2KT0A

Solution structure of human stem cell transcription factor nanog homeodomain fragment
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords Homeobox protein NANOG
publication title Solution structure of human stem cell transcription factor Nanog
rcsb
source organism Homo sapiens
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2kt0A01
3IH3A 2P81A 2QF7A 4JP0A 4W1UA 1JGGA 2L7MP 1FTTA 2O9LA 1B72A 2LKXA 2XGCA 3MN2A 2JJ7A 2YS9A 2EZLA 2ID6A 5EG0B 5JLXA 2L0KA 3LSPA 5DS9A 2XPWA 4A3KJ 1WGXA 4MO7A 4HNVA 3M3YJ 3A03A 4FE4A 1LE8B 2HOSA 2HDDA 5FKMA 2DA3A 2IBDA 2Y2ZA 3MVPA 2LP0A 4XRMA 1IDZA 2HQ5A 3D1NI 1HF0A 4M3GA 1PUFA 1ZK8A 2CUEA 5EF6A 4XICA 1APLC 1JUSA 3ZQHA 1VNDA 5F27A 1IG7A 1MBHA 4MIMA 2H8RA 1XG1A 3ZOBA 1I50J 2DA2A 2NS8A 3OSFA 1R9TJ 1T56A 1MSFC 1W0TA 2WV1A 2EH3A 2E2IJ 1JKRC 4A3EJ 3BR1A 2JWTA 2DN0A 2MSYA 1LE8A 4MLOA 2EQRA 1ORKA 4M3EA 3JREA 1I6HJ 5C4XJ 2K9QA 2GBYA 3HEFA 4W97A 1JT6A 3G1MA 1A6IA 1ETOA 2DA7A 1MNMC 3S1MJ 3DEWA 3S14J 4QSHA 3JR9A 1X58A 1IUFA 2O7OA 3WHCA 1FIPA 5K7ZA 4RBOA 3TW6A 4FE7A 5IP6A 3IV5A 3I4NJ 4BBSJ 3CCYA 5EGOA 2IAIA 5J3LA 1Z77A 4CYCB 2JA6J 1G2HA 2HOTA 2DMPA 1JUPA 4X6AJ 4AYBN 3HM5A 3SJMA 5F0HA 3S1NJ 4IHYA 4JX4A 4B1RA 3ZQCA 4DYQA 4Y7NJ 5F0CA 1BJZA 2X9DA 1BW5A 2M8GX 3W6VA 2PMZN 2LVSA 4C3IJ 2VI6A 2CU7A 3BG9A 2GLOA 5EYRA 1ETQA 2YUSA 1U8BA 2R0QC 1RETA 2DMNA 5DTDA 1HLVA 1FEXA 4DYCA 1IDYA 4DZPA 2L7FP 3PO2J 2K9NA 3HOYJ 1GUUA 3G1OA 4CYCA 4M3DA 1B72B 2KT0A 1MSEC 1CQTA 1XS9A 3ZQIA 4DW6A 1OCTC 2DJNA 3JRAA 3BG5A 3BR6A 4XK4A 3RQIA 4MFEA 4LOCA 1GVDA 1QPIA 1K83J 3JRHA 2HOAA 3SDGA 1IRZA 1HDPA 3UKGA 1BL0A 2L9RA 3BR2A 3S2DJ 2FX0A 1IGNA 1WCMJ 1TWFJ 3PM1A 1NK2P 5M5XJ 2ME6A 4IHXA 3BTCA 4A3BJ 2ELKA 1ZKGA 1HDDC 1PUFB 1VI0A 2COBA 5FJ8J 1MBGA 1UG2A 1BW6A 1A5JA 3S1QJ 2QCOA 3FK6A 2K9SA 3BT9A 1O4XA 4D5FA 1GDTA 2DMQA 3DCFA 1TC3C 4A93J 4EEFG 5HODA 2JMWA 1RPWA 5IP7J 1X2NA 5E3NA 5C4JJ 2Y30A 2EZKA 3HGYA 1GV2A 1GT0C 1Y1WJ 2IEKA 4C3HJ 1UMQA 5FKLA 3E7LA 1ZQ3P 4C2MJ 2XPUA 2X48A 3IH2A 2Y9YA 5IOZA 3B6CA 2DA6A 2EBIA 4MFDA 2H1KA 1DU6A 1B8IB 4XIDA 1EF4A 2KDZA 1ZGWA 2MGQA 2FJ1A 4JX5A 5FKOA 4DZJA 1I3QJ 2XRLA 5EGOB 3WHBA 4IHVA 1TWGJ 2FD5A 2LLKA 1DU0A 5IYCJ 1Q1VA 1JJ8C 3QPLA 1IV6A 1Y1VJ 3CQZJ 1QRYA 2R5ZA 2R92J 4L5EA 1BA5A 1JTXA 1AHDP 1YRNA 1TWHJ 3ZQFA 5EZHA 1H8AC 2XB5A 4JYKA 4V2GA 2E19A 1E3OC 3RZOJ 1B8IA 2ID3A 4BBRJ 4NDLA 5M5YJ 1AKHB 4FISA 3C2BA 2HI3A 3A01A 1FJLA 3OIOA 3LNQA 3JRGA 4S0HB 3HDDA 1IC8A 2FQ4A 3HB9A 1U9OA 2R5YA 3GTGJ 2W48A 5K7HA 3BTIA 4A3GJ 1VFCA 3NARA 4BXXJ 2DMTA 3RZDJ 2CUFA 2LTPA 1JKPC 1TWCJ 3BG3A 4AC0A 1FIAA 1NK3P 2GM4A 2XGEA 1OJLA 3CMYA 3NAUA 9ANTA 2Y0SN 2E1OA 1RKTA 1ETWA 1IJWC 2HXOA 4UUTA 2JA8J 2WAQN 2OPTA 3GTJJ 2HXIA 5M3MJ 3GTPJ 4GFBA 4FTHA 3S15J 1NTCA 3TW7A 1AKHA 1QVUA 3GTOJ 4XRSG 5EEAA 1S7EA 1H89C 2ZB9A 3VPRA 4RDUA 1H88C 3HGGA 2CQXA 5EZGA 2EZIA 5J1RA 1AU7A 3LOCA 4QTRA 1HOMA 1MH4A 1UHSA 4XRSA 2B63J 1RKWA 1ETVA 1U9NA 5M5WJ 2MG4A 4A3CJ 1JUMA 3Q0WA 1MBEA 1X2MA 2EZHA 3IH4A 2VKVA 3S17J 2LR8A 5E3OA 5IOYA 2CRGA 2M0CA 1P7IA 4C3JJ 4AUXA 2LFBA 3ZQGA 2NVTJ 5FKKA 2M2EA 3HOVJ 1ITYA 2LK2A 2AO9A 1ZR2A 1MBJA 1F36A 5BNGA 1P7JA 3S1RJ 3LSGA 4DYRA 3B6AA 5E3MA 1WH5A 4D5CA 1Z0XA 2E2JJ 3QPSA 3GTKJ 2LY9A 3FISA 3OSGA 2DA5A 4M3FA 4BY7J 2R5ZB 3GTMJ 1LFUP 5IPAA 2D5VA 3HOZJ 2CQQA 3A02A 1YRNB 3JRCA 1GV5A 3BQYA 3H0GJ 5K7FA 4FCYA 3PO3J 4UUSB 3BQZA 1MBKA 2VKEA 3LSRA 3GBGA 5F1JA 4A3JJ 3FKIJ 3GTLJ 5GPAA 3MKLA 1F43A 3FK7A 5F08A 2Y9ZA 3TEDA 4JX6A 3QQAA 2X6OA 2XGDA 2WB1N 1ZR4A 2RAEA 4B4CA 5GP9A 3JRDA 2NOGA 3L1PA 1WI3A 1T33A 3BR0A 3A01B 3HOWJ 4BKXA 2MW8A 3JRFA 2R5YB 5C44J 1ENHA 3TP0A 4A3IJ 2NS7A 2O8KA 3HBLA 2XPVA 3ZQLA 3HKZN 5FLMJ 4UUSA 4G12A 4J19A 4BY1J 2ECBA 2E2HJ 3K7AJ 4I6ZA 2G0EA 1JTYA 4IEJA 3Q3SA 5EDNA 4IHWA 3HOUJ 2I10A 3TP3A 5EG0A 5C3EJ 2DTZA 1ETXA 3OOUA 3BR3A 3FIWA 3I4MJ 1WH7A 5F04A 1SFOJ 1QVTA 2NVXJ 1MBFA 2TCTA 2CJJA 5IP9J 3GTQJ 1ETKA 3S2HJ 3M4OJ 1FTZA 2TRTA 1W0UA 4A3MJ 1D5YA 4ABZA 2R93J 3JRBA 1POGA 2R7ZJ 2M34A 1TWAJ 2ME0A 2JA7J 3H3VK 1XC5A 2JA5J 2JN6A 3O8GA 5GPCA 4A3FJ 3K2AA 5J1YA 1ZTRA 2XB0X 3LSJA 3Q0VA 1OCPA 1U78A 1WPKA 2ECCA 5J1UA 1ETYA 4A69C 1MH3A 2M9HA 2LD5A 3JRIA 2HYJA 2Y31A 4A3DJ 2DA4A 1RESA 4M3BA 5F0FA 2DA1A 3BTLA 5IYBJ 4V2FA 2DMUA 1RR7A 2VPRA 3BR5A 5FKNA 5M3FJ 1JT0A 2OF7A 5IYDJ 2AHQA 2NVYJ 2NVQJ 4M6VA 3Q0UA 4I76A 2L7ZA 4X1EA 5JLWA 3HOXJ 3CDLA 2N8GA 4A3LJ 4B3AA 3O8HA 1K61A 1VF9A 5FLVA 1SANA 4QIWN 1OFCX 4D7MA 4D7NA 1JJ6C 3F0CA 5E3LA 2VUMJ 2XSDC 3S16J 2JK3A 1JKOC 3SFIA 3BTJA 2K40A 1HCRA 1LFBA 3G1LA 2YU9J 1JKQC 4Y52J 3RKQA
chains in the Genus database with same CATH superfamily
1T08B 2EB7A 4OMZA 3QODA 2BY3A 4W1UA 2IVMA 3M07A 2O9LA 1TQPA 2RN7A 1I1SA 3ABMH 3FXRA 5H6RA 3DU6A 5FFXA 2LDUA 2L0KA 4AD9A 4R79A 3RKWA 1X3UA 2NS0A 4Z2YA 5TGTA 3KETA 2FU4A 1BC7C 1ON2A 4HNVA 1YHQI 3K1NA 4C2UA 1I3AA 3J81K 2CQNA 4O5VA 3JW4A 3M3YJ 2HDDA 2B7EA 1FX7A 4B48A 3WTTC 2XHKA 1HSTA 3FXJA 4UVAA 3L2QA 3OL4A 1R5GA 4Q48A 3HRMA 3T1BA 2CUEA 2OUMA 3DEUA 2LBFB 1XPXA 1QGPA 4L5IA 1VNDA 5F27A 1APLC 3MZHA 1TT0A 1V4RA 1WQ2A 3HXLA 1MBHA 4EM2A 3JAMZ 1IN8A 4MNUA 3P9CA 2DA2A 2L4MA 1R9TJ 5LEJA 1YJ9I 1MSFC 2PLYA 2ZXIA 4FX0A 4WWCA 1SAXA 3HUGB 2WV1A 5IY5H 1LEAA 4XN3A 1UAAA 1YI2I 2KIFA 3CO6C 1X1AA 3H3ZA 1LE8A 3GWZA 4MLOA 4XLAA 4UB8C 3E97A 3IRRA 5LGTA 1D5VA 1LFPA 1I6HJ 1FOWA 1MIJA 3S1MJ 3S14J 3VFZA 3WODF 4AM3A 2K4BA 3ELKA 2GXGA 4RAYA 3ABKH 4PUSA 2EA4A 1SD6A 3WHCA 2XAFA 3TW6A 4FE7A 3I4NJ 4HV5A 1X4PA 4XL9A 3JSOA 2VBXA 2VONA 1KU7A 4I0BA 3RPQA 1YS7A 4L0YB 3I64A 3TOAA 4DOZA 2QENA 3ONQA 5K5OA 4IHYA 3L2CA 4JX4A 4L18B 4Q4ZF 2Z16A 1S9HA 3S3OA 2VODA 3KYDB 1BW5A 4C2TA 1R22A 2VI6A 4F52A 2EFQA 4H0EA 4PJJA 3F6OA 4M72A 2Q2EA 1V3FA 1XGSA 2E5NA 3OYMA 4S04A 1IDYA 4DZPA 1O3TA 3PO2J 1FP2A 2K9NA 3U21A 1BR4A 3HOYJ 4E7SA 2NOJB 1B4AA 4YFNF 4NC7A 2ISYA 3CMMA 2UUZA 1SFXA 5CVRA 1R71A 1B72B 2KT0A 2A6HF 2W25A 1CQTA 5HLTA 3FHZA 4NBQA 1X3ZB 4XLHA 2LC2A 4PCQA 3ZQIA 5JHUA 2IS1A 4L9TA 2GIZA 1K4TA 3BR6A 4PDKA 3G3ZA 4PFOA 3I0TA 4LOCA 2ZO4A 5HVQC 4C30A 2P7CB 3CCVI 1HDPA 3UKGA 2K9MA 2OD5A 3OOPA 5LHIA 4AWXB 3BR2A 3QAHA 3CJQB 3ZPLA 4IQJA 2W4SA 2KFDA 4BAYA 1FY7A 4IHXA 2PJRA 3IC7A 4A3BJ 3FM3A 3PQKA 4F55A 1PUFB 1VI0A 2V79A 2A69F 1IV8A 1MBGA 4KMUX 5LBQA 2WA0A 4BL0B 4OU0A 3BT9A 1V5GA 3DP7A 3AFHA 1E3PA 3IWFA 1LUJB 2DT7B 1NH3A 2UV1A 1T98A 4BHPA 3FBNB 4KN4X 4EEFG 3ZXSA 5HODA 3GLXA 1R23A 1RPWA 5IP7J 5E3NA 2BW3A 2K9LA 1WJEA 2F5FA 2XAUA 1V55H 3KP2A 3O2PE 3V7RA 1R5ID 2IS6A 4MTDA 2E35A 4G6QA 2DXIA 2XDVA 1KONA 2IEKA 4LMYA 2WY8Q 4LD5A 3E6MA 2DT5A 2QA4I 1T8IA 4XLEA 1JHFA 4LG0B 4I09A 2EBIA 3AG1H 1DU6A 4XBFA 1J0RA 4XIDA 1EF4A 4L9JA 1ZGWA 1Y39A 3EETA 5FKOA 4ETSA 4DZJA 1S8NA 5EGOB 1OCRH 3WHBA 2FE3A 4II2A 4BQOA 3F8NA 2LRDA 3QPLA 1Y1VJ 5DDGA 3CQZJ 2R5ZA 4A6DA 3E1SA 3CCEI 2CMPA 5L3FA 1SAUA 2XROA 3BPVA 2RV8A 4NQWA 1Y0UA 4IXAA 3OIQA 3E3VA 5CQGA 3ZQFA 4WCGA 2HPMA 2QSGX 4ON0A 2A61A 3CCUI 1DP7P 3D5LA 1MJ9A 4KT5C 2XB5A 4G7HF 2HQNA 3QYEA 1E3OC 1JHHA 4ZDPA 5B66C 3IWZA 1BI0A 1D0YA 3K2ZA 5HNFA 1B8IA 3ZN1A 2KIQA 3REOA 2ID3A 1R4NB 1J75A 3K9TA 1QQIA 3FXLA 1LDKB 2Q0OA 1IF1A 1V54H 4GYIA 4P9FA 3A01A 3OIOA 1YLFA 2K4JA 3A0HC 2CFXA 3W2WA 3JRGA 2R5YA 3F9KA 5K7HA 2X4HA 4IF4A 1QHHD 1KYWA 3QOEA 4M9ZA 4A3GJ 2EV6A 2MABA 3RZDJ 1MMNA 2FBKA 2CUFA 3AG3H 1QBJA 2VC1A 3TQNA 3PNTA 1JKPC 3U1KA 1FOXA 5FROA 1OJLA 3CMYA 3NAUA 9ANTA 2VL8A 1FYMA 1OYYA 5ILVA 1IRGA 4Y17A 2IW5A 1WKMA 2OPTA 3GTJJ 2IA2A 4BDYA 4G8XA 3J7YJ 4BJTA 4G7ZF 3DPTA 3GTOJ 2I5UA 2W7NA 4UVBA 1H89C 1N78A 1GXQA 2HGCA 5FD6A 3VPRA 3F23A 1XTAA 1MGTA 3HGGA 3GLLA 2EIKH 4RB1A 5DYMA 1P4AA 2Y48A 5EZGA 5ICCA 5J1RA 3OYHA 3ULQB 1WSUA 2WV0A 3LOCA 1UCRA 4QTRA 1MH4A 5BPDA 3L2WA 1ETVA 2OAZA 1MMGA 4HNUA 2HKOA 2H6BA 2KDOA 5HDGA 2MG4A 2R7DA 1ZYRF 3GW2A 1X2MA 3A4CA 2ZFWA 4F3QA 3GYHX 2CRGA 2M0CA 1J2XA 1OR7C 2LFBA 2M2EA 2BE5F 1RUNA 3H35A 1PYVA 5BNGA 5D5WB 2E34A 1R49A 2P6TA 1GVJA 5FB2A 3MMYB 2KRHA 2HFHA 4HDVA 1T2KA 2UXNA 2ZNYA 3CCRI 1BR2A 1I1GA 4BY7J 1N75A 3GFJA 1LFUP 2Y0SA 3F8BA 2D5VA 1YRNB 3A02A 3E5QA 1A35A 3H0GJ 3KPHA 3OYNA 3PO3J 1CF7B 3DTKA 3LSRA 3GBGA 4EATA 1VQ6I 2MA3A 2DBBA 2E7XA 5GPAA 3EYIA 2J5OA 2BOLA 4I01A 4R1HA 2P7VB 4ZTFA 1I39A 2K27A 2X6OA 1STZA 5BQTA 2FEZA 5CJ9A 2WB1N 2RAEA 1LVAA 1F5TA 3WE2A 3JRDA 2BZTA 4LK0F 3L1PA 1O7LA 4HF2A 2P4WA 1Z3XA 1G8XA 4BKXA 4E7IA 3HRUA 2DFFA 3FXMA 5HNHA 4BEHA 1QZEA 3DFGA 2C6YA 1FBQA 3TP0A 3RPUA 2CYYA 5D8KB 3ZQLA 3OS0A 4ZC3A 2ZJPF 3PNYA 4G6TB 2IA0A 5D5XB 4CH7A 3LSIA 2VPLA 2PN6A 4YEJA 4I6ZA 4R8HA 2QQ8A 2O03A 3OYIA 2DI3A 3GCMA 3F3XA 1EH7A 2DTZA 1Q1HA 2P5LC 1WH7A 4U0VA 1SFOJ 3GXOA 3FBIB 2NVXJ 3QP5A 2EFNA 1MBFA 1SFUA 1Z7LA 3A2KA 3M1EA 2TCTA 4KFCA 3GVAA 4CCMA 3GTQJ 2TRTA 3LA7A 2HZTA 3EUKL 1TTYA 2W00A 4FX4A 4ABZA 3CLQA 2LBFA 2O5RA 5F64A 1PP8F 5DUKA 1POGA 4U0YA 3GF2A 2R7ZJ 2ME0A 4BXFA 1W7PA 1XB4A 1EH8A 2IS2A 5J4VA 3BY6A 3WTUC 3HSRA 4BE1A 3K2AA 5J1YA 2XB0X 3LSJA 2DCEA 2E60A 3HOTA 1WPKA 4E7JA 1R7JA 3FF5A 3K4BA 3SXYA 3K4JA 2LOOA 3IAS2 3TO7A 3K6GA 5ILUA 3HKZA 3BG6A 1RESA 2XIGA 3ERMA 3ROUA 4RB2C 4B44A 2K5CA 1LKXA 4PK4A 1K78B 2P5KA 5H20A 1RR7A 1X4OA 1D1CA 3K4MA 1YITI 1R36A 4LITA 5D4RA 2VOPA 5FKNA 1JT0A 1J09A 1BC8C 4EVIA 1L3LA 4M6VA 2RQQA 2VBZA 2UWMA 2RDPA 3B02A 4X1EA 2RVCA 3DF8A 1P4XA 5JHFA 2IGMA 2KRFA 3CDLA 3G2BA 3SQNA 3IL2A 2WAFA 2F6CA 5KAFC 4B3AA 4DBQA 2WTEA 1EKEA 1VF9A 2M4GA 1SANA 1KYZA 4BQNA 1OFCX 3ZP5A 1AOYA 2ZKZA 1VTNC 4GRIA 2CW7A 3F0CA 4YFXF 1FPQA 1R1TA 2VQLA 5K1YA 2AXLA 2YPRA 1RR8C 1ACIA 2VKHA 3BJOA 1MZBA 1UFMA 4J01A 2VUMJ 2Q8KA 2ZFUA 2JK3A 1TQIA 3GO5A 3BTJA 1XD7A 3LQQA 1BI3A 3ABUA 1LFBA 3L2VA 4LIUA 2YU9J 1JKQC 3HC7A 3SEQA 5ICFA 4EJUA 3O3KA 1TQMA 1VQKI 3IH3A 4IL6C 3TGNA 4HSRA 3W6JB 2M30A 4P9UA 1JGGA 3RIRA 5IT9K 1B72A 2QGUA 2R7UA 2H94A 3SZTA 4YIIA 4IHTA 2CQKA 5EG0B 3ABTA 3E6DA 1SFKA 2PMHA 4KYWA 3MCZA 2XPWA 4UHTA 3I55I 1MKMA 1XMXA 1PVEA 2QQBA 2R3SA 3KZIC 2A05A 5CKTA 1OYWA 3J80K 2ZJQF 1XSDA 4KDPA 1SC7A 2EIMH 3OYEA 3LA3A 1R6RA 2IBDA 3PUFA 5DM6F 3K4KA 1HW2A 1IDZA 2KRCA 3ASOH 1XX5A 3SEZA 1HF0A 2CO5A 5E1WA 3RI4A 2QVOA 2BHZA 1PUFA 4XLPF 5EF6A 4XICA 1JUSA 3KLOA 1WJCA 4XM3A 3CDIA 5E20A 1IG7A 5ED4A 2WC2A 3GZ5A 3KE2A 2IJLA 3ZOBA 2V1UA 1EV7A 3BLYA 2V4JC 1FYLA 1LNWA 2E1CA 3E5UA 2IGKA 2MC4A 2JWTA 1Z91A 2DN0A 3KYCB 3HZJA 3TBIA 4XN0A 2CW0F 1YS6A 1ORKA 1T39A 2EIJH 4M3EA 5D8LB 4W97A 3CCSI 3G1MA 2Z1DA 2JA2A 4WXDA 4E7ZA 3ZQQA 1ETOA 3IHUA 1M1EB 4QSHA 4LG0A 3V8KA 2Y0MA 1X1BA 3JR9A 3OYAA 5IP6A 3X2QH 1YFHA 4AVZA 4BBSJ 5EGOA 1G2HA 1Z77A 1P4WA 2V9VA 3I71A 1S29A 2I8DA 2QLZA 4OAYA 2LH9A 1W5CC 4ITVA 2YX4A 3M8EA 3SJMA 5F0HA 3S1NJ 3CD6I 4B1RA 3ZQCA 3V8LA 3WGHA 2H27A 3NQOA 5F0CA 2MYSA 4AU7A 2M8GX 3W6VA 3FHNA 3KEYA 2LVSA 2BY2A 3OYKA 3E5XA 4WXCA 3OY9A 2GLOA 4LLNA 4AIHA 2KHMA 1ETQA 4UUVA 1U8BA 3F6VA 4KITB 1O3QA 1BOAA 2XV4S 1HLVA 1QHGA 3DBRB 4M9XA 4DYCA 3DKXA 2VJ4A 1RZ4A 1SMYF 2RNJA 4ZYEA 3IRQA 3KZZA 3TO6A 4MEXF 3FMSA 4Q47A 4U7DA 1TT5B 3G1OA 1ERDA 2K3FA 4CYCA 2MFZA 2VXZA 4OIPF 2JT1A 3BPXA 3I59B 2O8XA 2CSOA 1YIOA 1HKQA 3BG5A 1V5EA 3H36A 4DJAA 2GXBA 2ELJA 2XAQA 1TZLA 3CZ6A 2A5WA 2L01A 4MFEA 2DJIA 2PX9A 3EUHC 4B47A 1YOVB 1VQ8I 2Z33A 4ZDOA 2L9RA 4ZYHA 1D0XA 3E6BA 1TWFJ 2DFEA 3ABLH 4GDFA 5CPRB 1NK2P 4KIGA 4MQVA 2EA2A 2QEXI 2V9KA 2HTSA 5D6EA 1XCVA 4IX7A 4KUMA 5L3DA 3F22A 1TL8A 2EK5A 3FM5A 5LGUA 3EQLF 3FK6A 5DUIA 4D5FA 4EJVA 4KA4A 1B9MA 4U88A 2QBYB 5LFAA 3P5JA 1VQLI 6PAXA 5JI6A 2L2OA 4A93J 1VQNI 4KISA 1T0FC 1X2NA 1SD5A 1J5YA 2Y30A 2EZKA 3GZNB 2HU9A 3HPHA 3HGYA 1BJAA 5A2QZ 1GT0C 1Y1WJ 1ZLKA 3OYDA 2K85A 1PP7U 3DXJF 5FKLA 4P96A 4HF1A 3OYFA 4C2MJ 2LNBA 2JSCA 2DU9A 5CYVA 3IH2A 4KMFA 4JBAA 3RTRA 4A5NA 2XUBA 1E2XA 2H6CA 2FJ1A 4IQ4A 1B9NA 1LDDA 1OCOH 2X1EA 4CCOA 2ZJRF 2PQ8A 3D5RC 3I9V2 3C2GA 4XNFA 2STWA 2R92J 2M3AA 3WU0A 4E7LA 4G9YA 1AHDP 3H5AA 1YRNA 3SZGA 5KCMA 2F2EA 3H1CA 4M74A 1TWHJ 3RYRA 1CF7A 2HDCA 1ONVA 3H9JA 1KA8A 1H8AC 2XF6A 1VQMI 1XDUA 1XDSA 1HBXG 2E7WA 4NDLA 1AKHB 3CESA 1X1CA 2G7UA 3K4LA 1S6LA 4RB0A 3GFLA 3WTZA 4S0HB 1IC8A 2FQ4A 3HB9A 3GTGJ 1B59A 2W48A 2NNYA 2EILH 4C9YA 3NARA 4BXXJ 4P55A 5TJJA 4M9SA 1F4KA 2DFIA 2LTPA 1TWCJ 3TO9A 4F91B 1NK3P 3AKZA 4EQQA 4P5OA 1J7KA 4KJZA 2Y0SN 3M8FA 5CVVA 3OWTA 3GX4X 3Q5FA 2K02A 1UB9A 2V26A 2VT3A 2R7RA 2A07F 3SFZA 1RC9A 1XGNA 4AIKA 3J81Z 4ZYAA 4FTHA 3S15J 1NTCA 3TW7A 3V8JA 5LHGA 1Y8RB 4XR6A 5KNLA 4PJ0C 2R7FA 1VQ7I 1OCZH 4MQ9F 4RDUA 3LAJA 1LEBA 1XMAA 1H88C 2VJIA 3DLLF 1AU7A 3J7ZI 1HQCA 4EJTA 4XRSA 1XN7A 1RKWA 1S3JA 2FBHA 2M8EA 4A3CJ 1WVRA 4CZZA 5L3EA 4FETA 3G71I 1WZ2A 4HSTA 1FSEA 3IH4A 2VKVA 3GMEA 2L9NA 2LR8A 2VE8A 1OR7A 1P7IA 4AUXA 5FKKA 5J4YA 4BNCA 2LK2A 1IW7F 2AO9A 4CYDA 4UXNA 2GA1A 1P7JA 3S1RJ 1IN5A 3BP8A 5H2FC 5E3MA 4I0AA 4D1QA 3GEZA 1WH5A 1Z0XA 2GWRA 3QPSA 2E2JJ 4CZCA 3FISA 5L3CA 4XRFA 2HEOA 1K78A 5K5QA 4BQQA 2ADUA 3GTMJ 5CLSA 1WJFA 5CQEA 4QPOA 3BQYA 2OQRA 4WK8F 4OOIA 1PDNC 4FCYA 4BQAA 2WAQA 3HRTA 3HRSA 5B1BH 2IGNA 4YELA 2M1BA 2QKMB 1F43A 3ZR8X 5D6FA 1YJWI 2PEXA 3QQAA 1YO5C 1SVLA 3VOEA 1WFXA 2BVLA 5B5EC 3L2RA 2DAOA 3DLAA 2ZNZA 4XLFA 2TDXA 3HOWJ 1MMAA 4ESJA 5FRNA 1P9QC 2L02A 3QYBA 4XKBA 5C44J 1ENHA 2ZBKA 2XSJC 2O8KA 3L09A 5HDNA 1U5TA 4WF2A 2XPVA 3HKZN 3H5NA 5DM7F 5FLMJ 4UUSA 4G12A 2R7TA 2HZDA 5J8CA 2CS3A 5FRMA 1N25A 5KVRA 2EINH 4HNTA 1FT9A 3H0DA 5EDNA 2I10A 5EG0A 1FMVA 5HOOA 1TNSA 3J7AO 2J5PA 1ETXA 3RKYA 3U9GA 3WE3A 3OS1A 4ENKA 2VOOA 5C4JJ 1J59A 4M6YA 1QVTA 1S7OA 3FXUA 3G6EI 2L4AA 2X6XA 2A5YB 4HPQA 2OA4A 2OCEA 2QKLB 2EJRA 2W82A 3TDZC 1U8RA 1WJ5A 3OMYA 3RSNA 4AIDA 4A3MJ 4PGGA 4QPQA 1MJAA 1FLIA 4M6XA 2R93J 3L2UA 4OINF 2HDWA 2XVCA 3ZMVA 2JA7J 2X6WA 1XC5A 2JN6A 2L9VA 2JA5J 1XGMA 1D1BA 4L9NA 3TMOA 5B3SH 3PQJA 1ZTRA 3OYGA 4BXUA 4HG2A 3TKYA 1U78A 3N05A 1H0MA 1HW5A 2CWEA 4UNOA 2STTA 1X1PA 3DV8A 3NRVA 4MGRA 1YW7A 2AQEA 1QA6A 2HYJA 3CUQC 3OYBA 4A3DJ 4B43A 1ZARA 1ZLJA 4M3BA 3WTSC 2DA1A 2BGCA 1XMKA 2ZJ2A 2DOFA 3OR2C 5F6FA 2DMUA 5IYBJ 4B8XA 3OYLA 3IKTA 4NC8A 4BU2A 3LSMA 1R58A 2DLLA 3CDHA 3CC2I 5M3FJ 5IYDJ 3Q0UA 1KGSA 2JSPA 3I4PA 3E0JB 2LF7A 3T8TA 3DTIA 4NNJA 2HPIA 5LRSA 3DBLB 1XCBA 2M5WA 5FLVA 3KP4A 1O57A 3CJTB 4PFPA 1C0WA 1AWCA 3HL2A 1YIJI 4II3A 3ZN0A 4BDZA 2R7SA 1TNTA 3AG4H 2QYOA 3I5UA 3K4CA 3MEXA 1NG6A 1IUYA 2FBIA 4HYEA 2CG4A 3IKVA 1HCRA 2AQFA 5HS7A 1ZN2A 2L54A 3HSFA 3C1DA 1BI1A 1LVKA 4Y52J 2VQCA 4A2UA 3RKQA 2P81A 2QF7A 2JUCA 2L7MP 1FTTA 1FC3A 2LKSA 1TP4A 4CCKA 4CCJA 3CCMI 2LKXA 3I59A 4CHUA 1K6YA 4LLLA 2HYFA 1ZG3A 4CCNA 2V6EA 2JQ7A 3K70C 4A3KJ 1WGXA 4MO7A 2OTLI 4OIRF 3LWFA 3P7NA 1FWZA 3A03A 4FE4A 4EGYA 1LE8B 1RUOA 5FKMA 2DA3A 2JRMA 1YYVA 2Y2ZA 3MVPA 4XKWA 3C2HA 2HQ5A 1KQ9A 3D1NI 2DW4A 4M3GA 3LFKA 4X0GA 2R7VA 3FWEA 4I2OA 5J8FA 3RKXA 1PUEE 4OAZA 3HTSB 4PSWA 2VIXA 4MIMA 2FF4A 3BCAA 5GAEJ 3WTXC 4IVNA 3RYPA 2IS4A 1T56A 5D5VB 1W0TA 1W5TA 1ZAOA 4D0PA 2E2IJ 1CGPA 5AONA 4A3EJ 4FASD 2MSYA 4ZH4F 3OV8A 3CUQB 2P0WA 3DWLE 3JREA 1TBXA 4KT6A 2K9QA 2GBYA 3HEFA 3KFWX 5B1AH 1JT6A 2QWWA 2VB6A 4XORA 2DA7A 2Q2EB 2XASA 2X6YA 4RAZA 1OPCA 4XOTA 4I98B 3PL8A 4Y3OA 1X58A 2MLKA 2O7OA 1FIPA 3H9QA 3I3LA 3QP6A 4HX8A 4RBOA 2QSHX 2R7XA 2VE9A 3IV5A 2IAIA 5J3LA 3MAJA 2MD0A 2HOTA 2DMPA 4S05A 3F8FA 2JPBA 2P5VA 4XSXF 4X6AJ 3HUGA 3ZQ7A 2K3PA 3HM5A 4RMNA 4ZZDA 5ERIA 1IZ1A 1PJRA 1S7AA 2OU2A 3JTGA 2B0LA 3GUDA 2X9DA 4CDGA 5EJCA 1OMIA 2DYSH 4Q5SF 4C3IJ 4HBLA 3ISPA 2VLAA 3FXQA 4CO8A 4PZJA 2CU7A 3BG9A 4XKVA 1FNNA 5EYRA 2GIVA 2UXXA 2YUSA 1IRFA 5DEQA 1BM9A 1RETA 2DMNA 5DTDA 3K69A 4EV0A 1Z05A 1G4DA 2DFHA 2HR3A 2L7FP 3HYIA 4EM0B 4Y13A 3VYSB 4E70A 3ZMUA 3K0LA 1XS9A 4DW6A 2WADA 1OCTC 1DDNA 3T8RA 3KZYA 4BHCA 3G4SI 3EUHA 1L0OC 1GVDA 1T6SA 3O6BB 1K83J 4FT8A 2HOAA 3ZMTA 4BJ6C 2PMUA 3JRHA 1QPIA 1IRZA 1BL0A 2WWYA 3S2DJ 2FX0A 1IGNA 1WCMJ 1SD7A 4XLCA 3LMMA 5HS9A 2KPMA 3PFYA 1OLTA 4N4NB 3H9GA 4PGHA 3LL7A 3CJRB 2ME6A 2VJ5A 3BTCA 3CJNA 2FQ3A 5LHHA 1Z7UA 1ZKGA 2DDBA 5FJ8J 3F8CA 4ESFA 2ELHA 3AAFA 5FLXZ 1P92A 4AYBA 4ZTJA 1KU3A 1O4XA 1HSJA 2NRAC 3R6SA 5DD8A 2PMZA 4XQFA 2DMQA 3DCFA 1QPMA 2JMWA 1UG0A 2D45A 5J47A 4HF0A 3AG2H 5ILSA 4F92B 4AVPA 2VBYA 4NUBA 3I54A 1UMQA 2QQ9A 4BS9A 2IXSA 3CTAA 3E7LA 1Z9CA 1ZQ3P 3BROA 2V9PA 2X48A 2MLGA 1MD0A 2M7BA 1B8IB 2LMDA 1LQ1A 3WGIA 2KDZA 1OKRA 2XRLA 1DGWY 4IHVA 1TWGJ 4N4OB 3CF5F 2AXTC 5LGNA 3IAM2 4E6KG 5IYCJ 4CICA 1JJ8C 1DU0A 4H4KC 1FP1D 5KAIC 3W2VA 2MD5A 1HW1A 4RAGA 1U0JA 1QRYA 2NYXA 4L5EA 5HLGA 1JTXA 4Y33A 2Z5UA 2EFOA 4IRHA 1JGSA 1MW7A 4F93B 1UJ8A 2HS5A 5E8GA 5EZHA 4ASNA 4LFUA 1GLNA 3OL3A 2DO7A 4V2GA 1W1WE 2E19A 4QLCU 1T95A 1OCCH 4YRVA 1U6GA 1Z6RA 1R1VA 3KX2A 4FISA 5BOXA 3C2BA 2HI3A 2NAZA 1FJLA 3LNQA 4V19K 3SYTA 3BTIA 1H9GA 3CF2A 1VFCA 2CH0A 3QOPA 2X0LA 5IT9Z 2HQAA 1F9NA 1IO2A 1K4SA 1LB2A 1FIAA 3FX3A 2M87A 2GM4A 2JRTA 2K7LA 2XGEA 4BYYA 2VQGA 1R4MB 2OZ6A 1W4MA 3M1CA 3F21A 1K7AA 4XOPA 3H3UA 4UUTA 3LSHA 3M9AA 2WAQN 5CVUA 3COAC 2HXIA 4LGWA 3V7CA 5M3MJ 4CXFA 4HA8A 2ZXHA 2OTJI 2IPQX 2LF8A 4AIJA 1Y56A 3I53A 2EPFA 3ASNH 1IXSB 4Z6YA 1I5ZA 3RDIA 1EA3A 2RC4A 2WAEA 3HPGA 2A3SA 4LG3A 1YQAA 2CQXA 3HJEA 4GCVA 1EJ9A 1UHSA 1S5LC 2VBWA 3JAMK 4BACA 3RJPA 5HLHA 2HTJA 1U9NA 2VXDA 2PBIA 5M5WJ 5GADJ 1R5HA 2Z9OA 5LRRA 2DPDA 4EGZA 2GOXB 4NC6A 4RA2A 4LB6B 2QQAA 3ECOA 1MBEA 2OV7A 4MTEA 2W24A 1MNDA 2EZHA 1FOYA 3ZCOA 3S17J 3L9FA 4FQGA 4C3JJ 4ZYGA 1ITYA 2RREA 3KP3A 2X1DA 3VEPA 3HOVJ 1NG7A 1ZR2A 2CGPA 3QPHA 4I02A 3K1PA 3LSGA 1ZG5A 3WG7H 4DYRA 4E7HA 3A1YA 3B6AA 4ESBA 3H92A 1HA8A 4D5CA 1DP3A 1E17A 3RCOA 4D9JA 3UNGC 3QU3A 3V42A 2DPUA 1Y8QB 4M3FA 1MMSA 2P6SA 4BHBA 3C18A 3LSKA 5IPAA 3HOZJ 2CQQA 4L9VA 1GV5A 2XF7A 2HNHA 4HAMA 5E8IA 1ZRCA 2V1DA 4DQ2A 4GO1A 1W36D 3BQZA 1MBKA 3PUBA 2EFPA 2D1VA 5F1JA 4A3JJ 3FKIJ 3GTLJ 2H8WA 1USSA 1ODDA 1ZG1A 4QWQA 4HV6A 4LIVA 3U2RA 2YSRA 1YW9A 4JX6A 1IN6A 2XGDA 2R7WA 4IRGA 2ZMEC 3S8PA 5GP9A 4IOAF 1WI3A 2ZSHB 2PG4A 3VYTB 3BR0A 5CVIA 1A6QA 3V7SA 2MW8A 2ZSIB 3BZKA 3KP5A 5BPIA 2NS7A 4J00A 2DT6A 1YX5A 3HBLA 1U2WA 4BY1J 4A0XA 5L3GA 2KJCA 1TW2A 3HOSA 2FXAA 1DQUA 3TL4X 1YX3A 2L9SA 1W7PB 5JR3A 3LQRA 3Q9SA 3FZVA 3P9IA 4K2EA 3V4GA 3HTUA 3TP3A 4BJ5C 1XGOA 3HHGA 1P2FA 3K70D 5C3EJ 2K86A 4JOMA 1EH6A 2KIUA 3DPUA 2KZVA 3OOUA 3FIWA 2R4GA 3I4MJ 5EEGA 3W6KB 1SVOA 1YW8A 5ICEA 4RLQA 2IGOA 2FNPA 2QSFX 3K10A 1ZHFA 3MWMA 2CJJA 5IP9J 4N9HA 1ETKA 3S2HJ 1P6RA 4YG2F 2L5QA 4LLGF 1OISA 4JQFA 2Z2SB 2MH2A 3JRBA 4XLNF 3VDXA 2HVRA 1SMTA 2F4OB 1SEUA 3H3VK 2VASA 4HW0A 2GAUA 2QZ8A 4IRIA 1TLHB 1XSVA 5GPCA 1LPQA 1G6NA 4IO9F 4ENNA 2GA2A 3Q0VA 1OCPA 2LG4A 2ECCA 5J1UA 5F1RA 1MH3A 2M9HA 4HRIA 4EM1A 1OQYA 3CUQA 4HLYA 2RGVA 2Y31A 1O3RA 3BCBA 3PJRA 2LSOA 4Y4RA 2DA4A 5F0FA 2LY2A 1JI8A 3K4NA 4V2FA 2BY0A 2W85A 2VPRA 1K6OA 1D1AA 4B09A 4KIFA 4CGZA 2OF7A 2IA1A 1A04A 4HQMA 2OQGA 5DCMB 4U87A 2O3FA 4I76A 1U3EM 3KP7A 3D5SC 3GFIA 5JLWA 3HOXJ 5KK1A 2JPCA 4UVCA 2E71A 3O8HA 3ESWB 3M7GA 1K61A 4QIWN 1KQ0A 4D7MA 2ZMEB 1JJ6C 2IT0A 1BIBA 3ML6A 3DTEA 4HQEA 4HEA2 2NXNB 2A6EF 2DOAA 2X1CA 4PJMA 2XSDC 1JE8A 3SFIA 2ESHA 1IRXA 2KISA 4FHTA 3G1LA 5E18F 2BXYA 2GXAA 2HWVA 1O7FA 2XAGA 1GXPA 4JP0A 2JUGA 1R1UA 4HX4A 3OIPA 4ZZLA 3CO7C 3DU5A 3BDDA 5AIPA 4A0YA 2JTVA 2XGCA 1KU2A 3MN2A 2JJ7A 2YS9A 2EZLA 2ID6A 3PIPF 1WWXA 5JLXA 2BVMA 3LSPA 5DS9A 1WJAA 1SD4A 2YX7A 4RGXA 3CCLI 2OCCH 3I58A 2PI0A 2HOSA 1TW3A 3EUAA 4M73A 2HYGD 2LP0A 3CP2A 3W3CA 3VSLA 2ICWG 4XRMA 1S72I 3KCCA 4I7HA 2W1OA 1G59A 2FA5A 3FDYA 3CUOA 4O6JA 1ZK8A 4G7OF 3QYFA 3ZQHA 1YJNI 3BJ6A 2VC0A 1VQ5I 2XAJA 2KJBA 4Y15A 3BZ6A 3DEEA 2H8RA 2OC6A 3CCJI 1XG1A 1B6AA 1BIAA 5E1XA 1YTYA 2FMYA 1I50J 2NS8A 3QU6A 3OSFA 1X3WB 4LB5A 1H9TA 2EH3A 2Z99A 1BI2A 1WHUA 2BHYA 4GGGA 2KKOA 2XAHA 4A5MA 3G73A 1JKRC 3BR1A 3R4KA 1IXCA 2DODA 3I56I 2EQRA 2E1NA 2KZGA 3PSIA 5E79C 3SZPA 3JCUC 5C4XJ 3PIOF 1MDMB 1A6IA 1VZ0A 1MNMC 3DEWA 3DBHB 3WTWC 2DDAA 2NVUB 4RB3C 1IUFA 5K7ZA 4A12A 4OMYA 2MBFA 2FNAA 2NNNA 3K1MA 4P1WA 3CCYA 4IJAA 4CYCB 2BXZA 2JA6J 3HHHA 5IT3A 1JUPA 1WRJA 2F5VA 2G7HA 4DIQA 3RPUD 4AYBN 2CFOA 4DYQA 4Y7NJ 3DPLC 4HOBA 1G3WA 1BJZA 1DPRA 1VQPI 2PMZN 2JZYA 4M71A 1HXDA 1E0EA 2HQRA 3ECHA 3MD2A 4DBRA 3IP4B 2XGXA 3EPZA 3RQ4A 2R0QC 4OIOF 3VYUB 2Y69H 1FEXA 1D8JA 3NEUA 4YIFA 1DUXC 2XC7A 1GUUA 3HIFA 4LJZF 3CC4I 3S3MA 5J6XA 2V6CA 2Z3YA 3EDPA 1LDJA 5DV5A 4A0ZA 5GAGJ 3WU1B 3LAPA 4HDUA 4M3DA 1W36C 3AL0C 1MSEC 4TV7A 5DCFA 2KP6A 2BEOA 4OWRB 2CUZA 2DJNA 3C3WA 5CVJA 5EEHA 3JRAA 1F1ZA 4RAFA 4XK4A 2F4IA 3RQIA 1XSXA 5E1ZB 2VN2A 3SDGA 4BH9A 3KEQA 5BS6A 2W84A 3S2WA 1W7PD 5BMZA 3R0JA 4HLXA 1O3SA 2L7KA 2LKPA 3PM1A 5J40A 4RGUA 5M5XJ 2M45A 2BV6A 4I99C 2ELKA 3HG9A 1HDDC 4XONA 1FSHA 3BZCA 2COBA 1UG2A 1BW6A 2DOEA 4CA0A 1UELB 4G94A 2HVQA 2QCOA 4ANJA 3S1QJ 1A5JA 1FBSA 2K9SA 4UV9A 2VKDA 3ZMDA 3CC7I 5FD5A 5TISC 1QZYA 4BE2A 1GDTA 2O61A 2X51A 3WG9A 3PSFA 2RNGA 3ZRGA 3CMEI 1TC3C 3HSEA 3T5XA 2IRFG 2QM3A 1Z21A 3MZ8A 1GV2A 3D0SA 2CV2A 3T0YA 1VQOI 1Z67A 2E1MC 2RQPA 3MKZA 4C3HJ 2FMLA 2XPUA 5IOZA 2Y9YA 3B6CA 2BYVE 2DA6A 4HX7A 3S32A 4MFDA 2H1KA 3FMRA 4CSWA 2RKHA 2OZUA 2MGQA 4YIRX 4JX5A 3SDBA 1I3QJ 1MNEA 2R7QA 2FD5A 2LLKA 2Y75A 2QBYA 1Q1VA 2AS5F 5LEKA 1QO0D 2JVGA 1IV6A 1UHMA 3P9KA 1DGRM 2FUG2 1N77A 1REPC 2ZXWH 5JVGF 1BA5A 2EFWA 1ZREA 2V7FA 1U5TC 3QPTA 2Q1ZB 2W57A 1G3SA 2DQRA 2OBPA 2ZXJA 1FMWA 3CP8A 4KIBA 5D4SA 2H1LA 4JYKA 3WTVC 3CLOA 1OYIA 5D5UB 1AA7A 1JXSA 3FKJA 3BJAA 4A6EA 3RZOJ 2UZKA 3B73A 4YFKF 2V1NA 5TRDA 4BBRJ 4JK1X 5M5YJ 3UR3C 3AL0B 4CCLA 3HDDA 1U9OA 2XKPA 4BUPA 4XKCA 2WY7Q 2F48A 4XSZF 3IUOA 3Q9VA 1QNTA 2DMTA 1D3YA 3ZGKA 5FLXK 1RRJA 4IHSA 2LREA 3C7JA 3BG3A 2ESNA 5L3BA 4AC0A 2ETHA 3NWSA 1Z6TA 5GTHC 5JVTA 2HVSA 3KEOA 2BY1A 2WBMA 4NB5A 2GQQA 4L0ZB 2ZCWA 3S3NA 1UHWA 2E1OA 4IPAA 1RKTA 1ETWA 5DD4A 2A6TA 5ICGA 2CUJA 4RM3A 2HXOA 2LY1A 3DQVC 3S93A 1IJWC 2JA8J 2M7AA 1Y0NA 4KICA 1NHAA 3GTPJ 2PJRB 4GFBA 1KZHA 1KQ8A 1E3HA 1ZGAA 2COMA 1QVUA 1ULYA 1AKHA 1K79A 4XRSG 5EEAA 1MJBA 3R60A 1S7EA 4XMYA 2V1XA 5H6QA 2ZB9A 2X85A 3F72A 3QWLA 5HDKA 3J7AY 1RI7A 4N9IA 4UY8I 2PJPA 3FXKA 2DTRA 2EZIA 1I27A 1HKTA 1HOMA 4WXHA 4F7ZA 3OYJA 2KL4A 2B63J 1ZRFA 1X1DA 2BW3B 4B3XA 1YG2A 2M0MA 1ZGJA 2XKOA 2KQRA 1JUMA 4PJNA 3Q0WA 2E1MB 4DGWB 1ZRDA 3CMAI 1HC8A 3BWGA 1D0ZA 5E3OA 5GAHJ 5IOYA 2CV1A 4O3MA 2NVTJ 3TDUC 3ZQGA 4UB6C 1VQ9I 4GXOA 1BOBA 1MBJA 1QU3A 3WTYC 1F36A 5KHDA 3E6CC 3BOQA 2FOKA 3KIOA 3LSTA 3VYRB 5HLIA 2BBYA 3GTKJ 2QUFA 2LY9A 2KIMA 3OSGA 2DA5A 2R5ZB 2CV0A 3MKYB 2B9SA 4GYGA 1T0FA 3ZMZA 4ZYDA 2GZWA 3JRCA 1U5TB 1KU9A 2F5DA 4RS8A 2O0YA 1WJBA 4ZJZA 5K7FA 5E17F 4NQWB 4UUSB 3F8MA 2FRHA 2VKEA 3GZ6A 1V5FA 5DCMA 4HZFA 3WGGA 4G6DA 3KP6A 3JSPA 1USTA 4ENJA 3MKLA 4RGRA 1IN7A 3FK7A 5F08A 2E36A 3PNVA 3OR1C 4ENMA 3TEDA 4PJLA 2Y9ZA 2EV5A 3TOBA 3LA2A 1DPUA 4E4HA 1QZZA 1FOKA 1WI9A 2ZMEA 3VB2A 2CW8A 1ZR4A 4B4CA 1ZELA 1BR1A 2F5CA 2NOGA 4MHGA 3WU2C 2FSWA 2F4MB 2IP2A 4DNCA 1FYKA 1T33A 1IN4A 3BC8A 3A01B 3W2AA 4OIQF 4EJOA 3KLNA 1B1BA 3JRFA 2HKXA 2R5YB 3R61A 3BG7A 3FMQA 3M8JA 4BE0A 2DQLA 4A3IJ 2D1HA 2A68F 2P8TA 1SFEA 2OJED 4J19A 2XF5A 3MKWB 1GHCA 5K5RA 2ECBA 2FOWA 5HS8A 2E2HJ 3K7AJ 2G0EA 1JTYA 4IEJA 2O6GE 3Q3SA 4IHWA 3HOUJ 3A0BC 2ZC2A 4RGSA 3OS2A 3U1DA 1G3YA 4PSXA 2PFBA 3BR3A 4EJWA 1FZPB 3FXOA 3GFMA 5F04A 1IAWA 1W5SA 2EWNA 2DK5A 4CUGA 3QRFF 4RM2A 5FGMA 3LFUA 3SHFA 1I6XA 1HKSA 3ERED 1Z1DA 2XRNA 1D8KA 3M4OJ 1FTZA 1A36A 1W0UA 1VQ4I 2YU3A 1D5YA 4NHJA 2R7OA 3JTHA 4EMSA 1WJDA 4U7BA 3NWTA 4IOCF 2M34A 1TWAJ 2MC3A 5AIQA 4E7KA 1A31A 2DK8A 3O8GA 2WB1A 4MEYF 3J80Z 3VWBA 5LD2C 4LK1F 3DKYA 4A3FJ 2ISZA 2YR2A 5FO5A 2VJJA 5A2QK 1LJ9A 1T38A 1UZCA 2KLOA 1SVMA 4UV8A 1RIOH 2H09A 4BGDA 1ETYA 4N0BA 4A69C 2LD5A 3PFIA 3JRIA 5JFRA 4IKFA 5GTIC 4L5JA 3MFKA 3VSKA 1MMDA 3BTLA 1MDMA 2KMUA 4WX9A 1IXRC 3BR5A 3VODA 2VT2A 1ZH5A 1X19A 1Z3YA 3ZMSA 3L00A 2AHQA 2NVYJ 4IZZA 2M4KA 2NVQJ 2CQ7A 3OYCA 1R00A 3L7WA 1Y6IA 2DYRH 2L7ZA 2LYCA 2MH9A 4KN7X 5LLQA 4KNYA 2N8GA 2F5EA 2JVHA 3DKWA 4A3LJ 3CCQI 3H5RA 3MZYA 2L3DA 2VQHA 2E5ZA 1YE9A 4D7NA 1BN5A 1J9IA 1ON1A 3R0AA 1RNLA 1BBYA 2EV0A 2G9WA 5FFZA 5E3LA 3N4MA 3S16J 2HOEA 3EYYA 3MQ0A 1JKOC 2GOMA 4RLFA 4U0WA 3N97A 4BEHB 2K40A 2ACJA 1G3TA 3KYLA 4ZDLA 2D2WA 1FBUA
chains in the Genus database with same CATH topology
3IH3A 2P81A 2QF7A 4JP0A 4W1UA 1JGGA 2L7MP 1FTTA 2O9LA 1B72A 2LKXA 2XGCA 3MN2A 2JJ7A 2YS9A 2EZLA 2ID6A 5EG0B 5JLXA 2L0KA 3LSPA 5DS9A 2XPWA 4A3KJ 1WGXA 4MO7A 4HNVA 3M3YJ 3A03A 4FE4A 1LE8B 2HOSA 2HDDA 5FKMA 2DA3A 2IBDA 2Y2ZA 3MVPA 2LP0A 4XRMA 1IDZA 2HQ5A 3D1NI 1HF0A 4M3GA 1PUFA 1ZK8A 2CUEA 5EF6A 4XICA 1APLC 1JUSA 3ZQHA 1VNDA 5F27A 1IG7A 1MBHA 4MIMA 2H8RA 1XG1A 3ZOBA 1I50J 2DA2A 2NS8A 3OSFA 1R9TJ 1T56A 1MSFC 1W0TA 2WV1A 2EH3A 2E2IJ 1JKRC 4A3EJ 3BR1A 2JWTA 2DN0A 2MSYA 1LE8A 4MLOA 2EQRA 1ORKA 4M3EA 3JREA 1I6HJ 5C4XJ 2K9QA 2GBYA 3HEFA 4W97A 1JT6A 3G1MA 1A6IA 1ETOA 2DA7A 1MNMC 3S1MJ 3DEWA 3S14J 4QSHA 3JR9A 1X58A 1IUFA 2O7OA 3WHCA 1FIPA 5K7ZA 4RBOA 3TW6A 4FE7A 5IP6A 3IV5A 3I4NJ 4BBSJ 3CCYA 5EGOA 2IAIA 5J3LA 1Z77A 4CYCB 2JA6J 1G2HA 2HOTA 2DMPA 1JUPA 4X6AJ 4AYBN 3HM5A 3SJMA 5F0HA 3S1NJ 4IHYA 4JX4A 4B1RA 3ZQCA 4DYQA 4Y7NJ 5F0CA 1BJZA 2X9DA 1BW5A 2M8GX 3W6VA 2PMZN 2LVSA 4C3IJ 2VI6A 2CU7A 3BG9A 2GLOA 5EYRA 1ETQA 2YUSA 1U8BA 2R0QC 1RETA 2DMNA 5DTDA 1HLVA 1FEXA 4DYCA 1IDYA 4DZPA 2L7FP 3PO2J 2K9NA 3HOYJ 1GUUA 3G1OA 4CYCA 4M3DA 1B72B 2KT0A 1MSEC 1CQTA 1XS9A 3ZQIA 4DW6A 1OCTC 2DJNA 3JRAA 3BG5A 3BR6A 4XK4A 3RQIA 4MFEA 4LOCA 1GVDA 1QPIA 1K83J 3JRHA 2HOAA 3SDGA 1IRZA 1HDPA 3UKGA 1BL0A 2L9RA 3BR2A 3S2DJ 2FX0A 1IGNA 1WCMJ 1TWFJ 3PM1A 1NK2P 5M5XJ 2ME6A 4IHXA 3BTCA 4A3BJ 2ELKA 1ZKGA 1HDDC 1PUFB 1VI0A 2COBA 5FJ8J 1MBGA 1UG2A 1BW6A 1A5JA 3S1QJ 2QCOA 3FK6A 2K9SA 3BT9A 1O4XA 4D5FA 1GDTA 2DMQA 3DCFA 1TC3C 4A93J 4EEFG 5HODA 2JMWA 1RPWA 5IP7J 1X2NA 5E3NA 5C4JJ 2Y30A 2EZKA 3HGYA 1GV2A 1GT0C 1Y1WJ 2IEKA 4C3HJ 1UMQA 5FKLA 3E7LA 1ZQ3P 4C2MJ 2XPUA 2X48A 3IH2A 2Y9YA 5IOZA 3B6CA 2DA6A 2EBIA 4MFDA 2H1KA 1DU6A 1B8IB 4XIDA 1EF4A 2KDZA 1ZGWA 2MGQA 2FJ1A 4JX5A 5FKOA 4DZJA 1I3QJ 2XRLA 5EGOB 3WHBA 4IHVA 1TWGJ 2FD5A 2LLKA 1DU0A 5IYCJ 1Q1VA 1JJ8C 3QPLA 1IV6A 1Y1VJ 3CQZJ 1QRYA 2R5ZA 2R92J 4L5EA 1BA5A 1JTXA 1AHDP 1YRNA 1TWHJ 3ZQFA 5EZHA 1H8AC 2XB5A 4JYKA 4V2GA 2E19A 1E3OC 3RZOJ 1B8IA 2ID3A 4BBRJ 4NDLA 5M5YJ 1AKHB 4FISA 3C2BA 2HI3A 3A01A 1FJLA 3OIOA 3LNQA 3JRGA 4S0HB 3HDDA 1IC8A 2FQ4A 3HB9A 1U9OA 2R5YA 3GTGJ 2W48A 5K7HA 3BTIA 4A3GJ 1VFCA 3NARA 4BXXJ 2DMTA 3RZDJ 2CUFA 2LTPA 1JKPC 1TWCJ 3BG3A 4AC0A 1FIAA 1NK3P 2GM4A 2XGEA 1OJLA 3CMYA 3NAUA 9ANTA 2Y0SN 2E1OA 1RKTA 1ETWA 1IJWC 2HXOA 4UUTA 2JA8J 2WAQN 2OPTA 3GTJJ 2HXIA 5M3MJ 3GTPJ 4GFBA 4FTHA 3S15J 1NTCA 3TW7A 1AKHA 1QVUA 3GTOJ 4XRSG 5EEAA 1S7EA 1H89C 2ZB9A 3VPRA 4RDUA 1H88C 3HGGA 2CQXA 5EZGA 2EZIA 5J1RA 1AU7A 3LOCA 4QTRA 1HOMA 1MH4A 1UHSA 4XRSA 2B63J 1RKWA 1ETVA 1U9NA 5M5WJ 2MG4A 4A3CJ 1JUMA 3Q0WA 1MBEA 1X2MA 2EZHA 3IH4A 2VKVA 3S17J 2LR8A 5E3OA 5IOYA 2CRGA 2M0CA 1P7IA 4C3JJ 4AUXA 2LFBA 3ZQGA 2NVTJ 5FKKA 2M2EA 3HOVJ 1ITYA 2LK2A 2AO9A 1ZR2A 1MBJA 1F36A 5BNGA 1P7JA 3S1RJ 3LSGA 4DYRA 3B6AA 5E3MA 1WH5A 4D5CA 1Z0XA 2E2JJ 3QPSA 3GTKJ 2LY9A 3FISA 3OSGA 2DA5A 4M3FA 4BY7J 2R5ZB 3GTMJ 1LFUP 5IPAA 2D5VA 3HOZJ 2CQQA 3A02A 1YRNB 3JRCA 1GV5A 3BQYA 3H0GJ 5K7FA 4FCYA 3PO3J 4UUSB 3BQZA 1MBKA 2VKEA 3LSRA 3GBGA 5F1JA 4A3JJ 3FKIJ 3GTLJ 5GPAA 3MKLA 1F43A 3FK7A 5F08A 2Y9ZA 3TEDA 4JX6A 3QQAA 2X6OA 2XGDA 2WB1N 1ZR4A 2RAEA 4B4CA 5GP9A 3JRDA 2NOGA 3L1PA 1WI3A 1T33A 3BR0A 3A01B 3HOWJ 4BKXA 2MW8A 3JRFA 2R5YB 5C44J 1ENHA 3TP0A 4A3IJ 2NS7A 2O8KA 3HBLA 2XPVA 3ZQLA 3HKZN 5FLMJ 4UUSA 4G12A 4J19A 4BY1J 2ECBA 2E2HJ 3K7AJ 4I6ZA 2G0EA 1JTYA 4IEJA 3Q3SA 5EDNA 4IHWA 3HOUJ 2I10A 3TP3A 5EG0A 5C3EJ 2DTZA 1ETXA 3OOUA 3BR3A 3FIWA 3I4MJ 1WH7A 5F04A 1SFOJ 1QVTA 2NVXJ 1MBFA 2TCTA 2CJJA 5IP9J 3GTQJ 1ETKA 3S2HJ 3M4OJ 1FTZA 2TRTA 1W0UA 4A3MJ 1D5YA 4ABZA 2R93J 3JRBA 1POGA 2R7ZJ 2M34A 1TWAJ 2ME0A 2JA7J 3H3VK 1XC5A 2JA5J 2JN6A 3O8GA 5GPCA 4A3FJ 3K2AA 5J1YA 1ZTRA 2XB0X 3LSJA 3Q0VA 1OCPA 1U78A 1WPKA 2ECCA 5J1UA 1ETYA 4A69C 1MH3A 2M9HA 2LD5A 3JRIA 2HYJA 2Y31A 4A3DJ 2DA4A 1RESA 4M3BA 5F0FA 2DA1A 3BTLA 5IYBJ 4V2FA 2DMUA 1RR7A 2VPRA 3BR5A 5FKNA 5M3FJ 1JT0A 2OF7A 5IYDJ 2AHQA 2NVYJ 2NVQJ 4M6VA 3Q0UA 4I76A 2L7ZA 4X1EA 5JLWA 3HOXJ 3CDLA 2N8GA 4A3LJ 4B3AA 3O8HA 1K61A 1VF9A 5FLVA 1SANA 4QIWN 1OFCX 4D7MA 4D7NA 1JJ6C 3F0CA 5E3LA 2VUMJ 2XSDC 3S16J 2JK3A 1JKOC 3SFIA 3BTJA 2K40A 1HCRA 1LFBA 3G1LA 2YU9J 1JKQC 4Y52J 3RKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH3 A;  2P81 A;  2QF7 A;  4JP0 A;  4W1U A;  1JGG A;  2L7M P;  1FTT A;  2O9L A;  1B72 A;  2LKX A;  2XGC A;  3MN2 A;  2JJ7 A;  2YS9 A;  2EZL A;  2ID6 A;  5EG0 B;  5JLX A;  2L0K A;  3LSP A;  5DS9 A;  2XPW A;  4A3K J;  1WGX A;  4MO7 A;  4HNV A;  3M3Y J;  3A03 A;  4FE4 A;  1LE8 B;  2HOS A;  2HDD A;  5FKM A;  2DA3 A;  2IBD A;  2Y2Z A;  3MVP A;  2LP0 A;  4XRM A;  1IDZ A;  2HQ5 A;  3D1N I;  1HF0 A;  4M3G A;  1PUF A;  1ZK8 A;  2CUE A;  5EF6 A;  4XIC A;  1APL C;  1JUS A;  3ZQH A;  1VND A;  5F27 A;  1IG7 A;  1MBH A;  4MIM A;  2H8R A;  1XG1 A;  3ZOB A;  1I50 J;  2DA2 A;  2NS8 A;  3OSF A;  1R9T J;  1T56 A;  1MSF C;  1W0T A;  2WV1 A;  2EH3 A;  2E2I J;  1JKR C;  4A3E J;  3BR1 A;  2JWT A;  2DN0 A;  2MSY A;  1LE8 A;  4MLO A;  2EQR A;  1ORK A;  4M3E A;  3JRE A;  1I6H J;  5C4X J;  2K9Q A;  2GBY A;  3HEF A;  4W97 A;  1JT6 A;  3G1M A;  1A6I A;  1ETO A;  2DA7 A;  1MNM C;  3S1M J;  3DEW A;  3S14 J;  4QSH A;  3JR9 A;  1X58 A;  1IUF A;  2O7O A;  3WHC A;  1FIP A;  5K7Z A;  4RBO A;  3TW6 A;  4FE7 A;  5IP6 A;  3IV5 A;  3I4N J;  4BBS J;  3CCY A;  5EGO A;  2IAI A;  5J3L A;  1Z77 A;  4CYC B;  2JA6 J;  1G2H A;  2HOT A;  2DMP A;  1JUP A;  4X6A J;  4AYB N;  3HM5 A;  3SJM A;  5F0H A;  3S1N J;  4IHY A;  4JX4 A;  4B1R A;  3ZQC A;  4DYQ A;  4Y7N J;  5F0C A;  1BJZ A;  2X9D A;  1BW5 A;  2M8G X;  3W6V A;  2PMZ N;  2LVS A;  4C3I J;  2VI6 A;  2CU7 A;  3BG9 A;  2GLO A;  5EYR A;  1ETQ A;  2YUS A;  1U8B A;  2R0Q C;  1RET A;  2DMN A;  5DTD A;  1HLV A;  1FEX A;  4DYC A;  1IDY A;  4DZP A;  2L7F P;  3PO2 J;  2K9N A;  3HOY J;  1GUU A;  3G1O A;  4CYC A;  4M3D A;  1B72 B;  2KT0 A;  1MSE C;  1CQT A;  1XS9 A;  3ZQI A;  4DW6 A;  1OCT C;  2DJN A;  3JRA A;  3BG5 A;  3BR6 A;  4XK4 A;  3RQI A;  4MFE A;  4LOC A;  1GVD A;  1QPI A;  1K83 J;  3JRH A;  2HOA A;  3SDG A;  1IRZ A;  1HDP A;  3UKG A;  1BL0 A;  2L9R A;  3BR2 A;  3S2D J;  2FX0 A;  1IGN A;  1WCM J;  1TWF J;  3PM1 A;  1NK2 P;  5M5X J;  2ME6 A;  4IHX A;  3BTC A;  4A3B J;  2ELK A;  1ZKG A;  1HDD C;  1PUF B;  1VI0 A;  2COB A;  5FJ8 J;  1MBG A;  1UG2 A;  1BW6 A;  1A5J A;  3S1Q J;  2QCO A;  3FK6 A;  2K9S A;  3BT9 A;  1O4X A;  4D5F A;  1GDT A;  2DMQ A;  3DCF A;  1TC3 C;  4A93 J;  4EEF G;  5HOD A;  2JMW A;  1RPW A;  5IP7 J;  1X2N A;  5E3N A;  5C4J J;  2Y30 A;  2EZK A;  3HGY A;  1GV2 A;  1GT0 C;  1Y1W J;  2IEK A;  4C3H J;  1UMQ A;  5FKL A;  3E7L A;  1ZQ3 P;  4C2M J;  2XPU A;  2X48 A;  3IH2 A;  2Y9Y A;  5IOZ A;  3B6C A;  2DA6 A;  2EBI A;  4MFD A;  2H1K A;  1DU6 A;  1B8I B;  4XID A;  1EF4 A;  2KDZ A;  1ZGW A;  2MGQ A;  2FJ1 A;  4JX5 A;  5FKO A;  4DZJ A;  1I3Q J;  2XRL A;  5EGO B;  3WHB A;  4IHV A;  1TWG J;  2FD5 A;  2LLK A;  1DU0 A;  5IYC J;  1Q1V A;  1JJ8 C;  3QPL A;  1IV6 A;  1Y1V J;  3CQZ J;  1QRY A;  2R5Z A;  2R92 J;  4L5E A;  1BA5 A;  1JTX A;  1AHD P;  1YRN A;  1TWH J;  3ZQF A;  5EZH A;  1H8A C;  2XB5 A;  4JYK A;  4V2G A;  2E19 A;  1E3O C;  3RZO J;  1B8I A;  2ID3 A;  4BBR J;  4NDL A;  5M5Y J;  1AKH B;  4FIS A;  3C2B A;  2HI3 A;  3A01 A;  1FJL A;  3OIO A;  3LNQ A;  3JRG A;  4S0H B;  3HDD A;  1IC8 A;  2FQ4 A;  3HB9 A;  1U9O A;  2R5Y A;  3GTG J;  2W48 A;  5K7H A;  3BTI A;  4A3G J;  1VFC A;  3NAR A;  4BXX J;  2DMT A;  3RZD J;  2CUF A;  2LTP A;  1JKP C;  1TWC J;  3BG3 A;  4AC0 A;  1FIA A;  1NK3 P;  2GM4 A;  2XGE A;  1OJL A;  3CMY A;  3NAU A;  9ANT A;  2Y0S N;  2E1O A;  1RKT A;  1ETW A;  1IJW C;  2HXO A;  4UUT A;  2JA8 J;  2WAQ N;  2OPT A;  3GTJ J;  2HXI A;  5M3M J;  3GTP J;  4GFB A;  4FTH A;  3S15 J;  1NTC A;  3TW7 A;  1AKH A;  1QVU A;  3GTO J;  4XRS G;  5EEA A;  1S7E A;  1H89 C;  2ZB9 A;  3VPR A;  4RDU A;  1H88 C;  3HGG A;  2CQX A;  5EZG A;  2EZI A;  5J1R A;  1AU7 A;  3LOC A;  4QTR A;  1HOM A;  1MH4 A;  1UHS A;  4XRS A;  2B63 J;  1RKW A;  1ETV A;  1U9N A;  5M5W J;  2MG4 A;  4A3C J;  1JUM A;  3Q0W A;  1MBE A;  1X2M A;  2EZH A;  3IH4 A;  2VKV A;  3S17 J;  2LR8 A;  5E3O A;  5IOY A;  2CRG A;  2M0C A;  1P7I A;  4C3J J;  4AUX A;  2LFB A;  3ZQG A;  2NVT J;  5FKK A;  2M2E A;  3HOV J;  1ITY A;  2LK2 A;  2AO9 A;  1ZR2 A;  1MBJ A;  1F36 A;  5BNG A;  1P7J A;  3S1R J;  3LSG A;  4DYR A;  3B6A A;  5E3M A;  1WH5 A;  4D5C A;  1Z0X A;  2E2J J;  3QPS A;  3GTK J;  2LY9 A;  3FIS A;  3OSG A;  2DA5 A;  4M3F A;  4BY7 J;  2R5Z B;  3GTM J;  1LFU P;  5IPA A;  2D5V A;  3HOZ J;  2CQQ A;  3A02 A;  1YRN B;  3JRC A;  1GV5 A;  3BQY A;  3H0G J;  5K7F A;  4FCY A;  3PO3 J;  4UUS B;  3BQZ A;  1MBK A;  2VKE A;  3LSR A;  3GBG A;  5F1J A;  4A3J J;  3FKI J;  3GTL J;  5GPA A;  3MKL A;  1F43 A;  3FK7 A;  5F08 A;  2Y9Z A;  3TED A;  4JX6 A;  3QQA A;  2X6O A;  2XGD A;  2WB1 N;  1ZR4 A;  2RAE A;  4B4C A;  5GP9 A;  3JRD A;  2NOG A;  3L1P A;  1WI3 A;  1T33 A;  3BR0 A;  3A01 B;  3HOW J;  4BKX A;  2MW8 A;  3JRF A;  2R5Y B;  5C44 J;  1ENH A;  3TP0 A;  4A3I J;  2NS7 A;  2O8K A;  3HBL A;  2XPV A;  3ZQL A;  3HKZ N;  5FLM J;  4UUS A;  4G12 A;  4J19 A;  4BY1 J;  2ECB A;  2E2H J;  3K7A J;  4I6Z A;  2G0E A;  1JTY A;  4IEJ A;  3Q3S A;  5EDN A;  4IHW A;  3HOU J;  2I10 A;  3TP3 A;  5EG0 A;  5C3E J;  2DTZ A;  1ETX A;  3OOU A;  3BR3 A;  3FIW A;  3I4M J;  1WH7 A;  5F04 A;  1SFO J;  1QVT A;  2NVX J;  1MBF A;  2TCT A;  2CJJ A;  5IP9 J;  3GTQ J;  1ETK A;  3S2H J;  3M4O J;  1FTZ A;  2TRT A;  1W0U A;  4A3M J;  1D5Y A;  4ABZ A;  2R93 J;  3JRB A;  1POG A;  2R7Z J;  2M34 A;  1TWA J;  2ME0 A;  2JA7 J;  3H3V K;  1XC5 A;  2JA5 J;  2JN6 A;  3O8G A;  5GPC A;  4A3F J;  3K2A A;  5J1Y A;  1ZTR A;  2XB0 X;  3LSJ A;  3Q0V A;  1OCP A;  1U78 A;  1WPK A;  2ECC A;  5J1U A;  1ETY A;  4A69 C;  1MH3 A;  2M9H A;  2LD5 A;  3JRI A;  2HYJ A;  2Y31 A;  4A3D J;  2DA4 A;  1RES A;  4M3B A;  5F0F A;  2DA1 A;  3BTL A;  5IYB J;  4V2F A;  2DMU A;  1RR7 A;  2VPR A;  3BR5 A;  5FKN A;  5M3F J;  1JT0 A;  2OF7 A;  5IYD J;  2AHQ A;  2NVY J;  2NVQ J;  4M6V A;  3Q0U A;  4I76 A;  2L7Z A;  4X1E A;  5JLW A;  3HOX J;  3CDL A;  2N8G A;  4A3L J;  4B3A A;  3O8H A;  1K61 A;  1VF9 A;  5FLV A;  1SAN A;  4QIW N;  1OFC X;  4D7M A;  4D7N A;  1JJ6 C;  3F0C A;  5E3L A;  2VUM J;  2XSD C;  3S16 J;  2JK3 A;  1JKO C;  3SFI A;  3BTJ A;  2K40 A;  1HCR A;  1LFB A;  3G1L A;  2YU9 J;  1JKQ C;  4Y52 J;  3RKQ A; 
#chains in the Genus database with same CATH topology
 1T08 B;  2EB7 A;  4OMZ A;  3QOD A;  2BY3 A;  4W1U A;  2IVM A;  3M07 A;  2O9L A;  1TQP A;  2RN7 A;  1I1S A;  3ABM H;  3FXR A;  5H6R A;  3DU6 A;  5FFX A;  2LDU A;  2L0K A;  4AD9 A;  4R79 A;  3RKW A;  1X3U A;  2NS0 A;  4Z2Y A;  5TGT A;  3KET A;  2FU4 A;  1BC7 C;  1ON2 A;  4HNV A;  1YHQ I;  3K1N A;  4C2U A;  1I3A A;  3J81 K;  2CQN A;  4O5V A;  3JW4 A;  3M3Y J;  2HDD A;  2B7E A;  1FX7 A;  4B48 A;  3WTT C;  2XHK A;  1HST A;  3FXJ A;  4UVA A;  3L2Q A;  3OL4 A;  1R5G A;  4Q48 A;  3HRM A;  3T1B A;  2CUE A;  2OUM A;  3DEU A;  2LBF B;  1XPX A;  1QGP A;  4L5I A;  1VND A;  5F27 A;  1APL C;  3MZH A;  1TT0 A;  1V4R A;  1WQ2 A;  3HXL A;  1MBH A;  4EM2 A;  3JAM Z;  1IN8 A;  4MNU A;  3P9C A;  2DA2 A;  2L4M A;  1R9T J;  5LEJ A;  1YJ9 I;  1MSF C;  2PLY A;  2ZXI A;  4FX0 A;  4WWC A;  1SAX A;  3HUG B;  2WV1 A;  5IY5 H;  1LEA A;  4XN3 A;  1UAA A;  1YI2 I;  2KIF A;  3CO6 C;  1X1A A;  3H3Z A;  1LE8 A;  3GWZ A;  4MLO A;  4XLA A;  4UB8 C;  3E97 A;  3IRR A;  5LGT A;  1D5V A;  1LFP A;  1I6H J;  1FOW A;  1MIJ A;  3S1M J;  3S14 J;  3VFZ A;  3WOD F;  4AM3 A;  2K4B A;  3ELK A;  2GXG A;  4RAY A;  3ABK H;  4PUS A;  2EA4 A;  1SD6 A;  3WHC A;  2XAF A;  3TW6 A;  4FE7 A;  3I4N J;  4HV5 A;  1X4P A;  4XL9 A;  3JSO A;  2VBX A;  2VON A;  1KU7 A;  4I0B A;  3RPQ A;  1YS7 A;  4L0Y B;  3I64 A;  3TOA A;  4DOZ A;  2QEN A;  3ONQ A;  5K5O A;  4IHY A;  3L2C A;  4JX4 A;  4L18 B;  4Q4Z F;  2Z16 A;  1S9H A;  3S3O A;  2VOD A;  3KYD B;  1BW5 A;  4C2T A;  1R22 A;  2VI6 A;  4F52 A;  2EFQ A;  4H0E A;  4PJJ A;  3F6O A;  4M72 A;  2Q2E A;  1V3F A;  1XGS A;  2E5N A;  3OYM A;  4S04 A;  1IDY A;  4DZP A;  1O3T A;  3PO2 J;  1FP2 A;  2K9N A;  3U21 A;  1BR4 A;  3HOY J;  4E7S A;  2NOJ B;  1B4A A;  4YFN F;  4NC7 A;  2ISY A;  3CMM A;  2UUZ A;  1SFX A;  5CVR A;  1R71 A;  1B72 B;  2KT0 A;  2A6H F;  2W25 A;  1CQT A;  5HLT A;  3FHZ A;  4NBQ A;  1X3Z B;  4XLH A;  2LC2 A;  4PCQ A;  3ZQI A;  5JHU A;  2IS1 A;  4L9T A;  2GIZ A;  1K4T A;  3BR6 A;  4PDK A;  3G3Z A;  4PFO A;  3I0T A;  4LOC A;  2ZO4 A;  5HVQ C;  4C30 A;  2P7C B;  3CCV I;  1HDP A;  3UKG A;  2K9M A;  2OD5 A;  3OOP A;  5LHI A;  4AWX B;  3BR2 A;  3QAH A;  3CJQ B;  3ZPL A;  4IQJ A;  2W4S A;  2KFD A;  4BAY A;  1FY7 A;  4IHX A;  2PJR A;  3IC7 A;  4A3B J;  3FM3 A;  3PQK A;  4F55 A;  1PUF B;  1VI0 A;  2V79 A;  2A69 F;  1IV8 A;  1MBG A;  4KMU X;  5LBQ A;  2WA0 A;  4BL0 B;  4OU0 A;  3BT9 A;  1V5G A;  3DP7 A;  3AFH A;  1E3P A;  3IWF A;  1LUJ B;  2DT7 B;  1NH3 A;  2UV1 A;  1T98 A;  4BHP A;  3FBN B;  4KN4 X;  4EEF G;  3ZXS A;  5HOD A;  3GLX A;  1R23 A;  1RPW A;  5IP7 J;  5E3N A;  2BW3 A;  2K9L A;  1WJE A;  2F5F A;  2XAU A;  1V55 H;  3KP2 A;  3O2P E;  3V7R A;  1R5I D;  2IS6 A;  4MTD A;  2E35 A;  4G6Q A;  2DXI A;  2XDV A;  1KON A;  2IEK A;  4LMY A;  2WY8 Q;  4LD5 A;  3E6M A;  2DT5 A;  2QA4 I;  1T8I A;  4XLE A;  1JHF A;  4LG0 B;  4I09 A;  2EBI A;  3AG1 H;  1DU6 A;  4XBF A;  1J0R A;  4XID A;  1EF4 A;  4L9J A;  1ZGW A;  1Y39 A;  3EET A;  5FKO A;  4ETS A;  4DZJ A;  1S8N A;  5EGO B;  1OCR H;  3WHB A;  2FE3 A;  4II2 A;  4BQO A;  3F8N A;  2LRD A;  3QPL A;  1Y1V J;  5DDG A;  3CQZ J;  2R5Z A;  4A6D A;  3E1S A;  3CCE I;  2CMP A;  5L3F A;  1SAU A;  2XRO A;  3BPV A;  2RV8 A;  4NQW A;  1Y0U A;  4IXA A;  3OIQ A;  3E3V A;  5CQG A;  3ZQF A;  4WCG A;  2HPM A;  2QSG X;  4ON0 A;  2A61 A;  3CCU I;  1DP7 P;  3D5L A;  1MJ9 A;  4KT5 C;  2XB5 A;  4G7H F;  2HQN A;  3QYE A;  1E3O C;  1JHH A;  4ZDP A;  5B66 C;  3IWZ A;  1BI0 A;  1D0Y A;  3K2Z A;  5HNF A;  1B8I A;  3ZN1 A;  2KIQ A;  3REO A;  2ID3 A;  1R4N B;  1J75 A;  3K9T A;  1QQI A;  3FXL A;  1LDK B;  2Q0O A;  1IF1 A;  1V54 H;  4GYI A;  4P9F A;  3A01 A;  3OIO A;  1YLF A;  2K4J A;  3A0H C;  2CFX A;  3W2W A;  3JRG A;  2R5Y A;  3F9K A;  5K7H A;  2X4H A;  4IF4 A;  1QHH D;  1KYW A;  3QOE A;  4M9Z A;  4A3G J;  2EV6 A;  2MAB A;  3RZD J;  1MMN A;  2FBK A;  2CUF A;  3AG3 H;  1QBJ A;  2VC1 A;  3TQN A;  3PNT A;  1JKP C;  3U1K A;  1FOX A;  5FRO A;  1OJL A;  3CMY A;  3NAU A;  9ANT A;  2VL8 A;  1FYM A;  1OYY A;  5ILV A;  1IRG A;  4Y17 A;  2IW5 A;  1WKM A;  2OPT A;  3GTJ J;  2IA2 A;  4BDY A;  4G8X A;  3J7Y J;  4BJT A;  4G7Z F;  3DPT A;  3GTO J;  2I5U A;  2W7N A;  4UVB A;  1H89 C;  1N78 A;  1GXQ A;  2HGC A;  5FD6 A;  3VPR A;  3F23 A;  1XTA A;  1MGT A;  3HGG A;  3GLL A;  2EIK H;  4RB1 A;  5DYM A;  1P4A A;  2Y48 A;  5EZG A;  5ICC A;  5J1R A;  3OYH A;  3ULQ B;  1WSU A;  2WV0 A;  3LOC A;  1UCR A;  4QTR A;  1MH4 A;  5BPD A;  3L2W A;  1ETV A;  2OAZ A;  1MMG A;  4HNU A;  2HKO A;  2H6B A;  2KDO A;  5HDG A;  2MG4 A;  2R7D A;  1ZYR F;  3GW2 A;  1X2M A;  3A4C A;  2ZFW A;  4F3Q A;  3GYH X;  2CRG A;  2M0C A;  1J2X A;  1OR7 C;  2LFB A;  2M2E A;  2BE5 F;  1RUN A;  3H35 A;  1PYV A;  5BNG A;  5D5W B;  2E34 A;  1R49 A;  2P6T A;  1GVJ A;  5FB2 A;  3MMY B;  2KRH A;  2HFH A;  4HDV A;  1T2K A;  2UXN A;  2ZNY A;  3CCR I;  1BR2 A;  1I1G A;  4BY7 J;  1N75 A;  3GFJ A;  1LFU P;  2Y0S A;  3F8B A;  2D5V A;  1YRN B;  3A02 A;  3E5Q A;  1A35 A;  3H0G J;  3KPH A;  3OYN A;  3PO3 J;  1CF7 B;  3DTK A;  3LSR A;  3GBG A;  4EAT A;  1VQ6 I;  2MA3 A;  2DBB A;  2E7X A;  5GPA A;  3EYI A;  2J5O A;  2BOL A;  4I01 A;  4R1H A;  2P7V B;  4ZTF A;  1I39 A;  2K27 A;  2X6O A;  1STZ A;  5BQT A;  2FEZ A;  5CJ9 A;  2WB1 N;  2RAE A;  1LVA A;  1F5T A;  3WE2 A;  3JRD A;  2BZT A;  4LK0 F;  3L1P A;  1O7L A;  4HF2 A;  2P4W A;  1Z3X A;  1G8X A;  4BKX A;  4E7I A;  3HRU A;  2DFF A;  3FXM A;  5HNH A;  4BEH A;  1QZE A;  3DFG A;  2C6Y A;  1FBQ A;  3TP0 A;  3RPU A;  2CYY A;  5D8K B;  3ZQL A;  3OS0 A;  4ZC3 A;  2ZJP F;  3PNY A;  4G6T B;  2IA0 A;  5D5X B;  4CH7 A;  3LSI A;  2VPL A;  2PN6 A;  4YEJ A;  4I6Z A;  4R8H A;  2QQ8 A;  2O03 A;  3OYI A;  2DI3 A;  3GCM A;  3F3X A;  1EH7 A;  2DTZ A;  1Q1H A;  2P5L C;  1WH7 A;  4U0V A;  1SFO J;  3GXO A;  3FBI B;  2NVX J;  3QP5 A;  2EFN A;  1MBF A;  1SFU A;  1Z7L A;  3A2K A;  3M1E A;  2TCT A;  4KFC A;  3GVA A;  4CCM A;  3GTQ J;  2TRT A;  3LA7 A;  2HZT A;  3EUK L;  1TTY A;  2W00 A;  4FX4 A;  4ABZ A;  3CLQ A;  2LBF A;  2O5R A;  5F64 A;  1PP8 F;  5DUK A;  1POG A;  4U0Y A;  3GF2 A;  2R7Z J;  2ME0 A;  4BXF A;  1W7P A;  1XB4 A;  1EH8 A;  2IS2 A;  5J4V A;  3BY6 A;  3WTU C;  3HSR A;  4BE1 A;  3K2A A;  5J1Y A;  2XB0 X;  3LSJ A;  2DCE A;  2E60 A;  3HOT A;  1WPK A;  4E7J A;  1R7J A;  3FF5 A;  3K4B A;  3SXY A;  3K4J A;  2LOO A;  3IAS 2;  3TO7 A;  3K6G A;  5ILU A;  3HKZ A;  3BG6 A;  1RES A;  2XIG A;  3ERM A;  3ROU A;  4RB2 C;  4B44 A;  2K5C A;  1LKX A;  4PK4 A;  1K78 B;  2P5K A;  5H20 A;  1RR7 A;  1X4O A;  1D1C A;  3K4M A;  1YIT I;  1R36 A;  4LIT A;  5D4R A;  2VOP A;  5FKN A;  1JT0 A;  1J09 A;  1BC8 C;  4EVI A;  1L3L A;  4M6V A;  2RQQ A;  2VBZ A;  2UWM A;  2RDP A;  3B02 A;  4X1E A;  2RVC A;  3DF8 A;  1P4X A;  5JHF A;  2IGM A;  2KRF A;  3CDL A;  3G2B A;  3SQN A;  3IL2 A;  2WAF A;  2F6C A;  5KAF C;  4B3A A;  4DBQ A;  2WTE A;  1EKE A;  1VF9 A;  2M4G A;  1SAN A;  1KYZ A;  4BQN A;  1OFC X;  3ZP5 A;  1AOY A;  2ZKZ A;  1VTN C;  4GRI A;  2CW7 A;  3F0C A;  4YFX F;  1FPQ A;  1R1T A;  2VQL A;  5K1Y A;  2AXL A;  2YPR A;  1RR8 C;  1ACI A;  2VKH A;  3BJO A;  1MZB A;  1UFM A;  4J01 A;  2VUM J;  2Q8K A;  2ZFU A;  2JK3 A;  1TQI A;  3GO5 A;  3BTJ A;  1XD7 A;  3LQQ A;  1BI3 A;  3ABU A;  1LFB A;  3L2V A;  4LIU A;  2YU9 J;  1JKQ C;  3HC7 A;  3SEQ A;  5ICF A;  4EJU A;  3O3K A;  1TQM A;  1VQK I;  3IH3 A;  4IL6 C;  3TGN A;  4HSR A;  3W6J B;  2M30 A;  4P9U A;  1JGG A;  3RIR A;  5IT9 K;  1B72 A;  2QGU A;  2R7U A;  2H94 A;  3SZT A;  4YII A;  4IHT A;  2CQK A;  5EG0 B;  3ABT A;  3E6D A;  1SFK A;  2PMH A;  4KYW A;  3MCZ A;  2XPW A;  4UHT A;  3I55 I;  1MKM A;  1XMX A;  1PVE A;  2QQB A;  2R3S A;  3KZI C;  2A05 A;  5CKT A;  1OYW A;  3J80 K;  2ZJQ F;  1XSD A;  4KDP A;  1SC7 A;  2EIM H;  3OYE A;  3LA3 A;  1R6R A;  2IBD A;  3PUF A;  5DM6 F;  3K4K A;  1HW2 A;  1IDZ A;  2KRC A;  3ASO H;  1XX5 A;  3SEZ A;  1HF0 A;  2CO5 A;  5E1W A;  3RI4 A;  2QVO A;  2BHZ A;  1PUF A;  4XLP F;  5EF6 A;  4XIC A;  1JUS A;  3KLO A;  1WJC A;  4XM3 A;  3CDI A;  5E20 A;  1IG7 A;  5ED4 A;  2WC2 A;  3GZ5 A;  3KE2 A;  2IJL A;  3ZOB A;  2V1U A;  1EV7 A;  3BLY A;  2V4J C;  1FYL A;  1LNW A;  2E1C A;  3E5U A;  2IGK A;  2MC4 A;  2JWT A;  1Z91 A;  2DN0 A;  3KYC B;  3HZJ A;  3TBI A;  4XN0 A;  2CW0 F;  1YS6 A;  1ORK A;  1T39 A;  2EIJ H;  4M3E A;  5D8L B;  4W97 A;  3CCS I;  3G1M A;  2Z1D A;  2JA2 A;  4WXD A;  4E7Z A;  3ZQQ A;  1ETO A;  3IHU A;  1M1E B;  4QSH A;  4LG0 A;  3V8K A;  2Y0M A;  1X1B A;  3JR9 A;  3OYA A;  5IP6 A;  3X2Q H;  1YFH A;  4AVZ A;  4BBS J;  5EGO A;  1G2H A;  1Z77 A;  1P4W A;  2V9V A;  3I71 A;  1S29 A;  2I8D A;  2QLZ A;  4OAY A;  2LH9 A;  1W5C C;  4ITV A;  2YX4 A;  3M8E A;  3SJM A;  5F0H A;  3S1N J;  3CD6 I;  4B1R A;  3ZQC A;  3V8L A;  3WGH A;  2H27 A;  3NQO A;  5F0C A;  2MYS A;  4AU7 A;  2M8G X;  3W6V A;  3FHN A;  3KEY A;  2LVS A;  2BY2 A;  3OYK A;  3E5X A;  4WXC A;  3OY9 A;  2GLO A;  4LLN A;  4AIH A;  2KHM A;  1ETQ A;  4UUV A;  1U8B A;  3F6V A;  4KIT B;  1O3Q A;  1BOA A;  2XV4 S;  1HLV A;  1QHG A;  3DBR B;  4M9X A;  4DYC A;  3DKX A;  2VJ4 A;  1RZ4 A;  1SMY F;  2RNJ A;  4ZYE A;  3IRQ A;  3KZZ A;  3TO6 A;  4MEX F;  3FMS A;  4Q47 A;  4U7D A;  1TT5 B;  3G1O A;  1ERD A;  2K3F A;  4CYC A;  2MFZ A;  2VXZ A;  4OIP F;  2JT1 A;  3BPX A;  3I59 B;  2O8X A;  2CSO A;  1YIO A;  1HKQ A;  3BG5 A;  1V5E A;  3H36 A;  4DJA A;  2GXB A;  2ELJ A;  2XAQ A;  1TZL A;  3CZ6 A;  2A5W A;  2L01 A;  4MFE A;  2DJI A;  2PX9 A;  3EUH C;  4B47 A;  1YOV B;  1VQ8 I;  2Z33 A;  4ZDO A;  2L9R A;  4ZYH A;  1D0X A;  3E6B A;  1TWF J;  2DFE A;  3ABL H;  4GDF A;  5CPR B;  1NK2 P;  4KIG A;  4MQV A;  2EA2 A;  2QEX I;  2V9K A;  2HTS A;  5D6E A;  1XCV A;  4IX7 A;  4KUM A;  5L3D A;  3F22 A;  1TL8 A;  2EK5 A;  3FM5 A;  5LGU A;  3EQL F;  3FK6 A;  5DUI A;  4D5F A;  4EJV A;  4KA4 A;  1B9M A;  4U88 A;  2QBY B;  5LFA A;  3P5J A;  1VQL I;  6PAX A;  5JI6 A;  2L2O A;  4A93 J;  1VQN I;  4KIS A;  1T0F C;  1X2N A;  1SD5 A;  1J5Y A;  2Y30 A;  2EZK A;  3GZN B;  2HU9 A;  3HPH A;  3HGY A;  1BJA A;  5A2Q Z;  1GT0 C;  1Y1W J;  1ZLK A;  3OYD A;  2K85 A;  1PP7 U;  3DXJ F;  5FKL A;  4P96 A;  4HF1 A;  3OYF A;  4C2M J;  2LNB A;  2JSC A;  2DU9 A;  5CYV A;  3IH2 A;  4KMF A;  4JBA A;  3RTR A;  4A5N A;  2XUB A;  1E2X A;  2H6C A;  2FJ1 A;  4IQ4 A;  1B9N A;  1LDD A;  1OCO H;  2X1E A;  4CCO A;  2ZJR F;  2PQ8 A;  3D5R C;  3I9V 2;  3C2G A;  4XNF A;  2STW A;  2R92 J;  2M3A A;  3WU0 A;  4E7L A;  4G9Y A;  1AHD P;  3H5A A;  1YRN A;  3SZG A;  5KCM A;  2F2E A;  3H1C A;  4M74 A;  1TWH J;  3RYR A;  1CF7 A;  2HDC A;  1ONV A;  3H9J A;  1KA8 A;  1H8A C;  2XF6 A;  1VQM I;  1XDU A;  1XDS A;  1HBX G;  2E7W A;  4NDL A;  1AKH B;  3CES A;  1X1C A;  2G7U A;  3K4L A;  1S6L A;  4RB0 A;  3GFL A;  3WTZ A;  4S0H B;  1IC8 A;  2FQ4 A;  3HB9 A;  3GTG J;  1B59 A;  2W48 A;  2NNY A;  2EIL H;  4C9Y A;  3NAR A;  4BXX J;  4P55 A;  5TJJ A;  4M9S A;  1F4K A;  2DFI A;  2LTP A;  1TWC J;  3TO9 A;  4F91 B;  1NK3 P;  3AKZ A;  4EQQ A;  4P5O A;  1J7K A;  4KJZ A;  2Y0S N;  3M8F A;  5CVV A;  3OWT A;  3GX4 X;  3Q5F A;  2K02 A;  1UB9 A;  2V26 A;  2VT3 A;  2R7R A;  2A07 F;  3SFZ A;  1RC9 A;  1XGN A;  4AIK A;  3J81 Z;  4ZYA A;  4FTH A;  3S15 J;  1NTC A;  3TW7 A;  3V8J A;  5LHG A;  1Y8R B;  4XR6 A;  5KNL A;  4PJ0 C;  2R7F A;  1VQ7 I;  1OCZ H;  4MQ9 F;  4RDU A;  3LAJ A;  1LEB A;  1XMA A;  1H88 C;  2VJI A;  3DLL F;  1AU7 A;  3J7Z I;  1HQC A;  4EJT A;  4XRS A;  1XN7 A;  1RKW A;  1S3J A;  2FBH A;  2M8E A;  4A3C J;  1WVR A;  4CZZ A;  5L3E A;  4FET A;  3G71 I;  1WZ2 A;  4HST A;  1FSE A;  3IH4 A;  2VKV A;  3GME A;  2L9N A;  2LR8 A;  2VE8 A;  1OR7 A;  1P7I A;  4AUX A;  5FKK A;  5J4Y A;  4BNC A;  2LK2 A;  1IW7 F;  2AO9 A;  4CYD A;  4UXN A;  2GA1 A;  1P7J A;  3S1R J;  1IN5 A;  3BP8 A;  5H2F C;  5E3M A;  4I0A A;  4D1Q A;  3GEZ A;  1WH5 A;  1Z0X A;  2GWR A;  3QPS A;  2E2J J;  4CZC A;  3FIS A;  5L3C A;  4XRF A;  2HEO A;  1K78 A;  5K5Q A;  4BQQ A;  2ADU A;  3GTM J;  5CLS A;  1WJF A;  5CQE A;  4QPO A;  3BQY A;  2OQR A;  4WK8 F;  4OOI A;  1PDN C;  4FCY A;  4BQA A;  2WAQ A;  3HRT A;  3HRS A;  5B1B H;  2IGN A;  4YEL A;  2M1B A;  2QKM B;  1F43 A;  3ZR8 X;  5D6F A;  1YJW I;  2PEX A;  3QQA A;  1YO5 C;  1SVL A;  3VOE A;  1WFX A;  2BVL A;  5B5E C;  3L2R A;  2DAO A;  3DLA A;  2ZNZ A;  4XLF A;  2TDX A;  3HOW J;  1MMA A;  4ESJ A;  5FRN A;  1P9Q C;  2L02 A;  3QYB A;  4XKB A;  5C44 J;  1ENH A;  2ZBK A;  2XSJ C;  2O8K A;  3L09 A;  5HDN A;  1U5T A;  4WF2 A;  2XPV A;  3HKZ N;  3H5N A;  5DM7 F;  5FLM J;  4UUS A;  4G12 A;  2R7T A;  2HZD A;  5J8C A;  2CS3 A;  5FRM A;  1N25 A;  5KVR A;  2EIN H;  4HNT A;  1FT9 A;  3H0D A;  5EDN A;  2I10 A;  5EG0 A;  1FMV A;  5HOO A;  1TNS A;  3J7A O;  2J5P A;  1ETX A;  3RKY A;  3U9G A;  3WE3 A;  3OS1 A;  4ENK A;  2VOO A;  5C4J J;  1J59 A;  4M6Y A;  1QVT A;  1S7O A;  3FXU A;  3G6E I;  2L4A A;  2X6X A;  2A5Y B;  4HPQ A;  2OA4 A;  2OCE A;  2QKL B;  2EJR A;  2W82 A;  3TDZ C;  1U8R A;  1WJ5 A;  3OMY A;  3RSN A;  4AID A;  4A3M J;  4PGG A;  4QPQ A;  1MJA A;  1FLI A;  4M6X A;  2R93 J;  3L2U A;  4OIN F;  2HDW A;  2XVC A;  3ZMV A;  2JA7 J;  2X6W A;  1XC5 A;  2JN6 A;  2L9V A;  2JA5 J;  1XGM A;  1D1B A;  4L9N A;  3TMO A;  5B3S H;  3PQJ A;  1ZTR A;  3OYG A;  4BXU A;  4HG2 A;  3TKY A;  1U78 A;  3N05 A;  1H0M A;  1HW5 A;  2CWE A;  4UNO A;  2STT A;  1X1P A;  3DV8 A;  3NRV A;  4MGR A;  1YW7 A;  2AQE A;  1QA6 A;  2HYJ A;  3CUQ C;  3OYB A;  4A3D J;  4B43 A;  1ZAR A;  1ZLJ A;  4M3B A;  3WTS C;  2DA1 A;  2BGC A;  1XMK A;  2ZJ2 A;  2DOF A;  3OR2 C;  5F6F A;  2DMU A;  5IYB J;  4B8X A;  3OYL A;  3IKT A;  4NC8 A;  4BU2 A;  3LSM A;  1R58 A;  2DLL A;  3CDH A;  3CC2 I;  5M3F J;  5IYD J;  3Q0U A;  1KGS A;  2JSP A;  3I4P A;  3E0J B;  2LF7 A;  3T8T A;  3DTI A;  4NNJ A;  2HPI A;  5LRS A;  3DBL B;  1XCB A;  2M5W A;  5FLV A;  3KP4 A;  1O57 A;  3CJT B;  4PFP A;  1C0W A;  1AWC A;  3HL2 A;  1YIJ I;  4II3 A;  3ZN0 A;  4BDZ A;  2R7S A;  1TNT A;  3AG4 H;  2QYO A;  3I5U A;  3K4C A;  3MEX A;  1NG6 A;  1IUY A;  2FBI A;  4HYE A;  2CG4 A;  3IKV A;  1HCR A;  2AQF A;  5HS7 A;  1ZN2 A;  2L54 A;  3HSF A;  3C1D A;  1BI1 A;  1LVK A;  4Y52 J;  2VQC A;  4A2U A;  3RKQ A;  2P81 A;  2QF7 A;  2JUC A;  2L7M P;  1FTT A;  1FC3 A;  2LKS A;  1TP4 A;  4CCK A;  4CCJ A;  3CCM I;  2LKX A;  3I59 A;  4CHU A;  1K6Y A;  4LLL A;  2HYF A;  1ZG3 A;  4CCN A;  2V6E A;  2JQ7 A;  3K70 C;  4A3K J;  1WGX A;  4MO7 A;  2OTL I;  4OIR F;  3LWF A;  3P7N A;  1FWZ A;  3A03 A;  4FE4 A;  4EGY A;  1LE8 B;  1RUO A;  5FKM A;  2DA3 A;  2JRM A;  1YYV A;  2Y2Z A;  3MVP A;  4XKW A;  3C2H A;  2HQ5 A;  1KQ9 A;  3D1N I;  2DW4 A;  4M3G A;  3LFK A;  4X0G A;  2R7V A;  3FWE A;  4I2O A;  5J8F A;  3RKX A;  1PUE E;  4OAZ A;  3HTS B;  4PSW A;  2VIX A;  4MIM A;  2FF4 A;  3BCA A;  5GAE J;  3WTX C;  4IVN A;  3RYP A;  2IS4 A;  1T56 A;  5D5V B;  1W0T A;  1W5T A;  1ZAO A;  4D0P A;  2E2I J;  1CGP A;  5AON A;  4A3E J;  4FAS D;  2MSY A;  4ZH4 F;  3OV8 A;  3CUQ B;  2P0W A;  3DWL E;  3JRE A;  1TBX A;  4KT6 A;  2K9Q A;  2GBY A;  3HEF A;  3KFW X;  5B1A H;  1JT6 A;  2QWW A;  2VB6 A;  4XOR A;  2DA7 A;  2Q2E B;  2XAS A;  2X6Y A;  4RAZ A;  1OPC A;  4XOT A;  4I98 B;  3PL8 A;  4Y3O A;  1X58 A;  2MLK A;  2O7O A;  1FIP A;  3H9Q A;  3I3L A;  3QP6 A;  4HX8 A;  4RBO A;  2QSH X;  2R7X A;  2VE9 A;  3IV5 A;  2IAI A;  5J3L A;  3MAJ A;  2MD0 A;  2HOT A;  2DMP A;  4S05 A;  3F8F A;  2JPB A;  2P5V A;  4XSX F;  4X6A J;  3HUG A;  3ZQ7 A;  2K3P A;  3HM5 A;  4RMN A;  4ZZD A;  5ERI A;  1IZ1 A;  1PJR A;  1S7A A;  2OU2 A;  3JTG A;  2B0L A;  3GUD A;  2X9D A;  4CDG A;  5EJC A;  1OMI A;  2DYS H;  4Q5S F;  4C3I J;  4HBL A;  3ISP A;  2VLA A;  3FXQ A;  4CO8 A;  4PZJ A;  2CU7 A;  3BG9 A;  4XKV A;  1FNN A;  5EYR A;  2GIV A;  2UXX A;  2YUS A;  1IRF A;  5DEQ A;  1BM9 A;  1RET A;  2DMN A;  5DTD A;  3K69 A;  4EV0 A;  1Z05 A;  1G4D A;  2DFH A;  2HR3 A;  2L7F P;  3HYI A;  4EM0 B;  4Y13 A;  3VYS B;  4E70 A;  3ZMU A;  3K0L A;  1XS9 A;  4DW6 A;  2WAD A;  1OCT C;  1DDN A;  3T8R A;  3KZY A;  4BHC A;  3G4S I;  3EUH A;  1L0O C;  1GVD A;  1T6S A;  3O6B B;  1K83 J;  4FT8 A;  2HOA A;  3ZMT A;  4BJ6 C;  2PMU A;  3JRH A;  1QPI A;  1IRZ A;  1BL0 A;  2WWY A;  3S2D J;  2FX0 A;  1IGN A;  1WCM J;  1SD7 A;  4XLC A;  3LMM A;  5HS9 A;  2KPM A;  3PFY A;  1OLT A;  4N4N B;  3H9G A;  4PGH A;  3LL7 A;  3CJR B;  2ME6 A;  2VJ5 A;  3BTC A;  3CJN A;  2FQ3 A;  5LHH A;  1Z7U A;  1ZKG A;  2DDB A;  5FJ8 J;  3F8C A;  4ESF A;  2ELH A;  3AAF A;  5FLX Z;  1P92 A;  4AYB A;  4ZTJ A;  1KU3 A;  1O4X A;  1HSJ A;  2NRA C;  3R6S A;  5DD8 A;  2PMZ A;  4XQF A;  2DMQ A;  3DCF A;  1QPM A;  2JMW A;  1UG0 A;  2D45 A;  5J47 A;  4HF0 A;  3AG2 H;  5ILS A;  4F92 B;  4AVP A;  2VBY A;  4NUB A;  3I54 A;  1UMQ A;  2QQ9 A;  4BS9 A;  2IXS A;  3CTA A;  3E7L A;  1Z9C A;  1ZQ3 P;  3BRO A;  2V9P A;  2X48 A;  2MLG A;  1MD0 A;  2M7B A;  1B8I B;  2LMD A;  1LQ1 A;  3WGI A;  2KDZ A;  1OKR A;  2XRL A;  1DGW Y;  4IHV A;  1TWG J;  4N4O B;  3CF5 F;  2AXT C;  5LGN A;  3IAM 2;  4E6K G;  5IYC J;  4CIC A;  1JJ8 C;  1DU0 A;  4H4K C;  1FP1 D;  5KAI C;  3W2V A;  2MD5 A;  1HW1 A;  4RAG A;  1U0J A;  1QRY A;  2NYX A;  4L5E A;  5HLG A;  1JTX A;  4Y33 A;  2Z5U A;  2EFO A;  4IRH A;  1JGS A;  1MW7 A;  4F93 B;  1UJ8 A;  2HS5 A;  5E8G A;  5EZH A;  4ASN A;  4LFU A;  1GLN A;  3OL3 A;  2DO7 A;  4V2G A;  1W1W E;  2E19 A;  4QLC U;  1T95 A;  1OCC H;  4YRV A;  1U6G A;  1Z6R A;  1R1V A;  3KX2 A;  4FIS A;  5BOX A;  3C2B A;  2HI3 A;  2NAZ A;  1FJL A;  3LNQ A;  4V19 K;  3SYT A;  3BTI A;  1H9G A;  3CF2 A;  1VFC A;  2CH0 A;  3QOP A;  2X0L A;  5IT9 Z;  2HQA A;  1F9N A;  1IO2 A;  1K4S A;  1LB2 A;  1FIA A;  3FX3 A;  2M87 A;  2GM4 A;  2JRT A;  2K7L A;  2XGE A;  4BYY A;  2VQG A;  1R4M B;  2OZ6 A;  1W4M A;  3M1C A;  3F21 A;  1K7A A;  4XOP A;  3H3U A;  4UUT A;  3LSH A;  3M9A A;  2WAQ N;  5CVU A;  3COA C;  2HXI A;  4LGW A;  3V7C A;  5M3M J;  4CXF A;  4HA8 A;  2ZXH A;  2OTJ I;  2IPQ X;  2LF8 A;  4AIJ A;  1Y56 A;  3I53 A;  2EPF A;  3ASN H;  1IXS B;  4Z6Y A;  1I5Z A;  3RDI A;  1EA3 A;  2RC4 A;  2WAE A;  3HPG A;  2A3S A;  4LG3 A;  1YQA A;  2CQX A;  3HJE A;  4GCV A;  1EJ9 A;  1UHS A;  1S5L C;  2VBW A;  3JAM K;  4BAC A;  3RJP A;  5HLH A;  2HTJ A;  1U9N A;  2VXD A;  2PBI A;  5M5W J;  5GAD J;  1R5H A;  2Z9O A;  5LRR A;  2DPD A;  4EGZ A;  2GOX B;  4NC6 A;  4RA2 A;  4LB6 B;  2QQA A;  3ECO A;  1MBE A;  2OV7 A;  4MTE A;  2W24 A;  1MND A;  2EZH A;  1FOY A;  3ZCO A;  3S17 J;  3L9F A;  4FQG A;  4C3J J;  4ZYG A;  1ITY A;  2RRE A;  3KP3 A;  2X1D A;  3VEP A;  3HOV J;  1NG7 A;  1ZR2 A;  2CGP A;  3QPH A;  4I02 A;  3K1P A;  3LSG A;  1ZG5 A;  3WG7 H;  4DYR A;  4E7H A;  3A1Y A;  3B6A A;  4ESB A;  3H92 A;  1HA8 A;  4D5C A;  1DP3 A;  1E17 A;  3RCO A;  4D9J A;  3UNG C;  3QU3 A;  3V42 A;  2DPU A;  1Y8Q B;  4M3F A;  1MMS A;  2P6S A;  4BHB A;  3C18 A;  3LSK A;  5IPA A;  3HOZ J;  2CQQ A;  4L9V A;  1GV5 A;  2XF7 A;  2HNH A;  4HAM A;  5E8I A;  1ZRC A;  2V1D A;  4DQ2 A;  4GO1 A;  1W36 D;  3BQZ A;  1MBK A;  3PUB A;  2EFP A;  2D1V A;  5F1J A;  4A3J J;  3FKI J;  3GTL J;  2H8W A;  1USS A;  1ODD A;  1ZG1 A;  4QWQ A;  4HV6 A;  4LIV A;  3U2R A;  2YSR A;  1YW9 A;  4JX6 A;  1IN6 A;  2XGD A;  2R7W A;  4IRG A;  2ZME C;  3S8P A;  5GP9 A;  4IOA F;  1WI3 A;  2ZSH B;  2PG4 A;  3VYT B;  3BR0 A;  5CVI A;  1A6Q A;  3V7S A;  2MW8 A;  2ZSI B;  3BZK A;  3KP5 A;  5BPI A;  2NS7 A;  4J00 A;  2DT6 A;  1YX5 A;  3HBL A;  1U2W A;  4BY1 J;  4A0X A;  5L3G A;  2KJC A;  1TW2 A;  3HOS A;  2FXA A;  1DQU A;  3TL4 X;  1YX3 A;  2L9S A;  1W7P B;  5JR3 A;  3LQR A;  3Q9S A;  3FZV A;  3P9I A;  4K2E A;  3V4G A;  3HTU A;  3TP3 A;  4BJ5 C;  1XGO A;  3HHG A;  1P2F A;  3K70 D;  5C3E J;  2K86 A;  4JOM A;  1EH6 A;  2KIU A;  3DPU A;  2KZV A;  3OOU A;  3FIW A;  2R4G A;  3I4M J;  5EEG A;  3W6K B;  1SVO A;  1YW8 A;  5ICE A;  4RLQ A;  2IGO A;  2FNP A;  2QSF X;  3K10 A;  1ZHF A;  3MWM A;  2CJJ A;  5IP9 J;  4N9H A;  1ETK A;  3S2H J;  1P6R A;  4YG2 F;  2L5Q A;  4LLG F;  1OIS A;  4JQF A;  2Z2S B;  2MH2 A;  3JRB A;  4XLN F;  3VDX A;  2HVR A;  1SMT A;  2F4O B;  1SEU A;  3H3V K;  2VAS A;  4HW0 A;  2GAU A;  2QZ8 A;  4IRI A;  1TLH B;  1XSV A;  5GPC A;  1LPQ A;  1G6N A;  4IO9 F;  4ENN A;  2GA2 A;  3Q0V A;  1OCP A;  2LG4 A;  2ECC A;  5J1U A;  5F1R A;  1MH3 A;  2M9H A;  4HRI A;  4EM1 A;  1OQY A;  3CUQ A;  4HLY A;  2RGV A;  2Y31 A;  1O3R A;  3BCB A;  3PJR A;  2LSO A;  4Y4R A;  2DA4 A;  5F0F A;  2LY2 A;  1JI8 A;  3K4N A;  4V2F A;  2BY0 A;  2W85 A;  2VPR A;  1K6O A;  1D1A A;  4B09 A;  4KIF A;  4CGZ A;  2OF7 A;  2IA1 A;  1A04 A;  4HQM A;  2OQG A;  5DCM B;  4U87 A;  2O3F A;  4I76 A;  1U3E M;  3KP7 A;  3D5S C;  3GFI A;  5JLW A;  3HOX J;  5KK1 A;  2JPC A;  4UVC A;  2E71 A;  3O8H A;  3ESW B;  3M7G A;  1K61 A;  4QIW N;  1KQ0 A;  4D7M A;  2ZME B;  1JJ6 C;  2IT0 A;  1BIB A;  3ML6 A;  3DTE A;  4HQE A;  4HEA 2;  2NXN B;  2A6E F;  2DOA A;  2X1C A;  4PJM A;  2XSD C;  1JE8 A;  3SFI A;  2ESH A;  1IRX A;  2KIS A;  4FHT A;  3G1L A;  5E18 F;  2BXY A;  2GXA A;  2HWV A;  1O7F A;  2XAG A;  1GXP A;  4JP0 A;  2JUG A;  1R1U A;  4HX4 A;  3OIP A;  4ZZL A;  3CO7 C;  3DU5 A;  3BDD A;  5AIP A;  4A0Y A;  2JTV A;  2XGC A;  1KU2 A;  3MN2 A;  2JJ7 A;  2YS9 A;  2EZL A;  2ID6 A;  3PIP F;  1WWX A;  5JLX A;  2BVM A;  3LSP A;  5DS9 A;  1WJA A;  1SD4 A;  2YX7 A;  4RGX A;  3CCL I;  2OCC H;  3I58 A;  2PI0 A;  2HOS A;  1TW3 A;  3EUA A;  4M73 A;  2HYG D;  2LP0 A;  3CP2 A;  3W3C A;  3VSL A;  2ICW G;  4XRM A;  1S72 I;  3KCC A;  4I7H A;  2W1O A;  1G59 A;  2FA5 A;  3FDY A;  3CUO A;  4O6J A;  1ZK8 A;  4G7O F;  3QYF A;  3ZQH A;  1YJN I;  3BJ6 A;  2VC0 A;  1VQ5 I;  2XAJ A;  2KJB A;  4Y15 A;  3BZ6 A;  3DEE A;  2H8R A;  2OC6 A;  3CCJ I;  1XG1 A;  1B6A A;  1BIA A;  5E1X A;  1YTY A;  2FMY A;  1I50 J;  2NS8 A;  3QU6 A;  3OSF A;  1X3W B;  4LB5 A;  1H9T A;  2EH3 A;  2Z99 A;  1BI2 A;  1WHU A;  2BHY A;  4GGG A;  2KKO A;  2XAH A;  4A5M A;  3G73 A;  1JKR C;  3BR1 A;  3R4K A;  1IXC A;  2DOD A;  3I56 I;  2EQR A;  2E1N A;  2KZG A;  3PSI A;  5E79 C;  3SZP A;  3JCU C;  5C4X J;  3PIO F;  1MDM B;  1A6I A;  1VZ0 A;  1MNM C;  3DEW A;  3DBH B;  3WTW C;  2DDA A;  2NVU B;  4RB3 C;  1IUF A;  5K7Z A;  4A12 A;  4OMY A;  2MBF A;  2FNA A;  2NNN A;  3K1M A;  4P1W A;  3CCY A;  4IJA A;  4CYC B;  2BXZ A;  2JA6 J;  3HHH A;  5IT3 A;  1JUP A;  1WRJ A;  2F5V A;  2G7H A;  4DIQ A;  3RPU D;  4AYB N;  2CFO A;  4DYQ A;  4Y7N J;  3DPL C;  4HOB A;  1G3W A;  1BJZ A;  1DPR A;  1VQP I;  2PMZ N;  2JZY A;  4M71 A;  1HXD A;  1E0E A;  2HQR A;  3ECH A;  3MD2 A;  4DBR A;  3IP4 B;  2XGX A;  3EPZ A;  3RQ4 A;  2R0Q C;  4OIO F;  3VYU B;  2Y69 H;  1FEX A;  1D8J A;  3NEU A;  4YIF A;  1DUX C;  2XC7 A;  1GUU A;  3HIF A;  4LJZ F;  3CC4 I;  3S3M A;  5J6X A;  2V6C A;  2Z3Y A;  3EDP A;  1LDJ A;  5DV5 A;  4A0Z A;  5GAG J;  3WU1 B;  3LAP A;  4HDU A;  4M3D A;  1W36 C;  3AL0 C;  1MSE C;  4TV7 A;  5DCF A;  2KP6 A;  2BEO A;  4OWR B;  2CUZ A;  2DJN A;  3C3W A;  5CVJ A;  5EEH A;  3JRA A;  1F1Z A;  4RAF A;  4XK4 A;  2F4I A;  3RQI A;  1XSX A;  5E1Z B;  2VN2 A;  3SDG A;  4BH9 A;  3KEQ A;  5BS6 A;  2W84 A;  3S2W A;  1W7P D;  5BMZ A;  3R0J A;  4HLX A;  1O3S A;  2L7K A;  2LKP A;  3PM1 A;  5J40 A;  4RGU A;  5M5X J;  2M45 A;  2BV6 A;  4I99 C;  2ELK A;  3HG9 A;  1HDD C;  4XON A;  1FSH A;  3BZC A;  2COB A;  1UG2 A;  1BW6 A;  2DOE A;  4CA0 A;  1UEL B;  4G94 A;  2HVQ A;  2QCO A;  4ANJ A;  3S1Q J;  1A5J A;  1FBS A;  2K9S A;  4UV9 A;  2VKD A;  3ZMD A;  3CC7 I;  5FD5 A;  5TIS C;  1QZY A;  4BE2 A;  1GDT A;  2O61 A;  2X51 A;  3WG9 A;  3PSF A;  2RNG A;  3ZRG A;  3CME I;  1TC3 C;  3HSE A;  3T5X A;  2IRF G;  2QM3 A;  1Z21 A;  3MZ8 A;  1GV2 A;  3D0S A;  2CV2 A;  3T0Y A;  1VQO I;  1Z67 A;  2E1M C;  2RQP A;  3MKZ A;  4C3H J;  2FML A;  2XPU A;  5IOZ A;  2Y9Y A;  3B6C A;  2BYV E;  2DA6 A;  4HX7 A;  3S32 A;  4MFD A;  2H1K A;  3FMR A;  4CSW A;  2RKH A;  2OZU A;  2MGQ A;  4YIR X;  4JX5 A;  3SDB A;  1I3Q J;  1MNE A;  2R7Q A;  2FD5 A;  2LLK A;  2Y75 A;  2QBY A;  1Q1V A;  2AS5 F;  5LEK A;  1QO0 D;  2JVG A;  1IV6 A;  1UHM A;  3P9K A;  1DGR M;  2FUG 2;  1N77 A;  1REP C;  2ZXW H;  5JVG F;  1BA5 A;  2EFW A;  1ZRE A;  2V7F A;  1U5T C;  3QPT A;  2Q1Z B;  2W57 A;  1G3S A;  2DQR A;  2OBP A;  2ZXJ A;  1FMW A;  3CP8 A;  4KIB A;  5D4S A;  2H1L A;  4JYK A;  3WTV C;  3CLO A;  1OYI A;  5D5U B;  1AA7 A;  1JXS A;  3FKJ A;  3BJA A;  4A6E A;  3RZO J;  2UZK A;  3B73 A;  4YFK F;  2V1N A;  5TRD A;  4BBR J;  4JK1 X;  5M5Y J;  3UR3 C;  3AL0 B;  4CCL A;  3HDD A;  1U9O A;  2XKP A;  4BUP A;  4XKC A;  2WY7 Q;  2F48 A;  4XSZ F;  3IUO A;  3Q9V A;  1QNT A;  2DMT A;  1D3Y A;  3ZGK A;  5FLX K;  1RRJ A;  4IHS A;  2LRE A;  3C7J A;  3BG3 A;  2ESN A;  5L3B A;  4AC0 A;  2ETH A;  3NWS A;  1Z6T A;  5GTH C;  5JVT A;  2HVS A;  3KEO A;  2BY1 A;  2WBM A;  4NB5 A;  2GQQ A;  4L0Z B;  2ZCW A;  3S3N A;  1UHW A;  2E1O A;  4IPA A;  1RKT A;  1ETW A;  5DD4 A;  2A6T A;  5ICG A;  2CUJ A;  4RM3 A;  2HXO A;  2LY1 A;  3DQV C;  3S93 A;  1IJW C;  2JA8 J;  2M7A A;  1Y0N A;  4KIC A;  1NHA A;  3GTP J;  2PJR B;  4GFB A;  1KZH A;  1KQ8 A;  1E3H A;  1ZGA A;  2COM A;  1QVU A;  1ULY A;  1AKH A;  1K79 A;  4XRS G;  5EEA A;  1MJB A;  3R60 A;  1S7E A;  4XMY A;  2V1X A;  5H6Q A;  2ZB9 A;  2X85 A;  3F72 A;  3QWL A;  5HDK A;  3J7A Y;  1RI7 A;  4N9I A;  4UY8 I;  2PJP A;  3FXK A;  2DTR A;  2EZI A;  1I27 A;  1HKT A;  1HOM A;  4WXH A;  4F7Z A;  3OYJ A;  2KL4 A;  2B63 J;  1ZRF A;  1X1D A;  2BW3 B;  4B3X A;  1YG2 A;  2M0M A;  1ZGJ A;  2XKO A;  2KQR A;  1JUM A;  4PJN A;  3Q0W A;  2E1M B;  4DGW B;  1ZRD A;  3CMA I;  1HC8 A;  3BWG A;  1D0Z A;  5E3O A;  5GAH J;  5IOY A;  2CV1 A;  4O3M A;  2NVT J;  3TDU C;  3ZQG A;  4UB6 C;  1VQ9 I;  4GXO A;  1BOB A;  1MBJ A;  1QU3 A;  3WTY C;  1F36 A;  5KHD A;  3E6C C;  3BOQ A;  2FOK A;  3KIO A;  3LST A;  3VYR B;  5HLI A;  2BBY A;  3GTK J;  2QUF A;  2LY9 A;  2KIM A;  3OSG A;  2DA5 A;  2R5Z B;  2CV0 A;  3MKY B;  2B9S A;  4GYG A;  1T0F A;  3ZMZ A;  4ZYD A;  2GZW A;  3JRC A;  1U5T B;  1KU9 A;  2F5D A;  4RS8 A;  2O0Y A;  1WJB A;  4ZJZ A;  5K7F A;  5E17 F;  4NQW B;  4UUS B;  3F8M A;  2FRH A;  2VKE A;  3GZ6 A;  1V5F A;  5DCM A;  4HZF A;  3WGG A;  4G6D A;  3KP6 A;  3JSP A;  1UST A;  4ENJ A;  3MKL A;  4RGR A;  1IN7 A;  3FK7 A;  5F08 A;  2E36 A;  3PNV A;  3OR1 C;  4ENM A;  3TED A;  4PJL A;  2Y9Z A;  2EV5 A;  3TOB A;  3LA2 A;  1DPU A;  4E4H A;  1QZZ A;  1FOK A;  1WI9 A;  2ZME A;  3VB2 A;  2CW8 A;  1ZR4 A;  4B4C A;  1ZEL A;  1BR1 A;  2F5C A;  2NOG A;  4MHG A;  3WU2 C;  2FSW A;  2F4M B;  2IP2 A;  4DNC A;  1FYK A;  1T33 A;  1IN4 A;  3BC8 A;  3A01 B;  3W2A A;  4OIQ F;  4EJO A;  3KLN A;  1B1B A;  3JRF A;  2HKX A;  2R5Y B;  3R61 A;  3BG7 A;  3FMQ A;  3M8J A;  4BE0 A;  2DQL A;  4A3I J;  2D1H A;  2A68 F;  2P8T A;  1SFE A;  2OJE D;  4J19 A;  2XF5 A;  3MKW B;  1GHC A;  5K5R A;  2ECB A;  2FOW A;  5HS8 A;  2E2H J;  3K7A J;  2G0E A;  1JTY A;  4IEJ A;  2O6G E;  3Q3S A;  4IHW A;  3HOU J;  3A0B C;  2ZC2 A;  4RGS A;  3OS2 A;  3U1D A;  1G3Y A;  4PSX A;  2PFB A;  3BR3 A;  4EJW A;  1FZP B;  3FXO A;  3GFM A;  5F04 A;  1IAW A;  1W5S A;  2EWN A;  2DK5 A;  4CUG A;  3QRF F;  4RM2 A;  5FGM A;  3LFU A;  3SHF A;  1I6X A;  1HKS A;  3ERE D;  1Z1D A;  2XRN A;  1D8K A;  3M4O J;  1FTZ A;  1A36 A;  1W0U A;  1VQ4 I;  2YU3 A;  1D5Y A;  4NHJ A;  2R7O A;  3JTH A;  4EMS A;  1WJD A;  4U7B A;  3NWT A;  4IOC F;  2M34 A;  1TWA J;  2MC3 A;  5AIQ A;  4E7K A;  1A31 A;  2DK8 A;  3O8G A;  2WB1 A;  4MEY F;  3J80 Z;  3VWB A;  5LD2 C;  4LK1 F;  3DKY A;  4A3F J;  2ISZ A;  2YR2 A;  5FO5 A;  2VJJ A;  5A2Q K;  1LJ9 A;  1T38 A;  1UZC A;  2KLO A;  1SVM A;  4UV8 A;  1RIO H;  2H09 A;  4BGD A;  1ETY A;  4N0B A;  4A69 C;  2LD5 A;  3PFI A;  3JRI A;  5JFR A;  4IKF A;  5GTI C;  4L5J A;  3MFK A;  3VSK A;  1MMD A;  3BTL A;  1MDM A;  2KMU A;  4WX9 A;  1IXR C;  3BR5 A;  3VOD A;  2VT2 A;  1ZH5 A;  1X19 A;  1Z3Y A;  3ZMS A;  3L00 A;  2AHQ A;  2NVY J;  4IZZ A;  2M4K A;  2NVQ J;  2CQ7 A;  3OYC A;  1R00 A;  3L7W A;  1Y6I A;  2DYR H;  2L7Z A;  2LYC A;  2MH9 A;  4KN7 X;  5LLQ A;  4KNY A;  2N8G A;  2F5E A;  2JVH A;  3DKW A;  4A3L J;  3CCQ I;  3H5R A;  3MZY A;  2L3D A;  2VQH A;  2E5Z A;  1YE9 A;  4D7N A;  1BN5 A;  1J9I A;  1ON1 A;  3R0A A;  1RNL A;  1BBY A;  2EV0 A;  2G9W A;  5FFZ A;  5E3L A;  3N4M A;  3S16 J;  2HOE A;  3EYY A;  3MQ0 A;  1JKO C;  2GOM A;  4RLF A;  4U0W A;  3N97 A;  4BEH B;  2K40 A;  2ACJ A;  1G3T A;  3KYL A;  4ZDL A;  2D2W A;  1FBU A; 
#chains in the Genus database with same CATH homology
 3IH3 A;  2P81 A;  2QF7 A;  4JP0 A;  4W1U A;  1JGG A;  2L7M P;  1FTT A;  2O9L A;  1B72 A;  2LKX A;  2XGC A;  3MN2 A;  2JJ7 A;  2YS9 A;  2EZL A;  2ID6 A;  5EG0 B;  5JLX A;  2L0K A;  3LSP A;  5DS9 A;  2XPW A;  4A3K J;  1WGX A;  4MO7 A;  4HNV A;  3M3Y J;  3A03 A;  4FE4 A;  1LE8 B;  2HOS A;  2HDD A;  5FKM A;  2DA3 A;  2IBD A;  2Y2Z A;  3MVP A;  2LP0 A;  4XRM A;  1IDZ A;  2HQ5 A;  3D1N I;  1HF0 A;  4M3G A;  1PUF A;  1ZK8 A;  2CUE A;  5EF6 A;  4XIC A;  1APL C;  1JUS A;  3ZQH A;  1VND A;  5F27 A;  1IG7 A;  1MBH A;  4MIM A;  2H8R A;  1XG1 A;  3ZOB A;  1I50 J;  2DA2 A;  2NS8 A;  3OSF A;  1R9T J;  1T56 A;  1MSF C;  1W0T A;  2WV1 A;  2EH3 A;  2E2I J;  1JKR C;  4A3E J;  3BR1 A;  2JWT A;  2DN0 A;  2MSY A;  1LE8 A;  4MLO A;  2EQR A;  1ORK A;  4M3E A;  3JRE A;  1I6H J;  5C4X J;  2K9Q A;  2GBY A;  3HEF A;  4W97 A;  1JT6 A;  3G1M A;  1A6I A;  1ETO A;  2DA7 A;  1MNM C;  3S1M J;  3DEW A;  3S14 J;  4QSH A;  3JR9 A;  1X58 A;  1IUF A;  2O7O A;  3WHC A;  1FIP A;  5K7Z A;  4RBO A;  3TW6 A;  4FE7 A;  5IP6 A;  3IV5 A;  3I4N J;  4BBS J;  3CCY A;  5EGO A;  2IAI A;  5J3L A;  1Z77 A;  4CYC B;  2JA6 J;  1G2H A;  2HOT A;  2DMP A;  1JUP A;  4X6A J;  4AYB N;  3HM5 A;  3SJM A;  5F0H A;  3S1N J;  4IHY A;  4JX4 A;  4B1R A;  3ZQC A;  4DYQ A;  4Y7N J;  5F0C A;  1BJZ A;  2X9D A;  1BW5 A;  2M8G X;  3W6V A;  2PMZ N;  2LVS A;  4C3I J;  2VI6 A;  2CU7 A;  3BG9 A;  2GLO A;  5EYR A;  1ETQ A;  2YUS A;  1U8B A;  2R0Q C;  1RET A;  2DMN A;  5DTD A;  1HLV A;  1FEX A;  4DYC A;  1IDY A;  4DZP A;  2L7F P;  3PO2 J;  2K9N A;  3HOY J;  1GUU A;  3G1O A;  4CYC A;  4M3D A;  1B72 B;  2KT0 A;  1MSE C;  1CQT A;  1XS9 A;  3ZQI A;  4DW6 A;  1OCT C;  2DJN A;  3JRA A;  3BG5 A;  3BR6 A;  4XK4 A;  3RQI A;  4MFE A;  4LOC A;  1GVD A;  1QPI A;  1K83 J;  3JRH A;  2HOA A;  3SDG A;  1IRZ A;  1HDP A;  3UKG A;  1BL0 A;  2L9R A;  3BR2 A;  3S2D J;  2FX0 A;  1IGN A;  1WCM J;  1TWF J;  3PM1 A;  1NK2 P;  5M5X J;  2ME6 A;  4IHX A;  3BTC A;  4A3B J;  2ELK A;  1ZKG A;  1HDD C;  1PUF B;  1VI0 A;  2COB A;  5FJ8 J;  1MBG A;  1UG2 A;  1BW6 A;  1A5J A;  3S1Q J;  2QCO A;  3FK6 A;  2K9S A;  3BT9 A;  1O4X A;  4D5F A;  1GDT A;  2DMQ A;  3DCF A;  1TC3 C;  4A93 J;  4EEF G;  5HOD A;  2JMW A;  1RPW A;  5IP7 J;  1X2N A;  5E3N A;  5C4J J;  2Y30 A;  2EZK A;  3HGY A;  1GV2 A;  1GT0 C;  1Y1W J;  2IEK A;  4C3H J;  1UMQ A;  5FKL A;  3E7L A;  1ZQ3 P;  4C2M J;  2XPU A;  2X48 A;  3IH2 A;  2Y9Y A;  5IOZ A;  3B6C A;  2DA6 A;  2EBI A;  4MFD A;  2H1K A;  1DU6 A;  1B8I B;  4XID A;  1EF4 A;  2KDZ A;  1ZGW A;  2MGQ A;  2FJ1 A;  4JX5 A;  5FKO A;  4DZJ A;  1I3Q J;  2XRL A;  5EGO B;  3WHB A;  4IHV A;  1TWG J;  2FD5 A;  2LLK A;  1DU0 A;  5IYC J;  1Q1V A;  1JJ8 C;  3QPL A;  1IV6 A;  1Y1V J;  3CQZ J;  1QRY A;  2R5Z A;  2R92 J;  4L5E A;  1BA5 A;  1JTX A;  1AHD P;  1YRN A;  1TWH J;  3ZQF A;  5EZH A;  1H8A C;  2XB5 A;  4JYK A;  4V2G A;  2E19 A;  1E3O C;  3RZO J;  1B8I A;  2ID3 A;  4BBR J;  4NDL A;  5M5Y J;  1AKH B;  4FIS A;  3C2B A;  2HI3 A;  3A01 A;  1FJL A;  3OIO A;  3LNQ A;  3JRG A;  4S0H B;  3HDD A;  1IC8 A;  2FQ4 A;  3HB9 A;  1U9O A;  2R5Y A;  3GTG J;  2W48 A;  5K7H A;  3BTI A;  4A3G J;  1VFC A;  3NAR A;  4BXX J;  2DMT A;  3RZD J;  2CUF A;  2LTP A;  1JKP C;  1TWC J;  3BG3 A;  4AC0 A;  1FIA A;  1NK3 P;  2GM4 A;  2XGE A;  1OJL A;  3CMY A;  3NAU A;  9ANT A;  2Y0S N;  2E1O A;  1RKT A;  1ETW A;  1IJW C;  2HXO A;  4UUT A;  2JA8 J;  2WAQ N;  2OPT A;  3GTJ J;  2HXI A;  5M3M J;  3GTP J;  4GFB A;  4FTH A;  3S15 J;  1NTC A;  3TW7 A;  1AKH A;  1QVU A;  3GTO J;  4XRS G;  5EEA A;  1S7E A;  1H89 C;  2ZB9 A;  3VPR A;  4RDU A;  1H88 C;  3HGG A;  2CQX A;  5EZG A;  2EZI A;  5J1R A;  1AU7 A;  3LOC A;  4QTR A;  1HOM A;  1MH4 A;  1UHS A;  4XRS A;  2B63 J;  1RKW A;  1ETV A;  1U9N A;  5M5W J;  2MG4 A;  4A3C J;  1JUM A;  3Q0W A;  1MBE A;  1X2M A;  2EZH A;  3IH4 A;  2VKV A;  3S17 J;  2LR8 A;  5E3O A;  5IOY A;  2CRG A;  2M0C A;  1P7I A;  4C3J J;  4AUX A;  2LFB A;  3ZQG A;  2NVT J;  5FKK A;  2M2E A;  3HOV J;  1ITY A;  2LK2 A;  2AO9 A;  1ZR2 A;  1MBJ A;  1F36 A;  5BNG A;  1P7J A;  3S1R J;  3LSG A;  4DYR A;  3B6A A;  5E3M A;  1WH5 A;  4D5C A;  1Z0X A;  2E2J J;  3QPS A;  3GTK J;  2LY9 A;  3FIS A;  3OSG A;  2DA5 A;  4M3F A;  4BY7 J;  2R5Z B;  3GTM J;  1LFU P;  5IPA A;  2D5V A;  3HOZ J;  2CQQ A;  3A02 A;  1YRN B;  3JRC A;  1GV5 A;  3BQY A;  3H0G J;  5K7F A;  4FCY A;  3PO3 J;  4UUS B;  3BQZ A;  1MBK A;  2VKE A;  3LSR A;  3GBG A;  5F1J A;  4A3J J;  3FKI J;  3GTL J;  5GPA A;  3MKL A;  1F43 A;  3FK7 A;  5F08 A;  2Y9Z A;  3TED A;  4JX6 A;  3QQA A;  2X6O A;  2XGD A;  2WB1 N;  1ZR4 A;  2RAE A;  4B4C A;  5GP9 A;  3JRD A;  2NOG A;  3L1P A;  1WI3 A;  1T33 A;  3BR0 A;  3A01 B;  3HOW J;  4BKX A;  2MW8 A;  3JRF A;  2R5Y B;  5C44 J;  1ENH A;  3TP0 A;  4A3I J;  2NS7 A;  2O8K A;  3HBL A;  2XPV A;  3ZQL A;  3HKZ N;  5FLM J;  4UUS A;  4G12 A;  4J19 A;  4BY1 J;  2ECB A;  2E2H J;  3K7A J;  4I6Z A;  2G0E A;  1JTY A;  4IEJ A;  3Q3S A;  5EDN A;  4IHW A;  3HOU J;  2I10 A;  3TP3 A;  5EG0 A;  5C3E J;  2DTZ A;  1ETX A;  3OOU A;  3BR3 A;  3FIW A;  3I4M J;  1WH7 A;  5F04 A;  1SFO J;  1QVT A;  2NVX J;  1MBF A;  2TCT A;  2CJJ A;  5IP9 J;  3GTQ J;  1ETK A;  3S2H J;  3M4O J;  1FTZ A;  2TRT A;  1W0U A;  4A3M J;  1D5Y A;  4ABZ A;  2R93 J;  3JRB A;  1POG A;  2R7Z J;  2M34 A;  1TWA J;  2ME0 A;  2JA7 J;  3H3V K;  1XC5 A;  2JA5 J;  2JN6 A;  3O8G A;  5GPC A;  4A3F J;  3K2A A;  5J1Y A;  1ZTR A;  2XB0 X;  3LSJ A;  3Q0V A;  1OCP A;  1U78 A;  1WPK A;  2ECC A;  5J1U A;  1ETY A;  4A69 C;  1MH3 A;  2M9H A;  2LD5 A;  3JRI A;  2HYJ A;  2Y31 A;  4A3D J;  2DA4 A;  1RES A;  4M3B A;  5F0F A;  2DA1 A;  3BTL A;  5IYB J;  4V2F A;  2DMU A;  1RR7 A;  2VPR A;  3BR5 A;  5FKN A;  5M3F J;  1JT0 A;  2OF7 A;  5IYD J;  2AHQ A;  2NVY J;  2NVQ J;  4M6V A;  3Q0U A;  4I76 A;  2L7Z A;  4X1E A;  5JLW A;  3HOX J;  3CDL A;  2N8G A;  4A3L J;  4B3A A;  3O8H A;  1K61 A;  1VF9 A;  5FLV A;  1SAN A;  4QIW N;  1OFC X;  4D7M A;  4D7N A;  1JJ6 C;  3F0C A;  5E3L A;  2VUM J;  2XSD C;  3S16 J;  2JK3 A;  1JKO C;  3SFI A;  3BTJ A;  2K40 A;  1HCR A;  1LFB A;  3G1L A;  2YU9 J;  1JKQ C;  4Y52 J;  3RKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...