2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
3H2VE 5DCMA 2CPHA 2DK2A 4M74A 1VQPS 2HGLA 3WTYC 2B0LA 4P6QA 2TDXA 2D2WA 3Q9VA 2NS0A 3IWZA 1YIOA 2QQ9A 2EV6A 4Y15A 2DNZA 3G6ES 2Z5UA 1B6AA 1R1TA 2XB2D 3HHNB 2DHSA 2QWWA 2XAGA 5TJJA 4IPAA 1U6FA 2G7UA 1P4XA 1W7PD 1ZZNA 1WEYA 1LB2A 1UHMA 2ZFWA 1U3EM 3DXJF 4M9ZA 2M5WA 1YITS 2Z33A 2KIMA 3UCGA 3MURP 4F7ZA 5FD5A 3TO6A 1X4HA 2FF4A 3R27A 2MLKA 2FC9A 2M7SA 1X4AA 5LHGA 3ZN1A 1FYLA 1H2VZ 4UUVA 3E5XA 4KUMA 3GEZA 4ZYGA 2M30A 2KXFA 1B59A 1A9NB 3JSPA 1JJHA 5ICEA 2SXLA 3Q2SC 2RUGA 3HRUA 2V94A 1N88A 1W2BR 5KVRA 2JWNA 2EFQA 5H20A 1YYVA 2J5PA 2XRNA 2RRBA 3KCCA 1H6KX 3BY6A 3ECOA 4IF4A 3GF2A 3LFKA 3E5UA 4CIOA 4ZYEA 4AIKA 4CZZA 4LD5A 5H6RA 2P7CB 1FT8A 2L4MA 1R5GA 2HEOA 1XGNA 1K6OA 1D8JA 3GFLA 4KA4A 3GW2A 4U0YA 5CVVA 3CF5Q 1P4WA 1TLHB 4WX9A 3F21A 4CO8A 4EMSA 1QM9A 1YHQS 3RIRA 2UXXA 2YKAA 5DETA 1BC8C 2KYXA 4HF1A 5GAGU 1QBJA 1IAWA 1S7OA 1KQSR 1PGZA 2A6HF 5EEGA 1L3KA 2XASA 3HTUA 2HQNA 2ESNA 2L4AA 2KKOA 5LJ3Y 4C4WA 2PG4A 4M9XA 3FM5A 5FGMA 1ODDA 4PCQA 1YW8A 2DAOA 4P55A 3HOTA 2E44A 4J5OA 2JPCA 3NS5A 3C18A 3BOQA 5FLXZ 2DH8A 2JRSA 1IN5A 4BYYA 2FPHX 3UD4P 1M5KC 4GXOA 2OSRA 4BHCA 3UD3P 2GA1A 2GIVA 1FPQA 2W85A 3WU0A 2RVJA 5D5UB 4NQWA 1ZRFA 2VT2A 4OU0A 5D5WB 2K4BA 3RKWA 2P7VB 3G71S 2HGMA 1JGSA 2FRHA 3PFIA 1G6NA 2DT5A 3MWMA 1NHAA 1J2XA 3WTZA 2DNHA 2P4WA 3OW2R 4U7BA 2E5IA 3FXRA 2K86A 2KI2A 5GVQA 1QVGR 4HDVA 1XSDA 1FO1A 2CYYA 2FNAA 1SJ3P 4EJOA 1ZYRF 4JQFA 3QP5A 2M8HA 3MI7X 1IUYA 2OQRA 1FSEA 4F02A 5ICFA 3HHHA 3L9FA 1MDMA 1QZZA 2I2YA 2JRTA 3L09A 2ZJRQ 3EETA 1KU2A 2GWRA 2KFYA 2PJPA 1D5VA 1Q82T 3C1DA 4HBLA 3VAGA 3F22A 1ZN2A 2FQ3A 1XMKA 1JXSA 5HDGA 4M6YA 2HYGD 1C0WA 1BJAA 3WTWC 4TU8A 4ENKA 1SJ4P 2MPUA 1VQ9S 4A12A 3P9IA 5DD8A 2FEZA 1KQ8A 2D9OA 2DNGA 2WWYA 4HYEA 4Q5SF 3JAMK 5J6XA 2RQPA 2E7XA 1W5TA 5H1SV 3N9UC 3R60A 5JI6A 2L41A 2CQ2A 2CW0F 5DD4A 3EDPA 4AD9A 3GO5A 3O3KA 3NRVA 1WG5A 1FP2A 4OZ1A 1L3LA 1ZAOA 5HO4A 3F6OA 3S01A 1HW2A 1RIOH 5LSLA 2LYVA 2RV8A 5ILSA 4C0OC 3GFMA 3BO2A 4LLNA 5LGUA 3D2WA 5ED4A 2CQ0A 3RI4A 3S7RA 4TU9A 3IRQA 1OIAA 2PFBA 4UVAA 1WQ2A 1MD0A 3WGHA 2LF8A 1ZG5A 2D1HA 3GLXA 3G73A 1Z91A 3V8JA 1S79A 3U1MA 5LJ5Y 4UXNA 1OPCA 1VBYA 2RS8A 1O57A 5L3BA 1P1TA 3ZMUA 3SHFA 3ABTA 3CUQB 5D8LB 5LGNA 4ERDA 3MXHP 5K1YA 5IT9Z 4A0YA 5CXTA 3B02A 4WK8F 3KEQA 1WKMA 4Y0FA 1MJAA 3JW4A 3E6DA 1YJ9S 2BBYA 3KEOA 1LQ1A 1RUNA 2F2EA 1WF2A 3CPWR 2YR2A 1DPRA 3ZPLA 3HSFA 4G7ZF 1DHMA 4EM1A 1VC5A 2ELHA 2F5FA 3HHGA 2XV4S 4O5VA 4M72A 5E1ZB 2MSSA 4I0AA 5J8FA 2BZ2A 2OQGA 5LEJA 2GXGA 2FU4A 5JVTA 3TOAA 3IWFA 5HLGA 2MH2A 3WTUC 2RQCA 2F3JA 2IRFG 2CQCA 4U67Q 1IN6A 3VAMA 1YW9A 2H27A 1W5SA 1FZPB 2CPEA 2DGTA 1S3JA 3E5QA 4GYGA 1SFXA 2DTRA 2QBYB 2BYVE 5A2QK 1CF7B 4TV7A 1Q81T 1FP1D 2P5KA 4WXDA 4KT5C 3F23A 1DUXC 2ACJA 4HX4A 3Q9SA 3DLLQ 5HDNA 3RW7A 3QPHA 4HW0A 1K79A 1Q1HA 4KN7X 1FOKA 2LCWA 2MZSA 1VQMS 5HLIA 4OIPF 2DNLA 5HDKA 2LMIA 4YIFA 1X4EA 1R8PA 1FLIA 3CCVS 2DH7A 1FJCA 3GFIA 2XKPA 3TOBA 4MHGA 2HS5A 1TTYA 4I7HA 1ZG1A 3BPVA 3K1PA 1U78A 4GGGA 3E6MA 1OYIA 5HLHA 3RJPA 1P27B 2FBKA 2YSRA 3I64A 2XUBA 3T1BA 4JBAA 3DV8A 1LJ9A 2DB1A 3I56S 3T8TA 2V1DA 4OZ0A 3KP7A 2V1UA 2KRBA 1BI3A 4HV6A 5LLQA 3VAKA 4CGZA 3TO8A 3G3ZA 3LQQA 2RN7A 3F8CA 2KHCA 1J5YA 4A0ZA 4YFNF 2E5HA 5D6EA 3U1LA 3PQJA 4AIJA 3M8FA 1VQ7S 2EFPA 3TDUC 2NAZA 5MLCV 1U8RA 4RGXA 2OA4A 5DDGA 5J8CA 3FX3A 2HGCA 2MKCA 2HZTA 3S6EA 5TRDA 4A5MA 3E97A 2KM8B 3QOPA 3CCES 2FMYA 2FA5A 1VC6A 2W84A 1VBXA 2OZUA 2CPZA 4MQ9F 4MTDA 2ADBA 4P9FA 1KQ0A 2L02A 5CVIA 2STTA 3ZMTA 4LB5A 1VQKS 1TNTA 2KXNB 1Y0UA 3KP3A 1IF1A 1QVFR 2JVOA 2J5OA 3HRMA 2CPFA 3BDDA 1UB9A 4U88A 1ZG3A 5E1XA 1R22A 5DUIA 3G9CA 2CO5A 2EK1A 1LNWA 3P9CA 5DDRC 3PQKA 5FFXA 3THPA 1B7FA 1YW7A 1X5OA 4KDPA 2F9JA 1G3YA 1AOYA 4NHJA 3F72A 1VQ5S 3TGNA 5IM0B 4WF2A 4WIIA 4PKDB 5DCFA 5ICGA 3ZN0A 1FC3A 2HTJA 3I59A 2VODA 4UHTA 1WEZA 3DEUA 2DHAA 2KG1A 4W92B 4PRFA 2M2BA 2Y75A 4LIRA 1LDDA 5DCMB 2P8TA 3LQRA 4RGUA 1G3SA 4TLQA 1WF0A 2E1CA 1BY9A 1R5HA 2DNRA 2CQKA 2VBZA 5LSOA 1OWXA 1U6GA 3L7WA 3E6CC 2OSQA 3MOJB 2HDCA 4LGWA 2XROA 4G6DA 2MZ1A 2E5JA 4BHBA 1ZHFA 3REOA 4L0YB 1YFHA 2KRFA 2MD5A 4A6DA 2KIFA 1J9IA 1Z7UA 2MA3A 3O6BB 2BOPA 1F9NA 4UVBA 2IVMA 2MKSA 1ZRCA 1I6XA 5DDQC 4BNCA 5HVQC 2YTCA 2FBHA 1BOAA 3IRWP 3WG9A 2ADCA 3CCQS 4D0PA 1S6LA 1O3RA 4KN4X 3V8LA 2ZJQQ 3VOEA 4I0BA 4ENMA 5FJ4A 1U5TC 3EQLF 1LEAA 2CPXA 4Z2XA 3SZTA 3J81Z 2EVZA 1SD6A 4P96A 1USSA 1T2KA 1VC0A 2C6YA 4KMUX 3BP8A 2NLWA 2MGZA 2K02A 3CUNA 1UP1A 2P5VA 3K1MA 2PLYA 2JX2A 1M5OC 4Y13A 3FF5A 2KU7A 4EJWA 5CLSA 4RB2C 3JSOA 4RU2A 3EUHA 4ZKAA 1RK8A 2DH9A 2HZCA 1J59A 1B4AA 3ISPA 2DI3A 2FNPA 3CULA 3HUGA 1OKRA 1SJQA 2MZJA 2ZXJA 1Z9CA 1XCVA 3NEUA 1O3TA 3MEXA 2CQGA 2H6CA 3KLNA 1KYWA 2CSOA 4M9SA 3F8NA 4EGYA 1XN9A 1SFEA 2NRAC 4A5NA 1IZ1A 3KETA 2JSCA 1FHTA 1GVJA 2HYIB 2MQOA 5FO5A 4ON0A 3TDZC 2G0CA 1SAXA 1AWCA 2BV6A 4G7OF 4OOIA 1USTA 5AONA 3CO6C 3WE3A 2M45A 2RKHA 1FT9A 1XSVA 2EK6A 1SD7A 4H0EA 5DDPC 4EJVA 2FE3A 4HOBA 2QQAA 4KMFA 2FMLA 2G9WA 1F5TA 2QUFA 1WHWA 5FD6A 1QGPA 4ENJA 1O7FA 2K4JA 1QNTA 2ZKZA 2MQPA 5F64A 2VE9A 5ITHA 2EA2A 3HIFA 1ZLKA 2MQMA 2DLLA 1DDNA 2A3JA 5D8KB 1V4RA 1H0MA 1FBQA 3P6YC 2XS7A 1R7JA 1A7GE 1EV7A 3ML6A 2I38A 2JT1A 4E70A 1YTYA 3CC4S 1R58A 3UCUP 1MDMB 4O6JA 3ZZYA 4RAZA 5IT3A 1DP7P 1XSXA 2MMYA 4LFUA 5HS7A 5ERIA 3IKTA 2J8AA 2DNKA 3NNCA 4OINF 5JR3A 2DNYA 4A8XA 2FY1A 2CGPA 4W90B 2LA4A 1DRZA 2CPYA 1E17A 4F26A 3M9AA 2CQHA 3KZZA 2KIUA 3WE2A 3DF8A 1V3FA 1HKQA 1U1OA 3LA7A 4U7DA 3B4MA 2XAJA 2OZ6A 3SQNA 2RDPA 2CPIA 4CDGA 1HA1A 3ZZZA 2M1BA 1XB4A 4IHTA 2KRRA 3UE2A 1BI2A 1KQ9A 2MQQA 2F5EA 2DGOA 3JTHA 5BS6A 4I02A 4XSZF 3OOPA 4OIRF 2PEHA 3JTGA 3IL2A 1WF1A 3JB9k 2DO4A 4HV5A 1D3YA 1WI9A 4R1HA 1E2XA 2CG4A 4G9YA 2VC1A 2YH0A 3V8KA 3EX7B 4V19X 5CYVA 3IKVA 2VBXA 4WXHA 1R00A 5DV5A 1WRJA 5D78A 1HBXG 3F8MA 4ESJA 2QENA 3GZ6A 2HWVA 4ESFA 4KIBA 1I27A 1UAWA 2HFHA 1JHFA 2HR3A 4UV8A 2X1BA 2Y48A 4ZYHA 2GAUA 1KOHA 1I5ZA 2W57A 1YI2S 3SDEA 3Q5FA 5CYJA 2YH1A 4L9TA 2D45A 1VQ4S 2MKHA 1R36A 2XAQA 4B09A 3P5TL 4OMZA 4BXUA 1OYWA 2CPDA 3LAPA 4AVPA 2MH9A 1S8NA 4OIOF 1FYKA 3I55S 2P6SA 3V7CA 3I53A 2GQQA 3KFWX 2CQ1A 4YIIA 4HDUA 1K78B 3IWNC 4M5DB 1SJRA 3CCMS 2YX4A 3P7NA 1I1GA 2G4BA 5KK1A 4CH1A 3FHZA 1VTNC 3G8SA 2AS5F 2RC4A 2OTLS 1X4GA 2ZNZA 2X1AA 5E18F 1WSUA 3COAC 5DDOC 1ZLJA 4LK1F 2MQNA 2ESHA 1M5PC 3VEPA 1SD4A 2W25A 3MD3A 3VAFA 1IN8A 1S29A 2Q2EA 3R61A 2QYOA 2RNJA 3PIOQ 4WF9Q 1FJ7A 1VBZA 3EGNA 1IN4A 3SXYA 2BEOA 3RKYA 3ZQ7A 1U1MA 1FNNA 3GXOA 3AAFA 1VQ6S 4HF0A 1TQMA 2ZBKA 2KXHA 2IA2A 2K8GA 2IW5A 1STZA 1K78A 1HW1A 1VQOS 1T0FA 3I58A 5HS9A 1N52B 4O3MA 3J80K 3EYIA 2DQLA 3ZMDA 4IOAQ 1HQCA 4G8XA 1A04A 3M1EA 3HYIA 3UWTA 2GA2A 2M9KA 2DO7A 4RAYA 3WGIA 4YFKF 3KP2A 3US5A 2FSWA 1UCRA 4IXAA 2QM3A 2IT0A 1IXCA 1M90T 1U1LA 2Z99A 5LEKA 2ISZA 4LG0A 1U1KA 4HZFA 3CUQC 5CVUA 4AIHA 3B73A 2K7LA 3MUMP 1IXRC 2H09A 2QLZA 3E3VA 5JFRA 3KZYA 4LLGF 2DNOA 2Q8KA 2PMHA 2GHPA 4WCGA 3B4DA 2O61A 2HKXA 3I4PA 2WV0A 1JMTA 2OTJS 5CA5A 1PO6A 2CQDA 5CVJA 1FXLA 3WTTC 2DHGA 1RNLA 2DO0A 3GFJA 2YU3A 2G1DA 2DFIA 3RDIA 1FBUA 1UW4A 3JAMZ 3LWFA 2LQ5A 4FX4A 2QVOA 1U1NA 2VT3A 2EV0A 2PQ8A 4CICA 2NYXA 3CTAA 2DIVA 3HRTA 2M87A 4YFXF 3RW6A 4PR6A 1U1PA 1WWHA 3O2PE 3I0TA 2M8DB 4GCVA 4R79A 1TNSA 3U1DA 5L3FA 4YB1P 4BS2A 2VBWA 5D4RA 4EM2A 1TQIA 2DQRA 2ZO4A 1KGSA 1U6BA 4P9UA 2MC3A 3H3ZA 4EJUA 1HD1A 2MZRA 2VBYA 3T8RA 1Z1DA 2V79A 1N8RT 2N3LA 2LSOA 3R1LA 1XDSA 2A5YB 4I98B 2ADUA 1X5SA 3GUDA 2QZ8A 2RS2A 3I59B 1S7AA 3FEYB 5AIQA 1FYMA 3T5XA 3CLOA 1AUDA 4MGRA 4R8HA 2AXLA 1YG2A 1K7AA 2P5LC 2MHNA 2IJLA 4IUFA 4N9IA 1O3SA 3C3WA 3CC2S 4HX8A 4KYWA 4CQ1A 1JJ4A 3ULQB 1YWXA 1HKSA 2MKIA 4YG2F 1NU4A 2M0GB 3R4KA 1DBDA 3QRFF 3N4MA 1QQIA 1B9MA 3CXCR 3HTSB 1XMAA 3FWEA 2HGNA 1GHCA 4ZH4F 1SMYF 3DKWA 3CCJS 1Z6TA 1F9FA 3R0AA 1H9TA 4A0XA 3J7ZT 3L2CA 1XGSA 1PP8F 4MEXF 1ZZFA 4Q47A 5E1WA 2FOKA 1G2EA 4MTEA 3V4GA 1W4MA 2DK8A 3CTRA 2KM8C 1IN7A 2EFOA 2RRAA 2DGWA 2LEBA 1SMTA 3QU3A 3CO7C 3EYYA 4G94A 4QU7A 1M5VC 5BMZA 2ZJPQ 3U2RA 1N54B 2DNQA 3VFZA 2KH9A 3KP6A 2VXZA 2COMA 2J0QD 2O6GE 1JJ2R 5DYMA 1WI8A 5A2QZ 3V4MA 2MGZB 3BEGB 4WXCA 4ETSA 3LPYA 4AWXB 1G3TA 2X4HA 3GVAA 5LHIA 1HL6A 1SXLA 2RQ4A 5D4SA 1X5TA 3F8BA 5HS8A 3SFZA 2M4MA 1SD5A 3RPQA 2KJBA 3RTRA 4HX7A 2B0GA 4QWQA 2MJNA 2IPQX 2PE8A 1DZ5A 4P5OA 2DGVA 2ETHA 3THTA 4PDKA 1WHXA 4L5JA 4LB6B 1HSJA 2DPUA 5BPDA 1FSHA 4WFNQ 5D5XB 4Z2YA 5AIPA 1JHHA 5L3GA 2MZTA 3BZ6A 1U5TB 3TQNA 2HKOA 5F1RA 2GZWA 1UFMA 2EK5A 3BROA 3J7AO 2EJRA 2G7HA 4G7HF 4Y17A 1L0OC 4C7QA 4I09A 4I2OA 5FLXK 3L3CA 3PIPQ 4OIQF 3VAIA 4N0BA 3WTSC 1MGTA 1HXDA 3FMRA 4LLLA 3ZMZA 1P4AA 4IJAA 2OBPA 5DEQA 2ZJ2A 1FX7A 3K0LA 1REPC 3CMAS 3VALA 4XRFA 5LXRA 2E5GA 4HAMA 3LA3A 3V7SA 5BJRA 4RGRA 2MY8A 2MKKA 3FMSA 1JE8A 4L18B 3S2WA 2JPBA 2FHOB 2D9PA 1ZGJA 4UV9A 1ON2A 4KNYA 2WBRA 2EFNA 2XAHA 3CJNA 4IRGA 1NJIT 3ZMVA 2XS2A 2LF7A 3BO3A 2R7DA 3MCZA 2E1NA 3LA2A 3ZP5A 4FXWA 3P49B 4EGZA 1U5TA 5K5RA 2HVZA 3I54A 3QU6A 1X4CA 3D0SA 4M6XA 4L5IA 5JVGQ 1X3UA 4WFAQ 4M73A 4XBFA 3RYPA 4CYDA 4L9NA 5LXYA 5GAHU 1BM9A 2NNNA 1OMIA 2KJCA 3VF0B 4BHPA 3F6VA 5BQTA 1KU7A 2UWMA 3TO9A 4UY8T 1H9GA 2E7WA 1LEBA 1WI6A 4GO1A 2XNQA 3SXLA 3H92A 5L3CA 1MJ9A 4S05A 4LK0F 4EQQA 2HTSA 1IQTA 2WTEA 4IO9Q 4QU6A 2L9WA 4QPTA 3ERED 4FXVA 2UP1A 1P6RA 5EEHA 5GADU 4HA8A 3M8EA 2V1XA 4KIFA 1LDJA 1CGPA 2O03A 1FBSA 3J7YU 2XVCA 5D6FA 2QEXS 5GMKa 5BPIA 5EN1A 1B9NA 1LDKB 2RU3A 4U0WA 5K5QA 2K27A 4HQMA 2K3KA 1EH6A 2GXBA 2MBFA 2LNBA 2OD5A 5H6QA 1RI7A 3MZHA 3IRRA 4IOCQ 5CJ9A 4HLYA 1KYZA 4ENNA 4Y00A 4EVIA 3SDEB 3K1NA 3FEXB 3ZMSA 3P3DA 2OU2A 5L3EA 3MQ0A 1HD0A 1O3QA 2FBIA 1BI1A 5LRSA 1D8KA 4QLCU 4PGHA 2CWEA 2A07F 1YJWS 2AYMA 4RB3C 2MQLA 2VC0A 4MEYF 3VAHA 3HRSA 1VQ8S 4XLPF 3H2UB 2A69F 3HOSA 5IT9K 3MUTP 1BIBA 2IA1A 2DHXA 3TP2A 2VONA 1O0PA 3S8SA 1TBXA 5CVRA 2PMUA 3DFGA 2DGUA 3FXUA 4S04A 1EH7A 2R3SA 2NZ4A 2LKZA 1YS6A 3BJOA 3I71A 4L9JA 1TW2A 4BQAA 2BGCA 4L0ZB 3LAJA 6PAXA 1ULYA 1OO0B 5D77A 3M7GA 3ECHA 1Q86T 1XD7A 5ILVA 3BJAA 2UZKA 4UQTA 2ISYA 1BBYA 3QPTA 4UNOA 1WG1A 2ERRA 3G4SS 2MSTA 3E6BA 3ULHA 1YS7A 4ED5A 1ONVA 1PP7U 1MZBA 1MJBA 5E20A 2M88A 3FZVA 4YUDA 2LEAA 3DPTA 4LJZF 3W6JB 5GAEU 4LMYA 2U2FA 1Q7YT 1KA8A 3GWZA 1WHYA 2KG0A 3H3UA 2JTVA 1X0FA 3DQVC 4PGGA 1P92A 3GX4X 2GO9A 1W7PB 1KU3A 4I01A 1KU9A 2XS5A 3K2ZA 3KLOA 2CPJA 2PEXA 2JZYA 1ZREA 3MD1A 3L00A 2OJ3A 2F9DA 1WG4A 3GZ5A 1FY7A 1B1BA 3WU1B 3DPLC 2XAFA 5ICCA 4EM0B 3Q2TC 1XN7A 2RT3A 5LHHA 3BPXA 1F1ZA 2DNNA 4CXFA 4ZZLA 1HKTA 3I5UA 4LG0B 1RZ4A 2M70A 1OR7A 3QP6A 4TU7A 2VN2A 1K9MT 5IFMA 1YJNS 3F3XA 1VQNS 4QQBA 4KIGA 2LKPA 2UXNA 2X0LA 2N7CA 2XKOA 5BOXA 3UCZP 2Z3YA 1WHVA 2DGXA 3WTXC 2LDUA 2L01A 1ZARA 4MNUA 4OMYA 2CQIA 3RYRA 2J76E 2EB7A 3NNAA 1R23A 1FJEB 4YOEA 1YO5C 3QAHA 3WODF 4WWCA 2PBIA 1ZH5A 2PN6A 1W7PA 1XCBA 3BS9A 3VAJA 3VODA 2H94A 2MXYA 3DXBA 1O7LA 3D5LA 3SZPA 3LSTA 2HYFA 1U1RA 2M52A 4RS8A 2VOPA 3MDFA 1KD1T 1P2FA 1WTBA 5ILUA 3RPUA 3R0JA 1MKMA 1D8ZA 1EH8A 2DK5A 4Q4ZF 3VB2A 2ZMEB 3MFKA 4K2EA 1XGMA 2X1FA 2KVIA 3T0YA 2XIGA 2DITA 3NMRA 5DM7Q 1J7KA 1FNXH 4EJTA 4IRIA 2A6EF 3BJ6A 1YLFA 1BI0A 2M8EA 5LRRA 2LA6A 2RVCA 5LGTA 3BWGA 2V9VA 2CQBA 2QQBA 2VE8A 3K0JA 1T39A 3ELKA 2MB0B 2IP2A 1ON1A 4FT8A 2Z9OA 2YWKA 2KT5A 2A3SA 1X4DA 1DPUA 2DW4A 2KN4A 1RKJA 3TYTA 1IXSB 1Z05A 1S72S 2CQ4A 2W24A 2L54A 2OAZA 4XLNF 1WEXA 4DNCA 1IW7F 2O0YA 2CJKA 1X4BA 5DUKA 2DIUA 3HI9A 1YQAA 3OV8A 2MKJA 3CUQA 1H2UX 2Y0MA 3GYHX 3EGZA 4CH0S 2DGQA 3C7JA 1M1KT 4WCEQ 2D3OR 2AD9A 3MUVP 3KE2A 2XSFA 1PDNC 2F5DA 1HW5A 2MLGA 3CC7S 4M71A 3NQOA 1OPIA 3CCLS 2N3OA 2DISA 2ZMEA 1F4KA 1QZYA 2CQ3A 1XGOA 5E17F 4DQ2A 1TW3A 3CUOA 1RUOA 2EWNA 5D5VB 2CQPA 2L3DA 4NB5A 4LJMA 1QO0D 3CD6S 3R1HA 3IC7A 4GYIA 3NS6A 4A6EA 3KP4A 1BIAA 1T6SA 4BAYA 4ESBA 4IHSA 1URNA 2MZQA 3G96A 3CDHA 4PZJA 1Z6RA 2Q0OA 1TQPA 2R7FA 2VOOA 3NNHA 1H2TZ 2U1AA 3J81K 2O8XA 4RB1A 2YX7A 2QBYA 1CF7A 4KFCA 1ZRDA 2EA4A 2AYGA 3K69A 2X1GA 2QA4S 4F25A 4FX0A 2A68F 1ZGAA 2CFXA 2DNPA 5L3DA 2A61A 4HLXA 3HSEA 3IHUA 4FHTA 3V7RA 1XDUA 2NNYA 1YIJS 2DBBA 1WELA 3J80Z 1QPMA 2IA0A 4BH9A 4N9HA 3FMQA 2WC2A 3FM3A 3CCRS 1BC7C 4WKRA 4IVNA 2H6BA 5K5OA 2D1VA 1GXPA 1J75A 5E8IA 2F5CA 4KICA 3CMES 1HSTA 3WTVC 1D9AA 1R1UA 1UHWA 1GXQA 2LECA 4WFBQ 5FFZA 3FXQA 2EV5A 2DPDA 1K73T 3HSRA 5F6FA 3ABUA 1U2FA 1U2WA 3F8FA 2XGXA 3KP5A 1WWXA 2O3DA 1FWZA 1VQLS 2STWA 4G6QA 3U9GA 3K9TA 2PI0A 1R1VA 2EFWA 3SMZA 4U0VA 4XSXF 3P9KA 3RKXA 3WGGA 1T38A 2DGSA 5E8GA 1CVJA 1IRGA 2MYFA 4ASNA 4HF2A 1UFWA 3CCSS 4EV0A 1NO8A 2RGVA 2N82B 3MAJA 2FC8A 2QFJA 1R8HA 1T98A 1G4DA 5IQQA 2L08A 1I1SA 3MZYA 3G8TA 3N97A 2MY7A 2HOEA 3TO7A 1X4FA 3BO4A 2RNEA 3ROUA 2JVRA 4L9VA 2XHKA 2ZNYA 4ZYDA 4RB0A 4MQVA 5LBQA 2J0SD 1PUEE 1U1QA 1SJFA 5JHUA 4CHUA 4LMZA 1KOOA 5FB2A 2Q79A 4JK1X 1SFUA 3DP7A 4RGSA 5HOOA 3CCUS 2O3FA 5JVHQ 2HQRA 1IRFA 2OIHA 2AYEA 5HL7Q 4B8XA 1K8AT 2YPRA 4A2UA 4ZZDA 1OYYA 4UVCA 2LXUA 2FXAA 2DNMA 1J0RA 3R6SA 2P6TA 3LQVA 1G3WA 5IM0A 2MJUA 3W6KB 2LXIA 1KC8T 5DM6Q 1X5PA 2BE5F 2XNRA 2DU9A 2V6CA 1BN5A 4HQEA 4EGLA 3TKYA 1LVAA 2AYBA 2ZCWA 4Q48A 4IRHA
chains in the Genus database with same CATH superfamily
3H2VE 2N8GA 2CPHA 2D7SA 2KLOA 1KBRA 1TC3C 3FMWA 2D2WA 2NS0A 2COLA 1R6YA 4ZIVA 2Z5UA 2HRTA 3RQIA 2CAJA 4Q7AA 2XB2D 2LRDA 5E3LA 4JI0F 3A02A 2QWWA 2XAGA 5TJJA 3LW5C 2Y69H 2OCCH 4D1QA 2AQFA 1RAIB 1U6FA 5H9FJ 2RDJA 2X6XA 5HROB 3OVBA 4B9NA 2JA8J 3AODA 4YN3B 4F3OA 3R2CJ 1OY6A 1UHMA 2ZFWA 4E7LA 3DXJF 2KIMA 4HG2A 2Q66A 5FD5A 3ET6A 3AOAA 2FF4A 2WADA 2MLKA 3S14J 8ATCB 4CCNA 2M7SA 4AM3A 4GRSA 2P8IA 1TP4A 3RPUD 4AIDA 4KUMA 5KFGA 3VGUA 1QHGA 1B59A 1A9NB 4LFCF 1JJHA 1IRZA 5IYDJ 3DMJB 2B7BB 2CA9A 3K58A 2V94A 2PO4A 2EFQA 5H20A 1H6KX 3ECOA 3O1LA 3LFKA 2NREA 2R2SA 5H6RA 2CQ7A 1U02A 2QV6A 1FT8A 4PAAA 3AB2B 4CCOA 4BQNA 4ETZA 2XMVA 4IZZA 5CVVA 3CF5Q 1GXLA 1L5UA 4WX9A 3VV2B 3F21A 2OMLA 1UPMB 1YHQS 2CRGA 5DETA 2KYXA 2ZDPA 5GAGU 1QBJA 2C2MB 3HD1A 2DA2A 1IAWA 1NK2P 2E36A 4WBFA 3T1YJ 3HTUA 5GAGJ 3PR5B 2ESNA 4LSZB 2GBYA 3MMJA 1TK8A 2QGUA 1N78A 2E7VA 3FM5A 3NBPA 4DL2A 5FGMA 1T9TA 1YW8A 3HOTA 4CCHA 4WYWA 2BXYA 4UOGA 3NS5A 3UDLA 3C18A 2ZZNA 2D74B 5FLXZ 2PD1A 1TELA 3C2HA 3UD4P 1M5KC 4OYWA 4TQSA 3QFHA 1N75A 3HM5A 1FPQA 3LP0B 1X1PA 4A3MJ 3J7Z5 5KFZA 1G1XA 4A93J 4NQWA 2L5QA 3A1YA 2W2PP 3BR0A 5D5WB 2P7VB 1GT0C 4IDKB 4B3XA 4KISA 1G6NA 1X4OA 4KGVB 3OW2R 2E5IA 4L76A 3GONA 1XSDA 3QBCA 5IOLA 1ZYRF 2LOOA 3WHIA 3PW5A 2GW8A 4I6ZA 4X4UA 4PSXA 4USIA 4F02A 3L9FA 1MDMA 1G7CB 2OEJA 1QZZA 1YRNA 3D9BA 5LD2C 2I2YA 1X19A 3M6XA 3BPDA 1Q5YA 4R25A 4N4OB 3WHCA 4PUOB 3DRSB 2IGKA 1Q82T 4FF1A 1VYAA 3DTIA 3QJPA 3VAGA 2WRMA 1L3TA 1JXSA 4KSEB 1SKUB 2HYGD 1VK8A 1Z2LA 3HZGA 2HHVA 1SJ4P 2MPUA 3MMAA 5EWEA 1RHMB 3PG9A 1SFKA 1NZAA 1Y56A 4YDXA 1NTCA 2ZHBA 1S6PA 2FEZA 1EP4B 3GIJA 2WWYA 3IGVA 3JAMK 2Q1LA 4ZVQB 3W8GA 1JLGB 4BEHA 2CQ2A 2X1EA 2MG4A 2CW0F 4IX7A 2RH3A 1TT5B 2CUZA 4X84A 2G0JA 4Q2MA 3KK2A 1Y0HA 3CJ5A 3G6VA 3KYLA 1SVMA 2YKNB 4FYWB 1FP2A 1VQOI 2CV1A 1Q1KA 5M5XJ 4CLKA 3DOKB 4N8NA 1L3LA 1ZAOA 2JK3A 3S01A 4QIWN 1N5QA 1T0FC 4QYZK 1F9EB 1A31A 4AUKA 4NC7A 4D5CA 4TU9A 3BG6A 1E6YA 1OIAA 2GX8A 3OVAA 4AC0A 1NAQA 4TY9A 3M8QB 1WQ2A 5IYCJ 1MD0A 5EDWA 1HHQA 2LF8A 4DV1F 2D1HA 5D3GA 5IOYA 2YNFB 3GLXA 1TKDA 4BS9A 1J27A 4F8RA 1Z91A 2X51A 3W6VA 1PG5B 1S79A 2RS8A 1O57A 3ZMUA 2G0EA 4LFBF 1RAEB 2QSFX 2CU7A 3HEFA 4OYIA 4W1UA 2KDOA 2H5IB 4A0YA 3UN5A 1X31C 2JLEA 3T1HF 2QF7A 3KEQA 3KMQA 3OIQA 4KT6A 4Y0FA 4Z7CA 3CDUA 2OPRA 3FEZA 2IS1A 4D7MA 2TCTA 2F2EA 4YRVA 2O5DA 3PL8A 1BGXT 3A12A 4F36A 3HHGA 2XV4S 5A8RA 2MSSA 2EG1A 2BZ2A 2P81A 2HYJA 4IHWA 1D0ZA 2FU4A 1N33F 3CCLI 1ZAWA 4OHYA 2YUSA 4NI2B 1OCOH 4URQU 2C3MA 2IRFG 2VQCA 3PO4A 3N01A 2DGTA 2J6TA 1B3TA 2IVFB 2B9SA 2QBYB 4CLZA 5A2QK 4DV7F 3S1RJ 4TV7A 1FP1D 1LWCA 2MQ8A 1I6JA 3KUHA 2XZWA 4K4TA 2V9KA 1T9YA 3M9MB 2ZXIA 5CCLA 2C42A 4CNZA 4FTHA 3RW7A 5D15A 4JI4J 1Q1HA 2CUEA 4DL0C 3HVRA 2GMLA 1X4EA 1R8PA 2P9CA 1FLIA 1FJCA 2JUGA 2VKHA 2IM3A 3X2QH 2FHJA 4JX4A 2HS5A 1ZG1A 3LUYA 1ZTRA 3NWGA 3K1PA 4GKJJ 3CC2I 1XTZA 3GIKA 3E6MA 5RUBA 1OYIA 3RJPA 1P27B 5K8OA 2YSRA 3T1BA 4JBAA 1QDUB 2ZOGA 4KT0C 2BJEA 2P9EA 3I56S 4DBRA 3X3UA 2V1DA 1JKHB 4OZ0A 4U6PA 3B82A 2KRBA 4HV6A 2W7NA 1Y8RB 5L1KA 5LLQA 3VAKA 3G3ZA 3LQQA 2RN7A 2C22A 1VZ0A 2AIRB 1W7WA 3M8FA 3Q86A 3BR1A 1VQ7S 3JSRA 1QY7A 3TDUC 1P8GA 4LT6A 5MLCV 1WC5A 2OA4A 2RAEA 3H5RA 3WIVA 3OYCA 1F2GA 2KM8B 4PZVA 1U24A 3GZ7A 5F08A 4DCPB 1BA5A 2W84A 1CJUA 1VBXA 1K83J 2BW3B 4X62F 4MQ9F 4RO0A 2E1PA 1MU2A 3AAWB 1Y5NB 4CO1A 2STTA 4NLYA 4NPOA 1VQKS 1DARA 4NZ6A 3W2WA 3V6DB 4V1Ak 5F1JA 3DRPB 2VJJA 2JVOA 2J5OA 4XOTA 3GZNB 1PBAA 4X4VA 4NLGA 1UB9A 4C2MJ 4A8SA 2DT6A 1ZG3A 4ATNA 2KB2A 4IH5A 5HVGA 4J91A 3P9CA 5D4NA 1ENHA 2CG8A 3PQKA 2OPPA 5DDRC 3THPA 1U0JA 4KDPA 2F9JA 3KMSA 1G3YA 3H9JA 1AOYA 1R71A 3U1KA 2CADA 3SCJE 4JX6A 4UUWA 1L3UA 4PKDB 1WTFA 2OAUA 1GDTA 1CJVB 1O4XA 1Y5LB 3DEUA 3H5AA 4FE4A 2EC2A 2F4VJ 4LIRA 4RA2A 3SSRA 1NK9A 2AJ2A 3HC7A 1AROP 2DNRA 4WWSA 2DMTA 1OWXA 3L7WA 2OSQA 3CLQA 2VFTA 3HJVA 3MOJB 2JHEA 1VK3A 3TVKA 5KG3A 4LGWA 4N7TA 3RTVA 3B78A 3PX0A 3DI6A 2HBYB 1IBKF 2MZ1A 1WJEA 1FRMA 4BHBA 4DR3F 1ZHFA 3REOA 4L0YB 1XMQF 2PIIA 3ZQGA 3E2EA 4XONA 4HDHA 1J9IA 3ZCOA 1Z7UA 2MA3A 1QZEA 4UVBA 2W4CA 5KFDA 3PR4A 1I6XA 4KY3A 3Q0AA 1Y11A 1Z0XA 2O67A 4BNCA 3PIOF 2YTCA 1ETVA 3ET6B 5B1AH 3ZZRA 3HXLA 1FOXA 3FDYA 3MCMA 3CCQS 1SANA 1A5JA 3V8LA 1HMVA 1DQAA 3V81A 1DGRM 2XF5A 3B8HA 4CO0A 3MMBA 2EVZA 1SD6A 1USSA 4WE1B 1TL7B 4CYUB 2NLWA 4KMUX 1RETA 3PCOB 4DV2F 4JP8A 3CUNA 1UP1A 2GQCA 1I39A 4OMFG 4Y13A 3FF5A 2HPUA 4BU2A 1TKZB 2I1RA 4RB2C 1JLQA 2DPJA 1TL4A 4FF4A 2DMQA 4RUHA 2C2KB 4P2FA 4K2XA 3ILOA 2ZXJA 3IGNA 2CW7A 3LSJA 1XS9A 1Q4RA 4XIUA 3KLNA 1KNZA 3MWBA 2VDHA 2WB1N 3FQKA 4EU0A 4NMLA 1GVJA 5FO5A 2DRAA 3NBPB 1AWCA 1AKHB 4UOHA 2HHTA 2B8PA 4DMZA 2HSEB 3OOUA 2LQ9A 2M45A 2Y2ZA 4BY7J 1IJFB 2Q6BA 5DDPC 2FE3A 4PQUB 4HOBA 2QQAA 3AD9C 2FMLA 3RJMB 3JSMA 3ABLH 1FEHA 4H4MA 4NQWB 1JWWA 3VTIA 4DUYJ 5F64A 4X4PA 4IRKA 2DLLA 2UVRA 3DLGA 1FIPA 2A3JA 2WAEA 4NUBA 1V4RA 4O3PA 1LPQA 4HEA9 1FBQA 3V6HA 2XGQA 3TP3A 5F0HA 1A7GE 1EV7A 4XICA 2I38A 2Y1JA 1YTYA 4A3FJ 2XMKA 1MDMB 2EZLA 4JP0A 1YRNB 2VL1A 1DP7P 4LFUA 1YSJA 5HS7A 3IKTA 2FZCB 1HWUA 1KQKA 5LMUJ 4A8XA 4KGKA 5KCMA 5D0EA 3LSKA 4TLRA 2CPYA 1DRZA 2LYCA 1I94J 3M9AA 3W60A 3QODA 1IJEB 1V3FA 4ZHRA 5AXNA 2V69A 2OZ6A 1J5OA 3MMAB 3G86A 3D1QA 2NPIA 2IXSA 1XB4A 5F04A 1G59A 1BI2A 3LNQA 1S6PB 4C2TA 1QLNA 2HVHA 4C3JJ 5BS6A 3OYGA 1RHUB 4ZDPA 3TQ1A 4OIRF 1CJKB 2L9SA 3EVMA 1SI9A 1WF1A 3GMGA 2DO4A 5BR8J 3POTA 1S0OA 1IBMJ 1WI9A 1F3VA 4JI6F 2ROEA 4QWAA 5GMDA 2YQ3A 4QWEA 3V8KA 2Y0SN 4V19X 3IKVA 2VBXA 1RADB 1OYEA 3IBCB 4ESJA 5EGOA 3SI8A 4LIVA 2VHGA 2W7PA 2HR3A 4UV8A 4NA2A 3NL0A 2Y48A 3S15J 4O3QA 4CO5A 5J4YA 1WHUA 5L9NA 3GIMA 3SDEA 4L3NA 5D3GB 3NAUA 5CYJA 4ILMA 2YH1A 3CVKA 1YJNI 1VQNI 2O8KA 4FF3A 2M34A 4OMZA 1RPWA 3LAPA 4AVPA 2MH9A 2OFHX 1G4CA 3P96A 3M9NB 1D0XA 3OLAA 3V7CA 2CQ1A 4YIIA 2JC0A 4HDUA 1H74A 2RQKA 2HG4A 4RW7A 4DN0A 5EWFA 3CCMS 2YX4A 1S4EA 5E3OA 4P2SA 2K40A 2OPRB 4LFAF 2VU5A 1Z77A 3FHZA 2CJAA 3G8SA 5KFRA 4ECTA 1X4GA 3FKBA 4F52A 2J7WA 2YU9J 3COAC 1IKXA 5DDOC 3N5FA 3NS7B 3MM9A 2ZWOA 1M5PC 5A8RB 3MD3A 1S29A 2Q2EA 3R61A 3D4JA 4LR7A 2QYOA 3QOEA 4JYKA 1MN9A 3C46A 3PIOQ 5B0AA 1FJ7A 1ACMB 3I4MJ 4KBIA 2XHWA 2P9GA 4F4ZA 1S7HA 4DR1F 3NCQA 2NQPA 4QR1A 3ZQ7A 1LWCB 1RWPB 1SPBP 1QTMA 3OMYA 4DL7A 3BR2A 4P7VA 2M2EA 2CUYA 3FCVA 1TQMA 1MSFC 1XJWB 2IA2A 3W65A 3MFHA 4LSLA 4MKAA 3R5AA 3OTDA 4FZVA 2YKQA 3I58A 1N52B 4O3MA 3J80K 1I51B 2VQFJ 1KVIA 1HLWA 1S72I 3HYIA 3NGKA 2M9KA 5KT3A 2DO7A 2F48A 3WGIA 2FSWA 2J9CA 4M5LA 3DFEA 1XIQA 1IXCA 2PDAA 2IPOB 1HBNA 2H8WA 2R7OA 1X2MA 2HVEA 4HZFA 3IRXA 2MEWA 2ELJA 4CH7A 3IXQA 2F63A 3B73A 1WJFA 2ATLA 3MUMP 4S0HB 4LF5F 5JVGF 3E3VA 3CCVI 2XF6A 2AMCB 2ZWPA 5FROA 3OJUA 2Q8KA 2ZMEC 4DL6A 1MWYA 4DSEA 4II3A 2GHPA 2MGQA 2WONA 2O61A 5KG0A 2RQQA 1GXUA 3ISNC 1KLMA 3K89A 1YLXA 5KFLA 1J5EF 2OTJS 5CA5A 3CP2A 4IO9F 1BR4A 1K47A 1FXLA 2XWXA 1IUJA 1AA1B 2Z56B 1UVKA 2ASJA 5C24B 1RNLA 3TAQA 2OPQA 4GFBA 1RHJB 1MIJA 4IRCA 4LBIA 1CJUB 2LQ5A 4ED0A 2QA4I 2R7SA 1MU2B 2FD5A 2CXEA 3SCIE 2PQ8A 3ISZA 1GVDA 2WCXA 3HRTA 2FHKA 4DFMA 4GO7X 4UB6C 3W2WB 2LLKA 3FBFA 1U1PA 2EQRA 2CRLA 1YVFA 2IM0A 4R79A 4ZDNA 1OCZH 4X4SA 1TQIA 1XWLA 3G6YA 1YJTA 1S1VA 3MCNA 4ZLPA 4YR3A 1LVKA 4XRSG 2MZRA 2VBYA 3IP4B 4ZVFA 2OD4A 4J9SA 2QFIA 2N3LA 3DYAA 2HHXA 2B4UA 3H9GA 2FVCA 2V5HG 1S7AA 4CLSA 2J0XA 5AIQA 3CE8A 3T5XA 3CLOA 3W3CA 4LF7F 4H4OA 1JT6A 2P5LC 2MHNA 2QLFB 2IJLA 2L2OA 4IUFA 2YVSA 1RWXB 5E41A 4L5EA 1CULB 5F8NA 1TWAJ 1HKSA 1F1BB 3CIZA 2MC4A 1UHSA 5B0EA 2BW7A 1FRIA 1XMAA 2DOEA 3FWEA 2HGNA 1H98A 1GHCA 3DI6B 1QUPA 1SMYF 5AT1B 1KHVA 1U9OA 2RU9A 3G2XA 4A0XA 5J2NA 2XO7A 2XSJC 5K5MA 2VPRA 1EQ0A 5J1YA 2LY2A 3JQMA 5E1WA 2F40A 1W4MA 3CTRA 2HFVA 3HJEA 2KM8C 1DQ9A 4KO0A 1PVEA 4JI3J 2EFOA 4A8MP 1NK6A 4NLWA 5EDNA 2C3UA 2VQGA 5IP9J 3OYFA 4G94A 4I64A 3R6GB 1ZETA 1SBRA 2VG7A 3K5MA 5EZGA 3IH2A 2ROPA 3V81B 3MMBB 2B7CB 5IZHA 2KH9A 4WFXA 4CLWA 3FFIB 2J0QD 2O6GE 5DYMA 4UY8I 2EIKH 4WXCA 1ELOA 3DHXA 4AWXB 3GVAA 4I7FB 2VPYB 3PNTA 1SXLA 1X5TA 1LQ9A 3CJ0A 1FTCA 3F8BA 1JLQB 3BCBA 2KHMA 4F2SA 3PZPA 2PE8A 4P5OA 1WC0A 1T95A 3EGVA 2DMNA 4K7QA 3L2UA 4PDKA 3NOGA 4LB6B 4AL5A 3BV8A 1R4NB 3D6MB 3CP8A 2HIQA 1JLFB 2K3FA 3EUAA 2LVWA 2DFEA 2GZWA 1UFMA 3MOZA 3S1NJ 1CC7A 2PFFB 1YJUA 1KKHA 5J2MB 1V5GA 3L3CA 3TP0A 2JWTA 1NH7A 3OTEA 3AFGA 2DDAA 2FGOA 3FIWA 1P4AA 4E4HA 3FVYA 2O9LA 4NZ7A 5DEQA 4QR2A 1FX7A 3N5BA 2GFFA 4C6AA 2E5GA 2ECCA 2C2NA 3FBEA 3DLGB 1OY8A 1XC5A 2V8GA 4ZN3A 2VPXB 3M3YJ 3C3LA 2XB5A 4DL5A 2XGCA 2MY8A 3K10A 3OL3A 3KLHA 4KIAA 1T9VA 2JPBA 3DNCA 4USKA 1A35A 1FNOA 5ETPA 2COBA 4UV9A 5I4MA 2EFNA 4W97A 3E0JB 1EJ9A 4ED8A 5SZTA 3P49B 3JRHA 3MAHA 4EBEA 4XKBA 1X4CA 4GO5X 5JVGQ 3UFCX 1RKTA 4WFAQ 1ZM9A 4X4OA 2W9BA 5KT7A 3K4NA 4L9NA 4CYDA 3IV5A 4DQPA 4BBRJ 3VF0B 2A18A 1WPKA 5A2QY 4NL5A 1T56A 1YHQI 3CZ6A 2ZOFA 1LEBA 4GO1A 4ZHRB 3CIMA 4J9NA 3CC4I 3SXLA 1RXOB 1J5OB 1XQIA 5ETMA 4A3JJ 1PJRA 3LP2A 1MJ9A 1YJVA 3T1YF 4LK0F 1R3NA 3KLEB 1Z7LA 2WTEA 2W4SA 1C0TA 5DLFA 4IO9Q 3PJ9A 4FXVA 4ZPDA 2E1MB 4UUSA 3PUBA 3HP6A 5EEHA 3OUYA 1T7PA 3M8EA 4JV5J 4L6V3 5IWAJ 4KIFA 2Z30B 1LDJA 9ATCB 1CGPA 2IAIA 3POTB 2MDAA 3BQ2A 1K44A 3WHBA 3BSNA 3BG5A 5IPAA 5C44J 2QEXS 4B9VA 4ZVOB 1LDKB 1FX4A 4B3SF 2BDPA 5K5QA 2K27A 1F9HA 4DSIA 4BWMA 3MZHA 4IOCQ 3PEHA 2XTJP 4CCKA 2KZZA 4FISA 2DMUA 2FLPA 4ENNA 2RUSA 3OYIA 3BQYA 3SDEB 3HVTA 2XEXA 3B6AA 3ZMSA 2C28A 2OU2A 3MQ0A 4ANEA 1F43A 5A8WA 2FJAB 5LRSA 5L39A 1NSKL 3OXGA 4U7UK 2EXUA 5BYRA 5KFYA 4YQWA 3TAMA 4Y6IA 3HMJG 4U9RA 1VQ8S 5H2FC 3HOSA 5IT9K 3MUTP 3MPYA 1DQUA 4E7HA 5B66C 2DHXA 1KSPA 1O0PA 3S8SA 1VHIA 4RW7B 2PMUA 3DFGA 2DGUA 1HWLA 3FXUA 3KLVA 2AQ4A 3OPKA 1FE0A 2VKVA 2WA0A 3IP0A 4HHUA 2LKZA 1UAAA 1ZM4A 3CSKA 3I71A 1FERA 3VSKA 3H5XA 3AXKA 3DGPA 5F0WA 3CD0A 3BTCA 3MM9B 4ZIWA 2KMUA 3LAJA 3H0PA 6PAXA 2Q2EB 2JZ5A 1TTHB 4HH0A 3ECHA 5ILVA 2XCAA 3W2AA 3C2BA 3AJ1A 3E6BA 1FKOA 1RSCA 4PXBA 4DW6A 1MJBA 1FXRA 5E20A 1PUFA 4B1RA 4CYCA 5ETKA 1QRYA 2U2FA 3WIUA 2F4MB 1YK9A 4ZCMA 4ZDOA 1Q7YT 4C97A 1WHYA 3GWZA 2C2ZB 2KG0A 4PGGA 4LSLB 2AX1A 4OJ3A 2OF7A 1KU3A 3TUIC 2XS5A 3CDAA 2Q6CA 2XPWA 4DV0J 3V42A 2JZYA 4CUGA 3VWSA 4AQYF 3ELHA 1T05A 2QLJB 2XC9A 1WG4A 3GZ5A 4CT9A 2H54B 2XAFA 2DRDA 5ICCA 2LY1A 4EM0B 3Q2TC 4FPIA 5J4VA 2RT3A 5GPCA 3BPXA 5KFMA 1XPXA 2RJZA 5IQ6A 2M70A 1AB8A 4AT1B 3QP6A 1LWEA 3RUBL 4Q44A 2HFSA 2VN2A 5THWA 3F3XA 1ZKGA 3QSYB 2X0LA 3S16J 3QRRA 5HSPA 5IXUA 3W3SA 2WV1A 2WONB 2NVUB 5ETQA 1QVTA 2QLXA 2EINH 1Q8LA 2J76E 5IS2A 2EB7A 3NNAA 4CLLA 2BOLA 1W2IA 2NS8A 1XR6A 5DM6F 3TNVA 2GCFA 1W7PA 4DFPA 1KRPA 3RZAA 1X8DA 3VODA 4GVBA 4I6AA 2XLKA 3KLGA 2HYFA 2OPQB 1U1RA 1NSAA 3BDPA 3PJRA 1S7EA 4LIWA 4YEAA 2J7UA 2VOPA 3MDFA 3IG1B 2HXIA 2CDRB 1U9NA 1P2FA 5ILUA 3C16A 2Z2YB 4OZNA 2M4KA 2A1BA 2DK5A 4Q4ZF 4W4MA 5JXSA 2BA9A 4CO4A 3NMRA 1KN6A 2HXOA 3F0CA 5B08A 3BQ1A 3BJ6A 4UY85 3I31A 1YLFA 4GKJF 4F50A 5KFIA 4XQFA 4BWJA 1MBKA 2RVCA 4WKYA 2V9VA 2CQBA 2VQLA 4LR9A 3MFIA 1PCAA 1Q0NA 2BBEA 3K7AJ 2IP2A 2Z9OA 2KT5A 4DL4A 5B7WA 4DR2J 3OT9A 1X4DA 5EZHA 3I56I 2DW4A 4I2PA 4DLEA 1JKPC 3C15A 3ZFVA 4IG3A 2OAZA 1QSLA 3N79A 4H4OB 3TA1A 1IW7F 2VKRA 2NXCA 1EETA 4XN0A 1YQAA 2MKJA 1H2UX 4USMA 5F8GA 2Y0MA 5EYRA 2XG8A 2B3TB 2XBPA 4CH0S 5L8RC 5EWGA 3IC1A 3C7JA 2HPIA 1FA0A 2ID3A 2BQUA 1VQ7I 1HW5A 2MLGA 2R7RA 3G87A 1K0VA 1DTQB 3TA2A 3NQOA 3MN2A 4USWA 5FLMJ 2K9NA 3RB6A 1RWUA 1FJGF 5E17F 3BH7B 3KHLA 2DA7A 2EBIA 3QZ7A 1V3SA 5D5VB 2IAJA 3H36A 1S0VA 3GCMA 4OJHA 1HDPA 1FVSA 2CQPA 2L3DA 2QYGA 5I3QA 4KO0B 4LJMA 1QO0D 4K8RA 4CI0B 1VQKI 1H3DA 2BJ9A 5ETTA 3CDHA 3F56A 3OHAA 2VG7B 1NKEA 1SQGA 2E1RA 1H2TZ 5F9NA 4WP8A 2L7FP 1Q7LB 3VR1A 2JN6A 3SYZA 5FD1A 4DDFA 2EPIA 2AYGA 3K69A 4DUZF 1Y10A 3MTJA 4RW6B 2A68F 1ZGAA 2F4IA 1Q79A 1D0EA 3DOMA 4C8KA 5L3DA 5GAEI 3QMQA 1XDUA 1JI8A 1YIJS 1NUEA 4QTRA 3A13A 4A3CJ 4B17A 1SH2A 4LRAA 2ZXWH 3NARA 3D6TB 2F5VA 3DBHB 2DD8S 2WC2A 1HHTP 2ZH2A 2V8VA 4K0KF 1BMQB 2DVIA 2AX0A 2N4CA 1QPIA 2V6EA 1WFXA 2D1VA 2HIYA 1J75A 5E8IA 1FTRA 2CS3A 3WTVC 4IRDA 2HI3A 4TNOA 3SSSA 2H5JB 1AZSB 1E3OC 1R1UA 1GXQA 5DS7A 2E35A 1ORKA 4FYXB 4YHHF 2EV5A 4A8KA 2HVIA 4KGMA 2FZGB 3QYEA 5F6FA 3ABUA 1U2FA 4NA1A 3PO2J 3BKUA 1AW0A 1UA0A 1N0VC 5JUMA 4UW2A 3K9TA 4I4BA 4MIBA 1F5AA 3P9KA 1T38A 5E8GA 3K4BA 1IRGA 2CMPA 3T9NA 3CCQI 1JUMA 1JQGA 2QL7B 4FP9A 2IVYA 1UFKA 4RM3A 5K7ZA 3W2VA 2J9EA 2N82B 1FDAA 3M6WA 3FBIB 4ZS6A 3KLHB 2RE1A 4HRIA 3G8TA 2MY7A 3NY0A 2HOEA 3TO7A 4JUZA 1BC6A 2RNEA 3ROUA 4L9VA 3UQSA 5DTDA 4RB0A 1OY9A 4K5SA 3CMAI 4X66J 4LF2A 5JHUA 5FJ8J 5D0GA 5F27A 1KOOA 1N5SA 1S1TA 2V63A 3HPOA 4DV5F 3H9QA 3CDEA 3HGGA 5HOOA 3CCUS 1H0HB 1TWFJ 1HR0J 1OCTC 3ASNH 2YPRA 4ZZDA 3UDCA 3R6SA 4A47A 2P6TA 3LQVA 4FYVB 3LP2B 1CEZA 3VVTA 4G1PA 2DR8A 3V2UC 5DM6Q 1X5PA 2IBDA 1C0TB 2DU9A 2I10A 3S1TA 2V6CA 3FCWA 4NXNJ 1LVAA 3SV4A 4HSRA 2ZCWA 4UUSB 3J80Y 4NCBA 4IRHA 2GGPA 3T41A 2B56A 3NGSA 1S6QA 1A6LA 2DK2A 1K1SA 5H9FK 1HI8A 2BJDA 3TL4X 4B3TJ 1KP6A 3PX6A 4EMDA 2Q1ZB 1HNWJ 2DNZA 3QSIA 5AXLA 1QVUA 1JUSA 1R1TA 5I3UB 5DM7F 2DHSA 4C3KA 4YR0A 1Y39A 3OSGA 2BY2A 3K8VA 5J1EA 4IPAA 4ABZA 3VGSA 5LMNJ 1IKVA 2ASLA 2JFDA 4K4WA 2RB7A 4M9ZA 1FWLA 1RWKB 1S59A 3HVTB 4JI2J 3O8WA 3MURP 2AXTC 1NPRA 4PPDA 2CJYB 5A8WB 3QWUA 1KFSA 3MM7B 2DYSH 1FKPA 1FYLA 3TAMB 2ZZMA 4J9LA 2EKNA 4BJTA 2M30A 5CD4H 2RUGA 4Y2MA 5D4PA 4LREA 4E2FB 5DGBA 3FXLA 2JWNA 3GILA 3AG3H 2HRYA 4JI8F 1YYVA 4MLOA 1MMDA 3DKDA 4WP3A 4CIOA 1RQ0A 2VPZB 4ZYEA 4AIKA 4LD5A 3FQLA 1YJWI 2OD6A 2UZAA 2A05A 2P7CB 3GTMJ 5HJYA 3TANA 2L4MA 3DGPB 2H8RA 1XGNA 4DFKA 1K6OA 1D8JA 5DJBA 3GFLA 4KA4A 4BCAA 1RISA 1TVRA 2HQDA 2ZD1B 5BR8F 1IBMF 3PVXA 2CIMA 4CO8A 4EMSA 1HC8A 1QM9A 2QL5B 3RIRA 3MEKA 2YKAA 2LFVA 1KLNA 5CH7B 4PSWA 1J2VA 2GC8A 1MNEA 4M5GA 4BACA 3AT1B 2A6HF 4KH0B 2XASA 3MCOA 1FKOB 2L4AA 1QA6A 1YOVB 1PYOB 1PUFB 1EIYB 4Y52J 1ODDA 2PC6A 4PCQA 2VXDA 3NMAA 1NDCA 1UTAA 1OSCA 2GHWA 1F6TA 3FK7A 5M2UA 3AHPA 4FS2A 3SFGA 3EJMA 3QFWA 4HPQA 1UVLA 1K4SA 2FVPA 2FPHX 4GXOA 4BHCA 2GIVA 5LFAA 3HT3A 4I2QA 2W85A 3QO9A 1T05B 3M8YA 4ZVSB 3H3VK 2ZH8A 1ZRFA 3DEWA 4OU0A 1GUUA 4DU8A 5GPAA 3RKWA 2JMWA 1N48A 2BHYA 2FRHA 3PFIA 1ACIA 3HULA 1NHAA 1J2XA 2P4WA 2KI2A 3FXRA 3PTWA 4B9TA 4HDVA 2FNAA 1XMOF 4ZP9A 1S1XA 2Y1RI 2R7XA 3Q8UA 3MI7X 1IUYA 3L7PA 2BM1A 3C14A 3KIOA 2WW4A 2NR0A 3BR6A 3FMBA 3T5HA 2CVIA 1NB7A 2KYZA 3L09A 3EETA 4NE9C 1KU2A 2ASDA 4BQOA 2GWRA 2PJPA 1RA7A 3C1DA 4AXJA 1VJQA 1RT6A 3F22A 1ZN2A 2ALYB 1D5YA 5B0CA 3O5TB 5HDGA 1UPPA 1UZCA 2NUUG 3WDOA 3W9JA 4BY1J 2Z2ZA 2HOAA 3CDWA 2YWHA 4A12A 4GVBB 4NBQA 4DGWB 3KLGB 4R8UA 4Q5SF 5J6XA 2RQPA 2E7XA 1RU1A 1W5TA 4ECXA 3IMQJ 5JI6A 2VQEF 4LRFA 5M3MJ 5DD4A 3ADAC 1N6QB 3C16B 4DS5A 3GO5A 2DTZA 3NRVA 2BE7D 2ZC4A 2D41A 2WVDA 2VQFF 3NWTA 3FRZA 5HO4A 2UUAJ 1HW2A 1RIOH 2E5LJ 1B70B 2RV8A 3I0SA 1PSDA 5ILSA 3GFMA 2B43A 4IEJA 2VD3A 1T0TV 3M1VA 5E3MA 4B4CA 1I5OB 3WGHA 3E51A 1S9GB 2JDJA 4RPFA 2KRCA 5J2PA 2VA2A 3PX4A 5HK4A 2KFDA 3PYDA 4I2PB 2ZJQF 3KHGA 2DOAA 1BD6A 1ZK8A 2ZFHA 1RT1A 1VBYA 2R93J 2R8GA 5T7LB 3Q24A 5D8LB 1WJAA 3DLEA 3E01A 3ZQQA 3GWCA 4LSNB 2LQJA 1IC8A 3FCHA 5K1YA 4P71A 2D5VA 1RTJB 5CXTA 2OTJI 5HJXA 3WU2C 3NLCA 4X64F 3K5LA 2DEJA 3FXKA 3PHTA 3JW4A 3KUGA 3KEOA 5KG1A 1HWIA 1AFIA 2YR2A 2F4OB 4IKAA 4G7ZF 4EM1A 5KT5A 1VC5A 3AH6A 2ELHA 3KJVA 4XKVA 5E1ZB 3TW0A 4I0AA 4GKKF 5JVTA 2GJ2A 3D7SB 5KG7A 1RYRA 1HQEA 1NPKA 4B44A 1XK8A 4JBCA 5DQHA 3CWJA 2WAQA 1OCPA 2CQCA 4B08A 3VAMA 2H27A 1FZPB 2ACMA 3I32A 5ETOA 5L38A 4GYGA 2HDDA 4ANCA 1TUGB 1TL8A 3UR0A 2PJRA 2KKHA 1Y8QB 3F23A 2ACJA 3OYJA 2UVVA 4HW0A 1GMUA 4KN7X 2LCWA 1VQMS 5HLIA 4ALZA 3CJ4A 2DH7A 4ZJZA 3GFIA 2XKPA 2IIHA 3QYYA 2LY9A 3ZZOA 2ZM6J 2IY5B 1BQNA 4QWBA 3BPVA 1RP5A 3R7NB 5DG8A 2RDIA 3QQAA 1TFWA 2KT0A 5E5NA 2V34A 3ZR8X 3W63A 3DV8A 4ER8A 1M0SA 1LJ9A 4DZ6A 4M5KA 1TU0B 4OL8A 5KT4A 4ZLLA 4D7NA 3T8TA 3HCXA 1BI3A 3HSDA 2CFOA 4KH1B 3QJLA 3D1OA 4TY8B 5BNGA 4CGZA 1RT2A 2AHOB 3VSLA 3GPAA 4A0ZA 2E5HA 5D6EA 4LG3A 3EWGA 3O3LA 3FZBA 3V5RA 4LF4J 2EFPA 1EKRA 4EUVA 1HLVA 2IJFA 2JEFA 2W9CB 4ZJQA 2LKXA 2Z58B 2NXEA 3J81U 4JX5A 5DDGA 4P2XA 5J8CA 2MKCA 3HPGA 1L3VA 3MKWB 1YRUA 3W2VB 4NDLA 3GTLJ 2EW9A 4A5MA 3E97A 3GFXA 3T1AA 1C0UA 2FZKB 1X1BA 3QOPA 2QQ8A 3CCES 1T8IA 1VQLI 3M4OJ 3G8QA 5C25A 2OZUA 3A4CA 1HBMA 4MTDA 4CLPA 4Y3OA 3RSNA 3ZMTA 1OS5A 1WKLA 2BMBA 2DYAA 1J09A 1JK9B 4NA3A 4RW9A 1S1TB 1W5CC 3ZO7A 1H89C 3NCRA 5K8NA 1R22A 1R49A 2EK1A 4KKOA 1VLOA 2DA1A 2IM2A 4NHJA 4LF9J 3F72A 3TGNA 2HQFA 4WIIA 4OYXA 1S5LC 3ZN0A 1FC3A 5C4JJ 4UHTA 2DHAA 2IRXA 4FS1A 2V50A 1YX5A 3AA8A 4JOMA 2M2BA 3R5DA 2GGPB 1S9EB 4GDFA 2Y75A 5HN0A 1LDDA 1S6QB 3RG6A 3OTBA 4TLQA 2DR9A 1BY9A 2VBZA 1MNMC 2EFVA 5LSOA 3CDIA 1WH5A 2QCOA 4I1TA 4G6DA 1R8AA 4FASD 2LBFA 5K14A 2FOWA 2MTLA 4NX9A 3ILIA 4M8LA 4AVZA 5J1EB 3RAQA 4AD6A 3HZJA 1M1HA 1NEEA 1IKVB 3OR2A 2JC1A 1S9FA 3HFZB 4QIFA 1BWEA 2N7YA 5DDQC 5D4OA 5HVQC 2FBHA 4Y65A 3QATA 3KYCB 2ADCA 5KOXA 1S6LA 1BXNA 1U0SA 2ZJQQ 1FKPB 4ENMA 1LEAA 3J81Z 1WKJA 3L2QA 1XNQJ 4P96A 2WAFA 1Q8IA 5KG5A 1E3HA 2C6YA 3BP8A 1Q53A 3OWTA 3IFEA 2AEJA 1M5OC 3K1MA 2LU1A 3JSYA 2JSPA 2KT2A 5E79C 5CLSA 3QAUA 2ZKUA 3EZ5A 4RU2A 1IBKJ 3EUHA 4ZKAA 4DR3J 1IM6A 1RK8A 3U21A 1YRTA 2DH9A 3M2VB 2V2KA 3ISPA 2DI3A 4O0NA 3P5BP 3HUGA 3Q83A 3WX4A 3BZKA 1ZS6A 5KFTA 1Z9CA 4ZPVR 3OTOJ 3RZOJ 2X1DA 4K4VA 2E5NA 3Q0WA 2CQGA 2H6CA 2XI3A 5CAAA 1KYWA 4M9SA 1YZ6A 1V5EA 1UEUA 2QE5A 4EGYA 2QEXI 1SFEA 3FC9A 2FYXA 4M5NA 3MVPA 2E34A 3TVZA 2G0CA 4OI6A 1FCAA 3CDLA 2BV6A 3E8OA 1PYSB 4G7OF 3KJFB 2VJUA 2H1LA 4KJIA 2RKHA 1FT9A 1XSVA 4H0EA 2IA6A 4DV2J 3A3OB 1I6HJ 5KOWA 4RAGA 1S1WA 4L75A 3V6KA 3DOLB 4MJKA 4Q45A 4I2QB 2HMIB 3QO9B 1O7FA 2K4JA 5IT4A 2EWHA 1UVIA 2AZ3A 2VE9A 5ITHA 3BLYA 1FDBA 1T94A 4F7VA 3I5CA 4K2JA 5K20B 2A6TA 2IGNA 1HDDC 4XLEA 3K57A 5F3TA 1MNDA 1LFWA 2XS7A 2R5YA 2Z2SB 1R7JA 3ML6A 3Q3SA 1Z3XA 1N0UA 3EUKL 1RKWA 2CJQA 2JT1A 3C14B 4J9MA 3SEOA 3JRFA 4IH6A 1R58A 1TWCJ 1SH0A 4ZVPB 4RNOA 3ABMH 4LR8A 4NLPA 4RAZA 4C8MA 2MMYA 3G71I 2XLIA 2EH3A 4FVMA 5ERIA 1W36C 2DNKA 2ZHAA 1RT6B 3NNCA 1TK0A 2QIFA 2XHCA 2FY1A 2LA4A 4NOHA 3CCWA 2GVDA 2KIUA 3WE2A 2QTWA 2YKMA 1U1OA 2FHJD 3LA7A 2XAJA 4GMKA 2KJVA 3MEGB 4KPCA 2HPMA 3D3CJ 1HA1A 3ZZZA 2M7BA 4ECQA 2QMUB 3KPHA 3JTHA 5FDLB 1HI0P 5HMWA 4B48A 3OOPA 1LFBA 2O66A 4OI4A 3IL2A 3JB9k 1EX8A 1AA7A 2WTFA 1OFCX 3QNWB 4MH8A 4DV0F 3OJSA 2ZITA 4PWWA 1U48A 1K4TA 3C6TA 1XX5A 1R00A 1CQNA 1WRJA 2OGUA 1HBXG 4RL1A 4LITA 4Q5VA 2QENA 2IEKA 2VH7A 3GZ6A 2HWVA 4ESFA 2JEIA 2HEKA 3IM8A 4KIBA 1XNRF 3IR6B 1UAWA 2E9RX 3MPWA 2X1BA 3M1VB 4QZVB 2XM3A 3HVWA 5AXMA 1IG7A 2AKWB 1YI2S 2ZJPF 2ZH4A 2PMZA 3Q5FA 4L9TA 1DFDA 2HWTA 3P5TL 2UV8G 1AFJA 3ZTQA 3DLEB 2GVZA 4FE7A 2HVSA 1S8NA 2BKNA 4F67A 4ZP6A 3QZ8A 4JI6J 1K78B 3H90A 3IWNC 1FX2A 2M3AA 2KRHA 1RRJA 4M5HA 2G4BA 3KX2A 4F0MA 2AS5F 2VUMJ 2RC4A 3BSAA 3UDVA 4LF6J 2ZNZA 4CCLA 1WSUA 1ZLJA 4A8OA 2MQNA 2ESHA 3KJVB 4K4SA 4CLUA 4OYMA 5I42B 4IYQA 1SD4A 2KHDA 3BTJA 1N77A 1IN8A 2KP6A 1TMMA 3HLUA 5FLXY 1HQEB 2XCPA 1JKOC 4A3KJ 4NNJA 3IS9A 4WF9Q 4CNYA 2HHWA 3JR9A 5KFJA 1WOSA 2M5YA 4USUA 2W1OA 1RTDA 4ED6A 2XMUA 4RNHA 1JLBA 1HHSA 2AJ4A 3SCLE 2BEOA 4AXIA 4FDFA 1U1MA 1FFSB 3KUEA 2PJRB 2QSGX 2V8DA 1SEUA 3MM8B 1T08B 1NDLA 4HF0A 5LL6d 2KXHA 2K8GA 1STZA 4KHMA 1HW1A 3VZHA 3HZEA 4KGXB 4P72A 3EYIA 2DQLA 4OHVA 1EKSA 5AE3A 4G8XA 1A04A 4LFAJ 3GFZA 1LW0A 2JH3A 3UWTA 4RAYA 4YFKF 4RNNA 3KP2A 1RTHA 4LRCA 3I3LA 1BQNB 2DJIA 3M7VA 2G2ZA 2Z99A 5LEKA 2OEKA 2ISZA 4LG0A 1NNDA 1R43A 4FN5A 1VDHA 5HLFA 4TVAB 5CVUA 4AIHA 5EJCA 4ELTA 4ID5B 2K7LA 3S93A 1D1BA 5F0UA 4IH7A 2R2TA 1IXRC 4D5FA 1RGVA 3CJQA 3T5KA 3J7ZI 3MR3A 5JFRA 4BJ6C 5CYQA 3BYPA 1V3RA 3M2UA 1VLYA 4DR1J 2BJ8A 2G2OA 4WCGA 3B4DA 3BZCA 2VKEA 1NMEB 3BCAA 4AYBN 1QU3A 2V26A 2WV0A 1JMTA 3HL2A 2E60A 2JJ4D 2E9ZA 1RT7A 4I56A 2CQDA 2BY0A 2WOMA 5KT6A 3QGGA 2DHGA 4LVOP 1B7YB 1C0UB 3GFJA 3PO5A 5I3PA 2L0KA 3NCPA 3IAS2 3JAMZ 1B99A 5C25B 1HBMB 4YIRX 2VT3A 1OCCH 2HZVA 2NYXA 4ZK7M 1UKUA 2M87A 2HHUA 2XMAA 2KISA 1A6QA 4YFXF 2Z0GA 3RW6A 4RW9B 4CT8A 3BGRA 1WWHA 3O2PE 3I0TA 2OH2A 4JI5J 5AE2A 3ONQA 4YB1P 2VBWA 5D4RA 4EM2A 4CM0A 2YKOA 3LH2S 2DQRA 4KKOB 3A8JA 3LAKA 4O44B 2YWWA 4W98A 2ZO4A 3OQ2A 4IG0A 5B0FA 3T8RA 2RIJA 3DC2A 1Z1DA 1J5EJ 2ROGA 1X4PA 1B0PA 4J9KA 1ZR2A 3BTIA 2ADUA 1ZYQA 2QZ8A 3DHWC 4GC7A 3UPFA 3S2DJ 4NMXA 3PV8A 4D3GA 4MGRA 1YG2A 2UXDJ 1Q1VA 3I9V2 1VFCA 2QSFA 4N9IA 4NXMF 4LF8J 4HACA 3C3WA 4M94A 4KYWA 3ULQB 1YWXA 2V4JA 5IV3A 2I5JB 1DBDA 4OI2A 3UN2A 4ITVA 1B9MA 3HTSB 4J9OA 2OCEA 2LBFB 1VGYA 4ZH4F 5K14B 1TWGJ 3DKWA 4YMEA 2L7ZA 1EZZB 1Z6TA 1F9FA 3OR2B 2FLLA 4PJJA 1PP8F 4KPYA 5EUHA 1IKWA 3BGOP 1FK9B 2QKLB 1G2EA 3D1NI 5EHHA 5J1RA 1TUWA 4CO3A 3G2BA 4QBUA 4IHXA 1U7LA 3S17J 2KFNA 2WAQN 2DGWA 2LEBA 2V9PA 5DG9A 3EYYA 1BOBA 1M5VC 3LSPA 1TP7A 2HNZA 2ZJPQ 2OUMA 3U2RA 4H54A 1N54B 2F8EX 5CZVA 3VFZA 1FJLA 1HR0F 3KP6A 3LAMA 2MABA 1WI8A 2R2RA 5A2QZ 3V4MA 3H0DA 1JLAA 3LPYA 1V55H 3KKFA 2X4HA 4WK3A 3QIDA 4RX6A 5LHIA 2RQ4A 3QIPB 5D4SA 2WSCC 3GJRB 4XMYA 2BANB 3ZZPA 2FX0A 4IQ4A 2M4MA 1SD5A 4M63A 3RPQA 1MWQA 2B0GA 3HUGB 3LSRA 2BYCA 3U7JA 3W5YA 5HQMA 2V8PA 2W4DA 2K9LA 1DURA 2ETHA 2KZVA 3THTA 4EZ9A 3SBMA 4B3TF 3NEKA 1S76D 4L5JA 4CTAA 3BZQA 5FRNA 5CCMA 1HNWF 5BPDA 1FSHA 4WFNQ 3J81j 4Z2YA 2HNDB 1JHHA 3BZ6A 2B5JA 4XTTA 2DN0A 3TQNA 4DG1A 2HKOA 3ETOA 2YNIA 1ZM2A 4G7HF 1L0OC 1LK7A 1B72A 4WXWA 3ZOBA 4IL6C 4ZP8A 3DBRB 4J9QA 4I09A 2JVHA 3E1SA 2EC0A 1S57A 1X2NA 2H1YA 3VAIA 4N0BA 4UT4A 3WTSC 4BC7A 4CCJA 2HQIA 2YXLA 1U0HA 4RR5A 2K2PA 3QT6A 1T8EA 4DPXA 1REPC 1FE4A 3RRGA 3VALA 3PFYA 3JREA 2A6MA 1N5TA 5M2PA 3LA3A 3V7SA 1SL1A 4RGRA 4PYAA 2PX9A 3FMSA 1NH3A 2R7WA 3DLKA 2FQ4A 2FHOB 4P74A 1LWFA 2D9PA 4C11B 2ELKA 2O01C 1VBKA 2XAHA 3ZMVA 3I0RA 2BE2A 1APSA 3MCZA 1TZLA 3LA2A 4FXWA 3W1YC 3EXYA 4ZMMA 1U5TA 4ZPCA 2HVZA 3I54A 2IYIA 3ITHA 3CD5A 2K06A 2XRLA 2Z2MA 4M73A 1RT5A 4XBFA 2BE9B 1BM9A 1HBOA 1X58A 4X65F 3BPSP 4BHPA 2UWMA 2ZH3A 2GVDB 2LKSA 2YKMB 3JRAA 1JTXA 5T41A 3W7BA 2XNQA 2DCUB 3H92A 3L1PA 5L3CA 2HBQB 4S05A 4HR2A 3HKZA 2ZBQA 2L9WA 4QPTA 3ERED 3R3TA 5L1LA 1NJWA 1NB2A 4X4RA 3S3OA 4DX7A 1RWVB 4F4YA 2CUJA 4DEZA 3HHKA 1TL5A 4O23A 1TWHJ 2AHQA 1VRUA 3ZGKA 4II2A 5GMKa 4E7IA 4OYPA 2RU3A 1C4CA 4U0WA 1KS2A 5KFOA 2K3KA 2HU9A 3K2YA 2LNBA 1M1GA 3GMEA 2BW2A 2XDVA 4ZTJA 5KFUA 1KYZA 6FDRA 3CF2A 3A8IA 1DY3A 2DOFA 3K1NA 1RHRB 1NDPA 3P3DA 2CW8A 4JV2A 1HD0A 1O3QA 1BI1A 2VKZG 5A0YA 2Y31A 4PGHA 2A07F 4QPXA 3H98A 4ELVA 4MEYF 2F6CA 1PJ6A 3VAHA 2VASA 3HRSA 2GVZB 2UVWA 1L3SA 2A69F 1VQYA 3UDEA 1NK4A 4DX6A 2UXBJ 3QT8A 1G2HA 4RMNA 3TP2A 3TZXA 3NGUA 4A3LJ 5CVRA 5J3LA 1WJDA 3TI0A 1YJ7A 4Z37A 3EPIA 1EH7A 2R3SA 4FF2A 4Z7YA 3GTPJ 2B9YA 4B3SJ 1VQ4I 2X6WA 1P9YA 2J6UA 1R9TJ 1TW2A 2E1AA 2BGCA 1GLNA 4L0ZB 2W2QP 5C4XJ 2C2DA 3I55I 2ABYA 4RU9A 3DGVA 1UEVA 4QIGA 4CWBA 1W0UA 2R92J 4DZPA 1OO0B 5D77A 3BR3A 1SQEA 1ZR4A 2WVCA 1REVA 3G1MA 2UUAF 2ISYA 2E5LF 3M07A 1V9OA 2MSTA 4Q43A 3ULHA 1NKBA 1H73A 4O4RA 1PP7U 2YPZA 1MZBA 1SKWA 2M88A 2UXCJ 3HG9A 1H7WA 5GAEU 1FDNA 1WJ9A 1IV6A 4LRDA 3KK3A 3PDNA 2W2MP 2PA8D 1KA8A 2W2OP 3W9IA 3DQVC 2A2DA 4DSFA 3GX4X 3VHQA 1KU9A 2W00A 4PXCA 2JRMA 3PHEA 3RBDA 3MD1A 1LW0B 1UWAA 2OJ3A 2OLWA 1FY7A 1B1BA 3FNNA 1HPZA 1RTHB 2CQXA 1NJYA 1XERA 1F1ZA 4P9SA 4CXFA 2W7OA 5F8HA 4LG0B 4EK2A 1TR0A 3NAIA 1SAUA 1OR7A 3GSIA 1FIAA 2C3YA 4P75A 4ZVRB 9ANTA 1LNQA 4XIDA 1UJ5A 2UXNA 2RF2A 3BC8A 1MBJA 2X9DA 5CYQB 2X1CA 1PAUB 2QG9B 5BOXA 7FDRA 2ZEJA 1N4LA 4LQ3A 2FJ1A 3JS9A 3M2UB 4OZ2A 2B9WA 4WP9A 2DGXA 1SUQA 2HK3A 2FVRA 4ZVEA 9RUBA 4XLFA 2LFBA 3AOBA 1R23A 2R7ZJ 1VRTA 1FJEB 3MMYB 1YO5C 3QAHA 3WODF 3KNGA 1RT7B 1WD6A 1XCBA 2XPUA 4AQYJ 2WOMB 2B4OA 3BQ0A 5HMYA 2OKQA 4PFOA 1D1AA 3D5LA 5KFFA 3TZZA 4CM2A 1HNIA 1Q8KA 1R31A 3VYTB 1EQMA 1KD1T 3O8HA 4WTYA 4PJNA 2AT1B 3UVJB 2O5RA 3R0JA 1D8ZA 2IC3B 4CA0A 3W9HA 2ZMEB 3D0HE 3EDQB 1XGMA 2XIGA 3BREA 3BGRB 1FNXH 2DY9A 2F5GA 4NYPA 5DRKA 1HYSA 2BUNA 3J7YI 2ZM6F 3I6PA 1BI0A 1LKZA 3CNQP 1YKWA 2DA5A 2QJ3A 3BWGA 2YQ1A 1WSVA 2VKDA 4FT8A 1ON1A 2Z1DA 2YWKA 1ULRA 2A3SA 2XZDB 2HZAA 5F8LA 1DPUA 4RUCA 1RKJA 2D69A 5K7HA 3TYTA 4X0GA 2H1KA 2KJWA 3NXZA 2LEPA 1N32J 1GFWB 4ECVA 3DDKA 3Q0VA 4E8UA 1Z3YA 3OYHA 3CUQA 3OYMA 1XTAA 3K6GA 4K4ZA 5ETVA 3EGZA 3MM6A 1BQXA 3LGHA 4LRBA 3BG7A 1UJ4A 4LF4F 3H5SA 3N05A 1UJ8A 4YB5A 1PDNC 4PG7A 2F5DA 2ZKTA 4J37A 4M71A 3LGMA 2H65B 2ZE2A 3CCLS 2UUBJ 2GJFA 1F4KA 2JA6J 3T3FA 2CQ3A 1FRXA 3THVA 1LFPA 1A36A 1VIXA 1RUOA 3FHNA 1IKWB 2XYHB 3LA0A 1UWBB 3CCEI 2EWNA 1VQSA 1U49A 4QR0A 1Q8BA 2GIRA 1S48A 3IH3A 1ETWA 3R1HA 4A6EA 5KHDA 4ESBA 1UELB 4Y2IA 2HNZB 1FFGB 1Z6RA 2QSWA 4C48A 2QRRA 4Y2AA 2ME6A 5KFEA 1CS4A 1ZELA 3GG1A 5E7OB 1CF7A 1ZRDA 2EA4A 1JJCB 2R4FA 2V4RA 2JEJA 1FMWA 3PSFA 4FX0A 4LF9F 1JLEB 1WZ2A 4M3BA 1TK5A 2CFXA 2A61A 4ZCLA 1IR2A 1OYDA 3V7RA 4FHTA 2XSJB 3H40A 1WELA 3GE9A 3IBWA 3BGFA 1FJGJ 3J80Z 1NK3P 4USTA 1MSWD 3K7RA 1QPMA 4BH9A 4XRSA 2RSQA 4N9HA 2PA3A 3FGVA 2DA6A 1H88C 2FLNA 4X6AJ 3CCRS 2UV1A 1BC7C 5F8JA 2WHOA 3TUPA 2CVEA 4IVNA 4CTAB 4YB7A 2F5CA 4KICA 5FLVA 2B5JB 4DG1B 3X1LB 4UF4A 1D9AA 2YNIB 1UHWA 1S6OA 4CCMA 3NGRA 2LECA 2UUCJ 3I96A 3U27A 2DODA 5FFZA 2NPFA 2DPDA 4RWWA 3QLHA 1BW6A 3A2KA 1W36D 1WWXA 1FWZA 3PRVA 3MCSA 2STWA 4DUZJ 4G6QA 2KDZA 3OR2C 5EX3A 3L2VA 2PI0A 4IFYA 1R1VA 3ZC4A 4U0VA 3SQGA 1D1UA 3RKXA 3HHLA 2DGSA 2MYFA 3PRBA 1UA1A 3G1LA 4V2GA 5J40A 1A0OB 2HQ5A 1NZ8A 5JLXA 4EV0A 2RGVA 3MAJA 1XNQF 3KDOA 3GP9A 1KZHA 2GMJA 4XPCA 4K4YA 3DLKB 4K0KJ 3N97A 1P6TA 2CQNA 4C9DA 1U4BA 3I0RB 2BE2B 5LBQA 4PQAA 2R42A 2HS4A 1SJFA 4USHA 1JT0A 4CHUA 2AGOA 5FB2A 3SQOP 2DHHA 3L7UA 3ITHB 2HVRA 1X1DA 2Q79A 3AG4H 4DU7A 2DR6A 2H48B 4I99C 1RT5B 4YHHJ 2CKWA 3GTYX 3GIIA 3EUHC 3DCFA 2B63J 1HBOB 1WC1A 2WY7Q 4NWBA 1MH3A 2OIHA 2AYEA 3OTOF 5HL7Q 4B8XA 4DIQA 1S5ZA 1OYYA 2FXAA 2DNMA 3JRDA 2G13A 3EGWB 4F04B 2XY7A 1G3WA 2V7FA 5IM0A 2MJUA 1ITYA 1KC8T 2BE5F 4PK4A 1BN5A 3TKYA 1R0BG 3GR0A 1P4WA 4Q48A 2M0MA 2OI2A 3HB9A 5DCMA 1VQPS 1HCRA 3CJRA 3PJWA 3IO1A 4NCGA 5K9FA 3WTYC 4Q0BA 4YR2A 1YIOA 4AE5A 3TUZC 1JLCA 2EV6A 3S32A 1JJ6C 1B6AA 4Z6YA 2NZCA 3ZQHA 4IFVA 2DR7A 2LVSA 4N41A 1N36F 3BR5A 4DV5J 3JCUC 3BR8A 1P4XA 1W7PD 3PNVA 1WEYA 1Y9OA 4NLSA 3BQZA 2DR5A 1U3EM 2H5EA 1SL2A 2M5WA 4U87A 1YITS 2M7AA 3UCGA 3M05A 4F7ZA 3TO6A 1G6BA 3R27A 5A0YB 3UKGA 4XRMA 1B0TA 5M3FJ 5IC6B 3MEDA 5LHGA 3ZN1A 4UUVA 1SKSA 2HZDA 3HGYA 4A3DJ 2ZBRA 2UU9J 2NVXJ 1QSSA 3JSPA 2J9DE 3GR1A 3JTOA 4DPWA 5T14A 5AJ3F 4FXDA 1Q16B 2X85A 3OBIA 1N88A 3NKYA 3CMQA 4CP5A 1Y6IA 2OEMA 3RGIA 2J5PA 2XRNA 2RRBA 3KCCA 3BY6A 4ANDA 2KVQE 5E33A 1R5GA 2HEOA 2IBOA 2XYPB 3GW2A 4NLQA 3IBFB 3PNYA 2UXXA 4ILRA 1BC8C 1S7OA 1KQSR 1UVJA 5U47A 1DU6A 5LJ3Y 4M9XA 3K4KA 4MYUA 3OFFA 4GVLA 1RB0A 5E3NA 3KK3B 1VI0A 2HURA 2IHR1 1NBEB 2OSRA 3GLJA 3MTKA 3UD3P 2GA1A 4JI8J 1YI2I 4C2MA 3D67A 4NLDA 4MIWA 5D5UB 4KHRA 1Y00A 4HHJA 2VT2A 2EIJH 1AT1B 2K4BA 5H9EK 3R5BA 5IT9U 3HO1A 1BQMA 1HPZB 4WIQA 2K85A 3W61A 3M8WA 3GJSB 1JGSA 4BEHB 3MWMA 3R7SB 1AXQA 4U95A 3WTZA 2DNHA 2YQ0A 4O4GA 1KONA 7FD1A 1OQ3A 2B4VA 3KK2B 1A6IA 1ETYA 2M8HA 2YS9A 4F93B 2OQRA 5ICFA 3HHHA 5KTQA 3EMTA 2RF2B 3C19A 4LF6F 2V4QA 2KFYA 4ZITA 3FXOA 3VDXA 4HBLA 1E6YB 1SUQB 3GYGA 3HSJA 2DMPA 1MLAA 4H4KA 1BW5A 2FQ3A 3JSBA 1SC7A 3HKZN 1VRTB 3BN7A 1BJAA 1WJCA 4TU8A 2BACA 4ENKA 5KAIC 2JQ7A 3LP0A 3P9IA 1ZQ3P 2HVDA 4DX5A 1KQ8A 2DNGA 1T11A 3DU6A 1SCJB 4HYEA 2BJ1A 1HNIB 1IQZA 2HFUA 4ZTFA 5H1SV 4ITSA 3N9UC 5BXIA 4N4NB 2DXIA 1AUSL 3HFVA 3L4BC 1RAGB 3QWPA 3UW1A 1XMOJ 4MFBA 4ZJOA 1WG5A 2ATCB 2EILH 3C2GA 3NG8A 3GYXB 2RQMA 3HJFA 5L1IA 3D2WA 1S9HA 5ED4A 3AJ2A 5D0HA 4DL3A 2CQ0A 4PUOA 3S7RA 3DRSA 3IRQA 2PFBA 4UVAA 1S4FA 2BRKA 5IY5H 3MHYA 2GV1A 5HVFA 2HAIA 1WACA 5KFXA 5HLTA