5EGOA

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
b'AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis1
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoA00
4J19A 1GV2A 3DEWA 4A3DJ 4A3IJ 4S0HB 1GUUA 3BR2A 4UUSB 4I76A 4RDUA 3S2DJ 5HODA 1TWCJ 4DYCA 2HOTA 1K83J 2X9DA 1X2NA 1U9OA 2I10A 1P7JA 2R5YB 2K9NA 3BTIA 2EQRA 4C3IJ 3LOCA 1I3QJ 1SFOJ 3HGYA 3ZQLA 2JMWA 4L5EA 1EF4A 5M5WJ 2DA7A 1TWGJ 1NK3P 1ETQA 1RR7A 2DA6A 2LK2A 3B6AA 4G12A 1I6HJ 1UHSA 2DA1A 1R9TJ 3GTQJ 3GTGJ 4JX4A 3HM5A 5FKOA 2DA2A 4A3GJ 2XRLA 1JJ8C 2VKEA 2DA4A 1JKRC 3OIOA 2KDZA 2HXIA 3ZQCA 3DCFA 2DMPA 2Y2ZA 4X6AJ 4A3LJ 1OJLA 2E1OA 1FJLA 4BBSJ 3BTLA 3H3VK 1BW5A 3LNQA 4A3EJ 2ZB9A 3Q0VA 5DS9A 2JJ7A 4A3MJ 5FKKA 1ENHA 2QF7A 1IJWC 1E3OC 1WCMJ 2EZHA 2DJNA 3NAUA 5C4JJ 2HDDA 2CJJA 5IOZA 3BQZA 3BTJA 4IHWA 5EEAA 4MIMA 2WV1A 2E19A 4M3GA 2TRTA 2K9SA 4D7MA 1FIAA 2IAIA 3ZQHA 1LFBA 2M34A 3HEFA 1FEXA 3ZQIA 4AC0A 5FLMJ 1FTZA 1JGGA 1LE8A 2ME6A 2JA5J 1MBFA 3TW6A 4D7NA 1PUFB 1OCPA 1ETVA 3JREA 5E3OA 1IDZA 2FD5A 3G1OA 1SANA 2DMNA 3K2AA 4XK4A 1D5YA 3L1PA 3BR1A 1JUSA 4W97A 1B72A 2N8GA 1FTTA 3BG3A 1MSFC 5EG0B 1HCRA 2JN6A 2R92J 3C2BA 3I4NJ 4MO7A 4AUXA 5FJ8J 2JA7J 5K7FA 4MFDA 2O8KA 4UUTA 5IP9J 2IBDA 1ITYA 3W6VA 3FIWA 5EGOB 4QIWN 4GFBA 3FISA 3HKZN 4C2MJ 1TWAJ 1VI0A 3CMYA 1HDDC 2FQ4A 3QPSA 1GT0C 2DA3A 1LE8B 2MGQA 1POGA 3BG9A 4JX5A 5EF6A 3SFIA 2MG4A 2HYJA 4FE7A 3A03A 1O4XA 3S1NJ 2LP0A 3A02A 1BJZA 1MBEA 2GBYA 3HGGA 2EZLA 1IDYA 2NVTJ 5J3LA 4EEFG 3JR9A 4BBRJ 1MH4A 3JRAA 1MBKA 2E2IJ 2DA5A 2VI6A 4M3FA 1IUFA 2R7ZJ 2LLKA 2G0EA 2XB5A 2HI3A 1QVTA 4FTHA 1I50J 2M9HA 3CDLA 4IHYA 4A69C 4ABZA 4V2GA 5M3MJ 3A01B 1ETOA 2OF7A 5K7ZA 3HOUJ 5FKNA 3JRGA 3IH4A 2NS8A 5J1RA 3JRDA 1JKQC 2AHQA 1BA5A 4W1UA 2VPRA 1VF9A 2COBA 3QQAA 2K40A 1X58A 3GTOJ 4B1RA 3S1MJ 1GV5A 3BG5A 1OFCX 1CQTA 4IHVA 1P7IA 5IYBJ 1RKWA 2O7OA 2QCOA 1NTCA 1HOMA 2EBIA 2CUEA 1ORKA 5EDNA 1XC5A 1ZQ3P 1H89C 5F1JA 2LR8A 4JX6A 5GP9A 4I6ZA 4X1EA 3GBGA 4V2FA 4HNVA 1JT0A 1K61A 2HXOA 5K7HA 2GLOA 3CQZJ 4BKXA 3E7LA 5JLWA 1H8AC 1VNDA 3HOWJ 9ANTA 3BR0A 2LTPA 1MSEC 3LSRA 1AU7A 2ECCA 5JLXA 2ME0A 1IG7A 5FKLA 4A93J 2FX0A 3ZQGA 3JRFA 4DYQA 1W0UA 1WH7A 4D5FA 1WPKA 5E3MA 4C3JJ 4Y52J 5IP6A 2L7ZA 1TC3C 1QVUA 3JRCA 2LD5A 2PMZN 1IGNA 3GTMJ 4CYCA 2XGEA 4RBOA 4DZJA 2Y0SN 3F0CA 4FISA 2HOSA 4A3CJ 1ETXA 4IHXA 3S1QJ 1W0TA 5J1YA 2EZIA 1JKOC 1F36A 5F04A 3VPRA 4QTRA 5F08A 1U9NA 5C4XJ 1MBJA 1GDTA 5IOYA 2DMUA 2H8RA 1BW6A 1ETYA 3HOXJ 3S15J 2JA8J 1HDPA 1U8BA 3ZOBA 3SJMA 3HDDA 4A3KJ 2IEKA 3LSPA 4DW6A 3Q0UA 1HLVA 1T33A 3GTPJ 1RESA 4A3FJ 1APLC 3MN2A 2HOAA 3K7AJ 3HOVJ 1UMQA 3MKLA 2CQQA 4DYRA 5IYCJ 4XIDA 3LSGA 2VUMJ 5FKMA 1UG2A 5EYRA 5E3NA 4CYCB 2R0QC 1Y1WJ 2ID6A 2WAQN 2YU9J 2AO9A 1U78A 2XGCA 1X2MA 4XRSA 3FKIJ 3PO3J 4BY7J 2CU7A 1ZR4A 5E3LA 2DN0A 3O8HA 3RKQA 3TW7A 2R5YA 3NARA 2NS7A 1VFCA 3SDGA 3S14J 2NOGA 2XSDC 2XPWA 2X48A 1IC8A 2K9QA 2JK3A 2GM4A 3TP3A 1B8IA 1B72B 2D5VA 4M3EA 2M0CA 4QSHA 1AHDP 1XG1A 2XB0X 2R93J 1A5JA 2E2HJ 5F27A 3GTLJ 4A3JJ 3RZOJ 2Y30A 3HB9A 3BR3A 1WI3A 4XRSG 4FE4A 2XPVA 1JKPC 5IYDJ 5M5XJ 2XGDA 4MFEA 3QPLA 5DTDA 3UKGA 2ELKA 3Q3SA 2EH3A 3BQYA 3IV5A 3TEDA 3I4MJ 3B6CA 1ZKGA 2TCTA 1ZGWA 3BT9A 2B63J 5F0CA 2ID3A 1H88C 2X6OA 2JA6J 1JUMA 4B4CA 3WHCA 4XRMA 3BR6A 3JRHA 5EZGA 1MH3A 1WGXA 2LFBA 3MVPA 4LOCA 4B3AA 2R5ZA 3IH2A 1B8IB 2E2JJ 3PM1A 4IEJA 2KT0A 1JT6A 2L7MP 2M2EA 5GPCA 1HF0A 1RKTA 3JRIA 1T56A 2CQXA 4MLOA 5M3FJ 4BXXJ 1XS9A 2JWTA 4C3HJ 3PO2J 1F43A 3LSJA 3GTJJ 2DMTA 2LKXA 3BTCA 3HOYJ 2O9LA 1Q1VA 1Z0XA 2P81A 3OSGA 2W48A 3S2HJ 3CCYA 3RQIA 2EZKA 2M8GX 1IRZA 1PUFA 3OOUA 2FJ1A 1IV6A 2VKVA 1TWHJ 4NDLA 3HBLA 1LFUP 1MNMC 5IPAA 1AKHA 2ECBA 3HOZJ 5EZHA 5IP7J 1JJ6C 3FK6A 1QPIA 2R5ZB 3S16J 5C44J 3M4OJ 1DU0A 5F0HA 5EG0A 1YRNA 2DMQA 2Y9ZA 1ETKA 3TP0A 1Y1VJ 2RAEA 4FCYA 3FK7A 3G1LA 2DTZA 3S17J 4JP0A 3JRBA 4Y7NJ 5M5YJ 4M6VA 1FIPA 2Y9YA 5EGOA 1ZTRA 1ZK8A 2L9RA 1ETWA 1JUPA 2YS9A 3ZQFA 1GVDA 1MBHA 1ZR2A 2HQ5A 4BY1J 3S1RJ 3O8GA 1S7EA 4JYKA 1JTYA 4M3DA 5J1UA 2WB1N 2OPTA 2NVQJ 2CUFA 1AKHB 4D5CA 5C3EJ 1MBGA 3BR5A 2LVSA 3Q0WA 1A6IA 4DZPA 1NK2P 2Y31A 5BNGA 4UUSA 2NVYJ 1YRNB 2MSYA 1BL0A 2XPUA 2MW8A 3GTKJ 1Z77A 2NVXJ 4M3BA 4A3BJ 3RZDJ 2L0KA 3M3YJ 2L7FP 4XICA 1WH5A 1RPWA 1OCTC 3A01A 3D1NI 5FLVA 1G2HA 3G1MA 1RETA 2CRGA 2H1KA 2LY9A 3OSFA 5GPAA 3WHBA 1QRYA 4AYBN 3H0GJ 1DU6A 1TWFJ 1JTXA 3IH3A 5F0FA 2YUSA
chains in the Genus database with same CATH superfamily
2VJIA 3DEWA 1MZBA 1EJ9A 1YE9A 2XAQA 3E5UA 1TZLA 4WX9A 1UG0A 5FD5A 4S0HB 1RUOA 4OIPF 2HKXA 4Q5SF 4RDUA 2EFQA 2LKSA 3K4NA 1XMAA 2VONA 5FFXA 1IRFA 3QU3A 4AVZA 3I5UA 2DJIA 2I10A 1FNNA 3C18A 1RZ4A 2WV0A 1QHHD 4A2UA 2R5YB 3FKJA 4R1HA 3I59A 4IHSA 4L9NA 4ZYGA 3K2ZA 3F21A 2EQRA 4C3IJ 4MGRA 4BE2A 1P2FA 2M5WA 1I3QJ 3WTYC 3HGYA 2DI3A 1EF4A 3U2RA 3OYHA 4AD9A 1TWGJ 2FOKA 3ML6A 3G4SI 2DA6A 3B6AA 1VTNC 1BR4A 3GLLA 4G12A 4HPQA 1MIJA 3QPTA 5F1RA 2CQNA 4CDGA 5K1YA 4AIKA 4LLNA 3GTGJ 1LQ1A 4XLNF 3PUBA 1CF7A 2DA2A 3OYKA 2PBIA 5DCMA 2DA4A 3ULQB 4HNTA 1JKRC 3P9CA 4Y4RA 4MEYF 1P4WA 2VE9A 1B9NA 2K27A 2XIGA 4M74A 3OYCA 3JAMK 1XB4A 4HLYA 3PQKA 4A3LJ 1KYZA 4BAYA 2IJLA 1O7FA 1OJLA 2E1OA 2PFBA 3E5QA 3LFUA 2O6GE 4L5IA 4NUBA 4A3EJ 2ZB9A 4LK1F 5DS9A 4G7ZF 1Z21A 4HA8A 3IRQA 4A3MJ 1ENHA 1IJWC 2NXNB 4UB8C 1WSUA 5TGTA 2JSPA 1E3PA 3M8FA 5C4JJ 2HDDA 1MJAA 1XGOA 4D9JA 1MMSA 3FM5A 2E35A 2VBZA 4IHWA 3WU2C 4RGUA 1YQAA 3DTKA 5LHIA 4UVBA 1CF7B 3ZQHA 1U2WA 2M34A 4ZDOA 2DT5A 4OU0A 1B4AA 4N9IA 3J7ZI 1J09A 2EV5A 1FTZA 5LLQA 5DCMB 1YJ9I 4BJTA 2MC3A 3L00A 1LEBA 1O57A 2ME6A 2ZXJA 1J2XA 4NHJA 2I8DA 4YEJA 4D7NA 3RTRA 1PUFB 2KLOA 2DT7B 3ZMVA 3G1OA 3ERED 4Y33A 4IOCF 4E7HA 3K2AA 4Y3OA 1S8NA 2IVMA 2ZSIB 3ECOA 1SC7A 5CVRA 4CZZA 4FT8A 1JUSA 3GFMA 4W97A 5CYVA 3F72A 3ZN0A 3E6MA 3VSKA 2A05A 4PCQA 2V7FA 2KIQA 5KAIC 1BI1A 4PK4A 1JHHA 2XROA 1R71A 2H09A 3C2BA 3H9GA 4AUXA 5HLGA 4HQEA 1Z6RA 3EUHA 2LREA 3MFKA 1UCRA 5ICFA 1X1CA 2IBDA 1YLFA 2M3AA 4GFBA 3FISA 1VQKI 4RGXA 4C2MJ 1TWAJ 5FGMA 2FQ4A 2RNGA 3A4CA 4WXCA 1GT0C 4ESBA 3GCMA 4EVIA 2VOPA 5DM7F 2EJRA 3A03A 4ESFA 1O4XA 3S1NJ 2IT0A 2V9KA 3AL0C 3E6CC 1BJZA 3PNYA 1MBEA 1Y8QB 3HGGA 4QPQA 1BBYA 1HC8A 2EZLA 3I58A 4GRIA 2Y69H 1KYWA 4RB0A 3KP6A 3JRAA 5D8LB 4A6DA 1IUFA 3VSLA 3CJQB 3WTXC 2R7ZJ 2LLKA 2XB5A 3AFHA 2HQRA 3CDLA 2HVRA 4IHYA 1XGMA 2OC6A 3JSOA 2DTRA 4ZDPA 1GHCA 2OF7A 3R60A 1PP7U 2NRAC 5FKNA 3JRGA 3MKYB 3IH4A 1WFXA 2NS8A 3PIOF 2R3SA 3LA7A 4U87A 3RPQA 3KP2A 4L5JA 2XHKA 3KEOA 4GXOA 4AIJA 1D0YA 1VF9A 3QQAA 4C30A 2R7WA 4BE1A 3S1MJ 1J0RA 1S72I 4F52A 1T8IA 4IHVA 3SYTA 5IYBJ 2QCOA 2O7OA 1A31A 3EYYA 1ZLJA 2OD5A 5ICCA 5BPIA 2CUEA 5EDNA 1DPRA 1ZQ3P 1VQOI 2Y75A 1FT9A 5F1JA 2ZMEA 4I6ZA 1YJNI 2IS2A 3GLXA 4X1EA 1IV8A 3GW2A 3GBGA 3TOAA 4V2FA 2CQ7A 2FU4A 4HNVA 2CYYA 3CQZJ 1AA7A 4E7ZA 1H8AC 1VNDA 3HOWJ 2EK5A 3OS2A 4H4KC 2P5LC 1EH7A 2KP6A 5FROA 4OOIA 2FMYA 3FM3A 3DKWA 4LIUA 5FKLA 2MC4A 2A07F 4XNFA 2QQAA 3G6EI 3SZTA 3QOPA 3MKWB 4IX7A 1W0UA 5AONA 1ZN2A 2V9PA 3KP5A 2X0LA 1QVUA 3JRCA 2PMZN 5IY5H 4ZH4F 2QA4I 3WTTC 4U88A 4FISA 1S5LC 2ZMEB 4A3CJ 2L3DA 1W0TA 1MMNA 2WAEA 5B5EC 1OR7C 4QTRA 1OKRA 1OYYA 1V4RA 4L9JA 4HF0A 2ZKZA 1J7KA 5KNLA 1B59A 1ACIA 1BW6A 2ZC2A 5DV5A 3GXOA 4DGWB 1MJ9A 4PFPA 4EM1A 3G3ZA 3WGGA 2CO5A 2KZGA 2G7UA 5JR3A 2HR3A 2X6WA 4OMZA 4G6TB 2Q0OA 2VT3A 3LWFA 2QZ8A 1WQ2A 5LGTA 1APLC 3MN2A 3JTHA 5A2QZ 5DD4A 1UMQA 5GAGJ 2PI0A 3MKLA 2A5WA 3K6GA 1C0WA 2VUMJ 2R7QA 3F8MA 2V1UA 1UG2A 5EYRA 5F64A 2R0QC 2MH2A 5J47A 4BDYA 4FHTA 3H3ZA 4WF2A 5LGNA 1WRJA 2UXXA 4ZYDA 1X2MA 1XDUA 4E6KG 1HW5A 3QODA 2Z99A 5E3LA 2DN0A 1ZRDA 3N97A 2FSWA 2KIMA 1VFCA 3S14J 3R61A 4MNUA 1IC8A 3S32A 1VQ9I 4NC8A 4PJNA 4HW0A 3GFIA 1D8KA 4B09A 2GM4A 2PLYA 3O3KA 4NNJA 4IQJA 2M7AA 3F8BA 3H9JA 1T98A 4OAYA 1XG1A 2NNNA 3LAJA 1A04A 4FQGA 1HW1A 2Y30A 2FEZA 2XC7A 1ZHFA 5DM6F 3MWMA 1PDNC 5IYDJ 3DLAA 3SQNA 2XGDA 3CCJI 3HIFA 2QSHX 1W5SA 5BMZA 4U0WA 2CUZA 2EILH 4KISA 2LSOA 2FXAA 2P5VA 4RS8A 4PZJA 3OWTA 2EH3A 3IV5A 1OYWA 2TCTA 1OMIA 3BT9A 1RR8C 1N75A 1PYVA 4N4OB 5E1XA 2EINH 2ID3A 3C2HA 2JA6J 1Z3YA 2KFDA 1NG7A 4XRFA 5L3BA 3EQLF 3BR6A 3JRHA 3G73A 2MABA 2W84A 4BS9A 3DBRB 1MH3A 2LFBA 1SD6A 2E7WA 4B3AA 2OTJI 5KCMA 2E2JJ 3PM1A 5HVQC 1Q1HA 1VQ8I 4PDKA 2XF5A 2KT0A 3AG2H 3ABTA 4EJOA 3KIOA 4XORA 5GPCA 3ZMSA 3JRIA 3ZMTA 3SDBA 3TO7A 4B48A 5M3FJ 3ESWB 4C3HJ 2JTVA 1VQLI 4UVAA 1F43A 1XD7A 2KPMA 3LSJA 3K4BA 4HX8A 3BTCA 4EJVA 1TQPA 2VE8A 1Q1VA 4ZJZA 3OSGA 3HG9A 2W48A 3IKTA 3RQIA 1WHUA 1K4SA 4OIOF 1ZREA 3GF2A 2WB1A 1IV6A 1SFKA 1VQ4I 3GO5A 1TWHJ 3J80K 2CV0A 1MJBA 5J4YA 2L9VA 1X19A 1T39A 5FLXK 3M4OJ 4RGSA 4B44A 5KHDA 1GXQA 5EG0A 1YRNA 1R6RA 2DMQA 2Y9ZA 2E5NA 3MCZA 1Y1VJ 2RAEA 3QWLA 2VBYA 2JQ7A 1HA8A 3VEPA 2LNBA 3FK7A 2DTZA 3CUQC 2ESHA 2L54A 2OCEA 2HPMA 4MQ9F 1ZTRA 1ZK8A 1ETWA 4JOMA 4E4HA 1ZR2A 2P7VB 2DT6A 2HQ5A 3KCCA 4RA2A 2A6HF 1BIAA 2G7HA 2R7TA 1OCCH 3A1YA 5LGUA 4M3DA 4CUGA 4KA4A 3CC2I 2CUFA 2Y48A 3QAHA 3QYEA 4I02A 1JE8A 1RNLA 4XOTA 3SEQA 4D5CA 4CA0A 4DZPA 1A6IA 5DEQA 3D5RC 5BPDA 4BHCA 1IXRC 2HVSA 5KAFC 4RAYA 4CH7A 4C9YA 3KZYA 3IL2A 1YRNB 3COAC 3P9KA 2F48A 1VQPI 1Z77A 3P9IA 4AIDA 3F6VA 4BACA 1BIBA 1MNDA 4LB6B 2WADA 2L0KA 2OA4A 2RKHA 4G8XA 2KIUA 1RPWA 1Z1DA 4CICA 1G2HA 3L9FA 5FLVA 1MDMA 3H35A 3PNVA 1WJEA 3LFKA 2F5EA 3CMAI 2Z5UA 3ZMUA 3OSFA 5GPAA 2XASA 1MD0A 1QRYA 1RI7A 3HUGA 4DNCA 3L2RA 2RQPA 3OYBA 1FZPB 4IL6C 3GX4X 3CTAA 3I4NJ 2K4BA 2YUSA 3A0BC 4I09A 5DUKA 1W5TA 3UNGC 3OYEA 4J19A 3RI4A 1GV2A 1LB2A 4ANJA 4A3IJ 1GUUA 3HTSB 3PFYA 1OYIA 4RAGA 4C2TA 2DFIA 3VFZA 2STTA 3BR2A 5LHHA 4I76A 2HOEA 4U7BA 3CCUI 4CO8A 2ACJA 3S2DJ 5HODA 1TNTA 4DYCA 1P9QC 4IZZA 1PUEE 3SFZA 2JVGA 1USTA 5DCFA 3MKZA 1U9OA 3K1MA 4KMFA 2F5FA 1P7JA 2BV6A 2FQ3A 1ZAOA 4IVNA 1IN8A 5JVTA 2XAFA 4EJWA 3LOCA 2XF7A 4Y15A 5LHGA 1SFOJ 2G9WA 4ZYHA 4L5EA 1FMVA 3R6SA 2DPUA 3CCQI 4OAZA 2QQBA 1YW7A 1ETQA 2NYXA 1I6HJ 1GXPA 3AG1H 5D5XB 1UHSA 1T95A 2LKPA 3HUGB 4HLXA 2CG4A 1DGWY 2GQQA 1I3AA 1EA3A 1ON1A 3MMYB 3RQ4A 2GOXB 3ZCOA 2QGUA 2UV1A 3HRSA 4ZTFA 4A3GJ 4P96A 1W4MA 2L9SA 3BOQA 1JJ8C 2KZVA 1MMDA 3NQOA 2VKEA 4CCLA 1BR2A 3ZQCA 3KLOA 4YFXF 3WG9A 1WJ5A 3VYSB 3IWZA 3HOSA 1SAXA 4X6AJ 1B9MA 3DLLF 3SHFA 2LRDA 3I4PA 3FZVA 1FJLA 4HNUA 3FHZA 1S6LA 4PJMA 1S9HA 3OL4A 3BTLA 4RB2C 3F22A 2IA0A 4CGZA 4BQOA 1X3WB 2RVCA 4HV6A 2EIKH 2QF7A 4HDUA 1JI8A 1WJBA 3M9AA 2EZHA 4ENJA 3P5JA 1YIJI 1BOAA 4U0YA 3FMQA 1X4PA 2CFXA 3BQZA 3BTJA 2O61A 5EEAA 2A6TA 4M3GA 4XL9A 1DUXC 2K9SA 3ASNH 1IZ1A 1M1EB 1I5ZA 4RLQA 1UHWA 2WA0A 2RNJA 1I39A 3ABLH 1JGSA 1FC3A 1TQIA 2L02A 2LY1A 2V4JC 3KPHA 2FD5A 1KGSA 1KU7A 1S7OA 1V54H 4F55A 2L2OA 3PIPF 5L3CA 1N77A 1LKXA 4YIIA 4XK4A 1IO2A 5IT3A 1D5YA 3L1PA 3KETA 3BR1A 3LSKA 2LY2A 1LDJA 1B72A 5BS6A 1D5VA 3BG3A 1MSFC 2LYCA 5LRRA 4XN0A 1MDMB 2W82A 1QO0D 2FF4A 2DQLA 2JN6A 4M9ZA 2JA7J 1I6XA 2QQ8A 1SVLA 5K7FA 2M8EA 2DYRH 4ASNA 2DK8A 2QLZA 1ITYA 3IC7A 2H6CA 4HG2A 2PQ8A 3OOPA 3J7AO 2NS0A 1Z05A 1HDDC 4GCVA 3RPUA 3QPSA 1U5TC 4S05A 2QKMB 1I1GA 1U0JA 2MGQA 2DK5A 3BG9A 3S3MA 3KYCB 1YO5C 1UZCA 2GXAA 3PSFA 3SFIA 4FE7A 3QP5A 3A02A 3I9V2 5TISC 2UXNA 2CH0A 4OWRB 1E3HA 4BH9A 2WC2A 1DQUA 2BYVE 4EEFG 1YYVA 1G6NA 3HZJA 3JR9A 2Z16A 2B0LA 4BBRJ 3HPHA 3HOTA 2ZXIA 3S93A 4EGZA 2E2IJ 2DA5A 2DODA 2VI6A 2KIFA 2EIMH 4DBQA 2G0EA 2LOOA 5LD2C 1I50J 2M9HA 2RV8A 3E6BA 5ICGA 4ABZA 2MFZA 1FOWA 1T0FA 4V2GA 3A01B 4M72A 1TT0A 2ETHA 1YG2A 5K7ZA 6PAXA 5J1RA 1JKQC 2EFOA 5HDKA 4W1UA 4O6JA 1IUYA 2COBA 1W36C 4B1RA 2JVHA 5FRNA 1GV5A 2HVQA 1KQ9A 3BG5A 2CUJA 2HZDA 3OYFA 4G6QA 3LL7A 5LRSA 1RKWA 2PMZA 3D5LA 1HOMA 1X1AA 2EBIA 1ORKA 2ELHA 1XC5A 3T0YA 5D5WB 1WZ2A 5HLIA 1H89C 1W7PA 2VKDA 1UELB 2P4WA 1KU9A 3DV8A 4HRIA 2O0YA 3FDYA 1F9NA 2D1HA 1O3TA 1JT0A 3WTSC 1K61A 5K7HA 2GLOA 3I59B 4MHGA 5A2QK 2VJ4A 3BR0A 3VYTB 5HOOA 3CF5F 1MSEC 2O5RA 2ECCA 3OIPA 2W7NA 1AU7A 5JLXA 1R36A 3NRVA 1HSTA 2KRCA 3LSTA 1IG7A 1BI2A 1W36D 4JQFA 1K7AA 4OIRF 2O8XA 3FXMA 3JRFA 4DYQA 1HKSA 3HXLA 1QNTA 4D5FA 1WPKA 1D0XA 1FMWA 4BEHA 2Y0MA 1TC3C 2OTLI 2Z3YA 1REPC 2CW0F 3CCRI 1IGNA 4CYCA 2XGEA 4PJLA 2DO7A 4LG0A 2JPBA 3HL2A 3F0CA 3T1BA 4P9FA 1ZG3A 2HOSA 4BNCA 3HC7A 3KEYA 5J1YA 4WXDA 1ZG5A 3HRUA 1R5ID 3WTUC 4I98B 5F08A 2DDBA 4II3A 3LAPA 5B1AH 5IOYA 2CWEA 3BDDA 2JA8J 4BHPA 1U8BA 1OQYA 3ZOBA 1FWZA 5EEHA 2BVMA 4DW6A 3S3OA 4BU2A 2VBXA 3CMEI 3Q0UA 1HLVA 2BHZA 2IGNA 4A5NA 1F4KA 1Z7UA 3CUQA 3GZNB 4YELA 1V3FA 2OUMA 5FD6A 3K7AJ 1FBUA 3G71I 2LF7A 4CCNA 4IXAA 2IS1A 3BJAA 4KITB 1T38A 3QYBA 1ODDA 4BEHB 5ERIA 1W5CC 4ETSA 5FKMA 5HS8A 3CC4I 1FPQA 5E3NA 4CYCB 2P6SA 1PVEA 4LG0B 2DFFA 2Z33A 4BQQA 2ID6A 4EJTA 2WAQN 2YU9J 1IXCA 1Z3XA 3FMRA 3IWFA 4E70A 4JK1X 3DP7A 2CU7A 4EJUA 3LMMA 3KEQA 3NARA 5TJJA 1X1DA 2DOEA 2JK3A 4L9VA 3OS0A 5GTHC 1DP7P 4R8HA 2EWNA 2KMUA 4N4NB 1AHDP 2DXIA 1MGTA 3IAM2 2H27A 1D8JA 3F23A 1G4DA 3GTLJ 2B7EA 2R7XA 3HB9A 2ICWG 4XSZF 1YS7A 4KICA 4FE4A 2EFPA 4PJJA 5M5XJ 3QPLA 5DYMA 1ZRFA 4KFCA 2ELKA 3Q3SA 3BQYA 2R7RA 3B6CA 2WY7Q 3I4MJ 3GVAA 1ZGWA 2OBPA 1G3YA 3DFGA 3I3LA 2OU2A 4KYWA 1HBXG 2M45A 1B6AA 3M7GA 1UB9A 3K70C 4XRMA 3Q9SA 3GUDA 2OJED 5LFAA 4MQVA 3WE3A 1IRXA 1Z7LA 1HF0A 3OIQA 3O2PE 3PL8A 1XS9A 1EH8A 3BCBA 3H5RA 3KE2A 3PO2J 4P5OA 2YX7A 1FOXA 2V79A 3ERMA 3QRFF 3ZPLA 3V8LA 3SEZA 2YX4A 2RDPA 3CCYA 3HHGA 1R49A 2M8GX 3C2GA 1IRZA 3OOUA 2FJ1A 2VB6A 5GAHJ 3K70D 4NB5A 3TDUC 2EB7A 2GIVA 1BI0A 3HPGA 3J7YJ 1AOYA 3FK6A 5H6RA 2XAHA 1SFEA 2XKPA 1G3TA 4XKBA 3RKXA 4EMSA 3PNTA 2IPQX 3MAJA 4A5MA 4AWXB 4FCYA 3W6KB 2A61A 4XLCA 1AWCA 1MNEA 2V1DA 3PQJA 1USSA 4BQNA 3HRTA 1JHFA 1XMXA 3K0LA 1FIPA 1YITI 1JXSA 2Y9YA 5EGOA 3FF5A 3JTGA 1YI2I 2YS9A 4UUVA 3KZZA 3I71A 4UVCA 1G59A 4BY1J 3O8GA 4L9TA 1S7EA 1FSEA 1Z9CA 2DAOA 2PN6A 1TNSA 2VC1A 5GAEJ 3E97A 2E1MB 2ZJQF 1Y6IA 1ZLKA 2OPTA 5BQTA 2NVQJ 1Y0NA 3ZMZA 3F8CA 5HLTA 1Z67A 2GA2A 4ENKA 4KJZA 1MBGA 1NK2P 2LVSA 4EATA 3RYPA 2Y31A 4UUSA 5KVRA 2NVYJ 3DXJF 4PGHA 3ONQA 4XOPA 2QENA 4BGDA 4KIFA 3JAMZ 3DF8A 2K9MA 2IXSA 3LSIA 1KU3A 2QSGX 3ZXSA 1J9IA 2MD0A 3RZDJ 3M3YJ 3M1EA 2E36A 3GZ6A 2MA3A 3KFWX 2FBIA 5D6EA 2VQGA 2AQEA 2KRFA 3KLNA 1VQ6I 2M30A 3G1MA 3DTIA 3WTZA 4L0YB 1KQ0A 1PJRA 4AYBN 3U1DA 2QBYA 1TWFJ 1JTXA 2X6YA 3IH3A 3WODF 5D5VB 5F0FA 2IGMA 2M0MA 3E6DA 3WG7H 3ASOH 4CCKA 4RAFA 1FLIA 2L5QA 4F92B 4UUSB 1U5TA 3K4KA 4XKCA 2HOTA 1LFPA 3ZRGA 5L3EA 4EM0B 1K83J 2IS6A 2MH9A 1X2NA 3HSEA 5B3SH 5ED4A 1V5FA 1IN7A 1LDKB 4KT5C 3I56I 1XN7A 1I27A 2H94A 1MKMA 2K9NA 2MYSA 3BTIA 3FXJA 3CJNA 4HSTA 1TBXA 1FOKA 3AAFA 4AVPA 2DQRA 2KKOA 3TO9A 5LEKA 2E1NA 5HLHA 5B1BH 3ZQLA 4U7DA 5M5WJ 2DA7A 4M73A 2X1EA 4ITVA 4D0PA 3EYIA 3EDPA 4HZFA 2IA1A 2DYSH 2LK2A 3L2WA 2BHYA 4PJ0C 4E7IA 2DA1A 4CXFA 2QBYB 1P4AA 1D0ZA 1QZZA 2HWVA 3GTQJ 4F3QA 4JX4A 3HM5A 4R79A 1VQMI 3FXUA 1R00A 3QU6A 2D2WA 3DWLE 1T08B 2Y0SA 5HDNA 5H20A 3OIOA 2DW4A 2QVOA 3N05A 3DCFA 1P4XA 1F1ZA 2DMPA 2Y2ZA 3I0TA 3U9GA 4XLAA 4AM3A 5HS7A 1XCVA 2JSCA 3FXLA 5E79C 2HKOA 4RM3A 1BW5A 4J00A 2JJ7A 1R22A 4ZYEA 2W25A 5FKKA 3TQNA 1E3OC 4KN4X 1K6OA 4B3XA 2LDUA 2Z1DA 1O3RA 2CJJA 3TO6A 4XM3A 5IOZA 4HF2A 1N78A 2XRNA 1RC9A 4NBQA 1IXSB 2WV1A 4B8XA 3IHUA 2BW3A 4D7MA 3K4LA 3LQRA 1LFBA 1FEXA 3FXRA 1YOVB 2HTJA 3HEFA 3ZQIA 2WAFA 2L9NA 4AC0A 3H5AA 1VQNI 4KMUX 1Y56A 1JGGA 3ZMDA 4L0ZB 1ZRCA 1LE8A 3NEUA 4HSRA 3PFIA 2YR2A 3TW6A 2FOWA 2O3FA 2L7KA 1QGPA 3W6JB 3FMSA 1ETVA 1HKQA 3B02A 3EUHC 1SANA 3E0JB 3H3UA 3OV8A 1I1SA 1OCOH 1WJAA 1D1AA 2JUCA 4MTDA 2VKHA 2N8GA 1R5GA 3CDIA 1FTTA 3GEZA 4NC7A 4A6EA 3R4KA 5EG0B 3DQVC 3QYFA 4KT6A 4ZC3A 4A0ZA 4BJ6C 3WTVC 1HCRA 5EEGA 2W57A 3PUFA 1LVKA 1XMKA 1U6GA 2OQRA 4YFKF 2VBWA 2UWMA 4UUTA 3V42A 2A3SA 2BW3B 3W6VA 3FIWA 3OL3A 5HNFA 4DJAA 2BEOA 4J01A 4OIQF 4XKVA 3HKZN 4B43A 5D6FA 4FX4A 1YX3A 4UB6C 3CLQA 1X1BA 2VASA 1TL8A 1ZH5A 4I2OA 2DA3A 3K69A 1LE8B 3L2QA 1POGA 3TKYA 4JX5A 2BY0A 2FA5A 3DKYA 5EF6A 2HEOA 2V1XA 1YFHA 4DIQA 4H0EA 3ABMH 5JFRA 5DDGA 2W00A 1IDYA 2KHMA 1MH4A 3FXKA 2IW5A 2X1CA 2M4GA 2HFHA 2R7OA 3DU6A 3KP3A 4GGGA 5H6QA 4M3FA 4CYDA 3CF2A 5BOXA 2STWA 5HS9A 2DDAA 3ECHA 3L2UA 4FTHA 4AU7A 2WWYA 1WJCA 2M4KA 3ABKH 4UY8I 2ZJPF 1ZGJA 2KDOA 4MTEA 2TDXA 2DOAA 1K4TA 4UV9A 2EPFA 1U8RA 2FUG2 2KQRA 1BA5A 5LEJA 1O3SA 2ZMEC 2K40A 3IRRA 2V6EA 4E7KA 3VOEA 2E7XA 3ZQQA 1CQTA 2BE5F 2ZXHA 1P7IA 1E0EA 2GXBA 2IGOA 1Y0UA 3CJRB 2WTEA 2J5OA 2LR8A 3A0HC 3HJEA 4JX6A 5GP9A 1X3UA 2DFHA 4TV7A 3RIRA 5CLSA 3BP8A 3AL0B 3QP6A 2HXOA 2MLGA 3KX2A 3CMMA 3E7LA 4EV0A 2V26A 3OYDA 5JLWA 4M9XA 9ANTA 2OV7A 2LTPA 3LSRA 3W2VA 2Q2EA 4YIFA 4I0BA 3MZHA 3TL4X 2ME0A 2K3FA 4LJZF 1FYKA 3LA2A 5CVIA 3BCAA 4A93J 2HQNA 3BG7A 2LBFA 4I99C 1X1PA 4ON0A 3ZQGA 4BQAA 2YSRA 1WH7A 5F6FA 5E3MA 4C3JJ 4NQWA 2VIXA 4V19K 2FE3A 1P92A 1UHMA 4N9HA 5ILVA 4E7JA 1O3QA 2LD5A 3GWZA 1MW7A 4Q47A 2QSFX 4RBOA 4DZJA 2Y0SN 3L09A 2WAQA 1IW7F 4KNYA 1BR1A 3BZ6A 4MEXF 2ZCWA 3S1QJ 2V1NA 3BPXA 4RB3C 1JKOC 1F36A 1OLTA 5DD8A 3P7NA 4E7LA 2VPLA 3H1CA 5C4XJ 2QKLB 4CZCA 5JVGF 1FP2A 2RC4A 4HF1A 2J5PA 2VQCA 4BDZA 2Q2EB 1HDPA 1SD5A 3SJMA 4A3KJ 4LFUA 2IEKA 3LSPA 4GO1A 1K6YA 3I53A 2VLAA 1OR7A 1BJAA 3AKZA 1QZEA 4FX0A 2CGPA 2K86A 4RGRA 3RKYA 5CPRB 2P6TA 5IYCJ 4XIDA 3LSGA 3K9TA 2EV0A 2VQLA 1IRGA 4EGYA 4O5VA 2XGCA 4XRSA 1WJDA 4BY7J 2R7FA 2L4AA 1QA6A 4XKWA 4I7HA 3TMOA 3RKQA 2R5YA 3OR2C 3SDGA 5JHFA 2NOGA 2X48A 4HAMA 2L4MA 2K9QA 5HNHA 4IOAF 5FLXZ 3TP3A 1B72B 4F7ZA 1XSVA 1FP1D 2H1LA 2M0CA 4IKFA 2XB0X 5E17F 3I54A 1BC7C 4KUMA 5J8CA 1ZYRF 3FBIB 2ZXWH 1WI3A 3BR3A 5JI6A 4BYYA 2OAZA 1FX7A 2DOFA 4DOZA 2EA2A 5ICEA 3CESA 3G2BA 3CCVI 2V6CA 4MFEA 3GFJA 1XGSA 4NC6A 3UKGA 2HTSA 3CO7C 3FX3A 4IRGA 1SMYF 3TEDA 1ZKGA 1K79A 1R4NB 3NWSA 2B63J 1XGNA 1KQ8A 1H88C 1VZ0A 2X6OA 1D1CA 4PFOA 4KDPA 1JUMA 5IT9Z 5E8GA 2PMHA 3WHCA 4XLPF 5K5QA 3F9KA 3TDZC 1IN6A 2ZO4A 4LOCA 3ZN1A 3CJTB 1XSDA 4BXUA 2HYGD 4IEJA 2FRHA 4IF4A 2JRTA 1J5YA 2OQGA 2WBMA 1RKTA 1R7JA 1T56A 3QOEA 4IQ4A 2WY8Q 4BXXJ 5L3GA 1E2XA 3VB2A 3A2KA 4ESJA 1IAWA 2PMUA 4YRVA 3T5XA 3JW4A 2NNYA 1V5GA 2BY2A 2MD5A 2DU9A 3GTJJ 2DMTA 2LKXA 1YW8A 1ZELA 2I5UA 3HOYJ 1EV7A 4C2UA 3MZ8A 1Z0XA 4HX4A 5HDGA 1SFUA 3E1SA 1BC8C 3S2HJ 3OYAA 2C6YA 2ZNZA 1TW3A 3KYLA 1PUFA 2HDCA 5E20A 3M1CA 4KIBA 4S04A 2VKVA 4NDLA 5AIPA 2O03A 1BN5A 5FB2A 2QM3A 5IPAA 1AKHA 2COMA 5CKTA 2PEXA 1JJ6C 5CQEA 2Q1ZB 1QPIA 1HSJA 4LLGF 3S16J 1DP3A 4XONA 1W7PB 5C44J 4GDFA 3PSIA 1DU0A 2VXDA 4LITA 5F0HA 1A36A 5H2FC 1ETKA 4QWQA 3CCEI 2K02A 5TRDA 3S17J 4JP0A 2P0WA 3JRBA 1KZHA 4Y7NJ 5GTIC 5D4RA 4M6VA 1RUNA 4IRHA 1K78A 2FMLA 4ZTJA 4L18B 2K9LA 5J4VA 3ZQFA 1YHQI 4G9YA 1MBHA 1XPXA 3KZIC 1TW2A 4CCMA 4JYKA 5CVUA 4AYBA 3OYMA 2EIJH 2ISYA 4HV5A 3C7JA 5LBQA 2VT2A 2K7LA 2X1DA 3SZGA 2R7VA 3KP4A 3OYNA 3H0DA 1AKHB 2ZNYA 5E8IA 5C3EJ 2W4SA 1ZARA 3Q0WA 2OZ6A 4HYEA 5BNGA 4G94A 1VQ7I 1KA8A 2CS3A 4PGGA 2NOJB 2MSYA 3CCLI 1BL0A 3WGHA 1S7AA 4WXHA 3V8KA 2NAZA 2VJ5A 3L7WA 2CV1A 1QPMA 4M3BA 2L7FP 3MEXA 4ENMA 4BUPA 2KRHA 3OYGA 5B66C 1QQIA 1KONA 5E1ZB 1K78B 1LUJB 5FRMA 4M6YA 2GOMA 1V55H 2H1KA 3DBHB 2E34A 1YJWI 5K5OA 1LNWA 2LY9A 3M8EA 4WK8F 3BY6A 1Y39A 3CUQB 2GIZA 3V7SA 1SFXA 3BLYA 2YU3A 1XCBA 2JA5J 3KYDB 1V5EA 2X85A 1R1VA 4UNOA 1T6SA 4A3DJ 1D3YA 4XLEA 3HSRA 1LJ9A 4PSWA 1HQCA 1R1UA 2OZUA 2ELJA 1EKEA 3L2VA 1OISA 1TWCJ 2BGCA 2X9DA 4F91B 3CC7I 1BI3A 4HEA2 3HYIA 4CCJA 3HHHA 3DEEA 4UHTA 1DGRM 4F93B 2IS4A 1XSXA 1XX5A 2F4OB 2ZSHB 2JRMA 3V4GA 2JA2A 2QEXI 2HYFA 3VDXA 4BE0A 1SD4A 2JMWA 1RIOH 2A6EF 1O7LA 1NK3P 1RR7A 4G6DA 2BZTA 2QWWA 1BM9A 3DBLB 3X2QH 1R9TJ 1ULYA 2GXGA 3OYIA 5J40A 3C3WA 5FKOA 2DLLA 2FNPA 2K5CA 4P55A 4FETA 5J8FA 3DPTA 4LGWA 3J81Z 2GZWA 2XRLA 1VQ5I 3F8NA 1E17A 1SAUA 2HU9A 2KDZA 1P6RA 2HXIA 2CFOA 2KJCA 2VXZA 2VQHA 4BJ5C 3TGNA 2D45A 2P5KA 5CVJA 2D1VA 3L2CA 2JPCA 2FNAA 1WJFA 3GZ5A 2PJPA 2LMDA 4BBSJ 3WU1B 4XBFA 3VYRB 3H3VK 4RMNA 3LNQA 2DBBA 2VOOA 3Q0VA 1KU2A 2A5YB 5EJCA 4BXFA 3OS1A 4G7HF 5DUIA 2KL4A 2XSJC 1WCMJ 2DJNA 3NAUA 3RDIA 3RCOA 1SVOA 1R23A 4Y17A 4JBAA 4MIMA 4ZZLA 2E19A 2TRTA 2IGKA 1FIAA 2IAIA 1CGPA 2Z9OA 3HKZA 2VL8A 4XLHA 4LIVA 5FLMJ 4U0VA 2XF6A 4LD5A 2LH9A 1MBFA 5FO5A 2JT1A 2B9SA 4HBLA 1OCPA 2EFNA 3JREA 1G3SA 5AIQA 5E3OA 1IDZA 2BY1A 4M6XA 3WE2A 2DMNA 3OR1C 1IF1A 5J6XA 1EH6A 3DEUA 2PJRA 2XAJA 5E1WA 3BWGA 3V7CA 2ZFUA 4WWCA 3CDHA 2A69F 3RYRA 3VODA 1A6QA 1J59A 4KIGA 3EETA 3K4MA 2XV4S 2ESNA 2R92J 2CSOA 3ELKA 4MO7A 2HQAA 4XR6A 5FJ8J 4Y13A 4IJAA 4MFDA 2O8KA 5IP9J 3JCUC 5EGOB 4QIWN 2F5CA 2F2EA 2RQQA 4X0GA 3I64A 1VI0A 3CMYA 2OCCH 2MLKA 2F4MB 4M9SA 4A12A 2HPIA 2EFWA 4EQQA 1LPQA 4RLFA 2MG4A 1YIOA 2HYJA 2X6XA 3C1DA 2BVLA 4ZYAA 2LP0A 2GBYA 4FASD 1NHAA 2NVTJ 5J3LA 3RJPA 2PJRB 1HW2A 2W1OA 5CQGA 1T0FC 1RRJA 3RPUD 3CD6I 1MBKA 2VN2A 4P1WA 4PUSA 3OYJA 1QU3A 3RKWA 2HI3A 1QVTA 2H8WA 3BC8A 2R7SA 2R7DA 3W2WA 4LMYA 1FSHA 4A69C 2F5VA 2A68F 5M3MJ 1ETOA 4B47A 4ZDLA 3DKXA 3CLOA 3W2AA 3HOUJ 3IKVA 4HX7A 2NVUB 3AG4H 3JRDA 2AHQA 2VODA 2QQ9A 1HKTA 2VPRA 2E60A 1IN4A 1X58A 3HTUA 3GTOJ 2M7BA 1HXDA 2P8TA 4IRIA 1OFCX 3BJOA 2H6BA 3M07A 4QPOA 3CO6C 2QUFA 2GA1A 1ERDA 4LB5A 3CCMI 1NTCA 3M8JA 4PSXA 3ZR8X 2V9VA 3K1NA 1U5TB 2FBKA 4Q48A 1F5TA 4BL0B 3DPUA 4N0BA 3ZGKA 2BXZA 1WKMA 3F6OA 4DQ2A 4YG2F 2EA4A 2JUGA 3E3VA 3R0AA 3WGIA 2KJBA 1FBQA 1G3WA 2RN7A 4KN7X 4LK0F 4BKXA 1G8XA 4Q4ZF 4G7OF 5K5RA 2VJJA 2F4IA 1B1BA 2HS5A 1W7PD 1TP4A 3BROA 5L3DA 3ZQ7A 3B73A 2LG4A 2FX0A 3FBNB 1OCRH 4IPAA 2HNHA 3VWBA 2F6CA 4Y52J 5IP6A 3R0JA 2L7ZA 1X4OA 1YW9A 3GTMJ 3DU5A 4CSWA 1FYLA 4HDVA 2IA2A 1MMGA 3K10A 4EM2A 4YFNF 1X3ZB 1ETXA 4IHXA 2BY3A 3FWEA 4Z2YA 3D5SC 2EZIA 1TLHB 5GADJ 1TTYA 5F04A 3VPRA 1T2KA 1U9NA 1MBJA 4XQFA 1GDTA 3BG6A 4K2EA 5ILUA 2DMUA 2H8RA 3E5XA 2CV2A 1ETYA 2E5ZA 3HOXJ 3S15J 2DPDA 1Y8RB 3N4MA 4OMYA 1Z91A 3HDDA 5ILSA 4RM2A 3VYUB 1SD7A 3WTWC 3U1KA 2ZJRF 2K85A 1YX5A 1T33A 3GTPJ 1RESA 4A3FJ 3SZPA 1LEAA 3H5NA 4HOBA 2HOAA 2M87A 3HOVJ 5D5UB 1GLNA 4WCGA 2CMPA 2CQQA 4DYRA 2DCEA 2PX9A 3CP8A 1OCZH 5CJ9A 3OY9A 1NG6A 5IT9K 3BJ6A 1R5HA 1Y1WJ 3REOA 3JSPA 3H92A 2AO9A 5CVVA 4P9UA 3F8FA 2JZYA 1U78A 3PO3J 3FKIJ 4A0XA 1UJ8A 3Q9VA 3S8PA 2BOLA 1ZR4A 2XDVA 3CUOA 1SMTA 3RSNA 3O8HA 2ISZA 3TW7A 3TOBA 1YTYA 2NS7A 2XSDC 2XPWA 2XVCA 2XAUA 2K3PA 1MMAA 2W85A 1B8IA 3GYHX 1TQMA 2D5VA 1TT5B 4ZZDA 4M3EA 3BZCA 4QSHA 4XSXF 2R93J 1A5JA 2E2HJ 3EPZA 3ISPA 5F27A 3EUAA 3FXQA 2HDWA 3I55I 4A3JJ 3S3NA 2P7CB 3RZOJ 2F5DA 1XDSA 1UFMA 2X51A 4UXNA 2Q8KA 4XRSG 4AIHA 2PG4A 1LVAA 3GFLA 2XPVA 1JKPC 4ENNA 2ZJ2A 5DTDA 2DFEA 2VC0A 3T8RA 3U21A 2XUBA 3V7RA 5E18F 2Z2SB 3WU0A 3LSHA 4IO9F 1FY7A 1H9GA 4XLFA 2R7UA 1D1BA 1N25A 1DDNA 5F0CA 2XAGA 3T8TA 2E1CA 1UAAA 1WWXA 3CZ6A 2CW7A 3D0SA 4CHUA 1DPUA 1ZG1A 4O3MA 4B4CA 5EZGA 2XGXA 1BOBA 1WGXA 3EUKL 3FXOA 3FHNA 3MVPA 2R5ZA 3IH2A 1OPCA 1L3LA 1B8IB 2IRFG 3O6BB 1QZYA 1NH3A 1GVJA 1JT6A 1L0OC 2HGCA 3DPLC 2L7MP 2M2EA 2RREA 3H9QA 2CQXA 4MLOA 4UV8A 2FBHA 4RAZA 4II2A 2E1MC 2JWTA 1H0MA 2LF8A 4IHTA 1J75A 2GWRA 2IP2A 3AG3H 3K1PA 4LG3A 3SXYA 2AXLA 2O9LA 2P81A 4A0YA 1QHGA 4XN3A 3K4JA 2EZKA 4DBRA 3ZP5A 2X4HA 4QLCU 1XTAA 3HBLA 1LFUP 1MNMC 1FOYA 2ECBA 3HOZJ 5EZHA 5IP7J 4D1QA 5L3FA 3QPHA 3BZKA 2R5ZB 2AQFA 3CCSI 3PJRA 3J7AY 1FYMA 3ROUA 2UUZA 1ONVA 2CQKA 3MQ0A 4GYIA 3S2WA 4Z6YA 3TP0A 1S29A 1QBJA 2UZKA 2BBYA 4YIRX 2L01A 3G1LA 1PP8F 4M71A 3NWTA 1STZA 5M5YJ 3Q5FA 2E71A 4I0AA 2CW8A 4CCOA 1WVRA 3BPVA 3IAS2 3GMEA 4BHBA 2L9RA 2EV6A 2YPRA 1JUPA 3UR3C 2M1BA 1GVDA 2MBFA 5D4SA 3S1RJ 1W1WE 1ZGAA 3MD2A 1JTYA 1R58A 3K4CA 4E7SA 2LBFB 1A35A 1WI9A 5J1UA 2K4JA 2WB1N 3LQQA 3HSFA 4NQWB 2HZTA 2LC2A 3LSMA 2AS5F 3V8JA 3CP2A 3DTEA 3BR5A 4GYGA 3IP4B 2BXYA 2GAUA 1R4MB 2W24A 1Z6TA 3IUOA 3LA3A 3TBIA 2XKOA 5D8KB 2KISA 4I01A 3F3XA 3ABUA 1ON2A 2XPUA 2RGVA 2MW8A 3J80Z 3GTKJ 2NVXJ 3HRMA 4HQMA 4A3BJ 1SEUA 1YS6A 3W3CA 2ADUA 1S3JA 3KP7A 5JHUA 4XICA 1WH5A 1IN5A 1OCTC 1LDDA 3A01A 3D1NI 4LLLA 1RETA 3J81K 2CRGA 4XMYA 4RB1A 1FBSA 2QYOA 4OINF 3OYLA 2ZFWA 3WHBA 2AXTC 3MZYA 1R1TA 2ZBKA 1SVMA 3H0GJ 5KK1A 1H9TA 3OMYA 1DU6A 2R4GA 5FFZA 1U3EM 3H36A
chains in the Genus database with same CATH topology
4J19A 1GV2A 3DEWA 4A3DJ 4A3IJ 4S0HB 1GUUA 3BR2A 4UUSB 4I76A 4RDUA 3S2DJ 5HODA 1TWCJ 4DYCA 2HOTA 1K83J 2X9DA 1X2NA 1U9OA 2I10A 1P7JA 2R5YB 2K9NA 3BTIA 2EQRA 4C3IJ 3LOCA 1I3QJ 1SFOJ 3HGYA 3ZQLA 2JMWA 4L5EA 1EF4A 5M5WJ 2DA7A 1TWGJ 1NK3P 1ETQA 1RR7A 2DA6A 2LK2A 3B6AA 4G12A 1I6HJ 1UHSA 2DA1A 1R9TJ 3GTQJ 3GTGJ 4JX4A 3HM5A 5FKOA 2DA2A 4A3GJ 2XRLA 1JJ8C 2VKEA 2DA4A 1JKRC 3OIOA 2KDZA 2HXIA 3ZQCA 3DCFA 2DMPA 2Y2ZA 4X6AJ 4A3LJ 1OJLA 2E1OA 1FJLA 4BBSJ 3BTLA 3H3VK 1BW5A 3LNQA 4A3EJ 2ZB9A 3Q0VA 5DS9A 2JJ7A 4A3MJ 5FKKA 1ENHA 2QF7A 1IJWC 1E3OC 1WCMJ 2EZHA 2DJNA 3NAUA 5C4JJ 2HDDA 2CJJA 5IOZA 3BQZA 3BTJA 4IHWA 5EEAA 4MIMA 2WV1A 2E19A 4M3GA 2TRTA 2K9SA 4D7MA 1FIAA 2IAIA 3ZQHA 1LFBA 2M34A 3HEFA 1FEXA 3ZQIA 4AC0A 5FLMJ 1FTZA 1JGGA 1LE8A 2ME6A 2JA5J 1MBFA 3TW6A 4D7NA 1PUFB 1OCPA 1ETVA 3JREA 5E3OA 1IDZA 2FD5A 3G1OA 1SANA 2DMNA 3K2AA 4XK4A 1D5YA 3L1PA 3BR1A 1JUSA 4W97A 1B72A 2N8GA 1FTTA 3BG3A 1MSFC 5EG0B 1HCRA 2JN6A 2R92J 3C2BA 3I4NJ 4MO7A 4AUXA 5FJ8J 2JA7J 5K7FA 4MFDA 2O8KA 4UUTA 5IP9J 2IBDA 1ITYA 3W6VA 3FIWA 5EGOB 4QIWN 4GFBA 3FISA 3HKZN 4C2MJ 1TWAJ 1VI0A 3CMYA 1HDDC 2FQ4A 3QPSA 1GT0C 2DA3A 1LE8B 2MGQA 1POGA 3BG9A 4JX5A 5EF6A 3SFIA 2MG4A 2HYJA 4FE7A 3A03A 1O4XA 3S1NJ 2LP0A 3A02A 1BJZA 1MBEA 2GBYA 3HGGA 2EZLA 1IDYA 2NVTJ 5J3LA 4EEFG 3JR9A 4BBRJ 1MH4A 3JRAA 1MBKA 2E2IJ 2DA5A 2VI6A 4M3FA 1IUFA 2R7ZJ 2LLKA 2G0EA 2XB5A 2HI3A 1QVTA 4FTHA 1I50J 2M9HA 3CDLA 4IHYA 4A69C 4ABZA 4V2GA 5M3MJ 3A01B 1ETOA 2OF7A 5K7ZA 3HOUJ 5FKNA 3JRGA 3IH4A 2NS8A 5J1RA 3JRDA 1JKQC 2AHQA 1BA5A 4W1UA 2VPRA 1VF9A 2COBA 3QQAA 2K40A 1X58A 3GTOJ 4B1RA 3S1MJ 1GV5A 3BG5A 1OFCX 1CQTA 4IHVA 1P7IA 5IYBJ 1RKWA 2O7OA 2QCOA 1NTCA 1HOMA 2EBIA 2CUEA 1ORKA 5EDNA 1XC5A 1ZQ3P 1H89C 5F1JA 2LR8A 4JX6A 5GP9A 4I6ZA 4X1EA 3GBGA 4V2FA 4HNVA 1JT0A 1K61A 2HXOA 5K7HA 2GLOA 3CQZJ 4BKXA 3E7LA 5JLWA 1H8AC 1VNDA 3HOWJ 9ANTA 3BR0A 2LTPA 1MSEC 3LSRA 1AU7A 2ECCA 5JLXA 2ME0A 1IG7A 5FKLA 4A93J 2FX0A 3ZQGA 3JRFA 4DYQA 1W0UA 1WH7A 4D5FA 1WPKA 5E3MA 4C3JJ 4Y52J 5IP6A 2L7ZA 1TC3C 1QVUA 3JRCA 2LD5A 2PMZN 1IGNA 3GTMJ 4CYCA 2XGEA 4RBOA 4DZJA 2Y0SN 3F0CA 4FISA 2HOSA 4A3CJ 1ETXA 4IHXA 3S1QJ 1W0TA 5J1YA 2EZIA 1JKOC 1F36A 5F04A 3VPRA 4QTRA 5F08A 1U9NA 5C4XJ 1MBJA 1GDTA 5IOYA 2DMUA 2H8RA 1BW6A 1ETYA 3HOXJ 3S15J 2JA8J 1HDPA 1U8BA 3ZOBA 3SJMA 3HDDA 4A3KJ 2IEKA 3LSPA 4DW6A 3Q0UA 1HLVA 1T33A 3GTPJ 1RESA 4A3FJ 1APLC 3MN2A 2HOAA 3K7AJ 3HOVJ 1UMQA 3MKLA 2CQQA 4DYRA 5IYCJ 4XIDA 3LSGA 2VUMJ 5FKMA 1UG2A 5EYRA 5E3NA 4CYCB 2R0QC 1Y1WJ 2ID6A 2WAQN 2YU9J 2AO9A 1U78A 2XGCA 1X2MA 4XRSA 3FKIJ 3PO3J 4BY7J 2CU7A 1ZR4A 5E3LA 2DN0A 3O8HA 3RKQA 3TW7A 2R5YA 3NARA 2NS7A 1VFCA 3SDGA 3S14J 2NOGA 2XSDC 2XPWA 2X48A 1IC8A 2K9QA 2JK3A 2GM4A 3TP3A 1B8IA 1B72B 2D5VA 4M3EA 2M0CA 4QSHA 1AHDP 1XG1A 2XB0X 2R93J 1A5JA 2E2HJ 5F27A 3GTLJ 4A3JJ 3RZOJ 2Y30A 3HB9A 3BR3A 1WI3A 4XRSG 4FE4A 2XPVA 1JKPC 5IYDJ 5M5XJ 2XGDA 4MFEA 3QPLA 5DTDA 3UKGA 2ELKA 3Q3SA 2EH3A 3BQYA 3IV5A 3TEDA 3I4MJ 3B6CA 1ZKGA 2TCTA 1ZGWA 3BT9A 2B63J 5F0CA 2ID3A 1H88C 2X6OA 2JA6J 1JUMA 4B4CA 3WHCA 4XRMA 3BR6A 3JRHA 5EZGA 1MH3A 1WGXA 2LFBA 3MVPA 4LOCA 4B3AA 2R5ZA 3IH2A 1B8IB 2E2JJ 3PM1A 4IEJA 2KT0A 1JT6A 2L7MP 2M2EA 5GPCA 1HF0A 1RKTA 3JRIA 1T56A 2CQXA 4MLOA 5M3FJ 4BXXJ 1XS9A 2JWTA 4C3HJ 3PO2J 1F43A 3LSJA 3GTJJ 2DMTA 2LKXA 3BTCA 3HOYJ 2O9LA 1Q1VA 1Z0XA 2P81A 3OSGA 2W48A 3S2HJ 3CCYA 3RQIA 2EZKA 2M8GX 1IRZA 1PUFA 3OOUA 2FJ1A 1IV6A 2VKVA 1TWHJ 4NDLA 3HBLA 1LFUP 1MNMC 5IPAA 1AKHA 2ECBA 3HOZJ 5EZHA 5IP7J 1JJ6C 3FK6A 1QPIA 2R5ZB 3S16J 5C44J 3M4OJ 1DU0A 5F0HA 5EG0A 1YRNA 2DMQA 2Y9ZA 1ETKA 3TP0A 1Y1VJ 2RAEA 4FCYA 3FK7A 3G1LA 2DTZA 3S17J 4JP0A 3JRBA 4Y7NJ 5M5YJ 4M6VA 1FIPA 2Y9YA 5EGOA 1ZTRA 1ZK8A 2L9RA 1ETWA 1JUPA 2YS9A 3ZQFA 1GVDA 1MBHA 1ZR2A 2HQ5A 4BY1J 3S1RJ 3O8GA 1S7EA 4JYKA 1JTYA 4M3DA 5J1UA 2WB1N 2OPTA 2NVQJ 2CUFA 1AKHB 4D5CA 5C3EJ 1MBGA 3BR5A 2LVSA 3Q0WA 1A6IA 4DZPA 1NK2P 2Y31A 5BNGA 4UUSA 2NVYJ 1YRNB 2MSYA 1BL0A 2XPUA 2MW8A 3GTKJ 1Z77A 2NVXJ 4M3BA 4A3BJ 3RZDJ 2L0KA 3M3YJ 2L7FP 4XICA 1WH5A 1RPWA 1OCTC 3A01A 3D1NI 5FLVA 1G2HA 3G1MA 1RETA 2CRGA 2H1KA 2LY9A 3OSFA 5GPAA 3WHBA 1QRYA 4AYBN 3H0GJ 1DU6A 1TWFJ 1JTXA 3IH3A 5F0FA 2YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J19 A;  1GV2 A;  3DEW A;  4A3D J;  4A3I J;  4S0H B;  1GUU A;  3BR2 A;  4UUS B;  4I76 A;  4RDU A;  3S2D J;  5HOD A;  1TWC J;  4DYC A;  2HOT A;  1K83 J;  2X9D A;  1X2N A;  1U9O A;  2I10 A;  1P7J A;  2R5Y B;  2K9N A;  3BTI A;  2EQR A;  4C3I J;  3LOC A;  1I3Q J;  1SFO J;  3HGY A;  3ZQL A;  2JMW A;  4L5E A;  1EF4 A;  5M5W J;  2DA7 A;  1TWG J;  1NK3 P;  1ETQ A;  1RR7 A;  2DA6 A;  2LK2 A;  3B6A A;  4G12 A;  1I6H J;  1UHS A;  2DA1 A;  1R9T J;  3GTQ J;  3GTG J;  4JX4 A;  3HM5 A;  5FKO A;  2DA2 A;  4A3G J;  2XRL A;  1JJ8 C;  2VKE A;  2DA4 A;  1JKR C;  3OIO A;  2KDZ A;  2HXI A;  3ZQC A;  3DCF A;  2DMP A;  2Y2Z A;  4X6A J;  4A3L J;  1OJL A;  2E1O A;  1FJL A;  4BBS J;  3BTL A;  3H3V K;  1BW5 A;  3LNQ A;  4A3E J;  2ZB9 A;  3Q0V A;  5DS9 A;  2JJ7 A;  4A3M J;  5FKK A;  1ENH A;  2QF7 A;  1IJW C;  1E3O C;  1WCM J;  2EZH A;  2DJN A;  3NAU A;  5C4J J;  2HDD A;  2CJJ A;  5IOZ A;  3BQZ A;  3BTJ A;  4IHW A;  5EEA A;  4MIM A;  2WV1 A;  2E19 A;  4M3G A;  2TRT A;  2K9S A;  4D7M A;  1FIA A;  2IAI A;  3ZQH A;  1LFB A;  2M34 A;  3HEF A;  1FEX A;  3ZQI A;  4AC0 A;  5FLM J;  1FTZ A;  1JGG A;  1LE8 A;  2ME6 A;  2JA5 J;  1MBF A;  3TW6 A;  4D7N A;  1PUF B;  1OCP A;  1ETV A;  3JRE A;  5E3O A;  1IDZ A;  2FD5 A;  3G1O A;  1SAN A;  2DMN A;  3K2A A;  4XK4 A;  1D5Y A;  3L1P A;  3BR1 A;  1JUS A;  4W97 A;  1B72 A;  2N8G A;  1FTT A;  3BG3 A;  1MSF C;  5EG0 B;  1HCR A;  2JN6 A;  2R92 J;  3C2B A;  3I4N J;  4MO7 A;  4AUX A;  5FJ8 J;  2JA7 J;  5K7F A;  4MFD A;  2O8K A;  4UUT A;  5IP9 J;  2IBD A;  1ITY A;  3W6V A;  3FIW A;  5EGO B;  4QIW N;  4GFB A;  3FIS A;  3HKZ N;  4C2M J;  1TWA J;  1VI0 A;  3CMY A;  1HDD C;  2FQ4 A;  3QPS A;  1GT0 C;  2DA3 A;  1LE8 B;  2MGQ A;  1POG A;  3BG9 A;  4JX5 A;  5EF6 A;  3SFI A;  2MG4 A;  2HYJ A;  4FE7 A;  3A03 A;  1O4X A;  3S1N J;  2LP0 A;  3A02 A;  1BJZ A;  1MBE A;  2GBY A;  3HGG A;  2EZL A;  1IDY A;  2NVT J;  5J3L A;  4EEF G;  3JR9 A;  4BBR J;  1MH4 A;  3JRA A;  1MBK A;  2E2I J;  2DA5 A;  2VI6 A;  4M3F A;  1IUF A;  2R7Z J;  2LLK A;  2G0E A;  2XB5 A;  2HI3 A;  1QVT A;  4FTH A;  1I50 J;  2M9H A;  3CDL A;  4IHY A;  4A69 C;  4ABZ A;  4V2G A;  5M3M J;  3A01 B;  1ETO A;  2OF7 A;  5K7Z A;  3HOU J;  5FKN A;  3JRG A;  3IH4 A;  2NS8 A;  5J1R A;  3JRD A;  1JKQ C;  2AHQ A;  1BA5 A;  4W1U A;  2VPR A;  1VF9 A;  2COB A;  3QQA A;  2K40 A;  1X58 A;  3GTO J;  4B1R A;  3S1M J;  1GV5 A;  3BG5 A;  1OFC X;  1CQT A;  4IHV A;  1P7I A;  5IYB J;  1RKW A;  2O7O A;  2QCO A;  1NTC A;  1HOM A;  2EBI A;  2CUE A;  1ORK A;  5EDN A;  1XC5 A;  1ZQ3 P;  1H89 C;  5F1J A;  2LR8 A;  4JX6 A;  5GP9 A;  4I6Z A;  4X1E A;  3GBG A;  4V2F A;  4HNV A;  1JT0 A;  1K61 A;  2HXO A;  5K7H A;  2GLO A;  3CQZ J;  4BKX A;  3E7L A;  5JLW A;  1H8A C;  1VND A;  3HOW J;  9ANT A;  3BR0 A;  2LTP A;  1MSE C;  3LSR A;  1AU7 A;  2ECC A;  5JLX A;  2ME0 A;  1IG7 A;  5FKL A;  4A93 J;  2FX0 A;  3ZQG A;  3JRF A;  4DYQ A;  1W0U A;  1WH7 A;  4D5F A;  1WPK A;  5E3M A;  4C3J J;  4Y52 J;  5IP6 A;  2L7Z A;  1TC3 C;  1QVU A;  3JRC A;  2LD5 A;  2PMZ N;  1IGN A;  3GTM J;  4CYC A;  2XGE A;  4RBO A;  4DZJ A;  2Y0S N;  3F0C A;  4FIS A;  2HOS A;  4A3C J;  1ETX A;  4IHX A;  3S1Q J;  1W0T A;  5J1Y A;  2EZI A;  1JKO C;  1F36 A;  5F04 A;  3VPR A;  4QTR A;  5F08 A;  1U9N A;  5C4X J;  1MBJ A;  1GDT A;  5IOY A;  2DMU A;  2H8R A;  1BW6 A;  1ETY A;  3HOX J;  3S15 J;  2JA8 J;  1HDP A;  1U8B A;  3ZOB A;  3SJM A;  3HDD A;  4A3K J;  2IEK A;  3LSP A;  4DW6 A;  3Q0U A;  1HLV A;  1T33 A;  3GTP J;  1RES A;  4A3F J;  1APL C;  3MN2 A;  2HOA A;  3K7A J;  3HOV J;  1UMQ A;  3MKL A;  2CQQ A;  4DYR A;  5IYC J;  4XID A;  3LSG A;  2VUM J;  5FKM A;  1UG2 A;  5EYR A;  5E3N A;  4CYC B;  2R0Q C;  1Y1W J;  2ID6 A;  2WAQ N;  2YU9 J;  2AO9 A;  1U78 A;  2XGC A;  1X2M A;  4XRS A;  3FKI J;  3PO3 J;  4BY7 J;  2CU7 A;  1ZR4 A;  5E3L A;  2DN0 A;  3O8H A;  3RKQ A;  3TW7 A;  2R5Y A;  3NAR A;  2NS7 A;  1VFC A;  3SDG A;  3S14 J;  2NOG A;  2XSD C;  2XPW A;  2X48 A;  1IC8 A;  2K9Q A;  2JK3 A;  2GM4 A;  3TP3 A;  1B8I A;  1B72 B;  2D5V A;  4M3E A;  2M0C A;  4QSH A;  1AHD P;  1XG1 A;  2XB0 X;  2R93 J;  1A5J A;  2E2H J;  5F27 A;  3GTL J;  4A3J J;  3RZO J;  2Y30 A;  3HB9 A;  3BR3 A;  1WI3 A;  4XRS G;  4FE4 A;  2XPV A;  1JKP C;  5IYD J;  5M5X J;  2XGD A;  4MFE A;  3QPL A;  5DTD A;  3UKG A;  2ELK A;  3Q3S A;  2EH3 A;  3BQY A;  3IV5 A;  3TED A;  3I4M J;  3B6C A;  1ZKG A;  2TCT A;  1ZGW A;  3BT9 A;  2B63 J;  5F0C A;  2ID3 A;  1H88 C;  2X6O A;  2JA6 J;  1JUM A;  4B4C A;  3WHC A;  4XRM A;  3BR6 A;  3JRH A;  5EZG A;  1MH3 A;  1WGX A;  2LFB A;  3MVP A;  4LOC A;  4B3A A;  2R5Z A;  3IH2 A;  1B8I B;  2E2J J;  3PM1 A;  4IEJ A;  2KT0 A;  1JT6 A;  2L7M P;  2M2E A;  5GPC A;  1HF0 A;  1RKT A;  3JRI A;  1T56 A;  2CQX A;  4MLO A;  5M3F J;  4BXX J;  1XS9 A;  2JWT A;  4C3H J;  3PO2 J;  1F43 A;  3LSJ A;  3GTJ J;  2DMT A;  2LKX A;  3BTC A;  3HOY J;  2O9L A;  1Q1V A;  1Z0X A;  2P81 A;  3OSG A;  2W48 A;  3S2H J;  3CCY A;  3RQI A;  2EZK A;  2M8G X;  1IRZ A;  1PUF A;  3OOU A;  2FJ1 A;  1IV6 A;  2VKV A;  1TWH J;  4NDL A;  3HBL A;  1LFU P;  1MNM C;  5IPA A;  1AKH A;  2ECB A;  3HOZ J;  5EZH A;  5IP7 J;  1JJ6 C;  3FK6 A;  1QPI A;  2R5Z B;  3S16 J;  5C44 J;  3M4O J;  1DU0 A;  5F0H A;  5EG0 A;  1YRN A;  2DMQ A;  2Y9Z A;  1ETK A;  3TP0 A;  1Y1V J;  2RAE A;  4FCY A;  3FK7 A;  3G1L A;  2DTZ A;  3S17 J;  4JP0 A;  3JRB A;  4Y7N J;  5M5Y J;  4M6V A;  1FIP A;  2Y9Y A;  5EGO A;  1ZTR A;  1ZK8 A;  2L9R A;  1ETW A;  1JUP A;  2YS9 A;  3ZQF A;  1GVD A;  1MBH A;  1ZR2 A;  2HQ5 A;  4BY1 J;  3S1R J;  3O8G A;  1S7E A;  4JYK A;  1JTY A;  4M3D A;  5J1U A;  2WB1 N;  2OPT A;  2NVQ J;  2CUF A;  1AKH B;  4D5C A;  5C3E J;  1MBG A;  3BR5 A;  2LVS A;  3Q0W A;  1A6I A;  4DZP A;  1NK2 P;  2Y31 A;  5BNG A;  4UUS A;  2NVY J;  1YRN B;  2MSY A;  1BL0 A;  2XPU A;  2MW8 A;  3GTK J;  1Z77 A;  2NVX J;  4M3B A;  4A3B J;  3RZD J;  2L0K A;  3M3Y J;  2L7F P;  4XIC A;  1WH5 A;  1RPW A;  1OCT C;  3A01 A;  3D1N I;  5FLV A;  1G2H A;  3G1M A;  1RET A;  2CRG A;  2H1K A;  2LY9 A;  3OSF A;  5GPA A;  3WHB A;  1QRY A;  4AYB N;  3H0G J;  1DU6 A;  1TWF J;  1JTX A;  3IH3 A;  5F0F A;  2YUS A; 
#chains in the Genus database with same CATH topology
 2VJI A;  3DEW A;  1MZB A;  1EJ9 A;  1YE9 A;  2XAQ A;  3E5U A;  1TZL A;  4WX9 A;  1UG0 A;  5FD5 A;  4S0H B;  1RUO A;  4OIP F;  2HKX A;  4Q5S F;  4RDU A;  2EFQ A;  2LKS A;  3K4N A;  1XMA A;  2VON A;  5FFX A;  1IRF A;  3QU3 A;  4AVZ A;  3I5U A;  2DJI A;  2I10 A;  1FNN A;  3C18 A;  1RZ4 A;  2WV0 A;  1QHH D;  4A2U A;  2R5Y B;  3FKJ A;  4R1H A;  3I59 A;  4IHS A;  4L9N A;  4ZYG A;  3K2Z A;  3F21 A;  2EQR A;  4C3I J;  4MGR A;  4BE2 A;  1P2F A;  2M5W A;  1I3Q J;  3WTY C;  3HGY A;  2DI3 A;  1EF4 A;  3U2R A;  3OYH A;  4AD9 A;  1TWG J;  2FOK A;  3ML6 A;  3G4S I;  2DA6 A;  3B6A A;  1VTN C;  1BR4 A;  3GLL A;  4G12 A;  4HPQ A;  1MIJ A;  3QPT A;  5F1R A;  2CQN A;  4CDG A;  5K1Y A;  4AIK A;  4LLN A;  3GTG J;  1LQ1 A;  4XLN F;  3PUB A;  1CF7 A;  2DA2 A;  3OYK A;  2PBI A;  5DCM A;  2DA4 A;  3ULQ B;  4HNT A;  1JKR C;  3P9C A;  4Y4R A;  4MEY F;  1P4W A;  2VE9 A;  1B9N A;  2K27 A;  2XIG A;  4M74 A;  3OYC A;  3JAM K;  1XB4 A;  4HLY A;  3PQK A;  4A3L J;  1KYZ A;  4BAY A;  2IJL A;  1O7F A;  1OJL A;  2E1O A;  2PFB A;  3E5Q A;  3LFU A;  2O6G E;  4L5I A;  4NUB A;  4A3E J;  2ZB9 A;  4LK1 F;  5DS9 A;  4G7Z F;  1Z21 A;  4HA8 A;  3IRQ A;  4A3M J;  1ENH A;  1IJW C;  2NXN B;  4UB8 C;  1WSU A;  5TGT A;  2JSP A;  1E3P A;  3M8F A;  5C4J J;  2HDD A;  1MJA A;  1XGO A;  4D9J A;  1MMS A;  3FM5 A;  2E35 A;  2VBZ A;  4IHW A;  3WU2 C;  4RGU A;  1YQA A;  3DTK A;  5LHI A;  4UVB A;  1CF7 B;  3ZQH A;  1U2W A;  2M34 A;  4ZDO A;  2DT5 A;  4OU0 A;  1B4A A;  4N9I A;  3J7Z I;  1J09 A;  2EV5 A;  1FTZ A;  5LLQ A;  5DCM B;  1YJ9 I;  4BJT A;  2MC3 A;  3L00 A;  1LEB A;  1O57 A;  2ME6 A;  2ZXJ A;  1J2X A;  4NHJ A;  2I8D A;  4YEJ A;  4D7N A;  3RTR A;  1PUF B;  2KLO A;  2DT7 B;  3ZMV A;  3G1O A;  3ERE D;  4Y33 A;  4IOC F;  4E7H A;  3K2A A;  4Y3O A;  1S8N A;  2IVM A;  2ZSI B;  3ECO A;  1SC7 A;  5CVR A;  4CZZ A;  4FT8 A;  1JUS A;  3GFM A;  4W97 A;  5CYV A;  3F72 A;  3ZN0 A;  3E6M A;  3VSK A;  2A05 A;  4PCQ A;  2V7F A;  2KIQ A;  5KAI C;  1BI1 A;  4PK4 A;  1JHH A;  2XRO A;  1R71 A;  2H09 A;  3C2B A;  3H9G A;  4AUX A;  5HLG A;  4HQE A;  1Z6R A;  3EUH A;  2LRE A;  3MFK A;  1UCR A;  5ICF A;  1X1C A;  2IBD A;  1YLF A;  2M3A A;  4GFB A;  3FIS A;  1VQK I;  4RGX A;  4C2M J;  1TWA J;  5FGM A;  2FQ4 A;  2RNG A;  3A4C A;  4WXC A;  1GT0 C;  4ESB A;  3GCM A;  4EVI A;  2VOP A;  5DM7 F;  2EJR A;  3A03 A;  4ESF A;  1O4X A;  3S1N J;  2IT0 A;  2V9K A;  3AL0 C;  3E6C C;  1BJZ A;  3PNY A;  1MBE A;  1Y8Q B;  3HGG A;  4QPQ A;  1BBY A;  1HC8 A;  2EZL A;  3I58 A;  4GRI A;  2Y69 H;  1KYW A;  4RB0 A;  3KP6 A;  3JRA A;  5D8L B;  4A6D A;  1IUF A;  3VSL A;  3CJQ B;  3WTX C;  2R7Z J;  2LLK A;  2XB5 A;  3AFH A;  2HQR A;  3CDL A;  2HVR A;  4IHY A;  1XGM A;  2OC6 A;  3JSO A;  2DTR A;  4ZDP A;  1GHC A;  2OF7 A;  3R60 A;  1PP7 U;  2NRA C;  5FKN A;  3JRG A;  3MKY B;  3IH4 A;  1WFX A;  2NS8 A;  3PIO F;  2R3S A;  3LA7 A;  4U87 A;  3RPQ A;  3KP2 A;  4L5J A;  2XHK A;  3KEO A;  4GXO A;  4AIJ A;  1D0Y A;  1VF9 A;  3QQA A;  4C30 A;  2R7W A;  4BE1 A;  3S1M J;  1J0R A;  1S72 I;  4F52 A;  1T8I A;  4IHV A;  3SYT A;  5IYB J;  2QCO A;  2O7O A;  1A31 A;  3EYY A;  1ZLJ A;  2OD5 A;  5ICC A;  5BPI A;  2CUE A;  5EDN A;  1DPR A;  1ZQ3 P;  1VQO I;  2Y75 A;  1FT9 A;  5F1J A;  2ZME A;  4I6Z A;  1YJN I;  2IS2 A;  3GLX A;  4X1E A;  1IV8 A;  3GW2 A;  3GBG A;  3TOA A;  4V2F A;  2CQ7 A;  2FU4 A;  4HNV A;  2CYY A;  3CQZ J;  1AA7 A;  4E7Z A;  1H8A C;  1VND A;  3HOW J;  2EK5 A;  3OS2 A;  4H4K C;  2P5L C;  1EH7 A;  2KP6 A;  5FRO A;  4OOI A;  2FMY A;  3FM3 A;  3DKW A;  4LIU A;  5FKL A;  2MC4 A;  2A07 F;  4XNF A;  2QQA A;  3G6E I;  3SZT A;  3QOP A;  3MKW B;  4IX7 A;  1W0U A;  5AON A;  1ZN2 A;  2V9P A;  3KP5 A;  2X0L A;  1QVU A;  3JRC A;  2PMZ N;  5IY5 H;  4ZH4 F;  2QA4 I;  3WTT C;  4U88 A;  4FIS A;  1S5L C;  2ZME B;  4A3C J;  2L3D A;  1W0T A;  1MMN A;  2WAE A;  5B5E C;  1OR7 C;  4QTR A;  1OKR A;  1OYY A;  1V4R A;  4L9J A;  4HF0 A;  2ZKZ A;  1J7K A;  5KNL A;  1B59 A;  1ACI A;  1BW6 A;  2ZC2 A;  5DV5 A;  3GXO A;  4DGW B;  1MJ9 A;  4PFP A;  4EM1 A;  3G3Z A;  3WGG A;  2CO5 A;  2KZG A;  2G7U A;  5JR3 A;  2HR3 A;  2X6W A;  4OMZ A;  4G6T B;  2Q0O A;  2VT3 A;  3LWF A;  2QZ8 A;  1WQ2 A;  5LGT A;  1APL C;  3MN2 A;  3JTH A;  5A2Q Z;  5DD4 A;  1UMQ A;  5GAG J;  2PI0 A;  3MKL A;  2A5W A;  3K6G A;  1C0W A;  2VUM J;  2R7Q A;  3F8M A;  2V1U A;  1UG2 A;  5EYR A;  5F64 A;  2R0Q C;  2MH2 A;  5J47 A;  4BDY A;  4FHT A;  3H3Z A;  4WF2 A;  5LGN A;  1WRJ A;  2UXX A;  4ZYD A;  1X2M A;  1XDU A;  4E6K G;  1HW5 A;  3QOD A;  2Z99 A;  5E3L A;  2DN0 A;  1ZRD A;  3N97 A;  2FSW A;  2KIM A;  1VFC A;  3S14 J;  3R61 A;  4MNU A;  1IC8 A;  3S32 A;  1VQ9 I;  4NC8 A;  4PJN A;  4HW0 A;  3GFI A;  1D8K A;  4B09 A;  2GM4 A;  2PLY A;  3O3K A;  4NNJ A;  4IQJ A;  2M7A A;  3F8B A;  3H9J A;  1T98 A;  4OAY A;  1XG1 A;  2NNN A;  3LAJ A;  1A04 A;  4FQG A;  1HW1 A;  2Y30 A;  2FEZ A;  2XC7 A;  1ZHF A;  5DM6 F;  3MWM A;  1PDN C;  5IYD J;  3DLA A;  3SQN A;  2XGD A;  3CCJ I;  3HIF A;  2QSH X;  1W5S A;  5BMZ A;  4U0W A;  2CUZ A;  2EIL H;  4KIS A;  2LSO A;  2FXA A;  2P5V A;  4RS8 A;  4PZJ A;  3OWT A;  2EH3 A;  3IV5 A;  1OYW A;  2TCT A;  1OMI A;  3BT9 A;  1RR8 C;  1N75 A;  1PYV A;  4N4O B;  5E1X A;  2EIN H;  2ID3 A;  3C2H A;  2JA6 J;  1Z3Y A;  2KFD A;  1NG7 A;  4XRF A;  5L3B A;  3EQL F;  3BR6 A;  3JRH A;  3G73 A;  2MAB A;  2W84 A;  4BS9 A;  3DBR B;  1MH3 A;  2LFB A;  1SD6 A;  2E7W A;  4B3A A;  2OTJ I;  5KCM A;  2E2J J;  3PM1 A;  5HVQ C;  1Q1H A;  1VQ8 I;  4PDK A;  2XF5 A;  2KT0 A;  3AG2 H;  3ABT A;  4EJO A;  3KIO A;  4XOR A;  5GPC A;  3ZMS A;  3JRI A;  3ZMT A;  3SDB A;  3TO7 A;  4B48 A;  5M3F J;  3ESW B;  4C3H J;  2JTV A;  1VQL I;  4UVA A;  1F43 A;  1XD7 A;  2KPM A;  3LSJ A;  3K4B A;  4HX8 A;  3BTC A;  4EJV A;  1TQP A;  2VE8 A;  1Q1V A;  4ZJZ A;  3OSG A;  3HG9 A;  2W48 A;  3IKT A;  3RQI A;  1WHU A;  1K4S A;  4OIO F;  1ZRE A;  3GF2 A;  2WB1 A;  1IV6 A;  1SFK A;  1VQ4 I;  3GO5 A;  1TWH J;  3J80 K;  2CV0 A;  1MJB A;  5J4Y A;  2L9V A;  1X19 A;  1T39 A;  5FLX K;  3M4O J;  4RGS A;  4B44 A;  5KHD A;  1GXQ A;  5EG0 A;  1YRN A;  1R6R A;  2DMQ A;  2Y9Z A;  2E5N A;  3MCZ A;  1Y1V J;  2RAE A;  3QWL A;  2VBY A;  2JQ7 A;  1HA8 A;  3VEP A;  2LNB A;  3FK7 A;  2DTZ A;  3CUQ C;  2ESH A;  2L54 A;  2OCE A;  2HPM A;  4MQ9 F;  1ZTR A;  1ZK8 A;  1ETW A;  4JOM A;  4E4H A;  1ZR2 A;  2P7V B;  2DT6 A;  2HQ5 A;  3KCC A;  4RA2 A;  2A6H F;  1BIA A;  2G7H A;  2R7T A;  1OCC H;  3A1Y A;  5LGU A;  4M3D A;  4CUG A;  4KA4 A;  3CC2 I;  2CUF A;  2Y48 A;  3QAH A;  3QYE A;  4I02 A;  1JE8 A;  1RNL A;  4XOT A;  3SEQ A;  4D5C A;  4CA0 A;  4DZP A;  1A6I A;  5DEQ A;  3D5R C;  5BPD A;  4BHC A;  1IXR C;  2HVS A;  5KAF C;  4RAY A;  4CH7 A;  4C9Y A;  3KZY A;  3IL2 A;  1YRN B;  3COA C;  3P9K A;  2F48 A;  1VQP I;  1Z77 A;  3P9I A;  4AID A;  3F6V A;  4BAC A;  1BIB A;  1MND A;  4LB6 B;  2WAD A;  2L0K A;  2OA4 A;  2RKH A;  4G8X A;  2KIU A;  1RPW A;  1Z1D A;  4CIC A;  1G2H A;  3L9F A;  5FLV A;  1MDM A;  3H35 A;  3PNV A;  1WJE A;  3LFK A;  2F5E A;  3CMA I;  2Z5U A;  3ZMU A;  3OSF A;  5GPA A;  2XAS A;  1MD0 A;  1QRY A;  1RI7 A;  3HUG A;  4DNC A;  3L2R A;  2RQP A;  3OYB A;  1FZP B;  4IL6 C;  3GX4 X;  3CTA A;  3I4N J;  2K4B A;  2YUS A;  3A0B C;  4I09 A;  5DUK A;  1W5T A;  3UNG C;  3OYE A;  4J19 A;  3RI4 A;  1GV2 A;  1LB2 A;  4ANJ A;  4A3I J;  1GUU A;  3HTS B;  3PFY A;  1OYI A;  4RAG A;  4C2T A;  2DFI A;  3VFZ A;  2STT A;  3BR2 A;  5LHH A;  4I76 A;  2HOE A;  4U7B A;  3CCU I;  4CO8 A;  2ACJ A;  3S2D J;  5HOD A;  1TNT A;  4DYC A;  1P9Q C;  4IZZ A;  1PUE E;  3SFZ A;  2JVG A;  1UST A;  5DCF A;  3MKZ A;  1U9O A;  3K1M A;  4KMF A;  2F5F A;  1P7J A;  2BV6 A;  2FQ3 A;  1ZAO A;  4IVN A;  1IN8 A;  5JVT A;  2XAF A;  4EJW A;  3LOC A;  2XF7 A;  4Y15 A;  5LHG A;  1SFO J;  2G9W A;  4ZYH A;  4L5E A;  1FMV A;  3R6S A;  2DPU A;  3CCQ I;  4OAZ A;  2QQB A;  1YW7 A;  1ETQ A;  2NYX A;  1I6H J;  1GXP A;  3AG1 H;  5D5X B;  1UHS A;  1T95 A;  2LKP A;  3HUG B;  4HLX A;  2CG4 A;  1DGW Y;  2GQQ A;  1I3A A;  1EA3 A;  1ON1 A;  3MMY B;  3RQ4 A;  2GOX B;  3ZCO A;  2QGU A;  2UV1 A;  3HRS A;  4ZTF A;  4A3G J;  4P96 A;  1W4M A;  2L9S A;  3BOQ A;  1JJ8 C;  2KZV A;  1MMD A;  3NQO A;  2VKE A;  4CCL A;  1BR2 A;  3ZQC A;  3KLO A;  4YFX F;  3WG9 A;  1WJ5 A;  3VYS B;  3IWZ A;  3HOS A;  1SAX A;  4X6A J;  1B9M A;  3DLL F;  3SHF A;  2LRD A;  3I4P A;  3FZV A;  1FJL A;  4HNU A;  3FHZ A;  1S6L A;  4PJM A;  1S9H A;  3OL4 A;  3BTL A;  4RB2 C;  3F22 A;  2IA0 A;  4CGZ A;  4BQO A;  1X3W B;  2RVC A;  4HV6 A;  2EIK H;  2QF7 A;  4HDU A;  1JI8 A;  1WJB A;  3M9A A;  2EZH A;  4ENJ A;  3P5J A;  1YIJ I;  1BOA A;  4U0Y A;  3FMQ A;  1X4P A;  2CFX A;  3BQZ A;  3BTJ A;  2O61 A;  5EEA A;  2A6T A;  4M3G A;  4XL9 A;  1DUX C;  2K9S A;  3ASN H;  1IZ1 A;  1M1E B;  1I5Z A;  4RLQ A;  1UHW A;  2WA0 A;  2RNJ A;  1I39 A;  3ABL H;  1JGS A;  1FC3 A;  1TQI A;  2L02 A;  2LY1 A;  2V4J C;  3KPH A;  2FD5 A;  1KGS A;  1KU7 A;  1S7O A;  1V54 H;  4F55 A;  2L2O A;  3PIP F;  5L3C A;  1N77 A;  1LKX A;  4YII A;  4XK4 A;  1IO2 A;  5IT3 A;  1D5Y A;  3L1P A;  3KET A;  3BR1 A;  3LSK A;  2LY2 A;  1LDJ A;  1B72 A;  5BS6 A;  1D5V A;  3BG3 A;  1MSF C;  2LYC A;  5LRR A;  4XN0 A;  1MDM B;  2W82 A;  1QO0 D;  2FF4 A;  2DQL A;  2JN6 A;  4M9Z A;  2JA7 J;  1I6X A;  2QQ8 A;  1SVL A;  5K7F A;  2M8E A;  2DYR H;  4ASN A;  2DK8 A;  2QLZ A;  1ITY A;  3IC7 A;  2H6C A;  4HG2 A;  2PQ8 A;  3OOP A;  3J7A O;  2NS0 A;  1Z05 A;  1HDD C;  4GCV A;  3RPU A;  3QPS A;  1U5T C;  4S05 A;  2QKM B;  1I1G A;  1U0J A;  2MGQ A;  2DK5 A;  3BG9 A;  3S3M A;  3KYC B;  1YO5 C;  1UZC A;  2GXA A;  3PSF A;  3SFI A;  4FE7 A;  3QP5 A;  3A02 A;  3I9V 2;  5TIS C;  2UXN A;  2CH0 A;  4OWR B;  1E3H A;  4BH9 A;  2WC2 A;  1DQU A;  2BYV E;  4EEF G;  1YYV A;  1G6N A;  3HZJ A;  3JR9 A;  2Z16 A;  2B0L A;  4BBR J;  3HPH A;  3HOT A;  2ZXI A;  3S93 A;  4EGZ A;  2E2I J;  2DA5 A;  2DOD A;  2VI6 A;  2KIF A;  2EIM H;  4DBQ A;  2G0E A;  2LOO A;  5LD2 C;  1I50 J;  2M9H A;  2RV8 A;  3E6B A;  5ICG A;  4ABZ A;  2MFZ A;  1FOW A;  1T0F A;  4V2G A;  3A01 B;  4M72 A;  1TT0 A;  2ETH A;  1YG2 A;  5K7Z A;  6PAX A;  5J1R A;  1JKQ C;  2EFO A;  5HDK A;  4W1U A;  4O6J A;  1IUY A;  2COB A;  1W36 C;  4B1R A;  2JVH A;  5FRN A;  1GV5 A;  2HVQ A;  1KQ9 A;  3BG5 A;  2CUJ A;  2HZD A;  3OYF A;  4G6Q A;  3LL7 A;  5LRS A;  1RKW A;  2PMZ A;  3D5L A;  1HOM A;  1X1A A;  2EBI A;  1ORK A;  2ELH A;  1XC5 A;  3T0Y A;  5D5W B;  1WZ2 A;  5HLI A;  1H89 C;  1W7P A;  2VKD A;  1UEL B;  2P4W A;  1KU9 A;  3DV8 A;  4HRI A;  2O0Y A;  3FDY A;  1F9N A;  2D1H A;  1O3T A;  1JT0 A;  3WTS C;  1K61 A;  5K7H A;  2GLO A;  3I59 B;  4MHG A;  5A2Q K;  2VJ4 A;  3BR0 A;  3VYT B;  5HOO A;  3CF5 F;  1MSE C;  2O5R A;  2ECC A;  3OIP A;  2W7N A;  1AU7 A;  5JLX A;  1R36 A;  3NRV A;  1HST A;  2KRC A;  3LST A;  1IG7 A;  1BI2 A;  1W36 D;  4JQF A;  1K7A A;  4OIR F;  2O8X A;  3FXM A;  3JRF A;  4DYQ A;  1HKS A;  3HXL A;  1QNT A;  4D5F A;  1WPK A;  1D0X A;  1FMW A;  4BEH A;  2Y0M A;  1TC3 C;  2OTL I;  2Z3Y A;  1REP C;  2CW0 F;  3CCR I;  1IGN A;  4CYC A;  2XGE A;  4PJL A;  2DO7 A;  4LG0 A;  2JPB A;  3HL2 A;  3F0C A;  3T1B A;  4P9F A;  1ZG3 A;  2HOS A;  4BNC A;  3HC7 A;  3KEY A;  5J1Y A;  4WXD A;  1ZG5 A;  3HRU A;  1R5I D;  3WTU C;  4I98 B;  5F08 A;  2DDB A;  4II3 A;  3LAP A;  5B1A H;  5IOY A;  2CWE A;  3BDD A;  2JA8 J;  4BHP A;  1U8B A;  1OQY A;  3ZOB A;  1FWZ A;  5EEH A;  2BVM A;  4DW6 A;  3S3O A;  4BU2 A;  2VBX A;  3CME I;  3Q0U A;  1HLV A;  2BHZ A;  2IGN A;  4A5N A;  1F4K A;  1Z7U A;  3CUQ A;  3GZN B;  4YEL A;  1V3F A;  2OUM A;  5FD6 A;  3K7A J;  1FBU A;  3G71 I;  2LF7 A;  4CCN A;  4IXA A;  2IS1 A;  3BJA A;  4KIT B;  1T38 A;  3QYB A;  1ODD A;  4BEH B;  5ERI A;  1W5C C;  4ETS A;  5FKM A;  5HS8 A;  3CC4 I;  1FPQ A;  5E3N A;  4CYC B;  2P6S A;  1PVE A;  4LG0 B;  2DFF A;  2Z33 A;  4BQQ A;  2ID6 A;  4EJT A;  2WAQ N;  2YU9 J;  1IXC A;  1Z3X A;  3FMR A;  3IWF A;  4E70 A;  4JK1 X;  3DP7 A;  2CU7 A;  4EJU A;  3LMM A;  3KEQ A;  3NAR A;  5TJJ A;  1X1D A;  2DOE A;  2JK3 A;  4L9V A;  3OS0 A;  5GTH C;  1DP7 P;  4R8H A;  2EWN A;  2KMU A;  4N4N B;  1AHD P;  2DXI A;  1MGT A;  3IAM 2;  2H27 A;  1D8J A;  3F23 A;  1G4D A;  3GTL J;  2B7E A;  2R7X A;  3HB9 A;  2ICW G;  4XSZ F;  1YS7 A;  4KIC A;  4FE4 A;  2EFP A;  4PJJ A;  5M5X J;  3QPL A;  5DYM A;  1ZRF A;  4KFC A;  2ELK A;  3Q3S A;  3BQY A;  2R7R A;  3B6C A;  2WY7 Q;  3I4M J;  3GVA A;  1ZGW A;  2OBP A;  1G3Y A;  3DFG A;  3I3L A;  2OU2 A;  4KYW A;  1HBX G;  2M45 A;  1B6A A;  3M7G A;  1UB9 A;  3K70 C;  4XRM A;  3Q9S A;  3GUD A;  2OJE D;  5LFA A;  4MQV A;  3WE3 A;  1IRX A;  1Z7L A;  1HF0 A;  3OIQ A;  3O2P E;  3PL8 A;  1XS9 A;  1EH8 A;  3BCB A;  3H5R A;  3KE2 A;  3PO2 J;  4P5O A;  2YX7 A;  1FOX A;  2V79 A;  3ERM A;  3QRF F;  3ZPL A;  3V8L A;  3SEZ A;  2YX4 A;  2RDP A;  3CCY A;  3HHG A;  1R49 A;  2M8G X;  3C2G A;  1IRZ A;  3OOU A;  2FJ1 A;  2VB6 A;  5GAH J;  3K70 D;  4NB5 A;  3TDU C;  2EB7 A;  2GIV A;  1BI0 A;  3HPG A;  3J7Y J;  1AOY A;  3FK6 A;  5H6R A;  2XAH A;  1SFE A;  2XKP A;  1G3T A;  4XKB A;  3RKX A;  4EMS A;  3PNT A;  2IPQ X;  3MAJ A;  4A5M A;  4AWX B;  4FCY A;  3W6K B;  2A61 A;  4XLC A;  1AWC A;  1MNE A;  2V1D A;  3PQJ A;  1USS A;  4BQN A;  3HRT A;  1JHF A;  1XMX A;  3K0L A;  1FIP A;  1YIT I;  1JXS A;  2Y9Y A;  5EGO A;  3FF5 A;  3JTG A;  1YI2 I;  2YS9 A;  4UUV A;  3KZZ A;  3I71 A;  4UVC A;  1G59 A;  4BY1 J;  3O8G A;  4L9T A;  1S7E A;  1FSE A;  1Z9C A;  2DAO A;  2PN6 A;  1TNS A;  2VC1 A;  5GAE J;  3E97 A;  2E1M B;  2ZJQ F;  1Y6I A;  1ZLK A;  2OPT A;  5BQT A;  2NVQ J;  1Y0N A;  3ZMZ A;  3F8C A;  5HLT A;  1Z67 A;  2GA2 A;  4ENK A;  4KJZ A;  1MBG A;  1NK2 P;  2LVS A;  4EAT A;  3RYP A;  2Y31 A;  4UUS A;  5KVR A;  2NVY J;  3DXJ F;  4PGH A;  3ONQ A;  4XOP A;  2QEN A;  4BGD A;  4KIF A;  3JAM Z;  3DF8 A;  2K9M A;  2IXS A;  3LSI A;  1KU3 A;  2QSG X;  3ZXS A;  1J9I A;  2MD0 A;  3RZD J;  3M3Y J;  3M1E A;  2E36 A;  3GZ6 A;  2MA3 A;  3KFW X;  2FBI A;  5D6E A;  2VQG A;  2AQE A;  2KRF A;  3KLN A;  1VQ6 I;  2M30 A;  3G1M A;  3DTI A;  3WTZ A;  4L0Y B;  1KQ0 A;  1PJR A;  4AYB N;  3U1D A;  2QBY A;  1TWF J;  1JTX A;  2X6Y A;  3IH3 A;  3WOD F;  5D5V B;  5F0F A;  2IGM A;  2M0M A;  3E6D A;  3WG7 H;  3ASO H;  4CCK A;  4RAF A;  1FLI A;  2L5Q A;  4F92 B;  4UUS B;  1U5T A;  3K4K A;  4XKC A;  2HOT A;  1LFP A;  3ZRG A;  5L3E A;  4EM0 B;  1K83 J;  2IS6 A;  2MH9 A;  1X2N A;  3HSE A;  5B3S H;  5ED4 A;  1V5F A;  1IN7 A;  1LDK B;  4KT5 C;  3I56 I;  1XN7 A;  1I27 A;  2H94 A;  1MKM A;  2K9N A;  2MYS A;  3BTI A;  3FXJ A;  3CJN A;  4HST A;  1TBX A;  1FOK A;  3AAF A;  4AVP A;  2DQR A;  2KKO A;  3TO9 A;  5LEK A;  2E1N A;  5HLH A;  5B1B H;  3ZQL A;  4U7D A;  5M5W J;  2DA7 A;  4M73 A;  2X1E A;  4ITV A;  4D0P A;  3EYI A;  3EDP A;  4HZF A;  2IA1 A;  2DYS H;  2LK2 A;  3L2W A;  2BHY A;  4PJ0 C;  4E7I A;  2DA1 A;  4CXF A;  2QBY B;  1P4A A;  1D0Z A;  1QZZ A;  2HWV A;  3GTQ J;  4F3Q A;  4JX4 A;  3HM5 A;  4R79 A;  1VQM I;  3FXU A;  1R00 A;  3QU6 A;  2D2W A;  3DWL E;  1T08 B;  2Y0S A;  5HDN A;  5H20 A;  3OIO A;  2DW4 A;  2QVO A;  3N05 A;  3DCF A;  1P4X A;  1F1Z A;  2DMP A;  2Y2Z A;  3I0T A;  3U9G A;  4XLA A;  4AM3 A;  5HS7 A;  1XCV A;  2JSC A;  3FXL A;  5E79 C;  2HKO A;  4RM3 A;  1BW5 A;  4J00 A;  2JJ7 A;  1R22 A;  4ZYE A;  2W25 A;  5FKK A;  3TQN A;  1E3O C;  4KN4 X;  1K6O A;  4B3X A;  2LDU A;  2Z1D A;  1O3R A;  2CJJ A;  3TO6 A;  4XM3 A;  5IOZ A;  4HF2 A;  1N78 A;  2XRN A;  1RC9 A;  4NBQ A;  1IXS B;  2WV1 A;  4B8X A;  3IHU A;  2BW3 A;  4D7M A;  3K4L A;  3LQR A;  1LFB A;  1FEX A;  3FXR A;  1YOV B;  2HTJ A;  3HEF A;  3ZQI A;  2WAF A;  2L9N A;  4AC0 A;  3H5A A;  1VQN I;  4KMU X;  1Y56 A;  1JGG A;  3ZMD A;  4L0Z B;  1ZRC A;  1LE8 A;  3NEU A;  4HSR A;  3PFI A;  2YR2 A;  3TW6 A;  2FOW A;  2O3F A;  2L7K A;  1QGP A;  3W6J B;  3FMS A;  1ETV A;  1HKQ A;  3B02 A;  3EUH C;  1SAN A;  3E0J B;  3H3U A;  3OV8 A;  1I1S A;  1OCO H;  1WJA A;  1D1A A;  2JUC A;  4MTD A;  2VKH A;  2N8G A;  1R5G A;  3CDI A;  1FTT A;  3GEZ A;  4NC7 A;  4A6E A;  3R4K A;  5EG0 B;  3DQV C;  3QYF A;  4KT6 A;  4ZC3 A;  4A0Z A;  4BJ6 C;  3WTV C;  1HCR A;  5EEG A;  2W57 A;  3PUF A;  1LVK A;  1XMK A;  1U6G A;  2OQR A;  4YFK F;  2VBW A;  2UWM A;  4UUT A;  3V42 A;  2A3S A;  2BW3 B;  3W6V A;  3FIW A;  3OL3 A;  5HNF A;  4DJA A;  2BEO A;  4J01 A;  4OIQ F;  4XKV A;  3HKZ N;  4B43 A;  5D6F A;  4FX4 A;  1YX3 A;  4UB6 C;  3CLQ A;  1X1B A;  2VAS A;  1TL8 A;  1ZH5 A;  4I2O A;  2DA3 A;  3K69 A;  1LE8 B;  3L2Q A;  1POG A;  3TKY A;  4JX5 A;  2BY0 A;  2FA5 A;  3DKY A;  5EF6 A;  2HEO A;  2V1X A;  1YFH A;  4DIQ A;  4H0E A;  3ABM H;  5JFR A;  5DDG A;  2W00 A;  1IDY A;  2KHM A;  1MH4 A;  3FXK A;  2IW5 A;  2X1C A;  2M4G A;  2HFH A;  2R7O A;  3DU6 A;  3KP3 A;  4GGG A;  5H6Q A;  4M3F A;  4CYD A;  3CF2 A;  5BOX A;  2STW A;  5HS9 A;  2DDA A;  3ECH A;  3L2U A;  4FTH A;  4AU7 A;  2WWY A;  1WJC A;  2M4K A;  3ABK H;  4UY8 I;  2ZJP F;  1ZGJ A;  2KDO A;  4MTE A;  2TDX A;  2DOA A;  1K4T A;  4UV9 A;  2EPF A;  1U8R A;  2FUG 2;  2KQR A;  1BA5 A;  5LEJ A;  1O3S A;  2ZME C;  2K40 A;  3IRR A;  2V6E A;  4E7K A;  3VOE A;  2E7X A;  3ZQQ A;  1CQT A;  2BE5 F;  2ZXH A;  1P7I A;  1E0E A;  2GXB A;  2IGO A;  1Y0U A;  3CJR B;  2WTE A;  2J5O A;  2LR8 A;  3A0H C;  3HJE A;  4JX6 A;  5GP9 A;  1X3U A;  2DFH A;  4TV7 A;  3RIR A;  5CLS A;  3BP8 A;  3AL0 B;  3QP6 A;  2HXO A;  2MLG A;  3KX2 A;  3CMM A;  3E7L A;  4EV0 A;  2V26 A;  3OYD A;  5JLW A;  4M9X A;  9ANT A;  2OV7 A;  2LTP A;  3LSR A;  3W2V A;  2Q2E A;  4YIF A;  4I0B A;  3MZH A;  3TL4 X;  2ME0 A;  2K3F A;  4LJZ F;  1FYK A;  3LA2 A;  5CVI A;  3BCA A;  4A93 J;  2HQN A;  3BG7 A;  2LBF A;  4I99 C;  1X1P A;  4ON0 A;  3ZQG A;  4BQA A;  2YSR A;  1WH7 A;  5F6F A;  5E3M A;  4C3J J;  4NQW A;  2VIX A;  4V19 K;  2FE3 A;  1P92 A;  1UHM A;  4N9H A;  5ILV A;  4E7J A;  1O3Q A;  2LD5 A;  3GWZ A;  1MW7 A;  4Q47 A;  2QSF X;  4RBO A;  4DZJ A;  2Y0S N;  3L09 A;  2WAQ A;  1IW7 F;  4KNY A;  1BR1 A;  3BZ6 A;  4MEX F;  2ZCW A;  3S1Q J;  2V1N A;  3BPX A;  4RB3 C;  1JKO C;  1F36 A;  1OLT A;  5DD8 A;  3P7N A;  4E7L A;  2VPL A;  3H1C A;  5C4X J;  2QKL B;  4CZC A;  5JVG F;  1FP2 A;  2RC4 A;  4HF1 A;  2J5P A;  2VQC A;  4BDZ A;  2Q2E B;  1HDP A;  1SD5 A;  3SJM A;  4A3K J;  4LFU A;  2IEK A;  3LSP A;  4GO1 A;  1K6Y A;  3I53 A;  2VLA A;  1OR7 A;  1BJA A;  3AKZ A;  1QZE A;  4FX0 A;  2CGP A;  2K86 A;  4RGR A;  3RKY A;  5CPR B;  2P6T A;  5IYC J;  4XID A;  3LSG A;  3K9T A;  2EV0 A;  2VQL A;  1IRG A;  4EGY A;  4O5V A;  2XGC A;  4XRS A;  1WJD A;  4BY7 J;  2R7F A;  2L4A A;  1QA6 A;  4XKW A;  4I7H A;  3TMO A;  3RKQ A;  2R5Y A;  3OR2 C;  3SDG A;  5JHF A;  2NOG A;  2X48 A;  4HAM A;  2L4M A;  2K9Q A;  5HNH A;  4IOA F;  5FLX Z;  3TP3 A;  1B72 B;  4F7Z A;  1XSV A;  1FP1 D;  2H1L A;  2M0C A;  4IKF A;  2XB0 X;  5E17 F;  3I54 A;  1BC7 C;  4KUM A;  5J8C A;  1ZYR F;  3FBI B;  2ZXW H;  1WI3 A;  3BR3 A;  5JI6 A;  4BYY A;  2OAZ A;  1FX7 A;  2DOF A;  4DOZ A;  2EA2 A;  5ICE A;  3CES A;  3G2B A;  3CCV I;  2V6C A;  4MFE A;  3GFJ A;  1XGS A;  4NC6 A;  3UKG A;  2HTS A;  3CO7 C;  3FX3 A;  4IRG A;  1SMY F;  3TED A;  1ZKG A;  1K79 A;  1R4N B;  3NWS A;  2B63 J;  1XGN A;  1KQ8 A;  1H88 C;  1VZ0 A;  2X6O A;  1D1C A;  4PFO A;  4KDP A;  1JUM A;  5IT9 Z;  5E8G A;  2PMH A;  3WHC A;  4XLP F;  5K5Q A;  3F9K A;  3TDZ C;  1IN6 A;  2ZO4 A;  4LOC A;  3ZN1 A;  3CJT B;  1XSD A;  4BXU A;  2HYG D;  4IEJ A;  2FRH A;  4IF4 A;  2JRT A;  1J5Y A;  2OQG A;  2WBM A;  1RKT A;  1R7J A;  1T56 A;  3QOE A;  4IQ4 A;  2WY8 Q;  4BXX J;  5L3G A;  1E2X A;  3VB2 A;  3A2K A;  4ESJ A;  1IAW A;  2PMU A;  4YRV A;  3T5X A;  3JW4 A;  2NNY A;  1V5G A;  2BY2 A;  2MD5 A;  2DU9 A;  3GTJ J;  2DMT A;  2LKX A;  1YW8 A;  1ZEL A;  2I5U A;  3HOY J;  1EV7 A;  4C2U A;  3MZ8 A;  1Z0X A;  4HX4 A;  5HDG A;  1SFU A;  3E1S A;  1BC8 C;  3S2H J;  3OYA A;  2C6Y A;  2ZNZ A;  1TW3 A;  3KYL A;  1PUF A;  2HDC A;  5E20 A;  3M1C A;  4KIB A;  4S04 A;  2VKV A;  4NDL A;  5AIP A;  2O03 A;  1BN5 A;  5FB2 A;  2QM3 A;  5IPA A;  1AKH A;  2COM A;  5CKT A;  2PEX A;  1JJ6 C;  5CQE A;  2Q1Z B;  1QPI A;  1HSJ A;  4LLG F;  3S16 J;  1DP3 A;  4XON A;  1W7P B;  5C44 J;  4GDF A;  3PSI A;  1DU0 A;  2VXD A;  4LIT A;  5F0H A;  1A36 A;  5H2F C;  1ETK A;  4QWQ A;  3CCE I;  2K02 A;  5TRD A;  3S17 J;  4JP0 A;  2P0W A;  3JRB A;  1KZH A;  4Y7N J;  5GTI C;  5D4R A;  4M6V A;  1RUN A;  4IRH A;  1K78 A;  2FML A;  4ZTJ A;  4L18 B;  2K9L A;  5J4V A;  3ZQF A;  1YHQ I;  4G9Y A;  1MBH A;  1XPX A;  3KZI C;  1TW2 A;  4CCM A;  4JYK A;  5CVU A;  4AYB A;  3OYM A;  2EIJ H;  2ISY A;  4HV5 A;  3C7J A;  5LBQ A;  2VT2 A;  2K7L A;  2X1D A;  3SZG A;  2R7V A;  3KP4 A;  3OYN A;  3H0D A;  1AKH B;  2ZNY A;  5E8I A;  5C3E J;  2W4S A;  1ZAR A;  3Q0W A;  2OZ6 A;  4HYE A;  5BNG A;  4G94 A;  1VQ7 I;  1KA8 A;  2CS3 A;  4PGG A;  2NOJ B;  2MSY A;  3CCL I;  1BL0 A;  3WGH A;  1S7A A;  4WXH A;  3V8K A;  2NAZ A;  2VJ5 A;  3L7W A;  2CV1 A;  1QPM A;  4M3B A;  2L7F P;  3MEX A;  4ENM A;  4BUP A;  2KRH A;  3OYG A;  5B66 C;  1QQI A;  1KON A;  5E1Z B;  1K78 B;  1LUJ B;  5FRM A;  4M6Y A;  2GOM A;  1V55 H;  2H1K A;  3DBH B;  2E34 A;  1YJW I;  5K5O A;  1LNW A;  2LY9 A;  3M8E A;  4WK8 F;  3BY6 A;  1Y39 A;  3CUQ B;  2GIZ A;  3V7S A;  1SFX A;  3BLY A;  2YU3 A;  1XCB A;  2JA5 J;  3KYD B;  1V5E A;  2X85 A;  1R1V A;  4UNO A;  1T6S A;  4A3D J;  1D3Y A;  4XLE A;  3HSR A;  1LJ9 A;  4PSW A;  1HQC A;  1R1U A;  2OZU A;  2ELJ A;  1EKE A;  3L2V A;  1OIS A;  1TWC J;  2BGC A;  2X9D A;  4F91 B;  3CC7 I;  1BI3 A;  4HEA 2;  3HYI A;  4CCJ A;  3HHH A;  3DEE A;  4UHT A;  1DGR M;  4F93 B;  2IS4 A;  1XSX A;  1XX5 A;  2F4O B;  2ZSH B;  2JRM A;  3V4G A;  2JA2 A;  2QEX I;  2HYF A;  3VDX A;  4BE0 A;  1SD4 A;  2JMW A;  1RIO H;  2A6E F;  1O7L A;  1NK3 P;  1RR7 A;  4G6D A;  2BZT A;  2QWW A;  1BM9 A;  3DBL B;  3X2Q H;  1R9T J;  1ULY A;  2GXG A;  3OYI A;  5J40 A;  3C3W A;  5FKO A;  2DLL A;  2FNP A;  2K5C A;  4P55 A;  4FET A;  5J8F A;  3DPT A;  4LGW A;  3J81 Z;  2GZW A;  2XRL A;  1VQ5 I;  3F8N A;  1E17 A;  1SAU A;  2HU9 A;  2KDZ A;  1P6R A;  2HXI A;  2CFO A;  2KJC A;  2VXZ A;  2VQH A;  4BJ5 C;  3TGN A;  2D45 A;  2P5K A;  5CVJ A;  2D1V A;  3L2C A;  2JPC A;  2FNA A;  1WJF A;  3GZ5 A;  2PJP A;  2LMD A;  4BBS J;  3WU1 B;  4XBF A;  3VYR B;  3H3V K;  4RMN A;  3LNQ A;  2DBB A;  2VOO A;  3Q0V A;  1KU2 A;  2A5Y B;  5EJC A;  4BXF A;  3OS1 A;  4G7H F;  5DUI A;  2KL4 A;  2XSJ C;  1WCM J;  2DJN A;  3NAU A;  3RDI A;  3RCO A;  1SVO A;  1R23 A;  4Y17 A;  4JBA A;  4MIM A;  4ZZL A;  2E19 A;  2TRT A;  2IGK A;  1FIA A;  2IAI A;  1CGP A;  2Z9O A;  3HKZ A;  2VL8 A;  4XLH A;  4LIV A;  5FLM J;  4U0V A;  2XF6 A;  4LD5 A;  2LH9 A;  1MBF A;  5FO5 A;  2JT1 A;  2B9S A;  4HBL A;  1OCP A;  2EFN A;  3JRE A;  1G3S A;  5AIQ A;  5E3O A;  1IDZ A;  2BY1 A;  4M6X A;  3WE2 A;  2DMN A;  3OR1 C;  1IF1 A;  5J6X A;  1EH6 A;  3DEU A;  2PJR A;  2XAJ A;  5E1W A;  3BWG A;  3V7C A;  2ZFU A;  4WWC A;  3CDH A;  2A69 F;  3RYR A;  3VOD A;  1A6Q A;  1J59 A;  4KIG A;  3EET A;  3K4M A;  2XV4 S;  2ESN A;  2R92 J;  2CSO A;  3ELK A;  4MO7 A;  2HQA A;  4XR6 A;  5FJ8 J;  4Y13 A;  4IJA A;  4MFD A;  2O8K A;  5IP9 J;  3JCU C;  5EGO B;  4QIW N;  2F5C A;  2F2E A;  2RQQ A;  4X0G A;  3I64 A;  1VI0 A;  3CMY A;  2OCC H;  2MLK A;  2F4M B;  4M9S A;  4A12 A;  2HPI A;  2EFW A;  4EQQ A;  1LPQ A;  4RLF A;  2MG4 A;  1YIO A;  2HYJ A;  2X6X A;  3C1D A;  2BVL A;  4ZYA A;  2LP0 A;  2GBY A;  4FAS D;  1NHA A;  2NVT J;  5J3L A;  3RJP A;  2PJR B;  1HW2 A;  2W1O A;  5CQG A;  1T0F C;  1RRJ A;  3RPU D;  3CD6 I;  1MBK A;  2VN2 A;  4P1W A;  4PUS A;  3OYJ A;  1QU3 A;  3RKW A;  2HI3 A;  1QVT A;  2H8W A;  3BC8 A;  2R7S A;  2R7D A;  3W2W A;  4LMY A;  1FSH A;  4A69 C;  2F5V A;  2A68 F;  5M3M J;  1ETO A;  4B47 A;  4ZDL A;  3DKX A;  3CLO A;  3W2A A;  3HOU J;  3IKV A;  4HX7 A;  2NVU B;  3AG4 H;  3JRD A;  2AHQ A;  2VOD A;  2QQ9 A;  1HKT A;  2VPR A;  2E60 A;  1IN4 A;  1X58 A;  3HTU A;  3GTO J;  2M7B A;  1HXD A;  2P8T A;  4IRI A;  1OFC X;  3BJO A;  2H6B A;  3M07 A;  4QPO A;  3CO6 C;  2QUF A;  2GA1 A;  1ERD A;  4LB5 A;  3CCM I;  1NTC A;  3M8J A;  4PSX A;  3ZR8 X;  2V9V A;  3K1N A;  1U5T B;  2FBK A;  4Q48 A;  1F5T A;  4BL0 B;  3DPU A;  4N0B A;  3ZGK A;  2BXZ A;  1WKM A;  3F6O A;  4DQ2 A;  4YG2 F;  2EA4 A;  2JUG A;  3E3V A;  3R0A A;  3WGI A;  2KJB A;  1FBQ A;  1G3W A;  2RN7 A;  4KN7 X;  4LK0 F;  4BKX A;  1G8X A;  4Q4Z F;  4G7O F;  5K5R A;  2VJJ A;  2F4I A;  1B1B A;  2HS5 A;  1W7P D;  1TP4 A;  3BRO A;  5L3D A;  3ZQ7 A;  3B73 A;  2LG4 A;  2FX0 A;  3FBN B;  1OCR H;  4IPA A;  2HNH A;  3VWB A;  2F6C A;  4Y52 J;  5IP6 A;  3R0J A;  2L7Z A;  1X4O A;  1YW9 A;  3GTM J;  3DU5 A;  4CSW A;  1FYL A;  4HDV A;  2IA2 A;  1MMG A;  3K10 A;  4EM2 A;  4YFN F;  1X3Z B;  1ETX A;  4IHX A;  2BY3 A;  3FWE A;  4Z2Y A;  3D5S C;  2EZI A;  1TLH B;  5GAD J;  1TTY A;  5F04 A;  3VPR A;  1T2K A;  1U9N A;  1MBJ A;  4XQF A;  1GDT A;  3BG6 A;  4K2E A;  5ILU A;  2DMU A;  2H8R A;  3E5X A;  2CV2 A;  1ETY A;  2E5Z A;  3HOX J;  3S15 J;  2DPD A;  1Y8R B;  3N4M A;  4OMY A;  1Z91 A;  3HDD A;  5ILS A;  4RM2 A;  3VYU B;  1SD7 A;  3WTW C;  3U1K A;  2ZJR F;  2K85 A;  1YX5 A;  1T33 A;  3GTP J;  1RES A;  4A3F J;  3SZP A;  1LEA A;  3H5N A;  4HOB A;  2HOA A;  2M87 A;  3HOV J;  5D5U B;  1GLN A;  4WCG A;  2CMP A;  2CQQ A;  4DYR A;  2DCE A;  2PX9 A;  3CP8 A;  1OCZ H;  5CJ9 A;  3OY9 A;  1NG6 A;  5IT9 K;  3BJ6 A;  1R5H A;  1Y1W J;  3REO A;  3JSP A;  3H92 A;  2AO9 A;  5CVV A;  4P9U A;  3F8F A;  2JZY A;  1U78 A;  3PO3 J;  3FKI J;  4A0X A;  1UJ8 A;  3Q9V A;  3S8P A;  2BOL A;  1ZR4 A;  2XDV A;  3CUO A;  1SMT A;  3RSN A;  3O8H A;  2ISZ A;  3TW7 A;  3TOB A;  1YTY A;  2NS7 A;  2XSD C;  2XPW A;  2XVC A;  2XAU A;  2K3P A;  1MMA A;  2W85 A;  1B8I A;  3GYH X;  1TQM A;  2D5V A;  1TT5 B;  4ZZD A;  4M3E A;  3BZC A;  4QSH A;  4XSX F;  2R93 J;  1A5J A;  2E2H J;  3EPZ A;  3ISP A;  5F27 A;  3EUA A;  3FXQ A;  2HDW A;  3I55 I;  4A3J J;  3S3N A;  2P7C B;  3RZO J;  2F5D A;  1XDS A;  1UFM A;  2X51 A;  4UXN A;  2Q8K A;  4XRS G;  4AIH A;  2PG4 A;  1LVA A;  3GFL A;  2XPV A;  1JKP C;  4ENN A;  2ZJ2 A;  5DTD A;  2DFE A;  2VC0 A;  3T8R A;  3U21 A;  2XUB A;  3V7R A;  5E18 F;  2Z2S B;  3WU0 A;  3LSH A;  4IO9 F;  1FY7 A;  1H9G A;  4XLF A;  2R7U A;  1D1B A;  1N25 A;  1DDN A;  5F0C A;  2XAG A;  3T8T A;  2E1C A;  1UAA A;  1WWX A;  3CZ6 A;  2CW7 A;  3D0S A;  4CHU A;  1DPU A;  1ZG1 A;  4O3M A;  4B4C A;  5EZG A;  2XGX A;  1BOB A;  1WGX A;  3EUK L;  3FXO A;  3FHN A;  3MVP A;  2R5Z A;  3IH2 A;  1OPC A;  1L3L A;  1B8I B;  2IRF G;  3O6B B;  1QZY A;  1NH3 A;  1GVJ A;  1JT6 A;  1L0O C;  2HGC A;  3DPL C;  2L7M P;  2M2E A;  2RRE A;  3H9Q A;  2CQX A;  4MLO A;  4UV8 A;  2FBH A;  4RAZ A;  4II2 A;  2E1M C;  2JWT A;  1H0M A;  2LF8 A;  4IHT A;  1J75 A;  2GWR A;  2IP2 A;  3AG3 H;  3K1P A;  4LG3 A;  3SXY A;  2AXL A;  2O9L A;  2P81 A;  4A0Y A;  1QHG A;  4XN3 A;  3K4J A;  2EZK A;  4DBR A;  3ZP5 A;  2X4H A;  4QLC U;  1XTA A;  3HBL A;  1LFU P;  1MNM C;  1FOY A;  2ECB A;  3HOZ J;  5EZH A;  5IP7 J;  4D1Q A;  5L3F A;  3QPH A;  3BZK A;  2R5Z B;  2AQF A;  3CCS I;  3PJR A;  3J7A Y;  1FYM A;  3ROU A;  2UUZ A;  1ONV A;  2CQK A;  3MQ0 A;  4GYI A;  3S2W A;  4Z6Y A;  3TP0 A;  1S29 A;  1QBJ A;  2UZK A;  2BBY A;  4YIR X;  2L01 A;  3G1L A;  1PP8 F;  4M71 A;  3NWT A;  1STZ A;  5M5Y J;  3Q5F A;  2E71 A;  4I0A A;  2CW8 A;  4CCO A;  1WVR A;  3BPV A;  3IAS 2;  3GME A;  4BHB A;  2L9R A;  2EV6 A;  2YPR A;  1JUP A;  3UR3 C;  2M1B A;  1GVD A;  2MBF A;  5D4S A;  3S1R J;  1W1W E;  1ZGA A;  3MD2 A;  1JTY A;  1R58 A;  3K4C A;  4E7S A;  2LBF B;  1A35 A;  1WI9 A;  5J1U A;  2K4J A;  2WB1 N;  3LQQ A;  3HSF A;  4NQW B;  2HZT A;  2LC2 A;  3LSM A;  2AS5 F;  3V8J A;  3CP2 A;  3DTE A;  3BR5 A;  4GYG A;  3IP4 B;  2BXY A;  2GAU A;  1R4M B;  2W24 A;  1Z6T A;  3IUO A;  3LA3 A;  3TBI A;  2XKO A;  5D8K B;  2KIS A;  4I01 A;  3F3X A;  3ABU A;  1ON2 A;  2XPU A;  2RGV A;  2MW8 A;  3J80 Z;  3GTK J;  2NVX J;  3HRM A;  4HQM A;  4A3B J;  1SEU A;  1YS6 A;  3W3C A;  2ADU A;  1S3J A;  3KP7 A;  5JHU A;  4XIC A;  1WH5 A;  1IN5 A;  1OCT C;  1LDD A;  3A01 A;  3D1N I;  4LLL A;  1RET A;  3J81 K;  2CRG A;  4XMY A;  4RB1 A;  1FBS A;  2QYO A;  4OIN F;  3OYL A;  2ZFW A;  3WHB A;  2AXT C;  3MZY A;  1R1T A;  2ZBK A;  1SVM A;  3H0G J;  5KK1 A;  1H9T A;  3OMY A;  1DU6 A;  2R4G A;  5FFZ A;  1U3E M;  3H36 A; 
#chains in the Genus database with same CATH homology
 4J19 A;  1GV2 A;  3DEW A;  4A3D J;  4A3I J;  4S0H B;  1GUU A;  3BR2 A;  4UUS B;  4I76 A;  4RDU A;  3S2D J;  5HOD A;  1TWC J;  4DYC A;  2HOT A;  1K83 J;  2X9D A;  1X2N A;  1U9O A;  2I10 A;  1P7J A;  2R5Y B;  2K9N A;  3BTI A;  2EQR A;  4C3I J;  3LOC A;  1I3Q J;  1SFO J;  3HGY A;  3ZQL A;  2JMW A;  4L5E A;  1EF4 A;  5M5W J;  2DA7 A;  1TWG J;  1NK3 P;  1ETQ A;  1RR7 A;  2DA6 A;  2LK2 A;  3B6A A;  4G12 A;  1I6H J;  1UHS A;  2DA1 A;  1R9T J;  3GTQ J;  3GTG J;  4JX4 A;  3HM5 A;  5FKO A;  2DA2 A;  4A3G J;  2XRL A;  1JJ8 C;  2VKE A;  2DA4 A;  1JKR C;  3OIO A;  2KDZ A;  2HXI A;  3ZQC A;  3DCF A;  2DMP A;  2Y2Z A;  4X6A J;  4A3L J;  1OJL A;  2E1O A;  1FJL A;  4BBS J;  3BTL A;  3H3V K;  1BW5 A;  3LNQ A;  4A3E J;  2ZB9 A;  3Q0V A;  5DS9 A;  2JJ7 A;  4A3M J;  5FKK A;  1ENH A;  2QF7 A;  1IJW C;  1E3O C;  1WCM J;  2EZH A;  2DJN A;  3NAU A;  5C4J J;  2HDD A;  2CJJ A;  5IOZ A;  3BQZ A;  3BTJ A;  4IHW A;  5EEA A;  4MIM A;  2WV1 A;  2E19 A;  4M3G A;  2TRT A;  2K9S A;  4D7M A;  1FIA A;  2IAI A;  3ZQH A;  1LFB A;  2M34 A;  3HEF A;  1FEX A;  3ZQI A;  4AC0 A;  5FLM J;  1FTZ A;  1JGG A;  1LE8 A;  2ME6 A;  2JA5 J;  1MBF A;  3TW6 A;  4D7N A;  1PUF B;  1OCP A;  1ETV A;  3JRE A;  5E3O A;  1IDZ A;  2FD5 A;  3G1O A;  1SAN A;  2DMN A;  3K2A A;  4XK4 A;  1D5Y A;  3L1P A;  3BR1 A;  1JUS A;  4W97 A;  1B72 A;  2N8G A;  1FTT A;  3BG3 A;  1MSF C;  5EG0 B;  1HCR A;  2JN6 A;  2R92 J;  3C2B A;  3I4N J;  4MO7 A;  4AUX A;  5FJ8 J;  2JA7 J;  5K7F A;  4MFD A;  2O8K A;  4UUT A;  5IP9 J;  2IBD A;  1ITY A;  3W6V A;  3FIW A;  5EGO B;  4QIW N;  4GFB A;  3FIS A;  3HKZ N;  4C2M J;  1TWA J;  1VI0 A;  3CMY A;  1HDD C;  2FQ4 A;  3QPS A;  1GT0 C;  2DA3 A;  1LE8 B;  2MGQ A;  1POG A;  3BG9 A;  4JX5 A;  5EF6 A;  3SFI A;  2MG4 A;  2HYJ A;  4FE7 A;  3A03 A;  1O4X A;  3S1N J;  2LP0 A;  3A02 A;  1BJZ A;  1MBE A;  2GBY A;  3HGG A;  2EZL A;  1IDY A;  2NVT J;  5J3L A;  4EEF G;  3JR9 A;  4BBR J;  1MH4 A;  3JRA A;  1MBK A;  2E2I J;  2DA5 A;  2VI6 A;  4M3F A;  1IUF A;  2R7Z J;  2LLK A;  2G0E A;  2XB5 A;  2HI3 A;  1QVT A;  4FTH A;  1I50 J;  2M9H A;  3CDL A;  4IHY A;  4A69 C;  4ABZ A;  4V2G A;  5M3M J;  3A01 B;  1ETO A;  2OF7 A;  5K7Z A;  3HOU J;  5FKN A;  3JRG A;  3IH4 A;  2NS8 A;  5J1R A;  3JRD A;  1JKQ C;  2AHQ A;  1BA5 A;  4W1U A;  2VPR A;  1VF9 A;  2COB A;  3QQA A;  2K40 A;  1X58 A;  3GTO J;  4B1R A;  3S1M J;  1GV5 A;  3BG5 A;  1OFC X;  1CQT A;  4IHV A;  1P7I A;  5IYB J;  1RKW A;  2O7O A;  2QCO A;  1NTC A;  1HOM A;  2EBI A;  2CUE A;  1ORK A;  5EDN A;  1XC5 A;  1ZQ3 P;  1H89 C;  5F1J A;  2LR8 A;  4JX6 A;  5GP9 A;  4I6Z A;  4X1E A;  3GBG A;  4V2F A;  4HNV A;  1JT0 A;  1K61 A;  2HXO A;  5K7H A;  2GLO A;  3CQZ J;  4BKX A;  3E7L A;  5JLW A;  1H8A C;  1VND A;  3HOW J;  9ANT A;  3BR0 A;  2LTP A;  1MSE C;  3LSR A;  1AU7 A;  2ECC A;  5JLX A;  2ME0 A;  1IG7 A;  5FKL A;  4A93 J;  2FX0 A;  3ZQG A;  3JRF A;  4DYQ A;  1W0U A;  1WH7 A;  4D5F A;  1WPK A;  5E3M A;  4C3J J;  4Y52 J;  5IP6 A;  2L7Z A;  1TC3 C;  1QVU A;  3JRC A;  2LD5 A;  2PMZ N;  1IGN A;  3GTM J;  4CYC A;  2XGE A;  4RBO A;  4DZJ A;  2Y0S N;  3F0C A;  4FIS A;  2HOS A;  4A3C J;  1ETX A;  4IHX A;  3S1Q J;  1W0T A;  5J1Y A;  2EZI A;  1JKO C;  1F36 A;  5F04 A;  3VPR A;  4QTR A;  5F08 A;  1U9N A;  5C4X J;  1MBJ A;  1GDT A;  5IOY A;  2DMU A;  2H8R A;  1BW6 A;  1ETY A;  3HOX J;  3S15 J;  2JA8 J;  1HDP A;  1U8B A;  3ZOB A;  3SJM A;  3HDD A;  4A3K J;  2IEK A;  3LSP A;  4DW6 A;  3Q0U A;  1HLV A;  1T33 A;  3GTP J;  1RES A;  4A3F J;  1APL C;  3MN2 A;  2HOA A;  3K7A J;  3HOV J;  1UMQ A;  3MKL A;  2CQQ A;  4DYR A;  5IYC J;  4XID A;  3LSG A;  2VUM J;  5FKM A;  1UG2 A;  5EYR A;  5E3N A;  4CYC B;  2R0Q C;  1Y1W J;  2ID6 A;  2WAQ N;  2YU9 J;  2AO9 A;  1U78 A;  2XGC A;  1X2M A;  4XRS A;  3FKI J;  3PO3 J;  4BY7 J;  2CU7 A;  1ZR4 A;  5E3L A;  2DN0 A;  3O8H A;  3RKQ A;  3TW7 A;  2R5Y A;  3NAR A;  2NS7 A;  1VFC A;  3SDG A;  3S14 J;  2NOG A;  2XSD C;  2XPW A;  2X48 A;  1IC8 A;  2K9Q A;  2JK3 A;  2GM4 A;  3TP3 A;  1B8I A;  1B72 B;  2D5V A;  4M3E A;  2M0C A;  4QSH A;  1AHD P;  1XG1 A;  2XB0 X;  2R93 J;  1A5J A;  2E2H J;  5F27 A;  3GTL J;  4A3J J;  3RZO J;  2Y30 A;  3HB9 A;  3BR3 A;  1WI3 A;  4XRS G;  4FE4 A;  2XPV A;  1JKP C;  5IYD J;  5M5X J;  2XGD A;  4MFE A;  3QPL A;  5DTD A;  3UKG A;  2ELK A;  3Q3S A;  2EH3 A;  3BQY A;  3IV5 A;  3TED A;  3I4M J;  3B6C A;  1ZKG A;  2TCT A;  1ZGW A;  3BT9 A;  2B63 J;  5F0C A;  2ID3 A;  1H88 C;  2X6O A;  2JA6 J;  1JUM A;  4B4C A;  3WHC A;  4XRM A;  3BR6 A;  3JRH A;  5EZG A;  1MH3 A;  1WGX A;  2LFB A;  3MVP A;  4LOC A;  4B3A A;  2R5Z A;  3IH2 A;  1B8I B;  2E2J J;  3PM1 A;  4IEJ A;  2KT0 A;  1JT6 A;  2L7M P;  2M2E A;  5GPC A;  1HF0 A;  1RKT A;  3JRI A;  1T56 A;  2CQX A;  4MLO A;  5M3F J;  4BXX J;  1XS9 A;  2JWT A;  4C3H J;  3PO2 J;  1F43 A;  3LSJ A;  3GTJ J;  2DMT A;  2LKX A;  3BTC A;  3HOY J;  2O9L A;  1Q1V A;  1Z0X A;  2P81 A;  3OSG A;  2W48 A;  3S2H J;  3CCY A;  3RQI A;  2EZK A;  2M8G X;  1IRZ A;  1PUF A;  3OOU A;  2FJ1 A;  1IV6 A;  2VKV A;  1TWH J;  4NDL A;  3HBL A;  1LFU P;  1MNM C;  5IPA A;  1AKH A;  2ECB A;  3HOZ J;  5EZH A;  5IP7 J;  1JJ6 C;  3FK6 A;  1QPI A;  2R5Z B;  3S16 J;  5C44 J;  3M4O J;  1DU0 A;  5F0H A;  5EG0 A;  1YRN A;  2DMQ A;  2Y9Z A;  1ETK A;  3TP0 A;  1Y1V J;  2RAE A;  4FCY A;  3FK7 A;  3G1L A;  2DTZ A;  3S17 J;  4JP0 A;  3JRB A;  4Y7N J;  5M5Y J;  4M6V A;  1FIP A;  2Y9Y A;  5EGO A;  1ZTR A;  1ZK8 A;  2L9R A;  1ETW A;  1JUP A;  2YS9 A;  3ZQF A;  1GVD A;  1MBH A;  1ZR2 A;  2HQ5 A;  4BY1 J;  3S1R J;  3O8G A;  1S7E A;  4JYK A;  1JTY A;  4M3D A;  5J1U A;  2WB1 N;  2OPT A;  2NVQ J;  2CUF A;  1AKH B;  4D5C A;  5C3E J;  1MBG A;  3BR5 A;  2LVS A;  3Q0W A;  1A6I A;  4DZP A;  1NK2 P;  2Y31 A;  5BNG A;  4UUS A;  2NVY J;  1YRN B;  2MSY A;  1BL0 A;  2XPU A;  2MW8 A;  3GTK J;  1Z77 A;  2NVX J;  4M3B A;  4A3B J;  3RZD J;  2L0K A;  3M3Y J;  2L7F P;  4XIC A;  1WH5 A;  1RPW A;  1OCT C;  3A01 A;  3D1N I;  5FLV A;  1G2H A;  3G1M A;  1RET A;  2CRG A;  2H1K A;  2LY9 A;  3OSF A;  5GPA A;  3WHB A;  1QRY A;  4AYB N;  3H0G J;  1DU6 A;  1TWF J;  1JTX A;  3IH3 A;  5F0F A;  2YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...