5EGOA

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis1
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoA00
1P7JA 3PO3J 1MH3A 2DA4A 2VKEA 4JYKA 2FD5A 4RDUA 3BT9A 3SFIA 2NS7A 2LR8A 4Y7NJ 3K7AJ 4EEFG 2HXOA 5FKNA 2E2IJ 2EH3A 1GDTA 3BG3A 4MFEA 1F43A 1Y1VJ 1RR7A 3E7LA 5IYCJ 1YRNB 1OJLA 1LE8B 1HDDC 2JA8J 4I6ZA 4M3EA 2XGCA 2XSDC 2DN0A 3M3YJ 2ELKA 2QF7A 3FKIJ 1IUFA 1ZQ3P 2XGEA 1MBJA 2D5VA 2HXIA 4MIMA 3HKZN 1B72A 5C4XJ 1MBGA 4C3HJ 2X9DA 1I6HJ 2DMQA 3OIOA 9ANTA 2VKVA 4IHVA 1JUPA 3S1QJ 3NARA 1BJZA 1I3QJ 3HGYA 4XRSG 4DYRA 3CCYA 2NVQJ 3HOUJ 1IV6A 3G1MA 5E3NA 1U78A 2OF7A 3TP3A 1PUFA 1DU0A 2R5ZB 1RPWA 1UHSA 1ETKA 4L5EA 2RAEA 3HB9A 1S7EA 3LSJA 3JRDA 3JR9A 5IYDJ 2DA5A 1JKPC 3DCFA 2GM4A 4FTHA 1R9TJ 3GBGA 2DMTA 5FKOA 3JRBA 2PMZN 2FJ1A 4V2GA 3MVPA 4AUXA 1MH4A 1P7IA 2MG4A 3O8HA 1AKHA 5F0HA 3D1NI 4W1UA 2ECCA 2L0KA 3BTLA 3CQZJ 1U9NA 2XB5A 1JKOC 1K83J 3SDGA 3S17J 4BY1J 1HDPA 1QVTA 5BNGA 5GP9A 1Y1WJ 1G2HA 1ETXA 1XG1A 3S1NJ 1D5YA 2B63J 2N8GA 4JX4A 1B8IB 4BXXJ 1F36A 1MBEA 1K61A 1VNDA 3A01B 4W97A 1TWFJ 5IOZA 2K9SA 5IYBJ 4A3LJ 1T56A 1Q1VA 1MSFC 1FTTA 1BW5A 1IC8A 4X1EA 5IP9J 5EGOA 1HF0A 2ZB9A 5M5WJ 5K7HA 2JA7J 2YUSA 2R7ZJ 3ZQIA 3NAUA 3FK7A 4D7MA 2P81A 4IHWA 3ZQHA 2K9NA 2M2EA 2YU9J 1MBHA 3GTMJ 4A3JJ 3OSGA 1X58A 5EG0B 2HI3A 2Y9YA 1X2MA 2EZKA 2OPTA 1X2NA 1LFBA 2IEKA 4DYQA 3CMYA 4BKXA 5E3MA 4AC0A 5EYRA 3JRHA 5FLMJ 1RESA 5K7FA 3HOVJ 1WI3A 3GTQJ 1FEXA 2GBYA 2HOTA 3S1MJ 4JX5A 4A3KJ 2O9LA 3BR0A 1JGGA 1U8BA 1MBKA 1MBFA 1GV2A 3RZOJ 3MN2A 4IHXA 5C4JJ 1TWHJ 3GTLJ 4QSHA 1UMQA 1E3OC 2CRGA 1U9OA 2TRTA 1LFUP 5EZHA 2XRLA 3S16J 1BA5A 2CJJA 4C2MJ 1GT0C 3G1LA 5EEAA 4D5CA 2KDZA 4LOCA 3GTPJ 2DJNA 1H89C 2JK3A 2DMNA 2FX0A 2DMPA 1A5JA 2XPUA 1POGA 2XGDA 1TWCJ 2DA6A 3RQIA 3HOWJ 1JTXA 1XS9A 3BR3A 3FIWA 4IEJA 2WB1N 2MSYA 1ORKA 2MW8A 4UUSB 1JUSA 3PO2J 4A3CJ 3HGGA 3IH2A 2K9QA 2R92J 3B6CA 3S1RJ 3JRGA 4A3BJ 1FIPA 4D5FA 1JT6A 4M3GA 2L7MP 2IAIA 3ZQFA 1ZTRA 3FISA 4A3EJ 5EF6A 2JA6J 2LKXA 3WHBA 2NVTJ 1A6IA 5M3MJ 1AU7A 4QIWN 2R5YA 4Y52J 4HNVA 1SANA 3OOUA 3GTKJ 3K2AA 2HDDA 5EDNA 1HCRA 1T33A 1JTYA 2VI6A 3HBLA 2H1KA 3RZDJ 2ECBA 5IP6A 4C3JJ 5M5XJ 4CYCA 1OCPA 3GTGJ 2M9HA 2LTPA 4FISA 2DTZA 2L7FP 4MLOA 2Y30A 3HEFA 1GVDA 4DW6A 4M3BA 3IH3A 2M0CA 4DZJA 1B72B 1GV5A 1H8AC 1XC5A 2E1OA 4J19A 4FE7A 5JLXA 1JKQC 1IGNA 2EBIA 1ZR2A 5F04A 1WPKA 2JA5J 1QRYA 2R93J 3HM5A 3BTCA 1PUFB 2O7OA 5E3LA 1VF9A 2WV1A 4BY7J 2K40A 2XPWA 2L7ZA 4G12A 2HOAA 1I50J 2VUMJ 1WH7A 3JREA 5DS9A 4XICA 4FE4A 1AKHB 3JRIA 3BTIA 2NVYJ 1ETOA 1WH5A 3BR5A 2LP0A 2E2HJ 1QVUA 4XIDA 3LSPA 3HOYJ 2JWTA 3LOCA 3UKGA 5J1RA 2LK2A 2AO9A 3A03A 3S2HJ 5F27A 4NDLA 3QPSA 1MNMC 3LNQA 1EF4A 2CQXA 3TEDA 2HOSA 2MGQA 3A02A 1RKTA 5EGOB 5FKMA 3L1PA 2KT0A 4UUTA 5M5YJ 2G0EA 2E19A 5E3OA 3RKQA 2X48A 2W48A 1TWGJ 2CQQA 2M8GX 1RETA 3WHCA 3B6AA 4V2FA 3Q0WA 3HOZJ 1DU6A 2JJ7A 3C2BA 4X6AJ 1YRNA 1IJWC 1VFCA 1IDYA 2ME0A 1LE8A 2H8RA 4A3GJ 3F0CA 2CUEA 5F1JA 2DMUA 2JN6A 3ZQLA 3TW6A 3OSFA 1FJLA 4JP0A 2I10A 2EZLA 2ME6A 1IDZA 1GUUA 1FIAA 5GPAA 3TW7A 3ZQCA 3M4OJ 1Z0XA 5M3FJ 2AHQA 4FCYA 2HQ5A 2EZIA 5FKKA 1JKRC 3GTJJ 1BW6A 4A3DJ 1JUMA 2NOGA 3JRCA 1IG7A 4A69C 3BG5A 2YS9A 2R5ZA 1ETYA 5F0FA 2LY9A 3BR2A 4M6VA 2NVXJ 1O4XA 5IOYA 1ETVA 3ZOBA 5HODA 5IP7J 4M3DA 1ETQA 1HLVA 3LSRA 4DZPA 4MFDA 1ENHA 1BL0A 4BBRJ 4AYBN 2Y31A 3QQAA 5J3LA 1WGXA 4DYCA 2CUFA 1WCMJ 4XRSA 1RKWA 3JRFA 3TP0A 1VI0A 4MO7A 1IRZA 2EZHA 1TWAJ 3BTJA 4BBSJ 4QTRA 3W6VA 3PM1A 1SFOJ 1HOMA 3HOXJ 4ABZA 1AHDP 2LFBA 5J1YA 2R0QC 1B8IA 4JX6A 2R5YB 3MKLA 3A01A 2DA7A 3DEWA 3Q3SA 4B3AA 3Q0VA 3QPLA 2Y9ZA 1QPIA 2ID3A 3S15J 3SJMA 2QCOA 4CYCB 3BR6A 2Y2ZA 1TC3C 3BR1A 3BG9A 5JLWA 2HYJA 3FK6A 3G1OA 4S0HB 2DA1A 5C44J 1JT0A 3CDLA 4A93J 4M3FA 2E2JJ 5EZGA 5EG0A 1JJ6C 2FQ4A 4A3MJ 1OCTC 5F08A 1ZK8A 3GTOJ 2LD5A 3BQZA 5IPAA 3S14J 1W0TA 1JJ8C 1APLC 4A3IJ 1NK3P 2M34A 3ZQGA 1Z77A 1MSEC 1ZR4A 4D7NA 2JMWA 5FLVA 4B1RA 4I76A 4A3FJ 2EQRA 5J1UA 3BQYA 1NTCA 2NS8A 1W0UA 1OFCX 2LLKA 3LSGA 4XK4A 1H88C 3H3VK 3H0GJ 3O8GA 5DTDA 1ZKGA 5F0CA 2XPVA 3VPRA 1ZGWA 2XB0X 4IHYA 1FTZA 4C3IJ 2X6OA 2ID6A 1ETWA 5FJ8J 5C3EJ 2DA3A 2COBA 3Q0UA 1NK2P 2IBDA 3S2DJ 5FKLA 4GFBA 4RBOA 3I4NJ 4B4CA 3I4MJ 2WAQN 2CU7A 5K7ZA 3HDDA 2TCTA 2L9RA 2Y0SN 3JRAA 4UUSA 3IH4A 1CQTA 2DA2A 5GPCA 3IV5A 2LVSA 2O8KA 2GLOA 1UG2A 1ITYA 4XRMA 2VPRA
chains in the Genus database with same CATH superfamily
3QPTA 5DD4A 4HLXA 4HNTA 5LBQA 2DFEA 4DBRA 4ZYEA 2VL8A 4JYKA 3FZVA 1IUYA 2FBKA 4AIDA 3SFIA 2NS7A 2LR8A 3VFZA 3K7AJ 1LB2A 1REPC 2HXOA 1YITI 3SZGA 2RNGA 4U0VA 2RGVA 3GZ5A 1EJ9A 2XAHA 4A5NA 3GFMA 2DQLA 3ULQB 5D5UB 5FRMA 1UHWA 5H2FC 4D1QA 3OYCA 2DBBA 3OS0A 3H9GA 3ISPA 1PJRA 1R4NB 2XSDC 2ELKA 3C2HA 4BH9A 2QF7A 1IUFA 1X3ZB 3FXRA 2XGEA 3OYFA 1SD7A 3IWFA 1B72A 1FOYA 2CFXA 2X9DA 3F6VA 1T39A 1T0FC 3RDIA 4IRIA 2LF7A 3R60A 3BPVA 1TW2A 4HX7A 4M71A 2L02A 4ZH4F 3S1QJ 1FNNA 3HGYA 2V1NA 5ICCA 5D4SA 3G1MA 4HAMA 3DLLF 2R5ZB 2OQGA 2DDBA 1S7EA 1XGSA 5IYDJ 2DA5A 2HDCA 3QYBA 5CJ9A 3DCFA 2IGNA 2OUMA 4IXAA 1O3SA 2GAUA 1R9TJ 3QRFF 2QQAA 3L2VA 2PMZN 5ILVA 2FJ1A 3K1NA 4IQ4A 2STTA 2PI0A 4AUXA 2M87A 2D45A 5B3SH 2M7AA 3D1NI 3CJQB 1S7AA 5CLSA 3L2QA 1T8IA 3S17J 1HBXG 3L2UA 1HDPA 5BNGA 3IAS2 2W1OA 4PGHA 2IT0A 4XKCA 2WAQA 1VNDA 4Y17A 4EJTA 2RDPA 3BG7A 2L01A 1W36D 2XKOA 3L2RA 1FTTA 2KIUA 1P6RA 4QPOA 1FP2A 4X1EA 3AKZA 2O6GE 3HSFA 1K4TA 5M5WJ 2PG4A 3KLOA 5L3CA 1ULYA 2R7FA 2YUSA 2UUZA 4IHWA 3ZQHA 2K9NA 4DOZA 1OQYA 4MQ9F 1AA7A 3GEZA 2Q2EB 1HXDA 1J59A 2UV1A 4DJAA 1BC7C 2DT6A 2IEKA 3PQKA 2EB7A 3DPTA 5E3MA 2WAFA 4AC0A 4GYGA 3V42A 4CO8A 5K7FA 1WI3A 2XF5A 2H8WA 4I98B 4HNUA 3S1MJ 2DI3A 1VZ0A 2O9LA 2A5WA 4PJLA 1JGGA 1U8BA 2H27A 1VQ9I 3CO7C 2BXZA 5B1BH 4AYBA 2CUZA 2K5CA 1U5TA 2TDXA 2GOMA 1BIBA 2AQEA 4QSHA 1UMQA 1I1SA 3RYPA 2QQ9A 2RC4A 2PX9A 2KPMA 1FOWA 3LA7A 1FYKA 5E20A 4LOCA 3GTPJ 2DJNA 4BUPA 4HLYA 5ICEA 4OU0A 5F64A 2DMNA 2FX0A 3DP7A 4UVBA 1VQNI 2P8TA 4Y3OA 5JI6A 1DPUA 3HRUA 3HOWJ 2EFNA 3PSIA 4XORA 2MLGA 4RLFA 2MW8A 1TNTA 1X3WB 3ABTA 1V54H 3CJRB 2PJRA 2A68F 1JUSA 3PO2J 4A3CJ 2J5OA 3IH2A 4RB0A 4E7HA 2CV0A 3K70D 3JRGA 1OCOH 2LF8A 1FIPA 4KMUX 2IS6A 3VODA 1WQ2A 2IAIA 1BOBA 1BR4A 3TKYA 1AU7A 1I6XA 3I56I 4Y33A 2QGUA 3JCUC 3K2AA 4CGZA 3UR3C 2E7WA 4XLAA 3P9KA 2VI6A 2ETHA 2H1KA 2IPQX 3RZDJ 2P5VA 4PK4A 4DNCA 5FGMA 2M9HA 2LTPA 1OMIA 3KYCB 4ZZDA 1N77A 1L3LA 1VQ6I 2DTZA 3K1MA 3CDHA 3MD2A 5E8IA 5BOXA 1GVDA 1PVEA 3DQVC 4M3BA 1L0OC 5FFXA 3NQOA 1SFXA 2M0CA 2O3FA 4OAYA 2DAOA 4DZJA 2DK5A 4RS8A 4LLNA 2O5RA 3T0YA 1Y8RB 4LLLA 1WKMA 2QSHX 2FXAA 4R1HA 1WJFA 1QA6A 5F04A 3PNVA 2JA5J 4YIFA 1YJ9I 3KYDB 3HXLA 3O2PE 5DDGA 2MH9A 1KA8A 3HHGA 3AG4H 3DBLB 1UB9A 4I09A 2CYYA 2CFOA 2R4GA 2XUBA 1MMDA 2K40A 2XPWA 4F55A 2Y75A 3RKWA 2KLOA 5ILSA 2CUJA 2L7ZA 4KT5C 2KFDA 2CS3A 3RIRA 2VUMJ 3JREA 3H3UA 3M1CA 4EATA 3OR2C 1BI2A 4CXFA 3KEQA 3AAFA 4LB5A 1E2XA 1MNEA 1YTYA 3COAC 3OV8A 4L9VA 2GQQA 2OCEA 3BTIA 2MD5A 2R7TA 1OR7A 4ZC3A 2PEXA 2BOLA 2FBIA 3CCQI 4XIDA 3LSPA 3LFUA 4H0EA 3NRVA 3VYUB 3UKGA 2CGPA 2ISYA 2LK2A 2AO9A 3GVAA 2Q0OA 3S2HJ 1MNMC 4YFXF 3WTXC 3LNQA 1LDJA 4J01A 2V79A 3P5JA 3LAJA 4M9SA 4A0XA 5LD2C 2HOSA 3A02A 1MNDA 2M5WA 3AG3H 5FKMA 4HW0A 2HR3A 4UUTA 4GO1A 1ZG5A 3DKXA 2XF7A 5M5YJ 3IL2A 2E19A 3GW2A 3W6KB 2EK5A 2ZCWA 1XMKA 2F4IA 4EGYA 3GXOA 3DBRB 2CQQA 2M8GX 3WHCA 4V2FA 4KISA 3BZ6A 1D0ZA 2WTEA 2Z2SB 4X6AJ 4K2EA 2ZBKA 3TDUC 3VWBA 4PJNA 2H8RA 4CUGA 4HBLA 4D9JA 3M8JA 2FUG2 4RLQA 5HS7A 4E7KA 2JN6A 4P96A 5DM6F 1HKQA 3OSFA 3F8NA 2IA0A 4JP0A 5L3EA 1KU7A 4CZCA 2R7RA 2A6TA 2FA5A 2VJ4A 1FYLA 3QPHA 2AHQA 3K6GA 2HQ5A 1JKRC 5F1RA 3JRCA 5CPRB 2XVCA 2IS2A 1YG2A 1BOAA 3N05A 3KE2A 3P9IA 3ZP5A 3FXUA 2PLYA 2BVLA 3F8BA 2LY9A 2OTJI 1ETVA 3J7YJ 3OYDA 5FRNA 4M3DA 2ZJQF 3JW4A 3SZPA 4HQEA 2RQPA 2BYVE 5D5WB 1J75A 3ECOA 2AS5F 1MMSA 1HW2A 3ZR8X 3K9TA 3HJEA 4XRSA 3TP0A 2MFZA 5CVRA 2EZHA 3SEQA 3BTJA 3SDBA 4UHTA 2VKHA 2CG4A 5ERIA 1FC3A 5JHUA 2E60A 3PM1A 1A31A 1V5EA 3I58A 5CVUA 5J4VA 3F22A 2HU9A 4Z2YA 2VQHA 4ABZA 2VT3A 2B0LA 5J6XA 1PYVA 2PQ8A 1FP1D 2R5YB 5LHHA 3MKLA 3A01A 4XBFA 2RNJA 4R8HA 3DEWA 4B3AA 4LGWA 1HKTA 3WGIA 1B9MA 1K6YA 4NBQA 3EQLF 2Y2ZA 2F5EA 3RCOA 3BR1A 4UUVA 3J7AY 3BG9A 2HYJA 3AL0B 3IRQA 3G1OA 2YU3A 5L3BA 2F2EA 2LRDA 4B48A 4P5OA 3O6BB 4EJWA 4NQWB 2E2JJ 1LNWA 2DYRH 4YFKF 3M7GA 2NRAC 4IRHA 4IRGA 1D8KA 3EUKL 1R00A 3V7CA 2P5KA 3KZYA 3KCCA 4EQQA 1SFUA 2WC2A 2V6CA 3GTOJ 3BQZA 1FX7A 1N78A 1XGNA 5D8LB 3KPHA 2Y69H 5IPAA 4XL9A 3T8TA 2F5DA 2IP2A 2P6TA 2IS1A 4GRIA 2G9WA 4MNUA 2M34A 1XCBA 3C1DA 1MSEC 3EYYA 2XAUA 1ZR4A 3CCRI 2DCEA 2M3AA 4BYYA 5CQEA 5FLVA 2W4SA 2VASA 4A3FJ 3S93A 3EETA 1USSA 2EQRA 3OYKA 2WB1A 3BQYA 5LGTA 3R4KA 3FF5A 4ENKA 2KIMA 3LSGA 4XK4A 2E71A 3H3VK 4LK0F 5DTDA 1UFMA 3QU3A 5FFZA 1G59A 2HFHA 5GAHJ 4C3IJ 4HDVA 1DGWY 5A2QZ 5E1ZB 4B44A 3Q0UA 1NK2P 5FKLA 1Y39A 1JI8A 2CW8A 3I4MJ 2FBHA 2CU7A 3GLLA 4BQAA 1S8NA 3QODA 2TCTA 2L9RA 2HPIA 4A5MA 3KETA 3ZMZA 3D5RC 3RTRA 3JRAA 4CCLA 3ZMDA 4E7LA 4XN3A 3GUDA 4BS9A 3AG1H 1XCVA 2EILH 3IKTA 2VPRA 2D1VA 3BY6A 4ITVA 3F3XA 1MH3A 2BGCA 1I3AA 2VKEA 3CZ6A 3LL7A 2FE3A 2FD5A 5FD5A 5GTIC 1O3TA 3P7NA 1HW1A 2PMUA 4Y7NJ 3I59B 2JPBA 3CC7I 3BG3A 4GGGA 1F43A 5DCFA 1Y0UA 2V1UA 3E6MA 4XLHA 3OYNA 2FMYA 3M9AA 5IYCJ 2HTSA 3ZRGA 1YRNB 1Z05A 1P4XA 5HOOA 1LE8B 4A6EA 1O57A 2IGOA 4M3EA 2VBYA 1Y6IA 3H9JA 3JSPA 2DN0A 4RGSA 4IOAF 4CCMA 3CF2A 3FKIJ 2A07F 1X4PA 2D5VA 1WHUA 2H6BA 3HKZN 5C4XJ 2JSCA 1MBGA 4CYDA 2OJED 3I3LA 1OLTA 4IL6C 9ANTA 1JUPA 3GO5A 1IN5A 2X0LA 3T8RA 3FDYA 1BJZA 4D0PA 4NHJA 4DYRA 3CCYA 5E3NA 1PUFA 1CF7B 4G8XA 1ETKA 4B8XA 4B47A 2DOAA 1KQ0A 2HS5A 1JKPC 3CCEI 3HHHA 4RGUA 4PFOA 1H0MA 2V9KA 5FKOA 3JRBA 4LG0A 2E34A 2QSFX 1W5SA 3VB2A 3HUGB 3TOAA 4FX4A 4IQJA 4E4HA 3TO7A 3MVPA 3REOA 3O8HA 1AKHA 1AWCA 2L7KA 5F0HA 3WG7H 3BC8A 5FLXK 3IP4B 3LSTA 4W1UA 2L0KA 3E0JB 1R1TA 3BTLA 4XLFA 4NUBA 2BY0A 1K83J 2STWA 2JVGA 2VBZA 3S8PA 1D5YA 3F72A 1DQUA 2QA4I 2OTLI 1BJAA 3H9QA 3QYFA 1K61A 3HYIA 4EMSA 1Z3YA 2WAEA 4W97A 1TWFJ 3KX2A 5IOZA 5KHDA 2XF6A 3CLOA 1Q1VA 2PFBA 1E17A 1MSFC 1ZG3A 4EJOA 2CW7A 2JRTA 2GZWA 2Y48A 2CSOA 2LMDA 1MDMA 2Y0SA 2MC4A 5EGOA 1LDKB 5ICGA 1PP7U 2K85A 2ELHA 2CQ7A 2K86A 5EEHA 2VB6A 1ZGJA 1ZLKA 3KZZA 1YX3A 2EJRA 3T1BA 3U9GA 2R7ZJ 3N4MA 1FSHA 3NAUA 3FK7A 3J7ZI 1K78A 2P81A 2W25A 1T2KA 1W1WE 2QKLB 1S3JA 1ZARA 4LD5A 1IF1A 4YELA 1ZH5A 3GTMJ 4A3JJ 3F21A 3OSGA 2Q8KA 4C2TA 3KYLA 2HI3A 5DUIA 1X2MA 2F48A 5LEKA 2H94A 1RNLA 1EV7A 2NS0A 4Q5SF 1LFBA 2E1CA 2K27A 4BKXA 4MEYF 1OYIA 3ABUA 3LQRA 5EYRA 4BGDA 1MJAA 3GTQJ 2GBYA 2QBYA 3K2ZA 4XNFA 2R7SA 4JX5A 3H0DA 4A3KJ 2GXAA 3D0SA 1X1AA 2OD5A 3M07A 4HSRA 3OR1C 1TLHB 1J9IA 3HTSB 4AU7A 1WVRA 1GV2A 3RZOJ 5JFRA 3OS2A 3PFYA 5TGTA 1TWHJ 3GYHX 3CC4I 1T98A 3L00A 2TRTA 5EZHA 3K10A 3ZN1A 4BQOA 4EGZA 1BA5A 3WU2C 2CJJA 3FMQA 4I02A 2EIJH 4C2MJ 5EEAA 1A35A 3AL0C 3CD6I 2ZFWA 4A2UA 4B09A 1G3TA 5GAGJ 3CUQA 2CV2A 2M1BA 2NOJB 4GDFA 3QU6A 2DMPA 2YR2A 3E6DA 1A5JA 3ZMVA 1POGA 2P0WA 3TO6A 1V5FA 2E7XA 1PUEE 1TWCJ 2DA6A 2R7WA 1MIJA 2K3PA 2GA2A 2LOOA 1XSXA 4WCGA 3OYEA 4UY8I 2F5CA 3PL8A 2PMZA 2HVRA 1GVJA 1ORKA 3Q5FA 3IAM2 1LJ9A 4UUSB 3EUHC 5J4YA 3HGGA 1RRJA 2JTVA 3B6CA 4ZJZA 1R7JA 4M6YA 1MKMA 4D5FA 4BDYA 4BHBA 3ZQFA 1ZTRA 2VXDA 3FISA 4A3EJ 2NVTJ 2LKXA 4ASNA 4Y52J 2VQCA 1SANA 3OOUA 5FB2A 2RQQA 3GTKJ 1LQ1A 4LK1F 5KCMA 4M72A 1VQMI 3E97A 3HBLA 2ZXJA 1D3YA 1U0JA 4C3JJ 1O3QA 1H9TA 4CYCA 1OCPA 3KEOA 4UB6C 4L5JA 2KRFA 2QQBA 1R5GA 3KIOA 2L7FP 2WV0A 2L5QA 1HKSA 2Y0MA 3C18A 1S5LC 4PDKA 1R23A 3GMEA 4G6QA 1G6NA 4HQMA 2HTJA 1FMVA 4HSTA 4GCVA 5F6FA 2VBWA 1TP4A 4E7IA 1B72B 2DLLA 2EFOA 3I64A 1BR1A 2QEXI 1W36C 4G94A 2BE5F 5K5QA 4C30A 4J19A 1NG6A 2UWMA 2VJJA 5JLXA 3TMOA 4NB5A 1XDSA 5LGUA 1IGNA 2KRHA 2FMLA 1WPKA 4UV8A 1YS6A 3ZPLA 5FLXZ 2R93J 3PUFA 2KZGA 2ISZA 3BTCA 3DU6A 5E3LA 4RAFA 4HPQA 1X19A 2F5FA 2IGKA 3C2GA 1DPRA 1YW8A 4LLGF 4XKBA 3HG9A 4I99C 3GWZA 5BPDA 4G12A 2V1XA 1I50J 5LGNA 1D5VA 4PJMA 4KMFA 2D2WA 1R5ID 3DTKA 5DS9A 1Q1HA 3DKWA 4G6TB 3R6SA 4ZZLA 4LB6B 3JRIA 2ZC2A 4KNYA 4I01A 1ETOA 1WJAA 4ZYAA 5D5VB 3BR5A 3ZMSA 3OY9A 1NHAA 2OBPA 3FXMA 2E2HJ 2V26A 1QVUA 3HOYJ 2DDAA 2VIXA 5HNHA 1OCZH 1E3PA 5F27A 1R1UA 3QPSA 3H3ZA 3S3MA 1X3UA 2Z9OA 5KK1A 5KVRA 4RB1A 1BBYA 3TBIA 2CWEA 2BY1A 2MGQA 3L1PA 5J8FA 2JUCA 2G0EA 1BI1A 2EINH 4HF2A 1B59A 3VYSB 2DT5A 4AVZA 3RKQA 2EV6A 1TWGJ 4HF1A 1RETA 1KYWA 3CCUI 3WODF 6PAXA 1Z6TA 1IZ1A 1OCCH 2JJ7A 4NC7A 1RZ4A 5L3FA 1IJWC 1LEBA 5E1WA 1HA8A 1EH8A 4G7OF 1QZEA 3F0CA 3QOPA 5F1JA 3CO6C 3BROA 1SMYF 4LIVA 3ZQLA 1YX5A 1JXSA 3CMEI 1FZPB 1FJLA 2VJIA 1R58A 2EZLA 3BJOA 3KP5A 4EV0A 5B66C 1IDZA 5DCMA 3V8LA 5E8GA 3OYJA 4CSWA 3QYEA 1U5TB 2JT1A 4HYEA 2EZIA 2OCCH 3GTJJ 1BW6A 4WX9A 2NOGA 1O3RA 1X1PA 2DOEA 1ERDA 4A69C 4UVCA 1IW7F 4IZZA 2HQRA 2YS9A 1JHFA 2QZ8A 4I0BA 3ZCOA 3CCSI 1Z6RA 4ZDOA 1E0EA 5H6QA 2HVQA 2NVXJ 4C9YA 2XROA 4ESJA 1CGPA 4AIJA 5LHGA 1T38A 1VQ8I 1F1ZA 5IP7J 4E7SA 4XSZF 4V19K 3HTUA 2M7BA 2HKXA 4MHGA 4E70A 4BL0B 2Z16A 3LSRA 1ENHA 4AYBN 2Y31A 3QQAA 2R7VA 4M6XA 2GIVA 1XGOA 2W00A 1SVMA 3FBIB 1W4MA 3WTSC 5KAIC 1FBUA 1MGTA 2FOKA 4XKVA 2PJRB 1IN8A 1TQIA 1LDDA 2E35A 4HRIA 3V8KA 4BBSJ 4II2A 1WRJA 4IOCF 4ZTFA 1U2WA 2W85A 3U2RA 1ZRFA 3W6VA 1ACIA 1SFOJ 5KNLA 3HOXJ 5J1YA 1B8IA 2AXLA 4PZJA 4JX6A 3CJTB 5LEJA 2DA7A 1R22A 3SEZA 4TV7A 4AWXB 1YLFA 3Q3SA 1A6QA 2DODA 2QQ8A 4GYIA 1XTAA 4KIFA 1V55H 3RJPA 2W84A 4F7ZA 3LAPA 1QPIA 4JBAA 4UXNA 2X51A 4KN4X 1IRXA 4IF4A 4XONA 1Z7UA 3FK6A 3G2BA 3TOBA 4S0HB 4BE0A 2BXYA 1AOYA 5C44J 2EPFA 4BXFA 1JT0A 4M3FA 5EZGA 1EH7A 4WXDA 3DV8A 2GA1A 3GFJA 4DQ2A 3H5RA 5EG0A 2FQ4A 2X1EA 1TT5B 4S04A 1XGMA 1Y8QB 1DUXC 3K69A 1D1CA 1WZ2A 1LEAA 2OAZA 4PSXA 3S14J 5IT3A 4B43A 1MZBA 4Q47A 4EJUA 1X1CA 3BP8A 3ZQGA 2QSGX 2P6SA 2JMWA 3DPLC 4PUSA 4Z6YA 3H36A 4I76A 4P55A 1YW9A 1R1VA 1ZELA 4XQFA 1T08B 3GZ6A 1Z91A 4BDZA 1IV8A 3KP6A 5J1UA 4M74A 2XC7A 1NTCA 3J80K 1W0UA 1OFCX 5A2QK 2VOOA 1DP3A 3S3OA 1MJBA 3MWMA 4RB3C 2XPVA 4OAZA 3GLXA 1LUJB 1ZGWA 1D8JA 5LFAA 2XB0X 4IHYA 1QQIA 3FM3A 2ID6A 4RMNA 1ETWA 5C3EJ 2K7LA 3I53A 3I4NJ 2IBDA 4EJVA 4RBOA 2BW3A 2A6HF 4J00A 3DKYA 3SZTA 1GXQA 4E7JA 1TT0A 2DOFA 4QWQA 1WJCA 4YG2F 1IRGA 1FMWA 2R7UA 2HZTA 1KQ8A 3FKJA 3SHFA 5GPCA 2LVSA 2IRFG 1N25A 2GLOA 2DT7B 1UG2A 4I2OA 3A4CA 1RC9A 4XRMA 4ZYGA 1B4AA 1N75A 1O7FA 3KP2A 4PSWA 4ON0A 3OYMA 2QM3A 3BT9A 3V4GA 3ECHA 3DU5A 1FSEA 2VQLA 2R7QA 4EEFG 2E2IJ 2EH3A 1GDTA 1X1BA 2MABA 2QVOA 4MFEA 1VQKI 1RR7A 1BIAA 4YIIA 2ZMEA 1OJLA 2MC3A 4JK1X 3HC7A 2KHMA 4L9NA 1XMAA 3CCJI 5J40A 4NC6A 1BR2A 1ZQ3P 3E5UA 1A36A 2JZYA 1MBJA 1XD7A 1QGPA 2VT2A 3F6OA 3R0AA 1S72I 4C3HJ 3CMAI 3HOSA 1I6HJ 2DMQA 2VKVA 3KP7A 3K0LA 3TL4X 2OU2A 1I3QJ 2XV4S 3W2AA 4XRSG 3HOUJ 2NVQJ 3FXKA 4PCQA 5HLIA 3V7RA 4HA8A 1DU0A 4Y15A 1RPWA 3HB9A 3JRDA 2GIZA 3PUBA 2L4AA 2ZJ2A 3ZN0A 2F4OB 2X1CA 2X85A 3C7JA 3DXJF 5HNFA 2X4HA 4BJTA 2JVHA 1TQMA 2ICWG 3GBGA 4BEHB 4CA0A 1WJDA 2DMTA 2KZVA 3RPUD 3H1CA 3VOEA 2JUGA 2OV7A 1MH4A 1P7IA 2KL4A 2WA0A 1Z67A 2HOEA 3J81Z 2BZTA 2ECCA 4XR6A 1TZLA 3CQZJ 1MMNA 4LFUA 4H4KC 1JKOC 1QBJA 3SDGA 4BY1J 2KDOA 1ZAOA 1G2HA 2WY8Q 1H9GA 3S1NJ 2E1NA 2N8GA 5FD6A 3PIOF 1F36A 1MBEA 1T0FA 3HRTA 4KICA 2PMHA 3A01B 4HF0A 5JHFA 2K9SA 5IYBJ 1U5TC 4Y4RA 3LWFA 2UXXA 3Q9SA 3DEUA 3MMYB 1IC8A 2FF4A 1SFKA 5IP9J 3EYIA 1ON2A 2V1DA 5K7HA 1ZG1A 3OWTA 2K9LA 4D7MA 2XAQA 2M2EA 3I9V2 2ZSHB 4HX4A 4WXCA 1FOXA 4WXHA 3FBNB 4M9XA 1IXCA 4CCNA 2O61A 1X58A 4HX8A 1R6RA 4HDUA 2D1HA 2EZKA 3BJAA 2NNNA 1SD4A 3J80Z 3F8MA 1WJBA 3ZXSA 4KJZA 1NG7A 3CMYA 1Y0NA 2BY2A 3X2QH 5FLMJ 3JRHA 1RESA 3I54A 1YW7A 5AIQA 1FEXA 1A04A 1ZREA 2GOXB 2FQ3A 2JSPA 2VE9A 3G3ZA 4FHTA 3T5XA 4N4OB 2VN2A 3W6JB 1KU9A 3MN2A 3MAJA 2DU9A 4BHPA 5J8CA 4IHXA 3SFZA 2XIGA 5C4JJ 3GTLJ 4KT6A 2CRGA 1LFPA 4OMYA 2LH9A 2XRLA 3DEEA 5GTHC 5JVGF 1S6LA 1J7KA 1GT0C 3G1LA 2K3FA 2VQGA 4D5CA 5B1AH 1HQCA 1YIJI 1H89C 5DEQA 1QZZA 2XHKA 4UVAA 1HSTA 4XLPF 2DQRA 1MMGA 1T6SA 4WK8F 1QU3A 3RQIA 3BR3A 3FIWA 2WB1N 5ILUA 2LBFA 3ERED 4AVPA 3MQ0A 4RAGA 2HGCA 4EM1A 3BOQA 1LVKA 3I55I 3SYTA 2K9QA 2R92J 2DYSH 3HIFA 2QWWA 4OIOF 1JT6A 4M3GA 2CV1A 2L7MP 3EDPA 2DW4A 5JVTA 1USTA 5EF6A 1SVOA 1A6IA 1ZRDA 3JAMK 4HV5A 4XKWA 5L3DA 4HNVA 3NEUA 4E6KG 2I8DA 2BHZA 1OKRA 5JR3A 5EDNA 1HCRA 2I5UA 2HDDA 4RB2C 1JTYA 3HZJA 1EH6A 4ZTJA 4BNCA 5IP6A 1YS7A 2LY2A 3HUGA 2H6CA 2EIKH 4HV6A 1Z9CA 4BJ6C 3GTGJ 2M4GA 1XDUA 3LMMA 1UG0A 2YX7A 2E36A 2Y30A 4U88A 1U8RA 2H1LA 3HEFA 4ZDPA 1OR7C 4DW6A 5HLGA 2KISA 2XRNA 5TRDA 3O3KA 1GV5A 1DGRM 1XC5A 2GXBA 2VE8A 5HLTA 4FE7A 3RSNA 2FOWA 2HQNA 3KLNA 4IHTA 1QRYA 2COMA 1TBXA 4M73A 1QPMA 4EM2A 4ENJA 1PUFB 2O7OA 2RREA 2WV1A 4BY7J 2FNPA 3MZYA 3PQJA 4A12A 3MZHA 3MZ8A 3TQNA 3BZKA 3RPQA 2IS4A 4Y13A 3MEXA 2EWNA 3OYGA 1W7PA 1KU3A 2X6YA 1Y56A 3BZCA 3U21A 2ZXHA 4LG0B 1RI7A 1F9NA 1TW3A 2LYCA 2K4JA 4OIRF 4XICA 2CH0A 3OS1A 3NWSA 4FE4A 4P9FA 1AKHB 2R7DA 2NNYA 4U87A 4BJ5C 4L0ZB 2O8XA 5H20A 3MKZA 3LSIA 4IX7A 2NVYJ 1J09A 2ADUA 2IA1A 5D6FA 1YIOA 1WH5A 2LP0A 2MLKA 3RKYA 5D4RA 1FY7A 4UV9A 3OYAA 4XSXF 1J5YA 3H92A 2JWTA 3LOCA 3PFIA 1D1AA 4MGRA 1W5CC 3K4KA 2W82A 2MA3A 4NDLA 1LKXA 3IUOA 4MTEA 3TEDA 2HYFA 1MDMB 3LFKA 2YPRA 3BWGA 4LMYA 5EGOB 2KT0A 2KJBA 3CUOA 1BI3A 5CVVA 2RN7A 3PNYA 2FSWA 2ZSIB 1K78B 3QWLA 3ASOH 2ACJA 2IVMA 3ABKH 2EFQA 4CHUA 3U1KA 4S05A 1K79A 3WE3A 4CCJA 1DU6A 1IN7A 3C2BA 3ONQA 1VFCA 3H5NA 1R49A 1V4RA 1IDYA 1WJ5A 3G6EI 2NXNB 1IN6A 1VQPI 5L3GA 3I4PA 3KP4A 3C3WA 5KAFC 3BLYA 3QAHA 2QBYB 5HVQC 2DPUA 2I10A 1SMTA 2Z5UA 2L54A 1YI2I 1D0YA 1GUUA 1TTYA 3CLQA 1FIAA 2LKSA 3VDXA 3RKXA 2IJLA 2CQKA 2XKPA 4OOIA 3MFKA 3ZQCA 2IA2A 3OIPA 2M45A 2VJ5A 3VSLA 3WE2A 5FKKA 2QUFA 5M3FJ 4FCYA 1S7OA 4A3DJ 3LSHA 2OC6A 1GHCA 2YX4A 4JQFA 4N9HA 3BG5A 4N4NB 4L9JA 2R5ZA 2DJIA 3QP5A 2DK8A 5F0FA 1X1DA 3BR2A 4BAYA 4IPAA 4A0YA 1O4XA 5IOYA 2A61A 4PGGA 4WF2A 3CUQB 1ETQA 4A6DA 5IT9K 3CCVI 3JAMZ 3DWLE 2FU4A 4MFDA 5DM7F 4BBRJ 1I39A 3PJRA 2XAGA 1G4DA 1P4AA 4XOPA 4DYCA 2CUFA 3WTYC 3BPXA 4UB8C 2NYXA 3WU0A 4X0GA 1RKWA 1KZHA 3BJ6A 3JRFA 2HPMA 4MO7A 3WTTC 3V8JA 3BCBA 1U3EM 2NAZA 2PJPA 1UELB 3ZGKA 3I71A 3ROUA 1VQ4I 3V7SA 4A0ZA 3S2WA 3GF2A 1ZLJA 1R36A 2J5PA 4LG3A 2DTRA 3IRRA 5LRRA 4XMYA 2MD0A 3Q0VA 1YJNI 4IVNA 2Y9ZA 2ID3A 2M0MA 2QCOA 4CYCB 2P7VB 3RPUA 2WADA 5JLWA 1KONA 2K02A 2X6XA 5CYVA 3L2WA 1ODDA 2R7OA 2DA1A 3HL2A 1YQAA 1D0XA 1BM9A 1UHMA 4EVIA 4F93B 4BE1A 3LQQA 2Q2EA 4A3MJ 2BHYA 3LA2A 4QPQA 1OYYA 1K4SA 3ML6A 4KYWA 2JRMA 5F08A 4F52A 5D8KB 2JPCA 2K4BA 2M8EA 1I1GA 1YHQI 1DDNA 1R5HA 2P4WA 2KKOA 1W0TA 3CESA 1APLC 4Q4ZF 3QP6A 1ZYRF 2DXIA 1NK3P 1UJ8A 3F8FA 2P5LC 4E7ZA 5DD8A 1QNTA 3B02A 1Z77A 2HVSA 3CJNA 3E5XA 3OL3A 5EEGA 4D7NA 2MH2A 3G4SI 2CMPA 1QHHD 1FPQA 1P4WA 4BACA 2NS8A 1Z7LA 3GFLA 4F92B 3H0GJ 1YO5C 1F5TA 3GX4X 3VPRA 3E6CC 3I0TA 2LSOA 1M1EB 2X6OA 1BC8C 5FJ8J 1E3HA 5E79C 2VC0A 2COBA 4DBQA 5TJJA 1YOVB 2ZJPF 4L0YB 4B4CA 2WAQN 3OL4A 3OOPA 1K7AA 3S3NA 4FASD 5K7ZA 2Z33A 4B3XA 2RKHA 1IN4A 4G9YA 2EV5A 3K70C 3L09A 4YRVA 3L2CA 1QHGA 2OZUA 1CQTA 2O8KA 3OIQA 1TNSA 1ITYA 2LC2A 1P7JA 3PO3J 1WI9A 3VSKA 3CTAA 2KQRA 2DA4A 3CP8A 4RDUA 1V3FA 3BCAA 1G8XA 2MYSA 5E18F 2R7XA 3KP3A 2L2OA 3E6BA 5FKNA 4PJ0C 1Y1VJ 2DFFA 3OYBA 3E7LA 1KYZA 3LA3A 1G3SA 3LSKA 4II3A 1HDDC 2JA8J 4I6ZA 2DO7A 2LKPA 3WTZA 2XGCA 1P92A 3IC7A 2XASA 3M3YJ 2G7HA 4FT8A 5BPIA 2OZ6A 4MQVA 1FBSA 1KGSA 1OPCA 2L4MA 4LIUA 2HXIA 3FXLA 4MIMA 4ZYDA 4U7DA 2O0YA 5DCMB 5IT9Z 4WWCA 4CH7A 3ELKA 3WTUC 1YYVA 3W2WA 3W3CA 3OIOA 3DLAA 3A2KA 4IHVA 3SQNA 2F4MB 4HZFA 3NARA 1Z21A 3IKVA 3JSOA 4KFCA 1IV6A 2HDWA 5FO5A 1U78A 1B1BA 1OYWA 2OF7A 1MW7A 4LJZF 3TP3A 5D5XB 1UHSA 4L5EA 3TDZC 2RAEA 3LSJA 3E3VA 1XX5A 3JR9A 2UZKA 3BDDA 2VBXA 2CQNA 4BU2A 4JOMA 3PIPF 2GM4A 2QKMB 4PFPA 4FTHA 3GCMA 2B9SA 4RM3A 3J81K 2WY7Q 1TL8A 1W7PD 4V2GA 3VYRB 4KUMA 2L9SA 3F8CA 2MG4A 4Q48A 2HZDA 1U9NA 2XB5A 2ZNYA 4AD9A 2JA2A 1YJWI 4MTDA 1J0RA 1QVTA 2KP6A 2Z99A 5GP9A 1Y1WJ 2XAFA 1ETXA 1XG1A 3ESWB 1S9HA 2B63J 4O3MA 4JX4A 1B8IB 4BXXJ 1WJEA 4PJJA 2K9MA 5CKTA 1OCRH 4RAYA 2IGMA 3QOEA 3ERMA 1FLIA 4A3LJ 1T56A 3BG6A 3EUAA 2E5NA 4XM3A 2A05A 4RGRA 1BW5A 5ED4A 4FX0A 3OYLA 4R79A 1HF0A 2ZB9A 3OYHA 2JA7J 1LPQA 4KIBA 3ZMTA 3ZQIA 5HS8A 5GAEJ 5LHIA 4U0YA 4KA4A 4O5VA 3K4CA 2BV6A 3TGNA 4DGWB 2YU9J 2EV0A 1MBHA 3CUQC 2P7CB 4ESBA 2EIMH 5EG0B 2KIQA 2Y9YA 3PSFA 2EA4A 3I5UA 2OPTA 1X2NA 4HG2A 4DYQA 1K6OA 2PN6A 5DUKA 4I0AA 1JHHA 1P9QC 3WTVC 4CICA 3HOVJ 4L18B 2RV8A 4KDPA 2BY3A 1DP7P 2M30A 3F23A 2HOTA 3W2VA 1YFHA 2VLAA 1P2FA 5DV5A 3BR0A 1ON1A 3Q9VA 1MBKA 4RAZA 1J2XA 1MBFA 3FXQA 3H35A 4CDGA 2ZO4A 2L9NA 3J7AO 3WU1B 2LNBA 1MMAA 3HRSA 1E3OC 1U9OA 5HS9A 1WSUA 3U1DA 1LFUP 1XMXA 5HDGA 2W7NA 4I7HA 3S16J 2VPLA 1RUOA 2O03A 2V6EA 1O7LA 2QENA 2VXZA 1KQ9A 2KDZA 2ZNZA 5E17F 2JK3A 2BW3B 1IAWA 1IRFA 2XPUA 2XGDA 2ZXIA 1ONVA 1RUNA 3ZMUA 1JTXA 1XS9A 3KFWX 3IWZA 2PBIA 4IEJA 3A0BC 1G3WA 2MSYA 2IW5A 3DTEA 5EJCA 1PP8F 3VYTB 3DFGA 5J47A 1PDNC 2E1MB 3FX3A 3JTHA 1UAAA 4IJAA 4BQQA 3IHUA 5LLQA 3N97A 4KITB 3S1RJ 4A3BJ 2VONA 5IY5H 2V9VA 5H6RA 4HOBA 1C0WA 1VQOI 2JA6J 3DBHB 4FQGA 3WHBA 3ABMH 5M3MJ 4IHSA 4QIWN 1D1BA 2R5YA 3HSEA 1XSVA 2FNAA 3FWEA 2EFPA 1T33A 3MCZA 5DYMA 4BEHA 4F91B 2FEZA 2ECBA 5M5XJ 2ZMEB 2V7FA 1RIOH 2XSJC 3G71I 3M8EA 2W57A 5HDKA 3KZIC 4FISA 1YE9A 4OIPF 2FRHA 1HSJA 1EA3A 3PNTA 5CVJA 4MLOA 5K5OA 3GFIA 1R71A 4NQWA 2HQAA 3IH3A 1HC8A 1H8AC 1SD5A 2E1OA 4U0WA 1NH3A 2V4JC 2W24A 1JKQC 4OWRB 1I27A 1R4MB 2EBIA 1ZR2A 4BQNA 3EUHA 2VODA 4ETSA 5TISC 1UCRA 3HM5A 3K4JA 4EM0B 4OMZA 3UNGC 1EKEA 1VF9A 3L9FA 2AXTC 4LITA 2ESNA 2ZFUA 3E5QA 3HPHA 4BHCA 4CCOA 1IXSB 1SFEA 3P9CA 4XN0A 2HOAA 1SC7A 1WH7A 3FHNA 3WGHA 4GXOA 4ZDLA 1SEUA 1F4KA 3M1EA 4AM3A 3G73A 5AIPA 2GXGA 2VC1A 4G7HF 1JGSA 2BEOA 2EA2A 2OA4A 4FETA 2LREA 2ZJRF 5ICFA 4M9ZA 2B7EA 5D6EA 3HSRA 3D5SC 3ABLH 2L3DA 5J1RA 4L5IA 3A03A 2V9PA 5BMZA 2KRCA 4OIQF 4DIQA 3H5AA 3FHZA 5HLHA 4MEXF 1EF4A 3R61A 2CQXA 3RYRA 4P9UA 3S32A 1BN5A 3OYIA 3WTWC 4XOTA 1FOKA 1Z1DA 3CC2I 1RKTA 3TO9A 3CCLI 1JE8A 2ZKZA 4RGXA 3HKZA 5GADJ 1VQLI 1QZYA 4ZYHA 3B73A 5E3OA 3I59A 3HPGA 2X48A 4G7ZF 2W48A 3HRMA 3DPUA 3B6AA 3Q0WA 2KJCA 4U7BA 3HOZJ 1YRNA 2ME0A 2G7UA 3GZNB 1LE8A 1VQ7I 4A3GJ 3A0HC 2CUEA 2KMUA 2ZXWH 3FMRA 2DMUA 5BS6A 4KIGA 2CW0F 3TW6A 3FXJA 1VQ5I 4IKFA 3E1SA 3ASNH 1VTNC 2ME6A 4YIRX 1FWZA 1ZRCA 3WGGA 4UNOA 1XSDA 5GPAA 3TW7A 3M4OJ 4IO9F 1Z0XA 4RA2A 2CO5A 2X6WA 3CP2A 4P1WA 3ZQQA 2QYOA 4QLCU 1JUMA 3F9KA 5CQGA 3CCMI 1IG7A 1WWXA 4KN7X 2HEOA 2QLZA 1CF7A 2YSRA 1ETYA 2NVUB 3KEYA 1U6GA 5K1YA 4HEA2 4M6VA 2LG4A 3LSMA 4CZZA 2ESHA 3ZOBA 4F3QA 3OMYA 5HODA 1SAXA 5B5EC 1HLVA 2UXNA 1LVAA 4L9TA 4DZPA 4C2UA 1B9NA 3DF8A 3HOTA 1BL0A 3FMSA 1QO0D 4N9IA 5J3LA 1WGXA 2VKDA 1Z3XA 1ZHFA 3A1YA 4XLNF 1GLNA 4AIHA 2AQFA 2LBFB 3MKWB 3AG2H 1WCMJ 1S29A 2A69F 4BE2A 1VI0A 1IRZA 2DFHA 1TWAJ 2XAJA 2A5YB 1ZN2A 2HYGD 2HNHA 4QTRA 2VOPA 4NNJA 4AIKA 1XB4A 2DFIA 5CVIA 1HOMA 1SVLA 1AHDP 2LFBA 2R0QC 1W5TA 4ESFA 2EFWA 3CMMA 1FT9A 1FYMA 5BQTA 1SD6A 2Z3YA 1X4OA 1B6AA 1IXRC 1T95A 3QPLA 4XRFA 1SAUA 2F5VA 3S15J 3SJMA 3BR6A 1TC3C 3L7WA 1I5ZA 2ELJA 3RI4A 3CF5F 5LRSA 2XDVA 2BBYA 2WBMA 3CDLA 2RVCA 4A93J 4OINF 2XGXA 1JJ6C 2HWVA 4XLEA 2Z1DA 1OCTC 1FBQA 1KU2A 2M4KA 4RM2A 2C6YA 3MKYB 1ZK8A 1OISA 2LD5A 3M8FA 1STZA 4N0BA 2E1MC 3R0JA 1JJ8C 2HKOA 4A3IJ 1BI0A 2H09A 2MBFA 3AFHA 3EPZA 3SXYA 2KIFA 2X1DA 1XPXA 4BXUA 2OQRA 1G3YA 2F6CA 1IO2A 3D5LA 1W7PB 3JTGA 4B1RA 1WFXA 1MD0A 1ZGAA 2A3SA 4O6JA 3VEPA 4YFNF 2LLKA 2A6EF 1H88C 3K4NA 3O8GA 4G6DA 1ZKGA 5F0CA 4ANJA 2ZMEC 4XLCA 1FTZA 2DPDA 4CCKA 2LDUA 2LY1A 3FM5A 2DA3A 3K4MA 3RQ4A 2IXSA 2WWYA 1RR8C 3S2DJ 4GFBA 1UZCA 3NWTA 3WG9A 2L9VA 2JQ7A 2Q1ZB 4YEJA 1V5GA 3K4LA 1MJ9A 3HDDA 3CDIA 5AONA 5HDNA 3DTIA 1XN7A 3K1PA 1GXPA 4NC8A 4ENMA 3K4BA 2Y0SN 5E1XA 1TQPA 2BVMA 4UUSA 2E5ZA 3IH4A 2GWRA 1HW5A 2DA2A 2R3SA 3IV5A 3ZQ7A 3FXOA 5K5RA 4ENNA 5FROA
chains in the Genus database with same CATH topology
1P7JA 3PO3J 1MH3A 2DA4A 2VKEA 4JYKA 2FD5A 4RDUA 3BT9A 3SFIA 2NS7A 2LR8A 4Y7NJ 3K7AJ 4EEFG 2HXOA 5FKNA 2E2IJ 2EH3A 1GDTA 3BG3A 4MFEA 1F43A 1Y1VJ 1RR7A 3E7LA 5IYCJ 1YRNB 1OJLA 1LE8B 1HDDC 2JA8J 4I6ZA 4M3EA 2XGCA 2XSDC 2DN0A 3M3YJ 2ELKA 2QF7A 3FKIJ 1IUFA 1ZQ3P 2XGEA 1MBJA 2D5VA 2HXIA 4MIMA 3HKZN 1B72A 5C4XJ 1MBGA 4C3HJ 2X9DA 1I6HJ 2DMQA 3OIOA 9ANTA 2VKVA 4IHVA 1JUPA 3S1QJ 3NARA 1BJZA 1I3QJ 3HGYA 4XRSG 4DYRA 3CCYA 2NVQJ 3HOUJ 1IV6A 3G1MA 5E3NA 1U78A 2OF7A 3TP3A 1PUFA 1DU0A 2R5ZB 1RPWA 1UHSA 1ETKA 4L5EA 2RAEA 3HB9A 1S7EA 3LSJA 3JRDA 3JR9A 5IYDJ 2DA5A 1JKPC 3DCFA 2GM4A 4FTHA 1R9TJ 3GBGA 2DMTA 5FKOA 3JRBA 2PMZN 2FJ1A 4V2GA 3MVPA 4AUXA 1MH4A 1P7IA 2MG4A 3O8HA 1AKHA 5F0HA 3D1NI 4W1UA 2ECCA 2L0KA 3BTLA 3CQZJ 1U9NA 2XB5A 1JKOC 1K83J 3SDGA 3S17J 4BY1J 1HDPA 1QVTA 5BNGA 5GP9A 1Y1WJ 1G2HA 1ETXA 1XG1A 3S1NJ 1D5YA 2B63J 2N8GA 4JX4A 1B8IB 4BXXJ 1F36A 1MBEA 1K61A 1VNDA 3A01B 4W97A 1TWFJ 5IOZA 2K9SA 5IYBJ 4A3LJ 1T56A 1Q1VA 1MSFC 1FTTA 1BW5A 1IC8A 4X1EA 5IP9J 5EGOA 1HF0A 2ZB9A 5M5WJ 5K7HA 2JA7J 2YUSA 2R7ZJ 3ZQIA 3NAUA 3FK7A 4D7MA 2P81A 4IHWA 3ZQHA 2K9NA 2M2EA 2YU9J 1MBHA 3GTMJ 4A3JJ 3OSGA 1X58A 5EG0B 2HI3A 2Y9YA 1X2MA 2EZKA 2OPTA 1X2NA 1LFBA 2IEKA 4DYQA 3CMYA 4BKXA 5E3MA 4AC0A 5EYRA 3JRHA 5FLMJ 1RESA 5K7FA 3HOVJ 1WI3A 3GTQJ 1FEXA 2GBYA 2HOTA 3S1MJ 4JX5A 4A3KJ 2O9LA 3BR0A 1JGGA 1U8BA 1MBKA 1MBFA 1GV2A 3RZOJ 3MN2A 4IHXA 5C4JJ 1TWHJ 3GTLJ 4QSHA 1UMQA 1E3OC 2CRGA 1U9OA 2TRTA 1LFUP 5EZHA 2XRLA 3S16J 1BA5A 2CJJA 4C2MJ 1GT0C 3G1LA 5EEAA 4D5CA 2KDZA 4LOCA 3GTPJ 2DJNA 1H89C 2JK3A 2DMNA 2FX0A 2DMPA 1A5JA 2XPUA 1POGA 2XGDA 1TWCJ 2DA6A 3RQIA 3HOWJ 1JTXA 1XS9A 3BR3A 3FIWA 4IEJA 2WB1N 2MSYA 1ORKA 2MW8A 4UUSB 1JUSA 3PO2J 4A3CJ 3HGGA 3IH2A 2K9QA 2R92J 3B6CA 3S1RJ 3JRGA 4A3BJ 1FIPA 4D5FA 1JT6A 4M3GA 2L7MP 2IAIA 3ZQFA 1ZTRA 3FISA 4A3EJ 5EF6A 2JA6J 2LKXA 3WHBA 2NVTJ 1A6IA 5M3MJ 1AU7A 4QIWN 2R5YA 4Y52J 4HNVA 1SANA 3OOUA 3GTKJ 3K2AA 2HDDA 5EDNA 1HCRA 1T33A 1JTYA 2VI6A 3HBLA 2H1KA 3RZDJ 2ECBA 5IP6A 4C3JJ 5M5XJ 4CYCA 1OCPA 3GTGJ 2M9HA 2LTPA 4FISA 2DTZA 2L7FP 4MLOA 2Y30A 3HEFA 1GVDA 4DW6A 4M3BA 3IH3A 2M0CA 4DZJA 1B72B 1GV5A 1H8AC 1XC5A 2E1OA 4J19A 4FE7A 5JLXA 1JKQC 1IGNA 2EBIA 1ZR2A 5F04A 1WPKA 2JA5J 1QRYA 2R93J 3HM5A 3BTCA 1PUFB 2O7OA 5E3LA 1VF9A 2WV1A 4BY7J 2K40A 2XPWA 2L7ZA 4G12A 2HOAA 1I50J 2VUMJ 1WH7A 3JREA 5DS9A 4XICA 4FE4A 1AKHB 3JRIA 3BTIA 2NVYJ 1ETOA 1WH5A 3BR5A 2LP0A 2E2HJ 1QVUA 4XIDA 3LSPA 3HOYJ 2JWTA 3LOCA 3UKGA 5J1RA 2LK2A 2AO9A 3A03A 3S2HJ 5F27A 4NDLA 3QPSA 1MNMC 3LNQA 1EF4A 2CQXA 3TEDA 2HOSA 2MGQA 3A02A 1RKTA 5EGOB 5FKMA 3L1PA 2KT0A 4UUTA 5M5YJ 2G0EA 2E19A 5E3OA 3RKQA 2X48A 2W48A 1TWGJ 2CQQA 2M8GX 1RETA 3WHCA 3B6AA 4V2FA 3Q0WA 3HOZJ 1DU6A 2JJ7A 3C2BA 4X6AJ 1YRNA 1IJWC 1VFCA 1IDYA 2ME0A 1LE8A 2H8RA 4A3GJ 3F0CA 2CUEA 5F1JA 2DMUA 2JN6A 3ZQLA 3TW6A 3OSFA 1FJLA 4JP0A 2I10A 2EZLA 2ME6A 1IDZA 1GUUA 1FIAA 5GPAA 3TW7A 3ZQCA 3M4OJ 1Z0XA 5M3FJ 2AHQA 4FCYA 2HQ5A 2EZIA 5FKKA 1JKRC 3GTJJ 1BW6A 4A3DJ 1JUMA 2NOGA 3JRCA 1IG7A 4A69C 3BG5A 2YS9A 2R5ZA 1ETYA 5F0FA 2LY9A 3BR2A 4M6VA 2NVXJ 1O4XA 5IOYA 1ETVA 3ZOBA 5HODA 5IP7J 4M3DA 1ETQA 1HLVA 3LSRA 4DZPA 4MFDA 1ENHA 1BL0A 4BBRJ 4AYBN 2Y31A 3QQAA 5J3LA 1WGXA 4DYCA 2CUFA 1WCMJ 4XRSA 1RKWA 3JRFA 3TP0A 1VI0A 4MO7A 1IRZA 2EZHA 1TWAJ 3BTJA 4BBSJ 4QTRA 3W6VA 3PM1A 1SFOJ 1HOMA 3HOXJ 4ABZA 1AHDP 2LFBA 5J1YA 2R0QC 1B8IA 4JX6A 2R5YB 3MKLA 3A01A 2DA7A 3DEWA 3Q3SA 4B3AA 3Q0VA 3QPLA 2Y9ZA 1QPIA 2ID3A 3S15J 3SJMA 2QCOA 4CYCB 3BR6A 2Y2ZA 1TC3C 3BR1A 3BG9A 5JLWA 2HYJA 3FK6A 3G1OA 4S0HB 2DA1A 5C44J 1JT0A 3CDLA 4A93J 4M3FA 2E2JJ 5EZGA 5EG0A 1JJ6C 2FQ4A 4A3MJ 1OCTC 5F08A 1ZK8A 3GTOJ 2LD5A 3BQZA 5IPAA 3S14J 1W0TA 1JJ8C 1APLC 4A3IJ 1NK3P 2M34A 3ZQGA 1Z77A 1MSEC 1ZR4A 4D7NA 2JMWA 5FLVA 4B1RA 4I76A 4A3FJ 2EQRA 5J1UA 3BQYA 1NTCA 2NS8A 1W0UA 1OFCX 2LLKA 3LSGA 4XK4A 1H88C 3H3VK 3H0GJ 3O8GA 5DTDA 1ZKGA 5F0CA 2XPVA 3VPRA 1ZGWA 2XB0X 4IHYA 1FTZA 4C3IJ 2X6OA 2ID6A 1ETWA 5FJ8J 5C3EJ 2DA3A 2COBA 3Q0UA 1NK2P 2IBDA 3S2DJ 5FKLA 4GFBA 4RBOA 3I4NJ 4B4CA 3I4MJ 2WAQN 2CU7A 5K7ZA 3HDDA 2TCTA 2L9RA 2Y0SN 3JRAA 4UUSA 3IH4A 1CQTA 2DA2A 5GPCA 3IV5A 2LVSA 2O8KA 2GLOA 1UG2A 1ITYA 4XRMA 2VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7J A;  3PO3 J;  1MH3 A;  2DA4 A;  2VKE A;  4JYK A;  2FD5 A;  4RDU A;  3BT9 A;  3SFI A;  2NS7 A;  2LR8 A;  4Y7N J;  3K7A J;  4EEF G;  2HXO A;  5FKN A;  2E2I J;  2EH3 A;  1GDT A;  3BG3 A;  4MFE A;  1F43 A;  1Y1V J;  1RR7 A;  3E7L A;  5IYC J;  1YRN B;  1OJL A;  1LE8 B;  1HDD C;  2JA8 J;  4I6Z A;  4M3E A;  2XGC A;  2XSD C;  2DN0 A;  3M3Y J;  2ELK A;  2QF7 A;  3FKI J;  1IUF A;  1ZQ3 P;  2XGE A;  1MBJ A;  2D5V A;  2HXI A;  4MIM A;  3HKZ N;  1B72 A;  5C4X J;  1MBG A;  4C3H J;  2X9D A;  1I6H J;  2DMQ A;  3OIO A;  9ANT A;  2VKV A;  4IHV A;  1JUP A;  3S1Q J;  3NAR A;  1BJZ A;  1I3Q J;  3HGY A;  4XRS G;  4DYR A;  3CCY A;  2NVQ J;  3HOU J;  1IV6 A;  3G1M A;  5E3N A;  1U78 A;  2OF7 A;  3TP3 A;  1PUF A;  1DU0 A;  2R5Z B;  1RPW A;  1UHS A;  1ETK A;  4L5E A;  2RAE A;  3HB9 A;  1S7E A;  3LSJ A;  3JRD A;  3JR9 A;  5IYD J;  2DA5 A;  1JKP C;  3DCF A;  2GM4 A;  4FTH A;  1R9T J;  3GBG A;  2DMT A;  5FKO A;  3JRB A;  2PMZ N;  2FJ1 A;  4V2G A;  3MVP A;  4AUX A;  1MH4 A;  1P7I A;  2MG4 A;  3O8H A;  1AKH A;  5F0H A;  3D1N I;  4W1U A;  2ECC A;  2L0K A;  3BTL A;  3CQZ J;  1U9N A;  2XB5 A;  1JKO C;  1K83 J;  3SDG A;  3S17 J;  4BY1 J;  1HDP A;  1QVT A;  5BNG A;  5GP9 A;  1Y1W J;  1G2H A;  1ETX A;  1XG1 A;  3S1N J;  1D5Y A;  2B63 J;  2N8G A;  4JX4 A;  1B8I B;  4BXX J;  1F36 A;  1MBE A;  1K61 A;  1VND A;  3A01 B;  4W97 A;  1TWF J;  5IOZ A;  2K9S A;  5IYB J;  4A3L J;  1T56 A;  1Q1V A;  1MSF C;  1FTT A;  1BW5 A;  1IC8 A;  4X1E A;  5IP9 J;  5EGO A;  1HF0 A;  2ZB9 A;  5M5W J;  5K7H A;  2JA7 J;  2YUS A;  2R7Z J;  3ZQI A;  3NAU A;  3FK7 A;  4D7M A;  2P81 A;  4IHW A;  3ZQH A;  2K9N A;  2M2E A;  2YU9 J;  1MBH A;  3GTM J;  4A3J J;  3OSG A;  1X58 A;  5EG0 B;  2HI3 A;  2Y9Y A;  1X2M A;  2EZK A;  2OPT A;  1X2N A;  1LFB A;  2IEK A;  4DYQ A;  3CMY A;  4BKX A;  5E3M A;  4AC0 A;  5EYR A;  3JRH A;  5FLM J;  1RES A;  5K7F A;  3HOV J;  1WI3 A;  3GTQ J;  1FEX A;  2GBY A;  2HOT A;  3S1M J;  4JX5 A;  4A3K J;  2O9L A;  3BR0 A;  1JGG A;  1U8B A;  1MBK A;  1MBF A;  1GV2 A;  3RZO J;  3MN2 A;  4IHX A;  5C4J J;  1TWH J;  3GTL J;  4QSH A;  1UMQ A;  1E3O C;  2CRG A;  1U9O A;  2TRT A;  1LFU P;  5EZH A;  2XRL A;  3S16 J;  1BA5 A;  2CJJ A;  4C2M J;  1GT0 C;  3G1L A;  5EEA A;  4D5C A;  2KDZ A;  4LOC A;  3GTP J;  2DJN A;  1H89 C;  2JK3 A;  2DMN A;  2FX0 A;  2DMP A;  1A5J A;  2XPU A;  1POG A;  2XGD A;  1TWC J;  2DA6 A;  3RQI A;  3HOW J;  1JTX A;  1XS9 A;  3BR3 A;  3FIW A;  4IEJ A;  2WB1 N;  2MSY A;  1ORK A;  2MW8 A;  4UUS B;  1JUS A;  3PO2 J;  4A3C J;  3HGG A;  3IH2 A;  2K9Q A;  2R92 J;  3B6C A;  3S1R J;  3JRG A;  4A3B J;  1FIP A;  4D5F A;  1JT6 A;  4M3G A;  2L7M P;  2IAI A;  3ZQF A;  1ZTR A;  3FIS A;  4A3E J;  5EF6 A;  2JA6 J;  2LKX A;  3WHB A;  2NVT J;  1A6I A;  5M3M J;  1AU7 A;  4QIW N;  2R5Y A;  4Y52 J;  4HNV A;  1SAN A;  3OOU A;  3GTK J;  3K2A A;  2HDD A;  5EDN A;  1HCR A;  1T33 A;  1JTY A;  2VI6 A;  3HBL A;  2H1K A;  3RZD J;  2ECB A;  5IP6 A;  4C3J J;  5M5X J;  4CYC A;  1OCP A;  3GTG J;  2M9H A;  2LTP A;  4FIS A;  2DTZ A;  2L7F P;  4MLO A;  2Y30 A;  3HEF A;  1GVD A;  4DW6 A;  4M3B A;  3IH3 A;  2M0C A;  4DZJ A;  1B72 B;  1GV5 A;  1H8A C;  1XC5 A;  2E1O A;  4J19 A;  4FE7 A;  5JLX A;  1JKQ C;  1IGN A;  2EBI A;  1ZR2 A;  5F04 A;  1WPK A;  2JA5 J;  1QRY A;  2R93 J;  3HM5 A;  3BTC A;  1PUF B;  2O7O A;  5E3L A;  1VF9 A;  2WV1 A;  4BY7 J;  2K40 A;  2XPW A;  2L7Z A;  4G12 A;  2HOA A;  1I50 J;  2VUM J;  1WH7 A;  3JRE A;  5DS9 A;  4XIC A;  4FE4 A;  1AKH B;  3JRI A;  3BTI A;  2NVY J;  1ETO A;  1WH5 A;  3BR5 A;  2LP0 A;  2E2H J;  1QVU A;  4XID A;  3LSP A;  3HOY J;  2JWT A;  3LOC A;  3UKG A;  5J1R A;  2LK2 A;  2AO9 A;  3A03 A;  3S2H J;  5F27 A;  4NDL A;  3QPS A;  1MNM C;  3LNQ A;  1EF4 A;  2CQX A;  3TED A;  2HOS A;  2MGQ A;  3A02 A;  1RKT A;  5EGO B;  5FKM A;  3L1P A;  2KT0 A;  4UUT A;  5M5Y J;  2G0E A;  2E19 A;  5E3O A;  3RKQ A;  2X48 A;  2W48 A;  1TWG J;  2CQQ A;  2M8G X;  1RET A;  3WHC A;  3B6A A;  4V2F A;  3Q0W A;  3HOZ J;  1DU6 A;  2JJ7 A;  3C2B A;  4X6A J;  1YRN A;  1IJW C;  1VFC A;  1IDY A;  2ME0 A;  1LE8 A;  2H8R A;  4A3G J;  3F0C A;  2CUE A;  5F1J A;  2DMU A;  2JN6 A;  3ZQL A;  3TW6 A;  3OSF A;  1FJL A;  4JP0 A;  2I10 A;  2EZL A;  2ME6 A;  1IDZ A;  1GUU A;  1FIA A;  5GPA A;  3TW7 A;  3ZQC A;  3M4O J;  1Z0X A;  5M3F J;  2AHQ A;  4FCY A;  2HQ5 A;  2EZI A;  5FKK A;  1JKR C;  3GTJ J;  1BW6 A;  4A3D J;  1JUM A;  2NOG A;  3JRC A;  1IG7 A;  4A69 C;  3BG5 A;  2YS9 A;  2R5Z A;  1ETY A;  5F0F A;  2LY9 A;  3BR2 A;  4M6V A;  2NVX J;  1O4X A;  5IOY A;  1ETV A;  3ZOB A;  5HOD A;  5IP7 J;  4M3D A;  1ETQ A;  1HLV A;  3LSR A;  4DZP A;  4MFD A;  1ENH A;  1BL0 A;  4BBR J;  4AYB N;  2Y31 A;  3QQA A;  5J3L A;  1WGX A;  4DYC A;  2CUF A;  1WCM J;  4XRS A;  1RKW A;  3JRF A;  3TP0 A;  1VI0 A;  4MO7 A;  1IRZ A;  2EZH A;  1TWA J;  3BTJ A;  4BBS J;  4QTR A;  3W6V A;  3PM1 A;  1SFO J;  1HOM A;  3HOX J;  4ABZ A;  1AHD P;  2LFB A;  5J1Y A;  2R0Q C;  1B8I A;  4JX6 A;  2R5Y B;  3MKL A;  3A01 A;  2DA7 A;  3DEW A;  3Q3S A;  4B3A A;  3Q0V A;  3QPL A;  2Y9Z A;  1QPI A;  2ID3 A;  3S15 J;  3SJM A;  2QCO A;  4CYC B;  3BR6 A;  2Y2Z A;  1TC3 C;  3BR1 A;  3BG9 A;  5JLW A;  2HYJ A;  3FK6 A;  3G1O A;  4S0H B;  2DA1 A;  5C44 J;  1JT0 A;  3CDL A;  4A93 J;  4M3F A;  2E2J J;  5EZG A;  5EG0 A;  1JJ6 C;  2FQ4 A;  4A3M J;  1OCT C;  5F08 A;  1ZK8 A;  3GTO J;  2LD5 A;  3BQZ A;  5IPA A;  3S14 J;  1W0T A;  1JJ8 C;  1APL C;  4A3I J;  1NK3 P;  2M34 A;  3ZQG A;  1Z77 A;  1MSE C;  1ZR4 A;  4D7N A;  2JMW A;  5FLV A;  4B1R A;  4I76 A;  4A3F J;  2EQR A;  5J1U A;  3BQY A;  1NTC A;  2NS8 A;  1W0U A;  1OFC X;  2LLK A;  3LSG A;  4XK4 A;  1H88 C;  3H3V K;  3H0G J;  3O8G A;  5DTD A;  1ZKG A;  5F0C A;  2XPV A;  3VPR A;  1ZGW A;  2XB0 X;  4IHY A;  1FTZ A;  4C3I J;  2X6O A;  2ID6 A;  1ETW A;  5FJ8 J;  5C3E J;  2DA3 A;  2COB A;  3Q0U A;  1NK2 P;  2IBD A;  3S2D J;  5FKL A;  4GFB A;  4RBO A;  3I4N J;  4B4C A;  3I4M J;  2WAQ N;  2CU7 A;  5K7Z A;  3HDD A;  2TCT A;  2L9R A;  2Y0S N;  3JRA A;  4UUS A;  3IH4 A;  1CQT A;  2DA2 A;  5GPC A;  3IV5 A;  2LVS A;  2O8K A;  2GLO A;  1UG2 A;  1ITY A;  4XRM A;  2VPR A; 
#chains in the Genus database with same CATH topology
 3QPT A;  5DD4 A;  4HLX A;  4HNT A;  5LBQ A;  2DFE A;  4DBR A;  4ZYE A;  2VL8 A;  4JYK A;  3FZV A;  1IUY A;  2FBK A;  4AID A;  3SFI A;  2NS7 A;  2LR8 A;  3VFZ A;  3K7A J;  1LB2 A;  1REP C;  2HXO A;  1YIT I;  3SZG A;  2RNG A;  4U0V A;  2RGV A;  3GZ5 A;  1EJ9 A;  2XAH A;  4A5N A;  3GFM A;  2DQL A;  3ULQ B;  5D5U B;  5FRM A;  1UHW A;  5H2F C;  4D1Q A;  3OYC A;  2DBB A;  3OS0 A;  3H9G A;  3ISP A;  1PJR A;  1R4N B;  2XSD C;  2ELK A;  3C2H A;  4BH9 A;  2QF7 A;  1IUF A;  1X3Z B;  3FXR A;  2XGE A;  3OYF A;  1SD7 A;  3IWF A;  1B72 A;  1FOY A;  2CFX A;  2X9D A;  3F6V A;  1T39 A;  1T0F C;  3RDI A;  4IRI A;  2LF7 A;  3R60 A;  3BPV A;  1TW2 A;  4HX7 A;  4M71 A;  2L02 A;  4ZH4 F;  3S1Q J;  1FNN A;  3HGY A;  2V1N A;  5ICC A;  5D4S A;  3G1M A;  4HAM A;  3DLL F;  2R5Z B;  2OQG A;  2DDB A;  1S7E A;  1XGS A;  5IYD J;  2DA5 A;  2HDC A;  3QYB A;  5CJ9 A;  3DCF A;  2IGN A;  2OUM A;  4IXA A;  1O3S A;  2GAU A;  1R9T J;  3QRF F;  2QQA A;  3L2V A;  2PMZ N;  5ILV A;  2FJ1 A;  3K1N A;  4IQ4 A;  2STT A;  2PI0 A;  4AUX A;  2M87 A;  2D45 A;  5B3S H;  2M7A A;  3D1N I;  3CJQ B;  1S7A A;  5CLS A;  3L2Q A;  1T8I A;  3S17 J;  1HBX G;  3L2U A;  1HDP A;  5BNG A;  3IAS 2;  2W1O A;  4PGH A;  2IT0 A;  4XKC A;  2WAQ A;  1VND A;  4Y17 A;  4EJT A;  2RDP A;  3BG7 A;  2L01 A;  1W36 D;  2XKO A;  3L2R A;  1FTT A;  2KIU A;  1P6R A;  4QPO A;  1FP2 A;  4X1E A;  3AKZ A;  2O6G E;  3HSF A;  1K4T A;  5M5W J;  2PG4 A;  3KLO A;  5L3C A;  1ULY A;  2R7F A;  2YUS A;  2UUZ A;  4IHW A;  3ZQH A;  2K9N A;  4DOZ A;  1OQY A;  4MQ9 F;  1AA7 A;  3GEZ A;  2Q2E B;  1HXD A;  1J59 A;  2UV1 A;  4DJA A;  1BC7 C;  2DT6 A;  2IEK A;  3PQK A;  2EB7 A;  3DPT A;  5E3M A;  2WAF A;  4AC0 A;  4GYG A;  3V42 A;  4CO8 A;  5K7F A;  1WI3 A;  2XF5 A;  2H8W A;  4I98 B;  4HNU A;  3S1M J;  2DI3 A;  1VZ0 A;  2O9L A;  2A5W A;  4PJL A;  1JGG A;  1U8B A;  2H27 A;  1VQ9 I;  3CO7 C;  2BXZ A;  5B1B H;  4AYB A;  2CUZ A;  2K5C A;  1U5T A;  2TDX A;  2GOM A;  1BIB A;  2AQE A;  4QSH A;  1UMQ A;  1I1S A;  3RYP A;  2QQ9 A;  2RC4 A;  2PX9 A;  2KPM A;  1FOW A;  3LA7 A;  1FYK A;  5E20 A;  4LOC A;  3GTP J;  2DJN A;  4BUP A;  4HLY A;  5ICE A;  4OU0 A;  5F64 A;  2DMN A;  2FX0 A;  3DP7 A;  4UVB A;  1VQN I;  2P8T A;  4Y3O A;  5JI6 A;  1DPU A;  3HRU A;  3HOW J;  2EFN A;  3PSI A;  4XOR A;  2MLG A;  4RLF A;  2MW8 A;  1TNT A;  1X3W B;  3ABT A;  1V54 H;  3CJR B;  2PJR A;  2A68 F;  1JUS A;  3PO2 J;  4A3C J;  2J5O A;  3IH2 A;  4RB0 A;  4E7H A;  2CV0 A;  3K70 D;  3JRG A;  1OCO H;  2LF8 A;  1FIP A;  4KMU X;  2IS6 A;  3VOD A;  1WQ2 A;  2IAI A;  1BOB A;  1BR4 A;  3TKY A;  1AU7 A;  1I6X A;  3I56 I;  4Y33 A;  2QGU A;  3JCU C;  3K2A A;  4CGZ A;  3UR3 C;  2E7W A;  4XLA A;  3P9K A;  2VI6 A;  2ETH A;  2H1K A;  2IPQ X;  3RZD J;  2P5V A;  4PK4 A;  4DNC A;  5FGM A;  2M9H A;  2LTP A;  1OMI A;  3KYC B;  4ZZD A;  1N77 A;  1L3L A;  1VQ6 I;  2DTZ A;  3K1M A;  3CDH A;  3MD2 A;  5E8I A;  5BOX A;  1GVD A;  1PVE A;  3DQV C;  4M3B A;  1L0O C;  5FFX A;  3NQO A;  1SFX A;  2M0C A;  2O3F A;  4OAY A;  2DAO A;  4DZJ A;  2DK5 A;  4RS8 A;  4LLN A;  2O5R A;  3T0Y A;  1Y8R B;  4LLL A;  1WKM A;  2QSH X;  2FXA A;  4R1H A;  1WJF A;  1QA6 A;  5F04 A;  3PNV A;  2JA5 J;  4YIF A;  1YJ9 I;  3KYD B;  3HXL A;  3O2P E;  5DDG A;  2MH9 A;  1KA8 A;  3HHG A;  3AG4 H;  3DBL B;  1UB9 A;  4I09 A;  2CYY A;  2CFO A;  2R4G A;  2XUB A;  1MMD A;  2K40 A;  2XPW A;  4F55 A;  2Y75 A;  3RKW A;  2KLO A;  5ILS A;  2CUJ A;  2L7Z A;  4KT5 C;  2KFD A;  2CS3 A;  3RIR A;  2VUM J;  3JRE A;  3H3U A;  3M1C A;  4EAT A;  3OR2 C;  1BI2 A;  4CXF A;  3KEQ A;  3AAF A;  4LB5 A;  1E2X A;  1MNE A;  1YTY A;  3COA C;  3OV8 A;  4L9V A;  2GQQ A;  2OCE A;  3BTI A;  2MD5 A;  2R7T A;  1OR7 A;  4ZC3 A;  2PEX A;  2BOL A;  2FBI A;  3CCQ I;  4XID A;  3LSP A;  3LFU A;  4H0E A;  3NRV A;  3VYU B;  3UKG A;  2CGP A;  2ISY A;  2LK2 A;  2AO9 A;  3GVA A;  2Q0O A;  3S2H J;  1MNM C;  4YFX F;  3WTX C;  3LNQ A;  1LDJ A;  4J01 A;  2V79 A;  3P5J A;  3LAJ A;  4M9S A;  4A0X A;  5LD2 C;  2HOS A;  3A02 A;  1MND A;  2M5W A;  3AG3 H;  5FKM A;  4HW0 A;  2HR3 A;  4UUT A;  4GO1 A;  1ZG5 A;  3DKX A;  2XF7 A;  5M5Y J;  3IL2 A;  2E19 A;  3GW2 A;  3W6K B;  2EK5 A;  2ZCW A;  1XMK A;  2F4I A;  4EGY A;  3GXO A;  3DBR B;  2CQQ A;  2M8G X;  3WHC A;  4V2F A;  4KIS A;  3BZ6 A;  1D0Z A;  2WTE A;  2Z2S B;  4X6A J;  4K2E A;  2ZBK A;  3TDU C;  3VWB A;  4PJN A;  2H8R A;  4CUG A;  4HBL A;  4D9J A;  3M8J A;  2FUG 2;  4RLQ A;  5HS7 A;  4E7K A;  2JN6 A;  4P96 A;  5DM6 F;  1HKQ A;  3OSF A;  3F8N A;  2IA0 A;  4JP0 A;  5L3E A;  1KU7 A;  4CZC A;  2R7R A;  2A6T A;  2FA5 A;  2VJ4 A;  1FYL A;  3QPH A;  2AHQ A;  3K6G A;  2HQ5 A;  1JKR C;  5F1R A;  3JRC A;  5CPR B;  2XVC A;  2IS2 A;  1YG2 A;  1BOA A;  3N05 A;  3KE2 A;  3P9I A;  3ZP5 A;  3FXU A;  2PLY A;  2BVL A;  3F8B A;  2LY9 A;  2OTJ I;  1ETV A;  3J7Y J;  3OYD A;  5FRN A;  4M3D A;  2ZJQ F;  3JW4 A;  3SZP A;  4HQE A;  2RQP A;  2BYV E;  5D5W B;  1J75 A;  3ECO A;  2AS5 F;  1MMS A;  1HW2 A;  3ZR8 X;  3K9T A;  3HJE A;  4XRS A;  3TP0 A;  2MFZ A;  5CVR A;  2EZH A;  3SEQ A;  3BTJ A;  3SDB A;  4UHT A;  2VKH A;  2CG4 A;  5ERI A;  1FC3 A;  5JHU A;  2E60 A;  3PM1 A;  1A31 A;  1V5E A;  3I58 A;  5CVU A;  5J4V A;  3F22 A;  2HU9 A;  4Z2Y A;  2VQH A;  4ABZ A;  2VT3 A;  2B0L A;  5J6X A;  1PYV A;  2PQ8 A;  1FP1 D;  2R5Y B;  5LHH A;  3MKL A;  3A01 A;  4XBF A;  2RNJ A;  4R8H A;  3DEW A;  4B3A A;  4LGW A;  1HKT A;  3WGI A;  1B9M A;  1K6Y A;  4NBQ A;  3EQL F;  2Y2Z A;  2F5E A;  3RCO A;  3BR1 A;  4UUV A;  3J7A Y;  3BG9 A;  2HYJ A;  3AL0 B;  3IRQ A;  3G1O A;  2YU3 A;  5L3B A;  2F2E A;  2LRD A;  4B48 A;  4P5O A;  3O6B B;  4EJW A;  4NQW B;  2E2J J;  1LNW A;  2DYR H;  4YFK F;  3M7G A;  2NRA C;  4IRH A;  4IRG A;  1D8K A;  3EUK L;  1R00 A;  3V7C A;  2P5K A;  3KZY A;  3KCC A;  4EQQ A;  1SFU A;  2WC2 A;  2V6C A;  3GTO J;  3BQZ A;  1FX7 A;  1N78 A;  1XGN A;  5D8L B;  3KPH A;  2Y69 H;  5IPA A;  4XL9 A;  3T8T A;  2F5D A;  2IP2 A;  2P6T A;  2IS1 A;  4GRI A;  2G9W A;  4MNU A;  2M34 A;  1XCB A;  3C1D A;  1MSE C;  3EYY A;  2XAU A;  1ZR4 A;  3CCR I;  2DCE A;  2M3A A;  4BYY A;  5CQE A;  5FLV A;  2W4S A;  2VAS A;  4A3F J;  3S93 A;  3EET A;  1USS A;  2EQR A;  3OYK A;  2WB1 A;  3BQY A;  5LGT A;  3R4K A;  3FF5 A;  4ENK A;  2KIM A;  3LSG A;  4XK4 A;  2E71 A;  3H3V K;  4LK0 F;  5DTD A;  1UFM A;  3QU3 A;  5FFZ A;  1G59 A;  2HFH A;  5GAH J;  4C3I J;  4HDV A;  1DGW Y;  5A2Q Z;  5E1Z B;  4B44 A;  3Q0U A;  1NK2 P;  5FKL A;  1Y39 A;  1JI8 A;  2CW8 A;  3I4M J;  2FBH A;  2CU7 A;  3GLL A;  4BQA A;  1S8N A;  3QOD A;  2TCT A;  2L9R A;  2HPI A;  4A5M A;  3KET A;  3ZMZ A;  3D5R C;  3RTR A;  3JRA A;  4CCL A;  3ZMD A;  4E7L A;  4XN3 A;  3GUD A;  4BS9 A;  3AG1 H;  1XCV A;  2EIL H;  3IKT A;  2VPR A;  2D1V A;  3BY6 A;  4ITV A;  3F3X A;  1MH3 A;  2BGC A;  1I3A A;  2VKE A;  3CZ6 A;  3LL7 A;  2FE3 A;  2FD5 A;  5FD5 A;  5GTI C;  1O3T A;  3P7N A;  1HW1 A;  2PMU A;  4Y7N J;  3I59 B;  2JPB A;  3CC7 I;  3BG3 A;  4GGG A;  1F43 A;  5DCF A;  1Y0U A;  2V1U A;  3E6M A;  4XLH A;  3OYN A;  2FMY A;  3M9A A;  5IYC J;  2HTS A;  3ZRG A;  1YRN B;  1Z05 A;  1P4X A;  5HOO A;  1LE8 B;  4A6E A;  1O57 A;  2IGO A;  4M3E A;  2VBY A;  1Y6I A;  3H9J A;  3JSP A;  2DN0 A;  4RGS A;  4IOA F;  4CCM A;  3CF2 A;  3FKI J;  2A07 F;  1X4P A;  2D5V A;  1WHU A;  2H6B A;  3HKZ N;  5C4X J;  2JSC A;  1MBG A;  4CYD A;  2OJE D;  3I3L A;  1OLT A;  4IL6 C;  9ANT A;  1JUP A;  3GO5 A;  1IN5 A;  2X0L A;  3T8R A;  3FDY A;  1BJZ A;  4D0P A;  4NHJ A;  4DYR A;  3CCY A;  5E3N A;  1PUF A;  1CF7 B;  4G8X A;  1ETK A;  4B8X A;  4B47 A;  2DOA A;  1KQ0 A;  2HS5 A;  1JKP C;  3CCE I;  3HHH A;  4RGU A;  4PFO A;  1H0M A;  2V9K A;  5FKO A;  3JRB A;  4LG0 A;  2E34 A;  2QSF X;  1W5S A;  3VB2 A;  3HUG B;  3TOA A;  4FX4 A;  4IQJ A;  4E4H A;  3TO7 A;  3MVP A;  3REO A;  3O8H A;  1AKH A;  1AWC A;  2L7K A;  5F0H A;  3WG7 H;  3BC8 A;  5FLX K;  3IP4 B;  3LST A;  4W1U A;  2L0K A;  3E0J B;  1R1T A;  3BTL A;  4XLF A;  4NUB A;  2BY0 A;  1K83 J;  2STW A;  2JVG A;  2VBZ A;  3S8P A;  1D5Y A;  3F72 A;  1DQU A;  2QA4 I;  2OTL I;  1BJA A;  3H9Q A;  3QYF A;  1K61 A;  3HYI A;  4EMS A;  1Z3Y A;  2WAE A;  4W97 A;  1TWF J;  3KX2 A;  5IOZ A;  5KHD A;  2XF6 A;  3CLO A;  1Q1V A;  2PFB A;  1E17 A;  1MSF C;  1ZG3 A;  4EJO A;  2CW7 A;  2JRT A;  2GZW A;  2Y48 A;  2CSO A;  2LMD A;  1MDM A;  2Y0S A;  2MC4 A;  5EGO A;  1LDK B;  5ICG A;  1PP7 U;  2K85 A;  2ELH A;  2CQ7 A;  2K86 A;  5EEH A;  2VB6 A;  1ZGJ A;  1ZLK A;  3KZZ A;  1YX3 A;  2EJR A;  3T1B A;  3U9G A;  2R7Z J;  3N4M A;  1FSH A;  3NAU A;  3FK7 A;  3J7Z I;  1K78 A;  2P81 A;  2W25 A;  1T2K A;  1W1W E;  2QKL B;  1S3J A;  1ZAR A;  4LD5 A;  1IF1 A;  4YEL A;  1ZH5 A;  3GTM J;  4A3J J;  3F21 A;  3OSG A;  2Q8K A;  4C2T A;  3KYL A;  2HI3 A;  5DUI A;  1X2M A;  2F48 A;  5LEK A;  2H94 A;  1RNL A;  1EV7 A;  2NS0 A;  4Q5S F;  1LFB A;  2E1C A;  2K27 A;  4BKX A;  4MEY F;  1OYI A;  3ABU A;  3LQR A;  5EYR A;  4BGD A;  1MJA A;  3GTQ J;  2GBY A;  2QBY A;  3K2Z A;  4XNF A;  2R7S A;  4JX5 A;  3H0D A;  4A3K J;  2GXA A;  3D0S A;  1X1A A;  2OD5 A;  3M07 A;  4HSR A;  3OR1 C;  1TLH B;  1J9I A;  3HTS B;  4AU7 A;  1WVR A;  1GV2 A;  3RZO J;  5JFR A;  3OS2 A;  3PFY A;  5TGT A;  1TWH J;  3GYH X;  3CC4 I;  1T98 A;  3L00 A;  2TRT A;  5EZH A;  3K10 A;  3ZN1 A;  4BQO A;  4EGZ A;  1BA5 A;  3WU2 C;  2CJJ A;  3FMQ A;  4I02 A;  2EIJ H;  4C2M J;  5EEA A;  1A35 A;  3AL0 C;  3CD6 I;  2ZFW A;  4A2U A;  4B09 A;  1G3T A;  5GAG J;  3CUQ A;  2CV2 A;  2M1B A;  2NOJ B;  4GDF A;  3QU6 A;  2DMP A;  2YR2 A;  3E6D A;  1A5J A;  3ZMV A;  1POG A;  2P0W A;  3TO6 A;  1V5F A;  2E7X A;  1PUE E;  1TWC J;  2DA6 A;  2R7W A;  1MIJ A;  2K3P A;  2GA2 A;  2LOO A;  1XSX A;  4WCG A;  3OYE A;  4UY8 I;  2F5C A;  3PL8 A;  2PMZ A;  2HVR A;  1GVJ A;  1ORK A;  3Q5F A;  3IAM 2;  1LJ9 A;  4UUS B;  3EUH C;  5J4Y A;  3HGG A;  1RRJ A;  2JTV A;  3B6C A;  4ZJZ A;  1R7J A;  4M6Y A;  1MKM A;  4D5F A;  4BDY A;  4BHB A;  3ZQF A;  1ZTR A;  2VXD A;  3FIS A;  4A3E J;  2NVT J;  2LKX A;  4ASN A;  4Y52 J;  2VQC A;  1SAN A;  3OOU A;  5FB2 A;  2RQQ A;  3GTK J;  1LQ1 A;  4LK1 F;  5KCM A;  4M72 A;  1VQM I;  3E97 A;  3HBL A;  2ZXJ A;  1D3Y A;  1U0J A;  4C3J J;  1O3Q A;  1H9T A;  4CYC A;  1OCP A;  3KEO A;  4UB6 C;  4L5J A;  2KRF A;  2QQB A;  1R5G A;  3KIO A;  2L7F P;  2WV0 A;  2L5Q A;  1HKS A;  2Y0M A;  3C18 A;  1S5L C;  4PDK A;  1R23 A;  3GME A;  4G6Q A;  1G6N A;  4HQM A;  2HTJ A;  1FMV A;  4HST A;  4GCV A;  5F6F A;  2VBW A;  1TP4 A;  4E7I A;  1B72 B;  2DLL A;  2EFO A;  3I64 A;  1BR1 A;  2QEX I;  1W36 C;  4G94 A;  2BE5 F;  5K5Q A;  4C30 A;  4J19 A;  1NG6 A;  2UWM A;  2VJJ A;  5JLX A;  3TMO A;  4NB5 A;  1XDS A;  5LGU A;  1IGN A;  2KRH A;  2FML A;  1WPK A;  4UV8 A;  1YS6 A;  3ZPL A;  5FLX Z;  2R93 J;  3PUF A;  2KZG A;  2ISZ A;  3BTC A;  3DU6 A;  5E3L A;  4RAF A;  4HPQ A;  1X19 A;  2F5F A;  2IGK A;  3C2G A;  1DPR A;  1YW8 A;  4LLG F;  4XKB A;  3HG9 A;  4I99 C;  3GWZ A;  5BPD A;  4G12 A;  2V1X A;  1I50 J;  5LGN A;  1D5V A;  4PJM A;  4KMF A;  2D2W A;  1R5I D;  3DTK A;  5DS9 A;  1Q1H A;  3DKW A;  4G6T B;  3R6S A;  4ZZL A;  4LB6 B;  3JRI A;  2ZC2 A;  4KNY A;  4I01 A;  1ETO A;  1WJA A;  4ZYA A;  5D5V B;  3BR5 A;  3ZMS A;  3OY9 A;  1NHA A;  2OBP A;  3FXM A;  2E2H J;  2V26 A;  1QVU A;  3HOY J;  2DDA A;  2VIX A;  5HNH A;  1OCZ H;  1E3P A;  5F27 A;  1R1U A;  3QPS A;  3H3Z A;  3S3M A;  1X3U A;  2Z9O A;  5KK1 A;  5KVR A;  4RB1 A;  1BBY A;  3TBI A;  2CWE A;  2BY1 A;  2MGQ A;  3L1P A;  5J8F A;  2JUC A;  2G0E A;  1BI1 A;  2EIN H;  4HF2 A;  1B59 A;  3VYS B;  2DT5 A;  4AVZ A;  3RKQ A;  2EV6 A;  1TWG J;  4HF1 A;  1RET A;  1KYW A;  3CCU I;  3WOD F;  6PAX A;  1Z6T A;  1IZ1 A;  1OCC H;  2JJ7 A;  4NC7 A;  1RZ4 A;  5L3F A;  1IJW C;  1LEB A;  5E1W A;  1HA8 A;  1EH8 A;  4G7O F;  1QZE A;  3F0C A;  3QOP A;  5F1J A;  3CO6 C;  3BRO A;  1SMY F;  4LIV A;  3ZQL A;  1YX5 A;  1JXS A;  3CME I;  1FZP B;  1FJL A;  2VJI A;  1R58 A;  2EZL A;  3BJO A;  3KP5 A;  4EV0 A;  5B66 C;  1IDZ A;  5DCM A;  3V8L A;  5E8G A;  3OYJ A;  4CSW A;  3QYE A;  1U5T B;  2JT1 A;  4HYE A;  2EZI A;  2OCC H;  3GTJ J;  1BW6 A;  4WX9 A;  2NOG A;  1O3R A;  1X1P A;  2DOE A;  1ERD A;  4A69 C;  4UVC A;  1IW7 F;  4IZZ A;  2HQR A;  2YS9 A;  1JHF A;  2QZ8 A;  4I0B A;  3ZCO A;  3CCS I;  1Z6R A;  4ZDO A;  1E0E A;  5H6Q A;  2HVQ A;  2NVX J;  4C9Y A;  2XRO A;  4ESJ A;  1CGP A;  4AIJ A;  5LHG A;  1T38 A;  1VQ8 I;  1F1Z A;  5IP7 J;  4E7S A;  4XSZ F;  4V19 K;  3HTU A;  2M7B A;  2HKX A;  4MHG A;  4E70 A;  4BL0 B;  2Z16 A;  3LSR A;  1ENH A;  4AYB N;  2Y31 A;  3QQA A;  2R7V A;  4M6X A;  2GIV A;  1XGO A;  2W00 A;  1SVM A;  3FBI B;  1W4M A;  3WTS C;  5KAI C;  1FBU A;  1MGT A;  2FOK A;  4XKV A;  2PJR B;  1IN8 A;  1TQI A;  1LDD A;  2E35 A;  4HRI A;  3V8K A;  4BBS J;  4II2 A;  1WRJ A;  4IOC F;  4ZTF A;  1U2W A;  2W85 A;  3U2R A;  1ZRF A;  3W6V A;  1ACI A;  1SFO J;  5KNL A;  3HOX J;  5J1Y A;  1B8I A;  2AXL A;  4PZJ A;  4JX6 A;  3CJT B;  5LEJ A;  2DA7 A;  1R22 A;  3SEZ A;  4TV7 A;  4AWX B;  1YLF A;  3Q3S A;  1A6Q A;  2DOD A;  2QQ8 A;  4GYI A;  1XTA A;  4KIF A;  1V55 H;  3RJP A;  2W84 A;  4F7Z A;  3LAP A;  1QPI A;  4JBA A;  4UXN A;  2X51 A;  4KN4 X;  1IRX A;  4IF4 A;  4XON A;  1Z7U A;  3FK6 A;  3G2B A;  3TOB A;  4S0H B;  4BE0 A;  2BXY A;  1AOY A;  5C44 J;  2EPF A;  4BXF A;  1JT0 A;  4M3F A;  5EZG A;  1EH7 A;  4WXD A;  3DV8 A;  2GA1 A;  3GFJ A;  4DQ2 A;  3H5R A;  5EG0 A;  2FQ4 A;  2X1E A;  1TT5 B;  4S04 A;  1XGM A;  1Y8Q B;  1DUX C;  3K69 A;  1D1C A;  1WZ2 A;  1LEA A;  2OAZ A;  4PSX A;  3S14 J;  5IT3 A;  4B43 A;  1MZB A;  4Q47 A;  4EJU A;  1X1C A;  3BP8 A;  3ZQG A;  2QSG X;  2P6S A;  2JMW A;  3DPL C;  4PUS A;  4Z6Y A;  3H36 A;  4I76 A;  4P55 A;  1YW9 A;  1R1V A;  1ZEL A;  4XQF A;  1T08 B;  3GZ6 A;  1Z91 A;  4BDZ A;  1IV8 A;  3KP6 A;  5J1U A;  4M74 A;  2XC7 A;  1NTC A;  3J80 K;  1W0U A;  1OFC X;  5A2Q K;  2VOO A;  1DP3 A;  3S3O A;  1MJB A;  3MWM A;  4RB3 C;  2XPV A;  4OAZ A;  3GLX A;  1LUJ B;  1ZGW A;  1D8J A;  5LFA A;  2XB0 X;  4IHY A;  1QQI A;  3FM3 A;  2ID6 A;  4RMN A;  1ETW A;  5C3E J;  2K7L A;  3I53 A;  3I4N J;  2IBD A;  4EJV A;  4RBO A;  2BW3 A;  2A6H F;  4J00 A;  3DKY A;  3SZT A;  1GXQ A;  4E7J A;  1TT0 A;  2DOF A;  4QWQ A;  1WJC A;  4YG2 F;  1IRG A;  1FMW A;  2R7U A;  2HZT A;  1KQ8 A;  3FKJ A;  3SHF A;  5GPC A;  2LVS A;  2IRF G;  1N25 A;  2GLO A;  2DT7 B;  1UG2 A;  4I2O A;  3A4C A;  1RC9 A;  4XRM A;  4ZYG A;  1B4A A;  1N75 A;  1O7F A;  3KP2 A;  4PSW A;  4ON0 A;  3OYM A;  2QM3 A;  3BT9 A;  3V4G A;  3ECH A;  3DU5 A;  1FSE A;  2VQL A;  2R7Q A;  4EEF G;  2E2I J;  2EH3 A;  1GDT A;  1X1B A;  2MAB A;  2QVO A;  4MFE A;  1VQK I;  1RR7 A;  1BIA A;  4YII A;  2ZME A;  1OJL A;  2MC3 A;  4JK1 X;  3HC7 A;  2KHM A;  4L9N A;  1XMA A;  3CCJ I;  5J40 A;  4NC6 A;  1BR2 A;  1ZQ3 P;  3E5U A;  1A36 A;  2JZY A;  1MBJ A;  1XD7 A;  1QGP A;  2VT2 A;  3F6O A;  3R0A A;  1S72 I;  4C3H J;  3CMA I;  3HOS A;  1I6H J;  2DMQ A;  2VKV A;  3KP7 A;  3K0L A;  3TL4 X;  2OU2 A;  1I3Q J;  2XV4 S;  3W2A A;  4XRS G;  3HOU J;  2NVQ J;  3FXK A;  4PCQ A;  5HLI A;  3V7R A;  4HA8 A;  1DU0 A;  4Y15 A;  1RPW A;  3HB9 A;  3JRD A;  2GIZ A;  3PUB A;  2L4A A;  2ZJ2 A;  3ZN0 A;  2F4O B;  2X1C A;  2X85 A;  3C7J A;  3DXJ F;  5HNF A;  2X4H A;  4BJT A;  2JVH A;  1TQM A;  2ICW G;  3GBG A;  4BEH B;  4CA0 A;  1WJD A;  2DMT A;  2KZV A;  3RPU D;  3H1C A;  3VOE A;  2JUG A;  2OV7 A;  1MH4 A;  1P7I A;  2KL4 A;  2WA0 A;  1Z67 A;  2HOE A;  3J81 Z;  2BZT A;  2ECC A;  4XR6 A;  1TZL A;  3CQZ J;  1MMN A;  4LFU A;  4H4K C;  1JKO C;  1QBJ A;  3SDG A;  4BY1 J;  2KDO A;  1ZAO A;  1G2H A;  2WY8 Q;  1H9G A;  3S1N J;  2E1N A;  2N8G A;  5FD6 A;  3PIO F;  1F36 A;  1MBE A;  1T0F A;  3HRT A;  4KIC A;  2PMH A;  3A01 B;  4HF0 A;  5JHF A;  2K9S A;  5IYB J;  1U5T C;  4Y4R A;  3LWF A;  2UXX A;  3Q9S A;  3DEU A;  3MMY B;  1IC8 A;  2FF4 A;  1SFK A;  5IP9 J;  3EYI A;  1ON2 A;  2V1D A;  5K7H A;  1ZG1 A;  3OWT A;  2K9L A;  4D7M A;  2XAQ A;  2M2E A;  3I9V 2;  2ZSH B;  4HX4 A;  4WXC A;  1FOX A;  4WXH A;  3FBN B;  4M9X A;  1IXC A;  4CCN A;  2O61 A;  1X58 A;  4HX8 A;  1R6R A;  4HDU A;  2D1H A;  2EZK A;  3BJA A;  2NNN A;  1SD4 A;  3J80 Z;  3F8M A;  1WJB A;  3ZXS A;  4KJZ A;  1NG7 A;  3CMY A;  1Y0N A;  2BY2 A;  3X2Q H;  5FLM J;  3JRH A;  1RES A;  3I54 A;  1YW7 A;  5AIQ A;  1FEX A;  1A04 A;  1ZRE A;  2GOX B;  2FQ3 A;  2JSP A;  2VE9 A;  3G3Z A;  4FHT A;  3T5X A;  4N4O B;  2VN2 A;  3W6J B;  1KU9 A;  3MN2 A;  3MAJ A;  2DU9 A;  4BHP A;  5J8C A;  4IHX A;  3SFZ A;  2XIG A;  5C4J J;  3GTL J;  4KT6 A;  2CRG A;  1LFP A;  4OMY A;  2LH9 A;  2XRL A;  3DEE A;  5GTH C;  5JVG F;  1S6L A;  1J7K A;  1GT0 C;  3G1L A;  2K3F A;  2VQG A;  4D5C A;  5B1A H;  1HQC A;  1YIJ I;  1H89 C;  5DEQ A;  1QZZ A;  2XHK A;  4UVA A;  1HST A;  4XLP F;  2DQR A;  1MMG A;  1T6S A;  4WK8 F;  1QU3 A;  3RQI A;  3BR3 A;  3FIW A;  2WB1 N;  5ILU A;  2LBF A;  3ERE D;  4AVP A;  3MQ0 A;  4RAG A;  2HGC A;  4EM1 A;  3BOQ A;  1LVK A;  3I55 I;  3SYT A;  2K9Q A;  2R92 J;  2DYS H;  3HIF A;  2QWW A;  4OIO F;  1JT6 A;  4M3G A;  2CV1 A;  2L7M P;  3EDP A;  2DW4 A;  5JVT A;  1UST A;  5EF6 A;  1SVO A;  1A6I A;  1ZRD A;  3JAM K;  4HV5 A;  4XKW A;  5L3D A;  4HNV A;  3NEU A;  4E6K G;  2I8D A;  2BHZ A;  1OKR A;  5JR3 A;  5EDN A;  1HCR A;  2I5U A;  2HDD A;  4RB2 C;  1JTY A;  3HZJ A;  1EH6 A;  4ZTJ A;  4BNC A;  5IP6 A;  1YS7 A;  2LY2 A;  3HUG A;  2H6C A;  2EIK H;  4HV6 A;  1Z9C A;  4BJ6 C;  3GTG J;  2M4G A;  1XDU A;  3LMM A;  1UG0 A;  2YX7 A;  2E36 A;  2Y30 A;  4U88 A;  1U8R A;  2H1L A;  3HEF A;  4ZDP A;  1OR7 C;  4DW6 A;  5HLG A;  2KIS A;  2XRN A;  5TRD A;  3O3K A;  1GV5 A;  1DGR M;  1XC5 A;  2GXB A;  2VE8 A;  5HLT A;  4FE7 A;  3RSN A;  2FOW A;  2HQN A;  3KLN A;  4IHT A;  1QRY A;  2COM A;  1TBX A;  4M73 A;  1QPM A;  4EM2 A;  4ENJ A;  1PUF B;  2O7O A;  2RRE A;  2WV1 A;  4BY7 J;  2FNP A;  3MZY A;  3PQJ A;  4A12 A;  3MZH A;  3MZ8 A;  3TQN A;  3BZK A;  3RPQ A;  2IS4 A;  4Y13 A;  3MEX A;  2EWN A;  3OYG A;  1W7P A;  1KU3 A;  2X6Y A;  1Y56 A;  3BZC A;  3U21 A;  2ZXH A;  4LG0 B;  1RI7 A;  1F9N A;  1TW3 A;  2LYC A;  2K4J A;  4OIR F;  4XIC A;  2CH0 A;  3OS1 A;  3NWS A;  4FE4 A;  4P9F A;  1AKH B;  2R7D A;  2NNY A;  4U87 A;  4BJ5 C;  4L0Z B;  2O8X A;  5H20 A;  3MKZ A;  3LSI A;  4IX7 A;  2NVY J;  1J09 A;  2ADU A;  2IA1 A;  5D6F A;  1YIO A;  1WH5 A;  2LP0 A;  2MLK A;  3RKY A;  5D4R A;  1FY7 A;  4UV9 A;  3OYA A;  4XSX F;  1J5Y A;  3H92 A;  2JWT A;  3LOC A;  3PFI A;  1D1A A;  4MGR A;  1W5C C;  3K4K A;  2W82 A;  2MA3 A;  4NDL A;  1LKX A;  3IUO A;  4MTE A;  3TED A;  2HYF A;  1MDM B;  3LFK A;  2YPR A;  3BWG A;  4LMY A;  5EGO B;  2KT0 A;  2KJB A;  3CUO A;  1BI3 A;  5CVV A;  2RN7 A;  3PNY A;  2FSW A;  2ZSI B;  1K78 B;  3QWL A;  3ASO H;  2ACJ A;  2IVM A;  3ABK H;  2EFQ A;  4CHU A;  3U1K A;  4S05 A;  1K79 A;  3WE3 A;  4CCJ A;  1DU6 A;  1IN7 A;  3C2B A;  3ONQ A;  1VFC A;  3H5N A;  1R49 A;  1V4R A;  1IDY A;  1WJ5 A;  3G6E I;  2NXN B;  1IN6 A;  1VQP I;  5L3G A;  3I4P A;  3KP4 A;  3C3W A;  5KAF C;  3BLY A;  3QAH A;  2QBY B;  5HVQ C;  2DPU A;  2I10 A;  1SMT A;  2Z5U A;  2L54 A;  1YI2 I;  1D0Y A;  1GUU A;  1TTY A;  3CLQ A;  1FIA A;  2LKS A;  3VDX A;  3RKX A;  2IJL A;  2CQK A;  2XKP A;  4OOI A;  3MFK A;  3ZQC A;  2IA2 A;  3OIP A;  2M45 A;  2VJ5 A;  3VSL A;  3WE2 A;  5FKK A;  2QUF A;  5M3F J;  4FCY A;  1S7O A;  4A3D J;  3LSH A;  2OC6 A;  1GHC A;  2YX4 A;  4JQF A;  4N9H A;  3BG5 A;  4N4N B;  4L9J A;  2R5Z A;  2DJI A;  3QP5 A;  2DK8 A;  5F0F A;  1X1D A;  3BR2 A;  4BAY A;  4IPA A;  4A0Y A;  1O4X A;  5IOY A;  2A61 A;  4PGG A;  4WF2 A;  3CUQ B;  1ETQ A;  4A6D A;  5IT9 K;  3CCV I;  3JAM Z;  3DWL E;  2FU4 A;  4MFD A;  5DM7 F;  4BBR J;  1I39 A;  3PJR A;  2XAG A;  1G4D A;  1P4A A;  4XOP A;  4DYC A;  2CUF A;  3WTY C;  3BPX A;  4UB8 C;  2NYX A;  3WU0 A;  4X0G A;  1RKW A;  1KZH A;  3BJ6 A;  3JRF A;  2HPM A;  4MO7 A;  3WTT C;  3V8J A;  3BCB A;  1U3E M;  2NAZ A;  2PJP A;  1UEL B;  3ZGK A;  3I71 A;  3ROU A;  1VQ4 I;  3V7S A;  4A0Z A;  3S2W A;  3GF2 A;  1ZLJ A;  1R36 A;  2J5P A;  4LG3 A;  2DTR A;  3IRR A;  5LRR A;  4XMY A;  2MD0 A;  3Q0V A;  1YJN I;  4IVN A;  2Y9Z A;  2ID3 A;  2M0M A;  2QCO A;  4CYC B;  2P7V B;  3RPU A;  2WAD A;  5JLW A;  1KON A;  2K02 A;  2X6X A;  5CYV A;  3L2W A;  1ODD A;  2R7O A;  2DA1 A;  3HL2 A;  1YQA A;  1D0X A;  1BM9 A;  1UHM A;  4EVI A;  4F93 B;  4BE1 A;  3LQQ A;  2Q2E A;  4A3M J;  2BHY A;  3LA2 A;  4QPQ A;  1OYY A;  1K4S A;  3ML6 A;  4KYW A;  2JRM A;  5F08 A;  4F52 A;  5D8K B;  2JPC A;  2K4B A;  2M8E A;  1I1G A;  1YHQ I;  1DDN A;  1R5H A;  2P4W A;  2KKO A;  1W0T A;  3CES A;  1APL C;  4Q4Z F;  3QP6 A;  1ZYR F;  2DXI A;  1NK3 P;  1UJ8 A;  3F8F A;  2P5L C;  4E7Z A;  5DD8 A;  1QNT A;  3B02 A;  1Z77 A;  2HVS A;  3CJN A;  3E5X A;  3OL3 A;  5EEG A;  4D7N A;  2MH2 A;  3G4S I;  2CMP A;  1QHH D;  1FPQ A;  1P4W A;  4BAC A;  2NS8 A;  1Z7L A;  3GFL A;  4F92 B;  3H0G J;  1YO5 C;  1F5T A;  3GX4 X;  3VPR A;  3E6C C;  3I0T A;  2LSO A;  1M1E B;  2X6O A;  1BC8 C;  5FJ8 J;  1E3H A;  5E79 C;  2VC0 A;  2COB A;  4DBQ A;  5TJJ A;  1YOV B;  2ZJP F;  4L0Y B;  4B4C A;  2WAQ N;  3OL4 A;  3OOP A;  1K7A A;  3S3N A;  4FAS D;  5K7Z A;  2Z33 A;  4B3X A;  2RKH A;  1IN4 A;  4G9Y A;  2EV5 A;  3K70 C;  3L09 A;  4YRV A;  3L2C A;  1QHG A;  2OZU A;  1CQT A;  2O8K A;  3OIQ A;  1TNS A;  1ITY A;  2LC2 A;  1P7J A;  3PO3 J;  1WI9 A;  3VSK A;  3CTA A;  2KQR A;  2DA4 A;  3CP8 A;  4RDU A;  1V3F A;  3BCA A;  1G8X A;  2MYS A;  5E18 F;  2R7X A;  3KP3 A;  2L2O A;  3E6B A;  5FKN A;  4PJ0 C;  1Y1V J;  2DFF A;  3OYB A;  3E7L A;  1KYZ A;  3LA3 A;  1G3S A;  3LSK A;  4II3 A;  1HDD C;  2JA8 J;  4I6Z A;  2DO7 A;  2LKP A;  3WTZ A;  2XGC A;  1P92 A;  3IC7 A;  2XAS A;  3M3Y J;  2G7H A;  4FT8 A;  5BPI A;  2OZ6 A;  4MQV A;  1FBS A;  1KGS A;  1OPC A;  2L4M A;  4LIU A;  2HXI A;  3FXL A;  4MIM A;  4ZYD A;  4U7D A;  2O0Y A;  5DCM B;  5IT9 Z;  4WWC A;  4CH7 A;  3ELK A;  3WTU C;  1YYV A;  3W2W A;  3W3C A;  3OIO A;  3DLA A;  3A2K A;  4IHV A;  3SQN A;  2F4M B;  4HZF A;  3NAR A;  1Z21 A;  3IKV A;  3JSO A;  4KFC A;  1IV6 A;  2HDW A;  5FO5 A;  1U78 A;  1B1B A;  1OYW A;  2OF7 A;  1MW7 A;  4LJZ F;  3TP3 A;  5D5X B;  1UHS A;  4L5E A;  3TDZ C;  2RAE A;  3LSJ A;  3E3V A;  1XX5 A;  3JR9 A;  2UZK A;  3BDD A;  2VBX A;  2CQN A;  4BU2 A;  4JOM A;  3PIP F;  2GM4 A;  2QKM B;  4PFP A;  4FTH A;  3GCM A;  2B9S A;  4RM3 A;  3J81 K;  2WY7 Q;  1TL8 A;  1W7P D;  4V2G A;  3VYR B;  4KUM A;  2L9S A;  3F8C A;  2MG4 A;  4Q48 A;  2HZD A;  1U9N A;  2XB5 A;  2ZNY A;  4AD9 A;  2JA2 A;  1YJW I;  4MTD A;  1J0R A;  1QVT A;  2KP6 A;  2Z99 A;  5GP9 A;  1Y1W J;  2XAF A;  1ETX A;  1XG1 A;  3ESW B;  1S9H A;  2B63 J;  4O3M A;  4JX4 A;  1B8I B;  4BXX J;  1WJE A;  4PJJ A;  2K9M A;  5CKT A;  1OCR H;  4RAY A;  2IGM A;  3QOE A;  3ERM A;  1FLI A;  4A3L J;  1T56 A;  3BG6 A;  3EUA A;  2E5N A;  4XM3 A;  2A05 A;  4RGR A;  1BW5 A;  5ED4 A;  4FX0 A;  3OYL A;  4R79 A;  1HF0 A;  2ZB9 A;  3OYH A;  2JA7 J;  1LPQ A;  4KIB A;  3ZMT A;  3ZQI A;  5HS8 A;  5GAE J;  5LHI A;  4U0Y A;  4KA4 A;  4O5V A;  3K4C A;  2BV6 A;  3TGN A;  4DGW B;  2YU9 J;  2EV0 A;  1MBH A;  3CUQ C;  2P7C B;  4ESB A;  2EIM H;  5EG0 B;  2KIQ A;  2Y9Y A;  3PSF A;  2EA4 A;  3I5U A;  2OPT A;  1X2N A;  4HG2 A;  4DYQ A;  1K6O A;  2PN6 A;  5DUK A;  4I0A A;  1JHH A;  1P9Q C;  3WTV C;  4CIC A;  3HOV J;  4L18 B;  2RV8 A;  4KDP A;  2BY3 A;  1DP7 P;  2M30 A;  3F23 A;  2HOT A;  3W2V A;  1YFH A;  2VLA A;  1P2F A;  5DV5 A;  3BR0 A;  1ON1 A;  3Q9V A;  1MBK A;  4RAZ A;  1J2X A;  1MBF A;  3FXQ A;  3H35 A;  4CDG A;  2ZO4 A;  2L9N A;  3J7A O;  3WU1 B;  2LNB A;  1MMA A;  3HRS A;  1E3O C;  1U9O A;  5HS9 A;  1WSU A;  3U1D A;  1LFU P;  1XMX A;  5HDG A;  2W7N A;  4I7H A;  3S16 J;  2VPL A;  1RUO A;  2O03 A;  2V6E A;  1O7L A;  2QEN A;  2VXZ A;  1KQ9 A;  2KDZ A;  2ZNZ A;  5E17 F;  2JK3 A;  2BW3 B;  1IAW A;  1IRF A;  2XPU A;  2XGD A;  2ZXI A;  1ONV A;  1RUN A;  3ZMU A;  1JTX A;  1XS9 A;  3KFW X;  3IWZ A;  2PBI A;  4IEJ A;  3A0B C;  1G3W A;  2MSY A;  2IW5 A;  3DTE A;  5EJC A;  1PP8 F;  3VYT B;  3DFG A;  5J47 A;  1PDN C;  2E1M B;  3FX3 A;  3JTH A;  1UAA A;  4IJA A;  4BQQ A;  3IHU A;  5LLQ A;  3N97 A;  4KIT B;  3S1R J;  4A3B J;  2VON A;  5IY5 H;  2V9V A;  5H6R A;  4HOB A;  1C0W A;  1VQO I;  2JA6 J;  3DBH B;  4FQG A;  3WHB A;  3ABM H;  5M3M J;  4IHS A;  4QIW N;  1D1B A;  2R5Y A;  3HSE A;  1XSV A;  2FNA A;  3FWE A;  2EFP A;  1T33 A;  3MCZ A;  5DYM A;  4BEH A;  4F91 B;  2FEZ A;  2ECB A;  5M5X J;  2ZME B;  2V7F A;  1RIO H;  2XSJ C;  3G71 I;  3M8E A;  2W57 A;  5HDK A;  3KZI C;  4FIS A;  1YE9 A;  4OIP F;  2FRH A;  1HSJ A;  1EA3 A;  3PNT A;  5CVJ A;  4MLO A;  5K5O A;  3GFI A;  1R71 A;  4NQW A;  2HQA A;  3IH3 A;  1HC8 A;  1H8A C;  1SD5 A;  2E1O A;  4U0W A;  1NH3 A;  2V4J C;  2W24 A;  1JKQ C;  4OWR B;  1I27 A;  1R4M B;  2EBI A;  1ZR2 A;  4BQN A;  3EUH A;  2VOD A;  4ETS A;  5TIS C;  1UCR A;  3HM5 A;  3K4J A;  4EM0 B;  4OMZ A;  3UNG C;  1EKE A;  1VF9 A;  3L9F A;  2AXT C;  4LIT A;  2ESN A;  2ZFU A;  3E5Q A;  3HPH A;  4BHC A;  4CCO A;  1IXS B;  1SFE A;  3P9C A;  4XN0 A;  2HOA A;  1SC7 A;  1WH7 A;  3FHN A;  3WGH A;  4GXO A;  4ZDL A;  1SEU A;  1F4K A;  3M1E A;  4AM3 A;  3G73 A;  5AIP A;  2GXG A;  2VC1 A;  4G7H F;  1JGS A;  2BEO A;  2EA2 A;  2OA4 A;  4FET A;  2LRE A;  2ZJR F;  5ICF A;  4M9Z A;  2B7E A;  5D6E A;  3HSR A;  3D5S C;  3ABL H;  2L3D A;  5J1R A;  4L5I A;  3A03 A;  2V9P A;  5BMZ A;  2KRC A;  4OIQ F;  4DIQ A;  3H5A A;  3FHZ A;  5HLH A;  4MEX F;  1EF4 A;  3R61 A;  2CQX A;  3RYR A;  4P9U A;  3S32 A;  1BN5 A;  3OYI A;  3WTW C;  4XOT A;  1FOK A;  1Z1D A;  3CC2 I;  1RKT A;  3TO9 A;  3CCL I;  1JE8 A;  2ZKZ A;  4RGX A;  3HKZ A;  5GAD J;  1VQL I;  1QZY A;  4ZYH A;  3B73 A;  5E3O A;  3I59 A;  3HPG A;  2X48 A;  4G7Z F;  2W48 A;  3HRM A;  3DPU A;  3B6A A;  3Q0W A;  2KJC A;  4U7B A;  3HOZ J;  1YRN A;  2ME0 A;  2G7U A;  3GZN B;  1LE8 A;  1VQ7 I;  4A3G J;  3A0H C;  2CUE A;  2KMU A;  2ZXW H;  3FMR A;  2DMU A;  5BS6 A;  4KIG A;  2CW0 F;  3TW6 A;  3FXJ A;  1VQ5 I;  4IKF A;  3E1S A;  3ASN H;  1VTN C;  2ME6 A;  4YIR X;  1FWZ A;  1ZRC A;  3WGG A;  4UNO A;  1XSD A;  5GPA A;  3TW7 A;  3M4O J;  4IO9 F;  1Z0X A;  4RA2 A;  2CO5 A;  2X6W A;  3CP2 A;  4P1W A;  3ZQQ A;  2QYO A;  4QLC U;  1JUM A;  3F9K A;  5CQG A;  3CCM I;  1IG7 A;  1WWX A;  4KN7 X;  2HEO A;  2QLZ A;  1CF7 A;  2YSR A;  1ETY A;  2NVU B;  3KEY A;  1U6G A;  5K1Y A;  4HEA 2;  4M6V A;  2LG4 A;  3LSM A;  4CZZ A;  2ESH A;  3ZOB A;  4F3Q A;  3OMY A;  5HOD A;  1SAX A;  5B5E C;  1HLV A;  2UXN A;  1LVA A;  4L9T A;  4DZP A;  4C2U A;  1B9N A;  3DF8 A;  3HOT A;  1BL0 A;  3FMS A;  1QO0 D;  4N9I A;  5J3L A;  1WGX A;  2VKD A;  1Z3X A;  1ZHF A;  3A1Y A;  4XLN F;  1GLN A;  4AIH A;  2AQF A;  2LBF B;  3MKW B;  3AG2 H;  1WCM J;  1S29 A;  2A69 F;  4BE2 A;  1VI0 A;  1IRZ A;  2DFH A;  1TWA J;  2XAJ A;  2A5Y B;  1ZN2 A;  2HYG D;  2HNH A;  4QTR A;  2VOP A;  4NNJ A;  4AIK A;  1XB4 A;  2DFI A;  5CVI A;  1HOM A;  1SVL A;  1AHD P;  2LFB A;  2R0Q C;  1W5T A;  4ESF A;  2EFW A;  3CMM A;  1FT9 A;  1FYM A;  5BQT A;  1SD6 A;  2Z3Y A;  1X4O A;  1B6A A;  1IXR C;  1T95 A;  3QPL A;  4XRF A;  1SAU A;  2F5V A;  3S15 J;  3SJM A;  3BR6 A;  1TC3 C;  3L7W A;  1I5Z A;  2ELJ A;  3RI4 A;  3CF5 F;  5LRS A;  2XDV A;  2BBY A;  2WBM A;  3CDL A;  2RVC A;  4A93 J;  4OIN F;  2XGX A;  1JJ6 C;  2HWV A;  4XLE A;  2Z1D A;  1OCT C;  1FBQ A;  1KU2 A;  2M4K A;  4RM2 A;  2C6Y A;  3MKY B;  1ZK8 A;  1OIS A;  2LD5 A;  3M8F A;  1STZ A;  4N0B A;  2E1M C;  3R0J A;  1JJ8 C;  2HKO A;  4A3I J;  1BI0 A;  2H09 A;  2MBF A;  3AFH A;  3EPZ A;  3SXY A;  2KIF A;  2X1D A;  1XPX A;  4BXU A;  2OQR A;  1G3Y A;  2F6C A;  1IO2 A;  3D5L A;  1W7P B;  3JTG A;  4B1R A;  1WFX A;  1MD0 A;  1ZGA A;  2A3S A;  4O6J A;  3VEP A;  4YFN F;  2LLK A;  2A6E F;  1H88 C;  3K4N A;  3O8G A;  4G6D A;  1ZKG A;  5F0C A;  4ANJ A;  2ZME C;  4XLC A;  1FTZ A;  2DPD A;  4CCK A;  2LDU A;  2LY1 A;  3FM5 A;  2DA3 A;  3K4M A;  3RQ4 A;  2IXS A;  2WWY A;  1RR8 C;  3S2D J;  4GFB A;  1UZC A;  3NWT A;  3WG9 A;  2L9V A;  2JQ7 A;  2Q1Z B;  4YEJ A;  1V5G A;  3K4L A;  1MJ9 A;  3HDD A;  3CDI A;  5AON A;  5HDN A;  3DTI A;  1XN7 A;  3K1P A;  1GXP A;  4NC8 A;  4ENM A;  3K4B A;  2Y0S N;  5E1X A;  1TQP A;  2BVM A;  4UUS A;  2E5Z A;  3IH4 A;  2GWR A;  1HW5 A;  2DA2 A;  2R3S A;  3IV5 A;  3ZQ7 A;  3FXO A;  5K5R A;  4ENN A;  5FRO A; 
#chains in the Genus database with same CATH homology
 1P7J A;  3PO3 J;  1MH3 A;  2DA4 A;  2VKE A;  4JYK A;  2FD5 A;  4RDU A;  3BT9 A;  3SFI A;  2NS7 A;  2LR8 A;  4Y7N J;  3K7A J;  4EEF G;  2HXO A;  5FKN A;  2E2I J;  2EH3 A;  1GDT A;  3BG3 A;  4MFE A;  1F43 A;  1Y1V J;  1RR7 A;  3E7L A;  5IYC J;  1YRN B;  1OJL A;  1LE8 B;  1HDD C;  2JA8 J;  4I6Z A;  4M3E A;  2XGC A;  2XSD C;  2DN0 A;  3M3Y J;  2ELK A;  2QF7 A;  3FKI J;  1IUF A;  1ZQ3 P;  2XGE A;  1MBJ A;  2D5V A;  2HXI A;  4MIM A;  3HKZ N;  1B72 A;  5C4X J;  1MBG A;  4C3H J;  2X9D A;  1I6H J;  2DMQ A;  3OIO A;  9ANT A;  2VKV A;  4IHV A;  1JUP A;  3S1Q J;  3NAR A;  1BJZ A;  1I3Q J;  3HGY A;  4XRS G;  4DYR A;  3CCY A;  2NVQ J;  3HOU J;  1IV6 A;  3G1M A;  5E3N A;  1U78 A;  2OF7 A;  3TP3 A;  1PUF A;  1DU0 A;  2R5Z B;  1RPW A;  1UHS A;  1ETK A;  4L5E A;  2RAE A;  3HB9 A;  1S7E A;  3LSJ A;  3JRD A;  3JR9 A;  5IYD J;  2DA5 A;  1JKP C;  3DCF A;  2GM4 A;  4FTH A;  1R9T J;  3GBG A;  2DMT A;  5FKO A;  3JRB A;  2PMZ N;  2FJ1 A;  4V2G A;  3MVP A;  4AUX A;  1MH4 A;  1P7I A;  2MG4 A;  3O8H A;  1AKH A;  5F0H A;  3D1N I;  4W1U A;  2ECC A;  2L0K A;  3BTL A;  3CQZ J;  1U9N A;  2XB5 A;  1JKO C;  1K83 J;  3SDG A;  3S17 J;  4BY1 J;  1HDP A;  1QVT A;  5BNG A;  5GP9 A;  1Y1W J;  1G2H A;  1ETX A;  1XG1 A;  3S1N J;  1D5Y A;  2B63 J;  2N8G A;  4JX4 A;  1B8I B;  4BXX J;  1F36 A;  1MBE A;  1K61 A;  1VND A;  3A01 B;  4W97 A;  1TWF J;  5IOZ A;  2K9S A;  5IYB J;  4A3L J;  1T56 A;  1Q1V A;  1MSF C;  1FTT A;  1BW5 A;  1IC8 A;  4X1E A;  5IP9 J;  5EGO A;  1HF0 A;  2ZB9 A;  5M5W J;  5K7H A;  2JA7 J;  2YUS A;  2R7Z J;  3ZQI A;  3NAU A;  3FK7 A;  4D7M A;  2P81 A;  4IHW A;  3ZQH A;  2K9N A;  2M2E A;  2YU9 J;  1MBH A;  3GTM J;  4A3J J;  3OSG A;  1X58 A;  5EG0 B;  2HI3 A;  2Y9Y A;  1X2M A;  2EZK A;  2OPT A;  1X2N A;  1LFB A;  2IEK A;  4DYQ A;  3CMY A;  4BKX A;  5E3M A;  4AC0 A;  5EYR A;  3JRH A;  5FLM J;  1RES A;  5K7F A;  3HOV J;  1WI3 A;  3GTQ J;  1FEX A;  2GBY A;  2HOT A;  3S1M J;  4JX5 A;  4A3K J;  2O9L A;  3BR0 A;  1JGG A;  1U8B A;  1MBK A;  1MBF A;  1GV2 A;  3RZO J;  3MN2 A;  4IHX A;  5C4J J;  1TWH J;  3GTL J;  4QSH A;  1UMQ A;  1E3O C;  2CRG A;  1U9O A;  2TRT A;  1LFU P;  5EZH A;  2XRL A;  3S16 J;  1BA5 A;  2CJJ A;  4C2M J;  1GT0 C;  3G1L A;  5EEA A;  4D5C A;  2KDZ A;  4LOC A;  3GTP J;  2DJN A;  1H89 C;  2JK3 A;  2DMN A;  2FX0 A;  2DMP A;  1A5J A;  2XPU A;  1POG A;  2XGD A;  1TWC J;  2DA6 A;  3RQI A;  3HOW J;  1JTX A;  1XS9 A;  3BR3 A;  3FIW A;  4IEJ A;  2WB1 N;  2MSY A;  1ORK A;  2MW8 A;  4UUS B;  1JUS A;  3PO2 J;  4A3C J;  3HGG A;  3IH2 A;  2K9Q A;  2R92 J;  3B6C A;  3S1R J;  3JRG A;  4A3B J;  1FIP A;  4D5F A;  1JT6 A;  4M3G A;  2L7M P;  2IAI A;  3ZQF A;  1ZTR A;  3FIS A;  4A3E J;  5EF6 A;  2JA6 J;  2LKX A;  3WHB A;  2NVT J;  1A6I A;  5M3M J;  1AU7 A;  4QIW N;  2R5Y A;  4Y52 J;  4HNV A;  1SAN A;  3OOU A;  3GTK J;  3K2A A;  2HDD A;  5EDN A;  1HCR A;  1T33 A;  1JTY A;  2VI6 A;  3HBL A;  2H1K A;  3RZD J;  2ECB A;  5IP6 A;  4C3J J;  5M5X J;  4CYC A;  1OCP A;  3GTG J;  2M9H A;  2LTP A;  4FIS A;  2DTZ A;  2L7F P;  4MLO A;  2Y30 A;  3HEF A;  1GVD A;  4DW6 A;  4M3B A;  3IH3 A;  2M0C A;  4DZJ A;  1B72 B;  1GV5 A;  1H8A C;  1XC5 A;  2E1O A;  4J19 A;  4FE7 A;  5JLX A;  1JKQ C;  1IGN A;  2EBI A;  1ZR2 A;  5F04 A;  1WPK A;  2JA5 J;  1QRY A;  2R93 J;  3HM5 A;  3BTC A;  1PUF B;  2O7O A;  5E3L A;  1VF9 A;  2WV1 A;  4BY7 J;  2K40 A;  2XPW A;  2L7Z A;  4G12 A;  2HOA A;  1I50 J;  2VUM J;  1WH7 A;  3JRE A;  5DS9 A;  4XIC A;  4FE4 A;  1AKH B;  3JRI A;  3BTI A;  2NVY J;  1ETO A;  1WH5 A;  3BR5 A;  2LP0 A;  2E2H J;  1QVU A;  4XID A;  3LSP A;  3HOY J;  2JWT A;  3LOC A;  3UKG A;  5J1R A;  2LK2 A;  2AO9 A;  3A03 A;  3S2H J;  5F27 A;  4NDL A;  3QPS A;  1MNM C;  3LNQ A;  1EF4 A;  2CQX A;  3TED A;  2HOS A;  2MGQ A;  3A02 A;  1RKT A;  5EGO B;  5FKM A;  3L1P A;  2KT0 A;  4UUT A;  5M5Y J;  2G0E A;  2E19 A;  5E3O A;  3RKQ A;  2X48 A;  2W48 A;  1TWG J;  2CQQ A;  2M8G X;  1RET A;  3WHC A;  3B6A A;  4V2F A;  3Q0W A;  3HOZ J;  1DU6 A;  2JJ7 A;  3C2B A;  4X6A J;  1YRN A;  1IJW C;  1VFC A;  1IDY A;  2ME0 A;  1LE8 A;  2H8R A;  4A3G J;  3F0C A;  2CUE A;  5F1J A;  2DMU A;  2JN6 A;  3ZQL A;  3TW6 A;  3OSF A;  1FJL A;  4JP0 A;  2I10 A;  2EZL A;  2ME6 A;  1IDZ A;  1GUU A;  1FIA A;  5GPA A;  3TW7 A;  3ZQC A;  3M4O J;  1Z0X A;  5M3F J;  2AHQ A;  4FCY A;  2HQ5 A;  2EZI A;  5FKK A;  1JKR C;  3GTJ J;  1BW6 A;  4A3D J;  1JUM A;  2NOG A;  3JRC A;  1IG7 A;  4A69 C;  3BG5 A;  2YS9 A;  2R5Z A;  1ETY A;  5F0F A;  2LY9 A;  3BR2 A;  4M6V A;  2NVX J;  1O4X A;  5IOY A;  1ETV A;  3ZOB A;  5HOD A;  5IP7 J;  4M3D A;  1ETQ A;  1HLV A;  3LSR A;  4DZP A;  4MFD A;  1ENH A;  1BL0 A;  4BBR J;  4AYB N;  2Y31 A;  3QQA A;  5J3L A;  1WGX A;  4DYC A;  2CUF A;  1WCM J;  4XRS A;  1RKW A;  3JRF A;  3TP0 A;  1VI0 A;  4MO7 A;  1IRZ A;  2EZH A;  1TWA J;  3BTJ A;  4BBS J;  4QTR A;  3W6V A;  3PM1 A;  1SFO J;  1HOM A;  3HOX J;  4ABZ A;  1AHD P;  2LFB A;  5J1Y A;  2R0Q C;  1B8I A;  4JX6 A;  2R5Y B;  3MKL A;  3A01 A;  2DA7 A;  3DEW A;  3Q3S A;  4B3A A;  3Q0V A;  3QPL A;  2Y9Z A;  1QPI A;  2ID3 A;  3S15 J;  3SJM A;  2QCO A;  4CYC B;  3BR6 A;  2Y2Z A;  1TC3 C;  3BR1 A;  3BG9 A;  5JLW A;  2HYJ A;  3FK6 A;  3G1O A;  4S0H B;  2DA1 A;  5C44 J;  1JT0 A;  3CDL A;  4A93 J;  4M3F A;  2E2J J;  5EZG A;  5EG0 A;  1JJ6 C;  2FQ4 A;  4A3M J;  1OCT C;  5F08 A;  1ZK8 A;  3GTO J;  2LD5 A;  3BQZ A;  5IPA A;  3S14 J;  1W0T A;  1JJ8 C;  1APL C;  4A3I J;  1NK3 P;  2M34 A;  3ZQG A;  1Z77 A;  1MSE C;  1ZR4 A;  4D7N A;  2JMW A;  5FLV A;  4B1R A;  4I76 A;  4A3F J;  2EQR A;  5J1U A;  3BQY A;  1NTC A;  2NS8 A;  1W0U A;  1OFC X;  2LLK A;  3LSG A;  4XK4 A;  1H88 C;  3H3V K;  3H0G J;  3O8G A;  5DTD A;  1ZKG A;  5F0C A;  2XPV A;  3VPR A;  1ZGW A;  2XB0 X;  4IHY A;  1FTZ A;  4C3I J;  2X6O A;  2ID6 A;  1ETW A;  5FJ8 J;  5C3E J;  2DA3 A;  2COB A;  3Q0U A;  1NK2 P;  2IBD A;  3S2D J;  5FKL A;  4GFB A;  4RBO A;  3I4N J;  4B4C A;  3I4M J;  2WAQ N;  2CU7 A;  5K7Z A;  3HDD A;  2TCT A;  2L9R A;  2Y0S N;  3JRA A;  4UUS A;  3IH4 A;  1CQT A;  2DA2 A;  5GPC A;  3IV5 A;  2LVS A;  2O8K A;  2GLO A;  1UG2 A;  1ITY A;  4XRM A;  2VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...