2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
b'DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
5ERIA 1H2VZ 4YIIA 1X5TA 1YJNS 3KP5A 3IHUA 3UCUP 3KP3A 4WFAQ 1SD4A 2O8XA 1G4DA 3TO9A 1FYLA 2DGQA 5DUIA 1Q1HA 3QPTA 4BYYA 2LF7A 2DK8A 2WBRA 3HHNB 3ECOA 2ZJ2A 2COMA 4JQFA 2EFNA 5IQQA 1ODDA 3WTZA 2CPIA 3VOEA 2DH9A 5CVRA 2DNHA 3TKYA 1Z1DA 4N0BA 4LIRA 2ZJQQ 1YG2A 4ASNA 3RTRA 4UNOA 3MUVP 3CDHA 3KE2A 1SAXA 1KD1T 1YIOA 1FY7A 1SJRA 1A9NB 4TU9A 1WQ2A 3KEOA 1AWCA 1QPMA 3J80K 3B4DA 3T0YA 3R1HA 4Q4ZF 3CXCR 2FY1A 3CC7S 3FM5A 1XGSA 4G8XA 3BDDA 4MTEA 1LVAA 2BE5F 3MCZA 3VF0B 5AIPA 1WEZA 2GA1A 2YPRA 2XUBA 3COAC 3VEPA 5DCFA 1NU4A 5JVTA 3G73A 3NS6A 1TBXA 1K9MT 1QNTA 1J75A 1FYKA 1S7AA 4F7ZA 1DP7P 2F3JA 1VQNS 3HRUA 3IWZA 5DYMA 1X4HA 2MQNA 3Q2SC 5LHHA 4EGYA 2O3FA 3S01A 3NNCA 1N88A 4RU2A 2A3JA 3ZP5A 5E20A 1MZBA 3ZZZA 3DP7A 2QA4S 2K86A 2CQPA 1HBXG 5F64A 2HWVA 3BY6A 2LA6A 1D5VA 3ERED 3E5QA 2N3LA 2M8DB 4M74A 4HDVA 2ZNZA 1O3RA 1IN4A 1O7FA 1VQ8S 3EYIA 1SXLA 2DH7A 3GFIA 1JE8A 2MA3A 1H2TZ 3C1DA 5DM6Q 5JI6A 4KUMA 1P1TA 3UE2A 4E70A 2EK1A 1DRZA 1IN5A 1QVFR 5HL7Q 2LSOA 2A6HF 1FO1A 2YR2A 4NQWA 1G2EA 2FC8A 1KQSR 2MQQA 1XN7A 3GWZA 3F8MA 4MEYF 1BI0A 3BROA 3RDIA 2CG4A 2VC1A 2OJ3A 4XSZF 2VONA 2GZWA 2L08A 3ZMSA 1R8PA 1U1KA 3QP5A 4H0EA 5CA5A 5CVIA 3PQJA 5ED4A 3CO6C 2MLGA 1WG1A 3ZQ7A 1YW7A 1Z6TA 2P5LC 3JTHA 4HA8A 2MHNA 3HI9A 4A5NA 4CGZA 2ACJA 4A0XA 2ZCWA 5DD8A 3RYPA 3WTVC 4CQ1A 4G7ZF 2XNQA 2CQDA 2PN6A 4ERDA 1UFWA 1TW2A 2FXAA 5BPDA 2VT2A 1D8JA 3LA2A 1DBDA 4IUFA 1YJWS 4FXWA 4Z2XA 2E5IA 1WF0A 1U6BA 2Y48A 1KYZA 5F6FA 4EV0A 3IRQA 3K2ZA 1PUEE 2XS7A 2DK5A 1FJ7A 2LF8A 1VC5A 1B9MA 4IJAA 4HOBA 2QWWA 5D5WB 4PGHA 1SMYF 1CVJA 5D6FA 4TU7A 2H09A 1R5GA 4EGLA 1ZYRF 3UD4P 3G3ZA 5E17F 5BQTA 2LCWA 2M1BA 3ZMTA 2U1AA 2RV8A 2F9DA 1XCVA 2RNEA 3BWGA 4MTDA 1P2FA 1B9NA 4HX8A 1BC8C 4B8XA 3L7WA 3R60A 1X0FA 2G9WA 3BJ6A 1R00A 1XGMA 2CQ3A 1KQ0A 2DH8A 4L9TA 3I59B 1M5OC 3ROUA 4R79A 1ZG5A 2QEXS 4M6XA 2V9VA 3PIOQ 3L2CA 2MKKA 2MJNA 5KVRA 1YQAA 4WF2A 4Q5SF 2RS2A 2CQBA 2DAOA 3EDPA 3GVAA 2UXXA 2W25A 3CTRA 4UY8T 4ENKA 1R36A 4LFUA 2UZKA 1VC0A 3DPTA 1OR7A 1P92A 1IXSB 3K1MA 2X1FA 2MPUA 1WI9A 2WC2A 4P96A 1IAWA 2CQIA 4M73A 1R7JA 3F22A 4WKRA 4P6QA 3V8KA 1M1KT 3RKYA 1BBYA 1QGPA 1QBJA 2NNNA 3WTWC 4UXNA 2DNRA 4YB1P 2DNNA 4O3MA 1OYYA 3MQ0A 1IW7F 2ADUA 2KIMA 2DNPA 1J7KA 1FT8A 3RKXA 3KFWX 3LA3A 3GXOA 2KM8C 1FSEA 3DF8A 4CHUA 3E97A 3EGNA 4Q48A 2B0GA 2K7LA 1K7AA 2VOOA 4ON0A 1OKRA 1D8ZA 3K9TA 1VQOS 5D4RA 2RGVA 1FWZA 3WTTC 1XSXA 1B4AA 1FJCA 4EMSA 1U8RA 2CQ2A 3R4KA 3GX4X 5LXYA 2J0QD 3KP2A 3NEUA 2AYEA 3T1BA 2EWNA 5FD5A 4W90B 1T98A 2HDCA 3BOQA 1NO8A 1LNWA 3K1NA 3SXLA 2GHPA 5J8FA 4WIIA 4G7HF 4LK0F 2STTA 2FC9A 1Z9CA 1ZRDA 1WEXA 3CO7C 4KA4A 4C7QA 1RKJA 3VAKA 1EH8A 2DHSA 3IL2A 3G8SA 3J81Z 2GAUA 2F9JA 4KMFA 2MJUA 3E3VA 2R7FA 1Z05A 4QU7A 3HRMA 4HLXA 2XROA 2G4BA 2M5WA 2Q2EA 3H3UA 2O6GE 1FT9A 2KI2A 2E7WA 1OPCA 5EN1A 3DXJF 5FD6A 2V6CA 2M2BA 2DO0A 4I2OA 2HFHA 3R61A 2KT5A 1HQCA 3GFJA 5ICGA 2PMHA 1P4XA 3CF5Q 4OIQF 4LMZA 3KLNA 3ZPLA 4L9JA 1A7GE 3M1EA 2KG1A 4A6DA 2EFWA 5E8GA 4LLNA 2KYXA 4RAZA 2D1VA 2QQAA 5D8KB 1ZHFA 1ZG3A 5F1RA 4G94A 2DQRA 1IUYA 1DHMA 5L3BA 2LNBA 2FRHA 4QLCU 2J76E 4G9YA 1YJ9S 3ML6A 1RI7A 3QOPA 2H94A 2RQPA 4XLNF 2I38A 2EK5A 3TQNA 3LPYA 4XRFA 2JTVA 3F21A 4LD5A 2KJCA 5IM0B 3CCES 3ULHA 5GAHU 2E5GA 4AVPA 3FXQA 3SZTA 4M71A 4F25A 5ICFA 4IVNA 5D5UB 5LEKA 4XLPF 3IRRA 2RRBA 1J5YA 2DFIA 2VXZA 1X4GA 4U7BA 1IRFA 5CVUA 3CUQB 4BHPA 4ZYEA 2LEAA 1WSUA 2XHKA 3I58A 2VOPA 3DXBA 2EVZA 1LEAA 4M9ZA 1KGSA 3KEQA 2RC4A 2FNAA 3HIFA 4A0ZA 3SMZA 5L3FA 3SDEB 4I0BA 2JSCA 1O7LA 2GA2A 1Z6RA 1B59A 2QBYA 5EEGA 2L01A 2DT5A 3HYIA 2IJLA 5LBQA 3LSTA 2CPXA 3BP8A 3IKTA 2I2YA 4V19X 3IKVA 2K3KA 1HKTA 1FJEB 4MQ9F 1ZZNA 1T39A 2X1AA 5L3EA 2XB2D 1WTBA 4Y0FA 2O3DA 4D0PA 2ZJPQ 4ESBA 3MZYA 4ZYDA 2LEBA 3CCVS 1BJAA 3VB2A 2UP1A 3C18A 3G6ES 2ZFWA 1P6RA 1Q7YT 4QQBA 5K5QA 1K73T 3DLLQ 1FYMA 4AIJA 3I71A 2MSTA 3THTA 1YW8A 1ULYA 1DUXC 1AUDA 5AIQA 2XS2A 2YKAA 1H6KX 4ESFA 2CFXA 1WF1A 2DIUA 2DPDA 4ED5A 1Z7UA 3R0JA 1VBYA 1UB9A 2DGUA 3TP2A 3LQVA 2OU2A 1MJAA 3THPA 3SXYA 1XSVA 2MLKA 3KETA 2M52A 2E1CA 4HX4A 2JVOA 2ZKZA 1X5PA 2RKHA 4U0VA 1ZLJA 5ICEA 1RUOA 2DGWA 2WTEA 3QU3A 5IT3A 1FNNA 2DHXA 1MJBA 5LRSA 4KYWA 2HS5A 1VQLS 3N9UC 2Z3YA 1FLIA 4S04A 1XDSA 1S6LA 2F5DA 2LXUA 1YTYA 4KN7X 4P9UA 2YH0A 4ZKAA 4YFKF 1IRGA 2PG4A 3CUNA 5MLCV 2IVMA 3DEUA 1U2WA 2CQ0A 3FMQA 3CCQS 1IN8A 1XN9A 1WI6A 1C0WA 1IN6A 3BJOA 4A12A 1V4RA 1HA1A 4AD9A 2LMIA 3E6BA 2KIUA 4MNUA 1VQKS 1BIBA 3P5TL 5HLIA 1TLHB 1X4CA 3P9KA 3RPUA 4YFNF 3UWTA 5DCMB 4EJVA 4RAYA 1LDJA 5HDNA 5IT9K 5HLGA 2OQGA 2IA0A 3IRWP 2FU4A 1KC8T 1ZGAA 3KZYA 2PFBA 4U88A 1BIAA 1VBZA 3WGGA 2OQRA 4PGGA 5FO5A 4DNCA 2Q0OA 3CC4S 5K5RA 4FHTA 2HKOA 2FA5A 2MBFA 4I09A 1ZZFA 2RDPA 4AIKA 1K78B 4IOCQ 5A2QZ 2RS8A 3U1MA 1REPC 3ECHA 4GO1A 1KU3A 3LFKA 2ZNYA 5FLXZ 4LLGF 3G4SS 2VBZA 2MY7A 4B09A 3FM3A 1RK8A 4CXFA 3REOA 5H1SV 3EETA 5CVJA 1J0RA 5EEHA 1DPUA 1O3QA 2BBYA 2TDXA 2DK2A 1GHCA 2P4WA 4L9VA 3TDZC 3HOSA 2L54A 3LQRA 2STWA 2CWEA 2HTSA 3CCRS 1J2XA 5ICCA 2L3DA 3L3CA 3F6VA 3V4GA 1N52B 3FZVA 2HTJA 5D78A 4MQVA 5DUKA 1KU9A 2IA1A 1L0OC 2MZJA 3CD6S 3K1PA 4P5OA 4KFCA 4GGGA 2HZTA 2Z5UA 5BOXA 2GXGA 1YFHA 3K69A 4MHGA 3V4MA 2PQ8A 3TO8A 3RW7A 3J81K 3MEXA 2PEXA 2DGXA 2L4MA 3HSFA 5FJ4A 2M4MA 2QM3A 2O03A 2DTRA 1JJ4A 3NNAA 5DETA 2HYGD 1I27A 1ON2A 4OOIA 2CPYA 2HGMA 5BJRA 1YLFA 3ZMZA 1ZGJA 3G8TA 1IZ1A 3H92A 4GXOA 3CC2S 1HSTA 1KOOA 5J6XA 1R22A 1FHTA 3MAJA 2DB1A 4I7HA 5H6QA 1I1GA 3I55S 2KXHA 4IO9Q 5BS6A 2CQHA 4M72A 2VBWA 4CYDA 2DITA 1HL6A 2FF4A 3R6SA 1FPQA 2DGOA 2L4AA 4M6YA 4ZYGA 2NAZA 3PIPQ 3P7NA 4WK8F 1U5TC 2NLWA 2K02A 4Y17A 3VALA 3F8BA 3TDUC 3M8EA 1M5VC 1O3TA 4HF1A 2RT3A 3E5XA 3F23A 1X5SA 5FB2A 3MXHP 2H6BA 3QPHA 5E18F 3GO5A 4LGWA 2M70A 1SJ4P 4OIPF 5HS7A 5GVQA 2Y0MA 3W6JB 3WE3A 3V7CA 4FT8A 3T5XA 1FBQA 2RNJA 5D8LB 5DDGA 3I0TA 1G3TA 2K4JA 1UAWA 3US5A 4LK1F 4WXHA 3F8NA 2KG0A 1ZLKA 2M45A 4IHSA 2DNMA 2ELHA 4K2EA 1X3UA 1BI1A 2FEZA 1IXRC 1QZZA 2EB7A 3N97A 4CICA 3E6MA 1U1OA 3CJNA 1UFMA 5DDOC 4R1HA 3WG9A 4J5OA 2HGCA 2IT0A 3DPLC 2BV6A 5L3GA 3FXUA 2V94A 2PLYA 5LHIA 1LDKB 3MDFA 3B4MA 5IT9Z 4HAMA 5DDRC 1H9GA 1I5ZA 2H27A 3IWNC 2K27A 2MQOA 3BS9A 1TTYA 2QZ8A 1VQ9S 2KHCA 4Y15A 3TO7A 2ETHA 3DFGA 2NZ4A 5E1ZB 1L3KA 1CGPA 4CO8A 1JHFA 1R1UA 3L00A 4RS8A 4Y00A 1JGSA 2X4HA 3R27A 2R7DA 4BH9A 3IC7A 2CGPA 2Z99A 5H6RA 3MI7X 3WODF 5CLSA 2GIVA 4IHTA 3P3DA 1URNA 2MKCA 3SQNA 2NNYA 4LMYA 1GXQA 3Q2TC 3CTAA 1U78A 1HW2A 2FOKA 2MXYA 2XAGA 2BYVE 3KP6A 2KXNB 5TJJA 2D45A 4ZZDA 2J5OA 1U5TA 1FX7A 3P9IA 1UCRA 4HF2A 1PDNC 4A2UA 2X0LA 3Q5FA 3NS5A 2MB0B 3Q9VA 3JTGA 3TOBA 1XGNA 2XNRA 3CPWR 2LYVA 3S7RA 2P7CB 2XASA 3UD3P 1STZA 2HQNA 3H3ZA 2DGVA 4L5JA 4AWXB 2HYFA 1I1SA 5E8IA 4BHBA 1RUNA 2RVJA 2V79A 2EV0A 1BI3A 2KIFA 2CPJA 1QVGR 2MZSA 1KU2A 4KDPA 1ZAOA 5DD4A 3NRVA 2LDUA 2W57A 1Y0UA 3MUMP 1USTA 3KZZA 2F5FA 2XAFA 2D2WA 3D2WA 2XVCA 1W7PA 2ZMEB 1W5TA 1OO0B 4G6QA 1D8KA 4LB6B 3H2UB 2AYMA 2MZTA 4RB0A 4JK1X 3KP7A 1MDMA 3PQKA 2FNPA 1W4MA 2P6SA 2A68F 4WX9A 3GZ6A 3RPQA 1T2KA 3TO6A 1IXCA 1G3WA 2EA4A 4JBAA 4N9HA 2CPDA 1M90T 2QLZA 1ON1A 2GQQA 4IRHA 4A6EA 1SJQA 4OU0A 2XSFA 4HX7A 3ISPA 2H6CA 1I6XA 2MQPA 4I98B 2V1XA 2DW4A 2OSQA 2M87A 1X4FA 2MGZA 2EV6A 4A0YA 4OIRF 1TQPA 1OIAA 4KICA 5D6EA 1SD7A 3BO3A 2CYYA 2MKJA 2HQRA 3VAGA 2A69F 4UUVA 4IF4A 2MQMA 5A2QK 5D5XB 3L9FA 4XBFA 2NRAC 5GAEU 3VFZA 1X4EA 3MFKA 2JZYA 2BGCA 2VBXA 5FLXK 4UVCA 5IFMA 3S8SA 4WXDA 1U1QA 1MD0A 1LQ1A 3I54A 1UP1A 3U1DA 1OPIA 2P5VA 1E17A 1F1ZA 1XGOA 2CQGA 5K1YA 2RUGA 4CZZA 5CJ9A 4PZJA 3HOTA 2F5CA 1SFXA 2KFYA 3D0SA 2MYFA 4EM1A 2D3OR 2DGTA 3ZMDA 3IWFA 3QU6A 2OD5A 3HTUA 4BAYA 2M8EA 1JJ2R 2AYBA 1TQMA 3NQOA 2MZQA 4RB1A 2XKOA 4TLQA 3SFZA 1VQPS 2D9OA 3CCLS 5DDPC 3C7JA 1H9TA 5ILVA 2IA2A 4OMZA 2AD9A 1WWHA 3OOPA 4KIGA 2MSSA 3WE2A 2NYXA 1LEBA 5JFRA 1SJ3P 4EGZA 1VQMS 2V1DA 4UV9A 4W92B 3VAHA 5D4SA 2DI3A 2XKPA 2CQKA 2JRSA 2KRRA 2C6YA 4WF9Q 5H20A 1O57A 4EJTA 3DKWA 2AYGA 1QM9A 5DV5A 4TU8A 5LSLA 2HKXA 1X4AA 2LA4A 4EJOA 4I0AA 1SMTA 2B0LA 2EFPA 5HO4A 3GEZA 4IXAA 5LSOA 4O5VA 1YITS 2E44A 4OMYA 1AOYA 1S29A 3O3KA 2X1BA 5LJ3Y 5L3DA 3N4MA 3S2WA 1PP7U 1SFEA 4TV7A 4LG0A 2A61A 1IN7A 4UVBA 2OBPA 1B1BA 5HDGA 2FE3A 4LJMA 2DNLA 3E5UA 3E6CC 1WG5A 3ZMUA 1ZH5A 1ZN2A 2LXIA 3QP6A 4U0WA 3BO2A 2QFJA 1S72S 1RIOH 5LEJA 3LAPA 2ZJRQ 1VQ6S 1DZ5A 5JVHQ 1EH7A 2XRNA 2HR3A 2P7VB 3OV8A 2FSWA 2KM8B 3CCJS 3C3WA 1LJ9A 2KRBA 4HLYA 2VE9A 3CMAS 2P5KA 2D1HA 5DCMA 4FXVA 1MKMA 2DNQA 1Z91A 1VQ7S 2DBBA 4NHJA 2G7HA 3G96A 1Q82T 3MUTP 5LRRA 4PDKA 3JW4A 4A5MA 2GO9A 2OAZA 3TOAA 2MKSA 4BXUA 1WKMA 5HLHA 2EA2A 1HKQA 3LWFA 2QBYB 2MZRA 1B6AA 2PE8A 3GUDA 1HD0A 1SD6A 3VAJA 3R0AA 1O0PA 2XV4S 2MD5A 1Q81T 1K78A 2ISYA 2KXFA 2O0YA 2JWNA 3CMES 1R1TA 1IF1A 2DIVA 3CCSS 4S05A 2SXLA 4FX4A 4YIFA 5HDKA 4HV6A 1U1RA 1S7OA 4XSXF 1QO0D 2JX2A 3SHFA 2QVOA 3U2RA 4WFBQ 4CDGA 1K6OA 2J8AA 1KU7A 5HS8A 2G1DA 1FXLA 4BHCA 4HZFA 2F2EA 4WXCA 4EQQA 2PMUA 5HOOA 2FMLA 3BJAA 3FX3A 4R8HA 4UVAA 3F72A 5DM7Q 2G7UA 3WTYC 1PP8F 2F5EA 4QPTA 1G3YA 1X4DA 5ILSA 5LGNA 2IPQX 3P6YC 1KA8A 1QZYA 4GYGA 1DDNA 1XDUA 5ITHA 3AAFA 4PCQA 1D3YA 1YI2S 1R5HA 2DU9A 1VTNC 3GZ5A 2N82B 2Q8KA 1CF7B 1T6SA 2ADBA 4CH1A 2L02A 4EVIA 1OMIA 1BOAA 1DPRA 2GXBA 3FF5A 2J0SD 1YYVA 3FMSA 1IQTA 4OZ1A 3O2PE 1U1MA 2N3OA 1XCBA 1SJFA 3P49B 4Q47A 1M5PC 2Y75A 4KT5C 2XS5A 2V1UA 2CPZA 4NB5A 5DEQA 1PGZA 2MZ1A 2DLLA 1RNLA 2DQLA 1HSJA 4HDUA 1FBSA 4ETSA 1F9NA 4G7OF 2DHAA 2CW0F 3MD3A 2W85A 3H2VE 4ENMA 1TNTA 5GMKa 3FXRA 4PKDB 2OA4A 4Y13A 1W2BR 2VN2A 4IOAQ 1QQIA 2PEHA 4YFXF 4L5IA 1USSA 2CO5A 2CPHA 4U7DA 5JVGQ 1WHWA 1L3LA 2FQ3A 2BZ2A 2ADCA 1UW4A 3HRSA 2DHGA 1HD1A 5GADU 3R1LA 2HVZA 3M7GA 2KKOA 3RYRA 3CCUS 3MD1A 3G71S 1WI8A 2YWKA 1JJHA 4YOEA 2D9PA 2ISZA 2CQ1A 4Z2YA 5CVVA 1YO5C 2XIGA 1UHWA 1GXPA 1HW5A 2FHOB 3EQLF 3FMRA 2HZCA 1HKSA 4UQTA 1SFUA 2OZUA 1J59A 2DNOA 2BEOA 1OYIA 1BI2A 3HTSB 3VAMA 1R58A 4EM0B 1JHHA 1RZ4A 4QWQA 4P9FA 4WWCA 1U2FA 2DNZA 3FEYB 3KLOA 2YX7A 2KH9A 5LGTA 3I59A 1U1LA 5GAGU 1R8HA 1U6FA 3JB9k 1VC6A 3I5UA 1JMTA 1MGTA 2E5JA 3J7AO 2LQ5A 5FFXA 3OW2R 2E5HA 2MH9A 3Q9SA 1PO6A 2OIHA 3DV8A 3EX7B 2ESNA 1VQ5S 4AIHA 1A04A 4IRGA 1WHYA 4LB5A 3HHHA 1FNXH 3K0JA 2M7SA 2FBHA 2M0GB 2FPHX 3FWEA 1WEYA 2EJRA 2YTCA 2RQCA 4HW0A 2RVCA 1ZRFA 1LB2A 5CYJA 2EK6A 2IW5A 5FFZA 3M9AA 1T38A 3TGNA 1ZARA 5JR3A 1BC7C 2HGLA 2KVIA 5JHUA 1YW9A 3JSPA 1WRJA 3T8TA 4RGSA 2DNGA 2RRAA 2GWRA 3I64A 2CJKA 3E6DA 4HQEA 4I01A 1XB4A 4IRIA 3JAMZ 3EYYA 1F9FA 2VT3A 1ONVA 3CCMS 4MEXF 1P27B 2RU3A 4WCGA 4L18B 3RJPA 3GFMA 2M8HA 3CUQC 4KIBA 2KU7A 4EJWA 1U1NA 2ESHA 4F26A 1Q86T 2J5PA 3RI4A 1MJ9A 2UWMA 3F8CA 4KIFA 2MKIA 1NHAA 3HSEA 2EFQA 1FBUA 2A6EF 2A5YB 3GW2A 1HXDA 1TNSA 2RN7A 5LJ5Y 2HYIB 1ZREA 2MKHA 1N8RT 2BOPA 4RB2C 1FSHA 4BQAA 1JXSA 1YS7A 4RGRA 4KNYA 4YG2F 1J9IA 3WGIA 2ZMEA 3BPXA 3CUOA 4UV8A 2A07F 6PAXA 4DQ2A 3GLXA 3J80Z 5LHGA 3B02A 3NNHA 2QUFA 2VBYA 3EUHA 3QAHA 2OZ6A 1F4KA 2YU3A 3PFIA 1TW3A 5LLQA 2N7CA 3RKWA 5K5OA 3NMRA 4ZZLA 2YX4A 3JSOA 2CQCA 4OZ0A 3ZN1A 3BO4A 2YSRA 1K79A 2EV5A 1G3SA 5HVQC 4F02A 1U6GA 2DPUA 2Z9OA 1OYWA 2KRFA 3FHZA 2JPCA 4OIOF 2RQ4A 4WFNQ 2DNKA 2MH2A 2Z33A 4M9SA 5BPIA 5E1XA 3J7ZT 2VODA 3VAFA 2XGXA 3BEGB 1W5SA 3WTUC 3T8RA 4KMUX 3WTSC 5KK1A 5CXTA 3WGHA 4ZYHA 5FGMA 1W7PD 2ZO4A 1NJIT 5IM0A 1U3EM 3U9GA 1KQ8A 2MY8A 1T0FA 1LDDA 2X1GA 1VQ4S 2XAHA 3WU1B 1YHQS 4FX0A 4RGUA 1EV7A 4OINF 4BNCA 4U0YA 3V8LA 1R23A 3CUQA 1K8AT 1TQIA 3ELKA 2AXLA 3HRTA 2MC3A 1YIJS 1FC3A 2QQBA 5LXRA 2OTJS 4M5DB 2CPFA 4A8XA 4P55A 1S8NA 2LKPA 2CPEA 1BN5A 4EJUA 3SDEA 1H0MA 5HS9A 2DO7A 3MZHA 1WG4A 4C4WA 1M5KC 3LAJA 1P4WA 3DQVC 1WWXA 2QENA 2FBIA 2UXNA 3KP4A 5DDQC 4ENNA 1S79A 3HUGA 3P9CA 2XAQA 2O61A 3QRFF 1U5TB 2WWYA 1X4BA 2NS0A 3RIRA 3KCCA 2IRFG 3WTXC 2DGSA 2ZXJA 3CLOA 1G6NA 2P8TA 2JT1A 3ULQB 2OTLS 3B73A 4O6JA 2FMYA 1KOHA 4RB3C 4IPAA 2MMYA 3O6BB 1FZPB 3HHGA 2MQLA 2HOEA 1FP2A 3FEXB 4WCEQ 3MURP 2ERRA 2M9KA 1R1VA 4GCVA 3SZPA 4GYIA 5CYVA 2VE8A 4HF0A 3I4PA 3UCGA 4HQMA 2YH1A 1WHXA 2PBIA 3GYHX 1D9AA 3F6OA 5D77A 3ABUA 2DISA 2DO4A 1YWXA 4C0OC 5BMZA 3UCZP 4HBLA 3HSRA 1X5OA 1HW1A 1W7PB 5AONA 4RGXA 1O3SA 1FOKA 4LLLA 3I56S 1UHMA 3BZ6A 3WU0A 4ENJA 4L9NA 2CSOA 3MOJB 1E2XA 4MGRA 2PI0A 4U67Q 2OSRA 3ZZYA 4HYEA 4PR6A 1MDMB 3K0LA 4L0YB 2L9WA 3U1LA 1OWXA 3F3XA 4M9XA 4PRFA 2HEOA 1B7FA 1N54B 4ESJA 4G6DA 2KJBA 1BM9A 1EH6A 3VODA 3BPVA 2MGZB 1WELA 1WHVA 2HGNA 3TYTA 1S3JA 4LJZF 5LGUA 4HV5A 4UHTA 2DNYA 2JVRA 2W84A 1XMAA 2FBKA 3G9CA 3LA7A 3VAIA 1WF2A 2Q79A 2QYOA 3V7RA 2JPBA 2JRTA 1P4AA 2IP2A 5D5VB 2K8GA 1F5TA 3I53A 2ZBKA 1H2UX 4N9IA 2XAJA 3V8JA 4CH0S 1XSDA 3ABTA 2E1NA 2QQ9A 2AS5F 2CQ4A 3GFLA 1KQ9A 4KN4X 4EM2A 1VBXA 3L09A 1ZG1A 5E1WA 1KYWA 5TRDA 3J7YU 1XD7A 1XMKA 3GF2A 3ZN0A 2R3SA 3V7SA 4I02A 4BS2A 2PJPA 2LKZA 2M30A 4L0ZB 1BY9A 3ZMVA 1CF7A 2WV0A 3D5LA 2LECA 2K4BA 3CULA 1GVJA 3W6KB 2L41A 2W24A 2E7XA 2G0CA 4QU6A 2U2FA 2EFOA 1U1PA 5L3CA 3LQQA 3EGZA 1V3FA 3M8FA 2VC0A 5J8CA 3S6EA 4YUDA 2A3SA 5ILUA 3MWMA 2P6TA 2KN4A 3JAMK 1SD5A 4LG0B 3RW6A 1FP1D 2M88A 3F8FA 4ZH4F 1YS6A 4CIOA 1ZRCA
chains in the Genus database with same CATH superfamily
5ERIA 4DV3F 4ZVTB 3EXCX 2I9SA 3UCUP 4K4UA 4WFAQ 1FYLA 3C66A 1YIJI 5DUIA 2XYPB 4FVMA 1Q1HA 2LF7A 3HHNB 2B5JB 2COMA 1RCXB 3LL7A 2DYRH 3H40A 4OV1A 4A8OA 2ZJQQ 1FFWB 3LWLA 2WV1A 3EVWA 2VF3A 4NLVA 4MLOA 2PSZA 3CDHA 1UZDA 5DJBA 2G13A 1KD1T 1U2RA 4B3OA 1GNKA 1YIOA 1FY7A 1SJRA 1WKLA 3K8WA 3JSRA 5EWEA 3KEOA 1JKQC 4J9SA 4DR5J 1EX8A 3B4DA 3FUYA 3LOUA 1FOXA 2FY1A 3M30B 2OTLI 1IM6A 1XGSA 3QO9B 2BE5F 3R3TA 3C6UA 1Y11A 4N7TA 1CJTA 4DR4F 2GA1A 3M8PB 2XUBA 4PFOA 1HBMA 3DN9A 5JVTA 2KRCA 4XOPA 2DODA 4DBQA 1K9MT 3A8IA 1NJZA 4R0EA 1S7AA 3Q3SA 4F7ZA 1EKEA 3H1CA 4B3MF 1N32F 3Q2SC 1MG7A 1FKAF 3ZP5A 3OT9A 2EQRA 3S3OA 2GX8A 1UWAA 1Q16B 2QA4S 1K44A 2JEIA 3BGRA 2VKDA 1HI8A 5F64A 1RA6A 5GMDA 3FZ2A 3I3LA 4FBTA 2M8DB 2VJIA 5HJYA 4HDVA 2QYCA 2ZJPF 1TK5A 3NGSA 2ID3A 1HI0P 2KPMA 4IHYA 1YZ7A 1WCMJ 3GFIA 2RIJA 3OBIA 1JXLA 2CUZA 4N4NB 3GMEA 5DM6Q 2JLFA 4ZS6A 2X1EA 1J5OB 3NGKA 1TVRA 5HVHA 3V6KA 1QVFR 2E2HJ 2LSOA 3M8QB 1FO1A 3CJKB 2BANB 2ZH8A 2GVZA 4FPRA 4OX8A 2XGPA 1XN7A 3F8MA 4MEYF 4DUYJ 2CG4A 3W5ZA 2VC1A 1S72I 4IQ4A 4LF5F 3ZMSA 3TQEA 1R8PA 4KIAA 2JA6J 2HQCA 1RHQB 4XICA 5CA5A 3QMQA 2AJ1A 2LREA 4D1QA 5KFNA 3ZQ7A 3D28A 2JWTA 1QZEA 2P5LC 5T41A 3T19A 1U0SA 1F6TA 3TW7A 2XY7A 1ERDA 4DLGA 2AZ3A 1A36A 3RBXA 3TZYA 3VVTA 4ELUA 4M6VA 1ZAVA 2DA1A 1T9VA 3ZQGA 3RYPA 4CQ1A 5JUMA 4ERDA 1RZMA 2FXAA 5BPDA 1D8JA 2FB0A 1DBDA 4IUFA 1YJWS 2CRGA 4HI1A 2Y48A 4IFVB 5C7PA 2FJEB 1KWMA 4K4XA 1QJHA 2G0JA 4LIWA 1PUEE 1FJ7A 5DM7F 4OX7A 3OVSA 1VC5A 4RBVA 3CCSI 4MFDA 4PGHA 4XIDA 5EDWA 2WY7Q 2M7BA 4M5GA 3MM8A 4TU7A 3H5SA 2HQDA 2C3MA 3HKZA 2VFRA 3SEQA 2OELA 3OR1C 3LFUA 3ZMTA 2RV8A 5M3FJ 2RNEA 4MTDA 5A8RA 1KLMB 2E19A 4HX8A 3TAMB 3KWMA 1BC8C 1AROP 1L3VA 4B8XA 3CESA 1S6PB 2G9WA 3BJ6A 2BOLA 5CCMA 1KQ0A 3B6BA 4V2FA 1M5OC 2I8DA 3BYPA 2HS3A 3CJ3A 3DLBA 3LSMA 1V5GA 1BR1A 3L2CA 2MKKA 5KVRA 2WVFA 1YQAA 3KLFA 4LVNP 2RS2A 2GW8A 2RHQB 4M8LA 2LY1A 1HWKA 4NPOA 2CS3A 1LK5A 1RABB 2ZKTA 4UY8T 4ENKA 2PT0A 3K59A 2UZKA 5KFFA 3QSIA 3DPTA 1Y8RB 2ASLA 1GXTA 1IXSB 1X0PA 3OD2A 3K1MA 4UUTA 1N36F 2WC2A 3IUOA 4J9PA 2CQIA 2W82A 4ED3A 1RTDA 2FVQA 1T9XA 1R7JA 1NB2A 4DPTA 1ETWA 3RKYA 1QBJA 4UXNA 5KG4A 1VQSA 3SJMA 1I3AA 1NHUA 1T05A 1VQNI 3ESWB 2J9DE 1J7KA 1UVLA 4FETA 3DRSB 4XL9A 1FSEA 1H73A 4DUZF 4PWWA 4KKOB 4DQIA 1RWXB 3DLHA 1X8DA 2FZKB 5F04A 4ON0A 3NBPA 2ZZNA 5D4RA 2RGVA 3WTTC 1F3VA 5KOXA 5E2QA 5DQIA 2E1RA 1U8RA 1RT1A 1S1VA 3OYNA 2E2IJ 2KHMA 4AT1B 3IM8A 4DXLA 2AYEA 2G0EA 3T1BA 3FCHA 1TL3A 3BOQA 3OVAA 4OJHA 1JNRB 2BVMA 3H9JA 1VQ8I 5J8FA 2GHPA 3OR1A 3CCUI 3W1YC 4G7HF 1VQYA 5HJXA 1C4AA 4LK0F 4Q7AA 1YRNB 2V9PA 3BGOP 3EVMA 2STTA 3PW5A 2NXCA 2NXUA 1B8IA 1RKJA 2DHSA 2F8EX 2DD8S 4IO9F 3J81Z 1I3OB 3FFIA 1B0VA 1ZPWX 3E3VA 4QU7A 2AX1A 2HZDA 3TUZC 2KI2A 3IAS2 2ROPA 3DXJF 2V6CA 2M2BA 2W1OA 2ALYB 3DYAA 3GFJA 2PMHA 3M05A 4OIQF 3HBLA 3KLNA 3W9HA 3ZPLA 4L9JA 4UOGA 1A7GE 3M1EA 2KYXA 1UVMA 2QQAA 3LP0A 1ZHFA 2KT3A 1ZG3A 3A01B 4R5PA 3GIRA 3BQZA 2ZH9A 2DQRA 5DG7A 2R7VA 1DHMA 2LNBA 2FRHA 4QLCU 4G9YA 4NCGB 3QOPA 3TQNA 3UQSA 3RBDA 3TR5A 1FKOA 3LGNA 2KJCA 2QO3A 3CCES 3FXQA 2R7TA 4M71A 5LEKA 3IRRA 2XWYA 2VXZA 3QYBA 2K9LA 4D3HA 2W9CA 3CUQB 1UETA 4BHPA 4ZYEA 4U95A 4QR2A 5CYQB 3EZUA 2Z30B 1KGSA 5B0GA 2UXBJ 4EU0A 1NDKA 4CLKA 4NBQA 5L3FA 2UXDJ 5IT9U 4DS5A 2V6EA 5EEGA 2L01A 3HD1A 2DT5A 2CV0A 4FBUA 2ZITA 5LBQA 4DW6A 1OCTC 1JLCB 2CPXA 1P6TA 5F8GA 3FBEA 3RAMA 3IKTA 4A3KJ 2I2YA 3M2UA 1Z3XA 2HHUA 4Q43A 1HKTA 3GJQB 3HVRA 2X1AA 2V5HG 5L3EA 2XB2D 2OEJA 3IBCB 5CABA 5I42B 2HRYA 1DFDA 2ZJPQ 4ESBA 4ZYDA 1RCOB 3VB2A 4WKYA 5KFCA 3C18A 1N5TA 1T33A 3CJRA 1UVNA 1VYAA 4I67A 3AA9A 1N34F 4XDCA 1FRHA 4K5SA 3A4TA 5K7FA 1T56A 4AIJA 3TMOA 1TQLA 2IGNA 2V68A 2QCOA 3THTA 1VRTB 2BY2A 2WSFC 5D4PA 1DUXC 3QGIA 2W7PA 3DLAA 1BD6A 2CVEA 2YKAA 3JAMY 1H6KX 5ETKA 2DXDA 2DPDA 4ED5A 3AL0C 3CO0P 4IG0A 2OI2A 1UB9A 2DGUA 3TP2A 5D4OA 3ZQCA 3LQVA 4O0NA 2IVFB 2OU2A 1MJAA 1M0SA 3BR9A 3THPA 3SXYA 2MLKA 1Z2LA 4P7VA 1WDDA 1RTHB 2B6AB 3AOBA 1P1LA 2ZKZA 1X5PA 2VG5B 4U0VA 1ZM2A 4PZVA 5CCLA 4TXSA 5F8JA 5IOYA 4V19J 1Y5LB 2Z3YA 2MYSA 4GVBB 4S04A 1S6LA 4A3LJ 4KN7X 2YH0A 4WP3A 1UTAA 4IRKA 4YFKF 3FKBA 1VHFA 3R7NB 1WDTA 2FLLA 4U7UD 5F8HA 3DEUA 2CQ0A 3TBIA 3CCQS 1XN9A 4PYDA 5ETLA 4BS9A 5GAGI 2WA0A 4I6WA 3DBLB 3JSBA 1HA1A 4AD9A 2DXFA 4MNUA 2HG4A 1UVJA 3GWCA 5DGBA 4BE2A 4ATNA 5HLIA 2R2RA 1X4CA 2DOEA 1X2NA 3FXKA 3A1YA 5DCMB 1FDDA 1B7YB 5HDNA 1RT4B 3L95X 2XSJB 5ETOA 3IRWP 2ID6A 1W1WE 3CDBA 4ICLB 1DAXA 1PIEA 2ZEJA 2C22A 3GG0A 3KZYA 2LXFA 1B99A 3P5JA 4U88A 2CIMA 2PI4A 3MHYA 2OQRA 1L3UA 1D1AA 4PGGA 3PEJA 1BWEA 3CC4S 3DM2A 3HT3A 2R2UA 4EBEA 2HKOA 2FA5A 5H2FC 4ECVA 5F0WA 4AIKA 4A8WA 1BQNB 3U1MA 5U47A 4FZVA 1KU3A 3TX8A 4HYKA 4DI6A 3E1SA 2BUNA 2LP0A 1N6QA 4JV1A 2XC7A 1XMBA 1OISA 4DV2F 1Y00A 1LWFA 1VDHA 4UB8C 1FJGF 3I56I 5CVJA 1J0RA 1HBUB 2UVVA 5IV4A 2BBYA 1QHHD 2DK2A 1MMLA 5B1BH 1SC3B 4L9VA 3MAHA 3GSIA 3HDDA 4X64F 2CWEA 5D0EA 2HTSA 4TY9A 3IS9A 4LITA 3CWJA 5D78A 2XHWA 2QJ3A 5EZHA 3QFWA 3QLHA 3FXMA 5B3SH 3CD6S 5J4YA 3K1PA 4GGGA 2HZTA 2NOGA 5BOXA 2QA2A 1AKHA 1LVKA 5HANA 3R5JB 4B3OB 3KK1A 3V4MA 2PQ8A 2YX1A 4F4XA 1YKWA 1X1AA 2PEXA 4IQJA 2L4MA 3HSFA 5HMYA 2M4MA 2VU5A 1N48A 1HWUA 5LSRA 2HYGD 1I27A 3C6UB 1HNWJ 1CJTB 3OR2C 1ON2A 3QYEA 4OOIA 5BJRA 1HBMB 2VG7A 4G1QA 2UUAJ 4PPZA 2K06A 1S1XA 2AEMA 3CC2S 4X66F 1TU0B 4F2RA 1KOOA 1HNVA 5J6XA 4NLSA 4ABZA 2CUJA 1VS3A 4MYUA 1YK9A 2XMMA 1MSWD 4I7HA 4WWSA 5LMUF 2QLBB 1I1GA 1RWMB 4JV5F 4LIUA 4NCBA 1FIAA 2J9DA 4IO9Q 4C8YA 2CQHA 2VZ9A 2DITA 2FF4A 1FPQA 1WVRA 2DGOA 3BGRB 3BKTA 4DV2J 2L4AA 1E3PA 4ZDLA 2J6TA 2BJ9A 2NAZA 1FJGJ 1U5TC 4D5FA 1GK8A 2NLWA 3VALA 2M9HA 3F8BA 3M8EA 3RZDJ 4LFCF 5FB2A 4HEA2 2MLXA 2H6BA 4DR1F 1HWIA 4LGWA 2R4FA 4ITSA 1SJ4P 3AD9C 1I6HJ 2AJ4A 5GVQA 4XDDA 3HKZD 3WE3A 4QTRA 4HDHA 4FT8A 1FBQA 5GTHC 5IS2A 2BHZA 5D8LB 2Z57B 1Q5YA 3GJRB 1IDYA 4LK1F 1HFEL 4WXHA 4DG1A 2BE9B 3L4BC 2GVZB 2B8QA 3QQAA 3SBMA 4KPYA 1FVSA 3E6MA 5DDOC 2HU9A 3VGUA 3WDOA 2UUCF 3DPLC 2H65B 2K3PA 3SEZA 3W7BA 2EIKH 2QLXA 4DPWA 4OZJA 2PLYA 2FJDB 1LDKB 1VK8A 3CJSA 4HAMA 2WB1A 5A2QU 1H9GA 3IWNC 2K27A 4I76A 3BS9A 2HHWA 1Y0HA 3DNCA 4NC7A 4Y15A 1R71A 3OR2A 3PHEA 2ETHA 3I96A 3DDKA 2BJ7A 3DFGA 2GZOA 4CO8A 1SAUA 2YWWA 4BXXJ 1LXNA 2R7DA 2BY3A 4BH9A 3KJVA 3IC7A 5ETVA 3ZQQA 5L1LA 4NXMJ 2KZZA 3WODF 4JI1J 1EB0A 2MKCA 3W5YA 2JMWA 5D6GA 2FD2A 3H8YA 1LUJB 4E7HA 1RQ0A 5IPAA 4DSEA 3Q2TC 3FKIJ 3CTAA 3NRBA 3BCAA 1U78A 3A02A 4DGWB 3NP5A 5JVGF 3DFEA 4ZLJA 4I7FA 2BYVE 2BYCA 2WY8Q 2D45A 2IDLA 2J5OA 1U5TA 1FX7A 4JI0F 2EZKA 2OUMA 1QAJA 1JKOC 2X0LA 3NS5A 5A8RB 1RT7A 3FIWA 2L48A 3JTGA 2HKEA 1XGNA 2IBOA 4G12A 3CPWR 4KJIA 3CJQB 2XASA 1WPKA 2BJEA 1HNZF 3C3LA 4AWXB 2EW9A 2DT9A 2E1MC 3CCRI 3NRVA 3V42A 2A10A 4IFYA 3KLFB 2DPIA 3MMAA 2F5FA 5BNGA 2D2WA 4F92B 1W7PA 1RHMB 1W5TA 5EUHA 1HQUA 1S49A 3EM1A 5E5NA 1D8KA 3H2UB 2MZTA 4RB0A 2EBIA 2RMLA 2HOAA 1RLDA 3DOMA 2FNPA 2DCEA 3NOGA 3J7YI 3MEEA 3GZ6A 1T2KA 4K50A 2P0WA 2PFDA 1G3WA 2I0XA 4ZJQA 1RTDB 3SDBA 5DZ7A 4KBIA 2BRLA 2A6MA 1RLCL 2B4PA 2GQQA 2K40A 1SJQA 3PUBA 1I6XA 1FD8A 1TFYA 2V1XA 2OSQA 2Y9ZA 2LR8A 4ZITA 4FYVB 5D6EA 1SD7A 4Y28C 5CQGA 3I55I 4IF4A 2XMUA 4DU7A 4H4MB 3OUYA 5D8HB 1X4EA 3MFKA 3R5AA 1NM2A 2BGCA 4JI0J 4RL1A 5FLXK 1RT1B 4UVCA 1U1QA 3S8SA 1FTCA 1GAOA 2CQGA 1SVDA 2HNYA 3N05A 3TI0A 2RUGA 3MTKA 5DS7A 4PZJA 1BR4A 2V50A 1IC8A 3D9BA 1TL3B 3IWFA 3QU6A 3HTUA 4BAYA 2AIRB 1Q5VA 3QZ7A 4I2PA 1T9UA 3OR1B 3BSOA 2Y9YA 4AVZA 2AYBA 2VQEF 2MZQA 1MMSA 2VICA 3IR5B 2DRDA 1K0VA 2DT7B 2BZTA 3C7JA 5G4DA 3FFIB 2NYXA 1LEBA 1S0NA 3PIOF 5K8PA 3MPYA 5D0GA 2CQKA 4JI6J 3NAIA 2ZH5A 2RAQA 2W4PA 3UW1A 1O57A 4EJTA 2EXUA 1WOOA 4TU8A 2B9SA 2HKXA 1X4AA 3V4IB 4EJOA 1SMTA 3DYAB 2EFPA 4B4CA 4CTAA 3H5NA 2QA4G 4O5VA 4E7JA 4IG3A 4YFUA 1SB6A 1FIPA 2B63J 3PYGA 4RNNA 5L3DA 2R7RA 3N4MA 4NC8A 2BA9A 3S2WA 4JX5A 3LTOA 3GV8B 3LMMA 2YNHB 4IHXA 3LP0B 1SKRA 1V3RA 1L3TA 4R5PB 4J19A 2LYCA 3E5UA 1U09A 1WG5A 3J81j 2O01C 4PJJA 2R8HA 1ZH5A 2QSFA 1FKOB 2CZ9A 3ET6A 1UJ8A 4QYZJ 5LEJA 2ZJRQ 2VQGA 1DZ5A 2YKOA 1FKPA 1EH7A 8ATCB 2XRNA 4LF9J 4YR2A 3MEDA 3CCJS 2E36A 2P5KA 1NNDA 1N75A 4I99C 3I87A 1IKWA 4FXVA 4TNOA 1XPXA 3BQYA 1VQ7S 1AZSB 1Q82T 1PBUA 3AQOA 2MKSA 1H3DA 3FJ2A 3GCMA 2C1EB 2ZC4A 5M5YJ 4IQXA 3QT7A 2FX0A 4OWRB 5HLHA 3T1YF 3HM9A 3PJXA 2KRHA 1SD6A 1HD0A 3VAJA 2CUFA 3R0AA 1T9WA 1M1GA 2VJ5A 1D1CA 3W65A 1S9EB 1R31A 2HPUA 1DY3A 3DRYA 4BBYA 2Z58B 3H25A 3BTJA 1R1TA 1IF1A 1S1UB 4PG8A 5E3PA 4P75A 1S7OA 2JX2A 4KSEB 3U2RA 2VLAA 4NLDA 2G1DA 2BQRA 5A0YA 4HZFA 5FLVA 2PMUA 2FMLA 3F72A 4PXBA 1JJCB 4DV4J 5K7ZA 5IP9J 3DCFA 1PKUA 2ZWPA 3AHPA 2F5EA 3L1PA 3DTIA 1G3YA 5GAHJ 2IPQX 3KMSA 1QZYA 1FTZA 3DKDA 1DDNA 5ITHA 4DV7F 2LKXA 2F4VJ 2NREA 1XMOJ 3K70C 3NWSA 1R5HA 2BKNA 3C6TA 1GXUA 3Q86A 4JYKA 1CF7B 5L46A 3NGUA 4IG0B 1LKXA 1M1HA 4CH1A 4EVIA 5FKNA 3HOXJ 3ZZRA 4DL3A 3PO3J 1G6BA 3V6DA 3Q8RB 1YYVA 1X9SA 3FMSA 2ASYA 3M6WA 3O2PE 3FQLA 1U1MA 2GAGC 4CO0A 9ANTA 4KT5C 3G8QA 4CLZA 1HHSA 1IKVB 4Q8FA 1S4FA 2MZ1A 2W4SA 1JNZB 1HSJA 5E3NA 1G7CB 2LMDA 4M95A 5B0CA 4A47A 4ETSA 2HFNA 2FZCB 2QSGX 3H2VE 2OEKA 2GBYA 2AJQA 2JA2A 3CQZJ 3H5YA 4C11A 4U8YA 4OJ3A 1TR0A 3FXRA 4Y13A 3NGTA 5DQGA 3Q0VA 1TMJA 1SIZA 3Q8PB 1ACMB 4Z7CA 4JI7J 2CPHA 3VR1A 1IBLJ 5JVGQ 2OP5A 3M9MB 2NS7A 2OPRA 4CDIA 4RUCA 3PM1A 3TZWA 3L7UA 2HVZA 3M7GA 3S2DJ 3RYRA 1T9TA 3MD1A 4WBFA 2YWKA 1S57A 5HMXA 3OS2A 4F3QA 2CQ1A 1YO5C 4XLFA 5FRNA 3DLLF 3U7JA 3FMRA 2VI6A 3SYZA 2VUMJ 4UQTA 3W8PA 4NI2A 4DZDA 4FYWB 4HHUA 2ZZTA 4K4VA 1OQYA 1OYIA 4C2UA 1R58A 4P9FA 5FLMJ 1KHWA 1N6QB 2Y30A 4P74A 2DNZA 3AL0B 2HBZB 2COLA 4CZCA 3D3CJ 1U1LA 2F40A 1Y3JA 3AXMA 1MGTA 3J7AO 2V67A 5KFZA 2HOTA 2VKEA 3SDGA 3DV8A 4CLPA 3A0HC 2LVWA 1VQ5S 1A04A 3HVAA 4WU2A 4LB5A 1T3OA 5EX3A 3HHHA 1FNXH 1SI9A 3VQSA 4I6AA 4I2QA 2YTCA 3O3LA 4A8FA 2HBQB 4MT1A 2RVCA 1DQAA 1LB2A 3IR7B 2RQQA 1W36C 2EK6A 2IW5A 3DEEA 5KT5A 1AKHB 2YWEA 1MROA 2HGLA 4DL0C 4RNFA 5JHUA 3LW5C 5J4VA 4YRVA 2C2RA 2MTLA 3VYRB 2GWRA 3PX6A 1T0FC 4MK7A 1XB4A 4IRIA 3JAMZ 3CCMS 3DRXA 2NXNB 3RJPA 4G1QB 3GFMA 1S1XB 4KIBA 3CW2C 4JI3F 1HARA 2ESHA 1LKZA 3O8WA 1OLTA 2R5YA 3GB0A 3HEFA 2PGCA 1QVTA 3D3BJ 4QSHA 3RI4A 2UWMA 2D69A 4M5LA 3BPSP 2MKIA 3OFFA 3GW2A 1HXDA 5LJ5Y 1JLEA 3B82A 1X3WB 2QGFB 3S1NJ 2MKHA 3E7LA 4JOMA 4ECWA 1FSHA 3Q8UA 1D0XA 2FJXA 3WGIA 1S48A 3JRFA 3NNHA 1EETA 3AJDA 5JMNA 2FJVA 3AQPA 2OZ6A 3K5MA 2AQEA 2FHKA 4ZJZA 3PFIA 4A93J 3NMRA 4BHQA 4ECUA 2CQCA 4OZ0A 3ZN1A 2A2DA 1FRIA 3GTKJ 3BN7A 1FOWA 1E6YA 4J9VA 3VSLA 2DRAA 3H90A 4DG1B 4WFNQ 2GAHC 3ISND 2Z33A 1IKXA 4C0HA 3CLQA 3UFCX 4S0MA 1ZA2B 2ELJA 2LDYA 4BDZA 2HHXA 4JI2J 1GDTA 4KMUX 1FE4A 4K5RA 4X4QA 2ROEA 1AT1B 1LQ9A 4EATA 1W7PD 1SL2A 1T0FA 2M3AA 4I6YA 2OPQA 4AYBD 3AFHA 1RAHB 3WU1B 1VQ4S 3JRDA 3RQ4A 4FX0A 3K17A 4U0YA 1WD6A 1R23A 4A48A 2JZ5A 2BJDA 4NLQA 4EEYA 1YIJS 1BLUA 3D1OA 3KJVB 4A8XA 3WHBA 1NSAA 1JUSA 1NAQA 1HPZA 1BN5A 4CO2A 3SDEA 1H0MA 1CJUA 1WG4A 3MZHA 3V5RA 4C4WA 3T5HA 3CDUA 5F9NA 5GP9A 5DDQC 1H38A 3GTOJ 4I7FB 3HUGA 2HVEA 5HATA 2O61A 4BJ6C 1U5TB 3KCCA 4CSWA 4W97A 3ULQB 2OTLS 3K2AA 3QWUA 4IPAA 1RT7B 3BDEA 2HOEA 2HFZA 3FEXB 1VRUB 2HHSA 5KFMA 3PM9A 3E01A 4BC7A 4OI0A 2VE8A 4HF0A 3I4PA 3EWGA 2PBIA 4E7SA 3F6OA 5A8KB 1YWXA 3CGIA 2BJ1A 2BR0A 3AB4B 4IFYB 3MMAB 4OFZA 4EYIB 2BJ3A 1W7PB 5AONA 1HQUB 1UPMB 2L7KA 2M3DA 4P2MA 4RLEA 1RHRB 1XMQJ 2CA9A 2CDQA 2HVDA 1Q7LB 1XIQA 4PR6A 2HWTA 3DOMB 4BU2A 3MEEB 2ME6A 3K5PA 2JC0A 4RZRA 2IBDA 3U1LA 1OWXA 4A69C 1VOMA 4BL0B 3GTLJ 2ZHOA 2VJUA 3NAUA 2HEOA 3FXLA 2Q1ZB 1VHIA 1N54B 2PFFB 2DTZA 4ESJA 1KKHA 1SC7A 5AXLA 4G1PA 1R43A 2XCAA 1SEUA 1TUWA 3J80U 1NLKL 3GIJA 4LJZF 2Y0BB 3KNGA 2E71A 4EUVA 2FBKA 3LA7A 1WF2A 5EEAA 2Q79A 2RQKA 2QYOA 1JLFA 3OUYB 3FK6A 4OQJA 2WHOA 2DMNA 4JV2A 1WKKA 4DQSA 5D5VB 2ZBKA 1H2UX 1RBAA 3MR7A 4N9IA 2XAJA 2HNYB 1XSDA 1J2VA 1OJLA 3VYTB 4F0HA 1TL7B 4AE5A 4EM2A 2FJ1A 2LBFB 4I2PB 5HLTA 2NPIA 3BZCA 5TRDA 5EHHA 2CJBA 3CCWA 3S1TA 1XD7A 1XMKA 3N4WA 4XRSA 1GXLA 1R8AA 4DN0A 4Q44A 4PSWA 3V7SA 5KFBA 3VGSA 1GMUA 2JSPA 1VFJA 3AKZA 3ZMVA 1R27B 2E1MB 2LECA 1D0EA 5KFKA 3CULA 1GVJA 1RAJA 5ETRA 3SIPB 1WI3A 2E34A 4WIQA 4F36A 2BQUA 3GFHA 3FBCA 2VC0A 5IT9Y 3S6EA 1IVZA 4CTAB 2F7VA 5ILUA 1CS4B 1Y39A 3I0RA 1YBTA 1VMBA 3FDSA 3AOCA 3EGWB 3RW6A 3DGPA 4B9TA 1PSDA 2YVSA 2YNIA 4KQZA 5IWAJ 4CIOA 1CG2A 2VPZB 2PI5A 4RR5A 5LMNF 4YIIA 1FMWA 8RUCA 1I6JA 1G4DA 1XQIA 1E6VA 3ET6B 2RD5C 1C0TA 4BYYA 2R7ZJ 1FKPB 3BSAA 3MEDB 2DH9A 4RNHA 3TKYA 4N0BA 1RISA 2L9DA 2EZLA 1R8CA 4ASNA 2V9KA 1L3SA 1VIXA 4HNUA 2WVDA 3A3OB 3HPGA 4RW4A 4FYXB 2ZBIA 1X1PA 1A9NB 1WQ2A 3HCXA 4W98A 2ECBA 3NXZA 3OLAA 1XTAA 3R6LB 3T0YA 5KAKA 2KIQA 4Q4ZF 4I4BA 4USVA 2X3DA 2KT0A 5J2NA 4MTEA 1LVAA 3S16J 3MCZA 4EYHB 5AIPA 2VL1A 1UVIA 5DCFA 4P7TA 3G73A 4DV6F 5KFSA 1TBXA 3IP0A 1FYKA 2F3JA 4GKKJ 1VQNS 4KGVB 4YDXA 2Y2ZA 3PFOA 2MQNA 1BL0A 4EGYA 2O3FA 3S01A 1N88A 2W00A 1W2IA 2LDIA 1Y1WJ 2CDRB 1N56A 1MZBA 4LFAJ 2F5VA 4YEJA 2GQ2A 2IYGA 3MD2A 4BUPA 2AJ0A 3BY6A 3FZBA 3ERED 2NXEA 2ZXIA 4R25A 1WSRA 5J2PA 1IN4A 1VQ8S 3EYIA 1SXLA 2DH7A 3OTBA 4ED0A 4J01A 3KLGB 1VZ0A 2M7AA 3VV2B 1JKHA 3C6TB 3FCVA 3TOQA 3C1DA 3Q8VA 3PY8A 5JI6A 1HNXF 1P1TA 1R4MB 1NG6A 3UE2A 2H1LA 1MBFA 3WHIA 1DRZA 2XPVA 2LQBA 2GIFA 4ELVA 3FNNA 1QSLA 4MFBA 1G2EA 2JEGA 2FC8A 4AQYJ 3MAAA 1NUEA 3LH2S 2VD3A 2MQQA 3GWZA 3CD7A 3EDRB 4PEOA 4RW9A 3MKZA 3RDIA 1OCOH 3A12A 1FDAA 2J8SA 2L08A 2GGPB 3C19A 1YZ6A 2DVIA 1KLNA 2J6UA 4PWDA 3GYGA 5J1PA 1GT0C 4DV6J 1PUFB 1Q8LA 1SVLA 5KFIA 1B72A 5ED4A 3CO6C 2MLGA 1X60A 1Z6TA 3JTHA 3AD7C 2ZM6J 2AEFA 3DRPA 1TKTB 1NK4A 1SH3A 1DP3A 1JI8A 2BY1A 1VCTA 3HI9A 4P10A 4G1IA 4IHVA 2OJED 3H35A 3WTVC 4G7ZF 2VFTA 2CQDA 3DU6A 1AHDP 3ILOA 5J1UA 3JQMA 3LA2A 3AJ2A 1X4OA 2OPRB 4ID8A 1O6XA 1U6BA 2DCUB 3BH7B 5CHCB 4EV0A 5C24A 2ECCA 2XS7A 1IR1A 4FF4A 4IJAA 2HLUA 2UU9F 2JUCA 1SMYF 5J2MB 1CVJA 2AF6A 4ZLPA 2H09A 4EGLA 1ZYRF 5IC6B 3UD4P 5H9FK 3G3ZA 2FLPA 2IRYA 4NI2B 3M9OB 1XEZA 3UKGA 3W66A 4ZCMA 2U1AA 4MKAA 4B3TF 2E1AA 3CJ2A 1XCVA 3G6VA 2KFNA 1P2FA 4MK8A 4CCMA 1YJNI 1EP4A 2FD5A 2CQ3A 2A0FB 3W2VA 1V5EA 4L9TA 2D5VA 1NK2P 1HDDC 3MMJA 4QBUA 1RESA 2HS0A 4C2MJ 1FA0A 1Q78A 2MJNA 5KAIC 3I9ZA 2CU7A 2W25A 3M07A 1PILA 3KLHA 4CCHA 5KHDA 1R36A 5FLXU 4LFUA 1LE8A 5JLWA 3RTVA 2DTJA 1FESA 2V4QA 4I2QB 3C46A 3LUYA 3PACA 3CE8A 2X1FA 2MPUA 1WI9A 3QFHA 1XNRJ 1FTRA 5GADJ 1IWAA 3S14J 5E0OA 2RE1A 3OTEA 2CWKA 4U7UK 1MROB 3PJWA 4WKRA 1AA7A 1PYTA 4IOAF 4DL4A 2DNRA 4PQAA 4IOBA 1IG7A 5HROA 5HQMA 2E9RX 4XRMA 2KQRA 4BQQA 2I8EA 4O3MA 3MQ0A 2ADUA 2KIMA 2DNPA 4ZDNA 1FT8A 3E3XA 1VFCA 3KFWX 3LA3A 1W36D 3MOZA 4CLSA 2CFOA 1YRUA 4L72B 2VOOA 1OKRA 3K9TA 2O5RA 3W2AA 2R5YB 1XSXA 2VPYB 4ZHRB 4GVLA 3GX4X 2BE2A 3C16A 5LXYA 2J0QD 2JNJA 3NEUA 3O8GA 2EWNA 5FD5A 4W90B 3BGUA 1SIWB 3K1NA 2IY5B 4WIIA 1JLEB 2LU1A 4ZVPB 2LP4A 3CO9A 3RBZA 2FC9A 5A2QY 1Z9CA 2FQQB 4BDYA 5EJCA 2VDHA 2XYHB 1EH8A 3IL2A 2GV1A 1FJLA 4IDKA 2GAUA 4LT6A 1EETB 4LF1A 1YRXA 2V4JC 3JSYA 5B09A 1Z05A 4HTIA 3HRMA 4HLXA 2VL8A 1OYDA 5CZVA 2M5WA 3H3UA 1FT9A 3GCWP 2W2PP 1RJJA 1CJVA 3ZTOA 2KT5A 1E6YB 5ICGA 3CF5Q 2ZXWH 3MMBA 4PXCA 1RUSA 1S5LC 3K6GA 4A6DA 1BJZA 3PCOB 1WC0A 2EFWA 1V5FA 1AUSL 1P7JA 2R42A 4CRJA 3TA2A 2RDJA 5EG0A 5KT6A 4G94A 5J1YA 4MFEA 4F3MA 4RW8A 4D7MA 2A05A 5L3BA 4A3BJ 2J76E 1EF4A 2I38A 3LPYA 2LTPA 4DSFA 4LF7J 5J1NA 3PUFA 4X4TA 3F21A 4LD5A 1R7IA 1UEKA 4EWTA 2HSEB 4AVPA 2HWIA 4F25A 4F50A 2WVCA 3H4BA 4IVNA 2OPQB 2DFIA 3I4NJ 2D74B 4U7BA 3G2BA 2F63A 1IRFA 4FPIA 2LEAA 1KEKA 1OJ4A 5IQ6A 1EAYC 3I58A 1R0AA 3DXBA 2MDAA 1WSVA 2CVIA 4M9ZA 1E0EA 2QL7B 3KEQA 2FNAA 1HPZB 4L74A 3SMZA 3CDIA 3SDEB 2FVRA 1LFPA 2IJFA 1CJUB 4DV0J 4PSXA 2LFVA 4UT4A 2ZH2A 4P2SA 1B59A 2WAQN 3HYIA 4LRAA 4R8UA 2MSYA 4M5MA 4AXJA 3HUGB 3LF0A 4J9MA 1TUGB 3ZQHA 2HAFA 4V19X 2UZAA 2K3KA 1RP5A 4CLWA 1GH8A 1RSCA 2YQ0A 3PEHA 2QEXI 2JFDA 1CSJA 1FMVA 3BKUA 4Y0FA 4XKCA 2V4JA 1Z21A 4CCNA 3OV7A 2HAIA 1KRPA 4FXDA 3E01B 2ZKUA 1K0TA 1TL8A 2RSQA 3QSYB 2ZFWA 6FDRA 2GMLA 2ZUAA 2B9EA 4QQBA 2R5ZA 3OL7A 1V55H 4ZPAA 4MIBA 5IC4B 4LRFA 3ZZPA 3I71A 5E3RA 2MSTA 4DCPB 2LQ8A 4NZ0A 1ULYA 5AIQA 1D3WA 2XMVA 5TGTA 1VNDA 3KLIA 2CFXA 2YPYA 2DIUA 4C30A 1C2PA 3OL4A 4Y2AA 3HHDA 3GR0A 2RF2A 3KKFA 3TX0A 3KETA 2M52A 1HWJA 4F55A 3UDEA 4O3OA 1ZR2A 2XY5A 4H4KC 4HX4A 1N25A 3M30A 3QO9A 1VQOI 4LFBF 2HHTA 2DGWA 2WTEA 2CQNA 5IT3A 1FNNA 2DHXA 1XX5A 1MJBA 1FWKA 4KV8B 4YQWA 4KYWA 1YQHA 2HXOA 2F5DA 1YHQI 3LSPA 3N79A 3PO2J 3KG0A 2QC3A 4ES3A 1Q8KA 5HLFA 1IRGA 2PG4A 2O8KA 2OMLA 1TL4A 5HVFA 4UB6C 1M5SA 1P8GA 3HMJG 4XNFA 1T8IA 4B3SF 2R2SA 1IN8A 2OTJI 3GIMA 1C0WA 4XTTA 2GFFA 4AYBN 2LMIA 3E6BA 2KIUA 7FD1A 2O67A 3SSRA 1BIBA 3N0VA 3P9KA 4OZLA 4RAYA 5IT9K 3G1MA 4P2XA 2FU4A 1U6ZA 1U02A 5M3MJ 4USWA 3QYYA 1BIAA 3FHNA 1VBZA 3GTGJ 2B7EA 5L1KA 5J47A 1NK7A 2WVEA 5C4JJ 3BLYA 2YU9J 4ANDA 5CD4H 4JYAF 2ZE2B 3P8BB 3MR2A 1SV5B 1J5OA 2RDPA 3P5BP 1K78B 3M8QA 3T1HJ 5C3EJ 2RS8A 3GV7B 1RE1B 2BANA 3LFKA 2RDDA 3RAQA 3V6HA 2ZH4A 1RU2A 1R49A 1NPRA 3F9KA 2MQ8A 1YJ9I 3I0RB 4ZTFA 2R4GA 3VSKA 2O66A 4I6ZA 1ITYA 5DS9A 4HHJA 3FM3A 2DMPA 1VJWA 3DGPB 5H1SV 3EETA 2YNIB 2HK3A 4BBRJ 3GZ7A 2B9XA 1FRXA 2W1BA 2ZBRA 2J0XA 4H4KA 2C2NA 1GHCA 3DLJA 3TDZC 3HOSA 2L54A 3LQRA 1C0TB 1KFDA 3CCRS 4LRCA 4NLPA 4U96A 4FVCA 4DX6A 3F6VA 2M8GX 2GOMA 4QIVA 2DRBA 3OYJA 1AA1B 1KU9A 2IA1A 1U49A 2R7SA 4OI2A 2EFVA 5L1IA 4P5OA 1JKPC 1FCAA 4ID5A 2ZBQA 4A3MJ 4RW4B 2GXGA 4NC6A 3K69A 4MHGA 3GTYX 1KBRA 1O8BA 3TO8A 1C1CA 2ZB9A 1U48A 5B7WA 3SQOP 3RU0A 2LRDA 2CJXB 4B3RF 1TKXA 2DGXA 2Z2MA 3M6VA 5FJ4A 5EF6A 5J2NB 1UW9A 3JRCA 1JJ4A 3NNAA 3SSSA 1MMAA 5A6PA 3G8TA 3H92A 5L9NA 1SH2A 4NMXA 4II3A 3TAMA 3MAJA 3JYTA 2NSCA 2BHYA 1F5BA 3I55S 4E6KG 4XPEA 1H7WA 4PPDA 4OAZA 5C25A 1F3FA 4ZP6A 1NK9A 4FE4A 4GKJF 3EE3A 3BKFA 2VBWA 2QRRA 3FXJA 1S12A 3HZJA 1D9DA 3R6SA 1Q0NA 2EPFA 3GILA 5B66C 3WBZA 4ZYGA 4QCLA 2K02A 3KUEA 5F08A 2H4WB 3H0DA 5L9XA 1O3TA 4HF1A 1XR6A 3UR0A 3F23A 4CCJA 4RBOA 3I5CA 2PO4A 1P7IA 4JX4A 4UUSA 5E18F 1Z67A 3MR6A 1JKHB 4YR0A 1RC9A 5HS7A 2DMQA 1IBMF 3GR1A 2H5IB 4M3GA 3W6JB 3ZR8X 3V7CA 4LRBA 3T5XA 1B0TA 1MMNA 3I0TA 1G3TA 5KFXA 2K4JA 4K0KJ 4CNZA 1UAWA 3NY0A 2KG0A 2ZJQF 1ZLKA 3IBWA 2M45A 1TL5A 3K2YA 1RETA 2DNMA 5K8MA 3EJMA 4TKTA 4ECZA 4RW9B 1S1WA 4X84A 1IXRC 4LG3A 1U1OA 3CJNA 1KVJA 4G6TB 3WG9A 4ETXA 5GAEI 5L3GA 2AWZA 4PWDB 4C8KA 3FXUA 5KCMA 4YP3A 2V94A 1OCCH 4X0GA 2LK2A 4KTQA 5DTDA 5IT9Z 2RUSA 1B72B 1REGX 3S2HJ 1I5ZA 4YN3B 3PNVA 4Y52J 2QZ8A 3AA8A 3DRPB 4NLOA 4MIMA 3SCIE 3ZRGA 2AZ1A 3I4MJ 2NZ4A 3HHLC 3OLBA 5DGAA 4RS8A 1VBKA 5HBMB 2CKWA 2X4HA 2YS9A 3D66A 2DMTA 4M5DA 3LPEA 3CZ6A 4Y65A 4ZOSA 2Z99A 3MI7X 4EZ9A 3L7OA 5CLSA 4O44A 2GIVA 5FRMA 4MMOA 1URNA 2HZVA 5C24B 1Q79A 2CQXA 3T5LA 4LMYA 5EGYA 1GXQA 1LPQA 2L9NA 4UZBA 3HFVA 1HW2A 2Z56B 2GA7A 3MEGA 2MXYA 1K83J 2XAGA 3FXOA 2WB4A 3UVJA 5TJJA 3G4SI 2FJBB 3P9IA 3MR3A 1UCRA 3ZQFA 1SKSA 2AGQA 5E33A 5KFGA 4HF2A 1PDNC 5DO2A 4A2UA 3S15J 3MWBA 1S6UA 3FRZA 3MAQA 1IBCB 3TA1A 2XNRA 1OQ3A 3D0HE 1EP4B 2FIUA 5KFYA 4CLUA 3UD3P 3H3ZA 2Z4PA 4F4KA 2DGVA 4L5JA 1I1SA 2HYFA 3KLEA 3HG9A 4YB7A 2IBKA 2K9QA 1L5UA 3PJ9A 1N5SA 4OZ5A 4CNYA 2D3O1 3M1CA 1JTXA 2MZSA 1KU2A 4QW8A 4KDPA 5DD4A 2AQFA 4YY3F 3ZGKA 2W57A 2DKOB 3ENVA 2F48A 1USTA 2XAFA 3D2WA 2XBPA 3PZPA 4MIWA 4YS2A 1PG5B 4G6QA 3HFKA 3HJEA 2PMZD 3KLHB 4C3KA 2HHHF 4LB6B 4FISA 2AYMA 1NJXA 3OTOJ 1VF9A 2ZH7A 2ELKA 2AT1B 3THVA 3HM5A 2WSCC 1W4MA 1JQGA 3RPQA 1VLOA 1NK0A 2YWGA 3TO6A 1IXCA 3HZEA 4KHMA 2P9EA 2EA4A 2P8IA 1BA5A 4NOHA 4DV5J 4N9HA 2PMWA 1UA1A 2QLZA 1ON1A 1W0UA 2V2VA 4A6EA 4AXIA 2XSFA 4HLBA 3ISPA 1FERA 1LWXA 1ZK8A 5HROB 1UJ4A 1Y10A 4NLXA 1FEEA 4OIRF 1FX4A 5KFJA 1Y5NB 2CYYA 2VIXA 5D4NA 3VAGA 2X6WA 4NASA 3GJTB 2OD6A 4UQGA 3FVYA 5A2QK 5D5XB 3EICA 3ICLA 3SQGA 1FRLA 4F4AA 4XBFA 4XM3A 1S76D 2JZYA 2M5YA 4PG5A 3E51A 3OXGA 1MD0A 3U1DA 2P5VA 2BE2B 1XGOA 1ICEB 4KJZA 1YJWI 4CZZA 2RRNA 3UO0A 3FGVA 3MM5A 2NSBA 5C4XJ 1MNMC 2M8EA 3B6AA 2VQFJ 3VTIA 1SQFA 1TQMA 3QWPA 3A0BC 4TLQA 3SFZA 4LSNA 1TWAJ 4ZJLA 5J40A 1H9TA 2IA2A 1NHKL 4OMZA 2MSSA 5CZXA 1XNQF 4DYQA 2N4CA 1GT8A 5JFRA 4LIVA 1SJ3P 2RU9A 4UV9A 2W8KA 2B3TB 3X2QH 5F3ZA 3HC7A 2F8HA 5H20A 1CJVB 5LSLA 2B9YA 4UF4A 2LA4A 4P2FA 4I0AA 2B0LA 3RRGA 5HO4A 1S7IA 3MMBB 2P2CB 4OMYA 1AOYA 5T14A 4A3FJ 2X1BA 3FC9A 2K3IA 3LALA 2KZMA 1SVMA 1M1EB 2QE5A 2DOAA 1SFEA 4CT9A 3PJRA 2A61A 2CUYA 5EG0B 1UFKA 3QIPB 1ETXA 2DNLA 1VQ9I 2L3MA 4RW8B 2IM0A 1UMJA 3N01A 3ZMUA 2V9WA 1WOPA 1IBKJ 3DC2A 1ZN2A 4U9RA 4U0WA 3BO2A 2UUZA 2HWHA 1RACB 4OZNA 4FQGA 2LG4A 3DKYA 1F5AA 3S3NA 3C2HA 1XR7A 1MWZA 2UVRA 5JVHQ 4HH0A 2HR3A 1S5ZA 2UV8A 2ZHBA 2VE9A 1UCNA 3CMAS 2Y1LB 1HYSB 1J5EF 2D1HA 2GIQA 2Y0SA 4E2FB 5DCMA 1R0AB 2DBBA 4NUBA 1HLVA 5KT4A 2G7HA 3G96A 5DG9A 3T9NA 2DA4A 3JW4A 4A5MA 1IV6A 2GO9A 5JJBA 2OAZA 3DOLA 3TOAA 2LC2A 3QATA 3PFEA 1WKMA 2MZRA 4QYRA 1B6AA 4A8YA 1FVQA 2PE8A 1S0VA 2LH9A 4R8UB 3GUDA 3D5MA 4DCOB 2XV4S 2MD5A 3DWLE 2PEBA 4NXNJ 2UXCF 1WNEA 2CQQA 3V81B 2O0YA 3OYFA 4FX4A 1PJ5A 4K2JA 3S93A 4XSXF 1VIOA 3SHFA 3W2WA 4CDGA 2V4JB 3DLGB 3J80Y 4NMLA 4XK4A 4GRSA 4OI4A 1SUQA 3F41A 1C1BA 3BJAA 4MKBA 3BQ0A 1LOUA 1RWNB 1I51B 2ZC2A 2H54B 4ZVQB 4Y3CA 2R5ZB 2E5LF 3JS9A 5LGNA 4J9OA 2C2OB 2W8LA 3AAFA 3JRIA 2LVSA 4B3XA 1YI2S 3KTQA 4MYTA 1VTNC 3SCLE 4M3FA 2Q8KA 3GP9A 3KLIB 2V2KA 4RJVA 2ADBA 2L02A 2GC8A 1GX6A 1OMIA 1BOAA 2GXBA 2WVBA 2RF2B 3FMWA 1EQ0A 2DDBA 1NH8A 1P9YA 1RDRA 3I31A 1IQTA 4OZ1A 4RA2A 1SJFA 3I32A 4RWXA 2D3ZA 2H8RA 4C3MA 3MM7B 1U4BA 5B5EC 4NB5A 5DEQA 1A5JA 1BC6A 3QAEA 1PGZA 2WONA 3CCEI 2DQLA 3TEHB 1ACIA 1NEEA 4ZJOA 4CA0A 4USMA 1WJDA 2VKZG 3QRQA 4LF6F 5HLFB 4G7OF 2DHAA 2XMTA 3IO1A 3K4BA 1VK3A 3ZNUA 4I64A 2YQ1A 3D6FB 4NWBA 2GOXB 1VQPI 1W2BR 3F73A 4A3DJ 2HK2A 2PEHA 2OD4A 2ZBCA 1USSA 4F67A 3AJ1A 1JUPA 1WHWA 3FBBA 3KJNB 2D1CA 1HD1A 2AHQA 4DV3J 3R1LA 3SCJE 3FBIB 4HKQA 1E3OC 4DFMA 4Y2CA 1ZQ3P 4RKUC 1OY9A 3G71S 4XKWA 3QJPA 3C14A 2KT2A 2ISZA 4Z2YA 3D0GE 3HVTA 1GXPA 4LREA 2IM2A 3EQLF 2DR7A 2V1NA 4OLOA 3NWTA 1SFUA 2QSFX 1TWGJ 3ILLA 3RYLA 3OL9A 1J59A 1BI2A 4EM0B 2VJ4A 2CNNB 1JHHA 1RZ4A 1V9OA 2W9BA 4B9LA 3MM9B 4WWCA 2VA2A 1F43A 1POGA 3FKJA 3PX4A 2YX7A 2KH9A 2YUSA 3I59A 2XY6A 5F0UA 3EUHC 3PL8A 3PW0A 1VQ6I 1RWOB 3PV8A 2KL4A 4DR4J 3I5UA 3KK3A 1JMTA 3DTKA 2HS4A 2V8GA 2ZOMA 5K14A 3CP8A 2E5HA 4ZC3A 1S4EA 2H1KA 2IYIA 4CYCA 2OIHA 2OHDA 3I5AA 2KO1A 1I94F 2A1BA 4LF6J 2DJNA 4AIHA 1FXDA 1N32J 4B3MJ 2CV2A 1YBAA 3GFYA 4KYZA 3ZZUA 3RCOA 4KAIA 2IDEA 2FPHX 3FWEA 1WEYA 3GYNA 4LSLB 1QUPA 4LF4F 4JI4F 1ZRFA 4ID5B 3WG7H 4JI8F 5CYJA 1D5YA 3M9AA 2GLOA 1T38A 3M8ZA 5IOZA 3G6YA 4FS1A 1BC7C 1OCPA 1KR4A 4ZVHA 3ENQA 1C1CB 1IXKA 1N5YA 3JSPA 2POKA 4RLFA 3CMEI 2EIJH 1TKXB 2DNGA 4RBTA 1WJBA 3JXOA 3M1VA 4I01A 2XZWA 3EYYA 4FASD 3TNVA 3MF5A 3D1HA 3TUIC 2MG4A 2COBA 2M8HA 1QD1A 4F52A 3S17J 3GPAA 4EJWA 4WXOA 2HIYA 3M6UA 1AFJA 5M2PA 3K4LA 4F26A 1AXQA 3M8WA 1Q86T 2HDDA 4TYBA 3JYTB 3CJQA 3ZC4A 4U8VA 3CD5A 2VPXB 4ES2A 5C25B 1IKYA 1HC8A 1E3HA 5K8OA 1WC1A 3VQTA 2DPJA 2A6EF 2A5YB 2RDIA 4CLTA 2I5UA 2K9NA 2RN7A 2HYIB 2HQAA 2NUHA 4JI5F 4ZPWR 1ZREA 2Z0GA 4K8RA 3D1QA 1N8RT 4LF5J 4KPCA 4BQAA 1EKRA 1YS7A 4WYLA 4YG2F 3CUOA 3TAQA 5IP6A 3PYEA 2A07F 3GLXA 3OS1A 7FDRA 3I9V2 3B02A 3PW2A 2ZSHB 2QUFA 2VBYA 4UUSB 3EUHA 1S97A 2EBGA 4QPOA 2EPIA 2V4RA 3JTPA 5LLQA 2BJ8A 2YX4A 2PDAA 3ZTSA 2YSRA 1K79A 3GSDA 4IRDA 2BOAA 4ECYA 5HVQC 4PG7A 1OYWA 2VPLA 2W4DA 5AXNA 3FHZA 2JPCA 2RQ4A 1B4SA 1ZKGA 2MH2A 4OYXA 5GPCA 4QWDA 1S1WB 5E1XA 2R92J 2XB0X 3IH2A 3Q89A 4FN5A 3JSMA 2IIHA 4AIDA 3ABKH 1W5SA 4ZTJA 4ZP7A 4ZK7M 1AU7A 4H4MA 4GC7A 5KK1A 3LAMA 3C8YA 2HNDA 4HH1A 2JLEA 1NJIT 4WJBA 1U3EM 3TARA 3GLLA 3CD6I 1KQ8A 2MY8A 3OSFA 1QA6A 1LDDA 2X1GA 4EO6A 3UN3A 1SKUB 1X9WA 4A8MP 4BNCA 4KH0B 1Z1ZA 3Q8SB 1RBOB 1HOMA 1FC3A 5LXRA 2X6XA 4M5DB 1I5OB 2LKPA 4O44B 1GLNA 5EX0A 5FLXY 4ZMMA 4GRIA 3ELHA 3HOWJ 3EYZA 1NJWA 2XAUA 1N0UA 1SFKA 1Y9OA 3LAJA 3DQVC 3MTJA 3HHLD 2QENA 4B48A 2FBIA 2UXNA 3KP4A 4ENNA 2C2KB 1NZAA 3MEGB 1S59A 3UVJB 3V4IA 4XQFA 3WTXC 2Y9HA 2HFUA 1N36J 2OGUA 3GCXP 2KLOA 3BG9A 2P8TA 4LF8F 1RTIB 4Y2MA 1T02A 4O6JA 2GMJA 2FMYA 1KOHA 3RRHA 3AG4H 1FP2A 2ERRA 2M9KA 2YNHA 3H98A 4PWUA 3W61A 3SZPA 2Q6CA 4GYIA 1NH7A 5CYVA 2RB7A 3NWGA 4WFZA 3KLEB 3KUHA 4B9MA 4HQMA 2YH1A 1WHXA 2HQIA 3IR6B 3ABUA 4XLHA 2H4YB 4DUZJ 3ZCOA 1MWQA 2F4MB 3UCZP 3RZAA 4AU7A 4L3KA 3SSQA 1X5OA 1HW1A 1FOKA 2UVUA 4RGXA 4ILLA 3QIDA 3O8HA 2E7VA 4L9NA 3MOJB 4M5HA 1Q95G 1CQTA 3ZZYA 3MGJA 4HYEA 4CWBA 4AUKA 4XONA 3BBFA 2ZVSA 3A8JA 3ZXWA 2EWHA 2DHHA 1AZSA 3F3XA 2ME0A 4GDFA 4M9XA 1X19A 2CH0A 1R4NB 4PUOA 1YJVA 4ER8A 2QL5B 2VFUA 2KJBA 4LRDA 1BM9A 3VODA 3BPVA 3FBFA 4OHVA 1WELA 3HHLB 2HGNA 3TYTA 3GONA 4OX9F 1ZTWA 4OLPA 2L2OA 4P72A 1S9EA 1HNIA 5C2GA 3IP4B 2W84A 1R5ID 1U8BA 5B0DA 1S1UA 3PW7A 3QGHA 3SQGB 3V7RA 4IH5A 2JPBA 4TQRA 1K61A 5CAAA 1Y1VJ 2HQ3A 2K8GA 1F5TA 3UPFA 3V8JA 1UMQA 4ZVFA 4CH0S 3ABTA 1XS9A 2E1NA 2QQ9A 2CQ4A 2RH3A 4KN4X 5F0FA 3MM5B 2Y0SD 3B78A 5HSPA 1ZG1A 3GU0A 4OZ3A 3QAUA 4DR2F 3IAM2 4LSNB 2AQ4A 1BHNA 2OLWA 2R3SA 4BS2A 2PJPA 3LWMA 5B0AA 2LKZA 1HQ2A 3FK4A 4L0ZB 2DR8A 4A8SA 3ZTRA 1NK6A 4RMNA 1CF7A 3OVBA 4O0IA 4DQQA 1KVIA 3EDQB 2L41A 2E7XA 3HFZB 2FVPA 3JQKA 2U2FA 3M8RA 4NZ7A 4DBRA 5HMWA 3IGVA 2IA6A 2IMOA 4DEZA 3RB4A 1G1XA 2B4VA 3N5FA 2A3SA 3DDIA 4CO3A 1T7PA 1Z77A 2LOOA 4ECXA 1IKVA 5B0FA 1ZAWA 2KN4A 1OPZA 3BGFA 2YKPA 4IL6C 3F8FA 4ZH4F 1UA0A 4ZIWA 3LP2A 1H2VZ 1QSSA 1RPWA 1X5TA 2QSHX 3KP5A 1YJNS 4OYPA 3T5JA 2BDPA 3KP3A 1HIYA 4EO8A 1TK0A 2PMZN 2DK8A 2WBRA 3ECOA 1WJFA 4OHWA 4JQFA 3UDVA 2FOWA 2EFNA 3EXYA 1XK8A 3WTZA 2LLKA 3QPSA 1HA8A 2DNHA 1NDLA 1G8XA 1I3QJ 3RTRA 3MUVP 4M3BA 1WFXA 5DG8A 5L38A 1WHUA 1N34J 5JXSA 4CUGA 3DOLB 1AWCA 4FYDA 3J80K 3CSKA 3R1HA 2GM4A 3FM5A 2IPOB 1TWHJ 3BDDA 1HDPA 1WEZA 2YPRA 3COAC 2XGCA 3VEPA 3K8VA 1LW2A 4D7NA 1YX5A 2FZGB 4YHHF 1V6HA 3HSZA 2F4IA 1QNTA 1J75A 2XF7A 1ETOA 2MLYA 3CP2A 2V8DA 3HRUA 1NDPA 5KAFC 1U2CA 2XEXA 3TW0A 3SFUA 3W2WB 1FDNA 2KISA 5F41A 2OCEA 3S32A 3OYMA 1ZYQA 3HGYA 3BQ2A 3NNCA 2RILA 3IWXA 2A3JA 1SUQB 5E20A 1C1BB 4NLWA 4DFPA 3JRHA 3IH4A 4A3IJ 1RR7A 2IM1A 2OKQA 1D5VA 5AT1B 3X1LB 2N3LA 4M74A 3GBGA 4E7KA 4C8LA 1O3RA 4RX6A 2XPWA 4WFYA 2RKIA 5H9EK 1JE8A 3EZOA 2LFBA 3KPHA 3D6HB 3ABLH 1H2TZ 1TP4A 2M34A 1PC5A 1DU0A 2ZSIB 3MZ8A 1V54H 5D0HA 1T9YA 1TC3C 1DU6A 3QODA 1I39A 3OYKA 2EK1A 2ZJRF 5HL7Q 2A6HF 4USIA 2YR2A 3ENWA 4QR1A 3PSFA 1XG1A 1NK3P 2QLJB 4DIQA 1KQSR 2GIZA 2BV3A 2KHDA 2L0KA 2JH3A 3BROA 1CJKB 1V3SA 2J7WA 2VFVA 2NXNA 2WONB 4XSZF 2VONA 1LFBA 1X1CA 3OFHA 1BR2A 1Y6IA 4X62F 3CB4A 3QP5A 4KFBB 2FHJA 4DZPA 3EUAA 4OJ1A 5CVIA 3C15A 3OL8A 3G87A 3HB9A 3PQJA 1LFUP 3H3VK 2IVYA 3K7AJ 2R7WA 4F4WA 4HA8A 5BYRA 4EBCA 2PA8D 4QWCA 1WTFA 1F60B 1Z7LA 4A5NA 4CGZA 2ACJA 1KHVA 3ZXSA 1RB0A 2ZCWA 5DD8A 3E8OA 3H2LA 2XNQA 3OTCA 2PN6A 1IM4A 1TW2A 4C8NA 3DRRA 3CDLA 2R3VA 3PVXA 1UELB 5B1AH 1WF0A 1KYZA 4B9NA 4WE1A 5DZ6A 3HZGA 5F6FA 3IRQA 2ATLA 3DCAA 1R6YA 1NZ8A 3K2ZA 3L2UA 2FYXA 4NA1A 2LF8A 3ISNC 2YNFA 1B9MA 4X64J 1Q4RA 3C14B 1QTMA 2QWWA 5D5WB 2KL8A 3HVTB 1Q53A 1WC6A 5FROA 5SZTA 1R5GA 3AXKA 2Z2SB 4WP9A 5BQTA 2HZAA 2LCWA 2DXIA 5AXKA 4J7CA 4DYRA 2RNGA 1OCRH 1HBNB 1TUVA 3BWGA 1B9NA 2WAQA 4RDUA 2W9BB 4BGDA 4ES1A 3L7WA 1H74A 1X0FA 2HVSA 1R00A 4P52A 3I59B 3R5GA 4R79A 1PYVA 4DR3F 4X4NA 4IOCF 4KHRA 2QEXS 3WX4A 2DA3A 2V8VA 5BXIA 2V9VA 5ETQA 3KK3B 4HNVA 3ZZ0A 3ILJA 5HVGA 4ECQA 2N8GA 5K14B 2R8GA 2CQBA 3EDPA 2J9CA 4X66J 4CYCB 3GVAA 3CTRA 2VG6A 2XGQA 5LMUJ 4OAYA 1DQUA 1VC0A 4JV5J 1P92A 1Q8BA 1TK8A 2J9EA 3D6TB 4RUHA 3CC7I 1S10A 1WJ5A 1UFLA 4J91A 1RKTA 3HULA 3F22A 3V8KA 1BBYA 1QGPA 3HVWA 2NNNA 1N5YB 4YB1P 2RREA 1UAAA 3OY9A 4LFCJ 2ZOGA 1RBLA 1QUVA 3OYLA 1OYYA 1IW7F