2LOOA

Backbone structure of human membrane protein tmem14a from noe data
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 14A
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2looA02
2LOOA
chains in the Genus database with same CATH superfamily
2DMPA 3DV8A 2K3FA 2GLOA 4BQOA 3K4KA 4AYBA 4R1HA 2G7HA 4MTEA 2MLGA 4FX4A 4KYWA 2DMQA 2VOPA 4A0ZA 4ESBA 2ELKA 2DA6A 1JKRC 3HSRA 3H0DA 1POGA 1RPWA 5JFRA 4F7ZA 2JT1A 4NDLA 1ZG3A 3ASOH 1Y8RB 4PFOA 2EA2A 2Y75A 2YU9J 3JCUC 3ZXSA 3GZ5A 3IHUA 1S7EA 3IC7A 1VQKI 1PP7U 3IAS2 2TDXA 3I4PA 1YX3A 3E6BA 2NVUB 2CUFA 2CFXA 2E1MB 2WY8Q 2GAUA 4E7JA 2R7TA 2A6HF 2EV5A 2TRTA 4WXDA 4BQNA 2FJ1A 3CZ6A 4CCNA 3WG9A 2VXZA 2CUEA 1BI0A 2QQ9A 2X85A 2X48A 2CMPA 3E3VA 5FO5A 3JRGA 1RKTA 1KU9A 2MSYA 2EIKH 4NQWA 4HW0A 2QUFA 2XRLA 3ZQQA 4CCMA 2MGQA 3M7GA 1X2NA 1FIPA 3JSPA 1T98A 3ZR8X 4I7HA 5TISC 1BC8C 4IHVA 3D0SA 2DQRA 4CUGA 1KA8A 2XVCA 2BZTA 3Q0VA 4BYYA 3CLOA 1G8XA 4RLQA 1S3JA 2XRNA 3ZQGA 2JRTA 2ZCWA 3V7RA 1E2XA 3BQZA 3OV8A 3ZQLA 1CF7B 3C2HA 3JRAA 4M3EA 4UB6C 5FJ8J 3K9TA 4I02A 4ZTFA 3H0GJ 2CGPA 1NG6A 2K40A 5CJ9A 3JRIA 3HEFA 2OPTA 3MMYB 1MDMB 1JKQC 4LGWA 4XN0A 3FBNB 3WTUC 1BR1A 1R5GA 3COAC 2EWNA 3E6DA 3MN2A 3C18A 1K6YA 3BJOA 3AL0C 4XLHA 1YRNB 1HKTA 2IGOA 1K83J 2STWA 5J8FA 5D5VB 1KQ9A 4ZDPA 4CCLA 2VXDA 2M87A 3GVAA 4Z2YA 1R5HA 3CCSI 4KIFA 2V1DA 5E3OA 3H1CA 3HBLA 3K4MA 3G4SI 3S3OA 1I6HJ 1BW5A 3JAMZ 2Z5UA 1ZGAA 2FQ3A 1LFPA 3AG1H 5EJCA 4A3MJ 2WBMA 1ON1A 2WAEA 1MBJA 4LG0B 4FQGA 3GLLA 3VOEA 1Z7UA 2XF6A 5A2QK 4BE2A 5GTIC 2LKXA 2XB0X 3GTGJ 4UUTA 2HWVA 2ID3A 1V4RA 2MH2A 4O3MA 3L7WA 4ZH4F 1DPRA 4BJ5C 1KQ8A 1K61A 1E17A 1I1SA 1B9NA 4HDVA 2WV0A 3OYAA 2LF7A 3OS1A 5LD2C 2P7CB 4CO8A 1XS9A 1OR7C 4HEA2 1RKWA 4HF0A 2TCTA 4AD9A 2WA0A 3E5QA 3GFIA 1XSDA 1PUFA 3FM5A 3VFZA 4LK0F 2ZKZA 3UNGC 1ZN2A 3HG9A 3I59B 2MD5A 5HLGA 2RNGA 1UHWA 2EB7A 1BA5A 2XAJA 4IHTA 4IJAA 1ZR4A 1FZPB 1LDDA 1MJ9A 1V5FA 3RDIA 1U5TB 3BTIA 3OSFA 2D5VA 3TMOA 3S1QJ 5L3EA 3A02A 2PMZA 2F4IA 3FDYA 2E36A 1DPUA 1IDYA 2I8DA 4E7IA 5E8IA 3M07A 3N4MA 3W2WA 2K9QA 1BOBA 1IW7F 3EUAA 2NNNA 5KHDA 4MLOA 5K7ZA 1Z91A 1QVUA 3CJRB 4AUXA 3CMYA 1SVLA 2I5UA 5FGMA 2AQFA 3E0JB 2ETHA 3AFHA 2GM4A 4FE7A 4M72A 3QP6A 4KIGA 4EV0A 4B1RA 2NVTJ 3DP7A 4XOTA 4M3FA 4NNJA 4G7HF 3GYHX 1JTXA 3FKJA 1DP7P 3SEZA 4IOAF 2OCEA 3BT9A 5CQGA 5F27A 4NUBA 1IV6A 9ANTA 4RAGA 3E6MA 3ZMVA 4BQQA 4C3JJ 1NK2P 3BR2A 3ZQCA 1IRFA 3KX2A 5EG0B 1USTA 3IH2A 3K2AA 5C3EJ 4FCYA 2CO5A 3RKQA 2JA6J 3CP2A 4ITVA 1FTTA 2IA2A 3HOVJ 4G6TB 1XD7A 2DU9A 3IAM2 4A3JJ 1Y0UA 1VQNI 1XC5A 2L4MA 2CQ7A 1PUEE 2JWTA 2CW0F 2MFZA 1B9MA 2EZLA 2WAQA 4NC8A 4L9NA 4UVBA 4U88A 3HL2A 1SC7A 3M1CA 1FYMA 3DWLE 2JMWA 1MBKA 3OYDA 5CYVA 1TQIA 1YE9A 3LQRA 4U0VA 4ENNA 2YX7A 1BJAA 2HEOA 1CF7A 1OPCA 4A69C 2KIQA 1JI8A 3PFIA 3F3XA 2VPRA 2ZNZA 4OOIA 3RYRA 4U7DA 4ETSA 2M5WA 3TBIA 3TDZC 1MDMA 1XPXA 1D3YA 4RBOA 2HDDA 1ZARA 2IGNA 3OSGA 4HDUA 4M6XA 2WY7Q 1WZ2A 2M3AA 1YRNA 3EYYA 3ABUA 2QQAA 1MMNA 2L7ZA 2GXAA 4V2FA 2FA5A 1B6AA 2D1HA 4D7MA 1VQOI 3FXJA 4IXAA 1T33A 1TQPA 3DEEA 1E3OC 2FMYA 2IVMA 3H9QA 2K86A 2PBIA 3CMAI 1IG7A 3CC4I 2OZ6A 1RESA 1IDZA 3L9FA 1YYVA 3CJNA 5E8GA 4LG0A 4OU0A 4N4OB 2FEZA 2HTSA 1I5ZA 1SANA 4N9HA 2XROA 2DAOA 5IOZA 2DDAA 4KN4X 4S05A 3BPVA 5JVGF 1IC8A 1KGSA 3ZMUA 3OYEA 1TWGJ 1BR4A 3RQIA 4IQ4A 1HDDC 2PMHA 3G1OA 2ESNA 2Y31A 3PQKA 3EYIA 3I4NJ 4AIJA 4M3GA 2CV1A 3SZGA 3J7YJ 2YS9A 2KZGA 3I59A 1T0FA 3BR5A 2PMUA 3H3UA 4ENMA 1IZ1A 1YW7A 3KCCA 5IP6A 3L2WA 2QKMB 2HVRA 1Z77A 1BC7C 4L9VA 5K5OA 4XRSG 3PSIA 3HHGA 5F0HA 4HLYA 2XAFA 1Y0NA 1U5TA 4JP0A 3U1KA 1YOVB 4ZYGA 3BTCA 5E1XA 3FF5A 5K7HA 4KFCA 3BG3A 4QIWN 1S9HA 2M0MA 5GP9A 5J40A 3X2QH 2HDCA 3FIWA 3T1BA 2QSFX 4EEFG 3JSOA 2QA4I 1A6IA 4PGGA 1IJWC 2JTVA 4JX5A 3HTSB 4XRSA 2HGCA 2DFHA 5K7FA 4ZZLA 2P5LC 3CMMA 3L2QA 1YIOA 2CUZA 1J9IA 2JA7J 4IHXA 1VQ6I 1WKMA 4L5JA 1Z6RA 3S8PA 1HCRA 2XASA 1G6NA 1X1PA 2VKDA 4BHBA 3HOUJ 1VQLI 4M6YA 2K9MA 2R7FA 1Z1DA 5D6FA 4E4HA 1ZG5A 3S14J 3G3ZA 3AAFA 5LEKA 2NS0A 5IYDJ 4LMYA 3HB9A 4UVCA 1B8IB 2DMNA 4HX8A 4IZZA 3PNYA 2L02A 1SD7A 1TT0A 3ECOA 3B02A 3FXKA 4JBAA 5EG0A 4H0EA 4HAMA 3BOQA 2IBDA 1X1AA 2V9KA 1GXQA 2ISYA 2KFDA 2O5RA 1FYLA 3KP3A 3OR2C 4HLXA 1W5SA 3CLQA 3W3CA 2XDVA 3DBHB 2LY2A 2LY9A 1XMXA 4A3DJ 3ONQA 5FKKA 4CA0A 2XC7A 3GTMJ 5FRMA 1FMVA 2FE3A 5B66C 1H0MA 1X3WB 3P9KA 2NYXA 1YJ9I 2ZXHA 3MZHA 1XX5A 4DQ2A 1I3AA 1JE8A 3PO3J 3OYJA 3CCVI 2HOAA 2WAQN 3GFJA 3W2AA 4XKWA 1UELB 2DYRH 1MNMC 4P5OA 1V55H 2HYFA 1WVRA 1F1ZA 3BWGA 1TLHB 2JA8J 1UAAA 5GPAA 3GTOJ 3S17J 2OU2A 4X1EA 1J5YA 2MW8A 1HW1A 4DYRA 3S1RJ 2P8TA 5DUIA 2QYOA 2ZB9A 1P4WA 5JR3A 1ZELA 1JKPC 5IOYA 2KRFA 1IO2A 1F5TA 2WAFA 3P9IA 2ZMEB 4PGHA 1SFEA 1X3ZB 2V6CA 4M6VA 2E1NA 1IRZA 4XLNF 4IVNA 5JVTA 2XSDC 2GOXB 1ZRDA 1L3LA 1TT5B 3PJRA 3K0LA 2E35A 4PFPA 2DTZA 1T6SA 4XRFA 2XF5A 3EQLF 1P7JA 2VLAA 4Q5SF 1W5TA 5J1UA 5HOOA 2Q2EB 4A93J 2EIMH 3M9AA 3VSLA 3SEQA 2VT3A 4I6ZA 3S2WA 3ERED 1UG0A 2KIUA 4DBRA 1G4DA 2LG4A 3IRRA 3ELKA 1LDJA 4IKFA 4YFNF 3HRTA 3SZPA 2R3SA 1U2WA 1MW7A 4K2EA 3WTVC 4BDYA 4BJ6C 4D7NA 4IPAA 2Z16A 2E2JJ 1WH5A 2CV2A 1I3QJ 2DOFA 4BHPA 2E1CA 2VBZA 3CCLI 2X6OA 1D1AA 1FX7A 1BR2A 2NOGA 4PJMA 1R22A 1IXSB 3FMRA 4NBQA 4P96A 2CH0A 2YX4A 2G0EA 2MYSA 3NARA 2P6TA 3TOBA 4A6DA 2JRMA 3HOXJ 3ISPA 1UHSA 2UXNA 4I0BA 5DM6F 4JYKA 2ZXIA 3V7CA 1RR8C 1YW9A 2IA0A 4CDGA 4NC6A 3NQOA 4E70A 3HC7A 5M5YJ 4UUSB 3BG7A 3N05A 3I71A 3QRFF 1VQ9I 2DCEA 2DMTA 4CYDA 2IS6A 1QVTA 4EJWA 2HOSA 4EJOA 2HOEA 2LBFB 2LSOA 4IRIA 1G3SA 3A4CA 3F8FA 4I99C 1XN7A 4ASNA 3OS0A 1QZYA 1WRJA 2Y9YA 3BCBA 5H20A 3HOWJ 5LGUA 4XSXF 3L1PA 3MCZA 2NVXJ 5M3FJ 4EM2A 3SQNA 2L9RA 5C4XJ 4FISA 4XSZF 3KP6A 1BI3A 2CWEA 2K4BA 2FRHA 3CCJI 3TP0A 1JT0A 1PVEA 2LR8A 1G3YA 3R6SA 1B8IA 2L7MP 4RGRA 1R5ID 1ETXA 1YJWI 1APLC 3I9V2 3LA7A 4BU2A 2RC4A 1YHQI 4TV7A 1LFUP 1OCOH 1BW6A 1R6RA 2AO9A 3BDDA 3I64A 3RPQA 3ZQ7A 1LEAA 1RR7A 3MZ8A 4WF2A 5GTHC 2XSJC 1OLTA 3TDUC 1IN4A 1O3RA 3QYFA 4XK4A 3CMEI 2BHYA 1U0JA 4RAYA 1OJLA 1X19A 3JRDA 4C2TA 2DOAA 3E7LA 4BJTA 4AIDA 4BXUA 1GUUA 2G9WA 3KIOA 3GZNB 1YS7A 5DD4A 2E7XA 1RUNA 3C2GA 1YG2A 1S29A 5BPDA 3KE2A 5A2QZ 4RDUA 1WJCA 2JPBA 1GVJA 2ZJ2A 1FOWA 4OWRB 4MFDA 2V6EA 3PSFA 2D45A 3BC8A 2M8GX 2VUMJ 5LGTA 2HDWA 3TOAA 1WFXA 5EZGA 3GTJJ 4J00A 4HX7A 4XM3A 2M30A 4A12A 2V7FA 2XGCA 4G7ZF 2VPLA 2MC4A 2ZMEA 1MMDA 1YS6A 1VTNC 1WJBA 2CQXA 2ELJA 4FETA 4KICA 2P6SA 4ZC3A 2M8EA 3RSNA 1SMYF 3IH4A 4BXFA 5L3BA 3PIOF 2FOWA 2K5CA 2ZFWA 4GYIA 1WJAA 2K9NA 3HPGA 4PJLA 2BHZA 1XGNA 2DK8A 4LB6B 2PJPA 1TL8A 2ZJQF 2N8GA 1R71A 5EYRA 2E2HJ 4M3DA 2DA4A 2Q2EA 4GXOA 4UV9A 3DBRB 4XLFA 5F1JA 2LK2A 3UR3C 3S1MJ 2IS2A 2ELHA 1IUFA 1O3TA 1CQTA 2ECBA 3LNQA 3KFWX 2O8XA 1X1DA 1X2MA 5L3DA 4M71A 4RM2A 5KCMA 2COBA 3OMYA 3V8JA 3V7SA 3WHBA 3WTYC 3GZ6A 5GAGJ 3KEYA 4HX4A 3RKYA 4U87A 4EJUA 3HOTA 4JX6A 2H6CA 4DIQA 3DU5A 1YW8A 2JA5J 3I5UA 1JHFA 4EVIA 1UB9A 3FK6A 1ZHFA 4XBFA 1IUYA 1D0ZA 1VQ4I 1TTYA 3WGHA 4IF4A 2XGDA 2NAZA 2V26A 2NNYA 2VQLA 3KZYA 4DYCA 2IS4A 2HKXA 3J7AO 3F23A 4A3FJ 2QQ8A 3OOUA 4RS8A 4C30A 2X6XA 5DUKA 4UUSA 1YLFA 2DK5A 3D5SC 4KN7X 3MKLA 4HBLA 5D8KB 3LSGA 2EK5A 2F5DA 4KITB 4XICA 1HXDA 3ML6A 4XRMA 1FBSA 2IA1A 2LBFA 5FLVA 2EILH 2PFBA 3HXLA 4F92B 2LVSA 4E7HA 2R7VA 4XLCA 1FBQA 3DCFA 5CVUA 3K6GA 2ZSHB 3EPZA 2FOKA 1RUOA 2R7UA 1HF0A 2V1UA 4M73A 1V5EA 3GTQJ 2L4AA 4EJTA 5FKLA 1P92A 2H8RA 2LY1A 1E3PA 2W57A 3HOYJ 3FWEA 2A07F 3L00A 1LJ9A 1P7IA 1T95A 4HV6A 5EF6A 1K79A 5F0FA 3DPTA 3NWSA 4L5IA 1NK3P 2R7WA 2DA1A 2V9VA 2UV1A 2DFIA 2WC2A 1Z7LA 4DBQA 1ENHA 2FXAA 5HLTA 4OMZA 4D9JA 3CUQC 2XGXA 4YEJA 2IS1A 3PM1A 5CVIA 4BY7J 2X6YA 2M45A 4GO1A 1MKMA 4DOZA 3CDLA 2F5VA 5D5XB 1BOAA 5IP9J 4BBRJ 3E1SA 4OINF 1O3QA 4U0YA 4LB5A 3BJAA 4RGXA 2LREA 3LWFA 1KU3A 1E0EA 4BQAA 1N78A 1FBUA 1JUSA 3OL4A 1FIAA 4QTRA 1HKQA 3HTUA 4PDKA 5D8LB 1J59A 2D2WA 3GLXA 1ETYA 3DKYA 2O7OA 3HKZN 1R1VA 3BY6A 2L3DA 4V2GA 3PNTA 4M3BA 1OMIA 3HRUA 1SAUA 1R7JA 2AXLA 3Q5FA 1STZA 2EIJH 1BL0A 1UCRA 2RV8A 1EH8A 4I0AA 2A69F 4PUSA 3DQVC 5ILVA 1TW2A 2P4WA 2J5OA 2NVQJ 5HDKA 2WB1A 3VYRB 5FFXA 4CH7A 5KVRA 4CCKA 2LH9A 4YIIA 1RRJA 1NHAA 3QPHA 4AVPA 2KL4A 4FHTA 2XKOA 4FX0A 4I98B 4DZJA 5D5UB 3RKXA 2MLKA 3SZTA 1D1CA 2BYVE 2KMUA 1B59A 1MGTA 1O57A 1QPMA 3OYHA 1P9QC 1QQIA 3L2CA 1BI1A 2DT5A 2R5ZB 3AG4H 3K4BA 2IGMA 5EEGA 4B3AA 1WCMJ 5E1ZB 2JQ7A 1TQMA 2O03A 3M8JA 4Q48A 4AYBN 2L54A 2R7SA 1ZREA 3MKYB 4XOPA 4UV8A 4DJAA 3BQYA 1C0WA 2CJJA 1WSUA 2O3FA 3WU2C 2IJLA 2VODA 1WPKA 3O8GA 1ETWA 1I1GA 4MO7A 4Q47A 1KYWA 1TNTA 1I50J 3JRBA 1RIOH 3ECHA 2A5WA 4A0YA 4HYEA 4Y4RA 1HBXG 4BE1A 2DA5A 4Y17A 3F72A 3HM5A 1VQPI 3H36A 1K7AA 2H1KA 3WTZA 1TC3C 1WHUA 3U1DA 3LA3A 4ABZA 4BGDA 1FOXA 5EZHA 2Q1ZB 2F4OB 1EF4A 3TGNA 3V8KA 2QF7A 3FXRA 3O8HA 5M3MJ 2GZWA 3ZN0A 2ZO4A 1A36A 3S3NA 1H89C 2VBXA 5ICCA 1T56A 5E20A 2JJ7A 3PFYA 1IXCA 3S16J 3VEPA 1W7PD 2EFQA 4H4KC 5GAEJ 1A04A 1SVMA 5KAIC 6PAXA 1FTZA 1RNLA 5FKNA 3KZIC 2HI3A 3IWFA 2PG4A 3KP4A 2O6GE 2PQ8A 5AIPA 1QA6A 1IV8A 3OR1C 2GA1A 4ZDOA 3TP3A 3S15J 2EPFA 4WX9A 5ICGA 3DTKA 4Y33A 3SYTA 4YG2F 4WXHA 2KDOA 2PI0A 1U9OA 2ADUA 2QQBA 4RAZA 1MD0A 4ZDLA 1K4SA 3BZ6A 4CZZA 1I39A 2VBWA 2LRDA 4HA8A 3FX3A 2FF4A 4C9YA 5FROA 3BLYA 5H6RA 4GGGA 4EM1A 4NHJA 4D5FA 5HNFA 2HS5A 1GV5A 3V4GA 3CTAA 4OIQF 3CDIA 3KYCB 1FWZA 3F9KA 1LQ1A 2Y48A 2CYYA 3G1MA 3U2RA 3ESWB 3KP5A 1YFHA 3DEWA 1GV2A 3GCMA 4CZCA 3K7AJ 3H5AA 4RLFA 2XGEA 4DW6A 1A5JA 4AC0A 1Y56A 1XMKA 3EUHC 1ERDA 3FHZA 3T0YA 2LLKA 2O61A 5IT9K 1ON2A 5E3MA 5J47A 2EFWA 3OIQA 3MEXA 2KPMA 1IF1A 4GDFA 4S04A 2A6TA 4BY1J 3C7JA 3H35A 3OYLA 2BY0A 4RA2A 2QSHX 3GTLJ 1SVOA 2JPCA 3HOZJ 3NWTA 4CXFA 1HW2A 1QO0D 2QCOA 2ECCA 1O7FA 3BG5A 4LLLA 1B72B 2E71A 3I3LA 4B09A 2DN0A 4QLCU 3LA2A 1R00A 3KYDB 4HOBA 3J81K 1H9TA 2GIZA 3GW2A 4IHSA 2VBYA 1Y1WJ 3LSPA 2QGUA 1X4OA 3VWBA 5CKTA 3SDGA 1XB4A 2ZJPF 2VI6A 2M34A 1IRGA 4IL6C 4KIBA 4P55A 3MVPA 5ED4A 2R5ZA 2E2IJ 1BBYA 4BDZA 1TZLA 2Z33A 1ETOA 4ESFA 4MIMA 4IHWA 3CD6I 1ZG1A 1E3HA 2PMZN 3TO6A 2BXZA 2QZ8A 5IYBJ 2V1NA 3WGIA 3WTWC 2E19A 2D1VA 1S7OA 2GA2A 3TEDA 1V5GA 1D5VA 4HF1A 5GPCA 2RQPA 5L3FA 4CGZA 1R1UA 2Q0OA 3OS2A 3G73A 1ZGJA 2OJED 2R7RA 4RB0A 5TJJA 2DXIA 4IO9F 1USSA 4BHCA 5J4VA 2GIVA 5HLHA 1AU7A 2VE8A 1U6GA 4UHTA 3QPLA 3OIOA 1T8IA 1UMQA 3I55I 1YTYA 2F5EA 4NB5A 3GO5A 3O3KA 4GFBA 1FT9A 3M1EA 5FKOA 4ZZDA 5LBQA 2VN2A 1FEXA 1KYZA 3HJEA 2Y69H 1G3WA 1VZ0A 1ETVA 1JTYA 3I58A 5KAFC 4D1QA 1WQ2A 4XN3A 1W0TA 3EETA 1KZHA 5K5QA 4V19K 3JRCA 2KISA 2RKHA 1BN5A 3HSFA 3OIPA 2DLLA 2EFOA 3GX4X 1FC3A 3JW4A 3ZMTA 2XKPA 3IV5A 1X1CA 2B7EA 3CF2A 3CCRI 1XCBA 3MQ0A 1MBFA 4IEJA 3NEUA 3NAUA 2BBYA 3B6AA 4DYQA 3LL7A 1TP4A 3BR0A 2FUG2 2R4GA 2F2EA 3LSMA 2DDBA 3OYFA 5E3NA 5D4RA 4PSWA 5ILSA 3OYMA 4G12A 4B3XA 2UUZA 4Z6YA 4AVZA 2UWMA 3DTEA 1MBGA 1WJDA 3J80K 2LFBA 2CQKA 3A1YA 3BPXA 4MFEA 1ACIA 1AA7A 2H1LA 4CCJA 3H3VK 1WGXA 2L7FP 2OC6A 5FD5A 4EQQA 4ANJA 4MHGA 3HOSA 4A3EJ 1DGWY 2KIMA 2EQRA 4RB3C 1XGOA 3QWLA 2ZC2A 4GYGA 3A03A 3WHCA 4ZYEA 5ICEA 1F4KA 3S3MA 4ZJZA 4QPQA 1QZZA 1RC9A 3LQQA 4UB8C 3K4CA 2VJ5A 4I01A 4HQEA 2BY3A 2L5QA 4F91B 2OQRA 1WH7A 2W48A 5M5WJ 2W4SA 3H5RA 4XR6A 5HS7A 2Y0SA 1YIJI 3RZOJ 3K2ZA 5BPIA 3J7AY 3Q9VA 2B9SA 5CVVA 2H09A 1GLNA 4E7KA 3H92A 1MBHA 4I09A 5LHHA 3IP4B 2DPDA 3BZKA 1F36A 2A3SA 4KT5C 2OA4A 4Y3OA 5DTDA 3HPHA 2H8WA 4XLAA 3GEZA 2IPQX 2F6CA 1SFOJ 2QSGX 2M7BA 2DBBA 4HRIA 3ZQFA 5BMZA 1ZR2A 2RAEA 2V79A 1X4PA 1TWCJ 5HS8A 4BS9A 3BCAA 4P9UA 2E1OA 4D0PA 2JA2A 2B0LA 2OAZA 2DA7A 1FP2A 4AU7A 5IPAA 4LITA 1B1BA 2LOOA 2WV1A 1B72A 4A3LJ 2EV6A 4KA4A 4YIRX 4YFKF 2MH9A 2RREA 4B4CA 2P5VA 2VJ4A 1FP1D 2I10A 1SFUA 5D5WB 2RNJA 4FASD 3WTSC 2ZXWH 4IRHA 1RETA 2HFHA 3BJ6A 1SMTA 3NRVA 2XUBA 3H3ZA 2MABA 2VKHA 3L2VA 2AS5F 1R36A 3CQZJ 3QPSA 4CSWA 2UZKA 1GVDA 2LF8A 3QYEA 3EDPA 1MNEA 3QAHA 3S93A 3SFZA 3T8TA 1MMAA 2K85A 4A6EA 2BVLA 4J01A 2BGCA 1QNTA 4R79A 3K4LA 3PUBA 4MQ9F 3D5LA 2VB6A 4AIHA 2EA4A 1LVKA 1DP3A 5IYCJ 3DKXA 2EBIA 2NXNB 2HQAA 2R92J 5EEAA 4A3CJ 1YI2I 1QZEA 1DQUA 4BXXJ 1V54H 1G59A 3MFKA 5FLXK 1R58A 3BR1A 3H9JA 1SAXA 2BVMA 2NS8A 1IAWA 1DGRM 1U8RA 4BL0B 2XAHA 1S8NA 1ZKGA 2FD5A 3RIRA 1ONVA 3FXQA 4QWQA 2DODA 2PEXA 5KK1A 2JSPA 4HG2A 1HA8A 3P5JA 2VJJA 3K1NA 2Z1DA 4X0GA 1W36C 1H9GA 3CP8A 4WK8F 1G2HA 1JJ8C 4G7OF 4IRGA 4KUMA 2CV0A 2K4JA 3Q3SA 2OD5A 3K70C 4RGSA 1RZ4A 3A0BC 2XPUA 4Y7NJ 2CSOA 2DPUA 4LLNA 2W1OA 4BNCA 3BZCA 4X6AJ 3TW6A 2Y0MA 3RPUD 1LDKB 2Q8KA 4Y52J 1MBEA 1Z3YA 4L5EA 2Z9OA 1XMAA 1Z67A 1BM9A 2RN7A 4HPQA 2HTJA 2KJBA 5CQEA 5F08A 1VF9A 4CYCB 2WTEA 2YU3A 3V42A 1D0YA 2E1MC 1X3UA 3FISA 3KLNA 3J7ZI 5E18F 4CCOA 2KJCA 3HDDA 2A68F 1YX5A 3SJMA 2CQNA 3QOPA 5J1RA 4WXCA 3PQJA 2YR2A 1XSVA 2QM3A 3WODF 2X1EA 3OYNA 1KU7A 3PUFA 2BY2A 1UFMA 2OTJI 3G71I 3FXLA 5CVJA 1R9TJ 4BH9A 3ZCOA 3ZOBA 1D8JA 1D8KA 3VDXA 2QEXI 1HOMA 4QSHA 5IP7J 4XONA 5B1BH 5GAHJ 1ODDA 4ESJA 1Z9CA 4RGUA 4PJ0C 2W85A 3CO7C 1VQ5I 4EMSA 1O4XA 5E1WA 3FMQA 1DU0A 2E7WA 2X1DA 2QLZA 4GCVA 1HW5A 3ABKH 4LIUA 1U78A 1DDNA 2PJRB 1BIBA 4MNUA 3VYTB 5IT3A 1N25A 3GFLA 1Z6TA 5ICFA 5HNHA 1XGMA 2KHMA 2E5ZA 2FNAA 4BEHB 1VNDA 4XLEA 4LIVA 5CLSA 2VKEA 4AWXB 4II3A 2IEKA 3BR3A 5FKMA 4CHUA 4EGYA 2P81A 2MD0A 4FT8A 5CPRB 1EA3A 3K1MA 4C2MJ 4J19A 3QOEA 2Z99A 1YQAA 3R0AA 3LSHA 3LSRA 3AKZA 4RB2C 5AIQA 3F21A 3W6VA 2ZXJA 1OQYA 3F6VA 1LUJB 2DA2A 1HDPA 3LSJA 2MA3A 5J6XA 4A3IJ 1JJ6C 2FU4A 1AHDP 4KNYA 3DLLF 3OWTA 4Q4ZF 4KMFA 3LOCA 2VQHA 3ABTA 1W5CC 3MKWB 2R7DA 1XCVA 4HNVA 1M1EB 4XMYA 2DI3A 5HS9A 4B47A 1G3TA 2FNPA 2YSRA 1D5YA 2R93J 3M4OJ 3AG2H 1HSTA 1FPQA 1FJLA 4LLGF 3FXMA 4JX4A 1MMSA 1V3FA 2MG4A 4R8HA 3B73A 3M8FA 1YJNI 3VYUB 1GHCA 3PO2J 4IX7A 2EFPA 1A35A 3Q0UA 2EINH 4M9SA 2F5CA 4KJZA 4RAFA 3VB2A 2DA3A 2KDZA 2O9LA 2E34A 4DZPA 1R49A 2ISZA 4RB1A 1QBJA 3HUGB 2KZVA 1XSXA 5EEHA 3ZRGA 1S7AA 3HRMA 3RZDJ 1T0FC 4B48A 1UZCA 4M74A 1NH3A 2X6WA 2L0KA 3FKIJ 2BXYA 3C1DA 4G9YA 3OYIA 1MSEC 1EV7A 3CESA 2DT6A 5LHGA 2EJRA 4CICA 3SFIA 1UJ8A 2Y2ZA 1W7PB 3CJQB 1N75A 2OCCH 5FLMJ 3CC7I 4PK4A 2GOMA 4KDPA 4OIPF 1U5TC 4B44A 3QYBA 1ETKA 3F6OA 3ZPLA 3ULQB 3I56I 4JQFA 4C3IJ 2DYSH 4L0YB 4OMYA 1ZYRF 2ZBKA 5HVQC 2VOOA 5J1YA 3A01B 2VC1A 1JGSA 3VODA 3BG9A 3HZJA 3CCMI 3HGGA 4L18B 2CG4A 1IN8A 3TW7A 1Y39A 1Y6IA 3DF8A 5JHUA 1OCPA 4B8XA 5F1RA 1SD6A 2KRCA 1OISA 5IT9Z 1O7LA 1MZBA 2W84A 2XAUA 3M8EA 3CCEI 2B63J 5F6FA 1JUMA 2VQGA 2BW3B 4PSXA 3SDBA 1P4XA 5CVRA 3JRFA 4CYCA 1MH4A 5JLWA 5EGOB 5C44J 2Z2SB 4LJZF 2OV7A 3KP2A 1QRYA 2A61A 4L9TA 3ZP5A 2HQNA 2M9HA 4D5CA 1FYKA 3P9CA 3VSKA 2RVCA 5LLQA 2L9SA 1FMWA 2L7KA 5J8CA 2XB5A 3I54A 1HLVA 4YELA 2HOTA 2FX0A 1WJEA 4E7SA 1LFBA 5H6QA 3ZMDA 4LG3A 3A2KA 5FD6A 3J81Z 2DMUA 1WJ5A 2QENA 3GMEA 2HXIA 5HLIA 4F93B 2EZKA 1HC8A 2VJIA 1W36D 1T38A 2E5NA 1QPIA 5DCMB 5BNGA 2L9NA 3MZYA 5E17F 1U9NA 2QKLB 1ZQ3P 3HGYA 3FZVA 2PX9A 3K70D 3C3WA 2JSCA 1Q1HA 1DU6A 2DT7B 3ZMZA 4MQVA 3ZQHA 5FFZA 3N97A 1KQ0A 1VFCA 3CJTB 2FBKA 3TL4X 2K9SA 2PJRA 1J0RA 2ME0A 3K69A 4A3KJ 1ZK8A 1F43A 4O5VA 3I53A 3AL0B 1KU2A 2XHKA 1DUXC 2EZIA 1N77A 5DS9A 2AQEA 4BEHA 3KLOA 1ULYA 1MNDA 2ACJA 5LRSA 4A0XA 2L2OA 2HYGD 2A6EF 3MKZA 2AXTC 3CCYA 1J2XA 4Y13A 2HVSA 1MJAA 4F55A 1WJFA 4PCQA 3CUQB 4AIKA 2ESHA 2R0QC 5DDGA 1LNWA 4HSTA 3E97A 5BQTA 5JI6A 2FBHA 1Z0XA 2BOLA 2M2EA 3HIFA 3BROA 3TO7A 1S5LC 4OAYA 1FSEA 3V8LA 1ZLKA 2KLOA 5DEQA 3D1NI 2YUSA 4QPOA 1W1WE 1EH6A 3KYLA 1XGSA 1UG2A 5BS6A 2CUJA 2L01A 2MC3A 5J3LA 2Y9ZA 2Y30A 4HF2A 1L0OC 2RDPA 2ME6A 2R7XA 5H2FC 1IRXA 4UY8I 2QVOA 2X4HA 3FXOA 2VT2A 2WADA 4G8XA 4MTDA 1YITI 5LRRA 2LMDA 4S0HB 1UHMA 2CRGA 2K9LA 2G7UA 5JHFA 3S32A 3LAPA 3CF5F 2XAGA 1PDNC 3ERMA 2OBPA 2KQRA 4XQFA 1PP8F 2HNHA 1ORKA 2OQGA 2V9PA 3PIPF 1Z3XA 2K7LA 2KT0A 2DJIA 4EATA 3A0HC 5M5XJ 1TWAJ 3EUKL 3MAJA 1FY7A 3HUGA 3CO6C 1VI0A 3J80Z 2OF7A 1AOYA 4IQJA 5ILUA 2LNBA 3K4JA 3E6CC 3REOA 4BBSJ 1MSFC 4A5NA 3F22A 1XG1A 4E7ZA 5K5RA 3QU3A 1HKSA 3Q9SA 1K4TA 5EDNA 2BE5F 2VKVA 3P7NA 1W7PA 5E79C 3TO9A 1K78B 1QGPA 3F0CA 3KZZA 2NS7A 4MEXF 3FXUA 3CCQI 2KIFA 2LTPA 2H27A 3S1NJ 1IXRC 1BIAA 1KONA 1MH3A 2DFFA 2XPVA 4ZYDA 2GXBA 5IY5H 5JLXA 3A01A 2M7AA 3C2BA 3G6EI 3R4KA 2ZNYA 2JK3A 3LSTA 4W1UA 3K10A 4OAZA 3IL2A 3FK7A 3GTKJ 5DD8A 3IUOA 3OL3A 5C4JJ 1OFCX 2XPWA 2FMLA 4HSRA 5F04A 3HRSA 2K02A 3DXJF 5TGTA 2LD5A 1O3SA 2PN6A 1Z21A 2M1BA 3K1PA 1I27A 2BW3A 2LYCA 1ZTRA 3BTLA 4RMNA 4XKCA 2CW8A 3WG7H 4UUVA 5EGOA 2KKOA 1SFXA 4I76A 2W25A 5D4SA 2X0LA 4C3HJ 3JAMK 1H8AC 2R7ZJ 3O6BB 3S2DJ 3ZN1A 1OCTC 1OKRA 2AHQA 2VC0A 4HQMA 4JK1X 4AM3A 2DTRA 1VQ8I 2DFEA 2V1XA 1S6LA 1B4AA 2W24A 2W82A 5GADJ 4ZTJA 2BEOA 3DKWA 3O2PE 3OOPA 1XTAA 2BY1A 2LC2A 4LD5A 2ZJRF 4HV5A 2QBYB 2WB1N 3E5UA 5B1AH 4XKVA 1OYIA 5DCMA 1JUPA 1HSJA 1R23A 2MBFA 4XORA 3ZMSA 2JN6A 1SFKA 2VIXA 3OYKA 2VONA 1NTCA 2LP0A 1U8BA 3PL8A 1OCCH 1IN6A 2EH3A 3IH3A 1HQCA 3K4NA 4JOMA 3SXYA 4BAYA 1J7KA 1D1BA 2A05A 1I6XA 4BUPA 1LVAA 1GXPA 4M9ZA 2VQCA 1R4MB 4I2OA 1TBXA 2DJNA 1LB2A 1CGPA 1R1TA 2M4KA 2DO7A 2F5FA 3Q0WA 3KEOA 2FSWA 4EM0B 4MEYF 5E3LA 3OYBA 3I4MJ 3OYGA 3OY9A 4FTHA 1XDUA 3CUQA 4FE4A 4XLPF 4U7BA 1OCZH 2GWRA 2ZMEC 3GFMA 3H5NA 3HHHA 3R61A 4A3GJ 2W7NA 2HPIA 1MJBA 3F8MA 1JGGA 1LPQA 3FHNA 3DU6A 3QQAA 4BKXA 4N0BA 1ITYA 2R7QA 4OIRF 5FLXZ 1NG7A 5DM7F 1W0UA 5FRNA 3E5XA 5F0CA 2LKSA 1LE8B 2NOJB 1LKXA 2R5YB 2LDUA 4ENJA 3S2HJ 3R0JA 4LOCA 2JUCA 5LHIA 4YRVA 5L3GA 1OR7A 1K6OA 3QU6A 4U0WA 1AWCA 3GBGA 1IN5A 1VQ7I 2STTA 3G2BA 5D6EA 3KETA 3WE3A 2XAQA 4GRIA 1D0XA 2HQRA 1Y1VJ 2K3PA 4MGRA 1FNNA 2HR3A 2EV0A 3AG3H 2O8KA 3UKGA 4OIOF 3WE2A 3TKYA 3L09A 2GXGA 4BACA 4II2A 3VPRA 1IGNA 3GXOA 3L2RA 4C2UA 4P9FA 1FLIA 4UXNA 1SD4A 4A2UA 2XIGA 3FBIB 3RQ4A 3F8NA 2X1CA 4NC7A 4G6QA 4HNTA 4PJNA 1K78A 2VASA 4UVAA 1BI2A 3H9GA 3QP5A 2WWYA 2FBIA 4E6KG 1IN7A 4G94A 1RI7A 4ENKA 2NRAC 1LEBA 2H94A 5B5EC 2VE9A 4E7LA 2P7VB 3RTRA 4P1WA 4LFUA 4IHYA 3RKWA 3ROUA 1X1BA 5F64A 3LMMA 3ASNH 3F8CA 3FM3A 1AKHB 3KP7A 2HKOA 2HVQA 4ON0A 2W00A 2A5YB 2J5PA 1TW3A 4O6JA 3DLAA 4WWCA 2EZHA 3GWZA 2X51A 2COMA 2M0CA 3ABLH 2X9DA 3LSKA 5BOXA 4M9XA 2OTLI 3I0TA 1T08B 1TWHJ 1REPC 4RM3A 2P0WA 3IKTA 2V4JC 1J09A 2O0YA 1W4MA 3G1LA 4N9IA 2HXOA 2R7OA 2HZDA 4BE0A 1Y8QB 2EFNA 3W2VA 5L3CA 5AONA 1S72I 2XF7A 2L9VA 3U9GA 5DV5A 4XKBA 2IT0A 1JXSA 5K1YA 2HPMA 3LSIA 2ICWG 1ZRCA 1QU3A 1FOKA 1TWFJ 4XL9A 2HZTA 3L2UA 5LEJA 5B3SH 1EH7A 2QBYA 2VL8A 1QHGA 5HDGA 5LGNA 4UNOA 2HYJA 3IRQA 2FQ4A 2RGVA 4A5MA 1A31A 3U21A 5KNLA 1ZRFA 1T39A 3FMSA 3RJPA 1MIJA 4WCGA 1JT6A 5TRDA 3B6CA 2UXXA 2GBYA 3ABMH 1VQMI 2IRFG 3DPUA 1P6RA 4W97A 3F8BA 2JVGA 4EJVA 3WTXC 2RQQA 2HU9A 2IXSA 4YIFA 2XV4S 2GQQA 4Y15A 3QODA 1MMGA 3KPHA 4XIDA 4YFXF 1U3EM 1T2KA 4L0ZB 3HSEA 2KRHA 1ZAOA 4ZYHA 5HODA 4NQWB 1XDSA 5J4YA 3DPLC 1WWXA 4PZJA 3RCOA 3WU0A 1X58A 4N4NB 2JUGA 3SHFA 3DTIA 1Z05A 2PLYA 4IOCF 4HNUA 2K27A 1SD5A 3CCUI 3QPTA 4F52A 1ETQA 2CFOA 1Q1VA 3EUHA 2OZUA 3MD2A 1TNSA 5LFAA 2NVYJ 2OUMA 3BG6A 1LE8A 2R5YA 2CS3A 5FB2A 1EJ9A 3JTGA 5DYMA 2JVHA 4KT6A 1BJZA 1ZH5A 3IWZA 1SEUA 2P5KA 1OYWA 2IGKA 3D5RC 3W6JB 3VYSB 1ZGWA 3JTHA 5ERIA 1GT0C 3CC2I 2DQLA 2YPRA 4DGWB 3BR6A 3PNVA 3LAJA 2CW7A 3CUOA 1EKEA 2ZFUA 2BV6A 3W6KB 3JR9A 2HQ5A 3BTJA 3M3YJ 1JKOC 3GTPJ 2Z3YA 2DOEA 3TQNA 4DNCA 3WU1B 1PJRA 1WI9A 3ZQIA 1ZLJA 4ZYAA 4L9JA 4A3BJ 3R60A 2ID6A 2F4MB 3DEUA 3MWMA 1FSHA 1F9NA 2M4GA 2LKPA 4KISA 2KP6A 2E60A 1YO5C 1JHHA 2IP2A 4XNFA 1J75A 1GDTA 3HKZA 2ZSIB 3LFKA 2H6BA 1OYYA 1PYVA 3KEQA 3RPUA 3JRHA 4HZFA 1AKHA 5HDNA 3WGGA 3GF2A 3DFGA 1FOYA 1WI3A 3JREA 4LK1F 2DW4A 3GUDA 1P2FA 4G6DA 3BP8A 1R4NB 4KMUX 3WTTC 1H88C 2QWWA 2CQQA 2Y0SN 1PUFB 3ZGKA 3LFUA 2C6YA 3HYIA 2IW5A 4B43A 5DCFA 1QHHD 2JZYA 1A6QA 3T5XA 3RYPA 4EGZA 4F3QA 2CU7A 3IKVA 3T8RA 4PJJA 3OYCA 3CDHA 3RI4A 2F48A 2IAIA 1P4AA 1OCRH 3DBLB
chains in the Genus database with same CATH topology
4BDYA 4BJ6C 3TL4X 2PJRA 2Z16A 4BQOA 3K4KA 4AYBA 2CV2A 1X4OA 3VWBA 5CKTA 3AL0B 1N77A 1D1AA 2AQEA 1BR2A 4BEHA 1MNDA 4PJMA 2L2OA 2CH0A 4BDZA 1TZLA 3H0DA 2MYSA 3MKZA 2HVSA 4F55A 1WJFA 4PFOA 2ZXIA 2V1NA 4HSTA 3ZXSA 1V5GA 2BOLA 3HC7A 3BG7A 3N05A 3IAS2 4OAYA 1YX3A 3OS2A 2R7RA 2E1MB 2WY8Q 4E7JA 2DXIA 2R7TA 2DCEA 2IS6A 2KLOA 4BQNA 2LBFB 3CZ6A 3A4CA 3OS0A 4QPOA 4CCNA 3KYLA 2VXZA 2CUJA 3BCBA 2X85A 2CMPA 2R7XA 1IRXA 3ZQQA 4CCMA 1VZ0A 2WADA 4D1QA 2K9LA 5JHFA 4XN3A 3S32A 3ZR8X 2KQRA 4XQFA 3OIPA 2HNHA 4CUGA 3I9V2 4BU2A 1X1CA 3CF2A 1G8XA 1Z3XA 4EATA 2DJIA 4RLQA 1R6RA 3EUKL 3LL7A 3C2HA 2FUG2 2R4GA 4IQJA 3K4JA 4ZTFA 1NG6A 4E7ZA 3LSMA 2XSJC 1OLTA 3MMYB 3QYFA 3FBNB 4XN0A 3OYFA 1BR1A 4PSWA 3OYMA 1U0JA 4B3XA 4C2TA 1X19A 2UUZA 4AVZA 2DOAA 4BJTA 2UWMA 1K6YA 3DTEA 1WJDA 3AL0C 1KONA 4XLHA 2IGOA 3A1YA 1AA7A 3C2GA 4CCJA 2M7AA 4ZDPA 3HOSA 2OC6A 4CCLA 2VXDA 4ANJA 1DGWY 1WJCA 3K10A 4OWRB 2V6EA 3K4MA 3S3OA 4OAZA 3S3MA 3PSFA 4ZJZA 4QPQA 3BC8A 3IUOA 3OL3A 1LFPA 2HDWA 4HSRA 2WBMA 3K4CA 2VJ5A 5TGTA 1WFXA 2L5QA 2WAEA 4F91B 4J00A 1Z21A 2BW3A 2XF6A 4XM3A 2LYCA 4RMNA 4XKCA 2V7FA 2CW8A 2W4SA 3H5RA 2MC4A 4XR6A 2Y0SA 4BE2A 1MMDA 2VPLA 1WJBA 3J7AY 2ELJA 4FETA 4BJ5C 4ZC3A 1GLNA 3RSNA 4BXFA 4E7KA 2K5CA 3OYAA 1WJAA 3OS1A 5LD2C 3HPGA 4PJLA 3IP4B 1OR7C 2W82A 4Y3OA 4HEA2 2WA0A 3HPHA 4ZTJA 4XLAA 2F6CA 2LC2A 3UNGC 2M7BA 3HG9A 4XLFA 4HRIA 2RNGA 3UR3C 1X4PA 2IS2A 4BS9A 3BCAA 4XKVA 2JA2A 4XORA 4AU7A 1X1DA 1SFKA 1V5FA 2VIXA 3OYKA 4LITA 2LOOA 4RM2A 5KCMA 3OMYA 3PL8A 3TMOA 3KEYA 4JOMA 3K4NA 2PMZA 2RREA 2F4IA 1D1BA 4BUPA 3FDYA 4U87A 3HOTA 2VJ4A 4DIQA 3DU5A 4FASD 2I8DA 4E7IA 2VQCA 3W2WA 1BOBA 3EUAA 2MABA 4MLOA 5KHDA 2M4KA 2VKHA 3L2VA 3CJRB 4CSWA 3OYBA 1D0ZA 2AQFA 3E0JB 3OYGA 3AFHA 2V26A 3OY9A 2VQLA 3QYEA 2IS4A 1MNEA 3S93A 1MMAA 4U7BA 3H5NA 2BVLA 4XOTA 3OOUA 4NNJA 4C30A 2W7NA 2HPIA 2X6XA 4R79A 4J01A 3K4LA 3PUBA 3FHNA 3FKJA 3D5LA 3DU6A 3SEZA 3D5SC 2VB6A 2R7QA 5CQGA 3LSGA 1LVKA 1NG7A 4NUBA 4KITB 1DP3A 2LBFA 4BQQA 5FRNA 3DKXA 2HQAA 2NOJB 1LKXA 3HXLA 3KX2A 4F92B 1DQUA 4E7HA 2R7VA 4XLCA 1G59A 3K6GA 3CP2A 2ZSHB 3EPZA 4YRVA 4ITVA 3H9JA 2BVMA 4G6TB 3IAM2 1DGRM 2R7UA 3GBGA 1V5EA 3G2BA 2JSPA 2MFZA 2WAQA 4HG2A 1HA8A 2VJJA 4NC8A 4GRIA 1D0XA 3HL2A 2Z1DA 3M1CA 4X0GA 1W36C 2LY1A 2K3PA 3CP8A 3DWLE 3OYDA 2CV0A 4BACA 1T95A 1YE9A 4II2A 3K70C 3L2RA 4C2UA 1JI8A 3DPTA 3NWSA 2W1OA 3FBIB 3RQ4A 2X1CA 3TBIA 4NC7A 2R7WA 3RPUD 1LDKB 4HNTA 4PJNA 1Z3YA 2IGNA 2UV1A 1Z7LA 2VASA 4DBQA 4HPQA 5HLTA 2WY7Q 3H9GA 4D9JA 4YEJA 2IS1A 5CQEA 2M3AA 2X6YA 4E6KG 4DOZA 2F5VA 4E7LA 1MMNA 3RTRA 4P1WA 3V42A 3E1SA 1X1BA 1D0YA 2E1MC 3LMMA 2LREA 1E0EA 2HVQA 2W00A 4CCOA 3DEEA 3OL4A 1N78A 1YX5A 3DLAA 3H9QA 2X51A 3LSKA 3DKYA 3PNTA 4RM3A 4N4OB 2P0WA 2X1EA 1SAUA 3OYNA 1J09A 2V4JC 3ZCOA 3VDXA 2R7OA 2HZDA 4BE0A 4PUSA 3W2VA 3DQVC 4XONA 2WB1A 3VYRB 4CH7A 2XF7A 4CCKA 3OYEA 2LH9A 2X1DA 1BR4A 4XKBA 4IQ4A 2HPMA 2KL4A 3LSIA 4LIUA 2PJRB 1QU3A 3VYTB 2CV1A 4XL9A 3SZGA 5HNHA 1D1CA 2KHMA 3L2UA 2E5ZA 2KMUA 3OYHA 1P9QC 4BEHB 2VL8A 1QHGA 4XLEA 4LIVA 3K4BA 2IGMA 4II3A 3L2WA 2QKMB 2HVRA 3U21A 2MD0A 3M8JA 5KNLA 5CPRB 3PSIA 1EA3A 3QOEA 2R7SA 3MKYB 4XOPA 3LSHA 4DJAA 3AKZA 3DPUA 2JVGA 1S9HA 2M0MA 3OWTA 2RQQA 2HU9A 2IXSA 2VQHA 3MKWB 3QODA 1MMGA 2A5WA 4Y4RA 4XMYA 4BE1A 3CMMA 3L2QA 4B47A 2KRHA 2CUZA 4BGDA 4NQWB 3S8PA 3DPLC 2Q1ZB 3RCOA 4N4NB 2JUGA 3DTIA 2VKDA 3VYUB 4HNUA 2K9MA 4IX7A 4E4HA 4F52A 3S3NA 2CFOA 3MD2A 5LFAA 4IZZA 3PFYA 4KJZA 2OUMA 3PNYA 1TT0A 3BG6A 4H4KC 2CS3A 2JVHA 4KT6A 3HUGB 2KZVA 3ZRGA 1X1AA 2V9KA 1T0FC 4B48A 2O5RA 2X6WA 3OYIA 3OR2C 2IGKA 3D5RC 3CESA 2DT6A 3VYSB 3W3CA 2XDVA 4DGWB 2LY2A 3OR1C 4ZDOA 3CJQB 1N75A 3PNVA 3ONQA 2CW7A 4PK4A 2GOMA 4CA0A 2XC7A 5FRMA 1FMVA 3DTKA 4Y33A 2ZFUA 3QYBA 4B44A 3SYTA 2ZXHA 2KDOA 4JQFA 3OYJA 4ZDLA 5HVQC 1PJRA 3W2AA 2LRDA 4ZYAA 4XKWA 1UELB 4C9YA 5FROA 3BLYA 4P5OA 1Y6IA 5HNFA 1UAAA 2M4GA 2KRCA 4KISA 2KP6A 2E60A 2XAUA 1ZELA 2VQGA 3F9KA 2BW3B 2WAFA 4PSXA 3SDBA 4XNFA 3HKZA 2Z2SB 2ZSIB 1PYVA 2OV7A 4CZCA 4RLFA 3H5AA 1ERDA 1Y56A 3EUHC 2GOXB 3PJRA 4PFPA 3VSKA 3OIQA 2KPMA 2L9SA 1FMWA 2L7KA 2XF5A 2VLAA 2A6TA 4YELA 5HOOA 1WJEA 3ZGKA 3LFUA 4E7SA 4LG3A 3A2KA 3H35A 2Q2EB 3OYLA 4B43A 1WJ5A 4F93B 1QHHD 2VJIA 1W36D 3VSLA 2E5NA 3SEQA 4F3QA 2L9NA 3NWTA 1UG0A 2QKLB 4DBRA 4PJJA 2LG4A 3K70D 3OYCA 4IKFA 1MW7A 4BL0B 2DT7B 3I3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOO A; 
#chains in the Genus database with same CATH topology
 2DMP A;  3DV8 A;  2K3F A;  2GLO A;  4BQO A;  3K4K A;  4AYB A;  4R1H A;  2G7H A;  4MTE A;  2MLG A;  4FX4 A;  4KYW A;  2DMQ A;  2VOP A;  4A0Z A;  4ESB A;  2ELK A;  2DA6 A;  1JKR C;  3HSR A;  3H0D A;  1POG A;  1RPW A;  5JFR A;  4F7Z A;  2JT1 A;  4NDL A;  1ZG3 A;  3ASO H;  1Y8R B;  4PFO A;  2EA2 A;  2Y75 A;  2YU9 J;  3JCU C;  3ZXS A;  3GZ5 A;  3IHU A;  1S7E A;  3IC7 A;  1VQK I;  1PP7 U;  3IAS 2;  2TDX A;  3I4P A;  1YX3 A;  3E6B A;  2NVU B;  2CUF A;  2CFX A;  2E1M B;  2WY8 Q;  2GAU A;  4E7J A;  2R7T A;  2A6H F;  2EV5 A;  2TRT A;  4WXD A;  4BQN A;  2FJ1 A;  3CZ6 A;  4CCN A;  3WG9 A;  2VXZ A;  2CUE A;  1BI0 A;  2QQ9 A;  2X85 A;  2X48 A;  2CMP A;  3E3V A;  5FO5 A;  3JRG A;  1RKT A;  1KU9 A;  2MSY A;  2EIK H;  4NQW A;  4HW0 A;  2QUF A;  2XRL A;  3ZQQ A;  4CCM A;  2MGQ A;  3M7G A;  1X2N A;  1FIP A;  3JSP A;  1T98 A;  3ZR8 X;  4I7H A;  5TIS C;  1BC8 C;  4IHV A;  3D0S A;  2DQR A;  4CUG A;  1KA8 A;  2XVC A;  2BZT A;  3Q0V A;  4BYY A;  3CLO A;  1G8X A;  4RLQ A;  1S3J A;  2XRN A;  3ZQG A;  2JRT A;  2ZCW A;  3V7R A;  1E2X A;  3BQZ A;  3OV8 A;  3ZQL A;  1CF7 B;  3C2H A;  3JRA A;  4M3E A;  4UB6 C;  5FJ8 J;  3K9T A;  4I02 A;  4ZTF A;  3H0G J;  2CGP A;  1NG6 A;  2K40 A;  5CJ9 A;  3JRI A;  3HEF A;  2OPT A;  3MMY B;  1MDM B;  1JKQ C;  4LGW A;  4XN0 A;  3FBN B;  3WTU C;  1BR1 A;  1R5G A;  3COA C;  2EWN A;  3E6D A;  3MN2 A;  3C18 A;  1K6Y A;  3BJO A;  3AL0 C;  4XLH A;  1YRN B;  1HKT A;  2IGO A;  1K83 J;  2STW A;  5J8F A;  5D5V B;  1KQ9 A;  4ZDP A;  4CCL A;  2VXD A;  2M87 A;  3GVA A;  4Z2Y A;  1R5H A;  3CCS I;  4KIF A;  2V1D A;  5E3O A;  3H1C A;  3HBL A;  3K4M A;  3G4S I;  3S3O A;  1I6H J;  1BW5 A;  3JAM Z;  2Z5U A;  1ZGA A;  2FQ3 A;  1LFP A;  3AG1 H;  5EJC A;  4A3M J;  2WBM A;  1ON1 A;  2WAE A;  1MBJ A;  4LG0 B;  4FQG A;  3GLL A;  3VOE A;  1Z7U A;  2XF6 A;  5A2Q K;  4BE2 A;  5GTI C;  2LKX A;  2XB0 X;  3GTG J;  4UUT A;  2HWV A;  2ID3 A;  1V4R A;  2MH2 A;  4O3M A;  3L7W A;  4ZH4 F;  1DPR A;  4BJ5 C;  1KQ8 A;  1K61 A;  1E17 A;  1I1S A;  1B9N A;  4HDV A;  2WV0 A;  3OYA A;  2LF7 A;  3OS1 A;  5LD2 C;  2P7C B;  4CO8 A;  1XS9 A;  1OR7 C;  4HEA 2;  1RKW A;  4HF0 A;  2TCT A;  4AD9 A;  2WA0 A;  3E5Q A;  3GFI A;  1XSD A;  1PUF A;  3FM5 A;  3VFZ A;  4LK0 F;  2ZKZ A;  3UNG C;  1ZN2 A;  3HG9 A;  3I59 B;  2MD5 A;  5HLG A;  2RNG A;  1UHW A;  2EB7 A;  1BA5 A;  2XAJ A;  4IHT A;  4IJA A;  1ZR4 A;  1FZP B;  1LDD A;  1MJ9 A;  1V5F A;  3RDI A;  1U5T B;  3BTI A;  3OSF A;  2D5V A;  3TMO A;  3S1Q J;  5L3E A;  3A02 A;  2PMZ A;  2F4I A;  3FDY A;  2E36 A;  1DPU A;  1IDY A;  2I8D A;  4E7I A;  5E8I A;  3M07 A;  3N4M A;  3W2W A;  2K9Q A;  1BOB A;  1IW7 F;  3EUA A;  2NNN A;  5KHD A;  4MLO A;  5K7Z A;  1Z91 A;  1QVU A;  3CJR B;  4AUX A;  3CMY A;  1SVL A;  2I5U A;  5FGM A;  2AQF A;  3E0J B;  2ETH A;  3AFH A;  2GM4 A;  4FE7 A;  4M72 A;  3QP6 A;  4KIG A;  4EV0 A;  4B1R A;  2NVT J;  3DP7 A;  4XOT A;  4M3F A;  4NNJ A;  4G7H F;  3GYH X;  1JTX A;  3FKJ A;  1DP7 P;  3SEZ A;  4IOA F;  2OCE A;  3BT9 A;  5CQG A;  5F27 A;  4NUB A;  1IV6 A;  9ANT A;  4RAG A;  3E6M A;  3ZMV A;  4BQQ A;  4C3J J;  1NK2 P;  3BR2 A;  3ZQC A;  1IRF A;  3KX2 A;  5EG0 B;  1UST A;  3IH2 A;  3K2A A;  5C3E J;  4FCY A;  2CO5 A;  3RKQ A;  2JA6 J;  3CP2 A;  4ITV A;  1FTT A;  2IA2 A;  3HOV J;  4G6T B;  1XD7 A;  2DU9 A;  3IAM 2;  4A3J J;  1Y0U A;  1VQN I;  1XC5 A;  2L4M A;  2CQ7 A;  1PUE E;  2JWT A;  2CW0 F;  2MFZ A;  1B9M A;  2EZL A;  2WAQ A;  4NC8 A;  4L9N A;  4UVB A;  4U88 A;  3HL2 A;  1SC7 A;  3M1C A;  1FYM A;  3DWL E;  2JMW A;  1MBK A;  3OYD A;  5CYV A;  1TQI A;  1YE9 A;  3LQR A;  4U0V A;  4ENN A;  2YX7 A;  1BJA A;  2HEO A;  1CF7 A;  1OPC A;  4A69 C;  2KIQ A;  1JI8 A;  3PFI A;  3F3X A;  2VPR A;  2ZNZ A;  4OOI A;  3RYR A;  4U7D A;  4ETS A;  2M5W A;  3TBI A;  3TDZ C;  1MDM A;  1XPX A;  1D3Y A;  4RBO A;  2HDD A;  1ZAR A;  2IGN A;  3OSG A;  4HDU A;  4M6X A;  2WY7 Q;  1WZ2 A;  2M3A A;  1YRN A;  3EYY A;  3ABU A;  2QQA A;  1MMN A;  2L7Z A;  2GXA A;  4V2F A;  2FA5 A;  1B6A A;  2D1H A;  4D7M A;  1VQO I;  3FXJ A;  4IXA A;  1T33 A;  1TQP A;  3DEE A;  1E3O C;  2FMY A;  2IVM A;  3H9Q A;  2K86 A;  2PBI A;  3CMA I;  1IG7 A;  3CC4 I;  2OZ6 A;  1RES A;  1IDZ A;  3L9F A;  1YYV A;  3CJN A;  5E8G A;  4LG0 A;  4OU0 A;  4N4O B;  2FEZ A;  2HTS A;  1I5Z A;  1SAN A;  4N9H A;  2XRO A;  2DAO A;  5IOZ A;  2DDA A;  4KN4 X;  4S05 A;  3BPV A;  5JVG F;  1IC8 A;  1KGS A;  3ZMU A;  3OYE A;  1TWG J;  1BR4 A;  3RQI A;  4IQ4 A;  1HDD C;  2PMH A;  3G1O A;  2ESN A;  2Y31 A;  3PQK A;  3EYI A;  3I4N J;  4AIJ A;  4M3G A;  2CV1 A;  3SZG A;  3J7Y J;  2YS9 A;  2KZG A;  3I59 A;  1T0F A;  3BR5 A;  2PMU A;  3H3U A;  4ENM A;  1IZ1 A;  1YW7 A;  3KCC A;  5IP6 A;  3L2W A;  2QKM B;  2HVR A;  1Z77 A;  1BC7 C;  4L9V A;  5K5O A;  4XRS G;  3PSI A;  3HHG A;  5F0H A;  4HLY A;  2XAF A;  1Y0N A;  1U5T A;  4JP0 A;  3U1K A;  1YOV B;  4ZYG A;  3BTC A;  5E1X A;  3FF5 A;  5K7H A;  4KFC A;  3BG3 A;  4QIW N;  1S9H A;  2M0M A;  5GP9 A;  5J40 A;  3X2Q H;  2HDC A;  3FIW A;  3T1B A;  2QSF X;  4EEF G;  3JSO A;  2QA4 I;  1A6I A;  4PGG A;  1IJW C;  2JTV A;  4JX5 A;  3HTS B;  4XRS A;  2HGC A;  2DFH A;  5K7F A;  4ZZL A;  2P5L C;  3CMM A;  3L2Q A;  1YIO A;  2CUZ A;  1J9I A;  2JA7 J;  4IHX A;  1VQ6 I;  1WKM A;  4L5J A;  1Z6R A;  3S8P A;  1HCR A;  2XAS A;  1G6N A;  1X1P A;  2VKD A;  4BHB A;  3HOU J;  1VQL I;  4M6Y A;  2K9M A;  2R7F A;  1Z1D A;  5D6F A;  4E4H A;  1ZG5 A;  3S14 J;  3G3Z A;  3AAF A;  5LEK A;  2NS0 A;  5IYD J;  4LMY A;  3HB9 A;  4UVC A;  1B8I B;  2DMN A;  4HX8 A;  4IZZ A;  3PNY A;  2L02 A;  1SD7 A;  1TT0 A;  3ECO A;  3B02 A;  3FXK A;  4JBA A;  5EG0 A;  4H0E A;  4HAM A;  3BOQ A;  2IBD A;  1X1A A;  2V9K A;  1GXQ A;  2ISY A;  2KFD A;  2O5R A;  1FYL A;  3KP3 A;  3OR2 C;  4HLX A;  1W5S A;  3CLQ A;  3W3C A;  2XDV A;  3DBH B;  2LY2 A;  2LY9 A;  1XMX A;  4A3D J;  3ONQ A;  5FKK A;  4CA0 A;  2XC7 A;  3GTM J;  5FRM A;  1FMV A;  2FE3 A;  5B66 C;  1H0M A;  1X3W B;  3P9K A;  2NYX A;  1YJ9 I;  2ZXH A;  3MZH A;  1XX5 A;  4DQ2 A;  1I3A A;  1JE8 A;  3PO3 J;  3OYJ A;  3CCV I;  2HOA A;  2WAQ N;  3GFJ A;  3W2A A;  4XKW A;  1UEL B;  2DYR H;  1MNM C;  4P5O A;  1V55 H;  2HYF A;  1WVR A;  1F1Z A;  3BWG A;  1TLH B;  2JA8 J;  1UAA A;  5GPA A;  3GTO J;  3S17 J;  2OU2 A;  4X1E A;  1J5Y A;  2MW8 A;  1HW1 A;  4DYR A;  3S1R J;  2P8T A;  5DUI A;  2QYO A;  2ZB9 A;  1P4W A;  5JR3 A;  1ZEL A;  1JKP C;  5IOY A;  2KRF A;  1IO2 A;  1F5T A;  2WAF A;  3P9I A;  2ZME B;  4PGH A;  1SFE A;  1X3Z B;  2V6C A;  4M6V A;  2E1N A;  1IRZ A;  4XLN F;  4IVN A;  5JVT A;  2XSD C;  2GOX B;  1ZRD A;  1L3L A;  1TT5 B;  3PJR A;  3K0L A;  2E35 A;  4PFP A;  2DTZ A;  1T6S A;  4XRF A;  2XF5 A;  3EQL F;  1P7J A;  2VLA A;  4Q5S F;  1W5T A;  5J1U A;  5HOO A;  2Q2E B;  4A93 J;  2EIM H;  3M9A A;  3VSL A;  3SEQ A;  2VT3 A;  4I6Z A;  3S2W A;  3ERE D;  1UG0 A;  2KIU A;  4DBR A;  1G4D A;  2LG4 A;  3IRR A;  3ELK A;  1LDJ A;  4IKF A;  4YFN F;  3HRT A;  3SZP A;  2R3S A;  1U2W A;  1MW7 A;  4K2E A;  3WTV C;  4BDY A;  4BJ6 C;  4D7N A;  4IPA A;  2Z16 A;  2E2J J;  1WH5 A;  2CV2 A;  1I3Q J;  2DOF A;  4BHP A;  2E1C A;  2VBZ A;  3CCL I;  2X6O A;  1D1A A;  1FX7 A;  1BR2 A;  2NOG A;  4PJM A;  1R22 A;  1IXS B;  3FMR A;  4NBQ A;  4P96 A;  2CH0 A;  2YX4 A;  2G0E A;  2MYS A;  3NAR A;  2P6T A;  3TOB A;  4A6D A;  2JRM A;  3HOX J;  3ISP A;  1UHS A;  2UXN A;  4I0B A;  5DM6 F;  4JYK A;  2ZXI A;  3V7C A;  1RR8 C;  1YW9 A;  2IA0 A;  4CDG A;  4NC6 A;  3NQO A;  4E70 A;  3HC7 A;  5M5Y J;  4UUS B;  3BG7 A;  3N05 A;  3I71 A;  3QRF F;  1VQ9 I;  2DCE A;  2DMT A;  4CYD A;  2IS6 A;  1QVT A;  4EJW A;  2HOS A;  4EJO A;  2HOE A;  2LBF B;  2LSO A;  4IRI A;  1G3S A;  3A4C A;  3F8F A;  4I99 C;  1XN7 A;  4ASN A;  3OS0 A;  1QZY A;  1WRJ A;  2Y9Y A;  3BCB A;  5H20 A;  3HOW J;  5LGU A;  4XSX F;  3L1P A;  3MCZ A;  2NVX J;  5M3F J;  4EM2 A;  3SQN A;  2L9R A;  5C4X J;  4FIS A;  4XSZ F;  3KP6 A;  1BI3 A;  2CWE A;  2K4B A;  2FRH A;  3CCJ I;  3TP0 A;  1JT0 A;  1PVE A;  2LR8 A;  1G3Y A;  3R6S A;  1B8I A;  2L7M P;  4RGR A;  1R5I D;  1ETX A;  1YJW I;  1APL C;  3I9V 2;  3LA7 A;  4BU2 A;  2RC4 A;  1YHQ I;  4TV7 A;  1LFU P;  1OCO H;  1BW6 A;  1R6R A;  2AO9 A;  3BDD A;  3I64 A;  3RPQ A;  3ZQ7 A;  1LEA A;  1RR7 A;  3MZ8 A;  4WF2 A;  5GTH C;  2XSJ C;  1OLT A;  3TDU C;  1IN4 A;  1O3R A;  3QYF A;  4XK4 A;  3CME I;  2BHY A;  1U0J A;  4RAY A;  1OJL A;  1X19 A;  3JRD A;  4C2T A;  2DOA A;  3E7L A;  4BJT A;  4AID A;  4BXU A;  1GUU A;  2G9W A;  3KIO A;  3GZN B;  1YS7 A;  5DD4 A;  2E7X A;  1RUN A;  3C2G A;  1YG2 A;  1S29 A;  5BPD A;  3KE2 A;  5A2Q Z;  4RDU A;  1WJC A;  2JPB A;  1GVJ A;  2ZJ2 A;  1FOW A;  4OWR B;  4MFD A;  2V6E A;  3PSF A;  2D45 A;  3BC8 A;  2M8G X;  2VUM J;  5LGT A;  2HDW A;  3TOA A;  1WFX A;  5EZG A;  3GTJ J;  4J00 A;  4HX7 A;  4XM3 A;  2M30 A;  4A12 A;  2V7F A;  2XGC A;  4G7Z F;  2VPL A;  2MC4 A;  2ZME A;  1MMD A;  1YS6 A;  1VTN C;  1WJB A;  2CQX A;  2ELJ A;  4FET A;  4KIC A;  2P6S A;  4ZC3 A;  2M8E A;  3RSN A;  1SMY F;  3IH4 A;  4BXF A;  5L3B A;  3PIO F;  2FOW A;  2K5C A;  2ZFW A;  4GYI A;  1WJA A;  2K9N A;  3HPG A;  4PJL A;  2BHZ A;  1XGN A;  2DK8 A;  4LB6 B;  2PJP A;  1TL8 A;  2ZJQ F;  2N8G A;  1R71 A;  5EYR A;  2E2H J;  4M3D A;  2DA4 A;  2Q2E A;  4GXO A;  4UV9 A;  3DBR B;  4XLF A;  5F1J A;  2LK2 A;  3UR3 C;  3S1M J;  2IS2 A;  2ELH A;  1IUF A;  1O3T A;  1CQT A;  2ECB A;  3LNQ A;  3KFW X;  2O8X A;  1X1D A;  1X2M A;  5L3D A;  4M71 A;  4RM2 A;  5KCM A;  2COB A;  3OMY A;  3V8J A;  3V7S A;  3WHB A;  3WTY C;  3GZ6 A;  5GAG J;  3KEY A;  4HX4 A;  3RKY A;  4U87 A;  4EJU A;  3HOT A;  4JX6 A;  2H6C A;  4DIQ A;  3DU5 A;  1YW8 A;  2JA5 J;  3I5U A;  1JHF A;  4EVI A;  1UB9 A;  3FK6 A;  1ZHF A;  4XBF A;  1IUY A;  1D0Z A;  1VQ4 I;  1TTY A;  3WGH A;  4IF4 A;  2XGD A;  2NAZ A;  2V26 A;  2NNY A;  2VQL A;  3KZY A;  4DYC A;  2IS4 A;  2HKX A;  3J7A O;  3F23 A;  4A3F J;  2QQ8 A;  3OOU A;  4RS8 A;  4C30 A;  2X6X A;  5DUK A;  4UUS A;  1YLF A;  2DK5 A;  3D5S C;  4KN7 X;  3MKL A;  4HBL A;  5D8K B;  3LSG A;  2EK5 A;  2F5D A;  4KIT B;  4XIC A;  1HXD A;  3ML6 A;  4XRM A;  1FBS A;  2IA1 A;  2LBF A;  5FLV A;  2EIL H;  2PFB A;  3HXL A;  4F92 B;  2LVS A;  4E7H A;  2R7V A;  4XLC A;  1FBQ A;  3DCF A;  5CVU A;  3K6G A;  2ZSH B;  3EPZ A;  2FOK A;  1RUO A;  2R7U A;  1HF0 A;  2V1U A;  4M73 A;  1V5E A;  3GTQ J;  2L4A A;  4EJT A;  5FKL A;  1P92 A;  2H8R A;  2LY1 A;  1E3P A;  2W57 A;  3HOY J;  3FWE A;  2A07 F;  3L00 A;  1LJ9 A;  1P7I A;  1T95 A;  4HV6 A;  5EF6 A;  1K79 A;  5F0F A;  3DPT A;  3NWS A;  4L5I A;  1NK3 P;  2R7W A;  2DA1 A;  2V9V A;  2UV1 A;  2DFI A;  2WC2 A;  1Z7L A;  4DBQ A;  1ENH A;  2FXA A;  5HLT A;  4OMZ A;  4D9J A;  3CUQ C;  2XGX A;  4YEJ A;  2IS1 A;  3PM1 A;  5CVI A;  4BY7 J;  2X6Y A;  2M45 A;  4GO1 A;  1MKM A;  4DOZ A;  3CDL A;  2F5V A;  5D5X B;  1BOA A;  5IP9 J;  4BBR J;  3E1S A;  4OIN F;  1O3Q A;  4U0Y A;  4LB5 A;  3BJA A;  4RGX A;  2LRE A;  3LWF A;  1KU3 A;  1E0E A;  4BQA A;  1N78 A;  1FBU A;  1JUS A;  3OL4 A;  1FIA A;  4QTR A;  1HKQ A;  3HTU A;  4PDK A;  5D8L B;  1J59 A;  2D2W A;  3GLX A;  1ETY A;  3DKY A;  2O7O A;  3HKZ N;  1R1V A;  3BY6 A;  2L3D A;  4V2G A;  3PNT A;  4M3B A;  1OMI A;  3HRU A;  1SAU A;  1R7J A;  2AXL A;  3Q5F A;  1STZ A;  2EIJ H;  1BL0 A;  1UCR A;  2RV8 A;  1EH8 A;  4I0A A;  2A69 F;  4PUS A;  3DQV C;  5ILV A;  1TW2 A;  2P4W A;  2J5O A;  2NVQ J;  5HDK A;  2WB1 A;  3VYR B;  5FFX A;  4CH7 A;  5KVR A;  4CCK A;  2LH9 A;  4YII A;  1RRJ A;  1NHA A;  3QPH A;  4AVP A;  2KL4 A;  4FHT A;  2XKO A;  4FX0 A;  4I98 B;  4DZJ A;  5D5U B;  3RKX A;  2MLK A;  3SZT A;  1D1C A;  2BYV E;  2KMU A;  1B59 A;  1MGT A;  1O57 A;  1QPM A;  3OYH A;  1P9Q C;  1QQI A;  3L2C A;  1BI1 A;  2DT5 A;  2R5Z B;  3AG4 H;  3K4B A;  2IGM A;  5EEG A;  4B3A A;  1WCM J;  5E1Z B;  2JQ7 A;  1TQM A;  2O03 A;  3M8J A;  4Q48 A;  4AYB N;  2L54 A;  2R7S A;  1ZRE A;  3MKY B;  4XOP A;  4UV8 A;  4DJA A;  3BQY A;  1C0W A;  2CJJ A;  1WSU A;  2O3F A;  3WU2 C;  2IJL A;  2VOD A;  1WPK A;  3O8G A;  1ETW A;  1I1G A;  4MO7 A;  4Q47 A;  1KYW A;  1TNT A;  1I50 J;  3JRB A;  1RIO H;  3ECH A;  2A5W A;  4A0Y A;  4HYE A;  4Y4R A;  1HBX G;  4BE1 A;  2DA5 A;  4Y17 A;  3F72 A;  3HM5 A;  1VQP I;  3H36 A;  1K7A A;  2H1K A;  3WTZ A;  1TC3 C;  1WHU A;  3U1D A;  3LA3 A;  4ABZ A;  4BGD A;  1FOX A;  5EZH A;  2Q1Z B;  2F4O B;  1EF4 A;  3TGN A;  3V8K A;  2QF7 A;  3FXR A;  3O8H A;  5M3M J;  2GZW A;  3ZN0 A;  2ZO4 A;  1A36 A;  3S3N A;  1H89 C;  2VBX A;  5ICC A;  1T56 A;  5E20 A;  2JJ7 A;  3PFY A;  1IXC A;  3S16 J;  3VEP A;  1W7P D;  2EFQ A;  4H4K C;  5GAE J;  1A04 A;  1SVM A;  5KAI C;  6PAX A;  1FTZ A;  1RNL A;  5FKN A;  3KZI C;  2HI3 A;  3IWF A;  2PG4 A;  3KP4 A;  2O6G E;  2PQ8 A;  5AIP A;  1QA6 A;  1IV8 A;  3OR1 C;  2GA1 A;  4ZDO A;  3TP3 A;  3S15 J;  2EPF A;  4WX9 A;  5ICG A;  3DTK A;  4Y33 A;  3SYT A;  4YG2 F;  4WXH A;  2KDO A;  2PI0 A;  1U9O A;  2ADU A;  2QQB A;  4RAZ A;  1MD0 A;  4ZDL A;  1K4S A;  3BZ6 A;  4CZZ A;  1I39 A;  2VBW A;  2LRD A;  4HA8 A;  3FX3 A;  2FF4 A;  4C9Y A;  5FRO A;  3BLY A;  5H6R A;  4GGG A;  4EM1 A;  4NHJ A;  4D5F A;  5HNF A;  2HS5 A;  1GV5 A;  3V4G A;  3CTA A;  4OIQ F;  3CDI A;  3KYC B;  1FWZ A;  3F9K A;  1LQ1 A;  2Y48 A;  2CYY A;  3G1M A;  3U2R A;  3ESW B;  3KP5 A;  1YFH A;  3DEW A;  1GV2 A;  3GCM A;  4CZC A;  3K7A J;  3H5A A;  4RLF A;  2XGE A;  4DW6 A;  1A5J A;  4AC0 A;  1Y56 A;  1XMK A;  3EUH C;  1ERD A;  3FHZ A;  3T0Y A;  2LLK A;  2O61 A;  5IT9 K;  1ON2 A;  5E3M A;  5J47 A;  2EFW A;  3OIQ A;  3MEX A;  2KPM A;  1IF1 A;  4GDF A;  4S04 A;  2A6T A;  4BY1 J;  3C7J A;  3H35 A;  3OYL A;  2BY0 A;  4RA2 A;  2QSH X;  3GTL J;  1SVO A;  2JPC A;  3HOZ J;  3NWT A;  4CXF A;  1HW2 A;  1QO0 D;  2QCO A;  2ECC A;  1O7F A;  3BG5 A;  4LLL A;  1B72 B;  2E71 A;  3I3L A;  4B09 A;  2DN0 A;  4QLC U;  3LA2 A;  1R00 A;  3KYD B;  4HOB A;  3J81 K;  1H9T A;  2GIZ A;  3GW2 A;  4IHS A;  2VBY A;  1Y1W J;  3LSP A;  2QGU A;  1X4O A;  3VWB A;  5CKT A;  3SDG A;  1XB4 A;  2ZJP F;  2VI6 A;  2M34 A;  1IRG A;  4IL6 C;  4KIB A;  4P55 A;  3MVP A;  5ED4 A;  2R5Z A;  2E2I J;  1BBY A;  4BDZ A;  1TZL A;  2Z33 A;  1ETO A;  4ESF A;  4MIM A;  4IHW A;  3CD6 I;  1ZG1 A;  1E3H A;  2PMZ N;  3TO6 A;  2BXZ A;  2QZ8 A;  5IYB J;  2V1N A;  3WGI A;  3WTW C;  2E19 A;  2D1V A;  1S7O A;  2GA2 A;  3TED A;  1V5G A;  1D5V A;  4HF1 A;  5GPC A;  2RQP A;  5L3F A;  4CGZ A;  1R1U A;  2Q0O A;  3OS2 A;  3G73 A;  1ZGJ A;  2OJE D;  2R7R A;  4RB0 A;  5TJJ A;  2DXI A;  4IO9 F;  1USS A;  4BHC A;  5J4V A;  2GIV A;  5HLH A;  1AU7 A;  2VE8 A;  1U6G A;  4UHT A;  3QPL A;  3OIO A;  1T8I A;  1UMQ A;  3I55 I;  1YTY A;  2F5E A;  4NB5 A;  3GO5 A;  3O3K A;  4GFB A;  1FT9 A;  3M1E A;  5FKO A;  4ZZD A;  5LBQ A;  2VN2 A;  1FEX A;  1KYZ A;  3HJE A;  2Y69 H;  1G3W A;  1VZ0 A;  1ETV A;  1JTY A;  3I58 A;  5KAF C;  4D1Q A;  1WQ2 A;  4XN3 A;  1W0T A;  3EET A;  1KZH A;  5K5Q A;  4V19 K;  3JRC A;  2KIS A;  2RKH A;  1BN5 A;  3HSF A;  3OIP A;  2DLL A;  2EFO A;  3GX4 X;  1FC3 A;  3JW4 A;  3ZMT A;  2XKP A;  3IV5 A;  1X1C A;  2B7E A;  3CF2 A;  3CCR I;  1XCB A;  3MQ0 A;  1MBF A;  4IEJ A;  3NEU A;  3NAU A;  2BBY A;  3B6A A;  4DYQ A;  3LL7 A;  1TP4 A;  3BR0 A;  2FUG 2;  2R4G A;  2F2E A;  3LSM A;  2DDB A;  3OYF A;  5E3N A;  5D4R A;  4PSW A;  5ILS A;  3OYM A;  4G12 A;  4B3X A;  2UUZ A;  4Z6Y A;  4AVZ A;  2UWM A;  3DTE A;  1MBG A;  1WJD A;  3J80 K;  2LFB A;  2CQK A;  3A1Y A;  3BPX A;  4MFE A;  1ACI A;  1AA7 A;  2H1L A;  4CCJ A;  3H3V K;  1WGX A;  2L7F P;  2OC6 A;  5FD5 A;  4EQQ A;  4ANJ A;  4MHG A;  3HOS A;  4A3E J;  1DGW Y;  2KIM A;  2EQR A;  4RB3 C;  1XGO A;  3QWL A;  2ZC2 A;  4GYG A;  3A03 A;  3WHC A;  4ZYE A;  5ICE A;  1F4K A;  3S3M A;  4ZJZ A;  4QPQ A;  1QZZ A;  1RC9 A;  3LQQ A;  4UB8 C;  3K4C A;  2VJ5 A;  4I01 A;  4HQE A;  2BY3 A;  2L5Q A;  4F91 B;  2OQR A;  1WH7 A;  2W48 A;  5M5W J;  2W4S A;  3H5R A;  4XR6 A;  5HS7 A;  2Y0S A;  1YIJ I;  3RZO J;  3K2Z A;  5BPI A;  3J7A Y;  3Q9V A;  2B9S A;  5CVV A;  2H09 A;  1GLN A;  4E7K A;  3H92 A;  1MBH A;  4I09 A;  5LHH A;  3IP4 B;  2DPD A;  3BZK A;  1F36 A;  2A3S A;  4KT5 C;  2OA4 A;  4Y3O A;  5DTD A;  3HPH A;  2H8W A;  4XLA A;  3GEZ A;  2IPQ X;  2F6C A;  1SFO J;  2QSG X;  2M7B A;  2DBB A;  4HRI A;  3ZQF A;  5BMZ A;  1ZR2 A;  2RAE A;  2V79 A;  1X4P A;  1TWC J;  5HS8 A;  4BS9 A;  3BCA A;  4P9U A;  2E1O A;  4D0P A;  2JA2 A;  2B0L A;  2OAZ A;  2DA7 A;  1FP2 A;  4AU7 A;  5IPA A;  4LIT A;  1B1B A;  2LOO A;  2WV1 A;  1B72 A;  4A3L J;  2EV6 A;  4KA4 A;  4YIR X;  4YFK F;  2MH9 A;  2RRE A;  4B4C A;  2P5V A;  2VJ4 A;  1FP1 D;  2I10 A;  1SFU A;  5D5W B;  2RNJ A;  4FAS D;  3WTS C;  2ZXW H;  4IRH A;  1RET A;  2HFH A;  3BJ6 A;  1SMT A;  3NRV A;  2XUB A;  3H3Z A;  2MAB A;  2VKH A;  3L2V A;  2AS5 F;  1R36 A;  3CQZ J;  3QPS A;  4CSW A;  2UZK A;  1GVD A;  2LF8 A;  3QYE A;  3EDP A;  1MNE A;  3QAH A;  3S93 A;  3SFZ A;  3T8T A;  1MMA A;  2K85 A;  4A6E A;  2BVL A;  4J01 A;  2BGC A;  1QNT A;  4R79 A;  3K4L A;  3PUB A;  4MQ9 F;  3D5L A;  2VB6 A;  4AIH A;  2EA4 A;  1LVK A;  1DP3 A;  5IYC J;  3DKX A;  2EBI A;  2NXN B;  2HQA A;  2R92 J;  5EEA A;  4A3C J;  1YI2 I;  1QZE A;  1DQU A;  4BXX J;  1V54 H;  1G59 A;  3MFK A;  5FLX K;  1R58 A;  3BR1 A;  3H9J A;  1SAX A;  2BVM A;  2NS8 A;  1IAW A;  1DGR M;  1U8R A;  4BL0 B;  2XAH A;  1S8N A;  1ZKG A;  2FD5 A;  3RIR A;  1ONV A;  3FXQ A;  4QWQ A;  2DOD A;  2PEX A;  5KK1 A;  2JSP A;  4HG2 A;  1HA8 A;  3P5J A;  2VJJ A;  3K1N A;  2Z1D A;  4X0G A;  1W36 C;  1H9G A;  3CP8 A;  4WK8 F;  1G2H A;  1JJ8 C;  4G7O F;  4IRG A;  4KUM A;  2CV0 A;  2K4J A;  3Q3S A;  2OD5 A;  3K70 C;  4RGS A;  1RZ4 A;  3A0B C;  2XPU A;  4Y7N J;  2CSO A;  2DPU A;  4LLN A;  2W1O A;  4BNC A;  3BZC A;  4X6A J;  3TW6 A;  2Y0M A;  3RPU D;  1LDK B;  2Q8K A;  4Y52 J;  1MBE A;  1Z3Y A;  4L5E A;  2Z9O A;  1XMA A;  1Z67 A;  1BM9 A;  2RN7 A;  4HPQ A;  2HTJ A;  2KJB A;  5CQE A;  5F08 A;  1VF9 A;  4CYC B;  2WTE A;  2YU3 A;  3V42 A;  1D0Y A;  2E1M C;  1X3U A;  3FIS A;  3KLN A;  3J7Z I;  5E18 F;  4CCO A;  2KJC A;  3HDD A;  2A68 F;  1YX5 A;  3SJM A;  2CQN A;  3QOP A;  5J1R A;  4WXC A;  3PQJ A;  2YR2 A;  1XSV A;  2QM3 A;  3WOD F;  2X1E A;  3OYN A;  1KU7 A;  3PUF A;  2BY2 A;  1UFM A;  2OTJ I;  3G71 I;  3FXL A;  5CVJ A;  1R9T J;  4BH9 A;  3ZCO A;  3ZOB A;  1D8J A;  1D8K A;  3VDX A;  2QEX I;  1HOM A;  4QSH A;  5IP7 J;  4XON A;  5B1B H;  5GAH J;  1ODD A;  4ESJ A;  1Z9C A;  4RGU A;  4PJ0 C;  2W85 A;  3CO7 C;  1VQ5 I;  4EMS A;  1O4X A;  5E1W A;  3FMQ A;  1DU0 A;  2E7W A;  2X1D A;  2QLZ A;  4GCV A;  1HW5 A;  3ABK H;  4LIU A;  1U78 A;  1DDN A;  2PJR B;  1BIB A;  4MNU A;  3VYT B;  5IT3 A;  1N25 A;  3GFL A;  1Z6T A;  5ICF A;  5HNH A;  1XGM A;  2KHM A;  2E5Z A;  2FNA A;  4BEH B;  1VND A;  4XLE A;  4LIV A;  5CLS A;  2VKE A;  4AWX B;  4II3 A;  2IEK A;  3BR3 A;  5FKM A;  4CHU A;  4EGY A;  2P81 A;  2MD0 A;  4FT8 A;  5CPR B;  1EA3 A;  3K1M A;  4C2M J;  4J19 A;  3QOE A;  2Z99 A;  1YQA A;  3R0A A;  3LSH A;  3LSR A;  3AKZ A;  4RB2 C;  5AIQ A;  3F21 A;  3W6V A;  2ZXJ A;  1OQY A;  3F6V A;  1LUJ B;  2DA2 A;  1HDP A;  3LSJ A;  2MA3 A;  5J6X A;  4A3I J;  1JJ6 C;  2FU4 A;  1AHD P;  4KNY A;  3DLL F;  3OWT A;  4Q4Z F;  4KMF A;  3LOC A;  2VQH A;  3ABT A;  1W5C C;  3MKW B;  2R7D A;  1XCV A;  4HNV A;  1M1E B;  4XMY A;  2DI3 A;  5HS9 A;  4B47 A;  1G3T A;  2FNP A;  2YSR A;  1D5Y A;  2R93 J;  3M4O J;  3AG2 H;  1HST A;  1FPQ A;  1FJL A;  4LLG F;  3FXM A;  4JX4 A;  1MMS A;  1V3F A;  2MG4 A;  4R8H A;  3B73 A;  3M8F A;  1YJN I;  3VYU B;  1GHC A;  3PO2 J;  4IX7 A;  2EFP A;  1A35 A;  3Q0U A;  2EIN H;  4M9S A;  2F5C A;  4KJZ A;  4RAF A;  3VB2 A;  2DA3 A;  2KDZ A;  2O9L A;  2E34 A;  4DZP A;  1R49 A;  2ISZ A;  4RB1 A;  1QBJ A;  3HUG B;  2KZV A;  1XSX A;  5EEH A;  3ZRG A;  1S7A A;  3HRM A;  3RZD J;  1T0F C;  4B48 A;  1UZC A;  4M74 A;  1NH3 A;  2X6W A;  2L0K A;  3FKI J;  2BXY A;  3C1D A;  4G9Y A;  3OYI A;  1MSE C;  1EV7 A;  3CES A;  2DT6 A;  5LHG A;  2EJR A;  4CIC A;  3SFI A;  1UJ8 A;  2Y2Z A;  1W7P B;  3CJQ B;  1N75 A;  2OCC H;  5FLM J;  3CC7 I;  4PK4 A;  2GOM A;  4KDP A;  4OIP F;  1U5T C;  4B44 A;  3QYB A;  1ETK A;  3F6O A;  3ZPL A;  3ULQ B;  3I56 I;  4JQF A;  4C3I J;  2DYS H;  4L0Y B;  4OMY A;  1ZYR F;  2ZBK A;  5HVQ C;  2VOO A;  5J1Y A;  3A01 B;  2VC1 A;  1JGS A;  3VOD A;  3BG9 A;  3HZJ A;  3CCM I;  3HGG A;  4L18 B;  2CG4 A;  1IN8 A;  3TW7 A;  1Y39 A;  1Y6I A;  3DF8 A;  5JHU A;  1OCP A;  4B8X A;  5F1R A;  1SD6 A;  2KRC A;  1OIS A;  5IT9 Z;  1O7L A;  1MZB A;  2W84 A;  2XAU A;  3M8E A;  3CCE I;  2B63 J;  5F6F A;  1JUM A;  2VQG A;  2BW3 B;  4PSX A;  3SDB A;  1P4X A;  5CVR A;  3JRF A;  4CYC A;  1MH4 A;  5JLW A;  5EGO B;  5C44 J;  2Z2S B;  4LJZ F;  2OV7 A;  3KP2 A;  1QRY A;  2A61 A;  4L9T A;  3ZP5 A;  2HQN A;  2M9H A;  4D5C A;  1FYK A;  3P9C A;  3VSK A;  2RVC A;  5LLQ A;  2L9S A;  1FMW A;  2L7K A;  5J8C A;  2XB5 A;  3I54 A;  1HLV A;  4YEL A;  2HOT A;  2FX0 A;  1WJE A;  4E7S A;  1LFB A;  5H6Q A;  3ZMD A;  4LG3 A;  3A2K A;  5FD6 A;  3J81 Z;  2DMU A;  1WJ5 A;  2QEN A;  3GME A;  2HXI A;  5HLI A;  4F93 B;  2EZK A;  1HC8 A;  2VJI A;  1W36 D;  1T38 A;  2E5N A;  1QPI A;  5DCM B;  5BNG A;  2L9N A;  3MZY A;  5E17 F;  1U9N A;  2QKL B;  1ZQ3 P;  3HGY A;  3FZV A;  2PX9 A;  3K70 D;  3C3W A;  2JSC A;  1Q1H A;  1DU6 A;  2DT7 B;  3ZMZ A;  4MQV A;  3ZQH A;  5FFZ A;  3N97 A;  1KQ0 A;  1VFC A;  3CJT B;  2FBK A;  3TL4 X;  2K9S A;  2PJR A;  1J0R A;  2ME0 A;  3K69 A;  4A3K J;  1ZK8 A;  1F43 A;  4O5V A;  3I53 A;  3AL0 B;  1KU2 A;  2XHK A;  1DUX C;  2EZI A;  1N77 A;  5DS9 A;  2AQE A;  4BEH A;  3KLO A;  1ULY A;  1MND A;  2ACJ A;  5LRS A;  4A0X A;  2L2O A;  2HYG D;  2A6E F;  3MKZ A;  2AXT C;  3CCY A;  1J2X A;  4Y13 A;  2HVS A;  1MJA A;  4F55 A;  1WJF A;  4PCQ A;  3CUQ B;  4AIK A;  2ESH A;  2R0Q C;  5DDG A;  1LNW A;  4HST A;  3E97 A;  5BQT A;  5JI6 A;  2FBH A;  1Z0X A;  2BOL A;  2M2E A;  3HIF A;  3BRO A;  3TO7 A;  1S5L C;  4OAY A;  1FSE A;  3V8L A;  1ZLK A;  2KLO A;  5DEQ A;  3D1N I;  2YUS A;  4QPO A;  1W1W E;  1EH6 A;  3KYL A;  1XGS A;  1UG2 A;  5BS6 A;  2CUJ A;  2L01 A;  2MC3 A;  5J3L A;  2Y9Z A;  2Y30 A;  4HF2 A;  1L0O C;  2RDP A;  2ME6 A;  2R7X A;  5H2F C;  1IRX A;  4UY8 I;  2QVO A;  2X4H A;  3FXO A;  2VT2 A;  2WAD A;  4G8X A;  4MTD A;  1YIT I;  5LRR A;  2LMD A;  4S0H B;  1UHM A;  2CRG A;  2K9L A;  2G7U A;  5JHF A;  3S32 A;  3LAP A;  3CF5 F;  2XAG A;  1PDN C;  3ERM A;  2OBP A;  2KQR A;  4XQF A;  1PP8 F;  2HNH A;  1ORK A;  2OQG A;  2V9P A;  3PIP F;  1Z3X A;  2K7L A;  2KT0 A;  2DJI A;  4EAT A;  3A0H C;  5M5X J;  1TWA J;  3EUK L;  3MAJ A;  1FY7 A;  3HUG A;  3CO6 C;  1VI0 A;  3J80 Z;  2OF7 A;  1AOY A;  4IQJ A;  5ILU A;  2LNB A;  3K4J A;  3E6C C;  3REO A;  4BBS J;  1MSF C;  4A5N A;  3F22 A;  1XG1 A;  4E7Z A;  5K5R A;  3QU3 A;  1HKS A;  3Q9S A;  1K4T A;  5EDN A;  2BE5 F;  2VKV A;  3P7N A;  1W7P A;  5E79 C;  3TO9 A;  1K78 B;  1QGP A;  3F0C A;  3KZZ A;  2NS7 A;  4MEX F;  3FXU A;  3CCQ I;  2KIF A;  2LTP A;  2H27 A;  3S1N J;  1IXR C;  1BIA A;  1KON A;  1MH3 A;  2DFF A;  2XPV A;  4ZYD A;  2GXB A;  5IY5 H;  5JLX A;  3A01 A;  2M7A A;  3C2B A;  3G6E I;  3R4K A;  2ZNY A;  2JK3 A;  3LST A;  4W1U A;  3K10 A;  4OAZ A;  3IL2 A;  3FK7 A;  3GTK J;  5DD8 A;  3IUO A;  3OL3 A;  5C4J J;  1OFC X;  2XPW A;  2FML A;  4HSR A;  5F04 A;  3HRS A;  2K02 A;  3DXJ F;  5TGT A;  2LD5 A;  1O3S A;  2PN6 A;  1Z21 A;  2M1B A;  3K1P A;  1I27 A;  2BW3 A;  2LYC A;  1ZTR A;  3BTL A;  4RMN A;  4XKC A;  2CW8 A;  3WG7 H;  4UUV A;  5EGO A;  2KKO A;  1SFX A;  4I76 A;  2W25 A;  5D4S A;  2X0L A;  4C3H J;  3JAM K;  1H8A C;  2R7Z J;  3O6B B;  3S2D J;  3ZN1 A;  1OCT C;  1OKR A;  2AHQ A;  2VC0 A;  4HQM A;  4JK1 X;  4AM3 A;  2DTR A;  1VQ8 I;  2DFE A;  2V1X A;  1S6L A;  1B4A A;  2W24 A;  2W82 A;  5GAD J;  4ZTJ A;  2BEO A;  3DKW A;  3O2P E;  3OOP A;  1XTA A;  2BY1 A;  2LC2 A;  4LD5 A;  2ZJR F;  4HV5 A;  2QBY B;  2WB1 N;  3E5U A;  5B1A H;  4XKV A;  1OYI A;  5DCM A;  1JUP A;  1HSJ A;  1R23 A;  2MBF A;  4XOR A;  3ZMS A;  2JN6 A;  1SFK A;  2VIX A;  3OYK A;  2VON A;  1NTC A;  2LP0 A;  1U8B A;  3PL8 A;  1OCC H;  1IN6 A;  2EH3 A;  3IH3 A;  1HQC A;  3K4N A;  4JOM A;  3SXY A;  4BAY A;  1J7K A;  1D1B A;  2A05 A;  1I6X A;  4BUP A;  1LVA A;  1GXP A;  4M9Z A;  2VQC A;  1R4M B;  4I2O A;  1TBX A;  2DJN A;  1LB2 A;  1CGP A;  1R1T A;  2M4K A;  2DO7 A;  2F5F A;  3Q0W A;  3KEO A;  2FSW A;  4EM0 B;  4MEY F;  5E3L A;  3OYB A;  3I4M J;  3OYG A;  3OY9 A;  4FTH A;  1XDU A;  3CUQ A;  4FE4 A;  4XLP F;  4U7B A;  1OCZ H;  2GWR A;  2ZME C;  3GFM A;  3H5N A;  3HHH A;  3R61 A;  4A3G J;  2W7N A;  2HPI A;  1MJB A;  3F8M A;  1JGG A;  1LPQ A;  3FHN A;  3DU6 A;  3QQA A;  4BKX A;  4N0B A;  1ITY A;  2R7Q A;  4OIR F;  5FLX Z;  1NG7 A;  5DM7 F;  1W0U A;  5FRN A;  3E5X A;  5F0C A;  2LKS A;  1LE8 B;  2NOJ B;  1LKX A;  2R5Y B;  2LDU A;  4ENJ A;  3S2H J;  3R0J A;  4LOC A;  2JUC A;  5LHI A;  4YRV A;  5L3G A;  1OR7 A;  1K6O A;  3QU6 A;  4U0W A;  1AWC A;  3GBG A;  1IN5 A;  1VQ7 I;  2STT A;  3G2B A;  5D6E A;  3KET A;  3WE3 A;  2XAQ A;  4GRI A;  1D0X A;  2HQR A;  1Y1V J;  2K3P A;  4MGR A;  1FNN A;  2HR3 A;  2EV0 A;  3AG3 H;  2O8K A;  3UKG A;  4OIO F;  3WE2 A;  3TKY A;  3L09 A;  2GXG A;  4BAC A;  4II2 A;  3VPR A;  1IGN A;  3GXO A;  3L2R A;  4C2U A;  4P9F A;  1FLI A;  4UXN A;  1SD4 A;  4A2U A;  2XIG A;  3FBI B;  3RQ4 A;  3F8N A;  2X1C A;  4NC7 A;  4G6Q A;  4HNT A;  4PJN A;  1K78 A;  2VAS A;  4UVA A;  1BI2 A;  3H9G A;  3QP5 A;  2WWY A;  2FBI A;  4E6K G;  1IN7 A;  4G94 A;  1RI7 A;  4ENK A;  2NRA C;  1LEB A;  2H94 A;  5B5E C;  2VE9 A;  4E7L A;  2P7V B;  3RTR A;  4P1W A;  4LFU A;  4IHY A;  3RKW A;  3ROU A;  1X1B A;  5F64 A;  3LMM A;  3ASN H;  3F8C A;  3FM3 A;  1AKH B;  3KP7 A;  2HKO A;  2HVQ A;  4ON0 A;  2W00 A;  2A5Y B;  2J5P A;  1TW3 A;  4O6J A;  3DLA A;  4WWC A;  2EZH A;  3GWZ A;  2X51 A;  2COM A;  2M0C A;  3ABL H;  2X9D A;  3LSK A;  5BOX A;  4M9X A;  2OTL I;  3I0T A;  1T08 B;  1TWH J;  1REP C;  4RM3 A;  2P0W A;  3IKT A;  2V4J C;  1J09 A;  2O0Y A;  1W4M A;  3G1L A;  4N9I A;  2HXO A;  2R7O A;  2HZD A;  4BE0 A;  1Y8Q B;  2EFN A;  3W2V A;  5L3C A;  5AON A;  1S72 I;  2XF7 A;  2L9V A;  3U9G A;  5DV5 A;  4XKB A;  2IT0 A;  1JXS A;  5K1Y A;  2HPM A;  3LSI A;  2ICW G;  1ZRC A;  1QU3 A;  1FOK A;  1TWF J;  4XL9 A;  2HZT A;  3L2U A;  5LEJ A;  5B3S H;  1EH7 A;  2QBY A;  2VL8 A;  1QHG A;  5HDG A;  5LGN A;  4UNO A;  2HYJ A;  3IRQ A;  2FQ4 A;  2RGV A;  4A5M A;  1A31 A;  3U21 A;  5KNL A;  1ZRF A;  1T39 A;  3FMS A;  3RJP A;  1MIJ A;  4WCG A;  1JT6 A;  5TRD A;  3B6C A;  2UXX A;  2GBY A;  3ABM H;  1VQM I;  2IRF G;  3DPU A;  1P6R A;  4W97 A;  3F8B A;  2JVG A;  4EJV A;  3WTX C;  2RQQ A;  2HU9 A;  2IXS A;  4YIF A;  2XV4 S;  2GQQ A;  4Y15 A;  3QOD A;  1MMG A;  3KPH A;  4XID A;  4YFX F;  1U3E M;  1T2K A;  4L0Z B;  3HSE A;  2KRH A;  1ZAO A;  4ZYH A;  5HOD A;  4NQW B;  1XDS A;  5J4Y A;  3DPL C;  1WWX A;  4PZJ A;  3RCO A;  3WU0 A;  1X58 A;  4N4N B;  2JUG A;  3SHF A;  3DTI A;  1Z05 A;  2PLY A;  4IOC F;  4HNU A;  2K27 A;  1SD5 A;  3CCU I;  3QPT A;  4F52 A;  1ETQ A;  2CFO A;  1Q1V A;  3EUH A;  2OZU A;  3MD2 A;  1TNS A;  5LFA A;  2NVY J;  2OUM A;  3BG6 A;  1LE8 A;  2R5Y A;  2CS3 A;  5FB2 A;  1EJ9 A;  3JTG A;  5DYM A;  2JVH A;  4KT6 A;  1BJZ A;  1ZH5 A;  3IWZ A;  1SEU A;  2P5K A;  1OYW A;  2IGK A;  3D5R C;  3W6J B;  3VYS B;  1ZGW A;  3JTH A;  5ERI A;  1GT0 C;  3CC2 I;  2DQL A;  2YPR A;  4DGW B;  3BR6 A;  3PNV A;  3LAJ A;  2CW7 A;  3CUO A;  1EKE A;  2ZFU A;  2BV6 A;  3W6K B;  3JR9 A;  2HQ5 A;  3BTJ A;  3M3Y J;  1JKO C;  3GTP J;  2Z3Y A;  2DOE A;  3TQN A;  4DNC A;  3WU1 B;  1PJR A;  1WI9 A;  3ZQI A;  1ZLJ A;  4ZYA A;  4L9J A;  4A3B J;  3R60 A;  2ID6 A;  2F4M B;  3DEU A;  3MWM A;  1FSH A;  1F9N A;  2M4G A;  2LKP A;  4KIS A;  2KP6 A;  2E60 A;  1YO5 C;  1JHH A;  2IP2 A;  4XNF A;  1J75 A;  1GDT A;  3HKZ A;  2ZSI B;  3LFK A;  2H6B A;  1OYY A;  1PYV A;  3KEQ A;  3RPU A;  3JRH A;  4HZF A;  1AKH A;  5HDN A;  3WGG A;  3GF2 A;  3DFG A;  1FOY A;  1WI3 A;  3JRE A;  4LK1 F;  2DW4 A;  3GUD A;  1P2F A;  4G6D A;  3BP8 A;  1R4N B;  4KMU X;  3WTT C;  1H88 C;  2QWW A;  2CQQ A;  2Y0S N;  1PUF B;  3ZGK A;  3LFU A;  2C6Y A;  3HYI A;  2IW5 A;  4B43 A;  5DCF A;  1QHH D;  2JZY A;  1A6Q A;  3T5X A;  3RYP A;  4EGZ A;  4F3Q A;  2CU7 A;  3IKV A;  3T8R A;  4PJJ A;  3OYC A;  3CDH A;  3RI4 A;  2F48 A;  2IAI A;  1P4A A;  1OCR H;  3DBL B; 
#chains in the Genus database with same CATH homology
 4BDY A;  4BJ6 C;  3TL4 X;  2PJR A;  2Z16 A;  4BQO A;  3K4K A;  4AYB A;  2CV2 A;  1X4O A;  3VWB A;  5CKT A;  3AL0 B;  1N77 A;  1D1A A;  2AQE A;  1BR2 A;  4BEH A;  1MND A;  4PJM A;  2L2O A;  2CH0 A;  4BDZ A;  1TZL A;  3H0D A;  2MYS A;  3MKZ A;  2HVS A;  4F55 A;  1WJF A;  4PFO A;  2ZXI A;  2V1N A;  4HST A;  3ZXS A;  1V5G A;  2BOL A;  3HC7 A;  3BG7 A;  3N05 A;  3IAS 2;  4OAY A;  1YX3 A;  3OS2 A;  2R7R A;  2E1M B;  2WY8 Q;  4E7J A;  2DXI A;  2R7T A;  2DCE A;  2IS6 A;  2KLO A;  4BQN A;  2LBF B;  3CZ6 A;  3A4C A;  3OS0 A;  4QPO A;  4CCN A;  3KYL A;  2VXZ A;  2CUJ A;  3BCB A;  2X85 A;  2CMP A;  2R7X A;  1IRX A;  3ZQQ A;  4CCM A;  1VZ0 A;  2WAD A;  4D1Q A;  2K9L A;  5JHF A;  4XN3 A;  3S32 A;  3ZR8 X;  2KQR A;  4XQF A;  3OIP A;  2HNH A;  4CUG A;  3I9V 2;  4BU2 A;  1X1C A;  3CF2 A;  1G8X A;  1Z3X A;  4EAT A;  2DJI A;  4RLQ A;  1R6R A;  3EUK L;  3LL7 A;  3C2H A;  2FUG 2;  2R4G A;  4IQJ A;  3K4J A;  4ZTF A;  1NG6 A;  4E7Z A;  3LSM A;  2XSJ C;  1OLT A;  3MMY B;  3QYF A;  3FBN B;  4XN0 A;  3OYF A;  1BR1 A;  4PSW A;  3OYM A;  1U0J A;  4B3X A;  4C2T A;  1X19 A;  2UUZ A;  4AVZ A;  2DOA A;  4BJT A;  2UWM A;  1K6Y A;  3DTE A;  1WJD A;  3AL0 C;  1KON A;  4XLH A;  2IGO A;  3A1Y A;  1AA7 A;  3C2G A;  4CCJ A;  2M7A A;  4ZDP A;  3HOS A;  2OC6 A;  4CCL A;  2VXD A;  4ANJ A;  1DGW Y;  1WJC A;  3K10 A;  4OWR B;  2V6E A;  3K4M A;  3S3O A;  4OAZ A;  3S3M A;  3PSF A;  4ZJZ A;  4QPQ A;  3BC8 A;  3IUO A;  3OL3 A;  1LFP A;  2HDW A;  4HSR A;  2WBM A;  3K4C A;  2VJ5 A;  5TGT A;  1WFX A;  2L5Q A;  2WAE A;  4F91 B;  4J00 A;  1Z21 A;  2BW3 A;  2XF6 A;  4XM3 A;  2LYC A;  4RMN A;  4XKC A;  2V7F A;  2CW8 A;  2W4S A;  3H5R A;  2MC4 A;  4XR6 A;  2Y0S A;  4BE2 A;  1MMD A;  2VPL A;  1WJB A;  3J7A Y;  2ELJ A;  4FET A;  4BJ5 C;  4ZC3 A;  1GLN A;  3RSN A;  4BXF A;  4E7K A;  2K5C A;  3OYA A;  1WJA A;  3OS1 A;  5LD2 C;  3HPG A;  4PJL A;  3IP4 B;  1OR7 C;  2W82 A;  4Y3O A;  4HEA 2;  2WA0 A;  3HPH A;  4ZTJ A;  4XLA A;  2F6C A;  2LC2 A;  3UNG C;  2M7B A;  3HG9 A;  4XLF A;  4HRI A;  2RNG A;  3UR3 C;  1X4P A;  2IS2 A;  4BS9 A;  3BCA A;  4XKV A;  2JA2 A;  4XOR A;  4AU7 A;  1X1D A;  1SFK A;  1V5F A;  2VIX A;  3OYK A;  4LIT A;  2LOO A;  4RM2 A;  5KCM A;  3OMY A;  3PL8 A;  3TMO A;  3KEY A;  4JOM A;  3K4N A;  2PMZ A;  2RRE A;  2F4I A;  1D1B A;  4BUP A;  3FDY A;  4U87 A;  3HOT A;  2VJ4 A;  4DIQ A;  3DU5 A;  4FAS D;  2I8D A;  4E7I A;  2VQC A;  3W2W A;  1BOB A;  3EUA A;  2MAB A;  4MLO A;  5KHD A;  2M4K A;  2VKH A;  3L2V A;  3CJR B;  4CSW A;  3OYB A;  1D0Z A;  2AQF A;  3E0J B;  3OYG A;  3AFH A;  2V26 A;  3OY9 A;  2VQL A;  3QYE A;  2IS4 A;  1MNE A;  3S93 A;  1MMA A;  4U7B A;  3H5N A;  2BVL A;  4XOT A;  3OOU A;  4NNJ A;  4C30 A;  2W7N A;  2HPI A;  2X6X A;  4R79 A;  4J01 A;  3K4L A;  3PUB A;  3FHN A;  3FKJ A;  3D5L A;  3DU6 A;  3SEZ A;  3D5S C;  2VB6 A;  2R7Q A;  5CQG A;  3LSG A;  1LVK A;  1NG7 A;  4NUB A;  4KIT B;  1DP3 A;  2LBF A;  4BQQ A;  5FRN A;  3DKX A;  2HQA A;  2NOJ B;  1LKX A;  3HXL A;  3KX2 A;  4F92 B;  1DQU A;  4E7H A;  2R7V A;  4XLC A;  1G59 A;  3K6G A;  3CP2 A;  2ZSH B;  3EPZ A;  4YRV A;  4ITV A;  3H9J A;  2BVM A;  4G6T B;  3IAM 2;  1DGR M;  2R7U A;  3GBG A;  1V5E A;  3G2B A;  2JSP A;  2MFZ A;  2WAQ A;  4HG2 A;  1HA8 A;  2VJJ A;  4NC8 A;  4GRI A;  1D0X A;  3HL2 A;  2Z1D A;  3M1C A;  4X0G A;  1W36 C;  2LY1 A;  2K3P A;  3CP8 A;  3DWL E;  3OYD A;  2CV0 A;  4BAC A;  1T95 A;  1YE9 A;  4II2 A;  3K70 C;  3L2R A;  4C2U A;  1JI8 A;  3DPT A;  3NWS A;  2W1O A;  3FBI B;  3RQ4 A;  2X1C A;  3TBI A;  4NC7 A;  2R7W A;  3RPU D;  1LDK B;  4HNT A;  4PJN A;  1Z3Y A;  2IGN A;  2UV1 A;  1Z7L A;  2VAS A;  4DBQ A;  4HPQ A;  5HLT A;  2WY7 Q;  3H9G A;  4D9J A;  4YEJ A;  2IS1 A;  5CQE A;  2M3A A;  2X6Y A;  4E6K G;  4DOZ A;  2F5V A;  4E7L A;  1MMN A;  3RTR A;  4P1W A;  3V42 A;  3E1S A;  1X1B A;  1D0Y A;  2E1M C;  3LMM A;  2LRE A;  1E0E A;  2HVQ A;  2W00 A;  4CCO A;  3DEE A;  3OL4 A;  1N78 A;  1YX5 A;  3DLA A;  3H9Q A;  2X51 A;  3LSK A;  3DKY A;  3PNT A;  4RM3 A;  4N4O B;  2P0W A;  2X1E A;  1SAU A;  3OYN A;  1J09 A;  2V4J C;  3ZCO A;  3VDX A;  2R7O A;  2HZD A;  4BE0 A;  4PUS A;  3W2V A;  3DQV C;  4XON A;  2WB1 A;  3VYR B;  4CH7 A;  2XF7 A;  4CCK A;  3OYE A;  2LH9 A;  2X1D A;  1BR4 A;  4XKB A;  4IQ4 A;  2HPM A;  2KL4 A;  3LSI A;  4LIU A;  2PJR B;  1QU3 A;  3VYT B;  2CV1 A;  4XL9 A;  3SZG A;  5HNH A;  1D1C A;  2KHM A;  3L2U A;  2E5Z A;  2KMU A;  3OYH A;  1P9Q C;  4BEH B;  2VL8 A;  1QHG A;  4XLE A;  4LIV A;  3K4B A;  2IGM A;  4II3 A;  3L2W A;  2QKM B;  2HVR A;  3U21 A;  2MD0 A;  3M8J A;  5KNL A;  5CPR B;  3PSI A;  1EA3 A;  3QOE A;  2R7S A;  3MKY B;  4XOP A;  3LSH A;  4DJA A;  3AKZ A;  3DPU A;  2JVG A;  1S9H A;  2M0M A;  3OWT A;  2RQQ A;  2HU9 A;  2IXS A;  2VQH A;  3MKW B;  3QOD A;  1MMG A;  2A5W A;  4Y4R A;  4XMY A;  4BE1 A;  3CMM A;  3L2Q A;  4B47 A;  2KRH A;  2CUZ A;  4BGD A;  4NQW B;  3S8P A;  3DPL C;  2Q1Z B;  3RCO A;  4N4N B;  2JUG A;  3DTI A;  2VKD A;  3VYU B;  4HNU A;  2K9M A;  4IX7 A;  4E4H A;  4F52 A;  3S3N A;  2CFO A;  3MD2 A;  5LFA A;  4IZZ A;  3PFY A;  4KJZ A;  2OUM A;  3PNY A;  1TT0 A;  3BG6 A;  4H4K C;  2CS3 A;  2JVH A;  4KT6 A;  3HUG B;  2KZV A;  3ZRG A;  1X1A A;  2V9K A;  1T0F C;  4B48 A;  2O5R A;  2X6W A;  3OYI A;  3OR2 C;  2IGK A;  3D5R C;  3CES A;  2DT6 A;  3VYS B;  3W3C A;  2XDV A;  4DGW B;  2LY2 A;  3OR1 C;  4ZDO A;  3CJQ B;  1N75 A;  3PNV A;  3ONQ A;  2CW7 A;  4PK4 A;  2GOM A;  4CA0 A;  2XC7 A;  5FRM A;  1FMV A;  3DTK A;  4Y33 A;  2ZFU A;  3QYB A;  4B44 A;  3SYT A;  2ZXH A;  2KDO A;  4JQF A;  3OYJ A;  4ZDL A;  5HVQ C;  1PJR A;  3W2A A;  2LRD A;  4ZYA A;  4XKW A;  1UEL B;  4C9Y A;  5FRO A;  3BLY A;  4P5O A;  1Y6I A;  5HNF A;  1UAA A;  2M4G A;  2KRC A;  4KIS A;  2KP6 A;  2E60 A;  2XAU A;  1ZEL A;  2VQG A;  3F9K A;  2BW3 B;  2WAF A;  4PSX A;  3SDB A;  4XNF A;  3HKZ A;  2Z2S B;  2ZSI B;  1PYV A;  2OV7 A;  4CZC A;  4RLF A;  3H5A A;  1ERD A;  1Y56 A;  3EUH C;  2GOX B;  3PJR A;  4PFP A;  3VSK A;  3OIQ A;  2KPM A;  2L9S A;  1FMW A;  2L7K A;  2XF5 A;  2VLA A;  2A6T A;  4YEL A;  5HOO A;  1WJE A;  3ZGK A;  3LFU A;  4E7S A;  4LG3 A;  3A2K A;  3H35 A;  2Q2E B;  3OYL A;  4B43 A;  1WJ5 A;  4F93 B;  1QHH D;  2VJI A;  1W36 D;  3VSL A;  2E5N A;  3SEQ A;  4F3Q A;  2L9N A;  3NWT A;  1UG0 A;  2QKL B;  4DBR A;  4PJJ A;  2LG4 A;  3K70 D;  3OYC A;  4IKF A;  1MW7 A;  4BL0 B;  2DT7 B;  3I3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...