2B63J

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2b63J00
1NK3P 1JUPA 3TW6A 1TWHJ 2EH3A 2VI6A 3G1LA 1TWFJ 2G0EA 2R5ZB 1XS9A 1AKHA 2Y2ZA 4X6AJ 2HOSA 2H1KA 2ID6A 1U8BA 2L9RA 4IHWA 3PO3J 1HF0A 2DA4A 3BR5A 1ZK8A 3CQZJ 1U78A 1HDPA 1TC3C 3Q3SA 9ANTA 3JRGA 5GP9A 1BA5A 1DU6A 2DTZA 4XRSG 3BG9A 1RPWA 1DU0A 5E3OA 4NDLA 3ZQFA 1ITYA 2K9NA 1MSFC 3JRDA 1QVUA 2OPTA 2ECCA 2L7ZA 4QSHA 3A01B 4A3JJ 1MBJA 1Z0XA 3S2HJ 3S15J 3GTJJ 2JJ7A 2Y0SN 1GV2A 2CJJA 3QPLA 4C3JJ 4I6ZA 3SJMA 1HOMA 3BT9A 5JLXA 3TEDA 5F04A 4D7MA 1JKOC 5F08A 2HDDA 3RQIA 1B72B 2AO9A 4HNVA 1LFBA 1EF4A 3Q0UA 1MBHA 2KDZA 2ID3A 1WCMJ 1JJ6C 3CCYA 1HDDC 2Y9ZA 5FKMA 4JX5A 2R7ZJ 5J1YA 2L7MP 4LOCA 1MBGA 1WH7A 2I10A 3HB9A 5E3NA 3S1RJ 4L5EA 3OOUA 4FCYA 5FLMJ 2LR8A 2XSDC 2JA7J 5IP9J 4A3BJ 3HBLA 2ME0A 3S16J 2L7FP 3K2AA 4A3FJ 2JN6A 1PUFA 2W48A 2E2JJ 2XB5A 4IHYA 4V2GA 3BTCA 3DCFA 2ELKA 4JX6A 1X58A 2GBYA 1OFCX 3WHBA 3A03A 1WPKA 2GLOA 3QQAA 3FISA 5J1RA 2MGQA 2JA8J 3GTKJ 1GT0C 4MFEA 3O8HA 1FIPA 3BR2A 4B4CA 1I50J 2P81A 1IV6A 2R0QC 4BXXJ 1MNMC 1XG1A 1MH4A 3TP3A 1O4XA 1A6IA 1U9OA 3JR9A 1LFUP 1F43A 2O8KA 5EDNA 5EZHA 1IDYA 1P7JA 2M8GX 1PUFB 3IH3A 4S0HB 2YU9J 5J1UA 2XGDA 2XPUA 1QPIA 1TWGJ 2XB0X 5FJ8J 5FKNA 2X6OA 1MSEC 2FQ4A 2X9DA 3HOUJ 3FIWA 5HODA 5IOYA 2JMWA 1Z77A 4FE7A 3HOVJ 2XGEA 4DZPA 2HI3A 3K7AJ 1K83J 1QRYA 2COBA 3O8GA 4B3AA 1HLVA 4C3HJ 1ZQ3P 1B8IA 2IEKA 2EZLA 3UKGA 1JKPC 2LTPA 2DN0A 1E3OC 5J3LA 4C2MJ 5C4JJ 2GM4A 1Y1VJ 2LLKA 4JP0A 1QVTA 4D5FA 1MBEA 3LSJA 4CYCA 3S1NJ 2WAQN 1MBFA 1RESA 5FKKA 1YRNA 1RKTA 2PMZN 3D1NI 5GPAA 3H3VK 1G2HA 3M3YJ 2HOAA 3A02A 2R5YA 2MW8A 1T56A 3S2DJ 2XRLA 5E3MA 3FK7A 4XRMA 2WV1A 2LY9A 1D5YA 5IYBJ 1K61A 1JT0A 3GBGA 1ETYA 1AKHB 4XICA 5FLVA 3C2BA 2NOGA 4A3DJ 1BW5A 2WB1N 3BR0A 3FK6A 1VNDA 2JA6J 1NTCA 1B8IB 1S7EA 4AUXA 5C44J 4D7NA 3BG3A 1JKQC 2E2HJ 2YUSA 4DYQA 4MFDA 1APLC 3BR1A 4FE4A 2EQRA 2EZKA 4BBRJ 3HEFA 3HOWJ 1ETXA 4CYCB 2EBIA 2XGCA 3HKZN 5K7ZA 4UUSA 1VI0A 4M6VA 3G1MA 1YRNB 2O7OA 2HXIA 2NVYJ 2R5YB 4X1EA 1T33A 3ZQIA 2DMNA 3BQYA 5DTDA 3ZQHA 5IPAA 1RR7A 4M3FA 2FD5A 2Y30A 1WI3A 2NVXJ 4FTHA 4BBSJ 1OCPA 4A93J 1JTXA 2N8GA 4V2FA 3JRFA 3PO2J 4JX4A 3ZOBA 2TRTA 3TW7A 1ETKA 3VPRA 1FEXA 2CUEA 2DA1A 5IOZA 2LVSA 3IV5A 4ABZA 5EG0A 3HM5A 3BR3A 5IP6A 2IBDA 2VUMJ 2HXOA 1WH5A 1UHSA 1ETWA 1UG2A 3ZQCA 1OJLA 4UUSB 1ZR2A 2JA5J 2LFBA 2R92J 2QCOA 3MKLA 1HCRA 5BNGA 4M3EA 3S14J 3SDGA 2LKXA 1IGNA 1GDTA 2M9HA 4QIWN 4BY1J 1ETQA 3NARA 2DJNA 1BJZA 3BTIA 1Q1VA 4A3KJ 2HOTA 3CDLA 4IHXA 1TWCJ 3HOXJ 1JT6A 1GUUA 2CQXA 4DW6A 3ZQLA 3JREA 4A3IJ 1ZGWA 1XC5A 1ZTRA 5IYCJ 2LK2A 2E19A 4BKXA 4A3EJ 5EZGA 4QTRA 2NVTJ 3RKQA 3BG5A 3WHCA 1BW6A 5F0CA 2VKEA 3FKIJ 4DZJA 2DMPA 3LOCA 5M3MJ 1NK2P 2HYJA 1TWAJ 3GTQJ 2DMQA 4C3IJ 2MSYA 4MLOA 1VFCA 5F0HA 2IAIA 3OIOA 5K7FA 4DYCA 4XIDA 4A3LJ 3SFIA 4GFBA 3LNQA 3HGYA 3NAUA 2CUFA 3RZOJ 5EYRA 5E3LA 1OCTC 4DYRA 3LSPA 1R9TJ 2Y31A 5IP7J 2DMUA 2L0KA 3I4NJ 1ETOA 3RZDJ 3M4OJ 2EZIA 3OSGA 3JRCA 3GTPJ 2DA5A 1IRZA 4Y52J 1B72A 5F1JA 2XPVA 4RBOA 4AYBN 2CRGA 1SFOJ 2DA6A 5M5XJ 1JKRC 1A5JA 3B6CA 2FX0A 1W0TA 1JGGA 1SANA 4UUTA 1IG7A 2CQQA 3BTJA 2RAEA 1AHDP 2HQ5A 1X2MA 2M34A 4B1RA 4A69C 2CU7A 1ENHA 2E2IJ 5M5WJ 4A3MJ 3Q0WA 4BY7J 3S1MJ 5C3EJ 3F0CA 4W1UA 5M5YJ 4M3BA 2JK3A 3JRBA 1I3QJ 5DS9A 4MIMA 1RKWA 5C4XJ 3JRHA 2VPRA 5JLWA 2R93J 1BL0A 2FJ1A 1H88C 2B63J 3L1PA 2LP0A 4AC0A 1GVDA 3S17J 5FKOA 2TCTA 4IEJA 5EGOA 3G1OA 4FISA 2M2EA 5F27A 2XPWA 4XRSA 3BR6A 3LSGA 1RETA 4M3DA 2H8RA 1H89C 2E1OA 3MN2A 1AU7A 3HOZJ 1MH3A 3JRAA 2NS8A 1FJLA 3TP0A 4I76A 2DA3A 3Q0VA 2X48A 1ZR4A 3JRIA 4G12A 3GTOJ 2VKVA 1JJ8C 3I4MJ 3IH2A 1H8AC 3S1QJ 1WGXA 3B6AA 3BTLA 4Y7NJ 4A3CJ 1GV5A 5F0FA 3HDDA 2M0CA 2K9SA 5EEAA 5EGOB 1JUSA 2KT0A 2D5VA 1FTTA 2EZHA 2ZB9A 3HOYJ 1POGA 4D5CA 3ZQGA 1JTYA 1UMQA 2JWTA 2K40A 1VF9A 1FIAA 2YS9A 3H0GJ 1Y1WJ 1I6HJ 3LSRA 1LE8A 2DA7A 1IUFA 2NVQJ 4MO7A 1X2NA 3CMYA 5EF6A 3W6VA 3GTMJ 1IDZA 2R5ZA 1U9NA 5EG0B 1IC8A 4XK4A 2DA2A 3E7LA 3OSFA 5GPCA 3HGGA 4A3GJ 5K7HA 1IJWC 4JYKA 5M3FJ 5IYDJ 2NS7A 1ORKA 1W0UA 4M3GA 1FTZA 3BQZA 2LD5A 4EEFG 3GTLJ 2DMTA 2ME6A 1P7IA 3MVPA 5FKLA 3QPSA 2O9LA 4RDUA 1MBKA 4J19A 1ZKGA 3GTGJ 2ECBA 2MG4A 1ETVA 4W97A 3A01A 2Y9YA 1CQTA 4IHVA 1F36A 2K9QA 3DEWA 3IH4A 2QF7A 3PM1A 2AHQA 1LE8B 2OF7A 1JUMA
chains in the Genus database with same CATH superfamily
2M87A 3HRTA 1LKXA 3U1KA 1JUPA 3OWTA 2B0LA 4NB5A 1TWFJ 3H9JA 3CMEI 1NH3A 1XS9A 1AKHA 2Y2ZA 3R60A 3ZMDA 3WTZA 3OR1C 2BVMA 3G71I 2HOSA 4XMYA 5LHHA 3K70C 4ENNA 4XLEA 1U8BA 5DUKA 2K7LA 3BR5A 2UUZA 5HVQC 1BI2A 2G7UA 1IXSB 1TC3C 4Q48A 2FXAA 1BA5A 2L2OA 4HNUA 1L0OC 3V7RA 1YJWI 4AYBA 4OAYA 3RTRA 4NHJA 3KCCA 1KYWA 3ZQFA 1ITYA 2W57A 5F6FA 2RQPA 4CCKA 4G9YA 1MSFC 4QSHA 2MD5A 4CXFA 2W00A 4I99C 2LNBA 1Z0XA 2VE9A 2BE5F 5E20A 2XF6A 2W84A 4XN3A 1TNTA 2DU9A 2DO7A 5EEGA 4BE0A 1KONA 1T2KA 3IHUA 4YFXF 3GVAA 3RKXA 4PSXA 1TBXA 2DJIA 2DFHA 2H09A 4Y15A 4F55A 1REPC 3WTTC 3I4PA 3I64A 1YJNI 2M8EA 1QZZA 1DPRA 2KPMA 3CO7C 2HZTA 4D9JA 3G6EI 3TO9A 2Z2SB 1TTYA 1UB9A 1SFKA 3H1CA 1HDDC 2ZSIB 2GIZA 1Y8RB 2CSOA 1AA7A 4UVBA 1J5YA 1T8IA 3I3LA 4XONA 4I02A 4JOMA 2L7MP 2VXDA 3AG2H 1ZAOA 5CQGA 3W6KB 3RYPA 2A61A 3CTAA 1OCOH 3J81K 2IRFG 3RPQA 4L5EA 4MNUA 3WTUC 4G6TB 4FCYA 4AIJA 2TDXA 3DKYA 3HOTA 2JA7J 4IQ4A 3QP6A 1J2XA 2GOXB 3F72A 2EJRA 2ME0A 3B02A 4BHCA 1YS7A 3S16J 4E7HA 4A3FJ 1FOXA 4IHYA 2IT0A 4F93B 2GA2A 2CQ7A 3V7SA 3BLYA 1U0JA 2DBBA 2GBYA 3WHBA 2EFPA 2ZMEC 5ERIA 1WPKA 3JSOA 5LFAA 2GLOA 1LNWA 3KFWX 1BM9A 2W24A 4MFEA 3O8HA 2MYSA 2ZXJA 2F5VA 2F4MB 2A5WA 2LMDA 3BR2A 1IF1A 5J4YA 1IV6A 4F92B 1K6YA 4XSXF 3DBRB 3KP6A 5FD5A 4DQ2A 3U9GA 2MBFA 1HQCA 3TP3A 2LG4A 1R58A 3QYEA 1DDNA 1LFUP 4XLHA 3U1DA 3I55I 2O8KA 5EDNA 3W3CA 1R4NB 2RQQA 3CC7I 2M30A 2F4IA 4S0HB 4BDYA 5CLSA 4RMNA 2YU9J 3VYTB 4ZYGA 2IVMA 5J1UA 4RAGA 2XGDA 3ONQA 1QPIA 1D8JA 5FJ8J 1J59A 2R7DA 2IS4A 3CJQB 5E8IA 1RI7A 4EM1A 5DM7F 2PN6A 2V7FA 3PQJA 4CUGA 2FQ4A 3WGHA 2ELHA 1SD5A 3FXOA 5HODA 1VQ6I 2RREA 4CHUA 2JMWA 5LBQA 3FMRA 2R3SA 3H5RA 2HI3A 2MH9A 3BZCA 3O8GA 5HS9A 1LFPA 2BV6A 4C3HJ 4LJZF 1O7FA 2EZLA 4O6JA 3UKGA 2QQ8A 1MD0A 4BYYA 2BHYA 1E3HA 2H6CA 1F4KA 1E3OC 2E1CA 4ESBA 2DYSH 2AQFA 4ZYEA 1H0MA 1EJ9A 4CYCA 5B66C 2WAFA 2WAQN 1FZPB 3E5XA 4XOPA 2H8WA 2PJRB 1RKTA 2XV4S 4MTEA 3HG9A 3ZN0A 4EMSA 2HOAA 3A02A 5IT9Z 2P5VA 4YIFA 3DBLB 1PP8F 4XRMA 1DGRM 3GO5A 2VPLA 2WV1A 4DOZA 1KU2A 1D5YA 3MEXA 3GBGA 4PZJA 3OYIA 1JT0A 3M8EA 1NG6A 2ISYA 2NOGA 1DGWY 2Y0SA 1BW5A 4BJTA 2WB1N 3BR0A 3I54A 2JA6J 4BE1A 1RR8C 1S7EA 3QPTA 3WTVC 2CWEA 4D1QA 3RSNA 5C44J 4A0ZA 2OQGA 4HX7A 2H27A 2YUSA 4HNTA 3DWLE 2HYGD 2DODA 2RN7A 2KMUA 3CMMA 2EQRA 3TL4X 4O3MA 2RNJA 4NBQA 1FOKA 3HEFA 2DK5A 3A0BC 3JSPA 2GZWA 1YO5C 5CVRA 4CYCB 2EBIA 2R7UA 2IGNA 3TOBA 4UUSA 1VI0A 2O7OA 4AD9A 4X1EA 1T33A 1Z3YA 5IPAA 4AIDA 4M3FA 1ZRCA 4GXOA 4IHSA 3QP5A 3QYFA 2Y30A 1XGOA 2NVXJ 2FQ3A 4A93J 2R7SA 3OV8A 5KK1A 2BHZA 1XGSA 2A68F 4EJWA 4JX4A 3ELKA 4G7HF 2TRTA 2FMLA 1ETKA 1FEXA 2LY1A 4PFOA 4UXNA 2DW4A 3RI4A 5IOZA 2LVSA 3IV5A 3DU5A 1XPXA 4IQJA 4OOIA 3ZMSA 1SVOA 4Y4RA 1O3RA 3I9V2 2HXOA 4Z6YA 4PJNA 1UHSA 3AKZA 3ZQCA 4PJMA 1OJLA 5E18F 3AG3H 3H3ZA 4UUSB 3J7AO 1PDNC 4PK4A 4U7BA 1ZR2A 1FYKA 1SMTA 4A5MA 4BUPA 4PFPA 4DIQA 4BEHA 1R5ID 2RDPA 3M1CA 2LKXA 1FWZA 2M9HA 3DF8A 4QIWN 3NARA 4E7KA 1U2WA 2IP2A 5E79C 3HHHA 3HOXJ 1JT6A 4DW6A 3ZQLA 4LLLA 4A3IJ 2Z5UA 1ZGWA 1XC5A 3K4CA 4IL6C 5FB2A 4S05A 1MJ9A 2L01A 3R0AA 2QSGX 3HSFA 3I56I 3MKYB 5K5OA 3IRRA 4XLPF 1VQKI 3E6BA 4QTRA 2NVTJ 4LB6B 3BG5A 1J09A 2IXSA 2YPRA 2LKSA 1OQYA 2K9LA 3QPHA 3FKIJ 4BDZA 1QQIA 5LD2C 1ZGAA 2DMPA 3ZGKA 5M3MJ 2P8TA 3A2KA 2DMQA 4KN7X 3RPUA 1USTA 2MSYA 2Q1ZB 3FXJA 3T8RA 1IRXA 4C3IJ 4MLOA 3JTGA 1VFCA 2O8XA 3ZR8X 4BEHB 1W7PA 1WKMA 1XTAA 2VJ4A 4XL9A 1U5TA 4A12A 5K7FA 3SZTA 1R1UA 3OYDA 3J80Z 4XIDA 3ZQQA 1R23A 1EH6A 2RNGA 5EYRA 2R7OA 4B47A 1XMXA 3KZYA 3P5JA 1SVLA 4DYRA 2FSWA 3LSPA 1OCTC 3MWMA 1KYZA 1ETOA 2EZIA 3OSGA 4MHGA 3JRCA 1B6AA 1FBSA 4E7JA 5D8LB 1P4XA 5K5QA 3OS0A 1BOBA 3B6CA 1I3AA 2ACJA 2JT1A 1W0TA 2E71A 3PL8A 4ENKA 2BY1A 3HUGA 4YG2F 2COMA 1IG7A 2DFEA 1TQIA 1W7PB 2RAEA 4UHTA 3M9AA 2HVQA 2HR3A 1U5TB 1P2FA 2W4SA 5DM6F 1X2MA 4A69C 4KYWA 2OU2A 3J81Z 2BGCA 3BZ6A 3Q0WA 2DT5A 1HKTA 4W1UA 2JK3A 1W36C 2DCEA 1G8XA 1I3QJ 1Z21A 4I2OA 4BU2A 3ZMUA 1RKWA 4Q47A 2VPRA 3QODA 1H88C 3I59A 3VEPA 1T08B 4PJ0C 1VQ9I 2HVSA 2VLAA 5FKOA 2TCTA 4IEJA 4QLCU 4P9UA 2EV6A 2M2EA 2V9VA 3BR6A 2E35A 3LSGA 4UUVA 4U0WA 3L2VA 4M72A 2VIXA 2H8RA 5FD6A 2XAGA 3MZHA 2ZJPF 3LSIA 5D5WB 3HUGB 2IGOA 1S9HA 5KAIC 1FJLA 2KRCA 5LEJA 3PNVA 3TP0A 4JK1X 3Q0VA 3K4JA 4CDGA 3P9CA 3HHGA 2DDAA 1ZR4A 3GTOJ 4G12A 1S5LC 2CFOA 3K69A 3IH2A 1H8AC 1WGXA 2HDCA 3E0JB 4R8HA 4BS9A 3BTLA 3PNTA 5D4RA 1WJFA 1YW8A 1UAAA 2YX7A 2QM3A 2EB7A 3AG1H 1S29A 3I59B 1RC9A 4A3CJ 1Y6IA 3CJRB 1Z05A 2K9SA 3BPVA 4RAFA 4BQNA 2YR2A 5HOOA 4BHBA 2H6BA 2V79A 4ZYAA 3G73A 3HOYJ 1K78A 1POGA 4ZC3A 1JTYA 2WTEA 2Z3YA 3DXJF 4A5NA 1JI8A 1VF9A 1FIAA 2XKOA 2YS9A 2XC7A 3F3XA 4NC7A 1Y1WJ 1I6HJ 4KIBA 2DA7A 3ZCOA 1IUFA 1DQUA 4RM2A 3GTMJ 1FMVA 1R00A 1ZG5A 3FXMA 4FX0A 2L54A 1IC8A 4XK4A 2XF5A 2HKXA 5K7HA 3AL0C 1IJWC 4UB8C 5BOXA 4HAMA 1Z3XA 2DAOA 3HTUA 4KNYA 2LSOA 3L2RA 1BI0A 2LD5A 4EEFG 5ICCA 3ZPLA 2PQ8A 5FKLA 3QPSA 2W7NA 5ICGA 2LYCA 4DBQA 2EFNA 1ZKGA 1BR4A 1MMNA 2ECBA 2MG4A 1K78B 1ETVA 2MFZA 2Z99A 4GGGA 4NUBA 4W97A 3TGNA 2OBPA 4O5VA 3VDXA 4IHVA 2DOFA 3H5NA 2Z33A 1JGSA 2CW7A 3H36A 2EH3A 1X4PA 3MZ8A 3A0HC 1CGPA 3LSHA 3W6JB 1D0XA 1D1AA 1MMAA 4X6AJ 3LFUA 1WJCA 2BVLA 2ID6A 2L9RA 4IHWA 3PO3J 3D5RC 5GAGJ 1FMWA 2DA4A 2LREA 1C0WA 1IN8A 5E1XA 4YIRX 3JRGA 2K9MA 3L2WA 2X85A 4EJUA 4XRSG 2G7HA 4B48A 1R49A 5LHIA 5LRRA 3TOAA 5D5VB 1P6RA 2STTA 3CUQA 2GQQA 1QVUA 5JFRA 3DLLF 4AIKA 4B43A 1YIOA 3WTYC 4E4HA 2LC2A 2R4GA 1A36A 1B1BA 3S15J 2CQKA 4Y17A 1HXDA 1OPCA 2VT2A 4UV9A 1T6SA 3QPLA 4C3JJ 5HNFA 4I6ZA 3SJMA 3OS1A 3TEDA 5JLXA 4FT8A 2IW5A 5F04A 3T1BA 4D7MA 2QKMB 3ZMTA 1YFHA 1MMDA 2L9NA 3JCUC 1B72B 2X51A 1PUEE 2AO9A 1G3YA 1LFBA 3I5UA 3Q0UA 2OZ6A 1MBHA 4QPQA 2Q8KA 2ID3A 4MQVA 1VTNC 3LSTA 3TO7A 3WGIA 5HS8A 2A6HF 5LHGA 3CCYA 4YFKF 1LJ9A 4OU0A 4RGXA 3R4KA 2ZJ2A 3K6GA 1FPQA 1SVMA 3GZ6A 3ZRGA 3CLOA 3CUQB 1MBGA 5ILUA 3CCLI 1FC3A 1TP4A 4RB2C 3HB9A 3WE3A 2EFQA 1UCRA 2CGPA 4HEA2 2UXNA 1Y8QB 2XSDC 5IP9J 3F8MA 1K6OA 3HZJA 3QYBA 3HBLA 5JI6A 3VWBA 2E5NA 2JN6A 2W48A 2XB5A 5JHUA 4BACA 2QYOA 1QGPA 2PMHA 3DCFA 2ELKA 5B3SH 5HLHA 3AL0B 4U7DA 3S3NA 3FISA 3OYFA 1ZN2A 3MQ0A 1IN4A 3KYDB 4HG2A 1UG0A 2JPCA 1XMKA 5IY5H 4B4CA 1I50J 2E60A 2P81A 2XUBA 2X1CA 3HPGA 4G6QA 1MNMC 1XG1A 1MH4A 3TO6A 1S72I 3G2BA 5FRMA 1G3WA 4UB6C 4XKBA 2VBXA 3FF5A 3IKVA 1U9OA 1VQLI 1F43A 1P7JA 3CCQI 2M8GX 1D1BA 1X1AA 2GXGA 2W25A 4UVCA 1TQPA 4RLQA 2MD0A 2M45A 3KE2A 5FFXA 4XQFA 2F5CA 3KEYA 1XX5A 3A4CA 2FE3A 4XN0A 4E6KG 2XB0X 2VKHA 5FKNA 2P4WA 4KISA 3EDPA 2X6OA 4M9XA 2EPFA 2XDVA 3CJTB 3FXRA 1ZREA 2R7XA 1LDDA 2Y69H 1ZGJA 2QUFA 5E17F 1Z77A 4Y3OA 3HOVJ 2XGEA 5L3FA 1K83J 1QRYA 1XDUA 4E7SA 4ITVA 1HLVA 4FASD 2IEKA 1LVAA 1HW5A 4HDUA 2HGCA 2LTPA 1CF7A 1K4TA 5ICFA 4KICA 3DKWA 4EVIA 4CZCA 1S3JA 4AIHA 4AWXB 2STWA 4D5FA 1FOYA 2DPUA 1VQPI 4BQAA 3F23A 1P4AA 1RESA 1XGMA 2PMZN 1G2HA 1O3QA 3M3YJ 2K85A 2IJLA 1OCCH 3SDBA 5JVTA 3J80K 2FBIA 4MTDA 3PFIA 2MW8A 1T56A 1MNEA 4ZJZA 3VYRB 3S2DJ 1T0FA 5LGNA 3PSIA 1ZRFA 5E8GA 2AQEA 3IP4B 1KQ0A 1K61A 2J5PA 2ELJA 1AKHB 3C2BA 1GXQA 2K5CA 4A3DJ 3LA2A 2K4JA 3N05A 3WTXC 5F64A 4KUMA 2VOOA 4GO1A 1XCBA 3IAM2 4BQQA 2W85A 3FBIB 4KMFA 1Z7LA 3TMOA 2Y0MA 4AUXA 3GZNB 3AG4H 3BG3A 4L5JA 1JKQC 5JHFA 1CF7B 4DYQA 2E2HJ 3K1NA 4MFDA 4B3XA 2LF8A 4G7ZF 3B73A 3ESWB 1D5VA 3HOWJ 1ULYA 1AWCA 2FNAA 2XGCA 3HKZN 3SYTA 3G1MA 3DFGA 1P4WA 2NOJB 4ZH4F 4LLGF 2V6EA 2VL8A 4OAZA 3FBNB 3ZQIA 2DMNA 4B09A 5L3EA 1HKQA 3HPHA 2EK5A 1TQMA 2QWWA 2E1NA 2ZFUA 3E6MA 1LVKA 1QHHD 1Z6TA 1B9MA 3OYNA 1Y39A 1BC7C 4FTHA 4BBSJ 1OCPA 4V2FA 1A04A 3PO2J 4HLXA 5GADJ 3CC2I 3ML6A 4M71A 1YTYA 2VOPA 1BI3A 1FBQA 4PDKA 1B4AA 2V9KA 3NWTA 4XKWA 3W2WA 3ZMVA 4ABZA 3HM5A 5EG0A 3IAS2 4IF4A 4WK8F 2VXZA 3N4MA 1VQ4I 1ETWA 2DK8A 1EH7A 4WX9A 3NEUA 2JA5J 1PP7U 3DU6A 2QCOA 3Q9SA 3CCUI 1HC8A 2CV1A 4M3EA 4CCNA 1GDTA 3S8PA 2XF7A 4I7HA 3ZQ7A 2K27A 2ZKZA 2PX9A 3DTEA 1ODDA 4IHXA 2HOTA 2BW3A 3SZGA 2KJCA 3K2ZA 1GUUA 4B8XA 3JREA 4ZYHA 4II2A 4MEXF 5KAFC 4F7ZA 4WCGA 2LK2A 2ZXWH 3L7WA 1ZYRF 4ANJA 5ILSA 2FU4A 5TJJA 2JTVA 2ZSHB 2DPDA 2BZTA 3WHCA 2P6TA 3SFZA 4XNFA 1E0EA 1T38A 2VKEA 3KP7A 2UXXA 4NQWA 5D8KB 5ED4A 3QAHA 2EIJH 4WF2A 2VB6A 2E5ZA 2L4AA 3LAJA 3PSFA 1R1TA 4CGZA 1KA8A 3HYIA 5F0HA 4ASNA 3S32A 2OV7A 2VBZA 2UV1A 4XKVA 2UZKA 4GYGA 4DYCA 5LGUA 4BH9A 3SFIA 3IWZA 3LNQA 4AVZA 2O5RA 2BW3B 2CUFA 3KP4A 1X3WB 1R9TJ 2DMUA 3NQOA 4Q4ZF 1D8KA 1IXCA 3E97A 3GTPJ 2V9PA 2V1XA 5F1JA 3M8FA 4XBFA 4RBOA 4AYBN 2CO5A 2IS2A 4DJAA 3ZP5A 2ISZA 4NQWB 2VN2A 3W2AA 3F22A 3CP8A 3J7ZI 2DT6A 3FM5A 2Q0OA 1W5CC 3EYYA 3K1PA 1MMSA 3PJRA 1SFEA 4PGGA 4JBAA 4IX7A 1XSVA 3KX2A 1AHDP 2EV5A 3FKJA 4LFUA 4XOTA 5H2FC 4E7ZA 2VJIA 2M34A 3BPXA 3FMSA 1YYVA 1ENHA 3E6DA 4GYIA 2E2IJ 1VZ0A 5CVUA 2X1DA 4BY7J 3FDYA 5C3EJ 1FP1D 1YW7A 3W2VA 1UHWA 1OCRH 1VQMI 4H4KC 4MIMA 1O57A 3PFYA 1FX7A 2KL4A 2L5QA 2B63J 3PIPF 1U5TC 4AC0A 4IJAA 3HL2A 2E1MB 3ABMH 3HJEA 2DI3A 4G6DA 4L9NA 2L3DA 2DYRH 1YG2A 3V4GA 4N9IA 3ROUA 2L02A 5KNLA 4UVAA 1V4RA 5HDKA 3SEQA 2HOEA 4M3DA 3WU1B 2QEXI 1I6XA 2KIQA 2NRAC 3HOZJ 5J4VA 3FZVA 2VQHA 2UWMA 3BP8A 3JRAA 5HLIA 2BXZA 2NS8A 2CUJA 1GVJA 3F6VA 2IA2A 3RIRA 5FFZA 2X48A 5DV5A 1O3SA 1KQ8A 5ICEA 2FF4A 4ZZLA 3BWGA 1A6QA 3BCBA 1MW7A 3B6AA 2EWNA 2E7WA 4M6YA 1LB2A 2ZC2A 1X1PA 3HDDA 1KU9A 2M0CA 1TL8A 5EEAA 4RGUA 4EGYA 1ERDA 1D0YA 2FMYA 2GWRA 4BXUA 1X1CA 1KGSA 2D5VA 2VC1A 2KRFA 1FYLA 3K4MA 2VE8A 3H9QA 1GHCA 3I53A 2RVCA 1UMQA 3T0YA 3LSRA 1J7KA 1QZYA 2NVQJ 3U2RA 2JUCA 4MO7A 5HLTA 2OC6A 1Z6RA 1X2NA 2ZBKA 5EF6A 2P5KA 4N0BA 5HNHA 3PIOF 2Z1DA 2V4JC 4L0YB 4R1HA 3IRQA 3IC7A 4A3GJ 2KFDA 5M3FJ 4LK1F 3ABUA 2NS7A 2R7VA 5EJCA 3BQZA 3DEEA 2VODA 4I0BA 4OWRB 1NHAA 2O9LA 2OQRA 1LPQA 4RDUA 1MBKA 1IZ1A 1STZA 4J19A 2X4HA 3KLOA 4A0XA 3AAFA 1XSXA 1TZLA 3A01A 5HLGA 4RLFA 2K3PA 2L7KA 2HU9A 2V6CA 2QF7A 3PM1A 2AHQA 3CMYA 1N75A 1YJ9I 4IHTA 2XSJC 2VI6A 1OR7C 3G1LA 5JVGF 2OUMA 3EUAA 3ZMZA 2QENA 5ILVA 3GUDA 3EQLF 2K3FA 3PQKA 3IKTA 5CVIA 1WJ5A 3SZPA 1HF0A 1S8NA 1ZK8A 4X0GA 1HDPA 3HOSA 3Q3SA 2HEOA 3DKXA 1DP7P 2DTZA 1XCVA 2ETHA 3BG9A 1BI1A 1DU0A 5E3OA 2G9WA 5EEHA 4NDLA 4Y13A 5A2QZ 2MLGA 3EPZA 1LQ1A 2NAZA 1A35A 2O3FA 3A01B 1N77A 5LLQA 1FY7A 2W82A 4HW0A 3KPHA 3GEZA 2V1NA 3TQNA 4HQEA 4C2UA 3GTJJ 1TT5B 2JJ7A 2Y0SN 2EA4A 5FGMA 1MIJA 2HZDA 3F8CA 4AM3A 5K1YA 4L5IA 3QU3A 4HPQA 3BT9A 2R7TA 2LBFA 2NYXA 2X6XA 4EATA 1JKOC 1UHMA 2K4BA 4MEYF 5F08A 1ZLKA 2HDDA 3RQIA 5FO5A 2EV0A 1R6RA 3LA7A 4TV7A 1OYWA 4ETSA 4HNVA 1I5ZA 2CYYA 1T39A 4U88A 1EF4A 4XLFA 5DCFA 2A07F 3OYHA 4FX4A 1L3LA 1QZEA 4KIFA 1FOWA 2ICWG 1W1WE 4KT6A 4JX5A 3ZN1A 4LIUA 4ZTJA 3LSKA 3V7CA 5J1YA 2IA0A 3ASNH 3KLNA 4LOCA 1G3TA 3IL2A 3F8BA 4BXFA 1WH7A 2WA0A 5L3CA 1GXPA 5E3NA 4QWQA 4HRIA 5IT3A 1XD7A 3OOUA 1BJAA 5FLMJ 1Z67A 1R71A 3IWFA 4L18B 2LR8A 1ON2A 2LBFB 4A3BJ 3CUQC 1WQ2A 1G6NA 2FBHA 4CCLA 2L7FP 3D5SC 3K2AA 5DCMA 2E7XA 4EM0B 5L3BA 2LRDA 3CCVI 1O3TA 2E2JJ 4V2GA 3BTCA 4HSTA 1OR7A 2W1OA 3OYMA 1ZG1A 2K02A 4XORA 4LG0A 1ACIA 4JX6A 2HYFA 1X58A 1OFCX 1LDJA 1R5GA 1YITI 1ZH5A 3GFIA 2ESHA 3QQAA 3QU6A 3S93A 2MGQA 4DGWB 2JA8J 3LMMA 1QO0D 1R7JA 3V8LA 3VFZA 2QZ8A 3C3WA 4CSWA 1FIPA 3ABTA 6PAXA 4HSRA 2J5OA 3EUHC 1IV8A 3FWEA 5DUIA 2FOKA 2XAQA 3OR2C 4ESJA 1HSTA 1V5FA 2M7AA 4IOAF 1O4XA 3CD6I 3BJAA 3QOPA 2IS1A 5DCMB 5EZHA 1IDYA 1W4MA 4Q5SF 4JQFA 3IH3A 3CJNA 4IRHA 4XSZF 2JVGA 4IZZA 4BQOA 4LG0B 5LEKA 2XPUA 1R1VA 4QPOA 4GDFA 1I39A 3D5LA 2XIGA 4XLCA 2ZNZA 1ONVA 5FRNA 2EILH 2KRHA 3SXYA 1N78A 1E17A 2A6EF 3HOUJ 2HQRA 3OYLA 1HW2A 3FIWA 4E7LA 2RV8A 1JHHA 3H92A 3WTWC 1YHQI 5IOYA 3WU0A 2X1EA 1XGNA 4DZPA 3BCAA 2XAFA 3RKYA 3K7AJ 3OYGA 2COBA 3H0DA 1KU7A 2MABA 5B1BH 3FXKA 4B3AA 2AS5F 3PUFA 1X19A 3G3ZA 3D0SA 3P9IA 5D4SA 1JKPC 1UJ8A 4KDPA 2H94A 3CP2A 4J01A 4KA4A 5C4JJ 2H1LA 2GM4A 1T95A 2BOLA 1P92A 1QVTA 4JP0A 4J00A 3LSJA 1JE8A 3V42A 1SD7A 4EQQA 1NG7A 3S2WA 5D5XB 3D1NI 3ECHA 4KT5C 1WJBA 2R5YA 1VQ5I 4GRIA 2XRLA 4EJVA 5E3MA 1G3SA 3L2QA 2D1VA 2M7BA 1U3EM 3SEZA 4PUSA 3DV8A 4IRIA 3ABKH 5IYBJ 2E36A 4F52A 3BY6A 3C7JA 1HKSA 3E5QA 4XICA 5FLVA 2QSFX 4NC8A 2WY8Q 3JTHA 3CCRI 2VASA 1YIJI 1NTCA 1WFXA 2ZNYA 2VONA 3FXQA 2GXBA 2X6WA 4ON0A 3EUHA 3HRMA 1YS6A 3REOA 1APLC 3RJPA 3KEOA 3EYIA 1RZ4A 3HSEA 3HXLA 4G8XA 3VYSB 2AXTC 4CCOA 1R5HA 4LG3A 2CFXA 3GX4X 4HYEA 3O6BB 4BGDA 4UY8I 2JA2A 3GFJA 2DLLA 2NVYJ 2R5YB 1R36A 1RIOH 1QA6A 3L2CA 3BQYA 5HS7A 3GMEA 2O6GE 5B5EC 2FD5A 2NXNB 4L0ZB 1WI3A 1V5EA 2XRNA 3H5AA 3C1DA 3F21A 1JTXA 3JRFA 3PUBA 5F1RA 3ZOBA 2VQGA 1VQNI 1KU3A 3TW7A 2CV0A 2IGKA 1T0FC 2CUEA 4HX4A 1AOYA 4D0PA 2R7WA 2B9SA 5DD4A 3BR3A 2KIFA 1BBYA 3M7GA 5IP6A 2R7FA 3VSLA 4LMYA 2P6SA 3GFLA 1OYIA 1X1BA 2EA2A 3IUOA 3LWFA 1SAXA 1N25A 3ECOA 1S6LA 1Z7UA 3FHNA 2WY7Q 2MA3A 5BNGA 2C6YA 4MGRA 1IGNA 5GAEJ 1J75A 4BY1J 1ETQA 2EFWA 4ZYDA 4A3KJ 2KP6A 1TWCJ 4RB1A 3E6CC 3A1YA 3M1EA 4FHTA 3WG9A 3KYLA 5IYCJ 3WG7H 2CUZA 3OOPA 4A3EJ 3QRFF 2ZJQF 5EZGA 3GYHX 1W5SA 2M5WA 1G59A 3RKQA 1SFUA 2Y48A 1A31A 1BW6A 2MC4A 3RDIA 5F0CA 3MKWB 4DZJA 2B7EA 3OIPA 3LOCA 5BMZA 2HYJA 2ZXIA 4I01A 3QWLA 2HDWA 2D45A 5FLXK 3ERED 4OINF 2HVRA 2IAIA 3OIOA 3S3MA 1KZHA 2EIKH 5LRSA 4CYDA 3BC8A 3CF2A 3GW2A 1YE9A 4A3LJ 4GFBA 2ZXHA 4WXHA 3RZOJ 2ADUA 5H6RA 1G4DA 1I27A 2VT3A 4P55A 2Y31A 2XAUA 3I4NJ 2L0KA 1MKMA 1FSEA 5TISC 1QNTA 2LY2A 1F9NA 3I0TA 2FUG2 4KIGA 5L3GA 2DA5A 1IRZA 4Y52J 2XPVA 2O03A 1JKRC 2WAQA 4XR6A 2F2EA 3GF2A 1WZ2A 1T98A 2IPQX 1HSJA 4B44A 5B1AH 1SANA 4G94A 2LH9A 3OL3A 4XLNF 2MH2A 4XRFA 3PNYA 3WGGA 3M07A 2JUGA 2CU7A 4YEJA 4A3MJ 2WB1A 5D6FA 3F0CA 5M5YJ 4AU7A 4HV6A 3OYBA 1XMAA 2HQNA 3JRBA 5A2QK 2L9VA 3GZ5A 4YFNF 4LITA 4II3A 4AVPA 3JRHA 2R93J 3I58A 1BL0A 5BQTA 4IVNA 1Y0UA 5D6EA 3JAMK 2LP0A 1DP3A 1I1GA 3CUOA 4ESFA 3VOEA 3FXUA 2RKHA 1GVDA 3S17J 1XDSA 3OYJA 3TDUC 4BL0B 2XPWA 4A2UA 4XRSA 2PLYA 4RGSA 2CS3A 2KHMA 3BG6A 1MNDA 3MN2A 4BAYA 2E1MC 4RGRA 2BEOA 1MH3A 2WADA 1LEBA 1HBXG 2BY2A 5D5UB 1VQ7I 2DA3A 1B59A 2JPBA 2DT7B 5E1WA 2M1BA 2M3AA 1LEAA 3BDDA 3UNGC 2CQNA 4I0AA 4XM3A 3DP7A 5CVVA 3I4MJ 4ZDOA 1JXSA 3S1QJ 2CMPA 1GLNA 3DTKA 2CV2A 1IRGA 4IRGA 1GV5A 5F0FA 5CYVA 2VKDA 2QVOA 4HBLA 2KT0A 2EZHA 4CICA 4DNCA 5FROA 1BR2A 4D5CA 1D1CA 3ZQGA 1OKRA 4M6XA 2JWTA 2BBYA 2K40A 1V54H 4U87A 4DBRA 3H0GJ 2NNNA 4M73A 1LE8A 1I1SA 2DQRA 2M4GA 1S7OA 4UNOA 2A6TA 1WJAA 1YOVB 2IA1A 2I8DA 1B9NA 4PSWA 1IDZA 2R5ZA 3GWZA 5EG0B 2OTLI 4NNJA 3L9FA 4HF1A 2F5DA 5KCMA 4LD5A 3OSFA 5GPCA 3HGGA 1F5TA 5IYDJ 4BHPA 2QGUA 2YX4A 4P96A 4Z2YA 4CZZA 1W0UA 2CH0A 3K4KA 3KYCB 2Y75A 4M3GA 1W36D 2OA4A 3KIOA 3F9KA 2O61A 1FTZA 4WWCA 1IRFA 2DMTA 2HKOA 1P7IA 1QHGA 4ENMA 1SMYF 4U0YA 4HOBA 1RNLA 3ISPA 2XKPA 2ZJRF 3AFHA 2QBYA 2PJRA 1EA3A 3F8NA 1V5GA 4YRVA 3DLAA 4WXCA 2Y9YA 1F36A 3BJOA 3TBIA 1X4OA 1X3ZB 1LE8B 4LIVA 1JUMA 1E2XA 1NK3P 2KIUA 3CO6C 2E34A 1TWHJ 3TW6A 2MLKA 3F6OA 2HS5A 5DD8A 3FMQA 4BJ5C 2ZCWA 5AIQA 4E7IA 2G0EA 4LB5A 2R5ZB 3S3OA 1SC7A 3BG7A 1FBUA 4IO9F 2HFHA 2H1KA 2F6CA 2D1HA 3CZ6A 1IAWA 4BE2A 1WJDA 4OIPF 4UV8A 3CQZJ 1U78A 9ANTA 1RUNA 5GP9A 1DU6A 4CH7A 5AONA 1HA8A 2JSCA 1RPWA 4XLAA 3R6SA 2F48A 2O0YA 4PJLA 1PYVA 2PEXA 3EETA 4ZDLA 2K9NA 1ZARA 3JRDA 2QBYB 1SAUA 2OPTA 2ECCA 2L7ZA 4A3JJ 4CO8A 1XN7A 1MBJA 3ZXSA 5GTIC 3S2HJ 2P5LC 4GCVA 1D3YA 2ZFWA 4S04A 3K4LA 4V19K 1GV2A 2CJJA 1HOMA 2ZMEA 2QA4I 3J7AY 2EFOA 2QLZA 4ZTFA 3V8KA 1WSUA 3KEQA 4FQGA 4PJJA 3J7YJ 1BIAA 2LF7A 2PFBA 2XAHA 1UZCA 2KDZA 2QKLB 4BNCA 1WCMJ 2PMUA 4I98B 1JJ6C 1PVEA 2K86A 1FP2A 2Y9ZA 5FKMA 1OYYA 1U6GA 2ZO4A 5CJ9A 1E3PA 4IXAA 2R7ZJ 4NC6A 5H6QA 4YELA 1W5TA 1Z9CA 3KP5A 5J47A 2I10A 3I71A 2FA5A 3P9KA 4N9HA 3S1RJ 5J8CA 4HV5A 2JVHA 4EM2A 1LDKB 2ZMEB 3OL4A 3RKWA 3CCSI 1K7AA 2DOEA 1HW1A 1PUFA 3BROA 5CVJA 1Q1HA 3KP3A 3GLXA 1R22A 2BY0A 2FRHA 3JW4A 4EGZA 2BY3A 1RRJA 3A03A 3CDIA 2YU3A 4F3QA 1BC8C 3C2HA 5CQEA 5J1RA 4WXDA 3GTKJ 1GT0C 1OISA 4OIOF 1ZRDA 4OIRF 2FOWA 1ZELA 1BOAA 2GIVA 3BJ6A 5FLXZ 4MQ9F 2R0QC 4BXXJ 1Z91A 2F5FA 1ZLJA 2KQRA 1Z1DA 2XHKA 2R7RA 4KJZA 3OY9A 1H9TA 3MMYB 3V8JA 5CKTA 2M0MA 4M74A 4KITB 1A6IA 4RS8A 5L3DA 3JR9A 2MC3A 3WODF 3T5XA 2HPIA 2M4KA 1PUFB 2HPMA 2XGXA 3LSMA 2WAEA 3OYCA 1TWGJ 4HZFA 4RAYA 3EUKL 3NRVA 3CF5F 1MSEC 2NVUB 2X9DA 2FEZA 4R79A 1M1EB 1S7AA 3T8TA 2OJED 2FNPA 3HRSA 2LDUA 4FE7A 1Y56A 5BS6A 3E3VA 2KISA 2WWYA 1YLFA 5LGTA 5J40A 1MJAA 2V1DA 2VQCA 3H9GA 1WWXA 1H9GA 2QQ9A 4HF0A 2IS6A 1ZQ3P 1PJRA 1WRJA 2PG4A 1B8IA 3BZKA 4HDVA 4IKFA 1IW7F 3DPLC 2DN0A 1ZG3A 5J3LA 4C2MJ 1Y1VJ 2LLKA 2KLOA 3KZIC 2QQAA 5DDGA 2OTJI 1XSDA 3O3KA 1MBEA 3L09A 3VODA 2D2WA 1IN7A 2RGVA 3ASOH 3S1NJ 1IUYA 4RM3A 1MBFA 3JAMZ 2A69F 1R4MB 5FKKA 1YRNA 3M8JA 5GPAA 3H3VK 3DBHB 3WE2A 3DTIA 3OYKA 2OCEA 4N4NB 4E70A 3FK7A 4A6EA 1YX3A 2LKPA 2LY9A 2F4OB 4Y33A 2LOOA 4HA8A 1ETYA 3VYUB 4LLNA 4N4OB 4C2TA 4M9SA 2OCCH 3HTSB 3FK6A 1VNDA 2X0LA 5DYMA 4L9TA 2BXYA 4ZZDA 1B8IB 4EJOA 1EH8A 3DEUA 4D7NA 3K4NA 1TW3A 2QQBA 5K5RA 4P1WA 4PGHA 3BR1A 3K4BA 4FE4A 2AXLA 1SD6A 2EZKA 4BBRJ 3H3UA 4L9JA 3LAPA 2PJPA 2NNYA 5DEQA 1ETXA 2JQ7A 5K7ZA 2KZGA 1OMIA 3ULQB 1WI9A 4M6VA 1V55H 1YRNB 2HXIA 2XAJA 3FX3A 2HNHA 5DTDA 3ZQHA 1RR7A 2Q2EA 4H0EA 3G4SI 2VBWA 3GXOA 2N8GA 2GOMA 5KVRA 2GA1A 1VQOI 3WU2C 1VQ8I 3C2GA 3TKYA 4HQMA 2QSHX 2IGMA 4HX8A 3VPRA 3FXLA 3QOEA 3KP2A 3K70D 2DA1A 3CC4I 3GLLA 4F91B 2HTJA 4EV0A 4RA2A 2IBDA 3HRUA 2VUMJ 2VC0A 2WC2A 4K2EA 1WH5A 4G7OF 1UG2A 3MKZA 2PI0A 2JRTA 3KZZA 4I09A 2VJJA 1IXRC 3CMAI 3SQNA 4RB0A 4KMUX 1J0RA 2LFBA 5CPRB 2R92J 1U8RA 3MKLA 1HCRA 5JR3A 1EV7A 3HSRA 1TNSA 3S14J 3SDGA 2Q2EB 1LUJB 1TW2A 2VQLA 1FT9A 2DJNA 4L9VA 4IOCF 3C18A 1BIBA 1BJZA 1Q1VA 3BTIA 4HF2A 3CDLA 4CA0A 2GXAA 2CQXA 5TRDA 1ZTRA 2DFIA 4C30A 4ENJA 3HC7A 2E19A 3DPTA 2JSPA 4BKXA 4ZDPA 3CCMI 2HTSA 2DFFA 2WV0A 3MD2A 2A3SA 2XROA 4IPAA 2ESNA 2DQLA 2EIMH 1YI2I 1MJBA 2FBKA 3UR3C 2RC4A 1QBJA 3LQRA 1X1DA 2A5YB 3CCEI 1P9QC 3FHZA 1NK2P 3RCOA 1SD4A 1TWAJ 3GTQJ 2XVCA 3F8FA 3LL7A 2V26A 1MGTA 3E5UA 2KKOA 3CDHA 3L00A 4P9FA 2VJ5A 3HGYA 3NAUA 1MDMA 1D0ZA 5E3LA 5E1ZB 3CCJI 2DXIA 1YX5A 1MMGA 5IP7J 5AIPA 1BN5A 1Y0NA 3RZDJ 3M4OJ 3E1SA 2Z9OA 3RYRA 2GAUA 2KIMA 3H35A 5GTHC 4XKCA 1TLHB 2YSRA 1B72A 1WHUA 4P5OA 3LFKA 2CRGA 1SFOJ 2DA6A 3OMYA 4KN4X 5M5XJ 2OD5A 1A5JA 1DUXC 3MFKA 2PMZA 3WTSC 2PBIA 2NS0A 1YW9A 2FX0A 1ON1A 2DTRA 2HQAA 4CCMA 1V3FA 1JGGA 2V1UA 1K79A 3K1MA 4UUTA 3ERMA 3OIQA 4LK0F 2CQQA 3BTJA 3BOQA 4LGWA 1BR1A 1QU3A 2HQ5A 4B1RA 3LQQA 1IO2A 4M9ZA 5M5WJ 3U21A 1MDMB 3S1MJ 4M3BA 3X2QH 2CW8A 5DS9A 4OMZA 4YIIA 1OLTA 3COAC 5C4XJ 2CW0F 5JLWA 5BPIA 2FJ1A 1XB4A 3L1PA 3SHFA 2KZVA 3K0LA 1QPMA 5EGOA 3G1OA 4FISA 5J6XA 2XASA 5F27A 2VBYA 4OMYA 5IT9K 1X3UA 1TT0A 2OAZA 3HKZA 1IN6A 3CESA 5GAHJ 3KETA 5BPDA 3K9TA 1OCZH 4CCJA 1RUOA 1RETA 3DPUA 3OYAA 2E1OA 1H89C 3R61A 5HDGA 3O2PE 1AU7A 2P7CB 1SEUA 4I76A 2JZYA 1IN5A 1J9IA 3K10A 2F5EA 3JRIA 4EJTA 2OZUA 4A0YA 2VKVA 5J8FA 1JJ8C 2BYVE 1DPUA 3HIFA 3CLQA 4BJ6C 2Z16A 3TDZC 4Y7NJ 3OYEA 2CG4A 3MCZA 3GFMA 3N97A 2L4MA 1WVRA 4HLYA 4KFCA 4U0VA 5EGOB 1FNNA 1JUSA 2P0WA 1FTTA 1ZHFA 2R7QA 2ZB9A 4OIQF 3LA3A 3L2UA 2KJBA 1O7LA 2JRMA 3DQVC 1UELB 3RQ4A 2DDBA 3OS2A 1EKEA 1WJEA 2P7VB 4PCQA 4RB3C 3Q5FA 2DOAA 3VB2A 1KQ9A 1K4SA 3W6VA 5HDNA 1MZBA 1U9NA 3P7NA 1UFMA 1SFXA 2DA2A 3ABLH 1F1ZA 3E7LA 3FM3A 4FETA 4JYKA 2L9SA 3MZYA 1ORKA 3GCMA 3NWSA 3R0JA 1FSHA 2EINH 3RPUD 2I5UA 2HWVA 1FYMA 4C9YA 5H20A 3GTLJ 2KDOA 2ME6A 3VSKA 3MVPA 1W7PD 2A05A 1FLIA 3GTGJ 4RAZA 3MAJA 2WBMA 1YQAA 5TGTA 1CQTA 2K9QA 3DEWA 5KHDA 2X6YA 1JHFA 3IH4A 2OF7A 3Q9VA 1USSA 4A6DA
chains in the Genus database with same CATH topology
1NK3P 1JUPA 3TW6A 1TWHJ 2EH3A 2VI6A 3G1LA 1TWFJ 2G0EA 2R5ZB 1XS9A 1AKHA 2Y2ZA 4X6AJ 2HOSA 2H1KA 2ID6A 1U8BA 2L9RA 4IHWA 3PO3J 1HF0A 2DA4A 3BR5A 1ZK8A 3CQZJ 1U78A 1HDPA 1TC3C 3Q3SA 9ANTA 3JRGA 5GP9A 1BA5A 1DU6A 2DTZA 4XRSG 3BG9A 1RPWA 1DU0A 5E3OA 4NDLA 3ZQFA 1ITYA 2K9NA 1MSFC 3JRDA 1QVUA 2OPTA 2ECCA 2L7ZA 4QSHA 3A01B 4A3JJ 1MBJA 1Z0XA 3S2HJ 3S15J 3GTJJ 2JJ7A 2Y0SN 1GV2A 2CJJA 3QPLA 4C3JJ 4I6ZA 3SJMA 1HOMA 3BT9A 5JLXA 3TEDA 5F04A 4D7MA 1JKOC 5F08A 2HDDA 3RQIA 1B72B 2AO9A 4HNVA 1LFBA 1EF4A 3Q0UA 1MBHA 2KDZA 2ID3A 1WCMJ 1JJ6C 3CCYA 1HDDC 2Y9ZA 5FKMA 4JX5A 2R7ZJ 5J1YA 2L7MP 4LOCA 1MBGA 1WH7A 2I10A 3HB9A 5E3NA 3S1RJ 4L5EA 3OOUA 4FCYA 5FLMJ 2LR8A 2XSDC 2JA7J 5IP9J 4A3BJ 3HBLA 2ME0A 3S16J 2L7FP 3K2AA 4A3FJ 2JN6A 1PUFA 2W48A 2E2JJ 2XB5A 4IHYA 4V2GA 3BTCA 3DCFA 2ELKA 4JX6A 1X58A 2GBYA 1OFCX 3WHBA 3A03A 1WPKA 2GLOA 3QQAA 3FISA 5J1RA 2MGQA 2JA8J 3GTKJ 1GT0C 4MFEA 3O8HA 1FIPA 3BR2A 4B4CA 1I50J 2P81A 1IV6A 2R0QC 4BXXJ 1MNMC 1XG1A 1MH4A 3TP3A 1O4XA 1A6IA 1U9OA 3JR9A 1LFUP 1F43A 2O8KA 5EDNA 5EZHA 1IDYA 1P7JA 2M8GX 1PUFB 3IH3A 4S0HB 2YU9J 5J1UA 2XGDA 2XPUA 1QPIA 1TWGJ 2XB0X 5FJ8J 5FKNA 2X6OA 1MSEC 2FQ4A 2X9DA 3HOUJ 3FIWA 5HODA 5IOYA 2JMWA 1Z77A 4FE7A 3HOVJ 2XGEA 4DZPA 2HI3A 3K7AJ 1K83J 1QRYA 2COBA 3O8GA 4B3AA 1HLVA 4C3HJ 1ZQ3P 1B8IA 2IEKA 2EZLA 3UKGA 1JKPC 2LTPA 2DN0A 1E3OC 5J3LA 4C2MJ 5C4JJ 2GM4A 1Y1VJ 2LLKA 4JP0A 1QVTA 4D5FA 1MBEA 3LSJA 4CYCA 3S1NJ 2WAQN 1MBFA 1RESA 5FKKA 1YRNA 1RKTA 2PMZN 3D1NI 5GPAA 3H3VK 1G2HA 3M3YJ 2HOAA 3A02A 2R5YA 2MW8A 1T56A 3S2DJ 2XRLA 5E3MA 3FK7A 4XRMA 2WV1A 2LY9A 1D5YA 5IYBJ 1K61A 1JT0A 3GBGA 1ETYA 1AKHB 4XICA 5FLVA 3C2BA 2NOGA 4A3DJ 1BW5A 2WB1N 3BR0A 3FK6A 1VNDA 2JA6J 1NTCA 1B8IB 1S7EA 4AUXA 5C44J 4D7NA 3BG3A 1JKQC 2E2HJ 2YUSA 4DYQA 4MFDA 1APLC 3BR1A 4FE4A 2EQRA 2EZKA 4BBRJ 3HEFA 3HOWJ 1ETXA 4CYCB 2EBIA 2XGCA 3HKZN 5K7ZA 4UUSA 1VI0A 4M6VA 3G1MA 1YRNB 2O7OA 2HXIA 2NVYJ 2R5YB 4X1EA 1T33A 3ZQIA 2DMNA 3BQYA 5DTDA 3ZQHA 5IPAA 1RR7A 4M3FA 2FD5A 2Y30A 1WI3A 2NVXJ 4FTHA 4BBSJ 1OCPA 4A93J 1JTXA 2N8GA 4V2FA 3JRFA 3PO2J 4JX4A 3ZOBA 2TRTA 3TW7A 1ETKA 3VPRA 1FEXA 2CUEA 2DA1A 5IOZA 2LVSA 3IV5A 4ABZA 5EG0A 3HM5A 3BR3A 5IP6A 2IBDA 2VUMJ 2HXOA 1WH5A 1UHSA 1ETWA 1UG2A 3ZQCA 1OJLA 4UUSB 1ZR2A 2JA5J 2LFBA 2R92J 2QCOA 3MKLA 1HCRA 5BNGA 4M3EA 3S14J 3SDGA 2LKXA 1IGNA 1GDTA 2M9HA 4QIWN 4BY1J 1ETQA 3NARA 2DJNA 1BJZA 3BTIA 1Q1VA 4A3KJ 2HOTA 3CDLA 4IHXA 1TWCJ 3HOXJ 1JT6A 1GUUA 2CQXA 4DW6A 3ZQLA 3JREA 4A3IJ 1ZGWA 1XC5A 1ZTRA 5IYCJ 2LK2A 2E19A 4BKXA 4A3EJ 5EZGA 4QTRA 2NVTJ 3RKQA 3BG5A 3WHCA 1BW6A 5F0CA 2VKEA 3FKIJ 4DZJA 2DMPA 3LOCA 5M3MJ 1NK2P 2HYJA 1TWAJ 3GTQJ 2DMQA 4C3IJ 2MSYA 4MLOA 1VFCA 5F0HA 2IAIA 3OIOA 5K7FA 4DYCA 4XIDA 4A3LJ 3SFIA 4GFBA 3LNQA 3HGYA 3NAUA 2CUFA 3RZOJ 5EYRA 5E3LA 1OCTC 4DYRA 3LSPA 1R9TJ 2Y31A 5IP7J 2DMUA 2L0KA 3I4NJ 1ETOA 3RZDJ 3M4OJ 2EZIA 3OSGA 3JRCA 3GTPJ 2DA5A 1IRZA 4Y52J 1B72A 5F1JA 2XPVA 4RBOA 4AYBN 2CRGA 1SFOJ 2DA6A 5M5XJ 1JKRC 1A5JA 3B6CA 2FX0A 1W0TA 1JGGA 1SANA 4UUTA 1IG7A 2CQQA 3BTJA 2RAEA 1AHDP 2HQ5A 1X2MA 2M34A 4B1RA 4A69C 2CU7A 1ENHA 2E2IJ 5M5WJ 4A3MJ 3Q0WA 4BY7J 3S1MJ 5C3EJ 3F0CA 4W1UA 5M5YJ 4M3BA 2JK3A 3JRBA 1I3QJ 5DS9A 4MIMA 1RKWA 5C4XJ 3JRHA 2VPRA 5JLWA 2R93J 1BL0A 2FJ1A 1H88C 2B63J 3L1PA 2LP0A 4AC0A 1GVDA 3S17J 5FKOA 2TCTA 4IEJA 5EGOA 3G1OA 4FISA 2M2EA 5F27A 2XPWA 4XRSA 3BR6A 3LSGA 1RETA 4M3DA 2H8RA 1H89C 2E1OA 3MN2A 1AU7A 3HOZJ 1MH3A 3JRAA 2NS8A 1FJLA 3TP0A 4I76A 2DA3A 3Q0VA 2X48A 1ZR4A 3JRIA 4G12A 3GTOJ 2VKVA 1JJ8C 3I4MJ 3IH2A 1H8AC 3S1QJ 1WGXA 3B6AA 3BTLA 4Y7NJ 4A3CJ 1GV5A 5F0FA 3HDDA 2M0CA 2K9SA 5EEAA 5EGOB 1JUSA 2KT0A 2D5VA 1FTTA 2EZHA 2ZB9A 3HOYJ 1POGA 4D5CA 3ZQGA 1JTYA 1UMQA 2JWTA 2K40A 1VF9A 1FIAA 2YS9A 3H0GJ 1Y1WJ 1I6HJ 3LSRA 1LE8A 2DA7A 1IUFA 2NVQJ 4MO7A 1X2NA 3CMYA 5EF6A 3W6VA 3GTMJ 1IDZA 2R5ZA 1U9NA 5EG0B 1IC8A 4XK4A 2DA2A 3E7LA 3OSFA 5GPCA 3HGGA 4A3GJ 5K7HA 1IJWC 4JYKA 5M3FJ 5IYDJ 2NS7A 1ORKA 1W0UA 4M3GA 1FTZA 3BQZA 2LD5A 4EEFG 3GTLJ 2DMTA 2ME6A 1P7IA 3MVPA 5FKLA 3QPSA 2O9LA 4RDUA 1MBKA 4J19A 1ZKGA 3GTGJ 2ECBA 2MG4A 1ETVA 4W97A 3A01A 2Y9YA 1CQTA 4IHVA 1F36A 2K9QA 3DEWA 3IH4A 2QF7A 3PM1A 2AHQA 1LE8B 2OF7A 1JUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK3 P;  1JUP A;  3TW6 A;  1TWH J;  2EH3 A;  2VI6 A;  3G1L A;  1TWF J;  2G0E A;  2R5Z B;  1XS9 A;  1AKH A;  2Y2Z A;  4X6A J;  2HOS A;  2H1K A;  2ID6 A;  1U8B A;  2L9R A;  4IHW A;  3PO3 J;  1HF0 A;  2DA4 A;  3BR5 A;  1ZK8 A;  3CQZ J;  1U78 A;  1HDP A;  1TC3 C;  3Q3S A;  9ANT A;  3JRG A;  5GP9 A;  1BA5 A;  1DU6 A;  2DTZ A;  4XRS G;  3BG9 A;  1RPW A;  1DU0 A;  5E3O A;  4NDL A;  3ZQF A;  1ITY A;  2K9N A;  1MSF C;  3JRD A;  1QVU A;  2OPT A;  2ECC A;  2L7Z A;  4QSH A;  3A01 B;  4A3J J;  1MBJ A;  1Z0X A;  3S2H J;  3S15 J;  3GTJ J;  2JJ7 A;  2Y0S N;  1GV2 A;  2CJJ A;  3QPL A;  4C3J J;  4I6Z A;  3SJM A;  1HOM A;  3BT9 A;  5JLX A;  3TED A;  5F04 A;  4D7M A;  1JKO C;  5F08 A;  2HDD A;  3RQI A;  1B72 B;  2AO9 A;  4HNV A;  1LFB A;  1EF4 A;  3Q0U A;  1MBH A;  2KDZ A;  2ID3 A;  1WCM J;  1JJ6 C;  3CCY A;  1HDD C;  2Y9Z A;  5FKM A;  4JX5 A;  2R7Z J;  5J1Y A;  2L7M P;  4LOC A;  1MBG A;  1WH7 A;  2I10 A;  3HB9 A;  5E3N A;  3S1R J;  4L5E A;  3OOU A;  4FCY A;  5FLM J;  2LR8 A;  2XSD C;  2JA7 J;  5IP9 J;  4A3B J;  3HBL A;  2ME0 A;  3S16 J;  2L7F P;  3K2A A;  4A3F J;  2JN6 A;  1PUF A;  2W48 A;  2E2J J;  2XB5 A;  4IHY A;  4V2G A;  3BTC A;  3DCF A;  2ELK A;  4JX6 A;  1X58 A;  2GBY A;  1OFC X;  3WHB A;  3A03 A;  1WPK A;  2GLO A;  3QQA A;  3FIS A;  5J1R A;  2MGQ A;  2JA8 J;  3GTK J;  1GT0 C;  4MFE A;  3O8H A;  1FIP A;  3BR2 A;  4B4C A;  1I50 J;  2P81 A;  1IV6 A;  2R0Q C;  4BXX J;  1MNM C;  1XG1 A;  1MH4 A;  3TP3 A;  1O4X A;  1A6I A;  1U9O A;  3JR9 A;  1LFU P;  1F43 A;  2O8K A;  5EDN A;  5EZH A;  1IDY A;  1P7J A;  2M8G X;  1PUF B;  3IH3 A;  4S0H B;  2YU9 J;  5J1U A;  2XGD A;  2XPU A;  1QPI A;  1TWG J;  2XB0 X;  5FJ8 J;  5FKN A;  2X6O A;  1MSE C;  2FQ4 A;  2X9D A;  3HOU J;  3FIW A;  5HOD A;  5IOY A;  2JMW A;  1Z77 A;  4FE7 A;  3HOV J;  2XGE A;  4DZP A;  2HI3 A;  3K7A J;  1K83 J;  1QRY A;  2COB A;  3O8G A;  4B3A A;  1HLV A;  4C3H J;  1ZQ3 P;  1B8I A;  2IEK A;  2EZL A;  3UKG A;  1JKP C;  2LTP A;  2DN0 A;  1E3O C;  5J3L A;  4C2M J;  5C4J J;  2GM4 A;  1Y1V J;  2LLK A;  4JP0 A;  1QVT A;  4D5F A;  1MBE A;  3LSJ A;  4CYC A;  3S1N J;  2WAQ N;  1MBF A;  1RES A;  5FKK A;  1YRN A;  1RKT A;  2PMZ N;  3D1N I;  5GPA A;  3H3V K;  1G2H A;  3M3Y J;  2HOA A;  3A02 A;  2R5Y A;  2MW8 A;  1T56 A;  3S2D J;  2XRL A;  5E3M A;  3FK7 A;  4XRM A;  2WV1 A;  2LY9 A;  1D5Y A;  5IYB J;  1K61 A;  1JT0 A;  3GBG A;  1ETY A;  1AKH B;  4XIC A;  5FLV A;  3C2B A;  2NOG A;  4A3D J;  1BW5 A;  2WB1 N;  3BR0 A;  3FK6 A;  1VND A;  2JA6 J;  1NTC A;  1B8I B;  1S7E A;  4AUX A;  5C44 J;  4D7N A;  3BG3 A;  1JKQ C;  2E2H J;  2YUS A;  4DYQ A;  4MFD A;  1APL C;  3BR1 A;  4FE4 A;  2EQR A;  2EZK A;  4BBR J;  3HEF A;  3HOW J;  1ETX A;  4CYC B;  2EBI A;  2XGC A;  3HKZ N;  5K7Z A;  4UUS A;  1VI0 A;  4M6V A;  3G1M A;  1YRN B;  2O7O A;  2HXI A;  2NVY J;  2R5Y B;  4X1E A;  1T33 A;  3ZQI A;  2DMN A;  3BQY A;  5DTD A;  3ZQH A;  5IPA A;  1RR7 A;  4M3F A;  2FD5 A;  2Y30 A;  1WI3 A;  2NVX J;  4FTH A;  4BBS J;  1OCP A;  4A93 J;  1JTX A;  2N8G A;  4V2F A;  3JRF A;  3PO2 J;  4JX4 A;  3ZOB A;  2TRT A;  3TW7 A;  1ETK A;  3VPR A;  1FEX A;  2CUE A;  2DA1 A;  5IOZ A;  2LVS A;  3IV5 A;  4ABZ A;  5EG0 A;  3HM5 A;  3BR3 A;  5IP6 A;  2IBD A;  2VUM J;  2HXO A;  1WH5 A;  1UHS A;  1ETW A;  1UG2 A;  3ZQC A;  1OJL A;  4UUS B;  1ZR2 A;  2JA5 J;  2LFB A;  2R92 J;  2QCO A;  3MKL A;  1HCR A;  5BNG A;  4M3E A;  3S14 J;  3SDG A;  2LKX A;  1IGN A;  1GDT A;  2M9H A;  4QIW N;  4BY1 J;  1ETQ A;  3NAR A;  2DJN A;  1BJZ A;  3BTI A;  1Q1V A;  4A3K J;  2HOT A;  3CDL A;  4IHX A;  1TWC J;  3HOX J;  1JT6 A;  1GUU A;  2CQX A;  4DW6 A;  3ZQL A;  3JRE A;  4A3I J;  1ZGW A;  1XC5 A;  1ZTR A;  5IYC J;  2LK2 A;  2E19 A;  4BKX A;  4A3E J;  5EZG A;  4QTR A;  2NVT J;  3RKQ A;  3BG5 A;  3WHC A;  1BW6 A;  5F0C A;  2VKE A;  3FKI J;  4DZJ A;  2DMP A;  3LOC A;  5M3M J;  1NK2 P;  2HYJ A;  1TWA J;  3GTQ J;  2DMQ A;  4C3I J;  2MSY A;  4MLO A;  1VFC A;  5F0H A;  2IAI A;  3OIO A;  5K7F A;  4DYC A;  4XID A;  4A3L J;  3SFI A;  4GFB A;  3LNQ A;  3HGY A;  3NAU A;  2CUF A;  3RZO J;  5EYR A;  5E3L A;  1OCT C;  4DYR A;  3LSP A;  1R9T J;  2Y31 A;  5IP7 J;  2DMU A;  2L0K A;  3I4N J;  1ETO A;  3RZD J;  3M4O J;  2EZI A;  3OSG A;  3JRC A;  3GTP J;  2DA5 A;  1IRZ A;  4Y52 J;  1B72 A;  5F1J A;  2XPV A;  4RBO A;  4AYB N;  2CRG A;  1SFO J;  2DA6 A;  5M5X J;  1JKR C;  1A5J A;  3B6C A;  2FX0 A;  1W0T A;  1JGG A;  1SAN A;  4UUT A;  1IG7 A;  2CQQ A;  3BTJ A;  2RAE A;  1AHD P;  2HQ5 A;  1X2M A;  2M34 A;  4B1R A;  4A69 C;  2CU7 A;  1ENH A;  2E2I J;  5M5W J;  4A3M J;  3Q0W A;  4BY7 J;  3S1M J;  5C3E J;  3F0C A;  4W1U A;  5M5Y J;  4M3B A;  2JK3 A;  3JRB A;  1I3Q J;  5DS9 A;  4MIM A;  1RKW A;  5C4X J;  3JRH A;  2VPR A;  5JLW A;  2R93 J;  1BL0 A;  2FJ1 A;  1H88 C;  2B63 J;  3L1P A;  2LP0 A;  4AC0 A;  1GVD A;  3S17 J;  5FKO A;  2TCT A;  4IEJ A;  5EGO A;  3G1O A;  4FIS A;  2M2E A;  5F27 A;  2XPW A;  4XRS A;  3BR6 A;  3LSG A;  1RET A;  4M3D A;  2H8R A;  1H89 C;  2E1O A;  3MN2 A;  1AU7 A;  3HOZ J;  1MH3 A;  3JRA A;  2NS8 A;  1FJL A;  3TP0 A;  4I76 A;  2DA3 A;  3Q0V A;  2X48 A;  1ZR4 A;  3JRI A;  4G12 A;  3GTO J;  2VKV A;  1JJ8 C;  3I4M J;  3IH2 A;  1H8A C;  3S1Q J;  1WGX A;  3B6A A;  3BTL A;  4Y7N J;  4A3C J;  1GV5 A;  5F0F A;  3HDD A;  2M0C A;  2K9S A;  5EEA A;  5EGO B;  1JUS A;  2KT0 A;  2D5V A;  1FTT A;  2EZH A;  2ZB9 A;  3HOY J;  1POG A;  4D5C A;  3ZQG A;  1JTY A;  1UMQ A;  2JWT A;  2K40 A;  1VF9 A;  1FIA A;  2YS9 A;  3H0G J;  1Y1W J;  1I6H J;  3LSR A;  1LE8 A;  2DA7 A;  1IUF A;  2NVQ J;  4MO7 A;  1X2N A;  3CMY A;  5EF6 A;  3W6V A;  3GTM J;  1IDZ A;  2R5Z A;  1U9N A;  5EG0 B;  1IC8 A;  4XK4 A;  2DA2 A;  3E7L A;  3OSF A;  5GPC A;  3HGG A;  4A3G J;  5K7H A;  1IJW C;  4JYK A;  5M3F J;  5IYD J;  2NS7 A;  1ORK A;  1W0U A;  4M3G A;  1FTZ A;  3BQZ A;  2LD5 A;  4EEF G;  3GTL J;  2DMT A;  2ME6 A;  1P7I A;  3MVP A;  5FKL A;  3QPS A;  2O9L A;  4RDU A;  1MBK A;  4J19 A;  1ZKG A;  3GTG J;  2ECB A;  2MG4 A;  1ETV A;  4W97 A;  3A01 A;  2Y9Y A;  1CQT A;  4IHV A;  1F36 A;  2K9Q A;  3DEW A;  3IH4 A;  2QF7 A;  3PM1 A;  2AHQ A;  1LE8 B;  2OF7 A;  1JUM A; 
#chains in the Genus database with same CATH topology
 2M87 A;  3HRT A;  1LKX A;  3U1K A;  1JUP A;  3OWT A;  2B0L A;  4NB5 A;  1TWF J;  3H9J A;  3CME I;  1NH3 A;  1XS9 A;  1AKH A;  2Y2Z A;  3R60 A;  3ZMD A;  3WTZ A;  3OR1 C;  2BVM A;  3G71 I;  2HOS A;  4XMY A;  5LHH A;  3K70 C;  4ENN A;  4XLE A;  1U8B A;  5DUK A;  2K7L A;  3BR5 A;  2UUZ A;  5HVQ C;  1BI2 A;  2G7U A;  1IXS B;  1TC3 C;  4Q48 A;  2FXA A;  1BA5 A;  2L2O A;  4HNU A;  1L0O C;  3V7R A;  1YJW I;  4AYB A;  4OAY A;  3RTR A;  4NHJ A;  3KCC A;  1KYW A;  3ZQF A;  1ITY A;  2W57 A;  5F6F A;  2RQP A;  4CCK A;  4G9Y A;  1MSF C;  4QSH A;  2MD5 A;  4CXF A;  2W00 A;  4I99 C;  2LNB A;  1Z0X A;  2VE9 A;  2BE5 F;  5E20 A;  2XF6 A;  2W84 A;  4XN3 A;  1TNT A;  2DU9 A;  2DO7 A;  5EEG A;  4BE0 A;  1KON A;  1T2K A;  3IHU A;  4YFX F;  3GVA A;  3RKX A;  4PSX A;  1TBX A;  2DJI A;  2DFH A;  2H09 A;  4Y15 A;  4F55 A;  1REP C;  3WTT C;  3I4P A;  3I64 A;  1YJN I;  2M8E A;  1QZZ A;  1DPR A;  2KPM A;  3CO7 C;  2HZT A;  4D9J A;  3G6E I;  3TO9 A;  2Z2S B;  1TTY A;  1UB9 A;  1SFK A;  3H1C A;  1HDD C;  2ZSI B;  2GIZ A;  1Y8R B;  2CSO A;  1AA7 A;  4UVB A;  1J5Y A;  1T8I A;  3I3L A;  4XON A;  4I02 A;  4JOM A;  2L7M P;  2VXD A;  3AG2 H;  1ZAO A;  5CQG A;  3W6K B;  3RYP A;  2A61 A;  3CTA A;  1OCO H;  3J81 K;  2IRF G;  3RPQ A;  4L5E A;  4MNU A;  3WTU C;  4G6T B;  4FCY A;  4AIJ A;  2TDX A;  3DKY A;  3HOT A;  2JA7 J;  4IQ4 A;  3QP6 A;  1J2X A;  2GOX B;  3F72 A;  2EJR A;  2ME0 A;  3B02 A;  4BHC A;  1YS7 A;  3S16 J;  4E7H A;  4A3F J;  1FOX A;  4IHY A;  2IT0 A;  4F93 B;  2GA2 A;  2CQ7 A;  3V7S A;  3BLY A;  1U0J A;  2DBB A;  2GBY A;  3WHB A;  2EFP A;  2ZME C;  5ERI A;  1WPK A;  3JSO A;  5LFA A;  2GLO A;  1LNW A;  3KFW X;  1BM9 A;  2W24 A;  4MFE A;  3O8H A;  2MYS A;  2ZXJ A;  2F5V A;  2F4M B;  2A5W A;  2LMD A;  3BR2 A;  1IF1 A;  5J4Y A;  1IV6 A;  4F92 B;  1K6Y A;  4XSX F;  3DBR B;  3KP6 A;  5FD5 A;  4DQ2 A;  3U9G A;  2MBF A;  1HQC A;  3TP3 A;  2LG4 A;  1R58 A;  3QYE A;  1DDN A;  1LFU P;  4XLH A;  3U1D A;  3I55 I;  2O8K A;  5EDN A;  3W3C A;  1R4N B;  2RQQ A;  3CC7 I;  2M30 A;  2F4I A;  4S0H B;  4BDY A;  5CLS A;  4RMN A;  2YU9 J;  3VYT B;  4ZYG A;  2IVM A;  5J1U A;  4RAG A;  2XGD A;  3ONQ A;  1QPI A;  1D8J A;  5FJ8 J;  1J59 A;  2R7D A;  2IS4 A;  3CJQ B;  5E8I A;  1RI7 A;  4EM1 A;  5DM7 F;  2PN6 A;  2V7F A;  3PQJ A;  4CUG A;  2FQ4 A;  3WGH A;  2ELH A;  1SD5 A;  3FXO A;  5HOD A;  1VQ6 I;  2RRE A;  4CHU A;  2JMW A;  5LBQ A;  3FMR A;  2R3S A;  3H5R A;  2HI3 A;  2MH9 A;  3BZC A;  3O8G A;  5HS9 A;  1LFP A;  2BV6 A;  4C3H J;  4LJZ F;  1O7F A;  2EZL A;  4O6J A;  3UKG A;  2QQ8 A;  1MD0 A;  4BYY A;  2BHY A;  1E3H A;  2H6C A;  1F4K A;  1E3O C;  2E1C A;  4ESB A;  2DYS H;  2AQF A;  4ZYE A;  1H0M A;  1EJ9 A;  4CYC A;  5B66 C;  2WAF A;  2WAQ N;  1FZP B;  3E5X A;  4XOP A;  2H8W A;  2PJR B;  1RKT A;  2XV4 S;  4MTE A;  3HG9 A;  3ZN0 A;  4EMS A;  2HOA A;  3A02 A;  5IT9 Z;  2P5V A;  4YIF A;  3DBL B;  1PP8 F;  4XRM A;  1DGR M;  3GO5 A;  2VPL A;  2WV1 A;  4DOZ A;  1KU2 A;  1D5Y A;  3MEX A;  3GBG A;  4PZJ A;  3OYI A;  1JT0 A;  3M8E A;  1NG6 A;  2ISY A;  2NOG A;  1DGW Y;  2Y0S A;  1BW5 A;  4BJT A;  2WB1 N;  3BR0 A;  3I54 A;  2JA6 J;  4BE1 A;  1RR8 C;  1S7E A;  3QPT A;  3WTV C;  2CWE A;  4D1Q A;  3RSN A;  5C44 J;  4A0Z A;  2OQG A;  4HX7 A;  2H27 A;  2YUS A;  4HNT A;  3DWL E;  2HYG D;  2DOD A;  2RN7 A;  2KMU A;  3CMM A;  2EQR A;  3TL4 X;  4O3M A;  2RNJ A;  4NBQ A;  1FOK A;  3HEF A;  2DK5 A;  3A0B C;  3JSP A;  2GZW A;  1YO5 C;  5CVR A;  4CYC B;  2EBI A;  2R7U A;  2IGN A;  3TOB A;  4UUS A;  1VI0 A;  2O7O A;  4AD9 A;  4X1E A;  1T33 A;  1Z3Y A;  5IPA A;  4AID A;  4M3F A;  1ZRC A;  4GXO A;  4IHS A;  3QP5 A;  3QYF A;  2Y30 A;  1XGO A;  2NVX J;  2FQ3 A;  4A93 J;  2R7S A;  3OV8 A;  5KK1 A;  2BHZ A;  1XGS A;  2A68 F;  4EJW A;  4JX4 A;  3ELK A;  4G7H F;  2TRT A;  2FML A;  1ETK A;  1FEX A;  2LY1 A;  4PFO A;  4UXN A;  2DW4 A;  3RI4 A;  5IOZ A;  2LVS A;  3IV5 A;  3DU5 A;  1XPX A;  4IQJ A;  4OOI A;  3ZMS A;  1SVO A;  4Y4R A;  1O3R A;  3I9V 2;  2HXO A;  4Z6Y A;  4PJN A;  1UHS A;  3AKZ A;  3ZQC A;  4PJM A;  1OJL A;  5E18 F;  3AG3 H;  3H3Z A;  4UUS B;  3J7A O;  1PDN C;  4PK4 A;  4U7B A;  1ZR2 A;  1FYK A;  1SMT A;  4A5M A;  4BUP A;  4PFP A;  4DIQ A;  4BEH A;  1R5I D;  2RDP A;  3M1C A;  2LKX A;  1FWZ A;  2M9H A;  3DF8 A;  4QIW N;  3NAR A;  4E7K A;  1U2W A;  2IP2 A;  5E79 C;  3HHH A;  3HOX J;  1JT6 A;  4DW6 A;  3ZQL A;  4LLL A;  4A3I J;  2Z5U A;  1ZGW A;  1XC5 A;  3K4C A;  4IL6 C;  5FB2 A;  4S05 A;  1MJ9 A;  2L01 A;  3R0A A;  2QSG X;  3HSF A;  3I56 I;  3MKY B;  5K5O A;  3IRR A;  4XLP F;  1VQK I;  3E6B A;  4QTR A;  2NVT J;  4LB6 B;  3BG5 A;  1J09 A;  2IXS A;  2YPR A;  2LKS A;  1OQY A;  2K9L A;  3QPH A;  3FKI J;  4BDZ A;  1QQI A;  5LD2 C;  1ZGA A;  2DMP A;  3ZGK A;  5M3M J;  2P8T A;  3A2K A;  2DMQ A;  4KN7 X;  3RPU A;  1UST A;  2MSY A;  2Q1Z B;  3FXJ A;  3T8R A;  1IRX A;  4C3I J;  4MLO A;  3JTG A;  1VFC A;  2O8X A;  3ZR8 X;  4BEH B;  1W7P A;  1WKM A;  1XTA A;  2VJ4 A;  4XL9 A;  1U5T A;  4A12 A;  5K7F A;  3SZT A;  1R1U A;  3OYD A;  3J80 Z;  4XID A;  3ZQQ A;  1R23 A;  1EH6 A;  2RNG A;  5EYR A;  2R7O A;  4B47 A;  1XMX A;  3KZY A;  3P5J A;  1SVL A;  4DYR A;  2FSW A;  3LSP A;  1OCT C;  3MWM A;  1KYZ A;  1ETO A;  2EZI A;  3OSG A;  4MHG A;  3JRC A;  1B6A A;  1FBS A;  4E7J A;  5D8L B;  1P4X A;  5K5Q A;  3OS0 A;  1BOB A;  3B6C A;  1I3A A;  2ACJ A;  2JT1 A;  1W0T A;  2E71 A;  3PL8 A;  4ENK A;  2BY1 A;  3HUG A;  4YG2 F;  2COM A;  1IG7 A;  2DFE A;  1TQI A;  1W7P B;  2RAE A;  4UHT A;  3M9A A;  2HVQ A;  2HR3 A;  1U5T B;  1P2F A;  2W4S A;  5DM6 F;  1X2M A;  4A69 C;  4KYW A;  2OU2 A;  3J81 Z;  2BGC A;  3BZ6 A;  3Q0W A;  2DT5 A;  1HKT A;  4W1U A;  2JK3 A;  1W36 C;  2DCE A;  1G8X A;  1I3Q J;  1Z21 A;  4I2O A;  4BU2 A;  3ZMU A;  1RKW A;  4Q47 A;  2VPR A;  3QOD A;  1H88 C;  3I59 A;  3VEP A;  1T08 B;  4PJ0 C;  1VQ9 I;  2HVS A;  2VLA A;  5FKO A;  2TCT A;  4IEJ A;  4QLC U;  4P9U A;  2EV6 A;  2M2E A;  2V9V A;  3BR6 A;  2E35 A;  3LSG A;  4UUV A;  4U0W A;  3L2V A;  4M72 A;  2VIX A;  2H8R A;  5FD6 A;  2XAG A;  3MZH A;  2ZJP F;  3LSI A;  5D5W B;  3HUG B;  2IGO A;  1S9H A;  5KAI C;  1FJL A;  2KRC A;  5LEJ A;  3PNV A;  3TP0 A;  4JK1 X;  3Q0V A;  3K4J A;  4CDG A;  3P9C A;  3HHG A;  2DDA A;  1ZR4 A;  3GTO J;  4G12 A;  1S5L C;  2CFO A;  3K69 A;  3IH2 A;  1H8A C;  1WGX A;  2HDC A;  3E0J B;  4R8H A;  4BS9 A;  3BTL A;  3PNT A;  5D4R A;  1WJF A;  1YW8 A;  1UAA A;  2YX7 A;  2QM3 A;  2EB7 A;  3AG1 H;  1S29 A;  3I59 B;  1RC9 A;  4A3C J;  1Y6I A;  3CJR B;  1Z05 A;  2K9S A;  3BPV A;  4RAF A;  4BQN A;  2YR2 A;  5HOO A;  4BHB A;  2H6B A;  2V79 A;  4ZYA A;  3G73 A;  3HOY J;  1K78 A;  1POG A;  4ZC3 A;  1JTY A;  2WTE A;  2Z3Y A;  3DXJ F;  4A5N A;  1JI8 A;  1VF9 A;  1FIA A;  2XKO A;  2YS9 A;  2XC7 A;  3F3X A;  4NC7 A;  1Y1W J;  1I6H J;  4KIB A;  2DA7 A;  3ZCO A;  1IUF A;  1DQU A;  4RM2 A;  3GTM J;  1FMV A;  1R00 A;  1ZG5 A;  3FXM A;  4FX0 A;  2L54 A;  1IC8 A;  4XK4 A;  2XF5 A;  2HKX A;  5K7H A;  3AL0 C;  1IJW C;  4UB8 C;  5BOX A;  4HAM A;  1Z3X A;  2DAO A;  3HTU A;  4KNY A;  2LSO A;  3L2R A;  1BI0 A;  2LD5 A;  4EEF G;  5ICC A;  3ZPL A;  2PQ8 A;  5FKL A;  3QPS A;  2W7N A;  5ICG A;  2LYC A;  4DBQ A;  2EFN A;  1ZKG A;  1BR4 A;  1MMN A;  2ECB A;  2MG4 A;  1K78 B;  1ETV A;  2MFZ A;  2Z99 A;  4GGG A;  4NUB A;  4W97 A;  3TGN A;  2OBP A;  4O5V A;  3VDX A;  4IHV A;  2DOF A;  3H5N A;  2Z33 A;  1JGS A;  2CW7 A;  3H36 A;  2EH3 A;  1X4P A;  3MZ8 A;  3A0H C;  1CGP A;  3LSH A;  3W6J B;  1D0X A;  1D1A A;  1MMA A;  4X6A J;  3LFU A;  1WJC A;  2BVL A;  2ID6 A;  2L9R A;  4IHW A;  3PO3 J;  3D5R C;  5GAG J;  1FMW A;  2DA4 A;  2LRE A;  1C0W A;  1IN8 A;  5E1X A;  4YIR X;  3JRG A;  2K9M A;  3L2W A;  2X85 A;  4EJU A;  4XRS G;  2G7H A;  4B48 A;  1R49 A;  5LHI A;  5LRR A;  3TOA A;  5D5V B;  1P6R A;  2STT A;  3CUQ A;  2GQQ A;  1QVU A;  5JFR A;  3DLL F;  4AIK A;  4B43 A;  1YIO A;  3WTY C;  4E4H A;  2LC2 A;  2R4G A;  1A36 A;  1B1B A;  3S15 J;  2CQK A;  4Y17 A;  1HXD A;  1OPC A;  2VT2 A;  4UV9 A;  1T6S A;  3QPL A;  4C3J J;  5HNF A;  4I6Z A;  3SJM A;  3OS1 A;  3TED A;  5JLX A;  4FT8 A;  2IW5 A;  5F04 A;  3T1B A;  4D7M A;  2QKM B;  3ZMT A;  1YFH A;  1MMD A;  2L9N A;  3JCU C;  1B72 B;  2X51 A;  1PUE E;  2AO9 A;  1G3Y A;  1LFB A;  3I5U A;  3Q0U A;  2OZ6 A;  1MBH A;  4QPQ A;  2Q8K A;  2ID3 A;  4MQV A;  1VTN C;  3LST A;  3TO7 A;  3WGI A;  5HS8 A;  2A6H F;  5LHG A;  3CCY A;  4YFK F;  1LJ9 A;  4OU0 A;  4RGX A;  3R4K A;  2ZJ2 A;  3K6G A;  1FPQ A;  1SVM A;  3GZ6 A;  3ZRG A;  3CLO A;  3CUQ B;  1MBG A;  5ILU A;  3CCL I;  1FC3 A;  1TP4 A;  4RB2 C;  3HB9 A;  3WE3 A;  2EFQ A;  1UCR A;  2CGP A;  4HEA 2;  2UXN A;  1Y8Q B;  2XSD C;  5IP9 J;  3F8M A;  1K6O A;  3HZJ A;  3QYB A;  3HBL A;  5JI6 A;  3VWB A;  2E5N A;  2JN6 A;  2W48 A;  2XB5 A;  5JHU A;  4BAC A;  2QYO A;  1QGP A;  2PMH A;  3DCF A;  2ELK A;  5B3S H;  5HLH A;  3AL0 B;  4U7D A;  3S3N A;  3FIS A;  3OYF A;  1ZN2 A;  3MQ0 A;  1IN4 A;  3KYD B;  4HG2 A;  1UG0 A;  2JPC A;  1XMK A;  5IY5 H;  4B4C A;  1I50 J;  2E60 A;  2P81 A;  2XUB A;  2X1C A;  3HPG A;  4G6Q A;  1MNM C;  1XG1 A;  1MH4 A;  3TO6 A;  1S72 I;  3G2B A;  5FRM A;  1G3W A;  4UB6 C;  4XKB A;  2VBX A;  3FF5 A;  3IKV A;  1U9O A;  1VQL I;  1F43 A;  1P7J A;  3CCQ I;  2M8G X;  1D1B A;  1X1A A;  2GXG A;  2W25 A;  4UVC A;  1TQP A;  4RLQ A;  2MD0 A;  2M45 A;  3KE2 A;  5FFX A;  4XQF A;  2F5C A;  3KEY A;  1XX5 A;  3A4C A;  2FE3 A;  4XN0 A;  4E6K G;  2XB0 X;  2VKH A;  5FKN A;  2P4W A;  4KIS A;  3EDP A;  2X6O A;  4M9X A;  2EPF A;  2XDV A;  3CJT B;  3FXR A;  1ZRE A;  2R7X A;  1LDD A;  2Y69 H;  1ZGJ A;  2QUF A;  5E17 F;  1Z77 A;  4Y3O A;  3HOV J;  2XGE A;  5L3F A;  1K83 J;  1QRY A;  1XDU A;  4E7S A;  4ITV A;  1HLV A;  4FAS D;  2IEK A;  1LVA A;  1HW5 A;  4HDU A;  2HGC A;  2LTP A;  1CF7 A;  1K4T A;  5ICF A;  4KIC A;  3DKW A;  4EVI A;  4CZC A;  1S3J A;  4AIH A;  4AWX B;  2STW A;  4D5F A;  1FOY A;  2DPU A;  1VQP I;  4BQA A;  3F23 A;  1P4A A;  1RES A;  1XGM A;  2PMZ N;  1G2H A;  1O3Q A;  3M3Y J;  2K85 A;  2IJL A;  1OCC H;  3SDB A;  5JVT A;  3J80 K;  2FBI A;  4MTD A;  3PFI A;  2MW8 A;  1T56 A;  1MNE A;  4ZJZ A;  3VYR B;  3S2D J;  1T0F A;  5LGN A;  3PSI A;  1ZRF A;  5E8G A;  2AQE A;  3IP4 B;  1KQ0 A;  1K61 A;  2J5P A;  2ELJ A;  1AKH B;  3C2B A;  1GXQ A;  2K5C A;  4A3D J;  3LA2 A;  2K4J A;  3N05 A;  3WTX C;  5F64 A;  4KUM A;  2VOO A;  4GO1 A;  1XCB A;  3IAM 2;  4BQQ A;  2W85 A;  3FBI B;  4KMF A;  1Z7L A;  3TMO A;  2Y0M A;  4AUX A;  3GZN B;  3AG4 H;  3BG3 A;  4L5J A;  1JKQ C;  5JHF A;  1CF7 B;  4DYQ A;  2E2H J;  3K1N A;  4MFD A;  4B3X A;  2LF8 A;  4G7Z F;  3B73 A;  3ESW B;  1D5V A;  3HOW J;  1ULY A;  1AWC A;  2FNA A;  2XGC A;  3HKZ N;  3SYT A;  3G1M A;  3DFG A;  1P4W A;  2NOJ B;  4ZH4 F;  4LLG F;  2V6E A;  2VL8 A;  4OAZ A;  3FBN B;  3ZQI A;  2DMN A;  4B09 A;  5L3E A;  1HKQ A;  3HPH A;  2EK5 A;  1TQM A;  2QWW A;  2E1N A;  2ZFU A;  3E6M A;  1LVK A;  1QHH D;  1Z6T A;  1B9M A;  3OYN A;  1Y39 A;  1BC7 C;  4FTH A;  4BBS J;  1OCP A;  4V2F A;  1A04 A;  3PO2 J;  4HLX A;  5GAD J;  3CC2 I;  3ML6 A;  4M71 A;  1YTY A;  2VOP A;  1BI3 A;  1FBQ A;  4PDK A;  1B4A A;  2V9K A;  3NWT A;  4XKW A;  3W2W A;  3ZMV A;  4ABZ A;  3HM5 A;  5EG0 A;  3IAS 2;  4IF4 A;  4WK8 F;  2VXZ A;  3N4M A;  1VQ4 I;  1ETW A;  2DK8 A;  1EH7 A;  4WX9 A;  3NEU A;  2JA5 J;  1PP7 U;  3DU6 A;  2QCO A;  3Q9S A;  3CCU I;  1HC8 A;  2CV1 A;  4M3E A;  4CCN A;  1GDT A;  3S8P A;  2XF7 A;  4I7H A;  3ZQ7 A;  2K27 A;  2ZKZ A;  2PX9 A;  3DTE A;  1ODD A;  4IHX A;  2HOT A;  2BW3 A;  3SZG A;  2KJC A;  3K2Z A;  1GUU A;  4B8X A;  3JRE A;  4ZYH A;  4II2 A;  4MEX F;  5KAF C;  4F7Z A;  4WCG A;  2LK2 A;  2ZXW H;  3L7W A;  1ZYR F;  4ANJ A;  5ILS A;  2FU4 A;  5TJJ A;  2JTV A;  2ZSH B;  2DPD A;  2BZT A;  3WHC A;  2P6T A;  3SFZ A;  4XNF A;  1E0E A;  1T38 A;  2VKE A;  3KP7 A;  2UXX A;  4NQW A;  5D8K B;  5ED4 A;  3QAH A;  2EIJ H;  4WF2 A;  2VB6 A;  2E5Z A;  2L4A A;  3LAJ A;  3PSF A;  1R1T A;  4CGZ A;  1KA8 A;  3HYI A;  5F0H A;  4ASN A;  3S32 A;  2OV7 A;  2VBZ A;  2UV1 A;  4XKV A;  2UZK A;  4GYG A;  4DYC A;  5LGU A;  4BH9 A;  3SFI A;  3IWZ A;  3LNQ A;  4AVZ A;  2O5R A;  2BW3 B;  2CUF A;  3KP4 A;  1X3W B;  1R9T J;  2DMU A;  3NQO A;  4Q4Z F;  1D8K A;  1IXC A;  3E97 A;  3GTP J;  2V9P A;  2V1X A;  5F1J A;  3M8F A;  4XBF A;  4RBO A;  4AYB N;  2CO5 A;  2IS2 A;  4DJA A;  3ZP5 A;  2ISZ A;  4NQW B;  2VN2 A;  3W2A A;  3F22 A;  3CP8 A;  3J7Z I;  2DT6 A;  3FM5 A;  2Q0O A;  1W5C C;  3EYY A;  3K1P A;  1MMS A;  3PJR A;  1SFE A;  4PGG A;  4JBA A;  4IX7 A;  1XSV A;  3KX2 A;  1AHD P;  2EV5 A;  3FKJ A;  4LFU A;  4XOT A;  5H2F C;  4E7Z A;  2VJI A;  2M34 A;  3BPX A;  3FMS A;  1YYV A;  1ENH A;  3E6D A;  4GYI A;  2E2I J;  1VZ0 A;  5CVU A;  2X1D A;  4BY7 J;  3FDY A;  5C3E J;  1FP1 D;  1YW7 A;  3W2V A;  1UHW A;  1OCR H;  1VQM I;  4H4K C;  4MIM A;  1O57 A;  3PFY A;  1FX7 A;  2KL4 A;  2L5Q A;  2B63 J;  3PIP F;  1U5T C;  4AC0 A;  4IJA A;  3HL2 A;  2E1M B;  3ABM H;  3HJE A;  2DI3 A;  4G6D A;  4L9N A;  2L3D A;  2DYR H;  1YG2 A;  3V4G A;  4N9I A;  3ROU A;  2L02 A;  5KNL A;  4UVA A;  1V4R A;  5HDK A;  3SEQ A;  2HOE A;  4M3D A;  3WU1 B;  2QEX I;  1I6X A;  2KIQ A;  2NRA C;  3HOZ J;  5J4V A;  3FZV A;  2VQH A;  2UWM A;  3BP8 A;  3JRA A;  5HLI A;  2BXZ A;  2NS8 A;  2CUJ A;  1GVJ A;  3F6V A;  2IA2 A;  3RIR A;  5FFZ A;  2X48 A;  5DV5 A;  1O3S A;  1KQ8 A;  5ICE A;  2FF4 A;  4ZZL A;  3BWG A;  1A6Q A;  3BCB A;  1MW7 A;  3B6A A;  2EWN A;  2E7W A;  4M6Y A;  1LB2 A;  2ZC2 A;  1X1P A;  3HDD A;  1KU9 A;  2M0C A;  1TL8 A;  5EEA A;  4RGU A;  4EGY A;  1ERD A;  1D0Y A;  2FMY A;  2GWR A;  4BXU A;  1X1C A;  1KGS A;  2D5V A;  2VC1 A;  2KRF A;  1FYL A;  3K4M A;  2VE8 A;  3H9Q A;  1GHC A;  3I53 A;  2RVC A;  1UMQ A;  3T0Y A;  3LSR A;  1J7K A;  1QZY A;  2NVQ J;  3U2R A;  2JUC A;  4MO7 A;  5HLT A;  2OC6 A;  1Z6R A;  1X2N A;  2ZBK A;  5EF6 A;  2P5K A;  4N0B A;  5HNH A;  3PIO F;  2Z1D A;  2V4J C;  4L0Y B;  4R1H A;  3IRQ A;  3IC7 A;  4A3G J;  2KFD A;  5M3F J;  4LK1 F;  3ABU A;  2NS7 A;  2R7V A;  5EJC A;  3BQZ A;  3DEE A;  2VOD A;  4I0B A;  4OWR B;  1NHA A;  2O9L A;  2OQR A;  1LPQ A;  4RDU A;  1MBK A;  1IZ1 A;  1STZ A;  4J19 A;  2X4H A;  3KLO A;  4A0X A;  3AAF A;  1XSX A;  1TZL A;  3A01 A;  5HLG A;  4RLF A;  2K3P A;  2L7K A;  2HU9 A;  2V6C A;  2QF7 A;  3PM1 A;  2AHQ A;  3CMY A;  1N75 A;  1YJ9 I;  4IHT A;  2XSJ C;  2VI6 A;  1OR7 C;  3G1L A;  5JVG F;  2OUM A;  3EUA A;  3ZMZ A;  2QEN A;  5ILV A;  3GUD A;  3EQL F;  2K3F A;  3PQK A;  3IKT A;  5CVI A;  1WJ5 A;  3SZP A;  1HF0 A;  1S8N A;  1ZK8 A;  4X0G A;  1HDP A;  3HOS A;  3Q3S A;  2HEO A;  3DKX A;  1DP7 P;  2DTZ A;  1XCV A;  2ETH A;  3BG9 A;  1BI1 A;  1DU0 A;  5E3O A;  2G9W A;  5EEH A;  4NDL A;  4Y13 A;  5A2Q Z;  2MLG A;  3EPZ A;  1LQ1 A;  2NAZ A;  1A35 A;  2O3F A;  3A01 B;  1N77 A;  5LLQ A;  1FY7 A;  2W82 A;  4HW0 A;  3KPH A;  3GEZ A;  2V1N A;  3TQN A;  4HQE A;  4C2U A;  3GTJ J;  1TT5 B;  2JJ7 A;  2Y0S N;  2EA4 A;  5FGM A;  1MIJ A;  2HZD A;  3F8C A;  4AM3 A;  5K1Y A;  4L5I A;  3QU3 A;  4HPQ A;  3BT9 A;  2R7T A;  2LBF A;  2NYX A;  2X6X A;  4EAT A;  1JKO C;  1UHM A;  2K4B A;  4MEY F;  5F08 A;  1ZLK A;  2HDD A;  3RQI A;  5FO5 A;  2EV0 A;  1R6R A;  3LA7 A;  4TV7 A;  1OYW A;  4ETS A;  4HNV A;  1I5Z A;  2CYY A;  1T39 A;  4U88 A;  1EF4 A;  4XLF A;  5DCF A;  2A07 F;  3OYH A;  4FX4 A;  1L3L A;  1QZE A;  4KIF A;  1FOW A;  2ICW G;  1W1W E;  4KT6 A;  4JX5 A;  3ZN1 A;  4LIU A;  4ZTJ A;  3LSK A;  3V7C A;  5J1Y A;  2IA0 A;  3ASN H;  3KLN A;  4LOC A;  1G3T A;  3IL2 A;  3F8B A;  4BXF A;  1WH7 A;  2WA0 A;  5L3C A;  1GXP A;  5E3N A;  4QWQ A;  4HRI A;  5IT3 A;  1XD7 A;  3OOU A;  1BJA A;  5FLM J;  1Z67 A;  1R71 A;  3IWF A;  4L18 B;  2LR8 A;  1ON2 A;  2LBF B;  4A3B J;  3CUQ C;  1WQ2 A;  1G6N A;  2FBH A;  4CCL A;  2L7F P;  3D5S C;  3K2A A;  5DCM A;  2E7X A;  4EM0 B;  5L3B A;  2LRD A;  3CCV I;  1O3T A;  2E2J J;  4V2G A;  3BTC A;  4HST A;  1OR7 A;  2W1O A;  3OYM A;  1ZG1 A;  2K02 A;  4XOR A;  4LG0 A;  1ACI A;  4JX6 A;  2HYF A;  1X58 A;  1OFC X;  1LDJ A;  1R5G A;  1YIT I;  1ZH5 A;  3GFI A;  2ESH A;  3QQA A;  3QU6 A;  3S93 A;  2MGQ A;  4DGW B;  2JA8 J;  3LMM A;  1QO0 D;  1R7J A;  3V8L A;  3VFZ A;  2QZ8 A;  3C3W A;  4CSW A;  1FIP A;  3ABT A;  6PAX A;  4HSR A;  2J5O A;  3EUH C;  1IV8 A;  3FWE A;  5DUI A;  2FOK A;  2XAQ A;  3OR2 C;  4ESJ A;  1HST A;  1V5F A;  2M7A A;  4IOA F;  1O4X A;  3CD6 I;  3BJA A;  3QOP A;  2IS1 A;  5DCM B;  5EZH A;  1IDY A;  1W4M A;  4Q5S F;  4JQF A;  3IH3 A;  3CJN A;  4IRH A;  4XSZ F;  2JVG A;  4IZZ A;  4BQO A;  4LG0 B;  5LEK A;  2XPU A;  1R1V A;  4QPO A;  4GDF A;  1I39 A;  3D5L A;  2XIG A;  4XLC A;  2ZNZ A;  1ONV A;  5FRN A;  2EIL H;  2KRH A;  3SXY A;  1N78 A;  1E17 A;  2A6E F;  3HOU J;  2HQR A;  3OYL A;  1HW2 A;  3FIW A;  4E7L A;  2RV8 A;  1JHH A;  3H92 A;  3WTW C;  1YHQ I;  5IOY A;  3WU0 A;  2X1E A;  1XGN A;  4DZP A;  3BCA A;  2XAF A;  3RKY A;  3K7A J;  3OYG A;  2COB A;  3H0D A;  1KU7 A;  2MAB A;  5B1B H;  3FXK A;  4B3A A;  2AS5 F;  3PUF A;  1X19 A;  3G3Z A;  3D0S A;  3P9I A;  5D4S A;  1JKP C;  1UJ8 A;  4KDP A;  2H94 A;  3CP2 A;  4J01 A;  4KA4 A;  5C4J J;  2H1L A;  2GM4 A;  1T95 A;  2BOL A;  1P92 A;  1QVT A;  4JP0 A;  4J00 A;  3LSJ A;  1JE8 A;  3V42 A;  1SD7 A;  4EQQ A;  1NG7 A;  3S2W A;  5D5X B;  3D1N I;  3ECH A;  4KT5 C;  1WJB A;  2R5Y A;  1VQ5 I;  4GRI A;  2XRL A;  4EJV A;  5E3M A;  1G3S A;  3L2Q A;  2D1V A;  2M7B A;  1U3E M;  3SEZ A;  4PUS A;  3DV8 A;  4IRI A;  3ABK H;  5IYB J;  2E36 A;  4F52 A;  3BY6 A;  3C7J A;  1HKS A;  3E5Q A;  4XIC A;  5FLV A;  2QSF X;  4NC8 A;  2WY8 Q;  3JTH A;  3CCR I;  2VAS A;  1YIJ I;  1NTC A;  1WFX A;  2ZNY A;  2VON A;  3FXQ A;  2GXB A;  2X6W A;  4ON0 A;  3EUH A;  3HRM A;  1YS6 A;  3REO A;  1APL C;  3RJP A;  3KEO A;  3EYI A;  1RZ4 A;  3HSE A;  3HXL A;  4G8X A;  3VYS B;  2AXT C;  4CCO A;  1R5H A;  4LG3 A;  2CFX A;  3GX4 X;  4HYE A;  3O6B B;  4BGD A;  4UY8 I;  2JA2 A;  3GFJ A;  2DLL A;  2NVY J;  2R5Y B;  1R36 A;  1RIO H;  1QA6 A;  3L2C A;  3BQY A;  5HS7 A;  3GME A;  2O6G E;  5B5E C;  2FD5 A;  2NXN B;  4L0Z B;  1WI3 A;  1V5E A;  2XRN A;  3H5A A;  3C1D A;  3F21 A;  1JTX A;  3JRF A;  3PUB A;  5F1R A;  3ZOB A;  2VQG A;  1VQN I;  1KU3 A;  3TW7 A;  2CV0 A;  2IGK A;  1T0F C;  2CUE A;  4HX4 A;  1AOY A;  4D0P A;  2R7W A;  2B9S A;  5DD4 A;  3BR3 A;  2KIF A;  1BBY A;  3M7G A;  5IP6 A;  2R7F A;  3VSL A;  4LMY A;  2P6S A;  3GFL A;  1OYI A;  1X1B A;  2EA2 A;  3IUO A;  3LWF A;  1SAX A;  1N25 A;  3ECO A;  1S6L A;  1Z7U A;  3FHN A;  2WY7 Q;  2MA3 A;  5BNG A;  2C6Y A;  4MGR A;  1IGN A;  5GAE J;  1J75 A;  4BY1 J;  1ETQ A;  2EFW A;  4ZYD A;  4A3K J;  2KP6 A;  1TWC J;  4RB1 A;  3E6C C;  3A1Y A;  3M1E A;  4FHT A;  3WG9 A;  3KYL A;  5IYC J;  3WG7 H;  2CUZ A;  3OOP A;  4A3E J;  3QRF F;  2ZJQ F;  5EZG A;  3GYH X;  1W5S A;  2M5W A;  1G59 A;  3RKQ A;  1SFU A;  2Y48 A;  1A31 A;  1BW6 A;  2MC4 A;  3RDI A;  5F0C A;  3MKW B;  4DZJ A;  2B7E A;  3OIP A;  3LOC A;  5BMZ A;  2HYJ A;  2ZXI A;  4I01 A;  3QWL A;  2HDW A;  2D45 A;  5FLX K;  3ERE D;  4OIN F;  2HVR A;  2IAI A;  3OIO A;  3S3M A;  1KZH A;  2EIK H;  5LRS A;  4CYD A;  3BC8 A;  3CF2 A;  3GW2 A;  1YE9 A;  4A3L J;  4GFB A;  2ZXH A;  4WXH A;  3RZO J;  2ADU A;  5H6R A;  1G4D A;  1I27 A;  2VT3 A;  4P55 A;  2Y31 A;  2XAU A;  3I4N J;  2L0K A;  1MKM A;  1FSE A;  5TIS C;  1QNT A;  2LY2 A;  1F9N A;  3I0T A;  2FUG 2;  4KIG A;  5L3G A;  2DA5 A;  1IRZ A;  4Y52 J;  2XPV A;  2O03 A;  1JKR C;  2WAQ A;  4XR6 A;  2F2E A;  3GF2 A;  1WZ2 A;  1T98 A;  2IPQ X;  1HSJ A;  4B44 A;  5B1A H;  1SAN A;  4G94 A;  2LH9 A;  3OL3 A;  4XLN F;  2MH2 A;  4XRF A;  3PNY A;  3WGG A;  3M07 A;  2JUG A;  2CU7 A;  4YEJ A;  4A3M J;  2WB1 A;  5D6F A;  3F0C A;  5M5Y J;  4AU7 A;  4HV6 A;  3OYB A;  1XMA A;  2HQN A;  3JRB A;  5A2Q K;  2L9V A;  3GZ5 A;  4YFN F;  4LIT A;  4II3 A;  4AVP A;  3JRH A;  2R93 J;  3I58 A;  1BL0 A;  5BQT A;  4IVN A;  1Y0U A;  5D6E A;  3JAM K;  2LP0 A;  1DP3 A;  1I1G A;  3CUO A;  4ESF A;  3VOE A;  3FXU A;  2RKH A;  1GVD A;  3S17 J;  1XDS A;  3OYJ A;  3TDU C;  4BL0 B;  2XPW A;  4A2U A;  4XRS A;  2PLY A;  4RGS A;  2CS3 A;  2KHM A;  3BG6 A;  1MND A;  3MN2 A;  4BAY A;  2E1M C;  4RGR A;  2BEO A;  1MH3 A;  2WAD A;  1LEB A;  1HBX G;  2BY2 A;  5D5U B;  1VQ7 I;  2DA3 A;  1B59 A;  2JPB A;  2DT7 B;  5E1W A;  2M1B A;  2M3A A;  1LEA A;  3BDD A;  3UNG C;  2CQN A;  4I0A A;  4XM3 A;  3DP7 A;  5CVV A;  3I4M J;  4ZDO A;  1JXS A;  3S1Q J;  2CMP A;  1GLN A;  3DTK A;  2CV2 A;  1IRG A;  4IRG A;  1GV5 A;  5F0F A;  5CYV A;  2VKD A;  2QVO A;  4HBL A;  2KT0 A;  2EZH A;  4CIC A;  4DNC A;  5FRO A;  1BR2 A;  4D5C A;  1D1C A;  3ZQG A;  1OKR A;  4M6X A;  2JWT A;  2BBY A;  2K40 A;  1V54 H;  4U87 A;  4DBR A;  3H0G J;  2NNN A;  4M73 A;  1LE8 A;  1I1S A;  2DQR A;  2M4G A;  1S7O A;  4UNO A;  2A6T A;  1WJA A;  1YOV B;  2IA1 A;  2I8D A;  1B9N A;  4PSW A;  1IDZ A;  2R5Z A;  3GWZ A;  5EG0 B;  2OTL I;  4NNJ A;  3L9F A;  4HF1 A;  2F5D A;  5KCM A;  4LD5 A;  3OSF A;  5GPC A;  3HGG A;  1F5T A;  5IYD J;  4BHP A;  2QGU A;  2YX4 A;  4P96 A;  4Z2Y A;  4CZZ A;  1W0U A;  2CH0 A;  3K4K A;  3KYC B;  2Y75 A;  4M3G A;  1W36 D;  2OA4 A;  3KIO A;  3F9K A;  2O61 A;  1FTZ A;  4WWC A;  1IRF A;  2DMT A;  2HKO A;  1P7I A;  1QHG A;  4ENM A;  1SMY F;  4U0Y A;  4HOB A;  1RNL A;  3ISP A;  2XKP A;  2ZJR F;  3AFH A;  2QBY A;  2PJR A;  1EA3 A;  3F8N A;  1V5G A;  4YRV A;  3DLA A;  4WXC A;  2Y9Y A;  1F36 A;  3BJO A;  3TBI A;  1X4O A;  1X3Z B;  1LE8 B;  4LIV A;  1JUM A;  1E2X A;  1NK3 P;  2KIU A;  3CO6 C;  2E34 A;  1TWH J;  3TW6 A;  2MLK A;  3F6O A;  2HS5 A;  5DD8 A;  3FMQ A;  4BJ5 C;  2ZCW A;  5AIQ A;  4E7I A;  2G0E A;  4LB5 A;  2R5Z B;  3S3O A;  1SC7 A;  3BG7 A;  1FBU A;  4IO9 F;  2HFH A;  2H1K A;  2F6C A;  2D1H A;  3CZ6 A;  1IAW A;  4BE2 A;  1WJD A;  4OIP F;  4UV8 A;  3CQZ J;  1U78 A;  9ANT A;  1RUN A;  5GP9 A;  1DU6 A;  4CH7 A;  5AON A;  1HA8 A;  2JSC A;  1RPW A;  4XLA A;  3R6S A;  2F48 A;  2O0Y A;  4PJL A;  1PYV A;  2PEX A;  3EET A;  4ZDL A;  2K9N A;  1ZAR A;  3JRD A;  2QBY B;  1SAU A;  2OPT A;  2ECC A;  2L7Z A;  4A3J J;  4CO8 A;  1XN7 A;  1MBJ A;  3ZXS A;  5GTI C;  3S2H J;  2P5L C;  4GCV A;  1D3Y A;  2ZFW A;  4S04 A;  3K4L A;  4V19 K;  1GV2 A;  2CJJ A;  1HOM A;  2ZME A;  2QA4 I;  3J7A Y;  2EFO A;  2QLZ A;  4ZTF A;  3V8K A;  1WSU A;  3KEQ A;  4FQG A;  4PJJ A;  3J7Y J;  1BIA A;  2LF7 A;  2PFB A;  2XAH A;  1UZC A;  2KDZ A;  2QKL B;  4BNC A;  1WCM J;  2PMU A;  4I98 B;  1JJ6 C;  1PVE A;  2K86 A;  1FP2 A;  2Y9Z A;  5FKM A;  1OYY A;  1U6G A;  2ZO4 A;  5CJ9 A;  1E3P A;  4IXA A;  2R7Z J;  4NC6 A;  5H6Q A;  4YEL A;  1W5T A;  1Z9C A;  3KP5 A;  5J47 A;  2I10 A;  3I71 A;  2FA5 A;  3P9K A;  4N9H A;  3S1R J;  5J8C A;  4HV5 A;  2JVH A;  4EM2 A;  1LDK B;  2ZME B;  3OL4 A;  3RKW A;  3CCS I;  1K7A A;  2DOE A;  1HW1 A;  1PUF A;  3BRO A;  5CVJ A;  1Q1H A;  3KP3 A;  3GLX A;  1R22 A;  2BY0 A;  2FRH A;  3JW4 A;  4EGZ A;  2BY3 A;  1RRJ A;  3A03 A;  3CDI A;  2YU3 A;  4F3Q A;  1BC8 C;  3C2H A;  5CQE A;  5J1R A;  4WXD A;  3GTK J;  1GT0 C;  1OIS A;  4OIO F;  1ZRD A;  4OIR F;  2FOW A;  1ZEL A;  1BOA A;  2GIV A;  3BJ6 A;  5FLX Z;  4MQ9 F;  2R0Q C;  4BXX J;  1Z91 A;  2F5F A;  1ZLJ A;  2KQR A;  1Z1D A;  2XHK A;  2R7R A;  4KJZ A;  3OY9 A;  1H9T A;  3MMY B;  3V8J A;  5CKT A;  2M0M A;  4M74 A;  4KIT B;  1A6I A;  4RS8 A;  5L3D A;  3JR9 A;  2MC3 A;  3WOD F;  3T5X A;  2HPI A;  2M4K A;  1PUF B;  2HPM A;  2XGX A;  3LSM A;  2WAE A;  3OYC A;  1TWG J;  4HZF A;  4RAY A;  3EUK L;  3NRV A;  3CF5 F;  1MSE C;  2NVU B;  2X9D A;  2FEZ A;  4R79 A;  1M1E B;  1S7A A;  3T8T A;  2OJE D;  2FNP A;  3HRS A;  2LDU A;  4FE7 A;  1Y56 A;  5BS6 A;  3E3V A;  2KIS A;  2WWY A;  1YLF A;  5LGT A;  5J40 A;  1MJA A;  2V1D A;  2VQC A;  3H9G A;  1WWX A;  1H9G A;  2QQ9 A;  4HF0 A;  2IS6 A;  1ZQ3 P;  1PJR A;  1WRJ A;  2PG4 A;  1B8I A;  3BZK A;  4HDV A;  4IKF A;  1IW7 F;  3DPL C;  2DN0 A;  1ZG3 A;  5J3L A;  4C2M J;  1Y1V J;  2LLK A;  2KLO A;  3KZI C;  2QQA A;  5DDG A;  2OTJ I;  1XSD A;  3O3K A;  1MBE A;  3L09 A;  3VOD A;  2D2W A;  1IN7 A;  2RGV A;  3ASO H;  3S1N J;  1IUY A;  4RM3 A;  1MBF A;  3JAM Z;  2A69 F;  1R4M B;  5FKK A;  1YRN A;  3M8J A;  5GPA A;  3H3V K;  3DBH B;  3WE2 A;  3DTI A;  3OYK A;  2OCE A;  4N4N B;  4E70 A;  3FK7 A;  4A6E A;  1YX3 A;  2LKP A;  2LY9 A;  2F4O B;  4Y33 A;  2LOO A;  4HA8 A;  1ETY A;  3VYU B;  4LLN A;  4N4O B;  4C2T A;  4M9S A;  2OCC H;  3HTS B;  3FK6 A;  1VND A;  2X0L A;  5DYM A;  4L9T A;  2BXY A;  4ZZD A;  1B8I B;  4EJO A;  1EH8 A;  3DEU A;  4D7N A;  3K4N A;  1TW3 A;  2QQB A;  5K5R A;  4P1W A;  4PGH A;  3BR1 A;  3K4B A;  4FE4 A;  2AXL A;  1SD6 A;  2EZK A;  4BBR J;  3H3U A;  4L9J A;  3LAP A;  2PJP A;  2NNY A;  5DEQ A;  1ETX A;  2JQ7 A;  5K7Z A;  2KZG A;  1OMI A;  3ULQ B;  1WI9 A;  4M6V A;  1V55 H;  1YRN B;  2HXI A;  2XAJ A;  3FX3 A;  2HNH A;  5DTD A;  3ZQH A;  1RR7 A;  2Q2E A;  4H0E A;  3G4S I;  2VBW A;  3GXO A;  2N8G A;  2GOM A;  5KVR A;  2GA1 A;  1VQO I;  3WU2 C;  1VQ8 I;  3C2G A;  3TKY A;  4HQM A;  2QSH X;  2IGM A;  4HX8 A;  3VPR A;  3FXL A;  3QOE A;  3KP2 A;  3K70 D;  2DA1 A;  3CC4 I;  3GLL A;  4F91 B;  2HTJ A;  4EV0 A;  4RA2 A;  2IBD A;  3HRU A;  2VUM J;  2VC0 A;  2WC2 A;  4K2E A;  1WH5 A;  4G7O F;  1UG2 A;  3MKZ A;  2PI0 A;  2JRT A;  3KZZ A;  4I09 A;  2VJJ A;  1IXR C;  3CMA I;  3SQN A;  4RB0 A;  4KMU X;  1J0R A;  2LFB A;  5CPR B;  2R92 J;  1U8R A;  3MKL A;  1HCR A;  5JR3 A;  1EV7 A;  3HSR A;  1TNS A;  3S14 J;  3SDG A;  2Q2E B;  1LUJ B;  1TW2 A;  2VQL A;  1FT9 A;  2DJN A;  4L9V A;  4IOC F;  3C18 A;  1BIB A;  1BJZ A;  1Q1V A;  3BTI A;  4HF2 A;  3CDL A;  4CA0 A;  2GXA A;  2CQX A;  5TRD A;  1ZTR A;  2DFI A;  4C30 A;  4ENJ A;  3HC7 A;  2E19 A;  3DPT A;  2JSP A;  4BKX A;  4ZDP A;  3CCM I;  2HTS A;  2DFF A;  2WV0 A;  3MD2 A;  2A3S A;  2XRO A;  4IPA A;  2ESN A;  2DQL A;  2EIM H;  1YI2 I;  1MJB A;  2FBK A;  3UR3 C;  2RC4 A;  1QBJ A;  3LQR A;  1X1D A;  2A5Y B;  3CCE I;  1P9Q C;  3FHZ A;  1NK2 P;  3RCO A;  1SD4 A;  1TWA J;  3GTQ J;  2XVC A;  3F8F A;  3LL7 A;  2V26 A;  1MGT A;  3E5U A;  2KKO A;  3CDH A;  3L00 A;  4P9F A;  2VJ5 A;  3HGY A;  3NAU A;  1MDM A;  1D0Z A;  5E3L A;  5E1Z B;  3CCJ I;  2DXI A;  1YX5 A;  1MMG A;  5IP7 J;  5AIP A;  1BN5 A;  1Y0N A;  3RZD J;  3M4O J;  3E1S A;  2Z9O A;  3RYR A;  2GAU A;  2KIM A;  3H35 A;  5GTH C;  4XKC A;  1TLH B;  2YSR A;  1B72 A;  1WHU A;  4P5O A;  3LFK A;  2CRG A;  1SFO J;  2DA6 A;  3OMY A;  4KN4 X;  5M5X J;  2OD5 A;  1A5J A;  1DUX C;  3MFK A;  2PMZ A;  3WTS C;  2PBI A;  2NS0 A;  1YW9 A;  2FX0 A;  1ON1 A;  2DTR A;  2HQA A;  4CCM A;  1V3F A;  1JGG A;  2V1U A;  1K79 A;  3K1M A;  4UUT A;  3ERM A;  3OIQ A;  4LK0 F;  2CQQ A;  3BTJ A;  3BOQ A;  4LGW A;  1BR1 A;  1QU3 A;  2HQ5 A;  4B1R A;  3LQQ A;  1IO2 A;  4M9Z A;  5M5W J;  3U21 A;  1MDM B;  3S1M J;  4M3B A;  3X2Q H;  2CW8 A;  5DS9 A;  4OMZ A;  4YII A;  1OLT A;  3COA C;  5C4X J;  2CW0 F;  5JLW A;  5BPI A;  2FJ1 A;  1XB4 A;  3L1P A;  3SHF A;  2KZV A;  3K0L A;  1QPM A;  5EGO A;  3G1O A;  4FIS A;  5J6X A;  2XAS A;  5F27 A;  2VBY A;  4OMY A;  5IT9 K;  1X3U A;  1TT0 A;  2OAZ A;  3HKZ A;  1IN6 A;  3CES A;  5GAH J;  3KET A;  5BPD A;  3K9T A;  1OCZ H;  4CCJ A;  1RUO A;  1RET A;  3DPU A;  3OYA A;  2E1O A;  1H89 C;  3R61 A;  5HDG A;  3O2P E;  1AU7 A;  2P7C B;  1SEU A;  4I76 A;  2JZY A;  1IN5 A;  1J9I A;  3K10 A;  2F5E A;  3JRI A;  4EJT A;  2OZU A;  4A0Y A;  2VKV A;  5J8F A;  1JJ8 C;  2BYV E;  1DPU A;  3HIF A;  3CLQ A;  4BJ6 C;  2Z16 A;  3TDZ C;  4Y7N J;  3OYE A;  2CG4 A;  3MCZ A;  3GFM A;  3N97 A;  2L4M A;  1WVR A;  4HLY A;  4KFC A;  4U0V A;  5EGO B;  1FNN A;  1JUS A;  2P0W A;  1FTT A;  1ZHF A;  2R7Q A;  2ZB9 A;  4OIQ F;  3LA3 A;  3L2U A;  2KJB A;  1O7L A;  2JRM A;  3DQV C;  1UEL B;  3RQ4 A;  2DDB A;  3OS2 A;  1EKE A;  1WJE A;  2P7V B;  4PCQ A;  4RB3 C;  3Q5F A;  2DOA A;  3VB2 A;  1KQ9 A;  1K4S A;  3W6V A;  5HDN A;  1MZB A;  1U9N A;  3P7N A;  1UFM A;  1SFX A;  2DA2 A;  3ABL H;  1F1Z A;  3E7L A;  3FM3 A;  4FET A;  4JYK A;  2L9S A;  3MZY A;  1ORK A;  3GCM A;  3NWS A;  3R0J A;  1FSH A;  2EIN H;  3RPU D;  2I5U A;  2HWV A;  1FYM A;  4C9Y A;  5H20 A;  3GTL J;  2KDO A;  2ME6 A;  3VSK A;  3MVP A;  1W7P D;  2A05 A;  1FLI A;  3GTG J;  4RAZ A;  3MAJ A;  2WBM A;  1YQA A;  5TGT A;  1CQT A;  2K9Q A;  3DEW A;  5KHD A;  2X6Y A;  1JHF A;  3IH4 A;  2OF7 A;  3Q9V A;  1USS A;  4A6D A; 
#chains in the Genus database with same CATH homology
 1NK3 P;  1JUP A;  3TW6 A;  1TWH J;  2EH3 A;  2VI6 A;  3G1L A;  1TWF J;  2G0E A;  2R5Z B;  1XS9 A;  1AKH A;  2Y2Z A;  4X6A J;  2HOS A;  2H1K A;  2ID6 A;  1U8B A;  2L9R A;  4IHW A;  3PO3 J;  1HF0 A;  2DA4 A;  3BR5 A;  1ZK8 A;  3CQZ J;  1U78 A;  1HDP A;  1TC3 C;  3Q3S A;  9ANT A;  3JRG A;  5GP9 A;  1BA5 A;  1DU6 A;  2DTZ A;  4XRS G;  3BG9 A;  1RPW A;  1DU0 A;  5E3O A;  4NDL A;  3ZQF A;  1ITY A;  2K9N A;  1MSF C;  3JRD A;  1QVU A;  2OPT A;  2ECC A;  2L7Z A;  4QSH A;  3A01 B;  4A3J J;  1MBJ A;  1Z0X A;  3S2H J;  3S15 J;  3GTJ J;  2JJ7 A;  2Y0S N;  1GV2 A;  2CJJ A;  3QPL A;  4C3J J;  4I6Z A;  3SJM A;  1HOM A;  3BT9 A;  5JLX A;  3TED A;  5F04 A;  4D7M A;  1JKO C;  5F08 A;  2HDD A;  3RQI A;  1B72 B;  2AO9 A;  4HNV A;  1LFB A;  1EF4 A;  3Q0U A;  1MBH A;  2KDZ A;  2ID3 A;  1WCM J;  1JJ6 C;  3CCY A;  1HDD C;  2Y9Z A;  5FKM A;  4JX5 A;  2R7Z J;  5J1Y A;  2L7M P;  4LOC A;  1MBG A;  1WH7 A;  2I10 A;  3HB9 A;  5E3N A;  3S1R J;  4L5E A;  3OOU A;  4FCY A;  5FLM J;  2LR8 A;  2XSD C;  2JA7 J;  5IP9 J;  4A3B J;  3HBL A;  2ME0 A;  3S16 J;  2L7F P;  3K2A A;  4A3F J;  2JN6 A;  1PUF A;  2W48 A;  2E2J J;  2XB5 A;  4IHY A;  4V2G A;  3BTC A;  3DCF A;  2ELK A;  4JX6 A;  1X58 A;  2GBY A;  1OFC X;  3WHB A;  3A03 A;  1WPK A;  2GLO A;  3QQA A;  3FIS A;  5J1R A;  2MGQ A;  2JA8 J;  3GTK J;  1GT0 C;  4MFE A;  3O8H A;  1FIP A;  3BR2 A;  4B4C A;  1I50 J;  2P81 A;  1IV6 A;  2R0Q C;  4BXX J;  1MNM C;  1XG1 A;  1MH4 A;  3TP3 A;  1O4X A;  1A6I A;  1U9O A;  3JR9 A;  1LFU P;  1F43 A;  2O8K A;  5EDN A;  5EZH A;  1IDY A;  1P7J A;  2M8G X;  1PUF B;  3IH3 A;  4S0H B;  2YU9 J;  5J1U A;  2XGD A;  2XPU A;  1QPI A;  1TWG J;  2XB0 X;  5FJ8 J;  5FKN A;  2X6O A;  1MSE C;  2FQ4 A;  2X9D A;  3HOU J;  3FIW A;  5HOD A;  5IOY A;  2JMW A;  1Z77 A;  4FE7 A;  3HOV J;  2XGE A;  4DZP A;  2HI3 A;  3K7A J;  1K83 J;  1QRY A;  2COB A;  3O8G A;  4B3A A;  1HLV A;  4C3H J;  1ZQ3 P;  1B8I A;  2IEK A;  2EZL A;  3UKG A;  1JKP C;  2LTP A;  2DN0 A;  1E3O C;  5J3L A;  4C2M J;  5C4J J;  2GM4 A;  1Y1V J;  2LLK A;  4JP0 A;  1QVT A;  4D5F A;  1MBE A;  3LSJ A;  4CYC A;  3S1N J;  2WAQ N;  1MBF A;  1RES A;  5FKK A;  1YRN A;  1RKT A;  2PMZ N;  3D1N I;  5GPA A;  3H3V K;  1G2H A;  3M3Y J;  2HOA A;  3A02 A;  2R5Y A;  2MW8 A;  1T56 A;  3S2D J;  2XRL A;  5E3M A;  3FK7 A;  4XRM A;  2WV1 A;  2LY9 A;  1D5Y A;  5IYB J;  1K61 A;  1JT0 A;  3GBG A;  1ETY A;  1AKH B;  4XIC A;  5FLV A;  3C2B A;  2NOG A;  4A3D J;  1BW5 A;  2WB1 N;  3BR0 A;  3FK6 A;  1VND A;  2JA6 J;  1NTC A;  1B8I B;  1S7E A;  4AUX A;  5C44 J;  4D7N A;  3BG3 A;  1JKQ C;  2E2H J;  2YUS A;  4DYQ A;  4MFD A;  1APL C;  3BR1 A;  4FE4 A;  2EQR A;  2EZK A;  4BBR J;  3HEF A;  3HOW J;  1ETX A;  4CYC B;  2EBI A;  2XGC A;  3HKZ N;  5K7Z A;  4UUS A;  1VI0 A;  4M6V A;  3G1M A;  1YRN B;  2O7O A;  2HXI A;  2NVY J;  2R5Y B;  4X1E A;  1T33 A;  3ZQI A;  2DMN A;  3BQY A;  5DTD A;  3ZQH A;  5IPA A;  1RR7 A;  4M3F A;  2FD5 A;  2Y30 A;  1WI3 A;  2NVX J;  4FTH A;  4BBS J;  1OCP A;  4A93 J;  1JTX A;  2N8G A;  4V2F A;  3JRF A;  3PO2 J;  4JX4 A;  3ZOB A;  2TRT A;  3TW7 A;  1ETK A;  3VPR A;  1FEX A;  2CUE A;  2DA1 A;  5IOZ A;  2LVS A;  3IV5 A;  4ABZ A;  5EG0 A;  3HM5 A;  3BR3 A;  5IP6 A;  2IBD A;  2VUM J;  2HXO A;  1WH5 A;  1UHS A;  1ETW A;  1UG2 A;  3ZQC A;  1OJL A;  4UUS B;  1ZR2 A;  2JA5 J;  2LFB A;  2R92 J;  2QCO A;  3MKL A;  1HCR A;  5BNG A;  4M3E A;  3S14 J;  3SDG A;  2LKX A;  1IGN A;  1GDT A;  2M9H A;  4QIW N;  4BY1 J;  1ETQ A;  3NAR A;  2DJN A;  1BJZ A;  3BTI A;  1Q1V A;  4A3K J;  2HOT A;  3CDL A;  4IHX A;  1TWC J;  3HOX J;  1JT6 A;  1GUU A;  2CQX A;  4DW6 A;  3ZQL A;  3JRE A;  4A3I J;  1ZGW A;  1XC5 A;  1ZTR A;  5IYC J;  2LK2 A;  2E19 A;  4BKX A;  4A3E J;  5EZG A;  4QTR A;  2NVT J;  3RKQ A;  3BG5 A;  3WHC A;  1BW6 A;  5F0C A;  2VKE A;  3FKI J;  4DZJ A;  2DMP A;  3LOC A;  5M3M J;  1NK2 P;  2HYJ A;  1TWA J;  3GTQ J;  2DMQ A;  4C3I J;  2MSY A;  4MLO A;  1VFC A;  5F0H A;  2IAI A;  3OIO A;  5K7F A;  4DYC A;  4XID A;  4A3L J;  3SFI A;  4GFB A;  3LNQ A;  3HGY A;  3NAU A;  2CUF A;  3RZO J;  5EYR A;  5E3L A;  1OCT C;  4DYR A;  3LSP A;  1R9T J;  2Y31 A;  5IP7 J;  2DMU A;  2L0K A;  3I4N J;  1ETO A;  3RZD J;  3M4O J;  2EZI A;  3OSG A;  3JRC A;  3GTP J;  2DA5 A;  1IRZ A;  4Y52 J;  1B72 A;  5F1J A;  2XPV A;  4RBO A;  4AYB N;  2CRG A;  1SFO J;  2DA6 A;  5M5X J;  1JKR C;  1A5J A;  3B6C A;  2FX0 A;  1W0T A;  1JGG A;  1SAN A;  4UUT A;  1IG7 A;  2CQQ A;  3BTJ A;  2RAE A;  1AHD P;  2HQ5 A;  1X2M A;  2M34 A;  4B1R A;  4A69 C;  2CU7 A;  1ENH A;  2E2I J;  5M5W J;  4A3M J;  3Q0W A;  4BY7 J;  3S1M J;  5C3E J;  3F0C A;  4W1U A;  5M5Y J;  4M3B A;  2JK3 A;  3JRB A;  1I3Q J;  5DS9 A;  4MIM A;  1RKW A;  5C4X J;  3JRH A;  2VPR A;  5JLW A;  2R93 J;  1BL0 A;  2FJ1 A;  1H88 C;  2B63 J;  3L1P A;  2LP0 A;  4AC0 A;  1GVD A;  3S17 J;  5FKO A;  2TCT A;  4IEJ A;  5EGO A;  3G1O A;  4FIS A;  2M2E A;  5F27 A;  2XPW A;  4XRS A;  3BR6 A;  3LSG A;  1RET A;  4M3D A;  2H8R A;  1H89 C;  2E1O A;  3MN2 A;  1AU7 A;  3HOZ J;  1MH3 A;  3JRA A;  2NS8 A;  1FJL A;  3TP0 A;  4I76 A;  2DA3 A;  3Q0V A;  2X48 A;  1ZR4 A;  3JRI A;  4G12 A;  3GTO J;  2VKV A;  1JJ8 C;  3I4M J;  3IH2 A;  1H8A C;  3S1Q J;  1WGX A;  3B6A A;  3BTL A;  4Y7N J;  4A3C J;  1GV5 A;  5F0F A;  3HDD A;  2M0C A;  2K9S A;  5EEA A;  5EGO B;  1JUS A;  2KT0 A;  2D5V A;  1FTT A;  2EZH A;  2ZB9 A;  3HOY J;  1POG A;  4D5C A;  3ZQG A;  1JTY A;  1UMQ A;  2JWT A;  2K40 A;  1VF9 A;  1FIA A;  2YS9 A;  3H0G J;  1Y1W J;  1I6H J;  3LSR A;  1LE8 A;  2DA7 A;  1IUF A;  2NVQ J;  4MO7 A;  1X2N A;  3CMY A;  5EF6 A;  3W6V A;  3GTM J;  1IDZ A;  2R5Z A;  1U9N A;  5EG0 B;  1IC8 A;  4XK4 A;  2DA2 A;  3E7L A;  3OSF A;  5GPC A;  3HGG A;  4A3G J;  5K7H A;  1IJW C;  4JYK A;  5M3F J;  5IYD J;  2NS7 A;  1ORK A;  1W0U A;  4M3G A;  1FTZ A;  3BQZ A;  2LD5 A;  4EEF G;  3GTL J;  2DMT A;  2ME6 A;  1P7I A;  3MVP A;  5FKL A;  3QPS A;  2O9L A;  4RDU A;  1MBK A;  4J19 A;  1ZKG A;  3GTG J;  2ECB A;  2MG4 A;  1ETV A;  4W97 A;  3A01 A;  2Y9Y A;  1CQT A;  4IHV A;  1F36 A;  2K9Q A;  3DEW A;  3IH4 A;  2QF7 A;  3PM1 A;  2AHQ A;  1LE8 B;  2OF7 A;  1JUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...