3KP5A

Staphylococcus epidermidis tcar in complex with kanamycin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/antibiotic
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
total genus 49
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp5A00
3T8RA 4LK1F 2WC2A 2XROA 4I7HA 4BYYA 3C3WA 1USTA 3COAC 2HKOA 1YFHA 3V8JA 2ACJA 1CGPA 3WU0A 2J5OA 3K9TA 1XGMA 2H27A 2V6CA 3AAFA 3LA3A 2OZ6A 5D6FA 1MKMA 2WV0A 5ILVA 4MNUA 4R1HA 4XSZF 3B73A 2LF7A 3H3ZA 3OV8A 4LMYA 3WTTC 4ESBA 5DCFA 1IXCA 2KKOA 2ZNYA 4RB3C 2CG4A 2CW0F 2TDXA 4WWCA 4M6XA 4MQVA 3I0TA 2DK5A 2M45A 4LJZF 3K69A 3O2PE 2KIFA 5HS8A 2NAZA 4G8XA 2PBIA 4LD5A 6PAXA 1IRFA 3E3VA 3KZYA 3MWMA 5L3BA 2OQGA 4I0BA 1WSUA 1K7AA 2OU2A 4FHTA 2WTEA 3LQRA 1I27A 3WGHA 2O6GE 1U5TC 3KP4A 3QRFF 2L54A 5FGMA 2XAHA 3KP6A 2DK8A 1OR7A 2LF8A 1BIAA 4A5MA 1YIOA 4XBFA 2R7FA 4FX4A 3KETA 2V1DA 4NB5A 4G7ZF 2LNBA 1W5TA 4YG2F 2IP2A 1YLFA 3JAMZ 3ZQ7A 4HQEA 2VC0A 4BQAA 1IRGA 3RTRA 3IRRA 1YO5C 1XCBA 1JE8A 2EFPA 1ZAOA 5E1WA 3FXUA 3GO5A 4MTEA 5ICEA 3GFMA 4Q48A 3LA7A 5DV5A 5CVVA 2STTA 1FPQA 1G4DA 4M73A 2GXBA 4OMYA 4M6YA 2XIGA 4KDPA 1ZG5A 3V4GA 3DPTA 1U2WA 5KK1A 4PGHA 2JSCA 4LB6B 3EDPA 5ERIA 2DPUA 4GYIA 1T39A 3IRQA 1R5HA 4B8XA 2D2WA 2ADUA 1MDMB 3BJ6A 2D1VA 3HTUA 3F6VA 2QZ8A 5BQTA 4U0WA 2RKHA 3LQQA 1TNTA 2FBKA 2JTVA 1R5GA 1B59A 2Q2EA 3QAHA 1QBJA 4Y15A 4GGGA 1FBSA 5CVUA 3TGNA 3ABTA 1IUYA 1V3FA 1BI1A 2VC1A 1HKQA 3CO7C 5JR3A 1GXQA 4A12A 2EFNA 3KP5A 5FFXA 4O3MA 1FBUA 3L9FA 2AS5F 5HVQC 2GQQA 3R61A 4NQWA 5FFZA 2VT3A 4AVPA 3ZMVA 2OAZA 4M9ZA 2J5PA 1KYZA 2RV8A 2HR3A 5EEGA 2P7CB 3HTSB 4P9UA 3HHGA 5DEQA 1IN7A 4RB0A 3KCCA 2Q8KA 1U78A 1HBXG 1Z7UA 4RAYA 3HYIA 1BIBA 1O3QA 4HQMA 1BC8C 3RDIA 5AONA 1HXDA 3KFWX 4JK1X 5JFRA 4HOBA 5DD8A 2Z5UA 4KA4A 3WTWC 1FC3A 3ERED 1Z6RA 3LSTA 1V4RA 4AIJA 1ZRCA 1TQPA 4EJTA 1B9NA 1QNTA 4WF2A 4IRGA 3KEOA 3DXJF 4AIHA 2UXXA 2OBPA 1J5YA 3BPVA 3WTZA 1ONVA 2P5KA 4MHGA 1DUXC 2V79A 5FB2A 1XSXA 3SXYA 1IW7F 1ZGJA 3HRSA 3WTXC 4OINF 4HDVA 1Z6TA 2HDCA 3GFLA 3D5LA 2STWA 4DQ2A 1U6GA 2A6EF 4R79A 5DUIA 2VE8A 4CZZA 5J8CA 5H20A 2BV6A 1W7PA 1WI9A 2ZFWA 2O61A 1VTNC 3SZPA 3FM3A 3GWZA 4EVIA 1IN6A 4L5JA 4IJAA 1HW5A 2QYOA 2O0YA 3ZP5A 3FHZA 2MH9A 3T8TA 3L2CA 3HRUA 2QQ9A 4N9IA 2D45A 1ZRFA 1B4AA 2H09A 2ZMEB 1KQ9A 3WG9A 2C6YA 2XHKA 4HX4A 2FMLA 2GXGA 2HQNA 3J80Z 2F5FA 4BHCA 1RIOH 3PFIA 2KJBA 1O7FA 2MA3A 4KT5C 1Z91A 5FD5A 2PLYA 1FNNA 1R1TA 5K5OA 2ESHA 3MFKA 5J8FA 3WE2A 1PUEE 3VOEA 2JPBA 1YTYA 2E1NA 4RGRA 1XCVA 4KICA 3IHUA 2PN6A 5BPDA 2RGVA 2L02A 5CYVA 3Q9SA 4XLNF 4RB2C 5L3EA 1FX7A 4WXCA 2DLLA 4ZZDA 2GA1A 4P9FA 3CLOA 4OU0A 1J2XA 1S7AA 5LHIA 3KP7A 1XB4A 2JRTA 4XRFA 1SD5A 5E8GA 1KGSA 5D4SA 1UFMA 4ON0A 1HQCA 5ILSA 2RC4A 4BHPA 3RKYA 2HYGD 1SAXA 3T5XA 2XKPA 4LK0F 3I59A 1T98A 2R7DA 1FT9A 4ZYGA 2E1CA 1FP2A 2ZXJA 1BN5A 5D6EA 2OD5A 4CXFA 3D0SA 2CWEA 4GXOA 1H9GA 1PDNC 4BNCA 3RKXA 1HKSA 2BE5F 1EV7A 1KYWA 2PQ8A 2F2EA 1QO0D 5CJ9A 3GUDA 1ZN2A 1ZYRF 1H0MA 2RDPA 3HOSA 2NNYA 1KU3A 1TW3A 4RS8A 1I6XA 2XAQA 1S3JA 3QOPA 2CSOA 1X3UA 4A6EA 3FZVA 1K6OA 1MDMA 5LGNA 1G6NA 2G7HA 2K4JA 3LAPA 2A3SA 5CVRA 4YIIA 4KMFA 1YYVA 3QP6A 4FT8A 2FMYA 1ZARA 2K4BA 3P7NA 1KQ0A 3M1EA 2FBHA 2HS5A 3QU6A 5ED4A 2H6BA 1XGSA 3K0LA 3G73A 4BHBA 1FY7A 3GVAA 3WTUC 4CGZA 3ZMUA 5DUKA 4HA8A 1R7JA 3DEUA 4YIFA 4S04A 3Q5FA 3F8NA 2FXAA 2IA1A 1FYLA 3W6JB 2VBYA 4LG0A 2CFXA 3F72A 3V8KA 5K1YA 3GX4X 5DCMB 5BS6A 1ZRDA 1PP7U 3I58A 4ZYEA 3BDDA 1QZYA 1BC7C 1RNLA 3E6DA 1LEBA 1RZ4A 3TOBA 3EQLF 3TOAA 2A68F 3R60A 2DAOA 2EK5A 2G7UA 2K86A 4Y17A 2A07F 2YX4A 3WODF 3EETA 4JBAA 3M7GA 3REOA 2D1HA 2IA0A 3O6BB 3HUGA 3NRVA 1WQ2A 3GFIA 2VXZA 5L3FA 3QP5A 3T1BA 1HW2A 2VONA 4PDKA 4HW0A 4UHTA 4UVAA 3BJAA 4L9JA 4P96A 4M72A 5HOOA 4LLLA 5ICCA 5CVJA 4IVNA 2ISYA 3TO6A 3L00A 1SMTA 5A2QZ 1CF7B 1TQMA 2VODA 2HFHA 3S2WA 1RUOA 1LEAA 4AD9A 3K1PA 2QBYB 2VE9A 1ON1A 1OPCA 1W5SA 3H3UA 4A0YA 2QQAA 1GXPA 3J81K 2XAFA 1W4MA 1D5VA 3E5UA 4A5NA 3RYRA 1LDJA 2PG4A 3VODA 3EUHA 2BGCA 1TNSA 2L3DA 1JHFA 1SD7A 4HX8A 5L3CA 5HLGA 5IT9K 1G3YA 2EA2A 4EM2A 3HSRA 3TQNA 2HZTA 4MTDA 4Z2YA 2DU9A 1OYIA 2ZMEA 5ILUA 1HW1A 3V7CA 1G3WA 3FMSA 2OQRA 2ZBKA 3P9IA 2V1XA 4KYWA 2M8EA 1E17A 2LDUA 3CUOA 1B9MA 1ZGAA 1S8NA 3JTHA 2JT1A 2W57A 4HV5A 3F6OA 1U8RA 3ZMSA 2EJRA 2X4HA 4HBLA 2XGXA 2ZCWA 3HRMA 5JVTA 4L5IA 4HF2A 1TLHB 1L0OC 3JSOA 1IN4A 3HIFA 5F1RA 2P6TA 4HAMA 3I4PA 2VOPA 2M5WA 3QPTA 5E1ZB 2UXNA 2O3FA 3SQNA 4LGWA 1TQIA 1T38A 1IZ1A 3V8LA 2Y0MA 4IRHA 4OOIA 5LLQA 2YSRA 1MJBA 5KVRA 1DPRA 1O3TA 1ZLKA 3M8EA 1EH7A 2KIMA 2A69F 3I53A 2DFIA 4A2UA 5FLXZ 1USSA 1R23A 1K79A 3R4KA 4HZFA 2FSWA 2M1BA 3NQOA 4PGGA 4BAYA 2HTJA 4I0AA 4YFNF 1KA8A 2IT0A 1LB2A 3FXQA 3W6KB 1XGNA 2VBXA 1P2FA 3FMQA 1LVAA 1Q1HA 5D4RA 3FWEA 2Y75A 1U5TA 3DPLC 4LLGF 1UHMA 4WXHA 4U7BA 3BPXA 4EQQA 3F21A 2IVMA 1KQ8A 3ZMDA 2VOOA 4OIRF 4ENJA 1I5ZA 3QPHA 4GO1A 1UHWA 4KN7X 2M30A 1U3EM 1R1UA 1UB9A 3BJOA 1IXRC 1I1GA 1REPC 1IAWA 2FNPA 2GZWA 2OZUA 2VBWA 2BBYA 3ECOA 1T6SA 3I54A 2Z3YA 3LAJA 2ZNZA 3SHFA 3WGGA 1MJAA 1TBXA 2K27A 2QQBA 3BY6A 2EFWA 3BP8A 3FX3A 3GXOA 4ZYHA 3N4MA 1J59A 3K1NA 5D8LB 1TW2A 4L0YB 1ZREA 2RQPA 3BWGA 1D8JA 1JHHA 3GZ6A 1BI0A 2VN2A 1YW8A 5DDGA 1RI7A 1WWXA 1H9TA 4EV0A 1ODDA 1DDNA 4QLCU 5L3GA 1JGSA 1R58A 4CHUA 4ESFA 1R22A 5DCMA 3TO7A 4HLXA 1R1VA 3LA2A 3TDUC 2EV6A 3U2RA 2PMHA 4I01A 1I1SA 4N0BA 4EJUA 2EA4A 3BOQA 3JAMK 1GVJA 4M74A 4R8HA 1LJ9A 1A04A 1KU2A 4PZJA 1J75A 3F8FA 2ETHA 2DPDA 2WWYA 1HSJA 1SMYF 3F8MA 1FP1D 4L9VA 1KU7A 5FD6A 2Z9OA 3KLNA 4H0EA 3KLOA 4UUVA 2GAUA 3BZ6A 1O3RA 4KNYA 5LHHA 2YPRA 2XVCA 3IWFA 2F5EA 4UV9A 3FM5A 3MCZA 2HGCA 3IKVA 4M9SA 4P5OA 2CQKA 2P8TA 3P9CA 3E6MA 1Z1DA 4DNCA 4ASNA 3E6BA 4ZZLA 1YQAA 4HF1A 2NS0A 3U9GA 4LB5A 1OYYA 2ZKZA 3GEZA 3TO9A 5LEJA 5H6RA 3TKYA 1J0RA 1ZHFA 2GIVA 1AOYA 1LNWA 3MZYA 4ENMA 4HDUA 2FNAA 1EH6A 4U88A 2ZJ2A 3EYIA 3GW2A 3WTVC 4CICA 4UVCA 1AWCA 3KE2A 3L7WA 2DO7A 2DT5A 4HLYA 2RNJA 4I98B 2MLKA 2Q0OA 2QWWA 2LSOA 3R0JA 4AIKA 1FWZA 5CVIA 4G6DA 2VBZA 2QM3A 4EGZA 1LQ1A 4IPAA 3F3XA 4M71A 3RPQA 3VB2A 3C7JA 4UNOA 1D8KA 1ZG3A 3IC7A 2IPQX 3OOPA 2PEXA 3EYYA 2X0LA 2YX7A 3TDZC 2O8XA 3WTYC 3JSPA 5TRDA 3R6SA 2FF4A 2Z99A 3ROUA 1DPUA 4KMUX 5E17F 4CDGA 1O7LA 4Q47A 2LKPA 3SFZA 1JXSA 1F9NA 2KJCA 2L01A 4RGSA 1E2XA 3C18A 3PQJA 3H92A 2DW4A 4CYDA 2BYVE 4A6DA 1S7OA 2UZKA 1OYWA 4O6JA 4KIFA 3QU3A 2BEOA 1BOAA 1K78B 4HV6A 2P5LC 4G7HF 3DFGA 3R0AA 5HLHA 1SD6A 1KU9A 3ULQB 4XLPF 5E1XA 2FU4A 4OIPF 1F4KA 3DP7A 2HOEA 3IL2A 4OIOF 2W84A 3WE3A 1P92A 4Q4ZF 5BMZA 5IT3A 3L09A 2E7XA 2UWMA 2KIUA 3E6CC 1BI2A 1S29A 3GZ5A 2HQRA 3CJNA 4G9YA 3FXRA 1HSTA 4NHJA 3HHHA 4O5VA 5K5QA 1QPMA 3J80K 1Y0UA 1SFXA 2NYXA 1S6LA 3K2ZA 1G3SA 3KP2A 2DQRA 2M87A 1T2KA 2CGPA 2JZYA 4K2EA 4U0VA 4XSXF 5FO5A 4HYEA 2FBIA 5EEHA 3DQVC 2FEZA 4BH9A 3VFZA 5CLSA 4L18B 4EJVA 1MD0A 1P4AA 2XUBA 4Q5SF 4KUMA 4B09A 3RIRA 2NRAC 1PP8F 3F23A 3I59B 1J9IA 1SD4A 2QUFA 4RB1A 2DI3A 2CYYA 3MAJA 5D5UB 3MZHA 2H94A 2R3SA 1YW7A 1WRJA 1ZH5A 1MGTA 1UCRA 2JPCA 5E8IA 2XASA 4IHSA 2P4WA 1G3TA 1XDSA 1HKTA 3T0YA 1IN5A 2PJPA 1D3YA 1XSDA 4RGUA 3PQKA 3JTGA 4MEYF 4TV7A 4QWQA 4ENNA 2W85A 3CUQB 3LWFA 1XGOA 1O3SA 1MZBA 5ICGA 1P4XA 3ZPLA 2XV4S 2V9VA 5DD4A 2GWRA 2MLGA 4G6QA 1YW9A 4KIGA 2W24A 3GF2A 3KZZA 3I5UA 1P4WA 5AIQA 3GYHX 1DP7P 5D5XB 1J7KA 1XD7A 4L9NA 5E20A 3M8FA 5H6QA 5LGUA 4UV8A 1FSHA 3J7AO 2F5DA 5LBQA 5HDGA 2A6HF 4RGXA 1XMKA 2HYFA 3VEPA 4UVBA 5LHGA 4YFXF 3RI4A 2DTRA 3RYPA 3RJPA 4A0ZA 4HF0A 4EJWA 5LRSA 2QLZA 2OA4A 1FYKA 2ESNA 1QQIA 1FOKA 4D0PA 3E97A 3IWZA 1ULYA 1LDKB 5D5WB 1IF1A 4IRIA 3C1DA 1P6RA 5TJJA 1W7PD 1XDUA 3U1DA 2DQLA 3ZMZA 4MGRA 3M9AA 4LG0B 2GA2A 4LFUA 5F6FA 5HS7A 3LFKA 2MD5A 2L4AA 4EJOA 4S05A 3E5XA 4RAZA 3ECHA 3BROA 3B02A 4JQFA 1STZA 1L3LA 5JI6A 2EWNA 4PCQA 4CO8A 1XSVA 4EMSA 1EH8A 4I2OA 2VT2A 2E7WA 2P5VA 5E18F 1R00A 4AWXB 2F5CA 2P6SA 2FRHA 4YFKF 2PFBA 3HSFA 4A0XA 3F22A 1YS7A 3HOTA 1R36A 4I09A 4N9HA 5LEKA 4ESJA 1XMAA 4WCGA 4IHTA 1ZLJA 3GLXA 3FMRA 3WU1B 2YU3A 3O3KA 2V1UA 2PI0A 3Q9VA 2AXLA 2KRFA 4U0YA 5ICFA 5HDNA 5BOXA 1FYMA 1NHAA 2CO5A 4Y13A 5F64A 3ZN0A 2QENA 4WX9A 2EV5A 2B0LA 2IJLA 2EB7A 3CUQC 3ML6A 5LGTA 3V7SA 2IRFG 1FZPB 5HDKA 1ON2A 2FQ3A 3GFJA 2QVOA 4OIQF 4G94A 5AIPA 3I64A 5A2QK 2ELHA 3WTSC 3DKWA 3RPUA 4P55A 1F1ZA 3I71A 3K1MA 3ELKA 1IN8A 3ZMTA 2A61A 1K78A 2EFOA 4ENKA 4GCVA 4BXUA 1IXSB 3G3ZA 2MH2A 5LRRA 3ABUA 3MQ0A 3ISPA 1OKRA 3NEUA 5BPIA 4KFCA 1LDDA 3CO6C 4WXDA 3JW4A 3DV8A 5K5RA 2L4MA 1C0WA 1B1BA 4I02A 3CDHA 4WK8F 2IA2A 4G7OF 1Z9CA 2Z33A 1B6AA 1WKMA 3MEXA 2MC3A 4ETSA 5J6XA 1QGPA 3J81Z 5D8KB 1SFUA 1RUNA 1OMIA 4IF4A 4E70A 5DYMA 4KIBA 3CTAA 4F7ZA 4L0ZB 5HS9A 1CF7A 2HTSA 4EM1A 5IT9Z 2NNNA 4M9XA 2HKXA 1YS6A 1Z05A 3F8CA 2EFQA 4IXAA 4ZYDA 2A5YB 1SFEA 2ZO4A 2MBFA 2QBYA 2W25A 4HX7A 4U7DA 1BJAA 3KEQA 4KN4X 5D5VB 2XKOA 2ISZA 1YG2A 3HSEA 3IKTA 3SZTA 1U5TB 2Y48A 3V7RA 1BI3A 4GYGA 2HEOA 1T0FA 1TTYA 1FBQA 3F8BA 5FLXK 4UXNA 4LLNA 2K02A 1BBYA 2RN7A 2PMUA 2HWVA 3P9KA 2XRNA 2P7VB 4OMZA 5L3DA 2COMA 3E5QA 1QZZA 2DBBA 2FOKA 3WGIA 1ZG1A 3N97A 3CUQA 2XAGA 3HRTA 1O57A 2FA5A 2H6CA 3DF8A 2RVCA 3KP3A 4MQ9F 4MEXF 1F5TA 2EV0A 2YR2A 1GHCA 2FE3A 1BM9A 1FLIA 3ZN1A 2XAJA 1FSEA 4FX0A 2IW5A 4EGYA 2O03A 1MJ9A 3RKWA 5HLIA 3FF5A 5JHUA 4L9TA 4ZH4F 2K7LA 1XN7A 2G9WA 4EM0B 1W7PB
chains in the Genus database with same CATH superfamily
3T8RA 4LK1F 3UNGC 2WC2A 2XROA 2R5ZB 3EUHC 3AL0B 2JVHA 4I7HA 4BYYA 3C3WA 1GV5A 1BJZA 4IZZA 1AKHB 1USTA 3COAC 4NDLA 2DN0A 2HKOA 3BLYA 4FCYA 4DIQA 1YFHA 3V8JA 2ACJA 1CGPA 3WU0A 2J5OA 3K9TA 5EZHA 1XGMA 4ZTFA 2H27A 2Y69H 2V6CA 3AAFA 3LA3A 4NNJA 2OZ6A 2ZC2A 5D6FA 1MKMA 5IP6A 3QYEA 2WV0A 4XK4A 3DTIA 5JLXA 2KDZA 1GLNA 5ILVA 4MNUA 4R1HA 2AHQA 3ZXSA 4XSZF 2WADA 3B73A 5EYRA 4F52A 2LF7A 4IL6C 4PSWA 3NARA 1X58A 3HOUJ 2VQHA 3H3ZA 3OV8A 4LMYA 3WTTC 2E2IJ 5IOZA 4PFPA 4ESBA 4IX7A 5DCFA 1WZ2A 1IXCA 2KKOA 2EILH 2ZNYA 4RB3C 2CG4A 1R71A 2CW0F 4GDFA 2TDXA 3M8JA 4WWCA 2KQRA 1PJRA 2GM4A 2VUMJ 1CQTA 3BTIA 2PX9A 5F08A 4M6XA 4JX5A 4M3BA 4MQVA 3I0TA 3K7AJ 4CUGA 2HVSA 2O7OA 5K7FA 2XPVA 4QPQA 4DBQA 3ZQHA 2DK5A 2M45A 4LJZF 5GTHC 2IEKA 3K69A 3C2GA 3K4MA 3I4NJ 4C2MJ 3O2PE 2KIFA 4C2UA 3FKIJ 4DYRA 5HS8A 2ZJPF 2NAZA 4G8XA 1RETA 2XF5A 2PBIA 2XRLA 4LD5A 6PAXA 1IRFA 3H1CA 5FKKA 2M7AA 1VQNI 3E3VA 3JRDA 4CCMA 2JMWA 1Q1VA 3KZYA 4HNUA 3L2RA 5TGTA 3MWMA 2XC7A 5L3BA 3GTKJ 2OQGA 3H0DA 1JKOC 4I0BA 1WSUA 3LSJA 1K7AA 2DMUA 2OU2A 2KHMA 4FHTA 2PMZN 5LD2C 2WTEA 3CLQA 3LQRA 1I27A 3WGHA 2HQ5A 3L2VA 2NS8A 2O6GE 1Y8RB 4CA0A 4B3XA 1U5TC 1DU6A 1E3OC 3ASOH 3BQYA 4BGDA 4IHVA 3KP4A 2QKMB 5JLWA 1U8BA 1DU0A 2GOXB 3QRFF 2X6WA 2L54A 5FGMA 3GTGJ 1OCRH 2XB0X 3C2BA 2VLAA 2XAHA 3MMYB 3KP6A 4EEFG 2R0QC 2XGCA 2DK8A 3OYGA 3OOUA 1OR7A 2KT0A 2LF8A 1BIAA 4A5MA 1YIOA 5HNFA 1XC5A 4XBFA 1UG0A 2R7FA 5GADJ 4FX4A 3KETA 3LSIA 2V1DA 4II3A 4NB5A 3DU6A 4G7ZF 1WJBA 2LNBA 1YJNI 1W5TA 4YG2F 1FMVA 2I5UA 2IP2A 2AO9A 1SVMA 1YLFA 3JAMZ 3ZQ7A 4HQEA 5JHFA 2BVMA 2VC0A 2DFEA 4BQAA 4XOTA 1IRGA 4A3IJ 3RTRA 3ZRGA 3AG2H 3IRRA 1YO5C 3S1MJ 4E6KG 1GVDA 1XCBA 2XPUA 1JE8A 2EFPA 2ICWG 5EGOA 1ZAOA 1X2MA 3HGGA 3MN2A 2ELKA 1X1BA 5E1WA 3FXUA 3GO5A 4MTEA 4B1RA 4X0GA 3J7AY 5KHDA 5ICEA 2X1EA 3GFMA 2IGMA 4Q48A 4S0HB 2HI3A 3LA7A 3EPZA 5DV5A 5CVVA 2STTA 2OUMA 1FPQA 1G4DA 4M73A 2GXBA 4OMYA 4M6YA 4A3FJ 2XIGA 1A31A 1ZG5A 4KDPA 4GRIA 3V4GA 1VQKI 2F48A 3DPTA 4BE1A 1U2WA 3PUFA 5KK1A 1F36A 4PGHA 2JSCA 4MFEA 3BG6A 4LB6B 2A5WA 3EDPA 2LYCA 2LY2A 1EKEA 5ERIA 2DPUA 2JA2A 3FXKA 3QPLA 1MIJA 4GYIA 1T39A 3IRQA 1R5HA 4B8XA 1MBJA 1WI3A 2D2WA 2ADUA 1MDMB 3BR5A 2JRMA 1WPKA 3BJ6A 2D1VA 3OIOA 3CCQI 3HTUA 3F6VA 4AYBA 2QZ8A 5BQTA 2R7SA 4U0WA 2RKHA 3LQQA 1MW7A 3IH3A 4CCNA 3ZQFA 1TNTA 2FBKA 2JTVA 1R5GA 3GBGA 1B59A 2Q2EA 3QAHA 2HDWA 1QBJA 2E1MB 1JT0A 4Y15A 2BXZA 3B6AA 4GGGA 4XKCA 3VYTB 1FBSA 9ANTA 3DTKA 5CVUA 3TGNA 3ABTA 1ZQ3P 4XMYA 1TC3C 1IUYA 4BJ5C 4UUSA 1V3FA 1BI1A 2VC1A 2DOEA 1HKQA 4XORA 5M5WJ 3CO7C 5JR3A 5E3LA 2VQGA 1Y56A 1GXQA 3CP8A 4ZTJA 1I3QJ 4D7MA 2CQQA 2EFNA 3FXMA 3VYUB 4A12A 4E7KA 3KP5A 2W82A 5FFXA 4O3MA 1FBUA 2QKLB 3L9FA 2DFHA 2AS5F 5HVQC 2GQQA 2LMDA 4IHWA 1LVKA 3R61A 1X1PA 4NQWA 3IAM2 3KEYA 5FFZA 2V4JC 3NWTA 1XG1A 2VT3A 3VYRB 4AVPA 3S8PA 4BACA 3S32A 3J7ZI 3ZMVA 2OAZA 4M9ZA 1OLTA 2J5PA 2KISA 3A0HC 1KYZA 2LBFA 2RV8A 2V9PA 3BG3A 2HR3A 5EEGA 1G59A 3DCFA 4QSHA 2P7CB 1TT0A 3HTSB 2ME6A 4P9UA 2VPLA 3HHGA 4YELA 2WB1N 5DEQA 1JUSA 2XGDA 3JCUC 1IN7A 4RB0A 3KCCA 2Q8KA 3CC4I 4IHXA 1U78A 3G6EI 1HBXG 2MGQA 1Z7UA 4ZDOA 3A1YA 4M3GA 4RAYA 3HYIA 1BIBA 1O3QA 2VB6A 1YITI 4HQMA 1K4TA 2VKEA 1BC8C 1D1BA 3RDIA 5AONA 3CCMI 1HXDA 3KFWX 1FOXA 3DBLB 4MLOA 2TRTA 4JK1X 5JFRA 2CV0A 4HOBA 5DD8A 1FTZA 2Z5UA 4KA4A 3WTWC 4BEHB 1FC3A 3ERED 4CCKA 1Z6RA 3LSTA 1V4RA 4AIJA 3D5SC 3GTPJ 2KL4A 1ZRCA 1TQPA 4EJTA 4KT6A 1FOWA 4ZJZA 2Z1DA 1B9NA 5E3MA 3NWSA 1QNTA 4WF2A 2Y30A 4IRGA 4V2FA 4XR6A 3KEOA 3VWBA 2KRCA 3DXJF 4AIHA 2UXXA 2OBPA 1J5YA 3BPVA 3WTZA 4DJAA 3JRFA 1ONVA 2P5KA 1YJ9I 4MHGA 2BY0A 1DUXC 2L7ZA 2V79A 5FB2A 2VJIA 2DA4A 3CF5F 1IGNA 1B8IB 1XSXA 3SXYA 1IW7F 2L9RA 3ZQLA 1ZGJA 3HRSA 3WTXC 2DMQA 4OINF 2BW3A 2XSJC 4HDVA 1Z6TA 4IKFA 2CW7A 2NOGA 2L7FP 2W1OA 2HDCA 1W0TA 3GFLA 3D5LA 4FE4A 2STWA 3CQZJ 3K6GA 4DQ2A 1U6GA 3HEFA 2A6EF 2EINH 3DKXA 4R79A 4CZZA 2VE8A 5DUIA 5J8CA 5H20A 2E19A 2BV6A 1LE8B 1W7PA 1WI9A 2ZFWA 1OFCX 2R5ZA 2O61A 1VTNC 1JUMA 1K6YA 1IRZA 2GOMA 3HZJA 1E3HA 2XDVA 3SZPA 5M5YJ 1ETWA 4QIWN 1QZEA 1OCPA 2ECCA 3FM3A 3U21A 2LKXA 2M7BA 4C3IJ 1OCOH 2VIXA 1NK2P 4E7SA 2K9NA 3GWZA 4LIVA 4EVIA 1IN6A 3OYLA 4L5JA 4IJAA 1HW5A 2QYOA 2O0YA 3B6CA 3HM5A 2EZLA 2M4GA 3KYDB 3ZP5A 2CUFA 3FHZA 2GBYA 1D5YA 2B9SA 3QWLA 2DA7A 2MH9A 4RAGA 3T8TA 3JRAA 1DP3A 3L2CA 2JSPA 2V26A 4FQGA 3HRUA 2QQ9A 4N9IA 4CCOA 2D45A 3SEZA 2HPIA 1ZRFA 1B4AA 2H09A 2ZMEB 3PUBA 1I50J 1KQ9A 3WG9A 1WJCA 3V42A 2C6YA 2XHKA 2CQ7A 4Y33A 4HX4A 1G8XA 4C3HJ 2FMLA 2GXGA 2HQNA 3WG7H 3S2DJ 3J80Z 2F5FA 4CYCA 4BHCA 1RIOH 3PFIA 2KJBA 4CZCA 1O7FA 2L0KA 3HL2A 2MA3A 4KT5C 1Z91A 2X9DA 3A03A 5FD5A 2PLYA 3S1NJ 1FNNA 1R1TA 5K5OA 1DGWY 2ESHA 3MFKA 3FKJA 5J8FA 3WE2A 2DT6A 5B5EC 1PUEE 3VOEA 5M3FJ 2JPBA 1YTYA 3OSFA 2JN6A 1SAUA 2HPMA 4RMNA 2E1NA 1B72A 4RGRA 5KCMA 2H8RA 1UZCA 2ID6A 1XCVA 4KICA 4D5CA 3IHUA 2PN6A 1YIJI 5BPDA 2RGVA 2L02A 5CYVA 3Q9SA 4XLNF 4RB2C 5GPCA 3FXOA 4A3BJ 5L3EA 1D0XA 1FX7A 4WXCA 2DLLA 4ZZDA 2GA1A 4P9FA 3CLOA 4OU0A 1J2XA 5J4YA 4XN3A 1AA7A 1S7AA 2VKDA 2QGUA 2GIZA 2ZXHA 3FISA 3H5RA 3IH2A 5LHIA 3GTQJ 1Y1VJ 3KP7A 2VJ4A 1XB4A 2JRTA 4XRFA 1SD5A 5E8GA 2B63J 1KGSA 5D4SA 3QPSA 2HZDA 1OJLA 1UFMA 4ON0A 2XSDC 1HQCA 5KNLA 5ILSA 3CC7I 2BZTA 5EEAA 2RC4A 1J09A 1OISA 3IAS2 4BHPA 3RKYA 5IOYA 2HYGD 3OYBA 1SAXA 4P1WA 5E3OA 3T5XA 3G1LA 3VSLA 3OS2A 2XKPA 4D7NA 4LK0F 3I59A 2B7EA 5GPAA 1WJDA 1T98A 1S9HA 2R7DA 2P81A 3CJRB 3JRIA 1VQPI 1FT9A 3SYTA 4ZYGA 3H35A 2E1CA 1FP2A 1I6HJ 2ZXJA 1BN5A 1HOMA 5D6EA 2VJ5A 1NH3A 2OD5A 1ETVA 1Z7LA 3D0SA 3HC7A 4CXFA 2CWEA 4GXOA 3TW7A 5F0HA 5B66C 4DYQA 4U87A 1H9GA 4IQJA 4JX4A 5CQGA 1PDNC 4BNCA 2NVYJ 3AG4H 3RKXA 3LSGA 4B43A 3GTOJ 1HKSA 3OYHA 3SDGA 2X6YA 2BE5F 1EV7A 1KYWA 2OF7A 3ZQGA 4Y7NJ 3CCRI 2PQ8A 1MMAA 2DODA 2F2EA 1QO0D 3ERMA 2W4SA 3GUDA 1ZN2A 5CJ9A 2L9SA 4BQNA 3OMYA 5B1BH 1OCTC 2K9QA 2R7QA 1ZYRF 1H0MA 2M0CA 2RDPA 2M8GX 4UB8C 3HOSA 2NNYA 3HXLA 5FLVA 1KU3A 1UJ8A 1TW3A 2L5QA 4DGWB 2LY9A 1I6XA 2XAQA 1S3JA 4RS8A 3QOPA 1XPXA 2CSOA 1X3UA 1VQ6I 2ZJRF 4A6EA 2HOAA 3FZVA 4XRSG 1K6OA 2TCTA 1MDMA 5LGNA 4C30A 1G6NA 2E71A 1HDPA 2G7HA 4HSRA 3PL8A 5F04A 2HXOA 2K4JA 2LK2A 4D9JA 4J19A 3LAPA 2A3SA 5CVRA 2K85A 4YIIA 4KMFA 4AUXA 1YYVA 3QP6A 2PJRB 4FT8A 2FMYA 1MMSA 1ZARA 2K4BA 2EZIA 3P7NA 2VASA 3LSPA 3GTMJ 1KQ0A 3QYFA 3M1EA 2FBHA 2HS5A 2JUCA 3BTCA 3QU6A 1MNDA 5ED4A 2H6BA 1XGSA 3K0LA 3I56I 4E7JA 3G73A 2QSHX 1DGRM 2ZMEC 4BHBA 1FY7A 3GVAA 1WFXA 3A01B 3WTUC 4CGZA 3ZMUA 3H36A 5DUKA 3OYCA 4A3LJ 2BY1A 4HA8A 1R7JA 1YX5A 5EZGA 3DEUA 4XLFA 4AYBN 4YIFA 1XTAA 4S04A 3Q5FA 1YRNB 1RPWA 1VQMI 1ORKA 3F8NA 1IV8A 2F4MB 2FXAA 3ABMH 2IA1A 1FYLA 1U9NA 3W6JB 4B3AA 2VBYA 2CU7A 4LG0A 3OYFA 1IG7A 2CFXA 3F72A 3V8KA 5B3SH 5K1YA 3GX4X 5DCMB 5BS6A 1QVTA 1ZRDA 1GUUA 3DPUA 1PP7U 3I58A 4ZYEA 5FKNA 3BDDA 1QRYA 1QZYA 3PFYA 1TWFJ 5DS9A 1BC7C 4XRMA 1JKPC 1RNLA 1X3WB 3AFHA 3E6DA 1LEBA 5DM7F 2ZSIB 1RZ4A 2KRHA 2Y0SA 3FBNB 3TOBA 1TWAJ 2E2HJ 3EQLF 5HNHA 4DW6A 5KAFC 3TOAA 2A68F 5IYBJ 3R60A 2DAOA 2EK5A 4ANJA 2K5CA 4OAYA 2K9SA 2KZVA 4NC7A 2G7UA 2K86A 2L9VA 4Y17A 1TZLA 2A07F 2YX4A 1MBFA 4UY8I 2N8GA 1W0UA 3WODF 3ZOBA 2WBMA 3F0CA 3EETA 4JBAA 3LSMA 3M7GA 3REOA 1KZHA 2WY7Q 2CUJA 3M1CA 2D1HA 2UUZA 4BJTA 2IA0A 2VPRA 2MD0A 2JA6J 2LFBA 2QSGX 3O6BB 1N75A 3HUGA 1X2NA 3NRVA 1WQ2A 3GFIA 2VXZA 3JRGA 4IEJA 1YOVB 1ZKGA 5L3FA 1N25A 3QP5A 3T1BA 4X1EA 1HW2A 2VONA 1BOBA 4PDKA 4HW0A 4UHTA 2VKHA 3M4OJ 1W5CC 2AXTC 3ONQA 1A35A 4BXFA 4UVAA 3BJAA 3TW6A 4L9JA 1B8IA 4P96A 4G12A 4M72A 5HOOA 4LLLA 5ICCA 5CVJA 2BXYA 2HVQA 2H1LA 5CQEA 4IVNA 2X1CA 2ISYA 5LFAA 3TO6A 2CQNA 3L00A 1SMTA 5A2QZ 1E0EA 3H3VK 1QHHD 1CF7B 1S7EA 1HF0A 1TQMA 2VODA 1X1DA 2HFHA 2Y31A 3S2WA 1RUOA 1LEAA 4BU2A 4AD9A 3K1PA 3ABLH 1MBHA 3TP0A 2QBYB 1BW6A 3MKWB 1LKXA 2XGEA 3ASNH 5J40A 4E4HA 1IV6A 2VE9A 1ON1A 4E7HA 3OYIA 1OPCA 1W5SA 1HC8A 3H3UA 4A0YA 4PFOA 2QQAA 2W7NA 1GXPA 1PYVA 5J1YA 3J81K 1MMGA 3E7LA 5BNGA 2X48A 1W4MA 2XAFA 1IDZA 3G1OA 2EQRA 3Q3SA 4E7IA 1D5VA 3E5UA 4A5NA 5IP9J 4MO7A 3RYRA 1LDJA 2PG4A 3VODA 3H9GA 3EUHA 3KZIC 2BGCA 2NVUB 3S17J 1TNSA 2DMPA 2JA8J 2L3DA 5FKMA 1JHFA 3BG5A 3JREA 2R7WA 1SD7A 1MBEA 4HX8A 4ITVA 5L3CA 5HLGA 5IT9K 5CKTA 1G3YA 2EA2A 4EM2A 1RR7A 2KZGA 3HSRA 3TQNA 2HZTA 4MTDA 3OYJA 3PJRA 3ZQCA 4Z2YA 2ZMEA 1OYIA 2DU9A 1Z77A 4B48A 5ILUA 2A6TA 1HW1A 1UAAA 3V7CA 1SVOA 4RDUA 2JA7J 1G3WA 3FMSA 2KLOA 3IH4A 1V5EA 2OQRA 3CCSI 4KITB 2F6CA 1WGXA 2X1DA 2ZBKA 1RESA 3P9IA 2V1XA 4L5EA 1WHUA 2M8EA 2LDUA 3A4CA 3CUOA 4I76A 4KYWA 1E17A 1B9MA 1ZGAA 1S8NA 3JTHA 2JT1A 2W57A 2X51A 2R5YB 4HV5A 1R49A 3F6OA 1U8RA 3ZMSA 2EJRA 3G4SI 4KISA 2X4HA 4HBLA 2XGXA 1TWCJ 2L7MP 2ZCWA 3HRMA 5JVTA 3CC2I 3LFUA 2DA5A 4IOAF 4KJZA 4L5IA 2OCCH 4HF2A 2M34A 1TLHB 1L0OC 4XQFA 3JSOA 1IN4A 1VZ0A 3HIFA 5F1RA 2P6TA 2ECBA 3KYLA 4FETA 4HAMA 3WU2C 3I4PA 2LY1A 1ENHA 2M5WA 2VOPA 3QPTA 3JRBA 5E1ZB 2DOFA 4JOMA 2UXNA 2CV1A 2O3FA 2E1OA 3SQNA 5DTDA 4DZPA 4A3JJ 3BC8A 4LGWA 3OS0A 1TQIA 3OYMA 1T38A 5J1UA 1IZ1A 3V8LA 2Y0MA 4IRHA 3A02A 4OOIA 5LLQA 3L1PA 2YSRA 1MJBA 5KVRA 2XB5A 1DPRA 1O3TA 1ZLKA 3M8EA 1ZR2A 1WJFA 5IPAA 1EH7A 2DCEA 2CFOA 2KIMA 2WAEA 3VSKA 2A69F 3I53A 3TMOA 1NG7A 3D1NI 2E34A 3CP2A 3O8GA 2AQEA 2DFIA 3HOZJ 4FE7A 4A2UA 2O5RA 5FLXZ 2VJJA 4BY7J 1USSA 1R23A 1IC8A 1K79A 3R4KA 3HG9A 2QCOA 4HZFA 2FSWA 2M1BA 3NQOA 1K4SA 2BVLA 2BY3A 2WAFA 2O9LA 4PGGA 4BAYA 2HTJA 4I0AA 3RCOA 4YFNF 2ID3A 1KA8A 2XPWA 1LB2A 3FXQA 2IT0A 5FRMA 1A36A 4A3CJ 3W6KB 1XGNA 2VBXA 1P2FA 3FMQA 1LVAA 3N05A 3OIPA 1Q1HA 5D4RA 3FWEA 2Y75A 1U5TA 3OSGA 3DPLC 4FTHA 4LLGF 5FKOA 4HPQA 1UHMA 4WXHA 2WY8Q 2NVTJ 3DBHB 3FHNA 4CCLA 4U7BA 1HDDC 4GFBA 3BPXA 4EQQA 3F21A 1T95A 1IRXA 2IVMA 1XMXA 1KQ8A 3ZMDA 3L2UA 3RPUD 4ZDPA 2K9MA 2COBA 2VOOA 4OIRF 4B4CA 3G1MA 5TISC 5EG0B 3S2HJ 4G6TB 4PJMA 4ENJA 5H2FC 1I5ZA 3QPHA 4GO1A 1PUFA 2IAIA 1UHWA 5FROA 4KN7X 1QU3A 4DBRA 2M30A 1U3EM 2OPTA 1R1UA 1UB9A 2IS2A 2LD5A 3H9JA 3BJOA 2Y9ZA 3VPRA 4F92B 1IXRC 1IJWC 1I1GA 1REPC 1WCMJ 1Z21A 4LG3A 1IAWA 2FNPA 3G2BA 2GZWA 4A3GJ 2RREA 2OZUA 2VBWA 2BBYA 3IV5A 2WAQA 3ECOA 1T6SA 2KPMA 1TP4A 3I54A 4CSWA 3A2KA 2IS4A 3K2AA 4NBQA 4BDZA 3CCJI 1G2HA 2F5VA 1ETYA 3CDIA 1UMQA 2Z3YA 1JJ8C 3LAJA 4BBRJ 3LSRA 2ZNZA 3SDBA 3SHFA 4N4NB 2Z2SB 5GAGJ 5HLTA 4C3JJ 2M3AA 2X6OA 2L7KA 1T0FC 3WGGA 1MJAA 5C4XJ 1VQ9I 3M07A 3HGYA 1TBXA 1AKHA 1I39A 2MSYA 2K27A 2QQBA 3BY6A 2L9NA 4JYKA 4OWRB 5GTIC 2EFWA 2FD5A 4A3MJ 3BP8A 3FX3A 3GXOA 2R4GA 4A69C 1HCRA 4ZYHA 3N4MA 4W1UA 1J59A 2KIQA 3K1NA 2HYJA 5D8LB 1TW2A 2VXDA 4L0YB 1Y1WJ 5E79C 2W00A 3X2QH 1ZREA 1ETQA 2RQPA 2ZJQF 3CMAI 3BWGA 1D8JA 1JHHA 3GZ6A 1BI0A 3EUKL 2VN2A 1ITYA 2DYRH 1YW8A 5DDGA 1RI7A 2CS3A 1WWXA 1H9TA 2RQQA 4EV0A 1ODDA 2JVGA 1DDNA 1BA5A 4QLCU 1ACIA 3W2AA 2OTJI 4XM3A 5L3GA 1JGSA 1R58A 4CHUA 1UELB 5J4VA 4ESFA 1JKRC 1R22A 2EH3A 4BQQA 5DCMA 3TO7A 4HLXA 4DZJA 2WV1A 1R1VA 3LA2A 3TDUC 4JX6A 2EV6A 3J7YJ 3U2RA 3HKZA 4DOZA 2DJNA 1VF9A 5HODA 1ETOA 4BBSJ 2PMHA 2ZFUA 4I01A 1I1SA 3BQZA 4N0BA 2XF6A 2I10A 4EJUA 1WJ5A 2P0WA 1MSEC 3MKZA 2EA4A 3BOQA 4UUTA 1GVJA 3JAMK 4A3EJ 3BT9A 1LPQA 4M74A 3TBIA 3DKYA 4R8HA 3H5AA 1SANA 5F1JA 4RM3A 1E3PA 1K61A 1YE9A 1LJ9A 1T8IA 1QA6A 1LUJB 4ZYAA 1X4PA 3GCMA 1JUPA 2VQCA 3AKZA 3LNQA 1A04A 1KU2A 4PZJA 3ABKH 3W2VA 1P7IA 3DEEA 1J75A 3F8FA 3CCYA 1ETKA 3OY9A 1FJLA 4BUPA 2ETHA 2DPDA 2A05A 3K70C 2Y0SN 2WWYA 2DDBA 5JVGF 4HRIA 3Q0VA 4HNVA 1HSJA 3H0GJ 1SMYF 3F8MA 1FP1D 4L9VA 1KU7A 2YU9J 5FD6A 2Z9OA 3KLNA 4H0EA 3KLOA 4UUVA 3G71I 2GAUA 2LR8A 1TT5B 3Q0UA 3BZ6A 2LOOA 1O3RA 4KNYA 2R7VA 5LHHA 2YPRA 2XVCA 3IWFA 2F5EA 1MNEA 2R7UA 1R9TJ 2IGKA 3PSIA 4UV9A 3FM5A 3MCZA 2HGCA 3IKVA 4M9SA 4P5OA 2CQKA 2P8TA 2LVSA 3I3LA 3P9CA 4NQWB 2JQ7A 3E6MA 1Z1DA 3BR0A 2UV1A 2FX0A 3FK7A 4RA2A 4DNCA 4Z6YA 4ASNA 1H88C 4E7LA 5IY5H 3E6BA 4ZZLA 3HOYJ 1YQAA 2LBFB 2HOTA 4HF1A 1P9QC 2BHYA 2NS0A 3U9GA 4LB5A 1OYYA 5F27A 2ZKZA 3GEZA 3PM1A 3TO9A 5LEJA 1WH7A 3BCAA 2RAEA 2X6XA 3FXJA 5H6RA 3K70D 3TKYA 1JTXA 1J0RA 1ZHFA 4XRSA 2Q1ZB 3S93A 2GIVA 4QTRA 2EZHA 1AOYA 1LNWA 1T56A 2YS9A 3MZYA 4ENMA 4PJLA 4HDUA 2VL8A 2FNAA 4D5FA 2IGNA 2W48A 5GAHJ 1EH6A 2ZJ2A 4U88A 3EYIA 3GW2A 1R5ID 3WTVC 4CICA 3QOEA 1N78A 2E5ZA 2R7XA 4UVCA 1AWCA 3K4KA 3KE2A 3L7WA 4BQOA 2DO7A 2HQAA 2DT5A 3CMEI 2ME0A 4HLYA 1FOYA 2RNJA 4I98B 2FJ1A 1EA3A 3HB9A 3TEDA 1JGGA 2NVQJ 2MLKA 2R7ZJ 2H1KA 2Q0OA 2QWWA 2LSOA 3MKLA 3PO2J 3MKYB 1VQ8I 1NG6A 2BY2A 1S72I 3R0JA 4AIKA 1FWZA 5CVIA 1VQLI 4G6DA 2VBZA 1OCCH 2R5YA 2QM3A 4EGZA 1LQ1A 4AM3A 1GV2A 4IPAA 3F3XA 3K4JA 3AG3H 1OR7C 4M71A 3RPQA 5B1AH 3VB2A 3C7JA 1YHQI 4UNOA 1D8KA 1VQ7I 2MFZA 4AC0A 3BG7A 1ZG3A 3S14J 2M9HA 3A0BC 3OL4A 4B47A 3IC7A 2IPQX 3OOPA 3U1KA 3E1SA 2PEXA 3EUAA 4F91B 1XX5A 3LSHA 3EYYA 2X0LA 2YX7A 4LITA 3TDZC 2O8XA 3QQAA 3WTYC 2OTLI 5F0CA 2JK3A 3JSPA 2VI6A 5TRDA 4BS9A 3LSKA 1I3AA 4C9YA 1FEXA 4AIDA 3R6SA 2FF4A 2Z99A 5KAIC 5EJCA 3ROUA 3M3YJ 4KMUX 3OL3A 5E17F 1DPUA 1VI0A 4CDGA 3CJQB 1O7LA 5GP9A 4Q47A 2LKPA 3SFZA 1JXSA 1SVLA 3S3MA 4JP0A 1F9NA 2KJCA 2L01A 4RGSA 3TP3A 1E2XA 3JRCA 5IYDJ 3CCEI 3C18A 4XOPA 5CPRB 5IYCJ 3AG1H 3PQJA 3C2HA 3BR1A 3W6VA 3H92A 3DTEA 2ZSHB 3OYKA 2DW4A 4IOCF 4CYDA 1FIPA 2BYVE 3PIPF 4A6DA 3ZCOA 1S7OA 4PJ0C 2UZKA 2DDAA 3DBRB 1OYWA 4O6JA 1W1WE 5EDNA 1R4NB 2BHZA 2V9KA 4KIFA 3QU3A 2BEOA 1BOAA 1K78B 4NC8A 2K3FA 4HV6A 1U0JA 3DFGA 2P5LC 4G7HF 3BTJA 4HEA2 3UR3C 3R0AA 5HLHA 2R93J 1SD6A 1KU9A 3ULQB 1ZR4A 4XLPF 4CYCB 5E1XA 5J3LA 1IDYA 2FU4A 4I99C 3S3NA 1F4KA 4OIPF 3DP7A 1D0ZA 2HOEA 4XN0A 4E7ZA 3IL2A 4OIOF 2W84A 2NOJB 4RLQA 3WE3A 2WA0A 4RLFA 2QSFX 4W97A 4BY1J 1P92A 4Q4ZF 2FUG2 3UKGA 1AHDP 5BMZA 4BEHA 3BZKA 5IT3A 5EG0A 2LLKA 3L09A 2E7XA 1LFUP 2UWMA 4XNFA 3HOWJ 2KIUA 3E6CC 1BI2A 1S29A 3GZ5A 3I4MJ 1B72B 2HQRA 3CJNA 4G9YA 3FXRA 1RKWA 3O8HA 3BR2A 4XLHA 2Y2ZA 2M2EA 1HSTA 4NHJA 3BG9A 3HHHA 4O5VA 5K5QA 1QPMA 2FQ4A 3J80K 3I55I 4M6VA 1Y0UA 2YUSA 1SFXA 2OC6A 2NYXA 4FASD 1S6LA 3K2ZA 3GLLA 1G3SA 2EIMH 3CF2A 3KP2A 2DQRA 2M87A 1X3ZB 1T2KA 2CGPA 1SEUA 5J1RA 2JZYA 4K2EA 4U0VA 4XSXF 2KDOA 4XKBA 2CUEA 4PSXA 5FO5A 3S15J 2HOSA 4HYEA 2FBIA 4Y3OA 5EEHA 3CCLI 3MZ8A 2QA4I 3DQVC 1LE8A 3FK6A 2FEZA 4BH9A 3WHBA 1YX3A 3PIOF 4DYCA 3VFZA 1HA8A 5CLSA 4YRVA 1W36C 2LTPA 4EJVA 4L18B 3D5RC 1MD0A 3KYCB 1P4AA 2XUBA 4Q5SF 4IHYA 3CDLA 2EBIA 4KUMA 4B09A 4IQ4A 2CMPA 3RIRA 2DA2A 1NTCA 2NRAC 3FBIB 1PP8F 3F23A 3I59B 3ZQQA 2WAQN 1J9IA 1BW5A 1X1CA 1SD4A 4RM2A 3S1QJ 2HU9A 2QUFA 4RB1A 2E2JJ 3RSNA 2DI3A 3OIQA 1VQ4I 2CYYA 5C4JJ 3MAJA 5D5UB 3MZHA 4XONA 2R92J 2H94A 2R3SA 3KX2A 1YW7A 1WRJA 1ZH5A 4NUBA 1T33A 4B44A 1MGTA 1UCRA 2JPCA 3S3OA 1FIAA 5E8IA 2DTZA 2XASA 4IHSA 4X6AJ 2P4WA 1G3TA 3CCUI 1XDSA 1HKTA 3T0YA 1IN5A 2GXAA 2PJPA 1D3YA 1XSDA 4RGUA 2JUGA 1JTYA 3PQKA 3JTGA 3RQIA 4MEYF 4TV7A 3JRHA 4QWQA 4ENNA 5EF6A 2W85A 4RAFA 3OYEA 3CUQB 2KFDA 5C3EJ 1JT6A 3LWFA 1XGOA 1O3SA 5FKLA 1IUFA 1MZBA 3BR6A 5ICGA 4XIDA 1P4XA 4I6ZA 1OCZH 1W36D 3ZPLA 2XV4S 2QF7A 2V9VA 4AVZA 1Y0NA 3RKQA 5K7HA 5DD4A 2DXIA 3DWLE 2DMNA 2D5VA 2GWRA 3PNVA 3L2QA 2DYSH 2MLGA 2E36A 2MC4A 3AL0C 4G6QA 1YW9A 4KIGA 2W24A 3GF2A 3KZZA 3I5UA 1P4WA 5AIQA 1WJAA 3GYHX 1DP7P 5D5XB 1RRJA 1J7KA 1XD7A 4L9NA 4XKVA 4XLAA 1GDTA 5E20A 3M8FA 3FXLA 5H6QA 5LGUA 4M3EA 4UV8A 1FSHA 3BR3A 2R7RA 3K4BA 2Z16A 3J7AO 1ZELA 2F5DA 3FIWA 3HKZN 2CH0A 5HDGA 5LBQA 4A3KJ 2A6HF 4HG2A 5GAEJ 4RGXA 2JA5J 1XMKA 2HYFA 2K9LA 3VEPA 1S5LC 2MG4A 4UVBA 1X19A 3LL7A 4PJNA 1WJEA 5LHGA 1ZK8A 4YFXF 3RI4A 4Y52J 1YJWI 2DTRA 3RYPA 3RJPA 4A0ZA 4HF0A 4EJWA 5LRSA 2QLZA 2OA4A 1FYKA 2DFFA 2ESNA 4V2GA 3E0JB 1QQIA 1MNMC 3KPHA 3HBLA 2EIKH 1FOKA 4D0PA 3E97A 4LOCA 4XLCA 3P5JA 1VFCA 3IWZA 1ULYA 4BDYA 3K10A 2GLOA 1LDKB 4ZC3A 5D5WB 1IF1A 1QHGA 4IRIA 3C1DA 1P6RA 5TJJA 1W7PD 1XDUA 3U1DA 3OYNA 2V1NA 2DQLA 3DLLF 1VQ5I 3RZOJ 2RNGA 3ZMZA 4MGRA 3M9AA 4C2TA 2G0EA 2H8WA 2M0MA 2QQ8A 4LG0B 2GA2A 1AU7A 4YEJA 3K4LA 3KIOA 3SFIA 4LFUA 5F6FA 5HS7A 3MD2A 1KONA 3LFKA 2MD5A 2L4AA 4EJOA 4S05A 1RC9A 3E5XA 4PUSA 4RAZA 3ECHA 2JJ7A 3BROA 3K4NA 3B02A 4JQFA 1STZA 1L3LA 5JI6A 2EWNA 4PCQA 1GT0C 4M3FA 4CO8A 5J47A 3ESWB 1XSVA 1M1EB 4EMSA 1EH8A 5M3MJ 4I2OA 1EF4A 1OQYA 2PMZA 2LH9A 1TWGJ 2VT2A 2E7WA 2P5VA 2E5NA 1D1AA 5E18F 4Y4RA 3LMMA 1V54H 3CMMA 3HOXJ 1R00A 2DMTA 1XS9A 3DU5A 3GZNB 4AWXB 2F5CA 2P6SA 3QODA 2FRHA 4CH7A 4A3DJ 4YFKF 2PFBA 3HSFA 1MBGA 3RZDJ 2V6EA 1VNDA 4A0XA 2DA6A 2NVXJ 3GMEA 1MH4A 3F22A 1YS7A 3HOTA 3CCVI 3CMYA 2IBDA 3HUGB 2VKVA 1R36A 1Z0XA 2VQLA 4I09A 4N9HA 3FDYA 2ZXIA 4HSTA 5LEKA 1POGA 3Q0WA 4ESJA 1XMAA 4WCGA 1LFPA 1UHSA 2XAUA 3DLAA 4IHTA 1ZLJA 3GLXA 3FMRA 1WH5A 3WU1B 1A6QA 2CW8A 4BJ6C 2YU3A 3O3KA 1RKTA 1O4XA 2V1UA 5DM6F 4D1QA 3HDDA 3VYSB 3JR9A 2PI0A 3Q9VA 4AU7A 4FISA 4M3DA 2AXLA 2EPFA 4ABZA 2KRFA 1HLVA 4U0YA 2PJRA 2CUZA 2LRDA 2IGOA 5ICFA 5HDNA 3OYAA 5BOXA 1TWHJ 3SJMA 1FYMA 1V55H 3W3CA 1NHAA 4MFDA 2CO5A 3PNYA 2ZXWH 5K7ZA 4Y13A 1DQUA 2MYSA 5F64A 1YI2I 4OAZA 1JI8A 3ZN0A 4NC6A 2QENA 2OV7A 4ZDLA 3F9KA 1T08B 3A01A 4WX9A 1UG2A 4F93B 3OYDA 1R4MB 2EV5A 4J01A 2B0LA 2E60A 3BZCA 2IJLA 2EB7A 3CUQC 3ML6A 2I8DA 3BCBA 5LGTA 3V7SA 1YRNA 2IRFG 2JWTA 1FZPB 5HDKA 3RQ4A 4HNTA 1JJ6C 1ON2A 1ZTRA 2FQ3A 3GFJA 3ZGKA 2QVOA 5EGOB 4OIQF 4G94A 5AIPA 3I64A 5A2QK 2ELHA 4BL0B 3WTSC 3DKWA 3RPUA 4II2A 4P55A 1F1ZA 3I71A 1SFKA 3K1MA 4V19K 3S1RJ 3ELKA 3MVPA 1U9OA 5FJ8J 2EIJH 4QPOA 1IN8A 2R7TA 3ZMTA 3GTLJ 1K83J 2A61A 1K78A 2EFOA 4ENKA 4GCVA 1Z67A 2OJED 2M4KA 2Y9YA 4BXUA 2HVRA 1IXSB 3OWTA 3G3ZA 1JKQC 2MH2A 3S16J 1Z3YA 2IXSA 3OR2C 5LRRA 3QYBA 1N77A 2FOWA 3ABUA 3MQ0A 3TL4X 3ISPA 1D0YA 1OKRA 3NEUA 4F55A 2E35A 2E1MC 2MABA 1MSFC 5FRNA 4UB6C 1MBKA 5BPIA 2LC2A 3K4CA 1LDDA 3CO6C 4KFCA 4WXDA 4XL9A 4F3QA 3JW4A 3CZ6A 3DV8A 5K5RA 2L4MA 2HDDA 2BOLA 2NXNB 3GTJJ 1B1BA 1TL8A 1C0WA 2IS1A 2DOAA 3IUOA 4I02A 3CDHA 2Q2EB 2EZKA 5FLMJ 1X1AA 1BR4A 1QPIA 4N4OB 3SZGA 4WK8F 2X85A 1WVRA 2IA2A 2XF7A 3H9QA 5M5XJ 2Z33A 1Z9CA 4G7OF 1B6AA 1IO2A 1WKMA 2KMUA 4LIUA 4UUSB 3MEXA 2L2OA 2LG4A 2MC3A 3CESA 1A5JA 2OCEA 4ETSA 5J6XA 1QGPA 1MMNA 4J00A 4BE0A 1LFBA 3J81Z 2K3PA 4EATA 4PK4A 2WB1A 5D8KB 1SFUA 1RUNA 1SC7A 1OMIA 1MMDA 1Y6IA 3VDXA 4IF4A 5E3NA 4E70A 5DYMA 4KIBA 2KP6A 3CTAA 1V5GA 3CJTB 4F7ZA 1QVUA 4L0ZB 3ZQIA 1NK3P 5HS9A 1CF7A 3OR1C 2HTSA 4EM1A 5IT9Z 2NNNA 2HKXA 4M9XA 3WHCA 1YS6A 1Z05A 3F8CA 2EFQA 1BL0A 1V5FA 4IXAA 4ZYDA 2A5YB 1SFEA 1Y8QB 2ZO4A 3NAUA 2MBFA 3I9V2 2QBYA 2W25A 4HX7A 4U7DA 3LOCA 1ZGWA 3H5NA 1BJAA 3KEQA 3HPHA 1APLC 1FTTA 4KN4X 5F0FA 5D5VB 2CV2A 2XKOA 1BR2A 1RR8C 2ISZA 1YG2A 2DJIA 4PJJA 4XLEA 3PNTA 3HOVJ 3HPGA 3HSEA 3IKTA 1H8AC 3CD6I 3SZTA 1U5TB 2Y48A 2V7FA 3V7RA 1BI3A 4YIRX 1VQOI 4GYGA 1D1CA 2DT7B 2HEOA 5IP7J 4XICA 1P7JA 1T0FA 1R6RA 1TTYA 1FBQA 1X4OA 3F8BA 1ERDA 5FLXK 1SFOJ 4UXNA 3BTLA 4LLNA 1EJ9A 2DA1A 2K02A 1BBYA 2RN7A 2PMUA 2HWVA 4CCJA 3P9KA 3SEQA 2DA3A 2CRGA 2XRNA 4H4KC 2LKSA 4BE2A 2ZB9A 2P7VB 4OMZA 5L3DA 1Y39A 1PUFB 2COMA 1FMWA 5C44J 4BKXA 1F43A 3E5QA 3W2WA 1QZZA 2DBBA 2FOKA 4IO9F 3WGIA 1ZG1A 3N97A 3CUQA 2XAGA 4BXXJ 3HRTA 3OS1A 1H89C 1PVEA 2O8KA 1O57A 2FA5A 2H6CA 4MIMA 1Z3XA 2K40A 3DF8A 2RVCA 3KP3A 4MQ9F 4MEXF 3L2WA 3ZR8X 3HJEA 1ETXA 2NS7A 1F5TA 2EV0A 2YR2A 1GHCA 2FE3A 1BM9A 2LP0A 2ELJA 1FLIA 2CQXA 2F4OB 2R7OA 2XAJA 2BW3B 3ZN1A 1FSEA 3PO3J 4FX0A 2IW5A 4RBOA 4EGYA 3IP4B 3PSFA 2O03A 1MJ9A 3RKWA 2MW8A 5HLIA 3FF5A 5JHUA 1A6IA 3DEWA 2AQFA 1MH3A 4L9TA 4XKWA 4ZH4F 2LREA 2K7LA 2QEXI 2CJJA 4A93J 1XN7A 1BR1A 2G9WA 4EM0B 2IS6A 1W7PB 2HXIA 2F4IA 2HNHA
chains in the Genus database with same CATH topology
3T8RA 4LK1F 2WC2A 2XROA 4I7HA 4BYYA 3C3WA 1USTA 3COAC 2HKOA 1YFHA 3V8JA 2ACJA 1CGPA 3WU0A 2J5OA 3K9TA 1XGMA 2H27A 2V6CA 3AAFA 3LA3A 2OZ6A 5D6FA 1MKMA 2WV0A 5ILVA 4MNUA 4R1HA 4XSZF 3B73A 2LF7A 3H3ZA 3OV8A 4LMYA 3WTTC 4ESBA 5DCFA 1IXCA 2KKOA 2ZNYA 4RB3C 2CG4A 2CW0F 2TDXA 4WWCA 4M6XA 4MQVA 3I0TA 2DK5A 2M45A 4LJZF 3K69A 3O2PE 2KIFA 5HS8A 2NAZA 4G8XA 2PBIA 4LD5A 6PAXA 1IRFA 3E3VA 3KZYA 3MWMA 5L3BA 2OQGA 4I0BA 1WSUA 1K7AA 2OU2A 4FHTA 2WTEA 3LQRA 1I27A 3WGHA 2O6GE 1U5TC 3KP4A 3QRFF 2L54A 5FGMA 2XAHA 3KP6A 2DK8A 1OR7A 2LF8A 1BIAA 4A5MA 1YIOA 4XBFA 2R7FA 4FX4A 3KETA 2V1DA 4NB5A 4G7ZF 2LNBA 1W5TA 4YG2F 2IP2A 1YLFA 3JAMZ 3ZQ7A 4HQEA 2VC0A 4BQAA 1IRGA 3RTRA 3IRRA 1YO5C 1XCBA 1JE8A 2EFPA 1ZAOA 5E1WA 3FXUA 3GO5A 4MTEA 5ICEA 3GFMA 4Q48A 3LA7A 5DV5A 5CVVA 2STTA 1FPQA 1G4DA 4M73A 2GXBA 4OMYA 4M6YA 2XIGA 4KDPA 1ZG5A 3V4GA 3DPTA 1U2WA 5KK1A 4PGHA 2JSCA 4LB6B 3EDPA 5ERIA 2DPUA 4GYIA 1T39A 3IRQA 1R5HA 4B8XA 2D2WA 2ADUA 1MDMB 3BJ6A 2D1VA 3HTUA 3F6VA 2QZ8A 5BQTA 4U0WA 2RKHA 3LQQA 1TNTA 2FBKA 2JTVA 1R5GA 1B59A 2Q2EA 3QAHA 1QBJA 4Y15A 4GGGA 1FBSA 5CVUA 3TGNA 3ABTA 1IUYA 1V3FA 1BI1A 2VC1A 1HKQA 3CO7C 5JR3A 1GXQA 4A12A 2EFNA 3KP5A 5FFXA 4O3MA 1FBUA 3L9FA 2AS5F 5HVQC 2GQQA 3R61A 4NQWA 5FFZA 2VT3A 4AVPA 3ZMVA 2OAZA 4M9ZA 2J5PA 1KYZA 2RV8A 2HR3A 5EEGA 2P7CB 3HTSB 4P9UA 3HHGA 5DEQA 1IN7A 4RB0A 3KCCA 2Q8KA 1U78A 1HBXG 1Z7UA 4RAYA 3HYIA 1BIBA 1O3QA 4HQMA 1BC8C 3RDIA 5AONA 1HXDA 3KFWX 4JK1X 5JFRA 4HOBA 5DD8A 2Z5UA 4KA4A 3WTWC 1FC3A 3ERED 1Z6RA 3LSTA 1V4RA 4AIJA 1ZRCA 1TQPA 4EJTA 1B9NA 1QNTA 4WF2A 4IRGA 3KEOA 3DXJF 4AIHA 2UXXA 2OBPA 1J5YA 3BPVA 3WTZA 1ONVA 2P5KA 4MHGA 1DUXC 2V79A 5FB2A 1XSXA 3SXYA 1IW7F 1ZGJA 3HRSA 3WTXC 4OINF 4HDVA 1Z6TA 2HDCA 3GFLA 3D5LA 2STWA 4DQ2A 1U6GA 2A6EF 4R79A 5DUIA 2VE8A 4CZZA 5J8CA 5H20A 2BV6A 1W7PA 1WI9A 2ZFWA 2O61A 1VTNC 3SZPA 3FM3A 3GWZA 4EVIA 1IN6A 4L5JA 4IJAA 1HW5A 2QYOA 2O0YA 3ZP5A 3FHZA 2MH9A 3T8TA 3L2CA 3HRUA 2QQ9A 4N9IA 2D45A 1ZRFA 1B4AA 2H09A 2ZMEB 1KQ9A 3WG9A 2C6YA 2XHKA 4HX4A 2FMLA 2GXGA 2HQNA 3J80Z 2F5FA 4BHCA 1RIOH 3PFIA 2KJBA 1O7FA 2MA3A 4KT5C 1Z91A 5FD5A 2PLYA 1FNNA 1R1TA 5K5OA 2ESHA 3MFKA 5J8FA 3WE2A 1PUEE 3VOEA 2JPBA 1YTYA 2E1NA 4RGRA 1XCVA 4KICA 3IHUA 2PN6A 5BPDA 2RGVA 2L02A 5CYVA 3Q9SA 4XLNF 4RB2C 5L3EA 1FX7A 4WXCA 2DLLA 4ZZDA 2GA1A 4P9FA 3CLOA 4OU0A 1J2XA 1S7AA 5LHIA 3KP7A 1XB4A 2JRTA 4XRFA 1SD5A 5E8GA 1KGSA 5D4SA 1UFMA 4ON0A 1HQCA 5ILSA 2RC4A 4BHPA 3RKYA 2HYGD 1SAXA 3T5XA 2XKPA 4LK0F 3I59A 1T98A 2R7DA 1FT9A 4ZYGA 2E1CA 1FP2A 2ZXJA 1BN5A 5D6EA 2OD5A 4CXFA 3D0SA 2CWEA 4GXOA 1H9GA 1PDNC 4BNCA 3RKXA 1HKSA 2BE5F 1EV7A 1KYWA 2PQ8A 2F2EA 1QO0D 5CJ9A 3GUDA 1ZN2A 1ZYRF 1H0MA 2RDPA 3HOSA 2NNYA 1KU3A 1TW3A 4RS8A 1I6XA 2XAQA 1S3JA 3QOPA 2CSOA 1X3UA 4A6EA 3FZVA 1K6OA 1MDMA 5LGNA 1G6NA 2G7HA 2K4JA 3LAPA 2A3SA 5CVRA 4YIIA 4KMFA 1YYVA 3QP6A 4FT8A 2FMYA 1ZARA 2K4BA 3P7NA 1KQ0A 3M1EA 2FBHA 2HS5A 3QU6A 5ED4A 2H6BA 1XGSA 3K0LA 3G73A 4BHBA 1FY7A 3GVAA 3WTUC 4CGZA 3ZMUA 5DUKA 4HA8A 1R7JA 3DEUA 4YIFA 4S04A 3Q5FA 3F8NA 2FXAA 2IA1A 1FYLA 3W6JB 2VBYA 4LG0A 2CFXA 3F72A 3V8KA 5K1YA 3GX4X 5DCMB 5BS6A 1ZRDA 1PP7U 3I58A 4ZYEA 3BDDA 1QZYA 1BC7C 1RNLA 3E6DA 1LEBA 1RZ4A 3TOBA 3EQLF 3TOAA 2A68F 3R60A 2DAOA 2EK5A 2G7UA 2K86A 4Y17A 2A07F 2YX4A 3WODF 3EETA 4JBAA 3M7GA 3REOA 2D1HA 2IA0A 3O6BB 3HUGA 3NRVA 1WQ2A 3GFIA 2VXZA 5L3FA 3QP5A 3T1BA 1HW2A 2VONA 4PDKA 4HW0A 4UHTA 4UVAA 3BJAA 4L9JA 4P96A 4M72A 5HOOA 4LLLA 5ICCA 5CVJA 4IVNA 2ISYA 3TO6A 3L00A 1SMTA 5A2QZ 1CF7B 1TQMA 2VODA 2HFHA 3S2WA 1RUOA 1LEAA 4AD9A 3K1PA 2QBYB 2VE9A 1ON1A 1OPCA 1W5SA 3H3UA 4A0YA 2QQAA 1GXPA 3J81K 2XAFA 1W4MA 1D5VA 3E5UA 4A5NA 3RYRA 1LDJA 2PG4A 3VODA 3EUHA 2BGCA 1TNSA 2L3DA 1JHFA 1SD7A 4HX8A 5L3CA 5HLGA 5IT9K 1G3YA 2EA2A 4EM2A 3HSRA 3TQNA 2HZTA 4MTDA 4Z2YA 2DU9A 1OYIA 2ZMEA 5ILUA 1HW1A 3V7CA 1G3WA 3FMSA 2OQRA 2ZBKA 3P9IA 2V1XA 4KYWA 2M8EA 1E17A 2LDUA 3CUOA 1B9MA 1ZGAA 1S8NA 3JTHA 2JT1A 2W57A 4HV5A 3F6OA 1U8RA 3ZMSA 2EJRA 2X4HA 4HBLA 2XGXA 2ZCWA 3HRMA 5JVTA 4L5IA 4HF2A 1TLHB 1L0OC 3JSOA 1IN4A 3HIFA 5F1RA 2P6TA 4HAMA 3I4PA 2VOPA 2M5WA 3QPTA 5E1ZB 2UXNA 2O3FA 3SQNA 4LGWA 1TQIA 1T38A 1IZ1A 3V8LA 2Y0MA 4IRHA 4OOIA 5LLQA 2YSRA 1MJBA 5KVRA 1DPRA 1O3TA 1ZLKA 3M8EA 1EH7A 2KIMA 2A69F 3I53A 2DFIA 4A2UA 5FLXZ 1USSA 1R23A 1K79A 3R4KA 4HZFA 2FSWA 2M1BA 3NQOA 4PGGA 4BAYA 2HTJA 4I0AA 4YFNF 1KA8A 2IT0A 1LB2A 3FXQA 3W6KB 1XGNA 2VBXA 1P2FA 3FMQA 1LVAA 1Q1HA 5D4RA 3FWEA 2Y75A 1U5TA 3DPLC 4LLGF 1UHMA 4WXHA 4U7BA 3BPXA 4EQQA 3F21A 2IVMA 1KQ8A 3ZMDA 2VOOA 4OIRF 4ENJA 1I5ZA 3QPHA 4GO1A 1UHWA 4KN7X 2M30A 1U3EM 1R1UA 1UB9A 3BJOA 1IXRC 1I1GA 1REPC 1IAWA 2FNPA 2GZWA 2OZUA 2VBWA 2BBYA 3ECOA 1T6SA 3I54A 2Z3YA 3LAJA 2ZNZA 3SHFA 3WGGA 1MJAA 1TBXA 2K27A 2QQBA 3BY6A 2EFWA 3BP8A 3FX3A 3GXOA 4ZYHA 3N4MA 1J59A 3K1NA 5D8LB 1TW2A 4L0YB 1ZREA 2RQPA 3BWGA 1D8JA 1JHHA 3GZ6A 1BI0A 2VN2A 1YW8A 5DDGA 1RI7A 1WWXA 1H9TA 4EV0A 1ODDA 1DDNA 4QLCU 5L3GA 1JGSA 1R58A 4CHUA 4ESFA 1R22A 5DCMA 3TO7A 4HLXA 1R1VA 3LA2A 3TDUC 2EV6A 3U2RA 2PMHA 4I01A 1I1SA 4N0BA 4EJUA 2EA4A 3BOQA 3JAMK 1GVJA 4M74A 4R8HA 1LJ9A 1A04A 1KU2A 4PZJA 1J75A 3F8FA 2ETHA 2DPDA 2WWYA 1HSJA 1SMYF 3F8MA 1FP1D 4L9VA 1KU7A 5FD6A 2Z9OA 3KLNA 4H0EA 3KLOA 4UUVA 2GAUA 3BZ6A 1O3RA 4KNYA 5LHHA 2YPRA 2XVCA 3IWFA 2F5EA 4UV9A 3FM5A 3MCZA 2HGCA 3IKVA 4M9SA 4P5OA 2CQKA 2P8TA 3P9CA 3E6MA 1Z1DA 4DNCA 4ASNA 3E6BA 4ZZLA 1YQAA 4HF1A 2NS0A 3U9GA 4LB5A 1OYYA 2ZKZA 3GEZA 3TO9A 5LEJA 5H6RA 3TKYA 1J0RA 1ZHFA 2GIVA 1AOYA 1LNWA 3MZYA 4ENMA 4HDUA 2FNAA 1EH6A 4U88A 2ZJ2A 3EYIA 3GW2A 3WTVC 4CICA 4UVCA 1AWCA 3KE2A 3L7WA 2DO7A 2DT5A 4HLYA 2RNJA 4I98B 2MLKA 2Q0OA 2QWWA 2LSOA 3R0JA 4AIKA 1FWZA 5CVIA 4G6DA 2VBZA 2QM3A 4EGZA 1LQ1A 4IPAA 3F3XA 4M71A 3RPQA 3VB2A 3C7JA 4UNOA 1D8KA 1ZG3A 3IC7A 2IPQX 3OOPA 2PEXA 3EYYA 2X0LA 2YX7A 3TDZC 2O8XA 3WTYC 3JSPA 5TRDA 3R6SA 2FF4A 2Z99A 3ROUA 1DPUA 4KMUX 5E17F 4CDGA 1O7LA 4Q47A 2LKPA 3SFZA 1JXSA 1F9NA 2KJCA 2L01A 4RGSA 1E2XA 3C18A 3PQJA 3H92A 2DW4A 4CYDA 2BYVE 4A6DA 1S7OA 2UZKA 1OYWA 4O6JA 4KIFA 3QU3A 2BEOA 1BOAA 1K78B 4HV6A 2P5LC 4G7HF 3DFGA 3R0AA 5HLHA 1SD6A 1KU9A 3ULQB 4XLPF 5E1XA 2FU4A 4OIPF 1F4KA 3DP7A 2HOEA 3IL2A 4OIOF 2W84A 3WE3A 1P92A 4Q4ZF 5BMZA 5IT3A 3L09A 2E7XA 2UWMA 2KIUA 3E6CC 1BI2A 1S29A 3GZ5A 2HQRA 3CJNA 4G9YA 3FXRA 1HSTA 4NHJA 3HHHA 4O5VA 5K5QA 1QPMA 3J80K 1Y0UA 1SFXA 2NYXA 1S6LA 3K2ZA 1G3SA 3KP2A 2DQRA 2M87A 1T2KA 2CGPA 2JZYA 4K2EA 4U0VA 4XSXF 5FO5A 4HYEA 2FBIA 5EEHA 3DQVC 2FEZA 4BH9A 3VFZA 5CLSA 4L18B 4EJVA 1MD0A 1P4AA 2XUBA 4Q5SF 4KUMA 4B09A 3RIRA 2NRAC 1PP8F 3F23A 3I59B 1J9IA 1SD4A 2QUFA 4RB1A 2DI3A 2CYYA 3MAJA 5D5UB 3MZHA 2H94A 2R3SA 1YW7A 1WRJA 1ZH5A 1MGTA 1UCRA 2JPCA 5E8IA 2XASA 4IHSA 2P4WA 1G3TA 1XDSA 1HKTA 3T0YA 1IN5A 2PJPA 1D3YA 1XSDA 4RGUA 3PQKA 3JTGA 4MEYF 4TV7A 4QWQA 4ENNA 2W85A 3CUQB 3LWFA 1XGOA 1O3SA 1MZBA 5ICGA 1P4XA 3ZPLA 2XV4S 2V9VA 5DD4A 2GWRA 2MLGA 4G6QA 1YW9A 4KIGA 2W24A 3GF2A 3KZZA 3I5UA 1P4WA 5AIQA 3GYHX 1DP7P 5D5XB 1J7KA 1XD7A 4L9NA 5E20A 3M8FA 5H6QA 5LGUA 4UV8A 1FSHA 3J7AO 2F5DA 5LBQA 5HDGA 2A6HF 4RGXA 1XMKA 2HYFA 3VEPA 4UVBA 5LHGA 4YFXF 3RI4A 2DTRA 3RYPA 3RJPA 4A0ZA 4HF0A 4EJWA 5LRSA 2QLZA 2OA4A 1FYKA 2ESNA 1QQIA 1FOKA 4D0PA 3E97A 3IWZA 1ULYA 1LDKB 5D5WB 1IF1A 4IRIA 3C1DA 1P6RA 5TJJA 1W7PD 1XDUA 3U1DA 2DQLA 3ZMZA 4MGRA 3M9AA 4LG0B 2GA2A 4LFUA 5F6FA 5HS7A 3LFKA 2MD5A 2L4AA 4EJOA 4S05A 3E5XA 4RAZA 3ECHA 3BROA 3B02A 4JQFA 1STZA 1L3LA 5JI6A 2EWNA 4PCQA 4CO8A 1XSVA 4EMSA 1EH8A 4I2OA 2VT2A 2E7WA 2P5VA 5E18F 1R00A 4AWXB 2F5CA 2P6SA 2FRHA 4YFKF 2PFBA 3HSFA 4A0XA 3F22A 1YS7A 3HOTA 1R36A 4I09A 4N9HA 5LEKA 4ESJA 1XMAA 4WCGA 4IHTA 1ZLJA 3GLXA 3FMRA 3WU1B 2YU3A 3O3KA 2V1UA 2PI0A 3Q9VA 2AXLA 2KRFA 4U0YA 5ICFA 5HDNA 5BOXA 1FYMA 1NHAA 2CO5A 4Y13A 5F64A 3ZN0A 2QENA 4WX9A 2EV5A 2B0LA 2IJLA 2EB7A 3CUQC 3ML6A 5LGTA 3V7SA 2IRFG 1FZPB 5HDKA 1ON2A 2FQ3A 3GFJA 2QVOA 4OIQF 4G94A 5AIPA 3I64A 5A2QK 2ELHA 3WTSC 3DKWA 3RPUA 4P55A 1F1ZA 3I71A 3K1MA 3ELKA 1IN8A 3ZMTA 2A61A 1K78A 2EFOA 4ENKA 4GCVA 4BXUA 1IXSB 3G3ZA 2MH2A 5LRRA 3ABUA 3MQ0A 3ISPA 1OKRA 3NEUA 5BPIA 4KFCA 1LDDA 3CO6C 4WXDA 3JW4A 3DV8A 5K5RA 2L4MA 1C0WA 1B1BA 4I02A 3CDHA 4WK8F 2IA2A 4G7OF 1Z9CA 2Z33A 1B6AA 1WKMA 3MEXA 2MC3A 4ETSA 5J6XA 1QGPA 3J81Z 5D8KB 1SFUA 1RUNA 1OMIA 4IF4A 4E70A 5DYMA 4KIBA 3CTAA 4F7ZA 4L0ZB 5HS9A 1CF7A 2HTSA 4EM1A 5IT9Z 2NNNA 4M9XA 2HKXA 1YS6A 1Z05A 3F8CA 2EFQA 4IXAA 4ZYDA 2A5YB 1SFEA 2ZO4A 2MBFA 2QBYA 2W25A 4HX7A 4U7DA 1BJAA 3KEQA 4KN4X 5D5VB 2XKOA 2ISZA 1YG2A 3HSEA 3IKTA 3SZTA 1U5TB 2Y48A 3V7RA 1BI3A 4GYGA 2HEOA 1T0FA 1TTYA 1FBQA 3F8BA 5FLXK 4UXNA 4LLNA 2K02A 1BBYA 2RN7A 2PMUA 2HWVA 3P9KA 2XRNA 2P7VB 4OMZA 5L3DA 2COMA 3E5QA 1QZZA 2DBBA 2FOKA 3WGIA 1ZG1A 3N97A 3CUQA 2XAGA 3HRTA 1O57A 2FA5A 2H6CA 3DF8A 2RVCA 3KP3A 4MQ9F 4MEXF 1F5TA 2EV0A 2YR2A 1GHCA 2FE3A 1BM9A 1FLIA 3ZN1A 2XAJA 1FSEA 4FX0A 2IW5A 4EGYA 2O03A 1MJ9A 3RKWA 5HLIA 3FF5A 5JHUA 4L9TA 4ZH4F 2K7LA 1XN7A 2G9WA 4EM0B 1W7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8R A;  4LK1 F;  2WC2 A;  2XRO A;  4I7H A;  4BYY A;  3C3W A;  1UST A;  3COA C;  2HKO A;  1YFH A;  3V8J A;  2ACJ A;  1CGP A;  3WU0 A;  2J5O A;  3K9T A;  1XGM A;  2H27 A;  2V6C A;  3AAF A;  3LA3 A;  2OZ6 A;  5D6F A;  1MKM A;  2WV0 A;  5ILV A;  4MNU A;  4R1H A;  4XSZ F;  3B73 A;  2LF7 A;  3H3Z A;  3OV8 A;  4LMY A;  3WTT C;  4ESB A;  5DCF A;  1IXC A;  2KKO A;  2ZNY A;  4RB3 C;  2CG4 A;  2CW0 F;  2TDX A;  4WWC A;  4M6X A;  4MQV A;  3I0T A;  2DK5 A;  2M45 A;  4LJZ F;  3K69 A;  3O2P E;  2KIF A;  5HS8 A;  2NAZ A;  4G8X A;  2PBI A;  4LD5 A;  6PAX A;  1IRF A;  3E3V A;  3KZY A;  3MWM A;  5L3B A;  2OQG A;  4I0B A;  1WSU A;  1K7A A;  2OU2 A;  4FHT A;  2WTE A;  3LQR A;  1I27 A;  3WGH A;  2O6G E;  1U5T C;  3KP4 A;  3QRF F;  2L54 A;  5FGM A;  2XAH A;  3KP6 A;  2DK8 A;  1OR7 A;  2LF8 A;  1BIA A;  4A5M A;  1YIO A;  4XBF A;  2R7F A;  4FX4 A;  3KET A;  2V1D A;  4NB5 A;  4G7Z F;  2LNB A;  1W5T A;  4YG2 F;  2IP2 A;  1YLF A;  3JAM Z;  3ZQ7 A;  4HQE A;  2VC0 A;  4BQA A;  1IRG A;  3RTR A;  3IRR A;  1YO5 C;  1XCB A;  1JE8 A;  2EFP A;  1ZAO A;  5E1W A;  3FXU A;  3GO5 A;  4MTE A;  5ICE A;  3GFM A;  4Q48 A;  3LA7 A;  5DV5 A;  5CVV A;  2STT A;  1FPQ A;  1G4D A;  4M73 A;  2GXB A;  4OMY A;  4M6Y A;  2XIG A;  4KDP A;  1ZG5 A;  3V4G A;  3DPT A;  1U2W A;  5KK1 A;  4PGH A;  2JSC A;  4LB6 B;  3EDP A;  5ERI A;  2DPU A;  4GYI A;  1T39 A;  3IRQ A;  1R5H A;  4B8X A;  2D2W A;  2ADU A;  1MDM B;  3BJ6 A;  2D1V A;  3HTU A;  3F6V A;  2QZ8 A;  5BQT A;  4U0W A;  2RKH A;  3LQQ A;  1TNT A;  2FBK A;  2JTV A;  1R5G A;  1B59 A;  2Q2E A;  3QAH A;  1QBJ A;  4Y15 A;  4GGG A;  1FBS A;  5CVU A;  3TGN A;  3ABT A;  1IUY A;  1V3F A;  1BI1 A;  2VC1 A;  1HKQ A;  3CO7 C;  5JR3 A;  1GXQ A;  4A12 A;  2EFN A;  3KP5 A;  5FFX A;  4O3M A;  1FBU A;  3L9F A;  2AS5 F;  5HVQ C;  2GQQ A;  3R61 A;  4NQW A;  5FFZ A;  2VT3 A;  4AVP A;  3ZMV A;  2OAZ A;  4M9Z A;  2J5P A;  1KYZ A;  2RV8 A;  2HR3 A;  5EEG A;  2P7C B;  3HTS B;  4P9U A;  3HHG A;  5DEQ A;  1IN7 A;  4RB0 A;  3KCC A;  2Q8K A;  1U78 A;  1HBX G;  1Z7U A;  4RAY A;  3HYI A;  1BIB A;  1O3Q A;  4HQM A;  1BC8 C;  3RDI A;  5AON A;  1HXD A;  3KFW X;  4JK1 X;  5JFR A;  4HOB A;  5DD8 A;  2Z5U A;  4KA4 A;  3WTW C;  1FC3 A;  3ERE D;  1Z6R A;  3LST A;  1V4R A;  4AIJ A;  1ZRC A;  1TQP A;  4EJT A;  1B9N A;  1QNT A;  4WF2 A;  4IRG A;  3KEO A;  3DXJ F;  4AIH A;  2UXX A;  2OBP A;  1J5Y A;  3BPV A;  3WTZ A;  1ONV A;  2P5K A;  4MHG A;  1DUX C;  2V79 A;  5FB2 A;  1XSX A;  3SXY A;  1IW7 F;  1ZGJ A;  3HRS A;  3WTX C;  4OIN F;  4HDV A;  1Z6T A;  2HDC A;  3GFL A;  3D5L A;  2STW A;  4DQ2 A;  1U6G A;  2A6E F;  4R79 A;  5DUI A;  2VE8 A;  4CZZ A;  5J8C A;  5H20 A;  2BV6 A;  1W7P A;  1WI9 A;  2ZFW A;  2O61 A;  1VTN C;  3SZP A;  3FM3 A;  3GWZ A;  4EVI A;  1IN6 A;  4L5J A;  4IJA A;  1HW5 A;  2QYO A;  2O0Y A;  3ZP5 A;  3FHZ A;  2MH9 A;  3T8T A;  3L2C A;  3HRU A;  2QQ9 A;  4N9I A;  2D45 A;  1ZRF A;  1B4A A;  2H09 A;  2ZME B;  1KQ9 A;  3WG9 A;  2C6Y A;  2XHK A;  4HX4 A;  2FML A;  2GXG A;  2HQN A;  3J80 Z;  2F5F A;  4BHC A;  1RIO H;  3PFI A;  2KJB A;  1O7F A;  2MA3 A;  4KT5 C;  1Z91 A;  5FD5 A;  2PLY A;  1FNN A;  1R1T A;  5K5O A;  2ESH A;  3MFK A;  5J8F A;  3WE2 A;  1PUE E;  3VOE A;  2JPB A;  1YTY A;  2E1N A;  4RGR A;  1XCV A;  4KIC A;  3IHU A;  2PN6 A;  5BPD A;  2RGV A;  2L02 A;  5CYV A;  3Q9S A;  4XLN F;  4RB2 C;  5L3E A;  1FX7 A;  4WXC A;  2DLL A;  4ZZD A;  2GA1 A;  4P9F A;  3CLO A;  4OU0 A;  1J2X A;  1S7A A;  5LHI A;  3KP7 A;  1XB4 A;  2JRT A;  4XRF A;  1SD5 A;  5E8G A;  1KGS A;  5D4S A;  1UFM A;  4ON0 A;  1HQC A;  5ILS A;  2RC4 A;  4BHP A;  3RKY A;  2HYG D;  1SAX A;  3T5X A;  2XKP A;  4LK0 F;  3I59 A;  1T98 A;  2R7D A;  1FT9 A;  4ZYG A;  2E1C A;  1FP2 A;  2ZXJ A;  1BN5 A;  5D6E A;  2OD5 A;  4CXF A;  3D0S A;  2CWE A;  4GXO A;  1H9G A;  1PDN C;  4BNC A;  3RKX A;  1HKS A;  2BE5 F;  1EV7 A;  1KYW A;  2PQ8 A;  2F2E A;  1QO0 D;  5CJ9 A;  3GUD A;  1ZN2 A;  1ZYR F;  1H0M A;  2RDP A;  3HOS A;  2NNY A;  1KU3 A;  1TW3 A;  4RS8 A;  1I6X A;  2XAQ A;  1S3J A;  3QOP A;  2CSO A;  1X3U A;  4A6E A;  3FZV A;  1K6O A;  1MDM A;  5LGN A;  1G6N A;  2G7H A;  2K4J A;  3LAP A;  2A3S A;  5CVR A;  4YII A;  4KMF A;  1YYV A;  3QP6 A;  4FT8 A;  2FMY A;  1ZAR A;  2K4B A;  3P7N A;  1KQ0 A;  3M1E A;  2FBH A;  2HS5 A;  3QU6 A;  5ED4 A;  2H6B A;  1XGS A;  3K0L A;  3G73 A;  4BHB A;  1FY7 A;  3GVA A;  3WTU C;  4CGZ A;  3ZMU A;  5DUK A;  4HA8 A;  1R7J A;  3DEU A;  4YIF A;  4S04 A;  3Q5F A;  3F8N A;  2FXA A;  2IA1 A;  1FYL A;  3W6J B;  2VBY A;  4LG0 A;  2CFX A;  3F72 A;  3V8K A;  5K1Y A;  3GX4 X;  5DCM B;  5BS6 A;  1ZRD A;  1PP7 U;  3I58 A;  4ZYE A;  3BDD A;  1QZY A;  1BC7 C;  1RNL A;  3E6D A;  1LEB A;  1RZ4 A;  3TOB A;  3EQL F;  3TOA A;  2A68 F;  3R60 A;  2DAO A;  2EK5 A;  2G7U A;  2K86 A;  4Y17 A;  2A07 F;  2YX4 A;  3WOD F;  3EET A;  4JBA A;  3M7G A;  3REO A;  2D1H A;  2IA0 A;  3O6B B;  3HUG A;  3NRV A;  1WQ2 A;  3GFI A;  2VXZ A;  5L3F A;  3QP5 A;  3T1B A;  1HW2 A;  2VON A;  4PDK A;  4HW0 A;  4UHT A;  4UVA A;  3BJA A;  4L9J A;  4P96 A;  4M72 A;  5HOO A;  4LLL A;  5ICC A;  5CVJ A;  4IVN A;  2ISY A;  3TO6 A;  3L00 A;  1SMT A;  5A2Q Z;  1CF7 B;  1TQM A;  2VOD A;  2HFH A;  3S2W A;  1RUO A;  1LEA A;  4AD9 A;  3K1P A;  2QBY B;  2VE9 A;  1ON1 A;  1OPC A;  1W5S A;  3H3U A;  4A0Y A;  2QQA A;  1GXP A;  3J81 K;  2XAF A;  1W4M A;  1D5V A;  3E5U A;  4A5N A;  3RYR A;  1LDJ A;  2PG4 A;  3VOD A;  3EUH A;  2BGC A;  1TNS A;  2L3D A;  1JHF A;  1SD7 A;  4HX8 A;  5L3C A;  5HLG A;  5IT9 K;  1G3Y A;  2EA2 A;  4EM2 A;  3HSR A;  3TQN A;  2HZT A;  4MTD A;  4Z2Y A;  2DU9 A;  1OYI A;  2ZME A;  5ILU A;  1HW1 A;  3V7C A;  1G3W A;  3FMS A;  2OQR A;  2ZBK A;  3P9I A;  2V1X A;  4KYW A;  2M8E A;  1E17 A;  2LDU A;  3CUO A;  1B9M A;  1ZGA A;  1S8N A;  3JTH A;  2JT1 A;  2W57 A;  4HV5 A;  3F6O A;  1U8R A;  3ZMS A;  2EJR A;  2X4H A;  4HBL A;  2XGX A;  2ZCW A;  3HRM A;  5JVT A;  4L5I A;  4HF2 A;  1TLH B;  1L0O C;  3JSO A;  1IN4 A;  3HIF A;  5F1R A;  2P6T A;  4HAM A;  3I4P A;  2VOP A;  2M5W A;  3QPT A;  5E1Z B;  2UXN A;  2O3F A;  3SQN A;  4LGW A;  1TQI A;  1T38 A;  1IZ1 A;  3V8L A;  2Y0M A;  4IRH A;  4OOI A;  5LLQ A;  2YSR A;  1MJB A;  5KVR A;  1DPR A;  1O3T A;  1ZLK A;  3M8E A;  1EH7 A;  2KIM A;  2A69 F;  3I53 A;  2DFI A;  4A2U A;  5FLX Z;  1USS A;  1R23 A;  1K79 A;  3R4K A;  4HZF A;  2FSW A;  2M1B A;  3NQO A;  4PGG A;  4BAY A;  2HTJ A;  4I0A A;  4YFN F;  1KA8 A;  2IT0 A;  1LB2 A;  3FXQ A;  3W6K B;  1XGN A;  2VBX A;  1P2F A;  3FMQ A;  1LVA A;  1Q1H A;  5D4R A;  3FWE A;  2Y75 A;  1U5T A;  3DPL C;  4LLG F;  1UHM A;  4WXH A;  4U7B A;  3BPX A;  4EQQ A;  3F21 A;  2IVM A;  1KQ8 A;  3ZMD A;  2VOO A;  4OIR F;  4ENJ A;  1I5Z A;  3QPH A;  4GO1 A;  1UHW A;  4KN7 X;  2M30 A;  1U3E M;  1R1U A;  1UB9 A;  3BJO A;  1IXR C;  1I1G A;  1REP C;  1IAW A;  2FNP A;  2GZW A;  2OZU A;  2VBW A;  2BBY A;  3ECO A;  1T6S A;  3I54 A;  2Z3Y A;  3LAJ A;  2ZNZ A;  3SHF A;  3WGG A;  1MJA A;  1TBX A;  2K27 A;  2QQB A;  3BY6 A;  2EFW A;  3BP8 A;  3FX3 A;  3GXO A;  4ZYH A;  3N4M A;  1J59 A;  3K1N A;  5D8L B;  1TW2 A;  4L0Y B;  1ZRE A;  2RQP A;  3BWG A;  1D8J A;  1JHH A;  3GZ6 A;  1BI0 A;  2VN2 A;  1YW8 A;  5DDG A;  1RI7 A;  1WWX A;  1H9T A;  4EV0 A;  1ODD A;  1DDN A;  4QLC U;  5L3G A;  1JGS A;  1R58 A;  4CHU A;  4ESF A;  1R22 A;  5DCM A;  3TO7 A;  4HLX A;  1R1V A;  3LA2 A;  3TDU C;  2EV6 A;  3U2R A;  2PMH A;  4I01 A;  1I1S A;  4N0B A;  4EJU A;  2EA4 A;  3BOQ A;  3JAM K;  1GVJ A;  4M74 A;  4R8H A;  1LJ9 A;  1A04 A;  1KU2 A;  4PZJ A;  1J75 A;  3F8F A;  2ETH A;  2DPD A;  2WWY A;  1HSJ A;  1SMY F;  3F8M A;  1FP1 D;  4L9V A;  1KU7 A;  5FD6 A;  2Z9O A;  3KLN A;  4H0E A;  3KLO A;  4UUV A;  2GAU A;  3BZ6 A;  1O3R A;  4KNY A;  5LHH A;  2YPR A;  2XVC A;  3IWF A;  2F5E A;  4UV9 A;  3FM5 A;  3MCZ A;  2HGC A;  3IKV A;  4M9S A;  4P5O A;  2CQK A;  2P8T A;  3P9C A;  3E6M A;  1Z1D A;  4DNC A;  4ASN A;  3E6B A;  4ZZL A;  1YQA A;  4HF1 A;  2NS0 A;  3U9G A;  4LB5 A;  1OYY A;  2ZKZ A;  3GEZ A;  3TO9 A;  5LEJ A;  5H6R A;  3TKY A;  1J0R A;  1ZHF A;  2GIV A;  1AOY A;  1LNW A;  3MZY A;  4ENM A;  4HDU A;  2FNA A;  1EH6 A;  4U88 A;  2ZJ2 A;  3EYI A;  3GW2 A;  3WTV C;  4CIC A;  4UVC A;  1AWC A;  3KE2 A;  3L7W A;  2DO7 A;  2DT5 A;  4HLY A;  2RNJ A;  4I98 B;  2MLK A;  2Q0O A;  2QWW A;  2LSO A;  3R0J A;  4AIK A;  1FWZ A;  5CVI A;  4G6D A;  2VBZ A;  2QM3 A;  4EGZ A;  1LQ1 A;  4IPA A;  3F3X A;  4M71 A;  3RPQ A;  3VB2 A;  3C7J A;  4UNO A;  1D8K A;  1ZG3 A;  3IC7 A;  2IPQ X;  3OOP A;  2PEX A;  3EYY A;  2X0L A;  2YX7 A;  3TDZ C;  2O8X A;  3WTY C;  3JSP A;  5TRD A;  3R6S A;  2FF4 A;  2Z99 A;  3ROU A;  1DPU A;  4KMU X;  5E17 F;  4CDG A;  1O7L A;  4Q47 A;  2LKP A;  3SFZ A;  1JXS A;  1F9N A;  2KJC A;  2L01 A;  4RGS A;  1E2X A;  3C18 A;  3PQJ A;  3H92 A;  2DW4 A;  4CYD A;  2BYV E;  4A6D A;  1S7O A;  2UZK A;  1OYW A;  4O6J A;  4KIF A;  3QU3 A;  2BEO A;  1BOA A;  1K78 B;  4HV6 A;  2P5L C;  4G7H F;  3DFG A;  3R0A A;  5HLH A;  1SD6 A;  1KU9 A;  3ULQ B;  4XLP F;  5E1X A;  2FU4 A;  4OIP F;  1F4K A;  3DP7 A;  2HOE A;  3IL2 A;  4OIO F;  2W84 A;  3WE3 A;  1P92 A;  4Q4Z F;  5BMZ A;  5IT3 A;  3L09 A;  2E7X A;  2UWM A;  2KIU A;  3E6C C;  1BI2 A;  1S29 A;  3GZ5 A;  2HQR A;  3CJN A;  4G9Y A;  3FXR A;  1HST A;  4NHJ A;  3HHH A;  4O5V A;  5K5Q A;  1QPM A;  3J80 K;  1Y0U A;  1SFX A;  2NYX A;  1S6L A;  3K2Z A;  1G3S A;  3KP2 A;  2DQR A;  2M87 A;  1T2K A;  2CGP A;  2JZY A;  4K2E A;  4U0V A;  4XSX F;  5FO5 A;  4HYE A;  2FBI A;  5EEH A;  3DQV C;  2FEZ A;  4BH9 A;  3VFZ A;  5CLS A;  4L18 B;  4EJV A;  1MD0 A;  1P4A A;  2XUB A;  4Q5S F;  4KUM A;  4B09 A;  3RIR A;  2NRA C;  1PP8 F;  3F23 A;  3I59 B;  1J9I A;  1SD4 A;  2QUF A;  4RB1 A;  2DI3 A;  2CYY A;  3MAJ A;  5D5U B;  3MZH A;  2H94 A;  2R3S A;  1YW7 A;  1WRJ A;  1ZH5 A;  1MGT A;  1UCR A;  2JPC A;  5E8I A;  2XAS A;  4IHS A;  2P4W A;  1G3T A;  1XDS A;  1HKT A;  3T0Y A;  1IN5 A;  2PJP A;  1D3Y A;  1XSD A;  4RGU A;  3PQK A;  3JTG A;  4MEY F;  4TV7 A;  4QWQ A;  4ENN A;  2W85 A;  3CUQ B;  3LWF A;  1XGO A;  1O3S A;  1MZB A;  5ICG A;  1P4X A;  3ZPL A;  2XV4 S;  2V9V A;  5DD4 A;  2GWR A;  2MLG A;  4G6Q A;  1YW9 A;  4KIG A;  2W24 A;  3GF2 A;  3KZZ A;  3I5U A;  1P4W A;  5AIQ A;  3GYH X;  1DP7 P;  5D5X B;  1J7K A;  1XD7 A;  4L9N A;  5E20 A;  3M8F A;  5H6Q A;  5LGU A;  4UV8 A;  1FSH A;  3J7A O;  2F5D A;  5LBQ A;  5HDG A;  2A6H F;  4RGX A;  1XMK A;  2HYF A;  3VEP A;  4UVB A;  5LHG A;  4YFX F;  3RI4 A;  2DTR A;  3RYP A;  3RJP A;  4A0Z A;  4HF0 A;  4EJW A;  5LRS A;  2QLZ A;  2OA4 A;  1FYK A;  2ESN A;  1QQI A;  1FOK A;  4D0P A;  3E97 A;  3IWZ A;  1ULY A;  1LDK B;  5D5W B;  1IF1 A;  4IRI A;  3C1D A;  1P6R A;  5TJJ A;  1W7P D;  1XDU A;  3U1D A;  2DQL A;  3ZMZ A;  4MGR A;  3M9A A;  4LG0 B;  2GA2 A;  4LFU A;  5F6F A;  5HS7 A;  3LFK A;  2MD5 A;  2L4A A;  4EJO A;  4S05 A;  3E5X A;  4RAZ A;  3ECH A;  3BRO A;  3B02 A;  4JQF A;  1STZ A;  1L3L A;  5JI6 A;  2EWN A;  4PCQ A;  4CO8 A;  1XSV A;  4EMS A;  1EH8 A;  4I2O A;  2VT2 A;  2E7W A;  2P5V A;  5E18 F;  1R00 A;  4AWX B;  2F5C A;  2P6S A;  2FRH A;  4YFK F;  2PFB A;  3HSF A;  4A0X A;  3F22 A;  1YS7 A;  3HOT A;  1R36 A;  4I09 A;  4N9H A;  5LEK A;  4ESJ A;  1XMA A;  4WCG A;  4IHT A;  1ZLJ A;  3GLX A;  3FMR A;  3WU1 B;  2YU3 A;  3O3K A;  2V1U A;  2PI0 A;  3Q9V A;  2AXL A;  2KRF A;  4U0Y A;  5ICF A;  5HDN A;  5BOX A;  1FYM A;  1NHA A;  2CO5 A;  4Y13 A;  5F64 A;  3ZN0 A;  2QEN A;  4WX9 A;  2EV5 A;  2B0L A;  2IJL A;  2EB7 A;  3CUQ C;  3ML6 A;  5LGT A;  3V7S A;  2IRF G;  1FZP B;  5HDK A;  1ON2 A;  2FQ3 A;  3GFJ A;  2QVO A;  4OIQ F;  4G94 A;  5AIP A;  3I64 A;  5A2Q K;  2ELH A;  3WTS C;  3DKW A;  3RPU A;  4P55 A;  1F1Z A;  3I71 A;  3K1M A;  3ELK A;  1IN8 A;  3ZMT A;  2A61 A;  1K78 A;  2EFO A;  4ENK A;  4GCV A;  4BXU A;  1IXS B;  3G3Z A;  2MH2 A;  5LRR A;  3ABU A;  3MQ0 A;  3ISP A;  1OKR A;  3NEU A;  5BPI A;  4KFC A;  1LDD A;  3CO6 C;  4WXD A;  3JW4 A;  3DV8 A;  5K5R A;  2L4M A;  1C0W A;  1B1B A;  4I02 A;  3CDH A;  4WK8 F;  2IA2 A;  4G7O F;  1Z9C A;  2Z33 A;  1B6A A;  1WKM A;  3MEX A;  2MC3 A;  4ETS A;  5J6X A;  1QGP A;  3J81 Z;  5D8K B;  1SFU A;  1RUN A;  1OMI A;  4IF4 A;  4E70 A;  5DYM A;  4KIB A;  3CTA A;  4F7Z A;  4L0Z B;  5HS9 A;  1CF7 A;  2HTS A;  4EM1 A;  5IT9 Z;  2NNN A;  4M9X A;  2HKX A;  1YS6 A;  1Z05 A;  3F8C A;  2EFQ A;  4IXA A;  4ZYD A;  2A5Y B;  1SFE A;  2ZO4 A;  2MBF A;  2QBY A;  2W25 A;  4HX7 A;  4U7D A;  1BJA A;  3KEQ A;  4KN4 X;  5D5V B;  2XKO A;  2ISZ A;  1YG2 A;  3HSE A;  3IKT A;  3SZT A;  1U5T B;  2Y48 A;  3V7R A;  1BI3 A;  4GYG A;  2HEO A;  1T0F A;  1TTY A;  1FBQ A;  3F8B A;  5FLX K;  4UXN A;  4LLN A;  2K02 A;  1BBY A;  2RN7 A;  2PMU A;  2HWV A;  3P9K A;  2XRN A;  2P7V B;  4OMZ A;  5L3D A;  2COM A;  3E5Q A;  1QZZ A;  2DBB A;  2FOK A;  3WGI A;  1ZG1 A;  3N97 A;  3CUQ A;  2XAG A;  3HRT A;  1O57 A;  2FA5 A;  2H6C A;  3DF8 A;  2RVC A;  3KP3 A;  4MQ9 F;  4MEX F;  1F5T A;  2EV0 A;  2YR2 A;  1GHC A;  2FE3 A;  1BM9 A;  1FLI A;  3ZN1 A;  2XAJ A;  1FSE A;  4FX0 A;  2IW5 A;  4EGY A;  2O03 A;  1MJ9 A;  3RKW A;  5HLI A;  3FF5 A;  5JHU A;  4L9T A;  4ZH4 F;  2K7L A;  1XN7 A;  2G9W A;  4EM0 B;  1W7P B; 
#chains in the Genus database with same CATH topology
 3T8R A;  4LK1 F;  3UNG C;  2WC2 A;  2XRO A;  2R5Z B;  3EUH C;  3AL0 B;  2JVH A;  4I7H A;  4BYY A;  3C3W A;  1GV5 A;  1BJZ A;  4IZZ A;  1AKH B;  1UST A;  3COA C;  4NDL A;  2DN0 A;  2HKO A;  3BLY A;  4FCY A;  4DIQ A;  1YFH A;  3V8J A;  2ACJ A;  1CGP A;  3WU0 A;  2J5O A;  3K9T A;  5EZH A;  1XGM A;  4ZTF A;  2H27 A;  2Y69 H;  2V6C A;  3AAF A;  3LA3 A;  4NNJ A;  2OZ6 A;  2ZC2 A;  5D6F A;  1MKM A;  5IP6 A;  3QYE A;  2WV0 A;  4XK4 A;  3DTI A;  5JLX A;  2KDZ A;  1GLN A;  5ILV A;  4MNU A;  4R1H A;  2AHQ A;  3ZXS A;  4XSZ F;  2WAD A;  3B73 A;  5EYR A;  4F52 A;  2LF7 A;  4IL6 C;  4PSW A;  3NAR A;  1X58 A;  3HOU J;  2VQH A;  3H3Z A;  3OV8 A;  4LMY A;  3WTT C;  2E2I J;  5IOZ A;  4PFP A;  4ESB A;  4IX7 A;  5DCF A;  1WZ2 A;  1IXC A;  2KKO A;  2EIL H;  2ZNY A;  4RB3 C;  2CG4 A;  1R71 A;  2CW0 F;  4GDF A;  2TDX A;  3M8J A;  4WWC A;  2KQR A;  1PJR A;  2GM4 A;  2VUM J;  1CQT A;  3BTI A;  2PX9 A;  5F08 A;  4M6X A;  4JX5 A;  4M3B A;  4MQV A;  3I0T A;  3K7A J;  4CUG A;  2HVS A;  2O7O A;  5K7F A;  2XPV A;  4QPQ A;  4DBQ A;  3ZQH A;  2DK5 A;  2M45 A;  4LJZ F;  5GTH C;  2IEK A;  3K69 A;  3C2G A;  3K4M A;  3I4N J;  4C2M J;  3O2P E;  2KIF A;  4C2U A;  3FKI J;  4DYR A;  5HS8 A;  2ZJP F;  2NAZ A;  4G8X A;  1RET A;  2XF5 A;  2PBI A;  2XRL A;  4LD5 A;  6PAX A;  1IRF A;  3H1C A;  5FKK A;  2M7A A;  1VQN I;  3E3V A;  3JRD A;  4CCM A;  2JMW A;  1Q1V A;  3KZY A;  4HNU A;  3L2R A;  5TGT A;  3MWM A;  2XC7 A;  5L3B A;  3GTK J;  2OQG A;  3H0D A;  1JKO C;  4I0B A;  1WSU A;  3LSJ A;  1K7A A;  2DMU A;  2OU2 A;  2KHM A;  4FHT A;  2PMZ N;  5LD2 C;  2WTE A;  3CLQ A;  3LQR A;  1I27 A;  3WGH A;  2HQ5 A;  3L2V A;  2NS8 A;  2O6G E;  1Y8R B;  4CA0 A;  4B3X A;  1U5T C;  1DU6 A;  1E3O C;  3ASO H;  3BQY A;  4BGD A;  4IHV A;  3KP4 A;  2QKM B;  5JLW A;  1U8B A;  1DU0 A;  2GOX B;  3QRF F;  2X6W A;  2L54 A;  5FGM A;  3GTG J;  1OCR H;  2XB0 X;  3C2B A;  2VLA A;  2XAH A;  3MMY B;  3KP6 A;  4EEF G;  2R0Q C;  2XGC A;  2DK8 A;  3OYG A;  3OOU A;  1OR7 A;  2KT0 A;  2LF8 A;  1BIA A;  4A5M A;  1YIO A;  5HNF A;  1XC5 A;  4XBF A;  1UG0 A;  2R7F A;  5GAD J;  4FX4 A;  3KET A;  3LSI A;  2V1D A;  4II3 A;  4NB5 A;  3DU6 A;  4G7Z F;  1WJB A;  2LNB A;  1YJN I;  1W5T A;  4YG2 F;  1FMV A;  2I5U A;  2IP2 A;  2AO9 A;  1SVM A;  1YLF A;  3JAM Z;  3ZQ7 A;  4HQE A;  5JHF A;  2BVM A;  2VC0 A;  2DFE A;  4BQA A;  4XOT A;  1IRG A;  4A3I J;  3RTR A;  3ZRG A;  3AG2 H;  3IRR A;  1YO5 C;  3S1M J;  4E6K G;  1GVD A;  1XCB A;  2XPU A;  1JE8 A;  2EFP A;  2ICW G;  5EGO A;  1ZAO A;  1X2M A;  3HGG A;  3MN2 A;  2ELK A;  1X1B A;  5E1W A;  3FXU A;  3GO5 A;  4MTE A;  4B1R A;  4X0G A;  3J7A Y;  5KHD A;  5ICE A;  2X1E A;  3GFM A;  2IGM A;  4Q48 A;  4S0H B;  2HI3 A;  3LA7 A;  3EPZ A;  5DV5 A;  5CVV A;  2STT A;  2OUM A;  1FPQ A;  1G4D A;  4M73 A;  2GXB A;  4OMY A;  4M6Y A;  4A3F J;  2XIG A;  1A31 A;  1ZG5 A;  4KDP A;  4GRI A;  3V4G A;  1VQK I;  2F48 A;  3DPT A;  4BE1 A;  1U2W A;  3PUF A;  5KK1 A;  1F36 A;  4PGH A;  2JSC A;  4MFE A;  3BG6 A;  4LB6 B;  2A5W A;  3EDP A;  2LYC A;  2LY2 A;  1EKE A;  5ERI A;  2DPU A;  2JA2 A;  3FXK A;  3QPL A;  1MIJ A;  4GYI A;  1T39 A;  3IRQ A;  1R5H A;  4B8X A;  1MBJ A;  1WI3 A;  2D2W A;  2ADU A;  1MDM B;  3BR5 A;  2JRM A;  1WPK A;  3BJ6 A;  2D1V A;  3OIO A;  3CCQ I;  3HTU A;  3F6V A;  4AYB A;  2QZ8 A;  5BQT A;  2R7S A;  4U0W A;  2RKH A;  3LQQ A;  1MW7 A;  3IH3 A;  4CCN A;  3ZQF A;  1TNT A;  2FBK A;  2JTV A;  1R5G A;  3GBG A;  1B59 A;  2Q2E A;  3QAH A;  2HDW A;  1QBJ A;  2E1M B;  1JT0 A;  4Y15 A;  2BXZ A;  3B6A A;  4GGG A;  4XKC A;  3VYT B;  1FBS A;  9ANT A;  3DTK A;  5CVU A;  3TGN A;  3ABT A;  1ZQ3 P;  4XMY A;  1TC3 C;  1IUY A;  4BJ5 C;  4UUS A;  1V3F A;  1BI1 A;  2VC1 A;  2DOE A;  1HKQ A;  4XOR A;  5M5W J;  3CO7 C;  5JR3 A;  5E3L A;  2VQG A;  1Y56 A;  1GXQ A;  3CP8 A;  4ZTJ A;  1I3Q J;  4D7M A;  2CQQ A;  2EFN A;  3FXM A;  3VYU B;  4A12 A;  4E7K A;  3KP5 A;  2W82 A;  5FFX A;  4O3M A;  1FBU A;  2QKL B;  3L9F A;  2DFH A;  2AS5 F;  5HVQ C;  2GQQ A;  2LMD A;  4IHW A;  1LVK A;  3R61 A;  1X1P A;  4NQW A;  3IAM 2;  3KEY A;  5FFZ A;  2V4J C;  3NWT A;  1XG1 A;  2VT3 A;  3VYR B;  4AVP A;  3S8P A;  4BAC A;  3S32 A;  3J7Z I;  3ZMV A;  2OAZ A;  4M9Z A;  1OLT A;  2J5P A;  2KIS A;  3A0H C;  1KYZ A;  2LBF A;  2RV8 A;  2V9P A;  3BG3 A;  2HR3 A;  5EEG A;  1G59 A;  3DCF A;  4QSH A;  2P7C B;  1TT0 A;  3HTS B;  2ME6 A;  4P9U A;  2VPL A;  3HHG A;  4YEL A;  2WB1 N;  5DEQ A;  1JUS A;  2XGD A;  3JCU C;  1IN7 A;  4RB0 A;  3KCC A;  2Q8K A;  3CC4 I;  4IHX A;  1U78 A;  3G6E I;  1HBX G;  2MGQ A;  1Z7U A;  4ZDO A;  3A1Y A;  4M3G A;  4RAY A;  3HYI A;  1BIB A;  1O3Q A;  2VB6 A;  1YIT I;  4HQM A;  1K4T A;  2VKE A;  1BC8 C;  1D1B A;  3RDI A;  5AON A;  3CCM I;  1HXD A;  3KFW X;  1FOX A;  3DBL B;  4MLO A;  2TRT A;  4JK1 X;  5JFR A;  2CV0 A;  4HOB A;  5DD8 A;  1FTZ A;  2Z5U A;  4KA4 A;  3WTW C;  4BEH B;  1FC3 A;  3ERE D;  4CCK A;  1Z6R A;  3LST A;  1V4R A;  4AIJ A;  3D5S C;  3GTP J;  2KL4 A;  1ZRC A;  1TQP A;  4EJT A;  4KT6 A;  1FOW A;  4ZJZ A;  2Z1D A;  1B9N A;  5E3M A;  3NWS A;  1QNT A;  4WF2 A;  2Y30 A;  4IRG A;  4V2F A;  4XR6 A;  3KEO A;  3VWB A;  2KRC A;  3DXJ F;  4AIH A;  2UXX A;  2OBP A;  1J5Y A;  3BPV A;  3WTZ A;  4DJA A;  3JRF A;  1ONV A;  2P5K A;  1YJ9 I;  4MHG A;  2BY0 A;  1DUX C;  2L7Z A;  2V79 A;  5FB2 A;  2VJI A;  2DA4 A;  3CF5 F;  1IGN A;  1B8I B;  1XSX A;  3SXY A;  1IW7 F;  2L9R A;  3ZQL A;  1ZGJ A;  3HRS A;  3WTX C;  2DMQ A;  4OIN F;  2BW3 A;  2XSJ C;  4HDV A;  1Z6T A;  4IKF A;  2CW7 A;  2NOG A;  2L7F P;  2W1O A;  2HDC A;  1W0T A;  3GFL A;  3D5L A;  4FE4 A;  2STW A;  3CQZ J;  3K6G A;  4DQ2 A;  1U6G A;  3HEF A;  2A6E F;  2EIN H;  3DKX A;  4R79 A;  4CZZ A;  2VE8 A;  5DUI A;  5J8C A;  5H20 A;  2E19 A;  2BV6 A;  1LE8 B;  1W7P A;  1WI9 A;  2ZFW A;  1OFC X;  2R5Z A;  2O61 A;  1VTN C;  1JUM A;  1K6Y A;  1IRZ A;  2GOM A;  3HZJ A;  1E3H A;  2XDV A;  3SZP A;  5M5Y J;  1ETW A;  4QIW N;  1QZE A;  1OCP A;  2ECC A;  3FM3 A;  3U21 A;  2LKX A;  2M7B A;  4C3I J;  1OCO H;  2VIX A;  1NK2 P;  4E7S A;  2K9N A;  3GWZ A;  4LIV A;  4EVI A;  1IN6 A;  3OYL A;  4L5J A;  4IJA A;  1HW5 A;  2QYO A;  2O0Y A;  3B6C A;  3HM5 A;  2EZL A;  2M4G A;  3KYD B;  3ZP5 A;  2CUF A;  3FHZ A;  2GBY A;  1D5Y A;  2B9S A;  3QWL A;  2DA7 A;  2MH9 A;  4RAG A;  3T8T A;  3JRA A;  1DP3 A;  3L2C A;  2JSP A;  2V26 A;  4FQG A;  3HRU A;  2QQ9 A;  4N9I A;  4CCO A;  2D45 A;  3SEZ A;  2HPI A;  1ZRF A;  1B4A A;  2H09 A;  2ZME B;  3PUB A;  1I50 J;  1KQ9 A;  3WG9 A;  1WJC A;  3V42 A;  2C6Y A;  2XHK A;  2CQ7 A;  4Y33 A;  4HX4 A;  1G8X A;  4C3H J;  2FML A;  2GXG A;  2HQN A;  3WG7 H;  3S2D J;  3J80 Z;  2F5F A;  4CYC A;  4BHC A;  1RIO H;  3PFI A;  2KJB A;  4CZC A;  1O7F A;  2L0K A;  3HL2 A;  2MA3 A;  4KT5 C;  1Z91 A;  2X9D A;  3A03 A;  5FD5 A;  2PLY A;  3S1N J;  1FNN A;  1R1T A;  5K5O A;  1DGW Y;  2ESH A;  3MFK A;  3FKJ A;  5J8F A;  3WE2 A;  2DT6 A;  5B5E C;  1PUE E;  3VOE A;  5M3F J;  2JPB A;  1YTY A;  3OSF A;  2JN6 A;  1SAU A;  2HPM A;  4RMN A;  2E1N A;  1B72 A;  4RGR A;  5KCM A;  2H8R A;  1UZC A;  2ID6 A;  1XCV A;  4KIC A;  4D5C A;  3IHU A;  2PN6 A;  1YIJ I;  5BPD A;  2RGV A;  2L02 A;  5CYV A;  3Q9S A;  4XLN F;  4RB2 C;  5GPC A;  3FXO A;  4A3B J;  5L3E A;  1D0X A;  1FX7 A;  4WXC A;  2DLL A;  4ZZD A;  2GA1 A;  4P9F A;  3CLO A;  4OU0 A;  1J2X A;  5J4Y A;  4XN3 A;  1AA7 A;  1S7A A;  2VKD A;  2QGU A;  2GIZ A;  2ZXH A;  3FIS A;  3H5R A;  3IH2 A;  5LHI A;  3GTQ J;  1Y1V J;  3KP7 A;  2VJ4 A;  1XB4 A;  2JRT A;  4XRF A;  1SD5 A;  5E8G A;  2B63 J;  1KGS A;  5D4S A;  3QPS A;  2HZD A;  1OJL A;  1UFM A;  4ON0 A;  2XSD C;  1HQC A;  5KNL A;  5ILS A;  3CC7 I;  2BZT A;  5EEA A;  2RC4 A;  1J09 A;  1OIS A;  3IAS 2;  4BHP A;  3RKY A;  5IOY A;  2HYG D;  3OYB A;  1SAX A;  4P1W A;  5E3O A;  3T5X A;  3G1L A;  3VSL A;  3OS2 A;  2XKP A;  4D7N A;  4LK0 F;  3I59 A;  2B7E A;  5GPA A;  1WJD A;  1T98 A;  1S9H A;  2R7D A;  2P81 A;  3CJR B;  3JRI A;  1VQP I;  1FT9 A;  3SYT A;  4ZYG A;  3H35 A;  2E1C A;  1FP2 A;  1I6H J;  2ZXJ A;  1BN5 A;  1HOM A;  5D6E A;  2VJ5 A;  1NH3 A;  2OD5 A;  1ETV A;  1Z7L A;  3D0S A;  3HC7 A;  4CXF A;  2CWE A;  4GXO A;  3TW7 A;  5F0H A;  5B66 C;  4DYQ A;  4U87 A;  1H9G A;  4IQJ A;  4JX4 A;  5CQG A;  1PDN C;  4BNC A;  2NVY J;  3AG4 H;  3RKX A;  3LSG A;  4B43 A;  3GTO J;  1HKS A;  3OYH A;  3SDG A;  2X6Y A;  2BE5 F;  1EV7 A;  1KYW A;  2OF7 A;  3ZQG A;  4Y7N J;  3CCR I;  2PQ8 A;  1MMA A;  2DOD A;  2F2E A;  1QO0 D;  3ERM A;  2W4S A;  3GUD A;  1ZN2 A;  5CJ9 A;  2L9S A;  4BQN A;  3OMY A;  5B1B H;  1OCT C;  2K9Q A;  2R7Q A;  1ZYR F;  1H0M A;  2M0C A;  2RDP A;  2M8G X;  4UB8 C;  3HOS A;  2NNY A;  3HXL A;  5FLV A;  1KU3 A;  1UJ8 A;  1TW3 A;  2L5Q A;  4DGW B;  2LY9 A;  1I6X A;  2XAQ A;  1S3J A;  4RS8 A;  3QOP A;  1XPX A;  2CSO A;  1X3U A;  1VQ6 I;  2ZJR F;  4A6E A;  2HOA A;  3FZV A;  4XRS G;  1K6O A;  2TCT A;  1MDM A;  5LGN A;  4C30 A;  1G6N A;  2E71 A;  1HDP A;  2G7H A;  4HSR A;  3PL8 A;  5F04 A;  2HXO A;  2K4J A;  2LK2 A;  4D9J A;  4J19 A;  3LAP A;  2A3S A;  5CVR A;  2K85 A;  4YII A;  4KMF A;  4AUX A;  1YYV A;  3QP6 A;  2PJR B;  4FT8 A;  2FMY A;  1MMS A;  1ZAR A;  2K4B A;  2EZI A;  3P7N A;  2VAS A;  3LSP A;  3GTM J;  1KQ0 A;  3QYF A;  3M1E A;  2FBH A;  2HS5 A;  2JUC A;  3BTC A;  3QU6 A;  1MND A;  5ED4 A;  2H6B A;  1XGS A;  3K0L A;  3I56 I;  4E7J A;  3G73 A;  2QSH X;  1DGR M;  2ZME C;  4BHB A;  1FY7 A;  3GVA A;  1WFX A;  3A01 B;  3WTU C;  4CGZ A;  3ZMU A;  3H36 A;  5DUK A;  3OYC A;  4A3L J;  2BY1 A;  4HA8 A;  1R7J A;  1YX5 A;  5EZG A;  3DEU A;  4XLF A;  4AYB N;  4YIF A;  1XTA A;  4S04 A;  3Q5F A;  1YRN B;  1RPW A;  1VQM I;  1ORK A;  3F8N A;  1IV8 A;  2F4M B;  2FXA A;  3ABM H;  2IA1 A;  1FYL A;  1U9N A;  3W6J B;  4B3A A;  2VBY A;  2CU7 A;  4LG0 A;  3OYF A;  1IG7 A;  2CFX A;  3F72 A;  3V8K A;  5B3S H;  5K1Y A;  3GX4 X;  5DCM B;  5BS6 A;  1QVT A;  1ZRD A;  1GUU A;  3DPU A;  1PP7 U;  3I58 A;  4ZYE A;  5FKN A;  3BDD A;  1QRY A;  1QZY A;  3PFY A;  1TWF J;  5DS9 A;  1BC7 C;  4XRM A;  1JKP C;  1RNL A;  1X3W B;  3AFH A;  3E6D A;  1LEB A;  5DM7 F;  2ZSI B;  1RZ4 A;  2KRH A;  2Y0S A;  3FBN B;  3TOB A;  1TWA J;  2E2H J;  3EQL F;  5HNH A;  4DW6 A;  5KAF C;  3TOA A;  2A68 F;  5IYB J;  3R60 A;  2DAO A;  2EK5 A;  4ANJ A;  2K5C A;  4OAY A;  2K9S A;  2KZV A;  4NC7 A;  2G7U A;  2K86 A;  2L9V A;  4Y17 A;  1TZL A;  2A07 F;  2YX4 A;  1MBF A;  4UY8 I;  2N8G A;  1W0U A;  3WOD F;  3ZOB A;  2WBM A;  3F0C A;  3EET A;  4JBA A;  3LSM A;  3M7G A;  3REO A;  1KZH A;  2WY7 Q;  2CUJ A;  3M1C A;  2D1H A;  2UUZ A;  4BJT A;  2IA0 A;  2VPR A;  2MD0 A;  2JA6 J;  2LFB A;  2QSG X;  3O6B B;  1N75 A;  3HUG A;  1X2N A;  3NRV A;  1WQ2 A;  3GFI A;  2VXZ A;  3JRG A;  4IEJ A;  1YOV B;  1ZKG A;  5L3F A;  1N25 A;  3QP5 A;  3T1B A;  4X1E A;  1HW2 A;  2VON A;  1BOB A;  4PDK A;  4HW0 A;  4UHT A;  2VKH A;  3M4O J;  1W5C C;  2AXT C;  3ONQ A;  1A35 A;  4BXF A;  4UVA A;  3BJA A;  3TW6 A;  4L9J A;  1B8I A;  4P96 A;  4G12 A;  4M72 A;  5HOO A;  4LLL A;  5ICC A;  5CVJ A;  2BXY A;  2HVQ A;  2H1L A;  5CQE A;  4IVN A;  2X1C A;  2ISY A;  5LFA A;  3TO6 A;  2CQN A;  3L00 A;  1SMT A;  5A2Q Z;  1E0E A;  3H3V K;  1QHH D;  1CF7 B;  1S7E A;  1HF0 A;  1TQM A;  2VOD A;  1X1D A;  2HFH A;  2Y31 A;  3S2W A;  1RUO A;  1LEA A;  4BU2 A;  4AD9 A;  3K1P A;  3ABL H;  1MBH A;  3TP0 A;  2QBY B;  1BW6 A;  3MKW B;  1LKX A;  2XGE A;  3ASN H;  5J40 A;  4E4H A;  1IV6 A;  2VE9 A;  1ON1 A;  4E7H A;  3OYI A;  1OPC A;  1W5S A;  1HC8 A;  3H3U A;  4A0Y A;  4PFO A;  2QQA A;  2W7N A;  1GXP A;  1PYV A;  5J1Y A;  3J81 K;  1MMG A;  3E7L A;  5BNG A;  2X48 A;  1W4M A;  2XAF A;  1IDZ A;  3G1O A;  2EQR A;  3Q3S A;  4E7I A;  1D5V A;  3E5U A;  4A5N A;  5IP9 J;  4MO7 A;  3RYR A;  1LDJ A;  2PG4 A;  3VOD A;  3H9G A;  3EUH A;  3KZI C;  2BGC A;  2NVU B;  3S17 J;  1TNS A;  2DMP A;  2JA8 J;  2L3D A;  5FKM A;  1JHF A;  3BG5 A;  3JRE A;  2R7W A;  1SD7 A;  1MBE A;  4HX8 A;  4ITV A;  5L3C A;  5HLG A;  5IT9 K;  5CKT A;  1G3Y A;  2EA2 A;  4EM2 A;  1RR7 A;  2KZG A;  3HSR A;  3TQN A;  2HZT A;  4MTD A;  3OYJ A;  3PJR A;  3ZQC A;  4Z2Y A;  2ZME A;  1OYI A;  2DU9 A;  1Z77 A;  4B48 A;  5ILU A;  2A6T A;  1HW1 A;  1UAA A;  3V7C A;  1SVO A;  4RDU A;  2JA7 J;  1G3W A;  3FMS A;  2KLO A;  3IH4 A;  1V5E A;  2OQR A;  3CCS I;  4KIT B;  2F6C A;  1WGX A;  2X1D A;  2ZBK A;  1RES A;  3P9I A;  2V1X A;  4L5E A;  1WHU A;  2M8E A;  2LDU A;  3A4C A;  3CUO A;  4I76 A;  4KYW A;  1E17 A;  1B9M A;  1ZGA A;  1S8N A;  3JTH A;  2JT1 A;  2W57 A;  2X51 A;  2R5Y B;  4HV5 A;  1R49 A;  3F6O A;  1U8R A;  3ZMS A;  2EJR A;  3G4S I;  4KIS A;  2X4H A;  4HBL A;  2XGX A;  1TWC J;  2L7M P;  2ZCW A;  3HRM A;  5JVT A;  3CC2 I;  3LFU A;  2DA5 A;  4IOA F;  4KJZ A;  4L5I A;  2OCC H;  4HF2 A;  2M34 A;  1TLH B;  1L0O C;  4XQF A;  3JSO A;  1IN4 A;  1VZ0 A;  3HIF A;  5F1R A;  2P6T A;  2ECB A;  3KYL A;  4FET A;  4HAM A;  3WU2 C;  3I4P A;  2LY1 A;  1ENH A;  2M5W A;  2VOP A;  3QPT A;  3JRB A;  5E1Z B;  2DOF A;  4JOM A;  2UXN A;  2CV1 A;  2O3F A;  2E1O A;  3SQN A;  5DTD A;  4DZP A;  4A3J J;  3BC8 A;  4LGW A;  3OS0 A;  1TQI A;  3OYM A;  1T38 A;  5J1U A;  1IZ1 A;  3V8L A;  2Y0M A;  4IRH A;  3A02 A;  4OOI A;  5LLQ A;  3L1P A;  2YSR A;  1MJB A;  5KVR A;  2XB5 A;  1DPR A;  1O3T A;  1ZLK A;  3M8E A;  1ZR2 A;  1WJF A;  5IPA A;  1EH7 A;  2DCE A;  2CFO A;  2KIM A;  2WAE A;  3VSK A;  2A69 F;  3I53 A;  3TMO A;  1NG7 A;  3D1N I;  2E34 A;  3CP2 A;  3O8G A;  2AQE A;  2DFI A;  3HOZ J;  4FE7 A;  4A2U A;  2O5R A;  5FLX Z;  2VJJ A;  4BY7 J;  1USS A;  1R23 A;  1IC8 A;  1K79 A;  3R4K A;  3HG9 A;  2QCO A;  4HZF A;  2FSW A;  2M1B A;  3NQO A;  1K4S A;  2BVL A;  2BY3 A;  2WAF A;  2O9L A;  4PGG A;  4BAY A;  2HTJ A;  4I0A A;  3RCO A;  4YFN F;  2ID3 A;  1KA8 A;  2XPW A;  1LB2 A;  3FXQ A;  2IT0 A;  5FRM A;  1A36 A;  4A3C J;  3W6K B;  1XGN A;  2VBX A;  1P2F A;  3FMQ A;  1LVA A;  3N05 A;  3OIP A;  1Q1H A;  5D4R A;  3FWE A;  2Y75 A;  1U5T A;  3OSG A;  3DPL C;  4FTH A;  4LLG F;  5FKO A;  4HPQ A;  1UHM A;  4WXH A;  2WY8 Q;  2NVT J;  3DBH B;  3FHN A;  4CCL A;  4U7B A;  1HDD C;  4GFB A;  3BPX A;  4EQQ A;  3F21 A;  1T95 A;  1IRX A;  2IVM A;  1XMX A;  1KQ8 A;  3ZMD A;  3L2U A;  3RPU D;  4ZDP A;  2K9M A;  2COB A;  2VOO A;  4OIR F;  4B4C A;  3G1M A;  5TIS C;  5EG0 B;  3S2H J;  4G6T B;  4PJM A;  4ENJ A;  5H2F C;  1I5Z A;  3QPH A;  4GO1 A;  1PUF A;  2IAI A;  1UHW A;  5FRO A;  4KN7 X;  1QU3 A;  4DBR A;  2M30 A;  1U3E M;  2OPT A;  1R1U A;  1UB9 A;  2IS2 A;  2LD5 A;  3H9J A;  3BJO A;  2Y9Z A;  3VPR A;  4F92 B;  1IXR C;  1IJW C;  1I1G A;  1REP C;  1WCM J;  1Z21 A;  4LG3 A;  1IAW A;  2FNP A;  3G2B A;  2GZW A;  4A3G J;  2RRE A;  2OZU A;  2VBW A;  2BBY A;  3IV5 A;  2WAQ A;  3ECO A;  1T6S A;  2KPM A;  1TP4 A;  3I54 A;  4CSW A;  3A2K A;  2IS4 A;  3K2A A;  4NBQ A;  4BDZ A;  3CCJ I;  1G2H A;  2F5V A;  1ETY A;  3CDI A;  1UMQ A;  2Z3Y A;  1JJ8 C;  3LAJ A;  4BBR J;  3LSR A;  2ZNZ A;  3SDB A;  3SHF A;  4N4N B;  2Z2S B;  5GAG J;  5HLT A;  4C3J J;  2M3A A;  2X6O A;  2L7K A;  1T0F C;  3WGG A;  1MJA A;  5C4X J;  1VQ9 I;  3M07 A;  3HGY A;  1TBX A;  1AKH A;  1I39 A;  2MSY A;  2K27 A;  2QQB A;  3BY6 A;  2L9N A;  4JYK A;  4OWR B;  5GTI C;  2EFW A;  2FD5 A;  4A3M J;  3BP8 A;  3FX3 A;  3GXO A;  2R4G A;  4A69 C;  1HCR A;  4ZYH A;  3N4M A;  4W1U A;  1J59 A;  2KIQ A;  3K1N A;  2HYJ A;  5D8L B;  1TW2 A;  2VXD A;  4L0Y B;  1Y1W J;  5E79 C;  2W00 A;  3X2Q H;  1ZRE A;  1ETQ A;  2RQP A;  2ZJQ F;  3CMA I;  3BWG A;  1D8J A;  1JHH A;  3GZ6 A;  1BI0 A;  3EUK L;  2VN2 A;  1ITY A;  2DYR H;  1YW8 A;  5DDG A;  1RI7 A;  2CS3 A;  1WWX A;  1H9T A;  2RQQ A;  4EV0 A;  1ODD A;  2JVG A;  1DDN A;  1BA5 A;  4QLC U;  1ACI A;  3W2A A;  2OTJ I;  4XM3 A;  5L3G A;  1JGS A;  1R58 A;  4CHU A;  1UEL B;  5J4V A;  4ESF A;  1JKR C;  1R22 A;  2EH3 A;  4BQQ A;  5DCM A;  3TO7 A;  4HLX A;  4DZJ A;  2WV1 A;  1R1V A;  3LA2 A;  3TDU C;  4JX6 A;  2EV6 A;  3J7Y J;  3U2R A;  3HKZ A;  4DOZ A;  2DJN A;  1VF9 A;  5HOD A;  1ETO A;  4BBS J;  2PMH A;  2ZFU A;  4I01 A;  1I1S A;  3BQZ A;  4N0B A;  2XF6 A;  2I10 A;  4EJU A;  1WJ5 A;  2P0W A;  1MSE C;  3MKZ A;  2EA4 A;  3BOQ A;  4UUT A;  1GVJ A;  3JAM K;  4A3E J;  3BT9 A;  1LPQ A;  4M74 A;  3TBI A;  3DKY A;  4R8H A;  3H5A A;  1SAN A;  5F1J A;  4RM3 A;  1E3P A;  1K61 A;  1YE9 A;  1LJ9 A;  1T8I A;  1QA6 A;  1LUJ B;  4ZYA A;  1X4P A;  3GCM A;  1JUP A;  2VQC A;  3AKZ A;  3LNQ A;  1A04 A;  1KU2 A;  4PZJ A;  3ABK H;  3W2V A;  1P7I A;  3DEE A;  1J75 A;  3F8F A;  3CCY A;  1ETK A;  3OY9 A;  1FJL A;  4BUP A;  2ETH A;  2DPD A;  2A05 A;  3K70 C;  2Y0S N;  2WWY A;  2DDB A;  5JVG F;  4HRI A;  3Q0V A;  4HNV A;  1HSJ A;  3H0G J;  1SMY F;  3F8M A;  1FP1 D;  4L9V A;  1KU7 A;  2YU9 J;  5FD6 A;  2Z9O A;  3KLN A;  4H0E A;  3KLO A;  4UUV A;  3G71 I;  2GAU A;  2LR8 A;  1TT5 B;  3Q0U A;  3BZ6 A;  2LOO A;  1O3R A;  4KNY A;  2R7V A;  5LHH A;  2YPR A;  2XVC A;  3IWF A;  2F5E A;  1MNE A;  2R7U A;  1R9T J;  2IGK A;  3PSI A;  4UV9 A;  3FM5 A;  3MCZ A;  2HGC A;  3IKV A;  4M9S A;  4P5O A;  2CQK A;  2P8T A;  2LVS A;  3I3L A;  3P9C A;  4NQW B;  2JQ7 A;  3E6M A;  1Z1D A;  3BR0 A;  2UV1 A;  2FX0 A;  3FK7 A;  4RA2 A;  4DNC A;  4Z6Y A;  4ASN A;  1H88 C;  4E7L A;  5IY5 H;  3E6B A;  4ZZL A;  3HOY J;  1YQA A;  2LBF B;  2HOT A;  4HF1 A;  1P9Q C;  2BHY A;  2NS0 A;  3U9G A;  4LB5 A;  1OYY A;  5F27 A;  2ZKZ A;  3GEZ A;  3PM1 A;  3TO9 A;  5LEJ A;  1WH7 A;  3BCA A;  2RAE A;  2X6X A;  3FXJ A;  5H6R A;  3K70 D;  3TKY A;  1JTX A;  1J0R A;  1ZHF A;  4XRS A;  2Q1Z B;  3S93 A;  2GIV A;  4QTR A;  2EZH A;  1AOY A;  1LNW A;  1T56 A;  2YS9 A;  3MZY A;  4ENM A;  4PJL A;  4HDU A;  2VL8 A;  2FNA A;  4D5F A;  2IGN A;  2W48 A;  5GAH J;  1EH6 A;  2ZJ2 A;  4U88 A;  3EYI A;  3GW2 A;  1R5I D;  3WTV C;  4CIC A;  3QOE A;  1N78 A;  2E5Z A;  2R7X A;  4UVC A;  1AWC A;  3K4K A;  3KE2 A;  3L7W A;  4BQO A;  2DO7 A;  2HQA A;  2DT5 A;  3CME I;  2ME0 A;  4HLY A;  1FOY A;  2RNJ A;  4I98 B;  2FJ1 A;  1EA3 A;  3HB9 A;  3TED A;  1JGG A;  2NVQ J;  2MLK A;  2R7Z J;  2H1K A;  2Q0O A;  2QWW A;  2LSO A;  3MKL A;  3PO2 J;  3MKY B;  1VQ8 I;  1NG6 A;  2BY2 A;  1S72 I;  3R0J A;  4AIK A;  1FWZ A;  5CVI A;  1VQL I;  4G6D A;  2VBZ A;  1OCC H;  2R5Y A;  2QM3 A;  4EGZ A;  1LQ1 A;  4AM3 A;  1GV2 A;  4IPA A;  3F3X A;  3K4J A;  3AG3 H;  1OR7 C;  4M71 A;  3RPQ A;  5B1A H;  3VB2 A;  3C7J A;  1YHQ I;  4UNO A;  1D8K A;  1VQ7 I;  2MFZ A;  4AC0 A;  3BG7 A;  1ZG3 A;  3S14 J;  2M9H A;  3A0B C;  3OL4 A;  4B47 A;  3IC7 A;  2IPQ X;  3OOP A;  3U1K A;  3E1S A;  2PEX A;  3EUA A;  4F91 B;  1XX5 A;  3LSH A;  3EYY A;  2X0L A;  2YX7 A;  4LIT A;  3TDZ C;  2O8X A;  3QQA A;  3WTY C;  2OTL I;  5F0C A;  2JK3 A;  3JSP A;  2VI6 A;  5TRD A;  4BS9 A;  3LSK A;  1I3A A;  4C9Y A;  1FEX A;  4AID A;  3R6S A;  2FF4 A;  2Z99 A;  5KAI C;  5EJC A;  3ROU A;  3M3Y J;  4KMU X;  3OL3 A;  5E17 F;  1DPU A;  1VI0 A;  4CDG A;  3CJQ B;  1O7L A;  5GP9 A;  4Q47 A;  2LKP A;  3SFZ A;  1JXS A;  1SVL A;  3S3M A;  4JP0 A;  1F9N A;  2KJC A;  2L01 A;  4RGS A;  3TP3 A;  1E2X A;  3JRC A;  5IYD J;  3CCE I;  3C18 A;  4XOP A;  5CPR B;  5IYC J;  3AG1 H;  3PQJ A;  3C2H A;  3BR1 A;  3W6V A;  3H92 A;  3DTE A;  2ZSH B;  3OYK A;  2DW4 A;  4IOC F;  4CYD A;  1FIP A;  2BYV E;  3PIP F;  4A6D A;  3ZCO A;  1S7O A;  4PJ0 C;  2UZK A;  2DDA A;  3DBR B;  1OYW A;  4O6J A;  1W1W E;  5EDN A;  1R4N B;  2BHZ A;  2V9K A;  4KIF A;  3QU3 A;  2BEO A;  1BOA A;  1K78 B;  4NC8 A;  2K3F A;  4HV6 A;  1U0J A;  3DFG A;  2P5L C;  4G7H F;  3BTJ A;  4HEA 2;  3UR3 C;  3R0A A;  5HLH A;  2R93 J;  1SD6 A;  1KU9 A;  3ULQ B;  1ZR4 A;  4XLP F;  4CYC B;  5E1X A;  5J3L A;  1IDY A;  2FU4 A;  4I99 C;  3S3N A;  1F4K A;  4OIP F;  3DP7 A;  1D0Z A;  2HOE A;  4XN0 A;  4E7Z A;  3IL2 A;  4OIO F;  2W84 A;  2NOJ B;  4RLQ A;  3WE3 A;  2WA0 A;  4RLF A;  2QSF X;  4W97 A;  4BY1 J;  1P92 A;  4Q4Z F;  2FUG 2;  3UKG A;  1AHD P;  5BMZ A;  4BEH A;  3BZK A;  5IT3 A;  5EG0 A;  2LLK A;  3L09 A;  2E7X A;  1LFU P;  2UWM A;  4XNF A;  3HOW J;  2KIU A;  3E6C C;  1BI2 A;  1S29 A;  3GZ5 A;  3I4M J;  1B72 B;  2HQR A;  3CJN A;  4G9Y A;  3FXR A;  1RKW A;  3O8H A;  3BR2 A;  4XLH A;  2Y2Z A;  2M2E A;  1HST A;  4NHJ A;  3BG9 A;  3HHH A;  4O5V A;  5K5Q A;  1QPM A;  2FQ4 A;  3J80 K;  3I55 I;  4M6V A;  1Y0U A;  2YUS A;  1SFX A;  2OC6 A;  2NYX A;  4FAS D;  1S6L A;  3K2Z A;  3GLL A;  1G3S A;  2EIM H;  3CF2 A;  3KP2 A;  2DQR A;  2M87 A;  1X3Z B;  1T2K A;  2CGP A;  1SEU A;  5J1R A;  2JZY A;  4K2E A;  4U0V A;  4XSX F;  2KDO A;  4XKB A;  2CUE A;  4PSX A;  5FO5 A;  3S15 J;  2HOS A;  4HYE A;  2FBI A;  4Y3O A;  5EEH A;  3CCL I;  3MZ8 A;  2QA4 I;  3DQV C;  1LE8 A;  3FK6 A;  2FEZ A;  4BH9 A;  3WHB A;  1YX3 A;  3PIO F;  4DYC A;  3VFZ A;  1HA8 A;  5CLS A;  4YRV A;  1W36 C;  2LTP A;  4EJV A;  4L18 B;  3D5R C;  1MD0 A;  3KYC B;  1P4A A;  2XUB A;  4Q5S F;  4IHY A;  3CDL A;  2EBI A;  4KUM A;  4B09 A;  4IQ4 A;  2CMP A;  3RIR A;  2DA2 A;  1NTC A;  2NRA C;  3FBI B;  1PP8 F;  3F23 A;  3I59 B;  3ZQQ A;  2WAQ N;  1J9I A;  1BW5 A;  1X1C A;  1SD4 A;  4RM2 A;  3S1Q J;  2HU9 A;  2QUF A;  4RB1 A;  2E2J J;  3RSN A;  2DI3 A;  3OIQ A;  1VQ4 I;  2CYY A;  5C4J J;  3MAJ A;  5D5U B;  3MZH A;  4XON A;  2R92 J;  2H94 A;  2R3S A;  3KX2 A;  1YW7 A;  1WRJ A;  1ZH5 A;  4NUB A;  1T33 A;  4B44 A;  1MGT A;  1UCR A;  2JPC A;  3S3O A;  1FIA A;  5E8I A;  2DTZ A;  2XAS A;  4IHS A;  4X6A J;  2P4W A;  1G3T A;  3CCU I;  1XDS A;  1HKT A;  3T0Y A;  1IN5 A;  2GXA A;  2PJP A;  1D3Y A;  1XSD A;  4RGU A;  2JUG A;  1JTY A;  3PQK A;  3JTG A;  3RQI A;  4MEY F;  4TV7 A;  3JRH A;  4QWQ A;  4ENN A;  5EF6 A;  2W85 A;  4RAF A;  3OYE A;  3CUQ B;  2KFD A;  5C3E J;  1JT6 A;  3LWF A;  1XGO A;  1O3S A;  5FKL A;  1IUF A;  1MZB A;  3BR6 A;  5ICG A;  4XID A;  1P4X A;  4I6Z A;  1OCZ H;  1W36 D;  3ZPL A;  2XV4 S;  2QF7 A;  2V9V A;  4AVZ A;  1Y0N A;  3RKQ A;  5K7H A;  5DD4 A;  2DXI A;  3DWL E;  2DMN A;  2D5V A;  2GWR A;  3PNV A;  3L2Q A;  2DYS H;  2MLG A;  2E36 A;  2MC4 A;  3AL0 C;  4G6Q A;  1YW9 A;  4KIG A;  2W24 A;  3GF2 A;  3KZZ A;  3I5U A;  1P4W A;  5AIQ A;  1WJA A;  3GYH X;  1DP7 P;  5D5X B;  1RRJ A;  1J7K A;  1XD7 A;  4L9N A;  4XKV A;  4XLA A;  1GDT A;  5E20 A;  3M8F A;  3FXL A;  5H6Q A;  5LGU A;  4M3E A;  4UV8 A;  1FSH A;  3BR3 A;  2R7R A;  3K4B A;  2Z16 A;  3J7A O;  1ZEL A;  2F5D A;  3FIW A;  3HKZ N;  2CH0 A;  5HDG A;  5LBQ A;  4A3K J;  2A6H F;  4HG2 A;  5GAE J;  4RGX A;  2JA5 J;  1XMK A;  2HYF A;  2K9L A;  3VEP A;  1S5L C;  2MG4 A;  4UVB A;  1X19 A;  3LL7 A;  4PJN A;  1WJE A;  5LHG A;  1ZK8 A;  4YFX F;  3RI4 A;  4Y52 J;  1YJW I;  2DTR A;  3RYP A;  3RJP A;  4A0Z A;  4HF0 A;  4EJW A;  5LRS A;  2QLZ A;  2OA4 A;  1FYK A;  2DFF A;  2ESN A;  4V2G A;  3E0J B;  1QQI A;  1MNM C;  3KPH A;  3HBL A;  2EIK H;  1FOK A;  4D0P A;  3E97 A;  4LOC A;  4XLC A;  3P5J A;  1VFC A;  3IWZ A;  1ULY A;  4BDY A;  3K10 A;  2GLO A;  1LDK B;  4ZC3 A;  5D5W B;  1IF1 A;  1QHG A;  4IRI A;  3C1D A;  1P6R A;  5TJJ A;  1W7P D;  1XDU A;  3U1D A;  3OYN A;  2V1N A;  2DQL A;  3DLL F;  1VQ5 I;  3RZO J;  2RNG A;  3ZMZ A;  4MGR A;  3M9A A;  4C2T A;  2G0E A;  2H8W A;  2M0M A;  2QQ8 A;  4LG0 B;  2GA2 A;  1AU7 A;  4YEJ A;  3K4L A;  3KIO A;  3SFI A;  4LFU A;  5F6F A;  5HS7 A;  3MD2 A;  1KON A;  3LFK A;  2MD5 A;  2L4A A;  4EJO A;  4S05 A;  1RC9 A;  3E5X A;  4PUS A;  4RAZ A;  3ECH A;  2JJ7 A;  3BRO A;  3K4N A;  3B02 A;  4JQF A;  1STZ A;  1L3L A;  5JI6 A;  2EWN A;  4PCQ A;  1GT0 C;  4M3F A;  4CO8 A;  5J47 A;  3ESW B;  1XSV A;  1M1E B;  4EMS A;  1EH8 A;  5M3M J;  4I2O A;  1EF4 A;  1OQY A;  2PMZ A;  2LH9 A;  1TWG J;  2VT2 A;  2E7W A;  2P5V A;  2E5N A;  1D1A A;  5E18 F;  4Y4R A;  3LMM A;  1V54 H;  3CMM A;  3HOX J;  1R00 A;  2DMT A;  1XS9 A;  3DU5 A;  3GZN B;  4AWX B;  2F5C A;  2P6S A;  3QOD A;  2FRH A;  4CH7 A;  4A3D J;  4YFK F;  2PFB A;  3HSF A;  1MBG A;  3RZD J;  2V6E A;  1VND A;  4A0X A;  2DA6 A;  2NVX J;  3GME A;  1MH4 A;  3F22 A;  1YS7 A;  3HOT A;  3CCV I;  3CMY A;  2IBD A;  3HUG B;  2VKV A;  1R36 A;  1Z0X A;  2VQL A;  4I09 A;  4N9H A;  3FDY A;  2ZXI A;  4HST A;  5LEK A;  1POG A;  3Q0W A;  4ESJ A;  1XMA A;  4WCG A;  1LFP A;  1UHS A;  2XAU A;  3DLA A;  4IHT A;  1ZLJ A;  3GLX A;  3FMR A;  1WH5 A;  3WU1 B;  1A6Q A;  2CW8 A;  4BJ6 C;  2YU3 A;  3O3K A;  1RKT A;  1O4X A;  2V1U A;  5DM6 F;  4D1Q A;  3HDD A;  3VYS B;  3JR9 A;  2PI0 A;  3Q9V A;  4AU7 A;  4FIS A;  4M3D A;  2AXL A;  2EPF A;  4ABZ A;  2KRF A;  1HLV A;  4U0Y A;  2PJR A;  2CUZ A;  2LRD A;  2IGO A;  5ICF A;  5HDN A;  3OYA A;  5BOX A;  1TWH J;  3SJM A;  1FYM A;  1V55 H;  3W3C A;  1NHA A;  4MFD A;  2CO5 A;  3PNY A;  2ZXW H;  5K7Z A;  4Y13 A;  1DQU A;  2MYS A;  5F64 A;  1YI2 I;  4OAZ A;  1JI8 A;  3ZN0 A;  4NC6 A;  2QEN A;  2OV7 A;  4ZDL A;  3F9K A;  1T08 B;  3A01 A;  4WX9 A;  1UG2 A;  4F93 B;  3OYD A;  1R4M B;  2EV5 A;  4J01 A;  2B0L A;  2E60 A;  3BZC A;  2IJL A;  2EB7 A;  3CUQ C;  3ML6 A;  2I8D A;  3BCB A;  5LGT A;  3V7S A;  1YRN A;  2IRF G;  2JWT A;  1FZP B;  5HDK A;  3RQ4 A;  4HNT A;  1JJ6 C;  1ON2 A;  1ZTR A;  2FQ3 A;  3GFJ A;  3ZGK A;  2QVO A;  5EGO B;  4OIQ F;  4G94 A;  5AIP A;  3I64 A;  5A2Q K;  2ELH A;  4BL0 B;  3WTS C;  3DKW A;  3RPU A;  4II2 A;  4P55 A;  1F1Z A;  3I71 A;  1SFK A;  3K1M A;  4V19 K;  3S1R J;  3ELK A;  3MVP A;  1U9O A;  5FJ8 J;  2EIJ H;  4QPO A;  1IN8 A;  2R7T A;  3ZMT A;  3GTL J;  1K83 J;  2A61 A;  1K78 A;  2EFO A;  4ENK A;  4GCV A;  1Z67 A;  2OJE D;  2M4K A;  2Y9Y A;  4BXU A;  2HVR A;  1IXS B;  3OWT A;  3G3Z A;  1JKQ C;  2MH2 A;  3S16 J;  1Z3Y A;  2IXS A;  3OR2 C;  5LRR A;  3QYB A;  1N77 A;  2FOW A;  3ABU A;  3MQ0 A;  3TL4 X;  3ISP A;  1D0Y A;  1OKR A;  3NEU A;  4F55 A;  2E35 A;  2E1M C;  2MAB A;  1MSF C;  5FRN A;  4UB6 C;  1MBK A;  5BPI A;  2LC2 A;  3K4C A;  1LDD A;  3CO6 C;  4KFC A;  4WXD A;  4XL9 A;  4F3Q A;  3JW4 A;  3CZ6 A;  3DV8 A;  5K5R A;  2L4M A;  2HDD A;  2BOL A;  2NXN B;  3GTJ J;  1B1B A;  1TL8 A;  1C0W A;  2IS1 A;  2DOA A;  3IUO A;  4I02 A;  3CDH A;  2Q2E B;  2EZK A;  5FLM J;  1X1A A;  1BR4 A;  1QPI A;  4N4O B;  3SZG A;  4WK8 F;  2X85 A;  1WVR A;  2IA2 A;  2XF7 A;  3H9Q A;  5M5X J;  2Z33 A;  1Z9C A;  4G7O F;  1B6A A;  1IO2 A;  1WKM A;  2KMU A;  4LIU A;  4UUS B;  3MEX A;  2L2O A;  2LG4 A;  2MC3 A;  3CES A;  1A5J A;  2OCE A;  4ETS A;  5J6X A;  1QGP A;  1MMN A;  4J00 A;  4BE0 A;  1LFB A;  3J81 Z;  2K3P A;  4EAT A;  4PK4 A;  2WB1 A;  5D8K B;  1SFU A;  1RUN A;  1SC7 A;  1OMI A;  1MMD A;  1Y6I A;  3VDX A;  4IF4 A;  5E3N A;  4E70 A;  5DYM A;  4KIB A;  2KP6 A;  3CTA A;  1V5G A;  3CJT B;  4F7Z A;  1QVU A;  4L0Z B;  3ZQI A;  1NK3 P;  5HS9 A;  1CF7 A;  3OR1 C;  2HTS A;  4EM1 A;  5IT9 Z;  2NNN A;  2HKX A;  4M9X A;  3WHC A;  1YS6 A;  1Z05 A;  3F8C A;  2EFQ A;  1BL0 A;  1V5F A;  4IXA A;  4ZYD A;  2A5Y B;  1SFE A;  1Y8Q B;  2ZO4 A;  3NAU A;  2MBF A;  3I9V 2;  2QBY A;  2W25 A;  4HX7 A;  4U7D A;  3LOC A;  1ZGW A;  3H5N A;  1BJA A;  3KEQ A;  3HPH A;  1APL C;  1FTT A;  4KN4 X;  5F0F A;  5D5V B;  2CV2 A;  2XKO A;  1BR2 A;  1RR8 C;  2ISZ A;  1YG2 A;  2DJI A;  4PJJ A;  4XLE A;  3PNT A;  3HOV J;  3HPG A;  3HSE A;  3IKT A;  1H8A C;  3CD6 I;  3SZT A;  1U5T B;  2Y48 A;  2V7F A;  3V7R A;  1BI3 A;  4YIR X;  1VQO I;  4GYG A;  1D1C A;  2DT7 B;  2HEO A;  5IP7 J;  4XIC A;  1P7J A;  1T0F A;  1R6R A;  1TTY A;  1FBQ A;  1X4O A;  3F8B A;  1ERD A;  5FLX K;  1SFO J;  4UXN A;  3BTL A;  4LLN A;  1EJ9 A;  2DA1 A;  2K02 A;  1BBY A;  2RN7 A;  2PMU A;  2HWV A;  4CCJ A;  3P9K A;  3SEQ A;  2DA3 A;  2CRG A;  2XRN A;  4H4K C;  2LKS A;  4BE2 A;  2ZB9 A;  2P7V B;  4OMZ A;  5L3D A;  1Y39 A;  1PUF B;  2COM A;  1FMW A;  5C44 J;  4BKX A;  1F43 A;  3E5Q A;  3W2W A;  1QZZ A;  2DBB A;  2FOK A;  4IO9 F;  3WGI A;  1ZG1 A;  3N97 A;  3CUQ A;  2XAG A;  4BXX J;  3HRT A;  3OS1 A;  1H89 C;  1PVE A;  2O8K A;  1O57 A;  2FA5 A;  2H6C A;  4MIM A;  1Z3X A;  2K40 A;  3DF8 A;  2RVC A;  3KP3 A;  4MQ9 F;  4MEX F;  3L2W A;  3ZR8 X;  3HJE A;  1ETX A;  2NS7 A;  1F5T A;  2EV0 A;  2YR2 A;  1GHC A;  2FE3 A;  1BM9 A;  2LP0 A;  2ELJ A;  1FLI A;  2CQX A;  2F4O B;  2R7O A;  2XAJ A;  2BW3 B;  3ZN1 A;  1FSE A;  3PO3 J;  4FX0 A;  2IW5 A;  4RBO A;  4EGY A;  3IP4 B;  3PSF A;  2O03 A;  1MJ9 A;  3RKW A;  2MW8 A;  5HLI A;  3FF5 A;  5JHU A;  1A6I A;  3DEW A;  2AQF A;  1MH3 A;  4L9T A;  4XKW A;  4ZH4 F;  2LRE A;  2K7L A;  2QEX I;  2CJJ A;  4A93 J;  1XN7 A;  1BR1 A;  2G9W A;  4EM0 B;  2IS6 A;  1W7P B;  2HXI A;  2F4I A;  2HNH A; 
#chains in the Genus database with same CATH homology
 3T8R A;  4LK1 F;  2WC2 A;  2XRO A;  4I7H A;  4BYY A;  3C3W A;  1UST A;  3COA C;  2HKO A;  1YFH A;  3V8J A;  2ACJ A;  1CGP A;  3WU0 A;  2J5O A;  3K9T A;  1XGM A;  2H27 A;  2V6C A;  3AAF A;  3LA3 A;  2OZ6 A;  5D6F A;  1MKM A;  2WV0 A;  5ILV A;  4MNU A;  4R1H A;  4XSZ F;  3B73 A;  2LF7 A;  3H3Z A;  3OV8 A;  4LMY A;  3WTT C;  4ESB A;  5DCF A;  1IXC A;  2KKO A;  2ZNY A;  4RB3 C;  2CG4 A;  2CW0 F;  2TDX A;  4WWC A;  4M6X A;  4MQV A;  3I0T A;  2DK5 A;  2M45 A;  4LJZ F;  3K69 A;  3O2P E;  2KIF A;  5HS8 A;  2NAZ A;  4G8X A;  2PBI A;  4LD5 A;  6PAX A;  1IRF A;  3E3V A;  3KZY A;  3MWM A;  5L3B A;  2OQG A;  4I0B A;  1WSU A;  1K7A A;  2OU2 A;  4FHT A;  2WTE A;  3LQR A;  1I27 A;  3WGH A;  2O6G E;  1U5T C;  3KP4 A;  3QRF F;  2L54 A;  5FGM A;  2XAH A;  3KP6 A;  2DK8 A;  1OR7 A;  2LF8 A;  1BIA A;  4A5M A;  1YIO A;  4XBF A;  2R7F A;  4FX4 A;  3KET A;  2V1D A;  4NB5 A;  4G7Z F;  2LNB A;  1W5T A;  4YG2 F;  2IP2 A;  1YLF A;  3JAM Z;  3ZQ7 A;  4HQE A;  2VC0 A;  4BQA A;  1IRG A;  3RTR A;  3IRR A;  1YO5 C;  1XCB A;  1JE8 A;  2EFP A;  1ZAO A;  5E1W A;  3FXU A;  3GO5 A;  4MTE A;  5ICE A;  3GFM A;  4Q48 A;  3LA7 A;  5DV5 A;  5CVV A;  2STT A;  1FPQ A;  1G4D A;  4M73 A;  2GXB A;  4OMY A;  4M6Y A;  2XIG A;  4KDP A;  1ZG5 A;  3V4G A;  3DPT A;  1U2W A;  5KK1 A;  4PGH A;  2JSC A;  4LB6 B;  3EDP A;  5ERI A;  2DPU A;  4GYI A;  1T39 A;  3IRQ A;  1R5H A;  4B8X A;  2D2W A;  2ADU A;  1MDM B;  3BJ6 A;  2D1V A;  3HTU A;  3F6V A;  2QZ8 A;  5BQT A;  4U0W A;  2RKH A;  3LQQ A;  1TNT A;  2FBK A;  2JTV A;  1R5G A;  1B59 A;  2Q2E A;  3QAH A;  1QBJ A;  4Y15 A;  4GGG A;  1FBS A;  5CVU A;  3TGN A;  3ABT A;  1IUY A;  1V3F A;  1BI1 A;  2VC1 A;  1HKQ A;  3CO7 C;  5JR3 A;  1GXQ A;  4A12 A;  2EFN A;  3KP5 A;  5FFX A;  4O3M A;  1FBU A;  3L9F A;  2AS5 F;  5HVQ C;  2GQQ A;  3R61 A;  4NQW A;  5FFZ A;  2VT3 A;  4AVP A;  3ZMV A;  2OAZ A;  4M9Z A;  2J5P A;  1KYZ A;  2RV8 A;  2HR3 A;  5EEG A;  2P7C B;  3HTS B;  4P9U A;  3HHG A;  5DEQ A;  1IN7 A;  4RB0 A;  3KCC A;  2Q8K A;  1U78 A;  1HBX G;  1Z7U A;  4RAY A;  3HYI A;  1BIB A;  1O3Q A;  4HQM A;  1BC8 C;  3RDI A;  5AON A;  1HXD A;  3KFW X;  4JK1 X;  5JFR A;  4HOB A;  5DD8 A;  2Z5U A;  4KA4 A;  3WTW C;  1FC3 A;  3ERE D;  1Z6R A;  3LST A;  1V4R A;  4AIJ A;  1ZRC A;  1TQP A;  4EJT A;  1B9N A;  1QNT A;  4WF2 A;  4IRG A;  3KEO A;  3DXJ F;  4AIH A;  2UXX A;  2OBP A;  1J5Y A;  3BPV A;  3WTZ A;  1ONV A;  2P5K A;  4MHG A;  1DUX C;  2V79 A;  5FB2 A;  1XSX A;  3SXY A;  1IW7 F;  1ZGJ A;  3HRS A;  3WTX C;  4OIN F;  4HDV A;  1Z6T A;  2HDC A;  3GFL A;  3D5L A;  2STW A;  4DQ2 A;  1U6G A;  2A6E F;  4R79 A;  5DUI A;  2VE8 A;  4CZZ A;  5J8C A;  5H20 A;  2BV6 A;  1W7P A;  1WI9 A;  2ZFW A;  2O61 A;  1VTN C;  3SZP A;  3FM3 A;  3GWZ A;  4EVI A;  1IN6 A;  4L5J A;  4IJA A;  1HW5 A;  2QYO A;  2O0Y A;  3ZP5 A;  3FHZ A;  2MH9 A;  3T8T A;  3L2C A;  3HRU A;  2QQ9 A;  4N9I A;  2D45 A;  1ZRF A;  1B4A A;  2H09 A;  2ZME B;  1KQ9 A;  3WG9 A;  2C6Y A;  2XHK A;  4HX4 A;  2FML A;  2GXG A;  2HQN A;  3J80 Z;  2F5F A;  4BHC A;  1RIO H;  3PFI A;  2KJB A;  1O7F A;  2MA3 A;  4KT5 C;  1Z91 A;  5FD5 A;  2PLY A;  1FNN A;  1R1T A;  5K5O A;  2ESH A;  3MFK A;  5J8F A;  3WE2 A;  1PUE E;  3VOE A;  2JPB A;  1YTY A;  2E1N A;  4RGR A;  1XCV A;  4KIC A;  3IHU A;  2PN6 A;  5BPD A;  2RGV A;  2L02 A;  5CYV A;  3Q9S A;  4XLN F;  4RB2 C;  5L3E A;  1FX7 A;  4WXC A;  2DLL A;  4ZZD A;  2GA1 A;  4P9F A;  3CLO A;  4OU0 A;  1J2X A;  1S7A A;  5LHI A;  3KP7 A;  1XB4 A;  2JRT A;  4XRF A;  1SD5 A;  5E8G A;  1KGS A;  5D4S A;  1UFM A;  4ON0 A;  1HQC A;  5ILS A;  2RC4 A;  4BHP A;  3RKY A;  2HYG D;  1SAX A;  3T5X A;  2XKP A;  4LK0 F;  3I59 A;  1T98 A;  2R7D A;  1FT9 A;  4ZYG A;  2E1C A;  1FP2 A;  2ZXJ A;  1BN5 A;  5D6E A;  2OD5 A;  4CXF A;  3D0S A;  2CWE A;  4GXO A;  1H9G A;  1PDN C;  4BNC A;  3RKX A;  1HKS A;  2BE5 F;  1EV7 A;  1KYW A;  2PQ8 A;  2F2E A;  1QO0 D;  5CJ9 A;  3GUD A;  1ZN2 A;  1ZYR F;  1H0M A;  2RDP A;  3HOS A;  2NNY A;  1KU3 A;  1TW3 A;  4RS8 A;  1I6X A;  2XAQ A;  1S3J A;  3QOP A;  2CSO A;  1X3U A;  4A6E A;  3FZV A;  1K6O A;  1MDM A;  5LGN A;  1G6N A;  2G7H A;  2K4J A;  3LAP A;  2A3S A;  5CVR A;  4YII A;  4KMF A;  1YYV A;  3QP6 A;  4FT8 A;  2FMY A;  1ZAR A;  2K4B A;  3P7N A;  1KQ0 A;  3M1E A;  2FBH A;  2HS5 A;  3QU6 A;  5ED4 A;  2H6B A;  1XGS A;  3K0L A;  3G73 A;  4BHB A;  1FY7 A;  3GVA A;  3WTU C;  4CGZ A;  3ZMU A;  5DUK A;  4HA8 A;  1R7J A;  3DEU A;  4YIF A;  4S04 A;  3Q5F A;  3F8N A;  2FXA A;  2IA1 A;  1FYL A;  3W6J B;  2VBY A;  4LG0 A;  2CFX A;  3F72 A;  3V8K A;  5K1Y A;  3GX4 X;  5DCM B;  5BS6 A;  1ZRD A;  1PP7 U;  3I58 A;  4ZYE A;  3BDD A;  1QZY A;  1BC7 C;  1RNL A;  3E6D A;  1LEB A;  1RZ4 A;  3TOB A;  3EQL F;  3TOA A;  2A68 F;  3R60 A;  2DAO A;  2EK5 A;  2G7U A;  2K86 A;  4Y17 A;  2A07 F;  2YX4 A;  3WOD F;  3EET A;  4JBA A;  3M7G A;  3REO A;  2D1H A;  2IA0 A;  3O6B B;  3HUG A;  3NRV A;  1WQ2 A;  3GFI A;  2VXZ A;  5L3F A;  3QP5 A;  3T1B A;  1HW2 A;  2VON A;  4PDK A;  4HW0 A;  4UHT A;  4UVA A;  3BJA A;  4L9J A;  4P96 A;  4M72 A;  5HOO A;  4LLL A;  5ICC A;  5CVJ A;  4IVN A;  2ISY A;  3TO6 A;  3L00 A;  1SMT A;  5A2Q Z;  1CF7 B;  1TQM A;  2VOD A;  2HFH A;  3S2W A;  1RUO A;  1LEA A;  4AD9 A;  3K1P A;  2QBY B;  2VE9 A;  1ON1 A;  1OPC A;  1W5S A;  3H3U A;  4A0Y A;  2QQA A;  1GXP A;  3J81 K;  2XAF A;  1W4M A;  1D5V A;  3E5U A;  4A5N A;  3RYR A;  1LDJ A;  2PG4 A;  3VOD A;  3EUH A;  2BGC A;  1TNS A;  2L3D A;  1JHF A;  1SD7 A;  4HX8 A;  5L3C A;  5HLG A;  5IT9 K;  1G3Y A;  2EA2 A;  4EM2 A;  3HSR A;  3TQN A;  2HZT A;  4MTD A;  4Z2Y A;  2DU9 A;  1OYI A;  2ZME A;  5ILU A;  1HW1 A;  3V7C A;  1G3W A;  3FMS A;  2OQR A;  2ZBK A;  3P9I A;  2V1X A;  4KYW A;  2M8E A;  1E17 A;  2LDU A;  3CUO A;  1B9M A;  1ZGA A;  1S8N A;  3JTH A;  2JT1 A;  2W57 A;  4HV5 A;  3F6O A;  1U8R A;  3ZMS A;  2EJR A;  2X4H A;  4HBL A;  2XGX A;  2ZCW A;  3HRM A;  5JVT A;  4L5I A;  4HF2 A;  1TLH B;  1L0O C;  3JSO A;  1IN4 A;  3HIF A;  5F1R A;  2P6T A;  4HAM A;  3I4P A;  2VOP A;  2M5W A;  3QPT A;  5E1Z B;  2UXN A;  2O3F A;  3SQN A;  4LGW A;  1TQI A;  1T38 A;  1IZ1 A;  3V8L A;  2Y0M A;  4IRH A;  4OOI A;  5LLQ A;  2YSR A;  1MJB A;  5KVR A;  1DPR A;  1O3T A;  1ZLK A;  3M8E A;  1EH7 A;  2KIM A;  2A69 F;  3I53 A;  2DFI A;  4A2U A;  5FLX Z;  1USS A;  1R23 A;  1K79 A;  3R4K A;  4HZF A;  2FSW A;  2M1B A;  3NQO A;  4PGG A;  4BAY A;  2HTJ A;  4I0A A;  4YFN F;  1KA8 A;  2IT0 A;  1LB2 A;  3FXQ A;  3W6K B;  1XGN A;  2VBX A;  1P2F A;  3FMQ A;  1LVA A;  1Q1H A;  5D4R A;  3FWE A;  2Y75 A;  1U5T A;  3DPL C;  4LLG F;  1UHM A;  4WXH A;  4U7B A;  3BPX A;  4EQQ A;  3F21 A;  2IVM A;  1KQ8 A;  3ZMD A;  2VOO A;  4OIR F;  4ENJ A;  1I5Z A;  3QPH A;  4GO1 A;  1UHW A;  4KN7 X;  2M30 A;  1U3E M;  1R1U A;  1UB9 A;  3BJO A;  1IXR C;  1I1G A;  1REP C;  1IAW A;  2FNP A;  2GZW A;  2OZU A;  2VBW A;  2BBY A;  3ECO A;  1T6S A;  3I54 A;  2Z3Y A;  3LAJ A;  2ZNZ A;  3SHF A;  3WGG A;  1MJA A;  1TBX A;  2K27 A;  2QQB A;  3BY6 A;  2EFW A;  3BP8 A;  3FX3 A;  3GXO A;  4ZYH A;  3N4M A;  1J59 A;  3K1N A;  5D8L B;  1TW2 A;  4L0Y B;  1ZRE A;  2RQP A;  3BWG A;  1D8J A;  1JHH A;  3GZ6 A;  1BI0 A;  2VN2 A;  1YW8 A;  5DDG A;  1RI7 A;  1WWX A;  1H9T A;  4EV0 A;  1ODD A;  1DDN A;  4QLC U;  5L3G A;  1JGS A;  1R58 A;  4CHU A;  4ESF A;  1R22 A;  5DCM A;  3TO7 A;  4HLX A;  1R1V A;  3LA2 A;  3TDU C;  2EV6 A;  3U2R A;  2PMH A;  4I01 A;  1I1S A;  4N0B A;  4EJU A;  2EA4 A;  3BOQ A;  3JAM K;  1GVJ A;  4M74 A;  4R8H A;  1LJ9 A;  1A04 A;  1KU2 A;  4PZJ A;  1J75 A;  3F8F A;  2ETH A;  2DPD A;  2WWY A;  1HSJ A;  1SMY F;  3F8M A;  1FP1 D;  4L9V A;  1KU7 A;  5FD6 A;  2Z9O A;  3KLN A;  4H0E A;  3KLO A;  4UUV A;  2GAU A;  3BZ6 A;  1O3R A;  4KNY A;  5LHH A;  2YPR A;  2XVC A;  3IWF A;  2F5E A;  4UV9 A;  3FM5 A;  3MCZ A;  2HGC A;  3IKV A;  4M9S A;  4P5O A;  2CQK A;  2P8T A;  3P9C A;  3E6M A;  1Z1D A;  4DNC A;  4ASN A;  3E6B A;  4ZZL A;  1YQA A;  4HF1 A;  2NS0 A;  3U9G A;  4LB5 A;  1OYY A;  2ZKZ A;  3GEZ A;  3TO9 A;  5LEJ A;  5H6R A;  3TKY A;  1J0R A;  1ZHF A;  2GIV A;  1AOY A;  1LNW A;  3MZY A;  4ENM A;  4HDU A;  2FNA A;  1EH6 A;  4U88 A;  2ZJ2 A;  3EYI A;  3GW2 A;  3WTV C;  4CIC A;  4UVC A;  1AWC A;  3KE2 A;  3L7W A;  2DO7 A;  2DT5 A;  4HLY A;  2RNJ A;  4I98 B;  2MLK A;  2Q0O A;  2QWW A;  2LSO A;  3R0J A;  4AIK A;  1FWZ A;  5CVI A;  4G6D A;  2VBZ A;  2QM3 A;  4EGZ A;  1LQ1 A;  4IPA A;  3F3X A;  4M71 A;  3RPQ A;  3VB2 A;  3C7J A;  4UNO A;  1D8K A;  1ZG3 A;  3IC7 A;  2IPQ X;  3OOP A;  2PEX A;  3EYY A;  2X0L A;  2YX7 A;  3TDZ C;  2O8X A;  3WTY C;  3JSP A;  5TRD A;  3R6S A;  2FF4 A;  2Z99 A;  3ROU A;  1DPU A;  4KMU X;  5E17 F;  4CDG A;  1O7L A;  4Q47 A;  2LKP A;  3SFZ A;  1JXS A;  1F9N A;  2KJC A;  2L01 A;  4RGS A;  1E2X A;  3C18 A;  3PQJ A;  3H92 A;  2DW4 A;  4CYD A;  2BYV E;  4A6D A;  1S7O A;  2UZK A;  1OYW A;  4O6J A;  4KIF A;  3QU3 A;  2BEO A;  1BOA A;  1K78 B;  4HV6 A;  2P5L C;  4G7H F;  3DFG A;  3R0A A;  5HLH A;  1SD6 A;  1KU9 A;  3ULQ B;  4XLP F;  5E1X A;  2FU4 A;  4OIP F;  1F4K A;  3DP7 A;  2HOE A;  3IL2 A;  4OIO F;  2W84 A;  3WE3 A;  1P92 A;  4Q4Z F;  5BMZ A;  5IT3 A;  3L09 A;  2E7X A;  2UWM A;  2KIU A;  3E6C C;  1BI2 A;  1S29 A;  3GZ5 A;  2HQR A;  3CJN A;  4G9Y A;  3FXR A;  1HST A;  4NHJ A;  3HHH A;  4O5V A;  5K5Q A;  1QPM A;  3J80 K;  1Y0U A;  1SFX A;  2NYX A;  1S6L A;  3K2Z A;  1G3S A;  3KP2 A;  2DQR A;  2M87 A;  1T2K A;  2CGP A;  2JZY A;  4K2E A;  4U0V A;  4XSX F;  5FO5 A;  4HYE A;  2FBI A;  5EEH A;  3DQV C;  2FEZ A;  4BH9 A;  3VFZ A;  5CLS A;  4L18 B;  4EJV A;  1MD0 A;  1P4A A;  2XUB A;  4Q5S F;  4KUM A;  4B09 A;  3RIR A;  2NRA C;  1PP8 F;  3F23 A;  3I59 B;  1J9I A;  1SD4 A;  2QUF A;  4RB1 A;  2DI3 A;  2CYY A;  3MAJ A;  5D5U B;  3MZH A;  2H94 A;  2R3S A;  1YW7 A;  1WRJ A;  1ZH5 A;  1MGT A;  1UCR A;  2JPC A;  5E8I A;  2XAS A;  4IHS A;  2P4W A;  1G3T A;  1XDS A;  1HKT A;  3T0Y A;  1IN5 A;  2PJP A;  1D3Y A;  1XSD A;  4RGU A;  3PQK A;  3JTG A;  4MEY F;  4TV7 A;  4QWQ A;  4ENN A;  2W85 A;  3CUQ B;  3LWF A;  1XGO A;  1O3S A;  1MZB A;  5ICG A;  1P4X A;  3ZPL A;  2XV4 S;  2V9V A;  5DD4 A;  2GWR A;  2MLG A;  4G6Q A;  1YW9 A;  4KIG A;  2W24 A;  3GF2 A;  3KZZ A;  3I5U A;  1P4W A;  5AIQ A;  3GYH X;  1DP7 P;  5D5X B;  1J7K A;  1XD7 A;  4L9N A;  5E20 A;  3M8F A;  5H6Q A;  5LGU A;  4UV8 A;  1FSH A;  3J7A O;  2F5D A;  5LBQ A;  5HDG A;  2A6H F;  4RGX A;  1XMK A;  2HYF A;  3VEP A;  4UVB A;  5LHG A;  4YFX F;  3RI4 A;  2DTR A;  3RYP A;  3RJP A;  4A0Z A;  4HF0 A;  4EJW A;  5LRS A;  2QLZ A;  2OA4 A;  1FYK A;  2ESN A;  1QQI A;  1FOK A;  4D0P A;  3E97 A;  3IWZ A;  1ULY A;  1LDK B;  5D5W B;  1IF1 A;  4IRI A;  3C1D A;  1P6R A;  5TJJ A;  1W7P D;  1XDU A;  3U1D A;  2DQL A;  3ZMZ A;  4MGR A;  3M9A A;  4LG0 B;  2GA2 A;  4LFU A;  5F6F A;  5HS7 A;  3LFK A;  2MD5 A;  2L4A A;  4EJO A;  4S05 A;  3E5X A;  4RAZ A;  3ECH A;  3BRO A;  3B02 A;  4JQF A;  1STZ A;  1L3L A;  5JI6 A;  2EWN A;  4PCQ A;  4CO8 A;  1XSV A;  4EMS A;  1EH8 A;  4I2O A;  2VT2 A;  2E7W A;  2P5V A;  5E18 F;  1R00 A;  4AWX B;  2F5C A;  2P6S A;  2FRH A;  4YFK F;  2PFB A;  3HSF A;  4A0X A;  3F22 A;  1YS7 A;  3HOT A;  1R36 A;  4I09 A;  4N9H A;  5LEK A;  4ESJ A;  1XMA A;  4WCG A;  4IHT A;  1ZLJ A;  3GLX A;  3FMR A;  3WU1 B;  2YU3 A;  3O3K A;  2V1U A;  2PI0 A;  3Q9V A;  2AXL A;  2KRF A;  4U0Y A;  5ICF A;  5HDN A;  5BOX A;  1FYM A;  1NHA A;  2CO5 A;  4Y13 A;  5F64 A;  3ZN0 A;  2QEN A;  4WX9 A;  2EV5 A;  2B0L A;  2IJL A;  2EB7 A;  3CUQ C;  3ML6 A;  5LGT A;  3V7S A;  2IRF G;  1FZP B;  5HDK A;  1ON2 A;  2FQ3 A;  3GFJ A;  2QVO A;  4OIQ F;  4G94 A;  5AIP A;  3I64 A;  5A2Q K;  2ELH A;  3WTS C;  3DKW A;  3RPU A;  4P55 A;  1F1Z A;  3I71 A;  3K1M A;  3ELK A;  1IN8 A;  3ZMT A;  2A61 A;  1K78 A;  2EFO A;  4ENK A;  4GCV A;  4BXU A;  1IXS B;  3G3Z A;  2MH2 A;  5LRR A;  3ABU A;  3MQ0 A;  3ISP A;  1OKR A;  3NEU A;  5BPI A;  4KFC A;  1LDD A;  3CO6 C;  4WXD A;  3JW4 A;  3DV8 A;  5K5R A;  2L4M A;  1C0W A;  1B1B A;  4I02 A;  3CDH A;  4WK8 F;  2IA2 A;  4G7O F;  1Z9C A;  2Z33 A;  1B6A A;  1WKM A;  3MEX A;  2MC3 A;  4ETS A;  5J6X A;  1QGP A;  3J81 Z;  5D8K B;  1SFU A;  1RUN A;  1OMI A;  4IF4 A;  4E70 A;  5DYM A;  4KIB A;  3CTA A;  4F7Z A;  4L0Z B;  5HS9 A;  1CF7 A;  2HTS A;  4EM1 A;  5IT9 Z;  2NNN A;  4M9X A;  2HKX A;  1YS6 A;  1Z05 A;  3F8C A;  2EFQ A;  4IXA A;  4ZYD A;  2A5Y B;  1SFE A;  2ZO4 A;  2MBF A;  2QBY A;  2W25 A;  4HX7 A;  4U7D A;  1BJA A;  3KEQ A;  4KN4 X;  5D5V B;  2XKO A;  2ISZ A;  1YG2 A;  3HSE A;  3IKT A;  3SZT A;  1U5T B;  2Y48 A;  3V7R A;  1BI3 A;  4GYG A;  2HEO A;  1T0F A;  1TTY A;  1FBQ A;  3F8B A;  5FLX K;  4UXN A;  4LLN A;  2K02 A;  1BBY A;  2RN7 A;  2PMU A;  2HWV A;  3P9K A;  2XRN A;  2P7V B;  4OMZ A;  5L3D A;  2COM A;  3E5Q A;  1QZZ A;  2DBB A;  2FOK A;  3WGI A;  1ZG1 A;  3N97 A;  3CUQ A;  2XAG A;  3HRT A;  1O57 A;  2FA5 A;  2H6C A;  3DF8 A;  2RVC A;  3KP3 A;  4MQ9 F;  4MEX F;  1F5T A;  2EV0 A;  2YR2 A;  1GHC A;  2FE3 A;  1BM9 A;  1FLI A;  3ZN1 A;  2XAJ A;  1FSE A;  4FX0 A;  2IW5 A;  4EGY A;  2O03 A;  1MJ9 A;  3RKW A;  5HLI A;  3FF5 A;  5JHU A;  4L9T A;  4ZH4 F;  2K7L A;  1XN7 A;  2G9W A;  4EM0 B;  1W7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...