3HOYJ

Complete rna polymerase ii elongation complex vi
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hoyJ00
4A69C 3WHCA 1X58A 1E3OC 1YRNB 1QRYA 2E19A 4I6ZA 5C4JJ 1W0TA 3HDDA 1ETKA 3VPRA 2IAIA 2Y30A 2NS8A 4QIWN 3TW7A 1O4XA 2WAQN 3Q3SA 2DA6A 1MNMC 2CU7A 1GVDA 2HOSA 3S2HJ 4IHWA 1ENHA 3I4MJ 2DMPA 1FIPA 3TP0A 2PMZN 3NARA 3ZQIA 4BY7J 3QPSA 1ITYA 2ID6A 3IH3A 3SJMA 1I50J 1FEXA 2L0KA 3ZOBA 5E3NA 2KDZA 1WH7A 2Y31A 1TWFJ 1ZK8A 3S2DJ 1P7IA 3UKGA 5FKLA 4AC0A 2IBDA 5F0CA 2W48A 3GTQJ 1K83J 3M4OJ 2YUSA 2G0EA 2XB0X 5E3MA 2K9QA 2GLOA 2HOAA 4XRSG 3OSFA 3CMYA 2EZIA 1OCPA 4XIDA 1UHSA 4S0HB 3I4NJ 5K7ZA 3JRIA 3BTCA 3PM1A 3LSRA 1MBHA 1UG2A 5E3OA 2LY9A 1U78A 4M6VA 5J1RA 1AHDP 3BT9A 1JTXA 5K7FA 3S15J 3FIWA 3SDGA 1QVUA 1Y1VJ 5F04A 1XS9A 5FLVA 1JJ8C 4UUTA 3HOXJ 1IUFA 2AO9A 2R5YA 1GDTA 2OF7A 2JA7J 5J1UA 2M8GX 2XB5A 1WPKA 3HEFA 5FJ8J 4C2MJ 3K7AJ 1ETYA 3WHBA 4M3FA 3W6VA 3H3VK 4D7NA 3G1OA 1APLC 1QVTA 2CQQA 4LOCA 2MG4A 4EEFG 3G1LA 2FD5A 2DMQA 2HDDA 3M3YJ 4C3IJ 1MBEA 1WGXA 2VPRA 4HNVA 3ZQCA 5IP7J 2EBIA 2CRGA 2X48A 2ECBA 3OSGA 2O7OA 3BTIA 2E1OA 1ZR4A 5GPAA 3PO3J 1RESA 4MO7A 1XG1A 2L9RA 5FKOA 2L7MP 1ETXA 1T56A 2VI6A 2R5YB 2DMTA 5E3LA 2NVQJ 1ZTRA 3HOUJ 1HDDC 3RQIA 1FTTA 2OPTA 3BG5A 4DZJA 1F43A 4GFBA 5JLWA 2JA6J 4W1UA 4JX4A 2XPUA 1ETWA 3TW6A 1TWAJ 1JKQC 2ELKA 2M34A 5F27A 2R5ZA 4M3BA 3BQZA 1FJLA 1Z0XA 2JJ7A 2LTPA 1JUSA 3HOVJ 3JRGA 2XPVA 1BJZA 3BR0A 2EZLA 2DA7A 2B63J 2DJNA 1WCMJ 1BA5A 1I6HJ 1K61A 3S16J 5IYBJ 1OJLA 1ZKGA 1X2MA 2XGDA 2NVTJ 5C4XJ 1ZQ3P 5EZHA 3LNQA 4B3AA 1Y1WJ 4AUXA 1OFCX 2CJJA 2GM4A 2CUEA 2EH3A 2R7ZJ 3RKQA 1MBGA 1MBJA 2LFBA 2DN0A 2EQRA 1RKWA 3GBGA 2FX0A 1A6IA 3BTJA 3CCYA 1U8BA 1PUFA 1RETA 1S7EA 3S1RJ 4A93J 1HCRA 1H8AC 1HOMA 1MBKA 1XC5A 4FCYA 5C3EJ 3HKZN 3Q0UA 2ID3A 4QSHA 2LKXA 2TRTA 1JKOC 4A3LJ 2DA1A 3FISA 5IP9J 2R5ZB 3ZQHA 1GT0C 3QPLA 4BY1J 5F1JA 2HYJA 1ETOA 1BL0A 4V2GA 3C2BA 1BW6A 3JRCA 2JMWA 2N8GA 1IDYA 3MVPA 3Q0VA 4M3EA 4Y7NJ 4D5FA 2H8RA 3BR2A 1GUUA 1ZR2A 2MW8A 4A3IJ 1ORKA 1VI0A 2R93J 1H88C 5K7HA 1LFUP 4X1EA 5IPAA 2JK3A 2Y2ZA 2Y9YA 5JLXA 4C3HJ 3QQAA 3D1NI 1JTYA 1IJWC 2I10A 4G12A 2AHQA 5IOZA 1I3QJ 2NVXJ 4NDLA 4IEJA 5FKKA 3LSPA 1IV6A 2Y9ZA 1MSFC 3GTLJ 1PUFB 3DEWA 4I76A 3BR1A 1JJ6C 1JGGA 2L7ZA 3B6AA 1F36A 1IGNA 3RZDJ 2MSYA 4FTHA 3JRDA 1JKPC 1RPWA 1TWCJ 3BR6A 1U9NA 5EF6A 3JR9A 1HF0A 2P81A 1POGA 5F0FA 4A3FJ 2M2EA 5J3LA 1RR7A 3H0GJ 2NVYJ 3ZQLA 2FJ1A 5EZGA 4IHXA 5FLMJ 3G1MA 1A5JA 1GV5A 2XSDC 1R9TJ 4DYCA 3MN2A 1B8IA 1X2NA 1Z77A 1ZGWA 4ABZA 1JUPA 2COBA 3S1QJ 4A3GJ 1ETQA 2YU9J 1NTCA 3OIOA 1QPIA 3HB9A 4DYRA 4A3JJ 2X9DA 3BG3A 3LSGA 4FISA 4A3KJ 2GBYA 2WB1N 2XGCA 4C3JJ 2NS7A 4L5EA 1TWHJ 3JREA 5M3FJ 2O9LA 2DMUA 1OCTC 1WH5A 2JWTA 4JX5A 3IH4A 2DTZA 3FK6A 5M3MJ 1SANA 5EEAA 2LD5A 3IH2A 3BQYA 3E7LA 4DW6A 2QF7A 2E2IJ 1T33A 4JX6A 3L1PA 1AU7A 4MLOA 4D7MA 5C44J 3ZQFA 1MH3A 2R0QC 2DA5A 3Q0WA 2ME6A 1IC8A 5EG0B 3GTKJ 1JUMA 1VFCA 1GV2A 3LSJA 4MFDA 9ANTA 2M9HA 1VNDA 2O8KA 2VUMJ 2JA8J 1B8IB 4JYKA 4XICA 1U9OA 5F08A 2XGEA 3HGYA 2LVSA 2JN6A 1HLVA 3HBLA 1RKTA 4RDUA 4V2FA 4UUSB 4BBRJ 5J1YA 3PO2J 2QCOA 1MBFA 1B72B 3GTPJ 5EGOA 4BKXA 1NK2P 3OOUA 5IOYA 3GTGJ 1JT6A 5DS9A 4A3CJ 5F0HA 1BW5A 1IRZA 2TCTA 3B6CA 5GP9A 4CYCA 4D5CA 1D5YA 1SFOJ 3IV5A 3O8HA 2CUFA 3DCFA 1ETVA 4M3DA 4W97A 2X6OA 3TEDA 3BR5A 3A03A 4A3EJ 5IYCJ 3S14J 4FE7A 3HM5A 2EZKA 3BTLA 3LOCA 3GTMJ 1EF4A 3A01A 1IG7A 2E2HJ 5EYRA 2E2JJ 3K2AA 2HOTA 5IYDJ 3HGGA 4M3GA 4DZPA 1W0UA 3HOZJ 1DU0A 3NAUA 1Q1VA 2VKEA 5M5XJ 4B4CA 3HOWJ 2DA2A 3JRFA 4A3DJ 5EDNA 4MFEA 3CQZJ 1LE8A 1IDZA 3RZOJ 1AKHA 2K40A 1G2HA 3S17J 2IEKA 3BG9A 1JKRC 2HXOA 4BXXJ 2LLKA 1MH4A 3GTJJ 3CDLA 2ECCA 2EZHA 3O8GA 4BBSJ 4XRMA 1NK3P 5EGOB 1TC3C 1VF9A 1CQTA 5FKMA 5IP6A 4A3BJ 4RBOA 2K9NA 2DMNA 4CYCB 4QTRA 2RAEA 2HI3A 3S1MJ 2H1KA 5EG0A 1YRNA 2JA5J 3JRAA 2LR8A 2HQ5A 1FTZA 5BNGA 4B1RA 3HOYJ 5FKNA 1P7JA 4XRSA 3A01B 4MIMA 3S1NJ 4J19A 2FQ4A 3MKLA 3FKIJ 2DA3A 2MGQA 4X6AJ 2K9SA 2LK2A 1JT0A 5GPCA 1DU6A 1UMQA 2ME0A 4UUSA 2D5VA 4IHVA 2XRLA 2XPWA 1LE8B 1TWGJ 3JRBA 1HDPA 4DYQA 2NOGA 2CQXA 3F0CA 1AKHB 1B72A 3JRHA 5M5YJ 3FK7A 3ZQGA 3A02A 1MSEC 1LFBA 4XK4A 1H89C 2YS9A 1WI3A 2M0CA 4JP0A 5DTDA 4AYBN 2Y0SN 2VKVA 5M5WJ 2R92J 1FIAA 4A3MJ 2ZB9A 2DA4A 2LP0A 2KT0A 3BR3A 2HXIA 4Y52J 4FE4A 2L7FP 3TP3A 2WV1A 5HODA 3GTOJ 3SFIA 4IHYA
chains in the Genus database with same CATH superfamily
3J80K 2E36A 3K70C 1S29A 4A6EA 1UHMA 3GMEA 2O61A 5C4JJ 2X4HA 2WAQA 1W7PB 3V42A 1ACIA 1VQPI 3Q3SA 1GVDA 1XGNA 5FD5A 2E34A 1IRXA 1YITI 3TDZC 5HS7A 4HX8A 2GXGA 3DPLC 3LSMA 1FSHA 4YFXF 3K4CA 3IWFA 3F6VA 3IKTA 3WGIA 1W36C 2CUJA 3NARA 3WGHA 2JVGA 3CLOA 3SJMA 1I50J 2L0KA 4EJVA 2XAHA 1TWFJ 1ZK8A 3KP6A 3LQRA 5FKLA 4M71A 1NHAA 1I3AA 5L3CA 4A6DA 5CPRB 3R0AA 4DOZA 4L9VA 5CLSA 1CF7B 1OCCH 3ZXSA 3WGGA 1ZELA 3HG9A 3KP5A 4D9JA 1X1AA 1PVEA 3ZCOA 1R1UA 5E3MA 3L2VA 3RKWA 2KPMA 4F92B 3F9KA 2NXNB 3V8JA 1BBYA 3SDBA 3OR2C 4G6DA 3O6BB 1XX5A 3LSRA 2PFBA 5E3OA 1SVMA 1YJNI 3NQOA 4FHTA 2WWYA 5TRDA 1S3JA 3S15J 2GQQA 1X1PA 2V1NA 2YR2A 3GX4X 5F04A 1O3TA 1G8XA 1R00A 3DBHB 1SD4A 1F4KA 4C2TA 4UUTA 2VT3A 5FFXA 2ELJA 3BPVA 2JA7J 2Q0OA 5J1UA 4II2A 2Q8KA 2XB5A 1WPKA 3HEFA 5IT9K 3GZNB 1Q1HA 4D7NA 2HWVA 2EV6A 1OISA 4G7ZF 4LOCA 5F64A 2VLAA 2DK8A 4EEFG 3G1LA 4DIQA 4IHSA 2DMQA 4ANJA 1OYWA 2HDDA 5TISC 5D6EA 5FB2A 3AG4H 1WGXA 2DT5A 3E97A 1SEUA 2F5FA 4BUPA 3F22A 4KIFA 2EBIA 2VBXA 1X4OA 1KYWA 1M1EB 4NBQA 1ZR4A 4BXFA 2WTEA 2JSCA 4GXOA 4RLQA 2FUG2 2L9RA 1TQMA 3KP7A 4IQJA 3TOAA 4XKVA 4AYBA 1MNDA 2UZKA 3OYHA 1T56A 4MHGA 4KITB 3VFZA 1Z7LA 1FYMA 4EM0B 5DDGA 4BNCA 1HDDC 3RQIA 3BG5A 2CQKA 4DZJA 1F43A 3V7SA 2LBFA 2K85A 3DF8A 3FXUA 2HR3A 5H20A 4W1UA 4JX4A 1ETWA 3M8EA 3FXLA 3PQJA 3C7JA 3LMMA 4ZYAA 1Z3YA 2PG4A 1TWAJ 2QWWA 1JKQC 2ELKA 4YEJA 5F27A 1K79A 2R5ZA 1VQ4I 1Z0XA 3D5RC 2LY1A 1R4NB 1N75A 1I27A 2B63J 1X3WB 3VSLA 2XKOA 1BA5A 4NB5A 3HPHA 5K5QA 3IKVA 3RQ4A 5C4XJ 1X2MA 2R7QA 2XGDA 4I09A 4M72A 5DV5A 1K78A 4XM3A 2DTRA 1YS7A 3FM3A 2A6TA 3LNQA 2UV1A 1K6OA 3DWLE 1YI2I 4YFKF 4L5IA 4PGGA 3LL7A 4AUXA 3WU1B 3H5AA 1VQOI 4E6KG 3SZGA 4A2UA 2BXYA 4PJJA 1XCVA 1MBJA 4AIHA 1LUJB 5FFZA 4ZDLA 2EQRA 5J4YA 2EK5A 2DFIA 5L3GA 1MDMA 2XF6A 2V6CA 2DOAA 3WE2A 1IO2A 4U7BA 3F23A 3V4GA 4PSXA 3S1RJ 1ZREA 1T0FA 2CUZA 3OV8A 1TL8A 1MBKA 3ZRGA 4FCYA 3HKZN 2ID3A 2WV0A 2XHKA 2TRTA 2D1VA 2CH0A 1JKOC 3FISA 2R5ZB 3KEYA 2A61A 5D5XB 4EATA 2CG4A 3RYPA 4YIRX 2HKXA 5DD4A 3DKWA 3PJRA 3REOA 1LPQA 2EA2A 3L7WA 3OYIA 3HTSB 4LK0F 2CV0A 1R4MB 4P5OA 1BR1A 1BOAA 1DPUA 2H8RA 1GUUA 1K78B 1ORKA 2LG4A 4HSRA 1P4AA 2BHYA 4AU7A 1R58A 4MTDA 1J0RA 2QQ9A 4EJUA 2JK3A 2Y2ZA 4C3HJ 1KQ8A 2YX4A 3FXKA 3ZPLA 4UY8I 5B1BH 4Z6YA 1LJ9A 3GFIA 1I3QJ 5FLXK 1FY7A 3BJAA 4OIRF 5FKKA 4C30A 4CSWA 1MDMB 1IV6A 3HIFA 1JGGA 3B6AA 3HXLA 1QHHD 3L2UA 1TWCJ 3MZ8A 2BGCA 2F5CA 2R7OA 3JR9A 2GIZA 4CCOA 5K5RA 1HF0A 2P81A 1DGWY 2FEZA 1POGA 2UXNA 2V26A 5HS8A 3PNYA 1HW1A 3F21A 1ZRCA 5KAIC 1S7AA 2FJ1A 5EZGA 4IHXA 1VTNC 1BI3A 2QVOA 3RKXA 4AVPA 2KIQA 2OCEA 2XSJC 4DYCA 1Z77A 5HS9A 3TO7A 4ABZA 2COBA 4MEXF 1T98A 4A3GJ 4DYRA 3Q5FA 3BG3A 2V6EA 3K69A 4A3KJ 4MNUA 1MZBA 1DGRM 1K7AA 1LVKA 3EQLF 1YX3A 3K9TA 4L5EA 2M7AA 2K5CA 2KP6A 1JE8A 1WH5A 2AS5F 3IH4A 2DTZA 1V5FA 5E1XA 4H0EA 1YQAA 3BQYA 2VKDA 1T33A 1XGOA 3K4KA 2HOEA 4CDGA 4D7MA 4Q48A 2R0QC 2H1LA 5KNLA 2YX7A 2FNAA 5B1AH 1R6RA 2QUFA 3GTKJ 3FF5A 4Q47A 5D4SA 2VUMJ 2LOOA 4U7DA 3WTUC 3GXOA 4WCGA 1IW7F 3F8BA 1U6GA 1U9OA 4CZZA 3G73A 4OU0A 4NUBA 1OYIA 1P4XA 3H5RA 4XLAA 5D5VB 5D5WB 4HAMA 3PIPF 1BIAA 4FX0A 3HRTA 1MBFA 1B72B 3HKZA 1K6YA 4P55A 3BJOA 3F8MA 3IP4B 4BKXA 4KA4A 1HSTA 1YHQI 3AG1H 1V4RA 3CMAI 2K4BA 2TCTA 2P6SA 1VQ8I 2V9KA 4OOIA 1ZN2A 2Z1DA 3B6CA 2P7CB 4D5CA 2CUFA 4M3DA 5A2QZ 1ON2A 2M1BA 3S14J 3WU2C 3WODF 2LF8A 4KMUX 1A31A 3WTZA 4FE7A 3JCUC 3R60A 2Z99A 3BWGA 3C18A 4DZPA 2MC4A 2EWNA 3NAUA 3BP8A 4XKWA 2CW0F 4HF0A 3RPUD 2D1HA 2Z2SB 2EILH 4XSZF 3JRFA 4A3DJ 2UWMA 2R7SA 3I5UA 3MFKA 1ZRFA 3RZOJ 4IO9F 4WWCA 4E7KA 2HXOA 1N77A 2LF7A 2LLKA 3HPGA 4YG2F 5L3BA 3OWTA 4EJOA 1L3LA 2R7TA 3H92A 4LG3A 2ECCA 4CA0A 1WJDA 2OZ6A 2FBIA 3O8GA 2M8EA 3C2GA 2KZGA 5LGNA 1T6SA 5FKMA 1KA8A 3ABMH 3MWMA 3OS1A 5IP6A 4RBOA 3H3ZA 2DMNA 1RUOA 2UXXA 2FA5A 4BAYA 3HUGA 2CQ7A 5GAEJ 5HLTA 5E20A 2ZXWH 2L01A 4IRGA 2JA5J 2EINH 1SFEA 2HQ5A 2PI0A 1FTZA 3HOYJ 2X1CA 1P7JA 2L02A 3W6KB 3OS2A 4MIMA 2DCEA 4J19A 4Q5SF 2FQ4A 4KDPA 1SAXA 2Y0MA 2LK2A 4HG2A 3HRUA 3PL8A 4N4OB 4I7HA 2FXAA 4RAYA 1ZLJA 1XPXA 2GA1A 3OIPA 2CQXA 3F0CA 2AQEA 3JRHA 3FK7A 4HV5A 2Z3YA 1G59A 2RC4A 1G6NA 1WI3A 2B0LA 4AWXB 2BXZA 3PIOF 4IRIA 4GDFA 3QYFA 5M5WJ 3RTRA 2NRAC 1VQKI 2Z9OA 5B66C 2VONA 1P92A 2LP0A 4CHUA 1ZAOA 3CD6I 4OMYA 3TP3A 2V9PA 2WV1A 3HUGB 1FBQA 2CQNA 2Y48A 3J7AY 3CUOA 4A69C 2HVQA 4PCQA 5CVJA 5FROA 2E19A 3HDDA 4P1WA 2IAIA 5DCFA 2ESHA 1T38A 1OQYA 2WAQN 2DA6A 2LNBA 3K4NA 3BY6A 4UV8A 3CCJI 3KP3A 5LHGA 2BVMA 5KK1A 1MNMC 5D4RA 2BZTA 2XDVA 3S3OA 2HOSA 5ICGA 1HSJA 3I58A 3S2HJ 2ZJQF 4IHWA 3L9FA 5E18F 1BC8C 2IGMA 1XTAA 2DOEA 4LG0A 3TP0A 1KGSA 2OQGA 3ZQIA 2ZJ2A 1IN7A 2ID6A 2Y69H 3IH3A 3QP6A 1FEXA 3GFLA 5CYVA 3ZOBA 1LDJA 5E3NA 1WH7A 2KDZA 2Y31A 2CWEA 2QENA 1A04A 4ZZLA 2Z16A 3FMSA 4AC0A 1R5ID 2PMHA 2W48A 2A5YB 2M4KA 4CH7A 3I71A 2L3DA 1QZZA 2YUSA 2G0EA 3CLQA 1XMAA 4WXCA 3K4LA 2OTJI 3OSFA 3O2PE 5L3EA 2EZIA 1JGSA 3DEEA 3IRRA 4RA2A 1RNLA 5GTIC 3L00A 1ZGAA 2W24A 4IPAA 3CCMI 2ZXIA 3BC8A 4YELA 1GXPA 2ESNA 3WTWC 4OIQF 3PM1A 4XL9A 1MBHA 2LY9A 1ZG3A 4M6VA 3AG3H 5J1RA 1AHDP 3QRFF 5HVQC 1YFHA 1SFUA 3BT9A 5K7FA 2KIFA 3FIWA 3ZMDA 3SDGA 1PP7U 1Y1VJ 4LG0B 2RQPA 3H1CA 4B47A 2OU2A 2VL8A 3OR1C 3QPHA 4F3QA 4EM2A 2AO9A 2OF7A 4II3A 3Q9VA 2M8GX 4RGXA 5LRSA 3M1CA 1MGTA 3RPQA 2XROA 1ETYA 3WHBA 1G4DA 3FXRA 1IN4A 1QVTA 4IQ4A 2STTA 1TTYA 2ZKZA 2EFQA 2FF4A 1FMWA 4ON0A 1W7PA 2FD5A 4XLCA 4BHCA 1R1TA 4RB1A 1RRJA 3PUBA 1D0YA 3KYLA 3ZMTA 1X3UA 3ZQCA 1EH8A 3CESA 3OYCA 2P0WA 5IP7J 1NH3A 2RNJA 3JTHA 4IVNA 3RDIA 5H6QA 2J5PA 2X48A 3QP5A 2JT1A 3HC7A 1AOYA 1U2WA 3OSGA 3OYFA 4ESFA 4N9HA 2JUGA 1VQ5I 2L9NA 5JR3A 2JZYA 4LJZF 3ERED 2BBYA 4EJTA 3R4KA 1XB4A 5LHHA 2E71A 4R8HA 2Z5UA 5HNFA 2BYVE 2FBKA 2LC2A 3TOBA 2R7FA 1USSA 2K3PA 1ETXA 2E35A 4LB6B 2CYYA 2HPIA 4OWRB 1TQPA 3CMMA 3LFKA 3MKWB 1JXSA 1WJAA 5LEKA 1E17A 5ILSA 1Z05A 1ZTRA 4XN0A 5KVRA 2M5WA 2R7XA 1FTTA 4GFBA 5LD2C 1AA7A 3QYEA 4L9TA 3WTSC 2DFHA 2RGVA 3MAJA 1QU3A 5HLHA 1DP7P 3ELKA 1X1CA 1OCRH 2M34A 4G9YA 2HTJA 4M3BA 2JJ7A 2W85A 1XMKA 1TQIA 4BYYA 3E6BA 3JRGA 5J8FA 3BR0A 1WCMJ 4A5NA 1ZLKA 1I6HJ 3GZ5A 2M7BA 1W5TA 3S16J 5IYBJ 2KLOA 1ZKGA 3BCBA 4PZJA 3I9V2 1ZQ3P 2WY8Q 1O7LA 5EZHA 4EQQA 4YIFA 1I1GA 1UB9A 3NWTA 3BZ6A 2OC6A 2ZCWA 2H09A 2EH3A 2E1NA 3RKQA 1MBGA 4M73A 5JFRA 2LFBA 1RKWA 2IS6A 2FX0A 5JHUA 1MMDA 1PUFA 4A93J 5E17F 1HOMA 3OYDA 3O3KA 2PQ8A 5C3EJ 2P6TA 4CZCA 3CZ6A 4LD5A 4UXNA 4WF2A 4QSHA 3SFZA 4WX9A 5BMZA 1WSUA 4ZH4F 2Q1ZB 2DA1A 2XAUA 4KT5C 3QPLA 1ULYA 4XN3A 5F1JA 2HYJA 2AXLA 1BL0A 1G3SA 1VQ9I 4V2GA 4BHPA 3C2BA 3F8FA 4LLNA 1BW6A 2JMWA 2IW5A 3J81Z 3OY9A 1RUNA 1IDYA 3MVPA 3Q0VA 4CCNA 4M3EA 1O57A 1WJFA 2IVMA 4KUMA 3OMYA 4PJMA 4AD9A 1Z7UA 3T1BA 4IOAF 2MW8A 2ZNYA 4HQMA 4C9YA 3JAMK 2IJLA 3IUOA 3LA2A 5D6FA 3ROUA 4DQ2A 2RNGA 3TDUC 1MMAA 4ASNA 1LFUP 4I0BA 3CP8A 4X1EA 5AIQA 3QQAA 3D1NI 2RDPA 1U3EM 4OINF 1DQUA 2I10A 2AQFA 4L0YB 1VQNI 4KT6A 2STWA 2KMUA 3OS0A 4NDLA 4IEJA 2L9VA 5GAHJ 2Y9ZA 1PUFB 3DEWA 3MZYA 2FRHA 3BR1A 4I76A 1O3RA 2K4JA 3QWLA 2IS4A 2L7ZA 4TV7A 3I3LA 4BE0A 2MSYA 2XIGA 4FASD 4FTHA 2YPRA 3GEZA 4N9IA 1ODDA 2E1MB 2HS5A 1N78A 1Z9CA 2VJ4A 3FXOA 4QPQA 3MD2A 1YW8A 2M2EA 5J3LA 5LRRA 4RGRA 3KP4A 2DAOA 2NVYJ 2JA2A 2QQ8A 2E1MC 2EIKH 2M0MA 3DTEA 5BQTA 4RB0A 4BQNA 1B8IA 2X85A 1V5GA 4UVAA 1ZGWA 1JUPA 3BCAA 2BHZA 1UG0A 2VBZA 2YU9J 3HB9A 4BXUA 2ZO4A 3LSHA 4G6TB 3HHGA 2X6YA 2GBYA 2WB1N 2XGCA 4FISA 3COAC 1IRFA 1O3QA 3PSFA 2ZJRF 4ESBA 4HDUA 2DYSH 1BC7C 2CGPA 1TWHJ 2PBIA 4LIUA 1IN8A 4PJ0C 4ZYHA 1Z21A 2JWTA 4JX5A 4IZZA 5M3MJ 1X3ZB 4G6QA 2DU9A 3HRSA 1SANA 5EEAA 4EGYA 1N25A 4UV9A 3ECHA 3KYDB 2LY2A 4DW6A 2BEOA 3T8TA 3CTAA 3K4MA 3JAMZ 1YIOA 3CP2A 3U1KA 4L0ZB 5GTHC 2R3SA 4MLOA 2PN6A 4CICA 2DA5A 2VC0A 3DTKA 2ME6A 3C2HA 2OAZA 2CO5A 5EG0B 1G3WA 1WJBA 3HOSA 1JUMA 1VFCA 4MFDA 3GLXA 1FBSA 1XMXA 5JHFA 2ADUA 2GA2A 2W4SA 3HHHA 2QKLB 1B8IB 3H3UA 1R23A 2JPBA 2LVSA 2H8WA 5CVIA 4PGHA 3R0JA 4ZTFA 2NNYA 3LFUA 1CGPA 2K86A 1HKSA 2FU4A 2KJCA 3GTPJ 4PDKA 5HDGA 3HRMA 1ZG5A 1SVOA 3QOPA 2ZMEA 5GAGJ 4A3CJ 5F0HA 3FXMA 1Z1DA 4RS8A 3ZN1A 4IF4A 1FSEA 4CYCA 2CW7A 1XSDA 4RMNA 4XKCA 1SFOJ 4XNFA 5DYMA 1HXDA 2MFZA 3MCZA 2X6OA 2DDBA 3LSIA 3TEDA 5K5OA 4HPQA 4UVBA 4A3EJ 1UAAA 3B02A 2WA0A 1YO5C 3CC4I 2A6HF 3HM5A 1EF4A 3LOCA 4G8XA 3M8JA 1PUEE 3A01A 1IG7A 1E2XA 2P5LC 2E2JJ 1LKXA 3F6OA 4M3GA 1W0UA 3HOZJ 3ML6A 1DU0A 2LREA 2UUZA 3MZHA 1FOWA 1Q1VA 5M5XJ 4I98B 2K3FA 2HVRA 4R1HA 5EDNA 3CQZJ 2VT2A 1LE8A 1IDZA 3PNTA 4ENMA 2ZSIB 1P4WA 5ICFA 3VYRB 2CV1A 3S17J 2IEKA 2J5OA 5E8GA 4HV6A 3P5JA 1MH4A 2X51A 2LKSA 4B09A 2WADA 2CFOA 4B43A 4ZYDA 3NRVA 2R7RA 2HGCA 2ZMEB 2KRCA 3JW4A 1T08B 1E3PA 1WZ2A 1U5TB 4CYCB 1JHFA 1HKQA 1HQCA 2HI3A 2A07F 1B6AA 1OPCA 3S3MA 2A68F 2O0YA 2H1KA 1YRNA 2JQ7A 3S1MJ 1OKRA 3BPXA 2ZMEC 1B9NA 4C2UA 4ZYEA 5BNGA 1MMGA 3M7GA 2X6WA 4PUSA 1LEBA 4OAYA 3A01B 1U5TC 1XDSA 4OAZA 2DPDA 5E8IA 5A2QK 2O6GE 5E1WA 2DA3A 4X6AJ 3VYTB 2VASA 2WB1A 1OYYA 4JOMA 4IHVA 1TW3A 2XRLA 1FYLA 2RVCA 2XPWA 4EJWA 1LE8B 1HDPA 2NOGA 1B72A 5M5YJ 2E5NA 2MABA 4KMFA 5ICCA 4XONA 3W2WA 1J2XA 4BACA 1LEAA 4EV0A 5JVTA 1H89C 1IV8A 4GO1A 4DBQA 4L18B 2HDCA 2W82A 3ABLH 1TW2A 2F5DA 2O03A 4JP0A 4B3XA 5DTDA 4XMYA 3IL2A 1FC3A 2HKOA 3IHUA 3V7CA 2HQRA 1XSXA 4ZJZA 2VBWA 1YJ9I 5D8KB 2F2EA 5CQGA 2QZ8A 4A3MJ 2OUMA 2ZB9A 1D1BA 2V7FA 3EYYA 4XR6A 2HXIA 2ACJA 2LSOA 1OR7A 2AXTC 2L7FP 4ENJA 3TGNA 1K4SA 3D0SA 1PJRA 4IHYA 2DQLA 2PLYA 1YRNB 4CYDA 3HSEA 1W5SA 1W0TA 2IS1A 3VPRA 1I39A 3HJEA 3P9KA 3V8KA 2VE9A 2Y30A 2NS8A 1I1SA 2VB6A 4QIWN 3TW7A 3VYUB 3ABKH 2CU7A 2Z33A 4Q4ZF 1ENHA 2G7HA 3FBNB 4HYEA 2DMPA 3TL4X 3K70D 1LDKB 2PMZN 1Y0NA 3H5NA 3UR3C 2MH2A 3H35A 3EUAA 4BY7J 4E7ZA 3MKYB 4B48A 4L9NA 3EPZA 2M30A 1P7IA 2CMPA 1ONVA 3KLOA 4I02A 4MGRA 3I4PA 2IBDA 5F0CA 3BDDA 1R5GA 3MKZA 3GTQJ 3OYEA 5DCMA 3M4OJ 2L5QA 2XB0X 3HZJA 2K9QA 2HOAA 2JTVA 4XRSG 3CMYA 3NWSA 1HC8A 3CF5F 1HKTA 1OCPA 4ESJA 2L4MA 3D5LA 4XIDA 1UHSA 4LITA 4JK1X 2E5ZA 3KZZA 5L3FA 2HQAA 3VODA 3TO6A 4PFPA 4EMSA 3BTCA 1U78A 4NNJA 1OR7C 4Y33A 2NVUB 4S04A 4UVCA 1JTXA 3C1DA 2KKOA 1Y8QB 1E0EA 1QVUA 2DI3A 1XS9A 1X4PA 2R7WA 1ON1A 2P5KA 3TMOA 4P96A 5FLVA 4PSWA 5B5EC 2DYRH 3SZPA 3RSNA 1QQIA 1W5CC 3CCSI 1GDTA 2EPFA 1BIBA 1QPMA 1YE9A 4A0ZA 2XF7A 2ZSHB 2K27A 1Z67A 3E6MA 2NS0A 3U21A 1FZPB 4NC6A 3WTTC 3K7AJ 3IC7A 4HW0A 4M3FA 3W6VA 3E6CC 5DCMB 1APLC 3FZVA 3GW2A 2EV0A 3E5QA 1D1AA 1Z91A 1R5HA 3BOQA 5AONA 2VKHA 4F91B 1SMYF 4UHTA 3MQ0A 4ZYGA 3KCCA 2ZFUA 1XDUA 3IAM2 2OBPA 2A3SA 1FMVA 3DLLF 4LIVA 4E7HA 2CRGA 5GADJ 2MH9A 3VEPA 5DUKA 3RCOA 5LBQA 4BDYA 1XGSA 2G7UA 1R71A 1AWCA 5GPAA 2EJRA 1LNWA 3PO3J 4ITVA 3CO7C 4MTEA 3UNGC 1IZ1A 2KIMA 2I5UA 3PQKA 1T39A 1XG1A 1FOKA 1Y8RB 4QPOA 1ZYRF 2MBFA 3K6GA 5HDNA 2ICWG 4UB8C 3VDXA 3I54A 5EEGA 1QO0D 2MYSA 3M9AA 1LVAA 1SVLA 4I01A 2BY0A 5E3LA 2D45A 2V79A 4KJZA 2C6YA 2FSWA 5E79C 4ZDOA 3HSRA 1MJBA 4LFUA 4BE2A 4MEYF 1UJ8A 5CJ9A 2FQ3A 1FWZA 3DBRB 2LH9A 1EH7A 4GCVA 4BJ6C 3GO5A 4WXHA 3N05A 1LB2A 3D5SC 3BG7A 2TDXA 4NHJA 1EH6A 3BQZA 1K4TA 2LTPA 1FJLA 3TQNA 3F8NA 3WG7H 3HOTA 2JPCA 2VN2A 1BJZA 3PNVA 1DDNA 2DA7A 2PMZA 5D5UB 3QPTA 2LYCA 4KNYA 2XGXA 1GHCA 3E6DA 1F1ZA 1YX5A 3GYHX 1K61A 2XUBA 5HDKA 2BE5F 1R22A 4U0YA 2VOOA 2I8DA 2F48A 1B59A 4L9JA 1WWXA 4G7HF 1TZLA 4HF2A 1MMSA 1KZHA 2XKPA 4IRHA 1WRJA 1OFCX 3I59B 1VQMI 4RLFA 4E7LA 4A0YA 5FRNA 1J59A 1G3TA 2EA4A 1OMIA 1E3HA 3E1SA 4P9UA 2R7ZJ 2RKHA 3VB2A 4GGGA 5LFAA 1GLNA 2DN0A 1BOBA 2WC2A 2IGKA 4HX7A 2VQHA 3G2BA 2Q2EA 3GBGA 3QODA 2K9LA 5FO5A 1SD7A 4U0WA 3F72A 1A6IA 3BTJA 1YJWI 1RETA 1S7EA 2OZUA 2MLGA 5EJCA 1H0MA 1H8AC 1KQ0A 4M6XA 3ZMUA 2IS2A 4O5VA 3SZTA 3T5XA 5HNHA 5BS6A 1S9HA 2ETHA 5H2FC 2LKXA 3CCRI 3RI4A 5IP9J 1B9MA 3ZQHA 3I56I 1GT0C 4BY1J 2VE8A 1S72I 1ETOA 3GFMA 3B73A 4EGZA 1YOVB 2CS3A 3I0TA 3CJRB 2FNPA 3K4JA 2VODA 1EA3A 2JRTA 1I6XA 3OYJA 3LA3A 1BR4A 3T0YA 5CQEA 3U9GA 4R79A 4AIDA 4A3IJ 3MEXA 1VQ7I 1VI0A 2R93J 5KAFC 1FNNA 2R7VA 1F5TA 1BI2A 1H88C 2DFFA 3EETA 2A69F 4AIJA 2RN7A 2W1OA 2FOWA 5L3DA 5IPAA 2GAUA 1QZEA 4HEA2 4WXDA 3KETA 1BI0A 1JTYA 2NYXA 1R1VA 1YG2A 3ABTA 3V7RA 3SQNA 3K1NA 1MD0A 1UCRA 3DBLB 5IOZA 4MQ9F 1LDDA 2Q2EB 2YU3A 1MSFC 3A1YA 1WJ5A 4E7IA 4RM3A 4M9SA 1HW2A 1F36A 1STZA 3JRDA 2W57A 1JKPC 1H9TA 1BR2A 4F7ZA 1U9NA 1IAWA 3TBIA 4RAFA 3PFYA 5LLQA 5EF6A 3KX2A 3RJPA 4OIPF 3W2VA 3A4CA 3LWFA 2VJIA 5F0FA 4A3FJ 2XAQA 2M3AA 2VXZA 3H0GJ 3ZQLA 3EUKL 5FLMJ 2FMYA 4AIKA 2DODA 2ZBKA 2DOFA 1GV5A 2XSDC 4BS9A 4U87A 2F4IA 1R9TJ 3MN2A 2QGUA 4PJLA 4ENKA 2WBMA 2QEXI 4IJAA 3LAJA 5LGUA 3J81K 3S1QJ 1IUYA 2W7NA 3OIOA 1QPIA 4ETSA 4XLHA 2XF5A 4Y4RA 5ICEA 2QA4I 2NS7A 3QU3A 2XAFA 3ERMA 3RPUA 2WY7Q 3GUDA 1Y6IA 2DMUA 2IA1A 3M8FA 3WG9A 3HYIA 2YSRA 1QA6A 4DGWB 1D0ZA 4YIIA 2F4MB 1FPQA 3DLAA 3E5UA 3E7LA 2QF7A 4AVZA 4F55A 2E2IJ 3G3ZA 2CSOA 4I0AA 1AU7A 1ZRDA 2ISYA 1WVRA 1FLIA 3KEOA 5C44J 3CUQC 1V55H 1U0JA 3ZQFA 3CCVI 3GLLA 2L54A 3K1MA 3ISPA 3Q0WA 2ZJPF 1IC8A 4FT8A 3CO6C 3VYSB 5J47A 1GV2A 9ANTA 4K2EA 2M9HA 3QOEA 3W6JB 1VNDA 2KHMA 4JYKA 4J01A 5IY5H 2ZC2A 4XICA 3RYRA 5F08A 2XGEA 3ZQQA 3HGYA 1WI9A 2JN6A 2K7LA 4RDUA 2KIUA 4V2FA 5JVGF 4UUSB 2BY1A 4RAGA 2W84A 1EV7A 3WTXC 4E4HA 4KFCA 4BL0B 1EKEA 2Y75A 1IN5A 2XRNA 2OJED 5EGOA 3GZ6A 2GXBA 4G7OF 4BQQA 2DQRA 5DS9A 2BVLA 4CCMA 2H6CA 2MC3A 2CV2A 3GWZA 3PSIA 2PJRA 2KFDA 5GP9A 1P9QC 2VJJA 3ECOA 3IV5A 2EFWA 4W97A 1WJCA 1TP4A 3BR5A 4M9XA 5AIPA 1Y0UA 4S05A 1MMNA 4IKFA 1UZCA 3KLNA 3LSTA 3ZQ7A 4F52A 2A05A 3BTLA 2DFEA 4XORA 1OLTA 2L4AA 3K10A 3P9CA 2LDUA 2GIVA 2HZDA 3OYMA 2VKEA 3IRQA 4B4CA 4HDVA 3RKYA 2DA2A 1IXCA 3BZKA 2EFNA 1A6QA 2O3FA 2K40A 2HVSA 1KU3A 1YLFA 1MNEA 2IP2A 3OYNA 4A12A 3GTJJ 3CDLA 2CFXA 3OL4A 3OYLA 3L2WA 4XRMA 1KU2A 5EGOB 3BZCA 2DBBA 1VF9A 2HNHA 4KIGA 2X1EA 3ZMSA 3J80Z 4IXAA 5DM7F 3GF2A 1UFMA 3DTIA 2XAJA 2E60A 2NNNA 3N4MA 2F6CA 2PJRB 2A6EF 4A3BJ 1FP2A 2BV6A 2K9NA 4XOPA 3KEQA 1VQLI 1IRGA 1X1BA 3FWEA 2RAEA 4GYGA 4PJNA 2VIXA 4IX7A 5EG0A 4WK8F 3JRAA 2LR8A 4JBAA 4HSTA 4BH9A 4B1RA 5FKNA 1IXSB 4XRSA 1Y56A 2QQAA 2M4GA 1OCZH 1ZG1A 3DPTA 3CJTB 2IGOA 3ESWB 3FBIB 2MGQA 1B4AA 1JT0A 4XOTA 2B9SA 2ME0A 2GWRA 1HBXG 2D5VA 3KYCB 1TWGJ 3JRBA 4DYQA 3OYKA 4V19K 4G94A 1LFBA 5HLIA 1RIOH 3CCQI 2JVHA 3DEUA 3E0JB 2GOMA 2M0CA 3KE2A 3A2KA 3P7NA 4Y17A 1J09A 2EFPA 2Y0SN 5HOOA 3F3XA 4IHTA 2F4OB 1C0WA 1FIAA 1UHWA 2DA4A 3BR3A 3QAHA 3CC7I 4FE4A 1XSVA 2BW3A 2ZFWA 3GTOJ 1NG7A 3WHCA 3V8LA 1X58A 4DNCA 1E3OC 1QRYA 2VPLA 1BM9A 2IRFG 4I6ZA 4EM1A 4U88A 3TKYA 1ETKA 4XLPF 4D0PA 2HQNA 3JTGA 1FYKA 1O4XA 3ULQB 4CUGA 2X6XA 3DKYA 1EJ9A 4XBFA 4HNTA 3DV8A 4N4NB 1RZ4A 2WAFA 1FBUA 4KN7X 3CCUI 3F8CA 3I4MJ 1G3YA 4CCLA 1LFPA 1FIPA 2RREA 3RIRA 2HTSA 5IT9Z 1ITYA 3QPSA 2KZVA 1MKMA 2OA4A 3S3NA 2E1CA 1YW7A 3S2DJ 5J40A 3UKGA 3DU5A 2PX9A 2V1UA 5BPIA 4KYWA 2DDAA 2JUCA 4HOBA 1U5TA 1FOXA 5DM6F 2COMA 1K83J 3C3WA 4FETA 4FQGA 2O5RA 2GLOA 5F1RA 1S5LC 1D3YA 1ZHFA 1R49A 2BW3B 2NAZA 2E7WA 2DK5A 4I2OA 2LBFB 2IA0A 4S0HB 3S93A 4X0GA 2IT0A 5FGMA 2XV4S 4XRFA 1XN7A 3I4NJ 1DP3A 1R36A 1J5YA 2B7EA 2P4WA 4HA8A 5CKTA 5K7ZA 3JRIA 3BLYA 4BHBA 2G9WA 5KCMA 1UG2A 1Z6TA 4HNUA 4E7SA 4OIOF 4UUVA 1J9IA 2H94A 5H6RA 4E70A 5ILUA 2R7DA 2ISZA 3N97A 4BE1A 3GFJA 4RAZA 3DKXA 3K0LA 1X19A 4Y3OA 3GVAA 3LSKA 2L7KA 2DPUA 4OMZA 2QBYA 1JJ8C 1SC7A 1MW7A 3HOXJ 1IUFA 2R5YA 4ZTJA 2FE3A 3H9JA 2IPQX 1NG6A 4YFNF 4Y15A 5FJ8J 3KFWX 4C2MJ 5FD6A 1SD6A 2HFHA 3H3VK 2MA3A 2HPMA 2IA2A 3G1OA 3FHZA 2MD5A 1T95A 2CQQA 3K4BA 3GCMA 3QYBA 5BOXA 2L9SA 1KONA 2MG4A 4BJ5C 4QWQA 1O3SA 4M6YA 4E7JA 3M3YJ 4C3IJ 3CJNA 1MBEA 3CCEI 1IF1A 2FOKA 4M74A 2VPRA 1PDNC 4HNVA 1HA8A 4JQFA 3CC2I 2ECBA 2O7OA 3BTIA 3P9IA 3FMRA 3L09A 3ZN0A 2E1OA 1TT5B 1T0FC 4HBLA 3JSOA 1D8KA 2BOLA 1RESA 3ZR8X 4U0VA 1BN5A 3K2ZA 4MO7A 3FHNA 3SHFA 1Z6RA 4KISA 2K9MA 4CCKA 2Y0SA 2QBYB 1XGMA 1SAUA 4I99C 5FKOA 2L7MP 4CGZA 2VI6A 2RV8A 2R5YB 3IWZA 2DMTA 4O6JA 1R7JA 3OYAA 4LK1F 2DJIA 2NVQJ 3I64A 4NC8A 2PEXA 3HOUJ 1MJ9A 1YTYA 2P8TA 2OPTA 3SYTA 2LRDA 1ZARA 5JLWA 2JA6J 3H36A 2XPUA 3TW6A 4RGUA 2KJBA 1WQ2A 1O7FA 1PYVA 4NQWA 4PFOA 3LA7A 4F93B 1JUSA 3HOVJ 1H9GA 3U1DA 2XPVA 2P7VB 3CCLI 2EZLA 3DFGA 5LGTA 2XAGA 4LB5A 1L0OC 2DJNA 3CDIA 2P5VA 3A0HC 3X2QH 1QNTA 5F6FA 1OJLA 1B1BA 2NVTJ 1GVJA 3CF2A 2DXIA 2V1DA 2GOXB 3PUFA 3FDYA 4B3AA 1Y1WJ 3FXJA 5FLXZ 1T2KA 2CJJA 1WJEA 2F5EA 2FBHA 2QSGX 2GM4A 3NEUA 1KYZA 2CUEA 2WAEA 1W7PD 2ELHA 3E5XA 1S8NA 2EIJH 1PP8F 2IXSA 1W36D 4HLXA 4BQOA 2MLKA 1QGPA 4LGWA 5KHDA 4HQEA 2HU9A 1SD5A 2EFOA 5CVRA 1RI7A 3CCYA 1U8BA 2R7UA 1HCRA 3I53A 2VOPA 1XC5A 2HDWA 1FOYA 3Q0UA 4KIBA 2E7XA 2X1DA 2PJPA 4A3LJ 4NQWB 5LEJA 3KP2A 5TJJA 4L5JA 3JRCA 3W3CA 1TLHB 2N8GA 1T8IA 1S6LA 3KZYA 1ZGJA 4D1QA 4LMYA 1UELB 4LLLA 1OCOH 4Y7NJ 4D5FA 3BR2A 1ZR2A 5D8LB 1X1DA 3SXYA 1BI1A 2LMDA 1SFXA 4IOCF 1P6RA 2DT7B 1D1CA 3ZGKA 5J8CA 5K7HA 1QBJA 2Y9YA 5JLXA 2M45A 1XD7A 1IJWC 4H4KC 4G12A 4CO8A 2AHQA 3W2AA 2R4GA 2NVXJ 4A5MA 5J6XA 2NOJB 3LSPA 3EYIA 1VQ6I 3GTLJ 4DJAA 1XCBA 1JJ6C 2KQRA 1KU9A 2A5WA 1IGNA 1JHHA 3RZDJ 1RPWA 3BR6A 2QQBA 4RB2C 2EV5A 3L2RA 2KRHA 1QZYA 4RGSA 1FP1D 1FX7A 4O3MA 4HLYA 4BEHA 3CMEI 2EIMH 2D2WA 4A0XA 3G71I 4XLFA 4XLEA 1JI8A 1RR7A 5TGTA 1ERDA 2CW8A 3SEZA 3MMYB 3G1MA 2KRFA 1A5JA 3G4SI 3OYGA 2EB7A 3I59A 1TNSA 1X2NA 3CJQB 3HSFA 4RM2A 4Z2YA 5FRMA 1ZH5A 1IXRC 1ETQA 1NTCA 2BY2A 2X0LA 1SMTA 4A3JJ 2X9DA 2KL4A 3LSGA 1REPC 2V4JC 2W00A 4C3JJ 2M87A 3FM5A 1P2FA 3L2QA 3J7AO 2HZTA 2HYFA 3DPUA 3JREA 3WU0A 5M3FJ 2O9LA 3ONQA 1KQ9A 5DUIA 1OCTC 3VWBA 3FK6A 4BGDA 5B3SH 1F9NA 3ABUA 2LD5A 4NC7A 3AFHA 3BROA 3QU6A 2DT6A 3IH2A 4UB6C 4XSXF 1LQ1A 4M9ZA 3BJ6A 1TNTA 4JX6A 3L1PA 1Z3XA 4RB3C 3VSKA 1J75A 1S7OA 3HTUA 1MH3A 5ERIA 1VZ0A 4BEHB 4IL6C 1W1WE 4J00A 3CDHA 5ED4A 3TO9A 3AKZA 3DU6A 1SFKA 3G6EI 3OOPA 1D0XA 1V54H 3KPHA 3LSJA 3OYBA 2H27A 2MD0A 2GXAA 4ENNA 3DP7A 2O8KA 2RQQA 3E3VA 2VQLA 3H9QA 1U8RA 2JA8J 1WFXA 1J7KA 4LLGF 3HL2A 1GXQA 4XKBA 4BJTA 4B44A 1HLVA 1USTA 2OD5A 3S2WA 3HBLA 5E1ZB 1RKTA 2XC7A 1DPRA 4PK4A 4BBRJ 1D5VA 2IGNA 2K02A 3H9GA 1FT9A 5J1YA 3WTVC 4HRIA 3PO2J 2QCOA 4BQAA 2XVCA 1WKMA 2QYOA 2VQCA 2KDOA 4HX4A 3WE3A 1NK2P 3OOUA 5IOYA 3T8RA 3J7YJ 2LKPA 2OTLI 1JT6A 3GTGJ 4YRVA 1BW5A 1IRZA 3EDPA 1TBXA 1TT0A 3R61A 2JRMA 3J7ZI 4N0BA 3OIQA 4XLNF 4B8XA 1D5YA 3O8HA 3DCFA 3ZMZA 1ETVA 5BPDA 2VQGA 4UNOA 2PMUA 2ZXHA 3A03A 2VJ5A 5IYCJ 1YYVA 3H0DA 3FXQA 2HYGD 3GTMJ 2EZKA 1HW5A 3DXJF 4BDZA 3PFIA 5CVVA 3L2CA 6PAXA 2OV7A 1MJAA 2W25A 1IN6A 3EUHA 3Q9SA 4MQVA 3ZMVA 5EYRA 2E2HJ 3K2AA 3WTYC 2HOTA 3KZIC 5IYDJ 3HGGA 2QSHX 1YIJI 1KU7A 3JSPA 4DBRA 3KIOA 5DD8A 3HOWJ 1A35A 4P9FA 3LQQA 4MFEA 5IT3A 2H6BA 2V9VA 1AKHA 1G2HA 4FX4A 3FX3A 3BG9A 1JKRC 1YW9A 4BXXJ 2BY3A 3CUQA 5HLGA 1YS6A 2EZHA 4BBSJ 4GYIA 3S8PA 1NK3P 2V1XA 5J4VA 1TC3C 1CQTA 4KN4X 2ZXJA 5ILVA 4ZDPA 5LHIA 1I5ZA 1RR8C 3AG2H 3U2RA 2OCCH 4QTRA 4BU2A 3FMQA 3FKJA 2VBYA 5DEQA 5EEHA 3DQVC 4HF1A 2JSPA 1DUXC 5JI6A 5CVUA 1QHGA 3K1PA 4HZFA 3VOEA 1A36A 3S1NJ 1D8JA 4CCJA 2QSFX 3MKLA 3ZP5A 3FKIJ 3AL0B 2K9SA 1W4MA 3S32A 3SEQA 2DW4A 2L2OA 1UMQA 2QKMB 5GPCA 1BJAA 2QM3A 1DU6A 3ASOH 4UUSA 2FMLA 2OQRA 3R6SA 4QLCU 4XQFA 2QLZA 4KICA 2VXDA 3EUHC 3AAFA 1AKHB 2O8XA 3IAS2 4Y13A 3ZQGA 3A02A 3LAPA 1MSEC 4XK4A 3AL0C 4CXFA 5K1YA 2DLLA 3CUQB 2YS9A 2HEOA 1Y39A 4AM3A 1CF7A 2F5VA 2VC1A 1V5EA 3M07A 4ZC3A 4AYBN 1MIJA 1V3FA 2VKVA 2ZNZA 4EVIA 3ASNH 2R92J 1RC9A 1WHUA 4Y52J 2KT0A 2KISA 2GZWA 2XASA 3OL3A 4GRIA 3I55I 3A0BC 2DO7A 3BG6A 4ZZDA 5HODA 3SFIA 3M1EA
chains in the Genus database with same CATH topology
4A69C 3WHCA 1X58A 1E3OC 1YRNB 1QRYA 2E19A 4I6ZA 5C4JJ 1W0TA 3HDDA 1ETKA 3VPRA 2IAIA 2Y30A 2NS8A 4QIWN 3TW7A 1O4XA 2WAQN 3Q3SA 2DA6A 1MNMC 2CU7A 1GVDA 2HOSA 3S2HJ 4IHWA 1ENHA 3I4MJ 2DMPA 1FIPA 3TP0A 2PMZN 3NARA 3ZQIA 4BY7J 3QPSA 1ITYA 2ID6A 3IH3A 3SJMA 1I50J 1FEXA 2L0KA 3ZOBA 5E3NA 2KDZA 1WH7A 2Y31A 1TWFJ 1ZK8A 3S2DJ 1P7IA 3UKGA 5FKLA 4AC0A 2IBDA 5F0CA 2W48A 3GTQJ 1K83J 3M4OJ 2YUSA 2G0EA 2XB0X 5E3MA 2K9QA 2GLOA 2HOAA 4XRSG 3OSFA 3CMYA 2EZIA 1OCPA 4XIDA 1UHSA 4S0HB 3I4NJ 5K7ZA 3JRIA 3BTCA 3PM1A 3LSRA 1MBHA 1UG2A 5E3OA 2LY9A 1U78A 4M6VA 5J1RA 1AHDP 3BT9A 1JTXA 5K7FA 3S15J 3FIWA 3SDGA 1QVUA 1Y1VJ 5F04A 1XS9A 5FLVA 1JJ8C 4UUTA 3HOXJ 1IUFA 2AO9A 2R5YA 1GDTA 2OF7A 2JA7J 5J1UA 2M8GX 2XB5A 1WPKA 3HEFA 5FJ8J 4C2MJ 3K7AJ 1ETYA 3WHBA 4M3FA 3W6VA 3H3VK 4D7NA 3G1OA 1APLC 1QVTA 2CQQA 4LOCA 2MG4A 4EEFG 3G1LA 2FD5A 2DMQA 2HDDA 3M3YJ 4C3IJ 1MBEA 1WGXA 2VPRA 4HNVA 3ZQCA 5IP7J 2EBIA 2CRGA 2X48A 2ECBA 3OSGA 2O7OA 3BTIA 2E1OA 1ZR4A 5GPAA 3PO3J 1RESA 4MO7A 1XG1A 2L9RA 5FKOA 2L7MP 1ETXA 1T56A 2VI6A 2R5YB 2DMTA 5E3LA 2NVQJ 1ZTRA 3HOUJ 1HDDC 3RQIA 1FTTA 2OPTA 3BG5A 4DZJA 1F43A 4GFBA 5JLWA 2JA6J 4W1UA 4JX4A 2XPUA 1ETWA 3TW6A 1TWAJ 1JKQC 2ELKA 2M34A 5F27A 2R5ZA 4M3BA 3BQZA 1FJLA 1Z0XA 2JJ7A 2LTPA 1JUSA 3HOVJ 3JRGA 2XPVA 1BJZA 3BR0A 2EZLA 2DA7A 2B63J 2DJNA 1WCMJ 1BA5A 1I6HJ 1K61A 3S16J 5IYBJ 1OJLA 1ZKGA 1X2MA 2XGDA 2NVTJ 5C4XJ 1ZQ3P 5EZHA 3LNQA 4B3AA 1Y1WJ 4AUXA 1OFCX 2CJJA 2GM4A 2CUEA 2EH3A 2R7ZJ 3RKQA 1MBGA 1MBJA 2LFBA 2DN0A 2EQRA 1RKWA 3GBGA 2FX0A 1A6IA 3BTJA 3CCYA 1U8BA 1PUFA 1RETA 1S7EA 3S1RJ 4A93J 1HCRA 1H8AC 1HOMA 1MBKA 1XC5A 4FCYA 5C3EJ 3HKZN 3Q0UA 2ID3A 4QSHA 2LKXA 2TRTA 1JKOC 4A3LJ 2DA1A 3FISA 5IP9J 2R5ZB 3ZQHA 1GT0C 3QPLA 4BY1J 5F1JA 2HYJA 1ETOA 1BL0A 4V2GA 3C2BA 1BW6A 3JRCA 2JMWA 2N8GA 1IDYA 3MVPA 3Q0VA 4M3EA 4Y7NJ 4D5FA 2H8RA 3BR2A 1GUUA 1ZR2A 2MW8A 4A3IJ 1ORKA 1VI0A 2R93J 1H88C 5K7HA 1LFUP 4X1EA 5IPAA 2JK3A 2Y2ZA 2Y9YA 5JLXA 4C3HJ 3QQAA 3D1NI 1JTYA 1IJWC 2I10A 4G12A 2AHQA 5IOZA 1I3QJ 2NVXJ 4NDLA 4IEJA 5FKKA 3LSPA 1IV6A 2Y9ZA 1MSFC 3GTLJ 1PUFB 3DEWA 4I76A 3BR1A 1JJ6C 1JGGA 2L7ZA 3B6AA 1F36A 1IGNA 3RZDJ 2MSYA 4FTHA 3JRDA 1JKPC 1RPWA 1TWCJ 3BR6A 1U9NA 5EF6A 3JR9A 1HF0A 2P81A 1POGA 5F0FA 4A3FJ 2M2EA 5J3LA 1RR7A 3H0GJ 2NVYJ 3ZQLA 2FJ1A 5EZGA 4IHXA 5FLMJ 3G1MA 1A5JA 1GV5A 2XSDC 1R9TJ 4DYCA 3MN2A 1B8IA 1X2NA 1Z77A 1ZGWA 4ABZA 1JUPA 2COBA 3S1QJ 4A3GJ 1ETQA 2YU9J 1NTCA 3OIOA 1QPIA 3HB9A 4DYRA 4A3JJ 2X9DA 3BG3A 3LSGA 4FISA 4A3KJ 2GBYA 2WB1N 2XGCA 4C3JJ 2NS7A 4L5EA 1TWHJ 3JREA 5M3FJ 2O9LA 2DMUA 1OCTC 1WH5A 2JWTA 4JX5A 3IH4A 2DTZA 3FK6A 5M3MJ 1SANA 5EEAA 2LD5A 3IH2A 3BQYA 3E7LA 4DW6A 2QF7A 2E2IJ 1T33A 4JX6A 3L1PA 1AU7A 4MLOA 4D7MA 5C44J 3ZQFA 1MH3A 2R0QC 2DA5A 3Q0WA 2ME6A 1IC8A 5EG0B 3GTKJ 1JUMA 1VFCA 1GV2A 3LSJA 4MFDA 9ANTA 2M9HA 1VNDA 2O8KA 2VUMJ 2JA8J 1B8IB 4JYKA 4XICA 1U9OA 5F08A 2XGEA 3HGYA 2LVSA 2JN6A 1HLVA 3HBLA 1RKTA 4RDUA 4V2FA 4UUSB 4BBRJ 5J1YA 3PO2J 2QCOA 1MBFA 1B72B 3GTPJ 5EGOA 4BKXA 1NK2P 3OOUA 5IOYA 3GTGJ 1JT6A 5DS9A 4A3CJ 5F0HA 1BW5A 1IRZA 2TCTA 3B6CA 5GP9A 4CYCA 4D5CA 1D5YA 1SFOJ 3IV5A 3O8HA 2CUFA 3DCFA 1ETVA 4M3DA 4W97A 2X6OA 3TEDA 3BR5A 3A03A 4A3EJ 5IYCJ 3S14J 4FE7A 3HM5A 2EZKA 3BTLA 3LOCA 3GTMJ 1EF4A 3A01A 1IG7A 2E2HJ 5EYRA 2E2JJ 3K2AA 2HOTA 5IYDJ 3HGGA 4M3GA 4DZPA 1W0UA 3HOZJ 1DU0A 3NAUA 1Q1VA 2VKEA 5M5XJ 4B4CA 3HOWJ 2DA2A 3JRFA 4A3DJ 5EDNA 4MFEA 3CQZJ 1LE8A 1IDZA 3RZOJ 1AKHA 2K40A 1G2HA 3S17J 2IEKA 3BG9A 1JKRC 2HXOA 4BXXJ 2LLKA 1MH4A 3GTJJ 3CDLA 2ECCA 2EZHA 3O8GA 4BBSJ 4XRMA 1NK3P 5EGOB 1TC3C 1VF9A 1CQTA 5FKMA 5IP6A 4A3BJ 4RBOA 2K9NA 2DMNA 4CYCB 4QTRA 2RAEA 2HI3A 3S1MJ 2H1KA 5EG0A 1YRNA 2JA5J 3JRAA 2LR8A 2HQ5A 1FTZA 5BNGA 4B1RA 3HOYJ 5FKNA 1P7JA 4XRSA 3A01B 4MIMA 3S1NJ 4J19A 2FQ4A 3MKLA 3FKIJ 2DA3A 2MGQA 4X6AJ 2K9SA 2LK2A 1JT0A 5GPCA 1DU6A 1UMQA 2ME0A 4UUSA 2D5VA 4IHVA 2XRLA 2XPWA 1LE8B 1TWGJ 3JRBA 1HDPA 4DYQA 2NOGA 2CQXA 3F0CA 1AKHB 1B72A 3JRHA 5M5YJ 3FK7A 3ZQGA 3A02A 1MSEC 1LFBA 4XK4A 1H89C 2YS9A 1WI3A 2M0CA 4JP0A 5DTDA 4AYBN 2Y0SN 2VKVA 5M5WJ 2R92J 1FIAA 4A3MJ 2ZB9A 2DA4A 2LP0A 2KT0A 3BR3A 2HXIA 4Y52J 4FE4A 2L7FP 3TP3A 2WV1A 5HODA 3GTOJ 3SFIA 4IHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A69 C;  3WHC A;  1X58 A;  1E3O C;  1YRN B;  1QRY A;  2E19 A;  4I6Z A;  5C4J J;  1W0T A;  3HDD A;  1ETK A;  3VPR A;  2IAI A;  2Y30 A;  2NS8 A;  4QIW N;  3TW7 A;  1O4X A;  2WAQ N;  3Q3S A;  2DA6 A;  1MNM C;  2CU7 A;  1GVD A;  2HOS A;  3S2H J;  4IHW A;  1ENH A;  3I4M J;  2DMP A;  1FIP A;  3TP0 A;  2PMZ N;  3NAR A;  3ZQI A;  4BY7 J;  3QPS A;  1ITY A;  2ID6 A;  3IH3 A;  3SJM A;  1I50 J;  1FEX A;  2L0K A;  3ZOB A;  5E3N A;  2KDZ A;  1WH7 A;  2Y31 A;  1TWF J;  1ZK8 A;  3S2D J;  1P7I A;  3UKG A;  5FKL A;  4AC0 A;  2IBD A;  5F0C A;  2W48 A;  3GTQ J;  1K83 J;  3M4O J;  2YUS A;  2G0E A;  2XB0 X;  5E3M A;  2K9Q A;  2GLO A;  2HOA A;  4XRS G;  3OSF A;  3CMY A;  2EZI A;  1OCP A;  4XID A;  1UHS A;  4S0H B;  3I4N J;  5K7Z A;  3JRI A;  3BTC A;  3PM1 A;  3LSR A;  1MBH A;  1UG2 A;  5E3O A;  2LY9 A;  1U78 A;  4M6V A;  5J1R A;  1AHD P;  3BT9 A;  1JTX A;  5K7F A;  3S15 J;  3FIW A;  3SDG A;  1QVU A;  1Y1V J;  5F04 A;  1XS9 A;  5FLV A;  1JJ8 C;  4UUT A;  3HOX J;  1IUF A;  2AO9 A;  2R5Y A;  1GDT A;  2OF7 A;  2JA7 J;  5J1U A;  2M8G X;  2XB5 A;  1WPK A;  3HEF A;  5FJ8 J;  4C2M J;  3K7A J;  1ETY A;  3WHB A;  4M3F A;  3W6V A;  3H3V K;  4D7N A;  3G1O A;  1APL C;  1QVT A;  2CQQ A;  4LOC A;  2MG4 A;  4EEF G;  3G1L A;  2FD5 A;  2DMQ A;  2HDD A;  3M3Y J;  4C3I J;  1MBE A;  1WGX A;  2VPR A;  4HNV A;  3ZQC A;  5IP7 J;  2EBI A;  2CRG A;  2X48 A;  2ECB A;  3OSG A;  2O7O A;  3BTI A;  2E1O A;  1ZR4 A;  5GPA A;  3PO3 J;  1RES A;  4MO7 A;  1XG1 A;  2L9R A;  5FKO A;  2L7M P;  1ETX A;  1T56 A;  2VI6 A;  2R5Y B;  2DMT A;  5E3L A;  2NVQ J;  1ZTR A;  3HOU J;  1HDD C;  3RQI A;  1FTT A;  2OPT A;  3BG5 A;  4DZJ A;  1F43 A;  4GFB A;  5JLW A;  2JA6 J;  4W1U A;  4JX4 A;  2XPU A;  1ETW A;  3TW6 A;  1TWA J;  1JKQ C;  2ELK A;  2M34 A;  5F27 A;  2R5Z A;  4M3B A;  3BQZ A;  1FJL A;  1Z0X A;  2JJ7 A;  2LTP A;  1JUS A;  3HOV J;  3JRG A;  2XPV A;  1BJZ A;  3BR0 A;  2EZL A;  2DA7 A;  2B63 J;  2DJN A;  1WCM J;  1BA5 A;  1I6H J;  1K61 A;  3S16 J;  5IYB J;  1OJL A;  1ZKG A;  1X2M A;  2XGD A;  2NVT J;  5C4X J;  1ZQ3 P;  5EZH A;  3LNQ A;  4B3A A;  1Y1W J;  4AUX A;  1OFC X;  2CJJ A;  2GM4 A;  2CUE A;  2EH3 A;  2R7Z J;  3RKQ A;  1MBG A;  1MBJ A;  2LFB A;  2DN0 A;  2EQR A;  1RKW A;  3GBG A;  2FX0 A;  1A6I A;  3BTJ A;  3CCY A;  1U8B A;  1PUF A;  1RET A;  1S7E A;  3S1R J;  4A93 J;  1HCR A;  1H8A C;  1HOM A;  1MBK A;  1XC5 A;  4FCY A;  5C3E J;  3HKZ N;  3Q0U A;  2ID3 A;  4QSH A;  2LKX A;  2TRT A;  1JKO C;  4A3L J;  2DA1 A;  3FIS A;  5IP9 J;  2R5Z B;  3ZQH A;  1GT0 C;  3QPL A;  4BY1 J;  5F1J A;  2HYJ A;  1ETO A;  1BL0 A;  4V2G A;  3C2B A;  1BW6 A;  3JRC A;  2JMW A;  2N8G A;  1IDY A;  3MVP A;  3Q0V A;  4M3E A;  4Y7N J;  4D5F A;  2H8R A;  3BR2 A;  1GUU A;  1ZR2 A;  2MW8 A;  4A3I J;  1ORK A;  1VI0 A;  2R93 J;  1H88 C;  5K7H A;  1LFU P;  4X1E A;  5IPA A;  2JK3 A;  2Y2Z A;  2Y9Y A;  5JLX A;  4C3H J;  3QQA A;  3D1N I;  1JTY A;  1IJW C;  2I10 A;  4G12 A;  2AHQ A;  5IOZ A;  1I3Q J;  2NVX J;  4NDL A;  4IEJ A;  5FKK A;  3LSP A;  1IV6 A;  2Y9Z A;  1MSF C;  3GTL J;  1PUF B;  3DEW A;  4I76 A;  3BR1 A;  1JJ6 C;  1JGG A;  2L7Z A;  3B6A A;  1F36 A;  1IGN A;  3RZD J;  2MSY A;  4FTH A;  3JRD A;  1JKP C;  1RPW A;  1TWC J;  3BR6 A;  1U9N A;  5EF6 A;  3JR9 A;  1HF0 A;  2P81 A;  1POG A;  5F0F A;  4A3F J;  2M2E A;  5J3L A;  1RR7 A;  3H0G J;  2NVY J;  3ZQL A;  2FJ1 A;  5EZG A;  4IHX A;  5FLM J;  3G1M A;  1A5J A;  1GV5 A;  2XSD C;  1R9T J;  4DYC A;  3MN2 A;  1B8I A;  1X2N A;  1Z77 A;  1ZGW A;  4ABZ A;  1JUP A;  2COB A;  3S1Q J;  4A3G J;  1ETQ A;  2YU9 J;  1NTC A;  3OIO A;  1QPI A;  3HB9 A;  4DYR A;  4A3J J;  2X9D A;  3BG3 A;  3LSG A;  4FIS A;  4A3K J;  2GBY A;  2WB1 N;  2XGC A;  4C3J J;  2NS7 A;  4L5E A;  1TWH J;  3JRE A;  5M3F J;  2O9L A;  2DMU A;  1OCT C;  1WH5 A;  2JWT A;  4JX5 A;  3IH4 A;  2DTZ A;  3FK6 A;  5M3M J;  1SAN A;  5EEA A;  2LD5 A;  3IH2 A;  3BQY A;  3E7L A;  4DW6 A;  2QF7 A;  2E2I J;  1T33 A;  4JX6 A;  3L1P A;  1AU7 A;  4MLO A;  4D7M A;  5C44 J;  3ZQF A;  1MH3 A;  2R0Q C;  2DA5 A;  3Q0W A;  2ME6 A;  1IC8 A;  5EG0 B;  3GTK J;  1JUM A;  1VFC A;  1GV2 A;  3LSJ A;  4MFD A;  9ANT A;  2M9H A;  1VND A;  2O8K A;  2VUM J;  2JA8 J;  1B8I B;  4JYK A;  4XIC A;  1U9O A;  5F08 A;  2XGE A;  3HGY A;  2LVS A;  2JN6 A;  1HLV A;  3HBL A;  1RKT A;  4RDU A;  4V2F A;  4UUS B;  4BBR J;  5J1Y A;  3PO2 J;  2QCO A;  1MBF A;  1B72 B;  3GTP J;  5EGO A;  4BKX A;  1NK2 P;  3OOU A;  5IOY A;  3GTG J;  1JT6 A;  5DS9 A;  4A3C J;  5F0H A;  1BW5 A;  1IRZ A;  2TCT A;  3B6C A;  5GP9 A;  4CYC A;  4D5C A;  1D5Y A;  1SFO J;  3IV5 A;  3O8H A;  2CUF A;  3DCF A;  1ETV A;  4M3D A;  4W97 A;  2X6O A;  3TED A;  3BR5 A;  3A03 A;  4A3E J;  5IYC J;  3S14 J;  4FE7 A;  3HM5 A;  2EZK A;  3BTL A;  3LOC A;  3GTM J;  1EF4 A;  3A01 A;  1IG7 A;  2E2H J;  5EYR A;  2E2J J;  3K2A A;  2HOT A;  5IYD J;  3HGG A;  4M3G A;  4DZP A;  1W0U A;  3HOZ J;  1DU0 A;  3NAU A;  1Q1V A;  2VKE A;  5M5X J;  4B4C A;  3HOW J;  2DA2 A;  3JRF A;  4A3D J;  5EDN A;  4MFE A;  3CQZ J;  1LE8 A;  1IDZ A;  3RZO J;  1AKH A;  2K40 A;  1G2H A;  3S17 J;  2IEK A;  3BG9 A;  1JKR C;  2HXO A;  4BXX J;  2LLK A;  1MH4 A;  3GTJ J;  3CDL A;  2ECC A;  2EZH A;  3O8G A;  4BBS J;  4XRM A;  1NK3 P;  5EGO B;  1TC3 C;  1VF9 A;  1CQT A;  5FKM A;  5IP6 A;  4A3B J;  4RBO A;  2K9N A;  2DMN A;  4CYC B;  4QTR A;  2RAE A;  2HI3 A;  3S1M J;  2H1K A;  5EG0 A;  1YRN A;  2JA5 J;  3JRA A;  2LR8 A;  2HQ5 A;  1FTZ A;  5BNG A;  4B1R A;  3HOY J;  5FKN A;  1P7J A;  4XRS A;  3A01 B;  4MIM A;  3S1N J;  4J19 A;  2FQ4 A;  3MKL A;  3FKI J;  2DA3 A;  2MGQ A;  4X6A J;  2K9S A;  2LK2 A;  1JT0 A;  5GPC A;  1DU6 A;  1UMQ A;  2ME0 A;  4UUS A;  2D5V A;  4IHV A;  2XRL A;  2XPW A;  1LE8 B;  1TWG J;  3JRB A;  1HDP A;  4DYQ A;  2NOG A;  2CQX A;  3F0C A;  1AKH B;  1B72 A;  3JRH A;  5M5Y J;  3FK7 A;  3ZQG A;  3A02 A;  1MSE C;  1LFB A;  4XK4 A;  1H89 C;  2YS9 A;  1WI3 A;  2M0C A;  4JP0 A;  5DTD A;  4AYB N;  2Y0S N;  2VKV A;  5M5W J;  2R92 J;  1FIA A;  4A3M J;  2ZB9 A;  2DA4 A;  2LP0 A;  2KT0 A;  3BR3 A;  2HXI A;  4Y52 J;  4FE4 A;  2L7F P;  3TP3 A;  2WV1 A;  5HOD A;  3GTO J;  3SFI A;  4IHY A; 
#chains in the Genus database with same CATH topology
 3J80 K;  2E36 A;  3K70 C;  1S29 A;  4A6E A;  1UHM A;  3GME A;  2O61 A;  5C4J J;  2X4H A;  2WAQ A;  1W7P B;  3V42 A;  1ACI A;  1VQP I;  3Q3S A;  1GVD A;  1XGN A;  5FD5 A;  2E34 A;  1IRX A;  1YIT I;  3TDZ C;  5HS7 A;  4HX8 A;  2GXG A;  3DPL C;  3LSM A;  1FSH A;  4YFX F;  3K4C A;  3IWF A;  3F6V A;  3IKT A;  3WGI A;  1W36 C;  2CUJ A;  3NAR A;  3WGH A;  2JVG A;  3CLO A;  3SJM A;  1I50 J;  2L0K A;  4EJV A;  2XAH A;  1TWF J;  1ZK8 A;  3KP6 A;  3LQR A;  5FKL A;  4M71 A;  1NHA A;  1I3A A;  5L3C A;  4A6D A;  5CPR B;  3R0A A;  4DOZ A;  4L9V A;  5CLS A;  1CF7 B;  1OCC H;  3ZXS A;  3WGG A;  1ZEL A;  3HG9 A;  3KP5 A;  4D9J A;  1X1A A;  1PVE A;  3ZCO A;  1R1U A;  5E3M A;  3L2V A;  3RKW A;  2KPM A;  4F92 B;  3F9K A;  2NXN B;  3V8J A;  1BBY A;  3SDB A;  3OR2 C;  4G6D A;  3O6B B;  1XX5 A;  3LSR A;  2PFB A;  5E3O A;  1SVM A;  1YJN I;  3NQO A;  4FHT A;  2WWY A;  5TRD A;  1S3J A;  3S15 J;  2GQQ A;  1X1P A;  2V1N A;  2YR2 A;  3GX4 X;  5F04 A;  1O3T A;  1G8X A;  1R00 A;  3DBH B;  1SD4 A;  1F4K A;  4C2T A;  4UUT A;  2VT3 A;  5FFX A;  2ELJ A;  3BPV A;  2JA7 J;  2Q0O A;  5J1U A;  4II2 A;  2Q8K A;  2XB5 A;  1WPK A;  3HEF A;  5IT9 K;  3GZN B;  1Q1H A;  4D7N A;  2HWV A;  2EV6 A;  1OIS A;  4G7Z F;  4LOC A;  5F64 A;  2VLA A;  2DK8 A;  4EEF G;  3G1L A;  4DIQ A;  4IHS A;  2DMQ A;  4ANJ A;  1OYW A;  2HDD A;  5TIS C;  5D6E A;  5FB2 A;  3AG4 H;  1WGX A;  2DT5 A;  3E97 A;  1SEU A;  2F5F A;  4BUP A;  3F22 A;  4KIF A;  2EBI A;  2VBX A;  1X4O A;  1KYW A;  1M1E B;  4NBQ A;  1ZR4 A;  4BXF A;  2WTE A;  2JSC A;  4GXO A;  4RLQ A;  2FUG 2;  2L9R A;  1TQM A;  3KP7 A;  4IQJ A;  3TOA A;  4XKV A;  4AYB A;  1MND A;  2UZK A;  3OYH A;  1T56 A;  4MHG A;  4KIT B;  3VFZ A;  1Z7L A;  1FYM A;  4EM0 B;  5DDG A;  4BNC A;  1HDD C;  3RQI A;  3BG5 A;  2CQK A;  4DZJ A;  1F43 A;  3V7S A;  2LBF A;  2K85 A;  3DF8 A;  3FXU A;  2HR3 A;  5H20 A;  4W1U A;  4JX4 A;  1ETW A;  3M8E A;  3FXL A;  3PQJ A;  3C7J A;  3LMM A;  4ZYA A;  1Z3Y A;  2PG4 A;  1TWA J;  2QWW A;  1JKQ C;  2ELK A;  4YEJ A;  5F27 A;  1K79 A;  2R5Z A;  1VQ4 I;  1Z0X A;  3D5R C;  2LY1 A;  1R4N B;  1N75 A;  1I27 A;  2B63 J;  1X3W B;  3VSL A;  2XKO A;  1BA5 A;  4NB5 A;  3HPH A;  5K5Q A;  3IKV A;  3RQ4 A;  5C4X J;  1X2M A;  2R7Q A;  2XGD A;  4I09 A;  4M72 A;  5DV5 A;  1K78 A;  4XM3 A;  2DTR A;  1YS7 A;  3FM3 A;  2A6T A;  3LNQ A;  2UV1 A;  1K6O A;  3DWL E;  1YI2 I;  4YFK F;  4L5I A;  4PGG A;  3LL7 A;  4AUX A;  3WU1 B;  3H5A A;  1VQO I;  4E6K G;  3SZG A;  4A2U A;  2BXY A;  4PJJ A;  1XCV A;  1MBJ A;  4AIH A;  1LUJ B;  5FFZ A;  4ZDL A;  2EQR A;  5J4Y A;  2EK5 A;  2DFI A;  5L3G A;  1MDM A;  2XF6 A;  2V6C A;  2DOA A;  3WE2 A;  1IO2 A;  4U7B A;  3F23 A;  3V4G A;  4PSX A;  3S1R J;  1ZRE A;  1T0F A;  2CUZ A;  3OV8 A;  1TL8 A;  1MBK A;  3ZRG A;  4FCY A;  3HKZ N;  2ID3 A;  2WV0 A;  2XHK A;  2TRT A;  2D1V A;  2CH0 A;  1JKO C;  3FIS A;  2R5Z B;  3KEY A;  2A61 A;  5D5X B;  4EAT A;  2CG4 A;  3RYP A;  4YIR X;  2HKX A;  5DD4 A;  3DKW A;  3PJR A;  3REO A;  1LPQ A;  2EA2 A;  3L7W A;  3OYI A;  3HTS B;  4LK0 F;  2CV0 A;  1R4M B;  4P5O A;  1BR1 A;  1BOA A;  1DPU A;  2H8R A;  1GUU A;  1K78 B;  1ORK A;  2LG4 A;  4HSR A;  1P4A A;  2BHY A;  4AU7 A;  1R58 A;  4MTD A;  1J0R A;  2QQ9 A;  4EJU A;  2JK3 A;  2Y2Z A;  4C3H J;  1KQ8 A;  2YX4 A;  3FXK A;  3ZPL A;  4UY8 I;  5B1B H;  4Z6Y A;  1LJ9 A;  3GFI A;  1I3Q J;  5FLX K;  1FY7 A;  3BJA A;  4OIR F;  5FKK A;  4C30 A;  4CSW A;  1MDM B;  1IV6 A;  3HIF A;  1JGG A;  3B6A A;  3HXL A;  1QHH D;  3L2U A;  1TWC J;  3MZ8 A;  2BGC A;  2F5C A;  2R7O A;  3JR9 A;  2GIZ A;  4CCO A;  5K5R A;  1HF0 A;  2P81 A;  1DGW Y;  2FEZ A;  1POG A;  2UXN A;  2V26 A;  5HS8 A;  3PNY A;  1HW1 A;  3F21 A;  1ZRC A;  5KAI C;  1S7A A;  2FJ1 A;  5EZG A;  4IHX A;  1VTN C;  1BI3 A;  2QVO A;  3RKX A;  4AVP A;  2KIQ A;  2OCE A;  2XSJ C;  4DYC A;  1Z77 A;  5HS9 A;  3TO7 A;  4ABZ A;  2COB A;  4MEX F;  1T98 A;  4A3G J;  4DYR A;  3Q5F A;  3BG3 A;  2V6E A;  3K69 A;  4A3K J;  4MNU A;  1MZB A;  1DGR M;  1K7A A;  1LVK A;  3EQL F;  1YX3 A;  3K9T A;  4L5E A;  2M7A A;  2K5C A;  2KP6 A;  1JE8 A;  1WH5 A;  2AS5 F;  3IH4 A;  2DTZ A;  1V5F A;  5E1X A;  4H0E A;  1YQA A;  3BQY A;  2VKD A;  1T33 A;  1XGO A;  3K4K A;  2HOE A;  4CDG A;  4D7M A;  4Q48 A;  2R0Q C;  2H1L A;  5KNL A;  2YX7 A;  2FNA A;  5B1A H;  1R6R A;  2QUF A;  3GTK J;  3FF5 A;  4Q47 A;  5D4S A;  2VUM J;  2LOO A;  4U7D A;  3WTU C;  3GXO A;  4WCG A;  1IW7 F;  3F8B A;  1U6G A;  1U9O A;  4CZZ A;  3G73 A;  4OU0 A;  4NUB A;  1OYI A;  1P4X A;  3H5R A;  4XLA A;  5D5V B;  5D5W B;  4HAM A;  3PIP F;  1BIA A;  4FX0 A;  3HRT A;  1MBF A;  1B72 B;  3HKZ A;  1K6Y A;  4P55 A;  3BJO A;  3F8M A;  3IP4 B;  4BKX A;  4KA4 A;  1HST A;  1YHQ I;  3AG1 H;  1V4R A;  3CMA I;  2K4B A;  2TCT A;  2P6S A;  1VQ8 I;  2V9K A;  4OOI A;  1ZN2 A;  2Z1D A;  3B6C A;  2P7C B;  4D5C A;  2CUF A;  4M3D A;  5A2Q Z;  1ON2 A;  2M1B A;  3S14 J;  3WU2 C;  3WOD F;  2LF8 A;  4KMU X;  1A31 A;  3WTZ A;  4FE7 A;  3JCU C;  3R60 A;  2Z99 A;  3BWG A;  3C18 A;  4DZP A;  2MC4 A;  2EWN A;  3NAU A;  3BP8 A;  4XKW A;  2CW0 F;  4HF0 A;  3RPU D;  2D1H A;  2Z2S B;  2EIL H;  4XSZ F;  3JRF A;  4A3D J;  2UWM A;  2R7S A;  3I5U A;  3MFK A;  1ZRF A;  3RZO J;  4IO9 F;  4WWC A;  4E7K A;  2HXO A;  1N77 A;  2LF7 A;  2LLK A;  3HPG A;  4YG2 F;  5L3B A;  3OWT A;  4EJO A;  1L3L A;  2R7T A;  3H92 A;  4LG3 A;  2ECC A;  4CA0 A;  1WJD A;  2OZ6 A;  2FBI A;  3O8G A;  2M8E A;  3C2G A;  2KZG A;  5LGN A;  1T6S A;  5FKM A;  1KA8 A;  3ABM H;  3MWM A;  3OS1 A;  5IP6 A;  4RBO A;  3H3Z A;  2DMN A;  1RUO A;  2UXX A;  2FA5 A;  4BAY A;  3HUG A;  2CQ7 A;  5GAE J;  5HLT A;  5E20 A;  2ZXW H;  2L01 A;  4IRG A;  2JA5 J;  2EIN H;  1SFE A;  2HQ5 A;  2PI0 A;  1FTZ A;  3HOY J;  2X1C A;  1P7J A;  2L02 A;  3W6K B;  3OS2 A;  4MIM A;  2DCE A;  4J19 A;  4Q5S F;  2FQ4 A;  4KDP A;  1SAX A;  2Y0M A;  2LK2 A;  4HG2 A;  3HRU A;  3PL8 A;  4N4O B;  4I7H A;  2FXA A;  4RAY A;  1ZLJ A;  1XPX A;  2GA1 A;  3OIP A;  2CQX A;  3F0C A;  2AQE A;  3JRH A;  3FK7 A;  4HV5 A;  2Z3Y A;  1G59 A;  2RC4 A;  1G6N A;  1WI3 A;  2B0L A;  4AWX B;  2BXZ A;  3PIO F;  4IRI A;  4GDF A;  3QYF A;  5M5W J;  3RTR A;  2NRA C;  1VQK I;  2Z9O A;  5B66 C;  2VON A;  1P92 A;  2LP0 A;  4CHU A;  1ZAO A;  3CD6 I;  4OMY A;  3TP3 A;  2V9P A;  2WV1 A;  3HUG B;  1FBQ A;  2CQN A;  2Y48 A;  3J7A Y;  3CUO A;  4A69 C;  2HVQ A;  4PCQ A;  5CVJ A;  5FRO A;  2E19 A;  3HDD A;  4P1W A;  2IAI A;  5DCF A;  2ESH A;  1T38 A;  1OQY A;  2WAQ N;  2DA6 A;  2LNB A;  3K4N A;  3BY6 A;  4UV8 A;  3CCJ I;  3KP3 A;  5LHG A;  2BVM A;  5KK1 A;  1MNM C;  5D4R A;  2BZT A;  2XDV A;  3S3O A;  2HOS A;  5ICG A;  1HSJ A;  3I58 A;  3S2H J;  2ZJQ F;  4IHW A;  3L9F A;  5E18 F;  1BC8 C;  2IGM A;  1XTA A;  2DOE A;  4LG0 A;  3TP0 A;  1KGS A;  2OQG A;  3ZQI A;  2ZJ2 A;  1IN7 A;  2ID6 A;  2Y69 H;  3IH3 A;  3QP6 A;  1FEX A;  3GFL A;  5CYV A;  3ZOB A;  1LDJ A;  5E3N A;  1WH7 A;  2KDZ A;  2Y31 A;  2CWE A;  2QEN A;  1A04 A;  4ZZL A;  2Z16 A;  3FMS A;  4AC0 A;  1R5I D;  2PMH A;  2W48 A;  2A5Y B;  2M4K A;  4CH7 A;  3I71 A;  2L3D A;  1QZZ A;  2YUS A;  2G0E A;  3CLQ A;  1XMA A;  4WXC A;  3K4L A;  2OTJ I;  3OSF A;  3O2P E;  5L3E A;  2EZI A;  1JGS A;  3DEE A;  3IRR A;  4RA2 A;  1RNL A;  5GTI C;  3L00 A;  1ZGA A;  2W24 A;  4IPA A;  3CCM I;  2ZXI A;  3BC8 A;  4YEL A;  1GXP A;  2ESN A;  3WTW C;  4OIQ F;  3PM1 A;  4XL9 A;  1MBH A;  2LY9 A;  1ZG3 A;  4M6V A;  3AG3 H;  5J1R A;  1AHD P;  3QRF F;  5HVQ C;  1YFH A;  1SFU A;  3BT9 A;  5K7F A;  2KIF A;  3FIW A;  3ZMD A;  3SDG A;  1PP7 U;  1Y1V J;  4LG0 B;  2RQP A;  3H1C A;  4B47 A;  2OU2 A;  2VL8 A;  3OR1 C;  3QPH A;  4F3Q A;  4EM2 A;  2AO9 A;  2OF7 A;  4II3 A;  3Q9V A;  2M8G X;  4RGX A;  5LRS A;  3M1C A;  1MGT A;  3RPQ A;  2XRO A;  1ETY A;  3WHB A;  1G4D A;  3FXR A;  1IN4 A;  1QVT A;  4IQ4 A;  2STT A;  1TTY A;  2ZKZ A;  2EFQ A;  2FF4 A;  1FMW A;  4ON0 A;  1W7P A;  2FD5 A;  4XLC A;  4BHC A;  1R1T A;  4RB1 A;  1RRJ A;  3PUB A;  1D0Y A;  3KYL A;  3ZMT A;  1X3U A;  3ZQC A;  1EH8 A;  3CES A;  3OYC A;  2P0W A;  5IP7 J;  1NH3 A;  2RNJ A;  3JTH A;  4IVN A;  3RDI A;  5H6Q A;  2J5P A;  2X48 A;  3QP5 A;  2JT1 A;  3HC7 A;  1AOY A;  1U2W A;  3OSG A;  3OYF A;  4ESF A;  4N9H A;  2JUG A;  1VQ5 I;  2L9N A;  5JR3 A;  2JZY A;  4LJZ F;  3ERE D;  2BBY A;  4EJT A;  3R4K A;  1XB4 A;  5LHH A;  2E71 A;  4R8H A;  2Z5U A;  5HNF A;  2BYV E;  2FBK A;  2LC2 A;  3TOB A;  2R7F A;  1USS A;  2K3P A;  1ETX A;  2E35 A;  4LB6 B;  2CYY A;  2HPI A;  4OWR B;  1TQP A;  3CMM A;  3LFK A;  3MKW B;  1JXS A;  1WJA A;  5LEK A;  1E17 A;  5ILS A;  1Z05 A;  1ZTR A;  4XN0 A;  5KVR A;  2M5W A;  2R7X A;  1FTT A;  4GFB A;  5LD2 C;  1AA7 A;  3QYE A;  4L9T A;  3WTS C;  2DFH A;  2RGV A;  3MAJ A;  1QU3 A;  5HLH A;  1DP7 P;  3ELK A;  1X1C A;  1OCR H;  2M34 A;  4G9Y A;  2HTJ A;  4M3B A;  2JJ7 A;  2W85 A;  1XMK A;  1TQI A;  4BYY A;  3E6B A;  3JRG A;  5J8F A;  3BR0 A;  1WCM J;  4A5N A;  1ZLK A;  1I6H J;  3GZ5 A;  2M7B A;  1W5T A;  3S16 J;  5IYB J;  2KLO A;  1ZKG A;  3BCB A;  4PZJ A;  3I9V 2;  1ZQ3 P;  2WY8 Q;  1O7L A;  5EZH A;  4EQQ A;  4YIF A;  1I1G A;  1UB9 A;  3NWT A;  3BZ6 A;  2OC6 A;  2ZCW A;  2H09 A;  2EH3 A;  2E1N A;  3RKQ A;  1MBG A;  4M73 A;  5JFR A;  2LFB A;  1RKW A;  2IS6 A;  2FX0 A;  5JHU A;  1MMD A;  1PUF A;  4A93 J;  5E17 F;  1HOM A;  3OYD A;  3O3K A;  2PQ8 A;  5C3E J;  2P6T A;  4CZC A;  3CZ6 A;  4LD5 A;  4UXN A;  4WF2 A;  4QSH A;  3SFZ A;  4WX9 A;  5BMZ A;  1WSU A;  4ZH4 F;  2Q1Z B;  2DA1 A;  2XAU A;  4KT5 C;  3QPL A;  1ULY A;  4XN3 A;  5F1J A;  2HYJ A;  2AXL A;  1BL0 A;  1G3S A;  1VQ9 I;  4V2G A;  4BHP A;  3C2B A;  3F8F A;  4LLN A;  1BW6 A;  2JMW A;  2IW5 A;  3J81 Z;  3OY9 A;  1RUN A;  1IDY A;  3MVP A;  3Q0V A;  4CCN A;  4M3E A;  1O57 A;  1WJF A;  2IVM A;  4KUM A;  3OMY A;  4PJM A;  4AD9 A;  1Z7U A;  3T1B A;  4IOA F;  2MW8 A;  2ZNY A;  4HQM A;  4C9Y A;  3JAM K;  2IJL A;  3IUO A;  3LA2 A;  5D6F A;  3ROU A;  4DQ2 A;  2RNG A;  3TDU C;  1MMA A;  4ASN A;  1LFU P;  4I0B A;  3CP8 A;  4X1E A;  5AIQ A;  3QQA A;  3D1N I;  2RDP A;  1U3E M;  4OIN F;  1DQU A;  2I10 A;  2AQF A;  4L0Y B;  1VQN I;  4KT6 A;  2STW A;  2KMU A;  3OS0 A;  4NDL A;  4IEJ A;  2L9V A;  5GAH J;  2Y9Z A;  1PUF B;  3DEW A;  3MZY A;  2FRH A;  3BR1 A;  4I76 A;  1O3R A;  2K4J A;  3QWL A;  2IS4 A;  2L7Z A;  4TV7 A;  3I3L A;  4BE0 A;  2MSY A;  2XIG A;  4FAS D;  4FTH A;  2YPR A;  3GEZ A;  4N9I A;  1ODD A;  2E1M B;  2HS5 A;  1N78 A;  1Z9C A;  2VJ4 A;  3FXO A;  4QPQ A;  3MD2 A;  1YW8 A;  2M2E A;  5J3L A;  5LRR A;  4RGR A;  3KP4 A;  2DAO A;  2NVY J;  2JA2 A;  2QQ8 A;  2E1M C;  2EIK H;  2M0M A;  3DTE A;  5BQT A;  4RB0 A;  4BQN A;  1B8I A;  2X85 A;  1V5G A;  4UVA A;  1ZGW A;  1JUP A;  3BCA A;  2BHZ A;  1UG0 A;  2VBZ A;  2YU9 J;  3HB9 A;  4BXU A;  2ZO4 A;  3LSH A;  4G6T B;  3HHG A;  2X6Y A;  2GBY A;  2WB1 N;  2XGC A;  4FIS A;  3COA C;  1IRF A;  1O3Q A;  3PSF A;  2ZJR F;  4ESB A;  4HDU A;  2DYS H;  1BC7 C;  2CGP A;  1TWH J;  2PBI A;  4LIU A;  1IN8 A;  4PJ0 C;  4ZYH A;  1Z21 A;  2JWT A;  4JX5 A;  4IZZ A;  5M3M J;  1X3Z B;  4G6Q A;  2DU9 A;  3HRS A;  1SAN A;  5EEA A;  4EGY A;  1N25 A;  4UV9 A;  3ECH A;  3KYD B;  2LY2 A;  4DW6 A;  2BEO A;  3T8T A;  3CTA A;  3K4M A;  3JAM Z;  1YIO A;  3CP2 A;  3U1K A;  4L0Z B;  5GTH C;  2R3S A;  4MLO A;  2PN6 A;  4CIC A;  2DA5 A;  2VC0 A;  3DTK A;  2ME6 A;  3C2H A;  2OAZ A;  2CO5 A;  5EG0 B;  1G3W A;  1WJB A;  3HOS A;  1JUM A;  1VFC A;  4MFD A;  3GLX A;  1FBS A;  1XMX A;  5JHF A;  2ADU A;  2GA2 A;  2W4S A;  3HHH A;  2QKL B;  1B8I B;  3H3U A;  1R23 A;  2JPB A;  2LVS A;  2H8W A;  5CVI A;  4PGH A;  3R0J A;  4ZTF A;  2NNY A;  3LFU A;  1CGP A;  2K86 A;  1HKS A;  2FU4 A;  2KJC A;  3GTP J;  4PDK A;  5HDG A;  3HRM A;  1ZG5 A;  1SVO A;  3QOP A;  2ZME A;  5GAG J;  4A3C J;  5F0H A;  3FXM A;  1Z1D A;  4RS8 A;  3ZN1 A;  4IF4 A;  1FSE A;  4CYC A;  2CW7 A;  1XSD A;  4RMN A;  4XKC A;  1SFO J;  4XNF A;  5DYM A;  1HXD A;  2MFZ A;  3MCZ A;  2X6O A;  2DDB A;  3LSI A;  3TED A;  5K5O A;  4HPQ A;  4UVB A;  4A3E J;  1UAA A;  3B02 A;  2WA0 A;  1YO5 C;  3CC4 I;  2A6H F;  3HM5 A;  1EF4 A;  3LOC A;  4G8X A;  3M8J A;  1PUE E;  3A01 A;  1IG7 A;  1E2X A;  2P5L C;  2E2J J;  1LKX A;  3F6O A;  4M3G A;  1W0U A;  3HOZ J;  3ML6 A;  1DU0 A;  2LRE A;  2UUZ A;  3MZH A;  1FOW A;  1Q1V A;  5M5X J;  4I98 B;  2K3F A;  2HVR A;  4R1H A;  5EDN A;  3CQZ J;  2VT2 A;  1LE8 A;  1IDZ A;  3PNT A;  4ENM A;  2ZSI B;  1P4W A;  5ICF A;  3VYR B;  2CV1 A;  3S17 J;  2IEK A;  2J5O A;  5E8G A;  4HV6 A;  3P5J A;  1MH4 A;  2X51 A;  2LKS A;  4B09 A;  2WAD A;  2CFO A;  4B43 A;  4ZYD A;  3NRV A;  2R7R A;  2HGC A;  2ZME B;  2KRC A;  3JW4 A;  1T08 B;  1E3P A;  1WZ2 A;  1U5T B;  4CYC B;  1JHF A;  1HKQ A;  1HQC A;  2HI3 A;  2A07 F;  1B6A A;  1OPC A;  3S3M A;  2A68 F;  2O0Y A;  2H1K A;  1YRN A;  2JQ7 A;  3S1M J;  1OKR A;  3BPX A;  2ZME C;  1B9N A;  4C2U A;  4ZYE A;  5BNG A;  1MMG A;  3M7G A;  2X6W A;  4PUS A;  1LEB A;  4OAY A;  3A01 B;  1U5T C;  1XDS A;  4OAZ A;  2DPD A;  5E8I A;  5A2Q K;  2O6G E;  5E1W A;  2DA3 A;  4X6A J;  3VYT B;  2VAS A;  2WB1 A;  1OYY A;  4JOM A;  4IHV A;  1TW3 A;  2XRL A;  1FYL A;  2RVC A;  2XPW A;  4EJW A;  1LE8 B;  1HDP A;  2NOG A;  1B72 A;  5M5Y J;  2E5N A;  2MAB A;  4KMF A;  5ICC A;  4XON A;  3W2W A;  1J2X A;  4BAC A;  1LEA A;  4EV0 A;  5JVT A;  1H89 C;  1IV8 A;  4GO1 A;  4DBQ A;  4L18 B;  2HDC A;  2W82 A;  3ABL H;  1TW2 A;  2F5D A;  2O03 A;  4JP0 A;  4B3X A;  5DTD A;  4XMY A;  3IL2 A;  1FC3 A;  2HKO A;  3IHU A;  3V7C A;  2HQR A;  1XSX A;  4ZJZ A;  2VBW A;  1YJ9 I;  5D8K B;  2F2E A;  5CQG A;  2QZ8 A;  4A3M J;  2OUM A;  2ZB9 A;  1D1B A;  2V7F A;  3EYY A;  4XR6 A;  2HXI A;  2ACJ A;  2LSO A;  1OR7 A;  2AXT C;  2L7F P;  4ENJ A;  3TGN A;  1K4S A;  3D0S A;  1PJR A;  4IHY A;  2DQL A;  2PLY A;  1YRN B;  4CYD A;  3HSE A;  1W5S A;  1W0T A;  2IS1 A;  3VPR A;  1I39 A;  3HJE A;  3P9K A;  3V8K A;  2VE9 A;  2Y30 A;  2NS8 A;  1I1S A;  2VB6 A;  4QIW N;  3TW7 A;  3VYU B;  3ABK H;  2CU7 A;  2Z33 A;  4Q4Z F;  1ENH A;  2G7H A;  3FBN B;  4HYE A;  2DMP A;  3TL4 X;  3K70 D;  1LDK B;  2PMZ N;  1Y0N A;  3H5N A;  3UR3 C;  2MH2 A;  3H35 A;  3EUA A;  4BY7 J;  4E7Z A;  3MKY B;  4B48 A;  4L9N A;  3EPZ A;  2M30 A;  1P7I A;  2CMP A;  1ONV A;  3KLO A;  4I02 A;  4MGR A;  3I4P A;  2IBD A;  5F0C A;  3BDD A;  1R5G A;  3MKZ A;  3GTQ J;  3OYE A;  5DCM A;  3M4O J;  2L5Q A;  2XB0 X;  3HZJ A;  2K9Q A;  2HOA A;  2JTV A;  4XRS G;  3CMY A;  3NWS A;  1HC8 A;  3CF5 F;  1HKT A;  1OCP A;  4ESJ A;  2L4M A;  3D5L A;  4XID A;  1UHS A;  4LIT A;  4JK1 X;  2E5Z A;  3KZZ A;  5L3F A;  2HQA A;  3VOD A;  3TO6 A;  4PFP A;  4EMS A;  3BTC A;  1U78 A;  4NNJ A;  1OR7 C;  4Y33 A;  2NVU B;  4S04 A;  4UVC A;  1JTX A;  3C1D A;  2KKO A;  1Y8Q B;  1E0E A;  1QVU A;  2DI3 A;  1XS9 A;  1X4P A;  2R7W A;  1ON1 A;  2P5K A;  3TMO A;  4P96 A;  5FLV A;  4PSW A;  5B5E C;  2DYR H;  3SZP A;  3RSN A;  1QQI A;  1W5C C;  3CCS I;  1GDT A;  2EPF A;  1BIB A;  1QPM A;  1YE9 A;  4A0Z A;  2XF7 A;  2ZSH B;  2K27 A;  1Z67 A;  3E6M A;  2NS0 A;  3U21 A;  1FZP B;  4NC6 A;  3WTT C;  3K7A J;  3IC7 A;  4HW0 A;  4M3F A;  3W6V A;  3E6C C;  5DCM B;  1APL C;  3FZV A;  3GW2 A;  2EV0 A;  3E5Q A;  1D1A A;  1Z91 A;  1R5H A;  3BOQ A;  5AON A;  2VKH A;  4F91 B;  1SMY F;  4UHT A;  3MQ0 A;  4ZYG A;  3KCC A;  2ZFU A;  1XDU A;  3IAM 2;  2OBP A;  2A3S A;  1FMV A;  3DLL F;  4LIV A;  4E7H A;  2CRG A;  5GAD J;  2MH9 A;  3VEP A;  5DUK A;  3RCO A;  5LBQ A;  4BDY A;  1XGS A;  2G7U A;  1R71 A;  1AWC A;  5GPA A;  2EJR A;  1LNW A;  3PO3 J;  4ITV A;  3CO7 C;  4MTE A;  3UNG C;  1IZ1 A;  2KIM A;  2I5U A;  3PQK A;  1T39 A;  1XG1 A;  1FOK A;  1Y8R B;  4QPO A;  1ZYR F;  2MBF A;  3K6G A;  5HDN A;  2ICW G;  4UB8 C;  3VDX A;  3I54 A;  5EEG A;  1QO0 D;  2MYS A;  3M9A A;  1LVA A;  1SVL A;  4I01 A;  2BY0 A;  5E3L A;  2D45 A;  2V79 A;  4KJZ A;  2C6Y A;  2FSW A;  5E79 C;  4ZDO A;  3HSR A;  1MJB A;  4LFU A;  4BE2 A;  4MEY F;  1UJ8 A;  5CJ9 A;  2FQ3 A;  1FWZ A;  3DBR B;  2LH9 A;  1EH7 A;  4GCV A;  4BJ6 C;  3GO5 A;  4WXH A;  3N05 A;  1LB2 A;  3D5S C;  3BG7 A;  2TDX A;  4NHJ A;  1EH6 A;  3BQZ A;  1K4T A;  2LTP A;  1FJL A;  3TQN A;  3F8N A;  3WG7 H;  3HOT A;  2JPC A;  2VN2 A;  1BJZ A;  3PNV A;  1DDN A;  2DA7 A;  2PMZ A;  5D5U B;  3QPT A;  2LYC A;  4KNY A;  2XGX A;  1GHC A;  3E6D A;  1F1Z A;  1YX5 A;  3GYH X;  1K61 A;  2XUB A;  5HDK A;  2BE5 F;  1R22 A;  4U0Y A;  2VOO A;  2I8D A;  2F48 A;  1B59 A;  4L9J A;  1WWX A;  4G7H F;  1TZL A;  4HF2 A;  1MMS A;  1KZH A;  2XKP A;  4IRH A;  1WRJ A;  1OFC X;  3I59 B;  1VQM I;  4RLF A;  4E7L A;  4A0Y A;  5FRN A;  1J59 A;  1G3T A;  2EA4 A;  1OMI A;  1E3H A;  3E1S A;  4P9U A;  2R7Z J;  2RKH A;  3VB2 A;  4GGG A;  5LFA A;  1GLN A;  2DN0 A;  1BOB A;  2WC2 A;  2IGK A;  4HX7 A;  2VQH A;  3G2B A;  2Q2E A;  3GBG A;  3QOD A;  2K9L A;  5FO5 A;  1SD7 A;  4U0W A;  3F72 A;  1A6I A;  3BTJ A;  1YJW I;  1RET A;  1S7E A;  2OZU A;  2MLG A;  5EJC A;  1H0M A;  1H8A C;  1KQ0 A;  4M6X A;  3ZMU A;  2IS2 A;  4O5V A;  3SZT A;  3T5X A;  5HNH A;  5BS6 A;  1S9H A;  2ETH A;  5H2F C;  2LKX A;  3CCR I;  3RI4 A;  5IP9 J;  1B9M A;  3ZQH A;  3I56 I;  1GT0 C;  4BY1 J;  2VE8 A;  1S72 I;  1ETO A;  3GFM A;  3B73 A;  4EGZ A;  1YOV B;  2CS3 A;  3I0T A;  3CJR B;  2FNP A;  3K4J A;  2VOD A;  1EA3 A;  2JRT A;  1I6X A;  3OYJ A;  3LA3 A;  1BR4 A;  3T0Y A;  5CQE A;  3U9G A;  4R79 A;  4AID A;  4A3I J;  3MEX A;  1VQ7 I;  1VI0 A;  2R93 J;  5KAF C;  1FNN A;  2R7V A;  1F5T A;  1BI2 A;  1H88 C;  2DFF A;  3EET A;  2A69 F;  4AIJ A;  2RN7 A;  2W1O A;  2FOW A;  5L3D A;  5IPA A;  2GAU A;  1QZE A;  4HEA 2;  4WXD A;  3KET A;  1BI0 A;  1JTY A;  2NYX A;  1R1V A;  1YG2 A;  3ABT A;  3V7R A;  3SQN A;  3K1N A;  1MD0 A;  1UCR A;  3DBL B;  5IOZ A;  4MQ9 F;  1LDD A;  2Q2E B;  2YU3 A;  1MSF C;  3A1Y A;  1WJ5 A;  4E7I A;  4RM3 A;  4M9S A;  1HW2 A;  1F36 A;  1STZ A;  3JRD A;  2W57 A;  1JKP C;  1H9T A;  1BR2 A;  4F7Z A;  1U9N A;  1IAW A;  3TBI A;  4RAF A;  3PFY A;  5LLQ A;  5EF6 A;  3KX2 A;  3RJP A;  4OIP F;  3W2V A;  3A4C A;  3LWF A;  2VJI A;  5F0F A;  4A3F J;  2XAQ A;  2M3A A;  2VXZ A;  3H0G J;  3ZQL A;  3EUK L;  5FLM J;  2FMY A;  4AIK A;  2DOD A;  2ZBK A;  2DOF A;  1GV5 A;  2XSD C;  4BS9 A;  4U87 A;  2F4I A;  1R9T J;  3MN2 A;  2QGU A;  4PJL A;  4ENK A;  2WBM A;  2QEX I;  4IJA A;  3LAJ A;  5LGU A;  3J81 K;  3S1Q J;  1IUY A;  2W7N A;  3OIO A;  1QPI A;  4ETS A;  4XLH A;  2XF5 A;  4Y4R A;  5ICE A;  2QA4 I;  2NS7 A;  3QU3 A;  2XAF A;  3ERM A;  3RPU A;  2WY7 Q;  3GUD A;  1Y6I A;  2DMU A;  2IA1 A;  3M8F A;  3WG9 A;  3HYI A;  2YSR A;  1QA6 A;  4DGW B;  1D0Z A;  4YII A;  2F4M B;  1FPQ A;  3DLA A;  3E5U A;  3E7L A;  2QF7 A;  4AVZ A;  4F55 A;  2E2I J;  3G3Z A;  2CSO A;  4I0A A;  1AU7 A;  1ZRD A;  2ISY A;  1WVR A;  1FLI A;  3KEO A;  5C44 J;  3CUQ C;  1V55 H;  1U0J A;  3ZQF A;  3CCV I;  3GLL A;  2L54 A;  3K1M A;  3ISP A;  3Q0W A;  2ZJP F;  1IC8 A;  4FT8 A;  3CO6 C;  3VYS B;  5J47 A;  1GV2 A;  9ANT A;  4K2E A;  2M9H A;  3QOE A;  3W6J B;  1VND A;  2KHM A;  4JYK A;  4J01 A;  5IY5 H;  2ZC2 A;  4XIC A;  3RYR A;  5F08 A;  2XGE A;  3ZQQ A;  3HGY A;  1WI9 A;  2JN6 A;  2K7L A;  4RDU A;  2KIU A;  4V2F A;  5JVG F;  4UUS B;  2BY1 A;  4RAG A;  2W84 A;  1EV7 A;  3WTX C;  4E4H A;  4KFC A;  4BL0 B;  1EKE A;  2Y75 A;  1IN5 A;  2XRN A;  2OJE D;  5EGO A;  3GZ6 A;  2GXB A;  4G7O F;  4BQQ A;  2DQR A;  5DS9 A;  2BVL A;  4CCM A;  2H6C A;  2MC3 A;  2CV2 A;  3GWZ A;  3PSI A;  2PJR A;  2KFD A;  5GP9 A;  1P9Q C;  2VJJ A;  3ECO A;  3IV5 A;  2EFW A;  4W97 A;  1WJC A;  1TP4 A;  3BR5 A;  4M9X A;  5AIP A;  1Y0U A;  4S05 A;  1MMN A;  4IKF A;  1UZC A;  3KLN A;  3LST A;  3ZQ7 A;  4F52 A;  2A05 A;  3BTL A;  2DFE A;  4XOR A;  1OLT A;  2L4A A;  3K10 A;  3P9C A;  2LDU A;  2GIV A;  2HZD A;  3OYM A;  2VKE A;  3IRQ A;  4B4C A;  4HDV A;  3RKY A;  2DA2 A;  1IXC A;  3BZK A;  2EFN A;  1A6Q A;  2O3F A;  2K40 A;  2HVS A;  1KU3 A;  1YLF A;  1MNE A;  2IP2 A;  3OYN A;  4A12 A;  3GTJ J;  3CDL A;  2CFX A;  3OL4 A;  3OYL A;  3L2W A;  4XRM A;  1KU2 A;  5EGO B;  3BZC A;  2DBB A;  1VF9 A;  2HNH A;  4KIG A;  2X1E A;  3ZMS A;  3J80 Z;  4IXA A;  5DM7 F;  3GF2 A;  1UFM A;  3DTI A;  2XAJ A;  2E60 A;  2NNN A;  3N4M A;  2F6C A;  2PJR B;  2A6E F;  4A3B J;  1FP2 A;  2BV6 A;  2K9N A;  4XOP A;  3KEQ A;  1VQL I;  1IRG A;  1X1B A;  3FWE A;  2RAE A;  4GYG A;  4PJN A;  2VIX A;  4IX7 A;  5EG0 A;  4WK8 F;  3JRA A;  2LR8 A;  4JBA A;  4HST A;  4BH9 A;  4B1R A;  5FKN A;  1IXS B;  4XRS A;  1Y56 A;  2QQA A;  2M4G A;  1OCZ H;  1ZG1 A;  3DPT A;  3CJT B;  2IGO A;  3ESW B;  3FBI B;  2MGQ A;  1B4A A;  1JT0 A;  4XOT A;  2B9S A;  2ME0 A;  2GWR A;  1HBX G;  2D5V A;  3KYC B;  1TWG J;  3JRB A;  4DYQ A;  3OYK A;  4V19 K;  4G94 A;  1LFB A;  5HLI A;  1RIO H;  3CCQ I;  2JVH A;  3DEU A;  3E0J B;  2GOM A;  2M0C A;  3KE2 A;  3A2K A;  3P7N A;  4Y17 A;  1J09 A;  2EFP A;  2Y0S N;  5HOO A;  3F3X A;  4IHT A;  2F4O B;  1C0W A;  1FIA A;  1UHW A;  2DA4 A;  3BR3 A;  3QAH A;  3CC7 I;  4FE4 A;  1XSV A;  2BW3 A;  2ZFW A;  3GTO J;  1NG7 A;  3WHC A;  3V8L A;  1X58 A;  4DNC A;  1E3O C;  1QRY A;  2VPL A;  1BM9 A;  2IRF G;  4I6Z A;  4EM1 A;  4U88 A;  3TKY A;  1ETK A;  4XLP F;  4D0P A;  2HQN A;  3JTG A;  1FYK A;  1O4X A;  3ULQ B;  4CUG A;  2X6X A;  3DKY A;  1EJ9 A;  4XBF A;  4HNT A;  3DV8 A;  4N4N B;  1RZ4 A;  2WAF A;  1FBU A;  4KN7 X;  3CCU I;  3F8C A;  3I4M J;  1G3Y A;  4CCL A;  1LFP A;  1FIP A;  2RRE A;  3RIR A;  2HTS A;  5IT9 Z;  1ITY A;  3QPS A;  2KZV A;  1MKM A;  2OA4 A;  3S3N A;  2E1C A;  1YW7 A;  3S2D J;  5J40 A;  3UKG A;  3DU5 A;  2PX9 A;  2V1U A;  5BPI A;  4KYW A;  2DDA A;  2JUC A;  4HOB A;  1U5T A;  1FOX A;  5DM6 F;  2COM A;  1K83 J;  3C3W A;  4FET A;  4FQG A;  2O5R A;  2GLO A;  5F1R A;  1S5L C;  1D3Y A;  1ZHF A;  1R49 A;  2BW3 B;  2NAZ A;  2E7W A;  2DK5 A;  4I2O A;  2LBF B;  2IA0 A;  4S0H B;  3S93 A;  4X0G A;  2IT0 A;  5FGM A;  2XV4 S;  4XRF A;  1XN7 A;  3I4N J;  1DP3 A;  1R36 A;  1J5Y A;  2B7E A;  2P4W A;  4HA8 A;  5CKT A;  5K7Z A;  3JRI A;  3BLY A;  4BHB A;  2G9W A;  5KCM A;  1UG2 A;  1Z6T A;  4HNU A;  4E7S A;  4OIO F;  4UUV A;  1J9I A;  2H94 A;  5H6R A;  4E70 A;  5ILU A;  2R7D A;  2ISZ A;  3N97 A;  4BE1 A;  3GFJ A;  4RAZ A;  3DKX A;  3K0L A;  1X19 A;  4Y3O A;  3GVA A;  3LSK A;  2L7K A;  2DPU A;  4OMZ A;  2QBY A;  1JJ8 C;  1SC7 A;  1MW7 A;  3HOX J;  1IUF A;  2R5Y A;  4ZTJ A;  2FE3 A;  3H9J A;  2IPQ X;  1NG6 A;  4YFN F;  4Y15 A;  5FJ8 J;  3KFW X;  4C2M J;  5FD6 A;  1SD6 A;  2HFH A;  3H3V K;  2MA3 A;  2HPM A;  2IA2 A;  3G1O A;  3FHZ A;  2MD5 A;  1T95 A;  2CQQ A;  3K4B A;  3GCM A;  3QYB A;  5BOX A;  2L9S A;  1KON A;  2MG4 A;  4BJ5 C;  4QWQ A;  1O3S A;  4M6Y A;  4E7J A;  3M3Y J;  4C3I J;  3CJN A;  1MBE A;  3CCE I;  1IF1 A;  2FOK A;  4M74 A;  2VPR A;  1PDN C;  4HNV A;  1HA8 A;  4JQF A;  3CC2 I;  2ECB A;  2O7O A;  3BTI A;  3P9I A;  3FMR A;  3L09 A;  3ZN0 A;  2E1O A;  1TT5 B;  1T0F C;  4HBL A;  3JSO A;  1D8K A;  2BOL A;  1RES A;  3ZR8 X;  4U0V A;  1BN5 A;  3K2Z A;  4MO7 A;  3FHN A;  3SHF A;  1Z6R A;  4KIS A;  2K9M A;  4CCK A;  2Y0S A;  2QBY B;  1XGM A;  1SAU A;  4I99 C;  5FKO A;  2L7M P;  4CGZ A;  2VI6 A;  2RV8 A;  2R5Y B;  3IWZ A;  2DMT A;  4O6J A;  1R7J A;  3OYA A;  4LK1 F;  2DJI A;  2NVQ J;  3I64 A;  4NC8 A;  2PEX A;  3HOU J;  1MJ9 A;  1YTY A;  2P8T A;  2OPT A;  3SYT A;  2LRD A;  1ZAR A;  5JLW A;  2JA6 J;  3H36 A;  2XPU A;  3TW6 A;  4RGU A;  2KJB A;  1WQ2 A;  1O7F A;  1PYV A;  4NQW A;  4PFO A;  3LA7 A;  4F93 B;  1JUS A;  3HOV J;  1H9G A;  3U1D A;  2XPV A;  2P7V B;  3CCL I;  2EZL A;  3DFG A;  5LGT A;  2XAG A;  4LB5 A;  1L0O C;  2DJN A;  3CDI A;  2P5V A;  3A0H C;  3X2Q H;  1QNT A;  5F6F A;  1OJL A;  1B1B A;  2NVT J;  1GVJ A;  3CF2 A;  2DXI A;  2V1D A;  2GOX B;  3PUF A;  3FDY A;  4B3A A;  1Y1W J;  3FXJ A;  5FLX Z;  1T2K A;  2CJJ A;  1WJE A;  2F5E A;  2FBH A;  2QSG X;  2GM4 A;  3NEU A;  1KYZ A;  2CUE A;  2WAE A;  1W7P D;  2ELH A;  3E5X A;  1S8N A;  2EIJ H;  1PP8 F;  2IXS A;  1W36 D;  4HLX A;  4BQO A;  2MLK A;  1QGP A;  4LGW A;  5KHD A;  4HQE A;  2HU9 A;  1SD5 A;  2EFO A;  5CVR A;  1RI7 A;  3CCY A;  1U8B A;  2R7U A;  1HCR A;  3I53 A;  2VOP A;  1XC5 A;  2HDW A;  1FOY A;  3Q0U A;  4KIB A;  2E7X A;  2X1D A;  2PJP A;  4A3L J;  4NQW B;  5LEJ A;  3KP2 A;  5TJJ A;  4L5J A;  3JRC A;  3W3C A;  1TLH B;  2N8G A;  1T8I A;  1S6L A;  3KZY A;  1ZGJ A;  4D1Q A;  4LMY A;  1UEL B;  4LLL A;  1OCO H;  4Y7N J;  4D5F A;  3BR2 A;  1ZR2 A;  5D8L B;  1X1D A;  3SXY A;  1BI1 A;  2LMD A;  1SFX A;  4IOC F;  1P6R A;  2DT7 B;  1D1C A;  3ZGK A;  5J8C A;  5K7H A;  1QBJ A;  2Y9Y A;  5JLX A;  2M45 A;  1XD7 A;  1IJW C;  4H4K C;  4G12 A;  4CO8 A;  2AHQ A;  3W2A A;  2R4G A;  2NVX J;  4A5M A;  5J6X A;  2NOJ B;  3LSP A;  3EYI A;  1VQ6 I;  3GTL J;  4DJA A;  1XCB A;  1JJ6 C;  2KQR A;  1KU9 A;  2A5W A;  1IGN A;  1JHH A;  3RZD J;  1RPW A;  3BR6 A;  2QQB A;  4RB2 C;  2EV5 A;  3L2R A;  2KRH A;  1QZY A;  4RGS A;  1FP1 D;  1FX7 A;  4O3M A;  4HLY A;  4BEH A;  3CME I;  2EIM H;  2D2W A;  4A0X A;  3G71 I;  4XLF A;  4XLE A;  1JI8 A;  1RR7 A;  5TGT A;  1ERD A;  2CW8 A;  3SEZ A;  3MMY B;  3G1M A;  2KRF A;  1A5J A;  3G4S I;  3OYG A;  2EB7 A;  3I59 A;  1TNS A;  1X2N A;  3CJQ B;  3HSF A;  4RM2 A;  4Z2Y A;  5FRM A;  1ZH5 A;  1IXR C;  1ETQ A;  1NTC A;  2BY2 A;  2X0L A;  1SMT A;  4A3J J;  2X9D A;  2KL4 A;  3LSG A;  1REP C;  2V4J C;  2W00 A;  4C3J J;  2M87 A;  3FM5 A;  1P2F A;  3L2Q A;  3J7A O;  2HZT A;  2HYF A;  3DPU A;  3JRE A;  3WU0 A;  5M3F J;  2O9L A;  3ONQ A;  1KQ9 A;  5DUI A;  1OCT C;  3VWB A;  3FK6 A;  4BGD A;  5B3S H;  1F9N A;  3ABU A;  2LD5 A;  4NC7 A;  3AFH A;  3BRO A;  3QU6 A;  2DT6 A;  3IH2 A;  4UB6 C;  4XSX F;  1LQ1 A;  4M9Z A;  3BJ6 A;  1TNT A;  4JX6 A;  3L1P A;  1Z3X A;  4RB3 C;  3VSK A;  1J75 A;  1S7O A;  3HTU A;  1MH3 A;  5ERI A;  1VZ0 A;  4BEH B;  4IL6 C;  1W1W E;  4J00 A;  3CDH A;  5ED4 A;  3TO9 A;  3AKZ A;  3DU6 A;  1SFK A;  3G6E I;  3OOP A;  1D0X A;  1V54 H;  3KPH A;  3LSJ A;  3OYB A;  2H27 A;  2MD0 A;  2GXA A;  4ENN A;  3DP7 A;  2O8K A;  2RQQ A;  3E3V A;  2VQL A;  3H9Q A;  1U8R A;  2JA8 J;  1WFX A;  1J7K A;  4LLG F;  3HL2 A;  1GXQ A;  4XKB A;  4BJT A;  4B44 A;  1HLV A;  1UST A;  2OD5 A;  3S2W A;  3HBL A;  5E1Z B;  1RKT A;  2XC7 A;  1DPR A;  4PK4 A;  4BBR J;  1D5V A;  2IGN A;  2K02 A;  3H9G A;  1FT9 A;  5J1Y A;  3WTV C;  4HRI A;  3PO2 J;  2QCO A;  4BQA A;  2XVC A;  1WKM A;  2QYO A;  2VQC A;  2KDO A;  4HX4 A;  3WE3 A;  1NK2 P;  3OOU A;  5IOY A;  3T8R A;  3J7Y J;  2LKP A;  2OTL I;  1JT6 A;  3GTG J;  4YRV A;  1BW5 A;  1IRZ A;  3EDP A;  1TBX A;  1TT0 A;  3R61 A;  2JRM A;  3J7Z I;  4N0B A;  3OIQ A;  4XLN F;  4B8X A;  1D5Y A;  3O8H A;  3DCF A;  3ZMZ A;  1ETV A;  5BPD A;  2VQG A;  4UNO A;  2PMU A;  2ZXH A;  3A03 A;  2VJ5 A;  5IYC J;  1YYV A;  3H0D A;  3FXQ A;  2HYG D;  3GTM J;  2EZK A;  1HW5 A;  3DXJ F;  4BDZ A;  3PFI A;  5CVV A;  3L2C A;  6PAX A;  2OV7 A;  1MJA A;  2W25 A;  1IN6 A;  3EUH A;  3Q9S A;  4MQV A;  3ZMV A;  5EYR A;  2E2H J;  3K2A A;  3WTY C;  2HOT A;  3KZI C;  5IYD J;  3HGG A;  2QSH X;  1YIJ I;  1KU7 A;  3JSP A;  4DBR A;  3KIO A;  5DD8 A;  3HOW J;  1A35 A;  4P9F A;  3LQQ A;  4MFE A;  5IT3 A;  2H6B A;  2V9V A;  1AKH A;  1G2H A;  4FX4 A;  3FX3 A;  3BG9 A;  1JKR C;  1YW9 A;  4BXX J;  2BY3 A;  3CUQ A;  5HLG A;  1YS6 A;  2EZH A;  4BBS J;  4GYI A;  3S8P A;  1NK3 P;  2V1X A;  5J4V A;  1TC3 C;  1CQT A;  4KN4 X;  2ZXJ A;  5ILV A;  4ZDP A;  5LHI A;  1I5Z A;  1RR8 C;  3AG2 H;  3U2R A;  2OCC H;  4QTR A;  4BU2 A;  3FMQ A;  3FKJ A;  2VBY A;  5DEQ A;  5EEH A;  3DQV C;  4HF1 A;  2JSP A;  1DUX C;  5JI6 A;  5CVU A;  1QHG A;  3K1P A;  4HZF A;  3VOE A;  1A36 A;  3S1N J;  1D8J A;  4CCJ A;  2QSF X;  3MKL A;  3ZP5 A;  3FKI J;  3AL0 B;  2K9S A;  1W4M A;  3S32 A;  3SEQ A;  2DW4 A;  2L2O A;  1UMQ A;  2QKM B;  5GPC A;  1BJA A;  2QM3 A;  1DU6 A;  3ASO H;  4UUS A;  2FML A;  2OQR A;  3R6S A;  4QLC U;  4XQF A;  2QLZ A;  4KIC A;  2VXD A;  3EUH C;  3AAF A;  1AKH B;  2O8X A;  3IAS 2;  4Y13 A;  3ZQG A;  3A02 A;  3LAP A;  1MSE C;  4XK4 A;  3AL0 C;  4CXF A;  5K1Y A;  2DLL A;  3CUQ B;  2YS9 A;  2HEO A;  1Y39 A;  4AM3 A;  1CF7 A;  2F5V A;  2VC1 A;  1V5E A;  3M07 A;  4ZC3 A;  4AYB N;  1MIJ A;  1V3F A;  2VKV A;  2ZNZ A;  4EVI A;  3ASN H;  2R92 J;  1RC9 A;  1WHU A;  4Y52 J;  2KT0 A;  2KIS A;  2GZW A;  2XAS A;  3OL3 A;  4GRI A;  3I55 I;  3A0B C;  2DO7 A;  3BG6 A;  4ZZD A;  5HOD A;  3SFI A;  3M1E A; 
#chains in the Genus database with same CATH homology
 4A69 C;  3WHC A;  1X58 A;  1E3O C;  1YRN B;  1QRY A;  2E19 A;  4I6Z A;  5C4J J;  1W0T A;  3HDD A;  1ETK A;  3VPR A;  2IAI A;  2Y30 A;  2NS8 A;  4QIW N;  3TW7 A;  1O4X A;  2WAQ N;  3Q3S A;  2DA6 A;  1MNM C;  2CU7 A;  1GVD A;  2HOS A;  3S2H J;  4IHW A;  1ENH A;  3I4M J;  2DMP A;  1FIP A;  3TP0 A;  2PMZ N;  3NAR A;  3ZQI A;  4BY7 J;  3QPS A;  1ITY A;  2ID6 A;  3IH3 A;  3SJM A;  1I50 J;  1FEX A;  2L0K A;  3ZOB A;  5E3N A;  2KDZ A;  1WH7 A;  2Y31 A;  1TWF J;  1ZK8 A;  3S2D J;  1P7I A;  3UKG A;  5FKL A;  4AC0 A;  2IBD A;  5F0C A;  2W48 A;  3GTQ J;  1K83 J;  3M4O J;  2YUS A;  2G0E A;  2XB0 X;  5E3M A;  2K9Q A;  2GLO A;  2HOA A;  4XRS G;  3OSF A;  3CMY A;  2EZI A;  1OCP A;  4XID A;  1UHS A;  4S0H B;  3I4N J;  5K7Z A;  3JRI A;  3BTC A;  3PM1 A;  3LSR A;  1MBH A;  1UG2 A;  5E3O A;  2LY9 A;  1U78 A;  4M6V A;  5J1R A;  1AHD P;  3BT9 A;  1JTX A;  5K7F A;  3S15 J;  3FIW A;  3SDG A;  1QVU A;  1Y1V J;  5F04 A;  1XS9 A;  5FLV A;  1JJ8 C;  4UUT A;  3HOX J;  1IUF A;  2AO9 A;  2R5Y A;  1GDT A;  2OF7 A;  2JA7 J;  5J1U A;  2M8G X;  2XB5 A;  1WPK A;  3HEF A;  5FJ8 J;  4C2M J;  3K7A J;  1ETY A;  3WHB A;  4M3F A;  3W6V A;  3H3V K;  4D7N A;  3G1O A;  1APL C;  1QVT A;  2CQQ A;  4LOC A;  2MG4 A;  4EEF G;  3G1L A;  2FD5 A;  2DMQ A;  2HDD A;  3M3Y J;  4C3I J;  1MBE A;  1WGX A;  2VPR A;  4HNV A;  3ZQC A;  5IP7 J;  2EBI A;  2CRG A;  2X48 A;  2ECB A;  3OSG A;  2O7O A;  3BTI A;  2E1O A;  1ZR4 A;  5GPA A;  3PO3 J;  1RES A;  4MO7 A;  1XG1 A;  2L9R A;  5FKO A;  2L7M P;  1ETX A;  1T56 A;  2VI6 A;  2R5Y B;  2DMT A;  5E3L A;  2NVQ J;  1ZTR A;  3HOU J;  1HDD C;  3RQI A;  1FTT A;  2OPT A;  3BG5 A;  4DZJ A;  1F43 A;  4GFB A;  5JLW A;  2JA6 J;  4W1U A;  4JX4 A;  2XPU A;  1ETW A;  3TW6 A;  1TWA J;  1JKQ C;  2ELK A;  2M34 A;  5F27 A;  2R5Z A;  4M3B A;  3BQZ A;  1FJL A;  1Z0X A;  2JJ7 A;  2LTP A;  1JUS A;  3HOV J;  3JRG A;  2XPV A;  1BJZ A;  3BR0 A;  2EZL A;  2DA7 A;  2B63 J;  2DJN A;  1WCM J;  1BA5 A;  1I6H J;  1K61 A;  3S16 J;  5IYB J;  1OJL A;  1ZKG A;  1X2M A;  2XGD A;  2NVT J;  5C4X J;  1ZQ3 P;  5EZH A;  3LNQ A;  4B3A A;  1Y1W J;  4AUX A;  1OFC X;  2CJJ A;  2GM4 A;  2CUE A;  2EH3 A;  2R7Z J;  3RKQ A;  1MBG A;  1MBJ A;  2LFB A;  2DN0 A;  2EQR A;  1RKW A;  3GBG A;  2FX0 A;  1A6I A;  3BTJ A;  3CCY A;  1U8B A;  1PUF A;  1RET A;  1S7E A;  3S1R J;  4A93 J;  1HCR A;  1H8A C;  1HOM A;  1MBK A;  1XC5 A;  4FCY A;  5C3E J;  3HKZ N;  3Q0U A;  2ID3 A;  4QSH A;  2LKX A;  2TRT A;  1JKO C;  4A3L J;  2DA1 A;  3FIS A;  5IP9 J;  2R5Z B;  3ZQH A;  1GT0 C;  3QPL A;  4BY1 J;  5F1J A;  2HYJ A;  1ETO A;  1BL0 A;  4V2G A;  3C2B A;  1BW6 A;  3JRC A;  2JMW A;  2N8G A;  1IDY A;  3MVP A;  3Q0V A;  4M3E A;  4Y7N J;  4D5F A;  2H8R A;  3BR2 A;  1GUU A;  1ZR2 A;  2MW8 A;  4A3I J;  1ORK A;  1VI0 A;  2R93 J;  1H88 C;  5K7H A;  1LFU P;  4X1E A;  5IPA A;  2JK3 A;  2Y2Z A;  2Y9Y A;  5JLX A;  4C3H J;  3QQA A;  3D1N I;  1JTY A;  1IJW C;  2I10 A;  4G12 A;  2AHQ A;  5IOZ A;  1I3Q J;  2NVX J;  4NDL A;  4IEJ A;  5FKK A;  3LSP A;  1IV6 A;  2Y9Z A;  1MSF C;  3GTL J;  1PUF B;  3DEW A;  4I76 A;  3BR1 A;  1JJ6 C;  1JGG A;  2L7Z A;  3B6A A;  1F36 A;  1IGN A;  3RZD J;  2MSY A;  4FTH A;  3JRD A;  1JKP C;  1RPW A;  1TWC J;  3BR6 A;  1U9N A;  5EF6 A;  3JR9 A;  1HF0 A;  2P81 A;  1POG A;  5F0F A;  4A3F J;  2M2E A;  5J3L A;  1RR7 A;  3H0G J;  2NVY J;  3ZQL A;  2FJ1 A;  5EZG A;  4IHX A;  5FLM J;  3G1M A;  1A5J A;  1GV5 A;  2XSD C;  1R9T J;  4DYC A;  3MN2 A;  1B8I A;  1X2N A;  1Z77 A;  1ZGW A;  4ABZ A;  1JUP A;  2COB A;  3S1Q J;  4A3G J;  1ETQ A;  2YU9 J;  1NTC A;  3OIO A;  1QPI A;  3HB9 A;  4DYR A;  4A3J J;  2X9D A;  3BG3 A;  3LSG A;  4FIS A;  4A3K J;  2GBY A;  2WB1 N;  2XGC A;  4C3J J;  2NS7 A;  4L5E A;  1TWH J;  3JRE A;  5M3F J;  2O9L A;  2DMU A;  1OCT C;  1WH5 A;  2JWT A;  4JX5 A;  3IH4 A;  2DTZ A;  3FK6 A;  5M3M J;  1SAN A;  5EEA A;  2LD5 A;  3IH2 A;  3BQY A;  3E7L A;  4DW6 A;  2QF7 A;  2E2I J;  1T33 A;  4JX6 A;  3L1P A;  1AU7 A;  4MLO A;  4D7M A;  5C44 J;  3ZQF A;  1MH3 A;  2R0Q C;  2DA5 A;  3Q0W A;  2ME6 A;  1IC8 A;  5EG0 B;  3GTK J;  1JUM A;  1VFC A;  1GV2 A;  3LSJ A;  4MFD A;  9ANT A;  2M9H A;  1VND A;  2O8K A;  2VUM J;  2JA8 J;  1B8I B;  4JYK A;  4XIC A;  1U9O A;  5F08 A;  2XGE A;  3HGY A;  2LVS A;  2JN6 A;  1HLV A;  3HBL A;  1RKT A;  4RDU A;  4V2F A;  4UUS B;  4BBR J;  5J1Y A;  3PO2 J;  2QCO A;  1MBF A;  1B72 B;  3GTP J;  5EGO A;  4BKX A;  1NK2 P;  3OOU A;  5IOY A;  3GTG J;  1JT6 A;  5DS9 A;  4A3C J;  5F0H A;  1BW5 A;  1IRZ A;  2TCT A;  3B6C A;  5GP9 A;  4CYC A;  4D5C A;  1D5Y A;  1SFO J;  3IV5 A;  3O8H A;  2CUF A;  3DCF A;  1ETV A;  4M3D A;  4W97 A;  2X6O A;  3TED A;  3BR5 A;  3A03 A;  4A3E J;  5IYC J;  3S14 J;  4FE7 A;  3HM5 A;  2EZK A;  3BTL A;  3LOC A;  3GTM J;  1EF4 A;  3A01 A;  1IG7 A;  2E2H J;  5EYR A;  2E2J J;  3K2A A;  2HOT A;  5IYD J;  3HGG A;  4M3G A;  4DZP A;  1W0U A;  3HOZ J;  1DU0 A;  3NAU A;  1Q1V A;  2VKE A;  5M5X J;  4B4C A;  3HOW J;  2DA2 A;  3JRF A;  4A3D J;  5EDN A;  4MFE A;  3CQZ J;  1LE8 A;  1IDZ A;  3RZO J;  1AKH A;  2K40 A;  1G2H A;  3S17 J;  2IEK A;  3BG9 A;  1JKR C;  2HXO A;  4BXX J;  2LLK A;  1MH4 A;  3GTJ J;  3CDL A;  2ECC A;  2EZH A;  3O8G A;  4BBS J;  4XRM A;  1NK3 P;  5EGO B;  1TC3 C;  1VF9 A;  1CQT A;  5FKM A;  5IP6 A;  4A3B J;  4RBO A;  2K9N A;  2DMN A;  4CYC B;  4QTR A;  2RAE A;  2HI3 A;  3S1M J;  2H1K A;  5EG0 A;  1YRN A;  2JA5 J;  3JRA A;  2LR8 A;  2HQ5 A;  1FTZ A;  5BNG A;  4B1R A;  3HOY J;  5FKN A;  1P7J A;  4XRS A;  3A01 B;  4MIM A;  3S1N J;  4J19 A;  2FQ4 A;  3MKL A;  3FKI J;  2DA3 A;  2MGQ A;  4X6A J;  2K9S A;  2LK2 A;  1JT0 A;  5GPC A;  1DU6 A;  1UMQ A;  2ME0 A;  4UUS A;  2D5V A;  4IHV A;  2XRL A;  2XPW A;  1LE8 B;  1TWG J;  3JRB A;  1HDP A;  4DYQ A;  2NOG A;  2CQX A;  3F0C A;  1AKH B;  1B72 A;  3JRH A;  5M5Y J;  3FK7 A;  3ZQG A;  3A02 A;  1MSE C;  1LFB A;  4XK4 A;  1H89 C;  2YS9 A;  1WI3 A;  2M0C A;  4JP0 A;  5DTD A;  4AYB N;  2Y0S N;  2VKV A;  5M5W J;  2R92 J;  1FIA A;  4A3M J;  2ZB9 A;  2DA4 A;  2LP0 A;  2KT0 A;  3BR3 A;  2HXI A;  4Y52 J;  4FE4 A;  2L7F P;  3TP3 A;  2WV1 A;  5HOD A;  3GTO J;  3SFI A;  4IHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...