3KP5A

Staphylococcus epidermidis tcar in complex with kanamycin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
136
Chain Sequence
RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator/antibiotic
molecule keywords Transcriptional regulator TcaR
total genus 49
structure length 136
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp5A00
4LGWA 2XKOA 1SFXA 5K1YA 2DFIA 1QBJA 4AVPA 2AXLA 2XASA 4HX4A 1YW8A 1ZLJA 5ILUA 2IJLA 1T38A 2PFBA 3CDHA 2FQ3A 5BOXA 3C7JA 4M9SA 4L9NA 5HS7A 1R1UA 3WGIA 4HF1A 3V7CA 3KP6A 2JRTA 4XSXF 3SQNA 4EQQA 4LB6B 1QQIA 4R79A 2R7DA 5AONA 1R7JA 3CUQB 3WTTC 2XROA 2WTEA 4IRHA 1F1ZA 1OYYA 1O3TA 3N97A 2V9VA 2ZNZA 4XSZF 4FX0A 4RGRA 1FSEA 3VODA 2GAUA 2VOPA 3JSOA 2Y0MA 3V4GA 3RI4A 3K1PA 1BN5A 2QENA 5BPDA 4Z2YA 5DCMA 1TW3A 3WTXC 3FZVA 1TW2A 1R1VA 1E17A 3E6MA 3EYIA 3EUHA 4I02A 4Q4ZF 2W85A 4CHUA 4HDUA 3NQOA 5DDGA 1DUXC 3KLOA 1EH6A 1SMYF 4MQVA 5FD6A 1CF7B 2L3DA 2CFXA 3L09A 4UHTA 4BXUA 3J80Z 5FB2A 3SZPA 4GYGA 2XUBA 2OQGA 5ED4A 1YS7A 2RDPA 3H3UA 4HLYA 3QOPA 2P5LC 2KRFA 5A2QK 1BI0A 3LA3A 1RNLA 4JQFA 4L0YB 2K4JA 2LKPA 4WWCA 4CYDA 2XAGA 1BIAA 3DFGA 1LJ9A 2GQQA 3GFMA 4BHPA 2UZKA 1G3YA 3ISPA 5D4RA 4YFNF 3R0JA 3DP7A 1P92A 2WWYA 3COAC 4LG0B 4EGZA 2O8XA 2DQRA 1P4XA 5ICGA 4EJVA 2VOOA 4I7HA 1PP7U 2M30A 3ZN1A 4UNOA 4RGUA 3F6OA 5CVUA 3WTUC 2LSOA 3ZMZA 3CUQA 4U88A 3AAFA 2Z9OA 1EV7A 2JZYA 5LLQA 1BI1A 2BE5F 5LRRA 4OIQF 4M71A 3ML6A 2L4MA 3REOA 5LHGA 1FPQA 1J2XA 4MEYF 3ZN0A 1XCVA 4MQ9F 5D5VB 1P4AA 1UFMA 3ZMVA 1ZG1A 1MD0A 3WE2A 2GXBA 4XRFA 2J5PA 2EFQA 3DEUA 2OBPA 4CO8A 2LDUA 3JTGA 3TKYA 3I64A 4G94A 2DI3A 5DUKA 2F5DA 5FO5A 2HZTA 4LJZF 4RB0A 4PGHA 5E1WA 2G7HA 1S3JA 4ZYDA 5CVVA 1FP1D 2CQKA 5LHHA 4M9ZA 3MFKA 2ZJ2A 2K27A 3I5UA 2IPQX 2LF7A 1RUNA 2RKHA 4G8XA 3MCZA 3NRVA 4FX4A 2FBKA 2BGCA 1IF1A 4BYYA 3BJ6A 1I27A 5BMZA 3KZYA 1YYVA 3VFZA 3BP8A 4AD9A 3EQLF 5CVRA 1T39A 4GO1A 3V8JA 1R1TA 3RTRA 1IUYA 1LDDA 4EM1A 1IN6A 5HLHA 1EH7A 2V1DA 4P55A 4P9FA 3HRSA 2YX7A 1B1BA 4CZZA 5E18F 1FOKA 3IWFA 2J5OA 1KQ0A 3GWZA 2O0YA 2QQBA 4HOBA 2VODA 2IVMA 1YO5C 1MJBA 4ZZDA 3LA7A 3SHFA 4KMUX 4WXCA 3ULQB 2PMHA 3U1DA 1CGPA 3ZP5A 1WI9A 3J80K 5ICFA 4M9XA 2D1HA 3J81K 1Y0UA 3KP3A 1L0OC 2VT3A 3PQJA 5CYVA 4FHTA 1GHCA 3BWGA 2O61A 1F5TA 2MLGA 2M5WA 3BY6A 3GZ6A 4LFUA 2HS5A 3WGGA 2A6EF 2P5VA 1S6LA 1FP2A 2RN7A 3RKWA 2QVOA 5E8GA 2PG4A 2HR3A 4G6QA 2IA0A 5L3GA 5H6RA 2X4HA 2XAHA 2W25A 2DBBA 4M73A 3I53A 2MLKA 4HZFA 4UVAA 3WU1B 1OYWA 1Z1DA 2CW0F 3QU6A 4EVIA 1LVAA 3KZZA 4UV8A 3N4MA 3F72A 2PLYA 2MBFA 3GW2A 1Z05A 2EB7A 2QUFA 3KCCA 3IKTA 2FNAA 1GVJA 4M74A 5HS9A 4GGGA 2QQAA 2M8EA 1K78B 1ZYRF 5CJ9A 1I5ZA 1AWCA 4U0VA 3B73A 5DD4A 4UVCA 2STTA 4G7ZF 2KIFA 1BJAA 4HV6A 2ZMEA 4NHJA 1STZA 1ZLKA 2RNJA 1Z6TA 3D0SA 4MHGA 1P6RA 4IHSA 4LK0F 4CICA 4A5MA 2QQ9A 3C18A 2E7XA 4CXFA 1SFUA 4G9YA 1HKQA 3F6VA 1UB9A 4I2OA 3RPQA 2K86A 5LEJA 3GYHX 1TQPA 4A6EA 3T8TA 2M45A 1IXSB 2OAZA 1XSXA 3LQQA 3BJAA 2F5FA 3V8LA 3W6JB 4QWQA 3L00A 1G6NA 1O3RA 1ON1A 2QYOA 5D5XB 2YU3A 3T5XA 1FLIA 1HBXG 4IHTA 3TQNA 1QZZA 4NQWA 3BROA 1PDNC 3DV8A 1X3UA 3SXYA 3J81Z 1YQAA 4Y13A 1SAXA 3H3ZA 3JAMK 2ZKZA 5D4SA 1ZHFA 2MA3A 2Q8KA 4OIOF 5D5WB 1D8KA 3ZQ7A 4XLNF 3FHZA 3DXJF 3JTHA 4BHCA 4D0PA 3DKWA 3P9CA 2NYXA 4ZZLA 1EH8A 1MJ9A 3ECHA 1KQ8A 4BNCA 5HVQC 5L3BA 3F21A 1TNTA 1HKTA 2XAFA 3QP6A 4OIPF 4HLXA 3V7SA 1D5VA 5HDNA 1UHMA 4ESJA 4ZYGA 1REPC 4M6YA 3KP2A 2VONA 4LB5A 3VOEA 2CSOA 4A6DA 3F8FA 4K2EA 5F1RA 3RYRA 3U2RA 1JHHA 2RVCA 1DDNA 4M6XA 3CTAA 2A3SA 4O6JA 1I6XA 2EFOA 2LF8A 1FT9A 1R58A 5LHIA 4JK1X 1ON2A 2VXZA 2OA4A 2Z3YA 1FYMA 2CYYA 2ISYA 1ZREA 2TDXA 4I09A 4OMYA 1J0RA 5K5RA 3JSPA 4N9HA 1A04A 1MJAA 2MC3A 3VEPA 2COMA 4M72A 4Q48A 3V7RA 2IA2A 3EYYA 3DPTA 3I59B 1KA8A 1Z6RA 1S8NA 2Z99A 4BAYA 1ZG3A 3GX4X 4HAMA 5CVIA 3V8KA 3GFJA 1IAWA 2EA2A 1OKRA 3G73A 4HV5A 1WKMA 1WRJA 2GA2A 3GLXA 5ICEA 3CUOA 4P9UA 4B09A 1WQ2A 2PN6A 3E6DA 2FMLA 5DD8A 4L5JA 4RB3C 3DQVC 3TO6A 1R5HA 3U9GA 2P7VB 1PP8F 4UVBA 2A68F 4KN7X 4EJWA 1LEAA 1RUOA 3ZMTA 4KICA 5E1ZB 4TV7A 1BIBA 2Y75A 4A0XA 4IPAA 2GZWA 2EFNA 4KDPA 1S7OA 2DK8A 1KU2A 5FD5A 3F3XA 2JT1A 4KFCA 1U5TA 1T2KA 3GEZA 1W7PD 3R61A 1XMKA 3PQKA 1O57A 1H9GA 1QO0D 1KU9A 4HQEA 1HW1A 4L0ZB 3M8FA 4MNUA 1FYLA 1IN4A 3HOTA 3O3KA 3KFWX 1UHWA 1U8RA 4A2UA 1K6OA 1RZ4A 2V1UA 1ZH5A 3BZ6A 5F6FA 4ZYHA 4WCGA 5L3DA 3FWEA 1B9MA 3KP7A 4LK1F 3SFZA 5JVTA 1ZRFA 2V1XA 4MTDA 2DLLA 1TBXA 2UWMA 3WU0A 4KMFA 1B9NA 3KE2A 4Y17A 2XRNA 3ABTA 1W7PA 2XVCA 2FEZA 4XLPF 5BPIA 2EFWA 3E6BA 2F2EA 4EJUA 5TRDA 4L9JA 4L5IA 4HDVA 1XB4A 2FE3A 4A5NA 1DPRA 5FGMA 3RPUA 4MGRA 1TTYA 2ZFWA 2HGCA 4GCVA 5K5QA 1Z7UA 5H6QA 2VBYA 3JAMZ 3GO5A 3TO7A 1J9IA 5TJJA 2RV8A 3K69A 2IA1A 1G3TA 3HYIA 2IRFG 3J7AO 1U5TB 2XGXA 3EDPA 3HOSA 2RGVA 3PFIA 2HEOA 5AIPA 1HQCA 5DCFA 3E5XA 4ON0A 4GXOA 1QNTA 3QU3A 1ZARA 1OMIA 2OD5A 1FZPB 1JXSA 4PDKA 2GIVA 4AIHA 4DQ2A 4WX9A 3D5LA 3IRRA 1Z9CA 1T6SA 5HLGA 1FY7A 3FF5A 4UUVA 1LB2A 2DW4A 1W5TA 1GXPA 4RGSA 2HWVA 3RKYA 3FM5A 3IWZA 1TQMA 1FBSA 3HRUA 5KK1A 1R5GA 1OPCA 2HKXA 1QZYA 3OV8A 5JFRA 1T98A 2E7WA 4WK8F 2K7LA 1GXQA 1J5YA 1YW9A 2F5EA 3KETA 2P5KA 1XMAA 3QAHA 4CGZA 4I0BA 3HTSB 2DK5A 1LDKB 2DTRA 4ENJA 5LEKA 2VT2A 2FMYA 2VBZA 1R36A 3RJPA 1LQ1A 2PBIA 2YPRA 1ULYA 2K4BA 1F4KA 2OU2A 5CLSA 3LAPA 4ASNA 2FNPA 5J8CA 2VBWA 4EJTA 4A12A 2P7CB 2BV6A 2PMUA 2O6GE 1SMTA 3IHUA 5DUIA 1B59A 5FFZA 4MEXF 3FXQA 1YG2A 4EM2A 5ILVA 1HSJA 2O03A 4O5VA 3WODF 3ERED 3HSEA 2FOKA 2YR2A 3MWMA 2FU4A 4AWXB 5H20A 3EETA 1USTA 3VB2A 2FF4A 1R00A 1HKSA 2QWWA 2W57A 4ESBA 2NNNA 4JBAA 1I1SA 2DT5A 4A0YA 3WTYC 5AIQA 1FX7A 2B0LA 4KYWA 2FBIA 3B02A 3DPLC 3L9FA 4DNCA 1ZGJA 4PCQA 2STWA 2O3FA 3M1EA 3T8RA 3HUGA 2DO7A 5L3FA 3WTSC 1K78A 1G3SA 3LQRA 2NS0A 2MD5A 1KU7A 3FX3A 5D6FA 1O7FA 4WXDA 2ZMEB 3R4KA 4L9TA 1IXCA 4KNYA 3QPHA 3TOAA 2PI0A 1IN8A 1HSTA 2ZXJA 2M87A 4EJOA 1R22A 2EWNA 1FWZA 4P5OA 1IRFA 3WTVC 2IP2A 3M7GA 2X0LA 4ENNA 4R8HA 1XGMA 1J75A 3CLOA 5JI6A 3BOQA 3MZHA 4ZYEA 1XGOA 5DYMA 5L3CA 1F9NA 2YSRA 3E5UA 3F8NA 4G6DA 2L54A 2IW5A 4UXNA 3K0LA 2VC0A 3CO7C 1CF7A 2KJBA 3CJNA 2DU9A 3QRFF 2ZBKA 5J6XA 1RI7A 3P9KA 1BBYA 1FC3A 3QP5A 4R1HA 2EV6A 4A0ZA 2AS5F 4KN4X 2KJCA 2QBYA 4BHBA 2H09A 2P4WA 1ZAOA 4O3MA 3O6BB 1JE8A 1BC8C 1RIOH 3GF2A 4PGGA 2L02A 5IT9Z 3MZYA 4HX8A 2VN2A 2EV5A 3MQ0A 2VBXA 2FXAA 2H27A 3OOPA 3ZMUA 2RC4A 5DEQA 2V6CA 1BOAA 2XAQA 3FM3A 1IN7A 2UXXA 3F8BA 4IVNA 4HQMA 3KLNA 1Z91A 4LLGF 4RAZA 3IC7A 3LAJA 2JSCA 3GZ5A 2PQ8A 1OR7A 4IRIA 1HW2A 5JR3A 4N0BA 1H9TA 3L7WA 4HX7A 1MZBA 1BI3A 5BQTA 2H94A 1IRGA 4AIJA 4Q5SF 3LFKA 4IRGA 3I0TA 2NRAC 1MKMA 1JHFA 5LGTA 2EV0A 5ICCA 1IW7F 5A2QZ 1UCRA 4ESFA 4YFKF 3F22A 1XDSA 3I4PA 4YIFA 1AOYA 2HOEA 4UV9A 3WTZA 2QZ8A 2D2WA 5BS6A 5D5UB 2ESNA 4EV0A 2JPBA 2FSWA 3WE3A 3FXUA 2OZUA 3ZPLA 5HLIA 1QGPA 1XGNA 3P7NA 2DPDA 2NNYA 3M8EA 2E1NA 3T0YA 3ROUA 3I54A 3LSTA 3WGHA 2A61A 2HTSA 4L9VA 2Z33A 3BPVA 2BEOA 3HSRA 4XBFA 3H92A 1KYWA 1K7AA 2XHKA 3I59A 3K1NA 4RGXA 5E20A 1C0WA 3G3ZA 1O7LA 1SD4A 3KEOA 4I0AA 5J8FA 3BJOA 5FFXA 1LNWA 1MDMA 1USSA 5E17F 4OU0A 1O3QA 1I1GA 1U6GA 3W6KB 1WSUA 1SD5A 2FRHA 3HHHA 3P9IA 4ENKA 3BDDA 1KQ9A 1SD7A 5KVRA 3CO6C 4LD5A 1D3YA 3R6SA 2HYFA 2R7FA 1ODDA 2OQRA 2PEXA 4Q47A 2K02A 2KIUA 1H0MA 3SZTA 2Y48A 1SD6A 1KYZA 4RB2C 3Q9VA 4Y15A 1U78A 4IJAA 4B8XA 2BBYA 4RB1A 3HRMA 4WXHA 2EA4A 2WC2A 4OMZA 1TNSA 2DQLA 5ERIA 1U3EM 2F5CA 5LGNA 5E8IA 3KP4A 3RKXA 4S05A 2MH9A 2OZ6A 2Q2EA 5EEHA 3GFLA 5EEGA 1G3WA 2G9WA 4KUMA 3ELKA 3MAJA 1R23A 1JGSA 4ZH4F 3C3WA 2FBHA 2ZCWA 1T0FA 3TDUC 4AIKA 3O2PE 2Q0OA 2JPCA 3TGNA 2H6BA 2KIMA 1E2XA 5JHUA 1P2FA 2IT0A 1PUEE 2ZNYA 4MTEA 4YIIA 4PZJA 1D8JA 2QM3A 3E6CC 1XSVA 2H6CA 3IKVA 4IXAA 4U0YA 3RYPA 1V4RA 2P8TA 1XD7A 2FA5A 1FYKA 3HRTA 1YS6A 5ILSA 2EK5A 2YX4A 4U7BA 1B4AA 5FLXK 3GUDA 3Q5FA 1QPMA 3Q9SA 4HA8A 2DAOA 3TOBA 4G7HF 1YFHA 1IZ1A 1P4WA 5IT9K 1KU3A 2RQPA 3HTUA 5LGUA 1FNNA 5LRSA 2XIGA 4I01A 5L3EA 3LA2A 1J59A 3BPXA 4NB5A 2L01A 2ZO4A 5D6EA 1OYIA 1YIOA 1WWXA 1IN5A 2LNBA 3WG9A 4U0WA 2D1VA 2VE9A 1G4DA 2ISZA 2CGPA 3FMSA 3E97A 1U5TC 5FLXZ 3LWFA 5F64A 4HBLA 4G7OF 3F23A 1K79A 4H0EA 2GA1A 4FT8A 1FSHA 4ETSA 4IF4A 1Q1HA 4ENMA 4YFXF 3DF8A 1XGSA 3E5QA 4BQAA 4LLLA 4N9IA 1XCBA 1BI2A 2KKOA 2CO5A 2V79A 1XDUA 1W7PB 3GVAA 3CUQC 3T1BA 2GXGA 3R0AA 3ZMSA 4LG0A 2CWEA 3M9AA 5CVJA 4L18B 3ABUA 4HYEA 2CG4A 1MGTA 5IT3A 1ZG5A 4I98B 2HKOA 3FMRA 2A07F 1V3FA 3FXRA 4CDGA 4KIBA 3IRQA 1MDMB 3KP5A 1SFEA 2VC1A 3RDIA 2E1CA 1HW5A 4S04A 4F7ZA 5K5OA 2W24A 1ZRCA 1BM9A 1DP7P 3I58A 3K2ZA 2ACJA 4YG2F 2DPUA 2BYVE 3RIRA 3HIFA 4HF2A 5HDKA 1ZN2A 2HDCA 2EJRA 3R60A 1O3SA 5E1XA 1DPUA 1KGSA 2P6SA 1J7KA 1S29A 2A5YB 3WTWC 3IL2A 4RS8A 2ADUA 4GYIA 1S7AA 3TDZC 4P96A 2ESHA 2M1BA 2GWRA 4OOIA 1XN7A 2ELHA 2C6YA 4HF0A 1YW7A 5LBQA 5D8KB 4EGYA 4U7DA 2A6HF 2W84A 2P6TA 3QPTA 2XAJA 3ECOA 2G7UA 2L4AA 4QLCU 3L2CA 2HTJA 1W5SA 2HFHA 4OIRF 2R3SA 2JTVA 6PAXA 3K1MA 1B6AA 2MH2A 4EM0B 4KIFA 1FBQA 1YLFA 3F8MA 4HW0A 2WV0A 3C1DA 3HSFA 2HYGD 3HHGA 4WF2A 2HQRA 4KIGA 2Z5UA 4OINF 1TQIA 2VE8A 1NHAA 4BH9A 3S2WA 2PJPA 5DCMB 1IXRC 3JW4A 1W4MA 3I71A 1L3LA 2HQNA 2UXNA 4LLNA 5HOOA 2EFPA 3KEQA 1LEBA 3ZMDA 4LMYA 3F8CA 1VTNC 1BC7C 1HXDA 1ZGAA 5DV5A 4KA4A 4RAYA 1ONVA 1XSDA 5HDGA 4EMSA 1FBUA 1TLHB 3NEUA 4KT5C 3FMQA 3K9TA 1U2WA 2QBYB 1YTYA 2D45A 2QLZA 2A69F 5D8LB 3GFIA 1LDJA 5HS8A 3MEXA 1ZRDA 2XKPA 3TO9A 2NAZA 2XV4S 4E70A 2ETHA 3E3VA 3GXOA
chains in the Genus database with same CATH superfamily
4B4CA 1G2HA 4UB8C 4LGWA 2XKOA 4S0HB 1RETA 1B8IA 1SFXA 1OCCH 2OCCH 5K1YA 2DFIA 1QBJA 4FCYA 2L9SA 4AVPA 3TW7A 1PUFA 1R5ID 2AXLA 4NQWB 2XASA 2ZSHB 4HX4A 2XSDC 1YW8A 2LD5A 1ZLJA 5ILUA 3LSJA 1YITI 3PO2J 2IJLA 1T38A 2PFBA 1PJRA 3CDHA 2FQ3A 5BOXA 3C7JA 4G6TB 1GV5A 3K4LA 4M9SA 2HVRA 4L9NA 5FKLA 5HS7A 1R1UA 3WGIA 4HF1A 2R7QA 3V7CA 3CJTB 2CV1A 5J1UA 1FEXA 3KP6A 2JVGA 3HG9A 2JRTA 1T95A 4XSXF 3SQNA 4V19K 3GTMJ 4EQQA 4LB6B 2KDZA 1QQIA 2IGMA 4R79A 3AL0C 2R7DA 2EZKA 5AONA 4UUTA 3FISA 2R7XA 1R7JA 3DU6A 3ZQCA 2F4MB 2LR8A 1FMVA 3CUQB 3H0GJ 2A5WA 3WTTC 2X6XA 2XROA 2LREA 2M0CA 2WTEA 4IRHA 5F0HA 1F1ZA 2CUJA 3CMEI 1OYYA 1O3TA 1XC5A 3N97A 2V9VA 2ZNZA 2X1DA 4XSZF 1YI2I 4A3LJ 2ELKA 4FX0A 4XLCA 4RGRA 2E35A 1VFCA 1ETYA 1FSEA 3VODA 3OYLA 3NAUA 4BEHA 2GAUA 2VOPA 3JSOA 2L5QA 2Y0MA 5B5EC 3V4GA 4A3KJ 3RI4A 3K1PA 1FOWA 1BN5A 2QENA 2X1CA 2K85A 5BPDA 3CDIA 3H5NA 3M1CA 2PJRA 3HOUJ 4Z2YA 2XDVA 3B6CA 4NBQA 1BJZA 5DCMA 1TW3A 1ZELA 3WTXC 3CCUI 3EUKL 3FZVA 2EPFA 1TW2A 3MD2A 1R1VA 1WH7A 4B44A 1E17A 3E6MA 2EZIA 1PVEA 2DTZA 4HRIA 3EYIA 2FOWA 3EUHA 4I02A 4Q4ZF 2IEKA 4B3XA 3DBLB 1Q1VA 2W85A 4PJLA 4HDUA 1NG7A 4CHUA 4PFOA 3NQOA 5DDGA 3BCBA 2X51A 1DUXC 3KLOA 1EH6A 3IH4A 1SMYF 3LOCA 4MQVA 5FD6A 2Y30A 3JRFA 1KZHA 1CF7B 2L3DA 3HM5A 2JMWA 2CUZA 5F04A 2K9NA 2E2IJ 2JUCA 2CFXA 2NOJB 1HC8A 4M3FA 3L09A 3CJQB 1OCRH 2L7ZA 4C30A 4UHTA 2WAQA 2DYSH 4BXUA 1UJ8A 2QKLB 2VQLA 3J80Z 4D1QA 1VQKI 5FB2A 3I4NJ 4X1EA 3SZPA 3BTLA 2R4GA 4GYGA 2VJIA 1SVOA 3M8JA 2M4KA 2O9LA 3MVPA 2DJNA 2W1OA 2XUBA 2OQGA 4XRSG 4BDYA 5ED4A 1YS7A 2RDPA 3H3UA 2XPUA 1PUFB 3A03A 1B72B 2W82A 4HLYA 2L7MP 3QOPA 2P5LC 2IXSA 2DMTA 2KRFA 5A2QK 3K4NA 1BI0A 3LA3A 3HKZN 1RNLA 4IEJA 4JQFA 4GFBA 4L0YB 2K4JA 2LKPA 4WWCA 4CYDA 3CQZJ 2XAGA 1BIAA 3DFGA 5K7HA 4HNUA 1UZCA 1LJ9A 1JTXA 2DA6A 1WJ5A 2GQQA 3GFMA 2JA7J 4BHPA 3KX2A 2CW7A 3LSGA 2UZKA 4BY1J 1G3YA 3ISPA 5D4RA 1O4XA 3W2AA 4YFNF 4DYRA 4DBRA 4J01A 3R0JA 3DP7A 1P92A 2WWYA 3COAC 4LG0B 4EGZA 2O8XA 4NDLA 3CD6I 2DQRA 3OYDA 4DBQA 1P4XA 5ICGA 4EJVA 1OQYA 1JGGA 2M8GX 2VOOA 3GLLA 4I7HA 5GADJ 4ZDLA 1PP7U 4A3DJ 2M30A 3QYBA 2VUMJ 1VNDA 3CF5F 3ZN1A 2VASA 5GAHJ 4UNOA 2JUGA 1K61A 4RGUA 1OCPA 3F6OA 5CVUA 3WTUC 1XTAA 1A6QA 2LSOA 2VIXA 5KCMA 3ZMZA 4QSHA 3CUQA 4U88A 3AAFA 3BZCA 2Y69H 2Z9OA 1EV7A 3PJRA 2JZYA 3ZGKA 5LLQA 1BI1A 2BE5F 5LRRA 4OIQF 2EH3A 3PNTA 3LMMA 1UG0A 3HEFA 3ML6A 1T0FC 4M71A 3DLLF 2L4MA 3O8HA 4BXXJ 4RLFA 3REOA 5LHGA 1FPQA 1Y1VJ 2O5RA 1J2XA 1LFUP 3DEEA 4MEYF 3ZN0A 1XCVA 2KDOA 4MQ9F 3A4CA 5D5VB 2M9HA 1VQ7I 3E1SA 1TWHJ 1P4AA 4NC7A 1UFMA 3ZMVA 2QA4I 1ZG1A 1MD0A 3WE2A 2QEXI 2WADA 3BR3A 3UKGA 2GXBA 4XRFA 3M4OJ 4II2A 1OLTA 3G4SI 2IS6A 3OYIA 3DBHB 3C2BA 2J5PA 1RR7A 4CSWA 2L9NA 2EFQA 1TP4A 3DEUA 2OBPA 4CO8A 2LDUA 3JTGA 1LKXA 1S72I 3TKYA 2VPRA 5JVGF 1BOBA 2BZTA 2CRGA 3I64A 4G94A 2DI3A 4B47A 5DUKA 5BNGA 2Q1ZB 2F5DA 4E7JA 3OYNA 1R9TJ 5FO5A 2HZTA 2KIQA 1S5LC 4LJZF 3I4MJ 4RB0A 4PGHA 5E1WA 2G7HA 4F52A 2KZGA 4BBSJ 1S3JA 4XM3A 5C44J 1V5GA 5CVVA 4ZYDA 1X1BA 1FP1D 2CQKA 5LHHA 3OSGA 4M9ZA 1FMWA 3MFKA 1IRZA 2ZJ2A 2K27A 2LY9A 1XMXA 2JA6J 3I5UA 2IPQX 2LF7A 1RUNA 2RKHA 4G8XA 1WZ2A 3MCZA 3NRVA 2EILH 4FX4A 2R7RA 2FBKA 1D0YA 1LFBA 2BGCA 2KT0A 1IF1A 2BHZA 2LTPA 4BYYA 3BJ6A 1I27A 3VFZA 3KZYA 1YYVA 5BMZA 1H88C 1MSFC 3BP8A 4AD9A 3EQLF 5CVRA 2LMDA 2ZB9A 1T39A 4GO1A 3RQIA 3V8JA 1R1TA 3RTRA 4BQNA 3F0CA 1IUYA 3H3VK 3GTLJ 2VJ5A 5EEAA 2ID3A 1LDDA 2M7AA 4EM1A 1IN6A 5HLHA 1EH7A 4LIVA 2V1DA 1Y0NA 4P55A 4P9FA 1SVLA 4EEFG 5IOYA 2KRCA 3HRSA 2YX7A 1B1BA 4CZZA 1FIPA 2CQ7A 5E18F 1FOKA 3IWFA 4PJMA 2J5OA 1LE8A 3GWZA 1KQ0A 2O0YA 2QQBA 2WAQN 3BG7A 4HOBA 2VODA 3DKYA 3Q0UA 3CCRI 2IVMA 2DA7A 3RPUD 1YO5C 2GOXB 1MJBA 4ZZDA 3LA7A 4W97A 2DMNA 3HBLA 3SHFA 5FLVA 2OUMA 3MKZA 1IUFA 4KMUX 3K70C 4XRSA 4WXCA 5IYCJ 1NG6A 2DFEA 2PMHA 3ULQB 3U1DA 4AVZA 2JA2A 1CGPA 3ZP5A 3OYHA 1WI9A 3J80K 5ICFA 4M9XA 2D1HA 1X4OA 2GIZA 2K9LA 1Y0UA 2W00A 1OISA 1L0OC 2VT3A 3KP3A 3PQJA 3J81K 1D5YA 1HCRA 5CYVA 2EBIA 4FHTA 1Y1WJ 4IHVA 2LKXA 2MW8A 2OTJI 2HQAA 2VKVA 2CV0A 1GHCA 3BWGA 2O61A 2R7TA 1F5TA 4ANJA 2MLGA 3CCEI 2M5WA 3BY6A 1MH4A 5M3MJ 3GZ6A 4LFUA 4FTHA 4D5CA 2HS5A 3WGGA 5K7ZA 2A6EF 2P5VA 1S6LA 2QSHX 3ASNH 1NTCA 5E3LA 3UR3C 3A2KA 1FP2A 2RN7A 3RKWA 4LITA 3AFHA 1VI0A 4AIDA 2QVOA 3BQYA 5E8GA 2PG4A 4I6ZA 2HR3A 3I55I 3IAS2 4QIWN 1WPKA 1U8BA 1UMQA 4G6QA 2IA0A 2N8GA 5L3GA 5H6RA 2F4IA 2M4GA 4H4KC 2XPVA 2X4HA 2XAHA 2HVQA 2IS2A 2W25A 2DBBA 2K5CA 4B1RA 4V2GA 4M73A 3I53A 2X6WA 2MLKA 4HZFA 4UVAA 3WU1B 1OYWA 2M2EA 4FASD 3JRAA 3LSIA 1Z1DA 1Y39A 3FIWA 1LPQA 1ETXA 2CW0F 3QU6A 3SEZA 4EVIA 1LVAA 3KZZA 4UV8A 5DM7F 3G2BA 3LSHA 3N4MA 3F72A 2V4JC 3VWBA 1Z0XA 5C4XJ 2K9SA 3CP2A 4Y4RA 3JRGA 2ZC2A 2PLYA 2MBFA 3GW2A 4ABZA 3HOWJ 1Z05A 3ABLH 1YJ9I 3KIOA 2EB7A 2QUFA 3KCCA 3IKTA 2FNAA 1JT0A 2MG4A 1P7IA 2V9PA 2Y9ZA 3DWLE 1ERDA 1X2NA 1GVJA 2E71A 4M74A 5HS9A 2DXIA 4GGGA 2QQAA 2M8EA 1MBGA 1WJCA 1K78B 1ZYRF 4IZZA 4XMYA 2X85A 2H8RA 3AG4H 2AHQA 4FE4A 2LG4A 5CJ9A 1I5ZA 4BE0A 2R92J 2X6OA 1AWCA 4U0VA 3B73A 2BXYA 5DD4A 5GP9A 1M1EB 4UVCA 4G7ZF 2KIFA 3FXMA 2STTA 1BJAA 3AKZA 3IP4B 5DM6F 4HV6A 2NXNB 2L7FP 2VXDA 2ZMEA 2G0EA 1HDPA 1STZA 1ZLKA 4NHJA 2RNJA 2MSYA 1DGWY 1Z6TA 3D0SA 4MHGA 2W7NA 1PYVA 1W5CC 2WY7Q 1P6RA 4IHSA 2WA0A 4LK0F 4CICA 3E0JB 3SDGA 4A5MA 2QQ9A 3C18A 2AQFA 2E7XA 4CXFA 1SFUA 4G9YA 4ZYAA 1AA7A 2ZXHA 1Z7LA 1HKQA 3IH3A 3F6VA 1UB9A 4I2OA 1FOYA 3RPQA 2K86A 5LEJA 3GYHX 1TQPA 4II3A 4A6EA 3HOXJ 5HNHA 3T8TA 4BE1A 1X3ZB 2M45A 2UUZA 1IXSB 2OAZA 4IHXA 3ZR8X 1XSXA 3LQQA 4AC0A 1OR7C 3BJAA 2F5FA 4ITVA 3V8LA 5J1RA 3W6JB 4QWQA 3L00A 1G6NA 1UAAA 1O3RA 1ON1A 2QYOA 3P5JA 2CH0A 5D5XB 2JJ7A 2YU3A 5FRNA 2WY8Q 2W48A 3T5XA 1FLIA 1HBXG 1U9OA 4IHTA 1A6IA 3TQNA 1QZZA 4A3GJ 4XLAA 4NQWA 3BROA 3VSLA 3DV8A 2Q2EB 1ETWA 1X3UA 5JLXA 3JREA 1PDNC 1FTZA 2ECCA 4CZCA 3SXYA 2V26A 3J81Z 2A6TA 1YQAA 4NC8A 4Y13A 4A3EJ 1WVRA 3CMAI 1SAXA 3H3ZA 2IS4A 3JAMK 3G1MA 2ZKZA 5D4SA 1ZHFA 1X19A 5TISC 2MA3A 3TEDA 2Q8KA 4OIOF 5D5WB 2CU7A 3QOEA 1UG2A 3MKLA 1D8KA 3PUBA 1MBEA 2IBDA 3ZQ7A 4XLNF 2VJ4A 2JWTA 3FHZA 4D7NA 3DXJF 3JTHA 4F55A 4BHCA 1YOVB 4D0PA 3A01B 3S1QJ 3DKWA 2VLAA 3P9CA 2NYXA 1HOMA 4ZZLA 2QF7A 1EH8A 1MJ9A 3AG1H 3ECHA 1KQ8A 4BNCA 5HVQC 5L3BA 3LSPA 4BDZA 3F21A 3EUAA 1ZGWA 1TNTA 1HKTA 2XAFA 1AU7A 2BXZA 3CMYA 2E5ZA 3QP6A 4JX6A 3FK7A 4OIPF 3DPUA 4HLXA 3V7SA 2B63J 1D5VA 5HDNA 2KPMA 1VQ9I 3BCAA 1UHMA 1MBFA 4ESJA 1I3QJ 4ZYGA 1REPC 4M6YA 3KP2A 4D9JA 2VONA 3EPZA 2DMPA 4LB5A 3VOEA 5F27A 4U87A 2CSOA 2GOMA 5CQGA 4A6DA 3F8FA 4K2EA 5F1RA 3RYRA 3U2RA 3BTIA 2VQHA 1JHHA 5GTHC 2FQ4A 5EG0B 2RVCA 4E7LA 1H89C 3F9KA 4M6XA 1DDNA 2NVTJ 3CTAA 4DW6A 2A3SA 3HDDA 2YUSA 4O6JA 1I6XA 5EYRA 1JKQC 3K4JA 1TWAJ 2YS9A 2EFOA 2LF8A 2Y0SA 1FT9A 3IAM2 3K4CA 2V9KA 3CMMA 3K7AJ 1R58A 2V7FA 3I9V2 5LHIA 3DTEA 4JK1X 2XGEA 1ON2A 2VXZA 3K6GA 2OA4A 4IQ4A 2Z3YA 1FYMA 2HNHA 2CYYA 2ISYA 1ZREA 2TDXA 3IUOA 1QHHD 3BTJA 1POGA 3OS1A 4I09A 2XF5A 4OMYA 4N4NB 4M3GA 1V55H 4C3HJ 3L2RA 1J0RA 1AKHA 1A35A 5K5RA 3JSPA 4N9HA 2A05A 2E5NA 2COBA 4E4HA 1A04A 1MJAA 2MC3A 1T56A 3VEPA 2COMA 4M72A 2R5ZA 4XOTA 1I50J 3OIQA 3HB9A 4OAZA 1R4MB 1RKTA 2LP0A 1JJ8C 2FD5A 4Q48A 5JLWA 5FLMJ 4PUSA 4MFEA 4BL0B 3V7RA 5EGOB 2HI3A 2HZDA 2IA2A 3HGGA 3EYYA 2XF7A 3DPTA 3JCUC 5EDNA 3I59B 1KA8A 4D7MA 1Z6RA 1S8NA 2Z99A 3A0BC 4BAYA 1ZG3A 3GX4X 1QPIA 4HAMA 5CVIA 1E3HA 2E2HJ 3V8KA 3GFJA 1IAWA 2EA2A 1OKRA 3PIPF 1ZKGA 2DA1A 4HV5A 3G73A 1WKMA 4A3FJ 5KNLA 1WRJA 3KEYA 4AUXA 2R7ZJ 2BY2A 2GA2A 3GLXA 5ICEA 4LOCA 1B8IB 3CUOA 4P9UA 4B09A 1WQ2A 2MD0A 2PN6A 3E6DA 2FMLA 2DMQA 2XRLA 4L5JA 5DD8A 4E6KG 1H8AC 2GLOA 2E36A 4RB3C 3DQVC 5EZGA 3NWTA 5CPRB 3TO6A 3OMYA 1NK2P 2LOOA 1R5HA 3U9GA 2P7VB 5EJCA 1PP8F 4UVBA 3ZRGA 3HC7A 2A68F 3GBGA 4KN7X 4IOAF 4EJWA 1LEAA 2HOTA 1RUOA 3AL0B 3GTKJ 1WHUA 1WJBA 3ZMTA 4KICA 2OPTA 5E1ZB 4TV7A 1BIBA 2Y75A 3DKXA 4BY7J 4PFPA 4A0XA 4IPAA 2BOLA 1NK3P 2GZWA 2YU9J 3VYTB 3BR2A 2EFNA 1MMGA 2H1KA 3N05A 2OF7A 1I3AA 2OJED 3D5SC 4KDPA 4BJ5C 3BR6A 1S7OA 2DK8A 1KU2A 5FD5A 3F3XA 4PSWA 4MFDA 2JT1A 2FUG2 4ZJZA 1U5TA 4C3IJ 4KFCA 2XF6A 3KYDB 1T2KA 3GEZA 1W7PD 2LLKA 2X48A 3R61A 3TBIA 1XMKA 2EQRA 1Z21A 3PQKA 1O57A 1H9GA 1QO0D 1KU9A 1JKRC 1ACIA 3OSFA 4X6AJ 1QVTA 1IDYA 1QU3A 3PNYA 1GV2A 3PL8A 5KAIC 4HQEA 5FKMA 1HW1A 3PM1A 3M8FA 4I99C 4MNUA 4C2TA 1FYLA 4L0ZB 4BS9A 5DTDA 1IN4A 2E19A 3OYCA 1ZK8A 3HOTA 1ENHA 3KFWX 1UHWA 3O3KA 1U8RA 4A2UA 2IGOA 2OTLI 1K6OA 1RKWA 1RZ4A 1NH3A 1V5FA 2V1UA 3BZ6A 1ZH5A 5F6FA 1IJWC 4ZYHA 4WCGA 5L3DA 1ITYA 3FWEA 3Q0WA 3HL2A 1B9MA 4A3CJ 4RM3A 2WB1N 4UB6C 4XLFA 3KP7A 2F6CA 1ETQA 4LK1F 3SFZA 5JVTA 1YJNI 1ZRFA 2V1XA 4MTDA 3HOVJ 2K40A 2DLLA 1TBXA 3BG3A 2NVYJ 2UWMA 2ID6A 1E3OC 3WU0A 3D1NI 4KMFA 1BR2A 3TL4X 1B9NA 3KE2A 4Y17A 2XRNA 3ABTA 3CCSI 2X6YA 1W7PA 1BR1A 2XVCA 4LG3A 2VI6A 4Y7NJ 2FEZA 4I76A 4XLPF 5BPIA 2EFWA 3RZOJ 3E6BA 5J1YA 1HA8A 5H2FC 2CMPA 2F2EA 3OYGA 4EJUA 4RLQA 3OYEA 5TRDA 1T8IA 4L9JA 4L5IA 3U21A 4HDVA 1YX5A 4CCKA 4M3EA 4UY8I 1XB4A 2BVLA 2BW3B 2FE3A 3ASOH 3ZQHA 3CP8A 4A5NA 1DPRA 3S32A 5FGMA 1D1CA 3RPUA 4CH7A 4KISA 4OWRB 4MGRA 1TTYA 2ZFWA 2CS3A 3LNQA 4QPQA 4MIMA 4BJ6C 2HGCA 4RAGA 1MIJA 3PO3J 3LSRA 5CKTA 4GCVA 1HDDC 1N25A 1U9NA 5K5QA 1Z7UA 5H6QA 1Z3YA 2VBYA 3JAMZ 1EF4A 3GO5A 3TO7A 1J9IA 5TJJA 3CCQI 1TC3C 3GTOJ 2RV8A 3K69A 3KYLA 1D1BA 2IA1A 5GAEJ 1ETOA 3VSKA 3GZNB 5J4YA 5FRMA 2QQ8A 3S2HJ 1G3TA 3HYIA 4F92B 3LL7A 2IRFG 3PSFA 5EGOA 1X4PA 3J7AO 5K7FA 4KJZA 1U5TB 2XGXA 3EDPA 2GBYA 2PX9A 3HOSA 2KP6A 4P1WA 2RGVA 3PFIA 2HEOA 2MGQA 5AIPA 1HQCA 2L0KA 2VKDA 4CUGA 5DCFA 4IOCF 2OV7A 4FE7A 3E5XA 4ON0A 3MZ8A 4GXOA 4ZTFA 1QNTA 2XGDA 2L7KA 3QU3A 1ZARA 1OMIA 2DT7B 1EA3A 2DOEA 5LD2C 4C9YA 2OD5A 1FZPB 1GT0C 3FHNA 1JXSA 4PDKA 2GIVA 3TP0A 4M6VA 2PJRB 2ZFUA 3CCMI 4AIHA 4DQ2A 4WX9A 2AXTC 3D5LA 3IRRA 1Z9CA 2LC2A 3MKYB 1T6SA 2KHMA 3OL4A 1R71A 3S8PA 5E3OA 5HLGA 3CCVI 1P9QC 1FY7A 1J09A 1VQOI 1K83J 3FF5A 4UUVA 1LB2A 2DW4A 4L5EA 3CLQA 1W5TA 4QPOA 1WI3A 1GXPA 4RGSA 5FKNA 2HWVA 2V1NA 1MBJA 4PSXA 3G71I 3RKYA 1IG7A 1JJ6C 1RC9A 3FM5A 2BY1A 4BACA 3ABMH 1WCMJ 3IWZA 1TQMA 3PSIA 1WGXA 5E3NA 1FBSA 3HRUA 3W2VA 3OYMA 5KK1A 2EZLA 3ZQQA 1R5GA 1OPCA 2HKXA 1QZYA 3OV8A 5JFRA 3OYFA 1T98A 2E7WA 5IPAA 3ZXSA 2EZHA 4WK8F 2K7LA 1G8XA 2VJJA 2HXIA 1N77A 3JRHA 3OR1C 2HOAA 2XB5A 3EUHC 3PUFA 1GXQA 1J5YA 1YW9A 2F5EA 3KETA 5FKOA 5B1AH 3AG2H 2P5KA 2DMUA 3K4MA 2NVXJ 1RRJA 1XMAA 1K4TA 3QAHA 2ZJPF 4CGZA 3DTIA 5CQEA 4I0BA 1X1PA 1YJWI 3HTSB 3OL3A 3CESA 1N78A 2DK5A 1LDKB 2DTRA 4BQQA 3G1OA 1YIJI 4ENJA 5LEKA 2VT2A 1FOXA 2FMYA 2VBZA 2ZJQF 3L1PA 3GTPJ 1KONA 5B3SH 1R36A 1D0XA 3RJPA 1LQ1A 1GVDA 1MSEC 2JN6A 2PBIA 2DA3A 2YPRA 1ULYA 5KHDA 2K4BA 1F4KA 2OU2A 5CLSA 3S17J 4JYKA 4IL6C 3H9GA 4A3MJ 3LAPA 2I5UA 4ASNA 2FNPA 2KZVA 1W36C 1AKHB 5J8CA 2DFHA 1G59A 2VBWA 4V2FA 2I8DA 4EJTA 2O8KA 4A12A 2P7CB 2BV6A 2R5YA 1TT0A 2PMUA 1I39A 5IOZA 2O6GE 1SMTA 3IHUA 2K3FA 5DUIA 1B59A 1W0UA 5FFZA 4MEXF 3FXQA 1YG2A 2E1MB 4EM2A 5ILVA 1HSJA 1TWGJ 2O03A 4O5VA 2VL8A 2XGCA 1YRNA 3WODF 3ERED 3HSEA 2FOKA 2YR2A 3MWMA 2FU4A 4AWXB 4RM2A 5H20A 3EETA 1USTA 1SANA 3VB2A 4DIQA 1VQ8I 4DJAA 3FXLA 1R6RA 1UHSA 2FF4A 1R00A 1HKSA 2QWWA 2W57A 4ESBA 2NNNA 4JBAA 1I1SA 2DT5A 1Z3XA 2CUFA 4A0YA 1ZTRA 1D0ZA 4E7ZA 1E3PA 3WTYC 5AIQA 4XN0A 3TP3A 1DGRM 2R93J 1FX7A 2B0LA 4KYWA 2FBIA 4QTRA 3B02A 3VYRB 2RAEA 2VKEA 2KMUA 1VZ0A 4DGWB 3DPLC 3L9FA 3RCOA 2HYJA 4HSTA 4DNCA 2FJ1A 4XRMA 1ZGJA 2QKMB 5E79C 1YHQI 4PCQA 2STWA 2O3FA 2CFOA 3M1EA 3T8RA 3HUGA 2DO7A 5L3FA 3WTSC 4F91B 1XG1A 1K78A 1G3SA 3LQRA 1CQTA 2NS0A 4XKBA 2QSGX 2MD5A 1WFXA 1KU7A 2IS1A 3FX3A 5JHFA 5D6FA 1O7FA 2O7OA 4WXDA 3MMYB 2ZMEB 3R4KA 4L9TA 2ME6A 4CA0A 1IXCA 4KNYA 2Z2SB 3QPHA 5J4VA 3IH2A 2M3AA 3TOAA 4ZDPA 3BG9A 2LBFA 3DU5A 2RNGA 2PI0A 4YIRX 2DCEA 3HJEA 1IN8A 1HSTA 1Y6IA 2DOFA 2ZXJA 4FQGA 1D1AA 4B43A 2M87A 3HOZJ 2E1MC 4EJOA 1IV8A 3ABKH 1R22A 2NVUB 2EWNA 1YX3A 2AQEA 3K10A 1A5JA 3RQ4A 5DS9A 1VQ5I 3WG7H 4G12A 5LFAA 1FWZA 1ZQ3P 4F3QA 4P5OA 4EATA 2ICWG 1IRFA 3WTVC 3CC7I 4IQJA 4Z6YA 2IP2A 3M7GA 1IDZA 3PIOF 2X0LA 3G6EI 4R8HA 4ENNA 1S9HA 1XGMA 4NNJA 1J75A 2HU9A 1MH3A 3CC4I 2W4SA 4M3DA 3CLOA 4J00A 5JI6A 3BOQA 3MZHA 4UUSB 3W6VA 4ZYEA 1XGOA 4HG2A 1XPXA 5DYMA 5L3CA 1F9NA 2YSRA 4DYCA 2KLOA 3H5RA 3E5UA 3F8NA 4G6DA 2EIMH 2L54A 1X1AA 2HPMA 5F08A 4A3IJ 2IW5A 4UXNA 3K0LA 3PNVA 1DQUA 3S15J 2VC0A 3CO7C 2LH9A 3S1NJ 1CF7A 2KJBA 3CJNA 2DU9A 3A01A 3QRFF 2ZBKA 2R7UA 5J6XA 3ERMA 1RI7A 1BW5A 3P9KA 4HPQA 1I6HJ 1BBYA 3WHCA 1FC3A 3QP5A 1MMNA 3H35A 2LVSA 4R1HA 2EV6A 4A0ZA 2AS5F 4KN4X 1QA6A 3S14J 2KJCA 3DTKA 1BR4A 2QBYA 4A3JJ 5M5XJ 1JUSA 4BHBA 3DLAA 2R5ZB 2R0QC 3SJMA 2WAEA 4E7KA 3ZQLA 3OS2A 2H09A 2P4WA 1ZAOA 3S3MA 4O3MA 3O6BB 1JE8A 2LFBA 4RBOA 1BW6A 5M3FJ 1BC8C 1TL8A 1RIOH 3GF2A 1Y8RB 1V5EA 4PGGA 4OAYA 2L02A 5IT9Z 3MZYA 4HX8A 2IAIA 2VN2A 4CCMA 2NS7A 2DFFA 4PJJA 3I56I 3C2GA 1OCTC 2EV5A 3MQ0A 2VBXA 1N75A 2FXAA 2H27A 3OOPA 3ZMUA 2RC4A 5DEQA 2V6CA 5IP6A 4XKVA 1BOAA 2XAQA 3FM3A 3CZ6A 1IN7A 4BXFA 1RPWA 2P0WA 1Y8QB 2UXXA 3F8BA 4IVNA 4ZC3A 1JKPC 4JX5A 4HQMA 3KLNA 1Z91A 4RMNA 3MKWB 4AM3A 4LLGF 4RAZA 1R49A 3IC7A 1OCOH 1TWCJ 1YE9A 4XLEA 3LAJA 2JSCA 4E7HA 5M5YJ 1F36A 3GZ5A 2PQ8A 4N4OB 1OR7A 5KAFC 5IP9J 1FTTA 2LY1A 4IRIA 3L2VA 3BLYA 1HW2A 5JR3A 4N0BA 3FK6A 1H9TA 1RR8C 3L7WA 4HX7A 1MZBA 3A0HC 1BI3A 3QYFA 4Y52J 2Y0SN 5BQTA 2H94A 1IRGA 1SAUA 4AIJA 4Q5SF 3LFKA 4IRGA 3OY9A 1IO2A 2KRHA 4JP0A 1JUPA 3BT9A 3BR1A 3RZDJ 2F4OB 3I0TA 3CCLI 2NRAC 5HLTA 1MKMA 1JHFA 5LGTA 2EV0A 5ICCA 1IW7F 5A2QZ 1UCRA 3HPGA 1XX5A 4ESFA 4YFKF 4F93B 3F22A 4C2UA 4RAFA 1XDSA 3I4PA 1ORKA 4YIFA 1WJFA 3DBRB 1P7JA 1AOYA 2HOEA 1LVKA 4UV9A 1APLC 2QGUA 3WTZA 2QZ8A 1AHDP 3H36A 2D2WA 1E0EA 4RDUA 5BS6A 5D5UB 2DT6A 2ESNA 2HPIA 4EV0A 1SEUA 3UNGC 4A93J 2MC4A 1V54H 3HXLA 2JPBA 4CCLA 3JRIA 5C4JJ 2ZSIB 2FSWA 3WE3A 2BHYA 3FXUA 2OZUA 4XICA 3ZPLA 5HLIA 1QGPA 1XGNA 3P7NA 2DPDA 2NNYA 4FETA 3M8EA 2E1NA 3H5AA 5F0FA 3T0YA 3ROUA 3I54A 1QZEA 3LSTA 3WGHA 2A61A 4DOZA 3VYUB 2HTSA 2TRTA 4L9VA 2Z33A 3BPVA 2BEOA 4XIDA 3HSRA 1EKEA 4XBFA 2DA2A 3H92A 1KYWA 1K7AA 4KITB 3M07A 2L9VA 3QWLA 2XHKA 3I59A 3ZOBA 3K1NA 3QYEA 1RESA 4CCOA 1MNDA 3X2QH 4RGXA 3C2HA 5E20A 1C0WA 3G3ZA 3HOYJ 1O7LA 1SD4A 2JA5J 4NUBA 3KEOA 4I0AA 5J8FA 3BJOA 1WJDA 4DZPA 5FFXA 2UV1A 2ZMEC 1LNWA 1MDMA 3PFYA 2KL4A 1USSA 1IRXA 2LBFB 5E17F 2K9MA 2JVHA 5HNFA 4OU0A 2DDAA 1ZR2A 2CW8A 2X9DA 2BVMA 1O3QA 1I1GA 1U6GA 3W6KB 1WSUA 1MMAA 1ETKA 2TCTA 2XPWA 5FKKA 1SD5A 4BKXA 2FRHA 3WU2C 2DN0A 3ESWB 3HHHA 3P9IA 3CF2A 4AU7A 1U0JA 4ENKA 3BDDA 1KQ9A 3KZIC 2KFDA 3NARA 1SD7A 4BGDA 5KVRA 1DU0A 2JQ7A 3CO6C 3O8GA 4LD5A 1D3YA 3R6SA 2HYFA 2R7FA 4BU2A 1ODDA 3GMEA 1WJAA 4XONA 1TWFJ 2OQRA 2PEXA 3S3OA 4Q47A 2K02A 2KIUA 1IV6A 1B72A 1H0MA 3SZTA 2Y48A 1SD6A 1KYZA 3CC2I 1SFKA 3GTJJ 4RB2C 4J19A 3L2WA 1OFCX 4BJTA 3Q9VA 4Y15A 1U78A 4IJAA 4B8XA 4AYBN 5J40A 4PJNA 2BBYA 2VQCA 3HRMA 4WXHA 4KT6A 3W3CA 4RB1A 3CCJI 2EA4A 3ONQA 2WC2A 1VQ6I 4OMZA 4CYCB 4UUSA 3SFIA 2VB6A 1TNSA 2DQLA 3K4BA 3OIPA 1R4NB 4B48A 4CCNA 2ZXWH 5ERIA 1U3EM 2AO9A 1SC7A 2F5CA 5LGNA 2DODA 2HDDA 1T33A 5E8IA 3KP4A 2KISA 3OYJA 3RKXA 4S05A 2LY2A 1VQMI 2M0MA 1TT5B 2MH9A 2OZ6A 2Q2EA 5EEHA 3GFLA 5EEGA 1G3WA 1IGNA 4LIUA 3A1YA 2G9WA 2BW3A 4KUMA 3ELKA 3MAJA 1X2MA 1R23A 2RREA 3QQAA 2DDBA 1JGSA 5J3LA 4ZH4F 3C3WA 2NS8A 1HLVA 3SZGA 3BQZA 2HOSA 3J7AY 2HDWA 2FBHA 2XB0X 2ZCWA 3JRCA 3SEQA 1T0FA 3TDUC 1GUUA 2CUEA 4AIKA 3O2PE 3K4KA 2Q0OA 2JPCA 3TGNA 2I10A 2H6BA 1MNEA 1T08B 1QRYA 5E3MA 2KIMA 3L2UA 1K6YA 1E2XA 5JHUA 1P2FA 2B7EA 2IT0A 4IHWA 1PUEE 2ZNYA 4MTEA 4YIIA 3BC8A 4PZJA 2D5VA 4M3BA 4GDFA 2VKHA 3LSKA 4HNTA 1QHGA 4YEJA 1D8JA 3OR2C 2QM3A 4BQOA 4RA2A 5FJ8J 3E6CC 1XSVA 2MABA 4PK4A 2H6CA 3IKVA 3Q0VA 4ZTJA 4IXAA 2Y9YA 2RQQA 4IX7A 4U0YA 3RYPA 3HGYA 4BBRJ 3HPHA 1V4RA 2P8TA 1XD7A 1VQPI 2FA5A 1FYKA 3HRTA 3HKZA 5FROA 2IGNA 1YS6A 4C2MJ 5ILSA 2R7SA 2EK5A 2YX4A 4XK4A 4U7BA 1B4AA 5FLXK 3GUDA 3Q5FA 1QPMA 3H9JA 3Q9SA 3GCMA 3KPHA 4W1UA 4HA8A 2XAUA 2NOGA 2DAOA 3TOBA 2L2OA 4G7HF 2MYSA 1YFHA 1IZ1A 1P4WA 1XS9A 5IT9K 4ZDOA 3WHBA 2K3PA 1KU3A 2RQPA 3HTUA 5LGUA 4XLHA 1FNNA 5LRSA 2XIGA 2DOAA 2EIJH 4I01A 5L3EA 3LA2A 1HF0A 1J59A 2ECBA 2CV2A 4JX4A 3BPXA 3D5RC 4NB5A 1A36A 3FXOA 2LKSA 2L01A 4C3JJ 4IHYA 5GPAA 1X1DA 2ZO4A 3OOUA 2QCOA 5D6EA 3GTGJ 4XKWA 3AG3H 4FISA 1OYIA 1YIOA 3S1MJ 3MN2A 1WWXA 1IN5A 2LNBA 4Y33A 3WG9A 4U0WA 1F43A 3ZQIA 2D1VA 2VE9A 1W1WE 2LYCA 1MW7A 3CJRB 2WB1A 2X1EA 1G4DA 1OJLA 1QVUA 3BZKA 3E97A 3FMSA 4XOPA 1U5TC 3TW6A 2CGPA 2ISZA 1X1CA 2CQXA 3FKIJ 3K70D 5FLXZ 3LWFA 5F64A 2HVSA 3S3NA 1K4SA 4HBLA 4G7OF 3IV5A 1MMSA 2DJIA 3F23A 4AYBA 1K79A 4GRIA 3ZCOA 4DYQA 4H0EA 2GA1A 4FT8A 1FSHA 4CCJA 1TZLA 4ETSA 4IF4A 4D5FA 1Q1HA 4ENMA 4YFXF 3DF8A 2NVQJ 3OS0A 1XGSA 3E5QA 4BQAA 4HEA2 4LLLA 1X58A 3FXJA 3KYCB 4N9IA 3OYBA 3OYKA 2R7VA 3L2QA 1XCBA 1BI2A 4IKFA 3HUGB 4A3BJ 2KKOA 1MBHA 2CO5A 3DEWA 4CYCA 2WV1A 2V79A 1ZR4A 1XDUA 3BR5A 3VPRA 1W7PB 3G1LA 1S7EA 2IGKA 3GVAA 2BY3A 2H8WA 3CUQC 3T1BA 3BR0A 3S16J 4BEHB 2GXGA 3S1RJ 4HNVA 5IP7J 1BL0A 3R0AA 1Y56A 3ZMSA 2R7WA 4LG0A 2E1OA 5J47A 2CWEA 3M9AA 5F0CA 3FDYA 5CVJA 4L18B 3ABUA 4HYEA 2CG4A 1JTYA 3FKJA 3VYSB 1MGTA 2E34A 4B3AA 5IT3A 4I98B 2HKOA 1ZG5A 2LK2A 2Y31A 2EIKH 1EJ9A 3FMRA 2A07F 1V3FA 3FBIB 3FXRA 2M34A 4KIBA 4CDGA 3RSNA 2JK3A 3IRQA 2JRMA 3VDXA 4YRVA 1MDMB 3KP5A 1SFEA 2VC1A 3RDIA 5EF6A 2L9RA 3HZJA 3NWSA 3W2WA 1LFPA 4XORA 2E1CA 1HW5A 4S04A 2BY0A 4F7ZA 3JRBA 5K5OA 2ME0A 2W24A 3DCFA 2F5VA 2Z16A 1ZRCA 1BM9A 1DP7P 2GM4A 1JT6A 3S93A 1W36D 1DU6A 1GLNA 4BE2A 1Z67A 3I58A 1UELB 3K2ZA 4HSRA 2ACJA 4YG2F 2DPUA 2BYVE 2OCEA 3QODA 2R5YB 1IC8A 2EINH 3RIRA 3HIFA 4HF2A 5HDKA 1ETVA 1ZN2A 3BG5A 4IO9F 2CQQA 2HDCA 2EJRA 3CDLA 3R60A 4XQFA 1O3SA 5E1XA 1DPUA 1KGSA 2P6SA 4PJ0C 1J7KA 2FX0A 1S29A 5TGTA 3H0DA 4XL9A 2K9QA 5EG0A 2E2JJ 2QSFX 3ZQGA 1JI8A 2A5YB 3WTWC 1MNMC 3H1CA 3IL2A 4RS8A 1VF9A 2R7OA 2ADUA 4GYIA 1LE8B 1S7AA 5HODA 2P81A 3TDZC 3OWTA 3H9QA 4P96A 4X0GA 2ESHA 2M1BA 1YRNB 4JOMA 4YELA 3I3LA 2GWRA 4OOIA 3J7YJ 3Q3SA 1XN7A 2ELHA 3QPLA 2C6YA 4HF0A 2ZXIA 1YW7A 5LBQA 2ZJRF 3A02A 5D8KB 2H1LA 3E7LA 4EGYA 2PMZA 4U7DA 3S2DJ 2A6HF 1MBKA 2W84A 2P6TA 1Z77A 2M7BA 3QPTA 1W0TA 2XAJA 3ECOA 2G7UA 2L4AA 3ZQFA 3LSMA 3CCYA 4QLCU 2VPLA 3L2CA 2HTJA 1W5SA 2HFHA 4OIRF 3SDBA 1GDTA 2R3SA 2JTVA 6PAXA 3K1MA 1B6AA 2MH2A 4EM0B 2HXOA 1FBQA 1YLFA 4KIFA 3F8MA 2V6EA 3SYTA 4HW0A 4E7SA 2B9SA 1X3WB 2WV0A 5M5WJ 2DA5A 3C1DA 3HSFA 2HYGD 3HHGA 4WF2A 2HQ5A 3TMOA 1WH5A 2HQRA 2Y2ZA 3K2AA 4KIGA 2Z1DA 2Z5UA 4OINF 1TQIA 2VE8A 3LFUA 1NHAA 4BH9A 4Y3OA 1JUMA 5GAGJ 3S2WA 1SFOJ 2DYRH 2JA8J 2CQNA 3FBNB 2PJPA 2JSPA 5IYDJ 5DCMB 2LRDA 1IXRC 1MMDA 1W4MA 3JW4A 3I71A 2HQNA 2WBMA 2UXNA 3JRDA 1L3LA 4LLNA 5F1JA 1DP3A 5HOOA 1WJEA 3J7ZI 5B66C 2EFPA 3M3YJ 1JKOC 2PMZN 3KEQA 3U1KA 1LEBA 2WAFA 5EZHA 4A69C 3ZMDA 4LMYA 3OYAA 3F8CA 1VTNC 2VQGA 1BC7C 1VQLI 2E60A 1HXDA 1ZGAA 5DV5A 4KA4A 1BA5A 3BG6A 1LUJB 1OCZH 4RAYA 1VQNI 5GTIC 2MFZA 3V42A 1ONVA 1XSDA 4XKCA 5HDGA 2XC7A 4EMSA 3GTQJ 1FBUA 1VQ4I 4BUPA 1TLHB 3NEUA 9ANTA 5C3EJ 3BTCA 4KT5C 3RKQA 3JR9A 3B6AA 5IY5H 3FMQA 3K9TA 2XSJC 1U2WA 3QPSA 2QBYB 1FIAA 5IYBJ 1YTYA 2D45A 2QLZA 2DA4A 2A69F 1SVMA 5D8LB 2OC6A 3GFIA 1LDJA 2ELJA 4XN3A 5HS8A 1FJLA 3MEXA 4XR6A 4XNFA 4DZJA 1ZRDA 4E7IA 4MO7A 5GPCA 2XKPA 3TO9A 2NAZA 1A31A 2CJJA 5B1BH 2KQRA 2GXAA 2XV4S 4MLOA 3OIOA 4NC6A 4E70A 3FXKA 2F48A 2ETHA 3E3VA 3GXOA
chains in the Genus database with same CATH topology
4LGWA 2XKOA 1SFXA 5K1YA 2DFIA 1QBJA 4AVPA 2AXLA 2XASA 4HX4A 1YW8A 1ZLJA 5ILUA 2IJLA 1T38A 2PFBA 3CDHA 2FQ3A 5BOXA 3C7JA 4M9SA 4L9NA 5HS7A 1R1UA 3WGIA 4HF1A 3V7CA 3KP6A 2JRTA 4XSXF 3SQNA 4EQQA 4LB6B 1QQIA 4R79A 2R7DA 5AONA 1R7JA 3CUQB 3WTTC 2XROA 2WTEA 4IRHA 1F1ZA 1OYYA 1O3TA 3N97A 2V9VA 2ZNZA 4XSZF 4FX0A 4RGRA 1FSEA 3VODA 2GAUA 2VOPA 3JSOA 2Y0MA 3V4GA 3RI4A 3K1PA 1BN5A 2QENA 5BPDA 4Z2YA 5DCMA 1TW3A 3WTXC 3FZVA 1TW2A 1R1VA 1E17A 3E6MA 3EYIA 3EUHA 4I02A 4Q4ZF 2W85A 4CHUA 4HDUA 3NQOA 5DDGA 1DUXC 3KLOA 1EH6A 1SMYF 4MQVA 5FD6A 1CF7B 2L3DA 2CFXA 3L09A 4UHTA 4BXUA 3J80Z 5FB2A 3SZPA 4GYGA 2XUBA 2OQGA 5ED4A 1YS7A 2RDPA 3H3UA 4HLYA 3QOPA 2P5LC 2KRFA 5A2QK 1BI0A 3LA3A 1RNLA 4JQFA 4L0YB 2K4JA 2LKPA 4WWCA 4CYDA 2XAGA 1BIAA 3DFGA 1LJ9A 2GQQA 3GFMA 4BHPA 2UZKA 1G3YA 3ISPA 5D4RA 4YFNF 3R0JA 3DP7A 1P92A 2WWYA 3COAC 4LG0B 4EGZA 2O8XA 2DQRA 1P4XA 5ICGA 4EJVA 2VOOA 4I7HA 1PP7U 2M30A 3ZN1A 4UNOA 4RGUA 3F6OA 5CVUA 3WTUC 2LSOA 3ZMZA 3CUQA 4U88A 3AAFA 2Z9OA 1EV7A 2JZYA 5LLQA 1BI1A 2BE5F 5LRRA 4OIQF 4M71A 3ML6A 2L4MA 3REOA 5LHGA 1FPQA 1J2XA 4MEYF 3ZN0A 1XCVA 4MQ9F 5D5VB 1P4AA 1UFMA 3ZMVA 1ZG1A 1MD0A 3WE2A 2GXBA 4XRFA 2J5PA 2EFQA 3DEUA 2OBPA 4CO8A 2LDUA 3JTGA 3TKYA 3I64A 4G94A 2DI3A 5DUKA 2F5DA 5FO5A 2HZTA 4LJZF 4RB0A 4PGHA 5E1WA 2G7HA 1S3JA 4ZYDA 5CVVA 1FP1D 2CQKA 5LHHA 4M9ZA 3MFKA 2ZJ2A 2K27A 3I5UA 2IPQX 2LF7A 1RUNA 2RKHA 4G8XA 3MCZA 3NRVA 4FX4A 2FBKA 2BGCA 1IF1A 4BYYA 3BJ6A 1I27A 5BMZA 3KZYA 1YYVA 3VFZA 3BP8A 4AD9A 3EQLF 5CVRA 1T39A 4GO1A 3V8JA 1R1TA 3RTRA 1IUYA 1LDDA 4EM1A 1IN6A 5HLHA 1EH7A 2V1DA 4P55A 4P9FA 3HRSA 2YX7A 1B1BA 4CZZA 5E18F 1FOKA 3IWFA 2J5OA 1KQ0A 3GWZA 2O0YA 2QQBA 4HOBA 2VODA 2IVMA 1YO5C 1MJBA 4ZZDA 3LA7A 3SHFA 4KMUX 4WXCA 3ULQB 2PMHA 3U1DA 1CGPA 3ZP5A 1WI9A 3J80K 5ICFA 4M9XA 2D1HA 3J81K 1Y0UA 3KP3A 1L0OC 2VT3A 3PQJA 5CYVA 4FHTA 1GHCA 3BWGA 2O61A 1F5TA 2MLGA 2M5WA 3BY6A 3GZ6A 4LFUA 2HS5A 3WGGA 2A6EF 2P5VA 1S6LA 1FP2A 2RN7A 3RKWA 2QVOA 5E8GA 2PG4A 2HR3A 4G6QA 2IA0A 5L3GA 5H6RA 2X4HA 2XAHA 2W25A 2DBBA 4M73A 3I53A 2MLKA 4HZFA 4UVAA 3WU1B 1OYWA 1Z1DA 2CW0F 3QU6A 4EVIA 1LVAA 3KZZA 4UV8A 3N4MA 3F72A 2PLYA 2MBFA 3GW2A 1Z05A 2EB7A 2QUFA 3KCCA 3IKTA 2FNAA 1GVJA 4M74A 5HS9A 4GGGA 2QQAA 2M8EA 1K78B 1ZYRF 5CJ9A 1I5ZA 1AWCA 4U0VA 3B73A 5DD4A 4UVCA 2STTA 4G7ZF 2KIFA 1BJAA 4HV6A 2ZMEA 4NHJA 1STZA 1ZLKA 2RNJA 1Z6TA 3D0SA 4MHGA 1P6RA 4IHSA 4LK0F 4CICA 4A5MA 2QQ9A 3C18A 2E7XA 4CXFA 1SFUA 4G9YA 1HKQA 3F6VA 1UB9A 4I2OA 3RPQA 2K86A 5LEJA 3GYHX 1TQPA 4A6EA 3T8TA 2M45A 1IXSB 2OAZA 1XSXA 3LQQA 3BJAA 2F5FA 3V8LA 3W6JB 4QWQA 3L00A 1G6NA 1O3RA 1ON1A 2QYOA 5D5XB 2YU3A 3T5XA 1FLIA 1HBXG 4IHTA 3TQNA 1QZZA 4NQWA 3BROA 1PDNC 3DV8A 1X3UA 3SXYA 3J81Z 1YQAA 4Y13A 1SAXA 3H3ZA 3JAMK 2ZKZA 5D4SA 1ZHFA 2MA3A 2Q8KA 4OIOF 5D5WB 1D8KA 3ZQ7A 4XLNF 3FHZA 3DXJF 3JTHA 4BHCA 4D0PA 3DKWA 3P9CA 2NYXA 4ZZLA 1EH8A 1MJ9A 3ECHA 1KQ8A 4BNCA 5HVQC 5L3BA 3F21A 1TNTA 1HKTA 2XAFA 3QP6A 4OIPF 4HLXA 3V7SA 1D5VA 5HDNA 1UHMA 4ESJA 4ZYGA 1REPC 4M6YA 3KP2A 2VONA 4LB5A 3VOEA 2CSOA 4A6DA 3F8FA 4K2EA 5F1RA 3RYRA 3U2RA 1JHHA 2RVCA 1DDNA 4M6XA 3CTAA 2A3SA 4O6JA 1I6XA 2EFOA 2LF8A 1FT9A 1R58A 5LHIA 4JK1X 1ON2A 2VXZA 2OA4A 2Z3YA 1FYMA 2CYYA 2ISYA 1ZREA 2TDXA 4I09A 4OMYA 1J0RA 5K5RA 3JSPA 4N9HA 1A04A 1MJAA 2MC3A 3VEPA 2COMA 4M72A 4Q48A 3V7RA 2IA2A 3EYYA 3DPTA 3I59B 1KA8A 1Z6RA 1S8NA 2Z99A 4BAYA 1ZG3A 3GX4X 4HAMA 5CVIA 3V8KA 3GFJA 1IAWA 2EA2A 1OKRA 3G73A 4HV5A 1WKMA 1WRJA 2GA2A 3GLXA 5ICEA 3CUOA 4P9UA 4B09A 1WQ2A 2PN6A 3E6DA 2FMLA 5DD8A 4L5JA 4RB3C 3DQVC 3TO6A 1R5HA 3U9GA 2P7VB 1PP8F 4UVBA 2A68F 4KN7X 4EJWA 1LEAA 1RUOA 3ZMTA 4KICA 5E1ZB 4TV7A 1BIBA 2Y75A 4A0XA 4IPAA 2GZWA 2EFNA 4KDPA 1S7OA 2DK8A 1KU2A 5FD5A 3F3XA 2JT1A 4KFCA 1U5TA 1T2KA 3GEZA 1W7PD 3R61A 1XMKA 3PQKA 1O57A 1H9GA 1QO0D 1KU9A 4HQEA 1HW1A 4L0ZB 3M8FA 4MNUA 1FYLA 1IN4A 3HOTA 3O3KA 3KFWX 1UHWA 1U8RA 4A2UA 1K6OA 1RZ4A 2V1UA 1ZH5A 3BZ6A 5F6FA 4ZYHA 4WCGA 5L3DA 3FWEA 1B9MA 3KP7A 4LK1F 3SFZA 5JVTA 1ZRFA 2V1XA 4MTDA 2DLLA 1TBXA 2UWMA 3WU0A 4KMFA 1B9NA 3KE2A 4Y17A 2XRNA 3ABTA 1W7PA 2XVCA 2FEZA 4XLPF 5BPIA 2EFWA 3E6BA 2F2EA 4EJUA 5TRDA 4L9JA 4L5IA 4HDVA 1XB4A 2FE3A 4A5NA 1DPRA 5FGMA 3RPUA 4MGRA 1TTYA 2ZFWA 2HGCA 4GCVA 5K5QA 1Z7UA 5H6QA 2VBYA 3JAMZ 3GO5A 3TO7A 1J9IA 5TJJA 2RV8A 3K69A 2IA1A 1G3TA 3HYIA 2IRFG 3J7AO 1U5TB 2XGXA 3EDPA 3HOSA 2RGVA 3PFIA 2HEOA 5AIPA 1HQCA 5DCFA 3E5XA 4ON0A 4GXOA 1QNTA 3QU3A 1ZARA 1OMIA 2OD5A 1FZPB 1JXSA 4PDKA 2GIVA 4AIHA 4DQ2A 4WX9A 3D5LA 3IRRA 1Z9CA 1T6SA 5HLGA 1FY7A 3FF5A 4UUVA 1LB2A 2DW4A 1W5TA 1GXPA 4RGSA 2HWVA 3RKYA 3FM5A 3IWZA 1TQMA 1FBSA 3HRUA 5KK1A 1R5GA 1OPCA 2HKXA 1QZYA 3OV8A 5JFRA 1T98A 2E7WA 4WK8F 2K7LA 1GXQA 1J5YA 1YW9A 2F5EA 3KETA 2P5KA 1XMAA 3QAHA 4CGZA 4I0BA 3HTSB 2DK5A 1LDKB 2DTRA 4ENJA 5LEKA 2VT2A 2FMYA 2VBZA 1R36A 3RJPA 1LQ1A 2PBIA 2YPRA 1ULYA 2K4BA 1F4KA 2OU2A 5CLSA 3LAPA 4ASNA 2FNPA 5J8CA 2VBWA 4EJTA 4A12A 2P7CB 2BV6A 2PMUA 2O6GE 1SMTA 3IHUA 5DUIA 1B59A 5FFZA 4MEXF 3FXQA 1YG2A 4EM2A 5ILVA 1HSJA 2O03A 4O5VA 3WODF 3ERED 3HSEA 2FOKA 2YR2A 3MWMA 2FU4A 4AWXB 5H20A 3EETA 1USTA 3VB2A 2FF4A 1R00A 1HKSA 2QWWA 2W57A 4ESBA 2NNNA 4JBAA 1I1SA 2DT5A 4A0YA 3WTYC 5AIQA 1FX7A 2B0LA 4KYWA 2FBIA 3B02A 3DPLC 3L9FA 4DNCA 1ZGJA 4PCQA 2STWA 2O3FA 3M1EA 3T8RA 3HUGA 2DO7A 5L3FA 3WTSC 1K78A 1G3SA 3LQRA 2NS0A 2MD5A 1KU7A 3FX3A 5D6FA 1O7FA 4WXDA 2ZMEB 3R4KA 4L9TA 1IXCA 4KNYA 3QPHA 3TOAA 2PI0A 1IN8A 1HSTA 2ZXJA 2M87A 4EJOA 1R22A 2EWNA 1FWZA 4P5OA 1IRFA 3WTVC 2IP2A 3M7GA 2X0LA 4ENNA 4R8HA 1XGMA 1J75A 3CLOA 5JI6A 3BOQA 3MZHA 4ZYEA 1XGOA 5DYMA 5L3CA 1F9NA 2YSRA 3E5UA 3F8NA 4G6DA 2L54A 2IW5A 4UXNA 3K0LA 2VC0A 3CO7C 1CF7A 2KJBA 3CJNA 2DU9A 3QRFF 2ZBKA 5J6XA 1RI7A 3P9KA 1BBYA 1FC3A 3QP5A 4R1HA 2EV6A 4A0ZA 2AS5F 4KN4X 2KJCA 2QBYA 4BHBA 2H09A 2P4WA 1ZAOA 4O3MA 3O6BB 1JE8A 1BC8C 1RIOH 3GF2A 4PGGA 2L02A 5IT9Z 3MZYA 4HX8A 2VN2A 2EV5A 3MQ0A 2VBXA 2FXAA 2H27A 3OOPA 3ZMUA 2RC4A 5DEQA 2V6CA 1BOAA 2XAQA 3FM3A 1IN7A 2UXXA 3F8BA 4IVNA 4HQMA 3KLNA 1Z91A 4LLGF 4RAZA 3IC7A 3LAJA 2JSCA 3GZ5A 2PQ8A 1OR7A 4IRIA 1HW2A 5JR3A 4N0BA 1H9TA 3L7WA 4HX7A 1MZBA 1BI3A 5BQTA 2H94A 1IRGA 4AIJA 4Q5SF 3LFKA 4IRGA 3I0TA 2NRAC 1MKMA 1JHFA 5LGTA 2EV0A 5ICCA 1IW7F 5A2QZ 1UCRA 4ESFA 4YFKF 3F22A 1XDSA 3I4PA 4YIFA 1AOYA 2HOEA 4UV9A 3WTZA 2QZ8A 2D2WA 5BS6A 5D5UB 2ESNA 4EV0A 2JPBA 2FSWA 3WE3A 3FXUA 2OZUA 3ZPLA 5HLIA 1QGPA 1XGNA 3P7NA 2DPDA 2NNYA 3M8EA 2E1NA 3T0YA 3ROUA 3I54A 3LSTA 3WGHA 2A61A 2HTSA 4L9VA 2Z33A 3BPVA 2BEOA 3HSRA 4XBFA 3H92A 1KYWA 1K7AA 2XHKA 3I59A 3K1NA 4RGXA 5E20A 1C0WA 3G3ZA 1O7LA 1SD4A 3KEOA 4I0AA 5J8FA 3BJOA 5FFXA 1LNWA 1MDMA 1USSA 5E17F 4OU0A 1O3QA 1I1GA 1U6GA 3W6KB 1WSUA 1SD5A 2FRHA 3HHHA 3P9IA 4ENKA 3BDDA 1KQ9A 1SD7A 5KVRA 3CO6C 4LD5A 1D3YA 3R6SA 2HYFA 2R7FA 1ODDA 2OQRA 2PEXA 4Q47A 2K02A 2KIUA 1H0MA 3SZTA 2Y48A 1SD6A 1KYZA 4RB2C 3Q9VA 4Y15A 1U78A 4IJAA 4B8XA 2BBYA 4RB1A 3HRMA 4WXHA 2EA4A 2WC2A 4OMZA 1TNSA 2DQLA 5ERIA 1U3EM 2F5CA 5LGNA 5E8IA 3KP4A 3RKXA 4S05A 2MH9A 2OZ6A 2Q2EA 5EEHA 3GFLA 5EEGA 1G3WA 2G9WA 4KUMA 3ELKA 3MAJA 1R23A 1JGSA 4ZH4F 3C3WA 2FBHA 2ZCWA 1T0FA 3TDUC 4AIKA 3O2PE 2Q0OA 2JPCA 3TGNA 2H6BA 2KIMA 1E2XA 5JHUA 1P2FA 2IT0A 1PUEE 2ZNYA 4MTEA 4YIIA 4PZJA 1D8JA 2QM3A 3E6CC 1XSVA 2H6CA 3IKVA 4IXAA 4U0YA 3RYPA 1V4RA 2P8TA 1XD7A 2FA5A 1FYKA 3HRTA 1YS6A 5ILSA 2EK5A 2YX4A 4U7BA 1B4AA 5FLXK 3GUDA 3Q5FA 1QPMA 3Q9SA 4HA8A 2DAOA 3TOBA 4G7HF 1YFHA 1IZ1A 1P4WA 5IT9K 1KU3A 2RQPA 3HTUA 5LGUA 1FNNA 5LRSA 2XIGA 4I01A 5L3EA 3LA2A 1J59A 3BPXA 4NB5A 2L01A 2ZO4A 5D6EA 1OYIA 1YIOA 1WWXA 1IN5A 2LNBA 3WG9A 4U0WA 2D1VA 2VE9A 1G4DA 2ISZA 2CGPA 3FMSA 3E97A 1U5TC 5FLXZ 3LWFA 5F64A 4HBLA 4G7OF 3F23A 1K79A 4H0EA 2GA1A 4FT8A 1FSHA 4ETSA 4IF4A 1Q1HA 4ENMA 4YFXF 3DF8A 1XGSA 3E5QA 4BQAA 4LLLA 4N9IA 1XCBA 1BI2A 2KKOA 2CO5A 2V79A 1XDUA 1W7PB 3GVAA 3CUQC 3T1BA 2GXGA 3R0AA 3ZMSA 4LG0A 2CWEA 3M9AA 5CVJA 4L18B 3ABUA 4HYEA 2CG4A 1MGTA 5IT3A 1ZG5A 4I98B 2HKOA 3FMRA 2A07F 1V3FA 3FXRA 4CDGA 4KIBA 3IRQA 1MDMB 3KP5A 1SFEA 2VC1A 3RDIA 2E1CA 1HW5A 4S04A 4F7ZA 5K5OA 2W24A 1ZRCA 1BM9A 1DP7P 3I58A 3K2ZA 2ACJA 4YG2F 2DPUA 2BYVE 3RIRA 3HIFA 4HF2A 5HDKA 1ZN2A 2HDCA 2EJRA 3R60A 1O3SA 5E1XA 1DPUA 1KGSA 2P6SA 1J7KA 1S29A 2A5YB 3WTWC 3IL2A 4RS8A 2ADUA 4GYIA 1S7AA 3TDZC 4P96A 2ESHA 2M1BA 2GWRA 4OOIA 1XN7A 2ELHA 2C6YA 4HF0A 1YW7A 5LBQA 5D8KB 4EGYA 4U7DA 2A6HF 2W84A 2P6TA 3QPTA 2XAJA 3ECOA 2G7UA 2L4AA 4QLCU 3L2CA 2HTJA 1W5SA 2HFHA 4OIRF 2R3SA 2JTVA 6PAXA 3K1MA 1B6AA 2MH2A 4EM0B 4KIFA 1FBQA 1YLFA 3F8MA 4HW0A 2WV0A 3C1DA 3HSFA 2HYGD 3HHGA 4WF2A 2HQRA 4KIGA 2Z5UA 4OINF 1TQIA 2VE8A 1NHAA 4BH9A 3S2WA 2PJPA 5DCMB 1IXRC 3JW4A 1W4MA 3I71A 1L3LA 2HQNA 2UXNA 4LLNA 5HOOA 2EFPA 3KEQA 1LEBA 3ZMDA 4LMYA 3F8CA 1VTNC 1BC7C 1HXDA 1ZGAA 5DV5A 4KA4A 4RAYA 1ONVA 1XSDA 5HDGA 4EMSA 1FBUA 1TLHB 3NEUA 4KT5C 3FMQA 3K9TA 1U2WA 2QBYB 1YTYA 2D45A 2QLZA 2A69F 5D8LB 3GFIA 1LDJA 5HS8A 3MEXA 1ZRDA 2XKPA 3TO9A 2NAZA 2XV4S 4E70A 2ETHA 3E3VA 3GXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGW A;  2XKO A;  1SFX A;  5K1Y A;  2DFI A;  1QBJ A;  4AVP A;  2AXL A;  2XAS A;  4HX4 A;  1YW8 A;  1ZLJ A;  5ILU A;  2IJL A;  1T38 A;  2PFB A;  3CDH A;  2FQ3 A;  5BOX A;  3C7J A;  4M9S A;  4L9N A;  5HS7 A;  1R1U A;  3WGI A;  4HF1 A;  3V7C A;  3KP6 A;  2JRT A;  4XSX F;  3SQN A;  4EQQ A;  4LB6 B;  1QQI A;  4R79 A;  2R7D A;  5AON A;  1R7J A;  3CUQ B;  3WTT C;  2XRO A;  2WTE A;  4IRH A;  1F1Z A;  1OYY A;  1O3T A;  3N97 A;  2V9V A;  2ZNZ A;  4XSZ F;  4FX0 A;  4RGR A;  1FSE A;  3VOD A;  2GAU A;  2VOP A;  3JSO A;  2Y0M A;  3V4G A;  3RI4 A;  3K1P A;  1BN5 A;  2QEN A;  5BPD A;  4Z2Y A;  5DCM A;  1TW3 A;  3WTX C;  3FZV A;  1TW2 A;  1R1V A;  1E17 A;  3E6M A;  3EYI A;  3EUH A;  4I02 A;  4Q4Z F;  2W85 A;  4CHU A;  4HDU A;  3NQO A;  5DDG A;  1DUX C;  3KLO A;  1EH6 A;  1SMY F;  4MQV A;  5FD6 A;  1CF7 B;  2L3D A;  2CFX A;  3L09 A;  4UHT A;  4BXU A;  3J80 Z;  5FB2 A;  3SZP A;  4GYG A;  2XUB A;  2OQG A;  5ED4 A;  1YS7 A;  2RDP A;  3H3U A;  4HLY A;  3QOP A;  2P5L C;  2KRF A;  5A2Q K;  1BI0 A;  3LA3 A;  1RNL A;  4JQF A;  4L0Y B;  2K4J A;  2LKP A;  4WWC A;  4CYD A;  2XAG A;  1BIA A;  3DFG A;  1LJ9 A;  2GQQ A;  3GFM A;  4BHP A;  2UZK A;  1G3Y A;  3ISP A;  5D4R A;  4YFN F;  3R0J A;  3DP7 A;  1P92 A;  2WWY A;  3COA C;  4LG0 B;  4EGZ A;  2O8X A;  2DQR A;  1P4X A;  5ICG A;  4EJV A;  2VOO A;  4I7H A;  1PP7 U;  2M30 A;  3ZN1 A;  4UNO A;  4RGU A;  3F6O A;  5CVU A;  3WTU C;  2LSO A;  3ZMZ A;  3CUQ A;  4U88 A;  3AAF A;  2Z9O A;  1EV7 A;  2JZY A;  5LLQ A;  1BI1 A;  2BE5 F;  5LRR A;  4OIQ F;  4M71 A;  3ML6 A;  2L4M A;  3REO A;  5LHG A;  1FPQ A;  1J2X A;  4MEY F;  3ZN0 A;  1XCV A;  4MQ9 F;  5D5V B;  1P4A A;  1UFM A;  3ZMV A;  1ZG1 A;  1MD0 A;  3WE2 A;  2GXB A;  4XRF A;  2J5P A;  2EFQ A;  3DEU A;  2OBP A;  4CO8 A;  2LDU A;  3JTG A;  3TKY A;  3I64 A;  4G94 A;  2DI3 A;  5DUK A;  2F5D A;  5FO5 A;  2HZT A;  4LJZ F;  4RB0 A;  4PGH A;  5E1W A;  2G7H A;  1S3J A;  4ZYD A;  5CVV A;  1FP1 D;  2CQK A;  5LHH A;  4M9Z A;  3MFK A;  2ZJ2 A;  2K27 A;  3I5U A;  2IPQ X;  2LF7 A;  1RUN A;  2RKH A;  4G8X A;  3MCZ A;  3NRV A;  4FX4 A;  2FBK A;  2BGC A;  1IF1 A;  4BYY A;  3BJ6 A;  1I27 A;  5BMZ A;  3KZY A;  1YYV A;  3VFZ A;  3BP8 A;  4AD9 A;  3EQL F;  5CVR A;  1T39 A;  4GO1 A;  3V8J A;  1R1T A;  3RTR A;  1IUY A;  1LDD A;  4EM1 A;  1IN6 A;  5HLH A;  1EH7 A;  2V1D A;  4P55 A;  4P9F A;  3HRS A;  2YX7 A;  1B1B A;  4CZZ A;  5E18 F;  1FOK A;  3IWF A;  2J5O A;  1KQ0 A;  3GWZ A;  2O0Y A;  2QQB A;  4HOB A;  2VOD A;  2IVM A;  1YO5 C;  1MJB A;  4ZZD A;  3LA7 A;  3SHF A;  4KMU X;  4WXC A;  3ULQ B;  2PMH A;  3U1D A;  1CGP A;  3ZP5 A;  1WI9 A;  3J80 K;  5ICF A;  4M9X A;  2D1H A;  3J81 K;  1Y0U A;  3KP3 A;  1L0O C;  2VT3 A;  3PQJ A;  5CYV A;  4FHT A;  1GHC A;  3BWG A;  2O61 A;  1F5T A;  2MLG A;  2M5W A;  3BY6 A;  3GZ6 A;  4LFU A;  2HS5 A;  3WGG A;  2A6E F;  2P5V A;  1S6L A;  1FP2 A;  2RN7 A;  3RKW A;  2QVO A;  5E8G A;  2PG4 A;  2HR3 A;  4G6Q A;  2IA0 A;  5L3G A;  5H6R A;  2X4H A;  2XAH A;  2W25 A;  2DBB A;  4M73 A;  3I53 A;  2MLK A;  4HZF A;  4UVA A;  3WU1 B;  1OYW A;  1Z1D A;  2CW0 F;  3QU6 A;  4EVI A;  1LVA A;  3KZZ A;  4UV8 A;  3N4M A;  3F72 A;  2PLY A;  2MBF A;  3GW2 A;  1Z05 A;  2EB7 A;  2QUF A;  3KCC A;  3IKT A;  2FNA A;  1GVJ A;  4M74 A;  5HS9 A;  4GGG A;  2QQA A;  2M8E A;  1K78 B;  1ZYR F;  5CJ9 A;  1I5Z A;  1AWC A;  4U0V A;  3B73 A;  5DD4 A;  4UVC A;  2STT A;  4G7Z F;  2KIF A;  1BJA A;  4HV6 A;  2ZME A;  4NHJ A;  1STZ A;  1ZLK A;  2RNJ A;  1Z6T A;  3D0S A;  4MHG A;  1P6R A;  4IHS A;  4LK0 F;  4CIC A;  4A5M A;  2QQ9 A;  3C18 A;  2E7X A;  4CXF A;  1SFU A;  4G9Y A;  1HKQ A;  3F6V A;  1UB9 A;  4I2O A;  3RPQ A;  2K86 A;  5LEJ A;  3GYH X;  1TQP A;  4A6E A;  3T8T A;  2M45 A;  1IXS B;  2OAZ A;  1XSX A;  3LQQ A;  3BJA A;  2F5F A;  3V8L A;  3W6J B;  4QWQ A;  3L00 A;  1G6N A;  1O3R A;  1ON1 A;  2QYO A;  5D5X B;  2YU3 A;  3T5X A;  1FLI A;  1HBX G;  4IHT A;  3TQN A;  1QZZ A;  4NQW A;  3BRO A;  1PDN C;  3DV8 A;  1X3U A;  3SXY A;  3J81 Z;  1YQA A;  4Y13 A;  1SAX A;  3H3Z A;  3JAM K;  2ZKZ A;  5D4S A;  1ZHF A;  2MA3 A;  2Q8K A;  4OIO F;  5D5W B;  1D8K A;  3ZQ7 A;  4XLN F;  3FHZ A;  3DXJ F;  3JTH A;  4BHC A;  4D0P A;  3DKW A;  3P9C A;  2NYX A;  4ZZL A;  1EH8 A;  1MJ9 A;  3ECH A;  1KQ8 A;  4BNC A;  5HVQ C;  5L3B A;  3F21 A;  1TNT A;  1HKT A;  2XAF A;  3QP6 A;  4OIP F;  4HLX A;  3V7S A;  1D5V A;  5HDN A;  1UHM A;  4ESJ A;  4ZYG A;  1REP C;  4M6Y A;  3KP2 A;  2VON A;  4LB5 A;  3VOE A;  2CSO A;  4A6D A;  3F8F A;  4K2E A;  5F1R A;  3RYR A;  3U2R A;  1JHH A;  2RVC A;  1DDN A;  4M6X A;  3CTA A;  2A3S A;  4O6J A;  1I6X A;  2EFO A;  2LF8 A;  1FT9 A;  1R58 A;  5LHI A;  4JK1 X;  1ON2 A;  2VXZ A;  2OA4 A;  2Z3Y A;  1FYM A;  2CYY A;  2ISY A;  1ZRE A;  2TDX A;  4I09 A;  4OMY A;  1J0R A;  5K5R A;  3JSP A;  4N9H A;  1A04 A;  1MJA A;  2MC3 A;  3VEP A;  2COM A;  4M72 A;  4Q48 A;  3V7R A;  2IA2 A;  3EYY A;  3DPT A;  3I59 B;  1KA8 A;  1Z6R A;  1S8N A;  2Z99 A;  4BAY A;  1ZG3 A;  3GX4 X;  4HAM A;  5CVI A;  3V8K A;  3GFJ A;  1IAW A;  2EA2 A;  1OKR A;  3G73 A;  4HV5 A;  1WKM A;  1WRJ A;  2GA2 A;  3GLX A;  5ICE A;  3CUO A;  4P9U A;  4B09 A;  1WQ2 A;  2PN6 A;  3E6D A;  2FML A;  5DD8 A;  4L5J A;  4RB3 C;  3DQV C;  3TO6 A;  1R5H A;  3U9G A;  2P7V B;  1PP8 F;  4UVB A;  2A68 F;  4KN7 X;  4EJW A;  1LEA A;  1RUO A;  3ZMT A;  4KIC A;  5E1Z B;  4TV7 A;  1BIB A;  2Y75 A;  4A0X A;  4IPA A;  2GZW A;  2EFN A;  4KDP A;  1S7O A;  2DK8 A;  1KU2 A;  5FD5 A;  3F3X A;  2JT1 A;  4KFC A;  1U5T A;  1T2K A;  3GEZ A;  1W7P D;  3R61 A;  1XMK A;  3PQK A;  1O57 A;  1H9G A;  1QO0 D;  1KU9 A;  4HQE A;  1HW1 A;  4L0Z B;  3M8F A;  4MNU A;  1FYL A;  1IN4 A;  3HOT A;  3O3K A;  3KFW X;  1UHW A;  1U8R A;  4A2U A;  1K6O A;  1RZ4 A;  2V1U A;  1ZH5 A;  3BZ6 A;  5F6F A;  4ZYH A;  4WCG A;  5L3D A;  3FWE A;  1B9M A;  3KP7 A;  4LK1 F;  3SFZ A;  5JVT A;  1ZRF A;  2V1X A;  4MTD A;  2DLL A;  1TBX A;  2UWM A;  3WU0 A;  4KMF A;  1B9N A;  3KE2 A;  4Y17 A;  2XRN A;  3ABT A;  1W7P A;  2XVC A;  2FEZ A;  4XLP F;  5BPI A;  2EFW A;  3E6B A;  2F2E A;  4EJU A;  5TRD A;  4L9J A;  4L5I A;  4HDV A;  1XB4 A;  2FE3 A;  4A5N A;  1DPR A;  5FGM A;  3RPU A;  4MGR A;  1TTY A;  2ZFW A;  2HGC A;  4GCV A;  5K5Q A;  1Z7U A;  5H6Q A;  2VBY A;  3JAM Z;  3GO5 A;  3TO7 A;  1J9I A;  5TJJ A;  2RV8 A;  3K69 A;  2IA1 A;  1G3T A;  3HYI A;  2IRF G;  3J7A O;  1U5T B;  2XGX A;  3EDP A;  3HOS A;  2RGV A;  3PFI A;  2HEO A;  5AIP A;  1HQC A;  5DCF A;  3E5X A;  4ON0 A;  4GXO A;  1QNT A;  3QU3 A;  1ZAR A;  1OMI A;  2OD5 A;  1FZP B;  1JXS A;  4PDK A;  2GIV A;  4AIH A;  4DQ2 A;  4WX9 A;  3D5L A;  3IRR A;  1Z9C A;  1T6S A;  5HLG A;  1FY7 A;  3FF5 A;  4UUV A;  1LB2 A;  2DW4 A;  1W5T A;  1GXP A;  4RGS A;  2HWV A;  3RKY A;  3FM5 A;  3IWZ A;  1TQM A;  1FBS A;  3HRU A;  5KK1 A;  1R5G A;  1OPC A;  2HKX A;  1QZY A;  3OV8 A;  5JFR A;  1T98 A;  2E7W A;  4WK8 F;  2K7L A;  1GXQ A;  1J5Y A;  1YW9 A;  2F5E A;  3KET A;  2P5K A;  1XMA A;  3QAH A;  4CGZ A;  4I0B A;  3HTS B;  2DK5 A;  1LDK B;  2DTR A;  4ENJ A;  5LEK A;  2VT2 A;  2FMY A;  2VBZ A;  1R36 A;  3RJP A;  1LQ1 A;  2PBI A;  2YPR A;  1ULY A;  2K4B A;  1F4K A;  2OU2 A;  5CLS A;  3LAP A;  4ASN A;  2FNP A;  5J8C A;  2VBW A;  4EJT A;  4A12 A;  2P7C B;  2BV6 A;  2PMU A;  2O6G E;  1SMT A;  3IHU A;  5DUI A;  1B59 A;  5FFZ A;  4MEX F;  3FXQ A;  1YG2 A;  4EM2 A;  5ILV A;  1HSJ A;  2O03 A;  4O5V A;  3WOD F;  3ERE D;  3HSE A;  2FOK A;  2YR2 A;  3MWM A;  2FU4 A;  4AWX B;  5H20 A;  3EET A;  1UST A;  3VB2 A;  2FF4 A;  1R00 A;  1HKS A;  2QWW A;  2W57 A;  4ESB A;  2NNN A;  4JBA A;  1I1S A;  2DT5 A;  4A0Y A;  3WTY C;  5AIQ A;  1FX7 A;  2B0L A;  4KYW A;  2FBI A;  3B02 A;  3DPL C;  3L9F A;  4DNC A;  1ZGJ A;  4PCQ A;  2STW A;  2O3F A;  3M1E A;  3T8R A;  3HUG A;  2DO7 A;  5L3F A;  3WTS C;  1K78 A;  1G3S A;  3LQR A;  2NS0 A;  2MD5 A;  1KU7 A;  3FX3 A;  5D6F A;  1O7F A;  4WXD A;  2ZME B;  3R4K A;  4L9T A;  1IXC A;  4KNY A;  3QPH A;  3TOA A;  2PI0 A;  1IN8 A;  1HST A;  2ZXJ A;  2M87 A;  4EJO A;  1R22 A;  2EWN A;  1FWZ A;  4P5O A;  1IRF A;  3WTV C;  2IP2 A;  3M7G A;  2X0L A;  4ENN A;  4R8H A;  1XGM A;  1J75 A;  3CLO A;  5JI6 A;  3BOQ A;  3MZH A;  4ZYE A;  1XGO A;  5DYM A;  5L3C A;  1F9N A;  2YSR A;  3E5U A;  3F8N A;  4G6D A;  2L54 A;  2IW5 A;  4UXN A;  3K0L A;  2VC0 A;  3CO7 C;  1CF7 A;  2KJB A;  3CJN A;  2DU9 A;  3QRF F;  2ZBK A;  5J6X A;  1RI7 A;  3P9K A;  1BBY A;  1FC3 A;  3QP5 A;  4R1H A;  2EV6 A;  4A0Z A;  2AS5 F;  4KN4 X;  2KJC A;  2QBY A;  4BHB A;  2H09 A;  2P4W A;  1ZAO A;  4O3M A;  3O6B B;  1JE8 A;  1BC8 C;  1RIO H;  3GF2 A;  4PGG A;  2L02 A;  5IT9 Z;  3MZY A;  4HX8 A;  2VN2 A;  2EV5 A;  3MQ0 A;  2VBX A;  2FXA A;  2H27 A;  3OOP A;  3ZMU A;  2RC4 A;  5DEQ A;  2V6C A;  1BOA A;  2XAQ A;  3FM3 A;  1IN7 A;  2UXX A;  3F8B A;  4IVN A;  4HQM A;  3KLN A;  1Z91 A;  4LLG F;  4RAZ A;  3IC7 A;  3LAJ A;  2JSC A;  3GZ5 A;  2PQ8 A;  1OR7 A;  4IRI A;  1HW2 A;  5JR3 A;  4N0B A;  1H9T A;  3L7W A;  4HX7 A;  1MZB A;  1BI3 A;  5BQT A;  2H94 A;  1IRG A;  4AIJ A;  4Q5S F;  3LFK A;  4IRG A;  3I0T A;  2NRA C;  1MKM A;  1JHF A;  5LGT A;  2EV0 A;  5ICC A;  1IW7 F;  5A2Q Z;  1UCR A;  4ESF A;  4YFK F;  3F22 A;  1XDS A;  3I4P A;  4YIF A;  1AOY A;  2HOE A;  4UV9 A;  3WTZ A;  2QZ8 A;  2D2W A;  5BS6 A;  5D5U B;  2ESN A;  4EV0 A;  2JPB A;  2FSW A;  3WE3 A;  3FXU A;  2OZU A;  3ZPL A;  5HLI A;  1QGP A;  1XGN A;  3P7N A;  2DPD A;  2NNY A;  3M8E A;  2E1N A;  3T0Y A;  3ROU A;  3I54 A;  3LST A;  3WGH A;  2A61 A;  2HTS A;  4L9V A;  2Z33 A;  3BPV A;  2BEO A;  3HSR A;  4XBF A;  3H92 A;  1KYW A;  1K7A A;  2XHK A;  3I59 A;  3K1N A;  4RGX A;  5E20 A;  1C0W A;  3G3Z A;  1O7L A;  1SD4 A;  3KEO A;  4I0A A;  5J8F A;  3BJO A;  5FFX A;  1LNW A;  1MDM A;  1USS A;  5E17 F;  4OU0 A;  1O3Q A;  1I1G A;  1U6G A;  3W6K B;  1WSU A;  1SD5 A;  2FRH A;  3HHH A;  3P9I A;  4ENK A;  3BDD A;  1KQ9 A;  1SD7 A;  5KVR A;  3CO6 C;  4LD5 A;  1D3Y A;  3R6S A;  2HYF A;  2R7F A;  1ODD A;  2OQR A;  2PEX A;  4Q47 A;  2K02 A;  2KIU A;  1H0M A;  3SZT A;  2Y48 A;  1SD6 A;  1KYZ A;  4RB2 C;  3Q9V A;  4Y15 A;  1U78 A;  4IJA A;  4B8X A;  2BBY A;  4RB1 A;  3HRM A;  4WXH A;  2EA4 A;  2WC2 A;  4OMZ A;  1TNS A;  2DQL A;  5ERI A;  1U3E M;  2F5C A;  5LGN A;  5E8I A;  3KP4 A;  3RKX A;  4S05 A;  2MH9 A;  2OZ6 A;  2Q2E A;  5EEH A;  3GFL A;  5EEG A;  1G3W A;  2G9W A;  4KUM A;  3ELK A;  3MAJ A;  1R23 A;  1JGS A;  4ZH4 F;  3C3W A;  2FBH A;  2ZCW A;  1T0F A;  3TDU C;  4AIK A;  3O2P E;  2Q0O A;  2JPC A;  3TGN A;  2H6B A;  2KIM A;  1E2X A;  5JHU A;  1P2F A;  2IT0 A;  1PUE E;  2ZNY A;  4MTE A;  4YII A;  4PZJ A;  1D8J A;  2QM3 A;  3E6C C;  1XSV A;  2H6C A;  3IKV A;  4IXA A;  4U0Y A;  3RYP A;  1V4R A;  2P8T A;  1XD7 A;  2FA5 A;  1FYK A;  3HRT A;  1YS6 A;  5ILS A;  2EK5 A;  2YX4 A;  4U7B A;  1B4A A;  5FLX K;  3GUD A;  3Q5F A;  1QPM A;  3Q9S A;  4HA8 A;  2DAO A;  3TOB A;  4G7H F;  1YFH A;  1IZ1 A;  1P4W A;  5IT9 K;  1KU3 A;  2RQP A;  3HTU A;  5LGU A;  1FNN A;  5LRS A;  2XIG A;  4I01 A;  5L3E A;  3LA2 A;  1J59 A;  3BPX A;  4NB5 A;  2L01 A;  2ZO4 A;  5D6E A;  1OYI A;  1YIO A;  1WWX A;  1IN5 A;  2LNB A;  3WG9 A;  4U0W A;  2D1V A;  2VE9 A;  1G4D A;  2ISZ A;  2CGP A;  3FMS A;  3E97 A;  1U5T C;  5FLX Z;  3LWF A;  5F64 A;  4HBL A;  4G7O F;  3F23 A;  1K79 A;  4H0E A;  2GA1 A;  4FT8 A;  1FSH A;  4ETS A;  4IF4 A;  1Q1H A;  4ENM A;  4YFX F;  3DF8 A;  1XGS A;  3E5Q A;  4BQA A;  4LLL A;  4N9I A;  1XCB A;  1BI2 A;  2KKO A;  2CO5 A;  2V79 A;  1XDU A;  1W7P B;  3GVA A;  3CUQ C;  3T1B A;  2GXG A;  3R0A A;  3ZMS A;  4LG0 A;  2CWE A;  3M9A A;  5CVJ A;  4L18 B;  3ABU A;  4HYE A;  2CG4 A;  1MGT A;  5IT3 A;  1ZG5 A;  4I98 B;  2HKO A;  3FMR A;  2A07 F;  1V3F A;  3FXR A;  4CDG A;  4KIB A;  3IRQ A;  1MDM B;  3KP5 A;  1SFE A;  2VC1 A;  3RDI A;  2E1C A;  1HW5 A;  4S04 A;  4F7Z A;  5K5O A;  2W24 A;  1ZRC A;  1BM9 A;  1DP7 P;  3I58 A;  3K2Z A;  2ACJ A;  4YG2 F;  2DPU A;  2BYV E;  3RIR A;  3HIF A;  4HF2 A;  5HDK A;  1ZN2 A;  2HDC A;  2EJR A;  3R60 A;  1O3S A;  5E1X A;  1DPU A;  1KGS A;  2P6S A;  1J7K A;  1S29 A;  2A5Y B;  3WTW C;  3IL2 A;  4RS8 A;  2ADU A;  4GYI A;  1S7A A;  3TDZ C;  4P96 A;  2ESH A;  2M1B A;  2GWR A;  4OOI A;  1XN7 A;  2ELH A;  2C6Y A;  4HF0 A;  1YW7 A;  5LBQ A;  5D8K B;  4EGY A;  4U7D A;  2A6H F;  2W84 A;  2P6T A;  3QPT A;  2XAJ A;  3ECO A;  2G7U A;  2L4A A;  4QLC U;  3L2C A;  2HTJ A;  1W5S A;  2HFH A;  4OIR F;  2R3S A;  2JTV A;  6PAX A;  3K1M A;  1B6A A;  2MH2 A;  4EM0 B;  4KIF A;  1FBQ A;  1YLF A;  3F8M A;  4HW0 A;  2WV0 A;  3C1D A;  3HSF A;  2HYG D;  3HHG A;  4WF2 A;  2HQR A;  4KIG A;  2Z5U A;  4OIN F;  1TQI A;  2VE8 A;  1NHA A;  4BH9 A;  3S2W A;  2PJP A;  5DCM B;  1IXR C;  3JW4 A;  1W4M A;  3I71 A;  1L3L A;  2HQN A;  2UXN A;  4LLN A;  5HOO A;  2EFP A;  3KEQ A;  1LEB A;  3ZMD A;  4LMY A;  3F8C A;  1VTN C;  1BC7 C;  1HXD A;  1ZGA A;  5DV5 A;  4KA4 A;  4RAY A;  1ONV A;  1XSD A;  5HDG A;  4EMS A;  1FBU A;  1TLH B;  3NEU A;  4KT5 C;  3FMQ A;  3K9T A;  1U2W A;  2QBY B;  1YTY A;  2D45 A;  2QLZ A;  2A69 F;  5D8L B;  3GFI A;  1LDJ A;  5HS8 A;  3MEX A;  1ZRD A;  2XKP A;  3TO9 A;  2NAZ A;  2XV4 S;  4E70 A;  2ETH A;  3E3V A;  3GXO A; 
#chains in the Genus database with same CATH topology
 4B4C A;  1G2H A;  4UB8 C;  4LGW A;  2XKO A;  4S0H B;  1RET A;  1B8I A;  1SFX A;  1OCC H;  2OCC H;  5K1Y A;  2DFI A;  1QBJ A;  4FCY A;  2L9S A;  4AVP A;  3TW7 A;  1PUF A;  1R5I D;  2AXL A;  4NQW B;  2XAS A;  2ZSH B;  4HX4 A;  2XSD C;  1YW8 A;  2LD5 A;  1ZLJ A;  5ILU A;  3LSJ A;  1YIT I;  3PO2 J;  2IJL A;  1T38 A;  2PFB A;  1PJR A;  3CDH A;  2FQ3 A;  5BOX A;  3C7J A;  4G6T B;  1GV5 A;  3K4L A;  4M9S A;  2HVR A;  4L9N A;  5FKL A;  5HS7 A;  1R1U A;  3WGI A;  4HF1 A;  2R7Q A;  3V7C A;  3CJT B;  2CV1 A;  5J1U A;  1FEX A;  3KP6 A;  2JVG A;  3HG9 A;  2JRT A;  1T95 A;  4XSX F;  3SQN A;  4V19 K;  3GTM J;  4EQQ A;  4LB6 B;  2KDZ A;  1QQI A;  2IGM A;  4R79 A;  3AL0 C;  2R7D A;  2EZK A;  5AON A;  4UUT A;  3FIS A;  2R7X A;  1R7J A;  3DU6 A;  3ZQC A;  2F4M B;  2LR8 A;  1FMV A;  3CUQ B;  3H0G J;  2A5W A;  3WTT C;  2X6X A;  2XRO A;  2LRE A;  2M0C A;  2WTE A;  4IRH A;  5F0H A;  1F1Z A;  2CUJ A;  3CME I;  1OYY A;  1O3T A;  1XC5 A;  3N97 A;  2V9V A;  2ZNZ A;  2X1D A;  4XSZ F;  1YI2 I;  4A3L J;  2ELK A;  4FX0 A;  4XLC A;  4RGR A;  2E35 A;  1VFC A;  1ETY A;  1FSE A;  3VOD A;  3OYL A;  3NAU A;  4BEH A;  2GAU A;  2VOP A;  3JSO A;  2L5Q A;  2Y0M A;  5B5E C;  3V4G A;  4A3K J;  3RI4 A;  3K1P A;  1FOW A;  1BN5 A;  2QEN A;  2X1C A;  2K85 A;  5BPD A;  3CDI A;  3H5N A;  3M1C A;  2PJR A;  3HOU J;  4Z2Y A;  2XDV A;  3B6C A;  4NBQ A;  1BJZ A;  5DCM A;  1TW3 A;  1ZEL A;  3WTX C;  3CCU I;  3EUK L;  3FZV A;  2EPF A;  1TW2 A;  3MD2 A;  1R1V A;  1WH7 A;  4B44 A;  1E17 A;  3E6M A;  2EZI A;  1PVE A;  2DTZ A;  4HRI A;  3EYI A;  2FOW A;  3EUH A;  4I02 A;  4Q4Z F;  2IEK A;  4B3X A;  3DBL B;  1Q1V A;  2W85 A;  4PJL A;  4HDU A;  1NG7 A;  4CHU A;  4PFO A;  3NQO A;  5DDG A;  3BCB A;  2X51 A;  1DUX C;  3KLO A;  1EH6 A;  3IH4 A;  1SMY F;  3LOC A;  4MQV A;  5FD6 A;  2Y30 A;  3JRF A;  1KZH A;  1CF7 B;  2L3D A;  3HM5 A;  2JMW A;  2CUZ A;  5F04 A;  2K9N A;  2E2I J;  2JUC A;  2CFX A;  2NOJ B;  1HC8 A;  4M3F A;  3L09 A;  3CJQ B;  1OCR H;  2L7Z A;  4C30 A;  4UHT A;  2WAQ A;  2DYS H;  4BXU A;  1UJ8 A;  2QKL B;  2VQL A;  3J80 Z;  4D1Q A;  1VQK I;  5FB2 A;  3I4N J;  4X1E A;  3SZP A;  3BTL A;  2R4G A;  4GYG A;  2VJI A;  1SVO A;  3M8J A;  2M4K A;  2O9L A;  3MVP A;  2DJN A;  2W1O A;  2XUB A;  2OQG A;  4XRS G;  4BDY A;  5ED4 A;  1YS7 A;  2RDP A;  3H3U A;  2XPU A;  1PUF B;  3A03 A;  1B72 B;  2W82 A;  4HLY A;  2L7M P;  3QOP A;  2P5L C;  2IXS A;  2DMT A;  2KRF A;  5A2Q K;  3K4N A;  1BI0 A;  3LA3 A;  3HKZ N;  1RNL A;  4IEJ A;  4JQF A;  4GFB A;  4L0Y B;  2K4J A;  2LKP A;  4WWC A;  4CYD A;  3CQZ J;  2XAG A;  1BIA A;  3DFG A;  5K7H A;  4HNU A;  1UZC A;  1LJ9 A;  1JTX A;  2DA6 A;  1WJ5 A;  2GQQ A;  3GFM A;  2JA7 J;  4BHP A;  3KX2 A;  2CW7 A;  3LSG A;  2UZK A;  4BY1 J;  1G3Y A;  3ISP A;  5D4R A;  1O4X A;  3W2A A;  4YFN F;  4DYR A;  4DBR A;  4J01 A;  3R0J A;  3DP7 A;  1P92 A;  2WWY A;  3COA C;  4LG0 B;  4EGZ A;  2O8X A;  4NDL A;  3CD6 I;  2DQR A;  3OYD A;  4DBQ A;  1P4X A;  5ICG A;  4EJV A;  1OQY A;  1JGG A;  2M8G X;  2VOO A;  3GLL A;  4I7H A;  5GAD J;  4ZDL A;  1PP7 U;  4A3D J;  2M30 A;  3QYB A;  2VUM J;  1VND A;  3CF5 F;  3ZN1 A;  2VAS A;  5GAH J;  4UNO A;  2JUG A;  1K61 A;  4RGU A;  1OCP A;  3F6O A;  5CVU A;  3WTU C;  1XTA A;  1A6Q A;  2LSO A;  2VIX A;  5KCM A;  3ZMZ A;  4QSH A;  3CUQ A;  4U88 A;  3AAF A;  3BZC A;  2Y69 H;  2Z9O A;  1EV7 A;  3PJR A;  2JZY A;  3ZGK A;  5LLQ A;  1BI1 A;  2BE5 F;  5LRR A;  4OIQ F;  2EH3 A;  3PNT A;  3LMM A;  1UG0 A;  3HEF A;  3ML6 A;  1T0F C;  4M71 A;  3DLL F;  2L4M A;  3O8H A;  4BXX J;  4RLF A;  3REO A;  5LHG A;  1FPQ A;  1Y1V J;  2O5R A;  1J2X A;  1LFU P;  3DEE A;  4MEY F;  3ZN0 A;  1XCV A;  2KDO A;  4MQ9 F;  3A4C A;  5D5V B;  2M9H A;  1VQ7 I;  3E1S A;  1TWH J;  1P4A A;  4NC7 A;  1UFM A;  3ZMV A;  2QA4 I;  1ZG1 A;  1MD0 A;  3WE2 A;  2QEX I;  2WAD A;  3BR3 A;  3UKG A;  2GXB A;  4XRF A;  3M4O J;  4II2 A;  1OLT A;  3G4S I;  2IS6 A;  3OYI A;  3DBH B;  3C2B A;  2J5P A;  1RR7 A;  4CSW A;  2L9N A;  2EFQ A;  1TP4 A;  3DEU A;  2OBP A;  4CO8 A;  2LDU A;  3JTG A;  1LKX A;  1S72 I;  3TKY A;  2VPR A;  5JVG F;  1BOB A;  2BZT A;  2CRG A;  3I64 A;  4G94 A;  2DI3 A;  4B47 A;  5DUK A;  5BNG A;  2Q1Z B;  2F5D A;  4E7J A;  3OYN A;  1R9T J;  5FO5 A;  2HZT A;  2KIQ A;  1S5L C;  4LJZ F;  3I4M J;  4RB0 A;  4PGH A;  5E1W A;  2G7H A;  4F52 A;  2KZG A;  4BBS J;  1S3J A;  4XM3 A;  5C44 J;  1V5G A;  5CVV A;  4ZYD A;  1X1B A;  1FP1 D;  2CQK A;  5LHH A;  3OSG A;  4M9Z A;  1FMW A;  3MFK A;  1IRZ A;  2ZJ2 A;  2K27 A;  2LY9 A;  1XMX A;  2JA6 J;  3I5U A;  2IPQ X;  2LF7 A;  1RUN A;  2RKH A;  4G8X A;  1WZ2 A;  3MCZ A;  3NRV A;  2EIL H;  4FX4 A;  2R7R A;  2FBK A;  1D0Y A;  1LFB A;  2BGC A;  2KT0 A;  1IF1 A;  2BHZ A;  2LTP A;  4BYY A;  3BJ6 A;  1I27 A;  3VFZ A;  3KZY A;  1YYV A;  5BMZ A;  1H88 C;  1MSF C;  3BP8 A;  4AD9 A;  3EQL F;  5CVR A;  2LMD A;  2ZB9 A;  1T39 A;  4GO1 A;  3RQI A;  3V8J A;  1R1T A;  3RTR A;  4BQN A;  3F0C A;  1IUY A;  3H3V K;  3GTL J;  2VJ5 A;  5EEA A;  2ID3 A;  1LDD A;  2M7A A;  4EM1 A;  1IN6 A;  5HLH A;  1EH7 A;  4LIV A;  2V1D A;  1Y0N A;  4P55 A;  4P9F A;  1SVL A;  4EEF G;  5IOY A;  2KRC A;  3HRS A;  2YX7 A;  1B1B A;  4CZZ A;  1FIP A;  2CQ7 A;  5E18 F;  1FOK A;  3IWF A;  4PJM A;  2J5O A;  1LE8 A;  3GWZ A;  1KQ0 A;  2O0Y A;  2QQB A;  2WAQ N;  3BG7 A;  4HOB A;  2VOD A;  3DKY A;  3Q0U A;  3CCR I;  2IVM A;  2DA7 A;  3RPU D;  1YO5 C;  2GOX B;  1MJB A;  4ZZD A;  3LA7 A;  4W97 A;  2DMN A;  3HBL A;  3SHF A;  5FLV A;  2OUM A;  3MKZ A;  1IUF A;  4KMU X;  3K70 C;  4XRS A;  4WXC A;  5IYC J;  1NG6 A;  2DFE A;  2PMH A;  3ULQ B;  3U1D A;  4AVZ A;  2JA2 A;  1CGP A;  3ZP5 A;  3OYH A;  1WI9 A;  3J80 K;  5ICF A;  4M9X A;  2D1H A;  1X4O A;  2GIZ A;  2K9L A;  1Y0U A;  2W00 A;  1OIS A;  1L0O C;  2VT3 A;  3KP3 A;  3PQJ A;  3J81 K;  1D5Y A;  1HCR A;  5CYV A;  2EBI A;  4FHT A;  1Y1W J;  4IHV A;  2LKX A;  2MW8 A;  2OTJ I;  2HQA A;  2VKV A;  2CV0 A;  1GHC A;  3BWG A;  2O61 A;  2R7T A;  1F5T A;  4ANJ A;  2MLG A;  3CCE I;  2M5W A;  3BY6 A;  1MH4 A;  5M3M J;  3GZ6 A;  4LFU A;  4FTH A;  4D5C A;  2HS5 A;  3WGG A;  5K7Z A;  2A6E F;  2P5V A;  1S6L A;  2QSH X;  3ASN H;  1NTC A;  5E3L A;  3UR3 C;  3A2K A;  1FP2 A;  2RN7 A;  3RKW A;  4LIT A;  3AFH A;  1VI0 A;  4AID A;  2QVO A;  3BQY A;  5E8G A;  2PG4 A;  4I6Z A;  2HR3 A;  3I55 I;  3IAS 2;  4QIW N;  1WPK A;  1U8B A;  1UMQ A;  4G6Q A;  2IA0 A;  2N8G A;  5L3G A;  5H6R A;  2F4I A;  2M4G A;  4H4K C;  2XPV A;  2X4H A;  2XAH A;  2HVQ A;  2IS2 A;  2W25 A;  2DBB A;  2K5C A;  4B1R A;  4V2G A;  4M73 A;  3I53 A;  2X6W A;  2MLK A;  4HZF A;  4UVA A;  3WU1 B;  1OYW A;  2M2E A;  4FAS D;  3JRA A;  3LSI A;  1Z1D A;  1Y39 A;  3FIW A;  1LPQ A;  1ETX A;  2CW0 F;  3QU6 A;  3SEZ A;  4EVI A;  1LVA A;  3KZZ A;  4UV8 A;  5DM7 F;  3G2B A;  3LSH A;  3N4M A;  3F72 A;  2V4J C;  3VWB A;  1Z0X A;  5C4X J;  2K9S A;  3CP2 A;  4Y4R A;  3JRG A;  2ZC2 A;  2PLY A;  2MBF A;  3GW2 A;  4ABZ A;  3HOW J;  1Z05 A;  3ABL H;  1YJ9 I;  3KIO A;  2EB7 A;  2QUF A;  3KCC A;  3IKT A;  2FNA A;  1JT0 A;  2MG4 A;  1P7I A;  2V9P A;  2Y9Z A;  3DWL E;  1ERD A;  1X2N A;  1GVJ A;  2E71 A;  4M74 A;  5HS9 A;  2DXI A;  4GGG A;  2QQA A;  2M8E A;  1MBG A;  1WJC A;  1K78 B;  1ZYR F;  4IZZ A;  4XMY A;  2X85 A;  2H8R A;  3AG4 H;  2AHQ A;  4FE4 A;  2LG4 A;  5CJ9 A;  1I5Z A;  4BE0 A;  2R92 J;  2X6O A;  1AWC A;  4U0V A;  3B73 A;  2BXY A;  5DD4 A;  5GP9 A;  1M1E B;  4UVC A;  4G7Z F;  2KIF A;  3FXM A;  2STT A;  1BJA A;  3AKZ A;  3IP4 B;  5DM6 F;  4HV6 A;  2NXN B;  2L7F P;  2VXD A;  2ZME A;  2G0E A;  1HDP A;  1STZ A;  1ZLK A;  4NHJ A;  2RNJ A;  2MSY A;  1DGW Y;  1Z6T A;  3D0S A;  4MHG A;  2W7N A;  1PYV A;  1W5C C;  2WY7 Q;  1P6R A;  4IHS A;  2WA0 A;  4LK0 F;  4CIC A;  3E0J B;  3SDG A;  4A5M A;  2QQ9 A;  3C18 A;  2AQF A;  2E7X A;  4CXF A;  1SFU A;  4G9Y A;  4ZYA A;  1AA7 A;  2ZXH A;  1Z7L A;  1HKQ A;  3IH3 A;  3F6V A;  1UB9 A;  4I2O A;  1FOY A;  3RPQ A;  2K86 A;  5LEJ A;  3GYH X;  1TQP A;  4II3 A;  4A6E A;  3HOX J;  5HNH A;  3T8T A;  4BE1 A;  1X3Z B;  2M45 A;  2UUZ A;  1IXS B;  2OAZ A;  4IHX A;  3ZR8 X;  1XSX A;  3LQQ A;  4AC0 A;  1OR7 C;  3BJA A;  2F5F A;  4ITV A;  3V8L A;  5J1R A;  3W6J B;  4QWQ A;  3L00 A;  1G6N A;  1UAA A;  1O3R A;  1ON1 A;  2QYO A;  3P5J A;  2CH0 A;  5D5X B;  2JJ7 A;  2YU3 A;  5FRN A;  2WY8 Q;  2W48 A;  3T5X A;  1FLI A;  1HBX G;  1U9O A;  4IHT A;  1A6I A;  3TQN A;  1QZZ A;  4A3G J;  4XLA A;  4NQW A;  3BRO A;  3VSL A;  3DV8 A;  2Q2E B;  1ETW A;  1X3U A;  5JLX A;  3JRE A;  1PDN C;  1FTZ A;  2ECC A;  4CZC A;  3SXY A;  2V26 A;  3J81 Z;  2A6T A;  1YQA A;  4NC8 A;  4Y13 A;  4A3E J;  1WVR A;  3CMA I;  1SAX A;  3H3Z A;  2IS4 A;  3JAM K;  3G1M A;  2ZKZ A;  5D4S A;  1ZHF A;  1X19 A;  5TIS C;  2MA3 A;  3TED A;  2Q8K A;  4OIO F;  5D5W B;  2CU7 A;  3QOE A;  1UG2 A;  3MKL A;  1D8K A;  3PUB A;  1MBE A;  2IBD A;  3ZQ7 A;  4XLN F;  2VJ4 A;  2JWT A;  3FHZ A;  4D7N A;  3DXJ F;  3JTH A;  4F55 A;  4BHC A;  1YOV B;  4D0P A;  3A01 B;  3S1Q J;  3DKW A;  2VLA A;  3P9C A;  2NYX A;  1HOM A;  4ZZL A;  2QF7 A;  1EH8 A;  1MJ9 A;  3AG1 H;  3ECH A;  1KQ8 A;  4BNC A;  5HVQ C;  5L3B A;  3LSP A;  4BDZ A;  3F21 A;  3EUA A;  1ZGW A;  1TNT A;  1HKT A;  2XAF A;  1AU7 A;  2BXZ A;  3CMY A;  2E5Z A;  3QP6 A;  4JX6 A;  3FK7 A;  4OIP F;  3DPU A;  4HLX A;  3V7S A;  2B63 J;  1D5V A;  5HDN A;  2KPM A;  1VQ9 I;  3BCA A;  1UHM A;  1MBF A;  4ESJ A;  1I3Q J;  4ZYG A;  1REP C;  4M6Y A;  3KP2 A;  4D9J A;  2VON A;  3EPZ A;  2DMP A;  4LB5 A;  3VOE A;  5F27 A;  4U87 A;  2CSO A;  2GOM A;  5CQG A;  4A6D A;  3F8F A;  4K2E A;  5F1R A;  3RYR A;  3U2R A;  3BTI A;  2VQH A;  1JHH A;  5GTH C;  2FQ4 A;  5EG0 B;  2RVC A;  4E7L A;  1H89 C;  3F9K A;  4M6X A;  1DDN A;  2NVT J;  3CTA A;  4DW6 A;  2A3S A;  3HDD A;  2YUS A;  4O6J A;  1I6X A;  5EYR A;  1JKQ C;  3K4J A;  1TWA J;  2YS9 A;  2EFO A;  2LF8 A;  2Y0S A;  1FT9 A;  3IAM 2;  3K4C A;  2V9K A;  3CMM A;  3K7A J;  1R58 A;  2V7F A;  3I9V 2;  5LHI A;  3DTE A;  4JK1 X;  2XGE A;  1ON2 A;  2VXZ A;  3K6G A;  2OA4 A;  4IQ4 A;  2Z3Y A;  1FYM A;  2HNH A;  2CYY A;  2ISY A;  1ZRE A;  2TDX A;  3IUO A;  1QHH D;  3BTJ A;  1POG A;  3OS1 A;  4I09 A;  2XF5 A;  4OMY A;  4N4N B;  4M3G A;  1V55 H;  4C3H J;  3L2R A;  1J0R A;  1AKH A;  1A35 A;  5K5R A;  3JSP A;  4N9H A;  2A05 A;  2E5N A;  2COB A;  4E4H A;  1A04 A;  1MJA A;  2MC3 A;  1T56 A;  3VEP A;  2COM A;  4M72 A;  2R5Z A;  4XOT A;  1I50 J;  3OIQ A;  3HB9 A;  4OAZ A;  1R4M B;  1RKT A;  2LP0 A;  1JJ8 C;  2FD5 A;  4Q48 A;  5JLW A;  5FLM J;  4PUS A;  4MFE A;  4BL0 B;  3V7R A;  5EGO B;  2HI3 A;  2HZD A;  2IA2 A;  3HGG A;  3EYY A;  2XF7 A;  3DPT A;  3JCU C;  5EDN A;  3I59 B;  1KA8 A;  4D7M A;  1Z6R A;  1S8N A;  2Z99 A;  3A0B C;  4BAY A;  1ZG3 A;  3GX4 X;  1QPI A;  4HAM A;  5CVI A;  1E3H A;  2E2H J;  3V8K A;  3GFJ A;  1IAW A;  2EA2 A;  1OKR A;  3PIP F;  1ZKG A;  2DA1 A;  4HV5 A;  3G73 A;  1WKM A;  4A3F J;  5KNL A;  1WRJ A;  3KEY A;  4AUX A;  2R7Z J;  2BY2 A;  2GA2 A;  3GLX A;  5ICE A;  4LOC A;  1B8I B;  3CUO A;  4P9U A;  4B09 A;  1WQ2 A;  2MD0 A;  2PN6 A;  3E6D A;  2FML A;  2DMQ A;  2XRL A;  4L5J A;  5DD8 A;  4E6K G;  1H8A C;  2GLO A;  2E36 A;  4RB3 C;  3DQV C;  5EZG A;  3NWT A;  5CPR B;  3TO6 A;  3OMY A;  1NK2 P;  2LOO A;  1R5H A;  3U9G A;  2P7V B;  5EJC A;  1PP8 F;  4UVB A;  3ZRG A;  3HC7 A;  2A68 F;  3GBG A;  4KN7 X;  4IOA F;  4EJW A;  1LEA A;  2HOT A;  1RUO A;  3AL0 B;  3GTK J;  1WHU A;  1WJB A;  3ZMT A;  4KIC A;  2OPT A;  5E1Z B;  4TV7 A;  1BIB A;  2Y75 A;  3DKX A;  4BY7 J;  4PFP A;  4A0X A;  4IPA A;  2BOL A;  1NK3 P;  2GZW A;  2YU9 J;  3VYT B;  3BR2 A;  2EFN A;  1MMG A;  2H1K A;  3N05 A;  2OF7 A;  1I3A A;  2OJE D;  3D5S C;  4KDP A;  4BJ5 C;  3BR6 A;  1S7O A;  2DK8 A;  1KU2 A;  5FD5 A;  3F3X A;  4PSW A;  4MFD A;  2JT1 A;  2FUG 2;  4ZJZ A;  1U5T A;  4C3I J;  4KFC A;  2XF6 A;  3KYD B;  1T2K A;  3GEZ A;  1W7P D;  2LLK A;  2X48 A;  3R61 A;  3TBI A;  1XMK A;  2EQR A;  1Z21 A;  3PQK A;  1O57 A;  1H9G A;  1QO0 D;  1KU9 A;  1JKR C;  1ACI A;  3OSF A;  4X6A J;  1QVT A;  1IDY A;  1QU3 A;  3PNY A;  1GV2 A;  3PL8 A;  5KAI C;  4HQE A;  5FKM A;  1HW1 A;  3PM1 A;  3M8F A;  4I99 C;  4MNU A;  4C2T A;  1FYL A;  4L0Z B;  4BS9 A;  5DTD A;  1IN4 A;  2E19 A;  3OYC A;  1ZK8 A;  3HOT A;  1ENH A;  3KFW X;  1UHW A;  3O3K A;  1U8R A;  4A2U A;  2IGO A;  2OTL I;  1K6O A;  1RKW A;  1RZ4 A;  1NH3 A;  1V5F A;  2V1U A;  3BZ6 A;  1ZH5 A;  5F6F A;  1IJW C;  4ZYH A;  4WCG A;  5L3D A;  1ITY A;  3FWE A;  3Q0W A;  3HL2 A;  1B9M A;  4A3C J;  4RM3 A;  2WB1 N;  4UB6 C;  4XLF A;  3KP7 A;  2F6C A;  1ETQ A;  4LK1 F;  3SFZ A;  5JVT A;  1YJN I;  1ZRF A;  2V1X A;  4MTD A;  3HOV J;  2K40 A;  2DLL A;  1TBX A;  3BG3 A;  2NVY J;  2UWM A;  2ID6 A;  1E3O C;  3WU0 A;  3D1N I;  4KMF A;  1BR2 A;  3TL4 X;  1B9N A;  3KE2 A;  4Y17 A;  2XRN A;  3ABT A;  3CCS I;  2X6Y A;  1W7P A;  1BR1 A;  2XVC A;  4LG3 A;  2VI6 A;  4Y7N J;  2FEZ A;  4I76 A;  4XLP F;  5BPI A;  2EFW A;  3RZO J;  3E6B A;  5J1Y A;  1HA8 A;  5H2F C;  2CMP A;  2F2E A;  3OYG A;  4EJU A;  4RLQ A;  3OYE A;  5TRD A;  1T8I A;  4L9J A;  4L5I A;  3U21 A;  4HDV A;  1YX5 A;  4CCK A;  4M3E A;  4UY8 I;  1XB4 A;  2BVL A;  2BW3 B;  2FE3 A;  3ASO H;  3ZQH A;  3CP8 A;  4A5N A;  1DPR A;  3S32 A;  5FGM A;  1D1C A;  3RPU A;  4CH7 A;  4KIS A;  4OWR B;  4MGR A;  1TTY A;  2ZFW A;  2CS3 A;  3LNQ A;  4QPQ A;  4MIM A;  4BJ6 C;  2HGC A;  4RAG A;  1MIJ A;  3PO3 J;  3LSR A;  5CKT A;  4GCV A;  1HDD C;  1N25 A;  1U9N A;  5K5Q A;  1Z7U A;  5H6Q A;  1Z3Y A;  2VBY A;  3JAM Z;  1EF4 A;  3GO5 A;  3TO7 A;  1J9I A;  5TJJ A;  3CCQ I;  1TC3 C;  3GTO J;  2RV8 A;  3K69 A;  3KYL A;  1D1B A;  2IA1 A;  5GAE J;  1ETO A;  3VSK A;  3GZN B;  5J4Y A;  5FRM A;  2QQ8 A;  3S2H J;  1G3T A;  3HYI A;  4F92 B;  3LL7 A;  2IRF G;  3PSF A;  5EGO A;  1X4P A;  3J7A O;  5K7F A;  4KJZ A;  1U5T B;  2XGX A;  3EDP A;  2GBY A;  2PX9 A;  3HOS A;  2KP6 A;  4P1W A;  2RGV A;  3PFI A;  2HEO A;  2MGQ A;  5AIP A;  1HQC A;  2L0K A;  2VKD A;  4CUG A;  5DCF A;  4IOC F;  2OV7 A;  4FE7 A;  3E5X A;  4ON0 A;  3MZ8 A;  4GXO A;  4ZTF A;  1QNT A;  2XGD A;  2L7K A;  3QU3 A;  1ZAR A;  1OMI A;  2DT7 B;  1EA3 A;  2DOE A;  5LD2 C;  4C9Y A;  2OD5 A;  1FZP B;  1GT0 C;  3FHN A;  1JXS A;  4PDK A;  2GIV A;  3TP0 A;  4M6V A;  2PJR B;  2ZFU A;  3CCM I;  4AIH A;  4DQ2 A;  4WX9 A;  2AXT C;  3D5L A;  3IRR A;  1Z9C A;  2LC2 A;  3MKY B;  1T6S A;  2KHM A;  3OL4 A;  1R71 A;  3S8P A;  5E3O A;  5HLG A;  3CCV I;  1P9Q C;  1FY7 A;  1J09 A;  1VQO I;  1K83 J;  3FF5 A;  4UUV A;  1LB2 A;  2DW4 A;  4L5E A;  3CLQ A;  1W5T A;  4QPO A;  1WI3 A;  1GXP A;  4RGS A;  5FKN A;  2HWV A;  2V1N A;  1MBJ A;  4PSX A;  3G71 I;  3RKY A;  1IG7 A;  1JJ6 C;  1RC9 A;  3FM5 A;  2BY1 A;  4BAC A;  3ABM H;  1WCM J;  3IWZ A;  1TQM A;  3PSI A;  1WGX A;  5E3N A;  1FBS A;  3HRU A;  3W2V A;  3OYM A;  5KK1 A;  2EZL A;  3ZQQ A;  1R5G A;  1OPC A;  2HKX A;  1QZY A;  3OV8 A;  5JFR A;  3OYF A;  1T98 A;  2E7W A;  5IPA A;  3ZXS A;  2EZH A;  4WK8 F;  2K7L A;  1G8X A;  2VJJ A;  2HXI A;  1N77 A;  3JRH A;  3OR1 C;  2HOA A;  2XB5 A;  3EUH C;  3PUF A;  1GXQ A;  1J5Y A;  1YW9 A;  2F5E A;  3KET A;  5FKO A;  5B1A H;  3AG2 H;  2P5K A;  2DMU A;  3K4M A;  2NVX J;  1RRJ A;  1XMA A;  1K4T A;  3QAH A;  2ZJP F;  4CGZ A;  3DTI A;  5CQE A;  4I0B A;  1X1P A;  1YJW I;  3HTS B;  3OL3 A;  3CES A;  1N78 A;  2DK5 A;  1LDK B;  2DTR A;  4BQQ A;  3G1O A;  1YIJ I;  4ENJ A;  5LEK A;  2VT2 A;  1FOX A;  2FMY A;  2VBZ A;  2ZJQ F;  3L1P A;  3GTP J;  1KON A;  5B3S H;  1R36 A;  1D0X A;  3RJP A;  1LQ1 A;  1GVD A;  1MSE C;  2JN6 A;  2PBI A;  2DA3 A;  2YPR A;  1ULY A;  5KHD A;  2K4B A;  1F4K A;  2OU2 A;  5CLS A;  3S17 J;  4JYK A;  4IL6 C;  3H9G A;  4A3M J;  3LAP A;  2I5U A;  4ASN A;  2FNP A;  2KZV A;  1W36 C;  1AKH B;  5J8C A;  2DFH A;  1G59 A;  2VBW A;  4V2F A;  2I8D A;  4EJT A;  2O8K A;  4A12 A;  2P7C B;  2BV6 A;  2R5Y A;  1TT0 A;  2PMU A;  1I39 A;  5IOZ A;  2O6G E;  1SMT A;  3IHU A;  2K3F A;  5DUI A;  1B59 A;  1W0U A;  5FFZ A;  4MEX F;  3FXQ A;  1YG2 A;  2E1M B;  4EM2 A;  5ILV A;  1HSJ A;  1TWG J;  2O03 A;  4O5V A;  2VL8 A;  2XGC A;  1YRN A;  3WOD F;  3ERE D;  3HSE A;  2FOK A;  2YR2 A;  3MWM A;  2FU4 A;  4AWX B;  4RM2 A;  5H20 A;  3EET A;  1UST A;  1SAN A;  3VB2 A;  4DIQ A;  1VQ8 I;  4DJA A;  3FXL A;  1R6R A;  1UHS A;  2FF4 A;  1R00 A;  1HKS A;  2QWW A;  2W57 A;  4ESB A;  2NNN A;  4JBA A;  1I1S A;  2DT5 A;  1Z3X A;  2CUF A;  4A0Y A;  1ZTR A;  1D0Z A;  4E7Z A;  1E3P A;  3WTY C;  5AIQ A;  4XN0 A;  3TP3 A;  1DGR M;  2R93 J;  1FX7 A;  2B0L A;  4KYW A;  2FBI A;  4QTR A;  3B02 A;  3VYR B;  2RAE A;  2VKE A;  2KMU A;  1VZ0 A;  4DGW B;  3DPL C;  3L9F A;  3RCO A;  2HYJ A;  4HST A;  4DNC A;  2FJ1 A;  4XRM A;  1ZGJ A;  2QKM B;  5E79 C;  1YHQ I;  4PCQ A;  2STW A;  2O3F A;  2CFO A;  3M1E A;  3T8R A;  3HUG A;  2DO7 A;  5L3F A;  3WTS C;  4F91 B;  1XG1 A;  1K78 A;  1G3S A;  3LQR A;  1CQT A;  2NS0 A;  4XKB A;  2QSG X;  2MD5 A;  1WFX A;  1KU7 A;  2IS1 A;  3FX3 A;  5JHF A;  5D6F A;  1O7F A;  2O7O A;  4WXD A;  3MMY B;  2ZME B;  3R4K A;  4L9T A;  2ME6 A;  4CA0 A;  1IXC A;  4KNY A;  2Z2S B;  3QPH A;  5J4V A;  3IH2 A;  2M3A A;  3TOA A;  4ZDP A;  3BG9 A;  2LBF A;  3DU5 A;  2RNG A;  2PI0 A;  4YIR X;  2DCE A;  3HJE A;  1IN8 A;  1HST A;  1Y6I A;  2DOF A;  2ZXJ A;  4FQG A;  1D1A A;  4B43 A;  2M87 A;  3HOZ J;  2E1M C;  4EJO A;  1IV8 A;  3ABK H;  1R22 A;  2NVU B;  2EWN A;  1YX3 A;  2AQE A;  3K10 A;  1A5J A;  3RQ4 A;  5DS9 A;  1VQ5 I;  3WG7 H;  4G12 A;  5LFA A;  1FWZ A;  1ZQ3 P;  4F3Q A;  4P5O A;  4EAT A;  2ICW G;  1IRF A;  3WTV C;  3CC7 I;  4IQJ A;  4Z6Y A;  2IP2 A;  3M7G A;  1IDZ A;  3PIO F;  2X0L A;  3G6E I;  4R8H A;  4ENN A;  1S9H A;  1XGM A;  4NNJ A;  1J75 A;  2HU9 A;  1MH3 A;  3CC4 I;  2W4S A;  4M3D A;  3CLO A;  4J00 A;  5JI6 A;  3BOQ A;  3MZH A;  4UUS B;  3W6V A;  4ZYE A;  1XGO A;  4HG2 A;  1XPX A;  5DYM A;  5L3C A;  1F9N A;  2YSR A;  4DYC A;  2KLO A;  3H5R A;  3E5U A;  3F8N A;  4G6D A;  2EIM H;  2L54 A;  1X1A A;  2HPM A;  5F08 A;  4A3I J;  2IW5 A;  4UXN A;  3K0L A;  3PNV A;  1DQU A;  3S15 J;  2VC0 A;  3CO7 C;  2LH9 A;  3S1N J;  1CF7 A;  2KJB A;  3CJN A;  2DU9 A;  3A01 A;  3QRF F;  2ZBK A;  2R7U A;  5J6X A;  3ERM A;  1RI7 A;  1BW5 A;  3P9K A;  4HPQ A;  1I6H J;  1BBY A;  3WHC A;  1FC3 A;  3QP5 A;  1MMN A;  3H35 A;  2LVS A;  4R1H A;  2EV6 A;  4A0Z A;  2AS5 F;  4KN4 X;  1QA6 A;  3S14 J;  2KJC A;  3DTK A;  1BR4 A;  2QBY A;  4A3J J;  5M5X J;  1JUS A;  4BHB A;  3DLA A;  2R5Z B;  2R0Q C;  3SJM A;  2WAE A;  4E7K A;  3ZQL A;  3OS2 A;  2H09 A;  2P4W A;  1ZAO A;  3S3M A;  4O3M A;  3O6B B;  1JE8 A;  2LFB A;  4RBO A;  1BW6 A;  5M3F J;  1BC8 C;  1TL8 A;  1RIO H;  3GF2 A;  1Y8R B;  1V5E A;  4PGG A;  4OAY A;  2L02 A;  5IT9 Z;  3MZY A;  4HX8 A;  2IAI A;  2VN2 A;  4CCM A;  2NS7 A;  2DFF A;  4PJJ A;  3I56 I;  3C2G A;  1OCT C;  2EV5 A;  3MQ0 A;  2VBX A;  1N75 A;  2FXA A;  2H27 A;  3OOP A;  3ZMU A;  2RC4 A;  5DEQ A;  2V6C A;  5IP6 A;  4XKV A;  1BOA A;  2XAQ A;  3FM3 A;  3CZ6 A;  1IN7 A;  4BXF A;  1RPW A;  2P0W A;  1Y8Q B;  2UXX A;  3F8B A;  4IVN A;  4ZC3 A;  1JKP C;  4JX5 A;  4HQM A;  3KLN A;  1Z91 A;  4RMN A;  3MKW B;  4AM3 A;  4LLG F;  4RAZ A;  1R49 A;  3IC7 A;  1OCO H;  1TWC J;  1YE9 A;  4XLE A;  3LAJ A;  2JSC A;  4E7H A;  5M5Y J;  1F36 A;  3GZ5 A;  2PQ8 A;  4N4O B;  1OR7 A;  5KAF C;  5IP9 J;  1FTT A;  2LY1 A;  4IRI A;  3L2V A;  3BLY A;  1HW2 A;  5JR3 A;  4N0B A;  3FK6 A;  1H9T A;  1RR8 C;  3L7W A;  4HX7 A;  1MZB A;  3A0H C;  1BI3 A;  3QYF A;  4Y52 J;  2Y0S N;  5BQT A;  2H94 A;  1IRG A;  1SAU A;  4AIJ A;  4Q5S F;  3LFK A;  4IRG A;  3OY9 A;  1IO2 A;  2KRH A;  4JP0 A;  1JUP A;  3BT9 A;  3BR1 A;  3RZD J;  2F4O B;  3I0T A;  3CCL I;  2NRA C;  5HLT A;  1MKM A;  1JHF A;  5LGT A;  2EV0 A;  5ICC A;  1IW7 F;  5A2Q Z;  1UCR A;  3HPG A;  1XX5 A;  4ESF A;  4YFK F;  4F93 B;  3F22 A;  4C2U A;  4RAF A;  1XDS A;  3I4P A;  1ORK A;  4YIF A;  1WJF A;  3DBR B;  1P7J A;  1AOY A;  2HOE A;  1LVK A;  4UV9 A;  1APL C;  2QGU A;  3WTZ A;  2QZ8 A;  1AHD P;  3H36 A;  2D2W A;  1E0E A;  4RDU A;  5BS6 A;  5D5U B;  2DT6 A;  2ESN A;  2HPI A;  4EV0 A;  1SEU A;  3UNG C;  4A93 J;  2MC4 A;  1V54 H;  3HXL A;  2JPB A;  4CCL A;  3JRI A;  5C4J J;  2ZSI B;  2FSW A;  3WE3 A;  2BHY A;  3FXU A;  2OZU A;  4XIC A;  3ZPL A;  5HLI A;  1QGP A;  1XGN A;  3P7N A;  2DPD A;  2NNY A;  4FET A;  3M8E A;  2E1N A;  3H5A A;  5F0F A;  3T0Y A;  3ROU A;  3I54 A;  1QZE A;  3LST A;  3WGH A;  2A61 A;  4DOZ A;  3VYU B;  2HTS A;  2TRT A;  4L9V A;  2Z33 A;  3BPV A;  2BEO A;  4XID A;  3HSR A;  1EKE A;  4XBF A;  2DA2 A;  3H92 A;  1KYW A;  1K7A A;  4KIT B;  3M07 A;  2L9V A;  3QWL A;  2XHK A;  3I59 A;  3ZOB A;  3K1N A;  3QYE A;  1RES A;  4CCO A;  1MND A;  3X2Q H;  4RGX A;  3C2H A;  5E20 A;  1C0W A;  3G3Z A;  3HOY J;  1O7L A;  1SD4 A;  2JA5 J;  4NUB A;  3KEO A;  4I0A A;  5J8F A;  3BJO A;  1WJD A;  4DZP A;  5FFX A;  2UV1 A;  2ZME C;  1LNW A;  1MDM A;  3PFY A;  2KL4 A;  1USS A;  1IRX A;  2LBF B;  5E17 F;  2K9M A;  2JVH A;  5HNF A;  4OU0 A;  2DDA A;  1ZR2 A;  2CW8 A;  2X9D A;  2BVM A;  1O3Q A;  1I1G A;  1U6G A;  3W6K B;  1WSU A;  1MMA A;  1ETK A;  2TCT A;  2XPW A;  5FKK A;  1SD5 A;  4BKX A;  2FRH A;  3WU2 C;  2DN0 A;  3ESW B;  3HHH A;  3P9I A;  3CF2 A;  4AU7 A;  1U0J A;  4ENK A;  3BDD A;  1KQ9 A;  3KZI C;  2KFD A;  3NAR A;  1SD7 A;  4BGD A;  5KVR A;  1DU0 A;  2JQ7 A;  3CO6 C;  3O8G A;  4LD5 A;  1D3Y A;  3R6S A;  2HYF A;  2R7F A;  4BU2 A;  1ODD A;  3GME A;  1WJA A;  4XON A;  1TWF J;  2OQR A;  2PEX A;  3S3O A;  4Q47 A;  2K02 A;  2KIU A;  1IV6 A;  1B72 A;  1H0M A;  3SZT A;  2Y48 A;  1SD6 A;  1KYZ A;  3CC2 I;  1SFK A;  3GTJ J;  4RB2 C;  4J19 A;  3L2W A;  1OFC X;  4BJT A;  3Q9V A;  4Y15 A;  1U78 A;  4IJA A;  4B8X A;  4AYB N;  5J40 A;  4PJN A;  2BBY A;  2VQC A;  3HRM A;  4WXH A;  4KT6 A;  3W3C A;  4RB1 A;  3CCJ I;  2EA4 A;  3ONQ A;  2WC2 A;  1VQ6 I;  4OMZ A;  4CYC B;  4UUS A;  3SFI A;  2VB6 A;  1TNS A;  2DQL A;  3K4B A;  3OIP A;  1R4N B;  4B48 A;  4CCN A;  2ZXW H;  5ERI A;  1U3E M;  2AO9 A;  1SC7 A;  2F5C A;  5LGN A;  2DOD A;  2HDD A;  1T33 A;  5E8I A;  3KP4 A;  2KIS A;  3OYJ A;  3RKX A;  4S05 A;  2LY2 A;  1VQM I;  2M0M A;  1TT5 B;  2MH9 A;  2OZ6 A;  2Q2E A;  5EEH A;  3GFL A;  5EEG A;  1G3W A;  1IGN A;  4LIU A;  3A1Y A;  2G9W A;  2BW3 A;  4KUM A;  3ELK A;  3MAJ A;  1X2M A;  1R23 A;  2RRE A;  3QQA A;  2DDB A;  1JGS A;  5J3L A;  4ZH4 F;  3C3W A;  2NS8 A;  1HLV A;  3SZG A;  3BQZ A;  2HOS A;  3J7A Y;  2HDW A;  2FBH A;  2XB0 X;  2ZCW A;  3JRC A;  3SEQ A;  1T0F A;  3TDU C;  1GUU A;  2CUE A;  4AIK A;  3O2P E;  3K4K A;  2Q0O A;  2JPC A;  3TGN A;  2I10 A;  2H6B A;  1MNE A;  1T08 B;  1QRY A;  5E3M A;  2KIM A;  3L2U A;  1K6Y A;  1E2X A;  5JHU A;  1P2F A;  2B7E A;  2IT0 A;  4IHW A;  1PUE E;  2ZNY A;  4MTE A;  4YII A;  3BC8 A;  4PZJ A;  2D5V A;  4M3B A;  4GDF A;  2VKH A;  3LSK A;  4HNT A;  1QHG A;  4YEJ A;  1D8J A;  3OR2 C;  2QM3 A;  4BQO A;  4RA2 A;  5FJ8 J;  3E6C C;  1XSV A;  2MAB A;  4PK4 A;  2H6C A;  3IKV A;  3Q0V A;  4ZTJ A;  4IXA A;  2Y9Y A;  2RQQ A;  4IX7 A;  4U0Y A;  3RYP A;  3HGY A;  4BBR J;  3HPH A;  1V4R A;  2P8T A;  1XD7 A;  1VQP I;  2FA5 A;  1FYK A;  3HRT A;  3HKZ A;  5FRO A;  2IGN A;  1YS6 A;  4C2M J;  5ILS A;  2R7S A;  2EK5 A;  2YX4 A;  4XK4 A;  4U7B A;  1B4A A;  5FLX K;  3GUD A;  3Q5F A;  1QPM A;  3H9J A;  3Q9S A;  3GCM A;  3KPH A;  4W1U A;  4HA8 A;  2XAU A;  2NOG A;  2DAO A;  3TOB A;  2L2O A;  4G7H F;  2MYS A;  1YFH A;  1IZ1 A;  1P4W A;  1XS9 A;  5IT9 K;  4ZDO A;  3WHB A;  2K3P A;  1KU3 A;  2RQP A;  3HTU A;  5LGU A;  4XLH A;  1FNN A;  5LRS A;  2XIG A;  2DOA A;  2EIJ H;  4I01 A;  5L3E A;  3LA2 A;  1HF0 A;  1J59 A;  2ECB A;  2CV2 A;  4JX4 A;  3BPX A;  3D5R C;  4NB5 A;  1A36 A;  3FXO A;  2LKS A;  2L01 A;  4C3J J;  4IHY A;  5GPA A;  1X1D A;  2ZO4 A;  3OOU A;  2QCO A;  5D6E A;  3GTG J;  4XKW A;  3AG3 H;  4FIS A;  1OYI A;  1YIO A;  3S1M J;  3MN2 A;  1WWX A;  1IN5 A;  2LNB A;  4Y33 A;  3WG9 A;  4U0W A;  1F43 A;  3ZQI A;  2D1V A;  2VE9 A;  1W1W E;  2LYC A;  1MW7 A;  3CJR B;  2WB1 A;  2X1E A;  1G4D A;  1OJL A;  1QVU A;  3BZK A;  3E97 A;  3FMS A;  4XOP A;  1U5T C;  3TW6 A;  2CGP A;  2ISZ A;  1X1C A;  2CQX A;  3FKI J;  3K70 D;  5FLX Z;  3LWF A;  5F64 A;  2HVS A;  3S3N A;  1K4S A;  4HBL A;  4G7O F;  3IV5 A;  1MMS A;  2DJI A;  3F23 A;  4AYB A;  1K79 A;  4GRI A;  3ZCO A;  4DYQ A;  4H0E A;  2GA1 A;  4FT8 A;  1FSH A;  4CCJ A;  1TZL A;  4ETS A;  4IF4 A;  4D5F A;  1Q1H A;  4ENM A;  4YFX F;  3DF8 A;  2NVQ J;  3OS0 A;  1XGS A;  3E5Q A;  4BQA A;  4HEA 2;  4LLL A;  1X58 A;  3FXJ A;  3KYC B;  4N9I A;  3OYB A;  3OYK A;  2R7V A;  3L2Q A;  1XCB A;  1BI2 A;  4IKF A;  3HUG B;  4A3B J;  2KKO A;  1MBH A;  2CO5 A;  3DEW A;  4CYC A;  2WV1 A;  2V79 A;  1ZR4 A;  1XDU A;  3BR5 A;  3VPR A;  1W7P B;  3G1L A;  1S7E A;  2IGK A;  3GVA A;  2BY3 A;  2H8W A;  3CUQ C;  3T1B A;  3BR0 A;  3S16 J;  4BEH B;  2GXG A;  3S1R J;  4HNV A;  5IP7 J;  1BL0 A;  3R0A A;  1Y56 A;  3ZMS A;  2R7W A;  4LG0 A;  2E1O A;  5J47 A;  2CWE A;  3M9A A;  5F0C A;  3FDY A;  5CVJ A;  4L18 B;  3ABU A;  4HYE A;  2CG4 A;  1JTY A;  3FKJ A;  3VYS B;  1MGT A;  2E34 A;  4B3A A;  5IT3 A;  4I98 B;  2HKO A;  1ZG5 A;  2LK2 A;  2Y31 A;  2EIK H;  1EJ9 A;  3FMR A;  2A07 F;  1V3F A;  3FBI B;  3FXR A;  2M34 A;  4KIB A;  4CDG A;  3RSN A;  2JK3 A;  3IRQ A;  2JRM A;  3VDX A;  4YRV A;  1MDM B;  3KP5 A;  1SFE A;  2VC1 A;  3RDI A;  5EF6 A;  2L9R A;  3HZJ A;  3NWS A;  3W2W A;  1LFP A;  4XOR A;  2E1C A;  1HW5 A;  4S04 A;  2BY0 A;  4F7Z A;  3JRB A;  5K5O A;  2ME0 A;  2W24 A;  3DCF A;  2F5V A;  2Z16 A;  1ZRC A;  1BM9 A;  1DP7 P;  2GM4 A;  1JT6 A;  3S93 A;  1W36 D;  1DU6 A;  1GLN A;  4BE2 A;  1Z67 A;  3I58 A;  1UEL B;  3K2Z A;  4HSR A;  2ACJ A;  4YG2 F;  2DPU A;  2BYV E;  2OCE A;  3QOD A;  2R5Y B;  1IC8 A;  2EIN H;  3RIR A;  3HIF A;  4HF2 A;  5HDK A;  1ETV A;  1ZN2 A;  3BG5 A;  4IO9 F;  2CQQ A;  2HDC A;  2EJR A;  3CDL A;  3R60 A;  4XQF A;  1O3S A;  5E1X A;  1DPU A;  1KGS A;  2P6S A;  4PJ0 C;  1J7K A;  2FX0 A;  1S29 A;  5TGT A;  3H0D A;  4XL9 A;  2K9Q A;  5EG0 A;  2E2J J;  2QSF X;  3ZQG A;  1JI8 A;  2A5Y B;  3WTW C;  1MNM C;  3H1C A;  3IL2 A;  4RS8 A;  1VF9 A;  2R7O A;  2ADU A;  4GYI A;  1LE8 B;  1S7A A;  5HOD A;  2P81 A;  3TDZ C;  3OWT A;  3H9Q A;  4P96 A;  4X0G A;  2ESH A;  2M1B A;  1YRN B;  4JOM A;  4YEL A;  3I3L A;  2GWR A;  4OOI A;  3J7Y J;  3Q3S A;  1XN7 A;  2ELH A;  3QPL A;  2C6Y A;  4HF0 A;  2ZXI A;  1YW7 A;  5LBQ A;  2ZJR F;  3A02 A;  5D8K B;  2H1L A;  3E7L A;  4EGY A;  2PMZ A;  4U7D A;  3S2D J;  2A6H F;  1MBK A;  2W84 A;  2P6T A;  1Z77 A;  2M7B A;  3QPT A;  1W0T A;  2XAJ A;  3ECO A;  2G7U A;  2L4A A;  3ZQF A;  3LSM A;  3CCY A;  4QLC U;  2VPL A;  3L2C A;  2HTJ A;  1W5S A;  2HFH A;  4OIR F;  3SDB A;  1GDT A;  2R3S A;  2JTV A;  6PAX A;  3K1M A;  1B6A A;  2MH2 A;  4EM0 B;  2HXO A;  1FBQ A;  1YLF A;  4KIF A;  3F8M A;  2V6E A;  3SYT A;  4HW0 A;  4E7S A;  2B9S A;  1X3W B;  2WV0 A;  5M5W J;  2DA5 A;  3C1D A;  3HSF A;  2HYG D;  3HHG A;  4WF2 A;  2HQ5 A;  3TMO A;  1WH5 A;  2HQR A;  2Y2Z A;  3K2A A;  4KIG A;  2Z1D A;  2Z5U A;  4OIN F;  1TQI A;  2VE8 A;  3LFU A;  1NHA A;  4BH9 A;  4Y3O A;  1JUM A;  5GAG J;  3S2W A;  1SFO J;  2DYR H;  2JA8 J;  2CQN A;  3FBN B;  2PJP A;  2JSP A;  5IYD J;  5DCM B;  2LRD A;  1IXR C;  1MMD A;  1W4M A;  3JW4 A;  3I71 A;  2HQN A;  2WBM A;  2UXN A;  3JRD A;  1L3L A;  4LLN A;  5F1J A;  1DP3 A;  5HOO A;  1WJE A;  3J7Z I;  5B66 C;  2EFP A;  3M3Y J;  1JKO C;  2PMZ N;  3KEQ A;  3U1K A;  1LEB A;  2WAF A;  5EZH A;  4A69 C;  3ZMD A;  4LMY A;  3OYA A;  3F8C A;  1VTN C;  2VQG A;  1BC7 C;  1VQL I;  2E60 A;  1HXD A;  1ZGA A;  5DV5 A;  4KA4 A;  1BA5 A;  3BG6 A;  1LUJ B;  1OCZ H;  4RAY A;  1VQN I;  5GTI C;  2MFZ A;  3V42 A;  1ONV A;  1XSD A;  4XKC A;  5HDG A;  2XC7 A;  4EMS A;  3GTQ J;  1FBU A;  1VQ4 I;  4BUP A;  1TLH B;  3NEU A;  9ANT A;  5C3E J;  3BTC A;  4KT5 C;  3RKQ A;  3JR9 A;  3B6A A;  5IY5 H;  3FMQ A;  3K9T A;  2XSJ C;  1U2W A;  3QPS A;  2QBY B;  1FIA A;  5IYB J;  1YTY A;  2D45 A;  2QLZ A;  2DA4 A;  2A69 F;  1SVM A;  5D8L B;  2OC6 A;  3GFI A;  1LDJ A;  2ELJ A;  4XN3 A;  5HS8 A;  1FJL A;  3MEX A;  4XR6 A;  4XNF A;  4DZJ A;  1ZRD A;  4E7I A;  4MO7 A;  5GPC A;  2XKP A;  3TO9 A;  2NAZ A;  1A31 A;  2CJJ A;  5B1B H;  2KQR A;  2GXA A;  2XV4 S;  4MLO A;  3OIO A;  4NC6 A;  4E70 A;  3FXK A;  2F48 A;  2ETH A;  3E3V A;  3GXO A; 
#chains in the Genus database with same CATH homology
 4LGW A;  2XKO A;  1SFX A;  5K1Y A;  2DFI A;  1QBJ A;  4AVP A;  2AXL A;  2XAS A;  4HX4 A;  1YW8 A;  1ZLJ A;  5ILU A;  2IJL A;  1T38 A;  2PFB A;  3CDH A;  2FQ3 A;  5BOX A;  3C7J A;  4M9S A;  4L9N A;  5HS7 A;  1R1U A;  3WGI A;  4HF1 A;  3V7C A;  3KP6 A;  2JRT A;  4XSX F;  3SQN A;  4EQQ A;  4LB6 B;  1QQI A;  4R79 A;  2R7D A;  5AON A;  1R7J A;  3CUQ B;  3WTT C;  2XRO A;  2WTE A;  4IRH A;  1F1Z A;  1OYY A;  1O3T A;  3N97 A;  2V9V A;  2ZNZ A;  4XSZ F;  4FX0 A;  4RGR A;  1FSE A;  3VOD A;  2GAU A;  2VOP A;  3JSO A;  2Y0M A;  3V4G A;  3RI4 A;  3K1P A;  1BN5 A;  2QEN A;  5BPD A;  4Z2Y A;  5DCM A;  1TW3 A;  3WTX C;  3FZV A;  1TW2 A;  1R1V A;  1E17 A;  3E6M A;  3EYI A;  3EUH A;  4I02 A;  4Q4Z F;  2W85 A;  4CHU A;  4HDU A;  3NQO A;  5DDG A;  1DUX C;  3KLO A;  1EH6 A;  1SMY F;  4MQV A;  5FD6 A;  1CF7 B;  2L3D A;  2CFX A;  3L09 A;  4UHT A;  4BXU A;  3J80 Z;  5FB2 A;  3SZP A;  4GYG A;  2XUB A;  2OQG A;  5ED4 A;  1YS7 A;  2RDP A;  3H3U A;  4HLY A;  3QOP A;  2P5L C;  2KRF A;  5A2Q K;  1BI0 A;  3LA3 A;  1RNL A;  4JQF A;  4L0Y B;  2K4J A;  2LKP A;  4WWC A;  4CYD A;  2XAG A;  1BIA A;  3DFG A;  1LJ9 A;  2GQQ A;  3GFM A;  4BHP A;  2UZK A;  1G3Y A;  3ISP A;  5D4R A;  4YFN F;  3R0J A;  3DP7 A;  1P92 A;  2WWY A;  3COA C;  4LG0 B;  4EGZ A;  2O8X A;  2DQR A;  1P4X A;  5ICG A;  4EJV A;  2VOO A;  4I7H A;  1PP7 U;  2M30 A;  3ZN1 A;  4UNO A;  4RGU A;  3F6O A;  5CVU A;  3WTU C;  2LSO A;  3ZMZ A;  3CUQ A;  4U88 A;  3AAF A;  2Z9O A;  1EV7 A;  2JZY A;  5LLQ A;  1BI1 A;  2BE5 F;  5LRR A;  4OIQ F;  4M71 A;  3ML6 A;  2L4M A;  3REO A;  5LHG A;  1FPQ A;  1J2X A;  4MEY F;  3ZN0 A;  1XCV A;  4MQ9 F;  5D5V B;  1P4A A;  1UFM A;  3ZMV A;  1ZG1 A;  1MD0 A;  3WE2 A;  2GXB A;  4XRF A;  2J5P A;  2EFQ A;  3DEU A;  2OBP A;  4CO8 A;  2LDU A;  3JTG A;  3TKY A;  3I64 A;  4G94 A;  2DI3 A;  5DUK A;  2F5D A;  5FO5 A;  2HZT A;  4LJZ F;  4RB0 A;  4PGH A;  5E1W A;  2G7H A;  1S3J A;  4ZYD A;  5CVV A;  1FP1 D;  2CQK A;  5LHH A;  4M9Z A;  3MFK A;  2ZJ2 A;  2K27 A;  3I5U A;  2IPQ X;  2LF7 A;  1RUN A;  2RKH A;  4G8X A;  3MCZ A;  3NRV A;  4FX4 A;  2FBK A;  2BGC A;  1IF1 A;  4BYY A;  3BJ6 A;  1I27 A;  5BMZ A;  3KZY A;  1YYV A;  3VFZ A;  3BP8 A;  4AD9 A;  3EQL F;  5CVR A;  1T39 A;  4GO1 A;  3V8J A;  1R1T A;  3RTR A;  1IUY A;  1LDD A;  4EM1 A;  1IN6 A;  5HLH A;  1EH7 A;  2V1D A;  4P55 A;  4P9F A;  3HRS A;  2YX7 A;  1B1B A;  4CZZ A;  5E18 F;  1FOK A;  3IWF A;  2J5O A;  1KQ0 A;  3GWZ A;  2O0Y A;  2QQB A;  4HOB A;  2VOD A;  2IVM A;  1YO5 C;  1MJB A;  4ZZD A;  3LA7 A;  3SHF A;  4KMU X;  4WXC A;  3ULQ B;  2PMH A;  3U1D A;  1CGP A;  3ZP5 A;  1WI9 A;  3J80 K;  5ICF A;  4M9X A;  2D1H A;  3J81 K;  1Y0U A;  3KP3 A;  1L0O C;  2VT3 A;  3PQJ A;  5CYV A;  4FHT A;  1GHC A;  3BWG A;  2O61 A;  1F5T A;  2MLG A;  2M5W A;  3BY6 A;  3GZ6 A;  4LFU A;  2HS5 A;  3WGG A;  2A6E F;  2P5V A;  1S6L A;  1FP2 A;  2RN7 A;  3RKW A;  2QVO A;  5E8G A;  2PG4 A;  2HR3 A;  4G6Q A;  2IA0 A;  5L3G A;  5H6R A;  2X4H A;  2XAH A;  2W25 A;  2DBB A;  4M73 A;  3I53 A;  2MLK A;  4HZF A;  4UVA A;  3WU1 B;  1OYW A;  1Z1D A;  2CW0 F;  3QU6 A;  4EVI A;  1LVA A;  3KZZ A;  4UV8 A;  3N4M A;  3F72 A;  2PLY A;  2MBF A;  3GW2 A;  1Z05 A;  2EB7 A;  2QUF A;  3KCC A;  3IKT A;  2FNA A;  1GVJ A;  4M74 A;  5HS9 A;  4GGG A;  2QQA A;  2M8E A;  1K78 B;  1ZYR F;  5CJ9 A;  1I5Z A;  1AWC A;  4U0V A;  3B73 A;  5DD4 A;  4UVC A;  2STT A;  4G7Z F;  2KIF A;  1BJA A;  4HV6 A;  2ZME A;  4NHJ A;  1STZ A;  1ZLK A;  2RNJ A;  1Z6T A;  3D0S A;  4MHG A;  1P6R A;  4IHS A;  4LK0 F;  4CIC A;  4A5M A;  2QQ9 A;  3C18 A;  2E7X A;  4CXF A;  1SFU A;  4G9Y A;  1HKQ A;  3F6V A;  1UB9 A;  4I2O A;  3RPQ A;  2K86 A;  5LEJ A;  3GYH X;  1TQP A;  4A6E A;  3T8T A;  2M45 A;  1IXS B;  2OAZ A;  1XSX A;  3LQQ A;  3BJA A;  2F5F A;  3V8L A;  3W6J B;  4QWQ A;  3L00 A;  1G6N A;  1O3R A;  1ON1 A;  2QYO A;  5D5X B;  2YU3 A;  3T5X A;  1FLI A;  1HBX G;  4IHT A;  3TQN A;  1QZZ A;  4NQW A;  3BRO A;  1PDN C;  3DV8 A;  1X3U A;  3SXY A;  3J81 Z;  1YQA A;  4Y13 A;  1SAX A;  3H3Z A;  3JAM K;  2ZKZ A;  5D4S A;  1ZHF A;  2MA3 A;  2Q8K A;  4OIO F;  5D5W B;  1D8K A;  3ZQ7 A;  4XLN F;  3FHZ A;  3DXJ F;  3JTH A;  4BHC A;  4D0P A;  3DKW A;  3P9C A;  2NYX A;  4ZZL A;  1EH8 A;  1MJ9 A;  3ECH A;  1KQ8 A;  4BNC A;  5HVQ C;  5L3B A;  3F21 A;  1TNT A;  1HKT A;  2XAF A;  3QP6 A;  4OIP F;  4HLX A;  3V7S A;  1D5V A;  5HDN A;  1UHM A;  4ESJ A;  4ZYG A;  1REP C;  4M6Y A;  3KP2 A;  2VON A;  4LB5 A;  3VOE A;  2CSO A;  4A6D A;  3F8F A;  4K2E A;  5F1R A;  3RYR A;  3U2R A;  1JHH A;  2RVC A;  1DDN A;  4M6X A;  3CTA A;  2A3S A;  4O6J A;  1I6X A;  2EFO A;  2LF8 A;  1FT9 A;  1R58 A;  5LHI A;  4JK1 X;  1ON2 A;  2VXZ A;  2OA4 A;  2Z3Y A;  1FYM A;  2CYY A;  2ISY A;  1ZRE A;  2TDX A;  4I09 A;  4OMY A;  1J0R A;  5K5R A;  3JSP A;  4N9H A;  1A04 A;  1MJA A;  2MC3 A;  3VEP A;  2COM A;  4M72 A;  4Q48 A;  3V7R A;  2IA2 A;  3EYY A;  3DPT A;  3I59 B;  1KA8 A;  1Z6R A;  1S8N A;  2Z99 A;  4BAY A;  1ZG3 A;  3GX4 X;  4HAM A;  5CVI A;  3V8K A;  3GFJ A;  1IAW A;  2EA2 A;  1OKR A;  3G73 A;  4HV5 A;  1WKM A;  1WRJ A;  2GA2 A;  3GLX A;  5ICE A;  3CUO A;  4P9U A;  4B09 A;  1WQ2 A;  2PN6 A;  3E6D A;  2FML A;  5DD8 A;  4L5J A;  4RB3 C;  3DQV C;  3TO6 A;  1R5H A;  3U9G A;  2P7V B;  1PP8 F;  4UVB A;  2A68 F;  4KN7 X;  4EJW A;  1LEA A;  1RUO A;  3ZMT A;  4KIC A;  5E1Z B;  4TV7 A;  1BIB A;  2Y75 A;  4A0X A;  4IPA A;  2GZW A;  2EFN A;  4KDP A;  1S7O A;  2DK8 A;  1KU2 A;  5FD5 A;  3F3X A;  2JT1 A;  4KFC A;  1U5T A;  1T2K A;  3GEZ A;  1W7P D;  3R61 A;  1XMK A;  3PQK A;  1O57 A;  1H9G A;  1QO0 D;  1KU9 A;  4HQE A;  1HW1 A;  4L0Z B;  3M8F A;  4MNU A;  1FYL A;  1IN4 A;  3HOT A;  3O3K A;  3KFW X;  1UHW A;  1U8R A;  4A2U A;  1K6O A;  1RZ4 A;  2V1U A;  1ZH5 A;  3BZ6 A;  5F6F A;  4ZYH A;  4WCG A;  5L3D A;  3FWE A;  1B9M A;  3KP7 A;  4LK1 F;  3SFZ A;  5JVT A;  1ZRF A;  2V1X A;  4MTD A;  2DLL A;  1TBX A;  2UWM A;  3WU0 A;  4KMF A;  1B9N A;  3KE2 A;  4Y17 A;  2XRN A;  3ABT A;  1W7P A;  2XVC A;  2FEZ A;  4XLP F;  5BPI A;  2EFW A;  3E6B A;  2F2E A;  4EJU A;  5TRD A;  4L9J A;  4L5I A;  4HDV A;  1XB4 A;  2FE3 A;  4A5N A;  1DPR A;  5FGM A;  3RPU A;  4MGR A;  1TTY A;  2ZFW A;  2HGC A;  4GCV A;  5K5Q A;  1Z7U A;  5H6Q A;  2VBY A;  3JAM Z;  3GO5 A;  3TO7 A;  1J9I A;  5TJJ A;  2RV8 A;  3K69 A;  2IA1 A;  1G3T A;  3HYI A;  2IRF G;  3J7A O;  1U5T B;  2XGX A;  3EDP A;  3HOS A;  2RGV A;  3PFI A;  2HEO A;  5AIP A;  1HQC A;  5DCF A;  3E5X A;  4ON0 A;  4GXO A;  1QNT A;  3QU3 A;  1ZAR A;  1OMI A;  2OD5 A;  1FZP B;  1JXS A;  4PDK A;  2GIV A;  4AIH A;  4DQ2 A;  4WX9 A;  3D5L A;  3IRR A;  1Z9C A;  1T6S A;  5HLG A;  1FY7 A;  3FF5 A;  4UUV A;  1LB2 A;  2DW4 A;  1W5T A;  1GXP A;  4RGS A;  2HWV A;  3RKY A;  3FM5 A;  3IWZ A;  1TQM A;  1FBS A;  3HRU A;  5KK1 A;  1R5G A;  1OPC A;  2HKX A;  1QZY A;  3OV8 A;  5JFR A;  1T98 A;  2E7W A;  4WK8 F;  2K7L A;  1GXQ A;  1J5Y A;  1YW9 A;  2F5E A;  3KET A;  2P5K A;  1XMA A;  3QAH A;  4CGZ A;  4I0B A;  3HTS B;  2DK5 A;  1LDK B;  2DTR A;  4ENJ A;  5LEK A;  2VT2 A;  2FMY A;  2VBZ A;  1R36 A;  3RJP A;  1LQ1 A;  2PBI A;  2YPR A;  1ULY A;  2K4B A;  1F4K A;  2OU2 A;  5CLS A;  3LAP A;  4ASN A;  2FNP A;  5J8C A;  2VBW A;  4EJT A;  4A12 A;  2P7C B;  2BV6 A;  2PMU A;  2O6G E;  1SMT A;  3IHU A;  5DUI A;  1B59 A;  5FFZ A;  4MEX F;  3FXQ A;  1YG2 A;  4EM2 A;  5ILV A;  1HSJ A;  2O03 A;  4O5V A;  3WOD F;  3ERE D;  3HSE A;  2FOK A;  2YR2 A;  3MWM A;  2FU4 A;  4AWX B;  5H20 A;  3EET A;  1UST A;  3VB2 A;  2FF4 A;  1R00 A;  1HKS A;  2QWW A;  2W57 A;  4ESB A;  2NNN A;  4JBA A;  1I1S A;  2DT5 A;  4A0Y A;  3WTY C;  5AIQ A;  1FX7 A;  2B0L A;  4KYW A;  2FBI A;  3B02 A;  3DPL C;  3L9F A;  4DNC A;  1ZGJ A;  4PCQ A;  2STW A;  2O3F A;  3M1E A;  3T8R A;  3HUG A;  2DO7 A;  5L3F A;  3WTS C;  1K78 A;  1G3S A;  3LQR A;  2NS0 A;  2MD5 A;  1KU7 A;  3FX3 A;  5D6F A;  1O7F A;  4WXD A;  2ZME B;  3R4K A;  4L9T A;  1IXC A;  4KNY A;  3QPH A;  3TOA A;  2PI0 A;  1IN8 A;  1HST A;  2ZXJ A;  2M87 A;  4EJO A;  1R22 A;  2EWN A;  1FWZ A;  4P5O A;  1IRF A;  3WTV C;  2IP2 A;  3M7G A;  2X0L A;  4ENN A;  4R8H A;  1XGM A;  1J75 A;  3CLO A;  5JI6 A;  3BOQ A;  3MZH A;  4ZYE A;  1XGO A;  5DYM A;  5L3C A;  1F9N A;  2YSR A;  3E5U A;  3F8N A;  4G6D A;  2L54 A;  2IW5 A;  4UXN A;  3K0L A;  2VC0 A;  3CO7 C;  1CF7 A;  2KJB A;  3CJN A;  2DU9 A;  3QRF F;  2ZBK A;  5J6X A;  1RI7 A;  3P9K A;  1BBY A;  1FC3 A;  3QP5 A;  4R1H A;  2EV6 A;  4A0Z A;  2AS5 F;  4KN4 X;  2KJC A;  2QBY A;  4BHB A;  2H09 A;  2P4W A;  1ZAO A;  4O3M A;  3O6B B;  1JE8 A;  1BC8 C;  1RIO H;  3GF2 A;  4PGG A;  2L02 A;  5IT9 Z;  3MZY A;  4HX8 A;  2VN2 A;  2EV5 A;  3MQ0 A;  2VBX A;  2FXA A;  2H27 A;  3OOP A;  3ZMU A;  2RC4 A;  5DEQ A;  2V6C A;  1BOA A;  2XAQ A;  3FM3 A;  1IN7 A;  2UXX A;  3F8B A;  4IVN A;  4HQM A;  3KLN A;  1Z91 A;  4LLG F;  4RAZ A;  3IC7 A;  3LAJ A;  2JSC A;  3GZ5 A;  2PQ8 A;  1OR7 A;  4IRI A;  1HW2 A;  5JR3 A;  4N0B A;  1H9T A;  3L7W A;  4HX7 A;  1MZB A;  1BI3 A;  5BQT A;  2H94 A;  1IRG A;  4AIJ A;  4Q5S F;  3LFK A;  4IRG A;  3I0T A;  2NRA C;  1MKM A;  1JHF A;  5LGT A;  2EV0 A;  5ICC A;  1IW7 F;  5A2Q Z;  1UCR A;  4ESF A;  4YFK F;  3F22 A;  1XDS A;  3I4P A;  4YIF A;  1AOY A;  2HOE A;  4UV9 A;  3WTZ A;  2QZ8 A;  2D2W A;  5BS6 A;  5D5U B;  2ESN A;  4EV0 A;  2JPB A;  2FSW A;  3WE3 A;  3FXU A;  2OZU A;  3ZPL A;  5HLI A;  1QGP A;  1XGN A;  3P7N A;  2DPD A;  2NNY A;  3M8E A;  2E1N A;  3T0Y A;  3ROU A;  3I54 A;  3LST A;  3WGH A;  2A61 A;  2HTS A;  4L9V A;  2Z33 A;  3BPV A;  2BEO A;  3HSR A;  4XBF A;  3H92 A;  1KYW A;  1K7A A;  2XHK A;  3I59 A;  3K1N A;  4RGX A;  5E20 A;  1C0W A;  3G3Z A;  1O7L A;  1SD4 A;  3KEO A;  4I0A A;  5J8F A;  3BJO A;  5FFX A;  1LNW A;  1MDM A;  1USS A;  5E17 F;  4OU0 A;  1O3Q A;  1I1G A;  1U6G A;  3W6K B;  1WSU A;  1SD5 A;  2FRH A;  3HHH A;  3P9I A;  4ENK A;  3BDD A;  1KQ9 A;  1SD7 A;  5KVR A;  3CO6 C;  4LD5 A;  1D3Y A;  3R6S A;  2HYF A;  2R7F A;  1ODD A;  2OQR A;  2PEX A;  4Q47 A;  2K02 A;  2KIU A;  1H0M A;  3SZT A;  2Y48 A;  1SD6 A;  1KYZ A;  4RB2 C;  3Q9V A;  4Y15 A;  1U78 A;  4IJA A;  4B8X A;  2BBY A;  4RB1 A;  3HRM A;  4WXH A;  2EA4 A;  2WC2 A;  4OMZ A;  1TNS A;  2DQL A;  5ERI A;  1U3E M;  2F5C A;  5LGN A;  5E8I A;  3KP4 A;  3RKX A;  4S05 A;  2MH9 A;  2OZ6 A;  2Q2E A;  5EEH A;  3GFL A;  5EEG A;  1G3W A;  2G9W A;  4KUM A;  3ELK A;  3MAJ A;  1R23 A;  1JGS A;  4ZH4 F;  3C3W A;  2FBH A;  2ZCW A;  1T0F A;  3TDU C;  4AIK A;  3O2P E;  2Q0O A;  2JPC A;  3TGN A;  2H6B A;  2KIM A;  1E2X A;  5JHU A;  1P2F A;  2IT0 A;  1PUE E;  2ZNY A;  4MTE A;  4YII A;  4PZJ A;  1D8J A;  2QM3 A;  3E6C C;  1XSV A;  2H6C A;  3IKV A;  4IXA A;  4U0Y A;  3RYP A;  1V4R A;  2P8T A;  1XD7 A;  2FA5 A;  1FYK A;  3HRT A;  1YS6 A;  5ILS A;  2EK5 A;  2YX4 A;  4U7B A;  1B4A A;  5FLX K;  3GUD A;  3Q5F A;  1QPM A;  3Q9S A;  4HA8 A;  2DAO A;  3TOB A;  4G7H F;  1YFH A;  1IZ1 A;  1P4W A;  5IT9 K;  1KU3 A;  2RQP A;  3HTU A;  5LGU A;  1FNN A;  5LRS A;  2XIG A;  4I01 A;  5L3E A;  3LA2 A;  1J59 A;  3BPX A;  4NB5 A;  2L01 A;  2ZO4 A;  5D6E A;  1OYI A;  1YIO A;  1WWX A;  1IN5 A;  2LNB A;  3WG9 A;  4U0W A;  2D1V A;  2VE9 A;  1G4D A;  2ISZ A;  2CGP A;  3FMS A;  3E97 A;  1U5T C;  5FLX Z;  3LWF A;  5F64 A;  4HBL A;  4G7O F;  3F23 A;  1K79 A;  4H0E A;  2GA1 A;  4FT8 A;  1FSH A;  4ETS A;  4IF4 A;  1Q1H A;  4ENM A;  4YFX F;  3DF8 A;  1XGS A;  3E5Q A;  4BQA A;  4LLL A;  4N9I A;  1XCB A;  1BI2 A;  2KKO A;  2CO5 A;  2V79 A;  1XDU A;  1W7P B;  3GVA A;  3CUQ C;  3T1B A;  2GXG A;  3R0A A;  3ZMS A;  4LG0 A;  2CWE A;  3M9A A;  5CVJ A;  4L18 B;  3ABU A;  4HYE A;  2CG4 A;  1MGT A;  5IT3 A;  1ZG5 A;  4I98 B;  2HKO A;  3FMR A;  2A07 F;  1V3F A;  3FXR A;  4CDG A;  4KIB A;  3IRQ A;  1MDM B;  3KP5 A;  1SFE A;  2VC1 A;  3RDI A;  2E1C A;  1HW5 A;  4S04 A;  4F7Z A;  5K5O A;  2W24 A;  1ZRC A;  1BM9 A;  1DP7 P;  3I58 A;  3K2Z A;  2ACJ A;  4YG2 F;  2DPU A;  2BYV E;  3RIR A;  3HIF A;  4HF2 A;  5HDK A;  1ZN2 A;  2HDC A;  2EJR A;  3R60 A;  1O3S A;  5E1X A;  1DPU A;  1KGS A;  2P6S A;  1J7K A;  1S29 A;  2A5Y B;  3WTW C;  3IL2 A;  4RS8 A;  2ADU A;  4GYI A;  1S7A A;  3TDZ C;  4P96 A;  2ESH A;  2M1B A;  2GWR A;  4OOI A;  1XN7 A;  2ELH A;  2C6Y A;  4HF0 A;  1YW7 A;  5LBQ A;  5D8K B;  4EGY A;  4U7D A;  2A6H F;  2W84 A;  2P6T A;  3QPT A;  2XAJ A;  3ECO A;  2G7U A;  2L4A A;  4QLC U;  3L2C A;  2HTJ A;  1W5S A;  2HFH A;  4OIR F;  2R3S A;  2JTV A;  6PAX A;  3K1M A;  1B6A A;  2MH2 A;  4EM0 B;  4KIF A;  1FBQ A;  1YLF A;  3F8M A;  4HW0 A;  2WV0 A;  3C1D A;  3HSF A;  2HYG D;  3HHG A;  4WF2 A;  2HQR A;  4KIG A;  2Z5U A;  4OIN F;  1TQI A;  2VE8 A;  1NHA A;  4BH9 A;  3S2W A;  2PJP A;  5DCM B;  1IXR C;  3JW4 A;  1W4M A;  3I71 A;  1L3L A;  2HQN A;  2UXN A;  4LLN A;  5HOO A;  2EFP A;  3KEQ A;  1LEB A;  3ZMD A;  4LMY A;  3F8C A;  1VTN C;  1BC7 C;  1HXD A;  1ZGA A;  5DV5 A;  4KA4 A;  4RAY A;  1ONV A;  1XSD A;  5HDG A;  4EMS A;  1FBU A;  1TLH B;  3NEU A;  4KT5 C;  3FMQ A;  3K9T A;  1U2W A;  2QBY B;  1YTY A;  2D45 A;  2QLZ A;  2A69 F;  5D8L B;  3GFI A;  1LDJ A;  5HS8 A;  3MEX A;  1ZRD A;  2XKP A;  3TO9 A;  2NAZ A;  2XV4 S;  4E70 A;  2ETH A;  3E3V A;  3GXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...