2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
4EJOA 2LECA 5LRSA 3GXOA 2DK8A 1M5KC 5LGTA 1DZ5A 2EV5A 5BPIA 2F5EA 2L3DA 3GWZA 1M5OC 2MKSA 4ED5A 2MH9A 3I58A 4BQAA 2PBIA 2Y48A 3HSEA 1J0RA 5LJ5Y 2PQ8A 2D9PA 1J9IA 2LXIA 3IRQA 2YPRA 1MJBA 2HQNA 3NNCA 1LDJA 3H3ZA 2HGLA 4RB3C 4WFNQ 2ZO4A 1X4DA 2FEZA 2Y0MA 2PEHA 2DH8A 1YS7A 2MY7A 5LRRA 4Y13A 1XGNA 3CMES 2OZ6A 1K7AA 1FT8A 3F6VA 4KIFA 2KVIA 4CIOA 5IFMA 5K5QA 1BI1A 4CH1A 4OINF 2MY8A 2BBYA 5ILVA 2PE8A 5AIQA 2DHXA 5E17F 1RK8A 2K7LA 3ZZYA 2QQ9A 1HW2A 1USSA 3REOA 2YTCA 3RYRA 2KXFA 3O6BB 5IM0A 3V7SA 5GAEU 1R36A 3VAGA 4L9TA 4ESBA 3V4GA 4ON0A 4A8XA 2MKIA 2DGSA 3FEYB 4BXUA 1T2KA 3ZMTA 1ZLJA 1NJIT 4HLXA 5K5RA 2CQ4A 2YU3A 3MAJA 1U2FA 1OWXA 3DPTA 3ML6A 4I0AA 1T38A 1IUYA 4QU7A 4EQQA 3N9UC 1BI3A 3V7RA 2EK1A 5ICEA 1SJ3P 3TO7A 4YFKF 5IT3A 3LA2A 2AXLA 3QRFF 4WF9Q 5DV5A 1PGZA 4LD5A 2RNJA 4Y00A 1TNSA 4RGUA 1ZHFA 4CICA 1P4WA 4IXAA 2X0LA 5BQTA 1WSUA 1F4KA 2DNKA 3ELKA 1D8ZA 1P6RA 5FD6A 4OU0A 5CYVA 3WE3A 2MGZB 3UWTA 4WF2A 2GAUA 1Q82T 3BDDA 2AD9A 4A0XA 1FNNA 2YH1A 1YIJS 1W2BR 2DNYA 2FBIA 2ZFWA 2MGZA 4E70A 2GWRA 4LLLA 2DNMA 5HVQC 3WG9A 3MURP 2D9OA 3TO8A 2RVJA 3G71S 3K0LA 5JFRA 2DGXA 1FNXH 3MFKA 1M5VC 4JBAA 3GFJA 2OQRA 3KFWX 3J80K 4OIOF 4EGZA 3R27A 5DDPC 1R5HA 3QOPA 3W6KB 1WI8A 4IHSA 4HW0A 3ABTA 3R0JA 5H20A 2DITA 2A5YB 2E7XA 2QBYB 2RS2A 2VODA 2XHKA 3VF0B 3CCQS 2MZSA 3LAJA 4YOEA 4ZYEA 2XSFA 4LK0F 4NHJA 3CPWR 1TTYA 1X5OA 1YWXA 1W5TA 4XRFA 1H0MA 1J5YA 2QUFA 1FBUA 3HHNB 3ROUA 2OD5A 1R1VA 1CF7B 2VOOA 3SXLA 3V4MA 3GFLA 4PGHA 4PGGA 1P92A 1KC8T 1B7FA 5CVUA 1VQLS 3CCJS 4MNUA 3E5XA 2STTA 3P9KA 4N9HA 3FEXB 1L3LA 2QQBA 2CPHA 1X0FA 2FNPA 1UFWA 2MHNA 1U1KA 4JQFA 4JK1X 2P6TA 2CQ3A 3DQVC 3ZZZA 1SJ4P 1VQ9S 3LAPA 1NHAA 1T0FA 3RKYA 2Z33A 1P27B 1UW4A 2FC9A 4M71A 4ERDA 1YTYA 5E20A 2RKHA 2W84A 2P8TA 4U0YA 1HKQA 1ZG1A 1ZG3A 2M1BA 2CW0F 4M5DB 3EX7B 5EEGA 4BHBA 4EV0A 4IRHA 3LPYA 2CQHA 2DK5A 2E5GA 3OW2R 4LK1F 2G7UA 5FJ4A 1G4DA 3K0JA 1OMIA 2OU2A 2JWNA 2KKOA 2XROA 3US5A 3BJ6A 1MZBA 1J75A 1WF1A 1T39A 5DETA 2KM8C 2G1DA 3LA3A 4A6DA 2ACJA 5LJ3Y 3U2RA 5MLCV 2LSOA 3HSRA 1UHMA 1X4HA 3E5QA 2RU3A 2CG4A 3T8TA 2OSRA 2AYMA 4EM1A 4KNYA 1SMTA 4L9VA 3EDPA 1X4BA 3ZMVA 3IWFA 3SHFA 1QM9A 2MA3A 1B9MA 5BPDA 2RN7A 2DGVA 1Q1HA 4P9FA 2H6CA 3BZ6A 5LHGA 2IT0A 2V9VA 3SQNA 4PDKA 1LQ1A 1Z6RA 4HF0A 2W57A 3UD4P 1M90T 4ESFA 2MB0B 5ILUA 2M8HA 1H2TZ 2A3SA 4UXNA 2IP2A 5IQQA 1FYMA 2NZ4A 3E6MA 4A12A 2V1XA 1KA8A 4EGYA 5TRDA 3CUQA 4M74A 4B8XA 4KN4X 2MQNA 2PFBA 3EQLF 3QP5A 2D1HA 4Z2YA 2LEBA 4YIFA 1KOOA 2BZ2A 3K9TA 2MPUA 1ZREA 1F5TA 4O6JA 1A7GE 2FMYA 4ENMA 1H2UX 2XS2A 2CQ2A 3RKWA 3F8CA 2FOKA 4EJWA 3KZZA 3VFZA 1YW8A 3S6EA 2O3FA 5JHUA 1HBXG 2OA4A 5LSLA 5D8KB 5LEKA 2FA5A 1ZRDA 1J7KA 5D78A 4RS8A 4PKDB 4KICA 3CDHA 3EYYA 5HDKA 1H9TA 2LEAA 5BS6A 4LB5A 4LLGF 2W25A 2ZNZA 2CPIA 4CQ1A 1XSXA 1D9AA 2JRSA 2EK6A 1JJ4A 1HQCA 5H6QA 4RGXA 1PDNC 3MUMP 1IF1A 2XAFA 5DYMA 4L0ZB 1EH8A 1UCRA 1DBDA 4AIJA 2EFWA 1WI6A 1Z9CA 4WWCA 1O57A 1QBJA 3BPXA 2CPJA 2HDCA 2RQCA 2VONA 4NB5A 1H6KX 1TBXA 5HO4A 4RAZA 2DGOA 2KJCA 2Q0OA 3P3DA 3I4PA 2L9WA 2ZJPQ 1G2EA 1OYYA 4R1HA 2ZCWA 2DHGA 5ICGA 2L54A 2MQLA 5L3DA 3MEXA 4PCQA 2MH2A 1VTNC 1A9NB 1T98A 2N82B 3KLNA 3I55S 5A2QK 1BBYA 2KT5A 4CO8A 4KIBA 2OQGA 3RTRA 4BHPA 2FY1A 1ZLKA 3WTXC 4RAYA 2LF7A 3TGNA 1Z7UA 2QLZA 4G8XA 3TDUC 3WGGA 2MZRA 4U67Q 2VC1A 3WTYC 2MQOA 2J0SD 2XV4S 2M0GB 2M87A 1IN8A 4HV6A 3ZMZA 2OIHA 1AOYA 2VXZA 2DPUA 1NU4A 3TO9A 3VAMA 2D45A 2WBRA 2BYVE 2A6HF 3MZYA 2MC3A 2F5CA 2VBWA 3UCUP 2XAHA 4A0ZA 2IW5A 2RQPA 1K8AT 5HOOA 1VC0A 5TJJA 4BS2A 1FLIA 2RUGA 1DHMA 1R5GA 3J80Z 4ASNA 5D5XB 2GO9A 5A2QZ 1FYLA 1ONVA 3VEPA 3F8FA 1N88A 3EGZA 2RC4A 4I0BA 2L4AA 4L9JA 2G0CA 2GA2A 5LBQA 1TW2A 4K2EA 1HD1A 2LQ5A 5ED4A 4QLCU 5AIPA 3VAFA 5FO5A 4AIHA 4N0BA 4Q5SF 2FMLA 3G73A 5EEHA 2U2FA 3LQVA 3I59B 3E5UA 2QFJA 2DFIA 2XUBA 3RI4A 3O3KA 2V1DA 1QGPA 5LHIA 2JT1A 4XLPF 4IOAQ 4FXVA 4MEXF 3DF8A 1U5TB 3B4DA 4UVBA 2FNAA 4CXFA 5BOXA 1HKTA 1RI7A 3J7ZT 1Z6TA 2CPFA 2B0GA 2VBYA 1KD1T 4GCVA 3R61A 1IXRC 2OSQA 3CD6S 4F02A 3HSFA 1UFMA 1V3FA 3RPUA 2GXGA 2STWA 1JHHA 4U0VA 2E1NA 2MQPA 4B09A 2G9WA 2XGXA 1CVJA 3JAMZ 2L4MA 4P55A 2JVOA 4FX4A 4YIIA 1RUOA 5DCMB 2CFXA 4G6QA 1ON1A 4BH9A 2K4BA 5JI6A 5HLIA 2LXUA 3DXJF 4L5IA 5CVVA 2MSTA 1QVGR 1A04A 2MJUA 2C6YA 2Y75A 2CSOA 5HL7Q 3QU6A 5D6FA 2HR3A 3NNHA 3B02A 2O3DA 5CVJA 1B59A 1I5ZA 2HGMA 1ZAOA 1FJCA 1D5VA 1XDUA 2ZMEA 1OYIA 2W24A 1YJNS 3LFKA 2P7VB 4LMZA 3CUQB 3ZQ7A 1USTA 2DU9A 2KH9A 3U1MA 4L18B 2JZYA 3RYPA 2HYGD 2FF4A 3FHZA 4ENJA 1JHFA 3SZPA 3D0SA 1K9MT 3T8RA 5ICCA 1XCBA 1ZG5A 1S6LA 3BROA 3THPA 2KFYA 4IRGA 2CQ1A 1URNA 1XN9A 1QQIA 1SD6A 2MYFA 3HTUA 3KETA 1J59A 2RRBA 1YFHA 1UHWA 2VE9A 4N9IA 5D5VB 5CVRA 4YFXF 2GA1A 5KVRA 1AUDA 1U8RA 3NQOA 2G7HA 3CUNA 5HS8A 3R1HA 1X5SA 3Q2TC 2M45A 3R0AA 1ZRCA 1LVAA 1KOHA 3QP6A 3P9CA 4UV9A 3KZYA 1WEZA 3KP6A 3K69A 2L08A 3GYHX 3SXYA 1W4MA 1RNLA 3MOJB 3G9CA 2HGNA 2LF8A 2RNEA 3LQRA 2A6EF 3Q2SC 1VQPS 5LLQA 1FSHA 4P5OA 3L2CA 2MXYA 2TDXA 3I56S 4HV5A 2ZNYA 2ADCA 1QPMA 3KP5A 3OV8A 1HD0A 2QYOA 2IA1A 1KU7A 2L02A 2A69F 3OOPA 3VOEA 3UCGA 3WTWC 1I27A 1MD0A 1L3KA 1YW7A 4MQ9F 2NYXA 5J8CA 4MHGA 2ZJRQ 2COMA 4CYDA 1WELA 4TU9A 2I38A 2Q79A 5JVHQ 4IVNA 1WHWA 2EK5A 2M2BA 2FC8A 2GHPA 2EA2A 2VE8A 1FHTA 1F9NA 2H27A 2AS5F 3IRRA 3FXQA 1Q86T 2Z99A 5DUIA 4WXCA 1U6BA 4UY8T 1LJ9A 1H2VZ 5LGUA 3WTTC 1C0WA 1TW3A 2NS0A 3CCVS 5E1ZB 1N52B 3FXRA 1K78B 2DH7A 1XDSA 5CJ9A 1K6OA 1PO6A 3ULHA 3BO3A 1F1ZA 3E97A 3MCZA 2MD5A 4QWQA 2DAOA 2MKHA 4P9UA 2DHAA 5EN1A 3G6ES 2A07F 2VOPA 2YR2A 2EFPA 1ZN2A 4GYGA 4ESJA 1OPCA 1SD5A 3J81K 2WTEA 4ENKA 3FM3A 4KA4A 2ZJ2A 1R00A 2NRAC 4OZ1A 5GMKa 3CCSS 1UB9A 1R58A 4G7HF 3BP8A 3T5XA 2EV6A 2F5DA 1IN7A 2YX7A 2W85A 5F1RA 2LYVA 2ZJQQ 2BGCA 2DPDA 2QWWA 1KYZA 3DV8A 2JPBA 2M52A 2MKJA 3SDEB 3GFMA 1W5SA 4Y17A 1P1TA 2JTVA 3TYTA 1SMYF 3FMSA 2X1GA 2OAZA 2HVZA 2HGCA 3HIFA 2DGTA 3L00A 5CA5A 2CGPA 1P4XA 3KP4A 4I09A 2M4MA 3IRWP 4EM0B 1TQIA 3CULA 4WFAQ 3DXBA 3WU0A 2CPYA 1K78A 2CPZA 1FT9A 1XB4A 1FP2A 3NS6A 2HS5A 4OIQF 3CUQC 5HLGA 1L0OC 4C7QA 1U1RA 4KFCA 3K2ZA 3MI7X 1KU2A 3WE2A 3IKTA 4HOBA 3VAJA 2ETHA 2N7CA 2RQ4A 2O8XA 2LCWA 4ZKAA 4I2OA 3UE2A 2IPQX 3HUGA 4RB0A 5D4RA 1IXCA 1XD7A 1KYWA 4A5MA 3P5TL 5FGMA 1JJHA 1LNWA 4OMYA 1X4EA 2D1VA 3RDIA 3MUTP 5DD8A 3CCMS 2NAZA 1ULYA 5L3FA 2CQDA 5D6EA 4M9ZA 1T6SA 3ISPA 2H94A 1WWHA 1QNTA 4KMFA 1LEAA 1S8NA 4ZYHA 1BM9A 2EV0A 4CHUA 2FXAA 2E5IA 1S29A 4M9SA 1LDDA 1MJAA 2EWNA 1S72S 1I6XA 2KIFA 1HL6A 3EUHA 3M8EA 4MTDA 2VT3A 3WODF 5BJRA 3JSPA 3R60A 1HA1A 2X1FA 4IOCQ 1BIBA 3HTSB 1LEBA 5DDQC 4GYIA 4G7OF 1FBQA 2ADBA 2PLYA 2PMHA 3T0YA 4AD9A 5HLHA 1YQAA 4UQTA 1I1SA 4HYEA 2H6BA 3SZTA 4O5VA 4KUMA 5E8IA 1S7OA 5FB2A 4I02A 3U1LA 2J5OA 4A6EA 3F23A 3GX4X 4KT5C 2K02A 1VQKS 2DQRA 4M9XA 4I01A 1RUNA 3N4MA 1VQ4S 1W7PB 2JX2A 3MD3A 2E7WA 2OZUA 2CQKA 3MDFA 2O03A 4IHTA 3WGHA 1Y0UA 4BHCA 3E6CC 1E17A 4TU8A 1SFXA 4U88A 3B73A 3CXCR 1U1OA 1IZ1A 2HZCA 3E3VA 4UVAA 4AIKA 3HOTA 1WF2A 2J76E 3F8BA 2Q8KA 4QPTA 2DTRA 2DIUA 3C7JA 2CPXA 3HYIA 3NRVA 1X3UA 1ZZNA 3HHGA 4MTEA 1KQ8A 5H1SV 1Q81T 1G3WA 1JE8A 5L3EA 2V79A 2MBFA 3LQQA 3D5LA 5JR3A 3CJNA 4WFBQ 2DT5A 4ENNA 5FFZA 1CGPA 1R8HA 1BI0A 2FBHA 2E1CA 4Y0FA 1IXSB 2QEXS 3HI9A 3ZN1A 2RDPA 5D5WB 4Z2XA 4EJVA 3ERED 2H09A 1WG1A 4R79A 2D3OR 3CO6C 3V7CA 1QZZA 1SD7A 3HRMA 2UXXA 1O3QA 4F26A 1BC8C 2HZTA 1X4AA 3R6SA 4G6DA 4UV8A 1WRJA 3IL2A 4G9YA 1X5PA 1K79A 1SFUA 2PI0A 1ZGJA 5E8GA 3BO2A 3C1DA 2DHSA 1WWXA 3WU1B 1KQ0A 2ZKZA 4M6YA 1ON2A 3CC2S 1U1NA 2ISZA 2VBZA 4G94A 2ISYA 4MGRA 2NLWA 5DM7Q 1DDNA 2KXHA 3PQKA 4IJAA 4PZJA 3I53A 3V8LA 3TP2A 1XMAA 3BS9A 1M5PC 3RW6A 2BV6A 1S3JA 4F25A 2LA4A 2A68F 2FSWA 2N3LA 5BMZA 2LA6A 1FX7A 3CTAA 1QO0D 3CMAS 3I54A 2K8GA 3ECHA 1XGMA 1XMKA 3ABUA 5LGNA 4RB2C 1ZRFA 3ZN0A 1YW9A 2YKAA 4FHTA 5L3GA 1GXQA 3CLOA 5K5OA 4IUFA 1ZH5A 2CYYA 2HKXA 3COAC 3GW2A 1VQ7S 5LXYA 3I0TA 2DNOA 1WHVA 5GVQA 1JXSA 2DQLA 4M73A 1PUEE 1HXDA 2XKPA 2K27A 2GIVA 2MZQA 2FBKA 2OJ3A 3ECOA 5DDOC 1X5TA 2DW4A 1R23A 1DP7P 3H3UA 1SJQA 2KRBA 4V19X 2EB7A 1BY9A 1WG5A 2ADUA 1HSJA 5ICFA 3F21A 1Q7YT 3WTSC 1OPIA 3UD3P 2ESHA 3Q9SA 2CQBA 4PR6A 3RPQA 1VQ8S 3DLLQ 3DP7A 1XCVA 3PIPQ 4EJTA 1GVJA 2R7FA 4TV7A 2F2EA 4XLNF 1WG4A 2O61A 1J2XA 1YYVA 3K1PA 3ZPLA 4LIRA 4P6QA 1FC3A 2DGQA 1LB2A 4A5NA 1BN5A 5D4SA 2IRFG 1MKMA 2JRTA 4IPAA 1G6NA 1OR7A 2EA4A 4U7DA 3BEGB 3GLXA 4HX8A 2PEXA 3NNAA 4LG0A 2WC2A 2B0LA 1FZPB 5E1WA 5ILSA 3DPLC 3PIOQ 2KRFA 3SFZA 3WGIA 3M1EA 1F9FA 2A61A 4HDUA 2VT2A 3GO5A 1V4RA 2P5VA 5GAHU 1UAWA 3BWGA 1SXLA 3P49B 2EJRA 1FXLA 3MQ0A 2M9KA 4HLYA 1MDMB 3FMQA 1N54B 2CPDA 4CGZA 1R7JA 4P96A 3TOAA 2XNRA 2IA0A 4HQMA 4L5JA 4LJMA 1MDMA 5GAGU 2DI3A 3HOSA 2MLGA 4HA8A 1SFEA 4BNCA 3TOBA 2KI2A 5DD4A 2R7DA 3E6DA 3F6OA 4YG2F 4RB1A 3JW4A 1WHXA 3FF5A 4XSZF 2PMUA 5IT9Z 3QPTA 4RU2A 4ZYDA 1KGSA 5KK1A 3BJOA 1GXPA 3RJPA 2HQRA 4J5OA 2O6GE 1JGSA 2AYBA 2DH9A 5E18F 3JSOA 4H0EA 1SAXA 1XN7A 4W92B 4Q4ZF 5LEJA 3QAHA 3J81Z 2DK2A 1WF0A 5ITHA 3IC7A 3GEZA 2HEOA 1VBZA 2PJPA 2J8AA 5JVGQ 2LNBA 6PAXA 2MKCA 3THTA 1VBYA 3L9FA 3GZ5A 5LHHA 5FD5A 3FM5A 4HF1A 3J7YU 2P6SA 1FY7A 4EGLA 1Z05A 2RT3A 2ZXJA 1N8RT 2P4WA 2RVCA 4LMYA 5D8LB 5H6RA 2DNZA 3K1MA 3KP3A 4HF2A 2MZ1A 4WXHA 1MJ9A 4L0YB 4IF4A 3PQJA 1B4AA 4BYYA 2FPHX 2Z9OA 1RIOH 3VB2A 1EH6A 4GXOA 1YI2S 3VALA 4U0WA 1O0PA 3SMZA 3IKVA 2DO0A 1TLHB 3KE2A 3SDEA 3BY6A 2V94A 4GO1A 5FLXZ 1O3TA 3UCZP 3ZMUA 3M8FA 3S8SA 2D2WA 2HFHA 4R8HA 2HYFA 5GADU 4RGSA 1B1BA 4ZYGA 1U3EM 5LSOA 4S04A 5FLXK 2DB1A 1STZA 2OTJS 2XAJA 1AWCA 1UP1A 2MKKA 4BAYA 2Z3YA 2JPCA 3KP7A 1R1TA 3NEUA 2VN2A 3IWZA 2MLKA 3GFIA 1DPRA 2R3SA 1U2WA 1M1KT 4EJUA 1W7PA 1XSVA 4HX4A 2XS7A 4NQWA 2CQGA 2FQ3A 2GXBA 3MUVP 1U78A 1FP1D 1GHCA 3U1DA 3G8SA 2MQQA 1E2XA 2CO5A 2QA4S 1FO1A 1IN5A 1XGSA 5IM0B 4WXDA 2MMYA 4WIIA 3MD1A 1FOKA 2XS5A 2X1AA 1IRFA 5DEQA 3CCES 4PRFA 3LWFA 3T1BA 1OO0B 3HRUA 3V8KA 1WEYA 3H2VE 5HS7A 3CO7C 3HRSA 1HKSA 2PN6A 3F8NA 1YJWS 1YJ9S 4ETSA 1X4GA 5D77A 4LG0B 3KEOA 3JB9k 1EV7A 2ESNA 4HDVA 3Q9VA 1U1QA 1IN6A 3CCLS 2DISA 3I59A 2DNPA 3KP2A 2DNRA 2QZ8A 4KN7X 2V1UA 5CLSA 3M9AA 5D5UB 2KG0A 1U5TA 1YG2A 2Z5UA 3MZHA 4LJZF 3R4KA 2IJLA 2FE3A 1X4FA 3CCUS 3JTGA 2EFQA 4LLNA 1B9NA 1TQPA 3KLOA 2QENA 2UP1A 1U6FA 1X4CA 2E5HA 4XBFA 3VAKA 2U1AA 1JMTA 3HRTA 3S2WA 3EYIA 2CJKA 4UUVA 3BOQA 1D3YA 2JVRA 2P5KA 2SXLA 1G3TA 2X4HA 4I98B 2QM3A 2XNQA 2J0QD 2XRNA 4U7BA 4OIRF 1PP8F 2LMIA 1U1PA 5DM6Q 4GGGA 4AWXB 4YB1P 4YUDA 2XB2D 2KIUA 1RKJA 2HWVA 3P9IA 2KG1A 2PG4A 1ZARA 2I2YA 5J6XA 5IT9K 2EFOA 1ZZFA 4F7ZA 2QQAA 2M70A 2KYXA 1IQTA 1O3RA 2OTLS 3GUDA 1VQ6S 2NNNA 2MJNA 2P7CB 3HHHA 5AONA 1BJAA 3I5UA 4DQ2A 5DUKA 4DNCA 3ZP5A 1CF7A 4UNOA 3EGNA 1G3YA 2KRRA 5J8FA 4EVIA 4C4WA 1HSTA 3BJAA 2VC0A 2A3JA 4LGWA 3IWNC 2M88A 2XVCA 2GQQA 2FRHA 1BIAA 2DBBA 5DDGA 2FHOB 5LXRA 2DNNA 2BE5F 2KM8B 4OIPF 3R1LA 4OZ0A 2MQMA 3F22A 1VQMS 3W6JB 2K86A 4ZZDA 3Q5FA 3WTUC 2HTSA 1HW1A 4G7ZF 3ZMSA 1O3SA 1SJFA 2RV8A 4TU7A 4XSXF 1HW5A 3MXHP 2DO7A 1BI2A 2HOEA 2ERRA 2XAGA 1B6AA 1ODDA 3JTHA 3VODA 1OKRA 3G8TA 2NNYA 3FWEA 1WTBA 3G4SS 3LA7A 5HDGA 4IRIA 3N97A 2CQCA 2YSRA 3RIRA 1U1LA 3P6YC 4LFUA 2F3JA 1K73T 3QPHA 2AYGA 1H9GA 2V6CA 3IHUA 4TLQA 2KIMA 3PFIA 2IVMA 4Y15A 3V8JA 4QU6A 3GZ6A 5K1YA 1YS6A 1VQ5S 3KCCA 2HTJA 2WWYA 2MZTA 3CCRS 4MEYF 1YITS 5JVTA 3J7AO 4HZFA 3GVAA 1IRGA 1VQNS 1P4AA 2WV0A 1KU9A 2ELHA 2YX4A 4FXWA 4I7HA 1FPQA 1IN4A 3NS5A 3CTRA 1FSEA 4IO9Q 3CUOA 3VAIA 2L01A 3I64A 2QVOA 1FJEB 4EM2A 5L3BA 1TQMA 3F8MA 2KHCA 1FJ7A 1R8PA 4KMUX 4CZZA 4HQEA 1TNTA 4WCGA 3H2UB 1LDKB 1OYWA 2VBXA 1FBSA 1DUXC 1Z91A 4KYWA 2KJBA 2UXNA 2DO4A 4S05A 4UHTA 2KU7A 2DNHA 4OOIA 4UVCA 1DRZA 3L3CA 1DPUA 4KDPA 4ZZLA 3AAFA 2M30A 1O7LA 2BOPA 1WEXA 3M7GA 1I1GA 2QBYA 3DEUA 4M6XA 1S79A 3VAHA 3FZVA 4WX9A 2O0YA 2E44A 3TQNA 4WKRA 3DFGA 3C18A 4EMSA 1BOAA 1FWZA 3TKYA 4D0PA 4QQBA 2F9JA 5F64A 3FX3A 1REPC 3I71A 2RS8A 2X1BA 4WK8F 2DNGA 1VQOS 1VC6A 3G3ZA 3NMRA 1RZ4A 4WCEQ 2LKPA 3WTVC 5DCFA 1U6GA 2M7SA 3CC4S 2HYIB 4AVPA 1R22A 3ZMDA 2DIVA 2L41A 1U5TC 3CC7S 1SD4A 2EVZA 3QU3A 1O7FA 1W7PD 3RKXA 2HKOA 1JJ2R 2F9DA 2UWMA 2M5WA 3EETA 2ZMEB 4CDGA 4HAMA 4L9NA 2GZWA 2DNQA 3B4MA 4FT8A 4HX7A 2P5LC 4OMZA 1WQ2A 2BEOA 5DCMA 4A0YA 2OBPA 3G96A 3TO6A 1FYKA 2LDUA 3L7WA 3C3WA 2CQIA 4RGRA 1S7AA 3FXUA 2XIGA 1D8KA 1ZGAA 1MGTA 3CF5Q 2M8DB 2XASA 2N3OA 2JSCA 2MZJA 1EH7A 2Q2EA 3WTZA 2K3KA 4LB6B 2CQ0A 4YFNF 3E6BA 5HS9A 2LKZA 1YO5C 1VBXA 3S01A 1QZYA 2J5PA 4CH0S 3O2PE 5FFXA 2DNLA 2IA2A 3RW7A 4KIGA 3BPVA 4W90B 3D2WA 2ZBKA 2YWKA 2YH0A 1R1UA 1PP7U 2F5FA 2CWEA 2CPEA 3JAMK 3GF2A 1D8JA 5E1XA 4MQVA 1KQ9A 5HDNA 4A2UA 3S7RA 3KEQA 2UZKA 1U1MA 2KN4A 5DDRC 2RRAA 1XSDA 1IW7F 1Z1DA 2M8EA 1P2FA 3F72A 4C0OC 2K4JA 1BC7C 1OIAA 3P7NA 2MSSA 5CXTA 4FX0A 1KQSR 1G3SA 1NO8A 3H92A 4Q47A 1WHYA 3K1NA 1VC5A 4ZH4F 1QVFR 1YHQS 2G4BA 5CVIA 1KU3A 1WI9A 1XGOA 2AYEA 3BO4A 4HBLA 3U9GA 1YIOA 3TDZC 2KXNB 1YLFA 2XKOA 5ERIA 3ULQB 3L09A 2E5JA 3FMRA 2FU4A 2XAQA 3DKWA 2RGVA 1WKMA 2DLLA 5L3CA 4M72A 2DGUA 4Q48A 4O3MA 1SJRA 1ZYRF 5CYJA 3LSTA 5F6FA 3F3XA 2EFNA 2DGWA 1IAWA 3MWMA 2CQPA
chains in the Genus database with same CATH superfamily
4EJOA 2LECA 1WGXA 2IGNA 3CC4I 4I7FA 1L3UA 2YVSA 3C16B 3CCWA 2P2CB 3ZTSA 2GA7A 1FF2A 3S1RJ 1GXTA 4RW7B 3TRGA 2CNLB 1OFCX 2NXJA 3GJQB 3K8VA 3HXMA 2PBIA 2Y48A 1J0RA 2VUGA 4NNJA 3V5RA 2LXIA 1OCOH 4X0GA 1MSEC 1Y0NA 4BE0A 3DLGB 2HGLA 3BREA 2EKYA 3T5LA 3OR1B 3PR5B 1X4DA 1S9EB 1VNDA 1YS7A 2MY7A 5LRRA 4A8SA 3CMES 2BW7A 1K7AA 5J2PB 3V6DB 1ZM3A 2XMKA 1JKRC 4KIFA 1KFSA 4XICA 2H48B 5K5QA 3AQOA 1FIPA 3RBEA 1YZ7A 2JK3A 2R4FA 4OINF 2DXIA 2PE8A 1NSAA 1RK8A 4ZJOA 2QQ9A 4P72A 2YTCA 2KXFA 1UJ6A 3O6BB 3G82B 1N4LA 3FDYA 3LH2S 3K17A 3V7SA 2FHKA 4G1IA 3VAGA 2B43A 3KLEA 2MKIA 2IA6A 3FCVA 5K5RA 2CQ4A 4JV0A 2YU3A 4M3BA 3TUZC 5AE2A 3Q8PB 5BXIA 4K4WA 4QU7A 4EQQA 1K6YA 1Y0HA 1B0VA 2HHPA 3V7RA 2A5WA 2EK1A 2J9CA 2Z57B 4WWSA 4I76A 1WVRA 5K7ZA 3QRFF 4WF9Q 5DV5A 3HOZJ 1VYAA 1U9NA 4RGUA 4CLSA 1A31A 2GVDB 1P4WA 3PO3J 1F4KA 4ICLA 1VRUA 3ELKA 2XWYA 4O3PA 4J91A 1IDYA 3K4MA 4QZVB 3M2RA 3PW2A 1HWIA 4NCAA 3BDDA 1FNNA 2YH1A 3D0HE 2BXZA 2XYPB 4NXNJ 1NK9A 3HXLA 1W2BR 2DNYA 2ZFWA 2GFFA 3MFHA 4E70A 1RT5A 4XIDA 1X7VA 2QV6A 2XZWA 5HVQC 3MGJA 2DCUB 2D9OA 3TO8A 4DX7A 3TARA 3K0LA 1IN0A 5KFVA 3R8YA 3GFJA 2CJBA 2DEIA 1SCJB 5D0GA 2GGPB 2YKMA 5DDPC 2X1EA 4HW0A 3ABTA 8RUCA 5J3LA 2DR9A 3PRBA 1HYSA 4KO0B 1FX4A 2GVZB 3VF0B 2H8RA 3CCQS 5LMNJ 1KQGB 4YOEA 2XSFA 4OX6A 4B3OB 4ES2A 4QJVA 4XRSG 4J9UE 5K7HA 5B0BA 3RB3A 2H1LA 1T33A 4XRFA 1FBUA 1RAFB 3HHNB 2E1AA 2XSJB 2X85A 1R1VA 1CF7B 2OH2A 2OEMA 4YMEA 5A2QY 4PGHA 1ZBTA 2R8KA 1RTDA 4OJ1A 3O5TB 2IM3A 1LWFA 4BQQA 1N56A 3E5XA 3FBIB 1L3LA 1S6QB 2AQEA 1S1VA 3CJKB 5ETPA 1J5OA 1U1KA 2P6TA 2CQ3A 3HMJG 3DQVC 3ILLA 5L1JA 3ZZZA 1HR0F 1VQ9S 1RT6B 3PZPA 1Q8BA 2RKIB 3PO2J 1YJTA 1UW4A 1DARA 5CZVA 4K0KJ 4M71A 4USVA 2KFNA 4J01A 1YTYA 1G2HA 4B3OA 3MR2A 3PNYA 5FDLA 1ZG1A 4M5DB 3OR2B 5EEGA 4UF4A 4LF5J 3LPYA 4RX6A 2XTJP 4LK1F 3Q24A 4JI0J 5JXSA 3H20A 5FJ4A 1OMIA 2E9ZA 2J0WA 2KKOA 4B4CA 3BJ6A 1WF1A 3PJRA 3VQTA 1C1CA 4NYOA 4R5PA 1WNEA 4K7QA 2G1DA 4WK3A 4LF7F 4O44A 2HQ5A 3CO9A 5LJ3Y 3LUYA 2QKMB 3CJ2A 1YRNA 1UHMA 3IO1A 1EZZB 2E5LJ 2RU3A 1H7XA 2E19A 3DLKA 5IT4A 3G1OA 4KNYA 3ZMVA 3IWFA 1B9MA 3PSFA 1HBNB 1RBAA 3OS1A 5LHGA 3KK3A 3OVAA 1N6QB 5TISC 3HF5A 2XO6A 4PWWA 2XY5A 1D1AA 3T19A 4IHYA 4ATNA 5J40A 1SUQA 1M90T 1VQ5I 2IS6A 2M8HA 2BA9A 2A3SA 1HLVA 1TKZA 4UXNA 3E6MA 2CVEA 3BQZA 2V9WA 2V1XA 1TUWA 3SZ2A 4B8XA 3ADAC 1RHUB 3EQLF 1A35A 3QP5A 2F1FA 3QFWA 3AB4B 4LVOP 2X51A 2BZ2A 2DA7A 2UUCJ 3PYEA 4LF2A 3FXJA 4EBCA 4FP9A 2RB7A 3DRRB 5FLXU 4JX6A 3HT3A 1TK0A 4XORA 3RKWA 4JI6F 3F8CA 2OPSA 4ZVTB 2EI5A 3KZZA 1LW0A 1YW8A 3S6EA 5K14B 2O3FA 3NOCA 2NOJB 5JHUA 1HBXG 1RE1B 2I1RA 3QT8A 5LMNF 2BANA 2MG4A 4A3CJ 3PNIA 1W1WE 1ZRDA 4NXMF 2DA4A 2HU9A 1QJHA 2YQ3A 5GPCA 1CULA 2WHOA 3CDHA 5HDKA 3POTA 3H0DA 1Y5LB 4LB5A 4F0HA 4KHPF 1GUUA 1VRTB 2ZH5A 4Q0BB 1XSXA 3CESA 4DUYF 4DR4F 1JJ4A 1VI0A 5H6QA 1HARA 3OYBA 2OUMA 1EH8A 1PSDA 3O8WA 2DA5A 1Z9CA 5KCMA 1O57A 1QBJA 3AXMA 4FDFA 2CPJA 2BQ3A 4EO6A 4OHYA 5AXMA 2GX8A 3JQJA 4K4XA 2DA2A 1WFXA 1IJFB 3KUEA 4RW9A 2FHMA 5KFBA 4RAZA 2KJCA 1R8BA 5HJYA 2Q0OA 2IJFA 3GV5B 3P3DA 1SQEA 4IX7A 1JNZB 2L9WA 1OYYA 4ZPBA 2DPIA 4RAGA 4R1HA 2VJUA 3PIOF 2EEYA 2QLFB 3PDNA 3MEXA 2MH2A 1VTNC 3AA8A 2VI6A 5B0CA 2F4IA 1T11A 5A2QK 3X1LB 3BSNA 1IXKA 1SB6A 1HHQA 3HVTB 3KHLA 3LAMA 2XMTA 2ZC4A 4BHPA 4RW7A 4HNUA 4ZC3A 3DGPA 2QLZA 3AAWB 4DR7J 3EUKL 3WTYC 4K5SA 1QAJA 1HQEB 5DGBA 4A3MJ 2MQOA 2XV4S 1HDDC 4MFDA 2M87A 1AOYA 4X4NA 2WBRA 4B47A 3H9QA 2F5CA 3JSMB 4JYAF 3FGVA 2FVRA 1QA6A 1FDDA 1U0HB 3H8YA 3LW5C 1J5EF 2RQPA 4KHMA 2W2OP 3OV7A 5TJJA 5LT5A 4BS2A 3OJUA 2G0EA 4HSRA 1FRLA 1SV5A 3E51A 5AJ3J 1S6PA 5D0RA 2HHTA 5I3UA 3MMAB 4ASNA 2LBFA 5E3LA 5D5XB 5A2QZ 4ZTJA 1FYLA 4YR2A 2DTZA 1HPZB 4L9JA 4P2SA 1RTZA 5KG1A 3BR5A 2LFBA 5AIPA 1SH0A 4DR5J 1WH5A 2YQ0A 3DLJA 4M5HA 2FMLA 4ZK7M 3G86A 2U2FA 1Z3XA 3I59B 1ETVA 4XLFA 2DFIA 1UCNA 3O3KA 2V1DA 1QGPA 5F0UA 1U5TB 2R3VA 3B4DA 4UVBA 2FNAA 5BOXA 2CUJA 3AQPA 5HMWA 2A05A 1NSKL 4KIAA 3J7ZT 4ILRA 4DU8A 5HATA 4NLXA 1YKWA 4GCVA 3R61A 1IXRC 2KPMA 2K06A 1UFMA 1V3FA 1VI7A 3J80Y 2CJQA 1YSJA 3S3OA 1UAAA 1ORKA 4OJHA 2DVIA 1CVJA 2ZKUA 3ZZPA 2LXFA 3A12A 2L4MA 5J1NA 1MNDA 4OYZA 4MJKA 2HFOA 1RUOA 2EFGA 2HHSA 3GPAA 2HVHA 1V3SA 1S99A 4PFOA 3ZO7A 2LXUA 1IQZA 3S3MA 1WOSA 5DS9A 3PM9A 1QVGR 1IKYB 2MJUA 3K4JA 2ZWPA 3LPEA 4BQNA 1XBWA 2CSOA 4NI2B 3BSCA 3N0VA 2HR3A 3NNHA 4OX8A 3OHAA 3EVMA 3QQCD 2HGMA 4O4RA 3QBCA 2ZMEA 4LRDA 1YJNS 2P7VB 3WC2A 3DDKA 3ZQ7A 2DU9A 2IM2A 1M1GA 2DMPA 1HQUA 2XMWA 3B78A 1MLAA 1RTHB 3VGTA 3FHZA 1WJFA 3HOWJ 4RWWA 2QSGX 3J7AY 2OLWA 2HS3A 3T8RA 5ICCA 1XCBA 3BROA 2CV2A 2KFYA 1Y5NB 2YNGB 1H3DA 2HHVA 3W2VB 3PW7A 3JTNA 4EBEA 4OZLA 2GOMA 4DSIA 3PUFA 3RB4A 3HTUA 1S48A 1IKYA 2RRBA 2QF7A 3G2BA 3CMEI 3EZOA 4N9IA 4P2FA 2GA1A 5KVRA 2C22A 1G6BA 1U8RA 3CUNA 4PUOA 1U8WA 2V2QA 2X6OA 1X5SA 1ZRCA 1U45A 3KZYA 4PJMA 5HVHA 2YWFA 3K69A 4Y6IA 3RBDA 5CD4A 1RHRB 3GYHX 3SXYA 1LK7A 3MOJB 1RNLA 3CDAA 2HGNA 3HO1A 2ECCA 1V5IB 4CNYA 1ULRA 1VQ9I 5CYMB 5LLQA 3PG9A 1DTQB 4MH8A 2V8PA 2EBEA 1RAGB 3UPFA 1UA1A 5KT2A 3KP5A 4AYBN 3IH2A 1IRXA 4DG1B 1T8IA 2R93J 3PFOA 3H5AA 1MD0A 2XMUA 4MQ9F 4B9MA 2N8GA 2YWHA 4EZ6A 1B72B 2E5LF 2HXOA 4MHGA 4LT6A 1K1SA 3C6TA 5MAOA 2ZJRQ 2COMA 1WELA 4DLEA 2Q79A 3BYRA 1FRJA 2K7KA 3IC1A 2FC8A 2GHPA 2VE8A 4L5EA 2WONA 2KJVA 2AS5F 2RJZA 3FXQA 2Z99A 3ET6B 3TBIA 2HS0A 1WJ5A 2K9LA 1U6BA 3BR3A 2XHWA 3HHDA 1C0WA 1Z2LA 2W2NP 2NS0A 2UV8G 1N52B 2UUWA 3KHGA 4DF4A 4RO0A 1K6OA 1PO6A 3ULHA 4XKBA 1BQMA 2MKHA 3I4NJ 2RDIA 2HNHA 2WB4A 3IG1A 3G6ES 2HHHJ 2R92J 4GYGA 5CHCB 3OD2A 3NMAA 4ENKA 2FIUA 4OZ1A 3DLGA 3BG6A 1YZ6A 5F1RA 4HDHA 2DOEA 2DPDA 1KYZA 3DV8A 2JPBA 4IHWA 2M52A 1W5SA 4WP9A 1REVB 4JUZA 3CJ8A 3CJSA 2JTVA 1TKXA 1SMYF 3FMSA 2I8EA 2HGCA 2AF6A 2DGTA 2BXYA 2A18A 4ZCIA 2CJXB 4FYYB 4DU7A 4NLRA 4XM3A 3HJEA 3PW5A 1RYRA 3QGPA 3ASNH 4ECUA 1VRQC 4WFAQ 1RCXB 2AZ3A 2G9OA 2OPQA 5G0RB 2CPZA 1XB4A 3PM1A 2EC2A 2HS5A 3K2ZA 1F3FA 1KU2A 1UVNA 1TWFJ 1PVEA 4J9KA 3HHLA 5D4RA 1WHUA 1ZM9A 3DYAB 4DUZJ 4J00A 5ETTA 1T94A 1YDLA 3WX8A 3LP1A 4WZQA 4PWDA 2KL4A 3P5TL 2P81A 1JJHA 3KUGA 3FCHA 4OMYA 3MUTP 3DTKA 3FQLA 5KFSA 4M9ZA 4HH1A 2VJVA 2DY9A 1FD8A 3OT9A 5M2PA 1WJDA 1QNTA 2VZ9A 2O67A 4CHUA 2FXAA 3B82A 2HBQB 2BY3A 2B9YA 2KIFA 5B0GA 2VT3A 3E8OA 1X1AA 3DM2B 5BJRA 2V4JB 3O3LA 4UUSB 3FMBA 4IDKA 1VIXA 4TQRA 4ZVGA 2ADBA 2PLYA 3H5NA 3MAQA 4O5VA 4KUMA 2K1RA 3W61A 5FB2A 4I02A 4A6EA 4DHVA 2EINH 5KHDA 3BQ2A 1RUNA 2QYCA 4PXDA 1DTTA 1W7PB 1LFWA 2JX2A 3W2AA 3MDFA 2CUEA 1SFXA 4LRFA 4USHA 4QPOA 3CWJA 3T6BA 1C4CA 4AIKA 1X3WB 2OI2A 1E6YA 3HDSA 2PFFB 4B9VA 3DMJB 1OLTA 2BJ8A 1F60B 2RU9A 2CPXA 3ILOA 4V2FA 4LF1A 4XOTA 1OJ4A 4MTEA 1G3WA 2V79A 2JDJA 3LSPA 2X3DA 3KK2A 2WAQA 4DLGA 2L3MA 3ZZOA 1OMSA 5A8WA 3RQIA 1FMWA 2E36A 4E7IA 4E98A 1BI0A 4C8MA 2CFOA 2B4PA 4JI4F 2QEXS 1IXSB 2V6AA 1FE4A 2DRAA 3HI9A 5KFTA 4NI2A 2RDPA 4EJVA 3BGOP 3M07A 4R79A 2Z2SB 3MN2A 3CO6C 5EHHA 4K4ZA 3QYEA 3OTBA 4N4NB 3V7CA 2GMLA 3CJQA 1O3QA 3EVWA 4X4PA 1X4AA 4UV8A 4K5RA 5M5XJ 3IL2A 2KYZA 1SFUA 4NX9A 4AM3A 1VR6A 2B9XA 2IXSA 2CMPA 3VWBA 5F8IA 1ON2A 3B6BA 4GKJF 4UQGA 4ANDA 1J09A 2ISZA 2VBZA 1XTZA 1SKSA 4ZVPB 4URQU 5DM7Q 1DDNA 4IJAA 1CC8A 2OC6A 3BV8A 3V8LA 3BS9A 3RW6A 2BOAA 1UJ8A 2VPWB 1Q5YA 3ABMH 2BQUA 2IJNA 3CMAS 3ECHA 1XMKA 2NUHA 3ABUA 5LGNA 4RB2C 2M34A 4S0MA 4HEA2 1S10A 2YKAA 4FHTA 2BM0A 2OO4A 3TVKA 2ICWG 1ZS6A 5K5OA 3IH3A 2LY9A 2HKXA 3KG1A 3CJRB 2P9EA 3GW2A 2NVYJ 3K7AJ 2DNOA 1WHVA 4HT5A 5GVQA 2R8GA 3NWSA 3FXKA 2CNKB 3CIZA 3CMYA 4K8RA 3AG1H 2XKPA 4XDDA 2K27A 1KFDA 3CZ6A 2PMWA 2J6TA 2BE2A 5KG2A 4Y2IA 2O7OA 3M4OJ 5B0FA 3UDEA 2QN6B 2R2SA 1R23A 4RNNA 1DP7P 2EKNA 3D6MB 4K2JA 2EIJH 2UXBJ 3UD3P 1Q8IA 3M6XA 4IH5A 4PR6A 3RPQA 4MIAA 1VQ8S 4LG3A 3PIPQ 4B08A 1GVJA 1VS3A 1G3OA 3NWGA 3RTVA 2O61A 4YHHJ 2ELJA 2Y9YA 4FKYA 4ZHRB 1Y8QB 4LIRA 2JFDA 1FC3A 2KLOA 2WONB 4CA0A 1RPWA 1WDDA 2VF3A 5D4SA 2MLYA 2DA3A 1OR7A 4U7DA 1GK8A 4LG0A 1QE1B 4F4KA 3O44A 1UVKA 5DG9A 2Y0SN 2VFTA 3NXZA 1DAXA 2KRFA 1QZEA 4FS2A 3T5JA 3WGIA 1DY3A 4B1RA 1F9FA 2XLJA 4TLRA 1BQMB 2VT2A 4ZVRB 1V4RA 4E4HA 5GAHU 1LEOA 4ED1A 3ENQA 1ETQA 3TZZA 1RT3B 3GFHA 2CPDA 4OHZA 3K5OA 4P96A 2HIYA 5KG7A 4LJMA 4NOHA 3CE8A 1TC3C 4OYOA 2G0JA 4G3IA 2JEIA 3HOSA 1ZELA 3A3PB 5KFUA 5DQIA 4FF4A 2MLGA 4MT1A 1SFEA 3C2GA 3TOBA 3CJKA 2QGFB 2HEKA 4WK1A 1JJ6C 3ONQA 1U0HA 3GB0A 1MBKA 3LSIA 2ASDA 4MIBA 4KT6A 3BN7A 1S6QA 1KN6A 3FF5A 2PMUA 4RU2A 2BUNA 4DCJB 2A10A 2OAUA 2JLFA 2UUBF 2RDDA 1HOMA 1HC8A 2MEWA 3RJPA 3G71I 2HQRA 3NS7B 1TL7A 4CLFA 4J5OA 3J7A1 3G6VA 6FD1A 2FYXA 1GMUA 1GNKA 1W36C 2LTPA 2VV5A 1SL1A 3JSOA 1SAXA 5B0DA 2LRDA 4HHJA 5LEJA 5D4NA 2PMZA 3M6UA 4OIXA 4B9TA 5ITHA 5ETNA 4DGWB 4A47A 2WADA 2E7VA 3I6PA 3IR5B 1W26A 1VBZA 2H3EB 4PXEA 1KNZA 2LNBA 1VBYA 3KLFB 1U2CA 3CD5A 5FROA 1FK9A 2I5JB 3QO9B 4KYZA 3BG3A 2L7FP 2ZH3A 1CSJA 2WSEC 4ECXA 2P6SA 3PR4A 4EGLA 1Z05A 2VPXB 2ZXJA 5F9LA 2P4WA 5D8LB 3K1MA 3KP3A 4HF2A 4B9NA 1MJ9A 1E6VB 2FJBB 2Z9OA 1RIOH 1EH6A 3VALA 3Q22A 4U0WA 3UR0A 2CQQA 2Y1IA 3S93A 2C2RA 2JA7J 4GFBA 3I4HX 4B3TJ 3R7NB 3OUYA 4I56A 3SDEA 4PG6A 2B8PA 3J7ZI 2MD0A 3M8FA 2D2WA 3KNGA 1NK5A 3MD2A 4P7TA 1TL3A 1MSWD 4R8HA 1RR7A 5HQ8A 2MABA 1UPPA 2HYFA 4MFEA 1ROFA 3AG2H 2R7VA 1U3EM 8ATCB 2DB1A 4YB7A 4YB5A 2DOFA 2HFNA 1UP1A 4OZ5A 2MKKA 4QIWD 5FJ8J 4JBCA 3KP7A 2FD2A 2OD4A 3GZNB 2VN2A 2P8IA 1SUQB 1DPRA 1Z0XA 4LRAA 1N34J 1D9FA 2PC6A 4DZPA 3SV3A 4NQWA 3LP2B 2FQ3A 3G8SA 2V5HG 2CO5A 2QA4S 4LF7J 3WC0A 4OX7A 1IN5A 1UFLA 4WIIA 3CD7A 1Y9OA 3MD1A 1FOKA 1J2VA 4C11A 2DDAA 3KLHA 3UVJA 2XPWA 3CCES 3T1BA 1OO0B 1WJAA 3H2VE 5HS7A 4MFBB 2HQFA 3AY0A 1EIYB 4OHWA 3EUHC 5D8HB 2GCFA 4LBPA 3JB9k 2J5AA 3MVPA 1EV7A 1T9TA 5F27A 4CLPA 4IQXA 1KLMB 4WU3A 3Q9VA 4X62J 1TT5B 2DISA 5DZ6A 3R2DJ 2DNPA 2F4OB 5CLSA 3M9AA 5CYQB 2RQMA 2VLAA 1MNMC 4X4TA 1YG2A 2Z5UA 2XC7A 2E2JJ 4JI3F 2MC4A 2YKNA 2FE3A 3KMQA 4UTGA 2PFDA 2VU5A 2GIZA 1UWBA 1Q7LB 1SVDA 1OY9A 3S17J 5E3RA 2KFZA 2XSJC 2A1BA 2QENA 3DOKB 2F6CA 2NOGA 2U1AA 1RWMB 3EPIA 2CJKA 3BOQA 2V26A 2SXLA 3T1YF 4QIGA 5HK4A 3GYXB 3QRRA 2XB0X 1K47A 3JQKA 4BKXA 1GFWB 4CM0A 2NXNA 3I9ZA 2EZLA 4M1KA 4DN9A 2BABA 1S76D 2R0QC 2X9DA 3HG9A 3NWTA 2KIUA 2AQ4A 3LGMA 1ZARA 3K59A 2I2YA 5IT9K 1SH3A 2UUBJ 2M70A 2KT0A 5C25A 2GMJA 3BN4A 2OTLS 2NNNA 1F5AA 2MJNA 1T02A 1Y4ZB 2P7CB 4Y34A 3I5UA 2QLWA 4NUBA 3VSKA 1CF7A 4YN3B 4C9DA 1DURA 1X19A 2C2MB 2KRRA 5J8FA 2ZDPA 2ZBQA 1HSTA 4GRIA 2R7ZJ 1HWJA 2KO1A 2KKHA 2VC0A 3IWNC 4USUA 2GLOA 1BIAA 2HHQA 3TP0A 3MZIA 2H5IB 2YX1A 2R42A 4RNOA 1XC9A 3M9NB 3QSIA 1RTJB 2H9ZA 4F0KA 3GMGA 5DRKA 3NGRA 4H4OB 1NXIA 3QGGA 3D68A 2FZKB 4XSXF 2CZVC 3PRDA 4QW9A 3A03A 5DQGA 2ERRA 1VGYA 3KX2A 1ODDA 4V19K 1HNVA 4PPZA 4XAKA 1T03B 2FGCA 1T9WA 2RILA 3T9NA 5A2QU 2LFVA 3LA7A 1HWLA 5HDGA 4ANJA 4IRIA 3V6DA 3OTDA 3RIRA 3P6YC 3KJVA 2F3JA 4LVNP 5G4DA 5F3ZA 2V6CA 1YIJI 3T1AA 4V2GA 4TLQA 1U8BA 3EICA 4MKAA 2IVMA 3V8JA 1HBMB 5J2QA 2LP0A 3KK1A 3ENAA 1AZSB 1TAUA 1S4EA 3JS9A 2HTJA 3M8PB 4MEYF 1H8AC 5JVTA 1PUFB 3J7AO 4HZFA 4QYRA 1BJZA 1P4AA 2XYHB 3S1MJ 2WV0A 2JH3A 3QWLA 4XK8C 2OPQB 2YX4A 4FXWA 3RUBL 1GXLA 3BPSP 1FPQA 1IN4A 1S7EA 1Z67A 3BTCA 1N32J 3K4CA 1VQ7I 3VAIA 1NJWA 1BC6A 4EM2A 5IC4B 4OV6A 3L2VA 1FJ7A 3RCOA 1R8PA 4XN0A 4DR3F 2VG6A 1TNTA 3H2UB 3KK3B 1OYWA 4KYWA 3MAHA 4UOFA 4YFUA 3QRQA 4FQGA 2KU7A 1LFPA 2ZH8A 1JXVA 1DPUA 3VZIA 2QQ8A 3A01A 1O7LA 1MBFA 3OYFA 1YRNB 4NLGA 1WEXA 1I1GA 3DEUA 3HPGA 3QT5A 2Z30B 2O0YA 2RF2B 2N4DA 3TQNA 1TWAJ 5HLFB 2XLKA 2WSFC 1FWZA 4U96A 1VF9A 1REPC 1IO2A 1MN7A 2RS8A 5C42B 4WK8F 4JI1F 4BBSJ 4JI2J 5KFDA 2ZFUA 1WORA 3BF4A 1VC6A 4D5FA 5EWFA 2ZZTA 2IMOA 1R22A 3ZMDA 2L41A 3D6TB 4EO8A 1SD4A 3CO0P 2CVIA 2UWMA 2M5WA 3EETA 3FQKA 2OFHX 4HAMA 1Q16B 2DNQA 4HX7A 1W36D 2AGQA 1RT1A 2CUFA 3G96A 4J9MA 2LDUA 4HLBA 5D0HA 3C3WA 4HPQA 1ZR4A 3DLBA 4I6ZA 5C5JA 1XNQJ 2NVXJ 2HNZB 2XIGA 3SDBA 2B5JB 1D8KA 5E7OB 1MGTA 3CF5Q 2O8KA 2XASA 2VDIA 2JSCA 1EH7A 1VJWA 1CJTA 1HNVB 2HDWA 1YQHA 2C3YA 4ZLPA 2K3KA 2CQ0A 2XSJA 3H42A 4DQRA 2LKZA 2ZH1A 1YO5C 3OPKA 2BY2A 1BR2A 3RBZA 3O2PE 2IGKA 4JI5J 1RBOB 1GDTA 2NS1B 3NCRA 4QWBA 1T7PA 3AOAA 3C15A 1ZPWX 3D2WA 4LFCF 2ATLA 1OQ6A 4MLOA 3H35A 1HLWA 2CWEA 1D8JA 1ITYA 3ZTOA 4DV7J 1T0TV 3MEGB 4NLYA 3S7RA 1Y6IA 2RRAA 1FESA 1V6HA 5K8MA 4ZPCA 1FTCA 1BC7C 1N5VA 1TP4A 4IH7A 3P7NA 3ILIA 4RBUA 4WU2A 2MSSA 5EZHA 4LF4F 1X60A 3H92A 3IRXB 3HOVJ 1VC5A 2OV7A 1KU3A 1WI9A 1XR5A 3MECA 5F8HA 5C2GA 3L09A 4LF8F 3DKWA 4FTHA 2XHCA 5L3CA 2DLLA 1RP5A 1RWPB 5BR8F 4Q48A 2PSZA 1K4SA 4O3MA 1S77D 1ZYRF 1R71A 1JLAB 2FX0A 3MMYB 2F8MA 1RB0A 1B64A 4AT1B 2BJDA 1JLBB 1NPKA 2CQPA 4OZNA 3QGIA 3NBPA 4BGDA 4ZCMA 1C1CB 1NPPA 4CP5A 1ZTRA 2F5EA 4KGXB 3KJFB 1M5OC 4PEOA 1ACIA 1JKHA 5AXKA 3U1NA 2QSFX 1UTAA 4II3A 3HULA 4DX6A 5LJ5Y 1B99A 1LDJA 3H3ZA 4A3LJ 3MEEB 3L1PA 3DLEA 3OSFA 2FEZA 2NPFA 1PJ5A 4DL5A 3EYZA 1YBAA 3F6VA 4WFYA 4GC6A 1X1BA 2CRGA 3Q8VA 1ITPA 5IFMA 3I96A 2G2YA 3I55I 2YWEA 4CH7A 2FQ4A 2MY8A 4OYXA 4CTAB 2BBYA 2EC0A 5AIQA 3OXFA 1JI8A 2K7LA 4IDKB 2DD8S 3UDLA 1PCAA 2VJJA 3ZZYA 2O1PA 2L0KA 1USSA 1FTRA 2W4SA 3HOUJ 1S9EA 1U0JA 3MM8B 3VGSA 3KUHA 5F8JA 3G4SI 4L9TA 3ZZ0A 3V4GA 1SJ1A 4ON0A 2FUG2 4A8XA 3CCLI 1GX5A 2W7AA 4HACB 3FEYB 3VTIA 4B17A 3EPZA 1ZLJA 3ZMTA 3JR9A 4ZDNA 1E3PA 1U2FA 2B3TB 2QC3A 3DPTA 4LIWA 4I0AA 4KH0B 1F0XA 4EATA 4MK9A 3TUIC 1T9UA 3EZUA 1RADB 4AXJA 3PEHA 5U47A 5E3MA 2ZM6F 2R2UA 2H8WA 3DDIA 2O9LA 5KFYA 2VQEF 4NC8A 2AJ2A 5FIIA 3BQ0A 5IT3A 1HQUB 3UR3C 2AXLA 3KJNB 5THWA 4Y00A 3BZCA 1S9GB 5IS2A 5IT0A 2B6AA 4IXAA 2IAJB 1WZ2A 4DV6F 3IV5A 1AU7A 2R2TA 5FD6A 4KISA 4JI3J 4BDPA 4RMNA 1C0UB 2DRDA 4FF3A 2W82A 2Y30A 4Z7YA 4CCOA 3W5XA 2VD3A 2OHDA 4KFBB 1AKHA 2TRTA 5K8OA 3H90A 3F0NA 4LLLA 4XIUA 3CW2C 1VRUB 3JTOA 5JFRA 1RACB 4MKYA 3G6YA 1O4XA 2PGCA 3A8IA 4L76A 4KB7A 1CS4B 3SQGA 4HKQA 3KFWX 1RDRA 2XWXA 3R27A 4DV3J 3R0JA 5H20A 4B3MF 2LREA 4RJVA 1U25A 3RZAA 2XCPA 2YKOA 4TYBA 2MZSA 3LAJA 4DV1J 2HW3A 3C2PA 4ZYEA 4NHJA 4NA1A 3CPWR 3HFVA 5HROA 1HDPA 1RESA 3PHEA 4O23A 2QUFA 1S1TB 4ZTFA 3LSJA 5GAHI 3UN2A 3M4XA 1S9HA 4UT4A 3QLHA 3SYTA 2VOOA 2RHQB 3NWRA 3TEGA 2M4KA 2XB5A 4DQSA 3V4MA 3FVYA 1YRXA 4ECSA 1PBAA 5CVUA 3CCJS 3OTCA 2HG4A 1ETKA 1DP3A 4BXFA 3KLEB 5KFPA 2STTA 2QKLB 3P9KA 3VPRA 5KNLA 2CPHA 2FNPA 1UFWA 1ENHA 4B3TF 1RRJA 1SJ4P 2AMCB 5DJBA 3A3NB 1O6XA 1T0FA 2K3PA 3RKYA 2X1CA 1AYEA 3CT9A 3G6EI 4OHVA 1P27B 5KFHA 3K2YA 4BCAA 1RETA 3C66A 1RTDB 4Y33A 1FRKA 2W84A 5A8RA 2M1BA 3IBCB 4K4SA 4BHBA 4EV0A 4IRHA 2DK5A 1SPBP 1AFJA 2E5GA 3OW2R 5HI7A 3W2WA 1VQMI 3EDRB 5L38A 3G8QA 1MBHA 1HNIB 2IAIA 1N34F 3Q23A 4PWDB 2OU2A 1LV5A 1MZBA 1J75A 5IT9U 1T39A 1IVZA 1BGXT 4ZHRA 5KFKA 3QIPB 2KM8C 3FDSA 3IBWA 1QU3A 3LA3A 3ELHA 1TTHB 4CCMA 4U7CA 2J9DE 1X4HA 3E5QA 1TFWA 2HFUA 2OSRA 3EE3A 3FBCA 1BQXA 2IRUA 3VCDA 1SMTA 3M8JA 4L9VA 3HHLB 4L3KA 2UUTA 1QM9A 1XMQF 2MA3A 2E5NA 3BM7A 4CYUB 4DX5A 2DGVA 2W8LA 1QTNB 4IQJA 4P9FA 2GW8A 3GLLA 2ASJA 3AG4H 2V9VA 4X4UA 2ZEJA 3O6QA 4ED4A 2D3O1 3SQNA 4B3SJ 4ZVOB 3NGTA 2W57A 2GJFA 3IR7B 3MWBA 4ESFA 3Q8RB 2KZGA 2M4GA 4I64A 4WYLA 2E35A 5F0CA 3IAM9 1FYMA 4FYWB 4A46A 1R4MB 2L9RA 2Y3YA 2YNGA 4EGYA 5TRDA 5KT5A 4M74A 3TW6A 3OSGA 1Q4RA 2MQNA 2RRNA 4HSTA 2D1HA 2BRLA 2LEBA 4FKXA 2ELKA 4ZVUB 2RREA 3K9TA 2MPUA 1ZREA 2HVQA 1EX8A 1A7GE 1RC9A 2JEGA 3MKLA 5HN0A 2HZVA 1WOOA 5KT7A 2XS2A 3TW7A 5HROB 2ZBPA 1SFKA 1TMMA 5F9NA 5RUBA 1JJ8C 2POKA 1OQ3A 2WCXA 3VFZA 3RPUD 1URRA 4AL6A 4PFPA 4OI2A 3NAIA 2HWHA 2EWHA 1WI3A 1HYSB 4DUTA 2UXDJ 2FA5A 1KEKA 1NSPA 4PKDB 2XPUA 4RS8A 1ZA1B 3NL0A 3GIJA 1SI9A 4HVZA 2CPIA 4CQ1A 2Z2LA 2E1RA 3TUPA 1PDNC 4Y2CA 1W2IA 1T95A 3JCUC 1NNDA 3J7YJ 2EFWA 5E3PA 1WI6A 2JUGA 1T08B 4DPTA 4WWCA 1YBTA 1U49A 3ZOBA 2EIMH 3DLEB 2PEBA 3SCIE 1P8GA 2HDCA 2RQCA 2JSPA 3DRSB 4AQYJ 1A0OB 3RAQA 3EPGA 2PT0A 5EG0A 2BRKA 4B3SF 2HRUA 5HO4A 5L1KA 1NK7A 1RTJA 2DGOA 4OYPA 1RA7A 5J4YA 2BJ3A 4O44B 1M5SA 4A3BJ 3M3YJ 5ICGA 1YVFA 4KTQA 4ED2A 3KEYA 1XMQJ 1IWAA 1A9NB 1T98A 2N82B 3KLNA 4KPCA 1EAYC 3I55S 3NBPB 5GADJ 1NH7A 1XJWB 2KT5A 2OP5A 2HBYB 4D3GA 2OQGA 2ZMEC 1HCRA 1TV6B 2C1EB 1CJKA 2IPOB 4C8OA 3MAAA 3FBFA 4W4MA 4U67Q 1F43A 3HBLA 2B9WA 2JC1A 2IBKA 3OR2C 1Z77A 3BGUA 1P9YA 2BE7D 3MM5A 1Y8RB 3QQAA 2QL5B 4CCNA 2VXZA 1NU4A 3TO9A 2D45A 3FMWA 3MZYA 1OSDA 2MC3A 5FDLB 3UCUP 2VBWA 4IL6C 4J19A 5I4MA 1YX5A 5HOOA 2WVDA 3MZ8A 3DU6A 3NGDA 3PJWA 2RUGA 4NLQA 1R5GA 4PXCA 2GVZA 4IQ4A 2GO9A 1S0VA 3VEPA 5GADI 3CCSI 3OVBA 4I0BA 1YJWI 4DSJA 1JLEB 4K2EA 3I31A 1HD1A 2LQ5A 2LK2A 3VAFA 1XC5A 4N0BA 5ETVA 4Q5SF 3E5UA 2BHYA 4IHXA 3RI4A 4NXMJ 5LHIA 4KGZB 4TQSA 3DF8A 1T8EA 4CXFA 1HKTA 4V1Ak 1RI7A 2QCOA 1Z6TA 5EF6A 2JQ7A 2CPFA 3BSOA 2B0GA 2Y8YA 4ZVSB 2OSQA 3U27A 2DPJA 2VL1A 1SC7A 2YXLA 2LVSA 1JHHA 1VQLI 4U0VA 4B3RF 3OIQA 2KP6A 2XGXA 4U87A 3BSAA 4P55A 2JVOA 5KFCA 1V5EA 1MWQA 4YIIA 1YJNI 4AXIA 4KH1B 1S1VB 1T3NA 4BH9A 2Z2YB 5B1AH 4MYTA 4PUSA 3LA0A 1BXNA 2VUMJ 5CVVA 3HHEA 3Q0VA 1VK3A 2VQEJ 4UUXA 1EETA 1RT7A 2C6YA 2XMVA 2Y75A 5HL7Q 3OYIA 2Z8QA 3T6JA 5CVJA 2DXDA 4UZBA 3K4BA 2HFVA 2YNIA 3IUOA 4XONA 4LMZA 2HHWA 1A6QA 4WTOB 2OEKA 3U1MA 2WBMA 3RYPA 4HH0A 5H9EJ 2HBZB 3OLBA 2QE5A 2FF4A 4XDCA 3F73A 3F44A 4CI0B 3M30B 4ENJA 4UW2A 4A8YA 3D0SA 4W98A 4E7KA 5FLVA 1R43A 2BHZA 1ZTWA 2CQ1A 2R5ZB 5C7PA 1KSPA 1XN9A 4C6AA 5FKOA 1RBLA 3JRBA 1IBLF 1K83J 4BBYA 3MPDA 2Y2ZA 4TY8B 4MTPA 4MMOA 2XSDC 4JI0F 2YWWA 4DV3F 2AT1B 2LYCA 2KB2A 2QGUA 1R6YA 1YLXA 5IOLA 4KJZA 4UV9A 1ZKGA 3DOLA 3HDDA 2ZH7A 5IP7J 3GQCA 1W4MA 1CJUA 2K85A 2VKHA 3DBLB 4KSEB 2LF8A 3LQRA 5H9FJ 1VQPS 4P5OA 1HNWJ 3OS0A 2K3IA 2TDXA 3MM9A 3I56S 3QFHA 5GMDA 4NLSA 3BJYA 2ADCA 4DV4F 1QPMA 4ZJQA 4DDFA 2QYOA 2L02A 5BYSA 2A69F 2CWKA 2XY7A 1I27A 1OPZA 3FBNB 1L3KA 1YW7A 3VWSA 2NYXA 4EBDA 4B9LA 1ETYA 1XEZA 3CP8A 4LIUA 2K7JA 1WHWA 3D1HA 2EK5A 2V50A 3C16A 1J5OB 2V4RA 2BKPA 1F9NA 4DQIA 1UG0A 4K59A 2VPZB 3G82A 3MMCB 2NSBA 2HVDA 2LQJA 4NQWB 4IOBA 3JAMY 3FXRA 3OYGA 4J9QA 3CQZJ 3BO3A 3E97A 3MCZA 4QWQA 5E3OA 5DGAA 3SZGA 4P9UA 2DXEA 4WP8A 1FIAA 2VOPA 2P9CA 4TY9A 1HI0P 2YR2A 4DV5F 3Q83A 2ZWOA 3FM3A 4KA4A 3VZHA 1T56A 3ZQLA 4F50A 3BP8A 2O66A 1MBJA 2FHJA 1R6VA 1IN7A 4OYWA 4LFAF 3MKWB 1C4AA 2LYVA 1WOPA 2BGCA 2QLXA 2QWWA 4WE1B 4W1UA 3MPWA 1LKZA 2MKJA 3DYAA 4D7NA 1P1TA 2BY1A 4RLFA 2XG8A 3TYTA 2V9PA 3D6FB 2OAZA 3CJ5A 2C2KB 4RR5A 2KFDA 4XPCA 4CRJA 3PO4A 1IRZA 3L00A 4Y7NJ 5CA5A 2RHSB 2BQRA 4XKCA 3KP4A 3DU5A 5E3CA 1TQIA 3I5CA 1CLFA 1IKWA 5F8MA 2V68A 3AOBA 2PJRA 5HLGA 4AIDA 4FPIA 1LWXA 1O5JA 3MI7X 1N6QA 3V6HA 2RQ4A 1REGX 4ZKAA 4I2OA 1TL1B 1JKOC 4O4GA 2IPQX 2C3PA 4UY8I 2MYSA 1IXCA 4HEA9 4C2MA 1KDNA 4X66J 3W63A 1LNWA 1X4EA 2JRMA 1WC4A 3UNGC 3MFIA 3RDIA 4EWTA 5DD8A 3GTMJ 4L74A 1ULYA 1V5GA 5C4JJ 1S1WB 4BL0B 4DIQA 2QL7B 4DL7A 3ZXWA 3M8SA 1BM9A 1XMBA 1Y3KA 3BDPA 1E6YB 2E5IA 1N5QA 1N5SA 3OYNA 3DC2A 1U4BA 3ZZRA 3X3UA 1I6XA 4MTDA 2L7ZA 4P2XA 4WBFA 3JSPA 3D28A 1JTYA 1DFDA 2X1FA 1EB0A 1LEBA 2QEXI 3N5BA 3M9MB 4GYIA 4G7OF 1IBCB 2OTLI 2UV1A 3T0YA 1ZK8A 2YS9A 1KLNA 1S7OA 2I10A 5EZGA 4II2A 4RKUC 3T3FA 4KT5C 2K02A 1WJ9A 2DQRA 2BOLA 4C3LA 3QAUA 1VQ4S 4E7LA 3MPVA 3CGIA 3GILA 1D9DA 3MD3A 3WHIA 3WGHA 1Y0UA 3B54A 4U88A 1TL4A 4F67A 4QPXA 4ANCA 4DSKA 2UXCJ 3MOZA 3E3VA 5J1RA 1QTMA 2HK2A 4HHUA 3VYTB 1TV6A 2K1RB 2PI5A 2Q8KA 2B8QA 2AJQA 1RHMB 1XS9A 3C7JA 3LSMA 4CYCA 4RLEA 3W66A 1X3UA 3OXLA 4GO7X 1ZZNA 1IJWC 3HHGA 1Q81T 3HOYJ 3JRCA 3HVTA 3TAPA 1RJJA 4JX5A 4OYMA 2MBFA 1HNXF 1X9SA 3H40A 3K57A 5JR3A 2LR8A 5H2FC 1SBRA 3SYZA 1T9XA 4WFBQ 4ENNA 2HPIA 1CGPA 4AE5A 1GVDA 3M8PA 3H5UA 3SDGA 3CCYA 4FXDA 1JKPC 4LSLB 4BJ6C 4LQ3A 3ZQIA 1U09A 5C24A 3HC7A 2NXUA 3H25A 1WG1A 2YQ1A 1HWUA 2D3OR 2QA4I 3KJVB 1QZZA 2XULA 4F26A 3GTGJ 1B8IB 5F8LA 2ID3A 1JB0C 2W9BB 3QPLA 4EMDA 2AO9A 1ZGJA 3N05A 3BO2A 4CLWA 1IBMJ 1WWXA 1N36J 3CJRA 2C28A 1IJEB 4M6YA 2Z56B 5E3QA 4JV2A 3CC2S 3OTOJ 1U1NA 4CO3A 1TL5A 2UZAA 5L9NA 4AUXA 4MGRA 4GRSA 3R2CJ 1UMJA 5FKMA 3TP2A 4ZDOA 1PJ7A 3AJ1A 2LA4A 1KWMA 2A68F 2FSWA 4XOPA 5K9FA 5J1EB 2N3LA 3C3LA 2LA6A 4RZRA 4DJBA 4I2QB 3BC8A 3I54A 4HACA 1XGMA 1ZRFA 3ZN0A 2OCEA 1FKPA 5L3GA 3SEQA 3SFUA 1HW8A 4M95A 1ZH5A 1AZSA 3BKUA 3Q86A 1SAUA 1Z21A 3JSRA 2XRLA 4M6VA 4CNZA 4Z37A 3X2QH 3CCTA 2DQLA 4M73A 1PUEE 3QO9A 4C8ZA 4S0HB 2MZQA 2HIQA 3BR0A 4F7VA 4XRMA 3FRZA 5C4XJ 2UUCF 4R0EA 4CCHA 1X5TA 3K5PA 4DMZA 1YX2A 3PJ9A 2QO3A 5E0OA 2CU7A 2WVCA 2X3GA 2EB7A 1BY9A 5ICFA 3F21A 1Q7YT 4O3NA 3WTSC 1JUMA 1W5CC 2CQ7A 2E66A 2FVPA 1R89A 3DLLQ 2FJ1A 4ITVA 4IFYA 1XCVA 4EJTA 1H74A 2R7FA 4XLNF 3CC2I 1YYVA 3ZPLA 1UL3A 4EU0A 2ZKTA 4A5NA 3LL7A 2IRFG 4ILMA 2HLUA 1R6RA 4CYCB 5IQ6A 1S5ZA 5JLWA 2WC2A 4XLCA 5EWGA 2FD5A 1FZPB 5E1WA 3AJDA 3NEKA 1IWGA 1RZMA 3M1EA 2ZJPF 4HDUA 3FEZA 3FXMA 3MCNA 2P5VA 2ZHOA 1YRTA 4RW6A 1FXLA 5A8KA 4HLYA 3OQ2A 1R7JA 4N7TA 2LDIA 3A02A 2AP6A 1RT6A 2IA0A 4HQMA 1MDMA 4WXWA 3AJ2A 2D3ZA 3KIOA 3OFGA 2GV1A 4F55A 4HA8A 1JX4A 3T1YJ 4F2SA 2HOTA 4FETA 5DD4A 3I56I 1LUJB 1MBEA 2TCTA 5LM7E 1D1CA 5SZTA 2R7WA 2QFIA 3ZXSA 5IT9Z 2QMUB 2F4VJ 5CH7B 2DYRH 4ZYDA 5HP1A 2QL9B 3L7PA 2DT6A 3DM2A 3NCQA 3KLGB 1VQKI 2AYBA 3N28A 3OY9A 3OR1A 4ZLJA 3I0SA 2DH9A 5E18F 3D66A 1OSCA 2FVSA 4C98A 4P71A 1S49A 2W4CA 2DK2A 3IC7A 2AV5A 5J47A 3GEZA 2ZVSA 2HEOA 1KS2A 5JVGQ 2J8AA 2NVUB 3PXGa 2JA2A 2MKCA 1BQNB 1RLDA 1NLKL 1ERDA 3TAMB 4O3QA 3LP1B 1I6HJ 1FY7A 4ED8A 3UNYA 4OAZA 2LQ9A 1N8RT 1JLBA 2LY1A 3L2RA 2WAQN 4WXHA 4O4GB 4IF4A 1FKAF 1JQGA 4BYYA 3DTIA 2VKVA 3F0CA 4G1QB 4RW8A 1ETXA 2BVLA 3SMZA 4U7UD 3IKVA 1KQKA 4LSNA 3OIPA 2K9QA 3POTB 1LE8A 3K2AA 2NUUG 1RUSA 2V94A 4GO1A 2VG5A 3UCZP 3ZMUA 3S8SA 3J81Y 4A3JJ 4FNHA 4RBOA 5GADU 1GAOA 1B1BA 4ZYGA 1X2MA 2ZFHA 1REVA 4OAYA 3MMBB 3DCAA 3IBFB 5LSOA 4S04A 5FLXK 3RAMA 5L9XA 4DQQA 1RR8C 1L3SA 4L6V3 3G1LA 3SV4A 3VDXA 3A01B 3NEUA 4DS4A 1N78A 5HNHA 2RIJA 4Y2KA 4EJUA 2GAGC 3WIVA 1W7PA 2WV1A 1U0SA 2VPYB 3ETOA 4F04B 2CQGA 3P96A 1FP1D 2ZBCA 3DPUA 1GHCA 3QSYB 1FO1A 5F41A 2QMWA 4WXDA 4YEAA 2CAJA 4RL1A 5I3UB 1ZETA 3M32A 5HMZA 4FBUA 3ABKH 4PRFA 3HRUA 1P9QC 2FGOA 5F8GA 1FFWB 2VKRA 3HD2A 4ED3A 3GJSB 3DKDA 1YJ9I 3F8NA 1X4GA 4Q2LA 3LP0B 4LG0B 2F4MB 2HRTA 3CCEI 1U1QA 4U8YA 5C24B 1IN6A 4FYDA 3PKYA 5JLXA 3KYLA 1S1XA 3C6TB 4BC9A 1X9MA 2KG0A 3R5AA 1MH4A 3MZHA 4K4YA 3TX8A 1N33J 1X4FA 3CMQA 1KLMA 3JTGA 2V8GA 4FF1A 4LLNA 1B9NA 2E2IJ 3KXDA 4XBFA 3DDNA 4HL9A 4M3DA 3BKFA 4RW9B 3S2WA 3KYCB 1D3YA 2P5KA 1IBMF 1PKUA 5F0HA 2HVSA 2X4HA 2QM3A 4TY8A 4LR9A 2J0QD 1AHDP 4U7BA 2CADA 3LGHA 4NL5A 4I2PB 2Y0SA 4B3XA 2M5YA 2HBRB 4YUDA 3SCKE 4DV0F 3LO3A 4UUTA 2IC3B 1RKJA 2DT9A 4XL9A 5J6XA 1ZZFA 4F7ZA 3BR8A 2LDYA 2KYXA 1IQTA 1SL2A 1O3RA 1WUUA 2VDHA 2Z4PA 1R7IA 1BJAA 3DRPB 3MEDA 4UNOA 2XY6A 1G3YA 4LGWA 3MKZA 1PUFA 2DBBA 4CO5A 2IDEA 1XNQF 5LXRA 1FD2A 2DNNA 3P4UB 5J2QB 3UD5A 4OZ0A 4G65A 3F22A 1VQMS 1F6TA 3D67A 2K86A 2QSFA 3Q5FA 2HTSA 2C3OA 3OTOF 3M2VB 2AJ1A 5CQEA 4F4WA 2RV8A 3C46A 3S2HJ 2VKEA 4TU7A 4FE4A 1NK2P 1HW5A 3MXHP 2FJXA 3CJ4A 4O3SA 1PBUA 3GTPJ 2HOEA 1NK4A 4NC7A 1RA6A 4DF8A 1RT2A 4CLUA 1WD6A 5GMEA 1YOVB 3FZBA 3G4SS 2VJIA 1HNZF 1S72I 3W2WB 1PAEX 1MROA 5J1PA 1TKTB 1U1LA 1R0CB 2DYSH 1H9GA 1MH3A 2ZE2B 3L95X 5ETKA 3LOCA 2UXBF 5K1YA 2WWYA 3CCRS 3QATA 4IHVA 2W4PA 3GVAA 2IAJA 1FE0A 1RLCL 5C3EJ 4D7MA 4BLGA 2Z1DA 1FRXA 1KRPA 2ZH9A 2AHQA 3GU0A 1U9OA 3H0PA 1ETWA 2RMLA 1U48A 3H36A 1SV5B 1NJZA 2L7MP 5HLFA 5ETRA 1WC3A 2VH7A 3F8MA 1BA5A 1U6ZA 2HI3A 5F0WA 4E7SA 2VBXA 1FBSA 2RE1A 1Z91A 5D0EA 2KJBA 2UXNA 3WHCA 1OY6A 4UHTA 3AFGA 1JJCB 2DNHA 4OOIA 1N32F 1DRZA 3WU2C 1JLCA 4ZZLA 1APLC 1UKUA 4DR5F 3AAFA 5IV4A 3NP5A 4ECRA 2VXDA 3M7GA 1Z3YA 1VQNI 5A8KB 2AIRB 1K1QA 3A3OB 3BBFA 2O5RA 3DI6A 3KHHA 3HKWA 2XZDB 3C18A 3UDCA 1BOAA 4Q5VA 3A2KA 3IGNA 2CQNA 4QQBA 2HMIB 2IS4A 1XERA 1XG1A 2LU1A 5HNFA 4LBIA 4BQOA 4R5PB 2HHXA 3SJMA 2LKPA 5DCFA 4NYZA 2VJ4A 2IMWP 1YBUA 2HYIB 3BLYA 3DXSX 3SEOA 4AVPA 4AL7A 1IC8A 2DIVA 4ECYA 1U5TC 4QTRA 1JKQC 1JGGA 1W7PD 3OFHA 3ZGKA 2F9DA 5IYDJ 3NG8A 3CCZA 2GZWA 3OL4A 4ZN1A 4JI8J 3EGWB 4FT8A 1R31A 3LSRA 2V2ZA 2NREA 1WQ2A 2BEOA 5GAEI 4I99C 5CZXA 3TO6A 2VA2A 1RQ0A 2CQIA 5EGOB 4IFVA 3GR0A 5HMYA 4AU7A 1ZGAA 4O0NA 3KPHA 3T41A 2MZJA 2XZTB 3RZDJ 5B08A 4LB6B 1IGNA 3BT9A 3E6BA 2XI3A 1GXUA 3S01A 3FK7A 3IRXA 2J5PA 1BQNA 4DV5J 5FFXA 1YI2I 4U6PA 1N0UA 4LQ9A 2FJVA 4OJ3A 4CT8A 4RBVA 1UPMB 1JIHA 1H72C 4X64J 4DWIA 1F3VA 1PP7U 4XTTA 1TVRA 1Z4UA 2VB6A 4IG0A 2CPEA 4EUVA 5E1XA 4MQVA 4DN0A 1TQLA 5HDNA 5GAEJ 1O8BA 4WPAA 3U02A 2NS7A 2V34A 4N77A 2UZKA 1U1MA 3GBGA 3LSGA 2KN4A 2MDAA 1IW7F 5L1LA 4JOUA 2M8EA 4X64F 1Q53A 2K4JA 1OIAA 2ZC3A 3HP6A 4FX0A 4FE7A 1WHYA 2DR5A 1I94F 1B8IA 4OZJA 4LREA 4N56A 1QVFR 1YHQS 4HBLA 1YIOA 3TDZC 4C3KA 4DR6F 3GONA 1YLFA 5ERIA 4UOCA 2E5JA 2FU4A 5GAGI 4QIEA 1F2HA 2DGUA 4X4VA 2IBOA 1FTTA 5CYJA 1IG7A 4A8OA 2ILYA 1B72A 4CO1A 3TA1A 2XGPA 5F6FA 2EFNA 1I94J 5GAGJ 1IAWA 3I3LA 2JEFA 1HBOB 1NKBA 4X1EA 2DK8A 1M5KC 1DZ5A 2EV5A 5BPIA 2L3DA 1C0TA 2YKNB 3NRBA 2CV0A 3G2XA 4DPWA 4JI8F 2E2HJ 4NCGB 5HANA 4ED5A 2MH9A 2HNYA 3TWZA 2DXFA 1TT0A 1XR6A 2IDLA 4BXXJ 1S1XB 3HSEA 2PQ8A 2ZITA 1J9IA 4M8LA 2YPRA 2CW8A 1MJBA 4ED7A 1PILA 1G59A 3W5YA 5F0FA 1GTHA 4L73A 3RGIA 2ZO4A 4G6TB 4UZCA 4P9SA 2DH8A 4ZP9A 3HZEA 1WKKA 3J81U 2VQGA 1XGNA 1GT8A 2HRYA 3VVUA 1DGRM 5C42A 3BZQA 5LFAA 3GFZA 4CIOA 4I4BA 1NG7A 3P8BB 1ZAVA 2IBDA 1M1HA 4JV1A 2F5GA 2NYIA 3QODA 3W3SA 4QIWN 1JXLA 1Y00A 3OYCA 4DR1J 3AL0B 2BR0A 3BDEA 3AB2B 3JSMA 5AXNA 2AHOB 4DV7F 5IM0A 5ADZA 3BGRB 2HKEA 4RW4A 4ESBA 4J9VA 2JWTA 4UUSA 2DGSA 1T2KA 1NJIT 4HLXA 4BS9A 2E1PA 1PYTA 3GCXP 2C2OB 4ANEA 2WA0A 5CKTA 2D41A 1BL0A 1T38A 3K58A 3N9UC 1M0SA 2Y8WA 2CIMA 2H4WB 1JT6A 5HBMA 4YY3J 3DKXA 1D5YA 3J81j 5ICEA 1NK0A 2JFKA 2W1BA 3AA9A 3H9GA 4YFKF 3PUBA 3DGPB 3LA2A 1ZTTA 3NAUA 4LD5A 2RNJA 4MK7A 1ZHFA 1MWZA 4CICA 3M30A 1CS4A 5EX3A 2D7SA 2GNKA 2X0LA 5E5NA 4A3DJ 1WSUA 1WJBA 2UXCF 2DNKA 2NVTJ 1D8ZA 3ZR8X 5AE3A 1NH3A 3WE3A 2MGZB 3UWTA 4WF2A 3HUGB 2GAUA 1Q82T 2AD9A 4A0XA 1BW6A 3AOCA 2Y1JA 1YX3A 1RSCA 1TZLA 3GFXA 3W8GA 1N5TA 1JLQB 4ER8A 3MURP 2VL8A 1EP4B 3G71S 1S12A 4GKKF 3PTWA 1FNXH 3MFKA 1M5VC 2O01C 3DNCA 2ASLA 1LXNA 1KONA 1L3VA 2OQRA 1LWEB 2W2QP 4NLTA 3J80K 2HVIA 4OIOF 2IGMA 1R5HA 2BKNA 1RTHA 1WI8A 1Y5IB 4IRDA 1NDCA 2LG4A 4OL8A 1U02A 2A5YB 3M8RA 4JI1J 2QBYB 2RS2A 2HVRA 3DGVA 2COBA 5HLTA 4ZCLA 1P1LA 1RU1A 2FZCB 5CQGA 1HHSA 3VR1A 2L9VA 1NK6A 1WC1A 3N5FA 1J5YA 4JI5F 3DRRA 2L2OA 3ROUA 5HMXA 2OD5A 1HNZJ 3BTLA 2VASA 1TKZB 2DYAA 1P92A 2K5CA 2J6SA 1Y7PA 1KC8T 1NK8A 1B7FA 2QA4G 1VQLS 4MNUA 4U9RA 4N9HA 3FEXB 2QQBA 4ED6A 2C2DA 3A4TA 3SSRA 2IEKA 4DV0J 4OZ3A 3OL3A 3SFIA 4AYBA 4FYVB 3W8PA 4ZDPA 1NHAA 4PQAA 3GJTB 1OQYA 1FMVA 3E0JB 5E20A 2RKHA 4U0YA 2Y0BB 4DG1A 1HKQA 3C14B 1ZG3A 3T5HA 1EKEA 1U24A 4K2XA 3GP9A 4DFJA 3OWTA 3WHBA 2YKMB 3HGYA 1VK8A 5FRMA 4RPFA 1G4DA 3K0JA 5KFJA 3DOMB 3M7VA 4A8QA 3S8PA 4ZA1A 2OMLA 3US5A 4DX8H 3BGLA 4PQUB 1V5FA 5DETA 5FKKA 2CS3A 3BR9A 3OL8A 3U2RA 5MLCV 3ABLH 1RCOB 2LSOA 4ID8A 5I42A 4BDYA 4IFYB 5M3FJ 2CG4A 4XNFA 3T8TA 1Z1ZA 2AYMA 4FS1A 4MO7A 1X4BA 2EG1A 1DTTB 3SHFA 1QRYA 4PG4A 3BZ6A 3TAQA 2M7AA 3KWMA 4QPQA 2VFVA 1VRTA 1LQ1A 2WSCC 1Z6RA 4HF0A 3BPDA 5DQHA 3K6GA 1M1EB 4L75A 4Y4RA 4WJBA 4M3FA 2YU9J 4FYXB 3HZJA 2NZ4A 2RAEA 4DL3A 3CUQA 4YB6A 4EK2A 3K5NA 2HQCA 1G8XA 1S1TA 4FVMA 2CWXA 1OR7C 3R5DA 1KQFB 2BVMA 1KOOA 2HWIA 4ZVEA 5K8NA 2B4VA 4O6JA 4ENMA 3D5RC 2A0FB 4TXSA 4CLKA 2QMXA 3O8HA 2PX9A 4X4RA 3DKYA 2F7VA 1SL0A 3WG7H 4RW8B 2XYGB 4EJWA 2RSQA 5IY5H 3A8JA 3HKZA 1GMVA 2LLKA 1DQUA 2OA4A 5D8KB 1VJQA 5LSLA 5LEKA 2DKOB 3IP0A 2F4VF 5J1UA 4OI1A 1J7KA 2FJAB 4KICA 4F52A 3OL6A 1H9TA 2LEAA 5BS6A 4LLGF 2W00A 2W25A 1FDBA 1FXRA 2EK6A 3N6LA 6FDRA 2M0MA 3PW0A 4ZIWA 4RGXA 3MUMP 1EJ7L 2XAFA 5DYMA 4L0ZB 3P5BP 1XWLA 4GKKJ 1K0VA 2QA1A 1VFCA 4ZPVR 5DS7A