  3FIW A;  5EG0 A;  3HOY J;  3HM5 A;  2KZV A;  3OSG A;  4NHJ A;  4WXD A;  2NS8 A;  4BL0 B;  2L4M A;  4XMY A;  1SAU A;  4Q48 A;  1FTZ A;  2VE8 A;  3ESW B;  1Z7L A;  4D7N A;  3ZQ7 A;  1S72 I;  4A6D A;  1D1C A;  1MGT A;  3LA3 A;  3NQO A;  1FY7 A;  2ADU A;  2Y75 A;  1FYM A;  1X3Z B;  1USS A;  1KQ0 A;  1U5T C;  2RDP A;  4F3Q A;  3W2A A;  1LE8 A;  5DDG A;  4UUS B;  4GO1 A;  2Y2Z A;  3LNQ A;  3CUQ C;  4AID A;  3I4M J;  3MVP A;  3WHC A;  1DP3 A;  3KZZ A;  1I6H J;  2HQ5 A;  2GXB A;  3CCL I;  1JKQ C;  4FQG A;  2KQR A;  3OYB A;  1ZRD A;  3IL2 A;  2Z33 A;  2ESN A;  2ZJR F;  2FMY A;  3CME I;  4RLQ A;  4MFE A;  2Y0S A;  2UXN A;  4BQN A;  1BJZ A;  1T98 A;  5AON A;  2QSF X;  3MQ0 A;  5DUK A;  1PP7 U;  2K3P A;  3BR5 A;  3KP2 A;  4S05 A;  1F5T A;  4KFC A;  2V9K A;  1JT6 A;  3HHG A;  1H9G A;  3BT9 A;  5KHD A;  4QLC U;  1BR4 A;  3V7C A;  3G1L A;  4IHY A;  2H6C A;  2BVM A;  4OOI A;  2KIS A;  3OYE A;  2LKP A;  4UB8 C;  4MQV A;  4DBQ A;  1ZG1 A;  5GPC A;  1YS6 A;  2WV0 A;  3TKY A;  3LA7 A;  5M5W J;  2OPT A;  3DV8 A;  2GM4 A;  4PSW A;  1XGS A;  3CCU I;  3KFW X;  2HNH A;  2JJ7 A;  1OMI A;  5FO5 A;  4M9Z A;  1YRN B;  4A93 J;  2KRF A;  1U0J A;  1JI8 A;  3CCE I;  2DO7 A;  1PUE E;  4HYE A;  5F1R A;  2P0W A;  4HDU A;  2R7Q A;  1Z9C A;  2BXZ A;  4HAM A;  1S29 A;  2KPM A;  2M9H A;  4CH7 A;  2BYV E;  1MD0 A;  1L3L A;  2CG4 A;  1B4A A;  1QZZ A;  2DN0 A;  2MG4 A;  2W85 A;  4B47 A;  3FXM A;  1DQU A;  4RGR A;  5B3S H;  3LSM A;  1QRY A;  3E7L A;  4B8X A;  2FE3 A;  1IRF A;  4LLL A;  1IN7 A;  3BJ6 A;  4PJJ A;  2LD5 A;  1JKO C;  3ULQ B;  1BR2 A;  4M3F A;  3OIQ A;  3RZD J;  2KLO A;  2P4W A;  4J19 A;  4A5M A;  4D7M A;  3V8K A;  1K78 A;  3S2W A;  2VJJ A;  2KIU A;  1A36 A;  5GP9 A;  4Y15 A;  2XGD A;  3DKW A;  4G12 A;  3LA2 A;  2V9V A;  1MMS A;  3LST A;  2JVH A;  1GDT A;  1LEA A;  2A5W A;  4E7I A;  3T5X A;  1FYK A;  3VDX A;  2EFQ A;  5DM6 F;  3AL0 B;  3LSI A;  1W4M A;  1KYZ A;  4BAC A;  4QPQ A;  5IYD J;  4PJM A;  4XLE A;  1F1Z A;  2F48 A;  3ZMV A;  2P81 A;  4I01 A;  2P8T A;  2AXT C;  2KDZ A;  1JUM A;  1HW5 A;  3HUG B;  4X1E A;  2CQX A;  5ERI A;  2ISY A;  4E4H A;  1XN7 A;  3K4K A;  1U8R A;  3T0Y A;  5BPD A;  3MZH A;  5IOY A;  4G6Q A;  2JWT A;  3TW7 A;  2W48 A;  5H6R A;  1XMX A;  2ZME C;  1QPI A;  1PDN C;  4ZJZ A;  1R36 A;  1U2W A;  1D0Z A;  1FPQ A;  1P9Q C;  2VAS A;  4IHW A;  4JK1 X;  2CWE A;  3FXQ A;  3ZMD A;  1FMV A;  2VB6 A;  4KT5 C;  2QUF A;  1FSE A;  1D1A A;  3PFY A;  1E17 A;  5EGO B;  4M3B A;  5LRS A;  4BE1 A;  2CRG A;  3DTK A;  3ZPL A;  1MJA A;  3FF5 A;  4II2 A;  4MNU A;  4WF2 A;  2E7W A;  4R1H A;  2R3S A;  3W6V A;  5C3E J;  2ZSH B;  2BW3 B;  4FTH A;  2FNP A;  2V1D A;  4KIT B;  5D5U B;  2HKO A;  3ABL H;  1GLN A;  2M34 A;  2V26 A;  2QEN A;  3SZP A;  4MO7 A;  1S7O A;  2OJE D;  2AQF A;  3C7J A;  4IRH A;  3OIO A;  2DJI A;  3IC7 A;  2TCT A;  1S5L C;  2DOE A;  1MH4 A;  2MC3 A;  2HWV A;  2EFO A;  3LAJ A;  1R1T A;  2RNG A;  4AWX B;  1T8I A;  1L0O C;  4IQ4 A;  2G0E A;  3RPQ A;  3GLX A;  1O3Q A;  1YYV A;  2EZI A;  3OL4 A;  3GTG J;  4EVI A;  2OV7 A;  4FE4 A;  3S3N A;  4Y17 A;  1WJF A;  4Z2Y A;  4HPQ A;  2CO5 A;  5DTD A;  1FYL A;  3ECO A;  1JXS A;  2X9D A;  2R7S A;  4WK8 F;  3RSN A;  1QA6 A;  5H6Q A;  3ZQF A;  1DGR M;  4CUG A;  3W2V A;  3FIS A;  2FD5 A;  3DEU A;  1KON A;  4BJ5 C;  2M7B A;  2ME0 A;  1RKT A;  4UHT A;  1LQ1 A;  5H20 A;  1U9N A;  5KAF C;  2W4S A;  3UNG C;  5C4X J;  1OPC A;  3GZ5 A;  4G8X A;  4UVA A;  5H2F C;  1R7J A;  3FKJ A;  2IEK A;  4ZDP A;  3RCO A;  2RV8 A;  2OD5 A;  2QBY A;  3LL7 A;  2D45 A;  3CCY A;  3K70 C;  3QOD A;  3ZR8 X;  1R1V A;  2KJC A;  3J80 K;  3JRC A;  2F5D A;  5ILV A;  5JVG F;  5FRM A;  1WRJ A;  3N05 A;  1Q1H A;  3PM1 A;  3UR3 C;  3PUB A;  1SEU A;  1K4T A;  3DBH B;  1FC3 A;  3ASO H;  4KUM A;  2QQ8 A;  4UUV A;  1H8A C;  4XKB A;  3HYI A;  1OYI A;  2IAI A;  3QP5 A;  2QYO A;  2MH9 A;  4XM3 A;  3H0G J;  3QU6 A;  3VOE A;  1WZ2 A;  3IH2 A;  3QYB A;  1G6N A;  3OOU A;  1G4D A;  4LIV A;  1YLF A;  5FKM A;  2E2J J;  3L2R A;  2ZFW A;  2HOA A;  1FEX A;  2ZJQ F;  5CVI A;  3DP7 A;  3CJQ B;  4X6A J;  5HOD A;  1TT5 B;  4W97 A;  2FRH A;  9ANT A;  2JA6 J;  1CF7 B;  1UHS A;  4BXX J;  1V54 H;  5HS7 A;  2LR8 A;  5JR3 A;  4OAY A;  4LG0 B;  4BBS J;  4CYD A;  5K7F A;  5LEK A;  1Z3X A;  4F52 A;  2O3F A;  2WB1 N;  2RKH A;  4B48 A;  3M1C A;  3Q9S A;  3IAM 2;  3A1Y A;  1ZLK A;  5IT9 Z;  5HNF A;  1ZR4 A;  3PIO F;  3F8C A;  3P9K A;  1LNW A;  3KP3 A;  4BY1 J;  2ELK A;  3CCS I;  4DNC A;  2K85 A;  4HLX A;  3PSF A;  3CLQ A;  2XUB A;  5J40 A;  2FNA A;  2Y30 A;  2RQP A;  3I5U A;  2CW0 F;  4JX6 A;  4PGG A;  5LHG A;  3WTY C;  2X6Y A;  4V2F A;  1VND A;  3R6S A;  5TJJ A;  2BY2 A;  4ZYH A;  1ZAO A;  1FWZ A;  2LC2 A;  4BQQ A;  3HTU A;  3CF5 F;  1BI0 A;  2L9R A;  5ED4 A;  3SFZ A;  2W57 A;  2DT6 A;  2X4H A;  2E1N A;  1MW7 A;  3EUA A;  2HPI A;  3AG4 H;  3J81 Z;  2DPD A;  3WU2 C;  1GVJ A;  3TW6 A;  3MKW B;  3KEQ A;  4RAZ A;  5EZG A;  2IA2 A;  1LJ9 A;  1HQC A;  4ITV A;  2HOS A;  2JUG A;  3L09 A;  5J47 A;  2R93 J;  1OCO H;  4FX0 A;  2V4J C;  2HDD A;  4KIS A;  4EJT A;  2FXA A;  2MH2 A;  3E5U A;  2ECC A;  4IEJ A;  3S3O A;  1AKH A;  2ZCW A;  1MJ9 A;  3GFI A;  4RDU A;  5HLT A;  3P7N A;  2XAJ A;  2NRA C;  1MDM B;  3SZT A;  2HOT A;  1Z7U A;  2VXD A;  3COA C;  4AIJ A;  1HLV A;  1SVL A;  3FK6 A;  2R5Z B;  2PJR A;  5J4Y A;  2XPV A;  2WAF A;  4DQ2 A;  3KYL A;  3HL2 A;  1HST A;  3MAJ A;  5DD4 A;  4ANJ A;  2R7V A;  4BH9 A;  2E1M B;  2IGO A;  4GYI A;  4XID A;  4A3J J;  4GDF A;  1DPR A;  2H1L A;  5E1X A;  2O5R A;  1TL8 A;  2LF7 A;  3HHH A;  5E3O A;  4RMN A;  1LFP A;  2K5C A;  3IHU A;  1QNT A;  2DFH A;  4M73 A;  4HV5 A;  3F72 A;  3Q0W A;  1Y8Q B;  4G6T B;  3LSK A;  2F4I A;  2ID3 A;  3GWZ A;  5CVV A;  2VQH A;  3GUD A;  1IV8 A;  3HG9 A;  1KYW A;  1OR7 C;  1F9N A;  2W00 A;  5LLQ A;  3DLL F;  3Q9V A;  4H0E A;  5LD2 C;  1LPQ A;  3QOE A;  4G6D A;  3H0D A;  2HYG D;  1G3W A;  2JPC A;  3ZQH A;  1IAW A;  3ZGK A;  1A35 A;  1IZ1 A;  4P55 A;  5DUI A;  1R5G A;  3HIF A;  4EEF G;  3RPU D;  1TWG J;  1T0F C;  2MBF A;  2QKM B;  2CUF A;  3IH3 A;  1GV5 A;  1U5T B;  3OYJ A;  3VFZ A;  1WGX A;  3CUQ B;  2CGP A;  4IHV A;  2L7K A;  3CZ6 A;  3SJM A;  5HS8 A;  4B44 A;  1I27 A;  2EQR A;  1MMG A;  4U7B A;  1CQT A;  4A3M J;  5FLM J;  1IRG A;  4XRM A;  4HA8 A;  1JJ8 C;  2DMT A;  2VOD A;  2WTE A;  1UB9 A;  3ZP5 A;  2ZC2 A;  1B6A A;  1EH8 A;  2EFW A;  2DTZ A;  3BQZ A;  4DZP A;  3ZN1 A;  4NC7 A;  1QBJ A;  2OTJ I;  3ZMT A;  3GZN B;  1W0T A;  3CES A;  3JR9 A;  2R92 J;  2VKV A;  3S93 A;  4HNT A;  4PK4 A;  5D6E A;  2YX7 A;  3GTM J;  2HOE A;  3DKX A;  1SFK A;  4W1U A;  3EUK L;  1Y1W J;  2XF5 A;  4CCO A;  1S9H A;  4ESJ A;  1QZE A;  3H9J A;  3HKZ N;  5CQG A;  1X58 A;  3K9T A;  2G7H A;  2V7F A;  3ZQI A;  1WJE A;  1E2X A;  4ZZL A;  4QIW N;  3TBI A;  3LQQ A;  3F6V A;  1Z6R A;  1U6G A;  3TGN A;  2CW8 A;  4RA2 A;  4XLH A;  4IRI A;  4OU0 A;  1B72 A;  4JP0 A;  2FQ3 A;  5F0H A;  3D0S A;  3DEE A;  3KX2 A;  5L3C A;  5TIS C;  1T6S A;  2M8E A;  5B1A H;  3S1R J;  1BJA A;  2VQG A;  3HSE A;  3JRH A;  4M3G A;  2FBH A;  1QU3 A;  1UG0 A;  3FHZ A;  4JX4 A;  3FM5 A;  4QTR A;  2AS5 F;  4HZF A;  4IHT A;  2QQA A;  4B1R A;  2E1O A;  2ZXJ A;  3BC8 A;  1CGP A;  4G94 A;  2FML A;  4ENN A;  5IP7 J;  3I64 A;  2EH3 A;  1HW2 A;  2ELH A;  3CD6 I;  1UCR A;  3V7R A;  2BEO A;  2IVM A;  3I53 A;  1U3E M;  1ZN2 A;  3E6D A;  4DW6 A;  3A01 B;  2IXS A;  4DYR A;  1JHH A;  1TWF J;  3CUO A;  4N9H A;  2M30 A;  3P5J A;  5FKN A;  2MLG A;  3FZV A;  1OYY A;  1RZ4 A;  2QWW A;  4YRV A;  4MLO A;  3M8J A;  4OIO F;  1TZL A;  4C3H J;  3BPV A;  2FOK A;  2X51 A;  4EGY A;  2K4J A;  2A61 A;  3OS1 A;  2HYJ A;  4RB3 C;  2VPL A;  3KCC A;  1MMA A;  4U88 A;  1GXP A;  3HKZ A;  2XGC A;  3OYG A;  2MD0 A;  1MBE A;  1IGN A;  3DQV C;  2MYS A;  5FFX A;  2ZXI A;  1HF0 A;  4UUS A;  2E2H J;  5M3F J;  3JRE A;  3MZ8 A;  3M07 A;  3HZJ A;  1BM9 A;  3WE2 A;  3UKG A;  5HLH A;  2ZME B;  4HX8 A;  2ELJ A;  1JTY A;  3HSR A;  4HBL A;  1U78 A;  2MC4 A;  1YIT I;  3MZY A;  4I0B A;  1YJN I;  2X1E A;  1XGO A;  1HCR A;  4L5J A;  2CJJ A;  1BI2 A;  2V9P A;  4ABZ A;  4P9U A;  4IXA A;  2ZXW H;  3IKV A;  2CW7 A;  2Y0M A;  3HOS A;  4I76 A;  2XGE A;  4EM0 B;  4ZTJ A;  2VKD A;  5IYB J;  3CJR B;  3HC7 A;  2PBI A;  5KVR A;  5K1Y A;  3JRF A;  2QSH X;  1WSU A;  3J7A Y;  2VKE A;  1RNL A;  3C2H A;  1Y56 A;  3BR2 A;  4M6X A;  2GZW A;  3F8N A;  1AHD P;  1FBS A;  4UUT A;  3PNY A;  4OAZ A;  3A02 A;  3F3X A;  3H5R A;  1VQN I;  2FOW A;  3HGY A;  1JKR C;  5ICE A;  2BV6 A;  4LK1 F;  2VIX A;  1YRN A;  1ITY A;  4XLP F;  5J3L A;  1PYV A;  3M7G A;  2IGK A;  2JMW A;  2LMD A;  2E35 A;  3IH4 A;  2YSR A;  1W5T A;  2EA2 A;  2JVG A;  1N75 A;  3I71 A;  3BQY A;  3VSL A;  5FJ8 J;  2WAQ N;  2IP2 A;  1LB2 A;  4KJZ A;  2DDA A;  1VQL I;  2QZ8 A;  2K9L A;  2VJ4 A;  1P4A A;  2UXX A;  3PUF A;  4LLG F;  1DPU A;  4FT8 A;  1B72 B;  3ABU A;  2HVS A;  2RRE A;  3H9G A;  2Y69 H;  3TOA A;  2Q2E B;  1R5I D;  2VLA A;  4G7H F;  3K7A J;  4GXO A;  4M9S A;  3VSK A;  4N9I A;  2PG4 A;  2QF7 A;  3NAR A;  1Y39 A;  1YIJ I;  2GA1 A;  1VF9 A;  3ZQL A;  5GAH J;  2WAD A;  3HRS A;  1IN5 A;  2NOG A;  4AU7 A;  2QSG X;  1SMY F;  3GW2 A;  3WGH A;  3W6J B;  1SVO A;  1WH5 A;  3ABM H;  4IHS A;  2VON A;  1SAN A;  1PP8 F;  3CC4 I;  2JRT A;  2K86 A;  3BR6 A;  4XLN F;  5CVU A;  5LHI A;  1WQ2 A;  1ZEL A;  5JI6 A;  3U9G A;  1TLH B;  1V5G A;  1ZKG A;  2DA3 A;  3GME A;  2NNY A;  2G9W A;  1IV6 A;  3H9Q A;  2YU9 J;  1I3Q J;  1S3J A;  3QAH A;  1FP2 A;  4LB5 A;  3OMY A;  1XDU A;  4F93 B;  3BZC A;  3HUG A;  3QPT A;  1ULY A;  4CCN A;  2PFB A;  3ECH A;  3KP4 A;  5JVT A;  1OFC X;  3HPG A;  1IW7 F;  3JSP A;  1TQP A;  1EA3 A;  2DDB A;  2XAH A;  4IQJ A;  1OLT A;  2N8G A;  1VQO I;  2K27 A;  2MSY A;  2B0L A;  1VQM I;  3OYD A;  2DMU A;  3GBG A;  1Y8R B;  4R8H A;  2IPQ X;  3I4P A;  3ROU A;  1HDD C;  1FZP B;  3S16 J;  3R4K A;  2R4G A;  1I1S A;  2WAQ A;  2NYX A;  2W25 A;  4BU2 A;  3S32 A;  1T56 A;  5J1U A;  1YJW I;  5EGO A;  2DLL A;  1H88 C;  1WPK A;  2UWM A;  3WHB A;  5BMZ A;  1P92 A;  4HX4 A;  3GYH X;  3HOT A;  2HTJ A;  3CO6 C;  2EPF A;  2HVQ A;  1OJL A;  4LGW A;  4GRI A;  4FE7 A;  4HG2 A;  1SFO J;  1KU3 A;  3JCU C;  3NAU A;  2BW3 A;  3K69 A;  2XB5 A;  2XGX A;  2OQR A;  5FKK A;  2L9S A;  5BOX A;  1ERD A;  3ABK H;  3EPZ A;  2EIN H;  4M3E A;  3QOP A;  5IT9 K;  1V5F A;  5FFZ A;  3G1O A;  3P9I A;  4BAY A;  2FSW A;  3M9A A;  3E6B A;  1RRJ A;  2L01 A;  1O3T A;  1Z77 A;  1ZH5 A;  1V55 H;  3CDL A;  5J4V A;  5EF6 A;  5DV5 A;  1LKX A;  1GXQ A;  5CQE A;  2CFX A;  5CYV A;  2DA6 A;  1MMD A;  1B8I B;  3M3Y J;  5D8K B;  2OZ6 A;  1D5V A;  4L9N A;  3J7A O;  1IUY A;  5A2Q Z;  3J81 K;  1Z0X A;  3MWM A;  5C44 J;  2HDC A;  1I3A A;  4KT6 A;  4L18 B;  4XON A;  2QQ9 A;  3HRU A;  5FD6 A;  2EV0 A;  5CLS A;  5L3G A;  2R0Q C;  3WGI A;  1YOV B;  4RM3 A;  3FXU A;  2F5F A;  3OYM A;  3TDU C;  2HS5 A;  3LOC A;  1X1P A;  3KEY A;  4HOB A;  1MBH A;  2D1H A;  1ONV A;  1OCP A;  1W7P D;  1BC8 C;  2LYC A;  3MMY B;  3CJN A;  3TQN A;  5E8G A;  2LG4 A;  2EZK A;  2BHY A;  1X3U A;  3G1M A;  2JA7 J;  3VPR A;  2PMZ N;  2QCO A;  1T39 A;  3S1Q J;  4ZZD A;  1KA8 A;  3QRF F;  2PEX A;  4HNU A;  5HNH A;  2NVY J;  4BE2 A;  4P1W A;  2IBD A;  3KZI C;  2A5Y B;  1MSF C;  5LBQ A;  3KLO A;  4RGU A;  4ASN A;  2VN2 A;  1MZB A;  2K9N A;  2DFF A;  3W6K B;  1YO5 C;  2CU7 A;  3GF2 A;  5E17 F;  3FDY A;  1IDY A;  2CS3 A;  3QYF A;  2VT2 A;  4V19 K;  1ETO A;  3JW4 A;  5ICF A;  2LK2 A;  3Q0U A;  1CF7 A;  1R1U A;  4D0P A;  4J01 A;  2HTS A;  1O7L A;  2O6G E;  4LG0 A;  1KU2 A;  5JLW A;  2OC6 A;  3LSG A;  1X4P A;  3A0B C;  4N4N B;  2HPM A;  2AXL A;  4AM3 A;  3DLA A;  1OCR H;  1IDZ A;  1Q1V A;  3IWZ A;  3CCR I;  1VFC A;  3G2B A;  2K02 A;  1G2H A;  1TBX A;  1DP7 P;  4ZYE A;  1NK3 P;  4XLF A;  2LY1 A;  2UV1 A;  5DS9 A;  3BY6 A;  4RB0 A;  1G3T A;  3BPX A;  2LKS A;  3HRT A;  3TOB A;  2DA4 A;  3ERM A;  3GCM A;  4KN4 X;  3I3L A;  1BOB A;  1KQ8 A;  4XKC A;  5FKL A;  1IXR C;  2X6O A;  3FK7 A;  2M5W A;  2GBY A;  2L0K A;  4E7Z A;  1ZTR A;  1V5E A;  2DJN A;  2VC1 A;  2X1D A;  2EJR A;  3OOP A;  5LGT A;  2DA1 A;  5F0C A;  1ZAR A;  2CUZ A;  2PMZ A;  1R49 A;  2XAF A;  5FGM A;  2R7O A;  1NG6 A;  2V1U A;  4JBA A;  2EBI A;  1TWH J;  1UFM A;  3FBN B;  3OYC A;  3EUH A;  3Q5F A;  2WA0 A;  2O8K A;  4OIQ F;  1AOY A;  3WU0 A;  4IF4 A;  1BI1 A;  1KU7 A;  2BY1 A;  2Z9O A;  1T2K A;  1MDM A;  4I09 A;  3RKQ A;  1YW8 A;  5BPI A;  1XMK A;  3IRR A;  5CPR B;  4I99 C;  1TW2 A;  4N0B A;  2JSP A;  2ZKZ A;  4I7H A;  2R5Z A;  2LKX A;  1G3S A;  2KDO A;  4QPO A;  3BCA A;  3CCM I;  4DIQ A;  3HTS B;  4BY7 J;  4O3M A;  2I5U A;  3E6C C;  2B9S A;  3OWT A;  4BGD A;  5D5X B;  4BXF A;  3F8B A;  1Z6T A;  4RGS A;  4GCV A;  2HZT A;  2DK8 A;  1LVA A;  4HX7 A;  1H89 C;  1BC7 C;  3S17 J;  1TWC J;  2BBY A;  2LTP A;  1JHF A;  4O6J A;  1RUO A;  3E1S A;  1GT0 C;  3CMY A;  4G7Z F;  3A03 A;  4LFU A;  2W7N A;  4B09 A;  4GGG A;  4HRI A;  2HQA A;  2COB A;  3K6G A;  1IF1 A;  5LGU A;  2HKX A;  2V79 A;  5HDN A;  1I1G A;  3JRA A;  1TNT A;  4L5E A;  2CQN A;  1E3P A;  1W1W E;  2L7M P;  4M6Y A;  5D8L B;  4CCL A;  2P7C B;  2F4M B;  3FKI J;  2GXG A;  4BXU A;  3RTR A;  2MGQ A;  2RC4 A;  4UY8 I;  4Y4R A;  1U5T A;  4QSH A;  2JPB A;  2VBY A;  2EIL H;  3K4B A;  1SFE A;  1ORK A;  3CUQ A;  4IVN A;  4UVB A;  5J6X A;  3WTS C;  1I39 A;  2FEZ A;  2HXO A;  3D5L A;  5IYC J;  1SFU A;  4L9J A;  4HF0 A;  4MGR A;  3BR3 A;  1ZR2 A;  2O8X A;  1G8X A;  2DMQ A;  3NEU A;  2FX0 A;  4Y52 J;  5J8C A;  3B73 A;  4NQW B;  1IJW C;  2BY3 A;  2R5Y B;  1QHH D; 
#chains in the Genus database with same CATH homology
 4HQM A;  5E8I A;  4ZYG A;  4BHB A;  2JSC A;  1ON1 A;  3KP5 A;  1I6X A;  5ILS A;  5J8F A;  2E1C A;  2A3S A;  4KIC A;  2XAG A;  3QP6 A;  1RIO H;  2HQR A;  3GVA A;  2OBP A;  4U0V A;  2RGV A;  2F2E A;  3RYP A;  1YW9 A;  3EYI A;  4R79 A;  2J5P A;  5DYM A;  3EQL F;  3K1M A;  1P4W A;  1A04 A;  3RKW A;  3LWF A;  1D3Y A;  4UNO A;  1HKS A;  4ZH4 F;  1MJB A;  1XSV A;  2UZK A;  1W5S A;  3BP8 A;  4MEX F;  3ISP A;  3GEZ A;  3MCZ A;  1YFH A;  2XKP A;  1LDK B;  5TRD A;  2DPU A;  1ZRF A;  3K1P A;  3T8R A;  4EQQ A;  4RB2 C;  1BI3 A;  1REP C;  1XGM A;  5ILU A;  3LQR A;  1S8N A;  1LEB A;  1P2F A;  5L3E A;  4OMZ A;  1KQ9 A;  3RIR A;  3ML6 A;  1FBU A;  3I59 B;  1FSH A;  4YFN F;  2ZME A;  2FBK A;  3K1N A;  4I02 A;  1K6O A;  4A5N A;  3TO6 A;  1R00 A;  3JTH A;  4PDK A;  4ENJ A;  3VEP A;  2GA2 A;  4A0X A;  1ZRE A;  2G7U A;  5FD5 A;  3GX4 X;  2O0Y A;  5HDG A;  1FOK A;  2LF8 A;  4IJA A;  3FMS A;  3PQK A;  1JGS A;  4RGX A;  1HSJ A;  1FNN A;  2PLY A;  1FBQ A;  3GFL A;  3LAP A;  3O6B B;  4YIF A;  3O2P E;  5D4S A;  4ESB A;  3QU3 A;  3ZMZ A;  4G9Y A;  3WU1 B;  4ETS A;  3NRV A;  3FMR A;  4KN7 X;  2ZNY A;  3L00 A;  1QGP A;  2R7F A;  3PQJ A;  2Q2E A;  1XCV A;  1F4K A;  3ZN0 A;  4UVC A;  5A2Q K;  3EET A;  1MKM A;  1QZY A;  3C1D A;  1O3R A;  1O3S A;  1P6R A;  4OIP F;  1P4X A;  3GZ6 A;  2EK5 A;  2OU2 A;  5DCM B;  2NAZ A;  2DT5 A;  1NHA A;  4E70 A;  2EA4 A;  1W7P B;  4EGZ A;  3AAF A;  1ZG5 A;  1R58 A;  2VC0 A;  1RUN A;  5DD8 A;  2KIM A;  1XGN A;  4AVP A;  5BQT A;  4LLN A;  3C18 A;  1SD7 A;  4L0Z B;  2EFN A;  1OKR A;  4CO8 A;  1J0R A;  4MTE A;  1YQA A;  2ACJ A;  4UXN A;  1C0W A;  2Z99 A;  1ZYR F;  2F5C A;  5HVQ C;  2PQ8 A;  3TDZ C;  5LHH A;  5CJ9 A;  4P5O A;  3DPL C;  3V8J A;  4LB6 B;  3B02 A;  1FT9 A;  2ESH A;  2GWR A;  3DFG A;  2W24 A;  3V8L A;  3BZ6 A;  5L3D A;  3RKY A;  1T38 A;  4YFX F;  2OQG A;  2H09 A;  2DW4 A;  4JQF A;  1QO0 D;  5JFR A;  3K0L A;  4UV8 A;  1XD7 A;  4KA4 A;  1UHW A;  1G3Y A;  4XBF A;  1EH7 A;  3PFI A;  2ZBK A;  2M1B A;  3FMQ A;  4QWQ A;  1VTN C;  2QQB A;  1DDN A;  1OYW A;  3IWF A;  3BJA A;  5E1Z B;  2P7V B;  3DPT A;  1YW7 A;  2FA5 A;  1BOA A;  5K5O A;  2EFP A;  1ODD A;  5D6F A;  3C3W A;  3MEX A;  1D8J A;  3FM3 A;  2DAO A;  3BRO A;  4MEY F;  1J75 A;  1OR7 A;  2Q8K A;  2V1X A;  3T8T A;  1FP1 D;  2DQL A;  2W84 A;  5K5Q A;  1T0F A;  3F8M A;  3QPH A;  2OAZ A;  3BOQ A;  2H94 A;  1FX7 A;  1SD6 A;  3RPU A;  1D8K A;  3WTU C;  2L4A A;  2IA0 A;  4U7D A;  3E97 A;  5IT3 A;  3JSO A;  4IPA A;  3F23 A;  1B1B A;  2RVC A;  3KLN A;  4IRG A;  5HLI A;  3KP6 A;  4LD5 A;  2PJP A;  2STT A;  2VBZ A;  3OV8 A;  4AIH A;  3ZMU A;  4KIF A;  4TV7 A;  3JAM Z;  2BE5 F;  4KIG A;  2XV4 S;  3BWG A;  1K7A A;  4BNC A;  4MHG A;  3I54 A;  4KYW A;  1S6L A;  2ISZ A;  1IXS B;  4NB5 A;  2CYY A;  3F22 A;  5JHU A;  2GAU A;  3WGG A;  4ON0 A;  2HFH A;  5LRR A;  3N97 A;  1R5H A;  4YFK F;  2XIG A;  3CTA A;  4OMY A;  3R61 A;  3H3Z A;  5K5R A;  1WWX A;  3L2C A;  1Z91 A;  4HDV A;  3F6O A;  4KIB A;  4EMS A;  2NNN A;  4I0A A;  4XRF A;  3VB2 A;  2COM A;  5D5W B;  2L54 A;  4CGZ A;  3O3K A;  2M45 A;  3RKX A;  2XAQ A;  2OZU A;  1TQM A;  3CDH A;  2BGC A;  4ENM A;  3E3V A;  2XKO A;  4BHP A;  1HKQ A;  3V4G A;  1R22 A;  1XB4 A;  4NQW A;  1O7F A;  3N4M A;  5L3F A;  4L5I A;  1QQI A;  3BJO A;  5FLX Z;  2RN7 A;  1XSD A;  1J5Y A;  1EH6 A;  2GQQ A;  1STZ A;  2DBB A;  3DF8 A;  5F6F A;  2IA1 A;  5AIQ A;  2VOO A;  2EB7 A;  2H27 A;  1V3F A;  1J9I A;  1SMT A;  3WE3 A;  5CVJ A;  2ZJ2 A;  3WTT C;  2KIF A;  4CZZ A;  4L9V A;  2PMU A;  2FU4 A;  2A69 F;  4U0Y A;  2XRN A;  5D5V B;  1IN4 A;  3EYY A;  1I5Z A;  2DI3 A;  2MA3 A;  2PN6 A;  2O03 A;  4P96 A;  4EJV A;  3SQN A;  3ZMS A;  3IKT A;  4M72 A;  5HOO A;  4EJU A;  3CO7 C;  4EJW A;  3HRM A;  2EWN A;  3RJP A;  3E5Q A;  5DCF A;  2HYF A;  2PMH A;  4CXF A;  3M1E A;  2YPR A;  3H3U A;  2ZNZ A;  2OA4 A;  2VOP A;  4PZJ A;  5AIP A;  2WWY A;  1LDJ A;  1K78 B;  4MQ9 F;  5HS9 A;  4XSX F;  3I59 A;  2JZY A;  3GXO A;  2YR2 A;  3F21 A;  4I2O A;  2Z3Y A;  3GFJ A;  1Z05 A;  2D2W A;  3M8F A;  4A0Z A;  4HQE A;  4KNY A;  1J2X A;  4EM1 A;  3P9C A;  3WTV C;  2VBX A;  3LFK A;  1FLI A;  3G73 A;  1UST A;  4RAY A;  2QLZ A;  2LSO A;  3ABT A;  2IJL A;  2TDX A;  3U2R A;  3V7S A;  4BYY A;  3M8E A;  5DEQ A;  2X0L A;  1HXD A;  2IW5 A;  4RB1 A;  1ZG3 A;  3TO7 A;  4AIK A;  1RI7 A;  1AWC A;  1BIB A;  3RDI A;  1WI9 A;  1SFX A;  2YU3 A;  1TTY A;  5FB2 A;  1SD4 A;  5CVR A;  1J7K A;  5EEG A;  4HF2 A;  4A6E A;  3HSF A;  3FXR A;  5L3B A;  1XMA A;  3T1B A;  5DCM A;  3VOD A;  2EV5 A;  2V6C A;  4AD9 A;  4BHC A;  5F64 A;  2VE9 A;  1W7P A;  2STW A;  4HF1 A;  5BS6 A;  2JT1 A;  4YG2 F;  4P9F A;  4EJO A;  5E18 F;  4Y13 A;  4XSZ F;  4OIR F;  1YIO A;  4S04 A;  2QBY B;  2CQK A;  4Q5S F;  3REO A;  2H6B A;  2P5L C;  5EEH A;  4WXH A;  2DFI A;  3MFK A;  1V4R A;  1YG2 A;  3KZY A;  1ON2 A;  4YII A;  1KU9 A;  2J5O A;  1WKM A;  1J59 A;  4KDP A;  4MTD A;  1S7A A;  3ELK A;  4OIN F;  1ZLJ A;  2D1V A;  4M71 A;  3FWE A;  2RNJ A;  4HV6 A;  2K4B A;  4EV0 A;  2O61 A;  4ENK A;  1B9N A;  2L3D A;  1R23 A;  2R7D A;  3L9F A;  1ZGA A;  3L7W A;  4KMU X;  1B59 A;  2M87 A;  3I0T A;  3RI4 A;  4WXC A;  2VT3 A;  1H9T A;  2MLK A;  2LNB A;  1TQI A;  3GO5 A;  3TO9 A;  2A68 F;  2XHK A;  3WTW C;  2GIV A;  2A07 F;  1BBY A;  4LJZ F;  3WTX C;  1BIA A;  3KET A;  1YS7 A;  2CSO A;  1H0M A;  1ZHF A;  3JAM K;  1IN8 A;  1Y0U A;  3KE2 A;  5ICG A;  2QVO A;  2L02 A;  6PAX A;  4WWC A;  3JTG A;  4K2E A;  2Q0O A;  3E5X A;  1SD5 A;  4L9T A;  5HDK A;  3G3Z A;  4LMY A;  4FHT A;  2P6T A;  2F5E A;  3RYR A;  2HQN A;  4PGH A;  3J80 Z;  4WX9 A;  4I98 B;  1Z1D A;  2ZO4 A;  1IXC A;  1TW3 A;  1DUX C;  2DTR A;  2WC2 A;  4Q4Z F;  2PI0 A;  3I58 A;  5HLG A;  2FBI A;  4BQA A;  3FX3 A;  2A6H F;  2VBW A;  1KGS A;  4F7Z A;  3BDD A;  3R0J A;  2XRO A;  3EDP A;  5LEJ A;  1QPM A;  2P5K A;  5E1W A;  4RAZ A;  1ZGJ A;  2A6E F;  1EV7 A;  2DQR A;  3CLO A;  2KJB A;  4LK0 F;  4Q47 A;  2VXZ A;  4ESF A;  2XVC A;  4A12 A;  3GFM A;  4UV9 A;  4G7O F;  4EM2 A;  4CHU A;  2LDU A;  4O5V A;  4U0W A;  4A0Y A;  5FLX K;  3KP7 A;  2P5V A;  2P6S A;  1XCB A;  4ZYD A;  3SXY A;  3IRQ A;  3SHF A;  5E20 A;  3WG9 A;  3KEO A;  1B9M A;  4RS8 A;  2HGC A;  2HR3 A;  1HBX G;  4GYG A;  2DU9 A;  1YTY A;  2FF4 A;  4A2U A;  4HLY A;  3R60 A;  3U1D A;  5LGN A;  2EV6 A;  3R0A A;  4PCQ A;  1K79 A;  3ERE D;  3H92 A;  2HEO A;  4HW0 A;  2Y48 A;  3F8F A;  5D4R A;  3K2Z A;  1BN5 A;  3WOD F;  2Z5U A;  2XAS A;  3DXJ F;  1SAX A;  1XSX A;  5KK1 A;  2KKO A;  2JTV A;  1HKT A;  4M9X A;  1UHM A;  2E7X A;  4CIC A;  1JE8 A;  3WTZ A;  2YX4 A;  3E6M A;  2ETH A;  4FX4 A;  1ZRC A;  1TNS A;  2IT0 A;  2QM3 A;  2IRF G;  1GHC A;  4L0Y B;  4KMF A;  1HW1 A;  1LDD A;  1IN6 A;  4WCG A;  4M74 A;  2DK5 A;  1O57 A;  5ICC A;  1XDS A;  2NS0 A;  4CDG A;  2K7L A;  2C6Y A;  2MD5 A;  4NHJ A;  4WXD A;  2L4M A;  4Q48 A;  2VE8 A;  3ZQ7 A;  4A6D A;  1MGT A;  3LA3 A;  3NQO A;  1FY7 A;  2ADU A;  2Y75 A;  1FYM A;  1USS A;  1KQ0 A;  1U5T C;  2RDP A;  5DDG A;  4GO1 A;  3CUQ C;  3KZZ A;  2GXB A;  1ZRD A;  3IL2 A;  2Z33 A;  2ESN A;  2FMY A;  2UXN A;  1T98 A;  5AON A;  3MQ0 A;  5DUK A;  1PP7 U;  1F5T A;  3KP2 A;  4S05 A;  4KFC A;  3HHG A;  1H9G A;  4QLC U;  3V7C A;  2H6C A;  4OOI A;  2LKP A;  4MQV A;  1ZG1 A;  1YS6 A;  2WV0 A;  3TKY A;  3LA7 A;  3DV8 A;  1XGS A;  3KFW X;  1OMI A;  5FO5 A;  4M9Z A;  2KRF A;  2DO7 A;  1PUE E;  4HYE A;  5F1R A;  4HDU A;  1Z9C A;  4HAM A;  1S29 A;  2BYV E;  1MD0 A;  1L3L A;  2CG4 A;  1B4A A;  1QZZ A;  2W85 A;  4RGR A;  4B8X A;  2FE3 A;  1IRF A;  4LLL A;  1IN7 A;  3BJ6 A;  3ULQ B;  2P4W A;  4A5M A;  3V8K A;  1K78 A;  3S2W A;  2KIU A;  4Y15 A;  3DKW A;  3LA2 A;  2V9V A;  3LST A;  1LEA A;  3T5X A;  1FYK A;  2EFQ A;  1W4M A;  1KYZ A;  1F1Z A;  3ZMV A;  4I01 A;  2P8T A;  1HW5 A;  5ERI A;  2ISY A;  1XN7 A;  1U8R A;  3T0Y A;  5BPD A;  3MZH A;  4G6Q A;  5H6R A;  1PDN C;  1R36 A;  1U2W A;  1FPQ A;  4JK1 X;  2CWE A;  3FXQ A;  3ZMD A;  4KT5 C;  2QUF A;  1FSE A;  1E17 A;  5LRS A;  3ZPL A;  1MJA A;  3FF5 A;  4MNU A;  4WF2 A;  2E7W A;  4R1H A;  2R3S A;  2FNP A;  2V1D A;  5D5U B;  2HKO A;  2QEN A;  3SZP A;  1S7O A;  3C7J A;  4IRH A;  3IC7 A;  2MC3 A;  2HWV A;  3LAJ A;  2EFO A;  1R1T A;  4AWX B;  1L0O C;  3RPQ A;  3GLX A;  1O3Q A;  1YYV A;  4EVI A;  4Y17 A;  4Z2Y A;  2CO5 A;  1FYL A;  3ECO A;  1JXS A;  4WK8 F;  5H6Q A;  3DEU A;  4UHT A;  1LQ1 A;  5H20 A;  1OPC A;  3GZ5 A;  4G8X A;  4UVA A;  1R7J A;  2RV8 A;  2OD5 A;  2QBY A;  2D45 A;  1R1V A;  2KJC A;  3J80 K;  2F5D A;  5ILV A;  1WRJ A;  1Q1H A;  1FC3 A;  4KUM A;  4UUV A;  3HYI A;  1OYI A;  3QP5 A;  2QYO A;  2MH9 A;  3QU6 A;  3VOE A;  1G6N A;  1G4D A;  1YLF A;  2ZFW A;  5CVI A;  3DP7 A;  2FRH A;  1CF7 B;  5HS7 A;  5JR3 A;  4LG0 B;  4CYD A;  5LEK A;  2O3F A;  2RKH A;  3Q9S A;  1ZLK A;  5IT9 Z;  3F8C A;  3P9K A;  1LNW A;  3KP3 A;  4DNC A;  4HLX A;  2XUB A;  2FNA A;  2RQP A;  3I5U A;  2CW0 F;  4PGG A;  5LHG A;  3WTY C;  3R6S A;  5TJJ A;  4ZYH A;  1ZAO A;  1FWZ A;  3HTU A;  1BI0 A;  5ED4 A;  3SFZ A;  2W57 A;  2X4H A;  2E1N A;  3J81 Z;  2DPD A;  1GVJ A;  3KEQ A;  2IA2 A;  1LJ9 A;  1HQC A;  3L09 A;  4FX0 A;  4EJT A;  2FXA A;  2MH2 A;  3E5U A;  2ZCW A;  1MJ9 A;  3GFI A;  3P7N A;  2XAJ A;  2NRA C;  1MDM B;  3SZT A;  1Z7U A;  3COA C;  4AIJ A;  4DQ2 A;  1HST A;  3MAJ A;  5DD4 A;  4BH9 A;  4GYI A;  1DPR A;  5E1X A;  2LF7 A;  3HHH A;  3IHU A;  1QNT A;  4M73 A;  4HV5 A;  3F72 A;  3GWZ A;  5CVV A;  3GUD A;  1KYW A;  1F9N A;  5LLQ A;  3Q9V A;  4H0E A;  4G6D A;  2HYG D;  1G3W A;  2JPC A;  1IAW A;  1IZ1 A;  4P55 A;  5DUI A;  1R5G A;  3HIF A;  2MBF A;  1U5T B;  3VFZ A;  3CUQ B;  2CGP A;  5HS8 A;  1I27 A;  4U7B A;  1IRG A;  4HA8 A;  2VOD A;  2WTE A;  1UB9 A;  3ZP5 A;  1B6A A;  1EH8 A;  2EFW A;  3ZN1 A;  1QBJ A;  3ZMT A;  5D6E A;  2YX7 A;  2HOE A;  4ESJ A;  3K9T A;  2G7H A;  1E2X A;  4ZZL A;  3LQQ A;  3F6V A;  1Z6R A;  1U6G A;  3TGN A;  4IRI A;  4OU0 A;  2FQ3 A;  3D0S A;  5L3C A;  1T6S A;  2M8E A;  1BJA A;  3HSE A;  2FBH A;  3FHZ A;  3FM5 A;  2AS5 F;  4HZF A;  4IHT A;  2QQA A;  2ZXJ A;  1CGP A;  4G94 A;  2FML A;  4ENN A;  1HW2 A;  3I64 A;  2ELH A;  1UCR A;  3V7R A;  2BEO A;  2IVM A;  3I53 A;  1U3E M;  1ZN2 A;  3E6D A;  1JHH A;  3CUO A;  4N9H A;  2M30 A;  2MLG A;  3FZV A;  1OYY A;  1RZ4 A;  2QWW A;  4OIO F;  3BPV A;  2FOK A;  4EGY A;  2K4J A;  2A61 A;  4RB3 C;  3KCC A;  4U88 A;  1GXP A;  3DQV C;  5FFX A;  3WE2 A;  1BM9 A;  5HLH A;  2ZME B;  4HX8 A;  3HSR A;  4HBL A;  1U78 A;  3MZY A;  4I0B A;  1XGO A;  4L5J A;  1BI2 A;  4P9U A;  4IXA A;  3IKV A;  2Y0M A;  3HOS A;  4EM0 B;  2PBI A;  5KVR A;  5K1Y A;  1WSU A;  1RNL A;  4M6X A;  2GZW A;  3F8N A;  1FBS A;  3F3X A;  5ICE A;  2BV6 A;  4LK1 F;  4XLP F;  3M7G A;  2YSR A;  1W5T A;  2EA2 A;  3I71 A;  2IP2 A;  1LB2 A;  2QZ8 A;  1P4A A;  2UXX A;  4LLG F;  1DPU A;  4FT8 A;  3ABU A;  3TOA A;  4G7H F;  4GXO A;  4M9S A;  4N9I A;  2PG4 A;  2GA1 A;  3HRS A;  1IN5 A;  1SMY F;  3GW2 A;  3WGH A;  3W6J B;  4IHS A;  2VON A;  1PP8 F;  2JRT A;  2K86 A;  4XLN F;  5CVU A;  5LHI A;  1WQ2 A;  5JI6 A;  3U9G A;  1TLH B;  2NNY A;  2G9W A;  1S3J A;  3QAH A;  1FP2 A;  4LB5 A;  1XDU A;  3HUG A;  5JVT A;  1ULY A;  3QPT A;  2PFB A;  3ECH A;  3KP4 A;  1IW7 F;  3JSP A;  1TQP A;  2XAH A;  2K27 A;  2B0L A;  4R8H A;  2IPQ X;  3I4P A;  3ROU A;  1FZP B;  3R4K A;  1I1S A;  2NYX A;  2W25 A;  2DLL A;  2UWM A;  5BMZ A;  1P92 A;  4HX4 A;  3GYH X;  3HOT A;  2HTJ A;  3CO6 C;  4LGW A;  1KU3 A;  3K69 A;  2XGX A;  2OQR A;  5BOX A;  3QOP A;  5IT9 K;  5FFZ A;  3P9I A;  4BAY A;  2FSW A;  3M9A A;  3E6B A;  2L01 A;  1O3T A;  1ZH5 A;  5DV5 A;  1GXQ A;  2CFX A;  5CYV A;  5D8K B;  2OZ6 A;  1D5V A;  4L9N A;  3J7A O;  1IUY A;  5A2Q Z;  3J81 K;  2HDC A;  3MWM A;  4L18 B;  2QQ9 A;  3HRU A;  5FD6 A;  2EV0 A;  5CLS A;  5L3G A;  3WGI A;  3FXU A;  2F5F A;  3TDU C;  2HS5 A;  4HOB A;  2D1H A;  1ONV A;  1W7P D;  1BC8 C;  3CJN A;  3TQN A;  5E8G A;  1X3U A;  1T39 A;  4ZZD A;  1KA8 A;  3QRF F;  2PEX A;  2A5Y B;  5LBQ A;  3KLO A;  4RGU A;  4ASN A;  2VN2 A;  1MZB A;  3W6K B;  1YO5 C;  3GF2 A;  5E17 F;  2VT2 A;  3JW4 A;  5ICF A;  1CF7 A;  1R1U A;  4D0P A;  2HTS A;  1O7L A;  2O6G E;  4LG0 A;  1KU2 A;  2AXL A;  3IWZ A;  2K02 A;  1TBX A;  1DP7 P;  4ZYE A;  3BY6 A;  4RB0 A;  1G3T A;  3BPX A;  3HRT A;  3TOB A;  4KN4 X;  1KQ8 A;  1IXR C;  2M5W A;  2VC1 A;  2EJR A;  3OOP A;  5LGT A;  1ZAR A;  2XAF A;  5FGM A;  2V1U A;  4JBA A;  1UFM A;  3EUH A;  3Q5F A;  4OIQ F;  1AOY A;  3WU0 A;  4IF4 A;  1BI1 A;  1KU7 A;  2Z9O A;  1T2K A;  1MDM A;  4I09 A;  1YW8 A;  5BPI A;  1XMK A;  3IRR A;  1TW2 A;  4N0B A;  2ZKZ A;  4I7H A;  1G3S A;  3HTS B;  4O3M A;  3E6C C;  5D5X B;  3F8B A;  1Z6T A;  4RGS A;  4GCV A;  2HZT A;  2DK8 A;  1LVA A;  4HX7 A;  1BC7 C;  2BBY A;  4O6J A;  1JHF A;  1RUO A;  4G7Z F;  4LFU A;  4B09 A;  4GGG A;  1IF1 A;  5LGU A;  2HKX A;  2V79 A;  5HDN A;  1I1G A;  1TNT A;  4M6Y A;  5D8L B;  2P7C B;  2GXG A;  4BXU A;  3RTR A;  2RC4 A;  1U5T A;  2JPB A;  5J6X A;  2VBY A;  1SFE A;  3CUQ A;  4IVN A;  4UVB A;  3WTS C;  2FEZ A;  3D5L A;  1SFU A;  4L9J A;  4HF0 A;  4MGR A;  2O8X A;  3NEU A;  5J8C A;  3B73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...