1NK3P

Vnd/nk-2 homeodomain/dna complex, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*GP*TP*GP*TP*CP*AP*AP*GP*TP*GP*GP*CP*TP*GP*T)-3
total genus 20
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1nk3P00
1MBKA 3IH3A 2LK2A 4C3HJ 2HOAA 3S15J 2GBYA 2GLOA 3FK6A 1MBEA 2LP0A 3Q0VA 5IP7J 2EZLA 1JKQC 4DZJA 3BQYA 1HCRA 5JLXA 2DA6A 5C44J 4A3IJ 1JT0A 1JKRC 1OFCX 2LD5A 2VPRA 1TWCJ 2CRGA 1XG1A 2Y0SN 2HDDA 1P7JA 5GP9A 2ID3A 2FX0A 2HQ5A 4UUTA 1U9NA 3BR1A 5K7FA 1ZTRA 2NVTJ 1EF4A 2ID6A 1WI3A 5HODA 4ABZA 4X1EA 3WHCA 2YU9J 3LNQA 3W6VA 1Z0XA 4BBRJ 5FKKA 4W97A 4AUXA 3HDDA 1OCPA 2DMQA 3I4NJ 3MKLA 2R5YA 2XGEA 5IP6A 1BW6A 3NAUA 1Z77A 1FIAA 3IH4A 2R93J 1G2HA 5F1JA 3FKIJ 2MSYA 3JRIA 4C3JJ 3M3YJ 1PUFA 3D1NI 1E3OC 3GTJJ 1ZKGA 2L7FP 2EBIA 4D5FA 1HLVA 3G1OA 1F36A 4M3FA 1IDYA 1MH3A 1BL0A 3BTLA 2B63J 2JA5J 4A3EJ 2QCOA 3M4OJ 3S1QJ 5F08A 3JRGA 2IAIA 2ME6A 3HOVJ 4FE7A 2KDZA 1GV2A 4C3IJ 1Y1VJ 4GFBA 5IPAA 1YRNA 1JTXA 2Y31A 5E3NA 5C4XJ 1SANA 3HGGA 4DYCA 3FIWA 9ANTA 2E2IJ 3JRDA 1P7IA 3A02A 3BG3A 2CQQA 1BW5A 3GTQJ 2XSDC 1O4XA 2XPWA 2XGDA 1Y1WJ 3DCFA 4V2FA 1ETKA 2QF7A 3TW6A 1A6IA 3HEFA 1B72B 2LLKA 1MBGA 4S0HB 1LFUP 3BTJA 4IHWA 2LY9A 3QPSA 3FK7A 5EYRA 2HYJA 5EGOA 3Q0WA 1IRZA 1QRYA 1JKPC 1FTTA 5F0FA 4BKXA 3ZQFA 1W0TA 1PUFB 1H89C 1JJ8C 5EG0B 1ETYA 3O8HA 1TWFJ 1U8BA 1GUUA 2HI3A 1APLC 4QTRA 1Q1VA 3WHBA 2D5VA 2DN0A 1ORKA 3S14J 3BR6A 5IYDJ 2DA3A 4X6AJ 1IG7A 3BG9A 5DS9A 2I10A 1NK3P 4FISA 2ECCA 4MFEA 1HF0A 1UG2A 4BY7J 1HOMA 4LOCA 4L5EA 4A93J 4MFDA 2NVQJ 1X2NA 4D5CA 3LSJA 2LVSA 3S16J 4MLOA 3S1RJ 4Y7NJ 1BA5A 2XB5A 4CYCA 1MBJA 3HOZJ 2E2HJ 1RETA 3PM1A 2H1KA 3H3VK 3FISA 1DU6A 2K9SA 2ME0A 1F43A 5DTDA 2L9RA 1I3QJ 4XICA 3RZOJ 3UKGA 2NOGA 2DMNA 1POGA 3TEDA 1IJWC 3GTKJ 2VUMJ 5BNGA 1LE8B 1QVTA 3HOXJ 5EGOB 2JA6J 1K83J 3BR0A 2O8KA 3OIOA 5J1YA 2DA5A 5EEAA 3ZQIA 2TRTA 2DA7A 1ENHA 2IEKA 2OPTA 2W48A 3B6AA 3TW7A 4A3LJ 2DTZA 5FKMA 1I50J 3E7LA 2Y30A 5E3LA 3A01B 1VF9A 2DA4A 4UUSA 4IHXA 3DEWA 4MIMA 2CQXA 2R5ZB 1TWAJ 4C2MJ 2XGCA 4M3DA 1RESA 3K2AA 3HBLA 2P81A 5FKOA 4M3EA 3ZQHA 3LOCA 5K7HA 3OSGA 3HKZN 2JWTA 2EZIA 2NVYJ 1UHSA 3K7AJ 4XRSA 3LSGA 1WH5A 2AHQA 1IC8A 1X58A 2PMZN 4RBOA 2DMUA 3BR5A 2FJ1A 5C3EJ 3SJMA 3GTLJ 1ITYA 1LE8A 3C2BA 3GTGJ 5F27A 1UMQA 3Q3SA 3Q0UA 4D7NA 2IBDA 2H8RA 1GV5A 1NTCA 2R7ZJ 3L1PA 2XRLA 2E1OA 1S7EA 2LR8A 1XC5A 5J3LA 5K7ZA 3HOYJ 5FKNA 4IEJA 2MG4A 1JUSA 5M3FJ 2N8GA 2M2EA 1JUPA 1JJ6C 4QSHA 1ETXA 3I4MJ 4B1RA 5EF6A 2X48A 3JR9A 2VKEA 2LTPA 3RKQA 2NS7A 1ZR2A 1FIPA 5FLMJ 4W1UA 3QPLA 5F0HA 2JA8J 4JYKA 2M9HA 3G1LA 5GPCA 1IUFA 4MO7A 5JLWA 2X6OA 4CYCB 2WV1A 1GVDA 2O7OA 4BXXJ 1WH7A 1RKTA 2FD5A 2R0QC 2L7ZA 3BQZA 3ZOBA 5J1RA 2AO9A 2RAEA 4B4CA 1JTYA 2VKVA 4AC0A 2JN6A 1AKHA 2ECBA 3HGYA 1ZGWA 5M5YJ 1ZQ3P 5EZHA 1MSEC 3GBGA 2JJ7A 2CU7A 2DA2A 3CCYA 3HOWJ 1JT6A 2OF7A 2XB0X 1U78A 5FJ8J 1U9OA 2CUEA 4B3AA 4V2GA 4D7MA 1RR7A 1QVUA 2KT0A 2O9LA 3S1NJ 3GTPJ 3TP0A 1CQTA 4Y52J 5M5XJ 4BY1J 4A3BJ 1VNDA 2CJJA 1SFOJ 1B8IA 4G12A 4FE4A 4FTHA 2Y2ZA 2R5YB 2HOSA 3O8GA 3RQIA 3JRFA 1TWHJ 3BG5A 3LSRA 2HXIA 1R9TJ 3ZQCA 3BTCA 2L0KA 1LFBA 1GT0C 4NDLA 2LFBA 2R92J 2MGQA 1MBFA 2YUSA 4DW6A 4HNVA 4XRSG 3MN2A 1IDZA 3HB9A 2YS9A 4A3FJ 3A01A 5F0CA 2MW8A 2HOTA 2Y9YA 2HXOA 2CUFA 3MVPA 4I76A 4A3CJ 3GTOJ 1WCMJ 3SDGA 2NS8A 4XK4A 5EZGA 5IOZA 3ZQGA 2EZHA 1RPWA 2K9NA 5IYCJ 4M6VA 4I6ZA 1MSFC 1A5JA 2E19A 2XPVA 2K9QA 2X9DA 1XS9A 4DYQA 2EZKA 5IYBJ 1K61A 2COBA 5E3OA 1WGXA 5IP9J 2WAQN 4A3KJ 3JRHA 4JX6A 2JK3A 2K40A 3CDLA 5GPAA 4FCYA 1BJZA 3S17J 2DMTA 5FLVA 1AKHB 4EEFG 2JMWA 3JREA 1ZR4A 5FKLA 1B8IB 1ETOA 3JRAA 1FEXA 1ETQA 4A3MJ 1OCTC 5IOYA 3PO2J 1VI0A 4A3DJ 2Y9ZA 1JUMA 1QPIA 2DA1A 2M8GX 3OSFA 3S2DJ 1OJLA 1IV6A 1ETWA 4A69C 5EDNA 3F0CA 3A03A 3BT9A 3BR3A 4M3BA 1FJLA 2ELKA 2XPUA 2NVXJ 1IGNA 4IHYA 2FQ4A 3NARA 1MH4A 2ZB9A 1TC3C 3RZDJ 5J1UA 4J19A 3VPRA 1AHDP 3B6CA 3BTIA 2G0EA 3HOUJ 3HM5A 4RDUA 3PO3J 1WPKA 4QIWN 4IHVA 3GTMJ 1TWGJ 3BR2A 1MNMC 2JA7J 5E3MA 4JX5A 3LSPA 3OOUA 2DMPA 3JRCA 1GDTA 2TCTA 1YRNB 1W0UA 5EG0A 5F04A 3TP3A 1H8AC 4A3GJ 4DYRA 5C4JJ 5M5WJ 1HDPA 3H0GJ 3JRBA 2L7MP 1D5YA 1H88C 4A3JJ 3S1MJ 1AU7A 1RKWA 1ZK8A 2M34A 1T56A 1B72A 5M3MJ 2EQRA 2EH3A 2VI6A 3IH2A 2DJNA 1FTZA 4XRMA 4XIDA 1NK2P 3SFIA 2R5ZA 2M0CA 4DZPA 1HDDC 1I6HJ 1ETVA 3G1MA 1VFCA 1JKOC 2E2JJ 3ZQLA 2WB1N 3CQZJ 4UUSB 1JGGA 4JX4A 1DU0A 4M3GA 4AYBN 3CMYA 3S2HJ 2GM4A 1X2MA 1T33A 4BBSJ 1MBHA 3IV5A 4JP0A 2LKXA 3QQAA
chains in the Genus database with same CATH superfamily
3A4CA 3W2AA 4V19K 2LK2A 4MGRA 2QZ8A 3AG3H 3S15J 1KGSA 5DD8A 4ZTJA 2GLOA 4BUPA 1S7AA 3FK6A 4B09A 3F6VA 5IP7J 2KISA 1JKQC 3QPHA 3BQYA 1P92A 1WJDA 4DZJA 1YO5C 1SMYF 2DA6A 4A3IJ 4FQGA 1UHWA 1R1UA 3K69A 1QZZA 2GXGA 2VQHA 1U2WA 5HS8A 1UB9A 2EFOA 5CVIA 1P7JA 2KL4A 1FYLA 1IF1A 2ID3A 2FNAA 2K4BA 2HQ5A 1KZHA 3F3XA 4UUTA 2Z1DA 1CF7A 2NVTJ 1R4NB 2HPIA 3HL2A 4XSZF 1NG6A 1E3HA 1WI3A 4P9FA 1P4AA 3WHCA 2L01A 3W6VA 4NQWB 2ZMEB 1WHUA 2VN2A 3KZIC 3HDDA 5L3CA 2DMQA 5ICFA 4HYEA 1MDMA 3I4NJ 1FSHA 4A0ZA 1BC8C 2XGEA 3T8TA 3VYSB 3CP8A 3ZMDA 2V7FA 4L9JA 5KAFC 1VTNC 1BW6A 4HDVA 5J6XA 1Z77A 1QPMA 1FIAA 4BE2A 2R93J 2EA2A 4PJMA 5GTHC 4Y4RA 5JHFA 2MSYA 4C3JJ 3VFZA 3GTJJ 3F8CA 1ZKGA 3M8FA 2EBIA 4D5FA 2KIMA 3QU3A 2DTRA 4LLGF 1F36A 2H8WA 1WKMA 1IDYA 4RAZA 3UR3C 1R7JA 3FWEA 2V1UA 2JA5J 3HRUA 4A3EJ 3M4OJ 3S1QJ 3KP2A 4BGDA 3FMSA 2DAOA 4UV8A 1BI3A 2RQPA 3K70C 4GRIA 1Y1VJ 2GXBA 2K02A 5IPAA 2F6CA 2K9MA 1OKRA 2MA3A 2VXZA 2Y31A 3HGGA 2IS6A 2M4GA 3FIWA 2VJ4A 4LFUA 2DYSH 2QUFA 1SC7A 3GTQJ 1KU3A 2ISZA 2Z2SB 4IOAF 1FMWA 5BS6A 1G3WA 1UFMA 1LJ9A 1ETKA 2QF7A 3TW6A 2W4SA 1D0YA 2X1EA 2LLKA 3ABUA 1JI8A 4IOCF 1MNEA 1XTAA 2LY9A 2W82A 2V1NA 4OOIA 1L0OC 3N4MA 3Q0WA 1KU2A 2EFPA 4PCQA 1OPCA 4XN3A 1WJCA 1T2KA 3O6BB 5D5UB 2Q2EB 3SZGA 4XMYA 1TWFJ 1USTA 3HSFA 2QGUA 1YX3A 1D8KA 3LFUA 1ACIA 4EQQA 3WHBA 1TT0A 2PJPA 2D5VA 2DN0A 2QBYB 3OYGA 3HTSB 2ZNYA 1SD6A 1R71A 1IG7A 4U0WA 4HRIA 2I10A 3OMYA 1ODDA 2XUBA 4ZTFA 2GXAA 1E3PA 1USSA 1SFKA 1VQLI 2OZUA 2IA1A 3DU6A 3PL8A 2M7BA 4L5EA 3G73A 4MFDA 1X2NA 5HS9A 4CCJA 2JT1A 4BAYA 1ERDA 4MLOA 3A1YA 4PJ0C 2GOXB 2VJJA 1D1CA 4Y7NJ 1V5EA 2DPUA 4BJTA 3NQOA 3GX4X 1MBJA 3CCMI 4IQ4A 2E2HJ 1RETA 3BY6A 2HWVA 3TO9A 2H1KA 2KLOA 3ZMZA 1DU6A 2HFHA 2HQRA 1R6RA 4KN4X 3DXJF 1N77A 3RZOJ 2E36A 2CQNA 3DTKA 1A35A 2PQ8A 1IJWC 3E6MA 4NB5A 5B1BH 3VSKA 3HOXJ 2JA6J 1K83J 3BR0A 3CUQB 3OIOA 2DDBA 5J1YA 2DFIA 3FKJA 3H3ZA 1ZG1A 3DLAA 2RKHA 2TRTA 2JUGA 2DA7A 1ENHA 5D4RA 2OPTA 1J59A 3B6AA 5L3DA 3BPXA 1OISA 4RB2C 4BQOA 1LEBA 1QHHD 2W24A 1RC9A 5FKMA 4LB6B 3M7GA 5HLIA 1VQPI 1I50J 1ZYRF 1WWXA 5E3LA 3U1DA 1PP7U 3A0HC 2GA1A 4U88A 5FFZA 3WODF 4YG2F 4EV0A 1EKEA 2JA2A 2V6CA 1PP8F 1SD5A 3LOCA 2WB1A 3HKZN 4HX8A 5AIPA 3KLOA 4E4HA 3EQLF 3DBRB 3ZQQA 2MFZA 2KIFA 5FFXA 2L4AA 1YE9A 3W6KB 3LAJA 1TQIA 4ZDPA 2DMUA 4QPQA 3I55I 2HVSA 3Q3SA 4EM1A 2VBZA 3NRVA 4D7NA 2DODA 3DLLF 2H8RA 3HRTA 2R7ZJ 3TOBA 3LAPA 3CJQB 2FBHA 3ZP5A 1Z21A 1WJFA 1Q1HA 2ZJ2A 3C1DA 1VQOI 3OV8A 2DBBA 1HBXG 1SD4A 3OIQA 4EGZA 2Q0OA 2OTJI 2OBPA 3KP7A 2XF7A 5M3FJ 2N8GA 2M2EA 1FP2A 4IVNA 1JUPA 3J81Z 2XAUA 1WFXA 3KLNA 4JQFA 2VB6A 3IWZA 1OCOH 3BOQA 4E7HA 3JR9A 2VKEA 3V8KA 1DGWY 4W1UA 3QPLA 4ASNA 1JE8A 1Z05A 2M9HA 3V4GA 1IUFA 2LRDA 4CYCB 1QZYA 2XF6A 1RKTA 2FD5A 3CCLI 3H92A 3E1SA 1IAWA 2MLKA 2VT3A 1ZGWA 2GWRA 1XGMA 4L9TA 2PMHA 4F91B 1QBJA 5FRNA 3IRQA 1DP3A 2VQCA 3G3ZA 1D8JA 2J5OA 4MTEA 3CCYA 3DKWA 1JT6A 5A2QZ 5DUKA 2EJRA 4RLFA 3OYHA 2VL8A 4CA0A 5HNFA 4Y52J 1IXRC 4BY1J 1IXSB 2CJJA 5LRRA 2CS3A 3F9KA 2UXXA 5L3GA 2R5YB 3E3VA 3TDUC 1TWHJ 2EPFA 3BG5A 3LSRA 2HXIA 3N05A 3ZR8X 3RKYA 4RS8A 1ZLJA 3Q9SA 2IPQX 3L2WA 3PNYA 1GT0C 4MEYF 2R92J 1YJNI 1HA8A 1G3SA 2ZMEC 3RPQA 1I39A 3DEEA 3IAS2 4XRSG 2Z5UA 3GCMA 1GLNA 2FUG2 4Q48A 4ANJA 2OZ6A 2B7EA 4E6KG 3RCOA 1FMVA 2YU3A 2HXOA 2IS4A 2D2WA 4I76A 4A3CJ 2F5EA 3GTOJ 1WCMJ 2NS8A 1XGOA 3D5SC 3LSHA 1OCRH 2RNGA 5DCMB 5E1XA 1RPWA 2NS0A 4EJVA 4YFXF 3HRSA 5IYCJ 2DOEA 4M6VA 3KPHA 4I6ZA 1MSFC 3GW2A 2E19A 2L4MA 2K9QA 2X9DA 3HZJA 3D0SA 2V9KA 2KMUA 2ESNA 2HEOA 2O03A 1I3AA 1X1AA 3TQNA 5IP9J 3I5UA 2XC7A 4BS9A 1XPXA 4A0XA 2JPBA 4FCYA 1BJZA 4IQJA 2DMTA 3S17J 2EA4A 4EEFG 4IF4A 4BXFA 1FYMA 1ZR4A 1BC7C 4M72A 3SYTA 1ETOA 3JRAA 2ELHA 1FEXA 3W2WA 3QODA 4A3MJ 1FY7A 2UV1A 3DPTA 5IOYA 5J8CA 3HHHA 4UHTA 1J7KA 3KZYA 2YX7A 3RTRA 3ZN0A 4CXFA 3QRFF 4A3DJ 1WQ2A 1YW8A 4B8XA 3OSFA 2KKOA 3H9QA 5LHIA 2CUZA 2COMA 3A03A 3BR3A 5CQEA 1FJLA 3WTWC 4D1QA 2ELKA 1YHQI 4IKFA 1R5HA 3B73A 4RGUA 4U7BA 4OINF 1IGNA 1YJ9I 3GLXA 5K1YA 3RZDJ 1V5GA 1FT9A 2ZC2A 3L2UA 2IGKA 2V9PA 1J9IA 1HC8A 2K27A 3B6CA 2XSJC 2G0EA 4G6QA 2PJRA 4IHVA 1R36A 3ML6A 2EILH 3GTMJ 1MNMC 4G9YA 2IA2A 4L0YB 4RMNA 1P4XA 2JA7J 2A6TA 3HG9A 5E3MA 3LSPA 4E7IA 3TBIA 3OOUA 2RDPA 3U2RA 3QP6A 2ZJRF 5ICEA 3FDYA 1W0UA 5J40A 3TP3A 3H5AA 4CHUA 2I5UA 4DYRA 3OS0A 1S72I 1XGNA 5HS7A 1WJAA 2K7LA 5KVRA 1RKWA 2WAFA 1BIAA 2BY1A 1T56A 4BHPA 4Z6YA 1SAUA 3SQNA 4CZZA 5KNLA 4UNOA 3JTHA 4NUBA 1W7PB 2R7SA 2O61A 3OR1C 1HDDC 1J75A 2OQGA 4XNFA 4BXUA 2Z33A 1TZLA 2BVLA 5LGTA 3G1MA 4PFOA 1SFUA 1LDDA 2E71A 4O5VA 3K2ZA 3H5RA 4I02A 3U9GA 1NHAA 3GO5A 2WV0A 2WAEA 2E1CA 5D4SA 1UAAA 4JX4A 2NYXA 3SDBA 2XAJA 4TV7A 3S32A 3FXMA 3WTZA 1HSTA 1TL8A 2Q8KA 1MZBA 3BWGA 2F5FA 1T33A 1UZCA 3FM5A 3IV5A 1JXSA 1VZ0A 1BR4A 1YG2A 3M1EA 4JP0A 1B4AA 4WCGA 3N97A 3I71A 3IH3A 2BY0A 3FXJA 3BPVA 4OIRF 4BQAA 1ZRCA 2IXSA 3M8JA 1R5ID 2GBYA 4RAFA 2VBWA 1MBEA 3Q0VA 4YFKF 2KQRA 2G7UA 2CMPA 2DLLA 1STZA 4C2UA 4ENJA 3F8BA 1XSVA 2WY8Q 5BOXA 3H3UA 1U5TB 3I4PA 1K79A 1OYWA 5ED4A 4ZC3A 3QP5A 2CRGA 3DTEA 3FBIB 3JAMZ 1BN5A 1X1DA 1X4PA 4LITA 1AOYA 1KYZA 1U9NA 3HOTA 3MAJA 5K7FA 3VEPA 3MKWB 2XAQA 2ID6A 2FBIA 3K9TA 1U6GA 2CW8A 1D0XA 2OJED 2DT7B 3LNQA 5ICGA 4BACA 1QGPA 4E7KA 2RVCA 4BU2A 1ZRDA 2PLYA 1M1EB 3MZYA 2HVQA 1OCZH 3IH4A 1XMXA 3VB2A 3CUQC 4EATA 4HX7A 2OQRA 1YW9A 1FOKA 3D1NI 1HW5A 1Z3XA 2V1DA 3BCAA 4M3FA 1BBYA 2P4WA 4XSXF 4ZZDA 4JBAA 2KPMA 1MH3A 2L54A 5LHHA 1BL0A 1XDSA 5GAHJ 2B63J 5DM6F 3ZQ7A 3P7NA 4YEJA 1W7PD 3DBHB 3RSNA 2L2OA 1OYYA 3HOVJ 4FE7A 1U8RA 1LUJB 2Z99A 4BEHB 3I56I 3KX2A 5E3NA 1N25A 4RB3C 3OYLA 4L18B 4M71A 4DYCA 9ANTA 1RIOH 1XSDA 3ZXSA 4AIJA 3BG3A 2LC2A 2Z3YA 1BW5A 2Z9OA 1RR8C 3QPTA 3H35A 2XSDC 2EIJH 3E6CC 1O4XA 5FLXZ 1Y1WJ 2Z16A 2V4JC 4N0BA 2VODA 1L3LA 4LJZF 2MYSA 5JFRA 3HEFA 1B72B 3ABTA 3KE2A 3QPSA 4GCVA 4UVAA 4UV9A 2ZFUA 1Y8RB 1JKPC 1FTTA 2F5CA 3F72A 3IUOA 2FE3A 2BW3A 3ZQFA 3KYLA 1HKQA 1W0TA 2P7CB 1H89C 1GUUA 1S6LA 2RGVA 4PDKA 3DFGA 2J5PA 4Y3OA 5KCMA 2L02A 4HLXA 3SHFA 2QSGX 1W4MA 4XRFA 2OAZA 2JRTA 4RLQA 2DA3A 3VDXA 3F23A 5IYDJ 1VQNI 3RDIA 3ZMVA 3E97A 1NK3P 4FISA 2BVMA 2NXNB 4AWXB 2ECCA 2FF4A 3CTAA 5HDGA 2H94A 3IKTA 1ZGJA 2DO7A 1OCCH 1ZARA 2IW5A 5E1WA 1FLIA 4HQMA 5F1RA 1OR7C 1J09A 2LVSA 1ON2A 2DOFA 2KJBA 4LG3A 1EH7A 1I1SA 3OY9A 1QZEA 2UUZA 3FISA 5D8KB 1F43A 3TDZC 2DCEA 5DTDA 4OAYA 4R79A 4M9SA 1I3QJ 3V8JA 1SEUA 1ZHFA 2A69F 4DJAA 2ESHA 2CWEA 1W36D 1QHGA 1ZLKA 1UELB 3TEDA 2VC1A 4RGRA 3R6SA 1GXQA 1QA6A 5JVTA 4BH9A 1CF7B 5EGOB 3MKZA 2CQKA 2HTJA 1HW1A 3ZN1A 4AVPA 1ZRFA 1F4KA 5DUIA 2EV0A 5E8IA 1XCVA 2A5YB 4II2A 3J80K 1WRJA 2W48A 3RYRA 1X4OA 3CJRB 3TW7A 4ZYEA 2IP2A 1ZN2A 2EWNA 3IWFA 4AU7A 2MC3A 2F48A 3HHGA 2DI3A 2E7WA 5DDGA 5L3FA 2P5LC 2ZNZA 4KMUX 4MQ9F 3A01B 4IHXA 2RN7A 3ABKH 2ISYA 5DEQA 5DYMA 1X1CA 1TWAJ 3RKWA 2M30A 2R5ZB 2DJIA 4C2MJ 3DPUA 3PQKA 4HF1A 2P81A 3M1CA 1JHFA 4BE0A 3ZQHA 2GOMA 2BW3B 5LFAA 2EZIA 3K7AJ 4XRSA 2DW4A 2NAZA 2HTSA 2AHQA 4E7ZA 1XCBA 2PMZN 4RBOA 5GTIC 2F5VA 1V5FA 2RQQA 3GTLJ 4HV5A 1LE8A 5FLXK 2HS5A 2JVHA 1UMQA 2RV8A 4ESFA 1R49A 3MWMA 5E79C 1ZELA 1G59A 4PJLA 4CYDA 5CYVA 1O3RA 3P9CA 4IXAA 2W00A 1S7EA 2X85A 3F8NA 1R00A 1XC5A 3JCUC 5LEJA 2HDCA 3JW4A 2EB7A 2GAUA 2D45A 3I58A 1YIOA 3HOYJ 1Y39A 3MZHA 2MG4A 2HKOA 4MEXF 2ZXHA 3GUDA 1I5ZA 4Y13A 3QOEA 4CZCA 2VOOA 2L9NA 1WJ5A 1JJ6C 3ISPA 2NOJB 4LG0B 2IJLA 4QSHA 1ETXA 2JPCA 4XKWA 5EF6A 4Q5SF 2A68F 2X6WA 2Y69H 3CC7I 2F4IA 3RKQA 3MFKA 4E7LA 1ZR2A 2K4JA 3HPGA 3K4NA 4IRIA 5F0HA 3CCVI 4XL9A 2JA8J 4BQQA 3AL0B 2LY2A 3ZMSA 5JLWA 1Y56A 2WV1A 1GVDA 1Y6IA 4BXXJ 1WH7A 2VJ5A 2L7ZA 3ZOBA 5JVGF 2RAEA 4OMYA 1JTYA 5H20A 4A12A 1JGSA 1X19A 1IO2A 3PSIA 1FBUA 2ECBA 3SZPA 1AKHA 3HGYA 5F6FA 1IRGA 2XAHA 4ITVA 2WY7Q 2QM3A 1H9TA 5IT9K 1HW2A 2DA2A 2KRFA 1O3QA 1K4TA 1IUYA 2JVGA 3W2VA 3R61A 2H27A 1U78A 2R7DA 4I99C 1NH3A 4KJZA 5CQGA 1GVJA 4V2GA 1VQ4I 2O9LA 3S1NJ 3FMQA 3WE2A 2JZYA 1J2XA 2KJCA 1WJBA 4A3BJ 1FC3A 2IT0A 4FX4A 5L3EA 1SFOJ 1O7FA 1SVLA 4G12A 4G6TB 4FE4A 4HQEA 4FTHA 3OYMA 3JRFA 2DQRA 4G8XA 2FEZA 3ZQCA 1IN4A 2QLZA 2P0WA 3BTCA 2L0KA 3AG2H 4NDLA 4XR6A 2DFFA 4A2UA 2HYFA 3ZPLA 1MBFA 1ZAOA 3AFHA 2VE9A 1K7AA 2ZJQF 4ZYHA 3VYRB 2R7WA 3MN2A 4PSWA 2E5ZA 1YI2I 3HB9A 2YS9A 3R4KA 4LLLA 4EMSA 1S3JA 2MW8A 1AWCA 4HNTA 2D1VA 3FBNB 4OU0A 4XQFA 4HLYA 2HDWA 4BEHA 1U5TA 4CO8A 1EA3A 4Y15A 5EZGA 4WX9A 3ZQGA 2EZHA 4HBLA 2K9NA 1PYVA 3S3NA 2OUMA 3L9FA 3FXUA 4H0EA 4IHTA 3ROUA 5GAGJ 3V7RA 1G8XA 3K70D 1BIBA 3HIFA 3CC2I 2EFNA 4KIFA 4DYQA 3WGGA 1SFEA 4KICA 2HZTA 5E3OA 2CV0A 3H0DA 5KK1A 3CDHA 3GFJA 3LSKA 3U21A 4MNUA 4JX6A 2M1BA 5FB2A 2JK3A 3CDLA 4LB5A 2MBFA 2QVOA 4HV6A 1AKHB 3E5UA 3EUKL 4NC7A 3K4MA 2CFXA 2BXYA 2OA4A 2V79A 2RNJA 4HF2A 3K4JA 2UWMA 4DIQA 3WG9A 2XKPA 3PO2J 2KRCA 2XV4S 6PAXA 2DA1A 3HUGB 3LA7A 1W5TA 4A69C 3VYTB 1O3TA 3F0CA 4M3BA 3HXLA 4R1HA 2XPUA 3WU1B 4X0GA 4XM3A 1Z6RA 2ZB9A 3AL0C 1SVOA 1MJ9A 4DQ2A 1EJ9A 5J1UA 2ZXIA 3CCUI 1S7OA 2LMDA 3ABLH 4G7ZF 3S3OA 3HM5A 3F6OA 3CZ6A 3GWZA 2DT6A 3K4LA 1K78B 3BR2A 2R7QA 3OIPA 3DU5A 3T5XA 4A5NA 1QNTA 3JRCA 2MH9A 5EG0A 1ON1A 5F04A 3DF8A 4A3GJ 2FNPA 4XLNF 5C4JJ 1HDPA 1T8IA 1Y8QB 1IN7A 3ZGKA 4BL0B 1MDMB 3A0BC 4DGWB 2ZSIB 3S1MJ 1AU7A 2O0YA 2QKMB 2ADUA 1W5CC 2WAQA 3IHUA 4UB6C 3L00A 5M3MJ 4CH7A 2EH3A 2BYVE 3PSFA 3ELKA 3O3KA 4XIDA 3SXYA 3TOAA 3SFIA 4AIHA 2PX9A 4DZPA 1KQ9A 1SMTA 1I6HJ 3QU6A 4P5OA 5E1ZB 3K1PA 4M9ZA 3HJEA 2BGCA 2MC4A 2VQGA 3OWTA 5E8GA 2ZKZA 5F64A 1JGGA 3E0JB 3BC8A 4M3GA 2HPMA 5LGUA 4G7OF 2BXZA 2DK8A 1QQIA 2HZDA 2PN6A 3RYPA 5B5EC 3K6GA 3GYHX 1D5VA 4GGGA 2JUCA 5HDKA 3A2KA 2XROA 2LF7A 1S5LC 3QQAA 5DCMA 4HDUA 2LKXA 3PJRA 3RPUD 3E5QA 2OD5A 3OL3A 1MBKA 2VC0A 2DXIA 2HOAA 1Z67A 1A6QA 3FF5A 2O8XA 2LP0A 2HU9A 1ONVA 4IO9F 1W5SA 2EZLA 2GIZA 2LSOA 3NEUA 2FXAA 3VSLA 1HCRA 3DEUA 5JLXA 4BNCA 2RC4A 3EETA 2DT5A 5C44J 4Q47A 4QLCU 1BR2A 3IL2A 1YTYA 1JT0A 1D0ZA 1OFCX 1XGSA 3V7SA 1Y0UA 2VPRA 1W1WE 2Q2EA 2PG4A 2LOOA 1SAXA 2ZCWA 2R3SA 2GIVA 2HDDA 5GP9A 3CP2A 4YIRX 2FX0A 3PIOF 3BR1A 2CFOA 2LNBA 3CCQI 1Z9CA 1ZTRA 2LY1A 1MKMA 3QAHA 3GF2A 3CF2A 1X1BA 5HODA 3Q5FA 4X1EA 4XKCA 5B66C 2FQ3A 4BBRJ 1DP7P 4I01A 3EYIA 1WVRA 2M8EA 1OCPA 2CW7A 5HLGA 5D6EA 2R5YA 3EUHC 5DM7F 3WGIA 1J5YA 3L2RA 3NAUA 3AKZA 1D1AA 1O3SA 2R7RA 3CLOA 4RB0A 1OMIA 3JRIA 3OS1A 2STTA 3COAC 3DV8A 3OOPA 2MD0A 4O3MA 2KIQA 1YJWI 2L7FP 3PQJA 1HLVA 4MHGA 3G1OA 5J47A 1WZ2A 1YFHA 2X0LA 2K3FA 4NHJA 4XONA 1V3FA 5CKTA 4KIBA 1IXCA 1YQAA 2QCOA 3G2BA 2P8TA 5F08A 3JRGA 4LD5A 4KISA 3OYFA 2KDZA 1GV2A 2EV5A 1MIJA 2V1XA 4C3IJ 2IRFG 1HKSA 1TLHB 3L09A 2BHZA 5JR3A 2G7HA 4GFBA 3BG7A 1YRNA 5C4XJ 2AXLA 3FX3A 4CCKA 3CCSI 1W36C 4A6EA 1DDNA 2BY2A 2XAFA 3ABMH 3BZCA 1VQ9I 2XPWA 1FWZA 2ZMEA 3DCFA 2OU2A 4V2FA 3QWLA 3JSPA 5KAIC 2WC2A 3G71I 1MBGA 3ZRGA 4S0HB 3BCBA 1FPQA 3BTJA 4IHWA 3SEQA 2HYJA 2LKPA 2KIUA 3WE3A 3S8PA 5EGOA 1IRZA 1S9HA 1Z91A 3HRMA 4BQNA 2PBIA 4RGSA 5LGNA 5DCFA 1F1ZA 5HLTA 4M6YA 2AQEA 1JJ8C 2X6YA 3T1BA 3HYIA 5J4YA 1R4MB 3S2WA 2HI3A 1APLC 4LIUA 1SVMA 2CYYA 2HGCA 4OAZA 1Q1VA 4AYBA 4K2EA 2F5DA 2HQAA 1EH6A 4XOTA 4CCNA 3MD2A 3PNTA 5CPRB 1X3UA 2FMYA 2O5RA 4GYGA 4MFEA 2TDXA 1UG2A 4HSTA 1HOMA 4BYYA 4A93J 5IT9Z 5BPIA 1FOWA 1V55H 1S29A 2CV1A 1E2XA 4F93B 3CMAI 4IHSA 3UNGC 1RUNA 4EVIA 3LL7A 3LSJA 3VWBA 2YR2A 3PIPF 3S16J 2LG4A 1P4WA 4NNJA 4IL6C 2ZSHB 2E34A 5H2FC 3L2VA 4KFCA 5BQTA 3FXOA 3HOZJ 2A6EF 1LVAA 4F52A 3KP4A 3CLQA 1S8NA 4XORA 4KT6A 2YSRA 3PFYA 4YELA 1O57A 2QQ9A 3HOSA 2L9RA 1DUXC 1C0WA 4B3XA 1PDNC 3LFKA 1TQPA 5CVJA 3VODA 1IN5A 4XLHA 4IJAA 1POGA 2VUMJ 4FETA 3DBLB 4HOBA 4R8HA 2R7TA 2ZO4A 2YPRA 2DA5A 5EEAA 3X2QH 1UCRA 2XASA 4F55A 3ZQIA 1XMKA 3CUQA 4J01A 1P9QC 2IEKA 1WI9A 4A6DA 3C3WA 3F21A 4LGWA 3FHZA 4A3LJ 4G6DA 1FZPB 2DTZA 2VXDA 5H6QA 4ESBA 3E7LA 4LLNA 2Y30A 3MQ0A 1VF9A 2DA4A 4UUSA 3JSOA 2NNYA 3DEWA 4MIMA 2IGNA 3ZMUA 2CQXA 1WJEA 4RB1A 3G4SI 2MD5A 1F9NA 2XGCA 4M3DA 3J7YJ 2Y75A 1RRJA 2CH0A 1MMAA 2R7XA 1R1TA 3IC7A 5B3SH 4MTDA 4BDYA 4GO1A 3K4KA 3OSGA 4N4NB 5A2QK 2JWTA 4NC6A 2XRNA 4HZFA 3E6DA 2NVYJ 4OMZA 1UHSA 1X1PA 1UG0A 4HF0A 4B47A 3T8RA 4HX4A 3LSGA 1H9GA 2A6HF 1Z7UA 3CCJI 2FJ1A 4AVZA 3SJMA 2H09A 3C2BA 5D6FA 3NWSA 3Q0UA 2E1MB 3CO7C 1GV5A 2BZTA 1HQCA 3L1PA 2QQ8A 3GZ5A 3K1NA 3LWFA 2LR8A 2ETHA 2XGXA 5J3LA 3DKYA 5FKNA 4IEJA 3J80Z 3BP8A 1JUSA 3DPLC 2IGOA 1HSJA 2O3FA 1B9MA 3O2PE 4UB8C 5E20A 1ZG3A 4ZH4F 2WTEA 1E17A 3I4MJ 2QSFX 5LRSA 2V9VA 4B1RA 1MMGA 3R0AA 2X48A 2M0MA 3C18A 3KEYA 2LBFB 5FLMJ 1CGPA 3FXLA 3KP3A 4JYKA 3G1LA 4M9XA 5GPCA 1FP1D 1K4SA 1LNWA 1BOBA 2X6OA 3HPHA 3U1KA 2O7OA 1LDKB 2R0QC 2QA4I 1Z7LA 5J1RA 2VKVA 3PUFA 4AC0A 1ZQ3P 3RIRA 5AONA 5EZHA 1MSEC 4JOMA 2CUJA 5FROA 2PMZA 2CU7A 3K4BA 2E35A 4ENNA 4EGYA 3K4CA 3J7ZI 2QQAA 3GMEA 3I53A 3ZMTA 4B3AA 1FBSA 1T38A 4D7MA 1I27A 1QVUA 5KHDA 3GTPJ 3QYFA 1CQTA 2VPLA 1XDUA 2EFQA 2H6CA 3GFLA 2NRAC 4U7DA 1YITI 5M5XJ 5LEKA 4A0YA 1MMSA 3ECHA 5JI6A 3V42A 1B8IA 4J00A 2Y2ZA 3WTXC 5HNHA 2PJRB 2Y0MA 1T95A 1R9TJ 1IRXA 4GYIA 4UUVA 1LFBA 4JK1X 1R23A 2MGQA 3RI4A 1LEAA 2QYOA 2A07F 2WA0A 2YUSA 2DFEA 3QYEA 4DW6A 4HNVA 3OYNA 1DPUA 1IDZA 4A3FJ 1K6YA 2BHYA 1GHCA 3EUHA 1D3YA 3TO6A 2X6XA 2Y9YA 3GXOA 4AD9A 2AS5F 3MVPA 3CMMA 1Z6TA 4KNYA 4CCMA 3B02A 3SDGA 1OQYA 3KIOA 2CW0F 4CSWA 1YW7A 2EINH 3GZNB 1BOAA 3CESA 4L0ZB 4BJ6C 4XLPF 1XB4A 4DOZA 4LMYA 4B43A 4NC8A 4OWRB 2XPVA 2KP6A 4PZJA 1TBXA 2EZKA 5IYBJ 2COBA 3I59B 3V8LA 3FXKA 2WAQN 2H6BA 4A3KJ 2DFHA 2K40A 5FLVA 3PFIA 3JREA 2JMWA 4WF2A 4NBQA 3K1MA 1EH8A 1ETQA 3CCEI 1R58A 2CO5A 2NVUB 2VKDA 3WG7H 1I6XA 4HG2A 1B59A 1VI0A 3ASNH 2Y9ZA 2P7VB 3H1CA 1JUMA 1QPIA 3M8EA 3S2DJ 1OJLA 1MJAA 1IV6A 1ETWA 5EDNA 4P55A 1ZG5A 5JHUA 2NVXJ 3I54A 4IHYA 1KQ8A 2DDAA 1BI1A 1MH4A 3NARA 5ILSA 3VPRA 2R7VA 1AHDP 2LH9A 2VIXA 3R60A 5GAEJ 3BTIA 5FGMA 1WPKA 4O6JA 2DYRH 1TW3A 1IRFA 3VOEA 4OIOF 2QENA 5CJ9A 2KDOA 3BJOA 3HSEA 4M74A 2XIGA 2UZKA 4IZZA 3EPZA 2K85A 2DMPA 3CD6I 2VKHA 4II3A 5M5WJ 2V26A 3H0GJ 1FOYA 1QU3A 2L7MP 4DNCA 4N9HA 1D5YA 4G94A 1H88C 4A3JJ 3P5JA 1YS7A 3HC7A 3K10A 5CVVA 1FYKA 2BE5F 2OCEA 2X4HA 4PGHA 4YRVA 5D8LB 2M34A 5DV5A 5EJCA 3LA2A 1B72A 2CV2A 4PJJA 3HKZA 2M5WA 4Y17A 2EQRA 2VI6A 3PUBA 1VQMI 4E7JA 2K5CA 2CGPA 4GDFA 3K0LA 3BZKA 1LDJA 5E17F 1DQUA 1NK2P 4XLAA 3TMOA 2M0CA 4PJNA 2DQLA 4PSXA 2VBXA 1ETVA 3BLYA 1JKOC 2RREA 2OC6A 3ZQLA 3SEZA 4UVCA 4RA2A 4XLEA 3TKYA 3CQZJ 1SFXA 4HAMA 2A3SA 1MD0A 2M4KA 1DU0A 1HKTA 4P96A 1XMAA 3OS2A 2FOKA 1V54H 2CSOA 1UJ8A 3I0TA 2F2EA 4LG0A 2W25A 4CICA 1X2MA 1FNNA 4PFPA 3OYKA 3CO6C 4L5IA 4BBSJ 4WWCA 2AQFA 4I0AA 4KMFA 4UVBA 5H6RA 2C6YA 1G3YA 1IW7F 3RKXA 5AIQA 4XOPA 1OYIA 5TISC 3OYBA 4C3HJ 3BG6A 3BDDA 3ZCOA 1KA8A 1Y0NA 4Q4ZF 1TNTA 3ASOH 2LKSA 4HPQA 2KRHA 4AIDA 2Y48A 1XSXA 3MMYB 4ON0A 1JKRC 2HQNA 4H4KC 4D0PA 4BJ5C 2LD5A 4ZDLA 1TTYA 1G3TA 1TWCJ 1XG1A 3W6JB 3BJ6A 2WADA 1LKXA 3GZ6A 2DPDA 2Y0SN 5K5OA 3SFZA 3EYYA 4KA4A 2ZFWA 4EJWA 1P6RA 1G6NA 1UHMA 3IAM2 1OR7A 5HVQC 1I1GA 4WXCA 1EF4A 2MLGA 3HUGA 2WBMA 2LYCA 4FX0A 2VLAA 1A04A 4ABZA 1A31A 1QO0D 2YU9J 1Z0XA 5FKKA 4W97A 4AUXA 5BMZA 3EDPA 3CJNA 3M07A 1T0FC 3MKLA 2E60A 1D1BA 5IP6A 2EIKH 2XVCA 3CF5F 2ACJA 3D5RC 2BEOA 2E1NA 1BM9A 2MH2A 4LK0F 1G2HA 5F1JA 2W85A 4QPOA 3FKIJ 3RPUA 3EUAA 3M3YJ 2FRHA 1LB2A 1RI7A 1PUFA 2GQQA 1LQ1A 1T6SA 2GZWA 2L7KA 4NQWA 1E3OC 1VQKI 1BR1A 5TGTA 4WK8F 3KYDB 4I09A 5D5WB 5IT3A 3BTLA 3KZZA 3H9JA 3L2CA 2M87A 1B6AA 3J7AY 3L7WA 2IAIA 1N75A 1PJRA 2ME6A 4KDPA 4F3QA 4YFNF 4EJTA 4CUGA 5K5RA 1JTXA 4E70A 3R0JA 1SANA 2IGMA 4WXHA 2E2IJ 4P9UA 3JRDA 1P7IA 3A02A 2PMUA 5EEHA 2CQQA 3GFIA 5L3BA 1PUEE 5FD6A 4L5JA 5ILUA 2PFBA 3WTYC 2XGDA 3ONQA 3M9AA 1A6IA 4L9VA 1FBQA 1ZGAA 2BOLA 2E7XA 2QSHX 1LFUP 2HKXA 3DKXA 2DOAA 4LK1F 3FK7A 5EYRA 3V7CA 2EFWA 4YIIA 4OIQF 1QRYA 4HEA2 5F0FA 4BKXA 1IZ1A 2VBYA 4D9JA 3L2QA 1PUFB 2VASA 5EG0B 1ETYA 3O8HA 2STWA 2QKLB 1U8BA 1REPC 4YIFA 3ESWB 4QTRA 2HOEA 2LDUA 4C9YA 3REOA 2K3PA 2X1CA 3P9KA 3OYIA 1XD7A 2G9WA 1ORKA 3IRRA 4XKVA 1VQ7I 4KYWA 3S14J 3BR6A 2AXTC 1VQ5I 2A61A 2UXNA 4X6AJ 1MMNA 3BG9A 5DS9A 1JHHA 4AIKA 2JSPA 4IX7A 2VOPA 2LBFA 1N78A 4E7SA 2FOWA 3QOPA 2DK5A 3PNVA 2WWYA 1HF0A 1TP4A 4BY7J 4LOCA 3C2HA 3LMMA 2NVQJ 4CCOA 4D5CA 1T08B 4DBQA 5HLHA 3CUOA 1VQ8I 4U87A 2F4OB 3FXQA 3S1RJ 3D5LA 1BA5A 2XB5A 1KU7A 3ULQB 4RAYA 5TJJA 4CYCA 4U0YA 1K6OA 4Y33A 4ZDOA 1ULYA 4I2OA 1TQMA 4IPAA 2ICWG 3PM1A 3H3VK 4N4OB 5LBQA 2K9SA 2ME0A 4EJUA 1H0MA 4XICA 1K78A 3LQQA 3LSIA 3KETA 1YX5A 5J8FA 3OYJA 3UKGA 4S05A 1BI0A 2NOGA 2DMNA 3GTKJ 5BNGA 1LE8B 2VE8A 5K5QA 1QVTA 2BV6A 4M6XA 5FD5A 2O8KA 4PGGA 1LVKA 2L9SA 1KYWA 2B9SA 1WSUA 1RUOA 2X51A 4FT8A 2FSWA 2M3AA 5ILVA 4F92B 2K9LA 4PUSA 3S93A 4EM2A 4KT5C 2ZXJA 4IRHA 4A5MA 4BE1A 3WU0A 3WTTC 1R22A 2I8DA 3MKYB 2EIMH 1RESA 3WTSC 2EV6A 3K2AA 1XN7A 3HBLA 2BBYA 2L5QA 5FKOA 3KP6A 4M3EA 5K7HA 2NNNA 2HR3A 2W57A 3GVAA 5DD4A 3MCZA 2P5KA 3ERED 2A05A 1MGTA 2D1HA 3I9V2 4U0VA 5J4VA 1WH5A 1U3EM 5EEGA 1IC8A 3DWLE 2FMLA 3FHNA 1X58A 4XLFA 1BI2A 3BR5A 1ZREA 5C3EJ 1TW2A 4CDGA 2X1DA 4EJOA 1ITYA 2R4GA 3GTGJ 5D5XB 5F27A 2IBDA 2ZJPF 3KCCA 2KHMA 2OV7A 4Z2YA 1NTCA 1X3WB 4XLCA 2YX4A 2XRLA 2E1OA 2PI0A 4GXOA 2VQLA 2V6EA 1BJAA 3WU2C 2EK5A 2HVRA 3BJAA 5K7ZA 4PK4A 5LLQA 1DPRA 3CJTB 4C30A 1U0JA 5CVUA 4XKBA 1MNDA 3H36A 2F4MB 2R7FA 3E5XA 1MJBA 3RJPA 1T98A 4M73A 1F5TA 1DGRM 4ESJA 3I3LA 2LTPA 3Q9VA 3H9GA 2NS7A 1FIPA 3LSTA 2MABA 4BDZA 2B0LA 2OCCH 1B1BA 3BROA 4MO7A 2JTVA 4KUMA 3IKVA 4HNUA 4BHCA 2OTLI 3LSMA 2A5WA 1FSEA 2QBYA 2DU9A 5FRMA 3TL4X 3TO7A 3BQZA 4CGZA 2K86A 4WXDA 2BY3A 3FMRA 2AO9A 4XBFA 4B4CA 3RQ4A 2P6TA 2QQBA 2JN6A 1T0FA 4ENMA 2LREA 5CVRA 4DBRA 4MQVA 1IN8A 4I98B 5M5YJ 4N9IA 1LPQA 3GBGA 5TRDA 2JJ7A 2KZGA 5LHGA 2XHKA 4ZJZA 3HOWJ 2O6GE 3KEQA 3SZTA 1IN6A 2OF7A 2XB0X 5FJ8J 1R1VA 4OIPF 3JAMK 3JTGA 4L9NA 1U9OA 2CUEA 3QYBA 5GADJ 5ICCA 1HXDA 3CCRI 3CDIA 4RAGA 1VQ6I 1RR7A 2KT0A 2FA5A 3TP0A 4HA8A 4KN7X 3GLLA 3KYCB 4ZYAA 1MMDA 1VNDA 2XKOA 1NG7A 1YS6A 3MEXA 4I7HA 2VJIA 4RM3A 2P5VA 4BHBA 4I0BA 5D5VB 2CQ7A 2HOSA 3O8GA 3RQIA 2PEXA 4ZYDA 3AAFA 1Z1DA 3AG1H 3FM3A 1X3ZB 3F8MA 2XDVA 5IY5H 2M7AA 4KITB 2LFBA 3DP7A 3WGHA 1OLTA 1RZ4A 5HOOA 1B9NA 1LFPA 4IRGA 3P9IA 2QEXI 2JRMA 4S04A 3F8FA 2M45A 3J81K 4ZYGA 1G4DA 2XF5A 1RNLA 1YOVB 2R7UA 5HDNA 5CLSA 3A01A 5F0CA 3IP4B 4ETSA 1YLFA 2HOTA 2CUFA 3G6EI 5FO5A 3OR2C 3TGNA 4RM2A 3OYDA 4HSRA 2JSCA 4XK4A 1EV7A 5IOZA 1O7LA 5LD2C 2IVMA 2LF8A 3DQVC 3T0YA 3OYEA 3FXRA 3WTVC 4KIGA 3KEOA 1A36A 1A5JA 3FZVA 2VT2A 1XS9A 3CMEI 3KFWX 1K61A 1J0RA 3I64A 1WGXA 2KZVA 3JRHA 1KONA 5GPAA 1AA7A 5FKLA 1B8IB 2ZXWH 1PVEA 1ZH5A 2ELJA 2E5NA 1OCTC 5ERIA 2L3DA 3F22A 2HYGD 3OYAA 5B1AH 1Z3YA 3C2GA 2M8GX 2XAGA 4HW0A 3I59A 3H5NA 4G7HF 1TNSA 3BT9A 3HTUA 5E18F 4AM3A 2Q1ZB 2FQ4A 1TC3C 3ECOA 2W1OA 2QWWA 2R7OA 4QWQA 4J19A 1FX7A 2W84A 3S3MA 2IA0A 3OYCA 3HOUJ 4XN0A 1V4RA 4RDUA 1TT5B 4EM0B 3VYUB 4FASD 3PO3J 4QIWN 4RGXA 1XX5A 3C7JA 2E1MC 1TWGJ 3GFMA 3NWTA 3J7AO 2IS2A 1MW7A 2W7NA 4JX5A 2FU4A 3E6BA 1GDTA 2TCTA 1YRNB 4F7ZA 4LIVA 1H8AC 1R5GA 2H1LA 4B44A 1E0EA 1IV8A 3JRBA 3W3CA 3WTUC 1T39A 3ERMA 4ENKA 2CG4A 4C2TA 1GXPA 2Y0SA 1ZK8A 2L9VA 4CCLA 4FHTA 2JQ7A 1FOXA 1YYVA 2GA2A 3IH2A 2DJNA 1FTZA 4XRMA 4UXNA 2R5ZA 4B48A 3LA3A 3AG4H 4ZZLA 1VFCA 2E2JJ 1P2FA 3MZ8A 3GEZA 1YIJI 2IS1A 2WB1N 2VONA 4UUSB 4UY8I 2P6SA 2KFDA 3KP5A 4P1WA 3BZ6A 1U5TC 1W7PA 3HSRA 4AYBN 2ZBKA 3CMYA 3S2HJ 2GM4A 1KU9A 3OL4A 5BPDA 3LQRA 1MBHA 1SD7A 2FBKA 1KQ0A 3DTIA 2HNHA 3CC4I
chains in the Genus database with same CATH topology
1MBKA 3IH3A 2LK2A 4C3HJ 2HOAA 3S15J 2GBYA 2GLOA 3FK6A 1MBEA 2LP0A 3Q0VA 5IP7J 2EZLA 1JKQC 4DZJA 3BQYA 1HCRA 5JLXA 2DA6A 5C44J 4A3IJ 1JT0A 1JKRC 1OFCX 2LD5A 2VPRA 1TWCJ 2CRGA 1XG1A 2Y0SN 2HDDA 1P7JA 5GP9A 2ID3A 2FX0A 2HQ5A 4UUTA 1U9NA 3BR1A 5K7FA 1ZTRA 2NVTJ 1EF4A 2ID6A 1WI3A 5HODA 4ABZA 4X1EA 3WHCA 2YU9J 3LNQA 3W6VA 1Z0XA 4BBRJ 5FKKA 4W97A 4AUXA 3HDDA 1OCPA 2DMQA 3I4NJ 3MKLA 2R5YA 2XGEA 5IP6A 1BW6A 3NAUA 1Z77A 1FIAA 3IH4A 2R93J 1G2HA 5F1JA 3FKIJ 2MSYA 3JRIA 4C3JJ 3M3YJ 1PUFA 3D1NI 1E3OC 3GTJJ 1ZKGA 2L7FP 2EBIA 4D5FA 1HLVA 3G1OA 1F36A 4M3FA 1IDYA 1MH3A 1BL0A 3BTLA 2B63J 2JA5J 4A3EJ 2QCOA 3M4OJ 3S1QJ 5F08A 3JRGA 2IAIA 2ME6A 3HOVJ 4FE7A 2KDZA 1GV2A 4C3IJ 1Y1VJ 4GFBA 5IPAA 1YRNA 1JTXA 2Y31A 5E3NA 5C4XJ 1SANA 3HGGA 4DYCA 3FIWA 9ANTA 2E2IJ 3JRDA 1P7IA 3A02A 3BG3A 2CQQA 1BW5A 3GTQJ 2XSDC 1O4XA 2XPWA 2XGDA 1Y1WJ 3DCFA 4V2FA 1ETKA 2QF7A 3TW6A 1A6IA 3HEFA 1B72B 2LLKA 1MBGA 4S0HB 1LFUP 3BTJA 4IHWA 2LY9A 3QPSA 3FK7A 5EYRA 2HYJA 5EGOA 3Q0WA 1IRZA 1QRYA 1JKPC 1FTTA 5F0FA 4BKXA 3ZQFA 1W0TA 1PUFB 1H89C 1JJ8C 5EG0B 1ETYA 3O8HA 1TWFJ 1U8BA 1GUUA 2HI3A 1APLC 4QTRA 1Q1VA 3WHBA 2D5VA 2DN0A 1ORKA 3S14J 3BR6A 5IYDJ 2DA3A 4X6AJ 1IG7A 3BG9A 5DS9A 2I10A 1NK3P 4FISA 2ECCA 4MFEA 1HF0A 1UG2A 4BY7J 1HOMA 4LOCA 4L5EA 4A93J 4MFDA 2NVQJ 1X2NA 4D5CA 3LSJA 2LVSA 3S16J 4MLOA 3S1RJ 4Y7NJ 1BA5A 2XB5A 4CYCA 1MBJA 3HOZJ 2E2HJ 1RETA 3PM1A 2H1KA 3H3VK 3FISA 1DU6A 2K9SA 2ME0A 1F43A 5DTDA 2L9RA 1I3QJ 4XICA 3RZOJ 3UKGA 2NOGA 2DMNA 1POGA 3TEDA 1IJWC 3GTKJ 2VUMJ 5BNGA 1LE8B 1QVTA 3HOXJ 5EGOB 2JA6J 1K83J 3BR0A 2O8KA 3OIOA 5J1YA 2DA5A 5EEAA 3ZQIA 2TRTA 2DA7A 1ENHA 2IEKA 2OPTA 2W48A 3B6AA 3TW7A 4A3LJ 2DTZA 5FKMA 1I50J 3E7LA 2Y30A 5E3LA 3A01B 1VF9A 2DA4A 4UUSA 4IHXA 3DEWA 4MIMA 2CQXA 2R5ZB 1TWAJ 4C2MJ 2XGCA 4M3DA 1RESA 3K2AA 3HBLA 2P81A 5FKOA 4M3EA 3ZQHA 3LOCA 5K7HA 3OSGA 3HKZN 2JWTA 2EZIA 2NVYJ 1UHSA 3K7AJ 4XRSA 3LSGA 1WH5A 2AHQA 1IC8A 1X58A 2PMZN 4RBOA 2DMUA 3BR5A 2FJ1A 5C3EJ 3SJMA 3GTLJ 1ITYA 1LE8A 3C2BA 3GTGJ 5F27A 1UMQA 3Q3SA 3Q0UA 4D7NA 2IBDA 2H8RA 1GV5A 1NTCA 2R7ZJ 3L1PA 2XRLA 2E1OA 1S7EA 2LR8A 1XC5A 5J3LA 5K7ZA 3HOYJ 5FKNA 4IEJA 2MG4A 1JUSA 5M3FJ 2N8GA 2M2EA 1JUPA 1JJ6C 4QSHA 1ETXA 3I4MJ 4B1RA 5EF6A 2X48A 3JR9A 2VKEA 2LTPA 3RKQA 2NS7A 1ZR2A 1FIPA 5FLMJ 4W1UA 3QPLA 5F0HA 2JA8J 4JYKA 2M9HA 3G1LA 5GPCA 1IUFA 4MO7A 5JLWA 2X6OA 4CYCB 2WV1A 1GVDA 2O7OA 4BXXJ 1WH7A 1RKTA 2FD5A 2R0QC 2L7ZA 3BQZA 3ZOBA 5J1RA 2AO9A 2RAEA 4B4CA 1JTYA 2VKVA 4AC0A 2JN6A 1AKHA 2ECBA 3HGYA 1ZGWA 5M5YJ 1ZQ3P 5EZHA 1MSEC 3GBGA 2JJ7A 2CU7A 2DA2A 3CCYA 3HOWJ 1JT6A 2OF7A 2XB0X 1U78A 5FJ8J 1U9OA 2CUEA 4B3AA 4V2GA 4D7MA 1RR7A 1QVUA 2KT0A 2O9LA 3S1NJ 3GTPJ 3TP0A 1CQTA 4Y52J 5M5XJ 4BY1J 4A3BJ 1VNDA 2CJJA 1SFOJ 1B8IA 4G12A 4FE4A 4FTHA 2Y2ZA 2R5YB 2HOSA 3O8GA 3RQIA 3JRFA 1TWHJ 3BG5A 3LSRA 2HXIA 1R9TJ 3ZQCA 3BTCA 2L0KA 1LFBA 1GT0C 4NDLA 2LFBA 2R92J 2MGQA 1MBFA 2YUSA 4DW6A 4HNVA 4XRSG 3MN2A 1IDZA 3HB9A 2YS9A 4A3FJ 3A01A 5F0CA 2MW8A 2HOTA 2Y9YA 2HXOA 2CUFA 3MVPA 4I76A 4A3CJ 3GTOJ 1WCMJ 3SDGA 2NS8A 4XK4A 5EZGA 5IOZA 3ZQGA 2EZHA 1RPWA 2K9NA 5IYCJ 4M6VA 4I6ZA 1MSFC 1A5JA 2E19A 2XPVA 2K9QA 2X9DA 1XS9A 4DYQA 2EZKA 5IYBJ 1K61A 2COBA 5E3OA 1WGXA 5IP9J 2WAQN 4A3KJ 3JRHA 4JX6A 2JK3A 2K40A 3CDLA 5GPAA 4FCYA 1BJZA 3S17J 2DMTA 5FLVA 1AKHB 4EEFG 2JMWA 3JREA 1ZR4A 5FKLA 1B8IB 1ETOA 3JRAA 1FEXA 1ETQA 4A3MJ 1OCTC 5IOYA 3PO2J 1VI0A 4A3DJ 2Y9ZA 1JUMA 1QPIA 2DA1A 2M8GX 3OSFA 3S2DJ 1OJLA 1IV6A 1ETWA 4A69C 5EDNA 3F0CA 3A03A 3BT9A 3BR3A 4M3BA 1FJLA 2ELKA 2XPUA 2NVXJ 1IGNA 4IHYA 2FQ4A 3NARA 1MH4A 2ZB9A 1TC3C 3RZDJ 5J1UA 4J19A 3VPRA 1AHDP 3B6CA 3BTIA 2G0EA 3HOUJ 3HM5A 4RDUA 3PO3J 1WPKA 4QIWN 4IHVA 3GTMJ 1TWGJ 3BR2A 1MNMC 2JA7J 5E3MA 4JX5A 3LSPA 3OOUA 2DMPA 3JRCA 1GDTA 2TCTA 1YRNB 1W0UA 5EG0A 5F04A 3TP3A 1H8AC 4A3GJ 4DYRA 5C4JJ 5M5WJ 1HDPA 3H0GJ 3JRBA 2L7MP 1D5YA 1H88C 4A3JJ 3S1MJ 1AU7A 1RKWA 1ZK8A 2M34A 1T56A 1B72A 5M3MJ 2EQRA 2EH3A 2VI6A 3IH2A 2DJNA 1FTZA 4XRMA 4XIDA 1NK2P 3SFIA 2R5ZA 2M0CA 4DZPA 1HDDC 1I6HJ 1ETVA 3G1MA 1VFCA 1JKOC 2E2JJ 3ZQLA 2WB1N 3CQZJ 4UUSB 1JGGA 4JX4A 1DU0A 4M3GA 4AYBN 3CMYA 3S2HJ 2GM4A 1X2MA 1T33A 4BBSJ 1MBHA 3IV5A 4JP0A 2LKXA 3QQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBK A;  3IH3 A;  2LK2 A;  4C3H J;  2HOA A;  3S15 J;  2GBY A;  2GLO A;  3FK6 A;  1MBE A;  2LP0 A;  3Q0V A;  5IP7 J;  2EZL A;  1JKQ C;  4DZJ A;  3BQY A;  1HCR A;  5JLX A;  2DA6 A;  5C44 J;  4A3I J;  1JT0 A;  1JKR C;  1OFC X;  2LD5 A;  2VPR A;  1TWC J;  2CRG A;  1XG1 A;  2Y0S N;  2HDD A;  1P7J A;  5GP9 A;  2ID3 A;  2FX0 A;  2HQ5 A;  4UUT A;  1U9N A;  3BR1 A;  5K7F A;  1ZTR A;  2NVT J;  1EF4 A;  2ID6 A;  1WI3 A;  5HOD A;  4ABZ A;  4X1E A;  3WHC A;  2YU9 J;  3LNQ A;  3W6V A;  1Z0X A;  4BBR J;  5FKK A;  4W97 A;  4AUX A;  3HDD A;  1OCP A;  2DMQ A;  3I4N J;  3MKL A;  2R5Y A;  2XGE A;  5IP6 A;  1BW6 A;  3NAU A;  1Z77 A;  1FIA A;  3IH4 A;  2R93 J;  1G2H A;  5F1J A;  3FKI J;  2MSY A;  3JRI A;  4C3J J;  3M3Y J;  1PUF A;  3D1N I;  1E3O C;  3GTJ J;  1ZKG A;  2L7F P;  2EBI A;  4D5F A;  1HLV A;  3G1O A;  1F36 A;  4M3F A;  1IDY A;  1MH3 A;  1BL0 A;  3BTL A;  2B63 J;  2JA5 J;  4A3E J;  2QCO A;  3M4O J;  3S1Q J;  5F08 A;  3JRG A;  2IAI A;  2ME6 A;  3HOV J;  4FE7 A;  2KDZ A;  1GV2 A;  4C3I J;  1Y1V J;  4GFB A;  5IPA A;  1YRN A;  1JTX A;  2Y31 A;  5E3N A;  5C4X J;  1SAN A;  3HGG A;  4DYC A;  3FIW A;  9ANT A;  2E2I J;  3JRD A;  1P7I A;  3A02 A;  3BG3 A;  2CQQ A;  1BW5 A;  3GTQ J;  2XSD C;  1O4X A;  2XPW A;  2XGD A;  1Y1W J;  3DCF A;  4V2F A;  1ETK A;  2QF7 A;  3TW6 A;  1A6I A;  3HEF A;  1B72 B;  2LLK A;  1MBG A;  4S0H B;  1LFU P;  3BTJ A;  4IHW A;  2LY9 A;  3QPS A;  3FK7 A;  5EYR A;  2HYJ A;  5EGO A;  3Q0W A;  1IRZ A;  1QRY A;  1JKP C;  1FTT A;  5F0F A;  4BKX A;  3ZQF A;  1W0T A;  1PUF B;  1H89 C;  1JJ8 C;  5EG0 B;  1ETY A;  3O8H A;  1TWF J;  1U8B A;  1GUU A;  2HI3 A;  1APL C;  4QTR A;  1Q1V A;  3WHB A;  2D5V A;  2DN0 A;  1ORK A;  3S14 J;  3BR6 A;  5IYD J;  2DA3 A;  4X6A J;  1IG7 A;  3BG9 A;  5DS9 A;  2I10 A;  1NK3 P;  4FIS A;  2ECC A;  4MFE A;  1HF0 A;  1UG2 A;  4BY7 J;  1HOM A;  4LOC A;  4L5E A;  4A93 J;  4MFD A;  2NVQ J;  1X2N A;  4D5C A;  3LSJ A;  2LVS A;  3S16 J;  4MLO A;  3S1R J;  4Y7N J;  1BA5 A;  2XB5 A;  4CYC A;  1MBJ A;  3HOZ J;  2E2H J;  1RET A;  3PM1 A;  2H1K A;  3H3V K;  3FIS A;  1DU6 A;  2K9S A;  2ME0 A;  1F43 A;  5DTD A;  2L9R A;  1I3Q J;  4XIC A;  3RZO J;  3UKG A;  2NOG A;  2DMN A;  1POG A;  3TED A;  1IJW C;  3GTK J;  2VUM J;  5BNG A;  1LE8 B;  1QVT A;  3HOX J;  5EGO B;  2JA6 J;  1K83 J;  3BR0 A;  2O8K A;  3OIO A;  5J1Y A;  2DA5 A;  5EEA A;  3ZQI A;  2TRT A;  2DA7 A;  1ENH A;  2IEK A;  2OPT A;  2W48 A;  3B6A A;  3TW7 A;  4A3L J;  2DTZ A;  5FKM A;  1I50 J;  3E7L A;  2Y30 A;  5E3L A;  3A01 B;  1VF9 A;  2DA4 A;  4UUS A;  4IHX A;  3DEW A;  4MIM A;  2CQX A;  2R5Z B;  1TWA J;  4C2M J;  2XGC A;  4M3D A;  1RES A;  3K2A A;  3HBL A;  2P81 A;  5FKO A;  4M3E A;  3ZQH A;  3LOC A;  5K7H A;  3OSG A;  3HKZ N;  2JWT A;  2EZI A;  2NVY J;  1UHS A;  3K7A J;  4XRS A;  3LSG A;  1WH5 A;  2AHQ A;  1IC8 A;  1X58 A;  2PMZ N;  4RBO A;  2DMU A;  3BR5 A;  2FJ1 A;  5C3E J;  3SJM A;  3GTL J;  1ITY A;  1LE8 A;  3C2B A;  3GTG J;  5F27 A;  1UMQ A;  3Q3S A;  3Q0U A;  4D7N A;  2IBD A;  2H8R A;  1GV5 A;  1NTC A;  2R7Z J;  3L1P A;  2XRL A;  2E1O A;  1S7E A;  2LR8 A;  1XC5 A;  5J3L A;  5K7Z A;  3HOY J;  5FKN A;  4IEJ A;  2MG4 A;  1JUS A;  5M3F J;  2N8G A;  2M2E A;  1JUP A;  1JJ6 C;  4QSH A;  1ETX A;  3I4M J;  4B1R A;  5EF6 A;  2X48 A;  3JR9 A;  2VKE A;  2LTP A;  3RKQ A;  2NS7 A;  1ZR2 A;  1FIP A;  5FLM J;  4W1U A;  3QPL A;  5F0H A;  2JA8 J;  4JYK A;  2M9H A;  3G1L A;  5GPC A;  1IUF A;  4MO7 A;  5JLW A;  2X6O A;  4CYC B;  2WV1 A;  1GVD A;  2O7O A;  4BXX J;  1WH7 A;  1RKT A;  2FD5 A;  2R0Q C;  2L7Z A;  3BQZ A;  3ZOB A;  5J1R A;  2AO9 A;  2RAE A;  4B4C A;  1JTY A;  2VKV A;  4AC0 A;  2JN6 A;  1AKH A;  2ECB A;  3HGY A;  1ZGW A;  5M5Y J;  1ZQ3 P;  5EZH A;  1MSE C;  3GBG A;  2JJ7 A;  2CU7 A;  2DA2 A;  3CCY A;  3HOW J;  1JT6 A;  2OF7 A;  2XB0 X;  1U78 A;  5FJ8 J;  1U9O A;  2CUE A;  4B3A A;  4V2G A;  4D7M A;  1RR7 A;  1QVU A;  2KT0 A;  2O9L A;  3S1N J;  3GTP J;  3TP0 A;  1CQT A;  4Y52 J;  5M5X J;  4BY1 J;  4A3B J;  1VND A;  2CJJ A;  1SFO J;  1B8I A;  4G12 A;  4FE4 A;  4FTH A;  2Y2Z A;  2R5Y B;  2HOS A;  3O8G A;  3RQI A;  3JRF A;  1TWH J;  3BG5 A;  3LSR A;  2HXI A;  1R9T J;  3ZQC A;  3BTC A;  2L0K A;  1LFB A;  1GT0 C;  4NDL A;  2LFB A;  2R92 J;  2MGQ A;  1MBF A;  2YUS A;  4DW6 A;  4HNV A;  4XRS G;  3MN2 A;  1IDZ A;  3HB9 A;  2YS9 A;  4A3F J;  3A01 A;  5F0C A;  2MW8 A;  2HOT A;  2Y9Y A;  2HXO A;  2CUF A;  3MVP A;  4I76 A;  4A3C J;  3GTO J;  1WCM J;  3SDG A;  2NS8 A;  4XK4 A;  5EZG A;  5IOZ A;  3ZQG A;  2EZH A;  1RPW A;  2K9N A;  5IYC J;  4M6V A;  4I6Z A;  1MSF C;  1A5J A;  2E19 A;  2XPV A;  2K9Q A;  2X9D A;  1XS9 A;  4DYQ A;  2EZK A;  5IYB J;  1K61 A;  2COB A;  5E3O A;  1WGX A;  5IP9 J;  2WAQ N;  4A3K J;  3JRH A;  4JX6 A;  2JK3 A;  2K40 A;  3CDL A;  5GPA A;  4FCY A;  1BJZ A;  3S17 J;  2DMT A;  5FLV A;  1AKH B;  4EEF G;  2JMW A;  3JRE A;  1ZR4 A;  5FKL A;  1B8I B;  1ETO A;  3JRA A;  1FEX A;  1ETQ A;  4A3M J;  1OCT C;  5IOY A;  3PO2 J;  1VI0 A;  4A3D J;  2Y9Z A;  1JUM A;  1QPI A;  2DA1 A;  2M8G X;  3OSF A;  3S2D J;  1OJL A;  1IV6 A;  1ETW A;  4A69 C;  5EDN A;  3F0C A;  3A03 A;  3BT9 A;  3BR3 A;  4M3B A;  1FJL A;  2ELK A;  2XPU A;  2NVX J;  1IGN A;  4IHY A;  2FQ4 A;  3NAR A;  1MH4 A;  2ZB9 A;  1TC3 C;  3RZD J;  5J1U A;  4J19 A;  3VPR A;  1AHD P;  3B6C A;  3BTI A;  2G0E A;  3HOU J;  3HM5 A;  4RDU A;  3PO3 J;  1WPK A;  4QIW N;  4IHV A;  3GTM J;  1TWG J;  3BR2 A;  1MNM C;  2JA7 J;  5E3M A;  4JX5 A;  3LSP A;  3OOU A;  2DMP A;  3JRC A;  1GDT A;  2TCT A;  1YRN B;  1W0U A;  5EG0 A;  5F04 A;  3TP3 A;  1H8A C;  4A3G J;  4DYR A;  5C4J J;  5M5W J;  1HDP A;  3H0G J;  3JRB A;  2L7M P;  1D5Y A;  1H88 C;  4A3J J;  3S1M J;  1AU7 A;  1RKW A;  1ZK8 A;  2M34 A;  1T56 A;  1B72 A;  5M3M J;  2EQR A;  2EH3 A;  2VI6 A;  3IH2 A;  2DJN A;  1FTZ A;  4XRM A;  4XID A;  1NK2 P;  3SFI A;  2R5Z A;  2M0C A;  4DZP A;  1HDD C;  1I6H J;  1ETV A;  3G1M A;  1VFC A;  1JKO C;  2E2J J;  3ZQL A;  2WB1 N;  3CQZ J;  4UUS B;  1JGG A;  4JX4 A;  1DU0 A;  4M3G A;  4AYB N;  3CMY A;  3S2H J;  2GM4 A;  1X2M A;  1T33 A;  4BBS J;  1MBH A;  3IV5 A;  4JP0 A;  2LKX A;  3QQA A; 
#chains in the Genus database with same CATH topology
 3A4C A;  3W2A A;  4V19 K;  2LK2 A;  4MGR A;  2QZ8 A;  3AG3 H;  3S15 J;  1KGS A;  5DD8 A;  4ZTJ A;  2GLO A;  4BUP A;  1S7A A;  3FK6 A;  4B09 A;  3F6V A;  5IP7 J;  2KIS A;  1JKQ C;  3QPH A;  3BQY A;  1P92 A;  1WJD A;  4DZJ A;  1YO5 C;  1SMY F;  2DA6 A;  4A3I J;  4FQG A;  1UHW A;  1R1U A;  3K69 A;  1QZZ A;  2GXG A;  2VQH A;  1U2W A;  5HS8 A;  1UB9 A;  2EFO A;  5CVI A;  1P7J A;  2KL4 A;  1FYL A;  1IF1 A;  2ID3 A;  2FNA A;  2K4B A;  2HQ5 A;  1KZH A;  3F3X A;  4UUT A;  2Z1D A;  1CF7 A;  2NVT J;  1R4N B;  2HPI A;  3HL2 A;  4XSZ F;  1NG6 A;  1E3H A;  1WI3 A;  4P9F A;  1P4A A;  3WHC A;  2L01 A;  3W6V A;  4NQW B;  2ZME B;  1WHU A;  2VN2 A;  3KZI C;  3HDD A;  5L3C A;  2DMQ A;  5ICF A;  4HYE A;  1MDM A;  3I4N J;  1FSH A;  4A0Z A;  1BC8 C;  2XGE A;  3T8T A;  3VYS B;  3CP8 A;  3ZMD A;  2V7F A;  4L9J A;  5KAF C;  1VTN C;  1BW6 A;  4HDV A;  5J6X A;  1Z77 A;  1QPM A;  1FIA A;  4BE2 A;  2R93 J;  2EA2 A;  4PJM A;  5GTH C;  4Y4R A;  5JHF A;  2MSY A;  4C3J J;  3VFZ A;  3GTJ J;  3F8C A;  1ZKG A;  3M8F A;  2EBI A;  4D5F A;  2KIM A;  3QU3 A;  2DTR A;  4LLG F;  1F36 A;  2H8W A;  1WKM A;  1IDY A;  4RAZ A;  3UR3 C;  1R7J A;  3FWE A;  2V1U A;  2JA5 J;  3HRU A;  4A3E J;  3M4O J;  3S1Q J;  3KP2 A;  4BGD A;  3FMS A;  2DAO A;  4UV8 A;  1BI3 A;  2RQP A;  3K70 C;  4GRI A;  1Y1V J;  2GXB A;  2K02 A;  5IPA A;  2F6C A;  2K9M A;  1OKR A;  2MA3 A;  2VXZ A;  2Y31 A;  3HGG A;  2IS6 A;  2M4G A;  3FIW A;  2VJ4 A;  4LFU A;  2DYS H;  2QUF A;  1SC7 A;  3GTQ J;  1KU3 A;  2ISZ A;  2Z2S B;  4IOA F;  1FMW A;  5BS6 A;  1G3W A;  1UFM A;  1LJ9 A;  1ETK A;  2QF7 A;  3TW6 A;  2W4S A;  1D0Y A;  2X1E A;  2LLK A;  3ABU A;  1JI8 A;  4IOC F;  1MNE A;  1XTA A;  2LY9 A;  2W82 A;  2V1N A;  4OOI A;  1L0O C;  3N4M A;  3Q0W A;  1KU2 A;  2EFP A;  4PCQ A;  1OPC A;  4XN3 A;  1WJC A;  1T2K A;  3O6B B;  5D5U B;  2Q2E B;  3SZG A;  4XMY A;  1TWF J;  1UST A;  3HSF A;  2QGU A;  1YX3 A;  1D8K A;  3LFU A;  1ACI A;  4EQQ A;  3WHB A;  1TT0 A;  2PJP A;  2D5V A;  2DN0 A;  2QBY B;  3OYG A;  3HTS B;  2ZNY A;  1SD6 A;  1R71 A;  1IG7 A;  4U0W A;  4HRI A;  2I10 A;  3OMY A;  1ODD A;  2XUB A;  4ZTF A;  2GXA A;  1E3P A;  1USS A;  1SFK A;  1VQL I;  2OZU A;  2IA1 A;  3DU6 A;  3PL8 A;  2M7B A;  4L5E A;  3G73 A;  4MFD A;  1X2N A;  5HS9 A;  4CCJ A;  2JT1 A;  4BAY A;  1ERD A;  4MLO A;  3A1Y A;  4PJ0 C;  2GOX B;  2VJJ A;  1D1C A;  4Y7N J;  1V5E A;  2DPU A;  4BJT A;  3NQO A;  3GX4 X;  1MBJ A;  3CCM I;  4IQ4 A;  2E2H J;  1RET A;  3BY6 A;  2HWV A;  3TO9 A;  2H1K A;  2KLO A;  3ZMZ A;  1DU6 A;  2HFH A;  2HQR A;  1R6R A;  4KN4 X;  3DXJ F;  1N77 A;  3RZO J;  2E36 A;  2CQN A;  3DTK A;  1A35 A;  2PQ8 A;  1IJW C;  3E6M A;  4NB5 A;  5B1B H;  3VSK A;  3HOX J;  2JA6 J;  1K83 J;  3BR0 A;  3CUQ B;  3OIO A;  2DDB A;  5J1Y A;  2DFI A;  3FKJ A;  3H3Z A;  1ZG1 A;  3DLA A;  2RKH A;  2TRT A;  2JUG A;  2DA7 A;  1ENH A;  5D4R A;  2OPT A;  1J59 A;  3B6A A;  5L3D A;  3BPX A;  1OIS A;  4RB2 C;  4BQO A;  1LEB A;  1QHH D;  2W24 A;  1RC9 A;  5FKM A;  4LB6 B;  3M7G A;  5HLI A;  1VQP I;  1I50 J;  1ZYR F;  1WWX A;  5E3L A;  3U1D A;  1PP7 U;  3A0H C;  2GA1 A;  4U88 A;  5FFZ A;  3WOD F;  4YG2 F;  4EV0 A;  1EKE A;  2JA2 A;  2V6C A;  1PP8 F;  1SD5 A;  3LOC A;  2WB1 A;  3HKZ N;  4HX8 A;  5AIP A;  3KLO A;  4E4H A;  3EQL F;  3DBR B;  3ZQQ A;  2MFZ A;  2KIF A;  5FFX A;  2L4A A;  1YE9 A;  3W6K B;  3LAJ A;  1TQI A;  4ZDP A;  2DMU A;  4QPQ A;  3I55 I;  2HVS A;  3Q3S A;  4EM1 A;  2VBZ A;  3NRV A;  4D7N A;  2DOD A;  3DLL F;  2H8R A;  3HRT A;  2R7Z J;  3TOB A;  3LAP A;  3CJQ B;  2FBH A;  3ZP5 A;  1Z21 A;  1WJF A;  1Q1H A;  2ZJ2 A;  3C1D A;  1VQO I;  3OV8 A;  2DBB A;  1HBX G;  1SD4 A;  3OIQ A;  4EGZ A;  2Q0O A;  2OTJ I;  2OBP A;  3KP7 A;  2XF7 A;  5M3F J;  2N8G A;  2M2E A;  1FP2 A;  4IVN A;  1JUP A;  3J81 Z;  2XAU A;  1WFX A;  3KLN A;  4JQF A;  2VB6 A;  3IWZ A;  1OCO H;  3BOQ A;  4E7H A;  3JR9 A;  2VKE A;  3V8K A;  1DGW Y;  4W1U A;  3QPL A;  4ASN A;  1JE8 A;  1Z05 A;  2M9H A;  3V4G A;  1IUF A;  2LRD A;  4CYC B;  1QZY A;  2XF6 A;  1RKT A;  2FD5 A;  3CCL I;  3H92 A;  3E1S A;  1IAW A;  2MLK A;  2VT3 A;  1ZGW A;  2GWR A;  1XGM A;  4L9T A;  2PMH A;  4F91 B;  1QBJ A;  5FRN A;  3IRQ A;  1DP3 A;  2VQC A;  3G3Z A;  1D8J A;  2J5O A;  4MTE A;  3CCY A;  3DKW A;  1JT6 A;  5A2Q Z;  5DUK A;  2EJR A;  4RLF A;  3OYH A;  2VL8 A;  4CA0 A;  5HNF A;  4Y52 J;  1IXR C;  4BY1 J;  1IXS B;  2CJJ A;  5LRR A;  2CS3 A;  3F9K A;  2UXX A;  5L3G A;  2R5Y B;  3E3V A;  3TDU C;  1TWH J;  2EPF A;  3BG5 A;  3LSR A;  2HXI A;  3N05 A;  3ZR8 X;  3RKY A;  4RS8 A;  1ZLJ A;  3Q9S A;  2IPQ X;  3L2W A;  3PNY A;  1GT0 C;  4MEY F;  2R92 J;  1YJN I;  1HA8 A;  1G3S A;  2ZME C;  3RPQ A;  1I39 A;  3DEE A;  3IAS 2;  4XRS G;  2Z5U A;  3GCM A;  1GLN A;  2FUG 2;  4Q48 A;  4ANJ A;  2OZ6 A;  2B7E A;  4E6K G;  3RCO A;  1FMV A;  2YU3 A;  2HXO A;  2IS4 A;  2D2W A;  4I76 A;  4A3C J;  2F5E A;  3GTO J;  1WCM J;  2NS8 A;  1XGO A;  3D5S C;  3LSH A;  1OCR H;  2RNG A;  5DCM B;  5E1X A;  1RPW A;  2NS0 A;  4EJV A;  4YFX F;  3HRS A;  5IYC J;  2DOE A;  4M6V A;  3KPH A;  4I6Z A;  1MSF C;  3GW2 A;  2E19 A;  2L4M A;  2K9Q A;  2X9D A;  3HZJ A;  3D0S A;  2V9K A;  2KMU A;  2ESN A;  2HEO A;  2O03 A;  1I3A A;  1X1A A;  3TQN A;  5IP9 J;  3I5U A;  2XC7 A;  4BS9 A;  1XPX A;  4A0X A;  2JPB A;  4FCY A;  1BJZ A;  4IQJ A;  2DMT A;  3S17 J;  2EA4 A;  4EEF G;  4IF4 A;  4BXF A;  1FYM A;  1ZR4 A;  1BC7 C;  4M72 A;  3SYT A;  1ETO A;  3JRA A;  2ELH A;  1FEX A;  3W2W A;  3QOD A;  4A3M J;  1FY7 A;  2UV1 A;  3DPT A;  5IOY A;  5J8C A;  3HHH A;  4UHT A;  1J7K A;  3KZY A;  2YX7 A;  3RTR A;  3ZN0 A;  4CXF A;  3QRF F;  4A3D J;  1WQ2 A;  1YW8 A;  4B8X A;  3OSF A;  2KKO A;  3H9Q A;  5LHI A;  2CUZ A;  2COM A;  3A03 A;  3BR3 A;  5CQE A;  1FJL A;  3WTW C;  4D1Q A;  2ELK A;  1YHQ I;  4IKF A;  1R5H A;  3B73 A;  4RGU A;  4U7B A;  4OIN F;  1IGN A;  1YJ9 I;  3GLX A;  5K1Y A;  3RZD J;  1V5G A;  1FT9 A;  2ZC2 A;  3L2U A;  2IGK A;  2V9P A;  1J9I A;  1HC8 A;  2K27 A;  3B6C A;  2XSJ C;  2G0E A;  4G6Q A;  2PJR A;  4IHV A;  1R36 A;  3ML6 A;  2EIL H;  3GTM J;  1MNM C;  4G9Y A;  2IA2 A;  4L0Y B;  4RMN A;  1P4X A;  2JA7 J;  2A6T A;  3HG9 A;  5E3M A;  3LSP A;  4E7I A;  3TBI A;  3OOU A;  2RDP A;  3U2R A;  3QP6 A;  2ZJR F;  5ICE A;  3FDY A;  1W0U A;  5J40 A;  3TP3 A;  3H5A A;  4CHU A;  2I5U A;  4DYR A;  3OS0 A;  1S72 I;  1XGN A;  5HS7 A;  1WJA A;  2K7L A;  5KVR A;  1RKW A;  2WAF A;  1BIA A;  2BY1 A;  1T56 A;  4BHP A;  4Z6Y A;  1SAU A;  3SQN A;  4CZZ A;  5KNL A;  4UNO A;  3JTH A;  4NUB A;  1W7P B;  2R7S A;  2O61 A;  3OR1 C;  1HDD C;  1J75 A;  2OQG A;  4XNF A;  4BXU A;  2Z33 A;  1TZL A;  2BVL A;  5LGT A;  3G1M A;  4PFO A;  1SFU A;  1LDD A;  2E71 A;  4O5V A;  3K2Z A;  3H5R A;  4I02 A;  3U9G A;  1NHA A;  3GO5 A;  2WV0 A;  2WAE A;  2E1C A;  5D4S A;  1UAA A;  4JX4 A;  2NYX A;  3SDB A;  2XAJ A;  4TV7 A;  3S32 A;  3FXM A;  3WTZ A;  1HST A;  1TL8 A;  2Q8K A;  1MZB A;  3BWG A;  2F5F A;  1T33 A;  1UZC A;  3FM5 A;  3IV5 A;  1JXS A;  1VZ0 A;  1BR4 A;  1YG2 A;  3M1E A;  4JP0 A;  1B4A A;  4WCG A;  3N97 A;  3I71 A;  3IH3 A;  2BY0 A;  3FXJ A;  3BPV A;  4OIR F;  4BQA A;  1ZRC A;  2IXS A;  3M8J A;  1R5I D;  2GBY A;  4RAF A;  2VBW A;  1MBE A;  3Q0V A;  4YFK F;  2KQR A;  2G7U A;  2CMP A;  2DLL A;  1STZ A;  4C2U A;  4ENJ A;  3F8B A;  1XSV A;  2WY8 Q;  5BOX A;  3H3U A;  1U5T B;  3I4P A;  1K79 A;  1OYW A;  5ED4 A;  4ZC3 A;  3QP5 A;  2CRG A;  3DTE A;  3FBI B;  3JAM Z;  1BN5 A;  1X1D A;  1X4P A;  4LIT A;  1AOY A;  1KYZ A;  1U9N A;  3HOT A;  3MAJ A;  5K7F A;  3VEP A;  3MKW B;  2XAQ A;  2ID6 A;  2FBI A;  3K9T A;  1U6G A;  2CW8 A;  1D0X A;  2OJE D;  2DT7 B;  3LNQ A;  5ICG A;  4BAC A;  1QGP A;  4E7K A;  2RVC A;  4BU2 A;  1ZRD A;  2PLY A;  1M1E B;  3MZY A;  2HVQ A;  1OCZ H;  3IH4 A;  1XMX A;  3VB2 A;  3CUQ C;  4EAT A;  4HX7 A;  2OQR A;  1YW9 A;  1FOK A;  3D1N I;  1HW5 A;  1Z3X A;  2V1D A;  3BCA A;  4M3F A;  1BBY A;  2P4W A;  4XSX F;  4ZZD A;  4JBA A;  2KPM A;  1MH3 A;  2L54 A;  5LHH A;  1BL0 A;  1XDS A;  5GAH J;  2B63 J;  5DM6 F;  3ZQ7 A;  3P7N A;  4YEJ A;  1W7P D;  3DBH B;  3RSN A;  2L2O A;  1OYY A;  3HOV J;  4FE7 A;  1U8R A;  1LUJ B;  2Z99 A;  4BEH B;  3I56 I;  3KX2 A;  5E3N A;  1N25 A;  4RB3 C;  3OYL A;  4L18 B;  4M71 A;  4DYC A;  9ANT A;  1RIO H;  1XSD A;  3ZXS A;  4AIJ A;  3BG3 A;  2LC2 A;  2Z3Y A;  1BW5 A;  2Z9O A;  1RR8 C;  3QPT A;  3H35 A;  2XSD C;  2EIJ H;  3E6C C;  1O4X A;  5FLX Z;  1Y1W J;  2Z16 A;  2V4J C;  4N0B A;  2VOD A;  1L3L A;  4LJZ F;  2MYS A;  5JFR A;  3HEF A;  1B72 B;  3ABT A;  3KE2 A;  3QPS A;  4GCV A;  4UVA A;  4UV9 A;  2ZFU A;  1Y8R B;  1JKP C;  1FTT A;  2F5C A;  3F72 A;  3IUO A;  2FE3 A;  2BW3 A;  3ZQF A;  3KYL A;  1HKQ A;  1W0T A;  2P7C B;  1H89 C;  1GUU A;  1S6L A;  2RGV A;  4PDK A;  3DFG A;  2J5P A;  4Y3O A;  5KCM A;  2L02 A;  4HLX A;  3SHF A;  2QSG X;  1W4M A;  4XRF A;  2OAZ A;  2JRT A;  4RLQ A;  2DA3 A;  3VDX A;  3F23 A;  5IYD J;  1VQN I;  3RDI A;  3ZMV A;  3E97 A;  1NK3 P;  4FIS A;  2BVM A;  2NXN B;  4AWX B;  2ECC A;  2FF4 A;  3CTA A;  5HDG A;  2H94 A;  3IKT A;  1ZGJ A;  2DO7 A;  1OCC H;  1ZAR A;  2IW5 A;  5E1W A;  1FLI A;  4HQM A;  5F1R A;  1OR7 C;  1J09 A;  2LVS A;  1ON2 A;  2DOF A;  2KJB A;  4LG3 A;  1EH7 A;  1I1S A;  3OY9 A;  1QZE A;  2UUZ A;  3FIS A;  5D8K B;  1F43 A;  3TDZ C;  2DCE A;  5DTD A;  4OAY A;  4R79 A;  4M9S A;  1I3Q J;  3V8J A;  1SEU A;  1ZHF A;  2A69 F;  4DJA A;  2ESH A;  2CWE A;  1W36 D;  1QHG A;  1ZLK A;  1UEL B;  3TED A;  2VC1 A;  4RGR A;  3R6S A;  1GXQ A;  1QA6 A;  5JVT A;  4BH9 A;  1CF7 B;  5EGO B;  3MKZ A;  2CQK A;  2HTJ A;  1HW1 A;  3ZN1 A;  4AVP A;  1ZRF A;  1F4K A;  5DUI A;  2EV0 A;  5E8I A;  1XCV A;  2A5Y B;  4II2 A;  3J80 K;  1WRJ A;  2W48 A;  3RYR A;  1X4O A;  3CJR B;  3TW7 A;  4ZYE A;  2IP2 A;  1ZN2 A;  2EWN A;  3IWF A;  4AU7 A;  2MC3 A;  2F48 A;  3HHG A;  2DI3 A;  2E7W A;  5DDG A;  5L3F A;  2P5L C;  2ZNZ A;  4KMU X;  4MQ9 F;  3A01 B;  4IHX A;  2RN7 A;  3ABK H;  2ISY A;  5DEQ A;  5DYM A;  1X1C A;  1TWA J;  3RKW A;  2M30 A;  2R5Z B;  2DJI A;  4C2M J;  3DPU A;  3PQK A;  4HF1 A;  2P81 A;  3M1C A;  1JHF A;  4BE0 A;  3ZQH A;  2GOM A;  2BW3 B;  5LFA A;  2EZI A;  3K7A J;  4XRS A;  2DW4 A;  2NAZ A;  2HTS A;  2AHQ A;  4E7Z A;  1XCB A;  2PMZ N;  4RBO A;  5GTI C;  2F5V A;  1V5F A;  2RQQ A;  3GTL J;  4HV5 A;  1LE8 A;  5FLX K;  2HS5 A;  2JVH A;  1UMQ A;  2RV8 A;  4ESF A;  1R49 A;  3MWM A;  5E79 C;  1ZEL A;  1G59 A;  4PJL A;  4CYD A;  5CYV A;  1O3R A;  3P9C A;  4IXA A;  2W00 A;  1S7E A;  2X85 A;  3F8N A;  1R00 A;  1XC5 A;  3JCU C;  5LEJ A;  2HDC A;  3JW4 A;  2EB7 A;  2GAU A;  2D45 A;  3I58 A;  1YIO A;  3HOY J;  1Y39 A;  3MZH A;  2MG4 A;  2HKO A;  4MEX F;  2ZXH A;  3GUD A;  1I5Z A;  4Y13 A;  3QOE A;  4CZC A;  2VOO A;  2L9N A;  1WJ5 A;  1JJ6 C;  3ISP A;  2NOJ B;  4LG0 B;  2IJL A;  4QSH A;  1ETX A;  2JPC A;  4XKW A;  5EF6 A;  4Q5S F;  2A68 F;  2X6W A;  2Y69 H;  3CC7 I;  2F4I A;  3RKQ A;  3MFK A;  4E7L A;  1ZR2 A;  2K4J A;  3HPG A;  3K4N A;  4IRI A;  5F0H A;  3CCV I;  4XL9 A;  2JA8 J;  4BQQ A;  3AL0 B;  2LY2 A;  3ZMS A;  5JLW A;  1Y56 A;  2WV1 A;  1GVD A;  1Y6I A;  4BXX J;  1WH7 A;  2VJ5 A;  2L7Z A;  3ZOB A;  5JVG F;  2RAE A;  4OMY A;  1JTY A;  5H20 A;  4A12 A;  1JGS A;  1X19 A;  1IO2 A;  3PSI A;  1FBU A;  2ECB A;  3SZP A;  1AKH A;  3HGY A;  5F6F A;  1IRG A;  2XAH A;  4ITV A;  2WY7 Q;  2QM3 A;  1H9T A;  5IT9 K;  1HW2 A;  2DA2 A;  2KRF A;  1O3Q A;  1K4T A;  1IUY A;  2JVG A;  3W2V A;  3R61 A;  2H27 A;  1U78 A;  2R7D A;  4I99 C;  1NH3 A;  4KJZ A;  5CQG A;  1GVJ A;  4V2G A;  1VQ4 I;  2O9L A;  3S1N J;  3FMQ A;  3WE2 A;  2JZY A;  1J2X A;  2KJC A;  1WJB A;  4A3B J;  1FC3 A;  2IT0 A;  4FX4 A;  5L3E A;  1SFO J;  1O7F A;  1SVL A;  4G12 A;  4G6T B;  4FE4 A;  4HQE A;  4FTH A;  3OYM A;  3JRF A;  2DQR A;  4G8X A;  2FEZ A;  3ZQC A;  1IN4 A;  2QLZ A;  2P0W A;  3BTC A;  2L0K A;  3AG2 H;  4NDL A;  4XR6 A;  2DFF A;  4A2U A;  2HYF A;  3ZPL A;  1MBF A;  1ZAO A;  3AFH A;  2VE9 A;  1K7A A;  2ZJQ F;  4ZYH A;  3VYR B;  2R7W A;  3MN2 A;  4PSW A;  2E5Z A;  1YI2 I;  3HB9 A;  2YS9 A;  3R4K A;  4LLL A;  4EMS A;  1S3J A;  2MW8 A;  1AWC A;  4HNT A;  2D1V A;  3FBN B;  4OU0 A;  4XQF A;  4HLY A;  2HDW A;  4BEH A;  1U5T A;  4CO8 A;  1EA3 A;  4Y15 A;  5EZG A;  4WX9 A;  3ZQG A;  2EZH A;  4HBL A;  2K9N A;  1PYV A;  3S3N A;  2OUM A;  3L9F A;  3FXU A;  4H0E A;  4IHT A;  3ROU A;  5GAG J;  3V7R A;  1G8X A;  3K70 D;  1BIB A;  3HIF A;  3CC2 I;  2EFN A;  4KIF A;  4DYQ A;  3WGG A;  1SFE A;  4KIC A;  2HZT A;  5E3O A;  2CV0 A;  3H0D A;  5KK1 A;  3CDH A;  3GFJ A;  3LSK A;  3U21 A;  4MNU A;  4JX6 A;  2M1B A;  5FB2 A;  2JK3 A;  3CDL A;  4LB5 A;  2MBF A;  2QVO A;  4HV6 A;  1AKH B;  3E5U A;  3EUK L;  4NC7 A;  3K4M A;  2CFX A;  2BXY A;  2OA4 A;  2V79 A;  2RNJ A;  4HF2 A;  3K4J A;  2UWM A;  4DIQ A;  3WG9 A;  2XKP A;  3PO2 J;  2KRC A;  2XV4 S;  6PAX A;  2DA1 A;  3HUG B;  3LA7 A;  1W5T A;  4A69 C;  3VYT B;  1O3T A;  3F0C A;  4M3B A;  3HXL A;  4R1H A;  2XPU A;  3WU1 B;  4X0G A;  4XM3 A;  1Z6R A;  2ZB9 A;  3AL0 C;  1SVO A;  1MJ9 A;  4DQ2 A;  1EJ9 A;  5J1U A;  2ZXI A;  3CCU I;  1S7O A;  2LMD A;  3ABL H;  4G7Z F;  3S3O A;  3HM5 A;  3F6O A;  3CZ6 A;  3GWZ A;  2DT6 A;  3K4L A;  1K78 B;  3BR2 A;  2R7Q A;  3OIP A;  3DU5 A;  3T5X A;  4A5N A;  1QNT A;  3JRC A;  2MH9 A;  5EG0 A;  1ON1 A;  5F04 A;  3DF8 A;  4A3G J;  2FNP A;  4XLN F;  5C4J J;  1HDP A;  1T8I A;  1Y8Q B;  1IN7 A;  3ZGK A;  4BL0 B;  1MDM B;  3A0B C;  4DGW B;  2ZSI B;  3S1M J;  1AU7 A;  2O0Y A;  2QKM B;  2ADU A;  1W5C C;  2WAQ A;  3IHU A;  4UB6 C;  3L00 A;  5M3M J;  4CH7 A;  2EH3 A;  2BYV E;  3PSF A;  3ELK A;  3O3K A;  4XID A;  3SXY A;  3TOA A;  3SFI A;  4AIH A;  2PX9 A;  4DZP A;  1KQ9 A;  1SMT A;  1I6H J;  3QU6 A;  4P5O A;  5E1Z B;  3K1P A;  4M9Z A;  3HJE A;  2BGC A;  2MC4 A;  2VQG A;  3OWT A;  5E8G A;  2ZKZ A;  5F64 A;  1JGG A;  3E0J B;  3BC8 A;  4M3G A;  2HPM A;  5LGU A;  4G7O F;  2BXZ A;  2DK8 A;  1QQI A;  2HZD A;  2PN6 A;  3RYP A;  5B5E C;  3K6G A;  3GYH X;  1D5V A;  4GGG A;  2JUC A;  5HDK A;  3A2K A;  2XRO A;  2LF7 A;  1S5L C;  3QQA A;  5DCM A;  4HDU A;  2LKX A;  3PJR A;  3RPU D;  3E5Q A;  2OD5 A;  3OL3 A;  1MBK A;  2VC0 A;  2DXI A;  2HOA A;  1Z67 A;  1A6Q A;  3FF5 A;  2O8X A;  2LP0 A;  2HU9 A;  1ONV A;  4IO9 F;  1W5S A;  2EZL A;  2GIZ A;  2LSO A;  3NEU A;  2FXA A;  3VSL A;  1HCR A;  3DEU A;  5JLX A;  4BNC A;  2RC4 A;  3EET A;  2DT5 A;  5C44 J;  4Q47 A;  4QLC U;  1BR2 A;  3IL2 A;  1YTY A;  1JT0 A;  1D0Z A;  1OFC X;  1XGS A;  3V7S A;  1Y0U A;  2VPR A;  1W1W E;  2Q2E A;  2PG4 A;  2LOO A;  1SAX A;  2ZCW A;  2R3S A;  2GIV A;  2HDD A;  5GP9 A;  3CP2 A;  4YIR X;  2FX0 A;  3PIO F;  3BR1 A;  2CFO A;  2LNB A;  3CCQ I;  1Z9C A;  1ZTR A;  2LY1 A;  1MKM A;  3QAH A;  3GF2 A;  3CF2 A;  1X1B A;  5HOD A;  3Q5F A;  4X1E A;  4XKC A;  5B66 C;  2FQ3 A;  4BBR J;  1DP7 P;  4I01 A;  3EYI A;  1WVR A;  2M8E A;  1OCP A;  2CW7 A;  5HLG A;  5D6E A;  2R5Y A;  3EUH C;  5DM7 F;  3WGI A;  1J5Y A;  3L2R A;  3NAU A;  3AKZ A;  1D1A A;  1O3S A;  2R7R A;  3CLO A;  4RB0 A;  1OMI A;  3JRI A;  3OS1 A;  2STT A;  3COA C;  3DV8 A;  3OOP A;  2MD0 A;  4O3M A;  2KIQ A;  1YJW I;  2L7F P;  3PQJ A;  1HLV A;  4MHG A;  3G1O A;  5J47 A;  1WZ2 A;  1YFH A;  2X0L A;  2K3F A;  4NHJ A;  4XON A;  1V3F A;  5CKT A;  4KIB A;  1IXC A;  1YQA A;  2QCO A;  3G2B A;  2P8T A;  5F08 A;  3JRG A;  4LD5 A;  4KIS A;  3OYF A;  2KDZ A;  1GV2 A;  2EV5 A;  1MIJ A;  2V1X A;  4C3I J;  2IRF G;  1HKS A;  1TLH B;  3L09 A;  2BHZ A;  5JR3 A;  2G7H A;  4GFB A;  3BG7 A;  1YRN A;  5C4X J;  2AXL A;  3FX3 A;  4CCK A;  3CCS I;  1W36 C;  4A6E A;  1DDN A;  2BY2 A;  2XAF A;  3ABM H;  3BZC A;  1VQ9 I;  2XPW A;  1FWZ A;  2ZME A;  3DCF A;  2OU2 A;  4V2F A;  3QWL A;  3JSP A;  5KAI C;  2WC2 A;  3G71 I;  1MBG A;  3ZRG A;  4S0H B;  3BCB A;  1FPQ A;  3BTJ A;  4IHW A;  3SEQ A;  2HYJ A;  2LKP A;  2KIU A;  3WE3 A;  3S8P A;  5EGO A;  1IRZ A;  1S9H A;  1Z91 A;  3HRM A;  4BQN A;  2PBI A;  4RGS A;  5LGN A;  5DCF A;  1F1Z A;  5HLT A;  4M6Y A;  2AQE A;  1JJ8 C;  2X6Y A;  3T1B A;  3HYI A;  5J4Y A;  1R4M B;  3S2W A;  2HI3 A;  1APL C;  4LIU A;  1SVM A;  2CYY A;  2HGC A;  4OAZ A;  1Q1V A;  4AYB A;  4K2E A;  2F5D A;  2HQA A;  1EH6 A;  4XOT A;  4CCN A;  3MD2 A;  3PNT A;  5CPR B;  1X3U A;  2FMY A;  2O5R A;  4GYG A;  4MFE A;  2TDX A;  1UG2 A;  4HST A;  1HOM A;  4BYY A;  4A93 J;  5IT9 Z;  5BPI A;  1FOW A;  1V55 H;  1S29 A;  2CV1 A;  1E2X A;  4F93 B;  3CMA I;  4IHS A;  3UNG C;  1RUN A;  4EVI A;  3LL7 A;  3LSJ A;  3VWB A;  2YR2 A;  3PIP F;  3S16 J;  2LG4 A;  1P4W A;  4NNJ A;  4IL6 C;  2ZSH B;  2E34 A;  5H2F C;  3L2V A;  4KFC A;  5BQT A;  3FXO A;  3HOZ J;  2A6E F;  1LVA A;  4F52 A;  3KP4 A;  3CLQ A;  1S8N A;  4XOR A;  4KT6 A;  2YSR A;  3PFY A;  4YEL A;  1O57 A;  2QQ9 A;  3HOS A;  2L9R A;  1DUX C;  1C0W A;  4B3X A;  1PDN C;  3LFK A;  1TQP A;  5CVJ A;  3VOD A;  1IN5 A;  4XLH A;  4IJA A;  1POG A;  2VUM J;  4FET A;  3DBL B;  4HOB A;  4R8H A;  2R7T A;  2ZO4 A;  2YPR A;  2DA5 A;  5EEA A;  3X2Q H;  1UCR A;  2XAS A;  4F55 A;  3ZQI A;  1XMK A;  3CUQ A;  4J01 A;  1P9Q C;  2IEK A;  1WI9 A;  4A6D A;  3C3W A;  3F21 A;  4LGW A;  3FHZ A;  4A3L J;  4G6D A;  1FZP B;  2DTZ A;  2VXD A;  5H6Q A;  4ESB A;  3E7L A;  4LLN A;  2Y30 A;  3MQ0 A;  1VF9 A;  2DA4 A;  4UUS A;  3JSO A;  2NNY A;  3DEW A;  4MIM A;  2IGN A;  3ZMU A;  2CQX A;  1WJE A;  4RB1 A;  3G4S I;  2MD5 A;  1F9N A;  2XGC A;  4M3D A;  3J7Y J;  2Y75 A;  1RRJ A;  2CH0 A;  1MMA A;  2R7X A;  1R1T A;  3IC7 A;  5B3S H;  4MTD A;  4BDY A;  4GO1 A;  3K4K A;  3OSG A;  4N4N B;  5A2Q K;  2JWT A;  4NC6 A;  2XRN A;  4HZF A;  3E6D A;  2NVY J;  4OMZ A;  1UHS A;  1X1P A;  1UG0 A;  4HF0 A;  4B47 A;  3T8R A;  4HX4 A;  3LSG A;  1H9G A;  2A6H F;  1Z7U A;  3CCJ I;  2FJ1 A;  4AVZ A;  3SJM A;  2H09 A;  3C2B A;  5D6F A;  3NWS A;  3Q0U A;  2E1M B;  3CO7 C;  1GV5 A;  2BZT A;  1HQC A;  3L1P A;  2QQ8 A;  3GZ5 A;  3K1N A;  3LWF A;  2LR8 A;  2ETH A;  2XGX A;  5J3L A;  3DKY A;  5FKN A;  4IEJ A;  3J80 Z;  3BP8 A;  1JUS A;  3DPL C;  2IGO A;  1HSJ A;  2O3F A;  1B9M A;  3O2P E;  4UB8 C;  5E20 A;  1ZG3 A;  4ZH4 F;  2WTE A;  1E17 A;  3I4M J;  2QSF X;  5LRS A;  2V9V A;  4B1R A;  1MMG A;  3R0A A;  2X48 A;  2M0M A;  3C18 A;  3KEY A;  2LBF B;  5FLM J;  1CGP A;  3FXL A;  3KP3 A;  4JYK A;  3G1L A;  4M9X A;  5GPC A;  1FP1 D;  1K4S A;  1LNW A;  1BOB A;  2X6O A;  3HPH A;  3U1K A;  2O7O A;  1LDK B;  2R0Q C;  2QA4 I;  1Z7L A;  5J1R A;  2VKV A;  3PUF A;  4AC0 A;  1ZQ3 P;  3RIR A;  5AON A;  5EZH A;  1MSE C;  4JOM A;  2CUJ A;  5FRO A;  2PMZ A;  2CU7 A;  3K4B A;  2E35 A;  4ENN A;  4EGY A;  3K4C A;  3J7Z I;  2QQA A;  3GME A;  3I53 A;  3ZMT A;  4B3A A;  1FBS A;  1T38 A;  4D7M A;  1I27 A;  1QVU A;  5KHD A;  3GTP J;  3QYF A;  1CQT A;  2VPL A;  1XDU A;  2EFQ A;  2H6C A;  3GFL A;  2NRA C;  4U7D A;  1YIT I;  5M5X J;  5LEK A;  4A0Y A;  1MMS A;  3ECH A;  5JI6 A;  3V42 A;  1B8I A;  4J00 A;  2Y2Z A;  3WTX C;  5HNH A;  2PJR B;  2Y0M A;  1T95 A;  1R9T J;  1IRX A;  4GYI A;  4UUV A;  1LFB A;  4JK1 X;  1R23 A;  2MGQ A;  3RI4 A;  1LEA A;  2QYO A;  2A07 F;  2WA0 A;  2YUS A;  2DFE A;  3QYE A;  4DW6 A;  4HNV A;  3OYN A;  1DPU A;  1IDZ A;  4A3F J;  1K6Y A;  2BHY A;  1GHC A;  3EUH A;  1D3Y A;  3TO6 A;  2X6X A;  2Y9Y A;  3GXO A;  4AD9 A;  2AS5 F;  3MVP A;  3CMM A;  1Z6T A;  4KNY A;  4CCM A;  3B02 A;  3SDG A;  1OQY A;  3KIO A;  2CW0 F;  4CSW A;  1YW7 A;  2EIN H;  3GZN B;  1BOA A;  3CES A;  4L0Z B;  4BJ6 C;  4XLP F;  1XB4 A;  4DOZ A;  4LMY A;  4B43 A;  4NC8 A;  4OWR B;  2XPV A;  2KP6 A;  4PZJ A;  1TBX A;  2EZK A;  5IYB J;  2COB A;  3I59 B;  3V8L A;  3FXK A;  2WAQ N;  2H6B A;  4A3K J;  2DFH A;  2K40 A;  5FLV A;  3PFI A;  3JRE A;  2JMW A;  4WF2 A;  4NBQ A;  3K1M A;  1EH8 A;  1ETQ A;  3CCE I;  1R58 A;  2CO5 A;  2NVU B;  2VKD A;  3WG7 H;  1I6X A;  4HG2 A;  1B59 A;  1VI0 A;  3ASN H;  2Y9Z A;  2P7V B;  3H1C A;  1JUM A;  1QPI A;  3M8E A;  3S2D J;  1OJL A;  1MJA A;  1IV6 A;  1ETW A;  5EDN A;  4P55 A;  1ZG5 A;  5JHU A;  2NVX J;  3I54 A;  4IHY A;  1KQ8 A;  2DDA A;  1BI1 A;  1MH4 A;  3NAR A;  5ILS A;  3VPR A;  2R7V A;  1AHD P;  2LH9 A;  2VIX A;  3R60 A;  5GAE J;  3BTI A;  5FGM A;  1WPK A;  4O6J A;  2DYR H;  1TW3 A;  1IRF A;  3VOE A;  4OIO F;  2QEN A;  5CJ9 A;  2KDO A;  3BJO A;  3HSE A;  4M74 A;  2XIG A;  2UZK A;  4IZZ A;  3EPZ A;  2K85 A;  2DMP A;  3CD6 I;  2VKH A;  4II3 A;  5M5W J;  2V26 A;  3H0G J;  1FOY A;  1QU3 A;  2L7M P;  4DNC A;  4N9H A;  1D5Y A;  4G94 A;  1H88 C;  4A3J J;  3P5J A;  1YS7 A;  3HC7 A;  3K10 A;  5CVV A;  1FYK A;  2BE5 F;  2OCE A;  2X4H A;  4PGH A;  4YRV A;  5D8L B;  2M34 A;  5DV5 A;  5EJC A;  3LA2 A;  1B72 A;  2CV2 A;  4PJJ A;  3HKZ A;  2M5W A;  4Y17 A;  2EQR A;  2VI6 A;  3PUB A;  1VQM I;  4E7J A;  2K5C A;  2CGP A;  4GDF A;  3K0L A;  3BZK A;  1LDJ A;  5E17 F;  1DQU A;  1NK2 P;  4XLA A;  3TMO A;  2M0C A;  4PJN A;  2DQL A;  4PSX A;  2VBX A;  1ETV A;  3BLY A;  1JKO C;  2RRE A;  2OC6 A;  3ZQL A;  3SEZ A;  4UVC A;  4RA2 A;  4XLE A;  3TKY A;  3CQZ J;  1SFX A;  4HAM A;  2A3S A;  1MD0 A;  2M4K A;  1DU0 A;  1HKT A;  4P96 A;  1XMA A;  3OS2 A;  2FOK A;  1V54 H;  2CSO A;  1UJ8 A;  3I0T A;  2F2E A;  4LG0 A;  2W25 A;  4CIC A;  1X2M A;  1FNN A;  4PFP A;  3OYK A;  3CO6 C;  4L5I A;  4BBS J;  4WWC A;  2AQF A;  4I0A A;  4KMF A;  4UVB A;  5H6R A;  2C6Y A;  1G3Y A;  1IW7 F;  3RKX A;  5AIQ A;  4XOP A;  1OYI A;  5TIS C;  3OYB A;  4C3H J;  3BG6 A;  3BDD A;  3ZCO A;  1KA8 A;  1Y0N A;  4Q4Z F;  1TNT A;  3ASO H;  2LKS A;  4HPQ A;  2KRH A;  4AID A;  2Y48 A;  1XSX A;  3MMY B;  4ON0 A;  1JKR C;  2HQN A;  4H4K C;  4D0P A;  4BJ5 C;  2LD5 A;  4ZDL A;  1TTY A;  1G3T A;  1TWC J;  1XG1 A;  3W6J B;  3BJ6 A;  2WAD A;  1LKX A;  3GZ6 A;  2DPD A;  2Y0S N;  5K5O A;  3SFZ A;  3EYY A;  4KA4 A;  2ZFW A;  4EJW A;  1P6R A;  1G6N A;  1UHM A;  3IAM 2;  1OR7 A;  5HVQ C;  1I1G A;  4WXC A;  1EF4 A;  2MLG A;  3HUG A;  2WBM A;  2LYC A;  4FX0 A;  2VLA A;  1A04 A;  4ABZ A;  1A31 A;  1QO0 D;  2YU9 J;  1Z0X A;  5FKK A;  4W97 A;  4AUX A;  5BMZ A;  3EDP A;  3CJN A;  3M07 A;  1T0F C;  3MKL A;  2E60 A;  1D1B A;  5IP6 A;  2EIK H;  2XVC A;  3CF5 F;  2ACJ A;  3D5R C;  2BEO A;  2E1N A;  1BM9 A;  2MH2 A;  4LK0 F;  1G2H A;  5F1J A;  2W85 A;  4QPO A;  3FKI J;  3RPU A;  3EUA A;  3M3Y J;  2FRH A;  1LB2 A;  1RI7 A;  1PUF A;  2GQQ A;  1LQ1 A;  1T6S A;  2GZW A;  2L7K A;  4NQW A;  1E3O C;  1VQK I;  1BR1 A;  5TGT A;  4WK8 F;  3KYD B;  4I09 A;  5D5W B;  5IT3 A;  3BTL A;  3KZZ A;  3H9J A;  3L2C A;  2M87 A;  1B6A A;  3J7A Y;  3L7W A;  2IAI A;  1N75 A;  1PJR A;  2ME6 A;  4KDP A;  4F3Q A;  4YFN F;  4EJT A;  4CUG A;  5K5R A;  1JTX A;  4E70 A;  3R0J A;  1SAN A;  2IGM A;  4WXH A;  2E2I J;  4P9U A;  3JRD A;  1P7I A;  3A02 A;  2PMU A;  5EEH A;  2CQQ A;  3GFI A;  5L3B A;  1PUE E;  5FD6 A;  4L5J A;  5ILU A;  2PFB A;  3WTY C;  2XGD A;  3ONQ A;  3M9A A;  1A6I A;  4L9V A;  1FBQ A;  1ZGA A;  2BOL A;  2E7X A;  2QSH X;  1LFU P;  2HKX A;  3DKX A;  2DOA A;  4LK1 F;  3FK7 A;  5EYR A;  3V7C A;  2EFW A;  4YII A;  4OIQ F;  1QRY A;  4HEA 2;  5F0F A;  4BKX A;  1IZ1 A;  2VBY A;  4D9J A;  3L2Q A;  1PUF B;  2VAS A;  5EG0 B;  1ETY A;  3O8H A;  2STW A;  2QKL B;  1U8B A;  1REP C;  4YIF A;  3ESW B;  4QTR A;  2HOE A;  2LDU A;  4C9Y A;  3REO A;  2K3P A;  2X1C A;  3P9K A;  3OYI A;  1XD7 A;  2G9W A;  1ORK A;  3IRR A;  4XKV A;  1VQ7 I;  4KYW A;  3S14 J;  3BR6 A;  2AXT C;  1VQ5 I;  2A61 A;  2UXN A;  4X6A J;  1MMN A;  3BG9 A;  5DS9 A;  1JHH A;  4AIK A;  2JSP A;  4IX7 A;  2VOP A;  2LBF A;  1N78 A;  4E7S A;  2FOW A;  3QOP A;  2DK5 A;  3PNV A;  2WWY A;  1HF0 A;  1TP4 A;  4BY7 J;  4LOC A;  3C2H A;  3LMM A;  2NVQ J;  4CCO A;  4D5C A;  1T08 B;  4DBQ A;  5HLH A;  3CUO A;  1VQ8 I;  4U87 A;  2F4O B;  3FXQ A;  3S1R J;  3D5L A;  1BA5 A;  2XB5 A;  1KU7 A;  3ULQ B;  4RAY A;  5TJJ A;  4CYC A;  4U0Y A;  1K6O A;  4Y33 A;  4ZDO A;  1ULY A;  4I2O A;  1TQM A;  4IPA A;  2ICW G;  3PM1 A;  3H3V K;  4N4O B;  5LBQ A;  2K9S A;  2ME0 A;  4EJU A;  1H0M A;  4XIC A;  1K78 A;  3LQQ A;  3LSI A;  3KET A;  1YX5 A;  5J8F A;  3OYJ A;  3UKG A;  4S05 A;  1BI0 A;  2NOG A;  2DMN A;  3GTK J;  5BNG A;  1LE8 B;  2VE8 A;  5K5Q A;  1QVT A;  2BV6 A;  4M6X A;  5FD5 A;  2O8K A;  4PGG A;  1LVK A;  2L9S A;  1KYW A;  2B9S A;  1WSU A;  1RUO A;  2X51 A;  4FT8 A;  2FSW A;  2M3A A;  5ILV A;  4F92 B;  2K9L A;  4PUS A;  3S93 A;  4EM2 A;  4KT5 C;  2ZXJ A;  4IRH A;  4A5M A;  4BE1 A;  3WU0 A;  3WTT C;  1R22 A;  2I8D A;  3MKY B;  2EIM H;  1RES A;  3WTS C;  2EV6 A;  3K2A A;  1XN7 A;  3HBL A;  2BBY A;  2L5Q A;  5FKO A;  3KP6 A;  4M3E A;  5K7H A;  2NNN A;  2HR3 A;  2W57 A;  3GVA A;  5DD4 A;  3MCZ A;  2P5K A;  3ERE D;  2A05 A;  1MGT A;  2D1H A;  3I9V 2;  4U0V A;  5J4V A;  1WH5 A;  1U3E M;  5EEG A;  1IC8 A;  3DWL E;  2FML A;  3FHN A;  1X58 A;  4XLF A;  1BI2 A;  3BR5 A;  1ZRE A;  5C3E J;  1TW2 A;  4CDG A;  2X1D A;  4EJO A;  1ITY A;  2R4G A;  3GTG J;  5D5X B;  5F27 A;  2IBD A;  2ZJP F;  3KCC A;  2KHM A;  2OV7 A;  4Z2Y A;  1NTC A;  1X3W B;  4XLC A;  2YX4 A;  2XRL A;  2E1O A;  2PI0 A;  4GXO A;  2VQL A;  2V6E A;  1BJA A;  3WU2 C;  2EK5 A;  2HVR A;  3BJA A;  5K7Z A;  4PK4 A;  5LLQ A;  1DPR A;  3CJT B;  4C30 A;  1U0J A;  5CVU A;  4XKB A;  1MND A;  3H36 A;  2F4M B;  2R7F A;  3E5X A;  1MJB A;  3RJP A;  1T98 A;  4M73 A;  1F5T A;  1DGR M;  4ESJ A;  3I3L A;  2LTP A;  3Q9V A;  3H9G A;  2NS7 A;  1FIP A;  3LST A;  2MAB A;  4BDZ A;  2B0L A;  2OCC H;  1B1B A;  3BRO A;  4MO7 A;  2JTV A;  4KUM A;  3IKV A;  4HNU A;  4BHC A;  2OTL I;  3LSM A;  2A5W A;  1FSE A;  2QBY A;  2DU9 A;  5FRM A;  3TL4 X;  3TO7 A;  3BQZ A;  4CGZ A;  2K86 A;  4WXD A;  2BY3 A;  3FMR A;  2AO9 A;  4XBF A;  4B4C A;  3RQ4 A;  2P6T A;  2QQB A;  2JN6 A;  1T0F A;  4ENM A;  2LRE A;  5CVR A;  4DBR A;  4MQV A;  1IN8 A;  4I98 B;  5M5Y J;  4N9I A;  1LPQ A;  3GBG A;  5TRD A;  2JJ7 A;  2KZG A;  5LHG A;  2XHK A;  4ZJZ A;  3HOW J;  2O6G E;  3KEQ A;  3SZT A;  1IN6 A;  2OF7 A;  2XB0 X;  5FJ8 J;  1R1V A;  4OIP F;  3JAM K;  3JTG A;  4L9N A;  1U9O A;  2CUE A;  3QYB A;  5GAD J;  5ICC A;  1HXD A;  3CCR I;  3CDI A;  4RAG A;  1VQ6 I;  1RR7 A;  2KT0 A;  2FA5 A;  3TP0 A;  4HA8 A;  4KN7 X;  3GLL A;  3KYC B;  4ZYA A;  1MMD A;  1VND A;  2XKO A;  1NG7 A;  1YS6 A;  3MEX A;  4I7H A;  2VJI A;  4RM3 A;  2P5V A;  4BHB A;  4I0B A;  5D5V B;  2CQ7 A;  2HOS A;  3O8G A;  3RQI A;  2PEX A;  4ZYD A;  3AAF A;  1Z1D A;  3AG1 H;  3FM3 A;  1X3Z B;  3F8M A;  2XDV A;  5IY5 H;  2M7A A;  4KIT B;  2LFB A;  3DP7 A;  3WGH A;  1OLT A;  1RZ4 A;  5HOO A;  1B9N A;  1LFP A;  4IRG A;  3P9I A;  2QEX I;  2JRM A;  4S04 A;  3F8F A;  2M45 A;  3J81 K;  4ZYG A;  1G4D A;  2XF5 A;  1RNL A;  1YOV B;  2R7U A;  5HDN A;  5CLS A;  3A01 A;  5F0C A;  3IP4 B;  4ETS A;  1YLF A;  2HOT A;  2CUF A;  3G6E I;  5FO5 A;  3OR2 C;  3TGN A;  4RM2 A;  3OYD A;  4HSR A;  2JSC A;  4XK4 A;  1EV7 A;  5IOZ A;  1O7L A;  5LD2 C;  2IVM A;  2LF8 A;  3DQV C;  3T0Y A;  3OYE A;  3FXR A;  3WTV C;  4KIG A;  3KEO A;  1A36 A;  1A5J A;  3FZV A;  2VT2 A;  1XS9 A;  3CME I;  3KFW X;  1K61 A;  1J0R A;  3I64 A;  1WGX A;  2KZV A;  3JRH A;  1KON A;  5GPA A;  1AA7 A;  5FKL A;  1B8I B;  2ZXW H;  1PVE A;  1ZH5 A;  2ELJ A;  2E5N A;  1OCT C;  5ERI A;  2L3D A;  3F22 A;  2HYG D;  3OYA A;  5B1A H;  1Z3Y A;  3C2G A;  2M8G X;  2XAG A;  4HW0 A;  3I59 A;  3H5N A;  4G7H F;  1TNS A;  3BT9 A;  3HTU A;  5E18 F;  4AM3 A;  2Q1Z B;  2FQ4 A;  1TC3 C;  3ECO A;  2W1O A;  2QWW A;  2R7O A;  4QWQ A;  4J19 A;  1FX7 A;  2W84 A;  3S3M A;  2IA0 A;  3OYC A;  3HOU J;  4XN0 A;  1V4R A;  4RDU A;  1TT5 B;  4EM0 B;  3VYU B;  4FAS D;  3PO3 J;  4QIW N;  4RGX A;  1XX5 A;  3C7J A;  2E1M C;  1TWG J;  3GFM A;  3NWT A;  3J7A O;  2IS2 A;  1MW7 A;  2W7N A;  4JX5 A;  2FU4 A;  3E6B A;  1GDT A;  2TCT A;  1YRN B;  4F7Z A;  4LIV A;  1H8A C;  1R5G A;  2H1L A;  4B44 A;  1E0E A;  1IV8 A;  3JRB A;  3W3C A;  3WTU C;  1T39 A;  3ERM A;  4ENK A;  2CG4 A;  4C2T A;  1GXP A;  2Y0S A;  1ZK8 A;  2L9V A;  4CCL A;  4FHT A;  2JQ7 A;  1FOX A;  1YYV A;  2GA2 A;  3IH2 A;  2DJN A;  1FTZ A;  4XRM A;  4UXN A;  2R5Z A;  4B48 A;  3LA3 A;  3AG4 H;  4ZZL A;  1VFC A;  2E2J J;  1P2F A;  3MZ8 A;  3GEZ A;  1YIJ I;  2IS1 A;  2WB1 N;  2VON A;  4UUS B;  4UY8 I;  2P6S A;  2KFD A;  3KP5 A;  4P1W A;  3BZ6 A;  1U5T C;  1W7P A;  3HSR A;  4AYB N;  2ZBK A;  3CMY A;  3S2H J;  2GM4 A;  1KU9 A;  3OL4 A;  5BPD A;  3LQR A;  1MBH A;  1SD7 A;  2FBK A;  1KQ0 A;  3DTI A;  2HNH A;  3CC4 I; 
#chains in the Genus database with same CATH homology
 1MBK A;  3IH3 A;  2LK2 A;  4C3H J;  2HOA A;  3S15 J;  2GBY A;  2GLO A;  3FK6 A;  1MBE A;  2LP0 A;  3Q0V A;  5IP7 J;  2EZL A;  1JKQ C;  4DZJ A;  3BQY A;  1HCR A;  5JLX A;  2DA6 A;  5C44 J;  4A3I J;  1JT0 A;  1JKR C;  1OFC X;  2LD5 A;  2VPR A;  1TWC J;  2CRG A;  1XG1 A;  2Y0S N;  2HDD A;  1P7J A;  5GP9 A;  2ID3 A;  2FX0 A;  2HQ5 A;  4UUT A;  1U9N A;  3BR1 A;  5K7F A;  1ZTR A;  2NVT J;  1EF4 A;  2ID6 A;  1WI3 A;  5HOD A;  4ABZ A;  4X1E A;  3WHC A;  2YU9 J;  3LNQ A;  3W6V A;  1Z0X A;  4BBR J;  5FKK A;  4W97 A;  4AUX A;  3HDD A;  1OCP A;  2DMQ A;  3I4N J;  3MKL A;  2R5Y A;  2XGE A;  5IP6 A;  1BW6 A;  3NAU A;  1Z77 A;  1FIA A;  3IH4 A;  2R93 J;  1G2H A;  5F1J A;  3FKI J;  2MSY A;  3JRI A;  4C3J J;  3M3Y J;  1PUF A;  3D1N I;  1E3O C;  3GTJ J;  1ZKG A;  2L7F P;  2EBI A;  4D5F A;  1HLV A;  3G1O A;  1F36 A;  4M3F A;  1IDY A;  1MH3 A;  1BL0 A;  3BTL A;  2B63 J;  2JA5 J;  4A3E J;  2QCO A;  3M4O J;  3S1Q J;  5F08 A;  3JRG A;  2IAI A;  2ME6 A;  3HOV J;  4FE7 A;  2KDZ A;  1GV2 A;  4C3I J;  1Y1V J;  4GFB A;  5IPA A;  1YRN A;  1JTX A;  2Y31 A;  5E3N A;  5C4X J;  1SAN A;  3HGG A;  4DYC A;  3FIW A;  9ANT A;  2E2I J;  3JRD A;  1P7I A;  3A02 A;  3BG3 A;  2CQQ A;  1BW5 A;  3GTQ J;  2XSD C;  1O4X A;  2XPW A;  2XGD A;  1Y1W J;  3DCF A;  4V2F A;  1ETK A;  2QF7 A;  3TW6 A;  1A6I A;  3HEF A;  1B72 B;  2LLK A;  1MBG A;  4S0H B;  1LFU P;  3BTJ A;  4IHW A;  2LY9 A;  3QPS A;  3FK7 A;  5EYR A;  2HYJ A;  5EGO A;  3Q0W A;  1IRZ A;  1QRY A;  1JKP C;  1FTT A;  5F0F A;  4BKX A;  3ZQF A;  1W0T A;  1PUF B;  1H89 C;  1JJ8 C;  5EG0 B;  1ETY A;  3O8H A;  1TWF J;  1U8B A;  1GUU A;  2HI3 A;  1APL C;  4QTR A;  1Q1V A;  3WHB A;  2D5V A;  2DN0 A;  1ORK A;  3S14 J;  3BR6 A;  5IYD J;  2DA3 A;  4X6A J;  1IG7 A;  3BG9 A;  5DS9 A;  2I10 A;  1NK3 P;  4FIS A;  2ECC A;  4MFE A;  1HF0 A;  1UG2 A;  4BY7 J;  1HOM A;  4LOC A;  4L5E A;  4A93 J;  4MFD A;  2NVQ J;  1X2N A;  4D5C A;  3LSJ A;  2LVS A;  3S16 J;  4MLO A;  3S1R J;  4Y7N J;  1BA5 A;  2XB5 A;  4CYC A;  1MBJ A;  3HOZ J;  2E2H J;  1RET A;  3PM1 A;  2H1K A;  3H3V K;  3FIS A;  1DU6 A;  2K9S A;  2ME0 A;  1F43 A;  5DTD A;  2L9R A;  1I3Q J;  4XIC A;  3RZO J;  3UKG A;  2NOG A;  2DMN A;  1POG A;  3TED A;  1IJW C;  3GTK J;  2VUM J;  5BNG A;  1LE8 B;  1QVT A;  3HOX J;  5EGO B;  2JA6 J;  1K83 J;  3BR0 A;  2O8K A;  3OIO A;  5J1Y A;  2DA5 A;  5EEA A;  3ZQI A;  2TRT A;  2DA7 A;  1ENH A;  2IEK A;  2OPT A;  2W48 A;  3B6A A;  3TW7 A;  4A3L J;  2DTZ A;  5FKM A;  1I50 J;  3E7L A;  2Y30 A;  5E3L A;  3A01 B;  1VF9 A;  2DA4 A;  4UUS A;  4IHX A;  3DEW A;  4MIM A;  2CQX A;  2R5Z B;  1TWA J;  4C2M J;  2XGC A;  4M3D A;  1RES A;  3K2A A;  3HBL A;  2P81 A;  5FKO A;  4M3E A;  3ZQH A;  3LOC A;  5K7H A;  3OSG A;  3HKZ N;  2JWT A;  2EZI A;  2NVY J;  1UHS A;  3K7A J;  4XRS A;  3LSG A;  1WH5 A;  2AHQ A;  1IC8 A;  1X58 A;  2PMZ N;  4RBO A;  2DMU A;  3BR5 A;  2FJ1 A;  5C3E J;  3SJM A;  3GTL J;  1ITY A;  1LE8 A;  3C2B A;  3GTG J;  5F27 A;  1UMQ A;  3Q3S A;  3Q0U A;  4D7N A;  2IBD A;  2H8R A;  1GV5 A;  1NTC A;  2R7Z J;  3L1P A;  2XRL A;  2E1O A;  1S7E A;  2LR8 A;  1XC5 A;  5J3L A;  5K7Z A;  3HOY J;  5FKN A;  4IEJ A;  2MG4 A;  1JUS A;  5M3F J;  2N8G A;  2M2E A;  1JUP A;  1JJ6 C;  4QSH A;  1ETX A;  3I4M J;  4B1R A;  5EF6 A;  2X48 A;  3JR9 A;  2VKE A;  2LTP A;  3RKQ A;  2NS7 A;  1ZR2 A;  1FIP A;  5FLM J;  4W1U A;  3QPL A;  5F0H A;  2JA8 J;  4JYK A;  2M9H A;  3G1L A;  5GPC A;  1IUF A;  4MO7 A;  5JLW A;  2X6O A;  4CYC B;  2WV1 A;  1GVD A;  2O7O A;  4BXX J;  1WH7 A;  1RKT A;  2FD5 A;  2R0Q C;  2L7Z A;  3BQZ A;  3ZOB A;  5J1R A;  2AO9 A;  2RAE A;  4B4C A;  1JTY A;  2VKV A;  4AC0 A;  2JN6 A;  1AKH A;  2ECB A;  3HGY A;  1ZGW A;  5M5Y J;  1ZQ3 P;  5EZH A;  1MSE C;  3GBG A;  2JJ7 A;  2CU7 A;  2DA2 A;  3CCY A;  3HOW J;  1JT6 A;  2OF7 A;  2XB0 X;  1U78 A;  5FJ8 J;  1U9O A;  2CUE A;  4B3A A;  4V2G A;  4D7M A;  1RR7 A;  1QVU A;  2KT0 A;  2O9L A;  3S1N J;  3GTP J;  3TP0 A;  1CQT A;  4Y52 J;  5M5X J;  4BY1 J;  4A3B J;  1VND A;  2CJJ A;  1SFO J;  1B8I A;  4G12 A;  4FE4 A;  4FTH A;  2Y2Z A;  2R5Y B;  2HOS A;  3O8G A;  3RQI A;  3JRF A;  1TWH J;  3BG5 A;  3LSR A;  2HXI A;  1R9T J;  3ZQC A;  3BTC A;  2L0K A;  1LFB A;  1GT0 C;  4NDL A;  2LFB A;  2R92 J;  2MGQ A;  1MBF A;  2YUS A;  4DW6 A;  4HNV A;  4XRS G;  3MN2 A;  1IDZ A;  3HB9 A;  2YS9 A;  4A3F J;  3A01 A;  5F0C A;  2MW8 A;  2HOT A;  2Y9Y A;  2HXO A;  2CUF A;  3MVP A;  4I76 A;  4A3C J;  3GTO J;  1WCM J;  3SDG A;  2NS8 A;  4XK4 A;  5EZG A;  5IOZ A;  3ZQG A;  2EZH A;  1RPW A;  2K9N A;  5IYC J;  4M6V A;  4I6Z A;  1MSF C;  1A5J A;  2E19 A;  2XPV A;  2K9Q A;  2X9D A;  1XS9 A;  4DYQ A;  2EZK A;  5IYB J;  1K61 A;  2COB A;  5E3O A;  1WGX A;  5IP9 J;  2WAQ N;  4A3K J;  3JRH A;  4JX6 A;  2JK3 A;  2K40 A;  3CDL A;  5GPA A;  4FCY A;  1BJZ A;  3S17 J;  2DMT A;  5FLV A;  1AKH B;  4EEF G;  2JMW A;  3JRE A;  1ZR4 A;  5FKL A;  1B8I B;  1ETO A;  3JRA A;  1FEX A;  1ETQ A;  4A3M J;  1OCT C;  5IOY A;  3PO2 J;  1VI0 A;  4A3D J;  2Y9Z A;  1JUM A;  1QPI A;  2DA1 A;  2M8G X;  3OSF A;  3S2D J;  1OJL A;  1IV6 A;  1ETW A;  4A69 C;  5EDN A;  3F0C A;  3A03 A;  3BT9 A;  3BR3 A;  4M3B A;  1FJL A;  2ELK A;  2XPU A;  2NVX J;  1IGN A;  4IHY A;  2FQ4 A;  3NAR A;  1MH4 A;  2ZB9 A;  1TC3 C;  3RZD J;  5J1U A;  4J19 A;  3VPR A;  1AHD P;  3B6C A;  3BTI A;  2G0E A;  3HOU J;  3HM5 A;  4RDU A;  3PO3 J;  1WPK A;  4QIW N;  4IHV A;  3GTM J;  1TWG J;  3BR2 A;  1MNM C;  2JA7 J;  5E3M A;  4JX5 A;  3LSP A;  3OOU A;  2DMP A;  3JRC A;  1GDT A;  2TCT A;  1YRN B;  1W0U A;  5EG0 A;  5F04 A;  3TP3 A;  1H8A C;  4A3G J;  4DYR A;  5C4J J;  5M5W J;  1HDP A;  3H0G J;  3JRB A;  2L7M P;  1D5Y A;  1H88 C;  4A3J J;  3S1M J;  1AU7 A;  1RKW A;  1ZK8 A;  2M34 A;  1T56 A;  1B72 A;  5M3M J;  2EQR A;  2EH3 A;  2VI6 A;  3IH2 A;  2DJN A;  1FTZ A;  4XRM A;  4XID A;  1NK2 P;  3SFI A;  2R5Z A;  2M0C A;  4DZP A;  1HDD C;  1I6H J;  1ETV A;  3G1M A;  1VFC A;  1JKO C;  2E2J J;  3ZQL A;  2WB1 N;  3CQZ J;  4UUS B;  1JGG A;  4JX4 A;  1DU0 A;  4M3G A;  4AYB N;  3CMY A;  3S2H J;  2GM4 A;  1X2M A;  1T33 A;  4BBS J;  1MBH A;  3IV5 A;  4JP0 A;  2LKX A;  3QQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...