2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
3TOAA 1YIOA 4GXOA 4XSZF 3TO9A 3G73A 1PGZA 4A12A 3V8LA 1VQ7S 1T6SA 1H0MA 3V4GA 4M9XA 1SFXA 3M9AA 3PFIA 3Q2SC 2DHXA 1F9NA 1K8AT 5ICGA 2DNOA 2YTCA 1X4GA 1UHWA 4ZYDA 5KVRA 3HHNB 3GUDA 1M90T 2KRFA 2VBWA 4GGGA 3SHFA 1ZLJA 2MLKA 5BOXA 4ERDA 1X5OA 1WQ2A 2DNHA 5IM0B 5ILSA 4TLQA 2J5OA 3ZMSA 2CQGA 3PQJA 2YH1A 4CQ1A 2EFNA 2JWNA 3JW4A 1YW7A 4LB5A 5H6RA 3NMRA 2BBYA 3BY6A 1BI0A 1H2VZ 3L09A 1L0OC 3FXQA 4RS8A 3JSOA 4HF0A 1IW7F 1D8KA 3CCSS 2CJKA 5JFRA 1OYIA 3RKWA 2A69F 4NB5A 2XKOA 2XASA 3KFWX 3LFKA 4Y00A 4EJWA 4U0WA 1T0FA 1DBDA 2ADUA 2ZXJA 1X0FA 3WTSC 2RNJA 3QP6A 3GEZA 3KP4A 4IVNA 3O3KA 3S01A 4IOAQ 3QU6A 5LEJA 2W84A 3W6JB 2CQKA 1MJ9A 3AAFA 2A6HF 5DUKA 1M5PC 3ABUA 3UWTA 1I5ZA 2DGVA 3LPYA 4IF4A 4OIPF 2XIGA 3WTTC 2MBFA 3M8FA 2BE5F 3MUTP 2EFPA 3JAMZ 2FU4A 2N3LA 2TDXA 1FYMA 4FT8A 3MDFA 5LSOA 4ENMA 2KKOA 2F5EA 1OYWA 2N3OA 4ZZLA 2CPHA 3GLXA 5E18F 2CFXA 5FJ4A 1V3FA 2FXAA 2D2WA 3F6VA 4WKRA 2RC4A 5LRRA 4KNYA 3BJAA 3FZVA 3L9FA 4MTEA 1ZH5A 4QLCU 1D3YA 4Y13A 4QPTA 1OMIA 1O57A 5TRDA 1I1GA 2P4WA 4CH1A 2Q2EA 2MQMA 2MA3A 4BHPA 4UVAA 1O3TA 2DNZA 2ACJA 5DDQC 2DH7A 1KU2A 1U5TB 1G3WA 1Z05A 3ECOA 3C3WA 2HS5A 4G7OF 4I0AA 3RJPA 1KA8A 1LDDA 2XV4S 2KRBA 2FF4A 1WF0A 2DGXA 1U1QA 2AYEA 1K78A 2AYMA 4LJZF 2BEOA 3UE2A 1SJFA 2V79A 3ZMDA 2EV0A 1GXPA 1HW2A 2MZ1A 3GW2A 1W7PD 4MHGA 2HGLA 2U1AA 5LBQA 3J7ZT 2DNGA 2N7CA 1H6KX 1VQLS 3KEQA 3UCGA 4U0VA 5DYMA 1K79A 5IT9Z 3P3DA 1B6AA 4G6DA 1O0PA 3RPQA 5IM0A 3N97A 2KH9A 2CPDA 1ZREA 2QZ8A 2V9VA 2KM8B 3U2RA 3QPTA 3JTHA 1E17A 1WELA 2RVJA 2HYIB 2EFQA 1YIJS 1YW8A 4N9HA 2JT1A 2YR2A 3FF5A 3FWEA 4O6JA 1FJCA 1SD7A 2E5JA 2H6CA 1FP1D 4UXNA 1X3UA 1YJ9S 3CO7C 4BH9A 3L00A 3BJ6A 5DD4A 4OMZA 1R1UA 2IRFG 1S29A 4OMYA 3K2ZA 2PEXA 2LF7A 4KT5C 1ZARA 3DKWA 2QBYB 3CDHA 5LGUA 1WF1A 4F26A 2OIHA 3VF0B 4NQWA 3ZZZA 3HSRA 4P5OA 2MHNA 4IUFA 3P9IA 4FHTA 2DNLA 2ZJRQ 5D5WB 1MZBA 1JJ2R 1Z6TA 2XRNA 2MSSA 4ESBA 1VQ6S 1J5YA 1RIOH 2MJUA 2XS7A 2K4BA 1PUEE 2PMHA 2D3OR 2LF8A 1XGOA 2DAOA 1ZRCA 3I5UA 2U2FA 2ZBKA 2KXFA 3CUQC 1V4RA 2QLZA 2YSRA 2HFHA 4EGZA 2VBYA 3F22A 2KI2A 1HXDA 1NJIT 1SMYF 2ZMEB 1SFUA 2ESNA 4WXHA 1R8PA 3N4MA 1J9IA 3U1DA 1XMKA 3BZ6A 4PCQA 2CQCA 4UNOA 4CIOA 2M30A 1X4CA 5E8IA 1WWXA 1LVAA 3Q2TC 3CCQS 4EGLA 2LA4A 3CUQA 3RPUA 3CXCR 2OJ3A 2G4BA 3EQLF 4L5JA 5EN1A 2EK5A 3FX3A 3CD6S 4RAYA 2LDUA 2MKKA 4TU7A 1OKRA 1K6OA 1AOYA 4WFAQ 3GZ6A 4HLXA 2HTJA 1IXCA 3BPVA 3T8TA 2CPIA 4CH0S 2X4HA 1OO0B 2EA2A 5CYVA 1FWZA 1TTYA 2DNRA 2MKJA 1U6FA 5IQQA 2VT3A 2CPFA 4G9YA 4Q47A 1M1KT 2RVCA 2CQ3A 5DDPC 3R60A 4I7HA 5HO4A 3CCES 1PO6A 2CW0F 2IA1A 2CPZA 4JK1X 5D5UB 4A0YA 1UHMA 1TNSA 4PRFA 4V19X 2HGCA 4HDVA 1WHWA 2DGOA 1U1OA 4Q5SF 5JHUA 2VODA 2P7CB 5KK1A 1P4WA 1OYYA 3L3CA 2OD5A 3BOQA 3BPXA 3SDEA 2OTJS 1AUDA 3U1LA 3CC4S 5D8KB 1ZG5A 2P6SA 2ZMEA 3ZMZA 1O3SA 4EV0A 2KU7A 2DH9A 3VAKA 1AWCA 4KIFA 4BHCA 2D1HA 2FMLA 4OU0A 4N0BA 2NZ4A 4L9NA 1MGTA 3S6EA 1F4KA 5CA5A 4EM2A 4HW0A 2PN6A 1YJNS 2QYOA 4B8XA 5IFMA 2QA4S 1HBXG 1QQIA 4RGRA 2XAJA 4BNCA 5BJRA 3VAJA 2E7WA 3V7RA 1TW2A 1FBSA 3BWGA 1U1KA 2IJLA 3ERED 1H9GA 5FD5A 3RYPA 1VTNC 3IHUA 2MQLA 5JR3A 2WV0A 1G3YA 3LA2A 2GZWA 3MAJA 3QAHA 5FGMA 1QVGR 4RB3C 3VAIA 2QVOA 3ZQ7A 3HTSB 4CYDA 4RB2C 2M2BA 1WSUA 2YU3A 4MGRA 4FX0A 3L2CA 4HF2A 1UFMA 4TU8A 4OIOF 2CSOA 3HRUA 2A68F 2GXGA 3VODA 5F64A 2DNPA 3NS5A 5AONA 3ZN0A 1GXQA 3WE3A 2DPDA 4WK8F 4Z2XA 2QEXS 2O61A 3WTXC 4HQMA 1T39A 4LGWA 4IHSA 4U67Q 3DEUA 2V1UA 2O8XA 2M52A 2ELHA 4Q4ZF 4Q48A 1M5VC 2J8AA 3CUNA 1NHAA 1VQ9S 1DZ5A 4YFXF 4WCGA 2DGTA 2MB0B 2XB2D 2WTEA 2LXUA 2DBBA 3B73A 5LHHA 1LB2A 4LLGF 5LHIA 1WHYA 3EGZA 3ZMUA 2Q0OA 5A2QK 2KFYA 1X4AA 4A5MA 3ZPLA 5ILVA 5CVJA 4DNCA 1E2XA 3MI7X 4C7QA 5FO5A 1ZYRF 3J81Z 4BYYA 1P1TA 1O3RA 4CGZA 3KP3A 1B4AA 2MPUA 2ZJ2A 1EV7A 2M0GB 1WI6A 2HZCA 1JGSA 3H3UA 3WE2A 2CO5A 3T1BA 4BHBA 1S79A 2PJPA 5ITHA 2DO7A 4LLLA 2GQQA 4W90B 5D77A 2ADBA 3E97A 4M6YA 4CZZA 5J8CA 4KDPA 5GAEU 2BYVE 5HS9A 2MH2A 4IRGA 3ROUA 3WU1B 3F8BA 3R61A 2JPBA 2IW5A 1IF1A 2DTRA 4C0OC 4G94A 5K5OA 3NNCA 1IAWA 1PDNC 3M1EA 4L9VA 2QFJA 4BAYA 1X5PA 1Z1DA 3NQOA 2DT5A 2MQPA 2MSTA 2CQHA 3KLOA 2MC3A 2UP1A 2M7SA 3ZN1A 2CQ0A 2DQLA 2RS8A 4EM1A 4GCVA 1VBZA 2F5FA 1XB4A 2XGXA 3WTZA 4ENNA 4KYWA 1YHQS 2L4MA 1FBQA 3UCUP 2ZKZA 1W5SA 3CUQB 2K3KA 2ZJQQ 4EMSA 3IC7A 2O6GE 4HZFA 1G2EA 3COAC 3WG9A 3EGNA 3R1HA 3G9CA 4O5VA 2G7UA 4XRFA 2ERRA 2L01A 2EB7A 3GZ5A 1ZGAA 5FD6A 3F6OA 1USSA 2KRRA 1ODDA 1U8RA 1U3EM 1G6NA 1I27A 1ZGJA 2LA6A 4MEYF 2A61A 2F9JA 3GFIA 1YI2S 4GYGA 1HSJA 3HHGA 4U7BA 1J59A 4IOCQ 3R1LA 2EV5A 3HUGA 2V94A 2K27A 4EJUA 2G7HA 2RS2A 3RIRA 4ZYHA 1XN9A 1TBXA 1SXLA 5AIPA 4P9FA 3BJOA 4A6DA 2P5VA 5JVGQ 2AYGA 4F25A 5L3GA 3LA3A 2DISA 2R7FA 4ON0A 2HZTA 3BO2A 6PAXA 4QWQA 1CF7A 4LK1F 4AIHA 1KOHA 2F9DA 4R8HA 2DH8A 4LK0F 4N9IA 3QPHA 2FMYA 3CTRA 2VN2A 1P2FA 1UW4A 1U6BA 4HAMA 1YYVA 4YFKF 5BMZA 2VXZA 4IRHA 1J75A 3H92A 3I54A 2DNQA 3CF5Q 1UFWA 1HKTA 4D0PA 3EX7B 2V6CA 2O0YA 1EH7A 3IWFA 4MQVA 3REOA 1MJAA 1WI8A 1ZG1A 5FFXA 4PGHA 1K73T 4Y0FA 3G6ES 4CICA 1BC8C 2UXNA 1B1BA 3B4DA 1D9AA 2GO9A 3MUVP 2KN4A 1SJ3P 4AWXB 4KMFA 4RGXA 1FBUA 4MNUA 3EUHA 3FMQA 3ULHA 5HDKA 5JVTA 1QVFR 2EA4A 3KP5A 2DO0A 2P8TA 4R1HA 2CQ2A 2Z9OA 1BI2A 1ZZNA 2RRAA 3ECHA 3QP5A 1U2FA 4F02A 1O3QA 5D8LB 2HOEA 1MDMB 2F5DA 4UVCA 4KICA 4ESFA 4ENKA 2B0LA 3ZP5A 1QO0D 3CC7S 2PEHA 1URNA 3O2PE 2SXLA 4HX8A 3EETA 1HKQA 2CPYA 4PR6A 3HRMA 5D5VB 1ZZFA 1QZYA 5E1XA 5ERIA 3CLOA 3K1PA 1ZRDA 2YWKA 5CVVA 3NS6A 1XDSA 3P5TL 4BXUA 3TDUC 3SFZA 1STZA 1L3LA 3T8RA 4LJMA 2WBRA 1SD6A 3TO8A 2W85A 1F1ZA 3TO6A 1H2UX 1H2TZ 2KVIA 2E7XA 1S7AA 5HOOA 2ETHA 5BPIA 2IP2A 5LSLA 4QQBA 1GHCA 3BEGB 2IA0A 4HOBA 4HF1A 4A0ZA 5CYJA 4TU9A 2M88A 1S72S 1B9MA 1CF7B 3D0SA 1VQ4S 1D8JA 2PMUA 5GVQA 1XGMA 2QUFA 2HYGD 2JVOA 1X4EA 1Q7YT 1JE8A 1Z6RA 5DCFA 3LQRA 1W2BR 3LWFA 3MD1A 5HLGA 3S7RA 5L3BA 1YFHA 3FEYB 1U2WA 3MUMP 5LXYA 5D6EA 1HW1A 2W25A 2MY7A 2HQRA 1JHHA 2OSRA 1W7PA 2HYFA 4M9SA 1UCRA 2F5CA 2MKCA 2MQQA 3FXUA 2JRSA 1UB9A 1XSXA 2M4MA 1R00A 3UD4P 1WG1A 4HLYA 2LSOA 2ZCWA 5ICEA 3JSPA 2VC1A 4XBFA 1R1VA 2FPHX 1RKJA 3BS9A 5D5XB 1WKMA 3FEXB 1KQ8A 2VC0A 3FM5A 1YS6A 1KU3A 4L18B 2COMA 1I1SA 3DFGA 2VT2A 4P96A 1ZLKA 4OZ0A 4O3MA 4HX4A 2L4AA 3R6SA 4ZYEA 3KP2A 2GA2A 1FYKA 1NU4A 3UD3P 3CMES 3K69A 1VQPS 3VEPA 2DIUA 3JB9k 4FX4A 3OW2R 5GAHU 3CCLS 3GXOA 1BI3A 3MXHP 3K1MA 3C18A 3DQVC 3WTWC 1SMTA 2ZFWA 1U5TC 3HOSA 4EJOA 5HLHA 5HVQC 1C0WA 3P6YC 1T98A 2KIUA 5DM6Q 1PP7U 3J81K 3TYTA 2XNQA 4MTDA 3VAGA 3BROA 1DUXC 2XVCA 1QGPA 2QQ9A 1ULYA 3UCZP 2LKZA 1FX7A 1Q81T 3H2VE 3TDZC 1I6XA 3I4PA 3K9TA 2DIVA 1S7OA 4HQEA 3I64A 5LGTA 3GYHX 2Q8KA 2MXYA 4LIRA 3NRVA 4CXFA 4YFNF 2MQNA 1JXSA 4HYEA 3IKTA 2WWYA 2ZJPQ 4LLNA 2R3SA 2OZ6A 4AVPA 3OOPA 2E1NA 3EDPA 1R8HA 2HGMA 2H09A 1YJWS 1LEBA 1KC8T 1ZG3A 3E5QA 3C7JA 1T2KA 2MY8A 2HTSA 2LMIA 5GADU 4G8XA 2ZNYA 2HVZA 2H6BA 2DGQA 3FMRA 2NNNA 1SJRA 2DB1A 2JVRA 4KFCA 3RW6A 4I98B 2J0SD 4WXCA 5E17F 2QQAA 2A3JA 3TO7A 3LA7A 2JSCA 4XLNF 2VOPA 2BZ2A 1CVJA 2CPJA 2I2YA 2MLGA 2W24A 3F72A 4R79A 5E8GA 5ICCA 4HV5A 3KP6A 2N82B 2DK5A 2DLLA 3TGNA 1P4AA 1WTBA 3MQ0A 1FY7A 3F23A 2DGWA 4W92B 3MD3A 1OIAA 1Q86T 1BIAA 4LG0B 3Q9VA 2LYVA 3W6KB 5TJJA 5LGNA 1WEXA 2PLYA 1KU7A 2AD9A 2BV6A 1N54B 1LJ9A 1USTA 2B0GA 4RB0A 1CGPA 2WC2A 2PG4A 3THPA 2NS0A 2OAZA 2FHOB 3DLLQ 4RU2A 4HX7A 4AIKA 3LQVA 5K5QA 1FNNA 3ZZYA 3G96A 2DK2A 2MMYA 1U6GA 5HS7A 1IN8A 2ZO4A 1VC0A 3J80K 5J6XA 2DGUA 3I55S 1TNTA 2FC9A 4RB1A 3Q5FA 4I2OA 2YPRA 4GYIA 3WTUC 5JVHQ 4FXVA 1Z91A 2XAHA 2AYBA 2FQ3A 5D4RA 1ZRFA 2HR3A 4I0BA 5D4SA 4WWCA 1ON1A 5F6FA 1X4DA 3QU3A 1FZPB 4M6XA 1HL6A 2DNMA 2KXHA 4LB6B 1FC3A 3LSTA 4CO8A 1KQ9A 2RDPA 1ZN2A 2JTVA 3J7YU 1QBJA 3DPTA 5L3FA 4M9ZA 4ZZDA 1JJ4A 2Q79A 3P9CA 2DW4A 3U9GA 1LEAA 2YX4A 2XROA 5DDRC 4A6EA 3VAMA 5EEHA 1W4MA 1BI1A 2CWEA 4M5DB 1F9FA 2CQPA 2CQIA 4EJTA 1P6RA 2D45A 1VBXA 1B7FA 4WFBQ 4M72A 1N52B 3I59B 3GVAA 3E5UA 2M8DB 4A0XA 2LQ5A 2DHGA 4ASNA 1A04A 2P5LC 4P55A 3I56S 1G3SA 4ZYGA 3ULQB 3CTAA 1NO8A 1XCBA 4YIIA 2EVZA 3PIPQ 1MDMA 3SZPA 1VC6A 4OIRF 1A9NB 3V7CA 1YWXA 2M8HA 5E20A 3HI9A 2L41A 4HBLA 3LAJA 2IA2A 4XLPF 2HDCA 4M73A 5FB2A 5HDGA 2EFWA 4UV8A 2FA5A 4J5OA 1SFEA 2STWA 1KD1T 2RQ4A 3Q9SA 3B4MA 1FXLA 3E6CC 4IRIA 2XS5A 3DXBA 5DD8A 1U1PA 3P9KA 3F8NA 1BJAA 1YQAA 1YITS 3DXJF 3JAMK 5K5RA 1XGSA 4OIQF 2CQDA 5BPDA 2EV6A 2LKPA 3RKYA 4DQ2A 4K2EA 1B59A 2HEOA 3VB2A 1X4HA 5HS8A 2DHSA 1VQMS 2PQ8A 5FLXK 3R4KA 2E5GA 5F1RA 3BP8A 2OTLS 2QBYA 2MZRA 2A5YB 2X1AA 1WWHA 1XN7A 1D5VA 1X4FA 2KG0A 3ZMTA 4ETSA 2LEAA 1R7JA 1LDJA 2UZKA 1VQKS 4WFNQ 1YO5C 5HLIA 2MKHA 3R0JA 3RDIA 2M9KA 4I01A 2FY1A 2L3DA 3CUOA 1K78B 2BOPA 2DO4A 1MD0A 1Q1HA 5BS6A 1ZHFA 1DP7P 4PKDB 3DV8A 1SAXA 2FNAA 2EFOA 4AIJA 1RI7A 2NYXA 4IO9Q 2STTA 2DNYA 2ISYA 3G3ZA 1UP1A 3SXLA 4LMZA 3I53A 4A8XA 2HKXA 2Z99A 3GF2A 2NAZA 3GO5A 3GWZA 3V7SA 5E1WA 1JHFA 2H94A 2G0CA 3ELKA 3T5XA 5LLQA 2FEZA 1R5GA 2XAGA 4QU6A 1HA1A 4IXAA 2JZYA 3US5A 4YG2F 4YB1P 4EVIA 3I58A 2D9PA 2EK6A 3MWMA 4CHUA 1X4BA 1U78A 2K4JA 3ISPA 3B02A 3F8CA 3DF8A 1Q82T 1LQ1A 5IT9K 2FBHA 4JBAA 3M8EA 3PQKA 3DP7A 4UQTA 3CC2S 1GVJA 3TP2A 3IRWP 1TQPA 3VAHA 1M5OC 3GFMA 2XAQA 5L3DA 1RUOA 4UV9A 4KA4A 2A3SA 2HQNA 4P6QA 2RRBA 4PZJA 3T0YA 2DNKA 1VC5A 1W7PB 3E6BA 2RU3A 2EK1A 3E5XA 4HA8A 1IN4A 4LMYA 3QRFF 2E5IA 2GIVA 2HKOA 4IHTA 2NRAC 3U1MA 3MURP 1DDNA 2AXLA 3K0JA 3SQNA 5JI6A 2X1BA 1XSVA 5ICFA 1KYWA 2YX7A 3MCZA 4RGSA 1A7GE 2OA4A 3MOJB 2I38A 3IRQA 1RK8A 4YOEA 1VQOS 1DHMA 2QENA 4UY8T 2XAFA 3LQQA 3IL2A 1FT8A 3RTRA 2FBIA 3TOBA 2GXBA 2NLWA 1KOOA 2GA1A 2P7VB 3F3XA 5LXRA 2OU2A 3F8MA 4Z2YA 4Y17A 3WTYC 4L0ZB 2FRHA 3RI4A 1IUYA 5DDGA 3G4SS 3IWZA 2K02A 4EGYA 2IVMA 2V1DA 3P49B 5CVUA 3NNHA 4GO1A 4NHJA 3IWNC 1KYZA 2K86A 5FFZA 2KXNB 3VOEA 3E6DA 3IKVA 5DUIA 3MZYA 4L9JA 1FJEB 1OPCA 1U1MA 3CCVS 1YG2A 1BOAA 4U88A 4E70A 4Y15A 4IJAA 1VQ8S 4L0YB 3FXRA 3KE2A 1U5TA 2X1FA 3KCCA 4UUVA 4KN7X 3CO6C 2OQRA 1Z9CA 1LDKB 4MQ9F 1HSTA 4WX9A 1S6LA 1O7LA 3HYIA 2PFBA 1JMTA 2D1VA 1FT9A 3HRSA 1S8NA 1T38A 3GFLA 2AS5F 1KGSA 1VBYA 1H9TA 3KEOA 1IQTA 5ED4A 4P9UA 1IZ1A 1XCVA 5DDOC 1HD0A 2M87A 2CQBA 1M5KC 1Z7UA 1WI9A 2M5WA 3J80Z 3MZHA 1EH6A 2JPCA 3QOPA 2VE9A 5DCMB 3BO3A 4G6QA 1R58A 3BDDA 3FMSA 2CQ1A 3SDEB 2RGVA 3HHHA 2DHAA 3DPLC 4L5IA 1N88A 3O6BB 1XSDA 4AD9A 1YTYA 4WF9Q 1RNLA 1OPIA 2CGPA 5HL7Q 2CYYA 4LD5A 1N8RT 2DK8A 2P6TA 3RYRA 1BN5A 4IPAA 2MKSA 3G71S 3EYIA 1IRGA 2MD5A 2KT5A 2FE3A 2VONA 1YLFA 1VQNS 4H0EA 3V8KA 1U1RA 1UAWA 3SMZA 2DFIA 4EM0B 4ZH4F 1WF2A 5D78A 1YW9A 2FC8A 2GAUA 5CXTA 1OWXA 4ZKAA 1FPQA 3M7GA 1WEYA 4LG0A 2KJCA 4I09A 4RGUA 4KIBA 4LFUA 5IT3A 5DETA 3CULA 2Z3YA 3IRRA 1R36A 2ESHA 4KIGA 2GWRA 1ONVA 4CDGA 2XUBA 3HSEA 3E6MA 5H6QA 2MGZB 1PP8F 3WU0A 4A2UA 1MJBA 2RKHA 4OINF 5GMKa 2MJNA 3KETA 1K9MT 3WGHA 3GX4X 2MZSA 2C6YA 5EEGA 3ML6A 3SZTA 2XKPA 2M70A 2XS2A 1DRZA 5E1ZB 3CCUS 4XSXF 3S8SA 4M71A 4QU7A 1IN5A 1P27B 3R27A 1LNWA 2IPQX 3BO4A 2DPUA 2DGSA 5LRSA 3FM3A 4EJVA 3C1DA 2X1GA 4C4WA 2OSQA 1WRJA 3I0TA 2XNRA 1KQ0A 3THTA 2MZTA 3NEUA 2JRTA 5D6FA 1WEZA 4PDKA 4HV6A 2L54A 2E5HA 4UVBA 4RAZA 4MEXF 1WG4A 2J0QD 1B9NA 2RNEA 1J0RA 2E1CA 3JTGA 3FHZA 2W57A 2HGNA 1JJHA 5H1SV 3CMAS 2OQGA 4KN4X 3MFKA 2A6EF 1L3KA 1RZ4A 1TLHB 4TV7A 5H20A 1SJ4P 4WF2A 5K1YA 1FOKA 2IT0A 1G3TA 2DQRA 2DU9A 4PGGA 4F7ZA 1BY9A 2R7DA 2LNBA 2Y48A 1WHXA 1QNTA 3EYYA 2NNYA 4HDUA 2D9OA 3F8FA 1FO1A 2MGZA 3OV8A 2MH9A 1WHVA 1X5SA 1U1LA 1XD7A 2LXIA 3K1NA 3SXYA 3KZYA 4ED5A 5CLSA 5FLXZ 4KUMA 1QZZA 1XMAA 2L9WA 2M45A 3PIOQ 5CJ9A 2ZNZA 3S2WA 1TQIA 1SJQA 4OZ1A 2FOKA 2M8EA 4YUDA 2QM3A 1IXSB 1MKMA 3CPWR 2O3FA 2JX2A 1BIBA 2J5PA 3HTUA 2FBKA 4WIIA 5AIQA 3MEXA 2FSWA 2EWNA 1DPUA 5LJ5Y 1FSEA 3HRTA 1F5TA 2CPEA 2RQPA 2A07F 2F3JA 1O7FA 3H2UB 4WCEQ 3TKYA 2ADCA 5DM7Q 3GFJA 1XGNA 1J2XA 1REPC 2RT3A 5MLCV 3V4MA 3KLNA 5BQTA 2RV8A 3KP7A 4WXDA 1X5TA 3CJNA 2XSFA 1U1NA 2PI0A 2MKIA 3L7WA 1XDUA 2KIFA 2K7LA 2YH0A 2LEBA 2FNPA 3NNAA 2KYXA 4B09A 4ESJA 4U7DA 2QQBA 4S05A 3WTVC 2CG4A 3KZZA 5L3CA 3CCMS 4G7ZF 3J7AO 3ABTA 2XHKA 2YKAA 3F21A 1KU9A 3TQNA 1FSHA 3E3VA 5HDNA 1D8ZA 3RW7A 2UXXA 1YS7A 2Y0MA 4M74A 1W5TA 2MQOA 1TQMA 4G7HF 1FJ7A 3R0AA 5DV5A 3N9UC 3K0LA 2E44A 2X0LA 5DEQA 3CCRS 1IRFA 5LEKA 1SD4A 3WGGA 5ILUA 2VOOA 4U0YA 2P5KA 1WG5A 2MZJA 3HSFA 5A2QZ 1HQCA 4BQAA 3P7NA 4UHTA 2EJRA 4EQQA 1BM9A 1RUNA 1SD5A 1P92A 3I71A 1OR7A 3G8SA 1HD1A 3HOTA 4A5NA 2LECA 1S3JA 2G9WA 3ZMVA 4ENJA 5CVRA 1QPMA 1IN6A 3CCJS 5CVIA 5GAGU 1K7AA 2DNNA 1VQ5S 3LAPA 2PE8A 3G8TA 2RN7A 1R1TA 3VAFA 2DITA 1ZAOA 2O03A 3RKXA 2RUGA 4JQFA 4S04A 1FHTA 3V8JA 3H3ZA 2H27A 5LJ3Y 1R22A 2OZUA 2CPXA 2K8GA 2QWWA 2Z5UA 3WODF 1P4XA 1ON2A 1Y0UA 1G4DA 1TW3A 2Y75A 1QM9A 1FP2A 4OOIA 2LCWA 2Z33A 2V1XA 1KQSR 1EH8A 2L08A 3WGIA 4L9TA 2MZQA 4BS2A 2L02A 2MYFA 2O3DA 1FNXH 1BBYA 1DPRA 4YIFA 2BGCA 2VBZA 5J8FA 4FXWA 3VFZA 2KJBA 2HWVA 2VE8A 1R5HA 2KIMA 3D2WA 1BC7C 5LHGA 3HIFA 2KM8C 2DI3A 1FLIA 2GHPA 2VBXA 2M1BA 3D5LA 1J7KA 3I59A 4I02A 4KMUX 2ISZA 1IXRC 3VALA 1HW5A 2J76E 2KG1A 5L3EA 2OBPA 2F2EA 2RQCA 1R23A 1HKSA 1IN7A 2CQ4A 5DCMA 2G1DA 2KHCA 2PBIA 1FYLA 2UWMA
chains in the Genus database with same CATH superfamily
4ZCMA 3R7SB 2EZHA 1DGWY 2W2OP 3F41A 1YIOA 4ZDLA 2QA4I 1EIYB 1NPKA 3V8LA 1T6SA 4MK7A 4J9NA 4DV3J 3V4GA 1SFXA 3PFIA 2DHXA 2XMWA 4H4KA 3SYTA 2BRLA 3HPHA 2OO4A 1HBUA 2DPIA 4XPCA 2J0WA 4B3SJ 4XDCA 3HHNB 2FGCA 3GUDA 4H4MA 3IBWA 2VBWA 5DO2A 3SHFA 2MLKA 5BOXA 4V2GA 2DNHA 1RT7A 2WZ1A 4FZVA 4EO6A 1KQKA 5LOQA 2J5OA 3ZMSA 3Q8PB 3KK2B 3PX0A 2KZZA 3PQJA 3T9NA 4CQ1A 2EFNA 4C11B 3JW4A 3I87A 5F8HA 3GQCA 3CCEI 1YW7A 1S77D 2MLYA 2W2NP 3AXKA 3KDOA 2AU0A 4OI3A 2CW8A 3SFGA 2BBYA 3JRAA 1BI0A 1WH5A 3L09A 1FDDA 1B8IA 3FXQA 4RS8A 4OJ1A 1R4MB 1D8KA 4HHUA 3CCSS 5A2QY 3VGVA 2CJAA 2A69F 4XL9A 1S6PA 2JA7J 3BGFA 3D1QA 3MECB 3LW5C 4QZVB 4DR5F 3LFKA 3HHLA 4U0WA 1T0FA 4GC7A 4DV7J 5EG0B 4A3KJ 1HOMA 3PNTA 2ZXJA 2CMPA 1X0FA 2QKLB 3WTSC 3W60A 5MAOA 3AJ2A 4IVNA 3EJMA 5IT0A 4PPZA 4RAFA 9ATCB 5LEJA 3CD7A 3W6JB 3RU0A 1Z7LA 4KV8A 1X2NA 2CQKA 3E3XA 2B4PA 1QTMA 4EU0A 1I5ZA 1T3NA 4K4VA 3LPYA 3CJTB 1X1BA 5KFBA 4XLAA 3WTTC 1Z4UA 3FK7A 5F8JA 2FU4A 5E3RA 2ASYA 4FE7A 4ZLJA 1UFKA 5FRMA 4FT8A 3MDFA 2F5EA 2N3OA 2DODA 4ZZLA 1UZDA 2E1PA 4ZLLA 2IS6A 5E18F 2YQ1A 4II2A 2FJ1A 2FXAA 4WKRA 1NPPA 2GOMA 4CO5A 5LRRA 4QW9A 2K9LA 4Q7AA 3MM5B 1CJKB 1O57A 3OHAA 1YX3A 2MQMA 3HOUJ 1O3TA 2RQMA 3ZC4A 4JV5J 2ACJA 2DH7A 5IPAA 1G3WA 5ETKA 3ECOA 2IAJB 1NG7A 2OPSB 1PJRA 2HS5A 2O7OA 3C6UB 2GC8A 1S0OA 3HMJG 2XV4S 2KRBA 1NDLA 2W8KA 1VRUB 3QODA 2DGXA 3LAMA 1I39A 4JI5J 2VU5A 4K50A 2W8LA 2AYMA 3LA0A 2D7SA 4ZDNA 2KQRA 3V4IB 1HW2A 1KFSA 2BANA 4P7VA 3F44A 2HGLA 2U1AA 5LBQA 4AM3A 2R8HA 3J7ZT 2DNGA 3MN2A 4HG2A 4B3RJ 4YHHF 1H6KX 1VQLS 3DM2A 3VDXA 2Y1JA 3UCGA 4EBEA 1K79A 3K4BA 4ATNA 5T14A 2BKNA 2Y8YA 3RPQA 2LYCA 1T9VA 1XWLA 1H73A 2QZ8A 3KKFA 1HHQA 4XOTA 2HBZB 3OSGA 5CABA 1WELA 4BY7J 1YIJS 3LGNA 1YW8A 3BQZA 3ZQFA 3RZAA 2ZM6J 1KVIA 2E5JA 4Y2CA 3TUJC 1N34J 2H54B 3KYDB 2W7NA 2ZC4A 1FCAA 1MN7A 2W7OA 1RC9A 3VYRB 2K7KA 4IG0A 3IXQA 4QOTA 4ZVTB 4QIGA 1S29A 4OMYA 3HKZA 2PEXA 3Q0UA 1RA7A 4IKAA 2J7WA 1MLAA 4NQWA 3W1YC 3HSRA 1XJWB 5EZGA 5KT2A 4AL6A 4LRBA 2AIRB 2DNLA 3W64A 2P8IA 2ZJRQ 5D5WB 3BSOA 1KNZA 1G7CB 2D3UA 2Z30B 3R2CJ 5ETTA 4YMEA 1PUEE 2D3OR 3UI3A 4ZP6A 2BJEA 2KXFA 1KTVA 1V5EA 1V4RA 2QLZA 1CJVB 2MLXA 4GRIA 5K8MA 2V68A 4J7CA 4DZDA 1S5ZA 2RSQA 1NJIT 1SMYF 2ZMEB 2E9ZA 2ESNA 1SFUA 4OL8A 1R8PA 4F3QA 3EZUA 3N4MA 3ICLA 4DS4A 1JLBB 2HNYA 5J2MA 1OCTC 4CIOA 2M30A 1X4CA 1WWXA 5AT1B 2LREA 3CCQS 4EGLA 2NS8A 2LA4A 3PUBA 1U45A 3CXCR 2G4BA 4NBQA 4YR0A 2LD5A 1TL3A 2LMDA 3KLIA 4G1QB 3BH6B 2QSHX 1AOYA 2XPUA 2GAGC 2GMLA 1LUJB 3SJMA 2PT0A 4NQWB 3W8PA 3RBDA 5C24A 2V50A 5BXIA 1RTIA 1TTYA 2MKJA 5IQQA 3IH4A 2CPFA 3AOBA 3I82A 1XR7A 1H74A 1RKWA 5KT5A 3FGVA 4I7HA 2VIHA 5B5EC 2CW0F 2CPZA 1WJ5A 4OV6A 3PW0A 3FCHA 2AXTC 3M1VB 1ACMB 4A0YA 1B4SA 2EG2A 3OBIA 4V19X 3QFHA 4ILMA 2HGCA 2YU9J 2ZH1A 4HDVA 1EETB 1U1OA 2KFNA 4Q5SF 4ALZA 2FVCA 4BDZA 2P7CB 4K2XA 1S1TA 3BOQA 2OTJS 1M5SA 3U1LA 2BW7A 2Z1DA 1EHWA 1O3SA 1D8YA 4JI4J 2K3PA 3DOKB 2V4JA 1YIJI 1X1PA 1K4SA 1AWCA 2JFDA 2D1HA 3OVBA 4L9NA 1MGTA 8RUCA 3BR3A 1T8EA 4RW6A 1K0TA 1S97A 1ETKA 3SFUA 1Y3KA 1WC1A 2WV1A 1V5IB 4DR1F 4IG3B 5IFMA 1SL1A 1X2MA 1QQIA 4RGRA 2XAJA 1FKPA 1RPWA 3M05A 1FJGF 1TTHB 3K5MA 3PVXA 1YBUA 1PC5A 2LC2A 3MPUB 1DFDA 3TR5A 3LA2A 2GZWA 3MAJA 2EZIA 4C3JJ 3QIDA 2JFKA 2ZXWH 4KFBB 2QVOA 5GMEA 4Q8FA 1UCNA 4DR6J 3V6KA 4UY85 1V6HA 3PACA 2ZOMA 2LY2A 4FX0A 5GAHJ 1ZBTA 2H5IB 4FVMA 2W7PA 1ZM4A 4E7ZA 3HRUA 2CJQA 3VSKA 2GIZA 1Q78A 1S1TB 5E3AA 3VODA 5F64A 3NS5A 3A03A 4DCPB 5AONA 1GXQA 1BR1A 4ZJQA 4X64F 4M5LA 4DCJB 2O61A 3QATA 3T5JA 4P7TA 2ZHBA 4C98A 1T39A 4MAKA 1QY7A 4TN2A 4EO8A 2O8XA 2M52A 4J9RA 4Q48A 5H2FC 3TZWA 4RLEA 4X4RA 3GTOJ 1DZ5A 4WCGA 4RO0A 2MB0B 1ZM2A 3CCQI 2WTEA 1IM6A 1N6QB 1Q8IA 1SKSA 4P72A 2ZH9A 4P52A 3ZMUA 3FXJA 2KFYA 4I69A 5HI7A 5K8OA 4HACA 3OIOA 1AA7A 1R8AA 3BGLA 5CYMB 1L3UA 3AG4H 3S15J 1MBEA 3HBLA 5FO5A 4BYYA 1XMQJ 5C5JA 3J7AN 3VGSA 1TK8A 3KP3A 1ITYA 2MPUA 3V6DB 3W63A 2XO6A 5DGAA 4ANJA 3ZO7A 2ZJ2A 3RBEA 3DLAA 1JKOC 3EZOA 4XICA 2HSEB 2HBQB 5B0DA 2F7VA 4YB7A 2J9DA 1C0TB 5KT7A 2CO5A 2KYZA 3QFWA 4LFBJ 2D69A 4ECTA 3E97A 1TAUA 4CZZA 4IO1A 1IV8A 2BYVE 4WP3A 3MM8A 5A0YA 4YIRX 5D3GA 3FXKA 3WU1B 3F8BA 5D8HB 2UXDF 2IW5A 1XK8A 1HQUA 3NNCA 2XDVA 1IAWA 2XMTA 4ECQA 3A8IA 4BAYA 4UB8C 1X5PA 3BGRA 1Z1DA 2JVHA 3W9JA 1YGYA 4QPOA 2JA8J 4MYTA 3K4LA 4CCMA 4XK4A 1VGYA 2CQHA 2MC3A 4KQZA 3BC8A 3ZN1A 3OTDA 4N8NA 4XMYA 3OTBA 1VBZA 2F5FA 3IBCB 3LP0B 4LF1A 3MKZA 3T9ZA 2L4MA 3BG3A 3ZXWA 1FBQA 3LF0A 1RHMB 2PMZN 1JB0C 4EMSA 3IC7A 4ENOA 2O6GE 4XR6A 3DTEA 4M6VA 4JYAJ 4J9LA 2HOSA 2XHWA 1AT1B 3G9CA 2L01A 4XONA 3GZ5A 5FD6A 1U02A 2DA5A 1AXQA 2LU2A 5B0FA 4C9YA 1U8RA 3PHEA 4LT6A 4X62F 1U3EM 1G6NA 2IGNA 5H9EK 2LA6A 3PHTA 2K9MA 3HHGA 1YBAA 4DFMA 4D1QA 2EV5A 3HUGA 3CC7I 5GP9A 5AXKA 5A0YB 2BE2A 2G7HA 1R8CA 1EJ7L 4IQXA 3LGHA 1SXLA 2CW7A 5AIPA 3BJOA 4NL5A 3LA3A 2R7FA 5GADJ 4ON0A 5AXLA 3MCSA 1HF0A 4ETZA 1LK5A 2JC1A 1KOHA 2MHEA 4A3BJ 3HSJA 5LM7E 1J2VA 2F9DA 4DQRA 2FJBB 4R8HA 4DL0C 1N77A 3CTRA 2FMYA 1HNIA 2GJ2A 2LBFB 1S99A 3IM8A 2UZAA 4B48A 4FETA 4LRDA 4D0PA 1VFJA 2CAJA 1TKTA 4HH0A 2V6CA 4ES3A 1KN6A 4KKOA 3REOA 5ETNA 1G59A 1WI8A 3IGNA 3H0GJ 3QO9B 3M8PB 2IMOA 1K73T 5F9NA 3CMYA 1APLC 4Q44A 4HACB 4B3MF 5AJ3J 3QPLA 1Y1WJ 3TEGA 1HHTP 2KDZA 3ZTRA 3RPUD 1W26A 1E0EA 2DYRH 2B4VA 3ILIA 2GO9A 2PGCA 2KN4A 1SJ3P 3MMJA 1IBLJ 1CEZA 1PAEX 2VJVA 4BDYA 1QVFR 4O3SA 1OYEA 4FISA 5M2PA 1VBKA 1RETA 4V19J 1JLQB 3MTJA 1E6VA 5E3CA 2AZ3A 4C97A 2Z9OA 5CHCB 1Q95G 4J90A 4KY3A 3NGRA 3H36A 3ECHA 4AU7A 1U2FA 2EZLA 1O3QA 4RW7A 4EEFG 2EBIA 2HQCA 1RJJA 3HT3A 2OCCH 4AQYF 3OQ2A 3KJFB 1FKOB 5D0EA 2VG5A 4ZK7M 3CC7S 4QTRA 2PEHA 1URNA 2R92J 3HO1A 3EETA 1LQ9A 2QSGX 5E1XA 2QT7A 1C1CB 5CVVA 1C2PA 1N56A 4ZIVA 3P5TL 2FGOA 3CJTA 2KTQA 2AGOA 4XKCA 2FVQA 1K0VA 1M1HA 2OEMA 1SD6A 4NYPA 4N5SA 4J9PA 1F1ZA 4OQJA 2CA9A 2E7XA 4PQUA 2ETHA 3K7AJ 4ZCLA 2B4OA 2VQLA 3K4CA 3TP0A 5D15A 1ETXA 3ELHA 4HKQA 3G2BA 4BQNA 1GHCA 2IA0A 3K70D 1B9MA 4P1WA 2DPJA 3WC2A 5C25A 5DS9A 4RWXA 1D8JA 1Z21A 2PMUA 1XGMA 2GOXB 2C2ZB 1X4EA 5L1KA 1TFWA 2E35A 1Q7YT 5D4OA 5DCFA 3LQRA 1RU1A 3BZKA 4L73A 2X6WA 3AT1B 4ZHRA 4RW7B 3BZQA 2OSRA 1QD1A 5G0RB 3C19A 3DXSX 3DOKA 2V67A 4HT7A 1TWCJ 4M9SA 1F9HA 3FXUA 4K59A 4ELUA 1UB9A 1XSXA 3UD4P 5ICEA 4G1PA 1PIEA 2VC1A 3T1YJ 3OYAA 5JJBA 1UZCA 1MMSA 1IKWB 1KQ8A 2VC0A 4DF4A 3FM5A 2BOAA 2G0JA 2WOMB 1DQ9A 1JNRB 4FBTA 1PCAA 2CJ9A 1MNMC 1TWAJ 3MCNA 1FNMA 2H1LA 5I4MA 3PM1A 3TAMB 5IOLA 1ROFA 3FZBA 1VQPS 4DR6F 3DC2A 3HD2A 4FS2A 3GXOA 1BI3A 1BL0A 3MXHP 5T41A 2C3YA 2WCXA 5HBMA 3C18A 4IOCF 3GR0A 1RB0A 3WTWC 3H59A 5FIIA 1MBFA 1HQEB 1SIWB 4OI2A 4TNOA 3H5RA 4CO4A 5F8NA 3LP1B 3TYTA 3HLUA 2YNIA 2QLFB 1Y8RB 4ZPTR 1Z3XA 4OYOA 2XVCA 3QWPA 3DHXA 1ULYA 4JI7F 3IRXB 2XSJA 2QEXI 1Y0HA 3TDZC 4F4KA 3I4PA 4LITA 3H90A 1JT0A 3PDNA 1S7OA 3D5MA 3BYPA 4AL5A 3SYZA 1RT7B 2HIYA 1HI0P 3HULA 3H5SA 4CXFA 4PEOA 4YFNF 2MQNA 2Y1LB 1FESA 1BC6A 2WWYA 2BY2A 1A6LA 5KHDA 3HZGA 2CH0A 4EYIB 2Y0SA 1HCRA 3OOPA 1XBWA 2HGMA 1GK8A 5FDLB 1YJWS 3PO5A 2QSFX 2A05A 1ZG3A 5KFYA 3QT7A 3QRRA 1K44A 2MY8A 2ZJRF 4NASA 4X4PA 2E29A 4F0KA 3GTGJ 5GADU 1YX5A 2HZVA 2HVZA 7FDRA 3FMRA 1KQGB 2CWXA 3GBGA 1SJRA 2JVRA 4ITSA 3GLLA 4KIAA 2JVGA 1GXLA 4II3A 3TO7A 2VOPA 1CVJA 2CPJA 1QSSA 2W24A 4N41A 1X3ZB 5E8GA 4UB6C 3FQLA 4LF8F 4B08A 4LOCA 1ZKGA 3P4UB 1WVRA 3KP6A 1N5TA 1BR4A 5DG8A 1Y7PA 3JSBA 3K17A 2BJ9A 3ONQA 4XIDA 3DM2B 1YRTA 2UXBJ 1WTBA 3IRXA 4A4JA 2R2TA 2E5ZA 3LMMA 2Z0GA 1GV5A 5M3FJ 1S9FA 1OIAA 4R5PA 2LYVA 4OZLA 3DKDA 2KMUA 5TJJA 4PFOA 3LSIA 1FRKA 5F08A 2PLYA 2PO4A 2AD9A 2BV6A 3D7SB 4RB0A 1SB6A 1CGPA 2PG4A 3CT9A 1PYSB 3DLLQ 4AIKA 2VG6B 3U1NA 2E71A 5BYQA 2XRLA 5K5QA 2EKYA 3ZZYA 3EVWA 5HS7A 1IN8A 5B0CA 2X9DA 1FEXA 1OPZA 2KHMA 3UW1A 4PXDA 1OSDA 5ETRA 1N48A 1EKSA 3KJVB 1AFIA 4RB1A 4GYIA 2E2JJ 2WOMA 3N4WA 2HR3A 4WWCA 1ON1A 3CDEA 5F6FA 3HFKA 1X4DA 1I6JA 5K7ZA 2DNMA 3RR7A 2C2MB 4LB6B 3D67A 1FC3A 3LSTA 2RILA 1FNOA 1KQ9A 2ZVIA 2M3AA 3L2VA 3DPTA 4M9ZA 3H9QA 2EZKA 1JJ4A 3P9CA 4USWA 4J9OA 4C9DA 4U8YA 1YSJA 2JOQA 3I5AA 3KMQA 3JRFA 2W9CA 2CQPA 2CQIA 3FCWA 4OIXA 1P6TA 1U2RA 1NM2A 1B7FA 2OI2A 1N52B 1REVB 3IA0A 2QA1A 3D4JA 1A04A 4HI2A 4QSHA 3CTAA 2WSFC 3EXCX 2EVZA 3SDGA 1VC6A 4C3IJ 4DFKA 1A9NB 1IKVA 1UA0A 2M8HA 1TVRA 4AXIA 4B3RF 2C3OA 1EQ0A 1S7HA 4UV8A 3AD9C 2MKYA 1R71A 1DLOA 2IJFA 1WHUA 1V3RA 1S1VB 3E6CC 4IRIA 4XOPA 2GA7A 2PMWA 5I42A 1U1PA 2GHWA 2KJVA 1V54H 4AUXA 1YQAA 6FD1A 2JSPA 2BY1A 3FK4A 1C1BA 5K5RA 1XGSA 1CQNA 2CRGA 4OIQF 5J1NA 2IM3A 2D74B 2AJ4A 5EWFA 1XG1A 3G6VA 2NXUA 3RGIA 1D5YA 2P2CB 3K8VA 4C48A 5F1RA 4OYXA 2MZRA 3K5OA 2BQUA 2VJIA 3H35A 4CLKA 2WONB 1MBKA 2KHDA 3LOCA 4MIBA 4X0GA 2LEAA 1FFGB 2UZKA 1BR2A 4WFNQ 2MKHA 3RDIA 2M9KA 4NLQA 3CUOA 1BQNB 1E3HA 2BOPA 3KZIC 5HNHA 4AXJA 1Z2ZA 1Q1HA 4A3FJ 2EFOA 1YITI 1SL0A 1JUMA 4IO9Q 2H8RA 5IP9J 1UP1A 1FX4A 2Y1RI 3I53A 4A8XA 2AKWB 2Z99A 3M8QB 2NAZA 1UHSA 1JHFA 5FKOA 2KL8A 2E2HJ 2B3TB 2H94A 3NGUA 4B3MJ 3VZIA 1EX8A 2XAGA 4X6AJ 1HA1A 1LWCB 3BCBA 3O5TB 1XQIA 4EVIA 2JMWA 1NK4A 2IJRA 3MWMA 4S0MA 4P71A 1BHNA 5M5YJ 2E1MC 1RHRB 3K59A 1WDTA 3S1TA 5DRKA 3PQKA 2VQEF 4UQTA 4O4GA 3TP2A 4LBPA 4ZN1A 1C0UB 1NJYA 4ZA1A 1M5OC 5L3DA 4USUA 2HQNA 4J19A 3DN9A 4ZITA 1RLCL 3RG6A 4IH7A 1W7PB 2KZGA 3MM8B 4NZ0A 2RU3A 3LNQA 3VVTA 4DJBA 5C4JJ 5L46A 4LMYA 3QRFF 4CUGA 2AXLA 3C8YA 2X1BA 4OLPA 1FDNA 4OI4A 2IRUA 3AAWB 2UXDJ 1KYWA 2ZJQF 4ZCIA 4U6PA 2YX7A 3QT6A 1A7GE 1RK8A 3FFIA 4NUBA 3ZZUA 1VQOS 1O8BA 4J9VA 1FT8A 4JYAF 3D0HE 2FBIA 1Q1VA 4J9SA 2P9EA 5FLXY 3DRPB 1IJWC 5LXRA 4E7KA 3TAMA 4NI2A 4CI0B 2Z2LA 4J01A 4K8RA 4X4UA 4JX6A 1ZR4A 2HHXA 2YKNA 2K02A 1UWBB 2V1DA 2DMTA 2POKA 4NHJA 2JC0A 8AT1B 5FFZA 3MM6B 3P5BP 3D1HA 4ANEA 2KXNB 5DUIA 3BR2A 3MZYA 4DQPA 4L9JA 3FKJA 4NLDA 2V8HA 1FJEB 3HHDA 3CCVS 2C2RA 3LP1A 1S6OA 4DG1A 4MK8A 1RUSA 4BGDA 1D0YA 4L0YB 2WTFA 1V3SA 2CV0A 4ZYAA 3MMAA 1GUUA 2A6TA 1J5OB 3JSRA 5L9NA 4WX9A 4KTQA 1KS2A 1JMTA 2IRYA 3A02A 3HRSA 4O0NA 5HAOA 2OAUA 2BUNA 2V9WA 2F4IA 5KFMA 4A8OA 3LSMA 1H9TA 2YUSA 5EDWA 3TZYA 4I7FA 4L72B 4FVCA 2ME6A 2CQBA 2HDWA 1FRLA 2KB2A 4TYAA 2EI5A 2JPCA 3G1MA 1AKHA 2WBMA 1GT8A 3TAQA 4K0KJ 2ZZMA 2CQ1A 3CJQB 3RRGA 5DG9A 3ABLH 1KFDA 2DHAA 2ZC3A 5L39A 3R6GB 1N88A 3O6BB 2FUG9 5D0RA 3RRHA 2F4VJ 5J4VA 2M0CA 4LD5A 1ICEB 2DOEA 3I3LA 3T1HJ 1HBNA 4IPAA 2VG7B 3I0SA 2R5ZB 1JKHA 3OR2A 2A10A 5J40A 3I32A 1IRGA 1FD8A 1R0BG 2VONA 5KFLA 2ZXHA 4HEA9 4K0KF 2ZKTA 4KGXB 3V8KA 4RLFA 2JNJA 4CO3A 2DFEA 1U1RA 1U0HA 4WZQA 3GR1A 3QAEA 2JDJA 3VQTA 4IG0B 3U27A 3LGMA 5AXNA 4RGUA 4KIBA 3T6BA 1FOWA 2VQCA 1IBCB 4GO5X 4NWBA 5A8KA 1SVLA 1OFCX 4UF4A 2XGQA 1R4NB 3WU0A 4A2UA 2VG6A 5GMKa 1KKHA 1K9MT 3WGHA 4CLWA 5I3PA 3M8WA 2C6YA 5EEGA 3ML6A 1Y5NB 4FF3A 3CNQP 2AX0A 1LNWA 3KJVA 4BE2A 4NPOA 3UDEA 2X51A 5H9FJ 1F43A 3I0TA 4NCBA 3M07A 5BNGA 3R8YA 2OPRB 2MZTA 3CJ3A 3NEUA 5D6FA 5IWAF 2L54A 4WE1B 4MEXF 2RNEA 3FHZA 3CMAS 2HQFA 4KN4X 4I6WA 1WSVA 3T3FA 5FJ8J 2A6EF 4CH7A 3B6CA 2DEIA 1KTQA 1NSKL 5K1YA 1IRZA 3TAPA 1FOKA 3ET6B 5KFCA 2DU9A 3KHRA 4ECVA 5FRNA 2F5VA 5AJ3F 4ECZA 1XNRF 3SZ2A 4R25A 5DS7A 2QMXA 4A3LJ 2LKXA 2Y48A 1WHXA 3EYYA 4DV1F 2Y9HA 5C42A 3F8FA 1WKJA 3FBFA 2FZGB 1TWFJ 3N79A 2X48A 1XD7A 3MM5A 3FMBA 1IDZA 1ETOA 4N56A 3FBEA 1IBKF 2FJDB 5CLSA 4MKYA 2Z2ZA 1I6HJ 3ZQCA 4AUKA 3MM7A 1XMAA 1RAIB 1QAJA 1VMBA 1Z67A 5CPRB 1R8BA 3C15A 3CDBA 2FVSA 2QM3A 1IXSB 1MKMA 2ZSHB 2QKMB 2HS0A 2J5PA 2FBKA 4WIIA 1LWXA 2UU9J 3BR1A 2DYAA 2DMPA 1DPUA 4WYWA 3KHGA 2RQPA 4ICLA 2DA1A 3H2UB 2AQ4A 2VLAA 4BWMA 1REPC 5HBMB 1J5EF 3V4MA 3KLNA 5BQTA 4CYCB 3KP7A 4DUYF 1X5TA 3BR8A 2WAQA 5KG5A 3SEQA 2MKIA 5FKLA 4Y2MA 1VFCA 1XDUA 4HL9A 3TNVA 2FNPA 4KB7A 4C8LA 2KYXA 2QN6B 1X9MA 4K4WA 4L75A 3DOLB 2NUUG 1OLTA 3TJAA 1EF4A 4ED3A 3H0DA 2KPMA 4NRUA 2LXFA 1GH8A 2VQEJ 2K7JA 1RAHB 3TQNA 3PNYA 5HDNA 2NOJB 2X1CA 2Y0MA 4HT5A 2DEJA 3RB6A 3MMYB 1F6TA 1D0ZA 2MQOA 4G7HF 1JXEA 2H4YB 3R0AA 3J80U 2NXJA 3SV4A 2E44A 1LFWA 4ID5B 1UWAA 1FMVA 5LEKA 5ILUA 1C1CA 4U0YA 4JI1F 3DDIA 4BQAA 4UHTA 2EJRA 3DTIA 4K7QA 4EQQA 1BM9A 1CQTA 4ZJOA 1N36J 4OI0A 3AJDA 4A5NA 1N5YA 3LL7A 4IQJA 3IV5A 1UEKA 4ENJA 3FJ2A 1QPMA 1R6YA 3DBLB 1UFLA 3AQOA 3LSRA 2X3GA 2J6TA 1B99A 4XKWA 3I0SB 2DNNA 1S4FA 3A3NB 2FZCB 2PE8A 3G8TA 1T3OA 3D6HB 1IQZA 3HOXJ 4H4OA 1U0JA 2DITA 1X7VA 3RKXA 4URGA 3FXMA 3J7Z5 1N25A 5LJ3Y 3RBXA 3DBHB 5DQIA 2EC0A 1JLFB 1LVKA 1ZA1B 4K4XA 2NVXJ 2DCEA 1S57A 2XO7A 1ERDA 4LSZB 4CLPA 4G3IA 1KQSR 3WGIA 3JSMA 5E3NA 4BS9A 4USMA 4BEHB 4YQWA 2BVMA 3KLVA 2K3IA 4M5IA 3OR1C 3H42A 3ILLA 4YIFA 5B7WA 4LSLA 1IDYA 2BGCA 3HK2A 3A0HC 1XPXA 3MAAB 2JJ7A 3VFZA 5E33A 4C3MA 1R5HA 4DCOB 5RUBA 1GTHA 2OPPB 2HHUA 3MPYA 2M1BA 1REVA 4E98A 1J7KA 2HAFA 4LQ3A 4QIVA 1IXRC 1MWYA 4OZ3A 2HS3A 3A01B 4IHWA 3H4DA 4ED2A 3CCVI 4K4UA 2OBPA 2CNKB 1G1XA 4RW6B 2BE9B 3PIPF 1RTIB 2AEFA 4RU9A 4WBFA 2WVEA 2PBIA 2UWMA 3R97A 3R6LB 3HDDA 2NR0A 5KFKA 4C8MA 2PD1A 2X3DA 1PGZA 4MKAA 4A12A 1VQ7S 3NWGA 1H0MA 2AMCB 1WD6A 1RKTA 4M9XA 2V2VA 4ZVRB 5ICGA 2YTCA 5GPAA 2NXEA 4ZYDA 3EXYA 5KVRA 3CCLI 1TUVA 2KRFA 4GGGA 4WFZA 1HNVA 5IM0B 3MZ8A 3HHEA 4FNHA 2CDRB 1S1XB 4BBSJ 3MM7B 5GPCA 1RAAB 4G1IA 4NMLA 4A3EJ 2FOWA 3IAM9 3NMRA 1H2VZ 2GJIA 4GDFA 1U6ZA 1OSCA 3M7VA 5J1UA 3JSOA 1RU2A 1S48A 2BW2A 4I2PA 2W2MP 2IS1A 1HNIB 2YKMB 2IJNA 4PXEA 3K58A 4DS5A 1GNKA 5FDLA 3GTJJ 5E41A 3BLYA 2XASA 3KFWX 1VRTB 4EJWA 2NS1B 4CDIA 5EWEA 1TL1A 2RNJA 3K57A 3QP6A 3KP4A 2XYGB 3ESWB 3UDVA 3S01A 1YJWI 4DR1J 4IOAQ 4ETXA 3LALA 5CAAA 3BQ1A 5DUKA 2R7SA 1M5PC 3ABUA 3UWTA 5EX3A 3BTIA 2ZD1B 2RKIB 4IF4A 3T41A 2XIGA 2IGKA 2IMWP 7AT1B 4LF5J 1NZ8A 1FF2A 3E7LA 4C3HJ 5EWGA 3R5JB 4LFAF 2HQ5A 2IC3A 5LSOA 2KKOA 1NDPA 3Q8VA 3M6WA 1EA3A 1NK2P 1RBOB 1NLKL 1F5BA 1VCTA 4P74A 4PAAA 3VWBA 5C42B 4A8FA 3BJAA 4MTEA 1SV5B 4IRDA 2BR0A 5TRDA 1I1GA 4NOHA 2Q2EA 1NH8A 1UZHA 3AH6A 4UVAA 1TL8A 4KBIA 3VYTB 1MSFC 5DDQC 1BQXA 2BBEA 3FZ2A 4DV5J 5KFQA 5J47A 3M2RB 3C15B 1WNEA 4I0AA 3QGIA 4ZDOA 5EGOB 1WF0A 4DV1J 3K8WA 4QW8A 2OF7A 4ECYA 1OCRH 4O4RA 3CVKA 4LJZF 3PFOA 1WJEA 2BEOA 1ZAVA 3UE2A 2ZKUA 5K8NA 1SJFA 3HL2A 2V79A 2N4DA 3A2KA 1MG7A 4OZ5A 1O4XA 1W7PD 8ATCB 5J2QA 3IO1A 2HQIA 2N7CA 4ED4A 2IM1A 1FJGJ 3O6QA 2B4UA 4F3OA 1B6AA 3ENAA 1O0PA 4UY8I 5IM0A 3N97A 3DRPA 2KH9A 3RQIA 1RTJA 2V9VA 5KFSA 1YHQI 3TW0A 3AOCA 3C2HA 3QPTA 1YZ6A 1E17A 4ZIWA 4K4SA 2H4WB 4PUOA 2IIHA 3FF5A 1WC0A 2PMZA 1JI8A 4P2FA 3UDLA 1FP1D 2OTJI 1X3UA 5GAEI 2PIIA 4FASD 3J81Y 3BJ6A 5DD4A 4EBCA 1R1UA 1SVMA 3WIVA 4ZN3A 3CCJI 2ZJPF 2DCUB 4ZPDA 3DKWA 3CDHA 3TVKA 4ZP7A 3V2UC 2OIHA 2OPSA 1UPMB 1YG0A 2NXNA 4JX5A 1JLCA 4X64J 4IUFA 3F56A 2K85A 2C3MA 4FHTA 2VDIA 1OCOH 2DR7A 1OQYA 3CDIA 1JJ2R 4C3LA 3GTKJ 4PXBA 2ZDPA 4BY1J 2DFFA 5F1JA 1UVIA 1J5YA 2XS7A 4YEJA 3MKLA 2K4BA 2PMHA 1XMOF 3H25A 2WVBA 1NSAA 2DAOA 3M8YA 4Q45A 4L3KA 3CUQC 4RW8A 2HFHA 1QZEA 1PYOB 3RR8A 3A12A 1N5QA 1HMVB 1YJ7A 3AB4B 2FHJD 3SQGB 4YY3F 5HK4A 1N5YB 1MMLA 4E0DA 1RTJB 1RAEB 2NPFA 5LD2C 4M3BA 1J9IA 1D1CA 3FISA 3GZNB 2FLOA 4K5RA 3BZ6A 2HKEA 4PCQA 3A8EA 1FRXA 2COBA 4PUOB 2CV2A 2VIXA 2XF6A 2HVSA 1B3TA 2R0QC 2OJ3A 9RUBA 4L5JA 2EK5A 3FX3A 3CD6S 4MMOA 4AQYJ 4RUCA 1LFPA 2BXYA 4EZ6A 3GZ6A 1MSEC 1U0HB 4XO0A 4LIUA 3T8TA 2CPIA 4CH0S 2X4HA 5CYVA 1QUPA 2DNRA 1U6FA 2RDJA 2VT3A 1RT4A 4OX8A 1E6YB 2B56A 2RVCA 4I1TA 5ETVA 3OSPA 1FI4A 5DDPC 4PYAA 1S1WB 2K5CA 5A8RA 2OJED 3KWMA 3OXGA 2IA1A 1YJRA 4XN0A 3OIPA 4JK1X 1HW9A 1IBLF 3OYDA 1Y10A 1UHMA 1BXNA 1TNSA 3M1CA 2BQRA 4B3OB 1WHWA 2RAEA 2I6WA 1S76D 1BE4A 1Y11A 2BKOA 3KXDA 1N4LA 3A1YA 5JHUA 2VODA 2F48A 5KK1A 1OYYA 5LMUJ 3BPXA 3K5PA 3SDEA 3RRKA 2XGCA 1LPQA 3CC4S 2B63J 4R0JA 5KG1A 2P6SA 2ZMEA 3ZMZA 2QL7B 4L5EA 4YDXA 3W2WA 2E1AA 2KU7A 2PDAA 3WBZA 4DOZA 3RB4A 4OU0A 4IFVB 4N0BA 4DEZA 1YI2I 1F4KA 3W8GA 1YJNS 4B8XA 2BOLA 4JUZA 1KP6A 2QJ3A 3S17J 1M0SA 5BJRA 2KIQA 2E7WA 3L9ZA 3BQYA 1H9GA 1KR4A 4EZ9A 1VTNC 2WV0A 5C25B 3FQKA 1D9FA 3QAHA 2XGEA 1PYVA 1QVGR 4I2QB 1T03A 2FLNA 1JUSA 3Q0WA 4N76A 3TEHB 3HTSB 2GVDA 5F0UA 4ZPBA 2KLOA 1IBMJ 4RW4B 3RAQA 4MGRA 1BWEA 1UFMA 3FMWA 1VI0A 4OIOF 3JQKA 3TA2A 3CCUI 4TQRA 2A68F 2UV8A 1IKYB 5L1LA 5KFZA 3N5FA 2JLFA 1U9NA 1WI3A 4KE5A 3IG1B 3CJKB 1RR7A 3FSYA 4WTYA 4IHSA 2ZOGA 1U4BA 3ZQLA 5CZXA 2V1UA 4U67Q 4I7FB 2ELHA 4Q4ZF 1S9GB 1Y39A 4RL1A 3CUNA 1NHUA 3CDUA 1VQ9S 3TW7A 4A3CJ 3JAMY 5KNLA 2UUBF 3JS9A 3OFEA 2DBBA 3B73A 1WHYA 4LLGF 2Z57B 2RF2B 2Q0OA 1X4AA 1FKPB 4TY9A 3HX9A 4BC9A 2AJ0A 4F3MA 1QTNB 2FJAB 4DNCA 1E2XA 1IUJA 2R7TA 1WTFA 1ZYRF 3JTNA 2HK3A 4DUYJ 4CGZA 1CSJA 1DLOB 2E7VA 4MIMA 5F0FA 2M0GB 1EJ9A 4LF6J 1CS4A 1SFKA 1S1UB 4MO7A 3BN4A 1D09B 4FE4A 1HC8A 4BHBA 3P8BB 3MCOA 3LSHA 1S79A 5ITHA 2DO7A 4NLWA 1ETYA 3DRXA 2ADBA 2VJ4A 2HPMA 1RT2B 2D3ZA 3GIJA 3G82B 2G13A 4KDPA 5HS9A 3OTCA 2BY0A 3GTMJ 2G0EA 1IF1A 5K5OA 3H1CA 4F4WA 2QV6A 3A8JA 4J37A 1TMJA 2UV1A 2UP1A 2DOFA 2V7FA 2ID6A 3M2UA 3JRGA 4YN3B 1U48A 3BZCA 4EM1A 1DJ0A 1XNRJ 3ZZOA 4ENNA 4KYWA 1Q5YA 3EZ5A 5J2QB 4ECWA 5CH7B 1ZPWX 4XLHA 2XY6A 1W5SA 2K3KA 2HBRB 2ZJQQ 4XRSG 1TL3B 5EGOA 3UQSA 2I8DA 3WG9A 3SFIA 2FJEB 1HW8A 3MF5A 1OQ3A 1WPKA 4HSRA 3M4OJ 4LSLB 1UW9A 3HFZB 2YKPA 5F3ZA 4HRIA 1ZGJA 1YBTA 2ROPA 4I64A 4MEYF 2F9JA 2VPZB 1YI2S 4GYGA 1IBMF 4U87A 4YDDB 3OXFA 1CULA 3R1LA 3C2BA 2CIMA 2F1FA 4KV8B 1XN9A 1XNQJ 2M34A 2QC3A 2IFXA 1X31C 5JVGQ 2AZ1A 3M8JA 3GJQB 2ZWOA 3BO2A 3KUHA 2DOAA 4LK1F 5KFGA 4PABA 4DSIA 4KHPJ 1HNZF 3Q0VA 1WKLA 1PG5B 3GFHA 3FUYA 4CCJA 4LK0F 3JRIA 2VN2A 1P9YA 1UW4A 2AF6A 4HAMA 4YFKF 3BM7A 2DDAA 3ISND 1HI8A 2W4SA 2WB1D 4DZPA 2DNQA 3I54A 4ILLA 2H1KA 2LVSA 1UETA 3EX7B 2O0YA 3IWFA 4MQVA 2DRAA 3G6XA 3QQAA 4PGHA 2FLLA 3BTCA 3F0NA 4Y0FA 1Z0XA 3QWLA 4ZP9A 4LF9J 3HOVJ 5D4PA 3V81A 4LBHA 2B8PA 1VNDA 1LOUA 2LQ9A 2RDIA 2CUZA 3ABMH 4RGXA 4NLVA 1FBUA 3EUHA 4CYCA 3BGUA 3JTOA 5HDKA 4ZS6A 4NDLA 2D5VA 2PI4A 5BR8J 3NLCA 5FLVA 4R1HA 3K6GA 3HP6A 1SC7A 2CQ2A 2VFSA 1ZZNA 2HVEA 3FBBA 2RRAA 4P75A 4QWDA 1L5UA 3HKZN 2A5WA 1LEOA 3T5KA 4F02A 4CSWA 4ZVEA 4UVCA 3S3MA 2ZBRA 3CSKA 4DV5F 3FK6A 4KICA 3BBCA 1JLAB 4PJNA 4NLPA 3ZP5A 5IXUA 2E34A 5GTIC 5A8RB 1HHSA 2RQQA 3M30B 4FQGA 5KOXA 4GC6A 1XMXA 3O8WA 4HX8A 1MN9A 4PR6A 5M5XJ 3HRMA 1QZYA 1K1QA 1P8GA 3W3CA 1ZRDA 2Z8QA 4KC5A 4PG5A 2YKMA 1H3DA 2ECBA 2KFZA 3SFZA 4LJMA 3K7RA 2WBRA 5KFHA 4RW9B 1PVEA 4D9JA 3KIOA 3TO8A 4OAYA 1H2UX 2JA2A 1H2TZ 1WSRA 2KVIA 2WONA 1YRUA 4Y2KA 2IP2A 5LSLA 2XYHB 2XZDB 1E6YA 3GSIA 3SQOP 3WX8A 1HARA 4C6AA 3S32A 5F8GA 2A1BA 5DZ6A 4HOBA 3ETMA 3W3SA 2AJQA 1EB0A 4DN9A 1UG0A 5F41A 4NEZA 5J2NB 1HYSA 1R0CB 4AD6A 2HLTA 3UNYA 4HDGA 1JXVA 2QUFA 1KWMA 2IS4A 2AT1B 4ID8A 2HYGD 1NK3P 2JVOA 1CPZA 2HU9A 1JKRC 5L3BA 1YFHA 1RHQB 3FEYB 1U2WA 3MUMP 1E6VB 2R8IA 1FTZA 2BJDA 1HW1A 3RQ4A 2HQRA 1W7PA 2F5CA 2MKCA 3C6UA 2F8EX 3EWGA 5J2PB 1T02A 2DT7B 1GTEA 1WG1A 3ILOA 2ZCWA 4OZ2A 2KO1A 1CJTA 2M0MA 1RKJA 5D5XB 1HNWF 3VYSB 4ZVUB 1RLDA 2RU9A 4LF8J 4L18B 2HFSA 5LMNF 1I1SA 3IGVA 4P96A 1ZLKA 4NC7A 1WJFA 3G87A 4ZYEA 4NE9C 1NU4A 1CJKA 3JB9k 4FX4A 3OYGA 2GVDB 5EUHA 2L5QA 3I5BA 4YFUA 3DQVC 1JNZB 2QL9B 4IQMA 1SMTA 5C44J 2IAJA 2ZFWA 3OFHA 1U5TC 4EJOA 1IM4A 4P2SA 3WHCA 3P6YC 4RR5A 1FWPA 4CLZA 3PL8A 2BANB 1LFUP 3C3LA 2XNQA 1DUXC 4HVZA 2Q6BA 2LRDA 4X62J 4QBUA 1FX7A 2WADA 1LWEB 3PO3J 4I4BA 4ED6A 2DIVA 2V4RA 2LFBA 3EUNA 4X1EA 5LGTA 3D54A 5KFWA 2ELJA 2MW8A 2ME0A 3I31A 2MXYA 1SV5A 2QGFB 4B3AA 2NXNB 3NRVA 3DDNA 3MAHA 3HB9A 4DPUA 1JXSA 2X7IA 4HYEA 3IKTA 5DLFA 2ZJPQ 2F4OB 1S9EB 2PJRA 2J6SA 1C4AA 4AVPA 1T0TV 2E1NA 4JI8F 3EDPA 2IDEA 3UN2A 3OL9A 3C7JA 1T2KA 3OL4A 2HTSA 3CJQA 4BJ5C 4A3MJ 1R31A 4G8XA 2H6BA 1OY6A 1AKHB 2NNNA 3MAQA 4E6KG 1X1CA 3FEZA 3W9IA 2QQAA 3WC0A 3BKFA 2K3FA 2W9AA 4XLNF 5GAHI 5L1JA 2I2YA 3EPGA 3DLKA 2Y9ZA 1S9HA 5FROA 3IN5A 2EXUA 1RTDB 3D28A 4HV5A 1TKZA 2DK5A 3J81j 2DLLA 1FY7A 2CJBA 3F23A 2KKHA 2DGWA 3QZ8A 3BKTA 1QE1A 1Q86T 3KYCB 2K9SA 3W6KB 2OELA 3DKXA 5LGNA 1V55H 4F0MA 1KU7A 2C2EA 4HH1A 1SKRA 2WC2A 1FKOA 3THPA 3D5SC 2FHOB 3Q8QB 2IXSA 4RA2A 4CLYA 4WU3A 4LQ9A 3KG1A 4CT9A 4MKVA 2MMYA 1G8XA 4PSWA 2GQ2A 3J80K 3AG1H 2TCTA 1FTRA 4Q0BB 1RT6A 3RSNA 4ZVHA 4DMZA 2YPRA 4LF4F 4QWAA 2E9TA 2VPRA 2AYBA 2FQ3A 5D4RA 2UU9F 5CZVA 2HEKA 5C24B 3QSIA 5HQ8A 2KXHA 4CO8A 3QAUA 2RDPA 2ZHOA 4FYWB 3UO0A 3J7YU 4ZZDA 5L3FA 4MIWA 3QYBA 2Q79A 1RXOB 4J9MA 4DV7F 5U47A 3VAMA 2DA2A 3RJMB 1RZMA 4LR7A 1SAUA 1W4MA 3ZQHA 2YWGA 3Q23A 3HC7A 1F9FA 2HNHA 3CW2C 4XQFA 3PJXA 4DV3F 4UOCA 1W36C 1P6RA 2D45A 1VBXA 5KFNA 4WFBQ 4M72A 1R0AA 2C2KB 4OJGA 2LQ8A 3LSJA 2LQ5A 5KFIA 1VLYA 2ROGA 3H9JA 3MEGA 4NXNJ 3I56S 2W9BB 2C3PA 4QIWD 1G3SA 4ZYGA 1G6BA 3ULQB 1T03B 4P2XA 1IWAA 1LW2A 2AGPA 2F5GA 3I9ZA 3TI0A 3V5RA 1MDMA 3H5AA 4IYQA 1VRQC 2UXCJ 3MFIA 5E20A 2L41A 3LAJA 4XLPF 2R5YA 2HDCA 1MBJA 2J7KA 5HDGA 2HHWA 1F36A 1KD1T 1FXLA 4X84A 1NHVA 2XS5A 4C0BA 2DHHA 3PYEA 1WJDA 4EATA 3P9KA 3F8NA 2VKEA 5IP7J 1YITS 3DXJF 1UJ5A 4XPEA 3WQPA 4I2QA 2W01A 2IBDA 4QR0A 2B43A 3A1YG 3SSQA 3Q3SA 5BPDA 4B9MA 3BTLA 2NZCA 1Z2LA 2YWEA 2HEOA 4HTIA 1GV2A 5HS8A 3GIRA 3JAMU 3J7YI 4ES2A 1RYRA 2BXJA 2E5GA 7FD1A 5J1YA 2OTLS 2A5YB 2WVCA 1GAOA 4Z6YA 1WWHA 1D5VA 5IC4B 2KG0A 3ZMTA 1R7JA 4D5CA 2CDQA 2QQ8A 5HLIA 4IKFA 4Y4RA 4RLQA 3G8QA 2DO4A 3IR7B 5BS6A 1ZHFA 1RTHA 3AHPA 5IYCJ 1UEVA 3DFEA 4W4MA 3NKYA 4DL3A 1XMQF 1TKDA 3QYEA 2NYXA 2JEIA 2L48A 1CS4B 2DNYA 1IKVB 3GLJA 4KGVB 1TVRB 2HKXA 3GWZA 1CG2A 5IWAJ 4DX8H 1SVDA 4PWUA 5E1WA 5DG7A 2G0CA 4O44B 4FKXA 3CCYA 1H89C 4CNYA 3KLGB 1HBOA 2GS8A 3M8ZA 4WP8A 4DV0F 3US5A 4YB1P 2D9PA 2DA3A 2VPLA 1N78A 1TKTB 3FBNB 1RWVB 3BH7B 3DPUA 1U78A 1TP7A 4MFBB 1MBGA 3F73A 3B02A 1XIQA 3F8CA 2V69A 5IT9K 1FFSB 3TJ8A 2EIJH 4E8UA 3DP7A 1BGXT 2LFVA 3VAHA 5B0EA 3GFMA 2XAQA 2ILYA 4UV9A 2A3SA 4DPOA 1RCOB 3ENVA 1T7PA 3CE8A 4MK9A 1SANA 2XMAA 5B0GA 2J6UA 3E5XA 3AFHA 1IN4A 1B70B 3VWSA 3D6FB 4IHTA 2NRAC 2AX1A 4WIQA 3VHQA 2Z2MA 5DQGA 1TAQA 1K83J 1U09A 1QE1B 1WZ2A 5AE3A 1RBLA 2WRMA 3W5YA 2DYSH 1T95A 5ICFA 4OMFG 4Y65A 2ZBIA 3AY0A 1KQFB 4WP9A 4LFCF 5KG3A 5K20B 2OA4A 1AW0A 4AYBD 3W65A 4ECXA 4Q43A 3BG7A 3IL2A 2XPVA 3RTRA 3EUKL 3M8QA 3NOCA 3F3XA 2IC3B 3JSMB 2OU2A 4TVAB 2O01C 4Y17A 3RI4A 4LF5F 5DDGA 1QVTA 3BSNA 3LUYA 2XTJP 4NX9A 3ZQQA 4DV2F 1N0VC 5M2UA 3P49B 1YKWA 2EEYA 4GO1A 3IWNC 2K86A 3KK3B 2VFUA 3FDSA 2B9SA 2WAQD 3ISNC 2WB1N 5HVFA 5EHHA 3IWLA 4U88A 4RJVA 5HP1B 2QCOA 4A3GJ 4J91A 4JI6J 3FXRA 3KE2A 2OFGX 2P9CA 4KN7X 4QR2A 2DTJA 3GTQJ 3CJRA 1HSTA 1O7LA 3NGDA 3OYEA 1XR6A 4U9RA 4YY3J 4DPTA 2AS5F 1KGSA 4RW4A 3ZCOA 3CJ5A 4AYBA 3I9V2 2L9VA 3HFVA 1T08B 4PG6A 1XCVA 1FE4A 3OTEA 3KNGA 1M5KC 1Z7UA 1WI9A 3IP0A 3J80Z 3MZHA 3D3BJ 2BHZA 2VJ5A 3QOPA 5JMNA 5HROB 5DCMB 4DBRA 1R58A 3Q8SB 2RGVA 1U2CA 2GXAA 1M5HA 2I9SA 3PRBA 3LSGA 2VKRA 4WF9Q 1OPIA 2FZKB 5M5WJ 1LWFB 3RYRA 1BN5A 3D9BA 2HFVA 2GBYA 1LWCA 3KLEA 2MD0A 3LO3A 3C6TB 3EYIA 2IBKA 1QU3A 2MD5A 3OMYA 2FE3A 1CULB 3M30A 4ZC3A 2NPIA 4XN3A 3SMZA 5D78A 2FC8A 2OD4A 4UOHA 1OWXA 1QSYA 3M7GA 2O5RA 1S7EA 2KJCA 5F8MA 4LFUA 5IT3A 2R7ZJ 3CULA 3IRRA 2ESHA 4KIGA 1VQMI 5EG0A 2GWRA 1ONVA 3VV2B 4QWEA 2DCLA 3MR3A 3UVJB 2MGZB 1KVJA 4YRVA 1S1XA 1MJBA 4YEAA 2MJNA 4F8RA 3GX4X 3GCMA 1VQPI 4CLSA 1DRZA 1UMJA 3D0IE 1VLOA 4DYQA 2MFZA 4XSXF 3T1HF 2QSFA 3NG8A 1OMSA 1P27B 1Q4RA 3SCIE 3IS9A 1Q8LA 2F4VF 1MNDA 4C8YA 1MROA 2DPUA 2DGSA 4DF8A 2L7MP 4WK1A 5FLMJ 3C1DA 1HMVA 4C4WA 3IFEA 1WRJA 2XNRA 2ECCA 1HLVA 1HNXF 1S6UA 3THTA 2IS2A 3ERMA 1WKKA 1WEZA 1SFOJ 4HEA2 2E5HA 2LLZA 4RAZA 3PSFA 2J0QD 1J0RA 2E1CA 2YQ0A 3QPIA 2EH3A 5JXSA 1ULRA 5H1SV 3S2HJ 2R93J 3Q89A 2QYCA 4I67A 3SIPB 1VDHA 4CLUA 3T5HA 2XZTB 2EQRA 3MFKA 3F0CA 1L3KA 1S0NA 1NPRA 5K7HA 5DZ7A 3KK3A 1WJAA 1S10A 5KG6A 5H20A 4LRAA 4Y3CA 4WF2A 4NRTA 3L4BC 2IAIA 3TUPA 2QLJB 2VJJA 4C8KA 4TQSA 5B1BH 2V26A 1JLGA 4IH5A 1VQ7I 1XTAA 1RT5A 1JLAA 1KONA 1QNTA 4HDUA 2D9OA 2MH9A 1WHVA 3U02A 1X5SA 1H98A 4RBVA 1U1LA 2XMVA 3OUYA 4DR7F 1RWWB 1FFWB 1VYAA 3KZYA 5FLXZ 1VQ5I 4KUMA 2CZVC 1UTAA 5M2RA 5TISC 1WDDA 3EDQB 1QZZA 2M45A 3PIOQ 1TQLA 5K7FA 5CCMA 4L76A 5DQHA 3Q86A 3PO2J 1TQIA 5E79C 3M2RA 2M8EA 3CPWR 1BIBA 2BVLA 3HTUA 2OTLI 2RMLA 2EWNA 3T1YF 5LJ5Y 3D5RC 1FSEA 3HRTA 5F0HA 1OS5A 2MLZA 1F5TA 2CPEA 3R5BA 4ZDPA 4LF6F 1O7FA 3C46A 3PIOF 2ADCA 4UTGA 5J1PA 2KJWA 1XGNA 2VFVA 4RAGA 3V6JA 2HXIA 2F4MB 5MLCV 3CJNA 3LWLA 5GADI 2PI0A 3L7WA 2KIFA 2LEBA 3W5ZA 5HMXA 2N4CA 1K61A 1SC1B 5IS2A 4U7DA 2DFHA 4DR3J 3TX8A 4ZPAA 3WTVC 4WK3A 2BHYA 2GX8A 3LAKA 2YKAA 2Z2YB 3E3VA 2QRRA 3RW7A 2UXXA 1OCPA 4DL2A 4EEYA 2P81A 4N8OA 1FJ7A 1RRJA 3K0LA 3PXGa 3FC9A 3JTPA 3CCRS 1IRFA 1SD4A 4EBDA 4OX7A 3OL3A 1IKYA 2HZAA 3P7NA 1U8WA 2ZH6A 1RUNA 1UJ4A 3IG1A 1REGX 4RUAA 1T11A 3K70C 3A0BC 5KT4A 3S1MJ 4X4SA 1WJBA 3ZMVA 4DDFA 5GAGU 2ZFUA 4YB5A 2CU7A 3NCQA 3HHKA 4M1KA 1VQ5S 3LAPA 4X66F 4QYZJ 4F67A 2LLKA 4B1RA 1GFWB 4CNZA 1R1TA 4M5DA 3DHWC 2EG1A 4BCAA 1JLEA 1YRXA 3MMCA 3MEKA 4I99C 2WAEA 4PZVA 4ED0A 4WXWA 2XLIA 3H3ZA 1R22A 4RUHA 2QWWA 1ETVA 3WODF 2CWKA 3MTKA 1P4XA 1Y0UA 4KT6A 3GP9A 2UUTA 4CCLA 2Y8WA 4P10A 1D1UA 3KLFA 3OYJA 2A18A 1BLUA 3IR6B 4OOIA 4Z7YA 5J3LA 4NCGA 4FF2A 4O0IA 2R42A 3VCDA 2B7EA 4OJHA 2DA4A 4XK8C 2JZ5A 3GFYA 2MYFA 1BBYA 1DPRA 4NZ6A 2UVVA 4FXWA 4ZPVR 4LR8A 2W2PP 3GMGA 2HWVA 2N8GA 3D2WA 1BC7C 2XB0X 5LHGA 4ILRA 2KM8C 4G1QA 4KMUX 3BF4A 4WYLA 3NEKA 3VALA 2J76E 1MIJA 2KG1A 3CMQA 1RHUB 1FD2A 4OHXA 2BM0A 2F2EA 2F8MA 3BR0A 3GYGA 2RQCA 1LKZA 1HKSA 1NKCA 1IN7A 2CQ4A 5DCMA 5HNFA 2G1DA 1NHKL 1VI7A 3TOAA 2J8SA 2UUAJ 4DBQA 3TA0A 1ZTWA 4GXOA 3TO9A 1ZGWA 2LK2A 4ZTFA 3G73A 3PEJA 3OD2A 3N05A 2BY3A 3RKQA 3Q2SC 5KAKA 4TKTA 1Z3YA 1LWEA 2GMHA 3Q83A 2DNOA 2XPWA 1X4GA 3KLEB 2XM3A 2B7CB 4BBYA 4NCGB 1UHWA 4RDUA 3DLEA 2DR5A 4Q8EA 3CJ0A 4ERDA 5EJCA 4HNUA 2YWHA 1WQ2A 3N6MA 1UMQA 2FX0A 5ILSA 1BQMB 2YH1A 2YPYA 4J00A 5KFVA 2OD6A 4ID5A 1XS9A 3CB4A 4LB5A 3AFGA 3PV8A 5H6RA 2J0XA 4O3QA 2LDYA 2YNHA 1IUFA 3MD2A 2ZDOA 3C6TA 5KTQA 5I3UA 1KRPA 4PQUB 1L0OC 2CJKA 3CC2I 2YQ3A 5JFRA 1TELA 1OYIA 5KT3A 2DY9A 3PUFA 4LVOP 2DXIA 2EW9A 2HMIA 1HKAA 2RF2A 4Y00A 3PW7A 4USVA 1WC5A 1DQ8A 2ADUA 2WB1A 1HA8A 3MHYA 4EMDA 1RT1A 3DCAA 3GEZA 2YNFA 1N34F 1RR8C 3O3KA 5L8RC 3VGTA 3O2IA 4JI0F 3QU6A 2W84A 4DG1B 5D0HA 3K10A 4X2BA 2V2QA 1OISA 2E36A 2A6HF 4PK4A 4A8WA 4PWDA 4NYOA 2DGVA 4OIPF 3OS0A 1F1BB 4AC0A 3U1KA 4NZ7A 4B3TF 4RBTA 2PMZD 1HR0F 2VKVA 5FKMA 2HVDA 2V5HG 2N3LA 4A48A 5KFDA 2D1CA 4D7MA 1FYMA 5KFPA 1ZTTA 4ENMA 2HHHF 4DX6A 3HVTA 2JSXA 1HLWA 2CFXA 1QUVA 1V3FA 2HK2A 2C42A 3F6VA 3M32A 1MU2A 3I4HX 4BJ6C 3FZVA 3L9FA 3MEEA 5IQ6A 4BXXJ 1ZH5A 4QLCU 2H48B 1HWKA 2YX1A 4QPTA 3J7A1 2ABYA 1OMIA 4DV4F 3H5UA 4LFCJ 3LP2A 2P4WA 4CH1A 2MA3A 4BHPA 2DNZA 2HFUA 4USIA 4FP9A 3S1QJ 3ZGKA 4A8KA 4H4MB 1U5TB 4BDPA 2BZTA 2B5JB 1RT1B 3C3WA 2GJFA 3KJNB 2VKZG 1AU7A 4ECSA 4XORA 3RJPA 1NH3A 1RGVA 1KA8A 5HMYA 1LDDA 1XC5A 1UEUA 4PPDA 1U0SA 3QLHB 1B72B 1L3TA 1PJ5A 2IVFB 1FIPA 1U1QA 4KHPF 2AYEA 2XULA 2H65B 2LQBA 3GJTB 1H8AC 2EV0A 1GXPA 2MZ1A 2Q1ZB 2W9BA 5HVGA 2QLXA 3KLFB 2Q3PA 2Y69H 4ANDA 4MHGA 3OJUA 1QPIA 2GIQA 1XR5A 3J7AY 1FKAF 3M2UB 5IT9Z 1DTTA 3P3DA 1QRYA 2J5AA 5HP1A 2VZ9A 4G6DA 2B9YA 3MFHA 2AQEA 3JRHA 5J2MB 1FVSA 4QCLA 3L2RA 2VI6A 2KM8B 3D0GE 1TL1B 2ZMEC 1APSA 1D1AA 2C2DA 2HYIB 2ZUAA 2EFQA 3PX6A 2EC2A 4O6JA 2XWXA 4XAKA 3PJ9A 2CV1A 2R5YB 3R5GA 4NI2B 2PSZA 2X6YA 3CO7C 3DOMA 3L00A 4F7VA 2KZVA 3K2ZA 4KT5C 1VHFA 4ELTA 5HROA 3D66A 1WF1A 4F26A 2YXLA 4ZP8A 4ED8A 3IUOA 4P5OA 4FCYA 4X66J 3MVPA 2L2OA 4LFAJ 2AW0A 4CT8A 4DSJA 3H5YA 2QE5A 1U8SA 4CYUB 2XMJA 1NBEB 4M5NA 2RB7A 2HHHJ 1HBNB 2VG7A 5H9EJ 3PKYA 3TOQA 1UJ6A 2V8VA 4QPQA 1QAYA 3I56I 3ETOA 3KG4A 2LF8A 2EINH 1YJVA 1ZRCA 5K5MA 3I5UA 3TX0A 2ZBKA 3PFYA 1LE8B 2BM1A 2QF7A 2WSEC 1FOXA 4ITVA 2FVRA 2VBYA 1FOYA 3BSAA 3F22A 2KI2A 1HXDA 4PG8A 4E7SA 1FRMA 3BR9A 2LH9A 3V81B 3U1DA 1R27B 1XMKA 2UXCF 2UVWA 1HWUA