3KP5A

Staphylococcus epidermidis tcar in complex with kanamycin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator/antibiotic
total genus 49
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp5A00
5D6EA 4A12A 4G6DA 2M87A 3ZMVA 2HTJA 4UV8A 4Y13A 4LG0A 3F23A 2O6GE 4HLYA 2NS0A 2P5KA 2K02A 4DNCA 1L3LA 1W4MA 4MQVA 4KN7X 2HZTA 5LEKA 2L3DA 4UVAA 4BYYA 2PMHA 5DDGA 1CF7B 4RB1A 3P9IA 4FX0A 4EGYA 2XROA 3G73A 3WE3A 4NQWA 1JGSA 3BOQA 1T39A 3LWFA 1KA8A 1HW1A 3E6BA 3FX3A 1WSUA 2OBPA 1Z7UA 1PUEE 5D5VB 4A2UA 1F4KA 3I58A 3RTRA 2Z9OA 3RPUA 4WX9A 1SD7A 1R7JA 3KLOA 2EK5A 1BC8C 4ZYDA 4HA8A 2EWNA 4FX4A 4EGZA 5ILUA 4L5JA 2FU4A 3RYPA 2UXNA 3E97A 5ICFA 3REOA 4XRFA 5A2QZ 3EDPA 2VOOA 2DBBA 2P7CB 3L00A 4G7OF 5FD6A 2JT1A 1STZA 1P4WA 4RS8A 3CUOA 4OINF 2DT5A 1O57A 5ED4A 2X4HA 1XMAA 5LEJA 3RPQA 1T98A 3E6CC 2WV0A 3U2RA 2HS5A 5HVQC 5CYVA 1MJAA 2DW4A 2L4AA 2ZFWA 2L02A 1ZREA 2Q0OA 1R5HA 5JR3A 1O3SA 5J8FA 5CVJA 5LHHA 1ZN2A 1D8JA 3MAJA 3R4KA 2XKOA 5AONA 5D6FA 1P2FA 1OYWA 1GXQA 1EV7A 2Q2EA 1U5TC 1RIOH 2PG4A 4L9JA 3VODA 4YIFA 3FM5A 1YFHA 1IF1A 4P9UA 3KCCA 2BGCA 3JTHA 2LDUA 2COMA 3GW2A 2NYXA 1U5TB 4HAMA 3IWFA 1HXDA 5FD5A 2ACJA 1WWXA 3F8BA 1H9GA 2JZYA 4CHUA 1ODDA 5L3EA 3BWGA 3I5UA 4Q4ZF 4PCQA 3KP3A 2L54A 3C1DA 2ZNYA 4YFXF 5DV5A 1O3TA 2DK8A 2DTRA 1SD5A 4UVBA 2FOKA 1O3RA 1I1GA 4RB3C 1PP8F 2XAFA 3VEPA 1F1ZA 1Y0UA 1BI0A 2HQRA 2VBYA 2YX7A 3E6MA 4G94A 2G7UA 2IA0A 2MBFA 3SZPA 2FEZA 4A5NA 4LB6B 2QVOA 3V8LA 2O03A 3LFKA 2IPQX 5ICGA 1FYMA 1ZAOA 2JRTA 4BQAA 4IXAA 3Q5FA 3ELKA 2ISZA 2IP2A 1G3WA 5D4SA 4M9XA 4WF2A 2QYOA 2ESHA 4PGGA 4ESJA 2OAZA 1S7AA 1TBXA 4U88A 1R5GA 1F5TA 4RGUA 1XSXA 2JTVA 4CXFA 1RUNA 4HDVA 3P7NA 2CW0F 3KLNA 5FO5A 1R23A 1YO5C 2M1BA 2RNJA 2XAGA 3QPHA 3JSPA 1G3YA 2KJBA 4A0ZA 1O7LA 4HOBA 1BIAA 2JPCA 4LK1F 1KU7A 1EH8A 4CDGA 2H6CA 3V8JA 2WTEA 1HKQA 2LNBA 4HQEA 2OQGA 5HS8A 5BS6A 2XAHA 5HDGA 2Z5UA 3K69A 3ZMUA 2X0LA 1LVAA 3KP5A 1JHFA 5TJJA 1I5ZA 2PQ8A 3R6SA 3ZQ7A 4KDPA 5HS7A 3BROA 4MNUA 1XGMA 4Z2YA 2P6TA 2HYFA 4AIHA 1KU2A 3QAHA 1ZLKA 3FMQA 3IRQA 2FBHA 4KN4X 1SD4A 2UXXA 1TNTA 1FY7A 2CO5A 2MLGA 2E1NA 4A0XA 1W7PB 2K27A 2RQPA 4L0YB 3WG9A 1DUXC 1RZ4A 1IXRC 5L3FA 3S2WA 4S05A 1MD0A 1RNLA 5JFRA 2P4WA 3GF2A 2KKOA 3TDZC 2L4MA 2UWMA 3IHUA 2MLKA 1IUYA 2F5CA 3F6OA 3GXOA 1QZYA 4KYWA 4P96A 3KFWX 1FT9A 3SQNA 4EJUA 2XIGA 4LGWA 1O3QA 1B4AA 3K9TA 4G9YA 4P9FA 1MJBA 1JXSA 4P5OA 3RKWA 5BPDA 2RN7A 2G9WA 4G8XA 1U3EM 2QQAA 2LSOA 4A6EA 2LKPA 3L7WA 3CO7C 5DEQA 1HW5A 1K78A 4AVPA 3M8EA 1KYWA 5CVIA 1BI3A 2FSWA 4RB2C 4UHTA 2W85A 5HOOA 3F8CA 4HBLA 1GVJA 3ULQB 4RB0A 1QGPA 3O3KA 1XCVA 1J59A 5E17F 1IXSB 2MH2A 3ROUA 1XGNA 5J6XA 2CQKA 5E1ZB 3LQQA 2F5FA 3T8TA 2A5YB 2RKHA 1PP7U 2FXAA 4RGXA 4XSXF 2GIVA 1ON2A 3WTVC 2YPRA 2P8TA 3LA3A 3K2ZA 4OMZA 1H9TA 3F8FA 3M1EA 3WTYC 1DP7P 1VTNC 1U78A 4ZZLA 4ZYHA 3WTXC 5AIPA 5D5XB 1HSTA 2E1CA 5FB2A 5D5WB 1FWZA 2FF4A 3KE2A 1S3JA 3WTSC 3RKYA 4EJWA 1YG2A 1U2WA 3HIFA 4ETSA 4HLXA 3I59A 2OD5A 4ENMA 3R0JA 3SZTA 1KU9A 1PDNC 3WTZA 4HDUA 2PN6A 2XV4S 4IRIA 4I0BA 5BMZA 5CLSA 2QBYB 1LDKB 5CVUA 2B0LA 4I7HA 1XGSA 2MD5A 5D4RA 3MCZA 2XKPA 5JI6A 4A6DA 2P5VA 3HRSA 4F7ZA 1LDJA 1OMIA 1W5TA 4IJAA 4RAZA 4YG2F 2EB7A 4XLPF 1XDUA 3F72A 4EM2A 3MZHA 4AIJA 3WTUC 2ZO4A 3ECHA 1G3TA 1J75A 4MEXF 4ESBA 4Q48A 5E1XA 2FE3A 1IN5A 1FYLA 5H6QA 5EEGA 2VE9A 1W5SA 2V1XA 4HX7A 3RI4A 1CF7A 3F22A 2PFBA 1ZRFA 4WXDA 1B1BA 3ABTA 4HF2A 3GZ5A 4GYGA 2DK5A 4N9HA 1S29A 4Q5SF 1F9NA 2NAZA 1XSVA 4NHJA 4ESFA 4D0PA 2KRFA 4L5IA 2QM3A 2D45A 5E1WA 1ZH5A 1MKMA 1R1UA 3K0LA 3KEQA 4JQFA 1ULYA 2A6EF 3FF5A 4LMYA 2HWVA 2HEOA 3LA2A 4MHGA 2FRHA 1YW7A 5E8IA 2GA2A 4HZFA 3L9FA 4BAYA 4A5MA 4U0VA 4IRHA 3QP6A 4HX4A 5IT9K 1ZG3A 1FC3A 5HS9A 3GYHX 3TOBA 3V4GA 1GHCA 3KP2A 4UV9A 1P6RA 1KQ8A 2HKXA 3GWZA 4M71A 3H92A 5K1YA 3FXQA 2HR3A 3HRUA 1QNTA 3ML6A 2VC0A 2P6SA 1G3SA 1K6OA 1Z9CA 2WC2A 2A69F 3J80Z 2AXLA 2CG4A 2K86A 1QQIA 3I53A 1ZGAA 3E6DA 3J81K 2H27A 1IN8A 3CJNA 1UHMA 2BYVE 2ADUA 4EQQA 5EEHA 3T0YA 1YLFA 2C6YA 4KNYA 4U7DA 2XGXA 3V7RA 2M45A 1E2XA 1T2KA 1Z1DA 4OIOF 4IF4A 4OU0A 3DKWA 2O61A 2HGCA 2HTSA 2IW5A 3HSEA 4BHPA 1U5TA 3B02A 2GA1A 3ZMSA 4YFKF 1Q1HA 2Y0MA 1J0RA 1FZPB 1IAWA 4PDKA 4I98B 4L9TA 4BHCA 3MZYA 2TDXA 4AWXB 5LGUA 3QRFF 1P92A 2QENA 1FP2A 1MDMA 1UB9A 4M9SA 2HKOA 3MEXA 1I1SA 2ZXJA 3FXUA 1T0FA 2FBKA 2M5WA 3IKTA 2FBIA 1S7OA 3KETA 2F2EA 4LLLA 2PMUA 4U7BA 2HYGD 2XAJA 4CZZA 3TO6A 2MC3A 2GXBA 1MDMB 5K5RA 3GX4X 2Y75A 2DQRA 1QZZA 4Q47A 4GGGA 3FMSA 3R61A 1I6XA 5L3DA 4XLNF 4LLNA 5ICEA 1FSEA 1ZYRF 3DEUA 4OIPF 5FGMA 1FP1D 4O3MA 4M9ZA 3JAMZ 4EJTA 1USTA 3C18A 3W6JB 3ZMTA 1G6NA 4BXUA 1ZRDA 4S04A 2O3FA 2HDCA 3GEZA 2IJLA 3VFZA 2RGVA 5F1RA 3E5XA 3TKYA 1V3FA 4XSZF 5AIQA 4UXNA 2JPBA 1BM9A 5L3BA 1YQAA 3Q9SA 2D2WA 1TQMA 5CVRA 2GQQA 2E7WA 5LBQA 5CJ9A 3NEUA 2OA4A 4BHBA 5LRRA 2UZKA 1FPQA 3CO6C 3TO7A 4KICA 4OMYA 5E20A 3AAFA 3LA7A 2Z33A 4MTEA 4EJOA 4FHTA 4LLGF 1LDDA 2MH9A 1JE8A 6PAXA 5HLHA 1DPUA 3ISPA 4HYEA 3SXYA 3BPVA 3DXJF 3I0TA 2YX4A 3LAPA 1FOKA 2IA1A 1REPC 1TLHB 1AWCA 2A3SA 4I09A 4JK1X 4MEYF 2PLYA 1W7PA 2VBWA 3N97A 1TW2A 1BBYA 4NB5A 5F6FA 2WWYA 1GXPA 4I2OA 4AD9A 3MFKA 1J2XA 2DPDA 2NNYA 2EFPA 2GAUA 1NHAA 3BP8A 1ZLJA 1R1VA 4GYIA 4HV6A 1Z05A 2VBZA 3F8NA 3J80K 1DPRA 5FFZA 1B9MA 5IT9Z 3HTSB 4WXCA 3I64A 3FWEA 2PBIA 3P9CA 2ESNA 1YYVA 3RYRA 2ZNZA 2H09A 2ETHA 4Y15A 5ERIA 3LSTA 4HQMA 1ONVA 3R0AA 4LK0F 4YIIA 5L3GA 2FNPA 4LFUA 4WWCA 5ILSA 1BI1A 1QO0D 3HRTA 3T5XA 2H6BA 1XD7A 4ON0A 5H6RA 3WGGA 3N4MA 1ZG5A 3EETA 1IW7F 3WGHA 3T1BA 2DO7A 4R8HA 2QZ8A 2Z99A 3WTTC 2AS5F 1XGOA 4HF0A 1LNWA 2YSRA 3OOPA 1SMYF 3J81Z 2NRAC 2IT0A 2IA2A 2R7DA 1L0OC 1S8NA 3IC7A 3E5UA 4CGZA 2KIUA 2DPUA 2P7VB 3E3VA 1JHHA 1TNSA 1SMTA 3ZPLA 1KQ0A 1TQIA 3QU3A 4CICA 1J9IA 4L9VA 2VBXA 4ENKA 3M8FA 1A04A 2RV8A 4PGHA 4BNCA 1EH7A 1FX7A 3WODF 2F5DA 3Q9VA 2D1HA 3DQVC 5ICCA 4M6YA 3EYYA 2DI3A 2XHKA 5JVTA 2FNAA 2EA4A 1ON1A 3LAJA 3ZP5A 2ZKZA 3ZMZA 4HW0A 4E70A 2VT2A 2YR2A 4HF1A 2V1UA 3HTUA 2RVCA 5DD8A 4EJVA 5D8LB 1Z6TA 2QBYA 4P55A 2OZUA 3JAMK 2DQLA 3RJPA 2OQRA 4LJZF 4G7ZF 1KGSA 3V7CA 3ERED 3QOPA 5ILVA 2IRFG 4IHTA 2W25A 1DDNA 1BJAA 4IPAA 1XN7A 1U8RA 2CYYA 2BEOA 2VC1A 2OZ6A 3HSFA 2V1DA 2DAOA 3GO5A 4MQ9F 4U0WA 3K1MA 3L09A 4R79A 1BIBA 1IN6A 3K1NA 3CUQC 3MQ0A 2K7LA 1D5VA 3B73A 3VOEA 4L9NA 2IVMA 4KMUX 5HDKA 4R1HA 5J8CA 1K7AA 1HQCA 5K5OA 4HV5A 2L01A 3IRRA 3CUQB 4N9IA 1ZARA 3RKXA 3TOAA 3EUHA 3J7AO 2XAQA 3I71A 2MA3A 3K1PA 1IRGA 3DFGA 1IRFA 2O0YA 5DCMB 4H0EA 5BQTA 1FBSA 3QP5A 3U1DA 1YTYA 1OPCA 1OR7A 3EQLF 1SFXA 4KUMA 1O7FA 4JBAA 2A61A 4L18B 4RGRA 5LRSA 2Z3YA 1CGPA 1BI2A 1LEBA 2P5LC 2LF7A 4ENJA 1OKRA 3LQRA 2R7FA 2PJPA 2BBYA 5L3CA 1R36A 2KIMA 4ENNA 3F3XA 3TO9A 2LF8A 2D1VA 2XRNA 4LG0B 2GZWA 3HHHA 2XASA 2G7HA 3TQNA 2ZCWA 2A68F 3CDHA 5FFXA 1MGTA 4O5VA 4MTDA 3WGIA 3P9KA 2Y48A 1OYIA 2CSOA 5HLIA 4B09A 3WU1B 1B9NA 1HKSA 4IHSA 5LGNA 2ZBKA 4KIBA 1S6LA 5TRDA 4MGRA 3QU6A 4ASNA 4B8XA 4YFNF 1ZG1A 2V9VA 3CTAA 1UHWA 3KP7A 3BZ6A 3GUDA 4UNOA 5H20A 3ABUA 2ZMEA 3U9GA 4Y17A 1R22A 4OIRF 5DUKA 3GFJA 4M72A 5CVVA 1K79A 1UCRA 2QUFA 4KIFA 1XDSA 1AOYA 3F8MA 2HFHA 5D5UB 1XMKA 4I02A 3IL2A 2V79A 5KK1A 4M74A 2FQ3A 2ZMEB 1ZHFA 4RAYA 2CFXA 3DP7A 1MJ9A 1KQ9A 3FXRA 1RUOA 5LHGA 1G4DA 1T6SA 2JSCA 4N0BA 3GFIA 1KU3A 3C7JA 4EM0B 2FMYA 1LJ9A 5FLXZ 2VN2A 2PEXA 3NQOA 3GVAA 2GWRA 2ISYA 1ZGJA 3MWMA 2Q8KA 4O6JA 3V7SA 4I01A 3F21A 1R1TA 2VE8A 3JW4A 4I0AA 3ECOA 3GFMA 1FYKA 1KYZA 2BE5F 1SD6A 3R60A 3NRVA 2K4BA 4EM1A 2HQNA 3O2PE 3RDIA 3PQKA 1C0WA 4WXHA 1D3YA 5BPIA 3TDUC 2EFWA 3HRMA 3KZYA 2M30A 2W24A 5JHUA 5LLQA 1IN4A 1W7PD 3KP4A 3V8KA 2A07F 5D8KB 1YS6A 5DUIA 1SAXA 4UUVA 1XB4A 1FLIA 2ZJ2A 1X3UA 1LQ1A 2PI0A 3H3ZA 4BH9A 4EMSA 2QQBA 2VOPA 2RDPA 1YW9A 1FSHA 2NNNA 1RI7A 2R3SA 3JTGA 2EA2A 4G6QA 3ZN1A 3IKVA 4KA4A 4LD5A 3RIRA 2FMLA 2CGPA 3CLOA 2EFQA 3OV8A 5K5QA 2XUBA 5DD4A 1MZBA 4M6XA 3F6VA 5HDNA 3I54A 3HOSA 1J5YA 5DYMA 4G7HF 2DFIA 3WTWC 1XCBA 1YIOA 1YW8A 3EYIA 4WCGA 4L0ZB 3G3ZA 1P4AA 4QLCU 2QQ9A 3BJAA 2KJCA 1LEAA 4KMFA 3FM3A 3PFIA 2ELHA 4RGSA 2J5PA 4U0YA 2KIFA 4UVCA 1FBUA 5E8GA 3T8RA 4HX8A 4WK8F 4XBFA 1Z6RA 1SFEA 2VT3A 3E5QA 2DLLA 5BOXA 2XVCA 4PZJA 3WU0A 2EFNA 4GO1A 3L2CA 2K4JA 1IN7A 5IT3A 1TW3A 2CWEA 4EVIA 3DV8A 3BDDA 3HYIA 4CYDA 3D0SA 4TV7A 2GXGA 1U6GA 4AIKA 4FT8A 1HBXG 5KVRA 1BC7C 3H3UA 2O8XA 1Z91A 3KP6A 5A2QK 3C3WA 5F64A 3KZZA 3M7GA 3HOTA 3TGNA 3SFZA 3COAC 1HSJA 3M9AA 3FMRA 2HOEA 4ZH4F 3WE2A 1WRJA 4ZYGA 3BJ6A 5LGTA 2FA5A 2RC4A 2QLZA 4DQ2A 3DPTA 3O6BB 2VXZA 3BY6A 3HHGA 1R58A 2EFOA 1D8KA 4IVNA 1FNNA 5FLXK 1USSA 2J5OA 3HUGA 3SHFA 4GXOA 2E7XA 1QPMA 3FHZA 3ZMDA 2H94A 1QBJA 2STWA 1HW2A 1SFUA 1BOAA 4ZYEA 1B6AA 4A0YA 1IZ1A 2EV0A 1XSDA 1LB2A 2F5EA 2EV5A 1J7KA 1TTYA 4QWQA 4M73A 2OU2A 1B59A 3BJOA 4IRGA 1WQ2A 1UFMA 2VONA 3HSRA 1P4XA 1K78B 1ZRCA 3DF8A 1TQPA 1WKMA 1I27A 4LB5A 5DCFA 2W84A 2YU3A 1EH6A 1BN5A 1R00A 5E18F 2QWWA 2EV6A 3IWZA 1WI9A 1H0MA 1YS7A 4K2EA 4KFCA 4EV0A 3JSOA 4OIQF 2W57A 3KEOA 3W6KB 3QPTA 4KIGA 3GLXA 2DU9A 4ZZDA 2BV6A 3DPLC 1OYYA 5LHIA 1FBQA 2EJRA 1HKTA 2M8EA 2STTA 1E17A 3GFLA 3PQJA 4CO8A 3CUQA 1T38A 3GZ6A 3FZVA 1V4RA 2A6HF 4KT5C 1IXCA 5HLGA 5DCMA 3D5LA 3ZN0A 3I59B 2V6CA 4GCVA 3BPXA 3I4PA 2VODA 3VB2A 4OOIA
chains in the Genus database with same CATH superfamily
2KT0A 4A3JJ 5F27A 3B6AA 1LE8B 3ABMH 5D6EA 1Z3YA 3KYDB 4CCKA 2HPIA 2DCEA 5JVGF 4A12A 4G6DA 1XPXA 2M87A 3ZMVA 2HTJA 5IY5H 1G2HA 2K3FA 3GMEA 4F91B 4UV8A 4Y13A 4Y7NJ 1EF4A 4LG0A 3F23A 3BQYA 2O6GE 1P7JA 4HLYA 2NS0A 2P5KA 2XAUA 1ERDA 2K02A 4DNCA 3I56I 1FOWA 1I50J 1L3LA 1W4MA 4MQVA 3ZQGA 4KN7X 1TL8A 2HZTA 2XB5A 4BL0B 4XR6A 4NC7A 4BY1J 5LEKA 3HOZJ 2L3DA 4UVAA 1U8BA 2KDOA 4BYYA 2PMHA 3DBHB 4RDUA 3W3CA 2VI6A 3H5RA 2I10A 5DDGA 1CF7B 4RB1A 3P9IA 2CH0A 2QKLB 3VDXA 4FX0A 1OCPA 4EGYA 2XROA 2E71A 5GP9A 3G73A 3WE3A 4XQFA 2XPVA 4XKVA 4NQWA 1BA5A 1JGSA 1UJ8A 3FIWA 3BOQA 4C2UA 3LSPA 1T39A 3HEFA 5E3OA 3LWFA 3O8HA 1KA8A 1HW1A 3E6BA 3FX3A 1X2MA 5K7FA 2WA0A 1WSUA 2OBPA 1Z7UA 1I39A 1PUEE 4ZDOA 1WJ5A 2BW3A 5D5VB 3Q3SA 1YX5A 4YRVA 4CCNA 3LSJA 4A2UA 3I58A 1F4KA 3DBLB 3RTRA 2DMNA 5DTDA 3PNYA 2Z9OA 3SZGA 2K9LA 2CV0A 3RPUA 3W6VA 3IP4B 5J1RA 4WX9A 4ZC3A 1SD7A 1R7JA 3KLOA 2EK5A 1BC8C 4ZYDA 4HA8A 2EWNA 3K4LA 1NK2P 1A5JA 1OISA 4FX4A 4W1UA 4M6VA 3OMYA 2E1OA 4EGZA 5ILUA 4L5JA 4FTHA 4IQJA 2DMTA 2FU4A 3A0HC 3RYPA 3J7ZI 2UXNA 3E97A 5ICFA 3REOA 4XNFA 4XRFA 5A2QZ 3EDPA 2F4IA 2VOOA 2DBBA 2P7CB 2DMPA 2MGQA 4AM3A 3L00A 4G7OF 1XMXA 2JT1A 1TWAJ 1STZA 5CQEA 1P4WA 5FD6A 4RS8A 1YJ9I 3CUOA 3VYSB 1UELB 2DT5A 1O57A 4OINF 3SDGA 4NNJA 1I3AA 2N8GA 4F92B 5EEAA 2E5ZA 1X4OA 5ED4A 2X4HA 1IO2A 1XMAA 3D5RC 4IZZA 5LEJA 3GLLA 3RPQA 3FISA 2L7MP 1T98A 3E6CC 2WV0A 3S17J 3U2RA 2HS5A 5HVQC 5CYVA 2Y9ZA 1MJAA 2NVXJ 1V5GA 2HZDA 2IS1A 2DW4A 4DYCA 2L4AA 2ZFWA 4DYQA 3CC4I 3Q0WA 3AL0C 2L02A 4ZYAA 1T08B 1ZREA 2Q0OA 4A3GJ 2PMZA 1R5HA 5JR3A 1O3SA 5J8FA 3LNQA 5CVJA 5LHHA 1ZN2A 3HOVJ 4JX5A 1D8JA 2K40A 2L0KA 4BJ5C 3MAJA 5J47A 1MMAA 2XC7A 3HOWJ 4XICA 1PJRA 3R4KA 2XKOA 5AONA 4E7KA 1CQTA 5D6FA 1P2FA 1OYWA 4U87A 2JA2A 4FE4A 3JRAA 3AL0B 2R7SA 1GXQA 3PNVA 1EV7A 2NS8A 3Q0VA 2Q2EA 1ETVA 1AA7A 3NWTA 1U5TC 1RIOH 2M0CA 2PG4A 4L9JA 4QSHA 3VODA 4YIFA 1V5EA 1VI0A 3FM5A 1YFHA 3CJQB 1IF1A 2EZHA 3CCVI 4P9UA 3OR1C 3KCCA 2BGCA 1TT5B 3JTHA 2LDUA 2K9MA 2COMA 3GW2A 1Y1VJ 2DOAA 5BNGA 1SC7A 2NYXA 2R0QC 1U5TB 2M7AA 1T0FC 3PL8A 4HAMA 3W2VA 3IWFA 1HXDA 5FD5A 2ACJA 1WWXA 1K4TA 3F8BA 1H9GA 2JZYA 3L2VA 4CHUA 2K9QA 1ODDA 2JSPA 2Y0SA 5L3EA 5GTIC 3BWGA 3I5UA 4Q4ZF 2BVMA 3VPRA 4PCQA 1SVOA 4XLEA 4BS9A 3KP3A 1IG7A 3S1MJ 2BHYA 1WVRA 2L54A 4JX6A 3C1DA 2ZNYA 3CDIA 4YFXF 2MW8A 3FKIJ 5DV5A 1O3TA 2JUGA 2Z16A 2DK8A 2DTRA 4J19A 1ZELA 1SD5A 2B7EA 2CMPA 4UVBA 1IC8A 2FOKA 3VSLA 1O3RA 1X1DA 4D9JA 2DYSH 2PMZN 2K5CA 4DJAA 1I1GA 4RB3C 4II3A 1PP8F 1W0UA 2XAFA 3K4MA 3AG1H 2XPUA 3VEPA 1F1ZA 1MMDA 1Y0UA 2FOWA 1BI0A 2HQRA 2VBYA 2YX7A 4J01A 2QA4I 1R6RA 3E6MA 4G94A 2G7UA 2IA0A 5B5EC 2MBFA 4AU7A 3SZPA 2GIZA 1YE9A 2FEZA 2VPLA 4A5NA 4LB6B 2QVOA 3FHNA 3LL7A 3V8LA 2HOSA 2O03A 3LFKA 4UB6C 4AYBA 3QQAA 4A3MJ 2OTLI 2IPQX 5ICGA 1FYMA 1R4NB 1ZAOA 2JRTA 4XONA 4BQAA 4DOZA 4IXAA 2QCOA 3ELKA 3Q5FA 2IP2A 2ISZA 3K4CA 1G3WA 5D4SA 4B3XA 3RZOJ 4UB8C 4A3LJ 2OCEA 2BZTA 1S7EA 3TMOA 4M9XA 4WF2A 1V54H 2QYOA 2ESHA 4FE7A 4PGGA 3C2HA 1A36A 4ESJA 5GAEJ 2OAZA 1S7AA 1TBXA 4U88A 1R5GA 3ESWB 4X0GA 1F5TA 3IH2A 2DOEA 4RGUA 1XSXA 2E1MC 4MO7A 4B3AA 2JTVA 4CXFA 2AQEA 4RLQA 5IYCJ 1RUNA 4HDVA 3P7NA 1K83J 2CW0F 2X6OA 3KLNA 1R23A 2Y69H 5FO5A 2NVUB 2DA6A 1YO5C 3A01B 2M1BA 1MBGA 4G6TB 5TGTA 1JKRC 2CQ7A 2RNJA 4B1RA 2XAGA 2Y0SN 2OV7A 5C4JJ 3QPHA 3JSPA 1G3YA 2DDBA 2KJBA 4BUPA 4A0ZA 3SYTA 1O7LA 1QVTA 2KPMA 4HOBA 5B1AH 1BIAA 3OYLA 2JPCA 4LK1F 1LFBA 1KU7A 2VQCA 1EH8A 4CDGA 2H6CA 2E1MB 5KCMA 3V8JA 2WTEA 1WJCA 2NVYJ 3W2AA 1HKQA 1JJ8C 2V9PA 2LNBA 5CPRB 5M5WJ 1ZK8A 3FK6A 4HQEA 2OQGA 2IGKA 3OWTA 5HS8A 5BS6A 2EH3A 2ZJPF 2XAHA 5HDGA 2Z5UA 3S2HJ 3D5SC 3K69A 3ZMUA 2X0LA 1LVAA 3KP5A 3VYTB 1JHFA 5TJJA 1Z7LA 1I5ZA 2K3PA 2VQLA 2Y9YA 3CESA 2PQ8A 3R6SA 2L7FP 3FDYA 3ZQ7A 3DEWA 4KDPA 5HS7A 4A69C 5C3EJ 2ZFUA 3TW6A 3BROA 1SVLA 4AYBN 1JTYA 4MNUA 1X2NA 2HXOA 1XGMA 4Z2YA 2R5ZA 3HXLA 2P6TA 3CCLI 1ACIA 2HYFA 4AIHA 3GTJJ 1KU2A 1U9OA 3QAHA 1ZLKA 1MMGA 1VF9A 3FMQA 3IRQA 2IEKA 3CCQI 4E7LA 2FBHA 4KN4X 1SD4A 1AU7A 1SANA 1Y1WJ 2UXXA 2IGMA 1TNTA 1H8AC 1FY7A 2CO5A 4A3BJ 1MNDA 3BR0A 2MLGA 2E1NA 4MFEA 1A35A 4A0XA 1W7PB 2K27A 2RQPA 4L0YB 3WG9A 1DUXC 2EBIA 1RZ4A 1IXRC 1SVMA 2VJ4A 5L3FA 3S2WA 4S05A 2EZLA 1MD0A 1RNLA 5JFRA 2P4WA 3CCMI 2F4MB 2KL4A 3GF2A 2DA7A 2KKOA 1W1WE 3TDZC 2L4MA 2UWMA 3IHUA 2MLKA 3OYAA 1AKHA 1IUYA 1Y8RB 2F5CA 3F6OA 3GXOA 1QZYA 4KYWA 4C3JJ 1T56A 3CP2A 5EDNA 2O7OA 4P96A 3KFWX 1FT9A 3SQNA 4EJUA 3S3MA 1D1BA 2QF7A 2F4OB 2AXTC 2HQAA 2XIGA 1MBKA 1Z0XA 1ZKGA 2HQ5A 2ZXHA 4LGWA 1X3WB 1O3QA 1B4AA 3K9TA 4G9YA 3PUFA 2VQGA 1MJBA 4P9FA 1JXSA 2EQRA 3QOEA 1X19A 4P5OA 2WBMA 3RKWA 5BPDA 1F36A 2RN7A 3QPLA 2DA5A 2G9WA 4ZJZA 4G8XA 2DYRH 1U3EM 2QQAA 2LSOA 4A6EA 2LKPA 3L7WA 3CO7C 5DEQA 1HW5A 1K78A 3OYBA 3V42A 5M3MJ 2IGOA 3OS0A 1D0XA 4CSWA 1TWCJ 4AVPA 1D1AA 3M8EA 1KYWA 4YEJA 2PX9A 2LVSA 3O8GA 5CVIA 3DCFA 1BI3A 2FSWA 4RB2C 2JA7J 4UHTA 2W85A 5HOOA 2QSFX 3FBNB 3F8CA 1W36D 4HBLA 4M3GA 1YHQI 1X3ZB 5J3LA 2L7KA 4I76A 2XF5A 1GVJA 3ULQB 4RB0A 1QGPA 3O3KA 1ITYA 2LD5A 1XCVA 1J59A 5E17F 2A6TA 1IXSB 1MH3A 3BR1A 3GCMA 3GTKJ 3VYUB 2JUCA 2MH2A 3ROUA 2VJIA 5LD2C 5FJ8J 1EJ9A 1XGNA 1JJ6C 5J6XA 2L5QA 4D1QA 2JN6A 2CQKA 5E1ZB 3LQQA 3RSNA 2F5FA 1QU3A 1A6QA 3ZRGA 3LSGA 1UG2A 3T8TA 2A5YB 2RKHA 2CV1A 1PP7U 2FXAA 3S15J 4RGXA 4XSXF 2GIVA 4NC6A 1ON2A 3ZXSA 3OIQA 3WTVC 1X1PA 1QHHD 2L9NA 2YPRA 2P8TA 3LA3A 3K2ZA 4OMZA 3ZQQA 1H9TA 3F8FA 2DFHA 2VUMJ 3M1EA 3WTYC 1DP7P 4BQOA 1VTNC 1U78A 4CYCA 4ZZLA 4BDYA 1Y39A 4ZYHA 2WV1A 3WTXC 5AIPA 5D5XB 1HSTA 1JKOC 2E1CA 5FB2A 5D5WB 1FWZA 2GLOA 2FF4A 1MH4A 3JRGA 4Z6YA 5FRNA 3KE2A 1S3JA 3WTSC 3RKYA 3QPSA 2KIQA 4ABZA 2I8DA 4EJWA 2R5YA 1YG2A 1U2WA 3HIFA 3DBRB 1G8XA 4CCLA 3CC2I 4ETSA 4HLXA 1JTXA 3I59A 2OD5A 4ENMA 3PSFA 3G71I 2RAEA 4BQQA 3R0JA 3DTEA 2V1NA 3HBLA 3SZTA 1KU9A 1PDNC 3WTZA 2W00A 1BR4A 4DBQA 2PN6A 4HDUA 3CCSI 2XV4S 1QPIA 1W0TA 4IRIA 4Y3OA 1LE8A 4I0BA 5BMZA 2Z2SB 5CLSA 2QBYB 3OYKA 1LDKB 1NG6A 4G12A 1OCCH 5CVUA 2B0LA 4I7HA 1XGSA 2ECCA 2MD5A 5D4RA 3MCZA 3DLAA 2XKPA 5JI6A 1J09A 2ZXIA 4A6DA 2BY3A 2EIJH 2R5YB 2P5VA 3HRSA 4F7ZA 2ZC2A 1LDJA 2KFDA 3PIOF 1OMIA 1W5TA 4RM3A 4IX7A 3GTQJ 2CW7A 2H1KA 4IJAA 5FKMA 3BG9A 2GXAA 4RAZA 3RPUD 4YG2F 5IYDJ 2EB7A 3W2WA 4XLPF 1QA6A 3HC7A 2WAEA 4C30A 4HPQA 2P81A 1UAAA 1XDUA 1IDZA 3F72A 4EM2A 2W7NA 4J00A 4IKFA 3MZHA 2F5VA 5GADJ 4AIJA 3WTUC 2ZO4A 1UZCA 3ECHA 4XOTA 2YU9J 1G3TA 1J75A 3BQZA 2JMWA 4MEXF 4ESBA 4Q48A 5E1XA 2FE3A 1IN5A 1IJWC 2X1DA 1FYLA 1DU6A 2EZKA 2HYJA 3QYBA 5H6QA 1R71A 2HDDA 1QVUA 5EEGA 5IPAA 2VE9A 1IRZA 1W5SA 2CUEA 2V1XA 4HX7A 2XPWA 3HJEA 3S8PA 3RI4A 1CF7A 2OPTA 3F22A 4JX4A 3IV5A 2PFBA 1ZRFA 4WXDA 2VL8A 1B1BA 1WGXA 3ABTA 3EUHC 4HF2A 3GZ5A 3BT9A 2XDVA 3K4JA 2LKXA 2KP6A 4GYGA 2DK5A 2NXNB 2VJJA 2DODA 4N9HA 1S29A 4C3IJ 4Q5SF 1F9NA 2NAZA 4XLAA 3UKGA 1XSVA 3QYEA 4NHJA 2KRCA 4FCYA 3KPHA 2JA8J 1S72I 4ESFA 4D0PA 2X6YA 2KRFA 2B9SA 1ETQA 3HGGA 4L5IA 3OYDA 2MYSA 2QM3A 3JRDA 2D45A 2HU9A 1D1CA 3VWBA 5E1WA 4HSRA 4IL6C 5M5YJ 1OR7C 2EPFA 1ZH5A 1MKMA 1R1UA 3K0LA 3KEQA 4JQFA 1MBEA 1ULYA 2A6EF 3FF5A 4LITA 2HWVA 4LMYA 1HDDC 2HEOA 3LA2A 4MHGA 2M0MA 1HF0A 2FRHA 3Q0UA 3H9GA 2ID6A 1YW7A 3DKXA 5E8IA 1XTAA 2GA2A 1UMQA 4HZFA 3L9FA 4BAYA 4A5MA 4U0VA 4IRHA 3QP6A 4HX4A 1T95A 1WJEA 2ZXWH 3L2WA 5IT9K 2LY9A 3FXJA 2OTJI 1ZG3A 1FC3A 5HS9A 3JRCA 3GYHX 2QEXI 3RCOA 3TOBA 3V4GA 1MSEC 1MBHA 1RC9A 1GHCA 3KP2A 4UV9A 3M8JA 1P6RA 3GTLJ 1KQ8A 2HKXA 3AG4H 3GWZA 4M71A 2M8GX 5CKTA 3H92A 9ANTA 5K1YA 3CCEI 5H2FC 3BR2A 3FXQA 2HR3A 3HRUA 1QNTA 3ML6A 5J1YA 2VC0A 2P6SA 3OSGA 1G3SA 1VQ5I 1K6OA 2M7BA 2X48A 1Z9CA 3OL4A 3FXKA 3H3VK 5IP6A 2WC2A 2A69F 3CMEI 3J80Z 5JLXA 2AXLA 4QTRA 2CG4A 2KMUA 3MVPA 2K86A 3HL2A 4XKBA 1QQIA 3I53A 2ME0A 1ZGAA 3CJTB 3E6DA 3J81K 1D0YA 1AHDP 2H27A 1IN8A 4RAGA 3CJNA 3OYCA 5M3FJ 1UHMA 2BYVE 1IGNA 2W82A 3ERMA 2ADUA 4EQQA 3JR9A 1RRJA 4CH7A 5EEHA 1XX5A 3T0YA 2ZMEC 1YLFA 3H1CA 2C6YA 3J7AY 2BOLA 5B1BH 3PIPF 4KNYA 3I4NJ 4U7DA 2XGXA 3V7RA 2M45A 1GDTA 1E2XA 2M3AA 1T2KA 1Z1DA 4XKWA 3CMMA 4OIOF 4IF4A 4OU0A 2YS9A 2Y30A 3DKWA 4GRIA 2O61A 2HGCA 4BY7J 2HTSA 2IW5A 4NBQA 3I9V2 3HSEA 3ZQIA 4BHPA 1U5TA 3B02A 2GA1A 3ZMSA 3WG7H 4YFKF 1Q1HA 2Y0MA 4A3EJ 1J0RA 1UG0A 1FZPB 1IAWA 4PDKA 4E4HA 4AUXA 4P1WA 4DZPA 1A6IA 3HM5A 4I98B 5F1JA 3CQZJ 1IUFA 4L9TA 4BHCA 3MZYA 1VQPI 3ZCOA 2TDXA 4AWXB 5LGUA 1UHSA 4RLFA 3QRFF 1P92A 2QENA 1FP2A 1MDMA 4NUBA 1ETKA 1UB9A 3IH4A 4M9SA 2HKOA 4LOCA 2MABA 3MEXA 1B72B 1I1SA 4B48A 2ZXJA 1I6HJ 3FXUA 3ZGKA 1T0FA 2FBKA 2M5WA 1OLTA 3U1KA 3IKTA 1Y6IA 2FBIA 5EGOB 3HOUJ 1S7OA 3KETA 5HODA 4BXXJ 2F2EA 2WAQA 4LLLA 2RQQA 2PMUA 4U7BA 2R93J 2Y2ZA 2HYGD 2K9SA 2GOMA 2XAJA 2M4KA 3MZ8A 1OCTC 4CZZA 2DA3A 3H0GJ 3TO6A 3OIOA 1TZLA 3P5JA 2MC3A 2GXBA 1MDMB 5K5RA 3GX4X 4E7IA 2Y75A 1FIAA 3G1LA 4UUSB 3ASNH 3BCAA 2DQRA 1QZZA 2X1CA 3S1NJ 3EUKL 5HLTA 3CCRI 2HDWA 2ECBA 4Q47A 4GGGA 2CUZA 3FMSA 3A1YA 3R61A 3WHBA 1I6XA 5L3DA 3BTIA 4XLNF 4DW6A 4C2TA 1WI3A 2O9LA 4LLNA 5ICEA 5J4VA 5JLWA 1XS9A 1FSEA 4BKXA 1RR8C 1ZYRF 3DEUA 3IAM2 4OIPF 5FGMA 4GDFA 1FP1D 4E7HA 3ABKH 1NH3A 4O3MA 2DMQA 4M9ZA 5KNLA 1JUSA 3A4CA 3JAMZ 4EJTA 3C18A 1USTA 3S16J 1GV5A 5E3LA 4QPOA 1LUJB 3W6JB 2K85A 3ZMTA 3CF5F 3FKJA 3BLYA 2NVTJ 2LREA 1G6NA 3L2QA 3I4MJ 2HPMA 4BXUA 1D0ZA 5IP7J 4S04A 1ZRDA 3C2GA 2CQXA 3A01A 2O3FA 2HDCA 3GEZA 1FJLA 2IJLA 1ETOA 3VFZA 2RGVA 5F1RA 3PO3J 4M3EA 4BGDA 2LR8A 2DFFA 3GTOJ 2M2EA 3E5XA 2MC4A 3TKYA 1V3FA 3SDBA 4XSZF 4BACA 2JVHA 5AIQA 2W48A 3ASOH 3A02A 4UXNA 1JKPC 1APLC 3PUBA 4YIRX 2JPBA 5CQGA 1BM9A 2LBFA 5L3BA 1W5CC 1YQAA 4OAYA 3Q9SA 2D2WA 3DKYA 1TQMA 2GOXB 2LY1A 5CVRA 2GQQA 2E7WA 5LBQA 4IHVA 5CJ9A 3NEUA 2OA4A 2WAQN 4BHBA 1FTTA 1IRXA 2O8KA 2UUZA 5LRRA 2UZKA 1WJAA 1N77A 1FPQA 5B3SH 4RBOA 5IP9J 1QZEA 4IQ4A 3CO6C 1TWHJ 2E35A 3TO7A 3OYIA 3SEZA 4HEA2 2HVRA 1E0EA 4KICA 1E3HA 4OMYA 4PFPA 3RQ4A 5E20A 1BW5A 3AAFA 4V2FA 3LA7A 4BXFA 2Z33A 3LFUA 4PSXA 4MTEA 2LBFB 4BJ6C 1MW7A 2CFOA 3S1RJ 2DN0A 4EJOA 1M1EB 4FHTA 4LLGF 4PUSA 1LDDA 2MH9A 5HNHA 1T8IA 1JE8A 6PAXA 5EF6A 5HLHA 4XRSA 1DPUA 3ISPA 4DBRA 3SFIA 4HYEA 3SXYA 4HNVA 3RQIA 2CUJA 5EG0B 1DP3A 5J4YA 3BPVA 3DXJF 2KZVA 2CRGA 3I0TA 3TBIA 2YX4A 2I5UA 3LAPA 1FOKA 2Y31A 1X4PA 2H1LA 2IA1A 1REPC 1TLHB 2Z1DA 1AWCA 1PVEA 5EYRA 2A3SA 4I09A 4JK1X 5KAIC 4MEYF 2PLYA 1W7PA 2IS2A 4HNUA 2VBWA 1YJNI 3VSKA 3N97A 2P0WA 3QYFA 4FISA 2LP0A 1BL0A 1ZTRA 5C44J 1Z67A 1TW2A 3G1OA 1BBYA 4NB5A 5F6FA 3BG5A 1JUMA 2WWYA 3S3NA 3GTGJ 1HOMA 1GXPA 4I2OA 4AD9A 3IH3A 1NK3P 3MFKA 2BVLA 1J2XA 3JREA 3BC8A 2DPDA 2XGDA 1D5YA 2NNYA 1V55H 3BG3A 3DU5A 3PJRA 3MKLA 2EFPA 2OUMA 2R7OA 2XSDC 2GAUA 3OYHA 1NHAA 5IYBJ 3BP8A 1ZLJA 4I99C 1R1VA 4GYIA 4HV6A 1I3QJ 1Z05A 2VBZA 3F8NA 3BG7A 1U9NA 4CZCA 2ME6A 5K7HA 2BY1A 1DPRA 3J80K 5FFZA 1B9MA 3K70D 5IT9Z 1RR7A 3HTSB 2L9SA 4WXCA 3I64A 3FWEA 2PBIA 1MBJA 3P9CA 3OY9A 1HCRA 2ESNA 1YYVA 3RYRA 4PJMA 2CQQA 3RKQA 2ZNZA 2H09A 4MIMA 2ETHA 4Y15A 1HDPA 2VKHA 5ERIA 2VPRA 4HSTA 3LSTA 1Y8QB 4HQMA 1O4XA 1RPWA 1ONVA 3R0AA 4LK0F 4YIIA 1JKQC 4RMNA 2Q1ZB 1MBFA 2DMUA 1VNDA 5L3GA 5E3MA 2FNPA 5FLMJ 4LFUA 4WWCA 5ILSA 1E3OC 1BI1A 1EKEA 1GLNA 1QO0D 3F0CA 4KT6A 3HRTA 2QSHX 3T5XA 3EPZA 2H6BA 1BR2A 1XD7A 4ON0A 5H6RA 4MLOA 3WGGA 3BTLA 3N4MA 1ZG5A 1MSFC 3EETA 1IW7F 3KYLA 2KDZA 3WGHA 3T1BA 2DO7A 2TCTA 4BU2A 2BXYA 1EA3A 2A05A 4R8HA 2QZ8A 2Z99A 3WTTC 2AS5F 2BY0A 3FBIB 1XGOA 4HF0A 4PK4A 1LNWA 1FMWA 5EJCA 2YSRA 3HPGA 3OOPA 1SMYF 1BOBA 3J81Z 2NRAC 2IT0A 3A03A 2IA2A 2R7DA 2XF7A 1L0OC 1S8NA 1SFKA 1S5LC 2F48A 1IV6A 2WY7Q 1YX3A 1WH5A 3IC7A 2KZGA 4D7NA 2R7WA 3E5UA 4CGZA 4BE0A 2KIUA 2CS3A 2JVGA 2P7VB 2DPUA 3E3VA 3UNGC 1JHHA 4V19K 1TNSA 3JCUC 3GZNB 1SMTA 1OCRH 3ZPLA 1KQ0A 1TQIA 3QU3A 4C2MJ 4CICA 1J9IA 4L9VA 1SAUA 2VBXA 3G4SI 5HNFA 4ENKA 3M3YJ 3CCYA 3M8FA 1A04A 5M5XJ 2RV8A 4PGHA 1TWFJ 4BNCA 1EH7A 4UY8I 5B66C 1FX7A 2AQFA 5FKKA 2HNHA 3WODF 1IDYA 1VQKI 4ZTFA 2F5DA 1JT0A 4A3CJ 3Q9VA 2D1HA 3DQVC 5ICCA 4M6YA 3FXMA 3C2BA 3EYYA 1R4MB 2DI3A 2XHKA 1FIPA 3NWSA 2JJ7A 5JVTA 5DM6F 2FNAA 1F43A 2EA4A 1ON1A 3LAJA 3ZP5A 3HUGB 4B47A 2ZKZA 3ZMZA 4HW0A 4E70A 2VT2A 1VQ9I 2YR2A 4HF1A 2E34A 2V1UA 1ETWA 2BHZA 3HTUA 2RVCA 5DD8A 3HZJA 1GT0C 2JA6J 3S1QJ 4EJVA 2DXIA 2V26A 5D8LB 2XGCA 1Z6TA 2GM4A 3CZ6A 3HKZN 2QBYA 4P55A 3ZQHA 2VQHA 2OZUA 3JAMK 2DQLA 3RJPA 2WB1N 3ZOBA 1U0JA 2DJNA 2OQRA 2DOFA 4LJZF 4G7ZF 1KGSA 2QKMB 1WPKA 3WU2C 3V7CA 3ERED 3QOPA 1LFUP 2FQ4A 5ILVA 2IRFG 4IHTA 2W25A 2VB6A 4H4KC 4B43A 3L2RA 1DDNA 1BJAA 1SFOJ 2KLOA 4IPAA 5JHFA 2IAIA 1XN7A 3HG9A 3CCJI 2CU7A 1U8RA 2CYYA 2BEOA 2IS6A 2VC1A 1K4SA 1QHGA 2OZ6A 3HSFA 4RAFA 2NVQJ 1RESA 2V1DA 4E7JA 2CV2A 1R49A 2E36A 2DAOA 3GO5A 3AFHA 4MQ9F 3OYFA 4M3DA 4U0WA 2V4JC 3K1MA 3L09A 5E3NA 4R79A 5EZHA 1BIBA 1IN6A 1GV2A 4Y33A 4PJNA 5GAHJ 3K1NA 3CUQC 2DJIA 2LLKA 3MQ0A 2LFBA 1XG1A 2HXIA 4B44A 2K7LA 2NOJB 1D5VA 3B73A 3BR6A 4L9NA 3VOEA 2IVMA 4HNTA 1DU0A 1GUUA 4JOMA 2OCCH 4KMUX 5HDKA 4R1HA 5J8CA 1PUFB 1K7AA 1HQCA 5K5OA 3QODA 3F9KA 4HV5A 3PO2J 3MN2A 2COBA 2L01A 3PSIA 3IRRA 3CUQB 3DWLE 4N9IA 1ZARA 3RKXA 3OYGA 3TOAA 3OYMA 1BR1A 4BBSJ 3EUHA 1JGGA 4BEHB 1W36C 3CF2A 1B8IB 3J7AO 1FOYA 3H0DA 2XAQA 3I71A 2KHMA 1LKXA 3HB9A 3S3OA 2MA3A 2E2JJ 1YJWI 2FJ1A 2A5WA 2LY2A 3K1PA 1IRGA 2MSYA 2AO9A 3DFGA 4XM3A 2OC6A 4F93B 1IRFA 2O0YA 1HLVA 5DCMB 4H0EA 3RZDJ 2E5NA 1HC8A 2R7TA 5BQTA 1FBSA 3QP5A 3U1DA 2ZJQF 1YTYA 1OPCA 1OR7A 2EILH 3EQLF 1SFXA 1T33A 2LTPA 4KUMA 1O7FA 3MD2A 4B4CA 3L1PA 4JBAA 2A61A 3TEDA 4JP0A 3M07A 3H5NA 1KZHA 1V5FA 2M34A 1GVDA 4L18B 2LMDA 4RGRA 5LRSA 2Z3YA 1OCOH 3DU6A 1BI2A 1CGPA 1LEBA 2VJ5A 1ZR4A 2P5LC 2LF7A 4ENJA 1OKRA 1FMVA 3LQRA 5FKNA 4IHWA 2LOOA 4EEFG 1ORKA 2R7FA 2PJPA 2BBYA 4A3FJ 5L3CA 1R36A 5DM7F 2F6CA 2KIMA 4ENNA 4DIQA 3F3XA 4HRIA 2LYCA 1WFXA 3TO9A 2LF8A 2D1VA 2XRNA 4DGWB 4LG0B 2GZWA 2EIMH 3HHHA 4PJJA 2LH9A 2XASA 1Y0NA 1TP4A 2G7HA 3TQNA 4CCMA 1TC3C 1YOVB 3CC7I 2ZCWA 4FASD 2A68F 4LIUA 2AHQA 4ZDPA 3CMYA 1Z3XA 3CDHA 4XRSG 5FFXA 2R4GA 1MGTA 4O5VA 1JUPA 2ID3A 4D5FA 4MTDA 1K61A 3WGIA 2JWTA 2XRLA 2GBYA 2MD0A 3P9KA 2Y48A 1OYIA 3LSHA 2CSOA 3OL3A 3OS1A 1WJFA 2CJJA 4XIDA 3H35A 1R5ID 2DA4A 5HLIA 4B09A 2LG4A 3BR5A 4S0HB 4NQWB 3WU1B 1B9NA 5GAGJ 2FX0A 1HKSA 2RNGA 4IHSA 5LGNA 1RETA 2ZBKA 4KIBA 4BE2A 3BTCA 2KQRA 1YIJI 1S6LA 2X6WA 5TRDA 4MGRA 3ONQA 3QU6A 4ASNA 3CCUI 2X51A 4B8XA 2CW8A 2XSJC 4YFNF 3HDDA 1H88C 1ZG1A 2BW3B 2V9VA 5GTHC 1MMSA 3CTAA 1UHWA 4F3QA 3KP7A 2DT6A 3BZ6A 3GUDA 4UNOA 5H20A 3ABUA 2ZMEA 3U9GA 4Y17A 3I55I 1R22A 3A0BC 2LKSA 4OIRF 4IOCF 3IAS2 5DUKA 3GFJA 4M72A 5CVVA 1K79A 1Y56A 3K2AA 4OWRB 3OOUA 1UCRA 1OQYA 2FD5A 1XDSA 2QUFA 4KIFA 3ZR8X 4N4OB 2UV1A 1OCZH 2IS4A 3PFYA 1E3PA 1B72A 1AOYA 2EINH 4I6ZA 3K4BA 1MNEA 3F8MA 3KX2A 2HFHA 5D5UB 1XMKA 4I02A 3OS2A 5EGOA 3IL2A 2V79A 3DPUA 5KK1A 4M74A 4NDLA 1X1AA 1NTCA 2FQ3A 2ZMEB 1ZHFA 3J7YJ 4RAYA 2CFXA 2G0EA 2VXDA 3DP7A 1MJ9A 1KQ9A 3FXRA 2DDAA 1WZ2A 3KEYA 4XK4A 3GBGA 1RUOA 5LHGA 1G4DA 1T6SA 1Z77A 2JSCA 4N0BA 3GFIA 2R7VA 3X2QH 1KU3A 3C7JA 4KJZA 4EM0B 2FMYA 1LJ9A 5FLXZ 2VN2A 4UUSA 1R9TJ 2PEXA 2JRMA 2X9DA 3NQOA 3GVAA 5EZGA 3JRFA 2GWRA 2ISYA 1ZGJA 3ZQFA 3MWMA 3ZQLA 1A31A 2Q8KA 3CLQA 4O6JA 3OYEA 2EIKH 5F0HA 1N75A 2L7ZA 3V7SA 1JI8A 4I01A 2R7UA 3F21A 1R1TA 4BQNA 2VE8A 3JW4A 3ZQCA 4FETA 4I0AA 1H89C 3ECOA 3LSRA 2IBDA 4DYRA 3GFMA 1FYKA 3OR2C 1KYZA 2OJED 2X6XA 2BE5F 1SD6A 2IXSA 3R60A 3NRVA 2K4BA 4E7ZA 4EM1A 2HQNA 4KITB 3O2PE 1HA8A 3RDIA 3PQKA 1MIJA 3HOXJ 2Q2EB 3BZCA 1MMNA 2DT7B 3OYNA 1C0WA 4WXHA 2L2OA 3B6CA 5KHDA 2R92J 1D3YA 3D1NI 5BPIA 3TDUC 3S2DJ 2EFWA 3HRMA 3KZYA 1LPQA 4QIWN 2M30A 2W24A 1WJDA 1N78A 3NARA 2KRHA 5JHUA 3DLLF 5LLQA 2DFEA 1IN4A 1W7PD 1G59A 1WHUA 4PJ0C 2LRDA 4XMYA 3KP4A 3M1CA 3KZIC 3V8KA 4BE1A 2A07F 5D8KB 1YS6A 5DUIA 1SAXA 2ICWG 4UUVA 3MKYB 1XB4A 5K7ZA 5F0CA 1FLIA 5F0FA 2ZJ2A 1X3UA 2PJRA 2KISA 3BCBA 3SJMA 1LQ1A 2XF6A 2PI0A 1S9HA 1TT0A 3M4OJ 3H3ZA 4BH9A 3ABLH 4EMSA 1VFCA 2QQBA 2VOPA 2RDPA 3HOYJ 3PNTA 3CMAI 2BXZA 4D5CA 3H5AA 1YW9A 4CCOA 1OFCX 3PM1A 1FSHA 2NNNA 1ZR2A 3H9JA 1RI7A 2R3SA 3JTGA 2WY8Q 2EA2A 4G6QA 4AVZA 3ZN1A 3MKZA 3KYCB 5FRMA 3DTIA 2H8WA 1KONA 3IKVA 3WHCA 4KA4A 2MG4A 2E2HJ 3LSKA 2VKVA 5LFAA 4LD5A 1ZGWA 1TWGJ 3DEEA 5C4XJ 3RIRA 5EG0A 4AIDA 1N25A 2FMLA 2CGPA 3CLOA 2PJRB 4HG2A 3I3LA 2EFQA 2ZSIB 4BJTA 3OV8A 5K5QA 2XUBA 5DD4A 1MZBA 4M6XA 4ZDLA 3F6VA 5HDNA 4C9YA 3JRBA 3FK7A 3I54A 3HOSA 1J5YA 2ELJA 1DQUA 5DYMA 4G7HF 2DFIA 2VASA 3K4NA 4BBRJ 3WTWC 4M3BA 2HVSA 1XCBA 3MMYB 3EUAA 1YIOA 1Q1VA 1YW8A 3EYIA 2M4GA 3AKZA 2ZSHB 4WCGA 4Y4RA 1IV8A 4L0ZB 2O5RA 1XC5A 3G3ZA 4XLFA 2YUSA 4XL9A 2FUG2 4PSWA 3S14J 1P4AA 5GPAA 4QLCU 2V7FA 2QQ9A 2RREA 3BJAA 2KJCA 1LEAA 4KMFA 3FXLA 3FM3A 3PFIA 3LOCA 2ELHA 4RGSA 2R7XA 1WJBA 5KAFC 2J5PA 1P7IA 4U0YA 3S32A 2KIFA 4UVCA 1FBUA 5E8GA 3SEQA 5F08A 1VQNI 3MKWB 3T8RA 4HX8A 4RM2A 2E60A 4WK8F 1LVKA 2X1EA 4XBFA 1Z6RA 1YI2I 2ELKA 1SFEA 2JQ7A 2VT3A 2M9HA 1MNMC 2B63J 3E5QA 2DLLA 4D7MA 2HOTA 5BOXA 5FKLA 4F52A 5J40A 3OSFA 2QSGX 1RKTA 2XVCA 4PZJA 4KISA 3E1SA 3WU0A 2R7ZJ 2EFNA 1QRYA 3AG3H 4GO1A 3L2CA 2K4JA 2OF7A 2DTZA 4AC0A 1IN7A 5IT3A 1TW3A 2CWEA 4EVIA 3DV8A 3BDDA 3HYIA 4CYDA 3D0SA 4TV7A 2GXGA 1U6GA 3TW7A 2MFZA 3K4KA 2W4SA 4NC8A 4L5EA 4AIKA 3A2KA 1VQLI 4FT8A 1HBXG 5KVRA 4YELA 1BC7C 5J1UA 3H3UA 2O8XA 1Z91A 4ZTJA 3KP6A 5A2QK 1DGWY 3C3WA 3JRIA 2CUFA 3U21A 5F64A 2WADA 4BDZA 4V2GA 2VIXA 3KZZA 3QWLA 4XLCA 3M7GA 3HOTA 3FXOA 3TGNA 2JK3A 4A93J 2R5ZB 2HVQA 3SFZA 3COAC 3JRHA 1HSJA 3M9AA 1VQ8I 3FMRA 3HKZA 4EATA 1BJZA 2HOEA 4ZH4F 3WE2A 4IEJA 2QGUA 2WB1A 5E79C 1BW6A 1WRJA 4ZYGA 1YRNA 2DA2A 3BJ6A 2IGNA 5DS9A 3G1MA 5LGTA 2FA5A 2R7QA 4XLHA 2RC4A 2R7RA 2QLZA 4XN0A 4DQ2A 3DPTA 2VKEA 3O6BB 2VXZA 3BY6A 3HHGA 1ETXA 1R58A 3IUOA 3BZKA 5TISC 1VQ6I 2EFOA 1D8KA 4IVNA 2V9KA 4CCJA 2VKDA 2ZB9A 1FNNA 4C3HJ 4IHXA 1Z21A 5FLXK 1USSA 2J5OA 3HUGA 3SHFA 4GXOA 2E7XA 1QPMA 4IOAF 3FHZA 3ZMDA 4XORA 2VLAA 1P9QC 3AG2H 4IO9F 1AKHB 2H94A 1X1BA 1QBJA 2STWA 1YRNB 2QQ8A 2JA5J 1HW2A 2XGEA 4N4NB 1OJLA 1VQ4I 1YITI 3K10A 5FLVA 4OAZA 1SFUA 1BOAA 3DTKA 4ZYEA 4LG3A 2W1OA 1B6AA 4A0YA 4PJLA 1IZ1A 5IOZA 4A3KJ 2EV0A 4FQGA 3OIPA 1FEXA 3OYJA 1XSDA 1LB2A 2F5EA 4IHYA 2CQNA 4MFDA 2E2IJ 2EV5A 1J7KA 3K7AJ 4Y52J 1TTYA 4QWQA 1VQ7I 4LIVA 4M73A 1ETYA 2OU2A 2L9VA 1K6YA 4GFBA 1B59A 4A3DJ 3BJOA 3E0JB 4IRGA 1FTZA 1WQ2A 1UFMA 2VONA 3HSRA 2NS7A 1P4XA 1K78B 1WCMJ 3CDLA 3BR3A 4M3FA 1ZRCA 5F04A 3DF8A 1LFPA 1TQPA 4X1EA 1WKMA 4X6AJ 3LSIA 1I27A 3CJRB 4II2A 4LB5A 1PYVA 5DCFA 2EZIA 2W84A 2LC2A 1DGRM 2YU3A 3LMMA 1EH6A 4CUGA 3G6EI 1BN5A 1R00A 5E18F 4E6KG 1FOXA 4XOPA 2QWWA 3LSMA 3H9QA 2EV6A 2K9NA 3IWZA 5FKOA 1WI9A 1H0MA 2DA1A 1YS7A 4UUTA 1WH7A 3E7LA 3K70C 4PFOA 4K2EA 2WAFA 3UR3C 2V6EA 4KFCA 4EV0A 3JSOA 1ENHA 2H8RA 4OIQF 1SEUA 4CA0A 1NG7A 3L2UA 4A3IJ 2LK2A 2W57A 3GTPJ 3HPHA 3KEOA 4ITVA 1VQMI 3W6KB 3QPTA 2HOAA 4KIGA 3N05A 3BTJA 3GLXA 3TP0A 2DU9A 4ZZDA 2BV6A 1PUFA 1X58A 2L9RA 4DZJA 1X1CA 2TRTA 3DPLC 5FROA 3K6GA 4XRMA 1OYYA 5LHIA 1FBQA 1ZQ3P 2EJRA 4QPQA 1HKTA 1JT6A 2X85A 2M8EA 2ZJRF 2STTA 1E17A 2NOGA 3GFLA 3PQJA 3HGYA 2BY2A 2D5VA 4CO8A 3CD6I 3CUQA 1T38A 4ANJA 3GZ6A 2XB0X 4BEHA 1VZ0A 3FZVA 4F55A 1B8IA 4W97A 4CYCB 4XN3A 1V4RA 2A6HF 4KT5C 1IXCA 2E19A 3TP3A 3BG6A 3G2BA 3KIOA 3NAUA 4JYKA 4E7SA 5HLGA 5DCMA 5GPCA 4RA2A 2HI3A 3D5LA 3VYRB 3ZN0A 3I59B 2V6CA 3TL4X 3GTMJ 3CP8A 4GCVA 3BPXA 5IOYA 3I4PA 4XKCA 3S93A 2VODA 1VQOI 1RKWA 3VB2A 3H36A 4OOIA 1POGA
chains in the Genus database with same CATH topology
5D6EA 4A12A 4G6DA 2M87A 3ZMVA 2HTJA 4UV8A 4Y13A 4LG0A 3F23A 2O6GE 4HLYA 2NS0A 2P5KA 2K02A 4DNCA 1L3LA 1W4MA 4MQVA 4KN7X 2HZTA 5LEKA 2L3DA 4UVAA 4BYYA 2PMHA 5DDGA 1CF7B 4RB1A 3P9IA 4FX0A 4EGYA 2XROA 3G73A 3WE3A 4NQWA 1JGSA 3BOQA 1T39A 3LWFA 1KA8A 1HW1A 3E6BA 3FX3A 1WSUA 2OBPA 1Z7UA 1PUEE 5D5VB 4A2UA 1F4KA 3I58A 3RTRA 2Z9OA 3RPUA 4WX9A 1SD7A 1R7JA 3KLOA 2EK5A 1BC8C 4ZYDA 4HA8A 2EWNA 4FX4A 4EGZA 5ILUA 4L5JA 2FU4A 3RYPA 2UXNA 3E97A 5ICFA 3REOA 4XRFA 5A2QZ 3EDPA 2VOOA 2DBBA 2P7CB 3L00A 4G7OF 5FD6A 2JT1A 1STZA 1P4WA 4RS8A 3CUOA 4OINF 2DT5A 1O57A 5ED4A 2X4HA 1XMAA 5LEJA 3RPQA 1T98A 3E6CC 2WV0A 3U2RA 2HS5A 5HVQC 5CYVA 1MJAA 2DW4A 2L4AA 2ZFWA 2L02A 1ZREA 2Q0OA 1R5HA 5JR3A 1O3SA 5J8FA 5CVJA 5LHHA 1ZN2A 1D8JA 3MAJA 3R4KA 2XKOA 5AONA 5D6FA 1P2FA 1OYWA 1GXQA 1EV7A 2Q2EA 1U5TC 1RIOH 2PG4A 4L9JA 3VODA 4YIFA 3FM5A 1YFHA 1IF1A 4P9UA 3KCCA 2BGCA 3JTHA 2LDUA 2COMA 3GW2A 2NYXA 1U5TB 4HAMA 3IWFA 1HXDA 5FD5A 2ACJA 1WWXA 3F8BA 1H9GA 2JZYA 4CHUA 1ODDA 5L3EA 3BWGA 3I5UA 4Q4ZF 4PCQA 3KP3A 2L54A 3C1DA 2ZNYA 4YFXF 5DV5A 1O3TA 2DK8A 2DTRA 1SD5A 4UVBA 2FOKA 1O3RA 1I1GA 4RB3C 1PP8F 2XAFA 3VEPA 1F1ZA 1Y0UA 1BI0A 2HQRA 2VBYA 2YX7A 3E6MA 4G94A 2G7UA 2IA0A 2MBFA 3SZPA 2FEZA 4A5NA 4LB6B 2QVOA 3V8LA 2O03A 3LFKA 2IPQX 5ICGA 1FYMA 1ZAOA 2JRTA 4BQAA 4IXAA 3Q5FA 3ELKA 2ISZA 2IP2A 1G3WA 5D4SA 4M9XA 4WF2A 2QYOA 2ESHA 4PGGA 4ESJA 2OAZA 1S7AA 1TBXA 4U88A 1R5GA 1F5TA 4RGUA 1XSXA 2JTVA 4CXFA 1RUNA 4HDVA 3P7NA 2CW0F 3KLNA 5FO5A 1R23A 1YO5C 2M1BA 2RNJA 2XAGA 3QPHA 3JSPA 1G3YA 2KJBA 4A0ZA 1O7LA 4HOBA 1BIAA 2JPCA 4LK1F 1KU7A 1EH8A 4CDGA 2H6CA 3V8JA 2WTEA 1HKQA 2LNBA 4HQEA 2OQGA 5HS8A 5BS6A 2XAHA 5HDGA 2Z5UA 3K69A 3ZMUA 2X0LA 1LVAA 3KP5A 1JHFA 5TJJA 1I5ZA 2PQ8A 3R6SA 3ZQ7A 4KDPA 5HS7A 3BROA 4MNUA 1XGMA 4Z2YA 2P6TA 2HYFA 4AIHA 1KU2A 3QAHA 1ZLKA 3FMQA 3IRQA 2FBHA 4KN4X 1SD4A 2UXXA 1TNTA 1FY7A 2CO5A 2MLGA 2E1NA 4A0XA 1W7PB 2K27A 2RQPA 4L0YB 3WG9A 1DUXC 1RZ4A 1IXRC 5L3FA 3S2WA 4S05A 1MD0A 1RNLA 5JFRA 2P4WA 3GF2A 2KKOA 3TDZC 2L4MA 2UWMA 3IHUA 2MLKA 1IUYA 2F5CA 3F6OA 3GXOA 1QZYA 4KYWA 4P96A 3KFWX 1FT9A 3SQNA 4EJUA 2XIGA 4LGWA 1O3QA 1B4AA 3K9TA 4G9YA 4P9FA 1MJBA 1JXSA 4P5OA 3RKWA 5BPDA 2RN7A 2G9WA 4G8XA 1U3EM 2QQAA 2LSOA 4A6EA 2LKPA 3L7WA 3CO7C 5DEQA 1HW5A 1K78A 4AVPA 3M8EA 1KYWA 5CVIA 1BI3A 2FSWA 4RB2C 4UHTA 2W85A 5HOOA 3F8CA 4HBLA 1GVJA 3ULQB 4RB0A 1QGPA 3O3KA 1XCVA 1J59A 5E17F 1IXSB 2MH2A 3ROUA 1XGNA 5J6XA 2CQKA 5E1ZB 3LQQA 2F5FA 3T8TA 2A5YB 2RKHA 1PP7U 2FXAA 4RGXA 4XSXF 2GIVA 1ON2A 3WTVC 2YPRA 2P8TA 3LA3A 3K2ZA 4OMZA 1H9TA 3F8FA 3M1EA 3WTYC 1DP7P 1VTNC 1U78A 4ZZLA 4ZYHA 3WTXC 5AIPA 5D5XB 1HSTA 2E1CA 5FB2A 5D5WB 1FWZA 2FF4A 3KE2A 1S3JA 3WTSC 3RKYA 4EJWA 1YG2A 1U2WA 3HIFA 4ETSA 4HLXA 3I59A 2OD5A 4ENMA 3R0JA 3SZTA 1KU9A 1PDNC 3WTZA 4HDUA 2PN6A 2XV4S 4IRIA 4I0BA 5BMZA 5CLSA 2QBYB 1LDKB 5CVUA 2B0LA 4I7HA 1XGSA 2MD5A 5D4RA 3MCZA 2XKPA 5JI6A 4A6DA 2P5VA 3HRSA 4F7ZA 1LDJA 1OMIA 1W5TA 4IJAA 4RAZA 4YG2F 2EB7A 4XLPF 1XDUA 3F72A 4EM2A 3MZHA 4AIJA 3WTUC 2ZO4A 3ECHA 1G3TA 1J75A 4MEXF 4ESBA 4Q48A 5E1XA 2FE3A 1IN5A 1FYLA 5H6QA 5EEGA 2VE9A 1W5SA 2V1XA 4HX7A 3RI4A 1CF7A 3F22A 2PFBA 1ZRFA 4WXDA 1B1BA 3ABTA 4HF2A 3GZ5A 4GYGA 2DK5A 4N9HA 1S29A 4Q5SF 1F9NA 2NAZA 1XSVA 4NHJA 4ESFA 4D0PA 2KRFA 4L5IA 2QM3A 2D45A 5E1WA 1ZH5A 1MKMA 1R1UA 3K0LA 3KEQA 4JQFA 1ULYA 2A6EF 3FF5A 4LMYA 2HWVA 2HEOA 3LA2A 4MHGA 2FRHA 1YW7A 5E8IA 2GA2A 4HZFA 3L9FA 4BAYA 4A5MA 4U0VA 4IRHA 3QP6A 4HX4A 5IT9K 1ZG3A 1FC3A 5HS9A 3GYHX 3TOBA 3V4GA 1GHCA 3KP2A 4UV9A 1P6RA 1KQ8A 2HKXA 3GWZA 4M71A 3H92A 5K1YA 3FXQA 2HR3A 3HRUA 1QNTA 3ML6A 2VC0A 2P6SA 1G3SA 1K6OA 1Z9CA 2WC2A 2A69F 3J80Z 2AXLA 2CG4A 2K86A 1QQIA 3I53A 1ZGAA 3E6DA 3J81K 2H27A 1IN8A 3CJNA 1UHMA 2BYVE 2ADUA 4EQQA 5EEHA 3T0YA 1YLFA 2C6YA 4KNYA 4U7DA 2XGXA 3V7RA 2M45A 1E2XA 1T2KA 1Z1DA 4OIOF 4IF4A 4OU0A 3DKWA 2O61A 2HGCA 2HTSA 2IW5A 3HSEA 4BHPA 1U5TA 3B02A 2GA1A 3ZMSA 4YFKF 1Q1HA 2Y0MA 1J0RA 1FZPB 1IAWA 4PDKA 4I98B 4L9TA 4BHCA 3MZYA 2TDXA 4AWXB 5LGUA 3QRFF 1P92A 2QENA 1FP2A 1MDMA 1UB9A 4M9SA 2HKOA 3MEXA 1I1SA 2ZXJA 3FXUA 1T0FA 2FBKA 2M5WA 3IKTA 2FBIA 1S7OA 3KETA 2F2EA 4LLLA 2PMUA 4U7BA 2HYGD 2XAJA 4CZZA 3TO6A 2MC3A 2GXBA 1MDMB 5K5RA 3GX4X 2Y75A 2DQRA 1QZZA 4Q47A 4GGGA 3FMSA 3R61A 1I6XA 5L3DA 4XLNF 4LLNA 5ICEA 1FSEA 1ZYRF 3DEUA 4OIPF 5FGMA 1FP1D 4O3MA 4M9ZA 3JAMZ 4EJTA 1USTA 3C18A 3W6JB 3ZMTA 1G6NA 4BXUA 1ZRDA 4S04A 2O3FA 2HDCA 3GEZA 2IJLA 3VFZA 2RGVA 5F1RA 3E5XA 3TKYA 1V3FA 4XSZF 5AIQA 4UXNA 2JPBA 1BM9A 5L3BA 1YQAA 3Q9SA 2D2WA 1TQMA 5CVRA 2GQQA 2E7WA 5LBQA 5CJ9A 3NEUA 2OA4A 4BHBA 5LRRA 2UZKA 1FPQA 3CO6C 3TO7A 4KICA 4OMYA 5E20A 3AAFA 3LA7A 2Z33A 4MTEA 4EJOA 4FHTA 4LLGF 1LDDA 2MH9A 1JE8A 6PAXA 5HLHA 1DPUA 3ISPA 4HYEA 3SXYA 3BPVA 3DXJF 3I0TA 2YX4A 3LAPA 1FOKA 2IA1A 1REPC 1TLHB 1AWCA 2A3SA 4I09A 4JK1X 4MEYF 2PLYA 1W7PA 2VBWA 3N97A 1TW2A 1BBYA 4NB5A 5F6FA 2WWYA 1GXPA 4I2OA 4AD9A 3MFKA 1J2XA 2DPDA 2NNYA 2EFPA 2GAUA 1NHAA 3BP8A 1ZLJA 1R1VA 4GYIA 4HV6A 1Z05A 2VBZA 3F8NA 3J80K 1DPRA 5FFZA 1B9MA 5IT9Z 3HTSB 4WXCA 3I64A 3FWEA 2PBIA 3P9CA 2ESNA 1YYVA 3RYRA 2ZNZA 2H09A 2ETHA 4Y15A 5ERIA 3LSTA 4HQMA 1ONVA 3R0AA 4LK0F 4YIIA 5L3GA 2FNPA 4LFUA 4WWCA 5ILSA 1BI1A 1QO0D 3HRTA 3T5XA 2H6BA 1XD7A 4ON0A 5H6RA 3WGGA 3N4MA 1ZG5A 3EETA 1IW7F 3WGHA 3T1BA 2DO7A 4R8HA 2QZ8A 2Z99A 3WTTC 2AS5F 1XGOA 4HF0A 1LNWA 2YSRA 3OOPA 1SMYF 3J81Z 2NRAC 2IT0A 2IA2A 2R7DA 1L0OC 1S8NA 3IC7A 3E5UA 4CGZA 2KIUA 2DPUA 2P7VB 3E3VA 1JHHA 1TNSA 1SMTA 3ZPLA 1KQ0A 1TQIA 3QU3A 4CICA 1J9IA 4L9VA 2VBXA 4ENKA 3M8FA 1A04A 2RV8A 4PGHA 4BNCA 1EH7A 1FX7A 3WODF 2F5DA 3Q9VA 2D1HA 3DQVC 5ICCA 4M6YA 3EYYA 2DI3A 2XHKA 5JVTA 2FNAA 2EA4A 1ON1A 3LAJA 3ZP5A 2ZKZA 3ZMZA 4HW0A 4E70A 2VT2A 2YR2A 4HF1A 2V1UA 3HTUA 2RVCA 5DD8A 4EJVA 5D8LB 1Z6TA 2QBYA 4P55A 2OZUA 3JAMK 2DQLA 3RJPA 2OQRA 4LJZF 4G7ZF 1KGSA 3V7CA 3ERED 3QOPA 5ILVA 2IRFG 4IHTA 2W25A 1DDNA 1BJAA 4IPAA 1XN7A 1U8RA 2CYYA 2BEOA 2VC1A 2OZ6A 3HSFA 2V1DA 2DAOA 3GO5A 4MQ9F 4U0WA 3K1MA 3L09A 4R79A 1BIBA 1IN6A 3K1NA 3CUQC 3MQ0A 2K7LA 1D5VA 3B73A 3VOEA 4L9NA 2IVMA 4KMUX 5HDKA 4R1HA 5J8CA 1K7AA 1HQCA 5K5OA 4HV5A 2L01A 3IRRA 3CUQB 4N9IA 1ZARA 3RKXA 3TOAA 3EUHA 3J7AO 2XAQA 3I71A 2MA3A 3K1PA 1IRGA 3DFGA 1IRFA 2O0YA 5DCMB 4H0EA 5BQTA 1FBSA 3QP5A 3U1DA 1YTYA 1OPCA 1OR7A 3EQLF 1SFXA 4KUMA 1O7FA 4JBAA 2A61A 4L18B 4RGRA 5LRSA 2Z3YA 1CGPA 1BI2A 1LEBA 2P5LC 2LF7A 4ENJA 1OKRA 3LQRA 2R7FA 2PJPA 2BBYA 5L3CA 1R36A 2KIMA 4ENNA 3F3XA 3TO9A 2LF8A 2D1VA 2XRNA 4LG0B 2GZWA 3HHHA 2XASA 2G7HA 3TQNA 2ZCWA 2A68F 3CDHA 5FFXA 1MGTA 4O5VA 4MTDA 3WGIA 3P9KA 2Y48A 1OYIA 2CSOA 5HLIA 4B09A 3WU1B 1B9NA 1HKSA 4IHSA 5LGNA 2ZBKA 4KIBA 1S6LA 5TRDA 4MGRA 3QU6A 4ASNA 4B8XA 4YFNF 1ZG1A 2V9VA 3CTAA 1UHWA 3KP7A 3BZ6A 3GUDA 4UNOA 5H20A 3ABUA 2ZMEA 3U9GA 4Y17A 1R22A 4OIRF 5DUKA 3GFJA 4M72A 5CVVA 1K79A 1UCRA 2QUFA 4KIFA 1XDSA 1AOYA 3F8MA 2HFHA 5D5UB 1XMKA 4I02A 3IL2A 2V79A 5KK1A 4M74A 2FQ3A 2ZMEB 1ZHFA 4RAYA 2CFXA 3DP7A 1MJ9A 1KQ9A 3FXRA 1RUOA 5LHGA 1G4DA 1T6SA 2JSCA 4N0BA 3GFIA 1KU3A 3C7JA 4EM0B 2FMYA 1LJ9A 5FLXZ 2VN2A 2PEXA 3NQOA 3GVAA 2GWRA 2ISYA 1ZGJA 3MWMA 2Q8KA 4O6JA 3V7SA 4I01A 3F21A 1R1TA 2VE8A 3JW4A 4I0AA 3ECOA 3GFMA 1FYKA 1KYZA 2BE5F 1SD6A 3R60A 3NRVA 2K4BA 4EM1A 2HQNA 3O2PE 3RDIA 3PQKA 1C0WA 4WXHA 1D3YA 5BPIA 3TDUC 2EFWA 3HRMA 3KZYA 2M30A 2W24A 5JHUA 5LLQA 1IN4A 1W7PD 3KP4A 3V8KA 2A07F 5D8KB 1YS6A 5DUIA 1SAXA 4UUVA 1XB4A 1FLIA 2ZJ2A 1X3UA 1LQ1A 2PI0A 3H3ZA 4BH9A 4EMSA 2QQBA 2VOPA 2RDPA 1YW9A 1FSHA 2NNNA 1RI7A 2R3SA 3JTGA 2EA2A 4G6QA 3ZN1A 3IKVA 4KA4A 4LD5A 3RIRA 2FMLA 2CGPA 3CLOA 2EFQA 3OV8A 5K5QA 2XUBA 5DD4A 1MZBA 4M6XA 3F6VA 5HDNA 3I54A 3HOSA 1J5YA 5DYMA 4G7HF 2DFIA 3WTWC 1XCBA 1YIOA 1YW8A 3EYIA 4WCGA 4L0ZB 3G3ZA 1P4AA 4QLCU 2QQ9A 3BJAA 2KJCA 1LEAA 4KMFA 3FM3A 3PFIA 2ELHA 4RGSA 2J5PA 4U0YA 2KIFA 4UVCA 1FBUA 5E8GA 3T8RA 4HX8A 4WK8F 4XBFA 1Z6RA 1SFEA 2VT3A 3E5QA 2DLLA 5BOXA 2XVCA 4PZJA 3WU0A 2EFNA 4GO1A 3L2CA 2K4JA 1IN7A 5IT3A 1TW3A 2CWEA 4EVIA 3DV8A 3BDDA 3HYIA 4CYDA 3D0SA 4TV7A 2GXGA 1U6GA 4AIKA 4FT8A 1HBXG 5KVRA 1BC7C 3H3UA 2O8XA 1Z91A 3KP6A 5A2QK 3C3WA 5F64A 3KZZA 3M7GA 3HOTA 3TGNA 3SFZA 3COAC 1HSJA 3M9AA 3FMRA 2HOEA 4ZH4F 3WE2A 1WRJA 4ZYGA 3BJ6A 5LGTA 2FA5A 2RC4A 2QLZA 4DQ2A 3DPTA 3O6BB 2VXZA 3BY6A 3HHGA 1R58A 2EFOA 1D8KA 4IVNA 1FNNA 5FLXK 1USSA 2J5OA 3HUGA 3SHFA 4GXOA 2E7XA 1QPMA 3FHZA 3ZMDA 2H94A 1QBJA 2STWA 1HW2A 1SFUA 1BOAA 4ZYEA 1B6AA 4A0YA 1IZ1A 2EV0A 1XSDA 1LB2A 2F5EA 2EV5A 1J7KA 1TTYA 4QWQA 4M73A 2OU2A 1B59A 3BJOA 4IRGA 1WQ2A 1UFMA 2VONA 3HSRA 1P4XA 1K78B 1ZRCA 3DF8A 1TQPA 1WKMA 1I27A 4LB5A 5DCFA 2W84A 2YU3A 1EH6A 1BN5A 1R00A 5E18F 2QWWA 2EV6A 3IWZA 1WI9A 1H0MA 1YS7A 4K2EA 4KFCA 4EV0A 3JSOA 4OIQF 2W57A 3KEOA 3W6KB 3QPTA 4KIGA 3GLXA 2DU9A 4ZZDA 2BV6A 3DPLC 1OYYA 5LHIA 1FBQA 2EJRA 1HKTA 2M8EA 2STTA 1E17A 3GFLA 3PQJA 4CO8A 3CUQA 1T38A 3GZ6A 3FZVA 1V4RA 2A6HF 4KT5C 1IXCA 5HLGA 5DCMA 3D5LA 3ZN0A 3I59B 2V6CA 4GCVA 3BPXA 3I4PA 2VODA 3VB2A 4OOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6E A;  4A12 A;  4G6D A;  2M87 A;  3ZMV A;  2HTJ A;  4UV8 A;  4Y13 A;  4LG0 A;  3F23 A;  2O6G E;  4HLY A;  2NS0 A;  2P5K A;  2K02 A;  4DNC A;  1L3L A;  1W4M A;  4MQV A;  4KN7 X;  2HZT A;  5LEK A;  2L3D A;  4UVA A;  4BYY A;  2PMH A;  5DDG A;  1CF7 B;  4RB1 A;  3P9I A;  4FX0 A;  4EGY A;  2XRO A;  3G73 A;  3WE3 A;  4NQW A;  1JGS A;  3BOQ A;  1T39 A;  3LWF A;  1KA8 A;  1HW1 A;  3E6B A;  3FX3 A;  1WSU A;  2OBP A;  1Z7U A;  1PUE E;  5D5V B;  4A2U A;  1F4K A;  3I58 A;  3RTR A;  2Z9O A;  3RPU A;  4WX9 A;  1SD7 A;  1R7J A;  3KLO A;  2EK5 A;  1BC8 C;  4ZYD A;  4HA8 A;  2EWN A;  4FX4 A;  4EGZ A;  5ILU A;  4L5J A;  2FU4 A;  3RYP A;  2UXN A;  3E97 A;  5ICF A;  3REO A;  4XRF A;  5A2Q Z;  3EDP A;  2VOO A;  2DBB A;  2P7C B;  3L00 A;  4G7O F;  5FD6 A;  2JT1 A;  1STZ A;  1P4W A;  4RS8 A;  3CUO A;  4OIN F;  2DT5 A;  1O57 A;  5ED4 A;  2X4H A;  1XMA A;  5LEJ A;  3RPQ A;  1T98 A;  3E6C C;  2WV0 A;  3U2R A;  2HS5 A;  5HVQ C;  5CYV A;  1MJA A;  2DW4 A;  2L4A A;  2ZFW A;  2L02 A;  1ZRE A;  2Q0O A;  1R5H A;  5JR3 A;  1O3S A;  5J8F A;  5CVJ A;  5LHH A;  1ZN2 A;  1D8J A;  3MAJ A;  3R4K A;  2XKO A;  5AON A;  5D6F A;  1P2F A;  1OYW A;  1GXQ A;  1EV7 A;  2Q2E A;  1U5T C;  1RIO H;  2PG4 A;  4L9J A;  3VOD A;  4YIF A;  3FM5 A;  1YFH A;  1IF1 A;  4P9U A;  3KCC A;  2BGC A;  3JTH A;  2LDU A;  2COM A;  3GW2 A;  2NYX A;  1U5T B;  4HAM A;  3IWF A;  1HXD A;  5FD5 A;  2ACJ A;  1WWX A;  3F8B A;  1H9G A;  2JZY A;  4CHU A;  1ODD A;  5L3E A;  3BWG A;  3I5U A;  4Q4Z F;  4PCQ A;  3KP3 A;  2L54 A;  3C1D A;  2ZNY A;  4YFX F;  5DV5 A;  1O3T A;  2DK8 A;  2DTR A;  1SD5 A;  4UVB A;  2FOK A;  1O3R A;  1I1G A;  4RB3 C;  1PP8 F;  2XAF A;  3VEP A;  1F1Z A;  1Y0U A;  1BI0 A;  2HQR A;  2VBY A;  2YX7 A;  3E6M A;  4G94 A;  2G7U A;  2IA0 A;  2MBF A;  3SZP A;  2FEZ A;  4A5N A;  4LB6 B;  2QVO A;  3V8L A;  2O03 A;  3LFK A;  2IPQ X;  5ICG A;  1FYM A;  1ZAO A;  2JRT A;  4BQA A;  4IXA A;  3Q5F A;  3ELK A;  2ISZ A;  2IP2 A;  1G3W A;  5D4S A;  4M9X A;  4WF2 A;  2QYO A;  2ESH A;  4PGG A;  4ESJ A;  2OAZ A;  1S7A A;  1TBX A;  4U88 A;  1R5G A;  1F5T A;  4RGU A;  1XSX A;  2JTV A;  4CXF A;  1RUN A;  4HDV A;  3P7N A;  2CW0 F;  3KLN A;  5FO5 A;  1R23 A;  1YO5 C;  2M1B A;  2RNJ A;  2XAG A;  3QPH A;  3JSP A;  1G3Y A;  2KJB A;  4A0Z A;  1O7L A;  4HOB A;  1BIA A;  2JPC A;  4LK1 F;  1KU7 A;  1EH8 A;  4CDG A;  2H6C A;  3V8J A;  2WTE A;  1HKQ A;  2LNB A;  4HQE A;  2OQG A;  5HS8 A;  5BS6 A;  2XAH A;  5HDG A;  2Z5U A;  3K69 A;  3ZMU A;  2X0L A;  1LVA A;  3KP5 A;  1JHF A;  5TJJ A;  1I5Z A;  2PQ8 A;  3R6S A;  3ZQ7 A;  4KDP A;  5HS7 A;  3BRO A;  4MNU A;  1XGM A;  4Z2Y A;  2P6T A;  2HYF A;  4AIH A;  1KU2 A;  3QAH A;  1ZLK A;  3FMQ A;  3IRQ A;  2FBH A;  4KN4 X;  1SD4 A;  2UXX A;  1TNT A;  1FY7 A;  2CO5 A;  2MLG A;  2E1N A;  4A0X A;  1W7P B;  2K27 A;  2RQP A;  4L0Y B;  3WG9 A;  1DUX C;  1RZ4 A;  1IXR C;  5L3F A;  3S2W A;  4S05 A;  1MD0 A;  1RNL A;  5JFR A;  2P4W A;  3GF2 A;  2KKO A;  3TDZ C;  2L4M A;  2UWM A;  3IHU A;  2MLK A;  1IUY A;  2F5C A;  3F6O A;  3GXO A;  1QZY A;  4KYW A;  4P96 A;  3KFW X;  1FT9 A;  3SQN A;  4EJU A;  2XIG A;  4LGW A;  1O3Q A;  1B4A A;  3K9T A;  4G9Y A;  4P9F A;  1MJB A;  1JXS A;  4P5O A;  3RKW A;  5BPD A;  2RN7 A;  2G9W A;  4G8X A;  1U3E M;  2QQA A;  2LSO A;  4A6E A;  2LKP A;  3L7W A;  3CO7 C;  5DEQ A;  1HW5 A;  1K78 A;  4AVP A;  3M8E A;  1KYW A;  5CVI A;  1BI3 A;  2FSW A;  4RB2 C;  4UHT A;  2W85 A;  5HOO A;  3F8C A;  4HBL A;  1GVJ A;  3ULQ B;  4RB0 A;  1QGP A;  3O3K A;  1XCV A;  1J59 A;  5E17 F;  1IXS B;  2MH2 A;  3ROU A;  1XGN A;  5J6X A;  2CQK A;  5E1Z B;  3LQQ A;  2F5F A;  3T8T A;  2A5Y B;  2RKH A;  1PP7 U;  2FXA A;  4RGX A;  4XSX F;  2GIV A;  1ON2 A;  3WTV C;  2YPR A;  2P8T A;  3LA3 A;  3K2Z A;  4OMZ A;  1H9T A;  3F8F A;  3M1E A;  3WTY C;  1DP7 P;  1VTN C;  1U78 A;  4ZZL A;  4ZYH A;  3WTX C;  5AIP A;  5D5X B;  1HST A;  2E1C A;  5FB2 A;  5D5W B;  1FWZ A;  2FF4 A;  3KE2 A;  1S3J A;  3WTS C;  3RKY A;  4EJW A;  1YG2 A;  1U2W A;  3HIF A;  4ETS A;  4HLX A;  3I59 A;  2OD5 A;  4ENM A;  3R0J A;  3SZT A;  1KU9 A;  1PDN C;  3WTZ A;  4HDU A;  2PN6 A;  2XV4 S;  4IRI A;  4I0B A;  5BMZ A;  5CLS A;  2QBY B;  1LDK B;  5CVU A;  2B0L A;  4I7H A;  1XGS A;  2MD5 A;  5D4R A;  3MCZ A;  2XKP A;  5JI6 A;  4A6D A;  2P5V A;  3HRS A;  4F7Z A;  1LDJ A;  1OMI A;  1W5T A;  4IJA A;  4RAZ A;  4YG2 F;  2EB7 A;  4XLP F;  1XDU A;  3F72 A;  4EM2 A;  3MZH A;  4AIJ A;  3WTU C;  2ZO4 A;  3ECH A;  1G3T A;  1J75 A;  4MEX F;  4ESB A;  4Q48 A;  5E1X A;  2FE3 A;  1IN5 A;  1FYL A;  5H6Q A;  5EEG A;  2VE9 A;  1W5S A;  2V1X A;  4HX7 A;  3RI4 A;  1CF7 A;  3F22 A;  2PFB A;  1ZRF A;  4WXD A;  1B1B A;  3ABT A;  4HF2 A;  3GZ5 A;  4GYG A;  2DK5 A;  4N9H A;  1S29 A;  4Q5S F;  1F9N A;  2NAZ A;  1XSV A;  4NHJ A;  4ESF A;  4D0P A;  2KRF A;  4L5I A;  2QM3 A;  2D45 A;  5E1W A;  1ZH5 A;  1MKM A;  1R1U A;  3K0L A;  3KEQ A;  4JQF A;  1ULY A;  2A6E F;  3FF5 A;  4LMY A;  2HWV A;  2HEO A;  3LA2 A;  4MHG A;  2FRH A;  1YW7 A;  5E8I A;  2GA2 A;  4HZF A;  3L9F A;  4BAY A;  4A5M A;  4U0V A;  4IRH A;  3QP6 A;  4HX4 A;  5IT9 K;  1ZG3 A;  1FC3 A;  5HS9 A;  3GYH X;  3TOB A;  3V4G A;  1GHC A;  3KP2 A;  4UV9 A;  1P6R A;  1KQ8 A;  2HKX A;  3GWZ A;  4M71 A;  3H92 A;  5K1Y A;  3FXQ A;  2HR3 A;  3HRU A;  1QNT A;  3ML6 A;  2VC0 A;  2P6S A;  1G3S A;  1K6O A;  1Z9C A;  2WC2 A;  2A69 F;  3J80 Z;  2AXL A;  2CG4 A;  2K86 A;  1QQI A;  3I53 A;  1ZGA A;  3E6D A;  3J81 K;  2H27 A;  1IN8 A;  3CJN A;  1UHM A;  2BYV E;  2ADU A;  4EQQ A;  5EEH A;  3T0Y A;  1YLF A;  2C6Y A;  4KNY A;  4U7D A;  2XGX A;  3V7R A;  2M45 A;  1E2X A;  1T2K A;  1Z1D A;  4OIO F;  4IF4 A;  4OU0 A;  3DKW A;  2O61 A;  2HGC A;  2HTS A;  2IW5 A;  3HSE A;  4BHP A;  1U5T A;  3B02 A;  2GA1 A;  3ZMS A;  4YFK F;  1Q1H A;  2Y0M A;  1J0R A;  1FZP B;  1IAW A;  4PDK A;  4I98 B;  4L9T A;  4BHC A;  3MZY A;  2TDX A;  4AWX B;  5LGU A;  3QRF F;  1P92 A;  2QEN A;  1FP2 A;  1MDM A;  1UB9 A;  4M9S A;  2HKO A;  3MEX A;  1I1S A;  2ZXJ A;  3FXU A;  1T0F A;  2FBK A;  2M5W A;  3IKT A;  2FBI A;  1S7O A;  3KET A;  2F2E A;  4LLL A;  2PMU A;  4U7B A;  2HYG D;  2XAJ A;  4CZZ A;  3TO6 A;  2MC3 A;  2GXB A;  1MDM B;  5K5R A;  3GX4 X;  2Y75 A;  2DQR A;  1QZZ A;  4Q47 A;  4GGG A;  3FMS A;  3R61 A;  1I6X A;  5L3D A;  4XLN F;  4LLN A;  5ICE A;  1FSE A;  1ZYR F;  3DEU A;  4OIP F;  5FGM A;  1FP1 D;  4O3M A;  4M9Z A;  3JAM Z;  4EJT A;  1UST A;  3C18 A;  3W6J B;  3ZMT A;  1G6N A;  4BXU A;  1ZRD A;  4S04 A;  2O3F A;  2HDC A;  3GEZ A;  2IJL A;  3VFZ A;  2RGV A;  5F1R A;  3E5X A;  3TKY A;  1V3F A;  4XSZ F;  5AIQ A;  4UXN A;  2JPB A;  1BM9 A;  5L3B A;  1YQA A;  3Q9S A;  2D2W A;  1TQM A;  5CVR A;  2GQQ A;  2E7W A;  5LBQ A;  5CJ9 A;  3NEU A;  2OA4 A;  4BHB A;  5LRR A;  2UZK A;  1FPQ A;  3CO6 C;  3TO7 A;  4KIC A;  4OMY A;  5E20 A;  3AAF A;  3LA7 A;  2Z33 A;  4MTE A;  4EJO A;  4FHT A;  4LLG F;  1LDD A;  2MH9 A;  1JE8 A;  6PAX A;  5HLH A;  1DPU A;  3ISP A;  4HYE A;  3SXY A;  3BPV A;  3DXJ F;  3I0T A;  2YX4 A;  3LAP A;  1FOK A;  2IA1 A;  1REP C;  1TLH B;  1AWC A;  2A3S A;  4I09 A;  4JK1 X;  4MEY F;  2PLY A;  1W7P A;  2VBW A;  3N97 A;  1TW2 A;  1BBY A;  4NB5 A;  5F6F A;  2WWY A;  1GXP A;  4I2O A;  4AD9 A;  3MFK A;  1J2X A;  2DPD A;  2NNY A;  2EFP A;  2GAU A;  1NHA A;  3BP8 A;  1ZLJ A;  1R1V A;  4GYI A;  4HV6 A;  1Z05 A;  2VBZ A;  3F8N A;  3J80 K;  1DPR A;  5FFZ A;  1B9M A;  5IT9 Z;  3HTS B;  4WXC A;  3I64 A;  3FWE A;  2PBI A;  3P9C A;  2ESN A;  1YYV A;  3RYR A;  2ZNZ A;  2H09 A;  2ETH A;  4Y15 A;  5ERI A;  3LST A;  4HQM A;  1ONV A;  3R0A A;  4LK0 F;  4YII A;  5L3G A;  2FNP A;  4LFU A;  4WWC A;  5ILS A;  1BI1 A;  1QO0 D;  3HRT A;  3T5X A;  2H6B A;  1XD7 A;  4ON0 A;  5H6R A;  3WGG A;  3N4M A;  1ZG5 A;  3EET A;  1IW7 F;  3WGH A;  3T1B A;  2DO7 A;  4R8H A;  2QZ8 A;  2Z99 A;  3WTT C;  2AS5 F;  1XGO A;  4HF0 A;  1LNW A;  2YSR A;  3OOP A;  1SMY F;  3J81 Z;  2NRA C;  2IT0 A;  2IA2 A;  2R7D A;  1L0O C;  1S8N A;  3IC7 A;  3E5U A;  4CGZ A;  2KIU A;  2DPU A;  2P7V B;  3E3V A;  1JHH A;  1TNS A;  1SMT A;  3ZPL A;  1KQ0 A;  1TQI A;  3QU3 A;  4CIC A;  1J9I A;  4L9V A;  2VBX A;  4ENK A;  3M8F A;  1A04 A;  2RV8 A;  4PGH A;  4BNC A;  1EH7 A;  1FX7 A;  3WOD F;  2F5D A;  3Q9V A;  2D1H A;  3DQV C;  5ICC A;  4M6Y A;  3EYY A;  2DI3 A;  2XHK A;  5JVT A;  2FNA A;  2EA4 A;  1ON1 A;  3LAJ A;  3ZP5 A;  2ZKZ A;  3ZMZ A;  4HW0 A;  4E70 A;  2VT2 A;  2YR2 A;  4HF1 A;  2V1U A;  3HTU A;  2RVC A;  5DD8 A;  4EJV A;  5D8L B;  1Z6T A;  2QBY A;  4P55 A;  2OZU A;  3JAM K;  2DQL A;  3RJP A;  2OQR A;  4LJZ F;  4G7Z F;  1KGS A;  3V7C A;  3ERE D;  3QOP A;  5ILV A;  2IRF G;  4IHT A;  2W25 A;  1DDN A;  1BJA A;  4IPA A;  1XN7 A;  1U8R A;  2CYY A;  2BEO A;  2VC1 A;  2OZ6 A;  3HSF A;  2V1D A;  2DAO A;  3GO5 A;  4MQ9 F;  4U0W A;  3K1M A;  3L09 A;  4R79 A;  1BIB A;  1IN6 A;  3K1N A;  3CUQ C;  3MQ0 A;  2K7L A;  1D5V A;  3B73 A;  3VOE A;  4L9N A;  2IVM A;  4KMU X;  5HDK A;  4R1H A;  5J8C A;  1K7A A;  1HQC A;  5K5O A;  4HV5 A;  2L01 A;  3IRR A;  3CUQ B;  4N9I A;  1ZAR A;  3RKX A;  3TOA A;  3EUH A;  3J7A O;  2XAQ A;  3I71 A;  2MA3 A;  3K1P A;  1IRG A;  3DFG A;  1IRF A;  2O0Y A;  5DCM B;  4H0E A;  5BQT A;  1FBS A;  3QP5 A;  3U1D A;  1YTY A;  1OPC A;  1OR7 A;  3EQL F;  1SFX A;  4KUM A;  1O7F A;  4JBA A;  2A61 A;  4L18 B;  4RGR A;  5LRS A;  2Z3Y A;  1CGP A;  1BI2 A;  1LEB A;  2P5L C;  2LF7 A;  4ENJ A;  1OKR A;  3LQR A;  2R7F A;  2PJP A;  2BBY A;  5L3C A;  1R36 A;  2KIM A;  4ENN A;  3F3X A;  3TO9 A;  2LF8 A;  2D1V A;  2XRN A;  4LG0 B;  2GZW A;  3HHH A;  2XAS A;  2G7H A;  3TQN A;  2ZCW A;  2A68 F;  3CDH A;  5FFX A;  1MGT A;  4O5V A;  4MTD A;  3WGI A;  3P9K A;  2Y48 A;  1OYI A;  2CSO A;  5HLI A;  4B09 A;  3WU1 B;  1B9N A;  1HKS A;  4IHS A;  5LGN A;  2ZBK A;  4KIB A;  1S6L A;  5TRD A;  4MGR A;  3QU6 A;  4ASN A;  4B8X A;  4YFN F;  1ZG1 A;  2V9V A;  3CTA A;  1UHW A;  3KP7 A;  3BZ6 A;  3GUD A;  4UNO A;  5H20 A;  3ABU A;  2ZME A;  3U9G A;  4Y17 A;  1R22 A;  4OIR F;  5DUK A;  3GFJ A;  4M72 A;  5CVV A;  1K79 A;  1UCR A;  2QUF A;  4KIF A;  1XDS A;  1AOY A;  3F8M A;  2HFH A;  5D5U B;  1XMK A;  4I02 A;  3IL2 A;  2V79 A;  5KK1 A;  4M74 A;  2FQ3 A;  2ZME B;  1ZHF A;  4RAY A;  2CFX A;  3DP7 A;  1MJ9 A;  1KQ9 A;  3FXR A;  1RUO A;  5LHG A;  1G4D A;  1T6S A;  2JSC A;  4N0B A;  3GFI A;  1KU3 A;  3C7J A;  4EM0 B;  2FMY A;  1LJ9 A;  5FLX Z;  2VN2 A;  2PEX A;  3NQO A;  3GVA A;  2GWR A;  2ISY A;  1ZGJ A;  3MWM A;  2Q8K A;  4O6J A;  3V7S A;  4I01 A;  3F21 A;  1R1T A;  2VE8 A;  3JW4 A;  4I0A A;  3ECO A;  3GFM A;  1FYK A;  1KYZ A;  2BE5 F;  1SD6 A;  3R60 A;  3NRV A;  2K4B A;  4EM1 A;  2HQN A;  3O2P E;  3RDI A;  3PQK A;  1C0W A;  4WXH A;  1D3Y A;  5BPI A;  3TDU C;  2EFW A;  3HRM A;  3KZY A;  2M30 A;  2W24 A;  5JHU A;  5LLQ A;  1IN4 A;  1W7P D;  3KP4 A;  3V8K A;  2A07 F;  5D8K B;  1YS6 A;  5DUI A;  1SAX A;  4UUV A;  1XB4 A;  1FLI A;  2ZJ2 A;  1X3U A;  1LQ1 A;  2PI0 A;  3H3Z A;  4BH9 A;  4EMS A;  2QQB A;  2VOP A;  2RDP A;  1YW9 A;  1FSH A;  2NNN A;  1RI7 A;  2R3S A;  3JTG A;  2EA2 A;  4G6Q A;  3ZN1 A;  3IKV A;  4KA4 A;  4LD5 A;  3RIR A;  2FML A;  2CGP A;  3CLO A;  2EFQ A;  3OV8 A;  5K5Q A;  2XUB A;  5DD4 A;  1MZB A;  4M6X A;  3F6V A;  5HDN A;  3I54 A;  3HOS A;  1J5Y A;  5DYM A;  4G7H F;  2DFI A;  3WTW C;  1XCB A;  1YIO A;  1YW8 A;  3EYI A;  4WCG A;  4L0Z B;  3G3Z A;  1P4A A;  4QLC U;  2QQ9 A;  3BJA A;  2KJC A;  1LEA A;  4KMF A;  3FM3 A;  3PFI A;  2ELH A;  4RGS A;  2J5P A;  4U0Y A;  2KIF A;  4UVC A;  1FBU A;  5E8G A;  3T8R A;  4HX8 A;  4WK8 F;  4XBF A;  1Z6R A;  1SFE A;  2VT3 A;  3E5Q A;  2DLL A;  5BOX A;  2XVC A;  4PZJ A;  3WU0 A;  2EFN A;  4GO1 A;  3L2C A;  2K4J A;  1IN7 A;  5IT3 A;  1TW3 A;  2CWE A;  4EVI A;  3DV8 A;  3BDD A;  3HYI A;  4CYD A;  3D0S A;  4TV7 A;  2GXG A;  1U6G A;  4AIK A;  4FT8 A;  1HBX G;  5KVR A;  1BC7 C;  3H3U A;  2O8X A;  1Z91 A;  3KP6 A;  5A2Q K;  3C3W A;  5F64 A;  3KZZ A;  3M7G A;  3HOT A;  3TGN A;  3SFZ A;  3COA C;  1HSJ A;  3M9A A;  3FMR A;  2HOE A;  4ZH4 F;  3WE2 A;  1WRJ A;  4ZYG A;  3BJ6 A;  5LGT A;  2FA5 A;  2RC4 A;  2QLZ A;  4DQ2 A;  3DPT A;  3O6B B;  2VXZ A;  3BY6 A;  3HHG A;  1R58 A;  2EFO A;  1D8K A;  4IVN A;  1FNN A;  5FLX K;  1USS A;  2J5O A;  3HUG A;  3SHF A;  4GXO A;  2E7X A;  1QPM A;  3FHZ A;  3ZMD A;  2H94 A;  1QBJ A;  2STW A;  1HW2 A;  1SFU A;  1BOA A;  4ZYE A;  1B6A A;  4A0Y A;  1IZ1 A;  2EV0 A;  1XSD A;  1LB2 A;  2F5E A;  2EV5 A;  1J7K A;  1TTY A;  4QWQ A;  4M73 A;  2OU2 A;  1B59 A;  3BJO A;  4IRG A;  1WQ2 A;  1UFM A;  2VON A;  3HSR A;  1P4X A;  1K78 B;  1ZRC A;  3DF8 A;  1TQP A;  1WKM A;  1I27 A;  4LB5 A;  5DCF A;  2W84 A;  2YU3 A;  1EH6 A;  1BN5 A;  1R00 A;  5E18 F;  2QWW A;  2EV6 A;  3IWZ A;  1WI9 A;  1H0M A;  1YS7 A;  4K2E A;  4KFC A;  4EV0 A;  3JSO A;  4OIQ F;  2W57 A;  3KEO A;  3W6K B;  3QPT A;  4KIG A;  3GLX A;  2DU9 A;  4ZZD A;  2BV6 A;  3DPL C;  1OYY A;  5LHI A;  1FBQ A;  2EJR A;  1HKT A;  2M8E A;  2STT A;  1E17 A;  3GFL A;  3PQJ A;  4CO8 A;  3CUQ A;  1T38 A;  3GZ6 A;  3FZV A;  1V4R A;  2A6H F;  4KT5 C;  1IXC A;  5HLG A;  5DCM A;  3D5L A;  3ZN0 A;  3I59 B;  2V6C A;  4GCV A;  3BPX A;  3I4P A;  2VOD A;  3VB2 A;  4OOI A; 
#chains in the Genus database with same CATH topology
 2KT0 A;  4A3J J;  5F27 A;  3B6A A;  1LE8 B;  3ABM H;  5D6E A;  1Z3Y A;  3KYD B;  4CCK A;  2HPI A;  2DCE A;  5JVG F;  4A12 A;  4G6D A;  1XPX A;  2M87 A;  3ZMV A;  2HTJ A;  5IY5 H;  1G2H A;  2K3F A;  3GME A;  4F91 B;  4UV8 A;  4Y13 A;  4Y7N J;  1EF4 A;  4LG0 A;  3F23 A;  3BQY A;  2O6G E;  1P7J A;  4HLY A;  2NS0 A;  2P5K A;  2XAU A;  1ERD A;  2K02 A;  4DNC A;  3I56 I;  1FOW A;  1I50 J;  1L3L A;  1W4M A;  4MQV A;  3ZQG A;  4KN7 X;  1TL8 A;  2HZT A;  2XB5 A;  4BL0 B;  4XR6 A;  4NC7 A;  4BY1 J;  5LEK A;  3HOZ J;  2L3D A;  4UVA A;  1U8B A;  2KDO A;  4BYY A;  2PMH A;  3DBH B;  4RDU A;  3W3C A;  2VI6 A;  3H5R A;  2I10 A;  5DDG A;  1CF7 B;  4RB1 A;  3P9I A;  2CH0 A;  2QKL B;  3VDX A;  4FX0 A;  1OCP A;  4EGY A;  2XRO A;  2E71 A;  5GP9 A;  3G73 A;  3WE3 A;  4XQF A;  2XPV A;  4XKV A;  4NQW A;  1BA5 A;  1JGS A;  1UJ8 A;  3FIW A;  3BOQ A;  4C2U A;  3LSP A;  1T39 A;  3HEF A;  5E3O A;  3LWF A;  3O8H A;  1KA8 A;  1HW1 A;  3E6B A;  3FX3 A;  1X2M A;  5K7F A;  2WA0 A;  1WSU A;  2OBP A;  1Z7U A;  1I39 A;  1PUE E;  4ZDO A;  1WJ5 A;  2BW3 A;  5D5V B;  3Q3S A;  1YX5 A;  4YRV A;  4CCN A;  3LSJ A;  4A2U A;  3I58 A;  1F4K A;  3DBL B;  3RTR A;  2DMN A;  5DTD A;  3PNY A;  2Z9O A;  3SZG A;  2K9L A;  2CV0 A;  3RPU A;  3W6V A;  3IP4 B;  5J1R A;  4WX9 A;  4ZC3 A;  1SD7 A;  1R7J A;  3KLO A;  2EK5 A;  1BC8 C;  4ZYD A;  4HA8 A;  2EWN A;  3K4L A;  1NK2 P;  1A5J A;  1OIS A;  4FX4 A;  4W1U A;  4M6V A;  3OMY A;  2E1O A;  4EGZ A;  5ILU A;  4L5J A;  4FTH A;  4IQJ A;  2DMT A;  2FU4 A;  3A0H C;  3RYP A;  3J7Z I;  2UXN A;  3E97 A;  5ICF A;  3REO A;  4XNF A;  4XRF A;  5A2Q Z;  3EDP A;  2F4I A;  2VOO A;  2DBB A;  2P7C B;  2DMP A;  2MGQ A;  4AM3 A;  3L00 A;  4G7O F;  1XMX A;  2JT1 A;  1TWA J;  1STZ A;  5CQE A;  1P4W A;  5FD6 A;  4RS8 A;  1YJ9 I;  3CUO A;  3VYS B;  1UEL B;  2DT5 A;  1O57 A;  4OIN F;  3SDG A;  4NNJ A;  1I3A A;  2N8G A;  4F92 B;  5EEA A;  2E5Z A;  1X4O A;  5ED4 A;  2X4H A;  1IO2 A;  1XMA A;  3D5R C;  4IZZ A;  5LEJ A;  3GLL A;  3RPQ A;  3FIS A;  2L7M P;  1T98 A;  3E6C C;  2WV0 A;  3S17 J;  3U2R A;  2HS5 A;  5HVQ C;  5CYV A;  2Y9Z A;  1MJA A;  2NVX J;  1V5G A;  2HZD A;  2IS1 A;  2DW4 A;  4DYC A;  2L4A A;  2ZFW A;  4DYQ A;  3CC4 I;  3Q0W A;  3AL0 C;  2L02 A;  4ZYA A;  1T08 B;  1ZRE A;  2Q0O A;  4A3G J;  2PMZ A;  1R5H A;  5JR3 A;  1O3S A;  5J8F A;  3LNQ A;  5CVJ A;  5LHH A;  1ZN2 A;  3HOV J;  4JX5 A;  1D8J A;  2K40 A;  2L0K A;  4BJ5 C;  3MAJ A;  5J47 A;  1MMA A;  2XC7 A;  3HOW J;  4XIC A;  1PJR A;  3R4K A;  2XKO A;  5AON A;  4E7K A;  1CQT A;  5D6F A;  1P2F A;  1OYW A;  4U87 A;  2JA2 A;  4FE4 A;  3JRA A;  3AL0 B;  2R7S A;  1GXQ A;  3PNV A;  1EV7 A;  2NS8 A;  3Q0V A;  2Q2E A;  1ETV A;  1AA7 A;  3NWT A;  1U5T C;  1RIO H;  2M0C A;  2PG4 A;  4L9J A;  4QSH A;  3VOD A;  4YIF A;  1V5E A;  1VI0 A;  3FM5 A;  1YFH A;  3CJQ B;  1IF1 A;  2EZH A;  3CCV I;  4P9U A;  3OR1 C;  3KCC A;  2BGC A;  1TT5 B;  3JTH A;  2LDU A;  2K9M A;  2COM A;  3GW2 A;  1Y1V J;  2DOA A;  5BNG A;  1SC7 A;  2NYX A;  2R0Q C;  1U5T B;  2M7A A;  1T0F C;  3PL8 A;  4HAM A;  3W2V A;  3IWF A;  1HXD A;  5FD5 A;  2ACJ A;  1WWX A;  1K4T A;  3F8B A;  1H9G A;  2JZY A;  3L2V A;  4CHU A;  2K9Q A;  1ODD A;  2JSP A;  2Y0S A;  5L3E A;  5GTI C;  3BWG A;  3I5U A;  4Q4Z F;  2BVM A;  3VPR A;  4PCQ A;  1SVO A;  4XLE A;  4BS9 A;  3KP3 A;  1IG7 A;  3S1M J;  2BHY A;  1WVR A;  2L54 A;  4JX6 A;  3C1D A;  2ZNY A;  3CDI A;  4YFX F;  2MW8 A;  3FKI J;  5DV5 A;  1O3T A;  2JUG A;  2Z16 A;  2DK8 A;  2DTR A;  4J19 A;  1ZEL A;  1SD5 A;  2B7E A;  2CMP A;  4UVB A;  1IC8 A;  2FOK A;  3VSL A;  1O3R A;  1X1D A;  4D9J A;  2DYS H;  2PMZ N;  2K5C A;  4DJA A;  1I1G A;  4RB3 C;  4II3 A;  1PP8 F;  1W0U A;  2XAF A;  3K4M A;  3AG1 H;  2XPU A;  3VEP A;  1F1Z A;  1MMD A;  1Y0U A;  2FOW A;  1BI0 A;  2HQR A;  2VBY A;  2YX7 A;  4J01 A;  2QA4 I;  1R6R A;  3E6M A;  4G94 A;  2G7U A;  2IA0 A;  5B5E C;  2MBF A;  4AU7 A;  3SZP A;  2GIZ A;  1YE9 A;  2FEZ A;  2VPL A;  4A5N A;  4LB6 B;  2QVO A;  3FHN A;  3LL7 A;  3V8L A;  2HOS A;  2O03 A;  3LFK A;  4UB6 C;  4AYB A;  3QQA A;  4A3M J;  2OTL I;  2IPQ X;  5ICG A;  1FYM A;  1R4N B;  1ZAO A;  2JRT A;  4XON A;  4BQA A;  4DOZ A;  4IXA A;  2QCO A;  3ELK A;  3Q5F A;  2IP2 A;  2ISZ A;  3K4C A;  1G3W A;  5D4S A;  4B3X A;  3RZO J;  4UB8 C;  4A3L J;  2OCE A;  2BZT A;  1S7E A;  3TMO A;  4M9X A;  4WF2 A;  1V54 H;  2QYO A;  2ESH A;  4FE7 A;  4PGG A;  3C2H A;  1A36 A;  4ESJ A;  5GAE J;  2OAZ A;  1S7A A;  1TBX A;  4U88 A;  1R5G A;  3ESW B;  4X0G A;  1F5T A;  3IH2 A;  2DOE A;  4RGU A;  1XSX A;  2E1M C;  4MO7 A;  4B3A A;  2JTV A;  4CXF A;  2AQE A;  4RLQ A;  5IYC J;  1RUN A;  4HDV A;  3P7N A;  1K83 J;  2CW0 F;  2X6O A;  3KLN A;  1R23 A;  2Y69 H;  5FO5 A;  2NVU B;  2DA6 A;  1YO5 C;  3A01 B;  2M1B A;  1MBG A;  4G6T B;  5TGT A;  1JKR C;  2CQ7 A;  2RNJ A;  4B1R A;  2XAG A;  2Y0S N;  2OV7 A;  5C4J J;  3QPH A;  3JSP A;  1G3Y A;  2DDB A;  2KJB A;  4BUP A;  4A0Z A;  3SYT A;  1O7L A;  1QVT A;  2KPM A;  4HOB A;  5B1A H;  1BIA A;  3OYL A;  2JPC A;  4LK1 F;  1LFB A;  1KU7 A;  2VQC A;  1EH8 A;  4CDG A;  2H6C A;  2E1M B;  5KCM A;  3V8J A;  2WTE A;  1WJC A;  2NVY J;  3W2A A;  1HKQ A;  1JJ8 C;  2V9P A;  2LNB A;  5CPR B;  5M5W J;  1ZK8 A;  3FK6 A;  4HQE A;  2OQG A;  2IGK A;  3OWT A;  5HS8 A;  5BS6 A;  2EH3 A;  2ZJP F;  2XAH A;  5HDG A;  2Z5U A;  3S2H J;  3D5S C;  3K69 A;  3ZMU A;  2X0L A;  1LVA A;  3KP5 A;  3VYT B;  1JHF A;  5TJJ A;  1Z7L A;  1I5Z A;  2K3P A;  2VQL A;  2Y9Y A;  3CES A;  2PQ8 A;  3R6S A;  2L7F P;  3FDY A;  3ZQ7 A;  3DEW A;  4KDP A;  5HS7 A;  4A69 C;  5C3E J;  2ZFU A;  3TW6 A;  3BRO A;  1SVL A;  4AYB N;  1JTY A;  4MNU A;  1X2N A;  2HXO A;  1XGM A;  4Z2Y A;  2R5Z A;  3HXL A;  2P6T A;  3CCL I;  1ACI A;  2HYF A;  4AIH A;  3GTJ J;  1KU2 A;  1U9O A;  3QAH A;  1ZLK A;  1MMG A;  1VF9 A;  3FMQ A;  3IRQ A;  2IEK A;  3CCQ I;  4E7L A;  2FBH A;  4KN4 X;  1SD4 A;  1AU7 A;  1SAN A;  1Y1W J;  2UXX A;  2IGM A;  1TNT A;  1H8A C;  1FY7 A;  2CO5 A;  4A3B J;  1MND A;  3BR0 A;  2MLG A;  2E1N A;  4MFE A;  1A35 A;  4A0X A;  1W7P B;  2K27 A;  2RQP A;  4L0Y B;  3WG9 A;  1DUX C;  2EBI A;  1RZ4 A;  1IXR C;  1SVM A;  2VJ4 A;  5L3F A;  3S2W A;  4S05 A;  2EZL A;  1MD0 A;  1RNL A;  5JFR A;  2P4W A;  3CCM I;  2F4M B;  2KL4 A;  3GF2 A;  2DA7 A;  2KKO A;  1W1W E;  3TDZ C;  2L4M A;  2UWM A;  3IHU A;  2MLK A;  3OYA A;  1AKH A;  1IUY A;  1Y8R B;  2F5C A;  3F6O A;  3GXO A;  1QZY A;  4KYW A;  4C3J J;  1T56 A;  3CP2 A;  5EDN A;  2O7O A;  4P96 A;  3KFW X;  1FT9 A;  3SQN A;  4EJU A;  3S3M A;  1D1B A;  2QF7 A;  2F4O B;  2AXT C;  2HQA A;  2XIG A;  1MBK A;  1Z0X A;  1ZKG A;  2HQ5 A;  2ZXH A;  4LGW A;  1X3W B;  1O3Q A;  1B4A A;  3K9T A;  4G9Y A;  3PUF A;  2VQG A;  1MJB A;  4P9F A;  1JXS A;  2EQR A;  3QOE A;  1X19 A;  4P5O A;  2WBM A;  3RKW A;  5BPD A;  1F36 A;  2RN7 A;  3QPL A;  2DA5 A;  2G9W A;  4ZJZ A;  4G8X A;  2DYR H;  1U3E M;  2QQA A;  2LSO A;  4A6E A;  2LKP A;  3L7W A;  3CO7 C;  5DEQ A;  1HW5 A;  1K78 A;  3OYB A;  3V42 A;  5M3M J;  2IGO A;  3OS0 A;  1D0X A;  4CSW A;  1TWC J;  4AVP A;  1D1A A;  3M8E A;  1KYW A;  4YEJ A;  2PX9 A;  2LVS A;  3O8G A;  5CVI A;  3DCF A;  1BI3 A;  2FSW A;  4RB2 C;  2JA7 J;  4UHT A;  2W85 A;  5HOO A;  2QSF X;  3FBN B;  3F8C A;  1W36 D;  4HBL A;  4M3G A;  1YHQ I;  1X3Z B;  5J3L A;  2L7K A;  4I76 A;  2XF5 A;  1GVJ A;  3ULQ B;  4RB0 A;  1QGP A;  3O3K A;  1ITY A;  2LD5 A;  1XCV A;  1J59 A;  5E17 F;  2A6T A;  1IXS B;  1MH3 A;  3BR1 A;  3GCM A;  3GTK J;  3VYU B;  2JUC A;  2MH2 A;  3ROU A;  2VJI A;  5LD2 C;  5FJ8 J;  1EJ9 A;  1XGN A;  1JJ6 C;  5J6X A;  2L5Q A;  4D1Q A;  2JN6 A;  2CQK A;  5E1Z B;  3LQQ A;  3RSN A;  2F5F A;  1QU3 A;  1A6Q A;  3ZRG A;  3LSG A;  1UG2 A;  3T8T A;  2A5Y B;  2RKH A;  2CV1 A;  1PP7 U;  2FXA A;  3S15 J;  4RGX A;  4XSX F;  2GIV A;  4NC6 A;  1ON2 A;  3ZXS A;  3OIQ A;  3WTV C;  1X1P A;  1QHH D;  2L9N A;  2YPR A;  2P8T A;  3LA3 A;  3K2Z A;  4OMZ A;  3ZQQ A;  1H9T A;  3F8F A;  2DFH A;  2VUM J;  3M1E A;  3WTY C;  1DP7 P;  4BQO A;  1VTN C;  1U78 A;  4CYC A;  4ZZL A;  4BDY A;  1Y39 A;  4ZYH A;  2WV1 A;  3WTX C;  5AIP A;  5D5X B;  1HST A;  1JKO C;  2E1C A;  5FB2 A;  5D5W B;  1FWZ A;  2GLO A;  2FF4 A;  1MH4 A;  3JRG A;  4Z6Y A;  5FRN A;  3KE2 A;  1S3J A;  3WTS C;  3RKY A;  3QPS A;  2KIQ A;  4ABZ A;  2I8D A;  4EJW A;  2R5Y A;  1YG2 A;  1U2W A;  3HIF A;  3DBR B;  1G8X A;  4CCL A;  3CC2 I;  4ETS A;  4HLX A;  1JTX A;  3I59 A;  2OD5 A;  4ENM A;  3PSF A;  3G71 I;  2RAE A;  4BQQ A;  3R0J A;  3DTE A;  2V1N A;  3HBL A;  3SZT A;  1KU9 A;  1PDN C;  3WTZ A;  2W00 A;  1BR4 A;  4DBQ A;  2PN6 A;  4HDU A;  3CCS I;  2XV4 S;  1QPI A;  1W0T A;  4IRI A;  4Y3O A;  1LE8 A;  4I0B A;  5BMZ A;  2Z2S B;  5CLS A;  2QBY B;  3OYK A;  1LDK B;  1NG6 A;  4G12 A;  1OCC H;  5CVU A;  2B0L A;  4I7H A;  1XGS A;  2ECC A;  2MD5 A;  5D4R A;  3MCZ A;  3DLA A;  2XKP A;  5JI6 A;  1J09 A;  2ZXI A;  4A6D A;  2BY3 A;  2EIJ H;  2R5Y B;  2P5V A;  3HRS A;  4F7Z A;  2ZC2 A;  1LDJ A;  2KFD A;  3PIO F;  1OMI A;  1W5T A;  4RM3 A;  4IX7 A;  3GTQ J;  2CW7 A;  2H1K A;  4IJA A;  5FKM A;  3BG9 A;  2GXA A;  4RAZ A;  3RPU D;  4YG2 F;  5IYD J;  2EB7 A;  3W2W A;  4XLP F;  1QA6 A;  3HC7 A;  2WAE A;  4C30 A;  4HPQ A;  2P81 A;  1UAA A;  1XDU A;  1IDZ A;  3F72 A;  4EM2 A;  2W7N A;  4J00 A;  4IKF A;  3MZH A;  2F5V A;  5GAD J;  4AIJ A;  3WTU C;  2ZO4 A;  1UZC A;  3ECH A;  4XOT A;  2YU9 J;  1G3T A;  1J75 A;  3BQZ A;  2JMW A;  4MEX F;  4ESB A;  4Q48 A;  5E1X A;  2FE3 A;  1IN5 A;  1IJW C;  2X1D A;  1FYL A;  1DU6 A;  2EZK A;  2HYJ A;  3QYB A;  5H6Q A;  1R71 A;  2HDD A;  1QVU A;  5EEG A;  5IPA A;  2VE9 A;  1IRZ A;  1W5S A;  2CUE A;  2V1X A;  4HX7 A;  2XPW A;  3HJE A;  3S8P A;  3RI4 A;  1CF7 A;  2OPT A;  3F22 A;  4JX4 A;  3IV5 A;  2PFB A;  1ZRF A;  4WXD A;  2VL8 A;  1B1B A;  1WGX A;  3ABT A;  3EUH C;  4HF2 A;  3GZ5 A;  3BT9 A;  2XDV A;  3K4J A;  2LKX A;  2KP6 A;  4GYG A;  2DK5 A;  2NXN B;  2VJJ A;  2DOD A;  4N9H A;  1S29 A;  4C3I J;  4Q5S F;  1F9N A;  2NAZ A;  4XLA A;  3UKG A;  1XSV A;  3QYE A;  4NHJ A;  2KRC A;  4FCY A;  3KPH A;  2JA8 J;  1S72 I;  4ESF A;  4D0P A;  2X6Y A;  2KRF A;  2B9S A;  1ETQ A;  3HGG A;  4L5I A;  3OYD A;  2MYS A;  2QM3 A;  3JRD A;  2D45 A;  2HU9 A;  1D1C A;  3VWB A;  5E1W A;  4HSR A;  4IL6 C;  5M5Y J;  1OR7 C;  2EPF A;  1ZH5 A;  1MKM A;  1R1U A;  3K0L A;  3KEQ A;  4JQF A;  1MBE A;  1ULY A;  2A6E F;  3FF5 A;  4LIT A;  2HWV A;  4LMY A;  1HDD C;  2HEO A;  3LA2 A;  4MHG A;  2M0M A;  1HF0 A;  2FRH A;  3Q0U A;  3H9G A;  2ID6 A;  1YW7 A;  3DKX A;  5E8I A;  1XTA A;  2GA2 A;  1UMQ A;  4HZF A;  3L9F A;  4BAY A;  4A5M A;  4U0V A;  4IRH A;  3QP6 A;  4HX4 A;  1T95 A;  1WJE A;  2ZXW H;  3L2W A;  5IT9 K;  2LY9 A;  3FXJ A;  2OTJ I;  1ZG3 A;  1FC3 A;  5HS9 A;  3JRC A;  3GYH X;  2QEX I;  3RCO A;  3TOB A;  3V4G A;  1MSE C;  1MBH A;  1RC9 A;  1GHC A;  3KP2 A;  4UV9 A;  3M8J A;  1P6R A;  3GTL J;  1KQ8 A;  2HKX A;  3AG4 H;  3GWZ A;  4M71 A;  2M8G X;  5CKT A;  3H92 A;  9ANT A;  5K1Y A;  3CCE I;  5H2F C;  3BR2 A;  3FXQ A;  2HR3 A;  3HRU A;  1QNT A;  3ML6 A;  5J1Y A;  2VC0 A;  2P6S A;  3OSG A;  1G3S A;  1VQ5 I;  1K6O A;  2M7B A;  2X48 A;  1Z9C A;  3OL4 A;  3FXK A;  3H3V K;  5IP6 A;  2WC2 A;  2A69 F;  3CME I;  3J80 Z;  5JLX A;  2AXL A;  4QTR A;  2CG4 A;  2KMU A;  3MVP A;  2K86 A;  3HL2 A;  4XKB A;  1QQI A;  3I53 A;  2ME0 A;  1ZGA A;  3CJT B;  3E6D A;  3J81 K;  1D0Y A;  1AHD P;  2H27 A;  1IN8 A;  4RAG A;  3CJN A;  3OYC A;  5M3F J;  1UHM A;  2BYV E;  1IGN A;  2W82 A;  3ERM A;  2ADU A;  4EQQ A;  3JR9 A;  1RRJ A;  4CH7 A;  5EEH A;  1XX5 A;  3T0Y A;  2ZME C;  1YLF A;  3H1C A;  2C6Y A;  3J7A Y;  2BOL A;  5B1B H;  3PIP F;  4KNY A;  3I4N J;  4U7D A;  2XGX A;  3V7R A;  2M45 A;  1GDT A;  1E2X A;  2M3A A;  1T2K A;  1Z1D A;  4XKW A;  3CMM A;  4OIO F;  4IF4 A;  4OU0 A;  2YS9 A;  2Y30 A;  3DKW A;  4GRI A;  2O61 A;  2HGC A;  4BY7 J;  2HTS A;  2IW5 A;  4NBQ A;  3I9V 2;  3HSE A;  3ZQI A;  4BHP A;  1U5T A;  3B02 A;  2GA1 A;  3ZMS A;  3WG7 H;  4YFK F;  1Q1H A;  2Y0M A;  4A3E J;  1J0R A;  1UG0 A;  1FZP B;  1IAW A;  4PDK A;  4E4H A;  4AUX A;  4P1W A;  4DZP A;  1A6I A;  3HM5 A;  4I98 B;  5F1J A;  3CQZ J;  1IUF A;  4L9T A;  4BHC A;  3MZY A;  1VQP I;  3ZCO A;  2TDX A;  4AWX B;  5LGU A;  1UHS A;  4RLF A;  3QRF F;  1P92 A;  2QEN A;  1FP2 A;  1MDM A;  4NUB A;  1ETK A;  1UB9 A;  3IH4 A;  4M9S A;  2HKO A;  4LOC A;  2MAB A;  3MEX A;  1B72 B;  1I1S A;  4B48 A;  2ZXJ A;  1I6H J;  3FXU A;  3ZGK A;  1T0F A;  2FBK A;  2M5W A;  1OLT A;  3U1K A;  3IKT A;  1Y6I A;  2FBI A;  5EGO B;  3HOU J;  1S7O A;  3KET A;  5HOD A;  4BXX J;  2F2E A;  2WAQ A;  4LLL A;  2RQQ A;  2PMU A;  4U7B A;  2R93 J;  2Y2Z A;  2HYG D;  2K9S A;  2GOM A;  2XAJ A;  2M4K A;  3MZ8 A;  1OCT C;  4CZZ A;  2DA3 A;  3H0G J;  3TO6 A;  3OIO A;  1TZL A;  3P5J A;  2MC3 A;  2GXB A;  1MDM B;  5K5R A;  3GX4 X;  4E7I A;  2Y75 A;  1FIA A;  3G1L A;  4UUS B;  3ASN H;  3BCA A;  2DQR A;  1QZZ A;  2X1C A;  3S1N J;  3EUK L;  5HLT A;  3CCR I;  2HDW A;  2ECB A;  4Q47 A;  4GGG A;  2CUZ A;  3FMS A;  3A1Y A;  3R61 A;  3WHB A;  1I6X A;  5L3D A;  3BTI A;  4XLN F;  4DW6 A;  4C2T A;  1WI3 A;  2O9L A;  4LLN A;  5ICE A;  5J4V A;  5JLW A;  1XS9 A;  1FSE A;  4BKX A;  1RR8 C;  1ZYR F;  3DEU A;  3IAM 2;  4OIP F;  5FGM A;  4GDF A;  1FP1 D;  4E7H A;  3ABK H;  1NH3 A;  4O3M A;  2DMQ A;  4M9Z A;  5KNL A;  1JUS A;  3A4C A;  3JAM Z;  4EJT A;  3C18 A;  1UST A;  3S16 J;  1GV5 A;  5E3L A;  4QPO A;  1LUJ B;  3W6J B;  2K85 A;  3ZMT A;  3CF5 F;  3FKJ A;  3BLY A;  2NVT J;  2LRE A;  1G6N A;  3L2Q A;  3I4M J;  2HPM A;  4BXU A;  1D0Z A;  5IP7 J;  4S04 A;  1ZRD A;  3C2G A;  2CQX A;  3A01 A;  2O3F A;  2HDC A;  3GEZ A;  1FJL A;  2IJL A;  1ETO A;  3VFZ A;  2RGV A;  5F1R A;  3PO3 J;  4M3E A;  4BGD A;  2LR8 A;  2DFF A;  3GTO J;  2M2E A;  3E5X A;  2MC4 A;  3TKY A;  1V3F A;  3SDB A;  4XSZ F;  4BAC A;  2JVH A;  5AIQ A;  2W48 A;  3ASO H;  3A02 A;  4UXN A;  1JKP C;  1APL C;  3PUB A;  4YIR X;  2JPB A;  5CQG A;  1BM9 A;  2LBF A;  5L3B A;  1W5C C;  1YQA A;  4OAY A;  3Q9S A;  2D2W A;  3DKY A;  1TQM A;  2GOX B;  2LY1 A;  5CVR A;  2GQQ A;  2E7W A;  5LBQ A;  4IHV A;  5CJ9 A;  3NEU A;  2OA4 A;  2WAQ N;  4BHB A;  1FTT A;  1IRX A;  2O8K A;  2UUZ A;  5LRR A;  2UZK A;  1WJA A;  1N77 A;  1FPQ A;  5B3S H;  4RBO A;  5IP9 J;  1QZE A;  4IQ4 A;  3CO6 C;  1TWH J;  2E35 A;  3TO7 A;  3OYI A;  3SEZ A;  4HEA 2;  2HVR A;  1E0E A;  4KIC A;  1E3H A;  4OMY A;  4PFP A;  3RQ4 A;  5E20 A;  1BW5 A;  3AAF A;  4V2F A;  3LA7 A;  4BXF A;  2Z33 A;  3LFU A;  4PSX A;  4MTE A;  2LBF B;  4BJ6 C;  1MW7 A;  2CFO A;  3S1R J;  2DN0 A;  4EJO A;  1M1E B;  4FHT A;  4LLG F;  4PUS A;  1LDD A;  2MH9 A;  5HNH A;  1T8I A;  1JE8 A;  6PAX A;  5EF6 A;  5HLH A;  4XRS A;  1DPU A;  3ISP A;  4DBR A;  3SFI A;  4HYE A;  3SXY A;  4HNV A;  3RQI A;  2CUJ A;  5EG0 B;  1DP3 A;  5J4Y A;  3BPV A;  3DXJ F;  2KZV A;  2CRG A;  3I0T A;  3TBI A;  2YX4 A;  2I5U A;  3LAP A;  1FOK A;  2Y31 A;  1X4P A;  2H1L A;  2IA1 A;  1REP C;  1TLH B;  2Z1D A;  1AWC A;  1PVE A;  5EYR A;  2A3S A;  4I09 A;  4JK1 X;  5KAI C;  4MEY F;  2PLY A;  1W7P A;  2IS2 A;  4HNU A;  2VBW A;  1YJN I;  3VSK A;  3N97 A;  2P0W A;  3QYF A;  4FIS A;  2LP0 A;  1BL0 A;  1ZTR A;  5C44 J;  1Z67 A;  1TW2 A;  3G1O A;  1BBY A;  4NB5 A;  5F6F A;  3BG5 A;  1JUM A;  2WWY A;  3S3N A;  3GTG J;  1HOM A;  1GXP A;  4I2O A;  4AD9 A;  3IH3 A;  1NK3 P;  3MFK A;  2BVL A;  1J2X A;  3JRE A;  3BC8 A;  2DPD A;  2XGD A;  1D5Y A;  2NNY A;  1V55 H;  3BG3 A;  3DU5 A;  3PJR A;  3MKL A;  2EFP A;  2OUM A;  2R7O A;  2XSD C;  2GAU A;  3OYH A;  1NHA A;  5IYB J;  3BP8 A;  1ZLJ A;  4I99 C;  1R1V A;  4GYI A;  4HV6 A;  1I3Q J;  1Z05 A;  2VBZ A;  3F8N A;  3BG7 A;  1U9N A;  4CZC A;  2ME6 A;  5K7H A;  2BY1 A;  1DPR A;  3J80 K;  5FFZ A;  1B9M A;  3K70 D;  5IT9 Z;  1RR7 A;  3HTS B;  2L9S A;  4WXC A;  3I64 A;  3FWE A;  2PBI A;  1MBJ A;  3P9C A;  3OY9 A;  1HCR A;  2ESN A;  1YYV A;  3RYR A;  4PJM A;  2CQQ A;  3RKQ A;  2ZNZ A;  2H09 A;  4MIM A;  2ETH A;  4Y15 A;  1HDP A;  2VKH A;  5ERI A;  2VPR A;  4HST A;  3LST A;  1Y8Q B;  4HQM A;  1O4X A;  1RPW A;  1ONV A;  3R0A A;  4LK0 F;  4YII A;  1JKQ C;  4RMN A;  2Q1Z B;  1MBF A;  2DMU A;  1VND A;  5L3G A;  5E3M A;  2FNP A;  5FLM J;  4LFU A;  4WWC A;  5ILS A;  1E3O C;  1BI1 A;  1EKE A;  1GLN A;  1QO0 D;  3F0C A;  4KT6 A;  3HRT A;  2QSH X;  3T5X A;  3EPZ A;  2H6B A;  1BR2 A;  1XD7 A;  4ON0 A;  5H6R A;  4MLO A;  3WGG A;  3BTL A;  3N4M A;  1ZG5 A;  1MSF C;  3EET A;  1IW7 F;  3KYL A;  2KDZ A;  3WGH A;  3T1B A;  2DO7 A;  2TCT A;  4BU2 A;  2BXY A;  1EA3 A;  2A05 A;  4R8H A;  2QZ8 A;  2Z99 A;  3WTT C;  2AS5 F;  2BY0 A;  3FBI B;  1XGO A;  4HF0 A;  4PK4 A;  1LNW A;  1FMW A;  5EJC A;  2YSR A;  3HPG A;  3OOP A;  1SMY F;  1BOB A;  3J81 Z;  2NRA C;  2IT0 A;  3A03 A;  2IA2 A;  2R7D A;  2XF7 A;  1L0O C;  1S8N A;  1SFK A;  1S5L C;  2F48 A;  1IV6 A;  2WY7 Q;  1YX3 A;  1WH5 A;  3IC7 A;  2KZG A;  4D7N A;  2R7W A;  3E5U A;  4CGZ A;  4BE0 A;  2KIU A;  2CS3 A;  2JVG A;  2P7V B;  2DPU A;  3E3V A;  3UNG C;  1JHH A;  4V19 K;  1TNS A;  3JCU C;  3GZN B;  1SMT A;  1OCR H;  3ZPL A;  1KQ0 A;  1TQI A;  3QU3 A;  4C2M J;  4CIC A;  1J9I A;  4L9V A;  1SAU A;  2VBX A;  3G4S I;  5HNF A;  4ENK A;  3M3Y J;  3CCY A;  3M8F A;  1A04 A;  5M5X J;  2RV8 A;  4PGH A;  1TWF J;  4BNC A;  1EH7 A;  4UY8 I;  5B66 C;  1FX7 A;  2AQF A;  5FKK A;  2HNH A;  3WOD F;  1IDY A;  1VQK I;  4ZTF A;  2F5D A;  1JT0 A;  4A3C J;  3Q9V A;  2D1H A;  3DQV C;  5ICC A;  4M6Y A;  3FXM A;  3C2B A;  3EYY A;  1R4M B;  2DI3 A;  2XHK A;  1FIP A;  3NWS A;  2JJ7 A;  5JVT A;  5DM6 F;  2FNA A;  1F43 A;  2EA4 A;  1ON1 A;  3LAJ A;  3ZP5 A;  3HUG B;  4B47 A;  2ZKZ A;  3ZMZ A;  4HW0 A;  4E70 A;  2VT2 A;  1VQ9 I;  2YR2 A;  4HF1 A;  2E34 A;  2V1U A;  1ETW A;  2BHZ A;  3HTU A;  2RVC A;  5DD8 A;  3HZJ A;  1GT0 C;  2JA6 J;  3S1Q J;  4EJV A;  2DXI A;  2V26 A;  5D8L B;  2XGC A;  1Z6T A;  2GM4 A;  3CZ6 A;  3HKZ N;  2QBY A;  4P55 A;  3ZQH A;  2VQH A;  2OZU A;  3JAM K;  2DQL A;  3RJP A;  2WB1 N;  3ZOB A;  1U0J A;  2DJN A;  2OQR A;  2DOF A;  4LJZ F;  4G7Z F;  1KGS A;  2QKM B;  1WPK A;  3WU2 C;  3V7C A;  3ERE D;  3QOP A;  1LFU P;  2FQ4 A;  5ILV A;  2IRF G;  4IHT A;  2W25 A;  2VB6 A;  4H4K C;  4B43 A;  3L2R A;  1DDN A;  1BJA A;  1SFO J;  2KLO A;  4IPA A;  5JHF A;  2IAI A;  1XN7 A;  3HG9 A;  3CCJ I;  2CU7 A;  1U8R A;  2CYY A;  2BEO A;  2IS6 A;  2VC1 A;  1K4S A;  1QHG A;  2OZ6 A;  3HSF A;  4RAF A;  2NVQ J;  1RES A;  2V1D A;  4E7J A;  2CV2 A;  1R49 A;  2E36 A;  2DAO A;  3GO5 A;  3AFH A;  4MQ9 F;  3OYF A;  4M3D A;  4U0W A;  2V4J C;  3K1M A;  3L09 A;  5E3N A;  4R79 A;  5EZH A;  1BIB A;  1IN6 A;  1GV2 A;  4Y33 A;  4PJN A;  5GAH J;  3K1N A;  3CUQ C;  2DJI A;  2LLK A;  3MQ0 A;  2LFB A;  1XG1 A;  2HXI A;  4B44 A;  2K7L A;  2NOJ B;  1D5V A;  3B73 A;  3BR6 A;  4L9N A;  3VOE A;  2IVM A;  4HNT A;  1DU0 A;  1GUU A;  4JOM A;  2OCC H;  4KMU X;  5HDK A;  4R1H A;  5J8C A;  1PUF B;  1K7A A;  1HQC A;  5K5O A;  3QOD A;  3F9K A;  4HV5 A;  3PO2 J;  3MN2 A;  2COB A;  2L01 A;  3PSI A;  3IRR A;  3CUQ B;  3DWL E;  4N9I A;  1ZAR A;  3RKX A;  3OYG A;  3TOA A;  3OYM A;  1BR1 A;  4BBS J;  3EUH A;  1JGG A;  4BEH B;  1W36 C;  3CF2 A;  1B8I B;  3J7A O;  1FOY A;  3H0D A;  2XAQ A;  3I71 A;  2KHM A;  1LKX A;  3HB9 A;  3S3O A;  2MA3 A;  2E2J J;  1YJW I;  2FJ1 A;  2A5W A;  2LY2 A;  3K1P A;  1IRG A;  2MSY A;  2AO9 A;  3DFG A;  4XM3 A;  2OC6 A;  4F93 B;  1IRF A;  2O0Y A;  1HLV A;  5DCM B;  4H0E A;  3RZD J;  2E5N A;  1HC8 A;  2R7T A;  5BQT A;  1FBS A;  3QP5 A;  3U1D A;  2ZJQ F;  1YTY A;  1OPC A;  1OR7 A;  2EIL H;  3EQL F;  1SFX A;  1T33 A;  2LTP A;  4KUM A;  1O7F A;  3MD2 A;  4B4C A;  3L1P A;  4JBA A;  2A61 A;  3TED A;  4JP0 A;  3M07 A;  3H5N A;  1KZH A;  1V5F A;  2M34 A;  1GVD A;  4L18 B;  2LMD A;  4RGR A;  5LRS A;  2Z3Y A;  1OCO H;  3DU6 A;  1BI2 A;  1CGP A;  1LEB A;  2VJ5 A;  1ZR4 A;  2P5L C;  2LF7 A;  4ENJ A;  1OKR A;  1FMV A;  3LQR A;  5FKN A;  4IHW A;  2LOO A;  4EEF G;  1ORK A;  2R7F A;  2PJP A;  2BBY A;  4A3F J;  5L3C A;  1R36 A;  5DM7 F;  2F6C A;  2KIM A;  4ENN A;  4DIQ A;  3F3X A;  4HRI A;  2LYC A;  1WFX A;  3TO9 A;  2LF8 A;  2D1V A;  2XRN A;  4DGW B;  4LG0 B;  2GZW A;  2EIM H;  3HHH A;  4PJJ A;  2LH9 A;  2XAS A;  1Y0N A;  1TP4 A;  2G7H A;  3TQN A;  4CCM A;  1TC3 C;  1YOV B;  3CC7 I;  2ZCW A;  4FAS D;  2A68 F;  4LIU A;  2AHQ A;  4ZDP A;  3CMY A;  1Z3X A;  3CDH A;  4XRS G;  5FFX A;  2R4G A;  1MGT A;  4O5V A;  1JUP A;  2ID3 A;  4D5F A;  4MTD A;  1K61 A;  3WGI A;  2JWT A;  2XRL A;  2GBY A;  2MD0 A;  3P9K A;  2Y48 A;  1OYI A;  3LSH A;  2CSO A;  3OL3 A;  3OS1 A;  1WJF A;  2CJJ A;  4XID A;  3H35 A;  1R5I D;  2DA4 A;  5HLI A;  4B09 A;  2LG4 A;  3BR5 A;  4S0H B;  4NQW B;  3WU1 B;  1B9N A;  5GAG J;  2FX0 A;  1HKS A;  2RNG A;  4IHS A;  5LGN A;  1RET A;  2ZBK A;  4KIB A;  4BE2 A;  3BTC A;  2KQR A;  1YIJ I;  1S6L A;  2X6W A;  5TRD A;  4MGR A;  3ONQ A;  3QU6 A;  4ASN A;  3CCU I;  2X51 A;  4B8X A;  2CW8 A;  2XSJ C;  4YFN F;  3HDD A;  1H88 C;  1ZG1 A;  2BW3 B;  2V9V A;  5GTH C;  1MMS A;  3CTA A;  1UHW A;  4F3Q A;  3KP7 A;  2DT6 A;  3BZ6 A;  3GUD A;  4UNO A;  5H20 A;  3ABU A;  2ZME A;  3U9G A;  4Y17 A;  3I55 I;  1R22 A;  3A0B C;  2LKS A;  4OIR F;  4IOC F;  3IAS 2;  5DUK A;  3GFJ A;  4M72 A;  5CVV A;  1K79 A;  1Y56 A;  3K2A A;  4OWR B;  3OOU A;  1UCR A;  1OQY A;  2FD5 A;  1XDS A;  2QUF A;  4KIF A;  3ZR8 X;  4N4O B;  2UV1 A;  1OCZ H;  2IS4 A;  3PFY A;  1E3P A;  1B72 A;  1AOY A;  2EIN H;  4I6Z A;  3K4B A;  1MNE A;  3F8M A;  3KX2 A;  2HFH A;  5D5U B;  1XMK A;  4I02 A;  3OS2 A;  5EGO A;  3IL2 A;  2V79 A;  3DPU A;  5KK1 A;  4M74 A;  4NDL A;  1X1A A;  1NTC A;  2FQ3 A;  2ZME B;  1ZHF A;  3J7Y J;  4RAY A;  2CFX A;  2G0E A;  2VXD A;  3DP7 A;  1MJ9 A;  1KQ9 A;  3FXR A;  2DDA A;  1WZ2 A;  3KEY A;  4XK4 A;  3GBG A;  1RUO A;  5LHG A;  1G4D A;  1T6S A;  1Z77 A;  2JSC A;  4N0B A;  3GFI A;  2R7V A;  3X2Q H;  1KU3 A;  3C7J A;  4KJZ A;  4EM0 B;  2FMY A;  1LJ9 A;  5FLX Z;  2VN2 A;  4UUS A;  1R9T J;  2PEX A;  2JRM A;  2X9D A;  3NQO A;  3GVA A;  5EZG A;  3JRF A;  2GWR A;  2ISY A;  1ZGJ A;  3ZQF A;  3MWM A;  3ZQL A;  1A31 A;  2Q8K A;  3CLQ A;  4O6J A;  3OYE A;  2EIK H;  5F0H A;  1N75 A;  2L7Z A;  3V7S A;  1JI8 A;  4I01 A;  2R7U A;  3F21 A;  1R1T A;  4BQN A;  2VE8 A;  3JW4 A;  3ZQC A;  4FET A;  4I0A A;  1H89 C;  3ECO A;  3LSR A;  2IBD A;  4DYR A;  3GFM A;  1FYK A;  3OR2 C;  1KYZ A;  2OJE D;  2X6X A;  2BE5 F;  1SD6 A;  2IXS A;  3R60 A;  3NRV A;  2K4B A;  4E7Z A;  4EM1 A;  2HQN A;  4KIT B;  3O2P E;  1HA8 A;  3RDI A;  3PQK A;  1MIJ A;  3HOX J;  2Q2E B;  3BZC A;  1MMN A;  2DT7 B;  3OYN A;  1C0W A;  4WXH A;  2L2O A;  3B6C A;  5KHD A;  2R92 J;  1D3Y A;  3D1N I;  5BPI A;  3TDU C;  3S2D J;  2EFW A;  3HRM A;  3KZY A;  1LPQ A;  4QIW N;  2M30 A;  2W24 A;  1WJD A;  1N78 A;  3NAR A;  2KRH A;  5JHU A;  3DLL F;  5LLQ A;  2DFE A;  1IN4 A;  1W7P D;  1G59 A;  1WHU A;  4PJ0 C;  2LRD A;  4XMY A;  3KP4 A;  3M1C A;  3KZI C;  3V8K A;  4BE1 A;  2A07 F;  5D8K B;  1YS6 A;  5DUI A;  1SAX A;  2ICW G;  4UUV A;  3MKY B;  1XB4 A;  5K7Z A;  5F0C A;  1FLI A;  5F0F A;  2ZJ2 A;  1X3U A;  2PJR A;  2KIS A;  3BCB A;  3SJM A;  1LQ1 A;  2XF6 A;  2PI0 A;  1S9H A;  1TT0 A;  3M4O J;  3H3Z A;  4BH9 A;  3ABL H;  4EMS A;  1VFC A;  2QQB A;  2VOP A;  2RDP A;  3HOY J;  3PNT A;  3CMA I;  2BXZ A;  4D5C A;  3H5A A;  1YW9 A;  4CCO A;  1OFC X;  3PM1 A;  1FSH A;  2NNN A;  1ZR2 A;  3H9J A;  1RI7 A;  2R3S A;  3JTG A;  2WY8 Q;  2EA2 A;  4G6Q A;  4AVZ A;  3ZN1 A;  3MKZ A;  3KYC B;  5FRM A;  3DTI A;  2H8W A;  1KON A;  3IKV A;  3WHC A;  4KA4 A;  2MG4 A;  2E2H J;  3LSK A;  2VKV A;  5LFA A;  4LD5 A;  1ZGW A;  1TWG J;  3DEE A;  5C4X J;  3RIR A;  5EG0 A;  4AID A;  1N25 A;  2FML A;  2CGP A;  3CLO A;  2PJR B;  4HG2 A;  3I3L A;  2EFQ A;  2ZSI B;  4BJT A;  3OV8 A;  5K5Q A;  2XUB A;  5DD4 A;  1MZB A;  4M6X A;  4ZDL A;  3F6V A;  5HDN A;  4C9Y A;  3JRB A;  3FK7 A;  3I54 A;  3HOS A;  1J5Y A;  2ELJ A;  1DQU A;  5DYM A;  4G7H F;  2DFI A;  2VAS A;  3K4N A;  4BBR J;  3WTW C;  4M3B A;  2HVS A;  1XCB A;  3MMY B;  3EUA A;  1YIO A;  1Q1V A;  1YW8 A;  3EYI A;  2M4G A;  3AKZ A;  2ZSH B;  4WCG A;  4Y4R A;  1IV8 A;  4L0Z B;  2O5R A;  1XC5 A;  3G3Z A;  4XLF A;  2YUS A;  4XL9 A;  2FUG 2;  4PSW A;  3S14 J;  1P4A A;  5GPA A;  4QLC U;  2V7F A;  2QQ9 A;  2RRE A;  3BJA A;  2KJC A;  1LEA A;  4KMF A;  3FXL A;  3FM3 A;  3PFI A;  3LOC A;  2ELH A;  4RGS A;  2R7X A;  1WJB A;  5KAF C;  2J5P A;  1P7I A;  4U0Y A;  3S32 A;  2KIF A;  4UVC A;  1FBU A;  5E8G A;  3SEQ A;  5F08 A;  1VQN I;  3MKW B;  3T8R A;  4HX8 A;  4RM2 A;  2E60 A;  4WK8 F;  1LVK A;  2X1E A;  4XBF A;  1Z6R A;  1YI2 I;  2ELK A;  1SFE A;  2JQ7 A;  2VT3 A;  2M9H A;  1MNM C;  2B63 J;  3E5Q A;  2DLL A;  4D7M A;  2HOT A;  5BOX A;  5FKL A;  4F52 A;  5J40 A;  3OSF A;  2QSG X;  1RKT A;  2XVC A;  4PZJ A;  4KIS A;  3E1S A;  3WU0 A;  2R7Z J;  2EFN A;  1QRY A;  3AG3 H;  4GO1 A;  3L2C A;  2K4J A;  2OF7 A;  2DTZ A;  4AC0 A;  1IN7 A;  5IT3 A;  1TW3 A;  2CWE A;  4EVI A;  3DV8 A;  3BDD A;  3HYI A;  4CYD A;  3D0S A;  4TV7 A;  2GXG A;  1U6G A;  3TW7 A;  2MFZ A;  3K4K A;  2W4S A;  4NC8 A;  4L5E A;  4AIK A;  3A2K A;  1VQL I;  4FT8 A;  1HBX G;  5KVR A;  4YEL A;  1BC7 C;  5J1U A;  3H3U A;  2O8X A;  1Z91 A;  4ZTJ A;  3KP6 A;  5A2Q K;  1DGW Y;  3C3W A;  3JRI A;  2CUF A;  3U21 A;  5F64 A;  2WAD A;  4BDZ A;  4V2G A;  2VIX A;  3KZZ A;  3QWL A;  4XLC A;  3M7G A;  3HOT A;  3FXO A;  3TGN A;  2JK3 A;  4A93 J;  2R5Z B;  2HVQ A;  3SFZ A;  3COA C;  3JRH A;  1HSJ A;  3M9A A;  1VQ8 I;  3FMR A;  3HKZ A;  4EAT A;  1BJZ A;  2HOE A;  4ZH4 F;  3WE2 A;  4IEJ A;  2QGU A;  2WB1 A;  5E79 C;  1BW6 A;  1WRJ A;  4ZYG A;  1YRN A;  2DA2 A;  3BJ6 A;  2IGN A;  5DS9 A;  3G1M A;  5LGT A;  2FA5 A;  2R7Q A;  4XLH A;  2RC4 A;  2R7R A;  2QLZ A;  4XN0 A;  4DQ2 A;  3DPT A;  2VKE A;  3O6B B;  2VXZ A;  3BY6 A;  3HHG A;  1ETX A;  1R58 A;  3IUO A;  3BZK A;  5TIS C;  1VQ6 I;  2EFO A;  1D8K A;  4IVN A;  2V9K A;  4CCJ A;  2VKD A;  2ZB9 A;  1FNN A;  4C3H J;  4IHX A;  1Z21 A;  5FLX K;  1USS A;  2J5O A;  3HUG A;  3SHF A;  4GXO A;  2E7X A;  1QPM A;  4IOA F;  3FHZ A;  3ZMD A;  4XOR A;  2VLA A;  1P9Q C;  3AG2 H;  4IO9 F;  1AKH B;  2H94 A;  1X1B A;  1QBJ A;  2STW A;  1YRN B;  2QQ8 A;  2JA5 J;  1HW2 A;  2XGE A;  4N4N B;  1OJL A;  1VQ4 I;  1YIT I;  3K10 A;  5FLV A;  4OAZ A;  1SFU A;  1BOA A;  3DTK A;  4ZYE A;  4LG3 A;  2W1O A;  1B6A A;  4A0Y A;  4PJL A;  1IZ1 A;  5IOZ A;  4A3K J;  2EV0 A;  4FQG A;  3OIP A;  1FEX A;  3OYJ A;  1XSD A;  1LB2 A;  2F5E A;  4IHY A;  2CQN A;  4MFD A;  2E2I J;  2EV5 A;  1J7K A;  3K7A J;  4Y52 J;  1TTY A;  4QWQ A;  1VQ7 I;  4LIV A;  4M73 A;  1ETY A;  2OU2 A;  2L9V A;  1K6Y A;  4GFB A;  1B59 A;  4A3D J;  3BJO A;  3E0J B;  4IRG A;  1FTZ A;  1WQ2 A;  1UFM A;  2VON A;  3HSR A;  2NS7 A;  1P4X A;  1K78 B;  1WCM J;  3CDL A;  3BR3 A;  4M3F A;  1ZRC A;  5F04 A;  3DF8 A;  1LFP A;  1TQP A;  4X1E A;  1WKM A;  4X6A J;  3LSI A;  1I27 A;  3CJR B;  4II2 A;  4LB5 A;  1PYV A;  5DCF A;  2EZI A;  2W84 A;  2LC2 A;  1DGR M;  2YU3 A;  3LMM A;  1EH6 A;  4CUG A;  3G6E I;  1BN5 A;  1R00 A;  5E18 F;  4E6K G;  1FOX A;  4XOP A;  2QWW A;  3LSM A;  3H9Q A;  2EV6 A;  2K9N A;  3IWZ A;  5FKO A;  1WI9 A;  1H0M A;  2DA1 A;  1YS7 A;  4UUT A;  1WH7 A;  3E7L A;  3K70 C;  4PFO A;  4K2E A;  2WAF A;  3UR3 C;  2V6E A;  4KFC A;  4EV0 A;  3JSO A;  1ENH A;  2H8R A;  4OIQ F;  1SEU A;  4CA0 A;  1NG7 A;  3L2U A;  4A3I J;  2LK2 A;  2W57 A;  3GTP J;  3HPH A;  3KEO A;  4ITV A;  1VQM I;  3W6K B;  3QPT A;  2HOA A;  4KIG A;  3N05 A;  3BTJ A;  3GLX A;  3TP0 A;  2DU9 A;  4ZZD A;  2BV6 A;  1PUF A;  1X58 A;  2L9R A;  4DZJ A;  1X1C A;  2TRT A;  3DPL C;  5FRO A;  3K6G A;  4XRM A;  1OYY A;  5LHI A;  1FBQ A;  1ZQ3 P;  2EJR A;  4QPQ A;  1HKT A;  1JT6 A;  2X85 A;  2M8E A;  2ZJR F;  2STT A;  1E17 A;  2NOG A;  3GFL A;  3PQJ A;  3HGY A;  2BY2 A;  2D5V A;  4CO8 A;  3CD6 I;  3CUQ A;  1T38 A;  4ANJ A;  3GZ6 A;  2XB0 X;  4BEH A;  1VZ0 A;  3FZV A;  4F55 A;  1B8I A;  4W97 A;  4CYC B;  4XN3 A;  1V4R A;  2A6H F;  4KT5 C;  1IXC A;  2E19 A;  3TP3 A;  3BG6 A;  3G2B A;  3KIO A;  3NAU A;  4JYK A;  4E7S A;  5HLG A;  5DCM A;  5GPC A;  4RA2 A;  2HI3 A;  3D5L A;  3VYR B;  3ZN0 A;  3I59 B;  2V6C A;  3TL4 X;  3GTM J;  3CP8 A;  4GCV A;  3BPX A;  5IOY A;  3I4P A;  4XKC A;  3S93 A;  2VOD A;  1VQO I;  1RKW A;  3VB2 A;  3H36 A;  4OOI A;  1POG A; 
#chains in the Genus database with same CATH homology
 5D6E A;  4A12 A;  4G6D A;  2M87 A;  3ZMV A;  2HTJ A;  4UV8 A;  4Y13 A;  4LG0 A;  3F23 A;  2O6G E;  4HLY A;  2NS0 A;  2P5K A;  2K02 A;  4DNC A;  1L3L A;  1W4M A;  4MQV A;  4KN7 X;  2HZT A;  5LEK A;  2L3D A;  4UVA A;  4BYY A;  2PMH A;  5DDG A;  1CF7 B;  4RB1 A;  3P9I A;  4FX0 A;  4EGY A;  2XRO A;  3G73 A;  3WE3 A;  4NQW A;  1JGS A;  3BOQ A;  1T39 A;  3LWF A;  1KA8 A;  1HW1 A;  3E6B A;  3FX3 A;  1WSU A;  2OBP A;  1Z7U A;  1PUE E;  5D5V B;  4A2U A;  1F4K A;  3I58 A;  3RTR A;  2Z9O A;  3RPU A;  4WX9 A;  1SD7 A;  1R7J A;  3KLO A;  2EK5 A;  1BC8 C;  4ZYD A;  4HA8 A;  2EWN A;  4FX4 A;  4EGZ A;  5ILU A;  4L5J A;  2FU4 A;  3RYP A;  2UXN A;  3E97 A;  5ICF A;  3REO A;  4XRF A;  5A2Q Z;  3EDP A;  2VOO A;  2DBB A;  2P7C B;  3L00 A;  4G7O F;  5FD6 A;  2JT1 A;  1STZ A;  1P4W A;  4RS8 A;  3CUO A;  4OIN F;  2DT5 A;  1O57 A;  5ED4 A;  2X4H A;  1XMA A;  5LEJ A;  3RPQ A;  1T98 A;  3E6C C;  2WV0 A;  3U2R A;  2HS5 A;  5HVQ C;  5CYV A;  1MJA A;  2DW4 A;  2L4A A;  2ZFW A;  2L02 A;  1ZRE A;  2Q0O A;  1R5H A;  5JR3 A;  1O3S A;  5J8F A;  5CVJ A;  5LHH A;  1ZN2 A;  1D8J A;  3MAJ A;  3R4K A;  2XKO A;  5AON A;  5D6F A;  1P2F A;  1OYW A;  1GXQ A;  1EV7 A;  2Q2E A;  1U5T C;  1RIO H;  2PG4 A;  4L9J A;  3VOD A;  4YIF A;  3FM5 A;  1YFH A;  1IF1 A;  4P9U A;  3KCC A;  2BGC A;  3JTH A;  2LDU A;  2COM A;  3GW2 A;  2NYX A;  1U5T B;  4HAM A;  3IWF A;  1HXD A;  5FD5 A;  2ACJ A;  1WWX A;  3F8B A;  1H9G A;  2JZY A;  4CHU A;  1ODD A;  5L3E A;  3BWG A;  3I5U A;  4Q4Z F;  4PCQ A;  3KP3 A;  2L54 A;  3C1D A;  2ZNY A;  4YFX F;  5DV5 A;  1O3T A;  2DK8 A;  2DTR A;  1SD5 A;  4UVB A;  2FOK A;  1O3R A;  1I1G A;  4RB3 C;  1PP8 F;  2XAF A;  3VEP A;  1F1Z A;  1Y0U A;  1BI0 A;  2HQR A;  2VBY A;  2YX7 A;  3E6M A;  4G94 A;  2G7U A;  2IA0 A;  2MBF A;  3SZP A;  2FEZ A;  4A5N A;  4LB6 B;  2QVO A;  3V8L A;  2O03 A;  3LFK A;  2IPQ X;  5ICG A;  1FYM A;  1ZAO A;  2JRT A;  4BQA A;  4IXA A;  3Q5F A;  3ELK A;  2ISZ A;  2IP2 A;  1G3W A;  5D4S A;  4M9X A;  4WF2 A;  2QYO A;  2ESH A;  4PGG A;  4ESJ A;  2OAZ A;  1S7A A;  1TBX A;  4U88 A;  1R5G A;  1F5T A;  4RGU A;  1XSX A;  2JTV A;  4CXF A;  1RUN A;  4HDV A;  3P7N A;  2CW0 F;  3KLN A;  5FO5 A;  1R23 A;  1YO5 C;  2M1B A;  2RNJ A;  2XAG A;  3QPH A;  3JSP A;  1G3Y A;  2KJB A;  4A0Z A;  1O7L A;  4HOB A;  1BIA A;  2JPC A;  4LK1 F;  1KU7 A;  1EH8 A;  4CDG A;  2H6C A;  3V8J A;  2WTE A;  1HKQ A;  2LNB A;  4HQE A;  2OQG A;  5HS8 A;  5BS6 A;  2XAH A;  5HDG A;  2Z5U A;  3K69 A;  3ZMU A;  2X0L A;  1LVA A;  3KP5 A;  1JHF A;  5TJJ A;  1I5Z A;  2PQ8 A;  3R6S A;  3ZQ7 A;  4KDP A;  5HS7 A;  3BRO A;  4MNU A;  1XGM A;  4Z2Y A;  2P6T A;  2HYF A;  4AIH A;  1KU2 A;  3QAH A;  1ZLK A;  3FMQ A;  3IRQ A;  2FBH A;  4KN4 X;  1SD4 A;  2UXX A;  1TNT A;  1FY7 A;  2CO5 A;  2MLG A;  2E1N A;  4A0X A;  1W7P B;  2K27 A;  2RQP A;  4L0Y B;  3WG9 A;  1DUX C;  1RZ4 A;  1IXR C;  5L3F A;  3S2W A;  4S05 A;  1MD0 A;  1RNL A;  5JFR A;  2P4W A;  3GF2 A;  2KKO A;  3TDZ C;  2L4M A;  2UWM A;  3IHU A;  2MLK A;  1IUY A;  2F5C A;  3F6O A;  3GXO A;  1QZY A;  4KYW A;  4P96 A;  3KFW X;  1FT9 A;  3SQN A;  4EJU A;  2XIG A;  4LGW A;  1O3Q A;  1B4A A;  3K9T A;  4G9Y A;  4P9F A;  1MJB A;  1JXS A;  4P5O A;  3RKW A;  5BPD A;  2RN7 A;  2G9W A;  4G8X A;  1U3E M;  2QQA A;  2LSO A;  4A6E A;  2LKP A;  3L7W A;  3CO7 C;  5DEQ A;  1HW5 A;  1K78 A;  4AVP A;  3M8E A;  1KYW A;  5CVI A;  1BI3 A;  2FSW A;  4RB2 C;  4UHT A;  2W85 A;  5HOO A;  3F8C A;  4HBL A;  1GVJ A;  3ULQ B;  4RB0 A;  1QGP A;  3O3K A;  1XCV A;  1J59 A;  5E17 F;  1IXS B;  2MH2 A;  3ROU A;  1XGN A;  5J6X A;  2CQK A;  5E1Z B;  3LQQ A;  2F5F A;  3T8T A;  2A5Y B;  2RKH A;  1PP7 U;  2FXA A;  4RGX A;  4XSX F;  2GIV A;  1ON2 A;  3WTV C;  2YPR A;  2P8T A;  3LA3 A;  3K2Z A;  4OMZ A;  1H9T A;  3F8F A;  3M1E A;  3WTY C;  1DP7 P;  1VTN C;  1U78 A;  4ZZL A;  4ZYH A;  3WTX C;  5AIP A;  5D5X B;  1HST A;  2E1C A;  5FB2 A;  5D5W B;  1FWZ A;  2FF4 A;  3KE2 A;  1S3J A;  3WTS C;  3RKY A;  4EJW A;  1YG2 A;  1U2W A;  3HIF A;  4ETS A;  4HLX A;  3I59 A;  2OD5 A;  4ENM A;  3R0J A;  3SZT A;  1KU9 A;  1PDN C;  3WTZ A;  4HDU A;  2PN6 A;  2XV4 S;  4IRI A;  4I0B A;  5BMZ A;  5CLS A;  2QBY B;  1LDK B;  5CVU A;  2B0L A;  4I7H A;  1XGS A;  2MD5 A;  5D4R A;  3MCZ A;  2XKP A;  5JI6 A;  4A6D A;  2P5V A;  3HRS A;  4F7Z A;  1LDJ A;  1OMI A;  1W5T A;  4IJA A;  4RAZ A;  4YG2 F;  2EB7 A;  4XLP F;  1XDU A;  3F72 A;  4EM2 A;  3MZH A;  4AIJ A;  3WTU C;  2ZO4 A;  3ECH A;  1G3T A;  1J75 A;  4MEX F;  4ESB A;  4Q48 A;  5E1X A;  2FE3 A;  1IN5 A;  1FYL A;  5H6Q A;  5EEG A;  2VE9 A;  1W5S A;  2V1X A;  4HX7 A;  3RI4 A;  1CF7 A;  3F22 A;  2PFB A;  1ZRF A;  4WXD A;  1B1B A;  3ABT A;  4HF2 A;  3GZ5 A;  4GYG A;  2DK5 A;  4N9H A;  1S29 A;  4Q5S F;  1F9N A;  2NAZ A;  1XSV A;  4NHJ A;  4ESF A;  4D0P A;  2KRF A;  4L5I A;  2QM3 A;  2D45 A;  5E1W A;  1ZH5 A;  1MKM A;  1R1U A;  3K0L A;  3KEQ A;  4JQF A;  1ULY A;  2A6E F;  3FF5 A;  4LMY A;  2HWV A;  2HEO A;  3LA2 A;  4MHG A;  2FRH A;  1YW7 A;  5E8I A;  2GA2 A;  4HZF A;  3L9F A;  4BAY A;  4A5M A;  4U0V A;  4IRH A;  3QP6 A;  4HX4 A;  5IT9 K;  1ZG3 A;  1FC3 A;  5HS9 A;  3GYH X;  3TOB A;  3V4G A;  1GHC A;  3KP2 A;  4UV9 A;  1P6R A;  1KQ8 A;  2HKX A;  3GWZ A;  4M71 A;  3H92 A;  5K1Y A;  3FXQ A;  2HR3 A;  3HRU A;  1QNT A;  3ML6 A;  2VC0 A;  2P6S A;  1G3S A;  1K6O A;  1Z9C A;  2WC2 A;  2A69 F;  3J80 Z;  2AXL A;  2CG4 A;  2K86 A;  1QQI A;  3I53 A;  1ZGA A;  3E6D A;  3J81 K;  2H27 A;  1IN8 A;  3CJN A;  1UHM A;  2BYV E;  2ADU A;  4EQQ A;  5EEH A;  3T0Y A;  1YLF A;  2C6Y A;  4KNY A;  4U7D A;  2XGX A;  3V7R A;  2M45 A;  1E2X A;  1T2K A;  1Z1D A;  4OIO F;  4IF4 A;  4OU0 A;  3DKW A;  2O61 A;  2HGC A;  2HTS A;  2IW5 A;  3HSE A;  4BHP A;  1U5T A;  3B02 A;  2GA1 A;  3ZMS A;  4YFK F;  1Q1H A;  2Y0M A;  1J0R A;  1FZP B;  1IAW A;  4PDK A;  4I98 B;  4L9T A;  4BHC A;  3MZY A;  2TDX A;  4AWX B;  5LGU A;  3QRF F;  1P92 A;  2QEN A;  1FP2 A;  1MDM A;  1UB9 A;  4M9S A;  2HKO A;  3MEX A;  1I1S A;  2ZXJ A;  3FXU A;  1T0F A;  2FBK A;  2M5W A;  3IKT A;  2FBI A;  1S7O A;  3KET A;  2F2E A;  4LLL A;  2PMU A;  4U7B A;  2HYG D;  2XAJ A;  4CZZ A;  3TO6 A;  2MC3 A;  2GXB A;  1MDM B;  5K5R A;  3GX4 X;  2Y75 A;  2DQR A;  1QZZ A;  4Q47 A;  4GGG A;  3FMS A;  3R61 A;  1I6X A;  5L3D A;  4XLN F;  4LLN A;  5ICE A;  1FSE A;  1ZYR F;  3DEU A;  4OIP F;  5FGM A;  1FP1 D;  4O3M A;  4M9Z A;  3JAM Z;  4EJT A;  1UST A;  3C18 A;  3W6J B;  3ZMT A;  1G6N A;  4BXU A;  1ZRD A;  4S04 A;  2O3F A;  2HDC A;  3GEZ A;  2IJL A;  3VFZ A;  2RGV A;  5F1R A;  3E5X A;  3TKY A;  1V3F A;  4XSZ F;  5AIQ A;  4UXN A;  2JPB A;  1BM9 A;  5L3B A;  1YQA A;  3Q9S A;  2D2W A;  1TQM A;  5CVR A;  2GQQ A;  2E7W A;  5LBQ A;  5CJ9 A;  3NEU A;  2OA4 A;  4BHB A;  5LRR A;  2UZK A;  1FPQ A;  3CO6 C;  3TO7 A;  4KIC A;  4OMY A;  5E20 A;  3AAF A;  3LA7 A;  2Z33 A;  4MTE A;  4EJO A;  4FHT A;  4LLG F;  1LDD A;  2MH9 A;  1JE8 A;  6PAX A;  5HLH A;  1DPU A;  3ISP A;  4HYE A;  3SXY A;  3BPV A;  3DXJ F;  3I0T A;  2YX4 A;  3LAP A;  1FOK A;  2IA1 A;  1REP C;  1TLH B;  1AWC A;  2A3S A;  4I09 A;  4JK1 X;  4MEY F;  2PLY A;  1W7P A;  2VBW A;  3N97 A;  1TW2 A;  1BBY A;  4NB5 A;  5F6F A;  2WWY A;  1GXP A;  4I2O A;  4AD9 A;  3MFK A;  1J2X A;  2DPD A;  2NNY A;  2EFP A;  2GAU A;  1NHA A;  3BP8 A;  1ZLJ A;  1R1V A;  4GYI A;  4HV6 A;  1Z05 A;  2VBZ A;  3F8N A;  3J80 K;  1DPR A;  5FFZ A;  1B9M A;  5IT9 Z;  3HTS B;  4WXC A;  3I64 A;  3FWE A;  2PBI A;  3P9C A;  2ESN A;  1YYV A;  3RYR A;  2ZNZ A;  2H09 A;  2ETH A;  4Y15 A;  5ERI A;  3LST A;  4HQM A;  1ONV A;  3R0A A;  4LK0 F;  4YII A;  5L3G A;  2FNP A;  4LFU A;  4WWC A;  5ILS A;  1BI1 A;  1QO0 D;  3HRT A;  3T5X A;  2H6B A;  1XD7 A;  4ON0 A;  5H6R A;  3WGG A;  3N4M A;  1ZG5 A;  3EET A;  1IW7 F;  3WGH A;  3T1B A;  2DO7 A;  4R8H A;  2QZ8 A;  2Z99 A;  3WTT C;  2AS5 F;  1XGO A;  4HF0 A;  1LNW A;  2YSR A;  3OOP A;  1SMY F;  3J81 Z;  2NRA C;  2IT0 A;  2IA2 A;  2R7D A;  1L0O C;  1S8N A;  3IC7 A;  3E5U A;  4CGZ A;  2KIU A;  2DPU A;  2P7V B;  3E3V A;  1JHH A;  1TNS A;  1SMT A;  3ZPL A;  1KQ0 A;  1TQI A;  3QU3 A;  4CIC A;  1J9I A;  4L9V A;  2VBX A;  4ENK A;  3M8F A;  1A04 A;  2RV8 A;  4PGH A;  4BNC A;  1EH7 A;  1FX7 A;  3WOD F;  2F5D A;  3Q9V A;  2D1H A;  3DQV C;  5ICC A;  4M6Y A;  3EYY A;  2DI3 A;  2XHK A;  5JVT A;  2FNA A;  2EA4 A;  1ON1 A;  3LAJ A;  3ZP5 A;  2ZKZ A;  3ZMZ A;  4HW0 A;  4E70 A;  2VT2 A;  2YR2 A;  4HF1 A;  2V1U A;  3HTU A;  2RVC A;  5DD8 A;  4EJV A;  5D8L B;  1Z6T A;  2QBY A;  4P55 A;  2OZU A;  3JAM K;  2DQL A;  3RJP A;  2OQR A;  4LJZ F;  4G7Z F;  1KGS A;  3V7C A;  3ERE D;  3QOP A;  5ILV A;  2IRF G;  4IHT A;  2W25 A;  1DDN A;  1BJA A;  4IPA A;  1XN7 A;  1U8R A;  2CYY A;  2BEO A;  2VC1 A;  2OZ6 A;  3HSF A;  2V1D A;  2DAO A;  3GO5 A;  4MQ9 F;  4U0W A;  3K1M A;  3L09 A;  4R79 A;  1BIB A;  1IN6 A;  3K1N A;  3CUQ C;  3MQ0 A;  2K7L A;  1D5V A;  3B73 A;  3VOE A;  4L9N A;  2IVM A;  4KMU X;  5HDK A;  4R1H A;  5J8C A;  1K7A A;  1HQC A;  5K5O A;  4HV5 A;  2L01 A;  3IRR A;  3CUQ B;  4N9I A;  1ZAR A;  3RKX A;  3TOA A;  3EUH A;  3J7A O;  2XAQ A;  3I71 A;  2MA3 A;  3K1P A;  1IRG A;  3DFG A;  1IRF A;  2O0Y A;  5DCM B;  4H0E A;  5BQT A;  1FBS A;  3QP5 A;  3U1D A;  1YTY A;  1OPC A;  1OR7 A;  3EQL F;  1SFX A;  4KUM A;  1O7F A;  4JBA A;  2A61 A;  4L18 B;  4RGR A;  5LRS A;  2Z3Y A;  1CGP A;  1BI2 A;  1LEB A;  2P5L C;  2LF7 A;  4ENJ A;  1OKR A;  3LQR A;  2R7F A;  2PJP A;  2BBY A;  5L3C A;  1R36 A;  2KIM A;  4ENN A;  3F3X A;  3TO9 A;  2LF8 A;  2D1V A;  2XRN A;  4LG0 B;  2GZW A;  3HHH A;  2XAS A;  2G7H A;  3TQN A;  2ZCW A;  2A68 F;  3CDH A;  5FFX A;  1MGT A;  4O5V A;  4MTD A;  3WGI A;  3P9K A;  2Y48 A;  1OYI A;  2CSO A;  5HLI A;  4B09 A;  3WU1 B;  1B9N A;  1HKS A;  4IHS A;  5LGN A;  2ZBK A;  4KIB A;  1S6L A;  5TRD A;  4MGR A;  3QU6 A;  4ASN A;  4B8X A;  4YFN F;  1ZG1 A;  2V9V A;  3CTA A;  1UHW A;  3KP7 A;  3BZ6 A;  3GUD A;  4UNO A;  5H20 A;  3ABU A;  2ZME A;  3U9G A;  4Y17 A;  1R22 A;  4OIR F;  5DUK A;  3GFJ A;  4M72 A;  5CVV A;  1K79 A;  1UCR A;  2QUF A;  4KIF A;  1XDS A;  1AOY A;  3F8M A;  2HFH A;  5D5U B;  1XMK A;  4I02 A;  3IL2 A;  2V79 A;  5KK1 A;  4M74 A;  2FQ3 A;  2ZME B;  1ZHF A;  4RAY A;  2CFX A;  3DP7 A;  1MJ9 A;  1KQ9 A;  3FXR A;  1RUO A;  5LHG A;  1G4D A;  1T6S A;  2JSC A;  4N0B A;  3GFI A;  1KU3 A;  3C7J A;  4EM0 B;  2FMY A;  1LJ9 A;  5FLX Z;  2VN2 A;  2PEX A;  3NQO A;  3GVA A;  2GWR A;  2ISY A;  1ZGJ A;  3MWM A;  2Q8K A;  4O6J A;  3V7S A;  4I01 A;  3F21 A;  1R1T A;  2VE8 A;  3JW4 A;  4I0A A;  3ECO A;  3GFM A;  1FYK A;  1KYZ A;  2BE5 F;  1SD6 A;  3R60 A;  3NRV A;  2K4B A;  4EM1 A;  2HQN A;  3O2P E;  3RDI A;  3PQK A;  1C0W A;  4WXH A;  1D3Y A;  5BPI A;  3TDU C;  2EFW A;  3HRM A;  3KZY A;  2M30 A;  2W24 A;  5JHU A;  5LLQ A;  1IN4 A;  1W7P D;  3KP4 A;  3V8K A;  2A07 F;  5D8K B;  1YS6 A;  5DUI A;  1SAX A;  4UUV A;  1XB4 A;  1FLI A;  2ZJ2 A;  1X3U A;  1LQ1 A;  2PI0 A;  3H3Z A;  4BH9 A;  4EMS A;  2QQB A;  2VOP A;  2RDP A;  1YW9 A;  1FSH A;  2NNN A;  1RI7 A;  2R3S A;  3JTG A;  2EA2 A;  4G6Q A;  3ZN1 A;  3IKV A;  4KA4 A;  4LD5 A;  3RIR A;  2FML A;  2CGP A;  3CLO A;  2EFQ A;  3OV8 A;  5K5Q A;  2XUB A;  5DD4 A;  1MZB A;  4M6X A;  3F6V A;  5HDN A;  3I54 A;  3HOS A;  1J5Y A;  5DYM A;  4G7H F;  2DFI A;  3WTW C;  1XCB A;  1YIO A;  1YW8 A;  3EYI A;  4WCG A;  4L0Z B;  3G3Z A;  1P4A A;  4QLC U;  2QQ9 A;  3BJA A;  2KJC A;  1LEA A;  4KMF A;  3FM3 A;  3PFI A;  2ELH A;  4RGS A;  2J5P A;  4U0Y A;  2KIF A;  4UVC A;  1FBU A;  5E8G A;  3T8R A;  4HX8 A;  4WK8 F;  4XBF A;  1Z6R A;  1SFE A;  2VT3 A;  3E5Q A;  2DLL A;  5BOX A;  2XVC A;  4PZJ A;  3WU0 A;  2EFN A;  4GO1 A;  3L2C A;  2K4J A;  1IN7 A;  5IT3 A;  1TW3 A;  2CWE A;  4EVI A;  3DV8 A;  3BDD A;  3HYI A;  4CYD A;  3D0S A;  4TV7 A;  2GXG A;  1U6G A;  4AIK A;  4FT8 A;  1HBX G;  5KVR A;  1BC7 C;  3H3U A;  2O8X A;  1Z91 A;  3KP6 A;  5A2Q K;  3C3W A;  5F64 A;  3KZZ A;  3M7G A;  3HOT A;  3TGN A;  3SFZ A;  3COA C;  1HSJ A;  3M9A A;  3FMR A;  2HOE A;  4ZH4 F;  3WE2 A;  1WRJ A;  4ZYG A;  3BJ6 A;  5LGT A;  2FA5 A;  2RC4 A;  2QLZ A;  4DQ2 A;  3DPT A;  3O6B B;  2VXZ A;  3BY6 A;  3HHG A;  1R58 A;  2EFO A;  1D8K A;  4IVN A;  1FNN A;  5FLX K;  1USS A;  2J5O A;  3HUG A;  3SHF A;  4GXO A;  2E7X A;  1QPM A;  3FHZ A;  3ZMD A;  2H94 A;  1QBJ A;  2STW A;  1HW2 A;  1SFU A;  1BOA A;  4ZYE A;  1B6A A;  4A0Y A;  1IZ1 A;  2EV0 A;  1XSD A;  1LB2 A;  2F5E A;  2EV5 A;  1J7K A;  1TTY A;  4QWQ A;  4M73 A;  2OU2 A;  1B59 A;  3BJO A;  4IRG A;  1WQ2 A;  1UFM A;  2VON A;  3HSR A;  1P4X A;  1K78 B;  1ZRC A;  3DF8 A;  1TQP A;  1WKM A;  1I27 A;  4LB5 A;  5DCF A;  2W84 A;  2YU3 A;  1EH6 A;  1BN5 A;  1R00 A;  5E18 F;  2QWW A;  2EV6 A;  3IWZ A;  1WI9 A;  1H0M A;  1YS7 A;  4K2E A;  4KFC A;  4EV0 A;  3JSO A;  4OIQ F;  2W57 A;  3KEO A;  3W6K B;  3QPT A;  4KIG A;  3GLX A;  2DU9 A;  4ZZD A;  2BV6 A;  3DPL C;  1OYY A;  5LHI A;  1FBQ A;  2EJR A;  1HKT A;  2M8E A;  2STT A;  1E17 A;  3GFL A;  3PQJ A;  4CO8 A;  3CUQ A;  1T38 A;  3GZ6 A;  3FZV A;  1V4R A;  2A6H F;  4KT5 C;  1IXC A;  5HLG A;  5DCM A;  3D5L A;  3ZN0 A;  3I59 B;  2V6C A;  4GCV A;  3BPX A;  3I4P A;  2VOD A;  3VB2 A;  4OOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...