2B63J

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
molecule keywords 31-MER
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2b63J00
1A6IA 3TP3A 5IPAA 3QQAA 1RETA 5DS9A 4XIDA 3LSGA 5EG0B 4DYCA 4Y7NJ 3OSGA 1IJWC 1GDTA 3LSRA 4JYKA 5JLWA 5J1UA 4FCYA 4Y52J 2ECCA 3SJMA 4ABZA 4CYCB 1K61A 4A3CJ 2L0KA 2ZB9A 3JRIA 5IOZA 2B63J 2N8GA 4A3FJ 2VKVA 1OCPA 5GP9A 2DMNA 2MSYA 1MSEC 2COBA 4JX4A 2IEKA 1PUFA 1MBGA 2DTZA 2HOSA 2HOTA 3HB9A 1FTZA 1AKHA 2K9NA 1U8BA 1B72B 1BW6A 4QIWN 2VUMJ 2LKXA 3BR5A 5IYCJ 1OFCX 5F0HA 4C3JJ 3NAUA 4A69C 1ORKA 1SANA 4JX6A 1ZQ3P 4C3IJ 1WCMJ 2YU9J 2FD5A 3GTGJ 1FTTA 5IYBJ 5BNGA 2M2EA 2DA3A 1ZKGA 1S7EA 1IG7A 4EEFG 3LOCA 1NTCA 4AC0A 3S1NJ 2O7OA 2L7FP 3BT9A 5FLMJ 1RKTA 2AHQA 2E2JJ 2YS9A 2IAIA 3A03A 5IP7J 4MFEA 4V2GA 2HDDA 1JKRC 1YRNA 5C4JJ 5EZHA 1QVUA 2RAEA 4MFDA 4BY7J 4CYCA 1XS9A 3TW7A 3B6CA 4XRSG 3BR3A 4IHXA 5M3MJ 3I4NJ 4A3GJ 4A3KJ 3BR2A 2WV1A 3GTMJ 3F0CA 1APLC 2XB0X 3PO3J 3RZDJ 5J1YA 2P81A 4M3BA 1RPWA 2G0EA 1MBKA 3IH3A 2O8KA 3MN2A 2WAQN 2JWTA 1ITYA 3UKGA 1FJLA 2GLOA 2Y31A 1NK2P 1W0UA 1HDDC 2DA5A 4W97A 1W0TA 3S16J 3BTIA 5EGOB 5EZGA 2L7MP 2JK3A 3GTLJ 2DJNA 1TWGJ 2H8RA 3HBLA 2Y0SN 3HOUJ 1LFUP 1DU0A 1MH4A 2ME6A 4D5FA 1ETYA 2LR8A 1X58A 3S2DJ 1HF0A 1Y1WJ 2R0QC 3DCFA 1FIAA 3ZQHA 1VI0A 2PMZN 1GV5A 3ZQGA 5FKLA 5IOYA 5GPAA 5C44J 1JKOC 4RDUA 2JA5J 2M0CA 5FLVA 3B6AA 9ANTA 2CUFA 1QPIA 2R5YB 2L9RA 5E3MA 2HQ5A 3CQZJ 3GTPJ 1I3QJ 4V2FA 2E2IJ 1JJ6C 1DU6A 2X48A 3BTJA 5FKKA 3DEWA 3BG9A 3BTCA 1Z0XA 3HGGA 2NOGA 2NVQJ 1OJLA 4M3EA 2KDZA 2EQRA 1WI3A 4FTHA 1WH7A 2MG4A 2JJ7A 5E3LA 1G2HA 1HCRA 4DYRA 3OIOA 4AUXA 5EGOA 3HOZJ 3GBGA 1ETOA 5FKNA 3H0GJ 4JX5A 2JA7J 4MO7A 3L1PA 1U78A 5EF6A 5C4XJ 2VKEA 2CUEA 2EZLA 1AU7A 3E7LA 1TWAJ 5EEAA 2EZHA 3WHBA 2XPUA 3HM5A 3HEFA 3SDGA 4NDLA 1R9TJ 1RR7A 5JLXA 2JA8J 4M3GA 1U9OA 3I4MJ 2QCOA 2Y2ZA 1IDZA 4MLOA 3A01A 3FK6A 4A3MJ 1IC8A 1JT0A 1HLVA 2R92J 2AO9A 1TWCJ 3GTQJ 1AKHB 1B72A 1WPKA 4D7MA 2VPRA 1JUSA 5J3LA 2R5YA 2MW8A 2FJ1A 4XRMA 1ENHA 3IH4A 1QVTA 4GFBA 4IHWA 3S17J 1MBHA 2WB1N 5IP6A 3FIWA 1ETXA 3HKZN 4G12A 4D5CA 4XICA 3MVPA 5M5YJ 3HDDA 1TWFJ 2YUSA 5HODA 3A02A 3Q3SA 3M4OJ 1POGA 5K7HA 5C3EJ 1BA5A 1IUFA 2E1OA 4D7NA 5F1JA 3S1QJ 4X6AJ 5EYRA 3IV5A 2CJJA 2LTPA 1TC3C 3HOWJ 4HNVA 1F36A 2DN0A 3QPLA 2D5VA 3GTKJ 1HOMA 1IDYA 1WGXA 1ETKA 2H1KA 2CQXA 3IH2A 3ZQIA 3Q0WA 3BR1A 2KT0A 1O4XA 4RBOA 2M8GX 3JRAA 3JR9A 4J19A 1JTXA 1P7IA 3VPRA 1H89C 4C3HJ 4IHVA 5E3OA 4BXXJ 3ZQCA 3S14J 3JRCA 2M9HA 4BBSJ 3HGYA 2R5ZA 1LFBA 2DMTA 2CQQA 3G1MA 2R7ZJ 2MGQA 5F0CA 3OSFA 3FISA 3K2AA 1JUMA 5FJ8J 2HXIA 1MNMC 3JRBA 5DTDA 3CMYA 3NARA 3BTLA 4UUTA 1P7JA 2HOAA 1HDPA 2LP0A 2ECBA 3BR0A 2DA7A 2CRGA 4BBRJ 3PO2J 1WH5A 3S2HJ 2NVYJ 4M6VA 3CDLA 2JN6A 2FQ4A 2EZIA 3M3YJ 5F0FA 3JRHA 1JUPA 2LFBA 3H3VK 1A5JA 5K7ZA 2TRTA 3C2BA 3TP0A 5FKMA 1ETWA 1D5YA 1GV2A 5M5WJ 2O9LA 4B4CA 2ID3A 4W1UA 3G1LA 2XPWA 2ME0A 3RKQA 2CU7A 3JRDA 3HOYJ 3O8HA 4QSHA 1Y1VJ 2NS7A 1GVDA 3BG3A 3JREA 1UHSA 1RKWA 2XPVA 1GUUA 2Y30A 4DW6A 3D1NI 1JT6A 2E19A 4M3FA 3GTJJ 1ETQA 1ZTRA 1OCTC 3HOXJ 1VFCA 4FE4A 1FEXA 2DMQA 3S15J 1B8IA 1I6HJ 4A3DJ 2JA6J 2DA2A 1MH3A 5F08A 5M5XJ 1SFOJ 3MKLA 4JP0A 5K7FA 2K40A 4LOCA 3ZQFA 5IP9J 1K83J 5GPCA 2W48A 2LY9A 1LE8B 3ZOBA 3LSJA 1ZR2A 3BG5A 4M3DA 2ID6A 1AHDP 4FE7A 1MBEA 3CCYA 5J1RA 4UUSB 3BR6A 4IHYA 2OF7A 2XGDA 1H8AC 2X9DA 2HYJA 4QTRA 1JTYA 2LVSA 1X2MA 4DZJA 4A93J 1E3OC 3HOVJ 1BW5A 4A3BJ 1MBFA 2XGEA 2GM4A 2VI6A 3A01B 3RQIA 2XRLA 1NK3P 3FKIJ 1YRNB 2NS8A 4BKXA 2LK2A 4L5EA 1IGNA 2DMPA 3O8GA 3Q0UA 1UMQA 3WHCA 4DZPA 4C2MJ 1BL0A 4BY1J 2DA6A 2HI3A 1VNDA 2XGCA 1ETVA 3TW6A 2X6OA 1XC5A 1GT0C 2FX0A 3PM1A 1MBJA 2JMWA 2K9SA 2LLKA 4B1RA 4A3JJ 2NVTJ 1I50J 3K7AJ 3S1MJ 1IRZA 1ZGWA 3RZOJ 2LD5A 2XB5A 4MIMA 5IYDJ 2QF7A 1B8IB 1Q1VA 2K9QA 4B3AA 1ZR4A 2E2HJ 1JKPC 4DYQA 3TEDA 5EG0A 1TWHJ 1LE8A 2Y9ZA 4A3LJ 1T33A 3S1RJ 1BJZA 1CQTA 1QRYA 3JRFA 2EH3A 4FISA 3SFIA 4UUSA 1ZK8A 2EBIA 3BQYA 1Z77A 1X2NA 1VF9A 2TCTA 5M3FJ 5F04A 4S0HB 2I10A 2EZKA 4IEJA 5E3NA 4XRSA 5FKOA 1JGGA 1PUFB 2DMUA 3JRGA 2M34A 2ELKA 4AYBN 5EDNA 2R93J 2DA4A 3Q0VA 2R5ZB 3W6VA 1XG1A 1UG2A 3QPSA 3FK7A 5F27A 4A3IJ 4A3EJ 2NVXJ 1EF4A 2DA1A 1FIPA 3GTOJ 4I6ZA 3LSPA 1T56A 1IV6A 3BQZA 2IBDA 1F43A 2HXOA 2OPTA 3G1OA 3LNQA 1RESA 3ZQLA 2XSDC 4XK4A 4I76A 2Y9YA 1JJ8C 4X1EA 1JKQC 1U9NA 1MSFC 3OOUA 2GBYA 1H88C 2L7ZA
chains in the Genus database with same CATH superfamily
2BGCA 3CCUI 1A6IA 2EINH 4ZTJA 3E3VA 6PAXA 4CCOA 1ERDA 1RETA 2PJRA 1HW5A 2XAFA 4DYCA 4XLAA 2R7VA 3PSIA 1FNNA 4F3QA 3PUBA 5JLWA 3CCRI 2ECCA 1IAWA 4XORA 3DEEA 4KDPA 5TISC 2VKVA 1SMYF 1OCPA 4KMUX 1X3UA 4DIQA 5A2QK 4HDUA 2GXAA 2XSJC 3G2BA 2BOLA 3OS1A 2FEZA 3MZ8A 3CUQA 1PUFA 1MBGA 1R00A 1ZRCA 2DO7A 3QPTA 1UB9A 1RC9A 3S3NA 2LRDA 1O7LA 3HB9A 4HZFA 3HG9A 3SQNA 2G7UA 2V4JC 1BW6A 2Y0SA 4RLFA 2QUFA 4QIWN 2LKXA 3E97A 5IYCJ 1OISA 1J75A 5DEQA 3WGHA 2PLYA 4XMYA 2WTEA 3PNVA 3L9FA 1SANA 1ZQ3P 3E1SA 1O3QA 3RDIA 3QOPA 1E2XA 1T6SA 1LB2A 2YU9J 2FD5A 4L5JA 2L9SA 4CCNA 3K1MA 2EFOA 5IYBJ 2FU4A 2M2EA 2DQLA 5K1YA 1ZGJA 2MD5A 1DGWY 4II2A 3S1NJ 4A0ZA 2XAHA 2ELJA 4M74A 4PK4A 2AXLA 4HSTA 4OMZA 5JI6A 1RKTA 4KIBA 1S6LA 2E2JJ 1ODDA 2OJED 1LUJB 2K9MA 4IRHA 3RQ4A 5HNHA 3FWEA 5DM7F 4G7HF 1KZHA 2R7FA 5IP7J 5GTHC 5ICEA 1JKRC 5C4JJ 1QVUA 2BVMA 4MFDA 2R7RA 2QKLB 4AIKA 1BN5A 2L01A 3F6VA 1V4RA 2E35A 3QAHA 5JFRA 4ZYGA 4BQAA 2BZTA 1OYYA 2F4MB 1MDMB 2X1DA 3K6GA 4PGHA 1APLC 3PO3J 4RAYA 1IRFA 2VXZA 2JVHA 2P5LC 3VDXA 2IGOA 1OMIA 4RLQA 5J1YA 5BOXA 3I54A 2ZC2A 2M7AA 1MBKA 4RA2A 5DCMB 3IH3A 3PIPF 2O8KA 5JHUA 2WAQN 4B43A 3BJOA 4RAFA 2JPBA 1FT9A 2JSCA 1SEUA 1PP7U 4EJTA 2JVGA 5K5RA 1HDDC 1X4OA 3FX3A 2WV0A 5EGOB 1Z91A 5EZGA 4IZZA 2K27A 3HOUJ 1TT0A 1LFUP 3SFZA 1RUNA 1DU0A 1W7PD 4EMSA 2DU9A 2KZVA 1YI2I 1P4WA 5HS9A 3UNGC 4D5FA 1ETYA 1FMWA 1Z05A 2IXSA 1G6NA 4XSZF 5H6RA 4IHTA 1FIAA 2UXNA 2FBKA 5E1ZB 1UFMA 2DAOA 2DI3A 5D5VB 4IQJA 5FKLA 3BJAA 2FBHA 4RDUA 5K5QA 4KN7X 2VPLA 1BIAA 4G6QA 5KAFC 5BPDA 2BXYA 9ANTA 4Z6YA 3IKTA 2Z33A 4I2OA 2ZSIB 2R5YB 1OLTA 3JAMZ 1FBQA 3BCBA 4CZZA 2HQ5A 1P4XA 2E2IJ 2BW3B 1JJ6C 2JPCA 3DBRB 3VYRB 4C9YA 4KJZA 4BXFA 2F5VA 3BG9A 5HLIA 4LB6B 2NOGA 3F8FA 2ZFWA 1OJLA 2W00A 4M3EA 1YJWI 4WXHA 3FXUA 3WU0A 4FTHA 3L2UA 2JJ7A 2RQQA 5E3LA 4HX7A 1HC8A 1T2KA 1Z3YA 2EV5A 3WTXC 4DYRA 1PJRA 4AUXA 1QHHD 2F4OB 1Y8QB 3FKJA 3RI4A 1IN6A 5EF6A 5LEJA 2VKEA 3RYPA 1ZN2A 2EZHA 1FBUA 2P7CB 3AFHA 4ON0A 3WTSC 1DGRM 2KJBA 3HTUA 3VYTB 3X2QH 2MLGA 2M45A 2BYVE 2VLAA 2JA8J 2EFWA 1TZLA 1A04A 1BI3A 3RKYA 4GDFA 3I4MJ 3CUQB 5HOOA 4EGZA 2JRMA 4PSXA 4A3MJ 3FK6A 1IDZA 4FASD 1EA3A 2DK8A 3BPXA 3FXMA 2AO9A 2OCEA 2D45A 4Y15A 1WHUA 3KCCA 2DYSH 4A6DA 1WPKA 4D7MA 2VPRA 3DLAA 1JUSA 2RC4A 1FP1D 4EJWA 2WB1N 3FIWA 1ETXA 3SXYA 3I71A 2KDOA 3H5AA 1FBSA 2JTVA 2VQLA 3SZPA 3BP8A 3Q3SA 3HKZA 1K78B 1P6RA 2H6BA 1FZPB 3GWZA 3I58A 4YELA 4IRGA 1R5HA 1BA5A 3OR2C 4BJTA 1IN5A 5EYRA 1C0WA 4ASNA 1MNEA 5HDNA 2IT0A 1F36A 2X6XA 1WGXA 1OKRA 4Y33A 2BHZA 1Y0NA 2CQXA 2HVQA 3DLLF 2CSOA 1FMVA 3H5RA 2Q2EB 3IH2A 3ZQIA 1LJ9A 4KIFA 3BR1A 3PIOF 2M8GX 1A6QA 4S04A 2EV6A 2IP2A 5D4SA 4YG2F 3HOTA 4J19A 2RGVA 3VPRA 1V5GA 2VASA 4Q48A 3VODA 4BXUA 2HS5A 4C3HJ 4DNCA 3F8CA 5FLXZ 4WK8F 3ZQCA 1I6XA 2W82A 3K9TA 4ZZLA 3JRCA 2M9HA 5FFZA 3VSLA 1PDNC 1UJ8A 1G3WA 3HGYA 2ZNYA 2RQPA 3G1MA 2R7ZJ 2MGQA 5F0CA 3E5UA 1ZAOA 2OC6A 2OTJI 2WC2A 2F5EA 2J5OA 2X1CA 4WCGA 3JRBA 3AKZA 3JSPA 2E71A 3DP7A 3BTLA 1G3TA 2HOAA 2XF7A 4UV9A 4BAYA 1I39A 2RDPA 3V7CA 1R5ID 3BR0A 3PO2J 4CH7A 1WH5A 2DFEA 1RNLA 2DW4A 3ZGKA 2R3SA 1D1AA 2HNHA 2FQ4A 2EZIA 5GTIC 2K02A 1FSEA 3JRHA 1T95A 3PQJA 2LFBA 1D8KA 4QWQA 4AD9A 1MMAA 2RN7A 1KU7A 2Y48A 3C2BA 4M6XA 3TP0A 1D0YA 1XCBA 4IKFA 1E17A 2ZMEC 3KE2A 4HSRA 1YX5A 3KP4A 1MZBA 1XN7A 2ID3A 2Z5UA 1BOBA 5LRSA 3N97A 2RVCA 5ILVA 2ME0A 1YITI 3AG1H 3RKQA 4FHTA 1R1TA 2LKPA 1U6GA 2W25A 5CVIA 1WJ5A 5HDGA 3GX4X 2W1OA 1YOVB 1GVDA 1CF7A 3E5QA 3JREA 1SFEA 5GADJ 2VC0A 4OU0A 1D5VA 1GUUA 3FBIB 3G73A 1LEBA 3LWFA 4C2UA 3ZQQA 1ZTRA 3TOAA 1OR7C 1FEXA 3F23A 3G6EI 1Z9CA 3S15J 1I6HJ 1S5LC 3DBHB 4E7SA 1XDUA 1MH3A 2K3FA 4LITA 4JP0A 2PMUA 5K7FA 4GO1A 3TGNA 2EB7A 1R36A 3OYDA 4ENKA 5FB2A 1I1GA 3FXRA 3LFKA 4UB8C 1IO2A 1ZR2A 4D1QA 4BNCA 1MBEA 4CHUA 4UHTA 5LRRA 2X85A 1U5TB 3E0JB 1HKTA 2OQGA 2OF7A 3WU1B 3OYAA 5E1WA 2LBFA 3T5XA 2PJPA 3K4NA 3PNYA 5D5UB 4A93J 4DZJA 1E3OC 1T8IA 1IF1A 2XGEA 4YIRX 3RQIA 1YG2A 2XRLA 3OYJA 3FKIJ 2CYYA 1YRNB 4BEHA 3V42A 4NNJA 1IGNA 3LQQA 2DMPA 2ISZA 1UMQA 4DZPA 5FROA 3KZIC 4P1WA 5IT9K 2GOMA 2JRTA 3IWZA 1BL0A 2GAUA 2DA6A 2HI3A 3CO6C 4UY8I 1VNDA 4BL0B 4I09A 1TTYA 1GT0C 2Z2SB 3DU6A 4H0EA 2FX0A 3U21A 2E1MB 3CCQI 2P5KA 1DUXC 3DTEA 5D5WB 1KA8A 1XSVA 3QU3A 4XOPA 2OU2A 1XPXA 1I50J 4LB5A 2W57A 3FM3A 3ZN1A 1IRZA 4MQVA 3TBIA 3OS0A 2OCCH 3EQLF 5IYDJ 2ZO4A 2HWVA 4G6DA 5B3SH 4IOAF 3LA3A 3GLLA 4IX7A 1ZR4A 4G6TB 3CO7C 1U2WA 1S7OA 3G3ZA 4I02A 3GW2A 3FDYA 3F3XA 2MD0A 2EK5A 4MEXF 4ZZDA 3E5XA 4A3LJ 3V8LA 2J5PA 1YO5C 3AAFA 3HTSB 4G94A 3JRFA 3FHZA 2EH3A 2EFPA 4J00A 1K6YA 2XV4S 3BQYA 3O6BB 3CJQB 4BDZA 2HDCA 1VF9A 5M3FJ 1VQ5I 2XROA 2I10A 2L4MA 2ESNA 5E3NA 5FKOA 4XRSA 3ABMH 4AWXB 1PUFB 2DMUA 4ZDOA 2M34A 1T0FA 3HPGA 1R4NB 3S3MA 4JK1X 4AYBN 2CWEA 2IW5A 4BHPA 4CYDA 1V5EA 3ZPLA 3FXKA 4NUBA 2HU9A 4DJAA 4OIOF 4IF4A 3J7AO 4XL9A 3TL4X 3ZMUA 3K4KA 3P9CA 4B8XA 2XRNA 1D1CA 2BE5F 5ED4A 4KT6A 5AONA 1H9TA 1IXRC 1FIPA 2OBPA 3GTOJ 1R71A 1X3WB 2H94A 1IV6A 2IBDA 2GWRA 4U7BA 4I01A 3ZQLA 2R7QA 1LEAA 2TDXA 4XK4A 1DP3A 1JKQC 2HGCA 2V1XA 5DM6F 2GXBA 3LSHA 2PQ8A 4L9NA 5KVRA 1GDTA 3BROA 2HQAA 3GXOA 2HPMA 2CV0A 4B44A 3TP3A 3HSFA 3QQAA 3T8RA 3BDDA 4RAZA 4LIUA 2RNGA 1ULYA 4PJJA 1QHGA 1YW9A 1IJWC 1NG7A 2K86A 3G4SI 2CGPA 2XAQA 3LSRA 4JYKA 1TNTA 4FCYA 2FF4A 4MTDA 4IHVA 3DPUA 4A3CJ 1WJCA 2L0KA 2DLLA 4WXDA 2B63J 2N8GA 1XMXA 2M8EA 2O5RA 2DMNA 1MGTA 5J8FA 1F5TA 5H6QA 4JX4A 5DD4A 2FNPA 4L9JA 4XKWA 2IEKA 3PUFA 4HA8A 1TP4A 2R7UA 3VSKA 2HOSA 3GLXA 3ERMA 1S72I 2M30A 3F6OA 2VT3A 2VJ5A 4UB6C 4JQFA 1FSHA 1XGNA 1EH8A 3VEPA 2V1DA 2A5YB 4O3MA 1HA8A 5IT9Z 3CESA 1L3LA 5F0HA 5EEHA 3E6CC 3HHHA 4C3IJ 1B9MA 2GA1A 2FOKA 1P92A 4HV6A 5AIQA 2FA5A 1WJEA 1S29A 3P9KA 1ZREA 4EEFG 3WE3A 3ZMSA 1KU2A 4FT8A 4AC0A 4BU2A 3GO5A 1MMNA 4TV7A 3U1DA 4E4HA 1G59A 2L3DA 3BT9A 2EIJH 3KPHA 1QZZA 2AHQA 4JBAA 3FZVA 2K9LA 3K4CA 4WXCA 3WTTC 4OAZA 1OCRH 1UHWA 2L54A 1TLHB 1XB4A 4LLNA 1YRNA 1W7PA 2RAEA 2RV8A 4CYCA 4HQMA 1BJAA 4LG0A 3TKYA 1XS9A 2QEXI 1FY7A 3CP8A 4IHXA 5M3MJ 3I4NJ 4A3GJ 2DPDA 2BW3A 1B9NA 3TQNA 1K6OA 1SD6A 2VE8A 4PCQA 2XB0X 4A6EA 2VONA 5ICCA 4XONA 3WGGA 5LEKA 3RZDJ 4LJZF 3ABTA 1MNDA 4EGYA 2P81A 2PBIA 1WJFA 5FO5A 2G0EA 2R7WA 2B7EA 1UHMA 2P4WA 5ERIA 3IHUA 1ITYA 2LC2A 2P6TA 2VQCA 2Y31A 1IW7F 1RRJA 1LFPA 1RIOH 1W5SA 4W97A 1SD5A 4OINF 3HHGA 3GTLJ 1TWGJ 2DJNA 2H8RA 3L00A 3HBLA 4KNYA 1T0FC 2VKDA 3PFIA 1ZLKA 1ZELA 1D8JA 2V9PA 2QLZA 1EV7A 1HF0A 3TMOA 1XGOA 5LBQA 1Y1WJ 3CC7I 2JT1A 3CCVI 2WB1A 3ZQHA 4RGUA 1VI0A 2PMZN 4CCKA 1X1PA 3NQOA 1S3JA 5C44J 2G7HA 1G4DA 2W7NA 1QZYA 5DUKA 2DOFA 5FD5A 3CLQA 3QU6A 2BY2A 3EUKL 3GTPJ 1FPQA 3QRFF 4GGGA 1OQYA 2X48A 1YHQI 1I5ZA 1Z0XA 3HGGA 4IXAA 3ZMZA 4BQNA 3JSOA 3MWMA 5CYVA 5B66C 1K78A 2DCEA 1BC7C 1WI3A 2CFOA 2ZJRF 2R7XA 3C2GA 3PQKA 3KETA 5E17F 1EKEA 1HCRA 2FRHA 4XSXF 3OIOA 5LHIA 4JOMA 4A5NA 4CSWA 3BZCA 3H3UA 4BE0A 1OCOH 2F48A 4DBQA 5KHDA 3VB2A 5C4XJ 2JA2A 3A1YA 3AG3H 5EEGA 2MABA 5EEAA 3COAC 2STWA 1YLFA 2XPUA 2IS2A 2VE9A 4NDLA 4BQQA 3J7ZI 1XDSA 2ESHA 2LSOA 2KRHA 4H4KC 1U9OA 3ESWB 4A0YA 2Y2ZA 1HBXG 3A01A 3OOPA 5CPRB 1TWCJ 4IJAA 3SZTA 4BEHB 1AOYA 2XGXA 3DEUA 5J3LA 2H09A 1OYIA 4IHWA 1R23A 1N75A 1W5TA 4G12A 1UZCA 1FYKA 1XSDA 3MKWB 4MGRA 2E1CA 3A4CA 1IXCA 2MC3A 4I7HA 3ASNH 4XM3A 1YJ9I 1D0XA 3BCAA 3DV8A 3TO6A 5C3EJ 1WI9A 3ABLH 4M9ZA 1IRGA 3IV5A 2DJIA 2M1BA 2LTPA 1Z7LA 3T0YA 2KIUA 2D5VA 4U0WA 1T39A 1HOMA 1YW8A 3I4PA 1ZRDA 2CFXA 1LKXA 1TW3A 2X6YA 3HRTA 2AQEA 3DF8A 3HYIA 2P5VA 3QODA 2XVCA 3D0SA 3LA7A 3CC4I 3DBLB 3JR9A 2VBYA 2X4HA 1JTXA 4EM0B 3H3ZA 1H89C 1Y56A 4OIQF 2CG4A 4F92B 4P5OA 3S14J 4ENJA 4P96A 2CMPA 4YEJA 5LGNA 2E34A 3MAJA 2EA2A 1LDKB 2JUCA 3V7RA 5H2FC 2R5ZA 3WTWC 1BI2A 5BQTA 1ZYRF 3OSFA 4OWRB 1WFXA 3L7WA 5FJ8J 2ZMEA 5TRDA 1JHHA 2A5WA 2QA4I 3CMYA 3WGIA 4UUTA 1D1BA 4RS8A 2CQKA 2O61A 2CRGA 3OYNA 2NVYJ 2OUMA 2KRCA 2ZXJA 4HX4A 2VJ4A 3CDLA 5DCFA 2Z16A 2JN6A 3KYCB 1O57A 2LBFB 2CQNA 2F6CA 5F0FA 4LLLA 4EATA 5K7ZA 2NXNB 2KQRA 2E5NA 1ETWA 1GVJA 4PFPA 2VOOA 4LD5A 1BR2A 5J6XA 5M5WJ 1PUEE 2O9LA 1IN8A 3G1LA 4NQWA 3JRDA 2E7XA 1Z21A 5BS6A 2V9VA 1MIJA 3BPVA 1TQIA 4QSHA 3H36A 1Y1VJ 3CMEI 4AVPA 2E60A 2NS7A 3BG6A 4CA0A 5CVUA 4F91B 4CCMA 4RB2C 3IRQA 1IZ1A 3FM5A 1W36D 4PGGA 2YR2A 2DQRA 3F21A 1FWZA 3BLYA 1VFCA 2FSWA 2DMQA 4ESFA 4A3DJ 4UV8A 3DPTA 1K7AA 2DA2A 2JA6J 4NC6A 1N77A 1MJBA 2KHMA 3KP6A 5M5XJ 1HQCA 3MKLA 4WWCA 2K40A 4M71A 4PJNA 1V55H 4G7OF 1XX5A 1IUYA 3MKYB 4IPAA 5GPCA 3E6MA 2LY9A 3VOEA 3LSJA 3SEQA 4M3DA 1QGPA 2L5QA 4IHSA 3QP5A 2FBIA 3LAJA 3BR6A 2XAUA 2XGDA 1W36C 4IHYA 3LQRA 2HYJA 1OCCH 4II3A 1ZARA 3AG2H 2PN6A 1VQLI 5D4RA 3P9IA 1IRXA 3FXOA 3A01B 1HW2A 2DXIA 2VKHA 5ICGA 4I98B 2FQ3A 2NS8A 1P2FA 4N9HA 4L5EA 4ZYHA 3HXLA 1ZRFA 2ACJA 2IGNA 4EM2A 3WHCA 3CZ6A 5GAGJ 2VBXA 5L3EA 2FXAA 3A0BC 1XMAA 2GIVA 2KPMA 3EUHA 3CJTB 1MBJA 3I55I 2K9SA 4A3JJ 2NVTJ 2ISYA 3Q9VA 2CUJA 4FX4A 3M1CA 1WWXA 3S1MJ 3D5LA 3K0LA 3GFJA 3OMYA 2UV1A 3V8JA 3EDPA 1LVAA 5A2QZ 2GIZA 4NB5A 4NC8A 3HRMA 1FC3A 3FXQA 3OV8A 4P9UA 1VZ0A 3S2WA 1JKPC 1FYLA 2Z9OA 4DYQA 1WSUA 1VQ4I 3SDBA 1TWHJ 1P9QC 3KEOA 3K1NA 3L2RA 3GEZA 1LE8A 2WBMA 2Z3YA 2Y9ZA 2ZJ2A 3S1RJ 3RPQA 3OYLA 1AA7A 2NAZA 3B73A 3GFLA 3FHNA 4UUSA 3H9JA 2EBIA 1X3ZB 4L5IA 1XTAA 1MW7A 5F04A 4S0HB 2HKOA 2M4GA 2EZKA 1JGGA 3K4LA 1OYWA 2EPFA 5DUIA 4QLCU 4KISA 2A6EF 3GF2A 3D5SC 5E8IA 3Q0VA 2R5ZB 2MLKA 1XG1A 1UG2A 3ZRGA 3QYBA 3RSNA 3FK7A 2KP6A 3M8EA 3HSRA 3QOEA 4WX9A 1ZG1A 2QSFX 2EA4A 2DA1A 3F72A 5CVRA 3D5RC 3IL2A 3TDZC 1F43A 4ENMA 3G1OA 1DDNA 4L0YB 1RESA 4N4OB 3WG9A 4I76A 2Y9YA 3HUGA 3C18A 1JJ8C 4XLPF 1U9NA 3ISPA 3FMRA 3CP2A 4G8XA 2PFBA 2YX4A 3OYMA 2CU7A 1H88C 2Q8KA 1ZG5A 3MQ0A 5D6FA 1MKMA 1J2XA 4U0YA 1J5YA 5DS9A 3LSTA 3G71I 4XIDA 2LH9A 2HR3A 5EG0B 1UAAA 3OSGA 4KT5C 4E6KG 2KMUA 1KU9A 3CJNA 1J9IA 1JHFA 3ZN0A 1FLIA 2G9WA 4Y52J 2V1NA 3ZQ7A 1W7PB 4QPOA 3IUOA 3ASOH 4ABZA 4CYCB 3OYEA 3R60A 2ZB9A 3JRIA 1XSXA 2IGMA 4EJUA 2DT7B 2MSYA 4Y3OA 2COBA 4YIFA 1MJ9A 4B47A 1P4AA 2DTZA 3SYTA 3MCZA 3GUDA 1G8XA 4FETA 1FTZA 2K9NA 4PJLA 4ZYEA 1U8BA 3LMMA 3H1CA 1HKQA 1BBYA 3ELKA 5FGMA 2VUMJ 3J7YJ 3BR5A 4YRVA 4C3JJ 1ORKA 4LMYA 4JX6A 1JE8A 1LDDA 1WCMJ 3OS2A 4AIJA 3L2WA 1FTTA 2DDBA 5BNGA 2DA3A 4RM2A 4LK0F 4E7LA 1S7EA 4OMYA 2HYFA 4CCJA 2QQAA 1B4AA 1OCZH 2A69F 3LOCA 4DOZA 3Q5FA 1IN4A 1V5FA 2QWWA 2O7OA 2L7FP 2ZJQF 1MMSA 2IVMA 2WY8Q 5FLMJ 2LY2A 1R6RA 4A12A 2BV6A 3BJ6A 3QYEA 4XNFA 1KYWA 1KGSA 4S05A 1BIBA 5KK1A 4ITVA 1VTNC 2EIMH 4MFEA 2STTA 4I99C 4V2GA 2ZNZA 4BY7J 2M7BA 3GFMA 2A05A 4XRSG 3SEZA 4KITB 1SMTA 3BG7A 3GZ5A 2QYOA 5LHGA 3BR2A 3S32A 2WV1A 3HIFA 3Q9SA 2IA0A 3BY6A 1USTA 4I0BA 2MA3A 3EYYA 2A6TA 2QQBA 2LMDA 4BDYA 1MMGA 2ETHA 4M6YA 4PDKA 3RPUD 3U9GA 1DPUA 3LSMA 2CV2A 2FMLA 2JWTA 3K2ZA 2GLOA 4P55A 2ZMEB 2KL4A 1NK2P 1W0UA 3DPLC 3WTVC 3ROUA 2DA5A 2VIXA 1TBXA 1LPQA 3S16J 1B59A 2L7MP 3GMEA 3R61A 1R5GA 2QZ8A 3IC7A 2C6YA 2AXTC 1G3YA 4U0VA 3KP2A 2ME6A 1L0OC 1TQPA 2QENA 2LR8A 5TJJA 5HLTA 3S2DJ 1HKSA 2LREA 2FMYA 5D8KB 2HDWA 5CQGA 2OQRA 4U87A 2CO5A 5L3GA 4E7IA 1VQKI 3ZXSA 4ZYAA 1GV5A 2KZGA 3ZQGA 5GPAA 2BY3A 4N0BA 5FLVA 2M0CA 2EWNA 3REOA 3ZCOA 3KP5A 3R0JA 1V54H 2P6SA 2VJJA 2RNJA 3BWGA 5E3MA 4BACA 4XKBA 3DU5A 5LFAA 2GOXB 2ZSHB 3CQZJ 2CQ7A 1MDMA 1KQ0A 4PFOA 2VBWA 3DEWA 1SD7A 2M3AA 4MQ9F 2NVQJ 2KDZA 3KLOA 2VB6A 1R1VA 2EQRA 2DFIA 5DCMA 3ULQB 2QM3A 1WH7A 1YQAA 4IQ4A 3UR3C 1G2HA 2QGUA 2UWMA 4PJ0C 1LQ1A 1KQ9A 1BC8C 3F8MA 1MJAA 4GYGA 3HOZJ 4XN3A 3RTRA 4UNOA 2ZCWA 1N25A 4JX5A 2JA7J 4MO7A 3L1PA 1U78A 3I5UA 2R7TA 2Q2EA 2EZLA 5JR3A 3E7LA 2FNAA 1AU7A 1WRJA 3WHBA 4CXFA 3HEFA 4F93B 3H35A 2NYXA 3H5NA 1R9TJ 3EUHC 4LLGF 1RR7A 3ZR8X 1VQPI 4X0GA 4M3GA 3W3CA 3J81Z 3OYGA 2QCOA 2V7FA 3T8TA 1IC8A 3KLNA 2R92J 5J47A 5DD8A 3J7AY 3I64A 3GTQJ 1E3PA 1SVOA 2Q0OA 3HPHA 1EJ9A 2A6HF 2I8DA 4HW0A 1TNSA 4HYEA 3R6SA 4HNUA 2QKMB 3OYCA 3S17J 1R58A 1QVTA 2EIKH 3IH4A 4RGRA 5H20A 4R79A 5JVGF 4XICA 3HKZN 4D5CA 2QBYB 5M5YJ 3HDDA 1TWFJ 1XMKA 2OZUA 3DTIA 1I27A 3M4OJ 2NS0A 3DFGA 1YE9A 4LIVA 3RYRA 1QA6A 3CUOA 4PJMA 2O8XA 4YIIA 3ONQA 5K7HA 2E1OA 1DPRA 3CDHA 4D7NA 4Q4ZF 5F1JA 2L7ZA 5JHFA 1JXSA 3CCEI 3VWBA 1T98A 2CJJA 4LFUA 4KICA 3HOWJ 2VC1A 4BYYA 5HLGA 3A2KA 2DN0A 2UZKA 1IDYA 2ZFUA 1ETKA 3M7GA 2H1KA 4ZYDA 5FFXA 3ML6A 3KP7A 1X1AA 1A36A 4F7ZA 3Q0WA 1LDJA 1O4XA 2KT0A 3W6KB 2I5UA 3HRSA 3AL0B 4RM3A 4XQFA 1USSA 3FXLA 5E3OA 5L3FA 4BXXJ 3KYLA 2GA2A 1ZHFA 2VL8A 4LK1F 1Z7UA 4D9JA 4U88A 3N4MA 1S9HA 2VQGA 2V6EA 2HVSA 3L2QA 2LF8A 1VQOI 2OAZA 5HS8A 1S8NA 2DMTA 4LG3A 2CQQA 4MEYF 3V8KA 4E7HA 1BR1A 1JUMA 3KZZA 1E3HA 2R7OA 2L9VA 3W2VA 2HOEA 3CC2I 5HDKA 1K4TA 5JVTA 5DTDA 4GXOA 2HQRA 2HYGD 2DFHA 2ZKZA 3MEXA 1HDPA 3PL8A 2GXGA 2DA7A 4D0PA 2OA4A 3S2HJ 2E1MC 4AVZA 3HUGB 4RB1A 1U5TA 3H9GA 3GZ6A 2GQQA 2A07F 2VOPA 3ZMTA 3EUAA 1IXSB 3K4MA 3M3YJ 2COMA 3K1PA 4XRFA 1JUPA 1H0MA 1WZ2A 4DBRA 3NWSA 3H3VK 4UVCA 2MYSA 2JQ7A 1A5JA 1ZLJA 1YTYA 4E7JA 1Z1DA 2F2EA 3B02A 2IRFG 4M73A 1D5YA 1E0EA 2W85A 1GV2A 2HEOA 5CVVA 4B4CA 2O6GE 1NHAA 1TT5B 2DK5A 1XGSA 3HSEA 2OD5A 4L0ZB 1NH3A 2HQNA 2XPWA 5HNFA 1HSTA 3WTZA 1ON1A 2V6CA 4HLXA 2B0LA 3OL3A 4IVNA 3BG3A 5KNLA 4CO8A 5DV5A 2KISA 2Z1DA 2XPVA 4EM1A 1XCVA 5LD2C 5J8CA 1STZA 1J09A 2Y30A 2CUZA 4DW6A 1M1EB 1JT6A 2E19A 4M3FA 2DYRH 1HXDA 4EJVA 4HPQA 4KA4A 1OCTC 2BXZA 3KP3A 2R7DA 3ABKH 2L2OA 3OYBA 2DT5A 2WAFA 2V79A 1KU3A 4G7ZF 1LNWA 5F08A 2FOWA 5DDGA 2QSGX 4LOCA 3ZQFA 4I0AA 3KEQA 4AIDA 5IT3A 3IKVA 2W48A 4BHBA 2YX7A 1LE8B 2YSRA 4Y17A 3BG5A 4HLYA 1AHDP 5ILSA 4BJ6C 4FE7A 3CCYA 5E8GA 3EPZA 2HTJA 1BOAA 1Z3XA 3F9KA 4EQQA 4BGDA 4WF2A 3GFIA 1BI0A 3V4GA 2R7SA 1X2MA 3WE2A 3HOVJ 1BW5A 3GCMA 4A3BJ 3C1DA 3CD6I 3KZYA 2GM4A 4HAMA 2VI6A 4B3XA 1U0JA 2DFFA 2IGKA 3WTUC 4BKXA 4GCVA 1W1WE 3DXJF 3O8GA 2CW7A 3FF5A 3PSFA 3CCSI 4BY1J 2XGCA 1ETVA 2QQ8A 2XF5A 1X1DA 3MKZA 2VT2A 2M87A 4F55A 1Y6IA 2JMWA 4BS9A 2LLKA 4ZH4F 3S93A 4UVBA 2FE3A 5B1BH 1X1BA 1WVRA 3K7AJ 1ZGWA 3RZOJ 4ESJA 2KKOA 4EV0A 2QF7A 1B8IB 1B1BA 2H1LA 2F5FA 3C2HA 4GRIA 1EH6A 2EV0A 1X1CA 4B3AA 4FQGA 2E2HJ 3F8BA 2LF7A 1BI1A 4XKCA 1IN7A 1RUOA 5EG0A 3J80K 1O3TA 2ZBKA 3A0HC 1D3YA 2EJRA 4OIRF 1SVLA 1BJZA 2XC7A 4U7DA 3ERED 3FMSA 1I1SA 4FISA 5KCMA 1YIJI 4PUSA 2IA1A 1Z77A 1SAUA 5F1RA 3TOBA 4AYBA 1F4KA 3WU2C 5LLQA 2MBFA 4AIHA 5IY5H 1WJBA 2B9SA 2ELKA 1SC7A 1VQNI 5EDNA 4YFXF 2DT6A 2EFQA 3W6VA 3L09A 4OAYA 3QPSA 3JCUC 4MNUA 3ZMDA 1J59A 3I0TA 2YPRA 4A3IJ 4RB0A 1WKMA 3L2VA 2PMZA 4A3EJ 4HRIA 2NVXJ 1EF4A 1I3AA 4I6ZA 2F4IA 3K69A 1KYZA 3BQZA 2HXOA 2OPTA 3K4BA 4HEA2 2X51A 3KYDB 5CLSA 2XSDC 2XIGA 3E6DA 4X1EA 4QPQA 3S3OA 3P5JA 3F22A 2XDVA 3OOUA 1MSFC 2GBYA 2KIQA 4HNTA 1XD7A 2NOJB 3VFZA 4HF1A 3LSKA 1TQMA 5IPAA 1F1ZA 5E18F 3LSGA 1QBJA 4Y7NJ 3VYUB 4Y4RA 2WAEA 5J1UA 4PZJA 3SJMA 1K4SA 4OIPF 2W84A 2OTLI 1K61A 1JGSA 2A68F 1REPC 5IOZA 4YFNF 4A3FJ 2LY1A 2HFHA 2EFNA 2WAQA 1UELB 3K70D 4Z2YA 2M4KA 3NEUA 5GP9A 1MSEC 1VQ6I 4XLEA 2MH2A 4B09A 1K79A 2Y75A 2HZTA 3E6BA 1FOKA 5BPIA 2HOTA 2KFDA 1KONA 4A2UA 1AKHA 1B72B 1VQ9I 5FRNA 5HLHA 3RCOA 2K7LA 2V9KA 1A31A 1QU3A 2XASA 4KMFA 1ACIA 1OFCX 3DQVC 2JSPA 3ECOA 4P9FA 1WQ2A 3DKYA 3NAUA 1SFXA 4ZDPA 4A69C 1Z6RA 2QBYA 2XAGA 3AL0C 1J7KA 3I3LA 3KX2A 4ZDLA 3W6JB 2DODA 1FOXA 3GTGJ 3S8PA 5J4VA 3CF5F 1ZKGA 1VQ8I 1AWCA 1IG7A 5DYMA 2YU3A 3JAMK 1NTCA 3R0AA 2PX9A 2UXXA 4LGWA 1KQ8A 3PFYA 5KAIC 3HOSA 2M5WA 2EILH 3U2RA 2P7VB 2K85A 2YS9A 3CMMA 3HZJA 2IAIA 3ECHA 1MMDA 3A03A 1Z67A 2XKOA 1Y39A 2HDDA 3CF2A 5EZHA 1MD0A 3U1KA 2IS6A 3TW7A 5B1AH 3B6CA 3BR3A 2R4GA 4M9XA 4A3KJ 1QPMA 2AQFA 4HOBA 4Q47A 1VQ7I 2DPUA 2BVLA 3GTMJ 3F0CA 3GYHX 1EH7A 3M1EA 2LOOA 2NNNA 2BY1A 2O03A 1N78A 3BC8A 2V26A 3CJRB 1FYMA 2PG4A 1SAXA 2DOAA 4N9IA 4M3BA 1RPWA 4BQOA 1FX7A 5TGTA 2M0MA 3MN2A 2UUZA 3PJRA 1ZG3A 1HW1A 2ZXWH 3W2AA 1U8RA 3UKGA 1FJLA 3MFKA 1PVEA 2ZXHA 3BZ6A 4K2EA 2VJIA 4RAGA 1W0TA 4O6JA 3BTIA 3WTYC 3RIRA 3ZMVA 4EJOA 2ADUA 2NNYA 4L18B 2JK3A 1O3SA 3DWLE 4NBQA 1Y0UA 2Y0SN 2ZXIA 1ONVA 5LGTA 2XHKA 4C30A 2MFZA 1MH4A 1BR4A 4YFKF 1X58A 2CH0A 2QVOA 2PEXA 1ON2A 4RGXA 3I9V2 2R0QC 5CJ9A 3DCFA 3LA2A 3TDUC 2HTSA 3CCMI 1FOWA 5IOYA 1JKOC 2JA5J 2WWYA 1W5CC 2WA0A 3RKXA 2HKXA 3B6AA 5GAEJ 5ILUA 2CUFA 4LG0B 2RREA 4XLHA 1QPIA 2H27A 1A35A 4RB3C 4XKVA 2L9RA 5B5EC 3M8FA 1I3QJ 1G3SA 4V2FA 1DU6A 1YJNI 3BTJA 5FKKA 3BTCA 3H92A 5L3CA 1UG0A 3O3KA 2Y69H 3QPHA 2W24A 4UVAA 5J4YA 4IRIA 4ETSA 2MG4A 3OYFA 4XLFA 2E5ZA 1YS7A 3CLOA 3QYFA 3CCJI 1H9GA 2PJRB 3NRVA 3JW4A 2F5CA 3OL4A 1U5TC 5F64A 3GBGA 5EGOA 1ETOA 4KIGA 5FKNA 3H0GJ 1LVKA 2H8WA 4V19K 3KIOA 1SD4A 2CUEA 2QSHX 1TWAJ 1YYVA 4L9TA 3HM5A 3SDGA 4M9SA 3TO7A 4ZC3A 4XN0A 4E7KA 2CS3A 5JLXA 1BM9A 4A5MA 1OPCA 1QZEA 4CDGA 2CW0F 5FD6A 1ZGAA 4MLOA 1JT0A 5E20A 2Y0MA 1HLVA 1RZ4A 4DGWB 5F6FA 2DDAA 1WJAA 2X0LA 3PNTA 1AKHB 1Q1HA 1B72A 2F5DA 3GZNB 2WY7Q 2LKSA 3C3WA 2K5CA 4HF0A 4BUPA 2L9NA 2R5YA 2MW8A 2FJ1A 3HC7A 1ENHA 4BHCA 4XRMA 4GFBA 2W4SA 4PSWA 1MBHA 3WODF 5IP6A 4CGZA 5AIPA 1YIOA 3MVPA 2HVRA 4ZTFA 2D1VA 2YUSA 3N05A 5ICFA 5HODA 3A02A 2XAJA 2PMHA 2E36A 3LFUA 2IS4A 4E70A 1POGA 2K3PA 4XLNF 1IUFA 1F9NA 1WJDA 3HL2A 3S1QJ 4M72A 2CV1A 4X6AJ 1YW7A 2FUG2 1TC3C 2P8TA 3OIPA 4IO9F 4HNVA 5L3DA 3SHFA 2DBBA 3QPLA 4XBFA 4HV5A 4C2TA 3GTKJ 4IL6C 2LYCA 3JTHA 2E7WA 3EETA 1OR7A 1D0ZA 1YS6A 1W4MA 4NQWB 2OZ6A 3LAPA 2XKPA 3O2PE 1R49A 3CCLI 4RBOA 4Q5SF 3JRAA 4ANJA 2Z99A 1PP8F 1P7IA 2P0WA 4NHJA 3OWTA 1DP7P 4R8HA 3WG7H 1PYVA 4BBSJ 2KRFA 4RGSA 2VBZA 1LFBA 4CCLA 4KYWA 3JTGA 4F52A 3FISA 1TW2A 3K2AA 3I59B 1NG6A 5LGUA 5EJCA 2HXIA 1MNMC 5BMZA 4ENNA 5D8LB 2D1HA 3AG4H 3NARA 3SZGA 4MTEA 5D6EA 1P7JA 3H9QA 1TL8A 3LSIA 3QP6A 2LP0A 3TO9A 2ECBA 5FRMA 2BEOA 3FMQA 4BBRJ 5HVQC 1UCRA 2BHYA 4M6VA 1R7JA 2XF6A 2XUBA 4A0XA 4FX0A 2IA2A 3FBNB 4OOIA 5FLXK 2PI0A 3I56I 5K5OA 3KFWX 2ZJPF 2KJCA 2TRTA 3M9AA 1QNTA 2DTRA 5FKMA 2QQ9A 4N4NB 1YX3A 3ZP5A 3HRUA 4IOCF 4HX8A 4W1UA 2JZYA 3BOQA 3IP4B 4EVIA 2JUGA 3OR1C 3CMAI 4HQEA 3HOYJ 2HZDA 2ICWG 3O8HA 4BE2A 3IWFA 3V7SA 1O3RA 1RR8C 3HJEA 1UHSA 1RKWA 3QWLA 3MZHA 1VQMI 2LDUA 1GLNA 2NVUB 3RPUA 3CTAA 3D1NI 2ELHA 5E1XA 4ESBA 3GTJJ 1ETQA 1R22A 3HOXJ 3RJPA 4FE4A 3MD2A 5J40A 1B8IA 2HPIA 1RI7A 1IV8A 1CGPA 4BJ5C 1SFOJ 1Y8RB 1SFUA 4KUMA 2IPQX 4XOTA 4ZJZA 5IP9J 1T08B 2L4AA 1K83J 4AM3A 5L3BA 3IAS2 1S7AA 3ZOBA 3KEYA 4KN4X 4NC7A 2ID6A 2DOEA 4BE1A 2BBYA 2CW8A 5J1RA 4UUSB 1QQIA 3K10A 1R1UA 4R1HA 3VYSB 1H8AC 1SFKA 2X9DA 4QTRA 3J81K 1JTYA 2LVSA 3R4KA 4UXNA 2VQHA 3W2WA 3OYKA 2LNBA 1MBFA 3DTKA 1SVMA 2VXDA 4HF2A 1NK3P 4Y13A 3P7NA 1XGMA 3F8NA 3K4JA 3IAM2 2KLOA 2LK2A 3Q0UA 1O7FA 3IRRA 1X19A 3CUQC 4C2MJ 2Q1ZB 4L9VA 3TW6A 4CUGA 2X6OA 1T38A 3MZYA 1XC5A 1CF7B 4BH9A 4AU7A 4B48A 3LL7A 3PM1A 2A61A 4B1RA 2NRAC 1GHCA 5HS7A 2X6WA 2AS5F 2K4JA 1Z6TA 2L02A 2LD5A 2XB5A 1V3FA 4HG2A 4MIMA 1U3EM 2KIMA 1JI8A 2OV7A 2K4BA 2L7KA 2MC4A 1GXQA 1Q1VA 1J0RA 2K9QA 2A3SA 4MHGA 4CZCA 3H0DA 3K70C 1FP2A 2VN2A 1QO0D 2IS1A 3TEDA 3OY9A 2KIFA 3NWTA 5CVJA 2RKHA 3M8JA 1DQUA 2O3FA 2V1UA 3ABUA 1B6AA 2GZWA 4XR6A 1T33A 4O5VA 2IJLA 1CQTA 1QRYA 3SFIA 1ZK8A 5GAHJ 4E7ZA 1R4MB 1X2NA 2TCTA 3BZKA 3OYHA 2MH9A 5CKTA 3M07A 4IEJA 2BY0A 3DKWA 5D5XB 3OIQA 2X1EA 4CICA 3J80Z 3JRGA 3L2CA 5E79C 2LG4A 2O0YA 1YFHA 2R93J 2DA4A 5CQEA 5LHHA 4J01A 2E1NA 3FXJA 4GYIA 2D2WA 3EYIA 4DQ2A 4G9YA 3I59A 5F27A 4RMNA 4KFCA 3DKXA 3OYIA 3I53A 3LSPA 1T56A 1X4PA 1GXPA 2WADA 3LNQA 4UUVA 1FOYA 3CDIA 4HDVA 4XLCA 2H6CA 3MMYB 4HBLA 1HSJA 1ZH5A 2VODA 3T1BA 3GVAA 3RKWA 3C7JA
chains in the Genus database with same CATH topology
1A6IA 3TP3A 5IPAA 3QQAA 1RETA 5DS9A 4XIDA 3LSGA 5EG0B 4DYCA 4Y7NJ 3OSGA 1IJWC 1GDTA 3LSRA 4JYKA 5JLWA 5J1UA 4FCYA 4Y52J 2ECCA 3SJMA 4ABZA 4CYCB 1K61A 4A3CJ 2L0KA 2ZB9A 3JRIA 5IOZA 2B63J 2N8GA 4A3FJ 2VKVA 1OCPA 5GP9A 2DMNA 2MSYA 1MSEC 2COBA 4JX4A 2IEKA 1PUFA 1MBGA 2DTZA 2HOSA 2HOTA 3HB9A 1FTZA 1AKHA 2K9NA 1U8BA 1B72B 1BW6A 4QIWN 2VUMJ 2LKXA 3BR5A 5IYCJ 1OFCX 5F0HA 4C3JJ 3NAUA 4A69C 1ORKA 1SANA 4JX6A 1ZQ3P 4C3IJ 1WCMJ 2YU9J 2FD5A 3GTGJ 1FTTA 5IYBJ 5BNGA 2M2EA 2DA3A 1ZKGA 1S7EA 1IG7A 4EEFG 3LOCA 1NTCA 4AC0A 3S1NJ 2O7OA 2L7FP 3BT9A 5FLMJ 1RKTA 2AHQA 2E2JJ 2YS9A 2IAIA 3A03A 5IP7J 4MFEA 4V2GA 2HDDA 1JKRC 1YRNA 5C4JJ 5EZHA 1QVUA 2RAEA 4MFDA 4BY7J 4CYCA 1XS9A 3TW7A 3B6CA 4XRSG 3BR3A 4IHXA 5M3MJ 3I4NJ 4A3GJ 4A3KJ 3BR2A 2WV1A 3GTMJ 3F0CA 1APLC 2XB0X 3PO3J 3RZDJ 5J1YA 2P81A 4M3BA 1RPWA 2G0EA 1MBKA 3IH3A 2O8KA 3MN2A 2WAQN 2JWTA 1ITYA 3UKGA 1FJLA 2GLOA 2Y31A 1NK2P 1W0UA 1HDDC 2DA5A 4W97A 1W0TA 3S16J 3BTIA 5EGOB 5EZGA 2L7MP 2JK3A 3GTLJ 2DJNA 1TWGJ 2H8RA 3HBLA 2Y0SN 3HOUJ 1LFUP 1DU0A 1MH4A 2ME6A 4D5FA 1ETYA 2LR8A 1X58A 3S2DJ 1HF0A 1Y1WJ 2R0QC 3DCFA 1FIAA 3ZQHA 1VI0A 2PMZN 1GV5A 3ZQGA 5FKLA 5IOYA 5GPAA 5C44J 1JKOC 4RDUA 2JA5J 2M0CA 5FLVA 3B6AA 9ANTA 2CUFA 1QPIA 2R5YB 2L9RA 5E3MA 2HQ5A 3CQZJ 3GTPJ 1I3QJ 4V2FA 2E2IJ 1JJ6C 1DU6A 2X48A 3BTJA 5FKKA 3DEWA 3BG9A 3BTCA 1Z0XA 3HGGA 2NOGA 2NVQJ 1OJLA 4M3EA 2KDZA 2EQRA 1WI3A 4FTHA 1WH7A 2MG4A 2JJ7A 5E3LA 1G2HA 1HCRA 4DYRA 3OIOA 4AUXA 5EGOA 3HOZJ 3GBGA 1ETOA 5FKNA 3H0GJ 4JX5A 2JA7J 4MO7A 3L1PA 1U78A 5EF6A 5C4XJ 2VKEA 2CUEA 2EZLA 1AU7A 3E7LA 1TWAJ 5EEAA 2EZHA 3WHBA 2XPUA 3HM5A 3HEFA 3SDGA 4NDLA 1R9TJ 1RR7A 5JLXA 2JA8J 4M3GA 1U9OA 3I4MJ 2QCOA 2Y2ZA 1IDZA 4MLOA 3A01A 3FK6A 4A3MJ 1IC8A 1JT0A 1HLVA 2R92J 2AO9A 1TWCJ 3GTQJ 1AKHB 1B72A 1WPKA 4D7MA 2VPRA 1JUSA 5J3LA 2R5YA 2MW8A 2FJ1A 4XRMA 1ENHA 3IH4A 1QVTA 4GFBA 4IHWA 3S17J 1MBHA 2WB1N 5IP6A 3FIWA 1ETXA 3HKZN 4G12A 4D5CA 4XICA 3MVPA 5M5YJ 3HDDA 1TWFJ 2YUSA 5HODA 3A02A 3Q3SA 3M4OJ 1POGA 5K7HA 5C3EJ 1BA5A 1IUFA 2E1OA 4D7NA 5F1JA 3S1QJ 4X6AJ 5EYRA 3IV5A 2CJJA 2LTPA 1TC3C 3HOWJ 4HNVA 1F36A 2DN0A 3QPLA 2D5VA 3GTKJ 1HOMA 1IDYA 1WGXA 1ETKA 2H1KA 2CQXA 3IH2A 3ZQIA 3Q0WA 3BR1A 2KT0A 1O4XA 4RBOA 2M8GX 3JRAA 3JR9A 4J19A 1JTXA 1P7IA 3VPRA 1H89C 4C3HJ 4IHVA 5E3OA 4BXXJ 3ZQCA 3S14J 3JRCA 2M9HA 4BBSJ 3HGYA 2R5ZA 1LFBA 2DMTA 2CQQA 3G1MA 2R7ZJ 2MGQA 5F0CA 3OSFA 3FISA 3K2AA 1JUMA 5FJ8J 2HXIA 1MNMC 3JRBA 5DTDA 3CMYA 3NARA 3BTLA 4UUTA 1P7JA 2HOAA 1HDPA 2LP0A 2ECBA 3BR0A 2DA7A 2CRGA 4BBRJ 3PO2J 1WH5A 3S2HJ 2NVYJ 4M6VA 3CDLA 2JN6A 2FQ4A 2EZIA 3M3YJ 5F0FA 3JRHA 1JUPA 2LFBA 3H3VK 1A5JA 5K7ZA 2TRTA 3C2BA 3TP0A 5FKMA 1ETWA 1D5YA 1GV2A 5M5WJ 2O9LA 4B4CA 2ID3A 4W1UA 3G1LA 2XPWA 2ME0A 3RKQA 2CU7A 3JRDA 3HOYJ 3O8HA 4QSHA 1Y1VJ 2NS7A 1GVDA 3BG3A 3JREA 1UHSA 1RKWA 2XPVA 1GUUA 2Y30A 4DW6A 3D1NI 1JT6A 2E19A 4M3FA 3GTJJ 1ETQA 1ZTRA 1OCTC 3HOXJ 1VFCA 4FE4A 1FEXA 2DMQA 3S15J 1B8IA 1I6HJ 4A3DJ 2JA6J 2DA2A 1MH3A 5F08A 5M5XJ 1SFOJ 3MKLA 4JP0A 5K7FA 2K40A 4LOCA 3ZQFA 5IP9J 1K83J 5GPCA 2W48A 2LY9A 1LE8B 3ZOBA 3LSJA 1ZR2A 3BG5A 4M3DA 2ID6A 1AHDP 4FE7A 1MBEA 3CCYA 5J1RA 4UUSB 3BR6A 4IHYA 2OF7A 2XGDA 1H8AC 2X9DA 2HYJA 4QTRA 1JTYA 2LVSA 1X2MA 4DZJA 4A93J 1E3OC 3HOVJ 1BW5A 4A3BJ 1MBFA 2XGEA 2GM4A 2VI6A 3A01B 3RQIA 2XRLA 1NK3P 3FKIJ 1YRNB 2NS8A 4BKXA 2LK2A 4L5EA 1IGNA 2DMPA 3O8GA 3Q0UA 1UMQA 3WHCA 4DZPA 4C2MJ 1BL0A 4BY1J 2DA6A 2HI3A 1VNDA 2XGCA 1ETVA 3TW6A 2X6OA 1XC5A 1GT0C 2FX0A 3PM1A 1MBJA 2JMWA 2K9SA 2LLKA 4B1RA 4A3JJ 2NVTJ 1I50J 3K7AJ 3S1MJ 1IRZA 1ZGWA 3RZOJ 2LD5A 2XB5A 4MIMA 5IYDJ 2QF7A 1B8IB 1Q1VA 2K9QA 4B3AA 1ZR4A 2E2HJ 1JKPC 4DYQA 3TEDA 5EG0A 1TWHJ 1LE8A 2Y9ZA 4A3LJ 1T33A 3S1RJ 1BJZA 1CQTA 1QRYA 3JRFA 2EH3A 4FISA 3SFIA 4UUSA 1ZK8A 2EBIA 3BQYA 1Z77A 1X2NA 1VF9A 2TCTA 5M3FJ 5F04A 4S0HB 2I10A 2EZKA 4IEJA 5E3NA 4XRSA 5FKOA 1JGGA 1PUFB 2DMUA 3JRGA 2M34A 2ELKA 4AYBN 5EDNA 2R93J 2DA4A 3Q0VA 2R5ZB 3W6VA 1XG1A 1UG2A 3QPSA 3FK7A 5F27A 4A3IJ 4A3EJ 2NVXJ 1EF4A 2DA1A 1FIPA 3GTOJ 4I6ZA 3LSPA 1T56A 1IV6A 3BQZA 2IBDA 1F43A 2HXOA 2OPTA 3G1OA 3LNQA 1RESA 3ZQLA 2XSDC 4XK4A 4I76A 2Y9YA 1JJ8C 4X1EA 1JKQC 1U9NA 1MSFC 3OOUA 2GBYA 1H88C 2L7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6I A;  3TP3 A;  5IPA A;  3QQA A;  1RET A;  5DS9 A;  4XID A;  3LSG A;  5EG0 B;  4DYC A;  4Y7N J;  3OSG A;  1IJW C;  1GDT A;  3LSR A;  4JYK A;  5JLW A;  5J1U A;  4FCY A;  4Y52 J;  2ECC A;  3SJM A;  4ABZ A;  4CYC B;  1K61 A;  4A3C J;  2L0K A;  2ZB9 A;  3JRI A;  5IOZ A;  2B63 J;  2N8G A;  4A3F J;  2VKV A;  1OCP A;  5GP9 A;  2DMN A;  2MSY A;  1MSE C;  2COB A;  4JX4 A;  2IEK A;  1PUF A;  1MBG A;  2DTZ A;  2HOS A;  2HOT A;  3HB9 A;  1FTZ A;  1AKH A;  2K9N A;  1U8B A;  1B72 B;  1BW6 A;  4QIW N;  2VUM J;  2LKX A;  3BR5 A;  5IYC J;  1OFC X;  5F0H A;  4C3J J;  3NAU A;  4A69 C;  1ORK A;  1SAN A;  4JX6 A;  1ZQ3 P;  4C3I J;  1WCM J;  2YU9 J;  2FD5 A;  3GTG J;  1FTT A;  5IYB J;  5BNG A;  2M2E A;  2DA3 A;  1ZKG A;  1S7E A;  1IG7 A;  4EEF G;  3LOC A;  1NTC A;  4AC0 A;  3S1N J;  2O7O A;  2L7F P;  3BT9 A;  5FLM J;  1RKT A;  2AHQ A;  2E2J J;  2YS9 A;  2IAI A;  3A03 A;  5IP7 J;  4MFE A;  4V2G A;  2HDD A;  1JKR C;  1YRN A;  5C4J J;  5EZH A;  1QVU A;  2RAE A;  4MFD A;  4BY7 J;  4CYC A;  1XS9 A;  3TW7 A;  3B6C A;  4XRS G;  3BR3 A;  4IHX A;  5M3M J;  3I4N J;  4A3G J;  4A3K J;  3BR2 A;  2WV1 A;  3GTM J;  3F0C A;  1APL C;  2XB0 X;  3PO3 J;  3RZD J;  5J1Y A;  2P81 A;  4M3B A;  1RPW A;  2G0E A;  1MBK A;  3IH3 A;  2O8K A;  3MN2 A;  2WAQ N;  2JWT A;  1ITY A;  3UKG A;  1FJL A;  2GLO A;  2Y31 A;  1NK2 P;  1W0U A;  1HDD C;  2DA5 A;  4W97 A;  1W0T A;  3S16 J;  3BTI A;  5EGO B;  5EZG A;  2L7M P;  2JK3 A;  3GTL J;  2DJN A;  1TWG J;  2H8R A;  3HBL A;  2Y0S N;  3HOU J;  1LFU P;  1DU0 A;  1MH4 A;  2ME6 A;  4D5F A;  1ETY A;  2LR8 A;  1X58 A;  3S2D J;  1HF0 A;  1Y1W J;  2R0Q C;  3DCF A;  1FIA A;  3ZQH A;  1VI0 A;  2PMZ N;  1GV5 A;  3ZQG A;  5FKL A;  5IOY A;  5GPA A;  5C44 J;  1JKO C;  4RDU A;  2JA5 J;  2M0C A;  5FLV A;  3B6A A;  9ANT A;  2CUF A;  1QPI A;  2R5Y B;  2L9R A;  5E3M A;  2HQ5 A;  3CQZ J;  3GTP J;  1I3Q J;  4V2F A;  2E2I J;  1JJ6 C;  1DU6 A;  2X48 A;  3BTJ A;  5FKK A;  3DEW A;  3BG9 A;  3BTC A;  1Z0X A;  3HGG A;  2NOG A;  2NVQ J;  1OJL A;  4M3E A;  2KDZ A;  2EQR A;  1WI3 A;  4FTH A;  1WH7 A;  2MG4 A;  2JJ7 A;  5E3L A;  1G2H A;  1HCR A;  4DYR A;  3OIO A;  4AUX A;  5EGO A;  3HOZ J;  3GBG A;  1ETO A;  5FKN A;  3H0G J;  4JX5 A;  2JA7 J;  4MO7 A;  3L1P A;  1U78 A;  5EF6 A;  5C4X J;  2VKE A;  2CUE A;  2EZL A;  1AU7 A;  3E7L A;  1TWA J;  5EEA A;  2EZH A;  3WHB A;  2XPU A;  3HM5 A;  3HEF A;  3SDG A;  4NDL A;  1R9T J;  1RR7 A;  5JLX A;  2JA8 J;  4M3G A;  1U9O A;  3I4M J;  2QCO A;  2Y2Z A;  1IDZ A;  4MLO A;  3A01 A;  3FK6 A;  4A3M J;  1IC8 A;  1JT0 A;  1HLV A;  2R92 J;  2AO9 A;  1TWC J;  3GTQ J;  1AKH B;  1B72 A;  1WPK A;  4D7M A;  2VPR A;  1JUS A;  5J3L A;  2R5Y A;  2MW8 A;  2FJ1 A;  4XRM A;  1ENH A;  3IH4 A;  1QVT A;  4GFB A;  4IHW A;  3S17 J;  1MBH A;  2WB1 N;  5IP6 A;  3FIW A;  1ETX A;  3HKZ N;  4G12 A;  4D5C A;  4XIC A;  3MVP A;  5M5Y J;  3HDD A;  1TWF J;  2YUS A;  5HOD A;  3A02 A;  3Q3S A;  3M4O J;  1POG A;  5K7H A;  5C3E J;  1BA5 A;  1IUF A;  2E1O A;  4D7N A;  5F1J A;  3S1Q J;  4X6A J;  5EYR A;  3IV5 A;  2CJJ A;  2LTP A;  1TC3 C;  3HOW J;  4HNV A;  1F36 A;  2DN0 A;  3QPL A;  2D5V A;  3GTK J;  1HOM A;  1IDY A;  1WGX A;  1ETK A;  2H1K A;  2CQX A;  3IH2 A;  3ZQI A;  3Q0W A;  3BR1 A;  2KT0 A;  1O4X A;  4RBO A;  2M8G X;  3JRA A;  3JR9 A;  4J19 A;  1JTX A;  1P7I A;  3VPR A;  1H89 C;  4C3H J;  4IHV A;  5E3O A;  4BXX J;  3ZQC A;  3S14 J;  3JRC A;  2M9H A;  4BBS J;  3HGY A;  2R5Z A;  1LFB A;  2DMT A;  2CQQ A;  3G1M A;  2R7Z J;  2MGQ A;  5F0C A;  3OSF A;  3FIS A;  3K2A A;  1JUM A;  5FJ8 J;  2HXI A;  1MNM C;  3JRB A;  5DTD A;  3CMY A;  3NAR A;  3BTL A;  4UUT A;  1P7J A;  2HOA A;  1HDP A;  2LP0 A;  2ECB A;  3BR0 A;  2DA7 A;  2CRG A;  4BBR J;  3PO2 J;  1WH5 A;  3S2H J;  2NVY J;  4M6V A;  3CDL A;  2JN6 A;  2FQ4 A;  2EZI A;  3M3Y J;  5F0F A;  3JRH A;  1JUP A;  2LFB A;  3H3V K;  1A5J A;  5K7Z A;  2TRT A;  3C2B A;  3TP0 A;  5FKM A;  1ETW A;  1D5Y A;  1GV2 A;  5M5W J;  2O9L A;  4B4C A;  2ID3 A;  4W1U A;  3G1L A;  2XPW A;  2ME0 A;  3RKQ A;  2CU7 A;  3JRD A;  3HOY J;  3O8H A;  4QSH A;  1Y1V J;  2NS7 A;  1GVD A;  3BG3 A;  3JRE A;  1UHS A;  1RKW A;  2XPV A;  1GUU A;  2Y30 A;  4DW6 A;  3D1N I;  1JT6 A;  2E19 A;  4M3F A;  3GTJ J;  1ETQ A;  1ZTR A;  1OCT C;  3HOX J;  1VFC A;  4FE4 A;  1FEX A;  2DMQ A;  3S15 J;  1B8I A;  1I6H J;  4A3D J;  2JA6 J;  2DA2 A;  1MH3 A;  5F08 A;  5M5X J;  1SFO J;  3MKL A;  4JP0 A;  5K7F A;  2K40 A;  4LOC A;  3ZQF A;  5IP9 J;  1K83 J;  5GPC A;  2W48 A;  2LY9 A;  1LE8 B;  3ZOB A;  3LSJ A;  1ZR2 A;  3BG5 A;  4M3D A;  2ID6 A;  1AHD P;  4FE7 A;  1MBE A;  3CCY A;  5J1R A;  4UUS B;  3BR6 A;  4IHY A;  2OF7 A;  2XGD A;  1H8A C;  2X9D A;  2HYJ A;  4QTR A;  1JTY A;  2LVS A;  1X2M A;  4DZJ A;  4A93 J;  1E3O C;  3HOV J;  1BW5 A;  4A3B J;  1MBF A;  2XGE A;  2GM4 A;  2VI6 A;  3A01 B;  3RQI A;  2XRL A;  1NK3 P;  3FKI J;  1YRN B;  2NS8 A;  4BKX A;  2LK2 A;  4L5E A;  1IGN A;  2DMP A;  3O8G A;  3Q0U A;  1UMQ A;  3WHC A;  4DZP A;  4C2M J;  1BL0 A;  4BY1 J;  2DA6 A;  2HI3 A;  1VND A;  2XGC A;  1ETV A;  3TW6 A;  2X6O A;  1XC5 A;  1GT0 C;  2FX0 A;  3PM1 A;  1MBJ A;  2JMW A;  2K9S A;  2LLK A;  4B1R A;  4A3J J;  2NVT J;  1I50 J;  3K7A J;  3S1M J;  1IRZ A;  1ZGW A;  3RZO J;  2LD5 A;  2XB5 A;  4MIM A;  5IYD J;  2QF7 A;  1B8I B;  1Q1V A;  2K9Q A;  4B3A A;  1ZR4 A;  2E2H J;  1JKP C;  4DYQ A;  3TED A;  5EG0 A;  1TWH J;  1LE8 A;  2Y9Z A;  4A3L J;  1T33 A;  3S1R J;  1BJZ A;  1CQT A;  1QRY A;  3JRF A;  2EH3 A;  4FIS A;  3SFI A;  4UUS A;  1ZK8 A;  2EBI A;  3BQY A;  1Z77 A;  1X2N A;  1VF9 A;  2TCT A;  5M3F J;  5F04 A;  4S0H B;  2I10 A;  2EZK A;  4IEJ A;  5E3N A;  4XRS A;  5FKO A;  1JGG A;  1PUF B;  2DMU A;  3JRG A;  2M34 A;  2ELK A;  4AYB N;  5EDN A;  2R93 J;  2DA4 A;  3Q0V A;  2R5Z B;  3W6V A;  1XG1 A;  1UG2 A;  3QPS A;  3FK7 A;  5F27 A;  4A3I J;  4A3E J;  2NVX J;  1EF4 A;  2DA1 A;  1FIP A;  3GTO J;  4I6Z A;  3LSP A;  1T56 A;  1IV6 A;  3BQZ A;  2IBD A;  1F43 A;  2HXO A;  2OPT A;  3G1O A;  3LNQ A;  1RES A;  3ZQL A;  2XSD C;  4XK4 A;  4I76 A;  2Y9Y A;  1JJ8 C;  4X1E A;  1JKQ C;  1U9N A;  1MSF C;  3OOU A;  2GBY A;  1H88 C;  2L7Z A; 
#chains in the Genus database with same CATH topology
 2BGC A;  3CCU I;  1A6I A;  2EIN H;  4ZTJ A;  3E3V A;  6PAX A;  4CCO A;  1ERD A;  1RET A;  2PJR A;  1HW5 A;  2XAF A;  4DYC A;  4XLA A;  2R7V A;  3PSI A;  1FNN A;  4F3Q A;  3PUB A;  5JLW A;  3CCR I;  2ECC A;  1IAW A;  4XOR A;  3DEE A;  4KDP A;  5TIS C;  2VKV A;  1SMY F;  1OCP A;  4KMU X;  1X3U A;  4DIQ A;  5A2Q K;  4HDU A;  2GXA A;  2XSJ C;  3G2B A;  2BOL A;  3OS1 A;  2FEZ A;  3MZ8 A;  3CUQ A;  1PUF A;  1MBG A;  1R00 A;  1ZRC A;  2DO7 A;  3QPT A;  1UB9 A;  1RC9 A;  3S3N A;  2LRD A;  1O7L A;  3HB9 A;  4HZF A;  3HG9 A;  3SQN A;  2G7U A;  2V4J C;  1BW6 A;  2Y0S A;  4RLF A;  2QUF A;  4QIW N;  2LKX A;  3E97 A;  5IYC J;  1OIS A;  1J75 A;  5DEQ A;  3WGH A;  2PLY A;  4XMY A;  2WTE A;  3PNV A;  3L9F A;  1SAN A;  1ZQ3 P;  3E1S A;  1O3Q A;  3RDI A;  3QOP A;  1E2X A;  1T6S A;  1LB2 A;  2YU9 J;  2FD5 A;  4L5J A;  2L9S A;  4CCN A;  3K1M A;  2EFO A;  5IYB J;  2FU4 A;  2M2E A;  2DQL A;  5K1Y A;  1ZGJ A;  2MD5 A;  1DGW Y;  4II2 A;  3S1N J;  4A0Z A;  2XAH A;  2ELJ A;  4M74 A;  4PK4 A;  2AXL A;  4HST A;  4OMZ A;  5JI6 A;  1RKT A;  4KIB A;  1S6L A;  2E2J J;  1ODD A;  2OJE D;  1LUJ B;  2K9M A;  4IRH A;  3RQ4 A;  5HNH A;  3FWE A;  5DM7 F;  4G7H F;  1KZH A;  2R7F A;  5IP7 J;  5GTH C;  5ICE A;  1JKR C;  5C4J J;  1QVU A;  2BVM A;  4MFD A;  2R7R A;  2QKL B;  4AIK A;  1BN5 A;  2L01 A;  3F6V A;  1V4R A;  2E35 A;  3QAH A;  5JFR A;  4ZYG A;  4BQA A;  2BZT A;  1OYY A;  2F4M B;  1MDM B;  2X1D A;  3K6G A;  4PGH A;  1APL C;  3PO3 J;  4RAY A;  1IRF A;  2VXZ A;  2JVH A;  2P5L C;  3VDX A;  2IGO A;  1OMI A;  4RLQ A;  5J1Y A;  5BOX A;  3I54 A;  2ZC2 A;  2M7A A;  1MBK A;  4RA2 A;  5DCM B;  3IH3 A;  3PIP F;  2O8K A;  5JHU A;  2WAQ N;  4B43 A;  3BJO A;  4RAF A;  2JPB A;  1FT9 A;  2JSC A;  1SEU A;  1PP7 U;  4EJT A;  2JVG A;  5K5R A;  1HDD C;  1X4O A;  3FX3 A;  2WV0 A;  5EGO B;  1Z91 A;  5EZG A;  4IZZ A;  2K27 A;  3HOU J;  1TT0 A;  1LFU P;  3SFZ A;  1RUN A;  1DU0 A;  1W7P D;  4EMS A;  2DU9 A;  2KZV A;  1YI2 I;  1P4W A;  5HS9 A;  3UNG C;  4D5F A;  1ETY A;  1FMW A;  1Z05 A;  2IXS A;  1G6N A;  4XSZ F;  5H6R A;  4IHT A;  1FIA A;  2UXN A;  2FBK A;  5E1Z B;  1UFM A;  2DAO A;  2DI3 A;  5D5V B;  4IQJ A;  5FKL A;  3BJA A;  2FBH A;  4RDU A;  5K5Q A;  4KN7 X;  2VPL A;  1BIA A;  4G6Q A;  5KAF C;  5BPD A;  2BXY A;  9ANT A;  4Z6Y A;  3IKT A;  2Z33 A;  4I2O A;  2ZSI B;  2R5Y B;  1OLT A;  3JAM Z;  1FBQ A;  3BCB A;  4CZZ A;  2HQ5 A;  1P4X A;  2E2I J;  2BW3 B;  1JJ6 C;  2JPC A;  3DBR B;  3VYR B;  4C9Y A;  4KJZ A;  4BXF A;  2F5V A;  3BG9 A;  5HLI A;  4LB6 B;  2NOG A;  3F8F A;  2ZFW A;  1OJL A;  2W00 A;  4M3E A;  1YJW I;  4WXH A;  3FXU A;  3WU0 A;  4FTH A;  3L2U A;  2JJ7 A;  2RQQ A;  5E3L A;  4HX7 A;  1HC8 A;  1T2K A;  1Z3Y A;  2EV5 A;  3WTX C;  4DYR A;  1PJR A;  4AUX A;  1QHH D;  2F4O B;  1Y8Q B;  3FKJ A;  3RI4 A;  1IN6 A;  5EF6 A;  5LEJ A;  2VKE A;  3RYP A;  1ZN2 A;  2EZH A;  1FBU A;  2P7C B;  3AFH A;  4ON0 A;  3WTS C;  1DGR M;  2KJB A;  3HTU A;  3VYT B;  3X2Q H;  2MLG A;  2M45 A;  2BYV E;  2VLA A;  2JA8 J;  2EFW A;  1TZL A;  1A04 A;  1BI3 A;  3RKY A;  4GDF A;  3I4M J;  3CUQ B;  5HOO A;  4EGZ A;  2JRM A;  4PSX A;  4A3M J;  3FK6 A;  1IDZ A;  4FAS D;  1EA3 A;  2DK8 A;  3BPX A;  3FXM A;  2AO9 A;  2OCE A;  2D45 A;  4Y15 A;  1WHU A;  3KCC A;  2DYS H;  4A6D A;  1WPK A;  4D7M A;  2VPR A;  3DLA A;  1JUS A;  2RC4 A;  1FP1 D;  4EJW A;  2WB1 N;  3FIW A;  1ETX A;  3SXY A;  3I71 A;  2KDO A;  3H5A A;  1FBS A;  2JTV A;  2VQL A;  3SZP A;  3BP8 A;  3Q3S A;  3HKZ A;  1K78 B;  1P6R A;  2H6B A;  1FZP B;  3GWZ A;  3I58 A;  4YEL A;  4IRG A;  1R5H A;  1BA5 A;  3OR2 C;  4BJT A;  1IN5 A;  5EYR A;  1C0W A;  4ASN A;  1MNE A;  5HDN A;  2IT0 A;  1F36 A;  2X6X A;  1WGX A;  1OKR A;  4Y33 A;  2BHZ A;  1Y0N A;  2CQX A;  2HVQ A;  3DLL F;  2CSO A;  1FMV A;  3H5R A;  2Q2E B;  3IH2 A;  3ZQI A;  1LJ9 A;  4KIF A;  3BR1 A;  3PIO F;  2M8G X;  1A6Q A;  4S04 A;  2EV6 A;  2IP2 A;  5D4S A;  4YG2 F;  3HOT A;  4J19 A;  2RGV A;  3VPR A;  1V5G A;  2VAS A;  4Q48 A;  3VOD A;  4BXU A;  2HS5 A;  4C3H J;  4DNC A;  3F8C A;  5FLX Z;  4WK8 F;  3ZQC A;  1I6X A;  2W82 A;  3K9T A;  4ZZL A;  3JRC A;  2M9H A;  5FFZ A;  3VSL A;  1PDN C;  1UJ8 A;  1G3W A;  3HGY A;  2ZNY A;  2RQP A;  3G1M A;  2R7Z J;  2MGQ A;  5F0C A;  3E5U A;  1ZAO A;  2OC6 A;  2OTJ I;  2WC2 A;  2F5E A;  2J5O A;  2X1C A;  4WCG A;  3JRB A;  3AKZ A;  3JSP A;  2E71 A;  3DP7 A;  3BTL A;  1G3T A;  2HOA A;  2XF7 A;  4UV9 A;  4BAY A;  1I39 A;  2RDP A;  3V7C A;  1R5I D;  3BR0 A;  3PO2 J;  4CH7 A;  1WH5 A;  2DFE A;  1RNL A;  2DW4 A;  3ZGK A;  2R3S A;  1D1A A;  2HNH A;  2FQ4 A;  2EZI A;  5GTI C;  2K02 A;  1FSE A;  3JRH A;  1T95 A;  3PQJ A;  2LFB A;  1D8K A;  4QWQ A;  4AD9 A;  1MMA A;  2RN7 A;  1KU7 A;  2Y48 A;  3C2B A;  4M6X A;  3TP0 A;  1D0Y A;  1XCB A;  4IKF A;  1E17 A;  2ZME C;  3KE2 A;  4HSR A;  1YX5 A;  3KP4 A;  1MZB A;  1XN7 A;  2ID3 A;  2Z5U A;  1BOB A;  5LRS A;  3N97 A;  2RVC A;  5ILV A;  2ME0 A;  1YIT I;  3AG1 H;  3RKQ A;  4FHT A;  1R1T A;  2LKP A;  1U6G A;  2W25 A;  5CVI A;  1WJ5 A;  5HDG A;  3GX4 X;  2W1O A;  1YOV B;  1GVD A;  1CF7 A;  3E5Q A;  3JRE A;  1SFE A;  5GAD J;  2VC0 A;  4OU0 A;  1D5V A;  1GUU A;  3FBI B;  3G73 A;  1LEB A;  3LWF A;  4C2U A;  3ZQQ A;  1ZTR A;  3TOA A;  1OR7 C;  1FEX A;  3F23 A;  3G6E I;  1Z9C A;  3S15 J;  1I6H J;  1S5L C;  3DBH B;  4E7S A;  1XDU A;  1MH3 A;  2K3F A;  4LIT A;  4JP0 A;  2PMU A;  5K7F A;  4GO1 A;  3TGN A;  2EB7 A;  1R36 A;  3OYD A;  4ENK A;  5FB2 A;  1I1G A;  3FXR A;  3LFK A;  4UB8 C;  1IO2 A;  1ZR2 A;  4D1Q A;  4BNC A;  1MBE A;  4CHU A;  4UHT A;  5LRR A;  2X85 A;  1U5T B;  3E0J B;  1HKT A;  2OQG A;  2OF7 A;  3WU1 B;  3OYA A;  5E1W A;  2LBF A;  3T5X A;  2PJP A;  3K4N A;  3PNY A;  5D5U B;  4A93 J;  4DZJ A;  1E3O C;  1T8I A;  1IF1 A;  2XGE A;  4YIR X;  3RQI A;  1YG2 A;  2XRL A;  3OYJ A;  3FKI J;  2CYY A;  1YRN B;  4BEH A;  3V42 A;  4NNJ A;  1IGN A;  3LQQ A;  2DMP A;  2ISZ A;  1UMQ A;  4DZP A;  5FRO A;  3KZI C;  4P1W A;  5IT9 K;  2GOM A;  2JRT A;  3IWZ A;  1BL0 A;  2GAU A;  2DA6 A;  2HI3 A;  3CO6 C;  4UY8 I;  1VND A;  4BL0 B;  4I09 A;  1TTY A;  1GT0 C;  2Z2S B;  3DU6 A;  4H0E A;  2FX0 A;  3U21 A;  2E1M B;  3CCQ I;  2P5K A;  1DUX C;  3DTE A;  5D5W B;  1KA8 A;  1XSV A;  3QU3 A;  4XOP A;  2OU2 A;  1XPX A;  1I50 J;  4LB5 A;  2W57 A;  3FM3 A;  3ZN1 A;  1IRZ A;  4MQV A;  3TBI A;  3OS0 A;  2OCC H;  3EQL F;  5IYD J;  2ZO4 A;  2HWV A;  4G6D A;  5B3S H;  4IOA F;  3LA3 A;  3GLL A;  4IX7 A;  1ZR4 A;  4G6T B;  3CO7 C;  1U2W A;  1S7O A;  3G3Z A;  4I02 A;  3GW2 A;  3FDY A;  3F3X A;  2MD0 A;  2EK5 A;  4MEX F;  4ZZD A;  3E5X A;  4A3L J;  3V8L A;  2J5P A;  1YO5 C;  3AAF A;  3HTS B;  4G94 A;  3JRF A;  3FHZ A;  2EH3 A;  2EFP A;  4J00 A;  1K6Y A;  2XV4 S;  3BQY A;  3O6B B;  3CJQ B;  4BDZ A;  2HDC A;  1VF9 A;  5M3F J;  1VQ5 I;  2XRO A;  2I10 A;  2L4M A;  2ESN A;  5E3N A;  5FKO A;  4XRS A;  3ABM H;  4AWX B;  1PUF B;  2DMU A;  4ZDO A;  2M34 A;  1T0F A;  3HPG A;  1R4N B;  3S3M A;  4JK1 X;  4AYB N;  2CWE A;  2IW5 A;  4BHP A;  4CYD A;  1V5E A;  3ZPL A;  3FXK A;  4NUB A;  2HU9 A;  4DJA A;  4OIO F;  4IF4 A;  3J7A O;  4XL9 A;  3TL4 X;  3ZMU A;  3K4K A;  3P9C A;  4B8X A;  2XRN A;  1D1C A;  2BE5 F;  5ED4 A;  4KT6 A;  5AON A;  1H9T A;  1IXR C;  1FIP A;  2OBP A;  3GTO J;  1R71 A;  1X3W B;  2H94 A;  1IV6 A;  2IBD A;  2GWR A;  4U7B A;  4I01 A;  3ZQL A;  2R7Q A;  1LEA A;  2TDX A;  4XK4 A;  1DP3 A;  1JKQ C;  2HGC A;  2V1X A;  5DM6 F;  2GXB A;  3LSH A;  2PQ8 A;  4L9N A;  5KVR A;  1GDT A;  3BRO A;  2HQA A;  3GXO A;  2HPM A;  2CV0 A;  4B44 A;  3TP3 A;  3HSF A;  3QQA A;  3T8R A;  3BDD A;  4RAZ A;  4LIU A;  2RNG A;  1ULY A;  4PJJ A;  1QHG A;  1YW9 A;  1IJW C;  1NG7 A;  2K86 A;  3G4S I;  2CGP A;  2XAQ A;  3LSR A;  4JYK A;  1TNT A;  4FCY A;  2FF4 A;  4MTD A;  4IHV A;  3DPU A;  4A3C J;  1WJC A;  2L0K A;  2DLL A;  4WXD A;  2B63 J;  2N8G A;  1XMX A;  2M8E A;  2O5R A;  2DMN A;  1MGT A;  5J8F A;  1F5T A;  5H6Q A;  4JX4 A;  5DD4 A;  2FNP A;  4L9J A;  4XKW A;  2IEK A;  3PUF A;  4HA8 A;  1TP4 A;  2R7U A;  3VSK A;  2HOS A;  3GLX A;  3ERM A;  1S72 I;  2M30 A;  3F6O A;  2VT3 A;  2VJ5 A;  4UB6 C;  4JQF A;  1FSH A;  1XGN A;  1EH8 A;  3VEP A;  2V1D A;  2A5Y B;  4O3M A;  1HA8 A;  5IT9 Z;  3CES A;  1L3L A;  5F0H A;  5EEH A;  3E6C C;  3HHH A;  4C3I J;  1B9M A;  2GA1 A;  2FOK A;  1P92 A;  4HV6 A;  5AIQ A;  2FA5 A;  1WJE A;  1S29 A;  3P9K A;  1ZRE A;  4EEF G;  3WE3 A;  3ZMS A;  1KU2 A;  4FT8 A;  4AC0 A;  4BU2 A;  3GO5 A;  1MMN A;  4TV7 A;  3U1D A;  4E4H A;  1G59 A;  2L3D A;  3BT9 A;  2EIJ H;  3KPH A;  1QZZ A;  2AHQ A;  4JBA A;  3FZV A;  2K9L A;  3K4C A;  4WXC A;  3WTT C;  4OAZ A;  1OCR H;  1UHW A;  2L54 A;  1TLH B;  1XB4 A;  4LLN A;  1YRN A;  1W7P A;  2RAE A;  2RV8 A;  4CYC A;  4HQM A;  1BJA A;  4LG0 A;  3TKY A;  1XS9 A;  2QEX I;  1FY7 A;  3CP8 A;  4IHX A;  5M3M J;  3I4N J;  4A3G J;  2DPD A;  2BW3 A;  1B9N A;  3TQN A;  1K6O A;  1SD6 A;  2VE8 A;  4PCQ A;  2XB0 X;  4A6E A;  2VON A;  5ICC A;  4XON A;  3WGG A;  5LEK A;  3RZD J;  4LJZ F;  3ABT A;  1MND A;  4EGY A;  2P81 A;  2PBI A;  1WJF A;  5FO5 A;  2G0E A;  2R7W A;  2B7E A;  1UHM A;  2P4W A;  5ERI A;  3IHU A;  1ITY A;  2LC2 A;  2P6T A;  2VQC A;  2Y31 A;  1IW7 F;  1RRJ A;  1LFP A;  1RIO H;  1W5S A;  4W97 A;  1SD5 A;  4OIN F;  3HHG A;  3GTL J;  1TWG J;  2DJN A;  2H8R A;  3L00 A;  3HBL A;  4KNY A;  1T0F C;  2VKD A;  3PFI A;  1ZLK A;  1ZEL A;  1D8J A;  2V9P A;  2QLZ A;  1EV7 A;  1HF0 A;  3TMO A;  1XGO A;  5LBQ A;  1Y1W J;  3CC7 I;  2JT1 A;  3CCV I;  2WB1 A;  3ZQH A;  4RGU A;  1VI0 A;  2PMZ N;  4CCK A;  1X1P A;  3NQO A;  1S3J A;  5C44 J;  2G7H A;  1G4D A;  2W7N A;  1QZY A;  5DUK A;  2DOF A;  5FD5 A;  3CLQ A;  3QU6 A;  2BY2 A;  3EUK L;  3GTP J;  1FPQ A;  3QRF F;  4GGG A;  1OQY A;  2X48 A;  1YHQ I;  1I5Z A;  1Z0X A;  3HGG A;  4IXA A;  3ZMZ A;  4BQN A;  3JSO A;  3MWM A;  5CYV A;  5B66 C;  1K78 A;  2DCE A;  1BC7 C;  1WI3 A;  2CFO A;  2ZJR F;  2R7X A;  3C2G A;  3PQK A;  3KET A;  5E17 F;  1EKE A;  1HCR A;  2FRH A;  4XSX F;  3OIO A;  5LHI A;  4JOM A;  4A5N A;  4CSW A;  3BZC A;  3H3U A;  4BE0 A;  1OCO H;  2F48 A;  4DBQ A;  5KHD A;  3VB2 A;  5C4X J;  2JA2 A;  3A1Y A;  3AG3 H;  5EEG A;  2MAB A;  5EEA A;  3COA C;  2STW A;  1YLF A;  2XPU A;  2IS2 A;  2VE9 A;  4NDL A;  4BQQ A;  3J7Z I;  1XDS A;  2ESH A;  2LSO A;  2KRH A;  4H4K C;  1U9O A;  3ESW B;  4A0Y A;  2Y2Z A;  1HBX G;  3A01 A;  3OOP A;  5CPR B;  1TWC J;  4IJA A;  3SZT A;  4BEH B;  1AOY A;  2XGX A;  3DEU A;  5J3L A;  2H09 A;  1OYI A;  4IHW A;  1R23 A;  1N75 A;  1W5T A;  4G12 A;  1UZC A;  1FYK A;  1XSD A;  3MKW B;  4MGR A;  2E1C A;  3A4C A;  1IXC A;  2MC3 A;  4I7H A;  3ASN H;  4XM3 A;  1YJ9 I;  1D0X A;  3BCA A;  3DV8 A;  3TO6 A;  5C3E J;  1WI9 A;  3ABL H;  4M9Z A;  1IRG A;  3IV5 A;  2DJI A;  2M1B A;  2LTP A;  1Z7L A;  3T0Y A;  2KIU A;  2D5V A;  4U0W A;  1T39 A;  1HOM A;  1YW8 A;  3I4P A;  1ZRD A;  2CFX A;  1LKX A;  1TW3 A;  2X6Y A;  3HRT A;  2AQE A;  3DF8 A;  3HYI A;  2P5V A;  3QOD A;  2XVC A;  3D0S A;  3LA7 A;  3CC4 I;  3DBL B;  3JR9 A;  2VBY A;  2X4H A;  1JTX A;  4EM0 B;  3H3Z A;  1H89 C;  1Y56 A;  4OIQ F;  2CG4 A;  4F92 B;  4P5O A;  3S14 J;  4ENJ A;  4P96 A;  2CMP A;  4YEJ A;  5LGN A;  2E34 A;  3MAJ A;  2EA2 A;  1LDK B;  2JUC A;  3V7R A;  5H2F C;  2R5Z A;  3WTW C;  1BI2 A;  5BQT A;  1ZYR F;  3OSF A;  4OWR B;  1WFX A;  3L7W A;  5FJ8 J;  2ZME A;  5TRD A;  1JHH A;  2A5W A;  2QA4 I;  3CMY A;  3WGI A;  4UUT A;  1D1B A;  4RS8 A;  2CQK A;  2O61 A;  2CRG A;  3OYN A;  2NVY J;  2OUM A;  2KRC A;  2ZXJ A;  4HX4 A;  2VJ4 A;  3CDL A;  5DCF A;  2Z16 A;  2JN6 A;  3KYC B;  1O57 A;  2LBF B;  2CQN A;  2F6C A;  5F0F A;  4LLL A;  4EAT A;  5K7Z A;  2NXN B;  2KQR A;  2E5N A;  1ETW A;  1GVJ A;  4PFP A;  2VOO A;  4LD5 A;  1BR2 A;  5J6X A;  5M5W J;  1PUE E;  2O9L A;  1IN8 A;  3G1L A;  4NQW A;  3JRD A;  2E7X A;  1Z21 A;  5BS6 A;  2V9V A;  1MIJ A;  3BPV A;  1TQI A;  4QSH A;  3H36 A;  1Y1V J;  3CME I;  4AVP A;  2E60 A;  2NS7 A;  3BG6 A;  4CA0 A;  5CVU A;  4F91 B;  4CCM A;  4RB2 C;  3IRQ A;  1IZ1 A;  3FM5 A;  1W36 D;  4PGG A;  2YR2 A;  2DQR A;  3F21 A;  1FWZ A;  3BLY A;  1VFC A;  2FSW A;  2DMQ A;  4ESF A;  4A3D J;  4UV8 A;  3DPT A;  1K7A A;  2DA2 A;  2JA6 J;  4NC6 A;  1N77 A;  1MJB A;  2KHM A;  3KP6 A;  5M5X J;  1HQC A;  3MKL A;  4WWC A;  2K40 A;  4M71 A;  4PJN A;  1V55 H;  4G7O F;  1XX5 A;  1IUY A;  3MKY B;  4IPA A;  5GPC A;  3E6M A;  2LY9 A;  3VOE A;  3LSJ A;  3SEQ A;  4M3D A;  1QGP A;  2L5Q A;  4IHS A;  3QP5 A;  2FBI A;  3LAJ A;  3BR6 A;  2XAU A;  2XGD A;  1W36 C;  4IHY A;  3LQR A;  2HYJ A;  1OCC H;  4II3 A;  1ZAR A;  3AG2 H;  2PN6 A;  1VQL I;  5D4R A;  3P9I A;  1IRX A;  3FXO A;  3A01 B;  1HW2 A;  2DXI A;  2VKH A;  5ICG A;  4I98 B;  2FQ3 A;  2NS8 A;  1P2F A;  4N9H A;  4L5E A;  4ZYH A;  3HXL A;  1ZRF A;  2ACJ A;  2IGN A;  4EM2 A;  3WHC A;  3CZ6 A;  5GAG J;  2VBX A;  5L3E A;  2FXA A;  3A0B C;  1XMA A;  2GIV A;  2KPM A;  3EUH A;  3CJT B;  1MBJ A;  3I55 I;  2K9S A;  4A3J J;  2NVT J;  2ISY A;  3Q9V A;  2CUJ A;  4FX4 A;  3M1C A;  1WWX A;  3S1M J;  3D5L A;  3K0L A;  3GFJ A;  3OMY A;  2UV1 A;  3V8J A;  3EDP A;  1LVA A;  5A2Q Z;  2GIZ A;  4NB5 A;  4NC8 A;  3HRM A;  1FC3 A;  3FXQ A;  3OV8 A;  4P9U A;  1VZ0 A;  3S2W A;  1JKP C;  1FYL A;  2Z9O A;  4DYQ A;  1WSU A;  1VQ4 I;  3SDB A;  1TWH J;  1P9Q C;  3KEO A;  3K1N A;  3L2R A;  3GEZ A;  1LE8 A;  2WBM A;  2Z3Y A;  2Y9Z A;  2ZJ2 A;  3S1R J;  3RPQ A;  3OYL A;  1AA7 A;  2NAZ A;  3B73 A;  3GFL A;  3FHN A;  4UUS A;  3H9J A;  2EBI A;  1X3Z B;  4L5I A;  1XTA A;  1MW7 A;  5F04 A;  4S0H B;  2HKO A;  2M4G A;  2EZK A;  1JGG A;  3K4L A;  1OYW A;  2EPF A;  5DUI A;  4QLC U;  4KIS A;  2A6E F;  3GF2 A;  3D5S C;  5E8I A;  3Q0V A;  2R5Z B;  2MLK A;  1XG1 A;  1UG2 A;  3ZRG A;  3QYB A;  3RSN A;  3FK7 A;  2KP6 A;  3M8E A;  3HSR A;  3QOE A;  4WX9 A;  1ZG1 A;  2QSF X;  2EA4 A;  2DA1 A;  3F72 A;  5CVR A;  3D5R C;  3IL2 A;  3TDZ C;  1F43 A;  4ENM A;  3G1O A;  1DDN A;  4L0Y B;  1RES A;  4N4O B;  3WG9 A;  4I76 A;  2Y9Y A;  3HUG A;  3C18 A;  1JJ8 C;  4XLP F;  1U9N A;  3ISP A;  3FMR A;  3CP2 A;  4G8X A;  2PFB A;  2YX4 A;  3OYM A;  2CU7 A;  1H88 C;  2Q8K A;  1ZG5 A;  3MQ0 A;  5D6F A;  1MKM A;  1J2X A;  4U0Y A;  1J5Y A;  5DS9 A;  3LST A;  3G71 I;  4XID A;  2LH9 A;  2HR3 A;  5EG0 B;  1UAA A;  3OSG A;  4KT5 C;  4E6K G;  2KMU A;  1KU9 A;  3CJN A;  1J9I A;  1JHF A;  3ZN0 A;  1FLI A;  2G9W A;  4Y52 J;  2V1N A;  3ZQ7 A;  1W7P B;  4QPO A;  3IUO A;  3ASO H;  4ABZ A;  4CYC B;  3OYE A;  3R60 A;  2ZB9 A;  3JRI A;  1XSX A;  2IGM A;  4EJU A;  2DT7 B;  2MSY A;  4Y3O A;  2COB A;  4YIF A;  1MJ9 A;  4B47 A;  1P4A A;  2DTZ A;  3SYT A;  3MCZ A;  3GUD A;  1G8X A;  4FET A;  1FTZ A;  2K9N A;  4PJL A;  4ZYE A;  1U8B A;  3LMM A;  3H1C A;  1HKQ A;  1BBY A;  3ELK A;  5FGM A;  2VUM J;  3J7Y J;  3BR5 A;  4YRV A;  4C3J J;  1ORK A;  4LMY A;  4JX6 A;  1JE8 A;  1LDD A;  1WCM J;  3OS2 A;  4AIJ A;  3L2W A;  1FTT A;  2DDB A;  5BNG A;  2DA3 A;  4RM2 A;  4LK0 F;  4E7L A;  1S7E A;  4OMY A;  2HYF A;  4CCJ A;  2QQA A;  1B4A A;  1OCZ H;  2A69 F;  3LOC A;  4DOZ A;  3Q5F A;  1IN4 A;  1V5F A;  2QWW A;  2O7O A;  2L7F P;  2ZJQ F;  1MMS A;  2IVM A;  2WY8 Q;  5FLM J;  2LY2 A;  1R6R A;  4A12 A;  2BV6 A;  3BJ6 A;  3QYE A;  4XNF A;  1KYW A;  1KGS A;  4S05 A;  1BIB A;  5KK1 A;  4ITV A;  1VTN C;  2EIM H;  4MFE A;  2STT A;  4I99 C;  4V2G A;  2ZNZ A;  4BY7 J;  2M7B A;  3GFM A;  2A05 A;  4XRS G;  3SEZ A;  4KIT B;  1SMT A;  3BG7 A;  3GZ5 A;  2QYO A;  5LHG A;  3BR2 A;  3S32 A;  2WV1 A;  3HIF A;  3Q9S A;  2IA0 A;  3BY6 A;  1UST A;  4I0B A;  2MA3 A;  3EYY A;  2A6T A;  2QQB A;  2LMD A;  4BDY A;  1MMG A;  2ETH A;  4M6Y A;  4PDK A;  3RPU D;  3U9G A;  1DPU A;  3LSM A;  2CV2 A;  2FML A;  2JWT A;  3K2Z A;  2GLO A;  4P55 A;  2ZME B;  2KL4 A;  1NK2 P;  1W0U A;  3DPL C;  3WTV C;  3ROU A;  2DA5 A;  2VIX A;  1TBX A;  1LPQ A;  3S16 J;  1B59 A;  2L7M P;  3GME A;  3R61 A;  1R5G A;  2QZ8 A;  3IC7 A;  2C6Y A;  2AXT C;  1G3Y A;  4U0V A;  3KP2 A;  2ME6 A;  1L0O C;  1TQP A;  2QEN A;  2LR8 A;  5TJJ A;  5HLT A;  3S2D J;  1HKS A;  2LRE A;  2FMY A;  5D8K B;  2HDW A;  5CQG A;  2OQR A;  4U87 A;  2CO5 A;  5L3G A;  4E7I A;  1VQK I;  3ZXS A;  4ZYA A;  1GV5 A;  2KZG A;  3ZQG A;  5GPA A;  2BY3 A;  4N0B A;  5FLV A;  2M0C A;  2EWN A;  3REO A;  3ZCO A;  3KP5 A;  3R0J A;  1V54 H;  2P6S A;  2VJJ A;  2RNJ A;  3BWG A;  5E3M A;  4BAC A;  4XKB A;  3DU5 A;  5LFA A;  2GOX B;  2ZSH B;  3CQZ J;  2CQ7 A;  1MDM A;  1KQ0 A;  4PFO A;  2VBW A;  3DEW A;  1SD7 A;  2M3A A;  4MQ9 F;  2NVQ J;  2KDZ A;  3KLO A;  2VB6 A;  1R1V A;  2EQR A;  2DFI A;  5DCM A;  3ULQ B;  2QM3 A;  1WH7 A;  1YQA A;  4IQ4 A;  3UR3 C;  1G2H A;  2QGU A;  2UWM A;  4PJ0 C;  1LQ1 A;  1KQ9 A;  1BC8 C;  3F8M A;  1MJA A;  4GYG A;  3HOZ J;  4XN3 A;  3RTR A;  4UNO A;  2ZCW A;  1N25 A;  4JX5 A;  2JA7 J;  4MO7 A;  3L1P A;  1U78 A;  3I5U A;  2R7T A;  2Q2E A;  2EZL A;  5JR3 A;  3E7L A;  2FNA A;  1AU7 A;  1WRJ A;  3WHB A;  4CXF A;  3HEF A;  4F93 B;  3H35 A;  2NYX A;  3H5N A;  1R9T J;  3EUH C;  4LLG F;  1RR7 A;  3ZR8 X;  1VQP I;  4X0G A;  4M3G A;  3W3C A;  3J81 Z;  3OYG A;  2QCO A;  2V7F A;  3T8T A;  1IC8 A;  3KLN A;  2R92 J;  5J47 A;  5DD8 A;  3J7A Y;  3I64 A;  3GTQ J;  1E3P A;  1SVO A;  2Q0O A;  3HPH A;  1EJ9 A;  2A6H F;  2I8D A;  4HW0 A;  1TNS A;  4HYE A;  3R6S A;  4HNU A;  2QKM B;  3OYC A;  3S17 J;  1R58 A;  1QVT A;  2EIK H;  3IH4 A;  4RGR A;  5H20 A;  4R79 A;  5JVG F;  4XIC A;  3HKZ N;  4D5C A;  2QBY B;  5M5Y J;  3HDD A;  1TWF J;  1XMK A;  2OZU A;  3DTI A;  1I27 A;  3M4O J;  2NS0 A;  3DFG A;  1YE9 A;  4LIV A;  3RYR A;  1QA6 A;  3CUO A;  4PJM A;  2O8X A;  4YII A;  3ONQ A;  5K7H A;  2E1O A;  1DPR A;  3CDH A;  4D7N A;  4Q4Z F;  5F1J A;  2L7Z A;  5JHF A;  1JXS A;  3CCE I;  3VWB A;  1T98 A;  2CJJ A;  4LFU A;  4KIC A;  3HOW J;  2VC1 A;  4BYY A;  5HLG A;  3A2K A;  2DN0 A;  2UZK A;  1IDY A;  2ZFU A;  1ETK A;  3M7G A;  2H1K A;  4ZYD A;  5FFX A;  3ML6 A;  3KP7 A;  1X1A A;  1A36 A;  4F7Z A;  3Q0W A;  1LDJ A;  1O4X A;  2KT0 A;  3W6K B;  2I5U A;  3HRS A;  3AL0 B;  4RM3 A;  4XQF A;  1USS A;  3FXL A;  5E3O A;  5L3F A;  4BXX J;  3KYL A;  2GA2 A;  1ZHF A;  2VL8 A;  4LK1 F;  1Z7U A;  4D9J A;  4U88 A;  3N4M A;  1S9H A;  2VQG A;  2V6E A;  2HVS A;  3L2Q A;  2LF8 A;  1VQO I;  2OAZ A;  5HS8 A;  1S8N A;  2DMT A;  4LG3 A;  2CQQ A;  4MEY F;  3V8K A;  4E7H A;  1BR1 A;  1JUM A;  3KZZ A;  1E3H A;  2R7O A;  2L9V A;  3W2V A;  2HOE A;  3CC2 I;  5HDK A;  1K4T A;  5JVT A;  5DTD A;  4GXO A;  2HQR A;  2HYG D;  2DFH A;  2ZKZ A;  3MEX A;  1HDP A;  3PL8 A;  2GXG A;  2DA7 A;  4D0P A;  2OA4 A;  3S2H J;  2E1M C;  4AVZ A;  3HUG B;  4RB1 A;  1U5T A;  3H9G A;  3GZ6 A;  2GQQ A;  2A07 F;  2VOP A;  3ZMT A;  3EUA A;  1IXS B;  3K4M A;  3M3Y J;  2COM A;  3K1P A;  4XRF A;  1JUP A;  1H0M A;  1WZ2 A;  4DBR A;  3NWS A;  3H3V K;  4UVC A;  2MYS A;  2JQ7 A;  1A5J A;  1ZLJ A;  1YTY A;  4E7J A;  1Z1D A;  2F2E A;  3B02 A;  2IRF G;  4M73 A;  1D5Y A;  1E0E A;  2W85 A;  1GV2 A;  2HEO A;  5CVV A;  4B4C A;  2O6G E;  1NHA A;  1TT5 B;  2DK5 A;  1XGS A;  3HSE A;  2OD5 A;  4L0Z B;  1NH3 A;  2HQN A;  2XPW A;  5HNF A;  1HST A;  3WTZ A;  1ON1 A;  2V6C A;  4HLX A;  2B0L A;  3OL3 A;  4IVN A;  3BG3 A;  5KNL A;  4CO8 A;  5DV5 A;  2KIS A;  2Z1D A;  2XPV A;  4EM1 A;  1XCV A;  5LD2 C;  5J8C A;  1STZ A;  1J09 A;  2Y30 A;  2CUZ A;  4DW6 A;  1M1E B;  1JT6 A;  2E19 A;  4M3F A;  2DYR H;  1HXD A;  4EJV A;  4HPQ A;  4KA4 A;  1OCT C;  2BXZ A;  3KP3 A;  2R7D A;  3ABK H;  2L2O A;  3OYB A;  2DT5 A;  2WAF A;  2V79 A;  1KU3 A;  4G7Z F;  1LNW A;  5F08 A;  2FOW A;  5DDG A;  2QSG X;  4LOC A;  3ZQF A;  4I0A A;  3KEQ A;  4AID A;  5IT3 A;  3IKV A;  2W48 A;  4BHB A;  2YX7 A;  1LE8 B;  2YSR A;  4Y17 A;  3BG5 A;  4HLY A;  1AHD P;  5ILS A;  4BJ6 C;  4FE7 A;  3CCY A;  5E8G A;  3EPZ A;  2HTJ A;  1BOA A;  1Z3X A;  3F9K A;  4EQQ A;  4BGD A;  4WF2 A;  3GFI A;  1BI0 A;  3V4G A;  2R7S A;  1X2M A;  3WE2 A;  3HOV J;  1BW5 A;  3GCM A;  4A3B J;  3C1D A;  3CD6 I;  3KZY A;  2GM4 A;  4HAM A;  2VI6 A;  4B3X A;  1U0J A;  2DFF A;  2IGK A;  3WTU C;  4BKX A;  4GCV A;  1W1W E;  3DXJ F;  3O8G A;  2CW7 A;  3FF5 A;  3PSF A;  3CCS I;  4BY1 J;  2XGC A;  1ETV A;  2QQ8 A;  2XF5 A;  1X1D A;  3MKZ A;  2VT2 A;  2M87 A;  4F55 A;  1Y6I A;  2JMW A;  4BS9 A;  2LLK A;  4ZH4 F;  3S93 A;  4UVB A;  2FE3 A;  5B1B H;  1X1B A;  1WVR A;  3K7A J;  1ZGW A;  3RZO J;  4ESJ A;  2KKO A;  4EV0 A;  2QF7 A;  1B8I B;  1B1B A;  2H1L A;  2F5F A;  3C2H A;  4GRI A;  1EH6 A;  2EV0 A;  1X1C A;  4B3A A;  4FQG A;  2E2H J;  3F8B A;  2LF7 A;  1BI1 A;  4XKC A;  1IN7 A;  1RUO A;  5EG0 A;  3J80 K;  1O3T A;  2ZBK A;  3A0H C;  1D3Y A;  2EJR A;  4OIR F;  1SVL A;  1BJZ A;  2XC7 A;  4U7D A;  3ERE D;  3FMS A;  1I1S A;  4FIS A;  5KCM A;  1YIJ I;  4PUS A;  2IA1 A;  1Z77 A;  1SAU A;  5F1R A;  3TOB A;  4AYB A;  1F4K A;  3WU2 C;  5LLQ A;  2MBF A;  4AIH A;  5IY5 H;  1WJB A;  2B9S A;  2ELK A;  1SC7 A;  1VQN I;  5EDN A;  4YFX F;  2DT6 A;  2EFQ A;  3W6V A;  3L09 A;  4OAY A;  3QPS A;  3JCU C;  4MNU A;  3ZMD A;  1J59 A;  3I0T A;  2YPR A;  4A3I J;  4RB0 A;  1WKM A;  3L2V A;  2PMZ A;  4A3E J;  4HRI A;  2NVX J;  1EF4 A;  1I3A A;  4I6Z A;  2F4I A;  3K69 A;  1KYZ A;  3BQZ A;  2HXO A;  2OPT A;  3K4B A;  4HEA 2;  2X51 A;  3KYD B;  5CLS A;  2XSD C;  2XIG A;  3E6D A;  4X1E A;  4QPQ A;  3S3O A;  3P5J A;  3F22 A;  2XDV A;  3OOU A;  1MSF C;  2GBY A;  2KIQ A;  4HNT A;  1XD7 A;  2NOJ B;  3VFZ A;  4HF1 A;  3LSK A;  1TQM A;  5IPA A;  1F1Z A;  5E18 F;  3LSG A;  1QBJ A;  4Y7N J;  3VYU B;  4Y4R A;  2WAE A;  5J1U A;  4PZJ A;  3SJM A;  1K4S A;  4OIP F;  2W84 A;  2OTL I;  1K61 A;  1JGS A;  2A68 F;  1REP C;  5IOZ A;  4YFN F;  4A3F J;  2LY1 A;  2HFH A;  2EFN A;  2WAQ A;  1UEL B;  3K70 D;  4Z2Y A;  2M4K A;  3NEU A;  5GP9 A;  1MSE C;  1VQ6 I;  4XLE A;  2MH2 A;  4B09 A;  1K79 A;  2Y75 A;  2HZT A;  3E6B A;  1FOK A;  5BPI A;  2HOT A;  2KFD A;  1KON A;  4A2U A;  1AKH A;  1B72 B;  1VQ9 I;  5FRN A;  5HLH A;  3RCO A;  2K7L A;  2V9K A;  1A31 A;  1QU3 A;  2XAS A;  4KMF A;  1ACI A;  1OFC X;  3DQV C;  2JSP A;  3ECO A;  4P9F A;  1WQ2 A;  3DKY A;  3NAU A;  1SFX A;  4ZDP A;  4A69 C;  1Z6R A;  2QBY A;  2XAG A;  3AL0 C;  1J7K A;  3I3L A;  3KX2 A;  4ZDL A;  3W6J B;  2DOD A;  1FOX A;  3GTG J;  3S8P A;  5J4V A;  3CF5 F;  1ZKG A;  1VQ8 I;  1AWC A;  1IG7 A;  5DYM A;  2YU3 A;  3JAM K;  1NTC A;  3R0A A;  2PX9 A;  2UXX A;  4LGW A;  1KQ8 A;  3PFY A;  5KAI C;  3HOS A;  2M5W A;  2EIL H;  3U2R A;  2P7V B;  2K85 A;  2YS9 A;  3CMM A;  3HZJ A;  2IAI A;  3ECH A;  1MMD A;  3A03 A;  1Z67 A;  2XKO A;  1Y39 A;  2HDD A;  3CF2 A;  5EZH A;  1MD0 A;  3U1K A;  2IS6 A;  3TW7 A;  5B1A H;  3B6C A;  3BR3 A;  2R4G A;  4M9X A;  4A3K J;  1QPM A;  2AQF A;  4HOB A;  4Q47 A;  1VQ7 I;  2DPU A;  2BVL A;  3GTM J;  3F0C A;  3GYH X;  1EH7 A;  3M1E A;  2LOO A;  2NNN A;  2BY1 A;  2O03 A;  1N78 A;  3BC8 A;  2V26 A;  3CJR B;  1FYM A;  2PG4 A;  1SAX A;  2DOA A;  4N9I A;  4M3B A;  1RPW A;  4BQO A;  1FX7 A;  5TGT A;  2M0M A;  3MN2 A;  2UUZ A;  3PJR A;  1ZG3 A;  1HW1 A;  2ZXW H;  3W2A A;  1U8R A;  3UKG A;  1FJL A;  3MFK A;  1PVE A;  2ZXH A;  3BZ6 A;  4K2E A;  2VJI A;  4RAG A;  1W0T A;  4O6J A;  3BTI A;  3WTY C;  3RIR A;  3ZMV A;  4EJO A;  2ADU A;  2NNY A;  4L18 B;  2JK3 A;  1O3S A;  3DWL E;  4NBQ A;  1Y0U A;  2Y0S N;  2ZXI A;  1ONV A;  5LGT A;  2XHK A;  4C30 A;  2MFZ A;  1MH4 A;  1BR4 A;  4YFK F;  1X58 A;  2CH0 A;  2QVO A;  2PEX A;  1ON2 A;  4RGX A;  3I9V 2;  2R0Q C;  5CJ9 A;  3DCF A;  3LA2 A;  3TDU C;  2HTS A;  3CCM I;  1FOW A;  5IOY A;  1JKO C;  2JA5 J;  2WWY A;  1W5C C;  2WA0 A;  3RKX A;  2HKX A;  3B6A A;  5GAE J;  5ILU A;  2CUF A;  4LG0 B;  2RRE A;  4XLH A;  1QPI A;  2H27 A;  1A35 A;  4RB3 C;  4XKV A;  2L9R A;  5B5E C;  3M8F A;  1I3Q J;  1G3S A;  4V2F A;  1DU6 A;  1YJN I;  3BTJ A;  5FKK A;  3BTC A;  3H92 A;  5L3C A;  1UG0 A;  3O3K A;  2Y69 H;  3QPH A;  2W24 A;  4UVA A;  5J4Y A;  4IRI A;  4ETS A;  2MG4 A;  3OYF A;  4XLF A;  2E5Z A;  1YS7 A;  3CLO A;  3QYF A;  3CCJ I;  1H9G A;  2PJR B;  3NRV A;  3JW4 A;  2F5C A;  3OL4 A;  1U5T C;  5F64 A;  3GBG A;  5EGO A;  1ETO A;  4KIG A;  5FKN A;  3H0G J;  1LVK A;  2H8W A;  4V19 K;  3KIO A;  1SD4 A;  2CUE A;  2QSH X;  1TWA J;  1YYV A;  4L9T A;  3HM5 A;  3SDG A;  4M9S A;  3TO7 A;  4ZC3 A;  4XN0 A;  4E7K A;  2CS3 A;  5JLX A;  1BM9 A;  4A5M A;  1OPC A;  1QZE A;  4CDG A;  2CW0 F;  5FD6 A;  1ZGA A;  4MLO A;  1JT0 A;  5E20 A;  2Y0M A;  1HLV A;  1RZ4 A;  4DGW B;  5F6F A;  2DDA A;  1WJA A;  2X0L A;  3PNT A;  1AKH B;  1Q1H A;  1B72 A;  2F5D A;  3GZN B;  2WY7 Q;  2LKS A;  3C3W A;  2K5C A;  4HF0 A;  4BUP A;  2L9N A;  2R5Y A;  2MW8 A;  2FJ1 A;  3HC7 A;  1ENH A;  4BHC A;  4XRM A;  4GFB A;  2W4S A;  4PSW A;  1MBH A;  3WOD F;  5IP6 A;  4CGZ A;  5AIP A;  1YIO A;  3MVP A;  2HVR A;  4ZTF A;  2D1V A;  2YUS A;  3N05 A;  5ICF A;  5HOD A;  3A02 A;  2XAJ A;  2PMH A;  2E36 A;  3LFU A;  2IS4 A;  4E70 A;  1POG A;  2K3P A;  4XLN F;  1IUF A;  1F9N A;  1WJD A;  3HL2 A;  3S1Q J;  4M72 A;  2CV1 A;  4X6A J;  1YW7 A;  2FUG 2;  1TC3 C;  2P8T A;  3OIP A;  4IO9 F;  4HNV A;  5L3D A;  3SHF A;  2DBB A;  3QPL A;  4XBF A;  4HV5 A;  4C2T A;  3GTK J;  4IL6 C;  2LYC A;  3JTH A;  2E7W A;  3EET A;  1OR7 A;  1D0Z A;  1YS6 A;  1W4M A;  4NQW B;  2OZ6 A;  3LAP A;  2XKP A;  3O2P E;  1R49 A;  3CCL I;  4RBO A;  4Q5S F;  3JRA A;  4ANJ A;  2Z99 A;  1PP8 F;  1P7I A;  2P0W A;  4NHJ A;  3OWT A;  1DP7 P;  4R8H A;  3WG7 H;  1PYV A;  4BBS J;  2KRF A;  4RGS A;  2VBZ A;  1LFB A;  4CCL A;  4KYW A;  3JTG A;  4F52 A;  3FIS A;  1TW2 A;  3K2A A;  3I59 B;  1NG6 A;  5LGU A;  5EJC A;  2HXI A;  1MNM C;  5BMZ A;  4ENN A;  5D8L B;  2D1H A;  3AG4 H;  3NAR A;  3SZG A;  4MTE A;  5D6E A;  1P7J A;  3H9Q A;  1TL8 A;  3LSI A;  3QP6 A;  2LP0 A;  3TO9 A;  2ECB A;  5FRM A;  2BEO A;  3FMQ A;  4BBR J;  5HVQ C;  1UCR A;  2BHY A;  4M6V A;  1R7J A;  2XF6 A;  2XUB A;  4A0X A;  4FX0 A;  2IA2 A;  3FBN B;  4OOI A;  5FLX K;  2PI0 A;  3I56 I;  5K5O A;  3KFW X;  2ZJP F;  2KJC A;  2TRT A;  3M9A A;  1QNT A;  2DTR A;  5FKM A;  2QQ9 A;  4N4N B;  1YX3 A;  3ZP5 A;  3HRU A;  4IOC F;  4HX8 A;  4W1U A;  2JZY A;  3BOQ A;  3IP4 B;  4EVI A;  2JUG A;  3OR1 C;  3CMA I;  4HQE A;  3HOY J;  2HZD A;  2ICW G;  3O8H A;  4BE2 A;  3IWF A;  3V7S A;  1O3R A;  1RR8 C;  3HJE A;  1UHS A;  1RKW A;  3QWL A;  3MZH A;  1VQM I;  2LDU A;  1GLN A;  2NVU B;  3RPU A;  3CTA A;  3D1N I;  2ELH A;  5E1X A;  4ESB A;  3GTJ J;  1ETQ A;  1R22 A;  3HOX J;  3RJP A;  4FE4 A;  3MD2 A;  5J40 A;  1B8I A;  2HPI A;  1RI7 A;  1IV8 A;  1CGP A;  4BJ5 C;  1SFO J;  1Y8R B;  1SFU A;  4KUM A;  2IPQ X;  4XOT A;  4ZJZ A;  5IP9 J;  1T08 B;  2L4A A;  1K83 J;  4AM3 A;  5L3B A;  3IAS 2;  1S7A A;  3ZOB A;  3KEY A;  4KN4 X;  4NC7 A;  2ID6 A;  2DOE A;  4BE1 A;  2BBY A;  2CW8 A;  5J1R A;  4UUS B;  1QQI A;  3K10 A;  1R1U A;  4R1H A;  3VYS B;  1H8A C;  1SFK A;  2X9D A;  4QTR A;  3J81 K;  1JTY A;  2LVS A;  3R4K A;  4UXN A;  2VQH A;  3W2W A;  3OYK A;  2LNB A;  1MBF A;  3DTK A;  1SVM A;  2VXD A;  4HF2 A;  1NK3 P;  4Y13 A;  3P7N A;  1XGM A;  3F8N A;  3K4J A;  3IAM 2;  2KLO A;  2LK2 A;  3Q0U A;  1O7F A;  3IRR A;  1X19 A;  3CUQ C;  4C2M J;  2Q1Z B;  4L9V A;  3TW6 A;  4CUG A;  2X6O A;  1T38 A;  3MZY A;  1XC5 A;  1CF7 B;  4BH9 A;  4AU7 A;  4B48 A;  3LL7 A;  3PM1 A;  2A61 A;  4B1R A;  2NRA C;  1GHC A;  5HS7 A;  2X6W A;  2AS5 F;  2K4J A;  1Z6T A;  2L02 A;  2LD5 A;  2XB5 A;  1V3F A;  4HG2 A;  4MIM A;  1U3E M;  2KIM A;  1JI8 A;  2OV7 A;  2K4B A;  2L7K A;  2MC4 A;  1GXQ A;  1Q1V A;  1J0R A;  2K9Q A;  2A3S A;  4MHG A;  4CZC A;  3H0D A;  3K70 C;  1FP2 A;  2VN2 A;  1QO0 D;  2IS1 A;  3TED A;  3OY9 A;  2KIF A;  3NWT A;  5CVJ A;  2RKH A;  3M8J A;  1DQU A;  2O3F A;  2V1U A;  3ABU A;  1B6A A;  2GZW A;  4XR6 A;  1T33 A;  4O5V A;  2IJL A;  1CQT A;  1QRY A;  3SFI A;  1ZK8 A;  5GAH J;  4E7Z A;  1R4M B;  1X2N A;  2TCT A;  3BZK A;  3OYH A;  2MH9 A;  5CKT A;  3M07 A;  4IEJ A;  2BY0 A;  3DKW A;  5D5X B;  3OIQ A;  2X1E A;  4CIC A;  3J80 Z;  3JRG A;  3L2C A;  5E79 C;  2LG4 A;  2O0Y A;  1YFH A;  2R93 J;  2DA4 A;  5CQE A;  5LHH A;  4J01 A;  2E1N A;  3FXJ A;  4GYI A;  2D2W A;  3EYI A;  4DQ2 A;  4G9Y A;  3I59 A;  5F27 A;  4RMN A;  4KFC A;  3DKX A;  3OYI A;  3I53 A;  3LSP A;  1T56 A;  1X4P A;  1GXP A;  2WAD A;  3LNQ A;  4UUV A;  1FOY A;  3CDI A;  4HDV A;  4XLC A;  2H6C A;  3MMY B;  4HBL A;  1HSJ A;  1ZH5 A;  2VOD A;  3T1B A;  3GVA A;  3RKW A;  3C7J A; 
#chains in the Genus database with same CATH homology
 1A6I A;  3TP3 A;  5IPA A;  3QQA A;  1RET A;  5DS9 A;  4XID A;  3LSG A;  5EG0 B;  4DYC A;  4Y7N J;  3OSG A;  1IJW C;  1GDT A;  3LSR A;  4JYK A;  5JLW A;  5J1U A;  4FCY A;  4Y52 J;  2ECC A;  3SJM A;  4ABZ A;  4CYC B;  1K61 A;  4A3C J;  2L0K A;  2ZB9 A;  3JRI A;  5IOZ A;  2B63 J;  2N8G A;  4A3F J;  2VKV A;  1OCP A;  5GP9 A;  2DMN A;  2MSY A;  1MSE C;  2COB A;  4JX4 A;  2IEK A;  1PUF A;  1MBG A;  2DTZ A;  2HOS A;  2HOT A;  3HB9 A;  1FTZ A;  1AKH A;  2K9N A;  1U8B A;  1B72 B;  1BW6 A;  4QIW N;  2VUM J;  2LKX A;  3BR5 A;  5IYC J;  1OFC X;  5F0H A;  4C3J J;  3NAU A;  4A69 C;  1ORK A;  1SAN A;  4JX6 A;  1ZQ3 P;  4C3I J;  1WCM J;  2YU9 J;  2FD5 A;  3GTG J;  1FTT A;  5IYB J;  5BNG A;  2M2E A;  2DA3 A;  1ZKG A;  1S7E A;  1IG7 A;  4EEF G;  3LOC A;  1NTC A;  4AC0 A;  3S1N J;  2O7O A;  2L7F P;  3BT9 A;  5FLM J;  1RKT A;  2AHQ A;  2E2J J;  2YS9 A;  2IAI A;  3A03 A;  5IP7 J;  4MFE A;  4V2G A;  2HDD A;  1JKR C;  1YRN A;  5C4J J;  5EZH A;  1QVU A;  2RAE A;  4MFD A;  4BY7 J;  4CYC A;  1XS9 A;  3TW7 A;  3B6C A;  4XRS G;  3BR3 A;  4IHX A;  5M3M J;  3I4N J;  4A3G J;  4A3K J;  3BR2 A;  2WV1 A;  3GTM J;  3F0C A;  1APL C;  2XB0 X;  3PO3 J;  3RZD J;  5J1Y A;  2P81 A;  4M3B A;  1RPW A;  2G0E A;  1MBK A;  3IH3 A;  2O8K A;  3MN2 A;  2WAQ N;  2JWT A;  1ITY A;  3UKG A;  1FJL A;  2GLO A;  2Y31 A;  1NK2 P;  1W0U A;  1HDD C;  2DA5 A;  4W97 A;  1W0T A;  3S16 J;  3BTI A;  5EGO B;  5EZG A;  2L7M P;  2JK3 A;  3GTL J;  2DJN A;  1TWG J;  2H8R A;  3HBL A;  2Y0S N;  3HOU J;  1LFU P;  1DU0 A;  1MH4 A;  2ME6 A;  4D5F A;  1ETY A;  2LR8 A;  1X58 A;  3S2D J;  1HF0 A;  1Y1W J;  2R0Q C;  3DCF A;  1FIA A;  3ZQH A;  1VI0 A;  2PMZ N;  1GV5 A;  3ZQG A;  5FKL A;  5IOY A;  5GPA A;  5C44 J;  1JKO C;  4RDU A;  2JA5 J;  2M0C A;  5FLV A;  3B6A A;  9ANT A;  2CUF A;  1QPI A;  2R5Y B;  2L9R A;  5E3M A;  2HQ5 A;  3CQZ J;  3GTP J;  1I3Q J;  4V2F A;  2E2I J;  1JJ6 C;  1DU6 A;  2X48 A;  3BTJ A;  5FKK A;  3DEW A;  3BG9 A;  3BTC A;  1Z0X A;  3HGG A;  2NOG A;  2NVQ J;  1OJL A;  4M3E A;  2KDZ A;  2EQR A;  1WI3 A;  4FTH A;  1WH7 A;  2MG4 A;  2JJ7 A;  5E3L A;  1G2H A;  1HCR A;  4DYR A;  3OIO A;  4AUX A;  5EGO A;  3HOZ J;  3GBG A;  1ETO A;  5FKN A;  3H0G J;  4JX5 A;  2JA7 J;  4MO7 A;  3L1P A;  1U78 A;  5EF6 A;  5C4X J;  2VKE A;  2CUE A;  2EZL A;  1AU7 A;  3E7L A;  1TWA J;  5EEA A;  2EZH A;  3WHB A;  2XPU A;  3HM5 A;  3HEF A;  3SDG A;  4NDL A;  1R9T J;  1RR7 A;  5JLX A;  2JA8 J;  4M3G A;  1U9O A;  3I4M J;  2QCO A;  2Y2Z A;  1IDZ A;  4MLO A;  3A01 A;  3FK6 A;  4A3M J;  1IC8 A;  1JT0 A;  1HLV A;  2R92 J;  2AO9 A;  1TWC J;  3GTQ J;  1AKH B;  1B72 A;  1WPK A;  4D7M A;  2VPR A;  1JUS A;  5J3L A;  2R5Y A;  2MW8 A;  2FJ1 A;  4XRM A;  1ENH A;  3IH4 A;  1QVT A;  4GFB A;  4IHW A;  3S17 J;  1MBH A;  2WB1 N;  5IP6 A;  3FIW A;  1ETX A;  3HKZ N;  4G12 A;  4D5C A;  4XIC A;  3MVP A;  5M5Y J;  3HDD A;  1TWF J;  2YUS A;  5HOD A;  3A02 A;  3Q3S A;  3M4O J;  1POG A;  5K7H A;  5C3E J;  1BA5 A;  1IUF A;  2E1O A;  4D7N A;  5F1J A;  3S1Q J;  4X6A J;  5EYR A;  3IV5 A;  2CJJ A;  2LTP A;  1TC3 C;  3HOW J;  4HNV A;  1F36 A;  2DN0 A;  3QPL A;  2D5V A;  3GTK J;  1HOM A;  1IDY A;  1WGX A;  1ETK A;  2H1K A;  2CQX A;  3IH2 A;  3ZQI A;  3Q0W A;  3BR1 A;  2KT0 A;  1O4X A;  4RBO A;  2M8G X;  3JRA A;  3JR9 A;  4J19 A;  1JTX A;  1P7I A;  3VPR A;  1H89 C;  4C3H J;  4IHV A;  5E3O A;  4BXX J;  3ZQC A;  3S14 J;  3JRC A;  2M9H A;  4BBS J;  3HGY A;  2R5Z A;  1LFB A;  2DMT A;  2CQQ A;  3G1M A;  2R7Z J;  2MGQ A;  5F0C A;  3OSF A;  3FIS A;  3K2A A;  1JUM A;  5FJ8 J;  2HXI A;  1MNM C;  3JRB A;  5DTD A;  3CMY A;  3NAR A;  3BTL A;  4UUT A;  1P7J A;  2HOA A;  1HDP A;  2LP0 A;  2ECB A;  3BR0 A;  2DA7 A;  2CRG A;  4BBR J;  3PO2 J;  1WH5 A;  3S2H J;  2NVY J;  4M6V A;  3CDL A;  2JN6 A;  2FQ4 A;  2EZI A;  3M3Y J;  5F0F A;  3JRH A;  1JUP A;  2LFB A;  3H3V K;  1A5J A;  5K7Z A;  2TRT A;  3C2B A;  3TP0 A;  5FKM A;  1ETW A;  1D5Y A;  1GV2 A;  5M5W J;  2O9L A;  4B4C A;  2ID3 A;  4W1U A;  3G1L A;  2XPW A;  2ME0 A;  3RKQ A;  2CU7 A;  3JRD A;  3HOY J;  3O8H A;  4QSH A;  1Y1V J;  2NS7 A;  1GVD A;  3BG3 A;  3JRE A;  1UHS A;  1RKW A;  2XPV A;  1GUU A;  2Y30 A;  4DW6 A;  3D1N I;  1JT6 A;  2E19 A;  4M3F A;  3GTJ J;  1ETQ A;  1ZTR A;  1OCT C;  3HOX J;  1VFC A;  4FE4 A;  1FEX A;  2DMQ A;  3S15 J;  1B8I A;  1I6H J;  4A3D J;  2JA6 J;  2DA2 A;  1MH3 A;  5F08 A;  5M5X J;  1SFO J;  3MKL A;  4JP0 A;  5K7F A;  2K40 A;  4LOC A;  3ZQF A;  5IP9 J;  1K83 J;  5GPC A;  2W48 A;  2LY9 A;  1LE8 B;  3ZOB A;  3LSJ A;  1ZR2 A;  3BG5 A;  4M3D A;  2ID6 A;  1AHD P;  4FE7 A;  1MBE A;  3CCY A;  5J1R A;  4UUS B;  3BR6 A;  4IHY A;  2OF7 A;  2XGD A;  1H8A C;  2X9D A;  2HYJ A;  4QTR A;  1JTY A;  2LVS A;  1X2M A;  4DZJ A;  4A93 J;  1E3O C;  3HOV J;  1BW5 A;  4A3B J;  1MBF A;  2XGE A;  2GM4 A;  2VI6 A;  3A01 B;  3RQI A;  2XRL A;  1NK3 P;  3FKI J;  1YRN B;  2NS8 A;  4BKX A;  2LK2 A;  4L5E A;  1IGN A;  2DMP A;  3O8G A;  3Q0U A;  1UMQ A;  3WHC A;  4DZP A;  4C2M J;  1BL0 A;  4BY1 J;  2DA6 A;  2HI3 A;  1VND A;  2XGC A;  1ETV A;  3TW6 A;  2X6O A;  1XC5 A;  1GT0 C;  2FX0 A;  3PM1 A;  1MBJ A;  2JMW A;  2K9S A;  2LLK A;  4B1R A;  4A3J J;  2NVT J;  1I50 J;  3K7A J;  3S1M J;  1IRZ A;  1ZGW A;  3RZO J;  2LD5 A;  2XB5 A;  4MIM A;  5IYD J;  2QF7 A;  1B8I B;  1Q1V A;  2K9Q A;  4B3A A;  1ZR4 A;  2E2H J;  1JKP C;  4DYQ A;  3TED A;  5EG0 A;  1TWH J;  1LE8 A;  2Y9Z A;  4A3L J;  1T33 A;  3S1R J;  1BJZ A;  1CQT A;  1QRY A;  3JRF A;  2EH3 A;  4FIS A;  3SFI A;  4UUS A;  1ZK8 A;  2EBI A;  3BQY A;  1Z77 A;  1X2N A;  1VF9 A;  2TCT A;  5M3F J;  5F04 A;  4S0H B;  2I10 A;  2EZK A;  4IEJ A;  5E3N A;  4XRS A;  5FKO A;  1JGG A;  1PUF B;  2DMU A;  3JRG A;  2M34 A;  2ELK A;  4AYB N;  5EDN A;  2R93 J;  2DA4 A;  3Q0V A;  2R5Z B;  3W6V A;  1XG1 A;  1UG2 A;  3QPS A;  3FK7 A;  5F27 A;  4A3I J;  4A3E J;  2NVX J;  1EF4 A;  2DA1 A;  1FIP A;  3GTO J;  4I6Z A;  3LSP A;  1T56 A;  1IV6 A;  3BQZ A;  2IBD A;  1F43 A;  2HXO A;  2OPT A;  3G1O A;  3LNQ A;  1RES A;  3ZQL A;  2XSD C;  4XK4 A;  4I76 A;  2Y9Y A;  1JJ8 C;  4X1E A;  1JKQ C;  1U9N A;  1MSF C;  3OOU A;  2GBY A;  1H88 C;  2L7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...