2KT0A

Solution structure of human stem cell transcription factor nanog homeodomain fragment
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein NANOG
publication title Solution structure of human stem cell transcription factor Nanog
rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kt0A01
5EEAA 3TW7A 3H0GJ 3RKQA 1W0UA 2R92J 1Z0XA 2EBIA 2EH3A 4V2FA 3GTLJ 1ETXA 5K7HA 3I4NJ 1U9OA 4LOCA 2OPTA 2WB1N 5IOYA 3ZQGA 5GPCA 1WGXA 2JA5J 1HDDC 4W97A 1JKOC 5J1UA 1AU7A 1MH4A 3B6CA 1IDYA 4XK4A 1RESA 2XPUA 1RR7A 3QQAA 4Y7NJ 2XSDC 2K9QA 2M9HA 5FKLA 1IG7A 3M4OJ 5C4JJ 2M8GX 3BR5A 4DYCA 3MN2A 4XIDA 1ETQA 2H1KA 1I50J 2HYJA 3QPSA 2GLOA 2R7ZJ 3IH2A 1U9NA 3GTPJ 3S1QJ 3OIOA 5FKOA 5EG0A 2DMNA 1WCMJ 1RKTA 2XGEA 3HOVJ 1CQTA 2DA7A 1U8BA 5M5XJ 2MW8A 3JRCA 4Y52J 1UMQA 3JRIA 1FIAA 2ECCA 4X1EA 3JRBA 4A3GJ 3SJMA 3S16J 1YRNB 1IV6A 2JWTA 1I6HJ 5JLWA 2AHQA 1QVUA 3CMYA 2L7ZA 4JYKA 2K9NA 2QF7A 1RKWA 1TWHJ 5DS9A 5IPAA 4CYCA 1K61A 1MBGA 1EF4A 1AHDP 4D7NA 4DZPA 3S17J 2LR8A 1JT6A 2XGCA 2HDDA 2LTPA 3TEDA 1SFOJ 4A3JJ 2ECBA 1NK2P 1LFUP 1BL0A 2HQ5A 3JRFA 5C3EJ 3TP3A 3BT9A 2GBYA 3BG5A 2Y0SN 4B4CA 3HOXJ 3S1NJ 1ZK8A 5JLXA 2R0QC 2EZLA 1HLVA 1F43A 4A3FJ 3I4MJ 4RDUA 1ZTRA 2CRGA 1FTTA 2Y2ZA 1Z77A 4A93J 1OCTC 2O9LA 3FKIJ 5FKNA 3UKGA 4A3EJ 1VFCA 4RBOA 1GT0C 1ZGWA 1JTYA 4AYBN 1H89C 3S1MJ 5E3OA 4DYRA 1X58A 5J1RA 1IRZA 3K7AJ 3A01B 1GDTA 2M0CA 1K83J 4M3FA 2L7FP 4X6AJ 5F0CA 1DU0A 1RETA 3JRDA 5IYCJ 2EZIA 4M6VA 1ZQ3P 2NOGA 1ZR4A 1T33A 1G2HA 3S2DJ 2M2EA 2CJJA 3A02A 3HGGA 4W1UA 1TWFJ 2NVTJ 3RQIA 4UUTA 1IGNA 5BNGA 1MSFC 4MLOA 1LE8B 1ETWA 3BR2A 2CQQA 2LLKA 3HOUJ 4I6ZA 2NVQJ 4B1RA 1HCRA 4C3HJ 1ENHA 2HXIA 3MKLA 4XRSG 9ANTA 2MGQA 4D7MA 1T56A 2YS9A 4MO7A 5F1JA 1AKHA 3JR9A 2DMTA 1SANA 1WH7A 2Y9YA 5EZGA 3WHCA 5IP7J 2DA4A 2JA6J 4I76A 1BW6A 4IHWA 4IHVA 3FK7A 5FKKA 2K40A 3HEFA 4C2MJ 1MBHA 1F36A 3TP0A 4FE7A 2QCOA 3NARA 3BG3A 2Y9ZA 1JUPA 2VUMJ 5FLMJ 3BR6A 3LSRA 5K7FA 5IOZA 2DMPA 4J19A 3DEWA 2XB0X 2FQ4A 5M5YJ 2PMZN 1MBFA 3OSGA 4C3JJ 2JK3A 4QIWN 1H8AC 4AC0A 2TRTA 1VI0A 2ME0A 3ZQFA 5FJ8J 3M3YJ 5FLVA 1Y1VJ 4DZJA 1W0TA 5F0HA 3ZQCA 1HF0A 1MBEA 3GTQJ 3FIWA 1JUMA 1VNDA 4ABZA 4IHXA 2O7OA 3BTIA 1PUFB 1IC8A 3RZDJ 2HXOA 3HDDA 4A3BJ 3LSGA 5M5WJ 4HNVA 1A5JA 2NS8A 3GTOJ 3Q0UA 3IH3A 1S7EA 3BQYA 2HOAA 1JKRC 1DU6A 5EF6A 2DTZA 2DMUA 1FIPA 3K2AA 4FE4A 1QVTA 2XGDA 4JX6A 1APLC 3O8GA 5EGOB 3D1NI 3PM1A 1POGA 4M3EA 1ETOA 2LVSA 2R5ZB 3Q3SA 5EYRA 2E19A 2NS7A 2D5VA 1MH3A 3VPRA 3MVPA 3HOZJ 3GBGA 3HOWJ 1JJ8C 1XG1A 5GPAA 5IP9J 4XRSA 5IYDJ 4S0HB 3S2HJ 2OF7A 2L7MP 3G1OA 3HOYJ 2DA1A 4QSHA 2CUEA 4IEJA 4A3CJ 3BR1A 1B72B 5HODA 2HI3A 5IYBJ 4XRMA 2AO9A 1ORKA 3O8HA 1JKPC 2M34A 2LK2A 2X9DA 2VI6A 1UG2A 4BBRJ 3F0CA 1JJ6C 2CU7A 3CQZJ 3BR3A 4L5EA 2JA8J 1TWAJ 1Q1VA 2DA2A 1H88C 2G0EA 3JRGA 1IUFA 3B6AA 1FEXA 3BG9A 2JA7J 2R5YB 1TC3C 2EQRA 3HGYA 1HDPA 5K7ZA 2ME6A 1VF9A 2IBDA 1YRNA 4A3LJ 4JP0A 5EG0B 2ELKA 1B8IB 4MFDA 2MSYA 1IDZA 3WHBA 3C2BA 4M3GA 5F08A 5F27A 3JRHA 2IEKA 3H3VK 2LFBA 4MFEA 5E3LA 4UUSB 5EGOA 1TWCJ 2X48A 1O4XA 3JRAA 2Y31A 1NK3P 1UHSA 1WPKA 3QPLA 3FK6A 3LNQA 2VKVA 1ETVA 1RPWA 4FTHA 1OCPA 2LD5A 4CYCB 3CDLA 2JJ7A 5DTDA 4B3AA 1Y1WJ 2DA5A 5EZHA 3HM5A 1JGGA 4G12A 1GV2A 5M3MJ 5C4XJ 5F0FA 1QPIA 4NDLA 1QRYA 4XICA 4DW6A 2ZB9A 1U78A 3LOCA 3NAUA 1MSEC 3TW6A 4D5FA 2E1OA 1IJWC 4IHYA 1XS9A 3CCYA 3ZQHA 5GP9A 3LSPA 1B72A 4A3MJ 2XPVA 1MBKA 4A3KJ 4QTRA 5C44J 2WAQN 3HB9A 4JX4A 1X2MA 2DA3A 5EDNA 2FJ1A 1ETKA 3BTJA 1GVDA 1P7IA 3A01A 2DA6A 2H8RA 2YU9J 3S1RJ 1FTZA 2P81A 4A69C 2XRLA 3BQZA 1BJZA 1GV5A 2MG4A 2R5YA 1WH5A 2W48A 4BY1J 4BXXJ 2B63J 4D5CA 4FISA 2DJNA 3S15J 3Q0VA 2NVYJ 2E2IJ 4BBSJ 4EEFG 4BY7J 2VKEA 1P7JA 2X6OA 3W6VA 2LY9A 1XC5A 2CQXA 2DN0A 4M3BA 4FCYA 1JT0A 1B8IA 2EZKA 3GTMJ 3PO3J 2CUFA 5FKMA 4C3IJ 3G1MA 3RZOJ 3LSJA 1LE8A 4AUXA 3GTJJ 4UUSA 2FX0A 5F04A 2XPWA 2DMQA 3ZQLA 1MNMC 1MBJA 2XB5A 2COBA 3L1PA 1R9TJ 2GM4A 1JKQC 4DYQA 2WV1A 2E2JJ 2IAIA 3G1LA 5IP6A 2NVXJ 1E3OC 2VPRA 3SFIA 1JTXA 3GTKJ 3SDGA 2L9RA 1AKHB 4BKXA 1BA5A 2ID6A 3ZQIA 1NTCA 1A6IA 5J3LA 2RAEA 2JMWA 2LKXA 2KT0A 1FJLA 3BTLA 1ZR2A 1I3QJ 2K9SA 1GUUA 2I10A 1ETYA 2ID3A 3GTGJ 5E3NA 1D5YA 3OOUA 1WI3A 2N8GA 3E7LA 2R93J 2KDZA 4A3IJ 4V2GA 2FD5A 3IH4A 1LFBA 3PO2J 3HBLA 2HOSA 3DCFA 1BW5A 1OFCX 1PUFA 3ZOBA 5J1YA 4GFBA 4M3DA 2JN6A 2LP0A 1ZKGA 1TWGJ 4A3DJ 1OJLA 2L0KA 5M3FJ 3BTCA 2Y30A 3BR0A 2O8KA 2EZHA 1JUSA 3S14J 1HOMA 3IV5A 2TCTA 3A03A 2E2HJ 2HOTA 1X2NA 1ITYA 4MIMA 3Q0WA 4JX5A 3JREA 2R5ZA 3FISA 3HKZN 2YUSA 3OSFA 5E3MA
chains in the Genus database with same CATH superfamily
4AU7A 3MFKA 5B5EC 4G7HF 3SZPA 2M7BA 1XPXA 2DPDA 1BI3A 3KFWX 4CCKA 3RKQA 3IRQA 2V9PA 4IVNA 4I09A 2M5WA 2M0MA 3JSPA 5K7HA 2OPTA 4OIRF 3J7ZI 3HOTA 3ZQGA 1S7AA 3I56I 5IT9Z 4AIJA 5EEHA 3I4PA 3PUBA 4A5MA 4IKFA 2G9WA 1BW5A 2GXBA 2EPFA 1AU7A 1BC8C 1KU3A 1MH4A 1Y8RB 3BPVA 1IDYA 5LHHA 4ZYEA 5CKTA 3QQAA 1Z7UA 1E3PA 2FU4A 5EJCA 3GTGJ 5FKLA 1IG7A 4CSWA 2L2OA 3HTSB 3PJRA 2KHMA 3BR5A 2A68F 3V42A 5ED4A 4XIDA 3ELKA 4LK1F 3DTEA 2MLGA 3ZXSA 1RR8C 3FBIB 1K78B 3ZPLA 4HZFA 3FKJA 1FPQA 3FHNA 4LB5A 2EK5A 1T0FC 3S1QJ 1IXSB 2V6EA 3ECOA 1YIJI 2MC4A 3I3LA 1CQTA 3TGNA 1N78A 2YU3A 2MW8A 1EH7A 1JHHA 4X1EA 3JRBA 2ZNZA 3ERED 4PCQA 4HLXA 2YR2A 2IP2A 4KT5C 3ECHA 2CV0A 2O03A 2K9NA 1RIOH 3E6MA 3GEZA 1MBGA 2RDPA 1W36D 4P96A 3HKZA 3S17J 1TBXA 4BHPA 3TEDA 1W7PB 3U1DA 1ON2A 1R5HA 4XKCA 1UZCA 4MTEA 4GO1A 4ZDLA 4FX4A 1X19A 1YE9A 2BY2A 1BL0A 3JRFA 2VPLA 2VIXA 2E1MB 3RTRA 4AVZA 2WB1A 3HOXJ 4R1HA 2UV1A 1ZK8A 1O3QA 2R7TA 4KIGA 2JT1A 3ZN0A 3C2HA 2CO5A 4K2EA 4R8HA 3CF5F 1O3TA 4CCMA 2E7XA 1BI0A 1ZLJA 1Z77A 1YHQI 2H09A 3WTYC 4A93J 4N9HA 3E97A 1XSDA 4KT6A 2HFHA 2OQRA 2PEXA 4C9YA 1I39A 3AAFA 2EIKH 2QBYB 3GZNB 4II3A 4XLEA 4CZZA 4UXNA 1VQNI 3PSIA 2JTVA 4HBLA 5E79C 4F52A 4RBOA 2AQFA 4GGGA 3DLLF 1GT0C 1VQ8I 1XGSA 2R7DA 1JTYA 2BV6A 5BPIA 3MAJA 1A35A 2VQCA 2GAUA 4BAYA 1F4KA 1IRZA 1DP3A 2F5FA 4MTDA 3GFMA 3WE3A 1K83J 2W00A 1K6OA 3MKWB 3F72A 2L7FP 4X6AJ 5F0CA 3H5AA 1YX5A 2OC6A 2BEOA 5LEKA 5K5RA 2MABA 2FF4A 5IYCJ 2WAFA 3L2RA 1J9IA 2L54A 4LIUA 3CCMI 5DCMA 2CJJA 2DBBA 2MYSA 3CTAA 4F7ZA 2P0WA 1J5YA 4UNOA 3DKXA 3HGGA 3MEXA 2JQ7A 1E0EA 2IGKA 2E5ZA 3CCRI 2NVTJ 3HUGB 3ZQQA 1ON1A 3WTTC 2HKOA 2QQAA 4C30A 5LGUA 4M71A 2Z99A 1ETWA 1UAAA 2W82A 3VYTB 1E2XA 3REOA 2RNJA 1IO2A 4BJTA 3H5RA 2NVQJ 1KU9A 2NOJB 4FASD 1XB4A 2DT5A 9ANTA 4P1WA 2CQ7A 4XM3A 5F1JA 1AKHA 1Z6TA 1G4DA 2EILH 3COAC 2YSRA 4LLNA 4I0AA 2EA2A 1SANA 5EZGA 4LFUA 2JA6J 1S8NA 1S6LA 1BW6A 4IHVA 1KA8A 4M6XA 4C2MJ 4I7HA 2MD5A 4FE7A 3CP2A 2VUMJ 4L5IA 5FLMJ 1D8JA 5L3EA 1FBQA 3KYLA 2XB0X 2FQ4A 2DAOA 5M5YJ 2PMZN 2H6CA 5CLSA 3I5UA 1LPQA 2JK3A 3CJNA 4QIWN 1H8AC 3M8FA 1OCCH 2QVOA 1R4NB 4GDFA 3LMMA 4E7HA 4E7ZA 3ABKH 1UFMA 1IN7A 3ZQCA 1FSHA 1LFPA 1W36C 3CCUI 2ZMEA 1JUMA 5FFXA 1YFHA 1VNDA 4QLCU 2FBIA 4ABZA 2V1DA 4A6DA 1QA6A 3MZYA 1VZ0A 1WJCA 2LY1A 3ZMSA 4U7DA 4FETA 3T5XA 4KJZA 4EV0A 1A5JA 3FXQA 4PJMA 1S7EA 3KP7A 4RAZA 4HNTA 5LEJA 4IX7A 1JKRC 4BH9A 5HVQC 2DTZA 3A1YA 1FIPA 1YG2A 3G3ZA 2BBYA 3BY6A 3MKZA 1APLC 5EGOB 2J5PA 3MZ8A 1O3SA 4M73A 3HPGA 5AONA 1WQ2A 3F6VA 4ZZLA 4PFOA 2VKHA 5CVJA 1KZHA 3S3OA 5FLXK 2LVSA 1FC3A 1TNTA 3W3CA 5GAGJ 1MJAA 2BYVE 5DCFA 2EFWA 4F3QA 3R60A 3GBGA 2COMA 1OYWA 4BDZA 1IW7F 4ANJA 3DPUA 3P7NA 1KONA 3HOYJ 2KRFA 1X3WB 4OMZA 1VQ6I 1HKQA 2RVCA 1B72B 5HODA 3QP6A 4XRMA 4M9XA 2AO9A 4LMYA 4MNUA 1ORKA 3O8HA 4CXFA 2M34A 1K79A 1A36A 2R7QA 2ICWG 3K4JA 2LK2A 1G59A 5F6FA 3WU0A 3F0CA 2CFXA 2OZ6A 3BR3A 3T8RA 5HOOA 3OYGA 2BZTA 1K78A 2DA2A 1H88C 2OTLI 1U8RA 2G0EA 2PI0A 2XAGA 5CVRA 3JRGA 1IUFA 4HX4A 1I3AA 1FEXA 2KMUA 2XKOA 4Q4ZF 3CUQB 2ZXHA 1TC3C 1LVAA 1EH6A 4NQWB 1HDPA 2DTRA 2ZSIB 1MMGA 3ABUA 2ME6A 2NS0A 5AIPA 4A3LJ 3L2CA 4FT8A 3OYIA 2V9VA 4CYDA 2MSYA 1IDZA 3RYPA 1ZGAA 3C2BA 2OTJI 4KN7X 4OAYA 4PDKA 4XLFA 2V79A 3HTUA 1QGPA 1FZPB 1TWCJ 3CP8A 2HQNA 2W57A 2Y31A 1W7PA 4Z6YA 2X0LA 1YS7A 2HVQA 4XMYA 3M1CA 1ETVA 1RPWA 3AG2H 4EATA 2DODA 3RPQA 1YW9A 3T1BA 4D1QA 5ILSA 4EJUA 2JJ7A 3JTHA 4B3AA 5EZHA 2FQ3A 3CMAI 2IGMA 4KMUX 3TQNA 1QPIA 2OJED 1BR4A 3PIPF 4DW6A 1S72I 3BLYA 3NAUA 3X2QH 3TW6A 4D5FA 4YIFA 2R7XA 2Y0MA 4PSWA 1XS9A 3ZQHA 2A3SA 1YLFA 2Q0OA 2VL8A 3QOPA 5KVRA 4A3MJ 3V4GA 3PFYA 1YJ9I 3Q9SA 2FMYA 2QBYA 1MBKA 3HZJA 4ITVA 2IS1A 5LGTA 2W25A 2WAQN 3LSMA 2HQAA 5ILUA 5K5QA 2QUFA 3ZMVA 1LNWA 1D0YA 3DWLE 2VASA 2KQRA 3SFZA 2LNBA 3BTJA 2EV6A 5BMZA 3WTXC 2A5YB 1AWCA 3PQKA 1T6SA 4E4HA 4BNCA 3J7AO 1U5TC 4PK4A 1BJZA 2FOKA 3ESWB 1WH5A 3FX3A 1V5EA 2WC2A 2B63J 3HIFA 4B8XA 3Q0VA 2NVYJ 5DEQA 1D0XA 2E2IJ 4XONA 1EKEA 1P7JA 3R0JA 4IRGA 1XC5A 2AQEA 2G7HA 2CQXA 2DN0A 1SD6A 3BP8A 4CO8A 4BL0B 1WFXA 2YPRA 2DPUA 3HUGA 4YEJA 4BDYA 5TGTA 4AUXA 2IA1A 3GTJJ 4XSZF 3CO6C 2H6BA 4KNYA 2FX0A 2XASA 4DBQA 5E1XA 2XAHA 1MNMC 4HLYA 1MZBA 2RGVA 1WI9A 3GZ6A 4XORA 3L1PA 4L9NA 4X0GA 1HA8A 4XSXF 2GM4A 3G73A 2OU2A 3RIRA 3K70D 2K4JA 2EJRA 3K4LA 1K6YA 2IAIA 2XAJA 3G1LA 3J80Z 4ETSA 3JSOA 3FMSA 2GXAA 3D0SA 1EJ9A 5KK1A 4I2OA 3FXKA 1J0RA 1EA3A 1Z1DA 4HPQA 3KP6A 4AD9A 2XF5A 5J4VA 2XSJC 1NTCA 4Y17A 2E35A 2A07F 1IZ1A 3NQOA 3JTGA 1Z9CA 2QGUA 1DDNA 1LEBA 4FHTA 4XL9A 2IA2A 3GFIA 3BG7A 4A6EA 2K9SA 3KIOA 3QU3A 2A69F 1ETYA 2OA4A 3G6EI 4ZTJA 1U2WA 1ZG1A 4E7IA 4RGXA 1T38A 2VT2A 1W5CC 1D5YA 1ZLKA 5ILVA 5AIQA 3KP5A 1BR1A 4MQVA 2FSWA 3DXJF 4V2GA 2QQ9A 3IH4A 3RI4A 2ETHA 3DCFA 1X3UA 1TP4A 1XDSA 2VC1A 2X1DA 3F8NA 1V3FA 4M3DA 5L3CA 4XKWA 2LP0A 2LRDA 1OJLA 4AWXB 2W7NA 3R6SA 3EUHC 4F91B 4HX7A 2EZHA 1FYMA 4HNUA 1WJ5A 3OV8A 1VQ4I 3S14J 2PN6A 2M7AA 3A03A 1H0MA 4EM1A 3MWMA 4IF4A 4JX5A 4UV9A 1RRJA 3ZGKA 4RS8A 1D0ZA 2E1MC 1SFUA 2BHZA 3EPZA 3PUFA 2CSOA 2FNAA 1QHHD 3H36A 4JBAA 4O3MA 5D6EA 1R4MB 1W0UA 1YW7A 2OUMA 4V2FA 2GOXB 2PLYA 2VBWA 3AG1H 4LB6B 5IOYA 1KQ0A 2R7OA 3B02A 2FBHA 3R61A 5GPCA 3L2VA 1FMWA 1PDNC 5J47A 1WGXA 2PX9A 3LAPA 2P7VB 1DPUA 1R22A 4W97A 3HPHA 3DU5A 1OQYA 2KIQA 4Y7NJ 2XSDC 4XNFA 5KHDA 2K9QA 5C4JJ 2M8GX 3F8BA 1USTA 4DYCA 2BGCA 1BIAA 4S04A 4YIIA 5HNHA 2Z16A 2HYJA 2VJJA 3CUQA 2VODA 3DEEA 4XN3A 4NQWA 5FROA 1WZ2A 2R7ZJ 2DLLA 4ZZDA 3IH2A 2EV5A 2W4SA 1FOYA 2PBIA 2E5NA 1FYLA 3OIOA 2OCCH 2E1NA 3LSTA 2DMNA 3BJOA 5M5XJ 4B44A 1KYWA 2HZTA 3K70C 2P7CB 4EJOA 1E3HA 2M4KA 2Q1ZB 1XCBA 2ECCA 5CJ9A 3SJMA 3S16J 4NC7A 1I6HJ 3E1SA 4G7OF 5JLWA 1R71A 4MGRA 2OZUA 3ABTA 4ASNA 3CMYA 3FMRA 1T0FA 1H9TA 2QF7A 1TWHJ 5IPAA 2XDVA 1K61A 4D9JA 4UB6C 4JK1X 2OV7A 3P9CA 5E1ZB 4D7NA 2RQQA 4KN4X 3DKYA 3AKZA 4A3JJ 2ECBA 1YOVB 2LBFB 1NK2P 1ZRDA 5J6XA 2V1UA 1X1PA 4WXHA 5D5VB 4YG2F 3OY9A 2YX4A 4BJ6C 3EUKL 3HRUA 3T0YA 1IRFA 4LG3A 2ISZA 4OWRB 4CGZA 1LDJA 2Y0SN 2W1OA 4B4CA 2L4AA 4YFKF 3S1NJ 4E7SA 2R0QC 2UZKA 2HPIA 2VN2A 1ZYRF 3DTKA 3K4BA 4A3FJ 1F43A 2AXTC 3U1KA 1J09A 2XF7A 4RDUA 1K4TA 5KAIC 1IV8A 3E0JB 4XKBA 2CRGA 3GFLA 1T98A 3H9JA 4KDPA 1HKSA 4Q5SF 2JA2A 2CH0A 2DOAA 2XC7A 3F8MA 2F48A 2H94A 2W85A 2AXLA 2Z3YA 3KX2A 1A6QA 4AYBN 3S1MJ 1MMSA 3I58A 2EA4A 3FM5A 4PFPA 2ZO4A 2ZMEB 2ZCWA 3C1DA 3VSKA 1O57A 3GWZA 3A01B 3J7AY 2M0CA 4ZH4F 4DJAA 1ACIA 3CLQA 3RCOA 1HBXG 4M3FA 2BY0A 1ZELA 1FMVA 4KA4A 1DU0A 1UCRA 2GIZA 3DU6A 3JRDA 3VEPA 2EZIA 2Q8KA 2NOGA 1T33A 3GVAA 1PVEA 1ZG5A 3WU2C 2HDWA 1TWFJ 2WV0A 3HJEA 4NUBA 4UUTA 5HLIA 5BNGA 4HV6A 2DK8A 3W2WA 1BN5A 1NG7A 1XGNA 4B47A 3JAMZ 3HOUJ 4I6ZA 3S2WA 4B1RA 1HCRA 4C3HJ 1ENHA 2HXIA 1IRXA 4XRSG 1P4AA 2QSHX 3HRMA 4MO7A 2VOOA 2AS5F 3MMYB 2DMTA 2NAZA 4RB1A 1WH7A 2LKPA 2BE5F 3RPUA 4I76A 4IHWA 2IS6A 2QSFX 4KIFA 2DYRH 5H2FC 3ONQA 4RAYA 4BQNA 4BU2A 1MBHA 1XTAA 4BQQA 4IL6C 4YELA 1IN8A 3BG3A 1I5ZA 5K7FA 1G3WA 5IOZA 3F8CA 4UUVA 2DMPA 1XMXA 4J19A 3TO9A 3BJAA 4RA2A 3ZQFA 2LYCA 3CZ6A 2VQGA 2HGCA 5FLVA 4LK0F 3ML6A 4DZJA 1W0TA 2OCEA 1HF0A 5GAEJ 1W4MA 3DPTA 2MBFA 2DK5A 1YYVA 4IHXA 3BTIA 2Z2SB 3K4NA 1M1EB 2HXOA 2ZXJA 2BVMA 2ESHA 3A4CA 3IAS2 2L3DA 3RQ4A 2R7SA 2HDCA 3GTOJ 3Q0UA 3IH3A 3BQYA 4EJVA 1BBYA 4Q47A 5J4YA 3RYRA 1ZAOA 4B3XA 3K2AA 2XIGA 1WJDA 2E34A 3CDHA 1B1BA 3ZMZA 2VONA 1D5VA 3PM1A 3OR1C 1POGA 2JUGA 3KZZA 2VE8A 1ETOA 5ICEA 1HW1A 2XAFA 1VQMI 3Q3SA 2D5VA 1D1BA 2ZSHB 1KYZA 1X1DA 1JGSA 3DV8A 3HOWJ 1JJ8C 1LB2A 1OPCA 2CW7A 5IYDJ 5CYVA 5D4SA 3S2HJ 2VKDA 1G3TA 2P6SA 4XLPF 2DFHA 3G1OA 2DA1A 3GXOA 2ZXWH 3HSFA 3TOAA 4A3CJ 3BR1A 4B09A 4BE2A 3SQNA 3L00A 1JKPC 3WTVC 2VI6A 3H0DA 1TLHB 2IW5A 3KPHA 4WCGA 4RM3A 5IY5H 3HSEA 1JJ6C 3KZYA 2JA8J 3KEYA 2K9MA 1K4SA 2KDOA 2LREA 1YJWI 2WAQA 1Y6IA 2LH9A 3BG9A 2JA7J 1QZYA 2LG4A 3P9KA 2X4HA 3MQ0A 2DO7A 3L09A 2Y75A 2WTEA 2IJLA 3HGYA 2STWA 3E3VA 2WWYA 1OKRA 3KEQA 1J59A 2IBDA 4UHTA 4Z2YA 1USSA 1JHFA 5EG0B 4XLHA 3F21A 5F27A 3QODA 3NRVA 3JRHA 2IEKA 2ADUA 2E71A 2D1HA 2VC0A 2HYGD 2B9SA 3LNQA 1XCVA 2LBFA 1STZA 2NRAC 4FTHA 1SMTA 1FOWA 1X4OA 2X6WA 4CYCB 3CDLA 3J81K 4U88A 2DA5A 4WXCA 1Y1WJ 4M72A 2ZJQF 3AFHA 2EIJH 1GV2A 3RKXA 5M3MJ 5C4XJ 4PGHA 4NDLA 3OYMA 1QRYA 3CC4I 4U0VA 2STTA 4XICA 1U78A 2HWVA 1TT0A 5CQEA 2E1OA 3RSNA 1IJWC 5HDKA 3CCYA 2XRNA 1MNEA 1V4RA 5CVVA 2KZGA 1NH3A 1RC9A 1ONVA 3EQLF 4A3KJ 1OR7C 5C44J 1Z91A 4PZJA 4NC6A 1R6RA 1TT5B 2LSOA 4F92B 2F5DA 1X2MA 3G71I 3ZMUA 1XSXA 2FJ1A 3RKWA 5HLGA 1ETKA 3Q5FA 2RV8A 4NB5A 2K02A 1X4PA 1P7IA 4A2UA 2P4WA 3F6OA 1QZEA 3A01A 2DA6A 4B48A 3SEQA 2KRHA 3SYTA 5FRNA 5DV5A 4A69C 1CF7A 2FMLA 2X1EA 1H9GA 2MG4A 4HQMA 5FB2A 2F6CA 4BY1J 2L01A 1XN7A 5J8FA 2QM3A 3S15J 2UXXA 1AA7A 3K1PA 3P5JA 3WU1B 5ICFA 3S3NA 3C2GA 2X6OA 3F8FA 5K5OA 3HSRA 2LY9A 3BZKA 3QP5A 4Y13A 1B8IA 3QWLA 1YTYA 3GTMJ 3IHUA 3EYYA 4GCVA 1TW2A 2F4MB 3KLNA 5CQGA 1TTYA 4ZDOA 4C3IJ 3RZOJ 3LSJA 3BJ6A 4DGWB 1U6GA 3QYEA 3TL4X 4UUSA 4QPOA 2GIVA 2XAUA 5F04A 4LG0A 5A2QK 5KCMA 2XPWA 3W2AA 4F55A 4KFCA 3T8TA 5LRSA 1SC7A 2V6CA 3CDIA 2Y69H 4BUPA 1YQAA 1RNLA 3KETA 2WV1A 4G9YA 2E2JJ 1X3ZB 2MA3A 1KQ8A 5FFZA 2DJIA 2VPRA 3SFIA 2K5CA 4P9FA 2L9RA 2BXYA 4A0XA 3I0TA 2J5OA 4BKXA 1BA5A 3CCEI 1HQCA 2IS2A 2CMPA 2FXAA 3CD6I 1Y56A 4CH7A 4HDVA 1R00A 2JMWA 1T95A 3MZHA 2WY8Q 3SZGA 4IQ4A 5H6QA 4KICA 1FP1D 1WI3A 2V1XA 2H8WA 4KISA 1S3JA 1ZH5A 4HQEA 3HHGA 2HOSA 1FT9A 2G7UA 3ZOBA 3QU6A 2QENA 4LIVA 2DDBA 3N05A 2MFZA 4YIRX 3OYEA 3ZMDA 2JN6A 4II2A 1TWGJ 2D2WA 5M3FJ 2Z5UA 2RQPA 4LITA 4CDGA 4DQ2A 2JVHA 3BTCA 3ERMA 3BR0A 2O8KA 1REPC 1NHAA 5LFAA 1OCOH 4D0PA 5JVGF 3IC7A 5J40A 2TCTA 4P9UA 3IV5A 2HZDA 2HOTA 4XRFA 1ITYA 2X51A 5LBQA 4RAGA 4ZYDA 2JVGA 2KIUA 2K4BA 3FISA 3CO7C 3F3XA 3H5NA 3HKZN 2YUSA 2VBXA 5CPRB 3JW4A 3HYIA 4HF2A 2CFOA 2VBYA 1KQ9A 2VQLA 2R92J 2EBIA 3H1CA 2RC4A 2VB6A 1P4WA 1ETXA 3I4NJ 1U9OA 4UVAA 3IRRA 2WB1N 3A0HC 1T39A 2RNGA 1WRJA 3E5XA 3HG9A 1W5TA 2RREA 2V26A 3CESA 5LRRA 1C0WA 1T2KA 1V54H 3FXMA 2JA5J 1HDDC 4PSXA 1R1TA 5HLHA 4WX9A 3B6CA 1JXSA 1MKMA 1MGTA 2KP6A 2XPUA 1RR7A 2XGXA 1HW2A 3QYFA 3DQVC 2HU9A 3CCVI 2ZMEC 1KGSA 3K9TA 2L9NA 3MN2A 4ENMA 1ETQA 2H1KA 2A6HF 2CQKA 2O61A 3QPSA 2EFQA 4H4KC 2ZBKA 3VWBA 4IOAF 1GHCA 1IAWA 3WTUC 3OYLA 1U9NA 1WJBA 1J7KA 2P6TA 2HPMA 3GTPJ 2O3FA 5CVUA 2QYOA 5E8GA 5K1YA 5EG0A 5B1BH 1RKTA 2QQBA 3TO6A 3HOVJ 5D6FA 4Y52J 3FF5A 1UMQA 5HDGA 3JRIA 3KE2A 1YRNB 2JPBA 2JWTA 1IV6A 2PMHA 3UNGC 4UY8I 3LWFA 1HXDA 4RB0A 4JYKA 1FOXA 3BPXA 1B6AA 4WWCA 3V7CA 4CYCA 1UELB 1EF4A 3DF8A 1AHDP 3BCBA 4DZPA 1S5LC 2LR8A 1B59A 2DOFA 2HDDA 4PJ0C 3U2RA 2LTPA 3V7SA 1SFOJ 4KIBA 4HRIA 4CCLA 2F4IA 3PQJA 1ZGJA 2HQ5A 3TP3A 3BT9A 3IL2A 3OYAA 1QPMA 2GOMA 2GBYA 3KLOA 2WA0A 2JPCA 2XROA 5JR3A 5JLXA 3LAJA 3TOBA 3M7GA 5FRMA 5LD2C 1HLVA 2E1CA 3K2ZA 3DBRB 3SZTA 1VQPI 3I4MJ 5FD5A 5E8IA 3L7WA 5DDGA 1FTTA 2VJIA 1P6RA 2CS3A 2O9LA 4O5VA 4FX0A 1RUOA 1UHWA 3PSFA 3FKIJ 5FO5A 3A2KA 1WHUA 2I8DA 3CJQB 2P5KA 3L9FA 3UKGA 4A3EJ 5IT9K 5HNFA 3VODA 2BHYA 3FXJA 1Z67A 3O2PE 2MD0A 3SXYA 1H89C 4L9TA 1YS6A 4DYRA 3S3MA 2OD5A 5J1RA 2VT3A 4TV7A 2ELJA 5FLXZ 3E5QA 3WG9A 3OYBA 2KFDA 1I6XA 2B7EA 4QPQA 2KPMA 4UVCA 2VE9A 1I1SA 1RETA 4A12A 4M6VA 1G2HA 2FEZA 3BZCA 3S2DJ 1PP8F 2KZVA 3EYIA 3A02A 3RJPA 2ELHA 3O3KA 1FSEA 2HTJA 1BIBA 1MSFC 2NYXA 4MLOA 3K0LA 1LE8B 3BR2A 4Y33A 4OINF 3R0AA 2CQQA 1IN4A 4OAZA 4IZZA 2Z1DA 4N9IA 4DIQA 5D8KB 3H9QA 3BCAA 1NG6A 1O3RA 3MKLA 2E36A 4D7MA 2R7FA 1YITI 3L2UA 3JR9A 1SD4A 2Y9YA 3WHCA 1OLTA 5IP7J 2DA4A 3AG3H 3N4MA 2UXNA 3FK7A 5FKKA 1PUEE 5D5WB 3EUAA 4EM0B 4AVPA 2QCOA 2L4MA 3FBNB 4HF1A 1JUPA 3OYHA 3LSRA 3LFKA 1DQUA 1ZREA 2XUBA 3ZR8X 4I99C 3BG6A 1ZRCA 3OSGA 1MBFA 5GAHJ 1R36A 2TRTA 2CV2A 4L0YB 1VI0A 3GMEA 3TBIA 4WK8F 5FJ8J 1JI8A 3M3YJ 5ICCA 1EV7A 3D5SC 5F0HA 1MMAA 2QLZA 3OMYA 1MBEA 2CYYA 3GTQJ 3AL0B 2B0LA 5TISC 4HV5A 1XMKA 2F5VA 3QPTA 5BOXA 1PUFB 5DYMA 3RZDJ 2BY3A 3HDDA 3LSKA 4L9VA 3S32A 1DP7P 5M5WJ 1A31A 3QPHA 2NS8A 4YFNF 1D8KA 1IXCA 2HOAA 3MKYB 1DU6A 2EFOA 3VSLA 4HA8A 4ON0A 2PG4A 4JX6A 2HTSA 3O8GA 3GO5A 3D1NI 1LEAA 2R7VA 4RGRA 3V8LA 4M3EA 2FA5A 2QZ8A 2K85A 2HVSA 2R5ZB 3IWZA 4J00A 5EYRA 2E19A 2NS7A 2XVCA 3VPRA 3MVPA 3HOZJ 1MW7A 4WXDA 1FYKA 1GLNA 4XRSA 5LLQA 3LA3A 1TZLA 1LDDA 2OF7A 2NXNB 4I01A 1TW3A 4QSHA 4CCJA 2FOWA 4HX8A 3I53A 1SFXA 3OL4A 5CVIA 3OL3A 4IEJA 3WGIA 4BQAA 1QHGA 4A0YA 4RB2C 5IYBJ 3CCQI 1SEUA 3KYCB 4UB8C 2HS5A 4Y15A 4EM2A 1UG2A 4BBRJ 1LUJB 2CU7A 3CQZJ 4EJTA 1TWAJ 3GF2A 4XKVA 4AM3A 1Q1VA 1GXPA 2WAEA 4ESJA 2PMZA 1IUYA 1HSTA 1FBUA 2GQQA 1D1CA 2ISYA 4XR6A 2HOEA 3H9GA 1VQKI 1CF7B 2A5WA 2ZC2A 1TNSA 2EQRA 2E60A 3KYDB 3CCJI 4O6JA 4U87A 3FMQA 4BACA 1YRNA 2M45A 2ELKA 2V7FA 2DT7B 3K10A 5L3GA 1B8IB 4E70A 1BOBA 1XMAA 3WHBA 4M3GA 4BXFA 1R5ID 3FDYA 3IAM2 2GWRA 4FQGA 4YRVA 3H3VK 1SVMA 4MFEA 1WSUA 3ZN1A 4UUSB 4ZC3A 2X48A 4EVIA 4LG0B 1BI1A 1NK3P 4OIPF 5DM6F 1WPKA 1GXQA 4EJWA 3FK6A 3D5LA 2IS4A 2VOPA 4V19K 1OCRH 2FUG2 5DTDA 3HM5A 1JGGA 2EFPA 4G12A 5D8LB 3K1NA 5F0FA 4LLLA 4HOBA 3S8PA 1SFKA 1SAXA 3QOEA 2A6EF 2K7LA 3LOCA 1MSEC 5DM7F 4HW0A 3K6GA 1U3EM 3WTZA 4IHYA 2LKSA 1SAUA 4ESBA 1VTNC 5LHGA 3LSPA 3CUQC 2HQRA 2XPVA 3FWEA 5DD8A 2IA0A 2KRCA 3ABLH 1V5FA 4QTRA 3RPUD 2K27A 3HB9A 3K4KA 4JX4A 4IRIA 5L3FA 5EDNA 4QWQA 3E6CC 1B9MA 2L7KA 2XF6A 3I64A 1N25A 3GCMA 1ZARA 3WGHA 3M8JA 4BEHB 3P9IA 1K7AA 4HYEA 3S1RJ 1S9HA 2R5YA 3EDPA 4BXXJ 3ASNH 1HC8A 1OR7A 1L0OC 2VKEA 3K1MA 3W6VA 2BOLA 3CF2A 4FCYA 4M3BA 3FXUA 2C6YA 1JT0A 2EZKA 1HSJA 4ZYAA 2CUFA 2R7WA 3PO3J 1MJ9A 1B4AA 1R5GA 3DPLC 4J01A 4N4NB 3F22A 2RN7A 1LE8A 4IRHA 3CCSI 5JHUA 2CUZA 3ZCOA 2M4GA 4AIKA 3EETA 2DMQA 3ZQLA 1Y0NA 3HHHA 1MBJA 2KIMA 5ICGA 2XB5A 2COBA 3GFJA 3MCZA 3CC2I 1R9TJ 1FWZA 3VDXA 3PL8A 2KJCA 3GZ5A 2NVXJ 2X6YA 1Y0UA 1KU7A 2IVMA 3SDGA 1LVKA 2DOEA 3MD2A 3ZQIA 5FGMA 1MNDA 2K9LA 3G2BA 3DTIA 4XBFA 2LKXA 4RB3C 2GA1A 1FJLA 4IHSA 4XOPA 1ZR2A 1I3QJ 3F9KA 4JQFA 2ZKZA 2A61A 2I10A 2ID3A 2KIFA 4MHGA 3OOUA 2N8GA 1T8IA 3UR3C 1MMDA 2QKMB 1FLIA 3PO2J 3HBLA 1UB9A 2VJ4A 1XX5A 3OR2C 5D4RA 1P9QC 1OFCX 1PUFA 3HC7A 5J1YA 5E20A 2IT0A 1AOYA 2ZXIA 1OMIA 1BOAA 4BGDA 2D1VA 1ZKGA 2DXIA 1G3SA 2FRHA 5BQTA 4B43A 3LQQA 2M87A 1JUSA 1Y39A 4N0BA 1O7LA 4HG2A 2FNPA 3QYBA 1GVJA 4MIMA 1I1GA 3E6DA 4U0YA 3Q0WA 5JVTA 6PAXA 2WBMA 1ZHFA 2CUJA 3JREA 2R5ZA 2LC2A 2IGOA 1BI2A 3WG7H 2V1NA 4EMSA 2CW0F 5E3MA 4OIQF 1FNNA 3OOPA 5EEAA 1F5TA 5LGNA 3OS0A 2DDAA 2H27A 2WY7Q 2LMDA 3LSHA 3H0GJ 4GYGA 3TW7A 1Z0XA 4I98B 3ISPA 1EH8A 2EH3A 4IOCF 3GTLJ 4ZYHA 1S29A 2OBPA 4LOCA 4IO9F 4BE1A 3ABMH 3BROA 1VQLI 5DD4A 2BW3A 1SVLA 2KL4A 3WTSC 2D45A 2Z9OA 3CC7I 2NNNA 3PIOF 2Z33A 4XQFA 3OYNA 1JKOC 4U0WA 5J1UA 2CGPA 4XK4A 1X1AA 3DBHB 5HS8A 1KU2A 1BJAA 1RESA 1PYVA 2WADA 4KUMA 2M9HA 3GLXA 3M4OJ 2EB7A 3M8EA 3R4KA 2L02A 3J80K 4M6YA 2RKHA 3VYUB 1WJAA 4RLQA 1I50J 4NNJA 5D5UB 3ZP5A 2GLOA 1VQ9I 3AG4H 3G4SI 1Z05A 2QQ8A 3GX4X 4UVBA 5FKOA 1TQMA 1WCMJ 1XDUA 2XGEA 1IRGA 3KP3A 1XGOA 2KKOA 3K4MA 2DA7A 1U8BA 1G3YA 2JRMA 4RGSA 1LDKB 3JRCA 1J2XA 2R7UA 1DUXC 1FIAA 4A3GJ 3QAHA 3PNVA 1U5TA 4AIHA 2CV1A 1XGMA 3C7JA 1DGWY 1OYYA 2AHQA 3ASOH 5IT3A 1QVUA 2L7ZA 3DP7A 4F93B 1YW8A 1RKWA 3I54A 5DS9A 3TKYA 2W24A 1L3LA 1QNTA 1YI2I 4ENJA 1V5GA 2XGCA 1JT6A 3O6BB 1B9NA 2MH2A 1N75A 1LFUP 1LQ1A 2PJRB 4G7ZF 2R7RA 5C3EJ 1FX7A 2ESNA 1R23A 3BC8A 3HRSA 4OOIA 3FXLA 4G6TB 5KNLA 3BG5A 3DBLB 3F23A 4I0BA 1BR2A 1TQPA 3PFIA 2EZLA 4G8XA 2BXZA 1VQOI 3CMEI 2A6TA 2FBKA 1ZTRA 2HKXA 1XD7A 2Y2ZA 3H3ZA 4IXAA 5B66C 1OCTC 4LD5A 4PJLA 1IN5A 2BVLA 3E5UA 3I59B 3AL0C 2CQNA 3JCUC 1MMNA 5FKNA 1DPRA 5GADJ 3OS2A 4BEHA 3VYRB 1D1AA 1VFCA 4ZTFA 2ACJA 2MC3A 1ZGWA 4Q48A 1IF1A 2F2EA 5EEGA 5E3OA 5F1RA 4JOMA 3HRTA 1X58A 2V9KA 3K7AJ 5E18F 5E17F 4CUGA 5HDNA 1GDTA 4PJJA 4M74A 1FOKA 4I02A 2M1BA 4HSTA 4C2UA 3M1EA 3CMMA 5L3BA 4ENNA 4YFXF 1ZQ3P 4CICA 1RI7A 1ZN2A 3PNYA 1ZR4A 2QSGX 5TJJA 3VB2A 2Q2EB 2M2EA 4U7BA 3ROUA 4W1UA 1FP2A 1IN6A 3RQIA 3BDDA 4DOZA 5TRDA 2XKPA 4R79A 1Q1HA 3Q9VA 1IGNA 3EUHA 1W7PD 3NWSA 4LJZF 2LLKA 2NNYA 2F4OB 3SEZA 4CCOA 1O7FA 3TMOA 2MGQA 2F5EA 2P5LC 1N77A 1R1UA 1T56A 2VBZA 2YS9A 5JI6A 5KAFC 1CGPA 2R4GA 1U0JA 1MJBA 4E6KG 2O6GE 2LF7A 4RGUA 3CCLI 3K4CA 2VXZA 1SMYF 4XN0A 2Y0SA 2JZYA 2K40A 3HEFA 1QO0D 1F36A 3SHFA 3TP0A 3NARA 2Y9ZA 1UG0A 4L5JA 3VYSB 3BR6A 3OYCA 5E1WA 3S93A 3KZIC 5LHIA 3DEWA 3IP4B 1R49A 4AIDA 4C3JJ 1V55H 1P92A 4IQJA 1R7JA 4M9SA 4RAFA 4AC0A 3KP4A 4RM2A 2ME0A 3NEUA 2X6XA 1Y1VJ 4BS9A 4EQQA 1OYIA 2EIMH 2LOOA 1MDMB 1S7OA 3ZQ7A 4AYBA 1OCZH 3FXRA 3KEOA 4BHCA 3FIWA 2EFNA 4G94A 4IPAA 5DUIA 2DQLA 2O7OA 4RMNA 3OIQA 1IC8A 3LFUA 3ULQB 2XV4S 4A3BJ 3V7RA 4XLNF 5DUKA 3LSGA 3WE2A 4HNVA 3WODF 4GYIA 1PJRA 3J81Z 3KP2A 4BYYA 4KYWA 2HYFA 1F9NA 1D3YA 5EF6A 4C2TA 3BWGA 5BS6A 1F1ZA 2DMUA 3H92A 4FE4A 1QVTA 2XGDA 4H0EA 2H1LA 1T08B 3DFGA 3GLLA 4DNCA 4E7JA 2ZJRF 2F5CA 3ZMTA 1Z7LA 2IGNA 1X1BA 3OYFA 4BXUA 4ESFA 1MH3A 2LDUA 2O8XA 3WGGA 2DQRA 2OQGA 2L9VA 4ZYGA 1XG1A 5GPAA 4LGWA 5IP9J 1JE8A 4S0HB 3BOQA 1SD5A 4OMYA 3L2WA 1MIJA 3M9AA 2XHKA 4BJ5C 2L7MP 2W84A 3NWTA 2ZNYA 5JHFA 3BZ6A 2CUEA 2ZFUA 2EINH 4MEYF 4PGGA 5HLTA 5FD6A 2HI3A 2IPQX 3HOSA 1IXRC 1RZ4A 3LA2A 1TL8A 3JAMK 3U21A 4E7KA 2X9DA 4XLCA 3FHZA 4P55A 4L5EA 1ODDA 1ULYA 2DFFA 3A0BC 2QA4I 4Y3OA 3CLOA 2CW8A 1HKTA 2ZJ2A 3GW2A 2GA2A 2TDXA 2VQHA 2X1CA 2VLAA 3B6AA 4NHJA 3TDUC 2IXSA 3OWTA 3TDZC 3D5RC 4A5NA 3VFZA 2P8TA 2R5YB 5GTIC 4L18B 2DYSH 3OS1A 5A2QZ 1ZRFA 2HEOA 5B1AH 4L0ZB 5K7ZA 3RKYA 2DCEA 3C3WA 1WKMA 1VF9A 3C18A 4JP0A 2PFBA 2ZFWA 3GUDA 4MFDA 4BHBA 5L3DA 2GXGA 5F08A 1A04A 1G8XA 2HVRA 2PQ8A 4HSRA 2LFBA 4A0ZA 2LF8A 5E3LA 1R58A 2M3AA 5EGOA 2HR3A 2JUCA 1YO5C 2JSPA 2L5QA 4CCNA 1O4XA 3JRAA 1FBSA 1UHSA 3QPLA 4S05A 3V8JA 2VKVA 4NBQA 4G6DA 1YIOA 2PJRA 3SDBA 1BC7C 2P5VA 1OCPA 2LD5A 2R3SA 3IUOA 2NVUB 4ZJZA 5H6RA 3FXOA 3V8KA 3U9GA 2DT6A 1HW5A 1UHMA 1UJ8A 1SD7A 5JFRA 3W6KB 1Z3YA 2VJ5A 1Z21A 2ZB9A 1QU3A 4EGZA 1LJ9A 2PJPA 1B72A 5GP9A 4EGYA 1VQ5I 2QEXI 3DLAA 2QKLB 2PMUA 4PJNA 3I59A 4CA0A 2CG4A 5GTHC 1Z6RA 3CJRB 3W6JB 1E17A 2DFIA 5J8CA 2DFEA 5HS9A 4PUSA 2DA3A 3LA7A 3W2VA 2CWEA 1ERDA 1QQIA 2JRTA 2BY1A 1P4XA 3L2QA 1GVDA 4OU0A 4GXOA 5B3SH 4ENKA 2K3FA 1Y8QB 2LY2A 2HNHA 3OYDA 2H8RA 2YU9J 4UV8A 2K3PA 2M8EA 2ZJPF 1FTZA 1P2FA 2P81A 3KCCA 3BQZA 2XRLA 1GV5A 3I71A 3QRFF 2W48A 4D5CA 4FISA 3TO7A 2DJNA 3HXLA 3I9V2 2YX7A 4G6QA 4XOTA 4EEFG 4BBSJ 4BY7J 3LQRA 2Q2EA 4BQOA 3OIPA 2X85A 2GZWA 5F64A 5FKMA 3G1MA 3K69A 2E7WA 3GYHX 2QWWA 4KMFA 3RDIA 2A05A 1QZZA 3HL2A 5BPDA 1WWXA 2O0YA 3PNTA 5DCMB 4KITB 1J75A 2L9SA 4ZDPA 2MH9A 2MLKA 1XSVA 3VOEA 2VXDA 3H3UA 2FE3A 4GRIA 1I27A 3LL7A 4OIOF 3N97A 2EV0A 2Y48A 4BE0A 1JKQC 1VQ7I 3WTWC 4DYQA 1G6NA 1Z3XA 1TQIA 4E7LA 4CZCA 5IP6A 1BM9A 1E3OC 4LLGF 1JTXA 3CUOA 2BW3B 1WJFA 4M9ZA 5D5XB 3GTKJ 2UWMA 2M30A 1AKHB 1DGRM 4CHUA 2ID6A 4IJAA 3M07A 1A6IA 2K86A 3OYKA 5J3LA 3B73A 2RAEA 4RLFA 1X1CA 4L9JA 5HS7A 1SFEA 2KT0A 4MQ9F 2UUZA 2IRFG 3IKVA 3BTLA 1GUUA 3J7YJ 2DW4A 4Y4RA 3DKWA 5E3NA 2KJBA 3I55I 2I5UA 2O5RA 3LSIA 1MDMA 3E7LA 1RUNA 1SVOA 2EWNA 3OYJA 1W5SA 2R93J 2KDZA 4A3IJ 2FD5A 1LFBA 3DEUA 3ZRGA 3H35A 1YJNI 1OISA 3FZVA 1WVRA 4HF0A 1QBJA 2XAQA 4N4OB 2KISA 1PP7U 1WJEA 3FM3A 1ZG3A 4GFBA 3IWFA 4HEA2 4XLAA 2JSCA 4A3DJ 2DU9A 2L0KA 2V4JC 2DI3A 4NC8A 3CJTB 3E6BA 5ERIA 4HDUA 2Y30A 1LKXA 1YX3A 1U5TB 1HOMA 4IHTA 2E2HJ 1X2NA 4DBRA 4HAMA 4MEXF 1W1WE 4P5OA 2OAZA 2KLOA 1R1VA 1FY7A 4WF2A 3OSFA 1MD0A 3IKTA 5H20A
chains in the Genus database with same CATH topology
5EEAA 3TW7A 3H0GJ 3RKQA 1W0UA 2R92J 1Z0XA 2EBIA 2EH3A 4V2FA 3GTLJ 1ETXA 5K7HA 3I4NJ 1U9OA 4LOCA 2OPTA 2WB1N 5IOYA 3ZQGA 5GPCA 1WGXA 2JA5J 1HDDC 4W97A 1JKOC 5J1UA 1AU7A 1MH4A 3B6CA 1IDYA 4XK4A 1RESA 2XPUA 1RR7A 3QQAA 4Y7NJ 2XSDC 2K9QA 2M9HA 5FKLA 1IG7A 3M4OJ 5C4JJ 2M8GX 3BR5A 4DYCA 3MN2A 4XIDA 1ETQA 2H1KA 1I50J 2HYJA 3QPSA 2GLOA 2R7ZJ 3IH2A 1U9NA 3GTPJ 3S1QJ 3OIOA 5FKOA 5EG0A 2DMNA 1WCMJ 1RKTA 2XGEA 3HOVJ 1CQTA 2DA7A 1U8BA 5M5XJ 2MW8A 3JRCA 4Y52J 1UMQA 3JRIA 1FIAA 2ECCA 4X1EA 3JRBA 4A3GJ 3SJMA 3S16J 1YRNB 1IV6A 2JWTA 1I6HJ 5JLWA 2AHQA 1QVUA 3CMYA 2L7ZA 4JYKA 2K9NA 2QF7A 1RKWA 1TWHJ 5DS9A 5IPAA 4CYCA 1K61A 1MBGA 1EF4A 1AHDP 4D7NA 4DZPA 3S17J 2LR8A 1JT6A 2XGCA 2HDDA 2LTPA 3TEDA 1SFOJ 4A3JJ 2ECBA 1NK2P 1LFUP 1BL0A 2HQ5A 3JRFA 5C3EJ 3TP3A 3BT9A 2GBYA 3BG5A 2Y0SN 4B4CA 3HOXJ 3S1NJ 1ZK8A 5JLXA 2R0QC 2EZLA 1HLVA 1F43A 4A3FJ 3I4MJ 4RDUA 1ZTRA 2CRGA 1FTTA 2Y2ZA 1Z77A 4A93J 1OCTC 2O9LA 3FKIJ 5FKNA 3UKGA 4A3EJ 1VFCA 4RBOA 1GT0C 1ZGWA 1JTYA 4AYBN 1H89C 3S1MJ 5E3OA 4DYRA 1X58A 5J1RA 1IRZA 3K7AJ 3A01B 1GDTA 2M0CA 1K83J 4M3FA 2L7FP 4X6AJ 5F0CA 1DU0A 1RETA 3JRDA 5IYCJ 2EZIA 4M6VA 1ZQ3P 2NOGA 1ZR4A 1T33A 1G2HA 3S2DJ 2M2EA 2CJJA 3A02A 3HGGA 4W1UA 1TWFJ 2NVTJ 3RQIA 4UUTA 1IGNA 5BNGA 1MSFC 4MLOA 1LE8B 1ETWA 3BR2A 2CQQA 2LLKA 3HOUJ 4I6ZA 2NVQJ 4B1RA 1HCRA 4C3HJ 1ENHA 2HXIA 3MKLA 4XRSG 9ANTA 2MGQA 4D7MA 1T56A 2YS9A 4MO7A 5F1JA 1AKHA 3JR9A 2DMTA 1SANA 1WH7A 2Y9YA 5EZGA 3WHCA 5IP7J 2DA4A 2JA6J 4I76A 1BW6A 4IHWA 4IHVA 3FK7A 5FKKA 2K40A 3HEFA 4C2MJ 1MBHA 1F36A 3TP0A 4FE7A 2QCOA 3NARA 3BG3A 2Y9ZA 1JUPA 2VUMJ 5FLMJ 3BR6A 3LSRA 5K7FA 5IOZA 2DMPA 4J19A 3DEWA 2XB0X 2FQ4A 5M5YJ 2PMZN 1MBFA 3OSGA 4C3JJ 2JK3A 4QIWN 1H8AC 4AC0A 2TRTA 1VI0A 2ME0A 3ZQFA 5FJ8J 3M3YJ 5FLVA 1Y1VJ 4DZJA 1W0TA 5F0HA 3ZQCA 1HF0A 1MBEA 3GTQJ 3FIWA 1JUMA 1VNDA 4ABZA 4IHXA 2O7OA 3BTIA 1PUFB 1IC8A 3RZDJ 2HXOA 3HDDA 4A3BJ 3LSGA 5M5WJ 4HNVA 1A5JA 2NS8A 3GTOJ 3Q0UA 3IH3A 1S7EA 3BQYA 2HOAA 1JKRC 1DU6A 5EF6A 2DTZA 2DMUA 1FIPA 3K2AA 4FE4A 1QVTA 2XGDA 4JX6A 1APLC 3O8GA 5EGOB 3D1NI 3PM1A 1POGA 4M3EA 1ETOA 2LVSA 2R5ZB 3Q3SA 5EYRA 2E19A 2NS7A 2D5VA 1MH3A 3VPRA 3MVPA 3HOZJ 3GBGA 3HOWJ 1JJ8C 1XG1A 5GPAA 5IP9J 4XRSA 5IYDJ 4S0HB 3S2HJ 2OF7A 2L7MP 3G1OA 3HOYJ 2DA1A 4QSHA 2CUEA 4IEJA 4A3CJ 3BR1A 1B72B 5HODA 2HI3A 5IYBJ 4XRMA 2AO9A 1ORKA 3O8HA 1JKPC 2M34A 2LK2A 2X9DA 2VI6A 1UG2A 4BBRJ 3F0CA 1JJ6C 2CU7A 3CQZJ 3BR3A 4L5EA 2JA8J 1TWAJ 1Q1VA 2DA2A 1H88C 2G0EA 3JRGA 1IUFA 3B6AA 1FEXA 3BG9A 2JA7J 2R5YB 1TC3C 2EQRA 3HGYA 1HDPA 5K7ZA 2ME6A 1VF9A 2IBDA 1YRNA 4A3LJ 4JP0A 5EG0B 2ELKA 1B8IB 4MFDA 2MSYA 1IDZA 3WHBA 3C2BA 4M3GA 5F08A 5F27A 3JRHA 2IEKA 3H3VK 2LFBA 4MFEA 5E3LA 4UUSB 5EGOA 1TWCJ 2X48A 1O4XA 3JRAA 2Y31A 1NK3P 1UHSA 1WPKA 3QPLA 3FK6A 3LNQA 2VKVA 1ETVA 1RPWA 4FTHA 1OCPA 2LD5A 4CYCB 3CDLA 2JJ7A 5DTDA 4B3AA 1Y1WJ 2DA5A 5EZHA 3HM5A 1JGGA 4G12A 1GV2A 5M3MJ 5C4XJ 5F0FA 1QPIA 4NDLA 1QRYA 4XICA 4DW6A 2ZB9A 1U78A 3LOCA 3NAUA 1MSEC 3TW6A 4D5FA 2E1OA 1IJWC 4IHYA 1XS9A 3CCYA 3ZQHA 5GP9A 3LSPA 1B72A 4A3MJ 2XPVA 1MBKA 4A3KJ 4QTRA 5C44J 2WAQN 3HB9A 4JX4A 1X2MA 2DA3A 5EDNA 2FJ1A 1ETKA 3BTJA 1GVDA 1P7IA 3A01A 2DA6A 2H8RA 2YU9J 3S1RJ 1FTZA 2P81A 4A69C 2XRLA 3BQZA 1BJZA 1GV5A 2MG4A 2R5YA 1WH5A 2W48A 4BY1J 4BXXJ 2B63J 4D5CA 4FISA 2DJNA 3S15J 3Q0VA 2NVYJ 2E2IJ 4BBSJ 4EEFG 4BY7J 2VKEA 1P7JA 2X6OA 3W6VA 2LY9A 1XC5A 2CQXA 2DN0A 4M3BA 4FCYA 1JT0A 1B8IA 2EZKA 3GTMJ 3PO3J 2CUFA 5FKMA 4C3IJ 3G1MA 3RZOJ 3LSJA 1LE8A 4AUXA 3GTJJ 4UUSA 2FX0A 5F04A 2XPWA 2DMQA 3ZQLA 1MNMC 1MBJA 2XB5A 2COBA 3L1PA 1R9TJ 2GM4A 1JKQC 4DYQA 2WV1A 2E2JJ 2IAIA 3G1LA 5IP6A 2NVXJ 1E3OC 2VPRA 3SFIA 1JTXA 3GTKJ 3SDGA 2L9RA 1AKHB 4BKXA 1BA5A 2ID6A 3ZQIA 1NTCA 1A6IA 5J3LA 2RAEA 2JMWA 2LKXA 2KT0A 1FJLA 3BTLA 1ZR2A 1I3QJ 2K9SA 1GUUA 2I10A 1ETYA 2ID3A 3GTGJ 5E3NA 1D5YA 3OOUA 1WI3A 2N8GA 3E7LA 2R93J 2KDZA 4A3IJ 4V2GA 2FD5A 3IH4A 1LFBA 3PO2J 3HBLA 2HOSA 3DCFA 1BW5A 1OFCX 1PUFA 3ZOBA 5J1YA 4GFBA 4M3DA 2JN6A 2LP0A 1ZKGA 1TWGJ 4A3DJ 1OJLA 2L0KA 5M3FJ 3BTCA 2Y30A 3BR0A 2O8KA 2EZHA 1JUSA 3S14J 1HOMA 3IV5A 2TCTA 3A03A 2E2HJ 2HOTA 1X2NA 1ITYA 4MIMA 3Q0WA 4JX5A 3JREA 2R5ZA 3FISA 3HKZN 2YUSA 3OSFA 5E3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EEA A;  3TW7 A;  3H0G J;  3RKQ A;  1W0U A;  2R92 J;  1Z0X A;  2EBI A;  2EH3 A;  4V2F A;  3GTL J;  1ETX A;  5K7H A;  3I4N J;  1U9O A;  4LOC A;  2OPT A;  2WB1 N;  5IOY A;  3ZQG A;  5GPC A;  1WGX A;  2JA5 J;  1HDD C;  4W97 A;  1JKO C;  5J1U A;  1AU7 A;  1MH4 A;  3B6C A;  1IDY A;  4XK4 A;  1RES A;  2XPU A;  1RR7 A;  3QQA A;  4Y7N J;  2XSD C;  2K9Q A;  2M9H A;  5FKL A;  1IG7 A;  3M4O J;  5C4J J;  2M8G X;  3BR5 A;  4DYC A;  3MN2 A;  4XID A;  1ETQ A;  2H1K A;  1I50 J;  2HYJ A;  3QPS A;  2GLO A;  2R7Z J;  3IH2 A;  1U9N A;  3GTP J;  3S1Q J;  3OIO A;  5FKO A;  5EG0 A;  2DMN A;  1WCM J;  1RKT A;  2XGE A;  3HOV J;  1CQT A;  2DA7 A;  1U8B A;  5M5X J;  2MW8 A;  3JRC A;  4Y52 J;  1UMQ A;  3JRI A;  1FIA A;  2ECC A;  4X1E A;  3JRB A;  4A3G J;  3SJM A;  3S16 J;  1YRN B;  1IV6 A;  2JWT A;  1I6H J;  5JLW A;  2AHQ A;  1QVU A;  3CMY A;  2L7Z A;  4JYK A;  2K9N A;  2QF7 A;  1RKW A;  1TWH J;  5DS9 A;  5IPA A;  4CYC A;  1K61 A;  1MBG A;  1EF4 A;  1AHD P;  4D7N A;  4DZP A;  3S17 J;  2LR8 A;  1JT6 A;  2XGC A;  2HDD A;  2LTP A;  3TED A;  1SFO J;  4A3J J;  2ECB A;  1NK2 P;  1LFU P;  1BL0 A;  2HQ5 A;  3JRF A;  5C3E J;  3TP3 A;  3BT9 A;  2GBY A;  3BG5 A;  2Y0S N;  4B4C A;  3HOX J;  3S1N J;  1ZK8 A;  5JLX A;  2R0Q C;  2EZL A;  1HLV A;  1F43 A;  4A3F J;  3I4M J;  4RDU A;  1ZTR A;  2CRG A;  1FTT A;  2Y2Z A;  1Z77 A;  4A93 J;  1OCT C;  2O9L A;  3FKI J;  5FKN A;  3UKG A;  4A3E J;  1VFC A;  4RBO A;  1GT0 C;  1ZGW A;  1JTY A;  4AYB N;  1H89 C;  3S1M J;  5E3O A;  4DYR A;  1X58 A;  5J1R A;  1IRZ A;  3K7A J;  3A01 B;  1GDT A;  2M0C A;  1K83 J;  4M3F A;  2L7F P;  4X6A J;  5F0C A;  1DU0 A;  1RET A;  3JRD A;  5IYC J;  2EZI A;  4M6V A;  1ZQ3 P;  2NOG A;  1ZR4 A;  1T33 A;  1G2H A;  3S2D J;  2M2E A;  2CJJ A;  3A02 A;  3HGG A;  4W1U A;  1TWF J;  2NVT J;  3RQI A;  4UUT A;  1IGN A;  5BNG A;  1MSF C;  4MLO A;  1LE8 B;  1ETW A;  3BR2 A;  2CQQ A;  2LLK A;  3HOU J;  4I6Z A;  2NVQ J;  4B1R A;  1HCR A;  4C3H J;  1ENH A;  2HXI A;  3MKL A;  4XRS G;  9ANT A;  2MGQ A;  4D7M A;  1T56 A;  2YS9 A;  4MO7 A;  5F1J A;  1AKH A;  3JR9 A;  2DMT A;  1SAN A;  1WH7 A;  2Y9Y A;  5EZG A;  3WHC A;  5IP7 J;  2DA4 A;  2JA6 J;  4I76 A;  1BW6 A;  4IHW A;  4IHV A;  3FK7 A;  5FKK A;  2K40 A;  3HEF A;  4C2M J;  1MBH A;  1F36 A;  3TP0 A;  4FE7 A;  2QCO A;  3NAR A;  3BG3 A;  2Y9Z A;  1JUP A;  2VUM J;  5FLM J;  3BR6 A;  3LSR A;  5K7F A;  5IOZ A;  2DMP A;  4J19 A;  3DEW A;  2XB0 X;  2FQ4 A;  5M5Y J;  2PMZ N;  1MBF A;  3OSG A;  4C3J J;  2JK3 A;  4QIW N;  1H8A C;  4AC0 A;  2TRT A;  1VI0 A;  2ME0 A;  3ZQF A;  5FJ8 J;  3M3Y J;  5FLV A;  1Y1V J;  4DZJ A;  1W0T A;  5F0H A;  3ZQC A;  1HF0 A;  1MBE A;  3GTQ J;  3FIW A;  1JUM A;  1VND A;  4ABZ A;  4IHX A;  2O7O A;  3BTI A;  1PUF B;  1IC8 A;  3RZD J;  2HXO A;  3HDD A;  4A3B J;  3LSG A;  5M5W J;  4HNV A;  1A5J A;  2NS8 A;  3GTO J;  3Q0U A;  3IH3 A;  1S7E A;  3BQY A;  2HOA A;  1JKR C;  1DU6 A;  5EF6 A;  2DTZ A;  2DMU A;  1FIP A;  3K2A A;  4FE4 A;  1QVT A;  2XGD A;  4JX6 A;  1APL C;  3O8G A;  5EGO B;  3D1N I;  3PM1 A;  1POG A;  4M3E A;  1ETO A;  2LVS A;  2R5Z B;  3Q3S A;  5EYR A;  2E19 A;  2NS7 A;  2D5V A;  1MH3 A;  3VPR A;  3MVP A;  3HOZ J;  3GBG A;  3HOW J;  1JJ8 C;  1XG1 A;  5GPA A;  5IP9 J;  4XRS A;  5IYD J;  4S0H B;  3S2H J;  2OF7 A;  2L7M P;  3G1O A;  3HOY J;  2DA1 A;  4QSH A;  2CUE A;  4IEJ A;  4A3C J;  3BR1 A;  1B72 B;  5HOD A;  2HI3 A;  5IYB J;  4XRM A;  2AO9 A;  1ORK A;  3O8H A;  1JKP C;  2M34 A;  2LK2 A;  2X9D A;  2VI6 A;  1UG2 A;  4BBR J;  3F0C A;  1JJ6 C;  2CU7 A;  3CQZ J;  3BR3 A;  4L5E A;  2JA8 J;  1TWA J;  1Q1V A;  2DA2 A;  1H88 C;  2G0E A;  3JRG A;  1IUF A;  3B6A A;  1FEX A;  3BG9 A;  2JA7 J;  2R5Y B;  1TC3 C;  2EQR A;  3HGY A;  1HDP A;  5K7Z A;  2ME6 A;  1VF9 A;  2IBD A;  1YRN A;  4A3L J;  4JP0 A;  5EG0 B;  2ELK A;  1B8I B;  4MFD A;  2MSY A;  1IDZ A;  3WHB A;  3C2B A;  4M3G A;  5F08 A;  5F27 A;  3JRH A;  2IEK A;  3H3V K;  2LFB A;  4MFE A;  5E3L A;  4UUS B;  5EGO A;  1TWC J;  2X48 A;  1O4X A;  3JRA A;  2Y31 A;  1NK3 P;  1UHS A;  1WPK A;  3QPL A;  3FK6 A;  3LNQ A;  2VKV A;  1ETV A;  1RPW A;  4FTH A;  1OCP A;  2LD5 A;  4CYC B;  3CDL A;  2JJ7 A;  5DTD A;  4B3A A;  1Y1W J;  2DA5 A;  5EZH A;  3HM5 A;  1JGG A;  4G12 A;  1GV2 A;  5M3M J;  5C4X J;  5F0F A;  1QPI A;  4NDL A;  1QRY A;  4XIC A;  4DW6 A;  2ZB9 A;  1U78 A;  3LOC A;  3NAU A;  1MSE C;  3TW6 A;  4D5F A;  2E1O A;  1IJW C;  4IHY A;  1XS9 A;  3CCY A;  3ZQH A;  5GP9 A;  3LSP A;  1B72 A;  4A3M J;  2XPV A;  1MBK A;  4A3K J;  4QTR A;  5C44 J;  2WAQ N;  3HB9 A;  4JX4 A;  1X2M A;  2DA3 A;  5EDN A;  2FJ1 A;  1ETK A;  3BTJ A;  1GVD A;  1P7I A;  3A01 A;  2DA6 A;  2H8R A;  2YU9 J;  3S1R J;  1FTZ A;  2P81 A;  4A69 C;  2XRL A;  3BQZ A;  1BJZ A;  1GV5 A;  2MG4 A;  2R5Y A;  1WH5 A;  2W48 A;  4BY1 J;  4BXX J;  2B63 J;  4D5C A;  4FIS A;  2DJN A;  3S15 J;  3Q0V A;  2NVY J;  2E2I J;  4BBS J;  4EEF G;  4BY7 J;  2VKE A;  1P7J A;  2X6O A;  3W6V A;  2LY9 A;  1XC5 A;  2CQX A;  2DN0 A;  4M3B A;  4FCY A;  1JT0 A;  1B8I A;  2EZK A;  3GTM J;  3PO3 J;  2CUF A;  5FKM A;  4C3I J;  3G1M A;  3RZO J;  3LSJ A;  1LE8 A;  4AUX A;  3GTJ J;  4UUS A;  2FX0 A;  5F04 A;  2XPW A;  2DMQ A;  3ZQL A;  1MNM C;  1MBJ A;  2XB5 A;  2COB A;  3L1P A;  1R9T J;  2GM4 A;  1JKQ C;  4DYQ A;  2WV1 A;  2E2J J;  2IAI A;  3G1L A;  5IP6 A;  2NVX J;  1E3O C;  2VPR A;  3SFI A;  1JTX A;  3GTK J;  3SDG A;  2L9R A;  1AKH B;  4BKX A;  1BA5 A;  2ID6 A;  3ZQI A;  1NTC A;  1A6I A;  5J3L A;  2RAE A;  2JMW A;  2LKX A;  2KT0 A;  1FJL A;  3BTL A;  1ZR2 A;  1I3Q J;  2K9S A;  1GUU A;  2I10 A;  1ETY A;  2ID3 A;  3GTG J;  5E3N A;  1D5Y A;  3OOU A;  1WI3 A;  2N8G A;  3E7L A;  2R93 J;  2KDZ A;  4A3I J;  4V2G A;  2FD5 A;  3IH4 A;  1LFB A;  3PO2 J;  3HBL A;  2HOS A;  3DCF A;  1BW5 A;  1OFC X;  1PUF A;  3ZOB A;  5J1Y A;  4GFB A;  4M3D A;  2JN6 A;  2LP0 A;  1ZKG A;  1TWG J;  4A3D J;  1OJL A;  2L0K A;  5M3F J;  3BTC A;  2Y30 A;  3BR0 A;  2O8K A;  2EZH A;  1JUS A;  3S14 J;  1HOM A;  3IV5 A;  2TCT A;  3A03 A;  2E2H J;  2HOT A;  1X2N A;  1ITY A;  4MIM A;  3Q0W A;  4JX5 A;  3JRE A;  2R5Z A;  3FIS A;  3HKZ N;  2YUS A;  3OSF A;  5E3M A; 
#chains in the Genus database with same CATH topology
 4AU7 A;  3MFK A;  5B5E C;  4G7H F;  3SZP A;  2M7B A;  1XPX A;  2DPD A;  1BI3 A;  3KFW X;  4CCK A;  3RKQ A;  3IRQ A;  2V9P A;  4IVN A;  4I09 A;  2M5W A;  2M0M A;  3JSP A;  5K7H A;  2OPT A;  4OIR F;  3J7Z I;  3HOT A;  3ZQG A;  1S7A A;  3I56 I;  5IT9 Z;  4AIJ A;  5EEH A;  3I4P A;  3PUB A;  4A5M A;  4IKF A;  2G9W A;  1BW5 A;  2GXB A;  2EPF A;  1AU7 A;  1BC8 C;  1KU3 A;  1MH4 A;  1Y8R B;  3BPV A;  1IDY A;  5LHH A;  4ZYE A;  5CKT A;  3QQA A;  1Z7U A;  1E3P A;  2FU4 A;  5EJC A;  3GTG J;  5FKL A;  1IG7 A;  4CSW A;  2L2O A;  3HTS B;  3PJR A;  2KHM A;  3BR5 A;  2A68 F;  3V42 A;  5ED4 A;  4XID A;  3ELK A;  4LK1 F;  3DTE A;  2MLG A;  3ZXS A;  1RR8 C;  3FBI B;  1K78 B;  3ZPL A;  4HZF A;  3FKJ A;  1FPQ A;  3FHN A;  4LB5 A;  2EK5 A;  1T0F C;  3S1Q J;  1IXS B;  2V6E A;  3ECO A;  1YIJ I;  2MC4 A;  3I3L A;  1CQT A;  3TGN A;  1N78 A;  2YU3 A;  2MW8 A;  1EH7 A;  1JHH A;  4X1E A;  3JRB A;  2ZNZ A;  3ERE D;  4PCQ A;  4HLX A;  2YR2 A;  2IP2 A;  4KT5 C;  3ECH A;  2CV0 A;  2O03 A;  2K9N A;  1RIO H;  3E6M A;  3GEZ A;  1MBG A;  2RDP A;  1W36 D;  4P96 A;  3HKZ A;  3S17 J;  1TBX A;  4BHP A;  3TED A;  1W7P B;  3U1D A;  1ON2 A;  1R5H A;  4XKC A;  1UZC A;  4MTE A;  4GO1 A;  4ZDL A;  4FX4 A;  1X19 A;  1YE9 A;  2BY2 A;  1BL0 A;  3JRF A;  2VPL A;  2VIX A;  2E1M B;  3RTR A;  4AVZ A;  2WB1 A;  3HOX J;  4R1H A;  2UV1 A;  1ZK8 A;  1O3Q A;  2R7T A;  4KIG A;  2JT1 A;  3ZN0 A;  3C2H A;  2CO5 A;  4K2E A;  4R8H A;  3CF5 F;  1O3T A;  4CCM A;  2E7X A;  1BI0 A;  1ZLJ A;  1Z77 A;  1YHQ I;  2H09 A;  3WTY C;  4A93 J;  4N9H A;  3E97 A;  1XSD A;  4KT6 A;  2HFH A;  2OQR A;  2PEX A;  4C9Y A;  1I39 A;  3AAF A;  2EIK H;  2QBY B;  3GZN B;  4II3 A;  4XLE A;  4CZZ A;  4UXN A;  1VQN I;  3PSI A;  2JTV A;  4HBL A;  5E79 C;  4F52 A;  4RBO A;  2AQF A;  4GGG A;  3DLL F;  1GT0 C;  1VQ8 I;  1XGS A;  2R7D A;  1JTY A;  2BV6 A;  5BPI A;  3MAJ A;  1A35 A;  2VQC A;  2GAU A;  4BAY A;  1F4K A;  1IRZ A;  1DP3 A;  2F5F A;  4MTD A;  3GFM A;  3WE3 A;  1K83 J;  2W00 A;  1K6O A;  3MKW B;  3F72 A;  2L7F P;  4X6A J;  5F0C A;  3H5A A;  1YX5 A;  2OC6 A;  2BEO A;  5LEK A;  5K5R A;  2MAB A;  2FF4 A;  5IYC J;  2WAF A;  3L2R A;  1J9I A;  2L54 A;  4LIU A;  3CCM I;  5DCM A;  2CJJ A;  2DBB A;  2MYS A;  3CTA A;  4F7Z A;  2P0W A;  1J5Y A;  4UNO A;  3DKX A;  3HGG A;  3MEX A;  2JQ7 A;  1E0E A;  2IGK A;  2E5Z A;  3CCR I;  2NVT J;  3HUG B;  3ZQQ A;  1ON1 A;  3WTT C;  2HKO A;  2QQA A;  4C30 A;  5LGU A;  4M71 A;  2Z99 A;  1ETW A;  1UAA A;  2W82 A;  3VYT B;  1E2X A;  3REO A;  2RNJ A;  1IO2 A;  4BJT A;  3H5R A;  2NVQ J;  1KU9 A;  2NOJ B;  4FAS D;  1XB4 A;  2DT5 A;  9ANT A;  4P1W A;  2CQ7 A;  4XM3 A;  5F1J A;  1AKH A;  1Z6T A;  1G4D A;  2EIL H;  3COA C;  2YSR A;  4LLN A;  4I0A A;  2EA2 A;  1SAN A;  5EZG A;  4LFU A;  2JA6 J;  1S8N A;  1S6L A;  1BW6 A;  4IHV A;  1KA8 A;  4M6X A;  4C2M J;  4I7H A;  2MD5 A;  4FE7 A;  3CP2 A;  2VUM J;  4L5I A;  5FLM J;  1D8J A;  5L3E A;  1FBQ A;  3KYL A;  2XB0 X;  2FQ4 A;  2DAO A;  5M5Y J;  2PMZ N;  2H6C A;  5CLS A;  3I5U A;  1LPQ A;  2JK3 A;  3CJN A;  4QIW N;  1H8A C;  3M8F A;  1OCC H;  2QVO A;  1R4N B;  4GDF A;  3LMM A;  4E7H A;  4E7Z A;  3ABK H;  1UFM A;  1IN7 A;  3ZQC A;  1FSH A;  1LFP A;  1W36 C;  3CCU I;  2ZME A;  1JUM A;  5FFX A;  1YFH A;  1VND A;  4QLC U;  2FBI A;  4ABZ A;  2V1D A;  4A6D A;  1QA6 A;  3MZY A;  1VZ0 A;  1WJC A;  2LY1 A;  3ZMS A;  4U7D A;  4FET A;  3T5X A;  4KJZ A;  4EV0 A;  1A5J A;  3FXQ A;  4PJM A;  1S7E A;  3KP7 A;  4RAZ A;  4HNT A;  5LEJ A;  4IX7 A;  1JKR C;  4BH9 A;  5HVQ C;  2DTZ A;  3A1Y A;  1FIP A;  1YG2 A;  3G3Z A;  2BBY A;  3BY6 A;  3MKZ A;  1APL C;  5EGO B;  2J5P A;  3MZ8 A;  1O3S A;  4M73 A;  3HPG A;  5AON A;  1WQ2 A;  3F6V A;  4ZZL A;  4PFO A;  2VKH A;  5CVJ A;  1KZH A;  3S3O A;  5FLX K;  2LVS A;  1FC3 A;  1TNT A;  3W3C A;  5GAG J;  1MJA A;  2BYV E;  5DCF A;  2EFW A;  4F3Q A;  3R60 A;  3GBG A;  2COM A;  1OYW A;  4BDZ A;  1IW7 F;  4ANJ A;  3DPU A;  3P7N A;  1KON A;  3HOY J;  2KRF A;  1X3W B;  4OMZ A;  1VQ6 I;  1HKQ A;  2RVC A;  1B72 B;  5HOD A;  3QP6 A;  4XRM A;  4M9X A;  2AO9 A;  4LMY A;  4MNU A;  1ORK A;  3O8H A;  4CXF A;  2M34 A;  1K79 A;  1A36 A;  2R7Q A;  2ICW G;  3K4J A;  2LK2 A;  1G59 A;  5F6F A;  3WU0 A;  3F0C A;  2CFX A;  2OZ6 A;  3BR3 A;  3T8R A;  5HOO A;  3OYG A;  2BZT A;  1K78 A;  2DA2 A;  1H88 C;  2OTL I;  1U8R A;  2G0E A;  2PI0 A;  2XAG A;  5CVR A;  3JRG A;  1IUF A;  4HX4 A;  1I3A A;  1FEX A;  2KMU A;  2XKO A;  4Q4Z F;  3CUQ B;  2ZXH A;  1TC3 C;  1LVA A;  1EH6 A;  4NQW B;  1HDP A;  2DTR A;  2ZSI B;  1MMG A;  3ABU A;  2ME6 A;  2NS0 A;  5AIP A;  4A3L J;  3L2C A;  4FT8 A;  3OYI A;  2V9V A;  4CYD A;  2MSY A;  1IDZ A;  3RYP A;  1ZGA A;  3C2B A;  2OTJ I;  4KN7 X;  4OAY A;  4PDK A;  4XLF A;  2V79 A;  3HTU A;  1QGP A;  1FZP B;  1TWC J;  3CP8 A;  2HQN A;  2W57 A;  2Y31 A;  1W7P A;  4Z6Y A;  2X0L A;  1YS7 A;  2HVQ A;  4XMY A;  3M1C A;  1ETV A;  1RPW A;  3AG2 H;  4EAT A;  2DOD A;  3RPQ A;  1YW9 A;  3T1B A;  4D1Q A;  5ILS A;  4EJU A;  2JJ7 A;  3JTH A;  4B3A A;  5EZH A;  2FQ3 A;  3CMA I;  2IGM A;  4KMU X;  3TQN A;  1QPI A;  2OJE D;  1BR4 A;  3PIP F;  4DW6 A;  1S72 I;  3BLY A;  3NAU A;  3X2Q H;  3TW6 A;  4D5F A;  4YIF A;  2R7X A;  2Y0M A;  4PSW A;  1XS9 A;  3ZQH A;  2A3S A;  1YLF A;  2Q0O A;  2VL8 A;  3QOP A;  5KVR A;  4A3M J;  3V4G A;  3PFY A;  1YJ9 I;  3Q9S A;  2FMY A;  2QBY A;  1MBK A;  3HZJ A;  4ITV A;  2IS1 A;  5LGT A;  2W25 A;  2WAQ N;  3LSM A;  2HQA A;  5ILU A;  5K5Q A;  2QUF A;  3ZMV A;  1LNW A;  1D0Y A;  3DWL E;  2VAS A;  2KQR A;  3SFZ A;  2LNB A;  3BTJ A;  2EV6 A;  5BMZ A;  3WTX C;  2A5Y B;  1AWC A;  3PQK A;  1T6S A;  4E4H A;  4BNC A;  3J7A O;  1U5T C;  4PK4 A;  1BJZ A;  2FOK A;  3ESW B;  1WH5 A;  3FX3 A;  1V5E A;  2WC2 A;  2B63 J;  3HIF A;  4B8X A;  3Q0V A;  2NVY J;  5DEQ A;  1D0X A;  2E2I J;  4XON A;  1EKE A;  1P7J A;  3R0J A;  4IRG A;  1XC5 A;  2AQE A;  2G7H A;  2CQX A;  2DN0 A;  1SD6 A;  3BP8 A;  4CO8 A;  4BL0 B;  1WFX A;  2YPR A;  2DPU A;  3HUG A;  4YEJ A;  4BDY A;  5TGT A;  4AUX A;  2IA1 A;  3GTJ J;  4XSZ F;  3CO6 C;  2H6B A;  4KNY A;  2FX0 A;  2XAS A;  4DBQ A;  5E1X A;  2XAH A;  1MNM C;  4HLY A;  1MZB A;  2RGV A;  1WI9 A;  3GZ6 A;  4XOR A;  3L1P A;  4L9N A;  4X0G A;  1HA8 A;  4XSX F;  2GM4 A;  3G73 A;  2OU2 A;  3RIR A;  3K70 D;  2K4J A;  2EJR A;  3K4L A;  1K6Y A;  2IAI A;  2XAJ A;  3G1L A;  3J80 Z;  4ETS A;  3JSO A;  3FMS A;  2GXA A;  3D0S A;  1EJ9 A;  5KK1 A;  4I2O A;  3FXK A;  1J0R A;  1EA3 A;  1Z1D A;  4HPQ A;  3KP6 A;  4AD9 A;  2XF5 A;  5J4V A;  2XSJ C;  1NTC A;  4Y17 A;  2E35 A;  2A07 F;  1IZ1 A;  3NQO A;  3JTG A;  1Z9C A;  2QGU A;  1DDN A;  1LEB A;  4FHT A;  4XL9 A;  2IA2 A;  3GFI A;  3BG7 A;  4A6E A;  2K9S A;  3KIO A;  3QU3 A;  2A69 F;  1ETY A;  2OA4 A;  3G6E I;  4ZTJ A;  1U2W A;  1ZG1 A;  4E7I A;  4RGX A;  1T38 A;  2VT2 A;  1W5C C;  1D5Y A;  1ZLK A;  5ILV A;  5AIQ A;  3KP5 A;  1BR1 A;  4MQV A;  2FSW A;  3DXJ F;  4V2G A;  2QQ9 A;  3IH4 A;  3RI4 A;  2ETH A;  3DCF A;  1X3U A;  1TP4 A;  1XDS A;  2VC1 A;  2X1D A;  3F8N A;  1V3F A;  4M3D A;  5L3C A;  4XKW A;  2LP0 A;  2LRD A;  1OJL A;  4AWX B;  2W7N A;  3R6S A;  3EUH C;  4F91 B;  4HX7 A;  2EZH A;  1FYM A;  4HNU A;  1WJ5 A;  3OV8 A;  1VQ4 I;  3S14 J;  2PN6 A;  2M7A A;  3A03 A;  1H0M A;  4EM1 A;  3MWM A;  4IF4 A;  4JX5 A;  4UV9 A;  1RRJ A;  3ZGK A;  4RS8 A;  1D0Z A;  2E1M C;  1SFU A;  2BHZ A;  3EPZ A;  3PUF A;  2CSO A;  2FNA A;  1QHH D;  3H36 A;  4JBA A;  4O3M A;  5D6E A;  1R4M B;  1W0U A;  1YW7 A;  2OUM A;  4V2F A;  2GOX B;  2PLY A;  2VBW A;  3AG1 H;  4LB6 B;  5IOY A;  1KQ0 A;  2R7O A;  3B02 A;  2FBH A;  3R61 A;  5GPC A;  3L2V A;  1FMW A;  1PDN C;  5J47 A;  1WGX A;  2PX9 A;  3LAP A;  2P7V B;  1DPU A;  1R22 A;  4W97 A;  3HPH A;  3DU5 A;  1OQY A;  2KIQ A;  4Y7N J;  2XSD C;  4XNF A;  5KHD A;  2K9Q A;  5C4J J;  2M8G X;  3F8B A;  1UST A;  4DYC A;  2BGC A;  1BIA A;  4S04 A;  4YII A;  5HNH A;  2Z16 A;  2HYJ A;  2VJJ A;  3CUQ A;  2VOD A;  3DEE A;  4XN3 A;  4NQW A;  5FRO A;  1WZ2 A;  2R7Z J;  2DLL A;  4ZZD A;  3IH2 A;  2EV5 A;  2W4S A;  1FOY A;  2PBI A;  2E5N A;  1FYL A;  3OIO A;  2OCC H;  2E1N A;  3LST A;  2DMN A;  3BJO A;  5M5X J;  4B44 A;  1KYW A;  2HZT A;  3K70 C;  2P7C B;  4EJO A;  1E3H A;  2M4K A;  2Q1Z B;  1XCB A;  2ECC A;  5CJ9 A;  3SJM A;  3S16 J;  4NC7 A;  1I6H J;  3E1S A;  4G7O F;  5JLW A;  1R71 A;  4MGR A;  2OZU A;  3ABT A;  4ASN A;  3CMY A;  3FMR A;  1T0F A;  1H9T A;  2QF7 A;  1TWH J;  5IPA A;  2XDV A;  1K61 A;  4D9J A;  4UB6 C;  4JK1 X;  2OV7 A;  3P9C A;  5E1Z B;  4D7N A;  2RQQ A;  4KN4 X;  3DKY A;  3AKZ A;  4A3J J;  2ECB A;  1YOV B;  2LBF B;  1NK2 P;  1ZRD A;  5J6X A;  2V1U A;  1X1P A;  4WXH A;  5D5V B;  4YG2 F;  3OY9 A;  2YX4 A;  4BJ6 C;  3EUK L;  3HRU A;  3T0Y A;  1IRF A;  4LG3 A;  2ISZ A;  4OWR B;  4CGZ A;  1LDJ A;  2Y0S N;  2W1O A;  4B4C A;  2L4A A;  4YFK F;  3S1N J;  4E7S A;  2R0Q C;  2UZK A;  2HPI A;  2VN2 A;  1ZYR F;  3DTK A;  3K4B A;  4A3F J;  1F43 A;  2AXT C;  3U1K A;  1J09 A;  2XF7 A;  4RDU A;  1K4T A;  5KAI C;  1IV8 A;  3E0J B;  4XKB A;  2CRG A;  3GFL A;  1T98 A;  3H9J A;  4KDP A;  1HKS A;  4Q5S F;  2JA2 A;  2CH0 A;  2DOA A;  2XC7 A;  3F8M A;  2F48 A;  2H94 A;  2W85 A;  2AXL A;  2Z3Y A;  3KX2 A;  1A6Q A;  4AYB N;  3S1M J;  1MMS A;  3I58 A;  2EA4 A;  3FM5 A;  4PFP A;  2ZO4 A;  2ZME B;  2ZCW A;  3C1D A;  3VSK A;  1O57 A;  3GWZ A;  3A01 B;  3J7A Y;  2M0C A;  4ZH4 F;  4DJA A;  1ACI A;  3CLQ A;  3RCO A;  1HBX G;  4M3F A;  2BY0 A;  1ZEL A;  1FMV A;  4KA4 A;  1DU0 A;  1UCR A;  2GIZ A;  3DU6 A;  3JRD A;  3VEP A;  2EZI A;  2Q8K A;  2NOG A;  1T33 A;  3GVA A;  1PVE A;  1ZG5 A;  3WU2 C;  2HDW A;  1TWF J;  2WV0 A;  3HJE A;  4NUB A;  4UUT A;  5HLI A;  5BNG A;  4HV6 A;  2DK8 A;  3W2W A;  1BN5 A;  1NG7 A;  1XGN A;  4B47 A;  3JAM Z;  3HOU J;  4I6Z A;  3S2W A;  4B1R A;  1HCR A;  4C3H J;  1ENH A;  2HXI A;  1IRX A;  4XRS G;  1P4A A;  2QSH X;  3HRM A;  4MO7 A;  2VOO A;  2AS5 F;  3MMY B;  2DMT A;  2NAZ A;  4RB1 A;  1WH7 A;  2LKP A;  2BE5 F;  3RPU A;  4I76 A;  4IHW A;  2IS6 A;  2QSF X;  4KIF A;  2DYR H;  5H2F C;  3ONQ A;  4RAY A;  4BQN A;  4BU2 A;  1MBH A;  1XTA A;  4BQQ A;  4IL6 C;  4YEL A;  1IN8 A;  3BG3 A;  1I5Z A;  5K7F A;  1G3W A;  5IOZ A;  3F8C A;  4UUV A;  2DMP A;  1XMX A;  4J19 A;  3TO9 A;  3BJA A;  4RA2 A;  3ZQF A;  2LYC A;  3CZ6 A;  2VQG A;  2HGC A;  5FLV A;  4LK0 F;  3ML6 A;  4DZJ A;  1W0T A;  2OCE A;  1HF0 A;  5GAE J;  1W4M A;  3DPT A;  2MBF A;  2DK5 A;  1YYV A;  4IHX A;  3BTI A;  2Z2S B;  3K4N A;  1M1E B;  2HXO A;  2ZXJ A;  2BVM A;  2ESH A;  3A4C A;  3IAS 2;  2L3D A;  3RQ4 A;  2R7S A;  2HDC A;  3GTO J;  3Q0U A;  3IH3 A;  3BQY A;  4EJV A;  1BBY A;  4Q47 A;  5J4Y A;  3RYR A;  1ZAO A;  4B3X A;  3K2A A;  2XIG A;  1WJD A;  2E34 A;  3CDH A;  1B1B A;  3ZMZ A;  2VON A;  1D5V A;  3PM1 A;  3OR1 C;  1POG A;  2JUG A;  3KZZ A;  2VE8 A;  1ETO A;  5ICE A;  1HW1 A;  2XAF A;  1VQM I;  3Q3S A;  2D5V A;  1D1B A;  2ZSH B;  1KYZ A;  1X1D A;  1JGS A;  3DV8 A;  3HOW J;  1JJ8 C;  1LB2 A;  1OPC A;  2CW7 A;  5IYD J;  5CYV A;  5D4S A;  3S2H J;  2VKD A;  1G3T A;  2P6S A;  4XLP F;  2DFH A;  3G1O A;  2DA1 A;  3GXO A;  2ZXW H;  3HSF A;  3TOA A;  4A3C J;  3BR1 A;  4B09 A;  4BE2 A;  3SQN A;  3L00 A;  1JKP C;  3WTV C;  2VI6 A;  3H0D A;  1TLH B;  2IW5 A;  3KPH A;  4WCG A;  4RM3 A;  5IY5 H;  3HSE A;  1JJ6 C;  3KZY A;  2JA8 J;  3KEY A;  2K9M A;  1K4S A;  2KDO A;  2LRE A;  1YJW I;  2WAQ A;  1Y6I A;  2LH9 A;  3BG9 A;  2JA7 J;  1QZY A;  2LG4 A;  3P9K A;  2X4H A;  3MQ0 A;  2DO7 A;  3L09 A;  2Y75 A;  2WTE A;  2IJL A;  3HGY A;  2STW A;  3E3V A;  2WWY A;  1OKR A;  3KEQ A;  1J59 A;  2IBD A;  4UHT A;  4Z2Y A;  1USS A;  1JHF A;  5EG0 B;  4XLH A;  3F21 A;  5F27 A;  3QOD A;  3NRV A;  3JRH A;  2IEK A;  2ADU A;  2E71 A;  2D1H A;  2VC0 A;  2HYG D;  2B9S A;  3LNQ A;  1XCV A;  2LBF A;  1STZ A;  2NRA C;  4FTH A;  1SMT A;  1FOW A;  1X4O A;  2X6W A;  4CYC B;  3CDL A;  3J81 K;  4U88 A;  2DA5 A;  4WXC A;  1Y1W J;  4M72 A;  2ZJQ F;  3AFH A;  2EIJ H;  1GV2 A;  3RKX A;  5M3M J;  5C4X J;  4PGH A;  4NDL A;  3OYM A;  1QRY A;  3CC4 I;  4U0V A;  2STT A;  4XIC A;  1U78 A;  2HWV A;  1TT0 A;  5CQE A;  2E1O A;  3RSN A;  1IJW C;  5HDK A;  3CCY A;  2XRN A;  1MNE A;  1V4R A;  5CVV A;  2KZG A;  1NH3 A;  1RC9 A;  1ONV A;  3EQL F;  4A3K J;  1OR7 C;  5C44 J;  1Z91 A;  4PZJ A;  4NC6 A;  1R6R A;  1TT5 B;  2LSO A;  4F92 B;  2F5D A;  1X2M A;  3G71 I;  3ZMU A;  1XSX A;  2FJ1 A;  3RKW A;  5HLG A;  1ETK A;  3Q5F A;  2RV8 A;  4NB5 A;  2K02 A;  1X4P A;  1P7I A;  4A2U A;  2P4W A;  3F6O A;  1QZE A;  3A01 A;  2DA6 A;  4B48 A;  3SEQ A;  2KRH A;  3SYT A;  5FRN A;  5DV5 A;  4A69 C;  1CF7 A;  2FML A;  2X1E A;  1H9G A;  2MG4 A;  4HQM A;  5FB2 A;  2F6C A;  4BY1 J;  2L01 A;  1XN7 A;  5J8F A;  2QM3 A;  3S15 J;  2UXX A;  1AA7 A;  3K1P A;  3P5J A;  3WU1 B;  5ICF A;  3S3N A;  3C2G A;  2X6O A;  3F8F A;  5K5O A;  3HSR A;  2LY9 A;  3BZK A;  3QP5 A;  4Y13 A;  1B8I A;  3QWL A;  1YTY A;  3GTM J;  3IHU A;  3EYY A;  4GCV A;  1TW2 A;  2F4M B;  3KLN A;  5CQG A;  1TTY A;  4ZDO A;  4C3I J;  3RZO J;  3LSJ A;  3BJ6 A;  4DGW B;  1U6G A;  3QYE A;  3TL4 X;  4UUS A;  4QPO A;  2GIV A;  2XAU A;  5F04 A;  4LG0 A;  5A2Q K;  5KCM A;  2XPW A;  3W2A A;  4F55 A;  4KFC A;  3T8T A;  5LRS A;  1SC7 A;  2V6C A;  3CDI A;  2Y69 H;  4BUP A;  1YQA A;  1RNL A;  3KET A;  2WV1 A;  4G9Y A;  2E2J J;  1X3Z B;  2MA3 A;  1KQ8 A;  5FFZ A;  2DJI A;  2VPR A;  3SFI A;  2K5C A;  4P9F A;  2L9R A;  2BXY A;  4A0X A;  3I0T A;  2J5O A;  4BKX A;  1BA5 A;  3CCE I;  1HQC A;  2IS2 A;  2CMP A;  2FXA A;  3CD6 I;  1Y56 A;  4CH7 A;  4HDV A;  1R00 A;  2JMW A;  1T95 A;  3MZH A;  2WY8 Q;  3SZG A;  4IQ4 A;  5H6Q A;  4KIC A;  1FP1 D;  1WI3 A;  2V1X A;  2H8W A;  4KIS A;  1S3J A;  1ZH5 A;  4HQE A;  3HHG A;  2HOS A;  1FT9 A;  2G7U A;  3ZOB A;  3QU6 A;  2QEN A;  4LIV A;  2DDB A;  3N05 A;  2MFZ A;  4YIR X;  3OYE A;  3ZMD A;  2JN6 A;  4II2 A;  1TWG J;  2D2W A;  5M3F J;  2Z5U A;  2RQP A;  4LIT A;  4CDG A;  4DQ2 A;  2JVH A;  3BTC A;  3ERM A;  3BR0 A;  2O8K A;  1REP C;  1NHA A;  5LFA A;  1OCO H;  4D0P A;  5JVG F;  3IC7 A;  5J40 A;  2TCT A;  4P9U A;  3IV5 A;  2HZD A;  2HOT A;  4XRF A;  1ITY A;  2X51 A;  5LBQ A;  4RAG A;  4ZYD A;  2JVG A;  2KIU A;  2K4B A;  3FIS A;  3CO7 C;  3F3X A;  3H5N A;  3HKZ N;  2YUS A;  2VBX A;  5CPR B;  3JW4 A;  3HYI A;  4HF2 A;  2CFO A;  2VBY A;  1KQ9 A;  2VQL A;  2R92 J;  2EBI A;  3H1C A;  2RC4 A;  2VB6 A;  1P4W A;  1ETX A;  3I4N J;  1U9O A;  4UVA A;  3IRR A;  2WB1 N;  3A0H C;  1T39 A;  2RNG A;  1WRJ A;  3E5X A;  3HG9 A;  1W5T A;  2RRE A;  2V26 A;  3CES A;  5LRR A;  1C0W A;  1T2K A;  1V54 H;  3FXM A;  2JA5 J;  1HDD C;  4PSX A;  1R1T A;  5HLH A;  4WX9 A;  3B6C A;  1JXS A;  1MKM A;  1MGT A;  2KP6 A;  2XPU A;  1RR7 A;  2XGX A;  1HW2 A;  3QYF A;  3DQV C;  2HU9 A;  3CCV I;  2ZME C;  1KGS A;  3K9T A;  2L9N A;  3MN2 A;  4ENM A;  1ETQ A;  2H1K A;  2A6H F;  2CQK A;  2O61 A;  3QPS A;  2EFQ A;  4H4K C;  2ZBK A;  3VWB A;  4IOA F;  1GHC A;  1IAW A;  3WTU C;  3OYL A;  1U9N A;  1WJB A;  1J7K A;  2P6T A;  2HPM A;  3GTP J;  2O3F A;  5CVU A;  2QYO A;  5E8G A;  5K1Y A;  5EG0 A;  5B1B H;  1RKT A;  2QQB A;  3TO6 A;  3HOV J;  5D6F A;  4Y52 J;  3FF5 A;  1UMQ A;  5HDG A;  3JRI A;  3KE2 A;  1YRN B;  2JPB A;  2JWT A;  1IV6 A;  2PMH A;  3UNG C;  4UY8 I;  3LWF A;  1HXD A;  4RB0 A;  4JYK A;  1FOX A;  3BPX A;  1B6A A;  4WWC A;  3V7C A;  4CYC A;  1UEL B;  1EF4 A;  3DF8 A;  1AHD P;  3BCB A;  4DZP A;  1S5L C;  2LR8 A;  1B59 A;  2DOF A;  2HDD A;  4PJ0 C;  3U2R A;  2LTP A;  3V7S A;  1SFO J;  4KIB A;  4HRI A;  4CCL A;  2F4I A;  3PQJ A;  1ZGJ A;  2HQ5 A;  3TP3 A;  3BT9 A;  3IL2 A;  3OYA A;  1QPM A;  2GOM A;  2GBY A;  3KLO A;  2WA0 A;  2JPC A;  2XRO A;  5JR3 A;  5JLX A;  3LAJ A;  3TOB A;  3M7G A;  5FRM A;  5LD2 C;  1HLV A;  2E1C A;  3K2Z A;  3DBR B;  3SZT A;  1VQP I;  3I4M J;  5FD5 A;  5E8I A;  3L7W A;  5DDG A;  1FTT A;  2VJI A;  1P6R A;  2CS3 A;  2O9L A;  4O5V A;  4FX0 A;  1RUO A;  1UHW A;  3PSF A;  3FKI J;  5FO5 A;  3A2K A;  1WHU A;  2I8D A;  3CJQ B;  2P5K A;  3L9F A;  3UKG A;  4A3E J;  5IT9 K;  5HNF A;  3VOD A;  2BHY A;  3FXJ A;  1Z67 A;  3O2P E;  2MD0 A;  3SXY A;  1H89 C;  4L9T A;  1YS6 A;  4DYR A;  3S3M A;  2OD5 A;  5J1R A;  2VT3 A;  4TV7 A;  2ELJ A;  5FLX Z;  3E5Q A;  3WG9 A;  3OYB A;  2KFD A;  1I6X A;  2B7E A;  4QPQ A;  2KPM A;  4UVC A;  2VE9 A;  1I1S A;  1RET A;  4A12 A;  4M6V A;  1G2H A;  2FEZ A;  3BZC A;  3S2D J;  1PP8 F;  2KZV A;  3EYI A;  3A02 A;  3RJP A;  2ELH A;  3O3K A;  1FSE A;  2HTJ A;  1BIB A;  1MSF C;  2NYX A;  4MLO A;  3K0L A;  1LE8 B;  3BR2 A;  4Y33 A;  4OIN F;  3R0A A;  2CQQ A;  1IN4 A;  4OAZ A;  4IZZ A;  2Z1D A;  4N9I A;  4DIQ A;  5D8K B;  3H9Q A;  3BCA A;  1NG6 A;  1O3R A;  3MKL A;  2E36 A;  4D7M A;  2R7F A;  1YIT I;  3L2U A;  3JR9 A;  1SD4 A;  2Y9Y A;  3WHC A;  1OLT A;  5IP7 J;  2DA4 A;  3AG3 H;  3N4M A;  2UXN A;  3FK7 A;  5FKK A;  1PUE E;  5D5W B;  3EUA A;  4EM0 B;  4AVP A;  2QCO A;  2L4M A;  3FBN B;  4HF1 A;  1JUP A;  3OYH A;  3LSR A;  3LFK A;  1DQU A;  1ZRE A;  2XUB A;  3ZR8 X;  4I99 C;  3BG6 A;  1ZRC A;  3OSG A;  1MBF A;  5GAH J;  1R36 A;  2TRT A;  2CV2 A;  4L0Y B;  1VI0 A;  3GME A;  3TBI A;  4WK8 F;  5FJ8 J;  1JI8 A;  3M3Y J;  5ICC A;  1EV7 A;  3D5S C;  5F0H A;  1MMA A;  2QLZ A;  3OMY A;  1MBE A;  2CYY A;  3GTQ J;  3AL0 B;  2B0L A;  5TIS C;  4HV5 A;  1XMK A;  2F5V A;  3QPT A;  5BOX A;  1PUF B;  5DYM A;  3RZD J;  2BY3 A;  3HDD A;  3LSK A;  4L9V A;  3S32 A;  1DP7 P;  5M5W J;  1A31 A;  3QPH A;  2NS8 A;  4YFN F;  1D8K A;  1IXC A;  2HOA A;  3MKY B;  1DU6 A;  2EFO A;  3VSL A;  4HA8 A;  4ON0 A;  2PG4 A;  4JX6 A;  2HTS A;  3O8G A;  3GO5 A;  3D1N I;  1LEA A;  2R7V A;  4RGR A;  3V8L A;  4M3E A;  2FA5 A;  2QZ8 A;  2K85 A;  2HVS A;  2R5Z B;  3IWZ A;  4J00 A;  5EYR A;  2E19 A;  2NS7 A;  2XVC A;  3VPR A;  3MVP A;  3HOZ J;  1MW7 A;  4WXD A;  1FYK A;  1GLN A;  4XRS A;  5LLQ A;  3LA3 A;  1TZL A;  1LDD A;  2OF7 A;  2NXN B;  4I01 A;  1TW3 A;  4QSH A;  4CCJ A;  2FOW A;  4HX8 A;  3I53 A;  1SFX A;  3OL4 A;  5CVI A;  3OL3 A;  4IEJ A;  3WGI A;  4BQA A;  1QHG A;  4A0Y A;  4RB2 C;  5IYB J;  3CCQ I;  1SEU A;  3KYC B;  4UB8 C;  2HS5 A;  4Y15 A;  4EM2 A;  1UG2 A;  4BBR J;  1LUJ B;  2CU7 A;  3CQZ J;  4EJT A;  1TWA J;  3GF2 A;  4XKV A;  4AM3 A;  1Q1V A;  1GXP A;  2WAE A;  4ESJ A;  2PMZ A;  1IUY A;  1HST A;  1FBU A;  2GQQ A;  1D1C A;  2ISY A;  4XR6 A;  2HOE A;  3H9G A;  1VQK I;  1CF7 B;  2A5W A;  2ZC2 A;  1TNS A;  2EQR A;  2E60 A;  3KYD B;  3CCJ I;  4O6J A;  4U87 A;  3FMQ A;  4BAC A;  1YRN A;  2M45 A;  2ELK A;  2V7F A;  2DT7 B;  3K10 A;  5L3G A;  1B8I B;  4E70 A;  1BOB A;  1XMA A;  3WHB A;  4M3G A;  4BXF A;  1R5I D;  3FDY A;  3IAM 2;  2GWR A;  4FQG A;  4YRV A;  3H3V K;  1SVM A;  4MFE A;  1WSU A;  3ZN1 A;  4UUS B;  4ZC3 A;  2X48 A;  4EVI A;  4LG0 B;  1BI1 A;  1NK3 P;  4OIP F;  5DM6 F;  1WPK A;  1GXQ A;  4EJW A;  3FK6 A;  3D5L A;  2IS4 A;  2VOP A;  4V19 K;  1OCR H;  2FUG 2;  5DTD A;  3HM5 A;  1JGG A;  2EFP A;  4G12 A;  5D8L B;  3K1N A;  5F0F A;  4LLL A;  4HOB A;  3S8P A;  1SFK A;  1SAX A;  3QOE A;  2A6E F;  2K7L A;  3LOC A;  1MSE C;  5DM7 F;  4HW0 A;  3K6G A;  1U3E M;  3WTZ A;  4IHY A;  2LKS A;  1SAU A;  4ESB A;  1VTN C;  5LHG A;  3LSP A;  3CUQ C;  2HQR A;  2XPV A;  3FWE A;  5DD8 A;  2IA0 A;  2KRC A;  3ABL H;  1V5F A;  4QTR A;  3RPU D;  2K27 A;  3HB9 A;  3K4K A;  4JX4 A;  4IRI A;  5L3F A;  5EDN A;  4QWQ A;  3E6C C;  1B9M A;  2L7K A;  2XF6 A;  3I64 A;  1N25 A;  3GCM A;  1ZAR A;  3WGH A;  3M8J A;  4BEH B;  3P9I A;  1K7A A;  4HYE A;  3S1R J;  1S9H A;  2R5Y A;  3EDP A;  4BXX J;  3ASN H;  1HC8 A;  1OR7 A;  1L0O C;  2VKE A;  3K1M A;  3W6V A;  2BOL A;  3CF2 A;  4FCY A;  4M3B A;  3FXU A;  2C6Y A;  1JT0 A;  2EZK A;  1HSJ A;  4ZYA A;  2CUF A;  2R7W A;  3PO3 J;  1MJ9 A;  1B4A A;  1R5G A;  3DPL C;  4J01 A;  4N4N B;  3F22 A;  2RN7 A;  1LE8 A;  4IRH A;  3CCS I;  5JHU A;  2CUZ A;  3ZCO A;  2M4G A;  4AIK A;  3EET A;  2DMQ A;  3ZQL A;  1Y0N A;  3HHH A;  1MBJ A;  2KIM A;  5ICG A;  2XB5 A;  2COB A;  3GFJ A;  3MCZ A;  3CC2 I;  1R9T J;  1FWZ A;  3VDX A;  3PL8 A;  2KJC A;  3GZ5 A;  2NVX J;  2X6Y A;  1Y0U A;  1KU7 A;  2IVM A;  3SDG A;  1LVK A;  2DOE A;  3MD2 A;  3ZQI A;  5FGM A;  1MND A;  2K9L A;  3G2B A;  3DTI A;  4XBF A;  2LKX A;  4RB3 C;  2GA1 A;  1FJL A;  4IHS A;  4XOP A;  1ZR2 A;  1I3Q J;  3F9K A;  4JQF A;  2ZKZ A;  2A61 A;  2I10 A;  2ID3 A;  2KIF A;  4MHG A;  3OOU A;  2N8G A;  1T8I A;  3UR3 C;  1MMD A;  2QKM B;  1FLI A;  3PO2 J;  3HBL A;  1UB9 A;  2VJ4 A;  1XX5 A;  3OR2 C;  5D4R A;  1P9Q C;  1OFC X;  1PUF A;  3HC7 A;  5J1Y A;  5E20 A;  2IT0 A;  1AOY A;  2ZXI A;  1OMI A;  1BOA A;  4BGD A;  2D1V A;  1ZKG A;  2DXI A;  1G3S A;  2FRH A;  5BQT A;  4B43 A;  3LQQ A;  2M87 A;  1JUS A;  1Y39 A;  4N0B A;  1O7L A;  4HG2 A;  2FNP A;  3QYB A;  1GVJ A;  4MIM A;  1I1G A;  3E6D A;  4U0Y A;  3Q0W A;  5JVT A;  6PAX A;  2WBM A;  1ZHF A;  2CUJ A;  3JRE A;  2R5Z A;  2LC2 A;  2IGO A;  1BI2 A;  3WG7 H;  2V1N A;  4EMS A;  2CW0 F;  5E3M A;  4OIQ F;  1FNN A;  3OOP A;  5EEA A;  1F5T A;  5LGN A;  3OS0 A;  2DDA A;  2H27 A;  2WY7 Q;  2LMD A;  3LSH A;  3H0G J;  4GYG A;  3TW7 A;  1Z0X A;  4I98 B;  3ISP A;  1EH8 A;  2EH3 A;  4IOC F;  3GTL J;  4ZYH A;  1S29 A;  2OBP A;  4LOC A;  4IO9 F;  4BE1 A;  3ABM H;  3BRO A;  1VQL I;  5DD4 A;  2BW3 A;  1SVL A;  2KL4 A;  3WTS C;  2D45 A;  2Z9O A;  3CC7 I;  2NNN A;  3PIO F;  2Z33 A;  4XQF A;  3OYN A;  1JKO C;  4U0W A;  5J1U A;  2CGP A;  4XK4 A;  1X1A A;  3DBH B;  5HS8 A;  1KU2 A;  1BJA A;  1RES A;  1PYV A;  2WAD A;  4KUM A;  2M9H A;  3GLX A;  3M4O J;  2EB7 A;  3M8E A;  3R4K A;  2L02 A;  3J80 K;  4M6Y A;  2RKH A;  3VYU B;  1WJA A;  4RLQ A;  1I50 J;  4NNJ A;  5D5U B;  3ZP5 A;  2GLO A;  1VQ9 I;  3AG4 H;  3G4S I;  1Z05 A;  2QQ8 A;  3GX4 X;  4UVB A;  5FKO A;  1TQM A;  1WCM J;  1XDU A;  2XGE A;  1IRG A;  3KP3 A;  1XGO A;  2KKO A;  3K4M A;  2DA7 A;  1U8B A;  1G3Y A;  2JRM A;  4RGS A;  1LDK B;  3JRC A;  1J2X A;  2R7U A;  1DUX C;  1FIA A;  4A3G J;  3QAH A;  3PNV A;  1U5T A;  4AIH A;  2CV1 A;  1XGM A;  3C7J A;  1DGW Y;  1OYY A;  2AHQ A;  3ASO H;  5IT3 A;  1QVU A;  2L7Z A;  3DP7 A;  4F93 B;  1YW8 A;  1RKW A;  3I54 A;  5DS9 A;  3TKY A;  2W24 A;  1L3L A;  1QNT A;  1YI2 I;  4ENJ A;  1V5G A;  2XGC A;  1JT6 A;  3O6B B;  1B9N A;  2MH2 A;  1N75 A;  1LFU P;  1LQ1 A;  2PJR B;  4G7Z F;  2R7R A;  5C3E J;  1FX7 A;  2ESN A;  1R23 A;  3BC8 A;  3HRS A;  4OOI A;  3FXL A;  4G6T B;  5KNL A;  3BG5 A;  3DBL B;  3F23 A;  4I0B A;  1BR2 A;  1TQP A;  3PFI A;  2EZL A;  4G8X A;  2BXZ A;  1VQO I;  3CME I;  2A6T A;  2FBK A;  1ZTR A;  2HKX A;  1XD7 A;  2Y2Z A;  3H3Z A;  4IXA A;  5B66 C;  1OCT C;  4LD5 A;  4PJL A;  1IN5 A;  2BVL A;  3E5U A;  3I59 B;  3AL0 C;  2CQN A;  3JCU C;  1MMN A;  5FKN A;  1DPR A;  5GAD J;  3OS2 A;  4BEH A;  3VYR B;  1D1A A;  1VFC A;  4ZTF A;  2ACJ A;  2MC3 A;  1ZGW A;  4Q48 A;  1IF1 A;  2F2E A;  5EEG A;  5E3O A;  5F1R A;  4JOM A;  3HRT A;  1X58 A;  2V9K A;  3K7A J;  5E18 F;  5E17 F;  4CUG A;  5HDN A;  1GDT A;  4PJJ A;  4M74 A;  1FOK A;  4I02 A;  2M1B A;  4HST A;  4C2U A;  3M1E A;  3CMM A;  5L3B A;  4ENN A;  4YFX F;  1ZQ3 P;  4CIC A;  1RI7 A;  1ZN2 A;  3PNY A;  1ZR4 A;  2QSG X;  5TJJ A;  3VB2 A;  2Q2E B;  2M2E A;  4U7B A;  3ROU A;  4W1U A;  1FP2 A;  1IN6 A;  3RQI A;  3BDD A;  4DOZ A;  5TRD A;  2XKP A;  4R79 A;  1Q1H A;  3Q9V A;  1IGN A;  3EUH A;  1W7P D;  3NWS A;  4LJZ F;  2LLK A;  2NNY A;  2F4O B;  3SEZ A;  4CCO A;  1O7F A;  3TMO A;  2MGQ A;  2F5E A;  2P5L C;  1N77 A;  1R1U A;  1T56 A;  2VBZ A;  2YS9 A;  5JI6 A;  5KAF C;  1CGP A;  2R4G A;  1U0J A;  1MJB A;  4E6K G;  2O6G E;  2LF7 A;  4RGU A;  3CCL I;  3K4C A;  2VXZ A;  1SMY F;  4XN0 A;  2Y0S A;  2JZY A;  2K40 A;  3HEF A;  1QO0 D;  1F36 A;  3SHF A;  3TP0 A;  3NAR A;  2Y9Z A;  1UG0 A;  4L5J A;  3VYS B;  3BR6 A;  3OYC A;  5E1W A;  3S93 A;  3KZI C;  5LHI A;  3DEW A;  3IP4 B;  1R49 A;  4AID A;  4C3J J;  1V55 H;  1P92 A;  4IQJ A;  1R7J A;  4M9S A;  4RAF A;  4AC0 A;  3KP4 A;  4RM2 A;  2ME0 A;  3NEU A;  2X6X A;  1Y1V J;  4BS9 A;  4EQQ A;  1OYI A;  2EIM H;  2LOO A;  1MDM B;  1S7O A;  3ZQ7 A;  4AYB A;  1OCZ H;  3FXR A;  3KEO A;  4BHC A;  3FIW A;  2EFN A;  4G94 A;  4IPA A;  5DUI A;  2DQL A;  2O7O A;  4RMN A;  3OIQ A;  1IC8 A;  3LFU A;  3ULQ B;  2XV4 S;  4A3B J;  3V7R A;  4XLN F;  5DUK A;  3LSG A;  3WE2 A;  4HNV A;  3WOD F;  4GYI A;  1PJR A;  3J81 Z;  3KP2 A;  4BYY A;  4KYW A;  2HYF A;  1F9N A;  1D3Y A;  5EF6 A;  4C2T A;  3BWG A;  5BS6 A;  1F1Z A;  2DMU A;  3H92 A;  4FE4 A;  1QVT A;  2XGD A;  4H0E A;  2H1L A;  1T08 B;  3DFG A;  3GLL A;  4DNC A;  4E7J A;  2ZJR F;  2F5C A;  3ZMT A;  1Z7L A;  2IGN A;  1X1B A;  3OYF A;  4BXU A;  4ESF A;  1MH3 A;  2LDU A;  2O8X A;  3WGG A;  2DQR A;  2OQG A;  2L9V A;  4ZYG A;  1XG1 A;  5GPA A;  4LGW A;  5IP9 J;  1JE8 A;  4S0H B;  3BOQ A;  1SD5 A;  4OMY A;  3L2W A;  1MIJ A;  3M9A A;  2XHK A;  4BJ5 C;  2L7M P;  2W84 A;  3NWT A;  2ZNY A;  5JHF A;  3BZ6 A;  2CUE A;  2ZFU A;  2EIN H;  4MEY F;  4PGG A;  5HLT A;  5FD6 A;  2HI3 A;  2IPQ X;  3HOS A;  1IXR C;  1RZ4 A;  3LA2 A;  1TL8 A;  3JAM K;  3U21 A;  4E7K A;  2X9D A;  4XLC A;  3FHZ A;  4P55 A;  4L5E A;  1ODD A;  1ULY A;  2DFF A;  3A0B C;  2QA4 I;  4Y3O A;  3CLO A;  2CW8 A;  1HKT A;  2ZJ2 A;  3GW2 A;  2GA2 A;  2TDX A;  2VQH A;  2X1C A;  2VLA A;  3B6A A;  4NHJ A;  3TDU C;  2IXS A;  3OWT A;  3TDZ C;  3D5R C;  4A5N A;  3VFZ A;  2P8T A;  2R5Y B;  5GTI C;  4L18 B;  2DYS H;  3OS1 A;  5A2Q Z;  1ZRF A;  2HEO A;  5B1A H;  4L0Z B;  5K7Z A;  3RKY A;  2DCE A;  3C3W A;  1WKM A;  1VF9 A;  3C18 A;  4JP0 A;  2PFB A;  2ZFW A;  3GUD A;  4MFD A;  4BHB A;  5L3D A;  2GXG A;  5F08 A;  1A04 A;  1G8X A;  2HVR A;  2PQ8 A;  4HSR A;  2LFB A;  4A0Z A;  2LF8 A;  5E3L A;  1R58 A;  2M3A A;  5EGO A;  2HR3 A;  2JUC A;  1YO5 C;  2JSP A;  2L5Q A;  4CCN A;  1O4X A;  3JRA A;  1FBS A;  1UHS A;  3QPL A;  4S05 A;  3V8J A;  2VKV A;  4NBQ A;  4G6D A;  1YIO A;  2PJR A;  3SDB A;  1BC7 C;  2P5V A;  1OCP A;  2LD5 A;  2R3S A;  3IUO A;  2NVU B;  4ZJZ A;  5H6R A;  3FXO A;  3V8K A;  3U9G A;  2DT6 A;  1HW5 A;  1UHM A;  1UJ8 A;  1SD7 A;  5JFR A;  3W6K B;  1Z3Y A;  2VJ5 A;  1Z21 A;  2ZB9 A;  1QU3 A;  4EGZ A;  1LJ9 A;  2PJP A;  1B72 A;  5GP9 A;  4EGY A;  1VQ5 I;  2QEX I;  3DLA A;  2QKL B;  2PMU A;  4PJN A;  3I59 A;  4CA0 A;  2CG4 A;  5GTH C;  1Z6R A;  3CJR B;  3W6J B;  1E17 A;  2DFI A;  5J8C A;  2DFE A;  5HS9 A;  4PUS A;  2DA3 A;  3LA7 A;  3W2V A;  2CWE A;  1ERD A;  1QQI A;  2JRT A;  2BY1 A;  1P4X A;  3L2Q A;  1GVD A;  4OU0 A;  4GXO A;  5B3S H;  4ENK A;  2K3F A;  1Y8Q B;  2LY2 A;  2HNH A;  3OYD A;  2H8R A;  2YU9 J;  4UV8 A;  2K3P A;  2M8E A;  2ZJP F;  1FTZ A;  1P2F A;  2P81 A;  3KCC A;  3BQZ A;  2XRL A;  1GV5 A;  3I71 A;  3QRF F;  2W48 A;  4D5C A;  4FIS A;  3TO7 A;  2DJN A;  3HXL A;  3I9V 2;  2YX7 A;  4G6Q A;  4XOT A;  4EEF G;  4BBS J;  4BY7 J;  3LQR A;  2Q2E A;  4BQO A;  3OIP A;  2X85 A;  2GZW A;  5F64 A;  5FKM A;  3G1M A;  3K69 A;  2E7W A;  3GYH X;  2QWW A;  4KMF A;  3RDI A;  2A05 A;  1QZZ A;  3HL2 A;  5BPD A;  1WWX A;  2O0Y A;  3PNT A;  5DCM B;  4KIT B;  1J75 A;  2L9S A;  4ZDP A;  2MH9 A;  2MLK A;  1XSV A;  3VOE A;  2VXD A;  3H3U A;  2FE3 A;  4GRI A;  1I27 A;  3LL7 A;  4OIO F;  3N97 A;  2EV0 A;  2Y48 A;  4BE0 A;  1JKQ C;  1VQ7 I;  3WTW C;  4DYQ A;  1G6N A;  1Z3X A;  1TQI A;  4E7L A;  4CZC A;  5IP6 A;  1BM9 A;  1E3O C;  4LLG F;  1JTX A;  3CUO A;  2BW3 B;  1WJF A;  4M9Z A;  5D5X B;  3GTK J;  2UWM A;  2M30 A;  1AKH B;  1DGR M;  4CHU A;  2ID6 A;  4IJA A;  3M07 A;  1A6I A;  2K86 A;  3OYK A;  5J3L A;  3B73 A;  2RAE A;  4RLF A;  1X1C A;  4L9J A;  5HS7 A;  1SFE A;  2KT0 A;  4MQ9 F;  2UUZ A;  2IRF G;  3IKV A;  3BTL A;  1GUU A;  3J7Y J;  2DW4 A;  4Y4R A;  3DKW A;  5E3N A;  2KJB A;  3I55 I;  2I5U A;  2O5R A;  3LSI A;  1MDM A;  3E7L A;  1RUN A;  1SVO A;  2EWN A;  3OYJ A;  1W5S A;  2R93 J;  2KDZ A;  4A3I J;  2FD5 A;  1LFB A;  3DEU A;  3ZRG A;  3H35 A;  1YJN I;  1OIS A;  3FZV A;  1WVR A;  4HF0 A;  1QBJ A;  2XAQ A;  4N4O B;  2KIS A;  1PP7 U;  1WJE A;  3FM3 A;  1ZG3 A;  4GFB A;  3IWF A;  4HEA 2;  4XLA A;  2JSC A;  4A3D J;  2DU9 A;  2L0K A;  2V4J C;  2DI3 A;  4NC8 A;  3CJT B;  3E6B A;  5ERI A;  4HDU A;  2Y30 A;  1LKX A;  1YX3 A;  1U5T B;  1HOM A;  4IHT A;  2E2H J;  1X2N A;  4DBR A;  4HAM A;  4MEX F;  1W1W E;  4P5O A;  2OAZ A;  2KLO A;  1R1V A;  1FY7 A;  4WF2 A;  3OSF A;  1MD0 A;  3IKT A;  5H20 A; 
#chains in the Genus database with same CATH homology
 5EEA A;  3TW7 A;  3H0G J;  3RKQ A;  1W0U A;  2R92 J;  1Z0X A;  2EBI A;  2EH3 A;  4V2F A;  3GTL J;  1ETX A;  5K7H A;  3I4N J;  1U9O A;  4LOC A;  2OPT A;  2WB1 N;  5IOY A;  3ZQG A;  5GPC A;  1WGX A;  2JA5 J;  1HDD C;  4W97 A;  1JKO C;  5J1U A;  1AU7 A;  1MH4 A;  3B6C A;  1IDY A;  4XK4 A;  1RES A;  2XPU A;  1RR7 A;  3QQA A;  4Y7N J;  2XSD C;  2K9Q A;  2M9H A;  5FKL A;  1IG7 A;  3M4O J;  5C4J J;  2M8G X;  3BR5 A;  4DYC A;  3MN2 A;  4XID A;  1ETQ A;  2H1K A;  1I50 J;  2HYJ A;  3QPS A;  2GLO A;  2R7Z J;  3IH2 A;  1U9N A;  3GTP J;  3S1Q J;  3OIO A;  5FKO A;  5EG0 A;  2DMN A;  1WCM J;  1RKT A;  2XGE A;  3HOV J;  1CQT A;  2DA7 A;  1U8B A;  5M5X J;  2MW8 A;  3JRC A;  4Y52 J;  1UMQ A;  3JRI A;  1FIA A;  2ECC A;  4X1E A;  3JRB A;  4A3G J;  3SJM A;  3S16 J;  1YRN B;  1IV6 A;  2JWT A;  1I6H J;  5JLW A;  2AHQ A;  1QVU A;  3CMY A;  2L7Z A;  4JYK A;  2K9N A;  2QF7 A;  1RKW A;  1TWH J;  5DS9 A;  5IPA A;  4CYC A;  1K61 A;  1MBG A;  1EF4 A;  1AHD P;  4D7N A;  4DZP A;  3S17 J;  2LR8 A;  1JT6 A;  2XGC A;  2HDD A;  2LTP A;  3TED A;  1SFO J;  4A3J J;  2ECB A;  1NK2 P;  1LFU P;  1BL0 A;  2HQ5 A;  3JRF A;  5C3E J;  3TP3 A;  3BT9 A;  2GBY A;  3BG5 A;  2Y0S N;  4B4C A;  3HOX J;  3S1N J;  1ZK8 A;  5JLX A;  2R0Q C;  2EZL A;  1HLV A;  1F43 A;  4A3F J;  3I4M J;  4RDU A;  1ZTR A;  2CRG A;  1FTT A;  2Y2Z A;  1Z77 A;  4A93 J;  1OCT C;  2O9L A;  3FKI J;  5FKN A;  3UKG A;  4A3E J;  1VFC A;  4RBO A;  1GT0 C;  1ZGW A;  1JTY A;  4AYB N;  1H89 C;  3S1M J;  5E3O A;  4DYR A;  1X58 A;  5J1R A;  1IRZ A;  3K7A J;  3A01 B;  1GDT A;  2M0C A;  1K83 J;  4M3F A;  2L7F P;  4X6A J;  5F0C A;  1DU0 A;  1RET A;  3JRD A;  5IYC J;  2EZI A;  4M6V A;  1ZQ3 P;  2NOG A;  1ZR4 A;  1T33 A;  1G2H A;  3S2D J;  2M2E A;  2CJJ A;  3A02 A;  3HGG A;  4W1U A;  1TWF J;  2NVT J;  3RQI A;  4UUT A;  1IGN A;  5BNG A;  1MSF C;  4MLO A;  1LE8 B;  1ETW A;  3BR2 A;  2CQQ A;  2LLK A;  3HOU J;  4I6Z A;  2NVQ J;  4B1R A;  1HCR A;  4C3H J;  1ENH A;  2HXI A;  3MKL A;  4XRS G;  9ANT A;  2MGQ A;  4D7M A;  1T56 A;  2YS9 A;  4MO7 A;  5F1J A;  1AKH A;  3JR9 A;  2DMT A;  1SAN A;  1WH7 A;  2Y9Y A;  5EZG A;  3WHC A;  5IP7 J;  2DA4 A;  2JA6 J;  4I76 A;  1BW6 A;  4IHW A;  4IHV A;  3FK7 A;  5FKK A;  2K40 A;  3HEF A;  4C2M J;  1MBH A;  1F36 A;  3TP0 A;  4FE7 A;  2QCO A;  3NAR A;  3BG3 A;  2Y9Z A;  1JUP A;  2VUM J;  5FLM J;  3BR6 A;  3LSR A;  5K7F A;  5IOZ A;  2DMP A;  4J19 A;  3DEW A;  2XB0 X;  2FQ4 A;  5M5Y J;  2PMZ N;  1MBF A;  3OSG A;  4C3J J;  2JK3 A;  4QIW N;  1H8A C;  4AC0 A;  2TRT A;  1VI0 A;  2ME0 A;  3ZQF A;  5FJ8 J;  3M3Y J;  5FLV A;  1Y1V J;  4DZJ A;  1W0T A;  5F0H A;  3ZQC A;  1HF0 A;  1MBE A;  3GTQ J;  3FIW A;  1JUM A;  1VND A;  4ABZ A;  4IHX A;  2O7O A;  3BTI A;  1PUF B;  1IC8 A;  3RZD J;  2HXO A;  3HDD A;  4A3B J;  3LSG A;  5M5W J;  4HNV A;  1A5J A;  2NS8 A;  3GTO J;  3Q0U A;  3IH3 A;  1S7E A;  3BQY A;  2HOA A;  1JKR C;  1DU6 A;  5EF6 A;  2DTZ A;  2DMU A;  1FIP A;  3K2A A;  4FE4 A;  1QVT A;  2XGD A;  4JX6 A;  1APL C;  3O8G A;  5EGO B;  3D1N I;  3PM1 A;  1POG A;  4M3E A;  1ETO A;  2LVS A;  2R5Z B;  3Q3S A;  5EYR A;  2E19 A;  2NS7 A;  2D5V A;  1MH3 A;  3VPR A;  3MVP A;  3HOZ J;  3GBG A;  3HOW J;  1JJ8 C;  1XG1 A;  5GPA A;  5IP9 J;  4XRS A;  5IYD J;  4S0H B;  3S2H J;  2OF7 A;  2L7M P;  3G1O A;  3HOY J;  2DA1 A;  4QSH A;  2CUE A;  4IEJ A;  4A3C J;  3BR1 A;  1B72 B;  5HOD A;  2HI3 A;  5IYB J;  4XRM A;  2AO9 A;  1ORK A;  3O8H A;  1JKP C;  2M34 A;  2LK2 A;  2X9D A;  2VI6 A;  1UG2 A;  4BBR J;  3F0C A;  1JJ6 C;  2CU7 A;  3CQZ J;  3BR3 A;  4L5E A;  2JA8 J;  1TWA J;  1Q1V A;  2DA2 A;  1H88 C;  2G0E A;  3JRG A;  1IUF A;  3B6A A;  1FEX A;  3BG9 A;  2JA7 J;  2R5Y B;  1TC3 C;  2EQR A;  3HGY A;  1HDP A;  5K7Z A;  2ME6 A;  1VF9 A;  2IBD A;  1YRN A;  4A3L J;  4JP0 A;  5EG0 B;  2ELK A;  1B8I B;  4MFD A;  2MSY A;  1IDZ A;  3WHB A;  3C2B A;  4M3G A;  5F08 A;  5F27 A;  3JRH A;  2IEK A;  3H3V K;  2LFB A;  4MFE A;  5E3L A;  4UUS B;  5EGO A;  1TWC J;  2X48 A;  1O4X A;  3JRA A;  2Y31 A;  1NK3 P;  1UHS A;  1WPK A;  3QPL A;  3FK6 A;  3LNQ A;  2VKV A;  1ETV A;  1RPW A;  4FTH A;  1OCP A;  2LD5 A;  4CYC B;  3CDL A;  2JJ7 A;  5DTD A;  4B3A A;  1Y1W J;  2DA5 A;  5EZH A;  3HM5 A;  1JGG A;  4G12 A;  1GV2 A;  5M3M J;  5C4X J;  5F0F A;  1QPI A;  4NDL A;  1QRY A;  4XIC A;  4DW6 A;  2ZB9 A;  1U78 A;  3LOC A;  3NAU A;  1MSE C;  3TW6 A;  4D5F A;  2E1O A;  1IJW C;  4IHY A;  1XS9 A;  3CCY A;  3ZQH A;  5GP9 A;  3LSP A;  1B72 A;  4A3M J;  2XPV A;  1MBK A;  4A3K J;  4QTR A;  5C44 J;  2WAQ N;  3HB9 A;  4JX4 A;  1X2M A;  2DA3 A;  5EDN A;  2FJ1 A;  1ETK A;  3BTJ A;  1GVD A;  1P7I A;  3A01 A;  2DA6 A;  2H8R A;  2YU9 J;  3S1R J;  1FTZ A;  2P81 A;  4A69 C;  2XRL A;  3BQZ A;  1BJZ A;  1GV5 A;  2MG4 A;  2R5Y A;  1WH5 A;  2W48 A;  4BY1 J;  4BXX J;  2B63 J;  4D5C A;  4FIS A;  2DJN A;  3S15 J;  3Q0V A;  2NVY J;  2E2I J;  4BBS J;  4EEF G;  4BY7 J;  2VKE A;  1P7J A;  2X6O A;  3W6V A;  2LY9 A;  1XC5 A;  2CQX A;  2DN0 A;  4M3B A;  4FCY A;  1JT0 A;  1B8I A;  2EZK A;  3GTM J;  3PO3 J;  2CUF A;  5FKM A;  4C3I J;  3G1M A;  3RZO J;  3LSJ A;  1LE8 A;  4AUX A;  3GTJ J;  4UUS A;  2FX0 A;  5F04 A;  2XPW A;  2DMQ A;  3ZQL A;  1MNM C;  1MBJ A;  2XB5 A;  2COB A;  3L1P A;  1R9T J;  2GM4 A;  1JKQ C;  4DYQ A;  2WV1 A;  2E2J J;  2IAI A;  3G1L A;  5IP6 A;  2NVX J;  1E3O C;  2VPR A;  3SFI A;  1JTX A;  3GTK J;  3SDG A;  2L9R A;  1AKH B;  4BKX A;  1BA5 A;  2ID6 A;  3ZQI A;  1NTC A;  1A6I A;  5J3L A;  2RAE A;  2JMW A;  2LKX A;  2KT0 A;  1FJL A;  3BTL A;  1ZR2 A;  1I3Q J;  2K9S A;  1GUU A;  2I10 A;  1ETY A;  2ID3 A;  3GTG J;  5E3N A;  1D5Y A;  3OOU A;  1WI3 A;  2N8G A;  3E7L A;  2R93 J;  2KDZ A;  4A3I J;  4V2G A;  2FD5 A;  3IH4 A;  1LFB A;  3PO2 J;  3HBL A;  2HOS A;  3DCF A;  1BW5 A;  1OFC X;  1PUF A;  3ZOB A;  5J1Y A;  4GFB A;  4M3D A;  2JN6 A;  2LP0 A;  1ZKG A;  1TWG J;  4A3D J;  1OJL A;  2L0K A;  5M3F J;  3BTC A;  2Y30 A;  3BR0 A;  2O8K A;  2EZH A;  1JUS A;  3S14 J;  1HOM A;  3IV5 A;  2TCT A;  3A03 A;  2E2H J;  2HOT A;  1X2N A;  1ITY A;  4MIM A;  3Q0W A;  4JX5 A;  3JRE A;  2R5Z A;  3FIS A;  3HKZ N;  2YUS A;  3OSF A;  5E3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...