2LOOA

Backbone structure of human membrane protein tmem14a from noe data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 14A
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2looA02
2LOOA
chains in the Genus database with same CATH superfamily
1Z77A 5FD6A 3M8EA 1K4TA 3E6CC 2Z2SB 2M30A 4MQVA 3T8RA 3X2QH 4IQJA 2R93J 2FRHA 4CGZA 2P7VB 4BXUA 2L7FP 2XAGA 5L3CA 2D5VA 2JRMA 4IXAA 1I5ZA 2KDZA 3P9KA 3I58A 4BYYA 5H6RA 1IN4A 4L5IA 1FIAA 4ENNA 2IA0A 2DFHA 1ZK8A 3BJ6A 5HLIA 5A2QZ 1BI0A 3LSGA 1DGWY 1JGGA 1P7IA 3TEDA 1SFOJ 3CUQC 4P96A 3DKYA 3A03A 3KETA 2QEXI 1B6AA 2OPTA 4XLCA 2TDXA 4Y17A 2LDUA 3H92A 2EFOA 2ZMEC 4OMYA 4XLHA 3S2WA 2IS1A 4M72A 4UXNA 2GLOA 4M74A 2NOJB 3K70C 3G2BA 1H8AC 1EV7A 2KJBA 5J1RA 2L54A 4M6YA 3H1CA 3SJMA 5GTHC 2V1NA 2VOPA 4BQQA 1DUXC 1WFXA 1FSHA 1U2WA 1ZTRA 4ESBA 3OYDA 2NVTJ 1VZ0A 4BHBA 1A31A 4M3FA 4E7IA 2B0LA 2H09A 3KCCA 1ZREA 3FKJA 1KU9A 4R79A 2NVUB 2GXBA 3BROA 3IRRA 4DJAA 5IT9K 4M71A 2UXNA 3BC8A 2EFNA 4BE1A 4MTDA 4XNFA 1ZELA 3ABTA 3J80Z 1ZG3A 2XB5A 4YFXF 4O3MA 2K5CA 4LJZF 2CW7A 3VPRA 2FQ3A 3ZXSA 3DTKA 1IJWC 4OIOF 1TQPA 4UNOA 3S1NJ 1YG2A 1MMAA 4M3EA 2IW5A 4ZYHA 4ZDOA 1FNNA 3TOBA 3KP2A 2M8EA 3KP6A 4XM3A 3L09A 2E7WA 1USSA 3CDIA 3TO9A 1X1CA 3TQNA 4YFNF 3GTJJ 4AIJA 2MH9A 2FD5A 4ENJA 2LVSA 2W7NA 2MD5A 2YSRA 5ILVA 3TOAA 4E70A 3I56I 3JRGA 1O4XA 3FIWA 3P7NA 4PJLA 1BR4A 5F0FA 2B63J 4FQGA 2R7FA 3K4MA 5K7HA 4UVCA 4DZPA 5EG0A 1IRGA 2ZJ2A 2R7RA 5FLVA 3F8BA 3K2ZA 3T5XA 1ULYA 2FU4A 2O9LA 2A6TA 4MTEA 3CDHA 3GZNB 2DYSH 3CUQA 3LSRA 1ITYA 4O6JA 2L0KA 3O2PE 1XDUA 5EEGA 2LBFB 5FKOA 1ON1A 1LVAA 1XMKA 5BMZA 2DOAA 1MDMA 4EVIA 1ERDA 3HOTA 2R7ZJ 2ZMEA 2XUBA 2DODA 2IGKA 3PNYA 3I54A 4DBQA 1O7LA 1QPMA 1SD7A 2NNYA 1YYVA 1I6HJ 3F22A 2KL4A 1B8IB 3PIPF 2V79A 1Z9CA 3J7AY 3RZOJ 3BG3A 1GXPA 2JQ7A 3F8CA 5FKLA 4I98B 3V8KA 4GDFA 1B72A 2RC4A 4IJAA 2LF8A 2MC4A 3E6BA 1LEAA 2HKXA 1HDPA 4I02A 2COBA 3FM5A 3A0BC 3M3YJ 1P4WA 4KIBA 4P9FA 2Y30A 2ISYA 1G2HA 2R3SA 5HLHA 2XGXA 3EDPA 2IS2A 3KLNA 1WH5A 3L1PA 1OYYA 1XD7A 3COAC 2RDPA 3FDYA 4EEFG 3DQVC 1P7JA 1X3UA 3BZ6A 3WG7H 3CCVI 3W2VA 4Z6YA 1MGTA 2MGQA 3ABLH 4U7DA 3D1NI 3HOWJ 2RN7A 2R0QC 2HQRA 1MBJA 4LFUA 3MWMA 2ELHA 1YW9A 2IVMA 1TC3C 3K9TA 4OWRB 5IT9Z 1WGXA 1MSFC 3K1PA 2Y0MA 5M5YJ 2X1EA 4B48A 2HDDA 2O7OA 3KZZA 2AXTC 1YOVB 4BJ6C 1V5FA 4RGUA 3F9KA 2I5UA 2JPCA 2F5FA 1I39A 2WAQN 1T98A 4ASNA 2P5LC 3VYUB 2DA1A 1BW6A 4L9VA 4HQMA 2VONA 2QZ8A 4BBSJ 4CDGA 1LVKA 2VKEA 3C2GA 4KFCA 1SVOA 4D7NA 4A3BJ 2M2EA 2ISZA 4A0XA 4UB8C 3SYTA 3QYFA 1TWGJ 1EH8A 2EFQA 4DOZA 5FD5A 4WXHA 2R7OA 3CP8A 3S3OA 2ZXJA 2CW0F 2L9VA 3GUDA 2KFDA 4JP0A 4HX7A 1TL8A 3VYTB 4BEHB 3C18A 3RKWA 3LSPA 4UV9A 1RR7A 2EV6A 1QQIA 1V5EA 3DU5A 1O3RA 2L02A 3DFGA 3QOPA 4XL9A 4DIQA 3F8FA 1JKRC 4E6KG 1EF4A 5L3BA 5GAGJ 3ASNH 4UUSB 2LY1A 3LL7A 3U9GA 4YIIA 1JUMA 2JA8J 3ZQIA 2ZJPF 1YX3A 1A35A 2IA2A 4HF0A 2E36A 4PDKA 4U0YA 1WJDA 5BPDA 2NS8A 2VJ4A 3KPHA 1FTZA 2A05A 3DCFA 2R92J 3A0HC 2R5YA 1P6RA 4ZYEA 3OR1C 2HYFA 3CCRI 1LE8A 3BP8A 2WAEA 2M5WA 2KZGA 4K2EA 4BQOA 3ZQCA 2FQ4A 1YJNI 2XPUA 3OWTA 4EJVA 4BL0B 4RGRA 4LMYA 4A5MA 5LBQA 3AFHA 4CCOA 4A0ZA 1XTAA 2XIGA 3P9IA 1R22A 1RESA 2EJRA 3JRHA 1GDTA 2XDVA 4MFDA 2HPMA 2K4BA 1YRNB 2CFXA 1A04A 1FBSA 4XLFA 3CCMI 1HKTA 4LIUA 3MZHA 3R6SA 1T6SA 4B3XA 2WY8Q 5ED4A 1MNMC 2CO5A 4FCYA 3HBLA 5HODA 1Z7UA 1VNDA 3LMMA 1WJEA 5CVVA 2YR2A 3H3ZA 4EM0B 1QPIA 3OSGA 3U21A 1K6YA 3LA7A 2DMUA 5EG0B 1ENHA 2XHKA 1G59A 3AG1H 2M34A 4ITVA 2F4OB 3AAFA 2JA2A 2FXAA 3CMYA 2CUZA 3O8HA 3OS0A 2VL8A 4XQFA 1JJ8C 2E35A 4D5CA 1APLC 2A69F 1FOWA 5EF6A 5LD2C 2XF7A 3T0YA 1GUUA 3SZTA 3JSOA 2JN6A 1QVUA 2ZMEB 3DEUA 1ZKGA 4I6ZA 2MSYA 4V2GA 3WTSC 3OS1A 1J5YA 1UG0A 4YIFA 1X19A 2VN2A 2B7EA 4XLEA 4ON0A 2JMWA 1NH3A 1OYIA 4IO9F 2HDWA 1TWHJ 5E17F 1G3YA 4PGGA 2JK3A 2KLOA 3OMYA 3F72A 3HB9A 2CG4A 1WCMJ 3PUBA 5ILSA 3K4NA 1LDKB 3BOQA 1CF7A 2NVYJ 5E3OA 4ENKA 2B9SA 2L4MA 2E34A 2VT2A 3GZ5A 4Q47A 3GTPJ 2IXSA 4UY8I 4G94A 4S05A 3CJTB 2ETHA 1AWCA 4OMZA 2KIMA 1USTA 4BDYA 4UUVA 3I4PA 2AHQA 2HR3A 5F64A 4DGWB 1AOYA 1NK3P 2H27A 2JUCA 3OYGA 3HDDA 5LRRA 5B1AH 1XG1A 4C9YA 1R5HA 2X6OA 3ZQGA 3HXLA 4LK1F 2E1MC 1OISA 5K7FA 1XCVA 2ELKA 2FMYA 2LK2A 4N0BA 1Z21A 2MD0A 1FWZA 3U2RA 3WODF 4KN4X 1X1PA 2LSOA 1Q1VA 1U6GA 4BBRJ 2UUZA 2E2HJ 1JHHA 4EMSA 4IRGA 1RNLA 1ZN2A 1MBGA 1Z6RA 4FISA 2DMTA 1W4MA 4YEJA 3UR3C 1Z05A 3FXKA 3HKZN 4Y15A 3PQKA 3VSLA 3FHNA 1S9HA 3I59B 2PI0A 2W24A 1W0UA 2HXOA 4IF4A 1M1EB 1TNTA 2O6GE 3S3NA 5M5WJ 1S7AA 3ZCOA 4FX4A 1IC8A 4MEXF 2VBWA 3QP5A 5FFZA 2DTZA 2HKOA 3H3VK 2P6SA 3PFIA 2DA2A 3FBNB 4G6TB 4CYDA 5JVGF 2ZSIB 3KEYA 4HPQA 2KRCA 3OSFA 3O6BB 2V26A 2YX7A 2HZDA 4IHWA 2L9NA 3LFKA 4WWCA 3VWBA 1F5TA 4GFBA 3E5QA 2XKOA 1G6NA 3MVPA 1D8JA 2R7TA 2UV1A 1ZAOA 3BCAA 3ERMA 3LOCA 2LFBA 5HNHA 5FGMA 5D5UB 1JKPC 2DMPA 1VQOI 3WG9A 4EQQA 3CDLA 4KIFA 2BXZA 3BG6A 4IRHA 5DM6F 1IGNA 3ZQFA 2CS3A 3PFYA 3SDGA 1YS7A 3HRSA 3H9GA 3KEQA 5B3SH 2KT0A 3WU1B 4NHJA 1AKHB 4HF2A 6PAXA 2L01A 4XONA 1HCRA 1YE9A 5FKKA 1S7EA 3HRMA 3VODA 2VT3A 3E6MA 4HNUA 3LSMA 3I71A 4NNJA 1XGSA 1ZARA 4U7BA 4G6DA 4KUMA 4RAYA 3ZPLA 1JUPA 2M9HA 1R1VA 1L0OC 1X4PA 3HPGA 1UHWA 3NAUA 3AG2H 3G1MA 4YRVA 3I9V2 1ZG5A 2J5OA 5A2QK 1WJFA 3CC7I 2A6HF 1SD5A 1LE8B 2K3PA 2M1BA 3CMEI 1KQ9A 4A3CJ 3ZR8X 4XIDA 1U78A 2CGPA 1TT0A 2WBMA 3QYBA 3CCLI 1MH3A 4NB5A 5AONA 2ACJA 3CJNA 1R9TJ 2DXIA 1WWXA 2KMUA 4NUBA 3JR9A 3ASOH 3BPXA 3MFKA 3FF5A 2L7ZA 4CSWA 5B5EC 1E3PA 1UG2A 4ETSA 2HXIA 1JI8A 4RB0A 2GOXB 2CU7A 3TL4X 1QZEA 4EJWA 3G4SI 3CD6I 4EM2A 3S3MA 4A3DJ 3FK6A 3DP7A 3A02A 1MW7A 5K1YA 4KA4A 4LG0B 4B09A 1DGRM 3VEPA 3AL0B 1T08B 2BY1A 3D0SA 4L9TA 4F55A 5KVRA 4LB6B 3Q0WA 4FETA 4WXCA 4IQ4A 4HW0A 4A3KJ 3RTRA 2ZSHB 1WSUA 4M3DA 4RM3A 2LOOA 2STWA 4H0EA 3S1MJ 2LBFA 4AIKA 4C3JJ 2PFBA 4M9SA 4A6DA 2KIUA 1HQCA 2DQLA 2A5YB 1I6XA 1C0WA 4IKFA 2EZHA 3ISPA 3OIOA 4UVAA 3CUOA 1R6RA 4BAYA 5C3EJ 3DEEA 3MAJA 2DA7A 4D7MA 3WHCA 3KYCB 2JT1A 1X3WB 3CP2A 3BCBA 2CUJA 1FC3A 3BR2A 1V4RA 1Z1DA 1OCTC 5DYMA 4I76A 1ACIA 1B8IA 1EH6A 5CLSA 4LD5A 5FFXA 2K4JA 2XAQA 3OYLA 3KX2A 2CWEA 1OCCH 1CGPA 3CF2A 3TMOA 1GVDA 5TRDA 3KFWX 5K5OA 5C44J 4M73A 4J19A 4WF2A 3GBGA 5GTIC 2HGCA 1YW7A 3DLLF 1HBXG 2VKDA 4RA2A 2GZWA 1W5TA 3GZ6A 2FBIA 2XASA 4IZZA 2A6EF 4IOAF 3DLAA 2CQKA 1ZGAA 2ZNZA 1IUFA 1ZGJA 4V2FA 3JTGA 5BS6A 3G71I 4IOCF 3E97A 4KMFA 4QSHA 1RKTA 3PM1A 1GVJA 2YUSA 4XSXF 3BR0A 3GLXA 3G1LA 3NWTA 2Q2EB 2XSJC 5M5XJ 3CO6C 4DNCA 5JHFA 1N78A 1GLNA 3JRBA 2KISA 3I3LA 5EZGA 1HF0A 3JREA 1BBYA 2X51A 2V6EA 3C7JA 3UNGC 5LRSA 2OA4A 1LUJB 1ONVA 5L3DA 1GXQA 2Y75A 4KT6A 2DFEA 3DKXA 1QVTA 1KQ0A 2CRGA 1FMWA 2OTLI 4PUSA 3GWZA 2Q8KA 1VQ5I 2OBPA 3D5SC 4M3BA 5D5WB 1W7PB 1P2FA 4I0BA 3FXJA 1V54H 2RGVA 1QZZA 4CHUA 4E7LA 2EV5A 2HWVA 2KRHA 4B47A 2Y2ZA 5GP9A 1VQ4I 2BE5F 3R60A 1WZ2A 3BZCA 1T95A 2VI6A 1ETVA 3HOZJ 2E1OA 2W00A 1TZLA 2ZCWA 2ZC2A 4BJ5C 1MBHA 2D1VA 3RKYA 5GAHJ 3CC2I 1YO5C 1IDYA 2XGCA 3RKXA 5J1YA 3AKZA 3Q0UA 2HOTA 1JT6A 1D0ZA 3OOUA 1K79A 4GO1A 1LEBA 3G73A 2BZTA 4AVZA 3L2UA 2XGEA 4YIRX 1R4NB 1QHGA 4BEHA 1IO2A 5DM7F 5LHGA 1QZYA 4KISA 3OYNA 4HV6A 1POGA 1ZYRF 1LB2A 4AIHA 5JLWA 4C30A 1D3YA 2TRTA 3K1MA 1H0MA 3BJOA 5LEJA 5D4RA 3EPZA 4AD9A 3Q9SA 4XMYA 5K5RA 4UUSA 3UKGA 3SDBA 4Q5SF 1OCRH 4BH9A 1FBQA 4ABZA 1JKOC 1HW2A 1R58A 1Z91A 1JT0A 4L18B 2Z1DA 2DA5A 1HXDA 2IGNA 1XB4A 2XF6A 3W6JB 4CCLA 3ZGKA 3T1BA 1P92A 3MZYA 3ZMVA 3S2DJ 3NEUA 2JZYA 3HGYA 5GADJ 4HNVA 1T33A 2NVQJ 1VQMI 1AA7A 2QA4I 4JX5A 2OD5A 2JUGA 2GXGA 1GV5A 3R61A 3ZMUA 2BXYA 4ZDPA 2VJJA 1U8RA 1KU7A 4N9HA 3G1OA 3EETA 5KAFC 5FROA 2Y9YA 1ORKA 1X3ZB 1FYMA 2IRFG 1AHDP 1MSEC 4LIVA 3BT9A 1YRNA 4UB6C 3E3VA 5EEHA 3GXOA 2E1MB 3KP5A 3KE2A 4II2A 3RQ4A 1KYWA 5J8CA 2DA6A 2G9WA 1WI9A 2Z9OA 3GCMA 5KAIC 1MJ9A 2IT0A 4A0YA 2PJPA 2QLZA 3FXLA 3K4KA 2OZ6A 2LY2A 1ZG1A 5HS9A 4HA8A 4GGGA 1Y8QB 1J0RA 4CZZA 2AO9A 1D1AA 3IH3A 2EA2A 3E5XA 1LFPA 1VQPI 2ZO4A 4PGHA 2KPMA 5JVTA 1ZRCA 1PUFA 2OUMA 1UCRA 1X1AA 2Z3YA 1STZA 4XKBA 4OIRF 3VYSB 3WE3A 4B44A 2PQ8A 1Y0UA 3FXOA 3TO7A 1ZRDA 5FRNA 1MD0A 2XF5A 2XAJA 2ZXWH 3FXRA 5DCMB 4HLYA 1SD6A 5GAEJ 2AXLA 3ZRGA 5D5VB 2DT5A 2CUFA 2FUG2 2KKOA 2ZFWA 2VLAA 2CSOA 4IL6C 2FA5A 4W97A 2L5QA 4B4CA 3K0LA 4G12A 4KIGA 1U9NA 5FRMA 5EGOB 4R8HA 3TO6A 4B3AA 1DU0A 2KHMA 5HLGA 3F6VA 2BOLA 3H9QA 2P8TA 2DDBA 2VC1A 4BU2A 3OYJA 2X6XA 4B8XA 3OL4A 2R5ZB 1FMVA 1MBFA 3M7GA 1YFHA 3HRTA 3A2KA 1VFCA 2CYYA 2HOSA 1IXCA 2HQNA 4HX4A 4FX0A 1BR1A 4OAZA 4CH7A 4MNUA 3Q3SA 4XRFA 4ZTFA 4XICA 3CCJI 2H8WA 4A3GJ 1Y1WJ 2ECCA 1Z3XA 2F4MB 1TW2A 3GMEA 4WCGA 4MQ9F 2BW3B 2DPUA 1OKRA 3QRFF 2G0EA 2LP0A 2QKLB 2DT6A 3LA3A 1LJ9A 1TLHB 3H0DA 1LFUP 4MO7A 2Y9ZA 5J4VA 4E7SA 1BC7C 2GQQA 1WJCA 1XCBA 3FISA 1T0FC 3ROUA 4HX8A 1XDSA 1I1GA 1SFEA 2XPWA 2K85A 1MBEA 3SQNA 4NC7A 4DYCA 1B4AA 2CQXA 4U0VA 2BY3A 2H8RA 4HAMA 1QNTA 3PSIA 1W7PD 2EFWA 4XLNF 4D5FA 2O0YA 3Q0VA 3AL0C 2DJIA 3I59A 4FE7A 3OS2A 4AC0A 3L2QA 4AUXA 4A2UA 1A6QA 3IV5A 5D6EA 5F08A 2DA4A 2VODA 3EUHC 1WHUA 2EFPA 3B02A 4RGXA 3F23A 1NHAA 5H20A 3O8GA 5FLXK 2VQLA 3ZOBA 1WQ2A 2KIQA 2HTJA 2NRAC 4XSZF 4U88A 1T56A 3JW4A 3ULQB 3ZQ7A 3R0AA 4A3JJ 3K4BA 1ZQ3P 1X1BA 2M4GA 3TDUC 5D8KB 1R1UA 3F0CA 4S04A 4XKWA 1Z0XA 3BQYA 5E8IA 3D5RC 3ECHA 2IS4A 3CF5F 3QPSA 2HYGD 4XN3A 2BEOA 1FYKA 4JK1X 1DPUA 3M9AA 3VB2A 5E79C 4BACA 2YU9J 5BPIA 3CC4I 3H9JA 3AG4H 1AKHA 3IH2A 1F36A 3DXJF 2VJ5A 4RLQA 4NQWB 4ENMA 5H2FC 5CPRB 3H5NA 1OJLA 2HNHA 4P1WA 3M1EA 4PJJA 3EQLF 1IRFA 1Y8RB 2KP6A 2WB1N 4IHVA 1MMDA 1OQYA 3IAS2 2X6WA 2FX0A 1I3AA 4LK0F 2BV6A 4AYBN 1BI2A 1VF9A 2DLLA 4Q48A 4W1UA 2O3FA 1ETKA 3KZYA 2X9DA 2XSDC 1SEUA 2VQCA 1PVEA 3L9FA 1MJBA 3PIOF 5FJ8J 2JSCA 2QKMB 3BTIA 4XLAA 5FKNA 4HSRA 4HQEA 1ODDA 2VPRA 3K6GA 1T2KA 4XK4A 4CCKA 4NBQA 4BQAA 5LGUA 3HSEA 5DUKA 4FASD 5IP9J 2NOGA 1Z6TA 5DEQA 2YS9A 1QRYA 1T0FA 2DT7B 2M7BA 3BTLA 5CKTA 3AG3H 1X2NA 3MKWB 1KU2A 3K10A 1JXSA 3J7AO 2D2WA 3BTCA 1BJAA 5LEKA 3JRIA 4F52A 3FXMA 4KICA 1TBXA 3S93A 1IXSB 1R4MB 2EK5A 2IP2A 3FX3A 4ZYAA 2KDOA 3T8TA 3ZN0A 1IUYA 2HI3A 1X1DA 1PP7U 4LG0A 4KITB 4WK8F 1ZLJA 3PNTA 2MH2A 2QQAA 4I0AA 1PYVA 2M0CA 2QCOA 3S8PA 3A01B 1LFBA 2H6BA 5B66C 5DS9A 2HTSA 3EUHA 2IGMA 5M3FJ 5JHUA 4IX7A 1PUFB 4KJZA 1HA8A 1OMIA 1RKWA 3BR1A 1ZRFA 1FP2A 2F5VA 3ZQQA 3WTYC 2Q1ZB 3PJRA 4DQ2A 4G7OF 2WA0A 1OCZH 4KMUX 5L3FA 2CUEA 1WRJA 1IF1A 3GYHX 1VQKI 2WAQA 5TJJA 1Y6IA 3F8MA 2LR8A 4ZC3A 2AQFA 2ZFUA 1JTXA 5IOZA 1FYLA 3BZKA 2JJ7A 3S1QJ 5CQEA 1CQTA 3QPHA 4JYKA 4A69C 1OCPA 5HS8A 3LNQA 5CVUA 3CCSI 1IV8A 3DU6A 3HSRA 4RB1A 4YFKF 1RRJA 4Y52J 1IRZA 5LHHA 3WU2C 2Z16A 1MNEA 3ZMDA 3ELKA 3HRUA 3E5UA 4QPQA 4MHGA 1E2XA 5FLXZ 3MKZA 1H89C 3WTTC 1HSJA 3DPUA 1BM9A 1MJAA 2CH0A 4I2OA 3N97A 1PUEE 2LF7A 5EEAA 1V55H 1Y39A 1YI2I 2L7MP 1S72I 4AM3A 2P6TA 3TGNA 1BIBA 1IW7F 2WC2A 3LWFA 2Q2EA 4IVNA 2JRTA 3Q5FA 4EATA 2P81A 4KDPA 4OOIA 3H36A 2W4SA 1XGMA 2M7AA 2JSPA 3ESWB 1JE8A 1J7KA 3QQAA 2P0WA 1R7JA 1FOYA 2WB1A 3KIOA 4XLPF 2BYVE 3HIFA 1O7FA 4C3IJ 2LC2A 2X1DA 4BE2A 3OY9A 1BOAA 3TP0A 2NVXJ 4M9XA 1S7OA 1FZPB 1OCOH 3CJQB 1ETOA 3MMYB 2HVSA 4PJMA 1W7PA 2RAEA 5LFAA 3L7WA 5DTDA 2DDAA 4TV7A 2NNNA 2PEXA 3EUAA 2G7HA 2LLKA 1LQ1A 3KLOA 2CQ7A 2GIVA 5E1XA 2OTJI 2PJRB 2K40A 3QPTA 5ICEA 3HGGA 4N4NB 3L2RA 1A5JA 1OPCA 1U9OA 3LFUA 1P4AA 2C6YA 3ZMTA 3JCUC 2YX4A 1WJBA 3ZQLA 2WTEA 4ZJZA 4CUGA 1HOMA 4I7HA 3K7AJ 4PFOA 3H5AA 3WGIA 2K27A 4A5NA 2FBHA 2FBKA 2R7DA 2FJ1A 3NRVA 5E8GA 1FSEA 3ECOA 5KK1A 5DDGA 1WH7A 5D4SA 4F7ZA 2M3AA 2QSGX 1BI1A 2MG4A 5LGNA 4IRIA 4UV8A 1D0XA 2UXXA 2WY7Q 3C2HA 5LLQA 3KP3A 1NG6A 2F6CA 2OQGA 2EA4A 2V9KA 3PL8A 3LSTA 2GAUA 2VKHA 4ZZLA 3WTXC 3KYDB 4RAFA 1H88C 1S29A 2R4GA 2HQAA 3V4GA 4EGYA 2CV2A 2LKXA 4G9YA 4RM2A 4HEA2 2DAOA 1N25A 4P55A 1MZBA 1V5GA 2EV0A 1DU6A 1HSTA 4IHYA 3RIRA 5HDKA 2ZBKA 1IV6A 3F8NA 4XKCA 1IXRC 1U3EM 4C2UA 1G3SA 2G7UA 1WJ5A 2OCCH 2STTA 4RLFA 2H94A 5EDNA 2LY9A 3GX4X 1FOKA 4A12A 4DZJA 4CO8A 1H9TA 2W48A 2XAHA 3QU3A 3VFZA 2XROA 3BR5A 3S1RJ 2HQ5A 1R5GA 5E1ZB 1GHCA 1Q1HA 4J00A 4NC8A 4FE4A 4IEJA 2Y0SN 1K61A 2BHZA 4LOCA 1KU3A 3OYKA 3C2BA 5B1BH 1K7AA 1W36C 1IDZA 1B59A 1XX5A 1E3HA 3JTHA 2HVQA 3FXUA 2EWNA 3BWGA 2E5NA 4AWXB 2F5DA 9ANTA 3E7LA 3QPLA 4FTHA 3RKQA 2F5EA 3HYIA 4C2MJ 5ICCA 2FEZA 5K7ZA 1F43A 2LMDA 2DBBA 2CV1A 5DCMA 2QM3A 3MQ0A 2PG4A 4RB2C 3JRDA 3HKZA 3RJPA 2HOAA 2KRFA 2V1UA 1AU7A 2EZLA 4HOBA 3R4KA 1XSDA 3I4MJ 5HLTA 2BY2A 5IOYA 1ETQA 2CQNA 4MGRA 2VQGA 3DTIA 3LAPA 2DOEA 4A3IJ 3QOEA 4CCNA 3H5RA 1T38A 2ZKZA 5KNLA 2DYRH 2H1LA 5EGOA 3HTSB 2ECBA 2MFZA 5HDNA 2QUFA 4C2TA 2MLKA 1U5TB 1RC9A 2NS0A 4ESJA 5FKMA 1K78B 1TQIA 3M8FA 3NWSA 4JX4A 2R5ZA 3RI4A 4F91B 2VE8A 2O61A 2CQQA 4HSTA 1PDNC 1Z7LA 2XPVA 3N4MA 2ZXHA 3BY6A 2V9VA 3REOA 3JRAA 4HG2A 3GFIA 5IYCJ 2HPIA 2F4IA 3HHHA 3WTUC 3GW2A 1SFKA 2XVCA 3HOXJ 5ILUA 1S3JA 4D1QA 4BXXJ 5C4XJ 1KZHA 1D1BA 3WTVC 4HLXA 2QSHX 1I50J 1IZ1A 3J81K 3OOPA 3GTKJ 2BW3A 1FLIA 1O3QA 2WADA 4IHXA 2EILH 3FMQA 2R7WA 3LQRA 1E3OC 3QAHA 4KNYA 2BY0A 2KJCA 2BVLA 1SC7A 2DK8A 2LRDA 3DBLB 2YPRA 2Y31A 4JQFA 2V7FA 3ZMZA 4QPOA 3RZDJ 2BBYA 4PJ0C 4M9ZA 4HNTA 1VQNI 4ANJA 3FMRA 4N9IA 2JVGA 2VQHA 1Y0NA 4QLCU 3GFLA 3HTUA 4G7ZF 1DP3A 3H35A 1J75A 2GBYA 1JTYA 4S0HB 1XS9A 3L2CA 2VUMJ 2JA7J 2EH3A 2LD5A 1FIPA 2EIJH 2OCEA 1D5VA 1RI7A 1X4OA 4Q4ZF 2V4JC 3L00A 4PCQA 2V6CA 2X85A 2DQRA 3OYFA 3CCYA 1XSXA 5E20A 1K83J 2EB7A 2L9SA 2K9SA 2JVHA 2L4AA 2HOEA 3QWLA 4WX9A 2FNPA 3L2WA 1D1CA 4A93J 2PN6A 4Z2YA 5KCMA 2IA1A 1HW5A 3JSPA 1FPQA 1MMGA 2E71A 2V1XA 2Y0SA 3DTEA 3MCZA 4EJUA 2ZJRF 2LNBA 3PO3J 5HDGA 4RGSA 4HYEA 2ZNYA 2EBIA 4JBAA 3GTLJ 5JLXA 4ZDLA 2JPBA 2VB6A 5K5QA 2A3SA 1IN8A 1K6OA 2CJJA 4CCMA 5DCFA 1TWCJ 3BDDA 3F3XA 3B6AA 1T8IA 1E17A 3E6DA 1R36A 4AU7A 4U87A 3JRCA 1O3TA 2L9RA 1ETYA 1P4XA 3ZMSA 1UHMA 1YIJI 3JAMZ 4U0WA 2XC7A 3QU6A 4NQWA 1GV2A 3TW6A 1L3LA 4E7JA 4OAYA 2A61A 2PBIA 1R23A 3I5UA 3PQJA 2QWWA 2E19A 1I3QJ 3N05A 3O3KA 4L9NA 5F1JA 1W5SA 2JWTA 2IS6A 2VXDA 2R7UA 2FOWA 1R49A 1BIAA 2DMNA 3SHFA 1XSVA 2A68F 1QBJA 1XMAA 3HPHA 2FE3A 4MLOA 4A3MJ 2LKPA 2HVRA 1TWFJ 4JOMA 2CV0A 4D0PA 3I4NJ 4L9JA 3L2VA 1W0TA 2BGCA 1LDJA 4Y33A 2RNJA 4GXOA 1SMYF 5DD8A 3E1SA 2W82A 5D5XB 2K7LA 2Z33A 2ZXIA 4XOPA 1JUSA 1IAWA 2HU9A 2MW8A 1T39A 2QENA 1KGSA 2Y48A 3ABMH 3IKVA 2QBYB 3CZ6A 5J40A 2UWMA 2DOFA 4I99C 3I55I 3V7SA 3MD2A 4RS8A 1ZLKA 5CQGA 4X1EA 1MBKA 3A01A 3J81Z 3CQZJ 1TWAJ 2EQRA 3GTQJ 4L5JA 2YU3A 2BVMA 3TP3A 3WGHA 3OYCA 4CZCA 2OU2A 5IPAA 5FLMJ 3CJRB 4BS9A 2XB0X 5CVIA 4LGWA 4FHTA 3QP6A 5L3GA 3U1KA 1REPC 3DKWA 1HLVA 1ON2A 2LTPA 2PLYA 3NARA 1TT5B 2IJLA 2NXNB 2Y69H 3BLYA 3K4JA 3LA2A 3LSJA 4BQNA 2HDCA 2IBDA 2W84A 2OV7A 3IUOA 2F48A 3HUGA 3ABKH 2M45A 3HOYJ 2DK5A 3CLOA 1HW1A 2K9NA 1SFXA 3CMMA 2RNGA 3CESA 4RAGA 1BJZA 5CYVA 1UB9A 3ABUA 3H3UA 1VQ9I 3DPTA 4PSWA 5GPAA 1FTTA 3V7RA 2FOKA 3HM5A 4BY7J 5E3MA 2E5ZA 3FXQA 4A3EJ 1F4KA 4QTRA 1JJ6C 2JA5J 3KP4A 4CYCB 1WI3A 1J2XA 4DYQA 3GTGJ 1OR7C 1VQ6I 3SFZA 2BHYA 1YW8A 1Z67A 3BPVA 4Y3OA 1FP1D 2QGUA 4BY1J 2VBZA 2W1OA 1ZR2A 1FJLA 3S2HJ 3RCOA 3GFMA 1MKMA 2DN0A 1IN5A 2FSWA 5J3LA 1W5CC 1J9IA 2A5WA 2PMZN 5EYRA 3HEFA 1A36A 2MYSA 3V8LA 3CO7C 3HSFA 2IGOA 5E3LA 1RR8C 1IG7A 4EGZA 2VJIA 3J7YJ 2NYXA 3BG9A 1BOBA 3IAM2 4XRSG 4C3HJ 2EPFA 1LNWA 3TW7A 3PUFA 5EJCA 4CXFA 4IPAA 1QU3A 1ZH5A 1JGSA 2E7XA 4HBLA 5L3EA 4MIMA 2EZIA 1S8NA 5AIPA 5HOOA 1J09A 2RQQA 4LLLA 4L0YB 2GIZA 1QO0D 4CICA 1SD4A 2F5CA 1YJWI 2QYOA 2OQRA 3OYEA 4IHTA 4LB5A 2FNAA 4KT5C 4F92B 1O57A 2MABA 1U8BA 2PJRA 3G3ZA 1R00A 3WU0A 4F93B 3KYLA 4XOTA 1SMTA 3WTZA 3ZN1A 3W3CA 3BR6A 1DP7P 1FEXA 3C3WA 4LITA 3RYRA 2FF4A 5ERIA 3S16J 4XKVA 4UVBA 3ZQHA 4F3QA 2F2EA 1I27A 1BC8C 1E0EA 1PJRA 4O5VA 5F1RA 3OV8A 3HOVJ 1ETXA 3GTOJ 4BNCA 4EJTA 1YS6A 5F0HA 4PSXA 1HC8A 5FB2A 3HG9A 1DQUA 3HC7A 2OZUA 4ZYGA 3V42A 2M0MA 2NAZA 4D9JA 3OYMA 1U5TC 2OAZA 1NK2P 1UMQA 1FOXA 1YJ9I 4EV0A 2FMLA 3RPUD 5J6XA 5LGTA 5IYDJ 2GWRA 2O8XA 5ICFA 2WV1A 2AQEA 5LHIA 5HNFA 1UFMA 4BE0A 3ZP5A 3FMSA 1XC5A 3S15J 1OR7A 1EJ9A 1UZCA 3HL2A 1R1TA 5J8FA 1FT9A 2QQBA 3FZVA 1W1WE 1YX5A 2VASA 5ICGA 1X58A 2WV0A 3DV8A 1YIOA 3GF2A 3IL2A 2L2OA 1QHHD 4P9UA 4E7HA 2E1CA 2LKSA 4G7HF 2VIXA 4CCJA 4XN0A 1RPWA 1BL0A 2DA3A 4ZH4F 2EIMH 2GA2A 2MC3A 4BUPA 2VPLA 1WPKA 1UELB 3SEQA 1F9NA 1LPQA 1ETWA 2HYJA 4BHPA 1B9NA 1YLFA 2LYCA 3H0GJ 4I09A 3ERED 3P9CA 1A6IA 5D6FA 2DI3A 1ZGWA 4YG2F 2XKPA 3GVAA 2PMZA 2LREA 1VQ8I 3EYIA 1N75A 5IP6A 4HDUA 1R71A 5F04A 2XAFA 2HFHA 1X2MA 2W85A 3QODA 4HZFA 3GO5A 3GTMJ 1LKXA 2MBFA 4XR6A 1OFCX 2ZB9A 1SANA 2OF7A 4QWQA 4M6VA 1KYZA 4L0ZB 5GPCA 3LSKA 3SFIA 1TQMA 4Y7NJ 4XORA 1D8KA 3K4LA 1QA6A 1R5ID 1J59A 5BOXA 3LSIA 4E7KA 1MMSA 1HKQA 4X6AJ 2R7XA 1N77A 4RDUA 2UZKA 2QVOA 1FX7A 3PNVA 2H6CA 4MFEA 1G4DA 2E1NA 1G8XA 2JA6J 5DUIA 2K9LA 1RETA 3B73A 2V9PA 3A1YA 3OL3A 3FHZA 1V3FA 3VYRB 3V8JA 5DV5A 1UJ8A 3HUGB 3E0JB 1U0JA 1B9MA 4WXDA 1IN6A 2RKHA 3KP7A 3OYIA 3K1NA 1VQLI 2EINH 3FK7A 4XRMA 3SXYA 3EYYA 1ZR4A 3IC7A 1U5TA 1K78A 1WJAA 4I01A 2R7SA 3F21A 5JR3A 2Q0OA 2E2JJ 3LAJA 3CUQB 3ONQA 1SFUA 3GLLA 3MZ8A 2CMPA 2CW8A 1LDDA 4BKXA 2P5KA 4G6QA 2E2IJ 1MDMB 4XRSA 2LG4A 5IT3A 1XPXA 2NS7A 4OU0A 2V1DA 3I0TA 2P7CB 1NG7A 2ELJA 3MN2A 2DTRA 1S5LC 4PJNA 1P9QC 4RBOA 2GA1A 2ID6A 2J5PA 4M3GA 5H6QA 3TKYA 3M07A 3CCUI 1K4SA 4KN7X 1JKQC 4E4HA 4L5EA 1B72B 3VSKA 2VBXA 3QYEA 2ID3A 3FWEA 3M4OJ 3DEWA 5HS7A 2DMQA 1UHSA 2VE9A 5BNGA 1XN7A 4II3A 2I10A 4AYBA 4BXFA 3F6OA 2ME0A 1IRXA 3CLQA 2DFFA 3HOUJ 2Z5UA 5JI6A 3BQZA 2VKVA 3DBRB 4GRIA 4PZJA 1XGNA 1OYWA 3DBHB 3RDIA 2X4HA 3R0JA 4MEYF 3U1DA 1VTNC 5DD4A 1TNSA 5TGTA 3WGGA 1YITI 1W36D 3CTAA 3W2AA 2IAIA 4N4OB 1I1SA 2E60A 2O03A 2R7QA 2TCTA 3CCQI 2ESNA 2K9MA 5TISC 3IH4A 5F6FA 5E3NA 3CMAI 3RYPA 3HHGA 2L7KA 3JRFA 3W6KB 1TP4A 3IWFA 3K2AA 4A3FJ 1ZHFA 4JX6A 3OIQA 3DPLC 4OIQF 4FT8A 3PSFA 1VI0A 3OYAA 2ME6A 2P5VA 3HJEA 2WWYA 3HZJA 3I53A 4PK4A 3RPQA 1Z3YA 4HV5A 1HDDC 2DU9A 1VQ7I 3IP4B 5JFRA 3FM3A 2XRLA 4LLGF 5IY5H 3BR3A 4AVPA 5CVJA 2X0LA 4OIPF 3DWLE 3I64A 2IPQX 2K3FA 2GXAA 3V7CA 2WAFA 3SEZA 4Y4RA 4RB3C 2X6YA 1YTYA 2OJED 2QQ8A 3K69A 4GCVA 3RPUA 3LSHA 2ZJQF 2I8DA 2HS5A 3OYBA 3VOEA 2EZKA 5C4JJ 4ZTJA 3C1DA 1XMXA 2ESHA 2GM4A 3P5JA 2GOMA 3GEZA 4XBFA 2M87A 3M1CA 1B1BA 3IKTA 3M8JA 3LQQA 4A3LJ 2DPDA 1MMNA 4BGDA 4IHSA 2MA3A 5J47A 2VBYA 4E7ZA 2K9QA 4NDLA 1D0YA 2VXZA 4LG3A 5D8LB 4HDVA 3MKYB 4NC6A 3MEXA 1DDNA 2HEOA 1G3WA 1BN5A 4CA0A 2M4KA 1MIJA 4HRIA 2CFOA 4GYIA 1WKMA 1KONA 1EA3A 2ADUA 2Z99A 2RVCA 3Q9VA 2R7VA 1BA5A 4QIWN 2DJNA 2W25A 2RREA 5KHDA 4ZYDA 3K4CA 1HKSA 5IP7J 4UUTA 2R5YB 2AS5F 1TW3A 2QBYA 2XV4S 4EM1A 5M3MJ 3SZPA 1YQAA 1KA8A 2KZVA 3GFJA 4P5OA 5J4YA 4OINF 3FKIJ 3JAMK 1BW5A 2D1HA 2K02A 4ESFA 3OYHA 2K86A 4ZZDA 2M8GX 2IEKA 5FO5A 3SZGA 3WHBA 1TTYA 3TDZC 2O8KA 4EJOA 2W57A 4PFPA 1RUNA 4KYWA 2PMHA 3KEOA 1EH7A 3OIPA 2QSFX 2DO7A 2X48A 2XAUA 3MKLA 2HZTA 5AIQA 3RSNA 4BJTA 2D45A 3CCEI 3BG5A 2QQ9A 2JTVA 3B6CA 3DF8A 3S32A 3EUKL 2LH9A 3RQIA 3W2WA 2PX9A 3OR2C 4DBRA 4H4KC 5EZHA 4DYRA 2PMUA 2X1CA 4R1HA 1G3TA 1EKEA 1MH4A 3W6VA 2KIFA 2O5RA 3VDXA 4V19K 1NTCA 3S14J 1SVLA 3IRQA 2P4WA 4AIDA 4CYCA 3J80K 1BR2A 2DW4A 4B1RA 3S17J 2EIKH 1RUOA 4UHTA 4M6XA 3G6EI 3BG7A 3K70D 3BTJA 3NQOA 4Y13A 1GT0C 5CVRA 5F0CA 2A07F 5E18F 1S6LA 4B43A 3A4CA 3WTWC 1O3SA 1KQ8A 1FBUA 4GYGA 4RAZA 4LLNA 1XGOA 3WE2A 4X0GA 5BQTA 4RMNA 3IHUA 4DW6A 3IWZA 1PP8F 5HVQC 3TBIA 4A6EA 1FY7A 2DFIA 5E1WA 2XGDA 2H1KA 2VOOA 2OC6A 2XRNA 1QGPA 2RQPA 3PO2J 3ML6A 1BI3A 1JHFA 3FBIB 1IN7A 3J7ZI 2DCEA 1DPRA 5CJ9A 5IYBJ 1SAXA 4G8XA 1YHQI 1MNDA 1RZ4A 3D5LA 1CF7B 1H9GA 5F27A 2QF7A 1UAAA 1Y56A 4J01A 2COMA 3BJAA 2VC0A 4YELA 1F1ZA 2ICWG 2MLGA 2KQRA 5J1UA 4BDZA 1SAUA 1SVMA 2N8GA 1RIOH 3HOSA 3KZIC 2L3DA 1OLTA 1Y1VJ 2RV8A 1D5YA 1WVRA 4BHCA 4HF1A
chains in the Genus database with same CATH topology
3S93A 1OR7C 3BG6A 2Z2SB 4ZYAA 2KDOA 4IQJA 2CS3A 3PFYA 4Y3OA 1X1DA 3H9GA 4KITB 2W1OA 3PNTA 3RCOA 1PYVA 3S8PA 4XONA 1YE9A 2A5WA 2MYSA 2IGMA 4HNUA 3LSMA 4IX7A 1HA8A 2IGOA 4KJZA 4NNJA 4U7BA 2VJIA 2F5VA 3ZQQA 3PJRA 1X4PA 2Q1ZB 3HPGA 1BOBA 3IAM2 1DGWY 2WA0A 3I9V2 3LSGA 4YRVA 1WJFA 2WAQA 2K3PA 1QU3A 1Y6IA 3DKYA 4XLCA 4ZC3A 2AQFA 2ZFUA 3ZR8X 5HOOA 1J09A 2RQQA 5CQEA 1TT0A 2WBMA 3QYBA 4XLHA 2IS1A 3DU6A 2NOJB 3K70C 3G2BA 3OYEA 2DXIA 2KMUA 4NUBA 4F92B 2MABA 2Z16A 1MNEA 2PJRA 4CSWA 2V1NA 1JI8A 4QPQA 4BQQA 2GOXB 3TL4X 3MKZA 1WFXA 4F93B 3KYLA 4XOTA 3DPUA 2CH0A 3W3CA 3OYDA 1VZ0A 4LITA 3S3MA 4XKVA 1MW7A 4E7IA 4F3QA 1DGRM 3AL0B 1E0EA 1PJRA 4F55A 3FKJA 4R79A 4FETA 4IQ4A 4PSXA 4EATA 3RTRA 4DJAA 2W4SA 3HG9A 2M7AA 2ZSHB 3BC8A 4BE1A 1DQUA 1ZELA 4XNFA 3HC7A 2LOOA 2JSPA 4RM3A 3V42A 2K5CA 2LBFA 2CW7A 2M0MA 2P0WA 4D9JA 2WB1A 3OYMA 3ZXSA 3DTKA 4IKFA 2LC2A 2X1DA 1R6RA 3DEEA 4BE2A 3OY9A 1MMAA 3CP2A 3BCBA 2CUJA 3RPUD 4ZDOA 2AQEA 3CJQB 3MMYB 5HNFA 4BE0A 2HVSA 4PJMA 4XM3A 5LFAA 3OYLA 3KX2A 3EUAA 3CF2A 3HL2A 3TMOA 1X1CA 3GBGA 2PJRB 1YX5A 2VASA 2VKDA 4N4NB 3L2RA 2W7NA 3LFUA 2L2OA 1QHHD 4IZZA 3DLAA 4PJLA 1BR4A 4E7HA 1WJBA 4ZJZA 2VIXA 4CCJA 4CUGA 4XN0A 4PFOA 3H5AA 3K4MA 4BUPA 2VPLA 1UELB 3NWTA 3SEQA 2Q2EB 2R7RA 2LYCA 2XSJC 2A6TA 5JHFA 1N78A 1GLNA 2M3AA 2PMZA 2LREA 1N75A 3I3LA 2LBFB 2X51A 3QODA 1D0XA 2DOAA 2V6EA 3UNGC 3HOTA 1ERDA 2WY7Q 3C2HA 1NG6A 1LKXA 2F6CA 4KT6A 4XR6A 2IGKA 2V9KA 3DKXA 3PNYA 4DBQA 1FMWA 3LSKA 3PL8A 2VKHA 4PUSA 4XORA 2KL4A 3D5SC 3K4LA 3J7AY 2R4GA 3LSIA 2HQAA 4E7KA 4E7LA 2KRHA 4B47A 2CV2A 2R7XA 1N77A 4RM2A 4HEA2 3PNVA 1V5GA 2MC4A 1T95A 1G8XA 2K9LA 2W00A 1TZLA 3A1YA 3OL3A 4XKCA 3VYRB 4BJ5C 4C2UA 1WJ5A 3HUGB 3E0JB 1U0JA 3AKZA 4RLFA 2IS2A 3OYIA 1D0ZA 3OOUA 1WJAA 3FDYA 2R7SA 4AVZA 3L2UA 3DQVC 1QHGA 3ONQA 3W2VA 4BEHA 4J00A 4NC8A 2CMPA 2CW8A 4KISA 3OYNA 3OYKA 4C30A 1W36C 2LG4A 2HVQA 3EPZA 4XMYA 1NG7A 2ELJA 2E5NA 3SDBA 4OWRB 2Z1DA 4PJNA 1P9QC 2IGNA 2X1EA 4B48A 2XF6A 4BJ6C 4CCLA 1V5FA 3ZGKA 4E4HA 2CV1A 3F9KA 3VSKA 3HKZA 3VYUB 1AA7A 3QYEA 2JUGA 5HLTA 4ZDPA 1LVKA 2VQGA 2VJJA 3C2GA 3DTIA 4II3A 4AYBA 3QOEA 4BXFA 4CCNA 5FROA 3H5RA 1IRXA 3SYTA 3QYFA 5KNLA 4GRIA 2MFZA 4LIVA 4DOZA 1W36D 5TGTA 3W2AA 2E1MB 4C2TA 2R7OA 3CP8A 3S3OA 4II2A 4N4OB 3RQ4A 2E60A 3NWSA 2R7QA 2K9MA 4F91B 3VYTB 4BEHB 4HSTA 1Z7LA 2ZXHA 4HG2A 2L7KA 3K4KA 2HPIA 2F4IA 2LY2A 1V5EA 3DU5A 1SFKA 3OIQA 4D1QA 3DPLC 4XL9A 4DIQA 1D1BA 4E6KG 3PSFA 3OYAA 2LY1A 1D1AA 3LL7A 4PK4A 1LFPA 2BW3A 2KPMA 2OUMA 1YX3A 1X1AA 2WADA 4XKBA 3VYSB 4B44A 2R7WA 1Z3YA 5FRNA 1WJDA 2XF5A 2BVLA 2VJ4A 2LRDA 3IP4B 4JQFA 2V7FA 4QPOA 3OR1C 3ZRGA 4HNTA 4ANJA 2WAEA 2JVGA 2VQHA 3DWLE 2FUG2 4BQOA 2VLAA 2L5QA 2WAFA 4Y4RA 3SEZA 3H35A 1DP3A 3OWTA 2X6YA 4BL0B 3AFHA 1X4OA 4CCOA 5FRMA 2V4JC 3LSHA 2KHMA 2XDVA 2X85A 2I8DA 2HPMA 3OYBA 2BOLA 3H9QA 4XLFA 3OYFA 4BU2A 3OYJA 2X6XA 4LIUA 4ZTJA 2L9SA 3OL4A 1FMVA 2GOMA 2JVHA 3L2WA 1D1CA 4B3XA 3A2KA 2WY8Q 3M1CA 3M8JA 4OAZA 5KCMA 1BR1A 4CH7A 4ZTFA 1MMNA 4BGDA 1MMGA 3DTEA 2Y0SA 3LMMA 1WJEA 4E7ZA 1D0YA 2VXZA 4LG3A 1Z3XA 3MKYB 3U21A 1K6YA 4CA0A 2M4KA 4HRIA 4ZDLA 2CFOA 2BW3B 2VB6A 1G59A 1KONA 1EA3A 4ITVA 2QKLB 2JA2A 2R7VA 2DT6A 4CCMA 3H0DA 2RREA 2CUZA 4E7SA 3K4CA 5KHDA 1WJCA 3OS0A 1T0FC 2VL8A 4XQFA 4NC7A 4AU7A 4U87A 5LD2C 2XF7A 4P5OA 2KZVA 3PSIA 2XC7A 3OS1A 4E7JA 1UG0A 4OAYA 3OYHA 1X19A 4XLEA 3SZGA 3AL0C 2DJIA 3OS2A 2HDWA 3N05A 2KLOA 4PFPA 3OMYA 2VXDA 3L2QA 2IS6A 2R7UA 3OIPA 3EUHC 3PUBA 2XAUA 4BJTA 3K4NA 3RSNA 1LDKB 2VQLA 3HPHA 4MLOA 2HVRA 3S32A 3EUKL 2IXSA 4JOMA 2CV0A 2LH9A 3W2WA 4DBRA 3OR2C 4H4KC 4BDYA 3L2VA 2X1CA 3K4BA 4DGWB 4Y33A 2O5RA 3VDXA 1X1BA 2M4GA 3OYGA 3E1SA 4XKWA 2W82A 4C9YA 3D5RC 3HXLA 1BR2A 2E1MC 2IS4A 2ZXIA 4XOPA 4XN3A 3BG7A 2HU9A 3K70D 1Z21A 2UWMA 2MD0A 3CZ6A 4BACA 4B43A 3A4CA 3H9JA 3MD2A 4X0GA 2UUZA 4RMNA 2VJ5A 4RLQA 5CQGA 4NQWB 5HVQC 3TBIA 5CPRB 3H5NA 2HNHA 4P1WA 4YEJA 3UR3C 2OC6A 4PJJA 2BVMA 3VSLA 3FHNA 2KP6A 3OYCA 1S9HA 4CZCA 1MMDA 3IAS2 3CJRB 2X6WA 4BS9A 3FBIB 3S3NA 2DCEA 3ZCOA 1MNDA 2VQCA 3BLYA 3K4JA 3D5LA 4BQNA 2QKMB 3FBNB 4G6TB 4XLAA 4HSRA 1UAAA 2OV7A 2ZSIB 3IUOA 3K6GA 1Y56A 3KEYA 4HPQA 2KRCA 4CCKA 4J01A 2V26A 2HZDA 3CMMA 2RNGA 2L9NA 3CESA 3VWBA 4FASD 4YELA 2M7BA 2DT7B 2KQRA 3DPTA 2UV1A 4PSWA 4BDZA 1SAUA 3BCAA 2R7TA 5CKTA 5HNHA 3MKWB 3HOSA 3K10A 1OLTA 2E5ZA 4F52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOO A; 
#chains in the Genus database with same CATH topology
 1Z77 A;  5FD6 A;  3M8E A;  1K4T A;  3E6C C;  2Z2S B;  2M30 A;  4MQV A;  3T8R A;  3X2Q H;  4IQJ A;  2R93 J;  2FRH A;  4CGZ A;  2P7V B;  4BXU A;  2L7F P;  2XAG A;  5L3C A;  2D5V A;  2JRM A;  4IXA A;  1I5Z A;  2KDZ A;  3P9K A;  3I58 A;  4BYY A;  5H6R A;  1IN4 A;  4L5I A;  1FIA A;  4ENN A;  2IA0 A;  2DFH A;  1ZK8 A;  3BJ6 A;  5HLI A;  5A2Q Z;  1BI0 A;  3LSG A;  1DGW Y;  1JGG A;  1P7I A;  3TED A;  1SFO J;  3CUQ C;  4P96 A;  3DKY A;  3A03 A;  3KET A;  2QEX I;  1B6A A;  2OPT A;  4XLC A;  2TDX A;  4Y17 A;  2LDU A;  3H92 A;  2EFO A;  2ZME C;  4OMY A;  4XLH A;  3S2W A;  2IS1 A;  4M72 A;  4UXN A;  2GLO A;  4M74 A;  2NOJ B;  3K70 C;  3G2B A;  1H8A C;  1EV7 A;  2KJB A;  5J1R A;  2L54 A;  4M6Y A;  3H1C A;  3SJM A;  5GTH C;  2V1N A;  2VOP A;  4BQQ A;  1DUX C;  1WFX A;  1FSH A;  1U2W A;  1ZTR A;  4ESB A;  3OYD A;  2NVT J;  1VZ0 A;  4BHB A;  1A31 A;  4M3F A;  4E7I A;  2B0L A;  2H09 A;  3KCC A;  1ZRE A;  3FKJ A;  1KU9 A;  4R79 A;  2NVU B;  2GXB A;  3BRO A;  3IRR A;  4DJA A;  5IT9 K;  4M71 A;  2UXN A;  3BC8 A;  2EFN A;  4BE1 A;  4MTD A;  4XNF A;  1ZEL A;  3ABT A;  3J80 Z;  1ZG3 A;  2XB5 A;  4YFX F;  4O3M A;  2K5C A;  4LJZ F;  2CW7 A;  3VPR A;  2FQ3 A;  3ZXS A;  3DTK A;  1IJW C;  4OIO F;  1TQP A;  4UNO A;  3S1N J;  1YG2 A;  1MMA A;  4M3E A;  2IW5 A;  4ZYH A;  4ZDO A;  1FNN A;  3TOB A;  3KP2 A;  2M8E A;  3KP6 A;  4XM3 A;  3L09 A;  2E7W A;  1USS A;  3CDI A;  3TO9 A;  1X1C A;  3TQN A;  4YFN F;  3GTJ J;  4AIJ A;  2MH9 A;  2FD5 A;  4ENJ A;  2LVS A;  2W7N A;  2MD5 A;  2YSR A;  5ILV A;  3TOA A;  4E70 A;  3I56 I;  3JRG A;  1O4X A;  3FIW A;  3P7N A;  4PJL A;  1BR4 A;  5F0F A;  2B63 J;  4FQG A;  2R7F A;  3K4M A;  5K7H A;  4UVC A;  4DZP A;  5EG0 A;  1IRG A;  2ZJ2 A;  2R7R A;  5FLV A;  3F8B A;  3K2Z A;  3T5X A;  1ULY A;  2FU4 A;  2O9L A;  2A6T A;  4MTE A;  3CDH A;  3GZN B;  2DYS H;  3CUQ A;  3LSR A;  1ITY A;  4O6J A;  2L0K A;  3O2P E;  1XDU A;  5EEG A;  2LBF B;  5FKO A;  1ON1 A;  1LVA A;  1XMK A;  5BMZ A;  2DOA A;  1MDM A;  4EVI A;  1ERD A;  3HOT A;  2R7Z J;  2ZME A;  2XUB A;  2DOD A;  2IGK A;  3PNY A;  3I54 A;  4DBQ A;  1O7L A;  1QPM A;  1SD7 A;  2NNY A;  1YYV A;  1I6H J;  3F22 A;  2KL4 A;  1B8I B;  3PIP F;  2V79 A;  1Z9C A;  3J7A Y;  3RZO J;  3BG3 A;  1GXP A;  2JQ7 A;  3F8C A;  5FKL A;  4I98 B;  3V8K A;  4GDF A;  1B72 A;  2RC4 A;  4IJA A;  2LF8 A;  2MC4 A;  3E6B A;  1LEA A;  2HKX A;  1HDP A;  4I02 A;  2COB A;  3FM5 A;  3A0B C;  3M3Y J;  1P4W A;  4KIB A;  4P9F A;  2Y30 A;  2ISY A;  1G2H A;  2R3S A;  5HLH A;  2XGX A;  3EDP A;  2IS2 A;  3KLN A;  1WH5 A;  3L1P A;  1OYY A;  1XD7 A;  3COA C;  2RDP A;  3FDY A;  4EEF G;  3DQV C;  1P7J A;  1X3U A;  3BZ6 A;  3WG7 H;  3CCV I;  3W2V A;  4Z6Y A;  1MGT A;  2MGQ A;  3ABL H;  4U7D A;  3D1N I;  3HOW J;  2RN7 A;  2R0Q C;  2HQR A;  1MBJ A;  4LFU A;  3MWM A;  2ELH A;  1YW9 A;  2IVM A;  1TC3 C;  3K9T A;  4OWR B;  5IT9 Z;  1WGX A;  1MSF C;  3K1P A;  2Y0M A;  5M5Y J;  2X1E A;  4B48 A;  2HDD A;  2O7O A;  3KZZ A;  2AXT C;  1YOV B;  4BJ6 C;  1V5F A;  4RGU A;  3F9K A;  2I5U A;  2JPC A;  2F5F A;  1I39 A;  2WAQ N;  1T98 A;  4ASN A;  2P5L C;  3VYU B;  2DA1 A;  1BW6 A;  4L9V A;  4HQM A;  2VON A;  2QZ8 A;  4BBS J;  4CDG A;  1LVK A;  2VKE A;  3C2G A;  4KFC A;  1SVO A;  4D7N A;  4A3B J;  2M2E A;  2ISZ A;  4A0X A;  4UB8 C;  3SYT A;  3QYF A;  1TWG J;  1EH8 A;  2EFQ A;  4DOZ A;  5FD5 A;  4WXH A;  2R7O A;  3CP8 A;  3S3O A;  2ZXJ A;  2CW0 F;  2L9V A;  3GUD A;  2KFD A;  4JP0 A;  4HX7 A;  1TL8 A;  3VYT B;  4BEH B;  3C18 A;  3RKW A;  3LSP A;  4UV9 A;  1RR7 A;  2EV6 A;  1QQI A;  1V5E A;  3DU5 A;  1O3R A;  2L02 A;  3DFG A;  3QOP A;  4XL9 A;  4DIQ A;  3F8F A;  1JKR C;  4E6K G;  1EF4 A;  5L3B A;  5GAG J;  3ASN H;  4UUS B;  2LY1 A;  3LL7 A;  3U9G A;  4YII A;  1JUM A;  2JA8 J;  3ZQI A;  2ZJP F;  1YX3 A;  1A35 A;  2IA2 A;  4HF0 A;  2E36 A;  4PDK A;  4U0Y A;  1WJD A;  5BPD A;  2NS8 A;  2VJ4 A;  3KPH A;  1FTZ A;  2A05 A;  3DCF A;  2R92 J;  3A0H C;  2R5Y A;  1P6R A;  4ZYE A;  3OR1 C;  2HYF A;  3CCR I;  1LE8 A;  3BP8 A;  2WAE A;  2M5W A;  2KZG A;  4K2E A;  4BQO A;  3ZQC A;  2FQ4 A;  1YJN I;  2XPU A;  3OWT A;  4EJV A;  4BL0 B;  4RGR A;  4LMY A;  4A5M A;  5LBQ A;  3AFH A;  4CCO A;  4A0Z A;  1XTA A;  2XIG A;  3P9I A;  1R22 A;  1RES A;  2EJR A;  3JRH A;  1GDT A;  2XDV A;  4MFD A;  2HPM A;  2K4B A;  1YRN B;  2CFX A;  1A04 A;  1FBS A;  4XLF A;  3CCM I;  1HKT A;  4LIU A;  3MZH A;  3R6S A;  1T6S A;  4B3X A;  2WY8 Q;  5ED4 A;  1MNM C;  2CO5 A;  4FCY A;  3HBL A;  5HOD A;  1Z7U A;  1VND A;  3LMM A;  1WJE A;  5CVV A;  2YR2 A;  3H3Z A;  4EM0 B;  1QPI A;  3OSG A;  3U21 A;  1K6Y A;  3LA7 A;  2DMU A;  5EG0 B;  1ENH A;  2XHK A;  1G59 A;  3AG1 H;  2M34 A;  4ITV A;  2F4O B;  3AAF A;  2JA2 A;  2FXA A;  3CMY A;  2CUZ A;  3O8H A;  3OS0 A;  2VL8 A;  4XQF A;  1JJ8 C;  2E35 A;  4D5C A;  1APL C;  2A69 F;  1FOW A;  5EF6 A;  5LD2 C;  2XF7 A;  3T0Y A;  1GUU A;  3SZT A;  3JSO A;  2JN6 A;  1QVU A;  2ZME B;  3DEU A;  1ZKG A;  4I6Z A;  2MSY A;  4V2G A;  3WTS C;  3OS1 A;  1J5Y A;  1UG0 A;  4YIF A;  1X19 A;  2VN2 A;  2B7E A;  4XLE A;  4ON0 A;  2JMW A;  1NH3 A;  1OYI A;  4IO9 F;  2HDW A;  1TWH J;  5E17 F;  1G3Y A;  4PGG A;  2JK3 A;  2KLO A;  3OMY A;  3F72 A;  3HB9 A;  2CG4 A;  1WCM J;  3PUB A;  5ILS A;  3K4N A;  1LDK B;  3BOQ A;  1CF7 A;  2NVY J;  5E3O A;  4ENK A;  2B9S A;  2L4M A;  2E34 A;  2VT2 A;  3GZ5 A;  4Q47 A;  3GTP J;  2IXS A;  4UY8 I;  4G94 A;  4S05 A;  3CJT B;  2ETH A;  1AWC A;  4OMZ A;  2KIM A;  1UST A;  4BDY A;  4UUV A;  3I4P A;  2AHQ A;  2HR3 A;  5F64 A;  4DGW B;  1AOY A;  1NK3 P;  2H27 A;  2JUC A;  3OYG A;  3HDD A;  5LRR A;  5B1A H;  1XG1 A;  4C9Y A;  1R5H A;  2X6O A;  3ZQG A;  3HXL A;  4LK1 F;  2E1M C;  1OIS A;  5K7F A;  1XCV A;  2ELK A;  2FMY A;  2LK2 A;  4N0B A;  1Z21 A;  2MD0 A;  1FWZ A;  3U2R A;  3WOD F;  4KN4 X;  1X1P A;  2LSO A;  1Q1V A;  1U6G A;  4BBR J;  2UUZ A;  2E2H J;  1JHH A;  4EMS A;  4IRG A;  1RNL A;  1ZN2 A;  1MBG A;  1Z6R A;  4FIS A;  2DMT A;  1W4M A;  4YEJ A;  3UR3 C;  1Z05 A;  3FXK A;  3HKZ N;  4Y15 A;  3PQK A;  3VSL A;  3FHN A;  1S9H A;  3I59 B;  2PI0 A;  2W24 A;  1W0U A;  2HXO A;  4IF4 A;  1M1E B;  1TNT A;  2O6G E;  3S3N A;  5M5W J;  1S7A A;  3ZCO A;  4FX4 A;  1IC8 A;  4MEX F;  2VBW A;  3QP5 A;  5FFZ A;  2DTZ A;  2HKO A;  3H3V K;  2P6S A;  3PFI A;  2DA2 A;  3FBN B;  4G6T B;  4CYD A;  5JVG F;  2ZSI B;  3KEY A;  4HPQ A;  2KRC A;  3OSF A;  3O6B B;  2V26 A;  2YX7 A;  2HZD A;  4IHW A;  2L9N A;  3LFK A;  4WWC A;  3VWB A;  1F5T A;  4GFB A;  3E5Q A;  2XKO A;  1G6N A;  3MVP A;  1D8J A;  2R7T A;  2UV1 A;  1ZAO A;  3BCA A;  3ERM A;  3LOC A;  2LFB A;  5HNH A;  5FGM A;  5D5U B;  1JKP C;  2DMP A;  1VQO I;  3WG9 A;  4EQQ A;  3CDL A;  4KIF A;  2BXZ A;  3BG6 A;  4IRH A;  5DM6 F;  1IGN A;  3ZQF A;  2CS3 A;  3PFY A;  3SDG A;  1YS7 A;  3HRS A;  3H9G A;  3KEQ A;  5B3S H;  2KT0 A;  3WU1 B;  4NHJ A;  1AKH B;  4HF2 A;  6PAX A;  2L01 A;  4XON A;  1HCR A;  1YE9 A;  5FKK A;  1S7E A;  3HRM A;  3VOD A;  2VT3 A;  3E6M A;  4HNU A;  3LSM A;  3I71 A;  4NNJ A;  1XGS A;  1ZAR A;  4U7B A;  4G6D A;  4KUM A;  4RAY A;  3ZPL A;  1JUP A;  2M9H A;  1R1V A;  1L0O C;  1X4P A;  3HPG A;  1UHW A;  3NAU A;  3AG2 H;  3G1M A;  4YRV A;  3I9V 2;  1ZG5 A;  2J5O A;  5A2Q K;  1WJF A;  3CC7 I;  2A6H F;  1SD5 A;  1LE8 B;  2K3P A;  2M1B A;  3CME I;  1KQ9 A;  4A3C J;  3ZR8 X;  4XID A;  1U78 A;  2CGP A;  1TT0 A;  2WBM A;  3QYB A;  3CCL I;  1MH3 A;  4NB5 A;  5AON A;  2ACJ A;  3CJN A;  1R9T J;  2DXI A;  1WWX A;  2KMU A;  4NUB A;  3JR9 A;  3ASO H;  3BPX A;  3MFK A;  3FF5 A;  2L7Z A;  4CSW A;  5B5E C;  1E3P A;  1UG2 A;  4ETS A;  2HXI A;  1JI8 A;  4RB0 A;  2GOX B;  2CU7 A;  3TL4 X;  1QZE A;  4EJW A;  3G4S I;  3CD6 I;  4EM2 A;  3S3M A;  4A3D J;  3FK6 A;  3DP7 A;  3A02 A;  1MW7 A;  5K1Y A;  4KA4 A;  4LG0 B;  4B09 A;  1DGR M;  3VEP A;  3AL0 B;  1T08 B;  2BY1 A;  3D0S A;  4L9T A;  4F55 A;  5KVR A;  4LB6 B;  3Q0W A;  4FET A;  4WXC A;  4IQ4 A;  4HW0 A;  4A3K J;  3RTR A;  2ZSH B;  1WSU A;  4M3D A;  4RM3 A;  2LOO A;  2STW A;  4H0E A;  3S1M J;  2LBF A;  4AIK A;  4C3J J;  2PFB A;  4M9S A;  4A6D A;  2KIU A;  1HQC A;  2DQL A;  2A5Y B;  1I6X A;  1C0W A;  4IKF A;  2EZH A;  3ISP A;  3OIO A;  4UVA A;  3CUO A;  1R6R A;  4BAY A;  5C3E J;  3DEE A;  3MAJ A;  2DA7 A;  4D7M A;  3WHC A;  3KYC B;  2JT1 A;  1X3W B;  3CP2 A;  3BCB A;  2CUJ A;  1FC3 A;  3BR2 A;  1V4R A;  1Z1D A;  1OCT C;  5DYM A;  4I76 A;  1ACI A;  1B8I A;  1EH6 A;  5CLS A;  4LD5 A;  5FFX A;  2K4J A;  2XAQ A;  3OYL A;  3KX2 A;  2CWE A;  1OCC H;  1CGP A;  3CF2 A;  3TMO A;  1GVD A;  5TRD A;  3KFW X;  5K5O A;  5C44 J;  4M73 A;  4J19 A;  4WF2 A;  3GBG A;  5GTI C;  2HGC A;  1YW7 A;  3DLL F;  1HBX G;  2VKD A;  4RA2 A;  2GZW A;  1W5T A;  3GZ6 A;  2FBI A;  2XAS A;  4IZZ A;  2A6E F;  4IOA F;  3DLA A;  2CQK A;  1ZGA A;  2ZNZ A;  1IUF A;  1ZGJ A;  4V2F A;  3JTG A;  5BS6 A;  3G71 I;  4IOC F;  3E97 A;  4KMF A;  4QSH A;  1RKT A;  3PM1 A;  1GVJ A;  2YUS A;  4XSX F;  3BR0 A;  3GLX A;  3G1L A;  3NWT A;  2Q2E B;  2XSJ C;  5M5X J;  3CO6 C;  4DNC A;  5JHF A;  1N78 A;  1GLN A;  3JRB A;  2KIS A;  3I3L A;  5EZG A;  1HF0 A;  3JRE A;  1BBY A;  2X51 A;  2V6E A;  3C7J A;  3UNG C;  5LRS A;  2OA4 A;  1LUJ B;  1ONV A;  5L3D A;  1GXQ A;  2Y75 A;  4KT6 A;  2DFE A;  3DKX A;  1QVT A;  1KQ0 A;  2CRG A;  1FMW A;  2OTL I;  4PUS A;  3GWZ A;  2Q8K A;  1VQ5 I;  2OBP A;  3D5S C;  4M3B A;  5D5W B;  1W7P B;  1P2F A;  4I0B A;  3FXJ A;  1V54 H;  2RGV A;  1QZZ A;  4CHU A;  4E7L A;  2EV5 A;  2HWV A;  2KRH A;  4B47 A;  2Y2Z A;  5GP9 A;  1VQ4 I;  2BE5 F;  3R60 A;  1WZ2 A;  3BZC A;  1T95 A;  2VI6 A;  1ETV A;  3HOZ J;  2E1O A;  2W00 A;  1TZL A;  2ZCW A;  2ZC2 A;  4BJ5 C;  1MBH A;  2D1V A;  3RKY A;  5GAH J;  3CC2 I;  1YO5 C;  1IDY A;  2XGC A;  3RKX A;  5J1Y A;  3AKZ A;  3Q0U A;  2HOT A;  1JT6 A;  1D0Z A;  3OOU A;  1K79 A;  4GO1 A;  1LEB A;  3G73 A;  2BZT A;  4AVZ A;  3L2U A;  2XGE A;  4YIR X;  1R4N B;  1QHG A;  4BEH A;  1IO2 A;  5DM7 F;  5LHG A;  1QZY A;  4KIS A;  3OYN A;  4HV6 A;  1POG A;  1ZYR F;  1LB2 A;  4AIH A;  5JLW A;  4C30 A;  1D3Y A;  2TRT A;  3K1M A;  1H0M A;  3BJO A;  5LEJ A;  5D4R A;  3EPZ A;  4AD9 A;  3Q9S A;  4XMY A;  5K5R A;  4UUS A;  3UKG A;  3SDB A;  4Q5S F;  1OCR H;  4BH9 A;  1FBQ A;  4ABZ A;  1JKO C;  1HW2 A;  1R58 A;  1Z91 A;  1JT0 A;  4L18 B;  2Z1D A;  2DA5 A;  1HXD A;  2IGN A;  1XB4 A;  2XF6 A;  3W6J B;  4CCL A;  3ZGK A;  3T1B A;  1P92 A;  3MZY A;  3ZMV A;  3S2D J;  3NEU A;  2JZY A;  3HGY A;  5GAD J;  4HNV A;  1T33 A;  2NVQ J;  1VQM I;  1AA7 A;  2QA4 I;  4JX5 A;  2OD5 A;  2JUG A;  2GXG A;  1GV5 A;  3R61 A;  3ZMU A;  2BXY A;  4ZDP A;  2VJJ A;  1U8R A;  1KU7 A;  4N9H A;  3G1O A;  3EET A;  5KAF C;  5FRO A;  2Y9Y A;  1ORK A;  1X3Z B;  1FYM A;  2IRF G;  1AHD P;  1MSE C;  4LIV A;  3BT9 A;  1YRN A;  4UB6 C;  3E3V A;  5EEH A;  3GXO A;  2E1M B;  3KP5 A;  3KE2 A;  4II2 A;  3RQ4 A;  1KYW A;  5J8C A;  2DA6 A;  2G9W A;  1WI9 A;  2Z9O A;  3GCM A;  5KAI C;  1MJ9 A;  2IT0 A;  4A0Y A;  2PJP A;  2QLZ A;  3FXL A;  3K4K A;  2OZ6 A;  2LY2 A;  1ZG1 A;  5HS9 A;  4HA8 A;  4GGG A;  1Y8Q B;  1J0R A;  4CZZ A;  2AO9 A;  1D1A A;  3IH3 A;  2EA2 A;  3E5X A;  1LFP A;  1VQP I;  2ZO4 A;  4PGH A;  2KPM A;  5JVT A;  1ZRC A;  1PUF A;  2OUM A;  1UCR A;  1X1A A;  2Z3Y A;  1STZ A;  4XKB A;  4OIR F;  3VYS B;  3WE3 A;  4B44 A;  2PQ8 A;  1Y0U A;  3FXO A;  3TO7 A;  1ZRD A;  5FRN A;  1MD0 A;  2XF5 A;  2XAJ A;  2ZXW H;  3FXR A;  5DCM B;  4HLY A;  1SD6 A;  5GAE J;  2AXL A;  3ZRG A;  5D5V B;  2DT5 A;  2CUF A;  2FUG 2;  2KKO A;  2ZFW A;  2VLA A;  2CSO A;  4IL6 C;  2FA5 A;  4W97 A;  2L5Q A;  4B4C A;  3K0L A;  4G12 A;  4KIG A;  1U9N A;  5FRM A;  5EGO B;  4R8H A;  3TO6 A;  4B3A A;  1DU0 A;  2KHM A;  5HLG A;  3F6V A;  2BOL A;  3H9Q A;  2P8T A;  2DDB A;  2VC1 A;  4BU2 A;  3OYJ A;  2X6X A;  4B8X A;  3OL4 A;  2R5Z B;  1FMV A;  1MBF A;  3M7G A;  1YFH A;  3HRT A;  3A2K A;  1VFC A;  2CYY A;  2HOS A;  1IXC A;  2HQN A;  4HX4 A;  4FX0 A;  1BR1 A;  4OAZ A;  4CH7 A;  4MNU A;  3Q3S A;  4XRF A;  4ZTF A;  4XIC A;  3CCJ I;  2H8W A;  4A3G J;  1Y1W J;  2ECC A;  1Z3X A;  2F4M B;  1TW2 A;  3GME A;  4WCG A;  4MQ9 F;  2BW3 B;  2DPU A;  1OKR A;  3QRF F;  2G0E A;  2LP0 A;  2QKL B;  2DT6 A;  3LA3 A;  1LJ9 A;  1TLH B;  3H0D A;  1LFU P;  4MO7 A;  2Y9Z A;  5J4V A;  4E7S A;  1BC7 C;  2GQQ A;  1WJC A;  1XCB A;  3FIS A;  1T0F C;  3ROU A;  4HX8 A;  1XDS A;  1I1G A;  1SFE A;  2XPW A;  2K85 A;  1MBE A;  3SQN A;  4NC7 A;  4DYC A;  1B4A A;  2CQX A;  4U0V A;  2BY3 A;  2H8R A;  4HAM A;  1QNT A;  3PSI A;  1W7P D;  2EFW A;  4XLN F;  4D5F A;  2O0Y A;  3Q0V A;  3AL0 C;  2DJI A;  3I59 A;  4FE7 A;  3OS2 A;  4AC0 A;  3L2Q A;  4AUX A;  4A2U A;  1A6Q A;  3IV5 A;  5D6E A;  5F08 A;  2DA4 A;  2VOD A;  3EUH C;  1WHU A;  2EFP A;  3B02 A;  4RGX A;  3F23 A;  1NHA A;  5H20 A;  3O8G A;  5FLX K;  2VQL A;  3ZOB A;  1WQ2 A;  2KIQ A;  2HTJ A;  2NRA C;  4XSZ F;  4U88 A;  1T56 A;  3JW4 A;  3ULQ B;  3ZQ7 A;  3R0A A;  4A3J J;  3K4B A;  1ZQ3 P;  1X1B A;  2M4G A;  3TDU C;  5D8K B;  1R1U A;  3F0C A;  4S04 A;  4XKW A;  1Z0X A;  3BQY A;  5E8I A;  3D5R C;  3ECH A;  2IS4 A;  3CF5 F;  3QPS A;  2HYG D;  4XN3 A;  2BEO A;  1FYK A;  4JK1 X;  1DPU A;  3M9A A;  3VB2 A;  5E79 C;  4BAC A;  2YU9 J;  5BPI A;  3CC4 I;  3H9J A;  3AG4 H;  1AKH A;  3IH2 A;  1F36 A;  3DXJ F;  2VJ5 A;  4RLQ A;  4NQW B;  4ENM A;  5H2F C;  5CPR B;  3H5N A;  1OJL A;  2HNH A;  4P1W A;  3M1E A;  4PJJ A;  3EQL F;  1IRF A;  1Y8R B;  2KP6 A;  2WB1 N;  4IHV A;  1MMD A;  1OQY A;  3IAS 2;  2X6W A;  2FX0 A;  1I3A A;  4LK0 F;  2BV6 A;  4AYB N;  1BI2 A;  1VF9 A;  2DLL A;  4Q48 A;  4W1U A;  2O3F A;  1ETK A;  3KZY A;  2X9D A;  2XSD C;  1SEU A;  2VQC A;  1PVE A;  3L9F A;  1MJB A;  3PIO F;  5FJ8 J;  2JSC A;  2QKM B;  3BTI A;  4XLA A;  5FKN A;  4HSR A;  4HQE A;  1ODD A;  2VPR A;  3K6G A;  1T2K A;  4XK4 A;  4CCK A;  4NBQ A;  4BQA A;  5LGU A;  3HSE A;  5DUK A;  4FAS D;  5IP9 J;  2NOG A;  1Z6T A;  5DEQ A;  2YS9 A;  1QRY A;  1T0F A;  2DT7 B;  2M7B A;  3BTL A;  5CKT A;  3AG3 H;  1X2N A;  3MKW B;  1KU2 A;  3K10 A;  1JXS A;  3J7A O;  2D2W A;  3BTC A;  1BJA A;  5LEK A;  3JRI A;  4F52 A;  3FXM A;  4KIC A;  1TBX A;  3S93 A;  1IXS B;  1R4M B;  2EK5 A;  2IP2 A;  3FX3 A;  4ZYA A;  2KDO A;  3T8T A;  3ZN0 A;  1IUY A;  2HI3 A;  1X1D A;  1PP7 U;  4LG0 A;  4KIT B;  4WK8 F;  1ZLJ A;  3PNT A;  2MH2 A;  2QQA A;  4I0A A;  1PYV A;  2M0C A;  2QCO A;  3S8P A;  3A01 B;  1LFB A;  2H6B A;  5B66 C;  5DS9 A;  2HTS A;  3EUH A;  2IGM A;  5M3F J;  5JHU A;  4IX7 A;  1PUF B;  4KJZ A;  1HA8 A;  1OMI A;  1RKW A;  3BR1 A;  1ZRF A;  1FP2 A;  2F5V A;  3ZQQ A;  3WTY C;  2Q1Z B;  3PJR A;  4DQ2 A;  4G7O F;  2WA0 A;  1OCZ H;  4KMU X;  5L3F A;  2CUE A;  1WRJ A;  1IF1 A;  3GYH X;  1VQK I;  2WAQ A;  5TJJ A;  1Y6I A;  3F8M A;  2LR8 A;  4ZC3 A;  2AQF A;  2ZFU A;  1JTX A;  5IOZ A;  1FYL A;  3BZK A;  2JJ7 A;  3S1Q J;  5CQE A;  1CQT A;  3QPH A;  4JYK A;  4A69 C;  1OCP A;  5HS8 A;  3LNQ A;  5CVU A;  3CCS I;  1IV8 A;  3DU6 A;  3HSR A;  4RB1 A;  4YFK F;  1RRJ A;  4Y52 J;  1IRZ A;  5LHH A;  3WU2 C;  2Z16 A;  1MNE A;  3ZMD A;  3ELK A;  3HRU A;  3E5U A;  4QPQ A;  4MHG A;  1E2X A;  5FLX Z;  3MKZ A;  1H89 C;  3WTT C;  1HSJ A;  3DPU A;  1BM9 A;  1MJA A;  2CH0 A;  4I2O A;  3N97 A;  1PUE E;  2LF7 A;  5EEA A;  1V55 H;  1Y39 A;  1YI2 I;  2L7M P;  1S72 I;  4AM3 A;  2P6T A;  3TGN A;  1BIB A;  1IW7 F;  2WC2 A;  3LWF A;  2Q2E A;  4IVN A;  2JRT A;  3Q5F A;  4EAT A;  2P81 A;  4KDP A;  4OOI A;  3H36 A;  2W4S A;  1XGM A;  2M7A A;  2JSP A;  3ESW B;  1JE8 A;  1J7K A;  3QQA A;  2P0W A;  1R7J A;  1FOY A;  2WB1 A;  3KIO A;  4XLP F;  2BYV E;  3HIF A;  1O7F A;  4C3I J;  2LC2 A;  2X1D A;  4BE2 A;  3OY9 A;  1BOA A;  3TP0 A;  2NVX J;  4M9X A;  1S7O A;  1FZP B;  1OCO H;  3CJQ B;  1ETO A;  3MMY B;  2HVS A;  4PJM A;  1W7P A;  2RAE A;  5LFA A;  3L7W A;  5DTD A;  2DDA A;  4TV7 A;  2NNN A;  2PEX A;  3EUA A;  2G7H A;  2LLK A;  1LQ1 A;  3KLO A;  2CQ7 A;  2GIV A;  5E1X A;  2OTJ I;  2PJR B;  2K40 A;  3QPT A;  5ICE A;  3HGG A;  4N4N B;  3L2R A;  1A5J A;  1OPC A;  1U9O A;  3LFU A;  1P4A A;  2C6Y A;  3ZMT A;  3JCU C;  2YX4 A;  1WJB A;  3ZQL A;  2WTE A;  4ZJZ A;  4CUG A;  1HOM A;  4I7H A;  3K7A J;  4PFO A;  3H5A A;  3WGI A;  2K27 A;  4A5N A;  2FBH A;  2FBK A;  2R7D A;  2FJ1 A;  3NRV A;  5E8G A;  1FSE A;  3ECO A;  5KK1 A;  5DDG A;  1WH7 A;  5D4S A;  4F7Z A;  2M3A A;  2QSG X;  1BI1 A;  2MG4 A;  5LGN A;  4IRI A;  4UV8 A;  1D0X A;  2UXX A;  2WY7 Q;  3C2H A;  5LLQ A;  3KP3 A;  1NG6 A;  2F6C A;  2OQG A;  2EA4 A;  2V9K A;  3PL8 A;  3LST A;  2GAU A;  2VKH A;  4ZZL A;  3WTX C;  3KYD B;  4RAF A;  1H88 C;  1S29 A;  2R4G A;  2HQA A;  3V4G A;  4EGY A;  2CV2 A;  2LKX A;  4G9Y A;  4RM2 A;  4HEA 2;  2DAO A;  1N25 A;  4P55 A;  1MZB A;  1V5G A;  2EV0 A;  1DU6 A;  1HST A;  4IHY A;  3RIR A;  5HDK A;  2ZBK A;  1IV6 A;  3F8N A;  4XKC A;  1IXR C;  1U3E M;  4C2U A;  1G3S A;  2G7U A;  1WJ5 A;  2OCC H;  2STT A;  4RLF A;  2H94 A;  5EDN A;  2LY9 A;  3GX4 X;  1FOK A;  4A12 A;  4DZJ A;  4CO8 A;  1H9T A;  2W48 A;  2XAH A;  3QU3 A;  3VFZ A;  2XRO A;  3BR5 A;  3S1R J;  2HQ5 A;  1R5G A;  5E1Z B;  1GHC A;  1Q1H A;  4J00 A;  4NC8 A;  4FE4 A;  4IEJ A;  2Y0S N;  1K61 A;  2BHZ A;  4LOC A;  1KU3 A;  3OYK A;  3C2B A;  5B1B H;  1K7A A;  1W36 C;  1IDZ A;  1B59 A;  1XX5 A;  1E3H A;  3JTH A;  2HVQ A;  3FXU A;  2EWN A;  3BWG A;  2E5N A;  4AWX B;  2F5D A;  9ANT A;  3E7L A;  3QPL A;  4FTH A;  3RKQ A;  2F5E A;  3HYI A;  4C2M J;  5ICC A;  2FEZ A;  5K7Z A;  1F43 A;  2LMD A;  2DBB A;  2CV1 A;  5DCM A;  2QM3 A;  3MQ0 A;  2PG4 A;  4RB2 C;  3JRD A;  3HKZ A;  3RJP A;  2HOA A;  2KRF A;  2V1U A;  1AU7 A;  2EZL A;  4HOB A;  3R4K A;  1XSD A;  3I4M J;  5HLT A;  2BY2 A;  5IOY A;  1ETQ A;  2CQN A;  4MGR A;  2VQG A;  3DTI A;  3LAP A;  2DOE A;  4A3I J;  3QOE A;  4CCN A;  3H5R A;  1T38 A;  2ZKZ A;  5KNL A;  2DYR H;  2H1L A;  5EGO A;  3HTS B;  2ECB A;  2MFZ A;  5HDN A;  2QUF A;  4C2T A;  2MLK A;  1U5T B;  1RC9 A;  2NS0 A;  4ESJ A;  5FKM A;  1K78 B;  1TQI A;  3M8F A;  3NWS A;  4JX4 A;  2R5Z A;  3RI4 A;  4F91 B;  2VE8 A;  2O61 A;  2CQQ A;  4HST A;  1PDN C;  1Z7L A;  2XPV A;  3N4M A;  2ZXH A;  3BY6 A;  2V9V A;  3REO A;  3JRA A;  4HG2 A;  3GFI A;  5IYC J;  2HPI A;  2F4I A;  3HHH A;  3WTU C;  3GW2 A;  1SFK A;  2XVC A;  3HOX J;  5ILU A;  1S3J A;  4D1Q A;  4BXX J;  5C4X J;  1KZH A;  1D1B A;  3WTV C;  4HLX A;  2QSH X;  1I50 J;  1IZ1 A;  3J81 K;  3OOP A;  3GTK J;  2BW3 A;  1FLI A;  1O3Q A;  2WAD A;  4IHX A;  2EIL H;  3FMQ A;  2R7W A;  3LQR A;  1E3O C;  3QAH A;  4KNY A;  2BY0 A;  2KJC A;  2BVL A;  1SC7 A;  2DK8 A;  2LRD A;  3DBL B;  2YPR A;  2Y31 A;  4JQF A;  2V7F A;  3ZMZ A;  4QPO A;  3RZD J;  2BBY A;  4PJ0 C;  4M9Z A;  4HNT A;  1VQN I;  4ANJ A;  3FMR A;  4N9I A;  2JVG A;  2VQH A;  1Y0N A;  4QLC U;  3GFL A;  3HTU A;  4G7Z F;  1DP3 A;  3H35 A;  1J75 A;  2GBY A;  1JTY A;  4S0H B;  1XS9 A;  3L2C A;  2VUM J;  2JA7 J;  2EH3 A;  2LD5 A;  1FIP A;  2EIJ H;  2OCE A;  1D5V A;  1RI7 A;  1X4O A;  4Q4Z F;  2V4J C;  3L00 A;  4PCQ A;  2V6C A;  2X85 A;  2DQR A;  3OYF A;  3CCY A;  1XSX A;  5E20 A;  1K83 J;  2EB7 A;  2L9S A;  2K9S A;  2JVH A;  2L4A A;  2HOE A;  3QWL A;  4WX9 A;  2FNP A;  3L2W A;  1D1C A;  4A93 J;  2PN6 A;  4Z2Y A;  5KCM A;  2IA1 A;  1HW5 A;  3JSP A;  1FPQ A;  1MMG A;  2E71 A;  2V1X A;  2Y0S A;  3DTE A;  3MCZ A;  4EJU A;  2ZJR F;  2LNB A;  3PO3 J;  5HDG A;  4RGS A;  4HYE A;  2ZNY A;  2EBI A;  4JBA A;  3GTL J;  5JLX A;  4ZDL A;  2JPB A;  2VB6 A;  5K5Q A;  2A3S A;  1IN8 A;  1K6O A;  2CJJ A;  4CCM A;  5DCF A;  1TWC J;  3BDD A;  3F3X A;  3B6A A;  1T8I A;  1E17 A;  3E6D A;  1R36 A;  4AU7 A;  4U87 A;  3JRC A;  1O3T A;  2L9R A;  1ETY A;  1P4X A;  3ZMS A;  1UHM A;  1YIJ I;  3JAM Z;  4U0W A;  2XC7 A;  3QU6 A;  4NQW A;  1GV2 A;  3TW6 A;  1L3L A;  4E7J A;  4OAY A;  2A61 A;  2PBI A;  1R23 A;  3I5U A;  3PQJ A;  2QWW A;  2E19 A;  1I3Q J;  3N05 A;  3O3K A;  4L9N A;  5F1J A;  1W5S A;  2JWT A;  2IS6 A;  2VXD A;  2R7U A;  2FOW A;  1R49 A;  1BIA A;  2DMN A;  3SHF A;  1XSV A;  2A68 F;  1QBJ A;  1XMA A;  3HPH A;  2FE3 A;  4MLO A;  4A3M J;  2LKP A;  2HVR A;  1TWF J;  4JOM A;  2CV0 A;  4D0P A;  3I4N J;  4L9J A;  3L2V A;  1W0T A;  2BGC A;  1LDJ A;  4Y33 A;  2RNJ A;  4GXO A;  1SMY F;  5DD8 A;  3E1S A;  2W82 A;  5D5X B;  2K7L A;  2Z33 A;  2ZXI A;  4XOP A;  1JUS A;  1IAW A;  2HU9 A;  2MW8 A;  1T39 A;  2QEN A;  1KGS A;  2Y48 A;  3ABM H;  3IKV A;  2QBY B;  3CZ6 A;  5J40 A;  2UWM A;  2DOF A;  4I99 C;  3I55 I;  3V7S A;  3MD2 A;  4RS8 A;  1ZLK A;  5CQG A;  4X1E A;  1MBK A;  3A01 A;  3J81 Z;  3CQZ J;  1TWA J;  2EQR A;  3GTQ J;  4L5J A;  2YU3 A;  2BVM A;  3TP3 A;  3WGH A;  3OYC A;  4CZC A;  2OU2 A;  5IPA A;  5FLM J;  3CJR B;  4BS9 A;  2XB0 X;  5CVI A;  4LGW A;  4FHT A;  3QP6 A;  5L3G A;  3U1K A;  1REP C;  3DKW A;  1HLV A;  1ON2 A;  2LTP A;  2PLY A;  3NAR A;  1TT5 B;  2IJL A;  2NXN B;  2Y69 H;  3BLY A;  3K4J A;  3LA2 A;  3LSJ A;  4BQN A;  2HDC A;  2IBD A;  2W84 A;  2OV7 A;  3IUO A;  2F48 A;  3HUG A;  3ABK H;  2M45 A;  3HOY J;  2DK5 A;  3CLO A;  1HW1 A;  2K9N A;  1SFX A;  3CMM A;  2RNG A;  3CES A;  4RAG A;  1BJZ A;  5CYV A;  1UB9 A;  3ABU A;  3H3U A;  1VQ9 I;  3DPT A;  4PSW A;  5GPA A;  1FTT A;  3V7R A;  2FOK A;  3HM5 A;  4BY7 J;  5E3M A;  2E5Z A;  3FXQ A;  4A3E J;  1F4K A;  4QTR A;  1JJ6 C;  2JA5 J;  3KP4 A;  4CYC B;  1WI3 A;  1J2X A;  4DYQ A;  3GTG J;  1OR7 C;  1VQ6 I;  3SFZ A;  2BHY A;  1YW8 A;  1Z67 A;  3BPV A;  4Y3O A;  1FP1 D;  2QGU A;  4BY1 J;  2VBZ A;  2W1O A;  1ZR2 A;  1FJL A;  3S2H J;  3RCO A;  3GFM A;  1MKM A;  2DN0 A;  1IN5 A;  2FSW A;  5J3L A;  1W5C C;  1J9I A;  2A5W A;  2PMZ N;  5EYR A;  3HEF A;  1A36 A;  2MYS A;  3V8L A;  3CO7 C;  3HSF A;  2IGO A;  5E3L A;  1RR8 C;  1IG7 A;  4EGZ A;  2VJI A;  3J7Y J;  2NYX A;  3BG9 A;  1BOB A;  3IAM 2;  4XRS G;  4C3H J;  2EPF A;  1LNW A;  3TW7 A;  3PUF A;  5EJC A;  4CXF A;  4IPA A;  1QU3 A;  1ZH5 A;  1JGS A;  2E7X A;  4HBL A;  5L3E A;  4MIM A;  2EZI A;  1S8N A;  5AIP A;  5HOO A;  1J09 A;  2RQQ A;  4LLL A;  4L0Y B;  2GIZ A;  1QO0 D;  4CIC A;  1SD4 A;  2F5C A;  1YJW I;  2QYO A;  2OQR A;  3OYE A;  4IHT A;  4LB5 A;  2FNA A;  4KT5 C;  4F92 B;  1O57 A;  2MAB A;  1U8B A;  2PJR A;  3G3Z A;  1R00 A;  3WU0 A;  4F93 B;  3KYL A;  4XOT A;  1SMT A;  3WTZ A;  3ZN1 A;  3W3C A;  3BR6 A;  1DP7 P;  1FEX A;  3C3W A;  4LIT A;  3RYR A;  2FF4 A;  5ERI A;  3S16 J;  4XKV A;  4UVB A;  3ZQH A;  4F3Q A;  2F2E A;  1I27 A;  1BC8 C;  1E0E A;  1PJR A;  4O5V A;  5F1R A;  3OV8 A;  3HOV J;  1ETX A;  3GTO J;  4BNC A;  4EJT A;  1YS6 A;  5F0H A;  4PSX A;  1HC8 A;  5FB2 A;  3HG9 A;  1DQU A;  3HC7 A;  2OZU A;  4ZYG A;  3V42 A;  2M0M A;  2NAZ A;  4D9J A;  3OYM A;  1U5T C;  2OAZ A;  1NK2 P;  1UMQ A;  1FOX A;  1YJ9 I;  4EV0 A;  2FML A;  3RPU D;  5J6X A;  5LGT A;  5IYD J;  2GWR A;  2O8X A;  5ICF A;  2WV1 A;  2AQE A;  5LHI A;  5HNF A;  1UFM A;  4BE0 A;  3ZP5 A;  3FMS A;  1XC5 A;  3S15 J;  1OR7 A;  1EJ9 A;  1UZC A;  3HL2 A;  1R1T A;  5J8F A;  1FT9 A;  2QQB A;  3FZV A;  1W1W E;  1YX5 A;  2VAS A;  5ICG A;  1X58 A;  2WV0 A;  3DV8 A;  1YIO A;  3GF2 A;  3IL2 A;  2L2O A;  1QHH D;  4P9U A;  4E7H A;  2E1C A;  2LKS A;  4G7H F;  2VIX A;  4CCJ A;  4XN0 A;  1RPW A;  1BL0 A;  2DA3 A;  4ZH4 F;  2EIM H;  2GA2 A;  2MC3 A;  4BUP A;  2VPL A;  1WPK A;  1UEL B;  3SEQ A;  1F9N A;  1LPQ A;  1ETW A;  2HYJ A;  4BHP A;  1B9N A;  1YLF A;  2LYC A;  3H0G J;  4I09 A;  3ERE D;  3P9C A;  1A6I A;  5D6F A;  2DI3 A;  1ZGW A;  4YG2 F;  2XKP A;  3GVA A;  2PMZ A;  2LRE A;  1VQ8 I;  3EYI A;  1N75 A;  5IP6 A;  4HDU A;  1R71 A;  5F04 A;  2XAF A;  2HFH A;  1X2M A;  2W85 A;  3QOD A;  4HZF A;  3GO5 A;  3GTM J;  1LKX A;  2MBF A;  4XR6 A;  1OFC X;  2ZB9 A;  1SAN A;  2OF7 A;  4QWQ A;  4M6V A;  1KYZ A;  4L0Z B;  5GPC A;  3LSK A;  3SFI A;  1TQM A;  4Y7N J;  4XOR A;  1D8K A;  3K4L A;  1QA6 A;  1R5I D;  1J59 A;  5BOX A;  3LSI A;  4E7K A;  1MMS A;  1HKQ A;  4X6A J;  2R7X A;  1N77 A;  4RDU A;  2UZK A;  2QVO A;  1FX7 A;  3PNV A;  2H6C A;  4MFE A;  1G4D A;  2E1N A;  1G8X A;  2JA6 J;  5DUI A;  2K9L A;  1RET A;  3B73 A;  2V9P A;  3A1Y A;  3OL3 A;  3FHZ A;  1V3F A;  3VYR B;  3V8J A;  5DV5 A;  1UJ8 A;  3HUG B;  3E0J B;  1U0J A;  1B9M A;  4WXD A;  1IN6 A;  2RKH A;  3KP7 A;  3OYI A;  3K1N A;  1VQL I;  2EIN H;  3FK7 A;  4XRM A;  3SXY A;  3EYY A;  1ZR4 A;  3IC7 A;  1U5T A;  1K78 A;  1WJA A;  4I01 A;  2R7S A;  3F21 A;  5JR3 A;  2Q0O A;  2E2J J;  3LAJ A;  3CUQ B;  3ONQ A;  1SFU A;  3GLL A;  3MZ8 A;  2CMP A;  2CW8 A;  1LDD A;  4BKX A;  2P5K A;  4G6Q A;  2E2I J;  1MDM B;  4XRS A;  2LG4 A;  5IT3 A;  1XPX A;  2NS7 A;  4OU0 A;  2V1D A;  3I0T A;  2P7C B;  1NG7 A;  2ELJ A;  3MN2 A;  2DTR A;  1S5L C;  4PJN A;  1P9Q C;  4RBO A;  2GA1 A;  2ID6 A;  2J5P A;  4M3G A;  5H6Q A;  3TKY A;  3M07 A;  3CCU I;  1K4S A;  4KN7 X;  1JKQ C;  4E4H A;  4L5E A;  1B72 B;  3VSK A;  2VBX A;  3QYE A;  2ID3 A;  3FWE A;  3M4O J;  3DEW A;  5HS7 A;  2DMQ A;  1UHS A;  2VE9 A;  5BNG A;  1XN7 A;  4II3 A;  2I10 A;  4AYB A;  4BXF A;  3F6O A;  2ME0 A;  1IRX A;  3CLQ A;  2DFF A;  3HOU J;  2Z5U A;  5JI6 A;  3BQZ A;  2VKV A;  3DBR B;  4GRI A;  4PZJ A;  1XGN A;  1OYW A;  3DBH B;  3RDI A;  2X4H A;  3R0J A;  4MEY F;  3U1D A;  1VTN C;  5DD4 A;  1TNS A;  5TGT A;  3WGG A;  1YIT I;  1W36 D;  3CTA A;  3W2A A;  2IAI A;  4N4O B;  1I1S A;  2E60 A;  2O03 A;  2R7Q A;  2TCT A;  3CCQ I;  2ESN A;  2K9M A;  5TIS C;  3IH4 A;  5F6F A;  5E3N A;  3CMA I;  3RYP A;  3HHG A;  2L7K A;  3JRF A;  3W6K B;  1TP4 A;  3IWF A;  3K2A A;  4A3F J;  1ZHF A;  4JX6 A;  3OIQ A;  3DPL C;  4OIQ F;  4FT8 A;  3PSF A;  1VI0 A;  3OYA A;  2ME6 A;  2P5V A;  3HJE A;  2WWY A;  3HZJ A;  3I53 A;  4PK4 A;  3RPQ A;  1Z3Y A;  4HV5 A;  1HDD C;  2DU9 A;  1VQ7 I;  3IP4 B;  5JFR A;  3FM3 A;  2XRL A;  4LLG F;  5IY5 H;  3BR3 A;  4AVP A;  5CVJ A;  2X0L A;  4OIP F;  3DWL E;  3I64 A;  2IPQ X;  2K3F A;  2GXA A;  3V7C A;  2WAF A;  3SEZ A;  4Y4R A;  4RB3 C;  2X6Y A;  1YTY A;  2OJE D;  2QQ8 A;  3K69 A;  4GCV A;  3RPU A;  3LSH A;  2ZJQ F;  2I8D A;  2HS5 A;  3OYB A;  3VOE A;  2EZK A;  5C4J J;  4ZTJ A;  3C1D A;  1XMX A;  2ESH A;  2GM4 A;  3P5J A;  2GOM A;  3GEZ A;  4XBF A;  2M87 A;  3M1C A;  1B1B A;  3IKT A;  3M8J A;  3LQQ A;  4A3L J;  2DPD A;  1MMN A;  4BGD A;  4IHS A;  2MA3 A;  5J47 A;  2VBY A;  4E7Z A;  2K9Q A;  4NDL A;  1D0Y A;  2VXZ A;  4LG3 A;  5D8L B;  4HDV A;  3MKY B;  4NC6 A;  3MEX A;  1DDN A;  2HEO A;  1G3W A;  1BN5 A;  4CA0 A;  2M4K A;  1MIJ A;  4HRI A;  2CFO A;  4GYI A;  1WKM A;  1KON A;  1EA3 A;  2ADU A;  2Z99 A;  2RVC A;  3Q9V A;  2R7V A;  1BA5 A;  4QIW N;  2DJN A;  2W25 A;  2RRE A;  5KHD A;  4ZYD A;  3K4C A;  1HKS A;  5IP7 J;  4UUT A;  2R5Y B;  2AS5 F;  1TW3 A;  2QBY A;  2XV4 S;  4EM1 A;  5M3M J;  3SZP A;  1YQA A;  1KA8 A;  2KZV A;  3GFJ A;  4P5O A;  5J4Y A;  4OIN F;  3FKI J;  3JAM K;  1BW5 A;  2D1H A;  2K02 A;  4ESF A;  3OYH A;  2K86 A;  4ZZD A;  2M8G X;  2IEK A;  5FO5 A;  3SZG A;  3WHB A;  1TTY A;  3TDZ C;  2O8K A;  4EJO A;  2W57 A;  4PFP A;  1RUN A;  4KYW A;  2PMH A;  3KEO A;  1EH7 A;  3OIP A;  2QSF X;  2DO7 A;  2X48 A;  2XAU A;  3MKL A;  2HZT A;  5AIQ A;  3RSN A;  4BJT A;  2D45 A;  3CCE I;  3BG5 A;  2QQ9 A;  2JTV A;  3B6C A;  3DF8 A;  3S32 A;  3EUK L;  2LH9 A;  3RQI A;  3W2W A;  2PX9 A;  3OR2 C;  4DBR A;  4H4K C;  5EZH A;  4DYR A;  2PMU A;  2X1C A;  4R1H A;  1G3T A;  1EKE A;  1MH4 A;  3W6V A;  2KIF A;  2O5R A;  3VDX A;  4V19 K;  1NTC A;  3S14 J;  1SVL A;  3IRQ A;  2P4W A;  4AID A;  4CYC A;  3J80 K;  1BR2 A;  2DW4 A;  4B1R A;  3S17 J;  2EIK H;  1RUO A;  4UHT A;  4M6X A;  3G6E I;  3BG7 A;  3K70 D;  3BTJ A;  3NQO A;  4Y13 A;  1GT0 C;  5CVR A;  5F0C A;  2A07 F;  5E18 F;  1S6L A;  4B43 A;  3A4C A;  3WTW C;  1O3S A;  1KQ8 A;  1FBU A;  4GYG A;  4RAZ A;  4LLN A;  1XGO A;  3WE2 A;  4X0G A;  5BQT A;  4RMN A;  3IHU A;  4DW6 A;  3IWZ A;  1PP8 F;  5HVQ C;  3TBI A;  4A6E A;  1FY7 A;  2DFI A;  5E1W A;  2XGD A;  2H1K A;  2VOO A;  2OC6 A;  2XRN A;  1QGP A;  2RQP A;  3PO2 J;  3ML6 A;  1BI3 A;  1JHF A;  3FBI B;  1IN7 A;  3J7Z I;  2DCE A;  1DPR A;  5CJ9 A;  5IYB J;  1SAX A;  4G8X A;  1YHQ I;  1MND A;  1RZ4 A;  3D5L A;  1CF7 B;  1H9G A;  5F27 A;  2QF7 A;  1UAA A;  1Y56 A;  4J01 A;  2COM A;  3BJA A;  2VC0 A;  4YEL A;  1F1Z A;  2ICW G;  2MLG A;  2KQR A;  5J1U A;  4BDZ A;  1SAU A;  1SVM A;  2N8G A;  1RIO H;  3HOS A;  3KZI C;  2L3D A;  1OLT A;  1Y1V J;  2RV8 A;  1D5Y A;  1WVR A;  4BHC A;  4HF1 A; 
#chains in the Genus database with same CATH homology
 3S93 A;  1OR7 C;  3BG6 A;  2Z2S B;  4ZYA A;  2KDO A;  4IQJ A;  2CS3 A;  3PFY A;  4Y3O A;  1X1D A;  3H9G A;  4KIT B;  2W1O A;  3PNT A;  3RCO A;  1PYV A;  3S8P A;  4XON A;  1YE9 A;  2A5W A;  2MYS A;  2IGM A;  4HNU A;  3LSM A;  4IX7 A;  1HA8 A;  2IGO A;  4KJZ A;  4NNJ A;  4U7B A;  2VJI A;  2F5V A;  3ZQQ A;  3PJR A;  1X4P A;  2Q1Z B;  3HPG A;  1BOB A;  3IAM 2;  1DGW Y;  2WA0 A;  3I9V 2;  3LSG A;  4YRV A;  1WJF A;  2WAQ A;  2K3P A;  1QU3 A;  1Y6I A;  3DKY A;  4XLC A;  4ZC3 A;  2AQF A;  2ZFU A;  3ZR8 X;  5HOO A;  1J09 A;  2RQQ A;  5CQE A;  1TT0 A;  2WBM A;  3QYB A;  4XLH A;  2IS1 A;  3DU6 A;  2NOJ B;  3K70 C;  3G2B A;  3OYE A;  2DXI A;  2KMU A;  4NUB A;  4F92 B;  2MAB A;  2Z16 A;  1MNE A;  2PJR A;  4CSW A;  2V1N A;  1JI8 A;  4QPQ A;  4BQQ A;  2GOX B;  3TL4 X;  3MKZ A;  1WFX A;  4F93 B;  3KYL A;  4XOT A;  3DPU A;  2CH0 A;  3W3C A;  3OYD A;  1VZ0 A;  4LIT A;  3S3M A;  4XKV A;  1MW7 A;  4E7I A;  4F3Q A;  1DGR M;  3AL0 B;  1E0E A;  1PJR A;  4F55 A;  3FKJ A;  4R79 A;  4FET A;  4IQ4 A;  4PSX A;  4EAT A;  3RTR A;  4DJA A;  2W4S A;  3HG9 A;  2M7A A;  2ZSH B;  3BC8 A;  4BE1 A;  1DQU A;  1ZEL A;  4XNF A;  3HC7 A;  2LOO A;  2JSP A;  4RM3 A;  3V42 A;  2K5C A;  2LBF A;  2CW7 A;  2M0M A;  2P0W A;  4D9J A;  2WB1 A;  3OYM A;  3ZXS A;  3DTK A;  4IKF A;  2LC2 A;  2X1D A;  1R6R A;  3DEE A;  4BE2 A;  3OY9 A;  1MMA A;  3CP2 A;  3BCB A;  2CUJ A;  3RPU D;  4ZDO A;  2AQE A;  3CJQ B;  3MMY B;  5HNF A;  4BE0 A;  2HVS A;  4PJM A;  4XM3 A;  5LFA A;  3OYL A;  3KX2 A;  3EUA A;  3CF2 A;  3HL2 A;  3TMO A;  1X1C A;  3GBG A;  2PJR B;  1YX5 A;  2VAS A;  2VKD A;  4N4N B;  3L2R A;  2W7N A;  3LFU A;  2L2O A;  1QHH D;  4IZZ A;  3DLA A;  4PJL A;  1BR4 A;  4E7H A;  1WJB A;  4ZJZ A;  2VIX A;  4CCJ A;  4CUG A;  4XN0 A;  4PFO A;  3H5A A;  3K4M A;  4BUP A;  2VPL A;  1UEL B;  3NWT A;  3SEQ A;  2Q2E B;  2R7R A;  2LYC A;  2XSJ C;  2A6T A;  5JHF A;  1N78 A;  1GLN A;  2M3A A;  2PMZ A;  2LRE A;  1N75 A;  3I3L A;  2LBF B;  2X51 A;  3QOD A;  1D0X A;  2DOA A;  2V6E A;  3UNG C;  3HOT A;  1ERD A;  2WY7 Q;  3C2H A;  1NG6 A;  1LKX A;  2F6C A;  4KT6 A;  4XR6 A;  2IGK A;  2V9K A;  3DKX A;  3PNY A;  4DBQ A;  1FMW A;  3LSK A;  3PL8 A;  2VKH A;  4PUS A;  4XOR A;  2KL4 A;  3D5S C;  3K4L A;  3J7A Y;  2R4G A;  3LSI A;  2HQA A;  4E7K A;  4E7L A;  2KRH A;  4B47 A;  2CV2 A;  2R7X A;  1N77 A;  4RM2 A;  4HEA 2;  3PNV A;  1V5G A;  2MC4 A;  1T95 A;  1G8X A;  2K9L A;  2W00 A;  1TZL A;  3A1Y A;  3OL3 A;  4XKC A;  3VYR B;  4BJ5 C;  4C2U A;  1WJ5 A;  3HUG B;  3E0J B;  1U0J A;  3AKZ A;  4RLF A;  2IS2 A;  3OYI A;  1D0Z A;  3OOU A;  1WJA A;  3FDY A;  2R7S A;  4AVZ A;  3L2U A;  3DQV C;  1QHG A;  3ONQ A;  3W2V A;  4BEH A;  4J00 A;  4NC8 A;  2CMP A;  2CW8 A;  4KIS A;  3OYN A;  3OYK A;  4C30 A;  1W36 C;  2LG4 A;  2HVQ A;  3EPZ A;  4XMY A;  1NG7 A;  2ELJ A;  2E5N A;  3SDB A;  4OWR B;  2Z1D A;  4PJN A;  1P9Q C;  2IGN A;  2X1E A;  4B48 A;  2XF6 A;  4BJ6 C;  4CCL A;  1V5F A;  3ZGK A;  4E4H A;  2CV1 A;  3F9K A;  3VSK A;  3HKZ A;  3VYU B;  1AA7 A;  3QYE A;  2JUG A;  5HLT A;  4ZDP A;  1LVK A;  2VQG A;  2VJJ A;  3C2G A;  3DTI A;  4II3 A;  4AYB A;  3QOE A;  4BXF A;  4CCN A;  5FRO A;  3H5R A;  1IRX A;  3SYT A;  3QYF A;  5KNL A;  4GRI A;  2MFZ A;  4LIV A;  4DOZ A;  1W36 D;  5TGT A;  3W2A A;  2E1M B;  4C2T A;  2R7O A;  3CP8 A;  3S3O A;  4II2 A;  4N4O B;  3RQ4 A;  2E60 A;  3NWS A;  2R7Q A;  2K9M A;  4F91 B;  3VYT B;  4BEH B;  4HST A;  1Z7L A;  2ZXH A;  4HG2 A;  2L7K A;  3K4K A;  2HPI A;  2F4I A;  2LY2 A;  1V5E A;  3DU5 A;  1SFK A;  3OIQ A;  4D1Q A;  3DPL C;  4XL9 A;  4DIQ A;  1D1B A;  4E6K G;  3PSF A;  3OYA A;  2LY1 A;  1D1A A;  3LL7 A;  4PK4 A;  1LFP A;  2BW3 A;  2KPM A;  2OUM A;  1YX3 A;  1X1A A;  2WAD A;  4XKB A;  3VYS B;  4B44 A;  2R7W A;  1Z3Y A;  5FRN A;  1WJD A;  2XF5 A;  2BVL A;  2VJ4 A;  2LRD A;  3IP4 B;  4JQF A;  2V7F A;  4QPO A;  3OR1 C;  3ZRG A;  4HNT A;  4ANJ A;  2WAE A;  2JVG A;  2VQH A;  3DWL E;  2FUG 2;  4BQO A;  2VLA A;  2L5Q A;  2WAF A;  4Y4R A;  3SEZ A;  3H35 A;  1DP3 A;  3OWT A;  2X6Y A;  4BL0 B;  3AFH A;  1X4O A;  4CCO A;  5FRM A;  2V4J C;  3LSH A;  2KHM A;  2XDV A;  2X85 A;  2I8D A;  2HPM A;  3OYB A;  2BOL A;  3H9Q A;  4XLF A;  3OYF A;  4BU2 A;  3OYJ A;  2X6X A;  4LIU A;  4ZTJ A;  2L9S A;  3OL4 A;  1FMV A;  2GOM A;  2JVH A;  3L2W A;  1D1C A;  4B3X A;  3A2K A;  2WY8 Q;  3M1C A;  3M8J A;  4OAZ A;  5KCM A;  1BR1 A;  4CH7 A;  4ZTF A;  1MMN A;  4BGD A;  1MMG A;  3DTE A;  2Y0S A;  3LMM A;  1WJE A;  4E7Z A;  1D0Y A;  2VXZ A;  4LG3 A;  1Z3X A;  3MKY B;  3U21 A;  1K6Y A;  4CA0 A;  2M4K A;  4HRI A;  4ZDL A;  2CFO A;  2BW3 B;  2VB6 A;  1G59 A;  1KON A;  1EA3 A;  4ITV A;  2QKL B;  2JA2 A;  2R7V A;  2DT6 A;  4CCM A;  3H0D A;  2RRE A;  2CUZ A;  4E7S A;  3K4C A;  5KHD A;  1WJC A;  3OS0 A;  1T0F C;  2VL8 A;  4XQF A;  4NC7 A;  4AU7 A;  4U87 A;  5LD2 C;  2XF7 A;  4P5O A;  2KZV A;  3PSI A;  2XC7 A;  3OS1 A;  4E7J A;  1UG0 A;  4OAY A;  3OYH A;  1X19 A;  4XLE A;  3SZG A;  3AL0 C;  2DJI A;  3OS2 A;  2HDW A;  3N05 A;  2KLO A;  4PFP A;  3OMY A;  2VXD A;  3L2Q A;  2IS6 A;  2R7U A;  3OIP A;  3EUH C;  3PUB A;  2XAU A;  4BJT A;  3K4N A;  3RSN A;  1LDK B;  2VQL A;  3HPH A;  4MLO A;  2HVR A;  3S32 A;  3EUK L;  2IXS A;  4JOM A;  2CV0 A;  2LH9 A;  3W2W A;  4DBR A;  3OR2 C;  4H4K C;  4BDY A;  3L2V A;  2X1C A;  3K4B A;  4DGW B;  4Y33 A;  2O5R A;  3VDX A;  1X1B A;  2M4G A;  3OYG A;  3E1S A;  4XKW A;  2W82 A;  4C9Y A;  3D5R C;  3HXL A;  1BR2 A;  2E1M C;  2IS4 A;  2ZXI A;  4XOP A;  4XN3 A;  3BG7 A;  2HU9 A;  3K70 D;  1Z21 A;  2UWM A;  2MD0 A;  3CZ6 A;  4BAC A;  4B43 A;  3A4C A;  3H9J A;  3MD2 A;  4X0G A;  2UUZ A;  4RMN A;  2VJ5 A;  4RLQ A;  5CQG A;  4NQW B;  5HVQ C;  3TBI A;  5CPR B;  3H5N A;  2HNH A;  4P1W A;  4YEJ A;  3UR3 C;  2OC6 A;  4PJJ A;  2BVM A;  3VSL A;  3FHN A;  2KP6 A;  3OYC A;  1S9H A;  4CZC A;  1MMD A;  3IAS 2;  3CJR B;  2X6W A;  4BS9 A;  3FBI B;  3S3N A;  2DCE A;  3ZCO A;  1MND A;  2VQC A;  3BLY A;  3K4J A;  3D5L A;  4BQN A;  2QKM B;  3FBN B;  4G6T B;  4XLA A;  4HSR A;  1UAA A;  2OV7 A;  2ZSI B;  3IUO A;  3K6G A;  1Y56 A;  3KEY A;  4HPQ A;  2KRC A;  4CCK A;  4J01 A;  2V26 A;  2HZD A;  3CMM A;  2RNG A;  2L9N A;  3CES A;  3VWB A;  4FAS D;  4YEL A;  2M7B A;  2DT7 B;  2KQR A;  3DPT A;  2UV1 A;  4PSW A;  4BDZ A;  1SAU A;  3BCA A;  2R7T A;  5CKT A;  5HNH A;  3MKW B;  3HOS A;  3K10 A;  1OLT A;  2E5Z A;  4F52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...