2VODA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vodA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vodA02
2P8TA 1WELA 3R0AA 2DHGA 4HYEA 4KYWA 1J5YA 3TO7A 3PIOQ 3RPUA 3VODA 1QNTA 5CYJA 1FNXH 3VF0B 3D0SA 4GXOA 4EJUA 4PDKA 2DNLA 4ZKAA 1G4DA 1B7FA 3CPWR 2ZJ2A 2W57A 1IF1A 2DGSA 4RB2C 3TDZC 3GXOA 4ESBA 3ZMDA 4A8XA 3F8MA 2KXNB 2FMYA 3LA7A 1FZPB 2M1BA 4CO8A 2MSTA 3I59B 5JI6A 4NB5A 2IPQX 3F8FA 2WC2A 2N3LA 1QQIA 3S6EA 3MEXA 3TO9A 3F21A 2MHNA 4ZH4F 1K78B 2KM8C 1YITS 1TQMA 4KDPA 5HLGA 3R6SA 5D4SA 2XROA 2Z33A 3FM5A 2RGVA 4RAYA 1U1PA 5FLXZ 1K79A 5DDPC 1DBDA 4M71A 1MZBA 1YO5C 4Z2XA 2HQNA 3WTYC 2L41A 1MD0A 1HW2A 2VOPA 2HGLA 4LIRA 3CO7C 1VQPS 3DEUA 2MXYA 1O7LA 1X3UA 4RGSA 1ZH5A 1JJ4A 1FT9A 4WX9A 2M8EA 5D77A 3PIPQ 3L00A 5A2QK 3IWNC 1MJAA 3EYIA 1TLHB 1QO0D 1PDNC 2YH1A 3HIFA 5K1YA 2BE5F 4HX4A 2QQ9A 4U0WA 2KH9A 3IC7A 3G8SA 4EJVA 1H2TZ 2DNRA 1O3RA 2WV0A 1XDUA 3CUNA 2AYGA 5F6FA 2Q0OA 2LMIA 3GX4X 2RT3A 4W90B 1VQ6S 1KQSR 4IUFA 5CVIA 3L3CA 4ASNA 1HW1A 3S7RA 1LEBA 1HW5A 4DQ2A 1QVGR 2M70A 1X0FA 4A5NA 3GZ6A 2DK8A 2MJNA 3MDFA 5D5UB 2DO4A 3ULQB 2KXFA 3J7ZT 1WQ2A 5IM0A 3T0YA 1FWZA 1T38A 1VQ7S 4GYGA 1DUXC 2L01A 4WK8F 2LDUA 3HHHA 2XAHA 5CYVA 1B4AA 2M4MA 2DQLA 2FNAA 1VTNC 5DEQA 2DNPA 2P4WA 3M8EA 3JSPA 1WG1A 2G0CA 3BPXA 3DLLQ 2RV8A 2FBIA 1U1RA 2E5JA 2MBFA 1IN5A 1YW8A 1SJ4P 1WEYA 4PR6A 2D2WA 1M5PC 4BS2A 5EEGA 2MZRA 1REPC 1YW7A 2X1GA 4WFNQ 4WFAQ 2PJPA 3LA3A 4G6QA 2XS5A 4M5DB 2M45A 3Q5FA 2DPDA 1MDMB 2H6BA 1N54B 4XBFA 1KD1T 1ZN2A 2ELHA 2J8AA 2BZ2A 3R0JA 2FPHX 1T6SA 4KIFA 4Q48A 3C7JA 2FEZA 3BO2A 4LK0F 4AVPA 2LCWA 1WF1A 1TBXA 1ZZNA 4RU2A 5D6EA 1B59A 4FHTA 2VBYA 3MD1A 2KRBA 1G3WA 3R4KA 4HW0A 1R00A 3HI9A 1WF0A 3O2PE 1LVAA 5LSOA 1E2XA 2IP2A 4OIQF 2L9WA 2NRAC 4U67Q 2ZJQQ 3MUMP 1N52B 2MJUA 1OWXA 3FM3A 3E5XA 4WXHA 4MTDA 2OZ6A 1S8NA 1T2KA 1S6LA 2VBZA 3REOA 1KU7A 3CMAS 3KETA 1B9NA 4QU7A 1WI6A 1U6FA 3F8BA 3ULHA 2PMHA 3B73A 3RIRA 2MKSA 2DNGA 2HKOA 3OOPA 2FQ3A 1KU3A 1YIJS 2F3JA 2L3DA 3T1BA 4EJWA 4QLCU 1FP2A 4WF9Q 3HRMA 2P5VA 4IVNA 1Z9CA 2MKCA 1FOKA 5J6XA 1WHXA 1O57A 4TV7A 1YHQS 2XB2D 4I7HA 2RS8A 1P6RA 1WEZA 2MZQA 3CCES 3NRVA 1TW3A 2M30A 2PEXA 5H20A 2OQRA 1ZLKA 5D6FA 1EH6A 4MEYF 5HDGA 4YG2F 2CPZA 4LMZA 4L9JA 1SAXA 1S29A 4RB0A 4S04A 3SXLA 3M8FA 1IRGA 1IN7A 1WI9A 5L3CA 2DB1A 2NYXA 4I2OA 2DGVA 1U5TC 1BOAA 3BY6A 1PO6A 1J0RA 2CQ3A 4WKRA 3HOTA 4R79A 2ERRA 3ML6A 1IXRC 4RS8A 4I01A 3WGGA 4MEXF 4UHTA 4Y15A 1ZRDA 2CQHA 1AUDA 2MSSA 1OYYA 4YOEA 3CUQC 1R1TA 1LNWA 3HSEA 4BHCA 5E1WA 1STZA 2O61A 5CVUA 2LQ5A 2VT3A 1IW7F 3HTUA 4HV5A 1EH8A 4LMYA 3DPLC 5HDKA 3CMES 4OZ0A 2DNHA 3T8RA 2DIUA 4I98B 5IT3A 1WSUA 3Q2SC 3VAGA 4QU6A 2OJ3A 3MURP 4ZYGA 1X4EA 1J2XA 4KICA 2EK5A 5LEKA 2XNRA 2HEOA 1U2WA 1UP1A 3GUDA 2CSOA 3ZMTA 5D5WB 4CQ1A 2ZXJA 2DNNA 3TOBA 2KFYA 3TGNA 2DGTA 3FMRA 1CVJA 3MOJB 4IRHA 3CC4S 1L0OC 3H3UA 2VONA 1IN6A 2A5YB 4KMFA 2R3SA 1R8PA 5CVJA 4XLNF 4ESJA 3QRFF 1ZYRF 3K1PA 3V7CA 3U1DA 2YKAA 2AYBA 3I56S 2CQ2A 3R61A 2STTA 3UWTA 3SHFA 3BWGA 1UHMA 2QQBA 3MZHA 1LDKB 3MXHP 2N82B 2E1CA 1Z91A 3MAJA 2E7WA 5DV5A 1BI1A 4CGZA 1QZYA 4LJZF 3UCGA 4WWCA 1UFWA 1WHWA 1N8RT 1UAWA 1OKRA 1D9AA 3VEPA 2QENA 3E97A 3KEQA 2EV0A 5ITHA 3FHZA 4WFBQ 4WIIA 1DDNA 2HTSA 1BIAA 3R27A 1D3YA 3SDEB 3D2WA 1YLFA 4CYDA 3L2CA 2KM8B 4JQFA 3I4PA 1MJBA 5LGNA 2FC9A 3JAMK 2F9DA 4EJTA 3L9FA 1XCVA 5HS8A 2EFWA 4EGZA 4G8XA 4U7DA 3JTGA 2MKIA 1DPUA 1WF2A 2LA6A 3KCCA 2MKKA 1YYVA 3QP6A 4L9TA 1HSJA 2JT1A 2BYVE 2EFOA 2FRHA 2JPBA 4HF1A 2W85A 2YPRA 4YFNF 1DPRA 4TLQA 2Z5UA 5E17F 2LA4A 3LAJA 1SJQA 4ENMA 1U1MA 2QBYA 3LA2A 1W7PA 4M73A 3KFWX 2CG4A 1JJ2R 4LB5A 1IQTA 1VBXA 3K9TA 5F1RA 2CQKA 2RRAA 4A0XA 5HS9A 1Q81T 1X4BA 1P4WA 1T98A 2TDXA 3VOEA 3FEYB 3NNAA 2DNQA 3M1EA 4KN4X 4LLLA 3UD4P 1FJ7A 3EETA 2L4AA 3F6VA 2NLWA 4YUDA 3P49B 4EMSA 4L0YB 3VAIA 2DH9A 1ZG1A 2GA1A 2P7VB 3WTWC 2IA0A 5ICCA 3M7GA 5AIPA 1FLIA 3JW4A 4L0ZB 3K69A 3NS5A 2MLKA 2LXUA 5F64A 3HHGA 1X4CA 2VBXA 1BI0A 2V79A 4M74A 2H27A 2EK1A 4A0YA 3CLOA 2I38A 3WTTC 3J80K 1X5SA 2L54A 2M88A 2RQCA 2Z99A 2IJLA 3RYPA 4O6JA 5FD5A 1O0PA 3GYHX 4BAYA 3KP7A 5LRRA 5L3GA 1BC8C 3CXCR 1FJEB 1TQPA 3I59A 1HKQA 4M9SA 1UFMA 2MH9A 4GO1A 2A3SA 3CTRA 4AWXB 1SD7A 2XAJA 5K5QA 4H0EA 1QM9A 1K78A 1FT8A 2DGWA 1VQ4S 3FZVA 2FA5A 4HDVA 3KZZA 4LG0B 1KU2A 2KIUA 3IL2A 4Y17A 2EV5A 3KLOA 4HQMA 3RYRA 2MGZA 3H92A 2RDPA 2RQPA 3DP7A 3IRRA 2E5IA 2K27A 2STWA 2QVOA 2JWNA 3NS6A 3HSRA 3EX7B 3GO5A 3J81K 2FXAA 1W7PD 4EM0B 4GYIA 2DH8A 5HVQC 2HQRA 1VC6A 1TTYA 2HGMA 2DK5A 4HV6A 1S79A 2HZTA 4PZJA 3KZYA 4F7ZA 2QUFA 4UNOA 4BHBA 4E70A 1FBUA 2PE8A 2CGPA 1AOYA 4C4WA 2KRFA 2QFJA 4G7OF 3VAKA 1USSA 1RUNA 1A04A 2CQCA 1XB4A 2CPHA 2FHOB 1ONVA 1S7AA 4P55A 1WG5A 5GAGU 4YB1P 1K7AA 5DCFA 3TO6A 4KIGA 4OIRF 2LXIA 2WBRA 2OU2A 3LPYA 3F72A 1S72S 3IWZA 4AIKA 2HWVA 3GFIA 4QQBA 1WHVA 5D8LB 1BN5A 5TJJA 3CC2S 1EH7A 3GWZA 3ZMVA 2DW4A 1GVJA 1IRFA 5D8KB 3FXQA 3TDUC 1WRJA 5DDRC 2FMLA 2HVZA 3F6OA 3G6ES 2D1VA 2HZCA 4O5VA 4EM1A 2VBWA 2MZTA 3DXJF 5L3EA 4L9NA 1M5VC 1ZAOA 4ENNA 3CO6C 1U5TB 4LD5A 3GW2A 2KYXA 2HYIB 2ZJPQ 3VAMA 2JX2A 2DI3A 3GF2A 2YR2A 4BNCA 3U9GA 3TKYA 4G7ZF 3ZN1A 2XIGA 2K8GA 4IXAA 4A12A 4C0OC 2DGUA 3F8CA 5FJ4A 5ILSA 2IT0A 4BHPA 2GXBA 3CUQB 3FMSA 2X1AA 3PQKA 3CCMS 2G7HA 4RB3C 1MDMA 3LAPA 1IXCA 1P1TA 5ICEA 1OMIA 2Q79A 1BI3A 4TU9A 2LEBA 3DV8A 3QPHA 2KVIA 5IQQA 2DNOA 3FX3A 4LJMA 5FLXK 2MQOA 3K0JA 2FY1A 4R1HA 5LXYA 4O3MA 2PMUA 3KP2A 3WGHA 1WKMA 4IO9Q 3GZ5A 2LNBA 1VQKS 1FY7A 2M8DB 4CDGA 5D5XB 3I55S 2KRRA 2GQQA 5GMKa 1XGOA 5HLIA 1F9NA 1MGTA 4HLYA 2HGNA 3IKTA 4LK1F 3DXBA 3ELKA 4CXFA 4CH1A 3FMQA 4A2UA 5ILUA 1FBSA 5BJRA 2QA4S 5HOOA 1HD0A 3ISPA 1ON2A 1ZREA 4OU0A 5CJ9A 3SZTA 3CF5Q 3DPTA 2Y75A 3W6JB 3THTA 2NZ4A 3E5QA 3LFKA 4IRGA 1OPCA 1NJIT 3ZMUA 2KXHA 3E6BA 4IHTA 1BI2A 5GAEU 3B4DA 4YFXF 5JFRA 2J5OA 2VC0A 1DRZA 3WU1B 1YW9A 2KU7A 1X5PA 4I0BA 1VQMS 2BOPA 5LHHA 5FO5A 2M5WA 2R7DA 5DM6Q 3S8SA 3V8KA 2A69F 1FP1D 2LKZA 1YG2A 2HTJA 3C3WA 1P2FA 3EDPA 2QWWA 2M0GB 2M2BA 1FBQA 1VBYA 3IRQA 4AD9A 3V4GA 3MFKA 3BJOA 3ZZYA 5MLCV 3RKYA 3Q2TC 2ZO4A 3L7WA 3QAHA 2MQLA 3P7NA 1ZARA 4M6XA 2HYGD 5DCMB 2ZNYA 2CPFA 3I5UA 1HL6A 4RGUA 5DD4A 5CVVA 2DTRA 4HDUA 4RGRA 2FU4A 2VXZA 1RI7A 3ZMZA 2X1BA 2J5PA 2MY8A 1S7OA 4EQQA 3T8TA 2F5CA 4OZ1A 2U2FA 4L18B 3BP8A 5E18F 1LDJA 1BJAA 1FXLA 3DKWA 2EV6A 4LGWA 3RKXA 3QOPA 1UB9A 1R1VA 2OQGA 2XAQA 2MZSA 3HYIA 2RVCA 1FSHA 3WTVC 4MTEA 2WWYA 2VC1A 1XSVA 1R5GA 3KEOA 3AAFA 5J8FA 1H2UX 1ZLJA 2K86A 2DPUA 4CIOA 1VQ9S 2XAGA 2M9KA 1JHHA 2EFQA 3I71A 1J59A 2QYOA 2MC3A 4I09A 2CQBA 1DZ5A 4UY8T 5LHIA 5LHGA 1FSEA 1IN8A 3K1MA 1KYWA 4TU7A 2GO9A 5GADU 2ZCWA 5FD6A 1HD1A 2XRNA 1BM9A 4YFKF 3IKVA 1SJFA 2JPCA 3TOAA 2LSOA 2XHKA 2W25A 3R60A 4UQTA 2CW0F 1QVFR 3NNHA 2XNQA 1XSXA 1TNTA 5IT9Z 1IUYA 2W24A 3EYYA 5J8CA 1I1SA 1CGPA 4Z2YA 3WE3A 3K0LA 4KA4A 3HOSA 1FYKA 3E6DA 1YQAA 1KQ0A 3BDDA 1SMTA 4U0YA 4F25A 1N88A 3CD6S 3ZPLA 3E6CC 1ZGJA 5H6RA 1WG4A 2B0LA 4QWQA 2LF7A 4A6DA 5L3BA 1CF7B 1WWHA 1LEAA 3MQ0A 4U0VA 1UCRA 1BY9A 1RK8A 1U1KA 3TYTA 1Q7YT 1IZ1A 2YX7A 3RI4A 4MHGA 3U2RA 1VC5A 3VB2A 1PUEE 2VT2A 3ZP5A 2P5LC 2E5HA 3CCJS 3BJAA 4WF2A 1GXQA 1X4FA 2MY7A 5D4RA 4M9XA 5JVHQ 1JGSA 3SDEA 1O7FA 4MGRA 3FEXB 2OTLS 3FXRA 3BS9A 1H0MA 1X5TA 1IN4A 4IJAA 4ENKA 3NMRA 4ZZLA 1J75A 2HKXA 3F8NA 3BJ6A 5GVQA 2P6TA 4HF2A 2E7XA 2N3OA 3CCUS 3M9AA 4GGGA 1SXLA 2KG0A 1XMAA 2AD9A 3H2UB 2OBPA 1EV7A 2G7UA 1Z6TA 2NNNA 1R7JA 1Z6RA 4RB1A 1KQ9A 1R23A 4FT8A 1FYLA 3Q9SA 4MQ9F 4KNYA 1K73T 1ULYA 2DGQA 2ZMEB 2A61A 3ZN0A 2H94A 2B0GA 3SFZA 3SMZA 5E8GA 2J76E 3EGZA 4GCVA 2DNMA 1JJHA 4OMZA 2CPXA 2MH2A 2DO0A 4WCGA 1FNNA 1H9GA 2V1DA 2EFPA 5CA5A 3S01A 2F5FA 1TNSA 2OTJS 2EA4A 2BEOA 2PQ8A 5LLQA 4FXWA 2KT5A 2ETHA 2XVCA 2K3KA 2EWNA 2CQ4A 4BXUA 1SD5A 2Z3YA 3G9CA 3G4SS 2MA3A 1LDDA 3OV8A 4PCQA 2PN6A 5LGUA 2E5GA 1WHYA 3KLNA 1ZGAA 2DNKA 1KA8A 4IRIA 1A7GE 1G3YA 1Y0UA 2AYMA 1QZZA 1P4AA 2XGXA 4NHJA 2NS0A 4OIOF 1OR7A 2CPIA 3EGNA 2O0YA 1R58A 5DDQC 2F9JA 2PI0A 5LBQA 4G6DA 4HLXA 5L3FA 2DIVA 2IA2A 4IF4A 2O3FA 4L5JA 2D3OR 2BBYA 3ROUA 2MQQA 5BS6A 3V7SA 1SD4A 5D78A 1VBZA 4LLGF 1XSDA 3O3KA 4LG0A 5DDOC 4KN7X 4EV0A 1YS6A 1Q1HA 1OYIA 2ESNA 1YS7A 3GLXA 4LFUA 5LRSA 2CWEA 2COMA 3CCQS 2KJCA 5AIQA 2RQ4A 1KC8T 1XCBA 5ED4A 1JMTA 1V4RA 1WEXA 2CYYA 3GVAA 4B8XA 3F22A 1XD7A 3ERED 5BMZA 1NO8A 2RU3A 1KOOA 3LQRA 2DHXA 3CJNA 2ZKZA 2HS5A 3V7RA 2JVRA 2RUGA 4HOBA 3BROA 4EGYA 1D8KA 2XKOA 4D0PA 2FF4A 2QQAA 3LQQA 2MLGA 1OPIA 4ZYHA 5E8IA 1XGSA 3J7YU 3CUOA 5BPDA 4P6QA 1X5OA 1MKMA 1WI8A 3BO3A 3IHUA 2CQ0A 2MB0B 3P3DA 5LEJA 3HRSA 1U2FA 2QM3A 3WTSC 2PEHA 5H1SV 4UUVA 1KU9A 3MUVP 3NQOA 4Q47A 2L02A 4CH0S 4A0ZA 2DHAA 1IXSB 4B09A 1YIOA 2K4BA 4L5IA 2FBKA 3BOQA 1JXSA 3SXYA 2QZ8A 2ZBKA 4ZYDA 4KMUX 3H3ZA 3HSFA 3PFIA 2HFHA 1QPMA 1W4MA 2KIFA 4OINF 3P6YC 2Y0MA 5DDGA 2HGCA 4P9UA 1YJWS 5LXRA 2AYEA 2V1UA 2DU9A 4G94A 1RKJA 5BOXA 3E6MA 2ADCA 1K6OA 2M87A 5HS7A 3QU6A 3CCRS 1Z1DA 3WTXC 3NNCA 2M52A 1U5TA 1L3KA 3G8TA 2IA1A 2BGCA 4ERDA 5DUKA 4Q4ZF 1JHFA 1I1GA 4OMYA 2VODA 4V19X 3VAFA 2YH0A 5A2QZ 1LQ1A 4JK1X 1X4HA 1U1OA 2JVOA 2UP1A 2PFBA 2I2YA 2RN7A 5CLSA 4EM2A 1PP7U 3CUQA 2PG4A 1SFEA 1H2VZ 2A3JA 5LGTA 4YIIA 2CFXA 1QBJA 4NQWA 3MWMA 2EFNA 4PGHA 1C0WA 2A6HF 2DGOA 2UXNA 2FBHA 1M5KC 2XUBA 2G1DA 4UVCA 2DITA 3VFZA 4HF0A 1M5OC 2MD5A 3WE2A 4EVIA 2P7CB 1J7KA 4Y13A 4UV8A 2EJRA 4ESFA 4RGXA 2DFIA 3N4MA 4XLPF 3B02A 1PGZA 1VQOS 4IHSA 1ZRFA 4XRFA 5KK1A 2K4JA 4HQEA 4KT5C 1SFXA 5E20A 5BQTA 3V4MA 1DHMA 2MGZB 4WCEQ 1D8JA 2DISA 1UW4A 3JTHA 2DGXA 3ABUA 2IW5A 1RUOA 4Q5SF 3T5XA 2GXGA 3I58A 4UXNA 3LQVA 1I5ZA 2Z9OA 1ZRCA 4PRFA 1XGNA 3E5UA 1URNA 2BV6A 2DNYA 2OZUA 4FXVA 3VAHA 2CQPA 2DQRA 5EN1A 5CVRA 2KJBA 1FHTA 2F2EA 1SD6A 2DH7A 1O3TA 2OAZA 4M72A 3MI7X 5ERIA 3N9UC 4TU8A 1VQ8S 1U1LA 2YSRA 1BBYA 2KIMA 3FXUA 5E1XA 1XN7A 3KE2A 2GZWA 2O3DA 3KP4A 1YJ9S 2NAZA 3U1MA 1ZZFA 5H6QA 3MD3A 4S05A 2KG1A 1K8AT 1Z05A 1W5SA 2H09A 4P96A 3N97A 3SQNA 3ZQ7A 5DYMA 5DCMA 3JSOA 1FX7A 3CCLS 1FPQA 2ADBA 3TQNA 4F02A 2EK6A 2FE3A 2DAOA 2SXLA 2HR3A 4MQVA 1XGMA 1VC0A 2CPYA 2ZFWA 2JRSA 2KHCA 1U78A 3VAJA 4A5MA 1FYMA 2IVMA 2L4MA 1ZHFA 2JSCA 4WXDA 3W6KB 1AWCA 4C7QA 3QPTA 4MNUA 1KYZA 4CZZA 4W92B 3MUTP 1B1BA 2XSFA 2P6SA 1USTA 3CCSS 4Y00A 3R1LA 5IFMA 5HO4A 4M6YA 3WU0A 3COAC 1HA1A 2RRBA 4EGLA 1BC7C 2VOOA 4XSZF 3IWFA 3I54A 1LJ9A 1RZ4A 5LSLA 1OIAA 3QP5A 3I53A 3TP2A 3WTZA 3HUGA 5ILVA 4RAZA 5BPIA 2MQNA 2A68F 5TRDA 3MZYA 3RKWA 3RW6A 5IM0B 3F23A 2ACJA 3G71S 4DNCA 2KKOA 4LB6B 3K2ZA 2EA2A 1YTYA 2L08A 1I6XA 1FJCA 4UV9A 2J0QD 3CCVS 2AS5F 3UCUP 5HDNA 4OIPF 4IPAA 3CULA 1CF7A 3VALA 3C18A 1GHCA 1YWXA 2YX4A 4ETSA 2CJKA 4U7BA 1R5HA 2X1FA 1R22A 2MYFA 4KUMA 2MPUA 2R7FA 3UE2A 3LSTA 5HLHA 1K9MT 2YTCA 3J7AO 2Q8KA 2PLYA 3EQLF 5E1ZB 3FF5A 2LEAA 4IOAQ 2RC4A 2ISZA 2ADUA 1QGPA 1IAWA 2V1XA 3BEGB 2GA2A 4HX7A 2F5EA 1G3SA 3CDHA 4AIJA 2ZJRQ 2MZ1A 2WTEA 3BPVA 3V8LA 2V9VA 2CQIA 2D9PA 1SFUA 1S3JA 1H6KX 3FWEA 3PQJA 1MJ9A 2VE8A 3CC7S 5ICGA 1WTBA 3HRTA 3U1LA 2KI2A 3V8JA 2UXXA 3WGIA 5KVRA 1U6GA 2F5DA 3E3VA 4F26A 2OIHA 2G9WA 2RNJA 2XKPA 5K5RA 3JB9k 1YFHA 1D5VA 5DM7Q 1BIBA 2LECA 3S2WA 3WODF 1DP7P 2ZMEA 2DNZA 3EUHA 2CO5A 2DHSA 1OYWA 1L3LA 3RDIA 2CQ1A 1HQCA 1FC3A 4UVBA 4QPTA 5DUIA 1YJNS 3GEZA 1B6AA 2CPJA 3K1NA 3WTUC 4BQAA 4ON0A 2CQDA 2M8HA 2QLZA 1M90T 3H2VE 2MKJA 1KOHA 4G7HF 2K02A 3B4MA 1HXDA 2PBIA 1HKTA 2GIVA 2HOEA 1VQ5S 3BZ6A 2UZKA 1ZG3A 5AONA 4BH9A 2XV4S 1M1KT 1G6NA 5FFZA 1FO1A 1TW2A 4J5OA 4P9FA 1F1ZA 4A6EA 3SZPA 3RJPA 1A9NB 5ICFA 3TO8A 3IRWP 2YU3A 3ECHA 4R8HA 4FX4A 5DD8A 3ZZZA 2O6GE 3R1HA 4AIHA 2RVJA 1ODDA 2E1NA 4I0AA 3JAMZ 1D8ZA 4PGGA 2LYVA 5CXTA 2DT5A 1H9TA 2H6CA 6PAXA 1LB2A 1X4AA 2FOKA 1TQIA 4HAMA 1F9FA 2DK2A 3P9CA 5FB2A 5IT9K 2OSQA 5EEHA 2N7CA 4N9HA 5K5OA 1B9MA 1R36A 2X4HA 2CPEA 1ZG5A 2FC8A 1XMKA 1R1UA 2RNEA 4KIBA 2V94A 1PP8F 3RPQA 2CQGA 1U1QA 2MQPA 3GFJA 2FNPA 3QU3A 5LJ5Y 1O3SA 3BO4A 1GXPA 5HL7Q 2M7SA 1J9IA 4P5OA 2J0SD 3GFMA 2DLLA 3LWFA 3GFLA 3KP6A 1NU4A 1V3FA 2XS2A 2OA4A 3KP5A 2JRTA 2X0LA 3G96A 2A6EF 2VN2A 2LKPA 1OO0B 3DFGA 1T39A 4LLNA 3THPA 2EVZA 4I02A 2JTVA 3D5LA 1X4GA 3P9KA 1KGSA 2P5KA 1P92A 1U3EM 5JVGQ 4L9VA 4ENJA 2NNYA 1Z7UA 3ABTA 4OOIA 1HKSA 3HHNB 2GWRA 1UHWA 4XSXF 4HX8A 4JBAA 4HBLA 1G2EA 3MCZA 4N0BA 3UD3P 5FFXA 3G3ZA 2HDCA 3DQVC 4EJOA 3J80Z 3I64A 3UCZP 4ED5A 4FX0A 1HSTA 1W2BR 5D5VB 1R8HA 2RS2A 1U8RA 2XASA 1G3TA 1Q86T 1SJ3P 2E44A 2OSRA 4G9YA 3US5A 2CPDA 3F3XA 4WXCA 3RTRA 3P5TL 1WWXA 2DO7A 3ECOA 2FSWA 2D45A 3OW2R 5JHUA 4PKDB 1X4DA 1F4KA 4CHUA 1E17A 3DF8A 1RNLA 2VE9A 1JE8A 1ON1A 2MQMA 4M9ZA 1RIOH 3ZMSA 2D1HA 5GAHU 2GHPA 1SMYF 2QEXS 2EB7A 1NHAA 1O3QA 2W84A 1P4XA 1U1NA 2C6YA 2XS7A 2Y48A 2ISYA 2RKHA 3Q9VA 3HTSB 1Q82T 2GAUA 3J81Z 3L09A 2MMYA 2YWKA 5LJ3Y 2IRFG 4Y0FA 1F5TA 4HZFA 3RW7A 3CTAA 3G73A 4IOCQ 1SJRA 5JR3A 1VQLS 3I0TA 1HBXG 2OD5A 2V6CA 3WG9A 4K2EA 2AXLA 1XDSA 1I27A 2D9OA 2Q2EA 3C1DA 4CICA 2MKHA 3HRUA 3O6BB 2ESHA 3KP3A 2XAFA 4N9IA 2G4BA 1P27B 4KFCA 2U1AA 3P9IA 2ZNZA 4ZYEA 2UWMA 1VQNS 4BYYA 1T0FA 5DETA 2LF8A 4YIFA 4ZZDA 2A07F 2QBYB 2KN4A 3NEUA 1W7PB 2K7LA 2MZJA 5L3DA 4U88A 2DBBA 1W5TA 2O03A 2HYFA 1XN9A 5JVTA 2O8XA 1YI2S 1KQ8A 5FGMA 1U6BA 4UVAA 4HA8A 2JZYA
chains in the Genus database with same CATH superfamily
2P8TA 2VIHA 3O3LA 4JI5J 3W64A 3NCPA 1VQ6I 3KK2A 3IC1A 1J5YA 4X6AJ 3U21A 1QNTA 2AEFA 1S6UA 2KFZA 4C97A 4K0KF 4ZKAA 4OHXA 2OCCH 3I32A 4USUA 4U96A 4JI4F 2W57A 2DGSA 4V19K 1X1CA 3FBIB 4YR3A 4N7TA 5DG9A 2UUZA 3I59B 1J09A 2GC8A 2JVHA 1Y3JA 2C28A 2WC2A 2HZVA 2ZWPA 1S6PB 1MBJA 2MHNA 4CZCA 1EIYB 5EF6A 3NLCA 2XROA 1QPIA 2Z33A 1S5ZA 2FJDB 5HLFB 3ONQA 4KIAA 2M5YA 5DDPC 4K5SA 5F8GA 3JYTB 5ETOA 1APSA 3KZIC 3EICA 1MZBA 4FS2A 4DL2A 1GTHA 2L41A 4AVZA 2VOPA 4XOTA 3CO7C 1R0AB 5B7WA 2MXYA 1ZH5A 1X3UA 3CESA 3MM9A 1EF4A 1J5OB 1SAUA 3PIPQ 1YRUA 1XJWB 3L00A 2AZ3A 1T9XA 3IWNC 4NZ7A 1R71A 2A6OA 5GAEJ 2PMZA 3C2BA 5ETTA 3HIFA 2YH1A 2BE5F 2QQ9A 5IC6B 1X1BA 4U0WA 1X1AA 1LK7A 2LQBA 2W8LA 2KH9A 5D15A 3LGNA 3E2EA 3CMMA 2HFZA 5IY5H 3NAHA 3OVBA 2LMIA 1MG7A 1WC3A 3UR3C 2VQFJ 4F4WA 4W90B 1N75A 1U09A 4IUFA 3FSYA 3L3CA 3HCXA 4B43A 4FISA 4EI2A 4CCJA 4C3JJ 3EYZA 1XEZA 1X0FA 3IBCB 3JS9A 3GYNA 2XTJP 1LXNA 2PT0A 3GV5B 1T38A 4DW6A 3CCEI 3VWSA 3ILOA 1TKTB 4GYGA 3CDAA 3BG5A 1S57A 2LDUA 3GV8B 2W9BB 5D0HA 3GSDA 2QKLB 2M4MA 3BTIA 1GXLA 3BR5A 3PCOB 2KIQA 2P4WA 4U6PA 2XPVA 4MFEA 4L75A 2G0CA 3F56A 4LR8A 1WJDA 4WPAA 3B54A 3KHHA 4B3SJ 3DDKA 5CD4A 4DR1J 2D2WA 3QO9B 1GEHA 1YBAA 2MZRA 5IWAJ 2FTRA 4WFNQ 4WFAQ 2PJPA 3DOMB 4A3EJ 4DL3A 1RTIA 1SKUB 2G1HA 3FKJA 3WC0A 3CJ8A 1FTTA 1T6SA 3CQZJ 2NVTJ 3DKDA 5G4DA 2FEZA 4DZ6A 2V6EA 3W6VA 4WTOB 1TBXA 1U2RA 2F48A 1QHHD 5D6EA 4FHTA 5LSRA 5M2RA 2YBVA 2ZHOA 3M8PB 1ZA1B 2JLEA 1SFOJ 1F5BA 4NLSA 1N5YB 5LSOA 2R2SA 1S49A 2DMNA 2V4QA 3G1LA 2E1RA 4U67Q 2ZJQQ 3MUMP 4F92B 4ED6A 1RACB 1FRHA 4DR6F 3E5XA 2W4CA 2BQRA 1RT5A 1MBKA 1JLAA 3KETA 3F8BA 3N01A 1JLFB 1OSCA 3DDNA 2HKOA 2FQ3A 4B9MA 1KU3A 3CCYA 4F3OA 2L3DA 2H5IB 2ZJPF 4H54A 1FERA 2RAEA 4RBTA 1FP2A 3HRMA 5F8LA 3HHLA 4DQIA 3NG8A 1Z9CA 4JI6J 2ZOGA 5LD2C 4LF7F 4K50A 3KJVA 1O57A 1YHQS 2XB2D 1BUXA 2JC1A 1WEZA 4PAAA 1T94A 2HPIA 3NRVA 3BTCA 3CO0P 5H20A 4QWBA 5AJ3J 5HDGA 2P9CA 1SAXA 1UVLA 3KYCB 3O8WA 1ZYQA 1IRGA 1IN7A 2F4IA 1SH3A 2IIHA 3X1LB 5FKMA 1VGYA 4J9RA 3GJRB 3MAAB 4K4VA 3HOTA 2ERRA 1IXRC 4RS8A 5GAGI 3MMCA 4UOGA 4QOTA 2OFHX 1LVKA 5G0RB 3BH6B 1VK8A 2Q1LA 1NSAA 1HYSB 4IDKB 4DR3F 1S99A 3H9JA 2AGQA 4J9OA 4F3MA 1GMWA 1Q16B 4Q8EA 2CQNA 2VT3A 5E5NA 2FOWA 5J1EA 3HTUA 4LMYA 4ZJZA 5HDKA 3UVJA 3T5KA 2I1RA 4RZRA 4BBYA 2XLIA 2VUMJ 1ZAWA 4I98B 1WSUA 3QGGA 3Q2SC 5HODA 4QU6A 1T08B 3KG0A 4ZYGA 1GXUA 2XGEA 1Y3KA 2XNRA 3KLFA 2KRCA 1UA1A 2NR0A 3ZFVA 5D5WB 4CQ1A 2ZXJA 3GR0A 3TOBA 4H4OB 2KFYA 4DR5J 1MMGA 4IRHA 1L0OC 3D1OA 1JKHB 2VONA 4I7FB 2DMTA 3TWZA 4DEZA 3VPRA 5J2QB 4K2XA 3V7CA 1EQ0A 3BQZA 3BDEA 1C0UB 2YKAA 4N8OA 3MTJA 1AW0A 3I56S 4ILRA 4FF2A 3H42A 1QE1A 3SHFA 1T8EA 1LFPA 3BWGA 3QODA 4M5JA 4TQSA 3A4TA 3BR2A 3MZHA 1S1WB 2E1CA 2BW3A 5K14B 1JKQC 1FA0A 2PFFB 2VG5A 4B3OA 2Z58B 4DV2F 1CS4B 2R8JA 2IC3B 4WWCA 3N6LA 3CCWA 1WHWA 5C25A 2V4RA 1VI0A 1N8RT 4B02A 1D9AA 2QENA 2CVEA 3KEQA 2EV0A 3I9V2 5ITHA 4WIIA 2HTSA 3G6YA 2AU0A 3MM5A 1C1CB 4NI2A 3WHIA 4WKYA 4PYDA 3L2CA 1AFIA 4ER8A 4JQFA 5LGNA 2DA6A 5J3LA 4EJTA 3LPEA 4EGZA 3DC2A 5IOYA 1JNRB 1L3VA 1WVRA 2IAIA 2COBA 1RU1A 3JAMU 1DPUA 5B08A 2NZCA 2LA6A 1YYVA 2BY0A 4DJAA 3D5RC 1PUFA 4Y3CA 1HSJA 4RLQA 4PG5A 4YB7A 1XNQF 2FRHA 3FNNA 3V81A 1ZAXA 2CUFA 2BQUA 4YFNF 4TLQA 3LAJA 1RTJB 3UPFA 3NP5A 2BY3A 2HHVA 4WU3A 3LA2A 4BJ6C 4RDUA 5E3MA 1IQTA 4OFZA 4XPEA 2COLA 3K9TA 2RRAA 2HHTA 1Q81T 5HS9A 2V7FA 3VOEA 1OY6A 2V68A 4MKVA 4D9JA 3NNAA 1FJ7A 3GFZA 2DKOB 4NDLA 5C5JA 4YUDA 3HFZB 3OR1B 4EMSA 1FRKA 2IS2A 1S9EA 1UJ6A 2IA0A 3Q0AA 3M2UB 3KUHA 2VKHA 3UN3A 4L0ZB 2GQCA 3NS5A 2MLKA 1A36A 3HHGA 2IS6A 2VBXA 5E3QA 4DX6A 2CU7A 2EK1A 2I38A 3WTTC 3HSZA 2GAGC 2M88A 2EINH 2M8GX 1SL0A 3SFIA 5DZ6A 3GYHX 3EUAA 5L3GA 3CXCR 5T41A 2YQ0A 3PM9A 1FVQA 4BKXA 1QDUB 1UFMA 4GO1A 3BN7A 2A3SA 1SD7A 3DLEA 1XNRJ 1VZ0A 3G2BA 4QWDA 1QM9A 3QRRA 3U02A 4DCPB 1VQ4S 2HHWA 3FZVA 4DUYF 4DN0A 1UZDA 3MR7A 1QY7A 2KIUA 4AQYF 1FTRA 4LFAF 2Y9HA 4HQMA 4ZVUB 1QU3A 4E7KA 1KQGB 2W4PA 3H92A 2RQPA 2I5JA 5KFBA 3W5ZA 2XSDC 3T1HF 4JYKA 2Q6CA 2K27A 2HIQA 5ETRA 2HSEB 2QVOA 3KK3B 4P72A 4ZN3A 2FLLA 4JUZA 2DH8A 2HQRA 1KKHA 1VC6A 4K4UA 2E71A 6AT1B 2RQKA 3K4MA 2AJ4A 2HGMA 4ZVHA 2FY8A 2HZTA 4PZJA 3P4UB 1T9WA 4BHBA 5FROA 3KLGA 3CJQA 2OPPA 1RUNA 9RUBA 4B3AA 2JC0A 3M8QA 3PRVA 4DOZA 1ONVA 1S7AA 4KGZB 4F4ZA 4P55A 4X4OA 3KMSA 2XBPA 3TO6A 2QMWA 1XR7A 4OIRF 5I3PA 4C48A 3F72A 3IWZA 2ROEA 4DFMA 1A6LA 4MIAA 2ATCB 3M7VA 4C98A 1GH8A 1RKWA 1N56A 5D8LB 1T9TA 4F4YA 2YUSA 4GKKJ 5D8KB 4Q43A 4PXEA 1WRJA 4H4KC 4FASD 1MNDA 3PJRA 3DBRB 2DYAA 2VL1A 1LK5A 1K4SA 4LF4J 4IG0B 4EBDA 4L9NA 5D3GB 4RW9A 2H1LA 5B1BH 3TW7A 1H38A 2IDEA 3S1QJ 1U5TB 1P6TA 2B9WA 3PO2J 1TL3A 1D1BA 1UMJA 4BNCA 1YZ6A 3HD1A 3RCOA 2VV5A 2NVYJ 1Q8LA 4QPXA 5K20B 4V2FA 4DSJA 1ZPWX 2GXBA 4BGDA 2JLFA 3A8EA 2BKPA 4DG1A 2X1AA 3H98A 3CCMS 1MDMA 1J5EF 3UW1A 1YJTA 2TCTA 5ICEA 2WK4A 3ZZRA 3H4BA 2IYGA 1G2HA 3HHEA 1D1UA 3AJDA 3HL2A 5LXYA 3GIJA 2L7ZA 1QTNB 4O3MA 3KP2A 4LIVA 2LNBA 2CMPA 4PFOA 4CDGA 2EZHA 4DS5A 3I55S 2NS7A 4DFKA 1XC5A 2GQQA 3LSPA 3HDDA 5HLIA 1F9NA 1JXLA 3M6XA 3ELKA 5KFNA 3OFGA 3O8HA 2AT1B 3MPWA 3FMQA 5ILUA 2X7IA 4CSWA 1FBSA 3TA2A 3BR3A 2QIFA 4KO0A 3PW5A 4A8OA 4CLUA 5F3ZA 2V50A 1ON2A 2XDVA 4OU0A 5CJ9A 5L1LA 2E9ZA 2IAJB 4ZN1A 3CF5Q 3DPTA 3PY8A 2NREA 2XSJC 3THTA 4X4TA 2H54B 3SI8A 1Q1KA 3B4DA 3N28A 5HQ8A 5KFRA 1OYDA 3PSFA 4UOHA 5HQMA 2CUZA 3WU1B 1YW9A 2KU7A 1X5PA 2AQ4A 3FBCA 4OHZA 4KB7A 5A2QY 2VFTA 2DDBA 1QLNA 1NZAA 4DV7F 5J2PB 4WFXA 4CUGA 2YKNB 2LKZA 2HTJA 1Z77A 2XB5A 2IBOA 4KSEB 4B9TA 1FBQA 5KFHA 4HACB 4F67A 3T5JA 3RKYA 3Q2TC 2ZO4A 3NRBA 3QAHA 2ZHAA 3JRDA 3GTJJ 4D5FA 2UV8A 4RGRA 2FU4A 2VXZA 5HROA 2J5PA 2CNLB 2F5CA 4RUAA 2F8EX 3MAQA 3BP8A 3AFHA 4MK8A 1BJAA 2BABA 3DKWA 4UUXA 2XAQA 3CCUI 4MKBA 5FDLB 3WTVC 2MD0A 3BR6A 3CJ0A 4CP5A 2YS9A 2CG8A 1MMSA 2WWYA 2VC1A 3OS1A 5D6GA 1ETQA 2L7KA 1R0BG 5J8FA 2K86A 4CIOA 3HD2A 2D7SA 1CC8A 1JHHA 4KRWA 3I71A 4B3TF 3IS9B 4I09A 1OQ3A 3CVKA 2WONB 5LHIA 1LW2B 1X19A 4ZLNA 1IN8A 3K1MA 2PC6A 4TU7A 2QSWA 4BXXJ 5GADU 4AL6A 5HATA 4EEYA 3ZTOA 2JPCA 3TOAA 2BE9B 4B4CA 4Q2LA 3NNHA 4NWBA 4P7VA 1JJ6C 1D9FA 2EFVA 1WUUA 2HWIA 4NLYA 3HVAA 3P45B 1I1SA 4LSNB 3K4CA 3DM2B 3ZZPA 3VQTA 4KA4A 4A3BJ 1PG5B 2WZ1A 4DCOB 1YQAA 1HR0J 2LK2A 3HM9A 1SMTA 1CJVA 4C3KA 1HWKA 3CD6S 2YNHB 2B0LA 4KPCA 1L3SA 3KMQA 5L3BA 2E19A 3QAEA 5L9XA 2RU9A 1CF7B 3ENAA 3R2CJ 3ZQGA 1BY9A 4D3HA 2YX7A 1FK9A 1HF0A 3AY0A 1KQKA 3CDLA 1CULB 2BZTA 3MAHA 2HPMA 1Q78A 1IKXA 2OV7A 1WGXA 2HHHF 3K5LA 3KHRA 4UUSA 2EH3A 3AL0B 4CO3A 1H0MA 2WSFC 1QD1A 3NMRA 4FS1A 1REVB 4ZZLA 1J75A 2HKXA 2DJNA 2P6TA 3UD5A 2E7XA 3CMQA 1YJ7A 2N3OA 3UN5A 3HO1A 2VQEF 4GGGA 5LOQA 4DV5F 2XY5A 1XMAA 4L74A 2Q1ZB 4UOCA 4CNYA 2AD9A 3M32A 2CKWA 3N79A 1MH3A 3IXQA 2NNNA 2KLOA 2A0FB 1KQ9A 2YNGA 1FYLA 2HBQB 1V55H 3Q9SA 4BDPA 3JSYA 4WZQA 3H5SA 4ZJOA 3TAMB 4C6AA 2CW7A 3MECA 1Z3YA 2C3OA 4J91A 5GAHJ 3BT9A 2J76E 3EGZA 2DNMA 2XZDB 3BGRA 2MH2A 2DO0A 4NCAA 4M63A 1Q53A 5J47A 1HBNA 2HFUA 3QSYB 1FMVA 3HZEA 4EZ9A 1R49A 3J7A1 4IZZA 3W65A 5IT0A 4NYPA 4FXWA 2ETHA 2K3KA 2EWNA 4URGA 3OLAA 3Q8RB 2MA3A 1LDDA 2E5GA 5LGUA 2ZUAA 1U26A 2R4GA 1UJ4A 1WHYA 3KLNA 2QSHX 4KV8B 3K70C 2E7VA 3OTBA 2NS0A 1OR7A 4NC6A 4ES2A 1TAQA 1WSVA 1K61A 3ZGKA 3LWLA 3FJ2A 3SEQA 5E3RA 2JUGA 2PI0A 5DM7F 4ICLA 2DIVA 2QL5B 2IA2A 4FXDA 5IP6A 4L5JA 1FE0A 3RAQA 1NJYA 4I0WA 2K3IA 1YS6A 4I64A 1OYIA 2ESNA 1YS7A 5HJXA 4DV0F 2JRMA 2FJAB 3UI3A 3CCQS 2I5UA 5AIQA 3MEGB 2XPUA 2RQ4A 1KC8T 5KFDA 1I3AA 5ED4A 1WC4A 1XX5A 1G7CB 5KG7A 1BR4A 1WJEA 1XD7A 2ICWG 3NWTA 1KOOA 3LQRA 2ZKZA 2HS5A 4RW7B 4PJNA 4EBEA 2UV1A 1VQOI 2JJ4D 3EZUA 2W7NA 4BL0B 4C8YA 4RMNA 4D5CA 3LQQA 4HSTA 3BSAA 3M1VA 1TV6B 1A6QA 2R93J 4NLTA 3O1LA 2LFBA 5B0DA 4IEJA 5BPDA 3DKXA 3H59A 4JV5J 1WI8A 4BS9A 3BO3A 2MB0B 3P3DA 4ZCIA 2XGCA 1NLKL 1D0YA 5LEJA 1FWKA 2UUAJ 5H1SV 2BANA 4PFPA 2LREA 1PJ7A 1D8YA 4Q47A 2L02A 2DHAA 1IXSB 1S9GB 4IOBA 2UVVA 5FRMA 4NLPA 1YRNA 2CW8A 1JXSA 1S97A 2AGOA 1B64A 4BHQA 4V2GA 4IFYA 2Y0MA 1VQ8I 2HGCA 2B9YA 1YJWS 1V5EA 3B6CA 1T05B 1D0EA 2ADCA 2M87A 3A8IA 4ZVSB 5KG1A 1YJ9I 3NWSA 2ZH3A 1XTZA 5JXSA 2VF3A 2QA1A 3CJTA 1JX4A 1NXIA 1JHFA 1I1GA 2Y9YA 4V19X 3VAFA 5A2QZ 1RHMB 1RJJA 5A0YB 2RQMA 2FHMA 2UP1A 4TY9A 2OEKA 2I2YA 3HDSA 3IRXB 4EM2A 3QQCD 2Q2EB 3IO1A 3K58A 2ZH2A 1H2VZ 1RR8C 4NQWA 1C0WA 1ZK8A 4W1UA 3BR1A 4U7CA 3I87A 4DU7A 4HF0A 3J80Y 2MD5A 4GRIA 1R4NB 3N6MA 4XLPF 4HVZA 2NYIA 3DEEA 1NTCA 1GLNA 2LC2A 1ZRFA 4NLOA 2JA5J 3QGIA 4A8FA 4QW9A 5K8NA 2IM1A 1LV5A 1VRQC 3A3PB 4WCEQ 1I6JA 2DISA 2R7XA 1UW4A 2HNYB 2DGXA 3S1TA 2EBIA 2BM1A 3KTQA 3JSMB 3A3OB 3I58A 1AU7A 5FIIA 2HOSA 4J19A 1XGNA 3E5UA 1TVRB 4YFUA 1UFKA 5KAFC 4UUWA 4BXFA 2QL9B 1E6VA 2Q6BA 1RT6A 2ASYA 3OVSA 1RWPB 4X64F 2HQGA 1FXRA 4Q0BA 4PWUA 1FHTA 1O8BA 1PKUA 2RF2B 1SD6A 3MM6A 1IBMF 2DH7A 1QJHA 3N9UC 5KG4A 2ZB9A 2O5RA 1D0ZA 2ZOMA 2UUCJ 2F7VA 4ZIWA 1R6RA 4I99C 3L4BC 1FKOB 1DARA 1XN7A 3KE2A 1S77D 2HLUA 5HANA 1F60B 3QPSA 4WFYA 1FE4A 1ZZFA 5H6QA 1LWEA 3HM5A 4K4WA 1NNDA 3KDOA 2ZH5A 5FLXU 3CDBA 3DEWA 1TKDA 3QQAA 1D1AA 3SQNA 3V6DB 1NK3P 5DYMA 2HWHA 3EMTA 5KTQA 4B9LA 1T03A 1PC4A 3TQNA 5HJYA 2DAOA 2VQGA 3QJPA 4PK4A 2SXLA 2F8MA 3PIOF 1RSCA 1XGMA 2HYJA 2XZWA 2C3MA 3BSCA 1H74A 1GFWB 3IAS9 4WXDA 1Z21A 3H2LA 5BYRA 4C7QA 5KFWA 3QPTA 1RBAA 4ANEA 4OX9J 1KYZA 3AKZA 3RR7A 3O5TB 2A10A 1TL1A 1Y4ZB 3DGVA 3PHEA 1LWCA 2IBDA 4Y00A 4XMYA 2QMXA 1WDDA 3DRYA 3R6LB 5IFMA 4UB6C 3DKYA 1L3TA 3M1CA 2FZCB 5ETNA 1NK5A 1WOSA 3ISNC 4QIWN 1OIAA 2RSQA 3QP5A 3QBCA 4NRUA 3TP2A 3I5BA 2PMZD 3HUGA 4GVBA 5BPIA 4DZDA 3MZYA 1NKCA 1HBMB 4OYMA 3BZCA 3QGPA 3BQYA 3IH2A 2ACJA 4XONA 2VDHA 3G71S 2F65A 2E1OA 3SDGA 2PJRA 3K2ZA 2ALZA 1SL1A 2XF5A 3AB4B 1HHQA 4HDHA 3A0BC 2L08A 1I6XA 2ZZMA 5B0FA 2J9EA 1T0FC 3V4IA 5TISC 4LOCA 4RW4A 1RBLA 3G6VA 1NUEA 4F04B 1RT4A 3CULA 3AG2H 3VALA 5K8MA 2ZKTA 3TUIC 3LH2S 4LIUA 3GTMJ 4J9SA 1HDDC 4MK9A 4YMEA 4U7BA 2OUGA 2JDJA 1R22A 2MPUA 2C2ZB 3UE2A 1K9MT 3J7AO 3OL4A 3K89A 2Q8KA 5IV3A 3QYYA 4ZLJA 1SV5A 5L1IA 2CDQA 1NJWA 2HLTA 5E1ZB 4LF8J 4LF9J 2O1PA 4JI0F 4IH5A 3BEGB 2HDDA 2ZJRQ 4DFPA 4J9NA 3V8LA 3O2IA 5CAAA 1HFEL 3ELHA 3MPDA 1Z4UA 1H6KX 3FWEA 3IA0A 1MJ9A 4Q45A 3CC7S 4K8RA 2DEJA 4ZP8A 3IM8A 3FISA 2NXEA 4HEA2 3FXJA 3OTOJ 3E3VA 4F26A 2FLOA 1SVDA 2ZD1B 2XKPA 1Y00A 3RBDA 5JUMA 1YFHA 1D5VA 3BCAA 2LECA 4V1Ak 4B17A 1DP7P 3LANA 2ZMEA 4I2QB 2AJ2A 2J6UA 3H20A 4DYQA 1BR2A 1FC3A 2JFDA 4DR7F 4CCLA 2CPJA 4NA1A 3ZNJ1 2M8HA 2GGPB 5FLVA 4M5GA 4U95A 3H2VE 3Q8UA 2YQ1A 4G7HF 4ED2A 1HXDA 1X1DA 4C3LA 3KNAA 1VQ5S 3NARA 3OL3A 4YY3J 1TC3C 1G6NA 3HXMA 3BF4A 3DMJA 3QAUA 5FKOA 3SZPA 2HEKA 1FWLA 4HRIA 3M8WA 3BGFA 2VQHA 3MOZA 2IVFB 2DN0A 5M3MJ 4E98A 5ETKA 3ZQFA 4XLEA 1D8ZA 4ZK7M 2G13A 4OZ3A 2LYVA 3KK1B 4M5KA 3TUZC 1H9TA 2H6CA 4HT7A 2QEXI 6PAXA 1X4AA 5KG0A 1TQIA 4Y34A 2XYGB 3H1CA 3P9CA 2DK2A 5IT9K 2OSQA 5K5OA 2CPEA 2WVFA 3PYDA 4K5RA 2V94A 2VJIA 1EJ7L 3GFJA 2FNPA 3QU3A 4AFFA 5I3QA 1GXPA 1TKXB 3I3LA 3NMAA 1D09B 3H0DA 2PMZN 3LWFA 2ATLA 3WBZA 1T7PA 1RU2A 3KP6A 1S7EA 2IYIA 3KP5A 2CUEA 1YZ7A 2JRTA 3K6GA 4FPRA 3G96A 3U1KA 4RBVA 2HXOA 1OO0B 1T39A 4LLNA 2FGCA 2HNHA 1N36F 2JTVA 1F43A 1X4GA 5DG7A 1HHTP 2P5KA 1MW7A 4M3DA 1RRJA 4OI3A 2FJWA 1N33J 4L9VA 2Y0SA 2NNYA 1HW9A 1Z7UA 4B3RJ 1PAUB 4KGVB 3FRYA 4OOIA 1HKSA 3AFGA 2LLKA 2ZJRF 3HHNB 1UHWA 4CLWA 2WA0A 3B6AA 4ANDA 4HBLA 1IM6A 4N0BA 2ZH9A 4MKAA 5FFXA 4F91B 4I4BA 1IBLF 1E6YA 2HDCA 3DQVC 4WK1A 3UDVA 3ZQQA 3J80Z 3I64A 4ED5A 2CV2A 4JYAF 4I68A 2IDLA 4NMLA 1V5IB 1RQ0A 2O66A 2W1BA 2QA4G 4C8NA 1Q86T 4J90A 2E44A 2EPIA 2OSRA 2ASDA 2B4UA 3TVZA 3OFFA 3BG7A 3P5TL 2DO7A 2XLKA 1I94F 3NCRA 1N78A 1AKHB 3ECOA 4GFBA 5JHUA 4NXNJ 4ZVGA 2DR6A 2I10A 1JE8A 3EVWA 4M9ZA 1HIYA 2WHOA 4JI8J 2DT6A 2F4VJ 5KT6A 4URQU 3D1NI 1EKRA 2FVCA 5E3AA 3A12A 1CLFA 2XB0X 2XS7A 2Y48A 3RZAA 1Q82T 3Q9VA 1NEEA 4ZVQB 2MMYA 2Y3YA 2OPSB 3GMEA 2VJ5A 1SH2A 1F5TA 4XLCA 4ANJA 2PI5A 2QN6B 3CTAA 1SANA 1JLCB 3G73A 4WP9A 4IOCQ 5BR8J 4ELUA 3V5RA 5JR3A 3VSLA 1VQLS 1HBXG 2OD5A 2PO4A 3HHLC 3HVTA 2YQ3A 1SFKA 1R43A 3R7NB 1LWFA 1JT0A 4NA2A 1OCOH 3V2UC 2QCOA 3ADAC 3JAMY 2D9OA 1VQPI 2XWXA 3TZWA 2ESHA 1KVIA 2DFFA 1JLEB 3BKUA 5KCMA 3FFIB 1HQEB 1H8AC 1M5HA 5JMNA 5C4JJ 5A8KB 5K8PA 2MHEA 2R7SA 4QIGA 4ZYEA 1SKRA 2UWMA 4YR2A 2OMOA 4ZITA 2DOFA 4WJBA 5CHCB 2KN4A 1W7PB 4NCGB 1W5TA 2O03A 4ZS6A 3DPUA 1XN9A 3C14A 2UZAA 2H4YB 2XC7A 2GOMA 4JI1F 5L8RC 2F6CA 5A8WA 5H9EJ 2DHGA 4LR7A 4HYEA 2X3GA 2HZDA 2E35A 2Y1IA 1K47A 1SH0A 2XULA 3VODA 4IFVB 3UKGA 5CYJA 2H9ZA 3VF0B 1RB0A 4X4RA 4ES3A 4DR4J 5D4OA 2FLNA 3FK6A 4GXOA 2DNLA 5EWEA 2JZ5A 2M3AA 3I9ZA 3OS0A 2ZJ2A 2OPQB 1VQ7I 4RB2C 1DAXA 4ESBA 3M3YJ 3ZMDA 2XMWA 1UWAA 4A8XA 2KXNB 2FMYA 3LA7A 1Y39A 3L1PA 1KTVA 2V5HG 1IKYA 4CO8A 4OYPA 1FOXA 4G65A 4NB5A 2IPQX 1SB6A 3FMWA 1WPKA 3F8FA 4A8MP 1QQIA 3S6EA 3TO9A 1IKWA 1S6QA 3MKLA 2BJ8A 3F21A 4O0NA 5C3EJ 1K78B 1YITS 5FKLA 1YKWA 3BG9A 1H7XA 5HLGA 4BE2A 5D4SA 2NPIA 2BW7A 3FM5A 2HDWA 4RAYA 1U1PA 5FLXZ 1K79A 1ZR4A 4NLVA 5F0WA 1S7IA 3TJAA 5I3UB 1QUVA 3LAKA 4Z2XA 5HVHA 3AOCA 4CCNA 4ZHRB 1FJGJ 2HGLA 4LIRA 5ETVA 3DEUA 1JJ4A 3MD2A 4PXBA 1V3RA 3AQOA 5D77A 1U4BA 5EDNA 3IH4A 2OC6A 3EYIA 3CZ6A 2M7BA 4NYZA 2EIJH 3SZGA 1TLHB 3J81Y 4NC7A 5HNFA 2DRBA 1CSJA 3M6VA 4I6YA 5KFXA 2HK2A 3LFUA 2K40A 4EJVA 4ID5A 4XICA 1O3RA 1NPRA 1XDUA 3CUNA 2R7ZJ 3O8GA 5F6FA 2Q0OA 3OR1C 4HH1A 3HKZD 2H8WA 3ISZA 4WE1B 4FETA 2UU9F 1RAEB 4IQJA 1RXOB 1FD8A 3M2VA 4CO2A 3DYAB 5C24B 4R5PA 3A13A 1QVGR 1F5CA 2M70A 1AHDP 5J1YA 4DQRA 1S1VA 1HNZJ 2DK8A 2JWTA 2J9DE 1LKZA 4TVAB 2FLPA 3ULQB 2KXFA 1KHWA 4OYAA 2F4OB 5IM0A 5KFGA 4ED7A 1FWZA 1CJKB 2QJ3A 5F3TA 2XAHA 1PSDA 1B4AA 2DQLA 5DEQA 2L48A 2DNPA 3M8EA 3JSPA 3LSKA 3QSIA 2KHMA 4YELA 4CLZA 3C15A 2B51A 3ABKH 4CDIA 2RV8A 2FBIA 4DSEA 1FDNA 2BJ9A 1U1RA 1P7IA 2PI4A 3QPLA 2BYCA 2XCPA 3PVXA 1YW8A 4M3EA 3FXKA 1SJ4P 4XIDA 3WQPA 4PQUA 1DTQA 1M5PC 4BY1J 3ZOBA 1REPC 1HQUA 1X4PA 1YW7A 2W2NP 4G6QA 2XS5A 4YDDB 5DGBA 5KT7A 4FYDA 1AZSA 1T3NA 1KD1T 2ELHA 4J9QA 2K9MA 2BZ2A 1G3OA 4KIFA 4JP8A 4DV4F 2OPTA 4LK0F 2NVUB 4AVPA 1HBOB 2LCWA 1WF1A 4MK7A 1Q5YA 1ZZNA 1B59A 2B3TB 2IM2A 4XRMA 2YWFA 2WY8Q 2GV1A 3RG6A 1E2XA 2IP2A 2L9WA 2NRAC 2XLJA 1MSEC 2IEKA 3M07A 4DUZJ 4WXHA 4RAFA 2OZ6A 1S8NA 3TR5A 1S6LA 2V2QA 4DXLA 3BPSP 1MMDA 3REOA 3CMAS 3CC4I 4DL5A 2DCLA 1B9NA 4QU7A 1U6FA 3TANA 4S0HB 3B73A 2MKSA 2XI2A 1MLAA 3G82B 2R92J 1IRZA 5D0GA 1YIJS 3T1BA 4EJWA 3NGSA 1RR7A 4LIWA 4RU9A 3BBBA 1HWJA 2CDRB 1S9FA 4LRFA 5KOWA 3K7RA 2MKCA 4BE0A 1U45A 2QFIA 1QAIA 3HEFA 2M2EA 1ZKGA 4KPYA 3PKMA 1JTXA 4RBOA 1TW3A 4MFBA 5F8HA 2OQRA 5D6FA 1SI9A 2MC4A 4MEYF 2CPZA 3K70D 4L9JA 3UNYA 3NGDA 1X9SA 4RB0A 2WOMB 2DMUA 3R5GA 1HPZB 2YWEA 2X9DA 5L3CA 2NYXA 1HNXJ 4YB5A 2DGVA 3GMGA 1U5TC 4OYIA 1BQMB 5H9FJ 3BDPA 5L39A 4TN2A 3FZBA 2H5JB 2V2KA 1HOMA 2IY5B 3W1YC 4MEXF 4G1QB 2GA7A 1UZCA 3TZZA 1ZGWA 4UHTA 4Y15A 1ZRDA 2CQHA 1O5JA 1TWHJ 3MMBA 3PUFA 3KHLA 1HBUA 2G2OA 1VF9A 1YVFA 4RW6B 3D54A 4CYUA 3HSEA 2AEMA 4CNZA 5CVUA 2BM0A 4HV5A 3DPLC 3CMES 4OZ0A 3GBGA 1XMOJ 2KB2A 4P75A 1RT7B 2OJ3A 2VG6B 2HHUA 3H8YA 2PA3A 4HTIA 2W9CA 3W2WB 1FRIA 2D41A 3BBFA 2BJ3A 4RWXA 4ECZA 2B7BB 4OI0A 3M8YA 4XLHA 5LEKA 1OY9A 4LRAA 4WTYA 3SCLE 3Q0UA 1HNIA 2HEOA 1U2WA 3OJUA 4IYQA 1UP1A 1OJ4A 2KTQA 5DM6F 3DU6A 1KFSA 1CVJA 3TGNA 3FMRA 1BWVA 2JN6A 3MEEA 4JI2F 1DU0A 3E51A 5M5YJ 1JT6A 2A5YB 2EQRA 5CVJA 1R8PA 4XLNF 3TJ9A 5EZHA 2QTWA 5E3OA 3QRFF 3GTKJ 2CZ4A 1VIOA 2GCFA 3U1DA 5M2UA 1LE8B 2I0XA 2ZDOA 3DNCA 1MN9A 1Y0HA 4RLEA 4DSLA 1UHMA 2BMBA 2QQBA 4PJJA 4CO5A 4X65J 2JSXA 1Z91A 3NAUA 3I0RB 3Q22A 2E7WA 4I2PA 4ED3A 2OEMA 4X66J 4C11B 3GPAA 4LJZF 2F1FA 1UFWA 4O3OA 2IRXA 2R5YA 2VG7A 1OCPA 1TT0A 3E97A 1F2HA 1KR4A 1N32F 2XMVA 4KC5A 3W2VB 4USMA 4J37A 3IMQJ 3LP0B 5C44J 4CRJA 5DZ7A 1R5ID 3SDEB 4TY8B 1YLFA 4CYDA 2IFXA 4AXIA 2KM8B 4ILLA 3JAMK 1OCZH 3L9FA 4PZVA 2YKQA 1KTQA 1LOUA 4KJIA 4DV6J 5GAEI 1NH7A 4QWCA 3JTGA 2BW2A 2W7OA 2MKIA 3WHBA 2WW4A 2DCUB 1S0NA 4CM2A 2HVSA 4IR9A 4L9TA 2J6TA 2JT1A 1KVKA 5KFVA 2EFOA 4RO0A 2XPWA 1R27B 2YPRA 4NXMJ 2Z5UA 5E17F 2LA4A 3MEDA 2O7OA 4ENMA 4CA0A 3UDCA 4XQFA 2QBYA 2MLYA 4M73A 5CD4H 3KFWX 2XGQA 1JJ2R 1H89C 3MM8A 3HG9A 3HXLA 3M30B 4IR1A 3C66A 2TDXA 4P2FA 1O4XA 3FEYB 2DNQA 3K5MA 4LLLA 1RUSA 3UD4P 1BMQB 1HLWA 1U49A 2NLWA 3E01A 3FBBA 2R8HA 3VAIA 1ZA2B 1ZG1A 2GA1A 3BZKA 5SUHA 5F8NA 3N5BA 3M7GA 5AIPA 3MPVA 2MABA 3Q24A 2JOQA 4DR2F 3ZQHA 2KT0A 4TYAA 4AL5A 2LXUA 4ZC3A 1A6IA 1FKAF 4PABA 1IBKF 2DR7A 2QSGX 4C8ZA 2J0XA 2NXNA 1FKPB 3SQOP 5FD5A 2H3EB 1HNVA 3AQPA 1UG2A 5IOLA 3W8GA 1FJEB 2A18A 2AIRB 1TQPA 3VYSB 1JUSA 3OY9A 5EX0A 2Y8WA 3T5LA 2KFDA 2MH9A 5K5QA 1FVSA 2XMUA 2R7QA 2QGUA 4CCHA 2NXJA 1FT8A 2WAQD 1RWMB 3CJKB 4HDVA 2FA5A 3AL0C 4A3DJ 3TJ8A 1HARA 4LG0B 3IL2A 1EQMA 1RHJB 3C16A 2JA6J 2XEXA 2XSJB 2UXDJ 2C2RA 1KLMB 2IMOA 1OLTA 4NNJA 1UEKA 3IRRA 2E5IA 4FDFA 2JWNA 1Z2ZA 1FESA 3FEZA 3GO5A 3J81K 3PKYA 4OLPA 3LA0A 2YNIB 1MBEA 1SQEA 3GIIA 4NZ0A 2OAUA 1TTYA 2ZZNA 3SCIE 2VJVA 4XRSG 5B66C 3BKTA 2LLZA 3EUHC 1VQKI 1R8BA 4C4WA 2KRFA 3D6HB 3TBIA 3T19A 4G7OF 5L9NA 3D1QA 3VGTA 1USSA 2X3DA 3D4JA 1XB4A 1FI4A 3NXZA 2CPHA 3JXOA 4RL1A 5E0OA 5K7FA 3PXGa 2LU1A 2ZM6J 4IKAA 1FNMA 4YB1P 4DFJA 3Q0VA 1K7AA 4KIGA 3TA0A 3T1AA 2LXIA 4FF3A 2HURA 1U02A 1S72S 4AIKA 3PSIA 4ZVEA 4I67A 3K4LA 4PG8A 4ZPDA 4QQBA 3KJQB 3OL9A 2XYPB 1WHVA 1FNOA 2GAHC 1TL8A 4A3MJ 1XWLA 4A8SA 5HP1A 1Q95G 3CC2S 2W01A 4MAKA 4Y6IA 3GWZA 3ZMVA 3NY0A 2DW4A 5HMYA 1IRFA 2R7RA 4I6AA 3FXQA 1VQMI 4OX6A 4Y4RA 2ZSHB 5DDRC 4U7UD 3H9GA 2FMLA 3G6ES 5H9EK 2LP0A 2XGPA 2D1VA 3SIPB 3HFKA 3EXYA 2E36A 4O5VA 2NS8A 1RESA 4CO4A 2QV6A 4M5HA 4EZ6A 3DXJF 3BQ1A 2YY3A 2ELKA 2IMWP 4LD5A 2HYIB 4OQJA 2ILYA 3BYRA 1DQ8A 3GF2A 2ZFHA 3LOUA 2YR2A 5J2NB 4JOMA 2CQXA 3LP2B 1UPMB 2KJWA 2Z8QA 1A5JA 3ILLA 1FX2A 4PWDB 4D3GA 3T1YJ 4JV2A 5ILSA 3H3VK 4ZP6A 3CUQB 4M5DA 3PQKA 4J01A 2G7HA 1MN7A 1EX8A 1VJWA 3DHWC 4NUBA 3RAXA 4C8MA 4TU9A 2AJ0A 3S3NA 4F50A 4GC7A 4YP3A 5IQQA 2DNOA 1A0OB 5EYRA 1Q0NA 4BJTA 1UZHA 4QJVA 2HXIA 5K7HA 1EARA 3AD9C 1QHGA 1VQ9I 4OHYA 2FHKA 3WGHA 3Q3SA 2FUG9 1FY7A 1OCRH 2F5VA 1YG0A 3FCWA 2KRRA 5GMKa 2FVPA 1MMNA 4UZCA 1MGTA 4LK1F 1DURA 4CXFA 3QIPB 4OI4A 4P73A 3VWBA 4OHWA 1B72A 1RTHA 2Y9ZA 4XNFA 3H5YA 3VZIA 4LF6F 1EB0A 5ETPA 1JLQA 1BC6A 1G4CA 1T9VA 1W26A 4OJ3A 3HP6A 3PG9A 3SZTA 1S5LC 2Y75A 3D5SC 3W6JB 3DXSX 5KFZA 3S32A 3LFKA 3IGNA 4CTAB 1RTDB 1CPZA 1NJIT 5EG0A 3A8JA 4NLRA 4X4UA 4IHTA 1RWOB 4ZDNA 4ECRA 1Y1WJ 4XAKA 2MLZA 4IO1A 5LMUF 4YFXF 4B9SA 2FX0A 2VC0A 2HQDA 4I0BA 4X4QA 2EIKH 2BOPA 4MT1A 2HVHA 5FO5A 5B5EC 3S15J 3S8SA 3SFUA 4USWA 4UTGA 2DOEA 4XKVA 2NOGA 1YG2A 2CVIA 2VPZB 2UXCF 3BSNA 1MU2A 3FCHA 2DEIA 2M0GB 1F5AA 4J9MA 1WOOA 4AD9A 1JI8A 3V4GA 3HFVA 5MLCV 3L7WA 1S6OA 1BHNA 3A01A 4HSRA 4M6XA 1R89A 2HYGD 2Z56B 1W36C 4N8NA 4LBHA 4MIBA 3F9KA 3PFOA 1OYEA 3I5UA 2DTRA 4CYCB 1HNWJ 3ZMZA 3GZ7A 2VKVA 1N4LA 2BHYA 2U2FA 3A1YG 3I4MJ 1PBUA 2EV6A 3QOPA 1UB9A 1R1VA 2MZSA 3HYIA 4Y3OA 1RDRA 2CAJA 5AT1B 2Y1RI 1FSHA 4P52A 4CLKA 3IN5A 2ZEJA 1XSVA 1TUGB 1R5GA 3HJEA 4W97A 1YX5A 3AAFA 3QT5A 2XAGA 1ETOA 4ECYA 3IWLA 3I5CA 4K4YA 4WXWA 2QYOA 2MC3A 3UFCX 4UY8T 2ZE2B 1FSEA 2W4DA 5CZVA 3JRAA 2WVBA 1U6ZA 4QIVA 2DJIA 2GO9A 1RT3B 3MR6A 5FD6A 1RC9A 2LR8A 1EAYC 2LSOA 2XHKA 2HIYA 2W25A 3R60A 1HKAA 2CW0F 5EGOA 4YEAA 2OTJI 3OV7A 1QRYA 1XSXA 1HMVA 1GX6A 1SC6A 3K0LA 5ETLA 5F0FA 4BLGA 1FYKA 3D6MB 4B3MF 3BDDA 4F25A 1SUQA 3HT3A 3BGUA 1WG4A 3Q8PB 3K2AA 3L2VA 4K59A 3FRZA 2ZBPA 3OHBA 1U1KA 1K1SA 2HNZB 4ZPVR 3RI4A 4AYBD 2E34A 3U2RA 1VC5A 4GKJF 1C1BA 3A0HC 3ENWA 1HCRA 3CCJS 1C4AA 3H4DA 3D3CJ 4HYKA 4DGWB 2W7AA 1FCAA 4ANCA 4XPCA 3DOLB 2Z2LA 2VUGA 5D4RA 4M9XA 3OTEA 3LAMA 5C42B 3FEXB 2OTLS 4M94A 1ERDA 3DI6A 4K4XA 1RT2B 2C22A 4ECUA 1X5TA 3ZZOA 3OPKA 4IG3B 4ENKA 4AM3A 1L3UA 3JTOA 3M05A 2B5JB 4E7ZA 5GVQA 5H9FK 2EG1A 3W8PA 1X60A 1VRTB 2LKSA 2JJ7A 2V34A 3AB2B 4CO0A 2BJ1A 1SKSA 3M8RA 2FHJD 3ZZTA 1GK8A 5LMNF 5CABA 2LBFA 1MBFA 3AHPA 2OBPA 2Y69H 2QLJB 2EFGA 3DRSB 2UVUA 3MKZA 1Z6TA 2MFZA 1LXJA 1WORA 1R7JA 3PUBA 4C3IJ 4CCKA 2W4SA 1SIZA 4U87A 1UELB 2O9LA 4KNYA 2DGQA 1M1GA 1VCTA 1XMQJ 3VSKA 2A61A 2H94A 1UWBA 2CNKB 3SFZA 3SMZA 2W2MP 2YKMB 4B08A 3JQJA 4GCVA 3L9ZA 1N6QB 1IUJA 2Y1LB 3NBPB 3CNQP 4C2TA 1H9GA 2WTFA 2V1DA 2R0QC 1R0CB 4O3NA 1Z2LA 3KX2A 2CJQA 2GVDB 3S01A 3AODA 1TNSA 1S1TB 4EK2A 2EA4A 2E60A 4E2FB 1OJLA 2PQ8A 3W5XA 4IOAF 2CQ4A 3KG4A 3PO4A 3S3MA 2Z3YA 3G9CA 2VB6A 3G4SS 1X3ZB 2PN6A 4O3SA 3GONA 2WVEA 2K85A 1ZGAA 4O44A 2OMLA 1GVDA 1ZM4A 3PW4A 1K1QA 1A7GE 5FD1A 2F4FA 3K4BA 4KT6A 2AYMA 4JI3F 4A47A 4NHJA 4LFBJ 1O51A 4DPTA 5BYSA 2AXTC 4IL6C 3EGNA 1R58A 1B8IB 1S1UA 2R8GA 1VYAA 3BR9A 1F3FA 2F9JA 1UHSA 1Y5IB 3SSQA 5L3FA 3A03A 3UDEA 1GMUA 2O3FA 5L46A 3LOCA 2BBYA 2MQQA 4OI2A 3V7SA 1TU0B 2X1CA 4Y7NJ 1VBZA 4G6TB 4LLGF 4GMKA 2Z2MA 5DDOC 1MNEA 3V42A 4KN7X 4EV0A 3QRQA 1TZLA 1Q1HA 5DLFA 4WU2A 1I39A 2DT9A 5TGTA 1O6XA 2KPMA 3A4CA 3AH6A 2KJCA 1RT1A 1TL7B 4DQPA 1CJTA 1NSKL 3L7PA 3ZXSA 1WEXA 3PDNA 2R8IA 1ULRA 2QGFB 1NO8A 2GIZA 2RU3A 5L1JA 1ELOA 1IWAA 3CJNA 2JVRA 3W66A 1X9WA 3PZPA 4R8UA 5C2GA 4D0PA 2W2PP 3QRPA 1S1XA 3SJMA 2OD4A 5KFFA 2MLGA 1I3QJ 1OPIA 3QLHB 4E7JA 2HFOA 1XGSA 1LW0B 3J7YU 3CJSA 3WDOA 1MKMA 1B0PA 3IHUA 1JKRC 4RJVA 3MFIA 1U2FA 2Y0SD 3Q89A 5D4PA 4UUVA 4BDYA 2X85A 4C9YA 3ZQLA 1F3VA 3OXLA 4PWWA 3QFHA 2VQCA 3K59A 1NH3A 3TZXA 5D0EA 3S93A 4YHHJ 1H98A 2HBRB 1Q8KA 5IYBJ 4ZYAA 4OI6A 4I56A 2K4BA 2FBKA 3MMAB 4NLXA 2HBZB 1GAOA 1VRUB 4WYWA 2ZBKA 4P2XA 4NASA 3H3ZA 3PFIA 4IRDA 1IM4A 1QPMA 1HI0P 2DA5A 1MBGA 1CQMA 5BOXA 3ET6B 1K6OA 3QU6A 4QWEA 1JUMA 4MMOA 3NNCA 2GMHA 2UUBF 2HMIA 1L3KA 5T7LA 2BE2B 2IA1A 3HK2A 1N25A 2F5GA 3CCTA 2V8DA 4ERDA 3PW7A 5F27A 5DUKA 1OFCX 3BBCA 4HR2A 2DYSH 1Q8BA 2JVOA 2NSCA 5A6PA 2PFBA 2RN7A 5CLSA 3ZQIA 5LGTA 3FHNA 4E7SA 3JREA 2R3VA 2CUYA 3CD7A 4PGHA 2DGOA 2NYHA 3ITHB 2DFHA 2DITA 3VFZA 4CLSA 1M5OC 5F1JA 3WE2A 2GHVC 1J7KA 4KR0B 3GP9A 4UV8A 2EJRA 4ESFA 3MCOA 1PGZA 3KLEB 2YX1A 5KK1A 4PUOA 2L9VA 2CRGA 1SFXA 5E20A 4MO7A 1SIWB 1D8JA 4OX8A 3KK2B 1YRXA 2ZVSA 3CDUA 1WKLA 3AJ1A 3ABUA 1S12A 4Q5SF 3T5XA 3PYFA 2GXGA 5KT5A 1CBKA 4UXNA 1UG0A 1AXQA 1ZRCA 1RAAB 2BEFA 4PRFA 1URNA 2XG8A 4LR9A 1XERA 2BV6A 5DRKA 2FQ4A 1X4OA 5HVFA 1HHSA 4FXVA 3MR5A 2IM0A 3GYXB 1A35A 4O4GA 2XY6A 4A4JA 4M3FA 1O3TA 1K0TA 3T9NA 3NGKA 4RWWA 3MI7X 3CCVI 3EVMA 1IO2A 4XKCA 3QT6A 2BY1A 1Y1VJ 2VKZG 3FXUA 1EA3A 5E1XA 5I42A 1VLOA 5FJ8J 3KP4A 4XLAA 1FTCA 1H72C 3U1MA 4F0KA 2KG1A 1TQLA 1K8AT 3RB3A 3POTA 2H09A 3MR3A 3ZQ7A 2M7AA 5DCMA 1NDKA 3CP2A 4Z6YA 3CCLS 1FPQA 2EC0A 4Y28C 2EK6A 2FE3A 2Y0SN 2Z2ZA 2BY2A 1S59A 2CPYA 2ZFWA 3NOGA 2LY1A 3JRCA 2JRSA 1U78A 4F36A 3VAJA 3CJ5A 4A5MA 3MM9B 5B3SH 1X0PA 4OWRB 2IVMA 4LQ3A 5GAHI 1AWCA 2KT3A 3DGPA 3VDXA 4CCOA 4LG3A 5F8MA 1ZELA 4KYZA 1BLUA 4B44A 1KQFB 5CQEA 3FQKA 3CCSS 2UXBF 5HO4A 3PM1A 4JI5F 3WU0A 1CC7A 5AE1A 3DLGA 2RRBA 2P9GA 2YWGA 4EGLA 4XSZF 3LP1A 3I54A 1NHKL 1YJNI 1T9YA 5LSLA 1NPPA 4IHWA 2E5NA 2J0WA 1IDYA 4RW8A 5ILVA 1P1LA 2MQNA 3F44A 5TRDA 3EM1A 1RAOA 4LVOP 4DF4A 3F23A 4OZ2A 4ZJQA 2FZGB 4Y52J 1F6TA 3Q83A 2EA2A 2DXDA 1F0XA 3FDSA 1FJCA 3NGUA 4UV9A 2J0QD 2E5ZA 2O01C 3PIPF 1FDBA 4IPAA 1RABB 2XHCA 4NBQA 2EEYA 2CV1A 3QZ8A 3VQSA 1YWXA 2N4DA 5KFOA 3H36A 4NOHA 2CJKA 4DV3J 2W82A 2MYFA 2R7FA 5HLHA 2YTCA 4XO0A 1WDTA 1Q4RA 4XK8C 1RTIB 1EETA 4FQGA 3GFYA 3C6UA 1RWWB 4P2MA 2RC4A 2LDIA 1ETYA 1LFWA 1KSPA 3SDBA 1IAWA 3R8YA 4HX7A 4MKYA 4HPQA 3BPVA 1TL4A 2D9PA 5J2MA 3N4WA 1QSLA 3H35A 4KGMA 2DFEA 1PCAA 3SZ2A 5E33A 2LH9A 3HRTA 2KVQE 4HG2A 1F9HA 3V8JA 2UXXA 3WGIA 5KVRA 3C2GA 5CYMA 1KNZA 3Q8SB 4H4MA 3R5CA 2OIHA 2G9WA 4LBPA 2VFVA 3G4SI 3JB9k 1RAJA 1Q7LB 1RT5B 1JLAB 5DQGA 1ETVA 1QAXA 3UR0A 2NQPA 2VQFF 2AX1A 2V9KA 1L3LA 5CYQA 1I6HJ 3DRRB 3OSFA 1F2GA 1HQCA 5KFAA 2ECCA 3MWBA 1B6AA 7FD1A 2XMTA 3WTUC 4BQAA 4ON0A 2CQDA 3JQKA 1M90T 3HHLB 4HT5A 3HX9A 5F8IA 2R7UA 4USKA 4R0EA 3DRPA 2GZOA 2PBIA 3OT9A 2H51B 3BZ6A 3KJVB 3SCJE 1ZG3A 2OLWA 1XK8A 2XV4S 3GFXA 5FFZA 1U0HA 5E3LA 3RJPA 2M0CA 1A9NB 2YU3A 4FE7A 4L3KA 1NJXA 4FX4A 3OJSA 1GXTA 5EHHA 1SC7A 3R1HA 2QT7A 1JLBA 4A3KJ 1RWVB 4I0AA 4PGGA 1IV8A 3D67A 2OCEA 4H4KA 3CO9A 2NXCA 4B3SF 2DXIA 4USIA 2FOKA 4DR1F 5F9NA 1DQAA 1UEUA 2DOAA 3MMCB 1B9MA 2CA9A 2BRKA 1ZG5A 2J7WA 2ZJQF 2MTLA 4ECTA 2RNEA 4KIBA 3QYFA 5IWAF 4YRVA 1U2CA 4FKXA 4HHHA 3BO4A 2I8DA 3PW2A 1NRKA 4HTJA 1H0HB 1RKIA 4P5OA 3UVJB 3BV8A 3LSRA 1V3FA 4A3CJ 2OA4A 2XS2A 4XL9A 1AYEA 3DCAA 4J7CA 3DFGA 4CLTA 1R7IA 3IBWA 3THPA 3D5LA 2HW3A 4I69A 2A5WA 1VQNI 3KLFB 4IH7A 5JVGQ 4ENJA 3ABTA 3DTKA 2N8GA 3EPGA 2BVZA 2GWRA 4O0IA 4XSXF 1G8XA 1QVUA 3LL7A 1N0VC 2V4JA 3D68A 4J9VA 3EZ5A 4BWMA 3G3ZA 1DQUA 4ZMMA 1RADB 5EZGA 2HOTA 1HSTA 2R42A 2HAIA 4JI6F 5D5VB 1R8HA 1QE1B 1KDNA 2JEIA 2KP6A 1U8RA 2XASA 2VPLA 4UY8I 5LL6d 5L1KA 2W8KA 3MZ8A 4G9YA 3PFEA 3US5A 2CPDA 2GBYA 3F3XA 3G86A 2BW3B 4WXCA 5AJ3F 2J9DA 2RB7A 2FSWA 2VG5B 4M5MA 1U0JA 4B3OB 1X4DA 4OZJA 4CHUA 1UFLA 4HLBA 1ON1A 5C25B 1ZETA 4O3RA 2KO1A 1X3WB 2HK3A 1O3QA 2B4PA 1P4XA 3MM5B 2ISYA 3GTPJ 4NI2B 1X1PA 2DHHA 4X1EA 2CJAA 3U1NA 1RZMA 2ZFUA 5D8HB 3TAPA 3PTWA 4Y0FA 4XIUA 2RHSB 1N34J 3K5PA 4ES1A 5F9LA 2CS3A 2FD2A 3T6BA 2HOAA 1KP6A 5BXIA 3RRGA 4C30A 3EE3A 4K2EA 3P8BB 1C0TA 4II2A 4A3IJ 2RMLA 2LP4A 1XDSA 1MWZA 1I27A 4CICA 4DBRA 1PUFB 3MM7A 2MKHA 3M8ZA 2GO8A 4DI6A 4UT4A 3MKYB 4W4MA 5KAIC 3H0GJ 2XY7A 2U1AA 3NKYA 3V81B 5JLWA 1NAQA 3P9IA 2ZNZA 1YGYA 2ACMA 2G0IA 2Z57B 2Y31A 3SBMA 3LSMA 4QCLA 4DR5F 4U88A 5L3DA 2DBBA 1JB0C 3FQLA 3RBEA 2RKIA 1YI2S 1KQ8A 3PO3J 4UVAA 2OPRA 2PGCA 1VBKA 2JZYA 5GPAA 2AO9A 3R0AA 4QR1A 4X4NA 4KYWA 2LFVA 2IRYA 2FQQB 3TO7A 1E3OC 4XDCA 1S9EB 2UUWA 4DX5A 3RYLA 4LF5J 3D0SA 3M8SA 2VA3A 4JX5A 3HKZA 1QTMA 4PEOA 1TFWA 3CPWR 4BC7A 1SQGA 2ME6A 4WWSA 4LRCA 3VZHA 3TDZC 2FGOA 4OL8A 3OYHA 3F8MA 3PW0A 1Y11A 1JWWA 1JQGA 3PNVA 3R3TA 1TKZA 2M1BA 2G2ZA 2RREA 2MSTA 4JX4A 4FE4A 1K44A 3IP0A 3JRIA 4LSLB 1WNEA 5ETMA 2N3LA 3DLEB 3ZZUA 2HRYA 4JI7J 1V6HA 4RM2A 4PG6A 2OFGX 3GLLA 4ZH4F 4Y2IA 1WACA 2HRTA 1W36D 1YJVA 2KM8C 4XN0A 1PAEX 3CCSI 1SC3B 4CH7A 2HFVA 2RGVA 3CMYA 3SQGA 3IR7B 3GE9A 3I6PA 3OUYA 3K8WA 2I5JB 1FIAA 1VQYA 3WTYC 1HW2A 3ENQA 3IAS2 4C0BA 4RNOA 3LF0A 1O7LA 4RGSA 2K1RA 4I1TA 1FT9A 1VMBA 1LFBA 4LVNP 4WX9A 3NGRA 2M8EA 1FRJA 5KG2A 1FXDA 2BUNA 3MCSA 1H88C 3VHQA 5A8RA 1PDNC 2ZBCA 4HX4A 5E79C 3KLGB 5A2QU 4USTA 3CJQB 2OPPB 1DGRM 3G8SA 3AT1B 4DPYA 2DNRA 3ETOA 3M8QB 3PR4A 2RT3A 2RQQA 3RR8A 1VQ6S 1VS3A 2V63A 4ZPWR 2L0KA 3IWXA 4ASNA 1HW1A 2GIFA 5F04A 2JA8J 3S7RA 1HW5A 1Q5VA 5DQIA 4WZMA 1LUJB 2J7KA 3GZ6A 3PJWA 3DOKB 2DO4A 2NOJB 1YHQI 2X6WA 3OIQA 2QYGA 2VFRA 1DUXC 2L01A 4WK8F 4ZVOB 3BG3A 3HHHA 5CYVA 4Q44A 2LY9A 1TK0A 1VTNC 2ZSIB 1EZZB 1WG1A 3A2KA 1U9NA 1UETA 1WC1A 4RW9B 3L7UA 3CJRA 2AQEA 1Z3XA 4KKOA 2C1EB 1MROA 5EDWA 1XNRF 2HHQA 1IN5A 4ECQA 4CCMA 1TL3B 4OV1A 5B1AH 2E2HJ 5BYQA 4PR6A 3AD8C 3BN4A 4BS2A 1AA7A 3FGVA 4L3NA 3TAQA 4CI0B 2AHQA 3I0SA 2X1GA 4LF1A 5J40A 3PJXA 3ZQCA 1V5VA 2AF6A 3O44A 4DV1J 5IZHA 4DG1B 3OLBA 3Q5FA 2DPDA 1MDMB 2H6BA 1N54B 4XBFA 2JL9A 2D5VA 1Z1ZA 2FPHX 4Q48A 3C7JA 3ILJA 4OYWA 3PFYA 4FZVA 4KJZA 4NEZA 3V6JA 4LFCJ 2XF6A 3S8PA 3MD1A 2HS3A 1G3WA 4HW0A 2HKEA 1GX5A 2F63A 5HLTA 1R00A 2MYSA 1WJBA 3HI9A 1WF0A 2HQIA 1LVAA 2GLOA 1GV5A 4AC0A 2QE5A 1N52B 2MJUA 4FYXB 4X62J 4CT8A 4QYRA 2AEJA 4BBSJ 3ERMA 1T2KA 4D7MA 4ALZA 5KHDA 2VBZA 1KU7A 1BQNA 2B56A 4X4VA 1WI6A 3ULHA 3DU5A 2PMHA 2C3UA 4KO0B 1N0UA 2HFNA 2F3JA 3C6TA 2YNFA 3I56I 4WF9Q 3PACA 4IVNA 1RWXB 2VPWB 3E0JB 2QLXA 3DLKA 3FC9A 3T41A 3FSXA 1X31C 2QG9B 3BPDA 1XC9A 4KHPJ 4GKKF 3BCBA 1RT2A 2RS8A 3EUNA 3CCES 2PEXA 3AD7C 4PQAA 4XM3A 3DFEA 1EH6A 4LMZA 3K10A 1S29A 4CT9A 4LF4F 3SXLA 4TXSA 3M8FA