2B63J

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2b63J00
1VI0A 5IP7J 1A6IA 3SDGA 3E7LA 3RKQA 2DTZA 1H88C 3D1NI 1TWFJ 2HOTA 3BT9A 2XGDA 1U9NA 2JJ7A 2L7ZA 4XICA 3BTCA 4QTRA 5M5XJ 2AHQA 3TW6A 3BTIA 4IHYA 1AKHB 4BXXJ 3HOVJ 1H8AC 2M34A 3FK6A 3VPRA 1ZKGA 2LVSA 1JKOC 2R5YA 4G12A 4JX4A 2VI6A 3LNQA 3LSRA 3K7AJ 5IYCJ 1MBGA 5IYDJ 2DA3A 3S2DJ 2XB5A 5E3MA 3CQZJ 2DA1A 2FQ4A 1S7EA 3WHCA 1ETOA 3PO2J 2AO9A 4A3IJ 1JTYA 2ID3A 4MLOA 1FIPA 2K9NA 3F0CA 4XRMA 2X48A 5JLXA 2KDZA 1E3OC 4CYCA 1UMQA 3DEWA 1ETVA 1X58A 5J1UA 5E3NA 4D5CA 4XK4A 1Z0XA 2LTPA 2EZIA 1MBHA 1OFCX 2R5YB 2M8GX 2EZKA 1T56A 3NAUA 3TP3A 5M3MJ 5GP9A 3A01B 3CCYA 2GLOA 2JA7J 3I4MJ 2MSYA 5HODA 3I4NJ 1O4XA 2YU9J 2ME6A 1T33A 4MO7A 3BR2A 5FKMA 1MBJA 4W97A 1DU0A 2R7ZJ 3M3YJ 4ABZA 3CDLA 2JN6A 3HM5A 4A3GJ 5M5WJ 2EQRA 3FIWA 2LKXA 2G0EA 2QCOA 1NK2P 2DA4A 4M3BA 5DS9A 1SANA 1W0UA 2Y2ZA 4A93J 1U78A 2Y0SN 1PUFA 5IPAA 2W48A 5FKOA 1ZQ3P 2EZHA 1WI3A 2DMPA 3C2BA 2CQQA 2OF7A 3S1RJ 4L5EA 3H3VK 2JA5J 2LFBA 1JT0A 1AKHA 2CRGA 1B8IB 2ECBA 3TW7A 3A03A 4DZJA 2LD5A 4A3EJ 1MNMC 2Y9ZA 1YRNB 4MIMA 3QPLA 2XPWA 2COBA 5C4XJ 4IEJA 2O9LA 4QSHA 4AYBN 4QIWN 4GFBA 2EZLA 1K83J 2XGEA 3JREA 2XRLA 3IH4A 2FJ1A 2E19A 2WAQN 3LSJA 2XPUA 3G1MA 4IHWA 3BR6A 1WGXA 1TWCJ 4BY1J 3QPSA 1PUFB 2TCTA 1X2NA 1MSEC 4EEFG 3CMYA 3GBGA 2ZB9A 1AU7A 1JJ8C 4JP0A 1ZTRA 1GT0C 2HDDA 4NDLA 3ZOBA 2K40A 3B6CA 1ETXA 1QRYA 4UUTA 4RBOA 1Q1VA 3OSFA 2O8KA 3GTQJ 3S1QJ 2YS9A 1JTXA 4A3BJ 1JKRC 2HYJA 2H8RA 3LOCA 1U9OA 5K7FA 2IBDA 1IC8A 1FJLA 3OIOA 2E1OA 4M3FA 4IHVA 5EDNA 1WPKA 2RAEA 2NVXJ 3A01A 2M0CA 2XB0X 4A3KJ 2X6OA 3A02A 2MGQA 3JRHA 3ZQGA 3S1MJ 2E2HJ 5E3LA 1BJZA 1ORKA 3S16J 4A3CJ 2R92J 3GTMJ 5E3OA 1K61A 3BTJA 2ID6A 3QQAA 3S14J 5F27A 3BR3A 1WH7A 2MG4A 3B6AA 5EYRA 1JUMA 3MKLA 3PM1A 4MFEA 5FKLA 2ME0A 2GM4A 2ECCA 5K7HA 1MBEA 1NK3P 3RZOJ 3FK7A 3K2AA 2CU7A 2VKEA 5FLVA 4J19A 1RKTA 4D5FA 2NOGA 3S15J 1B72B 1JGGA 5FLMJ 1UHSA 2JA8J 1LFBA 2E2IJ 3HGYA 5J3LA 3GTJJ 2B63J 3RZDJ 1JKQC 4A3JJ 1APLC 1IUFA 2X9DA 2EBIA 1I3QJ 1Z77A 2DMTA 2VPRA 4UUSA 5FKKA 2IEKA 3OOUA 1VNDA 3GTLJ 3JRFA 1F36A 4BBRJ 1B8IA 4M3GA 2M2EA 1TC3C 1FEXA 4M3EA 3JRBA 1YRNA 4W1UA 3JRIA 3IH2A 3JRAA 3SJMA 3TEDA 4A3LJ 3PO3J 1P7JA 1JJ6C 3BG9A 2HQ5A 4FE7A 3BTLA 4V2GA 4D7NA 4FTHA 2DMUA 5J1RA 4FCYA 1RR7A 4BKXA 3LSPA 5F0CA 4V2FA 1QVTA 2JK3A 2CQXA 4C2MJ 2NS7A 1HDDC 2VUMJ 1RETA 1WCMJ 1JUSA 4UUSB 4AC0A 1IGNA 1EF4A 1G2HA 1ZR4A 3HOWJ 3GTOJ 4JX5A 1QPIA 1I50J 2JMWA 3ZQFA 2QF7A 2L7MP 4C3IJ 5M3FJ 1TWGJ 2N8GA 1VFCA 2Y30A 5EG0B 4Y7NJ 2DA6A 4M6VA 4X1EA 1UG2A 3JRDA 3H0GJ 3HBLA 2LLKA 2Y31A 2HOSA 5JLWA 1HCRA 1ENHA 3Q0UA 5FKNA 1NTCA 4DZPA 1CQTA 3W6VA 5BNGA 2JA6J 1OJLA 5IP9J 2HXOA 1GUUA 2CJJA 3ZQCA 3UKGA 4IHXA 1R9TJ 2LP0A 9ANTA 5EZGA 2L0KA 1LFUP 2M9HA 3SFIA 3HKZN 1U8BA 3HOZJ 2HI3A 2R5ZA 1IJWC 4I76A 2DA5A 2LK2A 3BG5A 3BR5A 1MH3A 4B4CA 4C3JJ 4C3HJ 3FKIJ 1WH5A 1ETKA 3NARA 5GPAA 4I6ZA 2R0QC 4A3DJ 1B72A 5J1YA 3ZQLA 1DU6A 1MH4A 1ITYA 1ZK8A 1ETWA 1A5JA 4LOCA 3G1LA 3G1OA 5EGOA 4FISA 1VF9A 4X6AJ 3Q0VA 4HNVA 1Y1WJ 1MBKA 3BQYA 1IRZA 2H1KA 1MSFC 3LSGA 1IV6A 3BQZA 5IP6A 1X2MA 4D7MA 2MW8A 2OPTA 2EH3A 2WB1N 1LE8B 2DJNA 3GTKJ 2PMZN 5C3EJ 4XRSA 1XG1A 5IOZA 1RPWA 1IDYA 2R5ZB 5F04A 2TRTA 5EF6A 2R93J 2ELKA 3TP0A 3S17J 4Y52J 2DMQA 1GVDA 2FX0A 2CUFA 2LR8A 5FJ8J 1ZGWA 1BW5A 1I6HJ 1JKPC 2WV1A 1GV5A 5EZHA 5EGOB 1SFOJ 2Y9YA 3JRGA 2KT0A 3GTGJ 2I10A 1ETYA 2L7FP 4DW6A 4S0HB 1D5YA 5GPCA 2XGCA 2VKVA 3WHBA 4XRSG 1AHDP 3Q3SA 2LY9A 2DA2A 2DA7A 1XS9A 1FTZA 1P7IA 1IG7A 1ZR2A 3S2HJ 3JRCA 5EG0A 1BL0A 3OSGA 3HB9A 3IV5A 5C4JJ 4JYKA 1QVUA 3MVPA 1TWHJ 4FE4A 1HLVA 1F43A 1RESA 5M5YJ 2HOAA 4B3AA 5F0HA 2FD5A 3O8HA 1GDTA 3ZQIA 1RKWA 2NVQJ 3HDDA 3S1NJ 2DMNA 4MFDA 4XIDA 2YUSA 3JR9A 2NVYJ 3HOUJ 1FTTA 2L9RA 3HGGA 2O7OA 3BR1A 1IDZA 4M3DA 4A3MJ 3O8GA 5IYBJ 1JUPA 1BA5A 4RDUA 5K7ZA 5F1JA 4CYCB 3M4OJ 5EEAA 2NVTJ 3IH3A 1JT6A 4DYQA 5DTDA 1POGA 1ETQA 4B1RA 3DCFA 1GV2A 1OCTC 3L1PA 2E2JJ 3RQIA 1H89C 4DYRA 4JX6A 2XSDC 4A69C 2P81A 4BBSJ 5F08A 1HF0A 1HOMA 3MN2A 2NS8A 4AUXA 2GBYA 3Q0WA 1FIAA 1BW6A 2D5VA 3GTPJ 4DYCA 2K9SA 1MBFA 5IOYA 5C44J 2HXIA 1LE8A 3BR0A 1XC5A 5F0FA 3HOXJ 3ZQHA 2CUEA 2JWTA 3FISA 1HDPA 1TWAJ 3BG3A 2IAIA 1OCPA 3HEFA 1W0TA 1Y1VJ 3HOYJ 2DN0A 2K9QA 4A3FJ 4BY7J 2XPVA
chains in the Genus database with same CATH superfamily
3H3ZA 5LHIA 3RKQA 3S3MA 4RB0A 3KE2A 4U7BA 3EYIA 3NWSA 2A5WA 3DBHB 4P9FA 2ZJQF 3S3NA 5CVRA 3BT9A 2GIVA 3QU3A 4IPAA 3RYRA 1U9NA 2OQGA 3J7AO 3OYDA 2LDUA 1YITI 5LFAA 2FOWA 2VBYA 5KCMA 4XKWA 2P7VB 4XLEA 1R5HA 3VYTB 4FHTA 2NRAC 2V9KA 3QOEA 3LWFA 2E1CA 3F8CA 3IKTA 3IRRA 2Z33A 3GZ6A 3RPUD 1J7KA 4BYYA 4CCMA 1WQ2A 4CH7A 5JR3A 5IYCJ 5IYDJ 3PNTA 1QHGA 3S2DJ 3MZHA 5TISC 2TDXA 4OIOF 2FQ4A 3CQZJ 1U8RA 1ETOA 3KIOA 3NQOA 5AIPA 2VJJA 4A3IJ 4Y3OA 1USTA 2EFOA 2L5QA 1ZN2A 4YELA 4BQNA 3F0CA 3C2GA 2KDZA 3SZTA 3HUGB 2VN2A 1UMQA 2NNYA 1XD7A 1ETVA 4M73A 4X0GA 4O3MA 2LTPA 1Z05A 5JHFA 3G4SI 1FP1D 3V8JA 2KRCA 2NNNA 4KA4A 3TP3A 3T8TA 3A01B 3ECHA 2LG4A 4ZYEA 3I4MJ 4RAYA 3ZXSA 1ZYRF 3AG2H 3ZMUA 2VE8A 1T33A 1BIAA 2R7FA 3DFGA 3Q9SA 3CF5F 4PGHA 3L2WA 2ETHA 4M71A 4R8HA 2D1HA 2LYCA 5L3GA 1TBXA 3HHGA 2R7ZJ 2GA2A 4ENNA 3RYPA 5F6FA 3SQNA 3J80Z 1FSHA 3HM5A 1P2FA 1DP7P 2A68F 1FT9A 4RGSA 2IW5A 2EQRA 1KYZA 2ZSIB 3FIWA 3ONQA 2LKXA 2IS1A 2CGPA 2HFHA 2CYYA 4G9YA 4HG2A 2OTLI 3IUOA 5DS9A 1H9TA 2DYRH 4HDUA 1MDMA 5CVVA 3N05A 3G6EI 4UVAA 4A93J 1YW9A 5AIQA 2Y0SN 3K4CA 1RI7A 3M8FA 4HF1A 2W48A 5FKOA 1ZQ3P 1LVAA 1YOVB 2QQBA 4E4HA 1J0RA 3C2BA 3CD6I 5BPIA 4L5EA 3JTGA 1ZH5A 2DOFA 1TQMA 2CMPA 1HKSA 2RDPA 1BN5A 1IN5A 3DEEA 3UNGC 3TW7A 2OCCH 2V9VA 2RVCA 3BWGA 1IN6A 1V5EA 5L3CA 4LB6B 1YRNB 4MIMA 3WTTC 3QPLA 3D5RC 3KLNA 2FMYA 1EV7A 4AYBN 1XMKA 4I99C 3CO6C 3IRQA 3OYBA 3WTYC 3K1NA 4JK1X 4XBFA 1W1WE 2E19A 2HYGD 3L2UA 2XPUA 2V1DA 1GVJA 3J7YJ 1T08B 3G3ZA 4BY1J 4EJVA 3BJ6A 4EEFG 2M7BA 5FO5A 4L9JA 2CUZA 4BACA 1R00A 1ZTRA 3OS1A 1EA3A 1K7AA 1GT0C 3ZOBA 2K40A 1QRYA 1N25A 1OISA 1YW8A 4CZZA 4RBOA 3CZ6A 2HDWA 3FHNA 4ZYHA 5HNFA 1WZ2A 3E97A 3C1DA 3VDXA 1O3TA 2H8RA 4ZZLA 2VKDA 4YIFA 4HNTA 1SD5A 1U9OA 3M7GA 5CJ9A 4B43A 5K7FA 1IRFA 4P1WA 4E7HA 3I71A 3OR1C 4IZZA 2FF4A 5LEKA 4IHVA 3PQJA 4A3KJ 2XB0X 4L5JA 3A02A 3K70D 2DFEA 3W6JB 3S1MJ 2HZTA 1U5TA 4XR6A 3E6CC 1BJZA 1ORKA 3I59A 3S16J 2XVCA 2VE9A 4IO9F 1KQ0A 2LY2A 2R7OA 3QQAA 2HOEA 1QBJA 3B6AA 1QPMA 2BY0A 4HNUA 3LSHA 5FKLA 3N97A 1FNNA 1MJ9A 4MHGA 1F9NA 5K7HA 1MBEA 3TDZC 1LEBA 3R4KA 1VQ4I 1O7FA 1K6OA 1TTYA 2VKEA 4XLHA 4M9SA 1RKTA 2BHYA 5TRDA 1JGGA 2UXXA 5FLMJ 1UHSA 4ZDOA 1A35A 5JHUA 3K4BA 5J3LA 5H6RA 3ZN0A 2CQ7A 1JKQC 4ENKA 4RLQA 2EA4A 1APLC 2XROA 4BDZA 4IKFA 2IEKA 1D3YA 3I64A 1RIOH 3MFKA 5K1YA 4R1HA 1JHFA 2JUCA 1V54H 1YJWI 1VQ9I 2HWVA 2VB6A 4OWRB 2X1CA 1B8IA 3KEOA 5KVRA 1VQOI 1TC3C 2KZVA 3HXLA 3CDHA 4MEXF 3JRBA 2AQFA 5GAGJ 4W1UA 4XMYA 2HGCA 2JSPA 3JRIA 1VQLI 3DBRB 3WG7H 3L7WA 3ZMZA 3BZ6A 2KDOA 4UB6C 1JJ6C 3PJRA 2OZUA 3BG9A 2HQ5A 3J80K 4H4KC 4BEHA 3BTLA 4V2GA 5CKTA 4D7NA 5J1RA 2IS4A 2ZCWA 3EUHA 4NC6A 3K70C 1R5ID 5F0CA 4HV5A 4Z6YA 5DCMA 2JK3A 2CQXA 3WGHA 2VBWA 3E0JB 1ZRFA 3GX4X 3PL8A 4PFOA 2P4WA 4OMYA 3WODF 4EM2A 1G2HA 1YYVA 1I50J 4AIHA 4ENMA 4RS8A 3GFLA 2PN6A 2W57A 3K4JA 4M72A 5DD4A 4L5IA 4WXDA 5M3FJ 3M8JA 3G2BA 1VFCA 2Y30A 3JTHA 2LKPA 3ZMDA 3JRDA 1IV8A 3U1DA 1O3SA 2L4MA 3GUDA 3H0GJ 3HBLA 4I0BA 4M9ZA 2H8WA 1FOWA 5JLWA 1HCRA 1Z1DA 4HX7A 2CV1A 1NTCA 3O2PE 2FMLA 2JA6J 2Z99A 1OJLA 4AIKA 4IHXA 2NXNB 3WGGA 2FE3A 4XLPF 1ULYA 9ANTA 1XCBA 5EZGA 3I55I 5FGMA 5JI6A 2ISZA 2M9HA 1HKTA 4OOIA 1FZPB 3CP2A 1K4TA 1W5TA 4ON0A 1WHUA 2W25A 3BR5A 4B4CA 2XF7A 4C3JJ 3FKIJ 3NARA 2M30A 4AD9A 2R0QC 4KIGA 4CYDA 4Z2YA 3HHHA 3OYHA 3ZQLA 1MH4A 1R1TA 2P5VA 4KIBA 4LOCA 3GO5A 4ZZDA 2IGKA 3G1OA 2RN7A 5EGOA 4FISA 1L0OC 2M0MA 3NEUA 4Y4RA 5ILVA 4HNVA 5E1WA 3HRTA 1D1AA 1I6XA 1Z7LA 2LMDA 4EMSA 1T95A 1XTAA 3DPTA 3QRFF 1OR7C 3DTIA 1EH8A 3CO7C 2NOJB 2KL4A 3OYGA 5CVJA 3DP7A 4RM3A 4MQ9F 3OYIA 1WFXA 3AG1H 2Z1DA 3BJOA 4IRGA 4L9VA 1UAAA 1ZARA 1N75A 3F8BA 4XRSA 1BI2A 3BPXA 1IDYA 4XOTA 4PUSA 1XGMA 5EF6A 2F5DA 2IA2A 3F6OA 4NB5A 2MC3A 2ZJRF 1GXQA 4XLCA 1ZGWA 1ZG5A 1I6HJ 2GOMA 3MWMA 5LGNA 3PIPF 2WV1A 1S7AA 3QAHA 1GV5A 1LNWA 1STZA 3A2KA 2RC4A 3U9GA 3LMMA 1PYVA 4DW6A 4S05A 3OYLA 4KISA 1LDKB 1MIJA 3HRSA 3ZPLA 3QWLA 4XSZF 1KU9A 2L01A 3OL3A 3Q3SA 1XS9A 4IQJA 2GWRA 5DM6F 4I98B 4RGXA 2BGCA 3ISPA 5DV5A 4RB3C 1W7PD 3IV5A 3RI4A 5C4JJ 2CUJA 5ICCA 3OYEA 2BOLA 2IGNA 4AM3A 4B3AA 2Z3YA 1N78A 2W85A 1QZYA 2FD5A 4TV7A 4AWXB 1ZHFA 1GDTA 3DWLE 1ON2A 3F22A 3LQRA 4KITB 3JR9A 3WGIA 2UWMA 4HX8A 3BR1A 4M3DA 2BY3A 3VB2A 1MD0A 5HDNA 1JUPA 1BA5A 4RDUA 3K4MA 4A0ZA 3ESWB 2VIXA 1DGWY 4CXFA 2R7WA 1J09A 3ZGKA 4E7LA 2CW8A 1CF7B 4B1RA 1Z3XA 1XMXA 2DCEA 4LK0F 4KMFA 2E2JJ 1T0FC 2BBYA 3RQ4A 3F23A 4JX6A 4O5VA 2OCEA 1FBUA 2GXGA 4A12A 1IZ1A 1G3YA 4BBSJ 3OYMA 3CJNA 2V6EA 2K86A 1HOMA 4IHSA 5GADJ 5J47A 3ZRGA 2DBBA 2GBYA 2HR3A 2L54A 4GGGA 2G9WA 1E0EA 1TQPA 3F72A 4LG3A 2D5VA 4DYCA 2PJPA 2WAEA 2EWNA 2K9SA 2XC7A 3H9GA 5IOYA 3RPUA 5FFZA 1SMYF 2EB7A 3R60A 4AVZA 4PGGA 5F0FA 3MCZA 3K4LA 3QYBA 3L9FA 3HOXJ 2JWTA 3SFZA 5J6XA 1YE9A 3I3LA 3L2RA 3VYSB 1TWAJ 2PLYA 1OCPA 5E1XA 2JT1A 3ULQB 1DUXC 2E1MB 3CCSI 2K9QA 4BY7J 2WAQA 3LSIA 4GO1A 2KMUA 4RM2A 2ZJPF 3JCUC 3SDGA 3WE2A 1H88C 3D1NI 4GXOA 2MH2A 3U1KA 1I27A 2BYVE 4YG2F 3TGNA 4QTRA 2JJ7A 2CV0A 4YFNF 3BTCA 1ODDA 4A0YA 4B47A 2AHQA 2Z16A 3FMQA 2D1VA 3OL4A 4DNCA 5HS8A 2P6SA 2IXSA 3BCAA 3CCQI 5D8KB 1D1BA 3ERMA 4Y33A 2HVRA 3GEZA 2ZBKA 1YO5C 2PEXA 2XGXA 5D5WB 3LA2A 4UHTA 4G12A 4BHPA 2Q1ZB 3FXJA 2VI6A 2ZXWH 3LNQA 2O6GE 3T1BA 2W82A 2G7HA 4QPOA 1IN7A 2V1XA 1VQMI 2L9NA 4UNOA 2EV6A 2UXNA 3PO2J 2ID3A 3BOQA 1YX5A 1FIPA 5KK1A 2K9NA 2ACJA 2ZXJA 2LKSA 4XRMA 3DU5A 5DUIA 5JLXA 1A04A 1B1BA 2H6CA 2R7SA 1R5GA 3FMSA 3E1SA 1PVEA 3DEWA 5J1UA 2MH9A 4D5CA 3I56I 4C9YA 3OS2A 3CCLI 2EZIA 4P5OA 5CVUA 1OFCX 1TW2A 3LFKA 2UUZA 2WBMA 3TOBA 3NAUA 4HEA2 5M3MJ 2R7RA 1E2XA 1MMGA 2E1MC 3H5RA 4I7HA 3FXRA 3CCYA 2GLOA 4CHUA 3HOSA 2QSFX 1MGTA 1O4XA 1FWZA 3S93A 1J59A 4XORA 4P55A 1V3FA 4NHJA 4NC8A 5DCFA 2KFDA 4N9HA 3E3VA 1RUOA 3ZMVA 4IL6C 4W97A 1E3HA 2DT7B 1DU0A 5DM7F 4ABZA 2BZTA 3ELKA 3CDLA 1PDNC 4A3GJ 2F4IA 3I5UA 1IUYA 5M5WJ 4KNYA 4LG0B 1WJAA 4U0WA 3CC4I 3ZMSA 1NK2P 4K2EA 4BE1A 4M3BA 1REPC 1SANA 1W0UA 5FLXZ 4IHTA 1U78A 2PMUA 5CQGA 1Y39A 2IS2A 2A6EF 2X0LA 4E7IA 3KLOA 1GXPA 1WI3A 4HW0A 4HX4A 1W5CC 2OQRA 1MMSA 2WY7Q 4KDPA 2GOXB 3S1RJ 1WJ5A 1BBYA 3HPHA 2W7NA 1JT0A 3R61A 4BNCA 1AKHA 3AKZA 2VQGA 4BJTA 3A03A 1IXRC 3M9AA 2X1DA 1WVRA 3R0AA 1MNMC 2GXBA 2EK5A 4LD5A 1R4MB 1BIBA 2KKOA 5HLIA 2XPWA 4WCGA 2H09A 3K2ZA 1TNSA 1R1VA 2JRMA 4GFBA 1E3PA 2EZLA 2KIQA 2A05A 2RKHA 1K83J 2YX4A 2D45A 3CUQB 4AYBA 4ZYAA 4BH9A 4BHCA 4JQFA 2FJ1A 2WAQN 1WGXA 2LF8A 2JQ7A 1TLHB 1TWCJ 1UELB 3PFIA 4FX0A 1X2NA 2HVSA 2PJRB 2E35A 4ITVA 3CMYA 4L0YB 1AU7A 3K6GA 2DFFA 2HDDA 1IO2A 3OSFA 1B59A 4UUTA 1LDJA 2V6CA 1G6NA 3CCJI 5DYMA 3S1QJ 2A6HF 2FRHA 2R4GA 3WTWC 2L3DA 2QBYB 2VONA 3CUOA 2M87A 3H5AA 4BGDA 1JKRC 4B3XA 4A3BJ 2R7UA 3T0YA 5DUKA 1S9HA 4HDVA 1XSVA 2FEZA 3S32A 3KZYA 2IBDA 2QQ8A 1FJLA 3BG6A 5A2QZ 2CQNA 2KISA 2E1OA 4XM3A 1SFEA 4G7OF 2J5OA 2KP6A 4XLFA 2M0CA 5HOOA 2A07F 1XGSA 2GIZA 2HTJA 3ZQGA 1K4SA 2G7UA 5E3LA 2QQAA 4A3CJ 3KETA 3TO9A 5IY5H 3BTJA 1JE8A 3S14J 2OAZA 2HQNA 2MG4A 1JUMA 3MKLA 2EIJH 3RDIA 1KA8A 2JPBA 3GLXA 4PSWA 4PZJA 2ECCA 2FQ3A 3AAFA 3CLOA 4NNJA 3S8PA 5FLVA 2FBHA 3EUAA 4J19A 2J5PA 1Q1HA 5KHDA 3HZJA 2NOGA 4WK8F 2ZNYA 3B73A 1B72B 1BC8C 2X1EA 1R4NB 2JA8J 2O8XA 2Z2SB 1OPCA 5KAIC 1XSXA 3RZDJ 2YR2A 1OR7A 3CUQC 3FXQA 5JVTA 4A3JJ 2COMA 1IUFA 2X9DA 2GA1A 2M3AA 2VPRA 2O61A 1LPQA 1X1CA 2ESHA 4JBAA 4ANJA 2QGUA 2LOOA 3H0DA 3WTXC 3A1YA 2K4BA 2OC6A 1V5GA 3I54A 1S7OA 3FXOA 5FB2A 4HAMA 2M5WA 1Y0UA 3PO3J 1P7JA 3LA3A 1X4OA 2OTJI 4LITA 4FTHA 2DMUA 3F8NA 1LEAA 2VC0A 5IT9Z 3LSPA 1S72I 4V2FA 2VUMJ 5FLXK 1X3ZB 2VOOA 1JUSA 2FXAA 1YQAA 1D1CA 2XAQA 4CCLA 3CCRI 1R6RA 2RNGA 4XQFA 3R6SA 1ACIA 1QPIA 5CPRB 4HF0A 4MTEA 3R0JA 4Q5SF 3BDDA 3DKWA 3OS0A 2OZ6A 3GFIA 4HPQA 4KN7X 1FLIA 1TWGJ 1HXDA 2N8GA 3J7AY 4X1EA 1UG2A 2QENA 2XHKA 2DAOA 2F6CA 4FQGA 2JRTA 4RB2C 2X6XA 1JGSA 2Y31A 4F55A 3FXLA 2VASA 3IC7A 4OINF 2IVMA 4BQQA 2F5EA 1SVOA 5FKNA 1X3UA 4XKVA 2KLOA 2DOEA 3SYTA 5BNGA 2NAZA 2MYSA 4EJOA 1VQ5I 5IP9J 2HXOA 2CJJA 3UKGA 1J5YA 4MEYF 4BDYA 3B02A 4O6JA 2XRNA 1D0ZA 2L0KA 2HKXA 2Y75A 5HLHA 3PFYA 3VWBA 2HI3A 1VQ8I 4IRIA 4I76A 2DA5A 2LK2A 3PUFA 3ABMH 1MH3A 2LRDA 3TDUC 1ZELA 1T0FA 4C3HJ 2Y69H 1HSJA 1ETKA 1WH5A 2PG4A 5GPAA 2B9SA 1R7JA 3AL0B 4V19K 1DU6A 1ITYA 4QLCU 1PUEE 3FDYA 2RREA 4E7SA 2Q8KA 3CCUI 1DPRA 1XCVA 1QZEA 1WJEA 2ZMEB 4PDKA 4X6AJ 1UFMA 1Z67A 5A2QK 1Y1WJ 4F7ZA 2LBFB 1UCRA 2H1KA 3I58A 1Y8RB 4HBLA 1QZZA 5IP6A 2R7QA 1W7PA 4LJZF 2HQAA 4D7MA 2OPTA 3TBIA 2EH3A 1YJNI 5H2FC 2IT0A 2P5LC 6PAXA 3O3KA 3GTKJ 4UY8I 2R5ZB 2OUMA 4EGYA 4ZYGA 4ENJA 3MMYB 4UVCA 2P8TA 1XGNA 3D0SA 4WXCA 4CA0A 2CUFA 2KIFA 2DW4A 2F5VA 2YPRA 5FJ8J 1BW5A 1JXSA 5LGUA 3QP5A 2Z5UA 1Y6IA 3L2VA 1YJ9I 5FFXA 4XRFA 5GTHC 5D4RA 4HV6A 4ZTFA 1MJAA 2I5UA 2HZDA 2KT0A 3LAPA 2I10A 3M1EA 2W84A 5GPCA 2WV0A 1AHDP 2KZGA 2DA2A 2DOAA 2DA7A 4ETSA 5FD6A 1PJRA 1FTZA 2E1NA 2XUBA 1IG7A 4ZDLA 1CF7A 1YHQI 5EG0A 1AWCA 2DQLA 1BL0A 2L02A 1TW3A 3HB9A 2EPFA 2K9MA 4U0YA 4JYKA 4BQOA 1QVUA 3IL2A 1TWHJ 3ABKH 2EV5A 4FE4A 2DI3A 2L9VA 3AL0C 4IOCF 4EJTA 2HOAA 3C3WA 5K5QA 2ICWG 1ONVA 2FNPA 3CMAI 3DPUA 2JA2A 3BROA 3MEXA 3O8HA 1BI1A 5ED4A 1IRGA 1RKWA 3FX3A 3OYNA 2DMNA 3S1NJ 4XIDA 4G6DA 2FOKA 2R7XA 2MD5A 3QPTA 4YEJA 3F8FA 5IT9K 2L9RA 4AIJA 1USSA 2MD0A 1X19A 4WF2A 1KU2A 1ZREA 3ZQ7A 4ZYDA 5BMZA 4YRVA 5F1JA 3M4OJ 1XGOA 4N0BA 1HBXG 1ZLKA 2NVTJ 3FF5A 3IH3A 5DD8A 3COAC 3ABLH 1JT6A 3SEQA 4A5MA 4DYQA 1XN7A 2Y48A 3CMEI 3S3OA 1SAXA 2X85A 1ETQA 3DCFA 1GV2A 4XSXF 1OKRA 2E34A 4II3A 1OCTC 1TT5B 3L1PA 1QA6A 3RQIA 3F6VA 4LIVA 1H89C 1K78A 2JPCA 2VXZA 3MZ8A 3HIFA 2P81A 1F5TA 4N4OB 1T39A 2Z9OA 1Z9CA 2PI0A 3E5UA 4WXHA 4B09A 2VKHA 1OYYA 2NS8A 1RZ4A 2DJIA 2VL8A 3OIPA 3Q0WA 3GFMA 4WWCA 1H0MA 1U2WA 1LVKA 2IA1A 3GTPJ 2E60A 4FETA 3OV8A 2BW3A 1MBFA 4DBQA 4BHBA 1LE8A 3P9KA 4II2A 4CCJA 2CUEA 5HLTA 3BG7A 3FISA 1HDPA 1X4PA 4KN4X 1Z6TA 2GZWA 2H27A 3HEFA 3K69A 1Y1VJ 3JAMK 3TOAA 1MDMB 1KYWA 2Q2EA 2RNJA 2DN0A 5D4SA 1D5VA 1VI0A 3WU2C 1A6IA 2QEXI 4HYEA 2HS5A 2DTZA 1K6YA 3V7CA 4F3QA 4EGZA 3BZKA 1IW7F 1W5SA 3OWTA 2LY1A 4XICA 5LBQA 5JFRA 5LD2C 2HVQA 4J00A 5E20A 1SD7A 1ZGAA 3TO6A 3OY9A 3K0LA 2RGVA 3PQKA 3GFJA 3SHFA 4BXXJ 3HOVJ 2M34A 3F8MA 4XN0A 3MD2A 2AS5F 2LVSA 4FT8A 5E8GA 2HQRA 1ERDA 1JKOC 3E6MA 1WWXA 2H1LA 3DF8A 4JX4A 3FZVA 3RPQA 5LLQA 4ESJA 4NQWA 3LL7A 2A69F 2WTEA 1MBGA 2DA3A 2LNBA 3HC7A 2O0YA 2VT2A 2XB5A 5E3MA 1W4MA 1S7EA 3L2QA 2AO9A 2QM3A 1JTYA 2OA4A 4KMUX 2H6BA 4MLOA 1Z6RA 2L4AA 3C18A 2V9PA 4I02A 1TP4A 3E6DA 1KU3A 4FX4A 2X48A 2GQQA 4KYWA 4CYCA 2QKLB 2K7LA 4LLNA 2Q0OA 5E3NA 2QQ9A 4KUMA 1VQNI 1G3SA 1XPXA 1PP8F 4KFCA 1WJFA 2LF7A 2DFHA 1TT0A 3VFZA 2CV2A 1V5FA 1QU3A 2R5YB 2M8GX 2EZKA 2DQRA 2WWYA 2DFIA 5GP9A 1BI3A 1IXSB 3OMYA 5LRRA 4EJWA 5LEJA 4B8XA 4KT6A 2MSYA 2FNAA 3I4NJ 1FMVA 4RB1A 3KP6A 2YU9J 4Q47A 1XDUA 2ME6A 4MO7A 3CC2I 3TL4X 1JHHA 3BR2A 1MJBA 1SEUA 2GXAA 4R79A 2XAHA 1F4KA 1IF1A 1MBJA 1IXCA 1D0XA 1SVMA 5TJJA 3DTKA 1VQ7I 2QCOA 3CUQA 1I3AA 3H92A 2DA4A 4UXNA 3DQVC 3IHUA 1OCOH 2UV1A 1EH7A 3FXUA 3K9TA 1MNEA 2BV6A 4MNUA 2EZHA 3OR2C 3T8RA 3ASNH 2DMPA 3LSKA 3MAJA 1U6GA 2CQQA 2OF7A 3H3VK 4J01A 3QU6A 2ELHA 5K5RA 2OJED 3REOA 1MKMA 2JSCA 4G7ZF 2CRGA 3HPGA 1B8IB 4C30A 2LD5A 2A6TA 2HPIA 4PK4A 3PNYA 5HDGA 3J7ZI 4A3EJ 4QPQA 1KQ9A 2GAUA 2A61A 2E7WA 4GYIA 4I0AA 3A0BC 1BI0A 1DP3A 3X2QH 2Y0MA 5ILUA 2COBA 3H9JA 4BQAA 1TNTA 2XV4S 2O9LA 3HG9A 4QIWN 1OMIA 2PMHA 3IH4A 2P7CB 1A6QA 4NBQA 4IQ4A 2KIUA 1PUFB 2XIGA 2TCTA 3QYEA 5D6EA 2BXZA 5DCMB 3FKJA 3HRUA 5LRSA 3GBGA 2PQ8A 2MABA 2ZB9A 5L3FA 4CUGA 2QSGX 2KJBA 2JUGA 3ECOA 3H35A 2O8KA 3DU6A 4AIDA 2A5YB 3HKZA 3C7JA 3HUGA 2F5FA 1N77A 3LOCA 1J2XA 1Z3YA 4H0EA 5FRNA 2R7VA 5HNHA 1IC8A 2VXDA 3DXJF 3WTZA 3OIOA 4B44A 5LHHA 4M3FA 5HS9A 3ZP5A 5EDNA 2EJRA 2RAEA 5LHGA 2NVXJ 3A01A 4BE0A 2X6OA 5GAHJ 3CESA 2CW7A 3V8KA 2R92J 3GTMJ 5E3OA 1G3TA 4U88A 1FYLA 2ID6A 3FWEA 5F27A 1S5LC 3QP6A 1BOBA 1UJ8A 3ABTA 4CO8A 3HOTA 3BR3A 1WH7A 4PJ0C 5EYRA 3P7NA 1WKMA 1BM9A 1LJ9A 3PM1A 2ME0A 3AFHA 1NHAA 4DQ2A 5D6FA 1NK3P 2H94A 3FK7A 3NWTA 4D5FA 2VBXA 3V8LA 3S15J 4HA8A 2V26A 3AG4H 1LFBA 3OYFA 4A6DA 3BCBA 3DPLC 5J4YA 2O03A 3GTJJ 4E70A 4D1QA 4BL0B 1S29A 4LGWA 1XDSA 3EDPA 3FXKA 2AXLA 4IVNA 5FKKA 3ERED 2RQPA 2STTA 3VEPA 3OOUA 4NC7A 2HEOA 1VNDA 3GTLJ 5HVQC 3V7SA 2K27A 3DLAA 4BBRJ 3HTUA 1FEXA 4CCKA 4M3EA 1FBQA 2E5NA 3CF2A 1YRNA 5J40A 3IH2A 3JRAA 1P4WA 5TGTA 1ZRCA 3SJMA 4IX7A 1LKXA 4XKCA 4HRIA 3FM5A 2HPMA 4FE7A 3IKVA 3TQNA 4FCYA 1J75A 5KAFC 1RR7A 3HRMA 3JSOA 1GHCA 4YIRX 4EATA 1NH3A 2OV7A 1H9GA 3LQQA 5ERIA 4XOPA 1A36A 2NS7A 3WTVC 4UUSB 3RTRA 4AC0A 4BXUA 1ZR4A 1R23A 4G94A 3HOWJ 3ZQFA 1R71A 1DGRM 2QF7A 3N4MA 5IT3A 4I01A 2VLAA 2FBKA 4C3IJ 2X4HA 3GVAA 1EJ9A 1A31A 4M6VA 4GRIA 2KRHA 2JVGA 3QPHA 3W3CA 5HDKA 5J4VA 2QSHX 2LLKA 3KYLA 1YTYA 2HOSA 2CG4A 5EEHA 1YI2I 3MKWB 1ENHA 3DLLF 3Q0UA 2HNHA 2VC1A 4HQEA 3FMRA 2EILH 2K3FA 3DV8A 4DZPA 2P6TA 2M7AA 1GUUA 5H20A 3V4GA 3ZQCA 2BEOA 1WJCA 1R9TJ 1FYKA 1WJDA 1WI9A 2LP0A 3AG3H 3A0HC 1ON1A 4G7HF 2WC2A 3FBNB 3HJEA 4ZTJA 2EFQA 3SFIA 1X1BA 1X1DA 3HKZN 1VQPI 1U8BA 5E17F 2QKMB 2R5ZA 3WU0A 1VQ6I 3BG5A 4HLXA 2IP2A 1X3WB 2CS3A 4I6ZA 3CJRB 3SZPA 2FUG2 2EV0A 4A3DJ 2CQKA 2MLKA 5FROA 4EQQA 2B7EA 4BS9A 1U0JA 1ETWA 2DDAA 3IAM2 5ILSA 4HF2A 3RCOA 1BJAA 2E5ZA 3ASOH 2XAJA 4M74A 5BQTA 4GYGA 3KFWX 1S8NA 1MBKA 3BQYA 1IRZA 3EQLF 1R22A 1MSFC 3HSEA 3HYIA 1IV6A 4HZFA 1B9MA 2BE5F 4RA2A 1O3QA 1X2MA 2QVOA 3WE3A 2MW8A 5D5UB 3V7RA 1CGPA 3K10A 3K4KA 1P9QC 4RAZA 1MNDA 1XG1A 3PIOF 5IOZA 1RPWA 1SVLA 3H5NA 1ZGJA 2TRTA 1R1UA 5HS7A 2L2OA 4CZCA 3QYFA 2R93J 2ELKA 4Y52J 4LIUA 1GVDA 3LA7A 2DTRA 1UHMA 1I5ZA 4ZH4F 3CJTB 5EZHA 4L0ZB 3FHZA 3CCEI 4GCVA 1SFOJ 2V4JC 3J81Z 2Y9YA 3BP8A 5B66C 3JRGA 4ZJZA 1GLNA 2F2EA 1L3LA 4U87A 1R49A 2M4GA 4GDFA 3IAS2 4PJMA 4S0HB 1D5YA 2X6WA 5BOXA 2OD5A 1AA7A 2VKVA 2XGCA 3WHBA 2B0LA 3SXYA 3ML6A 3KYCB 2VJIA 1ZR2A 1T2KA 1V4RA 4HSRA 3S2HJ 2K4JA 1BOAA 4KT5C 2ESNA 1IAWA 2F4MB 5DDGA 1MMNA 3MVPA 1QQIA 5FRMA 1YG2A 3ZMTA 2IGOA 1SFKA 4HQMA 4YFKF 2ISYA 4RLFA 2I8DA 3EPZA 1VTNC 5F0HA 3ZQQA 2M8EA 2OU2A 2NVYJ 4ZDPA 4YFXF 3HOUJ 5J8FA 1IDZA 2O7OA 4HOBA 1O57A 1FP2A 4OIPF 3CCVI 2EA2A 2VJ4A 3GF2A 5K7ZA 1HW2A 2CH0A 4UVBA 5H6QA 1K79A 4AVPA 1TQIA 4ESFA 5DTDA 4OMZA 5EJCA 1POGA 2VPLA 1QNTA 3Q9VA 2DODA 2K5CA 1Z21A 1T38A 3SEZA 3CCMI 4A69C 3GZNB 3OYKA 3DKXA 5F08A 3I9V2 1BR2A 2VQCA 2ZXIA 3Q5FA 2QUFA 4AUXA 3HSFA 2VODA 3F21A 1FIAA 2ELJA 1BW6A 2LC2A 1XMAA 2VQHA 1S3JA 2RQQA 4XLNF 1UB9A 4DGWB 5DEQA 2EINH 3BR0A 3GW2A 2XAUA 1P92A 1XC5A 3U2RA 3ZQHA 2XSJC 2ZFWA 2FU4A 3JAMZ 1LQ1A 2CWEA 3RJPA 3EETA 2IAIA 3JW4A 1W0TA 4PJLA 1FBSA 2WA0A 3PSIA 4CCOA 4BJ6C 3WTSC 2VT3A 1PP7U 5IP7J 3E7LA 2L9SA 3IWFA 1TWFJ 2HOTA 1C0WA 2XGDA 3QOPA 1RNLA 2L7ZA 4M9XA 2XF5A 4B48A 5M5XJ 1KGSA 3TW6A 1HW1A 5F64A 3OYCA 3BTIA 2DPUA 4JOMA 4IHYA 1EKEA 1AKHB 4UUVA 1FOKA 3HL2A 2XASA 3TO7A 4PJNA 1SAUA 2M4KA 3FK6A 4OU0A 1H8AC 3VPRA 1YIOA 1ZKGA 3CDIA 4LLLA 2DDBA 3DBLB 4F93B 3PUBA 3ZN1A 4E7KA 1DPUA 1MZBA 2R5YA 3EUKL 3RKXA 2KPMA 2A3SA 2NS0A 5CVIA 3L2CA 3U21A 3LSRA 3K7AJ 2QYOA 2BY2A 2EFWA 4LMYA 1RRJA 2DA1A 1XX5A 1FYMA 3WHCA 4EVIA 3KP3A 3IWZA 1UZCA 4F52A 5B1AH 1YFHA 2P5KA 5CYVA 3TKYA 4A0XA 1U3EM 3CLQA 1Z7UA 2DPDA 2IRFG 1FC3A 2BHZA 5BS6A 5E1ZB 3ZCOA 2OBPA 1FY7A 4PFPA 1B9NA 2DO7A 3CTAA 1W36D 3J81K 1E3OC 4IXAA 2V1UA 2DXIA 2PBIA 4BE2A 3DTEA 2NVUB 3E5QA 1X58A 1IRXA 5CLSA 2WAFA 2YU3A 3KZZA 2HTSA 1BR1A 4XK4A 3BC8A 1G4DA 1Z0XA 4RAFA 2V79A 1MBHA 4IF4A 4EJUA 1BR4A 2X6YA 1DQUA 1T56A 1OLTA 4BU2A 2V1NA 3VYRB 1ZLJA 2O3FA 3KYDB 1P4AA 1SD6A 3W6KB 4DOZA 2JA7J 2K9LA 1QO0D 5HODA 5ICEA 1T98A 2W1OA 3GWZA 2LSOA 4DIQA 1E17A 2ZMEC 2CFXA 3BJAA 1RR8C 3OYAA 5FKMA 2FSWA 3KEQA 3VSLA 2MFZA 3M3YJ 4C2UA 1P4XA 4A6EA 2JN6A 3KEYA 4BUPA 2G0EA 5E18F 4EM1A 2CO5A 2M45A 1TZLA 4EM0B 1T6SA 4YIIA 4XLAA 3E5XA 2Y2ZA 1YW7A 2DYSH 1AOYA 1PUFA 4D0PA 3BLYA 5IPAA 1VZ0A 2F4OB 4PSXA 2BXYA 5E8IA 1I1SA 3A4CA 2HYFA 5BPDA 4L9NA 3UR3C 4E6KG 2BVMA 3MQ0A 2JA5J 2LFBA 2C6YA 4I2OA 1W36C 2ECBA 4DZJA 5LGTA 3SDBA 1KQ8A 1I1GA 2JVHA 3BZCA 2STWA 3H1CA 2Y9ZA 3KP7A 2KIMA 3KZIC 4CCNA 3GMEA 1YS7A 1KONA 5C4XJ 4IEJA 1BC7C 1DDNA 4QSHA 5J8CA 1OCRH 5D5VB 2XGEA 3LAJA 3JREA 1YIJI 2XRLA 3GCMA 3LSJA 3G1MA 2QLZA 3I53A 3BR6A 4IHWA 4F92B 4LK1F 1MMAA 3QPSA 2CSOA 1MSEC 1OQYA 1O3RA 3O6BB 2EFPA 2VJ5A 5B1BH 5D8LB 1JJ8C 4JP0A 2PX9A 2MBFA 3M8EA 4A5NA 4NDLA 1FOYA 1ETXA 3B6CA 2DT6A 3GTQJ 1Q1VA 4LLGF 4G8XA 1G3WA 2IA0A 2YS9A 1JTXA 2LREA 2ZFUA 3KX2A 2VQLA 3RKYA 2HYJA 1HKQA 2P0WA 1B4AA 5HLGA 1ZRDA 3GLLA 2IPQX 3K1PA 5AONA 2F5CA 3OIQA 1WPKA 3HSRA 2V7FA 2MGQA 3JRHA 2IS6A 2E2HJ 3ZR8X 3QODA 2K02A 3LSTA 2IJLA 1ZAOA 1TL8A 3TMOA 1K61A 2FA5A 4DJAA 2W4SA 4U0VA 3CC7I 1OCZH 4CDGA 5ICFA 5KNLA 4MFEA 2GM4A 3ROUA 3NRVA 2WB1A 3WTUC 2PMZA 4CSWA 4QWQA 3VOEA 3RZOJ 2K85A 4LG0A 3K2AA 2CU7A 4Y17A 4L18B 1KU7A 2RV8A 2XF6A 2ZNZA 1SC7A 3H9QA 1LDDA 5L3DA 2E2IJ 3CJQB 3HGYA 1QHHD 4RGUA 2B63J 4BJ5C 1SD4A 4KICA 3CP8A 2K3PA 4DBRA 2EBIA 1I3QJ 1Z77A 2DMTA 2MA3A 4UUSA 4LFUA 1QGPA 1U5TB 4BAYA 3I59B 3H3UA 3JRFA 1UHWA 1F36A 2E7XA 3K4NA 1B6AA 1W7PB 4I09A 3FM3A 4M3GA 2M2EA 2YSRA 3M07A 5L3EA 4BXFA 2M1BA 2CFOA 1EH6A 3TEDA 2QZ8A 4A3LJ 2KJCA 4KIFA 3G71I 3KCCA 4PCQA 1LFPA 3S2WA 2EFNA 1G8XA 1IN8A 1O7LA 4BKXA 2KRFA 3PNVA 1UG0A 2JZYA 1FOXA 1QVTA 2PJRA 4C2MJ 1HDDC 1RETA 1WCMJ 2DT5A 1M1EB 4Q48A 3KP2A 2YX7A 2CW0F 5EEGA 3GYHX 1IGNA 1RUNA 2ZSHB 1EF4A 2XAGA 1WSUA 2HDCA 4UB8C 4JX5A 3GTOJ 2JMWA 3FXMA 2XDVA 4UV8A 4XN3A 3P9CA 2QBYA 2L7MP 1J9IA 4E7JA 2UZKA 4U7DA 1I39A 1G59A 4MGRA 5EG0B 4Y7NJ 2DA6A 2L7KA 5F1RA 1HA8A 2F48A 2ZKZA 1KZHA 5ICGA 2E71A 1FX7A 1X1PA 1WRJA 5D5XB 3GXOA 4XKBA 3FBIB 3P5JA 4ZC3A 4BEHB 3M1CA 1D8JA 2ZJ2A 1IN4A 2BY1A 4NUBA 2XKPA 3W2VA 1CQTA 3W6VA 4AU7A 4RAGA 1HQCA 3ABUA 3OOPA 1HSTA 1U5TC 1X1AA 2D2WA 1YLFA 2EIKH 1SFXA 3RKWA 1LFUP 2O5RA 4L9TA 4MQVA 3HOZJ 5L3BA 1S6LA 4M6YA 1IJWC 2ZC2A 3HTSB 2DLLA 2W24A 3K1MA 1R58A 1B72A 4XL9A 5J1YA 2R7TA 1OCCH 2PFBA 4RMNA 1V55H 1ZK8A 3H36A 3P9IA 4CGZA 1A5JA 1SMTA 4PJJA 1HC8A 3G1LA 5FD5A 1K78B 4OAZA 1VF9A 1D8KA 4P9UA 5JVGF 2VBZA 3DEUA 3Q0VA 1NG7A 3BPVA 2HU9A 1F1ZA 3BY6A 1JI8A 1D0YA 2DU9A 3WU1B 3KP4A 3LSGA 1Y56A 1FSEA 3BQZA 1VQKI 2EIMH 2BW3B 4EV0A 3GZ5A 1Y0NA 2WB1N 1LE8B 2DJNA 4M6XA 2DK8A 2PMZN 5C3EJ 1OYWA 5K5OA 1Z91A 5F04A 3TP0A 3S17J 4OIRF 2WY8Q 2DMQA 2HKOA 3MZYA 4XONA 5CQEA 5GAEJ 3F9KA 2FX0A 3C2HA 4N4NB 3OYJA 3G73A 2Q2EB 3W2WA 1RC9A 2LR8A 2IGMA 3JSPA 4ASNA 4Y13A 1JKPC 2ADUA 3SZGA 2XAFA 1ZG1A 3LFUA 5EGOB 2QWWA 3KPHA 1OYIA 2MC4A 3EUHC 3GTGJ 1R36A 1ETYA 2L7FP 4G6TB 1LB2A 2VOPA 2KQRA 4HSTA 3KP5A 3LSMA 3CMMA 3DKYA 4XNFA 4XRSG 2MLGA 1FPQA 2LY9A 2ZO4A 2R3SA 1FMWA 1MW7A 1P7IA 4Y15A 4ESBA 1P6RA 5B5EC 4E7ZA 4S04A 3JRCA 2E36A 3OSGA 1T8IA 1HW5A 4RGRA 3VYUB 1HLVA 1F43A 1XSDA 1RESA 5M5YJ 4NQWB 3RSNA 3EYYA 1WJBA 4IRHA 4MTDA 3V42A 4OAYA 2X51A 3ZQIA 5B3SH 3HDDA 2NVQJ 4MFDA 1SFUA 2YUSA 3W2AA 2XKOA 4Q4ZF 2FBIA 1FTTA 1LUJB 3HGGA 4FASD 4A3MJ 3O8GA 4A2UA 5IYBJ 1MMDA 1YS6A 4UV9A 4WX9A 4CYCB 2WADA 5EEAA 4CICA 3IP4B 4G6QA 4LB5A 3D5SC 4N9IA 2QA4I 1YX3A 3VSKA 4C2TA 2LH9A 3L09A 3MKYB 4D9JA 3F3XA 4IJAA 5GTIC 4IOAF 2AXTC 2W00A 3L00A 2Y0SA 1Y8QB 4DYRA 3I0TA 2XSDC 2ZMEA 4F91B 3E6BA 3VODA 3D5LA 2LBFA 2NYXA 1HF0A 3I4PA 3MN2A 1NG6A 5E79C 2DK5A 4OIQF 2R7DA 3RIRA 1XB4A 3T5XA 2KHMA 1ZG3A 5C44J 2HXIA 3MKZA 2AQEA 2ZXHA 2JTVA 4KJZA 2BVLA 4P96A 3BG3A 4HLYA 3HOYJ 3WG9A 4A3FJ 3PSFA 2XPVA
chains in the Genus database with same CATH topology
1VI0A 5IP7J 1A6IA 3SDGA 3E7LA 3RKQA 2DTZA 1H88C 3D1NI 1TWFJ 2HOTA 3BT9A 2XGDA 1U9NA 2JJ7A 2L7ZA 4XICA 3BTCA 4QTRA 5M5XJ 2AHQA 3TW6A 3BTIA 4IHYA 1AKHB 4BXXJ 3HOVJ 1H8AC 2M34A 3FK6A 3VPRA 1ZKGA 2LVSA 1JKOC 2R5YA 4G12A 4JX4A 2VI6A 3LNQA 3LSRA 3K7AJ 5IYCJ 1MBGA 5IYDJ 2DA3A 3S2DJ 2XB5A 5E3MA 3CQZJ 2DA1A 2FQ4A 1S7EA 3WHCA 1ETOA 3PO2J 2AO9A 4A3IJ 1JTYA 2ID3A 4MLOA 1FIPA 2K9NA 3F0CA 4XRMA 2X48A 5JLXA 2KDZA 1E3OC 4CYCA 1UMQA 3DEWA 1ETVA 1X58A 5J1UA 5E3NA 4D5CA 4XK4A 1Z0XA 2LTPA 2EZIA 1MBHA 1OFCX 2R5YB 2M8GX 2EZKA 1T56A 3NAUA 3TP3A 5M3MJ 5GP9A 3A01B 3CCYA 2GLOA 2JA7J 3I4MJ 2MSYA 5HODA 3I4NJ 1O4XA 2YU9J 2ME6A 1T33A 4MO7A 3BR2A 5FKMA 1MBJA 4W97A 1DU0A 2R7ZJ 3M3YJ 4ABZA 3CDLA 2JN6A 3HM5A 4A3GJ 5M5WJ 2EQRA 3FIWA 2LKXA 2G0EA 2QCOA 1NK2P 2DA4A 4M3BA 5DS9A 1SANA 1W0UA 2Y2ZA 4A93J 1U78A 2Y0SN 1PUFA 5IPAA 2W48A 5FKOA 1ZQ3P 2EZHA 1WI3A 2DMPA 3C2BA 2CQQA 2OF7A 3S1RJ 4L5EA 3H3VK 2JA5J 2LFBA 1JT0A 1AKHA 2CRGA 1B8IB 2ECBA 3TW7A 3A03A 4DZJA 2LD5A 4A3EJ 1MNMC 2Y9ZA 1YRNB 4MIMA 3QPLA 2XPWA 2COBA 5C4XJ 4IEJA 2O9LA 4QSHA 4AYBN 4QIWN 4GFBA 2EZLA 1K83J 2XGEA 3JREA 2XRLA 3IH4A 2FJ1A 2E19A 2WAQN 3LSJA 2XPUA 3G1MA 4IHWA 3BR6A 1WGXA 1TWCJ 4BY1J 3QPSA 1PUFB 2TCTA 1X2NA 1MSEC 4EEFG 3CMYA 3GBGA 2ZB9A 1AU7A 1JJ8C 4JP0A 1ZTRA 1GT0C 2HDDA 4NDLA 3ZOBA 2K40A 3B6CA 1ETXA 1QRYA 4UUTA 4RBOA 1Q1VA 3OSFA 2O8KA 3GTQJ 3S1QJ 2YS9A 1JTXA 4A3BJ 1JKRC 2HYJA 2H8RA 3LOCA 1U9OA 5K7FA 2IBDA 1IC8A 1FJLA 3OIOA 2E1OA 4M3FA 4IHVA 5EDNA 1WPKA 2RAEA 2NVXJ 3A01A 2M0CA 2XB0X 4A3KJ 2X6OA 3A02A 2MGQA 3JRHA 3ZQGA 3S1MJ 2E2HJ 5E3LA 1BJZA 1ORKA 3S16J 4A3CJ 2R92J 3GTMJ 5E3OA 1K61A 3BTJA 2ID6A 3QQAA 3S14J 5F27A 3BR3A 1WH7A 2MG4A 3B6AA 5EYRA 1JUMA 3MKLA 3PM1A 4MFEA 5FKLA 2ME0A 2GM4A 2ECCA 5K7HA 1MBEA 1NK3P 3RZOJ 3FK7A 3K2AA 2CU7A 2VKEA 5FLVA 4J19A 1RKTA 4D5FA 2NOGA 3S15J 1B72B 1JGGA 5FLMJ 1UHSA 2JA8J 1LFBA 2E2IJ 3HGYA 5J3LA 3GTJJ 2B63J 3RZDJ 1JKQC 4A3JJ 1APLC 1IUFA 2X9DA 2EBIA 1I3QJ 1Z77A 2DMTA 2VPRA 4UUSA 5FKKA 2IEKA 3OOUA 1VNDA 3GTLJ 3JRFA 1F36A 4BBRJ 1B8IA 4M3GA 2M2EA 1TC3C 1FEXA 4M3EA 3JRBA 1YRNA 4W1UA 3JRIA 3IH2A 3JRAA 3SJMA 3TEDA 4A3LJ 3PO3J 1P7JA 1JJ6C 3BG9A 2HQ5A 4FE7A 3BTLA 4V2GA 4D7NA 4FTHA 2DMUA 5J1RA 4FCYA 1RR7A 4BKXA 3LSPA 5F0CA 4V2FA 1QVTA 2JK3A 2CQXA 4C2MJ 2NS7A 1HDDC 2VUMJ 1RETA 1WCMJ 1JUSA 4UUSB 4AC0A 1IGNA 1EF4A 1G2HA 1ZR4A 3HOWJ 3GTOJ 4JX5A 1QPIA 1I50J 2JMWA 3ZQFA 2QF7A 2L7MP 4C3IJ 5M3FJ 1TWGJ 2N8GA 1VFCA 2Y30A 5EG0B 4Y7NJ 2DA6A 4M6VA 4X1EA 1UG2A 3JRDA 3H0GJ 3HBLA 2LLKA 2Y31A 2HOSA 5JLWA 1HCRA 1ENHA 3Q0UA 5FKNA 1NTCA 4DZPA 1CQTA 3W6VA 5BNGA 2JA6J 1OJLA 5IP9J 2HXOA 1GUUA 2CJJA 3ZQCA 3UKGA 4IHXA 1R9TJ 2LP0A 9ANTA 5EZGA 2L0KA 1LFUP 2M9HA 3SFIA 3HKZN 1U8BA 3HOZJ 2HI3A 2R5ZA 1IJWC 4I76A 2DA5A 2LK2A 3BG5A 3BR5A 1MH3A 4B4CA 4C3JJ 4C3HJ 3FKIJ 1WH5A 1ETKA 3NARA 5GPAA 4I6ZA 2R0QC 4A3DJ 1B72A 5J1YA 3ZQLA 1DU6A 1MH4A 1ITYA 1ZK8A 1ETWA 1A5JA 4LOCA 3G1LA 3G1OA 5EGOA 4FISA 1VF9A 4X6AJ 3Q0VA 4HNVA 1Y1WJ 1MBKA 3BQYA 1IRZA 2H1KA 1MSFC 3LSGA 1IV6A 3BQZA 5IP6A 1X2MA 4D7MA 2MW8A 2OPTA 2EH3A 2WB1N 1LE8B 2DJNA 3GTKJ 2PMZN 5C3EJ 4XRSA 1XG1A 5IOZA 1RPWA 1IDYA 2R5ZB 5F04A 2TRTA 5EF6A 2R93J 2ELKA 3TP0A 3S17J 4Y52J 2DMQA 1GVDA 2FX0A 2CUFA 2LR8A 5FJ8J 1ZGWA 1BW5A 1I6HJ 1JKPC 2WV1A 1GV5A 5EZHA 5EGOB 1SFOJ 2Y9YA 3JRGA 2KT0A 3GTGJ 2I10A 1ETYA 2L7FP 4DW6A 4S0HB 1D5YA 5GPCA 2XGCA 2VKVA 3WHBA 4XRSG 1AHDP 3Q3SA 2LY9A 2DA2A 2DA7A 1XS9A 1FTZA 1P7IA 1IG7A 1ZR2A 3S2HJ 3JRCA 5EG0A 1BL0A 3OSGA 3HB9A 3IV5A 5C4JJ 4JYKA 1QVUA 3MVPA 1TWHJ 4FE4A 1HLVA 1F43A 1RESA 5M5YJ 2HOAA 4B3AA 5F0HA 2FD5A 3O8HA 1GDTA 3ZQIA 1RKWA 2NVQJ 3HDDA 3S1NJ 2DMNA 4MFDA 4XIDA 2YUSA 3JR9A 2NVYJ 3HOUJ 1FTTA 2L9RA 3HGGA 2O7OA 3BR1A 1IDZA 4M3DA 4A3MJ 3O8GA 5IYBJ 1JUPA 1BA5A 4RDUA 5K7ZA 5F1JA 4CYCB 3M4OJ 5EEAA 2NVTJ 3IH3A 1JT6A 4DYQA 5DTDA 1POGA 1ETQA 4B1RA 3DCFA 1GV2A 1OCTC 3L1PA 2E2JJ 3RQIA 1H89C 4DYRA 4JX6A 2XSDC 4A69C 2P81A 4BBSJ 5F08A 1HF0A 1HOMA 3MN2A 2NS8A 4AUXA 2GBYA 3Q0WA 1FIAA 1BW6A 2D5VA 3GTPJ 4DYCA 2K9SA 1MBFA 5IOYA 5C44J 2HXIA 1LE8A 3BR0A 1XC5A 5F0FA 3HOXJ 3ZQHA 2CUEA 2JWTA 3FISA 1HDPA 1TWAJ 3BG3A 2IAIA 1OCPA 3HEFA 1W0TA 1Y1VJ 3HOYJ 2DN0A 2K9QA 4A3FJ 4BY7J 2XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI0 A;  5IP7 J;  1A6I A;  3SDG A;  3E7L A;  3RKQ A;  2DTZ A;  1H88 C;  3D1N I;  1TWF J;  2HOT A;  3BT9 A;  2XGD A;  1U9N A;  2JJ7 A;  2L7Z A;  4XIC A;  3BTC A;  4QTR A;  5M5X J;  2AHQ A;  3TW6 A;  3BTI A;  4IHY A;  1AKH B;  4BXX J;  3HOV J;  1H8A C;  2M34 A;  3FK6 A;  3VPR A;  1ZKG A;  2LVS A;  1JKO C;  2R5Y A;  4G12 A;  4JX4 A;  2VI6 A;  3LNQ A;  3LSR A;  3K7A J;  5IYC J;  1MBG A;  5IYD J;  2DA3 A;  3S2D J;  2XB5 A;  5E3M A;  3CQZ J;  2DA1 A;  2FQ4 A;  1S7E A;  3WHC A;  1ETO A;  3PO2 J;  2AO9 A;  4A3I J;  1JTY A;  2ID3 A;  4MLO A;  1FIP A;  2K9N A;  3F0C A;  4XRM A;  2X48 A;  5JLX A;  2KDZ A;  1E3O C;  4CYC A;  1UMQ A;  3DEW A;  1ETV A;  1X58 A;  5J1U A;  5E3N A;  4D5C A;  4XK4 A;  1Z0X A;  2LTP A;  2EZI A;  1MBH A;  1OFC X;  2R5Y B;  2M8G X;  2EZK A;  1T56 A;  3NAU A;  3TP3 A;  5M3M J;  5GP9 A;  3A01 B;  3CCY A;  2GLO A;  2JA7 J;  3I4M J;  2MSY A;  5HOD A;  3I4N J;  1O4X A;  2YU9 J;  2ME6 A;  1T33 A;  4MO7 A;  3BR2 A;  5FKM A;  1MBJ A;  4W97 A;  1DU0 A;  2R7Z J;  3M3Y J;  4ABZ A;  3CDL A;  2JN6 A;  3HM5 A;  4A3G J;  5M5W J;  2EQR A;  3FIW A;  2LKX A;  2G0E A;  2QCO A;  1NK2 P;  2DA4 A;  4M3B A;  5DS9 A;  1SAN A;  1W0U A;  2Y2Z A;  4A93 J;  1U78 A;  2Y0S N;  1PUF A;  5IPA A;  2W48 A;  5FKO A;  1ZQ3 P;  2EZH A;  1WI3 A;  2DMP A;  3C2B A;  2CQQ A;  2OF7 A;  3S1R J;  4L5E A;  3H3V K;  2JA5 J;  2LFB A;  1JT0 A;  1AKH A;  2CRG A;  1B8I B;  2ECB A;  3TW7 A;  3A03 A;  4DZJ A;  2LD5 A;  4A3E J;  1MNM C;  2Y9Z A;  1YRN B;  4MIM A;  3QPL A;  2XPW A;  2COB A;  5C4X J;  4IEJ A;  2O9L A;  4QSH A;  4AYB N;  4QIW N;  4GFB A;  2EZL A;  1K83 J;  2XGE A;  3JRE A;  2XRL A;  3IH4 A;  2FJ1 A;  2E19 A;  2WAQ N;  3LSJ A;  2XPU A;  3G1M A;  4IHW A;  3BR6 A;  1WGX A;  1TWC J;  4BY1 J;  3QPS A;  1PUF B;  2TCT A;  1X2N A;  1MSE C;  4EEF G;  3CMY A;  3GBG A;  2ZB9 A;  1AU7 A;  1JJ8 C;  4JP0 A;  1ZTR A;  1GT0 C;  2HDD A;  4NDL A;  3ZOB A;  2K40 A;  3B6C A;  1ETX A;  1QRY A;  4UUT A;  4RBO A;  1Q1V A;  3OSF A;  2O8K A;  3GTQ J;  3S1Q J;  2YS9 A;  1JTX A;  4A3B J;  1JKR C;  2HYJ A;  2H8R A;  3LOC A;  1U9O A;  5K7F A;  2IBD A;  1IC8 A;  1FJL A;  3OIO A;  2E1O A;  4M3F A;  4IHV A;  5EDN A;  1WPK A;  2RAE A;  2NVX J;  3A01 A;  2M0C A;  2XB0 X;  4A3K J;  2X6O A;  3A02 A;  2MGQ A;  3JRH A;  3ZQG A;  3S1M J;  2E2H J;  5E3L A;  1BJZ A;  1ORK A;  3S16 J;  4A3C J;  2R92 J;  3GTM J;  5E3O A;  1K61 A;  3BTJ A;  2ID6 A;  3QQA A;  3S14 J;  5F27 A;  3BR3 A;  1WH7 A;  2MG4 A;  3B6A A;  5EYR A;  1JUM A;  3MKL A;  3PM1 A;  4MFE A;  5FKL A;  2ME0 A;  2GM4 A;  2ECC A;  5K7H A;  1MBE A;  1NK3 P;  3RZO J;  3FK7 A;  3K2A A;  2CU7 A;  2VKE A;  5FLV A;  4J19 A;  1RKT A;  4D5F A;  2NOG A;  3S15 J;  1B72 B;  1JGG A;  5FLM J;  1UHS A;  2JA8 J;  1LFB A;  2E2I J;  3HGY A;  5J3L A;  3GTJ J;  2B63 J;  3RZD J;  1JKQ C;  4A3J J;  1APL C;  1IUF A;  2X9D A;  2EBI A;  1I3Q J;  1Z77 A;  2DMT A;  2VPR A;  4UUS A;  5FKK A;  2IEK A;  3OOU A;  1VND A;  3GTL J;  3JRF A;  1F36 A;  4BBR J;  1B8I A;  4M3G A;  2M2E A;  1TC3 C;  1FEX A;  4M3E A;  3JRB A;  1YRN A;  4W1U A;  3JRI A;  3IH2 A;  3JRA A;  3SJM A;  3TED A;  4A3L J;  3PO3 J;  1P7J A;  1JJ6 C;  3BG9 A;  2HQ5 A;  4FE7 A;  3BTL A;  4V2G A;  4D7N A;  4FTH A;  2DMU A;  5J1R A;  4FCY A;  1RR7 A;  4BKX A;  3LSP A;  5F0C A;  4V2F A;  1QVT A;  2JK3 A;  2CQX A;  4C2M J;  2NS7 A;  1HDD C;  2VUM J;  1RET A;  1WCM J;  1JUS A;  4UUS B;  4AC0 A;  1IGN A;  1EF4 A;  1G2H A;  1ZR4 A;  3HOW J;  3GTO J;  4JX5 A;  1QPI A;  1I50 J;  2JMW A;  3ZQF A;  2QF7 A;  2L7M P;  4C3I J;  5M3F J;  1TWG J;  2N8G A;  1VFC A;  2Y30 A;  5EG0 B;  4Y7N J;  2DA6 A;  4M6V A;  4X1E A;  1UG2 A;  3JRD A;  3H0G J;  3HBL A;  2LLK A;  2Y31 A;  2HOS A;  5JLW A;  1HCR A;  1ENH A;  3Q0U A;  5FKN A;  1NTC A;  4DZP A;  1CQT A;  3W6V A;  5BNG A;  2JA6 J;  1OJL A;  5IP9 J;  2HXO A;  1GUU A;  2CJJ A;  3ZQC A;  3UKG A;  4IHX A;  1R9T J;  2LP0 A;  9ANT A;  5EZG A;  2L0K A;  1LFU P;  2M9H A;  3SFI A;  3HKZ N;  1U8B A;  3HOZ J;  2HI3 A;  2R5Z A;  1IJW C;  4I76 A;  2DA5 A;  2LK2 A;  3BG5 A;  3BR5 A;  1MH3 A;  4B4C A;  4C3J J;  4C3H J;  3FKI J;  1WH5 A;  1ETK A;  3NAR A;  5GPA A;  4I6Z A;  2R0Q C;  4A3D J;  1B72 A;  5J1Y A;  3ZQL A;  1DU6 A;  1MH4 A;  1ITY A;  1ZK8 A;  1ETW A;  1A5J A;  4LOC A;  3G1L A;  3G1O A;  5EGO A;  4FIS A;  1VF9 A;  4X6A J;  3Q0V A;  4HNV A;  1Y1W J;  1MBK A;  3BQY A;  1IRZ A;  2H1K A;  1MSF C;  3LSG A;  1IV6 A;  3BQZ A;  5IP6 A;  1X2M A;  4D7M A;  2MW8 A;  2OPT A;  2EH3 A;  2WB1 N;  1LE8 B;  2DJN A;  3GTK J;  2PMZ N;  5C3E J;  4XRS A;  1XG1 A;  5IOZ A;  1RPW A;  1IDY A;  2R5Z B;  5F04 A;  2TRT A;  5EF6 A;  2R93 J;  2ELK A;  3TP0 A;  3S17 J;  4Y52 J;  2DMQ A;  1GVD A;  2FX0 A;  2CUF A;  2LR8 A;  5FJ8 J;  1ZGW A;  1BW5 A;  1I6H J;  1JKP C;  2WV1 A;  1GV5 A;  5EZH A;  5EGO B;  1SFO J;  2Y9Y A;  3JRG A;  2KT0 A;  3GTG J;  2I10 A;  1ETY A;  2L7F P;  4DW6 A;  4S0H B;  1D5Y A;  5GPC A;  2XGC A;  2VKV A;  3WHB A;  4XRS G;  1AHD P;  3Q3S A;  2LY9 A;  2DA2 A;  2DA7 A;  1XS9 A;  1FTZ A;  1P7I A;  1IG7 A;  1ZR2 A;  3S2H J;  3JRC A;  5EG0 A;  1BL0 A;  3OSG A;  3HB9 A;  3IV5 A;  5C4J J;  4JYK A;  1QVU A;  3MVP A;  1TWH J;  4FE4 A;  1HLV A;  1F43 A;  1RES A;  5M5Y J;  2HOA A;  4B3A A;  5F0H A;  2FD5 A;  3O8H A;  1GDT A;  3ZQI A;  1RKW A;  2NVQ J;  3HDD A;  3S1N J;  2DMN A;  4MFD A;  4XID A;  2YUS A;  3JR9 A;  2NVY J;  3HOU J;  1FTT A;  2L9R A;  3HGG A;  2O7O A;  3BR1 A;  1IDZ A;  4M3D A;  4A3M J;  3O8G A;  5IYB J;  1JUP A;  1BA5 A;  4RDU A;  5K7Z A;  5F1J A;  4CYC B;  3M4O J;  5EEA A;  2NVT J;  3IH3 A;  1JT6 A;  4DYQ A;  5DTD A;  1POG A;  1ETQ A;  4B1R A;  3DCF A;  1GV2 A;  1OCT C;  3L1P A;  2E2J J;  3RQI A;  1H89 C;  4DYR A;  4JX6 A;  2XSD C;  4A69 C;  2P81 A;  4BBS J;  5F08 A;  1HF0 A;  1HOM A;  3MN2 A;  2NS8 A;  4AUX A;  2GBY A;  3Q0W A;  1FIA A;  1BW6 A;  2D5V A;  3GTP J;  4DYC A;  2K9S A;  1MBF A;  5IOY A;  5C44 J;  2HXI A;  1LE8 A;  3BR0 A;  1XC5 A;  5F0F A;  3HOX J;  3ZQH A;  2CUE A;  2JWT A;  3FIS A;  1HDP A;  1TWA J;  3BG3 A;  2IAI A;  1OCP A;  3HEF A;  1W0T A;  1Y1V J;  3HOY J;  2DN0 A;  2K9Q A;  4A3F J;  4BY7 J;  2XPV A; 
#chains in the Genus database with same CATH topology
 3H3Z A;  5LHI A;  3RKQ A;  3S3M A;  4RB0 A;  3KE2 A;  4U7B A;  3EYI A;  3NWS A;  2A5W A;  3DBH B;  4P9F A;  2ZJQ F;  3S3N A;  5CVR A;  3BT9 A;  2GIV A;  3QU3 A;  4IPA A;  3RYR A;  1U9N A;  2OQG A;  3J7A O;  3OYD A;  2LDU A;  1YIT I;  5LFA A;  2FOW A;  2VBY A;  5KCM A;  4XKW A;  2P7V B;  4XLE A;  1R5H A;  3VYT B;  4FHT A;  2NRA C;  2V9K A;  3QOE A;  3LWF A;  2E1C A;  3F8C A;  3IKT A;  3IRR A;  2Z33 A;  3GZ6 A;  3RPU D;  1J7K A;  4BYY A;  4CCM A;  1WQ2 A;  4CH7 A;  5JR3 A;  5IYC J;  5IYD J;  3PNT A;  1QHG A;  3S2D J;  3MZH A;  5TIS C;  2TDX A;  4OIO F;  2FQ4 A;  3CQZ J;  1U8R A;  1ETO A;  3KIO A;  3NQO A;  5AIP A;  2VJJ A;  4A3I J;  4Y3O A;  1UST A;  2EFO A;  2L5Q A;  1ZN2 A;  4YEL A;  4BQN A;  3F0C A;  3C2G A;  2KDZ A;  3SZT A;  3HUG B;  2VN2 A;  1UMQ A;  2NNY A;  1XD7 A;  1ETV A;  4M73 A;  4X0G A;  4O3M A;  2LTP A;  1Z05 A;  5JHF A;  3G4S I;  1FP1 D;  3V8J A;  2KRC A;  2NNN A;  4KA4 A;  3TP3 A;  3T8T A;  3A01 B;  3ECH A;  2LG4 A;  4ZYE A;  3I4M J;  4RAY A;  3ZXS A;  1ZYR F;  3AG2 H;  3ZMU A;  2VE8 A;  1T33 A;  1BIA A;  2R7F A;  3DFG A;  3Q9S A;  3CF5 F;  4PGH A;  3L2W A;  2ETH A;  4M71 A;  4R8H A;  2D1H A;  2LYC A;  5L3G A;  1TBX A;  3HHG A;  2R7Z J;  2GA2 A;  4ENN A;  3RYP A;  5F6F A;  3SQN A;  3J80 Z;  1FSH A;  3HM5 A;  1P2F A;  1DP7 P;  2A68 F;  1FT9 A;  4RGS A;  2IW5 A;  2EQR A;  1KYZ A;  2ZSI B;  3FIW A;  3ONQ A;  2LKX A;  2IS1 A;  2CGP A;  2HFH A;  2CYY A;  4G9Y A;  4HG2 A;  2OTL I;  3IUO A;  5DS9 A;  1H9T A;  2DYR H;  4HDU A;  1MDM A;  5CVV A;  3N05 A;  3G6E I;  4UVA A;  4A93 J;  1YW9 A;  5AIQ A;  2Y0S N;  3K4C A;  1RI7 A;  3M8F A;  4HF1 A;  2W48 A;  5FKO A;  1ZQ3 P;  1LVA A;  1YOV B;  2QQB A;  4E4H A;  1J0R A;  3C2B A;  3CD6 I;  5BPI A;  4L5E A;  3JTG A;  1ZH5 A;  2DOF A;  1TQM A;  2CMP A;  1HKS A;  2RDP A;  1BN5 A;  1IN5 A;  3DEE A;  3UNG C;  3TW7 A;  2OCC H;  2V9V A;  2RVC A;  3BWG A;  1IN6 A;  1V5E A;  5L3C A;  4LB6 B;  1YRN B;  4MIM A;  3WTT C;  3QPL A;  3D5R C;  3KLN A;  2FMY A;  1EV7 A;  4AYB N;  1XMK A;  4I99 C;  3CO6 C;  3IRQ A;  3OYB A;  3WTY C;  3K1N A;  4JK1 X;  4XBF A;  1W1W E;  2E19 A;  2HYG D;  3L2U A;  2XPU A;  2V1D A;  1GVJ A;  3J7Y J;  1T08 B;  3G3Z A;  4BY1 J;  4EJV A;  3BJ6 A;  4EEF G;  2M7B A;  5FO5 A;  4L9J A;  2CUZ A;  4BAC A;  1R00 A;  1ZTR A;  3OS1 A;  1EA3 A;  1K7A A;  1GT0 C;  3ZOB A;  2K40 A;  1QRY A;  1N25 A;  1OIS A;  1YW8 A;  4CZZ A;  4RBO A;  3CZ6 A;  2HDW A;  3FHN A;  4ZYH A;  5HNF A;  1WZ2 A;  3E97 A;  3C1D A;  3VDX A;  1O3T A;  2H8R A;  4ZZL A;  2VKD A;  4YIF A;  4HNT A;  1SD5 A;  1U9O A;  3M7G A;  5CJ9 A;  4B43 A;  5K7F A;  1IRF A;  4P1W A;  4E7H A;  3I71 A;  3OR1 C;  4IZZ A;  2FF4 A;  5LEK A;  4IHV A;  3PQJ A;  4A3K J;  2XB0 X;  4L5J A;  3A02 A;  3K70 D;  2DFE A;  3W6J B;  3S1M J;  2HZT A;  1U5T A;  4XR6 A;  3E6C C;  1BJZ A;  1ORK A;  3I59 A;  3S16 J;  2XVC A;  2VE9 A;  4IO9 F;  1KQ0 A;  2LY2 A;  2R7O A;  3QQA A;  2HOE A;  1QBJ A;  3B6A A;  1QPM A;  2BY0 A;  4HNU A;  3LSH A;  5FKL A;  3N97 A;  1FNN A;  1MJ9 A;  4MHG A;  1F9N A;  5K7H A;  1MBE A;  3TDZ C;  1LEB A;  3R4K A;  1VQ4 I;  1O7F A;  1K6O A;  1TTY A;  2VKE A;  4XLH A;  4M9S A;  1RKT A;  2BHY A;  5TRD A;  1JGG A;  2UXX A;  5FLM J;  1UHS A;  4ZDO A;  1A35 A;  5JHU A;  3K4B A;  5J3L A;  5H6R A;  3ZN0 A;  2CQ7 A;  1JKQ C;  4ENK A;  4RLQ A;  2EA4 A;  1APL C;  2XRO A;  4BDZ A;  4IKF A;  2IEK A;  1D3Y A;  3I64 A;  1RIO H;  3MFK A;  5K1Y A;  4R1H A;  1JHF A;  2JUC A;  1V54 H;  1YJW I;  1VQ9 I;  2HWV A;  2VB6 A;  4OWR B;  2X1C A;  1B8I A;  3KEO A;  5KVR A;  1VQO I;  1TC3 C;  2KZV A;  3HXL A;  3CDH A;  4MEX F;  3JRB A;  2AQF A;  5GAG J;  4W1U A;  4XMY A;  2HGC A;  2JSP A;  3JRI A;  1VQL I;  3DBR B;  3WG7 H;  3L7W A;  3ZMZ A;  3BZ6 A;  2KDO A;  4UB6 C;  1JJ6 C;  3PJR A;  2OZU A;  3BG9 A;  2HQ5 A;  3J80 K;  4H4K C;  4BEH A;  3BTL A;  4V2G A;  5CKT A;  4D7N A;  5J1R A;  2IS4 A;  2ZCW A;  3EUH A;  4NC6 A;  3K70 C;  1R5I D;  5F0C A;  4HV5 A;  4Z6Y A;  5DCM A;  2JK3 A;  2CQX A;  3WGH A;  2VBW A;  3E0J B;  1ZRF A;  3GX4 X;  3PL8 A;  4PFO A;  2P4W A;  4OMY A;  3WOD F;  4EM2 A;  1G2H A;  1YYV A;  1I50 J;  4AIH A;  4ENM A;  4RS8 A;  3GFL A;  2PN6 A;  2W57 A;  3K4J A;  4M72 A;  5DD4 A;  4L5I A;  4WXD A;  5M3F J;  3M8J A;  3G2B A;  1VFC A;  2Y30 A;  3JTH A;  2LKP A;  3ZMD A;  3JRD A;  1IV8 A;  3U1D A;  1O3S A;  2L4M A;  3GUD A;  3H0G J;  3HBL A;  4I0B A;  4M9Z A;  2H8W A;  1FOW A;  5JLW A;  1HCR A;  1Z1D A;  4HX7 A;  2CV1 A;  1NTC A;  3O2P E;  2FML A;  2JA6 J;  2Z99 A;  1OJL A;  4AIK A;  4IHX A;  2NXN B;  3WGG A;  2FE3 A;  4XLP F;  1ULY A;  9ANT A;  1XCB A;  5EZG A;  3I55 I;  5FGM A;  5JI6 A;  2ISZ A;  2M9H A;  1HKT A;  4OOI A;  1FZP B;  3CP2 A;  1K4T A;  1W5T A;  4ON0 A;  1WHU A;  2W25 A;  3BR5 A;  4B4C A;  2XF7 A;  4C3J J;  3FKI J;  3NAR A;  2M30 A;  4AD9 A;  2R0Q C;  4KIG A;  4CYD A;  4Z2Y A;  3HHH A;  3OYH A;  3ZQL A;  1MH4 A;  1R1T A;  2P5V A;  4KIB A;  4LOC A;  3GO5 A;  4ZZD A;  2IGK A;  3G1O A;  2RN7 A;  5EGO A;  4FIS A;  1L0O C;  2M0M A;  3NEU A;  4Y4R A;  5ILV A;  4HNV A;  5E1W A;  3HRT A;  1D1A A;  1I6X A;  1Z7L A;  2LMD A;  4EMS A;  1T95 A;  1XTA A;  3DPT A;  3QRF F;  1OR7 C;  3DTI A;  1EH8 A;  3CO7 C;  2NOJ B;  2KL4 A;  3OYG A;  5CVJ A;  3DP7 A;  4RM3 A;  4MQ9 F;  3OYI A;  1WFX A;  3AG1 H;  2Z1D A;  3BJO A;  4IRG A;  4L9V A;  1UAA A;  1ZAR A;  1N75 A;  3F8B A;  4XRS A;  1BI2 A;  3BPX A;  1IDY A;  4XOT A;  4PUS A;  1XGM A;  5EF6 A;  2F5D A;  2IA2 A;  3F6O A;  4NB5 A;  2MC3 A;  2ZJR F;  1GXQ A;  4XLC A;  1ZGW A;  1ZG5 A;  1I6H J;  2GOM A;  3MWM A;  5LGN A;  3PIP F;  2WV1 A;  1S7A A;  3QAH A;  1GV5 A;  1LNW A;  1STZ A;  3A2K A;  2RC4 A;  3U9G A;  3LMM A;  1PYV A;  4DW6 A;  4S05 A;  3OYL A;  4KIS A;  1LDK B;  1MIJ A;  3HRS A;  3ZPL A;  3QWL A;  4XSZ F;  1KU9 A;  2L01 A;  3OL3 A;  3Q3S A;  1XS9 A;  4IQJ A;  2GWR A;  5DM6 F;  4I98 B;  4RGX A;  2BGC A;  3ISP A;  5DV5 A;  4RB3 C;  1W7P D;  3IV5 A;  3RI4 A;  5C4J J;  2CUJ A;  5ICC A;  3OYE A;  2BOL A;  2IGN A;  4AM3 A;  4B3A A;  2Z3Y A;  1N78 A;  2W85 A;  1QZY A;  2FD5 A;  4TV7 A;  4AWX B;  1ZHF A;  1GDT A;  3DWL E;  1ON2 A;  3F22 A;  3LQR A;  4KIT B;  3JR9 A;  3WGI A;  2UWM A;  4HX8 A;  3BR1 A;  4M3D A;  2BY3 A;  3VB2 A;  1MD0 A;  5HDN A;  1JUP A;  1BA5 A;  4RDU A;  3K4M A;  4A0Z A;  3ESW B;  2VIX A;  1DGW Y;  4CXF A;  2R7W A;  1J09 A;  3ZGK A;  4E7L A;  2CW8 A;  1CF7 B;  4B1R A;  1Z3X A;  1XMX A;  2DCE A;  4LK0 F;  4KMF A;  2E2J J;  1T0F C;  2BBY A;  3RQ4 A;  3F23 A;  4JX6 A;  4O5V A;  2OCE A;  1FBU A;  2GXG A;  4A12 A;  1IZ1 A;  1G3Y A;  4BBS J;  3OYM A;  3CJN A;  2V6E A;  2K86 A;  1HOM A;  4IHS A;  5GAD J;  5J47 A;  3ZRG A;  2DBB A;  2GBY A;  2HR3 A;  2L54 A;  4GGG A;  2G9W A;  1E0E A;  1TQP A;  3F72 A;  4LG3 A;  2D5V A;  4DYC A;  2PJP A;  2WAE A;  2EWN A;  2K9S A;  2XC7 A;  3H9G A;  5IOY A;  3RPU A;  5FFZ A;  1SMY F;  2EB7 A;  3R60 A;  4AVZ A;  4PGG A;  5F0F A;  3MCZ A;  3K4L A;  3QYB A;  3L9F A;  3HOX J;  2JWT A;  3SFZ A;  5J6X A;  1YE9 A;  3I3L A;  3L2R A;  3VYS B;  1TWA J;  2PLY A;  1OCP A;  5E1X A;  2JT1 A;  3ULQ B;  1DUX C;  2E1M B;  3CCS I;  2K9Q A;  4BY7 J;  2WAQ A;  3LSI A;  4GO1 A;  2KMU A;  4RM2 A;  2ZJP F;  3JCU C;  3SDG A;  3WE2 A;  1H88 C;  3D1N I;  4GXO A;  2MH2 A;  3U1K A;  1I27 A;  2BYV E;  4YG2 F;  3TGN A;  4QTR A;  2JJ7 A;  2CV0 A;  4YFN F;  3BTC A;  1ODD A;  4A0Y A;  4B47 A;  2AHQ A;  2Z16 A;  3FMQ A;  2D1V A;  3OL4 A;  4DNC A;  5HS8 A;  2P6S A;  2IXS A;  3BCA A;  3CCQ I;  5D8K B;  1D1B A;  3ERM A;  4Y33 A;  2HVR A;  3GEZ A;  2ZBK A;  1YO5 C;  2PEX A;  2XGX A;  5D5W B;  3LA2 A;  4UHT A;  4G12 A;  4BHP A;  2Q1Z B;  3FXJ A;  2VI6 A;  2ZXW H;  3LNQ A;  2O6G E;  3T1B A;  2W82 A;  2G7H A;  4QPO A;  1IN7 A;  2V1X A;  1VQM I;  2L9N A;  4UNO A;  2EV6 A;  2UXN A;  3PO2 J;  2ID3 A;  3BOQ A;  1YX5 A;  1FIP A;  5KK1 A;  2K9N A;  2ACJ A;  2ZXJ A;  2LKS A;  4XRM A;  3DU5 A;  5DUI A;  5JLX A;  1A04 A;  1B1B A;  2H6C A;  2R7S A;  1R5G A;  3FMS A;  3E1S A;  1PVE A;  3DEW A;  5J1U A;  2MH9 A;  4D5C A;  3I56 I;  4C9Y A;  3OS2 A;  3CCL I;  2EZI A;  4P5O A;  5CVU A;  1OFC X;  1TW2 A;  3LFK A;  2UUZ A;  2WBM A;  3TOB A;  3NAU A;  4HEA 2;  5M3M J;  2R7R A;  1E2X A;  1MMG A;  2E1M C;  3H5R A;  4I7H A;  3FXR A;  3CCY A;  2GLO A;  4CHU A;  3HOS A;  2QSF X;  1MGT A;  1O4X A;  1FWZ A;  3S93 A;  1J59 A;  4XOR A;  4P55 A;  1V3F A;  4NHJ A;  4NC8 A;  5DCF A;  2KFD A;  4N9H A;  3E3V A;  1RUO A;  3ZMV A;  4IL6 C;  4W97 A;  1E3H A;  2DT7 B;  1DU0 A;  5DM7 F;  4ABZ A;  2BZT A;  3ELK A;  3CDL A;  1PDN C;  4A3G J;  2F4I A;  3I5U A;  1IUY A;  5M5W J;  4KNY A;  4LG0 B;  1WJA A;  4U0W A;  3CC4 I;  3ZMS A;  1NK2 P;  4K2E A;  4BE1 A;  4M3B A;  1REP C;  1SAN A;  1W0U A;  5FLX Z;  4IHT A;  1U78 A;  2PMU A;  5CQG A;  1Y39 A;  2IS2 A;  2A6E F;  2X0L A;  4E7I A;  3KLO A;  1GXP A;  1WI3 A;  4HW0 A;  4HX4 A;  1W5C C;  2OQR A;  1MMS A;  2WY7 Q;  4KDP A;  2GOX B;  3S1R J;  1WJ5 A;  1BBY A;  3HPH A;  2W7N A;  1JT0 A;  3R61 A;  4BNC A;  1AKH A;  3AKZ A;  2VQG A;  4BJT A;  3A03 A;  1IXR C;  3M9A A;  2X1D A;  1WVR A;  3R0A A;  1MNM C;  2GXB A;  2EK5 A;  4LD5 A;  1R4M B;  1BIB A;  2KKO A;  5HLI A;  2XPW A;  4WCG A;  2H09 A;  3K2Z A;  1TNS A;  1R1V A;  2JRM A;  4GFB A;  1E3P A;  2EZL A;  2KIQ A;  2A05 A;  2RKH A;  1K83 J;  2YX4 A;  2D45 A;  3CUQ B;  4AYB A;  4ZYA A;  4BH9 A;  4BHC A;  4JQF A;  2FJ1 A;  2WAQ N;  1WGX A;  2LF8 A;  2JQ7 A;  1TLH B;  1TWC J;  1UEL B;  3PFI A;  4FX0 A;  1X2N A;  2HVS A;  2PJR B;  2E35 A;  4ITV A;  3CMY A;  4L0Y B;  1AU7 A;  3K6G A;  2DFF A;  2HDD A;  1IO2 A;  3OSF A;  1B59 A;  4UUT A;  1LDJ A;  2V6C A;  1G6N A;  3CCJ I;  5DYM A;  3S1Q J;  2A6H F;  2FRH A;  2R4G A;  3WTW C;  2L3D A;  2QBY B;  2VON A;  3CUO A;  2M87 A;  3H5A A;  4BGD A;  1JKR C;  4B3X A;  4A3B J;  2R7U A;  3T0Y A;  5DUK A;  1S9H A;  4HDV A;  1XSV A;  2FEZ A;  3S32 A;  3KZY A;  2IBD A;  2QQ8 A;  1FJL A;  3BG6 A;  5A2Q Z;  2CQN A;  2KIS A;  2E1O A;  4XM3 A;  1SFE A;  4G7O F;  2J5O A;  2KP6 A;  4XLF A;  2M0C A;  5HOO A;  2A07 F;  1XGS A;  2GIZ A;  2HTJ A;  3ZQG A;  1K4S A;  2G7U A;  5E3L A;  2QQA A;  4A3C J;  3KET A;  3TO9 A;  5IY5 H;  3BTJ A;  1JE8 A;  3S14 J;  2OAZ A;  2HQN A;  2MG4 A;  1JUM A;  3MKL A;  2EIJ H;  3RDI A;  1KA8 A;  2JPB A;  3GLX A;  4PSW A;  4PZJ A;  2ECC A;  2FQ3 A;  3AAF A;  3CLO A;  4NNJ A;  3S8P A;  5FLV A;  2FBH A;  3EUA A;  4J19 A;  2J5P A;  1Q1H A;  5KHD A;  3HZJ A;  2NOG A;  4WK8 F;  2ZNY A;  3B73 A;  1B72 B;  1BC8 C;  2X1E A;  1R4N B;  2JA8 J;  2O8X A;  2Z2S B;  1OPC A;  5KAI C;  1XSX A;  3RZD J;  2YR2 A;  1OR7 A;  3CUQ C;  3FXQ A;  5JVT A;  4A3J J;  2COM A;  1IUF A;  2X9D A;  2GA1 A;  2M3A A;  2VPR A;  2O61 A;  1LPQ A;  1X1C A;  2ESH A;  4JBA A;  4ANJ A;  2QGU A;  2LOO A;  3H0D A;  3WTX C;  3A1Y A;  2K4B A;  2OC6 A;  1V5G A;  3I54 A;  1S7O A;  3FXO A;  5FB2 A;  4HAM A;  2M5W A;  1Y0U A;  3PO3 J;  1P7J A;  3LA3 A;  1X4O A;  2OTJ I;  4LIT A;  4FTH A;  2DMU A;  3F8N A;  1LEA A;  2VC0 A;  5IT9 Z;  3LSP A;  1S72 I;  4V2F A;  2VUM J;  5FLX K;  1X3Z B;  2VOO A;  1JUS A;  2FXA A;  1YQA A;  1D1C A;  2XAQ A;  4CCL A;  3CCR I;  1R6R A;  2RNG A;  4XQF A;  3R6S A;  1ACI A;  1QPI A;  5CPR B;  4HF0 A;  4MTE A;  3R0J A;  4Q5S F;  3BDD A;  3DKW A;  3OS0 A;  2OZ6 A;  3GFI A;  4HPQ A;  4KN7 X;  1FLI A;  1TWG J;  1HXD A;  2N8G A;  3J7A Y;  4X1E A;  1UG2 A;  2QEN A;  2XHK A;  2DAO A;  2F6C A;  4FQG A;  2JRT A;  4RB2 C;  2X6X A;  1JGS A;  2Y31 A;  4F55 A;  3FXL A;  2VAS A;  3IC7 A;  4OIN F;  2IVM A;  4BQQ A;  2F5E A;  1SVO A;  5FKN A;  1X3U A;  4XKV A;  2KLO A;  2DOE A;  3SYT A;  5BNG A;  2NAZ A;  2MYS A;  4EJO A;  1VQ5 I;  5IP9 J;  2HXO A;  2CJJ A;  3UKG A;  1J5Y A;  4MEY F;  4BDY A;  3B02 A;  4O6J A;  2XRN A;  1D0Z A;  2L0K A;  2HKX A;  2Y75 A;  5HLH A;  3PFY A;  3VWB A;  2HI3 A;  1VQ8 I;  4IRI A;  4I76 A;  2DA5 A;  2LK2 A;  3PUF A;  3ABM H;  1MH3 A;  2LRD A;  3TDU C;  1ZEL A;  1T0F A;  4C3H J;  2Y69 H;  1HSJ A;  1ETK A;  1WH5 A;  2PG4 A;  5GPA A;  2B9S A;  1R7J A;  3AL0 B;  4V19 K;  1DU6 A;  1ITY A;  4QLC U;  1PUE E;  3FDY A;  2RRE A;  4E7S A;  2Q8K A;  3CCU I;  1DPR A;  1XCV A;  1QZE A;  1WJE A;  2ZME B;  4PDK A;  4X6A J;  1UFM A;  1Z67 A;  5A2Q K;  1Y1W J;  4F7Z A;  2LBF B;  1UCR A;  2H1K A;  3I58 A;  1Y8R B;  4HBL A;  1QZZ A;  5IP6 A;  2R7Q A;  1W7P A;  4LJZ F;  2HQA A;  4D7M A;  2OPT A;  3TBI A;  2EH3 A;  1YJN I;  5H2F C;  2IT0 A;  2P5L C;  6PAX A;  3O3K A;  3GTK J;  4UY8 I;  2R5Z B;  2OUM A;  4EGY A;  4ZYG A;  4ENJ A;  3MMY B;  4UVC A;  2P8T A;  1XGN A;  3D0S A;  4WXC A;  4CA0 A;  2CUF A;  2KIF A;  2DW4 A;  2F5V A;  2YPR A;  5FJ8 J;  1BW5 A;  1JXS A;  5LGU A;  3QP5 A;  2Z5U A;  1Y6I A;  3L2V A;  1YJ9 I;  5FFX A;  4XRF A;  5GTH C;  5D4R A;  4HV6 A;  4ZTF A;  1MJA A;  2I5U A;  2HZD A;  2KT0 A;  3LAP A;  2I10 A;  3M1E A;  2W84 A;  5GPC A;  2WV0 A;  1AHD P;  2KZG A;  2DA2 A;  2DOA A;  2DA7 A;  4ETS A;  5FD6 A;  1PJR A;  1FTZ A;  2E1N A;  2XUB A;  1IG7 A;  4ZDL A;  1CF7 A;  1YHQ I;  5EG0 A;  1AWC A;  2DQL A;  1BL0 A;  2L02 A;  1TW3 A;  3HB9 A;  2EPF A;  2K9M A;  4U0Y A;  4JYK A;  4BQO A;  1QVU A;  3IL2 A;  1TWH J;  3ABK H;  2EV5 A;  4FE4 A;  2DI3 A;  2L9V A;  3AL0 C;  4IOC F;  4EJT A;  2HOA A;  3C3W A;  5K5Q A;  2ICW G;  1ONV A;  2FNP A;  3CMA I;  3DPU A;  2JA2 A;  3BRO A;  3MEX A;  3O8H A;  1BI1 A;  5ED4 A;  1IRG A;  1RKW A;  3FX3 A;  3OYN A;  2DMN A;  3S1N J;  4XID A;  4G6D A;  2FOK A;  2R7X A;  2MD5 A;  3QPT A;  4YEJ A;  3F8F A;  5IT9 K;  2L9R A;  4AIJ A;  1USS A;  2MD0 A;  1X19 A;  4WF2 A;  1KU2 A;  1ZRE A;  3ZQ7 A;  4ZYD A;  5BMZ A;  4YRV A;  5F1J A;  3M4O J;  1XGO A;  4N0B A;  1HBX G;  1ZLK A;  2NVT J;  3FF5 A;  3IH3 A;  5DD8 A;  3COA C;  3ABL H;  1JT6 A;  3SEQ A;  4A5M A;  4DYQ A;  1XN7 A;  2Y48 A;  3CME I;  3S3O A;  1SAX A;  2X85 A;  1ETQ A;  3DCF A;  1GV2 A;  4XSX F;  1OKR A;  2E34 A;  4II3 A;  1OCT C;  1TT5 B;  3L1P A;  1QA6 A;  3RQI A;  3F6V A;  4LIV A;  1H89 C;  1K78 A;  2JPC A;  2VXZ A;  3MZ8 A;  3HIF A;  2P81 A;  1F5T A;  4N4O B;  1T39 A;  2Z9O A;  1Z9C A;  2PI0 A;  3E5U A;  4WXH A;  4B09 A;  2VKH A;  1OYY A;  2NS8 A;  1RZ4 A;  2DJI A;  2VL8 A;  3OIP A;  3Q0W A;  3GFM A;  4WWC A;  1H0M A;  1U2W A;  1LVK A;  2IA1 A;  3GTP J;  2E60 A;  4FET A;  3OV8 A;  2BW3 A;  1MBF A;  4DBQ A;  4BHB A;  1LE8 A;  3P9K A;  4II2 A;  4CCJ A;  2CUE A;  5HLT A;  3BG7 A;  3FIS A;  1HDP A;  1X4P A;  4KN4 X;  1Z6T A;  2GZW A;  2H27 A;  3HEF A;  3K69 A;  1Y1V J;  3JAM K;  3TOA A;  1MDM B;  1KYW A;  2Q2E A;  2RNJ A;  2DN0 A;  5D4S A;  1D5V A;  1VI0 A;  3WU2 C;  1A6I A;  2QEX I;  4HYE A;  2HS5 A;  2DTZ A;  1K6Y A;  3V7C A;  4F3Q A;  4EGZ A;  3BZK A;  1IW7 F;  1W5S A;  3OWT A;  2LY1 A;  4XIC A;  5LBQ A;  5JFR A;  5LD2 C;  2HVQ A;  4J00 A;  5E20 A;  1SD7 A;  1ZGA A;  3TO6 A;  3OY9 A;  3K0L A;  2RGV A;  3PQK A;  3GFJ A;  3SHF A;  4BXX J;  3HOV J;  2M34 A;  3F8M A;  4XN0 A;  3MD2 A;  2AS5 F;  2LVS A;  4FT8 A;  5E8G A;  2HQR A;  1ERD A;  1JKO C;  3E6M A;  1WWX A;  2H1L A;  3DF8 A;  4JX4 A;  3FZV A;  3RPQ A;  5LLQ A;  4ESJ A;  4NQW A;  3LL7 A;  2A69 F;  2WTE A;  1MBG A;  2DA3 A;  2LNB A;  3HC7 A;  2O0Y A;  2VT2 A;  2XB5 A;  5E3M A;  1W4M A;  1S7E A;  3L2Q A;  2AO9 A;  2QM3 A;  1JTY A;  2OA4 A;  4KMU X;  2H6B A;  4MLO A;  1Z6R A;  2L4A A;  3C18 A;  2V9P A;  4I02 A;  1TP4 A;  3E6D A;  1KU3 A;  4FX4 A;  2X48 A;  2GQQ A;  4KYW A;  4CYC A;  2QKL B;  2K7L A;  4LLN A;  2Q0O A;  5E3N A;  2QQ9 A;  4KUM A;  1VQN I;  1G3S A;  1XPX A;  1PP8 F;  4KFC A;  1WJF A;  2LF7 A;  2DFH A;  1TT0 A;  3VFZ A;  2CV2 A;  1V5F A;  1QU3 A;  2R5Y B;  2M8G X;  2EZK A;  2DQR A;  2WWY A;  2DFI A;  5GP9 A;  1BI3 A;  1IXS B;  3OMY A;  5LRR A;  4EJW A;  5LEJ A;  4B8X A;  4KT6 A;  2MSY A;  2FNA A;  3I4N J;  1FMV A;  4RB1 A;  3KP6 A;  2YU9 J;  4Q47 A;  1XDU A;  2ME6 A;  4MO7 A;  3CC2 I;  3TL4 X;  1JHH A;  3BR2 A;  1MJB A;  1SEU A;  2GXA A;  4R79 A;  2XAH A;  1F4K A;  1IF1 A;  1MBJ A;  1IXC A;  1D0X A;  1SVM A;  5TJJ A;  3DTK A;  1VQ7 I;  2QCO A;  3CUQ A;  1I3A A;  3H92 A;  2DA4 A;  4UXN A;  3DQV C;  3IHU A;  1OCO H;  2UV1 A;  1EH7 A;  3FXU A;  3K9T A;  1MNE A;  2BV6 A;  4MNU A;  2EZH A;  3OR2 C;  3T8R A;  3ASN H;  2DMP A;  3LSK A;  3MAJ A;  1U6G A;  2CQQ A;  2OF7 A;  3H3V K;  4J01 A;  3QU6 A;  2ELH A;  5K5R A;  2OJE D;  3REO A;  1MKM A;  2JSC A;  4G7Z F;  2CRG A;  3HPG A;  1B8I B;  4C30 A;  2LD5 A;  2A6T A;  2HPI A;  4PK4 A;  3PNY A;  5HDG A;  3J7Z I;  4A3E J;  4QPQ A;  1KQ9 A;  2GAU A;  2A61 A;  2E7W A;  4GYI A;  4I0A A;  3A0B C;  1BI0 A;  1DP3 A;  3X2Q H;  2Y0M A;  5ILU A;  2COB A;  3H9J A;  4BQA A;  1TNT A;  2XV4 S;  2O9L A;  3HG9 A;  4QIW N;  1OMI A;  2PMH A;  3IH4 A;  2P7C B;  1A6Q A;  4NBQ A;  4IQ4 A;  2KIU A;  1PUF B;  2XIG A;  2TCT A;  3QYE A;  5D6E A;  2BXZ A;  5DCM B;  3FKJ A;  3HRU A;  5LRS A;  3GBG A;  2PQ8 A;  2MAB A;  2ZB9 A;  5L3F A;  4CUG A;  2QSG X;  2KJB A;  2JUG A;  3ECO A;  3H35 A;  2O8K A;  3DU6 A;  4AID A;  2A5Y B;  3HKZ A;  3C7J A;  3HUG A;  2F5F A;  1N77 A;  3LOC A;  1J2X A;  1Z3Y A;  4H0E A;  5FRN A;  2R7V A;  5HNH A;  1IC8 A;  2VXD A;  3DXJ F;  3WTZ A;  3OIO A;  4B44 A;  5LHH A;  4M3F A;  5HS9 A;  3ZP5 A;  5EDN A;  2EJR A;  2RAE A;  5LHG A;  2NVX J;  3A01 A;  4BE0 A;  2X6O A;  5GAH J;  3CES A;  2CW7 A;  3V8K A;  2R92 J;  3GTM J;  5E3O A;  1G3T A;  4U88 A;  1FYL A;  2ID6 A;  3FWE A;  5F27 A;  1S5L C;  3QP6 A;  1BOB A;  1UJ8 A;  3ABT A;  4CO8 A;  3HOT A;  3BR3 A;  1WH7 A;  4PJ0 C;  5EYR A;  3P7N A;  1WKM A;  1BM9 A;  1LJ9 A;  3PM1 A;  2ME0 A;  3AFH A;  1NHA A;  4DQ2 A;  5D6F A;  1NK3 P;  2H94 A;  3FK7 A;  3NWT A;  4D5F A;  2VBX A;  3V8L A;  3S15 J;  4HA8 A;  2V26 A;  3AG4 H;  1LFB A;  3OYF A;  4A6D A;  3BCB A;  3DPL C;  5J4Y A;  2O03 A;  3GTJ J;  4E70 A;  4D1Q A;  4BL0 B;  1S29 A;  4LGW A;  1XDS A;  3EDP A;  3FXK A;  2AXL A;  4IVN A;  5FKK A;  3ERE D;  2RQP A;  2STT A;  3VEP A;  3OOU A;  4NC7 A;  2HEO A;  1VND A;  3GTL J;  5HVQ C;  3V7S A;  2K27 A;  3DLA A;  4BBR J;  3HTU A;  1FEX A;  4CCK A;  4M3E A;  1FBQ A;  2E5N A;  3CF2 A;  1YRN A;  5J40 A;  3IH2 A;  3JRA A;  1P4W A;  5TGT A;  1ZRC A;  3SJM A;  4IX7 A;  1LKX A;  4XKC A;  4HRI A;  3FM5 A;  2HPM A;  4FE7 A;  3IKV A;  3TQN A;  4FCY A;  1J75 A;  5KAF C;  1RR7 A;  3HRM A;  3JSO A;  1GHC A;  4YIR X;  4EAT A;  1NH3 A;  2OV7 A;  1H9G A;  3LQQ A;  5ERI A;  4XOP A;  1A36 A;  2NS7 A;  3WTV C;  4UUS B;  3RTR A;  4AC0 A;  4BXU A;  1ZR4 A;  1R23 A;  4G94 A;  3HOW J;  3ZQF A;  1R71 A;  1DGR M;  2QF7 A;  3N4M A;  5IT3 A;  4I01 A;  2VLA A;  2FBK A;  4C3I J;  2X4H A;  3GVA A;  1EJ9 A;  1A31 A;  4M6V A;  4GRI A;  2KRH A;  2JVG A;  3QPH A;  3W3C A;  5HDK A;  5J4V A;  2QSH X;  2LLK A;  3KYL A;  1YTY A;  2HOS A;  2CG4 A;  5EEH A;  1YI2 I;  3MKW B;  1ENH A;  3DLL F;  3Q0U A;  2HNH A;  2VC1 A;  4HQE A;  3FMR A;  2EIL H;  2K3F A;  3DV8 A;  4DZP A;  2P6T A;  2M7A A;  1GUU A;  5H20 A;  3V4G A;  3ZQC A;  2BEO A;  1WJC A;  1R9T J;  1FYK A;  1WJD A;  1WI9 A;  2LP0 A;  3AG3 H;  3A0H C;  1ON1 A;  4G7H F;  2WC2 A;  3FBN B;  3HJE A;  4ZTJ A;  2EFQ A;  3SFI A;  1X1B A;  1X1D A;  3HKZ N;  1VQP I;  1U8B A;  5E17 F;  2QKM B;  2R5Z A;  3WU0 A;  1VQ6 I;  3BG5 A;  4HLX A;  2IP2 A;  1X3W B;  2CS3 A;  4I6Z A;  3CJR B;  3SZP A;  2FUG 2;  2EV0 A;  4A3D J;  2CQK A;  2MLK A;  5FRO A;  4EQQ A;  2B7E A;  4BS9 A;  1U0J A;  1ETW A;  2DDA A;  3IAM 2;  5ILS A;  4HF2 A;  3RCO A;  1BJA A;  2E5Z A;  3ASO H;  2XAJ A;  4M74 A;  5BQT A;  4GYG A;  3KFW X;  1S8N A;  1MBK A;  3BQY A;  1IRZ A;  3EQL F;  1R22 A;  1MSF C;  3HSE A;  3HYI A;  1IV6 A;  4HZF A;  1B9M A;  2BE5 F;  4RA2 A;  1O3Q A;  1X2M A;  2QVO A;  3WE3 A;  2MW8 A;  5D5U B;  3V7R A;  1CGP A;  3K10 A;  3K4K A;  1P9Q C;  4RAZ A;  1MND A;  1XG1 A;  3PIO F;  5IOZ A;  1RPW A;  1SVL A;  3H5N A;  1ZGJ A;  2TRT A;  1R1U A;  5HS7 A;  2L2O A;  4CZC A;  3QYF A;  2R93 J;  2ELK A;  4Y52 J;  4LIU A;  1GVD A;  3LA7 A;  2DTR A;  1UHM A;  1I5Z A;  4ZH4 F;  3CJT B;  5EZH A;  4L0Z B;  3FHZ A;  3CCE I;  4GCV A;  1SFO J;  2V4J C;  3J81 Z;  2Y9Y A;  3BP8 A;  5B66 C;  3JRG A;  4ZJZ A;  1GLN A;  2F2E A;  1L3L A;  4U87 A;  1R49 A;  2M4G A;  4GDF A;  3IAS 2;  4PJM A;  4S0H B;  1D5Y A;  2X6W A;  5BOX A;  2OD5 A;  1AA7 A;  2VKV A;  2XGC A;  3WHB A;  2B0L A;  3SXY A;  3ML6 A;  3KYC B;  2VJI A;  1ZR2 A;  1T2K A;  1V4R A;  4HSR A;  3S2H J;  2K4J A;  1BOA A;  4KT5 C;  2ESN A;  1IAW A;  2F4M B;  5DDG A;  1MMN A;  3MVP A;  1QQI A;  5FRM A;  1YG2 A;  3ZMT A;  2IGO A;  1SFK A;  4HQM A;  4YFK F;  2ISY A;  4RLF A;  2I8D A;  3EPZ A;  1VTN C;  5F0H A;  3ZQQ A;  2M8E A;  2OU2 A;  2NVY J;  4ZDP A;  4YFX F;  3HOU J;  5J8F A;  1IDZ A;  2O7O A;  4HOB A;  1O57 A;  1FP2 A;  4OIP F;  3CCV I;  2EA2 A;  2VJ4 A;  3GF2 A;  5K7Z A;  1HW2 A;  2CH0 A;  4UVB A;  5H6Q A;  1K79 A;  4AVP A;  1TQI A;  4ESF A;  5DTD A;  4OMZ A;  5EJC A;  1POG A;  2VPL A;  1QNT A;  3Q9V A;  2DOD A;  2K5C A;  1Z21 A;  1T38 A;  3SEZ A;  3CCM I;  4A69 C;  3GZN B;  3OYK A;  3DKX A;  5F08 A;  3I9V 2;  1BR2 A;  2VQC A;  2ZXI A;  3Q5F A;  2QUF A;  4AUX A;  3HSF A;  2VOD A;  3F21 A;  1FIA A;  2ELJ A;  1BW6 A;  2LC2 A;  1XMA A;  2VQH A;  1S3J A;  2RQQ A;  4XLN F;  1UB9 A;  4DGW B;  5DEQ A;  2EIN H;  3BR0 A;  3GW2 A;  2XAU A;  1P92 A;  1XC5 A;  3U2R A;  3ZQH A;  2XSJ C;  2ZFW A;  2FU4 A;  3JAM Z;  1LQ1 A;  2CWE A;  3RJP A;  3EET A;  2IAI A;  3JW4 A;  1W0T A;  4PJL A;  1FBS A;  2WA0 A;  3PSI A;  4CCO A;  4BJ6 C;  3WTS C;  2VT3 A;  1PP7 U;  5IP7 J;  3E7L A;  2L9S A;  3IWF A;  1TWF J;  2HOT A;  1C0W A;  2XGD A;  3QOP A;  1RNL A;  2L7Z A;  4M9X A;  2XF5 A;  4B48 A;  5M5X J;  1KGS A;  3TW6 A;  1HW1 A;  5F64 A;  3OYC A;  3BTI A;  2DPU A;  4JOM A;  4IHY A;  1EKE A;  1AKH B;  4UUV A;  1FOK A;  3HL2 A;  2XAS A;  3TO7 A;  4PJN A;  1SAU A;  2M4K A;  3FK6 A;  4OU0 A;  1H8A C;  3VPR A;  1YIO A;  1ZKG A;  3CDI A;  4LLL A;  2DDB A;  3DBL B;  4F93 B;  3PUB A;  3ZN1 A;  4E7K A;  1DPU A;  1MZB A;  2R5Y A;  3EUK L;  3RKX A;  2KPM A;  2A3S A;  2NS0 A;  5CVI A;  3L2C A;  3U21 A;  3LSR A;  3K7A J;  2QYO A;  2BY2 A;  2EFW A;  4LMY A;  1RRJ A;  2DA1 A;  1XX5 A;  1FYM A;  3WHC A;  4EVI A;  3KP3 A;  3IWZ A;  1UZC A;  4F52 A;  5B1A H;  1YFH A;  2P5K A;  5CYV A;  3TKY A;  4A0X A;  1U3E M;  3CLQ A;  1Z7U A;  2DPD A;  2IRF G;  1FC3 A;  2BHZ A;  5BS6 A;  5E1Z B;  3ZCO A;  2OBP A;  1FY7 A;  4PFP A;  1B9N A;  2DO7 A;  3CTA A;  1W36 D;  3J81 K;  1E3O C;  4IXA A;  2V1U A;  2DXI A;  2PBI A;  4BE2 A;  3DTE A;  2NVU B;  3E5Q A;  1X58 A;  1IRX A;  5CLS A;  2WAF A;  2YU3 A;  3KZZ A;  2HTS A;  1BR1 A;  4XK4 A;  3BC8 A;  1G4D A;  1Z0X A;  4RAF A;  2V79 A;  1MBH A;  4IF4 A;  4EJU A;  1BR4 A;  2X6Y A;  1DQU A;  1T56 A;  1OLT A;  4BU2 A;  2V1N A;  3VYR B;  1ZLJ A;  2O3F A;  3KYD B;  1P4A A;  1SD6 A;  3W6K B;  4DOZ A;  2JA7 J;  2K9L A;  1QO0 D;  5HOD A;  5ICE A;  1T98 A;  2W1O A;  3GWZ A;  2LSO A;  4DIQ A;  1E17 A;  2ZME C;  2CFX A;  3BJA A;  1RR8 C;  3OYA A;  5FKM A;  2FSW A;  3KEQ A;  3VSL A;  2MFZ A;  3M3Y J;  4C2U A;  1P4X A;  4A6E A;  2JN6 A;  3KEY A;  4BUP A;  2G0E A;  5E18 F;  4EM1 A;  2CO5 A;  2M45 A;  1TZL A;  4EM0 B;  1T6S A;  4YII A;  4XLA A;  3E5X A;  2Y2Z A;  1YW7 A;  2DYS H;  1AOY A;  1PUF A;  4D0P A;  3BLY A;  5IPA A;  1VZ0 A;  2F4O B;  4PSX A;  2BXY A;  5E8I A;  1I1S A;  3A4C A;  2HYF A;  5BPD A;  4L9N A;  3UR3 C;  4E6K G;  2BVM A;  3MQ0 A;  2JA5 J;  2LFB A;  2C6Y A;  4I2O A;  1W36 C;  2ECB A;  4DZJ A;  5LGT A;  3SDB A;  1KQ8 A;  1I1G A;  2JVH A;  3BZC A;  2STW A;  3H1C A;  2Y9Z A;  3KP7 A;  2KIM A;  3KZI C;  4CCN A;  3GME A;  1YS7 A;  1KON A;  5C4X J;  4IEJ A;  1BC7 C;  1DDN A;  4QSH A;  5J8C A;  1OCR H;  5D5V B;  2XGE A;  3LAJ A;  3JRE A;  1YIJ I;  2XRL A;  3GCM A;  3LSJ A;  3G1M A;  2QLZ A;  3I53 A;  3BR6 A;  4IHW A;  4F92 B;  4LK1 F;  1MMA A;  3QPS A;  2CSO A;  1MSE C;  1OQY A;  1O3R A;  3O6B B;  2EFP A;  2VJ5 A;  5B1B H;  5D8L B;  1JJ8 C;  4JP0 A;  2PX9 A;  2MBF A;  3M8E A;  4A5N A;  4NDL A;  1FOY A;  1ETX A;  3B6C A;  2DT6 A;  3GTQ J;  1Q1V A;  4LLG F;  4G8X A;  1G3W A;  2IA0 A;  2YS9 A;  1JTX A;  2LRE A;  2ZFU A;  3KX2 A;  2VQL A;  3RKY A;  2HYJ A;  1HKQ A;  2P0W A;  1B4A A;  5HLG A;  1ZRD A;  3GLL A;  2IPQ X;  3K1P A;  5AON A;  2F5C A;  3OIQ A;  1WPK A;  3HSR A;  2V7F A;  2MGQ A;  3JRH A;  2IS6 A;  2E2H J;  3ZR8 X;  3QOD A;  2K02 A;  3LST A;  2IJL A;  1ZAO A;  1TL8 A;  3TMO A;  1K61 A;  2FA5 A;  4DJA A;  2W4S A;  4U0V A;  3CC7 I;  1OCZ H;  4CDG A;  5ICF A;  5KNL A;  4MFE A;  2GM4 A;  3ROU A;  3NRV A;  2WB1 A;  3WTU C;  2PMZ A;  4CSW A;  4QWQ A;  3VOE A;  3RZO J;  2K85 A;  4LG0 A;  3K2A A;  2CU7 A;  4Y17 A;  4L18 B;  1KU7 A;  2RV8 A;  2XF6 A;  2ZNZ A;  1SC7 A;  3H9Q A;  1LDD A;  5L3D A;  2E2I J;  3CJQ B;  3HGY A;  1QHH D;  4RGU A;  2B63 J;  4BJ5 C;  1SD4 A;  4KIC A;  3CP8 A;  2K3P A;  4DBR A;  2EBI A;  1I3Q J;  1Z77 A;  2DMT A;  2MA3 A;  4UUS A;  4LFU A;  1QGP A;  1U5T B;  4BAY A;  3I59 B;  3H3U A;  3JRF A;  1UHW A;  1F36 A;  2E7X A;  3K4N A;  1B6A A;  1W7P B;  4I09 A;  3FM3 A;  4M3G A;  2M2E A;  2YSR A;  3M07 A;  5L3E A;  4BXF A;  2M1B A;  2CFO A;  1EH6 A;  3TED A;  2QZ8 A;  4A3L J;  2KJC A;  4KIF A;  3G71 I;  3KCC A;  4PCQ A;  1LFP A;  3S2W A;  2EFN A;  1G8X A;  1IN8 A;  1O7L A;  4BKX A;  2KRF A;  3PNV A;  1UG0 A;  2JZY A;  1FOX A;  1QVT A;  2PJR A;  4C2M J;  1HDD C;  1RET A;  1WCM J;  2DT5 A;  1M1E B;  4Q48 A;  3KP2 A;  2YX7 A;  2CW0 F;  5EEG A;  3GYH X;  1IGN A;  1RUN A;  2ZSH B;  1EF4 A;  2XAG A;  1WSU A;  2HDC A;  4UB8 C;  4JX5 A;  3GTO J;  2JMW A;  3FXM A;  2XDV A;  4UV8 A;  4XN3 A;  3P9C A;  2QBY A;  2L7M P;  1J9I A;  4E7J A;  2UZK A;  4U7D A;  1I39 A;  1G59 A;  4MGR A;  5EG0 B;  4Y7N J;  2DA6 A;  2L7K A;  5F1R A;  1HA8 A;  2F48 A;  2ZKZ A;  1KZH A;  5ICG A;  2E71 A;  1FX7 A;  1X1P A;  1WRJ A;  5D5X B;  3GXO A;  4XKB A;  3FBI B;  3P5J A;  4ZC3 A;  4BEH B;  3M1C A;  1D8J A;  2ZJ2 A;  1IN4 A;  2BY1 A;  4NUB A;  2XKP A;  3W2V A;  1CQT A;  3W6V A;  4AU7 A;  4RAG A;  1HQC A;  3ABU A;  3OOP A;  1HST A;  1U5T C;  1X1A A;  2D2W A;  1YLF A;  2EIK H;  1SFX A;  3RKW A;  1LFU P;  2O5R A;  4L9T A;  4MQV A;  3HOZ J;  5L3B A;  1S6L A;  4M6Y A;  1IJW C;  2ZC2 A;  3HTS B;  2DLL A;  2W24 A;  3K1M A;  1R58 A;  1B72 A;  4XL9 A;  5J1Y A;  2R7T A;  1OCC H;  2PFB A;  4RMN A;  1V55 H;  1ZK8 A;  3H36 A;  3P9I A;  4CGZ A;  1A5J A;  1SMT A;  4PJJ A;  1HC8 A;  3G1L A;  5FD5 A;  1K78 B;  4OAZ A;  1VF9 A;  1D8K A;  4P9U A;  5JVG F;  2VBZ A;  3DEU A;  3Q0V A;  1NG7 A;  3BPV A;  2HU9 A;  1F1Z A;  3BY6 A;  1JI8 A;  1D0Y A;  2DU9 A;  3WU1 B;  3KP4 A;  3LSG A;  1Y56 A;  1FSE A;  3BQZ A;  1VQK I;  2EIM H;  2BW3 B;  4EV0 A;  3GZ5 A;  1Y0N A;  2WB1 N;  1LE8 B;  2DJN A;  4M6X A;  2DK8 A;  2PMZ N;  5C3E J;  1OYW A;  5K5O A;  1Z91 A;  5F04 A;  3TP0 A;  3S17 J;  4OIR F;  2WY8 Q;  2DMQ A;  2HKO A;  3MZY A;  4XON A;  5CQE A;  5GAE J;  3F9K A;  2FX0 A;  3C2H A;  4N4N B;  3OYJ A;  3G73 A;  2Q2E B;  3W2W A;  1RC9 A;  2LR8 A;  2IGM A;  3JSP A;  4ASN A;  4Y13 A;  1JKP C;  2ADU A;  3SZG A;  2XAF A;  1ZG1 A;  3LFU A;  5EGO B;  2QWW A;  3KPH A;  1OYI A;  2MC4 A;  3EUH C;  3GTG J;  1R36 A;  1ETY A;  2L7F P;  4G6T B;  1LB2 A;  2VOP A;  2KQR A;  4HST A;  3KP5 A;  3LSM A;  3CMM A;  3DKY A;  4XNF A;  4XRS G;  2MLG A;  1FPQ A;  2LY9 A;  2ZO4 A;  2R3S A;  1FMW A;  1MW7 A;  1P7I A;  4Y15 A;  4ESB A;  1P6R A;  5B5E C;  4E7Z A;  4S04 A;  3JRC A;  2E36 A;  3OSG A;  1T8I A;  1HW5 A;  4RGR A;  3VYU B;  1HLV A;  1F43 A;  1XSD A;  1RES A;  5M5Y J;  4NQW B;  3RSN A;  3EYY A;  1WJB A;  4IRH A;  4MTD A;  3V42 A;  4OAY A;  2X51 A;  3ZQI A;  5B3S H;  3HDD A;  2NVQ J;  4MFD A;  1SFU A;  2YUS A;  3W2A A;  2XKO A;  4Q4Z F;  2FBI A;  1FTT A;  1LUJ B;  3HGG A;  4FAS D;  4A3M J;  3O8G A;  4A2U A;  5IYB J;  1MMD A;  1YS6 A;  4UV9 A;  4WX9 A;  4CYC B;  2WAD A;  5EEA A;  4CIC A;  3IP4 B;  4G6Q A;  4LB5 A;  3D5S C;  4N9I A;  2QA4 I;  1YX3 A;  3VSK A;  4C2T A;  2LH9 A;  3L09 A;  3MKY B;  4D9J A;  3F3X A;  4IJA A;  5GTI C;  4IOA F;  2AXT C;  2W00 A;  3L00 A;  2Y0S A;  1Y8Q B;  4DYR A;  3I0T A;  2XSD C;  2ZME A;  4F91 B;  3E6B A;  3VOD A;  3D5L A;  2LBF A;  2NYX A;  1HF0 A;  3I4P A;  3MN2 A;  1NG6 A;  5E79 C;  2DK5 A;  4OIQ F;  2R7D A;  3RIR A;  1XB4 A;  3T5X A;  2KHM A;  1ZG3 A;  5C44 J;  2HXI A;  3MKZ A;  2AQE A;  2ZXH A;  2JTV A;  4KJZ A;  2BVL A;  4P96 A;  3BG3 A;  4HLY A;  3HOY J;  3WG9 A;  4A3F J;  3PSF A;  2XPV A; 
#chains in the Genus database with same CATH homology
 1VI0 A;  5IP7 J;  1A6I A;  3SDG A;  3E7L A;  3RKQ A;  2DTZ A;  1H88 C;  3D1N I;  1TWF J;  2HOT A;  3BT9 A;  2XGD A;  1U9N A;  2JJ7 A;  2L7Z A;  4XIC A;  3BTC A;  4QTR A;  5M5X J;  2AHQ A;  3TW6 A;  3BTI A;  4IHY A;  1AKH B;  4BXX J;  3HOV J;  1H8A C;  2M34 A;  3FK6 A;  3VPR A;  1ZKG A;  2LVS A;  1JKO C;  2R5Y A;  4G12 A;  4JX4 A;  2VI6 A;  3LNQ A;  3LSR A;  3K7A J;  5IYC J;  1MBG A;  5IYD J;  2DA3 A;  3S2D J;  2XB5 A;  5E3M A;  3CQZ J;  2DA1 A;  2FQ4 A;  1S7E A;  3WHC A;  1ETO A;  3PO2 J;  2AO9 A;  4A3I J;  1JTY A;  2ID3 A;  4MLO A;  1FIP A;  2K9N A;  3F0C A;  4XRM A;  2X48 A;  5JLX A;  2KDZ A;  1E3O C;  4CYC A;  1UMQ A;  3DEW A;  1ETV A;  1X58 A;  5J1U A;  5E3N A;  4D5C A;  4XK4 A;  1Z0X A;  2LTP A;  2EZI A;  1MBH A;  1OFC X;  2R5Y B;  2M8G X;  2EZK A;  1T56 A;  3NAU A;  3TP3 A;  5M3M J;  5GP9 A;  3A01 B;  3CCY A;  2GLO A;  2JA7 J;  3I4M J;  2MSY A;  5HOD A;  3I4N J;  1O4X A;  2YU9 J;  2ME6 A;  1T33 A;  4MO7 A;  3BR2 A;  5FKM A;  1MBJ A;  4W97 A;  1DU0 A;  2R7Z J;  3M3Y J;  4ABZ A;  3CDL A;  2JN6 A;  3HM5 A;  4A3G J;  5M5W J;  2EQR A;  3FIW A;  2LKX A;  2G0E A;  2QCO A;  1NK2 P;  2DA4 A;  4M3B A;  5DS9 A;  1SAN A;  1W0U A;  2Y2Z A;  4A93 J;  1U78 A;  2Y0S N;  1PUF A;  5IPA A;  2W48 A;  5FKO A;  1ZQ3 P;  2EZH A;  1WI3 A;  2DMP A;  3C2B A;  2CQQ A;  2OF7 A;  3S1R J;  4L5E A;  3H3V K;  2JA5 J;  2LFB A;  1JT0 A;  1AKH A;  2CRG A;  1B8I B;  2ECB A;  3TW7 A;  3A03 A;  4DZJ A;  2LD5 A;  4A3E J;  1MNM C;  2Y9Z A;  1YRN B;  4MIM A;  3QPL A;  2XPW A;  2COB A;  5C4X J;  4IEJ A;  2O9L A;  4QSH A;  4AYB N;  4QIW N;  4GFB A;  2EZL A;  1K83 J;  2XGE A;  3JRE A;  2XRL A;  3IH4 A;  2FJ1 A;  2E19 A;  2WAQ N;  3LSJ A;  2XPU A;  3G1M A;  4IHW A;  3BR6 A;  1WGX A;  1TWC J;  4BY1 J;  3QPS A;  1PUF B;  2TCT A;  1X2N A;  1MSE C;  4EEF G;  3CMY A;  3GBG A;  2ZB9 A;  1AU7 A;  1JJ8 C;  4JP0 A;  1ZTR A;  1GT0 C;  2HDD A;  4NDL A;  3ZOB A;  2K40 A;  3B6C A;  1ETX A;  1QRY A;  4UUT A;  4RBO A;  1Q1V A;  3OSF A;  2O8K A;  3GTQ J;  3S1Q J;  2YS9 A;  1JTX A;  4A3B J;  1JKR C;  2HYJ A;  2H8R A;  3LOC A;  1U9O A;  5K7F A;  2IBD A;  1IC8 A;  1FJL A;  3OIO A;  2E1O A;  4M3F A;  4IHV A;  5EDN A;  1WPK A;  2RAE A;  2NVX J;  3A01 A;  2M0C A;  2XB0 X;  4A3K J;  2X6O A;  3A02 A;  2MGQ A;  3JRH A;  3ZQG A;  3S1M J;  2E2H J;  5E3L A;  1BJZ A;  1ORK A;  3S16 J;  4A3C J;  2R92 J;  3GTM J;  5E3O A;  1K61 A;  3BTJ A;  2ID6 A;  3QQA A;  3S14 J;  5F27 A;  3BR3 A;  1WH7 A;  2MG4 A;  3B6A A;  5EYR A;  1JUM A;  3MKL A;  3PM1 A;  4MFE A;  5FKL A;  2ME0 A;  2GM4 A;  2ECC A;  5K7H A;  1MBE A;  1NK3 P;  3RZO J;  3FK7 A;  3K2A A;  2CU7 A;  2VKE A;  5FLV A;  4J19 A;  1RKT A;  4D5F A;  2NOG A;  3S15 J;  1B72 B;  1JGG A;  5FLM J;  1UHS A;  2JA8 J;  1LFB A;  2E2I J;  3HGY A;  5J3L A;  3GTJ J;  2B63 J;  3RZD J;  1JKQ C;  4A3J J;  1APL C;  1IUF A;  2X9D A;  2EBI A;  1I3Q J;  1Z77 A;  2DMT A;  2VPR A;  4UUS A;  5FKK A;  2IEK A;  3OOU A;  1VND A;  3GTL J;  3JRF A;  1F36 A;  4BBR J;  1B8I A;  4M3G A;  2M2E A;  1TC3 C;  1FEX A;  4M3E A;  3JRB A;  1YRN A;  4W1U A;  3JRI A;  3IH2 A;  3JRA A;  3SJM A;  3TED A;  4A3L J;  3PO3 J;  1P7J A;  1JJ6 C;  3BG9 A;  2HQ5 A;  4FE7 A;  3BTL A;  4V2G A;  4D7N A;  4FTH A;  2DMU A;  5J1R A;  4FCY A;  1RR7 A;  4BKX A;  3LSP A;  5F0C A;  4V2F A;  1QVT A;  2JK3 A;  2CQX A;  4C2M J;  2NS7 A;  1HDD C;  2VUM J;  1RET A;  1WCM J;  1JUS A;  4UUS B;  4AC0 A;  1IGN A;  1EF4 A;  1G2H A;  1ZR4 A;  3HOW J;  3GTO J;  4JX5 A;  1QPI A;  1I50 J;  2JMW A;  3ZQF A;  2QF7 A;  2L7M P;  4C3I J;  5M3F J;  1TWG J;  2N8G A;  1VFC A;  2Y30 A;  5EG0 B;  4Y7N J;  2DA6 A;  4M6V A;  4X1E A;  1UG2 A;  3JRD A;  3H0G J;  3HBL A;  2LLK A;  2Y31 A;  2HOS A;  5JLW A;  1HCR A;  1ENH A;  3Q0U A;  5FKN A;  1NTC A;  4DZP A;  1CQT A;  3W6V A;  5BNG A;  2JA6 J;  1OJL A;  5IP9 J;  2HXO A;  1GUU A;  2CJJ A;  3ZQC A;  3UKG A;  4IHX A;  1R9T J;  2LP0 A;  9ANT A;  5EZG A;  2L0K A;  1LFU P;  2M9H A;  3SFI A;  3HKZ N;  1U8B A;  3HOZ J;  2HI3 A;  2R5Z A;  1IJW C;  4I76 A;  2DA5 A;  2LK2 A;  3BG5 A;  3BR5 A;  1MH3 A;  4B4C A;  4C3J J;  4C3H J;  3FKI J;  1WH5 A;  1ETK A;  3NAR A;  5GPA A;  4I6Z A;  2R0Q C;  4A3D J;  1B72 A;  5J1Y A;  3ZQL A;  1DU6 A;  1MH4 A;  1ITY A;  1ZK8 A;  1ETW A;  1A5J A;  4LOC A;  3G1L A;  3G1O A;  5EGO A;  4FIS A;  1VF9 A;  4X6A J;  3Q0V A;  4HNV A;  1Y1W J;  1MBK A;  3BQY A;  1IRZ A;  2H1K A;  1MSF C;  3LSG A;  1IV6 A;  3BQZ A;  5IP6 A;  1X2M A;  4D7M A;  2MW8 A;  2OPT A;  2EH3 A;  2WB1 N;  1LE8 B;  2DJN A;  3GTK J;  2PMZ N;  5C3E J;  4XRS A;  1XG1 A;  5IOZ A;  1RPW A;  1IDY A;  2R5Z B;  5F04 A;  2TRT A;  5EF6 A;  2R93 J;  2ELK A;  3TP0 A;  3S17 J;  4Y52 J;  2DMQ A;  1GVD A;  2FX0 A;  2CUF A;  2LR8 A;  5FJ8 J;  1ZGW A;  1BW5 A;  1I6H J;  1JKP C;  2WV1 A;  1GV5 A;  5EZH A;  5EGO B;  1SFO J;  2Y9Y A;  3JRG A;  2KT0 A;  3GTG J;  2I10 A;  1ETY A;  2L7F P;  4DW6 A;  4S0H B;  1D5Y A;  5GPC A;  2XGC A;  2VKV A;  3WHB A;  4XRS G;  1AHD P;  3Q3S A;  2LY9 A;  2DA2 A;  2DA7 A;  1XS9 A;  1FTZ A;  1P7I A;  1IG7 A;  1ZR2 A;  3S2H J;  3JRC A;  5EG0 A;  1BL0 A;  3OSG A;  3HB9 A;  3IV5 A;  5C4J J;  4JYK A;  1QVU A;  3MVP A;  1TWH J;  4FE4 A;  1HLV A;  1F43 A;  1RES A;  5M5Y J;  2HOA A;  4B3A A;  5F0H A;  2FD5 A;  3O8H A;  1GDT A;  3ZQI A;  1RKW A;  2NVQ J;  3HDD A;  3S1N J;  2DMN A;  4MFD A;  4XID A;  2YUS A;  3JR9 A;  2NVY J;  3HOU J;  1FTT A;  2L9R A;  3HGG A;  2O7O A;  3BR1 A;  1IDZ A;  4M3D A;  4A3M J;  3O8G A;  5IYB J;  1JUP A;  1BA5 A;  4RDU A;  5K7Z A;  5F1J A;  4CYC B;  3M4O J;  5EEA A;  2NVT J;  3IH3 A;  1JT6 A;  4DYQ A;  5DTD A;  1POG A;  1ETQ A;  4B1R A;  3DCF A;  1GV2 A;  1OCT C;  3L1P A;  2E2J J;  3RQI A;  1H89 C;  4DYR A;  4JX6 A;  2XSD C;  4A69 C;  2P81 A;  4BBS J;  5F08 A;  1HF0 A;  1HOM A;  3MN2 A;  2NS8 A;  4AUX A;  2GBY A;  3Q0W A;  1FIA A;  1BW6 A;  2D5V A;  3GTP J;  4DYC A;  2K9S A;  1MBF A;  5IOY A;  5C44 J;  2HXI A;  1LE8 A;  3BR0 A;  1XC5 A;  5F0F A;  3HOX J;  3ZQH A;  2CUE A;  2JWT A;  3FIS A;  1HDP A;  1TWA J;  3BG3 A;  2IAI A;  1OCP A;  3HEF A;  1W0T A;  1Y1V J;  3HOY J;  2DN0 A;  2K9Q A;  4A3F J;  4BY7 J;  2XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...