2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
2KXNB 3TO6A 4NB5A 4U7BA 4PKDB 4G7HF 4KUMA 2G1DA 1SXLA 4EM1A 3R0JA 1R8PA 1WHYA 4HX8A 2HZTA 2YU3A 4XSXF 3P9IA 5E1ZB 3V7SA 5BQTA 4BQAA 3WTXC 1LQ1A 2I2YA 1IN5A 2K4JA 1FY7A 3H3UA 3J7AO 2DH8A 5AIPA 3EGNA 2UXNA 1UHMA 2MSSA 3GO5A 3KP5A 5HDKA 2RT3A 2XHKA 2QVOA 4FT8A 2EFQA 3D0SA 3CCQS 1QPMA 3DFGA 3GWZA 1WI9A 1FZPB 2L4AA 2PMUA 1KU3A 1VC6A 3JB9k 3I5UA 3NNAA 2FMYA 1R1UA 5FD6A 3EX7B 3LQRA 2AXLA 3PIOQ 5E8IA 4UHTA 1T39A 1WG4A 1OMIA 2ZO4A 2MY7A 1ZG1A 3EETA 2FMLA 3IWZA 3RTRA 2QZ8A 2XASA 2J8AA 1YJWS 3H3ZA 1D8JA 3J80Z 4M74A 2X4HA 1FBUA 1MJ9A 2X1AA 3UWTA 2DAOA 2E44A 4PGGA 1LNWA 4M72A 3NNHA 1RKJA 2R7DA 1BBYA 2STWA 5AONA 5L3DA 2HYFA 2H94A 5JVTA 2OD5A 1BI3A 5K5OA 3K0JA 4HV5A 4H0EA 2XROA 4M5DB 3B02A 3RDIA 2LSOA 3WTVC 1DDNA 2P7CB 4G6QA 2BZ2A 1ZG3A 2PEXA 3ZP5A 3BROA 1YW7A 5E18F 3MD1A 2MKJA 3MUVP 2PI0A 5ICGA 1LJ9A 3RKWA 4OZ0A 1B7FA 2XRNA 4N0BA 1X0FA 2D2WA 3ZMSA 2AYEA 4IRIA 5BOXA 1BM9A 4MGRA 1REPC 4YFKF 2JX2A 3IWNC 3ZQ7A 3UCUP 3JAMZ 4WXCA 4HDUA 4AIKA 5LHHA 4ZYEA 4FX4A 3M8FA 2BYVE 3CCES 3I58A 2GAUA 1IN4A 1YTYA 2LEBA 2VONA 4DQ2A 4MTEA 1LB2A 2M45A 3DP7A 3VAMA 4AVPA 1F5TA 1UP1A 3C3WA 1A9NB 3HOSA 1ODDA 3H2UB 3F21A 3IRWP 2L3DA 2ZKZA 2E1NA 3DXJF 5ILSA 3S2WA 3ULQB 1VQ7S 2XNRA 3KETA 4IRGA 3N4MA 1URNA 3DKWA 2F3JA 2L01A 3IRQA 1BI0A 1QO0D 4P55A 2DITA 2M8DB 1CVJA 4HA8A 1OKRA 2RRBA 2FBKA 5HS9A 3ZN0A 2MMYA 3CCVS 3E6DA 4RB3C 3DEUA 4AD9A 5F64A 4HW0A 3HTSB 1KQSR 4UY8T 1H0MA 4S05A 4WFNQ 4PR6A 3EGZA 2CQ1A 3F8BA 5HOOA 3CC2S 1H6KX 2UWMA 3MUMP 1XGNA 4LB6B 2Q8KA 2KJCA 4ZKAA 1S8NA 3ABUA 5LXYA 1VQ8S 3NMRA 2TDXA 1MD0A 2MQOA 1IXRC 2CQ2A 2K3KA 4PZJA 1XD7A 2IP2A 1J9IA 1FYMA 3RKXA 4C7QA 2F5FA 3F6OA 4KYWA 4EJVA 5D8LB 4BH9A 4LD5A 5ICEA 2KRBA 3SZPA 5D78A 3TKYA 4L0YB 2EV5A 2YTCA 2O3FA 3SMZA 2HQNA 4EGZA 1WWHA 3SXYA 3E6MA 2EWNA 1UB9A 3CPWR 2OSQA 3N9UC 1H9GA 2CJKA 3HHGA 4WF9Q 3WE2A 1XCBA 2HGLA 1TTYA 2DK5A 4WCEQ 1O3QA 2MXYA 1A04A 3GZ5A 4IOAQ 3R4KA 1SFXA 2E7XA 2IW5A 1A7GE 3CCMS 1VC5A 1K78B 3CUQC 1Z91A 1KU2A 2WC2A 3CLOA 5K1YA 4Y13A 3VAFA 2KXFA 2CQ3A 1FXLA 5LRSA 4U88A 3TO9A 1KYZA 3R60A 1VQ9S 2EA2A 4UVCA 3SHFA 3DPTA 4UUVA 3U2RA 3GW2A 1CGPA 4KNYA 3WG9A 2CGPA 3IRRA 4HX4A 2IPQX 2EFPA 3JW4A 3COAC 2JRTA 1P2FA 1Z7UA 4F26A 1HW5A 2EV0A 1KC8T 2KRRA 2DPDA 3UD4P 3ZPLA 4LK1F 4EV0A 3S8SA 5ICCA 2JVOA 3B4DA 1S7AA 4GYGA 3GUDA 4O6JA 4A0XA 1XCVA 4CHUA 4CICA 4N9IA 2MLKA 4BHBA 4ESFA 2RDPA 5LGTA 4I09A 1FYLA 3WGGA 1G3WA 1FPQA 3UD3P 2BV6A 2CPJA 2NS0A 3TDUC 2KU7A 2M87A 2DTRA 1JHFA 1BN5A 2G0CA 1JJ4A 1HSTA 1ZREA 3U1LA 2PQ8A 3TOAA 3BPVA 2HFHA 3K1NA 1WF2A 2G4BA 3LSTA 3CDHA 1J0RA 4ETSA 3QP6A 1P4AA 1ZG5A 3VODA 3KE2A 3S6EA 1NO8A 1KU7A 2MZRA 1M1KT 1W5SA 1EH8A 5HLHA 2MYFA 2Q2EA 3F8NA 2JZYA 4WKRA 1I6XA 2NYXA 2RVJA 1IXCA 1IF1A 3CUQA 3C7JA 1BIAA 1RNLA 4RGXA 2A6HF 2O0YA 4U7DA 1I5ZA 3CC4S 1OWXA 4MEXF 3Q9VA 2HGMA 3WTWC 2ESHA 4M6XA 1WEXA 2MQPA 4I0BA 2YSRA 1Z05A 2A6EF 3JTHA 3KLNA 3MFKA 5TRDA 3RW6A 1VQPS 2X0LA 4M9SA 1W7PA 4O5VA 2M0GB 1X4DA 4PDKA 3SDEA 4M6YA 2Q79A 1W2BR 1FWZA 5DDQC 1W4MA 4FX0A 2PG4A 2Q0OA 1FSHA 2CG4A 3GXOA 1ULYA 4M9XA 4ED5A 1O3RA 2RN7A 5A2QZ 3BDDA 4WXHA 1BC8C 1KOOA 4ZYHA 1HL6A 5GAGU 3VB2A 4KDPA 1WG5A 1O7LA 2HEOA 4L9VA 3RYRA 2LCWA 5ITHA 1CF7B 1TNTA 5LEJA 2G9WA 2A61A 3CUNA 2W57A 1SAXA 2Z33A 4ESBA 4FXVA 3ISPA 1S72S 2ACJA 1IRGA 4G7OF 4G8XA 5LBQA 2O03A 1P27B 1D9AA 2QEXS 5JVGQ 4Z2XA 2DBBA 2UP1A 2HR3A 1T0FA 1X4BA 4LK0F 2FF4A 3DLLQ 1R8HA 2DHGA 4FXWA 3JSPA 2XS2A 3O3KA 2ADBA 2G7UA 4BS2A 4A2UA 5CVRA 5FO5A 4ON0A 2HYIB 1K7AA 2QBYB 2L9WA 4GCVA 2MGZA 2AYGA 3SZTA 1PP7U 2QBYA 2MGZB 1YJNS 1T6SA 1VBZA 2YX4A 4G94A 2DNOA 4LLLA 1QVFR 2F2EA 4KN7X 3CMAS 3E3VA 5JR3A 1K78A 1H2TZ 4LMYA 3C1DA 3GFMA 4QU6A 1H2VZ 5D8KB 3HTUA 4NHJA 3GF2A 1RIOH 3MEXA 2XKOA 3BP8A 3E5UA 1U5TB 5HDGA 4LFUA 3UCZP 2P5LC 2DGWA 5E17F 1HD1A 5DUKA 2CPFA 2GA2A 2XKPA 2K02A 2W24A 4HQEA 3F8FA 1PGZA 1BI2A 1BC7C 1QGPA 1WTBA 1OYIA 1MJBA 3QU3A 2FXAA 3UCGA 4XSZF 2CQDA 4F7ZA 1LEBA 4ZYDA 4BNCA 2EJRA 4YIIA 2MJNA 3BO3A 1L3KA 3R6SA 4XLPF 3BJOA 2F5CA 2W25A 3VAIA 4LGWA 2VC0A 2V9VA 4ESJA 3F72A 2N3OA 2DGXA 1BI1A 1DBDA 3EQLF 2DNQA 4G6DA 5F1RA 2QLZA 3E5QA 4MHGA 1OYWA 2MH9A 1V4RA 2P5KA 3WODF 5D5UB 3PQJA 4RGSA 4WK8F 2DGTA 1F9NA 2VBWA 1U1QA 3GFJA 4AIHA 2DT5A 2R7FA 4NQWA 2ZJPQ 3CCRS 4L9JA 3GFLA 1S6LA 3LQVA 2D1HA 3BJAA 1O57A 3W6JB 2EA4A 2M1BA 1XSVA 2PLYA 1T2KA 3V7CA 1FSEA 3RPUA 3LFKA 1J75A 4HOBA 1YIOA 2XVCA 4A0ZA 3BZ6A 5LGNA 3GVAA 3NS6A 3VFZA 1X5TA 5EEGA 2LA6A 2DO4A 3S01A 1VQ6S 1G6NA 2H27A 1WHWA 1KA8A 3BWGA 3R27A 1R58A 2F5EA 4F02A 2OBPA 3P9KA 1R1TA 3QPTA 1KQ8A 3G9CA 1W7PD 3GFIA 1Y0UA 3L09A 1U8RA 2V1DA 3KP3A 5LSOA 1KOHA 4XLNF 2CQ0A 2CPDA 4C0OC 3O6BB 2GXBA 3G8SA 1X4FA 3G4SS 4QU7A 1MDMB 2O6GE 1DPUA 3B73A 1U1NA 2VODA 1VQ5S 1NJIT 3D2WA 4KA4A 2D9OA 1D8ZA 1FNXH 1Z6RA 1R36A 3Q2SC 2X1GA 3CTRA 2PEHA 2GO9A 2XIGA 4I2OA 1ZLJA 3M1EA 4EJTA 2VOPA 4AIJA 4R79A 2V1UA 2CQ4A 2HKXA 2OAZA 1S29A 1HQCA 1D8KA 3FF5A 2J0QD 1U1OA 3OW2R 3MI7X 2DGQA 1Q82T 1OIAA 5FJ4A 1UHWA 1R00A 1ZHFA 1G3YA 5DDRC 1X5SA 5D5XB 2WWYA 1RZ4A 3HHHA 1R23A 2FSWA 4Q5SF 2VOOA 4XBFA 2YX7A 2MKKA 3ROUA 3SDEB 4IUFA 2GZWA 3QOPA 2RNEA 4EJOA 5DDPC 2IRFG 1XB4A 2NLWA 3MCZA 4OIRF 5D5VB 3CCSS 2VXZA 2COMA 1U1LA 1VQOS 4TU7A 2DLLA 2CPIA 3ERED 2J5OA 3K0LA 2KKOA 2E5GA 1N52B 1OYYA 3FM3A 2DB1A 2KFYA 4FHTA 5FLXK 1DRZA 4K2EA 4IO9Q 1IN7A 5J8FA 2MZSA 2M9KA 4KIBA 3KZYA 1VQKS 3FXUA 5ILUA 2MZQA 3VOEA 2XAFA 1HW1A 4GGGA 5E8GA 1SMTA 5KK1A 3T0YA 2V1XA 2MJUA 3H2VE 3T8RA 2B0LA 1J7KA 2K86A 1SJFA 2FPHX 2L02A 3T8TA 4MQ9F 2DNKA 3P3DA 3JTGA 2DO7A 1RI7A 5CA5A 5A2QK 1IN8A 1Z6TA 2VN2A 3WU0A 3T5XA 2Y0MA 2ZNYA 2W84A 1WEYA 2EK1A 3V7RA 2KT5A 2MSTA 1ZRDA 1JGSA 1K8AT 3NS5A 2BBYA 3R61A 3F8CA 3RI4A 1NU4A 2DNHA 3K69A 3TDZC 2D9PA 2P5VA 2RQ4A 2FC8A 2YPRA 4P9UA 1U6GA 5DDGA 3CUQB 1FC3A 4HBLA 4P5OA 3B4MA 1HBXG 5H20A 1U2WA 2CQIA 5H1SV 2KVIA 1MDMA 4EVIA 2PN6A 2WV0A 3HRUA 2M2BA 2CPXA 1SD6A 4OINF 5JI6A 3NRVA 5D5WB 3KZZA 3KCCA 2DH9A 5DETA 4KFCA 2OZ6A 2MBFA 5BMZA 4O3MA 1B6AA 1VTNC 1O3SA 2MZ1A 2F9JA 3MUTP 3I4PA 2DNYA 2OJ3A 3THTA 2GHPA 2ZFWA 4MTDA 2H6CA 2V6CA 5LEKA 1K9MT 4CQ1A 1WHXA 2DGUA 1HKSA 4L9TA 2FNAA 1LDKB 3MZHA 4J5OA 3TO7A 4ZYGA 3J7YU 3HSRA 2DNMA 4RAYA 4CH0S 2O3DA 1B4AA 2MKHA 1P6RA 1XMKA 3NNCA 2CQPA 2MA3A 3OV8A 2WTEA 3P7NA 2E5HA 1MGTA 3DF8A 3H92A 2HTJA 1AUDA 2LEAA 3L3CA 1U6FA 1J59A 1USTA 4KN4X 2RS8A 3SQNA 2XAGA 4RB2C 3LA7A 1PUEE 1AWCA 3U1DA 2RC4A 2MQQA 1YWXA 2LXIA 2VT2A 1U2FA 1WRJA 4YB1P 4ASNA 4QLCU 2PFBA 3FM5A 4I98B 2DGVA 4UVBA 2QQ9A 2LYVA 1IW7F 5L3CA 2XAQA 1KQ0A 3I53A 2ESNA 4JK1X 1S3JA 3REOA 4HX7A 1YLFA 2FBHA 4OIQF 1XGOA 5IQQA 3NEUA 4YFNF 1UCRA 3DV8A 5L3BA 4AWXB 2LF7A 2VT3A 5IT9Z 1O0PA 5DM7Q 1I27A 2MKIA 2C6YA 5FGMA 3WTUC 1HA1A 3TYTA 2JRSA 2EFNA 3CF5Q 3MWMA 3ZZZA 1ZH5A 2ISZA 4RB1A 1YJ9S 1J2XA 2MZJA 4QPTA 4CDGA 2OA4A 1FJCA 2DQLA 4P96A 4R8HA 5JHUA 2AYMA 4YIFA 2KYXA 3MD3A 4BYYA 2F9DA 1FOKA 1FJ7A 5AIQA 1GXQA 4PCQA 4QQBA 3TGNA 4Q48A 2RQCA 5EN1A 4BXUA 3DXBA 2YR2A 2IA0A 2F5DA 5LJ3Y 1HW2A 2CFXA 4L18B 5IT9K 4RGUA 2DGSA 2B0GA 4IHSA 3R1HA 1M90T 5FLXZ 1TQMA 4GXOA 3E6BA 4RAZA 1UFWA 2RUGA 4WIIA 1ONVA 1N54B 1PO6A 1N8RT 1XN9A 4KICA 1ZRCA 5E1XA 2KIUA 3MDFA 2O61A 3I64A 3ZMVA 1CF7A 3PFIA 2ADUA 1TW3A 4UNOA 4KMUX 1HSJA 3G3ZA 4I01A 2LDUA 1XSDA 2CWEA 1XDSA 3SFZA 3CO7C 3IKVA 4HDVA 1FNNA 1VC0A 1QZYA 1B59A 2DIVA 1Q7YT 1FYKA 3J7ZT 1WWXA 3VALA 1TQIA 5E20A 5ICFA 3WTYC 1DUXC 1X4HA 3R0AA 5JFRA 1DHMA 3IHUA 4EM2A 2HVZA 1LEAA 3RYPA 2RNJA 2AS5F 3E97A 2MB0B 1QVGR 3I0TA 1W5TA 2QENA 2E5JA 2ELHA 5EEHA 2OIHA 2LNBA 4ENJA 4L5IA 2BE5F 2HOEA 3ZN1A 1SD7A 2M30A 4WXDA 3GZ6A 1KQ9A 4EGLA 3RJPA 1IQTA 2WBRA 4A5NA 1JMTA 5DCMA 1H2UX 2J76E 1C0WA 5DV5A 3FEXB 3CO6C 1P4XA 3G73A 4BHCA 2XV4S 3BOQA 4OZ1A 1SJRA 3CUOA 2MQNA 3CCJS 4E70A 3L2CA 3ELKA 2FHOB 2DNPA 5LGUA 3R1LA 3T1BA 5IFMA 2YKAA 1B9MA 2X1FA 2XGXA 4IRHA 2VE8A 4U0VA 4CIOA 2DW4A 2CPYA 5D4RA 5GAHU 3VAGA 4IOCQ 1WQ2A 2LKZA 2JPCA 1X5OA 2HQRA 3THPA 1FLIA 2L4MA 2XS5A 1HD0A 1Q1HA 4MEYF 2X1BA 3QRFF 3J80K 2FA5A 1R7JA 3CTAA 3I71A 1RUOA 1ZN2A 2SXLA 2FQ3A 2UXXA 2LKPA 1VBYA 3FZVA 2YWKA 1SD5A 4LJZF 2FOKA 2BGCA 1JXSA 2DNRA 3P5TL 3HOTA 1SJ4P 3C18A 4LMZA 4OMZA 4XRFA 1ZLKA 2DQRA 2G7HA 2QWWA 2M7SA 2EB7A 2K27A 3WGHA 2KH9A 3DPLC 4HF2A 1LDJA 6PAXA 5ED4A 3KEQA 2CW0F 2M5WA 4EQQA 2STTA 3EUHA 2V94A 2CQCA 4HLYA 5D77A 2QUFA 2MZTA 2XNQA 1VQNS 3E5XA 1UW4A 2K8GA 4IXAA 2NNNA 3D5LA 2GXGA 1FJEB 3GYHX 4B09A 5DEQA 3FMSA 4PRFA 4OU0A 2A68F 2D45A 3ML6A 5ERIA 2HGNA 1X4AA 1ZARA 4ZH4F 2RU3A 1IUYA 5CVVA 4CYDA 4N9HA 5CYJA 3N97A 3PIPQ 2ZJQQ 3V8JA 2MH2A 3EYIA 3F23A 2JVRA 4HYEA 1ZZFA 1I1SA 4W90B 4EM0B 2EK5A 1FX7A 2QYOA 2DNNA 2MD5A 2DK2A 5BS6A 1IXSB 3F3XA 5CXTA 4PGHA 4HQMA 1F4KA 3L00A 5HLGA 1X5PA 2W85A 1D3YA 5DCMB 4S04A 2FEZA 4P6QA 2ZJRQ 3ECOA 1FP2A 4CGZA 2CQKA 5IM0A 2KIFA 1WG1A 1U5TC 5TJJA 4LB5A 4A5MA 2DU9A 5DCFA 2ZNZA 1M5OC 1OPIA 2XAHA 1P92A 1KGSA 4M71A 4WWCA 4A0YA 4UQTA 3HSFA 2ERRA 2GWRA 4U0WA 3FXQA 5CVIA 4WCGA 4L0ZB 2IA2A 2N3LA 1RUNA 2M88A 5IT3A 2DIUA 3CCUS 1VBXA 2V79A 2MKSA 1EH7A 3EDPA 1G3TA 4HF1A 2L08A 3V8KA 4C4WA 4GO1A 3P49B 1SFUA 2ADCA 3RW7A 3MURP 1YQAA 1R5GA 3K1PA 2H09A 3LWFA 1WI6A 1YG2A 2RGVA 1MZBA 2L54A 5BJRA 2QM3A 5MLCV 2FY1A 4EMSA 3M8EA 3L9FA 5HO4A 5CVJA 1QM9A 3J81K 3SXLA 2IVMA 4ZZLA 2NRAC 2HWVA 5L3GA 2LF8A 1X4CA 4LLGF 3RPQA 3W6KB 2GQQA 2E5IA 3V4GA 2JT1A 4OMYA 3FX3A 2O8XA 2K4BA 3LQQA 2Y75A 3G71S 1SFEA 5CVUA 3CULA 3IC7A 2LQ5A 3P9CA 1ZGAA 2CYYA 1QNTA 2I38A 2JPBA 2VBYA 4R1HA 4UXNA 2N7CA 1OPCA 2DHAA 1D5VA 3IKTA 1GVJA 5K5RA 4JQFA 2OU2A 5DM6Q 4KIGA 2HYGD 1FP1D 4HLXA 2DHSA 3TO8A 2MC3A 2YH1A 1K6OA 2FE3A 3I55S 2M8EA 2EV6A 2OSRA 1B9NA 5LJ5Y 2D3OR 1PP8F 3HSEA 2PMHA 3HRSA 2D1VA 1S7OA 2Z9OA 1GHCA 4Y17A 2OQGA 1T38A 2KG0A 5J8CA 4WX9A 2E1CA 3BO2A 4Q4ZF 4LG0A 1AOYA 3ULHA 5L3EA 1FHTA 4HAMA 4Y0FA 4U67Q 2P8TA 5F6FA 1EH6A 1O3TA 3KP4A 2MPUA 3I59B 2XSFA 3L7WA 3E6CC 1BY9A 2P6TA 2ZCWA 1YS6A 2RVCA 2AYBA 2ZJ2A 4DNCA 3FEYB 4W92B 4UV8A 1YI2S 2KM8C 1S79A 1DZ5A 4ENNA 2Z99A 2KXHA 1U1RA 3Q5FA 4QWQA 2JSCA 3VAKA 1GXPA 3RIRA 1VQ4S 3TP2A 2M70A 4I0AA 1R22A 4I7HA 4YG2F 4OIOF 3QP5A 1YYVA 2MHNA 1WHVA 2ISYA 3IWFA 4YOEA 2DHXA 2CO5A 2K7LA 3ECHA 1BJAA 2XUBA 3BO4A 1JJ2R 4IF4A 1U1PA 4B8XA 4HV6A 3BJ6A 4WFAQ 3WTTC 1IRFA 3NQOA 1FT9A 3QU6A 4Y00A 3MQ0A 4IPAA 1PDNC 2A07F 2LMIA 4RB0A 1OO0B 2M52A 4CXFA 2P7VB 4D0PA 1X4GA 1B1BA 1YS7A 2DNLA 1XSXA 2A5YB 3M9AA 2A69F 2HS5A 2Z5UA 3GX4X 3KP7A 3KEOA 2MQLA 1HXDA 2QQBA 5LHGA 2KG1A 3CJNA 2OQRA 3WGIA 2ZBKA 4EJWA 2JTVA 5CJ9A 3F6VA 2GIVA 1FBQA 3US5A 2R3SA 5LHIA 2IT0A 4MQVA 4LG0B 1SJQA 1ZRFA 5L3FA 2DISA 2DPUA 4Q47A 3I59A 4YUDA 5CYVA 2Y48A 4TU8A 3J81Z 3GLXA 3BY6A 4KT5C 5LLQA 1UAWA 5FB2A 2Z3YA 1G4DA 2KHCA 4A6EA 1KU9A 1XDUA 2ETHA 5H6QA 3G8TA 2OTJS 3CC7S 1V3FA 1WF1A 1G2EA 1G3SA 3HYIA 4TV7A 4CZZA 4A8XA 2FC9A 3VAJA 1SD4A 2J5PA 2QQAA 1U1KA 4HZFA 2NZ4A 1K79A 1YHQS 4RGRA 5DD8A 4L5JA 2LXUA 4GYIA 4L9NA 3HRTA 5ILVA 1F1ZA 1WF0A 3LA3A 4ENKA 2OZUA 2E7WA 2EK6A 2HKOA 4G7ZF 1TQPA 5GAEU 1VQMS 1WELA 5H6RA 5HVQC 4Z2YA 5HL7Q 1Q86T 2QFJA 5D4SA 2DGOA 1ZYRF 5BPDA 3Q9SA 5E1WA 3ZMZA 3Q2TC 3JSOA 1ZZNA 1BOAA 1ON1A 1BIBA 1STZA 2DH7A 2RQPA 3K2ZA 2CPHA 3HIFA 3K1MA 1JHHA 1SMYF 2FNPA 4MNUA 1J5YA 2CPEA 4ENMA 3BEGB 3KLOA 2CQBA 3S7RA 5LXRA 5KVRA 3MXHP 1KYWA 2PE8A 1TBXA 1L0OC 4LIRA 2AD9A 2L41A 2KRFA 2XB2D 3G96A 1JE8A 2RKHA 2DI3A 1U6BA 3ABTA 2PJPA 3KP6A 3HRMA 3CMES 3MZYA 2FU4A 3I54A 3V4MA 2MQMA 4BAYA 3GEZA 2CQGA 4JBAA 3TQNA 1U1MA 3LA2A 1XGSA 3VF0B 5D6FA 1YFHA 2ZXJA 2EFWA 1MJAA 5DD4A 1YITS 1NHAA 1FT8A 3VEPA 1I1GA 3FMRA 5LRRA 2KI2A 4U0YA 2NNYA 1R1VA 3LAJA 3UE2A 1XN7A 3DQVC 4M9ZA 1JJHA 4TU9A 3P6YC 3HHNB 1E17A 1X3UA 2DFIA 2VBXA 4HF0A 5HLIA 2M4MA 5IM0B 2ZMEB 2P4WA 4UVAA 2EVZA 3WTZA 2BOPA 3PQKA 4WF2A 3IL2A 3JAMK 3CCLS 3ZMDA 2P6SA 3HI9A 1TW2A 1X4EA 1KD1T 1ZGJA 4BHPA 2KM8B 3WE3A 5HS8A 2IA1A 3BPXA 4RS8A 2J0SD 2QA4S 2HTSA 3VAHA 4IVNA 1XGMA 1SJ3P 2XAJA 1ON2A 3LAPA 1E2XA 5FFXA 1USSA 2MY8A 5GMKa 1Z9CA 4YFXF 5HS7A 1TNSA 3QAHA 5FFZA 2YH0A 4CO8A 3WU1B 5DDOC 3OOPA 3WTSC 4CH1A 1MKMA 1YW9A 3HUGA 1QQIA 1YW8A 1F9FA 4KMFA 3RKYA 5GADU 5DUIA 3MAJA 3ZMTA 3LPYA 1IZ1A 1HKQA 2RS2A 1M5KC 4I02A 3F22A 3KFWX 2MLGA 1QZZA 2A3JA 3EYYA 4IHTA 3KP2A 4WFBQ 3CD6S 1U78A 1LVAA 1ZAOA 1VQLS 5GVQA 5K5QA 3G6ES 3MOJB 1T98A 3FHZA 2U1AA 2DNZA 1H9TA 1WSUA 1N88A 2LA4A 2BEOA 1IN6A 1W7PB 4IJAA 2HGCA 5D6EA 3FWEA 2LECA 5J6XA 2M8HA 1EV7A 2RRAA 4EGYA 5BPIA 1WKMA 2ZMEA 2H6BA 1P4WA 4P9FA 4M73A 4A6DA 1L3LA 2KN4A 2UZKA 1HKTA 3ZMUA 5HDNA 3K9TA 3CXCR 2N82B 2FRHA 1Z1DA 4LLNA 2CPZA 3QPHA 1O7FA 3M7GA 4UV9A 5CLSA 2PBIA 2JWNA 3F8MA 2VE9A 3U1MA 1FO1A 4ZZDA 2NAZA 4RU2A 4V19X 2IJLA 3ZZYA 4OIPF 4TLQA 3FMQA 1LDDA 4Y15A 3FXRA 2CSOA 4OOIA 2MKCA 2HZCA 1QBJA 3U9GA 4ERDA 3O2PE 1TLHB 2EFOA 4A12A 1IAWA 5DYMA 2DO0A 5FD5A 2DNGA 3BS9A 2CQHA 4G9YA 2HDCA 5JVHQ 1XMAA 2U2FA 2RV8A 2VBZA 1M5VC 1M5PC 2VC1A 3TOBA 2OTLS 2KIMA 1Q81T 1RK8A 1UFMA 4EJUA 1U3EM 2FBIA 1WEZA 1DP7P 1YIJS 1K73T 4LJMA 5LSLA 3AAFA 3V8LA 1R5HA 2KJBA 1P1TA 2XS7A 3I56S 4KIFA 1YO5C 1OR7A 2GA1A 1FBSA 2DK8A 1U5TA 1WI8A 1DPRA 4F25A 2A3SA
chains in the Genus database with same CATH superfamily
4UT4A 2KXNB 1GX6A 3MGJA 3A3NB 1J5OA 3HC7A 2XMMA 3VQTA 2QA4G 4EM1A 3R0JA 1R8PA 4AUXA 1WHYA 3DGPB 1V3SA 2OEKA 4Q0BB 2HZTA 3BGLA 3FCVA 2RF2B 1S0MA 1G7CB 2FUG2 4XSXF 4E6KG 3TW6A 2OUGA 3V7SA 5BQTA 2AGOA 1LQ1A 1IN5A 2RHQB 3L2QA 1XG1A 3ILLA 3H3UA 3J7AO 1RSCA 1L3TA 3FJ2A 2DH8A 2RKIB 4CLFA 3EGNA 3VTIA 1UHMA 2MSSA 4KFBB 2KB2A 2CA9A 3J81j 2LXFA 3D0SA 4KT6A 2XF6A 1PJ5A 3CCQS 2LU1A 2NXEA 1OCCH 1WI9A 4LOCA 2PMUA 3F9KA 1PKUA 4OYOA 3CESA 1FFSB 2FHJD 3KHGA 2QA4I 3SSQA 3I5UA 3NNAA 2FMYA 1U9OA 5FD6A 3EX7B 3LQRA 1Y1VJ 2LQBA 1D0YA 3UDCA 5E8IA 2K2PA 1OLTA 4O4GB 3MKWB 4MK9A 2R7XA 1WG4A 1YDLA 1KQGB 2DMUA 2QSHX 4ZHRB 3CCLI 2ZZTA 4ZPDA 3BGRA 4KT0C 2FLPA 3J80Z 1Z4UA 2X4HA 3NKYA 2X1AA 2XYGB 1WDDA 1FKOB 3PX0A 2OKQA 1LNWA 2YUSA 5F8MA 2OPPB 3PW5A 1KDNA 5AONA 2HK3A 3SBMA 4Y2AA 4QIWD 4HV5A 1IN0A 5HAOA 1SEUA 4K4XA 2P7CB 4DSEA 2GGPA 4Q2MA 1GMWD 4XRSA 3OL7A 3K4KA 2YVSA 1YW7A 3MD1A 3TNVA 1BQMA 2ZXIA 4OZ0A 1B7FA 5DZ7A 3HF5A 2IRYA 4LSLB 3ZMSA 1EA3A 2A0FB 1HBMB 2R2RA 5CYMA 3QAEA 5FD1A 1RKTA 3UO0A 1N6QA 4XK8C 3MM7A 2Y30A 4LT6A 2J9DE 1N34J 3CLQA 3IWNC 1RABB 4J01A 3JAMZ 4WXCA 4NLQA 3V81B 5E79C 3HFZB 3OFEA 2GAUA 1IN4A 1RHMB 2LEBA 1X9MA 4DQ2A 2M45A 4X64F 5I42B 2HPIA 2C2NA 3VAMA 1F5TA 3C3WA 3HOSA 4OZ2A 2DRDA 2XNRA 4DL0C 3NARA 3QT7A 1WJAA 1URNA 3MPDA 1BI0A 1QO0D 2DITA 1DTTB 2MMYA 1VYAA 3E6DA 4AD9A 2EZKA 2EG1A 3C66A 5LMNJ 4UY8T 3EDRB 4WFNQ 3PM9A 2BQRA 3C16B 3KLHA 5E3QA 5B0DA 2JUCA 3MUMP 4TN2A 2DJNA 3DBHB 2KJCA 5LXYA 3ABUA 3FK7A 3O2IA 4JP8A 3M4OJ 2TDXA 2IS4A 4E7JA 2MQOA 5ETOA 2CQ2A 2K3KA 1LWEA 3N6NA 3IG1A 2DDBA 3LW5C 4LFBJ 4M3EA 2F5FA 5B0BA 3F6OA 4KYWA 5ICEA 3KNAA 1X19A 1C0TA 5D78A 2B9EA 1Q8KA 3TANA 1YJNI 2HYJA 4EGZA 2AIRB 5T7LA 1UB9A 3CPWR 2OSQA 2COBA 4ZVEA 2BJ8A 4WCEQ 1IKXA 4CO3A 4ZVUB 1IKXB 1O3QA 2D1CA 2BKOA 2MXYA 2Z30B 2Z1DA 1MNMC 1DTQA 2GVZA 2WONB 1N36J 2XPVA 5FDLA 1K78B 5KT5A 2XLKA 3TZZA 3ABMH 3OYDA 3W65A 1KN6A 1KU2A 3CLOA 2R5ZA 4HH0A 4Y13A 3VAFA 4WK3A 4KR0B 3B78A 3R7BB 4J9LA 2AJQA 2DR8A 3MAAB 3HHLB 3R60A 4UVCA 4AIDA 4UOHA 2JHEA 4RX6A 2UU9J 4O3SA 4E7KA 4OX9J 1V3RA 4ELUA 3IRRA 4HX4A 3GZ7A 4CP5A 1OFCX 1T3NA 4P2XA 1Z7UA 3RSNA 4P10A 3NEKA 2PX9A 4XQFA 2DPDA 2BRKA 3UD4P 2BE2A 4LK1F 3S8SA 3IH4A 2A10A 1RAGB 2LU2A 4CHUA 5C24A 1T9XA 4CICA 3D1OA 4BHBA 3K6GA 2RDPA 3HVWA 4I09A 4NXNF 4HYKA 1LE8B 4MIMA 4A3KJ 1JJCB 1VOMA 2ZC4A 4ZCLA 1OCTC 3E01B 2KU7A 2DTRA 2W8KA 4RBTA 1Z3YA 1QTMA 3GSDA 4RNFA 2GGPB 3OTEA 1HSTA 1ZREA 2QLWA 3V5RA 3VODA 1DJ0A 1W0TA 3S6EA 2GVZB 2VJVA 1NO8A 4UZCA 3TAMB 4LRDA 5K7FA 4OYZA 5HLHA 3FMWA 3HJEA 1F5CA 3F8NA 2W00A 4ZN1A 2R5ZB 3FXJA 2QMXA 1YJWI 2DFEA 4ES1A 3C7JA 1RNLA 1H88C 2F8HA 3IAM2 2KO1A 2RRNA 3HFVA 3AA9A 2A6HF 4ES3A 4LR7A 3CDAA 4U7DA 4CO4A 1I5ZA 3CC4S 4FF3A 4KRWA 2ZXHA 4MEXF 1TKXB 2JA6J 2B5JA 2ZH5A 3Q9VA 3A8IA 2ESHA 2Q1ZB 4DV1J 2XSJB 3C19A 1MROB 2CDQA 1Z05A 1HBMA 5HATA 4KITB 1VBKA 3V6DB 4O5VA 1X4DA 1UFKA 4RW4B 3SDEA 1W2BR 3R6LB 4DEZA 1LPQA 5DDQC 4RJVA 2RUSA 1FSHA 4CYUA 3CZ6A 1BE4A 4M9XA 2GJIA 2GFFA 4C2UA 4DX5A 4QIEA 4ZYHA 1HL6A 2KZZA 2O7OA 3BR2A 1O7LA 2HEOA 3RYRA 4MFBB 1YVFA 1SAUA 1N5YA 1PIEA 4WU3A 4PK4A 4OAZA 3ISPA 4HSTA 3DRRB 2WHOA 4FCYA 4L73A 1LWEB 4Y4RA 4JX6A 4G7OF 3LA0A 2O03A 3PHTA 1ZPVA 1P27B 3CCEI 4KHRA 4Z2XA 2W2NP 1RJJA 1T0FA 3Q83A 4LK0F 4ZJZA 2FF4A 3R5CA 3DLLQ 1R8HA 2DHGA 1CJVA 4ZP6A 2XS2A 4ZJOA 2PSZA 4PZVA 3GIRA 3O3KA 1T9TA 1S12A 2D7SA 3TAMA 1S1VA 1K0VA 3MECB 3VYSB 1V55H 2QRRA 3MKYB 8ATCB 4TY9A 1EP4A 2OCCH 4WYWA 1Q8BA 1UFLA 4DLGA 3SQGB 2UVUA 4PEOA 1QLNA 4J90A 5KFMA 4LF6F 2CVEA 1FK9B 1QVFR 3MWBA 2QKMB 3E3VA 3N28A 4Y2KA 2Q66A 1IM6A 1XTZA 2BHYA 2E7VA 1REVB 2QV6A 2R7RA 3I9V2 4LFUA 3OSFA 2CPFA 1JXLA 5C4XJ 3UNGC 3OUYA 1QTNB 1NBEB 4W1UA 2K02A 3R3TA 4O44B 1BR4A 1BI2A 2X1EA 2J7UA 4OZNA 1OYIA 3QU3A 2FXAA 3D5MA 4ZYDA 2EJRA 3OS2A 2RIJA 3K10A 1FTTA 1Y10A 2CV1A 2HVDA 4XLPF 3W1YC 1RHUB 3RZOJ 2UXCF 3VAIA 2XZDB 3TMOA 1S6OA 4JI8J 4ESJA 3F72A 4OI0A 2N3OA 3PSIA 3AJ1A 2DGXA 1BI1A 2JRMA 2IC3B 1DBDA 4KGMA 1VRUA 1RA6A 4NLGA 3M9OB 4G6DA 3CD5A 5IXUA 2EEYA 3VSKA 5F1RA 3PFEA 4MHGA 4II2A 1OYWA 3DRXA 4OZ3A 3MMBA 1EHWA 3PQJA 1PUFA 1RWPB 3ET6B 3H40A 1U1QA 3GFJA 2R7FA 2ZJPQ 2PMZA 4V1Ak 3CCRS 4NMXA 2V67A 3K89A 3LGHA 2D1HA 1KLNA 1XERA 4HOBA 4CLKA 1YIOA 3QYFA 4BBSJ 2XVCA 4A0ZA 4F3OA 4PQUB 3HBLA 3CCYA 1H73A 1LE8A 3VFZA 3MKLA 2DO4A 1VQ6S 3RB3A 3BWGA 1R58A 3G1MA 4F02A 2R4FA 2JFDA 1KQ8A 4EYIB 4XAKA 2DPJA 3GFIA 1Y0UA 3AXKA 3OL9A 3TZYA 2V1DA 4LITA 1F5BA 1DURA 2XSJC 2FIUA 1RYRA 4C0OC 3GR0A 1OR7C 3O6BB 1NDCA 4K4UA 3AD7C 3B73A 3LSKA 3QIPA 3M8YA 4BU2A 3D2WA 2Y1IA 2HRUA 2J6UA 2N7YA 1ZR4A 4JI1F 5ETTA 1IVZA 1PCAA 2DXDA 2OV7A 2V4RA 2X1GA 2GO9A 3CJ4A 4CTAA 1P9QC 2OAZA 1S29A 2LLZA 4CLLA 2LFBA 3FF5A 2J0QD 3DLEA 3MI7X 2NR0A 1FVSA 1R5ID 3MM6A 4R5PB 3OHAA 1G3YA 3DNCA 1TAQA 4G1IA 4NASA 1RZ4A 1UW9A 1R23A 3RQIA 4XBFA 3FZ2A 3K2YA 3KMQA 2RNEA 1B4SA 2C1EB 2M34A 3LSJA 4AE5A 5KT4A 1MNDA 2AO9A 2KLOA 5GTHC 1X2NA 4B9MA 4MAKA 2QN6B 1FOXA 5F41A 3CO9A 3MCZA 5D5VB 2EIJH 3M1CA 1WCMJ 2OPRB 1EZZB 2COMA 2OAUA 4QCLA 1U1LA 3ENQA 1R43A 2J5OA 1N52B 2ECCA 3NGDA 4HL9A 2BACA 4K2EA 1SKRA 4IO9Q 3QPSA 4CSWA 3WC0A 3DRPA 4V19K 1UZHA 1VQKS 3FXUA 2MZQA 2L48A 2V4JA 3VOEA 2BVZA 1KTQA 3V4IA 1HW1A 4Y52J 1ZTWA 2W2QP 5IC6B 3T8RA 2B0LA 4ED7A 4QPOA 4OMFG 1SJFA 3WHCA 1BQNB 2BMBA 2PMZD 2LY2A 1EJ9A 1X8DA 3JTGA 1YRTA 1FIPA 3SZGA 3WU0A 3T5XA 2BW3A 3J80U 3B6CA 3BG6A 4OHWA 3HT0A 3HOUJ 3KZIC 2EK1A 3AB2B 1TL4A 1V6HA 3VWBA 2FHJA 5IC4B 3HDSA 3T41A 2BW2A 4DFMA 3DRSA 4MLOA 3R61A 1TFWA 4HSRA 2DNHA 1AROP 2I1RA 2QYGA 4CLTA 2UXDF 1WTFA 2FC8A 2Y31A 1X4PA 3W2WA 1TKZB 3CUQB 1FC3A 2AX0A 4DSKA 2K9QA 4Y34A 4D5FA 1BMQB 1U2WA 3OTOF 4BXXJ 4AC0A 5H1SV 2KVIA 2CQNA 5M2PA 2YPYA 2YS9A 4LFCJ 4JI3F 2Y9YA 4IRCA 4X4PA 3N4WA 5D5WB 1Z21A 1EKSA 1VQOI 4RNHA 4UB6C 4KFCA 2BY0A 3BR3A 3JSRA 1B6AA 2BXJA 2MZ1A 4TYAA 2GHPA 4MTDA 2EBGA 2V6CA 4CQ1A 1WHXA 4ZITA 1VRUB 3J7YU 1VISA 3HSRA 2DNMA 4CH0S 4A93J 1K61A 4XLFA 4B9LA 3ZO7A 3A02A 4DU7A 1B4AA 1NDLA 2V9KA 2MKHA 2BXYA 3VHQA 4Q5VA 2GQ2A 2WTEA 3MM8A 3NGSA 3DF8A 3H92A 1AUDA 3FGVA 2RQMA 1RU1A 2XMTA 3E01A 1BQNA 5I4MA 3AJDA 1SL1A 3M9NB 3PL8A 1JUMA 1WC3A 2FJVA 1JLQB 1CEZA 2VT2A 3HHKA 3ZC4A 5LMUF 2PFBA 3RG6A 3FXMA 2WTFA 2DGVA 2PEBA 4UVBA 2D3ZA 5L3CA 1KQ0A 4BEHA 3AA8A 4JK1X 3REOA 4FVMA 3AB4B 3W5XA 3QRQA 3K5PA 2ZH3A 4YFNF 1WVRA 3LTOA 1HKAA 3H8YA 5DM7Q 4JV5F 2V2ZA 2Q6BA 2C6YA 2HRTA 4IOAF 1DGWY 3V4IB 3ZZZA 1MNEA 4RB1A 1QZEA 1YJ9S 4DJAA 4DV0J 1J2XA 1HWUA 1TKTB 4RAGA 4P96A 4IR1A 4BYYA 1GXQA 4QQBA 1KKHA 1NDKA 5EN1A 4NZ0A 4NYOA 1I50J 2YR2A 1V5EA 2OC6A 5L1KA 3CIZA 4JBCA 1HW2A 5F8GA 5JJBA 2FJBB 2ZWPA 4EZ9A 4IHSA 3TJAA 5D3GA 1ZAXA 1IKWB 3E6BA 2RUGA 4F2SA 1ONVA 1PO6A 3ZQLA 3Q23A 3RB6A 5E1XA 2KIUA 5AXKA 3MDFA 2ZD1A 3DLKA 2RAEA 3EDQB 4LVOP 3MEGB 2VA3A 4YR0A 2XG8A 1HMVB 1YJ7A 2LDUA 1WUUA 4J37A 2WB1A 4PJNA 4HDVA 4RWXA 4O3PA 3ZQFA 3OYJA 3CE8A 2W4CA 1FYKA 1S6UA 2YKQA 4K8RA 3VGSA 1ZA2B 4ID8A 4M3FA 3J7ZT 3R0AA 3M2RB 4C8ZA 3CCVI 5AE3A 4DV1F 1DHMA 4OI1A 2HVZA 1LEAA 3RYPA 2IYIA 2DR7A 4S0HB 2MB0B 3S8PA 1I3OB 1RACB 2ELHA 1FESA 3OYIA 4L5IA 3M6XA 3W5ZA 4WXDA 3H25A 4X62J 1JMTA 2JN6A 2C3UA 4ZCKA 4DXLA 1X0PA 5D15A 1C0WA 1NSPA 3MR2A 3CO6C 1P4XA 4CYCA 5KFXA 2XV4S 3CUOA 5CQGA 2MQNA 3GB0A 5LL6d 3GIIA 3NBPA 3IC1A 1LFWA 4RDUA 3L2CA 4I99C 2A2DA 3DOLA 3MF5A 1GTEA 2DNPA 2W2MP 1QJHA 4KTQA 4IDKA 4JI0F 2YKAA 5GMDA 3LGMA 2CUJA 4JUZA 4IOCQ 2C2DA 1RWNB 4OHYA 3ESWB 4DUTA 1KNZA 1FA0A 2HQRA 3O1LA 4OX6A 2L4MA 1Z67A 4V2GA 2GAHC 1IKWA 5F1JA 1KLMA 3DYAB 2TRTA 4L6V3 3ILOA 5CPRB 1R7JA 3PW2A 1AT1B 2NXJA 2GM4A 2HAFA 1RT7B 1RUSA 1YX2A 2LRDA 2SXLA 3F73A 2FQ3A 3A01A 1IBMF 3FZVA 2ZKTA 2EZIA 1SD5A 4LJZF 2ZFHA 4A3BJ 3HHLD 1JXSA 1JKOC 3HSJA 1N75A 3HOTA 1NK7A 1SJ4P 1SC4B 4CO5A 2W9AA 4CI0B 3T9ZA 5CD4H 1DGRM 2CV0A 4RNOA 2QSGX 1E6YB 4HEA9 3C6TB 3WGHA 1NK5A 3ZOBA 3SEQA 6PAXA 5ED4A 1RE1B 3R2DJ 3KEQA 4EQQA 2ZH8A 4TNOA 3KYLA 3EUHA 3N5FA 4O3NA 2XYPB 3FSXA 2MZTA 2XNQA 1D5YA 4P2FA 3ZZTA 9ANTA 7FD1A 2BANA 2OGUA 2GZOA 2DHHA 2CU7A 1GFWB 4PRFA 4XMYA 3ML6A 1J5EJ 4D1QA 1MWQA 1BL0A 1R6VA 3W60A 1HW8A 4USKA 5KFBA 5THWA 3S3MA 5CVVA 4E0DA 2VG5A 4N9HA 5CYJA 5LMUJ 1S1WB 3HOWJ 1VQNI 2MH2A 3F23A 4DCOB 3G87A 1ZZFA 1HR0F 1I1SA 2ROGA 4EM0B 1CULB 2DK2A 5BS6A 3MOZA 2FD5A 4PGHA 1F4KA 3L00A 1AFIA 5HVGA 1D3YA 1E3HA 3CSKA 1KVJA 4CZCA 4S04A 3ITHB 5IM0A 4P52A 3W8PA 2B8QA 1U45A 1PAEX 5H9FK 1U7LA 3SFUA 5TJJA 4A5MA 4LB5A 2ZNZA 1OPIA 1WDTA 2AQEA 2ICWG 1RZMA 5IOLA 2MD0A 4L0ZB 1FRLA 2HI3A 2M88A 2K9NA 2DIUA 5KG7A 1EH7A 2ZOFA 3H5AA 1N33F 4HF1A 4IFVA 2K1RB 4ZCMA 3V8KA 4C4WA 1PYTA 2EXUA 5J2QB 1MSWD 2CW7A 3BKTA 1R5GA 3M8JA 2NSBA 2ROPA 1TU0B 1K1SA 1YG2A 2NREA 2L54A 5BJRA 2QM3A 1IBLJ 3LALA 4EMSA 3M8EA 2MABA 3L9FA 1UPPA 1S4FA 1ETVA 2ELJA 2IVMA 1X9SA 5L3GA 4HT5A 2LF8A 1X4CA 2V8PA 3RPQA 3W6KB 2GQQA 3LFUA 3UDVA 2JT1A 2XGEA 2BY1A 4OMYA 1UMJA 3OWTA 4B08A 3OL8A 2AXTC 1U8SA 1HC8A 3CCUI 2FHMA 2PJRA 3BGUA 4BQOA 3LMMA 4R1HA 4XK4A 3JRFA 3KYCB 2RSQA 1LWCA 4FYWB 1YE9A 2JEGA 4JQFA 2ZE2A 2OU2A 1FEHA 5EZGA 2K7KA 3HM9A 3BSNA 3K7RA 1OY6A 1Q0NA 4DZ6A 3DRSB 4EWTA 4AXJA 1S57A 5D4PA 1FJGJ 4V2FA 4XIDA 2ZMEC 1DAXA 3GE9A 5MAOA 4C9YA 1RETA 1I5OB 3HRSA 2VPXB 1F0XA 3CO0P 4M5KA 1F3FA 1TL7B 1S7OA 2E71A 1SC7A 1TL7A 1XC5A 3IM9A 3NWSA 2J9CA 3D4JA 5J8CA 4C11A 5F0WA 4Q4ZF 4M3BA 4LF7F 3PACA 2R2TA 1FFWB 3ZTQA 1FHTA 1WC1A 2P8TA 4H4OA 3JTOA 2MPUA 3HO1A 3V6JA 2WBMA 3L7WA 1GQEA 2CJYB 5EG0A 1ETXA 2AF6A 3CCZA 3IAS9 4DPUA 3VZIA 1V5IB 2ZJ2A 3FEYB 2CJJA 1D1AA 4B3TF 1DZ5A 1BC6A 1TL3A 2Z99A 6AT1B 2KXHA 2Y69H 4DF8A 4GKKF 4F4XA 1IQZA 1VQ4S 3TP2A 2M70A 3FKBA 4I0AA 2BJ7A 2IXSA 3QP5A 2UXDJ 3KJQB 3ABLH 4YOEA 2L9RA 3KLVA 1EIYB 3FXOA 2XUBA 1JI8A 1TAUA 3BO4A 1XNRF 4LSNB 5J1PA 4B8XA 3R7SB 2LVWA 4IPAA 2A07F 3B8HA 4RB0A 2IM2A 3CDIA 1S6PA 2H54B 1BXNA 2M52A 3DGPA 2OFGX 4D0PA 2F7VA 8RUCA 4UZBA 4JI3J 2DFFA 5ETRA 1Q5VA 3M9AA 3U02A 2A69F 1MBFA 2Z5UA 3OYKA 3GLJA 2MQLA 3J7YI 5B66C 1HXDA 2QQBA 4F52A 4DSLA 2KG1A 1W2IA 1FTRA 2OQRA 3VYUB 2VH7A 3WGIA 4ZJLA 5ETQA 1JLFA 2GMLA 3H0PA 1BGXT 4HNTA 1YBUA 5H9EJ 1A35A 2VFTA 2EFGA 4WK1A 3WX4A 5B1BH 4RLEA 1SJQA 2HS4A 3ILJA 2CADA 2E9RX 3Q8VA 1OQ6A 4MO7A 2V2KA 1RCOB 4KH0B 4ZVSB 4TU8A 1IG7A 2VKVA 3D5SC 3BY6A 1TKDA 4CLSA 4ZPWR 4BJ6C 2POKA 1UAWA 1I39A 5FB2A 5F27A 4HEA2 4NMLA 5DJBA 3AFGA 4A6EA 1KU9A 3PYEA 4DR3F 4ZP8A 5H6QA 4A46A 2JEIA 2E5LJ 1S0VA 1LFPA 1G2EA 2R5YA 3BN7A 1G3SA 3HYIA 2CWXA 4TV7A 4C9DA 4YR3A 3RAMA 4DYCA 2VPWB 2ZUGA 4QWEA 3PRVA 2PI5A 3BTJA 3KJNB 1YHQS 1IGNA 2O8KA 1F2GA 1E3PA 4GYIA 3HRTA 1U6ZA 1F1ZA 1HNIA 1TWAJ 3LA3A 1UEVA 3RJMB 3E7LA 3IGNA 1DLOA 1VQMS 5C42A 1WELA 4LBPA 1RKIA 2WOMA 5GAEI 4KGVB 2QFJA 1Y7PA 1F36A 2AZ1A 3Q9SA 1HDPA 3ZMZA 3CD6I 1S6QA 2DRBA 4URSA 1JX4A 3PO3J 5C5JA 3ABKH 4XDCA 3Q8UA 2RHSB 3K1MA 1UJ5A 5EDNA 2KZVA 5ETKA 3OL6A 3P5JA 1J5YA 2CPEA 3BEGB 4X4TA 4DMZA 4DPOA 3SCIE 5LXRA 5KVRA 4UUSB 3MXHP 1JLFB 3LSGA 1TBXA 1L0OC 3IUOA 9RUBA 2FVRA 1TV6B 4NUBA 3EGVA 5FDLB 3HVAA 5LD2C 3JRAA 4GFBA 2OELA 1Y5NB 1BWVA 5I3PA 1SFKA 4PG5A 3MM9A 1UETA 1HNXJ 1N0VC 2YNGA 3IAS2 1Y0HA 2XEXA 3LSPA 2XO6A 2OF7A 2EBEA 4N41A 3W66A 5J47A 2UU9F 4JBAA 3TQNA 2XMKA 2HHSA 3MMYB 1YFHA 3TVKA 4E7HA 3BDPA 2L7FP 4DJBA 4P71A 1NHAA 1JLCB 3VEPA 1I1GA 3FMRA 5GAHJ 5H9FJ 2KI2A 1SC6A 1V3ZA 4OHVA 3W63A 3LAJA 1YJRA 1SB6A 4NCBA 1XN7A 3PY8A 2DFIA 2ZMEB 4OI4A 2EVZA 3WTZA 2BOPA 4O23A 5JLXA 3PQKA 5KG0A 5DS9A 4OYPA 4B9TA 3CCLS 4C8NA 1WJBA 4X1EA 3ZMDA 5ETSA 2P6SA 1YGYA 3HI9A 1TW2A 3TUIC 1X4EA 4ICLA 1HHSA 3S2DJ 5JVGF 3JTNA 4AXIA 4NCGB 4USUA 2QA4S 3VAHA 1POGA 1FXRA 5AE2A 5CYQB 2Z2MA 1ON2A 1U0HA 1JQGA 2E1PA 3TL4X 1RWVB 4OYXA 5FFXA 1WZ2A 3FBCA 4ANJA 2MY8A 3PO4A 4YFXF 5HS7A 1URRA 2OEJA 3M9MB 2ZM6J 1FWKA 2NPIA 4TQRA 1OQ3A 5HMWA 5DDOC 3BYPA 1WACA 3OOPA 1SUQA 1TMJA 4UOCA 4ENOA 2R0QC 4D9JA 4PJMA 1OMSA 1MKMA 4A3CJ 1PBAA 2BEFA 2E1AA 3D66A 1MW7A 3MAJA 2IIHA 2AJFE 1D0XA 2AQFA 1HWIA 1UVJA 1NZ8A 1M5KC 4I02A 2P0WA 1LKXA 2CFOA 3F22A 1B99A 1ZETA 1QZZA 1CJTA 3TW0A 2R7TA 2JK3A 2GV1A 2A3JA 3PZPA 1Z3XA 3KP2A 4WFBQ 3GZNB 4LFAF 3QGIA 4AYBD 1PJRA 3CD6S 3LNQA 1FKAF 3R6GB 3OR1B 1LVAA 1ZAOA 1ZELA 1KVKA 3RBZA 4NEZA 2DNZA 2R7ZJ 5KFGA 3JQJA 3S1RJ 1W7PB 4IJAA 2OHDA 2JSXA 2LECA 3BBFA 4PUOA 5J6XA 2N4DA 3J7AY 2LLKA 2HNYA 2RRAA 4EGYA 5BPIA 3CJ0A 1R0AB 1WKMA 4WKYA 2ZMEA 3H20A 2WAQA 3OSPA 4DR5F 3TOQA 3H4BA 1NM2A 1S1XA 4I2QB 3RAXA 1WGXA 2UZKA 1F1BB 2G0JA 3ZMUA 2FUG9 3CXCR 5T14A 2C3MA 1R6YA 1X3ZB 3MR5A 1J27A 2N82B 2IMOA 2DOFA 1BA5A 2DJIA 4LLNA 2CPZA 4XLEA 1O7FA 4WZQA 2JWNA 2DEIA 2X85A 1WJCA 3F8MA 2V8DA 4M95A 2R8IA 4OHXA 2FGOA 4NRUA 4ZZDA 3A0HC 3AAWB 4V19X 4DFJA 2LVSA 3FXRA 2QA2A 3BF4A 2IBOA 3OLAA 2DMTA 3TR5A 4OOIA 4FISA 2HZCA 2WVDA 1OSDA 1RTHA 1PSDA 3C2GA 1IAWA 5DYMA 3Q89A 2ZJQF 2CQHA 3ZQIA 1CC8A 1YBTA 2U2FA 3BG3A 2RV8A 1CQTA 1M5PC 2VC1A 2OPTA 5F0FA 3UKGA 2W4SA 1X1PA 3TOBA 3IR7B 1UFMA 5B0GA 4BY7J 4EJUA 3G2BA 1SH0A 3GTYX 5A8KB 1DP7P 1Y8RB 2B56A 2G2OA 3S1TA 3HKZD 5I3UA 1R5HA 4KISA 1FWPA 1WHUA 2AGPA 1QU3A 4K0KF 4C3HJ 2XC7A 4ES2A 3J7YJ 1WI8A 4F25A 3TO6A 2AQ4A 4B3TJ 3RBXA 3L7PA 4U7BA 3VVTA 4OZJA 2FHKA 5KOXA 2JWTA 4YIRX 2VICA 1SXLA 4HX8A 3J81U 4ECZA 2HFSA 3FBNB 1VFCA 3MM5A 3OHBA 2W82A 3P9IA 5E1ZB 4BQAA 3WTXC 2K4JA 4LF9F 1FY7A 5EGOB 1NSKL 4NC6A 4DLEA 3GO5A 3KP5A 2WCXA 4D5CA 2RT3A 2OEMA 1KWMA 3T3FA 1UVKA 1QPMA 5HNHA 4I68A 1UG0A 1RAFB 1RTJA 1FZPB 2L4AA 2LK2A 2CUYA 3JB9k 2FVCA 2PI4A 4CM0A 2BV3A 2CZ9A 2QQ8A 4DV7F 3M07A 3ZQGA 4RW6B 3G8QA 1S1TA 5F3TA 2ZO4A 1KFDA 1ZG1A 4YFUA 2FMLA 3IWZA 1AXQA 2QFIA 2QZ8A 1WC4A 4DN0A 4JI8F 3PFYA 1B0PA 3QQAA 5B0CA 1UJ4A 3H1CA 4CH7A 1FBUA 1MJ9A 3M8PB 3UWTA 2DAOA 3W9JA 3NNHA 3NY0A 4U7UK 1RKJA 4AQYJ 3S3OA 1BBYA 1M0SA 1N48A 4ECUA 4BHQA 2VLAA 4WFZA 3SCLE 1YITI 3QWUA 4X4QA 4K2XA 1BI3A 5DGBA 2B6AA 4EU0A 2XROA 4M5DB 3NOGA 4M5LA 5EWFA 4LF8J 2LSOA 4ZS6A 4N76A 1PG5B 2PEXA 3ZP5A 3BROA 3CD7A 1HYSA 5E18F 2GIFA 1MBGA 2K5CA 2MKJA 4KIAA 1S1UA 1OY8A 3DM2A 4OV6A 1LJ9A 2XRNA 4N0BA 2VJ5A 5F8HA 2B4OA 3H0GJ 1BM9A 2KKHA 4CRJA 3EXCX 5KFOA 2JX2A 4FF2A 1BR2A 4F0HA 4KFBA 1R0BG 1G1XA 2JVGA 1HI1A 5LHHA 5KFAA 4ZYEA 3M8FA 2BYVE 4FE7A 2CH0A 1P7JA 2KIQA 1B3TA 3ZTPA 1FTZA 3CDWA 4GRIA 2QLBB 4RWWA 1LB2A 3PG9A 5FIIA 1CSJA 1UWAA 2X1DA 1ODDA 2GX8A 3IRWP 2L3DA 3S2WA 3DLLF 4ZVFA 3ZQQA 2DYAA 3UW1A 4OYMA 5C25B 3IRQA 2M8DB 4J91A 3RZAA 5KFRA 3I6PA 2RRBA 2IS6A 2FBKA 3ZN0A 2JC1A 4DV5F 5EUHA 2FZGB 1GX5A 4RB3C 1MU2B 3FBBA 5F64A 4HW0A 2NS8A 3K2AA 4QYZK 3GP9A 3QJPA 4ZIVA 1H0MA 4S05A 2CQ1A 1ULRA 5HOOA 2QO3A 1XNQJ 3HP6A 2HAIA 2J9DA 5M5YJ 4X64J 2IRUA 1XGNA 4HR2A 1BOBA 4ZKAA 1HHTP 5KFNA 2I5JB 3LUYA 3NMRA 4FNHA 2Z57B 4MKVA 1MD0A 1MWYA 4CLUA 4BLGA 5HI7A 5A8KA 1HYSB 2ID3A 4WBFA 4MKAA 4DIQA 2H5JB 1RP5A 1YRNA 2XF7A 2EIMH 4LRAA 4BH9A 2KRBA 3M32B 2CQ7A 3PW4A 3SZPA 1S5ZA 3TKYA 4L0YB 1YZ7A 3JRHA 2YTCA 4X65F 1FTCA 3SMZA 4EBEA 2O5DA 3SXYA 1ZK8A 1PC4A 2ASYA 1FKOA 4O3QA 4NEYA 5IYBJ 3HHGA 3PIOF 1XCBA 1IJFB 1TTYA 3LP1B 2DK5A 3I87A 4HI2A 1RHQB 1U4BA 1HI0P 3R4KA 2DY1A 3DCAA 2IW5A 5D3GB 3CUQC 2WV1A 4BQNA 5HJYA 2WC2A 1KR4A 3ISND 3DU6A 4NWBA 2KXFA 1FCAA 2CQ3A 2XLJA 2V5HG 5EDWA 1LW0A 5LRSA 3D0GE 1NRKA 2X6OA 1S1UB 4R8UB 3TO9A 1VQ9S 2UUBF 3AOCA 4UUVA 1MBHA 1VRTA 5TGTA 4CDIA 1CGPA 4UTGA 1MMGA 2CGPA 3JRBA 1S7EA 2IPQX 1IJWC 3KLEB 5HROB 1S7IA 2JRTA 1P2FA 4BS9A 3CCJI 4F26A 2JQ7A 2KRRA 2VASA 4IHVA 4ED8A 1NB2A 2BXZA 1VLYA 4L3KA 2JVOA 4F3MA 3GFXA 3B4DA 1S7AA 3M6VA 2ME6A 1Z2ZA 3GUDA 4O6JA 1CQNA 3UN3A 5HMXA 3EZUA 3OTOJ 1MSEC 3OOUA 4LF7J 1FYLA 3WGGA 2BV6A 2EIKH 2M3AA 3ZNJ1 2P9GA 2C2OB 2NS0A 1VGYA 1SC1B 3CCTA 2M87A 1JHFA 4DZJA 3A12A 2G0EA 4L76A 2XWXA 2KFNA 2L9NA 1JJ4A 3HJFA 3U1LA 4CLZA 1B70B 3TOAA 2FLOA 3IRXB 3IS9A 4J9NA 3FQKA 3KXDA 5IP9J 1WF2A 1Z1ZA 2G4BA 3CDHA 4ETSA 2QL9B 1P4AA 1ZG5A 3GYGA 3KE2A 1FERA 5IT0A 1EH8A 3D3BJ 4F7VA 2HG4A 2HWIA 3MTKA 3HCXA 5L46A 3QJLA 4GVBA 1JLBA 4WKRA 3HPGA 1I6XA 2RVJA 1IXCA 1IF1A 1BIAA 4FKXA 1IV8A 1H7XA 3H90A 2O0YA 1H98A 4PXEA 1VQ7I 5K8MA 2E60A 3VCDA 1OWXA 1YLXA 3S17J 1HARA 5DG9A 5FJ8J 3MR7A 3ZCOA 4LIUA 3IBWA 3JTHA 2A6EF 5KFHA 3OSNA 4DR1J 4AL6A 5TRDA 4RBUA 4M9SA 3PO5A 2M0GB 2Q79A 5DQIA 1FWZA 4O44A 3B82A 4X84A 2PG4A 1QDUB 5B08A 2CG4A 2L2OA 4EYHB 2X7IA 1I51B 1V9OA 2GQCA 5C24B 3QJJA 2XMJA 4ED5A 3FBEA 5C44J 3OS0A 1O3RA 2FLLA 1IKYB 1XR6A 4NLYA 5IT9Y 5A2QZ 2XY7A 5IOYA 1KOOA 5GAGU 3Q8YA 3GV5B 4I6WA 2LCWA 4XDDA 5ITHA 3NXZA 5DLFA 4EK2A 1SVLA 4IQ4A 3LWMA 4MFBA 3CUNA 1SAXA 2IM1A 2Z33A 1Q95G 4ESBA 3PHEA 4CUGA 4BDPA 4C3LA 2VG6B 3DDIA 1EB0A 4G8XA 5JLWA 5CABA 5JVGQ 3H5RA 2UP1A 2HR3A 5KFEA 2Y8YA 4DPWA 1HA8A 4A8KA 2IDLA 3KLIA 1VLOA 1VRQC 2ADBA 1LUJB 4NLSA 1KBRA 2HHUA 2XULA 3BQYA 4ID5A 5HNFA 3Q0VA 1RKWA 1RT4B 2V8VA 2EW9A 3NAIA 3UR3C 4NL5A 1DQAA 1WPKA 4XKBA 2MGZA 2AYGA 2MGZB 1T6SA 4N47A 1VBZA 2UUZA 1YBAA 4G94A 2DNOA 4RW8A 4JV1A 4KN7X 1K78A 4ILMA 1H2TZ 3ASNH 3GFMA 4QYRA 4DR2J 1LWXA 5D8KB 3HTUA 3EE3A 3GTKJ 1T7PA 5D8HB 5HDGA 3UCZP 2P5LC 2DGWA 5DUKA 1RRJA 3OLBA 2F4OB 1S9EB 2Y0SN 3OUYB 2W24A 3F8FA 2GS8A 2Q43A 4ETZA 1Q8IA 2VB6A 4XSZF 4FNIA 4F7ZA 3LAKA 1LEBA 4JI7F 4HLBA 4YIIA 2MJNA 4C97A 3BO3A 2EZLA 4GMKA 4P9SA 2K1RA 4L3NA 3BJOA 4Y2IA 4L75A 2W25A 2HMIA 2HQIA 1CJKA 9ATCB 4JI6J 3M8SA 2P2CB 4USMA 5IOZA 2DNQA 2VXDA 2YX1A 4KPYA 3BTCA 1TKXA 2QLZA 3OYBA 3CDBA 4NLVA 3H5NA 4RGSA 2DGTA 2XWYA 4DV4J 2VBWA 4DWIA 4PJJA 4AIHA 2W4DA 3K70C 4L9JA 1A5JA 2YQ3A 4DR2F 3H9GA 1S0NA 2ZDPA 4ZCIA 2AJ4A 2ZVIA 5FLXU 1T03B 2EA4A 1XSVA 2YNHB 1OYEA 4KGKA 3V7CA 2BY3A 2HURA 1PJ7A 4ID5B 3ZTOA 4X6AJ 3LFKA 1J75A 1H89C 3OXLA 2CXEA 3ZNUA 4HHHA 2H5EA 3GVAA 3C6UB 4RBVA 4RUCA 1X5TA 3R7NB 3LH2S 3J7Z5 5EEGA 3BV8A 2H27A 1KA8A 4YY3J 1JXEA 2QLFB 2OBPA 3K4MA 3MEKA 2AZ3A 1W7PD 1J09A 2IM3A 1XQIA 2DCEA 3PSFA 3GMGA 2PD1A 5EX0A 2LBFA 2BABA 1EKEA 2CQ0A 3KEYA 5DLGA 3G8SA 3G4SS 1UMQA 1MDMB 3ZR8X 2EFVA 3NWGA 2XSJA 4F67A 1SL0A 1U1NA 3QIPB 1NJIT 2ASDA 1UPMB 2YWWA 1TWHJ 4YB5A 4KA4A 4DI6A 1D8ZA 1I94F 2RMLA 2NXCA 2HPUA 4NYZA 1R36A 3WDOA 4URQU 2KJVA 3PX6A 3OTBA 2M0MA 2XIGA 1ZLJA 3M1EA 5GTIC 1EQ0A 1VS3A 2CQ4A 2HKXA 3PYFA 1D8KA 4DR4F 3OYMA 2UXBJ 1U1OA 3LSRA 3DLEB 1Q82T 4QW8A 2QG9B 2HDWA 2KVQE 4EBCA 1ZHFA 5DDRC 4OZLA 1X5SA 2WWYA 3HHHA 4QZVB 3KUHA 1RQ0A 2DA7A 3QLHB 2YX7A 3GJSB 3SDEB 2LY1A 2WW4A 2AP6A 4EJOA 1ZTRA 2NLWA 4JYAJ 1BHNA 2VJUA 3KLEA 2VXZA 1QAIA 5D6GA 3HKZN 3M7VA 2DLLA 1R7IA 3K0LA 2KKOA 2KFYA 4FHTA 5FLXK 1DRZA 1N4LA 4KIBA 1NEEA 2LTPA 1I94J 3KZYA 5DQHA 5ILUA 2G13A 1PUFB 5E8GA 3ET6A 3T0YA 1S97A 4E2FB 3CDUA 3L2WA 2R7QA 2W01A 3A03A 4TQSA 2K86A 2L02A 3T8TA 5GAGI 3P3DA 1ZR2A 2ZWOA 5J40A 1RI7A 1IN8A 2R93J 4QR1A 2VN2A 1FRHA 4C8YA 1GV5A 2Y0MA 3FK4A 4H54A 4UQGA 3A4CA 1WEYA 3ZXSA 2IGOA 3CDLA 1GLNA 1GH8A 4OYBA 3OFFA 1ZRDA 4B3MJ 4USIA 3DLGB 1K8AT 3DLGA 2BBYA 3ZZUA 1HBUA 3RI4A 2FB0A 2E2IJ 1RXOB 1TUGB 1X31C 3TZWA 2RQ4A 2WZ1A 5EF6A 4DYQA 4MKYA 3HG9A 3D6HB 1U6GA 2OPSB 3NGTA 1N32J 4HBLA 4P5OA 1WKJA 1S9EA 4ZPBA 1X7VA 1ETYA 5GAGJ 4G1PA 3D7SB 3G1OA 3EZOA 5L1LA 5GADJ 3UDEA 4W4MA 3MAHA 2Y3YA 3WIVA 2M2BA 2CPXA 4OINF 4LFCF 3T6JA 5JI6A 3NRVA 1NLKL 1F2HA 3HEFA 3PNTA 1HR0J 4ECSA 3BSAA 4OI6A 2F9JA 5KTQA 1Y00A 3MUTP 4LRBA 3I4PA 2OJ3A 1NKEA 1JNZB 2E2HJ 4ECQA 1SQFA 2H6CA 1FFGB 5LEKA 1K9MT 1FWLA 2DGUA 3DMJB 3ETOA 4L9TA 2FNAA 3DMJA 5K7HA 2L5QA 2HQ5A 4RMNA 3A01B 1E3OC 3MZIA 4AQYF 3C2BA 2O3DA 4RU9A 3JRIA 1R8BA 1C0UB 4FBUA 2CQPA 3G86A 1R0CB 2ZHBA 3OV8A 1EJ7L 2LFVA 5CCMA 4OYIA 3T5JA 1N5YB 5L1IA 4NI2B 2QX0A 4Z6YA 2PJRB 1LVKA 4RB2C 3MMAB 1E6YA 2IGMA 1AWCA 1DTTA 5SUHA 3EWGA 2Z2SB 1QHGA 2YNGB 2LXIA 2F4MB 1Q5YA 1DQ9A 3NWRA 4ASNA 4QLCU 2MEWA 3OYFA 1M1GA 4NLTA 1NPKA 4J9RA 4OIQF 3DRYA 1UCRA 4AWXB 2PGCA 5CKTA 4DBRA 5FGMA 3WTUC 1HA1A 2JRSA 3MWMA 4J9VA 4MMOA 1VQMI 1ZH5A 2ISZA 1XNRJ 3A8KA 1XX5A 2WA0A 4USVA 5KG5A 1NMEB 3OYGA 2MZJA 4QJVA 4QPTA 3M05A 4CDGA 1NK9A 2OA4A 1FJCA 3RAQA 4PG6A 2AYMA 3CC2I 2KYXA 2WAEA 1Z7LA 1S49A 1FOKA 3PFOA 1AA1B 1XR5A 4I2PA 4IOBA 1Z2LA 4LRFA 1SL2A 2HQAA 4ICLB 3EVWA 1F6TA 3SDBA 3BQZA 3GLLA 3DBRB 1UZDA 1FVQA 4ELVA 1FOYA 2KDOA 2MQ8A 4L18B 4FQGA 5BYQA 4ECRA 2E36A 1TK8A 4JYAF 2YXLA 3TUJC 5G0RB 2L9SA 1TQMA 4GXOA 1U09A 4HH1A 1RAEB 3NCQA 3NS7B 2QMUB 1AB8A 1D0ZA 1S5LC 2XGCA 4ZVPB 3Q0UA 2O61A 1HF0A 2WVFA 4P7VA 3PFIA 4UNOA 1TW3A 3HPOA 3G3ZA 2BOLA 1GT0C 4PXDA 4WPAA 3HVTA 3AXMA 2GOMA 1Y9OA 5LT5A 4IZZA 4LQ3A 3QYYA 2DIVA 4DHVA 5HVFA 3ELHA 4JI7J 2E1RA 5A0YA 2GHVC 3PJXA 1TQIA 5E20A 2FD2A 3JYTA 5ICFA 3WTYC 3M2RA 4U7UD 2IMWP 3EVMA 2ZSHB 3DEWA 1SH3A 3IBFB 2QKLB 3IHUA 4ANDA 1QA6A 3E97A 3I0TA 2ZHAA 1W5TA 2E5JA 3Q3SA 3OJSA 2R42A 3HKZA 2F5VA 3PIPF 4ENJA 4Z7CA 3LSMA 3MMCB 3GZ6A 2Z58B 3RJPA 3TI0A 2M7AA 1RBOB 2CAJA 1H2UX 2MSYA 1RISA 1Q8LA 3HB9A 4MIWA 1BUXA 1JGGA 4HVZA 3BOQA 4OZ1A 3K7AJ 2C42A 1Q79A 5L9XA 2IAJB 3ENAA 1RU2A 1JJ8C 2NVTJ 2C3PA 2F8EX 3ZTSA 2M5YA 3HOVJ 3LF0A 5LGUA 3R1LA 2VQHA 4QOTA 2YY3A 2WSEC 3H5SA 5KFVA 4ANEA 2X1FA 2XGXA 1LFUP 2HW3A 2DW4A 5D4RA 5GAHU 2QL7B 3N79A 1WQ2A 1LKZA 2JPCA 3JAMY 3L1PA 1FDDA 4B3MF 3THPA 1FLIA 2IRXA 4H4MA 2UUCJ 1OJLA 2YKOA 4U96A 1HD0A 1Q1HA 4MEYF 4N8OA 4JI4J 3OIQA 3IP0A 3QRPA 3J80K 2FA5A 1WJ5A 3I71A 1MBJA 4M5JA 2EQRA 4F55A 1RUOA 2KT2A 4DPXA 5KFFA 3R5AA 5CHCB 4WP8A 2VI6A 2UXXA 4DR7J 5KFSA 1OSCA 5F8NA 1MMLA 3OFHA 1QUVA 3PNIA 4I6ZA 3TEDA 2LDYA 4OMZA 4XRFA 4H4KC 5HK4A 5IYDJ 1B64A 2M7SA 2X51A 4GRSA 1N5SA 4NXMF 4NLWA 3BYRA 1JLQA 1LDJA 1Y39A 3S15J 2V63A 3L2UA 2W2PP 2CW0F 2M5WA 1A0OB 3KG1A 3EUKL 3CJTB 3JSMB 1UW4A 2K8GA 3D5LA 3BR9A 2GLOA 3VSLA 3GYHX 3PRDA 5DEQA 2R7WA 1YK9A 3T5KA 3IO1A 2HVHA 4OU0A 4FPIA 2D45A 1NK3P 2HGNA 4ECWA 3UNYA 1VQ9I 3JSBA 3C15A 3OPKA 1NG7A 5DM7F 1F3VA 4A8WA 2C3YA 1NJXA 4J9UE 1IUYA 4CYDA 3ASOH 4DX8H 3OD2A 4ZTFA 1FKPA 1IKVB 3PTWA 2ZOMA 3IR5B 2VJIA 4QPQA 2JVRA 3AL0B 4HYEA 1RADB 4O3RA 3D0IE 2QYOA 3N01A 2BYCA 2MD5A 3IV5A 2KT0A 4E7SA 1IXSB 3F3XA 2BA9A 3SQGA 1X5PA 1VQKI 5E0OA 2FEZA 2ZJRQ 3ZZOA 1RAJA 2KJWA 1FP2A 1G8XA 4CGZA 1AKHA 1Q16B 4QIGA 3BQ2A 3WIUA 1K6YA 2YNFA 1CPZA 3N05A 3H0DA 3AQPA 1UVNA 4GKJF 1BLUA 5HP1A 1M5OC 3DLHA 4U8VA 1P92A 1HWKA 4ED0A 3D6FB 3H3VK 1KGSA 2FLNA 3QLHA 2RNGA 4M71A 5D0EA 4Y65A 4UQTA 3HSFA 4B9UA 4LF4J 2N8GA 4HACB 4NYPA 4Z7YA 5IT3A 4JX4A 4HTIA 3EPGA 3EDPA 1FD8A 4QSHA 1ACIA 3WHBA 2XZTB 3PJWA 4GO1A 3MPYA 2TCTA 1SFUA 2HMIB 1UG2A 1QVTA 3MURP 1YQAA 3L7UA 2H09A 3D28A 1WI6A 2PC6A 3DLAA 3MEEA 2JEJA 5H2FC 4XL9A 3QZ7A 1RT5B 5CZVA 2FY1A 3J7AN 5CVJA 5J2MB 1RHKB 2Y0SD 1NH3A 3BZCA 1APSA 4DUZJ 4F0MA 2E5IA 4F4KA 3V4GA 1NHVA 3FX3A 3BBBA 1XMQJ 2O8XA 2HWTA 2D5VA 4UY8I 1NJYA 4YN3B 3G71S 1SFEA 1WSVA 2LQ5A 2JPBA 2E35A 4ZVRB 4AL5A 4BKXA 1ENHA 2LKXA 2NPFA 1WOPA 1GVJA 1IBLF 5K5RA 2IGNA 4BDZA 3MMCA 3BR5A 2R3VA 1I6HJ 4P72A 4DDFA 2NUHA 2EH3A 3C6UA 4HI1A 3TO8A 1WKKA 4J9PA 2VQFF 5KNLA 2YKNA 2OMLA 4E4HA 2EV6A 2OSRA 3VDXA 5LJ5Y 1PP8F 4Z37A 2IS1A 1FJGF 1RC9A 2PMHA 1NJWA 1GXTA 2CNLB 2OPQA 5IV4A 3DOLB 3MEDA 3WG7H 2X3GA 3EUAA 1X60A 3A8JA 3JREA 5B0EA 3ONQA 2OQGA 1IBKF 3T1AA 2KG0A 4QIWN 4HACA 1AOYA 2PDAA 4HAMA 4U67Q 4DUZF 2H51B 5EGYA 2D3O1 3NAHA 3IWXA 1P1LA 3ENWA 1BY9A 2ZCWA 1RT2B 1T05B 3KHLA 2RREA 1Y0NA 1XMOF 4ZLLA 4WFXA 2R92J 3S14J 4J9QA 2JL9A 2AYBA 4C30A 2W7AA 3A1YG 4DNCA 3T19A 4KJIA 2HVRA 4ENNA 4IG3B 4GKKJ 4I0WA 3BZKA 4HDGA 1W36D 2LH9A 2Y1LB 4WTYA 3HMJG 2KRHA 1WH7A 3QQCD 1LNQA 1O4XA 1R22A 2QC3A 3SYZA 1X1CA 2BUNA 3KG4A 5EX3A 2ISYA 3QSIA 2BR0A 2H48B 3MCMA 4RZRA 3HLUA 4HRIA 4M8LA 1BJAA 3DKYA 3HOYJ 1ZBTA 1CQMA 1U1PA 2M4KA 3BKFA 2UV1A 4WFAQ 3K5NA 3NQOA 2ZITA 1E6VA 3FKIJ 4CT9A 1PDNC 1VI0A 3RYLA 1OO0B 4LBIA 2P7VB 2A1BA 4CCHA 2DNLA 1XSXA 5CZXA 2A5YB 1QRYA 1QSYA 3DKDA 2HS5A 5B0FA 3KP7A 1ERDA 2V50A 4RNMA 4XNFA 3R9LA 2R4GA 3OBIA 1BWEA 2JTVA 1FBQA 4B47A 3QIDA 3JR9A 4I4BA 3I9ZA 2ZKUA 3I9V9 2UXBF 4MQVA 1NH8A 4X66F 4ZVGA 4LG0B 1QY7A 4C2MA 4ZPVR 4IO1A 5E3PA 1FDNA 2H1KA 5F9NA 3OYLA 1U8BA 2W9CB 2FDNA 4YUDA 5CYVA 3GLXA 1IJEB 2KDZA 2HVQA 1ZS6A 3HGGA 2R8GA 3HD1A 3G8TA 3CC7S 4DV3J 4DL7A 3G6VA 1TFYA 2HBYB 1SVDA 1NB7A 1BW6A 4UF4A 3KHHA 3F41A 2QQAA 3UVJA 3I56I 3NCRA 1U1KA 4K2JA 4HZFA 2V34A 1K79A 4GO5X 1RHJB 2LXUA 3M1VB 2CZVC 5L9NA 2HKOA 2O67A 5GAEU 1S77D 4DF4A 1LK7A 4R25A 1MG7A 2BDPA 4Z2YA 4K50A 2MDAA 2RU9A 4A8OA 1H0HB 4DSIA 3IG1B 2JLGA 4ZVQB 4LFAJ 5AXMA 1BOAA 2ASJA 1ZM9A 4Y2MA 1Q1VA 3K2ZA 2CPHA 1LXJA 1WKLA 1SMYF 1V5FA 4MNUA 3WHIA 3AOAA 3GJQB 3T1YJ 1PYOB 1KYWA 4QWAA 2PE8A 3T1HJ 4A3DJ 3FZBA 3MM5B 4CYCB 4LIRA 2UUAJ 2L41A 2KRFA 4XRMA 3T6BA 1JE8A 2G2YA 2RKHA 2ZH1A 2DI3A 4DZDA 5I3QA 3J7A1 1U2CA 3MZYA 1U02A 5KT7A 3EVOA 3SEZA 3V4MA 2MQMA 3PJ9A 4BAYA 3QT5A 2HXOA 1U1MA 5HANA 4D7MA 3QGHA 1QSLA 5JHFA 1X1DA 4CCJA 3D0HE 2Z56B 1MJAA 1SPBP 1HI8A 3C2HA 5D4NA 5HROA 3EZ5A 2NNYA 3BGRB 1H38A 4QYZJ 3DQVC 4PFPA 3P6YC 1X3UA 4LRCA 2NQPA 2B9YA 2HHTA 4PFOA 2M4MA 2P4WA 1SKWA 5J1YA 3IL2A 2Y8WA 1S1XB 3Q0WA 3JAMK 3A2KA 2LP4A 4RW7A 4XIUA 1KD1T 4OJ1A 3OSGA 4O4GA 3WE3A 5K8OA 2IA1A 4IH5A 1RAIB 2HTSA 4TVAB 1PVEA 2BJ9A 1XGMA 2B7EA 3BGOP 3M30A 4RKUC 1SJ3P 2XAJA 3AQOA 3LAPA 3PR4A 1U9NA 5KAFC 3ZXWA 3G1LA 2QA1A 4WIQA 4MK7A 4DR6J 3QAHA 5LFAA 5FFZA 5KFCA 5KG3A 2EI5A 1WH5A 2OD4A 4DUYJ 3BSCA 1Y5IB 5DG7A 4DPTA 3WTSC 1ZGWA 1YW9A 4Y6IA 3AT1B 4DX6A 1F9FA 4KMFA 3RKYA 5GADU 2V2VA 4ILRA 3ZMTA 3LANA 2DODA 3NLCA 1IZ1A 2VQGA 3KFWX 3JRCA 2MLGA 2FVQA 2K3FA 2GMHA 3ADAC 3DDNA 3FCWA 3AD8C 4DZPA 3PEJA 3EYYA 4LIVA 2UUTA 3CDEA 2LQ8A 5JUMA 1U78A 3QBCA 2A6OA 5HLFB 3LSIA 3K8WA 1H9TA 1BR1A 3S32A 3S1MJ 4FZVA 1IN6A 4RUHA 4BBYA 4JOUA 5D6EA 2DTJA 1UA1A 1T02A 3GU0A 5LM7E 2CQQA 3CD0A 1RTIA 3QO9A 3M8PA 3QGGA 1R71A 4M73A 3U1NA 1ZM4A 2XGDA 1L3LA 2BQUA 2JA8J 2ZH4A 4ZC3A 1HKTA 3K9TA 4DUYF 1NJZA 2OPQB 1A6QA 2DOEA 2FRHA 3U7JA 1YQHA 3K57A 1OCPA 4NCGA 2DTZA 2R8JA 1YIJI 2YWFA 4YELA 2Y1RI 3CNQP 4PUSA 3M4XA 1OCZH 2E34A 4P73A 2RH3A 4EBDA 3VZHA 3U1MA 3WU2C 4QPXA 3BCAA 2HIYA 2IJLA 3ZZYA 4OIPF 4XLHA 1GTHA 1W0UA 1CJUA 3HKWA 3DM2B 1QBJA 1C0TB 4HPQA 2Z4PA 3MKZA 3RRKA 2NZCA 4KBIA 2DO0A 3J80Y 2DNGA 3BS9A 4G9YA 5HJXA 1T8EA 2HBRB 1M5VC 4LQ9A 4WYLA 4ALZA 1JIHA 2KIMA 1GMUA 1WEZA 2EG2A 3HZJA 4LJMA 5LSLA 1HPZB 4LVNP 3V8LA 1H74A 1GMVA 1OR7A 5AXLA 3U21A 4YRVA 1UVIA 2FVSA 4B43A 3JCUC 2A3SA 4OZ5A 4AYBA 4NB5A 4PKDB 1Y4ZB 2YWHA 3H4DA 4G7HF 4KUMA 1A6LA 2G1DA 3K8VA 4DU8A 5IY5H 1A31A 4JP0A 4TLRA 1R4MB 1M1HA 2G2ZA 1RAHB 3HUGB 3NGUA 2I2YA 1WD6A 4A3LJ 3LWLA 3JTPA 4WTOB 3QGPA 5HDKA 3OYCA 2QVOA 4FT8A 2EFQA 5KT6A 3OVSA 4FYXB 3SFIA 1RTJB 1KU3A 3TQ1A 2HHHJ 1VC6A 4X66J 1NK4A 3L2VA 3E3XA 1R1UA 2P9EA 2HFZA 4PG4A 3CMAI 4W98A 5GAEJ 4UHTA 1OMIA 2HWHA 3DTIA 2RAQA 1UJ6A 2EC0A 3SCJE 2XASA 2GXAA 1YJWS 3QFHA 3H3ZA 2WVCA 2K9SA 1RTIB 1R0AA 2EINH 2E44A 1DQUA 4M72A 2XGQA 1SVOA 5HP1B 5HQMA 2QSFX 2STWA 5L3DA 2HYFA 3CMQA 2YWGA 2H94A 1IR1A 5K5OA 1ELOA 2YPZA 3FQLA 1HQEB 4H0EA 2VFUA 4JYKA 1DDNA 4G6VB 3OYAA 4G6QA 3CJSA 1ZG3A 1RT3B 1N33J 3MUVP 2PI0A 3FISA 5ICGA 2ZC3A 2WVBA 5DQGA 4UOFA 5KFZA 4NLOA 4O0IA 1GMWA 1MROA 4IRIA 3FSYA 4CNYA 4IR9A 3NG8A 1UTAA 4MGRA 2E1OA 2CJAA 1REPC 3FSIA 1M5SA 2EPIA 1IR2A 2RKIA 3ZQ7A 3CW2C 4KQZA 3LP1A 5D0GA 4FX4A 3CCES 2AEMA 3GCWP 1JJ6C 3I58A 2OLWA 1YTYA 2VONA 2YNIA 3DP7A 5EJCA 4AVPA 5A8WA 3CC7I 1RLCL 3H2UB 3F21A 1RWUA 2ZKZA 2E1NA 3DXJF 1MIJA 1U24A 4C3MA 4LF1A 1VQ7S 2XI2A 4IRGA 2A6MA 3N4MA 3DKWA 2F3JA 2L01A 4X4OA 1P6TA 1AYEA 1WJFA 4BCAA 4IHWA 4P55A 2J0XA 2VFVA 1OKRA 4ABZA 2YU9J 2GIRA 1XR7A 4B3OB 3IRXA 3H59A 3LL7A 4PR6A 3EGZA 3F8BA 2W7NA 4M3DA 3DC2A 3RPUD 1L3UA 3K70D 2K06A 6FD1A 3MCNA 2P8IA 3I5AA 3BQ1A 4L5EA 4PYAA 2CS3A 2Q8KA 4DCPB 1UZCA 1D1CA 2UVRA 4FYYB 1IXRC 2IP2A 1NH7A 1U26A 3E0JB 2COLA 1J9IA 2QT7A 4HNVA 2DXFA 4EJVA 5D8LB 2Y0SA 2KHDA 4QIFA 5DM6F 4DL5A 2HVIA 2OTLI 1REVA 2EV5A 3M30B 2O3FA 2HQNA 4DPYA 1QPIA 4NXMJ 3FFIB 2EWNA 4IKFA 3F56A 3W64A 2CJKA 5GPAA 1H9GA 3I4NJ 1RWOB 3VYTB 3WE2A