2LOOA

Backbone structure of human membrane protein tmem14a from noe data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Transmembrane protein 14A
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2looA02
2LOOA
chains in the Genus database with same CATH superfamily
3HGGA 1JKQC 5DM7F 3OYBA 1AU7A 1FP1D 3UR3C 3QP6A 3PO2J 2QWWA 1EJ9A 1I5ZA 1E17A 1YG2A 5E8GA 1ZLJA 1FP2A 4OWRB 3N4MA 3K4JA 1NK3P 1B1BA 4AU7A 3O8HA 4CH7A 1T56A 1GV5A 3WU2C 1B4AA 1R9TJ 2KPMA 3Q9VA 2HPMA 2AS5F 3P7NA 4YIIA 1KGSA 5J47A 3PNYA 4HSRA 3Q3SA 5D4RA 2DA2A 4NDLA 1EH8A 2VI6A 5JFRA 2HTJA 4C9YA 2Q0OA 1WH5A 2LKSA 3QU3A 3OYLA 3RKYA 3OL4A 3OYIA 2CUZA 2HOEA 1Z1DA 3VEPA 2CQ7A 5DD8A 5ED4A 2JSCA 4IRGA 2LKXA 2A6TA 5E3NA 4XN0A 1MNDA 4AC0A 3M8EA 2GXAA 3EQLF 5ERIA 1G2HA 4CA0A 3HOYJ 1WH7A 3OOUA 2JA6J 4II3A 2F5FA 2E1CA 2JJ7A 3KX2A 2NAZA 3DQVC 3CDLA 2VOPA 3M8FA 2TRTA 5J4VA 4QTRA 5C4XJ 5ICGA 4IEJA 2ZMEA 3KIOA 3DP7A 4LFUA 1FT9A 2RREA 2HTSA 3MKYB 1KYZA 1G3TA 2LMDA 4FX4A 3IWZA 2AQFA 4CYCA 1MH3A 3FIWA 3H9JA 3GTPJ 2MG4A 2E2IJ 5FLVA 4BHCA 1SFXA 2O8XA 4CZZA 2R5YB 4RB2C 4A6DA 3V7SA 3DKYA 3I9V2 2L9RA 2FNAA 1Y8QB 3ECOA 4DNCA 2VPLA 5D6FA 2IA0A 2M2EA 1TT5B 3JRBA 5FKNA 1T39A 1R5GA 2XRNA 3ROUA 4XKVA 3C7JA 2JA8J 1W36D 5L3FA 4ZJZA 2E19A 2CQKA 4LB6B 3U9GA 3CCLI 1HW2A 3RQ4A 2VT2A 1V5EA 3O6BB 2O6GE 1X1CA 2UUZA 1IDZA 4EM0B 2BY3A 2KRCA 4RM2A 2A05A 2NVTJ 1OCRH 1MSEC 5FGMA 4O3MA 2DDBA 2CUJA 4PUSA 2WB1A 1BJZA 4CYDA 2XPUA 5H6RA 2IGNA 4KT5C 1SFEA 4FHTA 4M73A 2B0LA 3S3MA 2F2EA 6PAXA 4MLOA 1OCPA 1FMWA 1PVEA 4B44A 4HG2A 5DUIA 4N9IA 3M1EA 1R5ID 1LFUP 1KU7A 3DKXA 5HNHA 1H88C 3K4BA 3I53A 4R79A 3RYRA 1Y39A 3DV8A 5LRSA 5HLGA 5KAIC 2JVHA 4E4HA 2KZGA 3KLNA 2FA5A 3MKZA 3GBGA 1KU3A 1IUFA 5GAGJ 2DYRH 3CJRB 2K9SA 1YW9A 1UELB 2BBYA 1BW5A 4KITB 3OY9A 4LIUA 4OINF 3K6GA 4WXDA 2CW0F 3LSRA 4OAYA 4RMNA 1TT0A 1ENHA 1JGGA 1BA5A 4RLQA 4P96A 3BCBA 3ABTA 3MN2A 3AKZA 4A3GJ 1JT6A 1JUSA 5LGTA 1WFXA 1DP7P 2DQRA 2E1OA 2XASA 3EUHA 3HKZN 4U0VA 1LFPA 2ID6A 1AWCA 1X1DA 3QPLA 4B48A 4NC8A 5LHIA 5B3SH 4ZDOA 4KIBA 1J59A 4DOZA 1R58A 4Y3OA 1OQYA 4J00A 1RR8C 1MMDA 1H8AC 4M3FA 4L9JA 1BC7C 3QU6A 4D9JA 1SFOJ 1R7JA 4A12A 1BM9A 4BNCA 4EM1A 2OAZA 3GFMA 5CLSA 2ECBA 1GLNA 4UB6C 2ESHA 1FZPB 1T0FC 1ZELA 2COMA 2PQ8A 3I59A 3K69A 1U3EM 1VQ9I 2R7FA 1LE8B 3TQNA 1XMAA 3L00A 1P92A 1MDMB 3ZMVA 2LLKA 1XGNA 3LSMA 1TWCJ 3ZXSA 4BEHB 3A2KA 2JMWA 2IAIA 4P1WA 2Y31A 4AIDA 2ZCWA 3JR9A 3CESA 2OUMA 2LP0A 2XVCA 1OMIA 2G7HA 5TISC 5A2QZ 4ENMA 4A3FJ 5EEAA 3L9FA 1QZZA 2JZYA 2M4GA 2GM4A 3GFLA 1UHWA 3BJ6A 2E60A 3Q5FA 3CCSI 5HODA 2YU3A 1I1GA 1J9IA 3NWTA 3KE2A 5FLMJ 4M9XA 1HQCA 2WBMA 2FX0A 3F8MA 2LFBA 3F0CA 1YO5C 4XSXF 2ECCA 2EIMH 2QGUA 2A61A 2GOXB 4A93J 4MTEA 2MLGA 5ILVA 4NNJA 4IQJA 1WQ2A 2KP6A 2OD5A 3JCUC 3ZPLA 2EK5A 2QEXI 1UJ8A 4UNOA 3CJNA 4AWXB 3F21A 5GPAA 1I3QJ 1FYMA 1S5LC 3MZ8A 5JHUA 1D0ZA 1E2XA 2GA2A 4IPAA 2JPCA 1QHHD 1Y8RB 3PUFA 4C3JJ 4BBSJ 2Z16A 3A03A 2KQRA 3RQIA 5CVVA 1DGWY 2EB7A 4BBRJ 1YRNB 2JRMA 3KYLA 4F3QA 1Z6RA 3I4MJ 3A1YA 2V26A 3WODF 1R71A 4ENKA 2EFOA 4CCLA 4G6TB 4CDGA 3VOEA 2Y30A 1GV2A 4RB3C 2CO5A 1SMYF 1EV7A 1IN8A 4HF0A 2DA5A 1FTZA 1FSEA 1EA3A 4ASNA 3S8PA 3BROA 3FXLA 4G12A 1RRJA 3B73A 4Q5SF 4XNFA 2K3FA 1GVDA 3CP8A 1Q1HA 2CU7A 2RAEA 5L3GA 1HBXG 2XDVA 1YHQI 4M3BA 5IT9K 2M30A 2HR3A 4OMZA 5IYCJ 1R49A 1EF4A 3WHBA 2XSDC 5FD5A 2DN0A 3HGYA 2R7WA 2WB1N 5EF6A 2XF6A 1B6AA 1GXPA 1U5TA 2HDDA 1FYLA 3I54A 2BVMA 1TW2A 2HYJA 3R6SA 4UY8I 1ETWA 3JRIA 2ZJ2A 3LSIA 2QENA 1FMVA 1RKWA 4F55A 4MHGA 1OKRA 2EFPA 2VLAA 4YRVA 1JJ6C 2Y9ZA 4PK4A 4C3IJ 2DDAA 1XCBA 2V1XA 2X1CA 3RZOJ 1K6OA 1F4KA 2HVSA 5J8FA 2EFQA 1SMTA 4K2EA 1SVOA 2MA3A 4IL6C 2CYYA 1RI7A 2GZWA 3SZPA 4HLYA 4XKCA 3S1RJ 1HKQA 3BG5A 2KDZA 1ZTRA 1KONA 2VJ5A 3VODA 4CO8A 2QQ9A 3KP2A 4UV9A 5J1RA 3VSKA 3R60A 2M0CA 2K4BA 4XONA 1A31A 2DOEA 5EDNA 1VQ7I 2E5ZA 2XAFA 3GFJA 2BY0A 3ZN1A 3MZHA 4GFBA 4L5IA 4I09A 1XD7A 3GLXA 4IHVA 2DJNA 3E5XA 1QNTA 3AG1H 3SZGA 4U7BA 4BY1J 4UB8C 2A07F 2RNJA 4YG2F 3K4CA 4BHPA 1AKHB 3HDDA 2KIQA 1V55H 3BZ6A 4XR6A 3C18A 4CZCA 4HDVA 3D5SC 4PCQA 2K85A 2VJIA 1XTAA 3BLYA 4NQWB 1NG6A 1ZG3A 4GCVA 4LLNA 1PYVA 2FOKA 4E7SA 1SD4A 3DKWA 3CLQA 1OR7A 1SANA 2FSWA 1P9QC 1APLC 2WADA 4DJAA 3TDZC 3G2BA 2Z99A 2VJ4A 3LFKA 1WJ5A 4UVAA 4IXAA 4ZDLA 5FFZA 4F91B 4WCGA 1W0TA 2HS5A 3FWEA 3MKLA 1FX7A 4C2TA 4DW6A 4F7ZA 3S17J 2W48A 5CQEA 4HF2A 3GTQJ 2DYSH 4LJZF 3DPLC 4KIFA 4JX6A 3K70C 4R1HA 4A3CJ 4ESBA 4QPOA 2JN6A 3I3LA 1GXQA 2LOOA 3HZJA 3GCMA 1USTA 2R7VA 1ETQA 4M3EA 3FXMA 4E70A 2JA5J 4IRHA 3M7GA 1UZCA 3NRVA 5FKMA 4F52A 2HVQA 3ZQFA 1J2XA 2LY1A 3IHUA 3CF5F 5DV5A 5M3MJ 1IN6A 2IS4A 4IHXA 5F0CA 1T33A 3J7YJ 1OISA 3CCJI 2DA6A 4JBAA 2X9DA 3S2HJ 4HV6A 2KKOA 5L3EA 3J7AY 1OCTC 4WXCA 3MCZA 3V7CA 3W2VA 2D1VA 1VFCA 4LB5A 4YEJA 3IH3A 1RIOH 1A35A 1W5SA 1O3SA 4IJAA 5JVGF 1OYWA 2LF8A 5LEJA 3TOBA 2ZKZA 3DBRB 4RB1A 3ML6A 1Y1VJ 4KMFA 3BC8A 3G4SI 2NVUB 2C6YA 1NK2P 1R6RA 1XGSA 2ELHA 5J3LA 1JGSA 3OYEA 2NOJB 3T1BA 3ZMUA 3S1MJ 2R7OA 2PLYA 2MD0A 1XSDA 4EQQA 1R36A 3DEEA 1W0UA 2A5YB 3HYIA 1ETYA 4M3DA 4BACA 2EPFA 2VQGA 4XRSA 4M9SA 5IP7J 3W2AA 2H27A 5TRDA 1WJCA 3L1PA 3RZDJ 4EATA 2L4AA 2P0WA 5KCMA 2MGQA 2G7UA 3OYMA 2W57A 3H5AA 1ACIA 2BV6A 2GQQA 5H20A 4HPQA 3T8TA 1BN5A 2X6YA 4BKXA 1OCOH 4JYKA 1MJBA 3PFIA 3K1MA 2PJPA 2DA4A 4BAYA 3K7AJ 4JOMA 2FQ4A 3GZ5A 5FLXK 3ASNH 3HXLA 2P5LC 2R7RA 1VQ5I 3FKJA 2L5QA 4N4NB 4PJMA 1UAAA 3HTSB 1X3WB 2RQPA 2WC2A 3GTOJ 1BJAA 2NNNA 3EUKL 4BH9A 3E5UA 2JTVA 3HOSA 1IXRC 3QPHA 3PO3J 5D6EA 4FE4A 4V2FA 4BXFA 1R23A 2EA2A 2KRFA 3CCYA 1VI0A 3PNVA 1UG0A 4XORA 2DFHA 1FPQA 2I8DA 3TMOA 4MEYF 4NUBA 4U7DA 3F6OA 1U9OA 1S7EA 4C30A 2Z2SB 2P8TA 3BG9A 4CCKA 1LB2A 3HOUJ 4P55A 2XAGA 5GPCA 4RBOA 3A0HC 4E7ZA 3S32A 1YW8A 3DCFA 5C44J 2DTRA 2PJRB 2QBYA 4EJOA 1DU0A 2BE5F 3A01B 2LBFA 5CVJA 2DMPA 1Q1VA 4ZTFA 3VYTB 4MGRA 2BZTA 3FMRA 5E3OA 2HOTA 2LY2A 2CG4A 5L3CA 4D7NA 3OV8A 2PI0A 3E5QA 4BE2A 3NAUA 4S04A 1D5VA 2HU9A 4GDFA 2D45A 2K02A 2P7VB 3GXOA 1ZLKA 4KICA 1O4XA 3CCEI 1IAWA 4KISA 1WWXA 2DA7A 1Z3YA 1RKTA 2OC6A 4EJVA 3QP5A 2MD5A 3PUBA 4HNTA 2FBIA 4LK0F 2E5NA 2JK3A 4YFNF 4BL0B 4AIJA 3DLLF 2X4HA 2W7NA 3D5RC 3DTIA 1K6YA 5DM6F 1B8IA 4XRSG 2P81A 1Y6IA 2D5VA 1NTCA 3DF8A 1P7IA 1AOYA 4BQNA 3COAC 1U9NA 5J1UA 1K7AA 1P4AA 2H6BA 5F1JA 1IW7F 4XM3A 2IVMA 4B09A 4DGWB 2FBKA 3CUQC 2KZVA 3OWTA 1IN7A 2M8EA 4PZJA 1SAUA 5BQTA 2GBYA 3LL7A 4XICA 3HRTA 3H3VK 2K7LA 2ZXHA 3IH2A 4E6KG 5IY5H 4EVIA 3L2WA 2H6CA 3ZQLA 5IT3A 5BMZA 3ZMTA 1I39A 4IX7A 2Y2ZA 3CLOA 3K4LA 1ZG5A 3HKZA 1VQPI 1W7PD 5HDNA 3LMMA 3CDHA 5HDGA 1X1PA 1LNWA 4G8XA 3ERED 5B5EC 1FBQA 4MTDA 3SHFA 1SFUA 4A3EJ 2LK2A 2VOOA 3QYEA 3JAMK 2KIUA 3WTWC 1R1TA 4Q47A 4YFXF 2IJLA 3E0JB 4RM3A 1A6IA 1LFBA 5F27A 1TL8A 4W97A 1WZ2A 1S29A 3U1KA 1K4TA 3RPQA 3IV5A 3FM5A 3ZN0A 2VBZA 1MGTA 1Z05A 3P5JA 3BG6A 4JP0A 2ZSIB 3HC7A 2BGCA 1R1UA 4QPQA 3KZYA 5K7FA 1I3AA 1P4WA 1QPMA 2O7OA 5L3DA 2GLOA 3T0YA 3OYAA 3GX4X 1BR2A 3RDIA 4X1EA 1H9TA 4A0YA 3MKWB 3GTLJ 4L5EA 3CCUI 2BXYA 3FF5A 2HXOA 3Q9SA 4H4KC 2D2WA 1E3PA 4A3BJ 4L0ZB 2BY1A 3CCMI 1XSXA 2YU9J 2DA3A 2V9KA 2XAQA 2ZFWA 5F08A 2CV2A 1MD0A 2NVXJ 3PL8A 1MBHA 2IT0A 2YS9A 3LSJA 2Q8KA 4DBQA 1IN4A 1GVJA 4IF4A 1FY7A 2WTEA 2L9VA 3E6CC 3G1OA 2XB5A 2F5VA 4ON0A 3HRUA 2OZ6A 4B1RA 3AL0B 5IP9J 1PJRA 1B72A 1O3RA 1U8BA 2XF5A 3I4NJ 4HQEA 4B8XA 1KQ0A 3NWSA 2CV0A 2ELKA 3F8NA 2GIZA 4M6YA 2O8KA 3CUQB 2FNPA 2R7ZJ 3W6VA 1W7PB 3J80K 1PUEE 5FJ8J 2LREA 1ZK8A 2ZJPF 1HW5A 2ICWG 4XSZF 2DO7A 2G0EA 1USSA 1X4OA 1BW6A 2DFFA 5F04A 1TWHJ 2VODA 2K5CA 3KZIC 3HOVJ 1W36C 3IC7A 1HW1A 1POGA 3CJQB 2A68F 3HM5A 4HLXA 2IGOA 2VL8A 1O3TA 4IHYA 1ERDA 1D3YA 4IHWA 3GTGJ 3SJMA 5J8CA 5DEQA 2RNGA 3LWFA 2CUEA 4HBLA 4HW0A 4FETA 3PIPF 3RI4A 4RLFA 3JRGA 4I6ZA 3MQ0A 5E17F 2E1NA 3OYJA 2VE9A 4A3LJ 2KJCA 1IRZA 1U8RA 1LJ9A 5LRRA 2AQEA 3RSNA 2OU2A 2R7XA 3GZ6A 1S9HA 2ZFUA 4I01A 3G3ZA 3LAJA 2HQRA 4B3AA 3OMYA 4EJUA 3DBHB 3R0JA 3VB2A 2QBYB 3SEZA 3ONQA 4AD9A 3ULQB 2IW5A 1V5GA 4HF1A 2JA2A 2WV0A 1YLFA 2F4MB 4IOAF 4CICA 3M4OJ 1LDKB 3C1DA 4XLAA 3OR1C 2A5WA 3AG3H 4XIDA 2XGDA 3V8KA 2R92J 4RAYA 5CYVA 2PBIA 3TO6A 5LLQA 1V5FA 2QSHX 5HOOA 3JRDA 2IRFG 4XOPA 3QOEA 3U2RA 3H0DA 4GO1A 5FLXZ 2OQGA 1HF0A 1FOXA 3K4MA 1ETKA 3V4GA 2OCCH 2R93J 4HDUA 1SD6A 2JUCA 2BHYA 2MH2A 2FOWA 4E7JA 1WSUA 5HLIA 1YTYA 1WJFA 2IA1A 4L9NA 3MD2A 2VN2A 2DT5A 3HUGA 1Z7LA 2X1EA 3FK6A 2PEXA 3MEXA 4E7KA 2R7TA 3HOZJ 3H1CA 4AIHA 1CGPA 5EYRA 1XN7A 1RPWA 2M34A 2UZKA 4A3KJ 2AXTC 3H3ZA 1TWGJ 1E0EA 3PNTA 4KFCA 4PSXA 5F64A 1PUFA 5GP9A 1U0JA 5LGUA 3GF2A 1MIJA 5D5XB 5B1AH 2XGXA 1XSVA 2BOLA 2P7CB 2H09A 1TQIA 4G6QA 5HVQC 3J81K 3JRFA 2EH3A 1VQKI 2WAEA 2OV7A 4EJTA 2CRGA 3TKYA 2H1KA 2V1UA 1D8JA 4WF2A 1MZBA 4BXUA 4Q48A 3WTVC 2NRAC 1SFKA 4MFDA 2V9VA 5B66C 1IF1A 4HZFA 2ETHA 4UUSB 1FYKA 3RYPA 2MW8A 3K10A 1X19A 2M3AA 1O7FA 1Z77A 5E1WA 4Z2YA 4D1QA 1JHFA 4HX7A 3CF2A 4BGDA 1Y0UA 2E1MB 1NH3A 4KMUX 2R7UA 2VQCA 5IYDJ 2QYOA 4AM3A 3C2GA 4B43A 1GUUA 1X1AA 3VYSB 2F4IA 2HVRA 2ZSHB 2WA0A 3RIRA 3K4NA 4S0HB 3JTGA 5E8IA 5FROA 3W6KB 4BUPA 2H1LA 3FDYA 1E3OC 1UHSA 1ZGJA 3DU5A 2ID3A 2XUBA 3MVPA 1F5TA 1TC3C 4BY7J 4I02A 3WTZA 1LEAA 1QPIA 1KZHA 3ZMDA 1JKOC 2EIKH 1PDNC 1RUNA 2CFXA 1BI3A 2HEOA 2IGMA 3TOAA 2RN7A 3O3KA 4LG0A 1W5TA 2KMUA 1XMXA 3M9AA 4XLFA 3IWFA 5J40A 5TJJA 3LQRA 1HDDC 2VQLA 3FXKA 1B72B 1QVUA 5H6QA 1BOAA 3FHNA 4L5JA 3VWBA 4XL9A 4BE1A 2VKHA 2F5EA 1F1ZA 1WI3A 1YQAA 1ZYRF 1S7OA 1EH6A 3IRQA 4WX9A 2ZMEB 4EGZA 2Y75A 2R5ZA 3LNQA 2LC2A 1ZARA 2EV5A 3SQNA 4PJ0C 3C2HA 2GA1A 4CYCB 2LYCA 2O61A 2CMPA 4NC7A 3HJEA 3U1DA 3MWMA 1QZYA 2XHKA 4J01A 3K2AA 1WI9A 2DPDA 2UXXA 2CJJA 5JVTA 3I5UA 3T8RA 1UMQA 3CCRI 2L2OA 5H2FC 1FIPA 3KP4A 1JUMA 1P6RA 3SFIA 3IH4A 4ZZDA 4G7HF 5E1ZB 2HKOA 3CDIA 4NBQA 4BJTA 1D8KA 4P5OA 5B1BH 2R0QC 3GVAA 4FE7A 5F0HA 3S3NA 1V54H 5FKLA 1ZN2A 3L2QA 4CGZA 2KL4A 4MIMA 3ZMZA 3CQZJ 5GAEJ 4G7ZF 5FFXA 3JRCA 2VC1A 2UV1A 2ZBKA 4HNUA 2BVLA 2B9SA 3V8LA 1VTNC 1VZ0A 4II2A 2G9WA 1M1EB 2PN6A 1K79A 1MMNA 2CV1A 3FK7A 4M9ZA 3FM3A 3WGIA 2IS2A 5DTDA 2M45A 2PG4A 2V6CA 3OIQA 1LQ1A 3F6VA 1B9NA 4LLLA 3AG4H 1S7AA 3LSTA 3S93A 1HXDA 1WJDA 2PX9A 4U87A 4ABZA 2EINH 2NXNB 4AUXA 3J80Z 1BL0A 3DEUA 2FMLA 4W1UA 4NC6A 1XMKA 2M87A 1QGPA 4I99C 4ITVA 4L9VA 3OOPA 3F22A 1KU2A 4UUTA 4LLGF 2GAUA 1Z67A 3KEYA 4D7MA 2E36A 3HSRA 4OU0A 4IHTA 2ZB9A 2V1DA 3QYFA 3MMYB 3X2QH 2EWNA 4PGHA 2PMZN 1F9NA 5DD4A 1ODDA 2Y0SA 1DPRA 1OCCH 3FXQA 5FO5A 1FOKA 4EV0A 2YSRA 3CUOA 2M7BA 4G94A 1JKRC 1Z0XA 3WTUC 3KLOA 3ZRGA 3ZCOA 2W82A 1D5YA 3I71A 1R1VA 3G1MA 2EV0A 2QQ8A 1Z91A 3WGGA 3JSPA 3MAJA 1VQNI 1A04A 2FQ3A 3BTIA 1K78A 2Z9OA 1CF7A 2BY2A 4DYCA 4M3GA 2VPRA 4DYQA 3I59B 3O2PE 3ELKA 4XK4A 1P2FA 2VC0A 3REOA 1TP4A 2NS7A 1LDJA 3HPGA 1IUYA 1IRXA 2CWEA 3RJPA 3ABMH 1L0OC 2ZXJA 1JJ8C 2VBXA 5E20A 4B47A 4I2OA 1VQOI 1UFMA 2XRLA 1ZGWA 4S05A 2DODA 2XSJC 2DAOA 4KIGA 1Z9CA 1IV8A 4RGSA 3J7AO 1KU9A 4G6DA 1FSHA 5BOXA 2HWVA 2J5PA 1B9MA 2DBBA 4WWCA 1SC7A 4HV5A 2CUFA 2RKHA 2UWMA 3KP7A 5FRNA 3R61A 5LHGA 3BQYA 3WHCA 3UKGA 5E1XA 4GYGA 2HQ5A 1ZG1A 3TW6A 4DQ2A 3S1NJ 1LKXA 2QQBA 1XPXA 4OIQF 3JRHA 3OL3A 4FTHA 1JXSA 1HLVA 1ON2A 2XAJA 3LAPA 2EJRA 3VPRA 4CCOA 4BXXJ 4LG0B 2LR8A 4UV8A 5K5QA 1YIJI 5IPAA 1DU6A 1J09A 4G9YA 3G1LA 1S3JA 4RAGA 1T08B 2FXAA 3ABKH 1XCVA 3D0SA 4Z6YA 1N77A 3J81Z 4RGUA 2HYFA 1BC8C 2WAQN 4GYIA 4ZYGA 2H8WA 2H8RA 1OR7C 1VNDA 2A69F 1JT0A 2J5OA 5IOYA 4HNVA 4MO7A 4QLCU 3JSOA 1TQMA 2E7XA 3OIOA 2MBFA 1RUOA 5K5OA 4L18B 3PJRA 3AAFA 2XF7A 2A3SA 3RKWA 2R7SA 1K61A 4EM2A 4ZDPA 4RB0A 4OIRF 2O9LA 2F5CA 3TDUC 3BCAA 1IC8A 3S3OA 3CCVI 3F23A 2HFHA 2Y0MA 5EG0A 3BPXA 4FQGA 4BJ5C 1YX5A 5FKOA 2XIGA 3DFGA 5LEKA 4JX5A 5HS9A 3IKVA 2KLOA 2DI3A 2LSOA 1S72I 5IYBJ 3W3CA 3CC4I 1SVLA 2X48A 1G4DA 1MMGA 2XROA 4V19K 4BYYA 3KFWX 2WY8Q 3WU0A 2DJIA 1A36A 1U5TB 1ETOA 1XX5A 3BTJA 3S2DJ 4Y17A 1BR1A 2K86A 2NOGA 3RPUA 1W4MA 1R22A 1HCRA 4QIWN 1MKMA 2LD5A 2LTPA 3KPHA 3PIOF 3S16J 4IO9F 2LH9A 2QQAA 3I58A 3LA3A 2CSOA 4BU2A 4EGYA 2VBYA 3TBIA 3B6AA 1I27A 2VASA 3K0LA 5M5WJ 2JPBA 5JI6A 1WGXA 5CVRA 4XLHA 1YOVB 3FBNB 4RS8A 4ANJA 4KN7X 2JRTA 2JUGA 2QSGX 3BP8A 1FLIA 1GHCA 4I76A 1N78A 1R4NB 4UXNA 2Y0SN 3SXYA 2LF7A 1TWFJ 4I0BA 2R5YA 1Z6TA 2VJJA 1IDYA 3HOTA 1D0XA 5CKTA 4FCYA 3DTKA 3FMSA 1TQPA 1BIAA 3E1SA 5AIPA 3HRSA 3KYDB 4WK8F 2W1OA 1ZGAA 1CQTA 5IT9Z 2EZLA 3BJOA 3HEFA 5BNGA 2Q1ZB 1MH4A 2RVCA 2DK8A 3E7LA 1XGOA 4GRIA 1JI8A 1S6LA 1BR4A 3BTLA 3FISA 4IVNA 4ZYHA 4ZTJA 4BS9A 1FC3A 2X1DA 2X85A 2JVGA 1UB9A 2O5RA 4HX4A 2JT1A 3CMMA 3SZTA 3P9CA 3PFYA 4QSHA 2V9PA 3I55I 1CF7B 4BQQA 3ABUA 2OQRA 4RGRA 5KHDA 4IRIA 4UVCA 1I1SA 1JUPA 5FKKA 2JA7J 1BIBA 3LOCA 4C2UA 3PM1A 5C4JJ 3BZCA 3AL0C 3T5XA 4E7LA 1T8IA 3EDPA 2FRHA 1H0MA 2EQRA 2ME6A 3GLLA 1W5CC 3ZMSA 3WTTC 4LITA 1KA8A 1H9GA 3S14J 1TW3A 2DCEA 4C2MJ 2XB0X 3H0GJ 2DW4A 3QYBA 2NVQJ 3HBLA 2QM3A 3BR5A 4JK1X 2V7FA 2L9NA 2QKLB 2LKPA 3GMEA 4ESFA 5IP6A 4FASD 1UHMA 1L3LA 2DA1A 2BEOA 4HX8A 1MNMC 1VQMI 1HSJA 1ONVA 5ICFA 2DU9A 1BI0A 1SD7A 4M6VA 2YX7A 4F92B 3W6JB 1FTTA 3ZQIA 2QKMB 2Q2EA 3KP3A 3BWGA 4Y7NJ 2L7FP 1G3YA 4I7HA 4BJ6C 2IEKA 5KNLA 2DPUA 3QRFF 2BYVE 4JQFA 4RGXA 1N25A 3S1QJ 5GTIC 2L7KA 2X6OA 2W4SA 2TCTA 1LE8A 4P9UA 1FOWA 3E6BA 4RDUA 1MDMA 2QVOA 2BW3A 2X6WA 2HPIA 3LFUA 3QQAA 4M71A 1SVMA 2M0MA 2VKVA 4BEHA 5JHFA 2FU4A 3I56I 4IKFA 1YITI 3IL2A 5JR3A 2EA4A 2LY9A 3CD6I 2HYGD 1WVRA 1P4XA 5ILSA 1JHHA 1TNSA 2HKXA 3WGHA 1K83J 4DZPA 4PJNA 2QZ8A 4HQMA 5CVUA 5C3EJ 4CCJA 1KYWA 3LA7A 3CJTB 2HDCA 3ZQCA 1V3FA 4A3JJ 2GXGA 2W25A 5EG0B 1OPCA 4FISA 2VIXA 3CMYA 2P5KA 1QA6A 4IZZA 4OOIA 2O0YA 3ZOBA 1XGMA 2EILH 1DQUA 3NQOA 3SFZA 3WG7H 1HOMA 1ON1A 1Y0NA 1FBUA 2VE8A 3EUAA 3HB9A 4E7IA 4MNUA 1PP7U 1Z7UA 3ESWB 4LOCA 1HC8A 3VYRB 1JTXA 4F93B 4N9HA 1W1WE 4HYEA 2EZHA 3A0BC 2L4MA 3DXJF 4KYWA 2K4JA 3LA2A 3OR2C 3IKTA 2GIVA 3WU1B 5K5RA 5FD6A 2KT0A 2BHZA 2DK5A 1YRNA 1FNNA 1J0RA 2CQXA 2MH9A 3QWLA 2MABA 2F5DA 2LVSA 4L9TA 1LVKA 1WHUA 2DFEA 2WV1A 4D5CA 3ZR8X 2IGKA 1ZRDA 5E79C 3IUOA 3KEQA 3H3UA 3OIPA 2ADUA 4GXOA 4TV7A 3P9KA 5ICEA 5KVRA 1F36A 2ZNYA 5LBQA 5KK1A 1LUJB 1HA8A 3F8BA 4ZH4F 2L3DA 3DLAA 1QU3A 1T95A 1WKMA 4PGGA 3EPZA 4XMYA 3DPUA 4XLPF 1IJWC 2NVYJ 2E1MC 4I98B 3ZQ7A 3CMEI 2VONA 1T0FA 4J19A 4D0PA 3DBLB 5JLWA 2P6SA 3K4KA 4HA8A 2LBFB 2CW8A 2M4KA 2EZIA 3AFHA 4HAMA 2Y9YA 4BHBA 4BDYA 5F6FA 3FMQA 2IPQX 2GXBA 2N8GA 3OYCA 2X51A 4XRMA 2X6XA 4CHUA 1YJNI 2E7WA 1LDDA 4ETSA 1S8NA 1ZHFA 5D8KB 5EEGA 4ZC3A 5D5WB 5M3FJ 4HOBA 3CMAI 3TP0A 1Z3XA 2MC3A 5LGNA 4B3XA 2VBWA 1X3UA 1OYYA 3FXUA 1I6XA 1X2MA 2GOMA 4Y33A 3MFKA 1B8IB 2E2JJ 2W24A 3MZYA 3M07A 1EH7A 4PJJA 2ZNZA 4R8HA 3FXOA 2PFBA 3SDGA 2XGCA 4BQAA 3ZQGA 4BQOA 1MW7A 4KDPA 2DMUA 4BDZA 2L7MP 2KISA 2ZMEC 4O5VA 3D1NI 1XC5A 1ETVA 4OAZA 3QPSA 1AKHA 1ULYA 1YFHA 2STTA 2HQAA 4NQWA 2K9LA 3L7WA 5DYMA 3BOQA 2EIJH 2NYXA 4LGWA 2PMZA 3LSHA 3H9GA 4Q4ZF 1YIOA 2K40A 1MBGA 5F1RA 3NARA 1VQ6I 3GFIA 5M5XJ 3DU6A 2Q2EB 1FJLA 1RNLA 1X3ZB 3GTJJ 2E71A 2QLZA 2L0KA 2RQQA 2YPRA 3U21A 3OS2A 1FOYA 1T38A 3HSEA 4UVBA 1IGNA 4CCMA 4MQVA 4XN3A 3VFZA 2CQQA 2MSYA 2DQLA 1XDUA 3B6CA 1IO2A 1D1CA 4H0EA 2PMUA 2ELJA 1PP8F 4OIPF 3GTKJ 3K1NA 2DMQA 3O8GA 2ISZA 2E2HJ 1HKTA 1BBYA 2P5VA 1XG1A 3H9QA 2XPWA 2BW3B 3GO5A 5EGOA 4HRIA 2LDUA 1MBEA 1OFCX 1D1AA 4A3MJ 1MNEA 2CH0A 2XKPA 1RETA 3BR2A 2E35A 4M74A 3BJAA 2W00A 1WRJA 4IHSA 3HRMA 3SEQA 2STWA 2VUMJ 5BS6A 1VQ4I 1A6QA 3A02A 2X0LA 2VKDA 3J7ZI 1I50J 5D5VB 2DTZA 1TWAJ 1T2KA 3HHGA 2KFDA 1YW7A 3FX3A 4KT6A 3OYHA 2NNYA 1FWZA 5DUKA 3ABLH 5J4YA 1ITYA 1ZRFA 1OLTA 5FB2A 1YYVA 1MMSA 1MSFC 4YELA 2OBPA 4ESJA 4YFKF 2IBDA 3EUHC 4X0GA 3L2RA 2DOFA 2RC4A 1X1BA 3FXJA 1DUXC 3IAS2 2HNHA 2DLLA 3JAMZ 2FE3A 1VF9A 4IQ4A 1XS9A 3GYHX 2A6EF 2OZUA 2IXSA 3ERMA 2ME0A 4QWQA 4OIOF 4CUGA 2PMHA 1BI2A 4A69C 1GT0C 5F0FA 2WAQA 2W84A 3G71I 3E3VA 2Z33A 1VQ8I 3RKXA 4NHJA 4NB5A 3KZZA 3BG3A 4ZYDA 3CCQI 2AHQA 3K1PA 2RDPA 5EZHA 1MBKA 1IZ1A 3WE2A 2E34A 3DEWA 1G3WA 2VB6A 3S2WA 4ENNA 2HOSA 1OJLA 1HDPA 5KAFC 2RV8A 1WJAA 2K3PA 4XKBA 3LQQA 3AG2H 2ZC2A 2H94A 4MQ9F 2K9NA 1E3HA 1JTYA 4EJWA 3DTEA 3H92A 2XKOA 2DFIA 2V4JC 1T98A 3QAHA 4L0YB 3LSGA 3KETA 2AXLA 2KIMA 3E6MA 2R3SA 1ZREA 2DOAA 3SDBA 5J6XA 3HTUA 2JQ7A 1MMAA 1LPQA 4LD5A 2XV4S 1TBXA 2V79A 1O3QA 5DCMA 5CQGA 3S15J 2CS3A 1MBFA 3K2ZA 3RTRA 4OMYA 3PSIA 4CSWA 1D1BA 5LHHA 4FX0A 3IRRA 3V7RA 4AVZA 5K1YA 1I6HJ 3L2UA 1GDTA 3ASOH 2K9MA 3CTAA 1JE8A 1QBJA 4Y15A 3GW2A 4A0XA 2K9QA 4RAFA 2ESNA 4FT8A 5M5YJ 2VXDA 4O6JA 5K7HA 3HOXJ 2I10A 5BPIA 2LNBA 3EYIA 3WE3A 4Y52J 5FRMA 4XLEA 4DYRA 3HUGB 2L01A 3HSFA 2FF4A 3I4PA 5K7ZA 2IS1A 2M9HA 1WCMJ 3HPHA 3BR3A 1QZEA 1G3SA 3IAM2 2NS8A 5E18F 1FIAA 2EFNA 3JRAA 2ACJA 3C2BA 3GWZA 2CGPA 4N0BA 2K27A 1UCRA 2HDWA 3OS1A 4E7HA 2MLKA 2KJBA 2F48A 1PUFB 1YI2I 4U88A 1LVAA 2OF7A 1R5HA 2HQNA 5J1YA 2PJRA 4I0AA 5EEHA 2R4GA 3VSLA 3ECHA 3QODA 4A3DJ 3TGNA 3FXRA 3A01A 2OPTA 2DT6A 1V4RA 1T6SA 1BI1A 2IA2A 5L3BA 1J5YA 4N4OB 2HZDA 1U2WA 2WY7Q 5GTHC 3N97A 3KCCA 4BE0A 4KA4A 2ZXWH 4EMSA 1SEUA 2Y48A 3M1CA 2CFOA 5JLXA 3JREA 3OYFA 2EFWA 1C0WA 1U5TC 1YS6A 3TO9A 3F8CA 1SAXA 3A4CA 1IXSB 2HOAA 4XKWA 3PQKA 3OSGA 4LK1F 2KIFA 1MJAA 2EV6A 4PSWA 3L2VA 2DMNA 1G8XA 3UNGC 2O03A 1RESA 3TO7A 4MFEA 2KHMA 2ZJRF 1X58A 4ENJA 3BTCA 4XOTA 3Q0WA 5EGOB 3KYCB 1QRYA 2KRHA 3L2CA 1H89C 2ZXIA 3FHZA 1DGRM 2Z1DA 5EJCA 1DDNA 1OCZH 1ZKGA 4ZYEA 4A3IJ 1X4PA 2Z5UA 1ZR4A 1JKPC 4D5FA 4KNYA 3WTXC 4XLNF 2QSFX 5DCFA 4ZYAA 1VQLI 4B4CA 3K70D 3W2WA 4DZJA 2OJED 1TTYA 3H35A 3TP3A 3B02A 3GEZA 5ILUA 1DP3A 2XPVA 1MBJA 3L09A 1XB4A 3GUDA 1TZLA 3CO7C 1IV6A 3DWLE 1QHGA 2W85A 3ZP5A 4RA2A 1YE9A 1N75A 1Y56A 1YX3A 1TNTA 2XC7A 2P4WA 5HLHA 5CJ9A 2EZKA 3D5LA 1D0YA 1RC9A 2DMTA 3KEOA 1ZR2A 3ZQQA 3Q0UA 3JTHA 2D1HA 1MJ9A 4IOCF 2L7ZA 1QVTA 2JSPA 1G6NA 2HXIA 2YX4A 2R5ZB 1O57A 4AYBA 2FEZA 3KP6A 3OYNA 1REPC 5HNFA 4Y4RA 1YJ9I 1K4SA 3H36A 2LG4A 2AO9A 3BPVA 4LMYA 1UG2A 4UHTA 5DS9A 1Y1WJ 4U0YA 4G7OF 4KJZA 2L9SA 4PFOA 3IP4B 5AONA 3OSFA 2MC4A 2DXIA 1OYIA 2CQNA 1YS7A 2KDOA 3BZKA 3VYUB 3FKIJ 3JW4A 2VXZA 2YUSA 3C3WA 4P9FA 2OA4A 1AA7A 2OCEA 1WPKA 1R4MB 2Y69H 1J7KA 2V1NA 1F43A 2L54A 3WTSC 1ZQ3P 4ZZLA 3BR1A 3KP5A 4LIVA 2COBA 4Y13A 3G6EI 1TLHB 1RR7A 2EBIA 4C3HJ 1AHDP 4GGGA 4U0WA 3K9TA 4DBRA 2XGEA 1IN5A 2FUG2 3QPTA 2FMYA 5BPDA 2P6TA 3V8JA 1BOBA 1IXCA 5DCMB 1YJWI 1ETXA 2M7AA 4M6XA 3TL4X 5E3MA 3LSKA 3PQJA 3G73A 3CC2I 1LEBA 1DPUA 3WTYC 1FEXA 3BY6A 3FBIB 3I0TA 3F72A 2ZO4A 3QOPA 3CP2A 4AVPA 4LG3A 1O7LA 2CW7A 3CUQA 1U78A 3R0AA 1W7PA 3BT9A 5GAHJ 1Z21A 2O3FA 3BR0A 4HEA2 3DPTA 2QF7A 2VQHA 2OTLI 4KUMA 3F3XA 3E97A 4YIFA 3Q0VA 2I5UA 2JWTA 3EYYA 2QA4I 2UXNA 3ISPA 1X2NA 9ANTA 2ISYA 2HZTA 4DIQA 2MYSA 3GZNB 2L02A 3HHHA 3NEUA 4M72A 3WG9A 3SYTA 3BG7A 4X6AJ 5EZGA 5TGTA 5HS8A 3TEDA 1NG7A 2QCOA 3EETA 3H5NA 1WJBA 2YR2A 2FBHA 4MEXF 3V42A 3HG9A 4WXHA 5E3LA 1U6GA 4CXFA 4A6EA 2XAHA 1EKEA 5GADJ 4XLCA 2V6EA 4KN4X 1J75A 1G59A 2HGCA 3OS0A 3F9KA 4HSTA 3RCOA 5LD2C 1ZH5A 2GWRA 4EEFG 2WWYA 5CPRB 1K78B 1KQ9A 4YIRX 2R7QA 5D8LB 3P9IA 3N05A 3BR6A 4PFPA 3CC7I 4A5MA 5AIQA 3GTMJ 4A0ZA 1A5JA 2QUFA 3CZ6A 3PSFA 3M3YJ 2HI3A 3H5RA 5A2QK 5CVIA 1FBSA 2A6HF 2OTJI 5ICCA 1ZAOA 4CCNA 1B59A 3TW7A 1P7JA 1ORKA 3LSPA 5HLTA 5D5UB 3E6DA 3OYGA 4A2UA 1RZ4A 1SD5A 2IS6A 1STZA 3RPUD 1HKSA 1IRFA 2B7EA 2DT7B 5LFAA 5IOZA 3FZVA 3M8JA 4XRFA 2R7DA 1XDSA 2IP2A 3VDXA 3CO6C 2TDXA 3BDDA 3HL2A 2F4OB 4JX4A 5HS7A 2MFZA 3RKQA 1HSTA 4RAZA 4UUVA 2F6CA 2M8GX 1WJEA 4PDKA 4AYBN 1ZRCA 3I64A 3OYKA 1QQIA 2M1BA 3ZQHA 1KQ8A 1R00A 3OYDA 4V2GA 5HDKA 5D4SA 2LRDA 3HIFA 3HOWJ 2M5WA 3BQZA 1IG7A 2NS0A 4AIKA 4XQFA 2XAUA 2RGVA 2Z3YA 3F8FA 3ZGKA 1NHAA 4A5NA 2FJ1A 2VKEA 5DDGA 4UUSA 2ZJQF 3R4KA 4XBFA 1IRGA 2WAFA 2VT3A 1QO0D 2FD5A 2B63J 2BXZA 4PJLA
chains in the Genus database with same CATH topology
3OYBA 3UR3C 4JOMA 3DU6A 2Q2EB 3HXLA 2R7RA 4ITVA 4OWRB 3FKJA 2L5QA 4N4NB 4PJMA 3K4JA 1UAAA 2RQQA 3U21A 3OS2A 4AU7A 3KEYA 4CH7A 3EUKL 3QYFA 4CCMA 3MMYB 4XN3A 3HOSA 2KPMA 2HPMA 3PNYA 4HSRA 1D1CA 4BXFA 2ELJA 2Y0SA 3PNVA 4XORA 1UG0A 3TMOA 2I8DA 4C9YA 4NUBA 2M7BA 3ZRGA 3H9QA 3ZCOA 2W82A 2BW3B 3OYLA 4C30A 4HRIA 3OL4A 3OYIA 2CUZA 1D1AA 2Z2SB 1MNEA 2CH0A 4CCKA 2A6TA 2W00A 4XN0A 1MNDA 3SEQA 4CA0A 4E7ZA 3OOUA 3HPGA 2VKDA 4II3A 1IRXA 3KX2A 3S32A 3DQVC 2PJRB 4B47A 4KT6A 2RREA 3MKYB 2XSJC 2LBFA 3OYHA 1OLTA 2AQFA 3H9JA 4ZTFA 3VYTB 2LY2A 4YELA 3DKYA 3EUHC 4X0GA 3I9V2 3L2RA 4BE2A 2HU9A 1X1BA 2VPLA 3IAS2 2HNHA 2UWMA 5FRNA 4KISA 4IQ4A 4XKVA 1W36D 1Z3YA 2OC6A 2IXSA 4ZJZA 4CUGA 3PUBA 4HNTA 1LKXA 3RQ4A 2E5NA 1V5EA 4BL0B 3OL3A 2WAQA 2W7NA 1X1CA 3DTIA 2UUZA 1K6YA 3D5RC 1Y6IA 4CCOA 2KRCA 4RM2A 4BQNA 2VB6A 1J09A 2CUJA 1WJAA 4XM3A 2K3PA 4PUSA 4DGWB 2WB1A 4XKBA 2KZVA 2IGNA 3OWTA 1N77A 1SAUA 3LL7A 3DTEA 3S3MA 2ZXHA 4E6KG 4MLOA 1FMWA 2V4JC 4B44A 1OR7C 4HG2A 3LSGA 3L2WA 3DKXA 2DOAA 3SDBA 5HNHA 3K4LA 4IX7A 1MMAA 3HKZA 3K4BA 4R79A 3LMMA 3PJRA 2XF7A 4E4HA 2JVHA 5CQGA 2CS3A 3MKZA 3RTRA 2R7SA 3GBGA 4ZDPA 3PSIA 4CSWA 1D1BA 3CJRB 3QYEA 1UELB 3BCAA 4KITB 3OY9A 4LIUA 3S3OA 3K6GA 4AVZA 4OAYA 3E0JB 4RMNA 1TT0A 4RM3A 4BJ5C 1YX5A 3L2UA 4RLQA 3BCBA 3AKZA 2KLOA 2K9MA 3W3CA 1WFXA 1MMGA 1LFPA 1X1DA 2WY8Q 2DJIA 2VXDA 4B48A 4NC8A 1BR1A 4ZDOA 5FRMA 4XLEA 3HUGB 3BG6A 4Y3OA 4DOZA 2IS1A 4J00A 2ZSIB 1MMDA 3HPHA 3HC7A 4QPQA 3IAM2 4D9JA 2LH9A 3OYAA 4BU2A 1BR2A 3TBIA 3MKWB 1GLNA 1T0FC 1ZELA 4H4KC 2HDWA 2VASA 3OS1A 4E7HA 3LSMA 2V9KA 3ZXSA 4BEHB 3A2KA 2CV2A 3PL8A 2PJRA 4XLHA 3FBNB 4ANJA 2R4GA 3VSLA 4DBQA 3QODA 4P1WA 2F5VA 2JUGA 2DT6A 3CESA 2OUMA 3AL0B 1N78A 1PJRA 4N4OB 2HZDA 2WY7Q 2M4GA 4BE0A 2VJJA 2XF5A 2E60A 3M1CA 2CFOA 3NWSA 2CV0A 3HOTA 1D0XA 5CKTA 3OYFA 3DTKA 3NWTA 3E1SA 2LREA 2WBMA 3A4CA 4XKWA 4PSWA 2W1OA 3L2VA 1X4OA 1G8XA 3UNGC 2K5CA 1W36C 2Q1ZB 2GOXB 2KHMA 3CJQB 2IGOA 2VL8A 4GRIA 4NNJA 4IQJA 1JI8A 1BR4A 4ZTJA 2KP6A 1ERDA 4BS9A 4XOTA 2X1DA 2X85A 2JVGA 2KRHA 2RNGA 2ZXIA 2O5RA 1DGRM 2Z1DA 1X4PA 4FETA 3CMMA 1D0ZA 4RLFA 3PFYA 4ZYAA 3OYJA 1QHHD 3K70D 3W2WA 2Z16A 2KQRA 1DGWY 2AQEA 3RSNA 3H35A 4BQQA 2R7XA 5KHDA 1DP3A 3KYLA 4F3QA 1S9HA 2ZFUA 3A1YA 2V26A 4C2UA 3OMYA 3AL0C 4E7LA 4CCLA 4G6TB 3SEZA 1TZLA 3ONQA 3DWLE 1QHGA 1V5GA 1YE9A 1N75A 1Y56A 1YX3A 2JA2A 4LITA 2XC7A 1EA3A 3S8PA 1LDKB 2DCEA 3D5LA 1D0YA 3OR1C 4XLAA 2A5WA 3QYBA 3ZQQA 4XNFA 2V7FA 3CP8A 2L9NA 1V5FA 5HOOA 4XOPA 2JSPA 2QKLB 3QOEA 3H0DA 2XDVA 4AYBA 4FASD 3K4MA 3OYNA 5HNFA 4Y4RA 2LG4A 2R7WA 4E7JA 4F92B 4KJZA 2L9SA 4PFOA 1WJFA 2XF6A 3IP4B 2QKMB 3MD2A 2MC4A 2BVMA 2DXIA 1Z7LA 2X1EA 2KDOA 3VYUB 3LSIA 4E7KA 2R7TA 4BJ6C 1FMVA 2VXZA 4F55A 5KNLA 4JQFA 1AA7A 2VLAA 4YRVA 4PK4A 2V1NA 2X1CA 2L7KA 2HVSA 1E0EA 2W4SA 3PNTA 4LIVA 4PSXA 4XKCA 1U0JA 2BW3A 2X6WA 1KONA 2HPIA 2VJ5A 3LFUA 4BEHA 2M0MA 5JHFA 4IKFA 4DBRA 2BOLA 3VSKA 4XONA 2FUG2 2E5ZA 5HVQC 2WAEA 2OV7A 1BOBA 2M7AA 4PJNA 3TL4X 3SZGA 4U7BA 4CCJA 3K4CA 3LSKA 1SFKA 4XR6A 4CZCA 3D5SC 3FBIB 2VJIA 3BLYA 4NQWB 1NG6A 3CP2A 4LG3A 2CW7A 3K10A 2VIXA 1X19A 1Z21A 2M3AA 4HEA2 3DPTA 2VQHA 4D1QA 1PYVA 4IZZA 4E7SA 3CF2A 4BGDA 2E1MB 2R7UA 2VQCA 1DQUA 1P9QC 3C2GA 4B43A 3EUAA 4DIQA 2MYSA 2WADA 4DJAA 4E7IA 3G2BA 3SYTA 2VJ4A 1X1AA 3BG7A 2F4IA 1WJ5A 3VYSB 2ZSHB 2HVRA 5TGTA 2WA0A 3VYRB 1NG7A 3K4NA 4F93B 4ZDLA 5FROA 4BUPA 4F91B 3FDYA 3H5NA 1WJBA 3DU5A 4C2TA 3V42A 3OR2C 3HG9A 5CQEA 3K70C 3DPLC 4XLCA 2V6EA 1G59A 3OS0A 3F9KA 2MABA 4QPOA 4HSTA 3I3LA 3RCOA 5LD2C 2IGMA 1LVKA 2LOOA 3ZR8X 2IGKA 2R7VA 3IUOA 3OIPA 2KMUA 5CPRB 4XLFA 2R7QA 2VQLA 1HA8A 3FHNA 3VWBA 3N05A 4PFPA 3DLAA 4XL9A 1T95A 4F52A 2HVQA 4BE1A 2VKHA 1QU3A 2LY1A 3EPZA 4XMYA 3DPUA 2IS4A 2E1MC 3CZ6A 3PSFA 2LC2A 3K4KA 3H5RA 2LBFB 2CW8A 3C2HA 2M4KA 3AFHA 4CCNA 3J7AY 2LYCA 2CMPA 4NC7A 4BDYA 3W2VA 5HLTA 4YEJA 3OYGA 3OYCA 2X51A 4J01A 2X6XA 2IS6A 3RPUD 4ZC3A 2DT7B 5LFAA 2L2OA 3M8JA 3VDXA 3BC8A 3HL2A 1R6RA 1Z3XA 4BJTA 4P5OA 2MFZA 4B3XA 2NOJB 3OYEA 2R7OA 3S3NA 2MD0A 3L2QA 2KL4A 2GOMA 4Y33A 2F6CA 3DEEA 4PJJA 1WJEA 2UV1A 4BACA 4HNUA 2BVLA 3OYKA 2VQGA 1VZ0A 1MW7A 4II2A 4BQOA 3W2AA 3OYDA 4BDZA 2LRDA 1WJCA 1MMNA 2CV1A 4EATA 2P0WA 4XQFA 2XAUA 5KCMA 3ZGKA 4OAZA 2IS2A 3OYMA 3H5AA 3OIQA 2HQAA 4HPQA 2K9LA 2X6YA 3S93A 2WAFA 1WJDA 4U87A 2PMZA 3LSHA 4PJLA 3H9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOO A; 
#chains in the Genus database with same CATH topology
 3HGG A;  1JKQ C;  5DM7 F;  3OYB A;  1AU7 A;  1FP1 D;  3UR3 C;  3QP6 A;  3PO2 J;  2QWW A;  1EJ9 A;  1I5Z A;  1E17 A;  1YG2 A;  5E8G A;  1ZLJ A;  1FP2 A;  4OWR B;  3N4M A;  3K4J A;  1NK3 P;  1B1B A;  4AU7 A;  3O8H A;  4CH7 A;  1T56 A;  1GV5 A;  3WU2 C;  1B4A A;  1R9T J;  2KPM A;  3Q9V A;  2HPM A;  2AS5 F;  3P7N A;  4YII A;  1KGS A;  5J47 A;  3PNY A;  4HSR A;  3Q3S A;  5D4R A;  2DA2 A;  4NDL A;  1EH8 A;  2VI6 A;  5JFR A;  2HTJ A;  4C9Y A;  2Q0O A;  1WH5 A;  2LKS A;  3QU3 A;  3OYL A;  3RKY A;  3OL4 A;  3OYI A;  2CUZ A;  2HOE A;  1Z1D A;  3VEP A;  2CQ7 A;  5DD8 A;  5ED4 A;  2JSC A;  4IRG A;  2LKX A;  2A6T A;  5E3N A;  4XN0 A;  1MND A;  4AC0 A;  3M8E A;  2GXA A;  3EQL F;  5ERI A;  1G2H A;  4CA0 A;  3HOY J;  1WH7 A;  3OOU A;  2JA6 J;  4II3 A;  2F5F A;  2E1C A;  2JJ7 A;  3KX2 A;  2NAZ A;  3DQV C;  3CDL A;  2VOP A;  3M8F A;  2TRT A;  5J4V A;  4QTR A;  5C4X J;  5ICG A;  4IEJ A;  2ZME A;  3KIO A;  3DP7 A;  4LFU A;  1FT9 A;  2RRE A;  2HTS A;  3MKY B;  1KYZ A;  1G3T A;  2LMD A;  4FX4 A;  3IWZ A;  2AQF A;  4CYC A;  1MH3 A;  3FIW A;  3H9J A;  3GTP J;  2MG4 A;  2E2I J;  5FLV A;  4BHC A;  1SFX A;  2O8X A;  4CZZ A;  2R5Y B;  4RB2 C;  4A6D A;  3V7S A;  3DKY A;  3I9V 2;  2L9R A;  2FNA A;  1Y8Q B;  3ECO A;  4DNC A;  2VPL A;  5D6F A;  2IA0 A;  2M2E A;  1TT5 B;  3JRB A;  5FKN A;  1T39 A;  1R5G A;  2XRN A;  3ROU A;  4XKV A;  3C7J A;  2JA8 J;  1W36 D;  5L3F A;  4ZJZ A;  2E19 A;  2CQK A;  4LB6 B;  3U9G A;  3CCL I;  1HW2 A;  3RQ4 A;  2VT2 A;  1V5E A;  3O6B B;  2O6G E;  1X1C A;  2UUZ A;  1IDZ A;  4EM0 B;  2BY3 A;  2KRC A;  4RM2 A;  2A05 A;  2NVT J;  1OCR H;  1MSE C;  5FGM A;  4O3M A;  2DDB A;  2CUJ A;  4PUS A;  2WB1 A;  1BJZ A;  4CYD A;  2XPU A;  5H6R A;  2IGN A;  4KT5 C;  1SFE A;  4FHT A;  4M73 A;  2B0L A;  3S3M A;  2F2E A;  6PAX A;  4MLO A;  1OCP A;  1FMW A;  1PVE A;  4B44 A;  4HG2 A;  5DUI A;  4N9I A;  3M1E A;  1R5I D;  1LFU P;  1KU7 A;  3DKX A;  5HNH A;  1H88 C;  3K4B A;  3I53 A;  4R79 A;  3RYR A;  1Y39 A;  3DV8 A;  5LRS A;  5HLG A;  5KAI C;  2JVH A;  4E4H A;  2KZG A;  3KLN A;  2FA5 A;  3MKZ A;  3GBG A;  1KU3 A;  1IUF A;  5GAG J;  2DYR H;  3CJR B;  2K9S A;  1YW9 A;  1UEL B;  2BBY A;  1BW5 A;  4KIT B;  3OY9 A;  4LIU A;  4OIN F;  3K6G A;  4WXD A;  2CW0 F;  3LSR A;  4OAY A;  4RMN A;  1TT0 A;  1ENH A;  1JGG A;  1BA5 A;  4RLQ A;  4P96 A;  3BCB A;  3ABT A;  3MN2 A;  3AKZ A;  4A3G J;  1JT6 A;  1JUS A;  5LGT A;  1WFX A;  1DP7 P;  2DQR A;  2E1O A;  2XAS A;  3EUH A;  3HKZ N;  4U0V A;  1LFP A;  2ID6 A;  1AWC A;  1X1D A;  3QPL A;  4B48 A;  4NC8 A;  5LHI A;  5B3S H;  4ZDO A;  4KIB A;  1J59 A;  4DOZ A;  1R58 A;  4Y3O A;  1OQY A;  4J00 A;  1RR8 C;  1MMD A;  1H8A C;  4M3F A;  4L9J A;  1BC7 C;  3QU6 A;  4D9J A;  1SFO J;  1R7J A;  4A12 A;  1BM9 A;  4BNC A;  4EM1 A;  2OAZ A;  3GFM A;  5CLS A;  2ECB A;  1GLN A;  4UB6 C;  2ESH A;  1FZP B;  1T0F C;  1ZEL A;  2COM A;  2PQ8 A;  3I59 A;  3K69 A;  1U3E M;  1VQ9 I;  2R7F A;  1LE8 B;  3TQN A;  1XMA A;  3L00 A;  1P92 A;  1MDM B;  3ZMV A;  2LLK A;  1XGN A;  3LSM A;  1TWC J;  3ZXS A;  4BEH B;  3A2K A;  2JMW A;  2IAI A;  4P1W A;  2Y31 A;  4AID A;  2ZCW A;  3JR9 A;  3CES A;  2OUM A;  2LP0 A;  2XVC A;  1OMI A;  2G7H A;  5TIS C;  5A2Q Z;  4ENM A;  4A3F J;  5EEA A;  3L9F A;  1QZZ A;  2JZY A;  2M4G A;  2GM4 A;  3GFL A;  1UHW A;  3BJ6 A;  2E60 A;  3Q5F A;  3CCS I;  5HOD A;  2YU3 A;  1I1G A;  1J9I A;  3NWT A;  3KE2 A;  5FLM J;  4M9X A;  1HQC A;  2WBM A;  2FX0 A;  3F8M A;  2LFB A;  3F0C A;  1YO5 C;  4XSX F;  2ECC A;  2EIM H;  2QGU A;  2A61 A;  2GOX B;  4A93 J;  4MTE A;  2MLG A;  5ILV A;  4NNJ A;  4IQJ A;  1WQ2 A;  2KP6 A;  2OD5 A;  3JCU C;  3ZPL A;  2EK5 A;  2QEX I;  1UJ8 A;  4UNO A;  3CJN A;  4AWX B;  3F21 A;  5GPA A;  1I3Q J;  1FYM A;  1S5L C;  3MZ8 A;  5JHU A;  1D0Z A;  1E2X A;  2GA2 A;  4IPA A;  2JPC A;  1QHH D;  1Y8R B;  3PUF A;  4C3J J;  4BBS J;  2Z16 A;  3A03 A;  2KQR A;  3RQI A;  5CVV A;  1DGW Y;  2EB7 A;  4BBR J;  1YRN B;  2JRM A;  3KYL A;  4F3Q A;  1Z6R A;  3I4M J;  3A1Y A;  2V26 A;  3WOD F;  1R71 A;  4ENK A;  2EFO A;  4CCL A;  4G6T B;  4CDG A;  3VOE A;  2Y30 A;  1GV2 A;  4RB3 C;  2CO5 A;  1SMY F;  1EV7 A;  1IN8 A;  4HF0 A;  2DA5 A;  1FTZ A;  1FSE A;  1EA3 A;  4ASN A;  3S8P A;  3BRO A;  3FXL A;  4G12 A;  1RRJ A;  3B73 A;  4Q5S F;  4XNF A;  2K3F A;  1GVD A;  3CP8 A;  1Q1H A;  2CU7 A;  2RAE A;  5L3G A;  1HBX G;  2XDV A;  1YHQ I;  4M3B A;  5IT9 K;  2M30 A;  2HR3 A;  4OMZ A;  5IYC J;  1R49 A;  1EF4 A;  3WHB A;  2XSD C;  5FD5 A;  2DN0 A;  3HGY A;  2R7W A;  2WB1 N;  5EF6 A;  2XF6 A;  1B6A A;  1GXP A;  1U5T A;  2HDD A;  1FYL A;  3I54 A;  2BVM A;  1TW2 A;  2HYJ A;  3R6S A;  4UY8 I;  1ETW A;  3JRI A;  2ZJ2 A;  3LSI A;  2QEN A;  1FMV A;  1RKW A;  4F55 A;  4MHG A;  1OKR A;  2EFP A;  2VLA A;  4YRV A;  1JJ6 C;  2Y9Z A;  4PK4 A;  4C3I J;  2DDA A;  1XCB A;  2V1X A;  2X1C A;  3RZO J;  1K6O A;  1F4K A;  2HVS A;  5J8F A;  2EFQ A;  1SMT A;  4K2E A;  1SVO A;  2MA3 A;  4IL6 C;  2CYY A;  1RI7 A;  2GZW A;  3SZP A;  4HLY A;  4XKC A;  3S1R J;  1HKQ A;  3BG5 A;  2KDZ A;  1ZTR A;  1KON A;  2VJ5 A;  3VOD A;  4CO8 A;  2QQ9 A;  3KP2 A;  4UV9 A;  5J1R A;  3VSK A;  3R60 A;  2M0C A;  2K4B A;  4XON A;  1A31 A;  2DOE A;  5EDN A;  1VQ7 I;  2E5Z A;  2XAF A;  3GFJ A;  2BY0 A;  3ZN1 A;  3MZH A;  4GFB A;  4L5I A;  4I09 A;  1XD7 A;  3GLX A;  4IHV A;  2DJN A;  3E5X A;  1QNT A;  3AG1 H;  3SZG A;  4U7B A;  4BY1 J;  4UB8 C;  2A07 F;  2RNJ A;  4YG2 F;  3K4C A;  4BHP A;  1AKH B;  3HDD A;  2KIQ A;  1V55 H;  3BZ6 A;  4XR6 A;  3C18 A;  4CZC A;  4HDV A;  3D5S C;  4PCQ A;  2K85 A;  2VJI A;  1XTA A;  3BLY A;  4NQW B;  1NG6 A;  1ZG3 A;  4GCV A;  4LLN A;  1PYV A;  2FOK A;  4E7S A;  1SD4 A;  3DKW A;  3CLQ A;  1OR7 A;  1SAN A;  2FSW A;  1P9Q C;  1APL C;  2WAD A;  4DJA A;  3TDZ C;  3G2B A;  2Z99 A;  2VJ4 A;  3LFK A;  1WJ5 A;  4UVA A;  4IXA A;  4ZDL A;  5FFZ A;  4F91 B;  4WCG A;  1W0T A;  2HS5 A;  3FWE A;  3MKL A;  1FX7 A;  4C2T A;  4DW6 A;  4F7Z A;  3S17 J;  2W48 A;  5CQE A;  4HF2 A;  3GTQ J;  2DYS H;  4LJZ F;  3DPL C;  4KIF A;  4JX6 A;  3K70 C;  4R1H A;  4A3C J;  4ESB A;  4QPO A;  2JN6 A;  3I3L A;  1GXQ A;  2LOO A;  3HZJ A;  3GCM A;  1UST A;  2R7V A;  1ETQ A;  4M3E A;  3FXM A;  4E70 A;  2JA5 J;  4IRH A;  3M7G A;  1UZC A;  3NRV A;  5FKM A;  4F52 A;  2HVQ A;  3ZQF A;  1J2X A;  2LY1 A;  3IHU A;  3CF5 F;  5DV5 A;  5M3M J;  1IN6 A;  2IS4 A;  4IHX A;  5F0C A;  1T33 A;  3J7Y J;  1OIS A;  3CCJ I;  2DA6 A;  4JBA A;  2X9D A;  3S2H J;  4HV6 A;  2KKO A;  5L3E A;  3J7A Y;  1OCT C;  4WXC A;  3MCZ A;  3V7C A;  3W2V A;  2D1V A;  1VFC A;  4LB5 A;  4YEJ A;  3IH3 A;  1RIO H;  1A35 A;  1W5S A;  1O3S A;  4IJA A;  5JVG F;  1OYW A;  2LF8 A;  5LEJ A;  3TOB A;  2ZKZ A;  3DBR B;  4RB1 A;  3ML6 A;  1Y1V J;  4KMF A;  3BC8 A;  3G4S I;  2NVU B;  2C6Y A;  1NK2 P;  1R6R A;  1XGS A;  2ELH A;  5J3L A;  1JGS A;  3OYE A;  2NOJ B;  3T1B A;  3ZMU A;  3S1M J;  2R7O A;  2PLY A;  2MD0 A;  1XSD A;  4EQQ A;  1R36 A;  3DEE A;  1W0U A;  2A5Y B;  3HYI A;  1ETY A;  4M3D A;  4BAC A;  2EPF A;  2VQG A;  4XRS A;  4M9S A;  5IP7 J;  3W2A A;  2H27 A;  5TRD A;  1WJC A;  3L1P A;  3RZD J;  4EAT A;  2L4A A;  2P0W A;  5KCM A;  2MGQ A;  2G7U A;  3OYM A;  2W57 A;  3H5A A;  1ACI A;  2BV6 A;  2GQQ A;  5H20 A;  4HPQ A;  3T8T A;  1BN5 A;  2X6Y A;  4BKX A;  1OCO H;  4JYK A;  1MJB A;  3PFI A;  3K1M A;  2PJP A;  2DA4 A;  4BAY A;  3K7A J;  4JOM A;  2FQ4 A;  3GZ5 A;  5FLX K;  3ASN H;  3HXL A;  2P5L C;  2R7R A;  1VQ5 I;  3FKJ A;  2L5Q A;  4N4N B;  4PJM A;  1UAA A;  3HTS B;  1X3W B;  2RQP A;  2WC2 A;  3GTO J;  1BJA A;  2NNN A;  3EUK L;  4BH9 A;  3E5U A;  2JTV A;  3HOS A;  1IXR C;  3QPH A;  3PO3 J;  5D6E A;  4FE4 A;  4V2F A;  4BXF A;  1R23 A;  2EA2 A;  2KRF A;  3CCY A;  1VI0 A;  3PNV A;  1UG0 A;  4XOR A;  2DFH A;  1FPQ A;  2I8D A;  3TMO A;  4MEY F;  4NUB A;  4U7D A;  3F6O A;  1U9O A;  1S7E A;  4C30 A;  2Z2S B;  2P8T A;  3BG9 A;  4CCK A;  1LB2 A;  3HOU J;  4P55 A;  2XAG A;  5GPC A;  4RBO A;  3A0H C;  4E7Z A;  3S32 A;  1YW8 A;  3DCF A;  5C44 J;  2DTR A;  2PJR B;  2QBY A;  4EJO A;  1DU0 A;  2BE5 F;  3A01 B;  2LBF A;  5CVJ A;  2DMP A;  1Q1V A;  4ZTF A;  3VYT B;  4MGR A;  2BZT A;  3FMR A;  5E3O A;  2HOT A;  2LY2 A;  2CG4 A;  5L3C A;  4D7N A;  3OV8 A;  2PI0 A;  3E5Q A;  4BE2 A;  3NAU A;  4S04 A;  1D5V A;  2HU9 A;  4GDF A;  2D45 A;  2K02 A;  2P7V B;  3GXO A;  1ZLK A;  4KIC A;  1O4X A;  3CCE I;  1IAW A;  4KIS A;  1WWX A;  2DA7 A;  1Z3Y A;  1RKT A;  2OC6 A;  4EJV A;  3QP5 A;  2MD5 A;  3PUB A;  4HNT A;  2FBI A;  4LK0 F;  2E5N A;  2JK3 A;  4YFN F;  4BL0 B;  4AIJ A;  3DLL F;  2X4H A;  2W7N A;  3D5R C;  3DTI A;  1K6Y A;  5DM6 F;  1B8I A;  4XRS G;  2P81 A;  1Y6I A;  2D5V A;  1NTC A;  3DF8 A;  1P7I A;  1AOY A;  4BQN A;  3COA C;  1U9N A;  5J1U A;  1K7A A;  1P4A A;  2H6B A;  5F1J A;  1IW7 F;  4XM3 A;  2IVM A;  4B09 A;  4DGW B;  2FBK A;  3CUQ C;  2KZV A;  3OWT A;  1IN7 A;  2M8E A;  4PZJ A;  1SAU A;  5BQT A;  2GBY A;  3LL7 A;  4XIC A;  3HRT A;  3H3V K;  2K7L A;  2ZXH A;  3IH2 A;  4E6K G;  5IY5 H;  4EVI A;  3L2W A;  2H6C A;  3ZQL A;  5IT3 A;  5BMZ A;  3ZMT A;  1I39 A;  4IX7 A;  2Y2Z A;  3CLO A;  3K4L A;  1ZG5 A;  3HKZ A;  1VQP I;  1W7P D;  5HDN A;  3LMM A;  3CDH A;  5HDG A;  1X1P A;  1LNW A;  4G8X A;  3ERE D;  5B5E C;  1FBQ A;  4MTD A;  3SHF A;  1SFU A;  4A3E J;  2LK2 A;  2VOO A;  3QYE A;  3JAM K;  2KIU A;  3WTW C;  1R1T A;  4Q47 A;  4YFX F;  2IJL A;  3E0J B;  4RM3 A;  1A6I A;  1LFB A;  5F27 A;  1TL8 A;  4W97 A;  1WZ2 A;  1S29 A;  3U1K A;  1K4T A;  3RPQ A;  3IV5 A;  3FM5 A;  3ZN0 A;  2VBZ A;  1MGT A;  1Z05 A;  3P5J A;  3BG6 A;  4JP0 A;  2ZSI B;  3HC7 A;  2BGC A;  1R1U A;  4QPQ A;  3KZY A;  5K7F A;  1I3A A;  1P4W A;  1QPM A;  2O7O A;  5L3D A;  2GLO A;  3T0Y A;  3OYA A;  3GX4 X;  1BR2 A;  3RDI A;  4X1E A;  1H9T A;  4A0Y A;  3MKW B;  3GTL J;  4L5E A;  3CCU I;  2BXY A;  3FF5 A;  2HXO A;  3Q9S A;  4H4K C;  2D2W A;  1E3P A;  4A3B J;  4L0Z B;  2BY1 A;  3CCM I;  1XSX A;  2YU9 J;  2DA3 A;  2V9K A;  2XAQ A;  2ZFW A;  5F08 A;  2CV2 A;  1MD0 A;  2NVX J;  3PL8 A;  1MBH A;  2IT0 A;  2YS9 A;  3LSJ A;  2Q8K A;  4DBQ A;  1IN4 A;  1GVJ A;  4IF4 A;  1FY7 A;  2WTE A;  2L9V A;  3E6C C;  3G1O A;  2XB5 A;  2F5V A;  4ON0 A;  3HRU A;  2OZ6 A;  4B1R A;  3AL0 B;  5IP9 J;  1PJR A;  1B72 A;  1O3R A;  1U8B A;  2XF5 A;  3I4N J;  4HQE A;  4B8X A;  1KQ0 A;  3NWS A;  2CV0 A;  2ELK A;  3F8N A;  2GIZ A;  4M6Y A;  2O8K A;  3CUQ B;  2FNP A;  2R7Z J;  3W6V A;  1W7P B;  3J80 K;  1PUE E;  5FJ8 J;  2LRE A;  1ZK8 A;  2ZJP F;  1HW5 A;  2ICW G;  4XSZ F;  2DO7 A;  2G0E A;  1USS A;  1X4O A;  1BW6 A;  2DFF A;  5F04 A;  1TWH J;  2VOD A;  2K5C A;  3KZI C;  3HOV J;  1W36 C;  3IC7 A;  1HW1 A;  1POG A;  3CJQ B;  2A68 F;  3HM5 A;  4HLX A;  2IGO A;  2VL8 A;  1O3T A;  4IHY A;  1ERD A;  1D3Y A;  4IHW A;  3GTG J;  3SJM A;  5J8C A;  5DEQ A;  2RNG A;  3LWF A;  2CUE A;  4HBL A;  4HW0 A;  4FET A;  3PIP F;  3RI4 A;  4RLF A;  3JRG A;  4I6Z A;  3MQ0 A;  5E17 F;  2E1N A;  3OYJ A;  2VE9 A;  4A3L J;  2KJC A;  1IRZ A;  1U8R A;  1LJ9 A;  5LRR A;  2AQE A;  3RSN A;  2OU2 A;  2R7X A;  3GZ6 A;  1S9H A;  2ZFU A;  4I01 A;  3G3Z A;  3LAJ A;  2HQR A;  4B3A A;  3OMY A;  4EJU A;  3DBH B;  3R0J A;  3VB2 A;  2QBY B;  3SEZ A;  3ONQ A;  4AD9 A;  3ULQ B;  2IW5 A;  1V5G A;  4HF1 A;  2JA2 A;  2WV0 A;  1YLF A;  2F4M B;  4IOA F;  4CIC A;  3M4O J;  1LDK B;  3C1D A;  4XLA A;  3OR1 C;  2A5W A;  3AG3 H;  4XID A;  2XGD A;  3V8K A;  2R92 J;  4RAY A;  5CYV A;  2PBI A;  3TO6 A;  5LLQ A;  1V5F A;  2QSH X;  5HOO A;  3JRD A;  2IRF G;  4XOP A;  3QOE A;  3U2R A;  3H0D A;  4GO1 A;  5FLX Z;  2OQG A;  1HF0 A;  1FOX A;  3K4M A;  1ETK A;  3V4G A;  2OCC H;  2R93 J;  4HDU A;  1SD6 A;  2JUC A;  2BHY A;  2MH2 A;  2FOW A;  4E7J A;  1WSU A;  5HLI A;  1YTY A;  1WJF A;  2IA1 A;  4L9N A;  3MD2 A;  2VN2 A;  2DT5 A;  3HUG A;  1Z7L A;  2X1E A;  3FK6 A;  2PEX A;  3MEX A;  4E7K A;  2R7T A;  3HOZ J;  3H1C A;  4AIH A;  1CGP A;  5EYR A;  1XN7 A;  1RPW A;  2M34 A;  2UZK A;  4A3K J;  2AXT C;  3H3Z A;  1TWG J;  1E0E A;  3PNT A;  4KFC A;  4PSX A;  5F64 A;  1PUF A;  5GP9 A;  1U0J A;  5LGU A;  3GF2 A;  1MIJ A;  5D5X B;  5B1A H;  2XGX A;  1XSV A;  2BOL A;  2P7C B;  2H09 A;  1TQI A;  4G6Q A;  5HVQ C;  3J81 K;  3JRF A;  2EH3 A;  1VQK I;  2WAE A;  2OV7 A;  4EJT A;  2CRG A;  3TKY A;  2H1K A;  2V1U A;  1D8J A;  4WF2 A;  1MZB A;  4BXU A;  4Q48 A;  3WTV C;  2NRA C;  1SFK A;  4MFD A;  2V9V A;  5B66 C;  1IF1 A;  4HZF A;  2ETH A;  4UUS B;  1FYK A;  3RYP A;  2MW8 A;  3K10 A;  1X19 A;  2M3A A;  1O7F A;  1Z77 A;  5E1W A;  4Z2Y A;  4D1Q A;  1JHF A;  4HX7 A;  3CF2 A;  4BGD A;  1Y0U A;  2E1M B;  1NH3 A;  4KMU X;  2R7U A;  2VQC A;  5IYD J;  2QYO A;  4AM3 A;  3C2G A;  4B43 A;  1GUU A;  1X1A A;  3VYS B;  2F4I A;  2HVR A;  2ZSH B;  2WA0 A;  3RIR A;  3K4N A;  4S0H B;  3JTG A;  5E8I A;  5FRO A;  3W6K B;  4BUP A;  2H1L A;  3FDY A;  1E3O C;  1UHS A;  1ZGJ A;  3DU5 A;  2ID3 A;  2XUB A;  3MVP A;  1F5T A;  1TC3 C;  4BY7 J;  4I02 A;  3WTZ A;  1LEA A;  1QPI A;  1KZH A;  3ZMD A;  1JKO C;  2EIK H;  1PDN C;  1RUN A;  2CFX A;  1BI3 A;  2HEO A;  2IGM A;  3TOA A;  2RN7 A;  3O3K A;  4LG0 A;  1W5T A;  2KMU A;  1XMX A;  3M9A A;  4XLF A;  3IWF A;  5J40 A;  5TJJ A;  3LQR A;  1HDD C;  2VQL A;  3FXK A;  1B72 B;  1QVU A;  5H6Q A;  1BOA A;  3FHN A;  4L5J A;  3VWB A;  4XL9 A;  4BE1 A;  2VKH A;  2F5E A;  1F1Z A;  1WI3 A;  1YQA A;  1ZYR F;  1S7O A;  1EH6 A;  3IRQ A;  4WX9 A;  2ZME B;  4EGZ A;  2Y75 A;  2R5Z A;  3LNQ A;  2LC2 A;  1ZAR A;  2EV5 A;  3SQN A;  4PJ0 C;  3C2H A;  2GA1 A;  4CYC B;  2LYC A;  2O61 A;  2CMP A;  4NC7 A;  3HJE A;  3U1D A;  3MWM A;  1QZY A;  2XHK A;  4J01 A;  3K2A A;  1WI9 A;  2DPD A;  2UXX A;  2CJJ A;  5JVT A;  3I5U A;  3T8R A;  1UMQ A;  3CCR I;  2L2O A;  5H2F C;  1FIP A;  3KP4 A;  1JUM A;  1P6R A;  3SFI A;  3IH4 A;  4ZZD A;  4G7H F;  5E1Z B;  2HKO A;  3CDI A;  4NBQ A;  4BJT A;  1D8K A;  4P5O A;  5B1B H;  2R0Q C;  3GVA A;  4FE7 A;  5F0H A;  3S3N A;  1V54 H;  5FKL A;  1ZN2 A;  3L2Q A;  4CGZ A;  2KL4 A;  4MIM A;  3ZMZ A;  3CQZ J;  5GAE J;  4G7Z F;  5FFX A;  3JRC A;  2VC1 A;  2UV1 A;  2ZBK A;  4HNU A;  2BVL A;  2B9S A;  3V8L A;  1VTN C;  1VZ0 A;  4II2 A;  2G9W A;  1M1E B;  2PN6 A;  1K79 A;  1MMN A;  2CV1 A;  3FK7 A;  4M9Z A;  3FM3 A;  3WGI A;  2IS2 A;  5DTD A;  2M45 A;  2PG4 A;  2V6C A;  3OIQ A;  1LQ1 A;  3F6V A;  1B9N A;  4LLL A;  3AG4 H;  1S7A A;  3LST A;  3S93 A;  1HXD A;  1WJD A;  2PX9 A;  4U87 A;  4ABZ A;  2EIN H;  2NXN B;  4AUX A;  3J80 Z;  1BL0 A;  3DEU A;  2FML A;  4W1U A;  4NC6 A;  1XMK A;  2M87 A;  1QGP A;  4I99 C;  4ITV A;  4L9V A;  3OOP A;  3F22 A;  1KU2 A;  4UUT A;  4LLG F;  2GAU A;  1Z67 A;  3KEY A;  4D7M A;  2E36 A;  3HSR A;  4OU0 A;  4IHT A;  2ZB9 A;  2V1D A;  3QYF A;  3MMY B;  3X2Q H;  2EWN A;  4PGH A;  2PMZ N;  1F9N A;  5DD4 A;  1ODD A;  2Y0S A;  1DPR A;  1OCC H;  3FXQ A;  5FO5 A;  1FOK A;  4EV0 A;  2YSR A;  3CUO A;  2M7B A;  4G94 A;  1JKR C;  1Z0X A;  3WTU C;  3KLO A;  3ZRG A;  3ZCO A;  2W82 A;  1D5Y A;  3I71 A;  1R1V A;  3G1M A;  2EV0 A;  2QQ8 A;  1Z91 A;  3WGG A;  3JSP A;  3MAJ A;  1VQN I;  1A04 A;  2FQ3 A;  3BTI A;  1K78 A;  2Z9O A;  1CF7 A;  2BY2 A;  4DYC A;  4M3G A;  2VPR A;  4DYQ A;  3I59 B;  3O2P E;  3ELK A;  4XK4 A;  1P2F A;  2VC0 A;  3REO A;  1TP4 A;  2NS7 A;  1LDJ A;  3HPG A;  1IUY A;  1IRX A;  2CWE A;  3RJP A;  3ABM H;  1L0O C;  2ZXJ A;  1JJ8 C;  2VBX A;  5E20 A;  4B47 A;  4I2O A;  1VQO I;  1UFM A;  2XRL A;  1ZGW A;  4S05 A;  2DOD A;  2XSJ C;  2DAO A;  4KIG A;  1Z9C A;  1IV8 A;  4RGS A;  3J7A O;  1KU9 A;  4G6D A;  1FSH A;  5BOX A;  2HWV A;  2J5P A;  1B9M A;  2DBB A;  4WWC A;  1SC7 A;  4HV5 A;  2CUF A;  2RKH A;  2UWM A;  3KP7 A;  5FRN A;  3R61 A;  5LHG A;  3BQY A;  3WHC A;  3UKG A;  5E1X A;  4GYG A;  2HQ5 A;  1ZG1 A;  3TW6 A;  4DQ2 A;  3S1N J;  1LKX A;  2QQB A;  1XPX A;  4OIQ F;  3JRH A;  3OL3 A;  4FTH A;  1JXS A;  1HLV A;  1ON2 A;  2XAJ A;  3LAP A;  2EJR A;  3VPR A;  4CCO A;  4BXX J;  4LG0 B;  2LR8 A;  4UV8 A;  5K5Q A;  1YIJ I;  5IPA A;  1DU6 A;  1J09 A;  4G9Y A;  3G1L A;  1S3J A;  4RAG A;  1T08 B;  2FXA A;  3ABK H;  1XCV A;  3D0S A;  4Z6Y A;  1N77 A;  3J81 Z;  4RGU A;  2HYF A;  1BC8 C;  2WAQ N;  4GYI A;  4ZYG A;  2H8W A;  2H8R A;  1OR7 C;  1VND A;  2A69 F;  1JT0 A;  2J5O A;  5IOY A;  4HNV A;  4MO7 A;  4QLC U;  3JSO A;  1TQM A;  2E7X A;  3OIO A;  2MBF A;  1RUO A;  5K5O A;  4L18 B;  3PJR A;  3AAF A;  2XF7 A;  2A3S A;  3RKW A;  2R7S A;  1K61 A;  4EM2 A;  4ZDP A;  4RB0 A;  4OIR F;  2O9L A;  2F5C A;  3TDU C;  3BCA A;  1IC8 A;  3S3O A;  3CCV I;  3F23 A;  2HFH A;  2Y0M A;  5EG0 A;  3BPX A;  4FQG A;  4BJ5 C;  1YX5 A;  5FKO A;  2XIG A;  3DFG A;  5LEK A;  4JX5 A;  5HS9 A;  3IKV A;  2KLO A;  2DI3 A;  2LSO A;  1S72 I;  5IYB J;  3W3C A;  3CC4 I;  1SVL A;  2X48 A;  1G4D A;  1MMG A;  2XRO A;  4V19 K;  4BYY A;  3KFW X;  2WY8 Q;  3WU0 A;  2DJI A;  1A36 A;  1U5T B;  1ETO A;  1XX5 A;  3BTJ A;  3S2D J;  4Y17 A;  1BR1 A;  2K86 A;  2NOG A;  3RPU A;  1W4M A;  1R22 A;  1HCR A;  4QIW N;  1MKM A;  2LD5 A;  2LTP A;  3KPH A;  3PIO F;  3S16 J;  4IO9 F;  2LH9 A;  2QQA A;  3I58 A;  3LA3 A;  2CSO A;  4BU2 A;  4EGY A;  2VBY A;  3TBI A;  3B6A A;  1I27 A;  2VAS A;  3K0L A;  5M5W J;  2JPB A;  5JI6 A;  1WGX A;  5CVR A;  4XLH A;  1YOV B;  3FBN B;  4RS8 A;  4ANJ A;  4KN7 X;  2JRT A;  2JUG A;  2QSG X;  3BP8 A;  1FLI A;  1GHC A;  4I76 A;  1N78 A;  1R4N B;  4UXN A;  2Y0S N;  3SXY A;  2LF7 A;  1TWF J;  4I0B A;  2R5Y A;  1Z6T A;  2VJJ A;  1IDY A;  3HOT A;  1D0X A;  5CKT A;  4FCY A;  3DTK A;  3FMS A;  1TQP A;  1BIA A;  3E1S A;  5AIP A;  3HRS A;  3KYD B;  4WK8 F;  2W1O A;  1ZGA A;  1CQT A;  5IT9 Z;  2EZL A;  3BJO A;  3HEF A;  5BNG A;  2Q1Z B;  1MH4 A;  2RVC A;  2DK8 A;  3E7L A;  1XGO A;  4GRI A;  1JI8 A;  1S6L A;  1BR4 A;  3BTL A;  3FIS A;  4IVN A;  4ZYH A;  4ZTJ A;  4BS9 A;  1FC3 A;  2X1D A;  2X85 A;  2JVG A;  1UB9 A;  2O5R A;  4HX4 A;  2JT1 A;  3CMM A;  3SZT A;  3P9C A;  3PFY A;  4QSH A;  2V9P A;  3I55 I;  1CF7 B;  4BQQ A;  3ABU A;  2OQR A;  4RGR A;  5KHD A;  4IRI A;  4UVC A;  1I1S A;  1JUP A;  5FKK A;  2JA7 J;  1BIB A;  3LOC A;  4C2U A;  3PM1 A;  5C4J J;  3BZC A;  3AL0 C;  3T5X A;  4E7L A;  1T8I A;  3EDP A;  2FRH A;  1H0M A;  2EQR A;  2ME6 A;  3GLL A;  1W5C C;  3ZMS A;  3WTT C;  4LIT A;  1KA8 A;  1H9G A;  3S14 J;  1TW3 A;  2DCE A;  4C2M J;  2XB0 X;  3H0G J;  2DW4 A;  3QYB A;  2NVQ J;  3HBL A;  2QM3 A;  3BR5 A;  4JK1 X;  2V7F A;  2L9N A;  2QKL B;  2LKP A;  3GME A;  4ESF A;  5IP6 A;  4FAS D;  1UHM A;  1L3L A;  2DA1 A;  2BEO A;  4HX8 A;  1MNM C;  1VQM I;  1HSJ A;  1ONV A;  5ICF A;  2DU9 A;  1BI0 A;  1SD7 A;  4M6V A;  2YX7 A;  4F92 B;  3W6J B;  1FTT A;  3ZQI A;  2QKM B;  2Q2E A;  3KP3 A;  3BWG A;  4Y7N J;  2L7F P;  1G3Y A;  4I7H A;  4BJ6 C;  2IEK A;  5KNL A;  2DPU A;  3QRF F;  2BYV E;  4JQF A;  4RGX A;  1N25 A;  3S1Q J;  5GTI C;  2L7K A;  2X6O A;  2W4S A;  2TCT A;  1LE8 A;  4P9U A;  1FOW A;  3E6B A;  4RDU A;  1MDM A;  2QVO A;  2BW3 A;  2X6W A;  2HPI A;  3LFU A;  3QQA A;  4M71 A;  1SVM A;  2M0M A;  2VKV A;  4BEH A;  5JHF A;  2FU4 A;  3I56 I;  4IKF A;  1YIT I;  3IL2 A;  5JR3 A;  2EA4 A;  2LY9 A;  3CD6 I;  2HYG D;  1WVR A;  1P4X A;  5ILS A;  1JHH A;  1TNS A;  2HKX A;  3WGH A;  1K83 J;  4DZP A;  4PJN A;  2QZ8 A;  4HQM A;  5CVU A;  5C3E J;  4CCJ A;  1KYW A;  3LA7 A;  3CJT B;  2HDC A;  3ZQC A;  1V3F A;  4A3J J;  2GXG A;  2W25 A;  5EG0 B;  1OPC A;  4FIS A;  2VIX A;  3CMY A;  2P5K A;  1QA6 A;  4IZZ A;  4OOI A;  2O0Y A;  3ZOB A;  1XGM A;  2EIL H;  1DQU A;  3NQO A;  3SFZ A;  3WG7 H;  1HOM A;  1ON1 A;  1Y0N A;  1FBU A;  2VE8 A;  3EUA A;  3HB9 A;  4E7I A;  4MNU A;  1PP7 U;  1Z7U A;  3ESW B;  4LOC A;  1HC8 A;  3VYR B;  1JTX A;  4F93 B;  4N9H A;  1W1W E;  4HYE A;  2EZH A;  3A0B C;  2L4M A;  3DXJ F;  4KYW A;  2K4J A;  3LA2 A;  3OR2 C;  3IKT A;  2GIV A;  3WU1 B;  5K5R A;  5FD6 A;  2KT0 A;  2BHZ A;  2DK5 A;  1YRN A;  1FNN A;  1J0R A;  2CQX A;  2MH9 A;  3QWL A;  2MAB A;  2F5D A;  2LVS A;  4L9T A;  1LVK A;  1WHU A;  2DFE A;  2WV1 A;  4D5C A;  3ZR8 X;  2IGK A;  1ZRD A;  5E79 C;  3IUO A;  3KEQ A;  3H3U A;  3OIP A;  2ADU A;  4GXO A;  4TV7 A;  3P9K A;  5ICE A;  5KVR A;  1F36 A;  2ZNY A;  5LBQ A;  5KK1 A;  1LUJ B;  1HA8 A;  3F8B A;  4ZH4 F;  2L3D A;  3DLA A;  1QU3 A;  1T95 A;  1WKM A;  4PGG A;  3EPZ A;  4XMY A;  3DPU A;  4XLP F;  1IJW C;  2NVY J;  2E1M C;  4I98 B;  3ZQ7 A;  3CME I;  2VON A;  1T0F A;  4J19 A;  4D0P A;  3DBL B;  5JLW A;  2P6S A;  3K4K A;  4HA8 A;  2LBF B;  2CW8 A;  2M4K A;  2EZI A;  3AFH A;  4HAM A;  2Y9Y A;  4BHB A;  4BDY A;  5F6F A;  3FMQ A;  2IPQ X;  2GXB A;  2N8G A;  3OYC A;  2X51 A;  4XRM A;  2X6X A;  4CHU A;  1YJN I;  2E7W A;  1LDD A;  4ETS A;  1S8N A;  1ZHF A;  5D8K B;  5EEG A;  4ZC3 A;  5D5W B;  5M3F J;  4HOB A;  3CMA I;  3TP0 A;  1Z3X A;  2MC3 A;  5LGN A;  4B3X A;  2VBW A;  1X3U A;  1OYY A;  3FXU A;  1I6X A;  1X2M A;  2GOM A;  4Y33 A;  3MFK A;  1B8I B;  2E2J J;  2W24 A;  3MZY A;  3M07 A;  1EH7 A;  4PJJ A;  2ZNZ A;  4R8H A;  3FXO A;  2PFB A;  3SDG A;  2XGC A;  4BQA A;  3ZQG A;  4BQO A;  1MW7 A;  4KDP A;  2DMU A;  4BDZ A;  2L7M P;  2KIS A;  2ZME C;  4O5V A;  3D1N I;  1XC5 A;  1ETV A;  4OAZ A;  3QPS A;  1AKH A;  1ULY A;  1YFH A;  2STT A;  2HQA A;  4NQW A;  2K9L A;  3L7W A;  5DYM A;  3BOQ A;  2EIJ H;  2NYX A;  4LGW A;  2PMZ A;  3LSH A;  3H9G A;  4Q4Z F;  1YIO A;  2K40 A;  1MBG A;  5F1R A;  3NAR A;  1VQ6 I;  3GFI A;  5M5X J;  3DU6 A;  2Q2E B;  1FJL A;  1RNL A;  1X3Z B;  3GTJ J;  2E71 A;  2QLZ A;  2L0K A;  2RQQ A;  2YPR A;  3U21 A;  3OS2 A;  1FOY A;  1T38 A;  3HSE A;  4UVB A;  1IGN A;  4CCM A;  4MQV A;  4XN3 A;  3VFZ A;  2CQQ A;  2MSY A;  2DQL A;  1XDU A;  3B6C A;  1IO2 A;  1D1C A;  4H0E A;  2PMU A;  2ELJ A;  1PP8 F;  4OIP F;  3GTK J;  3K1N A;  2DMQ A;  3O8G A;  2ISZ A;  2E2H J;  1HKT A;  1BBY A;  2P5V A;  1XG1 A;  3H9Q A;  2XPW A;  2BW3 B;  3GO5 A;  5EGO A;  4HRI A;  2LDU A;  1MBE A;  1OFC X;  1D1A A;  4A3M J;  1MNE A;  2CH0 A;  2XKP A;  1RET A;  3BR2 A;  2E35 A;  4M74 A;  3BJA A;  2W00 A;  1WRJ A;  4IHS A;  3HRM A;  3SEQ A;  2STW A;  2VUM J;  5BS6 A;  1VQ4 I;  1A6Q A;  3A02 A;  2X0L A;  2VKD A;  3J7Z I;  1I50 J;  5D5V B;  2DTZ A;  1TWA J;  1T2K A;  3HHG A;  2KFD A;  1YW7 A;  3FX3 A;  4KT6 A;  3OYH A;  2NNY A;  1FWZ A;  5DUK A;  3ABL H;  5J4Y A;  1ITY A;  1ZRF A;  1OLT A;  5FB2 A;  1YYV A;  1MMS A;  1MSF C;  4YEL A;  2OBP A;  4ESJ A;  4YFK F;  2IBD A;  3EUH C;  4X0G A;  3L2R A;  2DOF A;  2RC4 A;  1X1B A;  3FXJ A;  1DUX C;  3IAS 2;  2HNH A;  2DLL A;  3JAM Z;  2FE3 A;  1VF9 A;  4IQ4 A;  1XS9 A;  3GYH X;  2A6E F;  2OZU A;  2IXS A;  3ERM A;  2ME0 A;  4QWQ A;  4OIO F;  4CUG A;  2PMH A;  1BI2 A;  4A69 C;  1GT0 C;  5F0F A;  2WAQ A;  2W84 A;  3G71 I;  3E3V A;  2Z33 A;  1VQ8 I;  3RKX A;  4NHJ A;  4NB5 A;  3KZZ A;  3BG3 A;  4ZYD A;  3CCQ I;  2AHQ A;  3K1P A;  2RDP A;  5EZH A;  1MBK A;  1IZ1 A;  3WE2 A;  2E34 A;  3DEW A;  1G3W A;  2VB6 A;  3S2W A;  4ENN A;  2HOS A;  1OJL A;  1HDP A;  5KAF C;  2RV8 A;  1WJA A;  2K3P A;  4XKB A;  3LQQ A;  3AG2 H;  2ZC2 A;  2H94 A;  4MQ9 F;  2K9N A;  1E3H A;  1JTY A;  4EJW A;  3DTE A;  3H92 A;  2XKO A;  2DFI A;  2V4J C;  1T98 A;  3QAH A;  4L0Y B;  3LSG A;  3KET A;  2AXL A;  2KIM A;  3E6M A;  2R3S A;  1ZRE A;  2DOA A;  3SDB A;  5J6X A;  3HTU A;  2JQ7 A;  1MMA A;  1LPQ A;  4LD5 A;  2XV4 S;  1TBX A;  2V79 A;  1O3Q A;  5DCM A;  5CQG A;  3S15 J;  2CS3 A;  1MBF A;  3K2Z A;  3RTR A;  4OMY A;  3PSI A;  4CSW A;  1D1B A;  5LHH A;  4FX0 A;  3IRR A;  3V7R A;  4AVZ A;  5K1Y A;  1I6H J;  3L2U A;  1GDT A;  3ASO H;  2K9M A;  3CTA A;  1JE8 A;  1QBJ A;  4Y15 A;  3GW2 A;  4A0X A;  2K9Q A;  4RAF A;  2ESN A;  4FT8 A;  5M5Y J;  2VXD A;  4O6J A;  5K7H A;  3HOX J;  2I10 A;  5BPI A;  2LNB A;  3EYI A;  3WE3 A;  4Y52 J;  5FRM A;  4XLE A;  4DYR A;  3HUG B;  2L01 A;  3HSF A;  2FF4 A;  3I4P A;  5K7Z A;  2IS1 A;  2M9H A;  1WCM J;  3HPH A;  3BR3 A;  1QZE A;  1G3S A;  3IAM 2;  2NS8 A;  5E18 F;  1FIA A;  2EFN A;  3JRA A;  2ACJ A;  3C2B A;  3GWZ A;  2CGP A;  4N0B A;  2K27 A;  1UCR A;  2HDW A;  3OS1 A;  4E7H A;  2MLK A;  2KJB A;  2F48 A;  1PUF B;  1YI2 I;  4U88 A;  1LVA A;  2OF7 A;  1R5H A;  2HQN A;  5J1Y A;  2PJR A;  4I0A A;  5EEH A;  2R4G A;  3VSL A;  3ECH A;  3QOD A;  4A3D J;  3TGN A;  3FXR A;  3A01 A;  2OPT A;  2DT6 A;  1V4R A;  1T6S A;  1BI1 A;  2IA2 A;  5L3B A;  1J5Y A;  4N4O B;  2HZD A;  1U2W A;  2WY7 Q;  5GTH C;  3N97 A;  3KCC A;  4BE0 A;  4KA4 A;  2ZXW H;  4EMS A;  1SEU A;  2Y48 A;  3M1C A;  2CFO A;  5JLX A;  3JRE A;  3OYF A;  2EFW A;  1C0W A;  1U5T C;  1YS6 A;  3TO9 A;  3F8C A;  1SAX A;  3A4C A;  1IXS B;  2HOA A;  4XKW A;  3PQK A;  3OSG A;  4LK1 F;  2KIF A;  1MJA A;  2EV6 A;  4PSW A;  3L2V A;  2DMN A;  1G8X A;  3UNG C;  2O03 A;  1RES A;  3TO7 A;  4MFE A;  2KHM A;  2ZJR F;  1X58 A;  4ENJ A;  3BTC A;  4XOT A;  3Q0W A;  5EGO B;  3KYC B;  1QRY A;  2KRH A;  3L2C A;  1H89 C;  2ZXI A;  3FHZ A;  1DGR M;  2Z1D A;  5EJC A;  1DDN A;  1OCZ H;  1ZKG A;  4ZYE A;  4A3I J;  1X4P A;  2Z5U A;  1ZR4 A;  1JKP C;  4D5F A;  4KNY A;  3WTX C;  4XLN F;  2QSF X;  5DCF A;  4ZYA A;  1VQL I;  4B4C A;  3K70 D;  3W2W A;  4DZJ A;  2OJE D;  1TTY A;  3H35 A;  3TP3 A;  3B02 A;  3GEZ A;  5ILU A;  1DP3 A;  2XPV A;  1MBJ A;  3L09 A;  1XB4 A;  3GUD A;  1TZL A;  3CO7 C;  1IV6 A;  3DWL E;  1QHG A;  2W85 A;  3ZP5 A;  4RA2 A;  1YE9 A;  1N75 A;  1Y56 A;  1YX3 A;  1TNT A;  2XC7 A;  2P4W A;  5HLH A;  5CJ9 A;  2EZK A;  3D5L A;  1D0Y A;  1RC9 A;  2DMT A;  3KEO A;  1ZR2 A;  3ZQQ A;  3Q0U A;  3JTH A;  2D1H A;  1MJ9 A;  4IOC F;  2L7Z A;  1QVT A;  2JSP A;  1G6N A;  2HXI A;  2YX4 A;  2R5Z B;  1O57 A;  4AYB A;  2FEZ A;  3KP6 A;  3OYN A;  1REP C;  5HNF A;  4Y4R A;  1YJ9 I;  1K4S A;  3H36 A;  2LG4 A;  2AO9 A;  3BPV A;  4LMY A;  1UG2 A;  4UHT A;  5DS9 A;  1Y1W J;  4U0Y A;  4G7O F;  4KJZ A;  2L9S A;  4PFO A;  3IP4 B;  5AON A;  3OSF A;  2MC4 A;  2DXI A;  1OYI A;  2CQN A;  1YS7 A;  2KDO A;  3BZK A;  3VYU B;  3FKI J;  3JW4 A;  2VXZ A;  2YUS A;  3C3W A;  4P9F A;  2OA4 A;  1AA7 A;  2OCE A;  1WPK A;  1R4M B;  2Y69 H;  1J7K A;  2V1N A;  1F43 A;  2L54 A;  3WTS C;  1ZQ3 P;  4ZZL A;  3BR1 A;  3KP5 A;  4LIV A;  2COB A;  4Y13 A;  3G6E I;  1TLH B;  1RR7 A;  2EBI A;  4C3H J;  1AHD P;  4GGG A;  4U0W A;  3K9T A;  4DBR A;  2XGE A;  1IN5 A;  2FUG 2;  3QPT A;  2FMY A;  5BPD A;  2P6T A;  3V8J A;  1BOB A;  1IXC A;  5DCM B;  1YJW I;  1ETX A;  2M7A A;  4M6X A;  3TL4 X;  5E3M A;  3LSK A;  3PQJ A;  3G73 A;  3CC2 I;  1LEB A;  1DPU A;  3WTY C;  1FEX A;  3BY6 A;  3FBI B;  3I0T A;  3F72 A;  2ZO4 A;  3QOP A;  3CP2 A;  4AVP A;  4LG3 A;  1O7L A;  2CW7 A;  3CUQ A;  1U78 A;  3R0A A;  1W7P A;  3BT9 A;  5GAH J;  1Z21 A;  2O3F A;  3BR0 A;  4HEA 2;  3DPT A;  2QF7 A;  2VQH A;  2OTL I;  4KUM A;  3F3X A;  3E97 A;  4YIF A;  3Q0V A;  2I5U A;  2JWT A;  3EYY A;  2QA4 I;  2UXN A;  3ISP A;  1X2N A;  9ANT A;  2ISY A;  2HZT A;  4DIQ A;  2MYS A;  3GZN B;  2L02 A;  3HHH A;  3NEU A;  4M72 A;  3WG9 A;  3SYT A;  3BG7 A;  4X6A J;  5EZG A;  5TGT A;  5HS8 A;  3TED A;  1NG7 A;  2QCO A;  3EET A;  3H5N A;  1WJB A;  2YR2 A;  2FBH A;  4MEX F;  3V42 A;  3HG9 A;  4WXH A;  5E3L A;  1U6G A;  4CXF A;  4A6E A;  2XAH A;  1EKE A;  5GAD J;  4XLC A;  2V6E A;  4KN4 X;  1J75 A;  1G59 A;  2HGC A;  3OS0 A;  3F9K A;  4HST A;  3RCO A;  5LD2 C;  1ZH5 A;  2GWR A;  4EEF G;  2WWY A;  5CPR B;  1K78 B;  1KQ9 A;  4YIR X;  2R7Q A;  5D8L B;  3P9I A;  3N05 A;  3BR6 A;  4PFP A;  3CC7 I;  4A5M A;  5AIQ A;  3GTM J;  4A0Z A;  1A5J A;  2QUF A;  3CZ6 A;  3PSF A;  3M3Y J;  2HI3 A;  3H5R A;  5A2Q K;  5CVI A;  1FBS A;  2A6H F;  2OTJ I;  5ICC A;  1ZAO A;  4CCN A;  1B59 A;  3TW7 A;  1P7J A;  1ORK A;  3LSP A;  5HLT A;  5D5U B;  3E6D A;  3OYG A;  4A2U A;  1RZ4 A;  1SD5 A;  2IS6 A;  1STZ A;  3RPU D;  1HKS A;  1IRF A;  2B7E A;  2DT7 B;  5LFA A;  5IOZ A;  3FZV A;  3M8J A;  4XRF A;  2R7D A;  1XDS A;  2IP2 A;  3VDX A;  3CO6 C;  2TDX A;  3BDD A;  3HL2 A;  2F4O B;  4JX4 A;  5HS7 A;  2MFZ A;  3RKQ A;  1HST A;  4RAZ A;  4UUV A;  2F6C A;  2M8G X;  1WJE A;  4PDK A;  4AYB N;  1ZRC A;  3I64 A;  3OYK A;  1QQI A;  2M1B A;  3ZQH A;  1KQ8 A;  1R00 A;  3OYD A;  4V2G A;  5HDK A;  5D4S A;  2LRD A;  3HIF A;  3HOW J;  2M5W A;  3BQZ A;  1IG7 A;  2NS0 A;  4AIK A;  4XQF A;  2XAU A;  2RGV A;  2Z3Y A;  3F8F A;  3ZGK A;  1NHA A;  4A5N A;  2FJ1 A;  2VKE A;  5DDG A;  4UUS A;  2ZJQ F;  3R4K A;  4XBF A;  1IRG A;  2WAF A;  2VT3 A;  1QO0 D;  2FD5 A;  2B63 J;  2BXZ A;  4PJL A; 
#chains in the Genus database with same CATH homology
 3OYB A;  3UR3 C;  4JOM A;  3DU6 A;  2Q2E B;  3HXL A;  2R7R A;  4ITV A;  4OWR B;  3FKJ A;  2L5Q A;  4N4N B;  4PJM A;  3K4J A;  1UAA A;  2RQQ A;  3U21 A;  3OS2 A;  4AU7 A;  3KEY A;  4CH7 A;  3EUK L;  3QYF A;  4CCM A;  3MMY B;  4XN3 A;  3HOS A;  2KPM A;  2HPM A;  3PNY A;  4HSR A;  1D1C A;  4BXF A;  2ELJ A;  2Y0S A;  3PNV A;  4XOR A;  1UG0 A;  3TMO A;  2I8D A;  4C9Y A;  4NUB A;  2M7B A;  3ZRG A;  3H9Q A;  3ZCO A;  2W82 A;  2BW3 B;  3OYL A;  4C30 A;  4HRI A;  3OL4 A;  3OYI A;  2CUZ A;  1D1A A;  2Z2S B;  1MNE A;  2CH0 A;  4CCK A;  2A6T A;  2W00 A;  4XN0 A;  1MND A;  3SEQ A;  4CA0 A;  4E7Z A;  3OOU A;  3HPG A;  2VKD A;  4II3 A;  1IRX A;  3KX2 A;  3S32 A;  3DQV C;  2PJR B;  4B47 A;  4KT6 A;  2RRE A;  3MKY B;  2XSJ C;  2LBF A;  3OYH A;  1OLT A;  2AQF A;  3H9J A;  4ZTF A;  3VYT B;  2LY2 A;  4YEL A;  3DKY A;  3EUH C;  4X0G A;  3I9V 2;  3L2R A;  4BE2 A;  2HU9 A;  1X1B A;  2VPL A;  3IAS 2;  2HNH A;  2UWM A;  5FRN A;  4KIS A;  4IQ4 A;  4XKV A;  1W36 D;  1Z3Y A;  2OC6 A;  2IXS A;  4ZJZ A;  4CUG A;  3PUB A;  4HNT A;  1LKX A;  3RQ4 A;  2E5N A;  1V5E A;  4BL0 B;  3OL3 A;  2WAQ A;  2W7N A;  1X1C A;  3DTI A;  2UUZ A;  1K6Y A;  3D5R C;  1Y6I A;  4CCO A;  2KRC A;  4RM2 A;  4BQN A;  2VB6 A;  1J09 A;  2CUJ A;  1WJA A;  4XM3 A;  2K3P A;  4PUS A;  4DGW B;  2WB1 A;  4XKB A;  2KZV A;  2IGN A;  3OWT A;  1N77 A;  1SAU A;  3LL7 A;  3DTE A;  3S3M A;  2ZXH A;  4E6K G;  4MLO A;  1FMW A;  2V4J C;  4B44 A;  1OR7 C;  4HG2 A;  3LSG A;  3L2W A;  3DKX A;  2DOA A;  3SDB A;  5HNH A;  3K4L A;  4IX7 A;  1MMA A;  3HKZ A;  3K4B A;  4R79 A;  3LMM A;  3PJR A;  2XF7 A;  4E4H A;  2JVH A;  5CQG A;  2CS3 A;  3MKZ A;  3RTR A;  2R7S A;  3GBG A;  4ZDP A;  3PSI A;  4CSW A;  1D1B A;  3CJR B;  3QYE A;  1UEL B;  3BCA A;  4KIT B;  3OY9 A;  4LIU A;  3S3O A;  3K6G A;  4AVZ A;  4OAY A;  3E0J B;  4RMN A;  1TT0 A;  4RM3 A;  4BJ5 C;  1YX5 A;  3L2U A;  4RLQ A;  3BCB A;  3AKZ A;  2KLO A;  2K9M A;  3W3C A;  1WFX A;  1MMG A;  1LFP A;  1X1D A;  2WY8 Q;  2DJI A;  2VXD A;  4B48 A;  4NC8 A;  1BR1 A;  4ZDO A;  5FRM A;  4XLE A;  3HUG B;  3BG6 A;  4Y3O A;  4DOZ A;  2IS1 A;  4J00 A;  2ZSI B;  1MMD A;  3HPH A;  3HC7 A;  4QPQ A;  3IAM 2;  4D9J A;  2LH9 A;  3OYA A;  4BU2 A;  1BR2 A;  3TBI A;  3MKW B;  1GLN A;  1T0F C;  1ZEL A;  4H4K C;  2HDW A;  2VAS A;  3OS1 A;  4E7H A;  3LSM A;  2V9K A;  3ZXS A;  4BEH B;  3A2K A;  2CV2 A;  3PL8 A;  2PJR A;  4XLH A;  3FBN B;  4ANJ A;  2R4G A;  3VSL A;  4DBQ A;  3QOD A;  4P1W A;  2F5V A;  2JUG A;  2DT6 A;  3CES A;  2OUM A;  3AL0 B;  1N78 A;  1PJR A;  4N4O B;  2HZD A;  2WY7 Q;  2M4G A;  4BE0 A;  2VJJ A;  2XF5 A;  2E60 A;  3M1C A;  2CFO A;  3NWS A;  2CV0 A;  3HOT A;  1D0X A;  5CKT A;  3OYF A;  3DTK A;  3NWT A;  3E1S A;  2LRE A;  2WBM A;  3A4C A;  4XKW A;  4PSW A;  2W1O A;  3L2V A;  1X4O A;  1G8X A;  3UNG C;  2K5C A;  1W36 C;  2Q1Z B;  2GOX B;  2KHM A;  3CJQ B;  2IGO A;  2VL8 A;  4GRI A;  4NNJ A;  4IQJ A;  1JI8 A;  1BR4 A;  4ZTJ A;  2KP6 A;  1ERD A;  4BS9 A;  4XOT A;  2X1D A;  2X85 A;  2JVG A;  2KRH A;  2RNG A;  2ZXI A;  2O5R A;  1DGR M;  2Z1D A;  1X4P A;  4FET A;  3CMM A;  1D0Z A;  4RLF A;  3PFY A;  4ZYA A;  3OYJ A;  1QHH D;  3K70 D;  3W2W A;  2Z16 A;  2KQR A;  1DGW Y;  2AQE A;  3RSN A;  3H35 A;  4BQQ A;  2R7X A;  5KHD A;  1DP3 A;  3KYL A;  4F3Q A;  1S9H A;  2ZFU A;  3A1Y A;  2V26 A;  4C2U A;  3OMY A;  3AL0 C;  4E7L A;  4CCL A;  4G6T B;  3SEZ A;  1TZL A;  3ONQ A;  3DWL E;  1QHG A;  1V5G A;  1YE9 A;  1N75 A;  1Y56 A;  1YX3 A;  2JA2 A;  4LIT A;  2XC7 A;  1EA3 A;  3S8P A;  1LDK B;  2DCE A;  3D5L A;  1D0Y A;  3OR1 C;  4XLA A;  2A5W A;  3QYB A;  3ZQQ A;  4XNF A;  2V7F A;  3CP8 A;  2L9N A;  1V5F A;  5HOO A;  4XOP A;  2JSP A;  2QKL B;  3QOE A;  3H0D A;  2XDV A;  4AYB A;  4FAS D;  3K4M A;  3OYN A;  5HNF A;  4Y4R A;  2LG4 A;  2R7W A;  4E7J A;  4F92 B;  4KJZ A;  2L9S A;  4PFO A;  1WJF A;  2XF6 A;  3IP4 B;  2QKM B;  3MD2 A;  2MC4 A;  2BVM A;  2DXI A;  1Z7L A;  2X1E A;  2KDO A;  3VYU B;  3LSI A;  4E7K A;  2R7T A;  4BJ6 C;  1FMV A;  2VXZ A;  4F55 A;  5KNL A;  4JQF A;  1AA7 A;  2VLA A;  4YRV A;  4PK4 A;  2V1N A;  2X1C A;  2L7K A;  2HVS A;  1E0E A;  2W4S A;  3PNT A;  4LIV A;  4PSX A;  4XKC A;  1U0J A;  2BW3 A;  2X6W A;  1KON A;  2HPI A;  2VJ5 A;  3LFU A;  4BEH A;  2M0M A;  5JHF A;  4IKF A;  4DBR A;  2BOL A;  3VSK A;  4XON A;  2FUG 2;  2E5Z A;  5HVQ C;  2WAE A;  2OV7 A;  1BOB A;  2M7A A;  4PJN A;  3TL4 X;  3SZG A;  4U7B A;  4CCJ A;  3K4C A;  3LSK A;  1SFK A;  4XR6 A;  4CZC A;  3D5S C;  3FBI B;  2VJI A;  3BLY A;  4NQW B;  1NG6 A;  3CP2 A;  4LG3 A;  2CW7 A;  3K10 A;  2VIX A;  1X19 A;  1Z21 A;  2M3A A;  4HEA 2;  3DPT A;  2VQH A;  4D1Q A;  1PYV A;  4IZZ A;  4E7S A;  3CF2 A;  4BGD A;  2E1M B;  2R7U A;  2VQC A;  1DQU A;  1P9Q C;  3C2G A;  4B43 A;  3EUA A;  4DIQ A;  2MYS A;  2WAD A;  4DJA A;  4E7I A;  3G2B A;  3SYT A;  2VJ4 A;  1X1A A;  3BG7 A;  2F4I A;  1WJ5 A;  3VYS B;  2ZSH B;  2HVR A;  5TGT A;  2WA0 A;  3VYR B;  1NG7 A;  3K4N A;  4F93 B;  4ZDL A;  5FRO A;  4BUP A;  4F91 B;  3FDY A;  3H5N A;  1WJB A;  3DU5 A;  4C2T A;  3V42 A;  3OR2 C;  3HG9 A;  5CQE A;  3K70 C;  3DPL C;  4XLC A;  2V6E A;  1G59 A;  3OS0 A;  3F9K A;  2MAB A;  4QPO A;  4HST A;  3I3L A;  3RCO A;  5LD2 C;  2IGM A;  1LVK A;  2LOO A;  3ZR8 X;  2IGK A;  2R7V A;  3IUO A;  3OIP A;  2KMU A;  5CPR B;  4XLF A;  2R7Q A;  2VQL A;  1HA8 A;  3FHN A;  3VWB A;  3N05 A;  4PFP A;  3DLA A;  4XL9 A;  1T95 A;  4F52 A;  2HVQ A;  4BE1 A;  2VKH A;  1QU3 A;  2LY1 A;  3EPZ A;  4XMY A;  3DPU A;  2IS4 A;  2E1M C;  3CZ6 A;  3PSF A;  2LC2 A;  3K4K A;  3H5R A;  2LBF B;  2CW8 A;  3C2H A;  2M4K A;  3AFH A;  4CCN A;  3J7A Y;  2LYC A;  2CMP A;  4NC7 A;  4BDY A;  3W2V A;  5HLT A;  4YEJ A;  3OYG A;  3OYC A;  2X51 A;  4J01 A;  2X6X A;  2IS6 A;  3RPU D;  4ZC3 A;  2DT7 B;  5LFA A;  2L2O A;  3M8J A;  3VDX A;  3BC8 A;  3HL2 A;  1R6R A;  1Z3X A;  4BJT A;  4P5O A;  2MFZ A;  4B3X A;  2NOJ B;  3OYE A;  2R7O A;  3S3N A;  2MD0 A;  3L2Q A;  2KL4 A;  2GOM A;  4Y33 A;  2F6C A;  3DEE A;  4PJJ A;  1WJE A;  2UV1 A;  4BAC A;  4HNU A;  2BVL A;  3OYK A;  2VQG A;  1VZ0 A;  1MW7 A;  4II2 A;  4BQO A;  3W2A A;  3OYD A;  4BDZ A;  2LRD A;  1WJC A;  1MMN A;  2CV1 A;  4EAT A;  2P0W A;  4XQF A;  2XAU A;  5KCM A;  3ZGK A;  4OAZ A;  2IS2 A;  3OYM A;  3H5A A;  3OIQ A;  2HQA A;  4HPQ A;  2K9L A;  2X6Y A;  3S93 A;  2WAF A;  1WJD A;  4U87 A;  2PMZ A;  3LSH A;  4PJL A;  3H9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...