1NK3P

Vnd/nk-2 homeodomain/dna complex, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*GP*TP*GP*TP*CP*AP*AP*GP*TP*GP*GP*CP*TP*GP*T)-3
publication title Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1nk3P00
5E3OA 3TP0A 3S16J 1SANA 1U9OA 4C3HJ 5EDNA 2NS8A 2XB5A 1F36A 2R7ZJ 1MH4A 2ID6A 2LD5A 3PM1A 1ZTRA 5F04A 2JA5J 1ZR4A 1ZQ3P 2MGQA 3JRDA 2EZKA 1GDTA 1TWAJ 2OPTA 1JGGA 1ETXA 3ZQIA 2L7MP 4X6AJ 5EF6A 1W0UA 4L5EA 5IYDJ 2Y0SN 1SFOJ 3HKZN 4XRSG 1FIPA 5K7FA 5DTDA 2DMQA 2YU9J 3HGYA 1IRZA 2MG4A 3OOUA 1OCTC 1MBKA 1P7JA 2NVXJ 3LNQA 2I10A 2NVQJ 1IUFA 3PO3J 2XGCA 3OSFA 1HOMA 3IH2A 1IDYA 2D5VA 3SDGA 3FKIJ 3K2AA 2DA1A 4DZPA 5EGOB 2O9LA 1ETKA 5EGOA 1X2MA 1ETYA 3HOXJ 4BY1J 3M4OJ 5FLMJ 2LY9A 2IAIA 5FJ8J 1ZR2A 2ZB9A 1VI0A 1JTXA 1ETWA 2L7ZA 1VNDA 4RBOA 2NVYJ 3DCFA 3TW7A 2FD5A 5J1RA 1JT0A 1IDZA 2AO9A 1HDPA 4QTRA 3RZDJ 4CYCB 2XGDA 1NK2P 1MBGA 2YUSA 1R9TJ 1BW5A 2XPWA 4B3AA 1POGA 4BY7J 3HM5A 2VKEA 2E19A 1AKHB 1P7IA 2JMWA 2QCOA 2M2EA 2N8GA 4HNVA 2Y31A 3S2DJ 2LTPA 2R5YA 2TCTA 2P81A 3QQAA 4AUXA 1MBHA 2WV1A 3RZOJ 1GVDA 2XGEA 4JX6A 1UG2A 2DMPA 2G0EA 2Y30A 4A3KJ 1TWFJ 3JRAA 3JRCA 4UUSA 4I6ZA 1B72A 1I6HJ 4BBSJ 3JRBA 3LSJA 4D5FA 1ETOA 4MFDA 2HXOA 1U8BA 3M3YJ 1MNMC 1GV5A 9ANTA 3Q0UA 3IV5A 1QVTA 5E3MA 3TEDA 4GFBA 2RAEA 3HB9A 4V2FA 4JYKA 5EG0B 2MSYA 2VI6A 4C2MJ 1MSEC 2HOTA 1BW6A 2ECCA 1RKWA 3F0CA 3ZQFA 5GPCA 3H3VK 5FKOA 4A3LJ 3A01B 3TW6A 1JKQC 1OCPA 3ZQGA 4MLOA 2DN0A 2HYJA 3GTOJ 2AHQA 1PUFA 5M5XJ 3TP3A 4BKXA 5F0HA 5IOZA 2EBIA 1B8IA 1HF0A 5EEAA 2E2IJ 1JKOC 1H8AC 1IGNA 3CQZJ 1ETQA 1TWHJ 5IOYA 4A3MJ 2LK2A 4DYCA 5BNGA 1RETA 2DA4A 3A03A 3Q3SA 2HDDA 3B6CA 2NOGA 3VPRA 3JRIA 5M3MJ 3JRHA 3BT9A 5C4JJ 4ABZA 3IH3A 1APLC 4FE4A 2R0QC 2CU7A 3BG9A 3ZQHA 4G12A 1ITYA 2JWTA 2OF7A 3JRFA 2VKVA 4M3GA 4X1EA 1JT6A 1JTYA 2CJJA 2EZHA 1HCRA 3Q0WA 3HBLA 2R93J 1W0TA 1H89C 3S1MJ 3S1NJ 1F43A 1Z77A 3E7LA 2M9HA 1WPKA 2DMTA 3CCYA 4M3BA 3S17J 1XS9A 1K61A 2CUEA 2CQQA 4FCYA 5HODA 3O8GA 2DMUA 2L9RA 1ENHA 2XPVA 1ZK8A 2COBA 5FKKA 3FIWA 5F27A 1Z0XA 1ZKGA 4BBRJ 3CDLA 3HGGA 2XB0X 5FKNA 3ZQCA 1OFCX 4RDUA 5F08A 2JJ7A 3FISA 2E1OA 4QSHA 2LR8A 4A3BJ 3MN2A 3MKLA 1HLVA 4CYCA 3BR5A 4M3FA 3CMYA 1QRYA 3LOCA 1ZGWA 1T56A 3LSPA 2K40A 1AKHA 2LLKA 5FKLA 1FEXA 4J19A 5GP9A 1LFBA 2HXIA 2Y9ZA 3JRGA 3LSRA 2EZIA 3C2BA 2YS9A 1LFUP 3PO2J 1BA5A 4XRMA 4XIDA 3QPLA 5IP7J 2HOAA 2LVSA 2KT0A 4IHWA 2JA6J 2JA8J 1RPWA 2W48A 4M6VA 1H88C 1ETVA 1XC5A 5M5WJ 1FTTA 5J1YA 1JKRC 4Y52J 4UUTA 1IJWC 3GTMJ 2DA6A 2H8RA 1MBFA 5EG0A 2HI3A 3W6VA 4BXXJ 2DA7A 3S1QJ 1WCMJ 3RQIA 2M34A 4JX4A 3HOZJ 1Y1WJ 3A01A 2MW8A 2E2JJ 4XRSA 4DZJA 1GT0C 1MBJA 4A3IJ 3RKQA 4A3GJ 4QIWN 5GPAA 2NS7A 3OIOA 1I3QJ 3BR2A 3WHBA 1A6IA 2LKXA 4DYRA 3G1OA 4FE7A 2GM4A 3HOVJ 1X58A 2GBYA 3HDDA 3A02A 5IPAA 2R5ZB 1G2HA 1WH7A 3BQYA 5J3LA 3NARA 1UHSA 4M3DA 2FQ4A 1FIAA 4B4CA 2M0CA 1Y1VJ 2EQRA 3GTGJ 4IHYA 2CQXA 3BG3A 3BG5A 1BL0A 2L7FP 2LP0A 3GTKJ 1GUUA 3L1PA 2JK3A 2K9SA 1LE8B 2O7OA 1LE8A 1RESA 1FTZA 3BQZA 1EF4A 2CRGA 4MO7A 1JKPC 4A3FJ 2Y2ZA 1TWCJ 4B1RA 4IHXA 3UKGA 4I76A 3S14J 1XG1A 5IYCJ 1MH3A 2DA3A 1TWGJ 3OSGA 5F0FA 3HEFA 1TC3C 5FLVA 2ME0A 4MIMA 5F1JA 1ORKA 4FISA 1S7EA 4DYQA 5C3EJ 2XPUA 3DEWA 3GTQJ 3GTJJ 1QPIA 3I4MJ 1CQTA 3IH4A 1DU0A 5M3FJ 4V2GA 2HOSA 3WHCA 1A5JA 2EH3A 3FK6A 2DTZA 1UMQA 2E2HJ 3BR0A 2HQ5A 4FTHA 2TRTA 1VF9A 4D5CA 1MBEA 2EZLA 3BR3A 2CUFA 5EZHA 1IC8A 5IP6A 2X6OA 3K7AJ 1T33A 2PMZN 2WAQN 4A3EJ 3QPSA 3SFIA 2H1KA 1NK3P 1IV6A 1X2NA 3H0GJ 3ZQLA 3S1RJ 1MSFC 3G1LA 5K7HA 3HOUJ 4AC0A 4S0HB 4M3EA 2ID3A 3I4NJ 5JLXA 1RR7A 2L0KA 3O8HA 2XSDC 1Q1VA 2M8GX 1O4XA 1WGXA 2LFBA 3JR9A 3BR6A 5IYBJ 3BR1A 1AU7A 2K9NA 1AHDP 1DU6A 3BTCA 1JUPA 1U9NA 1JJ8C 2FJ1A 1GV2A 4C3IJ 5F0CA 2QF7A 5E3NA 2VPRA 4IEJA 4A93J 2K9QA 4MFEA 1I50J 3BTIA 3MVPA 2Y9YA 4C3JJ 5C4XJ 1WH5A 4W1UA 2R5YB 3B6AA 3D1NI 1QVUA 3G1MA 4W97A 4XICA 5FKMA 5E3LA 2IEKA 4LOCA 4EEFG 3BTLA 3S2HJ 2X9DA 1K83J 2VUMJ 1IG7A 3NAUA 2XRLA 4UUSB 1FJLA 1B72B 1JJ6C 1D5YA 4NDLA 3SJMA 3GBGA 3BTJA 5JLWA 4A3DJ 1YRNB 2B63J 1YRNA 2JA7J 4JP0A 4A3JJ 2ME6A 2KDZA 5K7ZA 3GTLJ 2DA2A 2IBDA 3GTPJ 2JN6A 1RKTA 4A69C 2X48A 5EYRA 2R92J 4D7NA 1VFCA 1WI3A 3Q0VA 3JREA 5EZGA 3FK7A 3LSGA 5J1UA 3HOWJ 2DMNA 4XK4A 3ZOBA 5DS9A 2FX0A 2R5ZA 2DA5A 1JUSA 1NTCA 2ELKA 5IP9J 2NVTJ 1JUMA 3HOYJ 4Y7NJ 4D7MA 2GLOA 1PUFB 4DW6A 4IHVA 1U78A 4AYBN 2DJNA 2O8KA 1B8IB 1E3OC 3S15J 2WB1N 1BJZA 2ECBA 1HDDC 5C44J 1OJLA 5M5YJ 4A3CJ 4JX5A
chains in the Genus database with same CATH superfamily
1YLFA 3OYHA 1WQ2A 2L2OA 2XIGA 2M8EA 4NQWB 5CPRB 1ZLKA 1S7OA 4NQWA 2VQLA 1XB4A 1H9TA 1TT5B 2LD5A 4BYYA 4HF2A 4UV9A 3U1DA 2DBBA 4XQFA 1K7AA 2CV1A 1LNWA 2BY1A 1H0MA 3IAS2 4KITB 2IS1A 2VN2A 2W00A 1DPUA 3DF8A 1MMAA 5TGTA 2L3DA 1W0UA 4EM2A 1EJ9A 4IHSA 2DT6A 1O3TA 2Y0SN 3BZKA 4WX9A 3HKZN 2ELHA 4Y13A 2EFWA 2QSGX 2BW3B 2WC2A 2X51A 3C1DA 2BXYA 3F8BA 3PQJA 1XGMA 2CO5A 2MG4A 3FDYA 4P9UA 4ZTFA 3OOUA 2JRMA 3F6VA 2RQPA 3LNQA 2ZMEA 3HPHA 3F22A 2NVQJ 3BY6A 1IUFA 3J7AO 1G8XA 2A07F 1O7LA 3PO3J 4MQVA 1BI3A 2DA1A 1ETKA 2VT2A 3HUGA 1CF7B 2HU9A 3NEUA 1R5HA 1RI7A 3HTUA 3MKZA 3MZYA 5LHHA 1BJAA 1W7PD 3DPTA 1WJFA 4YIFA 1FT9A 1BM9A 2DODA 5CJ9A 1ETWA 2L7ZA 3EPZA 3WTUC 1FYKA 1GHCA 3RSNA 2NVYJ 4LLNA 4P9FA 3TW7A 3RPUD 2JA2A 3V7RA 1UHMA 5E8IA 1MZBA 3KX2A 2HPMA 1U5TB 2XVCA 1DGWY 2XGDA 1MBGA 2YUSA 4B3AA 1POGA 4BY7J 2VKEA 3HIFA 2E19A 1P7IA 2KZGA 4IO9F 4RLQA 5B66C 2DK8A 4HX8A 5BOXA 5J40A 4HNVA 2Y31A 2LTPA 2R7XA 2V1NA 2K9MA 5FFZA 2LF7A 2X6YA 3T0YA 1MMDA 2OC6A 4M9SA 5K1YA 1GVDA 3LFKA 1TWFJ 3JRAA 1YS7A 3CF2A 4UUSA 4PGHA 4I6ZA 1I6HJ 1D8JA 2IP2A 3PIPF 3DWLE 2D45A 2YPRA 2KDOA 3CESA 2HPIA 3H5RA 3LMMA 2L02A 3M3YJ 1D1AA 4EQQA 3AAFA 1GV5A 4F7ZA 1OPCA 3DBLB 1JHFA 2DFIA 3M7GA 5J8FA 4E7HA 1UG0A 3HRTA 2IS4A 2MH9A 4GFBA 2BY3A 4V2FA 5EG0B 4MEXF 2VE8A 2KLOA 4J00A 1BW6A 1GVJA 4G8XA 1JXSA 1FYMA 2ECCA 3ZQFA 3PFYA 2RC4A 5FKOA 4A3LJ 1FLIA 3COAC 4ZDOA 4M73A 2CGPA 4MLOA 2HYJA 1XGSA 5DD4A 3GTOJ 2PX9A 2Z5UA 1X3WB 3TP3A 4BL0B 4P55A 1AA7A 4R79A 5IOZA 2XAHA 5D8LB 1B8IA 3E5XA 1HF0A 2M87A 2J5OA 1JKOC 4Z6YA 3QYEA 1SD5A 4KN7X 1TWHJ 2H6BA 1WRJA 5BNGA 3C2GA 3GLXA 2OUMA 1XN7A 3A03A 2Y48A 4ZYHA 2EILH 4ABZA 2JT1A 1MJ9A 3IH3A 5LLQA 2H94A 2R0QC 1DUXC 4G12A 4ENNA 3VYTB 5D5WB 2ZBKA 2DU9A 3BZ6A 2OF7A 1MDMB 3JRFA 2G7UA 4X1EA 4E6KG 5ED4A 3M07A 1JT6A 1QU3A 4KMFA 4F55A 4MTDA 2EZHA 1K6OA 1LDDA 1X3UA 2E1MB 3MQ0A 2MLKA 4HEA2 2XKOA 3SXYA 1MIJA 4KISA 2W84A 4IRGA 5D4RA 4I0AA 1WJEA 2HNHA 2B9SA 4HX7A 1FOXA 2M9HA 1P4XA 1WPKA 2DMTA 1MMGA 4M3BA 1WSUA 1HA8A 2LY1A 3K4KA 2ZXIA 3O8GA 3OY9A 2DMUA 1FYLA 2COBA 5FKKA 5F27A 1BBYA 1Z0XA 4U7BA 3CDLA 3B02A 4GYGA 5FKNA 4RDUA 4FQGA 2WB1A 3ABMH 4IX7A 5ILSA 4M6XA 3V42A 5GAHJ 3ABUA 3MN2A 3A0HC 1X1BA 4YFXF 1BOBA 1W7PA 3ZP5A 4BDZA 4CYCA 4UHTA 2LBFB 1MGTA 1QRYA 3PNVA 1O57A 1H9GA 1ZGWA 2K40A 2QUFA 1KU9A 4R1HA 4XKBA 3RPUA 3GEZA 5FKLA 3G6EI 4XN0A 2MD0A 1Z9CA 2YR2A 3N05A 3V4GA 2ICWG 1LFUP 3TO9A 2M4KA 2XHKA 4LMYA 5HDGA 1XDUA 2YX4A 4XRMA 3I59A 3L2UA 4KIFA 2CQNA 3ASOH 4P96A 3M1EA 4KIGA 2Q0OA 5IP7J 1S6LA 4HOBA 1TW3A 2YU3A 4IHWA 2JA6J 2W1OA 5CQGA 1RC9A 4E7JA 2NAZA 2LMDA 1RPWA 4EJVA 2UUZA 3D5LA 2P8TA 2EIMH 4A0ZA 2FXAA 4XN3A 5IT9Z 1ODDA 2E5ZA 5M5WJ 3CUQC 1FTTA 1Y8QB 3LA2A 5J1YA 1FOWA 2LG4A 1UELB 2KPMA 2DA6A 1MBFA 2HI3A 4M71A 1U6GA 3DLLF 3LAPA 3EYYA 5JHFA 3CDHA 2O3FA 1I1GA 3KZZA 2ISYA 2L9SA 3CMAI 1KQ8A 1S5LC 1OCZH 5H20A 2MW8A 3V7CA 2F5CA 2EK5A 1RNLA 2ETHA 3V8KA 3X2QH 4DZJA 4RA2A 3D5RC 4U0WA 2D2WA 5L3EA 3OYJA 3RKQA 4A3IJ 1N25A 2R7QA 4LG3A 1P92A 3I64A 3M8JA 3BR2A 4MQ9F 3FXKA 3WHBA 4EGYA 2CYYA 4KMUX 2LKSA 4FE7A 4N9HA 5DV5A 4WCGA 2R5ZB 4A0YA 1G2HA 1DPRA 4BDYA 4BACA 1WH7A 2CW0F 5HLHA 3NARA 4M3DA 3EUAA 3K10A 1FIAA 3W2VA 1YW7A 2EV0A 1U3EM 1X1CA 3ZN0A 1QGPA 4YRVA 3P9IA 3VWBA 3GTGJ 3BG3A 4WK8F 2LP0A 4L9NA 3RKXA 3GTKJ 4IOAF 1GUUA 3L1PA 1LE8B 1IAWA 3OYEA 3KPHA 1LE8A 2BV6A 2M7BA 3BQZA 1UAAA 4MO7A 3BPVA 5CLSA 1BN5A 1BR4A 2DTRA 5A2QZ 3F21A 1IN5A 4I76A 4IPAA 5IYCJ 2K5CA 1TWGJ 1ZHFA 3OSGA 3QP6A 3LL7A 4MIMA 5C3EJ 1VQLI 4FHTA 3IL2A 4ZJZA 2VC0A 4HA8A 1CQTA 1DU0A 3MAJA 3KYDB 3KCCA 5HDNA 4YELA 1BI1A 4KFCA 2EH3A 5D4SA 1XTAA 3TO6A 2E2HJ 4RB2C 4D1QA 2TRTA 3OL4A 4PCQA 3WU1B 4F92B 1VF9A 4D5CA 4H4KC 3OR1C 3WG9A 1U5TC 3K7AJ 2BEOA 3HPGA 2XF7A 3OYNA 4PZJA 2K4JA 5EEGA 4HX4A 1NK3P 3LSKA 1LKXA 2NS0A 2VC1A 1X2NA 3H0GJ 3WU0A 1ZRDA 2E35A 2L54A 2QKMB 5D8KB 2F5DA 2NRAC 3I54A 1R36A 2R7UA 2CSOA 3I4NJ 3I56I 2VQGA 1RR7A 4Y17A 5LHGA 2XSDC 2M8GX 2A61A 3I0TA 4MTEA 5J4VA 5IYBJ 5B5EC 2V26A 2K9NA 5KAFC 3BTCA 1ZG3A 2R4GA 1JUPA 1FZPB 1V4RA 3SHFA 2FJ1A 2XF6A 3TDUC 4GO1A 5F0CA 4BU2A 2G9WA 1TNSA 1XPXA 4IEJA 4YEJA 3EUKL 4MFEA 1I50J 1QO0D 1BIAA 4Y3OA 1WH5A 2VBYA 1I27A 3W2AA 2MD5A 3OMYA 3TBIA 1S3JA 2GZWA 5L3DA 1W36C 4KICA 4LOCA 4EEFG 4BE0A 2FNPA 1ON2A 3SZTA 5LEKA 3WTXC 2NNYA 1Y0UA 2R7OA 3BTJA 3GF2A 1G3SA 2CS3A 4HBLA 5CKTA 1YRNB 2B63J 1CGPA 1YRNA 2C6YA 2JA7J 1HKSA 3WTVC 4UNOA 1D0XA 2EV5A 1PUEE 1R5GA 1MJAA 2X48A 5EYRA 5LD2C 4D7NA 2F5FA 1Z7LA 1VFCA 3KP4A 3KETA 5EZGA 2X1EA 3FK7A 4E7IA 3L2VA 1MJBA 2HYFA 2XRNA 3PUBA 4RAYA 1G3TA 2DA5A 4IKFA 5IP9J 2NVTJ 4Y7NJ 1MNDA 4BJ5C 4DJAA 3E97A 1YYVA 5HS9A 2P5LC 2KJCA 4IHVA 3MWMA 4XSZF 1KYWA 1KU7A 1V55H 4PSWA 3S32A 2O8KA 3BCBA 1EH8A 2NYXA 2WB1N 1BJZA 2ECBA 3CUOA 4EVIA 5C44J 5LGTA 4ZDLA 2CFXA 2F4IA 4BJ6C 3BROA 3HL2A 1K6YA 2E1MC 3CO6C 5EDNA 2BY2A 1W4MA 4DOZA 1T0FC 3DKWA 2R7ZJ 2MLGA 1MH4A 3JAMZ 1J7KA 5JVTA 2ID6A 3PUFA 3ZCOA 1QBJA 3CCVI 1YITI 2CV2A 1ZR4A 3JRDA 1OLTA 4J01A 2OBPA 1SD7A 2ZJ2A 3HRMA 2V9VA 2DLLA 2QLZA 2OPTA 1XSDA 1JGGA 2JUCA 1GDTA 4LB5A 3ZQIA 5B1AH 1Z05A 3K1PA 3BLYA 1Y6IA 5IYDJ 3CJQB 4EJOA 1R58A 3K4CA 4XRSG 1FIPA 3PL8A 3LWFA 1Y39A 2Q1ZB 2W25A 3KEOA 4HDUA 3U2RA 1TNTA 1USSA 1OCTC 1WZ2A 1PP7U 1P7JA 2I10A 3FWEA 2CUJA 3DEUA 3SDBA 3J81Z 1RZ4A 3OSFA 1HOMA 4UVBA 3SDGA 3K2AA 4HF1A 3KIOA 4BY1J 1ETYA 3M4OJ 5FLMJ 1FOKA 2LY9A 2IA2A 2IAIA 4EJUA 4CXFA 5L3BA 4YG2F 4II2A 3S3OA 2QENA 4BJTA 2ZB9A 3A4CA 4HG2A 3OYMA 3QRFF 1JHHA 2Y0MA 1JTXA 2DQLA 3U21A 5D5XB 4OIQF 1F1ZA 1N78A 1VNDA 4GDFA 3ECOA 3R60A 4PDKA 3K4BA 5ILUA 1IDZA 3IWFA 1NHAA 2AO9A 1HDPA 3RZDJ 3FXMA 5FGMA 3H1CA 3L09A 1R9TJ 2E1NA 1FPQA 5CVRA 4BEHA 1OQYA 2KRHA 2Z2SB 3O2PE 1QHGA 2M2EA 2N8GA 3ULQB 2M0MA 2DOFA 3ZQ7A 5KCMA 2P81A 3GZ6A 2GAUA 4U7DA 4AUXA 4LG0B 2DCEA 3RZOJ 1RUNA 2ZKZA 1SD4A 4UB6C 3CP8A 2KMUA 2XGEA 3OYLA 4A3KJ 4G7OF 2Y30A 2HVQA 3ZMVA 1U2WA 2V4JC 5D5VB 5CVJA 1VQ9I 4QPOA 4CSWA 4BS9A 4BBSJ 4XOPA 3SQNA 1W36D 3LSJA 2X0LA 3IKVA 4WF2A 1K4TA 4MFDA 2LKPA 3K4MA 2PMZA 1WWXA 1T8IA 2DI3A 2XAQA 1B4AA 3Q0UA 3IV5A 4C9YA 1QVTA 3Q9VA 3CUQA 1KGSA 2H6CA 1QPMA 2RAEA 3AKZA 5LFAA 2EA2A 2MSYA 2VI6A 4C2MJ 2BYVE 1S9HA 2DO7A 4ZH4F 3O3KA 4U0YA 3CCMI 5CVIA 2HOTA 2R7TA 3QPHA 1VQMI 2VIXA 5F64A 3CC7I 2GQQA 5LGUA 2LREA 5K5RA 3AL0B 3ABKH 3HRSA 3J7YJ 2OQRA 1JKQC 5LEJA 4HV6A 2XROA 2XGXA 3GLLA 1KA8A 1SFKA 3MCZA 2AHQA 5M5XJ 4BKXA 3P9KA 1TQIA 4I99C 3OYIA 2EBIA 5EEAA 2E2IJ 2B7EA 2QGUA 4L9JA 1H8AC 3I5UA 4KJZA 1IGNA 1MNEA 1T98A 2KKOA 5IOYA 4A3MJ 2LK2A 1R71A 3I53A 2W85A 2ZO4A 2BHZA 1LDKB 2VT3A 2ESNA 2NOGA 2OJED 5E79C 1FBUA 2X85A 3K4NA 5M3MJ 1TT0A 5C4JJ 1ACIA 2VE9A 4K2EA 4BGDA 3OYGA 1LPQA 3LSMA 3M9AA 2CU7A 4OMYA 1MMNA 4RAFA 2BHYA 3ZQHA 2V1DA 1ITYA 2V9PA 1SFXA 2VKVA 3FKJA 2A5YB 2HTJA 3K1MA 4DBQA 4BQNA 3ABLH 1FBQA 2KIUA 4ESBA 2F48A 4LGWA 3OYAA 2BW3A 3L2QA 3S3MA 2MYSA 3Q0WA 4E4HA 1TTYA 3HBLA 2L9NA 3HSRA 3K70C 4CO8A 2P4WA 1H89C 4EM1A 3S1MJ 1FNNA 4A12A 3VYRB 1X1AA 3H3UA 3I9V2 3E1SA 2OV7A 1REPC 2CUEA 1CF7A 3OYKA 3AFHA 5HODA 3H5AA 1HSJA 2L9RA 2ZXWH 1B1BA 2IPQX 1FWZA 1SFEA 2HR3A 3CLOA 3HGGA 2XB0X 1KZHA 1S72I 4YFNF 4B44A 4AYBA 2X1DA 4NBQA 2E1OA 5CVVA 3SYTA 1S29A 1VQ7I 1YJ9I 2JUGA 2QQBA 4A3BJ 1U5TA 3MKLA 1HLVA 4RLFA 2EA4A 3BR5A 4M3FA 2HS5A 4YIIA 1XCBA 2XAFA 3WU2C 1RUOA 3LOCA 3T5XA 2YX7A 4ZZDA 4HLXA 4CCMA 4XSXF 3DLAA 3L7WA 3H9JA 3I55I 3K6GA 2RN7A 4L9VA 4UV8A 2RDPA 1PYVA 2HXIA 3CZ6A 2EZIA 1BA5A 3ZMUA 2R3SA 3OYBA 4C2UA 2A68F 3DP7A 5KK1A 1IN7A 3UR3C 5DD8A 2FSWA 2VQHA 3FM3A 4OIOF 4CH7A 3LFUA 1WKMA 1PDNC 3VFZA 1XC5A 2KZVA 2KRCA 1TQPA 1W5SA 2HDWA 2UXNA 5HS7A 4I7HA 4OOIA 1OYWA 2QSFX 2L5QA 1YJWI 3GTMJ 1R23A 3K4JA 5H6RA 5EG0A 5K5QA 2GXAA 4BXXJ 5DUKA 2GXGA 4I2OA 2DQRA 2XV4S 1Z3XA 1D3YA 3FM5A 2M34A 3K9TA 5KVRA 2AS5F 1GT0C 1LB2A 4E7SA 3VYUB 4PGGA 3RDIA 3VSKA 4BQOA 4OMZA 1BC8C 2STTA 1A6IA 3OR2C 3RJPA 4DYRA 1J59A 3E6DA 2GM4A 1K79A 1OKRA 2KIQA 3HDDA 1TP4A 3WE2A 2F4OB 2PQ8A 1YI2I 1PVEA 2CMPA 2F5EA 5CYVA 3QYBA 3RKWA 2DFFA 1LJ9A 2RKHA 4P1WA 1L3LA 4Y4RA 4UVAA 2PBIA 1Z6RA 5HVQC 2L4AA 3BG5A 2I8DA 2IS2A 3U9GA 2JK3A 2K9SA 1MDMA 2O7OA 3FXRA 3WGGA 4A2UA 2VOOA 1MD0A 4OAYA 1RR8C 3E6CC 1XD7A 1JKPC 2RVCA 2Y2ZA 5HLIA 1YIJI 3FHNA 1IN8A 2HQNA 4M9XA 3S93A 4IHXA 3S14J 1XG1A 3GCMA 3V7SA 2DA3A 2K27A 4GXOA 5F0FA 5HDKA 1T0FA 2VJ4A 3NQOA 3KLNA 2XPUA 3PSFA 4CUGA 4ETSA 4L0ZB 3H36A 3HC7A 1QPIA 1T6SA 3EDPA 3OYDA 5M3FJ 2KL4A 3K70D 4V2GA 3WHCA 3I58A 2QYOA 3QAHA 2DTZA 2LF8A 3K4LA 4N4OB 5J8CA 5FLXK 3UNGC 4Q4ZF 1IC8A 2X6OA 2PMZN 2ZC2A 1MKMA 3GFLA 4ZDPA 4UB8C 3ERMA 4RGSA 4XLFA 2XKPA 4JBAA 3DV8A 1BI2A 4FT8A 4RGRA 1B9NA 4D9JA 3ZQLA 1FP1D 2LBFA 3G1LA 1WVRA 1TBXA 5JI6A 5ICGA 5FFXA 4BAYA 4M3EA 3FXUA 5LRSA 4G94A 4HYEA 4IRIA 4O5VA 4N9IA 2L0KA 1IXRC 3O8HA 4KDPA 3HSFA 1AU7A 3A0BC 3L9FA 1V5EA 3GFMA 1KU3A 2QBYB 4XLPF 2P0WA 2QKLB 1LQ1A 1GV2A 4B09A 2G7HA 2QF7A 3H3ZA 5E3NA 2WV0A 2QM3A 5FROA 2K9QA 3VODA 2H09A 3MVPA 2L4MA 2Y9YA 4C3JJ 5LGNA 2W7NA 1XMXA 2R5YB 4NUBA 2EFPA 4ENMA 1VQ8I 4I0BA 4B3XA 1STZA 3DFGA 4XOTA 2GOMA 3SZGA 4XORA 2IEKA 3VSLA 1P2FA 1GXPA 1SFUA 5FD6A 5FB2A 2IGMA 1K83J 1LDJA 1IG7A 5GAEJ 2XRLA 4EJWA 3AL0C 2DK5A 2RGVA 1FJLA 4L5IA 1B72B 1EH7A 4Z2YA 1SMYF 1Z21A 1Y56A 4CCOA 1FOYA 1TLHB 4XL9A 3MEXA 2H27A 3GTLJ 3GTPJ 3QU6A 1I3AA 2IGKA 2R92J 3P9CA 2LY2A 1WI3A 1VQ6I 3LSGA 3PNYA 4PSXA 5J1UA 4AIKA 4AVZA 2DMNA 1Y8RB 4XK4A 3ZOBA 2R5ZA 4U88A 4EV0A 1NTCA 3HOYJ 2R7WA 2XF5A 4D7MA 4OU0A 3ROUA 3OS2A 5ICEA 2GLOA 2HQAA 1PUFB 2B0LA 4YFKF 4DW6A 3E6MA 3KP5A 2FF4A 3HOSA 1AWCA 4AYBN 2DJNA 3ZPLA 2UWMA 2VASA 4CDGA 5D5UB 3PIOF 1HDDC 1OJLA 4IL6C 3GW2A 4BH9A 4AWXB 5E3OA 3TP0A 3KEQA 5D6FA 3OIQA 3D5SC 3CCLI 3JW4A 5KHDA 3F8FA 4C3HJ 2NS8A 2OA4A 2XB5A 1LVAA 2M1BA 3FXJA 1ZYRF 3KP2A 3FMSA 2JSCA 3EYIA 3IUOA 3PNTA 1ZTRA 2OQGA 2JA5J 3U1KA 2MGQA 1VQOI 2WA0A 2DT7B 3KZIC 2KP6A 4GCVA 1O7FA 3H0DA 5DM7F 1Z91A 5EF6A 3OYFA 4HQEA 3KZYA 3QYFA 5L3CA 3F6OA 2DFHA 1SFOJ 4IF4A 1IXSB 1FX7A 1G6NA 2PFBA 1FC3A 1SVMA 1WJCA 2DMQA 2V1XA 3SFZA 2YU9J 4CA0A 1W5TA 1MBKA 4FX4A 2NVXJ 5FRMA 1YJNI 4AU7A 4TV7A 3HHHA 1IDYA 3FKIJ 1HC8A 5EGOB 2E36A 3EETA 3TDZC 5EGOA 2X6XA 3HOXJ 1O3QA 3IHUA 3EQLF 4X0GA 1ZR2A 3BOQA 3WTTC 1I6XA 3RIRA 1G3YA 1FSHA 2IT0A 3HRUA 2NNNA 2VXDA 1W1WE 4RBOA 3H92A 2EFNA 3FBIB 3T8TA 3DCFA 4CYDA 3QPTA 5E1ZB 4LK1F 5IY5H 3HSEA 1I5ZA 1K4SA 2CV0A 1KQ0A 4RB3C 3AG2H 3EUHA 3MKYB 1BW5A 4HW0A 2FOWA 1BC7C 3HM5A 2VPLA 1AKHB 3CCJI 2FBIA 1P4WA 4RAGA 1U8RA 4LLGF 2DYSH 1IZ1A 4ITVA 2QCOA 1D0YA 3S2DJ 3HJEA 3KYCB 2TCTA 1LUJB 1MMSA 2JPBA 1F5TA 1SC7A 3RQ4A 5E20A 2WV1A 1ZGAA 4E7LA 3LAJA 1M1EB 2IVMA 3DQVC 5HS8A 1T38A 4PFOA 5FRNA 3BP8A 2Z99A 1YQAA 2G0EA 3HKZA 4JX6A 2A6EF 3JRCA 4HNTA 1E17A 1V54H 2M4GA 4RGXA 4XNFA 3NRVA 3F23A 2WAFA 2X6WA 4II3A 2GWRA 3JRBA 4M9ZA 1ETOA 1VZ0A 2QVOA 4PJLA 2HXOA 3Q5FA 1U8BA 4G6TB 3IAM2 3LA7A 1MNMC 2DT5A 2WAQA 4AM3A 2LDUA 3RYRA 4B43A 9ANTA 2DAOA 5DM6F 2HDCA 1X3ZB 3TEDA 3HB9A 3OV8A 1T95A 2QWWA 1RKWA 5GPCA 1SAXA 3H3VK 3A01B 4CCLA 3HXLA 2VOPA 1OCPA 3JCUC 2BGCA 4QPQA 3ZQGA 4O3MA 2K86A 3MZHA 4YIRX 4IQ4A 4HZFA 4BUPA 3E3VA 4ON0A 5AIPA 3CF5F 1OR7C 1OCCH 4DYCA 2V7FA 3J7ZI 4DIQA 2DA4A 3Q3SA 2WBMA 1X4OA 1Z7UA 1UCRA 3R61A 3VPRA 6PAXA 1R6RA 4OAZA 1KQ9A 3VEPA 2CW7A 2AXLA 4L9TA 3ZXSA 1APLC 1D0ZA 4FE4A 3ML6A 3HTSB 1X1DA 3BG9A 4CZZA 4CHUA 1XDSA 3JTHA 4S05A 2R7RA 3NWSA 3TL4X 4AD9A 2HVRA 4M3GA 2JRTA 3MZ8A 2ACJA 3L00A 2EFQA 3WGHA 5JR3A 2VBWA 5D6EA 2UV1A 1JTYA 4U0VA 4F91B 2JQ7A 2M30A 2CJJA 2ZFWA 4KYWA 2F5VA 4BQAA 2A69F 1N75A 1WJBA 5KNLA 1WHUA 2XUBA 1SVOA 1P4AA 3ABTA 4P5OA 5DDGA 2MC3A 5LRRA 1WFXA 2IA1A 2JTVA 4UUVA 1J0RA 1P6RA 2I5UA 3C3WA 3CCSI 3F8NA 2Z3YA 1XS9A 1K61A 2K4BA 5BQTA 2CQQA 1D8KA 4LIVA 3W2WA 5ILVA 4ASNA 4EJTA 2XPVA 4PJ0C 4C30A 3JSOA 2DOEA 5DCMB 3FIWA 4I02A 3QOEA 4DGWB 1ZKGA 1K78B 1OISA 1QHHD 2OTJI 2FMYA 3OS1A 3VYSB 3FISA 2VBXA 3ZR8X 2HKXA 4BHPA 2RQQA 1TQMA 4QSHA 2PJRB 2LR8A 2XAJA 3TMOA 2RV8A 3KYLA 3I3LA 3N97A 2ZSIB 1ZN2A 1YO5C 3G71I 3KP7A 2GIVA 1I1SA 1XSVA 5LHIA 4NC6A 3C2HA 2DXIA 1T56A 1XMAA 3LSPA 3CTAA 2D1HA 4IVNA 2LLKA 3LSHA 2E5NA 1R1VA 1BR2A 4A5NA 4XKVA 5GP9A 2A05A 2Y9ZA 3JRGA 2O03A 3IWZA 3HG9A 3C2BA 2OAZA 1Z1DA 2OU2A 3BPXA 1HSTA 2FRHA 5KAIC 4LG0A 4HV5A 4XIDA 3QPLA 2R7DA 1WJDA 2HOAA 2LVSA 2VKHA 3R0JA 3RYPA 1KONA 2HYGD 3CP2A 4HLYA 3TKYA 2JA8J 2HGCA 3G4SI 1R22A 4XONA 1YS6A 1UHWA 4BE1A 1FMWA 2ISZA 3G3ZA 1H88C 2PMUA 4GRIA 1UFMA 2FEZA 4ESFA 4KNYA 2FMLA 3TO7A 2P6SA 1JKRC 4V19K 4Y52J 1IJWC 5JHUA 5AIQA 4OWRB 3KLOA 3ZMSA 5A2QK 5FLXZ 2O0YA 3W6VA 2BVMA 2J5PA 4KT5C 2VJ5A 3E5QA 4U87A 2DA7A 2Z16A 3S1QJ 3RQIA 4OIPF 2HZDA 4XBFA 1Y1WJ 5FO5A 4XLCA 1B6AA 3DU5A 4LLLA 5ICFA 3CCEI 1R49A 5GPAA 4MGRA 2AQEA 2BVLA 1I3QJ 4MHGA 3QP5A 3CMMA 2OZUA 2EJRA 4PUSA 3G1OA 4IOCF 2GBYA 3OOPA 1G4DA 3M8FA 3JTGA 3BQYA 4HF0A 2WTEA 2Q2EB 5L3GA 4B4CA 2LNBA 2M0CA 1Y1VJ 2EQRA 3BG6A 3IP4B 3P5JA 2OD5A 4ESJA 4RAZA 3WTYC 2VL8A 3GYHX 3WGIA 1BL0A 2PI0A 2AXTC 2L7FP 3ECHA 3CC4I 1GLNA 1D1BA 4GGGA 2M7AA 3OIPA 1RESA 2QQ8A 1EF4A 3BJ6A 2CRGA 2F2EA 4AVPA 4A3FJ 1R00A 1ZRCA 4RB1A 3DXJF 4B1RA 4BE2A 1MH3A 1FP2A 4HSTA 2FNAA 5B1BH 1TC3C 5FLVA 3HEFA 4IJAA 2WY8Q 2GA2A 2ZXJA 4ZYAA 4ZC3A 5F1JA 3AG3H 4FISA 1S7EA 4DYQA 5GAGJ 1EV7A 2O61A 2HEOA 4AIHA 4CZCA 3I4MJ 3IH4A 1E3PA 3IRQA 1DQUA 4I98B 2XDVA 3DTIA 4G7HF 2P7VB 3FK6A 1UMQA 3L2RA 3BR0A 2HQ5A 2O5RA 1YFHA 2MFZA 4KUMA 4HAMA 2CUZA 5GTHC 2EZLA 3BR3A 2NVUB 4KA4A 4EATA 2E60A 2ZMEB 3GX4X 2CH0A 5IP6A 2OZ6A 1T33A 2WAQN 2XASA 3EUHC 4A3EJ 4LITA 2HFHA 1KU2A 1ON1A 1UJ8A 3QPSA 3HUGB 3SFIA 3FMRA 3QWLA 1IV6A 1E0EA 1T39A 3J80K 1O3SA 3S1RJ 1MSFC 3G73A 1XX5A 5K7HA 3GFIA 4Q47A 4AC0A 4S0HB 2EFOA 4FX0A 2VLAA 3R6SA 3H9QA 1A36A 1SEUA 3ZGKA 1O4XA 2LFBA 4HPQA 3JR9A 3BR1A 4G6QA 1FY7A 1G3WA 1AHDP 3GUDA 2HTSA 1VQPI 3QOPA 3FMQA 2E71A 1BIBA 2V9KA 5E18F 5GADJ 2EIJH 5CQEA 3DKYA 4RB0A 3RCOA 1VQ5I 2E34A 4NHJA 4LD5A 4C3IJ 1RRJA 1FBSA 4LJZF 5BPDA 2DDAA 4BXUA 2VPRA 4UXNA 2F4MB 4RM3A 4A93J 2W24A 3E5UA 3M8EA 3CCQI 2DPDA 5C4XJ 4W1UA 3B6AA 1KYZA 1QVUA 4MEYF 1T08B 3G1MA 4XICA 5E3LA 1W5CC 1YE9A 2HOEA 3TOBA 4HNUA 2P7CB 3BTLA 2IRFG 3S2HJ 3JAMK 2VUMJ 3WTZA 3NAUA 2VBZA 3H35A 4UUSB 1Y0NA 4XLEA 2L9VA 4WWCA 3V8LA 2K02A 1D5YA 2QA4I 2UZKA 4PJNA 3CCUI 3O6BB 3S2WA 1LVKA 3FBNB 3T8RA 3CD6I 2M3AA 1Z67A 4A3JJ 3GO5A 3KEYA 4A6DA 1QA6A 2ZNYA 2IXSA 3ZQQA 2XAUA 3FXLA 2K85A 3MFKA 2JN6A 4M72A 2GOXB 2V79A 5E17F 3GMEA 2ZJQF 2GIZA 2WADA 1IV8A 1J9IA 2E1CA 3Q0VA 3JREA 1UZCA 1Q1HA 3PJRA 4Y15A 3SEQA 3P7NA 4N0BA 1RIOH 1NH3A 5E1XA 2VQCA 4MNUA 3J81K 1JUSA 1A31A 1JUMA 2X4HA 2DW4A 2DJIA 3BG7A 1OCRH 1YHQI 2KISA 2CQ7A 2KJBA 3C7JA 1U78A 1B8IB 2ESHA 1E3OC 2K3PA 2PEXA 1F4KA 5M5YJ 2H8RA 4A3CJ 3A1YA 2EWNA 1IXCA 2MBFA 3S16J 1ZGJA 1SANA 1U9OA 5FD5A 2HVSA 3GXOA 3ONQA 2OCEA 1OR7A 1IN6A 2BE5F 3FZVA 1A6QA 1F36A 2A3SA 3PM1A 3ELKA 1Z3YA 1IN4A 3F3XA 3ZN1A 4Y33A 1R1TA 5F04A 4QLCU 1ZQ3P 3REOA 2EZKA 2CW8A 2W57A 5TISC 1TWAJ 1BOAA 2IJLA 2V1UA 3DBHB 1ETXA 2VXZA 2ELJA 2L7MP 3OS0A 4X6AJ 3I4PA 4NB5A 3CCRI 3K2ZA 1YOVB 4L5EA 2WAEA 4L0YB 2IW5A 2KFDA 5K7FA 2D1VA 1QZYA 5DTDA 2L7KA 3K69A 1S7AA 3HGYA 4CCJA 1J09A 1IRZA 5BPIA 2EINH 3S8PA 1V3FA 2ZNZA 1ZAOA 4PJMA 5H6QA 2ADUA 1FMVA 2K9LA 2XGCA 2Y69H 1X4PA 3IH2A 2D5VA 4XMYA 2O9LA 2PG4A 2CQKA 4N4NB 4DZPA 3FF5A 1X2MA 3H9GA 2PMHA 1IO2A 2IGNA 1R5ID 5FJ8J 3HYIA 2VODA 4XKWA 1IRFA 3BWGA 1OMIA 2DFEA 1VI0A 3KP3A 5ERIA 5EEHA 4BHCA 3MKWB 1EA3A 1X19A 1YX3A 2XSJC 1ULYA 2JPCA 4XLNF 2FD5A 5E1WA 5J1RA 2JSPA 4S04A 1JT0A 1WJAA 3I71A 3S3NA 3W6JB 1E2XA 2F6CA 3IC7A 4AIJA 2QBYA 1W7PB 1T2KA 4QTRA 3B73A 4CYCB 1NK2P 4A5MA 2XPWA 4A0XA 2A6TA 1R4MB 4ANJA 1ZG5A 3ESWB 1YW9A 1XMKA 2JMWA 1HBXG 1LEBA 3CDIA 4BNCA 3N4MA 1S8NA 4A6EA 4CGZA 2STWA 2ZXHA 2R5YA 3QQAA 4I09A 1VQ4I 4LB6B 1MBHA 3I59B 3GZ5A 4JQFA 3ERED 1DP3A 1P9QC 3SEZA 3DPLC 3FXQA 1QZEA 1UG2A 2O8XA 2DMPA 2P5KA 3OWTA 2FU4A 5DEQA 1B72A 2DPUA 2W4SA 4RS8A 3CJRB 5DCFA 5EJCA 1USTA 4D5FA 2Z33A 4ENKA 2EV6A 1G59A 4NC7A 1N77A 2MABA 5TJJA 1B59A 1QQIA 2MC4A 2PJPA 5CVUA 1BI0A 2LYCA 5K5OA 5E3MA 4ZZLA 4XRFA 4JYKA 1MSEC 5DYMA 2WY7Q 3F0CA 2VJIA 2FA5A 4BXFA 4AIDA 2FBKA 3TW6A 2LRDA 1YX5A 5BS6A 5J47A 3ASNH 2DN0A 3KE2A 5TRDA 1YTYA 1PUFA 3FXOA 5F0HA 1E3HA 2E7XA 2BOLA 2HKOA 3CQZJ 1JI8A 1ETQA 3RI4A 3GWZA 3H5NA 2XC7A 1RETA 3IRRA 1NG7A 1ONVA 3B6CA 3IKTA 2HDDA 1UB9A 3CJTB 3JRIA 5BMZA 3JRHA 5E8GA 3E0JB 3BT9A 3V8JA 1V5FA 4BQQA 5F1RA 1B9MA 2BBYA 1A04A 1XCVA 2LH9A 2Z1DA 3ZMDA 3AG4H 2KQRA 3LSTA 3F8CA 1JGSA 2JWTA 1XGNA 1HW1A 2UXXA 1R1UA 1WI9A 2M5WA 2LSOA 3WE3A 2IS6A 2TDXA 1NG6A 1HKTA 2ZMEC 3TQNA 4BHBA 5IT3A 1HCRA 1OYYA 2YSRA 4LK0F 2R93J 3JSPA 4IRHA 3FX3A 1W0TA 2OTLI 2A6HF 3S1NJ 1F43A 1Z77A 3E7LA 1R7JA 3F8MA 4IHTA 3CCYA 3S17J 2JZYA 2CWEA 4Q48A 3WTWC 4FCYA 1XGOA 2K7LA 1VQNI 5F6FA 1ENHA 3BC8A 1ZK8A 3F72A 4BBRJ 3DTKA 4JOMA 3ZQCA 1OFCX 3T1BA 5F08A 2JJ7A 3D0SA 2O6GE 4KIBA 3BDDA 4QWQA 3VDXA 2V6CA 4M6YA 2JVHA 5ICCA 4DQ2A 3ZMTA 4E7KA 3CMYA 2IGOA 3SZPA 4PK4A 4ZTJA 1EH6A 1TW2A 1I39A 5AONA 5DUIA 2EIKH 4NNJA 2GA1A 1AKHA 3KFWX 4C2TA 1VQKI 1FEXA 2ZFUA 4J19A 1LFBA 4G7ZF 5HOOA 3LSRA 1GXQA 2YS9A 2NOJB 4D0PA 3RPQA 3PO2J 1VTNC 2K3FA 2Y0SA 3DBRB 1V5GA 2AQFA 2BZTA 1EKEA 4OINF 2KT0A 4FASD 2FBHA 5HLTA 3CMEI 5L3FA 1C0WA 4XR6A 2COMA 1ZARA 5J4YA 1DDNA 3R4KA 2W48A 4M6VA 1D5VA 3AG1H 3BJOA 1ETVA 3OL3A 4H0EA 4FETA 1TZLA 1HW2A 1J75A 4UUTA 4F52A 1JE8A 2QQ9A 4I01A 1PP8F 1PJRA 5HLGA 1HW5A 1HXDA 2FE3A 3GVAA 3GZNB 4EM0B 3MMYB 4PJJA 2VKDA 3DU6A 4WXDA 1OYIA 1WCMJ 3TGNA 4CICA 3C18A 4LIUA 3HHGA 5J6XA 3M1CA 4JX4A 3HOZJ 3A01A 2E2JJ 1YW8A 2MH2A 2OCCH 3LQRA 4XRSA 3J80Z 2BY0A 1IW7F 1MBJA 2WWYA 3L2WA 2Q8KA 4ZYGA 4L5JA 3HOTA 1ZREA 4QIWN 4A3GJ 3CJNA 2NS7A 3PQKA 4NC8A 3OIOA 4ZYDA 1WJ5A 2V6EA 1QZZA 1LFPA 3W3CA 1L0OC 3VB2A 3WTSC 2LKXA 1J5YA 5B3SH 4HSRA 4WXHA 3HOVJ 2H8WA 2GXBA 1X58A 3A02A 4JK1X 5IPAA 4KT6A 2P6TA 4ENJA 3DKXA 5J3LA 3PFIA 1UHSA 2FQ4A 4E70A 4HRIA 4IHYA 2CQXA 2HQRA 4F93B 2R7SA 2Y75A 4OIRF 5LBQA 2MA3A 3F9KA 2RREA 1SAUA 2VONA 3WG7H 2EPFA 2FQ3A 2DYRH 4WXCA 1TL8A 4L18B 1FTZA 4UY8I 4XLHA 2H1LA 2ZJPF 4DBRA 1DGRM 1FSEA 1TWCJ 2DDBA 2W82A 3W6KB 3UKGA 3CO7C 3J7AY 1Z6TA 4KN4X 2ME0A 1ORKA 2EB7A 3KP6A 3LSIA 3DEWA 3GTQJ 3GTJJ 4XKCA 4IXAA 3DEEA 2RNGA 5IT9K 3RTRA 1IRGA 4EMSA 2RNJA 4PFPA 2HOSA 2ZSHB 1A5JA 1SD6A 3VOEA 4ZYEA 3FHZA 1QNTA 4FTHA 5DCMA 5JFRA 4HDVA 5HNFA 2HWVA 2CG4A 1K78A 1MBEA 3L2CA 2NXNB 3GFJA 2ZJRF 2CUFA 4RMNA 5EZHA 1F9NA 4B47A 2E7WA 3TOAA 3Q9SA 2CFOA 2PJRA 1R4NB 2H1KA 2PN6A 1J2XA 3ZMZA 3ZRGA 4HQMA 2R7VA 3HOUJ 3PSIA 4RM2A 3E6BA 2LC2A 2X1CA 2ID3A 3HZJA 5JLXA 1X1PA 3QODA 1Q1VA 4XLAA 4B8XA 1WGXA 3R0AA 3BR6A 4G9YA 3CLQA 4Q5SF 1XSXA 4IZZA 1DU6A 2KIFA 2QEXI 1U9NA 1DP7P 4O6JA 1JJ8C 1YG2A 1SMTA 2VJJA 2FUG2 5GTIC 2A5WA 1LEAA 2PLYA 2KHMA 4BEHB 3K0LA 1SVLA 3ISPA 3DPUA 3BTIA 3LA3A 1MW7A 5HNHA 3NWTA 2FOKA 4F3QA 2XAGA 1IUYA 3RKYA 3D1NI 4CCKA 2VB6A 2QQAA 4W97A 1ZG1A 5FKMA 2HZTA 4R8HA 2L01A 3LQQA 4LFUA 2BXZA 2LOOA 2QZ8A 4B48A 1U0JA 2X9DA 1ZELA 2DOAA 2JVGA 3BCAA 4CCNA 2Z9OA 1ZH5A 4XM3A 1JJ6C 4NDLA 4UVCA 3A2KA 3SJMA 3GBGA 5JLWA 4A3DJ 1YIOA 1OCOH 1AOYA 2IA0A 1HKQA 4JP0A 3DTEA 5JVGF 1IF1A 2ZCWA 4IQJA 2ME6A 2KDZA 5K7ZA 2DA2A 2KRFA 3BJAA 2IBDA 3CUQB 1RKTA 4A69C 1A35A 2QSHX 4DNCA 2R7FA 4EGZA 1ERDA 1D1CA 1IRXA 1HQCA 4RGUA 3OYCA 2M45A 3G2BA 3HOWJ 5DS9A 2FX0A 2KIMA 3BZCA 3WODF 2ELKA 4G6DA 2Q2EA 2P5VA 4GYIA 1ZLJA 3CC2I 3QU3A 1BR1A 3K1NA 5H2FC 1ZRFA 3S15J 4E7ZA 1O3RA 3MD2A 4M74A 4JX5A
chains in the Genus database with same CATH topology
5E3OA 3TP0A 3S16J 1SANA 1U9OA 4C3HJ 5EDNA 2NS8A 2XB5A 1F36A 2R7ZJ 1MH4A 2ID6A 2LD5A 3PM1A 1ZTRA 5F04A 2JA5J 1ZR4A 1ZQ3P 2MGQA 3JRDA 2EZKA 1GDTA 1TWAJ 2OPTA 1JGGA 1ETXA 3ZQIA 2L7MP 4X6AJ 5EF6A 1W0UA 4L5EA 5IYDJ 2Y0SN 1SFOJ 3HKZN 4XRSG 1FIPA 5K7FA 5DTDA 2DMQA 2YU9J 3HGYA 1IRZA 2MG4A 3OOUA 1OCTC 1MBKA 1P7JA 2NVXJ 3LNQA 2I10A 2NVQJ 1IUFA 3PO3J 2XGCA 3OSFA 1HOMA 3IH2A 1IDYA 2D5VA 3SDGA 3FKIJ 3K2AA 2DA1A 4DZPA 5EGOB 2O9LA 1ETKA 5EGOA 1X2MA 1ETYA 3HOXJ 4BY1J 3M4OJ 5FLMJ 2LY9A 2IAIA 5FJ8J 1ZR2A 2ZB9A 1VI0A 1JTXA 1ETWA 2L7ZA 1VNDA 4RBOA 2NVYJ 3DCFA 3TW7A 2FD5A 5J1RA 1JT0A 1IDZA 2AO9A 1HDPA 4QTRA 3RZDJ 4CYCB 2XGDA 1NK2P 1MBGA 2YUSA 1R9TJ 1BW5A 2XPWA 4B3AA 1POGA 4BY7J 3HM5A 2VKEA 2E19A 1AKHB 1P7IA 2JMWA 2QCOA 2M2EA 2N8GA 4HNVA 2Y31A 3S2DJ 2LTPA 2R5YA 2TCTA 2P81A 3QQAA 4AUXA 1MBHA 2WV1A 3RZOJ 1GVDA 2XGEA 4JX6A 1UG2A 2DMPA 2G0EA 2Y30A 4A3KJ 1TWFJ 3JRAA 3JRCA 4UUSA 4I6ZA 1B72A 1I6HJ 4BBSJ 3JRBA 3LSJA 4D5FA 1ETOA 4MFDA 2HXOA 1U8BA 3M3YJ 1MNMC 1GV5A 9ANTA 3Q0UA 3IV5A 1QVTA 5E3MA 3TEDA 4GFBA 2RAEA 3HB9A 4V2FA 4JYKA 5EG0B 2MSYA 2VI6A 4C2MJ 1MSEC 2HOTA 1BW6A 2ECCA 1RKWA 3F0CA 3ZQFA 5GPCA 3H3VK 5FKOA 4A3LJ 3A01B 3TW6A 1JKQC 1OCPA 3ZQGA 4MLOA 2DN0A 2HYJA 3GTOJ 2AHQA 1PUFA 5M5XJ 3TP3A 4BKXA 5F0HA 5IOZA 2EBIA 1B8IA 1HF0A 5EEAA 2E2IJ 1JKOC 1H8AC 1IGNA 3CQZJ 1ETQA 1TWHJ 5IOYA 4A3MJ 2LK2A 4DYCA 5BNGA 1RETA 2DA4A 3A03A 3Q3SA 2HDDA 3B6CA 2NOGA 3VPRA 3JRIA 5M3MJ 3JRHA 3BT9A 5C4JJ 4ABZA 3IH3A 1APLC 4FE4A 2R0QC 2CU7A 3BG9A 3ZQHA 4G12A 1ITYA 2JWTA 2OF7A 3JRFA 2VKVA 4M3GA 4X1EA 1JT6A 1JTYA 2CJJA 2EZHA 1HCRA 3Q0WA 3HBLA 2R93J 1W0TA 1H89C 3S1MJ 3S1NJ 1F43A 1Z77A 3E7LA 2M9HA 1WPKA 2DMTA 3CCYA 4M3BA 3S17J 1XS9A 1K61A 2CUEA 2CQQA 4FCYA 5HODA 3O8GA 2DMUA 2L9RA 1ENHA 2XPVA 1ZK8A 2COBA 5FKKA 3FIWA 5F27A 1Z0XA 1ZKGA 4BBRJ 3CDLA 3HGGA 2XB0X 5FKNA 3ZQCA 1OFCX 4RDUA 5F08A 2JJ7A 3FISA 2E1OA 4QSHA 2LR8A 4A3BJ 3MN2A 3MKLA 1HLVA 4CYCA 3BR5A 4M3FA 3CMYA 1QRYA 3LOCA 1ZGWA 1T56A 3LSPA 2K40A 1AKHA 2LLKA 5FKLA 1FEXA 4J19A 5GP9A 1LFBA 2HXIA 2Y9ZA 3JRGA 3LSRA 2EZIA 3C2BA 2YS9A 1LFUP 3PO2J 1BA5A 4XRMA 4XIDA 3QPLA 5IP7J 2HOAA 2LVSA 2KT0A 4IHWA 2JA6J 2JA8J 1RPWA 2W48A 4M6VA 1H88C 1ETVA 1XC5A 5M5WJ 1FTTA 5J1YA 1JKRC 4Y52J 4UUTA 1IJWC 3GTMJ 2DA6A 2H8RA 1MBFA 5EG0A 2HI3A 3W6VA 4BXXJ 2DA7A 3S1QJ 1WCMJ 3RQIA 2M34A 4JX4A 3HOZJ 1Y1WJ 3A01A 2MW8A 2E2JJ 4XRSA 4DZJA 1GT0C 1MBJA 4A3IJ 3RKQA 4A3GJ 4QIWN 5GPAA 2NS7A 3OIOA 1I3QJ 3BR2A 3WHBA 1A6IA 2LKXA 4DYRA 3G1OA 4FE7A 2GM4A 3HOVJ 1X58A 2GBYA 3HDDA 3A02A 5IPAA 2R5ZB 1G2HA 1WH7A 3BQYA 5J3LA 3NARA 1UHSA 4M3DA 2FQ4A 1FIAA 4B4CA 2M0CA 1Y1VJ 2EQRA 3GTGJ 4IHYA 2CQXA 3BG3A 3BG5A 1BL0A 2L7FP 2LP0A 3GTKJ 1GUUA 3L1PA 2JK3A 2K9SA 1LE8B 2O7OA 1LE8A 1RESA 1FTZA 3BQZA 1EF4A 2CRGA 4MO7A 1JKPC 4A3FJ 2Y2ZA 1TWCJ 4B1RA 4IHXA 3UKGA 4I76A 3S14J 1XG1A 5IYCJ 1MH3A 2DA3A 1TWGJ 3OSGA 5F0FA 3HEFA 1TC3C 5FLVA 2ME0A 4MIMA 5F1JA 1ORKA 4FISA 1S7EA 4DYQA 5C3EJ 2XPUA 3DEWA 3GTQJ 3GTJJ 1QPIA 3I4MJ 1CQTA 3IH4A 1DU0A 5M3FJ 4V2GA 2HOSA 3WHCA 1A5JA 2EH3A 3FK6A 2DTZA 1UMQA 2E2HJ 3BR0A 2HQ5A 4FTHA 2TRTA 1VF9A 4D5CA 1MBEA 2EZLA 3BR3A 2CUFA 5EZHA 1IC8A 5IP6A 2X6OA 3K7AJ 1T33A 2PMZN 2WAQN 4A3EJ 3QPSA 3SFIA 2H1KA 1NK3P 1IV6A 1X2NA 3H0GJ 3ZQLA 3S1RJ 1MSFC 3G1LA 5K7HA 3HOUJ 4AC0A 4S0HB 4M3EA 2ID3A 3I4NJ 5JLXA 1RR7A 2L0KA 3O8HA 2XSDC 1Q1VA 2M8GX 1O4XA 1WGXA 2LFBA 3JR9A 3BR6A 5IYBJ 3BR1A 1AU7A 2K9NA 1AHDP 1DU6A 3BTCA 1JUPA 1U9NA 1JJ8C 2FJ1A 1GV2A 4C3IJ 5F0CA 2QF7A 5E3NA 2VPRA 4IEJA 4A93J 2K9QA 4MFEA 1I50J 3BTIA 3MVPA 2Y9YA 4C3JJ 5C4XJ 1WH5A 4W1UA 2R5YB 3B6AA 3D1NI 1QVUA 3G1MA 4W97A 4XICA 5FKMA 5E3LA 2IEKA 4LOCA 4EEFG 3BTLA 3S2HJ 2X9DA 1K83J 2VUMJ 1IG7A 3NAUA 2XRLA 4UUSB 1FJLA 1B72B 1JJ6C 1D5YA 4NDLA 3SJMA 3GBGA 3BTJA 5JLWA 4A3DJ 1YRNB 2B63J 1YRNA 2JA7J 4JP0A 4A3JJ 2ME6A 2KDZA 5K7ZA 3GTLJ 2DA2A 2IBDA 3GTPJ 2JN6A 1RKTA 4A69C 2X48A 5EYRA 2R92J 4D7NA 1VFCA 1WI3A 3Q0VA 3JREA 5EZGA 3FK7A 3LSGA 5J1UA 3HOWJ 2DMNA 4XK4A 3ZOBA 5DS9A 2FX0A 2R5ZA 2DA5A 1JUSA 1NTCA 2ELKA 5IP9J 2NVTJ 1JUMA 3HOYJ 4Y7NJ 4D7MA 2GLOA 1PUFB 4DW6A 4IHVA 1U78A 4AYBN 2DJNA 2O8KA 1B8IB 1E3OC 3S15J 2WB1N 1BJZA 2ECBA 1HDDC 5C44J 1OJLA 5M5YJ 4A3CJ 4JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3O A;  3TP0 A;  3S16 J;  1SAN A;  1U9O A;  4C3H J;  5EDN A;  2NS8 A;  2XB5 A;  1F36 A;  2R7Z J;  1MH4 A;  2ID6 A;  2LD5 A;  3PM1 A;  1ZTR A;  5F04 A;  2JA5 J;  1ZR4 A;  1ZQ3 P;  2MGQ A;  3JRD A;  2EZK A;  1GDT A;  1TWA J;  2OPT A;  1JGG A;  1ETX A;  3ZQI A;  2L7M P;  4X6A J;  5EF6 A;  1W0U A;  4L5E A;  5IYD J;  2Y0S N;  1SFO J;  3HKZ N;  4XRS G;  1FIP A;  5K7F A;  5DTD A;  2DMQ A;  2YU9 J;  3HGY A;  1IRZ A;  2MG4 A;  3OOU A;  1OCT C;  1MBK A;  1P7J A;  2NVX J;  3LNQ A;  2I10 A;  2NVQ J;  1IUF A;  3PO3 J;  2XGC A;  3OSF A;  1HOM A;  3IH2 A;  1IDY A;  2D5V A;  3SDG A;  3FKI J;  3K2A A;  2DA1 A;  4DZP A;  5EGO B;  2O9L A;  1ETK A;  5EGO A;  1X2M A;  1ETY A;  3HOX J;  4BY1 J;  3M4O J;  5FLM J;  2LY9 A;  2IAI A;  5FJ8 J;  1ZR2 A;  2ZB9 A;  1VI0 A;  1JTX A;  1ETW A;  2L7Z A;  1VND A;  4RBO A;  2NVY J;  3DCF A;  3TW7 A;  2FD5 A;  5J1R A;  1JT0 A;  1IDZ A;  2AO9 A;  1HDP A;  4QTR A;  3RZD J;  4CYC B;  2XGD A;  1NK2 P;  1MBG A;  2YUS A;  1R9T J;  1BW5 A;  2XPW A;  4B3A A;  1POG A;  4BY7 J;  3HM5 A;  2VKE A;  2E19 A;  1AKH B;  1P7I A;  2JMW A;  2QCO A;  2M2E A;  2N8G A;  4HNV A;  2Y31 A;  3S2D J;  2LTP A;  2R5Y A;  2TCT A;  2P81 A;  3QQA A;  4AUX A;  1MBH A;  2WV1 A;  3RZO J;  1GVD A;  2XGE A;  4JX6 A;  1UG2 A;  2DMP A;  2G0E A;  2Y30 A;  4A3K J;  1TWF J;  3JRA A;  3JRC A;  4UUS A;  4I6Z A;  1B72 A;  1I6H J;  4BBS J;  3JRB A;  3LSJ A;  4D5F A;  1ETO A;  4MFD A;  2HXO A;  1U8B A;  3M3Y J;  1MNM C;  1GV5 A;  9ANT A;  3Q0U A;  3IV5 A;  1QVT A;  5E3M A;  3TED A;  4GFB A;  2RAE A;  3HB9 A;  4V2F A;  4JYK A;  5EG0 B;  2MSY A;  2VI6 A;  4C2M J;  1MSE C;  2HOT A;  1BW6 A;  2ECC A;  1RKW A;  3F0C A;  3ZQF A;  5GPC A;  3H3V K;  5FKO A;  4A3L J;  3A01 B;  3TW6 A;  1JKQ C;  1OCP A;  3ZQG A;  4MLO A;  2DN0 A;  2HYJ A;  3GTO J;  2AHQ A;  1PUF A;  5M5X J;  3TP3 A;  4BKX A;  5F0H A;  5IOZ A;  2EBI A;  1B8I A;  1HF0 A;  5EEA A;  2E2I J;  1JKO C;  1H8A C;  1IGN A;  3CQZ J;  1ETQ A;  1TWH J;  5IOY A;  4A3M J;  2LK2 A;  4DYC A;  5BNG A;  1RET A;  2DA4 A;  3A03 A;  3Q3S A;  2HDD A;  3B6C A;  2NOG A;  3VPR A;  3JRI A;  5M3M J;  3JRH A;  3BT9 A;  5C4J J;  4ABZ A;  3IH3 A;  1APL C;  4FE4 A;  2R0Q C;  2CU7 A;  3BG9 A;  3ZQH A;  4G12 A;  1ITY A;  2JWT A;  2OF7 A;  3JRF A;  2VKV A;  4M3G A;  4X1E A;  1JT6 A;  1JTY A;  2CJJ A;  2EZH A;  1HCR A;  3Q0W A;  3HBL A;  2R93 J;  1W0T A;  1H89 C;  3S1M J;  3S1N J;  1F43 A;  1Z77 A;  3E7L A;  2M9H A;  1WPK A;  2DMT A;  3CCY A;  4M3B A;  3S17 J;  1XS9 A;  1K61 A;  2CUE A;  2CQQ A;  4FCY A;  5HOD A;  3O8G A;  2DMU A;  2L9R A;  1ENH A;  2XPV A;  1ZK8 A;  2COB A;  5FKK A;  3FIW A;  5F27 A;  1Z0X A;  1ZKG A;  4BBR J;  3CDL A;  3HGG A;  2XB0 X;  5FKN A;  3ZQC A;  1OFC X;  4RDU A;  5F08 A;  2JJ7 A;  3FIS A;  2E1O A;  4QSH A;  2LR8 A;  4A3B J;  3MN2 A;  3MKL A;  1HLV A;  4CYC A;  3BR5 A;  4M3F A;  3CMY A;  1QRY A;  3LOC A;  1ZGW A;  1T56 A;  3LSP A;  2K40 A;  1AKH A;  2LLK A;  5FKL A;  1FEX A;  4J19 A;  5GP9 A;  1LFB A;  2HXI A;  2Y9Z A;  3JRG A;  3LSR A;  2EZI A;  3C2B A;  2YS9 A;  1LFU P;  3PO2 J;  1BA5 A;  4XRM A;  4XID A;  3QPL A;  5IP7 J;  2HOA A;  2LVS A;  2KT0 A;  4IHW A;  2JA6 J;  2JA8 J;  1RPW A;  2W48 A;  4M6V A;  1H88 C;  1ETV A;  1XC5 A;  5M5W J;  1FTT A;  5J1Y A;  1JKR C;  4Y52 J;  4UUT A;  1IJW C;  3GTM J;  2DA6 A;  2H8R A;  1MBF A;  5EG0 A;  2HI3 A;  3W6V A;  4BXX J;  2DA7 A;  3S1Q J;  1WCM J;  3RQI A;  2M34 A;  4JX4 A;  3HOZ J;  1Y1W J;  3A01 A;  2MW8 A;  2E2J J;  4XRS A;  4DZJ A;  1GT0 C;  1MBJ A;  4A3I J;  3RKQ A;  4A3G J;  4QIW N;  5GPA A;  2NS7 A;  3OIO A;  1I3Q J;  3BR2 A;  3WHB A;  1A6I A;  2LKX A;  4DYR A;  3G1O A;  4FE7 A;  2GM4 A;  3HOV J;  1X58 A;  2GBY A;  3HDD A;  3A02 A;  5IPA A;  2R5Z B;  1G2H A;  1WH7 A;  3BQY A;  5J3L A;  3NAR A;  1UHS A;  4M3D A;  2FQ4 A;  1FIA A;  4B4C A;  2M0C A;  1Y1V J;  2EQR A;  3GTG J;  4IHY A;  2CQX A;  3BG3 A;  3BG5 A;  1BL0 A;  2L7F P;  2LP0 A;  3GTK J;  1GUU A;  3L1P A;  2JK3 A;  2K9S A;  1LE8 B;  2O7O A;  1LE8 A;  1RES A;  1FTZ A;  3BQZ A;  1EF4 A;  2CRG A;  4MO7 A;  1JKP C;  4A3F J;  2Y2Z A;  1TWC J;  4B1R A;  4IHX A;  3UKG A;  4I76 A;  3S14 J;  1XG1 A;  5IYC J;  1MH3 A;  2DA3 A;  1TWG J;  3OSG A;  5F0F A;  3HEF A;  1TC3 C;  5FLV A;  2ME0 A;  4MIM A;  5F1J A;  1ORK A;  4FIS A;  1S7E A;  4DYQ A;  5C3E J;  2XPU A;  3DEW A;  3GTQ J;  3GTJ J;  1QPI A;  3I4M J;  1CQT A;  3IH4 A;  1DU0 A;  5M3F J;  4V2G A;  2HOS A;  3WHC A;  1A5J A;  2EH3 A;  3FK6 A;  2DTZ A;  1UMQ A;  2E2H J;  3BR0 A;  2HQ5 A;  4FTH A;  2TRT A;  1VF9 A;  4D5C A;  1MBE A;  2EZL A;  3BR3 A;  2CUF A;  5EZH A;  1IC8 A;  5IP6 A;  2X6O A;  3K7A J;  1T33 A;  2PMZ N;  2WAQ N;  4A3E J;  3QPS A;  3SFI A;  2H1K A;  1NK3 P;  1IV6 A;  1X2N A;  3H0G J;  3ZQL A;  3S1R J;  1MSF C;  3G1L A;  5K7H A;  3HOU J;  4AC0 A;  4S0H B;  4M3E A;  2ID3 A;  3I4N J;  5JLX A;  1RR7 A;  2L0K A;  3O8H A;  2XSD C;  1Q1V A;  2M8G X;  1O4X A;  1WGX A;  2LFB A;  3JR9 A;  3BR6 A;  5IYB J;  3BR1 A;  1AU7 A;  2K9N A;  1AHD P;  1DU6 A;  3BTC A;  1JUP A;  1U9N A;  1JJ8 C;  2FJ1 A;  1GV2 A;  4C3I J;  5F0C A;  2QF7 A;  5E3N A;  2VPR A;  4IEJ A;  4A93 J;  2K9Q A;  4MFE A;  1I50 J;  3BTI A;  3MVP A;  2Y9Y A;  4C3J J;  5C4X J;  1WH5 A;  4W1U A;  2R5Y B;  3B6A A;  3D1N I;  1QVU A;  3G1M A;  4W97 A;  4XIC A;  5FKM A;  5E3L A;  2IEK A;  4LOC A;  4EEF G;  3BTL A;  3S2H J;  2X9D A;  1K83 J;  2VUM J;  1IG7 A;  3NAU A;  2XRL A;  4UUS B;  1FJL A;  1B72 B;  1JJ6 C;  1D5Y A;  4NDL A;  3SJM A;  3GBG A;  3BTJ A;  5JLW A;  4A3D J;  1YRN B;  2B63 J;  1YRN A;  2JA7 J;  4JP0 A;  4A3J J;  2ME6 A;  2KDZ A;  5K7Z A;  3GTL J;  2DA2 A;  2IBD A;  3GTP J;  2JN6 A;  1RKT A;  4A69 C;  2X48 A;  5EYR A;  2R92 J;  4D7N A;  1VFC A;  1WI3 A;  3Q0V A;  3JRE A;  5EZG A;  3FK7 A;  3LSG A;  5J1U A;  3HOW J;  2DMN A;  4XK4 A;  3ZOB A;  5DS9 A;  2FX0 A;  2R5Z A;  2DA5 A;  1JUS A;  1NTC A;  2ELK A;  5IP9 J;  2NVT J;  1JUM A;  3HOY J;  4Y7N J;  4D7M A;  2GLO A;  1PUF B;  4DW6 A;  4IHV A;  1U78 A;  4AYB N;  2DJN A;  2O8K A;  1B8I B;  1E3O C;  3S15 J;  2WB1 N;  1BJZ A;  2ECB A;  1HDD C;  5C44 J;  1OJL A;  5M5Y J;  4A3C J;  4JX5 A; 
#chains in the Genus database with same CATH topology
 1YLF A;  3OYH A;  1WQ2 A;  2L2O A;  2XIG A;  2M8E A;  4NQW B;  5CPR B;  1ZLK A;  1S7O A;  4NQW A;  2VQL A;  1XB4 A;  1H9T A;  1TT5 B;  2LD5 A;  4BYY A;  4HF2 A;  4UV9 A;  3U1D A;  2DBB A;  4XQF A;  1K7A A;  2CV1 A;  1LNW A;  2BY1 A;  1H0M A;  3IAS 2;  4KIT B;  2IS1 A;  2VN2 A;  2W00 A;  1DPU A;  3DF8 A;  1MMA A;  5TGT A;  2L3D A;  1W0U A;  4EM2 A;  1EJ9 A;  4IHS A;  2DT6 A;  1O3T A;  2Y0S N;  3BZK A;  4WX9 A;  3HKZ N;  2ELH A;  4Y13 A;  2EFW A;  2QSG X;  2BW3 B;  2WC2 A;  2X51 A;  3C1D A;  2BXY A;  3F8B A;  3PQJ A;  1XGM A;  2CO5 A;  2MG4 A;  3FDY A;  4P9U A;  4ZTF A;  3OOU A;  2JRM A;  3F6V A;  2RQP A;  3LNQ A;  2ZME A;  3HPH A;  3F22 A;  2NVQ J;  3BY6 A;  1IUF A;  3J7A O;  1G8X A;  2A07 F;  1O7L A;  3PO3 J;  4MQV A;  1BI3 A;  2DA1 A;  1ETK A;  2VT2 A;  3HUG A;  1CF7 B;  2HU9 A;  3NEU A;  1R5H A;  1RI7 A;  3HTU A;  3MKZ A;  3MZY A;  5LHH A;  1BJA A;  1W7P D;  3DPT A;  1WJF A;  4YIF A;  1FT9 A;  1BM9 A;  2DOD A;  5CJ9 A;  1ETW A;  2L7Z A;  3EPZ A;  3WTU C;  1FYK A;  1GHC A;  3RSN A;  2NVY J;  4LLN A;  4P9F A;  3TW7 A;  3RPU D;  2JA2 A;  3V7R A;  1UHM A;  5E8I A;  1MZB A;  3KX2 A;  2HPM A;  1U5T B;  2XVC A;  1DGW Y;  2XGD A;  1MBG A;  2YUS A;  4B3A A;  1POG A;  4BY7 J;  2VKE A;  3HIF A;  2E19 A;  1P7I A;  2KZG A;  4IO9 F;  4RLQ A;  5B66 C;  2DK8 A;  4HX8 A;  5BOX A;  5J40 A;  4HNV A;  2Y31 A;  2LTP A;  2R7X A;  2V1N A;  2K9M A;  5FFZ A;  2LF7 A;  2X6Y A;  3T0Y A;  1MMD A;  2OC6 A;  4M9S A;  5K1Y A;  1GVD A;  3LFK A;  1TWF J;  3JRA A;  1YS7 A;  3CF2 A;  4UUS A;  4PGH A;  4I6Z A;  1I6H J;  1D8J A;  2IP2 A;  3PIP F;  3DWL E;  2D45 A;  2YPR A;  2KDO A;  3CES A;  2HPI A;  3H5R A;  3LMM A;  2L02 A;  3M3Y J;  1D1A A;  4EQQ A;  3AAF A;  1GV5 A;  4F7Z A;  1OPC A;  3DBL B;  1JHF A;  2DFI A;  3M7G A;  5J8F A;  4E7H A;  1UG0 A;  3HRT A;  2IS4 A;  2MH9 A;  4GFB A;  2BY3 A;  4V2F A;  5EG0 B;  4MEX F;  2VE8 A;  2KLO A;  4J00 A;  1BW6 A;  1GVJ A;  4G8X A;  1JXS A;  1FYM A;  2ECC A;  3ZQF A;  3PFY A;  2RC4 A;  5FKO A;  4A3L J;  1FLI A;  3COA C;  4ZDO A;  4M73 A;  2CGP A;  4MLO A;  2HYJ A;  1XGS A;  5DD4 A;  3GTO J;  2PX9 A;  2Z5U A;  1X3W B;  3TP3 A;  4BL0 B;  4P55 A;  1AA7 A;  4R79 A;  5IOZ A;  2XAH A;  5D8L B;  1B8I A;  3E5X A;  1HF0 A;  2M87 A;  2J5O A;  1JKO C;  4Z6Y A;  3QYE A;  1SD5 A;  4KN7 X;  1TWH J;  2H6B A;  1WRJ A;  5BNG A;  3C2G A;  3GLX A;  2OUM A;  1XN7 A;  3A03 A;  2Y48 A;  4ZYH A;  2EIL H;  4ABZ A;  2JT1 A;  1MJ9 A;  3IH3 A;  5LLQ A;  2H94 A;  2R0Q C;  1DUX C;  4G12 A;  4ENN A;  3VYT B;  5D5W B;  2ZBK A;  2DU9 A;  3BZ6 A;  2OF7 A;  1MDM B;  3JRF A;  2G7U A;  4X1E A;  4E6K G;  5ED4 A;  3M07 A;  1JT6 A;  1QU3 A;  4KMF A;  4F55 A;  4MTD A;  2EZH A;  1K6O A;  1LDD A;  1X3U A;  2E1M B;  3MQ0 A;  2MLK A;  4HEA 2;  2XKO A;  3SXY A;  1MIJ A;  4KIS A;  2W84 A;  4IRG A;  5D4R A;  4I0A A;  1WJE A;  2HNH A;  2B9S A;  4HX7 A;  1FOX A;  2M9H A;  1P4X A;  1WPK A;  2DMT A;  1MMG A;  4M3B A;  1WSU A;  1HA8 A;  2LY1 A;  3K4K A;  2ZXI A;  3O8G A;  3OY9 A;  2DMU A;  1FYL A;  2COB A;  5FKK A;  5F27 A;  1BBY A;  1Z0X A;  4U7B A;  3CDL A;  3B02 A;  4GYG A;  5FKN A;  4RDU A;  4FQG A;  2WB1 A;  3ABM H;  4IX7 A;  5ILS A;  4M6X A;  3V42 A;  5GAH J;  3ABU A;  3MN2 A;  3A0H C;  1X1B A;  4YFX F;  1BOB A;  1W7P A;  3ZP5 A;  4BDZ A;  4CYC A;  4UHT A;  2LBF B;  1MGT A;  1QRY A;  3PNV A;  1O57 A;  1H9G A;  1ZGW A;  2K40 A;  2QUF A;  1KU9 A;  4R1H A;  4XKB A;  3RPU A;  3GEZ A;  5FKL A;  3G6E I;  4XN0 A;  2MD0 A;  1Z9C A;  2YR2 A;  3N05 A;  3V4G A;  2ICW G;  1LFU P;  3TO9 A;  2M4K A;  2XHK A;  4LMY A;  5HDG A;  1XDU A;  2YX4 A;  4XRM A;  3I59 A;  3L2U A;  4KIF A;  2CQN A;  3ASO H;  4P96 A;  3M1E A;  4KIG A;  2Q0O A;  5IP7 J;  1S6L A;  4HOB A;  1TW3 A;  2YU3 A;  4IHW A;  2JA6 J;  2W1O A;  5CQG A;  1RC9 A;  4E7J A;  2NAZ A;  2LMD A;  1RPW A;  4EJV A;  2UUZ A;  3D5L A;  2P8T A;  2EIM H;  4A0Z A;  2FXA A;  4XN3 A;  5IT9 Z;  1ODD A;  2E5Z A;  5M5W J;  3CUQ C;  1FTT A;  1Y8Q B;  3LA2 A;  5J1Y A;  1FOW A;  2LG4 A;  1UEL B;  2KPM A;  2DA6 A;  1MBF A;  2HI3 A;  4M71 A;  1U6G A;  3DLL F;  3LAP A;  3EYY A;  5JHF A;  3CDH A;  2O3F A;  1I1G A;  3KZZ A;  2ISY A;  2L9S A;  3CMA I;  1KQ8 A;  1S5L C;  1OCZ H;  5H20 A;  2MW8 A;  3V7C A;  2F5C A;  2EK5 A;  1RNL A;  2ETH A;  3V8K A;  3X2Q H;  4DZJ A;  4RA2 A;  3D5R C;  4U0W A;  2D2W A;  5L3E A;  3OYJ A;  3RKQ A;  4A3I J;  1N25 A;  2R7Q A;  4LG3 A;  1P92 A;  3I64 A;  3M8J A;  3BR2 A;  4MQ9 F;  3FXK A;  3WHB A;  4EGY A;  2CYY A;  4KMU X;  2LKS A;  4FE7 A;  4N9H A;  5DV5 A;  4WCG A;  2R5Z B;  4A0Y A;  1G2H A;  1DPR A;  4BDY A;  4BAC A;  1WH7 A;  2CW0 F;  5HLH A;  3NAR A;  4M3D A;  3EUA A;  3K10 A;  1FIA A;  3W2V A;  1YW7 A;  2EV0 A;  1U3E M;  1X1C A;  3ZN0 A;  1QGP A;  4YRV A;  3P9I A;  3VWB A;  3GTG J;  3BG3 A;  4WK8 F;  2LP0 A;  4L9N A;  3RKX A;  3GTK J;  4IOA F;  1GUU A;  3L1P A;  1LE8 B;  1IAW A;  3OYE A;  3KPH A;  1LE8 A;  2BV6 A;  2M7B A;  3BQZ A;  1UAA A;  4MO7 A;  3BPV A;  5CLS A;  1BN5 A;  1BR4 A;  2DTR A;  5A2Q Z;  3F21 A;  1IN5 A;  4I76 A;  4IPA A;  5IYC J;  2K5C A;  1TWG J;  1ZHF A;  3OSG A;  3QP6 A;  3LL7 A;  4MIM A;  5C3E J;  1VQL I;  4FHT A;  3IL2 A;  4ZJZ A;  2VC0 A;  4HA8 A;  1CQT A;  1DU0 A;  3MAJ A;  3KYD B;  3KCC A;  5HDN A;  4YEL A;  1BI1 A;  4KFC A;  2EH3 A;  5D4S A;  1XTA A;  3TO6 A;  2E2H J;  4RB2 C;  4D1Q A;  2TRT A;  3OL4 A;  4PCQ A;  3WU1 B;  4F92 B;  1VF9 A;  4D5C A;  4H4K C;  3OR1 C;  3WG9 A;  1U5T C;  3K7A J;  2BEO A;  3HPG A;  2XF7 A;  3OYN A;  4PZJ A;  2K4J A;  5EEG A;  4HX4 A;  1NK3 P;  3LSK A;  1LKX A;  2NS0 A;  2VC1 A;  1X2N A;  3H0G J;  3WU0 A;  1ZRD A;  2E35 A;  2L54 A;  2QKM B;  5D8K B;  2F5D A;  2NRA C;  3I54 A;  1R36 A;  2R7U A;  2CSO A;  3I4N J;  3I56 I;  2VQG A;  1RR7 A;  4Y17 A;  5LHG A;  2XSD C;  2M8G X;  2A61 A;  3I0T A;  4MTE A;  5J4V A;  5IYB J;  5B5E C;  2V26 A;  2K9N A;  5KAF C;  3BTC A;  1ZG3 A;  2R4G A;  1JUP A;  1FZP B;  1V4R A;  3SHF A;  2FJ1 A;  2XF6 A;  3TDU C;  4GO1 A;  5F0C A;  4BU2 A;  2G9W A;  1TNS A;  1XPX A;  4IEJ A;  4YEJ A;  3EUK L;  4MFE A;  1I50 J;  1QO0 D;  1BIA A;  4Y3O A;  1WH5 A;  2VBY A;  1I27 A;  3W2A A;  2MD5 A;  3OMY A;  3TBI A;  1S3J A;  2GZW A;  5L3D A;  1W36 C;  4KIC A;  4LOC A;  4EEF G;  4BE0 A;  2FNP A;  1ON2 A;  3SZT A;  5LEK A;  3WTX C;  2NNY A;  1Y0U A;  2R7O A;  3BTJ A;  3GF2 A;  1G3S A;  2CS3 A;  4HBL A;  5CKT A;  1YRN B;  2B63 J;  1CGP A;  1YRN A;  2C6Y A;  2JA7 J;  1HKS A;  3WTV C;  4UNO A;  1D0X A;  2EV5 A;  1PUE E;  1R5G A;  1MJA A;  2X48 A;  5EYR A;  5LD2 C;  4D7N A;  2F5F A;  1Z7L A;  1VFC A;  3KP4 A;  3KET A;  5EZG A;  2X1E A;  3FK7 A;  4E7I A;  3L2V A;  1MJB A;  2HYF A;  2XRN A;  3PUB A;  4RAY A;  1G3T A;  2DA5 A;  4IKF A;  5IP9 J;  2NVT J;  4Y7N J;  1MND A;  4BJ5 C;  4DJA A;  3E97 A;  1YYV A;  5HS9 A;  2P5L C;  2KJC A;  4IHV A;  3MWM A;  4XSZ F;  1KYW A;  1KU7 A;  1V55 H;  4PSW A;  3S32 A;  2O8K A;  3BCB A;  1EH8 A;  2NYX A;  2WB1 N;  1BJZ A;  2ECB A;  3CUO A;  4EVI A;  5C44 J;  5LGT A;  4ZDL A;  2CFX A;  2F4I A;  4BJ6 C;  3BRO A;  3HL2 A;  1K6Y A;  2E1M C;  3CO6 C;  5EDN A;  2BY2 A;  1W4M A;  4DOZ A;  1T0F C;  3DKW A;  2R7Z J;  2MLG A;  1MH4 A;  3JAM Z;  1J7K A;  5JVT A;  2ID6 A;  3PUF A;  3ZCO A;  1QBJ A;  3CCV I;  1YIT I;  2CV2 A;  1ZR4 A;  3JRD A;  1OLT A;  4J01 A;  2OBP A;  1SD7 A;  2ZJ2 A;  3HRM A;  2V9V A;  2DLL A;  2QLZ A;  2OPT A;  1XSD A;  1JGG A;  2JUC A;  1GDT A;  4LB5 A;  3ZQI A;  5B1A H;  1Z05 A;  3K1P A;  3BLY A;  1Y6I A;  5IYD J;  3CJQ B;  4EJO A;  1R58 A;  3K4C A;  4XRS G;  1FIP A;  3PL8 A;  3LWF A;  1Y39 A;  2Q1Z B;  2W25 A;  3KEO A;  4HDU A;  3U2R A;  1TNT A;  1USS A;  1OCT C;  1WZ2 A;  1PP7 U;  1P7J A;  2I10 A;  3FWE A;  2CUJ A;  3DEU A;  3SDB A;  3J81 Z;  1RZ4 A;  3OSF A;  1HOM A;  4UVB A;  3SDG A;  3K2A A;  4HF1 A;  3KIO A;  4BY1 J;  1ETY A;  3M4O J;  5FLM J;  1FOK A;  2LY9 A;  2IA2 A;  2IAI A;  4EJU A;  4CXF A;  5L3B A;  4YG2 F;  4II2 A;  3S3O A;  2QEN A;  4BJT A;  2ZB9 A;  3A4C A;  4HG2 A;  3OYM A;  3QRF F;  1JHH A;  2Y0M A;  1JTX A;  2DQL A;  3U21 A;  5D5X B;  4OIQ F;  1F1Z A;  1N78 A;  1VND A;  4GDF A;  3ECO A;  3R60 A;  4PDK A;  3K4B A;  5ILU A;  1IDZ A;  3IWF A;  1NHA A;  2AO9 A;  1HDP A;  3RZD J;  3FXM A;  5FGM A;  3H1C A;  3L09 A;  1R9T J;  2E1N A;  1FPQ A;  5CVR A;  4BEH A;  1OQY A;  2KRH A;  2Z2S B;  3O2P E;  1QHG A;  2M2E A;  2N8G A;  3ULQ B;  2M0M A;  2DOF A;  3ZQ7 A;  5KCM A;  2P81 A;  3GZ6 A;  2GAU A;  4U7D A;  4AUX A;  4LG0 B;  2DCE A;  3RZO J;  1RUN A;  2ZKZ A;  1SD4 A;  4UB6 C;  3CP8 A;  2KMU A;  2XGE A;  3OYL A;  4A3K J;  4G7O F;  2Y30 A;  2HVQ A;  3ZMV A;  1U2W A;  2V4J C;  5D5V B;  5CVJ A;  1VQ9 I;  4QPO A;  4CSW A;  4BS9 A;  4BBS J;  4XOP A;  3SQN A;  1W36 D;  3LSJ A;  2X0L A;  3IKV A;  4WF2 A;  1K4T A;  4MFD A;  2LKP A;  3K4M A;  2PMZ A;  1WWX A;  1T8I A;  2DI3 A;  2XAQ A;  1B4A A;  3Q0U A;  3IV5 A;  4C9Y A;  1QVT A;  3Q9V A;  3CUQ A;  1KGS A;  2H6C A;  1QPM A;  2RAE A;  3AKZ A;  5LFA A;  2EA2 A;  2MSY A;  2VI6 A;  4C2M J;  2BYV E;  1S9H A;  2DO7 A;  4ZH4 F;  3O3K A;  4U0Y A;  3CCM I;  5CVI A;  2HOT A;  2R7T A;  3QPH A;  1VQM I;  2VIX A;  5F64 A;  3CC7 I;  2GQQ A;  5LGU A;  2LRE A;  5K5R A;  3AL0 B;  3ABK H;  3HRS A;  3J7Y J;  2OQR A;  1JKQ C;  5LEJ A;  4HV6 A;  2XRO A;  2XGX A;  3GLL A;  1KA8 A;  1SFK A;  3MCZ A;  2AHQ A;  5M5X J;  4BKX A;  3P9K A;  1TQI A;  4I99 C;  3OYI A;  2EBI A;  5EEA A;  2E2I J;  2B7E A;  2QGU A;  4L9J A;  1H8A C;  3I5U A;  4KJZ A;  1IGN A;  1MNE A;  1T98 A;  2KKO A;  5IOY A;  4A3M J;  2LK2 A;  1R71 A;  3I53 A;  2W85 A;  2ZO4 A;  2BHZ A;  1LDK B;  2VT3 A;  2ESN A;  2NOG A;  2OJE D;  5E79 C;  1FBU A;  2X85 A;  3K4N A;  5M3M J;  1TT0 A;  5C4J J;  1ACI A;  2VE9 A;  4K2E A;  4BGD A;  3OYG A;  1LPQ A;  3LSM A;  3M9A A;  2CU7 A;  4OMY A;  1MMN A;  4RAF A;  2BHY A;  3ZQH A;  2V1D A;  1ITY A;  2V9P A;  1SFX A;  2VKV A;  3FKJ A;  2A5Y B;  2HTJ A;  3K1M A;  4DBQ A;  4BQN A;  3ABL H;  1FBQ A;  2KIU A;  4ESB A;  2F48 A;  4LGW A;  3OYA A;  2BW3 A;  3L2Q A;  3S3M A;  2MYS A;  3Q0W A;  4E4H A;  1TTY A;  3HBL A;  2L9N A;  3HSR A;  3K70 C;  4CO8 A;  2P4W A;  1H89 C;  4EM1 A;  3S1M J;  1FNN A;  4A12 A;  3VYR B;  1X1A A;  3H3U A;  3I9V 2;  3E1S A;  2OV7 A;  1REP C;  2CUE A;  1CF7 A;  3OYK A;  3AFH A;  5HOD A;  3H5A A;  1HSJ A;  2L9R A;  2ZXW H;  1B1B A;  2IPQ X;  1FWZ A;  1SFE A;  2HR3 A;  3CLO A;  3HGG A;  2XB0 X;  1KZH A;  1S72 I;  4YFN F;  4B44 A;  4AYB A;  2X1D A;  4NBQ A;  2E1O A;  5CVV A;  3SYT A;  1S29 A;  1VQ7 I;  1YJ9 I;  2JUG A;  2QQB A;  4A3B J;  1U5T A;  3MKL A;  1HLV A;  4RLF A;  2EA4 A;  3BR5 A;  4M3F A;  2HS5 A;  4YII A;  1XCB A;  2XAF A;  3WU2 C;  1RUO A;  3LOC A;  3T5X A;  2YX7 A;  4ZZD A;  4HLX A;  4CCM A;  4XSX F;  3DLA A;  3L7W A;  3H9J A;  3I55 I;  3K6G A;  2RN7 A;  4L9V A;  4UV8 A;  2RDP A;  1PYV A;  2HXI A;  3CZ6 A;  2EZI A;  1BA5 A;  3ZMU A;  2R3S A;  3OYB A;  4C2U A;  2A68 F;  3DP7 A;  5KK1 A;  1IN7 A;  3UR3 C;  5DD8 A;  2FSW A;  2VQH A;  3FM3 A;  4OIO F;  4CH7 A;  3LFU A;  1WKM A;  1PDN C;  3VFZ A;  1XC5 A;  2KZV A;  2KRC A;  1TQP A;  1W5S A;  2HDW A;  2UXN A;  5HS7 A;  4I7H A;  4OOI A;  1OYW A;  2QSF X;  2L5Q A;  1YJW I;  3GTM J;  1R23 A;  3K4J A;  5H6R A;  5EG0 A;  5K5Q A;  2GXA A;  4BXX J;  5DUK A;  2GXG A;  4I2O A;  2DQR A;  2XV4 S;  1Z3X A;  1D3Y A;  3FM5 A;  2M34 A;  3K9T A;  5KVR A;  2AS5 F;  1GT0 C;  1LB2 A;  4E7S A;  3VYU B;  4PGG A;  3RDI A;  3VSK A;  4BQO A;  4OMZ A;  1BC8 C;  2STT A;  1A6I A;  3OR2 C;  3RJP A;  4DYR A;  1J59 A;  3E6D A;  2GM4 A;  1K79 A;  1OKR A;  2KIQ A;  3HDD A;  1TP4 A;  3WE2 A;  2F4O B;  2PQ8 A;  1YI2 I;  1PVE A;  2CMP A;  2F5E A;  5CYV A;  3QYB A;  3RKW A;  2DFF A;  1LJ9 A;  2RKH A;  4P1W A;  1L3L A;  4Y4R A;  4UVA A;  2PBI A;  1Z6R A;  5HVQ C;  2L4A A;  3BG5 A;  2I8D A;  2IS2 A;  3U9G A;  2JK3 A;  2K9S A;  1MDM A;  2O7O A;  3FXR A;  3WGG A;  4A2U A;  2VOO A;  1MD0 A;  4OAY A;  1RR8 C;  3E6C C;  1XD7 A;  1JKP C;  2RVC A;  2Y2Z A;  5HLI A;  1YIJ I;  3FHN A;  1IN8 A;  2HQN A;  4M9X A;  3S93 A;  4IHX A;  3S14 J;  1XG1 A;  3GCM A;  3V7S A;  2DA3 A;  2K27 A;  4GXO A;  5F0F A;  5HDK A;  1T0F A;  2VJ4 A;  3NQO A;  3KLN A;  2XPU A;  3PSF A;  4CUG A;  4ETS A;  4L0Z B;  3H36 A;  3HC7 A;  1QPI A;  1T6S A;  3EDP A;  3OYD A;  5M3F J;  2KL4 A;  3K70 D;  4V2G A;  3WHC A;  3I58 A;  2QYO A;  3QAH A;  2DTZ A;  2LF8 A;  3K4L A;  4N4O B;  5J8C A;  5FLX K;  3UNG C;  4Q4Z F;  1IC8 A;  2X6O A;  2PMZ N;  2ZC2 A;  1MKM A;  3GFL A;  4ZDP A;  4UB8 C;  3ERM A;  4RGS A;  4XLF A;  2XKP A;  4JBA A;  3DV8 A;  1BI2 A;  4FT8 A;  4RGR A;  1B9N A;  4D9J A;  3ZQL A;  1FP1 D;  2LBF A;  3G1L A;  1WVR A;  1TBX A;  5JI6 A;  5ICG A;  5FFX A;  4BAY A;  4M3E A;  3FXU A;  5LRS A;  4G94 A;  4HYE A;  4IRI A;  4O5V A;  4N9I A;  2L0K A;  1IXR C;  3O8H A;  4KDP A;  3HSF A;  1AU7 A;  3A0B C;  3L9F A;  1V5E A;  3GFM A;  1KU3 A;  2QBY B;  4XLP F;  2P0W A;  2QKL B;  1LQ1 A;  1GV2 A;  4B09 A;  2G7H A;  2QF7 A;  3H3Z A;  5E3N A;  2WV0 A;  2QM3 A;  5FRO A;  2K9Q A;  3VOD A;  2H09 A;  3MVP A;  2L4M A;  2Y9Y A;  4C3J J;  5LGN A;  2W7N A;  1XMX A;  2R5Y B;  4NUB A;  2EFP A;  4ENM A;  1VQ8 I;  4I0B A;  4B3X A;  1STZ A;  3DFG A;  4XOT A;  2GOM A;  3SZG A;  4XOR A;  2IEK A;  3VSL A;  1P2F A;  1GXP A;  1SFU A;  5FD6 A;  5FB2 A;  2IGM A;  1K83 J;  1LDJ A;  1IG7 A;  5GAE J;  2XRL A;  4EJW A;  3AL0 C;  2DK5 A;  2RGV A;  1FJL A;  4L5I A;  1B72 B;  1EH7 A;  4Z2Y A;  1SMY F;  1Z21 A;  1Y56 A;  4CCO A;  1FOY A;  1TLH B;  4XL9 A;  3MEX A;  2H27 A;  3GTL J;  3GTP J;  3QU6 A;  1I3A A;  2IGK A;  2R92 J;  3P9C A;  2LY2 A;  1WI3 A;  1VQ6 I;  3LSG A;  3PNY A;  4PSX A;  5J1U A;  4AIK A;  4AVZ A;  2DMN A;  1Y8R B;  4XK4 A;  3ZOB A;  2R5Z A;  4U88 A;  4EV0 A;  1NTC A;  3HOY J;  2R7W A;  2XF5 A;  4D7M A;  4OU0 A;  3ROU A;  3OS2 A;  5ICE A;  2GLO A;  2HQA A;  1PUF B;  2B0L A;  4YFK F;  4DW6 A;  3E6M A;  3KP5 A;  2FF4 A;  3HOS A;  1AWC A;  4AYB N;  2DJN A;  3ZPL A;  2UWM A;  2VAS A;  4CDG A;  5D5U B;  3PIO F;  1HDD C;  1OJL A;  4IL6 C;  3GW2 A;  4BH9 A;  4AWX B;  5E3O A;  3TP0 A;  3KEQ A;  5D6F A;  3OIQ A;  3D5S C;  3CCL I;  3JW4 A;  5KHD A;  3F8F A;  4C3H J;  2NS8 A;  2OA4 A;  2XB5 A;  1LVA A;  2M1B A;  3FXJ A;  1ZYR F;  3KP2 A;  3FMS A;  2JSC A;  3EYI A;  3IUO A;  3PNT A;  1ZTR A;  2OQG A;  2JA5 J;  3U1K A;  2MGQ A;  1VQO I;  2WA0 A;  2DT7 B;  3KZI C;  2KP6 A;  4GCV A;  1O7F A;  3H0D A;  5DM7 F;  1Z91 A;  5EF6 A;  3OYF A;  4HQE A;  3KZY A;  3QYF A;  5L3C A;  3F6O A;  2DFH A;  1SFO J;  4IF4 A;  1IXS B;  1FX7 A;  1G6N A;  2PFB A;  1FC3 A;  1SVM A;  1WJC A;  2DMQ A;  2V1X A;  3SFZ A;  2YU9 J;  4CA0 A;  1W5T A;  1MBK A;  4FX4 A;  2NVX J;  5FRM A;  1YJN I;  4AU7 A;  4TV7 A;  3HHH A;  1IDY A;  3FKI J;  1HC8 A;  5EGO B;  2E36 A;  3EET A;  3TDZ C;  5EGO A;  2X6X A;  3HOX J;  1O3Q A;  3IHU A;  3EQL F;  4X0G A;  1ZR2 A;  3BOQ A;  3WTT C;  1I6X A;  3RIR A;  1G3Y A;  1FSH A;  2IT0 A;  3HRU A;  2NNN A;  2VXD A;  1W1W E;  4RBO A;  3H92 A;  2EFN A;  3FBI B;  3T8T A;  3DCF A;  4CYD A;  3QPT A;  5E1Z B;  4LK1 F;  5IY5 H;  3HSE A;  1I5Z A;  1K4S A;  2CV0 A;  1KQ0 A;  4RB3 C;  3AG2 H;  3EUH A;  3MKY B;  1BW5 A;  4HW0 A;  2FOW A;  1BC7 C;  3HM5 A;  2VPL A;  1AKH B;  3CCJ I;  2FBI A;  1P4W A;  4RAG A;  1U8R A;  4LLG F;  2DYS H;  1IZ1 A;  4ITV A;  2QCO A;  1D0Y A;  3S2D J;  3HJE A;  3KYC B;  2TCT A;  1LUJ B;  1MMS A;  2JPB A;  1F5T A;  1SC7 A;  3RQ4 A;  5E20 A;  2WV1 A;  1ZGA A;  4E7L A;  3LAJ A;  1M1E B;  2IVM A;  3DQV C;  5HS8 A;  1T38 A;  4PFO A;  5FRN A;  3BP8 A;  2Z99 A;  1YQA A;  2G0E A;  3HKZ A;  4JX6 A;  2A6E F;  3JRC A;  4HNT A;  1E17 A;  1V54 H;  2M4G A;  4RGX A;  4XNF A;  3NRV A;  3F23 A;  2WAF A;  2X6W A;  4II3 A;  2GWR A;  3JRB A;  4M9Z A;  1ETO A;  1VZ0 A;  2QVO A;  4PJL A;  2HXO A;  3Q5F A;  1U8B A;  4G6T B;  3IAM 2;  3LA7 A;  1MNM C;  2DT5 A;  2WAQ A;  4AM3 A;  2LDU A;  3RYR A;  4B43 A;  9ANT A;  2DAO A;  5DM6 F;  2HDC A;  1X3Z B;  3TED A;  3HB9 A;  3OV8 A;  1T95 A;  2QWW A;  1RKW A;  5GPC A;  1SAX A;  3H3V K;  3A01 B;  4CCL A;  3HXL A;  2VOP A;  1OCP A;  3JCU C;  2BGC A;  4QPQ A;  3ZQG A;  4O3M A;  2K86 A;  3MZH A;  4YIR X;  4IQ4 A;  4HZF A;  4BUP A;  3E3V A;  4ON0 A;  5AIP A;  3CF5 F;  1OR7 C;  1OCC H;  4DYC A;  2V7F A;  3J7Z I;  4DIQ A;  2DA4 A;  3Q3S A;  2WBM A;  1X4O A;  1Z7U A;  1UCR A;  3R61 A;  3VPR A;  6PAX A;  1R6R A;  4OAZ A;  1KQ9 A;  3VEP A;  2CW7 A;  2AXL A;  4L9T A;  3ZXS A;  1APL C;  1D0Z A;  4FE4 A;  3ML6 A;  3HTS B;  1X1D A;  3BG9 A;  4CZZ A;  4CHU A;  1XDS A;  3JTH A;  4S05 A;  2R7R A;  3NWS A;  3TL4 X;  4AD9 A;  2HVR A;  4M3G A;  2JRT A;  3MZ8 A;  2ACJ A;  3L00 A;  2EFQ A;  3WGH A;  5JR3 A;  2VBW A;  5D6E A;  2UV1 A;  1JTY A;  4U0V A;  4F91 B;  2JQ7 A;  2M30 A;  2CJJ A;  2ZFW A;  4KYW A;  2F5V A;  4BQA A;  2A69 F;  1N75 A;  1WJB A;  5KNL A;  1WHU A;  2XUB A;  1SVO A;  1P4A A;  3ABT A;  4P5O A;  5DDG A;  2MC3 A;  5LRR A;  1WFX A;  2IA1 A;  2JTV A;  4UUV A;  1J0R A;  1P6R A;  2I5U A;  3C3W A;  3CCS I;  3F8N A;  2Z3Y A;  1XS9 A;  1K61 A;  2K4B A;  5BQT A;  2CQQ A;  1D8K A;  4LIV A;  3W2W A;  5ILV A;  4ASN A;  4EJT A;  2XPV A;  4PJ0 C;  4C30 A;  3JSO A;  2DOE A;  5DCM B;  3FIW A;  4I02 A;  3QOE A;  4DGW B;  1ZKG A;  1K78 B;  1OIS A;  1QHH D;  2OTJ I;  2FMY A;  3OS1 A;  3VYS B;  3FIS A;  2VBX A;  3ZR8 X;  2HKX A;  4BHP A;  2RQQ A;  1TQM A;  4QSH A;  2PJR B;  2LR8 A;  2XAJ A;  3TMO A;  2RV8 A;  3KYL A;  3I3L A;  3N97 A;  2ZSI B;  1ZN2 A;  1YO5 C;  3G71 I;  3KP7 A;  2GIV A;  1I1S A;  1XSV A;  5LHI A;  4NC6 A;  3C2H A;  2DXI A;  1T56 A;  1XMA A;  3LSP A;  3CTA A;  2D1H A;  4IVN A;  2LLK A;  3LSH A;  2E5N A;  1R1V A;  1BR2 A;  4A5N A;  4XKV A;  5GP9 A;  2A05 A;  2Y9Z A;  3JRG A;  2O03 A;  3IWZ A;  3HG9 A;  3C2B A;  2OAZ A;  1Z1D A;  2OU2 A;  3BPX A;  1HST A;  2FRH A;  5KAI C;  4LG0 A;  4HV5 A;  4XID A;  3QPL A;  2R7D A;  1WJD A;  2HOA A;  2LVS A;  2VKH A;  3R0J A;  3RYP A;  1KON A;  2HYG D;  3CP2 A;  4HLY A;  3TKY A;  2JA8 J;  2HGC A;  3G4S I;  1R22 A;  4XON A;  1YS6 A;  1UHW A;  4BE1 A;  1FMW A;  2ISZ A;  3G3Z A;  1H88 C;  2PMU A;  4GRI A;  1UFM A;  2FEZ A;  4ESF A;  4KNY A;  2FML A;  3TO7 A;  2P6S A;  1JKR C;  4V19 K;  4Y52 J;  1IJW C;  5JHU A;  5AIQ A;  4OWR B;  3KLO A;  3ZMS A;  5A2Q K;  5FLX Z;  2O0Y A;  3W6V A;  2BVM A;  2J5P A;  4KT5 C;  2VJ5 A;  3E5Q A;  4U87 A;  2DA7 A;  2Z16 A;  3S1Q J;  3RQI A;  4OIP F;  2HZD A;  4XBF A;  1Y1W J;  5FO5 A;  4XLC A;  1B6A A;  3DU5 A;  4LLL A;  5ICF A;  3CCE I;  1R49 A;  5GPA A;  4MGR A;  2AQE A;  2BVL A;  1I3Q J;  4MHG A;  3QP5 A;  3CMM A;  2OZU A;  2EJR A;  4PUS A;  3G1O A;  4IOC F;  2GBY A;  3OOP A;  1G4D A;  3M8F A;  3JTG A;  3BQY A;  4HF0 A;  2WTE A;  2Q2E B;  5L3G A;  4B4C A;  2LNB A;  2M0C A;  1Y1V J;  2EQR A;  3BG6 A;  3IP4 B;  3P5J A;  2OD5 A;  4ESJ A;  4RAZ A;  3WTY C;  2VL8 A;  3GYH X;  3WGI A;  1BL0 A;  2PI0 A;  2AXT C;  2L7F P;  3ECH A;  3CC4 I;  1GLN A;  1D1B A;  4GGG A;  2M7A A;  3OIP A;  1RES A;  2QQ8 A;  1EF4 A;  3BJ6 A;  2CRG A;  2F2E A;  4AVP A;  4A3F J;  1R00 A;  1ZRC A;  4RB1 A;  3DXJ F;  4B1R A;  4BE2 A;  1MH3 A;  1FP2 A;  4HST A;  2FNA A;  5B1B H;  1TC3 C;  5FLV A;  3HEF A;  4IJA A;  2WY8 Q;  2GA2 A;  2ZXJ A;  4ZYA A;  4ZC3 A;  5F1J A;  3AG3 H;  4FIS A;  1S7E A;  4DYQ A;  5GAG J;  1EV7 A;  2O61 A;  2HEO A;  4AIH A;  4CZC A;  3I4M J;  3IH4 A;  1E3P A;  3IRQ A;  1DQU A;  4I98 B;  2XDV A;  3DTI A;  4G7H F;  2P7V B;  3FK6 A;  1UMQ A;  3L2R A;  3BR0 A;  2HQ5 A;  2O5R A;  1YFH A;  2MFZ A;  4KUM A;  4HAM A;  2CUZ A;  5GTH C;  2EZL A;  3BR3 A;  2NVU B;  4KA4 A;  4EAT A;  2E60 A;  2ZME B;  3GX4 X;  2CH0 A;  5IP6 A;  2OZ6 A;  1T33 A;  2WAQ N;  2XAS A;  3EUH C;  4A3E J;  4LIT A;  2HFH A;  1KU2 A;  1ON1 A;  1UJ8 A;  3QPS A;  3HUG B;  3SFI A;  3FMR A;  3QWL A;  1IV6 A;  1E0E A;  1T39 A;  3J80 K;  1O3S A;  3S1R J;  1MSF C;  3G73 A;  1XX5 A;  5K7H A;  3GFI A;  4Q47 A;  4AC0 A;  4S0H B;  2EFO A;  4FX0 A;  2VLA A;  3R6S A;  3H9Q A;  1A36 A;  1SEU A;  3ZGK A;  1O4X A;  2LFB A;  4HPQ A;  3JR9 A;  3BR1 A;  4G6Q A;  1FY7 A;  1G3W A;  1AHD P;  3GUD A;  2HTS A;  1VQP I;  3QOP A;  3FMQ A;  2E71 A;  1BIB A;  2V9K A;  5E18 F;  5GAD J;  2EIJ H;  5CQE A;  3DKY A;  4RB0 A;  3RCO A;  1VQ5 I;  2E34 A;  4NHJ A;  4LD5 A;  4C3I J;  1RRJ A;  1FBS A;  4LJZ F;  5BPD A;  2DDA A;  4BXU A;  2VPR A;  4UXN A;  2F4M B;  4RM3 A;  4A93 J;  2W24 A;  3E5U A;  3M8E A;  3CCQ I;  2DPD A;  5C4X J;  4W1U A;  3B6A A;  1KYZ A;  1QVU A;  4MEY F;  1T08 B;  3G1M A;  4XIC A;  5E3L A;  1W5C C;  1YE9 A;  2HOE A;  3TOB A;  4HNU A;  2P7C B;  3BTL A;  2IRF G;  3S2H J;  3JAM K;  2VUM J;  3WTZ A;  3NAU A;  2VBZ A;  3H35 A;  4UUS B;  1Y0N A;  4XLE A;  2L9V A;  4WWC A;  3V8L A;  2K02 A;  1D5Y A;  2QA4 I;  2UZK A;  4PJN A;  3CCU I;  3O6B B;  3S2W A;  1LVK A;  3FBN B;  3T8R A;  3CD6 I;  2M3A A;  1Z67 A;  4A3J J;  3GO5 A;  3KEY A;  4A6D A;  1QA6 A;  2ZNY A;  2IXS A;  3ZQQ A;  2XAU A;  3FXL A;  2K85 A;  3MFK A;  2JN6 A;  4M72 A;  2GOX B;  2V79 A;  5E17 F;  3GME A;  2ZJQ F;  2GIZ A;  2WAD A;  1IV8 A;  1J9I A;  2E1C A;  3Q0V A;  3JRE A;  1UZC A;  1Q1H A;  3PJR A;  4Y15 A;  3SEQ A;  3P7N A;  4N0B A;  1RIO H;  1NH3 A;  5E1X A;  2VQC A;  4MNU A;  3J81 K;  1JUS A;  1A31 A;  1JUM A;  2X4H A;  2DW4 A;  2DJI A;  3BG7 A;  1OCR H;  1YHQ I;  2KIS A;  2CQ7 A;  2KJB A;  3C7J A;  1U78 A;  1B8I B;  2ESH A;  1E3O C;  2K3P A;  2PEX A;  1F4K A;  5M5Y J;  2H8R A;  4A3C J;  3A1Y A;  2EWN A;  1IXC A;  2MBF A;  3S16 J;  1ZGJ A;  1SAN A;  1U9O A;  5FD5 A;  2HVS A;  3GXO A;  3ONQ A;  2OCE A;  1OR7 A;  1IN6 A;  2BE5 F;  3FZV A;  1A6Q A;  1F36 A;  2A3S A;  3PM1 A;  3ELK A;  1Z3Y A;  1IN4 A;  3F3X A;  3ZN1 A;  4Y33 A;  1R1T A;  5F04 A;  4QLC U;  1ZQ3 P;  3REO A;  2EZK A;  2CW8 A;  2W57 A;  5TIS C;  1TWA J;  1BOA A;  2IJL A;  2V1U A;  3DBH B;  1ETX A;  2VXZ A;  2ELJ A;  2L7M P;  3OS0 A;  4X6A J;  3I4P A;  4NB5 A;  3CCR I;  3K2Z A;  1YOV B;  4L5E A;  2WAE A;  4L0Y B;  2IW5 A;  2KFD A;  5K7F A;  2D1V A;  1QZY A;  5DTD A;  2L7K A;  3K69 A;  1S7A A;  3HGY A;  4CCJ A;  1J09 A;  1IRZ A;  5BPI A;  2EIN H;  3S8P A;  1V3F A;  2ZNZ A;  1ZAO A;  4PJM A;  5H6Q A;  2ADU A;  1FMV A;  2K9L A;  2XGC A;  2Y69 H;  1X4P A;  3IH2 A;  2D5V A;  4XMY A;  2O9L A;  2PG4 A;  2CQK A;  4N4N B;  4DZP A;  3FF5 A;  1X2M A;  3H9G A;  2PMH A;  1IO2 A;  2IGN A;  1R5I D;  5FJ8 J;  3HYI A;  2VOD A;  4XKW A;  1IRF A;  3BWG A;  1OMI A;  2DFE A;  1VI0 A;  3KP3 A;  5ERI A;  5EEH A;  4BHC A;  3MKW B;  1EA3 A;  1X19 A;  1YX3 A;  2XSJ C;  1ULY A;  2JPC A;  4XLN F;  2FD5 A;  5E1W A;  5J1R A;  2JSP A;  4S04 A;  1JT0 A;  1WJA A;  3I71 A;  3S3N A;  3W6J B;  1E2X A;  2F6C A;  3IC7 A;  4AIJ A;  2QBY A;  1W7P B;  1T2K A;  4QTR A;  3B73 A;  4CYC B;  1NK2 P;  4A5M A;  2XPW A;  4A0X A;  2A6T A;  1R4M B;  4ANJ A;  1ZG5 A;  3ESW B;  1YW9 A;  1XMK A;  2JMW A;  1HBX G;  1LEB A;  3CDI A;  4BNC A;  3N4M A;  1S8N A;  4A6E A;  4CGZ A;  2STW A;  2ZXH A;  2R5Y A;  3QQA A;  4I09 A;  1VQ4 I;  4LB6 B;  1MBH A;  3I59 B;  3GZ5 A;  4JQF A;  3ERE D;  1DP3 A;  1P9Q C;  3SEZ A;  3DPL C;  3FXQ A;  1QZE A;  1UG2 A;  2O8X A;  2DMP A;  2P5K A;  3OWT A;  2FU4 A;  5DEQ A;  1B72 A;  2DPU A;  2W4S A;  4RS8 A;  3CJR B;  5DCF A;  5EJC A;  1UST A;  4D5F A;  2Z33 A;  4ENK A;  2EV6 A;  1G59 A;  4NC7 A;  1N77 A;  2MAB A;  5TJJ A;  1B59 A;  1QQI A;  2MC4 A;  2PJP A;  5CVU A;  1BI0 A;  2LYC A;  5K5O A;  5E3M A;  4ZZL A;  4XRF A;  4JYK A;  1MSE C;  5DYM A;  2WY7 Q;  3F0C A;  2VJI A;  2FA5 A;  4BXF A;  4AID A;  2FBK A;  3TW6 A;  2LRD A;  1YX5 A;  5BS6 A;  5J47 A;  3ASN H;  2DN0 A;  3KE2 A;  5TRD A;  1YTY A;  1PUF A;  3FXO A;  5F0H A;  1E3H A;  2E7X A;  2BOL A;  2HKO A;  3CQZ J;  1JI8 A;  1ETQ A;  3RI4 A;  3GWZ A;  3H5N A;  2XC7 A;  1RET A;  3IRR A;  1NG7 A;  1ONV A;  3B6C A;  3IKT A;  2HDD A;  1UB9 A;  3CJT B;  3JRI A;  5BMZ A;  3JRH A;  5E8G A;  3E0J B;  3BT9 A;  3V8J A;  1V5F A;  4BQQ A;  5F1R A;  1B9M A;  2BBY A;  1A04 A;  1XCV A;  2LH9 A;  2Z1D A;  3ZMD A;  3AG4 H;  2KQR A;  3LST A;  3F8C A;  1JGS A;  2JWT A;  1XGN A;  1HW1 A;  2UXX A;  1R1U A;  1WI9 A;  2M5W A;  2LSO A;  3WE3 A;  2IS6 A;  2TDX A;  1NG6 A;  1HKT A;  2ZME C;  3TQN A;  4BHB A;  5IT3 A;  1HCR A;  1OYY A;  2YSR A;  4LK0 F;  2R93 J;  3JSP A;  4IRH A;  3FX3 A;  1W0T A;  2OTL I;  2A6H F;  3S1N J;  1F43 A;  1Z77 A;  3E7L A;  1R7J A;  3F8M A;  4IHT A;  3CCY A;  3S17 J;  2JZY A;  2CWE A;  4Q48 A;  3WTW C;  4FCY A;  1XGO A;  2K7L A;  1VQN I;  5F6F A;  1ENH A;  3BC8 A;  1ZK8 A;  3F72 A;  4BBR J;  3DTK A;  4JOM A;  3ZQC A;  1OFC X;  3T1B A;  5F08 A;  2JJ7 A;  3D0S A;  2O6G E;  4KIB A;  3BDD A;  4QWQ A;  3VDX A;  2V6C A;  4M6Y A;  2JVH A;  5ICC A;  4DQ2 A;  3ZMT A;  4E7K A;  3CMY A;  2IGO A;  3SZP A;  4PK4 A;  4ZTJ A;  1EH6 A;  1TW2 A;  1I39 A;  5AON A;  5DUI A;  2EIK H;  4NNJ A;  2GA1 A;  1AKH A;  3KFW X;  4C2T A;  1VQK I;  1FEX A;  2ZFU A;  4J19 A;  1LFB A;  4G7Z F;  5HOO A;  3LSR A;  1GXQ A;  2YS9 A;  2NOJ B;  4D0P A;  3RPQ A;  3PO2 J;  1VTN C;  2K3F A;  2Y0S A;  3DBR B;  1V5G A;  2AQF A;  2BZT A;  1EKE A;  4OIN F;  2KT0 A;  4FAS D;  2FBH A;  5HLT A;  3CME I;  5L3F A;  1C0W A;  4XR6 A;  2COM A;  1ZAR A;  5J4Y A;  1DDN A;  3R4K A;  2W48 A;  4M6V A;  1D5V A;  3AG1 H;  3BJO A;  1ETV A;  3OL3 A;  4H0E A;  4FET A;  1TZL A;  1HW2 A;  1J75 A;  4UUT A;  4F52 A;  1JE8 A;  2QQ9 A;  4I01 A;  1PP8 F;  1PJR A;  5HLG A;  1HW5 A;  1HXD A;  2FE3 A;  3GVA A;  3GZN B;  4EM0 B;  3MMY B;  4PJJ A;  2VKD A;  3DU6 A;  4WXD A;  1OYI A;  1WCM J;  3TGN A;  4CIC A;  3C18 A;  4LIU A;  3HHG A;  5J6X A;  3M1C A;  4JX4 A;  3HOZ J;  3A01 A;  2E2J J;  1YW8 A;  2MH2 A;  2OCC H;  3LQR A;  4XRS A;  3J80 Z;  2BY0 A;  1IW7 F;  1MBJ A;  2WWY A;  3L2W A;  2Q8K A;  4ZYG A;  4L5J A;  3HOT A;  1ZRE A;  4QIW N;  4A3G J;  3CJN A;  2NS7 A;  3PQK A;  4NC8 A;  3OIO A;  4ZYD A;  1WJ5 A;  2V6E A;  1QZZ A;  1LFP A;  3W3C A;  1L0O C;  3VB2 A;  3WTS C;  2LKX A;  1J5Y A;  5B3S H;  4HSR A;  4WXH A;  3HOV J;  2H8W A;  2GXB A;  1X58 A;  3A02 A;  4JK1 X;  5IPA A;  4KT6 A;  2P6T A;  4ENJ A;  3DKX A;  5J3L A;  3PFI A;  1UHS A;  2FQ4 A;  4E70 A;  4HRI A;  4IHY A;  2CQX A;  2HQR A;  4F93 B;  2R7S A;  2Y75 A;  4OIR F;  5LBQ A;  2MA3 A;  3F9K A;  2RRE A;  1SAU A;  2VON A;  3WG7 H;  2EPF A;  2FQ3 A;  2DYR H;  4WXC A;  1TL8 A;  4L18 B;  1FTZ A;  4UY8 I;  4XLH A;  2H1L A;  2ZJP F;  4DBR A;  1DGR M;  1FSE A;  1TWC J;  2DDB A;  2W82 A;  3W6K B;  3UKG A;  3CO7 C;  3J7A Y;  1Z6T A;  4KN4 X;  2ME0 A;  1ORK A;  2EB7 A;  3KP6 A;  3LSI A;  3DEW A;  3GTQ J;  3GTJ J;  4XKC A;  4IXA A;  3DEE A;  2RNG A;  5IT9 K;  3RTR A;  1IRG A;  4EMS A;  2RNJ A;  4PFP A;  2HOS A;  2ZSH B;  1A5J A;  1SD6 A;  3VOE A;  4ZYE A;  3FHZ A;  1QNT A;  4FTH A;  5DCM A;  5JFR A;  4HDV A;  5HNF A;  2HWV A;  2CG4 A;  1K78 A;  1MBE A;  3L2C A;  2NXN B;  3GFJ A;  2ZJR F;  2CUF A;  4RMN A;  5EZH A;  1F9N A;  4B47 A;  2E7W A;  3TOA A;  3Q9S A;  2CFO A;  2PJR A;  1R4N B;  2H1K A;  2PN6 A;  1J2X A;  3ZMZ A;  3ZRG A;  4HQM A;  2R7V A;  3HOU J;  3PSI A;  4RM2 A;  3E6B A;  2LC2 A;  2X1C A;  2ID3 A;  3HZJ A;  5JLX A;  1X1P A;  3QOD A;  1Q1V A;  4XLA A;  4B8X A;  1WGX A;  3R0A A;  3BR6 A;  4G9Y A;  3CLQ A;  4Q5S F;  1XSX A;  4IZZ A;  1DU6 A;  2KIF A;  2QEX I;  1U9N A;  1DP7 P;  4O6J A;  1JJ8 C;  1YG2 A;  1SMT A;  2VJJ A;  2FUG 2;  5GTI C;  2A5W A;  1LEA A;  2PLY A;  2KHM A;  4BEH B;  3K0L A;  1SVL A;  3ISP A;  3DPU A;  3BTI A;  3LA3 A;  1MW7 A;  5HNH A;  3NWT A;  2FOK A;  4F3Q A;  2XAG A;  1IUY A;  3RKY A;  3D1N I;  4CCK A;  2VB6 A;  2QQA A;  4W97 A;  1ZG1 A;  5FKM A;  2HZT A;  4R8H A;  2L01 A;  3LQQ A;  4LFU A;  2BXZ A;  2LOO A;  2QZ8 A;  4B48 A;  1U0J A;  2X9D A;  1ZEL A;  2DOA A;  2JVG A;  3BCA A;  4CCN A;  2Z9O A;  1ZH5 A;  4XM3 A;  1JJ6 C;  4NDL A;  4UVC A;  3A2K A;  3SJM A;  3GBG A;  5JLW A;  4A3D J;  1YIO A;  1OCO H;  1AOY A;  2IA0 A;  1HKQ A;  4JP0 A;  3DTE A;  5JVG F;  1IF1 A;  2ZCW A;  4IQJ A;  2ME6 A;  2KDZ A;  5K7Z A;  2DA2 A;  2KRF A;  3BJA A;  2IBD A;  3CUQ B;  1RKT A;  4A69 C;  1A35 A;  2QSH X;  4DNC A;  2R7F A;  4EGZ A;  1ERD A;  1D1C A;  1IRX A;  1HQC A;  4RGU A;  3OYC A;  2M45 A;  3G2B A;  3HOW J;  5DS9 A;  2FX0 A;  2KIM A;  3BZC A;  3WOD F;  2ELK A;  4G6D A;  2Q2E A;  2P5V A;  4GYI A;  1ZLJ A;  3CC2 I;  3QU3 A;  1BR1 A;  3K1N A;  5H2F C;  1ZRF A;  3S15 J;  4E7Z A;  1O3R A;  3MD2 A;  4M74 A;  4JX5 A; 
#chains in the Genus database with same CATH homology
 5E3O A;  3TP0 A;  3S16 J;  1SAN A;  1U9O A;  4C3H J;  5EDN A;  2NS8 A;  2XB5 A;  1F36 A;  2R7Z J;  1MH4 A;  2ID6 A;  2LD5 A;  3PM1 A;  1ZTR A;  5F04 A;  2JA5 J;  1ZR4 A;  1ZQ3 P;  2MGQ A;  3JRD A;  2EZK A;  1GDT A;  1TWA J;  2OPT A;  1JGG A;  1ETX A;  3ZQI A;  2L7M P;  4X6A J;  5EF6 A;  1W0U A;  4L5E A;  5IYD J;  2Y0S N;  1SFO J;  3HKZ N;  4XRS G;  1FIP A;  5K7F A;  5DTD A;  2DMQ A;  2YU9 J;  3HGY A;  1IRZ A;  2MG4 A;  3OOU A;  1OCT C;  1MBK A;  1P7J A;  2NVX J;  3LNQ A;  2I10 A;  2NVQ J;  1IUF A;  3PO3 J;  2XGC A;  3OSF A;  1HOM A;  3IH2 A;  1IDY A;  2D5V A;  3SDG A;  3FKI J;  3K2A A;  2DA1 A;  4DZP A;  5EGO B;  2O9L A;  1ETK A;  5EGO A;  1X2M A;  1ETY A;  3HOX J;  4BY1 J;  3M4O J;  5FLM J;  2LY9 A;  2IAI A;  5FJ8 J;  1ZR2 A;  2ZB9 A;  1VI0 A;  1JTX A;  1ETW A;  2L7Z A;  1VND A;  4RBO A;  2NVY J;  3DCF A;  3TW7 A;  2FD5 A;  5J1R A;  1JT0 A;  1IDZ A;  2AO9 A;  1HDP A;  4QTR A;  3RZD J;  4CYC B;  2XGD A;  1NK2 P;  1MBG A;  2YUS A;  1R9T J;  1BW5 A;  2XPW A;  4B3A A;  1POG A;  4BY7 J;  3HM5 A;  2VKE A;  2E19 A;  1AKH B;  1P7I A;  2JMW A;  2QCO A;  2M2E A;  2N8G A;  4HNV A;  2Y31 A;  3S2D J;  2LTP A;  2R5Y A;  2TCT A;  2P81 A;  3QQA A;  4AUX A;  1MBH A;  2WV1 A;  3RZO J;  1GVD A;  2XGE A;  4JX6 A;  1UG2 A;  2DMP A;  2G0E A;  2Y30 A;  4A3K J;  1TWF J;  3JRA A;  3JRC A;  4UUS A;  4I6Z A;  1B72 A;  1I6H J;  4BBS J;  3JRB A;  3LSJ A;  4D5F A;  1ETO A;  4MFD A;  2HXO A;  1U8B A;  3M3Y J;  1MNM C;  1GV5 A;  9ANT A;  3Q0U A;  3IV5 A;  1QVT A;  5E3M A;  3TED A;  4GFB A;  2RAE A;  3HB9 A;  4V2F A;  4JYK A;  5EG0 B;  2MSY A;  2VI6 A;  4C2M J;  1MSE C;  2HOT A;  1BW6 A;  2ECC A;  1RKW A;  3F0C A;  3ZQF A;  5GPC A;  3H3V K;  5FKO A;  4A3L J;  3A01 B;  3TW6 A;  1JKQ C;  1OCP A;  3ZQG A;  4MLO A;  2DN0 A;  2HYJ A;  3GTO J;  2AHQ A;  1PUF A;  5M5X J;  3TP3 A;  4BKX A;  5F0H A;  5IOZ A;  2EBI A;  1B8I A;  1HF0 A;  5EEA A;  2E2I J;  1JKO C;  1H8A C;  1IGN A;  3CQZ J;  1ETQ A;  1TWH J;  5IOY A;  4A3M J;  2LK2 A;  4DYC A;  5BNG A;  1RET A;  2DA4 A;  3A03 A;  3Q3S A;  2HDD A;  3B6C A;  2NOG A;  3VPR A;  3JRI A;  5M3M J;  3JRH A;  3BT9 A;  5C4J J;  4ABZ A;  3IH3 A;  1APL C;  4FE4 A;  2R0Q C;  2CU7 A;  3BG9 A;  3ZQH A;  4G12 A;  1ITY A;  2JWT A;  2OF7 A;  3JRF A;  2VKV A;  4M3G A;  4X1E A;  1JT6 A;  1JTY A;  2CJJ A;  2EZH A;  1HCR A;  3Q0W A;  3HBL A;  2R93 J;  1W0T A;  1H89 C;  3S1M J;  3S1N J;  1F43 A;  1Z77 A;  3E7L A;  2M9H A;  1WPK A;  2DMT A;  3CCY A;  4M3B A;  3S17 J;  1XS9 A;  1K61 A;  2CUE A;  2CQQ A;  4FCY A;  5HOD A;  3O8G A;  2DMU A;  2L9R A;  1ENH A;  2XPV A;  1ZK8 A;  2COB A;  5FKK A;  3FIW A;  5F27 A;  1Z0X A;  1ZKG A;  4BBR J;  3CDL A;  3HGG A;  2XB0 X;  5FKN A;  3ZQC A;  1OFC X;  4RDU A;  5F08 A;  2JJ7 A;  3FIS A;  2E1O A;  4QSH A;  2LR8 A;  4A3B J;  3MN2 A;  3MKL A;  1HLV A;  4CYC A;  3BR5 A;  4M3F A;  3CMY A;  1QRY A;  3LOC A;  1ZGW A;  1T56 A;  3LSP A;  2K40 A;  1AKH A;  2LLK A;  5FKL A;  1FEX A;  4J19 A;  5GP9 A;  1LFB A;  2HXI A;  2Y9Z A;  3JRG A;  3LSR A;  2EZI A;  3C2B A;  2YS9 A;  1LFU P;  3PO2 J;  1BA5 A;  4XRM A;  4XID A;  3QPL A;  5IP7 J;  2HOA A;  2LVS A;  2KT0 A;  4IHW A;  2JA6 J;  2JA8 J;  1RPW A;  2W48 A;  4M6V A;  1H88 C;  1ETV A;  1XC5 A;  5M5W J;  1FTT A;  5J1Y A;  1JKR C;  4Y52 J;  4UUT A;  1IJW C;  3GTM J;  2DA6 A;  2H8R A;  1MBF A;  5EG0 A;  2HI3 A;  3W6V A;  4BXX J;  2DA7 A;  3S1Q J;  1WCM J;  3RQI A;  2M34 A;  4JX4 A;  3HOZ J;  1Y1W J;  3A01 A;  2MW8 A;  2E2J J;  4XRS A;  4DZJ A;  1GT0 C;  1MBJ A;  4A3I J;  3RKQ A;  4A3G J;  4QIW N;  5GPA A;  2NS7 A;  3OIO A;  1I3Q J;  3BR2 A;  3WHB A;  1A6I A;  2LKX A;  4DYR A;  3G1O A;  4FE7 A;  2GM4 A;  3HOV J;  1X58 A;  2GBY A;  3HDD A;  3A02 A;  5IPA A;  2R5Z B;  1G2H A;  1WH7 A;  3BQY A;  5J3L A;  3NAR A;  1UHS A;  4M3D A;  2FQ4 A;  1FIA A;  4B4C A;  2M0C A;  1Y1V J;  2EQR A;  3GTG J;  4IHY A;  2CQX A;  3BG3 A;  3BG5 A;  1BL0 A;  2L7F P;  2LP0 A;  3GTK J;  1GUU A;  3L1P A;  2JK3 A;  2K9S A;  1LE8 B;  2O7O A;  1LE8 A;  1RES A;  1FTZ A;  3BQZ A;  1EF4 A;  2CRG A;  4MO7 A;  1JKP C;  4A3F J;  2Y2Z A;  1TWC J;  4B1R A;  4IHX A;  3UKG A;  4I76 A;  3S14 J;  1XG1 A;  5IYC J;  1MH3 A;  2DA3 A;  1TWG J;  3OSG A;  5F0F A;  3HEF A;  1TC3 C;  5FLV A;  2ME0 A;  4MIM A;  5F1J A;  1ORK A;  4FIS A;  1S7E A;  4DYQ A;  5C3E J;  2XPU A;  3DEW A;  3GTQ J;  3GTJ J;  1QPI A;  3I4M J;  1CQT A;  3IH4 A;  1DU0 A;  5M3F J;  4V2G A;  2HOS A;  3WHC A;  1A5J A;  2EH3 A;  3FK6 A;  2DTZ A;  1UMQ A;  2E2H J;  3BR0 A;  2HQ5 A;  4FTH A;  2TRT A;  1VF9 A;  4D5C A;  1MBE A;  2EZL A;  3BR3 A;  2CUF A;  5EZH A;  1IC8 A;  5IP6 A;  2X6O A;  3K7A J;  1T33 A;  2PMZ N;  2WAQ N;  4A3E J;  3QPS A;  3SFI A;  2H1K A;  1NK3 P;  1IV6 A;  1X2N A;  3H0G J;  3ZQL A;  3S1R J;  1MSF C;  3G1L A;  5K7H A;  3HOU J;  4AC0 A;  4S0H B;  4M3E A;  2ID3 A;  3I4N J;  5JLX A;  1RR7 A;  2L0K A;  3O8H A;  2XSD C;  1Q1V A;  2M8G X;  1O4X A;  1WGX A;  2LFB A;  3JR9 A;  3BR6 A;  5IYB J;  3BR1 A;  1AU7 A;  2K9N A;  1AHD P;  1DU6 A;  3BTC A;  1JUP A;  1U9N A;  1JJ8 C;  2FJ1 A;  1GV2 A;  4C3I J;  5F0C A;  2QF7 A;  5E3N A;  2VPR A;  4IEJ A;  4A93 J;  2K9Q A;  4MFE A;  1I50 J;  3BTI A;  3MVP A;  2Y9Y A;  4C3J J;  5C4X J;  1WH5 A;  4W1U A;  2R5Y B;  3B6A A;  3D1N I;  1QVU A;  3G1M A;  4W97 A;  4XIC A;  5FKM A;  5E3L A;  2IEK A;  4LOC A;  4EEF G;  3BTL A;  3S2H J;  2X9D A;  1K83 J;  2VUM J;  1IG7 A;  3NAU A;  2XRL A;  4UUS B;  1FJL A;  1B72 B;  1JJ6 C;  1D5Y A;  4NDL A;  3SJM A;  3GBG A;  3BTJ A;  5JLW A;  4A3D J;  1YRN B;  2B63 J;  1YRN A;  2JA7 J;  4JP0 A;  4A3J J;  2ME6 A;  2KDZ A;  5K7Z A;  3GTL J;  2DA2 A;  2IBD A;  3GTP J;  2JN6 A;  1RKT A;  4A69 C;  2X48 A;  5EYR A;  2R92 J;  4D7N A;  1VFC A;  1WI3 A;  3Q0V A;  3JRE A;  5EZG A;  3FK7 A;  3LSG A;  5J1U A;  3HOW J;  2DMN A;  4XK4 A;  3ZOB A;  5DS9 A;  2FX0 A;  2R5Z A;  2DA5 A;  1JUS A;  1NTC A;  2ELK A;  5IP9 J;  2NVT J;  1JUM A;  3HOY J;  4Y7N J;  4D7M A;  2GLO A;  1PUF B;  4DW6 A;  4IHV A;  1U78 A;  4AYB N;  2DJN A;  2O8K A;  1B8I B;  1E3O C;  3S15 J;  2WB1 N;  1BJZ A;  2ECB A;  1HDD C;  5C44 J;  1OJL A;  5M5Y J;  4A3C J;  4JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...