2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
1WELA 4R79A 4TU7A 3K69A 2P4WA 1U3EM 5K5QA 2MY8A 5L3EA 2DI3A 3F8NA 2OA4A 5HS8A 1N54B 1X4GA 1YW9A 3E97A 1GXQA 1WEYA 4WK8F 2QLZA 3QOPA 2QUFA 1R36A 2CQCA 3SFZA 3QAHA 4MNUA 1MZBA 4WCGA 1XGOA 2CWEA 4LMYA 3SZTA 3FEYB 2D45A 2X4HA 2FNPA 3BO4A 4QWQA 1IN7A 3KP2A 5EEHA 1ZREA 2RN7A 5GAGU 3ULHA 3GVAA 4IVNA 3FMRA 3OOPA 1HW1A 2DHGA 1SD6A 2VXZA 4Y17A 3G73A 2COMA 3ZN1A 2FBIA 2CPYA 2XNRA 2FE3A 2ZNYA 2HQRA 4GXOA 3TOBA 2DH7A 1LVAA 1BI2A 2D1HA 3M8FA 3E6BA 1HKQA 1XDUA 3E5XA 1JJHA 2V1DA 2HOEA 5JI6A 1G3YA 2MH9A 1YHQS 1RUOA 4B09A 3O3KA 3P9CA 3TDZC 2DO4A 2XROA 2D1VA 2Q8KA 4TV7A 2CQIA 3G71S 5ICFA 4UV9A 2TDXA 2HKXA 4A0XA 4C0OC 2CQKA 5F1RA 5D6EA 1SXLA 2WV0A 5HLGA 3VAGA 4M5DB 5CYJA 5KVRA 1J0RA 1FYLA 1VQOS 1P92A 2IP2A 3MWMA 4WFBQ 1A9NB 4KA4A 1JJ4A 2JVOA 2R7DA 2DNNA 1UFWA 4BHBA 3V7SA 1Q81T 2CQ4A 1HKTA 2MQQA 5HOOA 3J81Z 1R1VA 3KCCA 1NHAA 4ZYEA 4B8XA 2RV8A 1M5VC 3QU3A 3DKWA 5JFRA 1KOOA 3CCJS 2AYMA 3JSPA 2M30A 3VAHA 3D2WA 1DPRA 1VQ4S 3GUDA 4D0PA 4YFNF 5JVHQ 1SFUA 4OZ0A 3EGNA 3JB9k 4LMZA 1E2XA 1L3LA 1D9AA 4U7BA 1PUEE 3E5QA 2CQDA 2AS5F 1VQPS 1D8KA 3BS9A 3BP8A 3C7JA 3RDIA 2N3LA 3H3ZA 2M88A 2P5KA 1U8RA 3Q2TC 1YW8A 5BJRA 3BO3A 1V4RA 1J59A 1X4BA 2EWNA 3TO9A 2IA2A 3P6YC 2ADUA 1QNTA 4YFXF 4WXDA 3I5UA 4YB1P 4RAYA 2UZKA 2XKOA 5D77A 5D4RA 3TKYA 5BMZA 5HS7A 1P4AA 2CQ1A 3P5TL 1WI8A 4HQMA 5FO5A 3G8TA 3I53A 4KIFA 5J6XA 3HOTA 3I56S 2V9VA 3KLOA 4YIFA 3ECHA 1SMYF 2Z33A 2A07F 2PE8A 5FLXK 1TNTA 4UVAA 4N9HA 3CTRA 1I27A 4ZYGA 2CPEA 1PDNC 2EJRA 2YU3A 3KEOA 4P96A 1S72S 3K9TA 5A2QK 1H2VZ 2Q2EA 4WX9A 4ETSA 5E8IA 4HX8A 2DNZA 3VAIA 4L9VA 3B73A 4YFKF 3CTAA 1TTYA 2DPUA 2DNGA 3VAKA 4CGZA 1G2EA 1H6KX 4UUVA 4GYGA 4RB2C 1ZHFA 3CLOA 4YUDA 2KFYA 3G4SS 1ODDA 3ZMUA 2W84A 2MZQA 2ZFWA 2ZJPQ 1HQCA 2V1XA 2KJCA 2LDUA 1R1UA 5BQTA 3D0SA 2OZUA 1PO6A 3GF2A 1FBSA 3HTUA 1B9MA 2WTEA 3HRSA 3WTWC 2ZKZA 4YG2F 2VE8A 2L02A 3O6BB 1I1SA 2CPZA 1J9IA 2LF7A 3GWZA 1WQ2A 2VBWA 4OIRF 3MI7X 5IT3A 3Q9VA 1QM9A 3BOQA 2BYVE 2LMIA 5DM7Q 5E1WA 3BJ6A 3IRWP 2MPUA 3KE2A 5LGNA 2G9WA 1B7FA 2XIGA 3SQNA 2RGVA 1BI3A 4R1HA 5HLHA 1X5TA 3OV8A 4XRFA 3FMQA 3R0JA 1XMKA 4EM2A 3FXRA 2QYOA 4MQVA 2MQNA 4W92B 5L3BA 2QA4S 3CUQA 1HSTA 5ILUA 1U5TB 4I09A 3UCZP 3I64A 1KOHA 2J5OA 2CYYA 1GVJA 3K1PA 5J8CA 4MTDA 2MGZB 4FXVA 3CD6S 1RIOH 1FSHA 1FO1A 2Q0OA 2MJUA 3FF5A 2EK1A 4NB5A 1XDSA 3GZ5A 3R6SA 5LHHA 2MMYA 4U0WA 2MZJA 2V6CA 1VQKS 4BH9A 3HI9A 1J7KA 5DEQA 3T5XA 2DITA 1F9NA 2EVZA 2J8AA 4WCEQ 1WRJA 2YX7A 3AAFA 1B9NA 2GIVA 4LK0F 2CPFA 1UFMA 1U78A 3F3XA 1YIJS 2A6EF 1MGTA 4AVPA 3K1NA 3MUMP 3CUNA 1DZ5A 4MGRA 1SJ4P 4F02A 5CVJA 1P4WA 1ONVA 1S6LA 3DQVC 1K8AT 2R3SA 1USSA 4ESJA 3CMAS 1W7PB 2VBYA 2L4MA 3H3UA 4WXHA 1O0PA 3WTXC 3H92A 2O8XA 5AIPA 3RI4A 4Q48A 1JJ2R 1WWXA 2MZTA 2JWNA 1X4DA 3IKVA 2E5JA 4IRHA 2Y48A 4BYYA 4I98B 2FRHA 4HDUA 1SJFA 4P5OA 4Q4ZF 1FJCA 4KUMA 4KMUX 3RKWA 3HTSB 1Z1DA 1ZYRF 2CQPA 4JBAA 1FY7A 1ON1A 2KN4A 2MA3A 3CC2S 1NO8A 1XB4A 1O57A 1BI0A 5JVGQ 2P5LC 2MKCA 4O6JA 4HOBA 4Z2YA 3N97A 4TU8A 3F8MA 4OMZA 1QGPA 2HKOA 2DGSA 5GAEU 3PQJA 4IF4A 5FGMA 2KT5A 1U1RA 1ZAOA 2W25A 4MEXF 1L3KA 3E5UA 2KU7A 2YKAA 3UCGA 2XVCA 1ZH5A 1R8HA 2XUBA 1BBYA 2YX4A 2XHKA 1WEXA 4F26A 1YS6A 3NS5A 3PQKA 3BPXA 2DGVA 2CW0F 2RU3A 2HEOA 3CO7C 3F22A 2DGWA 1N52B 1OYIA 3HRUA 2KIUA 2BZ2A 5GAHU 3HSEA 1F4KA 1RUNA 4IHTA 1U6BA 3K1MA 4A6DA 4P9UA 5JHUA 2CQ3A 1K6OA 2ERRA 2KIFA 3RTRA 2DGUA 1IXSB 2QM3A 2CQHA 5ILSA 2HQNA 2DNRA 2Y75A 1WG1A 1UHMA 3S6EA 3R61A 3SXYA 3UE2A 1R58A 2IJLA 4DQ2A 5LBQA 2DGOA 1G3TA 4EVIA 1JGSA 1YFHA 2DNOA 2LECA 2DTRA 5LEJA 2A68F 1R5HA 1HKSA 2LA6A 1VBZA 2EA2A 2YSRA 1HA1A 2ZMEA 4PCQA 2PJPA 1SAXA 2XAFA 2K02A 4U0YA 4XBFA 5CJ9A 2FPHX 3VALA 3SHFA 2M45A 4NQWA 1KD1T 2VODA 3IRQA 4CIOA 5GMKa 3FXQA 3JW4A 4I7HA 5DCFA 1KQSR 2DNLA 1XSVA 1QBJA 4W90B 5D78A 5ICCA 4HQEA 1MD0A 4ED5A 2MZ1A 5DUIA 3MEXA 1LDKB 1R00A 1P6RA 2VBXA 2FSWA 1X5SA 3K0JA 2M9KA 2LKPA 4OZ1A 2DNYA 3WE3A 2EK5A 2O6GE 1O7FA 4HW0A 4WF9Q 1WF0A 4HLYA 2MKSA 3HRMA 4IRGA 1WWHA 1IAWA 2F3JA 4HYEA 4EGZA 5D5UB 3CCUS 1DUXC 5H20A 3UD4P 1YI2S 5FJ4A 1OMIA 4KMFA 2A5YB 3EETA 4A5NA 2K3KA 1X4FA 1TW2A 2E1NA 1WHYA 3UD3P 2WBRA 1UCRA 5HDKA 2KJBA 2X1FA 2L08A 5DDOC 1WTBA 2NS0A 1Q1HA 4L5IA 3S2WA 4CH1A 3L09A 5E18F 1BIAA 2CPHA 2IT0A 2RUGA 2ISZA 2DB1A 3VAMA 1EH8A 3HSFA 3P7NA 2DGQA 2KIMA 4UVCA 3DPLC 3SMZA 1LB2A 2EV5A 3V7RA 2DU9A 2A3SA 1WSUA 5IT9K 4EJVA 2MXYA 4RB1A 1WG5A 4EM1A 3HOSA 2G7HA 2J5PA 2LEAA 1U1NA 1LNWA 4ZZDA 1G3SA 3ECOA 3BDDA 4RS8A 1OR7A 2Z5UA 5IQQA 1AWCA 2E5GA 2YR2A 1BM9A 2M8DB 3C3WA 3JSOA 3KZZA 3MCZA 2MJNA 3MUVP 3EQLF 4IOAQ 2HZTA 2Z3YA 2XAQA 2QBYA 2MH2A 3P3DA 1ZG5A 3IL2A 3GX4X 2CQBA 3WU1B 1QVFR 1P1TA 2M0GB 1IF1A 1SD5A 3R0AA 1FX7A 4EQQA 1VQMS 5ILVA 3I59A 2DHAA 5H6RA 5LEKA 2GHPA 1FBQA 1M5KC 1VQ8S 2DIVA 1DHMA 5K5RA 1PGZA 3EUHA 1X3UA 2RDPA 4KNYA 4G7HF 1A04A 2QQBA 3SXLA 2ZJQQ 2HFHA 2VOOA 3VF0B 4IUFA 1OKRA 4LIRA 1NU4A 4RAZA 3RYRA 3LA7A 1ZARA 1X5PA 5D4SA 1EH7A 1YS7A 4LLLA 1N88A 2MSSA 2OAZA 1O3RA 2LKZA 2GO9A 2DLLA 3S7RA 5K1YA 1MJAA 1FC3A 4FHTA 2V1UA 2DNMA 2MBFA 2L01A 2XV4S 1S8NA 1LDDA 2RRBA 1A7GE 4ENNA 2NZ4A 5DYMA 1S3JA 4LGWA 1XSXA 5CYVA 3PIOQ 2L41A 3D5LA 3K0LA 2KRFA 3ZQ7A 3EYIA 4RB3C 2QEXS 3TGNA 2DK8A 3KP3A 5CVIA 4WF2A 5BOXA 3MD1A 1KU9A 2E1CA 3CUQB 1DDNA 2VC1A 2LXUA 5AIQA 2XRNA 3E6MA 4HLXA 5D5WB 4GO1A 2HGNA 4LB5A 2KG1A 2E7XA 1Z7UA 1I1GA 3M9AA 3CCVS 4A0ZA 1VC6A 1X4CA 2RVJA 3IWNC 4KIBA 3EDPA 1KGSA 3QPTA 3R1HA 1K78A 4K2EA 4RGRA 1XN9A 2JZYA 2PG4A 1K79A 4AWXB 3GZ6A 2DGTA 2IA1A 4FX4A 2KKOA 2K27A 2LNBA 3S01A 3BROA 1XMAA 2KI2A 4OU0A 3DFGA 2JVRA 3J80K 2N82B 5FD5A 4WFAQ 3B02A 2XS7A 5DM6Q 4BQAA 1H9TA 1YW7A 4PGHA 4GGGA 3VAFA 4WXCA 3TQNA 3E6CC 1EH6A 1X4AA 3DV8A 4YIIA 2LYVA 4NHJA 2U2FA 2FHOB 3LQRA 3NQOA 2WWYA 3TDUC 2MQMA 3VFZA 2CSOA 2GA2A 4LB6B 5DUKA 1SJQA 2RT3A 4QU7A 1J75A 4PKDB 2MYFA 4RU2A 2HYGD 2DO0A 4HBLA 1UHWA 1PP8F 3QRFF 2J0SD 3DP7A 4M6YA 2ADBA 2Y0MA 1YIOA 2ZO4A 2R7FA 1VQ7S 1F5TA 3FWEA 3IC7A 4HV5A 4IOCQ 4OIOF 1X4HA 5DDRC 2HZCA 1TW3A 2O0YA 2LF8A 1BI1A 2Q79A 1ZN2A 4G6DA 3P9IA 1X0FA 3DF8A 4L9JA 1DPUA 2KG0A 2G7UA 2FOKA 1R7JA 2EA4A 2EFQA 5CLSA 2ZJRQ 1FJEB 3MOJB 4LK1F 3H2UB 3VEPA 4EGLA 1W5SA 3KETA 5ICGA 1IZ1A 2EK6A 4G94A 2RC4A 1ZG1A 2DNPA 3CUQC 1QZZA 1FXLA 2MKIA 3WTSC 3LQQA 1R8PA 1ZRDA 5F6FA 4M72A 2CQGA 1YQAA 4HF1A 2MY7A 3RW6A 2UWMA 2M1BA 2SXLA 4PGGA 4RGUA 2LSOA 4U0VA 1XGNA 3PIPQ 1KA8A 3CC7S 1FT9A 3KZYA 2HYIB 1VQNS 3L3CA 3J7AO 2P5VA 2XAJA 3LQVA 4M9XA 3SDEA 4CQ1A 5DDPC 3GFJA 4J5OA 1URNA 5H6QA 1T98A 3DLLQ 2MZRA 1CF7A 3CMES 3THTA 2ZMEB 2RNEA 4WFNQ 4KN4X 4PDKA 1ZRCA 3WGGA 2RQ4A 1HD1A 2FF4A 3VOEA 1OWXA 2HWVA 5IT9Z 3KP6A 3KP7A 2KRRA 4QU6A 1BC7C 4KFCA 4ZZLA 2DK5A 1H2UX 1S7AA 5BPIA 1BN5A 2AYGA 4LJZF 5E1XA 2PMHA 2YH0A 3HHGA 1HW5A 1FYKA 4M73A 2EV6A 3WTTC 2F5EA 3U9GA 2M7SA 1XCVA 2Z9OA 4I2OA 3NS6A 4EJOA 1P2FA 3GYHX 5GADU 5HS9A 2QENA 3DXBA 1BIBA 1FWZA 4LLGF 4Z2XA 3V8JA 2E5IA 5E1ZB 3NNCA 2QQAA 3RJPA 1VBXA 3C1DA 1LQ1A 4XLNF 3HSRA 3ISPA 2FY1A 1IN4A 5LXYA 1QO0D 1BOAA 2F9JA 4IO9Q 2M70A 4PRFA 2LXIA 1AOYA 4WKRA 2MQPA 4G7ZF 1YO5C 4N9IA 1WHXA 2PMUA 1MKMA 1QPMA 2GA1A 3R4KA 5LHIA 1HD0A 3K2ZA 2ESHA 5L3GA 5LRSA 1YJNS 2M4MA 1CGPA 1WEZA 1T6SA 1WF2A 4I02A 2A69F 1TQMA 4UVBA 4OMYA 2FC8A 3W6KB 4BAYA 2M5WA 1RNLA 1M90T 1RK8A 2M8EA 2O3FA 2KVIA 1FHTA 1WF1A 4QPTA 1ON2A 4OOIA 1REPC 1MDMA 4MEYF 4OIQF 1EV7A 5LGUA 4M9ZA 1ZLJA 2GQQA 2HYFA 4L0ZB 4AIHA 2K8GA 2MHNA 4BHCA 1RI7A 1KU3A 2STTA 3BEGB 2CO5A 1T39A 3V8LA 2QBYB 3CCQS 2EFNA 4LG0A 4CDGA 2W24A 3BO2A 4IJAA 3IKTA 3JAMK 1WKMA 4CO8A 4O5VA 1KC8T 2E5HA 3LPYA 2DHXA 1PP7U 3I59B 5LRRA 2AYBA 2W57A 1U1QA 1W5TA 3KP4A 4BXUA 3KP5A 2MKKA 2I38A 2YTCA 1N8RT 1SD7A 1RZ4A 3RW7A 3ZMDA 1KU7A 4H0EA 3I55S 2UXNA 2MQOA 4U88A 2M52A 5LSLA 3W6JB 5ITHA 4QQBA 4Q5SF 3EYYA 4BHPA 2ZBKA 2FXAA 3ABUA 2F5DA 5DDQC 5AONA 1VTNC 2JX2A 3BPVA 4A5MA 1QZYA 3ZMVA 2DBBA 2CQ0A 1O7LA 2RNJA 1AUDA 4CXFA 2ZNZA 2M8HA 3I0TA 3I58A 3WODF 2ADCA 5DD4A 3TOAA 2Z99A 3J80Z 1Y0UA 2PEXA 1MJBA 3B4DA 3EX7B 2EFPA 4EJWA 3Q2SC 3LAJA 1D8ZA 4GCVA 2J76E 2OIHA 2O3DA 2G1DA 1WG4A 2MC3A 2U1AA 5D5XB 4TLQA 4IRIA 3KFWX 3WE2A 2OSRA 1SMTA 2DT5A 2EV0A 2XKPA 4G8XA 4ZYDA 5LSOA 3ULQB 1Z6RA 2BBYA 1IXCA 5LJ5Y 1FNXH 4A6EA 2L4AA 5FLXZ 3M8EA 3RPUA 1GXPA 1J2XA 2P7VB 3H2VE 2CGPA 3N9UC 1BY9A 3F6VA 5A2QZ 3SZPA 1H2TZ 3G6ES 2XAGA 4EV0A 4Y0FA 2P6SA 4ENJA 5TRDA 2OQGA 3WTZA 1I5ZA 4L18B 5FFZA 4UNOA 5MLCV 4OINF 3CCSS 3GFMA 3WGHA 3ZPLA 3F8FA 2CG4A 3ELKA 1K78B 4RGXA 2LQ5A 1S29A 3NNHA 2OTJS 1FLIA 2VOPA 4C4WA 3V4GA 1ZGJA 3FHZA 1XGMA 1R5GA 2OBPA 4F25A 4S04A 2E44A 2YPRA 2BV6A 5HDGA 2H94A 4UXNA 1X4EA 5D8LB 2B0GA 5DV5A 3GEZA 2LA4A 1O3SA 1KU2A 3F6OA 5JR3A 1JHFA 2PLYA 4IPAA 3CPWR 1VQLS 1STZA 1BJAA 3NMRA 1X5OA 5CVUA 1S79A 4UHTA 2HVZA 1ULYA 1ZGAA 2GAUA 3BWGA 1IUYA 2QZ8A 4O3MA 3JTGA 4BS2A 1B59A 2G0CA 1DRZA 2OU2A 4EGYA 4UY8T 4IHSA 3QPHA 1XSDA 4I0AA 1SFXA 1FPQA 5CVRA 1IN5A 4C7QA 4P9FA 2BE5F 2DO7A 5E8GA 3T1BA 5D5VB 2RRAA 3HRTA 2D3OR 2PN6A 1R22A 3ZP5A 1LEAA 2FQ3A 4KICA 2IRFG 2NNYA 2DK2A 2EB7A 5DDGA 3M7GA 3I71A 5LXRA 2HGMA 1VBYA 5EN1A 1FT8A 1OIAA 3U1MA 2WC2A 1VQ5S 2E7WA 1HBXG 1KYWA 2FMLA 1HXDA 4AIKA 4Y15A 2FEZA 1ZZFA 3IHUA 2GZWA 2ISYA 4HX4A 4M9SA 1M5OC 2RQCA 2OQRA 1TNSA 3TO8A 4ZKAA 1B1BA 3VB2A 3ZN0A 3ABTA 2KM8B 2XS5A 2UP1A 2B0LA 4MHGA 1IXRC 3U2RA 3DPTA 1HW2A 1B4AA 3F8CA 1RKJA 2QFJA 3MD3A 1Q82T 1W2BR 2XB2D 1IN8A 3LSTA 3NEUA 5IM0A 4AIJA 1Z6TA 3G8SA 2DH8A 2W85A 1K9MT 1JMTA 2CPXA 3JTHA 4LD5A 3FM3A 3Q5FA 3RYPA 3L00A 1VC0A 3MXHP 1JE8A 1VQ9S 2PI0A 2NLWA 3R1LA 2FU4A 3QP5A 1M5PC 1T2KA 1P27B 3DXJF 1DBDA 3GLXA 2PFBA 3G9CA 3J7ZT 3NNAA 1YITS 3SDEB 1UP1A 5L3CA 2KRBA 1LJ9A 1K73T 2CPDA 3RPQA 2A3JA 1CF7B 2P7CB 2M87A 3RIRA 3ZZYA 4EM0B 3N4MA 4A2UA 4U7DA 2RKHA 2H09A 4M6XA 2OJ3A 3CCRS 4ENKA 2EFOA 3F8BA 2QQ9A 3FZVA 1FSEA 4HV6A 1BC8C 2FMYA 3US5A 2KH9A 5LHGA 3HHHA 2J0QD 2M2BA 1TQIA 1ZG3A 5FFXA 3B4MA 1WI9A 4A8XA 2ACJA 4WWCA 3T8TA 2ZXJA 1L0OC 5DCMA 3L9FA 3NRVA 2DGXA 4Y00A 2XS2A 4G7OF 2MZSA 3JAMZ 2VN2A 3ROUA 3BJAA 4FT8A 4GYIA 4EMSA 4ENMA 3KEQA 2DPDA 5E20A 1F9FA 4KT5C 3FM5A 2VT2A 2DH9A 1D3YA 2CPIA 1JHHA 2D9OA 4L9NA 5IFMA 1CVJA 5LLQA 3PFIA 2H27A 2XASA 2OZ6A 5H1SV 1IW7F 4XSXF 2F2EA 3WGIA 4KDPA 5K5OA 3FEXB 2ETHA 4CHUA 4A0YA 3ML6A 1TQPA 2P6TA 2KM8C 2NAZA 4F7ZA 1QQIA 3P9KA 4FX0A 3FMSA 1SD4A 1U1MA 1F1ZA 3CC4S 3CDHA 2FA5A 4EJUA 2D2WA 1LDJA 3CO6C 2K4BA 2MLKA 3HIFA 1TBXA 1XGSA 1HL6A 3RKYA 3UCUP 1R1TA 2XNQA 2DISA 3R27A 2CFXA 2JRSA 2L3DA 1MDMB 4E70A 5DD8A 2GXGA 3TYTA 2MD5A 3GW2A 4WIIA 1OYYA 2JRTA 2BGCA 3BY6A 4DNCA 2DIUA 4XSZF 5ERIA 2K7LA 2KYXA 4XLPF 3OW2R 1VC5A 1ZRFA 2EFWA 3HUGA 5GVQA 2P8TA 4LG0B 2IVMA 4V19X 1DP7P 1XN7A 3UWTA 2OTLS 3IRRA 5ICEA 2DAOA 1KQ0A 2F5CA 2VC0A 1LEBA 1KQ8A 2LEBA 4TU9A 3U1DA 1U2WA 3LA2A 5LGTA 2GWRA 1T0FA 5FB2A 1ZLKA 2AD9A 1G6NA 2N7CA 4HF0A 2K4JA 5LJ3Y 1U1PA 5L3DA 5HVQC 5HL7Q 4BNCA 1YLFA 1NJIT 2UXXA 1Z9CA 3VAJA 2XAHA 1IN6A 3CCLS 4CYDA 3Q9SA 3CF5Q 1IRGA 1FJ7A 2FBHA 3R60A 1YJ9S 4JQFA 2KHCA 3GXOA 3LA3A 4U67Q 4ESBA 2X1GA 4RB0A 1U1OA 3COAC 1O3QA 1OPIA 4N0BA 2A61A 3LFKA 3ZZZA 2FBKA 1UW4A 4L5JA 1C0WA 2IPQX 3VODA 1SJ3P 3I4PA 3M1EA 3ZMSA 5L3FA 1Z91A 4L0YB 1IRFA 2DW4A 3CUOA 3T0YA 1R23A 2KXFA 2KXHA 1XCBA 2RVCA 1K7AA 4G6QA 3TP2A 2PBIA 2HTJA 2XSFA 1KYZA 2CPJA 3CXCR 2IW5A 1IQTA 2MQLA 3ERED 3FXUA 4P55A 3HHNB 2HGLA 3MUTP 2ESNA 1OO0B 2JTVA 2VE9A 4UQTA 3MQ0A 4KYWA 2X0LA 4HF2A 1OPCA 3IWZA 1U2FA 4LFUA 2STWA 4R8HA 2KXNB 5EEGA 2OSQA 3F72A 2H6BA 3MURP 3CULA 5F64A 2JPCA 3T8RA 2N3OA 3ZMZA 2YH1A 4ZH4F 1WI6A 3HYIA 2RQPA 1G4DA 3FX3A 2MKHA 1Q7YT 2HR3A 3J81K 3LWFA 3WTUC 1S7OA 2MB0B 4HDVA 5CA5A 1FYMA 4CZZA 1D8JA 3DEUA 4S05A 1W4MA 2NNNA 3WG9A 1YWXA 1YYVA 3V7CA 3LAPA 2JSCA 1U6GA 3EGZA 3MZHA 5D6FA 3MFKA 2PEHA 1TLHB 1YG2A 3P49B 3TO7A 2VT3A 5BS6A 6PAXA 5DETA 1FNNA 3L7WA 5CVVA 2D9PA 5D8KB 3QP6A 3GFIA 3KLNA 4PR6A 2XGXA 3V4MA 2HGCA 5FD6A 1J5YA 2DNQA 3L2CA 1GHCA 3J7YU 2O61A 2FNAA 2PQ8A 3WU0A 3E3VA 3REOA 4HAMA 1WHVA 4UV8A 4ERDA 1SJRA 2HTSA 2BEOA 5TJJA 2DQRA 2V79A 2CJKA 4ASNA 2CQ2A 4CICA 5ED4A 3WTYC 3WTVC 4OIPF 2NRAC 3MAJA 1FOKA 2YWKA 3C18A 4EJTA 2H6CA 1V3FA 2FC9A 4FXWA 2K86A 1U5TC 4L9TA 1P4XA 1D5VA 1JXSA 1B6AA 4M71A 4ESFA 4KN7X 1UAWA 4CH0S 4ZYHA 1FZPB 4A12A 2DHSA 1ZZNA 1E17A 3GFLA 5HDNA 1U5TA 3G96A 1H9GA 3E6DA 2VONA 1M1KT 2AYEA 2JPBA 4I01A 3THPA 2MGZA 1G3WA 1T38A 5J8FA 2GXBA 4ON0A 3I54A 1USTA 2JT1A 5HO4A 2ELHA 5HLIA 1YTYA 2OD5A 2X1AA 2RS8A 3BJOA 5IM0B 1HSJA 3S8SA 2G4BA 4Q47A 1Z05A 4HA8A 2LCWA 2NYXA 5KK1A 4RGSA 3G3ZA 4QLCU 1H0MA 2A6HF 2V94A 3CCES 1WHWA 4I0BA 3GO5A 4KIGA 2BOPA 2F5FA 4HZFA 2C6YA 1U1KA 2IA0A 1XD7A 4PZJA 2RS2A 1W7PA 4P6QA 3CCMS 2DNHA 3V8KA 4MQ9F 1U6FA 2ZCWA 4YOEA 4MTEA 4G9YA 1Q86T 1FP1D 4JK1X 2O03A 1SFEA 3F21A 1MJ9A 1QVGR 1FBUA 4LLNA 3U1LA 4HX7A 2MSTA 2QVOA 2ZJ2A 5JVTA 2I2YA 3TO6A 2MKJA 3IWFA 1UB9A 2DFIA 2X1BA 4IXAA 2F9DA 2HDCA 1U1LA 3ZMTA 4M74A 1YJWS 2MLGA 2VBZA 2DNKA 4LJMA 3F23A 2L54A 1VQ6S 1W7PD 4Y13A 5DCMB 1I6XA 3MDFA 3MZYA 3BZ6A 5BPDA 3CJNA 3RKXA 5E17F 2L9WA 5CXTA 1FP2A 4AD9A 2AXLA 1KQ9A 3QU6A 2DQLA 1OYWA 2HS5A 2QWWA 3O2PE 1O3TA
chains in the Genus database with same CATH superfamily
4DBQA 4X4VA 4DOZA 3ZXWA 2A5WA 2MY8A 5L3EA 2OCCH 2X51A 2H1KA 5HS8A 1SVLA 2XYGB 2FJWA 1JUMA 5KTQA 1WEYA 4WK8F 4FCYA 3CC2I 1R36A 2WHOA 3ZQIA 3OXGA 3PEJA 4MNUA 1GDTA 4WU3A 4JI6F 1XGOA 2CWEA 4LMYA 2D45A 4DPUA 1RA6A 2DXEA 2K7KA 3RBDA 3KP2A 5EEHA 2B6AB 2DHGA 4JUZA 1TZ0A 3H7HB 1D0ZA 2FLPA 1DLOA 2VXZA 3WX8A 4ZPAA 4OFZA 2EG2A 3IO1A 4GRSA 2HQRA 1DARA 3BTIA 4GXOA 5K7HA 1LVAA 3M8FA 2VJUA 1QSSA 3IRXB 4NLPA 1XDUA 4V2FA 1JJHA 5KFEA 2V1DA 2HOEA 4M3FA 1G3YA 2MH9A 5IV3A 5F27A 2WB1D 3QZ7A 3O3KA 3TBIA 2DO4A 1Z67A 5KFJA 2Q8KA 3W9IA 3BR6A 4QIGA 4H4MB 2TDXA 5F08A 3KK3B 2HKXA 3IMQJ 2BM1A 4UUSB 3JRGA 1RHKB 3VAGA 3BCAA 2OCEA 4JYAF 1VQOS 1MSWD 2V63A 3MWMA 1A9NB 5KT6A 3GLLA 3QFHA 4D5FA 2Y9ZA 2QLWA 2AKWB 2DNNA 3TAQA 4M94A 4BHBA 5GAGI 4IH5A 2MQQA 3DRRA 1E6VB 1FVQA 4KPYA 3KCCA 4IKFA 2ZB9A 1U47A 4ZYEA 1M5VC 4M3GA 3DKWA 5JFRA 5KG0A 1N48A 3CLQA 5J3LA 2OEMA 4DV1J 3IGNA 1VQ4S 4Z7YA 2MG4A 2JLEA 3JS9A 4DQRA 1NH7A 4OZ0A 4LMZA 4HI1A 2NS7A 4EO6A 1PUEE 2HZVA 3W62A 3OYMA 5F8HA 1ZAWA 2JC1A 1D8KA 3BS9A 3LH2S 1VQPS 2M3DA 2VV5A 3RDIA 4QYZJ 3LWLA 3SDGA 4K0KF 3BKFA 2P5KA 1TWHJ 3Q2TC 5BJRA 2HU9A 1YRXA 1B3TA 1Q8BA 4LRDA 3K89A 1K47A 4RAYA 4JI4F 2UZKA 2YKNB 5D4RA 3TKYA 1EJ7L 2Q66A 2J9DE 3H0PA 3CCYA 3C2BA 2CQ1A 4A3GJ 3BN7A 4TQSA 3DGVA 3G8TA 2IBDA 2B9WA 5J6XA 2CH0A 5E3AA 1C0UB 4K7QA 4QPOA 1YJTA 3W61A 1PBUA 4ZMMA 2GCFA 2V9VA 3OSNA 4OI6A 3X2QH 4CCKA 4YIFA 2XGPA 5EEAA 1RAIB 5FLXK 2UXBF 2DPJA 1BQMB 3H4DA 1I27A 4ZYGA 2CPEA 1XR6A 2H8WA 4WU2A 1XNQJ 4TQRA 4A4JA 1PYTA 3DDNA 4ETXA 2ZHOA 1R6YA 1LKXA 5HROB 3C14A 2JA5J 4I56A 2J7WA 4HDHA 3DKXA 5E8IA 3KLFB 1AU7A 2DNZA 2ZD1A 1Q8LA 1MNEA 3B73A 4YFKF 1LWEA 2L0KA 2DPUA 2X6WA 2ABYA 5L9NA 1HLWA 3CLOA 2IGOA 2JRMA 3HL2A 4YUDA 3CP8A 3TX0A 1ODDA 1HNZJ 1Z3XA 2MZQA 2QMWA 2V1XA 2KJCA 2LDUA 1R1UA 3H4BA 4IOCF 4DR6J 3SSRA 3MR5A 1TELA 5I4MA 4RNNA 3J7AN 2WTEA 5CQEA 5GAGJ 1ZA2B 1NK9A 2ZJPF 2XMAA 3LSPA 1HQUB 1Y5IB 3O6BB 1Y5LB 1B72B 2LF7A 4B02A 1VQMI 2P9GA 4E4HA 2NVQJ 3VGUA 3BZQA 3M8QA 3W63A 2HQDA 2M3AA 2LMIA 1K0TA 2PMWA 1L3SA 1DU6A 3H5UA 2CFOA 1YJRA 1XC5A 5E1WA 2C28A 3IRWP 1UWBA 2MPUA 3D28A 1NDCA 4AUXA 2CA9A 2JLFA 1YX5A 1UMQA 2YQ3A 2RGVA 5HLHA 2AV5A 3U02A 1XMKA 3F9KA 2RKIB 5L3BA 4NLUA 4YY3J 1U5TB 3DPUA 1OSDA 3I64A 2IA6A 5BXIA 3RBEA 2J5OA 2JVHA 4EMDA 1RIOH 3HD2A 5MAOA 2QJ3A 2Q0OA 2YS9A 3FCWA 3FBCA 4Q8FA 4NB5A 1XDSA 5B0EA 1VQOI 2V6CA 1B4SA 1VQKS 1NLKL 2WSFC 1S77D 4C2TA 4MMOA 3NKYA 3LP2B 3AAFA 2CPFA 2QA4G 2GIVA 1IBKF 4JX5A 1UFMA 1U78A 1CQNA 1QVUA 2A6EF 4AVPA 3CF2A 3K1NA 4C48A 3MUMP 3CUNA 1SJ4P 3D1QA 4F02A 5CVJA 2WB4A 2NXNA 3PHEA 4C9DA 2XDVA 4BXXJ 3UR3C 2VBYA 1RYRA 3SQGA 4XLFA 3H92A 3RI4A 1VQPI 2E5JA 2Y48A 3AL0B 3IAS2 4I98B 5D4OA 4HDUA 1SJFA 1YBAA 2FJEB 1FJCA 4UOHA 4O0IA 3FQLA 4JP8A 1FTZA 4CLWA 4JBAA 3HPOA 2BXYA 5FRNA 4O6JA 1I50J 1FDNA 3D68A 3HSJA 4IEJA 2K9SA 1BW6A 2QLBB 4I67A 2GBYA 2CQXA 2KT5A 1U1RA 4ZLNA 2HQFA 1L3KA 4J9PA 3E5UA 2KU7A 3IBCB 3W65A 2GZOA 3A3OB 4RNHA 4DL2A 2BY0A 3H5NA 2HQ3A 1AKHA 5K8PA 3N5FA 2ICWG 3BPXA 2QSHX 2DGVA 4QW9A 3ITHB 4EBDA 2L7ZA 3G1LA 1OYIA 2BZ2A 5GAHU 1UA1A 4Y3OA 3BTCA 4LRCA 2DMPA 2RREA 3K1MA 5JHUA 4X4QA 3DBLB 2CQ3A 3PNYA 3KEYA 5EJCA 2L9RA 5K5MA 2BY3A 2L3MA 3GIIA 3B54A 4MIAA 2IDEA 5F8JA 2HFVA 3UR0A 2QFIA 3E0JB 1J5EF 4BUPA 4PZVA 2BHYA 5GAEI 1WG1A 2KYZA 4P72A 1UZCA 4IG3A 4C8OA 3SXYA 3CJQA 4DQ2A 2DGOA 4IR1A 4DJBA 2HVIA 1YFHA 4I7FB 2XO6A 1YX3A 2LECA 3BSAA 3MFIA 5C42B 3DRXA 1UA0A 2YSRA 4X62J 4RUCA 3TW0A 3SQOP 2YWWA 5KT3A 4XBFA 4C0HA 5CJ9A 4ZP9A 2V2VA 1ETWA 2VQLA 1KVIA 2VODA 1BUXA 3HHLD 4FVMA 3DKDA 2G2OA 2HG4A 4DIQA 4QWDA 3M32B 5DCFA 3A3PB 1ZGWA 1D09B 5ETVA 1KQSR 3OUYA 2IJRA 3A01B 3IBWA 4PUOA 1VS3A 3SIPB 4W90B 1MD0A 4ED5A 3AL0C 1TKXA 2VPLA 3TI0A 4MFDA 2FSWA 3K0JA 1RABB 2M9KA 4C8YA 3A1YG 4HKQA 2EK5A 1F5BA 1KWMA 5CCLA 4WF9Q 3BGOP 5HQ8A 3HRMA 4GFBA 4JI1F 1IAWA 2F3JA 5D5UB 1DUXC 3ETMA 5H20A 2J9EA 3SFUA 4X4PA 3BKUA 4BE0A 2KB2A 4NLGA 1D1AA 4KMFA 2C22A 2A5YB 5IOZA 3A2KA 1OQ3A 5A8RA 4ELVA 3PXGa 4KIAA 2H8RA 5HLTA 1ETKA 1RA7A 1UWAA 2YNFA 1LW0B 4BHQA 2AJFE 3GR1A 3HOWJ 4LBPA 5HDKA 3LNQA 3PG9A 2OLWA 4Q43A 1SQFA 1WTBA 1SC1B 2R5ZA 1V3RA 3K4JA 3MTJA 4ECTA 2UXCJ 2OJED 1F3VA 1QDUB 4CTAB 4NRUA 1OYEA 1T56A 2IT0A 2RUGA 2ISZA 3VAMA 2CRLA 3P7NA 2E5LJ 3NBPB 4XDCA 1G4CA 4P2MA 2RH3A 5M5YJ 3V7RA 3W7BA 2DU9A 1FA0A 4LF9J 3GZNB 1X1PA 2LMDA 3CWJA 2MXYA 5THWA 3LALA 2NVTJ 3S14J 2J5PA 2LEAA 4ZZDA 4RW8B 1V3SA 5HSPA 4PJJA 1RT6A 1OR7A 4AU7A 1T9WA 3J81j 4JX4A 5IQQA 1AWCA 2EPIA 1BM9A 3ITHA 5B0AA 3MCZA 3BR8A 4UF4A 1BD6A 1MW7A 4F36A 2V2ZA 2QBYA 2MH2A 5GAEJ 3MEEB 4WPAA 4YN3B 3IL2A 5LD2C 4BE1A 1UVKA 3LSRA 2LQ8A 3LAKA 4PWDB 4K4YA 4LQ9A 4TVAB 1T9TA 3JQMA 1P1TA 1IF1A 5B09A 1SD5A 2Q2EB 3ZQFA 3P96A 2LP0A 3I59A 2DHAA 5H6RA 2UU9J 4ECUA 3H5XA 1FBQA 3J7AY 3MGJA 1VQ8S 2KFNA 1DHMA 5K5RA 1PGZA 4KNYA 3H36A 4HNUA 3MVPA 1HNXF 3SXLA 1X1AA 2HFHA 3VF0B 1X4OA 2L9DA 1ETQA 3C15B 4RAZA 4TY8A 1Y1WJ 4Q44A 2DA6A 1EH7A 3AA9A 1NKCA 4LLLA 2DVIA 4TLRA 2MSSA 1QHGA 2OAZA 2E60A 3GTJJ 1O3RA 2LKZA 1KHVA 3CJTB 3CCQI 4CP5A 3HD1A 5HQMA 1KR4A 1JT6A 3KJVB 2VPRA 2DNMA 2XYHB 4WP8A 2J7KA 3DLEA 1T8EA 4NYPA 2PIIA 2KISA 2XV4S 4YR3A 2RRBA 1A7GE 3SCJE 2BQ3A 3O8GA 3QWUA 4XOPA 4PYAA 1S3JA 1OYDA 3BSCA 2E2JJ 1XSXA 1TKTB 3LMMA 4K4XA 7FDRA 1Y56A 3D5LA 1D9FA 5HP1A 3EYIA 1FRJA 3BZKA 1YJVA 2BBEA 1RHUB 2EBIA 3KP3A 1U0SA 1D1BA 2BRKA 2E1CA 4CM0A 4N5SA 2JMWA 3PIOF 5AIQA 3JTPA 4DZDA 4GC7A 1T33A 4K4WA 1BW5A 2CNNB 2KG1A 3DOKB 4XLAA 1S4FA 1LW0A 1RT1B 5K14A 3IWNC 4A3MJ 5CQGA 3QPTA 3Q89A 4W97A 5C4XJ 1SC6A 4K2EA 3TW6A 3BCBA 3F0CA 1RAFB 2Y8WA 3GZ6A 3FCHA 2IA1A 4HACB 4FX4A 3IAM9 1MSEC 1IUFA 4J9NA 3L2WA 2LNBA 2DR5A 5AXKA 2XMVA 2QLJB 4YHHF 5D6GA 4ELTA 1QLNA 1Q78A 3GILA 4J9KA 3IR6B 3J80K 5DM6Q 7FD1A 1R8CA 4PGHA 4J9MA 1O5JA 3CW2C 5EX3A 3H90A 3BB5A 4DR3J 1XNRJ 3E6CC 1EH6A 2LYVA 4ECWA 1HNVA 4X1EA 3TR5A 1N56A 4XO0A 2MQMA 4O3OA 2H5EA 4LB6B 1SL1A 3MM8B 5KFUA 4PKDB 4RU2A 2MYFA 3GJSB 3R7SB 4KJIA 3DRPB 4JX6A 2C2EA 2J0SD 3UO0A 3PW0A 3QPSA 4M6YA 1QD1A 2Y0MA 1YIOA 1VQ7S 3E51A 5FJ8J 2HVDA 2BVMA 3IC7A 4PWUA 4A8QA 3TAMB 4IOCQ 3BC8A 1X4HA 5B0GA 2HNZA 1CG2A 1VQLI 3C15A 4PQAA 4E7KA 2RUSA 1K1SA 1RDRA 1FDAA 2NREA 2YBVA 3UN3A 1EIYB 2YKMA 1U2CA 2IM0A 4GVBA 2CZVC 2M5YA 2BJ9A 3ABLH 4DCOB 2G7UA 4YMEA 5EGOA 3H2LA 1TFYA 1MLAA 2EA4A 4NCBA 2RD5C 5K9FA 1FJEB 4X4UA 4LK1F 4LG3A 4ANEA 9ANTA 4P9SA 1RWMB 5DO2A 4CM2A 5ICGA 1U0JA 2QRRA 3DCAA 3PSIA 3IP4B 2DNPA 3KTQA 4A46A 2N8GA 4KSEB 5HAOA 1R8PA 1R4MB 4WZQA 2JHEA 3BPSP 2CQGA 2XQCA 4JI0F 5HMYA 1W26A 4U9RA 4HF1A 3RW6A 2GLOA 2LSOA 5DGAA 1Z4UA 2COLA 3C2PA 1XEZA 2IIHA 2VG6B 2UV1A 4IOBA 3S3NA 3KZYA 1VQNS 3J7AO 3LQVA 2XAJA 3JSMB 2BW3A 3ELHA 1AA1B 1R8AA 3THTA 2W00A 3W2AA 1K1QA 4NQWB 2P2CB 4M5IA 2KRRA 2LQJA 1BC7C 2CV1A 3DRSB 2QL9B 2YVSA 1TL3B 1S7AA 4DS4A 1BN5A 3NAIA 2ZHBA 3JQJA 2AYGA 4LJZF 2YH0A 1VHFA 3HHGA 1HW5A 2R7OA 4K2JA 5J1YA 3CDEA 3EZOA 5HMZA 1MROB 3HJEA 3DOLB 2YPYA 3NS6A 3PZPA 3DOMA 4EJOA 1P2FA 2ZWOA 4QYRA 5GADU 5TISC 2MDAA 2PMZA 4LLGF 4Z2XA 2E5IA 1ZR4A 1Y7PA 2E2IJ 1SCJB 2QQ8A 3C1DA 1WDTA 3B82A 1Q4RA 1WJFA 3C8YA 1IN4A 3OR1C 2F9JA 3MCOA 4IO9Q 5KHDA 1FKPB 5E5NA 2LXIA 1AOYA 2PSZA 4G7ZF 1YRNB 2VB6A 1YO5C 2OPTA 2EFGA 1QU3A 2IRUA 1MH4A 1QPMA 2GA1A 4MFBB 5LHIA 3K2ZA 5L3GA 1T6SA 4DX7A 2QGUA 3OR1A 1EKEA 3ISND 1NK6A 2JH3A 3HM9A 4OYMA 4O3NA 4DR7J 1RK8A 2BE2B 3L2QA 2KVIA 2JZ5A 1FHTA 5TGTA 1RISA 4OOIA 1REPC 4NLTA 4PQUB 1IKVB 4M9ZA 1ZLJA 2C3MA 4B9SA 3GTOJ 4I2QA 2HRYA 2XF5A 1P7JA 3V8LA 4K50A 5IV4A 4LG0A 2EBEA 3BM7A 2BW7A 2MW8A 2IM2A 3CO9A 4NXNJ 4IJAA 1W36C 2VPZB 3M9MB 3IKTA 2R2SA 1DTQA 4ZPDA 1GMWA 4RW9B 2E5HA 3LPYA 3CC4I 3KJFB 4NCAA 2HZAA 4NI2B 4BXUA 3AD8C 2JSXA 1JK9B 1RZ4A 3ZMDA 3CIZA 4DV1F 4H0EA 1CJTA 3M1VB 2UXNA 1JKQC 2MQOA 2M52A 5LSLA 3JSMA 4QQBA 4Q5SF 3PSFA 1E6YA 1HR0J 2B4PA 4UUXA 3LGHA 3IR5B 4P1WA 2JUGA 2HQCA 2KRCA 1QZYA 2XHWA 2RNJA 2XGCA 4A3BJ 2M8HA 2OEJA 3HGGA 3WODF 3JSYA 4R8UA 1MBHA 5DD4A 1JLCA 3I9ZA 4BJ5C 3TOAA 1VJQA 3J80Z 4URQU 1JT0A 1MJBA 2NOGA 2WV1A 2EFPA 5KFXA 3Q2SC 3LAJA 1RWXB 3EGWB 4GCVA 2Y3YA 1K6YA 1YE9A 1HBUB 1HNWJ 4ZVRB 2BVZA 3OJSA 2U1AA 4QWAA 4TLQA 3OYNA 4IRIA 3FK7A 1RC9A 2DT5A 4LVNP 3ULQB 5EG0A 1VQYA 1IXCA 3FXOA 3TL4X 2ZWPA 4A6EA 1VQNI 4M5MA 3FSIA 2ROGA 3QGPA 3AG4H 3OYGA 3F6VA 4LF1A 2Q1ZB 3SZPA 1TUGB 4MT1A 2CWXA 4CO1A 5ETRA 2XF6A 4Y0FA 4JOUA 2BQRA 3D9BA 5CYMA 4JI8F 1VF9A 2ILYA 5MLCV 2ID6A 2XM3A 1K61A 1XNQF 2CJJA 1R5ID 4AL6A 3SSQA 3GFMA 2Z1DA 3CCZA 5BR8J 3ZPLA 3QWPA 4RNOA 4RGXA 1PC4A 1FLIA 2VOPA 4C4WA 3V4GA 3I9V2 4UOGA 1J27A 3FHZA 4HLBA 1XGMA 1LKZA 2LYCA 3EUAA 3KDNA 4F4WA 2VQHA 2YPRA 3UVJA 4XLEA 1HHSA 5J2QB 1KU2A 2W4DA 3A0BC 5JR3A 2B8PA 3G82B 2PLYA 1HNZF 1WKLA 3QGHA 1SIZA 4DR6F 2IBOA 4WTYA 4DU7A 3NMRA 1X5OA 5CVUA 4FNHA 5J1NA 1S79A 2KRHA 3HOXJ 4B3XA 1ZGAA 3KYCB 1SIWB 4J90A 3JTGA 4ZPTR 1HBMA 2EIJH 4I2PA 1DRZA 1GNKA 3QPHA 2A18A 4PG5A 3G6YA 4I0AA 5DS7A 3V4IB 1AYEA 1HI1A 2BJ3A 4P7VA 1NRKA 5JLXA 2CJAA 2BE5F 2VKDA 5LM7E 1Q7LB 3HRTA 2D3OR 2K3PA 4P73A 4CCNA 1RTDB 2GO8A 3LANA 2PN6A 2JL9A 4WFZA 1KLNA 4KICA 2IRFG 1V5IB 1BQNB 1WUUA 2EB7A 5DDGA 3I0RB 3M7GA 5LXRA 1QAYA 5A0YB 4ZP7A 2HPIA 2UV8G 4O3PA 1HBXG 4ENOA 3P5BP 2POKA 1KYWA 2FMLA 4AIKA 2CUFA 4YQWA 2FEZA 4DPYA 4HX4A 1PSDA 2ZFUA 4M9SA 1GLNA 4BKXA 2ZZTA 4C3KA 2RQCA 4DF4A 3D6TB 1C1CB 3ZN0A 4OJ1A 2KM8B 2V50A 1SB6A 4LF6J 3GJRB 1Z7LA 5T14A 5I3UB 1HW2A 5HLFB 1QTMA 1IM4A 3MD3A 2XB2D 1IV6A 2GMLA 2WONB 3LSTA 3NEUA 5IM0A 5GP9A 4B17A 1HF0A 1Z6TA 3G8SA 2ILZA 4I69A 2TCTA 4G6TB 3EZ5A 4UUTA 3DGPA 1K9MT 2CPXA 4LD5A 2XMUA 3PV8A 5LT5A 4Y7NJ 1AA7A 3V81B 3VVUA 2NLWA 1T2KA 4K4ZA 1P27B 3DXJF 2BJDA 3J7ZT 3SDEB 3ZQCA 3I87A 5FDLB 3RZAA 3S32A 3G6VA 4WE1A 2Q3PA 3RPQA 5C24A 3MM5A 4M95A 3RIRA 2NOJB 3HP6A 3N4MA 4U7DA 1PILA 2KDOA 3AKZA 1MSFC 4K59A 5E3MA 4XPEA 4KITB 3CCRS 4WXOA 2FQ4A 2HLUA 4Y4RA 2IYIA 4KO0B 5KFBA 3ILIA 3MMJA 3NWGA 1QE1B 2V8DA 1V5GA 3QODA 2KH9A 2J0QD 2JNJA 4F7VA 1DAXA 2M2BA 2D7SA 3LA0A 5E79C 1REVB 5CYQA 5FFXA 1JX4A 1WI9A 2OPRA 3PNIA 4A8XA 3V5RA 1L0OC 2UV8A 4IH6A 4RW7B 1DQ9A 5C2GA 2HHTA 4HH1A 4Y00A 4OZJA 5KAFC 3NGDA 2ZBQA 2DCUB 3GTLJ 3CCMI 3NL0A 3W5YA 1P8GA 1RTHB 1S6QB 2GA7A 2DPDA 3I4NJ 1F9FA 2DH9A 2VT2A 3MM9B 1TWFJ 4FN5A 2D9OA 2EZLA 3PFIA 1JLBA 1WKJA 3AJ1A 3RB0A 5H1SV 2F2EA 4R5PB 3QJJA 3LSKA 5K5OA 4IFYA 3OVBA 5F04A 1KONA 4E7SA 4CHUA 1SVDA 4DPWA 2YXLA 2KM8C 4KY3A 2XO7A 1RHQB 4ABZA 2H5IB 3IC1A 4LSLB 5RUBA 2HBYB 1F9EB 2ZBRA 1KHWA 2CXEA 5F3ZA 1SKRA 4EJUA 2D2WA 1CC8A 4XICA 2V6EA 4CYUA 2MLKA 3Q22A 1TBXA 4XRMA 1HL6A 3TZWA 2ALYB 1R1TA 3BR0A 2CFXA 4X62F 5F0CA 4DYCA 4E70A 2MD5A 3GW2A 3QYFA 3M2VB 4NX9A 8AT1B 2AX0A 4DNCA 3UI3A 4XSZF 3CIMA 3OW2R 1FKOB 2UUZA 2P8TA 2IVMA 2PMZN 1XN7A 2NCKL 4ZC3A 2OTLS 3WHIA 1X7VA 3IRRA 2DAOA 2IM3A 3JQKA 4LSNB 5D0HA 4ZVEA 4NC8A 4ZHRA 2IVFB 3QRRA 3OLBA 2K4JA 3O8WA 4RWXA 3RB6A 2DT7B 2X1CA 4WFXA 5KG1A 4PFOA 3QJLA 3BSNA 4BNCA 1NJIT 1Z9CA 4NASA 3HSGA 4BS9A 3CCLS 4CYDA 3MPVA 2A05A 1N5YA 2ACYA 2FBHA 1YJ9S 2LU1A 4ITSA 2HK2A 4IYQA 2P9EA 4E6KG 2XI3A 1UELB 1OPIA 3G1OA 2A61A 3H40A 3RAQA 3ZZZA 4ZVHA 1T9VA 2IPQX 2V67A 3M1EA 3KWMA 4DZPA 4MK7A 2BR0A 1REGX 1Z91A 4L0YB 1IRFA 2DW4A 3M05A 3I4HX 1XCBA 4C2MA 4LF9F 4G6QA 2HTJA 4PXCA 2IS2A 1W0TA 2CNLB 2ZH3A 2IW5A 4B4CA 3F44A 3R5DA 1IQTA 1G8XA 4HEA2 1T95A 4CYCB 3MCNA 1BWVA 1ZAXA 1NZAA 3P4UB 4BBRJ 1H88C 2BW2A 3CCJI 3TA2A 2STWA 4R8HA 3U27A 2OSQA 3MM9A 5DG8A 1KFSA 3VCDA 2H6BA 2VU5A 3CCRI 2YH1A 8ATCB 1U9OA 2MKHA 3IG1A 2L7FP 3BF4A 1NKEA 2UU9F 1ITPA 1OCTC 3K4LA 2MB0B 1FYMA 3GV7B 3V7CA 5EYRA 3ERMA 3LAPA 5HK4A 1N0VC 3E2EA 4U8YA 1GX6A 1U6GA 4KKOA 5L1IA 1Y3JA 4X4SA 4OJHA 4DHVA 1YG2A 5KFHA 4QSHA 3PO4A 3TO7A 2JJ7A 2VT3A 3OYLA 4X64J 2B4UA 3LP1A 5DGBA 3GFIA 2DXFA 4RAGA 4QYZK 3DLBA 1GHCA 3LSJA 2O61A 2FNAA 2PQ8A 3H0GJ 4ZYAA 3VDXA 2AEMA 3D7SB 2HNHA 4QWBA 1CPZA 4FDFA 4L72B 1NJZA 2VG5A 1RHRB 2BEOA 4C3JJ 2DR8A 3H5RA 5CD4A 4CICA 5ED4A 3D3CJ 1N33J 3MAJA 2B9EA 2QSWA 3VYRB 2QL5B 3C18A 4EJTA 1A0OB 1HBOA 1TMMA 2K86A 1NPKA 4A8MP 1IDYA 4F04B 2HDDA 3LP0A 4L9TA 3HHLA 2LG4A 2BANA 3D3BJ 4V2GA 2HIQA 2CJBA 1U02A 2UVUA 5KT4A 3G4SI 2K1RB 2RAQA 1LEOA 4II3A 2DHSA 1ZZNA 3JRBA 1I6HJ 2V7FA 3CE8A 2ZXHA 3T41A 5KFSA 3CJ0A 5DJBA 4NLQA 2E71A 3LGNA 4I01A 1H98A 3J81U 3MEDA 2JEGA 4MTPA 2MSYA 4ETZA 4ZN1A 5E3CA 1USTA 1VRTA 2JT1A 1IKXA 4G1QB 4RDUA 1UVNA 1UVIA 2X1AA 4F4XA 3SV3A 2RS8A 1L3VA 3BJOA 2QG9B 1TL7B 2GS8A 2ZVSA 1Q5VA 2G4BA 2BY1A 4JV2A 1Z05A 1TTHB 1GXTA 2LCWA 1RACB 3U7JA 4DSKA 3HSDA 3EPGA 4DR3F 3T19A 3RJMB 3NRBA 3I6PA 3IAM2 1YJ9I 5J2MB 1EP4A 2V94A 3CCES 3EYZA 4MAKA 1WHWA 2HHVA 1JUPA 2WB1N 4KIGA 1RLDA 2QA4I 4B3SJ 5ETNA 5B66C 4F4KA 3D66A 4PXEA 2D69A 2IA0A 3IV5A 2RDDA 1HYSA 1SFOJ 1N75A 3CD6I 3RB3A 6FDRA 4DUYJ 2O7OA 4LBHA 4A8KA 4NLOA 4YOEA 3DU6A 4G3IA 1J5OB 2IS6A 1NTCA 3FCVA 2DA4A 4BQOA 3D1NI 2O03A 3RPUD 3F21A 1IBMJ 4CH7A 4LLNA 4F2RA 3J80Y 1S0MA 1QSLA 4B9VA 5IXUA 1UB9A 3NWRA 2CW7A 1WC6A 2X1BA 4Y33A 2F9DA 4AXJA 1JKHA 4N8NA 4H4OB 1MBEA 3JSRA 2L54A 2OFHX 3GCWP 1HARA 4ICLA 1WJ5A 3CMAI 5BPDA 3HOYJ 3C2GA 2OUGA 2L9WA 1R31A 1LW2B 3KXDA 2R92J 1H0HB 1TR0A 4B43A 1UJ5A 3H5SA 3MOZA 4ITVA 1OYWA 1JLAA 3HZEA 1S1VA 3S15J 3O2PE 1O3TA 1MMLA 4A69C 1ZM3A 1FD8A 3K69A 3IA0A 4ZITA 1NSPA 2FOWA 5K20B 2OA4A 3QQCD 1YW9A 5H9EJ 2QLZA 3VSLA 3S17J 4MFEA 3NY0A 3QAHA 2MYSA 3BGRB 4RU9A 1MZBA 5JUMA 4DUTA 1KZHA 3OS0A 4ZDNA 1PUFA 3PYDA 1HA8A 2RN7A 3LTOA 5ADZA 2OV7A 3FMRA 1C0TB 3OYEA 4JI3J 3OOPA 3HVTB 1HW1A 2E9TA 3KLEA 1IBLJ 3PJWA 4WK1A 4Y17A 2PEBA 1U2RA 3BBCA 1SH3A 5F8GA 3ZN1A 2HOTA 2AQ4A 5B1AH 2XNRA 2ZNYA 1UFLA 1Y3KA 4C30A 3TRGA 3TOBA 1OFCX 1N36J 3E6BA 3CJRA 1PC5A 4MKBA 5L1JA 5JI6A 4RWWA 2PFDA 1T94A 3W3SA 1T05B 4B09A 2VPXB 1I3QJ 2WY8Q 3P9CA 3TDZC 2ALZA 1KQKA 3R6GB 4RW6B 3G71S 3GTYX 5ICFA 4A0XA 1SXLA 2WV0A 4M5DB 1J0RA 4D3HA 2IP2A 4WFBQ 1WD6A 5JJBA 3M2RB 2LFBA 4W98A 3T1YJ 3CJ4A 3TOQA 3PM9A 3TX8A 3HJFA 3W9HA 3AXKA 2V4JB 1NHAA 4NA3A 2ZDOA 3M6XA 5KFYA 3HZGA 1KOOA 1RADB 2M30A 5ETPA 2DCLA 3D2WA 1DPRA 4D0PA 2F7VA 2V0NA 3EGNA 3R5CA 3JB9k 4JV1A 1E2XA 3PW7A 4ZVOB 2CQDA 2AS5F 2F63A 3LAMA 2K40A 3BP8A 4MIMA 3KUEA 2BJ1A 1SH2A 3ASOH 5B08A 2XC7A 2ZE2A 4HTIA 1VI0A 4DR7F 2F4IA 1U8RA 1YW8A 1BL0A 1J59A 4ECRA 5J4VA 5LSRA 1UG0A 4X2BA 3TUIC 2IA2A 2CWKA 2UVRA 4WXDA 2W7PA 3BTLA 1W7WA 5AXNA 5D4PA 5EHHA 4HQMA 1JUSA 5FO5A 3CDUA 3CJKA 1AHDP 1P7IA 4DN9A 1P9YA 4M6VA 3HOTA 3GG1A 4LFCF 1MN7A 1DTTB 3FMBA 2M0MA 2Z2SB 3I5BA 3ECHA 1SMYF 5IOYA 4XN3A 2Z33A 3OSPA 3N0VA 2L48A 3KEOA 2MLXA 1S72S 2VJ5A 2EEYA 2NVYJ 1T08B 5B0DA 1JJ8C 2CAJA 3GTQJ 2Y0BB 4PEOA 4ETSA 4L3NA 2RDJA 4DEZA 1HR0F 3H35A 3QIPB 4F91B 4K2XA 1NHUA 4WIQA 4X65J 4XRSG 3DLGB 3HT0A 4ID8A 2YNIA 3NGUA 1ROFA 2LKSA 2LK2A 2A10A 3VAKA 1H6KX 4UUVA 3HOUJ 4BWMA 2XPWA 5J2NB 1XMOJ 1ORKA 3CSKA 3FZBA 4FYYB 1T05A 1T0FC 3JSBA 1HNWF 4DQIA 2JUCA 3GF2A 3HTUA 1MMNA 2I8DA 2ZKZA 2AQEA 3DBRB 2EFVA 2L02A 1I1SA 2LBFA 2ATCB 2CPZA 2KL8A 1J9IA 3MI7X 1WQ2A 1PBAA 2C3OA 4OYXA 1N32J 2E5NA 3Q9VA 3K5NA 3BOQA 3FDYA 3K8VA 5DM7Q 3PJXA 3KE2A 3KOAA 3MMAA 4BY1J 1IUJA 4R1HA 2E9RX 3WIVA 3OV8A 1Y1VJ 1SBRA 1BR1A 3R0JA 4EM2A 2KZMA 3FXRA 2QYOA 4XAKA 5BR8F 2Y1JA 3CD7A 4I09A 3SEZA 1HQEA 4CO3A 3PY8A 3AA8A 1S5LC 2IM1A 1VLOA 2H1LA 1DQ8A 3MECA 2L7MP 1HWUA 3O2IA 1FOXA 2K9LA 1RUSA 3HXLA 1UJ4A 2EK1A 1CULB 2R7SA 4F0KA 4U0WA 5A2QU 4BH9A 4ILLA 5DEQA 4JBCA 1E3PA 1RU1A 3JXOA 5HBMA 4AT1B 5EDWA 3D6HB 3DLLF 4QWEA 2ZUAA 4WCEQ 2GGPA 1N5QA 1WRJA 2XZDB 4IHXA 1RSCA 4M5HA 1MGTA 4F2SA 3IS9B 5ETKA 2IJFA 1AZSA 2FHJD 2BA9A 3JTOA 4MGRA 3NOCA 4RMNA 3X1LB 1X19A 2HOAA 4XRSA 3EZUA 1P4WA 3TP3A 1FRLA 3R7BB 1Z21A 2W9BA 3OS2A 1GXUA 3J7Z5 1FRIA 1W7PB 3H3UA 2EIKH 3WTXC 2O8XA 5AIPA 1S7IA 4Q48A 1WWXA 2MZTA 3IKVA 4LF8J 3W2WB 3OV7A 1Z2LA 2ZC4A 2B63J 4KUMA 3OL9A 4KMUX 2FVSA 1JLEA 3M8SA 4P7TA 3RKWA 1SV5B 3KPHA 1ZYRF 1FY7A 2KN4A 2DYRH 2Z56B 4FYWB 1XB4A 1O57A 1BI0A 1OSCA 1RLCL 4ZCLA 1K44A 1LWCA 2WVEA 4X4TA 3N97A 3F8MA 3MFHA 3FXJA 4OMZA 1QGPA 3C16B 2KHDA 3PQJA 4IF4A 1TU0B 5FGMA 2O66A 3H3VK 1ZAOA 3BGFA 5JVGF 4NC6A 4LF6F 3MM7A 3OTDA 3GCXP 3PJRA 3GYXB 1FCAA 1R8HA 2XUBA 1BBYA 2E19A 2YX4A 2GVZB 1KS2A 4QR1A 3HO1A 3GIRA 4M3DA 3WU2C 3NS5A 3C3LA 1OY8A 2CW0F 2RU3A 2HEOA 2XBPA 4X4NA 1MMGA 3F22A 2DGWA 4WK3A 1N52B 4HPQA 4K4TA 3HSEA 1F4KA 1RUNA 3FFIA 4NPOA 4A6DA 4P9UA 1TV6A 1GEHA 2AT1B 3H9JA 1HBNB 3PYGA 3DHWC 1ZM2A 2VFRA 2W2PP 1VRQC 1MMSA 5KFOA 2CJYB 2KIFA 3RTRA 2DGUA 3KLGA 3MMCB 3N6MA 3QYBA 5IP6A 3W60A 1SQEA 2CQHA 2RHSB 3QYYA 5D0GA 1GTEA 2HNYA 1TAQA 5ILSA 2HQNA 4U7CA 1CS4B 3S6EA 5F0HA 2IYGA 1G3TA 3KYLA 4EVIA 1QA6A 3QYEA 2BDPA 2F4VJ 2YNGA 2HPMA 2DTRA 4GKJJ 2LA6A 3G1MA 1VBZA 2VLAA 5KOWA 3AFGA 2WVCA 4L75A 2PJPA 4PPDA 4U0YA 3GP9A 2M45A 1FK9A 2LFVA 3UFCX 2ZH9A 5KG2A 4AE5A 1KD1T 4E7HA 2JOQA 2EIMH 1S48A 3GE9A 5GMKa 1APLC 3FXQA 4OYIA 3JW4A 5GAHI 3FSXA 1Q8IA 3EXYA 4XORA 2DNLA 1NSAA 1RT5A 2J6TA 5DLFA 4HQEA 3OSFA 4MO7A 4HTJA 2MZ1A 2EILH 2MLYA 1LDKB 3QBCA 3M8ZA 2DNYA 1O7FA 4HLYA 3GB0A 5CHCB 3IH3A 1WWHA 2LQ9A 2Y1RI 4A93J 4L73A 4OX9J 4EGZA 3CCUS 4LUBA 5J1EB 1U9NA 3I32A 1YI2S 4F55A 4ZIWA 3PW5A 2K3KA 3N4WA 1HCRA 4M63A 1TW2A 4EEYA 2E1NA 1X4PA 1WHYA 3UD3P 2WBRA 1RAOA 3SBMA 3PX4A 1S76D 4L5IA 3L09A 4NOHA 4NEYA 3K4CA 5IP7J 5L39A 2JC0A 1BIAA 2HPUA 1WCMJ 3EM1A 4L3KA 2W1BA 2QF7A 3ET6A 2DGQA 3CMQA 4PXBA 5B1BH 2FUG9 3DPLC 1R43A 3F56A 3UDLA 4OI4A 1MBGA 3LO3A 3UDEA 3GTMJ 4TYBA 1RBOB 2HQGA 1AUSL 4IDKA 3VGSA 1RT2A 1LNWA 2AGOA 4AFFA 3BDDA 3L7UA 4RS8A 6AT1B 2E5GA 4ZCIA 1S6PB 2M8DB 3JSOA 2MJNA 3MUVP 5FRMA 2HZTA 1VFCA 3R5BA 1QAJA 3AB2B 4D7NA 3EUHC 1ZG5A 4UT4A 4KAIA 4PPZA 2YKPA 1SPBP 3PVXA 4HNTA 1A31A 4NL5A 1S9GB 4EQQA 1LOUA 1YJNI 5ILVA 2PO4A 3OYHA 3WBZA 2GQCA 4FP9A 1ENHA 3EUHA 3MEGA 2OPQB 3M30B 1ETOA 4G7HF 4ZVSB 2RF2B 1YZ6A 2VOOA 3GFHA 1MU2A 2O5DA 2Y1LB 2EC2A 2W8LA 1OKRA 1T03A 3M1CA 1ZARA 5GAHJ 4CNYA 4OZ3A 4LREA 3WX4A 1J2VA 2W7OA 4O0NA 2AX1A 4HSTA 5FROA 3FXMA 2DLLA 5BNGA 3S7RA 1ZYQA 1FC3A 4FHTA 3BG5A 2DTZA 4X66F 1FXDA 1I39A 3V6DA 4ES3A 1LDDA 1IDZA 2ELKA 4MYUA 3QAUA 1D8YA 4LGWA 1N6QB 5IT9U 4URGA 1ETVA 3I55I 1YGYA 2YWGA 3ZQ7A 3HDSA 5K8NA 3JRIA 2Q43A 4O3QA 3OHBA 3DDKA 5CVIA 5E3PA 5LMUJ 1T9UA 3CUQB 4JOMA 2LXUA 3EICA 4ZDOA 5D5WB 3MR7A 2HGNA 1WGXA 3MMBA 4K5SA 1FMWA 2E7XA 3M9AA 4ZP8A 3QNWB 2RVJA 2NQPA 4ECVA 4NLDA 3EDPA 1KGSA 2VDHA 5D0EA 3AT1B 4HT7A 2BJ7A 2JZYA 2PG4A 1K79A 2ZH8A 3DN9A 4ZK7M 3KK2B 5B3SH 4X64F 3S01A 3BROA 5IT0A 1XMAA 3FGVA 4YEAA 1WC3A 5A8WB 4PWWA 2XTJP 2E34A 5FD5A 1HPZB 2XS7A 2I6WA 3RQ4A 1H9TA 4KFBB 1I3OB 4GGGA 4LQ3A 4KH1B 3TQNA 3S1QJ 5JHFA 4IG0A 4ZLJA 5HVGA 4BWJA 5G0RB 2VG7A 2I5JB 3CCSI 1RB0A 4G65A 2M4KA 1N33F 4EO8A 3NMAA 5HQLA 4MKAA 3LSGA 2BYCA 5GTHC 2OTJI 1HI8A 4ED6A 2UUCJ 2BKPA 3VGTA 5FKNA 2IC3B 1SJQA 2RT3A 3OBIA 3OYFA 1VZ0A 4L6V3 5HMWA 4WKYA 3DP7A 1G7CB 3HJVA 3IM9A 3M30A 1F5TA 3DM2A 1CJKB 4BEHB 4HV5A 3UN2A 2XZTB 2A2DA 5IQ6A 2FVCA 1TKZA 2LF8A 2ZH5A 2UUTA 3ZOBA 3A8IA 2IRXA 2Q79A 5CZVA 1ZN2A 3GJTB 3SCLE 1NNDA 2RB7A 4L9JA 3NGSA 5KFRA 2KG0A 5IWAJ 3G2BA 1CC7A 2N4DA 3RYLA 2ZJRQ 4QIVA 1K0VA 1Y6IA 4EGLA 3VPRA 1W5SA 2WVFA 2YQ1A 2DXDA 2G2YA 1X9MA 4J9OA 1S57A 1EJ9A 2OMLA 5A8KA 1ZG1A 4NBQA 4RLQA 1S1WB 3CUQC 1UG2A 1FXLA 3LQQA 2R4FA 3M2UA 1S1TA 4B3SF 3L95X 5KFTA 3MWBA 1Y8QB 4CCHA 3SFIA 4M72A 2CZ4A 2NS8A 1U8BA 2MY7A 3PJ9A 4LSZB 2SXLA 4PGGA 3GV5B 4U0VA 4R25A 3PIPQ 1KA8A 4B44A 3N79A 4DUYF 2FLOA 1FT9A 5CKTA 3DLKA 4WYWA 4OI2A 5DDPC 3MAQA 5H6QA 1T98A 3DLLQ 2V1NA 2MZRA 3RG6A 2J0WA 2ZMEB 4URSA 5F9LA 1HNXJ 1IBMF 2HVSA 2L9SA 2LEPA 2QA2A 1ZRCA 2RQ4A 2WCXA 3CT9A 2HWVA 1XX5A 4Y34A 3OIPA 1G1XA 1S9EB 4CI0B 3AG3H 3BH7B 4ZZLA 2DK5A 1H2UX 1YX2A 3GTPJ 3H8YA 2PMHA 2FHKA 2R7QA 3A8EA 2LDIA 2QKMB 1BWEA 2F6CA 1QSYA 1RP5A 2QIFA 2EV6A 1WI3A 4IHYA 5B7WA 4NA1A 1Q8KA 2M7SA 3AY0A 4DL7A 4ZJLA 4I2OA 3ZFVA 2DD8S 2L2OA 3DEWA 5HS9A 2QENA 4B3RJ 3POTB 2HS3A 1UJ6A 2EI5A 3H5YA 2R8IA 5E1ZB 4HT5A 3NNCA 1ZA1B 1YDLA 3HSRA 5IYDJ 4OLPA 3FDSA 2D74B 4QPQA 2H51B 1ZM9A 2M70A 2CKWA 4PRFA 3B6CA 3QLHB 1MKMA 1M0SA 2HQIA 1X31C 4JI3F 1JTYA 1IBLF 1N78A 4DG1A 3I0SB 2ESHA 2JFDA 3NWTA 5LRSA 2M4MA 1XK8A 1WF2A 3RQIA 2A69F 4UVBA 4C6AA 1CJUA 2FQQB 1N36F 1PYSB 1OCCH 5KG4A 2M8EA 1X3ZB 2O3FA 1WF1A 1ON2A 1D1UA 1U4BA 1MDMA 1NK8A 3T1HJ 1KVJA 2UUBJ 2R4GA 1B8IB 3MM6B 5GADI 3FUYA 4OIQF 2F8HA 1EV7A 2FLNA 5LGUA 2GQQA 2HYFA 4L0ZB 1D0EA 2K8GA 2DHHA 1VLYA 1RI7A 4W1UA 4C8ZA 1FDBA 2EFNA 3N01A 4CDGA 3U1NA 1TL5A 2VKHA 3JAMK 2NYIA 4LR8A 3T1YF 2HDWA 2Y69H 1KC8T 2IMOA 3Q23A 5IY5H 2R7TA 1PP7U 5LRRA 2AYBA 5L8RC 2ZMEC 1SKUB 3KP5A 4MJKA 1F1BB 2YTCA 1N8RT 5M2UA 1EQMA 4A3CJ 1KU7A 2BKNA 4ED3A 5ITHA 3W6JB 1JLQA 2VKEA 3EYYA 1HMVA 2ZBKA 3ABUA 2FXAA 1IR1A 3W2VA 1T9YA 1UPMB 1HNIB 1FWPA 4A5MA 1OMSA 3ZMVA 2DBBA 1O7LA 1AUDA 4CXFA 1DGWY 3I0TA 4K5RA 1NB7A 4P2SA 1X60A 5F3TA 1Y0UA 3EX7B 1RT7A 4DLEA 3PKYA 5HNHA 1H8AC 4I1TA 2I10A 2V6AA 2O3DA 2G1DA 1PYOB 5I42A 3TA0A 1RYSA 3IN5A 2OSRA 1SMTA 1W36D 1RKIA 5J1RA 1Z6RA 1IKYB 2BBYA 5LJ5Y 1FNXH 1FJGF 4IHVA 3VHQA 3RPUA 2M4GA 1V5VA 5EX0A 2CGPA 4KTQA 3M8RA 4Q45A 1WC0A 4ZVTB 5A2QZ 3CDLA 4HH0A 1FE4A 1H2TZ 1VGYA 3G6ES 2B5JB 2P6SA 4ENJA 3TJAA 4IL6C 4FASD 3DI6A 1Z0XA 5FFZA 1YBUA 4JI0J 2VZ9A 1FRMA 2YNHA 3ZXSA 2A0FB 4YB6A 3F8FA 3DC2A 1K78B 5T7LB 1WVRA 2XSJB 4XM3A 3KG0A 5EZGA 1EETB 4G1PA 2XWYA 1FRKA 2HWHA 4X65F 3ISZA 3GSDA 4DL4A 1X9WA 2UXDF 1FE0A 5GADJ 5HDGA 1VHIA 4Q7AA 4DV6F 4C11B 5DV5A 2DJIA 4OHWA 1O3SA 4AC0A 3F6OA 4FF3A 1JHFA 4QCLA 1AB8A 2GJIA 3ILOA 2K3FA 1XMOF 4JYKA 3PFYA 1RAHB 3QO9B 1S5ZA 2GAUA 1IUYA 4BS2A 3R6LB 3Q0WA 3Q0UA 2CNKB 2G0CA 4R0EA 1N77A 4IHSA 1XSDA 5D4NA 4OHVA 1RXOB 3MAAB 4OI0A 3R9LA 2ZHAA 1N32F 1Y39A 1VRUA 4DZ6A 3EMTA 3L7PA 4FTHA 1N5TA 5HMXA 3LSHA 1IR0A 4USTA 3RRKA 1Y8RB 1F36A 1LEAA 4OX8A 2Z4PA 1M1HA 4ZVFA 3I71A 2VL1A 1RAAB 4Y2IA 2L5QA 3OTOJ 1OIAA 4FYVB 4PUSA 2WC2A 4RUBA 1VQ5S 2JDJA 1TKDA 3AXMA 1HXDA 2B43A 1GUUA 3NG8A 2W9CA 1M5OC 5F8LA 3JRAA 2R7XA 3VB2A 4HG2A 1T3OA 2XS5A 1Z1ZA 3ZNUA 4FF2A 3O5TB 2HMIB 5KT5A 2FZGB 1W0UA 1UFKA 3U2RA 2Q6BA 3A3NB 4BBYA 4QW8A 1R27B 2QFJA 1Q82T 2GX8A 2BX6A 1IN8A 1LQ9A 4BXFA 1IR2A 4LF5F 1P9QC 2VH7A 4AIJA 4RW4B 4C8NA 2LRDA 3OFEA 3HMJG 1RTJA 1P1LA 5GTIC 1S1UB 2WBMA 2MABA 1UEVA 3LOUA 1FFGB 1X58A 4K4UA 1R7IA 1VC0A 4H54A 2JA8J 4A8YA 1M5PC 4LF8F 2PFBA 5L3CA 2CV0A 1LJ9A 3HKWA 4QIWD 1K73T 5AT1B 2A3JA 4FE7A 1CF7B 2P7CB 1NM2A 2AW0A 4C3HJ 1TQLA 3TANA 4FETA 5HI7A 3HFKA 1IGNA 4A2UA 2ZXIA 5JLWA 3S3OA 2Y9YA 5J2PA 4ENKA 3HFZB 1CJVB 2R5YA 2H54B 2LTPA 1TZLA 5D3GA 2QQ9A 2KVQE 4HV6A 4AVZA 2FMYA 3US5A 2Y0SA 5F1JA 5LHGA 1R0AB 1ZG3A 4XKVA 3B4MA 3G6EI 2ACJA 2CIMA 2ZXJA 5EDNA 3I3LA 2LVWA 3DKYA 5DCMA 3KLHA 3QQAA 5HJXA 3WHBA 2MZSA 4NA2A 4F0MA 1X1DA 3JAMZ 1RT3A 2R8GA 3BJAA 4GYIA 1S7HA 4O44B 4DU8A 5F0FA 4BGDA 3VZHA 4OHXA 3TQ1A 3KEQA 4YDXA 4M3BA 2ROPA 3OL7A 2OZ6A 1IW7F 1ULRA 4GC6A 5F9NA 5IC4B 4FPIA 1TVRB 3LPEA 4J9LA 1FTTA 4WP3A 1VBKA 1WC4A 4HDGA 4JI8J 1FEXA 2JN6A 4AQYJ 1TQPA 2OPSB 1LXNA 1XPXA 2KTQA 3ZZOA 4DWIA 1DGRM 2B6AA 3ABMH 1VQ6I 2F4VF 3RKYA 2AGPA 4GKJF 1ETXA 3FJ2A 1PVEA 3R27A 3SYZA 4DYRA 1FOYA 2W4SA 2L3DA 2JRSA 4DQPA 5DD8A 3TYTA 4HVZA 4ZVQB 2E9ZA 2E66A 1RR7A 4Q0BB 3IRXA 4X4RA 2JRTA 3BY6A 1HHTP 2DIUA 4ZPVR 1VC5A 4Y3CA 4KV8B 5E3QA 4H4MA 4RW4A 3KK3A 3TEDA 3M4OJ 4UUSA 4J9VA 1RTIB 1OQYA 1Q95G 1JKRC 3FKIJ 3TZYA 4DXLA 3U1DA 3LA2A 5LGTA 5DQGA 2QYCA 4J01A 3ENAA 2W2QP 1ZLKA 5FB2A 2AD9A 4DJAA 4U96A 4OX9F 1U1PA 3GIJA 1SL0A 1Z2ZA 4EWTA 4PFPA 1NSQA 1E6VA 2J5AA 2QN6B 3OY9A 1KTQA 3K2YA 3GV8B 2UXXA 5H9EK 3VAJA 2QV6A 4XDDA 1IRGA 3GJQB 1FJ7A 4UQGA 2VASA 3E8OA 2FHJA 3LA3A 4U67Q 4RB0A 1A36A 1O3QA 2XMWA 4RBOA 1FMVA 2R42A 2FBKA 2A6OA 3CF5F 2ZOMA 1C0WA 2FIUA 4DI6A 3I4PA 5L3FA 3MPUB 4J00A 3NP5A 4ES2A 3T0YA 2XY5A 2R2UA 2KXHA 4BL0B 2RVCA 1UTAA 5CD4H 1OCOH 5HVHA 2ZXWH 3ERED 3DWLE 1Y00A 2YKNA 1S9HA 3ZZUA 2HGLA 2ESNA 2VE9A 3S16J 5KCMA 4X0GA 1ACIA 1AROP 1U2FA 2DEIA 2BV3A 4CO4A 3AJ2A 5EEGA 4MKYA 1C0UA 1VQ4I 4B9NA 3MURP 3M6WA 1ICEB 3R3TA 2PFFB 1G4DA 1YVFA 4ZCMA 2N4CA 2R8JA 3O8HA 1Q7YT 4G12A 3R5GA 3GFXA 1FRXA 1TFWA 3LWFA 2CJQA 1BQMA 4HDVA 4OYWA 4CZZA 2G13A 3JRFA 1D8JA 3DEUA 3DNCA 2NNNA 2Y30A 1IC8A 2JWTA 1YWXA 1YYVA 1CSJA 3BQYA 5HROA 4CNZA 1JLFB 4N7TA 2ID3A 1U45A 3KLFA 1BA5A 2OF7A 4NNJA 3MCSA 4NLRA 2EZHA 3EGZA 3MZHA 3EGVA 4UTGA 3MFKA 4AIDA 3P49B 3Q0VA 5BS6A 2GOMA 2JEFA 4XK8C 4FS1A 2KZVA 3SJMA 3PO5A 4IH7A 3GFYA 5FD6A 2K9MA 1J5YA 2DNQA 1TUWA 3E3VA 3ESWB 3REOA 2PI4A 4LITA 3HPHA 2KZGA 2CU7A 4ERDA 1FX2A 1RWOB 1KQGB 4GVLA 2HTSA 2V79A 1RTIA 3TWZA 4ASNA 2CQ2A 4F8RA 1HQUA 1SFKA 2ZBPA 1B72A 3DBHB 3A4TA 1RKTA 3NAUA 2FD5A 2Y31A 4DSIA 4C8KA 1U49A 2H6CA 1V3FA 2DTJA 1U5TC 2MHEA 4R0JA 5LMUF 1SANA 4CCLA 4CH0S 3N05A 1NH3A 5DZ7A 1FZPB 2DFHA 1WZ2A 4NLSA 4IHWA 1E17A 5KG7A 1JNZB 2RKIA 2CUEA 3GFLA 5HDNA 2XPVA 1U5TA 4XK4A 3TVYA 4EBCA 2Z58B 4BQNA 3E6DA 2YUSA 3JRHA 1IXKA 2GVDB 2JPBA 3THPA 2DFEA 4I64A 3N5BA 2GXBA 4ON0A 4OL8A 1ZS6A 2EPFA 1VIXA 5HO4A 1HSJA 1K83J 5CZXA 1EKSA 3M9OB 3LP2A 3CDAA 2VJIA 4FE4A 3V6JA 2NYXA 5KK1A 4RGSA 4ZTFA 5DTDA 4G1IA 2VFUA 2R9LA 4LRBA 2A6HF 2I5UA 2W7NA 1S1XB 2HEKA 1CQTA 1FWLA 2BOPA 3PKMA 2F5FA 4HZFA 4XLCA 3ZZTA 2LR8A 4P6QA 2UUCF 3G86A 2DA3A 3HHDA 3DMJB 1HWJA 1SAUA 2Z57B 3DRYA 4DDFA 1RT4B 1KDNA 4BC9A 2ZCWA 1VQKI 1R49A 1Q86T 3PL8A 1DURA 3BBFA 3W6VA 1SFEA 1QVGR 1MJ9A 1FBUA 2C2MB 2CJXB 4OV6A 4Z7CA 4HX7A 3IXQA 2MSTA 2QVOA 2DR9A 5B0BA 4FISA 2DXIA 4FQGA 4Y52J 2QGFB 4M74A 1YJWS 3WZ0A 2HWTA 2DNKA 4AYBD 1EHWA 1KP6A 5IWAF 3VZIA 3OIOA 3IAS9 3C2HA 4Y13A 2AJQA 2KT3A 3HDDA 3RKXA 1JB0C 1XBWA 5CXTA 3HHKA 5AE1A 2AXLA 5C2CA 2HVRA 4D9JA 3FQKA 5A2QY 3KK1B 3WQPA 2QWWA 2B51A 3C46A 1LWFB 4CLKA 1YIJS 2H65B 3K7AJ 2PJRB 2V4RA 3IH2A 1WELA 3JRCA 1S0VA 3R7NB 4ID5B 3F8NA 1X4GA 3E97A 3DLHA 1GXQA 3QOPA 2V2QA 2VFTA 1WH7A 1HI0P 2P8IA 2CQCA 3SFZA 4IRKA 1IV8A 2X4HA 1ZQ3P 3ZTSA 2W48A 1NZ8A 3BO4A 4IOAF 1IN7A 1ZREA 3DTEA 2X48A 3M8PB 4ATNA 3GVAA 4IVNA 4EFAC 2BOAA 4IFVB 3AG1H 1SD6A 4RAFA 3ILJA 5EWFA 3G73A 3JR9A 1F9HA 3FK6A 2FBIA 2CPYA 2HFUA 2FE3A 2Y0SN 4YDDB 1FOWA 1WJBA 3BLYA 4I7FA 2DH7A 1Y9OA 3A1YA 2CDQA 5C42A 5D8HB 1HKQA 2CADA 3FRYA 3BR2A 4DR5J 2HAIA 2F5VA 1YHQS 1RUOA 4AD6A 2ZJQF 2EBGA 5EUHA 3HUGB 1I51B 4DQSA 3PX0A 4C0OC 3C6TB 5F1RA 5D6EA 1KSPA 1UMJA 2XMTA 5HLGA 4MLOA 2DFFA 3M32A 1BGXT 3KHGA 5CYJA 1FYLA 3HVAA 1PJRA 3A01A 3I4MJ 1HOMA 4KA4A 1KVKA 3RSNA 2JVOA 4B3RF 2PA8D 3V7SA 1JXEA 1Q81T 2CQ4A 1HKTA 2ZH6A 1K4TA 3CEDA 3K10A 2Z2ZA 1Y4ZB 4DSEA 2IGKA 4XNFA 2E29A 2RV8A 1BR4A 2NSBA 4OV1A 2AYMA 3JSPA 3HX9A 2FJXA 1JTXA 2NSCA 2UUAJ 3TAPA 3E01B 3GUDA 2FX0A 3AOCA 2V9PA 2X85A 4M1KA 1SFUA 4YELA 2N7YA 2EG1A 1L3LA 2KZZA 1IKWB 4TNOA 3QAEA 3JYTB 3H3ZA 4CTAA 3SZ2A 2NUHA 1OCZH 2F65A 2NXJA 1V4RA 3TO9A 1N25A 3NBPA 3T1HF 5GMDA 1QNTA 2UUBF 4YB1P 3EVWA 5D77A 3D6MB 4ILMA 4KT0C 3ZQHA 5BMZA 2PA3A 3MR6A 5HS7A 3H98A 4HHUA 1FESA 1F0XA 5EZHA 3P5TL 1WI8A 3I53A 2IRYA 2ZM6J 4KIFA 5M3MJ 4RW8A 1T0TV 3BDEA 4QPXA 4B3OB 4IZZA 3I56S 3BREA 4ZJQA 3NCQA 3KLOA 1W2IA 5E3RA 2HFNA 5HANA 4TY9A 2PGCA 3DYAB 1KKHA 5LMNJ 3H0DA 4BE2A 2UVVA 3MEEA 4UVAA 4N9HA 4PWDA 3CTRA 3IM8A 4FXDA 1QPIA 3L2VA 2LLZA 1PDNC 1YLXA 2EJRA 4LF4J 2J9DA 3D0IE 3WIUA 3K9TA 2WOMB 3MR3A 2C2DA 2Q2EA 4F93B 1JNRB 2WA0A 3KLIB 4WX9A 1WORA 2GJ2A 4XMYA 3BG6A 2AIRB 3DLAA 3FBIB 1KBRA 2DN0A 4Q2MA 4TXSA 4WXWA 2HAFA 2XCAA 1UAAA 1TTYA 3KLVA 2E1PA 2R7WA 2DNGA 1G2EA 1JLGB 4USWA 4WJBA 1UKUA 2W84A 2ZFWA 2ZJPQ 1N5SA 3D0HE 1KRPA 1GH8A 4CLPA 3JAMY 3CJTA 5BQTA 4A8SA 2E36A 4KRWA 3KJVA 1B9MA 2R8KA 3WTWC 2H48B 3U21A 2FHMA 2VE8A 3FISA 3D6FB 2GIFA 3GWZA 2VBWA 4OIRF 2OO4A 5IT3A 1HHQA 3CZ6A 1QM9A 1SUQB 2UVWA 4RA2A 2BYVE 1VQ8I 1RAEB 3SFGA 1VK3A 3TUZC 5F41A 3OYKA 2R7UA 2W9AA 1TKTA 3BJ6A 1MH3A 3GZ7A 5LGNA 3HCXA 1IQZA 1PAEX 4A3KJ 2C2RA 2XEXA 3SQNA 1SI9A