3AG3H

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag3H00
3ABMH 2OCCH 3WG7H 1OCCH 2EINH 2DYSH 5B1AH 2EILH 3AG3H 3AG4H 1OCRH 1OCZH 2EIKH 2EIMH 2EIJH 5B1BH 3ASNH 1V55H 3ABLH 3X2QH 1OCOH 2DYRH 2Y69H 5B3SH 3ASOH 3AG1H 3ABKH 1V54H 2ZXWH 3AG2H 5IY5H
chains in the Genus database with same CATH superfamily
1SD4A 5CVIA 3MVPA 2LMDA 2Q8KA 3JR9A 1KQ8A 3MFKA 2E1CA 3HOYJ 4E70A 3SQNA 3BG9A 1WJDA 4PJLA 3H92A 2DPDA 2WBMA 4M9XA 3OYNA 4RB0A 2DA6A 3BR3A 4EJTA 1D0ZA 4BKXA 3OS0A 2HS5A 1MNMC 1FOYA 1AA7A 3QP5A 3R61A 2Z33A 3HGYA 2HQRA 3CCEI 2C6YA 2FOKA 4YEJA 1R71A 1SFEA 1FWZA 3VYRB 1I1SA 1R1VA 2EINH 2P5LC 1EA3A 4MEXF 1PP8F 5CPRB 4N4OB 4A3JJ 2FRHA 5FKKA 2FQ4A 2VOOA 2M5WA 2XF7A 1SFOJ 1ENHA 4HNTA 2Z9OA 2BBYA 3FXJA 4KITB 3FXMA 5CVRA 3C3WA 2UWMA 3EUAA 5CVVA 1YW7A 3QPSA 2VQLA 4LMYA 1IUFA 2M0MA 1YITI 1HLVA 1TTYA 2XPUA 3GCMA 1HSTA 4DIQA 2ELHA 3VPRA 4X1EA 1OKRA 3FBIB 3C1DA 4IXAA 2QZ8A 2DK5A 1RETA 3K69A 2PMUA 2KFDA 4F55A 3K4CA 2RV8A 2OTJI 4NUBA 2V7FA 2DFHA 3I59A 3K4JA 3R0JA 2A5YB 2H1LA 3BT9A 4F52A 3CLOA 2XB0X 5IT9K 4LK0F 4AIHA 4PCQA 1GDTA 3FDYA 4XLEA 4CDGA 4ZYGA 1B72B 2EZIA 3OS2A 1ITYA 3T0YA 2IBDA 4GO1A 2AXTC 2GIVA 2JZYA 3BR0A 3L9FA 3H35A 3M9AA 4BJTA 1E17A 1C0WA 1NG7A 4Y52J 1R58A 1FP2A 2X0LA 4EM2A 3K1PA 2ACJA 4XOTA 1MBFA 4IRGA 2JN6A 5EGOA 2IGKA 2GIZA 5ED4A 3RZDJ 3OYJA 3BDDA 1VQ6I 1ERDA 1ZREA 2EA4A 3K2AA 1RESA 5FD5A 2KJBA 3G3ZA 4BAYA 2HU9A 3PQKA 3GUDA 2R4GA 1N78A 2NNNA 5DD4A 5JHUA 4UUTA 4ENMA 3MAJA 3HG9A 3HOWJ 3EUHA 4LLLA 2FX0A 2CQNA 1QPMA 3E97A 3RJPA 1MNDA 3A01A 2FF4A 3PNVA 4IF4A 5CVJA 3VYTB 3L09A 3T8RA 2L7FP 3IHUA 1WRJA 1Y8RB 4XMYA 4D1QA 4MNUA 2HKXA 3F72A 2PEXA 4HAMA 1BJZA 1B1BA 2ESHA 3KETA 2MA3A 3U2RA 3IKTA 2GOMA 2DQLA 2ZXHA 2CUZA 1TT5B 4LG0A 4KMFA 1ZKGA 4PZJA 1MSEC 2OQGA 2R7VA 3BR6A 3ELKA 4EM1A 4AIJA 1CQTA 2IRFG 4IHSA 1AOYA 1IRXA 2RC4A 3ZN0A 3VWBA 2W48A 3GZ5A 5K1YA 2RVCA 4ZTFA 1ORKA 2V9KA 3P9IA 1YW8A 4E7SA 5FKOA 4XLNF 2E19A 5AONA 1ZLJA 2ZFWA 5C4JJ 3E6DA 1XC5A 1SD6A 2R3SA 5LBQA 1JKPC 2JA2A 1TBXA 1SD5A 2QSGX 5K5QA 4BH9A 1MDMB 3ZQCA 1HSJA 1X3WB 4NHJA 1JKOC 2PFBA 4FE7A 5GPCA 3RKQA 4HV6A 1ZARA 3I5UA 1H8AC 2EPFA 1EV7A 1BN5A 1N75A 3KEYA 2RDPA 3BZCA 1YX5A 3V4GA 1QHGA 5FLXK 5J1UA 2VC1A 1JUMA 5E79C 3KP3A 1BW5A 2W00A 3H5AA 1XGNA 3FWEA 3RZOJ 3KP5A 1HXDA 1LUJB 4CA0A 3JSOA 4OWRB 2JRMA 2HR3A 1SFXA 2JSPA 2O5RA 4Y4RA 2LD5A 2HOEA 4ON0A 1MBHA 3QU6A 3MMYB 1WVRA 5L3EA 2XGDA 2CFXA 2CG4A 4I98B 4WXCA 4L9NA 4BE2A 3EYYA 5DCFA 1IC8A 4OIOF 1QZZA 3H36A 5BOXA 1RNLA 4LK1F 2XAQA 2EZHA 3E5UA 3HTUA 1PUFB 3WODF 2RREA 2LH9A 3HB9A 3OYEA 1W1WE 4MO7A 3BTJA 4BQQA 1HW2A 2E71A 3FXLA 1BW6A 4A3EJ 2O7OA 5CLSA 2JPBA 1POGA 1FBSA 2XRLA 1V5EA 2OAZA 1JJ6C 3DEEA 2G7UA 4DYRA 2EH3A 2P8TA 4B3AA 3A02A 3I4PA 2P7VB 2CSOA 4B43A 4A3DJ 1IO2A 1FT9A 3KYCB 4EMSA 3MZ8A 1MMSA 1GV2A 2A5WA 4CCJA 4UB6C 2BY3A 3GTLJ 1U6GA 1O3QA 2W25A 4O3MA 1FX7A 3OYBA 1D5YA 4PGHA 5F1RA 4ENNA 2UXXA 3ZCOA 2X85A 1VQ9I 2PMZA 1VQKI 4ITVA 1IDZA 2BYVE 3E5XA 4A0ZA 3WTSC 1Z7UA 3QRFF 4Q48A 4RLFA 3ERED 2CQ7A 3QP6A 3O6BB 4FCYA 3WTXC 2X9DA 5FKLA 4EATA 5E1ZB 4XLFA 1LEBA 1Z7LA 2GAUA 3OYIA 4XR6A 2FD5A 2JTVA 2BY2A 2DMQA 3LSJA 4M6YA 3S16J 2COMA 3E6MA 1D1AA 3J81K 1R23A 2K3PA 3PSIA 3E5QA 2Z16A 3JTHA 5K5OA 3I58A 2TCTA 3H9QA 5BNGA 1WZ2A 3GW2A 1IRGA 1WI9A 3VB2A 3FXUA 2A6HF 2GBYA 4IZZA 3V42A 1YRNB 2VXDA 3LMMA 1T08B 3ABLH 3HRUA 1N77A 1FYMA 3K10A 2VBXA 3HDDA 1Z77A 3KZYA 3G73A 3V7SA 2KIFA 2VKDA 2E7XA 2JRTA 3KZZA 2ZXWH 3TW7A 2XKPA 3WG9A 3MD2A 3DBRB 3IL2A 4PSXA 1D5VA 1IZ1A 3C7JA 4FE4A 1GV5A 1A36A 1Z3YA 2KRFA 4JP0A 1KQ0A 3BJOA 2Y9ZA 3U1KA 4AC0A 3AFHA 2FSWA 3HRSA 2DFFA 4ZH4F 4FETA 4A12A 4XSZF 1JT6A 1LNWA 1T8IA 3BQYA 2V6EA 1R49A 4BJ6C 5ILUA 5M5YJ 5FO5A 2F48A 2JVGA 2CJJA 2DDBA 2KP6A 2DBBA 1GUUA 3E6BA 5LHIA 1H9TA 2PMHA 4YELA 3TO6A 1D8KA 3GF2A 4BQNA 3LAJA 3FK6A 5J8CA 1UG2A 2NVUB 1AKHA 2DO7A 5EZHA 4DOZA 2ID3A 3WGHA 2OBPA 1OCZH 1ZRCA 2AQEA 4PFOA 1UAAA 4HF0A 2L9SA 5E18F 4AYBA 4AYBN 1XMKA 1NK2P 2HVQA 4B4CA 3PO2J 2XAGA 4E7ZA 1VZ0A 1IN5A 3CC7I 1TW2A 2QVOA 2Y30A 4B1RA 2ISZA 3CCYA 2RQPA 1W0UA 4JOMA 3S3MA 3TOAA 1TQPA 3LFKA 2QF7A 2OCCH 1WQ2A 4GCVA 3CMEI 1Y6IA 3LA7A 2A6TA 4G6QA 1RR8C 2Z2SB 1OLTA 1UHSA 3C2GA 4YIIA 1ZG5A 2NS7A 4S0HB 1VI0A 4BEHA 2DOAA 1DGRM 4C2MJ 5DM6F 1MGTA 5C4XJ 4BXUA 3J81Z 3FKJA 4N9HA 4F91B 3LSHA 2E36A 3WE3A 1ZG1A 4L9VA 4GYIA 4BY1J 4C3JJ 1FC3A 1BR1A 1STZA 3ZOBA 1KONA 1VQ4I 5F64A 3H3ZA 1I1GA 1ONVA 1W36C 4HF2A 1IJWC 4L0ZB 3TDZC 2HXOA 1X1BA 2LKSA 3GFMA 1MMDA 3M4OJ 3HJEA 2GQQA 4QLCU 1S7OA 1QVUA 2LKXA 2EIMH 2DI3A 2K40A 4M9SA 3T1BA 3IKVA 1EH6A 5E3LA 2ZJ2A 3B73A 4OAZA 3QYBA 4XQFA 1W0TA 1EKEA 4KDPA 1DP3A 2VJIA 4RMNA 1S7EA 3HL2A 1F36A 3A01B 1MNEA 3UNGC 2UZKA 1ZRDA 1VTNC 1A6IA 3RYRA 1X2MA 2ZSHB 1JKQC 1P4WA 1S5LC 2E1MB 2NRAC 1DDNA 2BOLA 4UUSB 1CF7A 4GDFA 4EJVA 3KYDB 4R8HA 4EQQA 3T5XA 2VIXA 4UXNA 3DWLE 2E1NA 2GM4A 2WWYA 3J7AO 2VQCA 3HIFA 1JTYA 3L2WA 2QSHX 3HTSB 4I02A 1HCRA 1IAWA 1MZBA 4XLCA 1QRYA 5FFXA 2DFIA 4FQGA 1G59A 1OYIA 2DT6A 2LOOA 4F3QA 2OZ6A 1BOBA 3ZMTA 3GTGJ 5DDGA 3BJAA 4AUXA 4LLNA 1UJ8A 2QBYA 3BLYA 3MWMA 2ZXIA 1IF1A 4H0EA 5J4YA 2H6CA 3VYSB 2PBIA 4RGRA 1HC8A 1G2HA 3C18A 1WI3A 4M9ZA 3H9JA 4HLYA 1HQCA 5D6EA 3PUBA 2R5YB 5FLVA 4A5MA 3H3UA 3FHZA 5DUIA 3MKYB 2EZKA 3L2CA 4OOIA 4LB6B 5BQTA 4XNFA 4ZDOA 1OPCA 1U9NA 1W5TA 3DTKA 1I6HJ 3F8MA 2MC4A 4JYKA 5L3CA 1XDSA 3LQQA 3BG6A 4KMUX 4LOCA 3R60A 1OCCH 3DBHB 3JW4A 4XSXF 4ZDLA 4BJ5C 1Y39A 1VQ7I 3I4NJ 3S8PA 2IS2A 3KIOA 3KEQA 3BC8A 3ZQIA 1L3LA 2N8GA 2L4MA 3KFWX 4XRFA 2YU3A 1K78A 1T39A 3IAM2 2XAFA 3GZ6A 2LR8A 4MLOA 2ICWG 1MH4A 1U8RA 3RSNA 5FD6A 2CW0F 3CDLA 4Y17A 1X19A 3M07A 5J3LA 3EUHC 2XAHA 4YG2F 3L2UA 2QWWA 1XSXA 3CCRI 3BJ6A 2M8EA 3HEFA 4G9YA 2EILH 4MIMA 2OUMA 1FYLA 1XCVA 1R4MB 1ETVA 2ME0A 4FX0A 2RQQA 1MMNA 5TJJA 1U5TC 4EGZA 3TEDA 2L9RA 2VBYA 3SHFA 1IV8A 1FY7A 3VSLA 2IPQX 2FXAA 1K6OA 3ERMA 1K4SA 2EWNA 4FTHA 1FIPA 3S2HJ 5HLTA 1BR2A 4BU2A 2JT1A 3SZTA 2RGVA 5ICCA 1FYKA 2MD0A 3D5LA 3LSKA 1Y1WJ 1WHUA 1T6SA 2Y2ZA 3KZIC 3JRDA 1D1BA 2KRCA 4DZPA 2FOWA 5JR3A 1Z67A 3R0AA 4DJAA 4Q47A 1E0EA 4CH7A 4NC7A 1TWHJ 1B6AA 1K83J 4G12A 2M7BA 1QU3A 3PJRA 2BXZA 1D0YA 4IHVA 2Z99A 4W1UA 3ZMVA 3KPHA 5E3MA 2Z1DA 2HOSA 2E1OA 5KHDA 4BHCA 4G94A 2A69F 1PVEA 4OMZA 1TP4A 4KT6A 1Y0UA 1G3WA 1X1PA 3FISA 3PNTA 2DA7A 2DA4A 5E3OA 1NHAA 2VUMJ 5DEQA 3HOVJ 2OC6A 1WJBA 3KP4A 1T38A 1P7IA 1Z21A 2E60A 1R1TA 3QODA 4C3HJ 4U7BA 3KP2A 5B66C 3D5SC 2FBHA 1H9GA 1XD7A 4U88A 2VKEA 2I10A 5D4SA 1F5TA 2BVMA 5KAFC 4V2FA 1R1UA 1FMVA 2F2EA 3K9TA 3FMRA 2MC3A 2FNAA 1G6NA 3FBNB 4WWCA 3PIOF 1G4DA 4JQFA 1QGPA 2R7TA 4CZZA 4AIDA 4PJ0C 5JI6A 3O8GA 1WCMJ 5IY5H 1J09A 2VBWA 1WJCA 2IGMA 1XCBA 2RKHA 1YG2A 4U0VA 3WU2C 2NVTJ 1WJAA 2JA8J 3DU5A 3ZMZA 1OYWA 3J80Z 3OMYA 3VDXA 1A31A 3R4KA 4WK8F 1MBEA 1P6RA 4P9UA 4V2GA 2WY7Q 3MEXA 3CP8A 3BTLA 1TC3C 2X1EA 4B8XA 1HKQA 2OF7A 3G6EI 3OSGA 1HDPA 4XONA 2WADA 2DJIA 3QPLA 4RGSA 2ZNZA 5BS6A 4E7IA 4E7KA 2MH2A 1JHHA 3R6SA 4A6DA 3ULQB 3GVAA 1I5ZA 3G4SI 2X48A 4RM2A 1FBQA 2F5VA 1AKHB 4PUSA 2WTEA 3BZKA 1FLIA 3FM3A 4JX6A 1Z0XA 2Y0SN 2H8RA 1BC8C 2HVRA 4L9TA 1ODDA 4XIDA 2HQ5A 3B6CA 3NQOA 1OR7C 4HA8A 5EG0A 3HPHA 2MYSA 4MTDA 3PIPF 5E8GA 3REOA 2J5PA 3FHNA 2R7RA 3ZR8X 1J2XA 1KU9A 1YIJI 3H0GJ 2CQQA 1FNNA 3ZXSA 5M5WJ 2LK2A 2ZJQF 4GGGA 4EJOA 5GAEJ 1SFKA 4BACA 1G3SA 2OA4A 5F04A 1BBYA 3PL8A 2G9WA 5LGTA 4KFCA 3HXLA 4BEHB 2DFEA 2DMPA 2IS1A 2CW8A 2GXBA 2HYFA 5HS9A 4HLXA 1VQPI 3CC4I 4C2UA 3BZ6A 1TWGJ 2VB6A 2DW4A 1X58A 3S32A 1LB2A 1WJ5A 1X1CA 3RI4A 4EJWA 2XPVA 3GXOA 1X1AA 4ZYDA 2K9SA 4M71A 5HDGA 2HDCA 1Y0NA 1ETYA 3J7YJ 3W6VA 2DJNA 1T33A 2EA2A 2ELKA 3LOCA 4Y15A 2CYYA 4HDUA 4A93J 4RM3A 1TQMA 3ABUA 3RKWA 2EIJH 2LBFA 5BMZA 1XPXA 4ZJZA 1BM9A 3LWFA 3V8KA 4DYCA 1ZELA 1MBGA 3LA3A 3Q9VA 5F27A 3OYHA 3DKWA 1JGGA 1J0RA 2UXNA 4RB1A 3A2KA 4CZCA 3JRIA 1FIAA 3GO5A 2FU4A 1BIBA 1PUFA 2DN0A 2DTZA 4UV8A 4BXXJ 2QQBA 2H09A 1JT0A 1OJLA 3P5JA 1RKTA 3KCCA 3EQLF 3S1NJ 4HNUA 2M7AA 2P4WA 4G7HF 3CF5F 1UMQA 3KLNA 4D9JA 4OIQF 2HPIA 1ON2A 5FB2A 4IEJA 3FX3A 4U7DA 4M3EA 5LRSA 1OFCX 2LY9A 2QBYB 4KICA 4YFXF 3GYHX 4F93B 3AL0B 3RYPA 2Q1ZB 4QWQA 2E2HJ 2EZLA 5HS7A 1WGXA 5TRDA 1RKWA 2RAEA 3O2PE 3P9CA 1WPKA 2KJCA 2XAJA 4FASD 2X4HA 2B0LA 4YFKF 2YX7A 3DTIA 5ILSA 4XKCA 5M5XJ 1LJ9A 4RB3C 5HLHA 5JVTA 3MCZA 2VOPA 3ABKH 3BCBA 4ZYHA 3WTWC 5LD2C 2FEZA 1WSUA 4ZZDA 2W84A 3KLOA 4AVPA 5LGUA 4IKFA 2CFOA 2OZUA 3B6AA 3K1NA 1G3YA 4A0YA 2TDXA 5CKTA 5CQEA 3CESA 4XKWA 4O5VA 1XTAA 3OY9A 3K4BA 4LITA 4HDVA 1I27A 3BTCA 2V1NA 3ZMDA 1XMAA 4G6TB 2LF7A 1OCPA 1LFPA 4BY7J 4IX7A 2A68F 1VF9A 1DPUA 3B02A 2UUZA 2VASA 1AU7A 3VYUB 4L5IA 3TP0A 1OCTC 4IOAF 4I99C 4L18B 2NVQJ 4ESJA 4KIFA 3BOQA 3KE2A 1HA8A 4A3CJ 4EGYA 2GA2A 4UNOA 4C9YA 5IOZA 4QTRA 4RB2C 2XDVA 3DPTA 2IA0A 2ETHA 2STTA 5B1AH 2IA1A 1XDUA 3RQIA 4RDUA 2HEOA 3D0SA 3SZPA 1LFUP 4RGUA 1L0OC 4RAYA 2EV5A 1IDYA 1R7JA 5EGOB 1MDMA 4AIKA 4Y7NJ 3IH2A 3X2QH 3NEUA 4L9JA 3H3VK 2W7NA 1DU6A 3HBLA 3ZGKA 2HWVA 2ZJPF 1TQIA 4M3DA 4G7ZF 3OR2C 2H1KA 4EM0B 2VQGA 3FIWA 2DMTA 2KKOA 2LP0A 3FXKA 1W5SA 1AWCA 3IRQA 2VODA 2HNHA 1IN6A 3OIPA 2NNYA 1SVLA 4XORA 2LY1A 5JFRA 5F0HA 1RUOA 4WXHA 2CUJA 2L9NA 3I53A 3Q0VA 2O9LA 2EFPA 3BR5A 2VKHA 1J59A 4CCOA 2DTRA 3CLQA 2W24A 1ZH5A 3CZ6A 2QM3A 3K7AJ 2P5KA 2VONA 2R92J 4NBQA 4D7MA 3MKZA 2VT3A 3ZMUA 3ZRGA 1GVJA 1R00A 2W82A 2XVCA 5CVUA 3ABTA 4NB5A 3K1MA 5E1WA 2IXSA 2L3DA 1HKSA 3CJTB 2Q2EA 4XL9A 2ZFUA 4NDLA 3FXRA 3Q0UA 2XASA 5JLXA 4OIPF 2KZGA 4JX5A 4C3IJ 4I09A 4IRHA 2VJ5A 1H89C 2DOEA 1RUNA 4OIRF 2Y0MA 2R7DA 3JCUC 3M8JA 1Y1VJ 5F0FA 3GEZA 1RIOH 1QA6A 2E1MC 2WAEA 2VI6A 2R5ZA 5FRMA 3JRGA 5E20A 1SMYF 1FMWA 4I01A 4FX4A 2ZB9A 2LG4A 4HV5A 1JGSA 1MBJA 2PI0A 4IO9F 3AG4H 3GBGA 1ZRFA 3S14J 3LQRA 2FJ1A 3I54A 3ZP5A 4MQVA 4NQWA 4BBSJ 2M8GX 1MIJA 3UR3C 3CO6C 2CMPA 3BCAA 3HOUJ 2JMWA 2X51A 2V1UA 1SANA 2DYRH 2IVMA 3F0CA 3JREA 2PJRB 2HTJA 3CCVI 3S17J 1P2FA 2L02A 3SEZA 3AG2H 2K5CA 2K7LA 4IL6C 3CJRB 4QPQA 1ETOA 2IW5A 2VLAA 4Q5SF 3BROA 4AVZA 4PGGA 2QEXI 1MKMA 1QZEA 5FKNA 2H8WA 5FROA 3JRBA 1HKTA 3QYEA 4DBRA 2P0WA 1MJAA 1V55H 3CMYA 4I76A 2QKLB 1KQ9A 2DA2A 2ZKZA 4BE0A 3HHGA 1VQMI 3OL3A 4UVCA 3ZPLA 2HPMA 1MMGA 4Y33A 1FSEA 5ICGA 1HF0A 1JE8A 1LDJA 4HW0A 3F3XA 5M3MJ 4XKVA 3I9V2 2NS8A 2GOXB 1E3PA 2MLKA 2V1DA 4H4KC 1UCRA 2QENA 1ZG3A 3WHCA 4HF1A 1KU7A 2ZC2A 3OL4A 4XBFA 2ZJRF 1YS6A 2PG4A 3HOXJ 1SEUA 2NYXA 2FE3A 1ETXA 2V6CA 4WXDA 4E7LA 5DUKA 3L2VA 1ZGAA 5L3BA 3FF5A 2ZO4A 4Y13A 5H2FC 2OJED 2QSFX 2R93J 2HI3A 1BC7C 3UKGA 2PQ8A 1XGMA 2VBZA 1BL0A 2E2IJ 2HOTA 1I50J 3DXJF 3PNYA 4XRSG 4ZZLA 2YU9J 2JA5J 3TDUC 3GFIA 5F08A 2W85A 1FZPB 2DT5A 2Z5UA 1TLHB 1A6QA 5KCMA 3MN2A 2PJRA 4A3GJ 3MKLA 4A69C 1QNTA 1PYVA 1S7AA 3I55I 2M9HA 4ETSA 2DXIA 4BGDA 3ZQQA 5HLGA 2BGCA 4I0AA 1O4XA 1E2XA 2FMLA 3NWSA 2GXAA 2QKMB 2P5VA 1YRNA 5LFAA 4HYEA 4M3GA 3E7LA 2DDAA 2XAUA 3GTOJ 1OMIA 2XGXA 1H0MA 1J9IA 2LFBA 2EV0A 2O6GE 2CUFA 3HZJA 2R0QC 2DQRA 5DTDA 5IT3A 4HPQA 2A07F 2JA6J 2VXZA 3I3LA 3HHHA 3S15J 2RN7A 2VT2A 3BQZA 4BNCA 1ZK8A 1JHFA 2QQ9A 4NC6A 1QPIA 5K7HA 3QOPA 3RTRA 3HRMA 1CGPA 1RZ4A 1P92A 1JXSA 3FKIJ 2E35A 4HRIA 1VQNI 2MABA 5TISC 1JUPA 3TP3A 2VJJA 2K9NA 4ZTJA 3I0TA 2JUCA 4YRVA 4S04A 1VQ5I 1R5GA 2FNPA 3F8CA 3U21A 5J4VA 2STWA 2DK8A 3OYKA 2R7FA 1K79A 4PSWA 4G8XA 2HYJA 3GX4X 4J19A 4W97A 4YIRX 3DPUA 5IP6A 3V7RA 3C2BA 1Z6TA 5LLQA 3U1DA 1QVTA 5TGTA 2KDOA 1W7PB 4RBOA 2HZDA 2DA5A 4HX7A 5GAGJ 1BI2A 4C30A 5D5XB 2OTLI 4IJAA 4Y3OA 2EFWA 4LD5A 1IN7A 4UV9A 1IRFA 2OQRA 2K4JA 3NRVA 5FFZA 1E3OC 1AHDP 2IGNA 1QO0D 5GTIC 1GLNA 4M3FA 1X4PA 1WKMA 4XOPA 2IS4A 1LVKA 2FQ3A 5BPDA 2EJRA 3GTPJ 4GXOA 2M4GA 2K4BA 3K2ZA 2DCEA 3HYIA 2M45A 1O3SA 1UHWA 2EB7A 4A0XA 2COBA 2IGOA 2NS0A 5CYVA 4UY8I 2EBIA 3CQZJ 1DGWY 3IV5A 4WX9A 2DMUA 2YPRA 2JUGA 2L54A 3N05A 3HUGA 3OYGA 1V4RA 3DEWA 1NTCA 3LSPA 1WH7A 3WU1B 4XRSA 4N0BA 3CUQA 2P81A 4QIWN 3DBLB 1R9TJ 4DW6A 1F1ZA 5FLXZ 5DD8A 3LSGA 2Y31A 3CMAI 2WV1A 4MFDA 1WFXA 2HGCA 4CCNA 1XN7A 4DQ2A 2OCEA 4O6JA 1P4XA 2M30A 2PJPA 1Z6RA 1Q1HA 1TNTA 1TWAJ 1VFCA 1APLC 4HOBA 1OR7A 2F4MB 4EJUA 2O8KA 1IXCA 3HKZN 4R1HA 1EF4A 4F7ZA 2K9QA 2WAFA 3DU6A 4QPOA 3RPUA 1F4KA 5L3GA 5LEJA 5D5UB 5AIPA 3AL0C 2DAOA 2ZNYA 2HDDA 3SEQA 5FLMJ 4BDYA 2R7QA 1YW9A 3OYCA 3QU3A 4JX4A 4KYWA 3DCFA 3JRCA 4IQ4A 2X6OA 2V4JC 3A4CA 3CCJI 3OYLA 3A1YA 5HLIA 3V8LA 4MFEA 3GLXA 2HTSA 2LRDA 4HG2A 1X3UA 1U2WA 2D5VA 4AD9A 3CUOA 1SAXA 3N97A 3CDHA 2NVXJ 2O03A 1YJ9I 2GA1A 1GT0C 3GTQJ 1B4AA 2D1HA 4P1WA 1WJFA 3BG5A 2ZMEA 1V5GA 3RIRA 2W57A 3FZVA 5D5VB 2Q0OA 4HSTA 3L2RA 2D1VA 2KL4A 3WE2A 1KGSA 5HNHA 5IYDJ 3HUGB 3LSTA 3WU0A 4DYQA 1RPWA 3ZQ7A 1OISA 3G71I 1K7AA 1E3HA 1MJBA 4RLQA 2CGPA 2ISYA 2D2WA 4S05A 3H9GA 2XF5A 3RKYA 4A3KJ 2MGQA 1T98A 3NWTA 4KJZA 4CICA 4D0PA 3BG7A 3LSRA 4AU7A 2R5YA 5F0CA 4J00A 2O61A 2R7XA 5J1RA 3QAHA 2LC2A 1J5YA 4B44A 2WY8Q 2YR2A 5E8IA 4E7HA 1USSA 5C44J 5D4RA 3TL4X 2H94A 4C2TA 1KZHA 2ME6A 2MD5A 1JKRC 1Z05A 3WTVC 1U5TA 3MKWB 5IP7J 2O0YA 2BHZA 5J8FA 4A3BJ 1A35A 1YFHA 2BY1A 3ISPA 5B3SH 3FMQA 2LKPA 1I39A 5IPAA 3F6VA 1ZAOA 2JQ7A 5HDKA 2VPRA 2ELJA 3NARA 5EEAA 1Z1DA 4A5NA 2BHYA 2X6WA 3G2BA 1GVDA 4PJNA 1I3QJ 5KVRA 5F6FA 4LB5A 4OU0A 5DS9A 4R79A 1T0FA 2LSOA 4ENKA 1Z3XA 2E2JJ 4ZC3A 2R7OA 4ZYAA 4M73A 4M72A 4A3LJ 5JLWA 1KYZA 3JRHA 4XLPF 2HYGD 1YQAA 1TZLA 3CDIA 2ZMEB 3KX2A 1G3TA 1Q1VA 1EH7A 1W7PD 1X3ZB 3PSFA 3VSKA 5JVGF 2L7ZA 1BI1A 1LDDA 2MBFA 2V26A 4LG3A 3PUFA 4KIBA 1TW3A 1ETWA 3GWZA 2G0EA 4D7NA 3EPZA 2PN6A 4HQMA 3VOEA 2W1OA 3F6OA 1REPC 3KP7A 2Y0SA 2F5EA 4CCMA 3SDGA 3ZQGA 2F5FA 4ANJA 5DM7F 2Y75A 3D5RC 3LAPA 1KYWA 1HW1A 1UFMA 2DMNA 2I5UA 1RI7A 3IWFA 3HOTA 2QQ8A 4AM3A 2EV6A 2XSJC 4D5FA 2AXLA 3I64A 1YIOA 4HZFA 1D0XA 1V3FA 4CCLA 5LEKA 1F9NA 3SDBA 3DP7A 3P9KA 1OQYA 5J6XA 3HRTA 1MJ9A 2KPMA 3SFIA 4E4HA 1X2NA 3IUOA 4UB8C 2V1XA 3L2QA 2QQAA 3I4MJ 2LDUA 4G7OF 4WF2A 3DKXA 2DOFA 1YO5C 4KISA 4MEYF 1YHQI 4IHWA 5J47A 5M3FJ 3NAUA 3OYFA 1QQIA 1XSVA 5E17F 2MLGA 3DKYA 1ZR2A 5KNLA 4KUMA 1FOXA 1LKXA 1ULYA 3RQ4A 2EQRA 3G1LA 3WG7H 3F8BA 2QLZA 3I59B 2NVYJ 1XS9A 1OYYA 4KN4X 2DA3A 2M1BA 4II2A 1VNDA 1BIAA 2CQKA 3F9KA 5HS8A 1U9OA 2XUBA 1UHMA 2R7WA 1YX3A 4ZDPA 5C3EJ 3C2HA 4WCGA 4M74A 1X4OA 2TRTA 2RNJA 1S72I 4UUVA 3E1SA 1MH3A 2R7SA 1QHHD 5EZGA 5EEGA 2YUSA 9ANTA 4CYDA 1SVMA 4U0YA 4GYGA 2HQAA 3CJQB 4BBRJ 1B9NA 2OV7A 3ECHA 4CCKA 2MW8A 4UVAA 4CO8A 4A6EA 1JUSA 1SFUA 2MG4A 3DEUA 3K0LA 1KA8A 2NAZA 3HOZJ 4I0BA 3MQ0A 2M34A 4NC8A 4OAYA 2ZXJA 1BI3A 2ECBA 4CYCB 3K70D 4YFNF 2L01A 3CCUI 4IHTA 5EG0B 3OYMA 1J75A 1FTTA 1UZCA 3SJMA 1S29A 1I3AA 1Z91A 2CWEA 3F22A 1Y8QB 2V9PA 3BWGA 2GLOA 2CW7A 3O3KA 3HGGA 5ILVA 1FOWA 2VKVA 1O57A 4M3BA 2DT7B 3RPUD 4LG0B 3GTJJ 4LIVA 4HBLA 2WC2A 1IXSB 4QSHA 3VFZA 5IOYA 4XK4A 1U78A 4XKBA 2FMYA 3E0JB 3QWLA 3COAC 1V54H 4ENJA 4BQOA 4BXFA 2O3FA 1R5ID 3L7WA 3EYIA 5EYRA 1TT0A 3VEPA 3QPTA 4UHTA 4BHBA 2RNGA 1XSDA 3BR1A 1R4NB 3PFYA 3G1MA 4HX4A 2M4KA 1F43A 2WB1N 2K86A 5AIQA 1BOAA 1SD7A 2L9VA 1YS7A 4NNJA 2BE5F 1QBJA 5L3DA 1O3RA 1GXPA 2LNBA 5IYCJ 1LQ1A 1SAUA 2JWTA 1I6XA 4U0WA 2JA7J 2MH9A 1ZGWA 3P7NA 4HSRA 1TNSA 5EEHA 4CGZA 2B7EA 1ACIA 3BTIA 5HDNA 2OU2A 4CUGA 3DLAA 4Q4ZF 1UELB 3WTYC 3J7AY 2UV1A 3I71A 1MD0A 2CS3A 2KIMA 2QCOA 4X6AJ 4BYYA 1RRJA 4MHGA 4LFUA 3LSMA 2AQFA 3IAS2 3TKYA 3OYAA 1PP7U 3W2VA 4CHUA 1WWXA 1S3JA 5FGMA 3JAMK 5A2QK 1DU0A 1BR4A 1IW7F 1ETQA 2FUG2 2ID6A 2KIQA 4MQ9F 4J01A 3LNQA 2EK5A 2HDWA 1ZQ3P 1R5HA 1ETKA 2DU9A 2XGCA 3WGGA 1XGSA 3AG3H 3DF8A 2VC0A 2ZCWA 3KYLA 4L5JA 4LIUA 5H6QA 3AAFA 2IJLA 3OOUA 4MGRA 3M8FA 4D5CA 2AHQA 5FKMA 3U9GA 3JSPA 3PO3J 3E3VA 2MSYA 5KAIC 1B59A 1O7FA 1WH5A 2LY2A 4PDKA 3TQNA 2PMZN 4ASNA 2A6EF 4FT8A 2K02A 3W2AA 1DQUA 1MW7A 2CUEA 5E3NA 4L0YB 3ML6A 3IWZA 2NOJB 2XF6A 1OCRH 2WB1A 2VL8A 5ICFA 3GTMJ 4I6ZA 2XRNA 2WAQN 3S2DJ 3OOPA 1J7KA 1W7PA 1HDDC 2CH0A 5DV5A 1YJNI 5EDNA 1U8BA 2V9VA 1LDKB 1NK3P 2B63J 1BA5A 2ZBKA 2L4AA 2Y9YA 1IN8A 2KRHA 4PJJA 4XM3A 2Z3YA 2A05A 3VODA 1FTZA 3BR2A 2BVLA 1S9HA 3F8NA 1U3EM 4Z6YA 3OWTA 2R7ZJ 1JJ8C 3SXYA 3SYTA 3A0BC 1LEAA 5J1YA 4IHXA 3FM5A 4RA2A 2QGUA 4UVBA 2HFHA 3GMEA 3WTUC 5EF6A 4BHPA 3F23A 1PJRA 5IT9Z 1BI0A 5E1XA 1JTXA 1XGOA 2HZTA 2KHMA 3TO9A 1K4TA 2WA0A 3CCSI 1B8IB 1LPQA 5JHFA 2R5ZB 1YE9A 3WGIA 3M8EA 3JRAA 2CRGA 2PX9A 4A3MJ 3QPHA 4BQAA 4IHYA 5ERIA 1EJ9A 2H27A 1N25A 3QQAA 2GZWA 3TO7A 5K7FA 2KMUA 4PK4A 1EH8A 3IRRA 3IH3A 3ECOA 3JAMZ 5A2QZ 1D1CA 2W4SA 2ZSIB 3HSRA 3CMMA 5CJ9A 2GWRA 4E7JA 1HW5A 2LBFB 3CCLI 2BV6A 1ZN2A 3CUQC 1LFBA 2G7HA 3F8FA 3JRFA 3RCOA 2CO5A 2QYOA 3J80K 1IN4A 4LGWA 4N9IA 2BY0A 2M2EA 3SFZA 1ON1A 2CU7A 3DLLF 2HVSA 3CF2A 4XICA 3DV8A 4KA4A 1TWFJ 2EIKH 4CYCA 4P55A 1V5FA 3WHBA 2XHKA 5KK1A 3M3YJ 4B3XA 2LREA 4UUSA 1CF7B 1HBXG 4XN3A 1LVAA 3IH4A 3GFJA 3ZMSA 3A0HC 3AG1H 1YOVB 3DQVC 3ZQLA 1SVOA 3LL7A 1NH3A 4LLGF 5DCMB 5D8KB 1IRZA 3FXOA 3CC2I 2DA1A 3GLLA 4A3IJ 5EJCA 2FBKA 3S1RJ 3CUQB 2D45A 3EETA 1ZGJA 1H88C 2IEKA 1K6YA 3HC7A 1YLFA 2KT0A 1K61A 3CTAA 3M1EA 1FSHA 3D1NI 2I8DA 1OCOH 1X1DA 2JPCA 1R22A 2YX4A 1T56A 2XROA 3ASOH 2BW3A 2XGEA 4KT5C 2P6TA 2ZMEC 2HOAA 1PUEE 1ZTRA 2Y48A 2KDZA 2P6SA 1D8JA 2XB5A 3K4KA 3O8HA 2PLYA 1KU2A 2LYCA 5HODA 5L3FA 5HNFA 2CQXA 1GXQA 3OYDA 3CP2A 2BXYA 4FISA 2VN2A 2FBIA 5GP9A 2F5DA 4U87A 4EEFG 4XLAA 3V8JA 2LVSA 3K70C 2H6BA 1FP1D 1O3TA 3RPQA 2V79A 2E34A 3K4NA 3QYFA 3K6GA 1P4AA 2LF8A 3E6CC 2XPWA 3KP6A 2KQRA 1P9QC 3ZQFA 1G8XA 3S1QJ 1SMTA 4P5OA 2JJ7A 5K5RA 3W2WA 1FOKA 4PFPA 2DYSH 3FXQA 1MBKA 4MTEA 4CXFA 2NXNB 3HM5A 5HOOA 1LE8B 1A04A 3TBIA 3W6JB 3CCMI 3LSIA 1A5JA 2ECCA 4LJZF 3T8TA 1XX5A 1TWCJ 3M7GA 5GPAA 3PQJA 2IAIA 5LHHA 4GFBA 3WTTC 5DCMA 1NG6A 4DZJA 4ZYEA 1S6LA 3Q5FA 4OMYA 1UG0A 2XSDC 1D3YA 4JBAA 5IYBJ 3AKZA 2HKOA 3A03A 1T0FC 1R6RA 1TL8A 2XKOA 2FA5A 2L5QA 1IV6A 4XLHA 3L1PA 1DPRA 2L2OA 3DPLC 1SC7A 3BPVA 1IG7A 2DODA 2M87A 3OIQA 2X1DA 4HEA2 2K3FA 1IXRC 1QZYA 3TGNA 4RS8A 2EFQA 3N4MA 1HOMA 4DNCA 2MFZA 1U5TB 5LHGA 4ESBA 4DGWB 4JK1X 4N4NB 5D8LB 1R36A 1M1EB 3DTEA 3OV8A 2VE8A 2X6YA 2XC7A 2WAQA 4A2UA 3CCQI 3W6KB 2B9SA 3S2WA 3WTZA 1FBUA 4P96A 3MZHA 3ESWB 3GTKJ 1RC9A 1ZR4A 3EUKL 4HQEA 1FPQA 1VQ8I 2ESNA 4I7HA 4BUPA 5H20A 1K78B 3RKXA 2F5CA 2OPTA 3LFUA 3ASNH 1W5CC 4XRMA 1T95A 3M1CA 4PJMA 2VE9A 1FEXA 1GHCA 2EFOA 5DYMA 2NOGA 4ABZA 3I56I 3H0DA 2IS6A 3CJNA 3ZQHA 3CD6I 4GRIA 2J5OA 5B5EC 2Q2EB 2XV4S 2L0KA 3LA2A 1XG1A 4RAFA 4RAGA 2R7UA 3BY6A 5GTHC 5FJ8J 3HPGA 4EV0A 2F6CA 4L5EA 1S8NA 3KEOA 5IP9J 3DFGA 4IPAA 3CO7C 4KN7X 1B8IA 1W36D 2KISA 3TOBA 2HXIA 3Q9SA 1Z9CA 4BL0B 3J7ZI 1MSFC 3SZGA 2CV1A 2AO9A 2DLLA 4NQWB 2P7CB 2OD5A 4IRIA 3IP4B 3OR1C 2WV0A 4M6XA 1T2KA 2F4IA 2BZTA 2QUFA 3OS1A 2K27A 2F4OB 3BG3A 4KNYA 2X1CA 3HKZA 2E7WA 3ONQA 2O8XA 4II3A 1KU3A 3RDIA 2JK3A 2CV0A 3S3OA 4IVNA 5J40A 4Z2YA 2GXGA 1FJLA 3HSFA 1P7JA 2KZVA 2CV2A 2L7KA 5FRNA 1MMAA 5HVQC 4CSWA 3PFIA 2VQHA 5K7ZA 1VQLI 3OSFA 2DPUA 1XB4A 6PAXA 2LTPA 2A61A 3IC7A 4F92B 2IA2A 1IUYA 2L7MP 1USTA 1WJEA 3S3NA 2HQNA 4HX8A 2A3SA 1RR7A 1UB9A 2YS9A 3ABMH 3FMSA 3F21A 4V19K 5GADJ 2EFNA 1PDNC 2LLKA 4BE1A 3QOEA 4P9FA 3JTGA 2IT0A 4A3FJ 5LGNA 2IP2A 2X6XA 2KLOA 3OIOA 3TMOA 3V7CA 5BPIA 1O7LA 1ZHFA 4KIGA 1ZLKA 1JI8A 2Y69H 3H1CA 3Q3SA 4RAZA 5F1JA 3G1OA 2XIGA 2JVHA 3H5RA 3W3CA 4K2EA 3K4MA 1W4MA 4IQJA 1B9MA 2VJ4A 2QA4I 1DUXC 4E6KG 2YSRA 3K4LA 2AS5F 5D5WB 4DBQA 4BS9A 5H6RA 3ROUA 4AWXB 4G6DA 2BW3B 2VPLA 3BP8A 3H5NA 2BEOA 2M0CA 3GZNB 2JSCA 2KIUA 4OINF 1BJAA 3S93A 2E5ZA 3BPXA 3EDPA 2K85A 4B09A 3PM1A 2K9LA 3GFLA 4RGXA 4HNVA 5CQGA 3S1MJ 4IOCF 5LRRA 4EVIA 3HOSA 4M6VA 4I2OA 1YYVA 3Q0WA 1XMXA 3TW6A 3L00A 5GAHJ 2K9MA 4YIFA 4B48A 4B47A 5D6FA 5B1BH 1IGNA 1VQOI 5ICEA 1YTYA 3HSEA 4ESFA 4XN0A 4X0GA 1U0JA 1YI2I 3FK7A 4TV7A 1B72A 2E5NA 3ZN1A 2ADUA 1YJWI 4FHTA 1ZYRF 1Y56A 2M3AA 3MZYA 1LE8A 1DP7P 4BDZA
chains in the Genus database with same CATH topology
3ABMH 2OCCH 3WG7H 1OCCH 2EINH 2DYSH 5B1AH 2EILH 3AG3H 3AG4H 1OCRH 1OCZH 2EIKH 2EIMH 2EIJH 5B1BH 3ASNH 1V55H 3ABLH 3X2QH 1OCOH 2DYRH 2Y69H 5B3SH 3ASOH 3AG1H 3ABKH 1V54H 2ZXWH 3AG2H 5IY5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM H;  2OCC H;  3WG7 H;  1OCC H;  2EIN H;  2DYS H;  5B1A H;  2EIL H;  3AG3 H;  3AG4 H;  1OCR H;  1OCZ H;  2EIK H;  2EIM H;  2EIJ H;  5B1B H;  3ASN H;  1V55 H;  3ABL H;  3X2Q H;  1OCO H;  2DYR H;  2Y69 H;  5B3S H;  3ASO H;  3AG1 H;  3ABK H;  1V54 H;  2ZXW H;  3AG2 H;  5IY5 H; 
#chains in the Genus database with same CATH topology
 1SD4 A;  5CVI A;  3MVP A;  2LMD A;  2Q8K A;  3JR9 A;  1KQ8 A;  3MFK A;  2E1C A;  3HOY J;  4E70 A;  3SQN A;  3BG9 A;  1WJD A;  4PJL A;  3H92 A;  2DPD A;  2WBM A;  4M9X A;  3OYN A;  4RB0 A;  2DA6 A;  3BR3 A;  4EJT A;  1D0Z A;  4BKX A;  3OS0 A;  2HS5 A;  1MNM C;  1FOY A;  1AA7 A;  3QP5 A;  3R61 A;  2Z33 A;  3HGY A;  2HQR A;  3CCE I;  2C6Y A;  2FOK A;  4YEJ A;  1R71 A;  1SFE A;  1FWZ A;  3VYR B;  1I1S A;  1R1V A;  2EIN H;  2P5L C;  1EA3 A;  4MEX F;  1PP8 F;  5CPR B;  4N4O B;  4A3J J;  2FRH A;  5FKK A;  2FQ4 A;  2VOO A;  2M5W A;  2XF7 A;  1SFO J;  1ENH A;  4HNT A;  2Z9O A;  2BBY A;  3FXJ A;  4KIT B;  3FXM A;  5CVR A;  3C3W A;  2UWM A;  3EUA A;  5CVV A;  1YW7 A;  3QPS A;  2VQL A;  4LMY A;  1IUF A;  2M0M A;  1YIT I;  1HLV A;  1TTY A;  2XPU A;  3GCM A;  1HST A;  4DIQ A;  2ELH A;  3VPR A;  4X1E A;  1OKR A;  3FBI B;  3C1D A;  4IXA A;  2QZ8 A;  2DK5 A;  1RET A;  3K69 A;  2PMU A;  2KFD A;  4F55 A;  3K4C A;  2RV8 A;  2OTJ I;  4NUB A;  2V7F A;  2DFH A;  3I59 A;  3K4J A;  3R0J A;  2A5Y B;  2H1L A;  3BT9 A;  4F52 A;  3CLO A;  2XB0 X;  5IT9 K;  4LK0 F;  4AIH A;  4PCQ A;  1GDT A;  3FDY A;  4XLE A;  4CDG A;  4ZYG A;  1B72 B;  2EZI A;  3OS2 A;  1ITY A;  3T0Y A;  2IBD A;  4GO1 A;  2AXT C;  2GIV A;  2JZY A;  3BR0 A;  3L9F A;  3H35 A;  3M9A A;  4BJT A;  1E17 A;  1C0W A;  1NG7 A;  4Y52 J;  1R58 A;  1FP2 A;  2X0L A;  4EM2 A;  3K1P A;  2ACJ A;  4XOT A;  1MBF A;  4IRG A;  2JN6 A;  5EGO A;  2IGK A;  2GIZ A;  5ED4 A;  3RZD J;  3OYJ A;  3BDD A;  1VQ6 I;  1ERD A;  1ZRE A;  2EA4 A;  3K2A A;  1RES A;  5FD5 A;  2KJB A;  3G3Z A;  4BAY A;  2HU9 A;  3PQK A;  3GUD A;  2R4G A;  1N78 A;  2NNN A;  5DD4 A;  5JHU A;  4UUT A;  4ENM A;  3MAJ A;  3HG9 A;  3HOW J;  3EUH A;  4LLL A;  2FX0 A;  2CQN A;  1QPM A;  3E97 A;  3RJP A;  1MND A;  3A01 A;  2FF4 A;  3PNV A;  4IF4 A;  5CVJ A;  3VYT B;  3L09 A;  3T8R A;  2L7F P;  3IHU A;  1WRJ A;  1Y8R B;  4XMY A;  4D1Q A;  4MNU A;  2HKX A;  3F72 A;  2PEX A;  4HAM A;  1BJZ A;  1B1B A;  2ESH A;  3KET A;  2MA3 A;  3U2R A;  3IKT A;  2GOM A;  2DQL A;  2ZXH A;  2CUZ A;  1TT5 B;  4LG0 A;  4KMF A;  1ZKG A;  4PZJ A;  1MSE C;  2OQG A;  2R7V A;  3BR6 A;  3ELK A;  4EM1 A;  4AIJ A;  1CQT A;  2IRF G;  4IHS A;  1AOY A;  1IRX A;  2RC4 A;  3ZN0 A;  3VWB A;  2W48 A;  3GZ5 A;  5K1Y A;  2RVC A;  4ZTF A;  1ORK A;  2V9K A;  3P9I A;  1YW8 A;  4E7S A;  5FKO A;  4XLN F;  2E19 A;  5AON A;  1ZLJ A;  2ZFW A;  5C4J J;  3E6D A;  1XC5 A;  1SD6 A;  2R3S A;  5LBQ A;  1JKP C;  2JA2 A;  1TBX A;  1SD5 A;  2QSG X;  5K5Q A;  4BH9 A;  1MDM B;  3ZQC A;  1HSJ A;  1X3W B;  4NHJ A;  1JKO C;  2PFB A;  4FE7 A;  5GPC A;  3RKQ A;  4HV6 A;  1ZAR A;  3I5U A;  1H8A C;  2EPF A;  1EV7 A;  1BN5 A;  1N75 A;  3KEY A;  2RDP A;  3BZC A;  1YX5 A;  3V4G A;  1QHG A;  5FLX K;  5J1U A;  2VC1 A;  1JUM A;  5E79 C;  3KP3 A;  1BW5 A;  2W00 A;  3H5A A;  1XGN A;  3FWE A;  3RZO J;  3KP5 A;  1HXD A;  1LUJ B;  4CA0 A;  3JSO A;  4OWR B;  2JRM A;  2HR3 A;  1SFX A;  2JSP A;  2O5R A;  4Y4R A;  2LD5 A;  2HOE A;  4ON0 A;  1MBH A;  3QU6 A;  3MMY B;  1WVR A;  5L3E A;  2XGD A;  2CFX A;  2CG4 A;  4I98 B;  4WXC A;  4L9N A;  4BE2 A;  3EYY A;  5DCF A;  1IC8 A;  4OIO F;  1QZZ A;  3H36 A;  5BOX A;  1RNL A;  4LK1 F;  2XAQ A;  2EZH A;  3E5U A;  3HTU A;  1PUF B;  3WOD F;  2RRE A;  2LH9 A;  3HB9 A;  3OYE A;  1W1W E;  4MO7 A;  3BTJ A;  4BQQ A;  1HW2 A;  2E71 A;  3FXL A;  1BW6 A;  4A3E J;  2O7O A;  5CLS A;  2JPB A;  1POG A;  1FBS A;  2XRL A;  1V5E A;  2OAZ A;  1JJ6 C;  3DEE A;  2G7U A;  4DYR A;  2EH3 A;  2P8T A;  4B3A A;  3A02 A;  3I4P A;  2P7V B;  2CSO A;  4B43 A;  4A3D J;  1IO2 A;  1FT9 A;  3KYC B;  4EMS A;  3MZ8 A;  1MMS A;  1GV2 A;  2A5W A;  4CCJ A;  4UB6 C;  2BY3 A;  3GTL J;  1U6G A;  1O3Q A;  2W25 A;  4O3M A;  1FX7 A;  3OYB A;  1D5Y A;  4PGH A;  5F1R A;  4ENN A;  2UXX A;  3ZCO A;  2X85 A;  1VQ9 I;  2PMZ A;  1VQK I;  4ITV A;  1IDZ A;  2BYV E;  3E5X A;  4A0Z A;  3WTS C;  1Z7U A;  3QRF F;  4Q48 A;  4RLF A;  3ERE D;  2CQ7 A;  3QP6 A;  3O6B B;  4FCY A;  3WTX C;  2X9D A;  5FKL A;  4EAT A;  5E1Z B;  4XLF A;  1LEB A;  1Z7L A;  2GAU A;  3OYI A;  4XR6 A;  2FD5 A;  2JTV A;  2BY2 A;  2DMQ A;  3LSJ A;  4M6Y A;  3S16 J;  2COM A;  3E6M A;  1D1A A;  3J81 K;  1R23 A;  2K3P A;  3PSI A;  3E5Q A;  2Z16 A;  3JTH A;  5K5O A;  3I58 A;  2TCT A;  3H9Q A;  5BNG A;  1WZ2 A;  3GW2 A;  1IRG A;  1WI9 A;  3VB2 A;  3FXU A;  2A6H F;  2GBY A;  4IZZ A;  3V42 A;  1YRN B;  2VXD A;  3LMM A;  1T08 B;  3ABL H;  3HRU A;  1N77 A;  1FYM A;  3K10 A;  2VBX A;  3HDD A;  1Z77 A;  3KZY A;  3G73 A;  3V7S A;  2KIF A;  2VKD A;  2E7X A;  2JRT A;  3KZZ A;  2ZXW H;  3TW7 A;  2XKP A;  3WG9 A;  3MD2 A;  3DBR B;  3IL2 A;  4PSX A;  1D5V A;  1IZ1 A;  3C7J A;  4FE4 A;  1GV5 A;  1A36 A;  1Z3Y A;  2KRF A;  4JP0 A;  1KQ0 A;  3BJO A;  2Y9Z A;  3U1K A;  4AC0 A;  3AFH A;  2FSW A;  3HRS A;  2DFF A;  4ZH4 F;  4FET A;  4A12 A;  4XSZ F;  1JT6 A;  1LNW A;  1T8I A;  3BQY A;  2V6E A;  1R49 A;  4BJ6 C;  5ILU A;  5M5Y J;  5FO5 A;  2F48 A;  2JVG A;  2CJJ A;  2DDB A;  2KP6 A;  2DBB A;  1GUU A;  3E6B A;  5LHI A;  1H9T A;  2PMH A;  4YEL A;  3TO6 A;  1D8K A;  3GF2 A;  4BQN A;  3LAJ A;  3FK6 A;  5J8C A;  1UG2 A;  2NVU B;  1AKH A;  2DO7 A;  5EZH A;  4DOZ A;  2ID3 A;  3WGH A;  2OBP A;  1OCZ H;  1ZRC A;  2AQE A;  4PFO A;  1UAA A;  4HF0 A;  2L9S A;  5E18 F;  4AYB A;  4AYB N;  1XMK A;  1NK2 P;  2HVQ A;  4B4C A;  3PO2 J;  2XAG A;  4E7Z A;  1VZ0 A;  1IN5 A;  3CC7 I;  1TW2 A;  2QVO A;  2Y30 A;  4B1R A;  2ISZ A;  3CCY A;  2RQP A;  1W0U A;  4JOM A;  3S3M A;  3TOA A;  1TQP A;  3LFK A;  2QF7 A;  2OCC H;  1WQ2 A;  4GCV A;  3CME I;  1Y6I A;  3LA7 A;  2A6T A;  4G6Q A;  1RR8 C;  2Z2S B;  1OLT A;  1UHS A;  3C2G A;  4YII A;  1ZG5 A;  2NS7 A;  4S0H B;  1VI0 A;  4BEH A;  2DOA A;  1DGR M;  4C2M J;  5DM6 F;  1MGT A;  5C4X J;  4BXU A;  3J81 Z;  3FKJ A;  4N9H A;  4F91 B;  3LSH A;  2E36 A;  3WE3 A;  1ZG1 A;  4L9V A;  4GYI A;  4BY1 J;  4C3J J;  1FC3 A;  1BR1 A;  1STZ A;  3ZOB A;  1KON A;  1VQ4 I;  5F64 A;  3H3Z A;  1I1G A;  1ONV A;  1W36 C;  4HF2 A;  1IJW C;  4L0Z B;  3TDZ C;  2HXO A;  1X1B A;  2LKS A;  3GFM A;  1MMD A;  3M4O J;  3HJE A;  2GQQ A;  4QLC U;  1S7O A;  1QVU A;  2LKX A;  2EIM H;  2DI3 A;  2K40 A;  4M9S A;  3T1B A;  3IKV A;  1EH6 A;  5E3L A;  2ZJ2 A;  3B73 A;  4OAZ A;  3QYB A;  4XQF A;  1W0T A;  1EKE A;  4KDP A;  1DP3 A;  2VJI A;  4RMN A;  1S7E A;  3HL2 A;  1F36 A;  3A01 B;  1MNE A;  3UNG C;  2UZK A;  1ZRD A;  1VTN C;  1A6I A;  3RYR A;  1X2M A;  2ZSH B;  1JKQ C;  1P4W A;  1S5L C;  2E1M B;  2NRA C;  1DDN A;  2BOL A;  4UUS B;  1CF7 A;  4GDF A;  4EJV A;  3KYD B;  4R8H A;  4EQQ A;  3T5X A;  2VIX A;  4UXN A;  3DWL E;  2E1N A;  2GM4 A;  2WWY A;  3J7A O;  2VQC A;  3HIF A;  1JTY A;  3L2W A;  2QSH X;  3HTS B;  4I02 A;  1HCR A;  1IAW A;  1MZB A;  4XLC A;  1QRY A;  5FFX A;  2DFI A;  4FQG A;  1G59 A;  1OYI A;  2DT6 A;  2LOO A;  4F3Q A;  2OZ6 A;  1BOB A;  3ZMT A;  3GTG J;  5DDG A;  3BJA A;  4AUX A;  4LLN A;  1UJ8 A;  2QBY A;  3BLY A;  3MWM A;  2ZXI A;  1IF1 A;  4H0E A;  5J4Y A;  2H6C A;  3VYS B;  2PBI A;  4RGR A;  1HC8 A;  1G2H A;  3C18 A;  1WI3 A;  4M9Z A;  3H9J A;  4HLY A;  1HQC A;  5D6E A;  3PUB A;  2R5Y B;  5FLV A;  4A5M A;  3H3U A;  3FHZ A;  5DUI A;  3MKY B;  2EZK A;  3L2C A;  4OOI A;  4LB6 B;  5BQT A;  4XNF A;  4ZDO A;  1OPC A;  1U9N A;  1W5T A;  3DTK A;  1I6H J;  3F8M A;  2MC4 A;  4JYK A;  5L3C A;  1XDS A;  3LQQ A;  3BG6 A;  4KMU X;  4LOC A;  3R60 A;  1OCC H;  3DBH B;  3JW4 A;  4XSX F;  4ZDL A;  4BJ5 C;  1Y39 A;  1VQ7 I;  3I4N J;  3S8P A;  2IS2 A;  3KIO A;  3KEQ A;  3BC8 A;  3ZQI A;  1L3L A;  2N8G A;  2L4M A;  3KFW X;  4XRF A;  2YU3 A;  1K78 A;  1T39 A;  3IAM 2;  2XAF A;  3GZ6 A;  2LR8 A;  4MLO A;  2ICW G;  1MH4 A;  1U8R A;  3RSN A;  5FD6 A;  2CW0 F;  3CDL A;  4Y17 A;  1X19 A;  3M07 A;  5J3L A;  3EUH C;  2XAH A;  4YG2 F;  3L2U A;  2QWW A;  1XSX A;  3CCR I;  3BJ6 A;  2M8E A;  3HEF A;  4G9Y A;  2EIL H;  4MIM A;  2OUM A;  1FYL A;  1XCV A;  1R4M B;  1ETV A;  2ME0 A;  4FX0 A;  2RQQ A;  1MMN A;  5TJJ A;  1U5T C;  4EGZ A;  3TED A;  2L9R A;  2VBY A;  3SHF A;  1IV8 A;  1FY7 A;  3VSL A;  2IPQ X;  2FXA A;  1K6O A;  3ERM A;  1K4S A;  2EWN A;  4FTH A;  1FIP A;  3S2H J;  5HLT A;  1BR2 A;  4BU2 A;  2JT1 A;  3SZT A;  2RGV A;  5ICC A;  1FYK A;  2MD0 A;  3D5L A;  3LSK A;  1Y1W J;  1WHU A;  1T6S A;  2Y2Z A;  3KZI C;  3JRD A;  1D1B A;  2KRC A;  4DZP A;  2FOW A;  5JR3 A;  1Z67 A;  3R0A A;  4DJA A;  4Q47 A;  1E0E A;  4CH7 A;  4NC7 A;  1TWH J;  1B6A A;  1K83 J;  4G12 A;  2M7B A;  1QU3 A;  3PJR A;  2BXZ A;  1D0Y A;  4IHV A;  2Z99 A;  4W1U A;  3ZMV A;  3KPH A;  5E3M A;  2Z1D A;  2HOS A;  2E1O A;  5KHD A;  4BHC A;  4G94 A;  2A69 F;  1PVE A;  4OMZ A;  1TP4 A;  4KT6 A;  1Y0U A;  1G3W A;  1X1P A;  3FIS A;  3PNT A;  2DA7 A;  2DA4 A;  5E3O A;  1NHA A;  2VUM J;  5DEQ A;  3HOV J;  2OC6 A;  1WJB A;  3KP4 A;  1T38 A;  1P7I A;  1Z21 A;  2E60 A;  1R1T A;  3QOD A;  4C3H J;  4U7B A;  3KP2 A;  5B66 C;  3D5S C;  2FBH A;  1H9G A;  1XD7 A;  4U88 A;  2VKE A;  2I10 A;  5D4S A;  1F5T A;  2BVM A;  5KAF C;  4V2F A;  1R1U A;  1FMV A;  2F2E A;  3K9T A;  3FMR A;  2MC3 A;  2FNA A;  1G6N A;  3FBN B;  4WWC A;  3PIO F;  1G4D A;  4JQF A;  1QGP A;  2R7T A;  4CZZ A;  4AID A;  4PJ0 C;  5JI6 A;  3O8G A;  1WCM J;  5IY5 H;  1J09 A;  2VBW A;  1WJC A;  2IGM A;  1XCB A;  2RKH A;  1YG2 A;  4U0V A;  3WU2 C;  2NVT J;  1WJA A;  2JA8 J;  3DU5 A;  3ZMZ A;  1OYW A;  3J80 Z;  3OMY A;  3VDX A;  1A31 A;  3R4K A;  4WK8 F;  1MBE A;  1P6R A;  4P9U A;  4V2G A;  2WY7 Q;  3MEX A;  3CP8 A;  3BTL A;  1TC3 C;  2X1E A;  4B8X A;  1HKQ A;  2OF7 A;  3G6E I;  3OSG A;  1HDP A;  4XON A;  2WAD A;  2DJI A;  3QPL A;  4RGS A;  2ZNZ A;  5BS6 A;  4E7I A;  4E7K A;  2MH2 A;  1JHH A;  3R6S A;  4A6D A;  3ULQ B;  3GVA A;  1I5Z A;  3G4S I;  2X48 A;  4RM2 A;  1FBQ A;  2F5V A;  1AKH B;  4PUS A;  2WTE A;  3BZK A;  1FLI A;  3FM3 A;  4JX6 A;  1Z0X A;  2Y0S N;  2H8R A;  1BC8 C;  2HVR A;  4L9T A;  1ODD A;  4XID A;  2HQ5 A;  3B6C A;  3NQO A;  1OR7 C;  4HA8 A;  5EG0 A;  3HPH A;  2MYS A;  4MTD A;  3PIP F;  5E8G A;  3REO A;  2J5P A;  3FHN A;  2R7R A;  3ZR8 X;  1J2X A;  1KU9 A;  1YIJ I;  3H0G J;  2CQQ A;  1FNN A;  3ZXS A;  5M5W J;  2LK2 A;  2ZJQ F;  4GGG A;  4EJO A;  5GAE J;  1SFK A;  4BAC A;  1G3S A;  2OA4 A;  5F04 A;  1BBY A;  3PL8 A;  2G9W A;  5LGT A;  4KFC A;  3HXL A;  4BEH B;  2DFE A;  2DMP A;  2IS1 A;  2CW8 A;  2GXB A;  2HYF A;  5HS9 A;  4HLX A;  1VQP I;  3CC4 I;  4C2U A;  3BZ6 A;  1TWG J;  2VB6 A;  2DW4 A;  1X58 A;  3S32 A;  1LB2 A;  1WJ5 A;  1X1C A;  3RI4 A;  4EJW A;  2XPV A;  3GXO A;  1X1A A;  4ZYD A;  2K9S A;  4M71 A;  5HDG A;  2HDC A;  1Y0N A;  1ETY A;  3J7Y J;  3W6V A;  2DJN A;  1T33 A;  2EA2 A;  2ELK A;  3LOC A;  4Y15 A;  2CYY A;  4HDU A;  4A93 J;  4RM3 A;  1TQM A;  3ABU A;  3RKW A;  2EIJ H;  2LBF A;  5BMZ A;  1XPX A;  4ZJZ A;  1BM9 A;  3LWF A;  3V8K A;  4DYC A;  1ZEL A;  1MBG A;  3LA3 A;  3Q9V A;  5F27 A;  3OYH A;  3DKW A;  1JGG A;  1J0R A;  2UXN A;  4RB1 A;  3A2K A;  4CZC A;  3JRI A;  1FIA A;  3GO5 A;  2FU4 A;  1BIB A;  1PUF A;  2DN0 A;  2DTZ A;  4UV8 A;  4BXX J;  2QQB A;  2H09 A;  1JT0 A;  1OJL A;  3P5J A;  1RKT A;  3KCC A;  3EQL F;  3S1N J;  4HNU A;  2M7A A;  2P4W A;  4G7H F;  3CF5 F;  1UMQ A;  3KLN A;  4D9J A;  4OIQ F;  2HPI A;  1ON2 A;  5FB2 A;  4IEJ A;  3FX3 A;  4U7D A;  4M3E A;  5LRS A;  1OFC X;  2LY9 A;  2QBY B;  4KIC A;  4YFX F;  3GYH X;  4F93 B;  3AL0 B;  3RYP A;  2Q1Z B;  4QWQ A;  2E2H J;  2EZL A;  5HS7 A;  1WGX A;  5TRD A;  1RKW A;  2RAE A;  3O2P E;  3P9C A;  1WPK A;  2KJC A;  2XAJ A;  4FAS D;  2X4H A;  2B0L A;  4YFK F;  2YX7 A;  3DTI A;  5ILS A;  4XKC A;  5M5X J;  1LJ9 A;  4RB3 C;  5HLH A;  5JVT A;  3MCZ A;  2VOP A;  3ABK H;  3BCB A;  4ZYH A;  3WTW C;  5LD2 C;  2FEZ A;  1WSU A;  4ZZD A;  2W84 A;  3KLO A;  4AVP A;  5LGU A;  4IKF A;  2CFO A;  2OZU A;  3B6A A;  3K1N A;  1G3Y A;  4A0Y A;  2TDX A;  5CKT A;  5CQE A;  3CES A;  4XKW A;  4O5V A;  1XTA A;  3OY9 A;  3K4B A;  4LIT A;  4HDV A;  1I27 A;  3BTC A;  2V1N A;  3ZMD A;  1XMA A;  4G6T B;  2LF7 A;  1OCP A;  1LFP A;  4BY7 J;  4IX7 A;  2A68 F;  1VF9 A;  1DPU A;  3B02 A;  2UUZ A;  2VAS A;  1AU7 A;  3VYU B;  4L5I A;  3TP0 A;  1OCT C;  4IOA F;  4I99 C;  4L18 B;  2NVQ J;  4ESJ A;  4KIF A;  3BOQ A;  3KE2 A;  1HA8 A;  4A3C J;  4EGY A;  2GA2 A;  4UNO A;  4C9Y A;  5IOZ A;  4QTR A;  4RB2 C;  2XDV A;  3DPT A;  2IA0 A;  2ETH A;  2STT A;  5B1A H;  2IA1 A;  1XDU A;  3RQI A;  4RDU A;  2HEO A;  3D0S A;  3SZP A;  1LFU P;  4RGU A;  1L0O C;  4RAY A;  2EV5 A;  1IDY A;  1R7J A;  5EGO B;  1MDM A;  4AIK A;  4Y7N J;  3IH2 A;  3X2Q H;  3NEU A;  4L9J A;  3H3V K;  2W7N A;  1DU6 A;  3HBL A;  3ZGK A;  2HWV A;  2ZJP F;  1TQI A;  4M3D A;  4G7Z F;  3OR2 C;  2H1K A;  4EM0 B;  2VQG A;  3FIW A;  2DMT A;  2KKO A;  2LP0 A;  3FXK A;  1W5S A;  1AWC A;  3IRQ A;  2VOD A;  2HNH A;  1IN6 A;  3OIP A;  2NNY A;  1SVL A;  4XOR A;  2LY1 A;  5JFR A;  5F0H A;  1RUO A;  4WXH A;  2CUJ A;  2L9N A;  3I53 A;  3Q0V A;  2O9L A;  2EFP A;  3BR5 A;  2VKH A;  1J59 A;  4CCO A;  2DTR A;  3CLQ A;  2W24 A;  1ZH5 A;  3CZ6 A;  2QM3 A;  3K7A J;  2P5K A;  2VON A;  2R92 J;  4NBQ A;  4D7M A;  3MKZ A;  2VT3 A;  3ZMU A;  3ZRG A;  1GVJ A;  1R00 A;  2W82 A;  2XVC A;  5CVU A;  3ABT A;  4NB5 A;  3K1M A;  5E1W A;  2IXS A;  2L3D A;  1HKS A;  3CJT B;  2Q2E A;  4XL9 A;  2ZFU A;  4NDL A;  3FXR A;  3Q0U A;  2XAS A;  5JLX A;  4OIP F;  2KZG A;  4JX5 A;  4C3I J;  4I09 A;  4IRH A;  2VJ5 A;  1H89 C;  2DOE A;  1RUN A;  4OIR F;  2Y0M A;  2R7D A;  3JCU C;  3M8J A;  1Y1V J;  5F0F A;  3GEZ A;  1RIO H;  1QA6 A;  2E1M C;  2WAE A;  2VI6 A;  2R5Z A;  5FRM A;  3JRG A;  5E20 A;  1SMY F;  1FMW A;  4I01 A;  4FX4 A;  2ZB9 A;  2LG4 A;  4HV5 A;  1JGS A;  1MBJ A;  2PI0 A;  4IO9 F;  3AG4 H;  3GBG A;  1ZRF A;  3S14 J;  3LQR A;  2FJ1 A;  3I54 A;  3ZP5 A;  4MQV A;  4NQW A;  4BBS J;  2M8G X;  1MIJ A;  3UR3 C;  3CO6 C;  2CMP A;  3BCA A;  3HOU J;  2JMW A;  2X51 A;  2V1U A;  1SAN A;  2DYR H;  2IVM A;  3F0C A;  3JRE A;  2PJR B;  2HTJ A;  3CCV I;  3S17 J;  1P2F A;  2L02 A;  3SEZ A;  3AG2 H;  2K5C A;  2K7L A;  4IL6 C;  3CJR B;  4QPQ A;  1ETO A;  2IW5 A;  2VLA A;  4Q5S F;  3BRO A;  4AVZ A;  4PGG A;  2QEX I;  1MKM A;  1QZE A;  5FKN A;  2H8W A;  5FRO A;  3JRB A;  1HKT A;  3QYE A;  4DBR A;  2P0W A;  1MJA A;  1V55 H;  3CMY A;  4I76 A;  2QKL B;  1KQ9 A;  2DA2 A;  2ZKZ A;  4BE0 A;  3HHG A;  1VQM I;  3OL3 A;  4UVC A;  3ZPL A;  2HPM A;  1MMG A;  4Y33 A;  1FSE A;  5ICG A;  1HF0 A;  1JE8 A;  1LDJ A;  4HW0 A;  3F3X A;  5M3M J;  4XKV A;  3I9V 2;  2NS8 A;  2GOX B;  1E3P A;  2MLK A;  2V1D A;  4H4K C;  1UCR A;  2QEN A;  1ZG3 A;  3WHC A;  4HF1 A;  1KU7 A;  2ZC2 A;  3OL4 A;  4XBF A;  2ZJR F;  1YS6 A;  2PG4 A;  3HOX J;  1SEU A;  2NYX A;  2FE3 A;  1ETX A;  2V6C A;  4WXD A;  4E7L A;  5DUK A;  3L2V A;  1ZGA A;  5L3B A;  3FF5 A;  2ZO4 A;  4Y13 A;  5H2F C;  2OJE D;  2QSF X;  2R93 J;  2HI3 A;  1BC7 C;  3UKG A;  2PQ8 A;  1XGM A;  2VBZ A;  1BL0 A;  2E2I J;  2HOT A;  1I50 J;  3DXJ F;  3PNY A;  4XRS G;  4ZZL A;  2YU9 J;  2JA5 J;  3TDU C;  3GFI A;  5F08 A;  2W85 A;  1FZP B;  2DT5 A;  2Z5U A;  1TLH B;  1A6Q A;  5KCM A;  3MN2 A;  2PJR A;  4A3G J;  3MKL A;  4A69 C;  1QNT A;  1PYV A;  1S7A A;  3I55 I;  2M9H A;  4ETS A;  2DXI A;  4BGD A;  3ZQQ A;  5HLG A;  2BGC A;  4I0A A;  1O4X A;  1E2X A;  2FML A;  3NWS A;  2GXA A;  2QKM B;  2P5V A;  1YRN A;  5LFA A;  4HYE A;  4M3G A;  3E7L A;  2DDA A;  2XAU A;  3GTO J;  1OMI A;  2XGX A;  1H0M A;  1J9I A;  2LFB A;  2EV0 A;  2O6G E;  2CUF A;  3HZJ A;  2R0Q C;  2DQR A;  5DTD A;  5IT3 A;  4HPQ A;  2A07 F;  2JA6 J;  2VXZ A;  3I3L A;  3HHH A;  3S15 J;  2RN7 A;  2VT2 A;  3BQZ A;  4BNC A;  1ZK8 A;  1JHF A;  2QQ9 A;  4NC6 A;  1QPI A;  5K7H A;  3QOP A;  3RTR A;  3HRM A;  1CGP A;  1RZ4 A;  1P92 A;  1JXS A;  3FKI J;  2E35 A;  4HRI A;  1VQN I;  2MAB A;  5TIS C;  1JUP A;  3TP3 A;  2VJJ A;  2K9N A;  4ZTJ A;  3I0T A;  2JUC A;  4YRV A;  4S04 A;  1VQ5 I;  1R5G A;  2FNP A;  3F8C A;  3U21 A;  5J4V A;  2STW A;  2DK8 A;  3OYK A;  2R7F A;  1K79 A;  4PSW A;  4G8X A;  2HYJ A;  3GX4 X;  4J19 A;  4W97 A;  4YIR X;  3DPU A;  5IP6 A;  3V7R A;  3C2B A;  1Z6T A;  5LLQ A;  3U1D A;  1QVT A;  5TGT A;  2KDO A;  1W7P B;  4RBO A;  2HZD A;  2DA5 A;  4HX7 A;  5GAG J;  1BI2 A;  4C30 A;  5D5X B;  2OTL I;  4IJA A;  4Y3O A;  2EFW A;  4LD5 A;  1IN7 A;  4UV9 A;  1IRF A;  2OQR A;  2K4J A;  3NRV A;  5FFZ A;  1E3O C;  1AHD P;  2IGN A;  1QO0 D;  5GTI C;  1GLN A;  4M3F A;  1X4P A;  1WKM A;  4XOP A;  2IS4 A;  1LVK A;  2FQ3 A;  5BPD A;  2EJR A;  3GTP J;  4GXO A;  2M4G A;  2K4B A;  3K2Z A;  2DCE A;  3HYI A;  2M45 A;  1O3S A;  1UHW A;  2EB7 A;  4A0X A;  2COB A;  2IGO A;  2NS0 A;  5CYV A;  4UY8 I;  2EBI A;  3CQZ J;  1DGW Y;  3IV5 A;  4WX9 A;  2DMU A;  2YPR A;  2JUG A;  2L54 A;  3N05 A;  3HUG A;  3OYG A;  1V4R A;  3DEW A;  1NTC A;  3LSP A;  1WH7 A;  3WU1 B;  4XRS A;  4N0B A;  3CUQ A;  2P81 A;  4QIW N;  3DBL B;  1R9T J;  4DW6 A;  1F1Z A;  5FLX Z;  5DD8 A;  3LSG A;  2Y31 A;  3CMA I;  2WV1 A;  4MFD A;  1WFX A;  2HGC A;  4CCN A;  1XN7 A;  4DQ2 A;  2OCE A;  4O6J A;  1P4X A;  2M30 A;  2PJP A;  1Z6R A;  1Q1H A;  1TNT A;  1TWA J;  1VFC A;  1APL C;  4HOB A;  1OR7 A;  2F4M B;  4EJU A;  2O8K A;  1IXC A;  3HKZ N;  4R1H A;  1EF4 A;  4F7Z A;  2K9Q A;  2WAF A;  3DU6 A;  4QPO A;  3RPU A;  1F4K A;  5L3G A;  5LEJ A;  5D5U B;  5AIP A;  3AL0 C;  2DAO A;  2ZNY A;  2HDD A;  3SEQ A;  5FLM J;  4BDY A;  2R7Q A;  1YW9 A;  3OYC A;  3QU3 A;  4JX4 A;  4KYW A;  3DCF A;  3JRC A;  4IQ4 A;  2X6O A;  2V4J C;  3A4C A;  3CCJ I;  3OYL A;  3A1Y A;  5HLI A;  3V8L A;  4MFE A;  3GLX A;  2HTS A;  2LRD A;  4HG2 A;  1X3U A;  1U2W A;  2D5V A;  4AD9 A;  3CUO A;  1SAX A;  3N97 A;  3CDH A;  2NVX J;  2O03 A;  1YJ9 I;  2GA1 A;  1GT0 C;  3GTQ J;  1B4A A;  2D1H A;  4P1W A;  1WJF A;  3BG5 A;  2ZME A;  1V5G A;  3RIR A;  2W57 A;  3FZV A;  5D5V B;  2Q0O A;  4HST A;  3L2R A;  2D1V A;  2KL4 A;  3WE2 A;  1KGS A;  5HNH A;  5IYD J;  3HUG B;  3LST A;  3WU0 A;  4DYQ A;  1RPW A;  3ZQ7 A;  1OIS A;  3G71 I;  1K7A A;  1E3H A;  1MJB A;  4RLQ A;  2CGP A;  2ISY A;  2D2W A;  4S05 A;  3H9G A;  2XF5 A;  3RKY A;  4A3K J;  2MGQ A;  1T98 A;  3NWT A;  4KJZ A;  4CIC A;  4D0P A;  3BG7 A;  3LSR A;  4AU7 A;  2R5Y A;  5F0C A;  4J00 A;  2O61 A;  2R7X A;  5J1R A;  3QAH A;  2LC2 A;  1J5Y A;  4B44 A;  2WY8 Q;  2YR2 A;  5E8I A;  4E7H A;  1USS A;  5C44 J;  5D4R A;  3TL4 X;  2H94 A;  4C2T A;  1KZH A;  2ME6 A;  2MD5 A;  1JKR C;  1Z05 A;  3WTV C;  1U5T A;  3MKW B;  5IP7 J;  2O0Y A;  2BHZ A;  5J8F A;  4A3B J;  1A35 A;  1YFH A;  2BY1 A;  3ISP A;  5B3S H;  3FMQ A;  2LKP A;  1I39 A;  5IPA A;  3F6V A;  1ZAO A;  2JQ7 A;  5HDK A;  2VPR A;  2ELJ A;  3NAR A;  5EEA A;  1Z1D A;  4A5N A;  2BHY A;  2X6W A;  3G2B A;  1GVD A;  4PJN A;  1I3Q J;  5KVR A;  5F6F A;  4LB5 A;  4OU0 A;  5DS9 A;  4R79 A;  1T0F A;  2LSO A;  4ENK A;  1Z3X A;  2E2J J;  4ZC3 A;  2R7O A;  4ZYA A;  4M73 A;  4M72 A;  4A3L J;  5JLW A;  1KYZ A;  3JRH A;  4XLP F;  2HYG D;  1YQA A;  1TZL A;  3CDI A;  2ZME B;  3KX2 A;  1G3T A;  1Q1V A;  1EH7 A;  1W7P D;  1X3Z B;  3PSF A;  3VSK A;  5JVG F;  2L7Z A;  1BI1 A;  1LDD A;  2MBF A;  2V26 A;  4LG3 A;  3PUF A;  4KIB A;  1TW3 A;  1ETW A;  3GWZ A;  2G0E A;  4D7N A;  3EPZ A;  2PN6 A;  4HQM A;  3VOE A;  2W1O A;  3F6O A;  1REP C;  3KP7 A;  2Y0S A;  2F5E A;  4CCM A;  3SDG A;  3ZQG A;  2F5F A;  4ANJ A;  5DM7 F;  2Y75 A;  3D5R C;  3LAP A;  1KYW A;  1HW1 A;  1UFM A;  2DMN A;  2I5U A;  1RI7 A;  3IWF A;  3HOT A;  2QQ8 A;  4AM3 A;  2EV6 A;  2XSJ C;  4D5F A;  2AXL A;  3I64 A;  1YIO A;  4HZF A;  1D0X A;  1V3F A;  4CCL A;  5LEK A;  1F9N A;  3SDB A;  3DP7 A;  3P9K A;  1OQY A;  5J6X A;  3HRT A;  1MJ9 A;  2KPM A;  3SFI A;  4E4H A;  1X2N A;  3IUO A;  4UB8 C;  2V1X A;  3L2Q A;  2QQA A;  3I4M J;  2LDU A;  4G7O F;  4WF2 A;  3DKX A;  2DOF A;  1YO5 C;  4KIS A;  4MEY F;  1YHQ I;  4IHW A;  5J47 A;  5M3F J;  3NAU A;  3OYF A;  1QQI A;  1XSV A;  5E17 F;  2MLG A;  3DKY A;  1ZR2 A;  5KNL A;  4KUM A;  1FOX A;  1LKX A;  1ULY A;  3RQ4 A;  2EQR A;  3G1L A;  3WG7 H;  3F8B A;  2QLZ A;  3I59 B;  2NVY J;  1XS9 A;  1OYY A;  4KN4 X;  2DA3 A;  2M1B A;  4II2 A;  1VND A;  1BIA A;  2CQK A;  3F9K A;  5HS8 A;  1U9O A;  2XUB A;  1UHM A;  2R7W A;  1YX3 A;  4ZDP A;  5C3E J;  3C2H A;  4WCG A;  4M74 A;  1X4O A;  2TRT A;  2RNJ A;  1S72 I;  4UUV A;  3E1S A;  1MH3 A;  2R7S A;  1QHH D;  5EZG A;  5EEG A;  2YUS A;  9ANT A;  4CYD A;  1SVM A;  4U0Y A;  4GYG A;  2HQA A;  3CJQ B;  4BBR J;  1B9N A;  2OV7 A;  3ECH A;  4CCK A;  2MW8 A;  4UVA A;  4CO8 A;  4A6E A;  1JUS A;  1SFU A;  2MG4 A;  3DEU A;  3K0L A;  1KA8 A;  2NAZ A;  3HOZ J;  4I0B A;  3MQ0 A;  2M34 A;  4NC8 A;  4OAY A;  2ZXJ A;  1BI3 A;  2ECB A;  4CYC B;  3K70 D;  4YFN F;  2L01 A;  3CCU I;  4IHT A;  5EG0 B;  3OYM A;  1J75 A;  1FTT A;  1UZC A;  3SJM A;  1S29 A;  1I3A A;  1Z91 A;  2CWE A;  3F22 A;  1Y8Q B;  2V9P A;  3BWG A;  2GLO A;  2CW7 A;  3O3K A;  3HGG A;  5ILV A;  1FOW A;  2VKV A;  1O57 A;  4M3B A;  2DT7 B;  3RPU D;  4LG0 B;  3GTJ J;  4LIV A;  4HBL A;  2WC2 A;  1IXS B;  4QSH A;  3VFZ A;  5IOY A;  4XK4 A;  1U78 A;  4XKB A;  2FMY A;  3E0J B;  3QWL A;  3COA C;  1V54 H;  4ENJ A;  4BQO A;  4BXF A;  2O3F A;  1R5I D;  3L7W A;  3EYI A;  5EYR A;  1TT0 A;  3VEP A;  3QPT A;  4UHT A;  4BHB A;  2RNG A;  1XSD A;  3BR1 A;  1R4N B;  3PFY A;  3G1M A;  4HX4 A;  2M4K A;  1F43 A;  2WB1 N;  2K86 A;  5AIQ A;  1BOA A;  1SD7 A;  2L9V A;  1YS7 A;  4NNJ A;  2BE5 F;  1QBJ A;  5L3D A;  1O3R A;  1GXP A;  2LNB A;  5IYC J;  1LQ1 A;  1SAU A;  2JWT A;  1I6X A;  4U0W A;  2JA7 J;  2MH9 A;  1ZGW A;  3P7N A;  4HSR A;  1TNS A;  5EEH A;  4CGZ A;  2B7E A;  1ACI A;  3BTI A;  5HDN A;  2OU2 A;  4CUG A;  3DLA A;  4Q4Z F;  1UEL B;  3WTY C;  3J7A Y;  2UV1 A;  3I71 A;  1MD0 A;  2CS3 A;  2KIM A;  2QCO A;  4X6A J;  4BYY A;  1RRJ A;  4MHG A;  4LFU A;  3LSM A;  2AQF A;  3IAS 2;  3TKY A;  3OYA A;  1PP7 U;  3W2V A;  4CHU A;  1WWX A;  1S3J A;  5FGM A;  3JAM K;  5A2Q K;  1DU0 A;  1BR4 A;  1IW7 F;  1ETQ A;  2FUG 2;  2ID6 A;  2KIQ A;  4MQ9 F;  4J01 A;  3LNQ A;  2EK5 A;  2HDW A;  1ZQ3 P;  1R5H A;  1ETK A;  2DU9 A;  2XGC A;  3WGG A;  1XGS A;  3AG3 H;  3DF8 A;  2VC0 A;  2ZCW A;  3KYL A;  4L5J A;  4LIU A;  5H6Q A;  3AAF A;  2IJL A;  3OOU A;  4MGR A;  3M8F A;  4D5C A;  2AHQ A;  5FKM A;  3U9G A;  3JSP A;  3PO3 J;  3E3V A;  2MSY A;  5KAI C;  1B59 A;  1O7F A;  1WH5 A;  2LY2 A;  4PDK A;  3TQN A;  2PMZ N;  4ASN A;  2A6E F;  4FT8 A;  2K02 A;  3W2A A;  1DQU A;  1MW7 A;  2CUE A;  5E3N A;  4L0Y B;  3ML6 A;  3IWZ A;  2NOJ B;  2XF6 A;  1OCR H;  2WB1 A;  2VL8 A;  5ICF A;  3GTM J;  4I6Z A;  2XRN A;  2WAQ N;  3S2D J;  3OOP A;  1J7K A;  1W7P A;  1HDD C;  2CH0 A;  5DV5 A;  1YJN I;  5EDN A;  1U8B A;  2V9V A;  1LDK B;  1NK3 P;  2B63 J;  1BA5 A;  2ZBK A;  2L4A A;  2Y9Y A;  1IN8 A;  2KRH A;  4PJJ A;  4XM3 A;  2Z3Y A;  2A05 A;  3VOD A;  1FTZ A;  3BR2 A;  2BVL A;  1S9H A;  3F8N A;  1U3E M;  4Z6Y A;  3OWT A;  2R7Z J;  1JJ8 C;  3SXY A;  3SYT A;  3A0B C;  1LEA A;  5J1Y A;  4IHX A;  3FM5 A;  4RA2 A;  2QGU A;  4UVB A;  2HFH A;  3GME A;  3WTU C;  5EF6 A;  4BHP A;  3F23 A;  1PJR A;  5IT9 Z;  1BI0 A;  5E1X A;  1JTX A;  1XGO A;  2HZT A;  2KHM A;  3TO9 A;  1K4T A;  2WA0 A;  3CCS I;  1B8I B;  1LPQ A;  5JHF A;  2R5Z B;  1YE9 A;  3WGI A;  3M8E A;  3JRA A;  2CRG A;  2PX9 A;  4A3M J;  3QPH A;  4BQA A;  4IHY A;  5ERI A;  1EJ9 A;  2H27 A;  1N25 A;  3QQA A;  2GZW A;  3TO7 A;  5K7F A;  2KMU A;  4PK4 A;  1EH8 A;  3IRR A;  3IH3 A;  3ECO A;  3JAM Z;  5A2Q Z;  1D1C A;  2W4S A;  2ZSI B;  3HSR A;  3CMM A;  5CJ9 A;  2GWR A;  4E7J A;  1HW5 A;  2LBF B;  3CCL I;  2BV6 A;  1ZN2 A;  3CUQ C;  1LFB A;  2G7H A;  3F8F A;  3JRF A;  3RCO A;  2CO5 A;  2QYO A;  3J80 K;  1IN4 A;  4LGW A;  4N9I A;  2BY0 A;  2M2E A;  3SFZ A;  1ON1 A;  2CU7 A;  3DLL F;  2HVS A;  3CF2 A;  4XIC A;  3DV8 A;  4KA4 A;  1TWF J;  2EIK H;  4CYC A;  4P55 A;  1V5F A;  3WHB A;  2XHK A;  5KK1 A;  3M3Y J;  4B3X A;  2LRE A;  4UUS A;  1CF7 B;  1HBX G;  4XN3 A;  1LVA A;  3IH4 A;  3GFJ A;  3ZMS A;  3A0H C;  3AG1 H;  1YOV B;  3DQV C;  3ZQL A;  1SVO A;  3LL7 A;  1NH3 A;  4LLG F;  5DCM B;  5D8K B;  1IRZ A;  3FXO A;  3CC2 I;  2DA1 A;  3GLL A;  4A3I J;  5EJC A;  2FBK A;  3S1R J;  3CUQ B;  2D45 A;  3EET A;  1ZGJ A;  1H88 C;  2IEK A;  1K6Y A;  3HC7 A;  1YLF A;  2KT0 A;  1K61 A;  3CTA A;  3M1E A;  1FSH A;  3D1N I;  2I8D A;  1OCO H;  1X1D A;  2JPC A;  1R22 A;  2YX4 A;  1T56 A;  2XRO A;  3ASO H;  2BW3 A;  2XGE A;  4KT5 C;  2P6T A;  2ZME C;  2HOA A;  1PUE E;  1ZTR A;  2Y48 A;  2KDZ A;  2P6S A;  1D8J A;  2XB5 A;  3K4K A;  3O8H A;  2PLY A;  1KU2 A;  2LYC A;  5HOD A;  5L3F A;  5HNF A;  2CQX A;  1GXQ A;  3OYD A;  3CP2 A;  2BXY A;  4FIS A;  2VN2 A;  2FBI A;  5GP9 A;  2F5D A;  4U87 A;  4EEF G;  4XLA A;  3V8J A;  2LVS A;  3K70 C;  2H6B A;  1FP1 D;  1O3T A;  3RPQ A;  2V79 A;  2E34 A;  3K4N A;  3QYF A;  3K6G A;  1P4A A;  2LF8 A;  3E6C C;  2XPW A;  3KP6 A;  2KQR A;  1P9Q C;  3ZQF A;  1G8X A;  3S1Q J;  1SMT A;  4P5O A;  2JJ7 A;  5K5R A;  3W2W A;  1FOK A;  4PFP A;  2DYS H;  3FXQ A;  1MBK A;  4MTE A;  4CXF A;  2NXN B;  3HM5 A;  5HOO A;  1LE8 B;  1A04 A;  3TBI A;  3W6J B;  3CCM I;  3LSI A;  1A5J A;  2ECC A;  4LJZ F;  3T8T A;  1XX5 A;  1TWC J;  3M7G A;  5GPA A;  3PQJ A;  2IAI A;  5LHH A;  4GFB A;  3WTT C;  5DCM A;  1NG6 A;  4DZJ A;  4ZYE A;  1S6L A;  3Q5F A;  4OMY A;  1UG0 A;  2XSD C;  1D3Y A;  4JBA A;  5IYB J;  3AKZ A;  2HKO A;  3A03 A;  1T0F C;  1R6R A;  1TL8 A;  2XKO A;  2FA5 A;  2L5Q A;  1IV6 A;  4XLH A;  3L1P A;  1DPR A;  2L2O A;  3DPL C;  1SC7 A;  3BPV A;  1IG7 A;  2DOD A;  2M87 A;  3OIQ A;  2X1D A;  4HEA 2;  2K3F A;  1IXR C;  1QZY A;  3TGN A;  4RS8 A;  2EFQ A;  3N4M A;  1HOM A;  4DNC A;  2MFZ A;  1U5T B;  5LHG A;  4ESB A;  4DGW B;  4JK1 X;  4N4N B;  5D8L B;  1R36 A;  1M1E B;  3DTE A;  3OV8 A;  2VE8 A;  2X6Y A;  2XC7 A;  2WAQ A;  4A2U A;  3CCQ I;  3W6K B;  2B9S A;  3S2W A;  3WTZ A;  1FBU A;  4P96 A;  3MZH A;  3ESW B;  3GTK J;  1RC9 A;  1ZR4 A;  3EUK L;  4HQE A;  1FPQ A;  1VQ8 I;  2ESN A;  4I7H A;  4BUP A;  5H20 A;  1K78 B;  3RKX A;  2F5C A;  2OPT A;  3LFU A;  3ASN H;  1W5C C;  4XRM A;  1T95 A;  3M1C A;  4PJM A;  2VE9 A;  1FEX A;  1GHC A;  2EFO A;  5DYM A;  2NOG A;  4ABZ A;  3I56 I;  3H0D A;  2IS6 A;  3CJN A;  3ZQH A;  3CD6 I;  4GRI A;  2J5O A;  5B5E C;  2Q2E B;  2XV4 S;  2L0K A;  3LA2 A;  1XG1 A;  4RAF A;  4RAG A;  2R7U A;  3BY6 A;  5GTH C;  5FJ8 J;  3HPG A;  4EV0 A;  2F6C A;  4L5E A;  1S8N A;  3KEO A;  5IP9 J;  3DFG A;  4IPA A;  3CO7 C;  4KN7 X;  1B8I A;  1W36 D;  2KIS A;  3TOB A;  2HXI A;  3Q9S A;  1Z9C A;  4BL0 B;  3J7Z I;  1MSF C;  3SZG A;  2CV1 A;  2AO9 A;  2DLL A;  4NQW B;  2P7C B;  2OD5 A;  4IRI A;  3IP4 B;  3OR1 C;  2WV0 A;  4M6X A;  1T2K A;  2F4I A;  2BZT A;  2QUF A;  3OS1 A;  2K27 A;  2F4O B;  3BG3 A;  4KNY A;  2X1C A;  3HKZ A;  2E7W A;  3ONQ A;  2O8X A;  4II3 A;  1KU3 A;  3RDI A;  2JK3 A;  2CV0 A;  3S3O A;  4IVN A;  5J40 A;  4Z2Y A;  2GXG A;  1FJL A;  3HSF A;  1P7J A;  2KZV A;  2CV2 A;  2L7K A;  5FRN A;  1MMA A;  5HVQ C;  4CSW A;  3PFI A;  2VQH A;  5K7Z A;  1VQL I;  3OSF A;  2DPU A;  1XB4 A;  6PAX A;  2LTP A;  2A61 A;  3IC7 A;  4F92 B;  2IA2 A;  1IUY A;  2L7M P;  1UST A;  1WJE A;  3S3N A;  2HQN A;  4HX8 A;  2A3S A;  1RR7 A;  1UB9 A;  2YS9 A;  3ABM H;  3FMS A;  3F21 A;  4V19 K;  5GAD J;  2EFN A;  1PDN C;  2LLK A;  4BE1 A;  3QOE A;  4P9F A;  3JTG A;  2IT0 A;  4A3F J;  5LGN A;  2IP2 A;  2X6X A;  2KLO A;  3OIO A;  3TMO A;  3V7C A;  5BPI A;  1O7L A;  1ZHF A;  4KIG A;  1ZLK A;  1JI8 A;  2Y69 H;  3H1C A;  3Q3S A;  4RAZ A;  5F1J A;  3G1O A;  2XIG A;  2JVH A;  3H5R A;  3W3C A;  4K2E A;  3K4M A;  1W4M A;  4IQJ A;  1B9M A;  2VJ4 A;  2QA4 I;  1DUX C;  4E6K G;  2YSR A;  3K4L A;  2AS5 F;  5D5W B;  4DBQ A;  4BS9 A;  5H6R A;  3ROU A;  4AWX B;  4G6D A;  2BW3 B;  2VPL A;  3BP8 A;  3H5N A;  2BEO A;  2M0C A;  3GZN B;  2JSC A;  2KIU A;  4OIN F;  1BJA A;  3S93 A;  2E5Z A;  3BPX A;  3EDP A;  2K85 A;  4B09 A;  3PM1 A;  2K9L A;  3GFL A;  4RGX A;  4HNV A;  5CQG A;  3S1M J;  4IOC F;  5LRR A;  4EVI A;  3HOS A;  4M6V A;  4I2O A;  1YYV A;  3Q0W A;  1XMX A;  3TW6 A;  3L00 A;  5GAH J;  2K9M A;  4YIF A;  4B48 A;  4B47 A;  5D6F A;  5B1B H;  1IGN A;  1VQO I;  5ICE A;  1YTY A;  3HSE A;  4ESF A;  4XN0 A;  4X0G A;  1U0J A;  1YI2 I;  3FK7 A;  4TV7 A;  1B72 A;  2E5N A;  3ZN1 A;  2ADU A;  1YJW I;  4FHT A;  1ZYR F;  1Y56 A;  2M3A A;  3MZY A;  1LE8 A;  1DP7 P;  4BDZ A; 
#chains in the Genus database with same CATH homology
 3ABM H;  2OCC H;  3WG7 H;  1OCC H;  2EIN H;  2DYS H;  5B1A H;  2EIL H;  3AG3 H;  3AG4 H;  1OCR H;  1OCZ H;  2EIK H;  2EIM H;  2EIJ H;  5B1B H;  3ASN H;  1V55 H;  3ABL H;  3X2Q H;  1OCO H;  2DYR H;  2Y69 H;  5B3S H;  3ASO H;  3AG1 H;  3ABK H;  1V54 H;  2ZXW H;  3AG2 H;  5IY5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...