3HOYJ

Complete rna polymerase ii elongation complex vi
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hoyJ00
5IP9J 1Z77A 3MN2A 2EZKA 4BBRJ 3BR5A 3Q0VA 5FJ8J 2KDZA 2DA1A 2VPRA 3K7AJ 2CU7A 2ID3A 2QF7A 2EZHA 1JT0A 3IV5A 2Y9ZA 5EYRA 1MBHA 1MBEA 1ITYA 3A01B 5J1RA 4IHVA 5E3MA 1XG1A 1LFBA 2XPVA 1IRZA 3QPLA 1U9NA 4BKXA 1MH3A 4IHXA 4D7MA 3HB9A 3GTMJ 1ZK8A 1GV5A 1UMQA 1ZGWA 2ECCA 1VNDA 2H8RA 2Y9YA 1NK3P 2R5ZA 1HF0A 4L5EA 2HOAA 4V2FA 1Q1VA 2G0EA 2DMPA 1I3QJ 1P7JA 3BG9A 1WGXA 2JJ7A 1BW6A 1RESA 2JMWA 1NTCA 4D5FA 3BTLA 3NARA 1B72A 4C3HJ 3ZQIA 2LKXA 3G1LA 2TCTA 3G1MA 3MKLA 1ETYA 2X9DA 2YUSA 1IG7A 3DCFA 1OCTC 2YU9J 1XC5A 5IP7J 3BQYA 3RZOJ 2Y0SN 4M6VA 3S1NJ 1O4XA 2KT0A 4FTHA 2X6OA 1ETKA 3QQAA 1ETVA 5IOZA 1GUUA 3O8GA 1JJ8C 1X2NA 1ETWA 4JX5A 2E2HJ 1X58A 5GP9A 1LFUP 4A3GJ 1JUSA 2NVXJ 2IBDA 2DA2A 3HOVJ 4FCYA 5FKMA 4JP0A 5GPAA 2TRTA 2P81A 4MO7A 2XGCA 1ZKGA 4C3JJ 4A3MJ 3B6AA 1RPWA 2L0KA 1LE8A 1F43A 1IUFA 4XRSA 1MH4A 3GTGJ 2COBA 5M3FJ 2DMTA 3H0GJ 2DN0A 2HDDA 3UKGA 2HI3A 5JLXA 1WPKA 2WB1N 3BTJA 2JA7J 3SDGA 2MSYA 1BL0A 1JT6A 2L7FP 2M34A 2ZB9A 1B8IB 4MFEA 2LP0A 2DA7A 3GTQJ 4M3EA 1U9OA 2VUMJ 4A3IJ 5C4JJ 2HYJA 5F1JA 1TWGJ 3G1OA 1PUFB 2R7ZJ 3DEWA 2HOSA 4EEFG 3FK6A 3OOUA 2FD5A 4AUXA 2E1OA 4W97A 2FJ1A 4MLOA 3SFIA 3ZQGA 2LY9A 4M3FA 2FQ4A 1JUMA 5IP6A 5EF6A 1IDYA 2OF7A 3JRBA 5DS9A 5IPAA 3CDLA 4CYCB 3S16J 2EQRA 2JK3A 1WH5A 1EF4A 3S1QJ 3I4MJ 1JKQC 3BT9A 4DZJA 2R92J 1BW5A 4XRMA 2DA4A 1IV6A 2AHQA 2HXOA 1FIAA 4NDLA 2X48A 2GM4A 1ZR2A 4XRSG 5BNGA 3OSGA 4JX4A 2IAIA 2XPUA 1Z0XA 1GV2A 4RBOA 4B3AA 5K7HA 2Y2ZA 1B8IA 3HEFA 3HGGA 3B6CA 5EGOA 1FIPA 1PUFA 4DW6A 1T33A 3GBGA 2ME6A 2NVYJ 3NAUA 4S0HB 4MIMA 1VI0A 5HODA 2N8GA 2H1KA 5C4XJ 4M3GA 1JKPC 1TC3C 2RAEA 2HQ5A 4C3IJ 2ID6A 3O8HA 1GT0C 3M4OJ 4CYCA 4M3BA 1QPIA 2JN6A 1LE8B 4DYRA 1P7IA 2ME0A 3BR3A 2LK2A 2PMZN 3FKIJ 1SANA 3RQIA 2M2EA 3BR1A 5FKOA 4Y7NJ 2K9SA 4BBSJ 2E19A 3LOCA 3SJMA 1AHDP 2NS7A 4DYCA 1JKOC 2Y30A 4BXXJ 5EEAA 1HCRA 3JRDA 2XRLA 4A3BJ 1VFCA 5FKKA 2E2JJ 5FKLA 3BR2A 4FISA 3BR0A 1H8AC 1TWCJ 3BG3A 1A5JA 1ETQA 2LD5A 3L1PA 3CMYA 3ZQHA 1IC8A 3GTPJ 3LSRA 4D5CA 4DZPA 5M5XJ 2CQQA 3HM5A 1WI3A 2GLOA 1POGA 1MBGA 1WH7A 3HKZN 1TWHJ 2M0CA 3JRGA 3HDDA 3ZOBA 2JA5J 2R0QC 1H88C 3MVPA 3TEDA 1Y1WJ 1SFOJ 2XGDA 2QCOA 1FEXA 2D5VA 3FK7A 3FISA 1W0TA 5F27A 5M5WJ 2DA6A 5IYBJ 5EGOB 3RZDJ 4A3FJ 3PM1A 3K2AA 3Q0UA 1OJLA 3LSPA 1U78A 4A3CJ 4IHYA 3PO2J 3F0CA 4RDUA 1K61A 1VF9A 1MSEC 1W0UA 4MFDA 1UG2A 2O7OA 1AKHA 2O8KA 3JRCA 2JA6J 2K9NA 4FE4A 4JX6A 4A3DJ 2HOTA 1X2MA 2LVSA 3JREA 4IEJA 2EZIA 1YRNB 2NS8A 5E3NA 2XSDC 1HDDC 2IEKA 3BTCA 4X1EA 4X6AJ 4UUTA 3JRIA 4J19A 4BY1J 2DJNA 5E3OA 1ZQ3P 4UUSA 2WAQN 4FE7A 1DU0A 1BA5A 1MBFA 2MGQA 3HGYA 4HNVA 2FX0A 1TWAJ 1RETA 3HOWJ 5FKNA 5EDNA 2R5YB 4DYQA 3ZQLA 5F0CA 1ENHA 2YS9A 2L7ZA 2EBIA 3CCYA 2NVTJ 2I10A 2DA3A 5J3LA 3OIOA 3RKQA 2JA8J 3FIWA 4QSHA 4C2MJ 2L7MP 2R93J 5FLVA 1ORKA 1MSFC 1H89C 2DMUA 2DMQA 3HBLA 3TW6A 2LTPA 5EG0B 3JRHA 3HOYJ 2CRGA 2AO9A 1TWFJ 2VI6A 1D5YA 2Y31A 3S15J 1GDTA 2NVQJ 1T56A 1I50J 3GTLJ 5EZGA 1Y1VJ 4JYKA 1G2HA 3S17J 1JTXA 1YRNA 3ZQCA 2JWTA 1AU7A 2CJJA 2MG4A 4LOCA 3JRFA 1OFCX 5J1UA 3ZQFA 5M5YJ 3S14J 3A02A 3WHBA 4A93J 4QTRA 4AYBN 2B63J 3LSGA 1APLC 1FTTA 2NOGA 3WHCA 2MW8A 2XGEA 2GBYA 2E2IJ 3HOUJ 2ECBA 5C44J 1DU6A 1QRYA 4A3LJ 2VKEA 3S1RJ 5F0HA 1A6IA 1MBKA 2ELKA 3BR6A 1K83J 1JGGA 1FTZA 1WCMJ 2R5YA 1JTYA 3PO3J 1HLVA 2CQXA 1AKHB 2O9LA 2DTZA 4W1UA 2EZLA 3TP3A 3OSFA 1ZR4A 2EH3A 4B1RA 1NK2P 5IYDJ 5EG0A 4QIWN 2LR8A 1U8BA 3GTKJ 3M3YJ 3LNQA 2LFBA 1E3OC 3W6VA 3A01A 1IGNA 3C2BA 1OCPA 3IH2A 2WV1A 5GPCA 1JJ6C 5F08A 4UUSB 4IHWA 2DMNA 2OPTA 2M9HA 4A3KJ 1HOMA 1HDPA 1ZTRA 2XPWA 3QPSA 5F04A 3GTJJ 4V2GA 1UHSA 1GVDA 1RR7A 3LSJA 4A69C 2K9QA 1QVUA 5DTDA 5M3MJ 4M3DA 1MNMC 2VKVA 1CQTA 3S2HJ 1IDZA 5IYCJ 4Y52J 2DA5A 3Q3SA 3BG5A 4I76A 1S7EA 4B4CA 3JRAA 2HXIA 1QVTA 5JLWA 3JR9A 3D1NI 1XS9A 3IH3A 5EZHA 1FJLA 2CUFA 2W48A 1IJWC 3HOZJ 1ETOA 2K40A 4G12A 4AC0A 1RKWA 3CQZJ 5K7FA 1MBJA 1I6HJ 1RKTA 3Q0WA 1JKRC 4I6ZA 4A3EJ 9ANTA 1R9TJ 3BQZA 3TP0A 3A03A 2R5ZB 1JUPA 5FLMJ 5E3LA 5F0FA 3VPRA 3GTOJ 1BJZA 5K7ZA 4XIDA 2M8GX 3BTIA 2CUEA 5J1YA 1F36A 3E7LA 4ABZA 4BY7J 4D7NA 3HOXJ 5C3EJ 5IOYA 4A3JJ 1B72B 3I4NJ 3S2DJ 2XB5A 3H3VK 4XICA 1ETXA 4GFBA 3S1MJ 2XB0X 3IH4A 4XK4A 3TW7A 2L9RA 2LLKA
chains in the Genus database with same CATH superfamily
2RVCA 5FJ8J 3MMYB 2VPRA 3K7AJ 4B48A 1Y56A 1FLIA 2QM3A 2EZHA 4N4NB 3VB2A 1BJAA 2EFPA 4HQEA 4XONA 1ITYA 4A0YA 3KEQA 1MD0A 2L4MA 3A01B 4IHVA 4N0BA 3K1PA 4YIFA 5A2QK 1O3RA 5E3MA 3PIOF 4RM3A 1F4KA 1IRZA 1EH6A 3E3VA 2MLKA 5F6FA 4BKXA 4IHXA 1DGWY 3FXRA 4PJLA 4AYBA 4BYYA 1UMQA 4HEA2 2ECCA 3I58A 2K3FA 1HF0A 2HOAA 4C30A 1RR8C 3ROUA 4E6KG 2A6HF 1P7JA 1S6LA 2JJ7A 3HTUA 3KLOA 4IKFA 1B72A 4D5FA 3BTLA 3NARA 3ZQIA 2VQHA 1Z91A 3G1LA 2TCTA 5BMZA 4IF4A 2DQLA 1FYKA 1XC5A 2B0LA 2PX9A 4ETSA 1L3LA 2VJ5A 3RZOJ 3GUDA 1V55H 1SMTA 1D0XA 2XROA 3BZ6A 5J47A 2MABA 3QQAA 1GUUA 3AL0B 1K78A 3OYGA 1MMSA 3EUHC 1XGNA 4BUPA 2ZMEB 2FSWA 4JX5A 2E5ZA 3IKVA 4EJTA 4QPQA 4G8XA 3CCJI 5GP9A 1VTNC 1TQIA 3WG9A 2FXAA 3DLAA 3R0AA 2QWWA 3M7GA 2IBDA 3A1YA 3U2RA 1V5GA 3CP8A 2VXZA 2TRTA 3R6SA 2ESNA 4C2TA 4CCJA 3F6VA 4C3JJ 2MYSA 2LYCA 3ZR8X 2EIMH 1T0FC 4CZZA 4D0PA 2L01A 4OAZA 1F43A 1MH4A 3GTGJ 4ENKA 1WJAA 3H0GJ 3VYTB 1BI2A 5JLXA 1HKTA 1B9NA 3F3XA 3K1MA 3D5LA 3IP4B 5TGTA 2MSYA 5H2FC 4CICA 4QLCU 1EKEA 2ZB9A 3OWTA 2LH9A 1B8IB 4MFEA 2HVRA 2E1MB 1U9OA 2VUMJ 1R00A 4LB5A 2HYJA 5F1JA 1I27A 1R23A 2BBYA 3CUOA 3HPHA 4R8HA 3OOUA 1OR7A 5LBQA 4O5VA 4MLOA 2O5RA 4CHUA 5LEJA 2DT7B 1XCBA 3CCQI 4RGUA 4XKVA 5EF6A 3FXLA 2A07F 4EMSA 5HLHA 3N4MA 3JRBA 5F1RA 3MCZA 1QHHD 1MW7A 2B7EA 2M7BA 3RYRA 5ICGA 3HOTA 2VBWA 3F8FA 4I01A 5B5EC 5FFXA 3FHZA 3M1EA 2VBZA 1O7FA 1JKQC 1R49A 2R92J 1XD7A 2JSCA 4XRMA 1AOYA 2DA4A 4HNUA 4KNYA 3SZPA 5HNFA 1E3HA 4D9JA 3ISPA 1Y8RB 3SYTA 5LRSA 1OYWA 3ELKA 4I7HA 3OSGA 2K4JA 3OYHA 3L00A 4JX4A 2KISA 1BI0A 1GV2A 1YIJI 3V42A 4B3AA 1LEBA 1SVOA 4ZJZA 2A69F 3HEFA 4O6JA 1PVEA 1R36A 4DW6A 5JVTA 5H20A 2BY1A 2PJPA 2DODA 2KDOA 2A05A 1SAXA 1PP7U 1ON1A 3R0JA 3U21A 4ZYGA 4EJOA 3OS0A 4JBAA 3UR3C 2V9KA 1JKPC 4Q4ZF 2RAEA 2V9VA 1SVLA 2KQRA 3O8HA 3J81Z 3DV8A 3M4OJ 2F2EA 4F52A 1ZAOA 4DQ2A 2DT6A 2OA4A 2WAEA 4EJWA 2LK2A 5DYMA 2PMZN 3RQIA 1ZLJA 2P7CB 2IS6A 5DM7F 2TDXA 4IL6C 5FKOA 1FOKA 2ICWG 1U8RA 1S5LC 4I0BA 2WY7Q 1X3UA 2NAZA 4BBSJ 5KNLA 2WADA 2EA2A 2LG4A 2MFZA 3E97A 3CC7I 2HR3A 3ERED 4A12A 1USTA 2ACJA 3SJMA 3F8NA 4DYCA 2JPCA 5LGNA 2R7RA 1UZCA 3DXJF 4ZC3A 1IRGA 2Z2SB 2P5LC 1HCRA 1ZRDA 3LA3A 2XRLA 1VFCA 2X6WA 5FKKA 3C2HA 1KONA 2VOPA 3M07A 1I3AA 3BR2A 3BR0A 1H8AC 4P5OA 4G6QA 1ETQA 3GFMA 1B4AA 1IC8A 2V6CA 2ZXIA 4OU0A 3COAC 4DZPA 2VE9A 2CQQA 1R1TA 3J7YJ 2DOAA 1O57A 1YG2A 4UV8A 2Y48A 5HDNA 1WI3A 2VASA 2ESHA 3HKZN 3JRGA 1IXCA 1TWHJ 1Y6IA 2D1VA 2NNNA 2D2WA 2Q8KA 5DDGA 1H88C 2VQGA 5E18F 1YIOA 2ZXWH 3MVPA 2E36A 2LRDA 2WB1A 4UB8C 2V9PA 4Y4RA 1EH8A 3CJNA 1I1SA 3EYIA 1SFOJ 1TLHB 1D0YA 1H0MA 1HQCA 3MZYA 2QSFX 1EH7A 1L0OC 1REPC 2PMHA 5JVGF 1UFMA 3FK7A 4RGSA 1RRJA 5IY5H 3KP6A 1W0TA 2OCEA 2F4OB 5M5WJ 2ZXHA 2VJIA 4A3FJ 4BU2A 3K2AA 3Q0UA 4M74A 4QPOA 3DTIA 4A3CJ 1Z67A 4EJVA 5ICEA 1ZRCA 2NOJB 3F0CA 3IHUA 1VF9A 1OCCH 5CLSA 1BBYA 4MFDA 1R71A 3DP7A 5D5WB 1E0EA 1V3FA 3JRCA 2JVGA 2XC7A 5DV5A 2BXZA 3WTXC 1YI2I 2PG4A 1QZYA 1ACIA 2ELHA 3H9GA 2L9NA 3S1RJ 4UV9A 1V54H 1YRNB 2QA4I 2NS8A 3EUHA 2XSDC 1GVJA 3K69A 2O61A 3K4JA 2AXLA 5DUKA 1WKMA 2DBBA 2FQ3A 5BOXA 3JRIA 1S8NA 2WBMA 2DJNA 5E3OA 1ZQ3P 3KYCB 2HS5A 1J09A 4FE7A 2HKOA 3O3KA 2XAGA 2R7QA 3AKZA 4AM3A 4HNVA 1TWAJ 1RETA 2CUZA 3F23A 1PYVA 4XSXF 1T0FA 5FKNA 4EATA 1SFUA 4XQFA 4DYQA 2YS9A 2WC2A 3GVAA 5DD8A 3CMMA 2DA3A 4EQQA 2LREA 3OIOA 3RKQA 4G7HF 2DFFA 1SD7A 1WSUA 2GA2A 2R93J 1ORKA 3HRMA 4XLCA 3FMQA 3GEZA 4CCOA 1R5ID 2EIKH 5DCMA 3S3MA 1TZLA 2K5CA 2VI6A 1D5YA 2MH9A 2HGCA 3S15J 3I64A 1JHHA 4Q47A 5GADJ 5B1BH 5FLXK 2HWVA 1FBQA 3BOQA 2YSRA 4FHTA 3ZQCA 4Z6YA 3E6MA 3V7SA 1PJRA 1XB4A 2JWTA 3JAMZ 2XVCA 4XBFA 1AU7A 1EJ9A 1LDJA 4YIIA 4DIQA 4L9VA 3GXOA 3IRRA 1MMNA 5J1UA 2LY2A 2M0MA 3A02A 3LSGA 4IOCF 5DCFA 2DDBA 3SEQA 4BEHA 2RQPA 1VQLI 4S04A 2HKXA 2R7OA 4PUSA 5F0HA 2WWYA 3C18A 1A04A 1JGGA 1K83J 3W2VA 1QU3A 1FMVA 2CSOA 1JTYA 2V26A 3WTYC 2PN6A 4KT6A 2F5CA 1W5CC 4Q5SF 3P7NA 4W1UA 3DU5A 3VYRB 2ZMEC 3FM5A 3L7WA 2R7SA 4WXHA 1ZGJA 4ENMA 1ZREA 4II3A 5AONA 4QIWN 5EG0A 1N78A 1T39A 4WXCA 3RJPA 1KU9A 2BEOA 3DTKA 3CF5F 1G3WA 2QKMB 1OCPA 2WV1A 3CCRI 5F08A 4A0XA 4IHWA 2IA2A 1LJ9A 4A5NA 2Y75A 2M9HA 3HHHA 2BYVE 3GYHX 3DF8A 5AIQA 2XPWA 4DGWB 1FP1D 3RKWA 4IVNA 5E1WA 2BHZA 3TL4X 3NRVA 1TNTA 2VOOA 1UHSA 1X4OA 3LSJA 3ZMDA 5KHDA 1VQPI 1YS6A 1LDDA 1ONVA 1QVUA 1MJBA 4I2OA 2BY3A 2PLYA 4H0EA 4CH7A 5DCMB 3BG5A 3FWEA 5LGUA 4B4CA 2P5VA 3JRAA 3T1BA 1QVTA 3GFJA 5JLWA 2VT2A 1XS9A 3LWFA 1IN6A 1HA8A 1A35A 2CUFA 4CCNA 4OMZA 1LUJB 1I1GA 3G4SI 1KYZA 1I6HJ 1RKTA 1JKRC 2CMPA 4I6ZA 4A3EJ 5DUIA 3H3UA 2XF6A 1DP7P 4M71A 3E6BA 1X1DA 2JUGA 4BEHB 2Z16A 3BQZA 3TP0A 2HQNA 2HEOA 5F0FA 1FP2A 4A2UA 3CO6C 3VSKA 2DDAA 2CUEA 1J9IA 2BGCA 4ABZA 4ZH4F 5C3EJ 3KIOA 2E71A 2HQAA 3OOPA 3J7AO 4PFPA 1ETXA 1FX7A 2JPBA 4GFBA 1HC8A 2COMA 1IXRC 1OCZH 2HOEA 3KETA 3VDXA 3W6JB 1MJAA 1JHFA 1PUEE 3PNYA 2XIGA 2LLKA 4UB6C 5IP9J 5L3GA 1YJNI 2FBHA 2Z9OA 1A31A 4BBRJ 1CGPA 3Q0VA 3OYJA 2KDZA 4I98B 5HS9A 2EK5A 1FT9A 1G8XA 2Y9ZA 1MBEA 2E5NA 2IVMA 4PDKA 5J1RA 2IS4A 5L3FA 4X0GA 2AS5F 1XG1A 1BM9A 3M8FA 1X3ZB 1MMDA 2IP2A 1YTYA 2R4GA 2X85A 4IXAA 1YX3A 2P7VB 1ZK8A 3G73A 1IF1A 4HZFA 4LK0F 1ZGWA 4O3MA 3FXKA 4LGWA 1VNDA 1NK3P 2R5ZA 4L5EA 3DBLB 4M9ZA 1Q1VA 3E5XA 3QP5A 3ZMVA 5J8FA 3IL2A 2W85A 5FRNA 3CF2A 5CYVA 2EIJH 2OC6A 4OOIA 3V7RA 3WU2C 3DKWA 1Y0UA 1TQPA 1NTCA 2Y0MA 4IRIA 2KL4A 4C3HJ 4E7SA 1G3YA 4PJMA 1O3SA 4L0ZB 1LFPA 1XMXA 2GOXB 1ZGAA 2L9VA 3G1MA 3Q9VA 2YUSA 1MKMA 1QNTA 3KYLA 1WJ5A 3HRSA 5IP7J 3BQYA 1R22A 3PJRA 3BCBA 1RNLA 3E1SA 2HNHA 3L2CA 1O4XA 3QOEA 2ADUA 2EPFA 1ETVA 5IOZA 4RLQA 1ETWA 2DOEA 4E70A 4HRIA 2FNAA 3W2AA 1YOVB 3I71A 5IT3A 2HZTA 2STWA 4A3GJ 3V8JA 3H1CA 2UWMA 4U0VA 2DA2A 4J00A 3HOVJ 4S05A 3E6CC 4LLNA 5FKMA 2A61A 3H5NA 5GPAA 4V19K 1R6RA 3DBHB 4MO7A 2XGCA 1ZKGA 4GXOA 1E17A 2M7AA 4I99C 1RUNA 1RPWA 2L0KA 3KFWX 2ZO4A 1IUFA 1P2FA 2GAUA 2M5WA 3HOSA 3I53A 4ZZDA 2UXXA 1HW5A 4ASNA 1WPKA 1DPRA 1D1AA 1FBSA 3BTJA 2JA7J 3BCAA 5K5QA 1JT6A 2L7FP 1GXQA 2M34A 4KIGA 2EV0A 5K1YA 5D8LB 2V6EA 2L02A 2FOKA 3BP8A 2GXAA 2CO5A 4G6DA 4LG0B 3T8TA 2FD5A 2E1OA 4W97A 4CA0A 1O7LA 2EFWA 3SFIA 5B3SH 1QQIA 3ZQGA 2ZMEA 2LY9A 4M3FA 2FQ4A 2VKHA 3QYBA 1IDYA 5CVUA 2OF7A 3OYLA 5DS9A 3W2WA 3MWMA 4CYCB 1TTYA 4F3QA 3OY9A 3WTVC 4AIHA 5ILVA 3DWLE 1XTAA 3S1QJ 1R4NB 1QBJA 2E7XA 3F21A 3I0TA 4DZJA 3H0DA 1CF7B 3OR1C 3HG9A 1SFKA 3IAS2 4BXUA 2V1DA 4CZCA 3CUQC 2AHQA 2IGOA 1OMIA 2L2OA 4WF2A 2D1HA 2IGKA 4QWQA 5BNGA 4WCGA 4EM2A 2XPUA 4HV6A 2Q0OA 1Z0XA 2XDVA 4XKCA 4RBOA 2LNBA 2L3DA 1B8IA 2E1CA 2FMYA 2XAJA 5EGOA 4LD5A 1IN4A 3L2UA 3K4LA 2G7UA 1JGSA 2NVYJ 2CW8A 3NAUA 1RC9A 2DTRA 4KYWA 2PJRB 4M6YA 1VI0A 2N8GA 4L5IA 2H1KA 4PCQA 3F72A 4B44A 4M3GA 4AVZA 4BE2A 3H35A 3HUGB 4OIQF 2JN6A 4DYRA 3I59B 2ME0A 4ON0A 5LLQA 1P4XA 4Y17A 4ZDLA 5BQTA 3BR1A 3EQLF 5E17F 5JHUA 1MMAA 1BIAA 1XN7A 4PZJA 4Y7NJ 2A6TA 4HF1A 3CCEI 5HLGA 1QZEA 1OLTA 2ZFWA 3RPQA 4XLNF 1F1ZA 2Y0SA 2VIXA 2NS7A 2L9SA 2A3SA 2MBFA 3S8PA 1FWZA 2OU2A 2ZCWA 1YITI 3I5UA 4IRHA 4GGGA 1VQMI 2EB7A 1B6AA 1W36D 1BC7C 2FEZA 2E2JJ 3DBRB 3CMAI 2K86A 2J5PA 3ASNH 2GA1A 1BR4A 2KJBA 2CV0A 4XRFA 1A5JA 4F92B 3L1PA 3CMYA 3ZQHA 3FDYA 1QGPA 4EM0B 1WFXA 5M5XJ 5AIPA 4HQMA 1VQ7I 4OIOF 2DW4A 3HM5A 3KP3A 4HG2A 2ELJA 2GLOA 3BC8A 4WWCA 3K10A 3IC7A 1MBGA 1WH7A 3SZTA 2H6CA 3EUAA 3HDDA 3ZOBA 3V7CA 3ZGKA 1MJ9A 2R0QC 5HDGA 2O6GE 1Y1WJ 3EDPA 3TO7A 3I56I 3CLOA 2HDCA 2EWNA 4Y33A 5LHHA 2W4SA 1XGSA 3LQQA 2QCOA 3DPTA 4RS8A 1S7OA 3FISA 3L2WA 3T8RA 3FHNA 3O6BB 4YG2F 2PEXA 5EGOB 2XASA 3RZDJ 3RI4A 1LKXA 3LL7A 4HSRA 4G7ZF 1U5TC 1OJLA 3LSPA 1U78A 2OTLI 3SEZA 4WX9A 5HOOA 1MMGA 1MNEA 4EV0A 3ERMA 3KPHA 1V5EA 1GXPA 1MSEC 4KISA 5GTHC 3B73A 4E7KA 5J40A 2QUFA 1UG2A 5L3EA 3H5AA 1O3QA 5CVRA 3T0YA 2O8KA 1BI1A 5K5OA 2JA6J 3Q5FA 2PFBA 3JTGA 4JX6A 2HVQA 1ULYA 2X0LA 1M1EB 1X2MA 3QYFA 4ESJA 2HOTA 2X51A 4BQQA 2R7DA 3K4NA 3JREA 4IPAA 4A0ZA 3ZPLA 1BIBA 3PSFA 4MHGA 1JE8A 4YRVA 3HSFA 3BTCA 1XMAA 1Z3YA 3GFIA 3MFKA 3SDBA 4UUTA 5HVQC 3TBIA 4M6XA 4KDPA 2BOLA 4J19A 5HS7A 2K7LA 5CJ9A 4PJ0C 2ZBKA 1MBFA 2W25A 4C9YA 2EV5A 2H6BA 2XSJC 1ENHA 3GMEA 5F0CA 1D5VA 1UG0A 1TW2A 2ZJPF 3DEEA 2M3AA 2JA2A 4I02A 2HYFA 2GOMA 4MNUA 2NVTJ 2DQRA 5BPIA 2L7MP 2XV4S 1T38A 3P9KA 4J01A 5FB2A 2DMQA 3IAM2 3HOYJ 2HTJA 2LTPA 3BZCA 3LAJA 1T2KA 1Z6TA 3GCMA 1TWFJ 1YJ9I 4P96A 1GDTA 1YE9A 2KLOA 1T56A 1I50J 5HLIA 1Z3XA 3C3WA 4LFUA 4BH9A 1JTXA 2MLGA 3S17J 2VQCA 1UHMA 2HFHA 5A2QZ 1YRNA 3WGIA 2G9WA 5KAFC 1S9HA 2F48A 2CJJA 2MG4A 3HJEA 3I3LA 4CCKA 3WU1B 4HBLA 1B9MA 1HSJA 2F5EA 3ZQFA 5M5YJ 5ED4A 3S14J 4A93J 5JR3A 1FTTA 4AYBN 3P9IA 2NOGA 2MW8A 1YX5A 3OR2C 1TBXA 5C44J 2EILH 2B9SA 1QRYA 3E5UA 3BZKA 2QVOA 2VKEA 3AG1H 3ABKH 2JT1A 4HLXA 3U1DA 3AFHA 2ELKA 3BR6A 3ZN1A 2DYSH 1T6SA 1FSHA 4KA4A 1FTZA 3WGGA 4AIKA 3IKTA 2CH0A 2XAHA 2ZNZA 4Y13A 1HLVA 4I09A 3ABUA 1JI8A 2DTZA 1I6XA 1T98A 1X1BA 2LDUA 3FXOA 2HQRA 2EFNA 5KVRA 5K5RA 4BDYA 3OSFA 4NC7A 3K70D 3R4KA 1KZHA 4B1RA 1SMYF 2LR8A 2XAQA 1U8BA 3ML6A 1G4DA 3EUKL 5CQEA 2LFBA 3MD2A 3FXUA 4PJNA 3ASOH 2JZYA 5GTIC 1RUOA 1IGNA 3C2BA 1YLFA 1LVKA 4LLLA 4AIDA 4C2UA 4L0YB 4IQ4A 2OPTA 4A3KJ 5FO5A 2X6YA 4ZTJA 3PNVA 1IN8A 1PP8F 3QU3A 1VQ5I 3O2PE 2MA3A 4A69C 5DTDA 5M3MJ 2DK8A 5E79C 3S2HJ 3SXYA 1IDZA 4U88A 2DA5A 2CV2A 2RC4A 3NWTA 4ENNA 4XLFA 2HXIA 1X3WB 3HXLA 2LSOA 3DKYA 2ZJRF 2I5UA 4MTEA 2OJED 3BJOA 3IH3A 1ZARA 2W48A 3CC2I 4G12A 1SD6A 3HYIA 4AC0A 5EEGA 1MDMB 1P4WA 2MC4A 2F4IA 1DQUA 2JSPA 3AG4H 3D5RC 3Q0WA 3X2QH 2I8DA 2HDWA 2QQ8A 5HS8A 2WAQA 2OQRA 1XMKA 2A6EF 4XN3A 2P4WA 1W4MA 4DBRA 3VPRA 1SFEA 4A6DA 3GTOJ 2MD5A 3H9QA 3I54A 4XIDA 3KYDB 3E7LA 2AQFA 4BY7J 4A3JJ 3I4NJ 3H3VK 3F22A 1AWCA 2ZJ2A 3CUQB 2KZGA 4XK4A 3QRFF 2OCCH 3AG3H 2XUBA 4FT8A 1VQOI 2GIZA 3WE2A 3HPGA 3H5RA 1Z77A 2VL8A 1IN7A 4LITA 4BXFA 2DA1A 2LF8A 2MD0A 2CU7A 5CVJA 2ID3A 2QF7A 3RYPA 5L3DA 3IV5A 2G7HA 3CJRB 5EYRA 2Q1ZB 4WK8F 3CCLI 3KE2A 2H27A 1U5TA 1U6GA 2VJJA 5B1AH 2DFHA 3HSEA 2JVHA 4HLYA 1LFBA 1BI3A 2XPVA 2JRTA 3QPLA 1OKRA 1U9NA 2PI0A 2E35A 4XLEA 4D7MA 4ZYEA 1RIOH 3HB9A 1W36C 3GTMJ 1KA8A 2NNYA 1GV5A 4HDVA 2IA0A 2W1OA 2X1EA 2H8RA 2E1NA 2G0EA 2EINH 2K85A 2DMPA 3BG9A 3PFYA 3OYKA 3HTSB 1BW6A 1RESA 4FQGA 3BPXA 4E7ZA 4XLPF 3WG7H 3HIFA 2LKXA 2HU9A 3GZ5A 4UUVA 1D3YA 1IG7A 3DCFA 1BN5A 3BG7A 4KN4X 5GAHJ 1OCTC 1IRXA 2DFEA 2JQ7A 2YU9J 2EFOA 2LKPA 2CQKA 1I5ZA 2KP6A 5CKTA 2NVUB 4M6VA 1X1AA 1A6QA 4EM1A 1O3TA 2X6OA 4IZZA 3O8GA 2ETHA 2HTSA 3RCOA 1QPMA 3L9FA 2E2HJ 3FBNB 2CYYA 2M4KA 1FC3A 1XCVA 2F5DA 1LFUP 3CC4I 4LLGF 1JUSA 5JI6A 2M30A 4HOBA 3U1KA 4GDFA 4RGRA 1TNSA 4YFNF 2BVLA 1VQ8I 5D8KB 2M87A 3LSHA 4A3MJ 1NH3A 2H8WA 1AA7A 4HSTA 3KP7A 2COBA 2GQQA 5M3FJ 1TW3A 2DN0A 2HDDA 3UKGA 2HI3A 3VOEA 3M8JA 5ERIA 2WB1N 1Z9CA 3G2BA 1WZ2A 3P9CA 2BVMA 3WTWC 4XL9A 3MKWB 3QWLA 2DA7A 2VXDA 3DKXA 1T8IA 1U5TB 4KUMA 4II2A 4BJ5C 4YFKF 5C4JJ 3G1OA 1PUFB 3DEWA 2VONA 1GHCA 2FRHA 1J75A 4CO8A 2IS1A 2V1UA 2FJ1A 3RKXA 4KMFA 4NHJA 3OYCA 3RQ4A 1ZYRF 1YW9A 4PK4A 4M73A 1JUMA 5IP6A 2KPMA 5J6XA 4RGXA 4XSZF 4LIVA 1IUYA 3CDLA 3S16J 2EQRA 4FETA 2DXIA 5HNHA 1X19A 1H9GA 4Q48A 1T95A 3BT9A 2WY8Q 1ZHFA 2JRMA 4JQFA 1BW5A 1YW8A 2XHKA 3PL8A 1ODDA 2YX7A 2Z5UA 3FXQA 3MZHA 4ZDOA 3DPLC 2HXOA 3LQRA 4NDLA 4CYDA 1TT5B 4NB5A 2X48A 4CGZA 4NUBA 4U87A 4H4KC 2IAIA 2KJCA 3GLLA 4E7HA 4HV5A 2BHYA 2VKDA 5K7HA 1UB9A 2Y2ZA 2DU9A 3ZCOA 3HGGA 3B6CA 1FIPA 3ULQB 3ZMUA 4XNFA 5J8CA 2WTEA 4LG0A 3IWFA 2P5KA 3GBGA 2AQEA 3TOAA 3GWZA 3UNGC 5LHIA 3VODA 3ZQ7A 5HODA 4YFXF 5C4XJ 3JSPA 3U9GA 2E7WA 2HQ5A 2F5FA 2M8EA 3QODA 4C3IJ 2ID6A 1QA6A 1XGMA 4CYCA 2KMUA 4M3BA 4AU7A 3K70C 1WVRA 1QPIA 1MGTA 1XSVA 4R1HA 4GRIA 2STTA 3BR3A 4EVIA 4MQVA 5FLXZ 4XN0A 4CCMA 2CV1A 1CF7A 3GX4X 1OCRH 4PSXA 2K9SA 2RREA 3CLQA 1E2XA 4GO1A 4PJJA 5FGMA 5TJJA 2OZ6A 2HPMA 4EGZA 4HNTA 2EA4A 1U2WA 3FM3A 3L2RA 1AHDP 4LG3A 2K02A 1FZPB 3PUFA 4BXXJ 2LC2A 2IT0A 3DFGA 3SHFA 5EEAA 1QHGA 2KIQA 3VYUB 1FBUA 4NBQA 2UXNA 2Q2EB 3WU0A 1MIJA 3ZRGA 4Y3OA 3GLXA 4FISA 3RTRA 3BG3A 4G6TB 4M72A 1HW2A 3KP5A 4MEYF 2LD5A 3E6DA 2QSHX 2PJRA 1HKQA 5CVVA 3BROA 4D5CA 5E8GA 5JFRA 2R7XA 2V79A 2MH2A 3DU6A 3RDIA 1R1VA 3QPTA 2BXYA 3HUGA 3RPUD 1POGA 1K6OA 1SEUA 1U3EM 3DQVC 4BGDA 2JA5J 3I59A 2P8TA 4L9TA 4I0AA 3ZN0A 1UCRA 1VQ9I 1DP3A 4N4OB 1WI9A 2XGDA 2VE8A 1RI7A 1SC7A 1FEXA 2D5VA 4RB1A 2XAFA 2DCEA 3OMYA 4LMYA 3A0BC 5F27A 1J0RA 1TT0A 2DA6A 5IYBJ 5E8IA 3NWSA 2BV6A 1UJ8A 1B1BA 2PQ8A 1UELB 3ZP5A 3KCCA 3TO9A 3PO2J 4BE1A 3EPZA 1W0UA 4G9YA 3KX2A 3FMSA 2XF5A 1K6YA 2K4BA 2K9NA 3CTAA 4YEJA 2L54A 2GXBA 1VQ6I 4E4HA 4A3DJ 2VLAA 2LVSA 2H1LA 2H94A 5BS6A 1HBXG 5D5XB 1Z7UA 1FYMA 3VEPA 5L3CA 5E3NA 1HDDC 1WWXA 1EV7A 2V1XA 4X6AJ 3WTTC 1FOWA 4F7ZA 3R61A 3VYSB 1BOBA 5IT9K 4ZZLA 1SD5A 4B8XA 2FX0A 2F5VA 3CCUI 1X1PA 5FD5A 5E20A 5EDNA 4OMYA 2R5YB 2ZSIB 3ZQLA 4HA8A 3E0JB 2IGMA 2DPDA 4XLHA 2HVSA 2I10A 5J3LA 3JW4A 4CDGA 5E1XA 4QSHA 4C2MJ 2R7VA 3F9KA 4XKBA 1X4PA 5FLVA 2ZKZA 5J4VA 4P9FA 1MSFC 1H89C 2QYOA 3HBLA 3JRHA 2DOFA 1DGRM 2CRGA 3J81K 2QBYA 1H9TA 4FX4A 4ZYAA 4YIRX 1OCOH 3WODF 2HYGD 2C6YA 4U7DA 2XGXA 2XKPA 2PMZA 3KEOA 4RAGA 4B43A 1SAUA 4KT5C 1T08B 5LD2C 4PSWA 3C1DA 3QP6A 4KITB 1SVMA 1W7PD 3JRFA 1OFCX 4ZTFA 3MAJA 4IHSA 4QTRA 2B63J 1Y39A 1APLC 2YPRA 3MKYB 3WHCA 1J5YA 1TQMA 1Y0NA 2GBYA 5F64A 1DU6A 5DEQA 4CSWA 1LQ1A 4A3LJ 4MQ9F 1A6IA 3LAPA 2A5YB 2CFXA 4HX7A 1LNWA 5KCMA 4KN7X 4JK1X 2CUJA 1KQ9A 1SD4A 2O9LA 3TP3A 1Y8QB 3JSOA 1NG7A 2FBIA 3TMOA 1ZR4A 5D4SA 4XMYA 2ZFUA 4G94A 3HSRA 1NK2P 4UVBA 5IYDJ 3GTKJ 1F5TA 4BE0A 3K4BA 3HKZA 5FD6A 1E3OC 1IW7F 3PQJA 2PMUA 3IUOA 1K7AA 3V8KA 5GPCA 1WHUA 4XKWA 1QO0D 2QLZA 3WTSC 3ECOA 4OIRF 3TDUC 2DI3A 3FBIB 2NYXA 2BY2A 1ZTRA 2FE3A 1FYLA 4UNOA 1FOYA 3B02A 3QAHA 1RR7A 1PDNC 6PAXA 3PUBA 2WA0A 2K9QA 3KZZA 4N9HA 4P55A 4XOPA 3S93A 4M3DA 1MNMC 4M9XA 2M4GA 3ABLH 5IYCJ 4Y52J 3PIPF 3OS2A 2X6XA 1S29A 3G3ZA 4L5JA 4BHBA 2ISYA 2QBYB 3ECHA 4CXFA 2WAFA 4IX7A 2DJIA 2Z99A 3CMEI 3A4CA 3JR9A 3D1NI 3LFKA 5HLTA 1YW7A 1BR2A 5LHGA 4XR6A 1FJLA 2ZXJA 3DLLF 2QEXI 3HOZJ 5DD4A 3CCMI 1XSXA 1P92A 4RAFA 1RKWA 1N25A 3CQZJ 5FRMA 4ZYDA 4AD9A 5EEHA 3F8MA 3ZXSA 1MZBA 3I9V2 4BAYA 4KICA 2ISZA 2FUG2 2FMLA 1FNNA 3PNTA 1VZ0A 3A03A 2OV7A 1JUPA 5B66C 5FLMJ 5E3LA 1D1BA 2DK5A 4B09A 4RB0A 3H3ZA 3EYYA 1W5SA 5K7ZA 2M8GX 2J5OA 3BTIA 2NXNB 1XX5A 3F8CA 3HC7A 5IOYA 4E7LA 1B72B 3S2DJ 2XB5A 2QQAA 3V8LA 2GZWA 4AVPA 4XICA 3TDZC 3OYFA 3S1MJ 3PSIA 1U0JA 3K6GA 3BLYA 3LSMA 3TW7A 3R60A 2L9RA 5E1ZB 4PGGA 2IJLA 5D4RA 2UZKA 3MN2A 2P0WA 2EZKA 2W00A 3BR5A 4BS9A 3S3OA 1BC8C 1ZG3A 3CO7C 2LOOA 4XM3A 5IT9Z 5L3BA 4NQWA 1JT0A 1D8JA 2L4AA 3PQKA 1VQNI 1MBHA 4JOMA 2OUMA 2JUCA 3OL4A 1K78B 5DM6F 3JAMK 5GAEJ 3S3NA 3N97A 1MDMA 1WJEA 4U0WA 1MH3A 2LMDA 2O03A 2X1DA 4Y15A 4BHCA 2PBIA 3KZIC 1HSTA 3LSTA 2FOWA 1YJWI 4UXNA 2Y9YA 3K2ZA 3RKYA 4V2FA 3TKYA 2FBKA 2Z3YA 1I3QJ 1XDSA 4N9IA 4KFCA 1WGXA 1HXDA 3BWGA 1OQYA 3TO6A 2JMWA 4B47A 2IRFG 3CUQA 3MKLA 1ETYA 2X9DA 1P6RA 2JTVA 2WV0A 3BPVA 3QOPA 1Z05A 1WQ2A 2OAZA 2Y0SN 2Y69H 1WJDA 3S1NJ 2KT0A 3OYIA 4FTHA 4DJAA 2FA5A 1ETKA 5EJCA 2W7NA 1R5HA 1X2NA 2P6TA 1JJ8C 2VPLA 4XORA 2RV8A 4U0YA 2CQ7A 3ABTA 2RNJA 4IHTA 2V1NA 2XAUA 1RZ4A 1X58A 3V4GA 4KMUX 3TOBA 3VFZA 3QPHA 5BPDA 2NVXJ 4FCYA 4ZDPA 1IZ1A 2KZVA 3J7ZI 2KIUA 4JP0A 4PGHA 3L2VA 3NQOA 2P81A 4F55A 4MTDA 3OS1A 2OQGA 2FU4A 5D6EA 2CGPA 4ENJA 3CESA 3WTZA 3B6AA 5D5VB 2QQBA 2V4JC 1LE8A 3EETA 4XRSA 2K9LA 2RQQA 3BJAA 2DMTA 3DEUA 4XOTA 5H6QA 1F9NA 2O0YA 3GO5A 5FFZA 3SDGA 4P1WA 2OD5A 1A36A 1BL0A 4NQWB 3S2WA 2LP0A 1I39A 3GTQJ 4M3EA 5D6FA 5KK1A 4A3IJ 2KIMA 4IJAA 2YU3A 1TWGJ 3KEYA 1R5GA 2V7FA 3M1CA 2R7ZJ 2HOSA 4HX4A 3OIQA 4EEFG 4PFOA 3FK6A 3DPUA 2Z33A 1R4MB 4AUXA 1STZA 1VQKI 2VODA 4RAYA 3SZGA 4E7IA 1K4TA 3CD6I 3L09A 1ZG1A 2OZUA 1FY7A 4EGYA 1VQ4I 5IPAA 3VSLA 4BQNA 1YHQI 2JK3A 3GW2A 1MNDA 1WH5A 3H9JA 1EF4A 3I4MJ 1FPQA 4HF2A 3CZ6A 4GYGA 4BJTA 2W57A 3P5JA 4L9JA 2KFDA 1D0ZA 1X1CA 2QGUA 3OYAA 2VN2A 1IV6A 3OYDA 3T5XA 5LFAA 3I55I 1FIAA 3KLNA 3QU6A 2GM4A 2FNPA 1ZR2A 4XRSG 1NHAA 4L9NA 1K4SA 4RB2C 1KQ8A 3CJQB 1P9QC 1V4RA 1USSA 3LA2A 3K4CA 3HHGA 1PUFA 1KGSA 1T33A 2CS3A 2GIVA 2ME6A 5ICCA 1JXSA 1W1WE 4NC6A 3K9TA 2VB6A 3JTHA 1G3SA 4S0HB 2GXGA 2O8XA 4MIMA 4UVAA 3WE3A 3ZMTA 4BQAA 5LRRA 5J4YA 1TC3C 3DTEA 4KIBA 3L2QA 1Z21A 1Q1HA 1XGOA 1GT0C 2HZDA 3HRUA 2IA1A 4HYEA 4Z2YA 1GLNA 4KIFA 1LE8B 3HRTA 4AIJA 1P7IA 5CQGA 3IWZA 2BY0A 3GZNB 4U7BA 2IGNA 3AAFA 3FKIJ 1SANA 1E3PA 1KU3A 2M2EA 2VBYA 1DPUA 2X4HA 3QYEA 1ERDA 1KU7A 2UV1A 4WXDA 3AG2H 2E19A 3LOCA 2CG4A 2ZSHB 3C7JA 1JKOC 2Y30A 4OAYA 2ZC2A 2HPIA 3NEUA 3D5SC 2MC3A 1B59A 3BY6A 3ZMZA 1G6NA 1S72I 3FX3A 1BR1A 2KRHA 2XF7A 5ILSA 4F93B 3JRDA 4A3BJ 2OBPA 3C2GA 1ON2A 5FKLA 3S32A 1LPQA 3AL0C 4D1QA 1TWCJ 2QZ8A 3FXJA 2K3PA 3GTPJ 2VC0A 4ITVA 3LSRA 3MQ0A 4DNCA 5TRDA 1EA3A 2XRNA 4BQOA 1LB2A 2LKSA 4BHPA 2LY1A 2IXSA 3ZMSA 2CW0F 2M45A 2IS2A 3K4KA 1OYIA 2K27A 1IO2A 1WJFA 2KHMA 4EJUA 1ZLKA 2M0CA 3BDDA 4RM2A 3J80K 4E7JA 3CDIA 2D45A 4RAZA 3TEDA 4BDZA 1KYWA 1LEAA 2QKLB 1SFXA 2RKHA 3M9AA 4BACA 2F6CA 1S3JA 1FMWA 1Z6RA 3OYBA 1ZRFA 2EJRA 2OTJI 2E1MC 3PM1A 1BOAA 3WGHA 5LGTA 3OYMA 2CW7A 2LF7A 1WJCA 3RPUA 4FX0A 4IHYA 4RLFA 2O3FA 4RDUA 1K61A 2E60A 2Q2EA 3FZVA 2R3SA 4A6EA 2O7OA 2KKOA 1AKHA 4FE4A 2CFOA 4BL0B 3MEXA 4HDUA 1FSEA 1P4AA 1UAAA 2XKOA 2GWRA 4IEJA 4IOAF 1OYYA 4MGRA 2EZIA 1ZN2A 3A2KA 2IEKA 1R7JA 2DFIA 1Z1DA 3CCVI 4X1EA 3Q9SA 2W84A 2YR2A 2CWEA 4NNJA 3F8BA 1G3TA 5H6RA 3TGNA 4BY1J 4UUSA 2WAQN 3FMRA 1DU0A 1BA5A 4DOZA 2RGVA 2MGQA 3HGYA 4YELA 4IO9F 4BNCA 4IQJA 3CJTB 2R7WA 3OV8A 3HOWJ 3CDHA 3GFLA 2L7ZA 3FKJA 1TP4A 1N75A 3REOA 2EBIA 3CCYA 2A68F 2L7KA 3OYEA 1ZELA 2JA8J 3FIWA 3N05A 1HW1A 4FASD 1J7KA 3VWBA 4AWXB 5D5UB 4HF0A 1WRJA 2DMUA 3TW6A 5EG0B 3CCSI 1J2XA 3ZQQA 2AO9A 4RB3C 2Y31A 3JCUC 3W3CA 2NVQJ 1LDKB 1YS7A 2BW3A 1YO5C 3GTLJ 5EZGA 3A0HC 1Y1VJ 4G7OF 4JYKA 1R58A 4XLAA 1G2HA 2H09A 3HZJA 3KP2A 2ZNYA 1ZH5A 2DT5A 3CP2A 3IRQA 5GAGJ 4ESBA 1DDNA 2M1BA 4P9UA 1K79A 1OISA 2A5WA 4LOCA 3M8EA 4KJZA 2R7TA 5CVIA 4UHTA 3WHBA 3OYNA 2W82A 2W24A 4OINF 2F4MB 1YYVA 1DUXC 2XGEA 3H92A 3HOUJ 2E2IJ 5TISC 2ZJQF 2ECBA 5KAIC 2LBFA 1W5TA 2VBXA 4ESFA 1MBKA 2NRAC 1WCMJ 2YX4A 2DO7A 1XDUA 2R5YA 3TQNA 3FF5A 2EV6A 1OR7C 1V5FA 1YFHA 2CQXA 3PO3J 3E5QA 1AKHB 4HPQA 1D8KA 3HL2A 1IRFA 1N77A 1YQAA 2EZLA 2KRFA 3G6EI 4GCVA 1FOXA 3PFIA 1W7PA 2EH3A 3KP4A 2QENA 3ESWB 2DPUA 2AXTC 1D1CA 1NG6A 3J7AY 3OL3A 1IAWA 3M3YJ 1S7AA 3LNQA 3F6OA 3WTUC 3SFZA 3W6VA 3FXMA 3A01A 2R7FA 2VQLA 3LMMA 2L5QA 1KQ0A 4RA2A 1IN5A 3IH2A 1JJ6C 4LK1F 4UUSB 1KU2A 2DMNA 2R7UA 3D0SA 3RIRA 1QZZA 3LA7A 1HOMA 2RNGA 3LSIA 4OWRB 1HDPA 4F91B 2VC1A 4HX8A 3QPSA 4B3XA 2DAOA 2KIFA 5F04A 2E34A 4ANJA 3GTJJ 4V2GA 3LSKA 1Z7LA 1XPXA 4CCLA 4IRGA 3MKZA 3MZ8A 4A5MA 1GVDA 3I4PA 1C0WA 3ONQA 4LB6B 2VKVA 4NC8A 1R1UA 2CQNA 4MEXF 3J80Z 3BG6A 1CQTA 4LIUA 2QQ9A 3GZ6A 3Q3SA 4I76A 5HDKA 1S7EA 2VT3A 3ABMH 3LFUA 5ICFA 2NS0A 1IV8A 4CUGA 2Z1DA 4L18B 4UY8I 2UUZA 1UHWA 2BW3B 3G71I 2FF4A 3BJ6A 3K0LA 5EZHA 4HW0A 3W6KB 4TV7A 1IJWC 4R79A 2EFQA 1ETOA 2K40A 2P6SA 2IW5A 1WJBA 4ZYHA 5K7FA 2BZTA 2X1CA 3H36A 2RDPA 5LEKA 1XSDA 1MBJA 4HAMA 1HKSA 2IPQX 3SQNA 9ANTA 1OPCA 3GF2A 3K4MA 5ILUA 1R9TJ 2KRCA 2R5ZB 4K2EA 2DYRH 1ZG5A 1BJZA 2BE5F 4RMNA 2LBFB 1G59A 3K1NA 5J1YA 2K9MA 1F36A 4DBQA 3HOXJ 4D7NA 3KZYA 1TL8A 2QSGX 2DLLA 4OIPF 5CPRB 2RN7A 4LJZF 4BJ6C 2XB0X 3IH4A 4GYIA 1LVAA 2VJ4A 4UVCA 5JHFA 3OIPA 1IXSB 1J59A 5FROA 3RSNA 1W7PB 4M9SA
chains in the Genus database with same CATH topology
5IP9J 1Z77A 3MN2A 2EZKA 4BBRJ 3BR5A 3Q0VA 5FJ8J 2KDZA 2DA1A 2VPRA 3K7AJ 2CU7A 2ID3A 2QF7A 2EZHA 1JT0A 3IV5A 2Y9ZA 5EYRA 1MBHA 1MBEA 1ITYA 3A01B 5J1RA 4IHVA 5E3MA 1XG1A 1LFBA 2XPVA 1IRZA 3QPLA 1U9NA 4BKXA 1MH3A 4IHXA 4D7MA 3HB9A 3GTMJ 1ZK8A 1GV5A 1UMQA 1ZGWA 2ECCA 1VNDA 2H8RA 2Y9YA 1NK3P 2R5ZA 1HF0A 4L5EA 2HOAA 4V2FA 1Q1VA 2G0EA 2DMPA 1I3QJ 1P7JA 3BG9A 1WGXA 2JJ7A 1BW6A 1RESA 2JMWA 1NTCA 4D5FA 3BTLA 3NARA 1B72A 4C3HJ 3ZQIA 2LKXA 3G1LA 2TCTA 3G1MA 3MKLA 1ETYA 2X9DA 2YUSA 1IG7A 3DCFA 1OCTC 2YU9J 1XC5A 5IP7J 3BQYA 3RZOJ 2Y0SN 4M6VA 3S1NJ 1O4XA 2KT0A 4FTHA 2X6OA 1ETKA 3QQAA 1ETVA 5IOZA 1GUUA 3O8GA 1JJ8C 1X2NA 1ETWA 4JX5A 2E2HJ 1X58A 5GP9A 1LFUP 4A3GJ 1JUSA 2NVXJ 2IBDA 2DA2A 3HOVJ 4FCYA 5FKMA 4JP0A 5GPAA 2TRTA 2P81A 4MO7A 2XGCA 1ZKGA 4C3JJ 4A3MJ 3B6AA 1RPWA 2L0KA 1LE8A 1F43A 1IUFA 4XRSA 1MH4A 3GTGJ 2COBA 5M3FJ 2DMTA 3H0GJ 2DN0A 2HDDA 3UKGA 2HI3A 5JLXA 1WPKA 2WB1N 3BTJA 2JA7J 3SDGA 2MSYA 1BL0A 1JT6A 2L7FP 2M34A 2ZB9A 1B8IB 4MFEA 2LP0A 2DA7A 3GTQJ 4M3EA 1U9OA 2VUMJ 4A3IJ 5C4JJ 2HYJA 5F1JA 1TWGJ 3G1OA 1PUFB 2R7ZJ 3DEWA 2HOSA 4EEFG 3FK6A 3OOUA 2FD5A 4AUXA 2E1OA 4W97A 2FJ1A 4MLOA 3SFIA 3ZQGA 2LY9A 4M3FA 2FQ4A 1JUMA 5IP6A 5EF6A 1IDYA 2OF7A 3JRBA 5DS9A 5IPAA 3CDLA 4CYCB 3S16J 2EQRA 2JK3A 1WH5A 1EF4A 3S1QJ 3I4MJ 1JKQC 3BT9A 4DZJA 2R92J 1BW5A 4XRMA 2DA4A 1IV6A 2AHQA 2HXOA 1FIAA 4NDLA 2X48A 2GM4A 1ZR2A 4XRSG 5BNGA 3OSGA 4JX4A 2IAIA 2XPUA 1Z0XA 1GV2A 4RBOA 4B3AA 5K7HA 2Y2ZA 1B8IA 3HEFA 3HGGA 3B6CA 5EGOA 1FIPA 1PUFA 4DW6A 1T33A 3GBGA 2ME6A 2NVYJ 3NAUA 4S0HB 4MIMA 1VI0A 5HODA 2N8GA 2H1KA 5C4XJ 4M3GA 1JKPC 1TC3C 2RAEA 2HQ5A 4C3IJ 2ID6A 3O8HA 1GT0C 3M4OJ 4CYCA 4M3BA 1QPIA 2JN6A 1LE8B 4DYRA 1P7IA 2ME0A 3BR3A 2LK2A 2PMZN 3FKIJ 1SANA 3RQIA 2M2EA 3BR1A 5FKOA 4Y7NJ 2K9SA 4BBSJ 2E19A 3LOCA 3SJMA 1AHDP 2NS7A 4DYCA 1JKOC 2Y30A 4BXXJ 5EEAA 1HCRA 3JRDA 2XRLA 4A3BJ 1VFCA 5FKKA 2E2JJ 5FKLA 3BR2A 4FISA 3BR0A 1H8AC 1TWCJ 3BG3A 1A5JA 1ETQA 2LD5A 3L1PA 3CMYA 3ZQHA 1IC8A 3GTPJ 3LSRA 4D5CA 4DZPA 5M5XJ 2CQQA 3HM5A 1WI3A 2GLOA 1POGA 1MBGA 1WH7A 3HKZN 1TWHJ 2M0CA 3JRGA 3HDDA 3ZOBA 2JA5J 2R0QC 1H88C 3MVPA 3TEDA 1Y1WJ 1SFOJ 2XGDA 2QCOA 1FEXA 2D5VA 3FK7A 3FISA 1W0TA 5F27A 5M5WJ 2DA6A 5IYBJ 5EGOB 3RZDJ 4A3FJ 3PM1A 3K2AA 3Q0UA 1OJLA 3LSPA 1U78A 4A3CJ 4IHYA 3PO2J 3F0CA 4RDUA 1K61A 1VF9A 1MSEC 1W0UA 4MFDA 1UG2A 2O7OA 1AKHA 2O8KA 3JRCA 2JA6J 2K9NA 4FE4A 4JX6A 4A3DJ 2HOTA 1X2MA 2LVSA 3JREA 4IEJA 2EZIA 1YRNB 2NS8A 5E3NA 2XSDC 1HDDC 2IEKA 3BTCA 4X1EA 4X6AJ 4UUTA 3JRIA 4J19A 4BY1J 2DJNA 5E3OA 1ZQ3P 4UUSA 2WAQN 4FE7A 1DU0A 1BA5A 1MBFA 2MGQA 3HGYA 4HNVA 2FX0A 1TWAJ 1RETA 3HOWJ 5FKNA 5EDNA 2R5YB 4DYQA 3ZQLA 5F0CA 1ENHA 2YS9A 2L7ZA 2EBIA 3CCYA 2NVTJ 2I10A 2DA3A 5J3LA 3OIOA 3RKQA 2JA8J 3FIWA 4QSHA 4C2MJ 2L7MP 2R93J 5FLVA 1ORKA 1MSFC 1H89C 2DMUA 2DMQA 3HBLA 3TW6A 2LTPA 5EG0B 3JRHA 3HOYJ 2CRGA 2AO9A 1TWFJ 2VI6A 1D5YA 2Y31A 3S15J 1GDTA 2NVQJ 1T56A 1I50J 3GTLJ 5EZGA 1Y1VJ 4JYKA 1G2HA 3S17J 1JTXA 1YRNA 3ZQCA 2JWTA 1AU7A 2CJJA 2MG4A 4LOCA 3JRFA 1OFCX 5J1UA 3ZQFA 5M5YJ 3S14J 3A02A 3WHBA 4A93J 4QTRA 4AYBN 2B63J 3LSGA 1APLC 1FTTA 2NOGA 3WHCA 2MW8A 2XGEA 2GBYA 2E2IJ 3HOUJ 2ECBA 5C44J 1DU6A 1QRYA 4A3LJ 2VKEA 3S1RJ 5F0HA 1A6IA 1MBKA 2ELKA 3BR6A 1K83J 1JGGA 1FTZA 1WCMJ 2R5YA 1JTYA 3PO3J 1HLVA 2CQXA 1AKHB 2O9LA 2DTZA 4W1UA 2EZLA 3TP3A 3OSFA 1ZR4A 2EH3A 4B1RA 1NK2P 5IYDJ 5EG0A 4QIWN 2LR8A 1U8BA 3GTKJ 3M3YJ 3LNQA 2LFBA 1E3OC 3W6VA 3A01A 1IGNA 3C2BA 1OCPA 3IH2A 2WV1A 5GPCA 1JJ6C 5F08A 4UUSB 4IHWA 2DMNA 2OPTA 2M9HA 4A3KJ 1HOMA 1HDPA 1ZTRA 2XPWA 3QPSA 5F04A 3GTJJ 4V2GA 1UHSA 1GVDA 1RR7A 3LSJA 4A69C 2K9QA 1QVUA 5DTDA 5M3MJ 4M3DA 1MNMC 2VKVA 1CQTA 3S2HJ 1IDZA 5IYCJ 4Y52J 2DA5A 3Q3SA 3BG5A 4I76A 1S7EA 4B4CA 3JRAA 2HXIA 1QVTA 5JLWA 3JR9A 3D1NI 1XS9A 3IH3A 5EZHA 1FJLA 2CUFA 2W48A 1IJWC 3HOZJ 1ETOA 2K40A 4G12A 4AC0A 1RKWA 3CQZJ 5K7FA 1MBJA 1I6HJ 1RKTA 3Q0WA 1JKRC 4I6ZA 4A3EJ 9ANTA 1R9TJ 3BQZA 3TP0A 3A03A 2R5ZB 1JUPA 5FLMJ 5E3LA 5F0FA 3VPRA 3GTOJ 1BJZA 5K7ZA 4XIDA 2M8GX 3BTIA 2CUEA 5J1YA 1F36A 3E7LA 4ABZA 4BY7J 4D7NA 3HOXJ 5C3EJ 5IOYA 4A3JJ 1B72B 3I4NJ 3S2DJ 2XB5A 3H3VK 4XICA 1ETXA 4GFBA 3S1MJ 2XB0X 3IH4A 4XK4A 3TW7A 2L9RA 2LLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 J;  1Z77 A;  3MN2 A;  2EZK A;  4BBR J;  3BR5 A;  3Q0V A;  5FJ8 J;  2KDZ A;  2DA1 A;  2VPR A;  3K7A J;  2CU7 A;  2ID3 A;  2QF7 A;  2EZH A;  1JT0 A;  3IV5 A;  2Y9Z A;  5EYR A;  1MBH A;  1MBE A;  1ITY A;  3A01 B;  5J1R A;  4IHV A;  5E3M A;  1XG1 A;  1LFB A;  2XPV A;  1IRZ A;  3QPL A;  1U9N A;  4BKX A;  1MH3 A;  4IHX A;  4D7M A;  3HB9 A;  3GTM J;  1ZK8 A;  1GV5 A;  1UMQ A;  1ZGW A;  2ECC A;  1VND A;  2H8R A;  2Y9Y A;  1NK3 P;  2R5Z A;  1HF0 A;  4L5E A;  2HOA A;  4V2F A;  1Q1V A;  2G0E A;  2DMP A;  1I3Q J;  1P7J A;  3BG9 A;  1WGX A;  2JJ7 A;  1BW6 A;  1RES A;  2JMW A;  1NTC A;  4D5F A;  3BTL A;  3NAR A;  1B72 A;  4C3H J;  3ZQI A;  2LKX A;  3G1L A;  2TCT A;  3G1M A;  3MKL A;  1ETY A;  2X9D A;  2YUS A;  1IG7 A;  3DCF A;  1OCT C;  2YU9 J;  1XC5 A;  5IP7 J;  3BQY A;  3RZO J;  2Y0S N;  4M6V A;  3S1N J;  1O4X A;  2KT0 A;  4FTH A;  2X6O A;  1ETK A;  3QQA A;  1ETV A;  5IOZ A;  1GUU A;  3O8G A;  1JJ8 C;  1X2N A;  1ETW A;  4JX5 A;  2E2H J;  1X58 A;  5GP9 A;  1LFU P;  4A3G J;  1JUS A;  2NVX J;  2IBD A;  2DA2 A;  3HOV J;  4FCY A;  5FKM A;  4JP0 A;  5GPA A;  2TRT A;  2P81 A;  4MO7 A;  2XGC A;  1ZKG A;  4C3J J;  4A3M J;  3B6A A;  1RPW A;  2L0K A;  1LE8 A;  1F43 A;  1IUF A;  4XRS A;  1MH4 A;  3GTG J;  2COB A;  5M3F J;  2DMT A;  3H0G J;  2DN0 A;  2HDD A;  3UKG A;  2HI3 A;  5JLX A;  1WPK A;  2WB1 N;  3BTJ A;  2JA7 J;  3SDG A;  2MSY A;  1BL0 A;  1JT6 A;  2L7F P;  2M34 A;  2ZB9 A;  1B8I B;  4MFE A;  2LP0 A;  2DA7 A;  3GTQ J;  4M3E A;  1U9O A;  2VUM J;  4A3I J;  5C4J J;  2HYJ A;  5F1J A;  1TWG J;  3G1O A;  1PUF B;  2R7Z J;  3DEW A;  2HOS A;  4EEF G;  3FK6 A;  3OOU A;  2FD5 A;  4AUX A;  2E1O A;  4W97 A;  2FJ1 A;  4MLO A;  3SFI A;  3ZQG A;  2LY9 A;  4M3F A;  2FQ4 A;  1JUM A;  5IP6 A;  5EF6 A;  1IDY A;  2OF7 A;  3JRB A;  5DS9 A;  5IPA A;  3CDL A;  4CYC B;  3S16 J;  2EQR A;  2JK3 A;  1WH5 A;  1EF4 A;  3S1Q J;  3I4M J;  1JKQ C;  3BT9 A;  4DZJ A;  2R92 J;  1BW5 A;  4XRM A;  2DA4 A;  1IV6 A;  2AHQ A;  2HXO A;  1FIA A;  4NDL A;  2X48 A;  2GM4 A;  1ZR2 A;  4XRS G;  5BNG A;  3OSG A;  4JX4 A;  2IAI A;  2XPU A;  1Z0X A;  1GV2 A;  4RBO A;  4B3A A;  5K7H A;  2Y2Z A;  1B8I A;  3HEF A;  3HGG A;  3B6C A;  5EGO A;  1FIP A;  1PUF A;  4DW6 A;  1T33 A;  3GBG A;  2ME6 A;  2NVY J;  3NAU A;  4S0H B;  4MIM A;  1VI0 A;  5HOD A;  2N8G A;  2H1K A;  5C4X J;  4M3G A;  1JKP C;  1TC3 C;  2RAE A;  2HQ5 A;  4C3I J;  2ID6 A;  3O8H A;  1GT0 C;  3M4O J;  4CYC A;  4M3B A;  1QPI A;  2JN6 A;  1LE8 B;  4DYR A;  1P7I A;  2ME0 A;  3BR3 A;  2LK2 A;  2PMZ N;  3FKI J;  1SAN A;  3RQI A;  2M2E A;  3BR1 A;  5FKO A;  4Y7N J;  2K9S A;  4BBS J;  2E19 A;  3LOC A;  3SJM A;  1AHD P;  2NS7 A;  4DYC A;  1JKO C;  2Y30 A;  4BXX J;  5EEA A;  1HCR A;  3JRD A;  2XRL A;  4A3B J;  1VFC A;  5FKK A;  2E2J J;  5FKL A;  3BR2 A;  4FIS A;  3BR0 A;  1H8A C;  1TWC J;  3BG3 A;  1A5J A;  1ETQ A;  2LD5 A;  3L1P A;  3CMY A;  3ZQH A;  1IC8 A;  3GTP J;  3LSR A;  4D5C A;  4DZP A;  5M5X J;  2CQQ A;  3HM5 A;  1WI3 A;  2GLO A;  1POG A;  1MBG A;  1WH7 A;  3HKZ N;  1TWH J;  2M0C A;  3JRG A;  3HDD A;  3ZOB A;  2JA5 J;  2R0Q C;  1H88 C;  3MVP A;  3TED A;  1Y1W J;  1SFO J;  2XGD A;  2QCO A;  1FEX A;  2D5V A;  3FK7 A;  3FIS A;  1W0T A;  5F27 A;  5M5W J;  2DA6 A;  5IYB J;  5EGO B;  3RZD J;  4A3F J;  3PM1 A;  3K2A A;  3Q0U A;  1OJL A;  3LSP A;  1U78 A;  4A3C J;  4IHY A;  3PO2 J;  3F0C A;  4RDU A;  1K61 A;  1VF9 A;  1MSE C;  1W0U A;  4MFD A;  1UG2 A;  2O7O A;  1AKH A;  2O8K A;  3JRC A;  2JA6 J;  2K9N A;  4FE4 A;  4JX6 A;  4A3D J;  2HOT A;  1X2M A;  2LVS A;  3JRE A;  4IEJ A;  2EZI A;  1YRN B;  2NS8 A;  5E3N A;  2XSD C;  1HDD C;  2IEK A;  3BTC A;  4X1E A;  4X6A J;  4UUT A;  3JRI A;  4J19 A;  4BY1 J;  2DJN A;  5E3O A;  1ZQ3 P;  4UUS A;  2WAQ N;  4FE7 A;  1DU0 A;  1BA5 A;  1MBF A;  2MGQ A;  3HGY A;  4HNV A;  2FX0 A;  1TWA J;  1RET A;  3HOW J;  5FKN A;  5EDN A;  2R5Y B;  4DYQ A;  3ZQL A;  5F0C A;  1ENH A;  2YS9 A;  2L7Z A;  2EBI A;  3CCY A;  2NVT J;  2I10 A;  2DA3 A;  5J3L A;  3OIO A;  3RKQ A;  2JA8 J;  3FIW A;  4QSH A;  4C2M J;  2L7M P;  2R93 J;  5FLV A;  1ORK A;  1MSF C;  1H89 C;  2DMU A;  2DMQ A;  3HBL A;  3TW6 A;  2LTP A;  5EG0 B;  3JRH A;  3HOY J;  2CRG A;  2AO9 A;  1TWF J;  2VI6 A;  1D5Y A;  2Y31 A;  3S15 J;  1GDT A;  2NVQ J;  1T56 A;  1I50 J;  3GTL J;  5EZG A;  1Y1V J;  4JYK A;  1G2H A;  3S17 J;  1JTX A;  1YRN A;  3ZQC A;  2JWT A;  1AU7 A;  2CJJ A;  2MG4 A;  4LOC A;  3JRF A;  1OFC X;  5J1U A;  3ZQF A;  5M5Y J;  3S14 J;  3A02 A;  3WHB A;  4A93 J;  4QTR A;  4AYB N;  2B63 J;  3LSG A;  1APL C;  1FTT A;  2NOG A;  3WHC A;  2MW8 A;  2XGE A;  2GBY A;  2E2I J;  3HOU J;  2ECB A;  5C44 J;  1DU6 A;  1QRY A;  4A3L J;  2VKE A;  3S1R J;  5F0H A;  1A6I A;  1MBK A;  2ELK A;  3BR6 A;  1K83 J;  1JGG A;  1FTZ A;  1WCM J;  2R5Y A;  1JTY A;  3PO3 J;  1HLV A;  2CQX A;  1AKH B;  2O9L A;  2DTZ A;  4W1U A;  2EZL A;  3TP3 A;  3OSF A;  1ZR4 A;  2EH3 A;  4B1R A;  1NK2 P;  5IYD J;  5EG0 A;  4QIW N;  2LR8 A;  1U8B A;  3GTK J;  3M3Y J;  3LNQ A;  2LFB A;  1E3O C;  3W6V A;  3A01 A;  1IGN A;  3C2B A;  1OCP A;  3IH2 A;  2WV1 A;  5GPC A;  1JJ6 C;  5F08 A;  4UUS B;  4IHW A;  2DMN A;  2OPT A;  2M9H A;  4A3K J;  1HOM A;  1HDP A;  1ZTR A;  2XPW A;  3QPS A;  5F04 A;  3GTJ J;  4V2G A;  1UHS A;  1GVD A;  1RR7 A;  3LSJ A;  4A69 C;  2K9Q A;  1QVU A;  5DTD A;  5M3M J;  4M3D A;  1MNM C;  2VKV A;  1CQT A;  3S2H J;  1IDZ A;  5IYC J;  4Y52 J;  2DA5 A;  3Q3S A;  3BG5 A;  4I76 A;  1S7E A;  4B4C A;  3JRA A;  2HXI A;  1QVT A;  5JLW A;  3JR9 A;  3D1N I;  1XS9 A;  3IH3 A;  5EZH A;  1FJL A;  2CUF A;  2W48 A;  1IJW C;  3HOZ J;  1ETO A;  2K40 A;  4G12 A;  4AC0 A;  1RKW A;  3CQZ J;  5K7F A;  1MBJ A;  1I6H J;  1RKT A;  3Q0W A;  1JKR C;  4I6Z A;  4A3E J;  9ANT A;  1R9T J;  3BQZ A;  3TP0 A;  3A03 A;  2R5Z B;  1JUP A;  5FLM J;  5E3L A;  5F0F A;  3VPR A;  3GTO J;  1BJZ A;  5K7Z A;  4XID A;  2M8G X;  3BTI A;  2CUE A;  5J1Y A;  1F36 A;  3E7L A;  4ABZ A;  4BY7 J;  4D7N A;  3HOX J;  5C3E J;  5IOY A;  4A3J J;  1B72 B;  3I4N J;  3S2D J;  2XB5 A;  3H3V K;  4XIC A;  1ETX A;  4GFB A;  3S1M J;  2XB0 X;  3IH4 A;  4XK4 A;  3TW7 A;  2L9R A;  2LLK A; 
#chains in the Genus database with same CATH topology
 2RVC A;  5FJ8 J;  3MMY B;  2VPR A;  3K7A J;  4B48 A;  1Y56 A;  1FLI A;  2QM3 A;  2EZH A;  4N4N B;  3VB2 A;  1BJA A;  2EFP A;  4HQE A;  4XON A;  1ITY A;  4A0Y A;  3KEQ A;  1MD0 A;  2L4M A;  3A01 B;  4IHV A;  4N0B A;  3K1P A;  4YIF A;  5A2Q K;  1O3R A;  5E3M A;  3PIO F;  4RM3 A;  1F4K A;  1IRZ A;  1EH6 A;  3E3V A;  2MLK A;  5F6F A;  4BKX A;  4IHX A;  1DGW Y;  3FXR A;  4PJL A;  4AYB A;  4BYY A;  1UMQ A;  4HEA 2;  2ECC A;  3I58 A;  2K3F A;  1HF0 A;  2HOA A;  4C30 A;  1RR8 C;  3ROU A;  4E6K G;  2A6H F;  1P7J A;  1S6L A;  2JJ7 A;  3HTU A;  3KLO A;  4IKF A;  1B72 A;  4D5F A;  3BTL A;  3NAR A;  3ZQI A;  2VQH A;  1Z91 A;  3G1L A;  2TCT A;  5BMZ A;  4IF4 A;  2DQL A;  1FYK A;  1XC5 A;  2B0L A;  2PX9 A;  4ETS A;  1L3L A;  2VJ5 A;  3RZO J;  3GUD A;  1V55 H;  1SMT A;  1D0X A;  2XRO A;  3BZ6 A;  5J47 A;  2MAB A;  3QQA A;  1GUU A;  3AL0 B;  1K78 A;  3OYG A;  1MMS A;  3EUH C;  1XGN A;  4BUP A;  2ZME B;  2FSW A;  4JX5 A;  2E5Z A;  3IKV A;  4EJT A;  4QPQ A;  4G8X A;  3CCJ I;  5GP9 A;  1VTN C;  1TQI A;  3WG9 A;  2FXA A;  3DLA A;  3R0A A;  2QWW A;  3M7G A;  2IBD A;  3A1Y A;  3U2R A;  1V5G A;  3CP8 A;  2VXZ A;  2TRT A;  3R6S A;  2ESN A;  4C2T A;  4CCJ A;  3F6V A;  4C3J J;  2MYS A;  2LYC A;  3ZR8 X;  2EIM H;  1T0F C;  4CZZ A;  4D0P A;  2L01 A;  4OAZ A;  1F43 A;  1MH4 A;  3GTG J;  4ENK A;  1WJA A;  3H0G J;  3VYT B;  1BI2 A;  5JLX A;  1HKT A;  1B9N A;  3F3X A;  3K1M A;  3D5L A;  3IP4 B;  5TGT A;  2MSY A;  5H2F C;  4CIC A;  4QLC U;  1EKE A;  2ZB9 A;  3OWT A;  2LH9 A;  1B8I B;  4MFE A;  2HVR A;  2E1M B;  1U9O A;  2VUM J;  1R00 A;  4LB5 A;  2HYJ A;  5F1J A;  1I27 A;  1R23 A;  2BBY A;  3CUO A;  3HPH A;  4R8H A;  3OOU A;  1OR7 A;  5LBQ A;  4O5V A;  4MLO A;  2O5R A;  4CHU A;  5LEJ A;  2DT7 B;  1XCB A;  3CCQ I;  4RGU A;  4XKV A;  5EF6 A;  3FXL A;  2A07 F;  4EMS A;  5HLH A;  3N4M A;  3JRB A;  5F1R A;  3MCZ A;  1QHH D;  1MW7 A;  2B7E A;  2M7B A;  3RYR A;  5ICG A;  3HOT A;  2VBW A;  3F8F A;  4I01 A;  5B5E C;  5FFX A;  3FHZ A;  3M1E A;  2VBZ A;  1O7F A;  1JKQ C;  1R49 A;  2R92 J;  1XD7 A;  2JSC A;  4XRM A;  1AOY A;  2DA4 A;  4HNU A;  4KNY A;  3SZP A;  5HNF A;  1E3H A;  4D9J A;  3ISP A;  1Y8R B;  3SYT A;  5LRS A;  1OYW A;  3ELK A;  4I7H A;  3OSG A;  2K4J A;  3OYH A;  3L00 A;  4JX4 A;  2KIS A;  1BI0 A;  1GV2 A;  1YIJ I;  3V42 A;  4B3A A;  1LEB A;  1SVO A;  4ZJZ A;  2A69 F;  3HEF A;  4O6J A;  1PVE A;  1R36 A;  4DW6 A;  5JVT A;  5H20 A;  2BY1 A;  2PJP A;  2DOD A;  2KDO A;  2A05 A;  1SAX A;  1PP7 U;  1ON1 A;  3R0J A;  3U21 A;  4ZYG A;  4EJO A;  3OS0 A;  4JBA A;  3UR3 C;  2V9K A;  1JKP C;  4Q4Z F;  2RAE A;  2V9V A;  1SVL A;  2KQR A;  3O8H A;  3J81 Z;  3DV8 A;  3M4O J;  2F2E A;  4F52 A;  1ZAO A;  4DQ2 A;  2DT6 A;  2OA4 A;  2WAE A;  4EJW A;  2LK2 A;  5DYM A;  2PMZ N;  3RQI A;  1ZLJ A;  2P7C B;  2IS6 A;  5DM7 F;  2TDX A;  4IL6 C;  5FKO A;  1FOK A;  2ICW G;  1U8R A;  1S5L C;  4I0B A;  2WY7 Q;  1X3U A;  2NAZ A;  4BBS J;  5KNL A;  2WAD A;  2EA2 A;  2LG4 A;  2MFZ A;  3E97 A;  3CC7 I;  2HR3 A;  3ERE D;  4A12 A;  1UST A;  2ACJ A;  3SJM A;  3F8N A;  4DYC A;  2JPC A;  5LGN A;  2R7R A;  1UZC A;  3DXJ F;  4ZC3 A;  1IRG A;  2Z2S B;  2P5L C;  1HCR A;  1ZRD A;  3LA3 A;  2XRL A;  1VFC A;  2X6W A;  5FKK A;  3C2H A;  1KON A;  2VOP A;  3M07 A;  1I3A A;  3BR2 A;  3BR0 A;  1H8A C;  4P5O A;  4G6Q A;  1ETQ A;  3GFM A;  1B4A A;  1IC8 A;  2V6C A;  2ZXI A;  4OU0 A;  3COA C;  4DZP A;  2VE9 A;  2CQQ A;  1R1T A;  3J7Y J;  2DOA A;  1O57 A;  1YG2 A;  4UV8 A;  2Y48 A;  5HDN A;  1WI3 A;  2VAS A;  2ESH A;  3HKZ N;  3JRG A;  1IXC A;  1TWH J;  1Y6I A;  2D1V A;  2NNN A;  2D2W A;  2Q8K A;  5DDG A;  1H88 C;  2VQG A;  5E18 F;  1YIO A;  2ZXW H;  3MVP A;  2E36 A;  2LRD A;  2WB1 A;  4UB8 C;  2V9P A;  4Y4R A;  1EH8 A;  3CJN A;  1I1S A;  3EYI A;  1SFO J;  1TLH B;  1D0Y A;  1H0M A;  1HQC A;  3MZY A;  2QSF X;  1EH7 A;  1L0O C;  1REP C;  2PMH A;  5JVG F;  1UFM A;  3FK7 A;  4RGS A;  1RRJ A;  5IY5 H;  3KP6 A;  1W0T A;  2OCE A;  2F4O B;  5M5W J;  2ZXH A;  2VJI A;  4A3F J;  4BU2 A;  3K2A A;  3Q0U A;  4M74 A;  4QPO A;  3DTI A;  4A3C J;  1Z67 A;  4EJV A;  5ICE A;  1ZRC A;  2NOJ B;  3F0C A;  3IHU A;  1VF9 A;  1OCC H;  5CLS A;  1BBY A;  4MFD A;  1R71 A;  3DP7 A;  5D5W B;  1E0E A;  1V3F A;  3JRC A;  2JVG A;  2XC7 A;  5DV5 A;  2BXZ A;  3WTX C;  1YI2 I;  2PG4 A;  1QZY A;  1ACI A;  2ELH A;  3H9G A;  2L9N A;  3S1R J;  4UV9 A;  1V54 H;  1YRN B;  2QA4 I;  2NS8 A;  3EUH A;  2XSD C;  1GVJ A;  3K69 A;  2O61 A;  3K4J A;  2AXL A;  5DUK A;  1WKM A;  2DBB A;  2FQ3 A;  5BOX A;  3JRI A;  1S8N A;  2WBM A;  2DJN A;  5E3O A;  1ZQ3 P;  3KYC B;  2HS5 A;  1J09 A;  4FE7 A;  2HKO A;  3O3K A;  2XAG A;  2R7Q A;  3AKZ A;  4AM3 A;  4HNV A;  1TWA J;  1RET A;  2CUZ A;  3F23 A;  1PYV A;  4XSX F;  1T0F A;  5FKN A;  4EAT A;  1SFU A;  4XQF A;  4DYQ A;  2YS9 A;  2WC2 A;  3GVA A;  5DD8 A;  3CMM A;  2DA3 A;  4EQQ A;  2LRE A;  3OIO A;  3RKQ A;  4G7H F;  2DFF A;  1SD7 A;  1WSU A;  2GA2 A;  2R93 J;  1ORK A;  3HRM A;  4XLC A;  3FMQ A;  3GEZ A;  4CCO A;  1R5I D;  2EIK H;  5DCM A;  3S3M A;  1TZL A;  2K5C A;  2VI6 A;  1D5Y A;  2MH9 A;  2HGC A;  3S15 J;  3I64 A;  1JHH A;  4Q47 A;  5GAD J;  5B1B H;  5FLX K;  2HWV A;  1FBQ A;  3BOQ A;  2YSR A;  4FHT A;  3ZQC A;  4Z6Y A;  3E6M A;  3V7S A;  1PJR A;  1XB4 A;  2JWT A;  3JAM Z;  2XVC A;  4XBF A;  1AU7 A;  1EJ9 A;  1LDJ A;  4YII A;  4DIQ A;  4L9V A;  3GXO A;  3IRR A;  1MMN A;  5J1U A;  2LY2 A;  2M0M A;  3A02 A;  3LSG A;  4IOC F;  5DCF A;  2DDB A;  3SEQ A;  4BEH A;  2RQP A;  1VQL I;  4S04 A;  2HKX A;  2R7O A;  4PUS A;  5F0H A;  2WWY A;  3C18 A;  1A04 A;  1JGG A;  1K83 J;  3W2V A;  1QU3 A;  1FMV A;  2CSO A;  1JTY A;  2V26 A;  3WTY C;  2PN6 A;  4KT6 A;  2F5C A;  1W5C C;  4Q5S F;  3P7N A;  4W1U A;  3DU5 A;  3VYR B;  2ZME C;  3FM5 A;  3L7W A;  2R7S A;  4WXH A;  1ZGJ A;  4ENM A;  1ZRE A;  4II3 A;  5AON A;  4QIW N;  5EG0 A;  1N78 A;  1T39 A;  4WXC A;  3RJP A;  1KU9 A;  2BEO A;  3DTK A;  3CF5 F;  1G3W A;  2QKM B;  1OCP A;  2WV1 A;  3CCR I;  5F08 A;  4A0X A;  4IHW A;  2IA2 A;  1LJ9 A;  4A5N A;  2Y75 A;  2M9H A;  3HHH A;  2BYV E;  3GYH X;  3DF8 A;  5AIQ A;  2XPW A;  4DGW B;  1FP1 D;  3RKW A;  4IVN A;  5E1W A;  2BHZ A;  3TL4 X;  3NRV A;  1TNT A;  2VOO A;  1UHS A;  1X4O A;  3LSJ A;  3ZMD A;  5KHD A;  1VQP I;  1YS6 A;  1LDD A;  1ONV A;  1QVU A;  1MJB A;  4I2O A;  2BY3 A;  2PLY A;  4H0E A;  4CH7 A;  5DCM B;  3BG5 A;  3FWE A;  5LGU A;  4B4C A;  2P5V A;  3JRA A;  3T1B A;  1QVT A;  3GFJ A;  5JLW A;  2VT2 A;  1XS9 A;  3LWF A;  1IN6 A;  1HA8 A;  1A35 A;  2CUF A;  4CCN A;  4OMZ A;  1LUJ B;  1I1G A;  3G4S I;  1KYZ A;  1I6H J;  1RKT A;  1JKR C;  2CMP A;  4I6Z A;  4A3E J;  5DUI A;  3H3U A;  2XF6 A;  1DP7 P;  4M71 A;  3E6B A;  1X1D A;  2JUG A;  4BEH B;  2Z16 A;  3BQZ A;  3TP0 A;  2HQN A;  2HEO A;  5F0F A;  1FP2 A;  4A2U A;  3CO6 C;  3VSK A;  2DDA A;  2CUE A;  1J9I A;  2BGC A;  4ABZ A;  4ZH4 F;  5C3E J;  3KIO A;  2E71 A;  2HQA A;  3OOP A;  3J7A O;  4PFP A;  1ETX A;  1FX7 A;  2JPB A;  4GFB A;  1HC8 A;  2COM A;  1IXR C;  1OCZ H;  2HOE A;  3KET A;  3VDX A;  3W6J B;  1MJA A;  1JHF A;  1PUE E;  3PNY A;  2XIG A;  2LLK A;  4UB6 C;  5IP9 J;  5L3G A;  1YJN I;  2FBH A;  2Z9O A;  1A31 A;  4BBR J;  1CGP A;  3Q0V A;  3OYJ A;  2KDZ A;  4I98 B;  5HS9 A;  2EK5 A;  1FT9 A;  1G8X A;  2Y9Z A;  1MBE A;  2E5N A;  2IVM A;  4PDK A;  5J1R A;  2IS4 A;  5L3F A;  4X0G A;  2AS5 F;  1XG1 A;  1BM9 A;  3M8F A;  1X3Z B;  1MMD A;  2IP2 A;  1YTY A;  2R4G A;  2X85 A;  4IXA A;  1YX3 A;  2P7V B;  1ZK8 A;  3G73 A;  1IF1 A;  4HZF A;  4LK0 F;  1ZGW A;  4O3M A;  3FXK A;  4LGW A;  1VND A;  1NK3 P;  2R5Z A;  4L5E A;  3DBL B;  4M9Z A;  1Q1V A;  3E5X A;  3QP5 A;  3ZMV A;  5J8F A;  3IL2 A;  2W85 A;  5FRN A;  3CF2 A;  5CYV A;  2EIJ H;  2OC6 A;  4OOI A;  3V7R A;  3WU2 C;  3DKW A;  1Y0U A;  1TQP A;  1NTC A;  2Y0M A;  4IRI A;  2KL4 A;  4C3H J;  4E7S A;  1G3Y A;  4PJM A;  1O3S A;  4L0Z B;  1LFP A;  1XMX A;  2GOX B;  1ZGA A;  2L9V A;  3G1M A;  3Q9V A;  2YUS A;  1MKM A;  1QNT A;  3KYL A;  1WJ5 A;  3HRS A;  5IP7 J;  3BQY A;  1R22 A;  3PJR A;  3BCB A;  1RNL A;  3E1S A;  2HNH A;  3L2C A;  1O4X A;  3QOE A;  2ADU A;  2EPF A;  1ETV A;  5IOZ A;  4RLQ A;  1ETW A;  2DOE A;  4E70 A;  4HRI A;  2FNA A;  3W2A A;  1YOV B;  3I71 A;  5IT3 A;  2HZT A;  2STW A;  4A3G J;  3V8J A;  3H1C A;  2UWM A;  4U0V A;  2DA2 A;  4J00 A;  3HOV J;  4S05 A;  3E6C C;  4LLN A;  5FKM A;  2A61 A;  3H5N A;  5GPA A;  4V19 K;  1R6R A;  3DBH B;  4MO7 A;  2XGC A;  1ZKG A;  4GXO A;  1E17 A;  2M7A A;  4I99 C;  1RUN A;  1RPW A;  2L0K A;  3KFW X;  2ZO4 A;  1IUF A;  1P2F A;  2GAU A;  2M5W A;  3HOS A;  3I53 A;  4ZZD A;  2UXX A;  1HW5 A;  4ASN A;  1WPK A;  1DPR A;  1D1A A;  1FBS A;  3BTJ A;  2JA7 J;  3BCA A;  5K5Q A;  1JT6 A;  2L7F P;  1GXQ A;  2M34 A;  4KIG A;  2EV0 A;  5K1Y A;  5D8L B;  2V6E A;  2L02 A;  2FOK A;  3BP8 A;  2GXA A;  2CO5 A;  4G6D A;  4LG0 B;  3T8T A;  2FD5 A;  2E1O A;  4W97 A;  4CA0 A;  1O7L A;  2EFW A;  3SFI A;  5B3S H;  1QQI A;  3ZQG A;  2ZME A;  2LY9 A;  4M3F A;  2FQ4 A;  2VKH A;  3QYB A;  1IDY A;  5CVU A;  2OF7 A;  3OYL A;  5DS9 A;  3W2W A;  3MWM A;  4CYC B;  1TTY A;  4F3Q A;  3OY9 A;  3WTV C;  4AIH A;  5ILV A;  3DWL E;  1XTA A;  3S1Q J;  1R4N B;  1QBJ A;  2E7X A;  3F21 A;  3I0T A;  4DZJ A;  3H0D A;  1CF7 B;  3OR1 C;  3HG9 A;  1SFK A;  3IAS 2;  4BXU A;  2V1D A;  4CZC A;  3CUQ C;  2AHQ A;  2IGO A;  1OMI A;  2L2O A;  4WF2 A;  2D1H A;  2IGK A;  4QWQ A;  5BNG A;  4WCG A;  4EM2 A;  2XPU A;  4HV6 A;  2Q0O A;  1Z0X A;  2XDV A;  4XKC A;  4RBO A;  2LNB A;  2L3D A;  1B8I A;  2E1C A;  2FMY A;  2XAJ A;  5EGO A;  4LD5 A;  1IN4 A;  3L2U A;  3K4L A;  2G7U A;  1JGS A;  2NVY J;  2CW8 A;  3NAU A;  1RC9 A;  2DTR A;  4KYW A;  2PJR B;  4M6Y A;  1VI0 A;  2N8G A;  4L5I A;  2H1K A;  4PCQ A;  3F72 A;  4B44 A;  4M3G A;  4AVZ A;  4BE2 A;  3H35 A;  3HUG B;  4OIQ F;  2JN6 A;  4DYR A;  3I59 B;  2ME0 A;  4ON0 A;  5LLQ A;  1P4X A;  4Y17 A;  4ZDL A;  5BQT A;  3BR1 A;  3EQL F;  5E17 F;  5JHU A;  1MMA A;  1BIA A;  1XN7 A;  4PZJ A;  4Y7N J;  2A6T A;  4HF1 A;  3CCE I;  5HLG A;  1QZE A;  1OLT A;  2ZFW A;  3RPQ A;  4XLN F;  1F1Z A;  2Y0S A;  2VIX A;  2NS7 A;  2L9S A;  2A3S A;  2MBF A;  3S8P A;  1FWZ A;  2OU2 A;  2ZCW A;  1YIT I;  3I5U A;  4IRH A;  4GGG A;  1VQM I;  2EB7 A;  1B6A A;  1W36 D;  1BC7 C;  2FEZ A;  2E2J J;  3DBR B;  3CMA I;  2K86 A;  2J5P A;  3ASN H;  2GA1 A;  1BR4 A;  2KJB A;  2CV0 A;  4XRF A;  1A5J A;  4F92 B;  3L1P A;  3CMY A;  3ZQH A;  3FDY A;  1QGP A;  4EM0 B;  1WFX A;  5M5X J;  5AIP A;  4HQM A;  1VQ7 I;  4OIO F;  2DW4 A;  3HM5 A;  3KP3 A;  4HG2 A;  2ELJ A;  2GLO A;  3BC8 A;  4WWC A;  3K10 A;  3IC7 A;  1MBG A;  1WH7 A;  3SZT A;  2H6C A;  3EUA A;  3HDD A;  3ZOB A;  3V7C A;  3ZGK A;  1MJ9 A;  2R0Q C;  5HDG A;  2O6G E;  1Y1W J;  3EDP A;  3TO7 A;  3I56 I;  3CLO A;  2HDC A;  2EWN A;  4Y33 A;  5LHH A;  2W4S A;  1XGS A;  3LQQ A;  2QCO A;  3DPT A;  4RS8 A;  1S7O A;  3FIS A;  3L2W A;  3T8R A;  3FHN A;  3O6B B;  4YG2 F;  2PEX A;  5EGO B;  2XAS A;  3RZD J;  3RI4 A;  1LKX A;  3LL7 A;  4HSR A;  4G7Z F;  1U5T C;  1OJL A;  3LSP A;  1U78 A;  2OTL I;  3SEZ A;  4WX9 A;  5HOO A;  1MMG A;  1MNE A;  4EV0 A;  3ERM A;  3KPH A;  1V5E A;  1GXP A;  1MSE C;  4KIS A;  5GTH C;  3B73 A;  4E7K A;  5J40 A;  2QUF A;  1UG2 A;  5L3E A;  3H5A A;  1O3Q A;  5CVR A;  3T0Y A;  2O8K A;  1BI1 A;  5K5O A;  2JA6 J;  3Q5F A;  2PFB A;  3JTG A;  4JX6 A;  2HVQ A;  1ULY A;  2X0L A;  1M1E B;  1X2M A;  3QYF A;  4ESJ A;  2HOT A;  2X51 A;  4BQQ A;  2R7D A;  3K4N A;  3JRE A;  4IPA A;  4A0Z A;  3ZPL A;  1BIB A;  3PSF A;  4MHG A;  1JE8 A;  4YRV A;  3HSF A;  3BTC A;  1XMA A;  1Z3Y A;  3GFI A;  3MFK A;  3SDB A;  4UUT A;  5HVQ C;  3TBI A;  4M6X A;  4KDP A;  2BOL A;  4J19 A;  5HS7 A;  2K7L A;  5CJ9 A;  4PJ0 C;  2ZBK A;  1MBF A;  2W25 A;  4C9Y A;  2EV5 A;  2H6B A;  2XSJ C;  1ENH A;  3GME A;  5F0C A;  1D5V A;  1UG0 A;  1TW2 A;  2ZJP F;  3DEE A;  2M3A A;  2JA2 A;  4I02 A;  2HYF A;  2GOM A;  4MNU A;  2NVT J;  2DQR A;  5BPI A;  2L7M P;  2XV4 S;  1T38 A;  3P9K A;  4J01 A;  5FB2 A;  2DMQ A;  3IAM 2;  3HOY J;  2HTJ A;  2LTP A;  3BZC A;  3LAJ A;  1T2K A;  1Z6T A;  3GCM A;  1TWF J;  1YJ9 I;  4P96 A;  1GDT A;  1YE9 A;  2KLO A;  1T56 A;  1I50 J;  5HLI A;  1Z3X A;  3C3W A;  4LFU A;  4BH9 A;  1JTX A;  2MLG A;  3S17 J;  2VQC A;  1UHM A;  2HFH A;  5A2Q Z;  1YRN A;  3WGI A;  2G9W A;  5KAF C;  1S9H A;  2F48 A;  2CJJ A;  2MG4 A;  3HJE A;  3I3L A;  4CCK A;  3WU1 B;  4HBL A;  1B9M A;  1HSJ A;  2F5E A;  3ZQF A;  5M5Y J;  5ED4 A;  3S14 J;  4A93 J;  5JR3 A;  1FTT A;  4AYB N;  3P9I A;  2NOG A;  2MW8 A;  1YX5 A;  3OR2 C;  1TBX A;  5C44 J;  2EIL H;  2B9S A;  1QRY A;  3E5U A;  3BZK A;  2QVO A;  2VKE A;  3AG1 H;  3ABK H;  2JT1 A;  4HLX A;  3U1D A;  3AFH A;  2ELK A;  3BR6 A;  3ZN1 A;  2DYS H;  1T6S A;  1FSH A;  4KA4 A;  1FTZ A;  3WGG A;  4AIK A;  3IKT A;  2CH0 A;  2XAH A;  2ZNZ A;  4Y13 A;  1HLV A;  4I09 A;  3ABU A;  1JI8 A;  2DTZ A;  1I6X A;  1T98 A;  1X1B A;  2LDU A;  3FXO A;  2HQR A;  2EFN A;  5KVR A;  5K5R A;  4BDY A;  3OSF A;  4NC7 A;  3K70 D;  3R4K A;  1KZH A;  4B1R A;  1SMY F;  2LR8 A;  2XAQ A;  1U8B A;  3ML6 A;  1G4D A;  3EUK L;  5CQE A;  2LFB A;  3MD2 A;  3FXU A;  4PJN A;  3ASO H;  2JZY A;  5GTI C;  1RUO A;  1IGN A;  3C2B A;  1YLF A;  1LVK A;  4LLL A;  4AID A;  4C2U A;  4L0Y B;  4IQ4 A;  2OPT A;  4A3K J;  5FO5 A;  2X6Y A;  4ZTJ A;  3PNV A;  1IN8 A;  1PP8 F;  3QU3 A;  1VQ5 I;  3O2P E;  2MA3 A;  4A69 C;  5DTD A;  5M3M J;  2DK8 A;  5E79 C;  3S2H J;  3SXY A;  1IDZ A;  4U88 A;  2DA5 A;  2CV2 A;  2RC4 A;  3NWT A;  4ENN A;  4XLF A;  2HXI A;  1X3W B;  3HXL A;  2LSO A;  3DKY A;  2ZJR F;  2I5U A;  4MTE A;  2OJE D;  3BJO A;  3IH3 A;  1ZAR A;  2W48 A;  3CC2 I;  4G12 A;  1SD6 A;  3HYI A;  4AC0 A;  5EEG A;  1MDM B;  1P4W A;  2MC4 A;  2F4I A;  1DQU A;  2JSP A;  3AG4 H;  3D5R C;  3Q0W A;  3X2Q H;  2I8D A;  2HDW A;  2QQ8 A;  5HS8 A;  2WAQ A;  2OQR A;  1XMK A;  2A6E F;  4XN3 A;  2P4W A;  1W4M A;  4DBR A;  3VPR A;  1SFE A;  4A6D A;  3GTO J;  2MD5 A;  3H9Q A;  3I54 A;  4XID A;  3KYD B;  3E7L A;  2AQF A;  4BY7 J;  4A3J J;  3I4N J;  3H3V K;  3F22 A;  1AWC A;  2ZJ2 A;  3CUQ B;  2KZG A;  4XK4 A;  3QRF F;  2OCC H;  3AG3 H;  2XUB A;  4FT8 A;  1VQO I;  2GIZ A;  3WE2 A;  3HPG A;  3H5R A;  1Z77 A;  2VL8 A;  1IN7 A;  4LIT A;  4BXF A;  2DA1 A;  2LF8 A;  2MD0 A;  2CU7 A;  5CVJ A;  2ID3 A;  2QF7 A;  3RYP A;  5L3D A;  3IV5 A;  2G7H A;  3CJR B;  5EYR A;  2Q1Z B;  4WK8 F;  3CCL I;  3KE2 A;  2H27 A;  1U5T A;  1U6G A;  2VJJ A;  5B1A H;  2DFH A;  3HSE A;  2JVH A;  4HLY A;  1LFB A;  1BI3 A;  2XPV A;  2JRT A;  3QPL A;  1OKR A;  1U9N A;  2PI0 A;  2E35 A;  4XLE A;  4D7M A;  4ZYE A;  1RIO H;  3HB9 A;  1W36 C;  3GTM J;  1KA8 A;  2NNY A;  1GV5 A;  4HDV A;  2IA0 A;  2W1O A;  2X1E A;  2H8R A;  2E1N A;  2G0E A;  2EIN H;  2K85 A;  2DMP A;  3BG9 A;  3PFY A;  3OYK A;  3HTS B;  1BW6 A;  1RES A;  4FQG A;  3BPX A;  4E7Z A;  4XLP F;  3WG7 H;  3HIF A;  2LKX A;  2HU9 A;  3GZ5 A;  4UUV A;  1D3Y A;  1IG7 A;  3DCF A;  1BN5 A;  3BG7 A;  4KN4 X;  5GAH J;  1OCT C;  1IRX A;  2DFE A;  2JQ7 A;  2YU9 J;  2EFO A;  2LKP A;  2CQK A;  1I5Z A;  2KP6 A;  5CKT A;  2NVU B;  4M6V A;  1X1A A;  1A6Q A;  4EM1 A;  1O3T A;  2X6O A;  4IZZ A;  3O8G A;  2ETH A;  2HTS A;  3RCO A;  1QPM A;  3L9F A;  2E2H J;  3FBN B;  2CYY A;  2M4K A;  1FC3 A;  1XCV A;  2F5D A;  1LFU P;  3CC4 I;  4LLG F;  1JUS A;  5JI6 A;  2M30 A;  4HOB A;  3U1K A;  4GDF A;  4RGR A;  1TNS A;  4YFN F;  2BVL A;  1VQ8 I;  5D8K B;  2M87 A;  3LSH A;  4A3M J;  1NH3 A;  2H8W A;  1AA7 A;  4HST A;  3KP7 A;  2COB A;  2GQQ A;  5M3F J;  1TW3 A;  2DN0 A;  2HDD A;  3UKG A;  2HI3 A;  3VOE A;  3M8J A;  5ERI A;  2WB1 N;  1Z9C A;  3G2B A;  1WZ2 A;  3P9C A;  2BVM A;  3WTW C;  4XL9 A;  3MKW B;  3QWL A;  2DA7 A;  2VXD A;  3DKX A;  1T8I A;  1U5T B;  4KUM A;  4II2 A;  4BJ5 C;  4YFK F;  5C4J J;  3G1O A;  1PUF B;  3DEW A;  2VON A;  1GHC A;  2FRH A;  1J75 A;  4CO8 A;  2IS1 A;  2V1U A;  2FJ1 A;  3RKX A;  4KMF A;  4NHJ A;  3OYC A;  3RQ4 A;  1ZYR F;  1YW9 A;  4PK4 A;  4M73 A;  1JUM A;  5IP6 A;  2KPM A;  5J6X A;  4RGX A;  4XSZ F;  4LIV A;  1IUY A;  3CDL A;  3S16 J;  2EQR A;  4FET A;  2DXI A;  5HNH A;  1X19 A;  1H9G A;  4Q48 A;  1T95 A;  3BT9 A;  2WY8 Q;  1ZHF A;  2JRM A;  4JQF A;  1BW5 A;  1YW8 A;  2XHK A;  3PL8 A;  1ODD A;  2YX7 A;  2Z5U A;  3FXQ A;  3MZH A;  4ZDO A;  3DPL C;  2HXO A;  3LQR A;  4NDL A;  4CYD A;  1TT5 B;  4NB5 A;  2X48 A;  4CGZ A;  4NUB A;  4U87 A;  4H4K C;  2IAI A;  2KJC A;  3GLL A;  4E7H A;  4HV5 A;  2BHY A;  2VKD A;  5K7H A;  1UB9 A;  2Y2Z A;  2DU9 A;  3ZCO A;  3HGG A;  3B6C A;  1FIP A;  3ULQ B;  3ZMU A;  4XNF A;  5J8C A;  2WTE A;  4LG0 A;  3IWF A;  2P5K A;  3GBG A;  2AQE A;  3TOA A;  3GWZ A;  3UNG C;  5LHI A;  3VOD A;  3ZQ7 A;  5HOD A;  4YFX F;  5C4X J;  3JSP A;  3U9G A;  2E7W A;  2HQ5 A;  2F5F A;  2M8E A;  3QOD A;  4C3I J;  2ID6 A;  1QA6 A;  1XGM A;  4CYC A;  2KMU A;  4M3B A;  4AU7 A;  3K70 C;  1WVR A;  1QPI A;  1MGT A;  1XSV A;  4R1H A;  4GRI A;  2STT A;  3BR3 A;  4EVI A;  4MQV A;  5FLX Z;  4XN0 A;  4CCM A;  2CV1 A;  1CF7 A;  3GX4 X;  1OCR H;  4PSX A;  2K9S A;  2RRE A;  3CLQ A;  1E2X A;  4GO1 A;  4PJJ A;  5FGM A;  5TJJ A;  2OZ6 A;  2HPM A;  4EGZ A;  4HNT A;  2EA4 A;  1U2W A;  3FM3 A;  3L2R A;  1AHD P;  4LG3 A;  2K02 A;  1FZP B;  3PUF A;  4BXX J;  2LC2 A;  2IT0 A;  3DFG A;  3SHF A;  5EEA A;  1QHG A;  2KIQ A;  3VYU B;  1FBU A;  4NBQ A;  2UXN A;  2Q2E B;  3WU0 A;  1MIJ A;  3ZRG A;  4Y3O A;  3GLX A;  4FIS A;  3RTR A;  3BG3 A;  4G6T B;  4M72 A;  1HW2 A;  3KP5 A;  4MEY F;  2LD5 A;  3E6D A;  2QSH X;  2PJR A;  1HKQ A;  5CVV A;  3BRO A;  4D5C A;  5E8G A;  5JFR A;  2R7X A;  2V79 A;  2MH2 A;  3DU6 A;  3RDI A;  1R1V A;  3QPT A;  2BXY A;  3HUG A;  3RPU D;  1POG A;  1K6O A;  1SEU A;  1U3E M;  3DQV C;  4BGD A;  2JA5 J;  3I59 A;  2P8T A;  4L9T A;  4I0A A;  3ZN0 A;  1UCR A;  1VQ9 I;  1DP3 A;  4N4O B;  1WI9 A;  2XGD A;  2VE8 A;  1RI7 A;  1SC7 A;  1FEX A;  2D5V A;  4RB1 A;  2XAF A;  2DCE A;  3OMY A;  4LMY A;  3A0B C;  5F27 A;  1J0R A;  1TT0 A;  2DA6 A;  5IYB J;  5E8I A;  3NWS A;  2BV6 A;  1UJ8 A;  1B1B A;  2PQ8 A;  1UEL B;  3ZP5 A;  3KCC A;  3TO9 A;  3PO2 J;  4BE1 A;  3EPZ A;  1W0U A;  4G9Y A;  3KX2 A;  3FMS A;  2XF5 A;  1K6Y A;  2K4B A;  2K9N A;  3CTA A;  4YEJ A;  2L54 A;  2GXB A;  1VQ6 I;  4E4H A;  4A3D J;  2VLA A;  2LVS A;  2H1L A;  2H94 A;  5BS6 A;  1HBX G;  5D5X B;  1Z7U A;  1FYM A;  3VEP A;  5L3C A;  5E3N A;  1HDD C;  1WWX A;  1EV7 A;  2V1X A;  4X6A J;  3WTT C;  1FOW A;  4F7Z A;  3R61 A;  3VYS B;  1BOB A;  5IT9 K;  4ZZL A;  1SD5 A;  4B8X A;  2FX0 A;  2F5V A;  3CCU I;  1X1P A;  5FD5 A;  5E20 A;  5EDN A;  4OMY A;  2R5Y B;  2ZSI B;  3ZQL A;  4HA8 A;  3E0J B;  2IGM A;  2DPD A;  4XLH A;  2HVS A;  2I10 A;  5J3L A;  3JW4 A;  4CDG A;  5E1X A;  4QSH A;  4C2M J;  2R7V A;  3F9K A;  4XKB A;  1X4P A;  5FLV A;  2ZKZ A;  5J4V A;  4P9F A;  1MSF C;  1H89 C;  2QYO A;  3HBL A;  3JRH A;  2DOF A;  1DGR M;  2CRG A;  3J81 K;  2QBY A;  1H9T A;  4FX4 A;  4ZYA A;  4YIR X;  1OCO H;  3WOD F;  2HYG D;  2C6Y A;  4U7D A;  2XGX A;  2XKP A;  2PMZ A;  3KEO A;  4RAG A;  4B43 A;  1SAU A;  4KT5 C;  1T08 B;  5LD2 C;  4PSW A;  3C1D A;  3QP6 A;  4KIT B;  1SVM A;  1W7P D;  3JRF A;  1OFC X;  4ZTF A;  3MAJ A;  4IHS A;  4QTR A;  2B63 J;  1Y39 A;  1APL C;  2YPR A;  3MKY B;  3WHC A;  1J5Y A;  1TQM A;  1Y0N A;  2GBY A;  5F64 A;  1DU6 A;  5DEQ A;  4CSW A;  1LQ1 A;  4A3L J;  4MQ9 F;  1A6I A;  3LAP A;  2A5Y B;  2CFX A;  4HX7 A;  1LNW A;  5KCM A;  4KN7 X;  4JK1 X;  2CUJ A;  1KQ9 A;  1SD4 A;  2O9L A;  3TP3 A;  1Y8Q B;  3JSO A;  1NG7 A;  2FBI A;  3TMO A;  1ZR4 A;  5D4S A;  4XMY A;  2ZFU A;  4G94 A;  3HSR A;  1NK2 P;  4UVB A;  5IYD J;  3GTK J;  1F5T A;  4BE0 A;  3K4B A;  3HKZ A;  5FD6 A;  1E3O C;  1IW7 F;  3PQJ A;  2PMU A;  3IUO A;  1K7A A;  3V8K A;  5GPC A;  1WHU A;  4XKW A;  1QO0 D;  2QLZ A;  3WTS C;  3ECO A;  4OIR F;  3TDU C;  2DI3 A;  3FBI B;  2NYX A;  2BY2 A;  1ZTR A;  2FE3 A;  1FYL A;  4UNO A;  1FOY A;  3B02 A;  3QAH A;  1RR7 A;  1PDN C;  6PAX A;  3PUB A;  2WA0 A;  2K9Q A;  3KZZ A;  4N9H A;  4P55 A;  4XOP A;  3S93 A;  4M3D A;  1MNM C;  4M9X A;  2M4G A;  3ABL H;  5IYC J;  4Y52 J;  3PIP F;  3OS2 A;  2X6X A;  1S29 A;  3G3Z A;  4L5J A;  4BHB A;  2ISY A;  2QBY B;  3ECH A;  4CXF A;  2WAF A;  4IX7 A;  2DJI A;  2Z99 A;  3CME I;  3A4C A;  3JR9 A;  3D1N I;  3LFK A;  5HLT A;  1YW7 A;  1BR2 A;  5LHG A;  4XR6 A;  1FJL A;  2ZXJ A;  3DLL F;  2QEX I;  3HOZ J;  5DD4 A;  3CCM I;  1XSX A;  1P92 A;  4RAF A;  1RKW A;  1N25 A;  3CQZ J;  5FRM A;  4ZYD A;  4AD9 A;  5EEH A;  3F8M A;  3ZXS A;  1MZB A;  3I9V 2;  4BAY A;  4KIC A;  2ISZ A;  2FUG 2;  2FML A;  1FNN A;  3PNT A;  1VZ0 A;  3A03 A;  2OV7 A;  1JUP A;  5B66 C;  5FLM J;  5E3L A;  1D1B A;  2DK5 A;  4B09 A;  4RB0 A;  3H3Z A;  3EYY A;  1W5S A;  5K7Z A;  2M8G X;  2J5O A;  3BTI A;  2NXN B;  1XX5 A;  3F8C A;  3HC7 A;  5IOY A;  4E7L A;  1B72 B;  3S2D J;  2XB5 A;  2QQA A;  3V8L A;  2GZW A;  4AVP A;  4XIC A;  3TDZ C;  3OYF A;  3S1M J;  3PSI A;  1U0J A;  3K6G A;  3BLY A;  3LSM A;  3TW7 A;  3R60 A;  2L9R A;  5E1Z B;  4PGG A;  2IJL A;  5D4R A;  2UZK A;  3MN2 A;  2P0W A;  2EZK A;  2W00 A;  3BR5 A;  4BS9 A;  3S3O A;  1BC8 C;  1ZG3 A;  3CO7 C;  2LOO A;  4XM3 A;  5IT9 Z;  5L3B A;  4NQW A;  1JT0 A;  1D8J A;  2L4A A;  3PQK A;  1VQN I;  1MBH A;  4JOM A;  2OUM A;  2JUC A;  3OL4 A;  1K78 B;  5DM6 F;  3JAM K;  5GAE J;  3S3N A;  3N97 A;  1MDM A;  1WJE A;  4U0W A;  1MH3 A;  2LMD A;  2O03 A;  2X1D A;  4Y15 A;  4BHC A;  2PBI A;  3KZI C;  1HST A;  3LST A;  2FOW A;  1YJW I;  4UXN A;  2Y9Y A;  3K2Z A;  3RKY A;  4V2F A;  3TKY A;  2FBK A;  2Z3Y A;  1I3Q J;  1XDS A;  4N9I A;  4KFC A;  1WGX A;  1HXD A;  3BWG A;  1OQY A;  3TO6 A;  2JMW A;  4B47 A;  2IRF G;  3CUQ A;  3MKL A;  1ETY A;  2X9D A;  1P6R A;  2JTV A;  2WV0 A;  3BPV A;  3QOP A;  1Z05 A;  1WQ2 A;  2OAZ A;  2Y0S N;  2Y69 H;  1WJD A;  3S1N J;  2KT0 A;  3OYI A;  4FTH A;  4DJA A;  2FA5 A;  1ETK A;  5EJC A;  2W7N A;  1R5H A;  1X2N A;  2P6T A;  1JJ8 C;  2VPL A;  4XOR A;  2RV8 A;  4U0Y A;  2CQ7 A;  3ABT A;  2RNJ A;  4IHT A;  2V1N A;  2XAU A;  1RZ4 A;  1X58 A;  3V4G A;  4KMU X;  3TOB A;  3VFZ A;  3QPH A;  5BPD A;  2NVX J;  4FCY A;  4ZDP A;  1IZ1 A;  2KZV A;  3J7Z I;  2KIU A;  4JP0 A;  4PGH A;  3L2V A;  3NQO A;  2P81 A;  4F55 A;  4MTD A;  3OS1 A;  2OQG A;  2FU4 A;  5D6E A;  2CGP A;  4ENJ A;  3CES A;  3WTZ A;  3B6A A;  5D5V B;  2QQB A;  2V4J C;  1LE8 A;  3EET A;  4XRS A;  2K9L A;  2RQQ A;  3BJA A;  2DMT A;  3DEU A;  4XOT A;  5H6Q A;  1F9N A;  2O0Y A;  3GO5 A;  5FFZ A;  3SDG A;  4P1W A;  2OD5 A;  1A36 A;  1BL0 A;  4NQW B;  3S2W A;  2LP0 A;  1I39 A;  3GTQ J;  4M3E A;  5D6F A;  5KK1 A;  4A3I J;  2KIM A;  4IJA A;  2YU3 A;  1TWG J;  3KEY A;  1R5G A;  2V7F A;  3M1C A;  2R7Z J;  2HOS A;  4HX4 A;  3OIQ A;  4EEF G;  4PFO A;  3FK6 A;  3DPU A;  2Z33 A;  1R4M B;  4AUX A;  1STZ A;  1VQK I;  2VOD A;  4RAY A;  3SZG A;  4E7I A;  1K4T A;  3CD6 I;  3L09 A;  1ZG1 A;  2OZU A;  1FY7 A;  4EGY A;  1VQ4 I;  5IPA A;  3VSL A;  4BQN A;  1YHQ I;  2JK3 A;  3GW2 A;  1MND A;  1WH5 A;  3H9J A;  1EF4 A;  3I4M J;  1FPQ A;  4HF2 A;  3CZ6 A;  4GYG A;  4BJT A;  2W57 A;  3P5J A;  4L9J A;  2KFD A;  1D0Z A;  1X1C A;  2QGU A;  3OYA A;  2VN2 A;  1IV6 A;  3OYD A;  3T5X A;  5LFA A;  3I55 I;  1FIA A;  3KLN A;  3QU6 A;  2GM4 A;  2FNP A;  1ZR2 A;  4XRS G;  1NHA A;  4L9N A;  1K4S A;  4RB2 C;  1KQ8 A;  3CJQ B;  1P9Q C;  1V4R A;  1USS A;  3LA2 A;  3K4C A;  3HHG A;  1PUF A;  1KGS A;  1T33 A;  2CS3 A;  2GIV A;  2ME6 A;  5ICC A;  1JXS A;  1W1W E;  4NC6 A;  3K9T A;  2VB6 A;  3JTH A;  1G3S A;  4S0H B;  2GXG A;  2O8X A;  4MIM A;  4UVA A;  3WE3 A;  3ZMT A;  4BQA A;  5LRR A;  5J4Y A;  1TC3 C;  3DTE A;  4KIB A;  3L2Q A;  1Z21 A;  1Q1H A;  1XGO A;  1GT0 C;  2HZD A;  3HRU A;  2IA1 A;  4HYE A;  4Z2Y A;  1GLN A;  4KIF A;  1LE8 B;  3HRT A;  4AIJ A;  1P7I A;  5CQG A;  3IWZ A;  2BY0 A;  3GZN B;  4U7B A;  2IGN A;  3AAF A;  3FKI J;  1SAN A;  1E3P A;  1KU3 A;  2M2E A;  2VBY A;  1DPU A;  2X4H A;  3QYE A;  1ERD A;  1KU7 A;  2UV1 A;  4WXD A;  3AG2 H;  2E19 A;  3LOC A;  2CG4 A;  2ZSH B;  3C7J A;  1JKO C;  2Y30 A;  4OAY A;  2ZC2 A;  2HPI A;  3NEU A;  3D5S C;  2MC3 A;  1B59 A;  3BY6 A;  3ZMZ A;  1G6N A;  1S72 I;  3FX3 A;  1BR1 A;  2KRH A;  2XF7 A;  5ILS A;  4F93 B;  3JRD A;  4A3B J;  2OBP A;  3C2G A;  1ON2 A;  5FKL A;  3S32 A;  1LPQ A;  3AL0 C;  4D1Q A;  1TWC J;  2QZ8 A;  3FXJ A;  2K3P A;  3GTP J;  2VC0 A;  4ITV A;  3LSR A;  3MQ0 A;  4DNC A;  5TRD A;  1EA3 A;  2XRN A;  4BQO A;  1LB2 A;  2LKS A;  4BHP A;  2LY1 A;  2IXS A;  3ZMS A;  2CW0 F;  2M45 A;  2IS2 A;  3K4K A;  1OYI A;  2K27 A;  1IO2 A;  1WJF A;  2KHM A;  4EJU A;  1ZLK A;  2M0C A;  3BDD A;  4RM2 A;  3J80 K;  4E7J A;  3CDI A;  2D45 A;  4RAZ A;  3TED A;  4BDZ A;  1KYW A;  1LEA A;  2QKL B;  1SFX A;  2RKH A;  3M9A A;  4BAC A;  2F6C A;  1S3J A;  1FMW A;  1Z6R A;  3OYB A;  1ZRF A;  2EJR A;  2OTJ I;  2E1M C;  3PM1 A;  1BOA A;  3WGH A;  5LGT A;  3OYM A;  2CW7 A;  2LF7 A;  1WJC A;  3RPU A;  4FX0 A;  4IHY A;  4RLF A;  2O3F A;  4RDU A;  1K61 A;  2E60 A;  2Q2E A;  3FZV A;  2R3S A;  4A6E A;  2O7O A;  2KKO A;  1AKH A;  4FE4 A;  2CFO A;  4BL0 B;  3MEX A;  4HDU A;  1FSE A;  1P4A A;  1UAA A;  2XKO A;  2GWR A;  4IEJ A;  4IOA F;  1OYY A;  4MGR A;  2EZI A;  1ZN2 A;  3A2K A;  2IEK A;  1R7J A;  2DFI A;  1Z1D A;  3CCV I;  4X1E A;  3Q9S A;  2W84 A;  2YR2 A;  2CWE A;  4NNJ A;  3F8B A;  1G3T A;  5H6R A;  3TGN A;  4BY1 J;  4UUS A;  2WAQ N;  3FMR A;  1DU0 A;  1BA5 A;  4DOZ A;  2RGV A;  2MGQ A;  3HGY A;  4YEL A;  4IO9 F;  4BNC A;  4IQJ A;  3CJT B;  2R7W A;  3OV8 A;  3HOW J;  3CDH A;  3GFL A;  2L7Z A;  3FKJ A;  1TP4 A;  1N75 A;  3REO A;  2EBI A;  3CCY A;  2A68 F;  2L7K A;  3OYE A;  1ZEL A;  2JA8 J;  3FIW A;  3N05 A;  1HW1 A;  4FAS D;  1J7K A;  3VWB A;  4AWX B;  5D5U B;  4HF0 A;  1WRJ A;  2DMU A;  3TW6 A;  5EG0 B;  3CCS I;  1J2X A;  3ZQQ A;  2AO9 A;  4RB3 C;  2Y31 A;  3JCU C;  3W3C A;  2NVQ J;  1LDK B;  1YS7 A;  2BW3 A;  1YO5 C;  3GTL J;  5EZG A;  3A0H C;  1Y1V J;  4G7O F;  4JYK A;  1R58 A;  4XLA A;  1G2H A;  2H09 A;  3HZJ A;  3KP2 A;  2ZNY A;  1ZH5 A;  2DT5 A;  3CP2 A;  3IRQ A;  5GAG J;  4ESB A;  1DDN A;  2M1B A;  4P9U A;  1K79 A;  1OIS A;  2A5W A;  4LOC A;  3M8E A;  4KJZ A;  2R7T A;  5CVI A;  4UHT A;  3WHB A;  3OYN A;  2W82 A;  2W24 A;  4OIN F;  2F4M B;  1YYV A;  1DUX C;  2XGE A;  3H92 A;  3HOU J;  2E2I J;  5TIS C;  2ZJQ F;  2ECB A;  5KAI C;  2LBF A;  1W5T A;  2VBX A;  4ESF A;  1MBK A;  2NRA C;  1WCM J;  2YX4 A;  2DO7 A;  1XDU A;  2R5Y A;  3TQN A;  3FF5 A;  2EV6 A;  1OR7 C;  1V5F A;  1YFH A;  2CQX A;  3PO3 J;  3E5Q A;  1AKH B;  4HPQ A;  1D8K A;  3HL2 A;  1IRF A;  1N77 A;  1YQA A;  2EZL A;  2KRF A;  3G6E I;  4GCV A;  1FOX A;  3PFI A;  1W7P A;  2EH3 A;  3KP4 A;  2QEN A;  3ESW B;  2DPU A;  2AXT C;  1D1C A;  1NG6 A;  3J7A Y;  3OL3 A;  1IAW A;  3M3Y J;  1S7A A;  3LNQ A;  3F6O A;  3WTU C;  3SFZ A;  3W6V A;  3FXM A;  3A01 A;  2R7F A;  2VQL A;  3LMM A;  2L5Q A;  1KQ0 A;  4RA2 A;  1IN5 A;  3IH2 A;  1JJ6 C;  4LK1 F;  4UUS B;  1KU2 A;  2DMN A;  2R7U A;  3D0S A;  3RIR A;  1QZZ A;  3LA7 A;  1HOM A;  2RNG A;  3LSI A;  4OWR B;  1HDP A;  4F91 B;  2VC1 A;  4HX8 A;  3QPS A;  4B3X A;  2DAO A;  2KIF A;  5F04 A;  2E34 A;  4ANJ A;  3GTJ J;  4V2G A;  3LSK A;  1Z7L A;  1XPX A;  4CCL A;  4IRG A;  3MKZ A;  3MZ8 A;  4A5M A;  1GVD A;  3I4P A;  1C0W A;  3ONQ A;  4LB6 B;  2VKV A;  4NC8 A;  1R1U A;  2CQN A;  4MEX F;  3J80 Z;  3BG6 A;  1CQT A;  4LIU A;  2QQ9 A;  3GZ6 A;  3Q3S A;  4I76 A;  5HDK A;  1S7E A;  2VT3 A;  3ABM H;  3LFU A;  5ICF A;  2NS0 A;  1IV8 A;  4CUG A;  2Z1D A;  4L18 B;  4UY8 I;  2UUZ A;  1UHW A;  2BW3 B;  3G71 I;  2FF4 A;  3BJ6 A;  3K0L A;  5EZH A;  4HW0 A;  3W6K B;  4TV7 A;  1IJW C;  4R79 A;  2EFQ A;  1ETO A;  2K40 A;  2P6S A;  2IW5 A;  1WJB A;  4ZYH A;  5K7F A;  2BZT A;  2X1C A;  3H36 A;  2RDP A;  5LEK A;  1XSD A;  1MBJ A;  4HAM A;  1HKS A;  2IPQ X;  3SQN A;  9ANT A;  1OPC A;  3GF2 A;  3K4M A;  5ILU A;  1R9T J;  2KRC A;  2R5Z B;  4K2E A;  2DYR H;  1ZG5 A;  1BJZ A;  2BE5 F;  4RMN A;  2LBF B;  1G59 A;  3K1N A;  5J1Y A;  2K9M A;  1F36 A;  4DBQ A;  3HOX J;  4D7N A;  3KZY A;  1TL8 A;  2QSG X;  2DLL A;  4OIP F;  5CPR B;  2RN7 A;  4LJZ F;  4BJ6 C;  2XB0 X;  3IH4 A;  4GYI A;  1LVA A;  2VJ4 A;  4UVC A;  5JHF A;  3OIP A;  1IXS B;  1J59 A;  5FRO A;  3RSN A;  1W7P B;  4M9S A; 
#chains in the Genus database with same CATH homology
 5IP9 J;  1Z77 A;  3MN2 A;  2EZK A;  4BBR J;  3BR5 A;  3Q0V A;  5FJ8 J;  2KDZ A;  2DA1 A;  2VPR A;  3K7A J;  2CU7 A;  2ID3 A;  2QF7 A;  2EZH A;  1JT0 A;  3IV5 A;  2Y9Z A;  5EYR A;  1MBH A;  1MBE A;  1ITY A;  3A01 B;  5J1R A;  4IHV A;  5E3M A;  1XG1 A;  1LFB A;  2XPV A;  1IRZ A;  3QPL A;  1U9N A;  4BKX A;  1MH3 A;  4IHX A;  4D7M A;  3HB9 A;  3GTM J;  1ZK8 A;  1GV5 A;  1UMQ A;  1ZGW A;  2ECC A;  1VND A;  2H8R A;  2Y9Y A;  1NK3 P;  2R5Z A;  1HF0 A;  4L5E A;  2HOA A;  4V2F A;  1Q1V A;  2G0E A;  2DMP A;  1I3Q J;  1P7J A;  3BG9 A;  1WGX A;  2JJ7 A;  1BW6 A;  1RES A;  2JMW A;  1NTC A;  4D5F A;  3BTL A;  3NAR A;  1B72 A;  4C3H J;  3ZQI A;  2LKX A;  3G1L A;  2TCT A;  3G1M A;  3MKL A;  1ETY A;  2X9D A;  2YUS A;  1IG7 A;  3DCF A;  1OCT C;  2YU9 J;  1XC5 A;  5IP7 J;  3BQY A;  3RZO J;  2Y0S N;  4M6V A;  3S1N J;  1O4X A;  2KT0 A;  4FTH A;  2X6O A;  1ETK A;  3QQA A;  1ETV A;  5IOZ A;  1GUU A;  3O8G A;  1JJ8 C;  1X2N A;  1ETW A;  4JX5 A;  2E2H J;  1X58 A;  5GP9 A;  1LFU P;  4A3G J;  1JUS A;  2NVX J;  2IBD A;  2DA2 A;  3HOV J;  4FCY A;  5FKM A;  4JP0 A;  5GPA A;  2TRT A;  2P81 A;  4MO7 A;  2XGC A;  1ZKG A;  4C3J J;  4A3M J;  3B6A A;  1RPW A;  2L0K A;  1LE8 A;  1F43 A;  1IUF A;  4XRS A;  1MH4 A;  3GTG J;  2COB A;  5M3F J;  2DMT A;  3H0G J;  2DN0 A;  2HDD A;  3UKG A;  2HI3 A;  5JLX A;  1WPK A;  2WB1 N;  3BTJ A;  2JA7 J;  3SDG A;  2MSY A;  1BL0 A;  1JT6 A;  2L7F P;  2M34 A;  2ZB9 A;  1B8I B;  4MFE A;  2LP0 A;  2DA7 A;  3GTQ J;  4M3E A;  1U9O A;  2VUM J;  4A3I J;  5C4J J;  2HYJ A;  5F1J A;  1TWG J;  3G1O A;  1PUF B;  2R7Z J;  3DEW A;  2HOS A;  4EEF G;  3FK6 A;  3OOU A;  2FD5 A;  4AUX A;  2E1O A;  4W97 A;  2FJ1 A;  4MLO A;  3SFI A;  3ZQG A;  2LY9 A;  4M3F A;  2FQ4 A;  1JUM A;  5IP6 A;  5EF6 A;  1IDY A;  2OF7 A;  3JRB A;  5DS9 A;  5IPA A;  3CDL A;  4CYC B;  3S16 J;  2EQR A;  2JK3 A;  1WH5 A;  1EF4 A;  3S1Q J;  3I4M J;  1JKQ C;  3BT9 A;  4DZJ A;  2R92 J;  1BW5 A;  4XRM A;  2DA4 A;  1IV6 A;  2AHQ A;  2HXO A;  1FIA A;  4NDL A;  2X48 A;  2GM4 A;  1ZR2 A;  4XRS G;  5BNG A;  3OSG A;  4JX4 A;  2IAI A;  2XPU A;  1Z0X A;  1GV2 A;  4RBO A;  4B3A A;  5K7H A;  2Y2Z A;  1B8I A;  3HEF A;  3HGG A;  3B6C A;  5EGO A;  1FIP A;  1PUF A;  4DW6 A;  1T33 A;  3GBG A;  2ME6 A;  2NVY J;  3NAU A;  4S0H B;  4MIM A;  1VI0 A;  5HOD A;  2N8G A;  2H1K A;  5C4X J;  4M3G A;  1JKP C;  1TC3 C;  2RAE A;  2HQ5 A;  4C3I J;  2ID6 A;  3O8H A;  1GT0 C;  3M4O J;  4CYC A;  4M3B A;  1QPI A;  2JN6 A;  1LE8 B;  4DYR A;  1P7I A;  2ME0 A;  3BR3 A;  2LK2 A;  2PMZ N;  3FKI J;  1SAN A;  3RQI A;  2M2E A;  3BR1 A;  5FKO A;  4Y7N J;  2K9S A;  4BBS J;  2E19 A;  3LOC A;  3SJM A;  1AHD P;  2NS7 A;  4DYC A;  1JKO C;  2Y30 A;  4BXX J;  5EEA A;  1HCR A;  3JRD A;  2XRL A;  4A3B J;  1VFC A;  5FKK A;  2E2J J;  5FKL A;  3BR2 A;  4FIS A;  3BR0 A;  1H8A C;  1TWC J;  3BG3 A;  1A5J A;  1ETQ A;  2LD5 A;  3L1P A;  3CMY A;  3ZQH A;  1IC8 A;  3GTP J;  3LSR A;  4D5C A;  4DZP A;  5M5X J;  2CQQ A;  3HM5 A;  1WI3 A;  2GLO A;  1POG A;  1MBG A;  1WH7 A;  3HKZ N;  1TWH J;  2M0C A;  3JRG A;  3HDD A;  3ZOB A;  2JA5 J;  2R0Q C;  1H88 C;  3MVP A;  3TED A;  1Y1W J;  1SFO J;  2XGD A;  2QCO A;  1FEX A;  2D5V A;  3FK7 A;  3FIS A;  1W0T A;  5F27 A;  5M5W J;  2DA6 A;  5IYB J;  5EGO B;  3RZD J;  4A3F J;  3PM1 A;  3K2A A;  3Q0U A;  1OJL A;  3LSP A;  1U78 A;  4A3C J;  4IHY A;  3PO2 J;  3F0C A;  4RDU A;  1K61 A;  1VF9 A;  1MSE C;  1W0U A;  4MFD A;  1UG2 A;  2O7O A;  1AKH A;  2O8K A;  3JRC A;  2JA6 J;  2K9N A;  4FE4 A;  4JX6 A;  4A3D J;  2HOT A;  1X2M A;  2LVS A;  3JRE A;  4IEJ A;  2EZI A;  1YRN B;  2NS8 A;  5E3N A;  2XSD C;  1HDD C;  2IEK A;  3BTC A;  4X1E A;  4X6A J;  4UUT A;  3JRI A;  4J19 A;  4BY1 J;  2DJN A;  5E3O A;  1ZQ3 P;  4UUS A;  2WAQ N;  4FE7 A;  1DU0 A;  1BA5 A;  1MBF A;  2MGQ A;  3HGY A;  4HNV A;  2FX0 A;  1TWA J;  1RET A;  3HOW J;  5FKN A;  5EDN A;  2R5Y B;  4DYQ A;  3ZQL A;  5F0C A;  1ENH A;  2YS9 A;  2L7Z A;  2EBI A;  3CCY A;  2NVT J;  2I10 A;  2DA3 A;  5J3L A;  3OIO A;  3RKQ A;  2JA8 J;  3FIW A;  4QSH A;  4C2M J;  2L7M P;  2R93 J;  5FLV A;  1ORK A;  1MSF C;  1H89 C;  2DMU A;  2DMQ A;  3HBL A;  3TW6 A;  2LTP A;  5EG0 B;  3JRH A;  3HOY J;  2CRG A;  2AO9 A;  1TWF J;  2VI6 A;  1D5Y A;  2Y31 A;  3S15 J;  1GDT A;  2NVQ J;  1T56 A;  1I50 J;  3GTL J;  5EZG A;  1Y1V J;  4JYK A;  1G2H A;  3S17 J;  1JTX A;  1YRN A;  3ZQC A;  2JWT A;  1AU7 A;  2CJJ A;  2MG4 A;  4LOC A;  3JRF A;  1OFC X;  5J1U A;  3ZQF A;  5M5Y J;  3S14 J;  3A02 A;  3WHB A;  4A93 J;  4QTR A;  4AYB N;  2B63 J;  3LSG A;  1APL C;  1FTT A;  2NOG A;  3WHC A;  2MW8 A;  2XGE A;  2GBY A;  2E2I J;  3HOU J;  2ECB A;  5C44 J;  1DU6 A;  1QRY A;  4A3L J;  2VKE A;  3S1R J;  5F0H A;  1A6I A;  1MBK A;  2ELK A;  3BR6 A;  1K83 J;  1JGG A;  1FTZ A;  1WCM J;  2R5Y A;  1JTY A;  3PO3 J;  1HLV A;  2CQX A;  1AKH B;  2O9L A;  2DTZ A;  4W1U A;  2EZL A;  3TP3 A;  3OSF A;  1ZR4 A;  2EH3 A;  4B1R A;  1NK2 P;  5IYD J;  5EG0 A;  4QIW N;  2LR8 A;  1U8B A;  3GTK J;  3M3Y J;  3LNQ A;  2LFB A;  1E3O C;  3W6V A;  3A01 A;  1IGN A;  3C2B A;  1OCP A;  3IH2 A;  2WV1 A;  5GPC A;  1JJ6 C;  5F08 A;  4UUS B;  4IHW A;  2DMN A;  2OPT A;  2M9H A;  4A3K J;  1HOM A;  1HDP A;  1ZTR A;  2XPW A;  3QPS A;  5F04 A;  3GTJ J;  4V2G A;  1UHS A;  1GVD A;  1RR7 A;  3LSJ A;  4A69 C;  2K9Q A;  1QVU A;  5DTD A;  5M3M J;  4M3D A;  1MNM C;  2VKV A;  1CQT A;  3S2H J;  1IDZ A;  5IYC J;  4Y52 J;  2DA5 A;  3Q3S A;  3BG5 A;  4I76 A;  1S7E A;  4B4C A;  3JRA A;  2HXI A;  1QVT A;  5JLW A;  3JR9 A;  3D1N I;  1XS9 A;  3IH3 A;  5EZH A;  1FJL A;  2CUF A;  2W48 A;  1IJW C;  3HOZ J;  1ETO A;  2K40 A;  4G12 A;  4AC0 A;  1RKW A;  3CQZ J;  5K7F A;  1MBJ A;  1I6H J;  1RKT A;  3Q0W A;  1JKR C;  4I6Z A;  4A3E J;  9ANT A;  1R9T J;  3BQZ A;  3TP0 A;  3A03 A;  2R5Z B;  1JUP A;  5FLM J;  5E3L A;  5F0F A;  3VPR A;  3GTO J;  1BJZ A;  5K7Z A;  4XID A;  2M8G X;  3BTI A;  2CUE A;  5J1Y A;  1F36 A;  3E7L A;  4ABZ A;  4BY7 J;  4D7N A;  3HOX J;  5C3E J;  5IOY A;  4A3J J;  1B72 B;  3I4N J;  3S2D J;  2XB5 A;  3H3V K;  4XIC A;  1ETX A;  4GFB A;  3S1M J;  2XB0 X;  3IH4 A;  4XK4 A;  3TW7 A;  2L9R A;  2LLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...