5EGOA

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein Meis1
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoA00
2DMNA 4MFDA 3TW7A 3WHBA 1F36A 2EZLA 3B6AA 1ETKA 1Y1VJ 2VKEA 2CUEA 1GV5A 1TC3C 2YU9J 1JKRC 4JX6A 4DW6A 1WH7A 4BY1J 1HDPA 3RZOJ 2CJJA 5GPCA 5F0HA 4C2MJ 2KDZA 1K83J 2GBYA 3HOVJ 4B4CA 3S17J 1IRZA 2LD5A 4BBSJ 2EZIA 3IH4A 4BY7J 1VFCA 3RZDJ 1Y1WJ 3GBGA 4XRSA 1ENHA 4UUSA 3JRCA 3JREA 3HGYA 1RESA 3JRBA 1ZK8A 1SFOJ 4A3EJ 9ANTA 1B8IA 3MVPA 4J19A 2E2IJ 2CU7A 1WPKA 2XPUA 2R93J 3HM5A 1ETXA 4JX5A 3H3VK 1MSFC 2RAEA 1G2HA 3LSGA 1H88C 1ZR2A 3A01B 2R5ZA 1NK3P 2H1KA 4FCYA 4I6ZA 2B63J 2IEKA 2E2HJ 4JP0A 3ZQGA 5FKLA 1A5JA 1U9NA 1ORKA 2HOAA 1WH5A 2LR8A 5EZHA 2M0CA 2M34A 3PO2J 3QPLA 2P81A 2LFBA 2ME6A 4IHWA 3DEWA 5J3LA 3JRDA 2DA6A 2K9QA 3GTGJ 5M5YJ 4DZPA 4HNVA 2XPVA 3H0GJ 3LSPA 2E19A 2XB5A 3HOXJ 2JMWA 5FKMA 1T33A 5FLVA 4QSHA 3O8GA 5M3FJ 3W6VA 4NDLA 2ECBA 3BR1A 4XICA 5J1YA 2NVQJ 1P7IA 5IP9J 1MBFA 4UUSB 1UHSA 4G12A 3QPSA 1IDZA 3ZQIA 3ZQFA 2XGEA 2GM4A 1JKPC 3S14J 2M8GX 3CQZJ 5BNGA 3BR5A 2Y30A 1MBHA 2W48A 2JN6A 1W0UA 4V2FA 1ZTRA 3GTQJ 4A3KJ 2JA6J 1TWCJ 1LFBA 4B1RA 2HI3A 2VKVA 3CDLA 3PO3J 3F0CA 3FIWA 5EF6A 3LNQA 3HOZJ 3S2DJ 2EZKA 1APLC 3S2HJ 2DN0A 3GTMJ 1BW6A 1S7EA 5K7HA 2Y2ZA 2X48A 2CRGA 5JLWA 4A93J 4I76A 3ZQLA 3FK7A 2EZHA 3LSJA 2Y31A 1H8AC 3BG5A 3B6CA 2O8KA 4W97A 1RKWA 3RQIA 1MSEC 2DA3A 3SFIA 3S1MJ 1TWAJ 2AHQA 2O7OA 3M4OJ 2JA8J 4XK4A 3M3YJ 3Q3SA 5EYRA 2X9DA 5E3MA 5FLMJ 5F1JA 1FEXA 3HGGA 1JKOC 1FJLA 5EZGA 1JKQC 3HBLA 1BW5A 1MH4A 4A69C 3HEFA 2R5YA 3G1MA 2XPWA 2IBDA 3SDGA 1YRNB 1FTZA 1IDYA 5DTDA 1ZQ3P 2HXIA 4GFBA 1LFUP 4C3JJ 1X2NA 1BJZA 2LY9A 1NK2P 3GTPJ 2EQRA 1T56A 3QQAA 2DMPA 1MH3A 2ELKA 5JLXA 1SANA 1MBGA 2O9LA 2DMUA 2FJ1A 4BKXA 5C4XJ 3LOCA 1UMQA 3S16J 3IH3A 4A3MJ 3BQYA 2R7ZJ 4A3GJ 2KT0A 5FKNA 3OSGA 1PUFA 5C3EJ 3HOYJ 3C2BA 1POGA 2G0EA 3HKZN 4ABZA 2E1OA 2QCOA 2FD5A 4BBRJ 1Q1VA 1XC5A 2NS7A 1ITYA 5F08A 2K9SA 2R92J 1K61A 5K7ZA 2DTZA 1A6IA 1X2MA 2DA1A 1W0TA 1EF4A 4IHVA 2ID3A 2L7MP 2HDDA 3HOUJ 3BTCA 2IAIA 4AYBN 2N8GA 5EDNA 3D1NI 2EH3A 3WHCA 2DA2A 4QTRA 2DJNA 4XRSG 3S1RJ 3HB9A 5IPAA 3L1PA 3BR2A 1B8IB 3BR3A 2LKXA 3JRGA 2M9HA 1HF0A 4IHXA 2M2EA 5IOYA 1E3OC 4A3IJ 1U78A 1TWHJ 1OCPA 2L7FP 3VPRA 5F0CA 3BR0A 2ZB9A 1GVDA 2L9RA 4X6AJ 5K7FA 3SJMA 3Q0UA 1IJWC 4MIMA 1O4XA 3BTIA 2LTPA 5IOZA 3BG3A 5IYDJ 4M3BA 5EGOA 2NVYJ 2LLKA 2WV1A 5M3MJ 3JRHA 2HYJA 2MSYA 3FISA 2Y0SN 3BQZA 1MNMC 1JJ8C 1CQTA 1BL0A 2FQ4A 3A02A 3CMYA 1Z77A 3TW6A 5FJ8J 2YS9A 2CUFA 3TP3A 1LE8A 5FKOA 1GV2A 3UKGA 4IEJA 1WCMJ 2LP0A 2JK3A 1H89C 2GLOA 1JT0A 2LK2A 3A01A 4UUTA 1JTXA 3G1OA 5E3OA 2DA5A 2EBIA 3RKQA 4FE4A 5E3LA 2LVSA 1RPWA 3TP0A 1MBJA 2VUMJ 3BTLA 5EG0B 1FIAA 1B72B 1IGNA 3BR6A 1GT0C 4AC0A 4S0HB 1DU0A 2H8RA 4A3LJ 2ME0A 1I6HJ 5DS9A 2D5VA 1JUMA 4CYCB 3A03A 5HODA 1DU6A 1JTYA 1I3QJ 5EGOB 5C4JJ 3Q0WA 2DMQA 1JUPA 3OSFA 1ETYA 1AKHB 1U9OA 4A3DJ 1TWGJ 4A3CJ 1ZKGA 3ZOBA 1OJLA 2DMTA 2XB0X 2FX0A 2WAQN 2NS8A 4EEFG 5IYBJ 2DA4A 5J1UA 3PM1A 2NVXJ 2HXOA 4FISA 1WI3A 3JRAA 2K9NA 4M3FA 2NOGA 5EEAA 1P7JA 3K7AJ 2OPTA 1UG2A 1ETQA 4C3HJ 4D7MA 2VPRA 2HOSA 4X1EA 3TEDA 2VI6A 2XGDA 4D5FA 3GTOJ 3IH2A 1BA5A 2HOTA 4A3FJ 4A3JJ 2HQ5A 2NVTJ 3GTJJ 1ZGWA 3FK6A 4XIDA 4Y7NJ 2XRLA 3NARA 1HDDC 1JGGA 3S1QJ 1QPIA 3S15J 1JUSA 1OFCX 3BT9A 3DCFA 4MLOA 4QIWN 1ZR4A 4IHYA 4LOCA 1U8BA 2YUSA 2PMZN 3MN2A 2QF7A 3Q0VA 5M5WJ 3JRIA 2CQQA 2JA7J 2JA5J 1AKHA 1IV6A 4MO7A 1XS9A 2JJ7A 2Y9ZA 1TWFJ 1MBEA 5J1RA 3GTLJ 2WB1N 1XG1A 5F0FA 3LSRA 1Z0XA 4M3GA 1I50J 1RETA 3FKIJ 1FTTA 2AO9A 3OIOA 2TCTA 3OOUA 3MKLA 4RDUA 1HCRA 1VNDA 3K2AA 3E7LA 3O8HA 2ID6A 2I10A 1QRYA 3HOWJ 2MGQA 3BTJA 3I4NJ 1IG7A 1PUFB 1YRNA 5IP6A 2COBA 1ETOA 5F27A 2MW8A 5FKKA 1HOMA 2X6OA 4DYRA 3I4MJ 1RR7A 3G1LA 3HDDA 4JX4A 3JR9A 4XRMA 1GDTA 1IUFA 4DYQA 2CQXA 5M5XJ 1JT6A 1RKTA 1GUUA 4Y52J 4M3DA 1FIPA 2ECCA 4DZJA 4DYCA 1B72A 1NTCA 4W1UA 1HLVA 1MBKA 3ZQCA 5EG0A 2XGCA 1X58A 2L0KA 5E3NA 4B3AA 2JWTA 2R0QC 1QVUA 1QVTA 4M6VA 5GPAA 4D7NA 2R5ZB 5GP9A 2DA7A 1F43A 4A3BJ 4C3IJ 2OF7A 4L5EA 2R5YB 1VI0A 1ETWA 2L7ZA 3BG9A 1IC8A 4CYCA 5IYCJ 1AU7A 2XSDC 2MG4A 3GTKJ 2TRTA 1R9TJ 1D5YA 1LE8B 4JYKA 2Y9YA 4MFEA 2K40A 4M3EA 5F04A 4FE7A 1AHDP 2E2JJ 3ZQHA 1JJ6C 3S1NJ 5IP7J 3IV5A 1WGXA 3CCYA 3JRFA 4RBOA 1ETVA 4V2GA 4BXXJ 1OCTC 4AUXA 5C44J 4FTHA 3NAUA 1VF9A 4D5CA
chains in the Genus database with same CATH superfamily
3M8JA 4U0VA 2EZLA 3H9GA 4NC7A 4EJOA 3BC8A 3CZ6A 1ETKA 3CD6I 1OQYA 5HNFA 1VTNC 2QYOA 2R7FA 3E5XA 2BW3B 3I59B 5JI6A 2A3SA 1TC3C 4BE1A 4JX6A 4PUSA 1ZGJA 2VC0A 1BI3A 3LFKA 1G4DA 2OU2A 2CJJA 1N78A 1W5SA 1GXQA 5F0HA 1Y39A 3HYIA 2R7QA 4IOCF 2PG4A 2OCCH 3HOVJ 2KDZA 4XNFA 5CLSA 2EZIA 3CUQB 4YIRX 1VFCA 4E70A 3RZDJ 3HOSA 3I0TA 3CCRI 4XRSA 3OYIA 2DQRA 3ERED 4YFNF 1XB4A 2IGMA 3HGYA 2VOOA 1SFOJ 4BHCA 1YJ9I 2VBXA 9ANTA 2DT7B 3EQLF 2CU7A 2VL8A 1WPKA 3ZMUA 5HOOA 3HM5A 1O3QA 2R93J 4IRIA 4JX5A 4ETSA 4IQ4A 1EKEA 3W2AA 1RIOH 2L3DA 2JT1A 3ZR8X 1NK3P 4YFXF 3KEOA 4V19K 1IW7F 2EIKH 4I6ZA 2IEKA 3WU2C 4HLXA 2LKPA 3IHUA 3ZQGA 1USTA 1A5JA 1U9NA 3SQNA 4MTDA 2W7NA 2Q2EB 2QA4I 4YELA 5HDNA 2LR8A 1TTYA 1G8XA 2M0CA 2M34A 3MKZA 3PO2J 3QPLA 3WTSC 5FRNA 2P81A 4IPAA 3J81K 2FE3A 1OYWA 2H94A 3RSNA 3WU0A 3TOAA 4N9IA 2M8EA 2JPBA 2W85A 2BBYA 5EEHA 3S3MA 2E7XA 2H1LA 2QKLB 4DZPA 4HNVA 3H0GJ 3HOTA 4IL6C 2K3FA 2E19A 2XB5A 3KZYA 3DPUA 3HOXJ 1VQMI 1A31A 2M4KA 2DK5A 1J75A 4RB3C 2CH0A 5FLVA 2VJ5A 4QSHA 2L9VA 2OD5A 3VSLA 2VKHA 3BCBA 5J8FA 2VT2A 3W6VA 3GZ6A 2UXXA 3QP6A 2BEOA 2ZXHA 3WG7H 2XKPA 4UUSB 2LNBA 5L3BA 4HF0A 3N4MA 2NNNA 2ZMEC 4CH7A 4KFCA 2CGPA 3ZP5A 2GM4A 5LHGA 1SFUA 1UCRA 5BPIA 2XIGA 5KHDA 5BNGA 1B6AA 3BR5A 4LK0F 4AM3A 3IC7A 2DJIA 3HRTA 3VYUB 3L2VA 4KISA 2GZWA 4A3KJ 2JA6J 2P6SA 3I55I 1ZRCA 1VQ4I 1LFBA 2HI3A 2HDWA 3F0CA 3FIWA 2GOXB 3LNQA 2EZKA 3ABUA 3H3UA 3FXRA 1J09A 1XGSA 1DP7P 2RDPA 2V4JC 3JW4A 4GGGA 1IO2A 1O3TA 5K7HA 1CF7B 2KQRA 4DQ2A 2KZGA 2X48A 5JLWA 3ZQLA 1MKMA 2EZHA 3LSJA 2Y31A 2FXAA 3BG5A 1C0WA 3S93A 3RPUD 3B6CA 2BY1A 2LREA 2O8KA 2OBPA 2K3PA 4C2TA 4UNOA 4YIIA 5KCMA 1BR2A 3S1MJ 4XOTA 2NXNB 3HKZA 4FT8A 3BPXA 4CCMA 1TW3A 3C2HA 3AL0C 1V5EA 2DDBA 5E3MA 5FLMJ 5F1JA 3HGGA 1JKOC 2ADUA 5EZGA 4ZYGA 4A69C 4P1WA 4RAGA 5D4RA 2KL4A 3SDGA 2DOEA 4DNCA 5H20A 4L9TA 3ECOA 3RPQA 1WWXA 4RAZA 3ABMH 3K4MA 1R7JA 1BJZA 2FSWA 3GTPJ 1FLIA 2EQRA 1T56A 1I1SA 1EA3A 4CZZA 2XSJC 2ELKA 3OY9A 1MBGA 2FU4A 3TGNA 4LLNA 2E1NA 3GX4X 2FJ1A 4BKXA 5C4XJ 2QBYB 2PJRA 4A3GJ 2OA4A 1W36D 5ICEA 3OSGA 5HLHA 5C3EJ 3OS2A 1X1CA 1PUFA 3C2BA 3HOYJ 2I5UA 1D3YA 1EH7A 2H8WA 3NWTA 3TDUC 4PJ0C 3ABLH 2FD5A 2EFNA 1ITYA 1XC5A 3HRSA 4BYYA 1B9MA 1U2WA 2DTZA 1A6IA 3KYDB 3AG2H 3FMSA 3CJRB 1W0TA 1J59A 2V9VA 1WQ2A 5L3CA 2K02A 1YE9A 4UHTA 4B44A 3IKVA 2VC1A 4AYBN 2QVOA 3LQRA 2VQHA 2XVCA 3DWLE 4XRSG 3OYEA 2X6WA 3QPHA 1BM9A 1B8IB 3GUDA 1S7OA 3FDYA 3JRGA 6PAXA 4OMZA 2M9HA 4IHXA 2M2EA 3VYTB 3FWEA 1FP1D 3J80K 2H27A 1E3OC 4JK1X 3I53A 2FRHA 1U78A 3K1NA 1OCPA 2L7FP 3CUOA 4WXHA 2H6CA 3VODA 4BL0B 2K85A 2PEXA 2EB7A 4X6AJ 2JSPA 3Q0UA 1BN5A 4MIMA 5CJ9A 4ESJA 1K6YA 4BQAA 2V1DA 3SDBA 5AONA 1BC7C 4PGGA 1FT9A 3QRFF 3CESA 2FBHA 5EGOA 1K4SA 4E6KG 1FYKA 4NHJA 2LLKA 4R8HA 1R5GA 5M3MJ 1K4TA 1XGNA 1TLHB 5BS6A 5AIPA 1AA7A 3E6MA 1MNMC 4EATA 5LGNA 2VIXA 2ZXJA 1CQTA 3L9FA 1FOXA 1UB9A 3GLLA 2DOAA 2CUFA 3TP3A 5KAFC 2HVRA 3CMEI 4XL9A 1KGSA 1X1AA 1GLNA 1GV2A 1V5FA 2AXLA 2QEXI 1FSHA 2O61A 2K7LA 2K27A 1WCMJ 2CG4A 2JK3A 2NNYA 2CUZA 4OIOF 2Q1ZB 1JT0A 2LK2A 3A01A 2L4MA 3OL3A 2W4SA 3CO7C 1Z6TA 5E3OA 3B02A 3OIQA 4A0XA 2EV5A 3DFGA 4LMYA 2F48A 2HQAA 1HC8A 4FE4A 3KETA 4O6JA 3WTXC 1RPWA 3G3ZA 1MBJA 4ENNA 3SXYA 5EG0B 4XN0A 1V4RA 3K70C 1IGNA 1SFEA 1GT0C 4S0HB 2C6YA 1XDSA 2AQEA 2CYYA 3LSKA 1I6HJ 3F21A 2IS1A 5DS9A 2P8TA 3W6JB 4ENJA 3OYHA 3A03A 2HDCA 4HPQA 4F91B 4TV7A 2LYCA 1JTYA 5LD2C 4II2A 3Q0WA 2BV6A 4CXFA 3OSFA 2ISZA 1W7PB 3R0JA 4XLPF 2L02A 3IL2A 4RB2C 1U9OA 4HX8A 4F55A 5KNLA 1MDMA 3ZOBA 1HW5A 2XB0X 1CF7A 3H9JA 1STZA 1CGPA 2MD0A 3NEUA 4XQFA 2WB1A 4HW0A 4MEYF 3PM1A 3JAMK 3F9KA 3UR3C 2LOOA 3K4NA 1E0EA 4Y13A 2ZJPF 5E1ZB 5EEAA 4E7LA 1P7JA 5E8IA 3WGHA 3I71A 4HV6A 3MMYB 1J7KA 4HF1A 3CCJI 1EV7A 4BH9A 1FYMA 1SFXA 5D8KB 3J81Z 4D7MA 4A0YA 3S3OA 4DOZA 4ZTJA 2CFOA 3D5RC 4PK4A 3IH2A 3PSIA 1TT5B 1K78B 3FMRA 2VXDA 2HQ5A 1RNLA 4P5OA 1ZYRF 1WJEA 3COAC 4NB5A 2X1CA 2XRLA 3GWZA 4ZYHA 4OIQF 1JGGA 3S1QJ 3QYFA 3S15J 3LA3A 3BJOA 3BT9A 4MLOA 1JGSA 5FGMA 1V55H 2E1MB 2YUSA 3IAS2 4Z2YA 1X19A 4XKWA 3OYJA 4AIDA 2PQ8A 3JRIA 2A6EF 2DDAA 2M30A 3IRRA 4L0ZB 3K10A 4RGSA 1OR7A 3VYRB 3F22A 1AKHA 4MO7A 2JJ7A 1MBEA 1UFMA 2KRFA 3GFJA 5J1RA 3GTLJ 4XLCA 4E7HA 1N77A 4G6TB 3P7NA 2A69F 1LFPA 1FZPB 3FKIJ 1FTTA 1WJCA 4Y17A 4BS9A 1NG7A 3DP7A 5HS8A 4EQQA 3OOUA 1SVLA 3MKLA 4B47A 1HCRA 2VBYA 2F5VA 1VQ9I 2KRHA 2NOJB 5FRMA 4LK1F 3EUAA 1SD6A 2MGQA 1LDKB 1PUFB 3CP2A 4KNYA 3ISPA 3HSRA 5LHHA 1TL8A 3IWFA 4ZJZA 4DYRA 1JHFA 1RR7A 3HDDA 1GDTA 1T2KA 1IUFA 4BDYA 1FMVA 1GUUA 1MJAA 5ILUA 3IP4B 3LAPA 2V1UA 5FLXK 2G7HA 2Q0OA 4I02A 3PNVA 2XGCA 2DAOA 1X58A 4M74A 5E3NA 4RMNA 4LIVA 1T6SA 2R0QC 1QVUA 2DA7A 2R5YB 1ETWA 2ZSHB 5A2QK 1IC8A 2X1DA 5IYCJ 3BZCA 1R1UA 3LWFA 2VE9A 1R9TJ 3F72A 2LBFA 3B73A 4Q5SF 4MFEA 1Y56A 2K40A 4ZC3A 3HUGA 5TJJA 3T1BA 3LFUA 5HS9A 1Y0NA 4BQQA 2PLYA 2CV2A 1BI1A 1S3JA 2ZNZA 3RJPA 3JAMZ 2FNPA 2KISA 3TO6A 3IV5A 4O3MA 4UV9A 4AVZA 1LJ9A 4BEHB 1B4AA 3N05A 3NAUA 1T95A 1UHMA 2KHMA 4IZZA 2STTA 2GXGA 3ML6A 1F36A 3Q9SA 2ZNYA 1X1PA 2OUMA 3DPTA 3LL7A 4G7ZF 2QQAA 4KIBA 4NQWB 2UXNA 1Y1VJ 1ZREA 5E17F 2VBWA 2HR3A 3T8TA 2IA1A 3RDIA 4YEJA 1QQIA 1SVMA 5HLIA 3ZMDA 2QGUA 1JKRC 4A12A 3DV8A 2NAZA 5GTIC 2JVGA 3RZOJ 1NG6A 5GPCA 1IRXA 1TQIA 5BQTA 3ONQA 4KITB 4ITVA 3F8NA 4EM1A 2VJJA 3KP3A 2DFEA 5B66C 4D0PA 2HYGD 3QODA 4PDKA 4RLFA 5J8CA 2GXAA 1ENHA 2IRFG 4UUSA 1TBXA 3WTVC 4M9SA 1Z7LA 2KIMA 4ANJA 2HZDA 3NWSA 3JRBA 2HQNA 1ZK8A 4KICA 2IGOA 3MVPA 2KFDA 1O7LA 2V9KA 2ZMEA 2BHZA 3OYLA 2XPUA 1WJFA 1ETXA 4G7OF 4G7HF 3DBLB 1W7PA 1QHHD 3GZNB 2XF6A 1H88C 5L3EA 1B1BA 2TDXA 3A01B 2L2OA 1WFXA 1LB2A 2H1KA 2OTLI 3EYYA 3DU5A 2E2HJ 4KIGA 2LC2A 1OLTA 1S6LA 5FKLA 1ORKA 1WH5A 4Z6YA 1X3UA 5ICCA 4E7ZA 3WG9A 2LFBA 1QGPA 2G7UA 1G59A 4DJAA 3E5QA 5ILSA 2E35A 3JRDA 1KQ9A 4GO1A 4MGRA 4BJ5C 3F23A 4WXDA 1KU9A 4HDUA 1GXPA 2QLZA 4BAYA 3I9V2 3LSPA 2RGVA 4EM0B 3G4SI 2NYXA 1PVEA 2JMWA 3E1SA 3ZRGA 4J00A 2XF7A 3AFHA 4OMYA 3BROA 5E20A 3BR1A 1RZ4A 2ZSIB 4RAYA 1VQKI 5DDGA 1PUEE 2JRMA 4A6EA 1FYLA 3U2RA 1UHSA 4UVBA 4ZDLA 3QU6A 3G2BA 2CMPA 4HF2A 4ON0A 3LSHA 3CC2I 2XGEA 1WJ5A 4P9FA 2VB6A 1IAWA 2ZJQF 4LITA 5J6XA 1RUOA 3S32A 2Z5UA 1QHGA 3C2GA 1OPCA 1OCOH 4OIRF 2EIMH 2HFHA 2HTSA 2O3FA 1D1AA 5EF6A 3PO3J 3HOZJ 3M8EA 3S2HJ 2BW3A 2DN0A 4O5VA 5KVRA 5DEQA 3GTMJ 5LEJA 2V1NA 2KZVA 4FASD 2RVCA 3H5NA 4GCVA 3BY6A 3VYSB 2W1OA 4BGDA 4U0YA 2EPFA 2HU9A 4RLQA 4H4KC 1X1DA 4EVIA 3DKXA 1H8AC 1U0JA 1Z05A 3ASNH 2GAUA 1SAXA 1S8NA 2M3AA 3H1CA 1KQ0A 4OOIA 4M72A 3L2WA 2AHQA 2O7OA 3M4OJ 3BWGA 2JA8J 3U1DA 3Q3SA 3BCAA 4RM3A 4WF2A 1YJWI 2A5WA 3CMMA 2RN7A 2ZXIA 4HQEA 4L9NA 1MMNA 2M7AA 1JKQC 2LRDA 3QYBA 2IGNA 1Z7UA 2ZJRF 4NNJA 2P5VA 4M6YA 2A6TA 2XPWA 1S5LC 1P6RA 1FTZA 2F5DA 1YTYA 3CLOA 5DTDA 3JCUC 3TQNA 2HXIA 1G3SA 1LFUP 4OU0A 1F9NA 2E1CA 2HWVA 2M1BA 2ZJ2A 2FQ3A 4BXFA 3H5AA 3OMYA 2XDVA 3I5UA 2FUG2 4EGZA 1WSUA 1XDUA 4Y3OA 5JLXA 1UJ8A 2HGCA 1IZ1A 3CMAI 3OWTA 1YFHA 4Y33A 3AL0B 2FOKA 2K4JA 3VOEA 4BJTA 2F4MB 4CSWA 3LOCA 1UMQA 3BOQA 2AXTC 3S16J 4A3MJ 3K4BA 1OISA 4XKBA 2KT0A 3F8FA 4ZDPA 1T08B 3HKZN 3RPUA 1U5TB 4ABZA 1R5ID 4BBRJ 3ZCOA 1Q1VA 2NS7A 1UHWA 4PGHA 5F6FA 2VJ4A 4MEXF 2K9SA 2R92J 1VQ8I 1LEBA 1A36A 1HSJA 3BJAA 2DA1A 4LB6B 3EUHA 3GO5A 4Y4RA 3ULQB 1EF4A 4IHVA 2O03A 1BC8C 1OCCH 3RI4A 3PSFA 1R1VA 2ID3A 1O3RA 2L7MP 3PUFA 1X4PA 1YW9A 1QZZA 2VONA 2D45A 3SZTA 1IF1A 4F3QA 2N8GA 4I2OA 2EH3A 1F1ZA 4KN7X 4L5IA 4RB1A 1R00A 2DJNA 3KLOA 2O5RA 5CQGA 5L3GA 5D6EA 1P92A 5ICGA 2BY3A 2XF5A 1E2XA 2P0WA 1D0XA 1G3WA 3MWMA 4XKVA 1S7AA 2X4HA 1UAAA 5F0CA 3BR0A 4G8XA 4GRIA 1XCVA 3QOPA 3DBRB 2L9RA 5DM6F 3QPTA 2WWYA 1LPQA 2GIVA 1IJWC 1O4XA 4RAFA 4GYGA 5F1RA 2LTPA 3CC7I 5IOZA 3MAJA 1KYZA 2EIJH 1B59A 1YYVA 2WV1A 3JRHA 3O3KA 1JI8A 2EA2A 1KQ8A 1PP8F 1OCZH 2MSYA 3WE2A 2Y0SN 3I56I 3BQZA 3KLNA 2BXZA 2W82A 3RQ4A 1Z1DA 3A02A 3KZIC 2XAJA 2WAQA 3TW6A 2YS9A 3H9QA 4DIQA 5CYVA 1SEUA 1LE8A 5FKOA 1NH3A 4UVAA 3UKGA 4F7ZA 3FXOA 1OYYA 2COMA 1H89C 3VFZA 2GLOA 3F8BA 4AIKA 1XCBA 2PJRB 2QBYA 3R0AA 3ZMZA 3FX3A 2EBIA 1R22A 3DKWA 2LVSA 5E3LA 4NC6A 3OR1C 2P5LC 3LMMA 1JXSA 3BTLA 2FA5A 1FIAA 2X6XA 1SC7A 3W3CA 2Q2EA 4AC0A 2ELJA 4P9UA 2XAQA 1AOYA 2CQ7A 4QLCU 2D5VA 4CYCB 1LEAA 4HAMA 3ERMA 3A1YA 4M6XA 5BPDA 3AG3H 1DU6A 4M71A 1I3AA 5DUKA 1WVRA 3BZKA 4UB6C 3TO9A 2DMQA 2KDOA 2DPDA 1JUPA 1ETYA 4XSXF 4CO8A 4CZCA 1ODDA 2QSFX 2JZYA 3RIRA 1ZKGA 4PZJA 1BI0A 2MC3A 4CA0A 2X6YA 4L18B 4EM2A 2HZTA 1FWZA 2ZBKA 4U7DA 4EEFG 2DA4A 3C3WA 5J1UA 1IXRC 2NVXJ 4FISA 2L01A 2PI0A 1FX7A 1T0FA 2M4GA 5CVVA 2NOGA 4KDPA 4UY8I 2R7UA 2K5CA 3K7AJ 1YIJI 1UG2A 3QWLA 4KUMA 1ZELA 2B0LA 4KT6A 2VPRA 2HOSA 4Q48A 3V4GA 3HTSB 3TEDA 4FX4A 3IUOA 2XGDA 1Y8QB 3E3VA 4B43A 5GTHC 3L00A 4ZDOA 1BA5A 4A3JJ 1ON2A 1OYIA 2FF4A 5FD6A 2NVTJ 4PSXA 4HOBA 3AKZA 4HG2A 2IS2A 2R7VA 3FK6A 1MMGA 3GXOA 5DD8A 3R61A 4FQGA 4JOMA 3Q5FA 1JUSA 2IT0A 4IHYA 5HLGA 1N25A 3MN2A 2QF7A 2UUZA 4ZYAA 3M1EA 1KONA 1Y8RB 2V26A 1MIJA 2JA7J 5K5OA 5JR3A 2QSHX 1XS9A 4ZZLA 3U21A 1XG1A 4WXCA 4C9YA 4N0BA 1Z0XA 1I50J 3TDZC 1YHQI 3OIOA 2TCTA 4Q47A 3J7AO 4UB8C 2ZC2A 3KEQA 3E7LA 4KIFA 2I10A 2P5KA 2R7DA 4I01A 1XPXA 2KP6A 4CCJA 4WX9A 3BTJA 2E34A 1IG7A 2ZFWA 1YRNA 1DGRM 5IP6A 2Z2SB 2COBA 2QSGX 2FOWA 2HKOA 2LDUA 2MH9A 4KN4X 2E1MC 4G6DA 2K9LA 1BOBA 2WV0A 3P9IA 5LLQA 1REPC 3ELKA 2QZ8A 1KZHA 1B9NA 4DYQA 2IS6A 2DQLA 1HKQA 1J2XA 2OV7A 4DYCA 2BYVE 4W1UA 1HLVA 2A6HF 3V8JA 3CLQA 4AWXB 3A4CA 5IT9K 4AIHA 3ZPLA 1XN7A 1FP2A 4B3AA 2HS5A 2JWTA 4CICA 1BOAA 4M6VA 2MBFA 4AYBA 4C3IJ 4L5EA 2B9SA 1M1EB 4LG0A 1VI0A 2E7WA 2RKHA 2XUBA 1VQOI 3HHHA 1TNTA 1WKMA 1X3ZB 4CYCA 2EFQA 1AU7A 2MG4A 2LY2A 2DO7A 1Y6IA 1I6XA 2M7BA 1P2FA 3WE3A 5DV5A 1LE8B 4LD5A 4M9XA 5E8GA 3K6GA 3HPGA 5D5UB 5F04A 2KIFA 4CCOA 4FE7A 1AHDP 4EMSA 2CW7A 2DT5A 3S1NJ 2DU9A 3WODF 1WGXA 1YX3A 3OS1A 3I58A 1LNWA 4AUXA 1OCTC 2XAGA 4WK8F 1VF9A 1XMKA 4D5CA 2CWEA 3MCZA 1PYVA 2ESHA 2GOMA 3UNGC 3TW7A 3WHBA 5FB2A 4ENMA 2Y0SA 2IW5A 4HNUA 2XROA 2V6EA 2EFWA 3KP2A 3D0SA 3O2PE 4F92B 1GV5A 3C7JA 1X3WB 1D1BA 3FKJA 2YU9J 4IQJA 2CUJA 4BQOA 4DW6A 1WH7A 4BY1J 4XMYA 1TNSA 4PCQA 1K78A 1FBSA 4KMUX 5GAHJ 1DPUA 2RV8A 1YW8A 1T8IA 1UG0A 4RM2A 1K83J 4B4CA 4H0EA 3S17J 1IN4A 4PJNA 3ZQ7A 2LD5A 4BBSJ 4II3A 1K79A 1WRJA 2JPCA 5DUIA 4LGWA 3JRCA 2R7OA 3JREA 2VQGA 3PJRA 4KJZA 3FHNA 5IY5H 2QQ8A 4J19A 3E6BA 1DPRA 2E2IJ 4HDVA 4L9JA 1YW7A 1U5TA 3OV8A 2CV0A 1LUJB 1WHUA 1WJDA 3FXJA 1MSFC 3EPZA 1G2HA 3LSGA 3BP8A 2D1VA 1ZLKA 4BXUA 2R5ZA 2VQLA 3L2CA 3FZVA 5D5VB 2XHKA 1LVKA 1Z91A 1QZYA 3SZPA 4A5MA 2B63J 5H6QA 4JP0A 4ASNA 2CO5A 3I54A 2XGXA 2RNJA 2HOAA 1VQ5I 4HNTA 4ZYEA 1GVJA 4B8XA 1F4KA 2WBMA 1L3LA 1LKXA 2CSOA 2LKSA 3P9CA 2ME6A 4IHWA 4BJ6C 5KAIC 1IXCA 2CQKA 2DA6A 2DTRA 2K9QA 1JHHA 1MNDA 1USSA 4HX4A 1LQ1A 2CQNA 4LLGF 2RC4A 1VQLI 4G94A 3OYGA 2OQRA 3V8LA 2DI3A 2RQPA 2JUCA 2UV1A 1SMYF 1T33A 1U8RA 1I27A 2ZFUA 1EH8A 5E1WA 2PBIA 2Y69H 4NDLA 2ECBA 2WADA 3CCEI 5J1YA 2NVQJ 3A0BC 3KZZA 1P7IA 5ERIA 1OR7C 3OOPA 2WY7Q 1MBFA 2F4OB 2NS0A 3KP5A 5JHFA 1A04A 2F5CA 2OC6A 2MLGA 1H0MA 3QPSA 1IDZA 2HKXA 3ZQIA 3CUQC 3ZQFA 1RR8C 3S14J 1JKPC 2M8GX 3CQZJ 2Y30A 4IHSA 1MBHA 2YPRA 2JN6A 4A0ZA 1S72I 1W0UA 3BJ6A 1K6OA 4P96A 3GTQJ 3HTUA 1D5VA 1I1GA 2AS5F 4RS8A 1TWCJ 2WTEA 3AAFA 3CDLA 2VLAA 1EH6A 3MEXA 1BBYA 3BDDA 1TT0A 1Z67A 3H0DA 4J01A 1BW6A 4FHTA 1RUNA 2VXZA 2Y48A 4X0GA 4PJMA 2CRGA 3FK7A 3FBIB 4N9HA 4XKCA 4R1HA 3QU3A 2IJLA 2Q8KA 3TKYA 1RKWA 1FMWA 1E3PA 4XM3A 4XLHA 2W57A 3ZXSA 5BOXA 4RB0A 2EFPA 3SEZA 4XK4A 3I4PA 2EWNA 3M3YJ 3E6DA 4I7HA 1XMAA 2L7KA 2VKDA 5EYRA 1FEXA 1V54H 3CF2A 2DODA 1BW5A 2K4BA 2KPMA 3HEFA 2R5YA 5H6RA 5FD5A 4ZTFA 3G1MA 2OAZA 4G6QA 2IBDA 4CUGA 3WTZA 1YRNB 4HV5A 1W4MA 2ICWG 5HNHA 3FM3A 1U5TC 5B1BH 3JSOA 4GFBA 4C3JJ 1RI7A 1UELB 1NK2P 2XKOA 3U1KA 4XONA 5LGUA 3QQAA 5DM7F 3CCUI 1T39A 2RREA 2BY2A 4YIFA 2Z1DA 3J7YJ 2DMPA 1MH3A 3DTEA 2IA0A 2HPMA 2EILH 3TMOA 3K4JA 2WA0A 4HSRA 2GIZA 3ZMTA 4U0WA 2YSRA 4CCLA 1J5YA 3KX2A 3CCQI 1R5HA 2R7ZJ 1HXDA 3BLYA 3GVAA 4IKFA 1O7FA 3GFMA 3IAM2 4IVNA 4B48A 4G9YA 5FLXZ 2ELHA 2WY8Q 3ABKH 2E1OA 2ZMEB 4LG3A 4ESFA 2OZ6A 3FXUA 2Z99A 2LF8A 1MJBA 2DYRH 2J5OA 1PDNC 1K61A 5K7ZA 3FBNB 3HSFA 1X2MA 2VBZA 1W7PD 3QAHA 4CCKA 2P4WA 2MLKA 4E4HA 1X4OA 3MD2A 2HDDA 4BQNA 3BTCA 5D4SA 2IAIA 1HSTA 1VQPI 3A0HC 4OAZA 3FXMA 3K1PA 3WHCA 2DA2A 5K1YA 4L5JA 3HSEA 2UWMA 4QTRA 2E5ZA 3M7GA 1YIOA 3K0LA 3OYCA 5FO5A 1HA8A 3K2ZA 2LKXA 3CC4I 1Z3XA 1I39A 3C18A 2FBKA 1W36C 1YJNI 1T0FC 4LB5A 4A3IJ 1KYWA 1TWHJ 3VPRA 1DGWY 4XN3A 2ZB9A 1ZG5A 2DFFA 1GVDA 3L2UA 3KCCA 5K7FA 4E7IA 3BTIA 3E6CC 1FSEA 1ON1A 4M3BA 4LLLA 3TL4X 3SYTA 5BMZA 3P9KA 2FMYA 3FISA 4K2EA 1JJ8C 2IA2A 3EDPA 1L0OC 1YO5C 1BL0A 4NQWA 4MHGA 3HRUA 5FJ8J 4A5NA 3GW2A 1LVAA 3GYHX 4BHPA 3I64A 4CHUA 3J80Z 5FROA 2PN6A 3G73A 2CS3A 2DOFA 4UUTA 1JTXA 5JVTA 2ISYA 3G1OA 5CVIA 2PMUA 1NHAA 2DA5A 3REOA 1TQPA 3TP0A 3U9GA 3BR6A 2O6GE 4EV0A 1HKSA 2XAFA 1DU0A 2NVUB 3JTGA 4E7KA 1FBUA 1EJ9A 2Z9OA 2MA3A 1JUMA 2WAEA 2XC7A 5HODA 2W00A 1Q1HA 4BHBA 4IXAA 1I3QJ 2ZKZA 5C4JJ 3A2KA 1OMIA 4IX7A 1AKHB 2RQQA 3OIPA 4A3DJ 2L5QA 4MNUA 4A3CJ 3LSTA 3VDXA 1KU2A 3DXJF 2O0YA 3VB2A 1TP4A 2DMTA 1WI9A 1Z21A 2DFHA 2FX0A 2WAQN 3PFIA 1X1BA 2V7FA 2HXOA 4BE0A 3RCOA 1ULYA 2R3SA 1WI3A 4IRHA 2QQ9A 4M3FA 3K4KA 2OPTA 3HXLA 5EEGA 1VZ0A 1ETQA 1SMTA 3DLLF 4F52A 1ZARA 1YI2I 3MKYB 4X1EA 2VI6A 4ENKA 2KJCA 4D5FA 3GTOJ 3FXQA 3FF5A 2IXSA 3LA2A 4XORA 4A3FJ 3Q9VA 3GTJJ 1ONVA 1R6RA 1ZGWA 4KA4A 4D1QA 3NRVA 1FPQA 3V42A 4XIDA 4Y7NJ 1N75A 3I59A 3NARA 1HDDC 1ZRFA 2A05A 3ASOH 1QPIA 2V79A 2G9WA 3LA7A 4QIWN 3CJTB 1T38A 4LOCA 3CJNA 4U7BA 3T8RA 5JHUA 5M5WJ 5HVQC 5ED4A 2R4GA 2WAFA 2BVMA 2GQQA 2E71A 1QO0D 4QPOA 5DCMA 2P7CB 3K4CA 4C30A 2QENA 1TWFJ 4FX0A 1HKTA 2WB1N 4D9JA 1R4MB 1BI2A 3LSRA 4KMFA 1RETA 1D8JA 4UXNA 4KYWA 2AO9A 3BPVA 3CTAA 3L09A 3NQOA 2JUGA 2KLOA 1DDNA 1VNDA 1ZGAA 3K2AA 3O8HA 2ID6A 3EUHC 1BR1A 1QRYA 4L0YB 3HOWJ 3V7RA 3GFIA 1R23A 3E0JB 1ETOA 5J40A 1IV8A 4CGZA 5FKKA 2F6CA 1HOMA 4XLEA 5E79C 3JR9A 4XRMA 3RKXA 4HZFA 2DK8A 5M5XJ 3T5XA 1RKTA 1JT6A 4Y52J 1FIPA 2Z3YA 3EETA 1B72A 3SHFA 2M45A 1NTCA 1MJ9A 1ZRDA 2DPUA 1V3FA 3DEUA 3D5SC 3ZQCA 5EG0A 2Y75A 1P4WA 2BHYA 3ZGKA 2J5PA 4IOAF 2L0KA 3IWZA 3KP7A 1KU7A 4A6DA 2R7TA 1QVTA 2JSCA 3OL4A 4N4OB 1F43A 1LDJA 5GP9A 4A3BJ 2OF7A 1SVOA 3OR2C 4OINF 4BU2A 2X1EA 2EV6A 3IKTA 1R36A 2XSDC 4IO9F 3V7SA 2HEOA 1ZAOA 3GTKJ 5GADJ 2Y9YA 3RYRA 2JQ7A 3H92A 3ESWB 1AWCA 5E1XA 1JJ6C 4S04A 3T0YA 5IP7J 3KPHA 2XAUA 1PJRA 3CCYA 1HW2A 3L2QA 4RBOA 2YX7A 4V2GA 2KIQA 2HPIA 1KA8A 1XD7A 2DMNA 1DUXC 1FOYA 4MFDA 3B6AA 4B09A 3HPHA 3HC7A 4F93B 3HZJA 1ACIA 4U88A 5HDKA 3PQKA 1VQ7I 2VKEA 2CUEA 3MQ0A 1ZG3A 2F5FA 3MZHA 4L9VA 1KU3A 4M9ZA 4EGYA 3KFWX 5H2FC 1QU3A 2DLLA 1XX5A 1HDPA 2HNHA 2JA2A 3N97A 2JRTA 1U3EM 2LH9A 1IN5A 3OYNA 4C2MJ 2GBYA 1E3HA 1YQAA 5CPRB 2UZKA 1IRZA 2FMLA 3IH4A 4BY7J 1R71A 1I5ZA 2X0LA 1Y1WJ 3GBGA 3E5UA 3K1MA 3QYEA 1RESA 2LBFB 3RYPA 5J4VA 4HLYA 4A3EJ 2DCEA 4ZH4F 1B8IA 2A68F 2Z16A 3AG4H 4XR6A 4AIJA 4JQFA 2KRCA 4GDFA 3OYFA 3H3VK 2RAEA 4BE2A 2DFIA 4HA8A 4MQ9F 4HSTA 3ZN1A 1ZR2A 5LBQA 4ZYDA 1QNTA 4LIUA 4HYEA 3HL2A 1HQCA 2LG4A 2M87A 4FCYA 1DP3A 4HX7A 2PMZA 1MNEA 1R58A 1ZN2A 4BNCA 1P9QC 3KIOA 1H9TA 5D8LB 3F6OA 2D2WA 5IT9Z 5EZHA 1V5GA 2V9PA 2IPQX 4EJTA 2GWRA 3ZQQA 3DEWA 2DBBA 3GFLA 5J3LA 3GTGJ 5M5YJ 3PIPF 4EJVA 2LSOA 5JVGF 2XPVA 3LSMA 1G3YA 2EK5A 2F5EA 5GAEJ 2FBIA 2KIUA 3JSPA 3CJQB 1FNNA 3CDIA 2HTJA 5FKMA 4I99C 3F6VA 1BJAA 5LGTA 2BZTA 3O8GA 3PNYA 4NBQA 2VJIA 3L7WA 4A2UA 5M3FJ 1ZH5A 4IJAA 4XICA 2KMUA 4OAYA 1QA6A 4PSWA 2R7WA 5IP9J 4RGRA 1BIBA 2PJPA 1OKRA 4G12A 3V7CA 5CKTA 2M0MA 1A35A 2VE8A 2QQBA 1VQNI 4AD9A 3E97A 5DCMB 4E7JA 4ZZDA 2F4IA 2H6BA 4MQVA 2W48A 3RTRA 4BEHA 4V2FA 3CCMI 1ZTRA 2VPLA 2EFOA 3DKYA 2X85A 3AG1H 2V1XA 5KK1A 5K5RA 3CP8A 4B1RA 2VKVA 2K9MA 2PMHA 3S2DJ 2ZCWA 1W5CC 3QOEA 1YITI 1APLC 4I0BA 1G6NA 3HJEA 4BDZA 1S7EA 3C1DA 2F2EA 3DU6A 3WTTC 2Y2ZA 3DTKA 4HQMA 2A07F 3CO6C 1MMAA 3PUBA 2VODA 4E7SA 3R60A 4DBQA 3WGGA 4A93J 4NC8A 4I76A 2CV1A 3X2QH 3F3XA 5HDGA 1R4NB 1ZG1A 2XAHA 4W97A 3RQIA 1W5TA 2CFXA 1MSEC 2H09A 2BXYA 2DA3A 3SFIA 3R4KA 1TWAJ 4AVPA 2ZXWH 3OYMA 3JTHA 1MMSA 5F64A 1E17A 1YOVB 3MFKA 3OYKA 2OJED 4IRGA 2MD5A 1ZHFA 2X9DA 3MKWB 2JVHA 1FJLA 4PFOA 4PJLA 2QKMB 3HBLA 1MH4A 5LRRA 4DBRA 3DQVC 2BGCA 3DLAA 3FMQA 1T98A 1MZBA 1SD5A 3KYLA 2VT3A 5EJCA 1P4XA 3DF8A 4EJUA 1IDYA 1XMXA 3BZ6A 1ZQ3P 2R7XA 3GF2A 2MYSA 1WJAA 2ESNA 3HUGB 2V6CA 1X2NA 3K9TA 2LY9A 2HVSA 1RC9A 2HVQA 3LAJA 1JE8A 4NUBA 1H9GA 1SANA 1IN7A 2O9LA 1J9IA 4I0AA 4LFUA 2DMUA 3FM5A 2P6TA 3P5JA 3F8MA 3IH3A 3BQYA 3FXKA 5FKNA 5L3FA 3S2WA 2Z33A 1POGA 5AIQA 2G0EA 1S29A 3M9AA 1FOKA 2KJBA 3PL8A 2QCOA 4QWQA 2K86A 5F08A 2W25A 2JTVA 5TRDA 5LFAA 2FNAA 4S05A 2WC2A 1Z3YA 4GXOA 4B3XA 4R79A 3CCSI 2HQRA 3GMEA 5J4YA 3CUQA 5FFZA 3HOUJ 2MABA 3DBHB 3D1NI 2MFZA 5EDNA 4WCGA 3H3ZA 3VSKA 4MTEA 1J0RA 2CW8A 1IN8A 2P7VB 2OTJI 2VASA 3HB9A 3S1RJ 5CVUA 5IPAA 3L1PA 3BR2A 2DXIA 2HYFA 3MZYA 3BR3A 1IRFA 3PFYA 4I09A 1HF0A 3RKWA 1OCRH 2AQFA 5IOYA 2ETHA 1SFKA 3W2VA 2STWA 2A5YB 2PFBA 1QBJA 3SFZA 3I3LA 3GEZA 3PIOF 3KEYA 1IRGA 1MMDA 3SJMA 4PFPA 1TW2A 2R7RA 5ICFA 3J7ZI 1IN6A 5IYDJ 3BG3A 4Q4ZF 3OS0A 3LSIA 4LJZF 2NVYJ 2W24A 3KP6A 3DPLC 1LDDA 2HYJA 3S8PA 3BG7A 1F5TA 2EJRA 3V8KA 5FFXA 2XASA 3WTWC 3OYAA 1ERDA 2Y0MA 4UUVA 3K69A 5LHIA 2FQ4A 3CMYA 1Z77A 3W6KB 1UZCA 1XTAA 1IXSB 3IRQA 3CF5F 1TQMA 4IEJA 1WJBA 2E36A 3HHGA 2LP0A 2L9SA 3EUKL 2GA1A 5CVJA 2O8XA 2FEZA 2DYSH 3WTUC 4IF4A 3G6EI 2I8DA 3TBIA 1BR4A 1MD0A 3F8CA 3RKQA 4UV8A 2L9NA 2VUMJ 5B3SH 4HRIA 3H36A 3PNTA 1B72B 3OYBA 2OCEA 4KT5C 4GYIA 2H8RA 2E60A 2LY1A 4A3LJ 2ME0A 4JBAA 4XBFA 3M8FA 2KKOA 3M1CA 5CVRA 3VWBA 1MDMB 3G71I 3KE2A 4CCNA 1QZEA 2BE5F 3H5RA 1S9HA 2A61A 5EGOB 4XOPA 3CCLI 2EINH 5ILVA 4PJJA 1TWGJ 4YG2F 5LRSA 1W1WE 1OJLA 5B5EC 3SZGA 1O3SA 2NS8A 4CDGA 5IYBJ 4C2UA 5A2QZ 3JRAA 1YLFA 2K9NA 2ZO4A 2L54A 2MC4A 4OWRB 2YU3A 5DD4A 1HBXG 4C3HJ 2IS4A 2GA2A 1D8KA 2BY0A 1R1TA 1QPMA 3EYIA 1P4AA 3R6SA 4HEA2 2HOTA 2QWWA 1XGMA 1Z9CA 3VEPA 1RRJA 5D5WB 3QP5A 1YX5A 1FBQA 4UVCA 3OYDA 3KYCB 4YRVA 4FETA 3CCVI 2EA4A 1OFCX 3DCFA 1FOWA 2XV4S 1ZR4A 3HG9A 1XSXA 2BOLA 2D1HA 1Y0UA 1U8BA 1ZLJA 1BIAA 3GLXA 2CW0F 1SD7A 3CDHA 3ROUA 3WU1B 2PMZN 2YR2A 3SEQA 3Q0VA 5B1AH 2CQQA 4ESBA 2JA5J 4LG0B 1IV6A 2Y9ZA 3ZMSA 3K70D 3PQJA 5D6FA 3ZMVA 2QM3A 3FXLA 5F0FA 4YFKF 4M3GA 5J47A 2EV0A 1XSVA 3RKYA 3TOBA 3HIFA 1A6QA 3BG6A 1U6GA 1Z6RA 4P55A 5JFRA 4U87A 2XRNA 3WGIA 4RDUA 1IUYA 3GZ5A 2IVMA 4AU7A 2L4AA 5HLTA 3J7AY 5GAGJ 5E18F 4BUPA 3WTYC 5LEKA 1K7AA 3ECHA 3I4NJ 5F27A 3M07A 2M5WA 1VQ6I 1G3TA 2MW8A 2B7EA 1GHCA 2IGKA 2X6OA 3GCMA 2VN2A 3I4MJ 1SD4A 3G1LA 4JX4A 4XRFA 3ABTA 2QUFA 1WZ2A 2LF7A 2W84A 4XLFA 5TISC 2CQXA 2BVLA 2YX4A 2IP2A 4M3DA 4BACA 1SAUA 5TGTA 1D0YA 1DQUA 2ECCA 4DZJA 1YS7A 3TO7A 3D5LA 4XLAA 1MBKA 5DCFA 4IHTA 2VOPA 5K5QA 4HBLA 1D0ZA 1O57A 1FC3A 3DEEA 5CQEA 3W2WA 5D5XB 5GPAA 4D7NA 2R5ZB 2GXBA 4M73A 1PP7U 1MGTA 1FY7A 2RNGA 2DT6A 4RGXA 3MZ8A 2PX9A 4DGWB 2L7ZA 4EJWA 3BG9A 5HS7A 1D1CA 2NRAC 2DW4A 2E5NA 3S3NA 3L2RA 3K4LA 4N4NB 2HOEA 3LQQA 1HW1A 1XSDA 2ACJA 2TRTA 4RA2A 5DYMA 3O6BB 4JYKA 1D5YA 1YG2A 3HRMA 4OIPF 2VQCA 4M3EA 3KP4A 5IT3A 3ZN0A 4WWCA 2MH2A 2R7SA 2E2JJ 3ZQHA 2OZUA 3FHZA 1TZLA 4RGUA 1MW7A 5L3DA 4I98B 4XLNF 3JRFA 4Y15A 1ETVA 1YS6A 4CYDA 2OQGA 1XGOA 2X51A 1R49A 5C44J 4FTHA 4BXXJ 2LMDA 4XSZF 3H35A 4QPQA 3DTIA
chains in the Genus database with same CATH topology
2DMNA 4MFDA 3TW7A 3WHBA 1F36A 2EZLA 3B6AA 1ETKA 1Y1VJ 2VKEA 2CUEA 1GV5A 1TC3C 2YU9J 1JKRC 4JX6A 4DW6A 1WH7A 4BY1J 1HDPA 3RZOJ 2CJJA 5GPCA 5F0HA 4C2MJ 2KDZA 1K83J 2GBYA 3HOVJ 4B4CA 3S17J 1IRZA 2LD5A 4BBSJ 2EZIA 3IH4A 4BY7J 1VFCA 3RZDJ 1Y1WJ 3GBGA 4XRSA 1ENHA 4UUSA 3JRCA 3JREA 3HGYA 1RESA 3JRBA 1ZK8A 1SFOJ 4A3EJ 9ANTA 1B8IA 3MVPA 4J19A 2E2IJ 2CU7A 1WPKA 2XPUA 2R93J 3HM5A 1ETXA 4JX5A 3H3VK 1MSFC 2RAEA 1G2HA 3LSGA 1H88C 1ZR2A 3A01B 2R5ZA 1NK3P 2H1KA 4FCYA 4I6ZA 2B63J 2IEKA 2E2HJ 4JP0A 3ZQGA 5FKLA 1A5JA 1U9NA 1ORKA 2HOAA 1WH5A 2LR8A 5EZHA 2M0CA 2M34A 3PO2J 3QPLA 2P81A 2LFBA 2ME6A 4IHWA 3DEWA 5J3LA 3JRDA 2DA6A 2K9QA 3GTGJ 5M5YJ 4DZPA 4HNVA 2XPVA 3H0GJ 3LSPA 2E19A 2XB5A 3HOXJ 2JMWA 5FKMA 1T33A 5FLVA 4QSHA 3O8GA 5M3FJ 3W6VA 4NDLA 2ECBA 3BR1A 4XICA 5J1YA 2NVQJ 1P7IA 5IP9J 1MBFA 4UUSB 1UHSA 4G12A 3QPSA 1IDZA 3ZQIA 3ZQFA 2XGEA 2GM4A 1JKPC 3S14J 2M8GX 3CQZJ 5BNGA 3BR5A 2Y30A 1MBHA 2W48A 2JN6A 1W0UA 4V2FA 1ZTRA 3GTQJ 4A3KJ 2JA6J 1TWCJ 1LFBA 4B1RA 2HI3A 2VKVA 3CDLA 3PO3J 3F0CA 3FIWA 5EF6A 3LNQA 3HOZJ 3S2DJ 2EZKA 1APLC 3S2HJ 2DN0A 3GTMJ 1BW6A 1S7EA 5K7HA 2Y2ZA 2X48A 2CRGA 5JLWA 4A93J 4I76A 3ZQLA 3FK7A 2EZHA 3LSJA 2Y31A 1H8AC 3BG5A 3B6CA 2O8KA 4W97A 1RKWA 3RQIA 1MSEC 2DA3A 3SFIA 3S1MJ 1TWAJ 2AHQA 2O7OA 3M4OJ 2JA8J 4XK4A 3M3YJ 3Q3SA 5EYRA 2X9DA 5E3MA 5FLMJ 5F1JA 1FEXA 3HGGA 1JKOC 1FJLA 5EZGA 1JKQC 3HBLA 1BW5A 1MH4A 4A69C 3HEFA 2R5YA 3G1MA 2XPWA 2IBDA 3SDGA 1YRNB 1FTZA 1IDYA 5DTDA 1ZQ3P 2HXIA 4GFBA 1LFUP 4C3JJ 1X2NA 1BJZA 2LY9A 1NK2P 3GTPJ 2EQRA 1T56A 3QQAA 2DMPA 1MH3A 2ELKA 5JLXA 1SANA 1MBGA 2O9LA 2DMUA 2FJ1A 4BKXA 5C4XJ 3LOCA 1UMQA 3S16J 3IH3A 4A3MJ 3BQYA 2R7ZJ 4A3GJ 2KT0A 5FKNA 3OSGA 1PUFA 5C3EJ 3HOYJ 3C2BA 1POGA 2G0EA 3HKZN 4ABZA 2E1OA 2QCOA 2FD5A 4BBRJ 1Q1VA 1XC5A 2NS7A 1ITYA 5F08A 2K9SA 2R92J 1K61A 5K7ZA 2DTZA 1A6IA 1X2MA 2DA1A 1W0TA 1EF4A 4IHVA 2ID3A 2L7MP 2HDDA 3HOUJ 3BTCA 2IAIA 4AYBN 2N8GA 5EDNA 3D1NI 2EH3A 3WHCA 2DA2A 4QTRA 2DJNA 4XRSG 3S1RJ 3HB9A 5IPAA 3L1PA 3BR2A 1B8IB 3BR3A 2LKXA 3JRGA 2M9HA 1HF0A 4IHXA 2M2EA 5IOYA 1E3OC 4A3IJ 1U78A 1TWHJ 1OCPA 2L7FP 3VPRA 5F0CA 3BR0A 2ZB9A 1GVDA 2L9RA 4X6AJ 5K7FA 3SJMA 3Q0UA 1IJWC 4MIMA 1O4XA 3BTIA 2LTPA 5IOZA 3BG3A 5IYDJ 4M3BA 5EGOA 2NVYJ 2LLKA 2WV1A 5M3MJ 3JRHA 2HYJA 2MSYA 3FISA 2Y0SN 3BQZA 1MNMC 1JJ8C 1CQTA 1BL0A 2FQ4A 3A02A 3CMYA 1Z77A 3TW6A 5FJ8J 2YS9A 2CUFA 3TP3A 1LE8A 5FKOA 1GV2A 3UKGA 4IEJA 1WCMJ 2LP0A 2JK3A 1H89C 2GLOA 1JT0A 2LK2A 3A01A 4UUTA 1JTXA 3G1OA 5E3OA 2DA5A 2EBIA 3RKQA 4FE4A 5E3LA 2LVSA 1RPWA 3TP0A 1MBJA 2VUMJ 3BTLA 5EG0B 1FIAA 1B72B 1IGNA 3BR6A 1GT0C 4AC0A 4S0HB 1DU0A 2H8RA 4A3LJ 2ME0A 1I6HJ 5DS9A 2D5VA 1JUMA 4CYCB 3A03A 5HODA 1DU6A 1JTYA 1I3QJ 5EGOB 5C4JJ 3Q0WA 2DMQA 1JUPA 3OSFA 1ETYA 1AKHB 1U9OA 4A3DJ 1TWGJ 4A3CJ 1ZKGA 3ZOBA 1OJLA 2DMTA 2XB0X 2FX0A 2WAQN 2NS8A 4EEFG 5IYBJ 2DA4A 5J1UA 3PM1A 2NVXJ 2HXOA 4FISA 1WI3A 3JRAA 2K9NA 4M3FA 2NOGA 5EEAA 1P7JA 3K7AJ 2OPTA 1UG2A 1ETQA 4C3HJ 4D7MA 2VPRA 2HOSA 4X1EA 3TEDA 2VI6A 2XGDA 4D5FA 3GTOJ 3IH2A 1BA5A 2HOTA 4A3FJ 4A3JJ 2HQ5A 2NVTJ 3GTJJ 1ZGWA 3FK6A 4XIDA 4Y7NJ 2XRLA 3NARA 1HDDC 1JGGA 3S1QJ 1QPIA 3S15J 1JUSA 1OFCX 3BT9A 3DCFA 4MLOA 4QIWN 1ZR4A 4IHYA 4LOCA 1U8BA 2YUSA 2PMZN 3MN2A 2QF7A 3Q0VA 5M5WJ 3JRIA 2CQQA 2JA7J 2JA5J 1AKHA 1IV6A 4MO7A 1XS9A 2JJ7A 2Y9ZA 1TWFJ 1MBEA 5J1RA 3GTLJ 2WB1N 1XG1A 5F0FA 3LSRA 1Z0XA 4M3GA 1I50J 1RETA 3FKIJ 1FTTA 2AO9A 3OIOA 2TCTA 3OOUA 3MKLA 4RDUA 1HCRA 1VNDA 3K2AA 3E7LA 3O8HA 2ID6A 2I10A 1QRYA 3HOWJ 2MGQA 3BTJA 3I4NJ 1IG7A 1PUFB 1YRNA 5IP6A 2COBA 1ETOA 5F27A 2MW8A 5FKKA 1HOMA 2X6OA 4DYRA 3I4MJ 1RR7A 3G1LA 3HDDA 4JX4A 3JR9A 4XRMA 1GDTA 1IUFA 4DYQA 2CQXA 5M5XJ 1JT6A 1RKTA 1GUUA 4Y52J 4M3DA 1FIPA 2ECCA 4DZJA 4DYCA 1B72A 1NTCA 4W1UA 1HLVA 1MBKA 3ZQCA 5EG0A 2XGCA 1X58A 2L0KA 5E3NA 4B3AA 2JWTA 2R0QC 1QVUA 1QVTA 4M6VA 5GPAA 4D7NA 2R5ZB 5GP9A 2DA7A 1F43A 4A3BJ 4C3IJ 2OF7A 4L5EA 2R5YB 1VI0A 1ETWA 2L7ZA 3BG9A 1IC8A 4CYCA 5IYCJ 1AU7A 2XSDC 2MG4A 3GTKJ 2TRTA 1R9TJ 1D5YA 1LE8B 4JYKA 2Y9YA 4MFEA 2K40A 4M3EA 5F04A 4FE7A 1AHDP 2E2JJ 3ZQHA 1JJ6C 3S1NJ 5IP7J 3IV5A 1WGXA 3CCYA 3JRFA 4RBOA 1ETVA 4V2GA 4BXXJ 1OCTC 4AUXA 5C44J 4FTHA 3NAUA 1VF9A 4D5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMN A;  4MFD A;  3TW7 A;  3WHB A;  1F36 A;  2EZL A;  3B6A A;  1ETK A;  1Y1V J;  2VKE A;  2CUE A;  1GV5 A;  1TC3 C;  2YU9 J;  1JKR C;  4JX6 A;  4DW6 A;  1WH7 A;  4BY1 J;  1HDP A;  3RZO J;  2CJJ A;  5GPC A;  5F0H A;  4C2M J;  2KDZ A;  1K83 J;  2GBY A;  3HOV J;  4B4C A;  3S17 J;  1IRZ A;  2LD5 A;  4BBS J;  2EZI A;  3IH4 A;  4BY7 J;  1VFC A;  3RZD J;  1Y1W J;  3GBG A;  4XRS A;  1ENH A;  4UUS A;  3JRC A;  3JRE A;  3HGY A;  1RES A;  3JRB A;  1ZK8 A;  1SFO J;  4A3E J;  9ANT A;  1B8I A;  3MVP A;  4J19 A;  2E2I J;  2CU7 A;  1WPK A;  2XPU A;  2R93 J;  3HM5 A;  1ETX A;  4JX5 A;  3H3V K;  1MSF C;  2RAE A;  1G2H A;  3LSG A;  1H88 C;  1ZR2 A;  3A01 B;  2R5Z A;  1NK3 P;  2H1K A;  4FCY A;  4I6Z A;  2B63 J;  2IEK A;  2E2H J;  4JP0 A;  3ZQG A;  5FKL A;  1A5J A;  1U9N A;  1ORK A;  2HOA A;  1WH5 A;  2LR8 A;  5EZH A;  2M0C A;  2M34 A;  3PO2 J;  3QPL A;  2P81 A;  2LFB A;  2ME6 A;  4IHW A;  3DEW A;  5J3L A;  3JRD A;  2DA6 A;  2K9Q A;  3GTG J;  5M5Y J;  4DZP A;  4HNV A;  2XPV A;  3H0G J;  3LSP A;  2E19 A;  2XB5 A;  3HOX J;  2JMW A;  5FKM A;  1T33 A;  5FLV A;  4QSH A;  3O8G A;  5M3F J;  3W6V A;  4NDL A;  2ECB A;  3BR1 A;  4XIC A;  5J1Y A;  2NVQ J;  1P7I A;  5IP9 J;  1MBF A;  4UUS B;  1UHS A;  4G12 A;  3QPS A;  1IDZ A;  3ZQI A;  3ZQF A;  2XGE A;  2GM4 A;  1JKP C;  3S14 J;  2M8G X;  3CQZ J;  5BNG A;  3BR5 A;  2Y30 A;  1MBH A;  2W48 A;  2JN6 A;  1W0U A;  4V2F A;  1ZTR A;  3GTQ J;  4A3K J;  2JA6 J;  1TWC J;  1LFB A;  4B1R A;  2HI3 A;  2VKV A;  3CDL A;  3PO3 J;  3F0C A;  3FIW A;  5EF6 A;  3LNQ A;  3HOZ J;  3S2D J;  2EZK A;  1APL C;  3S2H J;  2DN0 A;  3GTM J;  1BW6 A;  1S7E A;  5K7H A;  2Y2Z A;  2X48 A;  2CRG A;  5JLW A;  4A93 J;  4I76 A;  3ZQL A;  3FK7 A;  2EZH A;  3LSJ A;  2Y31 A;  1H8A C;  3BG5 A;  3B6C A;  2O8K A;  4W97 A;  1RKW A;  3RQI A;  1MSE C;  2DA3 A;  3SFI A;  3S1M J;  1TWA J;  2AHQ A;  2O7O A;  3M4O J;  2JA8 J;  4XK4 A;  3M3Y J;  3Q3S A;  5EYR A;  2X9D A;  5E3M A;  5FLM J;  5F1J A;  1FEX A;  3HGG A;  1JKO C;  1FJL A;  5EZG A;  1JKQ C;  3HBL A;  1BW5 A;  1MH4 A;  4A69 C;  3HEF A;  2R5Y A;  3G1M A;  2XPW A;  2IBD A;  3SDG A;  1YRN B;  1FTZ A;  1IDY A;  5DTD A;  1ZQ3 P;  2HXI A;  4GFB A;  1LFU P;  4C3J J;  1X2N A;  1BJZ A;  2LY9 A;  1NK2 P;  3GTP J;  2EQR A;  1T56 A;  3QQA A;  2DMP A;  1MH3 A;  2ELK A;  5JLX A;  1SAN A;  1MBG A;  2O9L A;  2DMU A;  2FJ1 A;  4BKX A;  5C4X J;  3LOC A;  1UMQ A;  3S16 J;  3IH3 A;  4A3M J;  3BQY A;  2R7Z J;  4A3G J;  2KT0 A;  5FKN A;  3OSG A;  1PUF A;  5C3E J;  3HOY J;  3C2B A;  1POG A;  2G0E A;  3HKZ N;  4ABZ A;  2E1O A;  2QCO A;  2FD5 A;  4BBR J;  1Q1V A;  1XC5 A;  2NS7 A;  1ITY A;  5F08 A;  2K9S A;  2R92 J;  1K61 A;  5K7Z A;  2DTZ A;  1A6I A;  1X2M A;  2DA1 A;  1W0T A;  1EF4 A;  4IHV A;  2ID3 A;  2L7M P;  2HDD A;  3HOU J;  3BTC A;  2IAI A;  4AYB N;  2N8G A;  5EDN A;  3D1N I;  2EH3 A;  3WHC A;  2DA2 A;  4QTR A;  2DJN A;  4XRS G;  3S1R J;  3HB9 A;  5IPA A;  3L1P A;  3BR2 A;  1B8I B;  3BR3 A;  2LKX A;  3JRG A;  2M9H A;  1HF0 A;  4IHX A;  2M2E A;  5IOY A;  1E3O C;  4A3I J;  1U78 A;  1TWH J;  1OCP A;  2L7F P;  3VPR A;  5F0C A;  3BR0 A;  2ZB9 A;  1GVD A;  2L9R A;  4X6A J;  5K7F A;  3SJM A;  3Q0U A;  1IJW C;  4MIM A;  1O4X A;  3BTI A;  2LTP A;  5IOZ A;  3BG3 A;  5IYD J;  4M3B A;  5EGO A;  2NVY J;  2LLK A;  2WV1 A;  5M3M J;  3JRH A;  2HYJ A;  2MSY A;  3FIS A;  2Y0S N;  3BQZ A;  1MNM C;  1JJ8 C;  1CQT A;  1BL0 A;  2FQ4 A;  3A02 A;  3CMY A;  1Z77 A;  3TW6 A;  5FJ8 J;  2YS9 A;  2CUF A;  3TP3 A;  1LE8 A;  5FKO A;  1GV2 A;  3UKG A;  4IEJ A;  1WCM J;  2LP0 A;  2JK3 A;  1H89 C;  2GLO A;  1JT0 A;  2LK2 A;  3A01 A;  4UUT A;  1JTX A;  3G1O A;  5E3O A;  2DA5 A;  2EBI A;  3RKQ A;  4FE4 A;  5E3L A;  2LVS A;  1RPW A;  3TP0 A;  1MBJ A;  2VUM J;  3BTL A;  5EG0 B;  1FIA A;  1B72 B;  1IGN A;  3BR6 A;  1GT0 C;  4AC0 A;  4S0H B;  1DU0 A;  2H8R A;  4A3L J;  2ME0 A;  1I6H J;  5DS9 A;  2D5V A;  1JUM A;  4CYC B;  3A03 A;  5HOD A;  1DU6 A;  1JTY A;  1I3Q J;  5EGO B;  5C4J J;  3Q0W A;  2DMQ A;  1JUP A;  3OSF A;  1ETY A;  1AKH B;  1U9O A;  4A3D J;  1TWG J;  4A3C J;  1ZKG A;  3ZOB A;  1OJL A;  2DMT A;  2XB0 X;  2FX0 A;  2WAQ N;  2NS8 A;  4EEF G;  5IYB J;  2DA4 A;  5J1U A;  3PM1 A;  2NVX J;  2HXO A;  4FIS A;  1WI3 A;  3JRA A;  2K9N A;  4M3F A;  2NOG A;  5EEA A;  1P7J A;  3K7A J;  2OPT A;  1UG2 A;  1ETQ A;  4C3H J;  4D7M A;  2VPR A;  2HOS A;  4X1E A;  3TED A;  2VI6 A;  2XGD A;  4D5F A;  3GTO J;  3IH2 A;  1BA5 A;  2HOT A;  4A3F J;  4A3J J;  2HQ5 A;  2NVT J;  3GTJ J;  1ZGW A;  3FK6 A;  4XID A;  4Y7N J;  2XRL A;  3NAR A;  1HDD C;  1JGG A;  3S1Q J;  1QPI A;  3S15 J;  1JUS A;  1OFC X;  3BT9 A;  3DCF A;  4MLO A;  4QIW N;  1ZR4 A;  4IHY A;  4LOC A;  1U8B A;  2YUS A;  2PMZ N;  3MN2 A;  2QF7 A;  3Q0V A;  5M5W J;  3JRI A;  2CQQ A;  2JA7 J;  2JA5 J;  1AKH A;  1IV6 A;  4MO7 A;  1XS9 A;  2JJ7 A;  2Y9Z A;  1TWF J;  1MBE A;  5J1R A;  3GTL J;  2WB1 N;  1XG1 A;  5F0F A;  3LSR A;  1Z0X A;  4M3G A;  1I50 J;  1RET A;  3FKI J;  1FTT A;  2AO9 A;  3OIO A;  2TCT A;  3OOU A;  3MKL A;  4RDU A;  1HCR A;  1VND A;  3K2A A;  3E7L A;  3O8H A;  2ID6 A;  2I10 A;  1QRY A;  3HOW J;  2MGQ A;  3BTJ A;  3I4N J;  1IG7 A;  1PUF B;  1YRN A;  5IP6 A;  2COB A;  1ETO A;  5F27 A;  2MW8 A;  5FKK A;  1HOM A;  2X6O A;  4DYR A;  3I4M J;  1RR7 A;  3G1L A;  3HDD A;  4JX4 A;  3JR9 A;  4XRM A;  1GDT A;  1IUF A;  4DYQ A;  2CQX A;  5M5X J;  1JT6 A;  1RKT A;  1GUU A;  4Y52 J;  4M3D A;  1FIP A;  2ECC A;  4DZJ A;  4DYC A;  1B72 A;  1NTC A;  4W1U A;  1HLV A;  1MBK A;  3ZQC A;  5EG0 A;  2XGC A;  1X58 A;  2L0K A;  5E3N A;  4B3A A;  2JWT A;  2R0Q C;  1QVU A;  1QVT A;  4M6V A;  5GPA A;  4D7N A;  2R5Z B;  5GP9 A;  2DA7 A;  1F43 A;  4A3B J;  4C3I J;  2OF7 A;  4L5E A;  2R5Y B;  1VI0 A;  1ETW A;  2L7Z A;  3BG9 A;  1IC8 A;  4CYC A;  5IYC J;  1AU7 A;  2XSD C;  2MG4 A;  3GTK J;  2TRT A;  1R9T J;  1D5Y A;  1LE8 B;  4JYK A;  2Y9Y A;  4MFE A;  2K40 A;  4M3E A;  5F04 A;  4FE7 A;  1AHD P;  2E2J J;  3ZQH A;  1JJ6 C;  3S1N J;  5IP7 J;  3IV5 A;  1WGX A;  3CCY A;  3JRF A;  4RBO A;  1ETV A;  4V2G A;  4BXX J;  1OCT C;  4AUX A;  5C44 J;  4FTH A;  3NAU A;  1VF9 A;  4D5C A; 
#chains in the Genus database with same CATH topology
 3M8J A;  4U0V A;  2EZL A;  3H9G A;  4NC7 A;  4EJO A;  3BC8 A;  3CZ6 A;  1ETK A;  3CD6 I;  1OQY A;  5HNF A;  1VTN C;  2QYO A;  2R7F A;  3E5X A;  2BW3 B;  3I59 B;  5JI6 A;  2A3S A;  1TC3 C;  4BE1 A;  4JX6 A;  4PUS A;  1ZGJ A;  2VC0 A;  1BI3 A;  3LFK A;  1G4D A;  2OU2 A;  2CJJ A;  1N78 A;  1W5S A;  1GXQ A;  5F0H A;  1Y39 A;  3HYI A;  2R7Q A;  4IOC F;  2PG4 A;  2OCC H;  3HOV J;  2KDZ A;  4XNF A;  5CLS A;  2EZI A;  3CUQ B;  4YIR X;  1VFC A;  4E70 A;  3RZD J;  3HOS A;  3I0T A;  3CCR I;  4XRS A;  3OYI A;  2DQR A;  3ERE D;  4YFN F;  1XB4 A;  2IGM A;  3HGY A;  2VOO A;  1SFO J;  4BHC A;  1YJ9 I;  2VBX A;  9ANT A;  2DT7 B;  3EQL F;  2CU7 A;  2VL8 A;  1WPK A;  3ZMU A;  5HOO A;  3HM5 A;  1O3Q A;  2R93 J;  4IRI A;  4JX5 A;  4ETS A;  4IQ4 A;  1EKE A;  3W2A A;  1RIO H;  2L3D A;  2JT1 A;  3ZR8 X;  1NK3 P;  4YFX F;  3KEO A;  4V19 K;  1IW7 F;  2EIK H;  4I6Z A;  2IEK A;  3WU2 C;  4HLX A;  2LKP A;  3IHU A;  3ZQG A;  1UST A;  1A5J A;  1U9N A;  3SQN A;  4MTD A;  2W7N A;  2Q2E B;  2QA4 I;  4YEL A;  5HDN A;  2LR8 A;  1TTY A;  1G8X A;  2M0C A;  2M34 A;  3MKZ A;  3PO2 J;  3QPL A;  3WTS C;  5FRN A;  2P81 A;  4IPA A;  3J81 K;  2FE3 A;  1OYW A;  2H94 A;  3RSN A;  3WU0 A;  3TOA A;  4N9I A;  2M8E A;  2JPB A;  2W85 A;  2BBY A;  5EEH A;  3S3M A;  2E7X A;  2H1L A;  2QKL B;  4DZP A;  4HNV A;  3H0G J;  3HOT A;  4IL6 C;  2K3F A;  2E19 A;  2XB5 A;  3KZY A;  3DPU A;  3HOX J;  1VQM I;  1A31 A;  2M4K A;  2DK5 A;  1J75 A;  4RB3 C;  2CH0 A;  5FLV A;  2VJ5 A;  4QSH A;  2L9V A;  2OD5 A;  3VSL A;  2VKH A;  3BCB A;  5J8F A;  2VT2 A;  3W6V A;  3GZ6 A;  2UXX A;  3QP6 A;  2BEO A;  2ZXH A;  3WG7 H;  2XKP A;  4UUS B;  2LNB A;  5L3B A;  4HF0 A;  3N4M A;  2NNN A;  2ZME C;  4CH7 A;  4KFC A;  2CGP A;  3ZP5 A;  2GM4 A;  5LHG A;  1SFU A;  1UCR A;  5BPI A;  2XIG A;  5KHD A;  5BNG A;  1B6A A;  3BR5 A;  4LK0 F;  4AM3 A;  3IC7 A;  2DJI A;  3HRT A;  3VYU B;  3L2V A;  4KIS A;  2GZW A;  4A3K J;  2JA6 J;  2P6S A;  3I55 I;  1ZRC A;  1VQ4 I;  1LFB A;  2HI3 A;  2HDW A;  3F0C A;  3FIW A;  2GOX B;  3LNQ A;  2EZK A;  3ABU A;  3H3U A;  3FXR A;  1J09 A;  1XGS A;  1DP7 P;  2RDP A;  2V4J C;  3JW4 A;  4GGG A;  1IO2 A;  1O3T A;  5K7H A;  1CF7 B;  2KQR A;  4DQ2 A;  2KZG A;  2X48 A;  5JLW A;  3ZQL A;  1MKM A;  2EZH A;  3LSJ A;  2Y31 A;  2FXA A;  3BG5 A;  1C0W A;  3S93 A;  3RPU D;  3B6C A;  2BY1 A;  2LRE A;  2O8K A;  2OBP A;  2K3P A;  4C2T A;  4UNO A;  4YII A;  5KCM A;  1BR2 A;  3S1M J;  4XOT A;  2NXN B;  3HKZ A;  4FT8 A;  3BPX A;  4CCM A;  1TW3 A;  3C2H A;  3AL0 C;  1V5E A;  2DDB A;  5E3M A;  5FLM J;  5F1J A;  3HGG A;  1JKO C;  2ADU A;  5EZG A;  4ZYG A;  4A69 C;  4P1W A;  4RAG A;  5D4R A;  2KL4 A;  3SDG A;  2DOE A;  4DNC A;  5H20 A;  4L9T A;  3ECO A;  3RPQ A;  1WWX A;  4RAZ A;  3ABM H;  3K4M A;  1R7J A;  1BJZ A;  2FSW A;  3GTP J;  1FLI A;  2EQR A;  1T56 A;  1I1S A;  1EA3 A;  4CZZ A;  2XSJ C;  2ELK A;  3OY9 A;  1MBG A;  2FU4 A;  3TGN A;  4LLN A;  2E1N A;  3GX4 X;  2FJ1 A;  4BKX A;  5C4X J;  2QBY B;  2PJR A;  4A3G J;  2OA4 A;  1W36 D;  5ICE A;  3OSG A;  5HLH A;  5C3E J;  3OS2 A;  1X1C A;  1PUF A;  3C2B A;  3HOY J;  2I5U A;  1D3Y A;  1EH7 A;  2H8W A;  3NWT A;  3TDU C;  4PJ0 C;  3ABL H;  2FD5 A;  2EFN A;  1ITY A;  1XC5 A;  3HRS A;  4BYY A;  1B9M A;  1U2W A;  2DTZ A;  1A6I A;  3KYD B;  3AG2 H;  3FMS A;  3CJR B;  1W0T A;  1J59 A;  2V9V A;  1WQ2 A;  5L3C A;  2K02 A;  1YE9 A;  4UHT A;  4B44 A;  3IKV A;  2VC1 A;  4AYB N;  2QVO A;  3LQR A;  2VQH A;  2XVC A;  3DWL E;  4XRS G;  3OYE A;  2X6W A;  3QPH A;  1BM9 A;  1B8I B;  3GUD A;  1S7O A;  3FDY A;  3JRG A;  6PAX A;  4OMZ A;  2M9H A;  4IHX A;  2M2E A;  3VYT B;  3FWE A;  1FP1 D;  3J80 K;  2H27 A;  1E3O C;  4JK1 X;  3I53 A;  2FRH A;  1U78 A;  3K1N A;  1OCP A;  2L7F P;  3CUO A;  4WXH A;  2H6C A;  3VOD A;  4BL0 B;  2K85 A;  2PEX A;  2EB7 A;  4X6A J;  2JSP A;  3Q0U A;  1BN5 A;  4MIM A;  5CJ9 A;  4ESJ A;  1K6Y A;  4BQA A;  2V1D A;  3SDB A;  5AON A;  1BC7 C;  4PGG A;  1FT9 A;  3QRF F;  3CES A;  2FBH A;  5EGO A;  1K4S A;  4E6K G;  1FYK A;  4NHJ A;  2LLK A;  4R8H A;  1R5G A;  5M3M J;  1K4T A;  1XGN A;  1TLH B;  5BS6 A;  5AIP A;  1AA7 A;  3E6M A;  1MNM C;  4EAT A;  5LGN A;  2VIX A;  2ZXJ A;  1CQT A;  3L9F A;  1FOX A;  1UB9 A;  3GLL A;  2DOA A;  2CUF A;  3TP3 A;  5KAF C;  2HVR A;  3CME I;  4XL9 A;  1KGS A;  1X1A A;  1GLN A;  1GV2 A;  1V5F A;  2AXL A;  2QEX I;  1FSH A;  2O61 A;  2K7L A;  2K27 A;  1WCM J;  2CG4 A;  2JK3 A;  2NNY A;  2CUZ A;  4OIO F;  2Q1Z B;  1JT0 A;  2LK2 A;  3A01 A;  2L4M A;  3OL3 A;  2W4S A;  3CO7 C;  1Z6T A;  5E3O A;  3B02 A;  3OIQ A;  4A0X A;  2EV5 A;  3DFG A;  4LMY A;  2F48 A;  2HQA A;  1HC8 A;  4FE4 A;  3KET A;  4O6J A;  3WTX C;  1RPW A;  3G3Z A;  1MBJ A;  4ENN A;  3SXY A;  5EG0 B;  4XN0 A;  1V4R A;  3K70 C;  1IGN A;  1SFE A;  1GT0 C;  4S0H B;  2C6Y A;  1XDS A;  2AQE A;  2CYY A;  3LSK A;  1I6H J;  3F21 A;  2IS1 A;  5DS9 A;  2P8T A;  3W6J B;  4ENJ A;  3OYH A;  3A03 A;  2HDC A;  4HPQ A;  4F91 B;  4TV7 A;  2LYC A;  1JTY A;  5LD2 C;  4II2 A;  3Q0W A;  2BV6 A;  4CXF A;  3OSF A;  2ISZ A;  1W7P B;  3R0J A;  4XLP F;  2L02 A;  3IL2 A;  4RB2 C;  1U9O A;  4HX8 A;  4F55 A;  5KNL A;  1MDM A;  3ZOB A;  1HW5 A;  2XB0 X;  1CF7 A;  3H9J A;  1STZ A;  1CGP A;  2MD0 A;  3NEU A;  4XQF A;  2WB1 A;  4HW0 A;  4MEY F;  3PM1 A;  3JAM K;  3F9K A;  3UR3 C;  2LOO A;  3K4N A;  1E0E A;  4Y13 A;  2ZJP F;  5E1Z B;  5EEA A;  4E7L A;  1P7J A;  5E8I A;  3WGH A;  3I71 A;  4HV6 A;  3MMY B;  1J7K A;  4HF1 A;  3CCJ I;  1EV7 A;  4BH9 A;  1FYM A;  1SFX A;  5D8K B;  3J81 Z;  4D7M A;  4A0Y A;  3S3O A;  4DOZ A;  4ZTJ A;  2CFO A;  3D5R C;  4PK4 A;  3IH2 A;  3PSI A;  1TT5 B;  1K78 B;  3FMR A;  2VXD A;  2HQ5 A;  1RNL A;  4P5O A;  1ZYR F;  1WJE A;  3COA C;  4NB5 A;  2X1C A;  2XRL A;  3GWZ A;  4ZYH A;  4OIQ F;  1JGG A;  3S1Q J;  3QYF A;  3S15 J;  3LA3 A;  3BJO A;  3BT9 A;  4MLO A;  1JGS A;  5FGM A;  1V55 H;  2E1M B;  2YUS A;  3IAS 2;  4Z2Y A;  1X19 A;  4XKW A;  3OYJ A;  4AID A;  2PQ8 A;  3JRI A;  2A6E F;  2DDA A;  2M30 A;  3IRR A;  4L0Z B;  3K10 A;  4RGS A;  1OR7 A;  3VYR B;  3F22 A;  1AKH A;  4MO7 A;  2JJ7 A;  1MBE A;  1UFM A;  2KRF A;  3GFJ A;  5J1R A;  3GTL J;  4XLC A;  4E7H A;  1N77 A;  4G6T B;  3P7N A;  2A69 F;  1LFP A;  1FZP B;  3FKI J;  1FTT A;  1WJC A;  4Y17 A;  4BS9 A;  1NG7 A;  3DP7 A;  5HS8 A;  4EQQ A;  3OOU A;  1SVL A;  3MKL A;  4B47 A;  1HCR A;  2VBY A;  2F5V A;  1VQ9 I;  2KRH A;  2NOJ B;  5FRM A;  4LK1 F;  3EUA A;  1SD6 A;  2MGQ A;  1LDK B;  1PUF B;  3CP2 A;  4KNY A;  3ISP A;  3HSR A;  5LHH A;  1TL8 A;  3IWF A;  4ZJZ A;  4DYR A;  1JHF A;  1RR7 A;  3HDD A;  1GDT A;  1T2K A;  1IUF A;  4BDY A;  1FMV A;  1GUU A;  1MJA A;  5ILU A;  3IP4 B;  3LAP A;  2V1U A;  5FLX K;  2G7H A;  2Q0O A;  4I02 A;  3PNV A;  2XGC A;  2DAO A;  1X58 A;  4M74 A;  5E3N A;  4RMN A;  4LIV A;  1T6S A;  2R0Q C;  1QVU A;  2DA7 A;  2R5Y B;  1ETW A;  2ZSH B;  5A2Q K;  1IC8 A;  2X1D A;  5IYC J;  3BZC A;  1R1U A;  3LWF A;  2VE9 A;  1R9T J;  3F72 A;  2LBF A;  3B73 A;  4Q5S F;  4MFE A;  1Y56 A;  2K40 A;  4ZC3 A;  3HUG A;  5TJJ A;  3T1B A;  3LFU A;  5HS9 A;  1Y0N A;  4BQQ A;  2PLY A;  2CV2 A;  1BI1 A;  1S3J A;  2ZNZ A;  3RJP A;  3JAM Z;  2FNP A;  2KIS A;  3TO6 A;  3IV5 A;  4O3M A;  4UV9 A;  4AVZ A;  1LJ9 A;  4BEH B;  1B4A A;  3N05 A;  3NAU A;  1T95 A;  1UHM A;  2KHM A;  4IZZ A;  2STT A;  2GXG A;  3ML6 A;  1F36 A;  3Q9S A;  2ZNY A;  1X1P A;  2OUM A;  3DPT A;  3LL7 A;  4G7Z F;  2QQA A;  4KIB A;  4NQW B;  2UXN A;  1Y1V J;  1ZRE A;  5E17 F;  2VBW A;  2HR3 A;  3T8T A;  2IA1 A;  3RDI A;  4YEJ A;  1QQI A;  1SVM A;  5HLI A;  3ZMD A;  2QGU A;  1JKR C;  4A12 A;  3DV8 A;  2NAZ A;  5GTI C;  2JVG A;  3RZO J;  1NG6 A;  5GPC A;  1IRX A;  1TQI A;  5BQT A;  3ONQ A;  4KIT B;  4ITV A;  3F8N A;  4EM1 A;  2VJJ A;  3KP3 A;  2DFE A;  5B66 C;  4D0P A;  2HYG D;  3QOD A;  4PDK A;  4RLF A;  5J8C A;  2GXA A;  1ENH A;  2IRF G;  4UUS A;  1TBX A;  3WTV C;  4M9S A;  1Z7L A;  2KIM A;  4ANJ A;  2HZD A;  3NWS A;  3JRB A;  2HQN A;  1ZK8 A;  4KIC A;  2IGO A;  3MVP A;  2KFD A;  1O7L A;  2V9K A;  2ZME A;  2BHZ A;  3OYL A;  2XPU A;  1WJF A;  1ETX A;  4G7O F;  4G7H F;  3DBL B;  1W7P A;  1QHH D;  3GZN B;  2XF6 A;  1H88 C;  5L3E A;  1B1B A;  2TDX A;  3A01 B;  2L2O A;  1WFX A;  1LB2 A;  2H1K A;  2OTL I;  3EYY A;  3DU5 A;  2E2H J;  4KIG A;  2LC2 A;  1OLT A;  1S6L A;  5FKL A;  1ORK A;  1WH5 A;  4Z6Y A;  1X3U A;  5ICC A;  4E7Z A;  3WG9 A;  2LFB A;  1QGP A;  2G7U A;  1G59 A;  4DJA A;  3E5Q A;  5ILS A;  2E35 A;  3JRD A;  1KQ9 A;  4GO1 A;  4MGR A;  4BJ5 C;  3F23 A;  4WXD A;  1KU9 A;  4HDU A;  1GXP A;  2QLZ A;  4BAY A;  3I9V 2;  3LSP A;  2RGV A;  4EM0 B;  3G4S I;  2NYX A;  1PVE A;  2JMW A;  3E1S A;  3ZRG A;  4J00 A;  2XF7 A;  3AFH A;  4OMY A;  3BRO A;  5E20 A;  3BR1 A;  1RZ4 A;  2ZSI B;  4RAY A;  1VQK I;  5DDG A;  1PUE E;  2JRM A;  4A6E A;  1FYL A;  3U2R A;  1UHS A;  4UVB A;  4ZDL A;  3QU6 A;  3G2B A;  2CMP A;  4HF2 A;  4ON0 A;  3LSH A;  3CC2 I;  2XGE A;  1WJ5 A;  4P9F A;  2VB6 A;  1IAW A;  2ZJQ F;  4LIT A;  5J6X A;  1RUO A;  3S32 A;  2Z5U A;  1QHG A;  3C2G A;  1OPC A;  1OCO H;  4OIR F;  2EIM H;  2HFH A;  2HTS A;  2O3F A;  1D1A A;  5EF6 A;  3PO3 J;  3HOZ J;  3M8E A;  3S2H J;  2BW3 A;  2DN0 A;  4O5V A;  5KVR A;  5DEQ A;  3GTM J;  5LEJ A;  2V1N A;  2KZV A;  4FAS D;  2RVC A;  3H5N A;  4GCV A;  3BY6 A;  3VYS B;  2W1O A;  4BGD A;  4U0Y A;  2EPF A;  2HU9 A;  4RLQ A;  4H4K C;  1X1D A;  4EVI A;  3DKX A;  1H8A C;  1U0J A;  1Z05 A;  3ASN H;  2GAU A;  1SAX A;  1S8N A;  2M3A A;  3H1C A;  1KQ0 A;  4OOI A;  4M72 A;  3L2W A;  2AHQ A;  2O7O A;  3M4O J;  3BWG A;  2JA8 J;  3U1D A;  3Q3S A;  3BCA A;  4RM3 A;  4WF2 A;  1YJW I;  2A5W A;  3CMM A;  2RN7 A;  2ZXI A;  4HQE A;  4L9N A;  1MMN A;  2M7A A;  1JKQ C;  2LRD A;  3QYB A;  2IGN A;  1Z7U A;  2ZJR F;  4NNJ A;  2P5V A;  4M6Y A;  2A6T A;  2XPW A;  1S5L C;  1P6R A;  1FTZ A;  2F5D A;  1YTY A;  3CLO A;  5DTD A;  3JCU C;  3TQN A;  2HXI A;  1G3S A;  1LFU P;  4OU0 A;  1F9N A;  2E1C A;  2HWV A;  2M1B A;  2ZJ2 A;  2FQ3 A;  4BXF A;  3H5A A;  3OMY A;  2XDV A;  3I5U A;  2FUG 2;  4EGZ A;  1WSU A;  1XDU A;  4Y3O A;  5JLX A;  1UJ8 A;  2HGC A;  1IZ1 A;  3CMA I;  3OWT A;  1YFH A;  4Y33 A;  3AL0 B;  2FOK A;  2K4J A;  3VOE A;  4BJT A;  2F4M B;  4CSW A;  3LOC A;  1UMQ A;  3BOQ A;  2AXT C;  3S16 J;  4A3M J;  3K4B A;  1OIS A;  4XKB A;  2KT0 A;  3F8F A;  4ZDP A;  1T08 B;  3HKZ N;  3RPU A;  1U5T B;  4ABZ A;  1R5I D;  4BBR J;  3ZCO A;  1Q1V A;  2NS7 A;  1UHW A;  4PGH A;  5F6F A;  2VJ4 A;  4MEX F;  2K9S A;  2R92 J;  1VQ8 I;  1LEB A;  1A36 A;  1HSJ A;  3BJA A;  2DA1 A;  4LB6 B;  3EUH A;  3GO5 A;  4Y4R A;  3ULQ B;  1EF4 A;  4IHV A;  2O03 A;  1BC8 C;  1OCC H;  3RI4 A;  3PSF A;  1R1V A;  2ID3 A;  1O3R A;  2L7M P;  3PUF A;  1X4P A;  1YW9 A;  1QZZ A;  2VON A;  2D45 A;  3SZT A;  1IF1 A;  4F3Q A;  2N8G A;  4I2O A;  2EH3 A;  1F1Z A;  4KN7 X;  4L5I A;  4RB1 A;  1R00 A;  2DJN A;  3KLO A;  2O5R A;  5CQG A;  5L3G A;  5D6E A;  1P92 A;  5ICG A;  2BY3 A;  2XF5 A;  1E2X A;  2P0W A;  1D0X A;  1G3W A;  3MWM A;  4XKV A;  1S7A A;  2X4H A;  1UAA A;  5F0C A;  3BR0 A;  4G8X A;  4GRI A;  1XCV A;  3QOP A;  3DBR B;  2L9R A;  5DM6 F;  3QPT A;  2WWY A;  1LPQ A;  2GIV A;  1IJW C;  1O4X A;  4RAF A;  4GYG A;  5F1R A;  2LTP A;  3CC7 I;  5IOZ A;  3MAJ A;  1KYZ A;  2EIJ H;  1B59 A;  1YYV A;  2WV1 A;  3JRH A;  3O3K A;  1JI8 A;  2EA2 A;  1KQ8 A;  1PP8 F;  1OCZ H;  2MSY A;  3WE2 A;  2Y0S N;  3I56 I;  3BQZ A;  3KLN A;  2BXZ A;  2W82 A;  3RQ4 A;  1Z1D A;  3A02 A;  3KZI C;  2XAJ A;  2WAQ A;  3TW6 A;  2YS9 A;  3H9Q A;  4DIQ A;  5CYV A;  1SEU A;  1LE8 A;  5FKO A;  1NH3 A;  4UVA A;  3UKG A;  4F7Z A;  3FXO A;  1OYY A;  2COM A;  1H89 C;  3VFZ A;  2GLO A;  3F8B A;  4AIK A;  1XCB A;  2PJR B;  2QBY A;  3R0A A;  3ZMZ A;  3FX3 A;  2EBI A;  1R22 A;  3DKW A;  2LVS A;  5E3L A;  4NC6 A;  3OR1 C;  2P5L C;  3LMM A;  1JXS A;  3BTL A;  2FA5 A;  1FIA A;  2X6X A;  1SC7 A;  3W3C A;  2Q2E A;  4AC0 A;  2ELJ A;  4P9U A;  2XAQ A;  1AOY A;  2CQ7 A;  4QLC U;  2D5V A;  4CYC B;  1LEA A;  4HAM A;  3ERM A;  3A1Y A;  4M6X A;  5BPD A;  3AG3 H;  1DU6 A;  4M71 A;  1I3A A;  5DUK A;  1WVR A;  3BZK A;  4UB6 C;  3TO9 A;  2DMQ A;  2KDO A;  2DPD A;  1JUP A;  1ETY A;  4XSX F;  4CO8 A;  4CZC A;  1ODD A;  2QSF X;  2JZY A;  3RIR A;  1ZKG A;  4PZJ A;  1BI0 A;  2MC3 A;  4CA0 A;  2X6Y A;  4L18 B;  4EM2 A;  2HZT A;  1FWZ A;  2ZBK A;  4U7D A;  4EEF G;  2DA4 A;  3C3W A;  5J1U A;  1IXR C;  2NVX J;  4FIS A;  2L01 A;  2PI0 A;  1FX7 A;  1T0F A;  2M4G A;  5CVV A;  2NOG A;  4KDP A;  4UY8 I;  2R7U A;  2K5C A;  3K7A J;  1YIJ I;  1UG2 A;  3QWL A;  4KUM A;  1ZEL A;  2B0L A;  4KT6 A;  2VPR A;  2HOS A;  4Q48 A;  3V4G A;  3HTS B;  3TED A;  4FX4 A;  3IUO A;  2XGD A;  1Y8Q B;  3E3V A;  4B43 A;  5GTH C;  3L00 A;  4ZDO A;  1BA5 A;  4A3J J;  1ON2 A;  1OYI A;  2FF4 A;  5FD6 A;  2NVT J;  4PSX A;  4HOB A;  3AKZ A;  4HG2 A;  2IS2 A;  2R7V A;  3FK6 A;  1MMG A;  3GXO A;  5DD8 A;  3R61 A;  4FQG A;  4JOM A;  3Q5F A;  1JUS A;  2IT0 A;  4IHY A;  5HLG A;  1N25 A;  3MN2 A;  2QF7 A;  2UUZ A;  4ZYA A;  3M1E A;  1KON A;  1Y8R B;  2V26 A;  1MIJ A;  2JA7 J;  5K5O A;  5JR3 A;  2QSH X;  1XS9 A;  4ZZL A;  3U21 A;  1XG1 A;  4WXC A;  4C9Y A;  4N0B A;  1Z0X A;  1I50 J;  3TDZ C;  1YHQ I;  3OIO A;  2TCT A;  4Q47 A;  3J7A O;  4UB8 C;  2ZC2 A;  3KEQ A;  3E7L A;  4KIF A;  2I10 A;  2P5K A;  2R7D A;  4I01 A;  1XPX A;  2KP6 A;  4CCJ A;  4WX9 A;  3BTJ A;  2E34 A;  1IG7 A;  2ZFW A;  1YRN A;  1DGR M;  5IP6 A;  2Z2S B;  2COB A;  2QSG X;  2FOW A;  2HKO A;  2LDU A;  2MH9 A;  4KN4 X;  2E1M C;  4G6D A;  2K9L A;  1BOB A;  2WV0 A;  3P9I A;  5LLQ A;  1REP C;  3ELK A;  2QZ8 A;  1KZH A;  1B9N A;  4DYQ A;  2IS6 A;  2DQL A;  1HKQ A;  1J2X A;  2OV7 A;  4DYC A;  2BYV E;  4W1U A;  1HLV A;  2A6H F;  3V8J A;  3CLQ A;  4AWX B;  3A4C A;  5IT9 K;  4AIH A;  3ZPL A;  1XN7 A;  1FP2 A;  4B3A A;  2HS5 A;  2JWT A;  4CIC A;  1BOA A;  4M6V A;  2MBF A;  4AYB A;  4C3I J;  4L5E A;  2B9S A;  1M1E B;  4LG0 A;  1VI0 A;  2E7W A;  2RKH A;  2XUB A;  1VQO I;  3HHH A;  1TNT A;  1WKM A;  1X3Z B;  4CYC A;  2EFQ A;  1AU7 A;  2MG4 A;  2LY2 A;  2DO7 A;  1Y6I A;  1I6X A;  2M7B A;  1P2F A;  3WE3 A;  5DV5 A;  1LE8 B;  4LD5 A;  4M9X A;  5E8G A;  3K6G A;  3HPG A;  5D5U B;  5F04 A;  2KIF A;  4CCO A;  4FE7 A;  1AHD P;  4EMS A;  2CW7 A;  2DT5 A;  3S1N J;  2DU9 A;  3WOD F;  1WGX A;  1YX3 A;  3OS1 A;  3I58 A;  1LNW A;  4AUX A;  1OCT C;  2XAG A;  4WK8 F;  1VF9 A;  1XMK A;  4D5C A;  2CWE A;  3MCZ A;  1PYV A;  2ESH A;  2GOM A;  3UNG C;  3TW7 A;  3WHB A;  5FB2 A;  4ENM A;  2Y0S A;  2IW5 A;  4HNU A;  2XRO A;  2V6E A;  2EFW A;  3KP2 A;  3D0S A;  3O2P E;  4F92 B;  1GV5 A;  3C7J A;  1X3W B;  1D1B A;  3FKJ A;  2YU9 J;  4IQJ A;  2CUJ A;  4BQO A;  4DW6 A;  1WH7 A;  4BY1 J;  4XMY A;  1TNS A;  4PCQ A;  1K78 A;  1FBS A;  4KMU X;  5GAH J;  1DPU A;  2RV8 A;  1YW8 A;  1T8I A;  1UG0 A;  4RM2 A;  1K83 J;  4B4C A;  4H0E A;  3S17 J;  1IN4 A;  4PJN A;  3ZQ7 A;  2LD5 A;  4BBS J;  4II3 A;  1K79 A;  1WRJ A;  2JPC A;  5DUI A;  4LGW A;  3JRC A;  2R7O A;  3JRE A;  2VQG A;  3PJR A;  4KJZ A;  3FHN A;  5IY5 H;  2QQ8 A;  4J19 A;  3E6B A;  1DPR A;  2E2I J;  4HDV A;  4L9J A;  1YW7 A;  1U5T A;  3OV8 A;  2CV0 A;  1LUJ B;  1WHU A;  1WJD A;  3FXJ A;  1MSF C;  3EPZ A;  1G2H A;  3LSG A;  3BP8 A;  2D1V A;  1ZLK A;  4BXU A;  2R5Z A;  2VQL A;  3L2C A;  3FZV A;  5D5V B;  2XHK A;  1LVK A;  1Z91 A;  1QZY A;  3SZP A;  4A5M A;  2B63 J;  5H6Q A;  4JP0 A;  4ASN A;  2CO5 A;  3I54 A;  2XGX A;  2RNJ A;  2HOA A;  1VQ5 I;  4HNT A;  4ZYE A;  1GVJ A;  4B8X A;  1F4K A;  2WBM A;  1L3L A;  1LKX A;  2CSO A;  2LKS A;  3P9C A;  2ME6 A;  4IHW A;  4BJ6 C;  5KAI C;  1IXC A;  2CQK A;  2DA6 A;  2DTR A;  2K9Q A;  1JHH A;  1MND A;  1USS A;  4HX4 A;  1LQ1 A;  2CQN A;  4LLG F;  2RC4 A;  1VQL I;  4G94 A;  3OYG A;  2OQR A;  3V8L A;  2DI3 A;  2RQP A;  2JUC A;  2UV1 A;  1SMY F;  1T33 A;  1U8R A;  1I27 A;  2ZFU A;  1EH8 A;  5E1W A;  2PBI A;  2Y69 H;  4NDL A;  2ECB A;  2WAD A;  3CCE I;  5J1Y A;  2NVQ J;  3A0B C;  3KZZ A;  1P7I A;  5ERI A;  1OR7 C;  3OOP A;  2WY7 Q;  1MBF A;  2F4O B;  2NS0 A;  3KP5 A;  5JHF A;  1A04 A;  2F5C A;  2OC6 A;  2MLG A;  1H0M A;  3QPS A;  1IDZ A;  2HKX A;  3ZQI A;  3CUQ C;  3ZQF A;  1RR8 C;  3S14 J;  1JKP C;  2M8G X;  3CQZ J;  2Y30 A;  4IHS A;  1MBH A;  2YPR A;  2JN6 A;  4A0Z A;  1S72 I;  1W0U A;  3BJ6 A;  1K6O A;  4P96 A;  3GTQ J;  3HTU A;  1D5V A;  1I1G A;  2AS5 F;  4RS8 A;  1TWC J;  2WTE A;  3AAF A;  3CDL A;  2VLA A;  1EH6 A;  3MEX A;  1BBY A;  3BDD A;  1TT0 A;  1Z67 A;  3H0D A;  4J01 A;  1BW6 A;  4FHT A;  1RUN A;  2VXZ A;  2Y48 A;  4X0G A;  4PJM A;  2CRG A;  3FK7 A;  3FBI B;  4N9H A;  4XKC A;  4R1H A;  3QU3 A;  2IJL A;  2Q8K A;  3TKY A;  1RKW A;  1FMW A;  1E3P A;  4XM3 A;  4XLH A;  2W57 A;  3ZXS A;  5BOX A;  4RB0 A;  2EFP A;  3SEZ A;  4XK4 A;  3I4P A;  2EWN A;  3M3Y J;  3E6D A;  4I7H A;  1XMA A;  2L7K A;  2VKD A;  5EYR A;  1FEX A;  1V54 H;  3CF2 A;  2DOD A;  1BW5 A;  2K4B A;  2KPM A;  3HEF A;  2R5Y A;  5H6R A;  5FD5 A;  4ZTF A;  3G1M A;  2OAZ A;  4G6Q A;  2IBD A;  4CUG A;  3WTZ A;  1YRN B;  4HV5 A;  1W4M A;  2ICW G;  5HNH A;  3FM3 A;  1U5T C;  5B1B H;  3JSO A;  4GFB A;  4C3J J;  1RI7 A;  1UEL B;  1NK2 P;  2XKO A;  3U1K A;  4XON A;  5LGU A;  3QQA A;  5DM7 F;  3CCU I;  1T39 A;  2RRE A;  2BY2 A;  4YIF A;  2Z1D A;  3J7Y J;  2DMP A;  1MH3 A;  3DTE A;  2IA0 A;  2HPM A;  2EIL H;  3TMO A;  3K4J A;  2WA0 A;  4HSR A;  2GIZ A;  3ZMT A;  4U0W A;  2YSR A;  4CCL A;  1J5Y A;  3KX2 A;  3CCQ I;  1R5H A;  2R7Z J;  1HXD A;  3BLY A;  3GVA A;  4IKF A;  1O7F A;  3GFM A;  3IAM 2;  4IVN A;  4B48 A;  4G9Y A;  5FLX Z;  2ELH A;  2WY8 Q;  3ABK H;  2E1O A;  2ZME B;  4LG3 A;  4ESF A;  2OZ6 A;  3FXU A;  2Z99 A;  2LF8 A;  1MJB A;  2DYR H;  2J5O A;  1PDN C;  1K61 A;  5K7Z A;  3FBN B;  3HSF A;  1X2M A;  2VBZ A;  1W7P D;  3QAH A;  4CCK A;  2P4W A;  2MLK A;  4E4H A;  1X4O A;  3MD2 A;  2HDD A;  4BQN A;  3BTC A;  5D4S A;  2IAI A;  1HST A;  1VQP I;  3A0H C;  4OAZ A;  3FXM A;  3K1P A;  3WHC A;  2DA2 A;  5K1Y A;  4L5J A;  3HSE A;  2UWM A;  4QTR A;  2E5Z A;  3M7G A;  1YIO A;  3K0L A;  3OYC A;  5FO5 A;  1HA8 A;  3K2Z A;  2LKX A;  3CC4 I;  1Z3X A;  1I39 A;  3C18 A;  2FBK A;  1W36 C;  1YJN I;  1T0F C;  4LB5 A;  4A3I J;  1KYW A;  1TWH J;  3VPR A;  1DGW Y;  4XN3 A;  2ZB9 A;  1ZG5 A;  2DFF A;  1GVD A;  3L2U A;  3KCC A;  5K7F A;  4E7I A;  3BTI A;  3E6C C;  1FSE A;  1ON1 A;  4M3B A;  4LLL A;  3TL4 X;  3SYT A;  5BMZ A;  3P9K A;  2FMY A;  3FIS A;  4K2E A;  1JJ8 C;  2IA2 A;  3EDP A;  1L0O C;  1YO5 C;  1BL0 A;  4NQW A;  4MHG A;  3HRU A;  5FJ8 J;  4A5N A;  3GW2 A;  1LVA A;  3GYH X;  4BHP A;  3I64 A;  4CHU A;  3J80 Z;  5FRO A;  2PN6 A;  3G73 A;  2CS3 A;  2DOF A;  4UUT A;  1JTX A;  5JVT A;  2ISY A;  3G1O A;  5CVI A;  2PMU A;  1NHA A;  2DA5 A;  3REO A;  1TQP A;  3TP0 A;  3U9G A;  3BR6 A;  2O6G E;  4EV0 A;  1HKS A;  2XAF A;  1DU0 A;  2NVU B;  3JTG A;  4E7K A;  1FBU A;  1EJ9 A;  2Z9O A;  2MA3 A;  1JUM A;  2WAE A;  2XC7 A;  5HOD A;  2W00 A;  1Q1H A;  4BHB A;  4IXA A;  1I3Q J;  2ZKZ A;  5C4J J;  3A2K A;  1OMI A;  4IX7 A;  1AKH B;  2RQQ A;  3OIP A;  4A3D J;  2L5Q A;  4MNU A;  4A3C J;  3LST A;  3VDX A;  1KU2 A;  3DXJ F;  2O0Y A;  3VB2 A;  1TP4 A;  2DMT A;  1WI9 A;  1Z21 A;  2DFH A;  2FX0 A;  2WAQ N;  3PFI A;  1X1B A;  2V7F A;  2HXO A;  4BE0 A;  3RCO A;  1ULY A;  2R3S A;  1WI3 A;  4IRH A;  2QQ9 A;  4M3F A;  3K4K A;  2OPT A;  3HXL A;  5EEG A;  1VZ0 A;  1ETQ A;  1SMT A;  3DLL F;  4F52 A;  1ZAR A;  1YI2 I;  3MKY B;  4X1E A;  2VI6 A;  4ENK A;  2KJC A;  4D5F A;  3GTO J;  3FXQ A;  3FF5 A;  2IXS A;  3LA2 A;  4XOR A;  4A3F J;  3Q9V A;  3GTJ J;  1ONV A;  1R6R A;  1ZGW A;  4KA4 A;  4D1Q A;  3NRV A;  1FPQ A;  3V42 A;  4XID A;  4Y7N J;  1N75 A;  3I59 A;  3NAR A;  1HDD C;  1ZRF A;  2A05 A;  3ASO H;  1QPI A;  2V79 A;  2G9W A;  3LA7 A;  4QIW N;  3CJT B;  1T38 A;  4LOC A;  3CJN A;  4U7B A;  3T8R A;  5JHU A;  5M5W J;  5HVQ C;  5ED4 A;  2R4G A;  2WAF A;  2BVM A;  2GQQ A;  2E71 A;  1QO0 D;  4QPO A;  5DCM A;  2P7C B;  3K4C A;  4C30 A;  2QEN A;  1TWF J;  4FX0 A;  1HKT A;  2WB1 N;  4D9J A;  1R4M B;  1BI2 A;  3LSR A;  4KMF A;  1RET A;  1D8J A;  4UXN A;  4KYW A;  2AO9 A;  3BPV A;  3CTA A;  3L09 A;  3NQO A;  2JUG A;  2KLO A;  1DDN A;  1VND A;  1ZGA A;  3K2A A;  3O8H A;  2ID6 A;  3EUH C;  1BR1 A;  1QRY A;  4L0Y B;  3HOW J;  3V7R A;  3GFI A;  1R23 A;  3E0J B;  1ETO A;  5J40 A;  1IV8 A;  4CGZ A;  5FKK A;  2F6C A;  1HOM A;  4XLE A;  5E79 C;  3JR9 A;  4XRM A;  3RKX A;  4HZF A;  2DK8 A;  5M5X J;  3T5X A;  1RKT A;  1JT6 A;  4Y52 J;  1FIP A;  2Z3Y A;  3EET A;  1B72 A;  3SHF A;  2M45 A;  1NTC A;  1MJ9 A;  1ZRD A;  2DPU A;  1V3F A;  3DEU A;  3D5S C;  3ZQC A;  5EG0 A;  2Y75 A;  1P4W A;  2BHY A;  3ZGK A;  2J5P A;  4IOA F;  2L0K A;  3IWZ A;  3KP7 A;  1KU7 A;  4A6D A;  2R7T A;  1QVT A;  2JSC A;  3OL4 A;  4N4O B;  1F43 A;  1LDJ A;  5GP9 A;  4A3B J;  2OF7 A;  1SVO A;  3OR2 C;  4OIN F;  4BU2 A;  2X1E A;  2EV6 A;  3IKT A;  1R36 A;  2XSD C;  4IO9 F;  3V7S A;  2HEO A;  1ZAO A;  3GTK J;  5GAD J;  2Y9Y A;  3RYR A;  2JQ7 A;  3H92 A;  3ESW B;  1AWC A;  5E1X A;  1JJ6 C;  4S04 A;  3T0Y A;  5IP7 J;  3KPH A;  2XAU A;  1PJR A;  3CCY A;  1HW2 A;  3L2Q A;  4RBO A;  2YX7 A;  4V2G A;  2KIQ A;  2HPI A;  1KA8 A;  1XD7 A;  2DMN A;  1DUX C;  1FOY A;  4MFD A;  3B6A A;  4B09 A;  3HPH A;  3HC7 A;  4F93 B;  3HZJ A;  1ACI A;  4U88 A;  5HDK A;  3PQK A;  1VQ7 I;  2VKE A;  2CUE A;  3MQ0 A;  1ZG3 A;  2F5F A;  3MZH A;  4L9V A;  1KU3 A;  4M9Z A;  4EGY A;  3KFW X;  5H2F C;  1QU3 A;  2DLL A;  1XX5 A;  1HDP A;  2HNH A;  2JA2 A;  3N97 A;  2JRT A;  1U3E M;  2LH9 A;  1IN5 A;  3OYN A;  4C2M J;  2GBY A;  1E3H A;  1YQA A;  5CPR B;  2UZK A;  1IRZ A;  2FML A;  3IH4 A;  4BY7 J;  1R71 A;  1I5Z A;  2X0L A;  1Y1W J;  3GBG A;  3E5U A;  3K1M A;  3QYE A;  1RES A;  2LBF B;  3RYP A;  5J4V A;  4HLY A;  4A3E J;  2DCE A;  4ZH4 F;  1B8I A;  2A68 F;  2Z16 A;  3AG4 H;  4XR6 A;  4AIJ A;  4JQF A;  2KRC A;  4GDF A;  3OYF A;  3H3V K;  2RAE A;  4BE2 A;  2DFI A;  4HA8 A;  4MQ9 F;  4HST A;  3ZN1 A;  1ZR2 A;  5LBQ A;  4ZYD A;  1QNT A;  4LIU A;  4HYE A;  3HL2 A;  1HQC A;  2LG4 A;  2M87 A;  4FCY A;  1DP3 A;  4HX7 A;  2PMZ A;  1MNE A;  1R58 A;  1ZN2 A;  4BNC A;  1P9Q C;  3KIO A;  1H9T A;  5D8L B;  3F6O A;  2D2W A;  5IT9 Z;  5EZH A;  1V5G A;  2V9P A;  2IPQ X;  4EJT A;  2GWR A;  3ZQQ A;  3DEW A;  2DBB A;  3GFL A;  5J3L A;  3GTG J;  5M5Y J;  3PIP F;  4EJV A;  2LSO A;  5JVG F;  2XPV A;  3LSM A;  1G3Y A;  2EK5 A;  2F5E A;  5GAE J;  2FBI A;  2KIU A;  3JSP A;  3CJQ B;  1FNN A;  3CDI A;  2HTJ A;  5FKM A;  4I99 C;  3F6V A;  1BJA A;  5LGT A;  2BZT A;  3O8G A;  3PNY A;  4NBQ A;  2VJI A;  3L7W A;  4A2U A;  5M3F J;  1ZH5 A;  4IJA A;  4XIC A;  2KMU A;  4OAY A;  1QA6 A;  4PSW A;  2R7W A;  5IP9 J;  4RGR A;  1BIB A;  2PJP A;  1OKR A;  4G12 A;  3V7C A;  5CKT A;  2M0M A;  1A35 A;  2VE8 A;  2QQB A;  1VQN I;  4AD9 A;  3E97 A;  5DCM B;  4E7J A;  4ZZD A;  2F4I A;  2H6B A;  4MQV A;  2W48 A;  3RTR A;  4BEH A;  4V2F A;  3CCM I;  1ZTR A;  2VPL A;  2EFO A;  3DKY A;  2X85 A;  3AG1 H;  2V1X A;  5KK1 A;  5K5R A;  3CP8 A;  4B1R A;  2VKV A;  2K9M A;  2PMH A;  3S2D J;  2ZCW A;  1W5C C;  3QOE A;  1YIT I;  1APL C;  4I0B A;  1G6N A;  3HJE A;  4BDZ A;  1S7E A;  3C1D A;  2F2E A;  3DU6 A;  3WTT C;  2Y2Z A;  3DTK A;  4HQM A;  2A07 F;  3CO6 C;  1MMA A;  3PUB A;  2VOD A;  4E7S A;  3R60 A;  4DBQ A;  3WGG A;  4A93 J;  4NC8 A;  4I76 A;  2CV1 A;  3X2Q H;  3F3X A;  5HDG A;  1R4N B;  1ZG1 A;  2XAH A;  4W97 A;  3RQI A;  1W5T A;  2CFX A;  1MSE C;  2H09 A;  2BXY A;  2DA3 A;  3SFI A;  3R4K A;  1TWA J;  4AVP A;  2ZXW H;  3OYM A;  3JTH A;  1MMS A;  5F64 A;  1E17 A;  1YOV B;  3MFK A;  3OYK A;  2OJE D;  4IRG A;  2MD5 A;  1ZHF A;  2X9D A;  3MKW B;  2JVH A;  1FJL A;  4PFO A;  4PJL A;  2QKM B;  3HBL A;  1MH4 A;  5LRR A;  4DBR A;  3DQV C;  2BGC A;  3DLA A;  3FMQ A;  1T98 A;  1MZB A;  1SD5 A;  3KYL A;  2VT3 A;  5EJC A;  1P4X A;  3DF8 A;  4EJU A;  1IDY A;  1XMX A;  3BZ6 A;  1ZQ3 P;  2R7X A;  3GF2 A;  2MYS A;  1WJA A;  2ESN A;  3HUG B;  2V6C A;  1X2N A;  3K9T A;  2LY9 A;  2HVS A;  1RC9 A;  2HVQ A;  3LAJ A;  1JE8 A;  4NUB A;  1H9G A;  1SAN A;  1IN7 A;  2O9L A;  1J9I A;  4I0A A;  4LFU A;  2DMU A;  3FM5 A;  2P6T A;  3P5J A;  3F8M A;  3IH3 A;  3BQY A;  3FXK A;  5FKN A;  5L3F A;  3S2W A;  2Z33 A;  1POG A;  5AIQ A;  2G0E A;  1S29 A;  3M9A A;  1FOK A;  2KJB A;  3PL8 A;  2QCO A;  4QWQ A;  2K86 A;  5F08 A;  2W25 A;  2JTV A;  5TRD A;  5LFA A;  2FNA A;  4S05 A;  2WC2 A;  1Z3Y A;  4GXO A;  4B3X A;  4R79 A;  3CCS I;  2HQR A;  3GME A;  5J4Y A;  3CUQ A;  5FFZ A;  3HOU J;  2MAB A;  3DBH B;  3D1N I;  2MFZ A;  5EDN A;  4WCG A;  3H3Z A;  3VSK A;  4MTE A;  1J0R A;  2CW8 A;  1IN8 A;  2P7V B;  2OTJ I;  2VAS A;  3HB9 A;  3S1R J;  5CVU A;  5IPA A;  3L1P A;  3BR2 A;  2DXI A;  2HYF A;  3MZY A;  3BR3 A;  1IRF A;  3PFY A;  4I09 A;  1HF0 A;  3RKW A;  1OCR H;  2AQF A;  5IOY A;  2ETH A;  1SFK A;  3W2V A;  2STW A;  2A5Y B;  2PFB A;  1QBJ A;  3SFZ A;  3I3L A;  3GEZ A;  3PIO F;  3KEY A;  1IRG A;  1MMD A;  3SJM A;  4PFP A;  1TW2 A;  2R7R A;  5ICF A;  3J7Z I;  1IN6 A;  5IYD J;  3BG3 A;  4Q4Z F;  3OS0 A;  3LSI A;  4LJZ F;  2NVY J;  2W24 A;  3KP6 A;  3DPL C;  1LDD A;  2HYJ A;  3S8P A;  3BG7 A;  1F5T A;  2EJR A;  3V8K A;  5FFX A;  2XAS A;  3WTW C;  3OYA A;  1ERD A;  2Y0M A;  4UUV A;  3K69 A;  5LHI A;  2FQ4 A;  3CMY A;  1Z77 A;  3W6K B;  1UZC A;  1XTA A;  1IXS B;  3IRQ A;  3CF5 F;  1TQM A;  4IEJ A;  1WJB A;  2E36 A;  3HHG A;  2LP0 A;  2L9S A;  3EUK L;  2GA1 A;  5CVJ A;  2O8X A;  2FEZ A;  2DYS H;  3WTU C;  4IF4 A;  3G6E I;  2I8D A;  3TBI A;  1BR4 A;  1MD0 A;  3F8C A;  3RKQ A;  4UV8 A;  2L9N A;  2VUM J;  5B3S H;  4HRI A;  3H36 A;  3PNT A;  1B72 B;  3OYB A;  2OCE A;  4KT5 C;  4GYI A;  2H8R A;  2E60 A;  2LY1 A;  4A3L J;  2ME0 A;  4JBA A;  4XBF A;  3M8F A;  2KKO A;  3M1C A;  5CVR A;  3VWB A;  1MDM B;  3G71 I;  3KE2 A;  4CCN A;  1QZE A;  2BE5 F;  3H5R A;  1S9H A;  2A61 A;  5EGO B;  4XOP A;  3CCL I;  2EIN H;  5ILV A;  4PJJ A;  1TWG J;  4YG2 F;  5LRS A;  1W1W E;  1OJL A;  5B5E C;  3SZG A;  1O3S A;  2NS8 A;  4CDG A;  5IYB J;  4C2U A;  5A2Q Z;  3JRA A;  1YLF A;  2K9N A;  2ZO4 A;  2L54 A;  2MC4 A;  4OWR B;  2YU3 A;  5DD4 A;  1HBX G;  4C3H J;  2IS4 A;  2GA2 A;  1D8K A;  2BY0 A;  1R1T A;  1QPM A;  3EYI A;  1P4A A;  3R6S A;  4HEA 2;  2HOT A;  2QWW A;  1XGM A;  1Z9C A;  3VEP A;  1RRJ A;  5D5W B;  3QP5 A;  1YX5 A;  1FBQ A;  4UVC A;  3OYD A;  3KYC B;  4YRV A;  4FET A;  3CCV I;  2EA4 A;  1OFC X;  3DCF A;  1FOW A;  2XV4 S;  1ZR4 A;  3HG9 A;  1XSX A;  2BOL A;  2D1H A;  1Y0U A;  1U8B A;  1ZLJ A;  1BIA A;  3GLX A;  2CW0 F;  1SD7 A;  3CDH A;  3ROU A;  3WU1 B;  2PMZ N;  2YR2 A;  3SEQ A;  3Q0V A;  5B1A H;  2CQQ A;  4ESB A;  2JA5 J;  4LG0 B;  1IV6 A;  2Y9Z A;  3ZMS A;  3K70 D;  3PQJ A;  5D6F A;  3ZMV A;  2QM3 A;  3FXL A;  5F0F A;  4YFK F;  4M3G A;  5J47 A;  2EV0 A;  1XSV A;  3RKY A;  3TOB A;  3HIF A;  1A6Q A;  3BG6 A;  1U6G A;  1Z6R A;  4P55 A;  5JFR A;  4U87 A;  2XRN A;  3WGI A;  4RDU A;  1IUY A;  3GZ5 A;  2IVM A;  4AU7 A;  2L4A A;  5HLT A;  3J7A Y;  5GAG J;  5E18 F;  4BUP A;  3WTY C;  5LEK A;  1K7A A;  3ECH A;  3I4N J;  5F27 A;  3M07 A;  2M5W A;  1VQ6 I;  1G3T A;  2MW8 A;  2B7E A;  1GHC A;  2IGK A;  2X6O A;  3GCM A;  2VN2 A;  3I4M J;  1SD4 A;  3G1L A;  4JX4 A;  4XRF A;  3ABT A;  2QUF A;  1WZ2 A;  2LF7 A;  2W84 A;  4XLF A;  5TIS C;  2CQX A;  2BVL A;  2YX4 A;  2IP2 A;  4M3D A;  4BAC A;  1SAU A;  5TGT A;  1D0Y A;  1DQU A;  2ECC A;  4DZJ A;  1YS7 A;  3TO7 A;  3D5L A;  4XLA A;  1MBK A;  5DCF A;  4IHT A;  2VOP A;  5K5Q A;  4HBL A;  1D0Z A;  1O57 A;  1FC3 A;  3DEE A;  5CQE A;  3W2W A;  5D5X B;  5GPA A;  4D7N A;  2R5Z B;  2GXB A;  4M73 A;  1PP7 U;  1MGT A;  1FY7 A;  2RNG A;  2DT6 A;  4RGX A;  3MZ8 A;  2PX9 A;  4DGW B;  2L7Z A;  4EJW A;  3BG9 A;  5HS7 A;  1D1C A;  2NRA C;  2DW4 A;  2E5N A;  3S3N A;  3L2R A;  3K4L A;  4N4N B;  2HOE A;  3LQQ A;  1HW1 A;  1XSD A;  2ACJ A;  2TRT A;  4RA2 A;  5DYM A;  3O6B B;  4JYK A;  1D5Y A;  1YG2 A;  3HRM A;  4OIP F;  2VQC A;  4M3E A;  3KP4 A;  5IT3 A;  3ZN0 A;  4WWC A;  2MH2 A;  2R7S A;  2E2J J;  3ZQH A;  2OZU A;  3FHZ A;  1TZL A;  4RGU A;  1MW7 A;  5L3D A;  4I98 B;  4XLN F;  3JRF A;  4Y15 A;  1ETV A;  1YS6 A;  4CYD A;  2OQG A;  1XGO A;  2X51 A;  1R49 A;  5C44 J;  4FTH A;  4BXX J;  2LMD A;  4XSZ F;  3H35 A;  4QPQ A;  3DTI A; 
#chains in the Genus database with same CATH homology
 2DMN A;  4MFD A;  3TW7 A;  3WHB A;  1F36 A;  2EZL A;  3B6A A;  1ETK A;  1Y1V J;  2VKE A;  2CUE A;  1GV5 A;  1TC3 C;  2YU9 J;  1JKR C;  4JX6 A;  4DW6 A;  1WH7 A;  4BY1 J;  1HDP A;  3RZO J;  2CJJ A;  5GPC A;  5F0H A;  4C2M J;  2KDZ A;  1K83 J;  2GBY A;  3HOV J;  4B4C A;  3S17 J;  1IRZ A;  2LD5 A;  4BBS J;  2EZI A;  3IH4 A;  4BY7 J;  1VFC A;  3RZD J;  1Y1W J;  3GBG A;  4XRS A;  1ENH A;  4UUS A;  3JRC A;  3JRE A;  3HGY A;  1RES A;  3JRB A;  1ZK8 A;  1SFO J;  4A3E J;  9ANT A;  1B8I A;  3MVP A;  4J19 A;  2E2I J;  2CU7 A;  1WPK A;  2XPU A;  2R93 J;  3HM5 A;  1ETX A;  4JX5 A;  3H3V K;  1MSF C;  2RAE A;  1G2H A;  3LSG A;  1H88 C;  1ZR2 A;  3A01 B;  2R5Z A;  1NK3 P;  2H1K A;  4FCY A;  4I6Z A;  2B63 J;  2IEK A;  2E2H J;  4JP0 A;  3ZQG A;  5FKL A;  1A5J A;  1U9N A;  1ORK A;  2HOA A;  1WH5 A;  2LR8 A;  5EZH A;  2M0C A;  2M34 A;  3PO2 J;  3QPL A;  2P81 A;  2LFB A;  2ME6 A;  4IHW A;  3DEW A;  5J3L A;  3JRD A;  2DA6 A;  2K9Q A;  3GTG J;  5M5Y J;  4DZP A;  4HNV A;  2XPV A;  3H0G J;  3LSP A;  2E19 A;  2XB5 A;  3HOX J;  2JMW A;  5FKM A;  1T33 A;  5FLV A;  4QSH A;  3O8G A;  5M3F J;  3W6V A;  4NDL A;  2ECB A;  3BR1 A;  4XIC A;  5J1Y A;  2NVQ J;  1P7I A;  5IP9 J;  1MBF A;  4UUS B;  1UHS A;  4G12 A;  3QPS A;  1IDZ A;  3ZQI A;  3ZQF A;  2XGE A;  2GM4 A;  1JKP C;  3S14 J;  2M8G X;  3CQZ J;  5BNG A;  3BR5 A;  2Y30 A;  1MBH A;  2W48 A;  2JN6 A;  1W0U A;  4V2F A;  1ZTR A;  3GTQ J;  4A3K J;  2JA6 J;  1TWC J;  1LFB A;  4B1R A;  2HI3 A;  2VKV A;  3CDL A;  3PO3 J;  3F0C A;  3FIW A;  5EF6 A;  3LNQ A;  3HOZ J;  3S2D J;  2EZK A;  1APL C;  3S2H J;  2DN0 A;  3GTM J;  1BW6 A;  1S7E A;  5K7H A;  2Y2Z A;  2X48 A;  2CRG A;  5JLW A;  4A93 J;  4I76 A;  3ZQL A;  3FK7 A;  2EZH A;  3LSJ A;  2Y31 A;  1H8A C;  3BG5 A;  3B6C A;  2O8K A;  4W97 A;  1RKW A;  3RQI A;  1MSE C;  2DA3 A;  3SFI A;  3S1M J;  1TWA J;  2AHQ A;  2O7O A;  3M4O J;  2JA8 J;  4XK4 A;  3M3Y J;  3Q3S A;  5EYR A;  2X9D A;  5E3M A;  5FLM J;  5F1J A;  1FEX A;  3HGG A;  1JKO C;  1FJL A;  5EZG A;  1JKQ C;  3HBL A;  1BW5 A;  1MH4 A;  4A69 C;  3HEF A;  2R5Y A;  3G1M A;  2XPW A;  2IBD A;  3SDG A;  1YRN B;  1FTZ A;  1IDY A;  5DTD A;  1ZQ3 P;  2HXI A;  4GFB A;  1LFU P;  4C3J J;  1X2N A;  1BJZ A;  2LY9 A;  1NK2 P;  3GTP J;  2EQR A;  1T56 A;  3QQA A;  2DMP A;  1MH3 A;  2ELK A;  5JLX A;  1SAN A;  1MBG A;  2O9L A;  2DMU A;  2FJ1 A;  4BKX A;  5C4X J;  3LOC A;  1UMQ A;  3S16 J;  3IH3 A;  4A3M J;  3BQY A;  2R7Z J;  4A3G J;  2KT0 A;  5FKN A;  3OSG A;  1PUF A;  5C3E J;  3HOY J;  3C2B A;  1POG A;  2G0E A;  3HKZ N;  4ABZ A;  2E1O A;  2QCO A;  2FD5 A;  4BBR J;  1Q1V A;  1XC5 A;  2NS7 A;  1ITY A;  5F08 A;  2K9S A;  2R92 J;  1K61 A;  5K7Z A;  2DTZ A;  1A6I A;  1X2M A;  2DA1 A;  1W0T A;  1EF4 A;  4IHV A;  2ID3 A;  2L7M P;  2HDD A;  3HOU J;  3BTC A;  2IAI A;  4AYB N;  2N8G A;  5EDN A;  3D1N I;  2EH3 A;  3WHC A;  2DA2 A;  4QTR A;  2DJN A;  4XRS G;  3S1R J;  3HB9 A;  5IPA A;  3L1P A;  3BR2 A;  1B8I B;  3BR3 A;  2LKX A;  3JRG A;  2M9H A;  1HF0 A;  4IHX A;  2M2E A;  5IOY A;  1E3O C;  4A3I J;  1U78 A;  1TWH J;  1OCP A;  2L7F P;  3VPR A;  5F0C A;  3BR0 A;  2ZB9 A;  1GVD A;  2L9R A;  4X6A J;  5K7F A;  3SJM A;  3Q0U A;  1IJW C;  4MIM A;  1O4X A;  3BTI A;  2LTP A;  5IOZ A;  3BG3 A;  5IYD J;  4M3B A;  5EGO A;  2NVY J;  2LLK A;  2WV1 A;  5M3M J;  3JRH A;  2HYJ A;  2MSY A;  3FIS A;  2Y0S N;  3BQZ A;  1MNM C;  1JJ8 C;  1CQT A;  1BL0 A;  2FQ4 A;  3A02 A;  3CMY A;  1Z77 A;  3TW6 A;  5FJ8 J;  2YS9 A;  2CUF A;  3TP3 A;  1LE8 A;  5FKO A;  1GV2 A;  3UKG A;  4IEJ A;  1WCM J;  2LP0 A;  2JK3 A;  1H89 C;  2GLO A;  1JT0 A;  2LK2 A;  3A01 A;  4UUT A;  1JTX A;  3G1O A;  5E3O A;  2DA5 A;  2EBI A;  3RKQ A;  4FE4 A;  5E3L A;  2LVS A;  1RPW A;  3TP0 A;  1MBJ A;  2VUM J;  3BTL A;  5EG0 B;  1FIA A;  1B72 B;  1IGN A;  3BR6 A;  1GT0 C;  4AC0 A;  4S0H B;  1DU0 A;  2H8R A;  4A3L J;  2ME0 A;  1I6H J;  5DS9 A;  2D5V A;  1JUM A;  4CYC B;  3A03 A;  5HOD A;  1DU6 A;  1JTY A;  1I3Q J;  5EGO B;  5C4J J;  3Q0W A;  2DMQ A;  1JUP A;  3OSF A;  1ETY A;  1AKH B;  1U9O A;  4A3D J;  1TWG J;  4A3C J;  1ZKG A;  3ZOB A;  1OJL A;  2DMT A;  2XB0 X;  2FX0 A;  2WAQ N;  2NS8 A;  4EEF G;  5IYB J;  2DA4 A;  5J1U A;  3PM1 A;  2NVX J;  2HXO A;  4FIS A;  1WI3 A;  3JRA A;  2K9N A;  4M3F A;  2NOG A;  5EEA A;  1P7J A;  3K7A J;  2OPT A;  1UG2 A;  1ETQ A;  4C3H J;  4D7M A;  2VPR A;  2HOS A;  4X1E A;  3TED A;  2VI6 A;  2XGD A;  4D5F A;  3GTO J;  3IH2 A;  1BA5 A;  2HOT A;  4A3F J;  4A3J J;  2HQ5 A;  2NVT J;  3GTJ J;  1ZGW A;  3FK6 A;  4XID A;  4Y7N J;  2XRL A;  3NAR A;  1HDD C;  1JGG A;  3S1Q J;  1QPI A;  3S15 J;  1JUS A;  1OFC X;  3BT9 A;  3DCF A;  4MLO A;  4QIW N;  1ZR4 A;  4IHY A;  4LOC A;  1U8B A;  2YUS A;  2PMZ N;  3MN2 A;  2QF7 A;  3Q0V A;  5M5W J;  3JRI A;  2CQQ A;  2JA7 J;  2JA5 J;  1AKH A;  1IV6 A;  4MO7 A;  1XS9 A;  2JJ7 A;  2Y9Z A;  1TWF J;  1MBE A;  5J1R A;  3GTL J;  2WB1 N;  1XG1 A;  5F0F A;  3LSR A;  1Z0X A;  4M3G A;  1I50 J;  1RET A;  3FKI J;  1FTT A;  2AO9 A;  3OIO A;  2TCT A;  3OOU A;  3MKL A;  4RDU A;  1HCR A;  1VND A;  3K2A A;  3E7L A;  3O8H A;  2ID6 A;  2I10 A;  1QRY A;  3HOW J;  2MGQ A;  3BTJ A;  3I4N J;  1IG7 A;  1PUF B;  1YRN A;  5IP6 A;  2COB A;  1ETO A;  5F27 A;  2MW8 A;  5FKK A;  1HOM A;  2X6O A;  4DYR A;  3I4M J;  1RR7 A;  3G1L A;  3HDD A;  4JX4 A;  3JR9 A;  4XRM A;  1GDT A;  1IUF A;  4DYQ A;  2CQX A;  5M5X J;  1JT6 A;  1RKT A;  1GUU A;  4Y52 J;  4M3D A;  1FIP A;  2ECC A;  4DZJ A;  4DYC A;  1B72 A;  1NTC A;  4W1U A;  1HLV A;  1MBK A;  3ZQC A;  5EG0 A;  2XGC A;  1X58 A;  2L0K A;  5E3N A;  4B3A A;  2JWT A;  2R0Q C;  1QVU A;  1QVT A;  4M6V A;  5GPA A;  4D7N A;  2R5Z B;  5GP9 A;  2DA7 A;  1F43 A;  4A3B J;  4C3I J;  2OF7 A;  4L5E A;  2R5Y B;  1VI0 A;  1ETW A;  2L7Z A;  3BG9 A;  1IC8 A;  4CYC A;  5IYC J;  1AU7 A;  2XSD C;  2MG4 A;  3GTK J;  2TRT A;  1R9T J;  1D5Y A;  1LE8 B;  4JYK A;  2Y9Y A;  4MFE A;  2K40 A;  4M3E A;  5F04 A;  4FE7 A;  1AHD P;  2E2J J;  3ZQH A;  1JJ6 C;  3S1N J;  5IP7 J;  3IV5 A;  1WGX A;  3CCY A;  3JRF A;  4RBO A;  1ETV A;  4V2G A;  4BXX J;  1OCT C;  4AUX A;  5C44 J;  4FTH A;  3NAU A;  1VF9 A;  4D5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...