3AG3H

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag3H00
2EIMH 3AG4H 3AG3H 3AG1H 1OCRH 3ABKH 2EIJH 3ASOH 3ABLH 3ASNH 5IY5H 3ABMH 3AG2H 1OCZH 3X2QH 1OCCH 2EIKH 2ZXWH 1V54H 5B1BH 1OCOH 2DYRH 2OCCH 3WG7H 2EILH 1V55H 2DYSH 5B3SH 2EINH 2Y69H 5B1AH
chains in the Genus database with same CATH superfamily
3QPTA 3TQNA 2RREA 4HAMA 1A5JA 3S1MJ 4PZJA 4MTEA 1MH4A 2VT2A 4QWQA 5HODA 1JKPC 4PJLA 4EATA 1Z1DA 3H0DA 4BBRJ 2MBFA 2XAUA 2IW5A 1R1VA 2CW0F 2WAFA 2ZC2A 3M1CA 3V7CA 2PI0A 3ZR8X 3I5UA 3E5XA 2Q0OA 1QVUA 3DKWA 4XOTA 2KZVA 4XBFA 3CCJI 3LSRA 1WZ2A 3FBNB 1S8NA 1YQAA 3WTVC 2K7LA 3PUBA 5FKLA 3K4LA 3T5XA 4XLCA 5A2QK 2VJIA 3K2ZA 1DGWY 3H3UA 1CQTA 4G12A 4LG3A 5H2FC 1IN6A 1XSVA 4QLCU 1KONA 2BY1A 2XUBA 3IH4A 1J0RA 2FEZA 3L1PA 3ABLH 4DBRA 3QYEA 3LSHA 3RZDJ 1R71A 3OL4A 2EZIA 4XN3A 9ANTA 5FRNA 2Z1DA 1H9TA 2O8XA 1DGRM 4RM3A 2CG4A 1UG0A 1YG2A 3QOEA 1ZG5A 1RUOA 4EV0A 2V1DA 3O8HA 1IDZA 1MJBA 4LB6B 5HLHA 3IWFA 5M5WJ 2BXZA 2CW8A 2QGUA 3JRCA 4MGRA 2BHYA 1NK2P 1XD7A 2W1OA 1MJ9A 5HLTA 1X58A 2PG4A 4YFKF 1FOXA 2JT1A 1W7PD 2R5ZB 4KMFA 2VB6A 1I6XA 1ZHFA 2DMNA 4MQ9F 5EGOA 1S5LC 3GZ6A 1WH5A 2JPBA 3A01A 4R79A 2A68F 3IKTA 2DBBA 3KYLA 3A0HC 1BW6A 3IH2A 2D45A 3LSKA 5CVJA 6PAXA 5L3DA 2GAUA 3CMMA 3KZIC 2IA0A 1TTYA 1XSDA 3J7ZI 3HOSA 2ZJRF 1LFPA 5LHGA 2COBA 4FISA 3RZOJ 1BIAA 4CXFA 1D8KA 3CCYA 5BS6A 2QZ8A 2LG4A 4Y7NJ 4PFOA 5ED4A 2YU3A 2AQEA 5A2QZ 5J1UA 4KMUX 3DLAA 1E3OC 2F5FA 4AM3A 4ZDOA 4XLEA 3MEXA 5K5OA 1MMGA 1YS7A 3WGGA 2W57A 2BW3A 1I5ZA 2CUZA 4E4HA 2A69F 1HKSA 2BHZA 2DA4A 1ZKGA 5ILSA 5J47A 3DBRB 5IP9J 2IGOA 5AONA 3PIPF 1LVKA 2G7UA 3CJTB 4U0VA 3RKQA 4A93J 1T56A 1WJBA 3FXLA 2CW7A 4CCOA 4IX7A 3ML6A 3K0LA 5JR3A 3S17J 1SD7A 1N25A 2VPLA 3TDZC 3TO9A 2WBMA 2KMUA 1J7KA 5E3NA 2VASA 4OOIA 2BY3A 1LFBA 3R60A 2DQRA 3KX2A 1D0ZA 2BGCA 3OOPA 2DA1A 3OYBA 1XGSA 2L9RA 3OYKA 2Z3YA 3BQYA 3OYLA 4JX5A 2NS0A 2VBYA 2MG4A 5EGOB 5GTHC 2KHMA 2CJJA 1JHHA 2COMA 4BU2A 1FOYA 3A01B 1KQ9A 4L9VA 4HV6A 4XONA 5EEAA 2WV0A 2GBYA 2LKSA 1MBEA 2ZB9A 3E5UA 1PJRA 4XLNF 2ZSHB 3EYYA 3F8MA 3ZQFA 3HUGA 1UELB 4CYDA 5CKTA 1HKQA 2ELKA 2Y2ZA 4ZDLA 4M6XA 3FK7A 4GYGA 2RNJA 3HPGA 5LRSA 1JJ8C 5D4SA 5LEKA 2K85A 4IF4A 5KVRA 5FJ8J 1PDNC 2H27A 3GMEA 3CZ6A 4FX0A 2EIJH 2K9QA 1JKOC 4ZZLA 3CLOA 2HXOA 2X1CA 3KE2A 2O9LA 2BW3B 5DUKA 1GV2A 4QSHA 3CCSI 1TWHJ 2JWTA 3MKZA 1ZGWA 1OQYA 4A3FJ 3L7WA 1MBHA 4IJAA 4U7DA 4D7NA 4KITB 1OISA 1JKQC 3B02A 2A5WA 1SMYF 4M9ZA 3LWFA 5LGTA 2PLYA 4WK8F 2W82A 3OYJA 2QM3A 2GXGA 3OY9A 1K61A 2ZJPF 3IAM2 3ZMVA 2LC2A 2IVMA 4A3BJ 3NRVA 3HXLA 4LFUA 4JP0A 3BG6A 2VC1A 3ZMTA 3E6BA 5JHUA 3F6OA 4XR6A 2ZBKA 2UXNA 3CDLA 2GOMA 2Y69H 2IGNA 2JMWA 4BS9A 3JSOA 3IP4B 5E1XA 5EDNA 3LA3A 3TGNA 1G3YA 2LLKA 3DTEA 2ZXHA 2LDUA 1K79A 4P5OA 3BWGA 1X3WB 1APLC 2HFHA 3HUGB 2RC4A 2HPIA 4AVZA 2CWEA 5CQGA 3PO2J 5DUIA 4RB3C 1OCZH 2FNPA 1OCCH 2ADUA 5GTIC 2XAFA 3D1NI 2XF7A 3A02A 2DYRH 4KDPA 2HVSA 2PFBA 4I6ZA 2OC6A 1F43A 3MD2A 2GOXB 4UV9A 4GCVA 1VZ0A 2FJ1A 2EFPA 1Y56A 2E1OA 2EFNA 2FSWA 3OYNA 1VQ9I 4KT5C 5C4XJ 2X48A 1HW1A 1Z91A 1K78A 3TOAA 4FQGA 1P9QC 5LBQA 4ENKA 4IRGA 3U1KA 1TBXA 2E7WA 2EQRA 3FMSA 3HRTA 4G8XA 4KIGA 3RYRA 3SJMA 2V9VA 3JCUC 1TT0A 3PNYA 1RRJA 3F8CA 2YPRA 4RGSA 1AHDP 5LD2C 2EB7A 2R7VA 2NXNB 1IGNA 2XPUA 5ICCA 5KCMA 3JRFA 2O3FA 2JUGA 3LSJA 1T8IA 4CCKA 3K2AA 4UVAA 1EH8A 1A35A 4UB6C 1ITYA 2QUFA 3HOYJ 3CCVI 2O8KA 4ZYGA 5J1RA 3TO6A 4B3AA 3E6DA 2LNBA 2O0YA 1GDTA 2OQRA 2O6GE 4E7LA 2FQ4A 3M4OJ 3MMYB 2XASA 3CMEI 2HOSA 1SEUA 3BJOA 4MFEA 4IQJA 5DDGA 3FKIJ 1HW5A 2FXAA 3AG1H 3B73A 3A1YA 5DD8A 3HHGA 3BZKA 2XV4S 1IRXA 5E3LA 1KZHA 4FE4A 3ZQGA 2W24A 2IRFG 4E7IA 4D5FA 1PVEA 3JRAA 1VTNC 3FXOA 1RC9A 4A3IJ 2Z9OA 4M3GA 3TMOA 1E17A 2BOLA 1QNTA 4OWRB 2R7WA 3QQAA 3DF8A 2NOJB 3KFWX 4Q48A 3L2WA 2FNAA 2XAJA 3S2HJ 2AO9A 3ZQHA 2DPUA 3E5QA 1VNDA 2IJLA 1D1BA 3GLLA 5J6XA 2P81A 3GVAA 2IGKA 4F3QA 4ZYEA 5HLGA 2CRGA 1K78B 3Q0UA 1T95A 2HYJA 1FBUA 4LK0F 3MWMA 4CCLA 4A69C 4EVIA 3ZN0A 2IT0A 5B5EC 2HGCA 1ETYA 1UHMA 2D1VA 1ETVA 2QBYA 4XKBA 1JUPA 4U0WA 4IPAA 1K6OA 4Y17A 2ID3A 4EJUA 1FLIA 1S7EA 2KRCA 3ZXSA 4XOPA 3TKYA 2E1CA 5C3EJ 3BTLA 2OJED 4N0BA 1G3SA 4U0YA 3OOUA 4HPQA 3I4NJ 2PMZN 1YOVB 4D7MA 4AC0A 5D5WB 2F5CA 3F0CA 4EJTA 2HYGD 2OAZA 1AKHB 4I0AA 1EH7A 2M4GA 4IOAF 2O61A 4LIVA 4LB5A 3M1EA 3BY6A 2PX9A 5E1WA 2OUMA 3OS0A 3HBLA 3QWLA 5CPRB 2NVTJ 4JQFA 4FETA 4I2OA 3PNTA 2LTPA 2X1EA 4BE1A 2Z16A 2CYYA 4B4CA 2HQAA 3P9IA 1TQIA 4B1RA 1LDJA 2ECBA 2VIXA 2X6WA 3MKYB 1REPC 3G71I 3HTSB 3LQRA 1E0EA 4XLPF 3V7SA 3CMAI 1KYZA 3PM1A 1Y39A 5FKMA 2CH0A 4GO1A 4JOMA 1K4SA 2KKOA 1JKRC 3VB2A 2XAHA 3WU1B 1W36D 1B9MA 3OSFA 1OCTC 2HQNA 4A0XA 3BR1A 2DT5A 3JSPA 2KQRA 2VBXA 2K9MA 2A6EF 1S6LA 2NAZA 1ETQA 1X3ZB 1PUFA 1HSTA 1BI1A 4NQWB 2HDCA 3BJAA 1GLNA 5DYMA 4OIPF 1KYWA 2Y9YA 4KIBA 2L5QA 4R1HA 5JVGF 3L2RA 1I6HJ 4OAYA 3C2GA 2K86A 5H6RA 3BDDA 2DTZA 4PDKA 2QBYB 1QGPA 2HVQA 1HKTA 2EV0A 2I10A 2JA6J 3MAJA 2W4SA 3I54A 1U9NA 2PN6A 3IWZA 3OYMA 1I3QJ 3IKVA 4IHYA 1Z7LA 1PYVA 1W0UA 2XSJC 1GT0C 3HHHA 2C6YA 5L3BA 3ZRGA 1SD6A 4XKCA 3JRGA 2EA2A 2L4AA 2VN2A 1JTYA 2JVHA 2LBFA 3BQZA 3NWSA 2B9SA 1SD4A 4FX4A 1VQ8I 1UMQA 3CO6C 1VI0A 1SAXA 3BR2A 2ZCWA 4CZZA 1V4RA 3KYCB 1P7IA 1G8XA 5BOXA 1LVAA 5EEHA 5HLIA 2ZFUA 3V8JA 1NG6A 3DCFA 3IC7A 3G1LA 4KN4X 1OKRA 2MFZA 4S05A 3ABTA 3GUDA 1IXSB 4DYCA 3VYTB 4ZYHA 1OCRH 3ZQCA 1USTA 1XSXA 2M87A 2OCEA 1IUYA 3HRUA 3M3YJ 1LQ1A 3HC7A 1RKWA 4NB5A 3BOQA 3TOBA 4AYBA 1L3LA 3DXJF 4C9YA 1W5SA 2L9NA 3K6GA 1ZK8A 1DP7P 1ZYRF 1VQMI 2DI3A 1Z7UA 2RNGA 3KEOA 3ABUA 3E7LA 4BGDA 1PUFB 2LY1A 3BTIA 2QKLB 4C3IJ 2QF7A 4XMYA 2E35A 3ZMDA 1HDPA 3ZQ7A 1FTTA 1O7FA 2EZLA 4G6QA 3WE3A 2QQAA 5JI6A 4CH7A 1FY7A 1CGPA 2L9SA 1UG2A 2W25A 5FKKA 3H5NA 2LBFB 3ULQB 1I50J 2LSOA 1FIPA 2VBWA 1YS6A 3BG3A 3CDIA 1J2XA 2Q2EA 3TL4X 4A0YA 4LG0A 2R7SA 2JA5J 2PEXA 3LMMA 4KICA 2XPWA 4EMSA 1I3AA 5BNGA 3CP8A 3SYTA 1FT9A 3S32A 1FYMA 1R4MB 3SDBA 4PUSA 2NS7A 1QVTA 1TW2A 2B0LA 2YX4A 4XORA 3F8NA 5HS8A 2L02A 3L2VA 3WTSC 3GFJA 1Z67A 1F1ZA 1TWAJ 2E1NA 2MW8A 3BZ6A 3DPTA 3FXJA 3RPQA 3ZN1A 1UJ8A 5FGMA 2CQKA 1JUSA 4HSTA 1MBFA 1Z21A 3HG9A 2Y48A 2QCOA 2V1NA 1HDDC 2CV0A 2CQXA 2D2WA 5FRMA 4M3BA 2KLOA 5BPDA 3OMYA 2OU2A 4RGUA 5CJ9A 5IT3A 2ELHA 2E60A 1B1BA 2KJCA 4XSXF 3D5SC 4A3MJ 1BR2A 1BI2A 2RDPA 4E70A 4EM2A 1V3FA 2HOAA 2CU7A 2ZFWA 2GXBA 3LQQA 5IPAA 2HOTA 2MD0A 3CJNA 2LKXA 3S3NA 1BC8C 3P9KA 2FQ3A 1IRFA 2FU4A 4BHPA 5H6QA 3RQ4A 4RMNA 1P2FA 3NQOA 5FLVA 2OTLI 2IAIA 4DQ2A 1NHAA 4UVCA 4HV5A 2STWA 4CZCA 3VYSB 1IW7F 3S8PA 4LLGF 3V4GA 4MQVA 4LLNA 4DOZA 2DW4A 2WB1A 3DFGA 2PJRA 2DLLA 3EUAA 4C2MJ 4Q5SF 1UHSA 3B6CA 3T1BA 5LEJA 2B63J 1FOWA 4A0ZA 3GTMJ 1POGA 2KT0A 2GXAA 1P92A 2ECCA 3VSLA 2TCTA 2V4JC 3T8RA 2DFFA 2F5EA 2Q2EB 2Y0SN 3KP5A 3HJEA 3RYPA 4I7HA 4BE0A 2LYCA 4LG0B 3S3OA 2Z99A 2Z5UA 4G7ZF 5FD6A 4IHVA 1JGSA 3A4CA 2JJ7A 3W2VA 2ZJQF 3K4NA 3FZVA 2MD5A 4BQOA 2R7XA 3KP6A 1FIAA 1R5ID 3O2PE 1D8JA 1J59A 3GBGA 1X3UA 2IS1A 4IRHA 3PO3J 4O6JA 1X19A 1YRNA 5DD4A 4AUXA 5F0FA 1HC8A 1LDKB 4H0EA 4N9HA 2ZNZA 3R6SA 5CVVA 2MH9A 3R61A 4HF2A 4DGWB 1Y6IA 5KNLA 5K1YA 4JBAA 1K7AA 3PJRA 4RLFA 2KL4A 3H92A 2DOEA 2OF7A 4JK1X 5AIQA 2FD5A 2R92J 3E6MA 3HM5A 3ASOH 3RJPA 1KA8A 1HXDA 2DMQA 2MABA 1R49A 1MDMA 4Y15A 5ICGA 2DO7A 2H1LA 3FM3A 2Q1ZB 4L9TA 4YELA 4U7BA 3NEUA 3O3KA 5ILUA 4BUPA 3KP4A 3LL7A 4UXNA 3ZMZA 1H88C 1MBGA 4A3LJ 2ICWG 3KYDB 1H9GA 4DNCA 4XKVA 2LVSA 5EYRA 4HNUA 1B6AA 1BL0A 3MKLA 3F22A 3HSFA 4EJWA 4HQEA 4IRIA 3CCMI 2ZXIA 5EZGA 4RB2C 2UUZA 1X1BA 4M9XA 3RQIA 4ENJA 2PJRB 1X2NA 1VQOI 3B6AA 5K7FA 4X6AJ 3I0TA 4RS8A 3JRDA 2WTEA 2E34A 2K4JA 2VKVA 3IUOA 2NVQJ 1FTZA 3G3ZA 1XDUA 3S2DJ 1ZARA 5L3FA 4A3CJ 2KIFA 3SEQA 4ZTJA 1YIJI 5TRDA 3HKZA 4XRFA 2XIGA 2RQQA 3GXOA 4UB8C 2GLOA 1IV8A 2ESNA 4PJMA 3K4MA 4GRIA 5J8FA 1B8IA 1J75A 5J4VA 2M8GX 2DN0A 4CYCA 2HPMA 1Z3YA 5E20A 4M3EA 2VJ4A 4CUGA 3AL0C 3SZPA 2Y30A 2JRMA 4XLFA 3PFIA 1TL8A 3LSMA 1HBXG 3L9FA 5ILVA 1D5YA 1YO5C 3L2CA 5CYVA 1DPRA 1VF9A 2OTJI 5JLWA 2VQGA 2L7FP 2O5RA 5E8GA 4LMYA 3SHFA 2BE5F 3VODA 4OU0A 3GFMA 3NARA 1I39A 1MDMB 1RKTA 3QPSA 1SAUA 4P96A 5HNHA 3KEQA 1ACIA 2K27A 4M73A 4P9UA 4LJZF 2DODA 2PBIA 1X4PA 4YEJA 2AS5F 4ZJZA 1VQLI 1MSFC 1YJWI 3FBIB 2DMUA 3K70C 5BPIA 1O3SA 1YW7A 3ERED 1V5EA 4EGYA 1G2HA 3Q0VA 2WY8Q 5K5RA 4HLXA 2K4BA 4BQAA 1YJ9I 2V1XA 5DCMA 2DA2A 4G9YA 4M3FA 2HU9A 5B1AH 3OIOA 3CMYA 4Y52J 3E1SA 3PSFA 1SVMA 4RA2A 1ZRCA 2P0WA 4II2A 4KN7X 3RIRA 3WTYC 1U8BA 3TEDA 4FE7A 3W2WA 3Q9VA 4I02A 1BW5A 1WKMA 1OMIA 2GIVA 2JSPA 3FF5A 2V1UA 3GZ5A 2ZMEC 1R5HA 5IY5H 1XGMA 3MZHA 3HDDA 5DEQA 2X6OA 3S14J 2YU9J 1X2MA 1XB4A 3E6CC 2CGPA 3U21A 3IAS2 3JTHA 2A6TA 2VL8A 2IBDA 2ZXJA 1R36A 2EFOA 3BLYA 1R58A 4CDGA 4RGXA 4OIOF 3FXQA 4A5NA 2XB5A 2FF4A 4RB1A 2JZYA 1B8IB 3HGYA 2M9HA 3QPLA 2EJRA 4HF0A 4J00A 2WC2A 3RKXA 4CYCB 5JLXA 2QSFX 3LA2A 4Y4RA 3S2WA 4XLHA 2JTVA 1Z9CA 2EZKA 3BG7A 5TJJA 1D5VA 2LOOA 4I76A 5F08A 4HX8A 4ASNA 2FBHA 3F9KA 4AYBN 4A3EJ 3DEEA 3HZJA 1RESA 3JRBA 4NC7A 3CC2I 2K3PA 2RN7A 1WFXA 2MC4A 1R00A 3LA7A 4F91B 5F1JA 4BNCA 2E7XA 3O8GA 1QZZA 2K3FA 1GVJA 4ZYAA 1WI9A 2PQ8A 4FT8A 3DBLB 4AIHA 1R9TJ 2L54A 3G73A 1HW2A 2HXIA 3FK6A 1SC7A 4NUBA 5FLMJ 4A3KJ 3T8TA 1WJCA 1TWGJ 1PP8F 5FFXA 3K4BA 1WCMJ 5DCMB 2LFBA 4BL0B 4E7ZA 3CDHA 1EJ9A 2DOFA 2ZKZA 4Z2YA 1ZQ3P 1SFKA 3BR5A 2MYSA 2E71A 1H89C 4YRVA 2WV1A 1ZREA 1C0WA 1QRYA 5HDKA 5E18F 3ZQLA 1NTCA 1WWXA 1IRGA 1XN7A 3DWLE 2X4HA 3CUOA 1ULYA 2K02A 2ID6A 3DTKA 4HX7A 2HDDA 1FP1D 3GTQJ 2NYXA 4ENNA 1AWCA 1T08B 1Y0NA 4IKFA 1WJ5A 2H8RA 3F8BA 1FP2A 3AG2H 1Z0XA 3C2BA 2LP0A 3RKWA 1Y8QB 5FLXK 1KQ0A 3A03A 2RGVA 1QHHD 4OIRF 3GZNB 5GAEJ 1ON2A 4I99C 4IXAA 3VDXA 3L2UA 4G6TB 2XB0X 2GM4A 2M2EA 2R7ZJ 4E7KA 5D8LB 3KIOA 4BDYA 2F2EA 2M3AA 3HOUJ 1KGSA 2EBIA 5F64A 2IA1A 1U0JA 4QIWN 2HZTA 3GEZA 1YIOA 2WAEA 3DQVC 2Q8KA 4ZH4F 2X9DA 1FPQA 1STZA 1JUMA 3TP0A 4AD9A 3CCLI 3AFHA 3I58A 2EV6A 1QA6A 3FXRA 4F52A 2BVMA 5L3EA 4AWXB 3AG3H 2CFXA 3JTGA 3MZ8A 2Y75A 4GFBA 1PP7U 2CO5A 5CVRA 1W5TA 2Y0MA 3GO5A 1T0FC 4B44A 3I9V2 3HOTA 4KIFA 4Z6YA 2HTSA 2HZDA 2J5OA 2X6XA 2G7HA 3QAHA 3WTWC 4M9SA 5CVIA 4KA4A 1I1SA 2ME6A 3EDPA 4Q4ZF 4OMYA 4IL6C 2L3DA 3LAPA 2WB1N 2ACJA 1K83J 2LR8A 1YFHA 1E3HA 4F55A 1ZG1A 1IV6A 3PQKA 2F4OB 2QQ9A 2DMTA 2MA3A 5J1YA 1S7OA 1MIJA 2QSGX 4ZYDA 1JGGA 2WADA 3ECHA 3FKJA 4W97A 2Y31A 2KRFA 1FMWA 1WJAA 1WJEA 3BPVA 1XPXA 1YI2I 5L3GA 3IH3A 5DV5A 1P4XA 1QPMA 1MNMC 1HLVA 2F4MB 1KU3A 3COAC 2I8DA 3FMRA 2IGMA 4L5EA 1JXSA 2L7ZA 2VQHA 4D5CA 1LFUP 2GA1A 2VBZA 2P6SA 4M72A 2G0EA 5CQEA 4BXXJ 2NOGA 2EIMH 5FKNA 3D5LA 5LGNA 4JYKA 3WGIA 2VT3A 1SMTA 1LDDA 2VQCA 1F36A 3TO7A 5K7HA 1Q1VA 2RVCA 2OD5A 2XKPA 4RB0A 2EFWA 5EEGA 1MZBA 3TDUC 1ODDA 1Y1VJ 2XGCA 3QU3A 4O3MA 2HVRA 4RAFA 3ZMSA 2JSCA 4ZTFA 3TP3A 4BAYA 4BHBA 4NC8A 5M3FJ 2CQ7A 1OR7A 1LEAA 4JX4A 3ECOA 4YG2F 4OMZA 3C3WA 1ZELA 4O5VA 1VFCA 1Z77A 3G1MA 2DT7B 3CF2A 4B43A 3EUKL 3WG7H 2R0QC 1I27A 5JVTA 1LNWA 4DYRA 2R7FA 4MNUA 3GX4X 3H35A 3J80K 1FOKA 2E2IJ 1O3QA 3MCZA 2A6HF 5HDGA 2CFOA 2V6CA 3F72A 3AKZA 3I4PA 3RSNA 1A6QA 2FUG2 5E1ZB 5K5QA 4RAZA 1YLFA 1SVOA 1QPIA 2HYFA 2HS5A 3CESA 3N05A 4IZZA 3S93A 2ZSIB 3E3VA 4XIDA 2KIUA 3ZMUA 2CUEA 2YR2A 3WTUC 3LSGA 2DDBA 2JA8J 1FJLA 1WGXA 3ZP5A 2XGDA 5IT9K 1HSJA 1D1AA 1D3YA 2EINH 2R3SA 2X6YA 3CUQA 3Q3SA 5GADJ 3RKYA 1YW9A 4S0HB 5CLSA 3QYBA 2DK5A 2DA7A 2PMUA 1MNDA 2FOWA 3HKZN 2E5ZA 3K7AJ 1BR4A 1OYIA 2KIQA 3GTOJ 4G7OF 1FZPB 2XROA 3KP7A 3R0AA 3BG5A 1DQUA 1ETXA 1Q1HA 1XC5A 3JAMK 3MFKA 3N4MA 3WG9A 1JI8A 4TV7A 1R22A 2IXSA 4W1UA 3LNQA 1BA5A 3U1DA 1R7JA 4HF1A 4GXOA 1MMNA 2YUSA 4C3JJ 4V19K 2JN6A 2VI6A 1MW7A 5J4YA 2M1BA 1MNEA 3F8FA 3C2HA 3G1OA 1YE9A 3RPUD 3J80Z 2DTRA 1WPKA 5KAIC 5D8KB 3H9GA 5HNFA 2EPFA 1SFOJ 1P6RA 1DDNA 2P5VA 3QP5A 4P55A 2JA7J 1YW8A 1VQ6I 3S1NJ 2BY0A 1IC8A 3IRRA 3I3LA 1WHUA 1PUEE 2EWNA 2UZKA 3RDIA 1MGTA 5LGUA 3QRFF 2A07F 1TWFJ 3OSGA 3SFIA 4ON0A 2DMPA 2N8GA 5IT9Z 3J7YJ 3CC7I 4PJJA 2EH3A 3GYHX 4HRIA 3A0BC 2DFHA 1M1EB 4E7JA 5HDNA 3ESWB 3K9TA 1YJNI 1LUJB 2M8EA 2AHQA 1S9HA 1UHWA 3L00A 3CUQB 2KJBA 2KPMA 1W0TA 3VFZA 1V55H 4HDUA 3FHNA 1ZLKA 1R1UA 2R4GA 3LAJA 3OIPA 3OL3A 4PGHA 4NHJA 2PJPA 2FX0A 2V9KA 3OYEA 1USSA 1XGOA 1B4AA 4ESBA 1TLHB 2BY2A 3BR3A 3WE2A 2OZ6A 1O7LA 1EKEA 1TT5B 4LITA 4QPOA 2E36A 5F0CA 3JAMZ 1ZG3A 2M7AA 5HOOA 1DP3A 3SEZA 4PFPA 1R4NB 2VJJA 5LLQA 3FDYA 1MJAA 3W6JB 3KPHA 2VOOA 2BEOA 2NVYJ 4RAGA 3U2RA 2RQPA 1IXRC 5J40A 2BXYA 5LHHA 3KLOA 3ZCOA 2F5DA 2OQGA 3G2BA 4C3HJ 3LOCA 4FCYA 3K1MA 2V7FA 1HF0A 2R5YA 3K1NA 4XSZF 2H6CA 1JJ6C 1QU3A 2XAQA 1D0YA 3V7RA 5F6FA 3W3CA 4XNFA 1BOAA 3DEWA 2VE9A 3H9QA 2O03A 5BMZA 4FHTA 1G4DA 2IEKA 1T6SA 1FWZA 3NWTA 2ZMEA 2QWWA 5IP6A 4BACA 2HNHA 4PCQA 3PFYA 5D6EA 2RKHA 1E3PA 2R7QA 2JQ7A 4BEHA 2XF5A 2JRTA 1Z6TA 3KCCA 4KT6A 4BHCA 4DW6A 3CLQA 1A36A 3W2AA 2E19A 1O3RA 4MTDA 1BR1A 3IV5A 1XG1A 1ZR2A 1BIBA 2CQNA 1W7PA 3I4MJ 1OCPA 5DM7F 3VPRA 4GDFA 2DA3A 2VXZA 1N78A 4OINF 4WXHA 4DYQA 3S1QJ 2BV6A 2AQFA 3GFLA 2DXIA 3AL0B 2HTJA 4C2UA 5GP9A 3H9JA 1AOYA 1G3WA 3GFIA 2XSDC 3ISPA 2ZO4A 1MD0A 2VC0A 3L2QA 5F04A 3F23A 3S15J 3OIQA 4GYIA 2R7DA 4N4NB 2Y9ZA 2H1KA 2DFIA 2F6CA 5M3MJ 1OR7C 4P1WA 4B8XA 3M8EA 2XKOA 3PUFA 2Z33A 4UNOA 1QBJA 1U5TA 1IN5A 5FKOA 3HSRA 2A05A 1ZTRA 5EG0A 1U9OA 3F21A 1W5CC 4UUVA 2VPRA 5LFAA 3LSPA 5ERIA 1TNTA 4HSRA 2JK3A 3F6VA 2GA2A 2R5YB 5J8CA 4HA8A 5D4RA 4DIQA 3E97A 1A6IA 2VKDA 4IEJA 3ZOBA 2G9WA 5D5XB 3VYRB 1A04A 2XVCA 1U8RA 3G4SI 3K70D 2L4MA 3FX3A 4M3DA 5HS7A 1JT6A 4ANJA 2ZMEB 2TDXA 3CUQC 3BJ6A 1X1DA 1Y8RB 4B47A 1RR7A 3OR1C 1LB2A 2IA2A 3TW7A 1OYWA 4F93B 2CS3A 3CP2A 4XL9A 2NNYA 4BEHB 1DU6A 2F48A 4G7HF 3CO7C 2L7MP 1WQ2A 1MH3A 4D0PA 4EM0B 4X0GA 2V6EA 2LMDA 3F3XA 5HVQC 5C4JJ 1EA3A 3OYAA 1SFXA 2V26A 4BJTA 4I09A 1W7PB 2KDOA 2ELJA 4D1QA 3FMQA 1QQIA 1T33A 1WVRA 1U6GA 2KP6A 1WI3A 3WTXC 2M45A 1V54H 2HKOA 3W6VA 2OCCH 3DU5A 1RZ4A 1RNLA 1OYYA 4Q47A 2VKEA 2GWRA 2E2JJ 2K9NA 2MLGA 4BJ5C 1HQCA 2PMZA 3FHZA 4KYWA 5FB2A 4XKWA 2VXDA 1TP4A 1RETA 1WRJA 4LGWA 4EQQA 4IHXA 1U5TB 2WWYA 4S04A 4QTRA 2DJIA 4YIFA 4B09A 5JFRA 5AIPA 1DU0A 2DFEA 2VQLA 2KRHA 4CCJA 3TBIA 5EG0B 3K69A 1T0FA 5F1RA 5B1BH 2QQ8A 3FWEA 2DU9A 4LK1F 3LFKA 1DUXC 1S3JA 2NNNA 4E7SA 2TRTA 2E5NA 3UKGA 3MQ0A 2L9VA 2JPCA 1F9NA 4DZJA 2JA2A 2ZNYA 3K4KA 1I1GA 2L7KA 3BR6A 3MN2A 3C7JA 2W84A 3H5RA 1RUNA 1UZCA 3SXYA 1YRNB 4EJOA 2FOKA 2LY9A 4BBSJ 3H3ZA 3M9AA 4E6KG 3IL2A 4M71A 2D5VA 2CQQA 4WXCA 4LLLA 1RIOH 2R7UA 1R1TA 2VONA 3MZYA 1UAAA 2M30A 1SANA 2VODA 1MMAA 4IO9F 5FO5A 4L9NA 1P7JA 1LPQA 2LRDA 4V2FA 3OYCA 2UV1A 1FNNA 3VOEA 3LSTA 4BY7J 2DJNA 4Y13A 3HOZJ 3UR3C 4NNJA 1TQMA 1CF7A 4ZC3A 2CUFA 4XLAA 1DPUA 2ISYA 4CCNA 3BR0A 2DOAA 1BI3A 4ITVA 3OS1A 5E3OA 4U87A 4XN0A 2P7CB 3JRIA 4A6EA 4HYEA 2EILH 1RPWA 1IN7A 2AXLA 1QHGA 1VQ7I 2R7TA 1XMKA 3I53A 2Z2SB 1U78A 3CQZJ 3M07A 4C30A 4HDVA 4IQ4A 3V42A 1OFCX 2BBYA 1NK3P 2DAOA 4HZFA 4A6DA 1VQNI 3WHBA 3EYIA 3ZQQA 1FSEA 2IPQX 2OPTA 4HX4A 3GTPJ 2QLZA 1ETWA 1WJFA 3Q0WA 3OYFA 3N97A 2VE8A 1FYKA 3DBHB 1TC3C 2VJ5A 1QZEA 1ON1A 2FE3A 4A2UA 1IG7A 4IHSA 3BTJA 4OIQF 2LH9A 4X1EA 1G3TA 2EZHA 3DEUA 3GWZA 2QYOA 3S3MA 1GVDA 5C44J 5BQTA 4B48A 3TW6A 2M7BA 2R7RA 2STTA 1SFEA 5DTDA 2VUMJ 1KU7A 3E0JB 1FYLA 3LFUA 2K9LA 4RDUA 2P4WA 1FMVA 2XRLA 2V79A 1LE8A 3ABMH 5LHIA 1BI0A 3HIFA 5GPCA 5KAFC 1IN4A 2MH2A 1W4MA 2P7VB 2QQBA 1H8AC 1XCBA 2QKMB 4WX9A 2KZGA 4EM1A 1D0XA 3BCAA 4NDLA 2HQ5A 4RAYA 4AU7A 1GHCA 2HDWA 4WF2A 1XS9A 2YX7A 5E17F 1FEXA 2VOPA 1BM9A 5DM6F 1U5TC 2RV8A 4M74A 1CF7B 1HA8A 1X1AA 4ESFA 1OLTA 3EUHA 4MHGA 1BOBA 2WAQA 4KNYA 3CCRI 1ZRDA 3P5JA 1ZGAA 3J7AY 2DA5A 2HOEA 4MEYF 4AIDA 1F5TA 4DJAA 1ZR4A 5E8IA 3FXKA 3D5RC 5IYCJ 5ICEA 4CCMA 3JR9A 3BROA 3QPHA 3V8KA 3KZYA 1JTXA 4ENMA 1U2WA 3ONQA 4L0ZB 1ONVA 4RGRA 2XGEA 2QSHX 4MIMA 4J01A 3HL2A 3Q5FA 3ABKH 2WY7Q 1IUFA 3DPLC 3FXUA 3I64A 3GTJJ 1GV5A 1KU9A 3SFZA 4MEXF 3S1RJ 2BZTA 2YSRA 1LKXA 3DV8A 1K6YA 3L09A 1XDSA 3EPZA 3WHCA 4HW0A 4BDZA 1YHQI 3CCQI 1HCRA 4NC6A 2GZWA 4ZZDA 3ERMA 1S7AA 2GQQA 3X2QH 3OYDA 5IOYA 3DLLF 1ORKA 4Y33A 1O57A 3BTCA 1UCRA 4IVNA 1JHFA 3KLNA 3FM5A 4PGGA 4BKXA 4ETSA 1XMXA 2PMHA 1B9NA 2DCEA 4WCGA 3HGGA 1JT0A 2CMPA 2XC7A 3Q9SA 2LK2A 3BZCA 1P4AA 3DTIA 4K2EA 4PSWA 3BP8A 1GXPA 1R6RA 4BH9A 2ME0A 3MVPA 4L9JA 3ASNH 5M5YJ 1T39A 1BN5A 2FBIA 1LE8B 2M0CA 2ISZA 2XHKA 5K7ZA 2CV2A 3HYIA 1BJZA 3JREA 4UY8I 1HOMA 1B72A 1J09A 2QA4I 4LD5A 4HEA2 4KISA 3C1DA 2DDAA 3BCBA 2IS6A 3VWBA 1L0OC 3AAFA 5B66C 2W00A 1QZYA 2L2OA 3I56I 3A2KA 3C18A 1SD5A 3BT9A 4BE2A 1XX5A 1ETKA 4UUTA 3OYIA 3BG9A 1VQKI 3PQJA 3OV8A 1N75A 2FMYA 2OA4A 5TGTA 4G94A 5E3MA 3FIWA 4GGGA 3SDGA 4BXFA 4YFNF 1AKHA 3CCEI 3OYGA 1W1WE 2FMLA 3DKXA 2LY2A 1WJDA 2A3SA 4XQFA 3HRMA 2ESHA 2Y0SA 3VYUB 3BC8A 1E2XA 4UV8A 5IYBJ 2V9PA 1Y0UA 2W48A 4HLYA 3T0YA 2XPVA 2R93J 2R7OA 4EJVA 1BC7C 4D9JA 3GW2A 4CO8A 4YFXF 1YTYA 2UWMA 4G6DA 2E1MB 5FLXZ 3IRQA 2DT6A 3ZGKA 1TZLA 2P6TA 3HOWJ 4IOCF 3CJRB 2KFDA 2LF7A 2ZJ2A 3HEFA 4F7ZA 1G59A 3PIOF 4OAZA 2DQLA 2BYVE 4L18B 5D6FA 3SZTA 1S72I 1YX3A 1T98A 1TW3A 2LD5A 2K9SA 3QODA 2EFQA 2M0MA 4ESJA 3S16J 5ICFA 3U9GA 2NS8A 3CTAA 1QO0D 3REOA 2OBPA 4HBLA 3MKWB 4NQWA 1O4XA 1P4WA 1WH7A 1B72B 5DS9A 3JRHA 1YITI 2K40A 2OV7A 4N4OB 3HB9A 3LSIA 3QP6A 3NAUA 1OPCA 1EH6A 1ZGJA 2EIKH 4BYYA 2QEXI 1FSHA 2JUCA 2JVGA 3RPUA 2ETHA 3CD6I 1Z6RA 4BY1J 4BXUA 5H20A 2EA4A 2HQRA 3M8JA 4RM2A 3PSIA 1XTAA 1A31A 4PK4A 2QENA 2J5PA 5L3CA 2L0KA 1IXCA 1LJ9A 2VKHA 5EJCA 1IJWC 1ZH5A 2VLAA 3I59A 3RCOA 3J81K 3CC4I 3SZGA 4XRSA 3GTLJ 1B59A 2ZXWH 1KU2A 3FISA 4PJ0C 3H36A 1R5GA 4JX6A 4XICA 1T38A 1FC3A 2F5VA 2XGXA 4CA0A 2DYSH 5GPAA 4EGZA 3G6EI 5D5UB 2WA0A 2KIMA 4YIRX 4CSWA 2XRNA 3I71A 1FBSA 4MO7A 1TWCJ 3OR2C 3KZZA 2LREA 2EK5A 1IN8A 1K4TA 2DPDA 2XDVA 4UUSA 4FTHA 3BPXA 2FRHA 3WTTC 2UXXA 1FBQA 3GTKJ 3KETA 2L01A 3I55I 1XGNA 3WGHA 1XCVA 3ZPLA 5KHDA 2AXTC 2HI3A 3EUHC 2A5YB 5F27A 3VEPA 2EV5A 5TISC 1J5YA 3CF5F 2MC3A 5HS9A 5GAHJ 1ZAOA 3KEYA 4UVBA 3H0GJ 3GLXA 3DP7A 1V5FA 2YS9A 4P9FA 3OS2A 4A3GJ 4DBQA 1Z05A 4CGZA 3CCUI 3P7NA 1RR8C 4HG2A 4I0BA 3R0JA 3SQNA 4CHUA 1FX7A 2M5WA 4LIUA 1SFUA 3RTRA 4H4KC 2W7NA 3WODF 2D1HA 3HRSA 5D5VB 5B3SH 2CUJA 2DA6A 2K5CA 1UB9A 2DK8A 3J81Z 2HEOA 3DKYA 1MKMA 3FXMA 1MBJA 3QOPA 1ZN2A 2IS2A 4HQMA 2LF8A 1IDYA 2HR3A 2H6BA 1YX5A 3H3VK 1EF4A 2KISA 2E1MC 3H5AA 1H0MA 2H09A 3I59B 4BJ6C 1ZLJA 3VSKA 2CV1A 1G6NA 2B7EA 3WU2C 1YYVA 2CSOA 3K1PA 1F4KA 1X1CA 4U88A 3HPHA 3PNVA 4L5IA 4PSXA 4KFCA 3ELKA 1VQ5I 4C2TA 3KP2A 1ENHA 4EEFG 5KK1A 2XAGA 2GIZA 3UNGC 2I5UA 4N9IA 2IP2A 1XMAA 4V2GA 2X85A 1ZRFA 2BVLA 1GXQA 4IHTA 3QYFA 3QU6A 2HKXA 4BQNA 1MBKA 1EV7A 3GCMA 4UUSB 3J7AO 5EZHA 5IOZA 5EF6A 3JW4A 4XM3A 4KJZA 2LKPA 4Y3OA 4WWCA 3IHUA 4A12A 5CVUA 4IHWA 4HNTA 2E2HJ 3GTGJ 4LOCA 2P8TA 1N77A 1KQ8A 3GF2A 5E79C 2FBKA 1RI7A 4J19A 1SVLA 2NRAC 4B3XA 2P5KA 4M6VA 4MFDA 5IP7J 4AIKA 3DPUA 2F4IA 4M6YA 4CICA 3R4KA 2O7OA 3K4CA 1O3TA 4ZDPA 2M34A 4QPQA 1V5GA 1VQ4I 4MLOA 2HWVA 4AIJA 4PJNA 1ERDA 1Z3XA 1IO2A 5FROA 5JHFA 2MSYA 4E7HA 1NG7A 3D0SA 1OJLA 2OZUA 3K4JA 3HOXJ 4L5JA 1X1PA 4FASD 5GAGJ 2WAQN 3P9CA 4A3DJ 1WSUA 4HOBA 3PL8A 5FFZA 5LRRA 1ETOA 3KP3A 3WU0A 1W36C 3V8LA 2RAEA 4L0YB 1MSEC 4YIIA 3M8FA 3WTZA 5FD5A 4ABZA 4XRMA 5IYDJ 2MLKA 1BBYA 1D1CA 1MMDA 1J9IA 3K10A 3RI4A 1TQPA 1NH3A 1VQPI 2NVXJ 3EETA 4II3A 4BQQA 5F0HA 4A3JJ 4XRSG 4NBQA 4DZPA 2QVOA 3CJQB 3ROUA 4AVPA 2H94A 3HOVJ 4R8HA 2FA5A 2A61A 2MGQA 2X0LA 1IAWA 3HSEA 3HTUA 2M4KA 1IRZA 2XF6A 1BJAA 1LEBA 4I98B 4KUMA 3EQLF 4A5MA 2P5LC 1TNSA 4WXDA 4F92B 2IS4A 3ZQIA 4HNVA 1R23A 3AG4H 4RLQA 1IZ1A 3W6KB 3M7GA 1S29A 1AA7A 1U3EM 3DU6A 5DCFA 4I01A 4UHTA 4RBOA 1AU7A 5M5XJ 3OYHA 2NVUB 2H8WA 3O6BB 3H1CA 1X4OA 3OWTA 2R5ZA 1MMSA 1T2KA 1GUUA 2X1DA 2W85A 5J3LA 1Y1WJ 4XK4A 1OCOH 1UFMA 1IF1A 2KDZA 1JE8A 2X51A
chains in the Genus database with same CATH topology
2EIMH 3AG4H 3AG3H 3AG1H 1OCRH 3ABKH 2EIJH 3ASOH 3ABLH 3ASNH 5IY5H 3ABMH 3AG2H 1OCZH 3X2QH 1OCCH 2EIKH 2ZXWH 1V54H 5B1BH 1OCOH 2DYRH 2OCCH 3WG7H 2EILH 1V55H 2DYSH 5B3SH 2EINH 2Y69H 5B1AH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIM H;  3AG4 H;  3AG3 H;  3AG1 H;  1OCR H;  3ABK H;  2EIJ H;  3ASO H;  3ABL H;  3ASN H;  5IY5 H;  3ABM H;  3AG2 H;  1OCZ H;  3X2Q H;  1OCC H;  2EIK H;  2ZXW H;  1V54 H;  5B1B H;  1OCO H;  2DYR H;  2OCC H;  3WG7 H;  2EIL H;  1V55 H;  2DYS H;  5B3S H;  2EIN H;  2Y69 H;  5B1A H; 
#chains in the Genus database with same CATH topology
 3QPT A;  3TQN A;  2RRE A;  4HAM A;  1A5J A;  3S1M J;  4PZJ A;  4MTE A;  1MH4 A;  2VT2 A;  4QWQ A;  5HOD A;  1JKP C;  4PJL A;  4EAT A;  1Z1D A;  3H0D A;  4BBR J;  2MBF A;  2XAU A;  2IW5 A;  1R1V A;  2CW0 F;  2WAF A;  2ZC2 A;  3M1C A;  3V7C A;  2PI0 A;  3ZR8 X;  3I5U A;  3E5X A;  2Q0O A;  1QVU A;  3DKW A;  4XOT A;  2KZV A;  4XBF A;  3CCJ I;  3LSR A;  1WZ2 A;  3FBN B;  1S8N A;  1YQA A;  3WTV C;  2K7L A;  3PUB A;  5FKL A;  3K4L A;  3T5X A;  4XLC A;  5A2Q K;  2VJI A;  3K2Z A;  1DGW Y;  3H3U A;  1CQT A;  4G12 A;  4LG3 A;  5H2F C;  1IN6 A;  1XSV A;  4QLC U;  1KON A;  2BY1 A;  2XUB A;  3IH4 A;  1J0R A;  2FEZ A;  3L1P A;  3ABL H;  4DBR A;  3QYE A;  3LSH A;  3RZD J;  1R71 A;  3OL4 A;  2EZI A;  4XN3 A;  9ANT A;  5FRN A;  2Z1D A;  1H9T A;  2O8X A;  1DGR M;  4RM3 A;  2CG4 A;  1UG0 A;  1YG2 A;  3QOE A;  1ZG5 A;  1RUO A;  4EV0 A;  2V1D A;  3O8H A;  1IDZ A;  1MJB A;  4LB6 B;  5HLH A;  3IWF A;  5M5W J;  2BXZ A;  2CW8 A;  2QGU A;  3JRC A;  4MGR A;  2BHY A;  1NK2 P;  1XD7 A;  2W1O A;  1MJ9 A;  5HLT A;  1X58 A;  2PG4 A;  4YFK F;  1FOX A;  2JT1 A;  1W7P D;  2R5Z B;  4KMF A;  2VB6 A;  1I6X A;  1ZHF A;  2DMN A;  4MQ9 F;  5EGO A;  1S5L C;  3GZ6 A;  1WH5 A;  2JPB A;  3A01 A;  4R79 A;  2A68 F;  3IKT A;  2DBB A;  3KYL A;  3A0H C;  1BW6 A;  3IH2 A;  2D45 A;  3LSK A;  5CVJ A;  6PAX A;  5L3D A;  2GAU A;  3CMM A;  3KZI C;  2IA0 A;  1TTY A;  1XSD A;  3J7Z I;  3HOS A;  2ZJR F;  1LFP A;  5LHG A;  2COB A;  4FIS A;  3RZO J;  1BIA A;  4CXF A;  1D8K A;  3CCY A;  5BS6 A;  2QZ8 A;  2LG4 A;  4Y7N J;  4PFO A;  5ED4 A;  2YU3 A;  2AQE A;  5A2Q Z;  5J1U A;  4KMU X;  3DLA A;  1E3O C;  2F5F A;  4AM3 A;  4ZDO A;  4XLE A;  3MEX A;  5K5O A;  1MMG A;  1YS7 A;  3WGG A;  2W57 A;  2BW3 A;  1I5Z A;  2CUZ A;  4E4H A;  2A69 F;  1HKS A;  2BHZ A;  2DA4 A;  1ZKG A;  5ILS A;  5J47 A;  3DBR B;  5IP9 J;  2IGO A;  5AON A;  3PIP F;  1LVK A;  2G7U A;  3CJT B;  4U0V A;  3RKQ A;  4A93 J;  1T56 A;  1WJB A;  3FXL A;  2CW7 A;  4CCO A;  4IX7 A;  3ML6 A;  3K0L A;  5JR3 A;  3S17 J;  1SD7 A;  1N25 A;  2VPL A;  3TDZ C;  3TO9 A;  2WBM A;  2KMU A;  1J7K A;  5E3N A;  2VAS A;  4OOI A;  2BY3 A;  1LFB A;  3R60 A;  2DQR A;  3KX2 A;  1D0Z A;  2BGC A;  3OOP A;  2DA1 A;  3OYB A;  1XGS A;  2L9R A;  3OYK A;  2Z3Y A;  3BQY A;  3OYL A;  4JX5 A;  2NS0 A;  2VBY A;  2MG4 A;  5EGO B;  5GTH C;  2KHM A;  2CJJ A;  1JHH A;  2COM A;  4BU2 A;  1FOY A;  3A01 B;  1KQ9 A;  4L9V A;  4HV6 A;  4XON A;  5EEA A;  2WV0 A;  2GBY A;  2LKS A;  1MBE A;  2ZB9 A;  3E5U A;  1PJR A;  4XLN F;  2ZSH B;  3EYY A;  3F8M A;  3ZQF A;  3HUG A;  1UEL B;  4CYD A;  5CKT A;  1HKQ A;  2ELK A;  2Y2Z A;  4ZDL A;  4M6X A;  3FK7 A;  4GYG A;  2RNJ A;  3HPG A;  5LRS A;  1JJ8 C;  5D4S A;  5LEK A;  2K85 A;  4IF4 A;  5KVR A;  5FJ8 J;  1PDN C;  2H27 A;  3GME A;  3CZ6 A;  4FX0 A;  2EIJ H;  2K9Q A;  1JKO C;  4ZZL A;  3CLO A;  2HXO A;  2X1C A;  3KE2 A;  2O9L A;  2BW3 B;  5DUK A;  1GV2 A;  4QSH A;  3CCS I;  1TWH J;  2JWT A;  3MKZ A;  1ZGW A;  1OQY A;  4A3F J;  3L7W A;  1MBH A;  4IJA A;  4U7D A;  4D7N A;  4KIT B;  1OIS A;  1JKQ C;  3B02 A;  2A5W A;  1SMY F;  4M9Z A;  3LWF A;  5LGT A;  2PLY A;  4WK8 F;  2W82 A;  3OYJ A;  2QM3 A;  2GXG A;  3OY9 A;  1K61 A;  2ZJP F;  3IAM 2;  3ZMV A;  2LC2 A;  2IVM A;  4A3B J;  3NRV A;  3HXL A;  4LFU A;  4JP0 A;  3BG6 A;  2VC1 A;  3ZMT A;  3E6B A;  5JHU A;  3F6O A;  4XR6 A;  2ZBK A;  2UXN A;  3CDL A;  2GOM A;  2Y69 H;  2IGN A;  2JMW A;  4BS9 A;  3JSO A;  3IP4 B;  5E1X A;  5EDN A;  3LA3 A;  3TGN A;  1G3Y A;  2LLK A;  3DTE A;  2ZXH A;  2LDU A;  1K79 A;  4P5O A;  3BWG A;  1X3W B;  1APL C;  2HFH A;  3HUG B;  2RC4 A;  2HPI A;  4AVZ A;  2CWE A;  5CQG A;  3PO2 J;  5DUI A;  4RB3 C;  1OCZ H;  2FNP A;  1OCC H;  2ADU A;  5GTI C;  2XAF A;  3D1N I;  2XF7 A;  3A02 A;  2DYR H;  4KDP A;  2HVS A;  2PFB A;  4I6Z A;  2OC6 A;  1F43 A;  3MD2 A;  2GOX B;  4UV9 A;  4GCV A;  1VZ0 A;  2FJ1 A;  2EFP A;  1Y56 A;  2E1O A;  2EFN A;  2FSW A;  3OYN A;  1VQ9 I;  4KT5 C;  5C4X J;  2X48 A;  1HW1 A;  1Z91 A;  1K78 A;  3TOA A;  4FQG A;  1P9Q C;  5LBQ A;  4ENK A;  4IRG A;  3U1K A;  1TBX A;  2E7W A;  2EQR A;  3FMS A;  3HRT A;  4G8X A;  4KIG A;  3RYR A;  3SJM A;  2V9V A;  3JCU C;  1TT0 A;  3PNY A;  1RRJ A;  3F8C A;  2YPR A;  4RGS A;  1AHD P;  5LD2 C;  2EB7 A;  2R7V A;  2NXN B;  1IGN A;  2XPU A;  5ICC A;  5KCM A;  3JRF A;  2O3F A;  2JUG A;  3LSJ A;  1T8I A;  4CCK A;  3K2A A;  4UVA A;  1EH8 A;  1A35 A;  4UB6 C;  1ITY A;  2QUF A;  3HOY J;  3CCV I;  2O8K A;  4ZYG A;  5J1R A;  3TO6 A;  4B3A A;  3E6D A;  2LNB A;  2O0Y A;  1GDT A;  2OQR A;  2O6G E;  4E7L A;  2FQ4 A;  3M4O J;  3MMY B;  2XAS A;  3CME I;  2HOS A;  1SEU A;  3BJO A;  4MFE A;  4IQJ A;  5DDG A;  3FKI J;  1HW5 A;  2FXA A;  3AG1 H;  3B73 A;  3A1Y A;  5DD8 A;  3HHG A;  3BZK A;  2XV4 S;  1IRX A;  5E3L A;  1KZH A;  4FE4 A;  3ZQG A;  2W24 A;  2IRF G;  4E7I A;  4D5F A;  1PVE A;  3JRA A;  1VTN C;  3FXO A;  1RC9 A;  4A3I J;  2Z9O A;  4M3G A;  3TMO A;  1E17 A;  2BOL A;  1QNT A;  4OWR B;  2R7W A;  3QQA A;  3DF8 A;  2NOJ B;  3KFW X;  4Q48 A;  3L2W A;  2FNA A;  2XAJ A;  3S2H J;  2AO9 A;  3ZQH A;  2DPU A;  3E5Q A;  1VND A;  2IJL A;  1D1B A;  3GLL A;  5J6X A;  2P81 A;  3GVA A;  2IGK A;  4F3Q A;  4ZYE A;  5HLG A;  2CRG A;  1K78 B;  3Q0U A;  1T95 A;  2HYJ A;  1FBU A;  4LK0 F;  3MWM A;  4CCL A;  4A69 C;  4EVI A;  3ZN0 A;  2IT0 A;  5B5E C;  2HGC A;  1ETY A;  1UHM A;  2D1V A;  1ETV A;  2QBY A;  4XKB A;  1JUP A;  4U0W A;  4IPA A;  1K6O A;  4Y17 A;  2ID3 A;  4EJU A;  1FLI A;  1S7E A;  2KRC A;  3ZXS A;  4XOP A;  3TKY A;  2E1C A;  5C3E J;  3BTL A;  2OJE D;  4N0B A;  1G3S A;  4U0Y A;  3OOU A;  4HPQ A;  3I4N J;  2PMZ N;  1YOV B;  4D7M A;  4AC0 A;  5D5W B;  2F5C A;  3F0C A;  4EJT A;  2HYG D;  2OAZ A;  1AKH B;  4I0A A;  1EH7 A;  2M4G A;  4IOA F;  2O61 A;  4LIV A;  4LB5 A;  3M1E A;  3BY6 A;  2PX9 A;  5E1W A;  2OUM A;  3OS0 A;  3HBL A;  3QWL A;  5CPR B;  2NVT J;  4JQF A;  4FET A;  4I2O A;  3PNT A;  2LTP A;  2X1E A;  4BE1 A;  2Z16 A;  2CYY A;  4B4C A;  2HQA A;  3P9I A;  1TQI A;  4B1R A;  1LDJ A;  2ECB A;  2VIX A;  2X6W A;  3MKY B;  1REP C;  3G71 I;  3HTS B;  3LQR A;  1E0E A;  4XLP F;  3V7S A;  3CMA I;  1KYZ A;  3PM1 A;  1Y39 A;  5FKM A;  2CH0 A;  4GO1 A;  4JOM A;  1K4S A;  2KKO A;  1JKR C;  3VB2 A;  2XAH A;  3WU1 B;  1W36 D;  1B9M A;  3OSF A;  1OCT C;  2HQN A;  4A0X A;  3BR1 A;  2DT5 A;  3JSP A;  2KQR A;  2VBX A;  2K9M A;  2A6E F;  1S6L A;  2NAZ A;  1ETQ A;  1X3Z B;  1PUF A;  1HST A;  1BI1 A;  4NQW B;  2HDC A;  3BJA A;  1GLN A;  5DYM A;  4OIP F;  1KYW A;  2Y9Y A;  4KIB A;  2L5Q A;  4R1H A;  5JVG F;  3L2R A;  1I6H J;  4OAY A;  3C2G A;  2K86 A;  5H6R A;  3BDD A;  2DTZ A;  4PDK A;  2QBY B;  1QGP A;  2HVQ A;  1HKT A;  2EV0 A;  2I10 A;  2JA6 J;  3MAJ A;  2W4S A;  3I54 A;  1U9N A;  2PN6 A;  3IWZ A;  3OYM A;  1I3Q J;  3IKV A;  4IHY A;  1Z7L A;  1PYV A;  1W0U A;  2XSJ C;  1GT0 C;  3HHH A;  2C6Y A;  5L3B A;  3ZRG A;  1SD6 A;  4XKC A;  3JRG A;  2EA2 A;  2L4A A;  2VN2 A;  1JTY A;  2JVH A;  2LBF A;  3BQZ A;  3NWS A;  2B9S A;  1SD4 A;  4FX4 A;  1VQ8 I;  1UMQ A;  3CO6 C;  1VI0 A;  1SAX A;  3BR2 A;  2ZCW A;  4CZZ A;  1V4R A;  3KYC B;  1P7I A;  1G8X A;  5BOX A;  1LVA A;  5EEH A;  5HLI A;  2ZFU A;  3V8J A;  1NG6 A;  3DCF A;  3IC7 A;  3G1L A;  4KN4 X;  1OKR A;  2MFZ A;  4S05 A;  3ABT A;  3GUD A;  1IXS B;  4DYC A;  3VYT B;  4ZYH A;  1OCR H;  3ZQC A;  1UST A;  1XSX A;  2M87 A;  2OCE A;  1IUY A;  3HRU A;  3M3Y J;  1LQ1 A;  3HC7 A;  1RKW A;  4NB5 A;  3BOQ A;  3TOB A;  4AYB A;  1L3L A;  3DXJ F;  4C9Y A;  1W5S A;  2L9N A;  3K6G A;  1ZK8 A;  1DP7 P;  1ZYR F;  1VQM I;  2DI3 A;  1Z7U A;  2RNG A;  3KEO A;  3ABU A;  3E7L A;  4BGD A;  1PUF B;  2LY1 A;  3BTI A;  2QKL B;  4C3I J;  2QF7 A;  4XMY A;  2E35 A;  3ZMD A;  1HDP A;  3ZQ7 A;  1FTT A;  1O7F A;  2EZL A;  4G6Q A;  3WE3 A;  2QQA A;  5JI6 A;  4CH7 A;  1FY7 A;  1CGP A;  2L9S A;  1UG2 A;  2W25 A;  5FKK A;  3H5N A;  2LBF B;  3ULQ B;  1I50 J;  2LSO A;  1FIP A;  2VBW A;  1YS6 A;  3BG3 A;  3CDI A;  1J2X A;  2Q2E A;  3TL4 X;  4A0Y A;  4LG0 A;  2R7S A;  2JA5 J;  2PEX A;  3LMM A;  4KIC A;  2XPW A;  4EMS A;  1I3A A;  5BNG A;  3CP8 A;  3SYT A;  1FT9 A;  3S32 A;  1FYM A;  1R4M B;  3SDB A;  4PUS A;  2NS7 A;  1QVT A;  1TW2 A;  2B0L A;  2YX4 A;  4XOR A;  3F8N A;  5HS8 A;  2L02 A;  3L2V A;  3WTS C;  3GFJ A;  1Z67 A;  1F1Z A;  1TWA J;  2E1N A;  2MW8 A;  3BZ6 A;  3DPT A;  3FXJ A;  3RPQ A;  3ZN1 A;  1UJ8 A;  5FGM A;  2CQK A;  1JUS A;  4HST A;  1MBF A;  1Z21 A;  3HG9 A;  2Y48 A;  2QCO A;  2V1N A;  1HDD C;  2CV0 A;  2CQX A;  2D2W A;  5FRM A;  4M3B A;  2KLO A;  5BPD A;  3OMY A;  2OU2 A;  4RGU A;  5CJ9 A;  5IT3 A;  2ELH A;  2E60 A;  1B1B A;  2KJC A;  4XSX F;  3D5S C;  4A3M J;  1BR2 A;  1BI2 A;  2RDP A;  4E70 A;  4EM2 A;  1V3F A;  2HOA A;  2CU7 A;  2ZFW A;  2GXB A;  3LQQ A;  5IPA A;  2HOT A;  2MD0 A;  3CJN A;  2LKX A;  3S3N A;  1BC8 C;  3P9K A;  2FQ3 A;  1IRF A;  2FU4 A;  4BHP A;  5H6Q A;  3RQ4 A;  4RMN A;  1P2F A;  3NQO A;  5FLV A;  2OTL I;  2IAI A;  4DQ2 A;  1NHA A;  4UVC A;  4HV5 A;  2STW A;  4CZC A;  3VYS B;  1IW7 F;  3S8P A;  4LLG F;  3V4G A;  4MQV A;  4LLN A;  4DOZ A;  2DW4 A;  2WB1 A;  3DFG A;  2PJR A;  2DLL A;  3EUA A;  4C2M J;  4Q5S F;  1UHS A;  3B6C A;  3T1B A;  5LEJ A;  2B63 J;  1FOW A;  4A0Z A;  3GTM J;  1POG A;  2KT0 A;  2GXA A;  1P92 A;  2ECC A;  3VSL A;  2TCT A;  2V4J C;  3T8R A;  2DFF A;  2F5E A;  2Q2E B;  2Y0S N;  3KP5 A;  3HJE A;  3RYP A;  4I7H A;  4BE0 A;  2LYC A;  4LG0 B;  3S3O A;  2Z99 A;  2Z5U A;  4G7Z F;  5FD6 A;  4IHV A;  1JGS A;  3A4C A;  2JJ7 A;  3W2V A;  2ZJQ F;  3K4N A;  3FZV A;  2MD5 A;  4BQO A;  2R7X A;  3KP6 A;  1FIA A;  1R5I D;  3O2P E;  1D8J A;  1J59 A;  3GBG A;  1X3U A;  2IS1 A;  4IRH A;  3PO3 J;  4O6J A;  1X19 A;  1YRN A;  5DD4 A;  4AUX A;  5F0F A;  1HC8 A;  1LDK B;  4H0E A;  4N9H A;  2ZNZ A;  3R6S A;  5CVV A;  2MH9 A;  3R61 A;  4HF2 A;  4DGW B;  1Y6I A;  5KNL A;  5K1Y A;  4JBA A;  1K7A A;  3PJR A;  4RLF A;  2KL4 A;  3H92 A;  2DOE A;  2OF7 A;  4JK1 X;  5AIQ A;  2FD5 A;  2R92 J;  3E6M A;  3HM5 A;  3ASO H;  3RJP A;  1KA8 A;  1HXD A;  2DMQ A;  2MAB A;  1R49 A;  1MDM A;  4Y15 A;  5ICG A;  2DO7 A;  2H1L A;  3FM3 A;  2Q1Z B;  4L9T A;  4YEL A;  4U7B A;  3NEU A;  3O3K A;  5ILU A;  4BUP A;  3KP4 A;  3LL7 A;  4UXN A;  3ZMZ A;  1H88 C;  1MBG A;  4A3L J;  2ICW G;  3KYD B;  1H9G A;  4DNC A;  4XKV A;  2LVS A;  5EYR A;  4HNU A;  1B6A A;  1BL0 A;  3MKL A;  3F22 A;  3HSF A;  4EJW A;  4HQE A;  4IRI A;  3CCM I;  2ZXI A;  5EZG A;  4RB2 C;  2UUZ A;  1X1B A;  4M9X A;  3RQI A;  4ENJ A;  2PJR B;  1X2N A;  1VQO I;  3B6A A;  5K7F A;  4X6A J;  3I0T A;  4RS8 A;  3JRD A;  2WTE A;  2E34 A;  2K4J A;  2VKV A;  3IUO A;  2NVQ J;  1FTZ A;  3G3Z A;  1XDU A;  3S2D J;  1ZAR A;  5L3F A;  4A3C J;  2KIF A;  3SEQ A;  4ZTJ A;  1YIJ I;  5TRD A;  3HKZ A;  4XRF A;  2XIG A;  2RQQ A;  3GXO A;  4UB8 C;  2GLO A;  1IV8 A;  2ESN A;  4PJM A;  3K4M A;  4GRI A;  5J8F A;  1B8I A;  1J75 A;  5J4V A;  2M8G X;  2DN0 A;  4CYC A;  2HPM A;  1Z3Y A;  5E20 A;  4M3E A;  2VJ4 A;  4CUG A;  3AL0 C;  3SZP A;  2Y30 A;  2JRM A;  4XLF A;  3PFI A;  1TL8 A;  3LSM A;  1HBX G;  3L9F A;  5ILV A;  1D5Y A;  1YO5 C;  3L2C A;  5CYV A;  1DPR A;  1VF9 A;  2OTJ I;  5JLW A;  2VQG A;  2L7F P;  2O5R A;  5E8G A;  4LMY A;  3SHF A;  2BE5 F;  3VOD A;  4OU0 A;  3GFM A;  3NAR A;  1I39 A;  1MDM B;  1RKT A;  3QPS A;  1SAU A;  4P96 A;  5HNH A;  3KEQ A;  1ACI A;  2K27 A;  4M73 A;  4P9U A;  4LJZ F;  2DOD A;  2PBI A;  1X4P A;  4YEJ A;  2AS5 F;  4ZJZ A;  1VQL I;  1MSF C;  1YJW I;  3FBI B;  2DMU A;  3K70 C;  5BPI A;  1O3S A;  1YW7 A;  3ERE D;  1V5E A;  4EGY A;  1G2H A;  3Q0V A;  2WY8 Q;  5K5R A;  4HLX A;  2K4B A;  4BQA A;  1YJ9 I;  2V1X A;  5DCM A;  2DA2 A;  4G9Y A;  4M3F A;  2HU9 A;  5B1A H;  3OIO A;  3CMY A;  4Y52 J;  3E1S A;  3PSF A;  1SVM A;  4RA2 A;  1ZRC A;  2P0W A;  4II2 A;  4KN7 X;  3RIR A;  3WTY C;  1U8B A;  3TED A;  4FE7 A;  3W2W A;  3Q9V A;  4I02 A;  1BW5 A;  1WKM A;  1OMI A;  2GIV A;  2JSP A;  3FF5 A;  2V1U A;  3GZ5 A;  2ZME C;  1R5H A;  5IY5 H;  1XGM A;  3MZH A;  3HDD A;  5DEQ A;  2X6O A;  3S14 J;  2YU9 J;  1X2M A;  1XB4 A;  3E6C C;  2CGP A;  3U21 A;  3IAS 2;  3JTH A;  2A6T A;  2VL8 A;  2IBD A;  2ZXJ A;  1R36 A;  2EFO A;  3BLY A;  1R58 A;  4CDG A;  4RGX A;  4OIO F;  3FXQ A;  4A5N A;  2XB5 A;  2FF4 A;  4RB1 A;  2JZY A;  1B8I B;  3HGY A;  2M9H A;  3QPL A;  2EJR A;  4HF0 A;  4J00 A;  2WC2 A;  3RKX A;  4CYC B;  5JLX A;  2QSF X;  3LA2 A;  4Y4R A;  3S2W A;  4XLH A;  2JTV A;  1Z9C A;  2EZK A;  3BG7 A;  5TJJ A;  1D5V A;  2LOO A;  4I76 A;  5F08 A;  4HX8 A;  4ASN A;  2FBH A;  3F9K A;  4AYB N;  4A3E J;  3DEE A;  3HZJ A;  1RES A;  3JRB A;  4NC7 A;  3CC2 I;  2K3P A;  2RN7 A;  1WFX A;  2MC4 A;  1R00 A;  3LA7 A;  4F91 B;  5F1J A;  4BNC A;  2E7X A;  3O8G A;  1QZZ A;  2K3F A;  1GVJ A;  4ZYA A;  1WI9 A;  2PQ8 A;  4FT8 A;  3DBL B;  4AIH A;  1R9T J;  2L54 A;  3G73 A;  1HW2 A;  2HXI A;  3FK6 A;  1SC7 A;  4NUB A;  5FLM J;  4A3K J;  3T8T A;  1WJC A;  1TWG J;  1PP8 F;  5FFX A;  3K4B A;  1WCM J;  5DCM B;  2LFB A;  4BL0 B;  4E7Z A;  3CDH A;  1EJ9 A;  2DOF A;  2ZKZ A;  4Z2Y A;  1ZQ3 P;  1SFK A;  3BR5 A;  2MYS A;  2E71 A;  1H89 C;  4YRV A;  2WV1 A;  1ZRE A;  1C0W A;  1QRY A;  5HDK A;  5E18 F;  3ZQL A;  1NTC A;  1WWX A;  1IRG A;  1XN7 A;  3DWL E;  2X4H A;  3CUO A;  1ULY A;  2K02 A;  2ID6 A;  3DTK A;  4HX7 A;  2HDD A;  1FP1 D;  3GTQ J;  2NYX A;  4ENN A;  1AWC A;  1T08 B;  1Y0N A;  4IKF A;  1WJ5 A;  2H8R A;  3F8B A;  1FP2 A;  3AG2 H;  1Z0X A;  3C2B A;  2LP0 A;  3RKW A;  1Y8Q B;  5FLX K;  1KQ0 A;  3A03 A;  2RGV A;  1QHH D;  4OIR F;  3GZN B;  5GAE J;  1ON2 A;  4I99 C;  4IXA A;  3VDX A;  3L2U A;  4G6T B;  2XB0 X;  2GM4 A;  2M2E A;  2R7Z J;  4E7K A;  5D8L B;  3KIO A;  4BDY A;  2F2E A;  2M3A A;  3HOU J;  1KGS A;  2EBI A;  5F64 A;  2IA1 A;  1U0J A;  4QIW N;  2HZT A;  3GEZ A;  1YIO A;  2WAE A;  3DQV C;  2Q8K A;  4ZH4 F;  2X9D A;  1FPQ A;  1STZ A;  1JUM A;  3TP0 A;  4AD9 A;  3CCL I;  3AFH A;  3I58 A;  2EV6 A;  1QA6 A;  3FXR A;  4F52 A;  2BVM A;  5L3E A;  4AWX B;  3AG3 H;  2CFX A;  3JTG A;  3MZ8 A;  2Y75 A;  4GFB A;  1PP7 U;  2CO5 A;  5CVR A;  1W5T A;  2Y0M A;  3GO5 A;  1T0F C;  4B44 A;  3I9V 2;  3HOT A;  4KIF A;  4Z6Y A;  2HTS A;  2HZD A;  2J5O A;  2X6X A;  2G7H A;  3QAH A;  3WTW C;  4M9S A;  5CVI A;  4KA4 A;  1I1S A;  2ME6 A;  3EDP A;  4Q4Z F;  4OMY A;  4IL6 C;  2L3D A;  3LAP A;  2WB1 N;  2ACJ A;  1K83 J;  2LR8 A;  1YFH A;  1E3H A;  4F55 A;  1ZG1 A;  1IV6 A;  3PQK A;  2F4O B;  2QQ9 A;  2DMT A;  2MA3 A;  5J1Y A;  1S7O A;  1MIJ A;  2QSG X;  4ZYD A;  1JGG A;  2WAD A;  3ECH A;  3FKJ A;  4W97 A;  2Y31 A;  2KRF A;  1FMW A;  1WJA A;  1WJE A;  3BPV A;  1XPX A;  1YI2 I;  5L3G A;  3IH3 A;  5DV5 A;  1P4X A;  1QPM A;  1MNM C;  1HLV A;  2F4M B;  1KU3 A;  3COA C;  2I8D A;  3FMR A;  2IGM A;  4L5E A;  1JXS A;  2L7Z A;  2VQH A;  4D5C A;  1LFU P;  2GA1 A;  2VBZ A;  2P6S A;  4M72 A;  2G0E A;  5CQE A;  4BXX J;  2NOG A;  2EIM H;  5FKN A;  3D5L A;  5LGN A;  4JYK A;  3WGI A;  2VT3 A;  1SMT A;  1LDD A;  2VQC A;  1F36 A;  3TO7 A;  5K7H A;  1Q1V A;  2RVC A;  2OD5 A;  2XKP A;  4RB0 A;  2EFW A;  5EEG A;  1MZB A;  3TDU C;  1ODD A;  1Y1V J;  2XGC A;  3QU3 A;  4O3M A;  2HVR A;  4RAF A;  3ZMS A;  2JSC A;  4ZTF A;  3TP3 A;  4BAY A;  4BHB A;  4NC8 A;  5M3F J;  2CQ7 A;  1OR7 A;  1LEA A;  4JX4 A;  3ECO A;  4YG2 F;  4OMZ A;  3C3W A;  1ZEL A;  4O5V A;  1VFC A;  1Z77 A;  3G1M A;  2DT7 B;  3CF2 A;  4B43 A;  3EUK L;  3WG7 H;  2R0Q C;  1I27 A;  5JVT A;  1LNW A;  4DYR A;  2R7F A;  4MNU A;  3GX4 X;  3H35 A;  3J80 K;  1FOK A;  2E2I J;  1O3Q A;  3MCZ A;  2A6H F;  5HDG A;  2CFO A;  2V6C A;  3F72 A;  3AKZ A;  3I4P A;  3RSN A;  1A6Q A;  2FUG 2;  5E1Z B;  5K5Q A;  4RAZ A;  1YLF A;  1SVO A;  1QPI A;  2HYF A;  2HS5 A;  3CES A;  3N05 A;  4IZZ A;  3S93 A;  2ZSI B;  3E3V A;  4XID A;  2KIU A;  3ZMU A;  2CUE A;  2YR2 A;  3WTU C;  3LSG A;  2DDB A;  2JA8 J;  1FJL A;  1WGX A;  3ZP5 A;  2XGD A;  5IT9 K;  1HSJ A;  1D1A A;  1D3Y A;  2EIN H;  2R3S A;  2X6Y A;  3CUQ A;  3Q3S A;  5GAD J;  3RKY A;  1YW9 A;  4S0H B;  5CLS A;  3QYB A;  2DK5 A;  2DA7 A;  2PMU A;  1MND A;  2FOW A;  3HKZ N;  2E5Z A;  3K7A J;  1BR4 A;  1OYI A;  2KIQ A;  3GTO J;  4G7O F;  1FZP B;  2XRO A;  3KP7 A;  3R0A A;  3BG5 A;  1DQU A;  1ETX A;  1Q1H A;  1XC5 A;  3JAM K;  3MFK A;  3N4M A;  3WG9 A;  1JI8 A;  4TV7 A;  1R22 A;  2IXS A;  4W1U A;  3LNQ A;  1BA5 A;  3U1D A;  1R7J A;  4HF1 A;  4GXO A;  1MMN A;  2YUS A;  4C3J J;  4V19 K;  2JN6 A;  2VI6 A;  1MW7 A;  5J4Y A;  2M1B A;  1MNE A;  3F8F A;  3C2H A;  3G1O A;  1YE9 A;  3RPU D;  3J80 Z;  2DTR A;  1WPK A;  5KAI C;  5D8K B;  3H9G A;  5HNF A;  2EPF A;  1SFO J;  1P6R A;  1DDN A;  2P5V A;  3QP5 A;  4P55 A;  2JA7 J;  1YW8 A;  1VQ6 I;  3S1N J;  2BY0 A;  1IC8 A;  3IRR A;  3I3L A;  1WHU A;  1PUE E;  2EWN A;  2UZK A;  3RDI A;  1MGT A;  5LGU A;  3QRF F;  2A07 F;  1TWF J;  3OSG A;  3SFI A;  4ON0 A;  2DMP A;  2N8G A;  5IT9 Z;  3J7Y J;  3CC7 I;  4PJJ A;  2EH3 A;  3GYH X;  4HRI A;  3A0B C;  2DFH A;  1M1E B;  4E7J A;  5HDN A;  3ESW B;  3K9T A;  1YJN I;  1LUJ B;  2M8E A;  2AHQ A;  1S9H A;  1UHW A;  3L00 A;  3CUQ B;  2KJB A;  2KPM A;  1W0T A;  3VFZ A;  1V55 H;  4HDU A;  3FHN A;  1ZLK A;  1R1U A;  2R4G A;  3LAJ A;  3OIP A;  3OL3 A;  4PGH A;  4NHJ A;  2PJP A;  2FX0 A;  2V9K A;  3OYE A;  1USS A;  1XGO A;  1B4A A;  4ESB A;  1TLH B;  2BY2 A;  3BR3 A;  3WE2 A;  2OZ6 A;  1O7L A;  1EKE A;  1TT5 B;  4LIT A;  4QPO A;  2E36 A;  5F0C A;  3JAM Z;  1ZG3 A;  2M7A A;  5HOO A;  1DP3 A;  3SEZ A;  4PFP A;  1R4N B;  2VJJ A;  5LLQ A;  3FDY A;  1MJA A;  3W6J B;  3KPH A;  2VOO A;  2BEO A;  2NVY J;  4RAG A;  3U2R A;  2RQP A;  1IXR C;  5J40 A;  2BXY A;  5LHH A;  3KLO A;  3ZCO A;  2F5D A;  2OQG A;  3G2B A;  4C3H J;  3LOC A;  4FCY A;  3K1M A;  2V7F A;  1HF0 A;  2R5Y A;  3K1N A;  4XSZ F;  2H6C A;  1JJ6 C;  1QU3 A;  2XAQ A;  1D0Y A;  3V7R A;  5F6F A;  3W3C A;  4XNF A;  1BOA A;  3DEW A;  2VE9 A;  3H9Q A;  2O03 A;  5BMZ A;  4FHT A;  1G4D A;  2IEK A;  1T6S A;  1FWZ A;  3NWT A;  2ZME A;  2QWW A;  5IP6 A;  4BAC A;  2HNH A;  4PCQ A;  3PFY A;  5D6E A;  2RKH A;  1E3P A;  2R7Q A;  2JQ7 A;  4BEH A;  2XF5 A;  2JRT A;  1Z6T A;  3KCC A;  4KT6 A;  4BHC A;  4DW6 A;  3CLQ A;  1A36 A;  3W2A A;  2E19 A;  1O3R A;  4MTD A;  1BR1 A;  3IV5 A;  1XG1 A;  1ZR2 A;  1BIB A;  2CQN A;  1W7P A;  3I4M J;  1OCP A;  5DM7 F;  3VPR A;  4GDF A;  2DA3 A;  2VXZ A;  1N78 A;  4OIN F;  4WXH A;  4DYQ A;  3S1Q J;  2BV6 A;  2AQF A;  3GFL A;  2DXI A;  3AL0 B;  2HTJ A;  4C2U A;  5GP9 A;  3H9J A;  1AOY A;  1G3W A;  3GFI A;  2XSD C;  3ISP A;  2ZO4 A;  1MD0 A;  2VC0 A;  3L2Q A;  5F04 A;  3F23 A;  3S15 J;  3OIQ A;  4GYI A;  2R7D A;  4N4N B;  2Y9Z A;  2H1K A;  2DFI A;  2F6C A;  5M3M J;  1OR7 C;  4P1W A;  4B8X A;  3M8E A;  2XKO A;  3PUF A;  2Z33 A;  4UNO A;  1QBJ A;  1U5T A;  1IN5 A;  5FKO A;  3HSR A;  2A05 A;  1ZTR A;  5EG0 A;  1U9O A;  3F21 A;  1W5C C;  4UUV A;  2VPR A;  5LFA A;  3LSP A;  5ERI A;  1TNT A;  4HSR A;  2JK3 A;  3F6V A;  2GA2 A;  2R5Y B;  5J8C A;  4HA8 A;  5D4R A;  4DIQ A;  3E97 A;  1A6I A;  2VKD A;  4IEJ A;  3ZOB A;  2G9W A;  5D5X B;  3VYR B;  1A04 A;  2XVC A;  1U8R A;  3G4S I;  3K70 D;  2L4M A;  3FX3 A;  4M3D A;  5HS7 A;  1JT6 A;  4ANJ A;  2ZME B;  2TDX A;  3CUQ C;  3BJ6 A;  1X1D A;  1Y8R B;  4B47 A;  1RR7 A;  3OR1 C;  1LB2 A;  2IA2 A;  3TW7 A;  1OYW A;  4F93 B;  2CS3 A;  3CP2 A;  4XL9 A;  2NNY A;  4BEH B;  1DU6 A;  2F48 A;  4G7H F;  3CO7 C;  2L7M P;  1WQ2 A;  1MH3 A;  4D0P A;  4EM0 B;  4X0G A;  2V6E A;  2LMD A;  3F3X A;  5HVQ C;  5C4J J;  1EA3 A;  3OYA A;  1SFX A;  2V26 A;  4BJT A;  4I09 A;  1W7P B;  2KDO A;  2ELJ A;  4D1Q A;  3FMQ A;  1QQI A;  1T33 A;  1WVR A;  1U6G A;  2KP6 A;  1WI3 A;  3WTX C;  2M45 A;  1V54 H;  2HKO A;  3W6V A;  2OCC H;  3DU5 A;  1RZ4 A;  1RNL A;  1OYY A;  4Q47 A;  2VKE A;  2GWR A;  2E2J J;  2K9N A;  2MLG A;  4BJ5 C;  1HQC A;  2PMZ A;  3FHZ A;  4KYW A;  5FB2 A;  4XKW A;  2VXD A;  1TP4 A;  1RET A;  1WRJ A;  4LGW A;  4EQQ A;  4IHX A;  1U5T B;  2WWY A;  4S04 A;  4QTR A;  2DJI A;  4YIF A;  4B09 A;  5JFR A;  5AIP A;  1DU0 A;  2DFE A;  2VQL A;  2KRH A;  4CCJ A;  3TBI A;  5EG0 B;  3K69 A;  1T0F A;  5F1R A;  5B1B H;  2QQ8 A;  3FWE A;  2DU9 A;  4LK1 F;  3LFK A;  1DUX C;  1S3J A;  2NNN A;  4E7S A;  2TRT A;  2E5N A;  3UKG A;  3MQ0 A;  2L9V A;  2JPC A;  1F9N A;  4DZJ A;  2JA2 A;  2ZNY A;  3K4K A;  1I1G A;  2L7K A;  3BR6 A;  3MN2 A;  3C7J A;  2W84 A;  3H5R A;  1RUN A;  1UZC A;  3SXY A;  1YRN B;  4EJO A;  2FOK A;  2LY9 A;  4BBS J;  3H3Z A;  3M9A A;  4E6K G;  3IL2 A;  4M71 A;  2D5V A;  2CQQ A;  4WXC A;  4LLL A;  1RIO H;  2R7U A;  1R1T A;  2VON A;  3MZY A;  1UAA A;  2M30 A;  1SAN A;  2VOD A;  1MMA A;  4IO9 F;  5FO5 A;  4L9N A;  1P7J A;  1LPQ A;  2LRD A;  4V2F A;  3OYC A;  2UV1 A;  1FNN A;  3VOE A;  3LST A;  4BY7 J;  2DJN A;  4Y13 A;  3HOZ J;  3UR3 C;  4NNJ A;  1TQM A;  1CF7 A;  4ZC3 A;  2CUF A;  4XLA A;  1DPU A;  2ISY A;  4CCN A;  3BR0 A;  2DOA A;  1BI3 A;  4ITV A;  3OS1 A;  5E3O A;  4U87 A;  4XN0 A;  2P7C B;  3JRI A;  4A6E A;  4HYE A;  2EIL H;  1RPW A;  1IN7 A;  2AXL A;  1QHG A;  1VQ7 I;  2R7T A;  1XMK A;  3I53 A;  2Z2S B;  1U78 A;  3CQZ J;  3M07 A;  4C30 A;  4HDV A;  4IQ4 A;  3V42 A;  1OFC X;  2BBY A;  1NK3 P;  2DAO A;  4HZF A;  4A6D A;  1VQN I;  3WHB A;  3EYI A;  3ZQQ A;  1FSE A;  2IPQ X;  2OPT A;  4HX4 A;  3GTP J;  2QLZ A;  1ETW A;  1WJF A;  3Q0W A;  3OYF A;  3N97 A;  2VE8 A;  1FYK A;  3DBH B;  1TC3 C;  2VJ5 A;  1QZE A;  1ON1 A;  2FE3 A;  4A2U A;  1IG7 A;  4IHS A;  3BTJ A;  4OIQ F;  2LH9 A;  4X1E A;  1G3T A;  2EZH A;  3DEU A;  3GWZ A;  2QYO A;  3S3M A;  1GVD A;  5C44 J;  5BQT A;  4B48 A;  3TW6 A;  2M7B A;  2R7R A;  2STT A;  1SFE A;  5DTD A;  2VUM J;  1KU7 A;  3E0J B;  1FYL A;  3LFU A;  2K9L A;  4RDU A;  2P4W A;  1FMV A;  2XRL A;  2V79 A;  1LE8 A;  3ABM H;  5LHI A;  1BI0 A;  3HIF A;  5GPC A;  5KAF C;  1IN4 A;  2MH2 A;  1W4M A;  2P7V B;  2QQB A;  1H8A C;  1XCB A;  2QKM B;  4WX9 A;  2KZG A;  4EM1 A;  1D0X A;  3BCA A;  4NDL A;  2HQ5 A;  4RAY A;  4AU7 A;  1GHC A;  2HDW A;  4WF2 A;  1XS9 A;  2YX7 A;  5E17 F;  1FEX A;  2VOP A;  1BM9 A;  5DM6 F;  1U5T C;  2RV8 A;  4M74 A;  1CF7 B;  1HA8 A;  1X1A A;  4ESF A;  1OLT A;  3EUH A;  4MHG A;  1BOB A;  2WAQ A;  4KNY A;  3CCR I;  1ZRD A;  3P5J A;  1ZGA A;  3J7A Y;  2DA5 A;  2HOE A;  4MEY F;  4AID A;  1F5T A;  4DJA A;  1ZR4 A;  5E8I A;  3FXK A;  3D5R C;  5IYC J;  5ICE A;  4CCM A;  3JR9 A;  3BRO A;  3QPH A;  3V8K A;  3KZY A;  1JTX A;  4ENM A;  1U2W A;  3ONQ A;  4L0Z B;  1ONV A;  4RGR A;  2XGE A;  2QSH X;  4MIM A;  4J01 A;  3HL2 A;  3Q5F A;  3ABK H;  2WY7 Q;  1IUF A;  3DPL C;  3FXU A;  3I64 A;  3GTJ J;  1GV5 A;  1KU9 A;  3SFZ A;  4MEX F;  3S1R J;  2BZT A;  2YSR A;  1LKX A;  3DV8 A;  1K6Y A;  3L09 A;  1XDS A;  3EPZ A;  3WHC A;  4HW0 A;  4BDZ A;  1YHQ I;  3CCQ I;  1HCR A;  4NC6 A;  2GZW A;  4ZZD A;  3ERM A;  1S7A A;  2GQQ A;  3X2Q H;  3OYD A;  5IOY A;  3DLL F;  1ORK A;  4Y33 A;  1O57 A;  3BTC A;  1UCR A;  4IVN A;  1JHF A;  3KLN A;  3FM5 A;  4PGG A;  4BKX A;  4ETS A;  1XMX A;  2PMH A;  1B9N A;  2DCE A;  4WCG A;  3HGG A;  1JT0 A;  2CMP A;  2XC7 A;  3Q9S A;  2LK2 A;  3BZC A;  1P4A A;  3DTI A;  4K2E A;  4PSW A;  3BP8 A;  1GXP A;  1R6R A;  4BH9 A;  2ME0 A;  3MVP A;  4L9J A;  3ASN H;  5M5Y J;  1T39 A;  1BN5 A;  2FBI A;  1LE8 B;  2M0C A;  2ISZ A;  2XHK A;  5K7Z A;  2CV2 A;  3HYI A;  1BJZ A;  3JRE A;  4UY8 I;  1HOM A;  1B72 A;  1J09 A;  2QA4 I;  4LD5 A;  4HEA 2;  4KIS A;  3C1D A;  2DDA A;  3BCB A;  2IS6 A;  3VWB A;  1L0O C;  3AAF A;  5B66 C;  2W00 A;  1QZY A;  2L2O A;  3I56 I;  3A2K A;  3C18 A;  1SD5 A;  3BT9 A;  4BE2 A;  1XX5 A;  1ETK A;  4UUT A;  3OYI A;  3BG9 A;  1VQK I;  3PQJ A;  3OV8 A;  1N75 A;  2FMY A;  2OA4 A;  5TGT A;  4G94 A;  5E3M A;  3FIW A;  4GGG A;  3SDG A;  4BXF A;  4YFN F;  1AKH A;  3CCE I;  3OYG A;  1W1W E;  2FML A;  3DKX A;  2LY2 A;  1WJD A;  2A3S A;  4XQF A;  3HRM A;  2ESH A;  2Y0S A;  3VYU B;  3BC8 A;  1E2X A;  4UV8 A;  5IYB J;  2V9P A;  1Y0U A;  2W48 A;  4HLY A;  3T0Y A;  2XPV A;  2R93 J;  2R7O A;  4EJV A;  1BC7 C;  4D9J A;  3GW2 A;  4CO8 A;  4YFX F;  1YTY A;  2UWM A;  4G6D A;  2E1M B;  5FLX Z;  3IRQ A;  2DT6 A;  3ZGK A;  1TZL A;  2P6T A;  3HOW J;  4IOC F;  3CJR B;  2KFD A;  2LF7 A;  2ZJ2 A;  3HEF A;  4F7Z A;  1G59 A;  3PIO F;  4OAZ A;  2DQL A;  2BYV E;  4L18 B;  5D6F A;  3SZT A;  1S72 I;  1YX3 A;  1T98 A;  1TW3 A;  2LD5 A;  2K9S A;  3QOD A;  2EFQ A;  2M0M A;  4ESJ A;  3S16 J;  5ICF A;  3U9G A;  2NS8 A;  3CTA A;  1QO0 D;  3REO A;  2OBP A;  4HBL A;  3MKW B;  4NQW A;  1O4X A;  1P4W A;  1WH7 A;  1B72 B;  5DS9 A;  3JRH A;  1YIT I;  2K40 A;  2OV7 A;  4N4O B;  3HB9 A;  3LSI A;  3QP6 A;  3NAU A;  1OPC A;  1EH6 A;  1ZGJ A;  2EIK H;  4BYY A;  2QEX I;  1FSH A;  2JUC A;  2JVG A;  3RPU A;  2ETH A;  3CD6 I;  1Z6R A;  4BY1 J;  4BXU A;  5H20 A;  2EA4 A;  2HQR A;  3M8J A;  4RM2 A;  3PSI A;  1XTA A;  1A31 A;  4PK4 A;  2QEN A;  2J5P A;  5L3C A;  2L0K A;  1IXC A;  1LJ9 A;  2VKH A;  5EJC A;  1IJW C;  1ZH5 A;  2VLA A;  3I59 A;  3RCO A;  3J81 K;  3CC4 I;  3SZG A;  4XRS A;  3GTL J;  1B59 A;  2ZXW H;  1KU2 A;  3FIS A;  4PJ0 C;  3H36 A;  1R5G A;  4JX6 A;  4XIC A;  1T38 A;  1FC3 A;  2F5V A;  2XGX A;  4CA0 A;  2DYS H;  5GPA A;  4EGZ A;  3G6E I;  5D5U B;  2WA0 A;  2KIM A;  4YIR X;  4CSW A;  2XRN A;  3I71 A;  1FBS A;  4MO7 A;  1TWC J;  3OR2 C;  3KZZ A;  2LRE A;  2EK5 A;  1IN8 A;  1K4T A;  2DPD A;  2XDV A;  4UUS A;  4FTH A;  3BPX A;  2FRH A;  3WTT C;  2UXX A;  1FBQ A;  3GTK J;  3KET A;  2L01 A;  3I55 I;  1XGN A;  3WGH A;  1XCV A;  3ZPL A;  5KHD A;  2AXT C;  2HI3 A;  3EUH C;  2A5Y B;  5F27 A;  3VEP A;  2EV5 A;  5TIS C;  1J5Y A;  3CF5 F;  2MC3 A;  5HS9 A;  5GAH J;  1ZAO A;  3KEY A;  4UVB A;  3H0G J;  3GLX A;  3DP7 A;  1V5F A;  2YS9 A;  4P9F A;  3OS2 A;  4A3G J;  4DBQ A;  1Z05 A;  4CGZ A;  3CCU I;  3P7N A;  1RR8 C;  4HG2 A;  4I0B A;  3R0J A;  3SQN A;  4CHU A;  1FX7 A;  2M5W A;  4LIU A;  1SFU A;  3RTR A;  4H4K C;  2W7N A;  3WOD F;  2D1H A;  3HRS A;  5D5V B;  5B3S H;  2CUJ A;  2DA6 A;  2K5C A;  1UB9 A;  2DK8 A;  3J81 Z;  2HEO A;  3DKY A;  1MKM A;  3FXM A;  1MBJ A;  3QOP A;  1ZN2 A;  2IS2 A;  4HQM A;  2LF8 A;  1IDY A;  2HR3 A;  2H6B A;  1YX5 A;  3H3V K;  1EF4 A;  2KIS A;  2E1M C;  3H5A A;  1H0M A;  2H09 A;  3I59 B;  4BJ6 C;  1ZLJ A;  3VSK A;  2CV1 A;  1G6N A;  2B7E A;  3WU2 C;  1YYV A;  2CSO A;  3K1P A;  1F4K A;  1X1C A;  4U88 A;  3HPH A;  3PNV A;  4L5I A;  4PSX A;  4KFC A;  3ELK A;  1VQ5 I;  4C2T A;  3KP2 A;  1ENH A;  4EEF G;  5KK1 A;  2XAG A;  2GIZ A;  3UNG C;  2I5U A;  4N9I A;  2IP2 A;  1XMA A;  4V2G A;  2X85 A;  1ZRF A;  2BVL A;  1GXQ A;  4IHT A;  3QYF A;  3QU6 A;  2HKX A;  4BQN A;  1MBK A;  1EV7 A;  3GCM A;  4UUS B;  3J7A O;  5EZH A;  5IOZ A;  5EF6 A;  3JW4 A;  4XM3 A;  4KJZ A;  2LKP A;  4Y3O A;  4WWC A;  3IHU A;  4A12 A;  5CVU A;  4IHW A;  4HNT A;  2E2H J;  3GTG J;  4LOC A;  2P8T A;  1N77 A;  1KQ8 A;  3GF2 A;  5E79 C;  2FBK A;  1RI7 A;  4J19 A;  1SVL A;  2NRA C;  4B3X A;  2P5K A;  4M6V A;  4MFD A;  5IP7 J;  4AIK A;  3DPU A;  2F4I A;  4M6Y A;  4CIC A;  3R4K A;  2O7O A;  3K4C A;  1O3T A;  4ZDP A;  2M34 A;  4QPQ A;  1V5G A;  1VQ4 I;  4MLO A;  2HWV A;  4AIJ A;  4PJN A;  1ERD A;  1Z3X A;  1IO2 A;  5FRO A;  5JHF A;  2MSY A;  4E7H A;  1NG7 A;  3D0S A;  1OJL A;  2OZU A;  3K4J A;  3HOX J;  4L5J A;  1X1P A;  4FAS D;  5GAG J;  2WAQ N;  3P9C A;  4A3D J;  1WSU A;  4HOB A;  3PL8 A;  5FFZ A;  5LRR A;  1ETO A;  3KP3 A;  3WU0 A;  1W36 C;  3V8L A;  2RAE A;  4L0Y B;  1MSE C;  4YII A;  3M8F A;  3WTZ A;  5FD5 A;  4ABZ A;  4XRM A;  5IYD J;  2MLK A;  1BBY A;  1D1C A;  1MMD A;  1J9I A;  3K10 A;  3RI4 A;  1TQP A;  1NH3 A;  1VQP I;  2NVX J;  3EET A;  4II3 A;  4BQQ A;  5F0H A;  4A3J J;  4XRS G;  4NBQ A;  4DZP A;  2QVO A;  3CJQ B;  3ROU A;  4AVP A;  2H94 A;  3HOV J;  4R8H A;  2FA5 A;  2A61 A;  2MGQ A;  2X0L A;  1IAW A;  3HSE A;  3HTU A;  2M4K A;  1IRZ A;  2XF6 A;  1BJA A;  1LEB A;  4I98 B;  4KUM A;  3EQL F;  4A5M A;  2P5L C;  1TNS A;  4WXD A;  4F92 B;  2IS4 A;  3ZQI A;  4HNV A;  1R23 A;  3AG4 H;  4RLQ A;  1IZ1 A;  3W6K B;  3M7G A;  1S29 A;  1AA7 A;  1U3E M;  3DU6 A;  5DCF A;  4I01 A;  4UHT A;  4RBO A;  1AU7 A;  5M5X J;  3OYH A;  2NVU B;  2H8W A;  3O6B B;  3H1C A;  1X4O A;  3OWT A;  2R5Z A;  1MMS A;  1T2K A;  1GUU A;  2X1D A;  2W85 A;  5J3L A;  1Y1W J;  4XK4 A;  1OCO H;  1UFM A;  1IF1 A;  2KDZ A;  1JE8 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 2EIM H;  3AG4 H;  3AG3 H;  3AG1 H;  1OCR H;  3ABK H;  2EIJ H;  3ASO H;  3ABL H;  3ASN H;  5IY5 H;  3ABM H;  3AG2 H;  1OCZ H;  3X2Q H;  1OCC H;  2EIK H;  2ZXW H;  1V54 H;  5B1B H;  1OCO H;  2DYR H;  2OCC H;  3WG7 H;  2EIL H;  1V55 H;  2DYS H;  5B3S H;  2EIN H;  2Y69 H;  5B1A H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...