5EGOA

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis1
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoA00
2HXOA 3BTCA 5F08A 2E1OA 3BT9A 5DTDA 3GTMJ 2JK3A 5EG0A 2JMWA 2N8GA 2FD5A 2COBA 1JUPA 1FIAA 3A03A 3BG3A 1NK3P 2CU7A 1JUMA 5M5YJ 2EZLA 4NDLA 4UUTA 1CQTA 1AU7A 3BR6A 1AHDP 4BBSJ 1IDZA 5F27A 4JX5A 4DW6A 4V2FA 3DEWA 3LSRA 2YUSA 3QPLA 2G0EA 1POGA 1ETQA 2NS8A 1BJZA 4FTHA 2LFBA 2M0CA 2ME0A 4BY7J 3ZQGA 4QIWN 3S14J 2DA4A 2KT0A 1PUFB 3C2BA 1OJLA 3SDGA 4FE7A 2E2JJ 2JA5J 2MG4A 3S2DJ 1F36A 3MKLA 2HQ5A 5EZHA 2JA7J 3HGGA 3BR5A 1LE8B 2P81A 4MFEA 2ELKA 2M34A 1SANA 2WAQN 2Y9YA 1MBEA 3SJMA 3TP0A 1HCRA 1VF9A 1JJ8C 3S17J 4A3FJ 3D1NI 3IH3A 1H89C 3QQAA 5F1JA 2NVYJ 2NVQJ 2X6OA 2HOTA 2DMUA 1ETKA 3QPSA 3G1MA 1E3OC 3BQYA 5FKLA 4C2MJ 2R5ZB 1WPKA 2K40A 3CCYA 1IV6A 1FIPA 2AHQA 4EEFG 3JRHA 3OSGA 3LSJA 3JRDA 1MH4A 4CYCA 5FKKA 1TC3C 4D5FA 5J3LA 1W0UA 4IHWA 4V2GA 2Y0SN 5K7HA 4M6VA 2XB5A 3CMYA 1GT0C 5GPCA 5K7ZA 1P7IA 2XPVA 2LTPA 2QCOA 3TP3A 2LD5A 5EEAA 4UUSB 2LKXA 5M3FJ 4A3EJ 2XPUA 2DA5A 5M5WJ 3G1OA 4G12A 1QVUA 2D5VA 2CJJA 2R7ZJ 3WHBA 2NS7A 2E2IJ 3HEFA 3HOWJ 4W1UA 4A3JJ 4A3CJ 2OF7A 1Y1VJ 4Y7NJ 1VNDA 3HOXJ 4MFDA 1PUFA 1MBHA 3RKQA 2WB1N 2X9DA 5FLMJ 2LVSA 2R92J 3HOVJ 3Q0VA 1LE8A 2K9QA 1MH3A 2TRTA 3GTPJ 4A3LJ 1OFCX 5IOYA 3BR2A 2LY9A 2LR8A 2VKEA 4I76A 1RETA 1JGGA 1UG2A 1HOMA 2I10A 1TWCJ 1U78A 1Z77A 1MSEC 3BR1A 1ZQ3P 2R5YB 1X2NA 5J1RA 4FE4A 3FK7A 3IV5A 1F43A 1AKHA 2YU9J 5IYDJ 3I4NJ 5DS9A 2XPWA 2R5ZA 2L7ZA 4A3MJ 2M2EA 2KDZA 1JKOC 1BW6A 1RESA 1A6IA 1ENHA 2RAEA 4C3HJ 3ZQIA 2L7FP 4IEJA 3S1RJ 4L5EA 5IOZA 1W0TA 4C3JJ 2JA6J 2AO9A 3HGYA 3G1LA 1FEXA 3FKIJ 2XGEA 2Y2ZA 1B8IB 1BL0A 3BQZA 2GM4A 1GDTA 3CDLA 4B4CA 1T56A 1EF4A 2Y31A 3BR0A 2DMNA 2ECBA 4J19A 1U9OA 1XG1A 4RDUA 1JKPC 3GTQJ 3MVPA 1RPWA 2MW8A 5HODA 4A3GJ 4M3DA 2XRLA 3ZQHA 2GBYA 2DA7A 2VI6A 3TW7A 3M3YJ 2VUMJ 4A3BJ 1GV5A 3E7LA 1B72B 2DA6A 2CQXA 2ZB9A 1I6HJ 5EDNA 1I50J 2WV1A 4XICA 4M3EA 4LOCA 5IPAA 5J1UA 3B6AA 1VFCA 1LFUP 4XIDA 3JREA 3CQZJ 3ZQLA 3A01B 5C3EJ 1ETWA 2ME6A 2W48A 4B1RA 1G2HA 3GTKJ 2MGQA 3S16J 2CRGA 2CUEA 2CUFA 2XSDC 1IRZA 3TW6A 5EGOB 2HOSA 2JA8J 2DTZA 5IYCJ 4JYKA 2R5YA 3GTLJ 4HNVA 3GTGJ 5EG0B 5EZGA 3H3VK 3OSFA 1IUFA 2NOGA 2K9SA 1WH7A 5M3MJ 3RZDJ 1U8BA 2DJNA 4DYQA 2X48A 2M8GX 4A3KJ 3Q3SA 1JT0A 1DU6A 3HOZJ 2K9NA 4X1EA 1ZK8A 1U9NA 2Y9ZA 2XGDA 2HYJA 2XB0X 4DYRA 2HXIA 3S1NJ 2VPRA 1RKTA 3JRAA 4M3GA 4XRSG 1JKQC 1B8IA 4X6AJ 1IG7A 5K7FA 5E3LA 5F0CA 5IP6A 5C4XJ 1NTCA 3JRIA 4BY1J 4MLOA 1H88C 2NVXJ 5E3NA 1ZGWA 2EZKA 1BW5A 4IHXA 3FIWA 4A93J 5FKNA 3B6CA 1HLVA 1HF0A 3S2HJ 1IGNA 3K2AA 3ZOBA 3O8HA 1D5YA 2HI3A 1JUSA 4BBRJ 1B72A 4D7MA 1FJLA 1MBKA 1IJWC 3JRGA 4GFBA 1RR7A 4QSHA 3BG9A 2LP0A 4Y52J 2DMTA 2IEKA 3HM5A 5EYRA 2DA1A 4IHYA 5E3OA 2DA3A 1O4XA 4M3BA 4C3IJ 4I6ZA 3O8GA 4D7NA 1DU0A 2EH3A 2EQRA 3SFIA 1APLC 3IH2A 3FISA 2XGCA 2DMPA 1MBGA 1LFBA 3JRCA 4RBOA 2FJ1A 1JJ6C 1GV2A 5F0HA 1JKRC 1ITYA 1JTXA 1S7EA 4XRSA 1K61A 1TWAJ 1H8AC 1ETXA 3UKGA 3HOUJ 4IHVA 3HKZN 5F04A 3JR9A 1T33A 2JJ7A 2OPTA 4DYCA 5F0FA 4QTRA 4MO7A 1JTYA 1WGXA 1YRNB 4UUSA 1ETYA 1X58A 3Q0WA 4M3FA 3BR3A 5GPAA 1Y1WJ 5M5XJ 2FX0A 3NAUA 2ID3A 3M4OJ 3BG5A 3MN2A 2LLKA 2EZHA 5FKOA 2L7MP 4AC0A 3LSGA 5IP9J 3GTJJ 5GP9A 2O9LA 2QF7A 2ID6A 3BTIA 1WH5A 4AYBN 1GUUA 1HDDC 9ANTA 3I4MJ 5C4JJ 5FLVA 3H0GJ 1RKWA 2YS9A 4A3IJ 3NARA 3GTOJ 1MNMC 1FTZA 5FJ8J 1UHSA 4XRMA 3PO3J 1GVDA 2R93J 3WHCA 4DZPA 3OIOA 5FKMA 1OCTC 3VPRA 3DCFA 3LNQA 4FCYA 3GBGA 2DA2A 2NVTJ 4S0HB 5E3MA 3FK6A 3LSPA 2MSYA 1UMQA 4MIMA 3HB9A 3S1QJ 1AKHB 1WI3A 3HBLA 1MBFA 3HOYJ 1OCPA 1P7JA 1MSFC 1BA5A 3K7AJ 1QPIA 1TWHJ 2VKVA 5IYBJ 1TWFJ 1A5JA 2M9HA 2CQQA 3OOUA 1VI0A 1X2MA 2DN0A 4JP0A 4A69C 1HDPA 1IDYA 2JWTA 1JT6A 1SFOJ 4JX4A 2L9RA 5J1YA 2GLOA 3W6VA 2DMQA 5JLXA 1R9TJ 1TWGJ 4FISA 1XS9A 2H1KA 5C44J 4ABZA 3PM1A 2IAIA 3BTJA 1K83J 2EZIA 2JN6A 3RQIA 3JRBA 1YRNA 5IP7J 1ZR4A 5JLWA 2PMZN 2Y30A 3ZQFA 5BNGA 1FTTA 3Q0UA 1NK2P 3L1PA 3IH4A 2HOAA 3TEDA 2H8RA 2O7OA 3S1MJ 2E19A 4D5CA 3PO2J 1Z0XA 3BTLA 1MBJA 1QRYA 2HDDA 3RZOJ 4XK4A 2O8KA 2B63J 4AUXA 3HDDA 1ORKA 2IBDA 4BKXA 2FQ4A 2R0QC 1ETOA 1ZKGA 1QVTA 4DZJA 2L0KA 1ZTRA 3JRFA 4B3AA 4BXXJ 3A01A 3S15J 4W97A 2LK2A 1I3QJ 1WCMJ 5EF6A 1ETVA 2EBIA 3A02A 1IC8A 2TCTA 4JX6A 3ZQCA 3LOCA 2E2HJ 2ECCA 3F0CA 4CYCB 5EGOA 4A3DJ 1XC5A 1ZR2A 1Q1VA
chains in the Genus database with same CATH superfamily
4ZDPA 2JUGA 5LLQA 3K1MA 5DTDA 1W36C 4EQQA 4YFKF 4RB3C 5BMZA 1JUPA 2IGMA 2VJIA 4WK8F 2BHYA 3NQOA 2E35A 3R4KA 4C2UA 4NDLA 2DFHA 1AU7A 4ZYEA 3BR6A 1IDZA 5F27A 1UJ8A 3DKXA 4JX5A 4ZDLA 4DW6A 2ZCWA 2YUSA 2W85A 2LMDA 1ETQA 1MDMB 1BJZA 4FTHA 2IS6A 2XAQA 1TNTA 1T0FA 3V7CA 3DLLF 3CTAA 4OU0A 4HZFA 4QIWN 2K85A 3BC8A 2DA4A 1PUFB 1N75A 3C2BA 5B3SH 3L2RA 3A2KA 2H6CA 2G7UA 2B9SA 1F36A 4OIPF 3MKLA 3WU2C 2JA7J 3BR5A 2GZWA 1SANA 3AL0C 2DT7B 1MBEA 1XTAA 2FU4A 3CCJI 1HCRA 4II3A 5HS9A 1VQLI 3ELKA 1JJ8C 2KKOA 2Q1ZB 4KN7X 2CH0A 2QM3A 3EUKL 3D5SC 4ETSA 2PJPA 3I5UA 1IRGA 5E20A 4XORA 4YG2F 1OYWA 3QQAA 1V55H 4RGRA 2NVYJ 2NVQJ 2HOTA 3EETA 2JT1A 3K6GA 4IVNA 2IS4A 1CF7B 1T38A 1E3OC 4D1QA 3BP8A 5FRNA 4C30A 1U6GA 2FSWA 4RB0A 3E5XA 3FMQA 1Z6TA 5E17F 4BH9A 4C2MJ 2J5PA 4M71A 1WPKA 2G9WA 1TZLA 3CCYA 5LD2C 1IV6A 2AHQA 2QSFX 5J40A 3OSGA 3BOQA 2ESHA 3SFZA 1VQKI 5GTHC 1MNEA 5ICGA 1LDDA 5ILUA 1YJWI 4BEHA 1W0UA 1H9TA 4V2GA 1YQAA 2Y0SN 2HTJA 3K0LA 2XB5A 1LQ1A 4PJJA 2LC2A 3T8RA 3FHZA 3CCQI 1GT0C 2HPMA 1OR7A 1FOWA 2XPVA 2QCOA 2LY1A 1I1GA 2R7DA 2H6BA 2XPUA 3G1OA 1S7OA 2CJJA 2R7ZJ 3AKZA 2NS7A 2FNAA 2XHKA 4L9JA 4E7HA 2H8WA 3R60A 3C3WA 3TOAA 2MD0A 4A3JJ 1QGPA 5HNFA 1Y1VJ 2OF7A 3ZCOA 1J7KA 5JHUA 3QPHA 2A6EF 1VNDA 2BOLA 3TOBA 1PJRA 3CUQB 3EQLF 2OJED 1UHMA 3J80K 3OYCA 4HQEA 1IN7A 1IZ1A 2VQHA 2BXYA 2VBWA 2DOEA 3OR2C 4HLXA 4PCQA 3GTPJ 1E0EA 4A3LJ 2IA1A 1OCCH 5IOYA 4P9FA 1X3ZB 3BCBA 2VKEA 5FD6A 1BOAA 1RETA 2GQQA 1M1EB 2CFXA 4MTEA 3G71I 1ZAOA 1BI3A 3P5JA 3ONQA 4QPOA 1ZQ3P 3K4NA 2XAHA 1ERDA 5D4SA 3HRSA 2QVOA 3NWSA 4FE4A 1IN4A 2X51A 3IV5A 4HX7A 4ESBA 1AKHA 2YU9J 5IYDJ 3I4NJ 5DYMA 2VT2A 5HOOA 1ZH5A 5TJJA 1OPCA 2XIGA 1VQ9I 2R5ZA 4A3MJ 4BE2A 1MMAA 2HZTA 1TT5B 3M1EA 1A6IA 2FRHA 2WC2A 3F9KA 2ZXWH 4HDUA 1ZG5A 3ZQIA 2L5QA 5HLGA 1Z3XA 4L5EA 2EPFA 3ECOA 4BHPA 1W0TA 2CQKA 4C3JJ 3D5LA 2E60A 3GFMA 3HGYA 3G1LA 3K4JA 5BS6A 2XGEA 3LFUA 3HRTA 2G7HA 2F2EA 2X1EA 1W7PD 4R1HA 5JR3A 1ZGJA 3L00A 2YPRA 5GTIC 3WU0A 4UUVA 1ACIA 2F5CA 1ZARA 2Y31A 3BR0A 2O8XA 1U9OA 1XG1A 2E71A 5J8FA 1WJCA 4KN4X 2W4SA 3MVPA 4RGSA 1RPWA 1SC7A 2VKHA 2XRLA 4Q4ZF 1A6QA 1Y39A 2M3AA 4IHSA 4XOPA 3FWEA 5DCMA 3AG2H 1GV5A 3E7LA 1MMDA 1S7AA 2CQXA 3K9TA 5JVTA 4XICA 4M3EA 2MFZA 2VQGA 4CHUA 3TDUC 4H4KC 3O6BB 2HDWA 3A01B 5C3EJ 4ITVA 1ETWA 2ME6A 3OIPA 2DAOA 1G2HA 3GTKJ 3KP5A 4NQWA 2O03A 5TISC 1G3WA 4KT5C 4U7DA 1BI2A 3FM5A 3H9QA 2HKOA 3TW6A 2HR3A 4LMYA 1V5GA 2HOSA 4GDFA 2JA8J 2B0LA 2KQRA 3GTLJ 4HNVA 3MQ0A 4IPAA 5F1RA 3H3VK 4U0VA 2CQ7A 3ZN1A 3RZDJ 1WH7A 1X4OA 4XOTA 2OQRA 2DJNA 1D1BA 1W5SA 1U5TB 3F8CA 5KNLA 2M8GX 3S3NA 3VFZA 2A3SA 4CZZA 1JT0A 1D0XA 1RI7A 1U9NA 3GXOA 4GGGA 4WF2A 1FSHA 4HSRA 5E8GA 3QOEA 1MDMA 1DP3A 1RKTA 3JRAA 1X1BA 2XVCA 3RYRA 3CJRB 1IAWA 1WJ5A 4XMYA 3FMRA 1IRFA 1IG7A 3L2VA 4KA4A 5IP6A 4E7IA 2LG4A 3V4GA 2L3DA 3JRIA 1YS6A 2VPLA 1H88C 3QPTA 4UNOA 1YO5C 1ZGWA 2EZKA 4OMZA 3OS1A 2VC0A 2DYRH 2Z33A 1R6RA 4UB6C 1XGMA 5F64A 3F72A 4QWQA 3S2HJ 3D0SA 3BJAA 3K2AA 3GYHX 2JRTA 4OIRF 3SDBA 4NC6A 2HI3A 2K02A 1B72A 1SD5A 1Z7UA 3EUHC 1IJWC 1Y0UA 3JRGA 5HS8A 2NXNB 3BZCA 4QSHA 3BG9A 2LP0A 2Z16A 2IPQX 1CF7A 1HBXG 4ANJA 2KZGA 4A0ZA 5E3OA 3CCEI 4M3BA 4XBFA 4UXNA 4IX7A 2M4KA 3ISPA 3O2PE 2IRFG 2EINH 4CYDA 3FXKA 2F4IA 1FY7A 1EH6A 1OCOH 2EQRA 2Y0MA 3IRQA 1B59A 1O57A 1Z9CA 1J5YA 3IH2A 3LA3A 3ESWB 3ERED 1APLC 4EJVA 1FMWA 1MBGA 2GA1A 2FJ1A 5CVRA 3WG9A 3F23A 3CUOA 1JTXA 3CESA 3F6VA 4ESJA 1ETXA 3HOUJ 3HKZN 3K10A 3M8EA 4JBAA 2QWWA 1MNDA 1T33A 4IOCF 1R49A 4DYCA 5F0FA 4MO7A 2HVRA 1XGOA 5E1ZB 3H5RA 5LGTA 1WGXA 3TQNA 1YRNB 2WAFA 2R7UA 1X58A 3Q0WA 1LPQA 2L4MA 3UNGC 4N9IA 2P5LC 3KE2A 5J8CA 1MKMA 2STTA 3K4MA 2KFDA 3BY6A 2NNNA 5HDGA 2L7MP 3CZ6A 2DT5A 3LSGA 3CO6C 3CC7I 4YEJA 2MBFA 2OCCH 1T8IA 2HQNA 1WH5A 4LLGF 4AYBN 5CQGA 2WADA 2CUJA 2OTJI 2Y0SA 1OYIA 2NOJB 3NARA 1FLIA 3V8JA 3H1CA 2VODA 1IN8A 3GEZA 3L09A 5FJ8J 1IXCA 3CJNA 4YIIA 2HGCA 4DZPA 2D45A 1YYVA 5FKMA 4ENNA 5L3FA 3ZP5A 1MJAA 5FB2A 1P9QC 3JAMK 5IT9Z 2XDVA 2DA2A 4XONA 2NVTJ 4Q5SF 3FK6A 1XDSA 3LSPA 2OTLI 2VOOA 4RLFA 4HX8A 1WJDA 1FMVA 3HB9A 3PSFA 3S1QJ 2V6CA 2V26A 5B66C 5ILVA 2BY2A 4O5VA 3HL2A 4RGUA 4E7KA 2M1BA 3JCUC 1T98A 3F8FA 1MSFC 4P5OA 3K7AJ 1TWHJ 1TQPA 2VKVA 4I02A 4RAGA 4RB2C 2FBHA 3VODA 4ENMA 2M9HA 3OOUA 4JP0A 2IJLA 2O3FA 3HXLA 1USTA 2V1XA 1SFOJ 1R7JA 4JX4A 3OL3A 2L9RA 2DBBA 3S93A 2GLOA 5JLXA 1G3SA 2A6HF 4FISA 3EYIA 2H1LA 1R5ID 1RUOA 3OYJA 1GXQA 3FF5A 2HS5A 2ICWG 3ROUA 4M6XA 3RQIA 3RPQA 5ERIA 2Y30A 2XUBA 2VBXA 3OYGA 1P4WA 5BNGA 3OL4A 2XF6A 1X19A 5H2FC 3UR3C 2V6EA 2XC7A 1FTTA 3IRRA 1NK2P 2IT0A 2YR2A 3IH4A 2XAJA 2KDOA 4Y33A 4AIKA 2E19A 1HW5A 4GO1A 2IS1A 3HSRA 3FBIB 5KAFC 3RZOJ 2DDBA 2DT6A 1IXRC 4AUXA 2F5VA 1Z67A 4I0AA 2FQ4A 2R0QC 3M1CA 5E79C 1XSXA 3LSTA 2ISZA 1QHHD 2P8TA 4P96A 3A01A 2DTRA 3I0TA 2IGKA 1I3QJ 5EF6A 1ETVA 2KMUA 5DUIA 4KIGA 4HDVA 1YJNI 1B6AA 1R71A 2M4GA 2HFHA 4A5NA 3TO7A 1P92A 3W3CA 1YIJI 3ABUA 2W24A 2ECCA 3FHNA 2UUZA 2GIVA 1R00A 1ZR2A 1D1AA 4BEHB 4F7ZA 3BTCA 2YU3A 5F08A 1TQIA 3BT9A 4Z6YA 3GTMJ 5KHDA 2JK3A 1W1WE 2JMWA 3CO7C 4GCVA 1FIAA 3J81Z 1OLTA 4RA2A 1QZYA 2CU7A 3HZJA 5K5QA 3H5NA 2EZLA 4UUTA 4R79A 1PVEA 2MH2A 2DQLA 5A2QK 4L18B 2BBYA 1AHDP 5FLXK 3HG9A 2Q8KA 4YRVA 3DEWA 3RI4A 1RRJA 4FT8A 2C6YA 2G0EA 2NS8A 2ZJRF 4EM0B 1X1PA 1KQ9A 3LFKA 2LFBA 4DQ2A 3GZ5A 1E3HA 1BBYA 2AXLA 4BY7J 3OS2A 3LAJA 2QGUA 1OJLA 3SDGA 4FE7A 1YHQI 4MQVA 2I8DA 2HQ5A 4E4HA 1J0RA 4CICA 2LRDA 4XKBA 2P81A 2KISA 2IP2A 3M8FA 2GA2A 2L4AA 1O3RA 3FXQA 3MMYB 4NC8A 2P5VA 2NVUB 2OU2A 1VF9A 1EKEA 4Y15A 1ZYRF 1ZRCA 5DD8A 2HVSA 1Y6IA 4M9ZA 1N25A 3KZZA 4A3FJ 3CF2A 3PIPF 3IH3A 3VOEA 4CSWA 1IUYA 3CC4I 3BG7A 2M7AA 1T95A 3EDPA 3G1MA 3SXYA 4HW0A 3W2WA 3CCLI 2R7TA 4EGZA 5FKLA 1FOKA 2R5ZB 3ASNH 3C18A 5CKTA 4Y3OA 3AL0B 4RAYA 3CLOA 1R1VA 3JRDA 1H0MA 2JA2A 2V7FA 3GMEA 1XCVA 4D5FA 3RSNA 1MW7A 2R7OA 4IHWA 3K4CA 1S3JA 2FOKA 1R5HA 3DEUA 5K7HA 1Z7LA 4M6VA 1FT9A 3CMYA 2RV8A 4FX4A 5GPCA 3PQJA 1P7IA 4AD9A 4MEXF 1FOXA 3J80Z 4BYYA 1GVJA 1UHWA 1LVKA 5E18F 5GAGJ 2HYFA 3K69A 3L2QA 4PK4A 3WHBA 4BQAA 2B7EA 2E2IJ 3MAJA 1FOYA 4W1UA 3SEZA 1FX7A 1HKSA 3COAC 4D0PA 2QQ8A 5DCMB 2LDUA 4MFDA 1N78A 4BACA 1MBHA 3K1NA 2Y75A 2WB1N 4HBLA 5LRRA 3DFGA 2OAZA 4RM3A 5FFXA 3SEQA 2R92J 2KZVA 1ON1A 3Q0VA 1LE8A 3GLXA 3HKZA 4L5IA 4YIRX 2TRTA 1SVLA 1SD4A 1WFXA 3BR2A 3S8PA 4NQWB 4I76A 3RCOA 3KCCA 5EEHA 1JGGA 4FX0A 3BWGA 1HOMA 2I10A 3WGHA 1TWCJ 2ISYA 3OYEA 1UFMA 1BR1A 4CUGA 3Q5FA 3PQKA 2V1UA 1SVOA 2W84A 1RZ4A 5DS9A 2WBMA 4GRIA 3MEXA 2IGOA 4AYBA 3U1DA 1UELB 2BVLA 1R5GA 2DQRA 2HPIA 1EA3A 4CGZA 3KFWX 1K6YA 4CCNA 4CXFA 2L7FP 3HRMA 4XLNF 1X1AA 1SVMA 2AQEA 2CW8A 4G6QA 2QLZA 1ZLJA 4IEJA 4L9VA 2OBPA 3I3LA 3S1RJ 4N4OB 1OISA 3HYIA 3CF5F 1A36A 4KICA 2V9PA 2AO9A 1U3EM 4V19K 4AIDA 4EATA 3C1DA 2UZKA 3HOTA 3NEUA 4BJ6C 2L9NA 2DMNA 3H36A 4J19A 2STWA 3IC7A 1JKPC 2QZ8A 2FF4A 1EH8A 1WJAA 2MW8A 4XM3A 1WRJA 4A3GJ 2CUZA 3TMOA 4Y4RA 2PLYA 2DDAA 2DA7A 1Y8RB 2VI6A 2ZFWA 2PI0A 4XSZF 5CVIA 5AIQA 2VUMJ 3W6JB 3F3XA 3OYFA 1B72B 1B1BA 1FWZA 2DFEA 1OCZH 4QPQA 5EDNA 1IN5A 5IPAA 2JRMA 1BIAA 4XIDA 3DPUA 3CQZJ 3ZQLA 3HIFA 4P9UA 4I99C 3OV8A 1XGSA 2A69F 1V5FA 4EM2A 3K1PA 2ZC2A 2XKOA 2VBZA 2CRGA 3GWZA 1WJEA 2CUFA 4XQFA 1R1TA 4B43A 1OMIA 1K4TA 3DF8A 4CZCA 3U9GA 4PFPA 2XAFA 4HF0A 4CCLA 3E5UA 1F4KA 2VJ5A 1FP2A 2PMHA 3WTXC 1KGSA 3RKYA 2K9SA 5M3MJ 1FBSA 4E6KG 1J09A 1Z05A 2X48A 2DJIA 1A31A 1I6XA 4B8XA 3HOZJ 6PAXA 2K9NA 1KYWA 1ZK8A 2Y9ZA 2XGDA 3V8KA 1Z91A 2HQRA 2XB0X 4TV7A 4IF4A 1XN7A 4UV8A 1ZLKA 3RKXA 2A61A 4XRSG 1JKQC 1KU2A 2VJ4A 1XGNA 1LB2A 3OYHA 1B8IA 1ZRFA 1VQ8I 2EFPA 4U88A 5K7FA 2ACJA 1UAAA 4BY1J 2P5KA 3K70C 4PDKA 2RDPA 2NVXJ 1R36A 3C7JA 1X4PA 3NWTA 1BW5A 2QUFA 4IHXA 4A93J 3KYLA 1HLVA 1HF0A 3OYNA 2VB6A 1IGNA 3I64A 3ZOBA 2FEZA 3O8HA 1D5YA 2A5YB 2R7FA 2Z5UA 3WODF 4ZYHA 4CCJA 2W82A 3ZQ7A 1FJLA 2K3FA 3GVAA 5DD4A 2OC6A 2D2WA 2IEKA 4IHYA 3M9AA 3H9GA 3DLAA 2FQ3A 1G8XA 4EJOA 4ENKA 2BV6A 2L9SA 2X6YA 4XRFA 3CCMI 2CQNA 5D5UB 3HOSA 1RR8C 1LFBA 3TBIA 4P55A 1ODDA 4BQOA 5F0HA 1E3PA 1LEAA 2V9KA 2UXNA 2H09A 1S7EA 2BW3A 2QQBA 3UKGA 3CP2A 2V79A 3BCAA 3E97A 3HRUA 2KJCA 3DV8A 5F04A 3VYSB 4PJNA 2OPTA 5D5WB 2X4HA 4OAZA 3N05A 3FXJA 1JTYA 4DBRA 4BXUA 2EJRA 3WE3A 3MD2A 2O0YA 4M3FA 5D8KB 5D5VB 3R61A 1Y1WJ 1DQUA 2QA4I 2FX0A 4D9JA 1R23A 5LFAA 2ID3A 1MZBA 1SEUA 2EFQA 3ZMZA 3FXMA 5FKOA 2KL4A 4FETA 3JAMZ 2BZTA 3N4MA 3S32A 1Y0NA 3PFYA 3GTJJ 4U7BA 3KP7A 3I59B 1GUUA 3HHGA 3ZGKA 4ENJA 2YX4A 5EJCA 3LSMA 5FLVA 1YW8A 1RKWA 1RC9A 3MZ8A 1R22A 4XLCA 4OINF 2EA2A 5IY5H 5E8IA 1E17A 1DGWY 4O6JA 4XL9A 4I09A 2DW4A 3I56I 2R93J 4CCOA 4LG0A 3OIOA 4MNUA 3OYDA 4O3MA 3X2QH 3K4KA 3ZMDA 3IWZA 3I53A 3OMYA 3K4LA 5ICFA 3ULQB 1ZG3A 5E3MA 2YSRA 2MSYA 2CG4A 4LJZF 4MIMA 4YFNF 4PFOA 2QSGX 1DGRM 2K4BA 3HBLA 2ZXHA 3H35A 1FC3A 3LSKA 2DYSH 2WB1A 2LH9A 5IYBJ 1TWFJ 4LIVA 3PUFA 1O3TA 1UB9A 3ZPLA 4NC7A 1DDNA 2EK5A 1IDYA 4U0YA 3KX2A 3VB2A 3OYKA 2W7NA 1XMKA 1HA8A 1JT6A 2KLOA 3PJRA 3WTTC 1BC8C 3LL7A 1D0ZA 1STZA 1XS9A 1BC7C 2H1KA 4UY8I 5C44J 2E1MB 2BE5F 2ZMEC 3AAFA 4YFXF 3PM1A 4B47A 2JN6A 3A1YA 3KEQA 5KVRA 5JLWA 2OUMA 1KQ8A 1P4AA 1YITI 1WI9A 3ZQFA 3R6SA 3REOA 3KZIC 2CWEA 2RQQA 4Z2YA 2VE9A 1S72I 4HRIA 2KP6A 4M6YA 4DNCA 3ECHA 5E1WA 2O7OA 3ZQQA 4I98B 1WHUA 3MKWB 1Z0XA 1L0OC 1MBJA 1QRYA 4LD5A 2K4JA 1V3FA 4XLAA 2O8KA 2B63J 3HDDA 2IBDA 2KIMA 2EV5A 3WTSC 1S6LA 2JZYA 1QNTA 1ONVA 1ETOA 4KIBA 1YLFA 5KK1A 4DZJA 3H9JA 2IVMA 2KRCA 3JRFA 1KONA 3KYDB 2WV0A 4W97A 3WE2A 1WCMJ 2VIXA 1B9MA 3E6MA 2EBIA 3OIQA 1ZREA 2TCTA 5FLXZ 1QZZA 4JX6A 5FD5A 1PP7U 2EV0A 3ZQCA 2BGCA 3F0CA 5HDNA 2HNHA 3ZN0A 2QBYA 4PSWA 3S3MA 3IAS2 3LSHA 1Q1VA 3S1MJ 3E6DA 3Q9SA 2E36A 2XF7A 2E1OA 4IQ4A 4ZH4F 2N8GA 4HNTA 4A12A 1AWCA 2VOPA 2L01A 2VQCA 1BM9A 5M5YJ 2LBFA 3DKWA 5D6EA 3GFIA 2DPDA 2L02A 1KZHA 5H20A 2EWNA 4NBQA 2EA4A 3QPLA 1HXDA 4M73A 1VZ0A 1D8KA 5LGUA 5HNHA 1Y8QB 4LLNA 3FM3A 2VONA 3ABLH 1O7FA 3S14J 4F55A 2KT0A 2VKDA 2BHZA 3WTUC 2E2JJ 2V1NA 3CMMA 3LWFA 2MG4A 3S2DJ 3CDHA 3GZ6A 2VE8A 3JTHA 4XLFA 5EZHA 3E0JB 1LE8B 4MFEA 2ELKA 2M34A 2WAQN 2Y9YA 3J7AY 1BIBA 2W00A 3C2HA 3B02A 4X0GA 3SJMA 2AS5F 2JPBA 1T2KA 3S17J 2HOEA 4L5JA 2KPMA 3D1NI 3PFIA 2P0WA 4IKFA 1FYKA 1H89C 2X6OA 1WWXA 1D3YA 3QPSA 4PJLA 1W36D 3PL8A 4WX9A 1U5TC 4F93B 4BQQA 4Y13A 2ZFUA 2XAGA 2EFWA 5CPRB 3OYAA 1FIPA 4EEFG 3JRHA 5HVQC 2PMZA 3ML6A 1QBJA 5DM6F 2F4MB 2WY7Q 3GLLA 2CV2A 2KRFA 1TC3C 5J3LA 2ESNA 3KP2A 1YFHA 3VYTB 4ZYGA 3V7SA 4HAMA 2ZJPF 2JPCA 3EUHA 5TRDA 2RNJA 5CLSA 1DUXC 1MIJA 2DI3A 1K7AA 3S3OA 4OWRB 1TW2A 2WY8Q 3G3ZA 5J4YA 3TP3A 5HLIA 4UUSB 3GX4X 4J00A 3V8LA 2LD5A 5M3FJ 1HW1A 4A6EA 2CW7A 4WXCA 2A68F 4M72A 2FE3A 4XN0A 2HQAA 5FO5A 4HNUA 2K9LA 3IAM2 2ZBKA 3ZMVA 1SD7A 4HSTA 1XCBA 2A07F 2RKHA 4LIUA 2VJJA 4ZZDA 4JOMA 2XKPA 3G4SI 2X85A 1YG2A 2DU9A 3CJTB 4HG2A 3SZPA 3AG4H 3I59A 3W6KB 4IRHA 5DCFA 1SAXA 2HDCA 4EVIA 3HOVJ 4EJUA 5LEJA 2DO7A 4BE0A 2K9QA 2ELJA 1MH3A 2RN7A 3WGIA 1WQ2A 2MD5A 1OFCX 4YIFA 5J4VA 3DBLB 1BR4A 4HLYA 2CGPA 4RLQA 3I58A 3E3VA 2Z9OA 2LR8A 3QP6A 4G6DA 2PQ8A 4UVBA 3TO6A 2X0LA 5H6QA 1GXPA 1DPUA 4KMFA 4HV5A 1WZ2A 3RJPA 1BI1A 3NRVA 4S05A 3SYTA 1KQ0A 1X2NA 4MHGA 3FK7A 1F43A 3KEOA 2ELHA 2ZNYA 1A04A 2PX9A 3FMSA 4XLHA 1LKXA 2XPWA 1OKRA 3RTRA 2FXAA 2PFBA 3DPLC 2KDZA 3DU5A 2JTVA 1JKOC 2K3PA 2GXGA 4F91B 3MFKA 2DCEA 4ASNA 4M9SA 2BY3A 3T8TA 1VQ5I 4A0XA 4II2A 2O5RA 1VTNC 2DK5A 3BPVA 4A6DA 3J7ZI 4AVZA 3QP5A 1FEXA 3FKIJ 1YI2I 2W1OA 2Y2ZA 1B8IB 2L2OA 3HPGA 1GDTA 3CDLA 4KISA 4ZZLA 2YX7A 1SMYF 2EV6A 3M07A 1Q1HA 3DU6A 1E2XA 1IXSB 2ECBA 4RM2A 2KIQA 3BZKA 1WJBA 3OS0A 4AWXB 5HS7A 4HPQA 3MZYA 4MGRA 4I0BA 2R7SA 1KU3A 4M3DA 3JW4A 4HA8A 2E1NA 3E5QA 2GBYA 3ZQHA 4IQJA 2F48A 1BI0A 1I27A 2ZNZA 3OOPA 3QU3A 4LB6B 1MMNA 2UXXA 3ABTA 3SQNA 2VBYA 5LBQA 3BPXA 2DA6A 5ICCA 2ZB9A 1I6HJ 1I50J 2WV1A 3ZMSA 5DDGA 4LOCA 3CMEI 3HJEA 3B6AA 4KFCA 1QZEA 1G6NA 3ABMH 3KETA 4AIHA 2W48A 4B1RA 1Z1DA 2OCEA 3HSEA 4MQ9F 5B1BH 3IHUA 2MABA 2MGQA 2ZSIB 1R1UA 4KITB 3LA2A 1X3WB 4MEYF 1ON2A 2DK8A 2QQAA 3WTZA 1P6RA 5EGOB 1SMTA 2QEXI 4EJWA 2OD5A 1W4MA 3DTIA 2DTZA 4HOBA 1B4AA 2JSCA 2BW3B 2R5YA 4L0ZB 5GADJ 3GTGJ 4R8HA 5EG0B 2VLAA 5EZGA 1YIOA 3OSFA 2QKMB 4F52A 3QYEA 4L9TA 1U8BA 1HKTA 1F1ZA 3CCRI 2R7XA 4A3KJ 3I71A 4LITA 3Q3SA 1D8JA 2BEOA 2BVMA 3S2WA 4XKVA 2ZO4A 1XB4A 3QYFA 5IT9K 3B73A 3K2ZA 2HYJA 3U2RA 4UV9A 3J7YJ 3ZMUA 2HXIA 2DLLA 2RC4A 3CP8A 4ESFA 2VPRA 3S1NJ 1TBXA 3A0BC 3VSLA 4MTDA 4BNCA 3CMAI 2CSOA 3ZRGA 2A6TA 2IA2A 2AXTC 1O3QA 2PJRB 2QSHX 1FBQA 1TT0A 4N9HA 2DOFA 4RAZA 3PNVA 4QLCU 1NTCA 5CYVA 2VL8A 2GAUA 3MKZA 1R58A 4A5MA 3CD6I 1V4RA 3SZGA 4U0WA 2HWVA 1ZG1A 2EFNA 2DPUA 2JVHA 1J59A 2X6WA 2Z99A 1TP4A 4PGGA 4LG0B 4HF1A 1OCRH 3QOPA 3GW2A 4EMSA 1HSTA 1YOVB 3GUDA 3H5AA 2QYOA 3L2CA 4D7MA 2FOWA 3AG1H 1MBKA 1RR7A 1OR7C 5AIPA 4AU7A 4BU2A 2DMTA 3HM5A 3V42A 3W2AA 3F8MA 1O4XA 5DM7F 2E7WA 4C3IJ 4RAFA 3EYYA 3O8GA 4D7NA 2P7CB 2EH3A 2WTEA 3F22A 3FZVA 1PP8F 1VQ6I 2XGCA 2VQLA 3JRCA 2WAQA 1O3SA 2FA5A 4XNFA 1K61A 1FYLA 2H27A 3RPUA 1K78A 2MA3A 1UCRA 4A2UA 2LNBA 3CDIA 3P9KA 3OYIA 4IHVA 2LREA 2Y69H 1VQ4I 3JR9A 3KEYA 2JJ7A 4ON0A 4DOZA 3H3UA 4UHTA 4I7HA 4QTRA 1YW7A 3KPHA 3DQVC 4CA0A 3R0AA 2WWYA 1PUEE 4UUSA 3JSOA 2EIJH 1BN5A 1ETYA 3BR3A 2JUCA 5BOXA 1RIOH 3HC7A 2WAEA 4B48A 5M5XJ 3CCVI 2GXAA 5ILSA 2VT3A 3NAUA 4OMYA 3M4OJ 3BG5A 1LVAA 3MN2A 4IL6C 2LLKA 1YS7A 1JHFA 3LAPA 4AC0A 5BPIA 2L9VA 1D0YA 4NUBA 3J81K 2O9LA 3BG6A 2QF7A 4KMUX 4OIOF 4AIJA 3BTIA 2X6XA 5DEQA 4NB5A 1HDDC 9ANTA 5FROA 3I4MJ 1AOYA 3OY9A 2Q0OA 5C4JJ 2IGNA 3H0GJ 4ZJZA 3L2UA 3GO5A 4A3IJ 4GYGA 1FZPB 1ZELA 3H3ZA 3C2GA 4IZZA 4EGYA 1S8NA 1D5VA 1GVDA 2DFFA 5K5RA 4FASD 1OCTC 2RGVA 3VPRA 2OZ6A 4Y17A 1YE9A 3LNQA 1W5TA 4FCYA 2QBYB 2LKSA 3T1BA 3OYBA 3VDXA 2EIMH 3LA7A 2KRHA 1TL8A 2AQFA 1UMQA 4LK1F 3GFLA 2LSOA 1NG6A 1RNLA 2J5OA 1WI3A 2XAUA 2VASA 3IWFA 1MBFA 2LBFB 1QPIA 1C0WA 3QODA 1YW9A 2E7XA 2MH9A 1JE8A 5BPDA 2CQQA 1VI0A 4A69C 3GZNB 5LHIA 5F6FA 3QWLA 4CH7A 5BQTA 5FFZA 2NYXA 2JVGA 1TWGJ 4UB8C 1L3LA 3DEEA 5E1XA 4PZJA 4ABZA 2M5WA 3DWLE 3TL4X 2OA4A 4OOIA 1NH3A 3HTSB 5IP7J 2PMZN 2DODA 3FXRA 4XKCA 4G7OF 2P6SA 1CGPA 2V9VA 1IN6A 1ZN2A 2LF7A 3Q0UA 2CFOA 1LDKB 2HOAA 4HX4A 2H8RA 3DKYA 4OIQF 4CDGA 1G4DA 3PO2J 3BTLA 2F5DA 5DV5A 4IRIA 2HDDA 4XK4A 5FGMA 4G7ZF 1V54H 2PN6A 4L0YB 4XLEA 4AVPA 2ZMEB 1LUJB 4B3AA 4BXXJ 5FRMA 4WWCA 2HYGD 4LFUA 2RREA 2X1CA 1SFXA 4LLLA 3A02A 3FBNB 2RQPA 2F5EA 3OYMA 1HW2A 5LHHA 2E2HJ 4A3DJ 2M0MA 4PGHA 5EGOA 2E5NA 2O61A 2NAZA 1OYYA 1R4NB 1XC5A 3DTEA 5K1YA 4E7LA 3J7AO 3KP3A 4E7JA 2HXOA 3BLYA 3WTWC 3RIRA 1YX3A 2GOMA 4CO8A 2M87A 5EG0A 2FD5A 2COBA 3A03A 3BG3A 1KU7A 1NK3P 2CV0A 2IS2A 1G3TA 1JUMA 3VWBA 3HHHA 1CQTA 5L3BA 3VYRB 1ZHFA 2LOOA 5JFRA 1I3AA 3BROA 1VQPI 1RUNA 4BBSJ 3GFJA 2XROA 1FYMA 4V2FA 3LSRA 1OQYA 1POGA 4M74A 3ASOH 3BDDA 2R7VA 4G8XA 1QPMA 2M0CA 2NS0A 2ME0A 3ZQGA 2PJRA 1S5LC 4OAYA 3PUBA 3U1KA 1TW3A 3OR1C 2JA5J 1R4MB 2E1CA 2GWRA 4BDYA 5CJ9A 4I2OA 3HTUA 2HTSA 2GXBA 3HGGA 1VQMI 2ZXJA 4S04A 2IW5A 1VQ7I 1HC8A 1QQIA 1F5TA 4CCKA 3TP0A 2CMPA 3DBRB 4C2TA 2K5CA 5JVGF 1ZGAA 2P7VB 2QQ9A 3KP4A 1S29A 2KIFA 1G59A 2HZDA 2L54A 4AM3A 3RDIA 1IV8A 2O6GE 1UG0A 2R3SA 5F1JA 1J9IA 2Q2EA 3MCZA 5DUKA 3T0YA 4H0EA 2DMUA 1PDNC 1ETKA 3ZMTA 2A5WA 3F21A 4PSXA 3HUGB 4BS9A 3BQYA 2PG4A 4PUSA 3G6EI 1SFKA 1XD7A 4BQNA 1MJ9A 1Z21A 1U2WA 2D1VA 2K40A 2VC1A 5JI6A 2CW0F 5L3DA 5J6XA 3LSJA 4LGWA 4KYWA 2UV1A 4DBQA 3RYPA 1MH4A 4CYCA 5FKKA 1V5EA 3EPZA 2HEOA 2ZJQF 3A4CA 1TTYA 3I54A 4GYIA 1X1CA 1QHGA 4GXOA 1XMXA 2H94A 1SFUA 2OV7A 2CV1A 3EUAA 3CUQC 5K5OA 2IXSA 3PNYA 4Q47A 5K7ZA 2LTPA 3PNTA 3MKYB 3CLQA 5EEAA 2LKXA 1REPC 4BJTA 1K79A 4A3EJ 2DA5A 5M5WJ 4G12A 1QVUA 2D5VA 2F5FA 3N97A 4NNJA 4DIQA 4C9YA 3HEFA 3HOWJ 2VXDA 4BHBA 2COMA 2EB7A 2W57A 1HKQA 4A3CJ 4EM1A 4LK0F 3P9IA 5L3EA 2OZUA 4Y7NJ 4HV6A 2LYCA 2DFIA 1J2XA 2MLKA 3HOXJ 3FKJA 3Q9VA 1PUFA 3RKQA 3RPUD 1B9NA 2X9DA 5FLMJ 2D1HA 2LVSA 3I9V2 1Z3YA 1IF1A 4RMNA 1EH7A 3DXJF 2R4GA 1JHHA 1D1CA 3LQRA 5A2QZ 3KIOA 3QAHA 2LY9A 4JQFA 5GAHJ 4LB5A 1XMAA 3QU6A 1UG2A 2IA0A 1ULYA 3PSIA 1U78A 1Z77A 2FMYA 4G94A 3ABKH 1MSEC 3BR1A 5AONA 3KP6A 1BOBA 1MMGA 2R5YB 1W7PB 5J1RA 5LGNA 2EIKH 3L7WA 5CVJA 3O3KA 2RVCA 5LRSA 1XPXA 5HDKA 2M8EA 2KJBA 4KJZA 2BYVE 4ZYAA 4IHTA 2L7ZA 3OWTA 4G9YA 2M2EA 1BW6A 1RESA 1ENHA 2RAEA 3FXUA 4C3HJ 4IXAA 1WKMA 2GIZA 2R7RA 1X3UA 5JHFA 1U8RA 1JGSA 3A0HC 3DPTA 4L9NA 3RKWA 3K4BA 3HPHA 2ADUA 5IOZA 4FHTA 4XKWA 1SD6A 2JA6J 4B44A 1T08B 1MGTA 1BL0A 1W5CC 2HVQA 3BQZA 2CO5A 4F3QA 2GM4A 2VN2A 3KLOA 1TNSA 5CVVA 4KNYA 4B4CA 5D8LB 1T56A 1HQCA 1EF4A 3WGGA 4RDUA 1Y56A 3GTQJ 2XRNA 3M7GA 3MWMA 4HQMA 1EJ9A 1FNNA 5HODA 1DP7P 4BDZA 5CQEA 1S9HA 4EV0A 3I4PA 3P9CA 1K6OA 3KZYA 3TW7A 3M3YJ 5J47A 4A3BJ 3CUQA 5KAIC 4B3XA 2X1DA 1A35A 1JXSA 2ZMEA 5J1UA 1VFCA 1GLNA 1LFUP 3JREA 4M9XA 3F8BA 2QENA 1FP1D 2V1DA 4BJ5C 2JQ7A 3S16J 1T6SA 3AFHA 4Q48A 3MZHA 2LKPA 2CUEA 2ZJ2A 2XSDC 1YX5A 1IRZA 3FXLA 4HEA2 4XN3A 2FNPA 1IW7F 5IYCJ 1WSUA 4JYKA 2E1MC 5B5EC 3G73A 1QO0D 1K78B 3RQ4A 2V4JC 2R7WA 1I1SA 2LY2A 1IUFA 3WTYC 4RS8A 2NOGA 3IKVA 1FPQA 3GCMA 4I01A 2PBIA 3D5RC 4IRGA 4DYQA 2K9MA 4NHJA 3DP7A 1H9GA 1XSVA 1DU6A 2ZXIA 4WXDA 2NRAC 4RB1A 3TGNA 4X1EA 2EFOA 3ZR8X 4P1WA 4DYRA 3CCUI 4KUMA 3CJQB 4LG3A 4M3GA 3VYUB 4KIFA 4IOAF 2PMUA 4X6AJ 2EILH 1USSA 3ERMA 2OQGA 5E3LA 5F0CA 4UVAA 5C4XJ 4K2EA 3I55I 2QKLB 4CCMA 4MLOA 1TQMA 4JK1X 3VSKA 5E3NA 4U87A 3H92A 1X1DA 1SFEA 3FIWA 5FKNA 3B6CA 5L3CA 2R7QA 4G6TB 1IO2A 3W2VA 4ZTFA 3AG3H 2Y48A 5HLTA 3CCSI 1LJ9A 3QRFF 4BXFA 3DBHB 5L3GA 1VQOI 4A0YA 4ZDOA 1JUSA 4BBRJ 3ZXSA 4GFBA 3V7RA 2RNGA 1I39A 4Y52J 5EYRA 2DA1A 5GAEJ 3HUGA 1AA7A 2DA3A 4IJAA 3WU1B 3T5XA 2CS3A 4I6ZA 2P4WA 1DU0A 3SFIA 1IRXA 1MD0A 5D6FA 2DXIA 1KU9A 3FISA 3SZTA 2DMPA 1FSEA 4ZYDA 1JJ6C 4RBOA 1GV2A 2XGXA 4UVCA 1JKRC 4E7SA 1ZRDA 1ITYA 5CVUA 4XRSA 1NHAA 4WXHA 1TWAJ 1WJFA 1N77A 4F92B 1H8AC 1TLHB 2A05A 2FBIA 3F8NA 3IP4B 4YELA 4DGWB 4E7ZA 1BJAA 3G2BA 2K7LA 5KCMA 5D4RA 2BY0A 1U5TA 3FX3A 2M45A 3WG7H 5GPAA 3K70D 5IT3A 1YTYA 2ZKZA 1PYVA 5ICEA 4G7HF 2F6CA 2EZHA 1XX5A 3IUOA 3LSIA 4HYEA 1FBUA 4BUPA 5IP9J 2GOXB 3PIOF 1MJBA 2E5ZA 2KIUA 5GP9A 2ETHA 2FUG2 4BAYA 1KA8A 2CYYA 2ID6A 3OYLA 4XLPF 2NNYA 2M7BA 2F4OB 2FMLA 4FQGA 1JI8A 2YS9A 2K86A 5EEGA 3GTOJ 5HLHA 1MNMC 1FTZA 1DPRA 3BJOA 3WTVC 5LEKA 1NG7A 1UHSA 4XRMA 3L9FA 2L7KA 3PO3J 4KT6A 3VEPA 1UZCA 3WHCA 2BY1A 2MC3A 2VXZA 3DCFA 1QA6A 2XSJC 3SHFA 3BZ6A 3GBGA 3TDZC 1LEBA 4N0BA 1F9NA 3M8JA 4ZTJA 1T0FC 4S0HB 4BL0B 2UWMA 3HSFA 2XF5A 1W7PA 3CC2I 1O7LA 1AKHB 2M30A 3E6BA 5B1AH 2MLGA 2XASA 2FBKA 3LQQA 1XDUA 2MC4A 3GF2A 1OCPA 1P7JA 1YJ9I 2I5UA 2E34A 3JTGA 3HOYJ 1KYZA 3LMMA 1BA5A 4PJMA 1LDJA 2Z3YA 2HU9A 3E6CC 3U21A 1A5JA 3F6OA 1X2MA 2DN0A 1HDPA 3JSPA 2JWTA 3IKTA 1I5ZA 3KYCB 1G3YA 2W25A 1BR2A 5J1YA 2DMQA 5TGTA 3W6VA 2Z1DA 1R9TJ 1LFPA 3E1SA 4ZC3A 1U0JA 2K27A 4EJTA 3R0JA 2IAIA 3BTJA 1K83J 2EZIA 5LHGA 1Z6RA 1YRNA 3JRBA 1P4XA 1ZR4A 2P6TA 1J75A 2ZSHB 2TDXA 1VQNI 3BJ6A 2MYSA 4KDPA 2JSPA 2LF8A 4BGDA 1HSJA 3L1PA 3P7NA 2WA0A 5D5XB 3TEDA 3IL2A 5H6RA 4BHCA 3QYBA 4D5CA 4XSXF 4PJ0C 4E70A 4HF2A 4WCGA 4N4NB 1WVRA 3TKYA 1XSDA 1ORKA 4BKXA 2DOAA 4B09A 2Q2EB 1ZKGA 1QVTA 2L0KA 5ED4A 4BE1A 1ZTRA 1SAUA 3KLNA 1T39A 2KHMA 1MMSA 1GHCA 4DJAA 3S15J 2Z2SB 2LK2A 3TO9A 3FXOA 2PEXA 1K4SA 4IO9F 3FDYA 1IC8A 1EV7A 4RGXA 3DTKA 1P2FA 4XR6A 1QU3A 3LOCA 2XV4S 4J01A 4CYCB 3H0DA 2BXZA 3L2WA 1LNWA 2HKXA
chains in the Genus database with same CATH topology
2HXOA 3BTCA 5F08A 2E1OA 3BT9A 5DTDA 3GTMJ 2JK3A 5EG0A 2JMWA 2N8GA 2FD5A 2COBA 1JUPA 1FIAA 3A03A 3BG3A 1NK3P 2CU7A 1JUMA 5M5YJ 2EZLA 4NDLA 4UUTA 1CQTA 1AU7A 3BR6A 1AHDP 4BBSJ 1IDZA 5F27A 4JX5A 4DW6A 4V2FA 3DEWA 3LSRA 2YUSA 3QPLA 2G0EA 1POGA 1ETQA 2NS8A 1BJZA 4FTHA 2LFBA 2M0CA 2ME0A 4BY7J 3ZQGA 4QIWN 3S14J 2DA4A 2KT0A 1PUFB 3C2BA 1OJLA 3SDGA 4FE7A 2E2JJ 2JA5J 2MG4A 3S2DJ 1F36A 3MKLA 2HQ5A 5EZHA 2JA7J 3HGGA 3BR5A 1LE8B 2P81A 4MFEA 2ELKA 2M34A 1SANA 2WAQN 2Y9YA 1MBEA 3SJMA 3TP0A 1HCRA 1VF9A 1JJ8C 3S17J 4A3FJ 3D1NI 3IH3A 1H89C 3QQAA 5F1JA 2NVYJ 2NVQJ 2X6OA 2HOTA 2DMUA 1ETKA 3QPSA 3G1MA 1E3OC 3BQYA 5FKLA 4C2MJ 2R5ZB 1WPKA 2K40A 3CCYA 1IV6A 1FIPA 2AHQA 4EEFG 3JRHA 3OSGA 3LSJA 3JRDA 1MH4A 4CYCA 5FKKA 1TC3C 4D5FA 5J3LA 1W0UA 4IHWA 4V2GA 2Y0SN 5K7HA 4M6VA 2XB5A 3CMYA 1GT0C 5GPCA 5K7ZA 1P7IA 2XPVA 2LTPA 2QCOA 3TP3A 2LD5A 5EEAA 4UUSB 2LKXA 5M3FJ 4A3EJ 2XPUA 2DA5A 5M5WJ 3G1OA 4G12A 1QVUA 2D5VA 2CJJA 2R7ZJ 3WHBA 2NS7A 2E2IJ 3HEFA 3HOWJ 4W1UA 4A3JJ 4A3CJ 2OF7A 1Y1VJ 4Y7NJ 1VNDA 3HOXJ 4MFDA 1PUFA 1MBHA 3RKQA 2WB1N 2X9DA 5FLMJ 2LVSA 2R92J 3HOVJ 3Q0VA 1LE8A 2K9QA 1MH3A 2TRTA 3GTPJ 4A3LJ 1OFCX 5IOYA 3BR2A 2LY9A 2LR8A 2VKEA 4I76A 1RETA 1JGGA 1UG2A 1HOMA 2I10A 1TWCJ 1U78A 1Z77A 1MSEC 3BR1A 1ZQ3P 2R5YB 1X2NA 5J1RA 4FE4A 3FK7A 3IV5A 1F43A 1AKHA 2YU9J 5IYDJ 3I4NJ 5DS9A 2XPWA 2R5ZA 2L7ZA 4A3MJ 2M2EA 2KDZA 1JKOC 1BW6A 1RESA 1A6IA 1ENHA 2RAEA 4C3HJ 3ZQIA 2L7FP 4IEJA 3S1RJ 4L5EA 5IOZA 1W0TA 4C3JJ 2JA6J 2AO9A 3HGYA 3G1LA 1FEXA 3FKIJ 2XGEA 2Y2ZA 1B8IB 1BL0A 3BQZA 2GM4A 1GDTA 3CDLA 4B4CA 1T56A 1EF4A 2Y31A 3BR0A 2DMNA 2ECBA 4J19A 1U9OA 1XG1A 4RDUA 1JKPC 3GTQJ 3MVPA 1RPWA 2MW8A 5HODA 4A3GJ 4M3DA 2XRLA 3ZQHA 2GBYA 2DA7A 2VI6A 3TW7A 3M3YJ 2VUMJ 4A3BJ 1GV5A 3E7LA 1B72B 2DA6A 2CQXA 2ZB9A 1I6HJ 5EDNA 1I50J 2WV1A 4XICA 4M3EA 4LOCA 5IPAA 5J1UA 3B6AA 1VFCA 1LFUP 4XIDA 3JREA 3CQZJ 3ZQLA 3A01B 5C3EJ 1ETWA 2ME6A 2W48A 4B1RA 1G2HA 3GTKJ 2MGQA 3S16J 2CRGA 2CUEA 2CUFA 2XSDC 1IRZA 3TW6A 5EGOB 2HOSA 2JA8J 2DTZA 5IYCJ 4JYKA 2R5YA 3GTLJ 4HNVA 3GTGJ 5EG0B 5EZGA 3H3VK 3OSFA 1IUFA 2NOGA 2K9SA 1WH7A 5M3MJ 3RZDJ 1U8BA 2DJNA 4DYQA 2X48A 2M8GX 4A3KJ 3Q3SA 1JT0A 1DU6A 3HOZJ 2K9NA 4X1EA 1ZK8A 1U9NA 2Y9ZA 2XGDA 2HYJA 2XB0X 4DYRA 2HXIA 3S1NJ 2VPRA 1RKTA 3JRAA 4M3GA 4XRSG 1JKQC 1B8IA 4X6AJ 1IG7A 5K7FA 5E3LA 5F0CA 5IP6A 5C4XJ 1NTCA 3JRIA 4BY1J 4MLOA 1H88C 2NVXJ 5E3NA 1ZGWA 2EZKA 1BW5A 4IHXA 3FIWA 4A93J 5FKNA 3B6CA 1HLVA 1HF0A 3S2HJ 1IGNA 3K2AA 3ZOBA 3O8HA 1D5YA 2HI3A 1JUSA 4BBRJ 1B72A 4D7MA 1FJLA 1MBKA 1IJWC 3JRGA 4GFBA 1RR7A 4QSHA 3BG9A 2LP0A 4Y52J 2DMTA 2IEKA 3HM5A 5EYRA 2DA1A 4IHYA 5E3OA 2DA3A 1O4XA 4M3BA 4C3IJ 4I6ZA 3O8GA 4D7NA 1DU0A 2EH3A 2EQRA 3SFIA 1APLC 3IH2A 3FISA 2XGCA 2DMPA 1MBGA 1LFBA 3JRCA 4RBOA 2FJ1A 1JJ6C 1GV2A 5F0HA 1JKRC 1ITYA 1JTXA 1S7EA 4XRSA 1K61A 1TWAJ 1H8AC 1ETXA 3UKGA 3HOUJ 4IHVA 3HKZN 5F04A 3JR9A 1T33A 2JJ7A 2OPTA 4DYCA 5F0FA 4QTRA 4MO7A 1JTYA 1WGXA 1YRNB 4UUSA 1ETYA 1X58A 3Q0WA 4M3FA 3BR3A 5GPAA 1Y1WJ 5M5XJ 2FX0A 3NAUA 2ID3A 3M4OJ 3BG5A 3MN2A 2LLKA 2EZHA 5FKOA 2L7MP 4AC0A 3LSGA 5IP9J 3GTJJ 5GP9A 2O9LA 2QF7A 2ID6A 3BTIA 1WH5A 4AYBN 1GUUA 1HDDC 9ANTA 3I4MJ 5C4JJ 5FLVA 3H0GJ 1RKWA 2YS9A 4A3IJ 3NARA 3GTOJ 1MNMC 1FTZA 5FJ8J 1UHSA 4XRMA 3PO3J 1GVDA 2R93J 3WHCA 4DZPA 3OIOA 5FKMA 1OCTC 3VPRA 3DCFA 3LNQA 4FCYA 3GBGA 2DA2A 2NVTJ 4S0HB 5E3MA 3FK6A 3LSPA 2MSYA 1UMQA 4MIMA 3HB9A 3S1QJ 1AKHB 1WI3A 3HBLA 1MBFA 3HOYJ 1OCPA 1P7JA 1MSFC 1BA5A 3K7AJ 1QPIA 1TWHJ 2VKVA 5IYBJ 1TWFJ 1A5JA 2M9HA 2CQQA 3OOUA 1VI0A 1X2MA 2DN0A 4JP0A 4A69C 1HDPA 1IDYA 2JWTA 1JT6A 1SFOJ 4JX4A 2L9RA 5J1YA 2GLOA 3W6VA 2DMQA 5JLXA 1R9TJ 1TWGJ 4FISA 1XS9A 2H1KA 5C44J 4ABZA 3PM1A 2IAIA 3BTJA 1K83J 2EZIA 2JN6A 3RQIA 3JRBA 1YRNA 5IP7J 1ZR4A 5JLWA 2PMZN 2Y30A 3ZQFA 5BNGA 1FTTA 3Q0UA 1NK2P 3L1PA 3IH4A 2HOAA 3TEDA 2H8RA 2O7OA 3S1MJ 2E19A 4D5CA 3PO2J 1Z0XA 3BTLA 1MBJA 1QRYA 2HDDA 3RZOJ 4XK4A 2O8KA 2B63J 4AUXA 3HDDA 1ORKA 2IBDA 4BKXA 2FQ4A 2R0QC 1ETOA 1ZKGA 1QVTA 4DZJA 2L0KA 1ZTRA 3JRFA 4B3AA 4BXXJ 3A01A 3S15J 4W97A 2LK2A 1I3QJ 1WCMJ 5EF6A 1ETVA 2EBIA 3A02A 1IC8A 2TCTA 4JX6A 3ZQCA 3LOCA 2E2HJ 2ECCA 3F0CA 4CYCB 5EGOA 4A3DJ 1XC5A 1ZR2A 1Q1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXO A;  3BTC A;  5F08 A;  2E1O A;  3BT9 A;  5DTD A;  3GTM J;  2JK3 A;  5EG0 A;  2JMW A;  2N8G A;  2FD5 A;  2COB A;  1JUP A;  1FIA A;  3A03 A;  3BG3 A;  1NK3 P;  2CU7 A;  1JUM A;  5M5Y J;  2EZL A;  4NDL A;  4UUT A;  1CQT A;  1AU7 A;  3BR6 A;  1AHD P;  4BBS J;  1IDZ A;  5F27 A;  4JX5 A;  4DW6 A;  4V2F A;  3DEW A;  3LSR A;  2YUS A;  3QPL A;  2G0E A;  1POG A;  1ETQ A;  2NS8 A;  1BJZ A;  4FTH A;  2LFB A;  2M0C A;  2ME0 A;  4BY7 J;  3ZQG A;  4QIW N;  3S14 J;  2DA4 A;  2KT0 A;  1PUF B;  3C2B A;  1OJL A;  3SDG A;  4FE7 A;  2E2J J;  2JA5 J;  2MG4 A;  3S2D J;  1F36 A;  3MKL A;  2HQ5 A;  5EZH A;  2JA7 J;  3HGG A;  3BR5 A;  1LE8 B;  2P81 A;  4MFE A;  2ELK A;  2M34 A;  1SAN A;  2WAQ N;  2Y9Y A;  1MBE A;  3SJM A;  3TP0 A;  1HCR A;  1VF9 A;  1JJ8 C;  3S17 J;  4A3F J;  3D1N I;  3IH3 A;  1H89 C;  3QQA A;  5F1J A;  2NVY J;  2NVQ J;  2X6O A;  2HOT A;  2DMU A;  1ETK A;  3QPS A;  3G1M A;  1E3O C;  3BQY A;  5FKL A;  4C2M J;  2R5Z B;  1WPK A;  2K40 A;  3CCY A;  1IV6 A;  1FIP A;  2AHQ A;  4EEF G;  3JRH A;  3OSG A;  3LSJ A;  3JRD A;  1MH4 A;  4CYC A;  5FKK A;  1TC3 C;  4D5F A;  5J3L A;  1W0U A;  4IHW A;  4V2G A;  2Y0S N;  5K7H A;  4M6V A;  2XB5 A;  3CMY A;  1GT0 C;  5GPC A;  5K7Z A;  1P7I A;  2XPV A;  2LTP A;  2QCO A;  3TP3 A;  2LD5 A;  5EEA A;  4UUS B;  2LKX A;  5M3F J;  4A3E J;  2XPU A;  2DA5 A;  5M5W J;  3G1O A;  4G12 A;  1QVU A;  2D5V A;  2CJJ A;  2R7Z J;  3WHB A;  2NS7 A;  2E2I J;  3HEF A;  3HOW J;  4W1U A;  4A3J J;  4A3C J;  2OF7 A;  1Y1V J;  4Y7N J;  1VND A;  3HOX J;  4MFD A;  1PUF A;  1MBH A;  3RKQ A;  2WB1 N;  2X9D A;  5FLM J;  2LVS A;  2R92 J;  3HOV J;  3Q0V A;  1LE8 A;  2K9Q A;  1MH3 A;  2TRT A;  3GTP J;  4A3L J;  1OFC X;  5IOY A;  3BR2 A;  2LY9 A;  2LR8 A;  2VKE A;  4I76 A;  1RET A;  1JGG A;  1UG2 A;  1HOM A;  2I10 A;  1TWC J;  1U78 A;  1Z77 A;  1MSE C;  3BR1 A;  1ZQ3 P;  2R5Y B;  1X2N A;  5J1R A;  4FE4 A;  3FK7 A;  3IV5 A;  1F43 A;  1AKH A;  2YU9 J;  5IYD J;  3I4N J;  5DS9 A;  2XPW A;  2R5Z A;  2L7Z A;  4A3M J;  2M2E A;  2KDZ A;  1JKO C;  1BW6 A;  1RES A;  1A6I A;  1ENH A;  2RAE A;  4C3H J;  3ZQI A;  2L7F P;  4IEJ A;  3S1R J;  4L5E A;  5IOZ A;  1W0T A;  4C3J J;  2JA6 J;  2AO9 A;  3HGY A;  3G1L A;  1FEX A;  3FKI J;  2XGE A;  2Y2Z A;  1B8I B;  1BL0 A;  3BQZ A;  2GM4 A;  1GDT A;  3CDL A;  4B4C A;  1T56 A;  1EF4 A;  2Y31 A;  3BR0 A;  2DMN A;  2ECB A;  4J19 A;  1U9O A;  1XG1 A;  4RDU A;  1JKP C;  3GTQ J;  3MVP A;  1RPW A;  2MW8 A;  5HOD A;  4A3G J;  4M3D A;  2XRL A;  3ZQH A;  2GBY A;  2DA7 A;  2VI6 A;  3TW7 A;  3M3Y J;  2VUM J;  4A3B J;  1GV5 A;  3E7L A;  1B72 B;  2DA6 A;  2CQX A;  2ZB9 A;  1I6H J;  5EDN A;  1I50 J;  2WV1 A;  4XIC A;  4M3E A;  4LOC A;  5IPA A;  5J1U A;  3B6A A;  1VFC A;  1LFU P;  4XID A;  3JRE A;  3CQZ J;  3ZQL A;  3A01 B;  5C3E J;  1ETW A;  2ME6 A;  2W48 A;  4B1R A;  1G2H A;  3GTK J;  2MGQ A;  3S16 J;  2CRG A;  2CUE A;  2CUF A;  2XSD C;  1IRZ A;  3TW6 A;  5EGO B;  2HOS A;  2JA8 J;  2DTZ A;  5IYC J;  4JYK A;  2R5Y A;  3GTL J;  4HNV A;  3GTG J;  5EG0 B;  5EZG A;  3H3V K;  3OSF A;  1IUF A;  2NOG A;  2K9S A;  1WH7 A;  5M3M J;  3RZD J;  1U8B A;  2DJN A;  4DYQ A;  2X48 A;  2M8G X;  4A3K J;  3Q3S A;  1JT0 A;  1DU6 A;  3HOZ J;  2K9N A;  4X1E A;  1ZK8 A;  1U9N A;  2Y9Z A;  2XGD A;  2HYJ A;  2XB0 X;  4DYR A;  2HXI A;  3S1N J;  2VPR A;  1RKT A;  3JRA A;  4M3G A;  4XRS G;  1JKQ C;  1B8I A;  4X6A J;  1IG7 A;  5K7F A;  5E3L A;  5F0C A;  5IP6 A;  5C4X J;  1NTC A;  3JRI A;  4BY1 J;  4MLO A;  1H88 C;  2NVX J;  5E3N A;  1ZGW A;  2EZK A;  1BW5 A;  4IHX A;  3FIW A;  4A93 J;  5FKN A;  3B6C A;  1HLV A;  1HF0 A;  3S2H J;  1IGN A;  3K2A A;  3ZOB A;  3O8H A;  1D5Y A;  2HI3 A;  1JUS A;  4BBR J;  1B72 A;  4D7M A;  1FJL A;  1MBK A;  1IJW C;  3JRG A;  4GFB A;  1RR7 A;  4QSH A;  3BG9 A;  2LP0 A;  4Y52 J;  2DMT A;  2IEK A;  3HM5 A;  5EYR A;  2DA1 A;  4IHY A;  5E3O A;  2DA3 A;  1O4X A;  4M3B A;  4C3I J;  4I6Z A;  3O8G A;  4D7N A;  1DU0 A;  2EH3 A;  2EQR A;  3SFI A;  1APL C;  3IH2 A;  3FIS A;  2XGC A;  2DMP A;  1MBG A;  1LFB A;  3JRC A;  4RBO A;  2FJ1 A;  1JJ6 C;  1GV2 A;  5F0H A;  1JKR C;  1ITY A;  1JTX A;  1S7E A;  4XRS A;  1K61 A;  1TWA J;  1H8A C;  1ETX A;  3UKG A;  3HOU J;  4IHV A;  3HKZ N;  5F04 A;  3JR9 A;  1T33 A;  2JJ7 A;  2OPT A;  4DYC A;  5F0F A;  4QTR A;  4MO7 A;  1JTY A;  1WGX A;  1YRN B;  4UUS A;  1ETY A;  1X58 A;  3Q0W A;  4M3F A;  3BR3 A;  5GPA A;  1Y1W J;  5M5X J;  2FX0 A;  3NAU A;  2ID3 A;  3M4O J;  3BG5 A;  3MN2 A;  2LLK A;  2EZH A;  5FKO A;  2L7M P;  4AC0 A;  3LSG A;  5IP9 J;  3GTJ J;  5GP9 A;  2O9L A;  2QF7 A;  2ID6 A;  3BTI A;  1WH5 A;  4AYB N;  1GUU A;  1HDD C;  9ANT A;  3I4M J;  5C4J J;  5FLV A;  3H0G J;  1RKW A;  2YS9 A;  4A3I J;  3NAR A;  3GTO J;  1MNM C;  1FTZ A;  5FJ8 J;  1UHS A;  4XRM A;  3PO3 J;  1GVD A;  2R93 J;  3WHC A;  4DZP A;  3OIO A;  5FKM A;  1OCT C;  3VPR A;  3DCF A;  3LNQ A;  4FCY A;  3GBG A;  2DA2 A;  2NVT J;  4S0H B;  5E3M A;  3FK6 A;  3LSP A;  2MSY A;  1UMQ A;  4MIM A;  3HB9 A;  3S1Q J;  1AKH B;  1WI3 A;  3HBL A;  1MBF A;  3HOY J;  1OCP A;  1P7J A;  1MSF C;  1BA5 A;  3K7A J;  1QPI A;  1TWH J;  2VKV A;  5IYB J;  1TWF J;  1A5J A;  2M9H A;  2CQQ A;  3OOU A;  1VI0 A;  1X2M A;  2DN0 A;  4JP0 A;  4A69 C;  1HDP A;  1IDY A;  2JWT A;  1JT6 A;  1SFO J;  4JX4 A;  2L9R A;  5J1Y A;  2GLO A;  3W6V A;  2DMQ A;  5JLX A;  1R9T J;  1TWG J;  4FIS A;  1XS9 A;  2H1K A;  5C44 J;  4ABZ A;  3PM1 A;  2IAI A;  3BTJ A;  1K83 J;  2EZI A;  2JN6 A;  3RQI A;  3JRB A;  1YRN A;  5IP7 J;  1ZR4 A;  5JLW A;  2PMZ N;  2Y30 A;  3ZQF A;  5BNG A;  1FTT A;  3Q0U A;  1NK2 P;  3L1P A;  3IH4 A;  2HOA A;  3TED A;  2H8R A;  2O7O A;  3S1M J;  2E19 A;  4D5C A;  3PO2 J;  1Z0X A;  3BTL A;  1MBJ A;  1QRY A;  2HDD A;  3RZO J;  4XK4 A;  2O8K A;  2B63 J;  4AUX A;  3HDD A;  1ORK A;  2IBD A;  4BKX A;  2FQ4 A;  2R0Q C;  1ETO A;  1ZKG A;  1QVT A;  4DZJ A;  2L0K A;  1ZTR A;  3JRF A;  4B3A A;  4BXX J;  3A01 A;  3S15 J;  4W97 A;  2LK2 A;  1I3Q J;  1WCM J;  5EF6 A;  1ETV A;  2EBI A;  3A02 A;  1IC8 A;  2TCT A;  4JX6 A;  3ZQC A;  3LOC A;  2E2H J;  2ECC A;  3F0C A;  4CYC B;  5EGO A;  4A3D J;  1XC5 A;  1ZR2 A;  1Q1V A; 
#chains in the Genus database with same CATH topology
 4ZDP A;  2JUG A;  5LLQ A;  3K1M A;  5DTD A;  1W36 C;  4EQQ A;  4YFK F;  4RB3 C;  5BMZ A;  1JUP A;  2IGM A;  2VJI A;  4WK8 F;  2BHY A;  3NQO A;  2E35 A;  3R4K A;  4C2U A;  4NDL A;  2DFH A;  1AU7 A;  4ZYE A;  3BR6 A;  1IDZ A;  5F27 A;  1UJ8 A;  3DKX A;  4JX5 A;  4ZDL A;  4DW6 A;  2ZCW A;  2YUS A;  2W85 A;  2LMD A;  1ETQ A;  1MDM B;  1BJZ A;  4FTH A;  2IS6 A;  2XAQ A;  1TNT A;  1T0F A;  3V7C A;  3DLL F;  3CTA A;  4OU0 A;  4HZF A;  4QIW N;  2K85 A;  3BC8 A;  2DA4 A;  1PUF B;  1N75 A;  3C2B A;  5B3S H;  3L2R A;  3A2K A;  2H6C A;  2G7U A;  2B9S A;  1F36 A;  4OIP F;  3MKL A;  3WU2 C;  2JA7 J;  3BR5 A;  2GZW A;  1SAN A;  3AL0 C;  2DT7 B;  1MBE A;  1XTA A;  2FU4 A;  3CCJ I;  1HCR A;  4II3 A;  5HS9 A;  1VQL I;  3ELK A;  1JJ8 C;  2KKO A;  2Q1Z B;  4KN7 X;  2CH0 A;  2QM3 A;  3EUK L;  3D5S C;  4ETS A;  2PJP A;  3I5U A;  1IRG A;  5E20 A;  4XOR A;  4YG2 F;  1OYW A;  3QQA A;  1V55 H;  4RGR A;  2NVY J;  2NVQ J;  2HOT A;  3EET A;  2JT1 A;  3K6G A;  4IVN A;  2IS4 A;  1CF7 B;  1T38 A;  1E3O C;  4D1Q A;  3BP8 A;  5FRN A;  4C30 A;  1U6G A;  2FSW A;  4RB0 A;  3E5X A;  3FMQ A;  1Z6T A;  5E17 F;  4BH9 A;  4C2M J;  2J5P A;  4M71 A;  1WPK A;  2G9W A;  1TZL A;  3CCY A;  5LD2 C;  1IV6 A;  2AHQ A;  2QSF X;  5J40 A;  3OSG A;  3BOQ A;  2ESH A;  3SFZ A;  1VQK I;  5GTH C;  1MNE A;  5ICG A;  1LDD A;  5ILU A;  1YJW I;  4BEH A;  1W0U A;  1H9T A;  4V2G A;  1YQA A;  2Y0S N;  2HTJ A;  3K0L A;  2XB5 A;  1LQ1 A;  4PJJ A;  2LC2 A;  3T8R A;  3FHZ A;  3CCQ I;  1GT0 C;  2HPM A;  1OR7 A;  1FOW A;  2XPV A;  2QCO A;  2LY1 A;  1I1G A;  2R7D A;  2H6B A;  2XPU A;  3G1O A;  1S7O A;  2CJJ A;  2R7Z J;  3AKZ A;  2NS7 A;  2FNA A;  2XHK A;  4L9J A;  4E7H A;  2H8W A;  3R60 A;  3C3W A;  3TOA A;  2MD0 A;  4A3J J;  1QGP A;  5HNF A;  1Y1V J;  2OF7 A;  3ZCO A;  1J7K A;  5JHU A;  3QPH A;  2A6E F;  1VND A;  2BOL A;  3TOB A;  1PJR A;  3CUQ B;  3EQL F;  2OJE D;  1UHM A;  3J80 K;  3OYC A;  4HQE A;  1IN7 A;  1IZ1 A;  2VQH A;  2BXY A;  2VBW A;  2DOE A;  3OR2 C;  4HLX A;  4PCQ A;  3GTP J;  1E0E A;  4A3L J;  2IA1 A;  1OCC H;  5IOY A;  4P9F A;  1X3Z B;  3BCB A;  2VKE A;  5FD6 A;  1BOA A;  1RET A;  2GQQ A;  1M1E B;  2CFX A;  4MTE A;  3G71 I;  1ZAO A;  1BI3 A;  3P5J A;  3ONQ A;  4QPO A;  1ZQ3 P;  3K4N A;  2XAH A;  1ERD A;  5D4S A;  3HRS A;  2QVO A;  3NWS A;  4FE4 A;  1IN4 A;  2X51 A;  3IV5 A;  4HX7 A;  4ESB A;  1AKH A;  2YU9 J;  5IYD J;  3I4N J;  5DYM A;  2VT2 A;  5HOO A;  1ZH5 A;  5TJJ A;  1OPC A;  2XIG A;  1VQ9 I;  2R5Z A;  4A3M J;  4BE2 A;  1MMA A;  2HZT A;  1TT5 B;  3M1E A;  1A6I A;  2FRH A;  2WC2 A;  3F9K A;  2ZXW H;  4HDU A;  1ZG5 A;  3ZQI A;  2L5Q A;  5HLG A;  1Z3X A;  4L5E A;  2EPF A;  3ECO A;  4BHP A;  1W0T A;  2CQK A;  4C3J J;  3D5L A;  2E60 A;  3GFM A;  3HGY A;  3G1L A;  3K4J A;  5BS6 A;  2XGE A;  3LFU A;  3HRT A;  2G7H A;  2F2E A;  2X1E A;  1W7P D;  4R1H A;  5JR3 A;  1ZGJ A;  3L00 A;  2YPR A;  5GTI C;  3WU0 A;  4UUV A;  1ACI A;  2F5C A;  1ZAR A;  2Y31 A;  3BR0 A;  2O8X A;  1U9O A;  1XG1 A;  2E71 A;  5J8F A;  1WJC A;  4KN4 X;  2W4S A;  3MVP A;  4RGS A;  1RPW A;  1SC7 A;  2VKH A;  2XRL A;  4Q4Z F;  1A6Q A;  1Y39 A;  2M3A A;  4IHS A;  4XOP A;  3FWE A;  5DCM A;  3AG2 H;  1GV5 A;  3E7L A;  1MMD A;  1S7A A;  2CQX A;  3K9T A;  5JVT A;  4XIC A;  4M3E A;  2MFZ A;  2VQG A;  4CHU A;  3TDU C;  4H4K C;  3O6B B;  2HDW A;  3A01 B;  5C3E J;  4ITV A;  1ETW A;  2ME6 A;  3OIP A;  2DAO A;  1G2H A;  3GTK J;  3KP5 A;  4NQW A;  2O03 A;  5TIS C;  1G3W A;  4KT5 C;  4U7D A;  1BI2 A;  3FM5 A;  3H9Q A;  2HKO A;  3TW6 A;  2HR3 A;  4LMY A;  1V5G A;  2HOS A;  4GDF A;  2JA8 J;  2B0L A;  2KQR A;  3GTL J;  4HNV A;  3MQ0 A;  4IPA A;  5F1R A;  3H3V K;  4U0V A;  2CQ7 A;  3ZN1 A;  3RZD J;  1WH7 A;  1X4O A;  4XOT A;  2OQR A;  2DJN A;  1D1B A;  1W5S A;  1U5T B;  3F8C A;  5KNL A;  2M8G X;  3S3N A;  3VFZ A;  2A3S A;  4CZZ A;  1JT0 A;  1D0X A;  1RI7 A;  1U9N A;  3GXO A;  4GGG A;  4WF2 A;  1FSH A;  4HSR A;  5E8G A;  3QOE A;  1MDM A;  1DP3 A;  1RKT A;  3JRA A;  1X1B A;  2XVC A;  3RYR A;  3CJR B;  1IAW A;  1WJ5 A;  4XMY A;  3FMR A;  1IRF A;  1IG7 A;  3L2V A;  4KA4 A;  5IP6 A;  4E7I A;  2LG4 A;  3V4G A;  2L3D A;  3JRI A;  1YS6 A;  2VPL A;  1H88 C;  3QPT A;  4UNO A;  1YO5 C;  1ZGW A;  2EZK A;  4OMZ A;  3OS1 A;  2VC0 A;  2DYR H;  2Z33 A;  1R6R A;  4UB6 C;  1XGM A;  5F64 A;  3F72 A;  4QWQ A;  3S2H J;  3D0S A;  3BJA A;  3K2A A;  3GYH X;  2JRT A;  4OIR F;  3SDB A;  4NC6 A;  2HI3 A;  2K02 A;  1B72 A;  1SD5 A;  1Z7U A;  3EUH C;  1IJW C;  1Y0U A;  3JRG A;  5HS8 A;  2NXN B;  3BZC A;  4QSH A;  3BG9 A;  2LP0 A;  2Z16 A;  2IPQ X;  1CF7 A;  1HBX G;  4ANJ A;  2KZG A;  4A0Z A;  5E3O A;  3CCE I;  4M3B A;  4XBF A;  4UXN A;  4IX7 A;  2M4K A;  3ISP A;  3O2P E;  2IRF G;  2EIN H;  4CYD A;  3FXK A;  2F4I A;  1FY7 A;  1EH6 A;  1OCO H;  2EQR A;  2Y0M A;  3IRQ A;  1B59 A;  1O57 A;  1Z9C A;  1J5Y A;  3IH2 A;  3LA3 A;  3ESW B;  3ERE D;  1APL C;  4EJV A;  1FMW A;  1MBG A;  2GA1 A;  2FJ1 A;  5CVR A;  3WG9 A;  3F23 A;  3CUO A;  1JTX A;  3CES A;  3F6V A;  4ESJ A;  1ETX A;  3HOU J;  3HKZ N;  3K10 A;  3M8E A;  4JBA A;  2QWW A;  1MND A;  1T33 A;  4IOC F;  1R49 A;  4DYC A;  5F0F A;  4MO7 A;  2HVR A;  1XGO A;  5E1Z B;  3H5R A;  5LGT A;  1WGX A;  3TQN A;  1YRN B;  2WAF A;  2R7U A;  1X58 A;  3Q0W A;  1LPQ A;  2L4M A;  3UNG C;  4N9I A;  2P5L C;  3KE2 A;  5J8C A;  1MKM A;  2STT A;  3K4M A;  2KFD A;  3BY6 A;  2NNN A;  5HDG A;  2L7M P;  3CZ6 A;  2DT5 A;  3LSG A;  3CO6 C;  3CC7 I;  4YEJ A;  2MBF A;  2OCC H;  1T8I A;  2HQN A;  1WH5 A;  4LLG F;  4AYB N;  5CQG A;  2WAD A;  2CUJ A;  2OTJ I;  2Y0S A;  1OYI A;  2NOJ B;  3NAR A;  1FLI A;  3V8J A;  3H1C A;  2VOD A;  1IN8 A;  3GEZ A;  3L09 A;  5FJ8 J;  1IXC A;  3CJN A;  4YII A;  2HGC A;  4DZP A;  2D45 A;  1YYV A;  5FKM A;  4ENN A;  5L3F A;  3ZP5 A;  1MJA A;  5FB2 A;  1P9Q C;  3JAM K;  5IT9 Z;  2XDV A;  2DA2 A;  4XON A;  2NVT J;  4Q5S F;  3FK6 A;  1XDS A;  3LSP A;  2OTL I;  2VOO A;  4RLF A;  4HX8 A;  1WJD A;  1FMV A;  3HB9 A;  3PSF A;  3S1Q J;  2V6C A;  2V26 A;  5B66 C;  5ILV A;  2BY2 A;  4O5V A;  3HL2 A;  4RGU A;  4E7K A;  2M1B A;  3JCU C;  1T98 A;  3F8F A;  1MSF C;  4P5O A;  3K7A J;  1TWH J;  1TQP A;  2VKV A;  4I02 A;  4RAG A;  4RB2 C;  2FBH A;  3VOD A;  4ENM A;  2M9H A;  3OOU A;  4JP0 A;  2IJL A;  2O3F A;  3HXL A;  1UST A;  2V1X A;  1SFO J;  1R7J A;  4JX4 A;  3OL3 A;  2L9R A;  2DBB A;  3S93 A;  2GLO A;  5JLX A;  1G3S A;  2A6H F;  4FIS A;  3EYI A;  2H1L A;  1R5I D;  1RUO A;  3OYJ A;  1GXQ A;  3FF5 A;  2HS5 A;  2ICW G;  3ROU A;  4M6X A;  3RQI A;  3RPQ A;  5ERI A;  2Y30 A;  2XUB A;  2VBX A;  3OYG A;  1P4W A;  5BNG A;  3OL4 A;  2XF6 A;  1X19 A;  5H2F C;  3UR3 C;  2V6E A;  2XC7 A;  1FTT A;  3IRR A;  1NK2 P;  2IT0 A;  2YR2 A;  3IH4 A;  2XAJ A;  2KDO A;  4Y33 A;  4AIK A;  2E19 A;  1HW5 A;  4GO1 A;  2IS1 A;  3HSR A;  3FBI B;  5KAF C;  3RZO J;  2DDB A;  2DT6 A;  1IXR C;  4AUX A;  2F5V A;  1Z67 A;  4I0A A;  2FQ4 A;  2R0Q C;  3M1C A;  5E79 C;  1XSX A;  3LST A;  2ISZ A;  1QHH D;  2P8T A;  4P96 A;  3A01 A;  2DTR A;  3I0T A;  2IGK A;  1I3Q J;  5EF6 A;  1ETV A;  2KMU A;  5DUI A;  4KIG A;  4HDV A;  1YJN I;  1B6A A;  1R71 A;  2M4G A;  2HFH A;  4A5N A;  3TO7 A;  1P92 A;  3W3C A;  1YIJ I;  3ABU A;  2W24 A;  2ECC A;  3FHN A;  2UUZ A;  2GIV A;  1R00 A;  1ZR2 A;  1D1A A;  4BEH B;  4F7Z A;  3BTC A;  2YU3 A;  5F08 A;  1TQI A;  3BT9 A;  4Z6Y A;  3GTM J;  5KHD A;  2JK3 A;  1W1W E;  2JMW A;  3CO7 C;  4GCV A;  1FIA A;  3J81 Z;  1OLT A;  4RA2 A;  1QZY A;  2CU7 A;  3HZJ A;  5K5Q A;  3H5N A;  2EZL A;  4UUT A;  4R79 A;  1PVE A;  2MH2 A;  2DQL A;  5A2Q K;  4L18 B;  2BBY A;  1AHD P;  5FLX K;  3HG9 A;  2Q8K A;  4YRV A;  3DEW A;  3RI4 A;  1RRJ A;  4FT8 A;  2C6Y A;  2G0E A;  2NS8 A;  2ZJR F;  4EM0 B;  1X1P A;  1KQ9 A;  3LFK A;  2LFB A;  4DQ2 A;  3GZ5 A;  1E3H A;  1BBY A;  2AXL A;  4BY7 J;  3OS2 A;  3LAJ A;  2QGU A;  1OJL A;  3SDG A;  4FE7 A;  1YHQ I;  4MQV A;  2I8D A;  2HQ5 A;  4E4H A;  1J0R A;  4CIC A;  2LRD A;  4XKB A;  2P81 A;  2KIS A;  2IP2 A;  3M8F A;  2GA2 A;  2L4A A;  1O3R A;  3FXQ A;  3MMY B;  4NC8 A;  2P5V A;  2NVU B;  2OU2 A;  1VF9 A;  1EKE A;  4Y15 A;  1ZYR F;  1ZRC A;  5DD8 A;  2HVS A;  1Y6I A;  4M9Z A;  1N25 A;  3KZZ A;  4A3F J;  3CF2 A;  3PIP F;  3IH3 A;  3VOE A;  4CSW A;  1IUY A;  3CC4 I;  3BG7 A;  2M7A A;  1T95 A;  3EDP A;  3G1M A;  3SXY A;  4HW0 A;  3W2W A;  3CCL I;  2R7T A;  4EGZ A;  5FKL A;  1FOK A;  2R5Z B;  3ASN H;  3C18 A;  5CKT A;  4Y3O A;  3AL0 B;  4RAY A;  3CLO A;  1R1V A;  3JRD A;  1H0M A;  2JA2 A;  2V7F A;  3GME A;  1XCV A;  4D5F A;  3RSN A;  1MW7 A;  2R7O A;  4IHW A;  3K4C A;  1S3J A;  2FOK A;  1R5H A;  3DEU A;  5K7H A;  1Z7L A;  4M6V A;  1FT9 A;  3CMY A;  2RV8 A;  4FX4 A;  5GPC A;  3PQJ A;  1P7I A;  4AD9 A;  4MEX F;  1FOX A;  3J80 Z;  4BYY A;  1GVJ A;  1UHW A;  1LVK A;  5E18 F;  5GAG J;  2HYF A;  3K69 A;  3L2Q A;  4PK4 A;  3WHB A;  4BQA A;  2B7E A;  2E2I J;  3MAJ A;  1FOY A;  4W1U A;  3SEZ A;  1FX7 A;  1HKS A;  3COA C;  4D0P A;  2QQ8 A;  5DCM B;  2LDU A;  4MFD A;  1N78 A;  4BAC A;  1MBH A;  3K1N A;  2Y75 A;  2WB1 N;  4HBL A;  5LRR A;  3DFG A;  2OAZ A;  4RM3 A;  5FFX A;  3SEQ A;  2R92 J;  2KZV A;  1ON1 A;  3Q0V A;  1LE8 A;  3GLX A;  3HKZ A;  4L5I A;  4YIR X;  2TRT A;  1SVL A;  1SD4 A;  1WFX A;  3BR2 A;  3S8P A;  4NQW B;  4I76 A;  3RCO A;  3KCC A;  5EEH A;  1JGG A;  4FX0 A;  3BWG A;  1HOM A;  2I10 A;  3WGH A;  1TWC J;  2ISY A;  3OYE A;  1UFM A;  1BR1 A;  4CUG A;  3Q5F A;  3PQK A;  2V1U A;  1SVO A;  2W84 A;  1RZ4 A;  5DS9 A;  2WBM A;  4GRI A;  3MEX A;  2IGO A;  4AYB A;  3U1D A;  1UEL B;  2BVL A;  1R5G A;  2DQR A;  2HPI A;  1EA3 A;  4CGZ A;  3KFW X;  1K6Y A;  4CCN A;  4CXF A;  2L7F P;  3HRM A;  4XLN F;  1X1A A;  1SVM A;  2AQE A;  2CW8 A;  4G6Q A;  2QLZ A;  1ZLJ A;  4IEJ A;  4L9V A;  2OBP A;  3I3L A;  3S1R J;  4N4O B;  1OIS A;  3HYI A;  3CF5 F;  1A36 A;  4KIC A;  2V9P A;  2AO9 A;  1U3E M;  4V19 K;  4AID A;  4EAT A;  3C1D A;  2UZK A;  3HOT A;  3NEU A;  4BJ6 C;  2L9N A;  2DMN A;  3H36 A;  4J19 A;  2STW A;  3IC7 A;  1JKP C;  2QZ8 A;  2FF4 A;  1EH8 A;  1WJA A;  2MW8 A;  4XM3 A;  1WRJ A;  4A3G J;  2CUZ A;  3TMO A;  4Y4R A;  2PLY A;  2DDA A;  2DA7 A;  1Y8R B;  2VI6 A;  2ZFW A;  2PI0 A;  4XSZ F;  5CVI A;  5AIQ A;  2VUM J;  3W6J B;  3F3X A;  3OYF A;  1B72 B;  1B1B A;  1FWZ A;  2DFE A;  1OCZ H;  4QPQ A;  5EDN A;  1IN5 A;  5IPA A;  2JRM A;  1BIA A;  4XID A;  3DPU A;  3CQZ J;  3ZQL A;  3HIF A;  4P9U A;  4I99 C;  3OV8 A;  1XGS A;  2A69 F;  1V5F A;  4EM2 A;  3K1P A;  2ZC2 A;  2XKO A;  2VBZ A;  2CRG A;  3GWZ A;  1WJE A;  2CUF A;  4XQF A;  1R1T A;  4B43 A;  1OMI A;  1K4T A;  3DF8 A;  4CZC A;  3U9G A;  4PFP A;  2XAF A;  4HF0 A;  4CCL A;  3E5U A;  1F4K A;  2VJ5 A;  1FP2 A;  2PMH A;  3WTX C;  1KGS A;  3RKY A;  2K9S A;  5M3M J;  1FBS A;  4E6K G;  1J09 A;  1Z05 A;  2X48 A;  2DJI A;  1A31 A;  1I6X A;  4B8X A;  3HOZ J;  6PAX A;  2K9N A;  1KYW A;  1ZK8 A;  2Y9Z A;  2XGD A;  3V8K A;  1Z91 A;  2HQR A;  2XB0 X;  4TV7 A;  4IF4 A;  1XN7 A;  4UV8 A;  1ZLK A;  3RKX A;  2A61 A;  4XRS G;  1JKQ C;  1KU2 A;  2VJ4 A;  1XGN A;  1LB2 A;  3OYH A;  1B8I A;  1ZRF A;  1VQ8 I;  2EFP A;  4U88 A;  5K7F A;  2ACJ A;  1UAA A;  4BY1 J;  2P5K A;  3K70 C;  4PDK A;  2RDP A;  2NVX J;  1R36 A;  3C7J A;  1X4P A;  3NWT A;  1BW5 A;  2QUF A;  4IHX A;  4A93 J;  3KYL A;  1HLV A;  1HF0 A;  3OYN A;  2VB6 A;  1IGN A;  3I64 A;  3ZOB A;  2FEZ A;  3O8H A;  1D5Y A;  2A5Y B;  2R7F A;  2Z5U A;  3WOD F;  4ZYH A;  4CCJ A;  2W82 A;  3ZQ7 A;  1FJL A;  2K3F A;  3GVA A;  5DD4 A;  2OC6 A;  2D2W A;  2IEK A;  4IHY A;  3M9A A;  3H9G A;  3DLA A;  2FQ3 A;  1G8X A;  4EJO A;  4ENK A;  2BV6 A;  2L9S A;  2X6Y A;  4XRF A;  3CCM I;  2CQN A;  5D5U B;  3HOS A;  1RR8 C;  1LFB A;  3TBI A;  4P55 A;  1ODD A;  4BQO A;  5F0H A;  1E3P A;  1LEA A;  2V9K A;  2UXN A;  2H09 A;  1S7E A;  2BW3 A;  2QQB A;  3UKG A;  3CP2 A;  2V79 A;  3BCA A;  3E97 A;  3HRU A;  2KJC A;  3DV8 A;  5F04 A;  3VYS B;  4PJN A;  2OPT A;  5D5W B;  2X4H A;  4OAZ A;  3N05 A;  3FXJ A;  1JTY A;  4DBR A;  4BXU A;  2EJR A;  3WE3 A;  3MD2 A;  2O0Y A;  4M3F A;  5D8K B;  5D5V B;  3R61 A;  1Y1W J;  1DQU A;  2QA4 I;  2FX0 A;  4D9J A;  1R23 A;  5LFA A;  2ID3 A;  1MZB A;  1SEU A;  2EFQ A;  3ZMZ A;  3FXM A;  5FKO A;  2KL4 A;  4FET A;  3JAM Z;  2BZT A;  3N4M A;  3S32 A;  1Y0N A;  3PFY A;  3GTJ J;  4U7B A;  3KP7 A;  3I59 B;  1GUU A;  3HHG A;  3ZGK A;  4ENJ A;  2YX4 A;  5EJC A;  3LSM A;  5FLV A;  1YW8 A;  1RKW A;  1RC9 A;  3MZ8 A;  1R22 A;  4XLC A;  4OIN F;  2EA2 A;  5IY5 H;  5E8I A;  1E17 A;  1DGW Y;  4O6J A;  4XL9 A;  4I09 A;  2DW4 A;  3I56 I;  2R93 J;  4CCO A;  4LG0 A;  3OIO A;  4MNU A;  3OYD A;  4O3M A;  3X2Q H;  3K4K A;  3ZMD A;  3IWZ A;  3I53 A;  3OMY A;  3K4L A;  5ICF A;  3ULQ B;  1ZG3 A;  5E3M A;  2YSR A;  2MSY A;  2CG4 A;  4LJZ F;  4MIM A;  4YFN F;  4PFO A;  2QSG X;  1DGR M;  2K4B A;  3HBL A;  2ZXH A;  3H35 A;  1FC3 A;  3LSK A;  2DYS H;  2WB1 A;  2LH9 A;  5IYB J;  1TWF J;  4LIV A;  3PUF A;  1O3T A;  1UB9 A;  3ZPL A;  4NC7 A;  1DDN A;  2EK5 A;  1IDY A;  4U0Y A;  3KX2 A;  3VB2 A;  3OYK A;  2W7N A;  1XMK A;  1HA8 A;  1JT6 A;  2KLO A;  3PJR A;  3WTT C;  1BC8 C;  3LL7 A;  1D0Z A;  1STZ A;  1XS9 A;  1BC7 C;  2H1K A;  4UY8 I;  5C44 J;  2E1M B;  2BE5 F;  2ZME C;  3AAF A;  4YFX F;  3PM1 A;  4B47 A;  2JN6 A;  3A1Y A;  3KEQ A;  5KVR A;  5JLW A;  2OUM A;  1KQ8 A;  1P4A A;  1YIT I;  1WI9 A;  3ZQF A;  3R6S A;  3REO A;  3KZI C;  2CWE A;  2RQQ A;  4Z2Y A;  2VE9 A;  1S72 I;  4HRI A;  2KP6 A;  4M6Y A;  4DNC A;  3ECH A;  5E1W A;  2O7O A;  3ZQQ A;  4I98 B;  1WHU A;  3MKW B;  1Z0X A;  1L0O C;  1MBJ A;  1QRY A;  4LD5 A;  2K4J A;  1V3F A;  4XLA A;  2O8K A;  2B63 J;  3HDD A;  2IBD A;  2KIM A;  2EV5 A;  3WTS C;  1S6L A;  2JZY A;  1QNT A;  1ONV A;  1ETO A;  4KIB A;  1YLF A;  5KK1 A;  4DZJ A;  3H9J A;  2IVM A;  2KRC A;  3JRF A;  1KON A;  3KYD B;  2WV0 A;  4W97 A;  3WE2 A;  1WCM J;  2VIX A;  1B9M A;  3E6M A;  2EBI A;  3OIQ A;  1ZRE A;  2TCT A;  5FLX Z;  1QZZ A;  4JX6 A;  5FD5 A;  1PP7 U;  2EV0 A;  3ZQC A;  2BGC A;  3F0C A;  5HDN A;  2HNH A;  3ZN0 A;  2QBY A;  4PSW A;  3S3M A;  3IAS 2;  3LSH A;  1Q1V A;  3S1M J;  3E6D A;  3Q9S A;  2E36 A;  2XF7 A;  2E1O A;  4IQ4 A;  4ZH4 F;  2N8G A;  4HNT A;  4A12 A;  1AWC A;  2VOP A;  2L01 A;  2VQC A;  1BM9 A;  5M5Y J;  2LBF A;  3DKW A;  5D6E A;  3GFI A;  2DPD A;  2L02 A;  1KZH A;  5H20 A;  2EWN A;  4NBQ A;  2EA4 A;  3QPL A;  1HXD A;  4M73 A;  1VZ0 A;  1D8K A;  5LGU A;  5HNH A;  1Y8Q B;  4LLN A;  3FM3 A;  2VON A;  3ABL H;  1O7F A;  3S14 J;  4F55 A;  2KT0 A;  2VKD A;  2BHZ A;  3WTU C;  2E2J J;  2V1N A;  3CMM A;  3LWF A;  2MG4 A;  3S2D J;  3CDH A;  3GZ6 A;  2VE8 A;  3JTH A;  4XLF A;  5EZH A;  3E0J B;  1LE8 B;  4MFE A;  2ELK A;  2M34 A;  2WAQ N;  2Y9Y A;  3J7A Y;  1BIB A;  2W00 A;  3C2H A;  3B02 A;  4X0G A;  3SJM A;  2AS5 F;  2JPB A;  1T2K A;  3S17 J;  2HOE A;  4L5J A;  2KPM A;  3D1N I;  3PFI A;  2P0W A;  4IKF A;  1FYK A;  1H89 C;  2X6O A;  1WWX A;  1D3Y A;  3QPS A;  4PJL A;  1W36 D;  3PL8 A;  4WX9 A;  1U5T C;  4F93 B;  4BQQ A;  4Y13 A;  2ZFU A;  2XAG A;  2EFW A;  5CPR B;  3OYA A;  1FIP A;  4EEF G;  3JRH A;  5HVQ C;  2PMZ A;  3ML6 A;  1QBJ A;  5DM6 F;  2F4M B;  2WY7 Q;  3GLL A;  2CV2 A;  2KRF A;  1TC3 C;  5J3L A;  2ESN A;  3KP2 A;  1YFH A;  3VYT B;  4ZYG A;  3V7S A;  4HAM A;  2ZJP F;  2JPC A;  3EUH A;  5TRD A;  2RNJ A;  5CLS A;  1DUX C;  1MIJ A;  2DI3 A;  1K7A A;  3S3O A;  4OWR B;  1TW2 A;  2WY8 Q;  3G3Z A;  5J4Y A;  3TP3 A;  5HLI A;  4UUS B;  3GX4 X;  4J00 A;  3V8L A;  2LD5 A;  5M3F J;  1HW1 A;  4A6E A;  2CW7 A;  4WXC A;  2A68 F;  4M72 A;  2FE3 A;  4XN0 A;  2HQA A;  5FO5 A;  4HNU A;  2K9L A;  3IAM 2;  2ZBK A;  3ZMV A;  1SD7 A;  4HST A;  1XCB A;  2A07 F;  2RKH A;  4LIU A;  2VJJ A;  4ZZD A;  4JOM A;  2XKP A;  3G4S I;  2X85 A;  1YG2 A;  2DU9 A;  3CJT B;  4HG2 A;  3SZP A;  3AG4 H;  3I59 A;  3W6K B;  4IRH A;  5DCF A;  1SAX A;  2HDC A;  4EVI A;  3HOV J;  4EJU A;  5LEJ A;  2DO7 A;  4BE0 A;  2K9Q A;  2ELJ A;  1MH3 A;  2RN7 A;  3WGI A;  1WQ2 A;  2MD5 A;  1OFC X;  4YIF A;  5J4V A;  3DBL B;  1BR4 A;  4HLY A;  2CGP A;  4RLQ A;  3I58 A;  3E3V A;  2Z9O A;  2LR8 A;  3QP6 A;  4G6D A;  2PQ8 A;  4UVB A;  3TO6 A;  2X0L A;  5H6Q A;  1GXP A;  1DPU A;  4KMF A;  4HV5 A;  1WZ2 A;  3RJP A;  1BI1 A;  3NRV A;  4S05 A;  3SYT A;  1KQ0 A;  1X2N A;  4MHG A;  3FK7 A;  1F43 A;  3KEO A;  2ELH A;  2ZNY A;  1A04 A;  2PX9 A;  3FMS A;  4XLH A;  1LKX A;  2XPW A;  1OKR A;  3RTR A;  2FXA A;  2PFB A;  3DPL C;  2KDZ A;  3DU5 A;  2JTV A;  1JKO C;  2K3P A;  2GXG A;  4F91 B;  3MFK A;  2DCE A;  4ASN A;  4M9S A;  2BY3 A;  3T8T A;  1VQ5 I;  4A0X A;  4II2 A;  2O5R A;  1VTN C;  2DK5 A;  3BPV A;  4A6D A;  3J7Z I;  4AVZ A;  3QP5 A;  1FEX A;  3FKI J;  1YI2 I;  2W1O A;  2Y2Z A;  1B8I B;  2L2O A;  3HPG A;  1GDT A;  3CDL A;  4KIS A;  4ZZL A;  2YX7 A;  1SMY F;  2EV6 A;  3M07 A;  1Q1H A;  3DU6 A;  1E2X A;  1IXS B;  2ECB A;  4RM2 A;  2KIQ A;  3BZK A;  1WJB A;  3OS0 A;  4AWX B;  5HS7 A;  4HPQ A;  3MZY A;  4MGR A;  4I0B A;  2R7S A;  1KU3 A;  4M3D A;  3JW4 A;  4HA8 A;  2E1N A;  3E5Q A;  2GBY A;  3ZQH A;  4IQJ A;  2F48 A;  1BI0 A;  1I27 A;  2ZNZ A;  3OOP A;  3QU3 A;  4LB6 B;  1MMN A;  2UXX A;  3ABT A;  3SQN A;  2VBY A;  5LBQ A;  3BPX A;  2DA6 A;  5ICC A;  2ZB9 A;  1I6H J;  1I50 J;  2WV1 A;  3ZMS A;  5DDG A;  4LOC A;  3CME I;  3HJE A;  3B6A A;  4KFC A;  1QZE A;  1G6N A;  3ABM H;  3KET A;  4AIH A;  2W48 A;  4B1R A;  1Z1D A;  2OCE A;  3HSE A;  4MQ9 F;  5B1B H;  3IHU A;  2MAB A;  2MGQ A;  2ZSI B;  1R1U A;  4KIT B;  3LA2 A;  1X3W B;  4MEY F;  1ON2 A;  2DK8 A;  2QQA A;  3WTZ A;  1P6R A;  5EGO B;  1SMT A;  2QEX I;  4EJW A;  2OD5 A;  1W4M A;  3DTI A;  2DTZ A;  4HOB A;  1B4A A;  2JSC A;  2BW3 B;  2R5Y A;  4L0Z B;  5GAD J;  3GTG J;  4R8H A;  5EG0 B;  2VLA A;  5EZG A;  1YIO A;  3OSF A;  2QKM B;  4F52 A;  3QYE A;  4L9T A;  1U8B A;  1HKT A;  1F1Z A;  3CCR I;  2R7X A;  4A3K J;  3I71 A;  4LIT A;  3Q3S A;  1D8J A;  2BEO A;  2BVM A;  3S2W A;  4XKV A;  2ZO4 A;  1XB4 A;  3QYF A;  5IT9 K;  3B73 A;  3K2Z A;  2HYJ A;  3U2R A;  4UV9 A;  3J7Y J;  3ZMU A;  2HXI A;  2DLL A;  2RC4 A;  3CP8 A;  4ESF A;  2VPR A;  3S1N J;  1TBX A;  3A0B C;  3VSL A;  4MTD A;  4BNC A;  3CMA I;  2CSO A;  3ZRG A;  2A6T A;  2IA2 A;  2AXT C;  1O3Q A;  2PJR B;  2QSH X;  1FBQ A;  1TT0 A;  4N9H A;  2DOF A;  4RAZ A;  3PNV A;  4QLC U;  1NTC A;  5CYV A;  2VL8 A;  2GAU A;  3MKZ A;  1R58 A;  4A5M A;  3CD6 I;  1V4R A;  3SZG A;  4U0W A;  2HWV A;  1ZG1 A;  2EFN A;  2DPU A;  2JVH A;  1J59 A;  2X6W A;  2Z99 A;  1TP4 A;  4PGG A;  4LG0 B;  4HF1 A;  1OCR H;  3QOP A;  3GW2 A;  4EMS A;  1HST A;  1YOV B;  3GUD A;  3H5A A;  2QYO A;  3L2C A;  4D7M A;  2FOW A;  3AG1 H;  1MBK A;  1RR7 A;  1OR7 C;  5AIP A;  4AU7 A;  4BU2 A;  2DMT A;  3HM5 A;  3V42 A;  3W2A A;  3F8M A;  1O4X A;  5DM7 F;  2E7W A;  4C3I J;  4RAF A;  3EYY A;  3O8G A;  4D7N A;  2P7C B;  2EH3 A;  2WTE A;  3F22 A;  3FZV A;  1PP8 F;  1VQ6 I;  2XGC A;  2VQL A;  3JRC A;  2WAQ A;  1O3S A;  2FA5 A;  4XNF A;  1K61 A;  1FYL A;  2H27 A;  3RPU A;  1K78 A;  2MA3 A;  1UCR A;  4A2U A;  2LNB A;  3CDI A;  3P9K A;  3OYI A;  4IHV A;  2LRE A;  2Y69 H;  1VQ4 I;  3JR9 A;  3KEY A;  2JJ7 A;  4ON0 A;  4DOZ A;  3H3U A;  4UHT A;  4I7H A;  4QTR A;  1YW7 A;  3KPH A;  3DQV C;  4CA0 A;  3R0A A;  2WWY A;  1PUE E;  4UUS A;  3JSO A;  2EIJ H;  1BN5 A;  1ETY A;  3BR3 A;  2JUC A;  5BOX A;  1RIO H;  3HC7 A;  2WAE A;  4B48 A;  5M5X J;  3CCV I;  2GXA A;  5ILS A;  2VT3 A;  3NAU A;  4OMY A;  3M4O J;  3BG5 A;  1LVA A;  3MN2 A;  4IL6 C;  2LLK A;  1YS7 A;  1JHF A;  3LAP A;  4AC0 A;  5BPI A;  2L9V A;  1D0Y A;  4NUB A;  3J81 K;  2O9L A;  3BG6 A;  2QF7 A;  4KMU X;  4OIO F;  4AIJ A;  3BTI A;  2X6X A;  5DEQ A;  4NB5 A;  1HDD C;  9ANT A;  5FRO A;  3I4M J;  1AOY A;  3OY9 A;  2Q0O A;  5C4J J;  2IGN A;  3H0G J;  4ZJZ A;  3L2U A;  3GO5 A;  4A3I J;  4GYG A;  1FZP B;  1ZEL A;  3H3Z A;  3C2G A;  4IZZ A;  4EGY A;  1S8N A;  1D5V A;  1GVD A;  2DFF A;  5K5R A;  4FAS D;  1OCT C;  2RGV A;  3VPR A;  2OZ6 A;  4Y17 A;  1YE9 A;  3LNQ A;  1W5T A;  4FCY A;  2QBY B;  2LKS A;  3T1B A;  3OYB A;  3VDX A;  2EIM H;  3LA7 A;  2KRH A;  1TL8 A;  2AQF A;  1UMQ A;  4LK1 F;  3GFL A;  2LSO A;  1NG6 A;  1RNL A;  2J5O A;  1WI3 A;  2XAU A;  2VAS A;  3IWF A;  1MBF A;  2LBF B;  1QPI A;  1C0W A;  3QOD A;  1YW9 A;  2E7X A;  2MH9 A;  1JE8 A;  5BPD A;  2CQQ A;  1VI0 A;  4A69 C;  3GZN B;  5LHI A;  5F6F A;  3QWL A;  4CH7 A;  5BQT A;  5FFZ A;  2NYX A;  2JVG A;  1TWG J;  4UB8 C;  1L3L A;  3DEE A;  5E1X A;  4PZJ A;  4ABZ A;  2M5W A;  3DWL E;  3TL4 X;  2OA4 A;  4OOI A;  1NH3 A;  3HTS B;  5IP7 J;  2PMZ N;  2DOD A;  3FXR A;  4XKC A;  4G7O F;  2P6S A;  1CGP A;  2V9V A;  1IN6 A;  1ZN2 A;  2LF7 A;  3Q0U A;  2CFO A;  1LDK B;  2HOA A;  4HX4 A;  2H8R A;  3DKY A;  4OIQ F;  4CDG A;  1G4D A;  3PO2 J;  3BTL A;  2F5D A;  5DV5 A;  4IRI A;  2HDD A;  4XK4 A;  5FGM A;  4G7Z F;  1V54 H;  2PN6 A;  4L0Y B;  4XLE A;  4AVP A;  2ZME B;  1LUJ B;  4B3A A;  4BXX J;  5FRM A;  4WWC A;  2HYG D;  4LFU A;  2RRE A;  2X1C A;  1SFX A;  4LLL A;  3A02 A;  3FBN B;  2RQP A;  2F5E A;  3OYM A;  1HW2 A;  5LHH A;  2E2H J;  4A3D J;  2M0M A;  4PGH A;  5EGO A;  2E5N A;  2O61 A;  2NAZ A;  1OYY A;  1R4N B;  1XC5 A;  3DTE A;  5K1Y A;  4E7L A;  3J7A O;  3KP3 A;  4E7J A;  2HXO A;  3BLY A;  3WTW C;  3RIR A;  1YX3 A;  2GOM A;  4CO8 A;  2M87 A;  5EG0 A;  2FD5 A;  2COB A;  3A03 A;  3BG3 A;  1KU7 A;  1NK3 P;  2CV0 A;  2IS2 A;  1G3T A;  1JUM A;  3VWB A;  3HHH A;  1CQT A;  5L3B A;  3VYR B;  1ZHF A;  2LOO A;  5JFR A;  1I3A A;  3BRO A;  1VQP I;  1RUN A;  4BBS J;  3GFJ A;  2XRO A;  1FYM A;  4V2F A;  3LSR A;  1OQY A;  1POG A;  4M74 A;  3ASO H;  3BDD A;  2R7V A;  4G8X A;  1QPM A;  2M0C A;  2NS0 A;  2ME0 A;  3ZQG A;  2PJR A;  1S5L C;  4OAY A;  3PUB A;  3U1K A;  1TW3 A;  3OR1 C;  2JA5 J;  1R4M B;  2E1C A;  2GWR A;  4BDY A;  5CJ9 A;  4I2O A;  3HTU A;  2HTS A;  2GXB A;  3HGG A;  1VQM I;  2ZXJ A;  4S04 A;  2IW5 A;  1VQ7 I;  1HC8 A;  1QQI A;  1F5T A;  4CCK A;  3TP0 A;  2CMP A;  3DBR B;  4C2T A;  2K5C A;  5JVG F;  1ZGA A;  2P7V B;  2QQ9 A;  3KP4 A;  1S29 A;  2KIF A;  1G59 A;  2HZD A;  2L54 A;  4AM3 A;  3RDI A;  1IV8 A;  2O6G E;  1UG0 A;  2R3S A;  5F1J A;  1J9I A;  2Q2E A;  3MCZ A;  5DUK A;  3T0Y A;  4H0E A;  2DMU A;  1PDN C;  1ETK A;  3ZMT A;  2A5W A;  3F21 A;  4PSX A;  3HUG B;  4BS9 A;  3BQY A;  2PG4 A;  4PUS A;  3G6E I;  1SFK A;  1XD7 A;  4BQN A;  1MJ9 A;  1Z21 A;  1U2W A;  2D1V A;  2K40 A;  2VC1 A;  5JI6 A;  2CW0 F;  5L3D A;  5J6X A;  3LSJ A;  4LGW A;  4KYW A;  2UV1 A;  4DBQ A;  3RYP A;  1MH4 A;  4CYC A;  5FKK A;  1V5E A;  3EPZ A;  2HEO A;  2ZJQ F;  3A4C A;  1TTY A;  3I54 A;  4GYI A;  1X1C A;  1QHG A;  4GXO A;  1XMX A;  2H94 A;  1SFU A;  2OV7 A;  2CV1 A;  3EUA A;  3CUQ C;  5K5O A;  2IXS A;  3PNY A;  4Q47 A;  5K7Z A;  2LTP A;  3PNT A;  3MKY B;  3CLQ A;  5EEA A;  2LKX A;  1REP C;  4BJT A;  1K79 A;  4A3E J;  2DA5 A;  5M5W J;  4G12 A;  1QVU A;  2D5V A;  2F5F A;  3N97 A;  4NNJ A;  4DIQ A;  4C9Y A;  3HEF A;  3HOW J;  2VXD A;  4BHB A;  2COM A;  2EB7 A;  2W57 A;  1HKQ A;  4A3C J;  4EM1 A;  4LK0 F;  3P9I A;  5L3E A;  2OZU A;  4Y7N J;  4HV6 A;  2LYC A;  2DFI A;  1J2X A;  2MLK A;  3HOX J;  3FKJ A;  3Q9V A;  1PUF A;  3RKQ A;  3RPU D;  1B9N A;  2X9D A;  5FLM J;  2D1H A;  2LVS A;  3I9V 2;  1Z3Y A;  1IF1 A;  4RMN A;  1EH7 A;  3DXJ F;  2R4G A;  1JHH A;  1D1C A;  3LQR A;  5A2Q Z;  3KIO A;  3QAH A;  2LY9 A;  4JQF A;  5GAH J;  4LB5 A;  1XMA A;  3QU6 A;  1UG2 A;  2IA0 A;  1ULY A;  3PSI A;  1U78 A;  1Z77 A;  2FMY A;  4G94 A;  3ABK H;  1MSE C;  3BR1 A;  5AON A;  3KP6 A;  1BOB A;  1MMG A;  2R5Y B;  1W7P B;  5J1R A;  5LGN A;  2EIK H;  3L7W A;  5CVJ A;  3O3K A;  2RVC A;  5LRS A;  1XPX A;  5HDK A;  2M8E A;  2KJB A;  4KJZ A;  2BYV E;  4ZYA A;  4IHT A;  2L7Z A;  3OWT A;  4G9Y A;  2M2E A;  1BW6 A;  1RES A;  1ENH A;  2RAE A;  3FXU A;  4C3H J;  4IXA A;  1WKM A;  2GIZ A;  2R7R A;  1X3U A;  5JHF A;  1U8R A;  1JGS A;  3A0H C;  3DPT A;  4L9N A;  3RKW A;  3K4B A;  3HPH A;  2ADU A;  5IOZ A;  4FHT A;  4XKW A;  1SD6 A;  2JA6 J;  4B44 A;  1T08 B;  1MGT A;  1BL0 A;  1W5C C;  2HVQ A;  3BQZ A;  2CO5 A;  4F3Q A;  2GM4 A;  2VN2 A;  3KLO A;  1TNS A;  5CVV A;  4KNY A;  4B4C A;  5D8L B;  1T56 A;  1HQC A;  1EF4 A;  3WGG A;  4RDU A;  1Y56 A;  3GTQ J;  2XRN A;  3M7G A;  3MWM A;  4HQM A;  1EJ9 A;  1FNN A;  5HOD A;  1DP7 P;  4BDZ A;  5CQE A;  1S9H A;  4EV0 A;  3I4P A;  3P9C A;  1K6O A;  3KZY A;  3TW7 A;  3M3Y J;  5J47 A;  4A3B J;  3CUQ A;  5KAI C;  4B3X A;  2X1D A;  1A35 A;  1JXS A;  2ZME A;  5J1U A;  1VFC A;  1GLN A;  1LFU P;  3JRE A;  4M9X A;  3F8B A;  2QEN A;  1FP1 D;  2V1D A;  4BJ5 C;  2JQ7 A;  3S16 J;  1T6S A;  3AFH A;  4Q48 A;  3MZH A;  2LKP A;  2CUE A;  2ZJ2 A;  2XSD C;  1YX5 A;  1IRZ A;  3FXL A;  4HEA 2;  4XN3 A;  2FNP A;  1IW7 F;  5IYC J;  1WSU A;  4JYK A;  2E1M C;  5B5E C;  3G73 A;  1QO0 D;  1K78 B;  3RQ4 A;  2V4J C;  2R7W A;  1I1S A;  2LY2 A;  1IUF A;  3WTY C;  4RS8 A;  2NOG A;  3IKV A;  1FPQ A;  3GCM A;  4I01 A;  2PBI A;  3D5R C;  4IRG A;  4DYQ A;  2K9M A;  4NHJ A;  3DP7 A;  1H9G A;  1XSV A;  1DU6 A;  2ZXI A;  4WXD A;  2NRA C;  4RB1 A;  3TGN A;  4X1E A;  2EFO A;  3ZR8 X;  4P1W A;  4DYR A;  3CCU I;  4KUM A;  3CJQ B;  4LG3 A;  4M3G A;  3VYU B;  4KIF A;  4IOA F;  2PMU A;  4X6A J;  2EIL H;  1USS A;  3ERM A;  2OQG A;  5E3L A;  5F0C A;  4UVA A;  5C4X J;  4K2E A;  3I55 I;  2QKL B;  4CCM A;  4MLO A;  1TQM A;  4JK1 X;  3VSK A;  5E3N A;  4U87 A;  3H92 A;  1X1D A;  1SFE A;  3FIW A;  5FKN A;  3B6C A;  5L3C A;  2R7Q A;  4G6T B;  1IO2 A;  3W2V A;  4ZTF A;  3AG3 H;  2Y48 A;  5HLT A;  3CCS I;  1LJ9 A;  3QRF F;  4BXF A;  3DBH B;  5L3G A;  1VQO I;  4A0Y A;  4ZDO A;  1JUS A;  4BBR J;  3ZXS A;  4GFB A;  3V7R A;  2RNG A;  1I39 A;  4Y52 J;  5EYR A;  2DA1 A;  5GAE J;  3HUG A;  1AA7 A;  2DA3 A;  4IJA A;  3WU1 B;  3T5X A;  2CS3 A;  4I6Z A;  2P4W A;  1DU0 A;  3SFI A;  1IRX A;  1MD0 A;  5D6F A;  2DXI A;  1KU9 A;  3FIS A;  3SZT A;  2DMP A;  1FSE A;  4ZYD A;  1JJ6 C;  4RBO A;  1GV2 A;  2XGX A;  4UVC A;  1JKR C;  4E7S A;  1ZRD A;  1ITY A;  5CVU A;  4XRS A;  1NHA A;  4WXH A;  1TWA J;  1WJF A;  1N77 A;  4F92 B;  1H8A C;  1TLH B;  2A05 A;  2FBI A;  3F8N A;  3IP4 B;  4YEL A;  4DGW B;  4E7Z A;  1BJA A;  3G2B A;  2K7L A;  5KCM A;  5D4R A;  2BY0 A;  1U5T A;  3FX3 A;  2M45 A;  3WG7 H;  5GPA A;  3K70 D;  5IT3 A;  1YTY A;  2ZKZ A;  1PYV A;  5ICE A;  4G7H F;  2F6C A;  2EZH A;  1XX5 A;  3IUO A;  3LSI A;  4HYE A;  1FBU A;  4BUP A;  5IP9 J;  2GOX B;  3PIO F;  1MJB A;  2E5Z A;  2KIU A;  5GP9 A;  2ETH A;  2FUG 2;  4BAY A;  1KA8 A;  2CYY A;  2ID6 A;  3OYL A;  4XLP F;  2NNY A;  2M7B A;  2F4O B;  2FML A;  4FQG A;  1JI8 A;  2YS9 A;  2K86 A;  5EEG A;  3GTO J;  5HLH A;  1MNM C;  1FTZ A;  1DPR A;  3BJO A;  3WTV C;  5LEK A;  1NG7 A;  1UHS A;  4XRM A;  3L9F A;  2L7K A;  3PO3 J;  4KT6 A;  3VEP A;  1UZC A;  3WHC A;  2BY1 A;  2MC3 A;  2VXZ A;  3DCF A;  1QA6 A;  2XSJ C;  3SHF A;  3BZ6 A;  3GBG A;  3TDZ C;  1LEB A;  4N0B A;  1F9N A;  3M8J A;  4ZTJ A;  1T0F C;  4S0H B;  4BL0 B;  2UWM A;  3HSF A;  2XF5 A;  1W7P A;  3CC2 I;  1O7L A;  1AKH B;  2M30 A;  3E6B A;  5B1A H;  2MLG A;  2XAS A;  2FBK A;  3LQQ A;  1XDU A;  2MC4 A;  3GF2 A;  1OCP A;  1P7J A;  1YJ9 I;  2I5U A;  2E34 A;  3JTG A;  3HOY J;  1KYZ A;  3LMM A;  1BA5 A;  4PJM A;  1LDJ A;  2Z3Y A;  2HU9 A;  3E6C C;  3U21 A;  1A5J A;  3F6O A;  1X2M A;  2DN0 A;  1HDP A;  3JSP A;  2JWT A;  3IKT A;  1I5Z A;  3KYC B;  1G3Y A;  2W25 A;  1BR2 A;  5J1Y A;  2DMQ A;  5TGT A;  3W6V A;  2Z1D A;  1R9T J;  1LFP A;  3E1S A;  4ZC3 A;  1U0J A;  2K27 A;  4EJT A;  3R0J A;  2IAI A;  3BTJ A;  1K83 J;  2EZI A;  5LHG A;  1Z6R A;  1YRN A;  3JRB A;  1P4X A;  1ZR4 A;  2P6T A;  1J75 A;  2ZSH B;  2TDX A;  1VQN I;  3BJ6 A;  2MYS A;  4KDP A;  2JSP A;  2LF8 A;  4BGD A;  1HSJ A;  3L1P A;  3P7N A;  2WA0 A;  5D5X B;  3TED A;  3IL2 A;  5H6R A;  4BHC A;  3QYB A;  4D5C A;  4XSX F;  4PJ0 C;  4E70 A;  4HF2 A;  4WCG A;  4N4N B;  1WVR A;  3TKY A;  1XSD A;  1ORK A;  4BKX A;  2DOA A;  4B09 A;  2Q2E B;  1ZKG A;  1QVT A;  2L0K A;  5ED4 A;  4BE1 A;  1ZTR A;  1SAU A;  3KLN A;  1T39 A;  2KHM A;  1MMS A;  1GHC A;  4DJA A;  3S15 J;  2Z2S B;  2LK2 A;  3TO9 A;  3FXO A;  2PEX A;  1K4S A;  4IO9 F;  3FDY A;  1IC8 A;  1EV7 A;  4RGX A;  3DTK A;  1P2F A;  4XR6 A;  1QU3 A;  3LOC A;  2XV4 S;  4J01 A;  4CYC B;  3H0D A;  2BXZ A;  3L2W A;  1LNW A;  2HKX A; 
#chains in the Genus database with same CATH homology
 2HXO A;  3BTC A;  5F08 A;  2E1O A;  3BT9 A;  5DTD A;  3GTM J;  2JK3 A;  5EG0 A;  2JMW A;  2N8G A;  2FD5 A;  2COB A;  1JUP A;  1FIA A;  3A03 A;  3BG3 A;  1NK3 P;  2CU7 A;  1JUM A;  5M5Y J;  2EZL A;  4NDL A;  4UUT A;  1CQT A;  1AU7 A;  3BR6 A;  1AHD P;  4BBS J;  1IDZ A;  5F27 A;  4JX5 A;  4DW6 A;  4V2F A;  3DEW A;  3LSR A;  2YUS A;  3QPL A;  2G0E A;  1POG A;  1ETQ A;  2NS8 A;  1BJZ A;  4FTH A;  2LFB A;  2M0C A;  2ME0 A;  4BY7 J;  3ZQG A;  4QIW N;  3S14 J;  2DA4 A;  2KT0 A;  1PUF B;  3C2B A;  1OJL A;  3SDG A;  4FE7 A;  2E2J J;  2JA5 J;  2MG4 A;  3S2D J;  1F36 A;  3MKL A;  2HQ5 A;  5EZH A;  2JA7 J;  3HGG A;  3BR5 A;  1LE8 B;  2P81 A;  4MFE A;  2ELK A;  2M34 A;  1SAN A;  2WAQ N;  2Y9Y A;  1MBE A;  3SJM A;  3TP0 A;  1HCR A;  1VF9 A;  1JJ8 C;  3S17 J;  4A3F J;  3D1N I;  3IH3 A;  1H89 C;  3QQA A;  5F1J A;  2NVY J;  2NVQ J;  2X6O A;  2HOT A;  2DMU A;  1ETK A;  3QPS A;  3G1M A;  1E3O C;  3BQY A;  5FKL A;  4C2M J;  2R5Z B;  1WPK A;  2K40 A;  3CCY A;  1IV6 A;  1FIP A;  2AHQ A;  4EEF G;  3JRH A;  3OSG A;  3LSJ A;  3JRD A;  1MH4 A;  4CYC A;  5FKK A;  1TC3 C;  4D5F A;  5J3L A;  1W0U A;  4IHW A;  4V2G A;  2Y0S N;  5K7H A;  4M6V A;  2XB5 A;  3CMY A;  1GT0 C;  5GPC A;  5K7Z A;  1P7I A;  2XPV A;  2LTP A;  2QCO A;  3TP3 A;  2LD5 A;  5EEA A;  4UUS B;  2LKX A;  5M3F J;  4A3E J;  2XPU A;  2DA5 A;  5M5W J;  3G1O A;  4G12 A;  1QVU A;  2D5V A;  2CJJ A;  2R7Z J;  3WHB A;  2NS7 A;  2E2I J;  3HEF A;  3HOW J;  4W1U A;  4A3J J;  4A3C J;  2OF7 A;  1Y1V J;  4Y7N J;  1VND A;  3HOX J;  4MFD A;  1PUF A;  1MBH A;  3RKQ A;  2WB1 N;  2X9D A;  5FLM J;  2LVS A;  2R92 J;  3HOV J;  3Q0V A;  1LE8 A;  2K9Q A;  1MH3 A;  2TRT A;  3GTP J;  4A3L J;  1OFC X;  5IOY A;  3BR2 A;  2LY9 A;  2LR8 A;  2VKE A;  4I76 A;  1RET A;  1JGG A;  1UG2 A;  1HOM A;  2I10 A;  1TWC J;  1U78 A;  1Z77 A;  1MSE C;  3BR1 A;  1ZQ3 P;  2R5Y B;  1X2N A;  5J1R A;  4FE4 A;  3FK7 A;  3IV5 A;  1F43 A;  1AKH A;  2YU9 J;  5IYD J;  3I4N J;  5DS9 A;  2XPW A;  2R5Z A;  2L7Z A;  4A3M J;  2M2E A;  2KDZ A;  1JKO C;  1BW6 A;  1RES A;  1A6I A;  1ENH A;  2RAE A;  4C3H J;  3ZQI A;  2L7F P;  4IEJ A;  3S1R J;  4L5E A;  5IOZ A;  1W0T A;  4C3J J;  2JA6 J;  2AO9 A;  3HGY A;  3G1L A;  1FEX A;  3FKI J;  2XGE A;  2Y2Z A;  1B8I B;  1BL0 A;  3BQZ A;  2GM4 A;  1GDT A;  3CDL A;  4B4C A;  1T56 A;  1EF4 A;  2Y31 A;  3BR0 A;  2DMN A;  2ECB A;  4J19 A;  1U9O A;  1XG1 A;  4RDU A;  1JKP C;  3GTQ J;  3MVP A;  1RPW A;  2MW8 A;  5HOD A;  4A3G J;  4M3D A;  2XRL A;  3ZQH A;  2GBY A;  2DA7 A;  2VI6 A;  3TW7 A;  3M3Y J;  2VUM J;  4A3B J;  1GV5 A;  3E7L A;  1B72 B;  2DA6 A;  2CQX A;  2ZB9 A;  1I6H J;  5EDN A;  1I50 J;  2WV1 A;  4XIC A;  4M3E A;  4LOC A;  5IPA A;  5J1U A;  3B6A A;  1VFC A;  1LFU P;  4XID A;  3JRE A;  3CQZ J;  3ZQL A;  3A01 B;  5C3E J;  1ETW A;  2ME6 A;  2W48 A;  4B1R A;  1G2H A;  3GTK J;  2MGQ A;  3S16 J;  2CRG A;  2CUE A;  2CUF A;  2XSD C;  1IRZ A;  3TW6 A;  5EGO B;  2HOS A;  2JA8 J;  2DTZ A;  5IYC J;  4JYK A;  2R5Y A;  3GTL J;  4HNV A;  3GTG J;  5EG0 B;  5EZG A;  3H3V K;  3OSF A;  1IUF A;  2NOG A;  2K9S A;  1WH7 A;  5M3M J;  3RZD J;  1U8B A;  2DJN A;  4DYQ A;  2X48 A;  2M8G X;  4A3K J;  3Q3S A;  1JT0 A;  1DU6 A;  3HOZ J;  2K9N A;  4X1E A;  1ZK8 A;  1U9N A;  2Y9Z A;  2XGD A;  2HYJ A;  2XB0 X;  4DYR A;  2HXI A;  3S1N J;  2VPR A;  1RKT A;  3JRA A;  4M3G A;  4XRS G;  1JKQ C;  1B8I A;  4X6A J;  1IG7 A;  5K7F A;  5E3L A;  5F0C A;  5IP6 A;  5C4X J;  1NTC A;  3JRI A;  4BY1 J;  4MLO A;  1H88 C;  2NVX J;  5E3N A;  1ZGW A;  2EZK A;  1BW5 A;  4IHX A;  3FIW A;  4A93 J;  5FKN A;  3B6C A;  1HLV A;  1HF0 A;  3S2H J;  1IGN A;  3K2A A;  3ZOB A;  3O8H A;  1D5Y A;  2HI3 A;  1JUS A;  4BBR J;  1B72 A;  4D7M A;  1FJL A;  1MBK A;  1IJW C;  3JRG A;  4GFB A;  1RR7 A;  4QSH A;  3BG9 A;  2LP0 A;  4Y52 J;  2DMT A;  2IEK A;  3HM5 A;  5EYR A;  2DA1 A;  4IHY A;  5E3O A;  2DA3 A;  1O4X A;  4M3B A;  4C3I J;  4I6Z A;  3O8G A;  4D7N A;  1DU0 A;  2EH3 A;  2EQR A;  3SFI A;  1APL C;  3IH2 A;  3FIS A;  2XGC A;  2DMP A;  1MBG A;  1LFB A;  3JRC A;  4RBO A;  2FJ1 A;  1JJ6 C;  1GV2 A;  5F0H A;  1JKR C;  1ITY A;  1JTX A;  1S7E A;  4XRS A;  1K61 A;  1TWA J;  1H8A C;  1ETX A;  3UKG A;  3HOU J;  4IHV A;  3HKZ N;  5F04 A;  3JR9 A;  1T33 A;  2JJ7 A;  2OPT A;  4DYC A;  5F0F A;  4QTR A;  4MO7 A;  1JTY A;  1WGX A;  1YRN B;  4UUS A;  1ETY A;  1X58 A;  3Q0W A;  4M3F A;  3BR3 A;  5GPA A;  1Y1W J;  5M5X J;  2FX0 A;  3NAU A;  2ID3 A;  3M4O J;  3BG5 A;  3MN2 A;  2LLK A;  2EZH A;  5FKO A;  2L7M P;  4AC0 A;  3LSG A;  5IP9 J;  3GTJ J;  5GP9 A;  2O9L A;  2QF7 A;  2ID6 A;  3BTI A;  1WH5 A;  4AYB N;  1GUU A;  1HDD C;  9ANT A;  3I4M J;  5C4J J;  5FLV A;  3H0G J;  1RKW A;  2YS9 A;  4A3I J;  3NAR A;  3GTO J;  1MNM C;  1FTZ A;  5FJ8 J;  1UHS A;  4XRM A;  3PO3 J;  1GVD A;  2R93 J;  3WHC A;  4DZP A;  3OIO A;  5FKM A;  1OCT C;  3VPR A;  3DCF A;  3LNQ A;  4FCY A;  3GBG A;  2DA2 A;  2NVT J;  4S0H B;  5E3M A;  3FK6 A;  3LSP A;  2MSY A;  1UMQ A;  4MIM A;  3HB9 A;  3S1Q J;  1AKH B;  1WI3 A;  3HBL A;  1MBF A;  3HOY J;  1OCP A;  1P7J A;  1MSF C;  1BA5 A;  3K7A J;  1QPI A;  1TWH J;  2VKV A;  5IYB J;  1TWF J;  1A5J A;  2M9H A;  2CQQ A;  3OOU A;  1VI0 A;  1X2M A;  2DN0 A;  4JP0 A;  4A69 C;  1HDP A;  1IDY A;  2JWT A;  1JT6 A;  1SFO J;  4JX4 A;  2L9R A;  5J1Y A;  2GLO A;  3W6V A;  2DMQ A;  5JLX A;  1R9T J;  1TWG J;  4FIS A;  1XS9 A;  2H1K A;  5C44 J;  4ABZ A;  3PM1 A;  2IAI A;  3BTJ A;  1K83 J;  2EZI A;  2JN6 A;  3RQI A;  3JRB A;  1YRN A;  5IP7 J;  1ZR4 A;  5JLW A;  2PMZ N;  2Y30 A;  3ZQF A;  5BNG A;  1FTT A;  3Q0U A;  1NK2 P;  3L1P A;  3IH4 A;  2HOA A;  3TED A;  2H8R A;  2O7O A;  3S1M J;  2E19 A;  4D5C A;  3PO2 J;  1Z0X A;  3BTL A;  1MBJ A;  1QRY A;  2HDD A;  3RZO J;  4XK4 A;  2O8K A;  2B63 J;  4AUX A;  3HDD A;  1ORK A;  2IBD A;  4BKX A;  2FQ4 A;  2R0Q C;  1ETO A;  1ZKG A;  1QVT A;  4DZJ A;  2L0K A;  1ZTR A;  3JRF A;  4B3A A;  4BXX J;  3A01 A;  3S15 J;  4W97 A;  2LK2 A;  1I3Q J;  1WCM J;  5EF6 A;  1ETV A;  2EBI A;  3A02 A;  1IC8 A;  2TCT A;  4JX6 A;  3ZQC A;  3LOC A;  2E2H J;  2ECC A;  3F0C A;  4CYC B;  5EGO A;  4A3D J;  1XC5 A;  1ZR2 A;  1Q1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...