3KP5A

Staphylococcus epidermidis tcar in complex with kanamycin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator/antibiotic
total genus 49
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp5A00
4KYWA 3HTSB 1IXRC 4R1HA 5CVJA 1MDMA 2J5PA 1UHMA 4RB1A 2FQ3A 1LDJA 4MTEA 1S7OA 1XDUA 2ISZA 1IAWA 3BZ6A 3JSPA 5LGTA 1GHCA 3V7RA 3MCZA 5ICEA 1JHFA 3KP3A 1MDMB 1HW5A 1H9TA 5D4SA 4I02A 2EA2A 3K1PA 3M8FA 4IHSA 3GO5A 2GXBA 2HDCA 3CO7C 3FX3A 1IN5A 2H09A 4MEYF 1X3UA 1O3TA 4EMSA 2C6YA 2VBZA 3E6DA 1UHWA 1FYLA 2VXZA 4UV9A 3CUQA 3DF8A 1BI3A 1R1TA 5LEKA 2LKPA 4RB2C 1ZGAA 5JI6A 5BMZA 1D5VA 2Z5UA 5HOOA 3QPHA 3TO6A 2HGCA 3U1DA 2G9WA 4RAYA 4KIFA 4EM1A 3CUQB 1C0WA 4UVCA 2QZ8A 2HKXA 4RGSA 4HOBA 4RAZA 1HKSA 2XROA 4IF4A 3PQKA 2QYOA 3HRMA 4KN4X 1YIOA 2KJCA 2ESHA 2ISYA 2HEOA 4EJTA 3CUOA 4A0ZA 2HKOA 1O57A 2QBYA 2ZCWA 1ZG5A 3DPTA 5BPDA 1P4WA 1FLIA 2P6SA 5LEJA 3KZYA 5L3BA 5FGMA 5HDNA 2QBYB 1GVJA 4RGXA 3VB2A 1J2XA 2Y75A 3TOAA 3SZTA 3F8FA 1A04A 1XCBA 2QQAA 5ICCA 4Y13A 2ZMEA 3GFJA 5FFXA 2XVCA 2ACJA 2PFBA 2RGVA 2NS0A 5H6QA 4I09A 2R7FA 5HLIA 2WTEA 3ECOA 1PP7U 4NB5A 3NQOA 2VE9A 2QWWA 1G6NA 2M5WA 4BAYA 2STTA 4TV7A 2ZMEB 3Q9SA 2HZTA 4LJZF 4PDKA 1R23A 1W4MA 2W57A 1I6XA 3K69A 4EGYA 1ZG3A 1PDNC 1YTYA 3KFWX 1UB9A 2PMHA 2NAZA 3T5XA 5CJ9A 1RUNA 1S29A 3FXUA 5ICFA 1W7PA 2D1VA 3BP8A 3LA3A 5ED4A 1HKTA 3V4GA 4U0VA 2JPCA 2YR2A 1YS6A 3PFIA 3JW4A 3H3ZA 5HS9A 4XRFA 1W7PB 2Z99A 2JPBA 1QBJA 2OAZA 2PLYA 1R7JA 4L0YB 2EA4A 3FM3A 1I1SA 1FSEA 3QU6A 3ZMZA 4GYIA 2IA2A 3L09A 5L3EA 1R00A 1S6LA 3T1BA 3WTWC 2L4MA 3F8MA 2WC2A 1MGTA 4ESJA 1XCVA 2Z9OA 2DBBA 1YS7A 1SMTA 3GFMA 3V7CA 4Q4ZF 5BPIA 1QPMA 4P5OA 5E17F 3IWZA 2A3SA 3ROUA 1HSJA 3I64A 3WGHA 3R6SA 4S05A 4M72A 1YLFA 1V3FA 2HOEA 2D1HA 1PUEE 2CSOA 2DTRA 2GQQA 2LSOA 1K7AA 5AIQA 3FM5A 4HX7A 2YPRA 3WG9A 2PQ8A 4XSXF 5JFRA 3GFIA 4CGZA 2M30A 3L7WA 1YW8A 2L54A 2FOKA 2FF4A 2CW0F 3R61A 3CLOA 2A5YB 3HSEA 1XSVA 4WK8F 3P9CA 1UFMA 3LSTA 5F1RA 3IRRA 4Q5SF 2GWRA 3WODF 5DD4A 3DFGA 4KN7X 5L3GA 1MKMA 3TQNA 3W6JB 2K4BA 5IT9Z 4AD9A 4I0AA 4U0YA 2IT0A 2XGXA 3RYRA 2P4WA 1LDDA 4XBFA 3W6KB 1KQ8A 3EYYA 4GO1A 3TDZC 2E1NA 2VBYA 1REPC 5E1XA 4PCQA 1Z6RA 4IRGA 3I53A 3TKYA 5KVRA 3OOPA 3VODA 2W25A 1TW2A 4IJAA 5D5UB 3I0TA 4LK0F 1FSHA 4EGZA 3HHGA 1SFUA 2QLZA 5LRSA 3VEPA 2GA2A 4LGWA 1KQ0A 5HLGA 3DEUA 1FYKA 4RGUA 2P7VB 3KP7A 4EM0B 4U7DA 4L9JA 3LAJA 4G6QA 4RGRA 4KMFA 5D5XB 1BBYA 1ZARA 4CZZA 5LHGA 2XAHA 2W84A 2Z33A 3M1EA 2FNPA 3RPQA 3I4PA 5E20A 1BN5A 1P92A 4GYGA 2EV0A 5FLXZ 4HAMA 2H27A 2HFHA 5ILSA 2K4JA 1ZLKA 4EM2A 2L01A 2LDUA 3J80Z 5D4RA 4PGHA 1SD4A 3RIRA 1KYWA 4E70A 4LB5A 3GZ5A 1FY7A 4HF2A 1KA8A 1IUYA 3MAJA 1LQ1A 5A2QK 2GXGA 5D6FA 2DK5A 4G7ZF 4A12A 3MEXA 3QPTA 3BJ6A 1LEBA 4I01A 4KFCA 1BM9A 4IVNA 2DAOA 5D8LB 2WV0A 2F5EA 2EFPA 3C3WA 2XKOA 3IHUA 2ETHA 3V7SA 4Q48A 1WKMA 4WX9A 3LA7A 1Z6TA 2EFNA 1BIBA 1U5TC 2CYYA 3T8TA 4I2OA 4L9VA 1H9GA 5HS7A 4EV0A 3ZPLA 1QO0D 2MLGA 3LA2A 5KK1A 2ELHA 1WSUA 2O03A 4LLLA 2ZJ2A 2EFQA 1KU2A 3H92A 3KP5A 5EEHA 4CYDA 3HIFA 3VOEA 2FMLA 1TNSA 1L3LA 4GXOA 2Q2EA 4ZYDA 1OKRA 4I7HA 4LG0A 1AOYA 3RYPA 4ENKA 4JQFA 3QOPA 2L3DA 1LEAA 1T0FA 4ESFA 1F4KA 1R5GA 3GYHX 3E5XA 2QVOA 3KE2A 2L4AA 1U3EM 4G9YA 4ENMA 1BI1A 4I98B 5L3DA 4A5NA 4LG0B 3GVAA 3JAMK 2FEZA 2OQGA 2K27A 4IRIA 5EEGA 1SMYF 2IPQX 5AIPA 2VOOA 2VC1A 4HA8A 1IRGA 5JVTA 2V1XA 1LB2A 1B4AA 2AS5F 4OMYA 4M9ZA 4JK1X 1CGPA 3GFLA 3COAC 4OIPF 2XAGA 3BDDA 3ZQ7A 1SD6A 5HVQC 4UVAA 5TJJA 1XGMA 4R79A 3HOSA 2FSWA 1ZH5A 2HS5A 3WTVC 3E3VA 4GCVA 3K1MA 3DPLC 1DUXC 3E5UA 3MFKA 3F72A 4AVPA 1U8RA 3ZN1A 2ZBKA 3OV8A 2CO5A 4WWCA 1I5ZA 5DUIA 2CQKA 1FP1D 3B73A 3ZMVA 2OQRA 3WTZA 1RI7A 3BPXA 5L3CA 2EWNA 2H6CA 1SAXA 2OZUA 1F5TA 1IRFA 3WTSC 1D8KA 4M6XA 5BQTA 1G3SA 3SFZA 1R22A 4FX4A 3LFKA 1ONVA 2E1CA 2M1BA 3E5QA 1FBQA 2HQRA 5H6RA 4HLXA 2RC4A 3ML6A 2E7WA 5E18F 1HW1A 1P4AA 1U2WA 4ZYEA 4BNCA 4IHTA 1UCRA 2G7UA 2DW4A 2O6GE 1BIAA 4BXUA 2HTSA 1HQCA 5ICGA 3WE2A 2DK8A 1YO5C 1FBUA 1R36A 4HDVA 3O3KA 3ZMSA 2GA1A 1IN4A 5J8FA 3U2RA 3GX4X 1R1VA 1T2KA 1IN6A 1O3RA 1OYYA 5DDGA 2IW5A 4OIOF 2RKHA 2HR3A 3TGNA 2K86A 3FMRA 4BH9A 2V79A 4CICA 1OMIA 4H0EA 1SFEA 1QQIA 4KIGA 3KP4A 3F6VA 2P5LC 2HYGD 4YIFA 5FFZA 3H3UA 2D2WA 3KP6A 5L3FA 2EB7A 4UV8A 2G7HA 3I59A 3P7NA 3GEZA 1BC7C 5HLHA 1FC3A 1YW9A 1MJAA 3WTYC 3GWZA 2FBHA 4P9UA 2P6TA 3KP2A 4YG2F 3DV8A 2FBKA 2QENA 2MC3A 5H20A 2Y48A 2RQPA 1TQMA 3I59B 3QAHA 3MWMA 1L0OC 1ZGJA 1R58A 4AWXB 1RZ4A 1ZYRF 4M9SA 2ZKZA 1ZRDA 4LK1F 6PAXA 4QWQA 2O0YA 5E1ZB 3IWFA 3KLNA 4HW0A 4A0YA 4Z2YA 2MH2A 3MZHA 3ZMTA 2FA5A 1W7PD 3BJOA 5FD6A 1ZREA 2XRNA 4EJUA 4XLPF 2GAUA 4U0WA 3REOA 4N0BA 4F7ZA 5CVUA 4OIRF 2J5OA 1XSDA 4G7OF 2M8EA 3WGGA 4HV5A 4L5IA 1WI9A 1DPUA 2KIMA 3F8NA 2VOPA 2XUBA 3GLXA 5D5VB 4LLNA 4M6YA 1W5TA 4A2UA 1XSXA 3SXYA 3SQNA 1T6SA 5LRRA 2EFWA 2STWA 2EV6A 5FB2A 1P4XA 2GZWA 4HF1A 2DPUA 3WE3A 1T39A 1BI0A 1MZBA 3ELKA 3G73A 1HBXG 1FX7A 4WCGA 3DXJF 4OMZA 3GZ6A 4KUMA 3DKWA 1QNTA 3HYIA 1WWXA 1I27A 1Q1HA 2W24A 1MD0A 1YYVA 4EQQA 3C1DA 1P6RA 4LLGF 3WTXC 2P7CB 3GF2A 1BOAA 2PN6A 2X4HA 5IT3A 3PQJA 3RJPA 1J75A 2KIUA 3KETA 3R0AA 4OOIA 1HSTA 3F8CA 3TO7A 4G6DA 5D6EA 1PP8F 1IW7F 4MEXF 3L2CA 3D0SA 3I71A 3EUHA 1TLHB 5CVIA 2P5KA 5FD5A 1U6GA 3CUQC 2K7LA 2BBYA 2NYXA 3HSFA 1FWZA 4MGRA 2YX4A 2OZ6A 3F8BA 4BYYA 4HBLA 2UXXA 3EETA 3R4KA 5DYMA 2Z3YA 1YW7A 3IKTA 2E7XA 2V1DA 4FHTA 3L00A 1YFHA 2XV4S 3V8KA 2BE5F 4P9FA 3DP7A 2LF8A 4N9IA 2RDPA 1FYMA 5TRDA 3ZN0A 5LHIA 3QU3A 4JBAA 5J6XA 1HW2A 3N4MA 1BC8C 1K79A 2PI0A 2DO7A 2F2EA 3J81K 4UUVA 3GXOA 2P5VA 2A61A 5HS8A 2FBIA 3SHFA 4KA4A 2AXLA 4HQMA 3V8LA 1FP2A 1QGPA 4KICA 2DFIA 2DU9A 1FBSA 1ZHFA 1S8NA 4ZZDA 2O3FA 3SZPA 5ERIA 2VC0A 2VBXA 1B59A 3S2WA 4L18B 1P2FA 3ECHA 4MNUA 4BHPA 4AIHA 2COMA 1RNLA 2Y0MA 5K1YA 2MD5A 2YSRA 3MZYA 1CF7B 1E2XA 5BS6A 5D8KB 1IZ1A 4P96A 4I0BA 5A2QZ 4ENNA 3WU1B 1SFXA 2VE8A 4G7HF 1IN8A 3C18A 4NQWA 5D5WB 1S7AA 1TTYA 1O3QA 2DLLA 1XD7A 1FZPB 4MHGA 2JT1A 1U78A 3RDIA 2JRTA 1J59A 3TDUC 2TDXA 2O8XA 1DP7P 3V8JA 1TQIA 3M7GA 2DPDA 4MQVA 4ASNA 1BJAA 1F9NA 2VONA 2RV8A 4G8XA 5K5QA 4HYEA 4DQ2A 3KEQA 5CVVA 3O2PE 3RKXA 1B1BA 3LAPA 2RVCA 3ZMDA 1DPRA 1ODDA 2DT5A 4EJVA 3AAFA 2ZFWA 4ENJA 3FZVA 3F23A 2UZKA 4WXHA 2EJRA 2FMYA 4L0ZB 2DI3A 4K2EA 1WRJA 1T98A 3QP5A 1TNTA 3ABTA 5ILUA 2Q0OA 3NEUA 3IRQA 1IXSB 1MJ9A 4ZYGA 5DV5A 4OIQF 3FXQA 3R0JA 3WU0A 2NRAC 3M8EA 1EH6A 2BV6A 4FX0A 4YFXF 4RB3C 3HRTA 1HXDA 2KIFA 4O5VA 1K78A 1D8JA 1ZRCA 1JHHA 3BPVA 1AWCA 4B8XA 1Z1DA 4ON0A 3NRVA 2BEOA 4L9TA 2A6EF 1V4RA 2ZO4A 1LJ9A 4OINF 2KJBA 3R60A 4HDUA 1F1ZA 3FXRA 5DCMA 1K78B 2QQBA 4WXDA 4XSZF 3T0YA 2FE3A 2KRFA 2VBWA 3FMSA 3EDPA 1KU3A 3P9KA 4MQ9F 5DEQA 2WWYA 4IRHA 4U7BA 2IVMA 3JAMZ 4PGGA 1ZG1A 5DCMB 2HQNA 4NHJA 1O7LA 4CDGA 2M45A 2L02A 5ILVA 4DNCA 3E6BA 5JHUA 1GXQA 1ZRFA 1J7KA 4M74A 4XLNF 1XGSA 1LNWA 2IP2A 3LQQA 3P9IA 2XAQA 1Y0UA 2H94A 2LNBA 1OPCA 2V9VA 2O61A 1U5TA 4RS8A 2P8TA 2IJLA 3LQRA 5JR3A 4Y17A 1SD7A 3L9FA 3GUDA 1XMKA 4YFKF 2UWMA 1OYWA 2XHKA 2F5CA 1S3JA 1DDNA 3F21A 2EK5A 3HOTA 4M73A 1U5TB 5AONA 4ETSA 1KU7A 2VT3A 2QQ9A 1GXPA 5F6FA 3CDHA 2NNNA 2GIVA 1VTNC 3FF5A 2K02A 3U9GA 2JTVA 2MBFA 2V6CA 4LB6B 2VT2A 5DD8A 2B0LA 1O3SA 2DQRA 4ZH4F 2F5FA 2A07F 3I58A 2EV5A 2FXAA 3JTHA 2XASA 4L9NA 1TW3A 2A68F 2BYVE 4GGGA 1KYZA 2LF7A 5E8GA 4A6DA 2FU4A 4KMUX 1YQAA 1R5HA 1OYIA 3WGIA 1G4DA 2VN2A 3ULQB 3JTGA 3F22A 3HTUA 3D5LA 1XGNA 1IF1A 4UVBA 4CO8A 2OD5A 1WQ2A 3BWGA 5LBQA 2HTJA 4ESBA 3KEOA 2M87A 1J9IA 3BROA 2QUFA 3O6BB 4HV6A 3KZZA 3CJNA 3G3ZA 5LLQA 2UXNA 3EQLF 5FO5A 3T8RA 1Z05A 1FPQA 1RIOH 4BHBA 1T38A 2OA4A 3ERED 3MQ0A 1EH7A 2EFOA 2XAFA 5E8IA 3VFZA 1Z9CA 2CFXA 3K0LA 3QP6A 4G94A 1G3TA 4HLYA 4CXFA 1QZZA 4A5MA 3FMQA 2R7DA 3Q5FA 1K6OA 4R8HA 3KCCA 1IN7A 3Q9VA 4Y15A 2MA3A 1LDKB 1ON2A 1ZLJA 5LGUA 1KU9A 1ON1A 2ZXJA 4UXNA 1E17A 2XAJA 1ZN2A 2PBIA 2IA1A 3M9AA 1H0MA 2VODA 1EV7A 4S04A 3ZP5A 1B9NA 1STZA 3RKWA 2ZNZA 2YU3A 2PG4A 1ZAOA 3HRUA 1Z91A 5IT9K 5K5OA 2OBPA 1Z7UA 3TOBA 3BJAA 5CLSA 5LGNA 2MLKA 2MH9A 3ZMUA 3E6MA 3BOQA 2PEXA 3WTUC 1KGSA 3EYIA 4Q47A 1R1UA 3GW2A 1JE8A 1XGOA 2HYFA 2PMUA 4YFNF 2W85A 2NNYA 1B9MA 4P55A 2F5DA 3HRSA 4U88A 1HKQA 4UHTA 1I1GA 3FHZA 2HWVA 2DQLA 4M71A 4PZJA 4EVIA 2YX7A 4AIKA 1LVAA 1YG2A 1KQ9A 1TBXA 3TO9A 1FNNA 3ISPA 2JZYA 4O3MA 1XN7A 1OR7A 2IA0A 4O6JA 3ABUA 4RB0A 5F64A 2Q8KA 1MJBA 3I54A 3CTAA 3DQVC 1XB4A 1XDSA 3RI4A 1FOKA 1SD5A 3RTRA 5E1WA 3F3XA 2ZNYA 5HDGA 1RUOA 2IRFG 5FLXK 3K2ZA 4ZYHA 1J5YA 5CVRA 1JGSA 3BY6A 4KDPA 3J80K 5DUKA 4N9HA 2FNAA 1G3WA 1XMAA 2JSCA 1IXCA 3HSRA 3LWFA 3CO6C 3IKVA 4UNOA 3C7JA 4D0PA 2BGCA 1JXSA 4M9XA 4QLCU 3I5UA 4HX8A 1NHAA 3HUGA 3WTTC 1FT9A 3IL2A 4IPAA 4A6EA 1USSA 1EH8A 3KLOA 5CYVA 3J7AO 3RPUA 4KT5C 3K9TA 2FRHA 2ADUA 4HZFA 1J0RA 2QM3A 3K1NA 4FT8A 2KKOA 5J8CA 3N97A 1ULYA 1W5SA 4LMYA 4ZZLA 4HF0A 2V1UA 4B09A 3QRFF 4LFUA 2X0LA 4BQAA 1CF7A 1TQPA 4AIJA 4EJOA 4MTDA 4WF2A 3FWEA 2A6HF 2CWEA 4EJWA 4L5JA 3JSOA 1B6AA 3B02A 4YIIA 4CHUA 2RN7A 4KIBA 2OU2A 1USTA 2R3SA 4KNYA 5LHHA 1O7FA 2CG4A 4HX4A 2PJPA 3F6OA 3HHHA 3IC7A 2RNJA 4WXCA 2A69F 2D45A 3E6CC 5DCFA 4HQEA 5HDKA 5K5RA 3J81Z 3RKYA 2XKPA 4IXAA 2XIGA 1G3YA 3E97A 4LD5A 4A0XA 2CGPA 2ESNA 5BOXA 1BI2A 2H6BA 4OU0A 1QZYA 4BHCA 1D3YA
chains in the Genus database with same CATH superfamily
4KYWA 3HTSB 1W36C 2VL8A 2ECCA 3WHCA 1IXRC 4R1HA 5CVJA 3M8JA 2WB1A 1SANA 1VQ6I 1MDMA 1D1BA 3WHBA 1A35A 2J5PA 1UHMA 4RB1A 2ZSIB 2FQ3A 1LDJA 2L9VA 4MTEA 5FLVA 2R5YB 1S7OA 2WA0A 3AKZA 2M2EA 1XDUA 2ISZA 2B7EA 5GPAA 1A6QA 1IAWA 1W1WE 4UB6C 5KHDA 3BZ6A 3JSPA 4XL9A 3BTCA 5LGTA 1GHCA 1QVTA 3V7RA 1ZKGA 2NVUB 3MCZA 5ICEA 1JHFA 2Y0SN 5FRMA 2E1MC 4DGWB 3KP3A 1QU3A 3D5RC 1MDMB 1WJBA 1OLTA 3QYEA 2E19A 2WAQN 1HW5A 1WGXA 3E0JB 4I02A 5D4SA 1H9TA 2EA2A 3K1PA 2VKHA 3IAS2 2XGEA 3M8FA 1A6IA 4IHSA 3LSJA 5J1RA 3RZDJ 1TWCJ 3GO5A 4AVZA 2GXBA 3RSNA 2HDCA 2ZJRF 3CO7C 3FX3A 1IN5A 2H09A 2E60A 4MEYF 3JRFA 1X3UA 2M4KA 1O3TA 2EZLA 2JUGA 4EMSA 4MIMA 2C6YA 1YRNB 2VBZA 3QPLA 3ZQLA 1WPKA 3E6DA 1UHWA 2DA6A 1V5FA 5CQEA 5IP9J 3OS2A 1FYLA 2VXZA 3C2GA 2ME0A 4XN3A 4UV9A 3CUQA 1EJ9A 2HQAA 3DF8A 3HEFA 1BI3A 1R1TA 2O7OA 1D5YA 5LEKA 2LKPA 4BJ5C 3TW6A 4RB2C 1ZGAA 5JI6A 5BMZA 2X51A 1D5VA 3DU6A 2VI6A 3SEQA 2Z5UA 5HOOA 3QPHA 1Y0NA 5GADJ 3GTLJ 3TO6A 2HGCA 2LC2A 3U1DA 4A3MJ 1X3WB 4HRIA 1XMXA 3FK6A 2G9WA 2BVMA 1IDYA 2ELJA 3OYCA 3L2RA 1I3AA 5FKMA 3CDIA 2CUFA 3PJRA 3CMMA 4RAYA 4KIFA 4EM1A 3CUQB 1C0WA 4UVCA 3HGGA 2QZ8A 4C2UA 2HKXA 4RM3A 1I3QJ 4RGSA 4HOBA 4RAZA 1HKSA 2XROA 4IF4A 3H3VK 3PQKA 2DJNA 3K4JA 4QIWN 2QYOA 3P5JA 3HRMA 3MZ8A 1J09A 4KN4X 1YIOA 2KJCA 1S5LC 2ESHA 2KRHA 4FE7A 3HC7A 2ISYA 2WAFA 2HEOA 2BHZA 4DYRA 5IOYA 4IHVA 4EJTA 1QA6A 3CUOA 4A0ZA 2HKOA 3F0CA 4BE0A 2KPMA 3PSFA 1O57A 4BBRJ 4UUTA 2QBYA 2ZCWA 3IH2A 1ZG5A 3WG7H 3DPTA 5BPDA 1P4WA 1RKTA 1FLIA 2LP0A 3S2HJ 3GCMA 1X1CA 2P6SA 5LEJA 2LREA 2QQ8A 1X2NA 3CJRB 4B43A 2JJ7A 3KZYA 1WJAA 4J19A 2LLKA 4A3LJ 3QYBA 5L3BA 3GTMJ 5JLXA 2VIXA 4PJLA 1Y8QB 3NWSA 1HDPA 1IRXA 5FGMA 5FKLA 5HDNA 3HOXJ 1BW6A 4CUGA 2QBYB 1GVJA 1W5CC 3OIPA 4RGXA 3VB2A 1J2XA 1FIPA 2Y75A 3TOAA 3SZTA 2QKMB 2X6XA 3F8FA 2MSYA 3H9JA 4CA0A 2V26A 1A04A 1XCBA 4HPQA 2QQAA 2MC4A 5ICCA 4Y13A 5B5EC 2ZMEA 1R71A 3CESA 3GFJA 2XVCA 5FFXA 2ACJA 2PFBA 4XOTA 2RGVA 2NS0A 5H6QA 3OIQA 4I09A 4L5EA 4BE1A 1SVOA 2R7FA 1SVMA 4U87A 4CYCB 1H89C 5CPRB 5HLIA 1WHUA 2L7MP 2WTEA 3CCJI 4ABZA 2E36A 1VZ0A 1TWGJ 3ECOA 4QPQA 4NB5A 3CF2A 1PP7U 2F6CA 4HSTA 1ZELA 3NQOA 2VE9A 2QWWA 5K7ZA 1TL8A 1MBJA 1G6NA 4LIVA 2M5WA 3C2BA 2HOSA 4E7IA 4BAYA 2X6YA 2H1KA 1U8BA 4I76A 2STTA 2VUMJ 2WV1A 4TV7A 2ZC2A 2ZMEB 2DFEA 3Q9SA 4F91B 2HZTA 4LJZF 1BR4A 4PDKA 2QA4I 1JKRC 1R23A 1W4MA 2F5VA 2E34A 2W57A 4DJAA 1I6XA 5EZHA 2GOXB 2RNGA 3K69A 4F92B 4EGYA 1ZG3A 1TT0A 1PDNC 1TWHJ 1YTYA 2UV1A 3KFWX 4RBOA 4Y52J 5E3MA 1UB9A 2PMHA 2NAZA 3T5XA 1D0YA 5CJ9A 3GZNB 1JKQC 1RUNA 3CD6I 1S29A 3FXUA 4HSRA 1SFKA 5ICFA 1W7PA 1DU0A 2D1VA 3BP8A 1E3HA 3CLQA 2JA8J 1P9QC 3LA3A 5ED4A 1HKTA 3V4GA 3VDXA 4U0VA 2JK3A 2JPCA 4FQGA 2YR2A 2R7RA 1YS6A 2KT0A 3PFIA 3I55I 3TW7A 1ETKA 1VF9A 1YE9A 3EUHC 4F52A 3JW4A 2R93J 5IPAA 2NXNB 1OCZH 3NAUA 1MMSA 1TC3C 1JUSA 3CZ6A 5FJ8J 3BTLA 3FKIJ 1Y8RB 3H3ZA 3DEEA 4FASD 3HGYA 1S72I 1FOYA 5M3FJ 5HS9A 5GTIC 4IZZA 4XRFA 1W7PB 2Z99A 2JPBA 1QBJA 1BW5A 2OAZA 3HOWJ 2PLYA 1V5EA 2M0MA 3FXLA 4JX4A 1WJDA 1R7JA 2EQRA 2F48A 2K9QA 2X1EA 3OYDA 4XLEA 1VQ9I 4L0YB 2EA4A 3FM3A 1I1SA 1FSEA 1NH3A 1AU7A 3QU6A 1A36A 4M3EA 2W7NA 3ZMZA 4GYIA 1ETXA 2IA2A 2KL4A 3L09A 4BBSJ 1MSEC 2OV7A 5L3EA 1R00A 1S6LA 3T1BA 1Y1VJ 2VB6A 2N8GA 1MH3A 3WTWC 2L4MA 1GLNA 1R6RA 3F8MA 5DM7F 3OMYA 2R7QA 2WC2A 4UB8C 3V42A 1ITYA 1MGTA 4ESJA 3FKJA 3A2KA 3BR2A 1XCVA 2LFBA 2AO9A 2DBBA 2V7FA 2L5QA 1YS7A 2Z9OA 1SMTA 3OIOA 4DBQA 3GFMA 1MIJA 2EBIA 5C4XJ 5EDNA 3V7CA 4Q4ZF 5BPIA 1QPMA 5EZGA 3OSGA 4P5OA 5E17F 4NDLA 1WJ5A 3IWZA 2A3SA 3ROUA 1HSJA 1Y39A 3GTGJ 3I64A 3WGHA 3R6SA 5EF6A 1R49A 5BNGA 4S05A 2CV2A 1E0EA 3ASOH 2VPLA 4M72A 2VLAA 1P7JA 3M07A 1YLFA 2EZIA 3CMYA 1V3FA 2HOEA 2D1HA 1PUEE 2CSOA 5JLWA 3W2WA 2DTRA 2GQQA 2LD5A 2LSOA 5GAHJ 5AIQA 1K7AA 2JVHA 3FM5A 4HX7A 2IGKA 2V9KA 2YPRA 3LNQA 2MW8A 3WG9A 3NWTA 1RESA 4W1UA 2PQ8A 4XSXF 3RZOJ 4KT6A 5JFRA 3GFIA 4CGZA 2M30A 3L7WA 1YW8A 1ENHA 3LSGA 1VQ8I 2L54A 3J7AY 3GTQJ 5M5WJ 2FOKA 1GDTA 2FF4A 1MMAA 4QPOA 3CMAI 2K9MA 2CW0F 3R61A 1ZK8A 3CLOA 3TMOA 2A5YB 3MKLA 1DP3A 3HSEA 3MVPA 2R4GA 1XSVA 3K4LA 2CH0A 4WK8F 3DEWA 3P9CA 1UFMA 3LSTA 2E5ZA 1PJRA 5F1RA 3IRRA 3S1RJ 4Q5SF 2VJIA 3DTIA 2GWRA 3CCEI 3UKGA 3WODF 2W00A 3I4MJ 5DD4A 3DFGA 4KN7X 4DYQA 4DIQA 4PUSA 3JRIA 5L3GA 4ZDOA 2HNHA 4XR6A 1MKMA 3TQNA 2QKLB 3OOUA 3W6JB 2K4BA 5IT9Z 4AD9A 3S1NJ 4I0AA 4U0YA 4II3A 3Q0VA 3OYFA 1LFUP 2IT0A 2F4OB 2XGXA 3AL0B 3RYRA 1G59A 2P4WA 1LDDA 4XBFA 3W6KB 3A03A 3EYYA 1NG7A 1KQ8A 1FEXA 4GO1A 3TDZC 3OYLA 2E1NA 2DA3A 4XORA 2VBYA 5B3SH 1REPC 5E1XA 4PCQA 4DBRA 1Z6RA 4IRGA 3I53A 5IY5H 3TKYA 4IEJA 5KVRA 3OOPA 3VODA 1Y56A 2W25A 3PUFA 3M4OJ 2I5UA 1TW2A 5J3LA 4IJAA 2JSPA 5D5UB 3I0TA 4LK0F 2XRLA 1I39A 4G12A 2LH9A 1B72B 1FSHA 4EGZA 3HHGA 2R92J 4E7LA 2IGOA 1SFUA 2QLZA 4A3JJ 2ECBA 5LD2C 5LRSA 3VEPA 5C44J 5KNLA 2GA2A 4LGWA 2DDBA 1KQ0A 5HLGA 3DEUA 1FYKA 2OUMA 2YS9A 2P7VB 4RGUA 2M9HA 3KP7A 4EM0B 4U7DA 2OC6A 2LY2A 4L9JA 3LAJA 2HVRA 2DA5A 2ELKA 4G6QA 3U1KA 4RGRA 3OS0A 4KMFA 5D5XB 3VPRA 1BBYA 4ZTFA 4NNJA 1ZARA 4CZZA 5LHGA 2XAHA 2NVYJ 2W84A 2Z33A 3M1EA 2H1LA 5DS9A 2FNPA 2L9NA 3RPQA 3I4PA 4IL6C 5E20A 4IOCF 1BN5A 1P92A 4GYGA 2EV0A 5FLXZ 4HAMA 1T33A 4XKVA 2H27A 2QCOA 2HFHA 5ILSA 2K4JA 1ZLKA 4EM2A 2L01A 3MMYB 3FIWA 2LDUA 3J80Z 3RQIA 5D4RA 3BC8A 3S16J 4PGHA 1SD4A 2WAQA 3KYCB 3MD2A 3RIRA 1KYWA 4E70A 1WVRA 5GP9A 4LB5A 3GZ5A 1FY7A 3K4CA 1KA8A 3L2VA 3W6VA 4HF2A 1IUYA 3MAJA 2JMWA 3H9QA 1LQ1A 4ZJZA 5A2QK 2GXGA 5D6FA 2DK5A 4G7ZF 2LRDA 4A12A 2AXTC 2HXIA 3MEXA 3QPTA 5J1YA 4BDZA 1XPXA 1HF0A 3BJ6A 4ZDPA 4JX5A 3I56I 1LEBA 4I01A 4B3XA 4KFCA 2WY8Q 2DOAA 3S1QJ 2E2JJ 3ZRGA 2LBFB 3HKZN 2BW3A 1BM9A 2DCEA 2DAOA 2VQHA 4IVNA 3TL4X 2ME6A 4QSHA 5D8LB 2WV0A 1H8AC 2F5EA 1LFBA 2LY1A 2EFPA 2FD5A 3C3WA 1VQMI 4M3DA 3FHNA 1LUJB 2XKOA 3IHUA 2ETHA 3V7SA 4Q48A 1WKMA 3VYTB 3OYGA 4WX9A 2LTPA 3QQAA 3QOEA 3LA7A 1Z6TA 2UUZA 3LSPA 2EFNA 1BIBA 3KPHA 3DWLE 1U5TC 1WJCA 2XF6A 4D5FA 5E79C 2CYYA 1RETA 3JRBA 3HOUJ 2BW3B 1V5GA 4ZC3A 1SAUA 3RPUD 3T8TA 4I2OA 3OL3A 4L9VA 3GMEA 1IC8A 1H9GA 5HS7A 1QHHD 4EV0A 2KLOA 4XLAA 1WZ2A 1F36A 3ZPLA 1QO0D 2MLGA 4D7MA 3LA2A 4BE2A 5KK1A 1GV2A 2OCEA 3HPGA 2ELHA 1WSUA 2NS8A 2O03A 1UG2A 2KIQA 4LLLA 1XG1A 2EFQA 2ZJ2A 4JX6A 3IAM2 4CCMA 1KU2A 5B1AH 1JUMA 3H92A 1JI8A 1IV8A 1OCTC 1JJ8C 3VSLA 3JRGA 1O4XA 2DT6A 3KP5A 2IS4A 5EEHA 3GTOJ 2H8WA 4W97A 2CQ7A 2EIMH 4XICA 4CYDA 3HIFA 2Z1DA 3VOEA 5M3MJ 3CDLA 2FMLA 3PNYA 1TNSA 2P81A 4M6VA 4XLFA 1VQ4I 1L3LA 2KHMA 4GXOA 2Q2EA 2W4SA 2IBDA 2KQRA 4D9JA 1YRNA 4ZYDA 4XQFA 4C3JJ 2BY2A 1OKRA 2DXIA 4I7HA 4LG0A 1AOYA 2HDDA 1UAAA 1GUUA 4X1EA 4XLCA 3RYPA 4BXFA 4ENKA 4JQFA 1P7IA 3QOPA 2LVSA 1RKWA 2DA2A 1OCPA 2L3DA 1LEAA 2MGQA 1T0FA 4ESFA 2DMTA 2DFHA 1F4KA 1R5GA 2HZDA 3ABMH 1JTYA 2E2IJ 3GYHX 3E5XA 2QVOA 3KE2A 2L4AA 1U3EM 2Q2EB 3LSKA 2HYJA 2M8GX 4G9YA 1BI1A 4ENMA 4I98B 5L3DA 4A5NA 2L9SA 4LG0B 3GVAA 2CQXA 2EIJH 1FTZA 3JAMK 3C2HA 2FEZA 4QTRA 2OQGA 3DPUA 2K27A 2ZXIA 3G1MA 4IRIA 2XGDA 1SMYF 2IPQX 2EINH 5AIPA 5EEGA 2VC1A 2I8DA 4HA8A 3TP3A 2VOOA 4A3IJ 2CRGA 1IRGA 4LITA 5JVTA 2V1XA 3S15J 1G2HA 1JKOC 1LB2A 3K4MA 2DJIA 1V54H 1B4AA 1ZTRA 4MFEA 2AS5F 4OMYA 4M9ZA 1G8XA 4JK1X 2Y9YA 1CGPA 3GFLA 3BG6A 1DGRM 4E7ZA 3COAC 4OIPF 3KX2A 1TP4A 2XAGA 3BDDA 3ZQ7A 1ETVA 1SD6A 5HVQC 4UVAA 2ZJQF 3LFUA 1IJWC 1A5JA 5TJJA 1YJ9I 3DKYA 2JUCA 1XGMA 3PFYA 4ANJA 4R79A 1H88C 3HOSA 2FSWA 1ZH5A 2CW8A 2HS5A 3WTVC 5TISC 2QSGX 2GXAA 1BR1A 1POGA 4IKFA 3E3VA 4GCVA 3IV5A 3SZGA 3K1MA 3DPLC 1X19A 3CCYA 2X85A 4DW6A 4I99C 1OJLA 1DUXC 3FBNB 1X4PA 1BOBA 2OTJI 1A31A 4C3HJ 4AIDA 2JA5J 3E5UA 3MFKA 1E3OC 3F72A 1PUFA 3BG3A 4AVPA 1U8RA 3IP4B 2CUZA 3ZN1A 3H5NA 2ZBKA 1MW7A 3UR3C 2ZXWH 5EGOB 3OV8A 2CO5A 4WWCA 3HOYJ 1I5ZA 1VQOI 5DUIA 2CQKA 2E2HJ 1R4MB 5F0FA 3HG9A 1FP1D 3B73A 4XN0A 3ZMVA 4Z6YA 2OQRA 3ZOBA 3WTZA 1RI7A 3BPXA 5L3CA 2EWNA 2M3AA 2B63J 4CYCA 3HOZJ 1IGNA 2H6CA 4PSWA 4LIUA 2VXDA 1SAXA 2OZUA 3BR3A 1F5TA 2JA6J 1IRFA 3CMEI 1PUFB 3WTSC 1D8KA 4M6XA 3B6AA 5BQTA 1G3SA 3SFZA 1R22A 3S93A 4XOPA 3LMMA 2DA1A 1GT0C 3ZQCA 1X1AA 2AQEA 4FX4A 4IOAF 4F3QA 3LFKA 1ONVA 2ID6A 2E1CA 2M1BA 3X2QH 3E5QA 3OSFA 2MYSA 1FBQA 3CC4I 2HQRA 5H6RA 3FXKA 3Q0UA 4HLXA 2RC4A 3ML6A 2E7WA 5E18F 1HW1A 1P4AA 1U2WA 3B6CA 4ZYEA 3ABLH 4BNCA 4IHTA 1UCRA 5HODA 3JCUC 2G7UA 2DW4A 2O6GE 1BIAA 4BXUA 2Y30A 2HTSA 1HQCA 5ICGA 3WE2A 2DK8A 2ICWG 1YO5C 2XPUA 5E3LA 2XC7A 3NARA 1FBUA 1R36A 4HDVA 3O3KA 2BY1A 1OR7C 4A3CJ 3ZMSA 2GA1A 1IN4A 5J8FA 3U2RA 4DZJA 1JJ6C 3GX4X 1BL0A 1R1VA 1T2KA 3VWBA 1IN6A 2KZGA 4FCYA 1O3RA 1OYYA 1Z3XA 1N75A 5DDGA 3CCMI 3W2AA 3HXLA 4Y7NJ 1XC5A 3OYKA 2IW5A 4OIOF 2RKHA 2HR3A 5B66C 4PFOA 1OQYA 4J01A 3TGNA 2HOTA 3LSIA 2K86A 3FMRA 4BH9A 1MNEA 2OTLI 2V79A 4CICA 1JTXA 1OMIA 4YEJA 1K4TA 2JN6A 2LG4A 2R0QC 4H0EA 2QSFX 3S3NA 4BY1J 1M1EB 1QQIA 1AA7A 1SFEA 3KP4A 4KIGA 3CC7I 3F6VA 1FOWA 4H4KC 1YHQI 1FJLA 2BVLA 5EYRA 4JP0A 2P5LC 4C9YA 4FISA 1OCRH 2BHYA 2HYGD 4YIFA 5FFZA 3H3UA 4RMNA 2D2WA 3KP6A 1X1BA 5L3FA 2EB7A 2E1MB 4AU7A 4UV8A 2G7HA 2QGUA 3I59A 3P7NA 4NUBA 3GEZA 5GAEJ 4V19K 1BC7C 3FK7A 5HLHA 3PIOF 4A3BJ 5C4JJ 1IDZA 1FC3A 3ZCOA 1YW9A 1MJAA 3WTYC 2K5CA 4E7JA 2CW7A 3GWZA 2FBHA 2CV1A 4XM3A 5FKOA 4P9UA 2M7AA 2P6TA 4E6KG 5F0HA 3KP2A 4YG2F 2V6EA 2W1OA 3DV8A 4M3BA 2FBKA 2QENA 2MC3A 4A3EJ 1JKPC 2VKVA 5H20A 2Y48A 3SYTA 2RQPA 1TQMA 3I59B 1T95A 2V1NA 4GDFA 3QAHA 3MWMA 3K4KA 1L0OC 1ZGJA 2DT7B 1R58A 2XAUA 2HU9A 4AWXB 1RZ4A 1ZYRF 4M9SA 2ZKZA 3S1MJ 3BCAA 1ZRDA 4LK1F 6PAXA 3CCQI 4QWQA 2O0YA 3BQYA 5E1ZB 2L9RA 1N25A 3IWFA 4HNUA 4BU2A 2IEKA 3KLNA 5KCMA 3HJEA 4HW0A 2NOJB 5F04A 2DDAA 4A0YA 4Z2YA 2MH2A 4OAZA 3MZHA 3ZMTA 5JVGF 2FA5A 3SFIA 1LFPA 1W7PD 3BJOA 5FD6A 1D0ZA 2XF5A 1ZREA 2XRNA 5FKNA 4LOCA 5EG0A 3VYSB 4EJUA 3FXJA 4XLPF 2GAUA 1F43A 2XSJC 4U0WA 3REOA 2Y9ZA 1YX3A 1LE8A 2LYCA 4N0BA 2M0CA 4F7ZA 5CVUA 2DODA 2QF7A 2COBA 4OIRF 3H5AA 1SFOJ 1R9TJ 2J5OA 3BTIA 1PVEA 3AG3H 2IS2A 3ZQHA 1XSDA 4G7OF 2QSHX 2M8EA 3WGGA 1W0TA 4HV5A 3QYFA 4L5IA 5GPCA 4N4OB 2KMUA 1WI9A 1VFCA 3A4CA 2HI3A 3JREA 4IHYA 4CCLA 5F27A 1R4NB 1DPUA 2GIZA 1QZEA 2KIMA 2Q1ZB 3BT9A 1X4OA 3F8NA 5EG0B 2VOPA 2XUBA 3GLXA 3L1PA 2X6OA 5D5VB 2MD0A 3JR9A 1LE8B 4LLNA 4X6AJ 5HNFA 2FX0A 4M6YA 2DFFA 3MKWB 3H35A 1XTAA 4RLQA 2IS6A 2XPWA 1W5TA 4A2UA 4E7KA 2M7BA 1ETOA 2JA2A 1XSXA 1W0UA 3SXYA 1K6YA 3SQNA 1T6SA 4Y33A 5LRRA 2EFWA 1D0XA 2STWA 2BXZA 2IAIA 4AYBN 2HVSA 2EV6A 5FLMJ 5FB2A 1XX5A 1P4XA 2GZWA 3BTJA 3OL4A 3JRDA 4HF1A 2XDVA 3HOVJ 2CUJA 2LR8A 1Z7LA 2DPUA 1JUPA 3WE3A 1LVKA 1T39A 3OYEA 1BI0A 3S14J 1FIAA 1MZBA 3ELKA 3G73A 2DMUA 1HBXG 1FX7A 3I9V2 4WCGA 1HCRA 3HKZA 3DXJF 4E7SA 1MMGA 4CCNA 2X1CA 4OMZA 3GZ6A 1QHGA 3CCVI 4KUMA 1B72A 3DKWA 2RAEA 3HBLA 1QNTA 3HYIA 1WWXA 1I27A 4RLFA 2CJJA 1Q1HA 3BZKA 3S2DJ 2W24A 1MD0A 1YYVA 4EQQA 3C1DA 3O8GA 1P6RA 1U9OA 4LLGF 3WTXC 4ZDLA 2P7CB 3D5SC 3GF2A 5IYCJ 1BOAA 2PN6A 2X4HA 1I50J 2IGMA 5IT3A 3PQJA 1ETQA 3RJPA 4DZPA 1J75A 2KDZA 1WJFA 3FXMA 3A0HC 2KIUA 1ETYA 3KETA 4P1WA 3R0AA 4OOIA 1HSTA 1SVLA 3OYAA 3F8CA 1Y1WJ 3TO7A 3PM1A 3LSHA 2L7FP 4G6DA 5B1BH 5D6EA 1PP8F 1DGWY 3KZIC 1Z3YA 4BUPA 3L2QA 1IW7F 1RPWA 4MEXF 3L2CA 4PJJA 2ID3A 4FETA 2EH3A 3D0SA 3VSKA 2R7OA 3I71A 3EUHA 1TLHB 5CVIA 2P5KA 1T56A 5FD5A 3G71I 1U6GA 3QPSA 3CUQC 2K7LA 5IYBJ 2BBYA 2DMPA 1TWAJ 1YOVB 4KISA 2NYXA 3ZXSA 2W82A 2PMZN 3PO2J 3HSFA 3D1NI 1FWZA 4MGRA 2XB0X 5DTDA 2YX4A 3FDYA 2X6WA 2OZ6A 3F8BA 4BYYA 4HBLA 2UXXA 3EETA 3R4KA 2CFOA 4JOMA 1X3ZB 5DYMA 3LOCA 3SJMA 3K4BA 3Q0WA 2Z3YA 1YW7A 2CMPA 2L7KA 3PSIA 3WU2C 3IKTA 2E7XA 4E7HA 2V1DA 4FHTA 3L00A 3OYBA 1YFHA 3DCFA 3FISA 2XV4S 3V8KA 2LBFA 3PIPF 4J00A 2BE5F 4P9FA 2DMNA 3DP7A 2LF8A 3IH3A 4N9IA 2KRCA 3KIOA 2RDPA 1FYMA 3GLLA 5TRDA 3ZN0A 5LHIA 3QU3A 4JBAA 3BR5A 5J6XA 1HW2A 3N4MA 1BC8C 1K79A 2PI0A 1VQLI 2LY9A 3BR1A 2DO7A 2F2EA 3J81K 4BDYA 3KYDB 4M3GA 4UUVA 2R7SA 4D7NA 3GXOA 4IX7A 1WH5A 2P5VA 2R5ZA 2A61A 5HS8A 2FBIA 3SHFA 4Y3OA 4KA4A 1EF4A 3A1YA 4IQ4A 2AXLA 4HQMA 4PK4A 1MNDA 2HPMA 3VYUB 3V8LA 1FP2A 1QGPA 3CJQB 4KICA 5KAIC 3E1SA 2DFIA 2DU9A 3I3LA 2O9LA 3HDDA 1FBSA 9ANTA 1ZHFA 3DKXA 4FTHA 1NTCA 1S8NA 1ZR2A 4FE4A 4N4NB 4ZZDA 2O3FA 3SZPA 5ERIA 2VC0A 2VBXA 3H36A 1TT5B 1B59A 3S2WA 3DTKA 4BQNA 2K9NA 1CQTA 2KDOA 2BZTA 3CCSI 2HOAA 4BS9A 3H0GJ 1IO2A 1EKEA 4L18B 4MFDA 3ESWB 2R5ZB 1P2FA 3ECHA 4MNUA 1UMQA 4BHPA 4X0GA 4AIHA 2L7ZA 1YI2I 2COMA 1RNLA 4MLOA 2Y0MA 5K1YA 1BR2A 4C30A 2MD5A 2YSRA 1AHDP 3MZYA 2DA4A 4CCOA 1CF7B 1PYVA 3JRHA 2RREA 3HZJA 1E2XA 5BS6A 5D8KB 1IZ1A 2IXSA 1WH7A 3AG2H 4P96A 4I0BA 5A2QZ 4ENNA 3WU1B 1YITI 1SFXA 1HLVA 2VE8A 4G7HF 3HB9A 1X58A 3DU5A 4AC0A 3ERMA 1IN8A 1VQKI 3C18A 2VKDA 4NQWA 2ZMEC 5D5WB 1S7AA 3SDBA 1TTYA 2KP6A 1O3QA 5M5YJ 4E4HA 2XPVA 2DLLA 1XD7A 1FZPB 4MHGA 4XRMA 2JT1A 2BOLA 1U78A 3RDIA 1ETWA 4BL0B 2JRTA 1J59A 2ZXHA 2R7UA 2MFZA 2ZFUA 3AG4H 2TDXA 3TDUC 5FKKA 2O8XA 1Z0XA 1DP7P 2DYRH 2TRTA 2VPRA 3V8JA 2WAEA 1TQIA 3BQZA 4BJTA 4V2FA 2JVGA 3M7GA 4PFPA 5E3OA 2DPDA 2EILH 4MQVA 4ASNA 1BJAA 1F9NA 2A05A 2VONA 2BY3A 2RV8A 2E1OA 4G8XA 5K5QA 3A01A 2LKXA 4HYEA 3M1CA 4DQ2A 4NQWB 3KEQA 5F08A 2O8KA 5CVVA 3O2PE 3TEDA 3MKYB 3RKXA 1ACIA 2HQ5A 1B1BA 4UY8I 3K10A 3LAPA 4BGDA 2RVCA 2DN0A 1I6HJ 4RAGA 3ZMDA 2JQ7A 1DPRA 1ODDA 2DT5A 4EJVA 3ZQGA 3AAFA 2ZFWA 3CCLI 4BEHA 3H5RA 3ZQQA 4ENJA 3FZVA 3F23A 2UZKA 3H9GA 1X2MA 4WXHA 1IG7A 3TBIA 2EJRA 2FMYA 4L0ZB 2HXOA 5J4VA 2NVTJ 2DI3A 4K2EA 3OS1A 3PL8A 1WRJA 2IS1A 1T98A 3QP5A 1IUFA 3EPZA 3A01B 1TNTA 3ABTA 1N78A 5ILUA 2Q0OA 3NEUA 1IXSB 1MJ9A 4ZYGA 3IRQA 5DV5A 4OIQF 5K7FA 3G2BA 3FXQA 3R0JA 1JT0A 4BXXJ 2B9SA 3WU0A 2NRAC 3M8EA 1EH6A 2BV6A 4FX0A 4YFXF 4RB3C 3HRTA 1S7EA 1HXDA 2KIFA 4O5VA 1K78A 3O8HA 1D8JA 2A5WA 4BEHB 1ZRCA 3BCBA 3S8PA 2H8RA 1JHHA 2XGCA 3FXOA 4A69C 2KISA 1T08B 3BPVA 3S3OA 4B8XA 1Z1DA 1GVDA 1AWCA 4ON0A 3NRVA 2BEOA 1FMVA 3DLLF 4L9TA 2A6EF 1V4RA 2K85A 2ZO4A 3IH4A 1LJ9A 4B48A 4OINF 2KJBA 3R60A 3OYIA 4HDUA 1UG0A 1N77A 1F1ZA 1X1PA 2VASA 2QEXI 1MBEA 1UJ8A 1ZQ3P 3FXRA 3GBGA 5DCMA 2VKEA 1RR8C 3QODA 1K78B 2QQBA 3Q3SA 4WXDA 4XSZF 2CV0A 5EGOA 2GLOA 3T0YA 2FE3A 4ZTJA 3JRCA 2KRFA 5IP6A 2VBWA 3AFHA 4PJNA 2OCCH 2M34A 3FMSA 4XRSA 3EDPA 3BR0A 1KU3A 3OR1C 3PUBA 1UELB 3OR2C 4CH7A 3P9KA 2I10A 1RRJA 3ZGKA 4MQ9F 3OYHA 3L2UA 4EATA 5DEQA 2WWYA 4IRHA 4U7BA 4Y4RA 2IVMA 3QWLA 2XF7A 3JAMZ 4PGGA 1Z67A 1IV6A 1ZG1A 2X9DA 3W3CA 3G6EI 1T8IA 3DBLB 2R7XA 2GOMA 5DCMB 2HQNA 1SEUA 1K4SA 4NHJA 2W48A 1O7LA 2WB1N 2ZB9A 4AUXA 4CDGA 2M45A 2HPIA 2L02A 5ILVA 4DNCA 1MH4A 2CS3A 1LPQA 1GXQA 3E6BA 4BKXA 5JHUA 1FOXA 1ZRFA 1J7KA 4B3AA 4BQQA 4M74A 4XLNF 1XGSA 1LNWA 2IP2A 3LQQA 1X1DA 3P9IA 1MMNA 2XAQA 1Y0UA 2AQFA 5CKTA 4OAYA 2H94A 2LNBA 1OPCA 2V9VA 2XB5A 2O61A 3ASNH 4I6ZA 1U5TA 4RS8A 2P8TA 2IJLA 3LQRA 5JR3A 4Y17A 1SD7A 3L9FA 2OPTA 1JGGA 3GUDA 1XMKA 4YFKF 3GTJJ 4RDUA 3PNTA 1V55H 2UWMA 1EA3A 1OYWA 2FUG2 3AL0C 4B1RA 1MBGA 2XHKA 2F5CA 1S3JA 1Z77A 3ONQA 4XONA 2NVQJ 4XLHA 1DDNA 3OYNA 2EPFA 4MO7A 3F21A 4B47A 2EK5A 3HOTA 4M73A 3LSMA 5IOZA 3K70C 3BG9A 1U5TB 5AONA 1TZLA 4ETSA 1KU7A 2VT3A 3G1OA 1VQ7I 2QQ9A 1GXPA 1HC8A 2BXYA 4CZCA 1LKXA 5F6FA 5M5XJ 1D1AA 3CDHA 2M4GA 2WADA 1HDDC 1Z21A 5J1UA 2NNNA 2GIVA 3VYRB 1VTNC 3FF5A 2K02A 3U9GA 2JTVA 2MBFA 2V6CA 4LB6B 2VT2A 1YIJI 5DD8A 1WJEA 2B0LA 1O3SA 2OF7A 2R7WA 2DQRA 4ZH4F 2F5FA 2A07F 3I58A 1HA8A 2EV5A 2FXAA 2IGNA 2OJED 3JTHA 2EZKA 2XASA 4L9NA 1TW3A 2A68F 2BYVE 4GGGA 3L2WA 1KYZA 2LF7A 2JRMA 5E8GA 2NOGA 2LKSA 4A6DA 5H2FC 2FU4A 5JHFA 4KMUX 1VQNI 3CJTB 4ITVA 1YQAA 1R5HA 1OYIA 2WBMA 3DBRB 3WGIA 1G4DA 2CQQA 2VN2A 1ERDA 3ULQB 5K7HA 3DTEA 3JTGA 3F22A 1VQ5I 4A3KJ 2KFDA 3SDGA 3HTUA 3A02A 3D5LA 5LFAA 4V2GA 1XGNA 1KONA 1IF1A 4UVBA 4CO8A 5J40A 2OD5A 1WQ2A 3BWGA 5LBQA 2HTJA 5TGTA 4ESBA 2FOWA 3KEOA 4AYBA 4IO9F 2M87A 1DQUA 3UNGC 2AHQA 3IUOA 1J9IA 3BROA 2QUFA 4KJZA 5F1JA 3CCUI 1BA5A 3O6BB 4HV6A 3KZZA 3CJNA 1UHSA 5FROA 3KYLA 4OWRB 2VJ5A 3G3ZA 2LMDA 2DTZA 5LLQA 1W36D 4PJ0C 4CCJA 3OYJA 1VNDA 1NK2P 2UXNA 2Y69H 3EQLF 5FO5A 3T8RA 1UZCA 1Z05A 1FPQA 2YUSA 1RIOH 4BHBA 2F4IA 3TP0A 4C2TA 1T38A 2OA4A 3ERED 3MQ0A 5E3NA 1EH7A 2EFOA 4RM2A 2R7TA 2XAFA 1KZHA 5E8IA 3VFZA 3AG1H 3HM5A 2CFXA 1Z9CA 3K0LA 3QP6A 4G94A 1G3TA 4HLYA 3RCOA 4CXFA 1QZZA 2R7VA 4A5MA 3FMQA 4C3IJ 2HDWA 2R7DA 4LG3A 3RQ4A 3Q5FA 1K6OA 4BQOA 4R8HA 2E71A 3KCCA 4NBQA 1IN7A 1IRZA 3Q9VA 4Y15A 2MA3A 4HNTA 1LDKB 4A3GJ 2D5VA 1ON2A 1ZLJA 3DLAA 4NC6A 2K9LA 5LGUA 3BG5A 2WY7Q 1KU9A 1ON1A 2ZXJA 4UXNA 1S9HA 4A3FJ 5GTHC 1E17A 2GM4A 3EUAA 2XAJA 3ZQIA 1ZN2A 2PBIA 5KAFC 2IA1A 4XKCA 3KEYA 3M9AA 1H0MA 2NS7A 2VODA 1EV7A 1MMDA 2DOFA 4YRVA 4S04A 3ZP5A 1B9NA 3HPHA 2DMQA 1STZA 1YJWI 2PMZA 2NVXJ 3JRAA 3SEZA 3RKWA 2ZNZA 1K83J 2YU3A 5F0CA 2ZJPF 2PG4A 1ZAOA 3HRUA 1Z91A 5IT9K 5K5OA 4CSWA 2OBPA 5J47A 4IHXA 1Z7UA 3TOBA 1U0JA 3BJAA 5CLSA 5LGNA 2O5RA 2MLKA 3CQZJ 2MH9A 4NC8A 3ZMUA 3E6MA 2FQ4A 4S0HB 4G6TB 2Y31A 4HG2A 3BOQA 2PEXA 3WTUC 1K61A 1KGSA 2Z16A 3EYIA 4Q47A 1R1UA 2Y2ZA 1MNMC 1YJNI 2DA7A 3GW2A 3ZQFA 2ZSHB 1JE8A 3ABKH 1MSFC 2R7ZJ 1B8IA 2VQGA 1XGOA 2HYFA 2PMUA 5IP7J 1E3PA 4YFNF 1GV5A 2VJJA 2W85A 3RKQA 2NNYA 3MKZA 2K3PA 1B9MA 4ZYAA 4IQJA 4F55A 4P55A 2F5DA 1VI0A 3CP8A 3HRSA 4II2A 4U88A 2JA7J 3BZCA 2VJ4A 3OYMA 3G4SI 1HKQA 4UHTA 1ZGWA 2F4MB 2Z2SB 1I1GA 3FHZA 2HWVA 2K40A 2DQLA 4M71A 4PZJA 4EVIA 3K7AJ 1BJZA 2YX7A 4XK4A 3CCRI 4AIKA 1LVAA 3BR6A 1HOMA 1B8IB 1YG2A 1KQ9A 1TBXA 3TO9A 4B44A 2BY0A 1FNNA 3ISPA 2JZYA 4O3MA 1XN7A 1OR7A 2LK2A 3GTPJ 3FBIB 2IA0A 1SC7A 3J7YJ 2YU9J 4O6JA 1WCMJ 3ABUA 2CU7A 3K6GA 4A3DJ 4RB0A 5F64A 4YIRX 2Q8KA 1MJBA 3I54A 3CTAA 3DQVC 1XB4A 1XDSA 3S17J 3EUKL 4A93J 2KZVA 3RI4A 4UUSA 1FOKA 1SD5A 1T0FC 3K4NA 3RTRA 5E1WA 2XSDC 3F3XA 2ZNYA 5HDGA 1RUOA 2X48A 2IRFG 5FLXK 1ORKA 3PO3J 1VQPI 3K2ZA 4ZYHA 1J5YA 5CVRA 1JGSA 3BY6A 4D1QA 4KDPA 3J80K 4M3FA 5DUKA 3A0BC 4N9HA 1OFCX 2FNAA 1G3WA 4NC7A 1XMAA 4XIDA 1Y6IA 2JSCA 1MBHA 1IXCA 3HSRA 2MABA 3LWFA 3CO6C 5GAGJ 1FTTA 3IKVA 5HNHA 2X1DA 4C2MJ 1NG6A 1WI3A 3MN2A 2CQNA 4UNOA 3CF5F 3K70D 4UUSB 2E5NA 3C7JA 3U21A 4D0PA 4XRSG 3K2AA 2BGCA 1JXSA 4DOZA 4M9XA 4DYCA 4QLCU 3I5UA 4HX8A 2EIKH 4HEA2 1NHAA 2K9SA 1Q1VA 3HUGA 3WTTC 5J4YA 1U9NA 1FT9A 4BJ6C 3BLYA 3IL2A 3H1CA 2E35A 4IPAA 1OCCH 5HLTA 4A6EA 1OCOH 1USSA 1EH8A 3KLOA 4XMYA 5CYVA 4KITB 4PJMA 2G0EA 3J7AO 4GFBA 3LSRA 3RPUA 4KT5C 3K9TA 3I4NJ 2FRHA 2ADUA 2HVQA 4PSXA 4HZFA 4GRIA 1J0RA 2QM3A 5DM6F 3K1NA 4RAFA 3N05A 2KKOA 4FT8A 2VQCA 5J8CA 2Y0SA 3HUGB 3OWTA 4XKWA 1ULYA 3N97A 1W5SA 4LMYA 4AM3A 4EEFG 4HF0A 4ZZLA 3E7LA 2V1UA 1D1CA 4B4CA 3W2VA 4B09A 3QRFF 4LFUA 3DBHB 4XNFA 2X0LA 2FJ1A 4BQAA 5EEAA 2A6TA 1CF7A 2MG4A 5IYDJ 1RC9A 1AKHA 1TQPA 3BG7A 4AIJA 2V4JC 4IHWA 1XS9A 5CQGA 4F93B 1MBKA 4EJOA 4MTDA 3F9KA 1WFXA 4WF2A 5EJCA 3FWEA 2A6HF 2CWEA 3S3MA 2LOOA 4L5JA 4EJWA 1B6AA 3JSOA 1NK3P 3B02A 3ZR8X 3CC2I 1YX5A 4YIIA 3G1LA 4CHUA 2RN7A 4HNVA 4KIBA 2OU2A 2R3SA 1USTA 1RR7A 2PX9A 5LHHA 4KNYA 1O7FA 2CG4A 4HX4A 3PNVA 4BACA 3F6OA 2PJPA 2PJRA 2DOEA 1FMWA 3HHHA 3IC7A 3OY9A 5FRNA 1TWFJ 1JT6A 2RNJA 4WXCA 2A69F 2L0KA 1APLC 2D45A 3H0DA 3E6CC 4D5CA 4JYKA 4CCKA 1AKHB 3LL7A 1QPIA 2L2OA 2RQQA 1OISA 5DCFA 4HQEA 3GTKJ 4RA2A 5HDKA 5K5RA 3J81Z 2EZHA 2JWTA 1MBFA 2CUEA 1R5ID 3RKYA 2XKPA 3M3YJ 1ZR4A 4IXAA 3J7ZI 2XIGA 1G3YA 1DU6A 1QVUA 4BY7J 2V9PA 2PJRB 3E97A 2TCTA 5C3EJ 2P0WA 4LD5A 2R5YA 4A0XA 2CGPA 1QRYA 2VQLA 2ESNA 5BOXA 2DYSH 1BI2A 2H6BA 2GBYA 3CP2A 3S32A 4OU0A 1QZYA 4YELA 4BHCA 4XKBA 3HL2A 2K3FA 1D3YA
chains in the Genus database with same CATH topology
4KYWA 3HTSB 1IXRC 4R1HA 5CVJA 1MDMA 2J5PA 1UHMA 4RB1A 2FQ3A 1LDJA 4MTEA 1S7OA 1XDUA 2ISZA 1IAWA 3BZ6A 3JSPA 5LGTA 1GHCA 3V7RA 3MCZA 5ICEA 1JHFA 3KP3A 1MDMB 1HW5A 1H9TA 5D4SA 4I02A 2EA2A 3K1PA 3M8FA 4IHSA 3GO5A 2GXBA 2HDCA 3CO7C 3FX3A 1IN5A 2H09A 4MEYF 1X3UA 1O3TA 4EMSA 2C6YA 2VBZA 3E6DA 1UHWA 1FYLA 2VXZA 4UV9A 3CUQA 3DF8A 1BI3A 1R1TA 5LEKA 2LKPA 4RB2C 1ZGAA 5JI6A 5BMZA 1D5VA 2Z5UA 5HOOA 3QPHA 3TO6A 2HGCA 3U1DA 2G9WA 4RAYA 4KIFA 4EM1A 3CUQB 1C0WA 4UVCA 2QZ8A 2HKXA 4RGSA 4HOBA 4RAZA 1HKSA 2XROA 4IF4A 3PQKA 2QYOA 3HRMA 4KN4X 1YIOA 2KJCA 2ESHA 2ISYA 2HEOA 4EJTA 3CUOA 4A0ZA 2HKOA 1O57A 2QBYA 2ZCWA 1ZG5A 3DPTA 5BPDA 1P4WA 1FLIA 2P6SA 5LEJA 3KZYA 5L3BA 5FGMA 5HDNA 2QBYB 1GVJA 4RGXA 3VB2A 1J2XA 2Y75A 3TOAA 3SZTA 3F8FA 1A04A 1XCBA 2QQAA 5ICCA 4Y13A 2ZMEA 3GFJA 5FFXA 2XVCA 2ACJA 2PFBA 2RGVA 2NS0A 5H6QA 4I09A 2R7FA 5HLIA 2WTEA 3ECOA 1PP7U 4NB5A 3NQOA 2VE9A 2QWWA 1G6NA 2M5WA 4BAYA 2STTA 4TV7A 2ZMEB 3Q9SA 2HZTA 4LJZF 4PDKA 1R23A 1W4MA 2W57A 1I6XA 3K69A 4EGYA 1ZG3A 1PDNC 1YTYA 3KFWX 1UB9A 2PMHA 2NAZA 3T5XA 5CJ9A 1RUNA 1S29A 3FXUA 5ICFA 1W7PA 2D1VA 3BP8A 3LA3A 5ED4A 1HKTA 3V4GA 4U0VA 2JPCA 2YR2A 1YS6A 3PFIA 3JW4A 3H3ZA 5HS9A 4XRFA 1W7PB 2Z99A 2JPBA 1QBJA 2OAZA 2PLYA 1R7JA 4L0YB 2EA4A 3FM3A 1I1SA 1FSEA 3QU6A 3ZMZA 4GYIA 2IA2A 3L09A 5L3EA 1R00A 1S6LA 3T1BA 3WTWC 2L4MA 3F8MA 2WC2A 1MGTA 4ESJA 1XCVA 2Z9OA 2DBBA 1YS7A 1SMTA 3GFMA 3V7CA 4Q4ZF 5BPIA 1QPMA 4P5OA 5E17F 3IWZA 2A3SA 3ROUA 1HSJA 3I64A 3WGHA 3R6SA 4S05A 4M72A 1YLFA 1V3FA 2HOEA 2D1HA 1PUEE 2CSOA 2DTRA 2GQQA 2LSOA 1K7AA 5AIQA 3FM5A 4HX7A 2YPRA 3WG9A 2PQ8A 4XSXF 5JFRA 3GFIA 4CGZA 2M30A 3L7WA 1YW8A 2L54A 2FOKA 2FF4A 2CW0F 3R61A 3CLOA 2A5YB 3HSEA 1XSVA 4WK8F 3P9CA 1UFMA 3LSTA 5F1RA 3IRRA 4Q5SF 2GWRA 3WODF 5DD4A 3DFGA 4KN7X 5L3GA 1MKMA 3TQNA 3W6JB 2K4BA 5IT9Z 4AD9A 4I0AA 4U0YA 2IT0A 2XGXA 3RYRA 2P4WA 1LDDA 4XBFA 3W6KB 1KQ8A 3EYYA 4GO1A 3TDZC 2E1NA 2VBYA 1REPC 5E1XA 4PCQA 1Z6RA 4IRGA 3I53A 3TKYA 5KVRA 3OOPA 3VODA 2W25A 1TW2A 4IJAA 5D5UB 3I0TA 4LK0F 1FSHA 4EGZA 3HHGA 1SFUA 2QLZA 5LRSA 3VEPA 2GA2A 4LGWA 1KQ0A 5HLGA 3DEUA 1FYKA 4RGUA 2P7VB 3KP7A 4EM0B 4U7DA 4L9JA 3LAJA 4G6QA 4RGRA 4KMFA 5D5XB 1BBYA 1ZARA 4CZZA 5LHGA 2XAHA 2W84A 2Z33A 3M1EA 2FNPA 3RPQA 3I4PA 5E20A 1BN5A 1P92A 4GYGA 2EV0A 5FLXZ 4HAMA 2H27A 2HFHA 5ILSA 2K4JA 1ZLKA 4EM2A 2L01A 2LDUA 3J80Z 5D4RA 4PGHA 1SD4A 3RIRA 1KYWA 4E70A 4LB5A 3GZ5A 1FY7A 4HF2A 1KA8A 1IUYA 3MAJA 1LQ1A 5A2QK 2GXGA 5D6FA 2DK5A 4G7ZF 4A12A 3MEXA 3QPTA 3BJ6A 1LEBA 4I01A 4KFCA 1BM9A 4IVNA 2DAOA 5D8LB 2WV0A 2F5EA 2EFPA 3C3WA 2XKOA 3IHUA 2ETHA 3V7SA 4Q48A 1WKMA 4WX9A 3LA7A 1Z6TA 2EFNA 1BIBA 1U5TC 2CYYA 3T8TA 4I2OA 4L9VA 1H9GA 5HS7A 4EV0A 3ZPLA 1QO0D 2MLGA 3LA2A 5KK1A 2ELHA 1WSUA 2O03A 4LLLA 2ZJ2A 2EFQA 1KU2A 3H92A 3KP5A 5EEHA 4CYDA 3HIFA 3VOEA 2FMLA 1TNSA 1L3LA 4GXOA 2Q2EA 4ZYDA 1OKRA 4I7HA 4LG0A 1AOYA 3RYPA 4ENKA 4JQFA 3QOPA 2L3DA 1LEAA 1T0FA 4ESFA 1F4KA 1R5GA 3GYHX 3E5XA 2QVOA 3KE2A 2L4AA 1U3EM 4G9YA 4ENMA 1BI1A 4I98B 5L3DA 4A5NA 4LG0B 3GVAA 3JAMK 2FEZA 2OQGA 2K27A 4IRIA 5EEGA 1SMYF 2IPQX 5AIPA 2VOOA 2VC1A 4HA8A 1IRGA 5JVTA 2V1XA 1LB2A 1B4AA 2AS5F 4OMYA 4M9ZA 4JK1X 1CGPA 3GFLA 3COAC 4OIPF 2XAGA 3BDDA 3ZQ7A 1SD6A 5HVQC 4UVAA 5TJJA 1XGMA 4R79A 3HOSA 2FSWA 1ZH5A 2HS5A 3WTVC 3E3VA 4GCVA 3K1MA 3DPLC 1DUXC 3E5UA 3MFKA 3F72A 4AVPA 1U8RA 3ZN1A 2ZBKA 3OV8A 2CO5A 4WWCA 1I5ZA 5DUIA 2CQKA 1FP1D 3B73A 3ZMVA 2OQRA 3WTZA 1RI7A 3BPXA 5L3CA 2EWNA 2H6CA 1SAXA 2OZUA 1F5TA 1IRFA 3WTSC 1D8KA 4M6XA 5BQTA 1G3SA 3SFZA 1R22A 4FX4A 3LFKA 1ONVA 2E1CA 2M1BA 3E5QA 1FBQA 2HQRA 5H6RA 4HLXA 2RC4A 3ML6A 2E7WA 5E18F 1HW1A 1P4AA 1U2WA 4ZYEA 4BNCA 4IHTA 1UCRA 2G7UA 2DW4A 2O6GE 1BIAA 4BXUA 2HTSA 1HQCA 5ICGA 3WE2A 2DK8A 1YO5C 1FBUA 1R36A 4HDVA 3O3KA 3ZMSA 2GA1A 1IN4A 5J8FA 3U2RA 3GX4X 1R1VA 1T2KA 1IN6A 1O3RA 1OYYA 5DDGA 2IW5A 4OIOF 2RKHA 2HR3A 3TGNA 2K86A 3FMRA 4BH9A 2V79A 4CICA 1OMIA 4H0EA 1SFEA 1QQIA 4KIGA 3KP4A 3F6VA 2P5LC 2HYGD 4YIFA 5FFZA 3H3UA 2D2WA 3KP6A 5L3FA 2EB7A 4UV8A 2G7HA 3I59A 3P7NA 3GEZA 1BC7C 5HLHA 1FC3A 1YW9A 1MJAA 3WTYC 3GWZA 2FBHA 4P9UA 2P6TA 3KP2A 4YG2F 3DV8A 2FBKA 2QENA 2MC3A 5H20A 2Y48A 2RQPA 1TQMA 3I59B 3QAHA 3MWMA 1L0OC 1ZGJA 1R58A 4AWXB 1RZ4A 1ZYRF 4M9SA 2ZKZA 1ZRDA 4LK1F 6PAXA 4QWQA 2O0YA 5E1ZB 3IWFA 3KLNA 4HW0A 4A0YA 4Z2YA 2MH2A 3MZHA 3ZMTA 2FA5A 1W7PD 3BJOA 5FD6A 1ZREA 2XRNA 4EJUA 4XLPF 2GAUA 4U0WA 3REOA 4N0BA 4F7ZA 5CVUA 4OIRF 2J5OA 1XSDA 4G7OF 2M8EA 3WGGA 4HV5A 4L5IA 1WI9A 1DPUA 2KIMA 3F8NA 2VOPA 2XUBA 3GLXA 5D5VB 4LLNA 4M6YA 1W5TA 4A2UA 1XSXA 3SXYA 3SQNA 1T6SA 5LRRA 2EFWA 2STWA 2EV6A 5FB2A 1P4XA 2GZWA 4HF1A 2DPUA 3WE3A 1T39A 1BI0A 1MZBA 3ELKA 3G73A 1HBXG 1FX7A 4WCGA 3DXJF 4OMZA 3GZ6A 4KUMA 3DKWA 1QNTA 3HYIA 1WWXA 1I27A 1Q1HA 2W24A 1MD0A 1YYVA 4EQQA 3C1DA 1P6RA 4LLGF 3WTXC 2P7CB 3GF2A 1BOAA 2PN6A 2X4HA 5IT3A 3PQJA 3RJPA 1J75A 2KIUA 3KETA 3R0AA 4OOIA 1HSTA 3F8CA 3TO7A 4G6DA 5D6EA 1PP8F 1IW7F 4MEXF 3L2CA 3D0SA 3I71A 3EUHA 1TLHB 5CVIA 2P5KA 5FD5A 1U6GA 3CUQC 2K7LA 2BBYA 2NYXA 3HSFA 1FWZA 4MGRA 2YX4A 2OZ6A 3F8BA 4BYYA 4HBLA 2UXXA 3EETA 3R4KA 5DYMA 2Z3YA 1YW7A 3IKTA 2E7XA 2V1DA 4FHTA 3L00A 1YFHA 2XV4S 3V8KA 2BE5F 4P9FA 3DP7A 2LF8A 4N9IA 2RDPA 1FYMA 5TRDA 3ZN0A 5LHIA 3QU3A 4JBAA 5J6XA 1HW2A 3N4MA 1BC8C 1K79A 2PI0A 2DO7A 2F2EA 3J81K 4UUVA 3GXOA 2P5VA 2A61A 5HS8A 2FBIA 3SHFA 4KA4A 2AXLA 4HQMA 3V8LA 1FP2A 1QGPA 4KICA 2DFIA 2DU9A 1FBSA 1ZHFA 1S8NA 4ZZDA 2O3FA 3SZPA 5ERIA 2VC0A 2VBXA 1B59A 3S2WA 4L18B 1P2FA 3ECHA 4MNUA 4BHPA 4AIHA 2COMA 1RNLA 2Y0MA 5K1YA 2MD5A 2YSRA 3MZYA 1CF7B 1E2XA 5BS6A 5D8KB 1IZ1A 4P96A 4I0BA 5A2QZ 4ENNA 3WU1B 1SFXA 2VE8A 4G7HF 1IN8A 3C18A 4NQWA 5D5WB 1S7AA 1TTYA 1O3QA 2DLLA 1XD7A 1FZPB 4MHGA 2JT1A 1U78A 3RDIA 2JRTA 1J59A 3TDUC 2TDXA 2O8XA 1DP7P 3V8JA 1TQIA 3M7GA 2DPDA 4MQVA 4ASNA 1BJAA 1F9NA 2VONA 2RV8A 4G8XA 5K5QA 4HYEA 4DQ2A 3KEQA 5CVVA 3O2PE 3RKXA 1B1BA 3LAPA 2RVCA 3ZMDA 1DPRA 1ODDA 2DT5A 4EJVA 3AAFA 2ZFWA 4ENJA 3FZVA 3F23A 2UZKA 4WXHA 2EJRA 2FMYA 4L0ZB 2DI3A 4K2EA 1WRJA 1T98A 3QP5A 1TNTA 3ABTA 5ILUA 2Q0OA 3NEUA 3IRQA 1IXSB 1MJ9A 4ZYGA 5DV5A 4OIQF 3FXQA 3R0JA 3WU0A 2NRAC 3M8EA 1EH6A 2BV6A 4FX0A 4YFXF 4RB3C 3HRTA 1HXDA 2KIFA 4O5VA 1K78A 1D8JA 1ZRCA 1JHHA 3BPVA 1AWCA 4B8XA 1Z1DA 4ON0A 3NRVA 2BEOA 4L9TA 2A6EF 1V4RA 2ZO4A 1LJ9A 4OINF 2KJBA 3R60A 4HDUA 1F1ZA 3FXRA 5DCMA 1K78B 2QQBA 4WXDA 4XSZF 3T0YA 2FE3A 2KRFA 2VBWA 3FMSA 3EDPA 1KU3A 3P9KA 4MQ9F 5DEQA 2WWYA 4IRHA 4U7BA 2IVMA 3JAMZ 4PGGA 1ZG1A 5DCMB 2HQNA 4NHJA 1O7LA 4CDGA 2M45A 2L02A 5ILVA 4DNCA 3E6BA 5JHUA 1GXQA 1ZRFA 1J7KA 4M74A 4XLNF 1XGSA 1LNWA 2IP2A 3LQQA 3P9IA 2XAQA 1Y0UA 2H94A 2LNBA 1OPCA 2V9VA 2O61A 1U5TA 4RS8A 2P8TA 2IJLA 3LQRA 5JR3A 4Y17A 1SD7A 3L9FA 3GUDA 1XMKA 4YFKF 2UWMA 1OYWA 2XHKA 2F5CA 1S3JA 1DDNA 3F21A 2EK5A 3HOTA 4M73A 1U5TB 5AONA 4ETSA 1KU7A 2VT3A 2QQ9A 1GXPA 5F6FA 3CDHA 2NNNA 2GIVA 1VTNC 3FF5A 2K02A 3U9GA 2JTVA 2MBFA 2V6CA 4LB6B 2VT2A 5DD8A 2B0LA 1O3SA 2DQRA 4ZH4F 2F5FA 2A07F 3I58A 2EV5A 2FXAA 3JTHA 2XASA 4L9NA 1TW3A 2A68F 2BYVE 4GGGA 1KYZA 2LF7A 5E8GA 4A6DA 2FU4A 4KMUX 1YQAA 1R5HA 1OYIA 3WGIA 1G4DA 2VN2A 3ULQB 3JTGA 3F22A 3HTUA 3D5LA 1XGNA 1IF1A 4UVBA 4CO8A 2OD5A 1WQ2A 3BWGA 5LBQA 2HTJA 4ESBA 3KEOA 2M87A 1J9IA 3BROA 2QUFA 3O6BB 4HV6A 3KZZA 3CJNA 3G3ZA 5LLQA 2UXNA 3EQLF 5FO5A 3T8RA 1Z05A 1FPQA 1RIOH 4BHBA 1T38A 2OA4A 3ERED 3MQ0A 1EH7A 2EFOA 2XAFA 5E8IA 3VFZA 1Z9CA 2CFXA 3K0LA 3QP6A 4G94A 1G3TA 4HLYA 4CXFA 1QZZA 4A5MA 3FMQA 2R7DA 3Q5FA 1K6OA 4R8HA 3KCCA 1IN7A 3Q9VA 4Y15A 2MA3A 1LDKB 1ON2A 1ZLJA 5LGUA 1KU9A 1ON1A 2ZXJA 4UXNA 1E17A 2XAJA 1ZN2A 2PBIA 2IA1A 3M9AA 1H0MA 2VODA 1EV7A 4S04A 3ZP5A 1B9NA 1STZA 3RKWA 2ZNZA 2YU3A 2PG4A 1ZAOA 3HRUA 1Z91A 5IT9K 5K5OA 2OBPA 1Z7UA 3TOBA 3BJAA 5CLSA 5LGNA 2MLKA 2MH9A 3ZMUA 3E6MA 3BOQA 2PEXA 3WTUC 1KGSA 3EYIA 4Q47A 1R1UA 3GW2A 1JE8A 1XGOA 2HYFA 2PMUA 4YFNF 2W85A 2NNYA 1B9MA 4P55A 2F5DA 3HRSA 4U88A 1HKQA 4UHTA 1I1GA 3FHZA 2HWVA 2DQLA 4M71A 4PZJA 4EVIA 2YX7A 4AIKA 1LVAA 1YG2A 1KQ9A 1TBXA 3TO9A 1FNNA 3ISPA 2JZYA 4O3MA 1XN7A 1OR7A 2IA0A 4O6JA 3ABUA 4RB0A 5F64A 2Q8KA 1MJBA 3I54A 3CTAA 3DQVC 1XB4A 1XDSA 3RI4A 1FOKA 1SD5A 3RTRA 5E1WA 3F3XA 2ZNYA 5HDGA 1RUOA 2IRFG 5FLXK 3K2ZA 4ZYHA 1J5YA 5CVRA 1JGSA 3BY6A 4KDPA 3J80K 5DUKA 4N9HA 2FNAA 1G3WA 1XMAA 2JSCA 1IXCA 3HSRA 3LWFA 3CO6C 3IKVA 4UNOA 3C7JA 4D0PA 2BGCA 1JXSA 4M9XA 4QLCU 3I5UA 4HX8A 1NHAA 3HUGA 3WTTC 1FT9A 3IL2A 4IPAA 4A6EA 1USSA 1EH8A 3KLOA 5CYVA 3J7AO 3RPUA 4KT5C 3K9TA 2FRHA 2ADUA 4HZFA 1J0RA 2QM3A 3K1NA 4FT8A 2KKOA 5J8CA 3N97A 1ULYA 1W5SA 4LMYA 4ZZLA 4HF0A 2V1UA 4B09A 3QRFF 4LFUA 2X0LA 4BQAA 1CF7A 1TQPA 4AIJA 4EJOA 4MTDA 4WF2A 3FWEA 2A6HF 2CWEA 4EJWA 4L5JA 3JSOA 1B6AA 3B02A 4YIIA 4CHUA 2RN7A 4KIBA 2OU2A 1USTA 2R3SA 4KNYA 5LHHA 1O7FA 2CG4A 4HX4A 2PJPA 3F6OA 3HHHA 3IC7A 2RNJA 4WXCA 2A69F 2D45A 3E6CC 5DCFA 4HQEA 5HDKA 5K5RA 3J81Z 3RKYA 2XKPA 4IXAA 2XIGA 1G3YA 3E97A 4LD5A 4A0XA 2CGPA 2ESNA 5BOXA 1BI2A 2H6BA 4OU0A 1QZYA 4BHCA 1D3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYW A;  3HTS B;  1IXR C;  4R1H A;  5CVJ A;  1MDM A;  2J5P A;  1UHM A;  4RB1 A;  2FQ3 A;  1LDJ A;  4MTE A;  1S7O A;  1XDU A;  2ISZ A;  1IAW A;  3BZ6 A;  3JSP A;  5LGT A;  1GHC A;  3V7R A;  3MCZ A;  5ICE A;  1JHF A;  3KP3 A;  1MDM B;  1HW5 A;  1H9T A;  5D4S A;  4I02 A;  2EA2 A;  3K1P A;  3M8F A;  4IHS A;  3GO5 A;  2GXB A;  2HDC A;  3CO7 C;  3FX3 A;  1IN5 A;  2H09 A;  4MEY F;  1X3U A;  1O3T A;  4EMS A;  2C6Y A;  2VBZ A;  3E6D A;  1UHW A;  1FYL A;  2VXZ A;  4UV9 A;  3CUQ A;  3DF8 A;  1BI3 A;  1R1T A;  5LEK A;  2LKP A;  4RB2 C;  1ZGA A;  5JI6 A;  5BMZ A;  1D5V A;  2Z5U A;  5HOO A;  3QPH A;  3TO6 A;  2HGC A;  3U1D A;  2G9W A;  4RAY A;  4KIF A;  4EM1 A;  3CUQ B;  1C0W A;  4UVC A;  2QZ8 A;  2HKX A;  4RGS A;  4HOB A;  4RAZ A;  1HKS A;  2XRO A;  4IF4 A;  3PQK A;  2QYO A;  3HRM A;  4KN4 X;  1YIO A;  2KJC A;  2ESH A;  2ISY A;  2HEO A;  4EJT A;  3CUO A;  4A0Z A;  2HKO A;  1O57 A;  2QBY A;  2ZCW A;  1ZG5 A;  3DPT A;  5BPD A;  1P4W A;  1FLI A;  2P6S A;  5LEJ A;  3KZY A;  5L3B A;  5FGM A;  5HDN A;  2QBY B;  1GVJ A;  4RGX A;  3VB2 A;  1J2X A;  2Y75 A;  3TOA A;  3SZT A;  3F8F A;  1A04 A;  1XCB A;  2QQA A;  5ICC A;  4Y13 A;  2ZME A;  3GFJ A;  5FFX A;  2XVC A;  2ACJ A;  2PFB A;  2RGV A;  2NS0 A;  5H6Q A;  4I09 A;  2R7F A;  5HLI A;  2WTE A;  3ECO A;  1PP7 U;  4NB5 A;  3NQO A;  2VE9 A;  2QWW A;  1G6N A;  2M5W A;  4BAY A;  2STT A;  4TV7 A;  2ZME B;  3Q9S A;  2HZT A;  4LJZ F;  4PDK A;  1R23 A;  1W4M A;  2W57 A;  1I6X A;  3K69 A;  4EGY A;  1ZG3 A;  1PDN C;  1YTY A;  3KFW X;  1UB9 A;  2PMH A;  2NAZ A;  3T5X A;  5CJ9 A;  1RUN A;  1S29 A;  3FXU A;  5ICF A;  1W7P A;  2D1V A;  3BP8 A;  3LA3 A;  5ED4 A;  1HKT A;  3V4G A;  4U0V A;  2JPC A;  2YR2 A;  1YS6 A;  3PFI A;  3JW4 A;  3H3Z A;  5HS9 A;  4XRF A;  1W7P B;  2Z99 A;  2JPB A;  1QBJ A;  2OAZ A;  2PLY A;  1R7J A;  4L0Y B;  2EA4 A;  3FM3 A;  1I1S A;  1FSE A;  3QU6 A;  3ZMZ A;  4GYI A;  2IA2 A;  3L09 A;  5L3E A;  1R00 A;  1S6L A;  3T1B A;  3WTW C;  2L4M A;  3F8M A;  2WC2 A;  1MGT A;  4ESJ A;  1XCV A;  2Z9O A;  2DBB A;  1YS7 A;  1SMT A;  3GFM A;  3V7C A;  4Q4Z F;  5BPI A;  1QPM A;  4P5O A;  5E17 F;  3IWZ A;  2A3S A;  3ROU A;  1HSJ A;  3I64 A;  3WGH A;  3R6S A;  4S05 A;  4M72 A;  1YLF A;  1V3F A;  2HOE A;  2D1H A;  1PUE E;  2CSO A;  2DTR A;  2GQQ A;  2LSO A;  1K7A A;  5AIQ A;  3FM5 A;  4HX7 A;  2YPR A;  3WG9 A;  2PQ8 A;  4XSX F;  5JFR A;  3GFI A;  4CGZ A;  2M30 A;  3L7W A;  1YW8 A;  2L54 A;  2FOK A;  2FF4 A;  2CW0 F;  3R61 A;  3CLO A;  2A5Y B;  3HSE A;  1XSV A;  4WK8 F;  3P9C A;  1UFM A;  3LST A;  5F1R A;  3IRR A;  4Q5S F;  2GWR A;  3WOD F;  5DD4 A;  3DFG A;  4KN7 X;  5L3G A;  1MKM A;  3TQN A;  3W6J B;  2K4B A;  5IT9 Z;  4AD9 A;  4I0A A;  4U0Y A;  2IT0 A;  2XGX A;  3RYR A;  2P4W A;  1LDD A;  4XBF A;  3W6K B;  1KQ8 A;  3EYY A;  4GO1 A;  3TDZ C;  2E1N A;  2VBY A;  1REP C;  5E1X A;  4PCQ A;  1Z6R A;  4IRG A;  3I53 A;  3TKY A;  5KVR A;  3OOP A;  3VOD A;  2W25 A;  1TW2 A;  4IJA A;  5D5U B;  3I0T A;  4LK0 F;  1FSH A;  4EGZ A;  3HHG A;  1SFU A;  2QLZ A;  5LRS A;  3VEP A;  2GA2 A;  4LGW A;  1KQ0 A;  5HLG A;  3DEU A;  1FYK A;  4RGU A;  2P7V B;  3KP7 A;  4EM0 B;  4U7D A;  4L9J A;  3LAJ A;  4G6Q A;  4RGR A;  4KMF A;  5D5X B;  1BBY A;  1ZAR A;  4CZZ A;  5LHG A;  2XAH A;  2W84 A;  2Z33 A;  3M1E A;  2FNP A;  3RPQ A;  3I4P A;  5E20 A;  1BN5 A;  1P92 A;  4GYG A;  2EV0 A;  5FLX Z;  4HAM A;  2H27 A;  2HFH A;  5ILS A;  2K4J A;  1ZLK A;  4EM2 A;  2L01 A;  2LDU A;  3J80 Z;  5D4R A;  4PGH A;  1SD4 A;  3RIR A;  1KYW A;  4E70 A;  4LB5 A;  3GZ5 A;  1FY7 A;  4HF2 A;  1KA8 A;  1IUY A;  3MAJ A;  1LQ1 A;  5A2Q K;  2GXG A;  5D6F A;  2DK5 A;  4G7Z F;  4A12 A;  3MEX A;  3QPT A;  3BJ6 A;  1LEB A;  4I01 A;  4KFC A;  1BM9 A;  4IVN A;  2DAO A;  5D8L B;  2WV0 A;  2F5E A;  2EFP A;  3C3W A;  2XKO A;  3IHU A;  2ETH A;  3V7S A;  4Q48 A;  1WKM A;  4WX9 A;  3LA7 A;  1Z6T A;  2EFN A;  1BIB A;  1U5T C;  2CYY A;  3T8T A;  4I2O A;  4L9V A;  1H9G A;  5HS7 A;  4EV0 A;  3ZPL A;  1QO0 D;  2MLG A;  3LA2 A;  5KK1 A;  2ELH A;  1WSU A;  2O03 A;  4LLL A;  2ZJ2 A;  2EFQ A;  1KU2 A;  3H92 A;  3KP5 A;  5EEH A;  4CYD A;  3HIF A;  3VOE A;  2FML A;  1TNS A;  1L3L A;  4GXO A;  2Q2E A;  4ZYD A;  1OKR A;  4I7H A;  4LG0 A;  1AOY A;  3RYP A;  4ENK A;  4JQF A;  3QOP A;  2L3D A;  1LEA A;  1T0F A;  4ESF A;  1F4K A;  1R5G A;  3GYH X;  3E5X A;  2QVO A;  3KE2 A;  2L4A A;  1U3E M;  4G9Y A;  4ENM A;  1BI1 A;  4I98 B;  5L3D A;  4A5N A;  4LG0 B;  3GVA A;  3JAM K;  2FEZ A;  2OQG A;  2K27 A;  4IRI A;  5EEG A;  1SMY F;  2IPQ X;  5AIP A;  2VOO A;  2VC1 A;  4HA8 A;  1IRG A;  5JVT A;  2V1X A;  1LB2 A;  1B4A A;  2AS5 F;  4OMY A;  4M9Z A;  4JK1 X;  1CGP A;  3GFL A;  3COA C;  4OIP F;  2XAG A;  3BDD A;  3ZQ7 A;  1SD6 A;  5HVQ C;  4UVA A;  5TJJ A;  1XGM A;  4R79 A;  3HOS A;  2FSW A;  1ZH5 A;  2HS5 A;  3WTV C;  3E3V A;  4GCV A;  3K1M A;  3DPL C;  1DUX C;  3E5U A;  3MFK A;  3F72 A;  4AVP A;  1U8R A;  3ZN1 A;  2ZBK A;  3OV8 A;  2CO5 A;  4WWC A;  1I5Z A;  5DUI A;  2CQK A;  1FP1 D;  3B73 A;  3ZMV A;  2OQR A;  3WTZ A;  1RI7 A;  3BPX A;  5L3C A;  2EWN A;  2H6C A;  1SAX A;  2OZU A;  1F5T A;  1IRF A;  3WTS C;  1D8K A;  4M6X A;  5BQT A;  1G3S A;  3SFZ A;  1R22 A;  4FX4 A;  3LFK A;  1ONV A;  2E1C A;  2M1B A;  3E5Q A;  1FBQ A;  2HQR A;  5H6R A;  4HLX A;  2RC4 A;  3ML6 A;  2E7W A;  5E18 F;  1HW1 A;  1P4A A;  1U2W A;  4ZYE A;  4BNC A;  4IHT A;  1UCR A;  2G7U A;  2DW4 A;  2O6G E;  1BIA A;  4BXU A;  2HTS A;  1HQC A;  5ICG A;  3WE2 A;  2DK8 A;  1YO5 C;  1FBU A;  1R36 A;  4HDV A;  3O3K A;  3ZMS A;  2GA1 A;  1IN4 A;  5J8F A;  3U2R A;  3GX4 X;  1R1V A;  1T2K A;  1IN6 A;  1O3R A;  1OYY A;  5DDG A;  2IW5 A;  4OIO F;  2RKH A;  2HR3 A;  3TGN A;  2K86 A;  3FMR A;  4BH9 A;  2V79 A;  4CIC A;  1OMI A;  4H0E A;  1SFE A;  1QQI A;  4KIG A;  3KP4 A;  3F6V A;  2P5L C;  2HYG D;  4YIF A;  5FFZ A;  3H3U A;  2D2W A;  3KP6 A;  5L3F A;  2EB7 A;  4UV8 A;  2G7H A;  3I59 A;  3P7N A;  3GEZ A;  1BC7 C;  5HLH A;  1FC3 A;  1YW9 A;  1MJA A;  3WTY C;  3GWZ A;  2FBH A;  4P9U A;  2P6T A;  3KP2 A;  4YG2 F;  3DV8 A;  2FBK A;  2QEN A;  2MC3 A;  5H20 A;  2Y48 A;  2RQP A;  1TQM A;  3I59 B;  3QAH A;  3MWM A;  1L0O C;  1ZGJ A;  1R58 A;  4AWX B;  1RZ4 A;  1ZYR F;  4M9S A;  2ZKZ A;  1ZRD A;  4LK1 F;  6PAX A;  4QWQ A;  2O0Y A;  5E1Z B;  3IWF A;  3KLN A;  4HW0 A;  4A0Y A;  4Z2Y A;  2MH2 A;  3MZH A;  3ZMT A;  2FA5 A;  1W7P D;  3BJO A;  5FD6 A;  1ZRE A;  2XRN A;  4EJU A;  4XLP F;  2GAU A;  4U0W A;  3REO A;  4N0B A;  4F7Z A;  5CVU A;  4OIR F;  2J5O A;  1XSD A;  4G7O F;  2M8E A;  3WGG A;  4HV5 A;  4L5I A;  1WI9 A;  1DPU A;  2KIM A;  3F8N A;  2VOP A;  2XUB A;  3GLX A;  5D5V B;  4LLN A;  4M6Y A;  1W5T A;  4A2U A;  1XSX A;  3SXY A;  3SQN A;  1T6S A;  5LRR A;  2EFW A;  2STW A;  2EV6 A;  5FB2 A;  1P4X A;  2GZW A;  4HF1 A;  2DPU A;  3WE3 A;  1T39 A;  1BI0 A;  1MZB A;  3ELK A;  3G73 A;  1HBX G;  1FX7 A;  4WCG A;  3DXJ F;  4OMZ A;  3GZ6 A;  4KUM A;  3DKW A;  1QNT A;  3HYI A;  1WWX A;  1I27 A;  1Q1H A;  2W24 A;  1MD0 A;  1YYV A;  4EQQ A;  3C1D A;  1P6R A;  4LLG F;  3WTX C;  2P7C B;  3GF2 A;  1BOA A;  2PN6 A;  2X4H A;  5IT3 A;  3PQJ A;  3RJP A;  1J75 A;  2KIU A;  3KET A;  3R0A A;  4OOI A;  1HST A;  3F8C A;  3TO7 A;  4G6D A;  5D6E A;  1PP8 F;  1IW7 F;  4MEX F;  3L2C A;  3D0S A;  3I71 A;  3EUH A;  1TLH B;  5CVI A;  2P5K A;  5FD5 A;  1U6G A;  3CUQ C;  2K7L A;  2BBY A;  2NYX A;  3HSF A;  1FWZ A;  4MGR A;  2YX4 A;  2OZ6 A;  3F8B A;  4BYY A;  4HBL A;  2UXX A;  3EET A;  3R4K A;  5DYM A;  2Z3Y A;  1YW7 A;  3IKT A;  2E7X A;  2V1D A;  4FHT A;  3L00 A;  1YFH A;  2XV4 S;  3V8K A;  2BE5 F;  4P9F A;  3DP7 A;  2LF8 A;  4N9I A;  2RDP A;  1FYM A;  5TRD A;  3ZN0 A;  5LHI A;  3QU3 A;  4JBA A;  5J6X A;  1HW2 A;  3N4M A;  1BC8 C;  1K79 A;  2PI0 A;  2DO7 A;  2F2E A;  3J81 K;  4UUV A;  3GXO A;  2P5V A;  2A61 A;  5HS8 A;  2FBI A;  3SHF A;  4KA4 A;  2AXL A;  4HQM A;  3V8L A;  1FP2 A;  1QGP A;  4KIC A;  2DFI A;  2DU9 A;  1FBS A;  1ZHF A;  1S8N A;  4ZZD A;  2O3F A;  3SZP A;  5ERI A;  2VC0 A;  2VBX A;  1B59 A;  3S2W A;  4L18 B;  1P2F A;  3ECH A;  4MNU A;  4BHP A;  4AIH A;  2COM A;  1RNL A;  2Y0M A;  5K1Y A;  2MD5 A;  2YSR A;  3MZY A;  1CF7 B;  1E2X A;  5BS6 A;  5D8K B;  1IZ1 A;  4P96 A;  4I0B A;  5A2Q Z;  4ENN A;  3WU1 B;  1SFX A;  2VE8 A;  4G7H F;  1IN8 A;  3C18 A;  4NQW A;  5D5W B;  1S7A A;  1TTY A;  1O3Q A;  2DLL A;  1XD7 A;  1FZP B;  4MHG A;  2JT1 A;  1U78 A;  3RDI A;  2JRT A;  1J59 A;  3TDU C;  2TDX A;  2O8X A;  1DP7 P;  3V8J A;  1TQI A;  3M7G A;  2DPD A;  4MQV A;  4ASN A;  1BJA A;  1F9N A;  2VON A;  2RV8 A;  4G8X A;  5K5Q A;  4HYE A;  4DQ2 A;  3KEQ A;  5CVV A;  3O2P E;  3RKX A;  1B1B A;  3LAP A;  2RVC A;  3ZMD A;  1DPR A;  1ODD A;  2DT5 A;  4EJV A;  3AAF A;  2ZFW A;  4ENJ A;  3FZV A;  3F23 A;  2UZK A;  4WXH A;  2EJR A;  2FMY A;  4L0Z B;  2DI3 A;  4K2E A;  1WRJ A;  1T98 A;  3QP5 A;  1TNT A;  3ABT A;  5ILU A;  2Q0O A;  3NEU A;  3IRQ A;  1IXS B;  1MJ9 A;  4ZYG A;  5DV5 A;  4OIQ F;  3FXQ A;  3R0J A;  3WU0 A;  2NRA C;  3M8E A;  1EH6 A;  2BV6 A;  4FX0 A;  4YFX F;  4RB3 C;  3HRT A;  1HXD A;  2KIF A;  4O5V A;  1K78 A;  1D8J A;  1ZRC A;  1JHH A;  3BPV A;  1AWC A;  4B8X A;  1Z1D A;  4ON0 A;  3NRV A;  2BEO A;  4L9T A;  2A6E F;  1V4R A;  2ZO4 A;  1LJ9 A;  4OIN F;  2KJB A;  3R60 A;  4HDU A;  1F1Z A;  3FXR A;  5DCM A;  1K78 B;  2QQB A;  4WXD A;  4XSZ F;  3T0Y A;  2FE3 A;  2KRF A;  2VBW A;  3FMS A;  3EDP A;  1KU3 A;  3P9K A;  4MQ9 F;  5DEQ A;  2WWY A;  4IRH A;  4U7B A;  2IVM A;  3JAM Z;  4PGG A;  1ZG1 A;  5DCM B;  2HQN A;  4NHJ A;  1O7L A;  4CDG A;  2M45 A;  2L02 A;  5ILV A;  4DNC A;  3E6B A;  5JHU A;  1GXQ A;  1ZRF A;  1J7K A;  4M74 A;  4XLN F;  1XGS A;  1LNW A;  2IP2 A;  3LQQ A;  3P9I A;  2XAQ A;  1Y0U A;  2H94 A;  2LNB A;  1OPC A;  2V9V A;  2O61 A;  1U5T A;  4RS8 A;  2P8T A;  2IJL A;  3LQR A;  5JR3 A;  4Y17 A;  1SD7 A;  3L9F A;  3GUD A;  1XMK A;  4YFK F;  2UWM A;  1OYW A;  2XHK A;  2F5C A;  1S3J A;  1DDN A;  3F21 A;  2EK5 A;  3HOT A;  4M73 A;  1U5T B;  5AON A;  4ETS A;  1KU7 A;  2VT3 A;  2QQ9 A;  1GXP A;  5F6F A;  3CDH A;  2NNN A;  2GIV A;  1VTN C;  3FF5 A;  2K02 A;  3U9G A;  2JTV A;  2MBF A;  2V6C A;  4LB6 B;  2VT2 A;  5DD8 A;  2B0L A;  1O3S A;  2DQR A;  4ZH4 F;  2F5F A;  2A07 F;  3I58 A;  2EV5 A;  2FXA A;  3JTH A;  2XAS A;  4L9N A;  1TW3 A;  2A68 F;  2BYV E;  4GGG A;  1KYZ A;  2LF7 A;  5E8G A;  4A6D A;  2FU4 A;  4KMU X;  1YQA A;  1R5H A;  1OYI A;  3WGI A;  1G4D A;  2VN2 A;  3ULQ B;  3JTG A;  3F22 A;  3HTU A;  3D5L A;  1XGN A;  1IF1 A;  4UVB A;  4CO8 A;  2OD5 A;  1WQ2 A;  3BWG A;  5LBQ A;  2HTJ A;  4ESB A;  3KEO A;  2M87 A;  1J9I A;  3BRO A;  2QUF A;  3O6B B;  4HV6 A;  3KZZ A;  3CJN A;  3G3Z A;  5LLQ A;  2UXN A;  3EQL F;  5FO5 A;  3T8R A;  1Z05 A;  1FPQ A;  1RIO H;  4BHB A;  1T38 A;  2OA4 A;  3ERE D;  3MQ0 A;  1EH7 A;  2EFO A;  2XAF A;  5E8I A;  3VFZ A;  1Z9C A;  2CFX A;  3K0L A;  3QP6 A;  4G94 A;  1G3T A;  4HLY A;  4CXF A;  1QZZ A;  4A5M A;  3FMQ A;  2R7D A;  3Q5F A;  1K6O A;  4R8H A;  3KCC A;  1IN7 A;  3Q9V A;  4Y15 A;  2MA3 A;  1LDK B;  1ON2 A;  1ZLJ A;  5LGU A;  1KU9 A;  1ON1 A;  2ZXJ A;  4UXN A;  1E17 A;  2XAJ A;  1ZN2 A;  2PBI A;  2IA1 A;  3M9A A;  1H0M A;  2VOD A;  1EV7 A;  4S04 A;  3ZP5 A;  1B9N A;  1STZ A;  3RKW A;  2ZNZ A;  2YU3 A;  2PG4 A;  1ZAO A;  3HRU A;  1Z91 A;  5IT9 K;  5K5O A;  2OBP A;  1Z7U A;  3TOB A;  3BJA A;  5CLS A;  5LGN A;  2MLK A;  2MH9 A;  3ZMU A;  3E6M A;  3BOQ A;  2PEX A;  3WTU C;  1KGS A;  3EYI A;  4Q47 A;  1R1U A;  3GW2 A;  1JE8 A;  1XGO A;  2HYF A;  2PMU A;  4YFN F;  2W85 A;  2NNY A;  1B9M A;  4P55 A;  2F5D A;  3HRS A;  4U88 A;  1HKQ A;  4UHT A;  1I1G A;  3FHZ A;  2HWV A;  2DQL A;  4M71 A;  4PZJ A;  4EVI A;  2YX7 A;  4AIK A;  1LVA A;  1YG2 A;  1KQ9 A;  1TBX A;  3TO9 A;  1FNN A;  3ISP A;  2JZY A;  4O3M A;  1XN7 A;  1OR7 A;  2IA0 A;  4O6J A;  3ABU A;  4RB0 A;  5F64 A;  2Q8K A;  1MJB A;  3I54 A;  3CTA A;  3DQV C;  1XB4 A;  1XDS A;  3RI4 A;  1FOK A;  1SD5 A;  3RTR A;  5E1W A;  3F3X A;  2ZNY A;  5HDG A;  1RUO A;  2IRF G;  5FLX K;  3K2Z A;  4ZYH A;  1J5Y A;  5CVR A;  1JGS A;  3BY6 A;  4KDP A;  3J80 K;  5DUK A;  4N9H A;  2FNA A;  1G3W A;  1XMA A;  2JSC A;  1IXC A;  3HSR A;  3LWF A;  3CO6 C;  3IKV A;  4UNO A;  3C7J A;  4D0P A;  2BGC A;  1JXS A;  4M9X A;  4QLC U;  3I5U A;  4HX8 A;  1NHA A;  3HUG A;  3WTT C;  1FT9 A;  3IL2 A;  4IPA A;  4A6E A;  1USS A;  1EH8 A;  3KLO A;  5CYV A;  3J7A O;  3RPU A;  4KT5 C;  3K9T A;  2FRH A;  2ADU A;  4HZF A;  1J0R A;  2QM3 A;  3K1N A;  4FT8 A;  2KKO A;  5J8C A;  3N97 A;  1ULY A;  1W5S A;  4LMY A;  4ZZL A;  4HF0 A;  2V1U A;  4B09 A;  3QRF F;  4LFU A;  2X0L A;  4BQA A;  1CF7 A;  1TQP A;  4AIJ A;  4EJO A;  4MTD A;  4WF2 A;  3FWE A;  2A6H F;  2CWE A;  4EJW A;  4L5J A;  3JSO A;  1B6A A;  3B02 A;  4YII A;  4CHU A;  2RN7 A;  4KIB A;  2OU2 A;  1UST A;  2R3S A;  4KNY A;  5LHH A;  1O7F A;  2CG4 A;  4HX4 A;  2PJP A;  3F6O A;  3HHH A;  3IC7 A;  2RNJ A;  4WXC A;  2A69 F;  2D45 A;  3E6C C;  5DCF A;  4HQE A;  5HDK A;  5K5R A;  3J81 Z;  3RKY A;  2XKP A;  4IXA A;  2XIG A;  1G3Y A;  3E97 A;  4LD5 A;  4A0X A;  2CGP A;  2ESN A;  5BOX A;  1BI2 A;  2H6B A;  4OU0 A;  1QZY A;  4BHC A;  1D3Y A; 
#chains in the Genus database with same CATH topology
 4KYW A;  3HTS B;  1W36 C;  2VL8 A;  2ECC A;  3WHC A;  1IXR C;  4R1H A;  5CVJ A;  3M8J A;  2WB1 A;  1SAN A;  1VQ6 I;  1MDM A;  1D1B A;  3WHB A;  1A35 A;  2J5P A;  1UHM A;  4RB1 A;  2ZSI B;  2FQ3 A;  1LDJ A;  2L9V A;  4MTE A;  5FLV A;  2R5Y B;  1S7O A;  2WA0 A;  3AKZ A;  2M2E A;  1XDU A;  2ISZ A;  2B7E A;  5GPA A;  1A6Q A;  1IAW A;  1W1W E;  4UB6 C;  5KHD A;  3BZ6 A;  3JSP A;  4XL9 A;  3BTC A;  5LGT A;  1GHC A;  1QVT A;  3V7R A;  1ZKG A;  2NVU B;  3MCZ A;  5ICE A;  1JHF A;  2Y0S N;  5FRM A;  2E1M C;  4DGW B;  3KP3 A;  1QU3 A;  3D5R C;  1MDM B;  1WJB A;  1OLT A;  3QYE A;  2E19 A;  2WAQ N;  1HW5 A;  1WGX A;  3E0J B;  4I02 A;  5D4S A;  1H9T A;  2EA2 A;  3K1P A;  2VKH A;  3IAS 2;  2XGE A;  3M8F A;  1A6I A;  4IHS A;  3LSJ A;  5J1R A;  3RZD J;  1TWC J;  3GO5 A;  4AVZ A;  2GXB A;  3RSN A;  2HDC A;  2ZJR F;  3CO7 C;  3FX3 A;  1IN5 A;  2H09 A;  2E60 A;  4MEY F;  3JRF A;  1X3U A;  2M4K A;  1O3T A;  2EZL A;  2JUG A;  4EMS A;  4MIM A;  2C6Y A;  1YRN B;  2VBZ A;  3QPL A;  3ZQL A;  1WPK A;  3E6D A;  1UHW A;  2DA6 A;  1V5F A;  5CQE A;  5IP9 J;  3OS2 A;  1FYL A;  2VXZ A;  3C2G A;  2ME0 A;  4XN3 A;  4UV9 A;  3CUQ A;  1EJ9 A;  2HQA A;  3DF8 A;  3HEF A;  1BI3 A;  1R1T A;  2O7O A;  1D5Y A;  5LEK A;  2LKP A;  4BJ5 C;  3TW6 A;  4RB2 C;  1ZGA A;  5JI6 A;  5BMZ A;  2X51 A;  1D5V A;  3DU6 A;  2VI6 A;  3SEQ A;  2Z5U A;  5HOO A;  3QPH A;  1Y0N A;  5GAD J;  3GTL J;  3TO6 A;  2HGC A;  2LC2 A;  3U1D A;  4A3M J;  1X3W B;  4HRI A;  1XMX A;  3FK6 A;  2G9W A;  2BVM A;  1IDY A;  2ELJ A;  3OYC A;  3L2R A;  1I3A A;  5FKM A;  3CDI A;  2CUF A;  3PJR A;  3CMM A;  4RAY A;  4KIF A;  4EM1 A;  3CUQ B;  1C0W A;  4UVC A;  3HGG A;  2QZ8 A;  4C2U A;  2HKX A;  4RM3 A;  1I3Q J;  4RGS A;  4HOB A;  4RAZ A;  1HKS A;  2XRO A;  4IF4 A;  3H3V K;  3PQK A;  2DJN A;  3K4J A;  4QIW N;  2QYO A;  3P5J A;  3HRM A;  3MZ8 A;  1J09 A;  4KN4 X;  1YIO A;  2KJC A;  1S5L C;  2ESH A;  2KRH A;  4FE7 A;  3HC7 A;  2ISY A;  2WAF A;  2HEO A;  2BHZ A;  4DYR A;  5IOY A;  4IHV A;  4EJT A;  1QA6 A;  3CUO A;  4A0Z A;  2HKO A;  3F0C A;  4BE0 A;  2KPM A;  3PSF A;  1O57 A;  4BBR J;  4UUT A;  2QBY A;  2ZCW A;  3IH2 A;  1ZG5 A;  3WG7 H;  3DPT A;  5BPD A;  1P4W A;  1RKT A;  1FLI A;  2LP0 A;  3S2H J;  3GCM A;  1X1C A;  2P6S A;  5LEJ A;  2LRE A;  2QQ8 A;  1X2N A;  3CJR B;  4B43 A;  2JJ7 A;  3KZY A;  1WJA A;  4J19 A;  2LLK A;  4A3L J;  3QYB A;  5L3B A;  3GTM J;  5JLX A;  2VIX A;  4PJL A;  1Y8Q B;  3NWS A;  1HDP A;  1IRX A;  5FGM A;  5FKL A;  5HDN A;  3HOX J;  1BW6 A;  4CUG A;  2QBY B;  1GVJ A;  1W5C C;  3OIP A;  4RGX A;  3VB2 A;  1J2X A;  1FIP A;  2Y75 A;  3TOA A;  3SZT A;  2QKM B;  2X6X A;  3F8F A;  2MSY A;  3H9J A;  4CA0 A;  2V26 A;  1A04 A;  1XCB A;  4HPQ A;  2QQA A;  2MC4 A;  5ICC A;  4Y13 A;  5B5E C;  2ZME A;  1R71 A;  3CES A;  3GFJ A;  2XVC A;  5FFX A;  2ACJ A;  2PFB A;  4XOT A;  2RGV A;  2NS0 A;  5H6Q A;  3OIQ A;  4I09 A;  4L5E A;  4BE1 A;  1SVO A;  2R7F A;  1SVM A;  4U87 A;  4CYC B;  1H89 C;  5CPR B;  5HLI A;  1WHU A;  2L7M P;  2WTE A;  3CCJ I;  4ABZ A;  2E36 A;  1VZ0 A;  1TWG J;  3ECO A;  4QPQ A;  4NB5 A;  3CF2 A;  1PP7 U;  2F6C A;  4HST A;  1ZEL A;  3NQO A;  2VE9 A;  2QWW A;  5K7Z A;  1TL8 A;  1MBJ A;  1G6N A;  4LIV A;  2M5W A;  3C2B A;  2HOS A;  4E7I A;  4BAY A;  2X6Y A;  2H1K A;  1U8B A;  4I76 A;  2STT A;  2VUM J;  2WV1 A;  4TV7 A;  2ZC2 A;  2ZME B;  2DFE A;  3Q9S A;  4F91 B;  2HZT A;  4LJZ F;  1BR4 A;  4PDK A;  2QA4 I;  1JKR C;  1R23 A;  1W4M A;  2F5V A;  2E34 A;  2W57 A;  4DJA A;  1I6X A;  5EZH A;  2GOX B;  2RNG A;  3K69 A;  4F92 B;  4EGY A;  1ZG3 A;  1TT0 A;  1PDN C;  1TWH J;  1YTY A;  2UV1 A;  3KFW X;  4RBO A;  4Y52 J;  5E3M A;  1UB9 A;  2PMH A;  2NAZ A;  3T5X A;  1D0Y A;  5CJ9 A;  3GZN B;  1JKQ C;  1RUN A;  3CD6 I;  1S29 A;  3FXU A;  4HSR A;  1SFK A;  5ICF A;  1W7P A;  1DU0 A;  2D1V A;  3BP8 A;  1E3H A;  3CLQ A;  2JA8 J;  1P9Q C;  3LA3 A;  5ED4 A;  1HKT A;  3V4G A;  3VDX A;  4U0V A;  2JK3 A;  2JPC A;  4FQG A;  2YR2 A;  2R7R A;  1YS6 A;  2KT0 A;  3PFI A;  3I55 I;  3TW7 A;  1ETK A;  1VF9 A;  1YE9 A;  3EUH C;  4F52 A;  3JW4 A;  2R93 J;  5IPA A;  2NXN B;  1OCZ H;  3NAU A;  1MMS A;  1TC3 C;  1JUS A;  3CZ6 A;  5FJ8 J;  3BTL A;  3FKI J;  1Y8R B;  3H3Z A;  3DEE A;  4FAS D;  3HGY A;  1S72 I;  1FOY A;  5M3F J;  5HS9 A;  5GTI C;  4IZZ A;  4XRF A;  1W7P B;  2Z99 A;  2JPB A;  1QBJ A;  1BW5 A;  2OAZ A;  3HOW J;  2PLY A;  1V5E A;  2M0M A;  3FXL A;  4JX4 A;  1WJD A;  1R7J A;  2EQR A;  2F48 A;  2K9Q A;  2X1E A;  3OYD A;  4XLE A;  1VQ9 I;  4L0Y B;  2EA4 A;  3FM3 A;  1I1S A;  1FSE A;  1NH3 A;  1AU7 A;  3QU6 A;  1A36 A;  4M3E A;  2W7N A;  3ZMZ A;  4GYI A;  1ETX A;  2IA2 A;  2KL4 A;  3L09 A;  4BBS J;  1MSE C;  2OV7 A;  5L3E A;  1R00 A;  1S6L A;  3T1B A;  1Y1V J;  2VB6 A;  2N8G A;  1MH3 A;  3WTW C;  2L4M A;  1GLN A;  1R6R A;  3F8M A;  5DM7 F;  3OMY A;  2R7Q A;  2WC2 A;  4UB8 C;  3V42 A;  1ITY A;  1MGT A;  4ESJ A;  3FKJ A;  3A2K A;  3BR2 A;  1XCV A;  2LFB A;  2AO9 A;  2DBB A;  2V7F A;  2L5Q A;  1YS7 A;  2Z9O A;  1SMT A;  3OIO A;  4DBQ A;  3GFM A;  1MIJ A;  2EBI A;  5C4X J;  5EDN A;  3V7C A;  4Q4Z F;  5BPI A;  1QPM A;  5EZG A;  3OSG A;  4P5O A;  5E17 F;  4NDL A;  1WJ5 A;  3IWZ A;  2A3S A;  3ROU A;  1HSJ A;  1Y39 A;  3GTG J;  3I64 A;  3WGH A;  3R6S A;  5EF6 A;  1R49 A;  5BNG A;  4S05 A;  2CV2 A;  1E0E A;  3ASO H;  2VPL A;  4M72 A;  2VLA A;  1P7J A;  3M07 A;  1YLF A;  2EZI A;  3CMY A;  1V3F A;  2HOE A;  2D1H A;  1PUE E;  2CSO A;  5JLW A;  3W2W A;  2DTR A;  2GQQ A;  2LD5 A;  2LSO A;  5GAH J;  5AIQ A;  1K7A A;  2JVH A;  3FM5 A;  4HX7 A;  2IGK A;  2V9K A;  2YPR A;  3LNQ A;  2MW8 A;  3WG9 A;  3NWT A;  1RES A;  4W1U A;  2PQ8 A;  4XSX F;  3RZO J;  4KT6 A;  5JFR A;  3GFI A;  4CGZ A;  2M30 A;  3L7W A;  1YW8 A;  1ENH A;  3LSG A;  1VQ8 I;  2L54 A;  3J7A Y;  3GTQ J;  5M5W J;  2FOK A;  1GDT A;  2FF4 A;  1MMA A;  4QPO A;  3CMA I;  2K9M A;  2CW0 F;  3R61 A;  1ZK8 A;  3CLO A;  3TMO A;  2A5Y B;  3MKL A;  1DP3 A;  3HSE A;  3MVP A;  2R4G A;  1XSV A;  3K4L A;  2CH0 A;  4WK8 F;  3DEW A;  3P9C A;  1UFM A;  3LST A;  2E5Z A;  1PJR A;  5F1R A;  3IRR A;  3S1R J;  4Q5S F;  2VJI A;  3DTI A;  2GWR A;  3CCE I;  3UKG A;  3WOD F;  2W00 A;  3I4M J;  5DD4 A;  3DFG A;  4KN7 X;  4DYQ A;  4DIQ A;  4PUS A;  3JRI A;  5L3G A;  4ZDO A;  2HNH A;  4XR6 A;  1MKM A;  3TQN A;  2QKL B;  3OOU A;  3W6J B;  2K4B A;  5IT9 Z;  4AD9 A;  3S1N J;  4I0A A;  4U0Y A;  4II3 A;  3Q0V A;  3OYF A;  1LFU P;  2IT0 A;  2F4O B;  2XGX A;  3AL0 B;  3RYR A;  1G59 A;  2P4W A;  1LDD A;  4XBF A;  3W6K B;  3A03 A;  3EYY A;  1NG7 A;  1KQ8 A;  1FEX A;  4GO1 A;  3TDZ C;  3OYL A;  2E1N A;  2DA3 A;  4XOR A;  2VBY A;  5B3S H;  1REP C;  5E1X A;  4PCQ A;  4DBR A;  1Z6R A;  4IRG A;  3I53 A;  5IY5 H;  3TKY A;  4IEJ A;  5KVR A;  3OOP A;  3VOD A;  1Y56 A;  2W25 A;  3PUF A;  3M4O J;  2I5U A;  1TW2 A;  5J3L A;  4IJA A;  2JSP A;  5D5U B;  3I0T A;  4LK0 F;  2XRL A;  1I39 A;  4G12 A;  2LH9 A;  1B72 B;  1FSH A;  4EGZ A;  3HHG A;  2R92 J;  4E7L A;  2IGO A;  1SFU A;  2QLZ A;  4A3J J;  2ECB A;  5LD2 C;  5LRS A;  3VEP A;  5C44 J;  5KNL A;  2GA2 A;  4LGW A;  2DDB A;  1KQ0 A;  5HLG A;  3DEU A;  1FYK A;  2OUM A;  2YS9 A;  2P7V B;  4RGU A;  2M9H A;  3KP7 A;  4EM0 B;  4U7D A;  2OC6 A;  2LY2 A;  4L9J A;  3LAJ A;  2HVR A;  2DA5 A;  2ELK A;  4G6Q A;  3U1K A;  4RGR A;  3OS0 A;  4KMF A;  5D5X B;  3VPR A;  1BBY A;  4ZTF A;  4NNJ A;  1ZAR A;  4CZZ A;  5LHG A;  2XAH A;  2NVY J;  2W84 A;  2Z33 A;  3M1E A;  2H1L A;  5DS9 A;  2FNP A;  2L9N A;  3RPQ A;  3I4P A;  4IL6 C;  5E20 A;  4IOC F;  1BN5 A;  1P92 A;  4GYG A;  2EV0 A;  5FLX Z;  4HAM A;  1T33 A;  4XKV A;  2H27 A;  2QCO A;  2HFH A;  5ILS A;  2K4J A;  1ZLK A;  4EM2 A;  2L01 A;  3MMY B;  3FIW A;  2LDU A;  3J80 Z;  3RQI A;  5D4R A;  3BC8 A;  3S16 J;  4PGH A;  1SD4 A;  2WAQ A;  3KYC B;  3MD2 A;  3RIR A;  1KYW A;  4E70 A;  1WVR A;  5GP9 A;  4LB5 A;  3GZ5 A;  1FY7 A;  3K4C A;  1KA8 A;  3L2V A;  3W6V A;  4HF2 A;  1IUY A;  3MAJ A;  2JMW A;  3H9Q A;  1LQ1 A;  4ZJZ A;  5A2Q K;  2GXG A;  5D6F A;  2DK5 A;  4G7Z F;  2LRD A;  4A12 A;  2AXT C;  2HXI A;  3MEX A;  3QPT A;  5J1Y A;  4BDZ A;  1XPX A;  1HF0 A;  3BJ6 A;  4ZDP A;  4JX5 A;  3I56 I;  1LEB A;  4I01 A;  4B3X A;  4KFC A;  2WY8 Q;  2DOA A;  3S1Q J;  2E2J J;  3ZRG A;  2LBF B;  3HKZ N;  2BW3 A;  1BM9 A;  2DCE A;  2DAO A;  2VQH A;  4IVN A;  3TL4 X;  2ME6 A;  4QSH A;  5D8L B;  2WV0 A;  1H8A C;  2F5E A;  1LFB A;  2LY1 A;  2EFP A;  2FD5 A;  3C3W A;  1VQM I;  4M3D A;  3FHN A;  1LUJ B;  2XKO A;  3IHU A;  2ETH A;  3V7S A;  4Q48 A;  1WKM A;  3VYT B;  3OYG A;  4WX9 A;  2LTP A;  3QQA A;  3QOE A;  3LA7 A;  1Z6T A;  2UUZ A;  3LSP A;  2EFN A;  1BIB A;  3KPH A;  3DWL E;  1U5T C;  1WJC A;  2XF6 A;  4D5F A;  5E79 C;  2CYY A;  1RET A;  3JRB A;  3HOU J;  2BW3 B;  1V5G A;  4ZC3 A;  1SAU A;  3RPU D;  3T8T A;  4I2O A;  3OL3 A;  4L9V A;  3GME A;  1IC8 A;  1H9G A;  5HS7 A;  1QHH D;  4EV0 A;  2KLO A;  4XLA A;  1WZ2 A;  1F36 A;  3ZPL A;  1QO0 D;  2MLG A;  4D7M A;  3LA2 A;  4BE2 A;  5KK1 A;  1GV2 A;  2OCE A;  3HPG A;  2ELH A;  1WSU A;  2NS8 A;  2O03 A;  1UG2 A;  2KIQ A;  4LLL A;  1XG1 A;  2EFQ A;  2ZJ2 A;  4JX6 A;  3IAM 2;  4CCM A;  1KU2 A;  5B1A H;  1JUM A;  3H92 A;  1JI8 A;  1IV8 A;  1OCT C;  1JJ8 C;  3VSL A;  3JRG A;  1O4X A;  2DT6 A;  3KP5 A;  2IS4 A;  5EEH A;  3GTO J;  2H8W A;  4W97 A;  2CQ7 A;  2EIM H;  4XIC A;  4CYD A;  3HIF A;  2Z1D A;  3VOE A;  5M3M J;  3CDL A;  2FML A;  3PNY A;  1TNS A;  2P81 A;  4M6V A;  4XLF A;  1VQ4 I;  1L3L A;  2KHM A;  4GXO A;  2Q2E A;  2W4S A;  2IBD A;  2KQR A;  4D9J A;  1YRN A;  4ZYD A;  4XQF A;  4C3J J;  2BY2 A;  1OKR A;  2DXI A;  4I7H A;  4LG0 A;  1AOY A;  2HDD A;  1UAA A;  1GUU A;  4X1E A;  4XLC A;  3RYP A;  4BXF A;  4ENK A;  4JQF A;  1P7I A;  3QOP A;  2LVS A;  1RKW A;  2DA2 A;  1OCP A;  2L3D A;  1LEA A;  2MGQ A;  1T0F A;  4ESF A;  2DMT A;  2DFH A;  1F4K A;  1R5G A;  2HZD A;  3ABM H;  1JTY A;  2E2I J;  3GYH X;  3E5X A;  2QVO A;  3KE2 A;  2L4A A;  1U3E M;  2Q2E B;  3LSK A;  2HYJ A;  2M8G X;  4G9Y A;  1BI1 A;  4ENM A;  4I98 B;  5L3D A;  4A5N A;  2L9S A;  4LG0 B;  3GVA A;  2CQX A;  2EIJ H;  1FTZ A;  3JAM K;  3C2H A;  2FEZ A;  4QTR A;  2OQG A;  3DPU A;  2K27 A;  2ZXI A;  3G1M A;  4IRI A;  2XGD A;  1SMY F;  2IPQ X;  2EIN H;  5AIP A;  5EEG A;  2VC1 A;  2I8D A;  4HA8 A;  3TP3 A;  2VOO A;  4A3I J;  2CRG A;  1IRG A;  4LIT A;  5JVT A;  2V1X A;  3S15 J;  1G2H A;  1JKO C;  1LB2 A;  3K4M A;  2DJI A;  1V54 H;  1B4A A;  1ZTR A;  4MFE A;  2AS5 F;  4OMY A;  4M9Z A;  1G8X A;  4JK1 X;  2Y9Y A;  1CGP A;  3GFL A;  3BG6 A;  1DGR M;  4E7Z A;  3COA C;  4OIP F;  3KX2 A;  1TP4 A;  2XAG A;  3BDD A;  3ZQ7 A;  1ETV A;  1SD6 A;  5HVQ C;  4UVA A;  2ZJQ F;  3LFU A;  1IJW C;  1A5J A;  5TJJ A;  1YJ9 I;  3DKY A;  2JUC A;  1XGM A;  3PFY A;  4ANJ A;  4R79 A;  1H88 C;  3HOS A;  2FSW A;  1ZH5 A;  2CW8 A;  2HS5 A;  3WTV C;  5TIS C;  2QSG X;  2GXA A;  1BR1 A;  1POG A;  4IKF A;  3E3V A;  4GCV A;  3IV5 A;  3SZG A;  3K1M A;  3DPL C;  1X19 A;  3CCY A;  2X85 A;  4DW6 A;  4I99 C;  1OJL A;  1DUX C;  3FBN B;  1X4P A;  1BOB A;  2OTJ I;  1A31 A;  4C3H J;  4AID A;  2JA5 J;  3E5U A;  3MFK A;  1E3O C;  3F72 A;  1PUF A;  3BG3 A;  4AVP A;  1U8R A;  3IP4 B;  2CUZ A;  3ZN1 A;  3H5N A;  2ZBK A;  1MW7 A;  3UR3 C;  2ZXW H;  5EGO B;  3OV8 A;  2CO5 A;  4WWC A;  3HOY J;  1I5Z A;  1VQO I;  5DUI A;  2CQK A;  2E2H J;  1R4M B;  5F0F A;  3HG9 A;  1FP1 D;  3B73 A;  4XN0 A;  3ZMV A;  4Z6Y A;  2OQR A;  3ZOB A;  3WTZ A;  1RI7 A;  3BPX A;  5L3C A;  2EWN A;  2M3A A;  2B63 J;  4CYC A;  3HOZ J;  1IGN A;  2H6C A;  4PSW A;  4LIU A;  2VXD A;  1SAX A;  2OZU A;  3BR3 A;  1F5T A;  2JA6 J;  1IRF A;  3CME I;  1PUF B;  3WTS C;  1D8K A;  4M6X A;  3B6A A;  5BQT A;  1G3S A;  3SFZ A;  1R22 A;  3S93 A;  4XOP A;  3LMM A;  2DA1 A;  1GT0 C;  3ZQC A;  1X1A A;  2AQE A;  4FX4 A;  4IOA F;  4F3Q A;  3LFK A;  1ONV A;  2ID6 A;  2E1C A;  2M1B A;  3X2Q H;  3E5Q A;  3OSF A;  2MYS A;  1FBQ A;  3CC4 I;  2HQR A;  5H6R A;  3FXK A;  3Q0U A;  4HLX A;  2RC4 A;  3ML6 A;  2E7W A;  5E18 F;  1HW1 A;  1P4A A;  1U2W A;  3B6C A;  4ZYE A;  3ABL H;  4BNC A;  4IHT A;  1UCR A;  5HOD A;  3JCU C;  2G7U A;  2DW4 A;  2O6G E;  1BIA A;  4BXU A;  2Y30 A;  2HTS A;  1HQC A;  5ICG A;  3WE2 A;  2DK8 A;  2ICW G;  1YO5 C;  2XPU A;  5E3L A;  2XC7 A;  3NAR A;  1FBU A;  1R36 A;  4HDV A;  3O3K A;  2BY1 A;  1OR7 C;  4A3C J;  3ZMS A;  2GA1 A;  1IN4 A;  5J8F A;  3U2R A;  4DZJ A;  1JJ6 C;  3GX4 X;  1BL0 A;  1R1V A;  1T2K A;  3VWB A;  1IN6 A;  2KZG A;  4FCY A;  1O3R A;  1OYY A;  1Z3X A;  1N75 A;  5DDG A;  3CCM I;  3W2A A;  3HXL A;  4Y7N J;  1XC5 A;  3OYK A;  2IW5 A;  4OIO F;  2RKH A;  2HR3 A;  5B66 C;  4PFO A;  1OQY A;  4J01 A;  3TGN A;  2HOT A;  3LSI A;  2K86 A;  3FMR A;  4BH9 A;  1MNE A;  2OTL I;  2V79 A;  4CIC A;  1JTX A;  1OMI A;  4YEJ A;  1K4T A;  2JN6 A;  2LG4 A;  2R0Q C;  4H0E A;  2QSF X;  3S3N A;  4BY1 J;  1M1E B;  1QQI A;  1AA7 A;  1SFE A;  3KP4 A;  4KIG A;  3CC7 I;  3F6V A;  1FOW A;  4H4K C;  1YHQ I;  1FJL A;  2BVL A;  5EYR A;  4JP0 A;  2P5L C;  4C9Y A;  4FIS A;  1OCR H;  2BHY A;  2HYG D;  4YIF A;  5FFZ A;  3H3U A;  4RMN A;  2D2W A;  3KP6 A;  1X1B A;  5L3F A;  2EB7 A;  2E1M B;  4AU7 A;  4UV8 A;  2G7H A;  2QGU A;  3I59 A;  3P7N A;  4NUB A;  3GEZ A;  5GAE J;  4V19 K;  1BC7 C;  3FK7 A;  5HLH A;  3PIO F;  4A3B J;  5C4J J;  1IDZ A;  1FC3 A;  3ZCO A;  1YW9 A;  1MJA A;  3WTY C;  2K5C A;  4E7J A;  2CW7 A;  3GWZ A;  2FBH A;  2CV1 A;  4XM3 A;  5FKO A;  4P9U A;  2M7A A;  2P6T A;  4E6K G;  5F0H A;  3KP2 A;  4YG2 F;  2V6E A;  2W1O A;  3DV8 A;  4M3B A;  2FBK A;  2QEN A;  2MC3 A;  4A3E J;  1JKP C;  2VKV A;  5H20 A;  2Y48 A;  3SYT A;  2RQP A;  1TQM A;  3I59 B;  1T95 A;  2V1N A;  4GDF A;  3QAH A;  3MWM A;  3K4K A;  1L0O C;  1ZGJ A;  2DT7 B;  1R58 A;  2XAU A;  2HU9 A;  4AWX B;  1RZ4 A;  1ZYR F;  4M9S A;  2ZKZ A;  3S1M J;  3BCA A;  1ZRD A;  4LK1 F;  6PAX A;  3CCQ I;  4QWQ A;  2O0Y A;  3BQY A;  5E1Z B;  2L9R A;  1N25 A;  3IWF A;  4HNU A;  4BU2 A;  2IEK A;  3KLN A;  5KCM A;  3HJE A;  4HW0 A;  2NOJ B;  5F04 A;  2DDA A;  4A0Y A;  4Z2Y A;  2MH2 A;  4OAZ A;  3MZH A;  3ZMT A;  5JVG F;  2FA5 A;  3SFI A;  1LFP A;  1W7P D;  3BJO A;  5FD6 A;  1D0Z A;  2XF5 A;  1ZRE A;  2XRN A;  5FKN A;  4LOC A;  5EG0 A;  3VYS B;  4EJU A;  3FXJ A;  4XLP F;  2GAU A;  1F43 A;  2XSJ C;  4U0W A;  3REO A;  2Y9Z A;  1YX3 A;  1LE8 A;  2LYC A;  4N0B A;  2M0C A;  4F7Z A;  5CVU A;  2DOD A;  2QF7 A;  2COB A;  4OIR F;  3H5A A;  1SFO J;  1R9T J;  2J5O A;  3BTI A;  1PVE A;  3AG3 H;  2IS2 A;  3ZQH A;  1XSD A;  4G7O F;  2QSH X;  2M8E A;  3WGG A;  1W0T A;  4HV5 A;  3QYF A;  4L5I A;  5GPC A;  4N4O B;  2KMU A;  1WI9 A;  1VFC A;  3A4C A;  2HI3 A;  3JRE A;  4IHY A;  4CCL A;  5F27 A;  1R4N B;  1DPU A;  2GIZ A;  1QZE A;  2KIM A;  2Q1Z B;  3BT9 A;  1X4O A;  3F8N A;  5EG0 B;  2VOP A;  2XUB A;  3GLX A;  3L1P A;  2X6O A;  5D5V B;  2MD0 A;  3JR9 A;  1LE8 B;  4LLN A;  4X6A J;  5HNF A;  2FX0 A;  4M6Y A;  2DFF A;  3MKW B;  3H35 A;  1XTA A;  4RLQ A;  2IS6 A;  2XPW A;  1W5T A;  4A2U A;  4E7K A;  2M7B A;  1ETO A;  2JA2 A;  1XSX A;  1W0U A;  3SXY A;  1K6Y A;  3SQN A;  1T6S A;  4Y33 A;  5LRR A;  2EFW A;  1D0X A;  2STW A;  2BXZ A;  2IAI A;  4AYB N;  2HVS A;  2EV6 A;  5FLM J;  5FB2 A;  1XX5 A;  1P4X A;  2GZW A;  3BTJ A;  3OL4 A;  3JRD A;  4HF1 A;  2XDV A;  3HOV J;  2CUJ A;  2LR8 A;  1Z7L A;  2DPU A;  1JUP A;  3WE3 A;  1LVK A;  1T39 A;  3OYE A;  1BI0 A;  3S14 J;  1FIA A;  1MZB A;  3ELK A;  3G73 A;  2DMU A;  1HBX G;  1FX7 A;  3I9V 2;  4WCG A;  1HCR A;  3HKZ A;  3DXJ F;  4E7S A;  1MMG A;  4CCN A;  2X1C A;  4OMZ A;  3GZ6 A;  1QHG A;  3CCV I;  4KUM A;  1B72 A;  3DKW A;  2RAE A;  3HBL A;  1QNT A;  3HYI A;  1WWX A;  1I27 A;  4RLF A;  2CJJ A;  1Q1H A;  3BZK A;  3S2D J;  2W24 A;  1MD0 A;  1YYV A;  4EQQ A;  3C1D A;  3O8G A;  1P6R A;  1U9O A;  4LLG F;  3WTX C;  4ZDL A;  2P7C B;  3D5S C;  3GF2 A;  5IYC J;  1BOA A;  2PN6 A;  2X4H A;  1I50 J;  2IGM A;  5IT3 A;  3PQJ A;  1ETQ A;  3RJP A;  4DZP A;  1J75 A;  2KDZ A;  1WJF A;  3FXM A;  3A0H C;  2KIU A;  1ETY A;  3KET A;  4P1W A;  3R0A A;  4OOI A;  1HST A;  1SVL A;  3OYA A;  3F8C A;  1Y1W J;  3TO7 A;  3PM1 A;  3LSH A;  2L7F P;  4G6D A;  5B1B H;  5D6E A;  1PP8 F;  1DGW Y;  3KZI C;  1Z3Y A;  4BUP A;  3L2Q A;  1IW7 F;  1RPW A;  4MEX F;  3L2C A;  4PJJ A;  2ID3 A;  4FET A;  2EH3 A;  3D0S A;  3VSK A;  2R7O A;  3I71 A;  3EUH A;  1TLH B;  5CVI A;  2P5K A;  1T56 A;  5FD5 A;  3G71 I;  1U6G A;  3QPS A;  3CUQ C;  2K7L A;  5IYB J;  2BBY A;  2DMP A;  1TWA J;  1YOV B;  4KIS A;  2NYX A;  3ZXS A;  2W82 A;  2PMZ N;  3PO2 J;  3HSF A;  3D1N I;  1FWZ A;  4MGR A;  2XB0 X;  5DTD A;  2YX4 A;  3FDY A;  2X6W A;  2OZ6 A;  3F8B A;  4BYY A;  4HBL A;  2UXX A;  3EET A;  3R4K A;  2CFO A;  4JOM A;  1X3Z B;  5DYM A;  3LOC A;  3SJM A;  3K4B A;  3Q0W A;  2Z3Y A;  1YW7 A;  2CMP A;  2L7K A;  3PSI A;  3WU2 C;  3IKT A;  2E7X A;  4E7H A;  2V1D A;  4FHT A;  3L00 A;  3OYB A;  1YFH A;  3DCF A;  3FIS A;  2XV4 S;  3V8K A;  2LBF A;  3PIP F;  4J00 A;  2BE5 F;  4P9F A;  2DMN A;  3DP7 A;  2LF8 A;  3IH3 A;  4N9I A;  2KRC A;  3KIO A;  2RDP A;  1FYM A;  3GLL A;  5TRD A;  3ZN0 A;  5LHI A;  3QU3 A;  4JBA A;  3BR5 A;  5J6X A;  1HW2 A;  3N4M A;  1BC8 C;  1K79 A;  2PI0 A;  1VQL I;  2LY9 A;  3BR1 A;  2DO7 A;  2F2E A;  3J81 K;  4BDY A;  3KYD B;  4M3G A;  4UUV A;  2R7S A;  4D7N A;  3GXO A;  4IX7 A;  1WH5 A;  2P5V A;  2R5Z A;  2A61 A;  5HS8 A;  2FBI A;  3SHF A;  4Y3O A;  4KA4 A;  1EF4 A;  3A1Y A;  4IQ4 A;  2AXL A;  4HQM A;  4PK4 A;  1MND A;  2HPM A;  3VYU B;  3V8L A;  1FP2 A;  1QGP A;  3CJQ B;  4KIC A;  5KAI C;  3E1S A;  2DFI A;  2DU9 A;  3I3L A;  2O9L A;  3HDD A;  1FBS A;  9ANT A;  1ZHF A;  3DKX A;  4FTH A;  1NTC A;  1S8N A;  1ZR2 A;  4FE4 A;  4N4N B;  4ZZD A;  2O3F A;  3SZP A;  5ERI A;  2VC0 A;  2VBX A;  3H36 A;  1TT5 B;  1B59 A;  3S2W A;  3DTK A;  4BQN A;  2K9N A;  1CQT A;  2KDO A;  2BZT A;  3CCS I;  2HOA A;  4BS9 A;  3H0G J;  1IO2 A;  1EKE A;  4L18 B;  4MFD A;  3ESW B;  2R5Z B;  1P2F A;  3ECH A;  4MNU A;  1UMQ A;  4BHP A;  4X0G A;  4AIH A;  2L7Z A;  1YI2 I;  2COM A;  1RNL A;  4MLO A;  2Y0M A;  5K1Y A;  1BR2 A;  4C30 A;  2MD5 A;  2YSR A;  1AHD P;  3MZY A;  2DA4 A;  4CCO A;  1CF7 B;  1PYV A;  3JRH A;  2RRE A;  3HZJ A;  1E2X A;  5BS6 A;  5D8K B;  1IZ1 A;  2IXS A;  1WH7 A;  3AG2 H;  4P96 A;  4I0B A;  5A2Q Z;  4ENN A;  3WU1 B;  1YIT I;  1SFX A;  1HLV A;  2VE8 A;  4G7H F;  3HB9 A;  1X58 A;  3DU5 A;  4AC0 A;  3ERM A;  1IN8 A;  1VQK I;  3C18 A;  2VKD A;  4NQW A;  2ZME C;  5D5W B;  1S7A A;  3SDB A;  1TTY A;  2KP6 A;  1O3Q A;  5M5Y J;  4E4H A;  2XPV A;  2DLL A;  1XD7 A;  1FZP B;  4MHG A;  4XRM A;  2JT1 A;  2BOL A;  1U78 A;  3RDI A;  1ETW A;  4BL0 B;  2JRT A;  1J59 A;  2ZXH A;  2R7U A;  2MFZ A;  2ZFU A;  3AG4 H;  2TDX A;  3TDU C;  5FKK A;  2O8X A;  1Z0X A;  1DP7 P;  2DYR H;  2TRT A;  2VPR A;  3V8J A;  2WAE A;  1TQI A;  3BQZ A;  4BJT A;  4V2F A;  2JVG A;  3M7G A;  4PFP A;  5E3O A;  2DPD A;  2EIL H;  4MQV A;  4ASN A;  1BJA A;  1F9N A;  2A05 A;  2VON A;  2BY3 A;  2RV8 A;  2E1O A;  4G8X A;  5K5Q A;  3A01 A;  2LKX A;  4HYE A;  3M1C A;  4DQ2 A;  4NQW B;  3KEQ A;  5F08 A;  2O8K A;  5CVV A;  3O2P E;  3TED A;  3MKY B;  3RKX A;  1ACI A;  2HQ5 A;  1B1B A;  4UY8 I;  3K10 A;  3LAP A;  4BGD A;  2RVC A;  2DN0 A;  1I6H J;  4RAG A;  3ZMD A;  2JQ7 A;  1DPR A;  1ODD A;  2DT5 A;  4EJV A;  3ZQG A;  3AAF A;  2ZFW A;  3CCL I;  4BEH A;  3H5R A;  3ZQQ A;  4ENJ A;  3FZV A;  3F23 A;  2UZK A;  3H9G A;  1X2M A;  4WXH A;  1IG7 A;  3TBI A;  2EJR A;  2FMY A;  4L0Z B;  2HXO A;  5J4V A;  2NVT J;  2DI3 A;  4K2E A;  3OS1 A;  3PL8 A;  1WRJ A;  2IS1 A;  1T98 A;  3QP5 A;  1IUF A;  3EPZ A;  3A01 B;  1TNT A;  3ABT A;  1N78 A;  5ILU A;  2Q0O A;  3NEU A;  1IXS B;  1MJ9 A;  4ZYG A;  3IRQ A;  5DV5 A;  4OIQ F;  5K7F A;  3G2B A;  3FXQ A;  3R0J A;  1JT0 A;  4BXX J;  2B9S A;  3WU0 A;  2NRA C;  3M8E A;  1EH6 A;  2BV6 A;  4FX0 A;  4YFX F;  4RB3 C;  3HRT A;  1S7E A;  1HXD A;  2KIF A;  4O5V A;  1K78 A;  3O8H A;  1D8J A;  2A5W A;  4BEH B;  1ZRC A;  3BCB A;  3S8P A;  2H8R A;  1JHH A;  2XGC A;  3FXO A;  4A69 C;  2KIS A;  1T08 B;  3BPV A;  3S3O A;  4B8X A;  1Z1D A;  1GVD A;  1AWC A;  4ON0 A;  3NRV A;  2BEO A;  1FMV A;  3DLL F;  4L9T A;  2A6E F;  1V4R A;  2K85 A;  2ZO4 A;  3IH4 A;  1LJ9 A;  4B48 A;  4OIN F;  2KJB A;  3R60 A;  3OYI A;  4HDU A;  1UG0 A;  1N77 A;  1F1Z A;  1X1P A;  2VAS A;  2QEX I;  1MBE A;  1UJ8 A;  1ZQ3 P;  3FXR A;  3GBG A;  5DCM A;  2VKE A;  1RR8 C;  3QOD A;  1K78 B;  2QQB A;  3Q3S A;  4WXD A;  4XSZ F;  2CV0 A;  5EGO A;  2GLO A;  3T0Y A;  2FE3 A;  4ZTJ A;  3JRC A;  2KRF A;  5IP6 A;  2VBW A;  3AFH A;  4PJN A;  2OCC H;  2M34 A;  3FMS A;  4XRS A;  3EDP A;  3BR0 A;  1KU3 A;  3OR1 C;  3PUB A;  1UEL B;  3OR2 C;  4CH7 A;  3P9K A;  2I10 A;  1RRJ A;  3ZGK A;  4MQ9 F;  3OYH A;  3L2U A;  4EAT A;  5DEQ A;  2WWY A;  4IRH A;  4U7B A;  4Y4R A;  2IVM A;  3QWL A;  2XF7 A;  3JAM Z;  4PGG A;  1Z67 A;  1IV6 A;  1ZG1 A;  2X9D A;  3W3C A;  3G6E I;  1T8I A;  3DBL B;  2R7X A;  2GOM A;  5DCM B;  2HQN A;  1SEU A;  1K4S A;  4NHJ A;  2W48 A;  1O7L A;  2WB1 N;  2ZB9 A;  4AUX A;  4CDG A;  2M45 A;  2HPI A;  2L02 A;  5ILV A;  4DNC A;  1MH4 A;  2CS3 A;  1LPQ A;  1GXQ A;  3E6B A;  4BKX A;  5JHU A;  1FOX A;  1ZRF A;  1J7K A;  4B3A A;  4BQQ A;  4M74 A;  4XLN F;  1XGS A;  1LNW A;  2IP2 A;  3LQQ A;  1X1D A;  3P9I A;  1MMN A;  2XAQ A;  1Y0U A;  2AQF A;  5CKT A;  4OAY A;  2H94 A;  2LNB A;  1OPC A;  2V9V A;  2XB5 A;  2O61 A;  3ASN H;  4I6Z A;  1U5T A;  4RS8 A;  2P8T A;  2IJL A;  3LQR A;  5JR3 A;  4Y17 A;  1SD7 A;  3L9F A;  2OPT A;  1JGG A;  3GUD A;  1XMK A;  4YFK F;  3GTJ J;  4RDU A;  3PNT A;  1V55 H;  2UWM A;  1EA3 A;  1OYW A;  2FUG 2;  3AL0 C;  4B1R A;  1MBG A;  2XHK A;  2F5C A;  1S3J A;  1Z77 A;  3ONQ A;  4XON A;  2NVQ J;  4XLH A;  1DDN A;  3OYN A;  2EPF A;  4MO7 A;  3F21 A;  4B47 A;  2EK5 A;  3HOT A;  4M73 A;  3LSM A;  5IOZ A;  3K70 C;  3BG9 A;  1U5T B;  5AON A;  1TZL A;  4ETS A;  1KU7 A;  2VT3 A;  3G1O A;  1VQ7 I;  2QQ9 A;  1GXP A;  1HC8 A;  2BXY A;  4CZC A;  1LKX A;  5F6F A;  5M5X J;  1D1A A;  3CDH A;  2M4G A;  2WAD A;  1HDD C;  1Z21 A;  5J1U A;  2NNN A;  2GIV A;  3VYR B;  1VTN C;  3FF5 A;  2K02 A;  3U9G A;  2JTV A;  2MBF A;  2V6C A;  4LB6 B;  2VT2 A;  1YIJ I;  5DD8 A;  1WJE A;  2B0L A;  1O3S A;  2OF7 A;  2R7W A;  2DQR A;  4ZH4 F;  2F5F A;  2A07 F;  3I58 A;  1HA8 A;  2EV5 A;  2FXA A;  2IGN A;  2OJE D;  3JTH A;  2EZK A;  2XAS A;  4L9N A;  1TW3 A;  2A68 F;  2BYV E;  4GGG A;  3L2W A;  1KYZ A;  2LF7 A;  2JRM A;  5E8G A;  2NOG A;  2LKS A;  4A6D A;  5H2F C;  2FU4 A;  5JHF A;  4KMU X;  1VQN I;  3CJT B;  4ITV A;  1YQA A;  1R5H A;  1OYI A;  2WBM A;  3DBR B;  3WGI A;  1G4D A;  2CQQ A;  2VN2 A;  1ERD A;  3ULQ B;  5K7H A;  3DTE A;  3JTG A;  3F22 A;  1VQ5 I;  4A3K J;  2KFD A;  3SDG A;  3HTU A;  3A02 A;  3D5L A;  5LFA A;  4V2G A;  1XGN A;  1KON A;  1IF1 A;  4UVB A;  4CO8 A;  5J40 A;  2OD5 A;  1WQ2 A;  3BWG A;  5LBQ A;  2HTJ A;  5TGT A;  4ESB A;  2FOW A;  3KEO A;  4AYB A;  4IO9 F;  2M87 A;  1DQU A;  3UNG C;  2AHQ A;  3IUO A;  1J9I A;  3BRO A;  2QUF A;  4KJZ A;  5F1J A;  3CCU I;  1BA5 A;  3O6B B;  4HV6 A;  3KZZ A;  3CJN A;  1UHS A;  5FRO A;  3KYL A;  4OWR B;  2VJ5 A;  3G3Z A;  2LMD A;  2DTZ A;  5LLQ A;  1W36 D;  4PJ0 C;  4CCJ A;  3OYJ A;  1VND A;  1NK2 P;  2UXN A;  2Y69 H;  3EQL F;  5FO5 A;  3T8R A;  1UZC A;  1Z05 A;  1FPQ A;  2YUS A;  1RIO H;  4BHB A;  2F4I A;  3TP0 A;  4C2T A;  1T38 A;  2OA4 A;  3ERE D;  3MQ0 A;  5E3N A;  1EH7 A;  2EFO A;  4RM2 A;  2R7T A;  2XAF A;  1KZH A;  5E8I A;  3VFZ A;  3AG1 H;  3HM5 A;  2CFX A;  1Z9C A;  3K0L A;  3QP6 A;  4G94 A;  1G3T A;  4HLY A;  3RCO A;  4CXF A;  1QZZ A;  2R7V A;  4A5M A;  3FMQ A;  4C3I J;  2HDW A;  2R7D A;  4LG3 A;  3RQ4 A;  3Q5F A;  1K6O A;  4BQO A;  4R8H A;  2E71 A;  3KCC A;  4NBQ A;  1IN7 A;  1IRZ A;  3Q9V A;  4Y15 A;  2MA3 A;  4HNT A;  1LDK B;  4A3G J;  2D5V A;  1ON2 A;  1ZLJ A;  3DLA A;  4NC6 A;  2K9L A;  5LGU A;  3BG5 A;  2WY7 Q;  1KU9 A;  1ON1 A;  2ZXJ A;  4UXN A;  1S9H A;  4A3F J;  5GTH C;  1E17 A;  2GM4 A;  3EUA A;  2XAJ A;  3ZQI A;  1ZN2 A;  2PBI A;  5KAF C;  2IA1 A;  4XKC A;  3KEY A;  3M9A A;  1H0M A;  2NS7 A;  2VOD A;  1EV7 A;  1MMD A;  2DOF A;  4YRV A;  4S04 A;  3ZP5 A;  1B9N A;  3HPH A;  2DMQ A;  1STZ A;  1YJW I;  2PMZ A;  2NVX J;  3JRA A;  3SEZ A;  3RKW A;  2ZNZ A;  1K83 J;  2YU3 A;  5F0C A;  2ZJP F;  2PG4 A;  1ZAO A;  3HRU A;  1Z91 A;  5IT9 K;  5K5O A;  4CSW A;  2OBP A;  5J47 A;  4IHX A;  1Z7U A;  3TOB A;  1U0J A;  3BJA A;  5CLS A;  5LGN A;  2O5R A;  2MLK A;  3CQZ J;  2MH9 A;  4NC8 A;  3ZMU A;  3E6M A;  2FQ4 A;  4S0H B;  4G6T B;  2Y31 A;  4HG2 A;  3BOQ A;  2PEX A;  3WTU C;  1K61 A;  1KGS A;  2Z16 A;  3EYI A;  4Q47 A;  1R1U A;  2Y2Z A;  1MNM C;  1YJN I;  2DA7 A;  3GW2 A;  3ZQF A;  2ZSH B;  1JE8 A;  3ABK H;  1MSF C;  2R7Z J;  1B8I A;  2VQG A;  1XGO A;  2HYF A;  2PMU A;  5IP7 J;  1E3P A;  4YFN F;  1GV5 A;  2VJJ A;  2W85 A;  3RKQ A;  2NNY A;  3MKZ A;  2K3P A;  1B9M A;  4ZYA A;  4IQJ A;  4F55 A;  4P55 A;  2F5D A;  1VI0 A;  3CP8 A;  3HRS A;  4II2 A;  4U88 A;  2JA7 J;  3BZC A;  2VJ4 A;  3OYM A;  3G4S I;  1HKQ A;  4UHT A;  1ZGW A;  2F4M B;  2Z2S B;  1I1G A;  3FHZ A;  2HWV A;  2K40 A;  2DQL A;  4M71 A;  4PZJ A;  4EVI A;  3K7A J;  1BJZ A;  2YX7 A;  4XK4 A;  3CCR I;  4AIK A;  1LVA A;  3BR6 A;  1HOM A;  1B8I B;  1YG2 A;  1KQ9 A;  1TBX A;  3TO9 A;  4B44 A;  2BY0 A;  1FNN A;  3ISP A;  2JZY A;  4O3M A;  1XN7 A;  1OR7 A;  2LK2 A;  3GTP J;  3FBI B;  2IA0 A;  1SC7 A;  3J7Y J;  2YU9 J;  4O6J A;  1WCM J;  3ABU A;  2CU7 A;  3K6G A;  4A3D J;  4RB0 A;  5F64 A;  4YIR X;  2Q8K A;  1MJB A;  3I54 A;  3CTA A;  3DQV C;  1XB4 A;  1XDS A;  3S17 J;  3EUK L;  4A93 J;  2KZV A;  3RI4 A;  4UUS A;  1FOK A;  1SD5 A;  1T0F C;  3K4N A;  3RTR A;  5E1W A;  2XSD C;  3F3X A;  2ZNY A;  5HDG A;  1RUO A;  2X48 A;  2IRF G;  5FLX K;  1ORK A;  3PO3 J;  1VQP I;  3K2Z A;  4ZYH A;  1J5Y A;  5CVR A;  1JGS A;  3BY6 A;  4D1Q A;  4KDP A;  3J80 K;  4M3F A;  5DUK A;  3A0B C;  4N9H A;  1OFC X;  2FNA A;  1G3W A;  4NC7 A;  1XMA A;  4XID A;  1Y6I A;  2JSC A;  1MBH A;  1IXC A;  3HSR A;  2MAB A;  3LWF A;  3CO6 C;  5GAG J;  1FTT A;  3IKV A;  5HNH A;  2X1D A;  4C2M J;  1NG6 A;  1WI3 A;  3MN2 A;  2CQN A;  4UNO A;  3CF5 F;  3K70 D;  4UUS B;  2E5N A;  3C7J A;  3U21 A;  4D0P A;  4XRS G;  3K2A A;  2BGC A;  1JXS A;  4DOZ A;  4M9X A;  4DYC A;  4QLC U;  3I5U A;  4HX8 A;  2EIK H;  4HEA 2;  1NHA A;  2K9S A;  1Q1V A;  3HUG A;  3WTT C;  5J4Y A;  1U9N A;  1FT9 A;  4BJ6 C;  3BLY A;  3IL2 A;  3H1C A;  2E35 A;  4IPA A;  1OCC H;  5HLT A;  4A6E A;  1OCO H;  1USS A;  1EH8 A;  3KLO A;  4XMY A;  5CYV A;  4KIT B;  4PJM A;  2G0E A;  3J7A O;  4GFB A;  3LSR A;  3RPU A;  4KT5 C;  3K9T A;  3I4N J;  2FRH A;  2ADU A;  2HVQ A;  4PSX A;  4HZF A;  4GRI A;  1J0R A;  2QM3 A;  5DM6 F;  3K1N A;  4RAF A;  3N05 A;  2KKO A;  4FT8 A;  2VQC A;  5J8C A;  2Y0S A;  3HUG B;  3OWT A;  4XKW A;  1ULY A;  3N97 A;  1W5S A;  4LMY A;  4AM3 A;  4EEF G;  4HF0 A;  4ZZL A;  3E7L A;  2V1U A;  1D1C A;  4B4C A;  3W2V A;  4B09 A;  3QRF F;  4LFU A;  3DBH B;  4XNF A;  2X0L A;  2FJ1 A;  4BQA A;  5EEA A;  2A6T A;  1CF7 A;  2MG4 A;  5IYD J;  1RC9 A;  1AKH A;  1TQP A;  3BG7 A;  4AIJ A;  2V4J C;  4IHW A;  1XS9 A;  5CQG A;  4F93 B;  1MBK A;  4EJO A;  4MTD A;  3F9K A;  1WFX A;  4WF2 A;  5EJC A;  3FWE A;  2A6H F;  2CWE A;  3S3M A;  2LOO A;  4L5J A;  4EJW A;  1B6A A;  3JSO A;  1NK3 P;  3B02 A;  3ZR8 X;  3CC2 I;  1YX5 A;  4YII A;  3G1L A;  4CHU A;  2RN7 A;  4HNV A;  4KIB A;  2OU2 A;  2R3S A;  1UST A;  1RR7 A;  2PX9 A;  5LHH A;  4KNY A;  1O7F A;  2CG4 A;  4HX4 A;  3PNV A;  4BAC A;  3F6O A;  2PJP A;  2PJR A;  2DOE A;  1FMW A;  3HHH A;  3IC7 A;  3OY9 A;  5FRN A;  1TWF J;  1JT6 A;  2RNJ A;  4WXC A;  2A69 F;  2L0K A;  1APL C;  2D45 A;  3H0D A;  3E6C C;  4D5C A;  4JYK A;  4CCK A;  1AKH B;  3LL7 A;  1QPI A;  2L2O A;  2RQQ A;  1OIS A;  5DCF A;  4HQE A;  3GTK J;  4RA2 A;  5HDK A;  5K5R A;  3J81 Z;  2EZH A;  2JWT A;  1MBF A;  2CUE A;  1R5I D;  3RKY A;  2XKP A;  3M3Y J;  1ZR4 A;  4IXA A;  3J7Z I;  2XIG A;  1G3Y A;  1DU6 A;  1QVU A;  4BY7 J;  2V9P A;  2PJR B;  3E97 A;  2TCT A;  5C3E J;  2P0W A;  4LD5 A;  2R5Y A;  4A0X A;  2CGP A;  1QRY A;  2VQL A;  2ESN A;  5BOX A;  2DYS H;  1BI2 A;  2H6B A;  2GBY A;  3CP2 A;  3S32 A;  4OU0 A;  1QZY A;  4YEL A;  4BHC A;  4XKB A;  3HL2 A;  2K3F A;  1D3Y A; 
#chains in the Genus database with same CATH homology
 4KYW A;  3HTS B;  1IXR C;  4R1H A;  5CVJ A;  1MDM A;  2J5P A;  1UHM A;  4RB1 A;  2FQ3 A;  1LDJ A;  4MTE A;  1S7O A;  1XDU A;  2ISZ A;  1IAW A;  3BZ6 A;  3JSP A;  5LGT A;  1GHC A;  3V7R A;  3MCZ A;  5ICE A;  1JHF A;  3KP3 A;  1MDM B;  1HW5 A;  1H9T A;  5D4S A;  4I02 A;  2EA2 A;  3K1P A;  3M8F A;  4IHS A;  3GO5 A;  2GXB A;  2HDC A;  3CO7 C;  3FX3 A;  1IN5 A;  2H09 A;  4MEY F;  1X3U A;  1O3T A;  4EMS A;  2C6Y A;  2VBZ A;  3E6D A;  1UHW A;  1FYL A;  2VXZ A;  4UV9 A;  3CUQ A;  3DF8 A;  1BI3 A;  1R1T A;  5LEK A;  2LKP A;  4RB2 C;  1ZGA A;  5JI6 A;  5BMZ A;  1D5V A;  2Z5U A;  5HOO A;  3QPH A;  3TO6 A;  2HGC A;  3U1D A;  2G9W A;  4RAY A;  4KIF A;  4EM1 A;  3CUQ B;  1C0W A;  4UVC A;  2QZ8 A;  2HKX A;  4RGS A;  4HOB A;  4RAZ A;  1HKS A;  2XRO A;  4IF4 A;  3PQK A;  2QYO A;  3HRM A;  4KN4 X;  1YIO A;  2KJC A;  2ESH A;  2ISY A;  2HEO A;  4EJT A;  3CUO A;  4A0Z A;  2HKO A;  1O57 A;  2QBY A;  2ZCW A;  1ZG5 A;  3DPT A;  5BPD A;  1P4W A;  1FLI A;  2P6S A;  5LEJ A;  3KZY A;  5L3B A;  5FGM A;  5HDN A;  2QBY B;  1GVJ A;  4RGX A;  3VB2 A;  1J2X A;  2Y75 A;  3TOA A;  3SZT A;  3F8F A;  1A04 A;  1XCB A;  2QQA A;  5ICC A;  4Y13 A;  2ZME A;  3GFJ A;  5FFX A;  2XVC A;  2ACJ A;  2PFB A;  2RGV A;  2NS0 A;  5H6Q A;  4I09 A;  2R7F A;  5HLI A;  2WTE A;  3ECO A;  1PP7 U;  4NB5 A;  3NQO A;  2VE9 A;  2QWW A;  1G6N A;  2M5W A;  4BAY A;  2STT A;  4TV7 A;  2ZME B;  3Q9S A;  2HZT A;  4LJZ F;  4PDK A;  1R23 A;  1W4M A;  2W57 A;  1I6X A;  3K69 A;  4EGY A;  1ZG3 A;  1PDN C;  1YTY A;  3KFW X;  1UB9 A;  2PMH A;  2NAZ A;  3T5X A;  5CJ9 A;  1RUN A;  1S29 A;  3FXU A;  5ICF A;  1W7P A;  2D1V A;  3BP8 A;  3LA3 A;  5ED4 A;  1HKT A;  3V4G A;  4U0V A;  2JPC A;  2YR2 A;  1YS6 A;  3PFI A;  3JW4 A;  3H3Z A;  5HS9 A;  4XRF A;  1W7P B;  2Z99 A;  2JPB A;  1QBJ A;  2OAZ A;  2PLY A;  1R7J A;  4L0Y B;  2EA4 A;  3FM3 A;  1I1S A;  1FSE A;  3QU6 A;  3ZMZ A;  4GYI A;  2IA2 A;  3L09 A;  5L3E A;  1R00 A;  1S6L A;  3T1B A;  3WTW C;  2L4M A;  3F8M A;  2WC2 A;  1MGT A;  4ESJ A;  1XCV A;  2Z9O A;  2DBB A;  1YS7 A;  1SMT A;  3GFM A;  3V7C A;  4Q4Z F;  5BPI A;  1QPM A;  4P5O A;  5E17 F;  3IWZ A;  2A3S A;  3ROU A;  1HSJ A;  3I64 A;  3WGH A;  3R6S A;  4S05 A;  4M72 A;  1YLF A;  1V3F A;  2HOE A;  2D1H A;  1PUE E;  2CSO A;  2DTR A;  2GQQ A;  2LSO A;  1K7A A;  5AIQ A;  3FM5 A;  4HX7 A;  2YPR A;  3WG9 A;  2PQ8 A;  4XSX F;  5JFR A;  3GFI A;  4CGZ A;  2M30 A;  3L7W A;  1YW8 A;  2L54 A;  2FOK A;  2FF4 A;  2CW0 F;  3R61 A;  3CLO A;  2A5Y B;  3HSE A;  1XSV A;  4WK8 F;  3P9C A;  1UFM A;  3LST A;  5F1R A;  3IRR A;  4Q5S F;  2GWR A;  3WOD F;  5DD4 A;  3DFG A;  4KN7 X;  5L3G A;  1MKM A;  3TQN A;  3W6J B;  2K4B A;  5IT9 Z;  4AD9 A;  4I0A A;  4U0Y A;  2IT0 A;  2XGX A;  3RYR A;  2P4W A;  1LDD A;  4XBF A;  3W6K B;  1KQ8 A;  3EYY A;  4GO1 A;  3TDZ C;  2E1N A;  2VBY A;  1REP C;  5E1X A;  4PCQ A;  1Z6R A;  4IRG A;  3I53 A;  3TKY A;  5KVR A;  3OOP A;  3VOD A;  2W25 A;  1TW2 A;  4IJA A;  5D5U B;  3I0T A;  4LK0 F;  1FSH A;  4EGZ A;  3HHG A;  1SFU A;  2QLZ A;  5LRS A;  3VEP A;  2GA2 A;  4LGW A;  1KQ0 A;  5HLG A;  3DEU A;  1FYK A;  4RGU A;  2P7V B;  3KP7 A;  4EM0 B;  4U7D A;  4L9J A;  3LAJ A;  4G6Q A;  4RGR A;  4KMF A;  5D5X B;  1BBY A;  1ZAR A;  4CZZ A;  5LHG A;  2XAH A;  2W84 A;  2Z33 A;  3M1E A;  2FNP A;  3RPQ A;  3I4P A;  5E20 A;  1BN5 A;  1P92 A;  4GYG A;  2EV0 A;  5FLX Z;  4HAM A;  2H27 A;  2HFH A;  5ILS A;  2K4J A;  1ZLK A;  4EM2 A;  2L01 A;  2LDU A;  3J80 Z;  5D4R A;  4PGH A;  1SD4 A;  3RIR A;  1KYW A;  4E70 A;  4LB5 A;  3GZ5 A;  1FY7 A;  4HF2 A;  1KA8 A;  1IUY A;  3MAJ A;  1LQ1 A;  5A2Q K;  2GXG A;  5D6F A;  2DK5 A;  4G7Z F;  4A12 A;  3MEX A;  3QPT A;  3BJ6 A;  1LEB A;  4I01 A;  4KFC A;  1BM9 A;  4IVN A;  2DAO A;  5D8L B;  2WV0 A;  2F5E A;  2EFP A;  3C3W A;  2XKO A;  3IHU A;  2ETH A;  3V7S A;  4Q48 A;  1WKM A;  4WX9 A;  3LA7 A;  1Z6T A;  2EFN A;  1BIB A;  1U5T C;  2CYY A;  3T8T A;  4I2O A;  4L9V A;  1H9G A;  5HS7 A;  4EV0 A;  3ZPL A;  1QO0 D;  2MLG A;  3LA2 A;  5KK1 A;  2ELH A;  1WSU A;  2O03 A;  4LLL A;  2ZJ2 A;  2EFQ A;  1KU2 A;  3H92 A;  3KP5 A;  5EEH A;  4CYD A;  3HIF A;  3VOE A;  2FML A;  1TNS A;  1L3L A;  4GXO A;  2Q2E A;  4ZYD A;  1OKR A;  4I7H A;  4LG0 A;  1AOY A;  3RYP A;  4ENK A;  4JQF A;  3QOP A;  2L3D A;  1LEA A;  1T0F A;  4ESF A;  1F4K A;  1R5G A;  3GYH X;  3E5X A;  2QVO A;  3KE2 A;  2L4A A;  1U3E M;  4G9Y A;  4ENM A;  1BI1 A;  4I98 B;  5L3D A;  4A5N A;  4LG0 B;  3GVA A;  3JAM K;  2FEZ A;  2OQG A;  2K27 A;  4IRI A;  5EEG A;  1SMY F;  2IPQ X;  5AIP A;  2VOO A;  2VC1 A;  4HA8 A;  1IRG A;  5JVT A;  2V1X A;  1LB2 A;  1B4A A;  2AS5 F;  4OMY A;  4M9Z A;  4JK1 X;  1CGP A;  3GFL A;  3COA C;  4OIP F;  2XAG A;  3BDD A;  3ZQ7 A;  1SD6 A;  5HVQ C;  4UVA A;  5TJJ A;  1XGM A;  4R79 A;  3HOS A;  2FSW A;  1ZH5 A;  2HS5 A;  3WTV C;  3E3V A;  4GCV A;  3K1M A;  3DPL C;  1DUX C;  3E5U A;  3MFK A;  3F72 A;  4AVP A;  1U8R A;  3ZN1 A;  2ZBK A;  3OV8 A;  2CO5 A;  4WWC A;  1I5Z A;  5DUI A;  2CQK A;  1FP1 D;  3B73 A;  3ZMV A;  2OQR A;  3WTZ A;  1RI7 A;  3BPX A;  5L3C A;  2EWN A;  2H6C A;  1SAX A;  2OZU A;  1F5T A;  1IRF A;  3WTS C;  1D8K A;  4M6X A;  5BQT A;  1G3S A;  3SFZ A;  1R22 A;  4FX4 A;  3LFK A;  1ONV A;  2E1C A;  2M1B A;  3E5Q A;  1FBQ A;  2HQR A;  5H6R A;  4HLX A;  2RC4 A;  3ML6 A;  2E7W A;  5E18 F;  1HW1 A;  1P4A A;  1U2W A;  4ZYE A;  4BNC A;  4IHT A;  1UCR A;  2G7U A;  2DW4 A;  2O6G E;  1BIA A;  4BXU A;  2HTS A;  1HQC A;  5ICG A;  3WE2 A;  2DK8 A;  1YO5 C;  1FBU A;  1R36 A;  4HDV A;  3O3K A;  3ZMS A;  2GA1 A;  1IN4 A;  5J8F A;  3U2R A;  3GX4 X;  1R1V A;  1T2K A;  1IN6 A;  1O3R A;  1OYY A;  5DDG A;  2IW5 A;  4OIO F;  2RKH A;  2HR3 A;  3TGN A;  2K86 A;  3FMR A;  4BH9 A;  2V79 A;  4CIC A;  1OMI A;  4H0E A;  1SFE A;  1QQI A;  4KIG A;  3KP4 A;  3F6V A;  2P5L C;  2HYG D;  4YIF A;  5FFZ A;  3H3U A;  2D2W A;  3KP6 A;  5L3F A;  2EB7 A;  4UV8 A;  2G7H A;  3I59 A;  3P7N A;  3GEZ A;  1BC7 C;  5HLH A;  1FC3 A;  1YW9 A;  1MJA A;  3WTY C;  3GWZ A;  2FBH A;  4P9U A;  2P6T A;  3KP2 A;  4YG2 F;  3DV8 A;  2FBK A;  2QEN A;  2MC3 A;  5H20 A;  2Y48 A;  2RQP A;  1TQM A;  3I59 B;  3QAH A;  3MWM A;  1L0O C;  1ZGJ A;  1R58 A;  4AWX B;  1RZ4 A;  1ZYR F;  4M9S A;  2ZKZ A;  1ZRD A;  4LK1 F;  6PAX A;  4QWQ A;  2O0Y A;  5E1Z B;  3IWF A;  3KLN A;  4HW0 A;  4A0Y A;  4Z2Y A;  2MH2 A;  3MZH A;  3ZMT A;  2FA5 A;  1W7P D;  3BJO A;  5FD6 A;  1ZRE A;  2XRN A;  4EJU A;  4XLP F;  2GAU A;  4U0W A;  3REO A;  4N0B A;  4F7Z A;  5CVU A;  4OIR F;  2J5O A;  1XSD A;  4G7O F;  2M8E A;  3WGG A;  4HV5 A;  4L5I A;  1WI9 A;  1DPU A;  2KIM A;  3F8N A;  2VOP A;  2XUB A;  3GLX A;  5D5V B;  4LLN A;  4M6Y A;  1W5T A;  4A2U A;  1XSX A;  3SXY A;  3SQN A;  1T6S A;  5LRR A;  2EFW A;  2STW A;  2EV6 A;  5FB2 A;  1P4X A;  2GZW A;  4HF1 A;  2DPU A;  3WE3 A;  1T39 A;  1BI0 A;  1MZB A;  3ELK A;  3G73 A;  1HBX G;  1FX7 A;  4WCG A;  3DXJ F;  4OMZ A;  3GZ6 A;  4KUM A;  3DKW A;  1QNT A;  3HYI A;  1WWX A;  1I27 A;  1Q1H A;  2W24 A;  1MD0 A;  1YYV A;  4EQQ A;  3C1D A;  1P6R A;  4LLG F;  3WTX C;  2P7C B;  3GF2 A;  1BOA A;  2PN6 A;  2X4H A;  5IT3 A;  3PQJ A;  3RJP A;  1J75 A;  2KIU A;  3KET A;  3R0A A;  4OOI A;  1HST A;  3F8C A;  3TO7 A;  4G6D A;  5D6E A;  1PP8 F;  1IW7 F;  4MEX F;  3L2C A;  3D0S A;  3I71 A;  3EUH A;  1TLH B;  5CVI A;  2P5K A;  5FD5 A;  1U6G A;  3CUQ C;  2K7L A;  2BBY A;  2NYX A;  3HSF A;  1FWZ A;  4MGR A;  2YX4 A;  2OZ6 A;  3F8B A;  4BYY A;  4HBL A;  2UXX A;  3EET A;  3R4K A;  5DYM A;  2Z3Y A;  1YW7 A;  3IKT A;  2E7X A;  2V1D A;  4FHT A;  3L00 A;  1YFH A;  2XV4 S;  3V8K A;  2BE5 F;  4P9F A;  3DP7 A;  2LF8 A;  4N9I A;  2RDP A;  1FYM A;  5TRD A;  3ZN0 A;  5LHI A;  3QU3 A;  4JBA A;  5J6X A;  1HW2 A;  3N4M A;  1BC8 C;  1K79 A;  2PI0 A;  2DO7 A;  2F2E A;  3J81 K;  4UUV A;  3GXO A;  2P5V A;  2A61 A;  5HS8 A;  2FBI A;  3SHF A;  4KA4 A;  2AXL A;  4HQM A;  3V8L A;  1FP2 A;  1QGP A;  4KIC A;  2DFI A;  2DU9 A;  1FBS A;  1ZHF A;  1S8N A;  4ZZD A;  2O3F A;  3SZP A;  5ERI A;  2VC0 A;  2VBX A;  1B59 A;  3S2W A;  4L18 B;  1P2F A;  3ECH A;  4MNU A;  4BHP A;  4AIH A;  2COM A;  1RNL A;  2Y0M A;  5K1Y A;  2MD5 A;  2YSR A;  3MZY A;  1CF7 B;  1E2X A;  5BS6 A;  5D8K B;  1IZ1 A;  4P96 A;  4I0B A;  5A2Q Z;  4ENN A;  3WU1 B;  1SFX A;  2VE8 A;  4G7H F;  1IN8 A;  3C18 A;  4NQW A;  5D5W B;  1S7A A;  1TTY A;  1O3Q A;  2DLL A;  1XD7 A;  1FZP B;  4MHG A;  2JT1 A;  1U78 A;  3RDI A;  2JRT A;  1J59 A;  3TDU C;  2TDX A;  2O8X A;  1DP7 P;  3V8J A;  1TQI A;  3M7G A;  2DPD A;  4MQV A;  4ASN A;  1BJA A;  1F9N A;  2VON A;  2RV8 A;  4G8X A;  5K5Q A;  4HYE A;  4DQ2 A;  3KEQ A;  5CVV A;  3O2P E;  3RKX A;  1B1B A;  3LAP A;  2RVC A;  3ZMD A;  1DPR A;  1ODD A;  2DT5 A;  4EJV A;  3AAF A;  2ZFW A;  4ENJ A;  3FZV A;  3F23 A;  2UZK A;  4WXH A;  2EJR A;  2FMY A;  4L0Z B;  2DI3 A;  4K2E A;  1WRJ A;  1T98 A;  3QP5 A;  1TNT A;  3ABT A;  5ILU A;  2Q0O A;  3NEU A;  3IRQ A;  1IXS B;  1MJ9 A;  4ZYG A;  5DV5 A;  4OIQ F;  3FXQ A;  3R0J A;  3WU0 A;  2NRA C;  3M8E A;  1EH6 A;  2BV6 A;  4FX0 A;  4YFX F;  4RB3 C;  3HRT A;  1HXD A;  2KIF A;  4O5V A;  1K78 A;  1D8J A;  1ZRC A;  1JHH A;  3BPV A;  1AWC A;  4B8X A;  1Z1D A;  4ON0 A;  3NRV A;  2BEO A;  4L9T A;  2A6E F;  1V4R A;  2ZO4 A;  1LJ9 A;  4OIN F;  2KJB A;  3R60 A;  4HDU A;  1F1Z A;  3FXR A;  5DCM A;  1K78 B;  2QQB A;  4WXD A;  4XSZ F;  3T0Y A;  2FE3 A;  2KRF A;  2VBW A;  3FMS A;  3EDP A;  1KU3 A;  3P9K A;  4MQ9 F;  5DEQ A;  2WWY A;  4IRH A;  4U7B A;  2IVM A;  3JAM Z;  4PGG A;  1ZG1 A;  5DCM B;  2HQN A;  4NHJ A;  1O7L A;  4CDG A;  2M45 A;  2L02 A;  5ILV A;  4DNC A;  3E6B A;  5JHU A;  1GXQ A;  1ZRF A;  1J7K A;  4M74 A;  4XLN F;  1XGS A;  1LNW A;  2IP2 A;  3LQQ A;  3P9I A;  2XAQ A;  1Y0U A;  2H94 A;  2LNB A;  1OPC A;  2V9V A;  2O61 A;  1U5T A;  4RS8 A;  2P8T A;  2IJL A;  3LQR A;  5JR3 A;  4Y17 A;  1SD7 A;  3L9F A;  3GUD A;  1XMK A;  4YFK F;  2UWM A;  1OYW A;  2XHK A;  2F5C A;  1S3J A;  1DDN A;  3F21 A;  2EK5 A;  3HOT A;  4M73 A;  1U5T B;  5AON A;  4ETS A;  1KU7 A;  2VT3 A;  2QQ9 A;  1GXP A;  5F6F A;  3CDH A;  2NNN A;  2GIV A;  1VTN C;  3FF5 A;  2K02 A;  3U9G A;  2JTV A;  2MBF A;  2V6C A;  4LB6 B;  2VT2 A;  5DD8 A;  2B0L A;  1O3S A;  2DQR A;  4ZH4 F;  2F5F A;  2A07 F;  3I58 A;  2EV5 A;  2FXA A;  3JTH A;  2XAS A;  4L9N A;  1TW3 A;  2A68 F;  2BYV E;  4GGG A;  1KYZ A;  2LF7 A;  5E8G A;  4A6D A;  2FU4 A;  4KMU X;  1YQA A;  1R5H A;  1OYI A;  3WGI A;  1G4D A;  2VN2 A;  3ULQ B;  3JTG A;  3F22 A;  3HTU A;  3D5L A;  1XGN A;  1IF1 A;  4UVB A;  4CO8 A;  2OD5 A;  1WQ2 A;  3BWG A;  5LBQ A;  2HTJ A;  4ESB A;  3KEO A;  2M87 A;  1J9I A;  3BRO A;  2QUF A;  3O6B B;  4HV6 A;  3KZZ A;  3CJN A;  3G3Z A;  5LLQ A;  2UXN A;  3EQL F;  5FO5 A;  3T8R A;  1Z05 A;  1FPQ A;  1RIO H;  4BHB A;  1T38 A;  2OA4 A;  3ERE D;  3MQ0 A;  1EH7 A;  2EFO A;  2XAF A;  5E8I A;  3VFZ A;  1Z9C A;  2CFX A;  3K0L A;  3QP6 A;  4G94 A;  1G3T A;  4HLY A;  4CXF A;  1QZZ A;  4A5M A;  3FMQ A;  2R7D A;  3Q5F A;  1K6O A;  4R8H A;  3KCC A;  1IN7 A;  3Q9V A;  4Y15 A;  2MA3 A;  1LDK B;  1ON2 A;  1ZLJ A;  5LGU A;  1KU9 A;  1ON1 A;  2ZXJ A;  4UXN A;  1E17 A;  2XAJ A;  1ZN2 A;  2PBI A;  2IA1 A;  3M9A A;  1H0M A;  2VOD A;  1EV7 A;  4S04 A;  3ZP5 A;  1B9N A;  1STZ A;  3RKW A;  2ZNZ A;  2YU3 A;  2PG4 A;  1ZAO A;  3HRU A;  1Z91 A;  5IT9 K;  5K5O A;  2OBP A;  1Z7U A;  3TOB A;  3BJA A;  5CLS A;  5LGN A;  2MLK A;  2MH9 A;  3ZMU A;  3E6M A;  3BOQ A;  2PEX A;  3WTU C;  1KGS A;  3EYI A;  4Q47 A;  1R1U A;  3GW2 A;  1JE8 A;  1XGO A;  2HYF A;  2PMU A;  4YFN F;  2W85 A;  2NNY A;  1B9M A;  4P55 A;  2F5D A;  3HRS A;  4U88 A;  1HKQ A;  4UHT A;  1I1G A;  3FHZ A;  2HWV A;  2DQL A;  4M71 A;  4PZJ A;  4EVI A;  2YX7 A;  4AIK A;  1LVA A;  1YG2 A;  1KQ9 A;  1TBX A;  3TO9 A;  1FNN A;  3ISP A;  2JZY A;  4O3M A;  1XN7 A;  1OR7 A;  2IA0 A;  4O6J A;  3ABU A;  4RB0 A;  5F64 A;  2Q8K A;  1MJB A;  3I54 A;  3CTA A;  3DQV C;  1XB4 A;  1XDS A;  3RI4 A;  1FOK A;  1SD5 A;  3RTR A;  5E1W A;  3F3X A;  2ZNY A;  5HDG A;  1RUO A;  2IRF G;  5FLX K;  3K2Z A;  4ZYH A;  1J5Y A;  5CVR A;  1JGS A;  3BY6 A;  4KDP A;  3J80 K;  5DUK A;  4N9H A;  2FNA A;  1G3W A;  1XMA A;  2JSC A;  1IXC A;  3HSR A;  3LWF A;  3CO6 C;  3IKV A;  4UNO A;  3C7J A;  4D0P A;  2BGC A;  1JXS A;  4M9X A;  4QLC U;  3I5U A;  4HX8 A;  1NHA A;  3HUG A;  3WTT C;  1FT9 A;  3IL2 A;  4IPA A;  4A6E A;  1USS A;  1EH8 A;  3KLO A;  5CYV A;  3J7A O;  3RPU A;  4KT5 C;  3K9T A;  2FRH A;  2ADU A;  4HZF A;  1J0R A;  2QM3 A;  3K1N A;  4FT8 A;  2KKO A;  5J8C A;  3N97 A;  1ULY A;  1W5S A;  4LMY A;  4ZZL A;  4HF0 A;  2V1U A;  4B09 A;  3QRF F;  4LFU A;  2X0L A;  4BQA A;  1CF7 A;  1TQP A;  4AIJ A;  4EJO A;  4MTD A;  4WF2 A;  3FWE A;  2A6H F;  2CWE A;  4EJW A;  4L5J A;  3JSO A;  1B6A A;  3B02 A;  4YII A;  4CHU A;  2RN7 A;  4KIB A;  2OU2 A;  1UST A;  2R3S A;  4KNY A;  5LHH A;  1O7F A;  2CG4 A;  4HX4 A;  2PJP A;  3F6O A;  3HHH A;  3IC7 A;  2RNJ A;  4WXC A;  2A69 F;  2D45 A;  3E6C C;  5DCF A;  4HQE A;  5HDK A;  5K5R A;  3J81 Z;  3RKY A;  2XKP A;  4IXA A;  2XIG A;  1G3Y A;  3E97 A;  4LD5 A;  4A0X A;  2CGP A;  2ESN A;  5BOX A;  1BI2 A;  2H6B A;  4OU0 A;  1QZY A;  4BHC A;  1D3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...