5EGOA

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein Meis1
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoA00
5GP9A 1ETWA 3BR2A 3JRFA 3NARA 3O8GA 1JUMA 1ZGWA 3B6CA 2CRGA 4S0HB 2CUFA 1MSEC 3OSGA 1B72A 3S16J 4BBRJ 3ZQLA 2DA3A 2LR8A 3LOCA 3TW6A 4J19A 2XB0X 1APLC 3RZOJ 4X6AJ 2DMQA 1K61A 1RKTA 1LE8B 4DYRA 5M5YJ 3CMYA 1X58A 4JYKA 1HLVA 2DA4A 1H8AC 1LFUP 4AC0A 3HOVJ 2TRTA 3C2BA 3IH2A 1ZKGA 2R7ZJ 2DMUA 4EEFG 4BKXA 1W0UA 3S14J 4V2GA 2EZIA 1U78A 1RKWA 2FD5A 1HCRA 2DA5A 4JX4A 2WV1A 4M6VA 3HOUJ 1ETQA 2JMWA 5EF6A 4D7NA 4A93J 5F27A 4A3CJ 2D5VA 2JWTA 2ELKA 1H89C 3VPRA 5DS9A 1XG1A 1MBEA 1QVUA 5GPCA 3NAUA 3HGGA 5FLVA 3WHCA 1Z77A 2L0KA 3MVPA 2VKEA 2O7OA 3BR3A 3BR1A 4JX6A 4UUTA 4A69C 5EG0B 1ORKA 3S2HJ 5IP6A 2IEKA 3D1NI 1R9TJ 4DYQA 1IDZA 1HOMA 1BA5A 2DTZA 1XC5A 1GT0C 1MBKA 3JRAA 1ZQ3P 1IV6A 4BY7J 3GTKJ 4L5EA 4FCYA 5C4JJ 2JA5J 1MBFA 3F0CA 3OSFA 1BW5A 3HOWJ 2XPUA 4MFDA 3BR6A 4CYCB 3PM1A 4A3FJ 3BQYA 1H88C 3BR0A 5F0CA 3BTCA 2JN6A 4A3IJ 3CCYA 1PUFB 1BL0A 2E19A 5M5WJ 2IBDA 4MO7A 4D5FA 5K7ZA 1IUFA 1Z0XA 5M3FJ 3ZQFA 3S2DJ 1YRNB 3FK6A 1OCPA 3A01B 2DMPA 1CQTA 4FE7A 2R5YA 3TP3A 2M34A 4G12A 4XRSG 2YS9A 1GVDA 1FIAA 1NK3P 2XSDC 1JKPC 4M3BA 2PMZN 4XRSA 5C4XJ 1UHSA 3HEFA 2VKVA 1QVTA 3I4MJ 2X6OA 3WHBA 2XRLA 2EBIA 2MGQA 1IG7A 2HYJA 5EYRA 2M0CA 1QRYA 4M3GA 1P7IA 2LY9A 2VI6A 3TP0A 2O8KA 3MN2A 1HDPA 2LFBA 3SDGA 3GTLJ 2MSYA 1T33A 1BW6A 2LKXA 4W1UA 2EZLA 2M8GX 3BG5A 2NOGA 1I50J 1TWFJ 3GTMJ 2DA2A 2OF7A 2P81A 1FTTA 3LNQA 2K9NA 2ECBA 3K2AA 2R5ZA 1UMQA 1IDYA 5GPAA 5E3MA 5IOYA 2DMTA 1WH5A 4QSHA 2FQ4A 3GTPJ 1D5YA 2E2HJ 3S15J 1SANA 2YU9J 1ITYA 4MFEA 2HQ5A 1AKHB 3QQAA 4FISA 5J1RA 3IV5A 1LE8A 1JJ8C 1Y1WJ 5JLXA 5JLWA 2K9SA 2R5YB 3TW7A 1QPIA 1B8IA 1B72B 3HOZJ 5K7FA 1RESA 3UKGA 1YRNA 5E3NA 2QCOA 2JJ7A 4XIDA 1JUSA 1DU6A 1JKRC 4RDUA 3LSJA 3QPSA 2WAQN 5C3EJ 2DA7A 4M3DA 5F0FA 2HI3A 4IEJA 3O8HA 2NVQJ 1Y1VJ 2COBA 4W97A 2HXIA 1TWGJ 2XGCA 3S1NJ 3A03A 4C2MJ 2DA6A 2FX0A 3HKZN 5F08A 2LTPA 2Y9ZA 4DZJA 4A3JJ 5FLMJ 5FKKA 1F43A 1U9OA 3S1MJ 3HM5A 2VUMJ 4IHYA 1G2HA 4I76A 3B6AA 2Y2ZA 2E1OA 2EZHA 5FKLA 1TC3C 3BT9A 3RZDJ 3ZQCA 1AKHA 2GBYA 5EG0A 5IPAA 4IHXA 3BG3A 4A3GJ 1NTCA 2RAEA 1VFCA 2XPVA 2JA7J 2EH3A 1S7EA 1POGA 1GV2A 5F0HA 1I3QJ 3A02A 3MKLA 4MIMA 1W0TA 3HBLA 2R92J 2HDDA 1E3OC 3GTGJ 2N8GA 1ETXA 2H8RA 3Q0UA 3W6VA 1TWCJ 1IC8A 3FISA 2IAIA 3ZQGA 4QIWN 2XGEA 4FE4A 2XB5A 5FKNA 3CQZJ 5IYBJ 3IH4A 3ZOBA 5FJ8J 5J1YA 2M2EA 3L1PA 1ZK8A 2LLKA 4XICA 4FTHA 4HNVA 3HOYJ 3JRBA 5J3LA 2DJNA 2W48A 1K83J 1U9NA 1F36A 2JK3A 5EGOB 2L7MP 1ENHA 1OJLA 5EDNA 2GLOA 4M3FA 2CUEA 3RKQA 5IOZA 3PO2J 1X2NA 3ZQHA 2KDZA 4Y52J 2Y9YA 1GV5A 1ETVA 2CU7A 3JRDA 1ETYA 1JT0A 2ID6A 3FIWA 4IHVA 3SFIA 4D7MA 5HODA 1JJ6C 2VPRA 2Y0SN 3E7LA 1ETKA 2TCTA 2L7ZA 1HF0A 2HOAA 2Y31A 4BY1J 2ECCA 1AU7A 1GDTA 3JREA 1ZR4A 4C3IJ 4JP0A 4NDLA 2ME0A 1VNDA 4DZPA 4XRMA 1B8IB 5E3OA 4I6ZA 2DMNA 1AHDP 1RR7A 4D5CA 2XPWA 5IP7J 3FKIJ 5J1UA 2OPTA 3BTJA 2LK2A 2WB1N 2LVSA 3HDDA 2NS7A 2X48A 1ZR2A 3JRGA 3QPLA 2X9DA 4UUSB 2M9HA 1ETOA 3BQZA 1JT6A 3LSPA 2R5ZB 1EF4A 4B4CA 1MBGA 5F04A 2XGDA 1RETA 4Y7NJ 2G0EA 1JGGA 2L9RA 2B63J 3BTLA 1T56A 4IHWA 1IRZA 4RBOA 1MBHA 2NVXJ 3CDLA 5BNGA 2CQQA 2EZKA 3FK7A 2EQRA 1MSFC 1OCTC 2CJJA 5E3LA 1JUPA 2HXOA 3JRCA 2AO9A 1JKQC 3G1MA 4A3LJ 2MW8A 3I4NJ 3G1OA 4C3JJ 4XK4A 1BJZA 2H1KA 3S1QJ 4JX5A 2I10A 3A01A 2K40A 1XS9A 3HB9A 1P7JA 2L7FP 3JRIA 1ZTRA 4LOCA 1DU0A 3Q0VA 1WH7A 4B3AA 2JA6J 1SFOJ 1PUFA 4AYBN 1IJWC 1WI3A 4A3KJ 1TWAJ 1LFBA 3H3VK 1I6HJ 1FJLA 5M5XJ 5C44J 3SJMA 1VF9A 2R93J 3S17J 4A3MJ 4DW6A 4CYCA 2MG4A 3OOUA 1JTXA 2DA1A 1VI0A 3IH3A 4DYCA 2QF7A 4X1EA 1TWHJ 2NVYJ 3Q3SA 2GM4A 4AUXA 3BTIA 1MBJA 1OFCX 1A5JA 5FKMA 2E2IJ 5IYCJ 2DN0A 5EEAA 3H0GJ 3K7AJ 3GTQJ 3HGYA 2R0QC 5EZHA 4BXXJ 9ANTA 1X2MA 4B1RA 3GTOJ 2NVTJ 1WCMJ 5FKOA 3RQIA 1U8BA 2LD5A 1HDDC 3DCFA 5EGOA 1A6IA 4MLOA 1MNMC 3GBGA 5M3MJ 1WPKA 1FEXA 2CQXA 1JKOC 3G1LA 2FJ1A 4BBSJ 4QTRA 2HOSA 1UG2A 2E2JJ 3OIOA 1MH3A 3BR5A 1FIPA 2O9LA 5IYDJ 3JRHA 5K7HA 2K9QA 2AHQA 5F1JA 2NS8A 1WGXA 1MH4A 2JA8J 4C3HJ 3Q0WA 4UUSA 1FTZA 3HOXJ 5IP9J 2ZB9A 3PO3J 1JTYA 5EZGA 3JR9A 4A3EJ 4V2FA 1Q1VA 4ABZA 2YUSA 3BG9A 4M3EA 2KT0A 1IGNA 3M4OJ 3LSRA 3M3YJ 3DEWA 3LSGA 2ME6A 5DTDA 2ID3A 2Y30A 2LP0A 4A3DJ 3ZQIA 4A3BJ 1NK2P 4GFBA 3S1RJ 3TEDA 3GTJJ 1O4XA 2HOTA 1GUUA 1RPWA
chains in the Genus database with same CATH superfamily
2XVCA 3HSRA 4RGSA 2EV5A 2XAGA 4HQMA 3MKWB 3BJ6A 3F8FA 2EFWA 3AFHA 4IQ4A 3L9FA 3ZMDA 4CCMA 1TTYA 2L9SA 2M87A 2NXNB 1WHUA 1S3JA 1MSEC 1B72A 4BBRJ 1H9TA 2FNAA 5LRRA 3K70D 1R1UA 3IRRA 2RQPA 2OTLI 4HDVA 4EJUA 1ZRFA 4EJTA 1CF7B 3ZMUA 4ZDOA 1HLVA 2CH0A 3ZXSA 1REPC 2DA4A 2MH9A 3ZR8X 2R7ZJ 3HOVJ 3CMAI 3DF8A 5CQGA 2JPBA 2R7UA 3FWEA 5B3SH 3CLOA 4YEJA 3Q9SA 4IRIA 2WV1A 5D4SA 3F8CA 1ETQA 1OR7C 3R4KA 3TKYA 4L18B 2DCEA 4D7NA 3K10A 4A3CJ 2Z33A 3TBIA 3VPRA 2QQ8A 1XG1A 2PMHA 1MBEA 3MZ8A 4KT6A 2W85A 4BQNA 4JQFA 1YHQI 1NHAA 2VLAA 5GPCA 4TV7A 3TO7A 2MD5A 3K4JA 2HKXA 4N4NB 4RAZA 1ZRCA 4WCGA 2HR3A 3PNYA 3BR3A 3OYNA 4UUTA 2W4SA 2A5YB 4A69C 2DI3A 5EG0B 5IP6A 2F4IA 2IEKA 1MMAA 3LSTA 3CUQB 1R9TJ 1SVOA 4AYBA 4YG2F 1HOMA 3OL4A 1XC5A 1MBKA 2EINH 1IV6A 3BZKA 1FOXA 4F7ZA 2A5WA 1I3AA 1BIBA 1MBFA 2BVLA 2BW3B 5FFZA 2CWEA 2HQNA 3AKZA 1KYWA 2KZVA 3S2WA 1FZPB 1XMXA 1FBSA 5F0CA 1ZLJA 4XKCA 5ILVA 2HYFA 4HV5A 3U9GA 1PUFB 1KYZA 2DDAA 3GXOA 4D5FA 5HOOA 1SFXA 3HPGA 1S7OA 4E7KA 4KYWA 3BCBA 1CQTA 2DFHA 1WSUA 2R5YA 2XAJA 4CHUA 4U0VA 1G59A 4G12A 2CFXA 1GVDA 3E0JB 1FIAA 3BJAA 1ZN2A 2XSDC 4BE2A 3SFZA 2X85A 4N0BA 1O3RA 1JKPC 2Z3YA 3WHBA 1ZRDA 5GAEJ 4RAYA 3VODA 3MKYB 2EBIA 3CCRI 1XN7A 4C9YA 1MNDA 1S7AA 2MH2A 4EJVA 1LKXA 3FX3A 2Y75A 2JA2A 3KIOA 4Z6YA 2XSJC 5LHIA 1R00A 3MN2A 1BBYA 4O6JA 2DQLA 3C1DA 3P9IA 4HF2A 1U2WA 1PUEE 1NG6A 3BG5A 1I50J 4RLFA 3GTMJ 1WJBA 3HOSA 2DK8A 2OF7A 1FTTA 4F3QA 3HRTA 1SFUA 3CDHA 3NQOA 2X6WA 2CFOA 1R7JA 2PQ8A 3SXYA 1F5TA 1R5HA 3R0JA 2FOWA 1K78A 3GF2A 2VBWA 3QYEA 1RZ4A 3K1MA 2FQ4A 4EJWA 4ZZLA 1D5YA 2HNHA 1SANA 1W36C 4MFEA 2HQ5A 2EV6A 4A6DA 3SYTA 3H5NA 4FISA 2KPMA 3WTWC 4IX7A 1JJ8C 4HQEA 1D0XA 5D8KB 1HKQA 3J81Z 1JHHA 1LJ9A 3TW7A 2IXSA 3HOZJ 2V9KA 3REOA 3UKGA 3HTSB 4PJLA 2ISZA 2ZSHB 2QCOA 3EUKL 1LDKB 3DLLF 3LSJA 4XRFA 4EM2A 4CXFA 3OYAA 1FX7A 4GGGA 4FX0A 5GAHJ 5C3EJ 2DA7A 2HKOA 3ABKH 3K4KA 4FT8A 2HI3A 2VJ5A 4YFKF 3O8HA 2NVQJ 4A0ZA 4BQQA 3LSIA 2YPRA 5LD2C 1ON1A 1MW7A 5TJJA 2LF7A 3E6BA 1J9IA 4Y15A 4AVZA 3HKZN 2NNNA 4DZJA 4DBRA 3HOTA 2BEOA 2DAOA 1U9OA 5FO5A 3HM5A 2STWA 1ZHFA 4JBAA 3B6AA 2PLYA 3PNTA 5FKLA 4B43A 2P0WA 1VQNI 3F8NA 3WGGA 1FC3A 3LSHA 5LGTA 4BNCA 1V5GA 4IOAF 1G3SA 4RB0A 3OMYA 4L0ZB 3K70C 1VFCA 1SD6A 4PDKA 1OQYA 1R23A 1I3QJ 3C7JA 2LH9A 3A02A 3MKLA 4MIMA 4F92B 1XDUA 3HBLA 2ZJPF 1O3QA 1QGPA 2WA0A 2ICWG 3Q0UA 3W6VA 4OIRF 2WY8Q 4KJZA 2CV1A 3TGNA 3ZQGA 2ETHA 3R6SA 5FKNA 3CQZJ 2HYGD 1T2KA 2FSWA 1LDJA 3ZOBA 4HBLA 3H9JA 4M9XA 5J1YA 2M2EA 3L1PA 2PMUA 3L2UA 2KDOA 2LMDA 1LNWA 3FHZA 4FTHA 4LFUA 2PFBA 1FMWA 4Y13A 3ZPLA 2NVUB 1U9NA 3IP4B 5EGOB 1ENHA 5K5RA 3F6OA 4CZCA 1J75A 5EDNA 1X4PA 1XTAA 2A07F 5IOZA 3U21A 2KDZA 4Y52J 1ON2A 4UB8C 4KICA 1ETVA 1XCBA 4F93B 1IO2A 2VOOA 2TDXA 2F5FA 1FPQA 3WTXC 4CDGA 1JJ6C 2QBYA 1ETKA 2TCTA 2UXNA 2Y31A 2JRTA 4BY1J 3EUHA 3V8LA 2BXYA 1IZ1A 3TOAA 4DNCA 4RM2A 4IVNA 1SAXA 3F8MA 3U2RA 1DPRA 2ZNZA 2LBFB 3DXJF 4EATA 5B66C 3PQJA 4M6YA 3PJRA 3HHHA 1HW1A 2PMZA 3V4GA 2XPWA 1IXCA 1R6RA 2LNBA 3S93A 5E18F 2BHZA 4N9HA 3T0YA 4QPOA 2QSHX 2LK2A 2EFPA 2X48A 4WK8F 2F2EA 4FASD 2LG4A 5ICEA 3H5AA 3PIOF 2A6EF 2QSGX 4ESBA 2K9MA 2HDWA 1FBQA 2G7UA 1S29A 1OMIA 3I56I 4LD5A 2WWYA 4CA0A 2XGXA 3BG6A 1UJ8A 1GXQA 1MBGA 5F04A 4FETA 1M1EB 4HEA2 4Y7NJ 3OYMA 4BJ6C 4C2TA 5D8LB 2B63J 4A2UA 1T56A 4IHSA 1B9MA 1Q1HA 1VQMI 1O3SA 2R7QA 1BJAA 5CVIA 2DLLA 3TMOA 3IRQA 4CYDA 4GRIA 1DGRM 4CO8A 3WU1B 2R7FA 1H9GA 3CO7C 3QP5A 2CJJA 1VQ6I 5L3CA 3ZCOA 3WTSC 2E71A 1YX5A 3S3OA 3OYCA 1D0YA 3I4NJ 2V1NA 1K6YA 3HRSA 4E7SA 4JX5A 4ENKA 2L9NA 3J7AY 4XN0A 3DFGA 2K40A 4MEXF 3KEQA 4PJMA 3JRIA 1ZTRA 3DBRB 1SFOJ 1IJWC 3TQNA 2W00A 4A3KJ 1TWAJ 3M8EA 5F6FA 1LFBA 1Y56A 4G6QA 2IRFG 4RM3A 4A3MJ 4DW6A 5FLXZ 5IT9K 4LGWA 4KT5C 4CYCA 2GXBA 3T8RA 3WU2C 4U0YA 4A12A 2XC7A 5JHFA 4BJTA 1TWHJ 1XSXA 1MMNA 2KIUA 5L3DA 5H6RA 4AUXA 3ASNH 2XRNA 4I01A 2ELJA 2P8TA 3AG1H 5FKMA 4B09A 1RNLA 1E0EA 3CLQA 2DN0A 5EEAA 3H0GJ 3GTQJ 3HRUA 2KP6A 2DOAA 1EKEA 1OKRA 1HQCA 1X2MA 1X1PA 1BR2A 1I6XA 4S04A 3GTOJ 2M45A 2WY7Q 3DQVC 3FMRA 5FKOA 3HJEA 4MEYF 3CJQB 2K85A 1LEBA 5E20A 4YELA 3GBGA 3V42A 5HS9A 3WGHA 1WPKA 2RNJA 4M6XA 2VN2A 1P4WA 1ZREA 1P2FA 2PI0A 4YIFA 4HPQA 3OV8A 1MZBA 3CMMA 2JRMA 1MH3A 2COMA 3DPUA 3EPZA 2HS5A 4UV8A 4KITB 5JVGF 2I5UA 2D2WA 1FWZA 2P6SA 3X2QH 2WAFA 2V4JC 4AIKA 2H1LA 2M4GA 3EDPA 1YJWI 5JI6A 1WGXA 2DFIA 4C3HJ 4UUSA 2E1MC 4EVIA 3TDZC 2OQGA 5IP9J 1N75A 1W4MA 3FM5A 2ZB9A 3KP2A 1HW2A 4PSWA 1JTYA 5EZGA 1VQ8I 1RR8C 4D9JA 3HYIA 1L0OC 2FEZA 1WWXA 3H36A 4ABZA 1UELB 4L5IA 3BG9A 3OYJA 4IO9F 1A6QA 3M3YJ 4CCKA 2ME6A 3M07A 2ID3A 5B5EC 2ZO4A 2LP0A 3K4BA 4YFNF 4AIHA 3M7GA 1DP7P 4DOZA 1X3WB 3CJTB 3F72A 3GTJJ 3TEDA 1KU9A 1O4XA 1GUUA 3OIPA 2V9PA 2DJIA 3WE3A 4LLLA 2W1OA 2DO7A 4D1QA 2ZMEA 1ETWA 4ASNA 4ZTJA 3H35A 1ZGWA 2K5CA 3CESA 2CUFA 1A36A 2IJLA 2EPFA 2QQAA 2DA3A 3ZQLA 3RZOJ 2XB0X 4A6EA 5J47A 4HYEA 2IP2A 2PJRB 1RKTA 2CGPA 3VYSB 4DYRA 2VJ4A 1S9HA 5M5YJ 5L3EA 3GX4X 2RDPA 4UVAA 3GW2A 1LFUP 2VL8A 1ZKGA 3CCQI 4HX8A 2DMUA 2KJBA 5TRDA 3D5LA 2X0LA 1W0UA 4V2GA 2DXIA 1HKTA 2QGUA 4LB6B 4JX4A 2OC6A 2QYOA 3WODF 5FD6A 3IL2A 5F27A 2D5VA 2JWTA 2ELKA 4IRHA 1H89C 2VQLA 1XD7A 3RSNA 2WAEA 2DYSH 3MEXA 2CW7A 2KFDA 1QVUA 1G3TA 1OPCA 1W5CC 3PFYA 2L5QA 5DEQA 3HGGA 5DDGA 4RGUA 5JVTA 4E6KG 2XROA 2KMUA 4M71A 4XKVA 4E4HA 5FB2A 3BLYA 3KYLA 1X3UA 2NOJB 1N78A 1MMDA 1ORKA 3DPTA 2OCCH 3MZHA 3C3WA 4GXOA 5CVRA 1ODDA 1A31A 1E3PA 1V5FA 1KQ9A 1ZQ3P 2RVCA 3GTKJ 2ZXIA 3E6CC 2KJCA 2JA5J 1X1BA 5D5VB 2ACJA 4BHPA 2JVGA 4MGRA 1LPQA 4MFDA 2QKLB 1HC8A 3AG3H 1R4MB 3BY6A 3CJNA 4CYCB 1Z9CA 3L2CA 1X1CA 4A3FJ 3P9KA 5DV5A 1H88C 4AU7A 2E19A 5M5WJ 2E1NA 2F4MB 3ESWB 2VQHA 3WGIA 2EV0A 5M3FJ 3E5XA 3KE2A 3S2DJ 1OCCH 1L3LA 1WJCA 5H20A 4GYGA 4P9UA 2M7BA 2VKDA 3PL8A 4NQWA 2M34A 2M8EA 5EEHA 4OWRB 1RI7A 2PN6A 2CUZA 4M3BA 2E1CA 2V1UA 2F5VA 4F52A 2VKVA 3E6MA 1TT0A 2XRLA 1IN5A 3L2QA 1BN5A 2WB1A 1FY7A 2O61A 1QQIA 4M72A 4A0YA 4M3GA 1NH3A 2V6CA 4ETSA 5ICCA 3SDGA 3QOEA 5JR3A 1BW6A 2L02A 4B48A 4DQ2A 5DM6F 2EZLA 2M8GX 2R7SA 1FLIA 2XF5A 3P5JA 1QU3A 3FXMA 2K27A 1R22A 4LMYA 2Q0OA 3EYYA 3QODA 2E7WA 2ECBA 2K4BA 3WG7H 2DOFA 3SEQA 3JCUC 3L2RA 1LB2A 2K86A 1ZG5A 4DIQA 5GTHC 1MD0A 1WH5A 4XOTA 5DUKA 3GZ6A 4QSHA 1T38A 2E2HJ 4GCVA 3S15J 1T8IA 5J8FA 4IZZA 1ITYA 5GTIC 4BAYA 3CTAA 3IV5A 1U8RA 3DKYA 2WTEA 5LGNA 4BACA 5JLXA 3GLLA 4NQWB 2AXLA 5JLWA 2R5YB 1B8IA 2FRHA 1RESA 2CW8A 3BZCA 2D45A 5E3NA 3BC8A 3G4SI 1JUSA 2DQRA 2W84A 1DU6A 3MFKA 1JKRC 1XGNA 4ESFA 3LQRA 4BH9A 4YIRX 3QWLA 3VEPA 4HF0A 5F0FA 2EFQA 1X4OA 2P4WA 1X3ZB 2VJJA 1Y1VJ 1WKMA 2BBYA 2COBA 2PJPA 4W97A 2XGCA 2MFZA 1B59A 1OISA 2DA6A 5HNFA 1TT5B 2GXGA 5F08A 3W2WA 4ZYDA 2E35A 3I4PA 4KIBA 4L9TA 5FLMJ 4A3JJ 3JSPA 5FKKA 2HVRA 1F43A 2CQ7A 2VUMJ 4I76A 2FU4A 1JHFA 3FXOA 1YLFA 5ICFA 4YIIA 3CCEI 5E1ZB 3OYHA 4G8XA 2Y2ZA 2E1OA 2EZHA 3O6BB 1T95A 2J5OA 3BT9A 1VQ4I 3W3CA 1P6RA 4XL9A 5HDGA 1VQOI 1YITI 5EG0A 1YJ9I 2FMYA 4A3GJ 1NTCA 2EFNA 2IA1A 2R7WA 4S05A 4UUVA 2FE3A 2XPVA 2EH3A 2MC3A 1POGA 1GV2A 2DDBA 2ZFUA 3G73A 3OR1C 1TNSA 4KFCA 1SD4A 1FSEA 2QUFA 3LA3A 1I27A 2R92J 1E3OC 3GTGJ 2N8GA 2QZ8A 2IGOA 1D8KA 3BWGA 4XBFA 1YW7A 1B9NA 1TWCJ 2KIQA 1IC8A 4QIWN 3ZMTA 3I64A 5IYBJ 5LLQA 2WAQA 3R0AA 2OD5A 5LFAA 1FOWA 2XKOA 2A68F 1FP1D 1ZGJA 3HOYJ 3JRBA 4J00A 2ELHA 4CUGA 2DJNA 2CQKA 2W48A 3HC7A 2NAZA 2R7TA 1F4KA 2OBPA 4UB6C 2GLOA 1T98A 2CUEA 2DW4A 2QQBA 5K5QA 1HSJA 3RKQA 1X2NA 2D1HA 3ZQHA 2HU9A 4ON0A 2B9SA 5FLXK 1GV5A 2CU7A 1ETYA 3GLXA 3OYEA 2CW0F 3QRFF 1YTYA 4G7HF 3SFIA 4XMYA 5HODA 3NWSA 4BYYA 2FMLA 2E5NA 4MQVA 2VPRA 3E7LA 4BJ5C 1QZZA 1HF0A 5LGUA 3KYDB 3SZTA 2H6BA 5IY5H 2VT3A 1AU7A 1FYMA 1GDTA 4JP0A 3DU6A 2K7LA 2UZKA 5B1BH 4RLQA 1VNDA 2JUGA 4XRMA 2PX9A 3PIPF 3CCJI 4I7HA 1J2XA 4AIJA 3GFJA 2DPDA 4PFOA 3CUQC 2OPTA 4ENMA 2WB1N 1TZLA 2DFEA 5CJ9A 4LLGF 1JGSA 1XGOA 4LK1F 1ZR2A 5DCMB 4F55A 1FBUA 3ASOH 3K0LA 4IOCF 1K78B 4UUSB 1OYYA 3GMEA 2R5ZB 2NRAC 2HZTA 2Z9OA 3EYIA 2XGDA 1QA6A 1Y8QB 3PNVA 1JGGA 3T1BA 3CUOA 1Z67A 4WXDA 3VYTB 4G7ZF 2BXZA 2ZJQF 3LSMA 2JSCA 4IHWA 1Y8RB 2K02A 1S6LA 4G6DA 4OINF 4KDPA 4RBOA 5AIQA 1MBHA 4HF1A 3MMYB 3ZRGA 2HVQA 5CVJA 2CQQA 2EZKA 4I2OA 1T39A 1Z1DA 1GXPA 3ULQB 3O3KA 2HFHA 1P92A 3M8FA 3BCAA 3A0HC 4R1HA 3JRCA 2PJRA 1JKQC 3KLNA 5CKTA 3ZMSA 4C3JJ 1S5LC 3S1QJ 3FZVA 1IV8A 1V5EA 3OOPA 5DCMA 4CGZA 2QENA 2UUZA 2V1DA 2IA2A 3Q0VA 4BQAA 1PUFA 1W5TA 4AYBN 1VQ7I 1EJ9A 3H3VK 1I6HJ 5FGMA 1V55H 5EEGA 5C44J 3SJMA 3E6DA 3KZYA 2O5RA 4LG0A 3OOUA 2FUG2 4A5NA 2MLGA 1BOBA 2OCEA 2QF7A 1LVKA 2BW3A 3CO6C 4C2UA 4X1EA 3UNGC 4BL0B 2RKHA 1YO5C 3TL4X 2V79A 2GIZA 1MBJA 2L54A 4RB2C 2CYYA 2Y69H 4FHTA 4H4KC 3HGYA 2R0QC 4BXXJ 1TBXA 3RQ4A 2A6HF 5ERIA 2O0YA 1SFKA 1WCMJ 2KRHA 5E1XA 1U8BA 2OJED 3KP6A 1HDDC 2M5WA 1A6IA 4Y17A 3CC7I 4MHGA 1PJRA 2XHKA 4HW0A 5M3MJ 3N97A 5A2QZ 2Z99A 2X6YA 1KQ0A 2X1CA 3F22A 2CQXA 1OCZH 3Q9VA 1E17A 1B1BA 2LDUA 2QWWA 4KA4A 3BG7A 3NRVA 4ZDPA 3KX2A 4QTRA 1J7KA 2E2JJ 1FP2A 1EH8A 3BR5A 1RUNA 1FIPA 3VFZA 2O9LA 5K7HA 1EH6A 2EIMH 1TQIA 4BU2A 5BPDA 2O8XA 2K9QA 4UHTA 2AHQA 2NS8A 2KHMA 3I53A 1TQPA 2WC2A 1FTZA 3HOXJ 4XLPF 2BGCA 1YOVB 1GLNA 1JE8A 4XSXF 2HPMA 3JTHA 2AXTC 2VC1A 3ZMZA 3PO3J 2ZNYA 3ZGKA 4CCOA 2NS0A 4HG2A 3H92A 1IN6A 1XGSA 2ESHA 4CH7A 4M3EA 4C30A 2KT0A 1IN4A 3M4OJ 1USSA 2BY3A 3D5RC 5DTDA 1ZAOA 2X6XA 4GO1A 2IA0A 4RMNA 4ZJZA 4GFBA 4LG0B 2FBHA 3BOQA 2BOLA 3IKVA 4XOPA 2HOTA 1R5ID 3GFMA 3DV8A 3OYFA 4IL6C 2GXAA 3FXUA 1U5TB 2QBYB 5GP9A 5KVRA 1BC7C 3BR2A 3JRFA 2A6TA 1JUMA 1T0FC 1Z7UA 2YX4A 1D1BA 5D4RA 2YX7A 3OSGA 2F5DA 4P1WA 3OS0A 3TW6A 3LOCA 4RGRA 3U1KA 1UB9A 3J80Z 4LG3A 2EWNA 4IRGA 4PGGA 1LE8B 4U7DA 1X58A 1R58A 2OA4A 4MTDA 1H8AC 4AC0A 4NC8A 2TRTA 1PYVA 2B7EA 3C2BA 1W7PD 3JTGA 2E1MB 3ZMVA 1E2XA 3S14J 4JK1X 2DT7B 1RKWA 5FD5A 2FD5A 1JXSA 3BZ6A 3IUOA 4M6VA 2OAZA 2Z16A 3HOUJ 2OZUA 2H27A 2JMWA 2J5PA 4U0WA 1AA7A 4CSWA 1OYWA 2XAQA 3C18A 3ELKA 5LBQA 1D1AA 5DS9A 2EFOA 2AQFA 4WXCA 2M4KA 1FT9A 3NAUA 5FLVA 3WHCA 1Z77A 2DODA 2L0KA 5H6QA 3MVPA 1IAWA 2ZXHA 2VKEA 4HNUA 2O7OA 4JX6A 4P55A 3GFLA 3DEEA 2CSOA 3S2HJ 3K6GA 3VYRB 4DYQA 3JAMZ 3HSEA 1BA5A 5CYVA 3FHNA 4HRIA 2QKMB 3JRAA 5EJCA 4BY7J 1MDMB 3FXLA 5HLIA 2EK5A 3ISPA 3P9CA 4N9IA 4OMYA 3RJPA 5C4JJ 1YYVA 2X1EA 3HOWJ 4DGWB 3FXKA 5H2FC 2BV6A 1YQAA 4P96A 3BQYA 2VXZA 1R36A 1ZELA 5BPIA 1RC9A 3BR0A 3CP8A 1KU7A 3GUDA 3COAC 4KNYA 2JN6A 4K2EA 3CCYA 1BL0A 4Z2YA 5CLSA 2IBDA 4MO7A 3ZN0A 5K7ZA 3F3XA 3RYPA 2QSFX 3CCMI 4M73A 3ZQFA 1MKMA 1FYLA 2YSRA 3FK6A 4WF2A 3A01B 3M9AA 4HLXA 4FE7A 1EH7A 1YIOA 4ZYAA 3TP3A 3LQQA 2ZSIB 3CZ6A 3N05A 2MBFA 2OV7A 1ZG3A 1RIOH 1NK3P 3O2PE 4CICA 3HZJA 2PMZN 5C4XJ 2FNPA 3LAJA 2KRFA 3I4MJ 3VWBA 3LL7A 4IPAA 3KETA 4E70A 4U87A 3MQ0A 1XB4A 2P6TA 3BROA 3MZYA 1SVMA 1W7PA 3DKXA 3JSOA 2HYJA 3ABTA 5EYRA 1IG7A 3R61A 3F8BA 3K69A 2DK5A 2XUBA 2XIGA 1VQ9I 1EV7A 1C0WA 2E7XA 2EJRA 2LY9A 2VI6A 5DCFA 2O8KA 3H0DA 3Q5FA 3GTLJ 4EM1A 2F5CA 5DD8A 1Z3XA 4L9NA 3RI4A 1T33A 4MQ9F 2IGNA 2LKXA 2NYXA 5FRMA 3AG4H 2F6CA 5DD4A 2H94A 2Y0MA 3DWLE 3K2AA 3EUHC 3DLAA 2QA4I 1XPXA 1ZLKA 2KIFA 1XCVA 3A1YA 3T5XA 2P7VB 4HDUA 1U6GA 1A04A 5GPAA 5E3MA 1K6OA 2K3FA 2XKPA 5IOYA 2E60A 2DMTA 4XLNF 3S3MA 3AL0B 2KL4A 2VE9A 1I39A 4U7BA 5L3GA 3A2KA 3GTPJ 5D6FA 1J59A 2JZYA 3DEUA 1E3HA 2LRDA 3IWZA 4CCJA 2A69F 1LE8A 5K5OA 5TGTA 5J6XA 1QNTA 2LOOA 1Y1WJ 2Q2EA 4P5OA 2K9SA 1QPIA 3TO6A 1ZYRF 5K7FA 2IVMA 4RAGA 2RNGA 3ABUA 1XX5A 4XIDA 2IW5A 5D5UB 3QPSA 4B47A 4I0AA 2WAQN 3GCMA 4ZYGA 4M3DA 3RYRA 1LDDA 3P7NA 1WJ5A 1G3WA 3H3ZA 3OYDA 5E17F 1TWGJ 4C2MJ 3KP7A 1IN8A 1P4AA 2LTPA 4NC7A 2L9VA 2R7VA 4HNTA 3OY9A 4IQJA 2LYCA 2IGMA 3H1CA 1TC3C 1J5YA 2ZC2A 3BJOA 3RZDJ 3CUQA 1RUOA 4O5VA 5BMZA 5HDKA 4IHXA 1ULYA 3OL3A 1TW2A 2O03A 2O3FA 2IS1A 2DT5A 2JA7J 2LF8A 4HV6A 4IF4A 1W0TA 1J09A 1R71A 1BM9A 3HSFA 1BI3A 2HDDA 2CO5A 1ETXA 2H8RA 2R7RA 2JPCA 3RPUD 4BXFA 2BY2A 3FISA 2IAIA 3I3LA 2XGEA 4FE4A 2CUJA 2OZ6A 3EQLF 4IJAA 2PEXA 3ABLH 1SC7A 5FJ8J 3ONQA 1O57A 1T6SA 3U1DA 3N4MA 1DPUA 4FX4A 4XICA 4XNFA 3I0TA 3CC2I 1QZYA 1T0FA 5J4YA 5J3LA 4M9ZA 1K83J 3H5RA 1F36A 3IHUA 1TNTA 4QLCU 1OJLA 1W1WE 5J40A 1MMGA 2RGVA 5IT9Z 2VBXA 3OS2A 2L4MA 4AIDA 2LREA 4KIFA 2VKHA 3M1CA 2Y9YA 3OYGA 1WJAA 2HGCA 2F48A 2Z2SB 4QPQA 2ID6A 3FIWA 3V7SA 2MA3A 4IHVA 1HKSA 3RDIA 1YW8A 2R7XA 6PAXA 2GIVA 1A35A 4KMUX 3KP3A 1Z05A 3LA7A 2VBZA 2RV8A 2ECCA 4XONA 4XQFA 4IKFA 1ZR4A 4E7JA 4NDLA 3TDUC 2MLKA 1QHHD 1ZGAA 2GOMA 5AONA 1SVLA 5E3OA 1KA8A 4I6ZA 4WWCA 2DMNA 4D5CA 3PSFA 2X1DA 5IP7J 2OU2A 3JAMK 2UXXA 1X1AA 1VZ0A 2L3DA 3BTJA 5GAGJ 2ZJ2A 2JSPA 3CCVI 1DQUA 2LVSA 1S8NA 2NS7A 4UNOA 3I55I 2VOPA 4ZYEA 1WI9A 4GDFA 2STTA 3QPLA 2X9DA 3GWZA 5KAFC 3SHFA 2M9HA 1ETOA 3BQZA 1JT6A 1O3TA 4ITVA 3RIRA 1IUYA 3CF2A 3FMQA 4B4CA 4OIQF 3SZPA 2BY1A 1RETA 3VYUB 4YRVA 3L2VA 4I98B 4KN4X 2RREA 2L9RA 1HSTA 3BP8A 4BE0A 3RPUA 3DP7A 4OU0A 3W6JB 3VB2A 3QU3A 3PQKA 1IRZA 1T08B 4KMFA 1BI2A 4N4OB 3RKXA 1N77A 2MC4A 3HUGA 1X19A 3VSKA 3E5QA 2GAUA 1W7PB 2X4HA 2IGKA 5FRNA 1MSFC 3EETA 1OCTC 4OAZA 3L7WA 5D5XB 4EM0B 5LRSA 5E3LA 3K4NA 1JUPA 1KZHA 5L3FA 2AO9A 4A0XA 3G1MA 3LFUA 5K1YA 4A3LJ 2MW8A 2VQCA 3G1OA 2H1KA 3QU6A 1BJZA 3H3UA 4XK4A 3B73A 3FMSA 5E79C 3DTEA 4RB3C 4Y3OA 1BIAA 2XV4S 2MYSA 4ESJA 1D3YA 2E36A 3S32A 2L7FP 3OIQA 3T8TA 1F9NA 3DTIA 3TOBA 2JA6J 1D8JA 1B4AA 3GZ5A 3IC7A 4BS9A 1F1ZA 3WTYC 4E7HA 2CV2A 3IAS2 3G6EI 3KEOA 4BEHB 2R93J 1VF9A 3S17J 4KUMA 3HXLA 4XLAA 2MG4A 1JTXA 2VQGA 1TW3A 1VI0A 2DOEA 3IH3A 4DYCA 2EIJH 2QM3A 2L7KA 4I09A 2A3SA 4E7ZA 1SD5A 4UVBA 2IS2A 3F23A 3Q3SA 1MGTA 1MDMA 4EQQA 1WVRA 3LMMA 3S3NA 1XSVA 3BPXA 1SAUA 1VTNC 1A5JA 1I1SA 2E2IJ 5IYCJ 2D1VA 1WQ2A 4H0EA 5EZHA 5LEJA 3FDYA 1MJBA 4B1RA 2NVTJ 5KCMA 4XLFA 2VJIA 1LQ1A 4PJNA 5LHGA 2HQAA 2K4JA 2XF6A 1U5TC 3DCFA 5EGOA 4PZJA 5BQTA 1IXRC 2M30A 4MLOA 1DP3A 2P5LC 1KU2A 3E97A 1MNMC 3DBLB 2XF7A 1BR1A 3WE2A 2KZGA 4Q4ZF 1FEXA 2KKOA 1JKOC 4G9YA 1YFHA 3G1LA 2FJ1A 4BBSJ 3CCLI 4XN3A 4RA2A 3G71I 1IRGA 4ANJA 3RKWA 4M74A 3M8JA 2ZKZA 4U88A 3LFKA 2BHYA 3W6KB 2KRCA 2L2OA 2CS3A 4DJAA 2JA8J 1TQMA 3V7RA 1V54H 2VXDA 2JTVA 1IN7A 4PSXA 4PJJA 4Y4RA 1OLTA 3JW4A 3ZQQA 5ILUA 3A4CA 1R1VA 5FFXA 2XAFA 4EJOA 1MJAA 2NNYA 2XDVA 1YW9A 1MMSA 1TP4A 2QLZA 3FKJA 3KYCB 4V2FA 5KK1A 2G7HA 2FBIA 3LSRA 3J81K 4MTEA 2Y30A 1SEUA 2FXAA 3ZQIA 2LY1A 2ZFWA 4A3BJ 2K9LA 4L9VA 2C6YA 5CPRB 1AOYA 3H9GA 3S8PA 4YFXF 3GYHX 4NUBA 1HW5A 3MKZA 3OYBA 1BOAA 2KISA 5F1RA 4G94A 2JVHA 3ECHA 3NARA 2ZJRF 3O8GA 1YS7A 3OYIA 3OR2C 4XLEA 1R49A 1UHWA 2QEXI 1WJFA 3A0BC 3B6CA 2CRGA 1J0RA 4S0HB 3SQNA 1GVJA 2VC0A 3MWMA 5J8CA 3S16J 2LR8A 1QHGA 1APLC 4J19A 1MNEA 2O6GE 4X6AJ 2DMQA 3ML6A 3L2WA 1K61A 3G3ZA 3NEUA 4XKBA 3IKTA 1G4DA 3CMYA 3M1EA 2F5EA 4JYKA 3IAM2 3L09A 3CCSI 1V4RA 3MD2A 3HRMA 3IH2A 4EEFG 3ROUA 5HS7A 2M7AA 4BKXA 4PGHA 1SMTA 3G2BA 4UVCA 2EZIA 4M9SA 1U78A 2WBMA 1HCRA 1R5GA 2DA5A 3GVAA 5EF6A 2X51A 1Z21A 4OIPF 4A93J 2GZWA 3H9QA 2EB7A 2P5VA 4WXHA 2V7FA 4L9JA 3HHGA 5JHUA 2MD0A 2HVSA 3FXRA 5HDNA 3I59A 4B3XA 3K1NA 1XSDA 2Q1ZB 1S72I 2A61A 3OYLA 1PP8F 1Y0UA 2CV0A 4KISA 1STZA 2ZXWH 3ERMA 2WADA 3QAHA 4LK0F 2E5ZA 3BR1A 4Q47A 2P5KA 3D0SA 2HTSA 4BDZA 3KP5A 5L3BA 1P9QC 3D1NI 1IDZA 3BPVA 1K79A 1OCRH 2DTZA 4EV0A 2A05A 1GT0C 4LIVA 2EA4A 2HDCA 4R8HA 1W5SA 4L5EA 1UCRA 4FCYA 2I8DA 2W24A 3F0CA 2E34A 3OSFA 3ZP5A 5DM7F 1BW5A 1MIJA 2XPUA 2OQRA 2EA2A 3WU0A 5LHHA 3BR6A 1WJEA 3PM1A 2ADUA 1SFEA 3CCUI 1P4XA 2OUMA 2QQ9A 3BTCA 4A3IJ 4PFPA 1BR4A 2JUCA 2Y0SA 3HTUA 2AS5F 1IUFA 1O7LA 1Z0XA 2HOEA 4XLHA 3K2ZA 1B6AA 4V19K 1YRNB 1OCPA 1LUJB 3W2AA 2DMPA 3CC4I 3FBNB 1Y39A 4ZTFA 1I5ZA 1KQ8A 2Q2EB 4XRSG 2YS9A 2XAUA 3DU5A 4F91B 1PVEA 2B0LA 4KN7X 2W57A 4XRSA 1CGPA 1UHSA 3HEFA 1G6NA 1QVTA 3V7CA 4E7LA 4RGXA 2X6OA 1I1GA 3F9KA 3BDDA 4HOBA 3E3VA 2MGQA 5E1WA 4ENJA 4OOIA 4XR6A 1OYIA 3WTUC 2M0CA 1Z6TA 1BI1A 1QRYA 3HUGB 1P7IA 1UZCA 3TP0A 1K4TA 2IS4A 4Y33A 1HDPA 2LFBA 2FBKA 1OR7A 1QO0D 3GO5A 3LSKA 3QP6A 4XORA 3SZGA 2MSYA 3PSIA 4Q48A 4UV9A 4W1UA 2M0MA 4L0YB 2NOGA 1TWFJ 2L4AA 4B8XA 1SD7A 2DA2A 2P81A 2HTJA 2JT1A 3LNQA 2K9NA 4HZFA 4CCNA 5DUIA 2OTJI 2R5ZA 1UMQA 4AWXB 1TLHB 2L01A 5J4VA 1IDYA 4OAYA 5BOXA 1WFXA 1LFPA 3AG2H 2FOKA 5HLHA 3CJRB 4XLCA 1XGMA 1UHMA 3GFIA 4E7IA 2YU9J 2Y48A 2Z5UA 3I71A 1AKHB 2Z1DA 3QQAA 1OCOH 5JFRA 5J1RA 1Z91A 5E8IA 3I54A 4NBQA 1CF7A 2M1BA 2PBIA 2HEOA 2DYRH 2XASA 1FSHA 1D0ZA 2V9VA 1FYKA 1B72B 1U3EM 5BS6A 1YRNA 2FQ3A 3ABMH 2GA2A 2JJ7A 3QPHA 1HXDA 2PG4A 1D5VA 4NB5A 4RDUA 2RN7A 4JOMA 4XM3A 3PUBA 4O3MA 4IEJA 4IXAA 2ZMEB 4ZYHA 1XDSA 4FQGA 4PJ0C 5F64A 2CG4A 1MJ9A 5GADJ 4G7OF 2HXIA 3S1NJ 3A03A 2YR2A 2FX0A 1YS6A 2KIMA 2Y9ZA 1BI0A 3CD6I 1HA8A 3S1MJ 4IHYA 1G2HA 3FXQA 1YI2I 4D0PA 5ILSA 3J80K 5KAIC 2MABA 4AVPA 3ZQCA 1AKHA 1VQPI 2GBYA 4BUPA 4XSZF 5IPAA 2VODA 2GOXB 3L00A 3AL0C 3BG3A 1U0JA 1YE9A 2CQNA 2RAEA 2G9WA 4BQOA 3KLOA 2V26A 1S7EA 3J7AO 4II3A 5F0HA 1WRJA 3I59B 2P7CB 1ZARA 2GWRA 4OIOF 2H8WA 2BZTA 4R79A 4NNJA 3K4MA 1YIJI 1RRJA 2VB6A 5B1AH 3CP2A 2R4GA 4I0BA 3HIFA 4HX7A 2RQQA 1JI8A 2XB5A 1V3FA 2WV0A 1HBXG 4GYIA 1N25A 2H09A 3I58A 3IH4A 1UG0A 1DUXC 3QPTA 1FOKA 5CVUA 1QPMA 1ZK8A 3GEZA 2LLKA 3TO9A 4X0GA 4ZC3A 3F6VA 2V1XA 2YU3A 4HNVA 2R3SA 4J01A 1W36D 1UAAA 1LEAA 5CQEA 1D1CA 2JK3A 2LC2A 2L7MP 1YG2A 2GQQA 3KCCA 3WG9A 1DGWY 1X1DA 5IT3A 1ZH5A 3K4CA 4I02A 4M3FA 1WJDA 3PO2J 1G8XA 3LAPA 4MNUA 2V6EA 1WZ2A 3JRDA 5TISC 4HX4A 1JT0A 4WX9A 3K1PA 1XMKA 1FOYA 4AD9A 4D7MA 2AQEA 2Y0SN 4G6TB 1U5TA 2M3AA 2ZCWA 2W25A 2L7ZA 2VPLA 2ESNA 5D6EA 4ENNA 2HOAA 4NHJA 4AM3A 1R4NB 4LB5A 2GA1A 3NWTA 2HPIA 2CMPA 3MAJA 3C2GA 2HQRA 3DPLC 3I9V2 2VE8A 3KZIC 3JREA 4C3IJ 2ME0A 3W2VA 2R7DA 1Z3YA 4DZPA 2HZDA 2ZMEC 3VDXA 1KGSA 1B8IB 2LSOA 4EMSA 3DKWA 1AHDP 1RR7A 3OS1A 2EILH 4RAFA 2DBBA 2ISYA 3FKIJ 1IRXA 5J1UA 1ONVA 4BGDA 2DTRA 4LLNA 3KP4A 3HDDA 4PCQA 4HSTA 2W82A 3JRGA 3HG9A 4UY8I 3V8JA 2W7NA 2DPUA 2HWVA 1ERDA 1XMAA 3GZNB 4OMZA 3LSPA 4B44A 3C2HA 3SEZA 1SMYF 1YX3A 1EF4A 3ERED 3WTVC 2KLOA 2KQRA 3E1SA 5AIPA 3HL2A 1K7AA 3KPHA 2G0EA 2ZXJA 2JQ7A 2R7OA 4BHCA 4QWQA 2XAHA 4XKWA 3BTLA 2IPQX 4LITA 3CF5F 1ACIA 3VOEA 3UR3C 2EIKH 2NVXJ 3CDLA 5BNGA 1Z6RA 4EGYA 2BY0A 3FM3A 3RCOA 2F4OB 5LEKA 4P9FA 1DDNA 3FK7A 2VT2A 2EQRA 3IWFA 4I99C 3OWTA 1Y6IA 4PUSA 1FNNA 4BDYA 2HXOA 2IS6A 3E5UA 4DBQA 2K3PA 3ZN1A 1PP7U 3K9TA 4ZDLA 2BVMA 3A01A 2I10A 2UV1A 4A5MA 4HSRA 3MCZA 1QBJA 3VSLA 4CZZA 1IF1A 2DFFA 3RTRA 3WTTC 1TL8A 1XS9A 3HB9A 1P7JA 3CDIA 2FF4A 4LOCA 4BXUA 1DU0A 4UXNA 1WH7A 4PK4A 2RC4A 4B3AA 1ZG1A 4II2A 1WI3A 3KZZA 4EGZA 5ED4A 1G3YA 3SDBA 1FJLA 3K4LA 5M5XJ 4IHTA 3LA2A 3HKZA 2Q8KA 3KEYA 5D5WB 2DA1A 2LBFA 1BC8C 1Z7LA 3HPHA 2H6CA 5HVQC 4LIUA 2NVYJ 2GM4A 5DYMA 1AWCA 3BTIA 3J7YJ 3RKYA 5E8GA 2BYVE 1QZEA 3FXJA 1FMVA 1OFCX 4HLYA 1VQ5I 4HA8A 1USTA 2UWMA 1O7FA 3K7AJ 3OYKA 3WTZA 9ANTA 3R60A 5CVVA 3F21A 3ECOA 1R1TA 5HS8A 3RQIA 4CCLA 4LJZF 4L5JA 2LD5A 3AAFA 1GHCA 2LY2A 4ZH4F 2VASA 5HLGA 1YJNI 2FA5A 4RB1A 2QVOA 3J7ZI 5KNLA 3CMEI 5HLTA 2HOSA 1UG2A 3B02A 4ZZDA 3OIOA 3ZQ7A 1PDNC 5IYDJ 3JRHA 1H0MA 1KU3A 2VBYA 5F1JA 2VONA 3FBIB 1IXSB 1MH4A 3QYBA 1IW7F 1EA3A 3Q0WA 2LKPA 2VIXA 1KONA 2ZBKA 3EUAA 3D5SC 1UFMA 4NC6A 5FROA 3PFIA 3PUFA 3QOPA 4BHBA 1K4SA 3QYFA 3FF5A 2BE5F 3JR9A 3V8KA 4KIGA 4A3EJ 5A2QK 4HAMA 1Q1VA 2YUSA 5HNHA 2IT0A 2DT6A 1IGNA 1LVAA 1NG7A 4RS8A 3DEWA 1Y0NA 3LSGA 3KFWX 3DTKA 3DBHB 3I5UA 3RPQA 1IRFA 4A3DJ 5KHDA 1NK2P 2LKSA 3S1RJ 1VQKI 1VQLI 4Q5SF 3LWFA 5ICGA 2DU9A 1RPWA 4BEHA 4BE1A
chains in the Genus database with same CATH topology
5GP9A 1ETWA 3BR2A 3JRFA 3NARA 3O8GA 1JUMA 1ZGWA 3B6CA 2CRGA 4S0HB 2CUFA 1MSEC 3OSGA 1B72A 3S16J 4BBRJ 3ZQLA 2DA3A 2LR8A 3LOCA 3TW6A 4J19A 2XB0X 1APLC 3RZOJ 4X6AJ 2DMQA 1K61A 1RKTA 1LE8B 4DYRA 5M5YJ 3CMYA 1X58A 4JYKA 1HLVA 2DA4A 1H8AC 1LFUP 4AC0A 3HOVJ 2TRTA 3C2BA 3IH2A 1ZKGA 2R7ZJ 2DMUA 4EEFG 4BKXA 1W0UA 3S14J 4V2GA 2EZIA 1U78A 1RKWA 2FD5A 1HCRA 2DA5A 4JX4A 2WV1A 4M6VA 3HOUJ 1ETQA 2JMWA 5EF6A 4D7NA 4A93J 5F27A 4A3CJ 2D5VA 2JWTA 2ELKA 1H89C 3VPRA 5DS9A 1XG1A 1MBEA 1QVUA 5GPCA 3NAUA 3HGGA 5FLVA 3WHCA 1Z77A 2L0KA 3MVPA 2VKEA 2O7OA 3BR3A 3BR1A 4JX6A 4UUTA 4A69C 5EG0B 1ORKA 3S2HJ 5IP6A 2IEKA 3D1NI 1R9TJ 4DYQA 1IDZA 1HOMA 1BA5A 2DTZA 1XC5A 1GT0C 1MBKA 3JRAA 1ZQ3P 1IV6A 4BY7J 3GTKJ 4L5EA 4FCYA 5C4JJ 2JA5J 1MBFA 3F0CA 3OSFA 1BW5A 3HOWJ 2XPUA 4MFDA 3BR6A 4CYCB 3PM1A 4A3FJ 3BQYA 1H88C 3BR0A 5F0CA 3BTCA 2JN6A 4A3IJ 3CCYA 1PUFB 1BL0A 2E19A 5M5WJ 2IBDA 4MO7A 4D5FA 5K7ZA 1IUFA 1Z0XA 5M3FJ 3ZQFA 3S2DJ 1YRNB 3FK6A 1OCPA 3A01B 2DMPA 1CQTA 4FE7A 2R5YA 3TP3A 2M34A 4G12A 4XRSG 2YS9A 1GVDA 1FIAA 1NK3P 2XSDC 1JKPC 4M3BA 2PMZN 4XRSA 5C4XJ 1UHSA 3HEFA 2VKVA 1QVTA 3I4MJ 2X6OA 3WHBA 2XRLA 2EBIA 2MGQA 1IG7A 2HYJA 5EYRA 2M0CA 1QRYA 4M3GA 1P7IA 2LY9A 2VI6A 3TP0A 2O8KA 3MN2A 1HDPA 2LFBA 3SDGA 3GTLJ 2MSYA 1T33A 1BW6A 2LKXA 4W1UA 2EZLA 2M8GX 3BG5A 2NOGA 1I50J 1TWFJ 3GTMJ 2DA2A 2OF7A 2P81A 1FTTA 3LNQA 2K9NA 2ECBA 3K2AA 2R5ZA 1UMQA 1IDYA 5GPAA 5E3MA 5IOYA 2DMTA 1WH5A 4QSHA 2FQ4A 3GTPJ 1D5YA 2E2HJ 3S15J 1SANA 2YU9J 1ITYA 4MFEA 2HQ5A 1AKHB 3QQAA 4FISA 5J1RA 3IV5A 1LE8A 1JJ8C 1Y1WJ 5JLXA 5JLWA 2K9SA 2R5YB 3TW7A 1QPIA 1B8IA 1B72B 3HOZJ 5K7FA 1RESA 3UKGA 1YRNA 5E3NA 2QCOA 2JJ7A 4XIDA 1JUSA 1DU6A 1JKRC 4RDUA 3LSJA 3QPSA 2WAQN 5C3EJ 2DA7A 4M3DA 5F0FA 2HI3A 4IEJA 3O8HA 2NVQJ 1Y1VJ 2COBA 4W97A 2HXIA 1TWGJ 2XGCA 3S1NJ 3A03A 4C2MJ 2DA6A 2FX0A 3HKZN 5F08A 2LTPA 2Y9ZA 4DZJA 4A3JJ 5FLMJ 5FKKA 1F43A 1U9OA 3S1MJ 3HM5A 2VUMJ 4IHYA 1G2HA 4I76A 3B6AA 2Y2ZA 2E1OA 2EZHA 5FKLA 1TC3C 3BT9A 3RZDJ 3ZQCA 1AKHA 2GBYA 5EG0A 5IPAA 4IHXA 3BG3A 4A3GJ 1NTCA 2RAEA 1VFCA 2XPVA 2JA7J 2EH3A 1S7EA 1POGA 1GV2A 5F0HA 1I3QJ 3A02A 3MKLA 4MIMA 1W0TA 3HBLA 2R92J 2HDDA 1E3OC 3GTGJ 2N8GA 1ETXA 2H8RA 3Q0UA 3W6VA 1TWCJ 1IC8A 3FISA 2IAIA 3ZQGA 4QIWN 2XGEA 4FE4A 2XB5A 5FKNA 3CQZJ 5IYBJ 3IH4A 3ZOBA 5FJ8J 5J1YA 2M2EA 3L1PA 1ZK8A 2LLKA 4XICA 4FTHA 4HNVA 3HOYJ 3JRBA 5J3LA 2DJNA 2W48A 1K83J 1U9NA 1F36A 2JK3A 5EGOB 2L7MP 1ENHA 1OJLA 5EDNA 2GLOA 4M3FA 2CUEA 3RKQA 5IOZA 3PO2J 1X2NA 3ZQHA 2KDZA 4Y52J 2Y9YA 1GV5A 1ETVA 2CU7A 3JRDA 1ETYA 1JT0A 2ID6A 3FIWA 4IHVA 3SFIA 4D7MA 5HODA 1JJ6C 2VPRA 2Y0SN 3E7LA 1ETKA 2TCTA 2L7ZA 1HF0A 2HOAA 2Y31A 4BY1J 2ECCA 1AU7A 1GDTA 3JREA 1ZR4A 4C3IJ 4JP0A 4NDLA 2ME0A 1VNDA 4DZPA 4XRMA 1B8IB 5E3OA 4I6ZA 2DMNA 1AHDP 1RR7A 4D5CA 2XPWA 5IP7J 3FKIJ 5J1UA 2OPTA 3BTJA 2LK2A 2WB1N 2LVSA 3HDDA 2NS7A 2X48A 1ZR2A 3JRGA 3QPLA 2X9DA 4UUSB 2M9HA 1ETOA 3BQZA 1JT6A 3LSPA 2R5ZB 1EF4A 4B4CA 1MBGA 5F04A 2XGDA 1RETA 4Y7NJ 2G0EA 1JGGA 2L9RA 2B63J 3BTLA 1T56A 4IHWA 1IRZA 4RBOA 1MBHA 2NVXJ 3CDLA 5BNGA 2CQQA 2EZKA 3FK7A 2EQRA 1MSFC 1OCTC 2CJJA 5E3LA 1JUPA 2HXOA 3JRCA 2AO9A 1JKQC 3G1MA 4A3LJ 2MW8A 3I4NJ 3G1OA 4C3JJ 4XK4A 1BJZA 2H1KA 3S1QJ 4JX5A 2I10A 3A01A 2K40A 1XS9A 3HB9A 1P7JA 2L7FP 3JRIA 1ZTRA 4LOCA 1DU0A 3Q0VA 1WH7A 4B3AA 2JA6J 1SFOJ 1PUFA 4AYBN 1IJWC 1WI3A 4A3KJ 1TWAJ 1LFBA 3H3VK 1I6HJ 1FJLA 5M5XJ 5C44J 3SJMA 1VF9A 2R93J 3S17J 4A3MJ 4DW6A 4CYCA 2MG4A 3OOUA 1JTXA 2DA1A 1VI0A 3IH3A 4DYCA 2QF7A 4X1EA 1TWHJ 2NVYJ 3Q3SA 2GM4A 4AUXA 3BTIA 1MBJA 1OFCX 1A5JA 5FKMA 2E2IJ 5IYCJ 2DN0A 5EEAA 3H0GJ 3K7AJ 3GTQJ 3HGYA 2R0QC 5EZHA 4BXXJ 9ANTA 1X2MA 4B1RA 3GTOJ 2NVTJ 1WCMJ 5FKOA 3RQIA 1U8BA 2LD5A 1HDDC 3DCFA 5EGOA 1A6IA 4MLOA 1MNMC 3GBGA 5M3MJ 1WPKA 1FEXA 2CQXA 1JKOC 3G1LA 2FJ1A 4BBSJ 4QTRA 2HOSA 1UG2A 2E2JJ 3OIOA 1MH3A 3BR5A 1FIPA 2O9LA 5IYDJ 3JRHA 5K7HA 2K9QA 2AHQA 5F1JA 2NS8A 1WGXA 1MH4A 2JA8J 4C3HJ 3Q0WA 4UUSA 1FTZA 3HOXJ 5IP9J 2ZB9A 3PO3J 1JTYA 5EZGA 3JR9A 4A3EJ 4V2FA 1Q1VA 4ABZA 2YUSA 3BG9A 4M3EA 2KT0A 1IGNA 3M4OJ 3LSRA 3M3YJ 3DEWA 3LSGA 2ME6A 5DTDA 2ID3A 2Y30A 2LP0A 4A3DJ 3ZQIA 4A3BJ 1NK2P 4GFBA 3S1RJ 3TEDA 3GTJJ 1O4XA 2HOTA 1GUUA 1RPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GP9 A;  1ETW A;  3BR2 A;  3JRF A;  3NAR A;  3O8G A;  1JUM A;  1ZGW A;  3B6C A;  2CRG A;  4S0H B;  2CUF A;  1MSE C;  3OSG A;  1B72 A;  3S16 J;  4BBR J;  3ZQL A;  2DA3 A;  2LR8 A;  3LOC A;  3TW6 A;  4J19 A;  2XB0 X;  1APL C;  3RZO J;  4X6A J;  2DMQ A;  1K61 A;  1RKT A;  1LE8 B;  4DYR A;  5M5Y J;  3CMY A;  1X58 A;  4JYK A;  1HLV A;  2DA4 A;  1H8A C;  1LFU P;  4AC0 A;  3HOV J;  2TRT A;  3C2B A;  3IH2 A;  1ZKG A;  2R7Z J;  2DMU A;  4EEF G;  4BKX A;  1W0U A;  3S14 J;  4V2G A;  2EZI A;  1U78 A;  1RKW A;  2FD5 A;  1HCR A;  2DA5 A;  4JX4 A;  2WV1 A;  4M6V A;  3HOU J;  1ETQ A;  2JMW A;  5EF6 A;  4D7N A;  4A93 J;  5F27 A;  4A3C J;  2D5V A;  2JWT A;  2ELK A;  1H89 C;  3VPR A;  5DS9 A;  1XG1 A;  1MBE A;  1QVU A;  5GPC A;  3NAU A;  3HGG A;  5FLV A;  3WHC A;  1Z77 A;  2L0K A;  3MVP A;  2VKE A;  2O7O A;  3BR3 A;  3BR1 A;  4JX6 A;  4UUT A;  4A69 C;  5EG0 B;  1ORK A;  3S2H J;  5IP6 A;  2IEK A;  3D1N I;  1R9T J;  4DYQ A;  1IDZ A;  1HOM A;  1BA5 A;  2DTZ A;  1XC5 A;  1GT0 C;  1MBK A;  3JRA A;  1ZQ3 P;  1IV6 A;  4BY7 J;  3GTK J;  4L5E A;  4FCY A;  5C4J J;  2JA5 J;  1MBF A;  3F0C A;  3OSF A;  1BW5 A;  3HOW J;  2XPU A;  4MFD A;  3BR6 A;  4CYC B;  3PM1 A;  4A3F J;  3BQY A;  1H88 C;  3BR0 A;  5F0C A;  3BTC A;  2JN6 A;  4A3I J;  3CCY A;  1PUF B;  1BL0 A;  2E19 A;  5M5W J;  2IBD A;  4MO7 A;  4D5F A;  5K7Z A;  1IUF A;  1Z0X A;  5M3F J;  3ZQF A;  3S2D J;  1YRN B;  3FK6 A;  1OCP A;  3A01 B;  2DMP A;  1CQT A;  4FE7 A;  2R5Y A;  3TP3 A;  2M34 A;  4G12 A;  4XRS G;  2YS9 A;  1GVD A;  1FIA A;  1NK3 P;  2XSD C;  1JKP C;  4M3B A;  2PMZ N;  4XRS A;  5C4X J;  1UHS A;  3HEF A;  2VKV A;  1QVT A;  3I4M J;  2X6O A;  3WHB A;  2XRL A;  2EBI A;  2MGQ A;  1IG7 A;  2HYJ A;  5EYR A;  2M0C A;  1QRY A;  4M3G A;  1P7I A;  2LY9 A;  2VI6 A;  3TP0 A;  2O8K A;  3MN2 A;  1HDP A;  2LFB A;  3SDG A;  3GTL J;  2MSY A;  1T33 A;  1BW6 A;  2LKX A;  4W1U A;  2EZL A;  2M8G X;  3BG5 A;  2NOG A;  1I50 J;  1TWF J;  3GTM J;  2DA2 A;  2OF7 A;  2P81 A;  1FTT A;  3LNQ A;  2K9N A;  2ECB A;  3K2A A;  2R5Z A;  1UMQ A;  1IDY A;  5GPA A;  5E3M A;  5IOY A;  2DMT A;  1WH5 A;  4QSH A;  2FQ4 A;  3GTP J;  1D5Y A;  2E2H J;  3S15 J;  1SAN A;  2YU9 J;  1ITY A;  4MFE A;  2HQ5 A;  1AKH B;  3QQA A;  4FIS A;  5J1R A;  3IV5 A;  1LE8 A;  1JJ8 C;  1Y1W J;  5JLX A;  5JLW A;  2K9S A;  2R5Y B;  3TW7 A;  1QPI A;  1B8I A;  1B72 B;  3HOZ J;  5K7F A;  1RES A;  3UKG A;  1YRN A;  5E3N A;  2QCO A;  2JJ7 A;  4XID A;  1JUS A;  1DU6 A;  1JKR C;  4RDU A;  3LSJ A;  3QPS A;  2WAQ N;  5C3E J;  2DA7 A;  4M3D A;  5F0F A;  2HI3 A;  4IEJ A;  3O8H A;  2NVQ J;  1Y1V J;  2COB A;  4W97 A;  2HXI A;  1TWG J;  2XGC A;  3S1N J;  3A03 A;  4C2M J;  2DA6 A;  2FX0 A;  3HKZ N;  5F08 A;  2LTP A;  2Y9Z A;  4DZJ A;  4A3J J;  5FLM J;  5FKK A;  1F43 A;  1U9O A;  3S1M J;  3HM5 A;  2VUM J;  4IHY A;  1G2H A;  4I76 A;  3B6A A;  2Y2Z A;  2E1O A;  2EZH A;  5FKL A;  1TC3 C;  3BT9 A;  3RZD J;  3ZQC A;  1AKH A;  2GBY A;  5EG0 A;  5IPA A;  4IHX A;  3BG3 A;  4A3G J;  1NTC A;  2RAE A;  1VFC A;  2XPV A;  2JA7 J;  2EH3 A;  1S7E A;  1POG A;  1GV2 A;  5F0H A;  1I3Q J;  3A02 A;  3MKL A;  4MIM A;  1W0T A;  3HBL A;  2R92 J;  2HDD A;  1E3O C;  3GTG J;  2N8G A;  1ETX A;  2H8R A;  3Q0U A;  3W6V A;  1TWC J;  1IC8 A;  3FIS A;  2IAI A;  3ZQG A;  4QIW N;  2XGE A;  4FE4 A;  2XB5 A;  5FKN A;  3CQZ J;  5IYB J;  3IH4 A;  3ZOB A;  5FJ8 J;  5J1Y A;  2M2E A;  3L1P A;  1ZK8 A;  2LLK A;  4XIC A;  4FTH A;  4HNV A;  3HOY J;  3JRB A;  5J3L A;  2DJN A;  2W48 A;  1K83 J;  1U9N A;  1F36 A;  2JK3 A;  5EGO B;  2L7M P;  1ENH A;  1OJL A;  5EDN A;  2GLO A;  4M3F A;  2CUE A;  3RKQ A;  5IOZ A;  3PO2 J;  1X2N A;  3ZQH A;  2KDZ A;  4Y52 J;  2Y9Y A;  1GV5 A;  1ETV A;  2CU7 A;  3JRD A;  1ETY A;  1JT0 A;  2ID6 A;  3FIW A;  4IHV A;  3SFI A;  4D7M A;  5HOD A;  1JJ6 C;  2VPR A;  2Y0S N;  3E7L A;  1ETK A;  2TCT A;  2L7Z A;  1HF0 A;  2HOA A;  2Y31 A;  4BY1 J;  2ECC A;  1AU7 A;  1GDT A;  3JRE A;  1ZR4 A;  4C3I J;  4JP0 A;  4NDL A;  2ME0 A;  1VND A;  4DZP A;  4XRM A;  1B8I B;  5E3O A;  4I6Z A;  2DMN A;  1AHD P;  1RR7 A;  4D5C A;  2XPW A;  5IP7 J;  3FKI J;  5J1U A;  2OPT A;  3BTJ A;  2LK2 A;  2WB1 N;  2LVS A;  3HDD A;  2NS7 A;  2X48 A;  1ZR2 A;  3JRG A;  3QPL A;  2X9D A;  4UUS B;  2M9H A;  1ETO A;  3BQZ A;  1JT6 A;  3LSP A;  2R5Z B;  1EF4 A;  4B4C A;  1MBG A;  5F04 A;  2XGD A;  1RET A;  4Y7N J;  2G0E A;  1JGG A;  2L9R A;  2B63 J;  3BTL A;  1T56 A;  4IHW A;  1IRZ A;  4RBO A;  1MBH A;  2NVX J;  3CDL A;  5BNG A;  2CQQ A;  2EZK A;  3FK7 A;  2EQR A;  1MSF C;  1OCT C;  2CJJ A;  5E3L A;  1JUP A;  2HXO A;  3JRC A;  2AO9 A;  1JKQ C;  3G1M A;  4A3L J;  2MW8 A;  3I4N J;  3G1O A;  4C3J J;  4XK4 A;  1BJZ A;  2H1K A;  3S1Q J;  4JX5 A;  2I10 A;  3A01 A;  2K40 A;  1XS9 A;  3HB9 A;  1P7J A;  2L7F P;  3JRI A;  1ZTR A;  4LOC A;  1DU0 A;  3Q0V A;  1WH7 A;  4B3A A;  2JA6 J;  1SFO J;  1PUF A;  4AYB N;  1IJW C;  1WI3 A;  4A3K J;  1TWA J;  1LFB A;  3H3V K;  1I6H J;  1FJL A;  5M5X J;  5C44 J;  3SJM A;  1VF9 A;  2R93 J;  3S17 J;  4A3M J;  4DW6 A;  4CYC A;  2MG4 A;  3OOU A;  1JTX A;  2DA1 A;  1VI0 A;  3IH3 A;  4DYC A;  2QF7 A;  4X1E A;  1TWH J;  2NVY J;  3Q3S A;  2GM4 A;  4AUX A;  3BTI A;  1MBJ A;  1OFC X;  1A5J A;  5FKM A;  2E2I J;  5IYC J;  2DN0 A;  5EEA A;  3H0G J;  3K7A J;  3GTQ J;  3HGY A;  2R0Q C;  5EZH A;  4BXX J;  9ANT A;  1X2M A;  4B1R A;  3GTO J;  2NVT J;  1WCM J;  5FKO A;  3RQI A;  1U8B A;  2LD5 A;  1HDD C;  3DCF A;  5EGO A;  1A6I A;  4MLO A;  1MNM C;  3GBG A;  5M3M J;  1WPK A;  1FEX A;  2CQX A;  1JKO C;  3G1L A;  2FJ1 A;  4BBS J;  4QTR A;  2HOS A;  1UG2 A;  2E2J J;  3OIO A;  1MH3 A;  3BR5 A;  1FIP A;  2O9L A;  5IYD J;  3JRH A;  5K7H A;  2K9Q A;  2AHQ A;  5F1J A;  2NS8 A;  1WGX A;  1MH4 A;  2JA8 J;  4C3H J;  3Q0W A;  4UUS A;  1FTZ A;  3HOX J;  5IP9 J;  2ZB9 A;  3PO3 J;  1JTY A;  5EZG A;  3JR9 A;  4A3E J;  4V2F A;  1Q1V A;  4ABZ A;  2YUS A;  3BG9 A;  4M3E A;  2KT0 A;  1IGN A;  3M4O J;  3LSR A;  3M3Y J;  3DEW A;  3LSG A;  2ME6 A;  5DTD A;  2ID3 A;  2Y30 A;  2LP0 A;  4A3D J;  3ZQI A;  4A3B J;  1NK2 P;  4GFB A;  3S1R J;  3TED A;  3GTJ J;  1O4X A;  2HOT A;  1GUU A;  1RPW A; 
#chains in the Genus database with same CATH topology
 2XVC A;  3HSR A;  4RGS A;  2EV5 A;  2XAG A;  4HQM A;  3MKW B;  3BJ6 A;  3F8F A;  2EFW A;  3AFH A;  4IQ4 A;  3L9F A;  3ZMD A;  4CCM A;  1TTY A;  2L9S A;  2M87 A;  2NXN B;  1WHU A;  1S3J A;  1MSE C;  1B72 A;  4BBR J;  1H9T A;  2FNA A;  5LRR A;  3K70 D;  1R1U A;  3IRR A;  2RQP A;  2OTL I;  4HDV A;  4EJU A;  1ZRF A;  4EJT A;  1CF7 B;  3ZMU A;  4ZDO A;  1HLV A;  2CH0 A;  3ZXS A;  1REP C;  2DA4 A;  2MH9 A;  3ZR8 X;  2R7Z J;  3HOV J;  3CMA I;  3DF8 A;  5CQG A;  2JPB A;  2R7U A;  3FWE A;  5B3S H;  3CLO A;  4YEJ A;  3Q9S A;  4IRI A;  2WV1 A;  5D4S A;  3F8C A;  1ETQ A;  1OR7 C;  3R4K A;  3TKY A;  4L18 B;  2DCE A;  4D7N A;  3K10 A;  4A3C J;  2Z33 A;  3TBI A;  3VPR A;  2QQ8 A;  1XG1 A;  2PMH A;  1MBE A;  3MZ8 A;  4KT6 A;  2W85 A;  4BQN A;  4JQF A;  1YHQ I;  1NHA A;  2VLA A;  5GPC A;  4TV7 A;  3TO7 A;  2MD5 A;  3K4J A;  2HKX A;  4N4N B;  4RAZ A;  1ZRC A;  4WCG A;  2HR3 A;  3PNY A;  3BR3 A;  3OYN A;  4UUT A;  2W4S A;  2A5Y B;  4A69 C;  2DI3 A;  5EG0 B;  5IP6 A;  2F4I A;  2IEK A;  1MMA A;  3LST A;  3CUQ B;  1R9T J;  1SVO A;  4AYB A;  4YG2 F;  1HOM A;  3OL4 A;  1XC5 A;  1MBK A;  2EIN H;  1IV6 A;  3BZK A;  1FOX A;  4F7Z A;  2A5W A;  1I3A A;  1BIB A;  1MBF A;  2BVL A;  2BW3 B;  5FFZ A;  2CWE A;  2HQN A;  3AKZ A;  1KYW A;  2KZV A;  3S2W A;  1FZP B;  1XMX A;  1FBS A;  5F0C A;  1ZLJ A;  4XKC A;  5ILV A;  2HYF A;  4HV5 A;  3U9G A;  1PUF B;  1KYZ A;  2DDA A;  3GXO A;  4D5F A;  5HOO A;  1SFX A;  3HPG A;  1S7O A;  4E7K A;  4KYW A;  3BCB A;  1CQT A;  2DFH A;  1WSU A;  2R5Y A;  2XAJ A;  4CHU A;  4U0V A;  1G59 A;  4G12 A;  2CFX A;  1GVD A;  3E0J B;  1FIA A;  3BJA A;  1ZN2 A;  2XSD C;  4BE2 A;  3SFZ A;  2X85 A;  4N0B A;  1O3R A;  1JKP C;  2Z3Y A;  3WHB A;  1ZRD A;  5GAE J;  4RAY A;  3VOD A;  3MKY B;  2EBI A;  3CCR I;  1XN7 A;  4C9Y A;  1MND A;  1S7A A;  2MH2 A;  4EJV A;  1LKX A;  3FX3 A;  2Y75 A;  2JA2 A;  3KIO A;  4Z6Y A;  2XSJ C;  5LHI A;  1R00 A;  3MN2 A;  1BBY A;  4O6J A;  2DQL A;  3C1D A;  3P9I A;  4HF2 A;  1U2W A;  1PUE E;  1NG6 A;  3BG5 A;  1I50 J;  4RLF A;  3GTM J;  1WJB A;  3HOS A;  2DK8 A;  2OF7 A;  1FTT A;  4F3Q A;  3HRT A;  1SFU A;  3CDH A;  3NQO A;  2X6W A;  2CFO A;  1R7J A;  2PQ8 A;  3SXY A;  1F5T A;  1R5H A;  3R0J A;  2FOW A;  1K78 A;  3GF2 A;  2VBW A;  3QYE A;  1RZ4 A;  3K1M A;  2FQ4 A;  4EJW A;  4ZZL A;  1D5Y A;  2HNH A;  1SAN A;  1W36 C;  4MFE A;  2HQ5 A;  2EV6 A;  4A6D A;  3SYT A;  3H5N A;  4FIS A;  2KPM A;  3WTW C;  4IX7 A;  1JJ8 C;  4HQE A;  1D0X A;  5D8K B;  1HKQ A;  3J81 Z;  1JHH A;  1LJ9 A;  3TW7 A;  2IXS A;  3HOZ J;  2V9K A;  3REO A;  3UKG A;  3HTS B;  4PJL A;  2ISZ A;  2ZSH B;  2QCO A;  3EUK L;  1LDK B;  3DLL F;  3LSJ A;  4XRF A;  4EM2 A;  4CXF A;  3OYA A;  1FX7 A;  4GGG A;  4FX0 A;  5GAH J;  5C3E J;  2DA7 A;  2HKO A;  3ABK H;  3K4K A;  4FT8 A;  2HI3 A;  2VJ5 A;  4YFK F;  3O8H A;  2NVQ J;  4A0Z A;  4BQQ A;  3LSI A;  2YPR A;  5LD2 C;  1ON1 A;  1MW7 A;  5TJJ A;  2LF7 A;  3E6B A;  1J9I A;  4Y15 A;  4AVZ A;  3HKZ N;  2NNN A;  4DZJ A;  4DBR A;  3HOT A;  2BEO A;  2DAO A;  1U9O A;  5FO5 A;  3HM5 A;  2STW A;  1ZHF A;  4JBA A;  3B6A A;  2PLY A;  3PNT A;  5FKL A;  4B43 A;  2P0W A;  1VQN I;  3F8N A;  3WGG A;  1FC3 A;  3LSH A;  5LGT A;  4BNC A;  1V5G A;  4IOA F;  1G3S A;  4RB0 A;  3OMY A;  4L0Z B;  3K70 C;  1VFC A;  1SD6 A;  4PDK A;  1OQY A;  1R23 A;  1I3Q J;  3C7J A;  2LH9 A;  3A02 A;  3MKL A;  4MIM A;  4F92 B;  1XDU A;  3HBL A;  2ZJP F;  1O3Q A;  1QGP A;  2WA0 A;  2ICW G;  3Q0U A;  3W6V A;  4OIR F;  2WY8 Q;  4KJZ A;  2CV1 A;  3TGN A;  3ZQG A;  2ETH A;  3R6S A;  5FKN A;  3CQZ J;  2HYG D;  1T2K A;  2FSW A;  1LDJ A;  3ZOB A;  4HBL A;  3H9J A;  4M9X A;  5J1Y A;  2M2E A;  3L1P A;  2PMU A;  3L2U A;  2KDO A;  2LMD A;  1LNW A;  3FHZ A;  4FTH A;  4LFU A;  2PFB A;  1FMW A;  4Y13 A;  3ZPL A;  2NVU B;  1U9N A;  3IP4 B;  5EGO B;  1ENH A;  5K5R A;  3F6O A;  4CZC A;  1J75 A;  5EDN A;  1X4P A;  1XTA A;  2A07 F;  5IOZ A;  3U21 A;  2KDZ A;  4Y52 J;  1ON2 A;  4UB8 C;  4KIC A;  1ETV A;  1XCB A;  4F93 B;  1IO2 A;  2VOO A;  2TDX A;  2F5F A;  1FPQ A;  3WTX C;  4CDG A;  1JJ6 C;  2QBY A;  1ETK A;  2TCT A;  2UXN A;  2Y31 A;  2JRT A;  4BY1 J;  3EUH A;  3V8L A;  2BXY A;  1IZ1 A;  3TOA A;  4DNC A;  4RM2 A;  4IVN A;  1SAX A;  3F8M A;  3U2R A;  1DPR A;  2ZNZ A;  2LBF B;  3DXJ F;  4EAT A;  5B66 C;  3PQJ A;  4M6Y A;  3PJR A;  3HHH A;  1HW1 A;  2PMZ A;  3V4G A;  2XPW A;  1IXC A;  1R6R A;  2LNB A;  3S93 A;  5E18 F;  2BHZ A;  4N9H A;  3T0Y A;  4QPO A;  2QSH X;  2LK2 A;  2EFP A;  2X48 A;  4WK8 F;  2F2E A;  4FAS D;  2LG4 A;  5ICE A;  3H5A A;  3PIO F;  2A6E F;  2QSG X;  4ESB A;  2K9M A;  2HDW A;  1FBQ A;  2G7U A;  1S29 A;  1OMI A;  3I56 I;  4LD5 A;  2WWY A;  4CA0 A;  2XGX A;  3BG6 A;  1UJ8 A;  1GXQ A;  1MBG A;  5F04 A;  4FET A;  1M1E B;  4HEA 2;  4Y7N J;  3OYM A;  4BJ6 C;  4C2T A;  5D8L B;  2B63 J;  4A2U A;  1T56 A;  4IHS A;  1B9M A;  1Q1H A;  1VQM I;  1O3S A;  2R7Q A;  1BJA A;  5CVI A;  2DLL A;  3TMO A;  3IRQ A;  4CYD A;  4GRI A;  1DGR M;  4CO8 A;  3WU1 B;  2R7F A;  1H9G A;  3CO7 C;  3QP5 A;  2CJJ A;  1VQ6 I;  5L3C A;  3ZCO A;  3WTS C;  2E71 A;  1YX5 A;  3S3O A;  3OYC A;  1D0Y A;  3I4N J;  2V1N A;  1K6Y A;  3HRS A;  4E7S A;  4JX5 A;  4ENK A;  2L9N A;  3J7A Y;  4XN0 A;  3DFG A;  2K40 A;  4MEX F;  3KEQ A;  4PJM A;  3JRI A;  1ZTR A;  3DBR B;  1SFO J;  1IJW C;  3TQN A;  2W00 A;  4A3K J;  1TWA J;  3M8E A;  5F6F A;  1LFB A;  1Y56 A;  4G6Q A;  2IRF G;  4RM3 A;  4A3M J;  4DW6 A;  5FLX Z;  5IT9 K;  4LGW A;  4KT5 C;  4CYC A;  2GXB A;  3T8R A;  3WU2 C;  4U0Y A;  4A12 A;  2XC7 A;  5JHF A;  4BJT A;  1TWH J;  1XSX A;  1MMN A;  2KIU A;  5L3D A;  5H6R A;  4AUX A;  3ASN H;  2XRN A;  4I01 A;  2ELJ A;  2P8T A;  3AG1 H;  5FKM A;  4B09 A;  1RNL A;  1E0E A;  3CLQ A;  2DN0 A;  5EEA A;  3H0G J;  3GTQ J;  3HRU A;  2KP6 A;  2DOA A;  1EKE A;  1OKR A;  1HQC A;  1X2M A;  1X1P A;  1BR2 A;  1I6X A;  4S04 A;  3GTO J;  2M45 A;  2WY7 Q;  3DQV C;  3FMR A;  5FKO A;  3HJE A;  4MEY F;  3CJQ B;  2K85 A;  1LEB A;  5E20 A;  4YEL A;  3GBG A;  3V42 A;  5HS9 A;  3WGH A;  1WPK A;  2RNJ A;  4M6X A;  2VN2 A;  1P4W A;  1ZRE A;  1P2F A;  2PI0 A;  4YIF A;  4HPQ A;  3OV8 A;  1MZB A;  3CMM A;  2JRM A;  1MH3 A;  2COM A;  3DPU A;  3EPZ A;  2HS5 A;  4UV8 A;  4KIT B;  5JVG F;  2I5U A;  2D2W A;  1FWZ A;  2P6S A;  3X2Q H;  2WAF A;  2V4J C;  4AIK A;  2H1L A;  2M4G A;  3EDP A;  1YJW I;  5JI6 A;  1WGX A;  2DFI A;  4C3H J;  4UUS A;  2E1M C;  4EVI A;  3TDZ C;  2OQG A;  5IP9 J;  1N75 A;  1W4M A;  3FM5 A;  2ZB9 A;  3KP2 A;  1HW2 A;  4PSW A;  1JTY A;  5EZG A;  1VQ8 I;  1RR8 C;  4D9J A;  3HYI A;  1L0O C;  2FEZ A;  1WWX A;  3H36 A;  4ABZ A;  1UEL B;  4L5I A;  3BG9 A;  3OYJ A;  4IO9 F;  1A6Q A;  3M3Y J;  4CCK A;  2ME6 A;  3M07 A;  2ID3 A;  5B5E C;  2ZO4 A;  2LP0 A;  3K4B A;  4YFN F;  4AIH A;  3M7G A;  1DP7 P;  4DOZ A;  1X3W B;  3CJT B;  3F72 A;  3GTJ J;  3TED A;  1KU9 A;  1O4X A;  1GUU A;  3OIP A;  2V9P A;  2DJI A;  3WE3 A;  4LLL A;  2W1O A;  2DO7 A;  4D1Q A;  2ZME A;  1ETW A;  4ASN A;  4ZTJ A;  3H35 A;  1ZGW A;  2K5C A;  3CES A;  2CUF A;  1A36 A;  2IJL A;  2EPF A;  2QQA A;  2DA3 A;  3ZQL A;  3RZO J;  2XB0 X;  4A6E A;  5J47 A;  4HYE A;  2IP2 A;  2PJR B;  1RKT A;  2CGP A;  3VYS B;  4DYR A;  2VJ4 A;  1S9H A;  5M5Y J;  5L3E A;  3GX4 X;  2RDP A;  4UVA A;  3GW2 A;  1LFU P;  2VL8 A;  1ZKG A;  3CCQ I;  4HX8 A;  2DMU A;  2KJB A;  5TRD A;  3D5L A;  2X0L A;  1W0U A;  4V2G A;  2DXI A;  1HKT A;  2QGU A;  4LB6 B;  4JX4 A;  2OC6 A;  2QYO A;  3WOD F;  5FD6 A;  3IL2 A;  5F27 A;  2D5V A;  2JWT A;  2ELK A;  4IRH A;  1H89 C;  2VQL A;  1XD7 A;  3RSN A;  2WAE A;  2DYS H;  3MEX A;  2CW7 A;  2KFD A;  1QVU A;  1G3T A;  1OPC A;  1W5C C;  3PFY A;  2L5Q A;  5DEQ A;  3HGG A;  5DDG A;  4RGU A;  5JVT A;  4E6K G;  2XRO A;  2KMU A;  4M71 A;  4XKV A;  4E4H A;  5FB2 A;  3BLY A;  3KYL A;  1X3U A;  2NOJ B;  1N78 A;  1MMD A;  1ORK A;  3DPT A;  2OCC H;  3MZH A;  3C3W A;  4GXO A;  5CVR A;  1ODD A;  1A31 A;  1E3P A;  1V5F A;  1KQ9 A;  1ZQ3 P;  2RVC A;  3GTK J;  2ZXI A;  3E6C C;  2KJC A;  2JA5 J;  1X1B A;  5D5V B;  2ACJ A;  4BHP A;  2JVG A;  4MGR A;  1LPQ A;  4MFD A;  2QKL B;  1HC8 A;  3AG3 H;  1R4M B;  3BY6 A;  3CJN A;  4CYC B;  1Z9C A;  3L2C A;  1X1C A;  4A3F J;  3P9K A;  5DV5 A;  1H88 C;  4AU7 A;  2E19 A;  5M5W J;  2E1N A;  2F4M B;  3ESW B;  2VQH A;  3WGI A;  2EV0 A;  5M3F J;  3E5X A;  3KE2 A;  3S2D J;  1OCC H;  1L3L A;  1WJC A;  5H20 A;  4GYG A;  4P9U A;  2M7B A;  2VKD A;  3PL8 A;  4NQW A;  2M34 A;  2M8E A;  5EEH A;  4OWR B;  1RI7 A;  2PN6 A;  2CUZ A;  4M3B A;  2E1C A;  2V1U A;  2F5V A;  4F52 A;  2VKV A;  3E6M A;  1TT0 A;  2XRL A;  1IN5 A;  3L2Q A;  1BN5 A;  2WB1 A;  1FY7 A;  2O61 A;  1QQI A;  4M72 A;  4A0Y A;  4M3G A;  1NH3 A;  2V6C A;  4ETS A;  5ICC A;  3SDG A;  3QOE A;  5JR3 A;  1BW6 A;  2L02 A;  4B48 A;  4DQ2 A;  5DM6 F;  2EZL A;  2M8G X;  2R7S A;  1FLI A;  2XF5 A;  3P5J A;  1QU3 A;  3FXM A;  2K27 A;  1R22 A;  4LMY A;  2Q0O A;  3EYY A;  3QOD A;  2E7W A;  2ECB A;  2K4B A;  3WG7 H;  2DOF A;  3SEQ A;  3JCU C;  3L2R A;  1LB2 A;  2K86 A;  1ZG5 A;  4DIQ A;  5GTH C;  1MD0 A;  1WH5 A;  4XOT A;  5DUK A;  3GZ6 A;  4QSH A;  1T38 A;  2E2H J;  4GCV A;  3S15 J;  1T8I A;  5J8F A;  4IZZ A;  1ITY A;  5GTI C;  4BAY A;  3CTA A;  3IV5 A;  1U8R A;  3DKY A;  2WTE A;  5LGN A;  4BAC A;  5JLX A;  3GLL A;  4NQW B;  2AXL A;  5JLW A;  2R5Y B;  1B8I A;  2FRH A;  1RES A;  2CW8 A;  3BZC A;  2D45 A;  5E3N A;  3BC8 A;  3G4S I;  1JUS A;  2DQR A;  2W84 A;  1DU6 A;  3MFK A;  1JKR C;  1XGN A;  4ESF A;  3LQR A;  4BH9 A;  4YIR X;  3QWL A;  3VEP A;  4HF0 A;  5F0F A;  2EFQ A;  1X4O A;  2P4W A;  1X3Z B;  2VJJ A;  1Y1V J;  1WKM A;  2BBY A;  2COB A;  2PJP A;  4W97 A;  2XGC A;  2MFZ A;  1B59 A;  1OIS A;  2DA6 A;  5HNF A;  1TT5 B;  2GXG A;  5F08 A;  3W2W A;  4ZYD A;  2E35 A;  3I4P A;  4KIB A;  4L9T A;  5FLM J;  4A3J J;  3JSP A;  5FKK A;  2HVR A;  1F43 A;  2CQ7 A;  2VUM J;  4I76 A;  2FU4 A;  1JHF A;  3FXO A;  1YLF A;  5ICF A;  4YII A;  3CCE I;  5E1Z B;  3OYH A;  4G8X A;  2Y2Z A;  2E1O A;  2EZH A;  3O6B B;  1T95 A;  2J5O A;  3BT9 A;  1VQ4 I;  3W3C A;  1P6R A;  4XL9 A;  5HDG A;  1VQO I;  1YIT I;  5EG0 A;  1YJ9 I;  2FMY A;  4A3G J;  1NTC A;  2EFN A;  2IA1 A;  2R7W A;  4S05 A;  4UUV A;  2FE3 A;  2XPV A;  2EH3 A;  2MC3 A;  1POG A;  1GV2 A;  2DDB A;  2ZFU A;  3G73 A;  3OR1 C;  1TNS A;  4KFC A;  1SD4 A;  1FSE A;  2QUF A;  3LA3 A;  1I27 A;  2R92 J;  1E3O C;  3GTG J;  2N8G A;  2QZ8 A;  2IGO A;  1D8K A;  3BWG A;  4XBF A;  1YW7 A;  1B9N A;  1TWC J;  2KIQ A;  1IC8 A;  4QIW N;  3ZMT A;  3I64 A;  5IYB J;  5LLQ A;  2WAQ A;  3R0A A;  2OD5 A;  5LFA A;  1FOW A;  2XKO A;  2A68 F;  1FP1 D;  1ZGJ A;  3HOY J;  3JRB A;  4J00 A;  2ELH A;  4CUG A;  2DJN A;  2CQK A;  2W48 A;  3HC7 A;  2NAZ A;  2R7T A;  1F4K A;  2OBP A;  4UB6 C;  2GLO A;  1T98 A;  2CUE A;  2DW4 A;  2QQB A;  5K5Q A;  1HSJ A;  3RKQ A;  1X2N A;  2D1H A;  3ZQH A;  2HU9 A;  4ON0 A;  2B9S A;  5FLX K;  1GV5 A;  2CU7 A;  1ETY A;  3GLX A;  3OYE A;  2CW0 F;  3QRF F;  1YTY A;  4G7H F;  3SFI A;  4XMY A;  5HOD A;  3NWS A;  4BYY A;  2FML A;  2E5N A;  4MQV A;  2VPR A;  3E7L A;  4BJ5 C;  1QZZ A;  1HF0 A;  5LGU A;  3KYD B;  3SZT A;  2H6B A;  5IY5 H;  2VT3 A;  1AU7 A;  1FYM A;  1GDT A;  4JP0 A;  3DU6 A;  2K7L A;  2UZK A;  5B1B H;  4RLQ A;  1VND A;  2JUG A;  4XRM A;  2PX9 A;  3PIP F;  3CCJ I;  4I7H A;  1J2X A;  4AIJ A;  3GFJ A;  2DPD A;  4PFO A;  3CUQ C;  2OPT A;  4ENM A;  2WB1 N;  1TZL A;  2DFE A;  5CJ9 A;  4LLG F;  1JGS A;  1XGO A;  4LK1 F;  1ZR2 A;  5DCM B;  4F55 A;  1FBU A;  3ASO H;  3K0L A;  4IOC F;  1K78 B;  4UUS B;  1OYY A;  3GME A;  2R5Z B;  2NRA C;  2HZT A;  2Z9O A;  3EYI A;  2XGD A;  1QA6 A;  1Y8Q B;  3PNV A;  1JGG A;  3T1B A;  3CUO A;  1Z67 A;  4WXD A;  3VYT B;  4G7Z F;  2BXZ A;  2ZJQ F;  3LSM A;  2JSC A;  4IHW A;  1Y8R B;  2K02 A;  1S6L A;  4G6D A;  4OIN F;  4KDP A;  4RBO A;  5AIQ A;  1MBH A;  4HF1 A;  3MMY B;  3ZRG A;  2HVQ A;  5CVJ A;  2CQQ A;  2EZK A;  4I2O A;  1T39 A;  1Z1D A;  1GXP A;  3ULQ B;  3O3K A;  2HFH A;  1P92 A;  3M8F A;  3BCA A;  3A0H C;  4R1H A;  3JRC A;  2PJR A;  1JKQ C;  3KLN A;  5CKT A;  3ZMS A;  4C3J J;  1S5L C;  3S1Q J;  3FZV A;  1IV8 A;  1V5E A;  3OOP A;  5DCM A;  4CGZ A;  2QEN A;  2UUZ A;  2V1D A;  2IA2 A;  3Q0V A;  4BQA A;  1PUF A;  1W5T A;  4AYB N;  1VQ7 I;  1EJ9 A;  3H3V K;  1I6H J;  5FGM A;  1V55 H;  5EEG A;  5C44 J;  3SJM A;  3E6D A;  3KZY A;  2O5R A;  4LG0 A;  3OOU A;  2FUG 2;  4A5N A;  2MLG A;  1BOB A;  2OCE A;  2QF7 A;  1LVK A;  2BW3 A;  3CO6 C;  4C2U A;  4X1E A;  3UNG C;  4BL0 B;  2RKH A;  1YO5 C;  3TL4 X;  2V79 A;  2GIZ A;  1MBJ A;  2L54 A;  4RB2 C;  2CYY A;  2Y69 H;  4FHT A;  4H4K C;  3HGY A;  2R0Q C;  4BXX J;  1TBX A;  3RQ4 A;  2A6H F;  5ERI A;  2O0Y A;  1SFK A;  1WCM J;  2KRH A;  5E1X A;  1U8B A;  2OJE D;  3KP6 A;  1HDD C;  2M5W A;  1A6I A;  4Y17 A;  3CC7 I;  4MHG A;  1PJR A;  2XHK A;  4HW0 A;  5M3M J;  3N97 A;  5A2Q Z;  2Z99 A;  2X6Y A;  1KQ0 A;  2X1C A;  3F22 A;  2CQX A;  1OCZ H;  3Q9V A;  1E17 A;  1B1B A;  2LDU A;  2QWW A;  4KA4 A;  3BG7 A;  3NRV A;  4ZDP A;  3KX2 A;  4QTR A;  1J7K A;  2E2J J;  1FP2 A;  1EH8 A;  3BR5 A;  1RUN A;  1FIP A;  3VFZ A;  2O9L A;  5K7H A;  1EH6 A;  2EIM H;  1TQI A;  4BU2 A;  5BPD A;  2O8X A;  2K9Q A;  4UHT A;  2AHQ A;  2NS8 A;  2KHM A;  3I53 A;  1TQP A;  2WC2 A;  1FTZ A;  3HOX J;  4XLP F;  2BGC A;  1YOV B;  1GLN A;  1JE8 A;  4XSX F;  2HPM A;  3JTH A;  2AXT C;  2VC1 A;  3ZMZ A;  3PO3 J;  2ZNY A;  3ZGK A;  4CCO A;  2NS0 A;  4HG2 A;  3H92 A;  1IN6 A;  1XGS A;  2ESH A;  4CH7 A;  4M3E A;  4C30 A;  2KT0 A;  1IN4 A;  3M4O J;  1USS A;  2BY3 A;  3D5R C;  5DTD A;  1ZAO A;  2X6X A;  4GO1 A;  2IA0 A;  4RMN A;  4ZJZ A;  4GFB A;  4LG0 B;  2FBH A;  3BOQ A;  2BOL A;  3IKV A;  4XOP A;  2HOT A;  1R5I D;  3GFM A;  3DV8 A;  3OYF A;  4IL6 C;  2GXA A;  3FXU A;  1U5T B;  2QBY B;  5GP9 A;  5KVR A;  1BC7 C;  3BR2 A;  3JRF A;  2A6T A;  1JUM A;  1T0F C;  1Z7U A;  2YX4 A;  1D1B A;  5D4R A;  2YX7 A;  3OSG A;  2F5D A;  4P1W A;  3OS0 A;  3TW6 A;  3LOC A;  4RGR A;  3U1K A;  1UB9 A;  3J80 Z;  4LG3 A;  2EWN A;  4IRG A;  4PGG A;  1LE8 B;  4U7D A;  1X58 A;  1R58 A;  2OA4 A;  4MTD A;  1H8A C;  4AC0 A;  4NC8 A;  2TRT A;  1PYV A;  2B7E A;  3C2B A;  1W7P D;  3JTG A;  2E1M B;  3ZMV A;  1E2X A;  3S14 J;  4JK1 X;  2DT7 B;  1RKW A;  5FD5 A;  2FD5 A;  1JXS A;  3BZ6 A;  3IUO A;  4M6V A;  2OAZ A;  2Z16 A;  3HOU J;  2OZU A;  2H27 A;  2JMW A;  2J5P A;  4U0W A;  1AA7 A;  4CSW A;  1OYW A;  2XAQ A;  3C18 A;  3ELK A;  5LBQ A;  1D1A A;  5DS9 A;  2EFO A;  2AQF A;  4WXC A;  2M4K A;  1FT9 A;  3NAU A;  5FLV A;  3WHC A;  1Z77 A;  2DOD A;  2L0K A;  5H6Q A;  3MVP A;  1IAW A;  2ZXH A;  2VKE A;  4HNU A;  2O7O A;  4JX6 A;  4P55 A;  3GFL A;  3DEE A;  2CSO A;  3S2H J;  3K6G A;  3VYR B;  4DYQ A;  3JAM Z;  3HSE A;  1BA5 A;  5CYV A;  3FHN A;  4HRI A;  2QKM B;  3JRA A;  5EJC A;  4BY7 J;  1MDM B;  3FXL A;  5HLI A;  2EK5 A;  3ISP A;  3P9C A;  4N9I A;  4OMY A;  3RJP A;  5C4J J;  1YYV A;  2X1E A;  3HOW J;  4DGW B;  3FXK A;  5H2F C;  2BV6 A;  1YQA A;  4P96 A;  3BQY A;  2VXZ A;  1R36 A;  1ZEL A;  5BPI A;  1RC9 A;  3BR0 A;  3CP8 A;  1KU7 A;  3GUD A;  3COA C;  4KNY A;  2JN6 A;  4K2E A;  3CCY A;  1BL0 A;  4Z2Y A;  5CLS A;  2IBD A;  4MO7 A;  3ZN0 A;  5K7Z A;  3F3X A;  3RYP A;  2QSF X;  3CCM I;  4M73 A;  3ZQF A;  1MKM A;  1FYL A;  2YSR A;  3FK6 A;  4WF2 A;  3A01 B;  3M9A A;  4HLX A;  4FE7 A;  1EH7 A;  1YIO A;  4ZYA A;  3TP3 A;  3LQQ A;  2ZSI B;  3CZ6 A;  3N05 A;  2MBF A;  2OV7 A;  1ZG3 A;  1RIO H;  1NK3 P;  3O2P E;  4CIC A;  3HZJ A;  2PMZ N;  5C4X J;  2FNP A;  3LAJ A;  2KRF A;  3I4M J;  3VWB A;  3LL7 A;  4IPA A;  3KET A;  4E70 A;  4U87 A;  3MQ0 A;  1XB4 A;  2P6T A;  3BRO A;  3MZY A;  1SVM A;  1W7P A;  3DKX A;  3JSO A;  2HYJ A;  3ABT A;  5EYR A;  1IG7 A;  3R61 A;  3F8B A;  3K69 A;  2DK5 A;  2XUB A;  2XIG A;  1VQ9 I;  1EV7 A;  1C0W A;  2E7X A;  2EJR A;  2LY9 A;  2VI6 A;  5DCF A;  2O8K A;  3H0D A;  3Q5F A;  3GTL J;  4EM1 A;  2F5C A;  5DD8 A;  1Z3X A;  4L9N A;  3RI4 A;  1T33 A;  4MQ9 F;  2IGN A;  2LKX A;  2NYX A;  5FRM A;  3AG4 H;  2F6C A;  5DD4 A;  2H94 A;  2Y0M A;  3DWL E;  3K2A A;  3EUH C;  3DLA A;  2QA4 I;  1XPX A;  1ZLK A;  2KIF A;  1XCV A;  3A1Y A;  3T5X A;  2P7V B;  4HDU A;  1U6G A;  1A04 A;  5GPA A;  5E3M A;  1K6O A;  2K3F A;  2XKP A;  5IOY A;  2E60 A;  2DMT A;  4XLN F;  3S3M A;  3AL0 B;  2KL4 A;  2VE9 A;  1I39 A;  4U7B A;  5L3G A;  3A2K A;  3GTP J;  5D6F A;  1J59 A;  2JZY A;  3DEU A;  1E3H A;  2LRD A;  3IWZ A;  4CCJ A;  2A69 F;  1LE8 A;  5K5O A;  5TGT A;  5J6X A;  1QNT A;  2LOO A;  1Y1W J;  2Q2E A;  4P5O A;  2K9S A;  1QPI A;  3TO6 A;  1ZYR F;  5K7F A;  2IVM A;  4RAG A;  2RNG A;  3ABU A;  1XX5 A;  4XID A;  2IW5 A;  5D5U B;  3QPS A;  4B47 A;  4I0A A;  2WAQ N;  3GCM A;  4ZYG A;  4M3D A;  3RYR A;  1LDD A;  3P7N A;  1WJ5 A;  1G3W A;  3H3Z A;  3OYD A;  5E17 F;  1TWG J;  4C2M J;  3KP7 A;  1IN8 A;  1P4A A;  2LTP A;  4NC7 A;  2L9V A;  2R7V A;  4HNT A;  3OY9 A;  4IQJ A;  2LYC A;  2IGM A;  3H1C A;  1TC3 C;  1J5Y A;  2ZC2 A;  3BJO A;  3RZD J;  3CUQ A;  1RUO A;  4O5V A;  5BMZ A;  5HDK A;  4IHX A;  1ULY A;  3OL3 A;  1TW2 A;  2O03 A;  2O3F A;  2IS1 A;  2DT5 A;  2JA7 J;  2LF8 A;  4HV6 A;  4IF4 A;  1W0T A;  1J09 A;  1R71 A;  1BM9 A;  3HSF A;  1BI3 A;  2HDD A;  2CO5 A;  1ETX A;  2H8R A;  2R7R A;  2JPC A;  3RPU D;  4BXF A;  2BY2 A;  3FIS A;  2IAI A;  3I3L A;  2XGE A;  4FE4 A;  2CUJ A;  2OZ6 A;  3EQL F;  4IJA A;  2PEX A;  3ABL H;  1SC7 A;  5FJ8 J;  3ONQ A;  1O57 A;  1T6S A;  3U1D A;  3N4M A;  1DPU A;  4FX4 A;  4XIC A;  4XNF A;  3I0T A;  3CC2 I;  1QZY A;  1T0F A;  5J4Y A;  5J3L A;  4M9Z A;  1K83 J;  3H5R A;  1F36 A;  3IHU A;  1TNT A;  4QLC U;  1OJL A;  1W1W E;  5J40 A;  1MMG A;  2RGV A;  5IT9 Z;  2VBX A;  3OS2 A;  2L4M A;  4AID A;  2LRE A;  4KIF A;  2VKH A;  3M1C A;  2Y9Y A;  3OYG A;  1WJA A;  2HGC A;  2F48 A;  2Z2S B;  4QPQ A;  2ID6 A;  3FIW A;  3V7S A;  2MA3 A;  4IHV A;  1HKS A;  3RDI A;  1YW8 A;  2R7X A;  6PAX A;  2GIV A;  1A35 A;  4KMU X;  3KP3 A;  1Z05 A;  3LA7 A;  2VBZ A;  2RV8 A;  2ECC A;  4XON A;  4XQF A;  4IKF A;  1ZR4 A;  4E7J A;  4NDL A;  3TDU C;  2MLK A;  1QHH D;  1ZGA A;  2GOM A;  5AON A;  1SVL A;  5E3O A;  1KA8 A;  4I6Z A;  4WWC A;  2DMN A;  4D5C A;  3PSF A;  2X1D A;  5IP7 J;  2OU2 A;  3JAM K;  2UXX A;  1X1A A;  1VZ0 A;  2L3D A;  3BTJ A;  5GAG J;  2ZJ2 A;  2JSP A;  3CCV I;  1DQU A;  2LVS A;  1S8N A;  2NS7 A;  4UNO A;  3I55 I;  2VOP A;  4ZYE A;  1WI9 A;  4GDF A;  2STT A;  3QPL A;  2X9D A;  3GWZ A;  5KAF C;  3SHF A;  2M9H A;  1ETO A;  3BQZ A;  1JT6 A;  1O3T A;  4ITV A;  3RIR A;  1IUY A;  3CF2 A;  3FMQ A;  4B4C A;  4OIQ F;  3SZP A;  2BY1 A;  1RET A;  3VYU B;  4YRV A;  3L2V A;  4I98 B;  4KN4 X;  2RRE A;  2L9R A;  1HST A;  3BP8 A;  4BE0 A;  3RPU A;  3DP7 A;  4OU0 A;  3W6J B;  3VB2 A;  3QU3 A;  3PQK A;  1IRZ A;  1T08 B;  4KMF A;  1BI2 A;  4N4O B;  3RKX A;  1N77 A;  2MC4 A;  3HUG A;  1X19 A;  3VSK A;  3E5Q A;  2GAU A;  1W7P B;  2X4H A;  2IGK A;  5FRN A;  1MSF C;  3EET A;  1OCT C;  4OAZ A;  3L7W A;  5D5X B;  4EM0 B;  5LRS A;  5E3L A;  3K4N A;  1JUP A;  1KZH A;  5L3F A;  2AO9 A;  4A0X A;  3G1M A;  3LFU A;  5K1Y A;  4A3L J;  2MW8 A;  2VQC A;  3G1O A;  2H1K A;  3QU6 A;  1BJZ A;  3H3U A;  4XK4 A;  3B73 A;  3FMS A;  5E79 C;  3DTE A;  4RB3 C;  4Y3O A;  1BIA A;  2XV4 S;  2MYS A;  4ESJ A;  1D3Y A;  2E36 A;  3S32 A;  2L7F P;  3OIQ A;  3T8T A;  1F9N A;  3DTI A;  3TOB A;  2JA6 J;  1D8J A;  1B4A A;  3GZ5 A;  3IC7 A;  4BS9 A;  1F1Z A;  3WTY C;  4E7H A;  2CV2 A;  3IAS 2;  3G6E I;  3KEO A;  4BEH B;  2R93 J;  1VF9 A;  3S17 J;  4KUM A;  3HXL A;  4XLA A;  2MG4 A;  1JTX A;  2VQG A;  1TW3 A;  1VI0 A;  2DOE A;  3IH3 A;  4DYC A;  2EIJ H;  2QM3 A;  2L7K A;  4I09 A;  2A3S A;  4E7Z A;  1SD5 A;  4UVB A;  2IS2 A;  3F23 A;  3Q3S A;  1MGT A;  1MDM A;  4EQQ A;  1WVR A;  3LMM A;  3S3N A;  1XSV A;  3BPX A;  1SAU A;  1VTN C;  1A5J A;  1I1S A;  2E2I J;  5IYC J;  2D1V A;  1WQ2 A;  4H0E A;  5EZH A;  5LEJ A;  3FDY A;  1MJB A;  4B1R A;  2NVT J;  5KCM A;  4XLF A;  2VJI A;  1LQ1 A;  4PJN A;  5LHG A;  2HQA A;  2K4J A;  2XF6 A;  1U5T C;  3DCF A;  5EGO A;  4PZJ A;  5BQT A;  1IXR C;  2M30 A;  4MLO A;  1DP3 A;  2P5L C;  1KU2 A;  3E97 A;  1MNM C;  3DBL B;  2XF7 A;  1BR1 A;  3WE2 A;  2KZG A;  4Q4Z F;  1FEX A;  2KKO A;  1JKO C;  4G9Y A;  1YFH A;  3G1L A;  2FJ1 A;  4BBS J;  3CCL I;  4XN3 A;  4RA2 A;  3G71 I;  1IRG A;  4ANJ A;  3RKW A;  4M74 A;  3M8J A;  2ZKZ A;  4U88 A;  3LFK A;  2BHY A;  3W6K B;  2KRC A;  2L2O A;  2CS3 A;  4DJA A;  2JA8 J;  1TQM A;  3V7R A;  1V54 H;  2VXD A;  2JTV A;  1IN7 A;  4PSX A;  4PJJ A;  4Y4R A;  1OLT A;  3JW4 A;  3ZQQ A;  5ILU A;  3A4C A;  1R1V A;  5FFX A;  2XAF A;  4EJO A;  1MJA A;  2NNY A;  2XDV A;  1YW9 A;  1MMS A;  1TP4 A;  2QLZ A;  3FKJ A;  3KYC B;  4V2F A;  5KK1 A;  2G7H A;  2FBI A;  3LSR A;  3J81 K;  4MTE A;  2Y30 A;  1SEU A;  2FXA A;  3ZQI A;  2LY1 A;  2ZFW A;  4A3B J;  2K9L A;  4L9V A;  2C6Y A;  5CPR B;  1AOY A;  3H9G A;  3S8P A;  4YFX F;  3GYH X;  4NUB A;  1HW5 A;  3MKZ A;  3OYB A;  1BOA A;  2KIS A;  5F1R A;  4G94 A;  2JVH A;  3ECH A;  3NAR A;  2ZJR F;  3O8G A;  1YS7 A;  3OYI A;  3OR2 C;  4XLE A;  1R49 A;  1UHW A;  2QEX I;  1WJF A;  3A0B C;  3B6C A;  2CRG A;  1J0R A;  4S0H B;  3SQN A;  1GVJ A;  2VC0 A;  3MWM A;  5J8C A;  3S16 J;  2LR8 A;  1QHG A;  1APL C;  4J19 A;  1MNE A;  2O6G E;  4X6A J;  2DMQ A;  3ML6 A;  3L2W A;  1K61 A;  3G3Z A;  3NEU A;  4XKB A;  3IKT A;  1G4D A;  3CMY A;  3M1E A;  2F5E A;  4JYK A;  3IAM 2;  3L09 A;  3CCS I;  1V4R A;  3MD2 A;  3HRM A;  3IH2 A;  4EEF G;  3ROU A;  5HS7 A;  2M7A A;  4BKX A;  4PGH A;  1SMT A;  3G2B A;  4UVC A;  2EZI A;  4M9S A;  1U78 A;  2WBM A;  1HCR A;  1R5G A;  2DA5 A;  3GVA A;  5EF6 A;  2X51 A;  1Z21 A;  4OIP F;  4A93 J;  2GZW A;  3H9Q A;  2EB7 A;  2P5V A;  4WXH A;  2V7F A;  4L9J A;  3HHG A;  5JHU A;  2MD0 A;  2HVS A;  3FXR A;  5HDN A;  3I59 A;  4B3X A;  3K1N A;  1XSD A;  2Q1Z B;  1S72 I;  2A61 A;  3OYL A;  1PP8 F;  1Y0U A;  2CV0 A;  4KIS A;  1STZ A;  2ZXW H;  3ERM A;  2WAD A;  3QAH A;  4LK0 F;  2E5Z A;  3BR1 A;  4Q47 A;  2P5K A;  3D0S A;  2HTS A;  4BDZ A;  3KP5 A;  5L3B A;  1P9Q C;  3D1N I;  1IDZ A;  3BPV A;  1K79 A;  1OCR H;  2DTZ A;  4EV0 A;  2A05 A;  1GT0 C;  4LIV A;  2EA4 A;  2HDC A;  4R8H A;  1W5S A;  4L5E A;  1UCR A;  4FCY A;  2I8D A;  2W24 A;  3F0C A;  2E34 A;  3OSF A;  3ZP5 A;  5DM7 F;  1BW5 A;  1MIJ A;  2XPU A;  2OQR A;  2EA2 A;  3WU0 A;  5LHH A;  3BR6 A;  1WJE A;  3PM1 A;  2ADU A;  1SFE A;  3CCU I;  1P4X A;  2OUM A;  2QQ9 A;  3BTC A;  4A3I J;  4PFP A;  1BR4 A;  2JUC A;  2Y0S A;  3HTU A;  2AS5 F;  1IUF A;  1O7L A;  1Z0X A;  2HOE A;  4XLH A;  3K2Z A;  1B6A A;  4V19 K;  1YRN B;  1OCP A;  1LUJ B;  3W2A A;  2DMP A;  3CC4 I;  3FBN B;  1Y39 A;  4ZTF A;  1I5Z A;  1KQ8 A;  2Q2E B;  4XRS G;  2YS9 A;  2XAU A;  3DU5 A;  4F91 B;  1PVE A;  2B0L A;  4KN7 X;  2W57 A;  4XRS A;  1CGP A;  1UHS A;  3HEF A;  1G6N A;  1QVT A;  3V7C A;  4E7L A;  4RGX A;  2X6O A;  1I1G A;  3F9K A;  3BDD A;  4HOB A;  3E3V A;  2MGQ A;  5E1W A;  4ENJ A;  4OOI A;  4XR6 A;  1OYI A;  3WTU C;  2M0C A;  1Z6T A;  1BI1 A;  1QRY A;  3HUG B;  1P7I A;  1UZC A;  3TP0 A;  1K4T A;  2IS4 A;  4Y33 A;  1HDP A;  2LFB A;  2FBK A;  1OR7 A;  1QO0 D;  3GO5 A;  3LSK A;  3QP6 A;  4XOR A;  3SZG A;  2MSY A;  3PSI A;  4Q48 A;  4UV9 A;  4W1U A;  2M0M A;  4L0Y B;  2NOG A;  1TWF J;  2L4A A;  4B8X A;  1SD7 A;  2DA2 A;  2P81 A;  2HTJ A;  2JT1 A;  3LNQ A;  2K9N A;  4HZF A;  4CCN A;  5DUI A;  2OTJ I;  2R5Z A;  1UMQ A;  4AWX B;  1TLH B;  2L01 A;  5J4V A;  1IDY A;  4OAY A;  5BOX A;  1WFX A;  1LFP A;  3AG2 H;  2FOK A;  5HLH A;  3CJR B;  4XLC A;  1XGM A;  1UHM A;  3GFI A;  4E7I A;  2YU9 J;  2Y48 A;  2Z5U A;  3I71 A;  1AKH B;  2Z1D A;  3QQA A;  1OCO H;  5JFR A;  5J1R A;  1Z91 A;  5E8I A;  3I54 A;  4NBQ A;  1CF7 A;  2M1B A;  2PBI A;  2HEO A;  2DYR H;  2XAS A;  1FSH A;  1D0Z A;  2V9V A;  1FYK A;  1B72 B;  1U3E M;  5BS6 A;  1YRN A;  2FQ3 A;  3ABM H;  2GA2 A;  2JJ7 A;  3QPH A;  1HXD A;  2PG4 A;  1D5V A;  4NB5 A;  4RDU A;  2RN7 A;  4JOM A;  4XM3 A;  3PUB A;  4O3M A;  4IEJ A;  4IXA A;  2ZME B;  4ZYH A;  1XDS A;  4FQG A;  4PJ0 C;  5F64 A;  2CG4 A;  1MJ9 A;  5GAD J;  4G7O F;  2HXI A;  3S1N J;  3A03 A;  2YR2 A;  2FX0 A;  1YS6 A;  2KIM A;  2Y9Z A;  1BI0 A;  3CD6 I;  1HA8 A;  3S1M J;  4IHY A;  1G2H A;  3FXQ A;  1YI2 I;  4D0P A;  5ILS A;  3J80 K;  5KAI C;  2MAB A;  4AVP A;  3ZQC A;  1AKH A;  1VQP I;  2GBY A;  4BUP A;  4XSZ F;  5IPA A;  2VOD A;  2GOX B;  3L00 A;  3AL0 C;  3BG3 A;  1U0J A;  1YE9 A;  2CQN A;  2RAE A;  2G9W A;  4BQO A;  3KLO A;  2V26 A;  1S7E A;  3J7A O;  4II3 A;  5F0H A;  1WRJ A;  3I59 B;  2P7C B;  1ZAR A;  2GWR A;  4OIO F;  2H8W A;  2BZT A;  4R79 A;  4NNJ A;  3K4M A;  1YIJ I;  1RRJ A;  2VB6 A;  5B1A H;  3CP2 A;  2R4G A;  4I0B A;  3HIF A;  4HX7 A;  2RQQ A;  1JI8 A;  2XB5 A;  1V3F A;  2WV0 A;  1HBX G;  4GYI A;  1N25 A;  2H09 A;  3I58 A;  3IH4 A;  1UG0 A;  1DUX C;  3QPT A;  1FOK A;  5CVU A;  1QPM A;  1ZK8 A;  3GEZ A;  2LLK A;  3TO9 A;  4X0G A;  4ZC3 A;  3F6V A;  2V1X A;  2YU3 A;  4HNV A;  2R3S A;  4J01 A;  1W36 D;  1UAA A;  1LEA A;  5CQE A;  1D1C A;  2JK3 A;  2LC2 A;  2L7M P;  1YG2 A;  2GQQ A;  3KCC A;  3WG9 A;  1DGW Y;  1X1D A;  5IT3 A;  1ZH5 A;  3K4C A;  4I02 A;  4M3F A;  1WJD A;  3PO2 J;  1G8X A;  3LAP A;  4MNU A;  2V6E A;  1WZ2 A;  3JRD A;  5TIS C;  4HX4 A;  1JT0 A;  4WX9 A;  3K1P A;  1XMK A;  1FOY A;  4AD9 A;  4D7M A;  2AQE A;  2Y0S N;  4G6T B;  1U5T A;  2M3A A;  2ZCW A;  2W25 A;  2L7Z A;  2VPL A;  2ESN A;  5D6E A;  4ENN A;  2HOA A;  4NHJ A;  4AM3 A;  1R4N B;  4LB5 A;  2GA1 A;  3NWT A;  2HPI A;  2CMP A;  3MAJ A;  3C2G A;  2HQR A;  3DPL C;  3I9V 2;  2VE8 A;  3KZI C;  3JRE A;  4C3I J;  2ME0 A;  3W2V A;  2R7D A;  1Z3Y A;  4DZP A;  2HZD A;  2ZME C;  3VDX A;  1KGS A;  1B8I B;  2LSO A;  4EMS A;  3DKW A;  1AHD P;  1RR7 A;  3OS1 A;  2EIL H;  4RAF A;  2DBB A;  2ISY A;  3FKI J;  1IRX A;  5J1U A;  1ONV A;  4BGD A;  2DTR A;  4LLN A;  3KP4 A;  3HDD A;  4PCQ A;  4HST A;  2W82 A;  3JRG A;  3HG9 A;  4UY8 I;  3V8J A;  2W7N A;  2DPU A;  2HWV A;  1ERD A;  1XMA A;  3GZN B;  4OMZ A;  3LSP A;  4B44 A;  3C2H A;  3SEZ A;  1SMY F;  1YX3 A;  1EF4 A;  3ERE D;  3WTV C;  2KLO A;  2KQR A;  3E1S A;  5AIP A;  3HL2 A;  1K7A A;  3KPH A;  2G0E A;  2ZXJ A;  2JQ7 A;  2R7O A;  4BHC A;  4QWQ A;  2XAH A;  4XKW A;  3BTL A;  2IPQ X;  4LIT A;  3CF5 F;  1ACI A;  3VOE A;  3UR3 C;  2EIK H;  2NVX J;  3CDL A;  5BNG A;  1Z6R A;  4EGY A;  2BY0 A;  3FM3 A;  3RCO A;  2F4O B;  5LEK A;  4P9F A;  1DDN A;  3FK7 A;  2VT2 A;  2EQR A;  3IWF A;  4I99 C;  3OWT A;  1Y6I A;  4PUS A;  1FNN A;  4BDY A;  2HXO A;  2IS6 A;  3E5U A;  4DBQ A;  2K3P A;  3ZN1 A;  1PP7 U;  3K9T A;  4ZDL A;  2BVM A;  3A01 A;  2I10 A;  2UV1 A;  4A5M A;  4HSR A;  3MCZ A;  1QBJ A;  3VSL A;  4CZZ A;  1IF1 A;  2DFF A;  3RTR A;  3WTT C;  1TL8 A;  1XS9 A;  3HB9 A;  1P7J A;  3CDI A;  2FF4 A;  4LOC A;  4BXU A;  1DU0 A;  4UXN A;  1WH7 A;  4PK4 A;  2RC4 A;  4B3A A;  1ZG1 A;  4II2 A;  1WI3 A;  3KZZ A;  4EGZ A;  5ED4 A;  1G3Y A;  3SDB A;  1FJL A;  3K4L A;  5M5X J;  4IHT A;  3LA2 A;  3HKZ A;  2Q8K A;  3KEY A;  5D5W B;  2DA1 A;  2LBF A;  1BC8 C;  1Z7L A;  3HPH A;  2H6C A;  5HVQ C;  4LIU A;  2NVY J;  2GM4 A;  5DYM A;  1AWC A;  3BTI A;  3J7Y J;  3RKY A;  5E8G A;  2BYV E;  1QZE A;  3FXJ A;  1FMV A;  1OFC X;  4HLY A;  1VQ5 I;  4HA8 A;  1UST A;  2UWM A;  1O7F A;  3K7A J;  3OYK A;  3WTZ A;  9ANT A;  3R60 A;  5CVV A;  3F21 A;  3ECO A;  1R1T A;  5HS8 A;  3RQI A;  4CCL A;  4LJZ F;  4L5J A;  2LD5 A;  3AAF A;  1GHC A;  2LY2 A;  4ZH4 F;  2VAS A;  5HLG A;  1YJN I;  2FA5 A;  4RB1 A;  2QVO A;  3J7Z I;  5KNL A;  3CME I;  5HLT A;  2HOS A;  1UG2 A;  3B02 A;  4ZZD A;  3OIO A;  3ZQ7 A;  1PDN C;  5IYD J;  3JRH A;  1H0M A;  1KU3 A;  2VBY A;  5F1J A;  2VON A;  3FBI B;  1IXS B;  1MH4 A;  3QYB A;  1IW7 F;  1EA3 A;  3Q0W A;  2LKP A;  2VIX A;  1KON A;  2ZBK A;  3EUA A;  3D5S C;  1UFM A;  4NC6 A;  5FRO A;  3PFI A;  3PUF A;  3QOP A;  4BHB A;  1K4S A;  3QYF A;  3FF5 A;  2BE5 F;  3JR9 A;  3V8K A;  4KIG A;  4A3E J;  5A2Q K;  4HAM A;  1Q1V A;  2YUS A;  5HNH A;  2IT0 A;  2DT6 A;  1IGN A;  1LVA A;  1NG7 A;  4RS8 A;  3DEW A;  1Y0N A;  3LSG A;  3KFW X;  3DTK A;  3DBH B;  3I5U A;  3RPQ A;  1IRF A;  4A3D J;  5KHD A;  1NK2 P;  2LKS A;  3S1R J;  1VQK I;  1VQL I;  4Q5S F;  3LWF A;  5ICG A;  2DU9 A;  1RPW A;  4BEH A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 5GP9 A;  1ETW A;  3BR2 A;  3JRF A;  3NAR A;  3O8G A;  1JUM A;  1ZGW A;  3B6C A;  2CRG A;  4S0H B;  2CUF A;  1MSE C;  3OSG A;  1B72 A;  3S16 J;  4BBR J;  3ZQL A;  2DA3 A;  2LR8 A;  3LOC A;  3TW6 A;  4J19 A;  2XB0 X;  1APL C;  3RZO J;  4X6A J;  2DMQ A;  1K61 A;  1RKT A;  1LE8 B;  4DYR A;  5M5Y J;  3CMY A;  1X58 A;  4JYK A;  1HLV A;  2DA4 A;  1H8A C;  1LFU P;  4AC0 A;  3HOV J;  2TRT A;  3C2B A;  3IH2 A;  1ZKG A;  2R7Z J;  2DMU A;  4EEF G;  4BKX A;  1W0U A;  3S14 J;  4V2G A;  2EZI A;  1U78 A;  1RKW A;  2FD5 A;  1HCR A;  2DA5 A;  4JX4 A;  2WV1 A;  4M6V A;  3HOU J;  1ETQ A;  2JMW A;  5EF6 A;  4D7N A;  4A93 J;  5F27 A;  4A3C J;  2D5V A;  2JWT A;  2ELK A;  1H89 C;  3VPR A;  5DS9 A;  1XG1 A;  1MBE A;  1QVU A;  5GPC A;  3NAU A;  3HGG A;  5FLV A;  3WHC A;  1Z77 A;  2L0K A;  3MVP A;  2VKE A;  2O7O A;  3BR3 A;  3BR1 A;  4JX6 A;  4UUT A;  4A69 C;  5EG0 B;  1ORK A;  3S2H J;  5IP6 A;  2IEK A;  3D1N I;  1R9T J;  4DYQ A;  1IDZ A;  1HOM A;  1BA5 A;  2DTZ A;  1XC5 A;  1GT0 C;  1MBK A;  3JRA A;  1ZQ3 P;  1IV6 A;  4BY7 J;  3GTK J;  4L5E A;  4FCY A;  5C4J J;  2JA5 J;  1MBF A;  3F0C A;  3OSF A;  1BW5 A;  3HOW J;  2XPU A;  4MFD A;  3BR6 A;  4CYC B;  3PM1 A;  4A3F J;  3BQY A;  1H88 C;  3BR0 A;  5F0C A;  3BTC A;  2JN6 A;  4A3I J;  3CCY A;  1PUF B;  1BL0 A;  2E19 A;  5M5W J;  2IBD A;  4MO7 A;  4D5F A;  5K7Z A;  1IUF A;  1Z0X A;  5M3F J;  3ZQF A;  3S2D J;  1YRN B;  3FK6 A;  1OCP A;  3A01 B;  2DMP A;  1CQT A;  4FE7 A;  2R5Y A;  3TP3 A;  2M34 A;  4G12 A;  4XRS G;  2YS9 A;  1GVD A;  1FIA A;  1NK3 P;  2XSD C;  1JKP C;  4M3B A;  2PMZ N;  4XRS A;  5C4X J;  1UHS A;  3HEF A;  2VKV A;  1QVT A;  3I4M J;  2X6O A;  3WHB A;  2XRL A;  2EBI A;  2MGQ A;  1IG7 A;  2HYJ A;  5EYR A;  2M0C A;  1QRY A;  4M3G A;  1P7I A;  2LY9 A;  2VI6 A;  3TP0 A;  2O8K A;  3MN2 A;  1HDP A;  2LFB A;  3SDG A;  3GTL J;  2MSY A;  1T33 A;  1BW6 A;  2LKX A;  4W1U A;  2EZL A;  2M8G X;  3BG5 A;  2NOG A;  1I50 J;  1TWF J;  3GTM J;  2DA2 A;  2OF7 A;  2P81 A;  1FTT A;  3LNQ A;  2K9N A;  2ECB A;  3K2A A;  2R5Z A;  1UMQ A;  1IDY A;  5GPA A;  5E3M A;  5IOY A;  2DMT A;  1WH5 A;  4QSH A;  2FQ4 A;  3GTP J;  1D5Y A;  2E2H J;  3S15 J;  1SAN A;  2YU9 J;  1ITY A;  4MFE A;  2HQ5 A;  1AKH B;  3QQA A;  4FIS A;  5J1R A;  3IV5 A;  1LE8 A;  1JJ8 C;  1Y1W J;  5JLX A;  5JLW A;  2K9S A;  2R5Y B;  3TW7 A;  1QPI A;  1B8I A;  1B72 B;  3HOZ J;  5K7F A;  1RES A;  3UKG A;  1YRN A;  5E3N A;  2QCO A;  2JJ7 A;  4XID A;  1JUS A;  1DU6 A;  1JKR C;  4RDU A;  3LSJ A;  3QPS A;  2WAQ N;  5C3E J;  2DA7 A;  4M3D A;  5F0F A;  2HI3 A;  4IEJ A;  3O8H A;  2NVQ J;  1Y1V J;  2COB A;  4W97 A;  2HXI A;  1TWG J;  2XGC A;  3S1N J;  3A03 A;  4C2M J;  2DA6 A;  2FX0 A;  3HKZ N;  5F08 A;  2LTP A;  2Y9Z A;  4DZJ A;  4A3J J;  5FLM J;  5FKK A;  1F43 A;  1U9O A;  3S1M J;  3HM5 A;  2VUM J;  4IHY A;  1G2H A;  4I76 A;  3B6A A;  2Y2Z A;  2E1O A;  2EZH A;  5FKL A;  1TC3 C;  3BT9 A;  3RZD J;  3ZQC A;  1AKH A;  2GBY A;  5EG0 A;  5IPA A;  4IHX A;  3BG3 A;  4A3G J;  1NTC A;  2RAE A;  1VFC A;  2XPV A;  2JA7 J;  2EH3 A;  1S7E A;  1POG A;  1GV2 A;  5F0H A;  1I3Q J;  3A02 A;  3MKL A;  4MIM A;  1W0T A;  3HBL A;  2R92 J;  2HDD A;  1E3O C;  3GTG J;  2N8G A;  1ETX A;  2H8R A;  3Q0U A;  3W6V A;  1TWC J;  1IC8 A;  3FIS A;  2IAI A;  3ZQG A;  4QIW N;  2XGE A;  4FE4 A;  2XB5 A;  5FKN A;  3CQZ J;  5IYB J;  3IH4 A;  3ZOB A;  5FJ8 J;  5J1Y A;  2M2E A;  3L1P A;  1ZK8 A;  2LLK A;  4XIC A;  4FTH A;  4HNV A;  3HOY J;  3JRB A;  5J3L A;  2DJN A;  2W48 A;  1K83 J;  1U9N A;  1F36 A;  2JK3 A;  5EGO B;  2L7M P;  1ENH A;  1OJL A;  5EDN A;  2GLO A;  4M3F A;  2CUE A;  3RKQ A;  5IOZ A;  3PO2 J;  1X2N A;  3ZQH A;  2KDZ A;  4Y52 J;  2Y9Y A;  1GV5 A;  1ETV A;  2CU7 A;  3JRD A;  1ETY A;  1JT0 A;  2ID6 A;  3FIW A;  4IHV A;  3SFI A;  4D7M A;  5HOD A;  1JJ6 C;  2VPR A;  2Y0S N;  3E7L A;  1ETK A;  2TCT A;  2L7Z A;  1HF0 A;  2HOA A;  2Y31 A;  4BY1 J;  2ECC A;  1AU7 A;  1GDT A;  3JRE A;  1ZR4 A;  4C3I J;  4JP0 A;  4NDL A;  2ME0 A;  1VND A;  4DZP A;  4XRM A;  1B8I B;  5E3O A;  4I6Z A;  2DMN A;  1AHD P;  1RR7 A;  4D5C A;  2XPW A;  5IP7 J;  3FKI J;  5J1U A;  2OPT A;  3BTJ A;  2LK2 A;  2WB1 N;  2LVS A;  3HDD A;  2NS7 A;  2X48 A;  1ZR2 A;  3JRG A;  3QPL A;  2X9D A;  4UUS B;  2M9H A;  1ETO A;  3BQZ A;  1JT6 A;  3LSP A;  2R5Z B;  1EF4 A;  4B4C A;  1MBG A;  5F04 A;  2XGD A;  1RET A;  4Y7N J;  2G0E A;  1JGG A;  2L9R A;  2B63 J;  3BTL A;  1T56 A;  4IHW A;  1IRZ A;  4RBO A;  1MBH A;  2NVX J;  3CDL A;  5BNG A;  2CQQ A;  2EZK A;  3FK7 A;  2EQR A;  1MSF C;  1OCT C;  2CJJ A;  5E3L A;  1JUP A;  2HXO A;  3JRC A;  2AO9 A;  1JKQ C;  3G1M A;  4A3L J;  2MW8 A;  3I4N J;  3G1O A;  4C3J J;  4XK4 A;  1BJZ A;  2H1K A;  3S1Q J;  4JX5 A;  2I10 A;  3A01 A;  2K40 A;  1XS9 A;  3HB9 A;  1P7J A;  2L7F P;  3JRI A;  1ZTR A;  4LOC A;  1DU0 A;  3Q0V A;  1WH7 A;  4B3A A;  2JA6 J;  1SFO J;  1PUF A;  4AYB N;  1IJW C;  1WI3 A;  4A3K J;  1TWA J;  1LFB A;  3H3V K;  1I6H J;  1FJL A;  5M5X J;  5C44 J;  3SJM A;  1VF9 A;  2R93 J;  3S17 J;  4A3M J;  4DW6 A;  4CYC A;  2MG4 A;  3OOU A;  1JTX A;  2DA1 A;  1VI0 A;  3IH3 A;  4DYC A;  2QF7 A;  4X1E A;  1TWH J;  2NVY J;  3Q3S A;  2GM4 A;  4AUX A;  3BTI A;  1MBJ A;  1OFC X;  1A5J A;  5FKM A;  2E2I J;  5IYC J;  2DN0 A;  5EEA A;  3H0G J;  3K7A J;  3GTQ J;  3HGY A;  2R0Q C;  5EZH A;  4BXX J;  9ANT A;  1X2M A;  4B1R A;  3GTO J;  2NVT J;  1WCM J;  5FKO A;  3RQI A;  1U8B A;  2LD5 A;  1HDD C;  3DCF A;  5EGO A;  1A6I A;  4MLO A;  1MNM C;  3GBG A;  5M3M J;  1WPK A;  1FEX A;  2CQX A;  1JKO C;  3G1L A;  2FJ1 A;  4BBS J;  4QTR A;  2HOS A;  1UG2 A;  2E2J J;  3OIO A;  1MH3 A;  3BR5 A;  1FIP A;  2O9L A;  5IYD J;  3JRH A;  5K7H A;  2K9Q A;  2AHQ A;  5F1J A;  2NS8 A;  1WGX A;  1MH4 A;  2JA8 J;  4C3H J;  3Q0W A;  4UUS A;  1FTZ A;  3HOX J;  5IP9 J;  2ZB9 A;  3PO3 J;  1JTY A;  5EZG A;  3JR9 A;  4A3E J;  4V2F A;  1Q1V A;  4ABZ A;  2YUS A;  3BG9 A;  4M3E A;  2KT0 A;  1IGN A;  3M4O J;  3LSR A;  3M3Y J;  3DEW A;  3LSG A;  2ME6 A;  5DTD A;  2ID3 A;  2Y30 A;  2LP0 A;  4A3D J;  3ZQI A;  4A3B J;  1NK2 P;  4GFB A;  3S1R J;  3TED A;  3GTJ J;  1O4X A;  2HOT A;  1GUU A;  1RPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...