2KT0A

Solution structure of human stem cell transcription factor nanog homeodomain fragment
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein NANOG
publication title Solution structure of human stem cell transcription factor Nanog
rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kt0A01
4IHXA 1XS9A 1WI3A 4A3LJ 2GBYA 1P7JA 2YU9J 5DTDA 1H8AC 2EH3A 2GLOA 2QF7A 2X48A 2VPRA 3S14J 5K7FA 1RETA 4J19A 3BG5A 5J1RA 3GTMJ 1W0TA 5IP6A 1Q1VA 1LFBA 1A6IA 3BTJA 2B63J 2O7OA 1AHDP 9ANTA 3GTLJ 1ZKGA 2M9HA 1AKHB 2HOAA 2WV1A 3ZQIA 2RAEA 1P7IA 4I6ZA 1B8IA 2FX0A 3TW6A 3QQAA 4GFBA 2ECBA 3A02A 5IPAA 1Y1WJ 1LE8B 5FJ8J 5K7HA 1HCRA 2IEKA 1ITYA 1BW5A 2CU7A 2K40A 4A3JJ 1RR7A 2JWTA 5E3LA 2JMWA 3A03A 2JA6J 4MIMA 2HI3A 2NVYJ 1ETQA 2VKVA 3ZQLA 1ZGWA 3HOUJ 3HOXJ 1U78A 5FLMJ 1AKHA 2DMTA 4C3IJ 3W6VA 5F0HA 1QPIA 1BJZA 3LOCA 4RBOA 5FKLA 1RKWA 1TC3C 3ZQHA 2JK3A 2PMZN 3M4OJ 5FKOA 4JX5A 1JKQC 5IYDJ 1TWHJ 5IP9J 1LE8A 3S1RJ 2QCOA 2DMPA 1XC5A 1GT0C 1FJLA 2YS9A 1FEXA 1QVUA 3BR0A 3HOWJ 3Q3SA 1RESA 4M3DA 2JA7J 3JRCA 1IG7A 2R5YB 1X2MA 3B6AA 2DTZA 4XIDA 2AHQA 2HXOA 1T33A 5M5WJ 2H1KA 3LSGA 1OJLA 2XGEA 3DEWA 4IHYA 1MBGA 4C3HJ 2XPWA 4QSHA 1MH3A 2L7MP 2VI6A 1ETWA 3BTCA 1D5YA 2DJNA 1TWFJ 3OOUA 3B6CA 4XRMA 4D5CA 3S2DJ 3BTLA 5EF6A 1IUFA 2G0EA 1VI0A 3IH3A 2LKXA 1Y1VJ 2NS8A 1MBHA 1WH7A 4FTHA 5FLVA 2Y0SN 2GM4A 1NTCA 1MBJA 2ID6A 2DN0A 1TWCJ 3BR1A 3F0CA 3S1MJ 1FTZA 3GBGA 3JREA 1MNMC 3JRBA 3HGYA 3WHBA 3D1NI 3HKZN 5GPAA 1JTXA 2DA4A 1TWGJ 2E1OA 4BY7J 5FKKA 2R0QC 5DS9A 2CQQA 2R92J 1ZR4A 1JKPC 3BQZA 4A3KJ 1I50J 3JRDA 4IHWA 4C3JJ 1WH5A 3RZDJ 3GTQJ 2DA6A 1HDPA 2E19A 2D5VA 1UMQA 1H88C 4AUXA 4DYRA 4A3BJ 4M3BA 2K9QA 1SANA 1JUPA 3BR2A 1FIAA 4RDUA 2XGCA 2LP0A 1B8IB 3S16J 4Y52J 1ETVA 2JA5J 1IJWC 1RKTA 3JRFA 4XK4A 4IEJA 5F0FA 5JLWA 2YUSA 4XRSG 3FK7A 2H8RA 2NOGA 2LY9A 3GTOJ 3L1PA 2XB5A 1FIPA 5FKNA 2XB0X 2XPVA 2L9RA 3BQYA 1UG2A 1BL0A 2M2EA 4M3GA 4BBSJ 3BTIA 2R93J 2VKEA 2ME0A 1ETXA 2LVSA 3MN2A 1FTTA 2LD5A 2MG4A 2ID3A 1MBKA 1DU6A 4A3EJ 2HYJA 1HDDC 2FD5A 5EEAA 1TWAJ 1QRYA 1WCMJ 4W97A 3LSPA 1YRNB 2L7ZA 1VNDA 3OSFA 1H89C 3BR5A 3ZQGA 2O9LA 5C4XJ 3HB9A 2LTPA 3ZQFA 3MKLA 2XSDC 1GDTA 1X2NA 2NVTJ 2R7ZJ 3H0GJ 4EEFG 3O8HA 3G1MA 4MLOA 2Y2ZA 1WGXA 5M5XJ 5J1UA 2LR8A 3CQZJ 3HEFA 2Y31A 2DA2A 1IC8A 2L0KA 2E2JJ 3NAUA 2DA7A 2HQ5A 2IAIA 2P81A 3LNQA 1YRNA 4DZPA 4C2MJ 2CQXA 1O4XA 2X6OA 4MFEA 1RPWA 2DMUA 4FCYA 2KDZA 5M3FJ 4B3AA 4XICA 3HGGA 2ELKA 2EZKA 4S0HB 5F08A 2MSYA 2M34A 4A3DJ 2LFBA 2R5ZB 1XG1A 1S7EA 3CCYA 4CYCA 4D7NA 1QVTA 3S1QJ 3GTKJ 3ZQCA 3S2HJ 2XRLA 5E3OA 2DA3A 1K61A 1JJ8C 3FKIJ 1U8BA 5IYCJ 2CUFA 4L5EA 3RQIA 1OCTC 3HBLA 4NDLA 2EZLA 1LFUP 1BA5A 2OF7A 2MW8A 1JUMA 2COBA 3OIOA 5EGOB 5IOZA 4AC0A 3HDDA 3PO2J 1K83J 2R5ZA 2DMQA 4A93J 1EF4A 1PUFA 5EYRA 5GP9A 1APLC 2HDDA 2KT0A 3BR6A 1VFCA 1IRZA 1OCPA 4UUTA 5J1YA 4D5FA 1UHSA 1MSFC 1I6HJ 3BT9A 5F27A 4BBRJ 1WPKA 3FISA 2MGQA 2CRGA 4MFDA 2CJJA 1GV2A 2FQ4A 5IOYA 1T56A 1GUUA 5EGOA 4G12A 4V2FA 1GV5A 1Z77A 3FIWA 1F43A 3MVPA 3Q0WA 2XPUA 4D7MA 1JT6A 1ETKA 3TP3A 4M3EA 1VF9A 2HXIA 3HOZJ 4IHVA 3JRAA 3HOVJ 1X58A 4JX6A 1Z0XA 1IDYA 3BR3A 4FISA 1IV6A 1ZR2A 4HNVA 4V2GA 5EZGA 4ABZA 1JJ6C 4A3GJ 5K7ZA 3GTPJ 3TEDA 3I4MJ 5F04A 3HM5A 4MO7A 1POGA 5IP7J 2EZHA 4XRSA 3A01A 3HOYJ 4B4CA 4UUSA 3IH2A 2ECCA 2Y9ZA 2E2HJ 2XGDA 4DZJA 4QTRA 1R9TJ 2VUMJ 4A3MJ 2E2IJ 3G1LA 1JKRC 3JRHA 2L7FP 2NVXJ 3JRIA 2W48A 3K2AA 1HLVA 2N8GA 5BNGA 2NVQJ 5C44J 2HOSA 2DMNA 2Y9YA 3TP0A 4BXXJ 1CQTA 4X6AJ 3K7AJ 3UKGA 4LOCA 5F1JA 2Y30A 5M3MJ 2JA8J 2ME6A 3CMYA 2M0CA 4W1UA 5F0CA 4A3CJ 2AO9A 2IBDA 2K9NA 4CYCB 3WHCA 3CDLA 2M8GX 5JLXA 1MBEA 1ETOA 3RKQA 1MBFA 3ZOBA 4Y7NJ 4A3IJ 3PM1A 3S15J 3DCFA 4DYCA 4M3FA 3E7LA 3Q0UA 3VPRA 5E3MA 1ZK8A 1BW6A 1SFOJ 1B72B 4JP0A 3JR9A 1MH4A 3S1NJ 3S17J 1JKOC 1PUFB 4X1EA 1HF0A 1G2HA 5C3EJ 4A3FJ 3H3VK 1ENHA 2NS7A 3SDGA 1U9OA 5GPCA 1AU7A 1E3OC 4B1RA 4AYBN 3QPSA 4DW6A 5EG0B 3C2BA 4I76A 2HOTA 1IDZA 2LLKA 1B72A 1ZQ3P 1ORKA 1DU0A 3GTGJ 1ZTRA 3PO3J 1W0UA 5J3LA 2CUEA 1IGNA 3LSJA 1I3QJ 2OPTA 5HODA 3BG3A 2WAQN 5EDNA 4JYKA 5E3NA 1JT0A 2EQRA 2K9SA 3SFIA 4QIWN 3JRGA 4BY1J 1OFCX 1JTYA 2X9DA 3OSGA 5EG0A 2R5YA 2DA5A 3M3YJ 3TW7A 3RZOJ 3FK6A 3QPLA 5C4JJ 2ZB9A 4FE7A 3I4NJ 5FKMA 3O8GA 3G1OA 4BKXA 5M5YJ 2O8KA 1NK3P 2EBIA 2TRTA 5EZHA 1ETYA 2JN6A 3SJMA 1NK2P 1GVDA 4JX4A 3IV5A 4M6VA 2WB1N 3A01B 2I10A 2DA1A 1HOMA 2LK2A 4UUSB 1A5JA 2FJ1A 2EZIA 2TCTA 1JUSA 4FE4A 5IYBJ 3NARA 3GTJJ 3IH4A 1F36A 1U9NA 3BG9A 3Q0VA 2JJ7A 4A69C 1MSEC 1JGGA 3LSRA 4DYQA
chains in the Genus database with same CATH superfamily
2CSOA 2D1HA 4S04A 1WI3A 4A3LJ 2YU9J 1H8AC 3GZ6A 2QZ8A 4ZZDA 2CFOA 1M1EB 2QF7A 2DDBA 2GLOA 4HX8A 4NQWA 5K7FA 3BP8A 1KYWA 2BY0A 5CVIA 1WVRA 4G7ZF 2VN2A 1X3WB 4C9YA 3E5UA 4IRHA 1YW8A 4GYIA 1P4XA 2HWVA 3BTJA 3GX4X 3ZQ7A 2YX4A 3DU5A 5K1YA 2O7OA 3TL4X 1MJBA 3GTLJ 1CGPA 3H35A 4RGUA 5H6QA 4UB8C 2WV1A 1R71A 1Q1HA 3VEPA 3GXOA 5FD6A 3GFLA 4O6JA 5E1ZB 2WAFA 1MNEA 3TW6A 2YX7A 4OOIA 3A02A 3S2WA 3WTYC 5K7HA 5TISC 4AYBA 2IEKA 3E5XA 3WODF 1RR7A 3H3ZA 3DF8A 2DYSH 2FMYA 4MIMA 2NVYJ 1ZGWA 1YJNI 4XLAA 3DBHB 4BJ5C 5L3CA 5FLMJ 1EH8A 3FWEA 1MZBA 4NC7A 4FQGA 5CVRA 1RKWA 1SVOA 2JK3A 1SC7A 2OV7A 2PMZN 2LF7A 5FKOA 1R6RA 2VXDA 3KZZA 2EV5A 1JKQC 4CYDA 5F64A 3S1RJ 2QBYB 1BI2A 1OQYA 4IRIA 1LB2A 2H6BA 4KT5C 2XAQA 3J80Z 3HOWJ 4F3QA 3KFWX 3Q3SA 4OINF 1O3QA 1J2XA 1RESA 1B9NA 3JRCA 1WQ2A 1X2MA 5BMZA 5CLSA 3U21A 2AHQA 1Z7LA 2EFWA 1OKRA 1RNLA 3PNYA 4JQFA 2PJRB 4F91B 5KK1A 4I7HA 1F1ZA 4IKFA 4IHTA 1XGSA 5JVTA 2VC0A 2G9WA 3MD2A 4ENJA 2ZFUA 2VI6A 3DWLE 2QBYA 2OC6A 5ERIA 2FRHA 1D8JA 3GZNB 1H0MA 3BTLA 5EF6A 3IP4B 3DP7A 1QA6A 3CUQC 4OIQF 2QGUA 3HHGA 3CC4I 2NS8A 5EEGA 4BQAA 2VBYA 1YE9A 2GM4A 1MBJA 2DN0A 5GADJ 4NC6A 3JREA 3JRBA 2BYVE 2DT6A 3HGYA 2CS3A 2XAUA 2DAOA 2NOJB 3TQNA 2NYXA 4BE2A 1KONA 2AQFA 2M4KA 1OCRH 2CQQA 5DS9A 1R7JA 2R92J 1KQ0A 1JKPC 1FSEA 3JAMK 3CLQA 3PL8A 2WC2A 4FASD 4XM3A 2ZNZA 2MD5A 4IHWA 2PI0A 3E3VA 1UFMA 3IAS2 2E19A 4E7ZA 5AIPA 4AUXA 2JZYA 1WKMA 2VT2A 4Y4RA 1SD6A 1SANA 2OBPA 4PFPA 2F2EA 1X4OA 1BR4A 3S16J 4Y52J 3HRTA 2V1UA 1GXQA 4R79A 5D8LB 3GFMA 1P4WA 2EPFA 2D2WA 4XRSG 5HS8A 3FK7A 1FP2A 3MWMA 4K2EA 5CQEA 1ACIA 3GTOJ 5D5VB 1VQ4I 3SQNA 5J6XA 3DKWA 4L5IA 5FKNA 5K5QA 2XPVA 4LGWA 1YW9A 3DU6A 1IUYA 3BQYA 3LQQA 1UG2A 2E34A 1G3WA 3DEUA 3BTIA 2MD0A 3I59B 2IS1A 3HXLA 5HS7A 3OYAA 2AXTC 1RZ4A 1ULYA 3B02A 3CCVI 3KIOA 1LQ1A 3PUFA 4BJTA 2OCEA 3K69A 4W97A 3IRRA 3DPLC 3CF2A 3BJ6A 1YRNB 3VSLA 3OSFA 1MD0A 5D5XB 2DTRA 2B9SA 5D4SA 3CCSI 4UV9A 2ISYA 3G3ZA 2R7UA 1W5CC 4KN7X 2F5FA 1OR7C 3H0GJ 3KYCB 4RAFA 1VQNI 3FBNB 4XONA 5M5XJ 1J0RA 3K4BA 2R4GA 1HA8A 3AL0B 4B44A 2DFFA 2L0KA 2VBXA 2X6XA 4HDUA 1YRNA 1ZG5A 4DZPA 3I3LA 1O4XA 2X6OA 4FCYA 4I0AA 3SXYA 3FXQA 2DJIA 3HGGA 2Y69H 2ELKA 4HV5A 2GA1A 4IPAA 4M72A 3D5LA 5F08A 3ZMZA 2M34A 2ZJRF 1LDDA 4XKWA 2R5ZB 3WU2C 4HNTA 3F21A 3I9V2 1R58A 3KYDB 5J4YA 3L2CA 5LGUA 2LOOA 4AD9A 4A0XA 3ZN1A 1U8BA 2CUFA 1TNSA 2BVLA 4XMYA 1OCTC 1W5SA 4ANJA 3ELKA 4YIFA 2JRMA 1WJEA 1JUMA 3OIOA 3ASNH 1PYVA 3J7AY 3PO2J 1U5TA 3CJNA 2IGKA 1VQLI 2BW3B 2R5ZA 2DMQA 4YELA 1D8KA 2OZUA 1PUFA 1EF4A 3M7GA 1R4MB 2KT0A 3JW4A 4BDZA 2KP6A 4RGSA 3WTZA 3L2QA 1UHSA 2Z1DA 4L9TA 3AAFA 1MMGA 1K7AA 1ZGAA 2P5LC 2OQRA 2MGQA 1GV2A 1AOYA 3PFYA 2PQ8A 3HIFA 3ZN0A 1P4AA 1H9TA 2K5CA 5B1AH 4RM3A 2MC4A 2BW3A 1W36D 4LLNA 1DGWY 3VDXA 1F43A 3MVPA 3Q0WA 2XPUA 5GAGJ 1J75A 3VFZA 3PQJA 3TP3A 2PJPA 3C7JA 4I02A 3CCMI 2V9KA 2EIKH 4PGGA 4BHBA 3FMQA 5DCFA 1XMKA 3HG9A 4JX6A 2WY8Q 2GIVA 3P9CA 4GCVA 1G3YA 2GA2A 3TMOA 4XLEA 4IOAF 1YQAA 2HOEA 3J7YJ 3AFHA 4LIUA 2VQHA 5J40A 2IS2A 1GVJA 3OWTA 2PLYA 5HVQC 3I4MJ 5F04A 3OMYA 4Y17A 2QSGX 4XRSA 5HLHA 1SEUA 5FROA 4B4CA 2VB6A 2TDXA 2JSPA 2L9SA 2X51A 3H9GA 4DZJA 4DNCA 4QTRA 3E6CC 3SYTA 3G1LA 2VQGA 3BY6A 2L7FP 3JRIA 1HLVA 2N8GA 3KP4A 3VYRB 2A6HF 2GZWA 3IAM2 4U0YA 2M45A 4BXXJ 1CQTA 1FOYA 4LOCA 2DW4A 4RS8A 4ENNA 2JA8J 4CGZA 5ICEA 3VODA 1V5EA 2Y75A 2M0CA 4W1UA 2E5ZA 2VASA 3QU3A 2E5NA 2AO9A 2K9NA 2M8GX 4XKBA 4LITA 2C6YA 1ETOA 3RKQA 1Z91A 2HTSA 2VPLA 2R7DA 1ON2A 3P7NA 3ZOBA 1T38A 3N97A 4C2TA 3PM1A 1IAWA 4AIHA 4B48A 3TO9A 3W3CA 1YS6A 2RQQA 4ZZLA 2E7XA 2HZTA 3AKZA 1JHHA 1Z6TA 4I0BA 3JR9A 1ZN2A 3S17J 2V9VA 3ABTA 1TL8A 2A07F 3C18A 3V4GA 2RREA 4PJNA 4BAYA 5JHFA 1KU3A 1LUJB 5GPCA 2F5CA 2HVQA 4EVIA 2KISA 2VBZA 3QPSA 4DW6A 3C2BA 1QO0D 1SVLA 3IC7A 3LSMA 3G4SI 2P6SA 2H27A 5ILSA 1ZQ3P 4Q4ZF 3I53A 1ORKA 1DU0A 2O6GE 1ZTRA 2Z99A 2DPDA 3M8EA 3TGNA 1W0UA 1XB4A 2MLGA 4NUBA 2A05A 1IGNA 1I3QJ 1K79A 2VLAA 4EJTA 2HU9A 2ZSIB 3BG3A 2G7UA 3MEXA 2WY7Q 3GLLA 1YIJI 5EDNA 1RIOH 2K4JA 4RA2A 1XMXA 3DLLF 3EQLF 1NG7A 3SFIA 4QIWN 2FNAA 4BY1J 1JTYA 4UVBA 3H5NA 4L9JA 2DA5A 2KFDA 3QPLA 1QZEA 3KLNA 2W4SA 1FT9A 3ABLH 4A2UA 4B3XA 1A31A 2LRDA 1E3PA 4L0ZB 5JR3A 3O6BB 2I5UA 2ELHA 2P0WA 2JN6A 5DCMB 4E7HA 3RQ4A 3IV5A 4U0WA 2FE3A 3CCUI 1OCOH 2OD5A 4CCOA 4FE4A 1YITI 4J01A 2PMUA 3BG9A 4A69C 1MSEC 3SFZA 3WE2A 1L3LA 4KFCA 3B73A 3PIPF 4HV6A 1X4PA 3HZJA 2O8XA 5HS9A 2H94A 4DYQA 3BCBA 2VODA 1XGNA 5DCMA 3FMRA 4BUPA 2RN7A 4EGYA 5LHIA 4H0EA 5CVVA 1N77A 2KRFA 4UV8A 5DTDA 2LMDA 5E8GA 2FBKA 4LK1F 1UELB 2X48A 3S14J 3QWLA 1L0OC 3BG5A 5J1RA 5A2QK 2GOMA 2XSJC 3GFJA 1O7LA 1W36C 1LFBA 1A6IA 2HDCA 4IX7A 1W5TA 3IKVA 5E79C 2IS6A 3K1NA 2BEOA 3OYKA 1ZKGA 2M9HA 3MQ0A 2NXNB 3WTVC 3COAC 1AKHB 4U0VA 2CQKA 5TJJA 2J5OA 5ILVA 4LB5A 3K2ZA 2GXGA 1JXSA 3LSKA 5J47A 4I6ZA 5E8IA 1B8IA 4LMYA 3QQAA 1IZ1A 2MH2A 2V6EA 4UNOA 2STTA 4L0YB 4U87A 1F5TA 5HDNA 5FJ8J 4RLFA 5BQTA 4KIBA 1P92A 3E6MA 1ZRFA 4CXFA 2JA6J 1B6AA 2XGXA 1QQIA 2FXAA 2ZMEB 5LGNA 1AKHA 2DMTA 4C3IJ 3W6VA 2R7WA 4HSRA 3G2BA 1BJZA 3LOCA 1DGRM 3T0YA 5FKLA 1D0XA 1TC3C 3ZQHA 3GF2A 1T0FC 2WAQA 2LKPA 4KDPA 1KA8A 4FETA 2IPQX 5IYDJ 2MC3A 2H09A 2HQAA 2DMPA 2V1XA 1K78B 1RR8C 2YS9A 2A68F 2FU4A 4O5VA 4XOPA 4A5NA 1ZG3A 3F23A 2R7OA 3K6GA 3OOPA 2JA7J 4H4KC 1S7AA 3CJTB 3K10A 3PNVA 3W6KB 2L9NA 5E1WA 1GHCA 3B6AA 4FT8A 4EV0A 3QYBA 1XCVA 2LC2A 3RYPA 2HXOA 4ZTFA 4HLXA 4ZH4F 1T33A 3CJQB 1PJRA 2VJ4A 4PJ0C 1OJLA 4KNYA 2MYSA 2XGEA 4IHYA 2GXBA 4DIQA 2P7VB 3I58A 1QZZA 1ETWA 2GQQA 3BTCA 3L09A 5D6FA 1JHFA 1K78A 2DJNA 1TWFJ 3QP5A 1S6LA 3OOUA 3B6CA 4BDYA 4D5CA 5B3SH 2VOOA 3H9QA 4PK4A 1BI0A 1MBHA 3H1CA 1GXPA 2DPUA 5FLVA 4G8XA 1UJ8A 1NTCA 1VZ0A 2ID6A 1D0YA 3BR1A 3GO5A 3F0CA 4YFXF 2F4IA 3S1MJ 1FTZA 2DLLA 3TOAA 1JE8A 3FM3A 3HKZN 1WJDA 2XDVA 4ETSA 4IVNA 1FWZA 1JTXA 3K4CA 1FOWA 1WI9A 3CCLI 1R1UA 5FKKA 2BBYA 2LG4A 2LREA 4HLYA 3RPQA 1R5HA 3NWSA 1YO5C 4XSZF 4A3KJ 1I50J 1X1CA 1X1PA 3KEYA 1X1DA 3JRDA 3K4KA 2UXNA 1BIBA 1BN5A 3RZDJ 1YX3A 3HUGA 1DUXC 1HDPA 4V19K 5F1RA 4DYRA 4M9ZA 4A3BJ 2VOPA 2BY2A 2WV0A 2XAJA 1R23A 3C2HA 3NWTA 1WJCA 2IP2A 1ODDA 2NRAC 3FHZA 1RKTA 2F6CA 2DOAA 4IQ4A 1I5ZA 1B59A 4IEJA 4WF2A 3QPHA 5JLWA 1AWCA 2F5VA 2L2OA 3OR2C 4ENKA 3KP2A 4M6XA 5H2FC 1R22A 2RVCA 4PGHA 1WWXA 3V7CA 3BDDA 1BL0A 2M2EA 2E36A 3ESWB 4II3A 3W2WA 4UB6C 2XASA 5FD5A 4Z2YA 3I4PA 1DQUA 2LD5A 2B0LA 1XDUA 4A3EJ 3BCAA 4E7SA 2HYJA 3VSKA 3ZCOA 1HDDC 3CUOA 1ZREA 2RGVA 1O57A 5FGMA 2D1VA 4HBLA 1VNDA 2O9LA 1IF1A 4YFNF 4R8HA 2QYOA 2M87A 3HYIA 3ZQFA 3MKLA 3HSEA 2NVTJ 5BS6A 2R7ZJ 3DTKA 5HDGA 3O8HA 2DFIA 3MKYB 1YIOA 3WU0A 2BY3A 4L9VA 2CG4A 2EB7A 2Z2SB 1WGXA 2V79A 5LD2C 1XSVA 2HQNA 2GIZA 2VBWA 2Y31A 2DA2A 1IC8A 1BBYA 2Q0OA 3NAUA 4N9IA 4EJUA 2HZDA 2K4BA 2L01A 3ROUA 4G94A 1Z67A 4BE1A 2CQXA 1YJWI 4CCNA 5D5UB 4G6QA 4MTEA 1D1AA 3QYEA 2KDZA 1IRFA 2B7EA 1TQMA 3TDZC 2O61A 5L3DA 2BY1A 3ZGKA 2JUCA 3MKWB 2L9VA 4KISA 1Y0NA 3UR3C 2WB1A 4I01A 1LKXA 4A3DJ 2LFBA 4PJMA 5KAFC 2NVUB 3HL2A 1XG1A 4ESFA 1MIJA 2FBIA 5DM6F 1SAXA 4D7NA 1F9NA 4F55A 1WJAA 3OL4A 3S2HJ 5E3OA 3PFIA 1SD5A 1JJ8C 5B66C 3DFGA 2M5WA 2FSWA 2ZJQF 1XSXA 4BHPA 1V5FA 1KZHA 4L5EA 5CPRB 2HYGD 4NDLA 2VE9A 1BA5A 1YYVA 1CF7A 2COBA 5EGOB 4AC0A 3HDDA 3HRMA 1S3JA 4ZYEA 4HX4A 2KPMA 4KITB 2K86A 5EYRA 1APLC 2HDDA 3U1DA 3BR6A 3IUOA 3KE2A 3WGIA 3RKXA 1VFCA 1IRZA 3J81K 3WU1B 3K70D 3FM5A 4CSWA 1MSFC 3LA7A 3IHUA 2P7CB 3M8JA 4BQNA 3RIRA 5FRNA 3H36A 1WPKA 3FISA 4C2UA 4HYEA 4MFDA 4HX7A 1B1BA 2FQ4A 5IOYA 1G3SA 4HQEA 3BJAA 2CQ7A 3HTUA 2BV6A 5EGOA 2F4MB 3FX3A 1H9GA 3D0SA 3D5SC 1Z05A 3LWFA 4QPQA 1BC7C 3AL0C 3I54A 3ZXSA 3CP2A 5H6RA 5DDGA 1TZLA 3FXUA 4LD5A 4D7MA 4QLCU 4OU0A 4EJWA 4YRVA 1UZCA 1WJ5A 1BI3A 2V9PA 1ZELA 1UHWA 2HXIA 4JK1X 4ZDLA 3OS0A 4IHVA 3JRAA 2JSCA 3OYIA 3HOVJ 1ZYRF 1X58A 2OUMA 4RAYA 2OAZA 3H5AA 1MJ9A 2R7RA 4CHUA 1LJ9A 1I6XA 4WK8F 3TO7A 3F6VA 2XC7A 1JJ6C 2HVRA 1XN7A 4LK0F 5KHDA 3K1MA 5GAEJ 5D5WB 3HM5A 3R0AA 4MO7A 5ICFA 3LA3A 2EZHA 3A01A 4AM3A 1ZH5A 3SZGA 3M1CA 2ZJPF 1XSDA 1PUEE 2GXAA 4FX4A 2K9LA 1QGPA 2XGDA 3ZR8X 1MMSA 3FZVA 2VUMJ 3LAPA 4A3MJ 3OYHA 1EH7A 2FUG2 1JKRC 5DUKA 3BOQA 3JRHA 3K2AA 3CLOA 2NVQJ 4RGXA 3VWBA 2HTJA 3ULQB 3TP0A 1EV7A 3G71I 2JQ7A 5F1JA 3EDPA 2O0YA 4Y33A 5M3MJ 4NBQA 1Y0UA 5D6EA 4D1QA 2X85A 2ZSHB 3CTAA 2OTLI 1FC3A 2DDAA 3IWFA 5F0CA 5DYMA 4XN0A 2HFHA 4HW0A 2IBDA 2W24A 4E6KG 4F93B 3CDLA 2R7FA 5CKTA 2AXLA 1MBFA 4XRFA 1VQ5I 3VYUB 1TTYA 3CUQA 4U7BA 2V1DA 1U2WA 4DYCA 1NH3A 1LVAA 1ZK8A 2FA5A 1W7PA 1BW6A 2QQBA 1FPQA 1SFOJ 3LSIA 1B72B 1SVMA 3H92A 2MFZA 1J5YA 1MH4A 2KHMA 1VQKI 3DKXA 1U5TB 6PAXA 2E35A 3RPUA 3JSPA 1PUFB 4IRGA 2M30A 1G2HA 1SAUA 3H3VK 1ENHA 3DTEA 3SDGA 4AYBN 3VYTB 1N75A 2M8EA 2O03A 5GTHC 4E7LA 2DOFA 2VJIA 1FZPB 1R1VA 2K7LA 3AG2H 3TKYA 5F6FA 1B72A 4PFOA 4P5OA 3OYLA 4EATA 1Z9CA 3I56I 1MDMA 3M8FA 1XTAA 2IXSA 4PJLA 4HAMA 1TLHB 3LSJA 4XSXF 4OAZA 2H1LA 2DBBA 3CP8A 3J7AO 3KX2A 4LJZF 2W7NA 4RAGA 2RC4A 1Y6IA 2R5YA 2JRTA 3BG7A 3M3YJ 3TW7A 1WJFA 3FK6A 3L2VA 1XMAA 3E97A 4FE7A 4ESBA 2VKHA 5FKMA 4BKXA 1C0WA 4O3MA 2EBIA 3OYFA 2I8DA 1TQPA 3GEZA 3N05A 1NK2P 1S8NA 3BJOA 3W6JB 2QUFA 2WB1N 2P4WA 4AU7A 2E1MB 1HKQA 2DA1A 2UXXA 1HSJA 1A5JA 2EZIA 1FOKA 3QOPA 2DYRH 1E2XA 4HZFA 2EJRA 3EUHC 3F8CA 4GRIA 3JSOA 3RKYA 5LEKA 4MEXF 1TW3A 1KQ9A 2JJ7A 3L00A 4IL6C 1JGGA 1OMIA 2VQCA 4BXFA 4HF2A 4UVCA 3VOEA 3QODA 2BVMA 3LSRA 5BPDA 3K70C 1OR7A 3DQVC 2FQ3A 2X6YA 3KETA 2L7KA 2V4JC 2DQRA 3GYHX 3HRUA 3X2QH 1QNTA 4ENMA 2IGNA 3PSIA 2EILH 4TV7A 1T8IA 2VPRA 5E1XA 4NC8A 5KAIC 3WTTC 4XNFA 2E1CA 4KYWA 1LDJA 3ZMTA 4LG0A 2DI3A 1Q1VA 2VJ5A 4KA4A 1HBXG 2P8TA 2B63J 3HHHA 1JGSA 3S32A 1X3ZB 5GTIC 3K4JA 3UNGC 2HOAA 1ITYA 3T5XA 4HF1A 3LMMA 4BL0B 3ZQIA 2RAEA 5H20A 3RKWA 1U3EM 1B9MA 1G8XA 3OS1A 3QU6A 2FX0A 3JAMZ 1BI1A 5L3GA 2ESHA 4B47A 1OCCH 5FLXZ 2FEZA 3L2UA 4YG2F 2WBMA 4Q48A 2L4MA 2K02A 1HCRA 2CU7A 2K40A 2CV1A 2RNGA 5E3LA 3VYSB 1IRXA 2JMWA 3A03A 1R1TA 5KCMA 5DEQA 3OYNA 3ZQLA 1ETQA 1TT5B 3SEQA 3ML6A 1FYLA 1HW2A 3I5UA 1YW7A 2Q2EA 2CW0F 2E7WA 2IGMA 2KJCA 1G6NA 4Z6YA 2JPCA 1O3TA 2BHZA 2HNHA 1FY7A 3DBLB 4XLNF 1D1BA 2L3DA 2UWMA 5DD4A 1TWHJ 4I98B 4DBQA 3CO7C 1QZYA 3BROA 3DV8A 3Q9SA 3ECOA 1QVUA 3EETA 1S5LC 4DBRA 1STZA 4M3DA 1S72I 1SMTA 1PP8F 1IG7A 2ZC2A 3SEZA 2OU2A 4EMSA 4IHSA 1P2FA 3HRSA 5M5WJ 2HEOA 2WA0A 1YLFA 3WTSC 4C3HJ 4PUSA 3V8KA 2XPWA 2KJBA 4QSHA 1MH3A 4L9NA 2DK5A 2A5WA 1Z3YA 4I2OA 3IRQA 1Z7UA 1WHUA 2Y48A 1K4SA 4XRMA 3S2DJ 2JA2A 1SMYF 1IUFA 1PDNC 2R7QA 1RUNA 4B09A 2LKXA 1TBXA 2CUZA 1LNWA 2DOEA 1WH7A 3MAJA 2F5EA 4DJAA 1TWCJ 1YTYA 1YOVB 1MNMC 3MMYB 3WHBA 2R3SA 3EUKL 3D1NI 4HPQA 5GPAA 3WE3A 2KRCA 2BGCA 2RDPA 2DA4A 3FXKA 3VB2A 3TDUC 1VQ7I 2R0QC 2KKOA 3IKTA 2W00A 1ZR4A 1OLTA 3JTHA 2BXYA 2ZFWA 3BQZA 3LFKA 2ZMEC 4G9YA 1YHQI 4F7ZA 1RUOA 2EV0A 2L02A 4ON0A 1YS7A 4C30A 1WH5A 2IA0A 3HOTA 2DA6A 1BOAA 2W82A 1DP3A 1UMQA 2Q1ZB 1T39A 3KEOA 2L5QA 4CUGA 4M3BA 2K9QA 4IF4A 3E5QA 3Q9VA 1MKMA 2X1EA 1B8IB 4HG2A 2JA5J 2X1CA 2Z5UA 3JRFA 2KIFA 2XF5A 2GOXB 5F0FA 1ONVA 2YUSA 3NRVA 5GAHJ 3MZHA 2NOGA 4JBAA 3K4NA 4CDGA 3L1PA 2M7BA 1ZAOA 2XB5A 4LB6B 1FIPA 5JHUA 3J80K 5K5RA 2L9RA 2Z16A 4PCQA 2PMZA 1IN6A 3RCOA 1USTA 5HLGA 2HS5A 2HYFA 3OY9A 4E7KA 3KLOA 1UAAA 2X0LA 2VIXA 2VKEA 2ME0A 2RV8A 2LVSA 4BU2A 4GXOA 4ZYHA 2MG4A 1DU6A 2A69F 2KLOA 3KZIC 1AA7A 3FF5A 3S3OA 3QAHA 4XKCA 2FD5A 1WZ2A 3E6DA 4LLGF 5EEAA 1TWAJ 1QRYA 5LFAA 5J8FA 2ISZA 1WCMJ 2R7VA 3LSPA 1MW7A 3F8BA 3DLAA 4CCKA 2JTVA 3BR5A 3ZQGA 2KQRA 2X4HA 3LFUA 2LTPA 1GDTA 3H9JA 4A0ZA 4CCLA 3MZ8A 2EWNA 4Y3OA 4EEFG 5J4VA 4CICA 4LG3A 4MLOA 5FO5A 2W57A 3LSHA 1T08B 4B8XA 3GFIA 2DXIA 3O2PE 2LR8A 3CQZJ 2F5DA 1IN5A 4ESJA 3KEQA 4KN4X 2E2JJ 1I1SA 1GLNA 4N0BA 2DA7A 2HQ5A 3O3KA 3NEUA 4C2MJ 5HOOA 5ICCA 3V8LA 4P55A 2DMUA 5HNHA 2LDUA 5M3FJ 4B3AA 2LYCA 2EZKA 3JCUC 4CO8A 1IN7A 2R7TA 3IL2A 1XX5A 3OV8A 3LAJA 4A6EA 3ZMUA 3U9GA 1WSUA 2QLZA 3G73A 1S7EA 3CCYA 1O7FA 4CYCA 1K4TA 3BWGA 3EUAA 1D0ZA 3ZQCA 2ETHA 2Z3YA 4CZZA 2FNPA 1IXCA 1ZARA 2DA3A 2EFPA 3FKIJ 1NHAA 3A1YA 4AIDA 4EM0B 5DUIA 5IYCJ 4ZTJA 4U7DA 1D1CA 2EZLA 1RI7A 3HUGB 2XF7A 2OF7A 2MW8A 1O3SA 1DP7P 1OYIA 1Y8QB 1K83J 2R7XA 2DT5A 1S29A 4CCJA 1HQCA 5GP9A 1E3HA 1OCPA 3E1SA 4UUTA 5J1YA 4D5FA 2QSHX 2HVSA 3CCRI 5LHHA 1R49A 3BT9A 1BIAA 3WTXC 4BBRJ 1IRGA 1EA3A 1HW1A 2CRGA 2CJJA 3BZCA 1KU7A 3AG1H 1FX7A 3ONQA 1FSHA 2YR2A 4X0GA 1GUUA 3PNTA 3ZP5A 1KYZA 2J5PA 1JI8A 4RM2A 4G12A 3BZKA 5IT9Z 3FIWA 3N4MA 4IQJA 4BQOA 4HOBA 4F52A 2EV6A 2FOKA 4XR6A 1QHGA 4Q47A 2A61A 4AVZA 2O3FA 3GLXA 1JT6A 2ADUA 4IXAA 1YJ9I 4M3EA 1FYMA 3V7SA 2BOLA 1BR2A 2NNNA 2M0MA 2XAFA 2COMA 3KP7A 1O3RA 3MKZA 1R5ID 3BPVA 3BG6A 1IDYA 1R5GA 5LGTA 2MLKA 2KIUA 4P9FA 4HNVA 1FMWA 4BNCA 3PSFA 3FXLA 1IW7F 2CYYA 3A0BC 2P5VA 3DKYA 3ASOH 5LBQA 5E18F 4XLFA 3FXJA 4M6YA 1XGOA 1T0FA 3CESA 1POGA 1ZRDA 1BJAA 3QOEA 4GGGA 4UUSA 3G6EI 4UY8I 1HW5A 1I27A 2OJED 3FHNA 4OIOF 2ECCA 2Y9ZA 4E7JA 1REPC 3ERMA 5DD8A 2E2HJ 4ZDOA 5AONA 2W84A 4S05A 3HPHA 2ZKZA 2E2IJ 1VTNC 4NNJA 1J9IA 3PQKA 2K27A 3RI4A 5DM7F 4OIRF 3OS2A 2HOSA 2OZ6A 3P9IA 4X6AJ 3UKGA 2Y30A 4EGZA 4PJJA 3ABMH 4M73A 1SD7A 4E4HA 3I0TA 1N25A 4A3CJ 3OIPA 3DEEA 2BZTA 3WHCA 4DOZA 5JLXA 2CW8A 1YI2I 4XOTA 2DFHA 3L9FA 2JVHA 4NB5A 5E20A 2Y0SA 3E7LA 2DFEA 3KYLA 5E3MA 4RMNA 3L2WA 4ASNA 4BACA 4XBFA 3R0JA 3CCJI 2IGOA 4JP0A 2E71A 1CF7B 2F4OB 5A2QZ 1QU3A 3RDIA 3S1NJ 2JUGA 4PSXA 2ESNA 4DGWB 5B5EC 4AIKA 1JKOC 5ILUA 4R1HA 1V4RA 4X1EA 2D45A 4M74A 4I09A 2ZCWA 2IJLA 4IJAA 4N9HA 5C3EJ 4A3FJ 2NS7A 4EQQA 1AU7A 1KU2A 1R36A 3AG4H 1MMDA 2M3AA 1J59A 2HOTA 4ZJZA 3CMMA 3S3MA 1IDZA 2YU3A 2LLKA 2XUBA 2XV4S 3RJPA 3GTGJ 3PO3J 3FMSA 1Y56A 3CCEI 3KZYA 2WAEA 5J3LA 1SD4A 2CUEA 2HGCA 5HODA 5EEHA 4A12A 2WAQN 2DU9A 2H6CA 4JYKA 5E3NA 1JT0A 4N4OB 2K9SA 3JRGA 5CJ9A 2X9DA 4RB0A 2QEXI 3C3WA 3RZOJ 4LLLA 2MA3A 2G7HA 3MZYA 5C4JJ 2ZB9A 2CUJA 4G6DA 2JPBA 4BE0A 5HDKA 3CCQI 2PJRA 1ERDA 3G1OA 1OISA 5M5YJ 2QVOA 1NK3P 2CWEA 2O8KA 3ZQQA 1PP7U 2TRTA 2CH0A 1SFKA 1ETYA 3S3NA 3LSTA 3SJMA 3IWZA 1GVDA 4MTDA 3V7RA 3R4KA 4JX4A 1BR1A 1Y8RB 4HF0A 4M6VA 4RAZA 1DDNA 3A01B 1FBQA 4YIIA 1HOMA 2LK2A 3L2RA 2Q8KA 2FJ1A 3WG9A 1XD7A 1Z1DA 3NARA 4MNUA 3GTJJ 3IH4A 3GMEA 4U88A 3HPGA 1FP1D 3CC7I 3OYEA 5FLXK 1J09A 2Z33A 4BH9A 3OYMA 1FMVA 2BHYA 4BYYA 3S93A 2LY2A 4WX9A 4WXDA 1WRJA 5CVUA 3F9KA 5TRDA 1B4AA 4HA8A 2HPMA 4IHXA 1XS9A 1U5TC 1SFEA 4QWQA 2GBYA 1P7JA 2EH3A 2P6TA 1EJ9A 1RETA 5HNFA 2M7AA 3GZ5A 4HEA2 4J19A 2EINH 3GTMJ 4G6TB 1QPMA 1N78A 2DO7A 3V42A 4MGRA 1W0TA 2XF6A 5IP6A 3GCMA 3C2GA 2ELJA 2EIJH 3CF5F 2XVCA 2KZGA 4EJOA 3P5JA 4MHGA 1AHDP 3CUQB 2CMPA 4WCGA 9ANTA 3OYGA 1W7PB 3DBRB 4KJZA 2CV0A 1FOXA 4P1WA 2DQLA 4P9UA 1X1BA 1P7IA 3I64A 2PEXA 2KIMA 1R4NB 3PIOF 4J00A 1V5GA 4GFBA 2ECBA 2K3PA 5IPAA 1Y1WJ 2HKOA 1LE8B 2WWYA 4RB2C 2ICWG 2VXZA 2X1DA 5D8KB 1X1AA 3CMAI 3ZMSA 2JWTA 1LEAA 4A3JJ 1BW5A 2KRHA 3OYJA 5LRRA 2XAHA 2HI3A 2VKVA 1FLIA 2VE8A 1IXRC 4M9SA 3HOXJ 1U78A 3HOUJ 2L4AA 3PUBA 5DV5A 5F0HA 1QPIA 5JI6A 4AWXB 1T98A 4RBOA 2OA4A 3I59A 2K9MA 1E17A 3M4OJ 3A4CA 4UHTA 2E1MC 1G3TA 1NG6A 3W2VA 4JX5A 4AVPA 4EM1A 4IZZA 1MDMB 5IP9J 2PBIA 2KL4A 4LIVA 1LE8A 1HKTA 2UV1A 2QCOA 1XC5A 2AS5F 1GT0C 1FJLA 2RQPA 2FMLA 3HSFA 1FEXA 1Z21A 3BR0A 2K3FA 1G4DA 3LQRA 1QHHD 3KCCA 2W1OA 1HSTA 3E6BA 1IN4A 1T6SA 2R5YB 3S8PA 4ZYGA 2CO5A 2DTZA 4XIDA 2IT0A 3WTWC 1T95A 3T8TA 1OCZH 1X3UA 4XL9A 2H1KA 3LSGA 1DPUA 2W85A 2EFOA 1YX5A 3DEWA 1MBGA 4YIRX 5FFXA 1LDKB 2L7MP 2LBFB 2VONA 3ZRGA 1ZLJA 1IXSB 2R7SA 1D5YA 2VKDA 1WFXA 4WWCA 4RB3C 2QM3A 5J8CA 1K6OA 3ERED 2A6EF 2QQ8A 5JFRA 2EFNA 4M9XA 5LHGA 2G0EA 1VI0A 3IH3A 3L7WA 2PMHA 1Y1VJ 3PJRA 2V26A 4FTHA 3ZMDA 2Y0SN 1KGSA 3OYCA 4GYGA 3CMEI 3GBGA 1QBJA 4OWRB 5FB2A 1EH6A 2LBFA 1TP4A 1TWGJ 3OIQA 2E1OA 3ZMVA 3Q5FA 3QP6A 4XLCA 4BY7J 2M1BA 1MMNA 4HSTA 3K0LA 5BPIA 2BE5F 2H8WA 2A6TA 3F3XA 5E17F 2VL8A 2CW7A 3SDBA 4BJ6C 4LG0B 2Y0MA 1BM9A 1LVKA 2EA2A 2HPIA 2DODA 2VQLA 4C3JJ 5L3BA 1VQPI 3A2KA 3GTQJ 1ZLKA 2HR3A 2UUZA 2D5VA 1OYWA 1H88C 1OPCA 2ZXJA 1MGTA 4DQ2A 1JUPA 2AQEA 3BR2A 2VT3A 1FIAA 5L3FA 4RDUA 2LF8A 2IRFG 1BC8C 2LY1A 2XGCA 2LP0A 4QPOA 2EK5A 2XRNA 2YSRA 1ETVA 2ZJ2A 1UCRA 3SHFA 3R6SA 1IJWC 4XK4A 3DXJF 2NNYA 1HKSA 1I1GA 4HNUA 2H8RA 1UG0A 4IO9F 2LY9A 2UZKA 3HC7A 3QPTA 2JVGA 3EYIA 3HSRA 2O5RA 2XB0X 4L18B 3M9AA 2IVMA 2Q2EB 1A35A 4M3GA 1TT0A 4BBSJ 1FBUA 4Y13A 2Z9OA 2R93J 4OMZA 3J81Z 1ETXA 3MN2A 1A36A 1FTTA 2ZO4A 3MCZA 2ID3A 3T8RA 1MBKA 5LLQA 4BGDA 1I3AA 1A04A 3P9KA 4E7IA 5D4RA 5FFZA 2STWA 2DT7B 3RSNA 4II2A 4KMFA 2L7ZA 1H89C 1ZHFA 3K1PA 4KMUX 2QKMB 5C4XJ 1XGMA 3HB9A 4BQQA 2XSDC 1X2NA 3CZ6A 4LFUA 3TBIA 2QQAA 3K9TA 3I55I 3G1MA 1J7KA 1TW2A 3E0JB 2E60A 2Y2ZA 1X19A 2OTJI 2QKLB 4RLQA 5J1UA 3HEFA 1YG2A 2ZXHA 3W2AA 2XIGA 3H5RA 4ZDPA 5IT3A 1SFUA 5BOXA 4B43A 4UUVA 2IAIA 2P81A 3LNQA 3WGGA 4KUMA 3K4LA 2ZBKA 4MFEA 3OL3A 1RPWA 1Z3XA 1ZRCA 2FOWA 2RNJA 4XICA 2OQGA 3F8MA 4OIPF 5AIQA 3HKZA 4S0HB 1P9QC 4AIJA 3QRFF 2MSYA 1USSA 2XHKA 3LL7A 1F4KA 1P6RA 2W25A 1V54H 5IT9K 1QVTA 2V6CA 3S1QJ 3GTKJ 4KICA 4XLHA 3R61A 2KDOA 2XRLA 3EUHA 1K61A 1ZGJA 4BHCA 3GUDA 3RQIA 2X6WA 4N4NB 3HBLA 3WG7H 1LFUP 2A3SA 1BOBA 2LNBA 2V1NA 1YFHA 5KNLA 2PN6A 4MQ9F 4PDKA 3K4MA 1U0JA 5IOZA 5K5OA 2EIMH 1D5VA 2A5YB 2PFBA 4CH7A 3CD6I 2DCEA 1D3YA 3AG3H 4HRIA 4A93J 1A6QA 2GWRA 2MH9A 4CZCA 5IY5H 4OAYA 1LPQA 4ZYAA 2WADA 3GWZA 1I6HJ 4RGRA 1MNDA 5F27A 2QWWA 1Y39A 3CDIA 2FF4A 3MFKA 4OMYA 3GVAA 2CGPA 3TO6A 5EJCA 1T56A 1VQ8I 5FRMA 2NS0A 1ZG1A 1V3FA 5B1BH 2V7FA 5HLTA 5HLIA 4V2FA 3H3UA 1GV5A 1Z77A 2BXZA 2LSOA 2XKPA 4D9JA 1DPRA 1XPXA 1W1WE 4HQMA 3BC8A 4YEJA 3GW2A 5CQGA 4G7HF 1ETKA 1FBSA 4FHTA 2ZNYA 4ZYDA 1VF9A 3TOBA 3HOZJ 4XLPF 1VQMI 3RYRA 1Z0XA 3ZPLA 1G59A 3CJRB 2K85A 3BZ6A 3BR3A 1RC9A 2KIQA 4FISA 2IA2A 1ZR2A 1IV6A 4CA0A 1HC8A 4V2GA 4A0YA 3DPTA 5EZGA 3JTGA 1FNNA 1PVEA 4ABZA 4A3GJ 2CQNA 4XKVA 3DPUA 2E1NA 3OR1C 4L5JA 5K7ZA 4RB1A 2XROA 3TEDA 3GTPJ 2IS4A 1XDSA 5IP7J 2RKHA 3HOYJ 3KP6A 2HKXA 3M1EA 3ISPA 3IH2A 3F8FA 3QYFA 4A6DA 1R9TJ 1K6YA 1T2KA 2VJJA 3ABKH 1MMAA 4XORA 2NVXJ 2W48A 3BLYA 2PG4A 5BNGA 1Z6RA 4XN3A 4EJVA 5C44J 2HQRA 2DMNA 2Y9YA 1FYKA 5KVRA 1W4MA 3FBIB 3K7AJ 3U2RA 1SFXA 4BEHB 3CO6C 3LA2A 4FX0A 3KP3A 5CVJA 2ME6A 3CMYA 4BS9A 3I71A 3SZPA 1VQ9I 3H0DA 2L54A 1TNTA 3FXMA 4CYCB 4BXUA 2P5KA 1MBEA 1KU9A 2F48A 2CV2A 2EFQA 3RTRA 4F92B 4KT6A 2OCCH 4Y7NJ 2GAUA 5CYVA 2NAZA 3HOSA 1IO2A 3ABUA 4A3IJ 3S15J 3DCFA 2ZXIA 4M3FA 3Q0UA 5TGTA 1IN8A 3VPRA 2DK8A 3M07A 3FXOA 2XKOA 2XAGA 4BEHA 3F72A 1V55H 4JOMA 2MBFA 2YPRA 4MEYF 4UVAA 4CCMA 4I99C 4P96A 3HJEA 1S7OA 4UXNA 3FKJA 2LH9A 1XCBA 1OYYA 1W7PD 4EM2A 5ICGA 1HF0A 1S9HA 3REOA 2KZVA 3CC2I 4PZJA 4WXCA 2WTEA 2MABA 4KIGA 1U9OA 2ZMEA 1UB9A 1E3OC 4B1RA 1IV8A 5L3EA 2VC1A 5EG0B 4GDFA 4KIFA 3RPUD 2ACJA 4MQVA 4ZC3A 4I76A 1WJBA 1VQOI 3BPXA 2EA4A 1MJAA 3J7ZI 1UHMA 5ED4A 3C1DA 3NQOA 2QSFX 3DTIA 1KQ8A 3ECHA 4D0PA 4HDVA 2OPTA 1LEBA 2ZXWH 4ITVA 3A0HC 2PX9A 3FDYA 3OYDA 3U1KA 3SZTA 3OYBA 2EQRA 2QA4I 5LRSA 2QENA 1TQIA 1OFCX 1HXDA 3WTUC 3OSGA 5EG0A 1LFPA 4Y15A 2LKSA 2KMUA 3F22A 2JT1A 3I4NJ 3O8GA 1E0EA 3HTSB 1ON1A 4PSWA 5EZHA 4IOCF 3KP5A 4NHJA 2QQ9A 2IW5A 4E70A 3CDHA 1VQ6I 4WXHA 4GO1A 2M4GA 1R00A 3WGHA 5LEJA 2I10A 3KPHA 1EKEA 1RRJA 3FXRA 4UUSB 2TCTA 1U6GA 4NQWB 4G7OF 3D5RC 1JUSA 5IYBJ 3F8NA 3EPZA 1F36A 1U9NA 3Q0VA 1I39A 4A5MA 4M71A 3EYYA 4YFKF 4XQFA 4Q5SF 2HDWA 3T1BA 2IA1A 2FBHA 3V8JA 1U8RA 3F6OA 3R60A 2CFXA 5JVGF
chains in the Genus database with same CATH topology
4IHXA 1XS9A 1WI3A 4A3LJ 2GBYA 1P7JA 2YU9J 5DTDA 1H8AC 2EH3A 2GLOA 2QF7A 2X48A 2VPRA 3S14J 5K7FA 1RETA 4J19A 3BG5A 5J1RA 3GTMJ 1W0TA 5IP6A 1Q1VA 1LFBA 1A6IA 3BTJA 2B63J 2O7OA 1AHDP 9ANTA 3GTLJ 1ZKGA 2M9HA 1AKHB 2HOAA 2WV1A 3ZQIA 2RAEA 1P7IA 4I6ZA 1B8IA 2FX0A 3TW6A 3QQAA 4GFBA 2ECBA 3A02A 5IPAA 1Y1WJ 1LE8B 5FJ8J 5K7HA 1HCRA 2IEKA 1ITYA 1BW5A 2CU7A 2K40A 4A3JJ 1RR7A 2JWTA 5E3LA 2JMWA 3A03A 2JA6J 4MIMA 2HI3A 2NVYJ 1ETQA 2VKVA 3ZQLA 1ZGWA 3HOUJ 3HOXJ 1U78A 5FLMJ 1AKHA 2DMTA 4C3IJ 3W6VA 5F0HA 1QPIA 1BJZA 3LOCA 4RBOA 5FKLA 1RKWA 1TC3C 3ZQHA 2JK3A 2PMZN 3M4OJ 5FKOA 4JX5A 1JKQC 5IYDJ 1TWHJ 5IP9J 1LE8A 3S1RJ 2QCOA 2DMPA 1XC5A 1GT0C 1FJLA 2YS9A 1FEXA 1QVUA 3BR0A 3HOWJ 3Q3SA 1RESA 4M3DA 2JA7J 3JRCA 1IG7A 2R5YB 1X2MA 3B6AA 2DTZA 4XIDA 2AHQA 2HXOA 1T33A 5M5WJ 2H1KA 3LSGA 1OJLA 2XGEA 3DEWA 4IHYA 1MBGA 4C3HJ 2XPWA 4QSHA 1MH3A 2L7MP 2VI6A 1ETWA 3BTCA 1D5YA 2DJNA 1TWFJ 3OOUA 3B6CA 4XRMA 4D5CA 3S2DJ 3BTLA 5EF6A 1IUFA 2G0EA 1VI0A 3IH3A 2LKXA 1Y1VJ 2NS8A 1MBHA 1WH7A 4FTHA 5FLVA 2Y0SN 2GM4A 1NTCA 1MBJA 2ID6A 2DN0A 1TWCJ 3BR1A 3F0CA 3S1MJ 1FTZA 3GBGA 3JREA 1MNMC 3JRBA 3HGYA 3WHBA 3D1NI 3HKZN 5GPAA 1JTXA 2DA4A 1TWGJ 2E1OA 4BY7J 5FKKA 2R0QC 5DS9A 2CQQA 2R92J 1ZR4A 1JKPC 3BQZA 4A3KJ 1I50J 3JRDA 4IHWA 4C3JJ 1WH5A 3RZDJ 3GTQJ 2DA6A 1HDPA 2E19A 2D5VA 1UMQA 1H88C 4AUXA 4DYRA 4A3BJ 4M3BA 2K9QA 1SANA 1JUPA 3BR2A 1FIAA 4RDUA 2XGCA 2LP0A 1B8IB 3S16J 4Y52J 1ETVA 2JA5J 1IJWC 1RKTA 3JRFA 4XK4A 4IEJA 5F0FA 5JLWA 2YUSA 4XRSG 3FK7A 2H8RA 2NOGA 2LY9A 3GTOJ 3L1PA 2XB5A 1FIPA 5FKNA 2XB0X 2XPVA 2L9RA 3BQYA 1UG2A 1BL0A 2M2EA 4M3GA 4BBSJ 3BTIA 2R93J 2VKEA 2ME0A 1ETXA 2LVSA 3MN2A 1FTTA 2LD5A 2MG4A 2ID3A 1MBKA 1DU6A 4A3EJ 2HYJA 1HDDC 2FD5A 5EEAA 1TWAJ 1QRYA 1WCMJ 4W97A 3LSPA 1YRNB 2L7ZA 1VNDA 3OSFA 1H89C 3BR5A 3ZQGA 2O9LA 5C4XJ 3HB9A 2LTPA 3ZQFA 3MKLA 2XSDC 1GDTA 1X2NA 2NVTJ 2R7ZJ 3H0GJ 4EEFG 3O8HA 3G1MA 4MLOA 2Y2ZA 1WGXA 5M5XJ 5J1UA 2LR8A 3CQZJ 3HEFA 2Y31A 2DA2A 1IC8A 2L0KA 2E2JJ 3NAUA 2DA7A 2HQ5A 2IAIA 2P81A 3LNQA 1YRNA 4DZPA 4C2MJ 2CQXA 1O4XA 2X6OA 4MFEA 1RPWA 2DMUA 4FCYA 2KDZA 5M3FJ 4B3AA 4XICA 3HGGA 2ELKA 2EZKA 4S0HB 5F08A 2MSYA 2M34A 4A3DJ 2LFBA 2R5ZB 1XG1A 1S7EA 3CCYA 4CYCA 4D7NA 1QVTA 3S1QJ 3GTKJ 3ZQCA 3S2HJ 2XRLA 5E3OA 2DA3A 1K61A 1JJ8C 3FKIJ 1U8BA 5IYCJ 2CUFA 4L5EA 3RQIA 1OCTC 3HBLA 4NDLA 2EZLA 1LFUP 1BA5A 2OF7A 2MW8A 1JUMA 2COBA 3OIOA 5EGOB 5IOZA 4AC0A 3HDDA 3PO2J 1K83J 2R5ZA 2DMQA 4A93J 1EF4A 1PUFA 5EYRA 5GP9A 1APLC 2HDDA 2KT0A 3BR6A 1VFCA 1IRZA 1OCPA 4UUTA 5J1YA 4D5FA 1UHSA 1MSFC 1I6HJ 3BT9A 5F27A 4BBRJ 1WPKA 3FISA 2MGQA 2CRGA 4MFDA 2CJJA 1GV2A 2FQ4A 5IOYA 1T56A 1GUUA 5EGOA 4G12A 4V2FA 1GV5A 1Z77A 3FIWA 1F43A 3MVPA 3Q0WA 2XPUA 4D7MA 1JT6A 1ETKA 3TP3A 4M3EA 1VF9A 2HXIA 3HOZJ 4IHVA 3JRAA 3HOVJ 1X58A 4JX6A 1Z0XA 1IDYA 3BR3A 4FISA 1IV6A 1ZR2A 4HNVA 4V2GA 5EZGA 4ABZA 1JJ6C 4A3GJ 5K7ZA 3GTPJ 3TEDA 3I4MJ 5F04A 3HM5A 4MO7A 1POGA 5IP7J 2EZHA 4XRSA 3A01A 3HOYJ 4B4CA 4UUSA 3IH2A 2ECCA 2Y9ZA 2E2HJ 2XGDA 4DZJA 4QTRA 1R9TJ 2VUMJ 4A3MJ 2E2IJ 3G1LA 1JKRC 3JRHA 2L7FP 2NVXJ 3JRIA 2W48A 3K2AA 1HLVA 2N8GA 5BNGA 2NVQJ 5C44J 2HOSA 2DMNA 2Y9YA 3TP0A 4BXXJ 1CQTA 4X6AJ 3K7AJ 3UKGA 4LOCA 5F1JA 2Y30A 5M3MJ 2JA8J 2ME6A 3CMYA 2M0CA 4W1UA 5F0CA 4A3CJ 2AO9A 2IBDA 2K9NA 4CYCB 3WHCA 3CDLA 2M8GX 5JLXA 1MBEA 1ETOA 3RKQA 1MBFA 3ZOBA 4Y7NJ 4A3IJ 3PM1A 3S15J 3DCFA 4DYCA 4M3FA 3E7LA 3Q0UA 3VPRA 5E3MA 1ZK8A 1BW6A 1SFOJ 1B72B 4JP0A 3JR9A 1MH4A 3S1NJ 3S17J 1JKOC 1PUFB 4X1EA 1HF0A 1G2HA 5C3EJ 4A3FJ 3H3VK 1ENHA 2NS7A 3SDGA 1U9OA 5GPCA 1AU7A 1E3OC 4B1RA 4AYBN 3QPSA 4DW6A 5EG0B 3C2BA 4I76A 2HOTA 1IDZA 2LLKA 1B72A 1ZQ3P 1ORKA 1DU0A 3GTGJ 1ZTRA 3PO3J 1W0UA 5J3LA 2CUEA 1IGNA 3LSJA 1I3QJ 2OPTA 5HODA 3BG3A 2WAQN 5EDNA 4JYKA 5E3NA 1JT0A 2EQRA 2K9SA 3SFIA 4QIWN 3JRGA 4BY1J 1OFCX 1JTYA 2X9DA 3OSGA 5EG0A 2R5YA 2DA5A 3M3YJ 3TW7A 3RZOJ 3FK6A 3QPLA 5C4JJ 2ZB9A 4FE7A 3I4NJ 5FKMA 3O8GA 3G1OA 4BKXA 5M5YJ 2O8KA 1NK3P 2EBIA 2TRTA 5EZHA 1ETYA 2JN6A 3SJMA 1NK2P 1GVDA 4JX4A 3IV5A 4M6VA 2WB1N 3A01B 2I10A 2DA1A 1HOMA 2LK2A 4UUSB 1A5JA 2FJ1A 2EZIA 2TCTA 1JUSA 4FE4A 5IYBJ 3NARA 3GTJJ 3IH4A 1F36A 1U9NA 3BG9A 3Q0VA 2JJ7A 4A69C 1MSEC 1JGGA 3LSRA 4DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHX A;  1XS9 A;  1WI3 A;  4A3L J;  2GBY A;  1P7J A;  2YU9 J;  5DTD A;  1H8A C;  2EH3 A;  2GLO A;  2QF7 A;  2X48 A;  2VPR A;  3S14 J;  5K7F A;  1RET A;  4J19 A;  3BG5 A;  5J1R A;  3GTM J;  1W0T A;  5IP6 A;  1Q1V A;  1LFB A;  1A6I A;  3BTJ A;  2B63 J;  2O7O A;  1AHD P;  9ANT A;  3GTL J;  1ZKG A;  2M9H A;  1AKH B;  2HOA A;  2WV1 A;  3ZQI A;  2RAE A;  1P7I A;  4I6Z A;  1B8I A;  2FX0 A;  3TW6 A;  3QQA A;  4GFB A;  2ECB A;  3A02 A;  5IPA A;  1Y1W J;  1LE8 B;  5FJ8 J;  5K7H A;  1HCR A;  2IEK A;  1ITY A;  1BW5 A;  2CU7 A;  2K40 A;  4A3J J;  1RR7 A;  2JWT A;  5E3L A;  2JMW A;  3A03 A;  2JA6 J;  4MIM A;  2HI3 A;  2NVY J;  1ETQ A;  2VKV A;  3ZQL A;  1ZGW A;  3HOU J;  3HOX J;  1U78 A;  5FLM J;  1AKH A;  2DMT A;  4C3I J;  3W6V A;  5F0H A;  1QPI A;  1BJZ A;  3LOC A;  4RBO A;  5FKL A;  1RKW A;  1TC3 C;  3ZQH A;  2JK3 A;  2PMZ N;  3M4O J;  5FKO A;  4JX5 A;  1JKQ C;  5IYD J;  1TWH J;  5IP9 J;  1LE8 A;  3S1R J;  2QCO A;  2DMP A;  1XC5 A;  1GT0 C;  1FJL A;  2YS9 A;  1FEX A;  1QVU A;  3BR0 A;  3HOW J;  3Q3S A;  1RES A;  4M3D A;  2JA7 J;  3JRC A;  1IG7 A;  2R5Y B;  1X2M A;  3B6A A;  2DTZ A;  4XID A;  2AHQ A;  2HXO A;  1T33 A;  5M5W J;  2H1K A;  3LSG A;  1OJL A;  2XGE A;  3DEW A;  4IHY A;  1MBG A;  4C3H J;  2XPW A;  4QSH A;  1MH3 A;  2L7M P;  2VI6 A;  1ETW A;  3BTC A;  1D5Y A;  2DJN A;  1TWF J;  3OOU A;  3B6C A;  4XRM A;  4D5C A;  3S2D J;  3BTL A;  5EF6 A;  1IUF A;  2G0E A;  1VI0 A;  3IH3 A;  2LKX A;  1Y1V J;  2NS8 A;  1MBH A;  1WH7 A;  4FTH A;  5FLV A;  2Y0S N;  2GM4 A;  1NTC A;  1MBJ A;  2ID6 A;  2DN0 A;  1TWC J;  3BR1 A;  3F0C A;  3S1M J;  1FTZ A;  3GBG A;  3JRE A;  1MNM C;  3JRB A;  3HGY A;  3WHB A;  3D1N I;  3HKZ N;  5GPA A;  1JTX A;  2DA4 A;  1TWG J;  2E1O A;  4BY7 J;  5FKK A;  2R0Q C;  5DS9 A;  2CQQ A;  2R92 J;  1ZR4 A;  1JKP C;  3BQZ A;  4A3K J;  1I50 J;  3JRD A;  4IHW A;  4C3J J;  1WH5 A;  3RZD J;  3GTQ J;  2DA6 A;  1HDP A;  2E19 A;  2D5V A;  1UMQ A;  1H88 C;  4AUX A;  4DYR A;  4A3B J;  4M3B A;  2K9Q A;  1SAN A;  1JUP A;  3BR2 A;  1FIA A;  4RDU A;  2XGC A;  2LP0 A;  1B8I B;  3S16 J;  4Y52 J;  1ETV A;  2JA5 J;  1IJW C;  1RKT A;  3JRF A;  4XK4 A;  4IEJ A;  5F0F A;  5JLW A;  2YUS A;  4XRS G;  3FK7 A;  2H8R A;  2NOG A;  2LY9 A;  3GTO J;  3L1P A;  2XB5 A;  1FIP A;  5FKN A;  2XB0 X;  2XPV A;  2L9R A;  3BQY A;  1UG2 A;  1BL0 A;  2M2E A;  4M3G A;  4BBS J;  3BTI A;  2R93 J;  2VKE A;  2ME0 A;  1ETX A;  2LVS A;  3MN2 A;  1FTT A;  2LD5 A;  2MG4 A;  2ID3 A;  1MBK A;  1DU6 A;  4A3E J;  2HYJ A;  1HDD C;  2FD5 A;  5EEA A;  1TWA J;  1QRY A;  1WCM J;  4W97 A;  3LSP A;  1YRN B;  2L7Z A;  1VND A;  3OSF A;  1H89 C;  3BR5 A;  3ZQG A;  2O9L A;  5C4X J;  3HB9 A;  2LTP A;  3ZQF A;  3MKL A;  2XSD C;  1GDT A;  1X2N A;  2NVT J;  2R7Z J;  3H0G J;  4EEF G;  3O8H A;  3G1M A;  4MLO A;  2Y2Z A;  1WGX A;  5M5X J;  5J1U A;  2LR8 A;  3CQZ J;  3HEF A;  2Y31 A;  2DA2 A;  1IC8 A;  2L0K A;  2E2J J;  3NAU A;  2DA7 A;  2HQ5 A;  2IAI A;  2P81 A;  3LNQ A;  1YRN A;  4DZP A;  4C2M J;  2CQX A;  1O4X A;  2X6O A;  4MFE A;  1RPW A;  2DMU A;  4FCY A;  2KDZ A;  5M3F J;  4B3A A;  4XIC A;  3HGG A;  2ELK A;  2EZK A;  4S0H B;  5F08 A;  2MSY A;  2M34 A;  4A3D J;  2LFB A;  2R5Z B;  1XG1 A;  1S7E A;  3CCY A;  4CYC A;  4D7N A;  1QVT A;  3S1Q J;  3GTK J;  3ZQC A;  3S2H J;  2XRL A;  5E3O A;  2DA3 A;  1K61 A;  1JJ8 C;  3FKI J;  1U8B A;  5IYC J;  2CUF A;  4L5E A;  3RQI A;  1OCT C;  3HBL A;  4NDL A;  2EZL A;  1LFU P;  1BA5 A;  2OF7 A;  2MW8 A;  1JUM A;  2COB A;  3OIO A;  5EGO B;  5IOZ A;  4AC0 A;  3HDD A;  3PO2 J;  1K83 J;  2R5Z A;  2DMQ A;  4A93 J;  1EF4 A;  1PUF A;  5EYR A;  5GP9 A;  1APL C;  2HDD A;  2KT0 A;  3BR6 A;  1VFC A;  1IRZ A;  1OCP A;  4UUT A;  5J1Y A;  4D5F A;  1UHS A;  1MSF C;  1I6H J;  3BT9 A;  5F27 A;  4BBR J;  1WPK A;  3FIS A;  2MGQ A;  2CRG A;  4MFD A;  2CJJ A;  1GV2 A;  2FQ4 A;  5IOY A;  1T56 A;  1GUU A;  5EGO A;  4G12 A;  4V2F A;  1GV5 A;  1Z77 A;  3FIW A;  1F43 A;  3MVP A;  3Q0W A;  2XPU A;  4D7M A;  1JT6 A;  1ETK A;  3TP3 A;  4M3E A;  1VF9 A;  2HXI A;  3HOZ J;  4IHV A;  3JRA A;  3HOV J;  1X58 A;  4JX6 A;  1Z0X A;  1IDY A;  3BR3 A;  4FIS A;  1IV6 A;  1ZR2 A;  4HNV A;  4V2G A;  5EZG A;  4ABZ A;  1JJ6 C;  4A3G J;  5K7Z A;  3GTP J;  3TED A;  3I4M J;  5F04 A;  3HM5 A;  4MO7 A;  1POG A;  5IP7 J;  2EZH A;  4XRS A;  3A01 A;  3HOY J;  4B4C A;  4UUS A;  3IH2 A;  2ECC A;  2Y9Z A;  2E2H J;  2XGD A;  4DZJ A;  4QTR A;  1R9T J;  2VUM J;  4A3M J;  2E2I J;  3G1L A;  1JKR C;  3JRH A;  2L7F P;  2NVX J;  3JRI A;  2W48 A;  3K2A A;  1HLV A;  2N8G A;  5BNG A;  2NVQ J;  5C44 J;  2HOS A;  2DMN A;  2Y9Y A;  3TP0 A;  4BXX J;  1CQT A;  4X6A J;  3K7A J;  3UKG A;  4LOC A;  5F1J A;  2Y30 A;  5M3M J;  2JA8 J;  2ME6 A;  3CMY A;  2M0C A;  4W1U A;  5F0C A;  4A3C J;  2AO9 A;  2IBD A;  2K9N A;  4CYC B;  3WHC A;  3CDL A;  2M8G X;  5JLX A;  1MBE A;  1ETO A;  3RKQ A;  1MBF A;  3ZOB A;  4Y7N J;  4A3I J;  3PM1 A;  3S15 J;  3DCF A;  4DYC A;  4M3F A;  3E7L A;  3Q0U A;  3VPR A;  5E3M A;  1ZK8 A;  1BW6 A;  1SFO J;  1B72 B;  4JP0 A;  3JR9 A;  1MH4 A;  3S1N J;  3S17 J;  1JKO C;  1PUF B;  4X1E A;  1HF0 A;  1G2H A;  5C3E J;  4A3F J;  3H3V K;  1ENH A;  2NS7 A;  3SDG A;  1U9O A;  5GPC A;  1AU7 A;  1E3O C;  4B1R A;  4AYB N;  3QPS A;  4DW6 A;  5EG0 B;  3C2B A;  4I76 A;  2HOT A;  1IDZ A;  2LLK A;  1B72 A;  1ZQ3 P;  1ORK A;  1DU0 A;  3GTG J;  1ZTR A;  3PO3 J;  1W0U A;  5J3L A;  2CUE A;  1IGN A;  3LSJ A;  1I3Q J;  2OPT A;  5HOD A;  3BG3 A;  2WAQ N;  5EDN A;  4JYK A;  5E3N A;  1JT0 A;  2EQR A;  2K9S A;  3SFI A;  4QIW N;  3JRG A;  4BY1 J;  1OFC X;  1JTY A;  2X9D A;  3OSG A;  5EG0 A;  2R5Y A;  2DA5 A;  3M3Y J;  3TW7 A;  3RZO J;  3FK6 A;  3QPL A;  5C4J J;  2ZB9 A;  4FE7 A;  3I4N J;  5FKM A;  3O8G A;  3G1O A;  4BKX A;  5M5Y J;  2O8K A;  1NK3 P;  2EBI A;  2TRT A;  5EZH A;  1ETY A;  2JN6 A;  3SJM A;  1NK2 P;  1GVD A;  4JX4 A;  3IV5 A;  4M6V A;  2WB1 N;  3A01 B;  2I10 A;  2DA1 A;  1HOM A;  2LK2 A;  4UUS B;  1A5J A;  2FJ1 A;  2EZI A;  2TCT A;  1JUS A;  4FE4 A;  5IYB J;  3NAR A;  3GTJ J;  3IH4 A;  1F36 A;  1U9N A;  3BG9 A;  3Q0V A;  2JJ7 A;  4A69 C;  1MSE C;  1JGG A;  3LSR A;  4DYQ A; 
#chains in the Genus database with same CATH topology
 2CSO A;  2D1H A;  4S04 A;  1WI3 A;  4A3L J;  2YU9 J;  1H8A C;  3GZ6 A;  2QZ8 A;  4ZZD A;  2CFO A;  1M1E B;  2QF7 A;  2DDB A;  2GLO A;  4HX8 A;  4NQW A;  5K7F A;  3BP8 A;  1KYW A;  2BY0 A;  5CVI A;  1WVR A;  4G7Z F;  2VN2 A;  1X3W B;  4C9Y A;  3E5U A;  4IRH A;  1YW8 A;  4GYI A;  1P4X A;  2HWV A;  3BTJ A;  3GX4 X;  3ZQ7 A;  2YX4 A;  3DU5 A;  5K1Y A;  2O7O A;  3TL4 X;  1MJB A;  3GTL J;  1CGP A;  3H35 A;  4RGU A;  5H6Q A;  4UB8 C;  2WV1 A;  1R71 A;  1Q1H A;  3VEP A;  3GXO A;  5FD6 A;  3GFL A;  4O6J A;  5E1Z B;  2WAF A;  1MNE A;  3TW6 A;  2YX7 A;  4OOI A;  3A02 A;  3S2W A;  3WTY C;  5K7H A;  5TIS C;  4AYB A;  2IEK A;  3E5X A;  3WOD F;  1RR7 A;  3H3Z A;  3DF8 A;  2DYS H;  2FMY A;  4MIM A;  2NVY J;  1ZGW A;  1YJN I;  4XLA A;  3DBH B;  4BJ5 C;  5L3C A;  5FLM J;  1EH8 A;  3FWE A;  1MZB A;  4NC7 A;  4FQG A;  5CVR A;  1RKW A;  1SVO A;  2JK3 A;  1SC7 A;  2OV7 A;  2PMZ N;  2LF7 A;  5FKO A;  1R6R A;  2VXD A;  3KZZ A;  2EV5 A;  1JKQ C;  4CYD A;  5F64 A;  3S1R J;  2QBY B;  1BI2 A;  1OQY A;  4IRI A;  1LB2 A;  2H6B A;  4KT5 C;  2XAQ A;  3J80 Z;  3HOW J;  4F3Q A;  3KFW X;  3Q3S A;  4OIN F;  1O3Q A;  1J2X A;  1RES A;  1B9N A;  3JRC A;  1WQ2 A;  1X2M A;  5BMZ A;  5CLS A;  3U21 A;  2AHQ A;  1Z7L A;  2EFW A;  1OKR A;  1RNL A;  3PNY A;  4JQF A;  2PJR B;  4F91 B;  5KK1 A;  4I7H A;  1F1Z A;  4IKF A;  4IHT A;  1XGS A;  5JVT A;  2VC0 A;  2G9W A;  3MD2 A;  4ENJ A;  2ZFU A;  2VI6 A;  3DWL E;  2QBY A;  2OC6 A;  5ERI A;  2FRH A;  1D8J A;  3GZN B;  1H0M A;  3BTL A;  5EF6 A;  3IP4 B;  3DP7 A;  1QA6 A;  3CUQ C;  4OIQ F;  2QGU A;  3HHG A;  3CC4 I;  2NS8 A;  5EEG A;  4BQA A;  2VBY A;  1YE9 A;  2GM4 A;  1MBJ A;  2DN0 A;  5GAD J;  4NC6 A;  3JRE A;  3JRB A;  2BYV E;  2DT6 A;  3HGY A;  2CS3 A;  2XAU A;  2DAO A;  2NOJ B;  3TQN A;  2NYX A;  4BE2 A;  1KON A;  2AQF A;  2M4K A;  1OCR H;  2CQQ A;  5DS9 A;  1R7J A;  2R92 J;  1KQ0 A;  1JKP C;  1FSE A;  3JAM K;  3CLQ A;  3PL8 A;  2WC2 A;  4FAS D;  4XM3 A;  2ZNZ A;  2MD5 A;  4IHW A;  2PI0 A;  3E3V A;  1UFM A;  3IAS 2;  2E19 A;  4E7Z A;  5AIP A;  4AUX A;  2JZY A;  1WKM A;  2VT2 A;  4Y4R A;  1SD6 A;  1SAN A;  2OBP A;  4PFP A;  2F2E A;  1X4O A;  1BR4 A;  3S16 J;  4Y52 J;  3HRT A;  2V1U A;  1GXQ A;  4R79 A;  5D8L B;  3GFM A;  1P4W A;  2EPF A;  2D2W A;  4XRS G;  5HS8 A;  3FK7 A;  1FP2 A;  3MWM A;  4K2E A;  5CQE A;  1ACI A;  3GTO J;  5D5V B;  1VQ4 I;  3SQN A;  5J6X A;  3DKW A;  4L5I A;  5FKN A;  5K5Q A;  2XPV A;  4LGW A;  1YW9 A;  3DU6 A;  1IUY A;  3BQY A;  3LQQ A;  1UG2 A;  2E34 A;  1G3W A;  3DEU A;  3BTI A;  2MD0 A;  3I59 B;  2IS1 A;  3HXL A;  5HS7 A;  3OYA A;  2AXT C;  1RZ4 A;  1ULY A;  3B02 A;  3CCV I;  3KIO A;  1LQ1 A;  3PUF A;  4BJT A;  2OCE A;  3K69 A;  4W97 A;  3IRR A;  3DPL C;  3CF2 A;  3BJ6 A;  1YRN B;  3VSL A;  3OSF A;  1MD0 A;  5D5X B;  2DTR A;  2B9S A;  5D4S A;  3CCS I;  4UV9 A;  2ISY A;  3G3Z A;  2R7U A;  1W5C C;  4KN7 X;  2F5F A;  1OR7 C;  3H0G J;  3KYC B;  4RAF A;  1VQN I;  3FBN B;  4XON A;  5M5X J;  1J0R A;  3K4B A;  2R4G A;  1HA8 A;  3AL0 B;  4B44 A;  2DFF A;  2L0K A;  2VBX A;  2X6X A;  4HDU A;  1YRN A;  1ZG5 A;  4DZP A;  3I3L A;  1O4X A;  2X6O A;  4FCY A;  4I0A A;  3SXY A;  3FXQ A;  2DJI A;  3HGG A;  2Y69 H;  2ELK A;  4HV5 A;  2GA1 A;  4IPA A;  4M72 A;  3D5L A;  5F08 A;  3ZMZ A;  2M34 A;  2ZJR F;  1LDD A;  4XKW A;  2R5Z B;  3WU2 C;  4HNT A;  3F21 A;  3I9V 2;  1R58 A;  3KYD B;  5J4Y A;  3L2C A;  5LGU A;  2LOO A;  4AD9 A;  4A0X A;  3ZN1 A;  1U8B A;  2CUF A;  1TNS A;  2BVL A;  4XMY A;  1OCT C;  1W5S A;  4ANJ A;  3ELK A;  4YIF A;  2JRM A;  1WJE A;  1JUM A;  3OIO A;  3ASN H;  1PYV A;  3J7A Y;  3PO2 J;  1U5T A;  3CJN A;  2IGK A;  1VQL I;  2BW3 B;  2R5Z A;  2DMQ A;  4YEL A;  1D8K A;  2OZU A;  1PUF A;  1EF4 A;  3M7G A;  1R4M B;  2KT0 A;  3JW4 A;  4BDZ A;  2KP6 A;  4RGS A;  3WTZ A;  3L2Q A;  1UHS A;  2Z1D A;  4L9T A;  3AAF A;  1MMG A;  1K7A A;  1ZGA A;  2P5L C;  2OQR A;  2MGQ A;  1GV2 A;  1AOY A;  3PFY A;  2PQ8 A;  3HIF A;  3ZN0 A;  1P4A A;  1H9T A;  2K5C A;  5B1A H;  4RM3 A;  2MC4 A;  2BW3 A;  1W36 D;  4LLN A;  1DGW Y;  3VDX A;  1F43 A;  3MVP A;  3Q0W A;  2XPU A;  5GAG J;  1J75 A;  3VFZ A;  3PQJ A;  3TP3 A;  2PJP A;  3C7J A;  4I02 A;  3CCM I;  2V9K A;  2EIK H;  4PGG A;  4BHB A;  3FMQ A;  5DCF A;  1XMK A;  3HG9 A;  4JX6 A;  2WY8 Q;  2GIV A;  3P9C A;  4GCV A;  1G3Y A;  2GA2 A;  3TMO A;  4XLE A;  4IOA F;  1YQA A;  2HOE A;  3J7Y J;  3AFH A;  4LIU A;  2VQH A;  5J40 A;  2IS2 A;  1GVJ A;  3OWT A;  2PLY A;  5HVQ C;  3I4M J;  5F04 A;  3OMY A;  4Y17 A;  2QSG X;  4XRS A;  5HLH A;  1SEU A;  5FRO A;  4B4C A;  2VB6 A;  2TDX A;  2JSP A;  2L9S A;  2X51 A;  3H9G A;  4DZJ A;  4DNC A;  4QTR A;  3E6C C;  3SYT A;  3G1L A;  2VQG A;  3BY6 A;  2L7F P;  3JRI A;  1HLV A;  2N8G A;  3KP4 A;  3VYR B;  2A6H F;  2GZW A;  3IAM 2;  4U0Y A;  2M45 A;  4BXX J;  1CQT A;  1FOY A;  4LOC A;  2DW4 A;  4RS8 A;  4ENN A;  2JA8 J;  4CGZ A;  5ICE A;  3VOD A;  1V5E A;  2Y75 A;  2M0C A;  4W1U A;  2E5Z A;  2VAS A;  3QU3 A;  2E5N A;  2AO9 A;  2K9N A;  2M8G X;  4XKB A;  4LIT A;  2C6Y A;  1ETO A;  3RKQ A;  1Z91 A;  2HTS A;  2VPL A;  2R7D A;  1ON2 A;  3P7N A;  3ZOB A;  1T38 A;  3N97 A;  4C2T A;  3PM1 A;  1IAW A;  4AIH A;  4B48 A;  3TO9 A;  3W3C A;  1YS6 A;  2RQQ A;  4ZZL A;  2E7X A;  2HZT A;  3AKZ A;  1JHH A;  1Z6T A;  4I0B A;  3JR9 A;  1ZN2 A;  3S17 J;  2V9V A;  3ABT A;  1TL8 A;  2A07 F;  3C18 A;  3V4G A;  2RRE A;  4PJN A;  4BAY A;  5JHF A;  1KU3 A;  1LUJ B;  5GPC A;  2F5C A;  2HVQ A;  4EVI A;  2KIS A;  2VBZ A;  3QPS A;  4DW6 A;  3C2B A;  1QO0 D;  1SVL A;  3IC7 A;  3LSM A;  3G4S I;  2P6S A;  2H27 A;  5ILS A;  1ZQ3 P;  4Q4Z F;  3I53 A;  1ORK A;  1DU0 A;  2O6G E;  1ZTR A;  2Z99 A;  2DPD A;  3M8E A;  3TGN A;  1W0U A;  1XB4 A;  2MLG A;  4NUB A;  2A05 A;  1IGN A;  1I3Q J;  1K79 A;  2VLA A;  4EJT A;  2HU9 A;  2ZSI B;  3BG3 A;  2G7U A;  3MEX A;  2WY7 Q;  3GLL A;  1YIJ I;  5EDN A;  1RIO H;  2K4J A;  4RA2 A;  1XMX A;  3DLL F;  3EQL F;  1NG7 A;  3SFI A;  4QIW N;  2FNA A;  4BY1 J;  1JTY A;  4UVB A;  3H5N A;  4L9J A;  2DA5 A;  2KFD A;  3QPL A;  1QZE A;  3KLN A;  2W4S A;  1FT9 A;  3ABL H;  4A2U A;  4B3X A;  1A31 A;  2LRD A;  1E3P A;  4L0Z B;  5JR3 A;  3O6B B;  2I5U A;  2ELH A;  2P0W A;  2JN6 A;  5DCM B;  4E7H A;  3RQ4 A;  3IV5 A;  4U0W A;  2FE3 A;  3CCU I;  1OCO H;  2OD5 A;  4CCO A;  4FE4 A;  1YIT I;  4J01 A;  2PMU A;  3BG9 A;  4A69 C;  1MSE C;  3SFZ A;  3WE2 A;  1L3L A;  4KFC A;  3B73 A;  3PIP F;  4HV6 A;  1X4P A;  3HZJ A;  2O8X A;  5HS9 A;  2H94 A;  4DYQ A;  3BCB A;  2VOD A;  1XGN A;  5DCM A;  3FMR A;  4BUP A;  2RN7 A;  4EGY A;  5LHI A;  4H0E A;  5CVV A;  1N77 A;  2KRF A;  4UV8 A;  5DTD A;  2LMD A;  5E8G A;  2FBK A;  4LK1 F;  1UEL B;  2X48 A;  3S14 J;  3QWL A;  1L0O C;  3BG5 A;  5J1R A;  5A2Q K;  2GOM A;  2XSJ C;  3GFJ A;  1O7L A;  1W36 C;  1LFB A;  1A6I A;  2HDC A;  4IX7 A;  1W5T A;  3IKV A;  5E79 C;  2IS6 A;  3K1N A;  2BEO A;  3OYK A;  1ZKG A;  2M9H A;  3MQ0 A;  2NXN B;  3WTV C;  3COA C;  1AKH B;  4U0V A;  2CQK A;  5TJJ A;  2J5O A;  5ILV A;  4LB5 A;  3K2Z A;  2GXG A;  1JXS A;  3LSK A;  5J47 A;  4I6Z A;  5E8I A;  1B8I A;  4LMY A;  3QQA A;  1IZ1 A;  2MH2 A;  2V6E A;  4UNO A;  2STT A;  4L0Y B;  4U87 A;  1F5T A;  5HDN A;  5FJ8 J;  4RLF A;  5BQT A;  4KIB A;  1P92 A;  3E6M A;  1ZRF A;  4CXF A;  2JA6 J;  1B6A A;  2XGX A;  1QQI A;  2FXA A;  2ZME B;  5LGN A;  1AKH A;  2DMT A;  4C3I J;  3W6V A;  2R7W A;  4HSR A;  3G2B A;  1BJZ A;  3LOC A;  1DGR M;  3T0Y A;  5FKL A;  1D0X A;  1TC3 C;  3ZQH A;  3GF2 A;  1T0F C;  2WAQ A;  2LKP A;  4KDP A;  1KA8 A;  4FET A;  2IPQ X;  5IYD J;  2MC3 A;  2H09 A;  2HQA A;  2DMP A;  2V1X A;  1K78 B;  1RR8 C;  2YS9 A;  2A68 F;  2FU4 A;  4O5V A;  4XOP A;  4A5N A;  1ZG3 A;  3F23 A;  2R7O A;  3K6G A;  3OOP A;  2JA7 J;  4H4K C;  1S7A A;  3CJT B;  3K10 A;  3PNV A;  3W6K B;  2L9N A;  5E1W A;  1GHC A;  3B6A A;  4FT8 A;  4EV0 A;  3QYB A;  1XCV A;  2LC2 A;  3RYP A;  2HXO A;  4ZTF A;  4HLX A;  4ZH4 F;  1T33 A;  3CJQ B;  1PJR A;  2VJ4 A;  4PJ0 C;  1OJL A;  4KNY A;  2MYS A;  2XGE A;  4IHY A;  2GXB A;  4DIQ A;  2P7V B;  3I58 A;  1QZZ A;  1ETW A;  2GQQ A;  3BTC A;  3L09 A;  5D6F A;  1JHF A;  1K78 A;  2DJN A;  1TWF J;  3QP5 A;  1S6L A;  3OOU A;  3B6C A;  4BDY A;  4D5C A;  5B3S H;  2VOO A;  3H9Q A;  4PK4 A;  1BI0 A;  1MBH A;  3H1C A;  1GXP A;  2DPU A;  5FLV A;  4G8X A;  1UJ8 A;  1NTC A;  1VZ0 A;  2ID6 A;  1D0Y A;  3BR1 A;  3GO5 A;  3F0C A;  4YFX F;  2F4I A;  3S1M J;  1FTZ A;  2DLL A;  3TOA A;  1JE8 A;  3FM3 A;  3HKZ N;  1WJD A;  2XDV A;  4ETS A;  4IVN A;  1FWZ A;  1JTX A;  3K4C A;  1FOW A;  1WI9 A;  3CCL I;  1R1U A;  5FKK A;  2BBY A;  2LG4 A;  2LRE A;  4HLY A;  3RPQ A;  1R5H A;  3NWS A;  1YO5 C;  4XSZ F;  4A3K J;  1I50 J;  1X1C A;  1X1P A;  3KEY A;  1X1D A;  3JRD A;  3K4K A;  2UXN A;  1BIB A;  1BN5 A;  3RZD J;  1YX3 A;  3HUG A;  1DUX C;  1HDP A;  4V19 K;  5F1R A;  4DYR A;  4M9Z A;  4A3B J;  2VOP A;  2BY2 A;  2WV0 A;  2XAJ A;  1R23 A;  3C2H A;  3NWT A;  1WJC A;  2IP2 A;  1ODD A;  2NRA C;  3FHZ A;  1RKT A;  2F6C A;  2DOA A;  4IQ4 A;  1I5Z A;  1B59 A;  4IEJ A;  4WF2 A;  3QPH A;  5JLW A;  1AWC A;  2F5V A;  2L2O A;  3OR2 C;  4ENK A;  3KP2 A;  4M6X A;  5H2F C;  1R22 A;  2RVC A;  4PGH A;  1WWX A;  3V7C A;  3BDD A;  1BL0 A;  2M2E A;  2E36 A;  3ESW B;  4II3 A;  3W2W A;  4UB6 C;  2XAS A;  5FD5 A;  4Z2Y A;  3I4P A;  1DQU A;  2LD5 A;  2B0L A;  1XDU A;  4A3E J;  3BCA A;  4E7S A;  2HYJ A;  3VSK A;  3ZCO A;  1HDD C;  3CUO A;  1ZRE A;  2RGV A;  1O57 A;  5FGM A;  2D1V A;  4HBL A;  1VND A;  2O9L A;  1IF1 A;  4YFN F;  4R8H A;  2QYO A;  2M87 A;  3HYI A;  3ZQF A;  3MKL A;  3HSE A;  2NVT J;  5BS6 A;  2R7Z J;  3DTK A;  5HDG A;  3O8H A;  2DFI A;  3MKY B;  1YIO A;  3WU0 A;  2BY3 A;  4L9V A;  2CG4 A;  2EB7 A;  2Z2S B;  1WGX A;  2V79 A;  5LD2 C;  1XSV A;  2HQN A;  2GIZ A;  2VBW A;  2Y31 A;  2DA2 A;  1IC8 A;  1BBY A;  2Q0O A;  3NAU A;  4N9I A;  4EJU A;  2HZD A;  2K4B A;  2L01 A;  3ROU A;  4G94 A;  1Z67 A;  4BE1 A;  2CQX A;  1YJW I;  4CCN A;  5D5U B;  4G6Q A;  4MTE A;  1D1A A;  3QYE A;  2KDZ A;  1IRF A;  2B7E A;  1TQM A;  3TDZ C;  2O61 A;  5L3D A;  2BY1 A;  3ZGK A;  2JUC A;  3MKW B;  2L9V A;  4KIS A;  1Y0N A;  3UR3 C;  2WB1 A;  4I01 A;  1LKX A;  4A3D J;  2LFB A;  4PJM A;  5KAF C;  2NVU B;  3HL2 A;  1XG1 A;  4ESF A;  1MIJ A;  2FBI A;  5DM6 F;  1SAX A;  4D7N A;  1F9N A;  4F55 A;  1WJA A;  3OL4 A;  3S2H J;  5E3O A;  3PFI A;  1SD5 A;  1JJ8 C;  5B66 C;  3DFG A;  2M5W A;  2FSW A;  2ZJQ F;  1XSX A;  4BHP A;  1V5F A;  1KZH A;  4L5E A;  5CPR B;  2HYG D;  4NDL A;  2VE9 A;  1BA5 A;  1YYV A;  1CF7 A;  2COB A;  5EGO B;  4AC0 A;  3HDD A;  3HRM A;  1S3J A;  4ZYE A;  4HX4 A;  2KPM A;  4KIT B;  2K86 A;  5EYR A;  1APL C;  2HDD A;  3U1D A;  3BR6 A;  3IUO A;  3KE2 A;  3WGI A;  3RKX A;  1VFC A;  1IRZ A;  3J81 K;  3WU1 B;  3K70 D;  3FM5 A;  4CSW A;  1MSF C;  3LA7 A;  3IHU A;  2P7C B;  3M8J A;  4BQN A;  3RIR A;  5FRN A;  3H36 A;  1WPK A;  3FIS A;  4C2U A;  4HYE A;  4MFD A;  4HX7 A;  1B1B A;  2FQ4 A;  5IOY A;  1G3S A;  4HQE A;  3BJA A;  2CQ7 A;  3HTU A;  2BV6 A;  5EGO A;  2F4M B;  3FX3 A;  1H9G A;  3D0S A;  3D5S C;  1Z05 A;  3LWF A;  4QPQ A;  1BC7 C;  3AL0 C;  3I54 A;  3ZXS A;  3CP2 A;  5H6R A;  5DDG A;  1TZL A;  3FXU A;  4LD5 A;  4D7M A;  4QLC U;  4OU0 A;  4EJW A;  4YRV A;  1UZC A;  1WJ5 A;  1BI3 A;  2V9P A;  1ZEL A;  1UHW A;  2HXI A;  4JK1 X;  4ZDL A;  3OS0 A;  4IHV A;  3JRA A;  2JSC A;  3OYI A;  3HOV J;  1ZYR F;  1X58 A;  2OUM A;  4RAY A;  2OAZ A;  3H5A A;  1MJ9 A;  2R7R A;  4CHU A;  1LJ9 A;  1I6X A;  4WK8 F;  3TO7 A;  3F6V A;  2XC7 A;  1JJ6 C;  2HVR A;  1XN7 A;  4LK0 F;  5KHD A;  3K1M A;  5GAE J;  5D5W B;  3HM5 A;  3R0A A;  4MO7 A;  5ICF A;  3LA3 A;  2EZH A;  3A01 A;  4AM3 A;  1ZH5 A;  3SZG A;  3M1C A;  2ZJP F;  1XSD A;  1PUE E;  2GXA A;  4FX4 A;  2K9L A;  1QGP A;  2XGD A;  3ZR8 X;  1MMS A;  3FZV A;  2VUM J;  3LAP A;  4A3M J;  3OYH A;  1EH7 A;  2FUG 2;  1JKR C;  5DUK A;  3BOQ A;  3JRH A;  3K2A A;  3CLO A;  2NVQ J;  4RGX A;  3VWB A;  2HTJ A;  3ULQ B;  3TP0 A;  1EV7 A;  3G71 I;  2JQ7 A;  5F1J A;  3EDP A;  2O0Y A;  4Y33 A;  5M3M J;  4NBQ A;  1Y0U A;  5D6E A;  4D1Q A;  2X85 A;  2ZSH B;  3CTA A;  2OTL I;  1FC3 A;  2DDA A;  3IWF A;  5F0C A;  5DYM A;  4XN0 A;  2HFH A;  4HW0 A;  2IBD A;  2W24 A;  4E6K G;  4F93 B;  3CDL A;  2R7F A;  5CKT A;  2AXL A;  1MBF A;  4XRF A;  1VQ5 I;  3VYU B;  1TTY A;  3CUQ A;  4U7B A;  2V1D A;  1U2W A;  4DYC A;  1NH3 A;  1LVA A;  1ZK8 A;  2FA5 A;  1W7P A;  1BW6 A;  2QQB A;  1FPQ A;  1SFO J;  3LSI A;  1B72 B;  1SVM A;  3H92 A;  2MFZ A;  1J5Y A;  1MH4 A;  2KHM A;  1VQK I;  3DKX A;  1U5T B;  6PAX A;  2E35 A;  3RPU A;  3JSP A;  1PUF B;  4IRG A;  2M30 A;  1G2H A;  1SAU A;  3H3V K;  1ENH A;  3DTE A;  3SDG A;  4AYB N;  3VYT B;  1N75 A;  2M8E A;  2O03 A;  5GTH C;  4E7L A;  2DOF A;  2VJI A;  1FZP B;  1R1V A;  2K7L A;  3AG2 H;  3TKY A;  5F6F A;  1B72 A;  4PFO A;  4P5O A;  3OYL A;  4EAT A;  1Z9C A;  3I56 I;  1MDM A;  3M8F A;  1XTA A;  2IXS A;  4PJL A;  4HAM A;  1TLH B;  3LSJ A;  4XSX F;  4OAZ A;  2H1L A;  2DBB A;  3CP8 A;  3J7A O;  3KX2 A;  4LJZ F;  2W7N A;  4RAG A;  2RC4 A;  1Y6I A;  2R5Y A;  2JRT A;  3BG7 A;  3M3Y J;  3TW7 A;  1WJF A;  3FK6 A;  3L2V A;  1XMA A;  3E97 A;  4FE7 A;  4ESB A;  2VKH A;  5FKM A;  4BKX A;  1C0W A;  4O3M A;  2EBI A;  3OYF A;  2I8D A;  1TQP A;  3GEZ A;  3N05 A;  1NK2 P;  1S8N A;  3BJO A;  3W6J B;  2QUF A;  2WB1 N;  2P4W A;  4AU7 A;  2E1M B;  1HKQ A;  2DA1 A;  2UXX A;  1HSJ A;  1A5J A;  2EZI A;  1FOK A;  3QOP A;  2DYR H;  1E2X A;  4HZF A;  2EJR A;  3EUH C;  3F8C A;  4GRI A;  3JSO A;  3RKY A;  5LEK A;  4MEX F;  1TW3 A;  1KQ9 A;  2JJ7 A;  3L00 A;  4IL6 C;  1JGG A;  1OMI A;  2VQC A;  4BXF A;  4HF2 A;  4UVC A;  3VOE A;  3QOD A;  2BVM A;  3LSR A;  5BPD A;  3K70 C;  1OR7 A;  3DQV C;  2FQ3 A;  2X6Y A;  3KET A;  2L7K A;  2V4J C;  2DQR A;  3GYH X;  3HRU A;  3X2Q H;  1QNT A;  4ENM A;  2IGN A;  3PSI A;  2EIL H;  4TV7 A;  1T8I A;  2VPR A;  5E1X A;  4NC8 A;  5KAI C;  3WTT C;  4XNF A;  2E1C A;  4KYW A;  1LDJ A;  3ZMT A;  4LG0 A;  2DI3 A;  1Q1V A;  2VJ5 A;  4KA4 A;  1HBX G;  2P8T A;  2B63 J;  3HHH A;  1JGS A;  3S32 A;  1X3Z B;  5GTI C;  3K4J A;  3UNG C;  2HOA A;  1ITY A;  3T5X A;  4HF1 A;  3LMM A;  4BL0 B;  3ZQI A;  2RAE A;  5H20 A;  3RKW A;  1U3E M;  1B9M A;  1G8X A;  3OS1 A;  3QU6 A;  2FX0 A;  3JAM Z;  1BI1 A;  5L3G A;  2ESH A;  4B47 A;  1OCC H;  5FLX Z;  2FEZ A;  3L2U A;  4YG2 F;  2WBM A;  4Q48 A;  2L4M A;  2K02 A;  1HCR A;  2CU7 A;  2K40 A;  2CV1 A;  2RNG A;  5E3L A;  3VYS B;  1IRX A;  2JMW A;  3A03 A;  1R1T A;  5KCM A;  5DEQ A;  3OYN A;  3ZQL A;  1ETQ A;  1TT5 B;  3SEQ A;  3ML6 A;  1FYL A;  1HW2 A;  3I5U A;  1YW7 A;  2Q2E A;  2CW0 F;  2E7W A;  2IGM A;  2KJC A;  1G6N A;  4Z6Y A;  2JPC A;  1O3T A;  2BHZ A;  2HNH A;  1FY7 A;  3DBL B;  4XLN F;  1D1B A;  2L3D A;  2UWM A;  5DD4 A;  1TWH J;  4I98 B;  4DBQ A;  3CO7 C;  1QZY A;  3BRO A;  3DV8 A;  3Q9S A;  3ECO A;  1QVU A;  3EET A;  1S5L C;  4DBR A;  1STZ A;  4M3D A;  1S72 I;  1SMT A;  1PP8 F;  1IG7 A;  2ZC2 A;  3SEZ A;  2OU2 A;  4EMS A;  4IHS A;  1P2F A;  3HRS A;  5M5W J;  2HEO A;  2WA0 A;  1YLF A;  3WTS C;  4C3H J;  4PUS A;  3V8K A;  2XPW A;  2KJB A;  4QSH A;  1MH3 A;  4L9N A;  2DK5 A;  2A5W A;  1Z3Y A;  4I2O A;  3IRQ A;  1Z7U A;  1WHU A;  2Y48 A;  1K4S A;  4XRM A;  3S2D J;  2JA2 A;  1SMY F;  1IUF A;  1PDN C;  2R7Q A;  1RUN A;  4B09 A;  2LKX A;  1TBX A;  2CUZ A;  1LNW A;  2DOE A;  1WH7 A;  3MAJ A;  2F5E A;  4DJA A;  1TWC J;  1YTY A;  1YOV B;  1MNM C;  3MMY B;  3WHB A;  2R3S A;  3EUK L;  3D1N I;  4HPQ A;  5GPA A;  3WE3 A;  2KRC A;  2BGC A;  2RDP A;  2DA4 A;  3FXK A;  3VB2 A;  3TDU C;  1VQ7 I;  2R0Q C;  2KKO A;  3IKT A;  2W00 A;  1ZR4 A;  1OLT A;  3JTH A;  2BXY A;  2ZFW A;  3BQZ A;  3LFK A;  2ZME C;  4G9Y A;  1YHQ I;  4F7Z A;  1RUO A;  2EV0 A;  2L02 A;  4ON0 A;  1YS7 A;  4C30 A;  1WH5 A;  2IA0 A;  3HOT A;  2DA6 A;  1BOA A;  2W82 A;  1DP3 A;  1UMQ A;  2Q1Z B;  1T39 A;  3KEO A;  2L5Q A;  4CUG A;  4M3B A;  2K9Q A;  4IF4 A;  3E5Q A;  3Q9V A;  1MKM A;  2X1E A;  1B8I B;  4HG2 A;  2JA5 J;  2X1C A;  2Z5U A;  3JRF A;  2KIF A;  2XF5 A;  2GOX B;  5F0F A;  1ONV A;  2YUS A;  3NRV A;  5GAH J;  3MZH A;  2NOG A;  4JBA A;  3K4N A;  4CDG A;  3L1P A;  2M7B A;  1ZAO A;  2XB5 A;  4LB6 B;  1FIP A;  5JHU A;  3J80 K;  5K5R A;  2L9R A;  2Z16 A;  4PCQ A;  2PMZ A;  1IN6 A;  3RCO A;  1UST A;  5HLG A;  2HS5 A;  2HYF A;  3OY9 A;  4E7K A;  3KLO A;  1UAA A;  2X0L A;  2VIX A;  2VKE A;  2ME0 A;  2RV8 A;  2LVS A;  4BU2 A;  4GXO A;  4ZYH A;  2MG4 A;  1DU6 A;  2A69 F;  2KLO A;  3KZI C;  1AA7 A;  3FF5 A;  3S3O A;  3QAH A;  4XKC A;  2FD5 A;  1WZ2 A;  3E6D A;  4LLG F;  5EEA A;  1TWA J;  1QRY A;  5LFA A;  5J8F A;  2ISZ A;  1WCM J;  2R7V A;  3LSP A;  1MW7 A;  3F8B A;  3DLA A;  4CCK A;  2JTV A;  3BR5 A;  3ZQG A;  2KQR A;  2X4H A;  3LFU A;  2LTP A;  1GDT A;  3H9J A;  4A0Z A;  4CCL A;  3MZ8 A;  2EWN A;  4Y3O A;  4EEF G;  5J4V A;  4CIC A;  4LG3 A;  4MLO A;  5FO5 A;  2W57 A;  3LSH A;  1T08 B;  4B8X A;  3GFI A;  2DXI A;  3O2P E;  2LR8 A;  3CQZ J;  2F5D A;  1IN5 A;  4ESJ A;  3KEQ A;  4KN4 X;  2E2J J;  1I1S A;  1GLN A;  4N0B A;  2DA7 A;  2HQ5 A;  3O3K A;  3NEU A;  4C2M J;  5HOO A;  5ICC A;  3V8L A;  4P55 A;  2DMU A;  5HNH A;  2LDU A;  5M3F J;  4B3A A;  2LYC A;  2EZK A;  3JCU C;  4CO8 A;  1IN7 A;  2R7T A;  3IL2 A;  1XX5 A;  3OV8 A;  3LAJ A;  4A6E A;  3ZMU A;  3U9G A;  1WSU A;  2QLZ A;  3G73 A;  1S7E A;  3CCY A;  1O7F A;  4CYC A;  1K4T A;  3BWG A;  3EUA A;  1D0Z A;  3ZQC A;  2ETH A;  2Z3Y A;  4CZZ A;  2FNP A;  1IXC A;  1ZAR A;  2DA3 A;  2EFP A;  3FKI J;  1NHA A;  3A1Y A;  4AID A;  4EM0 B;  5DUI A;  5IYC J;  4ZTJ A;  4U7D A;  1D1C A;  2EZL A;  1RI7 A;  3HUG B;  2XF7 A;  2OF7 A;  2MW8 A;  1O3S A;  1DP7 P;  1OYI A;  1Y8Q B;  1K83 J;  2R7X A;  2DT5 A;  1S29 A;  4CCJ A;  1HQC A;  5GP9 A;  1E3H A;  1OCP A;  3E1S A;  4UUT A;  5J1Y A;  4D5F A;  2QSH X;  2HVS A;  3CCR I;  5LHH A;  1R49 A;  3BT9 A;  1BIA A;  3WTX C;  4BBR J;  1IRG A;  1EA3 A;  1HW1 A;  2CRG A;  2CJJ A;  3BZC A;  1KU7 A;  3AG1 H;  1FX7 A;  3ONQ A;  1FSH A;  2YR2 A;  4X0G A;  1GUU A;  3PNT A;  3ZP5 A;  1KYZ A;  2J5P A;  1JI8 A;  4RM2 A;  4G12 A;  3BZK A;  5IT9 Z;  3FIW A;  3N4M A;  4IQJ A;  4BQO A;  4HOB A;  4F52 A;  2EV6 A;  2FOK A;  4XR6 A;  1QHG A;  4Q47 A;  2A61 A;  4AVZ A;  2O3F A;  3GLX A;  1JT6 A;  2ADU A;  4IXA A;  1YJ9 I;  4M3E A;  1FYM A;  3V7S A;  2BOL A;  1BR2 A;  2NNN A;  2M0M A;  2XAF A;  2COM A;  3KP7 A;  1O3R A;  3MKZ A;  1R5I D;  3BPV A;  3BG6 A;  1IDY A;  1R5G A;  5LGT A;  2MLK A;  2KIU A;  4P9F A;  4HNV A;  1FMW A;  4BNC A;  3PSF A;  3FXL A;  1IW7 F;  2CYY A;  3A0B C;  2P5V A;  3DKY A;  3ASO H;  5LBQ A;  5E18 F;  4XLF A;  3FXJ A;  4M6Y A;  1XGO A;  1T0F A;  3CES A;  1POG A;  1ZRD A;  1BJA A;  3QOE A;  4GGG A;  4UUS A;  3G6E I;  4UY8 I;  1HW5 A;  1I27 A;  2OJE D;  3FHN A;  4OIO F;  2ECC A;  2Y9Z A;  4E7J A;  1REP C;  3ERM A;  5DD8 A;  2E2H J;  4ZDO A;  5AON A;  2W84 A;  4S05 A;  3HPH A;  2ZKZ A;  2E2I J;  1VTN C;  4NNJ A;  1J9I A;  3PQK A;  2K27 A;  3RI4 A;  5DM7 F;  4OIR F;  3OS2 A;  2HOS A;  2OZ6 A;  3P9I A;  4X6A J;  3UKG A;  2Y30 A;  4EGZ A;  4PJJ A;  3ABM H;  4M73 A;  1SD7 A;  4E4H A;  3I0T A;  1N25 A;  4A3C J;  3OIP A;  3DEE A;  2BZT A;  3WHC A;  4DOZ A;  5JLX A;  2CW8 A;  1YI2 I;  4XOT A;  2DFH A;  3L9F A;  2JVH A;  4NB5 A;  5E20 A;  2Y0S A;  3E7L A;  2DFE A;  3KYL A;  5E3M A;  4RMN A;  3L2W A;  4ASN A;  4BAC A;  4XBF A;  3R0J A;  3CCJ I;  2IGO A;  4JP0 A;  2E71 A;  1CF7 B;  2F4O B;  5A2Q Z;  1QU3 A;  3RDI A;  3S1N J;  2JUG A;  4PSX A;  2ESN A;  4DGW B;  5B5E C;  4AIK A;  1JKO C;  5ILU A;  4R1H A;  1V4R A;  4X1E A;  2D45 A;  4M74 A;  4I09 A;  2ZCW A;  2IJL A;  4IJA A;  4N9H A;  5C3E J;  4A3F J;  2NS7 A;  4EQQ A;  1AU7 A;  1KU2 A;  1R36 A;  3AG4 H;  1MMD A;  2M3A A;  1J59 A;  2HOT A;  4ZJZ A;  3CMM A;  3S3M A;  1IDZ A;  2YU3 A;  2LLK A;  2XUB A;  2XV4 S;  3RJP A;  3GTG J;  3PO3 J;  3FMS A;  1Y56 A;  3CCE I;  3KZY A;  2WAE A;  5J3L A;  1SD4 A;  2CUE A;  2HGC A;  5HOD A;  5EEH A;  4A12 A;  2WAQ N;  2DU9 A;  2H6C A;  4JYK A;  5E3N A;  1JT0 A;  4N4O B;  2K9S A;  3JRG A;  5CJ9 A;  2X9D A;  4RB0 A;  2QEX I;  3C3W A;  3RZO J;  4LLL A;  2MA3 A;  2G7H A;  3MZY A;  5C4J J;  2ZB9 A;  2CUJ A;  4G6D A;  2JPB A;  4BE0 A;  5HDK A;  3CCQ I;  2PJR A;  1ERD A;  3G1O A;  1OIS A;  5M5Y J;  2QVO A;  1NK3 P;  2CWE A;  2O8K A;  3ZQQ A;  1PP7 U;  2TRT A;  2CH0 A;  1SFK A;  1ETY A;  3S3N A;  3LST A;  3SJM A;  3IWZ A;  1GVD A;  4MTD A;  3V7R A;  3R4K A;  4JX4 A;  1BR1 A;  1Y8R B;  4HF0 A;  4M6V A;  4RAZ A;  1DDN A;  3A01 B;  1FBQ A;  4YII A;  1HOM A;  2LK2 A;  3L2R A;  2Q8K A;  2FJ1 A;  3WG9 A;  1XD7 A;  1Z1D A;  3NAR A;  4MNU A;  3GTJ J;  3IH4 A;  3GME A;  4U88 A;  3HPG A;  1FP1 D;  3CC7 I;  3OYE A;  5FLX K;  1J09 A;  2Z33 A;  4BH9 A;  3OYM A;  1FMV A;  2BHY A;  4BYY A;  3S93 A;  2LY2 A;  4WX9 A;  4WXD A;  1WRJ A;  5CVU A;  3F9K A;  5TRD A;  1B4A A;  4HA8 A;  2HPM A;  4IHX A;  1XS9 A;  1U5T C;  1SFE A;  4QWQ A;  2GBY A;  1P7J A;  2EH3 A;  2P6T A;  1EJ9 A;  1RET A;  5HNF A;  2M7A A;  3GZ5 A;  4HEA 2;  4J19 A;  2EIN H;  3GTM J;  4G6T B;  1QPM A;  1N78 A;  2DO7 A;  3V42 A;  4MGR A;  1W0T A;  2XF6 A;  5IP6 A;  3GCM A;  3C2G A;  2ELJ A;  2EIJ H;  3CF5 F;  2XVC A;  2KZG A;  4EJO A;  3P5J A;  4MHG A;  1AHD P;  3CUQ B;  2CMP A;  4WCG A;  9ANT A;  3OYG A;  1W7P B;  3DBR B;  4KJZ A;  2CV0 A;  1FOX A;  4P1W A;  2DQL A;  4P9U A;  1X1B A;  1P7I A;  3I64 A;  2PEX A;  2KIM A;  1R4N B;  3PIO F;  4J00 A;  1V5G A;  4GFB A;  2ECB A;  2K3P A;  5IPA A;  1Y1W J;  2HKO A;  1LE8 B;  2WWY A;  4RB2 C;  2ICW G;  2VXZ A;  2X1D A;  5D8K B;  1X1A A;  3CMA I;  3ZMS A;  2JWT A;  1LEA A;  4A3J J;  1BW5 A;  2KRH A;  3OYJ A;  5LRR A;  2XAH A;  2HI3 A;  2VKV A;  1FLI A;  2VE8 A;  1IXR C;  4M9S A;  3HOX J;  1U78 A;  3HOU J;  2L4A A;  3PUB A;  5DV5 A;  5F0H A;  1QPI A;  5JI6 A;  4AWX B;  1T98 A;  4RBO A;  2OA4 A;  3I59 A;  2K9M A;  1E17 A;  3M4O J;  3A4C A;  4UHT A;  2E1M C;  1G3T A;  1NG6 A;  3W2V A;  4JX5 A;  4AVP A;  4EM1 A;  4IZZ A;  1MDM B;  5IP9 J;  2PBI A;  2KL4 A;  4LIV A;  1LE8 A;  1HKT A;  2UV1 A;  2QCO A;  1XC5 A;  2AS5 F;  1GT0 C;  1FJL A;  2RQP A;  2FML A;  3HSF A;  1FEX A;  1Z21 A;  3BR0 A;  2K3F A;  1G4D A;  3LQR A;  1QHH D;  3KCC A;  2W1O A;  1HST A;  3E6B A;  1IN4 A;  1T6S A;  2R5Y B;  3S8P A;  4ZYG A;  2CO5 A;  2DTZ A;  4XID A;  2IT0 A;  3WTW C;  1T95 A;  3T8T A;  1OCZ H;  1X3U A;  4XL9 A;  2H1K A;  3LSG A;  1DPU A;  2W85 A;  2EFO A;  1YX5 A;  3DEW A;  1MBG A;  4YIR X;  5FFX A;  1LDK B;  2L7M P;  2LBF B;  2VON A;  3ZRG A;  1ZLJ A;  1IXS B;  2R7S A;  1D5Y A;  2VKD A;  1WFX A;  4WWC A;  4RB3 C;  2QM3 A;  5J8C A;  1K6O A;  3ERE D;  2A6E F;  2QQ8 A;  5JFR A;  2EFN A;  4M9X A;  5LHG A;  2G0E A;  1VI0 A;  3IH3 A;  3L7W A;  2PMH A;  1Y1V J;  3PJR A;  2V26 A;  4FTH A;  3ZMD A;  2Y0S N;  1KGS A;  3OYC A;  4GYG A;  3CME I;  3GBG A;  1QBJ A;  4OWR B;  5FB2 A;  1EH6 A;  2LBF A;  1TP4 A;  1TWG J;  3OIQ A;  2E1O A;  3ZMV A;  3Q5F A;  3QP6 A;  4XLC A;  4BY7 J;  2M1B A;  1MMN A;  4HST A;  3K0L A;  5BPI A;  2BE5 F;  2H8W A;  2A6T A;  3F3X A;  5E17 F;  2VL8 A;  2CW7 A;  3SDB A;  4BJ6 C;  4LG0 B;  2Y0M A;  1BM9 A;  1LVK A;  2EA2 A;  2HPI A;  2DOD A;  2VQL A;  4C3J J;  5L3B A;  1VQP I;  3A2K A;  3GTQ J;  1ZLK A;  2HR3 A;  2UUZ A;  2D5V A;  1OYW A;  1H88 C;  1OPC A;  2ZXJ A;  1MGT A;  4DQ2 A;  1JUP A;  2AQE A;  3BR2 A;  2VT3 A;  1FIA A;  5L3F A;  4RDU A;  2LF8 A;  2IRF G;  1BC8 C;  2LY1 A;  2XGC A;  2LP0 A;  4QPO A;  2EK5 A;  2XRN A;  2YSR A;  1ETV A;  2ZJ2 A;  1UCR A;  3SHF A;  3R6S A;  1IJW C;  4XK4 A;  3DXJ F;  2NNY A;  1HKS A;  1I1G A;  4HNU A;  2H8R A;  1UG0 A;  4IO9 F;  2LY9 A;  2UZK A;  3HC7 A;  3QPT A;  2JVG A;  3EYI A;  3HSR A;  2O5R A;  2XB0 X;  4L18 B;  3M9A A;  2IVM A;  2Q2E B;  1A35 A;  4M3G A;  1TT0 A;  4BBS J;  1FBU A;  4Y13 A;  2Z9O A;  2R93 J;  4OMZ A;  3J81 Z;  1ETX A;  3MN2 A;  1A36 A;  1FTT A;  2ZO4 A;  3MCZ A;  2ID3 A;  3T8R A;  1MBK A;  5LLQ A;  4BGD A;  1I3A A;  1A04 A;  3P9K A;  4E7I A;  5D4R A;  5FFZ A;  2STW A;  2DT7 B;  3RSN A;  4II2 A;  4KMF A;  2L7Z A;  1H89 C;  1ZHF A;  3K1P A;  4KMU X;  2QKM B;  5C4X J;  1XGM A;  3HB9 A;  4BQQ A;  2XSD C;  1X2N A;  3CZ6 A;  4LFU A;  3TBI A;  2QQA A;  3K9T A;  3I55 I;  3G1M A;  1J7K A;  1TW2 A;  3E0J B;  2E60 A;  2Y2Z A;  1X19 A;  2OTJ I;  2QKL B;  4RLQ A;  5J1U A;  3HEF A;  1YG2 A;  2ZXH A;  3W2A A;  2XIG A;  3H5R A;  4ZDP A;  5IT3 A;  1SFU A;  5BOX A;  4B43 A;  4UUV A;  2IAI A;  2P81 A;  3LNQ A;  3WGG A;  4KUM A;  3K4L A;  2ZBK A;  4MFE A;  3OL3 A;  1RPW A;  1Z3X A;  1ZRC A;  2FOW A;  2RNJ A;  4XIC A;  2OQG A;  3F8M A;  4OIP F;  5AIQ A;  3HKZ A;  4S0H B;  1P9Q C;  4AIJ A;  3QRF F;  2MSY A;  1USS A;  2XHK A;  3LL7 A;  1F4K A;  1P6R A;  2W25 A;  1V54 H;  5IT9 K;  1QVT A;  2V6C A;  3S1Q J;  3GTK J;  4KIC A;  4XLH A;  3R61 A;  2KDO A;  2XRL A;  3EUH A;  1K61 A;  1ZGJ A;  4BHC A;  3GUD A;  3RQI A;  2X6W A;  4N4N B;  3HBL A;  3WG7 H;  1LFU P;  2A3S A;  1BOB A;  2LNB A;  2V1N A;  1YFH A;  5KNL A;  2PN6 A;  4MQ9 F;  4PDK A;  3K4M A;  1U0J A;  5IOZ A;  5K5O A;  2EIM H;  1D5V A;  2A5Y B;  2PFB A;  4CH7 A;  3CD6 I;  2DCE A;  1D3Y A;  3AG3 H;  4HRI A;  4A93 J;  1A6Q A;  2GWR A;  2MH9 A;  4CZC A;  5IY5 H;  4OAY A;  1LPQ A;  4ZYA A;  2WAD A;  3GWZ A;  1I6H J;  4RGR A;  1MND A;  5F27 A;  2QWW A;  1Y39 A;  3CDI A;  2FF4 A;  3MFK A;  4OMY A;  3GVA A;  2CGP A;  3TO6 A;  5EJC A;  1T56 A;  1VQ8 I;  5FRM A;  2NS0 A;  1ZG1 A;  1V3F A;  5B1B H;  2V7F A;  5HLT A;  5HLI A;  4V2F A;  3H3U A;  1GV5 A;  1Z77 A;  2BXZ A;  2LSO A;  2XKP A;  4D9J A;  1DPR A;  1XPX A;  1W1W E;  4HQM A;  3BC8 A;  4YEJ A;  3GW2 A;  5CQG A;  4G7H F;  1ETK A;  1FBS A;  4FHT A;  2ZNY A;  4ZYD A;  1VF9 A;  3TOB A;  3HOZ J;  4XLP F;  1VQM I;  3RYR A;  1Z0X A;  3ZPL A;  1G59 A;  3CJR B;  2K85 A;  3BZ6 A;  3BR3 A;  1RC9 A;  2KIQ A;  4FIS A;  2IA2 A;  1ZR2 A;  1IV6 A;  4CA0 A;  1HC8 A;  4V2G A;  4A0Y A;  3DPT A;  5EZG A;  3JTG A;  1FNN A;  1PVE A;  4ABZ A;  4A3G J;  2CQN A;  4XKV A;  3DPU A;  2E1N A;  3OR1 C;  4L5J A;  5K7Z A;  4RB1 A;  2XRO A;  3TED A;  3GTP J;  2IS4 A;  1XDS A;  5IP7 J;  2RKH A;  3HOY J;  3KP6 A;  2HKX A;  3M1E A;  3ISP A;  3IH2 A;  3F8F A;  3QYF A;  4A6D A;  1R9T J;  1K6Y A;  1T2K A;  2VJJ A;  3ABK H;  1MMA A;  4XOR A;  2NVX J;  2W48 A;  3BLY A;  2PG4 A;  5BNG A;  1Z6R A;  4XN3 A;  4EJV A;  5C44 J;  2HQR A;  2DMN A;  2Y9Y A;  1FYK A;  5KVR A;  1W4M A;  3FBI B;  3K7A J;  3U2R A;  1SFX A;  4BEH B;  3CO6 C;  3LA2 A;  4FX0 A;  3KP3 A;  5CVJ A;  2ME6 A;  3CMY A;  4BS9 A;  3I71 A;  3SZP A;  1VQ9 I;  3H0D A;  2L54 A;  1TNT A;  3FXM A;  4CYC B;  4BXU A;  2P5K A;  1MBE A;  1KU9 A;  2F48 A;  2CV2 A;  2EFQ A;  3RTR A;  4F92 B;  4KT6 A;  2OCC H;  4Y7N J;  2GAU A;  5CYV A;  2NAZ A;  3HOS A;  1IO2 A;  3ABU A;  4A3I J;  3S15 J;  3DCF A;  2ZXI A;  4M3F A;  3Q0U A;  5TGT A;  1IN8 A;  3VPR A;  2DK8 A;  3M07 A;  3FXO A;  2XKO A;  2XAG A;  4BEH A;  3F72 A;  1V55 H;  4JOM A;  2MBF A;  2YPR A;  4MEY F;  4UVA A;  4CCM A;  4I99 C;  4P96 A;  3HJE A;  1S7O A;  4UXN A;  3FKJ A;  2LH9 A;  1XCB A;  1OYY A;  1W7P D;  4EM2 A;  5ICG A;  1HF0 A;  1S9H A;  3REO A;  2KZV A;  3CC2 I;  4PZJ A;  4WXC A;  2WTE A;  2MAB A;  4KIG A;  1U9O A;  2ZME A;  1UB9 A;  1E3O C;  4B1R A;  1IV8 A;  5L3E A;  2VC1 A;  5EG0 B;  4GDF A;  4KIF A;  3RPU D;  2ACJ A;  4MQV A;  4ZC3 A;  4I76 A;  1WJB A;  1VQO I;  3BPX A;  2EA4 A;  1MJA A;  3J7Z I;  1UHM A;  5ED4 A;  3C1D A;  3NQO A;  2QSF X;  3DTI A;  1KQ8 A;  3ECH A;  4D0P A;  4HDV A;  2OPT A;  1LEB A;  2ZXW H;  4ITV A;  3A0H C;  2PX9 A;  3FDY A;  3OYD A;  3U1K A;  3SZT A;  3OYB A;  2EQR A;  2QA4 I;  5LRS A;  2QEN A;  1TQI A;  1OFC X;  1HXD A;  3WTU C;  3OSG A;  5EG0 A;  1LFP A;  4Y15 A;  2LKS A;  2KMU A;  3F22 A;  2JT1 A;  3I4N J;  3O8G A;  1E0E A;  3HTS B;  1ON1 A;  4PSW A;  5EZH A;  4IOC F;  3KP5 A;  4NHJ A;  2QQ9 A;  2IW5 A;  4E70 A;  3CDH A;  1VQ6 I;  4WXH A;  4GO1 A;  2M4G A;  1R00 A;  3WGH A;  5LEJ A;  2I10 A;  3KPH A;  1EKE A;  1RRJ A;  3FXR A;  4UUS B;  2TCT A;  1U6G A;  4NQW B;  4G7O F;  3D5R C;  1JUS A;  5IYB J;  3F8N A;  3EPZ A;  1F36 A;  1U9N A;  3Q0V A;  1I39 A;  4A5M A;  4M71 A;  3EYY A;  4YFK F;  4XQF A;  4Q5S F;  2HDW A;  3T1B A;  2IA1 A;  2FBH A;  3V8J A;  1U8R A;  3F6O A;  3R60 A;  2CFX A;  5JVG F; 
#chains in the Genus database with same CATH homology
 4IHX A;  1XS9 A;  1WI3 A;  4A3L J;  2GBY A;  1P7J A;  2YU9 J;  5DTD A;  1H8A C;  2EH3 A;  2GLO A;  2QF7 A;  2X48 A;  2VPR A;  3S14 J;  5K7F A;  1RET A;  4J19 A;  3BG5 A;  5J1R A;  3GTM J;  1W0T A;  5IP6 A;  1Q1V A;  1LFB A;  1A6I A;  3BTJ A;  2B63 J;  2O7O A;  1AHD P;  9ANT A;  3GTL J;  1ZKG A;  2M9H A;  1AKH B;  2HOA A;  2WV1 A;  3ZQI A;  2RAE A;  1P7I A;  4I6Z A;  1B8I A;  2FX0 A;  3TW6 A;  3QQA A;  4GFB A;  2ECB A;  3A02 A;  5IPA A;  1Y1W J;  1LE8 B;  5FJ8 J;  5K7H A;  1HCR A;  2IEK A;  1ITY A;  1BW5 A;  2CU7 A;  2K40 A;  4A3J J;  1RR7 A;  2JWT A;  5E3L A;  2JMW A;  3A03 A;  2JA6 J;  4MIM A;  2HI3 A;  2NVY J;  1ETQ A;  2VKV A;  3ZQL A;  1ZGW A;  3HOU J;  3HOX J;  1U78 A;  5FLM J;  1AKH A;  2DMT A;  4C3I J;  3W6V A;  5F0H A;  1QPI A;  1BJZ A;  3LOC A;  4RBO A;  5FKL A;  1RKW A;  1TC3 C;  3ZQH A;  2JK3 A;  2PMZ N;  3M4O J;  5FKO A;  4JX5 A;  1JKQ C;  5IYD J;  1TWH J;  5IP9 J;  1LE8 A;  3S1R J;  2QCO A;  2DMP A;  1XC5 A;  1GT0 C;  1FJL A;  2YS9 A;  1FEX A;  1QVU A;  3BR0 A;  3HOW J;  3Q3S A;  1RES A;  4M3D A;  2JA7 J;  3JRC A;  1IG7 A;  2R5Y B;  1X2M A;  3B6A A;  2DTZ A;  4XID A;  2AHQ A;  2HXO A;  1T33 A;  5M5W J;  2H1K A;  3LSG A;  1OJL A;  2XGE A;  3DEW A;  4IHY A;  1MBG A;  4C3H J;  2XPW A;  4QSH A;  1MH3 A;  2L7M P;  2VI6 A;  1ETW A;  3BTC A;  1D5Y A;  2DJN A;  1TWF J;  3OOU A;  3B6C A;  4XRM A;  4D5C A;  3S2D J;  3BTL A;  5EF6 A;  1IUF A;  2G0E A;  1VI0 A;  3IH3 A;  2LKX A;  1Y1V J;  2NS8 A;  1MBH A;  1WH7 A;  4FTH A;  5FLV A;  2Y0S N;  2GM4 A;  1NTC A;  1MBJ A;  2ID6 A;  2DN0 A;  1TWC J;  3BR1 A;  3F0C A;  3S1M J;  1FTZ A;  3GBG A;  3JRE A;  1MNM C;  3JRB A;  3HGY A;  3WHB A;  3D1N I;  3HKZ N;  5GPA A;  1JTX A;  2DA4 A;  1TWG J;  2E1O A;  4BY7 J;  5FKK A;  2R0Q C;  5DS9 A;  2CQQ A;  2R92 J;  1ZR4 A;  1JKP C;  3BQZ A;  4A3K J;  1I50 J;  3JRD A;  4IHW A;  4C3J J;  1WH5 A;  3RZD J;  3GTQ J;  2DA6 A;  1HDP A;  2E19 A;  2D5V A;  1UMQ A;  1H88 C;  4AUX A;  4DYR A;  4A3B J;  4M3B A;  2K9Q A;  1SAN A;  1JUP A;  3BR2 A;  1FIA A;  4RDU A;  2XGC A;  2LP0 A;  1B8I B;  3S16 J;  4Y52 J;  1ETV A;  2JA5 J;  1IJW C;  1RKT A;  3JRF A;  4XK4 A;  4IEJ A;  5F0F A;  5JLW A;  2YUS A;  4XRS G;  3FK7 A;  2H8R A;  2NOG A;  2LY9 A;  3GTO J;  3L1P A;  2XB5 A;  1FIP A;  5FKN A;  2XB0 X;  2XPV A;  2L9R A;  3BQY A;  1UG2 A;  1BL0 A;  2M2E A;  4M3G A;  4BBS J;  3BTI A;  2R93 J;  2VKE A;  2ME0 A;  1ETX A;  2LVS A;  3MN2 A;  1FTT A;  2LD5 A;  2MG4 A;  2ID3 A;  1MBK A;  1DU6 A;  4A3E J;  2HYJ A;  1HDD C;  2FD5 A;  5EEA A;  1TWA J;  1QRY A;  1WCM J;  4W97 A;  3LSP A;  1YRN B;  2L7Z A;  1VND A;  3OSF A;  1H89 C;  3BR5 A;  3ZQG A;  2O9L A;  5C4X J;  3HB9 A;  2LTP A;  3ZQF A;  3MKL A;  2XSD C;  1GDT A;  1X2N A;  2NVT J;  2R7Z J;  3H0G J;  4EEF G;  3O8H A;  3G1M A;  4MLO A;  2Y2Z A;  1WGX A;  5M5X J;  5J1U A;  2LR8 A;  3CQZ J;  3HEF A;  2Y31 A;  2DA2 A;  1IC8 A;  2L0K A;  2E2J J;  3NAU A;  2DA7 A;  2HQ5 A;  2IAI A;  2P81 A;  3LNQ A;  1YRN A;  4DZP A;  4C2M J;  2CQX A;  1O4X A;  2X6O A;  4MFE A;  1RPW A;  2DMU A;  4FCY A;  2KDZ A;  5M3F J;  4B3A A;  4XIC A;  3HGG A;  2ELK A;  2EZK A;  4S0H B;  5F08 A;  2MSY A;  2M34 A;  4A3D J;  2LFB A;  2R5Z B;  1XG1 A;  1S7E A;  3CCY A;  4CYC A;  4D7N A;  1QVT A;  3S1Q J;  3GTK J;  3ZQC A;  3S2H J;  2XRL A;  5E3O A;  2DA3 A;  1K61 A;  1JJ8 C;  3FKI J;  1U8B A;  5IYC J;  2CUF A;  4L5E A;  3RQI A;  1OCT C;  3HBL A;  4NDL A;  2EZL A;  1LFU P;  1BA5 A;  2OF7 A;  2MW8 A;  1JUM A;  2COB A;  3OIO A;  5EGO B;  5IOZ A;  4AC0 A;  3HDD A;  3PO2 J;  1K83 J;  2R5Z A;  2DMQ A;  4A93 J;  1EF4 A;  1PUF A;  5EYR A;  5GP9 A;  1APL C;  2HDD A;  2KT0 A;  3BR6 A;  1VFC A;  1IRZ A;  1OCP A;  4UUT A;  5J1Y A;  4D5F A;  1UHS A;  1MSF C;  1I6H J;  3BT9 A;  5F27 A;  4BBR J;  1WPK A;  3FIS A;  2MGQ A;  2CRG A;  4MFD A;  2CJJ A;  1GV2 A;  2FQ4 A;  5IOY A;  1T56 A;  1GUU A;  5EGO A;  4G12 A;  4V2F A;  1GV5 A;  1Z77 A;  3FIW A;  1F43 A;  3MVP A;  3Q0W A;  2XPU A;  4D7M A;  1JT6 A;  1ETK A;  3TP3 A;  4M3E A;  1VF9 A;  2HXI A;  3HOZ J;  4IHV A;  3JRA A;  3HOV J;  1X58 A;  4JX6 A;  1Z0X A;  1IDY A;  3BR3 A;  4FIS A;  1IV6 A;  1ZR2 A;  4HNV A;  4V2G A;  5EZG A;  4ABZ A;  1JJ6 C;  4A3G J;  5K7Z A;  3GTP J;  3TED A;  3I4M J;  5F04 A;  3HM5 A;  4MO7 A;  1POG A;  5IP7 J;  2EZH A;  4XRS A;  3A01 A;  3HOY J;  4B4C A;  4UUS A;  3IH2 A;  2ECC A;  2Y9Z A;  2E2H J;  2XGD A;  4DZJ A;  4QTR A;  1R9T J;  2VUM J;  4A3M J;  2E2I J;  3G1L A;  1JKR C;  3JRH A;  2L7F P;  2NVX J;  3JRI A;  2W48 A;  3K2A A;  1HLV A;  2N8G A;  5BNG A;  2NVQ J;  5C44 J;  2HOS A;  2DMN A;  2Y9Y A;  3TP0 A;  4BXX J;  1CQT A;  4X6A J;  3K7A J;  3UKG A;  4LOC A;  5F1J A;  2Y30 A;  5M3M J;  2JA8 J;  2ME6 A;  3CMY A;  2M0C A;  4W1U A;  5F0C A;  4A3C J;  2AO9 A;  2IBD A;  2K9N A;  4CYC B;  3WHC A;  3CDL A;  2M8G X;  5JLX A;  1MBE A;  1ETO A;  3RKQ A;  1MBF A;  3ZOB A;  4Y7N J;  4A3I J;  3PM1 A;  3S15 J;  3DCF A;  4DYC A;  4M3F A;  3E7L A;  3Q0U A;  3VPR A;  5E3M A;  1ZK8 A;  1BW6 A;  1SFO J;  1B72 B;  4JP0 A;  3JR9 A;  1MH4 A;  3S1N J;  3S17 J;  1JKO C;  1PUF B;  4X1E A;  1HF0 A;  1G2H A;  5C3E J;  4A3F J;  3H3V K;  1ENH A;  2NS7 A;  3SDG A;  1U9O A;  5GPC A;  1AU7 A;  1E3O C;  4B1R A;  4AYB N;  3QPS A;  4DW6 A;  5EG0 B;  3C2B A;  4I76 A;  2HOT A;  1IDZ A;  2LLK A;  1B72 A;  1ZQ3 P;  1ORK A;  1DU0 A;  3GTG J;  1ZTR A;  3PO3 J;  1W0U A;  5J3L A;  2CUE A;  1IGN A;  3LSJ A;  1I3Q J;  2OPT A;  5HOD A;  3BG3 A;  2WAQ N;  5EDN A;  4JYK A;  5E3N A;  1JT0 A;  2EQR A;  2K9S A;  3SFI A;  4QIW N;  3JRG A;  4BY1 J;  1OFC X;  1JTY A;  2X9D A;  3OSG A;  5EG0 A;  2R5Y A;  2DA5 A;  3M3Y J;  3TW7 A;  3RZO J;  3FK6 A;  3QPL A;  5C4J J;  2ZB9 A;  4FE7 A;  3I4N J;  5FKM A;  3O8G A;  3G1O A;  4BKX A;  5M5Y J;  2O8K A;  1NK3 P;  2EBI A;  2TRT A;  5EZH A;  1ETY A;  2JN6 A;  3SJM A;  1NK2 P;  1GVD A;  4JX4 A;  3IV5 A;  4M6V A;  2WB1 N;  3A01 B;  2I10 A;  2DA1 A;  1HOM A;  2LK2 A;  4UUS B;  1A5J A;  2FJ1 A;  2EZI A;  2TCT A;  1JUS A;  4FE4 A;  5IYB J;  3NAR A;  3GTJ J;  3IH4 A;  1F36 A;  1U9N A;  3BG9 A;  3Q0V A;  2JJ7 A;  4A69 C;  1MSE C;  1JGG A;  3LSR A;  4DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...