2B63J

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2b63J00
1B72B 1APLC 2X9DA 3FKIJ 2HI3A 2DA5A 2OPTA 3CCYA 2Y30A 2XGEA 1Y1VJ 3FK6A 2DN0A 1K61A 1U78A 3NAUA 1ZTRA 1Z77A 1WGXA 1UG2A 2DA3A 1GT0C 2DMPA 1JKRC 2IAIA 3Q0WA 3F0CA 3WHBA 3TEDA 4A3CJ 2DA6A 4IHWA 3S1QJ 4FE4A 2FD5A 1I50J 1HF0A 1FIAA 1JKQC 3A03A 3UKGA 4BBSJ 3O8HA 4DYRA 3B6CA 3JR9A 1IDZA 3HOWJ 2LKXA 3OIOA 4AUXA 5J1UA 3L1PA 3S1NJ 1RETA 2ID6A 5GP9A 3LSGA 2CJJA 2GM4A 1ZKGA 1UHSA 1CQTA 3QQAA 3RQIA 1MBGA 1WH5A 1OCPA 3BG9A 4AC0A 2EQRA 1VNDA 3PO3J 2K9SA 1RPWA 1WPKA 3BR3A 3MKLA 1TWFJ 3ZQFA 1ETVA 2Y9YA 1DU0A 1BA5A 1U9OA 2LK2A 3HBLA 5JLXA 5M5YJ 1MBKA 2R5ZA 1MBFA 1OJLA 3JRCA 4IHYA 3HOXJ 1HLVA 3PO2J 5GPCA 2LP0A 4NDLA 4IHVA 5IP6A 4A3BJ 2XPUA 4UUTA 3LSJA 3HM5A 3I4MJ 2VPRA 2W48A 1Z0XA 4XRSA 3IH3A 4Y52J 3BTIA 1YRNB 2MGQA 2CUFA 5IOZA 3S2HJ 1IDYA 3A02A 2R5YA 1VFCA 1XS9A 2IEKA 2XGDA 4D5CA 3FISA 2FX0A 3BTJA 1WH7A 2HOAA 4FE7A 4FCYA 2H8RA 1ZR2A 2VUMJ 4M3FA 2ECBA 2CUEA 2XB0X 2LR8A 3H3VK 4W97A 2JJ7A 1MBHA 2D5VA 2DA1A 2JK3A 4C2MJ 2YUSA 2R0QC 2M9HA 4A3KJ 3S15J 4X6AJ 1H88C 5E3LA 1A6IA 4J19A 3GTLJ 2E2HJ 1BJZA 1H89C 5BNGA 3RZOJ 4L5EA 3G1MA 5F0CA 3HGYA 5EG0B 3BR2A 1RKWA 4QSHA 3SJMA 3BR5A 2PMZN 5EF6A 1OCTC 3A01B 2EZIA 2JMWA 1JTXA 4AYBN 4A3DJ 3ZQGA 4D7MA 4QTRA 1ETYA 3MN2A 4BY1J 1T33A 3IH4A 5E3OA 1EF4A 3K7AJ 3W6VA 2K40A 1ETOA 2EZLA 3TP3A 2AHQA 3HB9A 5F0HA 1ZGWA 1LFUP 2Y0SN 2HOTA 2N8GA 4RDUA 2M8GX 1PUFB 1IRZA 2HXOA 4BY7J 5E3MA 1MH4A 2ME6A 2NS8A 2DA7A 5IP7J 3ZQHA 2LY9A 2WAQN 2LD5A 1GV5A 3BG3A 4DYCA 3HDDA 3QPLA 1GDTA 1FIPA 2IBDA 4C3IJ 4S0HB 4DZPA 2EZHA 4XRSG 2Y2ZA 4JX4A 5K7ZA 1TWGJ 3LSPA 3ZOBA 3CMYA 4JX5A 2LFBA 1F36A 5EGOA 2XPVA 1JJ6C 3GTGJ 3GTKJ 3BTLA 1G2HA 3LOCA 3JRAA 3ZQCA 2JA5J 2JWTA 1HDPA 2DA2A 2HQ5A 3JRBA 5FLVA 1B8IA 2ME0A 1ETKA 5FJ8J 2L9RA 1WI3A 4HNVA 1NK2P 2P81A 1JT0A 1W0TA 2LLKA 1TWHJ 1F43A 5EZGA 5IYBJ 2XGCA 3MVPA 5FKLA 4FISA 5J1RA 4BBRJ 3BR6A 1TWAJ 3QPSA 3G1LA 2WB1N 4Y7NJ 1BW5A 2G0EA 3FIWA 1IUFA 2H1KA 4CYCB 2R93J 4B1RA 1O4XA 3IH2A 1IV6A 5IPAA 5M5WJ 1LE8A 1JUPA 1ENHA 3C2BA 1QRYA 2FJ1A 4V2GA 4IEJA 3CDLA 1ZK8A 3GTPJ 2O8KA 1HOMA 1RKTA 4A3GJ 1LFBA 5F27A 3JRIA 5C3EJ 2XSDC 4A3LJ 2YS9A 2QCOA 1FEXA 1TWCJ 2R5ZB 2I10A 2TCTA 4C3JJ 1ETWA 2NVQJ 1BL0A 3ZQIA 1Q1VA 2FQ4A 1HDDC 5M3MJ 3CQZJ 5HODA 2JN6A 3JRFA 4B4CA 1MSFC 2R7ZJ 4MIMA 2L0KA 1A5JA 1I3QJ 2NOGA 4BXXJ 1ETXA 5IYCJ 3O8GA 4MFEA 2NS7A 4M3DA 1OFCX 1VF9A 2X6OA 3GTMJ 9ANTA 4A3EJ 4UUSB 4JYKA 2HDDA 5K7FA 3BQYA 5C4XJ 4DYQA 5E3NA 3S17J 2ECCA 2L7ZA 2ELKA 3DCFA 2VI6A 5EG0A 1FTZA 3HOUJ 2EH3A 3I4NJ 1GVDA 5J1YA 1VI0A 2X48A 3FK7A 1MH3A 1POGA 3JREA 2O9LA 1X2NA 2XB5A 3DEWA 1RR7A 2WV1A 4DZJA 3RKQA 1FTTA 3SDGA 3VPRA 1U9NA 1JUMA 4JP0A 1R9TJ 1ORKA 2XPWA 2L7FP 1MBJA 1TC3C 1AKHB 1JKPC 1XG1A 2NVXJ 3S1MJ 1ITYA 3Q3SA 4MFDA 5IP9J 5M3FJ 1FJLA 2MG4A 1NTCA 1B72A 2E2JJ 2E1OA 3K2AA 4V2FA 4LOCA 2DTZA 3ZQLA 4A69C 1H8AC 2MSYA 4DW6A 2Y9ZA 5C4JJ 1BW6A 5EDNA 5FKKA 2DMTA 3HOVJ 3NARA 3PM1A 3Q0UA 2CRGA 2OF7A 4XK4A 3BG5A 3HOYJ 2DMUA 2M2EA 3BR1A 3H0GJ 1JUSA 1T56A 1QVTA 1Y1WJ 2YU9J 3OSFA 4MO7A 4C3HJ 1MSEC 4B3AA 2COBA 2DA4A 2LTPA 4BKXA 2VKVA 2B63J 1P7IA 2K9QA 1AU7A 3B6AA 1ZR4A 3M4OJ 3G1OA 4XRMA 1GUUA 3GBGA 2CQQA 2RAEA 3S2DJ 3LSRA 5EGOB 5FKMA 4W1UA 4A3IJ 5M5XJ 3Q0VA 3BT9A 2KT0A 4CYCA 1JGGA 4A93J 4X1EA 1B8IB 1WCMJ 1E3OC 2ZB9A 3TW6A 4IHXA 1SANA 3LNQA 3HGGA 2L7MP 2LVSA 1QPIA 2R92J 2E19A 4GFBA 1IG7A 1QVUA 2MW8A 4A3MJ 4D5FA 5EZHA 1W0UA 1YRNA 1K83J 4JX6A 3D1NI 4EEFG 2TRTA 2JA8J 2Y31A 1DU6A 1LE8B 3TP0A 2JA7J 4RBOA 2K9NA 2AO9A 1HCRA 4I6ZA 1JJ8C 1ETQA 3HKZN 5DS9A 2O7OA 2M0CA 2GBYA 2KDZA 2DJNA 3BR0A 1XC5A 3GTJJ 5IYDJ 1IC8A 1GV2A 1SFOJ 4I76A 1ZQ3P 3GTOJ 2CU7A 1S7EA 3S16J 2GLOA 3WHCA 3BQZA 3HOZJ 4QIWN 5F1JA 3JRHA 2R5YB 1MNMC 4G12A 3IV5A 4UUSA 4FTHA 4A3JJ 2VKEA 5EEAA 4ABZA 2E2IJ 3GTQJ 1JKOC 1JTYA 4A3FJ 1JT6A 2NVYJ 2DMNA 3A01A 2CQXA 5GPAA 2EZKA 3OOUA 5C44J 2NVTJ 5FKNA 1P7JA 3RZDJ 1U8BA 3S14J 2DMQA 1IGNA 1I6HJ 3SFIA 5JLWA 5J3LA 1AHDP 1RESA 1X2MA 2ID3A 5FLMJ 3HEFA 2JA6J 3BTCA 5F04A 1D5YA 4M3EA 1AKHA 3JRGA 2M34A 3M3YJ 2HXIA 1IJWC 5FKOA 5EYRA 4M3GA 5K7HA 1PUFA 5F08A 3E7LA 2HYJA 4XIDA 2XRLA 4MLOA 1X58A 2QF7A 4M3BA 2HOSA 1UMQA 3JRDA 4M6VA 5F0FA 5IOYA 2EBIA 3S1RJ 1MBEA 4D7NA 1NK3P 3TW7A 4XICA 5DTDA 3OSGA
chains in the Genus database with same CATH superfamily
2R7OA 4IPAA 3MKWB 3DLAA 2R7RA 3FKIJ 4ESBA 2QQAA 1QZYA 3KP2A 4FQGA 4XKWA 2OPTA 1YIJI 2GZWA 3V8LA 2XGEA 3F6VA 4RGSA 1G59A 3WTTC 1K61A 3NAUA 5CVIA 1R71A 3C18A 5DUKA 3CCUI 3QRFF 3KP6A 2DA3A 5JHUA 2A68F 1IN8A 2JRTA 1J09A 3Q0WA 1JKRC 3LSTA 3TEDA 4KT5C 4DJAA 2E60A 1QA6A 4IHWA 2FD5A 2IA0A 3AG3H 4S05A 1MZBA 1HF0A 2PX9A 3IP4B 5DDGA 2LNBA 1KU3A 2EFWA 2LKXA 5J1UA 2NVUB 3CC4I 1P4XA 3SZGA 1W4MA 5GP9A 2HOEA 1FBUA 3FXUA 2EFPA 1MJAA 5E8IA 3QQAA 4HF0A 3U9GA 3ERED 1FBQA 1VQNI 1WH5A 1OCPA 5AIQA 2EQRA 1VNDA 3NEUA 2W84A 2K9SA 3COAC 2PMHA 1Y39A 1X1BA 3D0SA 3ZQFA 3E6BA 4UUVA 1IUYA 4M72A 3ZMTA 4F52A 4RB2C 2GA1A 1P4AA 5M5YJ 2LREA 1REPC 1MBFA 1S7AA 1XSXA 3WE3A 3DTKA 3CO7C 4K2EA 2QBYA 3WTWC 2XV4S 3HOXJ 1HLVA 3PO2J 2ZXJA 1QU3A 3BWGA 4ENNA 4UUTA 3HM5A 2HS5A 4PFPA 1D1AA 3H3ZA 4LK1F 5KCMA 3CCEI 5BMZA 2QGUA 2IW5A 4LFUA 1Z0XA 4Y52J 3IH3A 3C1DA 1G6NA 4RS8A 5ILUA 3RCOA 3FWEA 5DEQA 4E7JA 2CUFA 4A6EA 5HDGA 3L09A 2R5YA 2DFIA 5AONA 2QSHX 1XS9A 2ESHA 4YFNF 1HXDA 2FF4A 2VOPA 3FMQA 4YIRX 3Q5FA 3GZ5A 4OWRB 2P7VB 4G6DA 2QVOA 3HHHA 4Y15A 1R4MB 4F93B 1SEUA 2VE9A 3FISA 4GDFA 4FCYA 5LHGA 2OUMA 1DP3A 4AM3A 2IGOA 3MCZA 2HVRA 4WK8F 3GYHX 2D5VA 4XN3A 2R0QC 3S15J 4A3KJ 4Y17A 1H88C 3BY6A 1A6IA 4GYGA 3GTLJ 3CLOA 4HX8A 2E2HJ 2HEOA 1BJZA 1H89C 4HBLA 3RZOJ 4E7ZA 4L5EA 2OQGA 3G1MA 5L3BA 5F0CA 1ZLKA 2D45A 4BYYA 2BV6A 4RAYA 2RKHA 4XRFA 4XSXF 3L2WA 5EF6A 1Z9CA 3IUOA 4KA4A 2JMWA 1JTXA 1K78A 2H6CA 5DD4A 2A5YB 5DV5A 3ZQGA 3MD2A 3M1CA 4OAYA 4DOZA 3IH4A 5E3OA 1DDNA 2IS1A 1EF4A 3PSIA 4B47A 2W1OA 2BE5F 4CICA 3HB9A 5F0HA 3OYMA 1JXSA 5KAIC 3ZN1A 2XROA 3OYDA 2P5VA 2HYFA 4RDUA 2XKOA 2M8GX 1HKQA 2DU9A 2WV0A 4G6TB 2D2WA 3CCSI 1IRZA 3B02A 3V42A 3OYNA 2NS8A 2JUGA 2IRFG 1EH6A 1W7PB 4RB1A 5F6FA 1IW7F 2LBFB 1WJFA 2FMYA 3GZ6A 2M87A 3HKZA 3RYRA 1TQIA 3KP3A 2M1BA 4IQJA 1B59A 1FIPA 1Z7LA 4S0HB 2KRFA 1FSHA 2VBXA 1MMNA 2A05A 1MNEA 3DTIA 4NB5A 4PCQA 1XTAA 3S3MA 2MH9A 4IOAF 2VXZA 1W36D 1ZAOA 1RIOH 3JW4A 3E97A 4XOPA 2HR3A 4Y3OA 3ZMSA 1XGNA 1EV7A 3LOCA 5A2QZ 4KMFA 1ETKA 1CF7A 1S7OA 2ACJA 2BHZA 3WU2C 4HOBA 3LSMA 2LLKA 3CF5F 3KFWX 1HKSA 1SAXA 2O61A 3QYEA 2JZYA 3BG6A 4FX4A 3DXJF 5JHFA 1IRXA 2Q1ZB 1TWAJ 4Y7NJ 1BI1A 5L3EA 2X1CA 2E7XA 3IH2A 1Z7UA 3BJOA 5IPAA 2O03A 4J01A 1ENHA 4L9NA 4L9TA 1MJ9A 1IO2A 1HBXG 2KDOA 4N9IA 2FJ1A 2CMPA 5BQTA 5LEKA 4CYDA 3OOPA 3H9GA 4H4KC 3CDLA 1WJBA 3L2UA 2O8KA 4XONA 4F55A 2WADA 4BXFA 1UCRA 4BHPA 2XSDC 5E1WA 2YS9A 3C2HA 1YX5A 1FEXA 2VODA 2I10A 4PFOA 4CUGA 3DEUA 2TCTA 1OKRA 3S8PA 1D8JA 4ZYAA 2K9LA 2PG4A 1D0ZA 1P6RA 2PQ8A 2ZCWA 5J8CA 3VFZA 2QA4I 2STTA 1SVMA 1KQ0A 3K10A 4MIMA 2NOGA 2F4OB 1PYVA 5IYCJ 1PUEE 2H09A 4O3MA 3ZPLA 1BOBA 2HZTA 2X6OA 4M3DA 2R4GA 2X1EA 4RGUA 4JYKA 1VQ4I 2OBPA 2ZFUA 2FOWA 5C4XJ 3AG4H 4DYQA 1IRFA 1Y8RB 1T95A 3DCFA 4HSRA 4IZZA 4LB6B 1R1VA 3KYLA 2ZBKA 3I4NJ 4AD9A 2DK8A 2EFOA 2M45A 1R6RA 1A36A 5K1YA 4EGZA 2HDCA 3GVAA 3DU5A 1X2NA 2L2OA 2XB5A 3DEWA 4HSTA 3K70D 5BPDA 2RV8A 1JUMA 2K4JA 3ZQQA 1ORKA 3LSIA 3GEZA 1AKHB 1BBYA 1XG1A 2NVXJ 3S1MJ 4MFDA 4ZDOA 3VYRB 4PGHA 1FJLA 2V7FA 4XLCA 2CYYA 3RKWA 1NTCA 1SMTA 2OJED 1FYMA 3SEZA 3J80Z 1Y6IA 3GCMA 3K2AA 2LBFA 3FBNB 2PJRA 5BS6A 1H8AC 1I39A 4XN0A 4BHCA 4FHTA 3RI4A 4CXFA 5LRSA 3H5AA 5C4JJ 4HF1A 6PAXA 4KIFA 5FKKA 1YJWI 1C0WA 1USSA 1R7JA 1UELB 2J5OA 3HTUA 2AXTC 1W5TA 3NARA 4BDYA 4M9SA 3HOYJ 2CS3A 3TO6A 4LG0B 3N97A 2K7LA 4JOMA 5GAHJ 3H0GJ 3VEPA 4CH7A 1OLTA 4C3HJ 4QWQA 2BZTA 5FD6A 1RI7A 3VSLA 2DA4A 2B63J 5GAGJ 1R00A 1AU7A 1QGPA 4O6JA 2F4MB 1GUUA 3GBGA 4G9YA 1Q1HA 4BEHB 3CMAI 2I5UA 4EM1A 3M07A 5HOOA 1U3EM 4LGWA 1KYWA 3LWFA 1Z21A 2RAEA 3LSRA 4FETA 3TO7A 4W1UA 2M30A 2OV7A 5M5XJ 1D1CA 2DT6A 1OCCH 2L01A 1JGGA 3ELKA 3TOAA 1B8IB 1WCMJ 2CG4A 1YI2I 2L7MP 2XASA 1T38A 2P5KA 2LVSA 3CCJI 3QODA 2Q8KA 4JQFA 4GYIA 4ZTFA 1HSJA 3IWZA 4U88A 4A3MJ 1SD6A 4MTEA 4D5FA 3HSRA 4P9FA 4ZZDA 1YRNA 1K83J 3CCRI 1I6XA 2CQNA 3VYSB 2TRTA 1KU7A 3RQ4A 1DU6A 4GGGA 4I6ZA 1ETQA 3EQLF 3HKZN 4PJJA 3KPHA 2M0CA 1Y0UA 3KZIC 4ENMA 1HW1A 2VQHA 4A5MA 1ZARA 3BR0A 3HPHA 3CUOA 2HTJA 1TLHB 2BBYA 3GTJJ 5IYDJ 1D1BA 4BQOA 2HU9A 4I76A 3A0BC 2CU7A 1VQ5I 5ILSA 5JFRA 1S7EA 4MGRA 3RSNA 3BJAA 2UXXA 3U1DA 3BQZA 3FBIB 4NHJA 2VJ4A 2F5VA 2FSWA 3C2GA 4U0WA 4CO8A 4ENKA 1AOYA 3ZN0A 2BXYA 1N75A 4A3JJ 1XSDA 2E2IJ 3P7NA 5EJCA 1JKOC 3CMMA 2ZSIB 1WJDA 1KONA 1JTYA 2RNJA 1KA8A 4XL9A 3FM3A 2CQXA 1FOYA 2VJIA 2M4KA 3IWFA 2EB7A 5JR3A 3P9CA 3RZDJ 5LGTA 3G3ZA 4BE0A 3S14J 1I6HJ 2P6TA 3N4MA 5FLMJ 2JA6J 3DEEA 3BTCA 5BPIA 2X1DA 1EA3A 4WF2A 1AKHA 3SXYA 4E7IA 3GUDA 4YIIA 2DQRA 2VBZA 4PJMA 3EYIA 1MJBA 5K7HA 4XIDA 5D8KB 4KN4X 5B1AH 2XF5A 2GXAA 4IHTA 1RC9A 1UMQA 4M6VA 5FRNA 4BQQA 5F0FA 5IOYA 2XGXA 2K3FA 1Z91A 1G3SA 4U7BA 3ABUA 2L4AA 3BPVA 3K9TA 3RTRA 2Z5UA 5LHIA 2NAZA 2L4MA 5DTDA 2VQLA 3OSGA 4EJUA 3EUKL 1O3RA 4IO9F 4EV0A 4HYEA 2IT0A 4LG0A 1E2XA 4UVCA 1TW3A 3ZR8X 2DOEA 1J7KA 3PL8A 3FK6A 4EJVA 3G71I 1ZTRA 3EUAA 1WGXA 1UG2A 2RDPA 2FBHA 4U0VA 1GT0C 1AWCA 4HW0A 4FASD 2K86A 3OS2A 5DCMB 3WHBA 5D4RA 2LY1A 2DA6A 4A3CJ 1LQ1A 1J75A 1OPCA 4FE4A 4UV9A 2L9SA 3WTUC 5ICCA 3LQRA 3WU0A 5D8LB 4G94A 1JKQC 4EM0B 1IDZA 4AUXA 1QQIA 1QPMA 5E1XA 5DM6F 2E7WA 3D5LA 3G6EI 3F8CA 5FO5A 5KHDA 2CJJA 4AIHA 1OISA 1JI8A 5BOXA 1MBGA 1IV8A 3TL4X 2MYSA 4YIFA 2EA2A 3OYCA 4HNUA 1WPKA 2FBKA 3VDXA 4A5NA 5D4SA 2W57A 1X1AA 2DYRH 5GAEJ 2AXLA 1BA5A 3BROA 1IAWA 1U9OA 3HBLA 5J6XA 2KL4A 2O0YA 4M9ZA 3JRCA 2R5ZA 3DWLE 4HLYA 4CCNA 4IHYA 1SAUA 4BQAA 1LDJA 1WRJA 4P96A 2PFBA 2LP0A 3QP5A 5K5QA 5HLIA 1RRJA 4F7ZA 2VPRA 2YSRA 3SZTA 2DYSH 4S04A 3D5RC 4CCKA 4II2A 4LLNA 5JI6A 3V7CA 3Q9SA 4RGXA 1ZRDA 5LHHA 3M8FA 3L2RA 1HW5A 1Z3XA 5DM7F 5IOZA 3ECHA 3S2HJ 2D1VA 1IDYA 1WSUA 3WGGA 3FKJA 2A5WA 1XX5A 2A3SA 2XGDA 3O3KA 2EA4A 2FOKA 4D5CA 1SVOA 1WVRA 4FE7A 4UXNA 2ECBA 4DNCA 3F6OA 2DA1A 4XR6A 2YUSA 3OIPA 4I0BA 2HQRA 4EVIA 2HTSA 2OZ6A 2H1LA 1V5GA 3KYDB 3JAMK 4L0ZB 1BR1A 5BNGA 1J59A 2BW3B 2Q0OA 1ZG5A 2CUZA 5EG0B 4MQVA 2Y69H 2EFNA 2DDBA 2LMDA 5B5EC 1JE8A 2EZIA 4Q5SF 3J81K 4LLLA 4DBQA 1LVAA 1USTA 2M7AA 4AYBN 4EATA 4C2UA 3MN2A 3OR2C 4BY1J 1T33A 4BJTA 3DF8A 3K7AJ 2QM3A 3I54A 4B48A 1ZGJA 1ETOA 1X1DA 3SEQA 1V5FA 2Z16A 3GF2A 4I2OA 1LFUP 2PLYA 2NXNB 2HOTA 1F1ZA 2QQBA 2QEXI 1FMVA 1PUFB 2Q2EB 3K6GA 4PJLA 5E3MA 1MH4A 2ME6A 4PK4A 1YHQI 3SDBA 2DA7A 3ZQHA 1YFHA 5D5VB 4XQFA 2QQ8A 2NYXA 3K1NA 3BG3A 4HLXA 3F8FA 2P8TA 3TOBA 1JGSA 2IBDA 4C3IJ 1L0OC 2EZHA 4XRSG 5DCMA 1ON2A 2F5EA 2Y2ZA 3I9V2 1U2WA 2EPFA 1V3FA 1UZCA 2E71A 4JX5A 3HOTA 2LFBA 2MC3A 4HV5A 3IHUA 2DOFA 1JJ6C 3QU3A 4KITB 2IJLA 3BTLA 5ILVA 1I3AA 3G73A 3C3WA 3JRAA 3ZQCA 2JWTA 2JA5J 1HDPA 2DA2A 5FLVA 5LLQA 5FJ8J 3PSFA 3OYIA 2L9RA 1SFUA 4HNVA 1T98A 1NK2P 1DGWY 1ZLJA 1TWHJ 1F43A 2XGCA 3VSKA 5ICGA 3TQNA 2CH0A 1SC7A 2Z2SB 2A61A 3FMRA 3FIWA 1IUFA 3MKYB 2H1KA 3L2QA 4B1RA 1IV6A 3F8BA 5M5WJ 1LE8A 1VQKI 1JUPA 1X19A 3VWBA 1QRYA 4OIOF 2XUBA 4V2GA 2QYOA 3T8RA 5D5XB 2HGCA 4BQNA 2K02A 1RKTA 3ZCOA 5CPRB 4A3GJ 2DTRA 5F27A 1S72I 3I0TA 3WE2A 3QP6A 2KIMA 1OYYA 4ON0A 2QCOA 5IT9K 1WJCA 2OAZA 1SD4A 2AS5F 1BM9A 1QZEA 2W85A 2BOLA 3FHNA 4UVBA 1G4DA 2VONA 2LF7A 4C3JJ 2A6EF 1ETWA 2DAOA 2ZJRF 1BL0A 4MQ9F 2XAJA 3Q9VA 1WFXA 2FQ4A 1T8IA 1K4SA 4CCJA 2NRAC 2VN2A 1E3HA 1XMAA 3M8JA 2RC4A 3FDYA 3BDDA 5LRRA 3HPGA 4XLEA 5K5OA 4CDGA 2R3SA 3B73A 1HC8A 1A5JA 3GMEA 4BJ6C 5KAFC 3HXLA 2R7UA 3O8GA 4MFEA 2JA2A 3UR3C 4PGGA 3GTMJ 9ANTA 4A6DA 4UUSB 1ONVA 4PZJA 2HDDA 5K7FA 4IHSA 2MD5A 2MFZA 1IZ1A 3MEXA 3IRQA 4ZH4F 3S17J 2BW3A 1FOKA 4Q47A 4CA0A 2W7NA 2VI6A 2DFEA 5E17F 5EG0A 1FTZA 1H0MA 4UV8A 3KEOA 1K6YA 2KISA 3FK7A 1O3QA 1IXSB 1PJRA 3WODF 1Z6TA 1Z6RA 2WY7Q 4L9VA 1TZLA 1TQPA 3W2WA 3HSEA 2KRCA 4EJTA 2H94A 4LIVA 3S3NA 1RR7A 4DZJA 3RKQA 5CVRA 4HG2A 1U9NA 3GW2A 4BHBA 2HQNA 1R9TJ 3T0YA 2XPWA 1A04A 1UFMA 2ZFWA 3DKYA 1MBJA 1XD7A 3ERMA 1VTNC 2DK5A 1TC3C 1V5EA 3I55I 2Z33A 1JKPC 1XB4A 1V55H 2WB1A 2XRNA 3AAFA 2PEXA 4PUSA 1IXCA 1R4NB 4ZYDA 2Q2EA 2H8WA 3ABMH 2OZUA 4PSXA 2E2JJ 1QHHD 1STZA 4V2FA 3CTAA 2M5WA 3PFYA 4LOCA 3NQOA 2DCEA 3CD6I 3BCAA 2DBBA 5TGTA 2MSYA 2KZGA 3DPTA 3P9IA 1UJ8A 5EDNA 3HOVJ 3LFKA 3M1EA 1K4TA 3PM1A 3EPZA 5L3GA 1MMDA 2RNGA 1TQMA 3Q0UA 2BY3A 4KMUX 2CRGA 3U1KA 2ZC2A 2DMUA 3KEQA 4LITA 4M6YA 1GVJA 2G9WA 1IF1A 1OCOH 1T56A 3OSFA 1WI9A 4MO7A 1FX7A 1MSEC 3DFGA 3V7SA 2LTPA 1XSVA 2JSPA 4KISA 3KP5A 3ASOH 1F4KA 2KMUA 4HQEA 2K9QA 4KNYA 2X51A 3DBLB 2JPCA 3G1OA 3G2BA 4XRMA 2HQAA 3IC7A 3W2AA 1RR8C 3QU6A 4CZZA 2VT2A 1EJ9A 4ETSA 3KYCB 5EGOB 5TISC 1FYLA 2EIJH 4ASNA 1NHAA 3OYEA 1NG6A 4BH9A 4A3IJ 3Q0VA 2AQEA 2JQ7A 1HW2A 1L3LA 4D0PA 3GXOA 2CQKA 4IHXA 2O5RA 3HGGA 2VJ5A 4KYWA 2WBMA 2DQLA 5TRDA 2E19A 4XLFA 5FLXK 3CUQC 3WTVC 3G4SI 1ZRCA 2RQQA 2NS0A 2KQRA 2LYCA 2E5ZA 1X1PA 3L9FA 5LFAA 2ESNA 4A12A 2JA8J 2DLLA 2JA7J 3TP0A 1ERDA 3PNVA 4XLPF 4RBOA 1FT9A 1JJ8C 3WTXC 2O7OA 5L3DA 3DLLF 1R5ID 2GBYA 2D1HA 4B09A 3QPHA 2OD5A 4BL0B 1U8RA 1ON1A 5J40A 1SFOJ 3GTOJ 1NH3A 3S16J 1V4RA 4MEYF 2V1XA 5B1BH 4IOCF 3SFZA 1LDKB 4IRIA 2L54A 3JSPA 1BI0A 5F1JA 2QKLB 2VC1A 1FOXA 3HOSA 5E79C 4UUSA 4N4NB 2M0MA 5EEAA 4ABZA 2FMLA 2Z99A 4I98B 2EV0A 2ZO4A 3R6SA 4EM2A 4G7HF 1J0RA 1W7PD 2NVYJ 3ABLH 2DMNA 3I59B 4PDKA 4H0EA 4OIPF 1FWZA 4UHTA 4A2UA 1WZ2A 5B3SH 2IS6A 3R4KA 1EH8A 3PQKA 5FKNA 3OS0A 1BJAA 4XSZF 1DPRA 3VYTB 4M9XA 2JPBA 2HKXA 3SFIA 3ZRGA 4EMSA 4Z6YA 4E7HA 1VQ6I 5J3LA 4WXHA 1FLIA 2PJPA 3OYJA 4L18B 1X2MA 4XLHA 5F04A 2MLGA 1N25A 2EIKH 4C30A 2M8EA 1IJWC 2X6YA 4B3XA 5FKOA 2WA0A 5EYRA 4RAFA 4A0ZA 2HYJA 2XRLA 4MLOA 4KN7X 2GWRA 2QF7A 1W7PA 3S32A 3S3OA 2HOSA 3H92A 3JRDA 1MDMB 2X6WA 5HS7A 2EBIA 2OC6A 2L02A 2R7WA 1SFXA 4CCMA 4OAZA 2RREA 4I7HA 4D7NA 3HHGA 1G3YA 4BUPA 5E1ZB 3TW7A 3PUFA 2PI0A 4XKCA 5L3FA 4LJZF 1B72B 4UB6C 1TNTA 3ZQ7A 2HI3A 4FT8A 4YRVA 3CCYA 2R7VA 4BXUA 2Y30A 4O5VA 4HAMA 1BIBA 4AVZA 2NNYA 4PJ0C 3FMSA 1U78A 3OV8A 1Z77A 2H27A 3RPQA 4NBQA 3DKXA 2DMPA 1TW2A 4HEA2 4ZTJA 1W36C 2M7BA 3MQ0A 4M6XA 3LL7A 3QWLA 2K27A 1I50J 3A03A 4XLNF 4AIKA 2ZJPF 3MZYA 1FC3A 1RZ4A 3PNTA 3FXMA 2V79A 3JR9A 4ZYHA 3HOWJ 2RGVA 2PN6A 4HDVA 3P9KA 2CV2A 2V6EA 1RETA 5DD8A 4HQMA 2ID6A 4C2TA 3F8NA 2DT5A 3TO9A 4CCLA 3LSKA 4R1HA 2O6GE 1UHSA 2JVGA 1R23A 4RMNA 2CQ7A 4HRIA 3T5XA 3OL4A 2RQPA 4AC0A 1ACIA 3PO3J 1RPWA 3IKVA 3MKLA 1VQ7I 2IA1A 1ETVA 2Y9YA 2LK2A 1MBKA 4E6KG 3FXLA 2ELJA 3J7AO 2HNHA 2P5LC 1VQ8I 4KIGA 5IP6A 2EJRA 2DODA 2XPUA 4Y4RA 4BAYA 4E7KA 3I4MJ 1K7AA 2NNNA 3QYFA 4ZDLA 2LKPA 3CP2A 4XRSA 2V9VA 3CJNA 3DPLC 3SQNA 4IL6C 2L7KA 2ZXWH 3TKYA 3HSFA 3BZ6A 2FE3A 3DBRB 2ZMEB 1D0YA 3P5JA 4BE1A 4KICA 4U0YA 2GAUA 3MZ8A 1O7FA 3R0JA 4IX7A 1VFCA 2K9MA 2A69F 5F1RA 2HPIA 2FBIA 5H2FC 1HA8A 2E1MC 2YX4A 2DDAA 2XF7A 2FX0A 2H8RA 2F5DA 2FQ3A 1WJAA 2HOAA 2F2EA 2MH2A 3H9JA 2GQQA 2VUMJ 2E36A 2BYVE 2ETHA 3EUHC 3JTHA 2CUEA 4M3FA 4P5OA 4XOTA 3CCLI 3ZMVA 3H3VK 4W97A 2DO7A 2JK3A 3WG9A 4C2MJ 2M9HA 3RPUD 1TL8A 3JTGA 1LB2A 2ADUA 4J19A 3CJRB 1B9NA 3GLLA 2IGKA 2IA2A 4CZCA 4MNUA 3BR2A 4QSHA 3SJMA 2W82A 3K4JA 3BR5A 2CW8A 3ZXSA 3A01B 5F64A 1SD5A 4GO1A 1VQMI 3CF2A 4DQ2A 2K5CA 3U2RA 4A3DJ 4NQWB 3HUGB 3F22A 2R7SA 3PQJA 2WAEA 4L5IA 2EZLA 2AHQA 3E1SA 2DOAA 3HTSB 4Y13A 3RPUA 3W2VA 1ZGWA 3CJTB 3IAM2 3QPTA 1I27A 1ZYRF 3CCMI 4L5JA 2WC2A 2XAQA 3PIPF 1PP8F 3OYLA 5HDNA 1MW7A 4BY7J 4YG2F 4ANJA 2HFHA 1DPUA 3FF5A 5IP7J 2A6HF 1GV5A 4HPQA 1S9HA 2CUJA 2HVQA 2XKPA 4DYCA 1TT5B 5KNLA 3HDDA 1OR7C 2Y0MA 4BDZA 2BY0A 1IN5A 5LGUA 4JX4A 1E17A 5K7ZA 4BEHA 3EYYA 3OL3A 4N0BA 1XGSA 3LSPA 1A35A 4DGWB 5FFZA 1XCBA 4XM3A 1S29A 3QAHA 3OY9A 5HNHA 1ZHFA 3GTKJ 1XGOA 4OIQF 3V8JA 2DFHA 1MKMA 3HRMA 1U5TB 1O57A 2LDUA 3H1CA 1XDSA 1B8IA 2ICWG 2ME0A 3SHFA 5LEJA 1U6GA 3CC7I 4M71A 2EK5A 4JBAA 2P81A 3K4NA 5EZGA 3OYBA 3LAJA 4FISA 4XLAA 5HVQC 4I09A 3BJ6A 4BU2A 4F91B 2FXAA 3QPSA 1YS6A 3AG2H 3WTSC 2G0EA 2JTVA 3HL2A 1BW5A 3IL2A 3K0LA 2VC0A 1F5TA 4CYCB 4WXDA 2DFFA 1ZH5A 1KGSA 2E1CA 3OYFA 2F48A 4KIBA 1MMAA 2XAGA 2LRDA 4IEJA 2QLZA 3GTPJ 2WTEA 2O8XA 3OYAA 1HOMA 2R7TA 1FP1D 3JRIA 3BG7A 5C3EJ 4J00A 3KZYA 3K4BA 1BC7C 1QZZA 3HYIA 4YFXF 4E7LA 4N4OB 2HKOA 1GLNA 2QBYB 2XAFA 4TV7A 3ZQIA 4IRHA 1IXRC 3F3XA 1XPXA 1HDDC 2ZNZA 4RGRA 1J5YA 5HODA 3H35A 3JRFA 3DP7A 4B4CA 1BN5A 2R7ZJ 2L0KA 4E4HA 5JVGF 2KIQA 1LPQA 1YLFA 1ETXA 2V4JC 2NS7A 2OTJI 1OFCX 1VF9A 4OMYA 1PP7U 2GOMA 4A3EJ 3RYPA 3OMYA 4XMYA 4CSWA 3C7JA 3CUQB 1ZELA 4LK0F 4ZC3A 1X3WB 5E3NA 3DU6A 2ECCA 2ELKA 2XHKA 4P9UA 4RLFA 2UWMA 3FZVA 3HOUJ 5J1YA 3W6JB 3MAJA 1SMYF 1VI0A 5FD5A 3H0DA 1MH3A 3FHZA 1POGA 3JREA 2O9LA 1WJEA 4F3QA 3K4CA 5D6FA 1FNNA 1MMSA 1E3PA 3V4GA 3HRTA 3H5RA 4OU0A 4KUMA 4LG3A 3RDIA 2RVCA 2WV1A 3E3VA 1FTTA 2QKMB 3SDGA 3VPRA 1R5GA 4OMZA 2QWWA 2L7FP 2L3DA 5HLGA 2GXBA 1YS7A 5M3FJ 2MC4A 5ERIA 3E6DA 3BP8A 1YITI 4OOIA 3V7RA 1LNWA 1YTYA 2Z1DA 2DTZA 3N05A 4I99C 1HKTA 4G8XA 2VBYA 3LFUA 2Y9ZA 2GIVA 5A2QK 4KDPA 2ZNYA 2MA3A 5AIPA 4RB0A 4WX9A 3OR1C 3OS1A 5CVJA 2OF7A 4GCVA 5K5RA 4UB8C 3BG5A 2M2EA 3BR1A 3TDZC 1JUSA 1SVLA 1FOWA 3OWTA 2VQGA 2X6XA 5J47A 4B3AA 1GXQA 2WY8Q 2COBA 3CDHA 4BKXA 1U5TA 3NWTA 1ZG1A 2BGCA 5DUIA 2UZKA 3K69A 3DTEA 5ED4A 2ZXHA 4Z2YA 1MMGA 2ZMEC 3CCQI 1D3YA 2PBIA 2CQQA 2VE8A 3S2DJ 5LGNA 3K4MA 2F5CA 4D1QA 4I01A 5FRMA 4WCGA 5FKMA 3OYKA 2HZDA 2ISZA 3FXKA 3A0HC 5KK1A 1YIOA 4CYCA 4Q4ZF 4A93J 1CF7B 1E3OC 2KHMA 2DPUA 2ZB9A 3TW6A 1SANA 4B8XA 4YEJA 3T1BA 3LNQA 2PMZA 2OCCH 1OYIA 1X1CA 4RB3C 1D8KA 2KJCA 4I0AA 1IG7A 1QVUA 2C6YA 2MW8A 1XDUA 5KVRA 5HLHA 2H6BA 5EZHA 1PVEA 2FNAA 2V1DA 1W0UA 3GFMA 1X3ZB 3ML6A 4EEFG 2Y31A 5ICFA 2DXIA 3F72A 4XKVA 2V1UA 2Y0SA 2AO9A 2ZJQF 2RN7A 1HCRA 3BZCA 1DGRM 2YPRA 4AWXB 2DJNA 4L0YB 1XC5A 2LY2A 1K6OA 2W24A 1IC8A 2MABA 3I58A 1TNSA 2WAQA 1GV2A 1ZQ3P 4NC6A 2CW7A 2CSOA 2M4GA 2CWEA 3H3UA 3PFIA 3GWZA 2GLOA 1LKXA 1F9NA 2DW4A 4HA8A 3WHCA 3HOZJ 3DV8A 4BJ5C 4QIWN 3JRHA 3J7YJ 1KU9A 3J7AY 4G12A 5FB2A 3IV5A 1J2XA 2MLKA 3CUQA 3I56I 1EKEA 3T8TA 4II3A 1YE9A 1YW9A 2M3AA 3GTQJ 2LKSA 2BY2A 2LC2A 1J9IA 2VKHA 2VJJA 3SZPA 4QPOA 1ODDA 3MZHA 1YQAA 2GIZA 5GPAA 1YX3A 4IF4A 2NOJB 3OOUA 5C44J 2NVTJ 3KCCA 3J80K 4CGZA 2CO5A 4MTDA 3CDIA 2UV1A 5HS9A 1YW7A 1T0FA 5JLWA 1AHDP 2VOOA 3F21A 1RESA 3BOQA 2ID3A 3HEFA 4LD5A 1MNDA 3TDUC 1O3SA 1XGMA 2E34A 4QLCU 1D5YA 4M3EA 3CZ6A 3JRGA 1U5TC 2M34A 4UVAA 3M3YJ 1E0EA 1U0JA 2V9KA 1PUFA 5F08A 3E7LA 4BS9A 4V19K 1B1BA 1FSEA 4EJWA 2X85A 1X58A 3I64A 3VODA 1LJ9A 2HDWA 2F5FA 4M3BA 3ZMUA 4XKBA 2Y75A 2E1MB 3KP4A 3LMMA 3BZKA 5IT3A 1DUXC 3JAMZ 1WHUA 2QUFA 1MBEA 2DJIA 3BCBA 4ESFA 1A6QA 1G3WA 3RKXA 3LA7A 2R7QA 4FX0A 4XICA 1WWXA 2GA2A 3A1YA 3I53A 3ABKH 1G3TA 1OQYA 2KLOA 2YR2A 3J81Z 3FXJA 1APLC 2X9DA 2KRHA 2DA5A 4HZFA 5L3CA 4U7DA 3ISPA 2PJRB 1BC8C 3CESA 2Y48A 1Y1VJ 1BR4A 2DN0A 3MFKA 2XC7A 2WAFA 2IAIA 3VOEA 2EINH 1D5VA 3SYTA 2CFOA 3F0CA 3AL0B 1QBJA 1R58A 1W1WE 1WQ2A 3S1QJ 3IKTA 1LEAA 1QO0D 3OIQA 3KEYA 3WTZA 1FIAA 2OU2A 4G6QA 4HNTA 1ZN2A 4RM2A 3UKGA 4BBSJ 1IRGA 2JT1A 3O8HA 1TTYA 3B6CA 4DYRA 2OCEA 2QSFX 1R1UA 3OIOA 5IY5H 1OCRH 3L1PA 2V9PA 3S1NJ 4RAZA 1FMWA 3GFJA 3FM5A 3WG7H 2DT7B 3KX2A 1GHCA 3LSGA 3K4LA 3S2WA 2GM4A 4LB5A 1ZKGA 2IS2A 1CQTA 2B9SA 1LEBA 3RQIA 1CGPA 3DKWA 3ESWB 3E6MA 5HNFA 3R60A 3BG9A 3K1MA 2KFDA 3X2QH 1TP4A 3BR3A 5CYVA 1TWFJ 2VBWA 3MWMA 3HRUA 4NC8A 1O3TA 1DU0A 3ULQB 5JLXA 5FFXA 4L9JA 1OJLA 2LG4A 1EH7A 2HVSA 2VQCA 1TBXA 4NUBA 2VIXA 5E20A 2IPQX 5D6EA 1B4AA 4B43A 2X0LA 1H9TA 5GPCA 4NDLA 4IHVA 3AFHA 2F6CA 2K85A 4A3BJ 1K79A 1HQCA 2EWNA 3LSJA 3OYHA 3HIFA 1T0FC 2QSGX 4AIDA 4HDUA 3GX4X 1R1TA 2W48A 1Z05A 3BTIA 3CLQA 1YRNB 1Y56A 2B0LA 1YO5C 2MGQA 2ZJ2A 2ELHA 3M8EA 3A02A 3FXOA 3TBIA 5GTIC 3WTYC 4IRGA 2BVLA 5CJ9A 3L2CA 2XIGA 2IEKA 1RUNA 3GO5A 3BTJA 1WH7A 2VXDA 3NWSA 1ZR2A 5IT9Z 2XB0X 3ABTA 2LR8A 1LDDA 2JJ7A 1MBHA 2KKOA 1R36A 2VLAA 4N9HA 1T08B 1ZREA 4X6AJ 1N77A 1MGTA 5E3LA 3PNYA 3KETA 3PUBA 2AQFA 3M9AA 4U87A 1SFEA 3HGYA 4RA2A 1RKWA 4UNOA 1B9MA 1KQ8A 2KJBA 1N78A 1XMKA 3QOPA 3HC7A 2PMZN 1OCTC 2VB6A 4DBRA 2WWYA 2Z3YA 3V8KA 5GADJ 1VQLI 1D0XA 3AKZA 1VQPI 3HRSA 4D7MA 4QTRA 4LMYA 1ETYA 3W3CA 5EEGA 2G7HA 3R0AA 5B66C 1WKMA 4E7SA 3W6VA 2K40A 1I5ZA 2UXNA 3I3LA 3TP3A 4M73A 5CLSA 1H9GA 5E18F 3EUHA 3VB2A 1B6AA 3O2PE 1TT0A 2Y0SN 3WGIA 4XNFA 2N8GA 5HLTA 2V6CA 1OCZH 2HXOA 1LVKA 2LY9A 2WAQN 4ZZLA 3OYGA 2LD5A 1KQ9A 1KYZA 3R61A 4D9JA 3QPLA 1I1SA 1YG2A 2EILH 1GDTA 4DZPA 3JCUC 4ZYGA 4R8HA 1BR2A 2FU4A 1R49A 5CQEA 2V1NA 4ZJZA 1XCVA 1X3UA 4EGYA 1TWGJ 3D5SC 3ZOBA 4P1WA 2J5PA 3CMYA 2V26A 2GXGA 1F36A 1FP2A 3CJQB 3WGHA 5CVVA 5EGOA 2XPVA 2VPLA 3GTGJ 4LIUA 4NC7A 1G2HA 1BI2A 3DBHB 2K4BA 2HQ5A 4QPQA 3ROUA 1S5LC 2B7EA 3JRBA 3ONQA 5EEHA 1WI3A 2XAHA 2FNPA 3A4CA 1BI3A 1JT0A 1W0TA 3HJEA 1VZ0A 5GTHC 5IYBJ 5CKTA 3CP8A 2OA4A 3MVPA 1WJ5A 2F4IA 5FKLA 1OR7A 5FROA 4A0XA 4C9YA 5J1RA 1YJ9I 3EDPA 1FY7A 3GFLA 4BBRJ 2DI3A 4CHUA 3BR6A 2UUZA 3G1LA 2WB1N 1YW8A 1MD0A 1T6SA 3NRVA 3S93A 3QYBA 3PJRA 2R93J 2XAUA 2XVCA 2L5QA 1UHMA 3HZJA 3L2VA 1O4XA 4IVNA 3ASNH 4ENJA 3C2BA 3LQQA 5H6RA 2ZXIA 1Z3YA 1MIJA 2EV5A 3REOA 3EETA 2CV1A 2IGNA 1AA7A 3K1PA 4RAGA 5D5WB 1ZK8A 4AYBA 1LFBA 2DPDA 2JSCA 4A3LJ 2STWA 2P6SA 1UB9A 1I1GA 1FPQA 4KFCA 1HSTA 3ZMZA 1TWCJ 2R5ZB 3A2KA 4UY8I 3E5XA 3IRRA 4G7ZF 2VASA 4KT6A 3U21A 2NVQJ 5ICEA 2K3PA 1Y8QB 2QQ9A 5E8GA 1Q1VA 3F8MA 1QNTA 3GZNB 1M1EB 5M3MJ 2I8DA 1V54H 3CQZJ 4IJAA 1ZGAA 2JN6A 5FLXZ 1MSFC 2OTLI 1VQ9I 1UHWA 1I3QJ 4BXXJ 3I59A 3UNGC 2Z9OA 2P7CB 1NG7A 2QZ8A 2LH9A 1R22A 1P4WA 2ISYA 3ZP5A 4XBFA 1QHGA 1P2FA 1OYWA 1LFPA 2KPMA 3BQYA 3O6BB 1RUOA 1XMXA 2L7ZA 5LD2C 2BHYA 3L00A 4LLGF 1ZRFA 2EH3A 2JRMA 1GVDA 4Y33A 4F92B 2FA5A 4IKFA 3KE2A 3MMYB 2X48A 2R7FA 5TJJA 3AL0C 3K70C 4IXAA 2XSJC 3W6KB 4I02A 1KZHA 4DIQA 1MDMA 2BY1A 2KIFA 5DYMA 2R7DA 3E5QA 4JP0A 4OIRF 2ZSHB 2IGMA 2IVMA 1O7LA 3E0JB 1S8NA 3H9QA 2R7XA 4JK1X 2YX7A 1ITYA 3Q3SA 5IP9J 3MKZA 2VT3A 3HG9A 2MG4A 1B72A 2LF8A 3CO6C 1W5CC 2E1OA 1S3JA 5CVUA 3ZQLA 4A69C 4BACA 4ITVA 2QENA 2EV6A 2OQRA 4DW6A 1BW6A 2DMTA 1YJNI 4HX7A 1FYKA 2TDXA 2A07F 3J7ZI 3KIOA 3LA3A 3KZZA 2VKDA 3ZMDA 4YELA 4XK4A 1DQUA 2CW0F 2YU9J 1QVTA 1Y1WJ 1T39A 1ZG3A 2P4WA 4X0GA 3ZGKA 4HV6A 1R5HA 2GOXB 2VKVA 3BC8A 1P7IA 2VL8A 4AVPA 3B6AA 1ZR4A 4MHGA 3FXRA 4GXOA 4G7OF 4A0YA 3M4OJ 2COMA 3K4KA 1PDNC 2XF6A 1IN6A 2FEZA 5D5UB 2BXZA 3BLYA 2A6TA 1FZPB 2W00A 2BEOA 4B44A 1G8XA 4NNJA 2YU3A 2G7UA 4AU7A 2CGPA 1IN7A 1P92A 1A31A 3DPUA 3BT9A 5HDKA 2KT0A 4HX4A 4R79A 4X1EA 3F23A 2ZKZA 3GLXA 3RIRA 2O3FA 1S6LA 4MEXF 4XORA 1BOAA 1QPIA 2R92J 2HWVA 3E5UA 3KLNA 4RLQA 4GFBA 4AIJA 2EIMH 2CFXA 1YYVA 2W4SA 3WU1B 4GRIA 2KZVA 4RM3A 3I4PA 3VYUB 1JHHA 1X4PA 2EFQA 2P0WA 1UAAA 4KJZA 4JX6A 3D1NI 3CC2I 4Q48A 4CCOA 1LE8B 2ZMEA 1XN7A 1OMIA 2K9NA 3CCVI 4P55A 3AG1H 5J8FA 4PJNA 4OINF 2MBFA 5DS9A 3JSOA 2KDZA 5H20A 1LUJB 5CQGA 4ESJA 3L7WA 3H36A 3TMOA 1JHFA 2E5NA 4WXCA 5LBQA 3H5NA 3GFIA 2JVHA 5DCFA 3KP7A 3I71A 3M7GA 1RNLA 2L9NA 1T2KA 2LSOA 1DP7P 1Z67A 1W5SA 1MNMC 2CV0A 2R5YB 1ULYA 1X4OA 2X4HA 2IP2A 4M74A 4YFKF 4FTHA 4E70A 5FGMA 2VKEA 4WWCA 3PIOF 3FXQA 2XDVA 4IQ4A 2KIUA 3LAPA 2BVMA 2MD0A 4A3FJ 1JT6A 4BNCA 3ECOA 3A01A 2HPMA 2EZKA 1BIAA 1Z1DA 2FUG2 1P7JA 1U8BA 3TGNA 4NQWA 2DMQA 1IGNA 3HUGA 3LSHA 3LA2A 5J4YA 3KLOA 3F9KA 1KU2A 4EQQA 2FRHA 1FBSA 3BPXA 3I5UA 2E1NA 5J4VA 4BE2A 2KP6A 1SFKA 3DQVC 1P9QC 2HXIA 4M3GA 1Y0NA 1K78B 1SD7A 5JVTA 1YOVB 2JUCA 4BGDA 2HYGD 3RKYA 3CMEI 1IN4A 5HS8A 2E35A 2IXSA 1GXPA 2L9VA 4PSWA 3IAS2 5H6QA 4ZYEA 3S1RJ 3RJPA 3FX3A 4ZDPA 2PMUA 3E6CC 1VQOI 3QOEA 4HF2A 2IS4A 2W25A 1NK3P 1UG0A 2LOOA 3K2ZA 4EJOA
chains in the Genus database with same CATH topology
1B72B 1APLC 2X9DA 3FKIJ 2HI3A 2DA5A 2OPTA 3CCYA 2Y30A 2XGEA 1Y1VJ 3FK6A 2DN0A 1K61A 1U78A 3NAUA 1ZTRA 1Z77A 1WGXA 1UG2A 2DA3A 1GT0C 2DMPA 1JKRC 2IAIA 3Q0WA 3F0CA 3WHBA 3TEDA 4A3CJ 2DA6A 4IHWA 3S1QJ 4FE4A 2FD5A 1I50J 1HF0A 1FIAA 1JKQC 3A03A 3UKGA 4BBSJ 3O8HA 4DYRA 3B6CA 3JR9A 1IDZA 3HOWJ 2LKXA 3OIOA 4AUXA 5J1UA 3L1PA 3S1NJ 1RETA 2ID6A 5GP9A 3LSGA 2CJJA 2GM4A 1ZKGA 1UHSA 1CQTA 3QQAA 3RQIA 1MBGA 1WH5A 1OCPA 3BG9A 4AC0A 2EQRA 1VNDA 3PO3J 2K9SA 1RPWA 1WPKA 3BR3A 3MKLA 1TWFJ 3ZQFA 1ETVA 2Y9YA 1DU0A 1BA5A 1U9OA 2LK2A 3HBLA 5JLXA 5M5YJ 1MBKA 2R5ZA 1MBFA 1OJLA 3JRCA 4IHYA 3HOXJ 1HLVA 3PO2J 5GPCA 2LP0A 4NDLA 4IHVA 5IP6A 4A3BJ 2XPUA 4UUTA 3LSJA 3HM5A 3I4MJ 2VPRA 2W48A 1Z0XA 4XRSA 3IH3A 4Y52J 3BTIA 1YRNB 2MGQA 2CUFA 5IOZA 3S2HJ 1IDYA 3A02A 2R5YA 1VFCA 1XS9A 2IEKA 2XGDA 4D5CA 3FISA 2FX0A 3BTJA 1WH7A 2HOAA 4FE7A 4FCYA 2H8RA 1ZR2A 2VUMJ 4M3FA 2ECBA 2CUEA 2XB0X 2LR8A 3H3VK 4W97A 2JJ7A 1MBHA 2D5VA 2DA1A 2JK3A 4C2MJ 2YUSA 2R0QC 2M9HA 4A3KJ 3S15J 4X6AJ 1H88C 5E3LA 1A6IA 4J19A 3GTLJ 2E2HJ 1BJZA 1H89C 5BNGA 3RZOJ 4L5EA 3G1MA 5F0CA 3HGYA 5EG0B 3BR2A 1RKWA 4QSHA 3SJMA 3BR5A 2PMZN 5EF6A 1OCTC 3A01B 2EZIA 2JMWA 1JTXA 4AYBN 4A3DJ 3ZQGA 4D7MA 4QTRA 1ETYA 3MN2A 4BY1J 1T33A 3IH4A 5E3OA 1EF4A 3K7AJ 3W6VA 2K40A 1ETOA 2EZLA 3TP3A 2AHQA 3HB9A 5F0HA 1ZGWA 1LFUP 2Y0SN 2HOTA 2N8GA 4RDUA 2M8GX 1PUFB 1IRZA 2HXOA 4BY7J 5E3MA 1MH4A 2ME6A 2NS8A 2DA7A 5IP7J 3ZQHA 2LY9A 2WAQN 2LD5A 1GV5A 3BG3A 4DYCA 3HDDA 3QPLA 1GDTA 1FIPA 2IBDA 4C3IJ 4S0HB 4DZPA 2EZHA 4XRSG 2Y2ZA 4JX4A 5K7ZA 1TWGJ 3LSPA 3ZOBA 3CMYA 4JX5A 2LFBA 1F36A 5EGOA 2XPVA 1JJ6C 3GTGJ 3GTKJ 3BTLA 1G2HA 3LOCA 3JRAA 3ZQCA 2JA5J 2JWTA 1HDPA 2DA2A 2HQ5A 3JRBA 5FLVA 1B8IA 2ME0A 1ETKA 5FJ8J 2L9RA 1WI3A 4HNVA 1NK2P 2P81A 1JT0A 1W0TA 2LLKA 1TWHJ 1F43A 5EZGA 5IYBJ 2XGCA 3MVPA 5FKLA 4FISA 5J1RA 4BBRJ 3BR6A 1TWAJ 3QPSA 3G1LA 2WB1N 4Y7NJ 1BW5A 2G0EA 3FIWA 1IUFA 2H1KA 4CYCB 2R93J 4B1RA 1O4XA 3IH2A 1IV6A 5IPAA 5M5WJ 1LE8A 1JUPA 1ENHA 3C2BA 1QRYA 2FJ1A 4V2GA 4IEJA 3CDLA 1ZK8A 3GTPJ 2O8KA 1HOMA 1RKTA 4A3GJ 1LFBA 5F27A 3JRIA 5C3EJ 2XSDC 4A3LJ 2YS9A 2QCOA 1FEXA 1TWCJ 2R5ZB 2I10A 2TCTA 4C3JJ 1ETWA 2NVQJ 1BL0A 3ZQIA 1Q1VA 2FQ4A 1HDDC 5M3MJ 3CQZJ 5HODA 2JN6A 3JRFA 4B4CA 1MSFC 2R7ZJ 4MIMA 2L0KA 1A5JA 1I3QJ 2NOGA 4BXXJ 1ETXA 5IYCJ 3O8GA 4MFEA 2NS7A 4M3DA 1OFCX 1VF9A 2X6OA 3GTMJ 9ANTA 4A3EJ 4UUSB 4JYKA 2HDDA 5K7FA 3BQYA 5C4XJ 4DYQA 5E3NA 3S17J 2ECCA 2L7ZA 2ELKA 3DCFA 2VI6A 5EG0A 1FTZA 3HOUJ 2EH3A 3I4NJ 1GVDA 5J1YA 1VI0A 2X48A 3FK7A 1MH3A 1POGA 3JREA 2O9LA 1X2NA 2XB5A 3DEWA 1RR7A 2WV1A 4DZJA 3RKQA 1FTTA 3SDGA 3VPRA 1U9NA 1JUMA 4JP0A 1R9TJ 1ORKA 2XPWA 2L7FP 1MBJA 1TC3C 1AKHB 1JKPC 1XG1A 2NVXJ 3S1MJ 1ITYA 3Q3SA 4MFDA 5IP9J 5M3FJ 1FJLA 2MG4A 1NTCA 1B72A 2E2JJ 2E1OA 3K2AA 4V2FA 4LOCA 2DTZA 3ZQLA 4A69C 1H8AC 2MSYA 4DW6A 2Y9ZA 5C4JJ 1BW6A 5EDNA 5FKKA 2DMTA 3HOVJ 3NARA 3PM1A 3Q0UA 2CRGA 2OF7A 4XK4A 3BG5A 3HOYJ 2DMUA 2M2EA 3BR1A 3H0GJ 1JUSA 1T56A 1QVTA 1Y1WJ 2YU9J 3OSFA 4MO7A 4C3HJ 1MSEC 4B3AA 2COBA 2DA4A 2LTPA 4BKXA 2VKVA 2B63J 1P7IA 2K9QA 1AU7A 3B6AA 1ZR4A 3M4OJ 3G1OA 4XRMA 1GUUA 3GBGA 2CQQA 2RAEA 3S2DJ 3LSRA 5EGOB 5FKMA 4W1UA 4A3IJ 5M5XJ 3Q0VA 3BT9A 2KT0A 4CYCA 1JGGA 4A93J 4X1EA 1B8IB 1WCMJ 1E3OC 2ZB9A 3TW6A 4IHXA 1SANA 3LNQA 3HGGA 2L7MP 2LVSA 1QPIA 2R92J 2E19A 4GFBA 1IG7A 1QVUA 2MW8A 4A3MJ 4D5FA 5EZHA 1W0UA 1YRNA 1K83J 4JX6A 3D1NI 4EEFG 2TRTA 2JA8J 2Y31A 1DU6A 1LE8B 3TP0A 2JA7J 4RBOA 2K9NA 2AO9A 1HCRA 4I6ZA 1JJ8C 1ETQA 3HKZN 5DS9A 2O7OA 2M0CA 2GBYA 2KDZA 2DJNA 3BR0A 1XC5A 3GTJJ 5IYDJ 1IC8A 1GV2A 1SFOJ 4I76A 1ZQ3P 3GTOJ 2CU7A 1S7EA 3S16J 2GLOA 3WHCA 3BQZA 3HOZJ 4QIWN 5F1JA 3JRHA 2R5YB 1MNMC 4G12A 3IV5A 4UUSA 4FTHA 4A3JJ 2VKEA 5EEAA 4ABZA 2E2IJ 3GTQJ 1JKOC 1JTYA 4A3FJ 1JT6A 2NVYJ 2DMNA 3A01A 2CQXA 5GPAA 2EZKA 3OOUA 5C44J 2NVTJ 5FKNA 1P7JA 3RZDJ 1U8BA 3S14J 2DMQA 1IGNA 1I6HJ 3SFIA 5JLWA 5J3LA 1AHDP 1RESA 1X2MA 2ID3A 5FLMJ 3HEFA 2JA6J 3BTCA 5F04A 1D5YA 4M3EA 1AKHA 3JRGA 2M34A 3M3YJ 2HXIA 1IJWC 5FKOA 5EYRA 4M3GA 5K7HA 1PUFA 5F08A 3E7LA 2HYJA 4XIDA 2XRLA 4MLOA 1X58A 2QF7A 4M3BA 2HOSA 1UMQA 3JRDA 4M6VA 5F0FA 5IOYA 2EBIA 3S1RJ 1MBEA 4D7NA 1NK3P 3TW7A 4XICA 5DTDA 3OSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B72 B;  1APL C;  2X9D A;  3FKI J;  2HI3 A;  2DA5 A;  2OPT A;  3CCY A;  2Y30 A;  2XGE A;  1Y1V J;  3FK6 A;  2DN0 A;  1K61 A;  1U78 A;  3NAU A;  1ZTR A;  1Z77 A;  1WGX A;  1UG2 A;  2DA3 A;  1GT0 C;  2DMP A;  1JKR C;  2IAI A;  3Q0W A;  3F0C A;  3WHB A;  3TED A;  4A3C J;  2DA6 A;  4IHW A;  3S1Q J;  4FE4 A;  2FD5 A;  1I50 J;  1HF0 A;  1FIA A;  1JKQ C;  3A03 A;  3UKG A;  4BBS J;  3O8H A;  4DYR A;  3B6C A;  3JR9 A;  1IDZ A;  3HOW J;  2LKX A;  3OIO A;  4AUX A;  5J1U A;  3L1P A;  3S1N J;  1RET A;  2ID6 A;  5GP9 A;  3LSG A;  2CJJ A;  2GM4 A;  1ZKG A;  1UHS A;  1CQT A;  3QQA A;  3RQI A;  1MBG A;  1WH5 A;  1OCP A;  3BG9 A;  4AC0 A;  2EQR A;  1VND A;  3PO3 J;  2K9S A;  1RPW A;  1WPK A;  3BR3 A;  3MKL A;  1TWF J;  3ZQF A;  1ETV A;  2Y9Y A;  1DU0 A;  1BA5 A;  1U9O A;  2LK2 A;  3HBL A;  5JLX A;  5M5Y J;  1MBK A;  2R5Z A;  1MBF A;  1OJL A;  3JRC A;  4IHY A;  3HOX J;  1HLV A;  3PO2 J;  5GPC A;  2LP0 A;  4NDL A;  4IHV A;  5IP6 A;  4A3B J;  2XPU A;  4UUT A;  3LSJ A;  3HM5 A;  3I4M J;  2VPR A;  2W48 A;  1Z0X A;  4XRS A;  3IH3 A;  4Y52 J;  3BTI A;  1YRN B;  2MGQ A;  2CUF A;  5IOZ A;  3S2H J;  1IDY A;  3A02 A;  2R5Y A;  1VFC A;  1XS9 A;  2IEK A;  2XGD A;  4D5C A;  3FIS A;  2FX0 A;  3BTJ A;  1WH7 A;  2HOA A;  4FE7 A;  4FCY A;  2H8R A;  1ZR2 A;  2VUM J;  4M3F A;  2ECB A;  2CUE A;  2XB0 X;  2LR8 A;  3H3V K;  4W97 A;  2JJ7 A;  1MBH A;  2D5V A;  2DA1 A;  2JK3 A;  4C2M J;  2YUS A;  2R0Q C;  2M9H A;  4A3K J;  3S15 J;  4X6A J;  1H88 C;  5E3L A;  1A6I A;  4J19 A;  3GTL J;  2E2H J;  1BJZ A;  1H89 C;  5BNG A;  3RZO J;  4L5E A;  3G1M A;  5F0C A;  3HGY A;  5EG0 B;  3BR2 A;  1RKW A;  4QSH A;  3SJM A;  3BR5 A;  2PMZ N;  5EF6 A;  1OCT C;  3A01 B;  2EZI A;  2JMW A;  1JTX A;  4AYB N;  4A3D J;  3ZQG A;  4D7M A;  4QTR A;  1ETY A;  3MN2 A;  4BY1 J;  1T33 A;  3IH4 A;  5E3O A;  1EF4 A;  3K7A J;  3W6V A;  2K40 A;  1ETO A;  2EZL A;  3TP3 A;  2AHQ A;  3HB9 A;  5F0H A;  1ZGW A;  1LFU P;  2Y0S N;  2HOT A;  2N8G A;  4RDU A;  2M8G X;  1PUF B;  1IRZ A;  2HXO A;  4BY7 J;  5E3M A;  1MH4 A;  2ME6 A;  2NS8 A;  2DA7 A;  5IP7 J;  3ZQH A;  2LY9 A;  2WAQ N;  2LD5 A;  1GV5 A;  3BG3 A;  4DYC A;  3HDD A;  3QPL A;  1GDT A;  1FIP A;  2IBD A;  4C3I J;  4S0H B;  4DZP A;  2EZH A;  4XRS G;  2Y2Z A;  4JX4 A;  5K7Z A;  1TWG J;  3LSP A;  3ZOB A;  3CMY A;  4JX5 A;  2LFB A;  1F36 A;  5EGO A;  2XPV A;  1JJ6 C;  3GTG J;  3GTK J;  3BTL A;  1G2H A;  3LOC A;  3JRA A;  3ZQC A;  2JA5 J;  2JWT A;  1HDP A;  2DA2 A;  2HQ5 A;  3JRB A;  5FLV A;  1B8I A;  2ME0 A;  1ETK A;  5FJ8 J;  2L9R A;  1WI3 A;  4HNV A;  1NK2 P;  2P81 A;  1JT0 A;  1W0T A;  2LLK A;  1TWH J;  1F43 A;  5EZG A;  5IYB J;  2XGC A;  3MVP A;  5FKL A;  4FIS A;  5J1R A;  4BBR J;  3BR6 A;  1TWA J;  3QPS A;  3G1L A;  2WB1 N;  4Y7N J;  1BW5 A;  2G0E A;  3FIW A;  1IUF A;  2H1K A;  4CYC B;  2R93 J;  4B1R A;  1O4X A;  3IH2 A;  1IV6 A;  5IPA A;  5M5W J;  1LE8 A;  1JUP A;  1ENH A;  3C2B A;  1QRY A;  2FJ1 A;  4V2G A;  4IEJ A;  3CDL A;  1ZK8 A;  3GTP J;  2O8K A;  1HOM A;  1RKT A;  4A3G J;  1LFB A;  5F27 A;  3JRI A;  5C3E J;  2XSD C;  4A3L J;  2YS9 A;  2QCO A;  1FEX A;  1TWC J;  2R5Z B;  2I10 A;  2TCT A;  4C3J J;  1ETW A;  2NVQ J;  1BL0 A;  3ZQI A;  1Q1V A;  2FQ4 A;  1HDD C;  5M3M J;  3CQZ J;  5HOD A;  2JN6 A;  3JRF A;  4B4C A;  1MSF C;  2R7Z J;  4MIM A;  2L0K A;  1A5J A;  1I3Q J;  2NOG A;  4BXX J;  1ETX A;  5IYC J;  3O8G A;  4MFE A;  2NS7 A;  4M3D A;  1OFC X;  1VF9 A;  2X6O A;  3GTM J;  9ANT A;  4A3E J;  4UUS B;  4JYK A;  2HDD A;  5K7F A;  3BQY A;  5C4X J;  4DYQ A;  5E3N A;  3S17 J;  2ECC A;  2L7Z A;  2ELK A;  3DCF A;  2VI6 A;  5EG0 A;  1FTZ A;  3HOU J;  2EH3 A;  3I4N J;  1GVD A;  5J1Y A;  1VI0 A;  2X48 A;  3FK7 A;  1MH3 A;  1POG A;  3JRE A;  2O9L A;  1X2N A;  2XB5 A;  3DEW A;  1RR7 A;  2WV1 A;  4DZJ A;  3RKQ A;  1FTT A;  3SDG A;  3VPR A;  1U9N A;  1JUM A;  4JP0 A;  1R9T J;  1ORK A;  2XPW A;  2L7F P;  1MBJ A;  1TC3 C;  1AKH B;  1JKP C;  1XG1 A;  2NVX J;  3S1M J;  1ITY A;  3Q3S A;  4MFD A;  5IP9 J;  5M3F J;  1FJL A;  2MG4 A;  1NTC A;  1B72 A;  2E2J J;  2E1O A;  3K2A A;  4V2F A;  4LOC A;  2DTZ A;  3ZQL A;  4A69 C;  1H8A C;  2MSY A;  4DW6 A;  2Y9Z A;  5C4J J;  1BW6 A;  5EDN A;  5FKK A;  2DMT A;  3HOV J;  3NAR A;  3PM1 A;  3Q0U A;  2CRG A;  2OF7 A;  4XK4 A;  3BG5 A;  3HOY J;  2DMU A;  2M2E A;  3BR1 A;  3H0G J;  1JUS A;  1T56 A;  1QVT A;  1Y1W J;  2YU9 J;  3OSF A;  4MO7 A;  4C3H J;  1MSE C;  4B3A A;  2COB A;  2DA4 A;  2LTP A;  4BKX A;  2VKV A;  2B63 J;  1P7I A;  2K9Q A;  1AU7 A;  3B6A A;  1ZR4 A;  3M4O J;  3G1O A;  4XRM A;  1GUU A;  3GBG A;  2CQQ A;  2RAE A;  3S2D J;  3LSR A;  5EGO B;  5FKM A;  4W1U A;  4A3I J;  5M5X J;  3Q0V A;  3BT9 A;  2KT0 A;  4CYC A;  1JGG A;  4A93 J;  4X1E A;  1B8I B;  1WCM J;  1E3O C;  2ZB9 A;  3TW6 A;  4IHX A;  1SAN A;  3LNQ A;  3HGG A;  2L7M P;  2LVS A;  1QPI A;  2R92 J;  2E19 A;  4GFB A;  1IG7 A;  1QVU A;  2MW8 A;  4A3M J;  4D5F A;  5EZH A;  1W0U A;  1YRN A;  1K83 J;  4JX6 A;  3D1N I;  4EEF G;  2TRT A;  2JA8 J;  2Y31 A;  1DU6 A;  1LE8 B;  3TP0 A;  2JA7 J;  4RBO A;  2K9N A;  2AO9 A;  1HCR A;  4I6Z A;  1JJ8 C;  1ETQ A;  3HKZ N;  5DS9 A;  2O7O A;  2M0C A;  2GBY A;  2KDZ A;  2DJN A;  3BR0 A;  1XC5 A;  3GTJ J;  5IYD J;  1IC8 A;  1GV2 A;  1SFO J;  4I76 A;  1ZQ3 P;  3GTO J;  2CU7 A;  1S7E A;  3S16 J;  2GLO A;  3WHC A;  3BQZ A;  3HOZ J;  4QIW N;  5F1J A;  3JRH A;  2R5Y B;  1MNM C;  4G12 A;  3IV5 A;  4UUS A;  4FTH A;  4A3J J;  2VKE A;  5EEA A;  4ABZ A;  2E2I J;  3GTQ J;  1JKO C;  1JTY A;  4A3F J;  1JT6 A;  2NVY J;  2DMN A;  3A01 A;  2CQX A;  5GPA A;  2EZK A;  3OOU A;  5C44 J;  2NVT J;  5FKN A;  1P7J A;  3RZD J;  1U8B A;  3S14 J;  2DMQ A;  1IGN A;  1I6H J;  3SFI A;  5JLW A;  5J3L A;  1AHD P;  1RES A;  1X2M A;  2ID3 A;  5FLM J;  3HEF A;  2JA6 J;  3BTC A;  5F04 A;  1D5Y A;  4M3E A;  1AKH A;  3JRG A;  2M34 A;  3M3Y J;  2HXI A;  1IJW C;  5FKO A;  5EYR A;  4M3G A;  5K7H A;  1PUF A;  5F08 A;  3E7L A;  2HYJ A;  4XID A;  2XRL A;  4MLO A;  1X58 A;  2QF7 A;  4M3B A;  2HOS A;  1UMQ A;  3JRD A;  4M6V A;  5F0F A;  5IOY A;  2EBI A;  3S1R J;  1MBE A;  4D7N A;  1NK3 P;  3TW7 A;  4XIC A;  5DTD A;  3OSG A; 
#chains in the Genus database with same CATH topology
 2R7O A;  4IPA A;  3MKW B;  3DLA A;  2R7R A;  3FKI J;  4ESB A;  2QQA A;  1QZY A;  3KP2 A;  4FQG A;  4XKW A;  2OPT A;  1YIJ I;  2GZW A;  3V8L A;  2XGE A;  3F6V A;  4RGS A;  1G59 A;  3WTT C;  1K61 A;  3NAU A;  5CVI A;  1R71 A;  3C18 A;  5DUK A;  3CCU I;  3QRF F;  3KP6 A;  2DA3 A;  5JHU A;  2A68 F;  1IN8 A;  2JRT A;  1J09 A;  3Q0W A;  1JKR C;  3LST A;  3TED A;  4KT5 C;  4DJA A;  2E60 A;  1QA6 A;  4IHW A;  2FD5 A;  2IA0 A;  3AG3 H;  4S05 A;  1MZB A;  1HF0 A;  2PX9 A;  3IP4 B;  5DDG A;  2LNB A;  1KU3 A;  2EFW A;  2LKX A;  5J1U A;  2NVU B;  3CC4 I;  1P4X A;  3SZG A;  1W4M A;  5GP9 A;  2HOE A;  1FBU A;  3FXU A;  2EFP A;  1MJA A;  5E8I A;  3QQA A;  4HF0 A;  3U9G A;  3ERE D;  1FBQ A;  1VQN I;  1WH5 A;  1OCP A;  5AIQ A;  2EQR A;  1VND A;  3NEU A;  2W84 A;  2K9S A;  3COA C;  2PMH A;  1Y39 A;  1X1B A;  3D0S A;  3ZQF A;  3E6B A;  4UUV A;  1IUY A;  4M72 A;  3ZMT A;  4F52 A;  4RB2 C;  2GA1 A;  1P4A A;  5M5Y J;  2LRE A;  1REP C;  1MBF A;  1S7A A;  1XSX A;  3WE3 A;  3DTK A;  3CO7 C;  4K2E A;  2QBY A;  3WTW C;  2XV4 S;  3HOX J;  1HLV A;  3PO2 J;  2ZXJ A;  1QU3 A;  3BWG A;  4ENN A;  4UUT A;  3HM5 A;  2HS5 A;  4PFP A;  1D1A A;  3H3Z A;  4LK1 F;  5KCM A;  3CCE I;  5BMZ A;  2QGU A;  2IW5 A;  4LFU A;  1Z0X A;  4Y52 J;  3IH3 A;  3C1D A;  1G6N A;  4RS8 A;  5ILU A;  3RCO A;  3FWE A;  5DEQ A;  4E7J A;  2CUF A;  4A6E A;  5HDG A;  3L09 A;  2R5Y A;  2DFI A;  5AON A;  2QSH X;  1XS9 A;  2ESH A;  4YFN F;  1HXD A;  2FF4 A;  2VOP A;  3FMQ A;  4YIR X;  3Q5F A;  3GZ5 A;  4OWR B;  2P7V B;  4G6D A;  2QVO A;  3HHH A;  4Y15 A;  1R4M B;  4F93 B;  1SEU A;  2VE9 A;  3FIS A;  4GDF A;  4FCY A;  5LHG A;  2OUM A;  1DP3 A;  4AM3 A;  2IGO A;  3MCZ A;  2HVR A;  4WK8 F;  3GYH X;  2D5V A;  4XN3 A;  2R0Q C;  3S15 J;  4A3K J;  4Y17 A;  1H88 C;  3BY6 A;  1A6I A;  4GYG A;  3GTL J;  3CLO A;  4HX8 A;  2E2H J;  2HEO A;  1BJZ A;  1H89 C;  4HBL A;  3RZO J;  4E7Z A;  4L5E A;  2OQG A;  3G1M A;  5L3B A;  5F0C A;  1ZLK A;  2D45 A;  4BYY A;  2BV6 A;  4RAY A;  2RKH A;  4XRF A;  4XSX F;  3L2W A;  5EF6 A;  1Z9C A;  3IUO A;  4KA4 A;  2JMW A;  1JTX A;  1K78 A;  2H6C A;  5DD4 A;  2A5Y B;  5DV5 A;  3ZQG A;  3MD2 A;  3M1C A;  4OAY A;  4DOZ A;  3IH4 A;  5E3O A;  1DDN A;  2IS1 A;  1EF4 A;  3PSI A;  4B47 A;  2W1O A;  2BE5 F;  4CIC A;  3HB9 A;  5F0H A;  3OYM A;  1JXS A;  5KAI C;  3ZN1 A;  2XRO A;  3OYD A;  2P5V A;  2HYF A;  4RDU A;  2XKO A;  2M8G X;  1HKQ A;  2DU9 A;  2WV0 A;  4G6T B;  2D2W A;  3CCS I;  1IRZ A;  3B02 A;  3V42 A;  3OYN A;  2NS8 A;  2JUG A;  2IRF G;  1EH6 A;  1W7P B;  4RB1 A;  5F6F A;  1IW7 F;  2LBF B;  1WJF A;  2FMY A;  3GZ6 A;  2M87 A;  3HKZ A;  3RYR A;  1TQI A;  3KP3 A;  2M1B A;  4IQJ A;  1B59 A;  1FIP A;  1Z7L A;  4S0H B;  2KRF A;  1FSH A;  2VBX A;  1MMN A;  2A05 A;  1MNE A;  3DTI A;  4NB5 A;  4PCQ A;  1XTA A;  3S3M A;  2MH9 A;  4IOA F;  2VXZ A;  1W36 D;  1ZAO A;  1RIO H;  3JW4 A;  3E97 A;  4XOP A;  2HR3 A;  4Y3O A;  3ZMS A;  1XGN A;  1EV7 A;  3LOC A;  5A2Q Z;  4KMF A;  1ETK A;  1CF7 A;  1S7O A;  2ACJ A;  2BHZ A;  3WU2 C;  4HOB A;  3LSM A;  2LLK A;  3CF5 F;  3KFW X;  1HKS A;  1SAX A;  2O61 A;  3QYE A;  2JZY A;  3BG6 A;  4FX4 A;  3DXJ F;  5JHF A;  1IRX A;  2Q1Z B;  1TWA J;  4Y7N J;  1BI1 A;  5L3E A;  2X1C A;  2E7X A;  3IH2 A;  1Z7U A;  3BJO A;  5IPA A;  2O03 A;  4J01 A;  1ENH A;  4L9N A;  4L9T A;  1MJ9 A;  1IO2 A;  1HBX G;  2KDO A;  4N9I A;  2FJ1 A;  2CMP A;  5BQT A;  5LEK A;  4CYD A;  3OOP A;  3H9G A;  4H4K C;  3CDL A;  1WJB A;  3L2U A;  2O8K A;  4XON A;  4F55 A;  2WAD A;  4BXF A;  1UCR A;  4BHP A;  2XSD C;  5E1W A;  2YS9 A;  3C2H A;  1YX5 A;  1FEX A;  2VOD A;  2I10 A;  4PFO A;  4CUG A;  3DEU A;  2TCT A;  1OKR A;  3S8P A;  1D8J A;  4ZYA A;  2K9L A;  2PG4 A;  1D0Z A;  1P6R A;  2PQ8 A;  2ZCW A;  5J8C A;  3VFZ A;  2QA4 I;  2STT A;  1SVM A;  1KQ0 A;  3K10 A;  4MIM A;  2NOG A;  2F4O B;  1PYV A;  5IYC J;  1PUE E;  2H09 A;  4O3M A;  3ZPL A;  1BOB A;  2HZT A;  2X6O A;  4M3D A;  2R4G A;  2X1E A;  4RGU A;  4JYK A;  1VQ4 I;  2OBP A;  2ZFU A;  2FOW A;  5C4X J;  3AG4 H;  4DYQ A;  1IRF A;  1Y8R B;  1T95 A;  3DCF A;  4HSR A;  4IZZ A;  4LB6 B;  1R1V A;  3KYL A;  2ZBK A;  3I4N J;  4AD9 A;  2DK8 A;  2EFO A;  2M45 A;  1R6R A;  1A36 A;  5K1Y A;  4EGZ A;  2HDC A;  3GVA A;  3DU5 A;  1X2N A;  2L2O A;  2XB5 A;  3DEW A;  4HST A;  3K70 D;  5BPD A;  2RV8 A;  1JUM A;  2K4J A;  3ZQQ A;  1ORK A;  3LSI A;  3GEZ A;  1AKH B;  1BBY A;  1XG1 A;  2NVX J;  3S1M J;  4MFD A;  4ZDO A;  3VYR B;  4PGH A;  1FJL A;  2V7F A;  4XLC A;  2CYY A;  3RKW A;  1NTC A;  1SMT A;  2OJE D;  1FYM A;  3SEZ A;  3J80 Z;  1Y6I A;  3GCM A;  3K2A A;  2LBF A;  3FBN B;  2PJR A;  5BS6 A;  1H8A C;  1I39 A;  4XN0 A;  4BHC A;  4FHT A;  3RI4 A;  4CXF A;  5LRS A;  3H5A A;  5C4J J;  4HF1 A;  6PAX A;  4KIF A;  5FKK A;  1YJW I;  1C0W A;  1USS A;  1R7J A;  1UEL B;  2J5O A;  3HTU A;  2AXT C;  1W5T A;  3NAR A;  4BDY A;  4M9S A;  3HOY J;  2CS3 A;  3TO6 A;  4LG0 B;  3N97 A;  2K7L A;  4JOM A;  5GAH J;  3H0G J;  3VEP A;  4CH7 A;  1OLT A;  4C3H J;  4QWQ A;  2BZT A;  5FD6 A;  1RI7 A;  3VSL A;  2DA4 A;  2B63 J;  5GAG J;  1R00 A;  1AU7 A;  1QGP A;  4O6J A;  2F4M B;  1GUU A;  3GBG A;  4G9Y A;  1Q1H A;  4BEH B;  3CMA I;  2I5U A;  4EM1 A;  3M07 A;  5HOO A;  1U3E M;  4LGW A;  1KYW A;  3LWF A;  1Z21 A;  2RAE A;  3LSR A;  4FET A;  3TO7 A;  4W1U A;  2M30 A;  2OV7 A;  5M5X J;  1D1C A;  2DT6 A;  1OCC H;  2L01 A;  1JGG A;  3ELK A;  3TOA A;  1B8I B;  1WCM J;  2CG4 A;  1YI2 I;  2L7M P;  2XAS A;  1T38 A;  2P5K A;  2LVS A;  3CCJ I;  3QOD A;  2Q8K A;  4JQF A;  4GYI A;  4ZTF A;  1HSJ A;  3IWZ A;  4U88 A;  4A3M J;  1SD6 A;  4MTE A;  4D5F A;  3HSR A;  4P9F A;  4ZZD A;  1YRN A;  1K83 J;  3CCR I;  1I6X A;  2CQN A;  3VYS B;  2TRT A;  1KU7 A;  3RQ4 A;  1DU6 A;  4GGG A;  4I6Z A;  1ETQ A;  3EQL F;  3HKZ N;  4PJJ A;  3KPH A;  2M0C A;  1Y0U A;  3KZI C;  4ENM A;  1HW1 A;  2VQH A;  4A5M A;  1ZAR A;  3BR0 A;  3HPH A;  3CUO A;  2HTJ A;  1TLH B;  2BBY A;  3GTJ J;  5IYD J;  1D1B A;  4BQO A;  2HU9 A;  4I76 A;  3A0B C;  2CU7 A;  1VQ5 I;  5ILS A;  5JFR A;  1S7E A;  4MGR A;  3RSN A;  3BJA A;  2UXX A;  3U1D A;  3BQZ A;  3FBI B;  4NHJ A;  2VJ4 A;  2F5V A;  2FSW A;  3C2G A;  4U0W A;  4CO8 A;  4ENK A;  1AOY A;  3ZN0 A;  2BXY A;  1N75 A;  4A3J J;  1XSD A;  2E2I J;  3P7N A;  5EJC A;  1JKO C;  3CMM A;  2ZSI B;  1WJD A;  1KON A;  1JTY A;  2RNJ A;  1KA8 A;  4XL9 A;  3FM3 A;  2CQX A;  1FOY A;  2VJI A;  2M4K A;  3IWF A;  2EB7 A;  5JR3 A;  3P9C A;  3RZD J;  5LGT A;  3G3Z A;  4BE0 A;  3S14 J;  1I6H J;  2P6T A;  3N4M A;  5FLM J;  2JA6 J;  3DEE A;  3BTC A;  5BPI A;  2X1D A;  1EA3 A;  4WF2 A;  1AKH A;  3SXY A;  4E7I A;  3GUD A;  4YII A;  2DQR A;  2VBZ A;  4PJM A;  3EYI A;  1MJB A;  5K7H A;  4XID A;  5D8K B;  4KN4 X;  5B1A H;  2XF5 A;  2GXA A;  4IHT A;  1RC9 A;  1UMQ A;  4M6V A;  5FRN A;  4BQQ A;  5F0F A;  5IOY A;  2XGX A;  2K3F A;  1Z91 A;  1G3S A;  4U7B A;  3ABU A;  2L4A A;  3BPV A;  3K9T A;  3RTR A;  2Z5U A;  5LHI A;  2NAZ A;  2L4M A;  5DTD A;  2VQL A;  3OSG A;  4EJU A;  3EUK L;  1O3R A;  4IO9 F;  4EV0 A;  4HYE A;  2IT0 A;  4LG0 A;  1E2X A;  4UVC A;  1TW3 A;  3ZR8 X;  2DOE A;  1J7K A;  3PL8 A;  3FK6 A;  4EJV A;  3G71 I;  1ZTR A;  3EUA A;  1WGX A;  1UG2 A;  2RDP A;  2FBH A;  4U0V A;  1GT0 C;  1AWC A;  4HW0 A;  4FAS D;  2K86 A;  3OS2 A;  5DCM B;  3WHB A;  5D4R A;  2LY1 A;  2DA6 A;  4A3C J;  1LQ1 A;  1J75 A;  1OPC A;  4FE4 A;  4UV9 A;  2L9S A;  3WTU C;  5ICC A;  3LQR A;  3WU0 A;  5D8L B;  4G94 A;  1JKQ C;  4EM0 B;  1IDZ A;  4AUX A;  1QQI A;  1QPM A;  5E1X A;  5DM6 F;  2E7W A;  3D5L A;  3G6E I;  3F8C A;  5FO5 A;  5KHD A;  2CJJ A;  4AIH A;  1OIS A;  1JI8 A;  5BOX A;  1MBG A;  1IV8 A;  3TL4 X;  2MYS A;  4YIF A;  2EA2 A;  3OYC A;  4HNU A;  1WPK A;  2FBK A;  3VDX A;  4A5N A;  5D4S A;  2W57 A;  1X1A A;  2DYR H;  5GAE J;  2AXL A;  1BA5 A;  3BRO A;  1IAW A;  1U9O A;  3HBL A;  5J6X A;  2KL4 A;  2O0Y A;  4M9Z A;  3JRC A;  2R5Z A;  3DWL E;  4HLY A;  4CCN A;  4IHY A;  1SAU A;  4BQA A;  1LDJ A;  1WRJ A;  4P96 A;  2PFB A;  2LP0 A;  3QP5 A;  5K5Q A;  5HLI A;  1RRJ A;  4F7Z A;  2VPR A;  2YSR A;  3SZT A;  2DYS H;  4S04 A;  3D5R C;  4CCK A;  4II2 A;  4LLN A;  5JI6 A;  3V7C A;  3Q9S A;  4RGX A;  1ZRD A;  5LHH A;  3M8F A;  3L2R A;  1HW5 A;  1Z3X A;  5DM7 F;  5IOZ A;  3ECH A;  3S2H J;  2D1V A;  1IDY A;  1WSU A;  3WGG A;  3FKJ A;  2A5W A;  1XX5 A;  2A3S A;  2XGD A;  3O3K A;  2EA4 A;  2FOK A;  4D5C A;  1SVO A;  1WVR A;  4FE7 A;  4UXN A;  2ECB A;  4DNC A;  3F6O A;  2DA1 A;  4XR6 A;  2YUS A;  3OIP A;  4I0B A;  2HQR A;  4EVI A;  2HTS A;  2OZ6 A;  2H1L A;  1V5G A;  3KYD B;  3JAM K;  4L0Z B;  1BR1 A;  5BNG A;  1J59 A;  2BW3 B;  2Q0O A;  1ZG5 A;  2CUZ A;  5EG0 B;  4MQV A;  2Y69 H;  2EFN A;  2DDB A;  2LMD A;  5B5E C;  1JE8 A;  2EZI A;  4Q5S F;  3J81 K;  4LLL A;  4DBQ A;  1LVA A;  1UST A;  2M7A A;  4AYB N;  4EAT A;  4C2U A;  3MN2 A;  3OR2 C;  4BY1 J;  1T33 A;  4BJT A;  3DF8 A;  3K7A J;  2QM3 A;  3I54 A;  4B48 A;  1ZGJ A;  1ETO A;  1X1D A;  3SEQ A;  1V5F A;  2Z16 A;  3GF2 A;  4I2O A;  1LFU P;  2PLY A;  2NXN B;  2HOT A;  1F1Z A;  2QQB A;  2QEX I;  1FMV A;  1PUF B;  2Q2E B;  3K6G A;  4PJL A;  5E3M A;  1MH4 A;  2ME6 A;  4PK4 A;  1YHQ I;  3SDB A;  2DA7 A;  3ZQH A;  1YFH A;  5D5V B;  4XQF A;  2QQ8 A;  2NYX A;  3K1N A;  3BG3 A;  4HLX A;  3F8F A;  2P8T A;  3TOB A;  1JGS A;  2IBD A;  4C3I J;  1L0O C;  2EZH A;  4XRS G;  5DCM A;  1ON2 A;  2F5E A;  2Y2Z A;  3I9V 2;  1U2W A;  2EPF A;  1V3F A;  1UZC A;  2E71 A;  4JX5 A;  3HOT A;  2LFB A;  2MC3 A;  4HV5 A;  3IHU A;  2DOF A;  1JJ6 C;  3QU3 A;  4KIT B;  2IJL A;  3BTL A;  5ILV A;  1I3A A;  3G73 A;  3C3W A;  3JRA A;  3ZQC A;  2JWT A;  2JA5 J;  1HDP A;  2DA2 A;  5FLV A;  5LLQ A;  5FJ8 J;  3PSF A;  3OYI A;  2L9R A;  1SFU A;  4HNV A;  1T98 A;  1NK2 P;  1DGW Y;  1ZLJ A;  1TWH J;  1F43 A;  2XGC A;  3VSK A;  5ICG A;  3TQN A;  2CH0 A;  1SC7 A;  2Z2S B;  2A61 A;  3FMR A;  3FIW A;  1IUF A;  3MKY B;  2H1K A;  3L2Q A;  4B1R A;  1IV6 A;  3F8B A;  5M5W J;  1LE8 A;  1VQK I;  1JUP A;  1X19 A;  3VWB A;  1QRY A;  4OIO F;  2XUB A;  4V2G A;  2QYO A;  3T8R A;  5D5X B;  2HGC A;  4BQN A;  2K02 A;  1RKT A;  3ZCO A;  5CPR B;  4A3G J;  2DTR A;  5F27 A;  1S72 I;  3I0T A;  3WE2 A;  3QP6 A;  2KIM A;  1OYY A;  4ON0 A;  2QCO A;  5IT9 K;  1WJC A;  2OAZ A;  1SD4 A;  2AS5 F;  1BM9 A;  1QZE A;  2W85 A;  2BOL A;  3FHN A;  4UVB A;  1G4D A;  2VON A;  2LF7 A;  4C3J J;  2A6E F;  1ETW A;  2DAO A;  2ZJR F;  1BL0 A;  4MQ9 F;  2XAJ A;  3Q9V A;  1WFX A;  2FQ4 A;  1T8I A;  1K4S A;  4CCJ A;  2NRA C;  2VN2 A;  1E3H A;  1XMA A;  3M8J A;  2RC4 A;  3FDY A;  3BDD A;  5LRR A;  3HPG A;  4XLE A;  5K5O A;  4CDG A;  2R3S A;  3B73 A;  1HC8 A;  1A5J A;  3GME A;  4BJ6 C;  5KAF C;  3HXL A;  2R7U A;  3O8G A;  4MFE A;  2JA2 A;  3UR3 C;  4PGG A;  3GTM J;  9ANT A;  4A6D A;  4UUS B;  1ONV A;  4PZJ A;  2HDD A;  5K7F A;  4IHS A;  2MD5 A;  2MFZ A;  1IZ1 A;  3MEX A;  3IRQ A;  4ZH4 F;  3S17 J;  2BW3 A;  1FOK A;  4Q47 A;  4CA0 A;  2W7N A;  2VI6 A;  2DFE A;  5E17 F;  5EG0 A;  1FTZ A;  1H0M A;  4UV8 A;  3KEO A;  1K6Y A;  2KIS A;  3FK7 A;  1O3Q A;  1IXS B;  1PJR A;  3WOD F;  1Z6T A;  1Z6R A;  2WY7 Q;  4L9V A;  1TZL A;  1TQP A;  3W2W A;  3HSE A;  2KRC A;  4EJT A;  2H94 A;  4LIV A;  3S3N A;  1RR7 A;  4DZJ A;  3RKQ A;  5CVR A;  4HG2 A;  1U9N A;  3GW2 A;  4BHB A;  2HQN A;  1R9T J;  3T0Y A;  2XPW A;  1A04 A;  1UFM A;  2ZFW A;  3DKY A;  1MBJ A;  1XD7 A;  3ERM A;  1VTN C;  2DK5 A;  1TC3 C;  1V5E A;  3I55 I;  2Z33 A;  1JKP C;  1XB4 A;  1V55 H;  2WB1 A;  2XRN A;  3AAF A;  2PEX A;  4PUS A;  1IXC A;  1R4N B;  4ZYD A;  2Q2E A;  2H8W A;  3ABM H;  2OZU A;  4PSX A;  2E2J J;  1QHH D;  1STZ A;  4V2F A;  3CTA A;  2M5W A;  3PFY A;  4LOC A;  3NQO A;  2DCE A;  3CD6 I;  3BCA A;  2DBB A;  5TGT A;  2MSY A;  2KZG A;  3DPT A;  3P9I A;  1UJ8 A;  5EDN A;  3HOV J;  3LFK A;  3M1E A;  1K4T A;  3PM1 A;  3EPZ A;  5L3G A;  1MMD A;  2RNG A;  1TQM A;  3Q0U A;  2BY3 A;  4KMU X;  2CRG A;  3U1K A;  2ZC2 A;  2DMU A;  3KEQ A;  4LIT A;  4M6Y A;  1GVJ A;  2G9W A;  1IF1 A;  1OCO H;  1T56 A;  3OSF A;  1WI9 A;  4MO7 A;  1FX7 A;  1MSE C;  3DFG A;  3V7S A;  2LTP A;  1XSV A;  2JSP A;  4KIS A;  3KP5 A;  3ASO H;  1F4K A;  2KMU A;  4HQE A;  2K9Q A;  4KNY A;  2X51 A;  3DBL B;  2JPC A;  3G1O A;  3G2B A;  4XRM A;  2HQA A;  3IC7 A;  3W2A A;  1RR8 C;  3QU6 A;  4CZZ A;  2VT2 A;  1EJ9 A;  4ETS A;  3KYC B;  5EGO B;  5TIS C;  1FYL A;  2EIJ H;  4ASN A;  1NHA A;  3OYE A;  1NG6 A;  4BH9 A;  4A3I J;  3Q0V A;  2AQE A;  2JQ7 A;  1HW2 A;  1L3L A;  4D0P A;  3GXO A;  2CQK A;  4IHX A;  2O5R A;  3HGG A;  2VJ5 A;  4KYW A;  2WBM A;  2DQL A;  5TRD A;  2E19 A;  4XLF A;  5FLX K;  3CUQ C;  3WTV C;  3G4S I;  1ZRC A;  2RQQ A;  2NS0 A;  2KQR A;  2LYC A;  2E5Z A;  1X1P A;  3L9F A;  5LFA A;  2ESN A;  4A12 A;  2JA8 J;  2DLL A;  2JA7 J;  3TP0 A;  1ERD A;  3PNV A;  4XLP F;  4RBO A;  1FT9 A;  1JJ8 C;  3WTX C;  2O7O A;  5L3D A;  3DLL F;  1R5I D;  2GBY A;  2D1H A;  4B09 A;  3QPH A;  2OD5 A;  4BL0 B;  1U8R A;  1ON1 A;  5J40 A;  1SFO J;  3GTO J;  1NH3 A;  3S16 J;  1V4R A;  4MEY F;  2V1X A;  5B1B H;  4IOC F;  3SFZ A;  1LDK B;  4IRI A;  2L54 A;  3JSP A;  1BI0 A;  5F1J A;  2QKL B;  2VC1 A;  1FOX A;  3HOS A;  5E79 C;  4UUS A;  4N4N B;  2M0M A;  5EEA A;  4ABZ A;  2FML A;  2Z99 A;  4I98 B;  2EV0 A;  2ZO4 A;  3R6S A;  4EM2 A;  4G7H F;  1J0R A;  1W7P D;  2NVY J;  3ABL H;  2DMN A;  3I59 B;  4PDK A;  4H0E A;  4OIP F;  1FWZ A;  4UHT A;  4A2U A;  1WZ2 A;  5B3S H;  2IS6 A;  3R4K A;  1EH8 A;  3PQK A;  5FKN A;  3OS0 A;  1BJA A;  4XSZ F;  1DPR A;  3VYT B;  4M9X A;  2JPB A;  2HKX A;  3SFI A;  3ZRG A;  4EMS A;  4Z6Y A;  4E7H A;  1VQ6 I;  5J3L A;  4WXH A;  1FLI A;  2PJP A;  3OYJ A;  4L18 B;  1X2M A;  4XLH A;  5F04 A;  2MLG A;  1N25 A;  2EIK H;  4C30 A;  2M8E A;  1IJW C;  2X6Y A;  4B3X A;  5FKO A;  2WA0 A;  5EYR A;  4RAF A;  4A0Z A;  2HYJ A;  2XRL A;  4MLO A;  4KN7 X;  2GWR A;  2QF7 A;  1W7P A;  3S32 A;  3S3O A;  2HOS A;  3H92 A;  3JRD A;  1MDM B;  2X6W A;  5HS7 A;  2EBI A;  2OC6 A;  2L02 A;  2R7W A;  1SFX A;  4CCM A;  4OAZ A;  2RRE A;  4I7H A;  4D7N A;  3HHG A;  1G3Y A;  4BUP A;  5E1Z B;  3TW7 A;  3PUF A;  2PI0 A;  4XKC A;  5L3F A;  4LJZ F;  1B72 B;  4UB6 C;  1TNT A;  3ZQ7 A;  2HI3 A;  4FT8 A;  4YRV A;  3CCY A;  2R7V A;  4BXU A;  2Y30 A;  4O5V A;  4HAM A;  1BIB A;  4AVZ A;  2NNY A;  4PJ0 C;  3FMS A;  1U78 A;  3OV8 A;  1Z77 A;  2H27 A;  3RPQ A;  4NBQ A;  3DKX A;  2DMP A;  1TW2 A;  4HEA 2;  4ZTJ A;  1W36 C;  2M7B A;  3MQ0 A;  4M6X A;  3LL7 A;  3QWL A;  2K27 A;  1I50 J;  3A03 A;  4XLN F;  4AIK A;  2ZJP F;  3MZY A;  1FC3 A;  1RZ4 A;  3PNT A;  3FXM A;  2V79 A;  3JR9 A;  4ZYH A;  3HOW J;  2RGV A;  2PN6 A;  4HDV A;  3P9K A;  2CV2 A;  2V6E A;  1RET A;  5DD8 A;  4HQM A;  2ID6 A;  4C2T A;  3F8N A;  2DT5 A;  3TO9 A;  4CCL A;  3LSK A;  4R1H A;  2O6G E;  1UHS A;  2JVG A;  1R23 A;  4RMN A;  2CQ7 A;  4HRI A;  3T5X A;  3OL4 A;  2RQP A;  4AC0 A;  1ACI A;  3PO3 J;  1RPW A;  3IKV A;  3MKL A;  1VQ7 I;  2IA1 A;  1ETV A;  2Y9Y A;  2LK2 A;  1MBK A;  4E6K G;  3FXL A;  2ELJ A;  3J7A O;  2HNH A;  2P5L C;  1VQ8 I;  4KIG A;  5IP6 A;  2EJR A;  2DOD A;  2XPU A;  4Y4R A;  4BAY A;  4E7K A;  3I4M J;  1K7A A;  2NNN A;  3QYF A;  4ZDL A;  2LKP A;  3CP2 A;  4XRS A;  2V9V A;  3CJN A;  3DPL C;  3SQN A;  4IL6 C;  2L7K A;  2ZXW H;  3TKY A;  3HSF A;  3BZ6 A;  2FE3 A;  3DBR B;  2ZME B;  1D0Y A;  3P5J A;  4BE1 A;  4KIC A;  4U0Y A;  2GAU A;  3MZ8 A;  1O7F A;  3R0J A;  4IX7 A;  1VFC A;  2K9M A;  2A69 F;  5F1R A;  2HPI A;  2FBI A;  5H2F C;  1HA8 A;  2E1M C;  2YX4 A;  2DDA A;  2XF7 A;  2FX0 A;  2H8R A;  2F5D A;  2FQ3 A;  1WJA A;  2HOA A;  2F2E A;  2MH2 A;  3H9J A;  2GQQ A;  2VUM J;  2E36 A;  2BYV E;  2ETH A;  3EUH C;  3JTH A;  2CUE A;  4M3F A;  4P5O A;  4XOT A;  3CCL I;  3ZMV A;  3H3V K;  4W97 A;  2DO7 A;  2JK3 A;  3WG9 A;  4C2M J;  2M9H A;  3RPU D;  1TL8 A;  3JTG A;  1LB2 A;  2ADU A;  4J19 A;  3CJR B;  1B9N A;  3GLL A;  2IGK A;  2IA2 A;  4CZC A;  4MNU A;  3BR2 A;  4QSH A;  3SJM A;  2W82 A;  3K4J A;  3BR5 A;  2CW8 A;  3ZXS A;  3A01 B;  5F64 A;  1SD5 A;  4GO1 A;  1VQM I;  3CF2 A;  4DQ2 A;  2K5C A;  3U2R A;  4A3D J;  4NQW B;  3HUG B;  3F22 A;  2R7S A;  3PQJ A;  2WAE A;  4L5I A;  2EZL A;  2AHQ A;  3E1S A;  2DOA A;  3HTS B;  4Y13 A;  3RPU A;  3W2V A;  1ZGW A;  3CJT B;  3IAM 2;  3QPT A;  1I27 A;  1ZYR F;  3CCM I;  4L5J A;  2WC2 A;  2XAQ A;  3PIP F;  1PP8 F;  3OYL A;  5HDN A;  1MW7 A;  4BY7 J;  4YG2 F;  4ANJ A;  2HFH A;  1DPU A;  3FF5 A;  5IP7 J;  2A6H F;  1GV5 A;  4HPQ A;  1S9H A;  2CUJ A;  2HVQ A;  2XKP A;  4DYC A;  1TT5 B;  5KNL A;  3HDD A;  1OR7 C;  2Y0M A;  4BDZ A;  2BY0 A;  1IN5 A;  5LGU A;  4JX4 A;  1E17 A;  5K7Z A;  4BEH A;  3EYY A;  3OL3 A;  4N0B A;  1XGS A;  3LSP A;  1A35 A;  4DGW B;  5FFZ A;  1XCB A;  4XM3 A;  1S29 A;  3QAH A;  3OY9 A;  5HNH A;  1ZHF A;  3GTK J;  1XGO A;  4OIQ F;  3V8J A;  2DFH A;  1MKM A;  3HRM A;  1U5T B;  1O57 A;  2LDU A;  3H1C A;  1XDS A;  1B8I A;  2ICW G;  2ME0 A;  3SHF A;  5LEJ A;  1U6G A;  3CC7 I;  4M71 A;  2EK5 A;  4JBA A;  2P81 A;  3K4N A;  5EZG A;  3OYB A;  3LAJ A;  4FIS A;  4XLA A;  5HVQ C;  4I09 A;  3BJ6 A;  4BU2 A;  4F91 B;  2FXA A;  3QPS A;  1YS6 A;  3AG2 H;  3WTS C;  2G0E A;  2JTV A;  3HL2 A;  1BW5 A;  3IL2 A;  3K0L A;  2VC0 A;  1F5T A;  4CYC B;  4WXD A;  2DFF A;  1ZH5 A;  1KGS A;  2E1C A;  3OYF A;  2F48 A;  4KIB A;  1MMA A;  2XAG A;  2LRD A;  4IEJ A;  2QLZ A;  3GTP J;  2WTE A;  2O8X A;  3OYA A;  1HOM A;  2R7T A;  1FP1 D;  3JRI A;  3BG7 A;  5C3E J;  4J00 A;  3KZY A;  3K4B A;  1BC7 C;  1QZZ A;  3HYI A;  4YFX F;  4E7L A;  4N4O B;  2HKO A;  1GLN A;  2QBY B;  2XAF A;  4TV7 A;  3ZQI A;  4IRH A;  1IXR C;  3F3X A;  1XPX A;  1HDD C;  2ZNZ A;  4RGR A;  1J5Y A;  5HOD A;  3H35 A;  3JRF A;  3DP7 A;  4B4C A;  1BN5 A;  2R7Z J;  2L0K A;  4E4H A;  5JVG F;  2KIQ A;  1LPQ A;  1YLF A;  1ETX A;  2V4J C;  2NS7 A;  2OTJ I;  1OFC X;  1VF9 A;  4OMY A;  1PP7 U;  2GOM A;  4A3E J;  3RYP A;  3OMY A;  4XMY A;  4CSW A;  3C7J A;  3CUQ B;  1ZEL A;  4LK0 F;  4ZC3 A;  1X3W B;  5E3N A;  3DU6 A;  2ECC A;  2ELK A;  2XHK A;  4P9U A;  4RLF A;  2UWM A;  3FZV A;  3HOU J;  5J1Y A;  3W6J B;  3MAJ A;  1SMY F;  1VI0 A;  5FD5 A;  3H0D A;  1MH3 A;  3FHZ A;  1POG A;  3JRE A;  2O9L A;  1WJE A;  4F3Q A;  3K4C A;  5D6F A;  1FNN A;  1MMS A;  1E3P A;  3V4G A;  3HRT A;  3H5R A;  4OU0 A;  4KUM A;  4LG3 A;  3RDI A;  2RVC A;  2WV1 A;  3E3V A;  1FTT A;  2QKM B;  3SDG A;  3VPR A;  1R5G A;  4OMZ A;  2QWW A;  2L7F P;  2L3D A;  5HLG A;  2GXB A;  1YS7 A;  5M3F J;  2MC4 A;  5ERI A;  3E6D A;  3BP8 A;  1YIT I;  4OOI A;  3V7R A;  1LNW A;  1YTY A;  2Z1D A;  2DTZ A;  3N05 A;  4I99 C;  1HKT A;  4G8X A;  2VBY A;  3LFU A;  2Y9Z A;  2GIV A;  5A2Q K;  4KDP A;  2ZNY A;  2MA3 A;  5AIP A;  4RB0 A;  4WX9 A;  3OR1 C;  3OS1 A;  5CVJ A;  2OF7 A;  4GCV A;  5K5R A;  4UB8 C;  3BG5 A;  2M2E A;  3BR1 A;  3TDZ C;  1JUS A;  1SVL A;  1FOW A;  3OWT A;  2VQG A;  2X6X A;  5J47 A;  4B3A A;  1GXQ A;  2WY8 Q;  2COB A;  3CDH A;  4BKX A;  1U5T A;  3NWT A;  1ZG1 A;  2BGC A;  5DUI A;  2UZK A;  3K69 A;  3DTE A;  5ED4 A;  2ZXH A;  4Z2Y A;  1MMG A;  2ZME C;  3CCQ I;  1D3Y A;  2PBI A;  2CQQ A;  2VE8 A;  3S2D J;  5LGN A;  3K4M A;  2F5C A;  4D1Q A;  4I01 A;  5FRM A;  4WCG A;  5FKM A;  3OYK A;  2HZD A;  2ISZ A;  3FXK A;  3A0H C;  5KK1 A;  1YIO A;  4CYC A;  4Q4Z F;  4A93 J;  1CF7 B;  1E3O C;  2KHM A;  2DPU A;  2ZB9 A;  3TW6 A;  1SAN A;  4B8X A;  4YEJ A;  3T1B A;  3LNQ A;  2PMZ A;  2OCC H;  1OYI A;  1X1C A;  4RB3 C;  1D8K A;  2KJC A;  4I0A A;  1IG7 A;  1QVU A;  2C6Y A;  2MW8 A;  1XDU A;  5KVR A;  5HLH A;  2H6B A;  5EZH A;  1PVE A;  2FNA A;  2V1D A;  1W0U A;  3GFM A;  1X3Z B;  3ML6 A;  4EEF G;  2Y31 A;  5ICF A;  2DXI A;  3F72 A;  4XKV A;  2V1U A;  2Y0S A;  2AO9 A;  2ZJQ F;  2RN7 A;  1HCR A;  3BZC A;  1DGR M;  2YPR A;  4AWX B;  2DJN A;  4L0Y B;  1XC5 A;  2LY2 A;  1K6O A;  2W24 A;  1IC8 A;  2MAB A;  3I58 A;  1TNS A;  2WAQ A;  1GV2 A;  1ZQ3 P;  4NC6 A;  2CW7 A;  2CSO A;  2M4G A;  2CWE A;  3H3U A;  3PFI A;  3GWZ A;  2GLO A;  1LKX A;  1F9N A;  2DW4 A;  4HA8 A;  3WHC A;  3HOZ J;  3DV8 A;  4BJ5 C;  4QIW N;  3JRH A;  3J7Y J;  1KU9 A;  3J7A Y;  4G12 A;  5FB2 A;  3IV5 A;  1J2X A;  2MLK A;  3CUQ A;  3I56 I;  1EKE A;  3T8T A;  4II3 A;  1YE9 A;  1YW9 A;  2M3A A;  3GTQ J;  2LKS A;  2BY2 A;  2LC2 A;  1J9I A;  2VKH A;  2VJJ A;  3SZP A;  4QPO A;  1ODD A;  3MZH A;  1YQA A;  2GIZ A;  5GPA A;  1YX3 A;  4IF4 A;  2NOJ B;  3OOU A;  5C44 J;  2NVT J;  3KCC A;  3J80 K;  4CGZ A;  2CO5 A;  4MTD A;  3CDI A;  2UV1 A;  5HS9 A;  1YW7 A;  1T0F A;  5JLW A;  1AHD P;  2VOO A;  3F21 A;  1RES A;  3BOQ A;  2ID3 A;  3HEF A;  4LD5 A;  1MND A;  3TDU C;  1O3S A;  1XGM A;  2E34 A;  4QLC U;  1D5Y A;  4M3E A;  3CZ6 A;  3JRG A;  1U5T C;  2M34 A;  4UVA A;  3M3Y J;  1E0E A;  1U0J A;  2V9K A;  1PUF A;  5F08 A;  3E7L A;  4BS9 A;  4V19 K;  1B1B A;  1FSE A;  4EJW A;  2X85 A;  1X58 A;  3I64 A;  3VOD A;  1LJ9 A;  2HDW A;  2F5F A;  4M3B A;  3ZMU A;  4XKB A;  2Y75 A;  2E1M B;  3KP4 A;  3LMM A;  3BZK A;  5IT3 A;  1DUX C;  3JAM Z;  1WHU A;  2QUF A;  1MBE A;  2DJI A;  3BCB A;  4ESF A;  1A6Q A;  1G3W A;  3RKX A;  3LA7 A;  2R7Q A;  4FX0 A;  4XIC A;  1WWX A;  2GA2 A;  3A1Y A;  3I53 A;  3ABK H;  1G3T A;  1OQY A;  2KLO A;  2YR2 A;  3J81 Z;  3FXJ A;  1APL C;  2X9D A;  2KRH A;  2DA5 A;  4HZF A;  5L3C A;  4U7D A;  3ISP A;  2PJR B;  1BC8 C;  3CES A;  2Y48 A;  1Y1V J;  1BR4 A;  2DN0 A;  3MFK A;  2XC7 A;  2WAF A;  2IAI A;  3VOE A;  2EIN H;  1D5V A;  3SYT A;  2CFO A;  3F0C A;  3AL0 B;  1QBJ A;  1R58 A;  1W1W E;  1WQ2 A;  3S1Q J;  3IKT A;  1LEA A;  1QO0 D;  3OIQ A;  3KEY A;  3WTZ A;  1FIA A;  2OU2 A;  4G6Q A;  4HNT A;  1ZN2 A;  4RM2 A;  3UKG A;  4BBS J;  1IRG A;  2JT1 A;  3O8H A;  1TTY A;  3B6C A;  4DYR A;  2OCE A;  2QSF X;  1R1U A;  3OIO A;  5IY5 H;  1OCR H;  3L1P A;  2V9P A;  3S1N J;  4RAZ A;  1FMW A;  3GFJ A;  3FM5 A;  3WG7 H;  2DT7 B;  3KX2 A;  1GHC A;  3LSG A;  3K4L A;  3S2W A;  2GM4 A;  4LB5 A;  1ZKG A;  2IS2 A;  1CQT A;  2B9S A;  1LEB A;  3RQI A;  1CGP A;  3DKW A;  3ESW B;  3E6M A;  5HNF A;  3R60 A;  3BG9 A;  3K1M A;  2KFD A;  3X2Q H;  1TP4 A;  3BR3 A;  5CYV A;  1TWF J;  2VBW A;  3MWM A;  3HRU A;  4NC8 A;  1O3T A;  1DU0 A;  3ULQ B;  5JLX A;  5FFX A;  4L9J A;  1OJL A;  2LG4 A;  1EH7 A;  2HVS A;  2VQC A;  1TBX A;  4NUB A;  2VIX A;  5E20 A;  2IPQ X;  5D6E A;  1B4A A;  4B43 A;  2X0L A;  1H9T A;  5GPC A;  4NDL A;  4IHV A;  3AFH A;  2F6C A;  2K85 A;  4A3B J;  1K79 A;  1HQC A;  2EWN A;  3LSJ A;  3OYH A;  3HIF A;  1T0F C;  2QSG X;  4AID A;  4HDU A;  3GX4 X;  1R1T A;  2W48 A;  1Z05 A;  3BTI A;  3CLQ A;  1YRN B;  1Y56 A;  2B0L A;  1YO5 C;  2MGQ A;  2ZJ2 A;  2ELH A;  3M8E A;  3A02 A;  3FXO A;  3TBI A;  5GTI C;  3WTY C;  4IRG A;  2BVL A;  5CJ9 A;  3L2C A;  2XIG A;  2IEK A;  1RUN A;  3GO5 A;  3BTJ A;  1WH7 A;  2VXD A;  3NWS A;  1ZR2 A;  5IT9 Z;  2XB0 X;  3ABT A;  2LR8 A;  1LDD A;  2JJ7 A;  1MBH A;  2KKO A;  1R36 A;  2VLA A;  4N9H A;  1T08 B;  1ZRE A;  4X6A J;  1N77 A;  1MGT A;  5E3L A;  3PNY A;  3KET A;  3PUB A;  2AQF A;  3M9A A;  4U87 A;  1SFE A;  3HGY A;  4RA2 A;  1RKW A;  4UNO A;  1B9M A;  1KQ8 A;  2KJB A;  1N78 A;  1XMK A;  3QOP A;  3HC7 A;  2PMZ N;  1OCT C;  2VB6 A;  4DBR A;  2WWY A;  2Z3Y A;  3V8K A;  5GAD J;  1VQL I;  1D0X A;  3AKZ A;  1VQP I;  3HRS A;  4D7M A;  4QTR A;  4LMY A;  1ETY A;  3W3C A;  5EEG A;  2G7H A;  3R0A A;  5B66 C;  1WKM A;  4E7S A;  3W6V A;  2K40 A;  1I5Z A;  2UXN A;  3I3L A;  3TP3 A;  4M73 A;  5CLS A;  1H9G A;  5E18 F;  3EUH A;  3VB2 A;  1B6A A;  3O2P E;  1TT0 A;  2Y0S N;  3WGI A;  4XNF A;  2N8G A;  5HLT A;  2V6C A;  1OCZ H;  2HXO A;  1LVK A;  2LY9 A;  2WAQ N;  4ZZL A;  3OYG A;  2LD5 A;  1KQ9 A;  1KYZ A;  3R61 A;  4D9J A;  3QPL A;  1I1S A;  1YG2 A;  2EIL H;  1GDT A;  4DZP A;  3JCU C;  4ZYG A;  4R8H A;  1BR2 A;  2FU4 A;  1R49 A;  5CQE A;  2V1N A;  4ZJZ A;  1XCV A;  1X3U A;  4EGY A;  1TWG J;  3D5S C;  3ZOB A;  4P1W A;  2J5P A;  3CMY A;  2V26 A;  2GXG A;  1F36 A;  1FP2 A;  3CJQ B;  3WGH A;  5CVV A;  5EGO A;  2XPV A;  2VPL A;  3GTG J;  4LIU A;  4NC7 A;  1G2H A;  1BI2 A;  3DBH B;  2K4B A;  2HQ5 A;  4QPQ A;  3ROU A;  1S5L C;  2B7E A;  3JRB A;  3ONQ A;  5EEH A;  1WI3 A;  2XAH A;  2FNP A;  3A4C A;  1BI3 A;  1JT0 A;  1W0T A;  3HJE A;  1VZ0 A;  5GTH C;  5IYB J;  5CKT A;  3CP8 A;  2OA4 A;  3MVP A;  1WJ5 A;  2F4I A;  5FKL A;  1OR7 A;  5FRO A;  4A0X A;  4C9Y A;  5J1R A;  1YJ9 I;  3EDP A;  1FY7 A;  3GFL A;  4BBR J;  2DI3 A;  4CHU A;  3BR6 A;  2UUZ A;  3G1L A;  2WB1 N;  1YW8 A;  1MD0 A;  1T6S A;  3NRV A;  3S93 A;  3QYB A;  3PJR A;  2R93 J;  2XAU A;  2XVC A;  2L5Q A;  1UHM A;  3HZJ A;  3L2V A;  1O4X A;  4IVN A;  3ASN H;  4ENJ A;  3C2B A;  3LQQ A;  5H6R A;  2ZXI A;  1Z3Y A;  1MIJ A;  2EV5 A;  3REO A;  3EET A;  2CV1 A;  2IGN A;  1AA7 A;  3K1P A;  4RAG A;  5D5W B;  1ZK8 A;  4AYB A;  1LFB A;  2DPD A;  2JSC A;  4A3L J;  2STW A;  2P6S A;  1UB9 A;  1I1G A;  1FPQ A;  4KFC A;  1HST A;  3ZMZ A;  1TWC J;  2R5Z B;  3A2K A;  4UY8 I;  3E5X A;  3IRR A;  4G7Z F;  2VAS A;  4KT6 A;  3U21 A;  2NVQ J;  5ICE A;  2K3P A;  1Y8Q B;  2QQ9 A;  5E8G A;  1Q1V A;  3F8M A;  1QNT A;  3GZN B;  1M1E B;  5M3M J;  2I8D A;  1V54 H;  3CQZ J;  4IJA A;  1ZGA A;  2JN6 A;  5FLX Z;  1MSF C;  2OTL I;  1VQ9 I;  1UHW A;  1I3Q J;  4BXX J;  3I59 A;  3UNG C;  2Z9O A;  2P7C B;  1NG7 A;  2QZ8 A;  2LH9 A;  1R22 A;  1P4W A;  2ISY A;  3ZP5 A;  4XBF A;  1QHG A;  1P2F A;  1OYW A;  1LFP A;  2KPM A;  3BQY A;  3O6B B;  1RUO A;  1XMX A;  2L7Z A;  5LD2 C;  2BHY A;  3L00 A;  4LLG F;  1ZRF A;  2EH3 A;  2JRM A;  1GVD A;  4Y33 A;  4F92 B;  2FA5 A;  4IKF A;  3KE2 A;  3MMY B;  2X48 A;  2R7F A;  5TJJ A;  3AL0 C;  3K70 C;  4IXA A;  2XSJ C;  3W6K B;  4I02 A;  1KZH A;  4DIQ A;  1MDM A;  2BY1 A;  2KIF A;  5DYM A;  2R7D A;  3E5Q A;  4JP0 A;  4OIR F;  2ZSH B;  2IGM A;  2IVM A;  1O7L A;  3E0J B;  1S8N A;  3H9Q A;  2R7X A;  4JK1 X;  2YX7 A;  1ITY A;  3Q3S A;  5IP9 J;  3MKZ A;  2VT3 A;  3HG9 A;  2MG4 A;  1B72 A;  2LF8 A;  3CO6 C;  1W5C C;  2E1O A;  1S3J A;  5CVU A;  3ZQL A;  4A69 C;  4BAC A;  4ITV A;  2QEN A;  2EV6 A;  2OQR A;  4DW6 A;  1BW6 A;  2DMT A;  1YJN I;  4HX7 A;  1FYK A;  2TDX A;  2A07 F;  3J7Z I;  3KIO A;  3LA3 A;  3KZZ A;  2VKD A;  3ZMD A;  4YEL A;  4XK4 A;  1DQU A;  2CW0 F;  2YU9 J;  1QVT A;  1Y1W J;  1T39 A;  1ZG3 A;  2P4W A;  4X0G A;  3ZGK A;  4HV6 A;  1R5H A;  2GOX B;  2VKV A;  3BC8 A;  1P7I A;  2VL8 A;  4AVP A;  3B6A A;  1ZR4 A;  4MHG A;  3FXR A;  4GXO A;  4G7O F;  4A0Y A;  3M4O J;  2COM A;  3K4K A;  1PDN C;  2XF6 A;  1IN6 A;  2FEZ A;  5D5U B;  2BXZ A;  3BLY A;  2A6T A;  1FZP B;  2W00 A;  2BEO A;  4B44 A;  1G8X A;  4NNJ A;  2YU3 A;  2G7U A;  4AU7 A;  2CGP A;  1IN7 A;  1P92 A;  1A31 A;  3DPU A;  3BT9 A;  5HDK A;  2KT0 A;  4HX4 A;  4R79 A;  4X1E A;  3F23 A;  2ZKZ A;  3GLX A;  3RIR A;  2O3F A;  1S6L A;  4MEX F;  4XOR A;  1BOA A;  1QPI A;  2R92 J;  2HWV A;  3E5U A;  3KLN A;  4RLQ A;  4GFB A;  4AIJ A;  2EIM H;  2CFX A;  1YYV A;  2W4S A;  3WU1 B;  4GRI A;  2KZV A;  4RM3 A;  3I4P A;  3VYU B;  1JHH A;  1X4P A;  2EFQ A;  2P0W A;  1UAA A;  4KJZ A;  4JX6 A;  3D1N I;  3CC2 I;  4Q48 A;  4CCO A;  1LE8 B;  2ZME A;  1XN7 A;  1OMI A;  2K9N A;  3CCV I;  4P55 A;  3AG1 H;  5J8F A;  4PJN A;  4OIN F;  2MBF A;  5DS9 A;  3JSO A;  2KDZ A;  5H20 A;  1LUJ B;  5CQG A;  4ESJ A;  3L7W A;  3H36 A;  3TMO A;  1JHF A;  2E5N A;  4WXC A;  5LBQ A;  3H5N A;  3GFI A;  2JVH A;  5DCF A;  3KP7 A;  3I71 A;  3M7G A;  1RNL A;  2L9N A;  1T2K A;  2LSO A;  1DP7 P;  1Z67 A;  1W5S A;  1MNM C;  2CV0 A;  2R5Y B;  1ULY A;  1X4O A;  2X4H A;  2IP2 A;  4M74 A;  4YFK F;  4FTH A;  4E70 A;  5FGM A;  2VKE A;  4WWC A;  3PIO F;  3FXQ A;  2XDV A;  4IQ4 A;  2KIU A;  3LAP A;  2BVM A;  2MD0 A;  4A3F J;  1JT6 A;  4BNC A;  3ECO A;  3A01 A;  2HPM A;  2EZK A;  1BIA A;  1Z1D A;  2FUG 2;  1P7J A;  1U8B A;  3TGN A;  4NQW A;  2DMQ A;  1IGN A;  3HUG A;  3LSH A;  3LA2 A;  5J4Y A;  3KLO A;  3F9K A;  1KU2 A;  4EQQ A;  2FRH A;  1FBS A;  3BPX A;  3I5U A;  2E1N A;  5J4V A;  4BE2 A;  2KP6 A;  1SFK A;  3DQV C;  1P9Q C;  2HXI A;  4M3G A;  1Y0N A;  1K78 B;  1SD7 A;  5JVT A;  1YOV B;  2JUC A;  4BGD A;  2HYG D;  3RKY A;  3CME I;  1IN4 A;  5HS8 A;  2E35 A;  2IXS A;  1GXP A;  2L9V A;  4PSW A;  3IAS 2;  5H6Q A;  4ZYE A;  3S1R J;  3RJP A;  3FX3 A;  4ZDP A;  2PMU A;  3E6C C;  1VQO I;  3QOE A;  4HF2 A;  2IS4 A;  2W25 A;  1NK3 P;  1UG0 A;  2LOO A;  3K2Z A;  4EJO A; 
#chains in the Genus database with same CATH homology
 1B72 B;  1APL C;  2X9D A;  3FKI J;  2HI3 A;  2DA5 A;  2OPT A;  3CCY A;  2Y30 A;  2XGE A;  1Y1V J;  3FK6 A;  2DN0 A;  1K61 A;  1U78 A;  3NAU A;  1ZTR A;  1Z77 A;  1WGX A;  1UG2 A;  2DA3 A;  1GT0 C;  2DMP A;  1JKR C;  2IAI A;  3Q0W A;  3F0C A;  3WHB A;  3TED A;  4A3C J;  2DA6 A;  4IHW A;  3S1Q J;  4FE4 A;  2FD5 A;  1I50 J;  1HF0 A;  1FIA A;  1JKQ C;  3A03 A;  3UKG A;  4BBS J;  3O8H A;  4DYR A;  3B6C A;  3JR9 A;  1IDZ A;  3HOW J;  2LKX A;  3OIO A;  4AUX A;  5J1U A;  3L1P A;  3S1N J;  1RET A;  2ID6 A;  5GP9 A;  3LSG A;  2CJJ A;  2GM4 A;  1ZKG A;  1UHS A;  1CQT A;  3QQA A;  3RQI A;  1MBG A;  1WH5 A;  1OCP A;  3BG9 A;  4AC0 A;  2EQR A;  1VND A;  3PO3 J;  2K9S A;  1RPW A;  1WPK A;  3BR3 A;  3MKL A;  1TWF J;  3ZQF A;  1ETV A;  2Y9Y A;  1DU0 A;  1BA5 A;  1U9O A;  2LK2 A;  3HBL A;  5JLX A;  5M5Y J;  1MBK A;  2R5Z A;  1MBF A;  1OJL A;  3JRC A;  4IHY A;  3HOX J;  1HLV A;  3PO2 J;  5GPC A;  2LP0 A;  4NDL A;  4IHV A;  5IP6 A;  4A3B J;  2XPU A;  4UUT A;  3LSJ A;  3HM5 A;  3I4M J;  2VPR A;  2W48 A;  1Z0X A;  4XRS A;  3IH3 A;  4Y52 J;  3BTI A;  1YRN B;  2MGQ A;  2CUF A;  5IOZ A;  3S2H J;  1IDY A;  3A02 A;  2R5Y A;  1VFC A;  1XS9 A;  2IEK A;  2XGD A;  4D5C A;  3FIS A;  2FX0 A;  3BTJ A;  1WH7 A;  2HOA A;  4FE7 A;  4FCY A;  2H8R A;  1ZR2 A;  2VUM J;  4M3F A;  2ECB A;  2CUE A;  2XB0 X;  2LR8 A;  3H3V K;  4W97 A;  2JJ7 A;  1MBH A;  2D5V A;  2DA1 A;  2JK3 A;  4C2M J;  2YUS A;  2R0Q C;  2M9H A;  4A3K J;  3S15 J;  4X6A J;  1H88 C;  5E3L A;  1A6I A;  4J19 A;  3GTL J;  2E2H J;  1BJZ A;  1H89 C;  5BNG A;  3RZO J;  4L5E A;  3G1M A;  5F0C A;  3HGY A;  5EG0 B;  3BR2 A;  1RKW A;  4QSH A;  3SJM A;  3BR5 A;  2PMZ N;  5EF6 A;  1OCT C;  3A01 B;  2EZI A;  2JMW A;  1JTX A;  4AYB N;  4A3D J;  3ZQG A;  4D7M A;  4QTR A;  1ETY A;  3MN2 A;  4BY1 J;  1T33 A;  3IH4 A;  5E3O A;  1EF4 A;  3K7A J;  3W6V A;  2K40 A;  1ETO A;  2EZL A;  3TP3 A;  2AHQ A;  3HB9 A;  5F0H A;  1ZGW A;  1LFU P;  2Y0S N;  2HOT A;  2N8G A;  4RDU A;  2M8G X;  1PUF B;  1IRZ A;  2HXO A;  4BY7 J;  5E3M A;  1MH4 A;  2ME6 A;  2NS8 A;  2DA7 A;  5IP7 J;  3ZQH A;  2LY9 A;  2WAQ N;  2LD5 A;  1GV5 A;  3BG3 A;  4DYC A;  3HDD A;  3QPL A;  1GDT A;  1FIP A;  2IBD A;  4C3I J;  4S0H B;  4DZP A;  2EZH A;  4XRS G;  2Y2Z A;  4JX4 A;  5K7Z A;  1TWG J;  3LSP A;  3ZOB A;  3CMY A;  4JX5 A;  2LFB A;  1F36 A;  5EGO A;  2XPV A;  1JJ6 C;  3GTG J;  3GTK J;  3BTL A;  1G2H A;  3LOC A;  3JRA A;  3ZQC A;  2JA5 J;  2JWT A;  1HDP A;  2DA2 A;  2HQ5 A;  3JRB A;  5FLV A;  1B8I A;  2ME0 A;  1ETK A;  5FJ8 J;  2L9R A;  1WI3 A;  4HNV A;  1NK2 P;  2P81 A;  1JT0 A;  1W0T A;  2LLK A;  1TWH J;  1F43 A;  5EZG A;  5IYB J;  2XGC A;  3MVP A;  5FKL A;  4FIS A;  5J1R A;  4BBR J;  3BR6 A;  1TWA J;  3QPS A;  3G1L A;  2WB1 N;  4Y7N J;  1BW5 A;  2G0E A;  3FIW A;  1IUF A;  2H1K A;  4CYC B;  2R93 J;  4B1R A;  1O4X A;  3IH2 A;  1IV6 A;  5IPA A;  5M5W J;  1LE8 A;  1JUP A;  1ENH A;  3C2B A;  1QRY A;  2FJ1 A;  4V2G A;  4IEJ A;  3CDL A;  1ZK8 A;  3GTP J;  2O8K A;  1HOM A;  1RKT A;  4A3G J;  1LFB A;  5F27 A;  3JRI A;  5C3E J;  2XSD C;  4A3L J;  2YS9 A;  2QCO A;  1FEX A;  1TWC J;  2R5Z B;  2I10 A;  2TCT A;  4C3J J;  1ETW A;  2NVQ J;  1BL0 A;  3ZQI A;  1Q1V A;  2FQ4 A;  1HDD C;  5M3M J;  3CQZ J;  5HOD A;  2JN6 A;  3JRF A;  4B4C A;  1MSF C;  2R7Z J;  4MIM A;  2L0K A;  1A5J A;  1I3Q J;  2NOG A;  4BXX J;  1ETX A;  5IYC J;  3O8G A;  4MFE A;  2NS7 A;  4M3D A;  1OFC X;  1VF9 A;  2X6O A;  3GTM J;  9ANT A;  4A3E J;  4UUS B;  4JYK A;  2HDD A;  5K7F A;  3BQY A;  5C4X J;  4DYQ A;  5E3N A;  3S17 J;  2ECC A;  2L7Z A;  2ELK A;  3DCF A;  2VI6 A;  5EG0 A;  1FTZ A;  3HOU J;  2EH3 A;  3I4N J;  1GVD A;  5J1Y A;  1VI0 A;  2X48 A;  3FK7 A;  1MH3 A;  1POG A;  3JRE A;  2O9L A;  1X2N A;  2XB5 A;  3DEW A;  1RR7 A;  2WV1 A;  4DZJ A;  3RKQ A;  1FTT A;  3SDG A;  3VPR A;  1U9N A;  1JUM A;  4JP0 A;  1R9T J;  1ORK A;  2XPW A;  2L7F P;  1MBJ A;  1TC3 C;  1AKH B;  1JKP C;  1XG1 A;  2NVX J;  3S1M J;  1ITY A;  3Q3S A;  4MFD A;  5IP9 J;  5M3F J;  1FJL A;  2MG4 A;  1NTC A;  1B72 A;  2E2J J;  2E1O A;  3K2A A;  4V2F A;  4LOC A;  2DTZ A;  3ZQL A;  4A69 C;  1H8A C;  2MSY A;  4DW6 A;  2Y9Z A;  5C4J J;  1BW6 A;  5EDN A;  5FKK A;  2DMT A;  3HOV J;  3NAR A;  3PM1 A;  3Q0U A;  2CRG A;  2OF7 A;  4XK4 A;  3BG5 A;  3HOY J;  2DMU A;  2M2E A;  3BR1 A;  3H0G J;  1JUS A;  1T56 A;  1QVT A;  1Y1W J;  2YU9 J;  3OSF A;  4MO7 A;  4C3H J;  1MSE C;  4B3A A;  2COB A;  2DA4 A;  2LTP A;  4BKX A;  2VKV A;  2B63 J;  1P7I A;  2K9Q A;  1AU7 A;  3B6A A;  1ZR4 A;  3M4O J;  3G1O A;  4XRM A;  1GUU A;  3GBG A;  2CQQ A;  2RAE A;  3S2D J;  3LSR A;  5EGO B;  5FKM A;  4W1U A;  4A3I J;  5M5X J;  3Q0V A;  3BT9 A;  2KT0 A;  4CYC A;  1JGG A;  4A93 J;  4X1E A;  1B8I B;  1WCM J;  1E3O C;  2ZB9 A;  3TW6 A;  4IHX A;  1SAN A;  3LNQ A;  3HGG A;  2L7M P;  2LVS A;  1QPI A;  2R92 J;  2E19 A;  4GFB A;  1IG7 A;  1QVU A;  2MW8 A;  4A3M J;  4D5F A;  5EZH A;  1W0U A;  1YRN A;  1K83 J;  4JX6 A;  3D1N I;  4EEF G;  2TRT A;  2JA8 J;  2Y31 A;  1DU6 A;  1LE8 B;  3TP0 A;  2JA7 J;  4RBO A;  2K9N A;  2AO9 A;  1HCR A;  4I6Z A;  1JJ8 C;  1ETQ A;  3HKZ N;  5DS9 A;  2O7O A;  2M0C A;  2GBY A;  2KDZ A;  2DJN A;  3BR0 A;  1XC5 A;  3GTJ J;  5IYD J;  1IC8 A;  1GV2 A;  1SFO J;  4I76 A;  1ZQ3 P;  3GTO J;  2CU7 A;  1S7E A;  3S16 J;  2GLO A;  3WHC A;  3BQZ A;  3HOZ J;  4QIW N;  5F1J A;  3JRH A;  2R5Y B;  1MNM C;  4G12 A;  3IV5 A;  4UUS A;  4FTH A;  4A3J J;  2VKE A;  5EEA A;  4ABZ A;  2E2I J;  3GTQ J;  1JKO C;  1JTY A;  4A3F J;  1JT6 A;  2NVY J;  2DMN A;  3A01 A;  2CQX A;  5GPA A;  2EZK A;  3OOU A;  5C44 J;  2NVT J;  5FKN A;  1P7J A;  3RZD J;  1U8B A;  3S14 J;  2DMQ A;  1IGN A;  1I6H J;  3SFI A;  5JLW A;  5J3L A;  1AHD P;  1RES A;  1X2M A;  2ID3 A;  5FLM J;  3HEF A;  2JA6 J;  3BTC A;  5F04 A;  1D5Y A;  4M3E A;  1AKH A;  3JRG A;  2M34 A;  3M3Y J;  2HXI A;  1IJW C;  5FKO A;  5EYR A;  4M3G A;  5K7H A;  1PUF A;  5F08 A;  3E7L A;  2HYJ A;  4XID A;  2XRL A;  4MLO A;  1X58 A;  2QF7 A;  4M3B A;  2HOS A;  1UMQ A;  3JRD A;  4M6V A;  5F0F A;  5IOY A;  2EBI A;  3S1R J;  1MBE A;  4D7N A;  1NK3 P;  3TW7 A;  4XIC A;  5DTD A;  3OSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...