2B63J

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
molecule keywords 31-MER
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2b63J00
1JJ8C 3HOWJ 1ETQA 3A03A 1U9OA 4M3GA 1B72B 1ZR2A 1HF0A 4BXXJ 5IYBJ 3A01A 1RETA 2LLKA 2M9HA 2NS7A 3SFIA 5GPAA 4QTRA 1JGGA 2K9SA 2R5YB 3BT9A 5IP7J 3TW6A 3S1QJ 4M3BA 5IYCJ 3ZQFA 2R92J 2FD5A 1P7JA 1Y1WJ 4A3IJ 2N8GA 2B63J 2DA4A 3B6AA 3NARA 4V2GA 3LSGA 2COBA 2CQXA 1W0UA 4XICA 3CDLA 5FKKA 4DW6A 3QQAA 1B8IB 2VPRA 1ZQ3P 1PUFB 3HOXJ 2AO9A 2IEKA 1GVDA 2XB5A 2HOTA 1IUFA 2Y0SN 2VKEA 3S2DJ 4UUSB 3BR5A 5C4XJ 2R93J 5DTDA 3Q3SA 4C3IJ 4CYCB 4IHXA 3QPLA 5F04A 4EEFG 2P81A 1BJZA 4M3DA 2R5ZA 5IOYA 1ETYA 1B8IA 3BTIA 5C4JJ 1EF4A 3S1NJ 1I6HJ 3BG3A 1JKRC 4M3FA 2LKXA 4BY1J 5IP6A 2K40A 1JJ6C 3JRGA 2LY9A 1IJWC 4DYCA 1LFBA 3ZQGA 1ETXA 1NTCA 1WCMJ 5M5XJ 4XRMA 5JLWA 5FLMJ 2KDZA 1XC5A 2E1OA 2TCTA 1Z0XA 1MH3A 3ZQIA 3BR1A 2DMPA 3HGYA 3HM5A 3S15J 3M3YJ 1BL0A 1JTYA 1VFCA 3PO3J 4JX6A 1FEXA 5FJ8J 1MBKA 5F08A 3JRIA 1MSFC 2JA6J 4AC0A 3TEDA 1GV5A 2CJJA 2HXIA 4DYQA 1LE8A 1RR7A 1IRZA 5BNGA 3JRFA 3TP3A 2GM4A 2DA6A 2EZLA 2H1KA 4NDLA 5F0CA 2ID6A 4AUXA 2LP0A 2XGEA 1YRNB 4IEJA 2YS9A 3BQYA 4C2MJ 2EZKA 2DMNA 2K9QA 1ORKA 1SANA 2NS8A 4JYKA 2EQRA 3QPSA 1APLC 4W97A 1GT0C 1OCPA 3RQIA 2JA5J 3BQZA 4AYBN 3RZDJ 3S1RJ 1ZKGA 2DN0A 1RESA 5J3LA 1OCTC 1PUFA 5F1JA 2OPTA 4D5CA 1QRYA 2M34A 2NVXJ 1XG1A 2MG4A 2X9DA 1CQTA 3CCYA 2WV1A 4A93J 4S0HB 2CUFA 3B6CA 2FQ4A 3HEFA 3O8HA 1VI0A 3S17J 4M3EA 2R5YA 1Z77A 4IHWA 2IBDA 2R0QC 2WAQN 3BTJA 1UG2A 3S2HJ 1I3QJ 2KT0A 2W48A 1UHSA 3L1PA 1JUSA 1IV6A 3LNQA 3TW7A 3K7AJ 4FCYA 3I4NJ 5EZGA 4A3GJ 1RKWA 4MO7A 1I50J 3BG9A 4M6VA 3GTMJ 2XGDA 4JX4A 5E3OA 5E3MA 5M5WJ 3BR3A 3WHBA 4QIWN 1SFOJ 2DMUA 3HDDA 9ANTA 2NVYJ 3HOZJ 4Y7NJ 2HOAA 3M4OJ 2ZB9A 3JRHA 4CYCA 2X48A 2EH3A 3JRBA 1HDPA 5FKMA 2XPUA 2ID3A 4G12A 1X2MA 1ZTRA 3JRAA 1A5JA 3OSGA 3GTJJ 3S1MJ 1ETVA 4C3HJ 4ABZA 3LSPA 4I76A 1X58A 3GTOJ 1VF9A 4D5FA 2Y9YA 1K83J 1ENHA 2NOGA 3Q0WA 1QVUA 3FK6A 1D5YA 4A3DJ 2YUSA 2ECBA 4J19A 1ITYA 1BW6A 5DS9A 1X2NA 3SDGA 4GFBA 1Y1VJ 4RDUA 1H8AC 1NK2P 1U9NA 1BA5A 3LSRA 1JKPC 5E3LA 3ZQHA 3G1LA 1OFCX 1TWCJ 2HYJA 2O7OA 1HCRA 3G1OA 1FJLA 3ZQCA 1T56A 3HB9A 1T33A 4JP0A 3OSFA 2E2IJ 4FISA 3HOUJ 2XB0X 4C3JJ 1MNMC 2M2EA 3CQZJ 1JT0A 2G0EA 3S16J 1RPWA 5E3NA 5M3MJ 2YU9J 3WHCA 1WPKA 3JRDA 1TWGJ 3A02A 2QF7A 1VNDA 4B1RA 2LVSA 3OOUA 1AKHA 1AHDP 2HXOA 2CUEA 2ELKA 3IV5A 1DU6A 2MSYA 1U8BA 3D1NI 1JUPA 5EGOA 4A3CJ 2O9LA 5C44J 3MKLA 1A6IA 1HLVA 2E2JJ 3GBGA 4JX5A 2FJ1A 3LSJA 4A3LJ 2D5VA 5J1UA 2QCOA 2HOSA 4X1EA 4UUSA 3JR9A 2VUMJ 5EEAA 1XS9A 1JKQC 2ME0A 2JK3A 2DA5A 4L5EA 1FIPA 2DA2A 5EG0B 1HDDC 2LD5A 4IHVA 2O8KA 3G1MA 4A3JJ 4XRSG 1JKOC 3RZOJ 3DCFA 2JJ7A 3MVPA 1U78A 2L7MP 3C2BA 4B3AA 2ECCA 2K9NA 2XSDC 3CMYA 1WH5A 1WI3A 2E2HJ 3RKQA 1POGA 2EZHA 4FE4A 4BBSJ 1H88C 2R7ZJ 4MLOA 5EYRA 2EZIA 2WB1N 3FIWA 4BY7J 1JT6A 1WH7A 5EZHA 3H0GJ 2L7FP 4LOCA 5J1YA 3TP0A 2E19A 3BG5A 3DEWA 3HKZN 4W1UA 3PM1A 5F27A 5IYDJ 2L0KA 2AHQA 1RKTA 5F0HA 2HQ5A 2L9RA 1O4XA 1LE8B 5EGOB 2NVQJ 2EBIA 4Y52J 1ZGWA 1WGXA 2LTPA 5EF6A 1FTTA 1IDYA 4B4CA 5FKOA 3K2AA 3GTQJ 3IH2A 2Y30A 5FKNA 3SJMA 1W0TA 4V2FA 5F0FA 4A3EJ 2PMZN 1LFUP 3BR6A 2CU7A 2LR8A 1G2HA 1ZK8A 2XPWA 5HODA 2DTZA 5JLXA 3HBLA 1GV2A 5J1RA 3ZOBA 2L7ZA 2M0CA 1ETKA 2MGQA 4HNVA 3GTKJ 5C3EJ 2GLOA 3IH4A 3W6VA 4A3BJ 2TRTA 5IOZA 1MBEA 2XPVA 3BTCA 2DMQA 1UMQA 4RBOA 4A69C 3I4MJ 3OIOA 5GPCA 1F43A 5EG0A 2DA7A 1GDTA 2NVTJ 4MFDA 4FE7A 4A3KJ 1IC8A 1IGNA 1S7EA 2ME6A 5IP9J 1YRNA 2JA8J 2RAEA 2DA1A 1ETWA 2CQQA 1BW5A 2OF7A 1FIAA 3Q0UA 4X6AJ 4XIDA 1AKHB 2JWTA 2M8GX 1QPIA 2H8RA 2DMTA 3FISA 3BTLA 3MN2A 1GUUA 4UUTA 2VKVA 3FK7A 4FTHA 2HI3A 1F36A 2Y2ZA 2DA3A 3O8GA 4D7NA 1MBJA 2LK2A 2GBYA 3GTGJ 2MW8A 1MH4A 2CRGA 3H3VK 4MFEA 4MIMA 2XRLA 3F0CA 2Y31A 3Q0VA 3NAUA 2JN6A 2VI6A 4BBRJ 4A3FJ 3PO2J 4DZJA 1QVTA 3VPRA 2XGCA 1HOMA 3HGGA 1K61A 1TWAJ 1FTZA 2DJNA 3JRCA 1MSEC 5GP9A 2X6OA 5FKLA 1JTXA 4DYRA 1OJLA 5FLVA 1H89C 1TWFJ 3ZQLA 4XK4A 2FX0A 4IHYA 3BR0A 5M5YJ 5IPAA 3E7LA 4QSHA 1E3OC 3GTPJ 1R9TJ 2R5ZB 1IDZA 1MBGA 2Y9ZA 1Q1VA 5EDNA 4A3MJ 1ETOA 1TC3C 2LFBA 1AU7A 5K7ZA 2JMWA 4DZPA 5K7FA 1NK3P 1MBFA 4D7MA 5K7HA 1JUMA 1MBHA 3IH3A 1P7IA 3UKGA 3LOCA 1DU0A 1B72A 2I10A 3HOVJ 3FKIJ 3A01B 3S14J 3HOYJ 4XRSA 4BKXA 5M3FJ 4I6ZA 1IG7A 3BR2A 1TWHJ 1ZR4A 2IAIA 3JREA 2JA7J 3GTLJ 2HDDA
chains in the Genus database with same CATH superfamily
2QQ9A 4JOMA 3HOWJ 1R1TA 1ETQA 1ULYA 4M3GA 3KP3A 2BXZA 1HF0A 2K3FA 2FEZA 5JR3A 1F4KA 5IYBJ 3E3VA 4Y4RA 2NS7A 4IRGA 1BI1A 4IQJA 5GPAA 2HS5A 3I0TA 5TISC 2F4OB 4E7KA 1V55H 1IXSB 2XHKA 4KN4X 2MH2A 3BT9A 1O57A 5E1XA 2DK5A 1P7JA 1Z7LA 2V1NA 1IRFA 3S2WA 2QSGX 1N25A 2N8GA 5LRSA 2O6GE 3L09A 5IT9K 5LEKA 2CW7A 1DGWY 2ADUA 4ESBA 4F7ZA 3F8BA 1M1EB 2BYVE 1W0UA 2F5DA 3F6VA 1BJAA 1PYVA 5HLIA 5FKKA 3W6KB 3CP2A 3QQAA 3BLYA 3J81K 1LVKA 1BI0A 4BHBA 1RNLA 2P7CB 5LLQA 3LSKA 3PQJA 1WHUA 5LRRA 4KT6A 4B44A 2MLGA 2DFIA 1IUFA 3MQ0A 3KLNA 3RTRA 3BR5A 4BQAA 4AIHA 2BHZA 3QPLA 5F04A 2WY8Q 2R5ZA 5HVQC 2R7QA 1B8IA 2A05A 2FUG2 4LG0B 1Z9CA 1EF4A 1IN4A 4OINF 3H3UA 4GRIA 3CMAI 3ABKH 3BG3A 2IA1A 1XCBA 3RJPA 1JJ6C 4HX7A 1B9NA 1Z7UA 3JRGA 1T0FC 4U7DA 1Y6IA 3KP6A 4DYCA 3OYAA 1LFBA 4GO1A 1WCMJ 5M5XJ 2KDZA 2STTA 2TCTA 3RKWA 3PSFA 3HRUA 1DP3A 3HGYA 1D1BA 2NXNB 1JTYA 2F4MB 1W7PB 3E5UA 4YFXF 5DD4A 4WCGA 4FT8A 3JRIA 1MSFC 4UNOA 4AC0A 1OKRA 4CCNA 2LF8A 5GAGJ 2M0MA 4I2OA 1GV5A 4KMFA 2CV1A 1LE8A 1SVOA 3L2CA 1LFPA 1RR7A 3OOPA 5BNGA 3TP3A 4U0WA 4G6DA 3JSPA 4LJZF 4IOAF 2G7UA 2XV4S 1YRNB 3I3LA 1JHFA 2DMNA 2KLOA 4XLNF 2P5LC 2VN2A 1SANA 5H6QA 3GLLA 2EQRA 3EUAA 3QPSA 1SVMA 1UHWA 2K27A 4YIRX 1U5TC 4HQEA 1FPQA 2K9MA 2QUFA 1TW3A 2GA2A 3IAS2 3RQIA 2WAQA 5LHGA 4AYBN 3FM3A 3S1RJ 3QPHA 4IQ4A 3V7RA 4HOBA 5F1JA 4BJ6C 2OPTA 5CQEA 4CCKA 4RAGA 1U5TB 3M8JA 4QLCU 2R7WA 2XGXA 3ZMSA 3VOEA 3O2PE 4V19K 4LB6B 4I7HA 3QWLA 3E6CC 1KU2A 2FQ4A 3TDUC 3O8HA 3N4MA 3BJAA 3A2KA 1ZYRF 3NRVA 3M1CA 3T5XA 2KJCA 2ISZA 1UG2A 2W1OA 2W48A 1XSXA 1UHSA 3L1PA 4LMYA 3OR1C 5LHHA 2OTLI 4YELA 3I4NJ 3JW4A 4IF4A 3BJOA 1S29A 1RKWA 5LD2C 1S3JA 4IXAA 4OIQF 3BG9A 3OYLA 2JTVA 2V1UA 4YEJA 4H0EA 5E3MA 2L01A 3BR3A 1VQ8I 1SFOJ 2DMUA 1T6SA 2J5OA 4PJMA 3HDDA 1A36A 3K2ZA 3M4OJ 1H0MA 1TNTA 3JRHA 4XN3A 2EH3A 3RDIA 4XNFA 5FKMA 5H2FC 2CV2A 2FNPA 1KA8A 3HXLA 4BQOA 1XD7A 3DPTA 1N78A 3JRAA 2AQFA 3SHFA 2OC6A 4EJWA 1X58A 2F5FA 1A04A 2A69F 4D5FA 2Y9YA 3U2RA 1K83J 2VC1A 2PJPA 3CUOA 1XGOA 1YHQI 4XQFA 1QHHD 4CCLA 2QENA 1X2NA 3WGGA 5BPDA 4OIOF 2F2EA 3G71I 3QODA 1S5LC 1FC3A 3IRRA 3IHUA 1FNNA 5BS6A 1K7AA 1HW1A 1R7JA 3K9TA 5TRDA 3MWMA 3FMQA 3C7JA 4ZDOA 1HCRA 3G1OA 1SFEA 2K4JA 4NNJA 2OZ6A 1R5ID 2IGOA 2KQRA 3QAHA 1IXRC 5AONA 1IAWA 3F9KA 3HHGA 3L2RA 1TBXA 4Y13A 3WTXC 2EA4A 1HC8A 4R1HA 1TL8A 3CQZJ 1JT0A 2E1MB 1WWXA 2G0EA 2RNJA 5KCMA 4QPOA 4HV6A 1GLNA 4EM1A 2V79A 3ULQB 1VNDA 4B1RA 3KETA 2XAUA 4LFUA 3C2GA 3QPTA 1VQPI 2DFFA 1AKHA 1OPCA 2HXOA 2E1MC 2CUEA 2ELKA 3E6DA 1B59A 3HG9A 3IV5A 2MSYA 3LA7A 3D1NI 1R71A 1KZHA 2O9LA 3VEPA 5C44J 2NNYA 3GX4X 1U6GA 2L9VA 2QEXI 2X1EA 2ZJQF 4HAMA 1ONVA 1K4TA 4HW0A 2F6CA 2ME0A 2Z1DA 5A2QZ 2GAUA 2WBMA 3QOEA 1FIPA 4IHVA 4BEHB 2XSJC 3PNVA 5ICFA 5J6XA 4FX4A 3RZOJ 4ZDPA 3TGNA 5IT3A 2ZO4A 3GFJA 2CO5A 2B9SA 2L7MP 3I9V2 2DT7B 2X85A 2K9NA 3CMYA 2VB6A 1Y0NA 2GXBA 3HRMA 1CF7B 5E18F 3AL0C 5IT9Z 1VQLI 4MLOA 1TT5B 3HRTA 3TOBA 4BY7J 2M5WA 5KVRA 1F1ZA 1JT6A 4EQQA 1FZPB 3V7SA 3ECOA 3RSNA 3BDDA 2PMUA 3DKYA 3E0JB 3V4GA 3R6SA 1T0FA 3K4KA 1MMAA 3WU2C 5ILVA 3DEWA 2MC3A 2DYSH 4W1UA 1MZBA 2RDPA 2W25A 4XMYA 3T8TA 4ZYGA 5J4VA 1MMGA 2CYYA 5F0HA 2HQ5A 1YJNI 3NWSA 4Y52J 2EBIA 1ZGWA 3TMOA 5CPRB 1IZ1A 4E7SA 2R3SA 1GVJA 4L5JA 5FD5A 4CHUA 1W0TA 2PMZN 3QRFF 3M9AA 1ZK8A 2XPWA 3OYMA 5JLXA 1W7PD 1X3WB 3HBLA 4YFNF 4R79A 2VODA 2W24A 4U87A 3WTUC 2XF6A 3ZOBA 2EA2A 3FMSA 2L7ZA 4RGSA 2MGQA 1Z91A 1YE9A 3F72A 3LSMA 4G6TB 5HLHA 5L3BA 2OJED 2CW0F 2ZMEA 5FLXK 2DQLA 2O03A 1YYVA 2DMQA 1HKSA 1ZAOA 2VQLA 3U9GA 1BIAA 4U0YA 3EYIA 1R6RA 3PUBA 3CF2A 1J75A 5LEJA 2VQCA 2HDWA 5EG0A 2DA7A 4IL6C 4DGWB 3ERED 2QZ8A 3PNTA 1FOWA 4F3QA 3UR3C 3CJTB 4MFDA 4FE7A 2EFNA 4ON0A 1IGNA 2EFWA 4ZYHA 2RAEA 3KEOA 2DT6A 1P9QC 1QBJA 4RAFA 1LEAA 3WGHA 3L2UA 2H94A 4X6AJ 3HTSB 4HBLA 4C30A 1AKHB 1K78A 3X2QH 1W5SA 4OIRF 3MN2A 2KIFA 4XKBA 4ZJZA 1W7PA 3O8GA 2GBYA 4Q48A 2K7LA 3K4CA 2MW8A 1MH4A 2CRGA 4HZFA 3DU6A 4MIMA 2XRLA 3F0CA 3MMYB 4BDYA 3KYDB 4M6YA 3ZCOA 2VI6A 4RM2A 4BBRJ 4A3FJ 1SD4A 1W36C 3CC2I 2KISA 2XGCA 3LQQA 4MGRA 4WXDA 3U21A 3HGGA 4L0YB 1K61A 4IKFA 4G6QA 1MSEC 3K1MA 3RKYA 2X6OA 1HKQA 3GFLA 2QBYA 5FKLA 3RPUD 4EJOA 1Y8RB 1XMXA 3HPHA 4XK4A 5DEQA 4DNCA 2F4IA 3BR0A 5M5YJ 3O3KA 3E7LA 1E3OC 3GTPJ 1R9TJ 2VXDA 3ZMDA 5ERIA 2Y9ZA 2H27A 1V5GA 5DM6F 2LG4A 1AU7A 5K7ZA 1TQIA 2FU4A 1MBFA 1JE8A 4D7MA 5L3GA 1MBHA 1P7IA 1IN8A 3CO6C 1YO5C 1REPC 2PEXA 2JZYA 3K69A 4RA2A 1T08B 1BC7C 2ETHA 1X19A 4EV0A 1I39A 5BPIA 4NQWA 2BXYA 2FNAA 3MFKA 3I4PA 3CZ6A 2KIQA 1ZR4A 1YI2I 1SFKA 2DW4A 4M72A 4XSZF 3JREA 3V7CA 1MNEA 3QYBA 3AAFA 4RB3C 2HGCA 2GIZA 2Q2EA 4UV8A 3A03A 3U1KA 1B72B 1W1WE 4X0GA 1S9HA 4BXXJ 1RETA 2M87A 2OBPA 4Z6YA 2RQQA 2ELHA 2L2OA 3BC8A 4QTRA 2AS5F 3R60A 2K9SA 2BW3A 4BEHA 3LA2A 2HR3A 5IP7J 3S1QJ 4GYGA 4E70A 2KRHA 2EV6A 3CD6I 4CYDA 4M3BA 5IYCJ 1A6QA 4UVCA 2RNGA 5KNLA 4A3IJ 4LLLA 2OQGA 2DA4A 3WTTC 1YS7A 4KT5C 1R23A 1YIJI 3LL7A 1QZZA 3ERMA 1ZGAA 3LSGA 3SEZA 5L3CA 1X1DA 4CUGA 3KEQA 4RAYA 4BJ5C 4XICA 1J59A 2IT0A 3FZVA 2PJRB 3ZGKA 2FMLA 1UELB 4XKCA 4DW6A 1B8IB 5LGUA 1E3PA 2FQ3A 4XOPA 4HNUA 3FXRA 3HOXJ 2UUZA 1GVDA 2XB5A 1XGMA 1QHGA 2ZXJA 1ZRFA 2BEOA 2HOTA 1TZLA 3RQ4A 2OV7A 2VKEA 4OAZA 4JQFA 4BJTA 1YQAA 1YW7A 1OMIA 1J09A 4EEFG 3E6MA 3SZTA 3OL4A 5IOYA 2DPUA 1ETYA 2QLZA 1I6HJ 2DJIA 2M4GA 3H9QA 1QNTA 3GEZA 3FM5A 2O8XA 4XLCA 2K40A 3PFYA 2KRCA 2ZKZA 1N75A 2DOEA 2L4AA 1DUXC 5DUKA 2E36A 2HVRA 1BI3A 2V4JC 4ZTJA 3S32A 2EJRA 2BE5F 3HJEA 4XRMA 2LNBA 2Q0OA 4CXFA 5FLMJ 4OMYA 1Z0XA 4DIQA 2L9NA 3TL4X 4N9IA 4G7ZF 2HOEA 5HDGA 2R7RA 1PVEA 1U2WA 3J7AY 2FMYA 4OWRB 1Z05A 2YX4A 1MBKA 2G7HA 3HYIA 2JA6J 1Z1DA 3ZPLA 1ON1A 2VQHA 5DYMA 5DCMA 3HL2A 2QQBA 3DTEA 2DA6A 2F5CA 2H1KA 4PZJA 2Z99A 3HSRA 5CVUA 4AUXA 2W84A 4UY8I 2GIVA 3BG6A 1FOYA 2DLLA 1ACIA 2F5VA 3DBLB 2LC2A 4C2MJ 2K9QA 1HKTA 2P5KA 3PNYA 4ZZDA 3KE2A 4BQQA 3WG7H 1APLC 3DPLC 2JA5J 4C9YA 1ZKGA 1OCTC 5KAIC 3RIRA 4CCOA 4CZCA 1PUFA 1QRYA 2M34A 2NVXJ 2KPMA 2ZSIB 1JXSA 2X9DA 4QPQA 3CCYA 2WWYA 2HKOA 2GXAA 3DP7A 1VQ7I 3QOPA 1EH6A 5KAFC 3OWTA 2CUFA 3HEFA 4XBFA 3ISPA 3WGIA 1OCOH 4Y15A 2R5YA 1Z77A 3W2VA 2R0QC 3CCEI 1Z67A 3J80K 2TDXA 2ZXHA 1JUSA 2XUBA 3I64A 1YX5A 2DODA 3W6JB 3ZMVA 1IV6A 4YRVA 1TT0A 3TW7A 4GYIA 3S3OA 2HDCA 4FCYA 5E17F 2DO7A 5EZGA 3CJQB 1ZGJA 2KJBA 2DOFA 1I50J 3GMEA 4NC6A 4L0ZB 5DD8A 2XGDA 4HG2A 4PUSA 3LFUA 2ZJ2A 4RB0A 1KQ0A 3J7AO 2VJ5A 4Q5SF 2P5VA 2WADA 3WHBA 2MABA 3JCUC 2WY7Q 1R1VA 4ZH4F 2XC7A 4LG0A 9ANTA 3HOZJ 4Y7NJ 1ODDA 1MIJA 1TQPA 2UXXA 4RLFA 1HA8A 2ZBKA 1HDPA 3K1NA 4MNUA 3DV8A 4PGGA 3CCRI 1L0OC 1E3HA 2XAJA 4Q4ZF 2QKMB 3CF5F 3A0BC 2BHYA 3H0DA 2MD0A 4BU2A 2HQAA 2I8DA 3GTJJ 2HEOA 1ETVA 5LHIA 4O6JA 1O7LA 2VXZA 5HNHA 3OYDA 2PFBA 3OYGA 5CVJA 2D45A 3KLOA 1QVUA 4BNCA 1ITYA 2LKPA 4J19A 4P9FA 1BW6A 2KIMA 1TP4A 2BOLA 2WAEA 3V8KA 5BOXA 1H8AC 1NK2P 1AOYA 2QGUA 4EMSA 5GAEJ 5E3LA 2QA4I 1Z21A 4TV7A 3G1LA 5B66C 2O7OA 4PSXA 2XDVA 3ROUA 2EV0A 2L4MA 3BZCA 2A6TA 1XB4A 4PFPA 4F55A 3HB9A 2BW3B 5K5RA 4LLNA 4JP0A 5GAHJ 3OSFA 2EINH 4C3JJ 1O3RA 2RQPA 2QM3A 2M2EA 3S16J 5E3NA 2HQRA 4BE0A 4O5VA 2CUJA 1WPKA 1TWGJ 2O5RA 2QF7A 2L3DA 3F21A 4UV9A 4OOIA 5DCMB 1ZH5A 2LVSA 4EJTA 2L5QA 1AHDP 4XL9A 4DQ2A 4FETA 3DPUA 3G3ZA 4A3CJ 2R7UA 1K79A 2CSOA 2RV8A 4BHPA 4ZYEA 2EFQA 4M73A 1SFUA 1ZRCA 4JX5A 1S8NA 2FJ1A 5E1WA 2HVSA 2WV0A 2D5VA 4A6DA 1W5TA 2XRNA 3QU3A 2VUMJ 4UUSA 3JR9A 5EEAA 1KQ9A 1XS9A 4XORA 5J8CA 4KDPA 3WTWC 1X1AA 2DA5A 3E1SA 4L5EA 2CGPA 2M7BA 1R00A 1IF1A 2X1DA 2DA2A 4LG3A 1SEUA 2HYGD 4ZYAA 4KA4A 4EVIA 3DCFA 1R58A 3HUGB 1U78A 1USSA 4OAYA 1U5TA 4ZZLA 3OYJA 2XSDC 3C2HA 2H6CA 2P6SA 1XGSA 2A6EF 2EWNA 1A35A 2E2HJ 2OTJI 2D1HA 3EYYA 2JSPA 1H88C 2R7ZJ 2LOOA 3KX2A 4II2A 2Z2SB 3DEEA 3W2AA 1FP2A 4E7ZA 2PI0A 1NH3A 1SVLA 1RIOH 2AXLA 4D0PA 3AFHA 1FOKA 3VB2A 3H0GJ 4JBAA 4UHTA 3TP0A 3BPVA 2ELJA 2ISYA 3E5QA 3EUKL 2MFZA 2E19A 3BG5A 4G7OF 1GXPA 4AU7A 3PM1A 5J8FA 5EEHA 1IXCA 1V5EA 1RKTA 2Y69H 1O4XA 1LE8B 4HNTA 3I59A 4CGZA 5BQTA 2LTPA 4QWQA 1FMVA 4L5IA 1R49A 2JUCA 2VBWA 4XLPF 3VFZA 2X1CA 1FBSA 2Y30A 4HYEA 5FKNA 1DPUA 2V6CA 3Q9VA 4V2FA 4A3EJ 2ZMEB 2IW5A 3BR6A 5J4YA 4BE1A 1G2HA 2E35A 3ZR8X 2WTEA 1QPMA 1LB2A 5ICEA 1TW2A 2IJLA 2JVGA 4FASD 5J1RA 3ESWB 2IS4A 1ETKA 3EDPA 3IC7A 3OYHA 3GTKJ 5A2QK 3W6VA 3J81Z 5TJJA 2XPVA 4ZC3A 1ZLJA 2FOWA 2ZXWH 1MW7A 1XSVA 3R61A 3Q5FA 3I53A 3MZHA 1DDNA 1KU9A 4CICA 2VASA 4BGDA 1RC9A 1MJ9A 1FSHA 1F43A 3FDYA 3KP5A 4L9JA 3EETA 3FF5A 3E5XA 3OS1A 2NVTJ 3LFKA 4A3KJ 3DQVC 1G3TA 2HPMA 2ME6A 2JA8J 3K0LA 1KYWA 3H35A 2DA1A 3NEUA 1BW5A 4WWCA 2IPQX 1RRJA 3P7NA 2DPDA 1UHMA 2DQRA 2KKOA 3QU6A 4N4NB 1B9MA 4U88A 4EM0B 3CCSI 4EJVA 4YIFA 4P5OA 3CP8A 1X1CA 1QPIA 2W7NA 4ASNA 2H8RA 2DYRH 1S6LA 2K3PA 3BTLA 2MBFA 1GXQA 2VKVA 1R4MB 1OCZH 3WODF 2XIGA 2XASA 2Y2ZA 3DTIA 3FX3A 4B43A 2LK2A 3IAM2 5CVRA 5F64A 1MDMA 3F22A 4JK1X 4LLGF 4UVAA 4MFEA 1IV8A 1MMNA 3Q0VA 1YTYA 3NAUA 3FXKA 2MA3A 2JN6A 3COAC 1Y8QB 3K4NA 1IRGA 1FX7A 1X4PA 2OCEA 4DBRA 5GTIC 4HV5A 1D0ZA 5HNFA 4DZJA 1FBUA 4MTEA 1HOMA 2HYFA 2XAQA 3MEXA 2ZNYA 3JRCA 3JAMK 4LIVA 1CF7A 3MKZA 1JTXA 4DYRA 3HKZA 2EFOA 1IUYA 2UV1A 4IVNA 3KCCA 1TWFJ 4OU0A 3ZQLA 1WJAA 2PQ8A 3HOSA 4QSHA 3TQNA 2DFHA 1XN7A 5FRMA 1WVRA 5EDNA 1TC3C 2C6YA 2LFBA 2JMWA 5K7FA 1NK3P 3JAMZ 2WB1A 2V6EA 2E71A 3L2WA 5CJ9A 2FBIA 2QWWA 4NC8A 5D5XB 3UKGA 2PMHA 2I10A 1MDMB 1EH8A 3A01B 4KICA 3H92A 3HOYJ 2F5EA 2BY1A 3L7WA 4BKXA 1IG7A 5GADJ 2KL4A 1QO0D 3KP7A 2R7SA 1J9IA 1YS6A 3KFWX 3KP2A 3F8NA 1XCVA 1G3YA 4CCJA 5DUIA 2IGKA 3GTLJ 4UB8C 1OCCH 3MZ8A 4YG2F 1BBYA 1U9OA 3O6BB 5CYVA 2LRDA 2RGVA 3KEYA 2DAOA 1G59A 1PUEE 2V9KA 3FKJA 3SFIA 4KISA 3NQOA 4FQGA 4PCQA 1BR2A 2CFXA 1QZYA 4DBQA 5K1YA 1I1SA 4LITA 3ZQFA 2L02A 2M1BA 4LK1F 1A31A 2PG4A 2B63J 3DFGA 3B6AA 2UXNA 3NARA 5CVVA 4RB2C 1VQ9I 2M45A 3C1DA 2COBA 3OIPA 3LAJA 2NS0A 3IRQA 4PJLA 4IRIA 3BP8A 3CDLA 3K4MA 1G4DA 2EIMH 4CO8A 4CZZA 2H6BA 1FMWA 2LKSA 4M71A 4BAYA 5B1BH 2VPRA 1EKEA 1ZQ3P 4I0AA 3KYLA 2AO9A 2HKXA 1EA3A 3S93A 4AYBA 3M1EA 3BCAA 4ESFA 1K4SA 2Y0SN 3S2DJ 4UUSB 4IHTA 1IO2A 2R93J 3S3MA 4IJAA 3CC7I 2XROA 5DTDA 4IHXA 5L3EA 2P81A 1BJZA 2RN7A 4NBQA 1ERDA 5C4JJ 1QQIA 3S1NJ 1WQ2A 1U0JA 1DP7P 5JVTA 2XKOA 1JKRC 2K02A 3LSHA 4Y33A 2VC0A 1V5FA 4BY1J 2FBHA 2OD5A 3OYEA 2HFHA 3I71A 3FXJA 2LY9A 3MKYB 4MEYF 4CH7A 3IWFA 3ZQGA 2K86A 3ASNH 1NTCA 1MNDA 1I1GA 2R7DA 5JLWA 4L9NA 3CJNA 5FO5A 2E1OA 1MH3A 3ZQIA 3LSIA 3P5JA 4K2EA 2DMPA 3GFIA 1OYIA 3I56I 3M3YJ 4A2UA 1VFCA 3BY6A 5CLSA 1T2KA 4XR6A 5J40A 1D0XA 3K4BA 2ZSHB 1ZARA 3HRSA 1FOXA 2HXIA 5FRNA 3H5NA 1LVAA 3JRFA 2GM4A 3M07A 2HTSA 3WTYC 4GXOA 3F8MA 1P2FA 5F0CA 4OMZA 2DT5A 3RCOA 1O3TA 5DM7F 2BVMA 2XGEA 2E7XA 4IEJA 4AVZA 3BQYA 1D0YA 3V42A 1ORKA 2XAFA 1Z6TA 5GTHC 4ENKA 2NS8A 2CS3A 4HPQA 2Z5UA 2LBFA 3DLAA 3ZMTA 5HDNA 2EILH 3GZ5A 1B6AA 2H1LA 2YX7A 2DU9A 4WXHA 2JRTA 3TO6A 1RESA 2KMUA 3KZYA 1WI9A 2RREA 1XG1A 1H9TA 2MG4A 1HSTA 2VBZA 3HOTA 5JVGF 2WV1A 3IUOA 1XX5A 1K78B 3L00A 2YR2A 4A93J 1V54H 3CMEI 2M7AA 2UZKA 4S0HB 2OUMA 3TBIA 1VI0A 2X6XA 4HF2A 3TO7A 3S17J 4M3EA 2ZFUA 5EEGA 1IW7F 2QSFX 2DI3A 2FA5A 1Z3XA 4MQ9F 2QVOA 5FB2A 3W2WA 4YFKF 3DEUA 1IN7A 2MH9A 3LNQA 4MQVA 4MO7A 4A3GJ 1LNWA 2KFDA 5E8GA 2DCEA 4JX4A 4EGYA 3K6GA 1V4RA 1WKMA 2JSCA 4QIWN 3AG3H 3FXQA 3TKYA 1XDUA 2NVYJ 2O0YA 1DPRA 2HOAA 2KP6A 1Y56A 4CYCA 2GQQA 2X48A 3JRBA 2QQAA 5JHFA 1GHCA 1MMSA 2NAZA 2P0WA 2VOPA 2COMA 1BR1A 4ZTFA 1MKMA 3CCMI 4G12A 3TDZC 1KU7A 1X2MA 1AA7A 2PBIA 3GUDA 3J7YJ 1LDKB 1S7OA 5IY5H 3S1MJ 4C3HJ 2R7TA 4ABZA 3GZ6A 1PP8F 1H9GA 3MD2A 3CUQC 3TOAA 3KP4A 1ENHA 2NOGA 4NUBA 3Q0WA 4E6KG 3FK6A 1AWCA 2ECBA 3I59B 2V7FA 3G2BA 5DS9A 3SDGA 1QZEA 1RUNA 4RGXA 3CUQB 1U9NA 1BA5A 4AD9A 1MJAA 1QA6A 1T95A 3I54A 3KZZA 4WK8F 1JKPC 3CLQA 3BWGA 1E0EA 2HYJA 2X4HA 2E60A 3ZQCA 4UXNA 1SAUA 1T56A 3FHZA 3PUFA 2VONA 4RM3A 2CW8A 2ZJPF 1NG6A 1T33A 1T98A 3BG7A 4MTDA 2OAZA 4XRFA 4FISA 1XGNA 2FOKA 1T38A 4GCVA 3HOUJ 5HDKA 5B3SH 4IZZA 1HW2A 1MNMC 2QYOA 3FHNA 1SMYF 4WXCA 3M8EA 5M3MJ 3WHCA 1L3LA 3LMMA 3JRDA 2V1DA 4I98B 3CESA 2CG4A 2JT1A 1XSDA 2M8EA 1HSJA 4HEA2 1DU6A 3OYBA 1U8BA 1YX3A 5EGOA 2OQRA 1YJ9I 5LBQA 1HLVA 2ESNA 4CA0A 3VWBA 3GBGA 2LH9A 3IKTA 2Y75A 2A07F 1O3QA 2DOAA 2H09A 4D9JA 3EPZA 5J1UA 2K9LA 2IRFG 1WJEA 4X1EA 2JUGA 4HF0A 3R4KA 1UCRA 1LEBA 3K70C 5EG0B 4A0XA 1BOBA 4F52A 4P9UA 3OYKA 4I01A 2IS6A 3G1MA 4D1QA 3GLXA 4HLXA 4A3JJ 1JKOC 4A5MA 2NVUB 3GYHX 3MVPA 3OMYA 2VJJA 4N0BA 2L9SA 2W85A 3C2BA 4BUPA 1FYKA 1TTYA 2ECCA 4B3AA 3P9IA 4EJUA 5LGTA 1WH5A 3FXLA 5D8KB 1FWZA 2KIUA 3WU1B 1Q1HA 4BE2A 1YOVB 1Z3YA 4G8XA 5D8LB 2BY2A 4AIKA 4BBSJ 1RI7A 5EYRA 2EZIA 2WB1N 1W36D 1J7KA 1MMDA 2FE3A 4BL0B 2VPLA 1OR7A 4XLFA 5EZHA 1Y39A 2BVLA 1T39A 1ZG5A 2GXGA 2DFEA 1FBQA 3RYRA 1WFXA 2A68F 5DDGA 1J2XA 1OCRH 1XPXA 1RR8C 2FBKA 3I55I 2A5WA 1WJDA 2HU9A 3HKZN 5F27A 1JI8A 3OY9A 2L0KA 3KYCB 3ZQ7A 1DGRM 1RUOA 1CGPA 1FTTA 1WGXA 3PIOF 4HDUA 2P6TA 3OYFA 3VODA 4BXUA 3GTQJ 3IH2A 2B0LA 4YIIA 5F6FA 3MZYA 2STWA 2X51A 4L9VA 1LFUP 1BI2A 3ABTA 2CU7A 2IVMA 2LR8A 2GZWA 3TO9A 2BGCA 5D5VB 3F8CA 5HODA 3N05A 1S7AA 2DTZA 4KIBA 2EFPA 1F5TA 3BOQA 3CTAA 1GV2A 5D6FA 4IHSA 1X3UA 2V26A 5EJCA 2M0CA 1LPQA 4M9XA 3PSIA 2W82A 3T0YA 2E5ZA 1UFMA 2VL8A 2GLOA 3IH4A 4P55A 3CCUI 3ZQQA 1OLTA 5IOZA 1VTNC 3VSLA 2MC4A 3I58A 3ONQA 4XM3A 1VQOI 4M9ZA 4BYYA 4RBOA 3AG2H 2VJ4A 5J47A 3D5LA 3RPQA 3R0JA 4ENNA 3I4MJ 4UVBA 2UWMA 2EPFA 3OIOA 2NNNA 4RGUA 3T8RA 3CCQI 3DTKA 4HX8A 1BR4A 2XVCA 1GDTA 3A4CA 2CWEA 5FROA 4B09A 1IC8A 5CVIA 4C2UA 2K4BA 3WE3A 3ABMH 4LD5A 3ZN1A 3ELKA 4R8HA 1ETWA 3IKVA 2OF7A 3REOA 2DBBA 4PSWA 4HX4A 1O7FA 1B1BA 4KMUX 2LDUA 2ZCWA 4PJNA 2JWTA 1SMTA 2M8GX 5AIQA 3C18A 3DXJF 5D4SA 3JTHA 1GUUA 3GF2A 1X3ZB 4FTHA 2PMZA 2HI3A 4HF1A 1K6OA 4HSRA 2IGMA 1F36A 4KIFA 1MBJA 3BCBA 5HS7A 3OYCA 2JQ7A 1TNSA 4G94A 4GGGA 3L2VA 2HQNA 5DCFA 4HRIA 3H3VK 3JTGA 5D6EA 2Y31A 2QSHX 4AWXB 1ZELA 3ZP5A 3IWZA 5K5QA 3CJRB 3SXYA 2BZTA 3PO2J 3VPRA 4KFCA 3CCJI 4L18B 3WE2A 3OV8A 1TWAJ 2DJNA 2JPCA 3CCLI 5GP9A 3LSTA 1DQUA 3FWEA 1SAXA 4CDGA 1KYZA 5FLVA 5FFXA 1H89C 2W00A 4UB6C 1SD7A 2Z33A 2WA0A 2BY0A 2HNHA 1U3EM 2LYCA 4ETSA 4WX9A 5IPAA 3SEQA 1MBGA 2R7VA 1MJBA 4HLYA 1Q1VA 4A3MJ 3F6OA 3T1BA 4DZPA 2HVQA 4L9TA 4AIDA 2OU2A 3K70D 3QP5A 1FY7A 2Y48A 4B48A 1DU0A 3LOCA 3OIQA 3VYRB 1FYMA 4ESJA 1SD5A 2PLYA 1J5YA 1T8IA 3S14J 5JFRA 2L54A 4O3MA 4U0VA 3HZJA 2DXIA 3Q9SA 1TWHJ 3W3CA 4AM3A 2KDOA 1R5GA 4IOCF 3ZRGA 2Z9OA 1OISA 1UG0A 2R7OA 2JA7J 2X0LA 3F23A 2HDDA 1G8XA 1JJ8C 1D5VA 4XOTA 2R7FA 1YW8A 1ZR2A 2VKDA 1QGPA 2ESHA 2JRMA 2LBFB 1YITI 4FX0A 2LLKA 3A01A 2M9HA 2LF7A 4KITB 3SZGA 3VSKA 2GWRA 4ZDLA 1JGGA 2R5YB 1WJFA 2DDBA 3PQKA 3TW6A 3GXOA 2V9PA 3MCZA 1QU3A 4I09A 4PK4A 2R92J 1I6XA 2FD5A 4A5NA 2BY3A 1TQMA 2G9WA 4XLEA 1Y1WJ 3OS2A 2M4KA 4F91B 2KZVA 4IPAA 3G6EI 1HQCA 4ITVA 3BZ6A 1UJ8A 1KGSA 4V2GA 4BQNA 2RVCA 2W4SA 2CQXA 2MLKA 1Z6RA 3HSFA 2DK8A 3J7ZI 4P96A 2NRAC 3HUGA 1E17A 1ZG3A 2JPBA 2KHMA 4KIGA 4A0ZA 1WJBA 3AKZA 1O3SA 2WAFA 1PUFB 1P4AA 4RMNA 2IEKA 2I5UA 4B3XA 1R5HA 2GOMA 4E7LA 3WU0A 2JA2A 4LK0F 5H20A 4G7HF 1XTAA 2HZTA 3QP6A 5C4XJ 3QYFA 3D5RC 3Q3SA 4S05A 3H5AA 4BHCA 4C3IJ 4CYCB 1VQ4I 4M3DA 2Z16A 1WRJA 2B7EA 3BTIA 5B5EC 1PDNC 1D1AA 2V9VA 3ZN0A 5FGMA 2E5NA 4ANJA 1UB9A 3CC4I 2CV0A 4M3FA 4XONA 5ILSA 2LKXA 4KN7X 5IP6A 2FSWA 1STZA 1HXDA 1IJWC 3H9GA 4OIPF 1ETXA 1YLFA 2Y0MA 3EUHC 3K10A 2A3SA 3DBRB 1R22A 5ICCA 3I5UA 1XC5A 3ASOH 3VYUB 4RGRA 3BR1A 2BBYA 3S15J 3HM5A 4RB1A 3LWFA 4DJAA 5F1RA 4HDVA 1BL0A 1YW9A 4II3A 5LGNA 5L3FA 2OZUA 4J00A 3PO3J 1YFHA 4JX6A 1FEXA 3H3ZA 5FJ8J 2JVHA 3CUQA 5F08A 1USTA 2DTRA 2YPRA 2VQGA 3QYEA 4A6EA 1PJRA 3TEDA 2CJJA 2X6WA 2ZMEC 1I5ZA 4DYQA 3PIPF 1IRZA 2H8WA 3BZKA 5AIPA 3NWTA 2EZLA 1BC8C 1MD0A 4NDLA 2ID6A 2O3FA 2LP0A 2GOXB 2ZJRF 2YS9A 1WZ2A 2EZKA 4JYKA 3H9JA 4W97A 1OQYA 1W4MA 1P4XA 2PJRA 1GT0C 1OCPA 2E7WA 2IS1A 3BQZA 3LA3A 3RZDJ 2DN0A 2VBYA 3E6BA 5J3LA 3KPHA 4GDFA 2P4WA 2FXAA 4D5CA 4NC7A 4RLQA 1PP7U 3EUHA 1CQTA 4KYWA 1S72I 1N77A 2PX9A 2CH0A 1FSEA 3SQNA 2CQNA 4XLHA 3B6CA 6PAXA 4ZYDA 4IHWA 2IBDA 1P6RA 2WAQN 2M30A 3BTJA 3CDIA 5HS9A 1I3QJ 4MHGA 2KT0A 4BXFA 5D5WB 3S2HJ 3JSOA 3D5SC 5CQGA 4J01A 1JHHA 3K7AJ 2PN6A 2IA2A 3EQLF 3CMMA 1XDSA 2QKLB 4E4HA 4EM2A 5BMZA 2MD5A 2OCCH 3M8FA 4M6VA 3GTMJ 4NHJA 4U7BA 1EH7A 5E3OA 4PFOA 5M5WJ 1YJWI 4WF2A 2R7XA 2HTJA 1EJ9A 3DU5A 3B73A 2IA0A 3H5RA 2D1VA 2ZB9A 4BACA 1FLIA 3MKWB 2M3AA 4CSWA 1LDDA 3DKXA 2XPUA 3ECHA 2ID3A 4RAZA 2CUZA 3IL2A 2IS2A 4NB5A 1FYLA 4I99C 2LSOA 1LDJA 4F92B 1ZTRA 3OYNA 1A5JA 3OSGA 4Y17A 3A1YA 3LSPA 2VIXA 3IP4B 4I76A 3PFIA 4KNYA 2X6YA 3GTOJ 1VF9A 4RS8A 5D4RA 2VKHA 4C2TA 1D5YA 4A3DJ 2VLAA 2YUSA 3FBNB 4XLAA 4LGWA 1B4AA 2NOJB 1FP1D 3S8PA 4GFBA 3GCMA 1Y1VJ 3OL3A 4RDUA 3ZMZA 3LSRA 3VYTB 2E1CA 3ZQHA 1OFCX 4E7JA 1TWCJ 4ENMA 2MYSA 3HHHA 3ML6A 1FJLA 3SDBA 2LMDA 4N4OB 1VQNI 1UZCA 2RKHA 3OS0A 3ZXSA 4MEXF 5HLGA 3HC7A 1WJ5A 2E2IJ 1LKXA 1D8KA 2XB0X 1V3FA 2K5CA 3AL0B 1WJCA 3H1CA 3K4JA 3N97A 2HPIA 1FT9A 1YG2A 2IGNA 4IX7A 3F3XA 4A12A 3RPUA 4LB5A 1RPWA 3P9CA 2YU9J 1VQMI 2KRFA 2Q1ZB 1R36A 3A02A 5CKTA 1X1PA 4M74A 3G73A 3OR2C 3OOUA 3RI4A 3RKXA 3GFMA 4P1WA 1JUPA 3MKLA 1HW5A 1A6IA 2VOOA 3UNGC 3MAJA 1IN5A 2E2JJ 4S04A 2ICWG 3LSJA 4XSXF 4A3LJ 3CLOA 1I3AA 4I02A 3BROA 5ED4A 2QCOA 5DV5A 2HOSA 3ABUA 1LQ1A 2XAGA 1JKQC 4N9HA 3V8LA 4PDKA 2JK3A 3ZMUA 2VE8A 1U8RA 3HTUA 1HDDC 2LD5A 2O8KA 4XRSG 4PJ0C 2L7KA 2LREA 2JJ7A 4HA8A 2CFOA 2WC2A 4H4KC 4LIUA 2VJIA 3E97A 5B1AH 3DBHB 2A6HF 4UUVA 1WI3A 2P7VB 1Y0UA 3RKQA 2EIKH 1POGA 3VDXA 1BN5A 2EZHA 4FE4A 5FFZA 3CCVI 1C0WA 1VZ0A 4DOZA 1VQKI 4Y3OA 4B47A 3FIWA 5LFAA 2V1XA 1UAAA 2FRHA 2RC4A 3GVAA 5E8IA 2AQEA 1WH7A 2EIJH 1P92A 4B8XA 4PGHA 2L7FP 4LOCA 4BS9A 5H6RA 2J5PA 5J1YA 4AIJA 2VT3A 5KHDA 4EATA 1G6NA 1ZN2A 2ZFWA 2IXSA 1OYWA 1R4NB 2K85A 2VE9A 1K6YA 1LUJB 1P4WA 4BDZA 1VQ5I 5IYDJ 3SFZA 3H36A 1WSUA 2AHQA 3B02A 1NG7A 1X1BA 2L9RA 2XF5A 3FXOA 5EGOB 2NVQJ 2Z3YA 5EF6A 1IDYA 4B4CA 1RZ4A 5FKOA 3K2AA 2Y0SA 1IN6A 2CQ7A 3A0HC 4IRHA 1XMAA 4XKVA 3SJMA 1KQ8A 3S3NA 2BV6A 1D1CA 3P9KA 5F0FA 3DKWA 4HSTA 1OYYA 1EV7A 1G3SA 1ZRDA 2GA1A 2ACJA 3F8FA 2R4GA 3ABLH 2DDAA 5HS8A 2Q8KA 3V8JA 1G3WA 1IRXA 2F48A 4FHTA 4HNVA 3PL8A 5C3EJ 5ICGA 3L2QA 5HLTA 4A3BJ 1ZG1A 2TRTA 1ZREA 3HSEA 1YIOA 3GZNB 4PJJA 1MBEA 3FBIB 3R0AA 3CO7C 1D8JA 3BTCA 1I27A 2XKPA 1HBXG 2XAHA 1LJ9A 1UMQA 3OYIA 2KZGA 1R1UA 2QBYB 4A69C 4AVPA 2ZC2A 4E7IA 5GPCA 1ZLKA 3BJ6A 2E1NA 4XN0A 4Q47A 3AG1H 1S7EA 2HZDA 3AG4H 5IP9J 1YRNA 3PJRA 4F93B 4CCMA 1BOAA 1D3YA 2ZNZA 2EV5A 2CQQA 3HIFA 1FIAA 3SZPA 1J0RA 1JGSA 4HQMA 3Q0UA 5TGTA 4XIDA 2OA4A 1MGTA 2AXTC 3GW2A 2YU3A 2DMTA 3FISA 5ILUA 1TLHB 2CMPA 3M7GA 4UUTA 3FK7A 5D5UB 5JI6A 2DA3A 2VT2A 4D7NA 4XKWA 3FXUA 4M9SA 2LY2A 3DWLE 3GTGJ 2FF4A 4ENJA 4M6XA 3LAPA 3L9FA 1BM9A 1E2XA 3K1PA 1ON2A 3BPXA 2P8TA 2W57A 5FD6A 2EB7A 2YSRA 2IP2A 1VQ6I 3FXMA 2LY1A 3RYPA 2A61A 4BH9A 3C3WA 1QVTA 1KONA 3WTSC 1ZHFA 2XF7A 4IO9F 1FTZA 3GWZA 5KK1A 3WTVC 3GO5A 3WG9A 3D0SA 2HWVA 5L3DA 1BIBA 5JHUA 3HPGA 1OJLA 4KJZA 3SYTA 2VBXA 2EK5A 5K5OA 1NHAA 3KZIC 4A0YA 1SD6A 5E1ZB 2FX0A 4IHYA 3CDHA 2A5YB 1KU3A 2CQKA 3FMRA 4NQWB 1IDZA 2R5ZB 5HOOA 1X4OA 4E7HA 3K4LA 3G4SI 4G9YA 4KUMA 1ETOA 3U1DA 4I0BA 3LQRA 1F9NA 1SC7A 2Q2EB 5K7HA 1JUMA 2QQ8A 1OR7C 3IH3A 3DF8A 1B72A 3DLLF 3HOVJ 3FKIJ 3KIOA 3J80Z 3VYSB 4XRSA 2ZXIA 5M3FJ 4I6ZA 1XMKA 3BR2A 5E79C 1SFXA 1W5CC 2NYXA 2O61A 5E20A 5FLXZ 2IAIA 4Z2YA 3WTZA 4EGZA 2D2WA 2E34A
chains in the Genus database with same CATH topology
1JJ8C 3HOWJ 1ETQA 3A03A 1U9OA 4M3GA 1B72B 1ZR2A 1HF0A 4BXXJ 5IYBJ 3A01A 1RETA 2LLKA 2M9HA 2NS7A 3SFIA 5GPAA 4QTRA 1JGGA 2K9SA 2R5YB 3BT9A 5IP7J 3TW6A 3S1QJ 4M3BA 5IYCJ 3ZQFA 2R92J 2FD5A 1P7JA 1Y1WJ 4A3IJ 2N8GA 2B63J 2DA4A 3B6AA 3NARA 4V2GA 3LSGA 2COBA 2CQXA 1W0UA 4XICA 3CDLA 5FKKA 4DW6A 3QQAA 1B8IB 2VPRA 1ZQ3P 1PUFB 3HOXJ 2AO9A 2IEKA 1GVDA 2XB5A 2HOTA 1IUFA 2Y0SN 2VKEA 3S2DJ 4UUSB 3BR5A 5C4XJ 2R93J 5DTDA 3Q3SA 4C3IJ 4CYCB 4IHXA 3QPLA 5F04A 4EEFG 2P81A 1BJZA 4M3DA 2R5ZA 5IOYA 1ETYA 1B8IA 3BTIA 5C4JJ 1EF4A 3S1NJ 1I6HJ 3BG3A 1JKRC 4M3FA 2LKXA 4BY1J 5IP6A 2K40A 1JJ6C 3JRGA 2LY9A 1IJWC 4DYCA 1LFBA 3ZQGA 1ETXA 1NTCA 1WCMJ 5M5XJ 4XRMA 5JLWA 5FLMJ 2KDZA 1XC5A 2E1OA 2TCTA 1Z0XA 1MH3A 3ZQIA 3BR1A 2DMPA 3HGYA 3HM5A 3S15J 3M3YJ 1BL0A 1JTYA 1VFCA 3PO3J 4JX6A 1FEXA 5FJ8J 1MBKA 5F08A 3JRIA 1MSFC 2JA6J 4AC0A 3TEDA 1GV5A 2CJJA 2HXIA 4DYQA 1LE8A 1RR7A 1IRZA 5BNGA 3JRFA 3TP3A 2GM4A 2DA6A 2EZLA 2H1KA 4NDLA 5F0CA 2ID6A 4AUXA 2LP0A 2XGEA 1YRNB 4IEJA 2YS9A 3BQYA 4C2MJ 2EZKA 2DMNA 2K9QA 1ORKA 1SANA 2NS8A 4JYKA 2EQRA 3QPSA 1APLC 4W97A 1GT0C 1OCPA 3RQIA 2JA5J 3BQZA 4AYBN 3RZDJ 3S1RJ 1ZKGA 2DN0A 1RESA 5J3LA 1OCTC 1PUFA 5F1JA 2OPTA 4D5CA 1QRYA 2M34A 2NVXJ 1XG1A 2MG4A 2X9DA 1CQTA 3CCYA 2WV1A 4A93J 4S0HB 2CUFA 3B6CA 2FQ4A 3HEFA 3O8HA 1VI0A 3S17J 4M3EA 2R5YA 1Z77A 4IHWA 2IBDA 2R0QC 2WAQN 3BTJA 1UG2A 3S2HJ 1I3QJ 2KT0A 2W48A 1UHSA 3L1PA 1JUSA 1IV6A 3LNQA 3TW7A 3K7AJ 4FCYA 3I4NJ 5EZGA 4A3GJ 1RKWA 4MO7A 1I50J 3BG9A 4M6VA 3GTMJ 2XGDA 4JX4A 5E3OA 5E3MA 5M5WJ 3BR3A 3WHBA 4QIWN 1SFOJ 2DMUA 3HDDA 9ANTA 2NVYJ 3HOZJ 4Y7NJ 2HOAA 3M4OJ 2ZB9A 3JRHA 4CYCA 2X48A 2EH3A 3JRBA 1HDPA 5FKMA 2XPUA 2ID3A 4G12A 1X2MA 1ZTRA 3JRAA 1A5JA 3OSGA 3GTJJ 3S1MJ 1ETVA 4C3HJ 4ABZA 3LSPA 4I76A 1X58A 3GTOJ 1VF9A 4D5FA 2Y9YA 1K83J 1ENHA 2NOGA 3Q0WA 1QVUA 3FK6A 1D5YA 4A3DJ 2YUSA 2ECBA 4J19A 1ITYA 1BW6A 5DS9A 1X2NA 3SDGA 4GFBA 1Y1VJ 4RDUA 1H8AC 1NK2P 1U9NA 1BA5A 3LSRA 1JKPC 5E3LA 3ZQHA 3G1LA 1OFCX 1TWCJ 2HYJA 2O7OA 1HCRA 3G1OA 1FJLA 3ZQCA 1T56A 3HB9A 1T33A 4JP0A 3OSFA 2E2IJ 4FISA 3HOUJ 2XB0X 4C3JJ 1MNMC 2M2EA 3CQZJ 1JT0A 2G0EA 3S16J 1RPWA 5E3NA 5M3MJ 2YU9J 3WHCA 1WPKA 3JRDA 1TWGJ 3A02A 2QF7A 1VNDA 4B1RA 2LVSA 3OOUA 1AKHA 1AHDP 2HXOA 2CUEA 2ELKA 3IV5A 1DU6A 2MSYA 1U8BA 3D1NI 1JUPA 5EGOA 4A3CJ 2O9LA 5C44J 3MKLA 1A6IA 1HLVA 2E2JJ 3GBGA 4JX5A 2FJ1A 3LSJA 4A3LJ 2D5VA 5J1UA 2QCOA 2HOSA 4X1EA 4UUSA 3JR9A 2VUMJ 5EEAA 1XS9A 1JKQC 2ME0A 2JK3A 2DA5A 4L5EA 1FIPA 2DA2A 5EG0B 1HDDC 2LD5A 4IHVA 2O8KA 3G1MA 4A3JJ 4XRSG 1JKOC 3RZOJ 3DCFA 2JJ7A 3MVPA 1U78A 2L7MP 3C2BA 4B3AA 2ECCA 2K9NA 2XSDC 3CMYA 1WH5A 1WI3A 2E2HJ 3RKQA 1POGA 2EZHA 4FE4A 4BBSJ 1H88C 2R7ZJ 4MLOA 5EYRA 2EZIA 2WB1N 3FIWA 4BY7J 1JT6A 1WH7A 5EZHA 3H0GJ 2L7FP 4LOCA 5J1YA 3TP0A 2E19A 3BG5A 3DEWA 3HKZN 4W1UA 3PM1A 5F27A 5IYDJ 2L0KA 2AHQA 1RKTA 5F0HA 2HQ5A 2L9RA 1O4XA 1LE8B 5EGOB 2NVQJ 2EBIA 4Y52J 1ZGWA 1WGXA 2LTPA 5EF6A 1FTTA 1IDYA 4B4CA 5FKOA 3K2AA 3GTQJ 3IH2A 2Y30A 5FKNA 3SJMA 1W0TA 4V2FA 5F0FA 4A3EJ 2PMZN 1LFUP 3BR6A 2CU7A 2LR8A 1G2HA 1ZK8A 2XPWA 5HODA 2DTZA 5JLXA 3HBLA 1GV2A 5J1RA 3ZOBA 2L7ZA 2M0CA 1ETKA 2MGQA 4HNVA 3GTKJ 5C3EJ 2GLOA 3IH4A 3W6VA 4A3BJ 2TRTA 5IOZA 1MBEA 2XPVA 3BTCA 2DMQA 1UMQA 4RBOA 4A69C 3I4MJ 3OIOA 5GPCA 1F43A 5EG0A 2DA7A 1GDTA 2NVTJ 4MFDA 4FE7A 4A3KJ 1IC8A 1IGNA 1S7EA 2ME6A 5IP9J 1YRNA 2JA8J 2RAEA 2DA1A 1ETWA 2CQQA 1BW5A 2OF7A 1FIAA 3Q0UA 4X6AJ 4XIDA 1AKHB 2JWTA 2M8GX 1QPIA 2H8RA 2DMTA 3FISA 3BTLA 3MN2A 1GUUA 4UUTA 2VKVA 3FK7A 4FTHA 2HI3A 1F36A 2Y2ZA 2DA3A 3O8GA 4D7NA 1MBJA 2LK2A 2GBYA 3GTGJ 2MW8A 1MH4A 2CRGA 3H3VK 4MFEA 4MIMA 2XRLA 3F0CA 2Y31A 3Q0VA 3NAUA 2JN6A 2VI6A 4BBRJ 4A3FJ 3PO2J 4DZJA 1QVTA 3VPRA 2XGCA 1HOMA 3HGGA 1K61A 1TWAJ 1FTZA 2DJNA 3JRCA 1MSEC 5GP9A 2X6OA 5FKLA 1JTXA 4DYRA 1OJLA 5FLVA 1H89C 1TWFJ 3ZQLA 4XK4A 2FX0A 4IHYA 3BR0A 5M5YJ 5IPAA 3E7LA 4QSHA 1E3OC 3GTPJ 1R9TJ 2R5ZB 1IDZA 1MBGA 2Y9ZA 1Q1VA 5EDNA 4A3MJ 1ETOA 1TC3C 2LFBA 1AU7A 5K7ZA 2JMWA 4DZPA 5K7FA 1NK3P 1MBFA 4D7MA 5K7HA 1JUMA 1MBHA 3IH3A 1P7IA 3UKGA 3LOCA 1DU0A 1B72A 2I10A 3HOVJ 3FKIJ 3A01B 3S14J 3HOYJ 4XRSA 4BKXA 5M3FJ 4I6ZA 1IG7A 3BR2A 1TWHJ 1ZR4A 2IAIA 3JREA 2JA7J 3GTLJ 2HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ8 C;  3HOW J;  1ETQ A;  3A03 A;  1U9O A;  4M3G A;  1B72 B;  1ZR2 A;  1HF0 A;  4BXX J;  5IYB J;  3A01 A;  1RET A;  2LLK A;  2M9H A;  2NS7 A;  3SFI A;  5GPA A;  4QTR A;  1JGG A;  2K9S A;  2R5Y B;  3BT9 A;  5IP7 J;  3TW6 A;  3S1Q J;  4M3B A;  5IYC J;  3ZQF A;  2R92 J;  2FD5 A;  1P7J A;  1Y1W J;  4A3I J;  2N8G A;  2B63 J;  2DA4 A;  3B6A A;  3NAR A;  4V2G A;  3LSG A;  2COB A;  2CQX A;  1W0U A;  4XIC A;  3CDL A;  5FKK A;  4DW6 A;  3QQA A;  1B8I B;  2VPR A;  1ZQ3 P;  1PUF B;  3HOX J;  2AO9 A;  2IEK A;  1GVD A;  2XB5 A;  2HOT A;  1IUF A;  2Y0S N;  2VKE A;  3S2D J;  4UUS B;  3BR5 A;  5C4X J;  2R93 J;  5DTD A;  3Q3S A;  4C3I J;  4CYC B;  4IHX A;  3QPL A;  5F04 A;  4EEF G;  2P81 A;  1BJZ A;  4M3D A;  2R5Z A;  5IOY A;  1ETY A;  1B8I A;  3BTI A;  5C4J J;  1EF4 A;  3S1N J;  1I6H J;  3BG3 A;  1JKR C;  4M3F A;  2LKX A;  4BY1 J;  5IP6 A;  2K40 A;  1JJ6 C;  3JRG A;  2LY9 A;  1IJW C;  4DYC A;  1LFB A;  3ZQG A;  1ETX A;  1NTC A;  1WCM J;  5M5X J;  4XRM A;  5JLW A;  5FLM J;  2KDZ A;  1XC5 A;  2E1O A;  2TCT A;  1Z0X A;  1MH3 A;  3ZQI A;  3BR1 A;  2DMP A;  3HGY A;  3HM5 A;  3S15 J;  3M3Y J;  1BL0 A;  1JTY A;  1VFC A;  3PO3 J;  4JX6 A;  1FEX A;  5FJ8 J;  1MBK A;  5F08 A;  3JRI A;  1MSF C;  2JA6 J;  4AC0 A;  3TED A;  1GV5 A;  2CJJ A;  2HXI A;  4DYQ A;  1LE8 A;  1RR7 A;  1IRZ A;  5BNG A;  3JRF A;  3TP3 A;  2GM4 A;  2DA6 A;  2EZL A;  2H1K A;  4NDL A;  5F0C A;  2ID6 A;  4AUX A;  2LP0 A;  2XGE A;  1YRN B;  4IEJ A;  2YS9 A;  3BQY A;  4C2M J;  2EZK A;  2DMN A;  2K9Q A;  1ORK A;  1SAN A;  2NS8 A;  4JYK A;  2EQR A;  3QPS A;  1APL C;  4W97 A;  1GT0 C;  1OCP A;  3RQI A;  2JA5 J;  3BQZ A;  4AYB N;  3RZD J;  3S1R J;  1ZKG A;  2DN0 A;  1RES A;  5J3L A;  1OCT C;  1PUF A;  5F1J A;  2OPT A;  4D5C A;  1QRY A;  2M34 A;  2NVX J;  1XG1 A;  2MG4 A;  2X9D A;  1CQT A;  3CCY A;  2WV1 A;  4A93 J;  4S0H B;  2CUF A;  3B6C A;  2FQ4 A;  3HEF A;  3O8H A;  1VI0 A;  3S17 J;  4M3E A;  2R5Y A;  1Z77 A;  4IHW A;  2IBD A;  2R0Q C;  2WAQ N;  3BTJ A;  1UG2 A;  3S2H J;  1I3Q J;  2KT0 A;  2W48 A;  1UHS A;  3L1P A;  1JUS A;  1IV6 A;  3LNQ A;  3TW7 A;  3K7A J;  4FCY A;  3I4N J;  5EZG A;  4A3G J;  1RKW A;  4MO7 A;  1I50 J;  3BG9 A;  4M6V A;  3GTM J;  2XGD A;  4JX4 A;  5E3O A;  5E3M A;  5M5W J;  3BR3 A;  3WHB A;  4QIW N;  1SFO J;  2DMU A;  3HDD A;  9ANT A;  2NVY J;  3HOZ J;  4Y7N J;  2HOA A;  3M4O J;  2ZB9 A;  3JRH A;  4CYC A;  2X48 A;  2EH3 A;  3JRB A;  1HDP A;  5FKM A;  2XPU A;  2ID3 A;  4G12 A;  1X2M A;  1ZTR A;  3JRA A;  1A5J A;  3OSG A;  3GTJ J;  3S1M J;  1ETV A;  4C3H J;  4ABZ A;  3LSP A;  4I76 A;  1X58 A;  3GTO J;  1VF9 A;  4D5F A;  2Y9Y A;  1K83 J;  1ENH A;  2NOG A;  3Q0W A;  1QVU A;  3FK6 A;  1D5Y A;  4A3D J;  2YUS A;  2ECB A;  4J19 A;  1ITY A;  1BW6 A;  5DS9 A;  1X2N A;  3SDG A;  4GFB A;  1Y1V J;  4RDU A;  1H8A C;  1NK2 P;  1U9N A;  1BA5 A;  3LSR A;  1JKP C;  5E3L A;  3ZQH A;  3G1L A;  1OFC X;  1TWC J;  2HYJ A;  2O7O A;  1HCR A;  3G1O A;  1FJL A;  3ZQC A;  1T56 A;  3HB9 A;  1T33 A;  4JP0 A;  3OSF A;  2E2I J;  4FIS A;  3HOU J;  2XB0 X;  4C3J J;  1MNM C;  2M2E A;  3CQZ J;  1JT0 A;  2G0E A;  3S16 J;  1RPW A;  5E3N A;  5M3M J;  2YU9 J;  3WHC A;  1WPK A;  3JRD A;  1TWG J;  3A02 A;  2QF7 A;  1VND A;  4B1R A;  2LVS A;  3OOU A;  1AKH A;  1AHD P;  2HXO A;  2CUE A;  2ELK A;  3IV5 A;  1DU6 A;  2MSY A;  1U8B A;  3D1N I;  1JUP A;  5EGO A;  4A3C J;  2O9L A;  5C44 J;  3MKL A;  1A6I A;  1HLV A;  2E2J J;  3GBG A;  4JX5 A;  2FJ1 A;  3LSJ A;  4A3L J;  2D5V A;  5J1U A;  2QCO A;  2HOS A;  4X1E A;  4UUS A;  3JR9 A;  2VUM J;  5EEA A;  1XS9 A;  1JKQ C;  2ME0 A;  2JK3 A;  2DA5 A;  4L5E A;  1FIP A;  2DA2 A;  5EG0 B;  1HDD C;  2LD5 A;  4IHV A;  2O8K A;  3G1M A;  4A3J J;  4XRS G;  1JKO C;  3RZO J;  3DCF A;  2JJ7 A;  3MVP A;  1U78 A;  2L7M P;  3C2B A;  4B3A A;  2ECC A;  2K9N A;  2XSD C;  3CMY A;  1WH5 A;  1WI3 A;  2E2H J;  3RKQ A;  1POG A;  2EZH A;  4FE4 A;  4BBS J;  1H88 C;  2R7Z J;  4MLO A;  5EYR A;  2EZI A;  2WB1 N;  3FIW A;  4BY7 J;  1JT6 A;  1WH7 A;  5EZH A;  3H0G J;  2L7F P;  4LOC A;  5J1Y A;  3TP0 A;  2E19 A;  3BG5 A;  3DEW A;  3HKZ N;  4W1U A;  3PM1 A;  5F27 A;  5IYD J;  2L0K A;  2AHQ A;  1RKT A;  5F0H A;  2HQ5 A;  2L9R A;  1O4X A;  1LE8 B;  5EGO B;  2NVQ J;  2EBI A;  4Y52 J;  1ZGW A;  1WGX A;  2LTP A;  5EF6 A;  1FTT A;  1IDY A;  4B4C A;  5FKO A;  3K2A A;  3GTQ J;  3IH2 A;  2Y30 A;  5FKN A;  3SJM A;  1W0T A;  4V2F A;  5F0F A;  4A3E J;  2PMZ N;  1LFU P;  3BR6 A;  2CU7 A;  2LR8 A;  1G2H A;  1ZK8 A;  2XPW A;  5HOD A;  2DTZ A;  5JLX A;  3HBL A;  1GV2 A;  5J1R A;  3ZOB A;  2L7Z A;  2M0C A;  1ETK A;  2MGQ A;  4HNV A;  3GTK J;  5C3E J;  2GLO A;  3IH4 A;  3W6V A;  4A3B J;  2TRT A;  5IOZ A;  1MBE A;  2XPV A;  3BTC A;  2DMQ A;  1UMQ A;  4RBO A;  4A69 C;  3I4M J;  3OIO A;  5GPC A;  1F43 A;  5EG0 A;  2DA7 A;  1GDT A;  2NVT J;  4MFD A;  4FE7 A;  4A3K J;  1IC8 A;  1IGN A;  1S7E A;  2ME6 A;  5IP9 J;  1YRN A;  2JA8 J;  2RAE A;  2DA1 A;  1ETW A;  2CQQ A;  1BW5 A;  2OF7 A;  1FIA A;  3Q0U A;  4X6A J;  4XID A;  1AKH B;  2JWT A;  2M8G X;  1QPI A;  2H8R A;  2DMT A;  3FIS A;  3BTL A;  3MN2 A;  1GUU A;  4UUT A;  2VKV A;  3FK7 A;  4FTH A;  2HI3 A;  1F36 A;  2Y2Z A;  2DA3 A;  3O8G A;  4D7N A;  1MBJ A;  2LK2 A;  2GBY A;  3GTG J;  2MW8 A;  1MH4 A;  2CRG A;  3H3V K;  4MFE A;  4MIM A;  2XRL A;  3F0C A;  2Y31 A;  3Q0V A;  3NAU A;  2JN6 A;  2VI6 A;  4BBR J;  4A3F J;  3PO2 J;  4DZJ A;  1QVT A;  3VPR A;  2XGC A;  1HOM A;  3HGG A;  1K61 A;  1TWA J;  1FTZ A;  2DJN A;  3JRC A;  1MSE C;  5GP9 A;  2X6O A;  5FKL A;  1JTX A;  4DYR A;  1OJL A;  5FLV A;  1H89 C;  1TWF J;  3ZQL A;  4XK4 A;  2FX0 A;  4IHY A;  3BR0 A;  5M5Y J;  5IPA A;  3E7L A;  4QSH A;  1E3O C;  3GTP J;  1R9T J;  2R5Z B;  1IDZ A;  1MBG A;  2Y9Z A;  1Q1V A;  5EDN A;  4A3M J;  1ETO A;  1TC3 C;  2LFB A;  1AU7 A;  5K7Z A;  2JMW A;  4DZP A;  5K7F A;  1NK3 P;  1MBF A;  4D7M A;  5K7H A;  1JUM A;  1MBH A;  3IH3 A;  1P7I A;  3UKG A;  3LOC A;  1DU0 A;  1B72 A;  2I10 A;  3HOV J;  3FKI J;  3A01 B;  3S14 J;  3HOY J;  4XRS A;  4BKX A;  5M3F J;  4I6Z A;  1IG7 A;  3BR2 A;  1TWH J;  1ZR4 A;  2IAI A;  3JRE A;  2JA7 J;  3GTL J;  2HDD A; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  4JOM A;  3HOW J;  1R1T A;  1ETQ A;  1ULY A;  4M3G A;  3KP3 A;  2BXZ A;  1HF0 A;  2K3F A;  2FEZ A;  5JR3 A;  1F4K A;  5IYB J;  3E3V A;  4Y4R A;  2NS7 A;  4IRG A;  1BI1 A;  4IQJ A;  5GPA A;  2HS5 A;  3I0T A;  5TIS C;  2F4O B;  4E7K A;  1V55 H;  1IXS B;  2XHK A;  4KN4 X;  2MH2 A;  3BT9 A;  1O57 A;  5E1X A;  2DK5 A;  1P7J A;  1Z7L A;  2V1N A;  1IRF A;  3S2W A;  2QSG X;  1N25 A;  2N8G A;  5LRS A;  2O6G E;  3L09 A;  5IT9 K;  5LEK A;  2CW7 A;  1DGW Y;  2ADU A;  4ESB A;  4F7Z A;  3F8B A;  1M1E B;  2BYV E;  1W0U A;  2F5D A;  3F6V A;  1BJA A;  1PYV A;  5HLI A;  5FKK A;  3W6K B;  3CP2 A;  3QQA A;  3BLY A;  3J81 K;  1LVK A;  1BI0 A;  4BHB A;  1RNL A;  2P7C B;  5LLQ A;  3LSK A;  3PQJ A;  1WHU A;  5LRR A;  4KT6 A;  4B44 A;  2MLG A;  2DFI A;  1IUF A;  3MQ0 A;  3KLN A;  3RTR A;  3BR5 A;  4BQA A;  4AIH A;  2BHZ A;  3QPL A;  5F04 A;  2WY8 Q;  2R5Z A;  5HVQ C;  2R7Q A;  1B8I A;  2A05 A;  2FUG 2;  4LG0 B;  1Z9C A;  1EF4 A;  1IN4 A;  4OIN F;  3H3U A;  4GRI A;  3CMA I;  3ABK H;  3BG3 A;  2IA1 A;  1XCB A;  3RJP A;  1JJ6 C;  4HX7 A;  1B9N A;  1Z7U A;  3JRG A;  1T0F C;  4U7D A;  1Y6I A;  3KP6 A;  4DYC A;  3OYA A;  1LFB A;  4GO1 A;  1WCM J;  5M5X J;  2KDZ A;  2STT A;  2TCT A;  3RKW A;  3PSF A;  3HRU A;  1DP3 A;  3HGY A;  1D1B A;  2NXN B;  1JTY A;  2F4M B;  1W7P B;  3E5U A;  4YFX F;  5DD4 A;  4WCG A;  4FT8 A;  3JRI A;  1MSF C;  4UNO A;  4AC0 A;  1OKR A;  4CCN A;  2LF8 A;  5GAG J;  2M0M A;  4I2O A;  1GV5 A;  4KMF A;  2CV1 A;  1LE8 A;  1SVO A;  3L2C A;  1LFP A;  1RR7 A;  3OOP A;  5BNG A;  3TP3 A;  4U0W A;  4G6D A;  3JSP A;  4LJZ F;  4IOA F;  2G7U A;  2XV4 S;  1YRN B;  3I3L A;  1JHF A;  2DMN A;  2KLO A;  4XLN F;  2P5L C;  2VN2 A;  1SAN A;  5H6Q A;  3GLL A;  2EQR A;  3EUA A;  3QPS A;  1SVM A;  1UHW A;  2K27 A;  4YIR X;  1U5T C;  4HQE A;  1FPQ A;  2K9M A;  2QUF A;  1TW3 A;  2GA2 A;  3IAS 2;  3RQI A;  2WAQ A;  5LHG A;  4AYB N;  3FM3 A;  3S1R J;  3QPH A;  4IQ4 A;  3V7R A;  4HOB A;  5F1J A;  4BJ6 C;  2OPT A;  5CQE A;  4CCK A;  4RAG A;  1U5T B;  3M8J A;  4QLC U;  2R7W A;  2XGX A;  3ZMS A;  3VOE A;  3O2P E;  4V19 K;  4LB6 B;  4I7H A;  3QWL A;  3E6C C;  1KU2 A;  2FQ4 A;  3TDU C;  3O8H A;  3N4M A;  3BJA A;  3A2K A;  1ZYR F;  3NRV A;  3M1C A;  3T5X A;  2KJC A;  2ISZ A;  1UG2 A;  2W1O A;  2W48 A;  1XSX A;  1UHS A;  3L1P A;  4LMY A;  3OR1 C;  5LHH A;  2OTL I;  4YEL A;  3I4N J;  3JW4 A;  4IF4 A;  3BJO A;  1S29 A;  1RKW A;  5LD2 C;  1S3J A;  4IXA A;  4OIQ F;  3BG9 A;  3OYL A;  2JTV A;  2V1U A;  4YEJ A;  4H0E A;  5E3M A;  2L01 A;  3BR3 A;  1VQ8 I;  1SFO J;  2DMU A;  1T6S A;  2J5O A;  4PJM A;  3HDD A;  1A36 A;  3K2Z A;  3M4O J;  1H0M A;  1TNT A;  3JRH A;  4XN3 A;  2EH3 A;  3RDI A;  4XNF A;  5FKM A;  5H2F C;  2CV2 A;  2FNP A;  1KA8 A;  3HXL A;  4BQO A;  1XD7 A;  3DPT A;  1N78 A;  3JRA A;  2AQF A;  3SHF A;  2OC6 A;  4EJW A;  1X58 A;  2F5F A;  1A04 A;  2A69 F;  4D5F A;  2Y9Y A;  3U2R A;  1K83 J;  2VC1 A;  2PJP A;  3CUO A;  1XGO A;  1YHQ I;  4XQF A;  1QHH D;  4CCL A;  2QEN A;  1X2N A;  3WGG A;  5BPD A;  4OIO F;  2F2E A;  3G71 I;  3QOD A;  1S5L C;  1FC3 A;  3IRR A;  3IHU A;  1FNN A;  5BS6 A;  1K7A A;  1HW1 A;  1R7J A;  3K9T A;  5TRD A;  3MWM A;  3FMQ A;  3C7J A;  4ZDO A;  1HCR A;  3G1O A;  1SFE A;  2K4J A;  4NNJ A;  2OZ6 A;  1R5I D;  2IGO A;  2KQR A;  3QAH A;  1IXR C;  5AON A;  1IAW A;  3F9K A;  3HHG A;  3L2R A;  1TBX A;  4Y13 A;  3WTX C;  2EA4 A;  1HC8 A;  4R1H A;  1TL8 A;  3CQZ J;  1JT0 A;  2E1M B;  1WWX A;  2G0E A;  2RNJ A;  5KCM A;  4QPO A;  4HV6 A;  1GLN A;  4EM1 A;  2V79 A;  3ULQ B;  1VND A;  4B1R A;  3KET A;  2XAU A;  4LFU A;  3C2G A;  3QPT A;  1VQP I;  2DFF A;  1AKH A;  1OPC A;  2HXO A;  2E1M C;  2CUE A;  2ELK A;  3E6D A;  1B59 A;  3HG9 A;  3IV5 A;  2MSY A;  3LA7 A;  3D1N I;  1R71 A;  1KZH A;  2O9L A;  3VEP A;  5C44 J;  2NNY A;  3GX4 X;  1U6G A;  2L9V A;  2QEX I;  2X1E A;  2ZJQ F;  4HAM A;  1ONV A;  1K4T A;  4HW0 A;  2F6C A;  2ME0 A;  2Z1D A;  5A2Q Z;  2GAU A;  2WBM A;  3QOE A;  1FIP A;  4IHV A;  4BEH B;  2XSJ C;  3PNV A;  5ICF A;  5J6X A;  4FX4 A;  3RZO J;  4ZDP A;  3TGN A;  5IT3 A;  2ZO4 A;  3GFJ A;  2CO5 A;  2B9S A;  2L7M P;  3I9V 2;  2DT7 B;  2X85 A;  2K9N A;  3CMY A;  2VB6 A;  1Y0N A;  2GXB A;  3HRM A;  1CF7 B;  5E18 F;  3AL0 C;  5IT9 Z;  1VQL I;  4MLO A;  1TT5 B;  3HRT A;  3TOB A;  4BY7 J;  2M5W A;  5KVR A;  1F1Z A;  1JT6 A;  4EQQ A;  1FZP B;  3V7S A;  3ECO A;  3RSN A;  3BDD A;  2PMU A;  3DKY A;  3E0J B;  3V4G A;  3R6S A;  1T0F A;  3K4K A;  1MMA A;  3WU2 C;  5ILV A;  3DEW A;  2MC3 A;  2DYS H;  4W1U A;  1MZB A;  2RDP A;  2W25 A;  4XMY A;  3T8T A;  4ZYG A;  5J4V A;  1MMG A;  2CYY A;  5F0H A;  2HQ5 A;  1YJN I;  3NWS A;  4Y52 J;  2EBI A;  1ZGW A;  3TMO A;  5CPR B;  1IZ1 A;  4E7S A;  2R3S A;  1GVJ A;  4L5J A;  5FD5 A;  4CHU A;  1W0T A;  2PMZ N;  3QRF F;  3M9A A;  1ZK8 A;  2XPW A;  3OYM A;  5JLX A;  1W7P D;  1X3W B;  3HBL A;  4YFN F;  4R79 A;  2VOD A;  2W24 A;  4U87 A;  3WTU C;  2XF6 A;  3ZOB A;  2EA2 A;  3FMS A;  2L7Z A;  4RGS A;  2MGQ A;  1Z91 A;  1YE9 A;  3F72 A;  3LSM A;  4G6T B;  5HLH A;  5L3B A;  2OJE D;  2CW0 F;  2ZME A;  5FLX K;  2DQL A;  2O03 A;  1YYV A;  2DMQ A;  1HKS A;  1ZAO A;  2VQL A;  3U9G A;  1BIA A;  4U0Y A;  3EYI A;  1R6R A;  3PUB A;  3CF2 A;  1J75 A;  5LEJ A;  2VQC A;  2HDW A;  5EG0 A;  2DA7 A;  4IL6 C;  4DGW B;  3ERE D;  2QZ8 A;  3PNT A;  1FOW A;  4F3Q A;  3UR3 C;  3CJT B;  4MFD A;  4FE7 A;  2EFN A;  4ON0 A;  1IGN A;  2EFW A;  4ZYH A;  2RAE A;  3KEO A;  2DT6 A;  1P9Q C;  1QBJ A;  4RAF A;  1LEA A;  3WGH A;  3L2U A;  2H94 A;  4X6A J;  3HTS B;  4HBL A;  4C30 A;  1AKH B;  1K78 A;  3X2Q H;  1W5S A;  4OIR F;  3MN2 A;  2KIF A;  4XKB A;  4ZJZ A;  1W7P A;  3O8G A;  2GBY A;  4Q48 A;  2K7L A;  3K4C A;  2MW8 A;  1MH4 A;  2CRG A;  4HZF A;  3DU6 A;  4MIM A;  2XRL A;  3F0C A;  3MMY B;  4BDY A;  3KYD B;  4M6Y A;  3ZCO A;  2VI6 A;  4RM2 A;  4BBR J;  4A3F J;  1SD4 A;  1W36 C;  3CC2 I;  2KIS A;  2XGC A;  3LQQ A;  4MGR A;  4WXD A;  3U21 A;  3HGG A;  4L0Y B;  1K61 A;  4IKF A;  4G6Q A;  1MSE C;  3K1M A;  3RKY A;  2X6O A;  1HKQ A;  3GFL A;  2QBY A;  5FKL A;  3RPU D;  4EJO A;  1Y8R B;  1XMX A;  3HPH A;  4XK4 A;  5DEQ A;  4DNC A;  2F4I A;  3BR0 A;  5M5Y J;  3O3K A;  3E7L A;  1E3O C;  3GTP J;  1R9T J;  2VXD A;  3ZMD A;  5ERI A;  2Y9Z A;  2H27 A;  1V5G A;  5DM6 F;  2LG4 A;  1AU7 A;  5K7Z A;  1TQI A;  2FU4 A;  1MBF A;  1JE8 A;  4D7M A;  5L3G A;  1MBH A;  1P7I A;  1IN8 A;  3CO6 C;  1YO5 C;  1REP C;  2PEX A;  2JZY A;  3K69 A;  4RA2 A;  1T08 B;  1BC7 C;  2ETH A;  1X19 A;  4EV0 A;  1I39 A;  5BPI A;  4NQW A;  2BXY A;  2FNA A;  3MFK A;  3I4P A;  3CZ6 A;  2KIQ A;  1ZR4 A;  1YI2 I;  1SFK A;  2DW4 A;  4M72 A;  4XSZ F;  3JRE A;  3V7C A;  1MNE A;  3QYB A;  3AAF A;  4RB3 C;  2HGC A;  2GIZ A;  2Q2E A;  4UV8 A;  3A03 A;  3U1K A;  1B72 B;  1W1W E;  4X0G A;  1S9H A;  4BXX J;  1RET A;  2M87 A;  2OBP A;  4Z6Y A;  2RQQ A;  2ELH A;  2L2O A;  3BC8 A;  4QTR A;  2AS5 F;  3R60 A;  2K9S A;  2BW3 A;  4BEH A;  3LA2 A;  2HR3 A;  5IP7 J;  3S1Q J;  4GYG A;  4E70 A;  2KRH A;  2EV6 A;  3CD6 I;  4CYD A;  4M3B A;  5IYC J;  1A6Q A;  4UVC A;  2RNG A;  5KNL A;  4A3I J;  4LLL A;  2OQG A;  2DA4 A;  3WTT C;  1YS7 A;  4KT5 C;  1R23 A;  1YIJ I;  3LL7 A;  1QZZ A;  3ERM A;  1ZGA A;  3LSG A;  3SEZ A;  5L3C A;  1X1D A;  4CUG A;  3KEQ A;  4RAY A;  4BJ5 C;  4XIC A;  1J59 A;  2IT0 A;  3FZV A;  2PJR B;  3ZGK A;  2FML A;  1UEL B;  4XKC A;  4DW6 A;  1B8I B;  5LGU A;  1E3P A;  2FQ3 A;  4XOP A;  4HNU A;  3FXR A;  3HOX J;  2UUZ A;  1GVD A;  2XB5 A;  1XGM A;  1QHG A;  2ZXJ A;  1ZRF A;  2BEO A;  2HOT A;  1TZL A;  3RQ4 A;  2OV7 A;  2VKE A;  4OAZ A;  4JQF A;  4BJT A;  1YQA A;  1YW7 A;  1OMI A;  1J09 A;  4EEF G;  3E6M A;  3SZT A;  3OL4 A;  5IOY A;  2DPU A;  1ETY A;  2QLZ A;  1I6H J;  2DJI A;  2M4G A;  3H9Q A;  1QNT A;  3GEZ A;  3FM5 A;  2O8X A;  4XLC A;  2K40 A;  3PFY A;  2KRC A;  2ZKZ A;  1N75 A;  2DOE A;  2L4A A;  1DUX C;  5DUK A;  2E36 A;  2HVR A;  1BI3 A;  2V4J C;  4ZTJ A;  3S32 A;  2EJR A;  2BE5 F;  3HJE A;  4XRM A;  2LNB A;  2Q0O A;  4CXF A;  5FLM J;  4OMY A;  1Z0X A;  4DIQ A;  2L9N A;  3TL4 X;  4N9I A;  4G7Z F;  2HOE A;  5HDG A;  2R7R A;  1PVE A;  1U2W A;  3J7A Y;  2FMY A;  4OWR B;  1Z05 A;  2YX4 A;  1MBK A;  2G7H A;  3HYI A;  2JA6 J;  1Z1D A;  3ZPL A;  1ON1 A;  2VQH A;  5DYM A;  5DCM A;  3HL2 A;  2QQB A;  3DTE A;  2DA6 A;  2F5C A;  2H1K A;  4PZJ A;  2Z99 A;  3HSR A;  5CVU A;  4AUX A;  2W84 A;  4UY8 I;  2GIV A;  3BG6 A;  1FOY A;  2DLL A;  1ACI A;  2F5V A;  3DBL B;  2LC2 A;  4C2M J;  2K9Q A;  1HKT A;  2P5K A;  3PNY A;  4ZZD A;  3KE2 A;  4BQQ A;  3WG7 H;  1APL C;  3DPL C;  2JA5 J;  4C9Y A;  1ZKG A;  1OCT C;  5KAI C;  3RIR A;  4CCO A;  4CZC A;  1PUF A;  1QRY A;  2M34 A;  2NVX J;  2KPM A;  2ZSI B;  1JXS A;  2X9D A;  4QPQ A;  3CCY A;  2WWY A;  2HKO A;  2GXA A;  3DP7 A;  1VQ7 I;  3QOP A;  1EH6 A;  5KAF C;  3OWT A;  2CUF A;  3HEF A;  4XBF A;  3ISP A;  3WGI A;  1OCO H;  4Y15 A;  2R5Y A;  1Z77 A;  3W2V A;  2R0Q C;  3CCE I;  1Z67 A;  3J80 K;  2TDX A;  2ZXH A;  1JUS A;  2XUB A;  3I64 A;  1YX5 A;  2DOD A;  3W6J B;  3ZMV A;  1IV6 A;  4YRV A;  1TT0 A;  3TW7 A;  4GYI A;  3S3O A;  2HDC A;  4FCY A;  5E17 F;  2DO7 A;  5EZG A;  3CJQ B;  1ZGJ A;  2KJB A;  2DOF A;  1I50 J;  3GME A;  4NC6 A;  4L0Z B;  5DD8 A;  2XGD A;  4HG2 A;  4PUS A;  3LFU A;  2ZJ2 A;  4RB0 A;  1KQ0 A;  3J7A O;  2VJ5 A;  4Q5S F;  2P5V A;  2WAD A;  3WHB A;  2MAB A;  3JCU C;  2WY7 Q;  1R1V A;  4ZH4 F;  2XC7 A;  4LG0 A;  9ANT A;  3HOZ J;  4Y7N J;  1ODD A;  1MIJ A;  1TQP A;  2UXX A;  4RLF A;  1HA8 A;  2ZBK A;  1HDP A;  3K1N A;  4MNU A;  3DV8 A;  4PGG A;  3CCR I;  1L0O C;  1E3H A;  2XAJ A;  4Q4Z F;  2QKM B;  3CF5 F;  3A0B C;  2BHY A;  3H0D A;  2MD0 A;  4BU2 A;  2HQA A;  2I8D A;  3GTJ J;  2HEO A;  1ETV A;  5LHI A;  4O6J A;  1O7L A;  2VXZ A;  5HNH A;  3OYD A;  2PFB A;  3OYG A;  5CVJ A;  2D45 A;  3KLO A;  1QVU A;  4BNC A;  1ITY A;  2LKP A;  4J19 A;  4P9F A;  1BW6 A;  2KIM A;  1TP4 A;  2BOL A;  2WAE A;  3V8K A;  5BOX A;  1H8A C;  1NK2 P;  1AOY A;  2QGU A;  4EMS A;  5GAE J;  5E3L A;  2QA4 I;  1Z21 A;  4TV7 A;  3G1L A;  5B66 C;  2O7O A;  4PSX A;  2XDV A;  3ROU A;  2EV0 A;  2L4M A;  3BZC A;  2A6T A;  1XB4 A;  4PFP A;  4F55 A;  3HB9 A;  2BW3 B;  5K5R A;  4LLN A;  4JP0 A;  5GAH J;  3OSF A;  2EIN H;  4C3J J;  1O3R A;  2RQP A;  2QM3 A;  2M2E A;  3S16 J;  5E3N A;  2HQR A;  4BE0 A;  4O5V A;  2CUJ A;  1WPK A;  1TWG J;  2O5R A;  2QF7 A;  2L3D A;  3F21 A;  4UV9 A;  4OOI A;  5DCM B;  1ZH5 A;  2LVS A;  4EJT A;  2L5Q A;  1AHD P;  4XL9 A;  4DQ2 A;  4FET A;  3DPU A;  3G3Z A;  4A3C J;  2R7U A;  1K79 A;  2CSO A;  2RV8 A;  4BHP A;  4ZYE A;  2EFQ A;  4M73 A;  1SFU A;  1ZRC A;  4JX5 A;  1S8N A;  2FJ1 A;  5E1W A;  2HVS A;  2WV0 A;  2D5V A;  4A6D A;  1W5T A;  2XRN A;  3QU3 A;  2VUM J;  4UUS A;  3JR9 A;  5EEA A;  1KQ9 A;  1XS9 A;  4XOR A;  5J8C A;  4KDP A;  3WTW C;  1X1A A;  2DA5 A;  3E1S A;  4L5E A;  2CGP A;  2M7B A;  1R00 A;  1IF1 A;  2X1D A;  2DA2 A;  4LG3 A;  1SEU A;  2HYG D;  4ZYA A;  4KA4 A;  4EVI A;  3DCF A;  1R58 A;  3HUG B;  1U78 A;  1USS A;  4OAY A;  1U5T A;  4ZZL A;  3OYJ A;  2XSD C;  3C2H A;  2H6C A;  2P6S A;  1XGS A;  2A6E F;  2EWN A;  1A35 A;  2E2H J;  2OTJ I;  2D1H A;  3EYY A;  2JSP A;  1H88 C;  2R7Z J;  2LOO A;  3KX2 A;  4II2 A;  2Z2S B;  3DEE A;  3W2A A;  1FP2 A;  4E7Z A;  2PI0 A;  1NH3 A;  1SVL A;  1RIO H;  2AXL A;  4D0P A;  3AFH A;  1FOK A;  3VB2 A;  3H0G J;  4JBA A;  4UHT A;  3TP0 A;  3BPV A;  2ELJ A;  2ISY A;  3E5Q A;  3EUK L;  2MFZ A;  2E19 A;  3BG5 A;  4G7O F;  1GXP A;  4AU7 A;  3PM1 A;  5J8F A;  5EEH A;  1IXC A;  1V5E A;  1RKT A;  2Y69 H;  1O4X A;  1LE8 B;  4HNT A;  3I59 A;  4CGZ A;  5BQT A;  2LTP A;  4QWQ A;  1FMV A;  4L5I A;  1R49 A;  2JUC A;  2VBW A;  4XLP F;  3VFZ A;  2X1C A;  1FBS A;  2Y30 A;  4HYE A;  5FKN A;  1DPU A;  2V6C A;  3Q9V A;  4V2F A;  4A3E J;  2ZME B;  2IW5 A;  3BR6 A;  5J4Y A;  4BE1 A;  1G2H A;  2E35 A;  3ZR8 X;  2WTE A;  1QPM A;  1LB2 A;  5ICE A;  1TW2 A;  2IJL A;  2JVG A;  4FAS D;  5J1R A;  3ESW B;  2IS4 A;  1ETK A;  3EDP A;  3IC7 A;  3OYH A;  3GTK J;  5A2Q K;  3W6V A;  3J81 Z;  5TJJ A;  2XPV A;  4ZC3 A;  1ZLJ A;  2FOW A;  2ZXW H;  1MW7 A;  1XSV A;  3R61 A;  3Q5F A;  3I53 A;  3MZH A;  1DDN A;  1KU9 A;  4CIC A;  2VAS A;  4BGD A;  1RC9 A;  1MJ9 A;  1FSH A;  1F43 A;  3FDY A;  3KP5 A;  4L9J A;  3EET A;  3FF5 A;  3E5X A;  3OS1 A;  2NVT J;  3LFK A;  4A3K J;  3DQV C;  1G3T A;  2HPM A;  2ME6 A;  2JA8 J;  3K0L A;  1KYW A;  3H35 A;  2DA1 A;  3NEU A;  1BW5 A;  4WWC A;  2IPQ X;  1RRJ A;  3P7N A;  2DPD A;  1UHM A;  2DQR A;  2KKO A;  3QU6 A;  4N4N B;  1B9M A;  4U88 A;  4EM0 B;  3CCS I;  4EJV A;  4YIF A;  4P5O A;  3CP8 A;  1X1C A;  1QPI A;  2W7N A;  4ASN A;  2H8R A;  2DYR H;  1S6L A;  2K3P A;  3BTL A;  2MBF A;  1GXQ A;  2VKV A;  1R4M B;  1OCZ H;  3WOD F;  2XIG A;  2XAS A;  2Y2Z A;  3DTI A;  3FX3 A;  4B43 A;  2LK2 A;  3IAM 2;  5CVR A;  5F64 A;  1MDM A;  3F22 A;  4JK1 X;  4LLG F;  4UVA A;  4MFE A;  1IV8 A;  1MMN A;  3Q0V A;  1YTY A;  3NAU A;  3FXK A;  2MA3 A;  2JN6 A;  3COA C;  1Y8Q B;  3K4N A;  1IRG A;  1FX7 A;  1X4P A;  2OCE A;  4DBR A;  5GTI C;  4HV5 A;  1D0Z A;  5HNF A;  4DZJ A;  1FBU A;  4MTE A;  1HOM A;  2HYF A;  2XAQ A;  3MEX A;  2ZNY A;  3JRC A;  3JAM K;  4LIV A;  1CF7 A;  3MKZ A;  1JTX A;  4DYR A;  3HKZ A;  2EFO A;  1IUY A;  2UV1 A;  4IVN A;  3KCC A;  1TWF J;  4OU0 A;  3ZQL A;  1WJA A;  2PQ8 A;  3HOS A;  4QSH A;  3TQN A;  2DFH A;  1XN7 A;  5FRM A;  1WVR A;  5EDN A;  1TC3 C;  2C6Y A;  2LFB A;  2JMW A;  5K7F A;  1NK3 P;  3JAM Z;  2WB1 A;  2V6E A;  2E71 A;  3L2W A;  5CJ9 A;  2FBI A;  2QWW A;  4NC8 A;  5D5X B;  3UKG A;  2PMH A;  2I10 A;  1MDM B;  1EH8 A;  3A01 B;  4KIC A;  3H92 A;  3HOY J;  2F5E A;  2BY1 A;  3L7W A;  4BKX A;  1IG7 A;  5GAD J;  2KL4 A;  1QO0 D;  3KP7 A;  2R7S A;  1J9I A;  1YS6 A;  3KFW X;  3KP2 A;  3F8N A;  1XCV A;  1G3Y A;  4CCJ A;  5DUI A;  2IGK A;  3GTL J;  4UB8 C;  1OCC H;  3MZ8 A;  4YG2 F;  1BBY A;  1U9O A;  3O6B B;  5CYV A;  2LRD A;  2RGV A;  3KEY A;  2DAO A;  1G59 A;  1PUE E;  2V9K A;  3FKJ A;  3SFI A;  4KIS A;  3NQO A;  4FQG A;  4PCQ A;  1BR2 A;  2CFX A;  1QZY A;  4DBQ A;  5K1Y A;  1I1S A;  4LIT A;  3ZQF A;  2L02 A;  2M1B A;  4LK1 F;  1A31 A;  2PG4 A;  2B63 J;  3DFG A;  3B6A A;  2UXN A;  3NAR A;  5CVV A;  4RB2 C;  1VQ9 I;  2M45 A;  3C1D A;  2COB A;  3OIP A;  3LAJ A;  2NS0 A;  3IRQ A;  4PJL A;  4IRI A;  3BP8 A;  3CDL A;  3K4M A;  1G4D A;  2EIM H;  4CO8 A;  4CZZ A;  2H6B A;  1FMW A;  2LKS A;  4M71 A;  4BAY A;  5B1B H;  2VPR A;  1EKE A;  1ZQ3 P;  4I0A A;  3KYL A;  2AO9 A;  2HKX A;  1EA3 A;  3S93 A;  4AYB A;  3M1E A;  3BCA A;  4ESF A;  1K4S A;  2Y0S N;  3S2D J;  4UUS B;  4IHT A;  1IO2 A;  2R93 J;  3S3M A;  4IJA A;  3CC7 I;  2XRO A;  5DTD A;  4IHX A;  5L3E A;  2P81 A;  1BJZ A;  2RN7 A;  4NBQ A;  1ERD A;  5C4J J;  1QQI A;  3S1N J;  1WQ2 A;  1U0J A;  1DP7 P;  5JVT A;  2XKO A;  1JKR C;  2K02 A;  3LSH A;  4Y33 A;  2VC0 A;  1V5F A;  4BY1 J;  2FBH A;  2OD5 A;  3OYE A;  2HFH A;  3I71 A;  3FXJ A;  2LY9 A;  3MKY B;  4MEY F;  4CH7 A;  3IWF A;  3ZQG A;  2K86 A;  3ASN H;  1NTC A;  1MND A;  1I1G A;  2R7D A;  5JLW A;  4L9N A;  3CJN A;  5FO5 A;  2E1O A;  1MH3 A;  3ZQI A;  3LSI A;  3P5J A;  4K2E A;  2DMP A;  3GFI A;  1OYI A;  3I56 I;  3M3Y J;  4A2U A;  1VFC A;  3BY6 A;  5CLS A;  1T2K A;  4XR6 A;  5J40 A;  1D0X A;  3K4B A;  2ZSH B;  1ZAR A;  3HRS A;  1FOX A;  2HXI A;  5FRN A;  3H5N A;  1LVA A;  3JRF A;  2GM4 A;  3M07 A;  2HTS A;  3WTY C;  4GXO A;  3F8M A;  1P2F A;  5F0C A;  4OMZ A;  2DT5 A;  3RCO A;  1O3T A;  5DM7 F;  2BVM A;  2XGE A;  2E7X A;  4IEJ A;  4AVZ A;  3BQY A;  1D0Y A;  3V42 A;  1ORK A;  2XAF A;  1Z6T A;  5GTH C;  4ENK A;  2NS8 A;  2CS3 A;  4HPQ A;  2Z5U A;  2LBF A;  3DLA A;  3ZMT A;  5HDN A;  2EIL H;  3GZ5 A;  1B6A A;  2H1L A;  2YX7 A;  2DU9 A;  4WXH A;  2JRT A;  3TO6 A;  1RES A;  2KMU A;  3KZY A;  1WI9 A;  2RRE A;  1XG1 A;  1H9T A;  2MG4 A;  1HST A;  2VBZ A;  3HOT A;  5JVG F;  2WV1 A;  3IUO A;  1XX5 A;  1K78 B;  3L00 A;  2YR2 A;  4A93 J;  1V54 H;  3CME I;  2M7A A;  2UZK A;  4S0H B;  2OUM A;  3TBI A;  1VI0 A;  2X6X A;  4HF2 A;  3TO7 A;  3S17 J;  4M3E A;  2ZFU A;  5EEG A;  1IW7 F;  2QSF X;  2DI3 A;  2FA5 A;  1Z3X A;  4MQ9 F;  2QVO A;  5FB2 A;  3W2W A;  4YFK F;  3DEU A;  1IN7 A;  2MH9 A;  3LNQ A;  4MQV A;  4MO7 A;  4A3G J;  1LNW A;  2KFD A;  5E8G A;  2DCE A;  4JX4 A;  4EGY A;  3K6G A;  1V4R A;  1WKM A;  2JSC A;  4QIW N;  3AG3 H;  3FXQ A;  3TKY A;  1XDU A;  2NVY J;  2O0Y A;  1DPR A;  2HOA A;  2KP6 A;  1Y56 A;  4CYC A;  2GQQ A;  2X48 A;  3JRB A;  2QQA A;  5JHF A;  1GHC A;  1MMS A;  2NAZ A;  2P0W A;  2VOP A;  2COM A;  1BR1 A;  4ZTF A;  1MKM A;  3CCM I;  4G12 A;  3TDZ C;  1KU7 A;  1X2M A;  1AA7 A;  2PBI A;  3GUD A;  3J7Y J;  1LDK B;  1S7O A;  5IY5 H;  3S1M J;  4C3H J;  2R7T A;  4ABZ A;  3GZ6 A;  1PP8 F;  1H9G A;  3MD2 A;  3CUQ C;  3TOA A;  3KP4 A;  1ENH A;  2NOG A;  4NUB A;  3Q0W A;  4E6K G;  3FK6 A;  1AWC A;  2ECB A;  3I59 B;  2V7F A;  3G2B A;  5DS9 A;  3SDG A;  1QZE A;  1RUN A;  4RGX A;  3CUQ B;  1U9N A;  1BA5 A;  4AD9 A;  1MJA A;  1QA6 A;  1T95 A;  3I54 A;  3KZZ A;  4WK8 F;  1JKP C;  3CLQ A;  3BWG A;  1E0E A;  2HYJ A;  2X4H A;  2E60 A;  3ZQC A;  4UXN A;  1SAU A;  1T56 A;  3FHZ A;  3PUF A;  2VON A;  4RM3 A;  2CW8 A;  2ZJP F;  1NG6 A;  1T33 A;  1T98 A;  3BG7 A;  4MTD A;  2OAZ A;  4XRF A;  4FIS A;  1XGN A;  2FOK A;  1T38 A;  4GCV A;  3HOU J;  5HDK A;  5B3S H;  4IZZ A;  1HW2 A;  1MNM C;  2QYO A;  3FHN A;  1SMY F;  4WXC A;  3M8E A;  5M3M J;  3WHC A;  1L3L A;  3LMM A;  3JRD A;  2V1D A;  4I98 B;  3CES A;  2CG4 A;  2JT1 A;  1XSD A;  2M8E A;  1HSJ A;  4HEA 2;  1DU6 A;  3OYB A;  1U8B A;  1YX3 A;  5EGO A;  2OQR A;  1YJ9 I;  5LBQ A;  1HLV A;  2ESN A;  4CA0 A;  3VWB A;  3GBG A;  2LH9 A;  3IKT A;  2Y75 A;  2A07 F;  1O3Q A;  2DOA A;  2H09 A;  4D9J A;  3EPZ A;  5J1U A;  2K9L A;  2IRF G;  1WJE A;  4X1E A;  2JUG A;  4HF0 A;  3R4K A;  1UCR A;  1LEB A;  3K70 C;  5EG0 B;  4A0X A;  1BOB A;  4F52 A;  4P9U A;  3OYK A;  4I01 A;  2IS6 A;  3G1M A;  4D1Q A;  3GLX A;  4HLX A;  4A3J J;  1JKO C;  4A5M A;  2NVU B;  3GYH X;  3MVP A;  3OMY A;  2VJJ A;  4N0B A;  2L9S A;  2W85 A;  3C2B A;  4BUP A;  1FYK A;  1TTY A;  2ECC A;  4B3A A;  3P9I A;  4EJU A;  5LGT A;  1WH5 A;  3FXL A;  5D8K B;  1FWZ A;  2KIU A;  3WU1 B;  1Q1H A;  4BE2 A;  1YOV B;  1Z3Y A;  4G8X A;  5D8L B;  2BY2 A;  4AIK A;  4BBS J;  1RI7 A;  5EYR A;  2EZI A;  2WB1 N;  1W36 D;  1J7K A;  1MMD A;  2FE3 A;  4BL0 B;  2VPL A;  1OR7 A;  4XLF A;  5EZH A;  1Y39 A;  2BVL A;  1T39 A;  1ZG5 A;  2GXG A;  2DFE A;  1FBQ A;  3RYR A;  1WFX A;  2A68 F;  5DDG A;  1J2X A;  1OCR H;  1XPX A;  1RR8 C;  2FBK A;  3I55 I;  2A5W A;  1WJD A;  2HU9 A;  3HKZ N;  5F27 A;  1JI8 A;  3OY9 A;  2L0K A;  3KYC B;  3ZQ7 A;  1DGR M;  1RUO A;  1CGP A;  1FTT A;  1WGX A;  3PIO F;  4HDU A;  2P6T A;  3OYF A;  3VOD A;  4BXU A;  3GTQ J;  3IH2 A;  2B0L A;  4YII A;  5F6F A;  3MZY A;  2STW A;  2X51 A;  4L9V A;  1LFU P;  1BI2 A;  3ABT A;  2CU7 A;  2IVM A;  2LR8 A;  2GZW A;  3TO9 A;  2BGC A;  5D5V B;  3F8C A;  5HOD A;  3N05 A;  1S7A A;  2DTZ A;  4KIB A;  2EFP A;  1F5T A;  3BOQ A;  3CTA A;  1GV2 A;  5D6F A;  4IHS A;  1X3U A;  2V26 A;  5EJC A;  2M0C A;  1LPQ A;  4M9X A;  3PSI A;  2W82 A;  3T0Y A;  2E5Z A;  1UFM A;  2VL8 A;  2GLO A;  3IH4 A;  4P55 A;  3CCU I;  3ZQQ A;  1OLT A;  5IOZ A;  1VTN C;  3VSL A;  2MC4 A;  3I58 A;  3ONQ A;  4XM3 A;  1VQO I;  4M9Z A;  4BYY A;  4RBO A;  3AG2 H;  2VJ4 A;  5J47 A;  3D5L A;  3RPQ A;  3R0J A;  4ENN A;  3I4M J;  4UVB A;  2UWM A;  2EPF A;  3OIO A;  2NNN A;  4RGU A;  3T8R A;  3CCQ I;  3DTK A;  4HX8 A;  1BR4 A;  2XVC A;  1GDT A;  3A4C A;  2CWE A;  5FRO A;  4B09 A;  1IC8 A;  5CVI A;  4C2U A;  2K4B A;  3WE3 A;  3ABM H;  4LD5 A;  3ZN1 A;  3ELK A;  4R8H A;  1ETW A;  3IKV A;  2OF7 A;  3REO A;  2DBB A;  4PSW A;  4HX4 A;  1O7F A;  1B1B A;  4KMU X;  2LDU A;  2ZCW A;  4PJN A;  2JWT A;  1SMT A;  2M8G X;  5AIQ A;  3C18 A;  3DXJ F;  5D4S A;  3JTH A;  1GUU A;  3GF2 A;  1X3Z B;  4FTH A;  2PMZ A;  2HI3 A;  4HF1 A;  1K6O A;  4HSR A;  2IGM A;  1F36 A;  4KIF A;  1MBJ A;  3BCB A;  5HS7 A;  3OYC A;  2JQ7 A;  1TNS A;  4G94 A;  4GGG A;  3L2V A;  2HQN A;  5DCF A;  4HRI A;  3H3V K;  3JTG A;  5D6E A;  2Y31 A;  2QSH X;  4AWX B;  1ZEL A;  3ZP5 A;  3IWZ A;  5K5Q A;  3CJR B;  3SXY A;  2BZT A;  3PO2 J;  3VPR A;  4KFC A;  3CCJ I;  4L18 B;  3WE2 A;  3OV8 A;  1TWA J;  2DJN A;  2JPC A;  3CCL I;  5GP9 A;  3LST A;  1DQU A;  3FWE A;  1SAX A;  4CDG A;  1KYZ A;  5FLV A;  5FFX A;  1H89 C;  2W00 A;  4UB6 C;  1SD7 A;  2Z33 A;  2WA0 A;  2BY0 A;  2HNH A;  1U3E M;  2LYC A;  4ETS A;  4WX9 A;  5IPA A;  3SEQ A;  1MBG A;  2R7V A;  1MJB A;  4HLY A;  1Q1V A;  4A3M J;  3F6O A;  3T1B A;  4DZP A;  2HVQ A;  4L9T A;  4AID A;  2OU2 A;  3K70 D;  3QP5 A;  1FY7 A;  2Y48 A;  4B48 A;  1DU0 A;  3LOC A;  3OIQ A;  3VYR B;  1FYM A;  4ESJ A;  1SD5 A;  2PLY A;  1J5Y A;  1T8I A;  3S14 J;  5JFR A;  2L54 A;  4O3M A;  4U0V A;  3HZJ A;  2DXI A;  3Q9S A;  1TWH J;  3W3C A;  4AM3 A;  2KDO A;  1R5G A;  4IOC F;  3ZRG A;  2Z9O A;  1OIS A;  1UG0 A;  2R7O A;  2JA7 J;  2X0L A;  3F23 A;  2HDD A;  1G8X A;  1JJ8 C;  1D5V A;  4XOT A;  2R7F A;  1YW8 A;  1ZR2 A;  2VKD A;  1QGP A;  2ESH A;  2JRM A;  2LBF B;  1YIT I;  4FX0 A;  2LLK A;  3A01 A;  2M9H A;  2LF7 A;  4KIT B;  3SZG A;  3VSK A;  2GWR A;  4ZDL A;  1JGG A;  2R5Y B;  1WJF A;  2DDB A;  3PQK A;  3TW6 A;  3GXO A;  2V9P A;  3MCZ A;  1QU3 A;  4I09 A;  4PK4 A;  2R92 J;  1I6X A;  2FD5 A;  4A5N A;  2BY3 A;  1TQM A;  2G9W A;  4XLE A;  1Y1W J;  3OS2 A;  2M4K A;  4F91 B;  2KZV A;  4IPA A;  3G6E I;  1HQC A;  4ITV A;  3BZ6 A;  1UJ8 A;  1KGS A;  4V2G A;  4BQN A;  2RVC A;  2W4S A;  2CQX A;  2MLK A;  1Z6R A;  3HSF A;  2DK8 A;  3J7Z I;  4P96 A;  2NRA C;  3HUG A;  1E17 A;  1ZG3 A;  2JPB A;  2KHM A;  4KIG A;  4A0Z A;  1WJB A;  3AKZ A;  1O3S A;  2WAF A;  1PUF B;  1P4A A;  4RMN A;  2IEK A;  2I5U A;  4B3X A;  1R5H A;  2GOM A;  4E7L A;  3WU0 A;  2JA2 A;  4LK0 F;  5H20 A;  4G7H F;  1XTA A;  2HZT A;  3QP6 A;  5C4X J;  3QYF A;  3D5R C;  3Q3S A;  4S05 A;  3H5A A;  4BHC A;  4C3I J;  4CYC B;  1VQ4 I;  4M3D A;  2Z16 A;  1WRJ A;  2B7E A;  3BTI A;  5B5E C;  1PDN C;  1D1A A;  2V9V A;  3ZN0 A;  5FGM A;  2E5N A;  4ANJ A;  1UB9 A;  3CC4 I;  2CV0 A;  4M3F A;  4XON A;  5ILS A;  2LKX A;  4KN7 X;  5IP6 A;  2FSW A;  1STZ A;  1HXD A;  1IJW C;  3H9G A;  4OIP F;  1ETX A;  1YLF A;  2Y0M A;  3EUH C;  3K10 A;  2A3S A;  3DBR B;  1R22 A;  5ICC A;  3I5U A;  1XC5 A;  3ASO H;  3VYU B;  4RGR A;  3BR1 A;  2BBY A;  3S15 J;  3HM5 A;  4RB1 A;  3LWF A;  4DJA A;  5F1R A;  4HDV A;  1BL0 A;  1YW9 A;  4II3 A;  5LGN A;  5L3F A;  2OZU A;  4J00 A;  3PO3 J;  1YFH A;  4JX6 A;  1FEX A;  3H3Z A;  5FJ8 J;  2JVH A;  3CUQ A;  5F08 A;  1UST A;  2DTR A;  2YPR A;  2VQG A;  3QYE A;  4A6E A;  1PJR A;  3TED A;  2CJJ A;  2X6W A;  2ZME C;  1I5Z A;  4DYQ A;  3PIP F;  1IRZ A;  2H8W A;  3BZK A;  5AIP A;  3NWT A;  2EZL A;  1BC8 C;  1MD0 A;  4NDL A;  2ID6 A;  2O3F A;  2LP0 A;  2GOX B;  2ZJR F;  2YS9 A;  1WZ2 A;  2EZK A;  4JYK A;  3H9J A;  4W97 A;  1OQY A;  1W4M A;  1P4X A;  2PJR A;  1GT0 C;  1OCP A;  2E7W A;  2IS1 A;  3BQZ A;  3LA3 A;  3RZD J;  2DN0 A;  2VBY A;  3E6B A;  5J3L A;  3KPH A;  4GDF A;  2P4W A;  2FXA A;  4D5C A;  4NC7 A;  4RLQ A;  1PP7 U;  3EUH A;  1CQT A;  4KYW A;  1S72 I;  1N77 A;  2PX9 A;  2CH0 A;  1FSE A;  3SQN A;  2CQN A;  4XLH A;  3B6C A;  6PAX A;  4ZYD A;  4IHW A;  2IBD A;  1P6R A;  2WAQ N;  2M30 A;  3BTJ A;  3CDI A;  5HS9 A;  1I3Q J;  4MHG A;  2KT0 A;  4BXF A;  5D5W B;  3S2H J;  3JSO A;  3D5S C;  5CQG A;  4J01 A;  1JHH A;  3K7A J;  2PN6 A;  2IA2 A;  3EQL F;  3CMM A;  1XDS A;  2QKL B;  4E4H A;  4EM2 A;  5BMZ A;  2MD5 A;  2OCC H;  3M8F A;  4M6V A;  3GTM J;  4NHJ A;  4U7B A;  1EH7 A;  5E3O A;  4PFO A;  5M5W J;  1YJW I;  4WF2 A;  2R7X A;  2HTJ A;  1EJ9 A;  3DU5 A;  3B73 A;  2IA0 A;  3H5R A;  2D1V A;  2ZB9 A;  4BAC A;  1FLI A;  3MKW B;  2M3A A;  4CSW A;  1LDD A;  3DKX A;  2XPU A;  3ECH A;  2ID3 A;  4RAZ A;  2CUZ A;  3IL2 A;  2IS2 A;  4NB5 A;  1FYL A;  4I99 C;  2LSO A;  1LDJ A;  4F92 B;  1ZTR A;  3OYN A;  1A5J A;  3OSG A;  4Y17 A;  3A1Y A;  3LSP A;  2VIX A;  3IP4 B;  4I76 A;  3PFI A;  4KNY A;  2X6Y A;  3GTO J;  1VF9 A;  4RS8 A;  5D4R A;  2VKH A;  4C2T A;  1D5Y A;  4A3D J;  2VLA A;  2YUS A;  3FBN B;  4XLA A;  4LGW A;  1B4A A;  2NOJ B;  1FP1 D;  3S8P A;  4GFB A;  3GCM A;  1Y1V J;  3OL3 A;  4RDU A;  3ZMZ A;  3LSR A;  3VYT B;  2E1C A;  3ZQH A;  1OFC X;  4E7J A;  1TWC J;  4ENM A;  2MYS A;  3HHH A;  3ML6 A;  1FJL A;  3SDB A;  2LMD A;  4N4O B;  1VQN I;  1UZC A;  2RKH A;  3OS0 A;  3ZXS A;  4MEX F;  5HLG A;  3HC7 A;  1WJ5 A;  2E2I J;  1LKX A;  1D8K A;  2XB0 X;  1V3F A;  2K5C A;  3AL0 B;  1WJC A;  3H1C A;  3K4J A;  3N97 A;  2HPI A;  1FT9 A;  1YG2 A;  2IGN A;  4IX7 A;  3F3X A;  4A12 A;  3RPU A;  4LB5 A;  1RPW A;  3P9C A;  2YU9 J;  1VQM I;  2KRF A;  2Q1Z B;  1R36 A;  3A02 A;  5CKT A;  1X1P A;  4M74 A;  3G73 A;  3OR2 C;  3OOU A;  3RI4 A;  3RKX A;  3GFM A;  4P1W A;  1JUP A;  3MKL A;  1HW5 A;  1A6I A;  2VOO A;  3UNG C;  3MAJ A;  1IN5 A;  2E2J J;  4S04 A;  2ICW G;  3LSJ A;  4XSX F;  4A3L J;  3CLO A;  1I3A A;  4I02 A;  3BRO A;  5ED4 A;  2QCO A;  5DV5 A;  2HOS A;  3ABU A;  1LQ1 A;  2XAG A;  1JKQ C;  4N9H A;  3V8L A;  4PDK A;  2JK3 A;  3ZMU A;  2VE8 A;  1U8R A;  3HTU A;  1HDD C;  2LD5 A;  2O8K A;  4XRS G;  4PJ0 C;  2L7K A;  2LRE A;  2JJ7 A;  4HA8 A;  2CFO A;  2WC2 A;  4H4K C;  4LIU A;  2VJI A;  3E97 A;  5B1A H;  3DBH B;  2A6H F;  4UUV A;  1WI3 A;  2P7V B;  1Y0U A;  3RKQ A;  2EIK H;  1POG A;  3VDX A;  1BN5 A;  2EZH A;  4FE4 A;  5FFZ A;  3CCV I;  1C0W A;  1VZ0 A;  4DOZ A;  1VQK I;  4Y3O A;  4B47 A;  3FIW A;  5LFA A;  2V1X A;  1UAA A;  2FRH A;  2RC4 A;  3GVA A;  5E8I A;  2AQE A;  1WH7 A;  2EIJ H;  1P92 A;  4B8X A;  4PGH A;  2L7F P;  4LOC A;  4BS9 A;  5H6R A;  2J5P A;  5J1Y A;  4AIJ A;  2VT3 A;  5KHD A;  4EAT A;  1G6N A;  1ZN2 A;  2ZFW A;  2IXS A;  1OYW A;  1R4N B;  2K85 A;  2VE9 A;  1K6Y A;  1LUJ B;  1P4W A;  4BDZ A;  1VQ5 I;  5IYD J;  3SFZ A;  3H36 A;  1WSU A;  2AHQ A;  3B02 A;  1NG7 A;  1X1B A;  2L9R A;  2XF5 A;  3FXO A;  5EGO B;  2NVQ J;  2Z3Y A;  5EF6 A;  1IDY A;  4B4C A;  1RZ4 A;  5FKO A;  3K2A A;  2Y0S A;  1IN6 A;  2CQ7 A;  3A0H C;  4IRH A;  1XMA A;  4XKV A;  3SJM A;  1KQ8 A;  3S3N A;  2BV6 A;  1D1C A;  3P9K A;  5F0F A;  3DKW A;  4HST A;  1OYY A;  1EV7 A;  1G3S A;  1ZRD A;  2GA1 A;  2ACJ A;  3F8F A;  2R4G A;  3ABL H;  2DDA A;  5HS8 A;  2Q8K A;  3V8J A;  1G3W A;  1IRX A;  2F48 A;  4FHT A;  4HNV A;  3PL8 A;  5C3E J;  5ICG A;  3L2Q A;  5HLT A;  4A3B J;  1ZG1 A;  2TRT A;  1ZRE A;  3HSE A;  1YIO A;  3GZN B;  4PJJ A;  1MBE A;  3FBI B;  3R0A A;  3CO7 C;  1D8J A;  3BTC A;  1I27 A;  2XKP A;  1HBX G;  2XAH A;  1LJ9 A;  1UMQ A;  3OYI A;  2KZG A;  1R1U A;  2QBY B;  4A69 C;  4AVP A;  2ZC2 A;  4E7I A;  5GPC A;  1ZLK A;  3BJ6 A;  2E1N A;  4XN0 A;  4Q47 A;  3AG1 H;  1S7E A;  2HZD A;  3AG4 H;  5IP9 J;  1YRN A;  3PJR A;  4F93 B;  4CCM A;  1BOA A;  1D3Y A;  2ZNZ A;  2EV5 A;  2CQQ A;  3HIF A;  1FIA A;  3SZP A;  1J0R A;  1JGS A;  4HQM A;  3Q0U A;  5TGT A;  4XID A;  2OA4 A;  1MGT A;  2AXT C;  3GW2 A;  2YU3 A;  2DMT A;  3FIS A;  5ILU A;  1TLH B;  2CMP A;  3M7G A;  4UUT A;  3FK7 A;  5D5U B;  5JI6 A;  2DA3 A;  2VT2 A;  4D7N A;  4XKW A;  3FXU A;  4M9S A;  2LY2 A;  3DWL E;  3GTG J;  2FF4 A;  4ENJ A;  4M6X A;  3LAP A;  3L9F A;  1BM9 A;  1E2X A;  3K1P A;  1ON2 A;  3BPX A;  2P8T A;  2W57 A;  5FD6 A;  2EB7 A;  2YSR A;  2IP2 A;  1VQ6 I;  3FXM A;  2LY1 A;  3RYP A;  2A61 A;  4BH9 A;  3C3W A;  1QVT A;  1KON A;  3WTS C;  1ZHF A;  2XF7 A;  4IO9 F;  1FTZ A;  3GWZ A;  5KK1 A;  3WTV C;  3GO5 A;  3WG9 A;  3D0S A;  2HWV A;  5L3D A;  1BIB A;  5JHU A;  3HPG A;  1OJL A;  4KJZ A;  3SYT A;  2VBX A;  2EK5 A;  5K5O A;  1NHA A;  3KZI C;  4A0Y A;  1SD6 A;  5E1Z B;  2FX0 A;  4IHY A;  3CDH A;  2A5Y B;  1KU3 A;  2CQK A;  3FMR A;  4NQW B;  1IDZ A;  2R5Z B;  5HOO A;  1X4O A;  4E7H A;  3K4L A;  3G4S I;  4G9Y A;  4KUM A;  1ETO A;  3U1D A;  4I0B A;  3LQR A;  1F9N A;  1SC7 A;  2Q2E B;  5K7H A;  1JUM A;  2QQ8 A;  1OR7 C;  3IH3 A;  3DF8 A;  1B72 A;  3DLL F;  3HOV J;  3FKI J;  3KIO A;  3J80 Z;  3VYS B;  4XRS A;  2ZXI A;  5M3F J;  4I6Z A;  1XMK A;  3BR2 A;  5E79 C;  1SFX A;  1W5C C;  2NYX A;  2O61 A;  5E20 A;  5FLX Z;  2IAI A;  4Z2Y A;  3WTZ A;  4EGZ A;  2D2W A;  2E34 A; 
#chains in the Genus database with same CATH homology
 1JJ8 C;  3HOW J;  1ETQ A;  3A03 A;  1U9O A;  4M3G A;  1B72 B;  1ZR2 A;  1HF0 A;  4BXX J;  5IYB J;  3A01 A;  1RET A;  2LLK A;  2M9H A;  2NS7 A;  3SFI A;  5GPA A;  4QTR A;  1JGG A;  2K9S A;  2R5Y B;  3BT9 A;  5IP7 J;  3TW6 A;  3S1Q J;  4M3B A;  5IYC J;  3ZQF A;  2R92 J;  2FD5 A;  1P7J A;  1Y1W J;  4A3I J;  2N8G A;  2B63 J;  2DA4 A;  3B6A A;  3NAR A;  4V2G A;  3LSG A;  2COB A;  2CQX A;  1W0U A;  4XIC A;  3CDL A;  5FKK A;  4DW6 A;  3QQA A;  1B8I B;  2VPR A;  1ZQ3 P;  1PUF B;  3HOX J;  2AO9 A;  2IEK A;  1GVD A;  2XB5 A;  2HOT A;  1IUF A;  2Y0S N;  2VKE A;  3S2D J;  4UUS B;  3BR5 A;  5C4X J;  2R93 J;  5DTD A;  3Q3S A;  4C3I J;  4CYC B;  4IHX A;  3QPL A;  5F04 A;  4EEF G;  2P81 A;  1BJZ A;  4M3D A;  2R5Z A;  5IOY A;  1ETY A;  1B8I A;  3BTI A;  5C4J J;  1EF4 A;  3S1N J;  1I6H J;  3BG3 A;  1JKR C;  4M3F A;  2LKX A;  4BY1 J;  5IP6 A;  2K40 A;  1JJ6 C;  3JRG A;  2LY9 A;  1IJW C;  4DYC A;  1LFB A;  3ZQG A;  1ETX A;  1NTC A;  1WCM J;  5M5X J;  4XRM A;  5JLW A;  5FLM J;  2KDZ A;  1XC5 A;  2E1O A;  2TCT A;  1Z0X A;  1MH3 A;  3ZQI A;  3BR1 A;  2DMP A;  3HGY A;  3HM5 A;  3S15 J;  3M3Y J;  1BL0 A;  1JTY A;  1VFC A;  3PO3 J;  4JX6 A;  1FEX A;  5FJ8 J;  1MBK A;  5F08 A;  3JRI A;  1MSF C;  2JA6 J;  4AC0 A;  3TED A;  1GV5 A;  2CJJ A;  2HXI A;  4DYQ A;  1LE8 A;  1RR7 A;  1IRZ A;  5BNG A;  3JRF A;  3TP3 A;  2GM4 A;  2DA6 A;  2EZL A;  2H1K A;  4NDL A;  5F0C A;  2ID6 A;  4AUX A;  2LP0 A;  2XGE A;  1YRN B;  4IEJ A;  2YS9 A;  3BQY A;  4C2M J;  2EZK A;  2DMN A;  2K9Q A;  1ORK A;  1SAN A;  2NS8 A;  4JYK A;  2EQR A;  3QPS A;  1APL C;  4W97 A;  1GT0 C;  1OCP A;  3RQI A;  2JA5 J;  3BQZ A;  4AYB N;  3RZD J;  3S1R J;  1ZKG A;  2DN0 A;  1RES A;  5J3L A;  1OCT C;  1PUF A;  5F1J A;  2OPT A;  4D5C A;  1QRY A;  2M34 A;  2NVX J;  1XG1 A;  2MG4 A;  2X9D A;  1CQT A;  3CCY A;  2WV1 A;  4A93 J;  4S0H B;  2CUF A;  3B6C A;  2FQ4 A;  3HEF A;  3O8H A;  1VI0 A;  3S17 J;  4M3E A;  2R5Y A;  1Z77 A;  4IHW A;  2IBD A;  2R0Q C;  2WAQ N;  3BTJ A;  1UG2 A;  3S2H J;  1I3Q J;  2KT0 A;  2W48 A;  1UHS A;  3L1P A;  1JUS A;  1IV6 A;  3LNQ A;  3TW7 A;  3K7A J;  4FCY A;  3I4N J;  5EZG A;  4A3G J;  1RKW A;  4MO7 A;  1I50 J;  3BG9 A;  4M6V A;  3GTM J;  2XGD A;  4JX4 A;  5E3O A;  5E3M A;  5M5W J;  3BR3 A;  3WHB A;  4QIW N;  1SFO J;  2DMU A;  3HDD A;  9ANT A;  2NVY J;  3HOZ J;  4Y7N J;  2HOA A;  3M4O J;  2ZB9 A;  3JRH A;  4CYC A;  2X48 A;  2EH3 A;  3JRB A;  1HDP A;  5FKM A;  2XPU A;  2ID3 A;  4G12 A;  1X2M A;  1ZTR A;  3JRA A;  1A5J A;  3OSG A;  3GTJ J;  3S1M J;  1ETV A;  4C3H J;  4ABZ A;  3LSP A;  4I76 A;  1X58 A;  3GTO J;  1VF9 A;  4D5F A;  2Y9Y A;  1K83 J;  1ENH A;  2NOG A;  3Q0W A;  1QVU A;  3FK6 A;  1D5Y A;  4A3D J;  2YUS A;  2ECB A;  4J19 A;  1ITY A;  1BW6 A;  5DS9 A;  1X2N A;  3SDG A;  4GFB A;  1Y1V J;  4RDU A;  1H8A C;  1NK2 P;  1U9N A;  1BA5 A;  3LSR A;  1JKP C;  5E3L A;  3ZQH A;  3G1L A;  1OFC X;  1TWC J;  2HYJ A;  2O7O A;  1HCR A;  3G1O A;  1FJL A;  3ZQC A;  1T56 A;  3HB9 A;  1T33 A;  4JP0 A;  3OSF A;  2E2I J;  4FIS A;  3HOU J;  2XB0 X;  4C3J J;  1MNM C;  2M2E A;  3CQZ J;  1JT0 A;  2G0E A;  3S16 J;  1RPW A;  5E3N A;  5M3M J;  2YU9 J;  3WHC A;  1WPK A;  3JRD A;  1TWG J;  3A02 A;  2QF7 A;  1VND A;  4B1R A;  2LVS A;  3OOU A;  1AKH A;  1AHD P;  2HXO A;  2CUE A;  2ELK A;  3IV5 A;  1DU6 A;  2MSY A;  1U8B A;  3D1N I;  1JUP A;  5EGO A;  4A3C J;  2O9L A;  5C44 J;  3MKL A;  1A6I A;  1HLV A;  2E2J J;  3GBG A;  4JX5 A;  2FJ1 A;  3LSJ A;  4A3L J;  2D5V A;  5J1U A;  2QCO A;  2HOS A;  4X1E A;  4UUS A;  3JR9 A;  2VUM J;  5EEA A;  1XS9 A;  1JKQ C;  2ME0 A;  2JK3 A;  2DA5 A;  4L5E A;  1FIP A;  2DA2 A;  5EG0 B;  1HDD C;  2LD5 A;  4IHV A;  2O8K A;  3G1M A;  4A3J J;  4XRS G;  1JKO C;  3RZO J;  3DCF A;  2JJ7 A;  3MVP A;  1U78 A;  2L7M P;  3C2B A;  4B3A A;  2ECC A;  2K9N A;  2XSD C;  3CMY A;  1WH5 A;  1WI3 A;  2E2H J;  3RKQ A;  1POG A;  2EZH A;  4FE4 A;  4BBS J;  1H88 C;  2R7Z J;  4MLO A;  5EYR A;  2EZI A;  2WB1 N;  3FIW A;  4BY7 J;  1JT6 A;  1WH7 A;  5EZH A;  3H0G J;  2L7F P;  4LOC A;  5J1Y A;  3TP0 A;  2E19 A;  3BG5 A;  3DEW A;  3HKZ N;  4W1U A;  3PM1 A;  5F27 A;  5IYD J;  2L0K A;  2AHQ A;  1RKT A;  5F0H A;  2HQ5 A;  2L9R A;  1O4X A;  1LE8 B;  5EGO B;  2NVQ J;  2EBI A;  4Y52 J;  1ZGW A;  1WGX A;  2LTP A;  5EF6 A;  1FTT A;  1IDY A;  4B4C A;  5FKO A;  3K2A A;  3GTQ J;  3IH2 A;  2Y30 A;  5FKN A;  3SJM A;  1W0T A;  4V2F A;  5F0F A;  4A3E J;  2PMZ N;  1LFU P;  3BR6 A;  2CU7 A;  2LR8 A;  1G2H A;  1ZK8 A;  2XPW A;  5HOD A;  2DTZ A;  5JLX A;  3HBL A;  1GV2 A;  5J1R A;  3ZOB A;  2L7Z A;  2M0C A;  1ETK A;  2MGQ A;  4HNV A;  3GTK J;  5C3E J;  2GLO A;  3IH4 A;  3W6V A;  4A3B J;  2TRT A;  5IOZ A;  1MBE A;  2XPV A;  3BTC A;  2DMQ A;  1UMQ A;  4RBO A;  4A69 C;  3I4M J;  3OIO A;  5GPC A;  1F43 A;  5EG0 A;  2DA7 A;  1GDT A;  2NVT J;  4MFD A;  4FE7 A;  4A3K J;  1IC8 A;  1IGN A;  1S7E A;  2ME6 A;  5IP9 J;  1YRN A;  2JA8 J;  2RAE A;  2DA1 A;  1ETW A;  2CQQ A;  1BW5 A;  2OF7 A;  1FIA A;  3Q0U A;  4X6A J;  4XID A;  1AKH B;  2JWT A;  2M8G X;  1QPI A;  2H8R A;  2DMT A;  3FIS A;  3BTL A;  3MN2 A;  1GUU A;  4UUT A;  2VKV A;  3FK7 A;  4FTH A;  2HI3 A;  1F36 A;  2Y2Z A;  2DA3 A;  3O8G A;  4D7N A;  1MBJ A;  2LK2 A;  2GBY A;  3GTG J;  2MW8 A;  1MH4 A;  2CRG A;  3H3V K;  4MFE A;  4MIM A;  2XRL A;  3F0C A;  2Y31 A;  3Q0V A;  3NAU A;  2JN6 A;  2VI6 A;  4BBR J;  4A3F J;  3PO2 J;  4DZJ A;  1QVT A;  3VPR A;  2XGC A;  1HOM A;  3HGG A;  1K61 A;  1TWA J;  1FTZ A;  2DJN A;  3JRC A;  1MSE C;  5GP9 A;  2X6O A;  5FKL A;  1JTX A;  4DYR A;  1OJL A;  5FLV A;  1H89 C;  1TWF J;  3ZQL A;  4XK4 A;  2FX0 A;  4IHY A;  3BR0 A;  5M5Y J;  5IPA A;  3E7L A;  4QSH A;  1E3O C;  3GTP J;  1R9T J;  2R5Z B;  1IDZ A;  1MBG A;  2Y9Z A;  1Q1V A;  5EDN A;  4A3M J;  1ETO A;  1TC3 C;  2LFB A;  1AU7 A;  5K7Z A;  2JMW A;  4DZP A;  5K7F A;  1NK3 P;  1MBF A;  4D7M A;  5K7H A;  1JUM A;  1MBH A;  3IH3 A;  1P7I A;  3UKG A;  3LOC A;  1DU0 A;  1B72 A;  2I10 A;  3HOV J;  3FKI J;  3A01 B;  3S14 J;  3HOY J;  4XRS A;  4BKX A;  5M3F J;  4I6Z A;  1IG7 A;  3BR2 A;  1TWH J;  1ZR4 A;  2IAI A;  3JRE A;  2JA7 J;  3GTL J;  2HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...