1NK3P

Vnd/nk-2 homeodomain/dna complex, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*GP*TP*GP*TP*CP*AP*AP*GP*TP*GP*GP*CP*TP*GP*T)-3
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1nk3P00
1I6HJ 4DZJA 1JJ6C 3ZQFA 4A3FJ 3GBGA 2DA7A 1A6IA 2XRLA 1QPIA 1MBGA 4BY1J 2ID6A 4IHXA 3I4NJ 5IOZA 1Z0XA 1ZGWA 2JMWA 3HOVJ 4M3FA 1UG2A 1I3QJ 3MN2A 1NTCA 4V2FA 2IAIA 1ENHA 2ME0A 3BR0A 4JX6A 1GVDA 1TWGJ 2FX0A 1VFCA 5M5XJ 4A3LJ 2E2IJ 2DJNA 1T56A 4CYCB 1ZK8A 2HDDA 4A3EJ 4C3IJ 3A01B 1U78A 2X6OA 2JWTA 1VF9A 2JK3A 3S1NJ 1B8IB 1MH4A 2XPWA 3BR5A 1F36A 3LNQA 1MBHA 4A3MJ 5EEAA 1ETVA 5J1YA 4D7MA 3GTMJ 5F27A 3HGYA 3JRCA 1JKOC 1GV2A 3IH3A 2XPVA 2DMPA 2H8RA 5EZGA 3JR9A 1MBFA 1RPWA 3MKLA 2E19A 2PMZN 4Y52J 1B72B 4C3HJ 1RKWA 4UUTA 2LVSA 3HKZN 1WI3A 1GUUA 2JA8J 1HOMA 2DTZA 1UMQA 2XPUA 1F43A 4IHVA 1TWCJ 2NS7A 3DEWA 1U9OA 1Y1WJ 4DYQA 3SDGA 3S16J 1E3OC 4JX5A 2TRTA 3QPSA 1ORKA 2ME6A 3FISA 5J3LA 5JLXA 5EGOB 3S1QJ 5C4XJ 4DZPA 4FE7A 2YS9A 3LSGA 2DA1A 4BBRJ 1IJWC 1ETWA 4XRMA 2XGEA 1X58A 3BR2A 4FCYA 4A3BJ 2HOTA 2DA4A 3A02A 3HOUJ 1MBKA 3G1LA 3S1MJ 2GM4A 1PUFA 4FISA 2LTPA 2W48A 1FIAA 3H0GJ 2R0QC 2M2EA 5K7ZA 1UHSA 2LFBA 2XB0X 4M3EA 5FKKA 2K9QA 3F0CA 3CMYA 2LR8A 5E3LA 2QF7A 4AYBN 2G0EA 4DYCA 5F0CA 3BG9A 1TWHJ 3S15J 2DMTA 2M34A 4QTRA 2Y9YA 1Y1VJ 4D5CA 2ID3A 5IYCJ 5M3MJ 2LY9A 3SFIA 4XIDA 1GT0C 3JREA 4X6AJ 3M3YJ 4A3GJ 3QQAA 3K7AJ 3OIOA 3PO2J 3WHBA 1OCPA 3NARA 1JKQC 5F08A 3TW6A 3A01A 3SJMA 1D5YA 2GLOA 3O8HA 1RR7A 3ZQIA 2M8GX 2NVYJ 4AC0A 4RBOA 1AHDP 3S17J 1TWFJ 1QRYA 3TP3A 2NS8A 2CRGA 2L7ZA 1IUFA 4A93J 4UUSA 2QCOA 1WH7A 5GP9A 3UKGA 2M9HA 4M6VA 3TW7A 3BG5A 2AHQA 1IC8A 3FK6A 1TWAJ 2ELKA 3RQIA 3PM1A 2R92J 2MGQA 1WGXA 2DA3A 2VI6A 2XGCA 4A3KJ 1RESA 9ANTA 3H3VK 2VKVA 1OFCX 3GTQJ 1MBJA 1Q1VA 5FKLA 1JJ8C 5C44J 1TC3C 3B6CA 2Y30A 5F0HA 3Q0WA 2E1OA 5GPAA 2EBIA 3G1MA 5E3NA 1IDYA 1XG1A 2L7MP 3S2HJ 2HQ5A 1ETKA 1FIPA 4EEFG 5IP9J 2L9RA 4XRSG 3FIWA 2JJ7A 1ZKGA 1FEXA 4DW6A 2CJJA 3BR3A 3BT9A 1APLC 2M0CA 3JRAA 1MNMC 2NVTJ 4BBSJ 3HOXJ 2WV1A 2DA2A 5M3FJ 2HXIA 3W6VA 5E3MA 1O4XA 5M5WJ 2ZB9A 4L5EA 2CQQA 4C2MJ 1HLVA 5FKNA 3LSRA 2IEKA 4XICA 2NVXJ 5EG0B 3LOCA 3O8GA 1JTXA 3RZDJ 1BW6A 2KDZA 4B1RA 3L1PA 2DMQA 4M3GA 1IG7A 5J1UA 4FE4A 1JT6A 5EG0A 5EDNA 2OF7A 2GBYA 4V2GA 2CU7A 4LOCA 5M5YJ 5F04A 5FLMJ 5EF6A 2RAEA 1DU0A 3CDLA 3HGGA 5IP7J 2CQXA 4S0HB 5C3EJ 5IYDJ 1RETA 2WAQN 1X2MA 1JKRC 1MSFC 3HB9A 1K83J 1WPKA 3S2DJ 5K7HA 4X1EA 3OSGA 2NVQJ 2P81A 3BTCA 4I76A 5EZHA 1ZR4A 3GTOJ 5GPCA 4BXXJ 1IDZA 2X9DA 4A69C 3C2BA 1QVUA 3JRBA 2DA5A 2LD5A 2DN0A 3BG3A 3CQZJ 1DU6A 1FTZA 3BTLA 2TCTA 2K40A 3GTJJ 3JRIA 3HDDA 2MSYA 3IH4A 2JN6A 4W97A 4DYRA 4QIWN 1FJLA 2XSDC 2FQ4A 2ECCA 3HM5A 1ETYA 5K7FA 3A03A 4W1UA 3ZQLA 4AUXA 2EZIA 2VPRA 3I4MJ 2HI3A 1HF0A 2EZKA 3PO3J 2YU9J 4XK4A 1T33A 5HODA 4A3IJ 1NK3P 2HXOA 2R5ZA 1VNDA 2FJ1A 1H8AC 5IOYA 2OPTA 5J1RA 4Y7NJ 3ZQCA 4HNVA 1I50J 4NDLA 3MVPA 3Q0VA 3WHCA 1JKPC 2N8GA 4J19A 1EF4A 1RKTA 5DS9A 1HDPA 5IPAA 1JTYA 4FTHA 2K9NA 2K9SA 1HCRA 1W0UA 1P7JA 3BR1A 2DMNA 5FKOA 1H88C 2HOAA 1MSEC 2LKXA 3G1OA 3GTKJ 4A3JJ 3HOYJ 5E3OA 3IV5A 3OOUA 1LE8A 4D7NA 2FD5A 2YUSA 2HOSA 2JA5J 2HYJA 4A3DJ 3NAUA 2EZLA 1YRNB 3GTLJ 1ZR2A 2WB1N 5F0FA 3TP0A 1LE8B 5IYBJ 1LFUP 1QVTA 1SFOJ 5BNGA 4ABZA 1S7EA 3BQYA 5EYRA 4MFDA 3ZQHA 3HOWJ 1GV5A 2Y31A 5C4JJ 4QSHA 2Y0SN 2CUFA 3ZOBA 4B4CA 4M3DA 4D5FA 1MBEA 3GTGJ 2R7ZJ 2COBA 1PUFB 3RKQA 4JP0A 1ETQA 1SANA 3FK7A 1BJZA 1IV6A 1JUPA 3B6AA 1ETOA 3BTIA 5JLWA 4C3JJ 1HDDC 3M4OJ 3E7LA 5DTDA 2Y2ZA 2E2JJ 4IHYA 2R5YB 4MLOA 2MG4A 4BKXA 3LSPA 3S14J 1POGA 3LSJA 5IP6A 2JA7J 2Y9ZA 1VI0A 1IRZA 2XGDA 2EZHA 4GFBA 1OCTC 2O7OA 1AKHA 3D1NI 2R93J 4B3AA 2NOGA 3BTJA 1A5JA 2B63J 1ETXA 4I6ZA 2IBDA 3TEDA 1B8IA 1JUSA 1ZQ3P 1H89C 1X2NA 2O8KA 5FJ8J 2DMUA 1K61A 3JRDA 3OSFA 1YRNA 4IHWA 4IEJA 4A3CJ 3HEFA 1MH3A 1LFBA 4XRSA 1JT0A 1CQTA 1U8BA 2KT0A 5FKMA 3RZOJ 2D5VA 2JA6J 3VPRA 1B72A 3QPLA 2R5YA 3BR6A 3JRFA 4MFEA 2E2HJ 2R5ZB 3JRGA 2ECBA 3K2AA 1JGGA 3Q0UA 1BL0A 4JYKA 2AO9A 3FKIJ 1AKHB 1BA5A 5F1JA 1U9NA 3S1RJ 2EH3A 1FTTA 2I10A 2O9LA 1NK2P 2VKEA 2LLKA 1OJLA 4M3BA 3GTPJ 1Z77A 5EGOA 3Q3SA 1GDTA 3IH2A 3HBLA 1R9TJ 1WCMJ 2MW8A 1IGNA 2X48A 3CCYA 4JX4A 1ITYA 1WH5A 1W0TA 1P7IA 2L7FP 3JRHA 2CUEA 4CYCA 1G2HA 3BQZA 3HOZJ 2DA6A 4MIMA 2H1KA 4UUSB 2LP0A 2VUMJ 1BW5A 1JUMA 1AU7A 4RDUA 2EQRA 3DCFA 1XS9A 2LK2A 4MO7A 2XB5A 3ZQGA 2L0KA 4G12A 4BY7J 1ZTRA 5FLVA 1XC5A
chains in the Genus database with same CATH superfamily
3FM3A 1I6HJ 2NRAC 2E36A 2YPRA 3ZQFA 2DA7A 4RGSA 5E17F 1USTA 3I4NJ 3U1DA 4E6KG 1ZG5A 3HZJA 2XUBA 3HSRA 1IXSB 2BHYA 4M3FA 3CCMI 1BI3A 1UG2A 3MN2A 1NTCA 4V2FA 1WSUA 1D3YA 4CCNA 2YX7A 3TGNA 4B44A 1VQPI 2HYGD 4O3MA 2H6BA 3ABLH 4I0AA 3CCRI 4BYYA 2E2IJ 2CW0F 4QPQA 2D1VA 1X19A 2JT1A 2HDDA 1I1GA 3GZ5A 3LSIA 4I01A 5F64A 3A01B 1H0MA 2K9MA 1J0RA 2A68F 3CCJI 2XF6A 2XF5A 4YG2F 3GFIA 1F36A 2CUJA 1MBHA 3LNQA 2PLYA 2ZJ2A 5J1YA 3L2QA 3QYEA 4P5OA 3WG9A 1E0EA 3HGYA 1YW7A 2CMPA 3JRCA 4F93B 1D0ZA 2CSOA 2HWVA 1CF7A 3JR9A 1MBFA 1HW2A 4BGDA 1PP8F 3MKLA 3H9JA 1ZREA 2PMZN 2E5ZA 1A31A 1LVAA 2NVUB 4C3HJ 2BHZA 4UUTA 3I59B 3J7YJ 1WFXA 4GDFA 4CCMA 3CUQB 3RIRA 4BJ6C 3CMAI 1TT5B 1WI3A 1BR4A 2EFWA 3MKWB 3L2UA 2A5YB 1IN8A 1EV7A 2RQPA 2OQGA 1IRFA 1OYIA 1MJAA 4U0WA 3BROA 4CO8A 1E3OC 2M7AA 4JX5A 4PSXA 3S8PA 3WGGA 4M74A 1XDSA 2E1MC 5CVUA 1K7AA 4CGZA 3H3ZA 4MEYF 1B6AA 4EGZA 2ZXHA 4FE7A 2YS9A 2DFFA 4IHSA 3LSGA 2EINH 1F5TA 4BBRJ 1ETWA 3RYRA 4KN4X 3H35A 3RKWA 4A2UA 2VKDA 3ASOH 1R6RA 2OTLI 4GCVA 1E17A 1MJ9A 2GIVA 3FM5A 2R7QA 3TBIA 3CC4I 2A5WA 1I6XA 2VJIA 1MDMB 1LPQA 2W48A 1FIAA 1W7PA 1OQYA 4H0EA 3DU5A 2ZMEC 2R0QC 4BNCA 2XB0X 1BIBA 4A0XA 1HKTA 2KKOA 2X6WA 4M3EA 5FKKA 3V8JA 4ASNA 1TQIA 1V55H 4PUSA 4IQJA 2DAOA 4HSTA 2QF7A 4DYCA 1S7AA 5F0CA 2Z5UA 5CQEA 3GMEA 4EV0A 2QQBA 3BG9A 4KT5C 2YU3A 4M6YA 1YHQI 1J9IA 4LK0F 3OYEA 2VJJA 4XORA 2M3AA 3KP6A 3SFIA 4HNUA 5H6RA 3JREA 1FP2A 2ZJQF 4ZDPA 4X6AJ 1U5TC 2KRFA 2Y48A 3K7AJ 3F8NA 3OY9A 3WHBA 1QPMA 1OCPA 5JI6A 1HA8A 4JOMA 1JKQC 3TOAA 3CD6I 1MNEA 1XMKA 1D5YA 3O8HA 1C0WA 1R71A 2QVOA 5J8CA 2NNYA 4AC0A 1AHDP 1XX5A 3S17J 4HLXA 2CRGA 1W5CC 1UHMA 2KP6A 1FYMA 4EVIA 1WH7A 4LB5A 2Z9OA 2OUMA 2AHQA 4M9SA 2X4HA 3RPQA 4PJJA 1K79A 2RQQA 3IAM2 1WGXA 4PJNA 2V6EA 2W82A 4OINF 4A3KJ 1RESA 3I54A 4PGGA 4RLQA 4B48A 3ZPLA 5FRMA 9ANTA 3K70D 2VKVA 3ECOA 1R00A 1SVOA 3H92A 2Q2EA 3H3VK 5FKLA 2ZJPF 3T1BA 5C44J 3B6CA 2X1DA 2W57A 3M07A 1J75A 3H5RA 2LC2A 2P5KA 1HBXG 1T6SA 2VASA 3DU6A 5D8LB 1IDYA 4XLPF 2L7MP 4MGRA 4LB6B 4II3A 3H5AA 3LWFA 3OYBA 3WTSC 2XC7A 3F8MA 3H9QA 2ELHA 3M8EA 1XN7A 1ETKA 6PAXA 1LB2A 3HTSB 5K5OA 4XRSG 2L9SA 2IS4A 2BY1A 4LIUA 2ZMEB 1X1DA 1R22A 2ZXWH 3WGHA 1MNMC 2IP2A 2WV1A 2DA2A 2E35A 5M3FJ 2JUCA 1T0FA 3E5XA 4KICA 1W1WE 5E3MA 2XKPA 3EYYA 2CQQA 3JW4A 3OS1A 2EWNA 3CF5F 2OU2A 4C30A 3WTVC 4XICA 1OCZH 2FBKA 2XKOA 3HUGB 5LHHA 2EV0A 4B1RA 2KRHA 2DMQA 3WU2C 2VONA 5J1UA 2BY2A 4FE4A 1D8JA 5EG0A 3MKYB 1SD6A 2GBYA 4V2GA 3DV8A 4ESBA 4NQWB 1LDDA 2CQXA 3CESA 5EEHA 5K5QA 4HF1A 2AXTC 3ZN1A 1MZBA 2WAQN 4ZYHA 1X2MA 2OQRA 1JKRC 2XROA 2L9VA 5J47A 1K83J 3F21A 2M30A 3BC8A 4UB6C 3EUKL 4A12A 1KU3A 3OSGA 2NVQJ 4U88A 3OOPA 5FROA 4BXXJ 2DDAA 1BC8C 4A69C 2E60A 2LKPA 2W1OA 2K9LA 4ZDLA 2W00A 3CQZJ 3BG3A 3QOEA 1OR7A 2K40A 3PSIA 3VEPA 3IH4A 2CYYA 2JN6A 3K1PA 1YJ9I 4UVAA 3VYSB 2L02A 4QIWN 3REOA 1TZLA 4LGWA 2VQHA 4NNJA 3A03A 3JAMK 3D5LA 4W1UA 3J80Z 3PQKA 5CJ9A 3UR3C 3ZXSA 1MMNA 4R8HA 3WG7H 4FX4A 3PO3J 3A1YA 5L3GA 1UZCA 1YX5A 1OCCH 3DKXA 1E3PA 5HODA 4A3IJ 2DYSH 3WTYC 2O0YA 1YW8A 2STTA 3JTHA 3O2PE 4XL9A 3BG6A 4ANJA 5IOYA 5J1RA 2EA2A 3K4CA 4BE1A 3ZQCA 3DQVC 2PMZA 3CCQI 4GRIA 4IF4A 1PP7U 3QOPA 3MVPA 4XN0A 3CUQA 3H9GA 4N9IA 3ABMH 3FMSA 2VOOA 1JTYA 3W2AA 1HCRA 4OAYA 4RGXA 1AWCA 1W0UA 3QODA 2UV1A 4P55A 1D0YA 4E7ZA 1H88C 4L0YB 4A0YA 2DQLA 2NOJB 3FXUA 2V1DA 3K69A 3KCCA 5B66C 3GEZA 3HOSA 2HOSA 2JA5J 5K5RA 4A3DJ 1YRNB 1CGPA 4ZC3A 3OIPA 2VBXA 3GTLJ 2WB1N 1STZA 2MA3A 2R7FA 1XGMA 3OYAA 1KU9A 4M9XA 1XTAA 4YFKF 2HNHA 5EYRA 1GV5A 4MQ9F 3KZZA 5C4JJ 2CS3A 1DPRA 2CUFA 5B1AH 1P4AA 4IRHA 2R7ZJ 3FXOA 1ZG1A 1ZELA 2PMHA 5F1RA 4JP0A 1OMIA 1SANA 4OAZA 2PFBA 1IV6A 4ENMA 3BTIA 3QPTA 5JLWA 3VYRB 5DTDA 4BQQA 5ED4A 2E2JJ 4BEHA 3G4SI 2QQAA 3FWEA 2DDBA 2Y0SA 4FQGA 3ZMVA 1SFUA 4MLOA 2DCEA 3S14J 2KRCA 3BCAA 5IP6A 3CLQA 2RVCA 1JI8A 1KA8A 2XGDA 1KQ0A 1A04A 2R93J 5AIPA 4B3AA 5DD4A 2R7XA 1B1BA 1XCBA 2QZ8A 3HL2A 1SVMA 3BTJA 2Z33A 2XV4S 1YJNI 4BS9A 3GUDA 3HSEA 1H9TA 1OR7C 3SZTA 5TJJA 1R5ID 1UG0A 5FFZA 3CCSI 4A3CJ 1OLTA 2CQ7A 1F1ZA 4XRSA 1VQMI 4ENKA 1MKMA 2XAHA 4HOBA 4R1HA 2E7XA 5DDGA 1CF7B 5ILSA 1U8BA 5FLXK 5A2QK 2R7VA 3GO5A 4JK1X 5E1XA 1ULYA 2D5VA 2JA6J 1R1TA 1A35A 3QP5A 1R5HA 4HZFA 4PFPA 4OIRF 2R5ZB 3S32A 4ENNA 1BOAA 4KMFA 4GGGA 2BY3A 1BL0A 3CCLI 3JAMZ 4M72A 4E7SA 2FMYA 2CFOA 3G71I 3FKIJ 2NNNA 3S1RJ 2EH3A 1U6GA 3WE3A 3BCBA 2VKEA 3KYLA 4JQFA 2LLKA 1USSA 5ICGA 4RS8A 1ZLKA 2VQCA 2UUZA 4KNYA 1Z77A 5CQGA 3BY6A 1QQIA 4Q5SF 2QYOA 3IH2A 1YG2A 3CUOA 1ZYRF 3SYTA 3NWSA 4AIHA 2MW8A 1R49A 3CC2I 2ISYA 1FBSA 1JXSA 5GTHC 3BOQA 4N4NB 2L2OA 3OYCA 3SEQA 1W0TA 2CV0A 4CHUA 1OCOH 1B9MA 2BOLA 2CUEA 4CYCA 4HDVA 2HEOA 1G2HA 3BQZA 2WAFA 4EQQA 2RC4A 1QO0D 3CP8A 2WBMA 3C18A 3LA3A 5E8GA 1Z9CA 3HOZJ 4EJOA 1FP1D 1P9QC 1BW5A 1JUMA 3QU3A 2IGOA 1AU7A 2R7DA 1O57A 3DCFA 1LJ9A 2ZNZA 2VC0A 5HLHA 1IN4A 2VJ5A 5KVRA 5JVTA 2XGXA 4PZJA 3RPUD 4DZJA 3WGIA 3MZYA 3HC7A 2EV6A 2HOEA 3J7ZI 4BY1J 1FMVA 4EM2A 3EUHA 3DLAA 3KEQA 2Z1DA 3FMRA 1MMSA 4XLEA 3LAPA 1ZGWA 4BEHB 4NQWA 5LEKA 2LMDA 3BR0A 3C7JA 1T08B 1GVDA 2WTEA 1VFCA 2IS6A 2VQLA 3L9FA 3OWTA 1Y6IA 5LEJA 3FXKA 2WV0A 2XAGA 4OOIA 4C3IJ 4EJWA 1V5EA 1S9HA 1DPUA 2GXAA 2X6OA 2HTSA 1O7FA 1ODDA 3RPUA 2DPDA 4BHPA 4E70A 1YW9A 5EEAA 4GO1A 4A3MJ 3E6BA 4DNCA 2M8EA 3E97A 4I09A 2V6CA 3S3OA 1JKOC 2LSOA 3MEXA 3IH3A 1W7PB 5JFRA 3OYNA 1K78B 3VOEA 4Y4RA 2H8RA 1X1PA 3C2GA 3CJNA 1X1AA 2E19A 3OYMA 4X0GA 3J81K 3H1CA 3HJEA 4B3XA 3D0SA 2DPUA 3HKZN 1ZH5A 5JVGF 1GUUA 5LGUA 4G9YA 3OS2A 5J4YA 4U7BA 2XPUA 2R7RA 1Z91A 2UXNA 4UV9A 1UHWA 1TWCJ 2NS7A 3I3LA 2K86A 1XGOA 4HA8A 4DYQA 2XASA 2LDUA 3GWZA 2Q1ZB 3T8RA 3QPSA 3FISA 5JLXA 2NXNB 5HNHA 5C4XJ 2K4JA 5FD5A 2L54A 1WZ2A 4RM2A 1KONA 4ZJZA 3K4KA 1IJWC 2V4JC 3WU0A 4XRMA 2A6HF 1HXDA 4A3BJ 2DA4A 3A02A 4HX8A 3J80K 2GXBA 5B3SH 3N4MA 3FXJA 3I4PA 1PUFA 3F8FA 3HPGA 2IGNA 2DW4A 2DO7A 3H0GJ 3F72A 2K7LA 4L9VA 4P9UA 5K7ZA 4V19K 3IWZA 3GF2A 1VQ9I 3PUBA 3FBNB 1REPC 4CDGA 4I2OA 2ZBKA 3CO6C 3CCVI 2QA4I 1BM9A 5BMZA 3GFMA 1V5GA 3RCOA 5LHIA 2GQQA 2R3SA 2QENA 5HS7A 4IKFA 4DOZA 2I8DA 2ID3A 1QU3A 1S29A 3M1CA 2DYRH 4BXFA 1GHCA 2FBIA 3CP2A 4L9JA 2FUG2 1MJBA 1EH7A 3QQAA 5E20A 3PO2J 2VPLA 2MH2A 4BDZA 2MLGA 3TW6A 1W7PD 2L3DA 1Z7LA 3F8CA 2KHMA 2F6CA 2GXGA 2QWWA 3HTUA 1LKXA 4L18B 2IW5A 1RR8C 2O8XA 4G6QA 4RGRA 3ONQA 4BH9A 1FPQA 2TDXA 3BG7A 3M7GA 4Q4ZF 1IRGA 2L7ZA 1U0JA 4A93J 4UUSA 1MD0A 2P0WA 5GP9A 4XQFA 1HC8A 2M9HA 5E79C 3U1KA 3P9IA 5HS8A 1P4XA 3RQIA 2CQKA 4TV7A 1ZN2A 1T38A 2R92J 4QWQA 1HSJA 2D1HA 1D1AA 1IRXA 1I27A 2XGCA 1YX3A 3DP7A 1IXCA 2K02A 2DTRA 1TC3C 4U7DA 3VODA 5KCMA 3MAJA 4L9TA 1Z1DA 3E6CC 5F0HA 1GVJA 3KFWX 3KIOA 5E3NA 1WI9A 4PCQA 5J4VA 4PJ0C 1XG1A 2FF4A 2EILH 5HLGA 2FNAA 1R36A 2WB1A 4IPAA 2EFNA 5DEQA 3BP8A 3P9KA 2DLLA 4PFOA 5E18F 2CW7A 3G2BA 1WJ5A 3VSLA 1YE9A 4AIDA 1X3WB 3V7RA 2KIUA 2DOFA 1Z6TA 3FIWA 2JJ7A 1ZKGA 2A69F 2W84A 3KX2A 4BJTA 1D0XA 4DW6A 3BR3A 1R5GA 3HHHA 5CKTA 4BBSJ 2RV8A 1GXQA 1N75A 2PG4A 2ZSHB 5D6EA 2HPMA 3HOXJ 2NVTJ 3FZVA 5A2QZ 3BZ6A 1TLHB 3ZQQA 2RGVA 3VFZA 4FHTA 4L5EA 1HLVA 4NUBA 5DD8A 3LSRA 4OIQF 2IEKA 3BPVA 2L4MA 5IT3A 2IA0A 3LFUA 3F3XA 2NVXJ 4E4HA 2HQAA 5LFAA 1JTXA 2IXSA 3RZDJ 2KDZA 3DXJF 1BR1A 1G4DA 4M3GA 2L9NA 4FT8A 3MQ0A 3BPXA 2V7FA 3IAS2 4D9JA 5KAIC 2OF7A 2CU7A 2WADA 1YS7A 3OYGA 1DU0A 3CDLA 2BBYA 1FOYA 1Y8RB 4S0HB 5IYDJ 2X51A 3V7SA 1PYVA 1MSFC 3CDIA 3DWLE 1SFEA 3S2DJ 3TMOA 2BEOA 2KJCA 1IDZA 4I76A 2B0LA 2L5QA 5GPCA 2X9DA 1G3YA 2M1BA 3KP5A 1JHFA 5H6QA 2DK8A 3QWLA 3FMQA 5JHUA 3KYCB 2DA5A 3R61A 3GTJJ 3AG3H 2JRTA 1J5YA 2MSYA 3HDDA 1U5TA 1N78A 3A2KA 1YQAA 2FQ4A 1RZ4A 3LFKA 1B9NA 2QKMB 3ZQLA 1U8RA 1LQ1A 2C6YA 1X1CA 3FX3A 1N25A 4ETSA 2EZKA 2O03A 3ELKA 4RMNA 4XK4A 4NHJA 2KLOA 1BJAA 3ZN0A 3DKYA 5LRRA 1NK3P 4CSWA 4Q48A 4ZH4F 3CO7C 4BE2A 2LRDA 4O6JA 2UZKA 4HQEA 4IVNA 5FFXA 2OPTA 2HKOA 1ZGAA 3MFKA 5J8FA 4IRGA 1T2KA 1KU7A 4F91B 1Z3XA 3PNVA 5CVVA 2ZSIB 1DQUA 2LY1A 1A6QA 2QBYB 2N8GA 1EF4A 1HW5A 2ZJRF 1FZPB 2RNGA 4HV5A 4BDYA 1R7JA 1P7JA 2AQFA 2HOAA 3PNTA 4KIBA 1YYVA 2XSJC 1PJRA 4A3JJ 3HOYJ 5E3OA 4Y33A 2W4SA 2FD5A 3E5QA 2KZVA 1VQOI 1BC7C 4DGWB 3EUAA 3FDYA 3BLYA 3DLLF 1O3QA 2MC3A 1OKRA 1LFUP 1S3JA 3MMYB 4ZZLA 4UB8C 2E34A 5BNGA 3SZPA 3ZQHA 3H0DA 2Y31A 4UNOA 1SFXA 3ZQ7A 4ZYEA 4Z6YA 1MBEA 3EQLF 4XONA 2EA4A 2DOAA 1PUFB 1ETQA 4BL0B 4BXUA 2F4MB 3FK7A 2CGPA 1TL8A 3I55I 4KITB 2L4AA 3DTEA 4L5IA 4A6DA 4OIOF 4C3JJ 5KHDA 1HDDC 2XAQA 3A0BC 2Y2ZA 3WTTC 3OYFA 1M1EB 1SFKA 1XGNA 1IF1A 2KQRA 2FE3A 3I56I 2MG4A 5BOXA 3LA7A 3PL8A 3AKZA 1ZGJA 1R1VA 2GAUA 4LLGF 4C2UA 2RN7A 2E1MB 2NOGA 2BVMA 2EK5A 1A5JA 4XOPA 2B63J 3BZKA 4IOCF 1ZQ3P 2MLKA 3GXOA 2CUZA 3H3UA 1Y8QB 2KIFA 4MHGA 3EETA 4IHWA 3OR1C 1Y39A 1OISA 1WQ2A 4M6XA 4GXOA 4AYBA 4NC6A 4XM3A 4MTDA 1JT0A 4L0ZB 1UELB 2DXIA 1CQTA 3HIFA 1SD5A 1XMXA 4AWXB 2KT0A 4HYEA 1RC9A 1TW2A 2RNJA 3VPRA 3M8FA 1B72A 2R5YA 3FHNA 2E2HJ 3QPHA 2ECBA 2DFHA 2QM3A 4ZYAA 4RB3C 3K2AA 5D4SA 2MFZA 4XKVA 3SXYA 1Z67A 2FU4A 4D0PA 2K4BA 1BIAA 5DCMB 2AO9A 3VDXA 4F55A 2XDVA 1FTTA 2I10A 2QGUA 4IX7A 3FXQA 1HQCA 3J7AO 3BJ6A 1R4MB 4M3BA 5FLXZ 3GTPJ 2KZGA 1R1UA 4RAGA 3PJRA 4KUMA 5EGOA 2Y69H 3Q3SA 3ABKH 2A07F 4G7ZF 3I0TA 1D1CA 1BOBA 5FD6A 2WAQA 2X48A 3CCYA 1IGNA 3ABUA 1ITYA 5D6FA 5DUIA 2M7BA 3S93A 2KDOA 1HW1A 3V4GA 4F7ZA 2P5LC 2H27A 3AL0C 1O7LA 1L0OC 5HNFA 5DUKA 4MIMA 3ERMA 1G3TA 1KZHA 4WK8F 2MD5A 4RDUA 2ETHA 4HX7A 4YEJA 3ZMUA 5ILUA 1XS9A 4MO7A 4A5NA 4G12A 3TO7A 5FLVA 1XC5A 1WJAA 3F22A 1VQNI 2PJRB 2KFDA 1JJ6C 5DM7F 3CDHA 1UB9A 3LSKA 4A3FJ 4G7OF 3N05A 2VT3A 1QPIA 2HVQA 4BE0A 1SD7A 1O3RA 3MZ8A 3P9CA 2F5EA 4HNTA 1RUOA 3HOVJ 3KE2A 3GCMA 2HVSA 1TTYA 2IAIA 1ENHA 2ME0A 3NRVA 1T98A 4JX6A 1ACIA 2VBZA 3EYIA 2DJNA 1T56A 2RKHA 3S2WA 4BHBA 3OYJA 1ZK8A 5GAGJ 2Q0OA 3HRSA 4A3EJ 2DT7B 3PFIA 1FMWA 1U78A 3S1NJ 1VF9A 2W24A 1B8IB 4RGUA 3NEUA 1IAWA 1MH4A 2WC2A 2XPWA 4CUGA 2CV1A 2LKSA 3BR5A 2PI0A 5IT9Z 5E1ZB 4D7MA 3S3NA 5F27A 3DBLB 3ZP5A 1GV2A 3BDDA 2XPVA 2DMPA 2ZFWA 5EZGA 5GAEJ 3GX4X 4F3QA 3I59A 1FNNA 3PIPF 1RPWA 1IN6A 2FSWA 4N9HA 4E7LA 4AVZA 2OCCH 4Y52J 4BHCA 1B72B 3GW2A 1MMGA 2LVSA 2Z2SB 3AG4H 1SAUA 1MNDA 2LH9A 2JA8J 4U0VA 2ESHA 4MTEA 1UMQA 4LIVA 1WVRA 3K10A 1F43A 4IHVA 1YO5C 2Y75A 2KIMA 1U9OA 2V9VA 3BJAA 4RA2A 5GAHJ 1KYWA 4BJ5C 4JBAA 3KLOA 4KT6A 3SDGA 2V26A 3ISPA 4XN3A 2P6SA 1ON1A 5J3LA 4YRVA 2VC1A 5EGOB 4UXNA 1NG6A 2DOEA 3CJRB 2YR2A 3AL0B 5LLQA 3S1QJ 2OA4A 3U9GA 2FBHA 1OCRH 2IS2A 1E2XA 1U5TB 3AAFA 4OU0A 2HQNA 4B47A 1XMAA 3IUOA 1YFHA 2CW8A 4FCYA 2HOTA 5HDGA 4KYWA 3HOUJ 4I0BA 1YLFA 2GM4A 2H6CA 1B4AA 3DPTA 4FISA 2LTPA 4BQOA 3W6JB 4ITVA 1UCRA 4UVCA 2VN2A 2P6TA 4PDKA 4EJVA 1S7OA 3V8LA 1UHSA 2LFBA 2XHKA 2K9QA 4UV8A 5L3FA 3F0CA 4XMYA 4RLFA 4F52A 2GOMA 2LR8A 1ON2A 4S05A 3OL3A 2JA2A 4LMYA 2M87A 5EJCA 1TWHJ 3S15J 4AD9A 4QTRA 1RRJA 5ILVA 3R0AA 5IYCJ 4KISA 1V4RA 3SDBA 4XIDA 1MIJA 5J6XA 1GT0C 3RDIA 3M3YJ 3OIOA 3SHFA 1Y56A 1VQ4I 2J5OA 3PNYA 3NARA 1G3SA 3JCUC 5L3BA 3SJMA 4M9ZA 1RR7A 1ZRDA 2DFEA 3KPHA 4C9YA 2M8GX 4GYIA 4RBOA 1J2XA 5CVIA 3HRMA 3CJTB 3L2WA 5JR3A 4XLAA 3V42A 3TP3A 2NS8A 3VYUB 2QUFA 3I53A 4ZDOA 2QCOA 1ZLJA 2CFXA 3UKGA 2F5FA 4LD5A 2VIXA 1IC8A 1Z21A 1TBXA 2ELKA 3RYPA 3PM1A 2MGQA 4UVBA 2QLZA 1Z6RA 2IVMA 3IWFA 1SAXA 2DA3A 2B7EA 2VI6A 5IY5H 1G6NA 1FYKA 1IUYA 1EH8A 2MC4A 3K4NA 1YITI 1FBQA 4IL6C 3KZIC 3GTQJ 4HF0A 1Q1VA 1X3UA 2PJPA 1VQKI 1FYLA 3FBIB 3IRQA 3ESWB 2Y30A 5IT9K 2VQGA 2HZDA 1LVKA 3Q0WA 4NB5A 1DDNA 2QQ9A 2X6XA 3IL2A 4Q47A 3TO6A 1P6RA 3CCUI 2O5RA 3QP6A 3F6VA 2HQ5A 5KNLA 3L2CA 3IKVA 5IP9J 5LRSA 3BZCA 2LBFB 2OV7A 2KIQA 4IRIA 2L9RA 1YI2I 2EB7A 1GXPA 3RSNA 1FOWA 3W2VA 1YIJI 2HDCA 1FEXA 2CJJA 3K4JA 3JRAA 2OZ6A 2A61A 4PK4A 3OYIA 4HBLA 4LG3A 3K9TA 2HXIA 5DV5A 4BUPA 1O4XA 1MMAA 2OTJI 4WXDA 1KQ8A 2P7VB 1YS6A 3C3WA 5FKNA 4KA4A 1IXRC 2VBYA 5EG0B 4RB1A 2BZTA 3L2RA 4RB2C 3X2QH 4EM0B 3MZHA 3HKZA 3L1PA 2MD0A 4EM1A 2V9PA 2ZO4A 1JT6A 2E1NA 1FOKA 2IGMA 3K4BA 2WY7Q 3TOBA 2BXZA 5F04A 3I5UA 5M5YJ 5FLMJ 2RAEA 5ICFA 3IKTA 3HGGA 2JVGA 2FNPA 2PJRA 1RETA 2B9SA 3EDPA 1VQ5I 2LBFA 2LF8A 3NWTA 4MQVA 5B1BH 1AA7A 2OD5A 3H36A 4A6EA 5H2FC 4Y17A 3OL4A 3L7WA 4X1EA 2P81A 4XLCA 5K7HA 4NBQA 3GZ6A 1Z3YA 3I64A 2EJRA 1QVUA 1X1BA 4E7JA 4G6TB 2STWA 2DN0A 1UJ8A 4Z2YA 4XLNF 4YIIA 2BY0A 3O3KA 3JRIA 4MNUA 4XLFA 4CYDA 3G6EI 4RAZA 2V1NA 1WWXA 2XSDC 2HPIA 1S72I 1K78A 1XB4A 1ETYA 1OYYA 5HDNA 1PVEA 2E7WA 5DM6F 4AUXA 2EZIA 2EFOA 2VPRA 2M0MA 4J01A 1HF0A 1I3AA 3WU1B 1VQ7I 1N77A 1LEBA 2YU9J 2M45A 5KK1A 1WRJA 1O3TA 1X4OA 4IHTA 2IS1A 1EH6A 3CMEI 4CA0A 2HXOA 2R5ZA 1W5SA 2FJ1A 3MKZA 2X6YA 1B59A 2D45A 4XR6A 4WCGA 4LFUA 3DF8A 4Y7NJ 2XAJA 4H4KC 1K4TA 4FETA 1I39A 1X3ZB 3EUHC 1IN5A 1W5TA 3M1EA 4NDLA 4HG2A 4EGYA 2R4GA 4R79A 3WHCA 2R7SA 4BAYA 4J19A 1XCVA 3IP4B 1FOXA 1RKTA 2EV5A 2OAZA 2BW3A 5IPAA 2K9NA 2PQ8A 3RTRA 2R7UA 1DP7P 5F6FA 2DMNA 2IGKA 3LQRA 5FKOA 2AXLA 2VE8A 5BPIA 1KQ9A 4FASD 3IV5A 4EJTA 1ONVA 3RI4A 4ESFA 2FA5A 2EZLA 5LGNA 3L09A 1ZR2A 5F0FA 4LG0A 2ZNYA 2ZC2A 5IYBJ 1A36A 1SFOJ 4ABZA 5HVQC 3BQYA 2VBWA 3ZCOA 3HOWJ 1S8NA 3LL7A 3TKYA 2X0LA 2OCEA 3ZOBA 2DT6A 4HEA2 5E1WA 4D5FA 3RJPA 4CH7A 3WTXC 2VB6A 3RKQA 2EPFA 5D5XB 1JUPA 2F5VA 3B6AA 4EATA 1ETOA 1WJEA 1BN5A 2W85A 3CTAA 3PIOF 5GTIC 5HS9A 3M4OJ 3IRRA 2GOXB 3E7LA 3QU6A 3SZGA 3E6MA 2F5CA 4IHYA 2QEXI 3E5UA 2Y0MA 4O5VA 1F9NA 1P92A 4KIGA 5HLIA 5LBQA 3WODF 4UUVA 1QNTA 1V3FA 2Z3YA 2QKLB 2NAZA 4IQ4A 4BKXA 3LSPA 2KJBA 1SD4A 3K4LA 3NQOA 3LSJA 4E7KA 2JA7J 2Y9ZA 1VI0A 3ZMTA 1VQ8I 2YSRA 1AKHA 3D1NI 4I99C 2H94A 3ROUA 3TDUC 4OMZA 2OBPA 2VE9A 2NYXA 1LDKB 1ETXA 4C2TA 2IBDA 1B8IA 2JSPA 2M4KA 1ZAOA 2COMA 3ZRGA 2EIKH 2O8KA 1KU2A 2P8TA 4E7IA 4ZTFA 1K61A 2DMUA 4NC8A 4YFNF 4ZYDA 2PMUA 3ZMSA 1P4WA 2FQ3A 1MH3A 2X85A 3LQQA 3U2RA 1K4SA 2P5VA 1MDMA 2X1CA 4UHTA 1QBJA 5FKMA 4XKWA 3RZOJ 4WXCA 3HYIA 3QPLA 3BR6A 2HDWA 3JRFA 4MFEA 1I1SA 3HXLA 4DQ2A 1TNTA 2H1LA 2XAFA 1JGGA 1T0FC 3DEUA 1R23A 1QA6A 3E6DA 5HOOA 2LY2A 3K1MA 1T8IA 1AKHB 1BA5A 4HAMA 1ZARA 2H09A 2KPMA 4OWRB 1NK2P 4XRFA 2HKXA 3I58A 3KEYA 4KMUX 5DCFA 2CQNA 3C2HA 4I02A 1D8KA 2BW3B 1D1BA 3KP4A 3HRTA 2AS5F 2PEXA 3SFZA 2CH0A 4XSZF 2M4GA 1WCMJ 3A0HC 4P9FA 1DGRM 4JX4A 3E3VA 1XSVA 1XPXA 5L3CA 2E1CA 3R60A 3W3CA 3OIQA 2L7FP 4LLLA 3JRHA 2G7UA 2H8WA 2BE5F 5LHGA 2V1UA 1FC3A 1AOYA 2CG4A 2DQRA 2ZXIA 3LSMA 4AIKA 1QZYA 1R58A 1ZG3A 5ERIA 3N97A 2V9KA 5GADJ 4LK1F 2VUMJ 1BR2A 3DFGA 2VODA 2BXYA 2QSFX 4Y13A 3K2ZA 1UFMA 1BI2A 3O6BB 5AIQA 2L0KA 2HQRA 3KYDB 1ZTRA 1G3WA 1VQ6I 3DBHB 2IRFG 3GBGA 1A6IA 3OMYA 2XRLA 4NC7A 1MBGA 2IA1A 4IHXA 2ID6A 1BI0A 3GZNB 3CUQC 4HF2A 5IOZA 1NHAA 1BI1A 3CJQB 1Z0XA 2JZYA 2JMWA 3AG1H 1I3QJ 3MCZA 5BS6A 4KDPA 3B73A 1JHHA 1TWGJ 2FX0A 3AG2H 5EEGA 5TGTA 5M5XJ 3F8BA 3S3MA 4A3LJ 3R4KA 3E1SA 3T0YA 1SMTA 4CYCB 3TQNA 3PUFA 3WTWC 1WKMA 4XNFA 4YFXF 3H5NA 3L2VA 4IOAF 3ULQB 2JWTA 2JK3A 2V79A 4IJAA 2MBFA 2QSHX 2MYSA 3KP2A 3ML6A 1ETVA 2DODA 3GTMJ 2M5WA 2IPQX 3G3ZA 2ADUA 3OS0A 4BQNA 1FSHA 4CZCA 1TNSA 4I98B 4MEXF 1QGPA 3HRUA 5L3DA 4CCLA 1RKWA 3SQNA 1I5ZA 1WJFA 1OYWA 1HOMA 2MH9A 1MGTA 2DTZA 1SVLA 4PJLA 4II2A 4KFCA 3DEWA 4FX0A 2W25A 5CPRB 3CLOA 1Y0UA 3IHUA 1Y1WJ 3WTZA 1J09A 3S16J 3P5JA 4RAYA 5TRDA 2HFHA 2TRTA 1XD7A 4XOTA 2DI3A 4XBFA 1ORKA 2ME6A 4XSXF 1YIOA 2I5UA 2NS0A 1XSXA 1FT9A 2XF7A 2ZXJA 3F6OA 3U21A 4DZPA 4IO9F 4UY8I 4CICA 4PGHA 1J7KA 2DA1A 3ZMZA 1RUNA 4BACA 3KP3A 1HSTA 1VZ0A 2Z16A 3PQJA 2XGEA 3CC7I 3OR2C 1X58A 1YOVB 3BR2A 4WXHA 5K1YA 2K27A 3K1NA 2F4OB 1MBKA 3LSHA 3EPZA 3G1LA 3S1MJ 3A4CA 4CCOA 4XKBA 1VTNC 4YELA 1XGSA 3F9KA 3E0JB 3GYHX 2M2EA 1XDUA 3V7CA 2O6GE 3PFYA 2FXAA 4LLNA 1LUJB 1FLIA 2JPBA 2OJED 1NG7A 5ICEA 2J5PA 1WJBA 2E71A 3CMYA 2R7OA 5DCMA 3FHZA 4HDUA 1LDJA 4HW0A 3CF2A 5E3LA 3VSKA 4AYBN 2G0EA 1G59A 2ZFUA 2WY8Q 3I71A 2OZUA 2DMTA 2M34A 1LFPA 2Y9YA 1Y1VJ 4D5CA 2LNBA 2LY9A 5M3MJ 2HGCA 4DIQA 3FXRA 4DBQA 1QZEA 4P1WA 3QYBA 1KYZA 3FXMA 1IO2A 4A3GJ 3GFLA 4M73A 1QZZA 1WHUA 1SC7A 1GLNA 4DJAA 4BU2A 5F08A 4AU7A 3A01A 2K3PA 3ERED 4XKCA 2GLOA 2F4IA 3HPHA 1HKQA 3ZQIA 3MWMA 4ZYGA 2NVYJ 4RB0A 2W7NA 5LGTA 3DKWA 1TWFJ 1QRYA 3B02A 1ZHFA 3ZMDA 1J59A 2HU9A 1P2FA 1IUFA 2A6TA 2BGCA 2KMUA 5HDKA 1E3HA 3TW7A 4M6VA 2JRMA 3BG5A 3FK6A 1TWAJ 3ZGKA 5LD2C 2G7HA 2FEZA 3CZ6A 2FOKA 2R7WA 3S2HJ 3DTIA 2X1EA 1IW7F 1Z05A 2PBIA 1KGSA 1LNWA 1OFCX 1WJDA 2JUGA 4OIPF 1MBJA 4HLYA 1JJ8C 2ICWG 2GZWA 2XRNA 2DBBA 3LMMA 3KLNA 4DBRA 1FSEA 1EKEA 2HZTA 2DK5A 4HSRA 2E1OA 4HQMA 5GPAA 1G8XA 4AIJA 1SEUA 2EBIA 3G1MA 1FBUA 1XSDA 2DT5A 2VL8A 3OYKA 2IT0A 2YX4A 2FOWA 1R4NB 1FIPA 1HKSA 4EEFG 1DGWY 5FGMA 4WX9A 3QRFF 3K70C 4GYGA 1U3EM 2VXDA 4LITA 2XIGA 4YIFA 1RNLA 5B5EC 3BT9A 1APLC 3I9V2 4OMYA 2M0CA 5D5UB 2FRHA 2VT2A 3HOTA 3CMMA 1EJ9A 1TW3A 1SMYF 3KZYA 3IC7A 3W6VA 4D1QA 2VKHA 5M5WJ 3AFHA 2ZB9A 4C2MJ 2LG4A 3J7AY 2ELJA 3ASNH 4CCJA 5CVJA 2R7TA 3LOCA 3O8GA 3LSTA 1BW6A 3RKYA 4G94A 2HVRA 1TT0A 1IG7A 1ZRCA 1IN7A 5CLSA 1PDNC 4WWCA 5D4RA 5EDNA 4F92B 3K4MA 2QSGX 2FMLA 4LOCA 2GWRA 4B09A 4S04A 4BQAA 5EF6A 2UXXA 4LJZF 5IP7J 1D5VA 5C3EJ 1BBYA 1V54H 3HB9A 3P7NA 4E7HA 2BVLA 3OYLA 3D5SC 2GIZA 1WPKA 3MD2A 3GTOJ 3BTCA 2KISA 5EZHA 1ZR4A 2O61A 2DU9A 2VOPA 3HG9A 2D2WA 1Y0NA 3C2BA 4U87A 2VJ4A 4U0YA 5D5WB 3JRBA 2LD5A 3FXLA 1DU6A 1S5LC 1FTZA 3BTLA 1K6OA 2TCTA 4DYRA 4W97A 3VB2A 5CYVA 5CVRA 1W36D 1FJLA 3UNGC 1V5FA 2ECCA 4HV6A 3HM5A 3ZR8X 2A05A 5K7FA 3WE2A 1IZ1A 4PJMA 4EJUA 2RREA 3PSFA 3J81Z 1L3LA 4ZTJA 3I4MJ 2HI3A 1QHGA 2GA1A 3OYHA 2VLAA 4RM3A 1T33A 3TL4X 2ACJA 5KAFC 1Q1HA 1VNDA 2A3SA 3RKXA 1H8AC 2Q2EB 3QAHA 2HTJA 4A5MA 2HS5A 4HNVA 1I50J 3VYTB 2WA0A 3T8TA 2PX9A 1NH3A 3Q0VA 5E8IA 1JKPC 4B8XA 1T95A 4Y15A 3Q9VA 5DS9A 4CCKA 1HDPA 2ZCWA 4FTHA 2K9SA 1EA3A 4ESJA 4KJZA 4L5JA 1IV8A 1DP3A 3BR1A 1TQMA 1MSEC 4ENJA 1FX7A 1QHHD 2MABA 3M9AA 3DEEA 3G1OA 2LKXA 2F2EA 3D5RC 3GTKJ 4ON0A 5AONA 4B43A 5FB2A 2CV2A 3OOUA 1LE8A 4D7NA 2BYVE 2YUSA 2HYJA 2P4WA 1YTYA 3HHGA 1WJCA 3W2WA 3NAUA 4HRIA 3KETA 1ZRFA 4HX4A 3TP0A 1LE8B 4KN7X 2XVCA 1QVTA 3QYFA 1T39A 1S7EA 3K6GA 2O3FA 4MFDA 4QSHA 2Y0SN 2GA2A 1U2WA 1TQPA 2EIMH 4N4OB 4M3DA 4B4CA 5FRNA 1RIOH 5BQTA 3V8KA 4G7HF 2JQ7A 2COBA 3DTKA 2G9WA 2JVHA 4IZZA 3JTGA 4G8XA 4XLHA 3GFJA 4EMSA 2LOOA 3LAJA 3DPUA 1BJZA 5DYMA 1VQLI 4A0ZA 3KEOA 3HSFA 1S6LA 1FY7A 3FF5A 2HYFA 1W4MA 5TISC 2JTVA 2DFIA 1OPCA 2AQEA 2EFPA 3F23A 2E5NA 2R5YB 1TP4A 1LEAA 2EFQA 1ERDA 5H20A 2EIJH 1POGA 1MW7A 2Q8KA 4K2EA 1IRZA 2EZHA 5J40A 1OCTC 4GFBA 2O7OA 2VXZA 4P96A 3ECHA 1JE8A 4QPOA 2ZMEA 2IJLA 2QQ8A 2KL4A 4PSWA 2ISZA 2RDPA 3R6SA 3TDZC 3GLLA 4J00A 2XAUA 1O3SA 4I6ZA 3TEDA 1W36C 1JUSA 2CWEA 1H89C 2Z99A 3BJOA 2JSCA 2OC6A 3L00A 1X2NA 4Y3OA 3TO9A 4AVPA 3W6KB 2CO5A 5FJ8J 3JRDA 3OSFA 1YRNA 3VWBA 1MMDA 4IEJA 3HEFA 4LG0B 1LFBA 2LF7A 4G6DA 3FKJA 3RQ4A 1YJWI 3BWGA 2K3FA 3LA2A 4I7HA 3COAC 2L7KA 1FWZA 4M71A 2IA2A 3JSOA 1RI7A 1PUEE 3JRGA 4N0BA 3CCEI 5D8KB 3HUGA 3Q0UA 3ABTA 2BV6A 2ZKZA 4JYKA 1UAAA 1DUXC 3OYDA 4ZZDA 5F1JA 2JPCA 1U9NA 3GVAA 4KIFA 4CXFA 5FO5A 5D5VB 2QBYA 2O9LA 2WWYA 1K6YA 4L9NA 4AM3A 4CZZA 2HR3A 2K85A 1OJLA 3G73A 4WF2A 3SEZA 2F5DA 1GDTA 2LREA 2L01A 3GLXA 5L3EA 3OV8A 2F48A 3HBLA 4IXAA 1R9TJ 4RAFA 2P7CB 3KP7A 5BPDA 4YIRX 3M8JA 5ICCA 1JGSA 4HPQA 4QLCU 1F4KA 1H9GA 1WH5A 2UWMA 1P7IA 1X4PA 2LYCA 3Q5FA 3C1DA 2ESNA 2A6EF 3T5XA 3DPLC 2DA6A 2H1KA 4UUSB 3K0LA 3DBRB 2LP0A 2WAEA 3Q9SA 2PN6A 1Z7UA 3R0JA 2DJIA 2EQRA 5HLTA 2LK2A 2V1XA 5JHFA 2XB5A 3ZQGA 3JSPA 2K5CA 3WTUC 4BY7J 3GTGJ
chains in the Genus database with same CATH topology
1I6HJ 4DZJA 1JJ6C 3ZQFA 4A3FJ 3GBGA 2DA7A 1A6IA 2XRLA 1QPIA 1MBGA 4BY1J 2ID6A 4IHXA 3I4NJ 5IOZA 1Z0XA 1ZGWA 2JMWA 3HOVJ 4M3FA 1UG2A 1I3QJ 3MN2A 1NTCA 4V2FA 2IAIA 1ENHA 2ME0A 3BR0A 4JX6A 1GVDA 1TWGJ 2FX0A 1VFCA 5M5XJ 4A3LJ 2E2IJ 2DJNA 1T56A 4CYCB 1ZK8A 2HDDA 4A3EJ 4C3IJ 3A01B 1U78A 2X6OA 2JWTA 1VF9A 2JK3A 3S1NJ 1B8IB 1MH4A 2XPWA 3BR5A 1F36A 3LNQA 1MBHA 4A3MJ 5EEAA 1ETVA 5J1YA 4D7MA 3GTMJ 5F27A 3HGYA 3JRCA 1JKOC 1GV2A 3IH3A 2XPVA 2DMPA 2H8RA 5EZGA 3JR9A 1MBFA 1RPWA 3MKLA 2E19A 2PMZN 4Y52J 1B72B 4C3HJ 1RKWA 4UUTA 2LVSA 3HKZN 1WI3A 1GUUA 2JA8J 1HOMA 2DTZA 1UMQA 2XPUA 1F43A 4IHVA 1TWCJ 2NS7A 3DEWA 1U9OA 1Y1WJ 4DYQA 3SDGA 3S16J 1E3OC 4JX5A 2TRTA 3QPSA 1ORKA 2ME6A 3FISA 5J3LA 5JLXA 5EGOB 3S1QJ 5C4XJ 4DZPA 4FE7A 2YS9A 3LSGA 2DA1A 4BBRJ 1IJWC 1ETWA 4XRMA 2XGEA 1X58A 3BR2A 4FCYA 4A3BJ 2HOTA 2DA4A 3A02A 3HOUJ 1MBKA 3G1LA 3S1MJ 2GM4A 1PUFA 4FISA 2LTPA 2W48A 1FIAA 3H0GJ 2R0QC 2M2EA 5K7ZA 1UHSA 2LFBA 2XB0X 4M3EA 5FKKA 2K9QA 3F0CA 3CMYA 2LR8A 5E3LA 2QF7A 4AYBN 2G0EA 4DYCA 5F0CA 3BG9A 1TWHJ 3S15J 2DMTA 2M34A 4QTRA 2Y9YA 1Y1VJ 4D5CA 2ID3A 5IYCJ 5M3MJ 2LY9A 3SFIA 4XIDA 1GT0C 3JREA 4X6AJ 3M3YJ 4A3GJ 3QQAA 3K7AJ 3OIOA 3PO2J 3WHBA 1OCPA 3NARA 1JKQC 5F08A 3TW6A 3A01A 3SJMA 1D5YA 2GLOA 3O8HA 1RR7A 3ZQIA 2M8GX 2NVYJ 4AC0A 4RBOA 1AHDP 3S17J 1TWFJ 1QRYA 3TP3A 2NS8A 2CRGA 2L7ZA 1IUFA 4A93J 4UUSA 2QCOA 1WH7A 5GP9A 3UKGA 2M9HA 4M6VA 3TW7A 3BG5A 2AHQA 1IC8A 3FK6A 1TWAJ 2ELKA 3RQIA 3PM1A 2R92J 2MGQA 1WGXA 2DA3A 2VI6A 2XGCA 4A3KJ 1RESA 9ANTA 3H3VK 2VKVA 1OFCX 3GTQJ 1MBJA 1Q1VA 5FKLA 1JJ8C 5C44J 1TC3C 3B6CA 2Y30A 5F0HA 3Q0WA 2E1OA 5GPAA 2EBIA 3G1MA 5E3NA 1IDYA 1XG1A 2L7MP 3S2HJ 2HQ5A 1ETKA 1FIPA 4EEFG 5IP9J 2L9RA 4XRSG 3FIWA 2JJ7A 1ZKGA 1FEXA 4DW6A 2CJJA 3BR3A 3BT9A 1APLC 2M0CA 3JRAA 1MNMC 2NVTJ 4BBSJ 3HOXJ 2WV1A 2DA2A 5M3FJ 2HXIA 3W6VA 5E3MA 1O4XA 5M5WJ 2ZB9A 4L5EA 2CQQA 4C2MJ 1HLVA 5FKNA 3LSRA 2IEKA 4XICA 2NVXJ 5EG0B 3LOCA 3O8GA 1JTXA 3RZDJ 1BW6A 2KDZA 4B1RA 3L1PA 2DMQA 4M3GA 1IG7A 5J1UA 4FE4A 1JT6A 5EG0A 5EDNA 2OF7A 2GBYA 4V2GA 2CU7A 4LOCA 5M5YJ 5F04A 5FLMJ 5EF6A 2RAEA 1DU0A 3CDLA 3HGGA 5IP7J 2CQXA 4S0HB 5C3EJ 5IYDJ 1RETA 2WAQN 1X2MA 1JKRC 1MSFC 3HB9A 1K83J 1WPKA 3S2DJ 5K7HA 4X1EA 3OSGA 2NVQJ 2P81A 3BTCA 4I76A 5EZHA 1ZR4A 3GTOJ 5GPCA 4BXXJ 1IDZA 2X9DA 4A69C 3C2BA 1QVUA 3JRBA 2DA5A 2LD5A 2DN0A 3BG3A 3CQZJ 1DU6A 1FTZA 3BTLA 2TCTA 2K40A 3GTJJ 3JRIA 3HDDA 2MSYA 3IH4A 2JN6A 4W97A 4DYRA 4QIWN 1FJLA 2XSDC 2FQ4A 2ECCA 3HM5A 1ETYA 5K7FA 3A03A 4W1UA 3ZQLA 4AUXA 2EZIA 2VPRA 3I4MJ 2HI3A 1HF0A 2EZKA 3PO3J 2YU9J 4XK4A 1T33A 5HODA 4A3IJ 1NK3P 2HXOA 2R5ZA 1VNDA 2FJ1A 1H8AC 5IOYA 2OPTA 5J1RA 4Y7NJ 3ZQCA 4HNVA 1I50J 4NDLA 3MVPA 3Q0VA 3WHCA 1JKPC 2N8GA 4J19A 1EF4A 1RKTA 5DS9A 1HDPA 5IPAA 1JTYA 4FTHA 2K9NA 2K9SA 1HCRA 1W0UA 1P7JA 3BR1A 2DMNA 5FKOA 1H88C 2HOAA 1MSEC 2LKXA 3G1OA 3GTKJ 4A3JJ 3HOYJ 5E3OA 3IV5A 3OOUA 1LE8A 4D7NA 2FD5A 2YUSA 2HOSA 2JA5J 2HYJA 4A3DJ 3NAUA 2EZLA 1YRNB 3GTLJ 1ZR2A 2WB1N 5F0FA 3TP0A 1LE8B 5IYBJ 1LFUP 1QVTA 1SFOJ 5BNGA 4ABZA 1S7EA 3BQYA 5EYRA 4MFDA 3ZQHA 3HOWJ 1GV5A 2Y31A 5C4JJ 4QSHA 2Y0SN 2CUFA 3ZOBA 4B4CA 4M3DA 4D5FA 1MBEA 3GTGJ 2R7ZJ 2COBA 1PUFB 3RKQA 4JP0A 1ETQA 1SANA 3FK7A 1BJZA 1IV6A 1JUPA 3B6AA 1ETOA 3BTIA 5JLWA 4C3JJ 1HDDC 3M4OJ 3E7LA 5DTDA 2Y2ZA 2E2JJ 4IHYA 2R5YB 4MLOA 2MG4A 4BKXA 3LSPA 3S14J 1POGA 3LSJA 5IP6A 2JA7J 2Y9ZA 1VI0A 1IRZA 2XGDA 2EZHA 4GFBA 1OCTC 2O7OA 1AKHA 3D1NI 2R93J 4B3AA 2NOGA 3BTJA 1A5JA 2B63J 1ETXA 4I6ZA 2IBDA 3TEDA 1B8IA 1JUSA 1ZQ3P 1H89C 1X2NA 2O8KA 5FJ8J 2DMUA 1K61A 3JRDA 3OSFA 1YRNA 4IHWA 4IEJA 4A3CJ 3HEFA 1MH3A 1LFBA 4XRSA 1JT0A 1CQTA 1U8BA 2KT0A 5FKMA 3RZOJ 2D5VA 2JA6J 3VPRA 1B72A 3QPLA 2R5YA 3BR6A 3JRFA 4MFEA 2E2HJ 2R5ZB 3JRGA 2ECBA 3K2AA 1JGGA 3Q0UA 1BL0A 4JYKA 2AO9A 3FKIJ 1AKHB 1BA5A 5F1JA 1U9NA 3S1RJ 2EH3A 1FTTA 2I10A 2O9LA 1NK2P 2VKEA 2LLKA 1OJLA 4M3BA 3GTPJ 1Z77A 5EGOA 3Q3SA 1GDTA 3IH2A 3HBLA 1R9TJ 1WCMJ 2MW8A 1IGNA 2X48A 3CCYA 4JX4A 1ITYA 1WH5A 1W0TA 1P7IA 2L7FP 3JRHA 2CUEA 4CYCA 1G2HA 3BQZA 3HOZJ 2DA6A 4MIMA 2H1KA 4UUSB 2LP0A 2VUMJ 1BW5A 1JUMA 1AU7A 4RDUA 2EQRA 3DCFA 1XS9A 2LK2A 4MO7A 2XB5A 3ZQGA 2L0KA 4G12A 4BY7J 1ZTRA 5FLVA 1XC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6H J;  4DZJ A;  1JJ6 C;  3ZQF A;  4A3F J;  3GBG A;  2DA7 A;  1A6I A;  2XRL A;  1QPI A;  1MBG A;  4BY1 J;  2ID6 A;  4IHX A;  3I4N J;  5IOZ A;  1Z0X A;  1ZGW A;  2JMW A;  3HOV J;  4M3F A;  1UG2 A;  1I3Q J;  3MN2 A;  1NTC A;  4V2F A;  2IAI A;  1ENH A;  2ME0 A;  3BR0 A;  4JX6 A;  1GVD A;  1TWG J;  2FX0 A;  1VFC A;  5M5X J;  4A3L J;  2E2I J;  2DJN A;  1T56 A;  4CYC B;  1ZK8 A;  2HDD A;  4A3E J;  4C3I J;  3A01 B;  1U78 A;  2X6O A;  2JWT A;  1VF9 A;  2JK3 A;  3S1N J;  1B8I B;  1MH4 A;  2XPW A;  3BR5 A;  1F36 A;  3LNQ A;  1MBH A;  4A3M J;  5EEA A;  1ETV A;  5J1Y A;  4D7M A;  3GTM J;  5F27 A;  3HGY A;  3JRC A;  1JKO C;  1GV2 A;  3IH3 A;  2XPV A;  2DMP A;  2H8R A;  5EZG A;  3JR9 A;  1MBF A;  1RPW A;  3MKL A;  2E19 A;  2PMZ N;  4Y52 J;  1B72 B;  4C3H J;  1RKW A;  4UUT A;  2LVS A;  3HKZ N;  1WI3 A;  1GUU A;  2JA8 J;  1HOM A;  2DTZ A;  1UMQ A;  2XPU A;  1F43 A;  4IHV A;  1TWC J;  2NS7 A;  3DEW A;  1U9O A;  1Y1W J;  4DYQ A;  3SDG A;  3S16 J;  1E3O C;  4JX5 A;  2TRT A;  3QPS A;  1ORK A;  2ME6 A;  3FIS A;  5J3L A;  5JLX A;  5EGO B;  3S1Q J;  5C4X J;  4DZP A;  4FE7 A;  2YS9 A;  3LSG A;  2DA1 A;  4BBR J;  1IJW C;  1ETW A;  4XRM A;  2XGE A;  1X58 A;  3BR2 A;  4FCY A;  4A3B J;  2HOT A;  2DA4 A;  3A02 A;  3HOU J;  1MBK A;  3G1L A;  3S1M J;  2GM4 A;  1PUF A;  4FIS A;  2LTP A;  2W48 A;  1FIA A;  3H0G J;  2R0Q C;  2M2E A;  5K7Z A;  1UHS A;  2LFB A;  2XB0 X;  4M3E A;  5FKK A;  2K9Q A;  3F0C A;  3CMY A;  2LR8 A;  5E3L A;  2QF7 A;  4AYB N;  2G0E A;  4DYC A;  5F0C A;  3BG9 A;  1TWH J;  3S15 J;  2DMT A;  2M34 A;  4QTR A;  2Y9Y A;  1Y1V J;  4D5C A;  2ID3 A;  5IYC J;  5M3M J;  2LY9 A;  3SFI A;  4XID A;  1GT0 C;  3JRE A;  4X6A J;  3M3Y J;  4A3G J;  3QQA A;  3K7A J;  3OIO A;  3PO2 J;  3WHB A;  1OCP A;  3NAR A;  1JKQ C;  5F08 A;  3TW6 A;  3A01 A;  3SJM A;  1D5Y A;  2GLO A;  3O8H A;  1RR7 A;  3ZQI A;  2M8G X;  2NVY J;  4AC0 A;  4RBO A;  1AHD P;  3S17 J;  1TWF J;  1QRY A;  3TP3 A;  2NS8 A;  2CRG A;  2L7Z A;  1IUF A;  4A93 J;  4UUS A;  2QCO A;  1WH7 A;  5GP9 A;  3UKG A;  2M9H A;  4M6V A;  3TW7 A;  3BG5 A;  2AHQ A;  1IC8 A;  3FK6 A;  1TWA J;  2ELK A;  3RQI A;  3PM1 A;  2R92 J;  2MGQ A;  1WGX A;  2DA3 A;  2VI6 A;  2XGC A;  4A3K J;  1RES A;  9ANT A;  3H3V K;  2VKV A;  1OFC X;  3GTQ J;  1MBJ A;  1Q1V A;  5FKL A;  1JJ8 C;  5C44 J;  1TC3 C;  3B6C A;  2Y30 A;  5F0H A;  3Q0W A;  2E1O A;  5GPA A;  2EBI A;  3G1M A;  5E3N A;  1IDY A;  1XG1 A;  2L7M P;  3S2H J;  2HQ5 A;  1ETK A;  1FIP A;  4EEF G;  5IP9 J;  2L9R A;  4XRS G;  3FIW A;  2JJ7 A;  1ZKG A;  1FEX A;  4DW6 A;  2CJJ A;  3BR3 A;  3BT9 A;  1APL C;  2M0C A;  3JRA A;  1MNM C;  2NVT J;  4BBS J;  3HOX J;  2WV1 A;  2DA2 A;  5M3F J;  2HXI A;  3W6V A;  5E3M A;  1O4X A;  5M5W J;  2ZB9 A;  4L5E A;  2CQQ A;  4C2M J;  1HLV A;  5FKN A;  3LSR A;  2IEK A;  4XIC A;  2NVX J;  5EG0 B;  3LOC A;  3O8G A;  1JTX A;  3RZD J;  1BW6 A;  2KDZ A;  4B1R A;  3L1P A;  2DMQ A;  4M3G A;  1IG7 A;  5J1U A;  4FE4 A;  1JT6 A;  5EG0 A;  5EDN A;  2OF7 A;  2GBY A;  4V2G A;  2CU7 A;  4LOC A;  5M5Y J;  5F04 A;  5FLM J;  5EF6 A;  2RAE A;  1DU0 A;  3CDL A;  3HGG A;  5IP7 J;  2CQX A;  4S0H B;  5C3E J;  5IYD J;  1RET A;  2WAQ N;  1X2M A;  1JKR C;  1MSF C;  3HB9 A;  1K83 J;  1WPK A;  3S2D J;  5K7H A;  4X1E A;  3OSG A;  2NVQ J;  2P81 A;  3BTC A;  4I76 A;  5EZH A;  1ZR4 A;  3GTO J;  5GPC A;  4BXX J;  1IDZ A;  2X9D A;  4A69 C;  3C2B A;  1QVU A;  3JRB A;  2DA5 A;  2LD5 A;  2DN0 A;  3BG3 A;  3CQZ J;  1DU6 A;  1FTZ A;  3BTL A;  2TCT A;  2K40 A;  3GTJ J;  3JRI A;  3HDD A;  2MSY A;  3IH4 A;  2JN6 A;  4W97 A;  4DYR A;  4QIW N;  1FJL A;  2XSD C;  2FQ4 A;  2ECC A;  3HM5 A;  1ETY A;  5K7F A;  3A03 A;  4W1U A;  3ZQL A;  4AUX A;  2EZI A;  2VPR A;  3I4M J;  2HI3 A;  1HF0 A;  2EZK A;  3PO3 J;  2YU9 J;  4XK4 A;  1T33 A;  5HOD A;  4A3I J;  1NK3 P;  2HXO A;  2R5Z A;  1VND A;  2FJ1 A;  1H8A C;  5IOY A;  2OPT A;  5J1R A;  4Y7N J;  3ZQC A;  4HNV A;  1I50 J;  4NDL A;  3MVP A;  3Q0V A;  3WHC A;  1JKP C;  2N8G A;  4J19 A;  1EF4 A;  1RKT A;  5DS9 A;  1HDP A;  5IPA A;  1JTY A;  4FTH A;  2K9N A;  2K9S A;  1HCR A;  1W0U A;  1P7J A;  3BR1 A;  2DMN A;  5FKO A;  1H88 C;  2HOA A;  1MSE C;  2LKX A;  3G1O A;  3GTK J;  4A3J J;  3HOY J;  5E3O A;  3IV5 A;  3OOU A;  1LE8 A;  4D7N A;  2FD5 A;  2YUS A;  2HOS A;  2JA5 J;  2HYJ A;  4A3D J;  3NAU A;  2EZL A;  1YRN B;  3GTL J;  1ZR2 A;  2WB1 N;  5F0F A;  3TP0 A;  1LE8 B;  5IYB J;  1LFU P;  1QVT A;  1SFO J;  5BNG A;  4ABZ A;  1S7E A;  3BQY A;  5EYR A;  4MFD A;  3ZQH A;  3HOW J;  1GV5 A;  2Y31 A;  5C4J J;  4QSH A;  2Y0S N;  2CUF A;  3ZOB A;  4B4C A;  4M3D A;  4D5F A;  1MBE A;  3GTG J;  2R7Z J;  2COB A;  1PUF B;  3RKQ A;  4JP0 A;  1ETQ A;  1SAN A;  3FK7 A;  1BJZ A;  1IV6 A;  1JUP A;  3B6A A;  1ETO A;  3BTI A;  5JLW A;  4C3J J;  1HDD C;  3M4O J;  3E7L A;  5DTD A;  2Y2Z A;  2E2J J;  4IHY A;  2R5Y B;  4MLO A;  2MG4 A;  4BKX A;  3LSP A;  3S14 J;  1POG A;  3LSJ A;  5IP6 A;  2JA7 J;  2Y9Z A;  1VI0 A;  1IRZ A;  2XGD A;  2EZH A;  4GFB A;  1OCT C;  2O7O A;  1AKH A;  3D1N I;  2R93 J;  4B3A A;  2NOG A;  3BTJ A;  1A5J A;  2B63 J;  1ETX A;  4I6Z A;  2IBD A;  3TED A;  1B8I A;  1JUS A;  1ZQ3 P;  1H89 C;  1X2N A;  2O8K A;  5FJ8 J;  2DMU A;  1K61 A;  3JRD A;  3OSF A;  1YRN A;  4IHW A;  4IEJ A;  4A3C J;  3HEF A;  1MH3 A;  1LFB A;  4XRS A;  1JT0 A;  1CQT A;  1U8B A;  2KT0 A;  5FKM A;  3RZO J;  2D5V A;  2JA6 J;  3VPR A;  1B72 A;  3QPL A;  2R5Y A;  3BR6 A;  3JRF A;  4MFE A;  2E2H J;  2R5Z B;  3JRG A;  2ECB A;  3K2A A;  1JGG A;  3Q0U A;  1BL0 A;  4JYK A;  2AO9 A;  3FKI J;  1AKH B;  1BA5 A;  5F1J A;  1U9N A;  3S1R J;  2EH3 A;  1FTT A;  2I10 A;  2O9L A;  1NK2 P;  2VKE A;  2LLK A;  1OJL A;  4M3B A;  3GTP J;  1Z77 A;  5EGO A;  3Q3S A;  1GDT A;  3IH2 A;  3HBL A;  1R9T J;  1WCM J;  2MW8 A;  1IGN A;  2X48 A;  3CCY A;  4JX4 A;  1ITY A;  1WH5 A;  1W0T A;  1P7I A;  2L7F P;  3JRH A;  2CUE A;  4CYC A;  1G2H A;  3BQZ A;  3HOZ J;  2DA6 A;  4MIM A;  2H1K A;  4UUS B;  2LP0 A;  2VUM J;  1BW5 A;  1JUM A;  1AU7 A;  4RDU A;  2EQR A;  3DCF A;  1XS9 A;  2LK2 A;  4MO7 A;  2XB5 A;  3ZQG A;  2L0K A;  4G12 A;  4BY7 J;  1ZTR A;  5FLV A;  1XC5 A; 
#chains in the Genus database with same CATH topology
 3FM3 A;  1I6H J;  2NRA C;  2E36 A;  2YPR A;  3ZQF A;  2DA7 A;  4RGS A;  5E17 F;  1UST A;  3I4N J;  3U1D A;  4E6K G;  1ZG5 A;  3HZJ A;  2XUB A;  3HSR A;  1IXS B;  2BHY A;  4M3F A;  3CCM I;  1BI3 A;  1UG2 A;  3MN2 A;  1NTC A;  4V2F A;  1WSU A;  1D3Y A;  4CCN A;  2YX7 A;  3TGN A;  4B44 A;  1VQP I;  2HYG D;  4O3M A;  2H6B A;  3ABL H;  4I0A A;  3CCR I;  4BYY A;  2E2I J;  2CW0 F;  4QPQ A;  2D1V A;  1X19 A;  2JT1 A;  2HDD A;  1I1G A;  3GZ5 A;  3LSI A;  4I01 A;  5F64 A;  3A01 B;  1H0M A;  2K9M A;  1J0R A;  2A68 F;  3CCJ I;  2XF6 A;  2XF5 A;  4YG2 F;  3GFI A;  1F36 A;  2CUJ A;  1MBH A;  3LNQ A;  2PLY A;  2ZJ2 A;  5J1Y A;  3L2Q A;  3QYE A;  4P5O A;  3WG9 A;  1E0E A;  3HGY A;  1YW7 A;  2CMP A;  3JRC A;  4F93 B;  1D0Z A;  2CSO A;  2HWV A;  1CF7 A;  3JR9 A;  1MBF A;  1HW2 A;  4BGD A;  1PP8 F;  3MKL A;  3H9J A;  1ZRE A;  2PMZ N;  2E5Z A;  1A31 A;  1LVA A;  2NVU B;  4C3H J;  2BHZ A;  4UUT A;  3I59 B;  3J7Y J;  1WFX A;  4GDF A;  4CCM A;  3CUQ B;  3RIR A;  4BJ6 C;  3CMA I;  1TT5 B;  1WI3 A;  1BR4 A;  2EFW A;  3MKW B;  3L2U A;  2A5Y B;  1IN8 A;  1EV7 A;  2RQP A;  2OQG A;  1IRF A;  1OYI A;  1MJA A;  4U0W A;  3BRO A;  4CO8 A;  1E3O C;  2M7A A;  4JX5 A;  4PSX A;  3S8P A;  3WGG A;  4M74 A;  1XDS A;  2E1M C;  5CVU A;  1K7A A;  4CGZ A;  3H3Z A;  4MEY F;  1B6A A;  4EGZ A;  2ZXH A;  4FE7 A;  2YS9 A;  2DFF A;  4IHS A;  3LSG A;  2EIN H;  1F5T A;  4BBR J;  1ETW A;  3RYR A;  4KN4 X;  3H35 A;  3RKW A;  4A2U A;  2VKD A;  3ASO H;  1R6R A;  2OTL I;  4GCV A;  1E17 A;  1MJ9 A;  2GIV A;  3FM5 A;  2R7Q A;  3TBI A;  3CC4 I;  2A5W A;  1I6X A;  2VJI A;  1MDM B;  1LPQ A;  2W48 A;  1FIA A;  1W7P A;  1OQY A;  4H0E A;  3DU5 A;  2ZME C;  2R0Q C;  4BNC A;  2XB0 X;  1BIB A;  4A0X A;  1HKT A;  2KKO A;  2X6W A;  4M3E A;  5FKK A;  3V8J A;  4ASN A;  1TQI A;  1V55 H;  4PUS A;  4IQJ A;  2DAO A;  4HST A;  2QF7 A;  4DYC A;  1S7A A;  5F0C A;  2Z5U A;  5CQE A;  3GME A;  4EV0 A;  2QQB A;  3BG9 A;  4KT5 C;  2YU3 A;  4M6Y A;  1YHQ I;  1J9I A;  4LK0 F;  3OYE A;  2VJJ A;  4XOR A;  2M3A A;  3KP6 A;  3SFI A;  4HNU A;  5H6R A;  3JRE A;  1FP2 A;  2ZJQ F;  4ZDP A;  4X6A J;  1U5T C;  2KRF A;  2Y48 A;  3K7A J;  3F8N A;  3OY9 A;  3WHB A;  1QPM A;  1OCP A;  5JI6 A;  1HA8 A;  4JOM A;  1JKQ C;  3TOA A;  3CD6 I;  1MNE A;  1XMK A;  1D5Y A;  3O8H A;  1C0W A;  1R71 A;  2QVO A;  5J8C A;  2NNY A;  4AC0 A;  1AHD P;  1XX5 A;  3S17 J;  4HLX A;  2CRG A;  1W5C C;  1UHM A;  2KP6 A;  1FYM A;  4EVI A;  1WH7 A;  4LB5 A;  2Z9O A;  2OUM A;  2AHQ A;  4M9S A;  2X4H A;  3RPQ A;  4PJJ A;  1K79 A;  2RQQ A;  3IAM 2;  1WGX A;  4PJN A;  2V6E A;  2W82 A;  4OIN F;  4A3K J;  1RES A;  3I54 A;  4PGG A;  4RLQ A;  4B48 A;  3ZPL A;  5FRM A;  9ANT A;  3K70 D;  2VKV A;  3ECO A;  1R00 A;  1SVO A;  3H92 A;  2Q2E A;  3H3V K;  5FKL A;  2ZJP F;  3T1B A;  5C44 J;  3B6C A;  2X1D A;  2W57 A;  3M07 A;  1J75 A;  3H5R A;  2LC2 A;  2P5K A;  1HBX G;  1T6S A;  2VAS A;  3DU6 A;  5D8L B;  1IDY A;  4XLP F;  2L7M P;  4MGR A;  4LB6 B;  4II3 A;  3H5A A;  3LWF A;  3OYB A;  3WTS C;  2XC7 A;  3F8M A;  3H9Q A;  2ELH A;  3M8E A;  1XN7 A;  1ETK A;  6PAX A;  1LB2 A;  3HTS B;  5K5O A;  4XRS G;  2L9S A;  2IS4 A;  2BY1 A;  4LIU A;  2ZME B;  1X1D A;  1R22 A;  2ZXW H;  3WGH A;  1MNM C;  2IP2 A;  2WV1 A;  2DA2 A;  2E35 A;  5M3F J;  2JUC A;  1T0F A;  3E5X A;  4KIC A;  1W1W E;  5E3M A;  2XKP A;  3EYY A;  2CQQ A;  3JW4 A;  3OS1 A;  2EWN A;  3CF5 F;  2OU2 A;  4C30 A;  3WTV C;  4XIC A;  1OCZ H;  2FBK A;  2XKO A;  3HUG B;  5LHH A;  2EV0 A;  4B1R A;  2KRH A;  2DMQ A;  3WU2 C;  2VON A;  5J1U A;  2BY2 A;  4FE4 A;  1D8J A;  5EG0 A;  3MKY B;  1SD6 A;  2GBY A;  4V2G A;  3DV8 A;  4ESB A;  4NQW B;  1LDD A;  2CQX A;  3CES A;  5EEH A;  5K5Q A;  4HF1 A;  2AXT C;  3ZN1 A;  1MZB A;  2WAQ N;  4ZYH A;  1X2M A;  2OQR A;  1JKR C;  2XRO A;  2L9V A;  5J47 A;  1K83 J;  3F21 A;  2M30 A;  3BC8 A;  4UB6 C;  3EUK L;  4A12 A;  1KU3 A;  3OSG A;  2NVQ J;  4U88 A;  3OOP A;  5FRO A;  4BXX J;  2DDA A;  1BC8 C;  4A69 C;  2E60 A;  2LKP A;  2W1O A;  2K9L A;  4ZDL A;  2W00 A;  3CQZ J;  3BG3 A;  3QOE A;  1OR7 A;  2K40 A;  3PSI A;  3VEP A;  3IH4 A;  2CYY A;  2JN6 A;  3K1P A;  1YJ9 I;  4UVA A;  3VYS B;  2L02 A;  4QIW N;  3REO A;  1TZL A;  4LGW A;  2VQH A;  4NNJ A;  3A03 A;  3JAM K;  3D5L A;  4W1U A;  3J80 Z;  3PQK A;  5CJ9 A;  3UR3 C;  3ZXS A;  1MMN A;  4R8H A;  3WG7 H;  4FX4 A;  3PO3 J;  3A1Y A;  5L3G A;  1UZC A;  1YX5 A;  1OCC H;  3DKX A;  1E3P A;  5HOD A;  4A3I J;  2DYS H;  3WTY C;  2O0Y A;  1YW8 A;  2STT A;  3JTH A;  3O2P E;  4XL9 A;  3BG6 A;  4ANJ A;  5IOY A;  5J1R A;  2EA2 A;  3K4C A;  4BE1 A;  3ZQC A;  3DQV C;  2PMZ A;  3CCQ I;  4GRI A;  4IF4 A;  1PP7 U;  3QOP A;  3MVP A;  4XN0 A;  3CUQ A;  3H9G A;  4N9I A;  3ABM H;  3FMS A;  2VOO A;  1JTY A;  3W2A A;  1HCR A;  4OAY A;  4RGX A;  1AWC A;  1W0U A;  3QOD A;  2UV1 A;  4P55 A;  1D0Y A;  4E7Z A;  1H88 C;  4L0Y B;  4A0Y A;  2DQL A;  2NOJ B;  3FXU A;  2V1D A;  3K69 A;  3KCC A;  5B66 C;  3GEZ A;  3HOS A;  2HOS A;  2JA5 J;  5K5R A;  4A3D J;  1YRN B;  1CGP A;  4ZC3 A;  3OIP A;  2VBX A;  3GTL J;  2WB1 N;  1STZ A;  2MA3 A;  2R7F A;  1XGM A;  3OYA A;  1KU9 A;  4M9X A;  1XTA A;  4YFK F;  2HNH A;  5EYR A;  1GV5 A;  4MQ9 F;  3KZZ A;  5C4J J;  2CS3 A;  1DPR A;  2CUF A;  5B1A H;  1P4A A;  4IRH A;  2R7Z J;  3FXO A;  1ZG1 A;  1ZEL A;  2PMH A;  5F1R A;  4JP0 A;  1OMI A;  1SAN A;  4OAZ A;  2PFB A;  1IV6 A;  4ENM A;  3BTI A;  3QPT A;  5JLW A;  3VYR B;  5DTD A;  4BQQ A;  5ED4 A;  2E2J J;  4BEH A;  3G4S I;  2QQA A;  3FWE A;  2DDB A;  2Y0S A;  4FQG A;  3ZMV A;  1SFU A;  4MLO A;  2DCE A;  3S14 J;  2KRC A;  3BCA A;  5IP6 A;  3CLQ A;  2RVC A;  1JI8 A;  1KA8 A;  2XGD A;  1KQ0 A;  1A04 A;  2R93 J;  5AIP A;  4B3A A;  5DD4 A;  2R7X A;  1B1B A;  1XCB A;  2QZ8 A;  3HL2 A;  1SVM A;  3BTJ A;  2Z33 A;  2XV4 S;  1YJN I;  4BS9 A;  3GUD A;  3HSE A;  1H9T A;  1OR7 C;  3SZT A;  5TJJ A;  1R5I D;  1UG0 A;  5FFZ A;  3CCS I;  4A3C J;  1OLT A;  2CQ7 A;  1F1Z A;  4XRS A;  1VQM I;  4ENK A;  1MKM A;  2XAH A;  4HOB A;  4R1H A;  2E7X A;  5DDG A;  1CF7 B;  5ILS A;  1U8B A;  5FLX K;  5A2Q K;  2R7V A;  3GO5 A;  4JK1 X;  5E1X A;  1ULY A;  2D5V A;  2JA6 J;  1R1T A;  1A35 A;  3QP5 A;  1R5H A;  4HZF A;  4PFP A;  4OIR F;  2R5Z B;  3S32 A;  4ENN A;  1BOA A;  4KMF A;  4GGG A;  2BY3 A;  1BL0 A;  3CCL I;  3JAM Z;  4M72 A;  4E7S A;  2FMY A;  2CFO A;  3G71 I;  3FKI J;  2NNN A;  3S1R J;  2EH3 A;  1U6G A;  3WE3 A;  3BCB A;  2VKE A;  3KYL A;  4JQF A;  2LLK A;  1USS A;  5ICG A;  4RS8 A;  1ZLK A;  2VQC A;  2UUZ A;  4KNY A;  1Z77 A;  5CQG A;  3BY6 A;  1QQI A;  4Q5S F;  2QYO A;  3IH2 A;  1YG2 A;  3CUO A;  1ZYR F;  3SYT A;  3NWS A;  4AIH A;  2MW8 A;  1R49 A;  3CC2 I;  2ISY A;  1FBS A;  1JXS A;  5GTH C;  3BOQ A;  4N4N B;  2L2O A;  3OYC A;  3SEQ A;  1W0T A;  2CV0 A;  4CHU A;  1OCO H;  1B9M A;  2BOL A;  2CUE A;  4CYC A;  4HDV A;  2HEO A;  1G2H A;  3BQZ A;  2WAF A;  4EQQ A;  2RC4 A;  1QO0 D;  3CP8 A;  2WBM A;  3C18 A;  3LA3 A;  5E8G A;  1Z9C A;  3HOZ J;  4EJO A;  1FP1 D;  1P9Q C;  1BW5 A;  1JUM A;  3QU3 A;  2IGO A;  1AU7 A;  2R7D A;  1O57 A;  3DCF A;  1LJ9 A;  2ZNZ A;  2VC0 A;  5HLH A;  1IN4 A;  2VJ5 A;  5KVR A;  5JVT A;  2XGX A;  4PZJ A;  3RPU D;  4DZJ A;  3WGI A;  3MZY A;  3HC7 A;  2EV6 A;  2HOE A;  3J7Z I;  4BY1 J;  1FMV A;  4EM2 A;  3EUH A;  3DLA A;  3KEQ A;  2Z1D A;  3FMR A;  1MMS A;  4XLE A;  3LAP A;  1ZGW A;  4BEH B;  4NQW A;  5LEK A;  2LMD A;  3BR0 A;  3C7J A;  1T08 B;  1GVD A;  2WTE A;  1VFC A;  2IS6 A;  2VQL A;  3L9F A;  3OWT A;  1Y6I A;  5LEJ A;  3FXK A;  2WV0 A;  2XAG A;  4OOI A;  4C3I J;  4EJW A;  1V5E A;  1S9H A;  1DPU A;  2GXA A;  2X6O A;  2HTS A;  1O7F A;  1ODD A;  3RPU A;  2DPD A;  4BHP A;  4E70 A;  1YW9 A;  5EEA A;  4GO1 A;  4A3M J;  3E6B A;  4DNC A;  2M8E A;  3E97 A;  4I09 A;  2V6C A;  3S3O A;  1JKO C;  2LSO A;  3MEX A;  3IH3 A;  1W7P B;  5JFR A;  3OYN A;  1K78 B;  3VOE A;  4Y4R A;  2H8R A;  1X1P A;  3C2G A;  3CJN A;  1X1A A;  2E19 A;  3OYM A;  4X0G A;  3J81 K;  3H1C A;  3HJE A;  4B3X A;  3D0S A;  2DPU A;  3HKZ N;  1ZH5 A;  5JVG F;  1GUU A;  5LGU A;  4G9Y A;  3OS2 A;  5J4Y A;  4U7B A;  2XPU A;  2R7R A;  1Z91 A;  2UXN A;  4UV9 A;  1UHW A;  1TWC J;  2NS7 A;  3I3L A;  2K86 A;  1XGO A;  4HA8 A;  4DYQ A;  2XAS A;  2LDU A;  3GWZ A;  2Q1Z B;  3T8R A;  3QPS A;  3FIS A;  5JLX A;  2NXN B;  5HNH A;  5C4X J;  2K4J A;  5FD5 A;  2L54 A;  1WZ2 A;  4RM2 A;  1KON A;  4ZJZ A;  3K4K A;  1IJW C;  2V4J C;  3WU0 A;  4XRM A;  2A6H F;  1HXD A;  4A3B J;  2DA4 A;  3A02 A;  4HX8 A;  3J80 K;  2GXB A;  5B3S H;  3N4M A;  3FXJ A;  3I4P A;  1PUF A;  3F8F A;  3HPG A;  2IGN A;  2DW4 A;  2DO7 A;  3H0G J;  3F72 A;  2K7L A;  4L9V A;  4P9U A;  5K7Z A;  4V19 K;  3IWZ A;  3GF2 A;  1VQ9 I;  3PUB A;  3FBN B;  1REP C;  4CDG A;  4I2O A;  2ZBK A;  3CO6 C;  3CCV I;  2QA4 I;  1BM9 A;  5BMZ A;  3GFM A;  1V5G A;  3RCO A;  5LHI A;  2GQQ A;  2R3S A;  2QEN A;  5HS7 A;  4IKF A;  4DOZ A;  2I8D A;  2ID3 A;  1QU3 A;  1S29 A;  3M1C A;  2DYR H;  4BXF A;  1GHC A;  2FBI A;  3CP2 A;  4L9J A;  2FUG 2;  1MJB A;  1EH7 A;  3QQA A;  5E20 A;  3PO2 J;  2VPL A;  2MH2 A;  4BDZ A;  2MLG A;  3TW6 A;  1W7P D;  2L3D A;  1Z7L A;  3F8C A;  2KHM A;  2F6C A;  2GXG A;  2QWW A;  3HTU A;  1LKX A;  4L18 B;  2IW5 A;  1RR8 C;  2O8X A;  4G6Q A;  4RGR A;  3ONQ A;  4BH9 A;  1FPQ A;  2TDX A;  3BG7 A;  3M7G A;  4Q4Z F;  1IRG A;  2L7Z A;  1U0J A;  4A93 J;  4UUS A;  1MD0 A;  2P0W A;  5GP9 A;  4XQF A;  1HC8 A;  2M9H A;  5E79 C;  3U1K A;  3P9I A;  5HS8 A;  1P4X A;  3RQI A;  2CQK A;  4TV7 A;  1ZN2 A;  1T38 A;  2R92 J;  4QWQ A;  1HSJ A;  2D1H A;  1D1A A;  1IRX A;  1I27 A;  2XGC A;  1YX3 A;  3DP7 A;  1IXC A;  2K02 A;  2DTR A;  1TC3 C;  4U7D A;  3VOD A;  5KCM A;  3MAJ A;  4L9T A;  1Z1D A;  3E6C C;  5F0H A;  1GVJ A;  3KFW X;  3KIO A;  5E3N A;  1WI9 A;  4PCQ A;  5J4V A;  4PJ0 C;  1XG1 A;  2FF4 A;  2EIL H;  5HLG A;  2FNA A;  1R36 A;  2WB1 A;  4IPA A;  2EFN A;  5DEQ A;  3BP8 A;  3P9K A;  2DLL A;  4PFO A;  5E18 F;  2CW7 A;  3G2B A;  1WJ5 A;  3VSL A;  1YE9 A;  4AID A;  1X3W B;  3V7R A;  2KIU A;  2DOF A;  1Z6T A;  3FIW A;  2JJ7 A;  1ZKG A;  2A69 F;  2W84 A;  3KX2 A;  4BJT A;  1D0X A;  4DW6 A;  3BR3 A;  1R5G A;  3HHH A;  5CKT A;  4BBS J;  2RV8 A;  1GXQ A;  1N75 A;  2PG4 A;  2ZSH B;  5D6E A;  2HPM A;  3HOX J;  2NVT J;  3FZV A;  5A2Q Z;  3BZ6 A;  1TLH B;  3ZQQ A;  2RGV A;  3VFZ A;  4FHT A;  4L5E A;  1HLV A;  4NUB A;  5DD8 A;  3LSR A;  4OIQ F;  2IEK A;  3BPV A;  2L4M A;  5IT3 A;  2IA0 A;  3LFU A;  3F3X A;  2NVX J;  4E4H A;  2HQA A;  5LFA A;  1JTX A;  2IXS A;  3RZD J;  2KDZ A;  3DXJ F;  1BR1 A;  1G4D A;  4M3G A;  2L9N A;  4FT8 A;  3MQ0 A;  3BPX A;  2V7F A;  3IAS 2;  4D9J A;  5KAI C;  2OF7 A;  2CU7 A;  2WAD A;  1YS7 A;  3OYG A;  1DU0 A;  3CDL A;  2BBY A;  1FOY A;  1Y8R B;  4S0H B;  5IYD J;  2X51 A;  3V7S A;  1PYV A;  1MSF C;  3CDI A;  3DWL E;  1SFE A;  3S2D J;  3TMO A;  2BEO A;  2KJC A;  1IDZ A;  4I76 A;  2B0L A;  2L5Q A;  5GPC A;  2X9D A;  1G3Y A;  2M1B A;  3KP5 A;  1JHF A;  5H6Q A;  2DK8 A;  3QWL A;  3FMQ A;  5JHU A;  3KYC B;  2DA5 A;  3R61 A;  3GTJ J;  3AG3 H;  2JRT A;  1J5Y A;  2MSY A;  3HDD A;  1U5T A;  1N78 A;  3A2K A;  1YQA A;  2FQ4 A;  1RZ4 A;  3LFK A;  1B9N A;  2QKM B;  3ZQL A;  1U8R A;  1LQ1 A;  2C6Y A;  1X1C A;  3FX3 A;  1N25 A;  4ETS A;  2EZK A;  2O03 A;  3ELK A;  4RMN A;  4XK4 A;  4NHJ A;  2KLO A;  1BJA A;  3ZN0 A;  3DKY A;  5LRR A;  1NK3 P;  4CSW A;  4Q48 A;  4ZH4 F;  3CO7 C;  4BE2 A;  2LRD A;  4O6J A;  2UZK A;  4HQE A;  4IVN A;  5FFX A;  2OPT A;  2HKO A;  1ZGA A;  3MFK A;  5J8F A;  4IRG A;  1T2K A;  1KU7 A;  4F91 B;  1Z3X A;  3PNV A;  5CVV A;  2ZSI B;  1DQU A;  2LY1 A;  1A6Q A;  2QBY B;  2N8G A;  1EF4 A;  1HW5 A;  2ZJR F;  1FZP B;  2RNG A;  4HV5 A;  4BDY A;  1R7J A;  1P7J A;  2AQF A;  2HOA A;  3PNT A;  4KIB A;  1YYV A;  2XSJ C;  1PJR A;  4A3J J;  3HOY J;  5E3O A;  4Y33 A;  2W4S A;  2FD5 A;  3E5Q A;  2KZV A;  1VQO I;  1BC7 C;  4DGW B;  3EUA A;  3FDY A;  3BLY A;  3DLL F;  1O3Q A;  2MC3 A;  1OKR A;  1LFU P;  1S3J A;  3MMY B;  4ZZL A;  4UB8 C;  2E34 A;  5BNG A;  3SZP A;  3ZQH A;  3H0D A;  2Y31 A;  4UNO A;  1SFX A;  3ZQ7 A;  4ZYE A;  4Z6Y A;  1MBE A;  3EQL F;  4XON A;  2EA4 A;  2DOA A;  1PUF B;  1ETQ A;  4BL0 B;  4BXU A;  2F4M B;  3FK7 A;  2CGP A;  1TL8 A;  3I55 I;  4KIT B;  2L4A A;  3DTE A;  4L5I A;  4A6D A;  4OIO F;  4C3J J;  5KHD A;  1HDD C;  2XAQ A;  3A0B C;  2Y2Z A;  3WTT C;  3OYF A;  1M1E B;  1SFK A;  1XGN A;  1IF1 A;  2KQR A;  2FE3 A;  3I56 I;  2MG4 A;  5BOX A;  3LA7 A;  3PL8 A;  3AKZ A;  1ZGJ A;  1R1V A;  2GAU A;  4LLG F;  4C2U A;  2RN7 A;  2E1M B;  2NOG A;  2BVM A;  2EK5 A;  1A5J A;  4XOP A;  2B63 J;  3BZK A;  4IOC F;  1ZQ3 P;  2MLK A;  3GXO A;  2CUZ A;  3H3U A;  1Y8Q B;  2KIF A;  4MHG A;  3EET A;  4IHW A;  3OR1 C;  1Y39 A;  1OIS A;  1WQ2 A;  4M6X A;  4GXO A;  4AYB A;  4NC6 A;  4XM3 A;  4MTD A;  1JT0 A;  4L0Z B;  1UEL B;  2DXI A;  1CQT A;  3HIF A;  1SD5 A;  1XMX A;  4AWX B;  2KT0 A;  4HYE A;  1RC9 A;  1TW2 A;  2RNJ A;  3VPR A;  3M8F A;  1B72 A;  2R5Y A;  3FHN A;  2E2H J;  3QPH A;  2ECB A;  2DFH A;  2QM3 A;  4ZYA A;  4RB3 C;  3K2A A;  5D4S A;  2MFZ A;  4XKV A;  3SXY A;  1Z67 A;  2FU4 A;  4D0P A;  2K4B A;  1BIA A;  5DCM B;  2AO9 A;  3VDX A;  4F55 A;  2XDV A;  1FTT A;  2I10 A;  2QGU A;  4IX7 A;  3FXQ A;  1HQC A;  3J7A O;  3BJ6 A;  1R4M B;  4M3B A;  5FLX Z;  3GTP J;  2KZG A;  1R1U A;  4RAG A;  3PJR A;  4KUM A;  5EGO A;  2Y69 H;  3Q3S A;  3ABK H;  2A07 F;  4G7Z F;  3I0T A;  1D1C A;  1BOB A;  5FD6 A;  2WAQ A;  2X48 A;  3CCY A;  1IGN A;  3ABU A;  1ITY A;  5D6F A;  5DUI A;  2M7B A;  3S93 A;  2KDO A;  1HW1 A;  3V4G A;  4F7Z A;  2P5L C;  2H27 A;  3AL0 C;  1O7L A;  1L0O C;  5HNF A;  5DUK A;  4MIM A;  3ERM A;  1G3T A;  1KZH A;  4WK8 F;  2MD5 A;  4RDU A;  2ETH A;  4HX7 A;  4YEJ A;  3ZMU A;  5ILU A;  1XS9 A;  4MO7 A;  4A5N A;  4G12 A;  3TO7 A;  5FLV A;  1XC5 A;  1WJA A;  3F22 A;  1VQN I;  2PJR B;  2KFD A;  1JJ6 C;  5DM7 F;  3CDH A;  1UB9 A;  3LSK A;  4A3F J;  4G7O F;  3N05 A;  2VT3 A;  1QPI A;  2HVQ A;  4BE0 A;  1SD7 A;  1O3R A;  3MZ8 A;  3P9C A;  2F5E A;  4HNT A;  1RUO A;  3HOV J;  3KE2 A;  3GCM A;  2HVS A;  1TTY A;  2IAI A;  1ENH A;  2ME0 A;  3NRV A;  1T98 A;  4JX6 A;  1ACI A;  2VBZ A;  3EYI A;  2DJN A;  1T56 A;  2RKH A;  3S2W A;  4BHB A;  3OYJ A;  1ZK8 A;  5GAG J;  2Q0O A;  3HRS A;  4A3E J;  2DT7 B;  3PFI A;  1FMW A;  1U78 A;  3S1N J;  1VF9 A;  2W24 A;  1B8I B;  4RGU A;  3NEU A;  1IAW A;  1MH4 A;  2WC2 A;  2XPW A;  4CUG A;  2CV1 A;  2LKS A;  3BR5 A;  2PI0 A;  5IT9 Z;  5E1Z B;  4D7M A;  3S3N A;  5F27 A;  3DBL B;  3ZP5 A;  1GV2 A;  3BDD A;  2XPV A;  2DMP A;  2ZFW A;  5EZG A;  5GAE J;  3GX4 X;  4F3Q A;  3I59 A;  1FNN A;  3PIP F;  1RPW A;  1IN6 A;  2FSW A;  4N9H A;  4E7L A;  4AVZ A;  2OCC H;  4Y52 J;  4BHC A;  1B72 B;  3GW2 A;  1MMG A;  2LVS A;  2Z2S B;  3AG4 H;  1SAU A;  1MND A;  2LH9 A;  2JA8 J;  4U0V A;  2ESH A;  4MTE A;  1UMQ A;  4LIV A;  1WVR A;  3K10 A;  1F43 A;  4IHV A;  1YO5 C;  2Y75 A;  2KIM A;  1U9O A;  2V9V A;  3BJA A;  4RA2 A;  5GAH J;  1KYW A;  4BJ5 C;  4JBA A;  3KLO A;  4KT6 A;  3SDG A;  2V26 A;  3ISP A;  4XN3 A;  2P6S A;  1ON1 A;  5J3L A;  4YRV A;  2VC1 A;  5EGO B;  4UXN A;  1NG6 A;  2DOE A;  3CJR B;  2YR2 A;  3AL0 B;  5LLQ A;  3S1Q J;  2OA4 A;  3U9G A;  2FBH A;  1OCR H;  2IS2 A;  1E2X A;  1U5T B;  3AAF A;  4OU0 A;  2HQN A;  4B47 A;  1XMA A;  3IUO A;  1YFH A;  2CW8 A;  4FCY A;  2HOT A;  5HDG A;  4KYW A;  3HOU J;  4I0B A;  1YLF A;  2GM4 A;  2H6C A;  1B4A A;  3DPT A;  4FIS A;  2LTP A;  4BQO A;  3W6J B;  4ITV A;  1UCR A;  4UVC A;  2VN2 A;  2P6T A;  4PDK A;  4EJV A;  1S7O A;  3V8L A;  1UHS A;  2LFB A;  2XHK A;  2K9Q A;  4UV8 A;  5L3F A;  3F0C A;  4XMY A;  4RLF A;  4F52 A;  2GOM A;  2LR8 A;  1ON2 A;  4S05 A;  3OL3 A;  2JA2 A;  4LMY A;  2M87 A;  5EJC A;  1TWH J;  3S15 J;  4AD9 A;  4QTR A;  1RRJ A;  5ILV A;  3R0A A;  5IYC J;  4KIS A;  1V4R A;  3SDB A;  4XID A;  1MIJ A;  5J6X A;  1GT0 C;  3RDI A;  3M3Y J;  3OIO A;  3SHF A;  1Y56 A;  1VQ4 I;  2J5O A;  3PNY A;  3NAR A;  1G3S A;  3JCU C;  5L3B A;  3SJM A;  4M9Z A;  1RR7 A;  1ZRD A;  2DFE A;  3KPH A;  4C9Y A;  2M8G X;  4GYI A;  4RBO A;  1J2X A;  5CVI A;  3HRM A;  3CJT B;  3L2W A;  5JR3 A;  4XLA A;  3V42 A;  3TP3 A;  2NS8 A;  3VYU B;  2QUF A;  3I53 A;  4ZDO A;  2QCO A;  1ZLJ A;  2CFX A;  3UKG A;  2F5F A;  4LD5 A;  2VIX A;  1IC8 A;  1Z21 A;  1TBX A;  2ELK A;  3RYP A;  3PM1 A;  2MGQ A;  4UVB A;  2QLZ A;  1Z6R A;  2IVM A;  3IWF A;  1SAX A;  2DA3 A;  2B7E A;  2VI6 A;  5IY5 H;  1G6N A;  1FYK A;  1IUY A;  1EH8 A;  2MC4 A;  3K4N A;  1YIT I;  1FBQ A;  4IL6 C;  3KZI C;  3GTQ J;  4HF0 A;  1Q1V A;  1X3U A;  2PJP A;  1VQK I;  1FYL A;  3FBI B;  3IRQ A;  3ESW B;  2Y30 A;  5IT9 K;  2VQG A;  2HZD A;  1LVK A;  3Q0W A;  4NB5 A;  1DDN A;  2QQ9 A;  2X6X A;  3IL2 A;  4Q47 A;  3TO6 A;  1P6R A;  3CCU I;  2O5R A;  3QP6 A;  3F6V A;  2HQ5 A;  5KNL A;  3L2C A;  3IKV A;  5IP9 J;  5LRS A;  3BZC A;  2LBF B;  2OV7 A;  2KIQ A;  4IRI A;  2L9R A;  1YI2 I;  2EB7 A;  1GXP A;  3RSN A;  1FOW A;  3W2V A;  1YIJ I;  2HDC A;  1FEX A;  2CJJ A;  3K4J A;  3JRA A;  2OZ6 A;  2A61 A;  4PK4 A;  3OYI A;  4HBL A;  4LG3 A;  3K9T A;  2HXI A;  5DV5 A;  4BUP A;  1O4X A;  1MMA A;  2OTJ I;  4WXD A;  1KQ8 A;  2P7V B;  1YS6 A;  3C3W A;  5FKN A;  4KA4 A;  1IXR C;  2VBY A;  5EG0 B;  4RB1 A;  2BZT A;  3L2R A;  4RB2 C;  3X2Q H;  4EM0 B;  3MZH A;  3HKZ A;  3L1P A;  2MD0 A;  4EM1 A;  2V9P A;  2ZO4 A;  1JT6 A;  2E1N A;  1FOK A;  2IGM A;  3K4B A;  2WY7 Q;  3TOB A;  2BXZ A;  5F04 A;  3I5U A;  5M5Y J;  5FLM J;  2RAE A;  5ICF A;  3IKT A;  3HGG A;  2JVG A;  2FNP A;  2PJR A;  1RET A;  2B9S A;  3EDP A;  1VQ5 I;  2LBF A;  2LF8 A;  3NWT A;  4MQV A;  5B1B H;  1AA7 A;  2OD5 A;  3H36 A;  4A6E A;  5H2F C;  4Y17 A;  3OL4 A;  3L7W A;  4X1E A;  2P81 A;  4XLC A;  5K7H A;  4NBQ A;  3GZ6 A;  1Z3Y A;  3I64 A;  2EJR A;  1QVU A;  1X1B A;  4E7J A;  4G6T B;  2STW A;  2DN0 A;  1UJ8 A;  4Z2Y A;  4XLN F;  4YII A;  2BY0 A;  3O3K A;  3JRI A;  4MNU A;  4XLF A;  4CYD A;  3G6E I;  4RAZ A;  2V1N A;  1WWX A;  2XSD C;  2HPI A;  1S72 I;  1K78 A;  1XB4 A;  1ETY A;  1OYY A;  5HDN A;  1PVE A;  2E7W A;  5DM6 F;  4AUX A;  2EZI A;  2EFO A;  2VPR A;  2M0M A;  4J01 A;  1HF0 A;  1I3A A;  3WU1 B;  1VQ7 I;  1N77 A;  1LEB A;  2YU9 J;  2M45 A;  5KK1 A;  1WRJ A;  1O3T A;  1X4O A;  4IHT A;  2IS1 A;  1EH6 A;  3CME I;  4CA0 A;  2HXO A;  2R5Z A;  1W5S A;  2FJ1 A;  3MKZ A;  2X6Y A;  1B59 A;  2D45 A;  4XR6 A;  4WCG A;  4LFU A;  3DF8 A;  4Y7N J;  2XAJ A;  4H4K C;  1K4T A;  4FET A;  1I39 A;  1X3Z B;  3EUH C;  1IN5 A;  1W5T A;  3M1E A;  4NDL A;  4HG2 A;  4EGY A;  2R4G A;  4R79 A;  3WHC A;  2R7S A;  4BAY A;  4J19 A;  1XCV A;  3IP4 B;  1FOX A;  1RKT A;  2EV5 A;  2OAZ A;  2BW3 A;  5IPA A;  2K9N A;  2PQ8 A;  3RTR A;  2R7U A;  1DP7 P;  5F6F A;  2DMN A;  2IGK A;  3LQR A;  5FKO A;  2AXL A;  2VE8 A;  5BPI A;  1KQ9 A;  4FAS D;  3IV5 A;  4EJT A;  1ONV A;  3RI4 A;  4ESF A;  2FA5 A;  2EZL A;  5LGN A;  3L09 A;  1ZR2 A;  5F0F A;  4LG0 A;  2ZNY A;  2ZC2 A;  5IYB J;  1A36 A;  1SFO J;  4ABZ A;  5HVQ C;  3BQY A;  2VBW A;  3ZCO A;  3HOW J;  1S8N A;  3LL7 A;  3TKY A;  2X0L A;  2OCE A;  3ZOB A;  2DT6 A;  4HEA 2;  5E1W A;  4D5F A;  3RJP A;  4CH7 A;  3WTX C;  2VB6 A;  3RKQ A;  2EPF A;  5D5X B;  1JUP A;  2F5V A;  3B6A A;  4EAT A;  1ETO A;  1WJE A;  1BN5 A;  2W85 A;  3CTA A;  3PIO F;  5GTI C;  5HS9 A;  3M4O J;  3IRR A;  2GOX B;  3E7L A;  3QU6 A;  3SZG A;  3E6M A;  2F5C A;  4IHY A;  2QEX I;  3E5U A;  2Y0M A;  4O5V A;  1F9N A;  1P92 A;  4KIG A;  5HLI A;  5LBQ A;  3WOD F;  4UUV A;  1QNT A;  1V3F A;  2Z3Y A;  2QKL B;  2NAZ A;  4IQ4 A;  4BKX A;  3LSP A;  2KJB A;  1SD4 A;  3K4L A;  3NQO A;  3LSJ A;  4E7K A;  2JA7 J;  2Y9Z A;  1VI0 A;  3ZMT A;  1VQ8 I;  2YSR A;  1AKH A;  3D1N I;  4I99 C;  2H94 A;  3ROU A;  3TDU C;  4OMZ A;  2OBP A;  2VE9 A;  2NYX A;  1LDK B;  1ETX A;  4C2T A;  2IBD A;  1B8I A;  2JSP A;  2M4K A;  1ZAO A;  2COM A;  3ZRG A;  2EIK H;  2O8K A;  1KU2 A;  2P8T A;  4E7I A;  4ZTF A;  1K61 A;  2DMU A;  4NC8 A;  4YFN F;  4ZYD A;  2PMU A;  3ZMS A;  1P4W A;  2FQ3 A;  1MH3 A;  2X85 A;  3LQQ A;  3U2R A;  1K4S A;  2P5V A;  1MDM A;  2X1C A;  4UHT A;  1QBJ A;  5FKM A;  4XKW A;  3RZO J;  4WXC A;  3HYI A;  3QPL A;  3BR6 A;  2HDW A;  3JRF A;  4MFE A;  1I1S A;  3HXL A;  4DQ2 A;  1TNT A;  2H1L A;  2XAF A;  1JGG A;  1T0F C;  3DEU A;  1R23 A;  1QA6 A;  3E6D A;  5HOO A;  2LY2 A;  3K1M A;  1T8I A;  1AKH B;  1BA5 A;  4HAM A;  1ZAR A;  2H09 A;  2KPM A;  4OWR B;  1NK2 P;  4XRF A;  2HKX A;  3I58 A;  3KEY A;  4KMU X;  5DCF A;  2CQN A;  3C2H A;  4I02 A;  1D8K A;  2BW3 B;  1D1B A;  3KP4 A;  3HRT A;  2AS5 F;  2PEX A;  3SFZ A;  2CH0 A;  4XSZ F;  2M4G A;  1WCM J;  3A0H C;  4P9F A;  1DGR M;  4JX4 A;  3E3V A;  1XSV A;  1XPX A;  5L3C A;  2E1C A;  3R60 A;  3W3C A;  3OIQ A;  2L7F P;  4LLL A;  3JRH A;  2G7U A;  2H8W A;  2BE5 F;  5LHG A;  2V1U A;  1FC3 A;  1AOY A;  2CG4 A;  2DQR A;  2ZXI A;  3LSM A;  4AIK A;  1QZY A;  1R58 A;  1ZG3 A;  5ERI A;  3N97 A;  2V9K A;  5GAD J;  4LK1 F;  2VUM J;  1BR2 A;  3DFG A;  2VOD A;  2BXY A;  2QSF X;  4Y13 A;  3K2Z A;  1UFM A;  1BI2 A;  3O6B B;  5AIQ A;  2L0K A;  2HQR A;  3KYD B;  1ZTR A;  1G3W A;  1VQ6 I;  3DBH B;  2IRF G;  3GBG A;  1A6I A;  3OMY A;  2XRL A;  4NC7 A;  1MBG A;  2IA1 A;  4IHX A;  2ID6 A;  1BI0 A;  3GZN B;  3CUQ C;  4HF2 A;  5IOZ A;  1NHA A;  1BI1 A;  3CJQ B;  1Z0X A;  2JZY A;  2JMW A;  3AG1 H;  1I3Q J;  3MCZ A;  5BS6 A;  4KDP A;  3B73 A;  1JHH A;  1TWG J;  2FX0 A;  3AG2 H;  5EEG A;  5TGT A;  5M5X J;  3F8B A;  3S3M A;  4A3L J;  3R4K A;  3E1S A;  3T0Y A;  1SMT A;  4CYC B;  3TQN A;  3PUF A;  3WTW C;  1WKM A;  4XNF A;  4YFX F;  3H5N A;  3L2V A;  4IOA F;  3ULQ B;  2JWT A;  2JK3 A;  2V79 A;  4IJA A;  2MBF A;  2QSH X;  2MYS A;  3KP2 A;  3ML6 A;  1ETV A;  2DOD A;  3GTM J;  2M5W A;  2IPQ X;  3G3Z A;  2ADU A;  3OS0 A;  4BQN A;  1FSH A;  4CZC A;  1TNS A;  4I98 B;  4MEX F;  1QGP A;  3HRU A;  5L3D A;  4CCL A;  1RKW A;  3SQN A;  1I5Z A;  1WJF A;  1OYW A;  1HOM A;  2MH9 A;  1MGT A;  2DTZ A;  1SVL A;  4PJL A;  4II2 A;  4KFC A;  3DEW A;  4FX0 A;  2W25 A;  5CPR B;  3CLO A;  1Y0U A;  3IHU A;  1Y1W J;  3WTZ A;  1J09 A;  3S16 J;  3P5J A;  4RAY A;  5TRD A;  2HFH A;  2TRT A;  1XD7 A;  4XOT A;  2DI3 A;  4XBF A;  1ORK A;  2ME6 A;  4XSX F;  1YIO A;  2I5U A;  2NS0 A;  1XSX A;  1FT9 A;  2XF7 A;  2ZXJ A;  3F6O A;  3U21 A;  4DZP A;  4IO9 F;  4UY8 I;  4CIC A;  4PGH A;  1J7K A;  2DA1 A;  3ZMZ A;  1RUN A;  4BAC A;  3KP3 A;  1HST A;  1VZ0 A;  2Z16 A;  3PQJ A;  2XGE A;  3CC7 I;  3OR2 C;  1X58 A;  1YOV B;  3BR2 A;  4WXH A;  5K1Y A;  2K27 A;  3K1N A;  2F4O B;  1MBK A;  3LSH A;  3EPZ A;  3G1L A;  3S1M J;  3A4C A;  4CCO A;  4XKB A;  1VTN C;  4YEL A;  1XGS A;  3F9K A;  3E0J B;  3GYH X;  2M2E A;  1XDU A;  3V7C A;  2O6G E;  3PFY A;  2FXA A;  4LLN A;  1LUJ B;  1FLI A;  2JPB A;  2OJE D;  1NG7 A;  5ICE A;  2J5P A;  1WJB A;  2E71 A;  3CMY A;  2R7O A;  5DCM A;  3FHZ A;  4HDU A;  1LDJ A;  4HW0 A;  3CF2 A;  5E3L A;  3VSK A;  4AYB N;  2G0E A;  1G59 A;  2ZFU A;  2WY8 Q;  3I71 A;  2OZU A;  2DMT A;  2M34 A;  1LFP A;  2Y9Y A;  1Y1V J;  4D5C A;  2LNB A;  2LY9 A;  5M3M J;  2HGC A;  4DIQ A;  3FXR A;  4DBQ A;  1QZE A;  4P1W A;  3QYB A;  1KYZ A;  3FXM A;  1IO2 A;  4A3G J;  3GFL A;  4M73 A;  1QZZ A;  1WHU A;  1SC7 A;  1GLN A;  4DJA A;  4BU2 A;  5F08 A;  4AU7 A;  3A01 A;  2K3P A;  3ERE D;  4XKC A;  2GLO A;  2F4I A;  3HPH A;  1HKQ A;  3ZQI A;  3MWM A;  4ZYG A;  2NVY J;  4RB0 A;  2W7N A;  5LGT A;  3DKW A;  1TWF J;  1QRY A;  3B02 A;  1ZHF A;  3ZMD A;  1J59 A;  2HU9 A;  1P2F A;  1IUF A;  2A6T A;  2BGC A;  2KMU A;  5HDK A;  1E3H A;  3TW7 A;  4M6V A;  2JRM A;  3BG5 A;  3FK6 A;  1TWA J;  3ZGK A;  5LD2 C;  2G7H A;  2FEZ A;  3CZ6 A;  2FOK A;  2R7W A;  3S2H J;  3DTI A;  2X1E A;  1IW7 F;  1Z05 A;  2PBI A;  1KGS A;  1LNW A;  1OFC X;  1WJD A;  2JUG A;  4OIP F;  1MBJ A;  4HLY A;  1JJ8 C;  2ICW G;  2GZW A;  2XRN A;  2DBB A;  3LMM A;  3KLN A;  4DBR A;  1FSE A;  1EKE A;  2HZT A;  2DK5 A;  4HSR A;  2E1O A;  4HQM A;  5GPA A;  1G8X A;  4AIJ A;  1SEU A;  2EBI A;  3G1M A;  1FBU A;  1XSD A;  2DT5 A;  2VL8 A;  3OYK A;  2IT0 A;  2YX4 A;  2FOW A;  1R4N B;  1FIP A;  1HKS A;  4EEF G;  1DGW Y;  5FGM A;  4WX9 A;  3QRF F;  3K70 C;  4GYG A;  1U3E M;  2VXD A;  4LIT A;  2XIG A;  4YIF A;  1RNL A;  5B5E C;  3BT9 A;  1APL C;  3I9V 2;  4OMY A;  2M0C A;  5D5U B;  2FRH A;  2VT2 A;  3HOT A;  3CMM A;  1EJ9 A;  1TW3 A;  1SMY F;  3KZY A;  3IC7 A;  3W6V A;  4D1Q A;  2VKH A;  5M5W J;  3AFH A;  2ZB9 A;  4C2M J;  2LG4 A;  3J7A Y;  2ELJ A;  3ASN H;  4CCJ A;  5CVJ A;  2R7T A;  3LOC A;  3O8G A;  3LST A;  1BW6 A;  3RKY A;  4G94 A;  2HVR A;  1TT0 A;  1IG7 A;  1ZRC A;  1IN7 A;  5CLS A;  1PDN C;  4WWC A;  5D4R A;  5EDN A;  4F92 B;  3K4M A;  2QSG X;  2FML A;  4LOC A;  2GWR A;  4B09 A;  4S04 A;  4BQA A;  5EF6 A;  2UXX A;  4LJZ F;  5IP7 J;  1D5V A;  5C3E J;  1BBY A;  1V54 H;  3HB9 A;  3P7N A;  4E7H A;  2BVL A;  3OYL A;  3D5S C;  2GIZ A;  1WPK A;  3MD2 A;  3GTO J;  3BTC A;  2KIS A;  5EZH A;  1ZR4 A;  2O61 A;  2DU9 A;  2VOP A;  3HG9 A;  2D2W A;  1Y0N A;  3C2B A;  4U87 A;  2VJ4 A;  4U0Y A;  5D5W B;  3JRB A;  2LD5 A;  3FXL A;  1DU6 A;  1S5L C;  1FTZ A;  3BTL A;  1K6O A;  2TCT A;  4DYR A;  4W97 A;  3VB2 A;  5CYV A;  5CVR A;  1W36 D;  1FJL A;  3UNG C;  1V5F A;  2ECC A;  4HV6 A;  3HM5 A;  3ZR8 X;  2A05 A;  5K7F A;  3WE2 A;  1IZ1 A;  4PJM A;  4EJU A;  2RRE A;  3PSF A;  3J81 Z;  1L3L A;  4ZTJ A;  3I4M J;  2HI3 A;  1QHG A;  2GA1 A;  3OYH A;  2VLA A;  4RM3 A;  1T33 A;  3TL4 X;  2ACJ A;  5KAF C;  1Q1H A;  1VND A;  2A3S A;  3RKX A;  1H8A C;  2Q2E B;  3QAH A;  2HTJ A;  4A5M A;  2HS5 A;  4HNV A;  1I50 J;  3VYT B;  2WA0 A;  3T8T A;  2PX9 A;  1NH3 A;  3Q0V A;  5E8I A;  1JKP C;  4B8X A;  1T95 A;  4Y15 A;  3Q9V A;  5DS9 A;  4CCK A;  1HDP A;  2ZCW A;  4FTH A;  2K9S A;  1EA3 A;  4ESJ A;  4KJZ A;  4L5J A;  1IV8 A;  1DP3 A;  3BR1 A;  1TQM A;  1MSE C;  4ENJ A;  1FX7 A;  1QHH D;  2MAB A;  3M9A A;  3DEE A;  3G1O A;  2LKX A;  2F2E A;  3D5R C;  3GTK J;  4ON0 A;  5AON A;  4B43 A;  5FB2 A;  2CV2 A;  3OOU A;  1LE8 A;  4D7N A;  2BYV E;  2YUS A;  2HYJ A;  2P4W A;  1YTY A;  3HHG A;  1WJC A;  3W2W A;  3NAU A;  4HRI A;  3KET A;  1ZRF A;  4HX4 A;  3TP0 A;  1LE8 B;  4KN7 X;  2XVC A;  1QVT A;  3QYF A;  1T39 A;  1S7E A;  3K6G A;  2O3F A;  4MFD A;  4QSH A;  2Y0S N;  2GA2 A;  1U2W A;  1TQP A;  2EIM H;  4N4O B;  4M3D A;  4B4C A;  5FRN A;  1RIO H;  5BQT A;  3V8K A;  4G7H F;  2JQ7 A;  2COB A;  3DTK A;  2G9W A;  2JVH A;  4IZZ A;  3JTG A;  4G8X A;  4XLH A;  3GFJ A;  4EMS A;  2LOO A;  3LAJ A;  3DPU A;  1BJZ A;  5DYM A;  1VQL I;  4A0Z A;  3KEO A;  3HSF A;  1S6L A;  1FY7 A;  3FF5 A;  2HYF A;  1W4M A;  5TIS C;  2JTV A;  2DFI A;  1OPC A;  2AQE A;  2EFP A;  3F23 A;  2E5N A;  2R5Y B;  1TP4 A;  1LEA A;  2EFQ A;  1ERD A;  5H20 A;  2EIJ H;  1POG A;  1MW7 A;  2Q8K A;  4K2E A;  1IRZ A;  2EZH A;  5J40 A;  1OCT C;  4GFB A;  2O7O A;  2VXZ A;  4P96 A;  3ECH A;  1JE8 A;  4QPO A;  2ZME A;  2IJL A;  2QQ8 A;  2KL4 A;  4PSW A;  2ISZ A;  2RDP A;  3R6S A;  3TDZ C;  3GLL A;  4J00 A;  2XAU A;  1O3S A;  4I6Z A;  3TED A;  1W36 C;  1JUS A;  2CWE A;  1H89 C;  2Z99 A;  3BJO A;  2JSC A;  2OC6 A;  3L00 A;  1X2N A;  4Y3O A;  3TO9 A;  4AVP A;  3W6K B;  2CO5 A;  5FJ8 J;  3JRD A;  3OSF A;  1YRN A;  3VWB A;  1MMD A;  4IEJ A;  3HEF A;  4LG0 B;  1LFB A;  2LF7 A;  4G6D A;  3FKJ A;  3RQ4 A;  1YJW I;  3BWG A;  2K3F A;  3LA2 A;  4I7H A;  3COA C;  2L7K A;  1FWZ A;  4M71 A;  2IA2 A;  3JSO A;  1RI7 A;  1PUE E;  3JRG A;  4N0B A;  3CCE I;  5D8K B;  3HUG A;  3Q0U A;  3ABT A;  2BV6 A;  2ZKZ A;  4JYK A;  1UAA A;  1DUX C;  3OYD A;  4ZZD A;  5F1J A;  2JPC A;  1U9N A;  3GVA A;  4KIF A;  4CXF A;  5FO5 A;  5D5V B;  2QBY A;  2O9L A;  2WWY A;  1K6Y A;  4L9N A;  4AM3 A;  4CZZ A;  2HR3 A;  2K85 A;  1OJL A;  3G73 A;  4WF2 A;  3SEZ A;  2F5D A;  1GDT A;  2LRE A;  2L01 A;  3GLX A;  5L3E A;  3OV8 A;  2F48 A;  3HBL A;  4IXA A;  1R9T J;  4RAF A;  2P7C B;  3KP7 A;  5BPD A;  4YIR X;  3M8J A;  5ICC A;  1JGS A;  4HPQ A;  4QLC U;  1F4K A;  1H9G A;  1WH5 A;  2UWM A;  1P7I A;  1X4P A;  2LYC A;  3Q5F A;  3C1D A;  2ESN A;  2A6E F;  3T5X A;  3DPL C;  2DA6 A;  2H1K A;  4UUS B;  3K0L A;  3DBR B;  2LP0 A;  2WAE A;  3Q9S A;  2PN6 A;  1Z7U A;  3R0J A;  2DJI A;  2EQR A;  5HLT A;  2LK2 A;  2V1X A;  5JHF A;  2XB5 A;  3ZQG A;  3JSP A;  2K5C A;  3WTU C;  4BY7 J;  3GTG J; 
#chains in the Genus database with same CATH homology
 1I6H J;  4DZJ A;  1JJ6 C;  3ZQF A;  4A3F J;  3GBG A;  2DA7 A;  1A6I A;  2XRL A;  1QPI A;  1MBG A;  4BY1 J;  2ID6 A;  4IHX A;  3I4N J;  5IOZ A;  1Z0X A;  1ZGW A;  2JMW A;  3HOV J;  4M3F A;  1UG2 A;  1I3Q J;  3MN2 A;  1NTC A;  4V2F A;  2IAI A;  1ENH A;  2ME0 A;  3BR0 A;  4JX6 A;  1GVD A;  1TWG J;  2FX0 A;  1VFC A;  5M5X J;  4A3L J;  2E2I J;  2DJN A;  1T56 A;  4CYC B;  1ZK8 A;  2HDD A;  4A3E J;  4C3I J;  3A01 B;  1U78 A;  2X6O A;  2JWT A;  1VF9 A;  2JK3 A;  3S1N J;  1B8I B;  1MH4 A;  2XPW A;  3BR5 A;  1F36 A;  3LNQ A;  1MBH A;  4A3M J;  5EEA A;  1ETV A;  5J1Y A;  4D7M A;  3GTM J;  5F27 A;  3HGY A;  3JRC A;  1JKO C;  1GV2 A;  3IH3 A;  2XPV A;  2DMP A;  2H8R A;  5EZG A;  3JR9 A;  1MBF A;  1RPW A;  3MKL A;  2E19 A;  2PMZ N;  4Y52 J;  1B72 B;  4C3H J;  1RKW A;  4UUT A;  2LVS A;  3HKZ N;  1WI3 A;  1GUU A;  2JA8 J;  1HOM A;  2DTZ A;  1UMQ A;  2XPU A;  1F43 A;  4IHV A;  1TWC J;  2NS7 A;  3DEW A;  1U9O A;  1Y1W J;  4DYQ A;  3SDG A;  3S16 J;  1E3O C;  4JX5 A;  2TRT A;  3QPS A;  1ORK A;  2ME6 A;  3FIS A;  5J3L A;  5JLX A;  5EGO B;  3S1Q J;  5C4X J;  4DZP A;  4FE7 A;  2YS9 A;  3LSG A;  2DA1 A;  4BBR J;  1IJW C;  1ETW A;  4XRM A;  2XGE A;  1X58 A;  3BR2 A;  4FCY A;  4A3B J;  2HOT A;  2DA4 A;  3A02 A;  3HOU J;  1MBK A;  3G1L A;  3S1M J;  2GM4 A;  1PUF A;  4FIS A;  2LTP A;  2W48 A;  1FIA A;  3H0G J;  2R0Q C;  2M2E A;  5K7Z A;  1UHS A;  2LFB A;  2XB0 X;  4M3E A;  5FKK A;  2K9Q A;  3F0C A;  3CMY A;  2LR8 A;  5E3L A;  2QF7 A;  4AYB N;  2G0E A;  4DYC A;  5F0C A;  3BG9 A;  1TWH J;  3S15 J;  2DMT A;  2M34 A;  4QTR A;  2Y9Y A;  1Y1V J;  4D5C A;  2ID3 A;  5IYC J;  5M3M J;  2LY9 A;  3SFI A;  4XID A;  1GT0 C;  3JRE A;  4X6A J;  3M3Y J;  4A3G J;  3QQA A;  3K7A J;  3OIO A;  3PO2 J;  3WHB A;  1OCP A;  3NAR A;  1JKQ C;  5F08 A;  3TW6 A;  3A01 A;  3SJM A;  1D5Y A;  2GLO A;  3O8H A;  1RR7 A;  3ZQI A;  2M8G X;  2NVY J;  4AC0 A;  4RBO A;  1AHD P;  3S17 J;  1TWF J;  1QRY A;  3TP3 A;  2NS8 A;  2CRG A;  2L7Z A;  1IUF A;  4A93 J;  4UUS A;  2QCO A;  1WH7 A;  5GP9 A;  3UKG A;  2M9H A;  4M6V A;  3TW7 A;  3BG5 A;  2AHQ A;  1IC8 A;  3FK6 A;  1TWA J;  2ELK A;  3RQI A;  3PM1 A;  2R92 J;  2MGQ A;  1WGX A;  2DA3 A;  2VI6 A;  2XGC A;  4A3K J;  1RES A;  9ANT A;  3H3V K;  2VKV A;  1OFC X;  3GTQ J;  1MBJ A;  1Q1V A;  5FKL A;  1JJ8 C;  5C44 J;  1TC3 C;  3B6C A;  2Y30 A;  5F0H A;  3Q0W A;  2E1O A;  5GPA A;  2EBI A;  3G1M A;  5E3N A;  1IDY A;  1XG1 A;  2L7M P;  3S2H J;  2HQ5 A;  1ETK A;  1FIP A;  4EEF G;  5IP9 J;  2L9R A;  4XRS G;  3FIW A;  2JJ7 A;  1ZKG A;  1FEX A;  4DW6 A;  2CJJ A;  3BR3 A;  3BT9 A;  1APL C;  2M0C A;  3JRA A;  1MNM C;  2NVT J;  4BBS J;  3HOX J;  2WV1 A;  2DA2 A;  5M3F J;  2HXI A;  3W6V A;  5E3M A;  1O4X A;  5M5W J;  2ZB9 A;  4L5E A;  2CQQ A;  4C2M J;  1HLV A;  5FKN A;  3LSR A;  2IEK A;  4XIC A;  2NVX J;  5EG0 B;  3LOC A;  3O8G A;  1JTX A;  3RZD J;  1BW6 A;  2KDZ A;  4B1R A;  3L1P A;  2DMQ A;  4M3G A;  1IG7 A;  5J1U A;  4FE4 A;  1JT6 A;  5EG0 A;  5EDN A;  2OF7 A;  2GBY A;  4V2G A;  2CU7 A;  4LOC A;  5M5Y J;  5F04 A;  5FLM J;  5EF6 A;  2RAE A;  1DU0 A;  3CDL A;  3HGG A;  5IP7 J;  2CQX A;  4S0H B;  5C3E J;  5IYD J;  1RET A;  2WAQ N;  1X2M A;  1JKR C;  1MSF C;  3HB9 A;  1K83 J;  1WPK A;  3S2D J;  5K7H A;  4X1E A;  3OSG A;  2NVQ J;  2P81 A;  3BTC A;  4I76 A;  5EZH A;  1ZR4 A;  3GTO J;  5GPC A;  4BXX J;  1IDZ A;  2X9D A;  4A69 C;  3C2B A;  1QVU A;  3JRB A;  2DA5 A;  2LD5 A;  2DN0 A;  3BG3 A;  3CQZ J;  1DU6 A;  1FTZ A;  3BTL A;  2TCT A;  2K40 A;  3GTJ J;  3JRI A;  3HDD A;  2MSY A;  3IH4 A;  2JN6 A;  4W97 A;  4DYR A;  4QIW N;  1FJL A;  2XSD C;  2FQ4 A;  2ECC A;  3HM5 A;  1ETY A;  5K7F A;  3A03 A;  4W1U A;  3ZQL A;  4AUX A;  2EZI A;  2VPR A;  3I4M J;  2HI3 A;  1HF0 A;  2EZK A;  3PO3 J;  2YU9 J;  4XK4 A;  1T33 A;  5HOD A;  4A3I J;  1NK3 P;  2HXO A;  2R5Z A;  1VND A;  2FJ1 A;  1H8A C;  5IOY A;  2OPT A;  5J1R A;  4Y7N J;  3ZQC A;  4HNV A;  1I50 J;  4NDL A;  3MVP A;  3Q0V A;  3WHC A;  1JKP C;  2N8G A;  4J19 A;  1EF4 A;  1RKT A;  5DS9 A;  1HDP A;  5IPA A;  1JTY A;  4FTH A;  2K9N A;  2K9S A;  1HCR A;  1W0U A;  1P7J A;  3BR1 A;  2DMN A;  5FKO A;  1H88 C;  2HOA A;  1MSE C;  2LKX A;  3G1O A;  3GTK J;  4A3J J;  3HOY J;  5E3O A;  3IV5 A;  3OOU A;  1LE8 A;  4D7N A;  2FD5 A;  2YUS A;  2HOS A;  2JA5 J;  2HYJ A;  4A3D J;  3NAU A;  2EZL A;  1YRN B;  3GTL J;  1ZR2 A;  2WB1 N;  5F0F A;  3TP0 A;  1LE8 B;  5IYB J;  1LFU P;  1QVT A;  1SFO J;  5BNG A;  4ABZ A;  1S7E A;  3BQY A;  5EYR A;  4MFD A;  3ZQH A;  3HOW J;  1GV5 A;  2Y31 A;  5C4J J;  4QSH A;  2Y0S N;  2CUF A;  3ZOB A;  4B4C A;  4M3D A;  4D5F A;  1MBE A;  3GTG J;  2R7Z J;  2COB A;  1PUF B;  3RKQ A;  4JP0 A;  1ETQ A;  1SAN A;  3FK7 A;  1BJZ A;  1IV6 A;  1JUP A;  3B6A A;  1ETO A;  3BTI A;  5JLW A;  4C3J J;  1HDD C;  3M4O J;  3E7L A;  5DTD A;  2Y2Z A;  2E2J J;  4IHY A;  2R5Y B;  4MLO A;  2MG4 A;  4BKX A;  3LSP A;  3S14 J;  1POG A;  3LSJ A;  5IP6 A;  2JA7 J;  2Y9Z A;  1VI0 A;  1IRZ A;  2XGD A;  2EZH A;  4GFB A;  1OCT C;  2O7O A;  1AKH A;  3D1N I;  2R93 J;  4B3A A;  2NOG A;  3BTJ A;  1A5J A;  2B63 J;  1ETX A;  4I6Z A;  2IBD A;  3TED A;  1B8I A;  1JUS A;  1ZQ3 P;  1H89 C;  1X2N A;  2O8K A;  5FJ8 J;  2DMU A;  1K61 A;  3JRD A;  3OSF A;  1YRN A;  4IHW A;  4IEJ A;  4A3C J;  3HEF A;  1MH3 A;  1LFB A;  4XRS A;  1JT0 A;  1CQT A;  1U8B A;  2KT0 A;  5FKM A;  3RZO J;  2D5V A;  2JA6 J;  3VPR A;  1B72 A;  3QPL A;  2R5Y A;  3BR6 A;  3JRF A;  4MFE A;  2E2H J;  2R5Z B;  3JRG A;  2ECB A;  3K2A A;  1JGG A;  3Q0U A;  1BL0 A;  4JYK A;  2AO9 A;  3FKI J;  1AKH B;  1BA5 A;  5F1J A;  1U9N A;  3S1R J;  2EH3 A;  1FTT A;  2I10 A;  2O9L A;  1NK2 P;  2VKE A;  2LLK A;  1OJL A;  4M3B A;  3GTP J;  1Z77 A;  5EGO A;  3Q3S A;  1GDT A;  3IH2 A;  3HBL A;  1R9T J;  1WCM J;  2MW8 A;  1IGN A;  2X48 A;  3CCY A;  4JX4 A;  1ITY A;  1WH5 A;  1W0T A;  1P7I A;  2L7F P;  3JRH A;  2CUE A;  4CYC A;  1G2H A;  3BQZ A;  3HOZ J;  2DA6 A;  4MIM A;  2H1K A;  4UUS B;  2LP0 A;  2VUM J;  1BW5 A;  1JUM A;  1AU7 A;  4RDU A;  2EQR A;  3DCF A;  1XS9 A;  2LK2 A;  4MO7 A;  2XB5 A;  3ZQG A;  2L0K A;  4G12 A;  4BY7 J;  1ZTR A;  5FLV A;  1XC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...