5EGOA

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Homeobox protein Meis1
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoA00
2LK2A 1IGNA 3NAUA 5DS9A 2VKVA 2TCTA 3S1RJ 1HCRA 1JT0A 4C3HJ 3JRAA 2R5YA 3QPSA 1ORKA 2H8RA 4QIWN 3HB9A 1JKRC 1MBKA 5E3OA 5EDNA 1VF9A 1X2MA 2CJJA 3DCFA 3S17J 4W1UA 3Q0VA 1QPIA 2DA6A 1QVTA 2E19A 3JRGA 5EGOB 2FX0A 2JK3A 1APLC 2LFBA 4B3AA 1QVUA 3A03A 1IG7A 4UUSB 4MFDA 1MBEA 3PO2J 1ZR4A 2LTPA 3WHCA 4JP0A 2LKXA 3HGGA 1LE8B 5IP6A 1EF4A 2IAIA 4BKXA 4X1EA 2DJNA 1ETKA 2XGDA 3HGYA 1LFBA 1B72B 3S1QJ 2M2EA 3HOVJ 4XRSA 1S7EA 5IP7J 2NVQJ 3TW7A 3S16J 3JRCA 5FKNA 2GM4A 2E2IJ 2N8GA 5E3NA 5IOYA 1TWHJ 2JA8J 2E2JJ 2HOSA 2CQQA 2GBYA 5K7HA 2ELKA 2COBA 1X2NA 2QF7A 2R7ZJ 4S0HB 1WGXA 3BR3A 4UUSA 1RESA 1ETOA 4D5CA 1U9OA 4JX5A 5EG0B 3Q0UA 1X58A 1AHDP 3I4NJ 3W6VA 1ETVA 1AU7A 1LE8A 2M34A 3GTOJ 3TP3A 4NDLA 3HOWJ 1PUFB 3IH3A 1F36A 1GVDA 2R0QC 2DTZA 1AKHB 1FEXA 1YRNB 2EBIA 3BR2A 5EZHA 1H89C 2W48A 4IHWA 4AC0A 5M5WJ 4D7MA 5F27A 2DN0A 1Y1WJ 2DA1A 4A69C 4C3JJ 2VUMJ 2Y2ZA 2OPTA 4BXXJ 1ETWA 2H1KA 2XB5A 3QPLA 1B8IB 1BA5A 3A01B 1MBHA 5EG0A 1JKPC 5JLWA 3GTMJ 2JA5J 5C4XJ 1TWCJ 3WHBA 3SFIA 3HKZN 1JGGA 2P81A 2R93J 2JA6J 3LNQA 3GTLJ 2WAQN 4MIMA 1IUFA 4RBOA 4B4CA 3G1MA 2Y9YA 2EH3A 3GTPJ 3B6AA 1FTZA 2LLKA 1AKHA 1A5JA 1YRNA 2O9LA 4BBSJ 3ZQGA 1ZQ3P 2XPVA 1IDZA 4A3CJ 3BG9A 2EZKA 3HOZJ 4M6VA 5FLVA 2NVXJ 2JA7J 1TWFJ 1IJWC 1B8IA 3JRBA 2CQXA 3BTCA 4EEFG 3A01A 1ZK8A 3LSGA 1JT6A 1VFCA 5JLXA 1VNDA 2EQRA 1IC8A 4DYCA 5FKOA 3E7LA 3OOUA 3OSGA 2B63J 2HQ5A 1P7IA 4FISA 4XRMA 2M0CA 1ETXA 1OCPA 4LOCA 1BW5A 3A02A 2DMTA 3TP0A 5F0FA 4A3EJ 3BR5A 4G12A 2KDZA 2DMNA 3JR9A 4Y7NJ 1A6IA 2LP0A 2HOAA 5J1RA 1JUSA 1JJ8C 1I6HJ 3FK7A 4XICA 1O4XA 2DMPA 2ID3A 1OJLA 3O8HA 2XPWA 1OCTC 2XB0X 3ZOBA 4ABZA 3FKIJ 2EZHA 1JTXA 2L7FP 1MBJA 5J1UA 2ME6A 4FCYA 3HEFA 1IRZA 2CU7A 3PM1A 4DYQA 3BR1A 3S2HJ 4M3GA 2HDDA 2KT0A 3G1LA 1IDYA 1MNMC 4I76A 1JUPA 2Y31A 3D1NI 4XRSG 3ZQIA 1NK3P 1Z77A 4MO7A 5F04A 3FIWA 5EF6A 5FKMA 2MGQA 5FLMJ 3BR6A 4QTRA 3JRDA 4DZPA 3RZOJ 5F0HA 1HDPA 2ECBA 2AHQA 2MW8A 4MFEA 4DW6A 2G0EA 1Z0XA 3ZQHA 3CMYA 2YS9A 3B6CA 3IV5A 5IYBJ 2X48A 3Q3SA 2M8GX 2NS7A 5FJ8J 2JMWA 3BG3A 4A3IJ 1U78A 5E3MA 2GLOA 2FQ4A 2MG4A 5M5YJ 3L1PA 3S15J 2MSYA 1JTYA 4D7NA 2HOTA 3BR0A 2K9SA 1UG2A 5FKKA 3BQZA 4JYKA 2FJ1A 1RETA 1ITYA 2DMUA 2CRGA 2TRTA 5DTDA 1JKQC 2YU9J 5K7FA 1ZKGA 1GDTA 2EZIA 3S14J 2X6OA 2XRLA 1JKOC 2FD5A 3FK6A 4IEJA 2DA3A 2K40A 4M3EA 5EYRA 3BTLA 4FTHA 1H88C 3RQIA 1G2HA 2VI6A 4V2FA 3MN2A 3S1MJ 1HOMA 3PO3J 5F0CA 2AO9A 4GFBA 5E3LA 2K9NA 1P7JA 4A3KJ 3LOCA 4BY7J 4AUXA 3K2AA 1POGA 1ENHA 3NARA 2DA4A 2NOGA 5GPAA 1MBFA 2Y9ZA 4FE7A 4M3FA 4XIDA 3JRFA 4XK4A 1XG1A 3VPRA 2QCOA 1HDDC 3TW6A 1MSFC 1MSEC 3JRHA 2XPUA 3HBLA 3RKQA 3ZQLA 3S1NJ 5IOZA 3LSPA 2L9RA 4HNVA 2ZB9A 1NTCA 1TWAJ 1ZGWA 3ZQFA 3JREA 5IPAA 4IHXA 2LR8A 3MKLA 1T33A 1BL0A 1MH4A 1FJLA 3GTQJ 2IEKA 2K9QA 1DU6A 4A93J 5GP9A 2NVTJ 1Q1VA 1K61A 3HOXJ 4CYCB 1FIAA 2RAEA 1HLVA 3G1OA 2OF7A 4MLOA 5C3EJ 1I3QJ 2O7OA 3BTIA 2HXIA 5IYDJ 2O8KA 1GUUA 3BQYA 1VI0A 5IYCJ 3BT9A 1WH7A 4W97A 1DU0A 2LVSA 1GT0C 4C2MJ 1U9NA 3SDGA 2JWTA 5EEAA 1TC3C 3GTGJ 4L5EA 1RKTA 3S2DJ 1MBGA 3M3YJ 1LFUP 1ZTRA 1FIPA 1ZR2A 4DZJA 3O8GA 1SANA 5K7ZA 1BW6A 2IBDA 3HOYJ 3K7AJ 3LSRA 1RKWA 2XGEA 1SFOJ 1MH3A 2VKEA 4A3FJ 1R9TJ 1UHSA 3MVPA 4A3GJ 2JN6A 2HXOA 1OFCX 2DMQA 2WB1N 4CYCA 2I10A 1K83J 5C44J 3BG5A 5HODA 1I50J 4AYBN 1D5YA 4BY1J 2E1OA 1IV6A 1RR7A 3CQZJ 4I6ZA 3GBGA 2XGCA 5F08A 3Q0WA 3IH2A 1TWGJ 3HM5A 3JRIA 3RZDJ 4V2GA 4D5FA 5BNGA 3OSFA 5J3LA 2ID6A 1U8BA 3C2BA 1ETQA 2EZLA 1WCMJ 2ME0A 2LY9A 5FKLA 5EGOA 2M9HA 1QRYA 4JX6A 2L0KA 2ECCA 1XS9A 2DA5A 1WI3A 2R92J 1RPWA 3GTJJ 3UKGA 2LD5A 3DEWA 5M3MJ 2HI3A 1WH5A 4M3BA 3CCYA 4QSHA 2NVYJ 4A3JJ 2PMZN 2Y0SN 4FE4A 3F0CA 1W0TA 1H8AC 1B72A 2DA2A 2E2HJ 2NS8A 4A3DJ 2VPRA 2HYJA 3FISA 3LSJA 4X6AJ 1W0UA 3M4OJ 1NK2P 1UMQA 2R5ZB 4UUTA 1E3OC 1JUMA 3TEDA 3QQAA 2WV1A 2X9DA 4A3MJ 4B1RA 1FTTA 2R5YB 1ETYA 1XC5A 1F43A 2JJ7A 4JX4A 1WPKA 2CUEA 2CUFA 1BJZA 5EZGA 1CQTA 4Y52J 4IHVA 2XSDC 3CDLA 1JJ6C 9ANTA 3ZQCA 4C3IJ 4RDUA 3H3VK 3GTKJ 1PUFA 2D5VA 3SJMA 4BBRJ 5IP9J 3I4MJ 3HDDA 3IH4A 3HOUJ 5J1YA 5M3FJ 1T56A 5M5XJ 2YUSA 1GV5A 1Y1VJ 2DA7A 4M3DA 1HF0A 4A3LJ 4J19A 1GV2A 2L7MP 5GPCA 4A3BJ 2R5ZA 5F1JA 4IHYA 2L7ZA 3H0GJ 4DYRA 5C4JJ 3BTJA 2Y30A 3OIOA
chains in the Genus database with same CATH superfamily
2F4MB 4J01A 4KISA 1W36D 3V7CA 2BBYA 3HIFA 4HQMA 1IGNA 3CCEI 2VKVA 2TCTA 4OU0A 4XRFA 2JA2A 4CHUA 3PNYA 3QPSA 3D0SA 3FWEA 1ORKA 4XN0A 2KIMA 3FBNB 3H35A 3OYIA 1E3PA 3V4GA 1JKRC 1MBKA 5E3OA 2D45A 1KQ9A 3HHGA 2R4GA 3F6OA 3GO5A 3VOEA 5EDNA 4Y33A 1SD6A 3DCFA 3W2AA 2FBIA 1OCCH 4IX7A 2E19A 3JRGA 3F8FA 3AAFA 3F8BA 1S7OA 2QSHX 2W1OA 1ZG5A 1RUNA 3C2HA 1IN7A 3A03A 4XM3A 2B0LA 3DPUA 3X2QH 3NRVA 4C2TA 1FT9A 3COAC 3WG9A 1EH6A 3SYTA 4NC6A 2W00A 4JP0A 2GA2A 2G7HA 4EVIA 1W7PB 3E0JB 2L54A 1LNWA 5FRMA 1G3YA 2YPRA 2VT2A 2M2EA 2BZTA 4XRSA 4ANJA 2P0WA 5FO5A 3S16J 2F5DA 4I98B 2L7KA 4NC7A 2GM4A 2V1XA 2ZKZA 1E3HA 2ZFWA 2QYOA 1FY7A 2HQNA 3IC7A 5BMZA 2IP2A 3MKYB 2K85A 5CLSA 4PZJA 4WCGA 2NNNA 1FPQA 4E7SA 2OJED 2ELKA 2COBA 3MD2A 4UUSA 4LLNA 1WKMA 3ONQA 2QQ8A 2ZMEC 3W6VA 3L2UA 2XF5A 4PUSA 5L3FA 5K1YA 1AU7A 1LE8A 5B3SH 3JAMK 4NDLA 1PUFB 3H3UA 3IH3A 2E7WA 4BYYA 4XNFA 1WRJA 3U9GA 2X6WA 4Z2YA 2DTZA 4AU7A 4F3QA 1FEXA 5HS9A 2DFIA 1TQMA 2EILH 5F27A 2DN0A 1SC7A 2DA1A 4C3JJ 3BROA 2VKDA 4XKVA 4CH7A 2XV4S 2BY2A 1JGSA 1ETWA 4D1QA 3HJEA 2R7RA 1TTYA 2OQRA 2XB5A 2H1KA 1BA5A 1XSXA 3A01B 3LA7A 1G4DA 1YX3A 5EG0A 4RGUA 5JLWA 2X85A 2X1CA 3GTMJ 4ZZLA 3M8JA 3WHBA 2VBYA 3SFIA 1VQ8I 1X3ZB 4K2EA 1TBXA 2DQRA 2PX9A 2HZTA 3RQ4A 5FRNA 3GTLJ 2WAQN 3DTKA 4MIMA 2MH9A 4D0PA 4CXFA 4XLPF 2AXTC 3GEZA 3GVAA 4LLGF 4B4CA 3G1MA 4PCQA 3I64A 3KFWX 2LRDA 4JOMA 3K70D 4FQGA 5CPRB 4YIRX 2IGNA 2MD0A 1Y8RB 2P4WA 2IGMA 1HW5A 1S3JA 2Y0MA 3ZQGA 3LL7A 2KMUA 3DU5A 4HA8A 3KP7A 3BG9A 3RJPA 2VQCA 4M6VA 2E71A 2IPQX 5FLVA 4U0WA 3F21A 3J7ZI 2DOEA 4KYWA 3EETA 3S3MA 3EUAA 1B8IA 3U1KA 3BTCA 3WTYC 1DPRA 3DPLC 1LQ1A 1JT6A 1VFCA 1MMSA 1OR7C 1VNDA 4N9IA 5J4VA 2DDAA 1U8RA 3IRQA 2YR2A 3I55I 5JHFA 2B63J 4FASD 2IS2A 2HQ5A 4A0XA 2A5WA 4XRMA 2RVCA 2WV0A 4LOCA 1W1WE 4A0ZA 4DQ2A 1Z1DA 2F48A 2FF4A 2RNGA 3TO9A 3I4PA 3MQ0A 3WTVC 1K7AA 2WC2A 3JR9A 5J40A 1UCRA 3K1PA 4BJ6C 3AL0B 4PGHA 2V4JC 1JJ8C 1UB9A 4XICA 2XAQA 2VONA 1EKEA 3CC7I 2DMPA 4ESBA 1SFKA 2ID3A 1OJLA 2XB0X 3O3KA 3FKIJ 2EZHA 1MJBA 3E6MA 3IKVA 2ME6A 3TDUC 2ACJA 1IRZA 1ERDA 3DEUA 1ZYRF 2FUG2 2HKXA 4LG0A 1FOXA 4M3GA 1IXCA 1X3UA 2QZ8A 3F3XA 2IRFG 3LA2A 3D5SC 1FYKA 1VQ7I 1R23A 5CYVA 1ZRCA 1MNMC 2K02A 2Y31A 4XRSG 1Y8QB 1NHAA 1MMGA 3A2KA 1IZ1A 1V54H 2ELJA 3L2CA 4NQWA 4RB2C 1ODDA 1FP1D 3DU6A 1Y39A 3EDPA 5FLMJ 3K4CA 2DT5A 1D1AA 3J7AO 1VZ0A 1FX7A 4IXAA 3K0LA 2JUCA 2ECBA 4DJAA 5TISC 1IN8A 2BW3A 2BOLA 2CS3A 2HDWA 5CJ9A 2YS9A 5E8GA 5D8KB 2J5OA 5IYBJ 1BR4A 3J81Z 2X0LA 3DBHB 3Q3SA 2M8GX 2D1HA 4FT8A 1LFPA 3BG3A 5LHIA 2CO5A 5E3MA 3ZN0A 1X1BA 1Z7LA 5M5YJ 3S15J 1VQ5I 4PGGA 4RAGA 1G59A 4O5VA 1JTYA 4D7NA 1HKQA 4YRVA 5FKKA 4JYKA 2HYGD 1RETA 1Z6TA 1O3QA 2LC2A 2H8WA 2A5YB 1JKQC 1ZKGA 4II2A 3S14J 3DTIA 2W82A 1T6SA 3MFKA 1JKOC 1UHWA 3KIOA 4KNYA 4E7KA 2DA3A 2ZJ2A 2PLYA 4M3EA 2EJRA 1H88C 3DQVC 5BOXA 4V2FA 3P5JA 4IZZA 4OAYA 1D8KA 1SD4A 2MA3A 1MGTA 1XTAA 2YX4A 4N4OB 4HX4A 2Y75A 4LJZF 4GFBA 3GX4X 2NXNB 3LOCA 1PVEA 2Q8KA 1VTNC 2HEOA 2H09A 1MBFA 2D2WA 2ZNZA 3BZKA 3FM3A 4M3FA 3H0DA 4BHBA 5J8FA 4HNUA 3EUKL 5FROA 5CVUA 5IOZA 3AG4H 1XB4A 2V79A 2ZB9A 4XONA 3CCJI 4EJVA 3T0YA 1TW3A 1HKTA 3L7WA 4UXNA 3HTUA 1MH4A 4XKWA 2PEXA 2JPBA 1XCVA 3OIQA 2IEKA 1MDMB 2K9QA 1H9TA 2LY2A 5GP9A 3E6BA 1R5ID 3GFIA 2Q0OA 1K61A 2BY3A 3CCSI 2RC4A 3G1OA 2OF7A 3ZP5A 3FF5A 2LSOA 1I3QJ 3CO6C 1ULYA 2W4SA 1EH8A 3H9GA 3OYJA 2ISYA 3HKZA 1KYZA 5D8LB 2DLLA 2XC7A 2L3DA 1DU0A 1YS7A 2LVSA 3OYHA 4KMFA 5EEAA 4PK4A 2DQLA 4XL9A 1Q1HA 3GTGJ 3ML6A 1T0FA 2HQAA 5KNLA 3CJQB 4BQOA 4P9UA 3M3YJ 1EA3A 2Q2EB 3PNTA 2DFFA 4BXFA 1LFUP 3BWGA 1HBXG 4CCKA 1G6NA 1OMIA 2ZNYA 1MMAA 1SANA 4ZDOA 3FDYA 4RLQA 1BW6A 3BJAA 4EMSA 4AVZA 5DEQA 5LRRA 3WTSC 3LSRA 3JW4A 1MH3A 2KZGA 1BI0A 1J9IA 2JVHA 4B3XA 1R9TJ 2HXOA 2DMQA 5HS7A 4R79A 3ABLH 3GW2A 2I10A 1DP3A 1IO2A 2JVGA 2MD5A 1WJBA 5HODA 4ZDPA 4AYBN 1BIBA 5KAFC 3L2QA 2KJBA 1T38A 1KONA 2HYFA 4I6ZA 1XCBA 1OISA 3PNVA 3FXOA 4M9ZA 3G71I 3OYEA 3RZDJ 2FNAA 4R1HA 1WQ2A 1O7LA 4BGDA 5CVVA 3C2BA 2D1VA 5B1BH 3OYMA 2EZLA 4OIPF 4RAZA 2V9VA 3ERMA 5FFXA 3ZQQA 5HOOA 2LREA 1JHFA 3PL8A 4CYDA 4N9HA 4E4HA 2A69F 1QRYA 2PN6A 3ZR8X 2RKHA 4F92B 2MLKA 2L9VA 6PAXA 1XMAA 2M4GA 4IRHA 2O5RA 3H5NA 4P96A 4J00A 2R92J 2VE9A 3BPXA 1W7PA 3DEWA 1KQ0A 4I99C 1IN6A 4WXHA 1WH5A 2X1EA 1VQOI 3BZ6A 4XBFA 3RYPA 3F0CA 2DA2A 1S29A 2P6TA 2NS8A 4A3DJ 2COMA 4BU2A 3KEQA 3FISA 3AG3H 1ZREA 1VQ9I 3E97A 5LGNA 1AWCA 1NK2P 1YX5A 2GAUA 2FRHA 1JUMA 4G9YA 3TEDA 2WTEA 2Z9OA 3IKTA 2XKPA 3OYLA 3GLXA 3V8LA 2HKOA 2R3SA 1U5TB 1I3AA 5ERIA 3AKZA 1FTTA 1JE8A 1XC5A 4JX4A 1WPKA 3L9FA 4CSWA 3R4KA 2XUBA 3V7SA 4YFXF 1JJ6C 2IW5A 2LF7A 2EFWA 1EJ9A 3GTKJ 3JCUC 1PUFA 2D5VA 3BOQA 4BBRJ 4FX4A 5IP9J 3I4MJ 3VSLA 3IHUA 4IHTA 2E5NA 1GV5A 3RPUD 3LAJA 2L01A 4A3LJ 4J19A 2VJ5A 2CQNA 2ZJQF 3JTHA 3F9KA 5F1JA 4ETSA 4IHYA 1YJNI 4BEHB 4DYRA 5C4JJ 2Y30A 3OIOA 2R7DA 1IW7F 5HLHA 3NEUA 2R7FA 2L9NA 3S1RJ 4C3HJ 3JRAA 1RC9A 3ZN1A 2XROA 2FSWA 2OV7A 2L02A 3HB9A 2CG4A 2X6YA 5D5XB 1FYLA 4G94A 3TGNA 2EV5A 3VEPA 1X2MA 2OC6A 4W1UA 4BXUA 3NQOA 1QVTA 2BGCA 4BHPA 1YYVA 2NOJB 3EUHC 3M8FA 5FD5A 5EGOB 2LFBA 2OUMA 3OWTA 1JXSA 4HDVA 2HNHA 1QVUA 2HFHA 4MFDA 2AXLA 2KIQA 4RB0A 1U3EM 3PO2J 1UHMA 1Y56A 3BJ6A 2LTPA 2XDVA 1UELB 1QPMA 2ESHA 2LKXA 3DKXA 4PSWA 2IAIA 3E1SA 2ADUA 4X1EA 1HKSA 2DJNA 4M72A 3VFZA 3WGGA 3TO7A 3H5AA 4HPQA 1LFBA 3OYBA 4ENNA 1B72B 2P7CB 3S1QJ 4HV5A 1NG7A 1P4XA 1FZPB 1BI2A 1K78A 1S7EA 4GCVA 4Y4RA 3JRCA 4YG2F 2N8GA 4AVPA 5E3NA 2E1MC 1XGOA 3W6KB 2IA2A 2CW0F 3A1YA 2JPCA 2Z5UA 1WWXA 2GQQA 5LGUA 5FB2A 2OQGA 4N4NB 3R0AA 1O3TA 2QF7A 4PJ0C 1WGXA 2KDOA 1ETOA 1KU7A 5LGTA 1X1DA 4H4KC 4PFOA 1REPC 4RAYA 4WXDA 4U0YA 2KP6A 4IHSA 1TQIA 3QU6A 3HSFA 4RGSA 5KK1A 5ED4A 2W25A 5CVIA 2MBFA 3GTOJ 4E7LA 4XSXF 2A6HF 2ZO4A 3LQRA 1PP8F 2ZFUA 4H0EA 3I53A 2XF7A 1F36A 1GVDA 4OIRF 4JBAA 4WK8F 3J80K 1T08B 1AKHB 3REOA 3K1NA 1ON2A 2L4AA 4LITA 4AC0A 2CQKA 2V6CA 3FKJA 4IL6C 4EJUA 4RGRA 2ISZA 2RV8A 3MZYA 4A69C 4A5NA 3PUFA 2Y2ZA 3CF2A 4RGXA 3CUOA 2QQAA 2HDCA 3T5XA 2DJIA 2LKPA 2WY7Q 1MBHA 1KGSA 3I54A 2JA5J 4CCOA 4BNCA 4LK0F 1IXSB 4MTEA 3CUQC 5BS6A 3F6VA 1TNTA 4GDFA 2AQEA 3EYIA 3PUBA 3L2WA 4TV7A 4MTDA 4RBOA 3B73A 4HYEA 2EH3A 1DUXC 1K6YA 3GTPJ 1WJCA 2DODA 2L2OA 2KJCA 3B6AA 4XLFA 1FTZA 3ASNH 2STWA 1USSA 1YRNA 1YIJI 2O9LA 4BBSJ 5J8CA 2KIFA 3WTTC 4L9TA 1VQNI 2Y0SA 1LEBA 3QPHA 5IT3A 3N05A 2JA7J 3TMOA 1QZZA 2IS4A 2IXSA 1IJWC 1IRXA 3HXLA 1FSEA 3HUGB 5F1RA 3R6SA 2VBXA 3HC7A 1XGMA 2QQBA 2EQRA 1IC8A 5ILUA 2OD5A 2QBYB 4UVCA 5TGTA 3UR3C 3RKXA 3A0HC 1SFUA 1Z9CA 1SFEA 2M0CA 2A05A 1V4RA 1LKXA 2HGCA 1LVAA 1OYIA 1BW5A 3A02A 3CDIA 2M45A 2EV6A 5D6FA 2DMNA 4EJTA 3WG7H 5DCMB 3E5XA 4IF4A 2O61A 2VQHA 2LP0A 3FMSA 2HWVA 5J1RA 4F93B 2V1DA 3FK7A 4II3A 3S8PA 2O03A 1O4XA 2ZXWH 2Z99A 4RMNA 4A6EA 3HTSB 5FLXZ 3LSKA 1ON1A 3OR1C 5DYMA 3ZOBA 2E5ZA 3HEFA 2CU7A 3PM1A 3OOPA 4ITVA 3PSFA 3N4MA 3P9CA 1YJWI 4DYQA 4NC8A 3QRFF 3BR1A 3S2HJ 3SHFA 5CQEA 4MGRA 1S9HA 1YE9A 1MDMA 2HDDA 4KITB 4XORA 4S04A 2ZCWA 2EPFA 4XKCA 4I76A 3LFUA 2G9WA 2VXZA 3ZQIA 1NK3P 1Z77A 2IS6A 1W5TA 5F04A 3CCLI 4G6DA 1RIOH 3W2VA 4YIFA 2VJ4A 3H36A 3OL3A 3BJOA 4XKBA 2PG4A 3ZMTA 5L3EA 4EM0B 1K6OA 4UV8A 5BQTA 3KP6A 3TL4X 3U1DA 3BG7A 1I1GA 2A6TA 5E1WA 3GZ5A 3VODA 1S8NA 3G2BA 1R6RA 2MW8A 4DW6A 2G0EA 3DWLE 1Z0XA 2DYRH 2OAZA 1R00A 3ZQHA 3B6CA 3IV5A 2X48A 3CP8A 2BE5F 3OYFA 2E60A 4L0YB 2VASA 1H0MA 4ZTFA 2GLOA 2EFOA 2MG4A 1QHHD 4CCLA 3CLOA 2F5VA 2JT1A 3WTZA 3L09A 2K9SA 1W5CC 5F64A 5ILVA 2CW7A 2LBFA 1B4AA 2QQ9A 3BQZA 1ZN2A 1X1CA 3J7AY 2CRGA 4IQ4A 3F8CA 2TRTA 5DTDA 1O3RA 2YU9J 5K7FA 3QP6A 4U88A 2X6OA 3IWZA 1GVJA 5EYRA 1DGWY 3BTLA 4FTHA 1G2HA 3KX2A 2C6YA 2UXNA 2VI6A 1MIJA 2RDPA 3MN2A 1CF7B 3CMAI 2F5EA 5E3LA 1P7JA 2M7BA 2QSFX 1ZGAA 3KZIC 4EM2A 4RM3A 2V9PA 3G6EI 1R4MB 1K79A 1YS6A 1D3YA 3M8EA 4HAMA 3CC2I 1U6GA 2ZMEB 1HDDC 4ENKA 1PUEE 5A2QK 2AS5F 3RKQA 1DGRM 3S1NJ 3LSPA 1TL8A 5B5EC 1TWAJ 2F6CA 3CMMA 2Z1DA 3KP5A 3ZQFA 1ZGWA 4V19K 2P8TA 2YX7A 3CESA 3GMEA 5HS8A 1I27A 1BL0A 4A0YA 2XSJC 3M1CA 3GTQJ 2J5PA 4XLAA 1DU6A 1FMVA 1R7JA 3ISPA 4A93J 2FBKA 5AIQA 1ZARA 5F6FA 3QAHA 1F4KA 4MHGA 1Q1VA 1T98A 4MLOA 3QPTA 5C3EJ 3LAPA 5IYDJ 2HXIA 4PJJA 4BE2A 2PMHA 2JQ7A 1GUUA 1VI0A 5IYCJ 3BT9A 1WH7A 2VL8A 4Q48A 2FU4A 1DP7P 1FSHA 4C2MJ 2JWTA 1ACIA 1QA6A 3CCUI 2WWYA 1RKTA 1QQIA 3K2ZA 3U21A 2KRHA 1ZTRA 2QUFA 2HVQA 4YIIA 1ZR2A 4DZJA 1XSDA 2LY1A 2W84A 1K4SA 5LEKA 2F4OB 3HOYJ 2Y69H 1RKWA 2KRFA 1X1AA 2LNBA 2XGEA 1SFOJ 2EA4A 2XIGA 4ZDLA 2PBIA 1UHSA 1OYWA 4A3GJ 2JN6A 3K4NA 3G3ZA 1OFCX 4XR6A 1ZRDA 5LRSA 2XVCA 4N0BA 4CYCA 4BEHA 1K83J 2K4JA 4YELA 5DD8A 4KFCA 1WJEA 3P9KA 3FMQA 2KISA 1D5YA 5JFRA 3VSKA 4A5MA 2BY0A 2IA0A 2M30A 1IV6A 3CQZJ 5E17F 3GBGA 2XGCA 3HRSA 3VYSB 3OS1A 1YITI 5IT9K 4CCJA 2MYSA 2KL4A 1J7KA 1M1EB 4OWRB 4V2GA 1ZHFA 4EJOA 5BNGA 1E2XA 1TT0A 2E36A 2K4BA 3W3CA 2IGOA 1Z91A 1S7AA 3SEZA 2ME0A 5E8IA 4RS8A 2LY9A 4A6DA 1PP7U 5EGOA 2P7VB 2M9HA 3N97A 3H9QA 2PJRA 3FZVA 3GZNB 4XLNF 4A12A 3M1EA 4PSXA 1A35A 2DA5A 2NS0A 4I02A 2QGUA 3PQKA 4NBQA 1FOYA 2B7EA 3GFLA 3UKGA 3M07A 1LVKA 1FBQA 2LD5A 1HXDA 2GOMA 4OIOF 4ZYGA 4L9VA 3CCYA 2HR3A 4M3BA 2NVYJ 4A3JJ 1W36C 2WY8Q 4P55A 4U0VA 1B72A 4L18B 2O8XA 1FC3A 2R7OA 2VPRA 2ZSIB 2OU2A 1WJAA 2CFOA 2XAHA 1RI7A 4OAZA 2HYJA 4AM3A 3LSJA 5EEGA 1YW8A 3M4OJ 4RB1A 4EGZA 1AOYA 5HLGA 1UMQA 2R5ZB 1GLNA 3QQAA 4MEYF 2WV1A 2ZJRF 3E6CC 1UG0A 3V7RA 1PDNC 5DM6F 1ZLKA 2RGVA 1YW9A 3HZJA 3IWFA 4ZC3A 4CCNA 3KLOA 1QU3A 1F43A 3IP4B 3RYRA 4M74A 2BVLA 4IKFA 3EQLF 2WADA 2DFHA 4LLLA 4Q5SF 2XSDC 3RIRA 4C3IJ 2CSOA 4HLXA 3OYGA 2UZKA 2G7UA 5H6RA 5CKTA 1RNLA 1T8IA 3MAJA 2HOEA 4HEA2 1U2WA 2R7XA 3HOUJ 5JVTA 4E6KG 5LHGA 3QYBA 4DGWB 2DK5A 2DA7A 2L7MP 5GPCA 3U2RA 4A3BJ 1MD0A 4KJZA 2VJJA 4NUBA 2L7ZA 2OA4A 2XAGA 3BTJA 3I0TA 4BAYA 4KICA 3F72A 2DAOA 4G7HF 2O6GE 3NAUA 4CDGA 1WJFA 1YOVB 4BJTA 1JT0A 2KKOA 2ZBKA 2R5YA 5TJJA 1G8XA 4NNJA 2H8RA 2X4HA 2LDUA 5GTIC 2VBWA 4HF0A 4LB6B 1VF9A 5ICFA 2R7SA 3S17J 1QPIA 3Q0VA 3O6BB 1XN7A 1W5SA 2JK3A 2IA1A 1TQPA 3P9IA 4LMYA 3SDBA 3HHHA 4UUSB 4IRIA 3TQNA 4BS9A 1ZR4A 3KYDB 5FLXK 1G3TA 4WWCA 1YHQI 5H2FC 3WHCA 4HNTA 2EINH 1LE8B 3CDHA 5IP6A 2EFPA 1G3SA 2HU9A 2UXXA 2QKMB 4XLEA 1EF4A 1FP2A 1ETKA 2BXYA 4IOCF 5BPDA 3OYNA 4UV9A 2EB7A 4BH9A 5FGMA 5FKNA 5D5VB 3KP3A 1XDSA 5DD4A 2E2IJ 2QBYA 1Z05A 2MFZA 4PJNA 4XSZF 5IOYA 4FX0A 1YI2I 3OYCA 4G7OF 2HZDA 4KIBA 3DKYA 4ZZDA 5K7HA 1A36A 3OYDA 3GUDA 1X2NA 3GWZA 3K70C 2R7ZJ 4S0HB 3BR3A 1JI8A 4M71A 1RZ4A 4D5CA 4JX5A 5EG0B 3KP2A 3Q0UA 5E1XA 3KLNA 1X58A 3KPHA 1AHDP 4YEJA 2M7AA 2OZUA 5GTHC 4CICA 3OR2C 3V8KA 2VKHA 4P5OA 3HPGA 4HX8A 4GYGA 3TP3A 1OPCA 1KQ8A 3CO7C 1YFHA 1WI9A 4PFPA 2ELHA 4G6QA 1Z3YA 4BE1A 4BQAA 2R0QC 4Q47A 3AG2H 3TOAA 2ZXJA 5EZHA 1H89C 2JTVA 4OMZA 4MNUA 5M5WJ 5LHHA 3G4SI 2CH0A 4AIKA 3H5RA 1Y1WJ 3ZCOA 3RKWA 2E1CA 2AQFA 2WAEA 2VUMJ 3MCZA 4LIVA 2OPTA 4BXXJ 3L00A 3ZQ7A 5HNFA 1ZLJA 4WF2A 3QPLA 4RA2A 1B8IB 2GA1A 2ZXIA 4UVBA 3F22A 4C30A 1HW1A 5C4XJ 4UNOA 3HKZN 2CGPA 3C3WA 2EWNA 2JA6J 3LNQA 1FNNA 5E1ZB 2TDXA 2VN2A 4DOZA 5JI6A 1IUFA 4I09A 2M87A 3VYTB 1VQMI 3SZTA 2Y9YA 2VLAA 1FBSA 1VQ6I 1SVOA 3K9TA 2KQRA 5D4RA 3IUOA 1E17A 1R71A 3I59B 4FETA 3C2GA 5E79C 5J6XA 2E7XA 2XPVA 5JR3A 1IDZA 4U7BA 4A3CJ 2EZKA 4HOBA 4DIQA 2JRTA 2GIZA 3HOZJ 1R1VA 3KCCA 1EH7A 1TWFJ 3HOSA 2W7NA 1HSJA 2CQXA 3A01A 1SFXA 3LSGA 2FOWA 1WVRA 4LG0B 1YO5C 1QZEA 3MEXA 4DYCA 2VB6A 1CF7A 2F4IA 1P2FA 2MC3A 3OSGA 1FLIA 3KZYA 2CUJA 1ETXA 1USTA 5L3BA 2PJPA 1BJAA 2DMTA 4A3EJ 4MQ9F 1YLFA 3RPUA 2ZMEA 2R7WA 1A6IA 2VC1A 2FNPA 3FXRA 1I6HJ 1R4NB 1QHGA 1LJ9A 2I8DA 2V7FA 1HC8A 2XPWA 4ABZA 2L7FP 1LDJA 2FXAA 2RNJA 1BIAA 3KEOA 1KZHA 4QPQA 4KUMA 3TO6A 3PQJA 3WGHA 3G1LA 1IN5A 1U0JA 3D1NI 4PDKA 2GXGA 5GADJ 5EF6A 4HX7A 2M4KA 5FKMA 2MGQA 4BJ5C 1SVLA 3BR6A 5CVRA 4QTRA 3JRDA 3CCQI 4X0GA 1WSUA 3BPVA 4R8HA 3D5RC 3WTXC 2H6CA 4HF2A 4IRGA 1QBJA 2NAZA 1HDPA 1OCRH 3J81K 3ZPLA 2LF8A 3GLLA 1S6LA 2V9KA 3IAM2 5J47A 4MFEA 1T0FC 2QM3A 3CMYA 4B43A 3QU3A 2EV0A 5LD2C 5D5UB 4EATA 4A3IJ 5JVGF 2WB1A 2DT6A 3ECOA 1YJ9I 2FQ4A 3S3OA 3L1PA 2GOXB 5KVRA 4GXOA 3CLQA 2HOTA 1STZA 1UG2A 3DP7A 3GFMA 4Y15A 4F55A 3KETA 3QOPA 1ZH5A 3MZ8A 1ITYA 5L3DA 3H92A 3ZRGA 1GXQA 2O3FA 3H3ZA 1LB2A 1WJ5A 2QVOA 2JSPA 2P5VA 1N77A 2XRLA 3I3LA 4E70A 1BR1A 2E1NA 2FD5A 3VDXA 1OR7A 4UB6C 3MKZA 3S1MJ 4G8XA 3PO3J 2E1MB 5F0CA 2AO9A 3ULQB 4HV6A 4A3KJ 1J0RA 3PJRA 4AUXA 1LDKB 3QOEA 2DBBA 1SAXA 3OS2A 2VQGA 3WTUC 2DA4A 2ICWG 5GPAA 2VE8A 2DPDA 1D1BA 3ZMDA 2Y9ZA 4FE7A 1XGSA 3EYYA 5DV5A 4AD9A 1A31A 3VPRA 3BG6A 1R1TA 3JRHA 2XPUA 1D0ZA 3HBLA 1RUOA 2PMZA 3TOBA 3ZQLA 2VPLA 1A04A 1X19A 2QA4I 3OY9A 4HNVA 4HLYA 1NTCA 2QWWA 2BHYA 4KN4X 3GYHX 1R36A 3QYEA 2LR8A 1IUYA 3MKLA 1B9NA 1FJLA 1I5ZA 4C9YA 5GAEJ 2L9SA 3K4BA 2NVTJ 4I01A 3SZGA 3HOXJ 2KPMA 1FIAA 3ABKH 1RR8C 2BYVE 2FQ3A 4GYIA 1HLVA 2H27A 2IVMA 3K1MA 3RPQA 2QSGX 2K27A 3R61A 4OOIA 5GAHJ 3DKWA 3K4LA 2LKSA 2KLOA 3K6GA 1FWZA 1GT0C 3A4CA 2WAQA 3KE2A 3CUQB 2Z16A 1U9NA 4I7HA 2RREA 1F9NA 1O7FA 1ONVA 2MH2A 1VQ4I 2GXAA 3S2DJ 1MBGA 4M6XA 4I2OA 3O8GA 3WU2C 3CJNA 3CCVI 3RKYA 4B48A 2NRAC 3K7AJ 4F7ZA 1XPXA 1FMWA 1V3FA 1TZLA 2VKEA 3K4KA 3KP4A 3VYRB 3VWBA 4A3FJ 1R5HA 4BUPA 3KYCB 3MVPA 4RLFA 4OINF 3FXJA 2WB1N 5DUIA 3DBRB 1OLTA 4HF1A 3SZPA 1L0OC 1X4PA 4S05A 2OTJI 2FBHA 5C44J 3BG5A 4O3MA 1I50J 2K3PA 5D4SA 2DI3A 5ICCA 5K5OA 3UNGC 2E1OA 1RR7A 5KCMA 2LYCA 3HSEA 3R0JA 1MKMA 1XDUA 2XKOA 3HM5A 1R49A 3OMYA 5J3LA 4UUVA 4XN3A 2KZVA 1TW2A 1U8BA 1ETQA 2Q2EA 4XQFA 3H1CA 4EGYA 3V42A 5HVQC 5FKLA 1I6XA 1DQUA 1TNSA 5DDGA 4AIJA 3GFJA 4E7HA 2XGXA 4JX6A 1DDNA 2FEZA 5HDGA 2Z33A 2ECCA 1X4OA 2MC4A 4I0AA 1XS9A 1IAWA 3CC4I 4QLCU 5LBQA 2K5CA 1P6RA 5E18F 3M7GA 1RPWA 4WX9A 3RSNA 3T8RA 2UV1A 4LB5A 4QSHA 4UY8I 4KT5C 2PMZN 2Y0SN 1W0TA 2VC0A 1H8AC 1VQKI 1J09A 3E3VA 1L3LA 1HSTA 3E5UA 3BCBA 2BV6A 2BHZA 4CUGA 1QNTA 2P5KA 1VQLI 1ZAOA 4UUTA 1E3OC 3S93A 1BC7C 1P4AA 3DFGA 2X9DA 4IO9F 1JHHA 2L5QA 4B1RA 2VOOA 1A6QA 3LFKA 2CUZA 3FXQA 1J5YA 3BLYA 4CZZA 2JZYA 1ETYA 3FXLA 3W6JB 4Y13A 2JJ7A 3C18A 3JTGA 2CUEA 1BJZA 4DBQA 1CQTA 4C2UA 3AL0C 1BR2A 3LSTA 4Y52J 3A0BC 3KEYA 3LQQA 2M3AA 3BY6A 3F8NA 3ZQCA 1O3SA 2QKLB 4RDUA 3H3VK 3IAS2 4Y3OA 2DXIA 1B1BA 3SFZA 1NH3A 2X6XA 3HDDA 3IH4A 5K5QA 2H94A 3HRUA 1KU2A 3ABUA 1T56A 1UAAA 2YUSA 1V5FA 1HF0A 1BBYA 2ZSHB 5IY5H 1GV2A 3QYFA 2RQQA 1LEAA 2OTLI 2KIUA 1FOWA 2CYYA 3JSPA 2HTJA 3Q5FA 2XHKA 2VXDA 1BN5A 3C1DA 2LK2A 1D5VA 2DU9A 1U5TA 2XRNA 3F23A 3F8MA 5DS9A 1HCRA 3OYKA 2V1NA 3SQNA 4NB5A 4Z6YA 3CJTB 3HG9A 3PSIA 4YFKF 3PIOF 3S3NA 2DOFA 1V5EA 1K78B 2IS1A 4QWQA 3SEQA 4QIWN 3ESWB 4IVNA 2EFNA 4KDPA 1R1UA 2K3FA 2WBMA 2YU3A 3LMMA 2X51A 2HS5A 2CJJA 3CCRI 1LPQA 3FX3A 4HW0A 2WA0A 2DA6A 3DEEA 3IRRA 1QZYA 3J7YJ 2FX0A 1TT5B 1APLC 4B3AA 2RN7A 1E0EA 1R58A 5L3GA 1IG7A 3DV8A 1MBEA 3I59A 3I58A 5H20A 4M9XA 1OQYA 3BCAA 3HGGA 2A3SA 2VODA 5HNHA 4BKXA 4E7IA 2XGDA 3HGYA 2HQRA 2HPIA 5D5WB 2VJIA 3FXUA 2BEOA 4HZFA 2ZJPF 2LG4A 1D0YA 3HOVJ 3WE2A 3KYLA 2X1DA 5IP7J 2DPUA 3TW7A 2F5CA 2NVQJ 4GGGA 4LG3A 2M0MA 1J59A 1X3WB 1G3WA 1W4MA 2CW8A 3WU0A 1TWHJ 2JA8J 2E2JJ 3OYAA 1P92A 2CQQA 2GBYA 2HOSA 3WODF 2ESNA 1SVMA 3BP8A 2DT7B 3LWFA 2K9MA 2PFBA 2GXBA 3I9V2 3DXJF 1RESA 2PMUA 2KHMA 1F1ZA 1U9OA 3FMRA 3ERED 2PI0A 5EEHA 3I4NJ 1HQCA 4KN7X 3S2WA 1ETVA 1OCZH 5E20A 3FHZA 4ON0A 4IOAF 2M34A 3ZMSA 5FD6A 2MABA 3MKWB 4P1WA 1UJ8A 1MZBA 3HOWJ 3NWSA 3LSHA 1IXRC 3I56I 5JHUA 1BI1A 2R7QA 1IV8A 2P6SA 1UZCA 1YRNB 2EBIA 3BR2A 4IHWA 3QP5A 2W48A 4D7MA 2IJLA 1SD5A 4AYBA 4CZCA 1Y0UA 5KHDA 1C0WA 2EIMH 2A07F 3PFYA 4JQFA 1H9GA 3J80Z 1OCOH 2DFEA 2XAJA 3S32A 1MMNA 1Z7UA 4DNCA 4UHTA 2VOPA 4BHCA 1JKPC 3RCOA 3FXMA 2CV1A 1XGNA 4CCMA 3OV8A 1TWCJ 1JGGA 2P81A 2R93J 2IT0A 4LFUA 4E7JA 2K7LA 1Z67A 3HPHA 4ESFA 3EUHA 3OS0A 4BE0A 1ZGJA 2M8EA 3ECHA 4D9JA 2LLKA 3I71A 1AKHA 1A5JA 2FA5A 1T39A 4QPOA 4XLCA 4EM1A 2A68F 2VT3A 1ZQ3P 5CVJA 1PYVA 3RTRA 4M6YA 2HVSA 2KRCA 2WAFA 1FOKA 2NVXJ 4L0ZB 1S5LC 3JSOA 2F5FA 2YSRA 3JRBA 5HLIA 4EEFG 1ZK8A 4PJLA 2ZXHA 2R7UA 5JLXA 4Q4ZF 2XF6A 1B6AA 5FKOA 3E7LA 1WJDA 1I39A 3OOUA 1KYWA 5DUKA 3EPZA 3LA3A 4ZTJA 4FISA 2HTSA 1OCPA 3FM5A 3KZZA 1GXPA 5HDNA 4RM2A 2IGKA 1Y6IA 3TP0A 5F0FA 2R7VA 3CD6I 3BR5A 5EJCA 4G12A 3DBLB 2KDZA 4ENJA 2XAUA 4AIHA 2OZ6A 3HSRA 3WE3A 3VYUB 3ZMUA 4Y7NJ 4LIUA 5ICEA 2HOAA 2W57A 1JUSA 4JK1X 2EIJH 1QGPA 3ZXSA 3BZCA 3WU1B 3DLLF 1BOAA 2QEXI 3CF5F 3Q9SA 3O8HA 1OCTC 1ZELA 4FCYA 2NYXA 5J1UA 1JTXA 1MBJA 3ROUA 4F91B 2V6EA 2VBZA 2EFQA 3HUGA 3AG1H 4HSTA 1IN4A 1BI3A 1XX5A 2KT0A 1IDYA 2LBFB 1MNDA 4ASNA 4AIDA 1JUPA 1NG6A 1MW7A 1W7PD 4E7ZA 4MO7A 1SMYF 3FIWA 4HRIA 2LH9A 1U5TC 1Y0NA 3WTWC 5DCMA 4DZPA 2JRMA 4HBLA 3RZOJ 5F0HA 4MEXF 3CUQA 2DYSH 2EA2A 2Y48A 4UVAA 1AA7A 4B8XA 2AHQA 4B09A 4DBRA 1YW7A 1SMTA 5DCFA 1F5TA 2B9SA 1HA8A 3CTAA 3NWTA 5AONA 2FMLA 2NS7A 1Z3XA 1DPUA 5FJ8J 2JMWA 2NVUB 3LSIA 1OYYA 3MZHA 1U78A 4F52A 4BDYA 5H6QA 1LDDA 4L9NA 4B44A 3JAMZ 3G73A 3DLAA 2CV0A 2MSYA 1IF1A 1P4WA 3BR0A 2DOAA 4A2UA 5GAGJ 1FBUA 3DF8A 1EV7A 4RB3C 2FJ1A 1Z6RA 1IRFA 2DMUA 3C7JA 2ZC2A 1MMDA 1ZG1A 4XLHA 1MJ9A 4ZYHA 3ELKA 1XSVA 1GDTA 2EZIA 2CFXA 4ZJZA 2EIKH 3ABMH 3FK6A 3CP2A 4IEJA 3AFHA 2K40A 2W24A 3RQIA 1QO0D 1HOMA 2PQ8A 4EQQA 4L5IA 1B9MA 3FHNA 2K9NA 4EV0A 3ABTA 3K10A 4BL0B 4BY7J 4YFNF 3BDDA 2CV2A 2L4MA 3K2AA 2NNYA 1POGA 1ENHA 3NARA 2NOGA 5DM7F 4P9FA 1O57A 2H1LA 4XIDA 1BOBA 3JRFA 3CJRB 4XK4A 2FMYA 1N75A 1P9QC 1WFXA 1XG1A 2QCOA 4U7DA 3TW6A 1MSFC 1MSEC 4M73A 3BC8A 4BQQA 3K4MA 1KA8A 3DTEA 1IRGA 4LD5A 1R5GA 2OBPA 1MJAA 2L9RA 2DW4A 2HPMA 4KIGA 2V1UA 3PIPF 3QODA 5A2QZ 3JREA 5IPAA 2FE3A 4IHXA 2CWEA 2E35A 3DPTA 2MLGA 2O0YA 4IJAA 3RDIA 2ETHA 5ICGA 1T33A 1YIOA 4IPAA 4WXCA 4OMYA 2JSCA 3FBIB 2GZWA 4EJWA 2VQLA 2Z3YA 4MQVA 4LK1F 3D5LA 1ZRFA 1KU9A 4G6TB 2RAEA 4CYCB 3RI4A 3B02A 2STTA 3HOTA 2O7OA 4NQWB 4UB8C 3BTIA 2OCCH 3QWLA 3K4JA 4FHTA 1T2KA 2O8KA 1YTYA 3BQYA 2HVRA 2K9LA 3ZMVA 4W97A 3LSMA 4PJMA 1J2XA 4ZYDA 1J75A 5TRDA 2CQ7A 4KIFA 3SDGA 2I5UA 1TC3C 2A61A 4L5EA 4IQJA 4I0BA 4U87A 3W2WA 2BW3B 2QLZA 1FIPA 2DDBA 3CZ6A 1GHCA 1YQAA 3OL4A 4CA0A 5BPIA 2BVMA 5K7ZA 2IBDA 4KT6A 4Y17A 3R60A 2PJRB 2Z2SB 3HYIA 4GRIA 2M5WA 4CO8A 3OIPA 4BDZA 5LLQA 1S72I 2R7TA 4ESJA 2JUGA 5D6EA 1D8JA 1N78A 1I1SA 1TP4A 2A6EF 4HSRA 5L3CA 5LFAA 2P5LC 2Q1ZB 4BY1J 2UWMA 3TKYA 2RQPA 4CGZA 3O2PE 4KMUX 5F08A 1PJRA 3Q0WA 2OCEA 5K5RA 3GXOA 4M9SA 3IH2A 1TWGJ 3MWMA 4XOPA 2LOOA 2CMPA 2UUZA 4KA4A 3JRIA 1WHUA 3L2RA 4D5FA 3OSFA 4NHJA 2ID6A 2QENA 1N25A 5LEJA 3V8JA 4G7ZF 1T95A 1R22A 5IT9Z 5CQGA 1V55H 4XMYA 1WCMJ 5B1AH 2H6BA 1XD7A 2XASA 5B66C 3T1BA 1OKRA 2GWRA 2V26A 4L5JA 2L0KA 3HRMA 3HL2A 3GCMA 3ASOH 1WI3A 5ILSA 3P7NA 4HG2A 3GTJJ 4HQEA 2DTRA 1D1CA 3Q9VA 2EK5A 1VQPI 5M3MJ 3VB2A 2HI3A 3WGIA 4RAFA 3E5QA 4LGWA 1RRJA 3K69A 3CMEI 1Z21A 3GZ6A 1B59A 2M1BA 1XMKA 4FE4A 5J4YA 1D0XA 1ZG3A 3E6DA 4ZYEA 4ENMA 1SD7A 2E2HJ 3FXKA 4X6AJ 2BXZA 1W0UA 5HDKA 2XAFA 4BACA 3TDZC 3HRTA 4HDUA 2K86A 1HW2A 1UFMA 1V5GA 3L2VA 2FOKA 3H9JA 4A3MJ 4OIQF 2DK8A 1X1PA 4B47A 1MNEA 2DCEA 1YG2A 2E34A 2VIXA 1SEUA 2R5YB 1BM9A 3TBIA 1WZ2A 2CUFA 5EZGA 3ZMZA 1LUJB 3I5UA 4L9JA 4IHVA 3CDLA 9ANTA 1FYMA 1BC8C 3GF2A 4ZYAA 3SXYA 3T8TA 1TLHB 2W85A 5FFZA 3SJMA 4XOTA 1CGPA 4ZH4F 4AWXB 3IL2A 2KFDA 4BQNA 3MMYB 5J1YA 5M3FJ 2DO7A 5M5XJ 2GIVA 1KU3A 1Y1VJ 3CCMI 1K4TA 4M3DA 3PFIA 1XMXA 5AIPA 2LMDA 4O6JA 2R5ZA 5KAIC 1SAUA 2F2EA 5HLTA 3H0GJ 3M9AA 4GO1A 1P7IA 2BY1A 3ZGKA
chains in the Genus database with same CATH topology
2LK2A 1IGNA 3NAUA 5DS9A 2VKVA 2TCTA 3S1RJ 1HCRA 1JT0A 4C3HJ 3JRAA 2R5YA 3QPSA 1ORKA 2H8RA 4QIWN 3HB9A 1JKRC 1MBKA 5E3OA 5EDNA 1VF9A 1X2MA 2CJJA 3DCFA 3S17J 4W1UA 3Q0VA 1QPIA 2DA6A 1QVTA 2E19A 3JRGA 5EGOB 2FX0A 2JK3A 1APLC 2LFBA 4B3AA 1QVUA 3A03A 1IG7A 4UUSB 4MFDA 1MBEA 3PO2J 1ZR4A 2LTPA 3WHCA 4JP0A 2LKXA 3HGGA 1LE8B 5IP6A 1EF4A 2IAIA 4BKXA 4X1EA 2DJNA 1ETKA 2XGDA 3HGYA 1LFBA 1B72B 3S1QJ 2M2EA 3HOVJ 4XRSA 1S7EA 5IP7J 2NVQJ 3TW7A 3S16J 3JRCA 5FKNA 2GM4A 2E2IJ 2N8GA 5E3NA 5IOYA 1TWHJ 2JA8J 2E2JJ 2HOSA 2CQQA 2GBYA 5K7HA 2ELKA 2COBA 1X2NA 2QF7A 2R7ZJ 4S0HB 1WGXA 3BR3A 4UUSA 1RESA 1ETOA 4D5CA 1U9OA 4JX5A 5EG0B 3Q0UA 1X58A 1AHDP 3I4NJ 3W6VA 1ETVA 1AU7A 1LE8A 2M34A 3GTOJ 3TP3A 4NDLA 3HOWJ 1PUFB 3IH3A 1F36A 1GVDA 2R0QC 2DTZA 1AKHB 1FEXA 1YRNB 2EBIA 3BR2A 5EZHA 1H89C 2W48A 4IHWA 4AC0A 5M5WJ 4D7MA 5F27A 2DN0A 1Y1WJ 2DA1A 4A69C 4C3JJ 2VUMJ 2Y2ZA 2OPTA 4BXXJ 1ETWA 2H1KA 2XB5A 3QPLA 1B8IB 1BA5A 3A01B 1MBHA 5EG0A 1JKPC 5JLWA 3GTMJ 2JA5J 5C4XJ 1TWCJ 3WHBA 3SFIA 3HKZN 1JGGA 2P81A 2R93J 2JA6J 3LNQA 3GTLJ 2WAQN 4MIMA 1IUFA 4RBOA 4B4CA 3G1MA 2Y9YA 2EH3A 3GTPJ 3B6AA 1FTZA 2LLKA 1AKHA 1A5JA 1YRNA 2O9LA 4BBSJ 3ZQGA 1ZQ3P 2XPVA 1IDZA 4A3CJ 3BG9A 2EZKA 3HOZJ 4M6VA 5FLVA 2NVXJ 2JA7J 1TWFJ 1IJWC 1B8IA 3JRBA 2CQXA 3BTCA 4EEFG 3A01A 1ZK8A 3LSGA 1JT6A 1VFCA 5JLXA 1VNDA 2EQRA 1IC8A 4DYCA 5FKOA 3E7LA 3OOUA 3OSGA 2B63J 2HQ5A 1P7IA 4FISA 4XRMA 2M0CA 1ETXA 1OCPA 4LOCA 1BW5A 3A02A 2DMTA 3TP0A 5F0FA 4A3EJ 3BR5A 4G12A 2KDZA 2DMNA 3JR9A 4Y7NJ 1A6IA 2LP0A 2HOAA 5J1RA 1JUSA 1JJ8C 1I6HJ 3FK7A 4XICA 1O4XA 2DMPA 2ID3A 1OJLA 3O8HA 2XPWA 1OCTC 2XB0X 3ZOBA 4ABZA 3FKIJ 2EZHA 1JTXA 2L7FP 1MBJA 5J1UA 2ME6A 4FCYA 3HEFA 1IRZA 2CU7A 3PM1A 4DYQA 3BR1A 3S2HJ 4M3GA 2HDDA 2KT0A 3G1LA 1IDYA 1MNMC 4I76A 1JUPA 2Y31A 3D1NI 4XRSG 3ZQIA 1NK3P 1Z77A 4MO7A 5F04A 3FIWA 5EF6A 5FKMA 2MGQA 5FLMJ 3BR6A 4QTRA 3JRDA 4DZPA 3RZOJ 5F0HA 1HDPA 2ECBA 2AHQA 2MW8A 4MFEA 4DW6A 2G0EA 1Z0XA 3ZQHA 3CMYA 2YS9A 3B6CA 3IV5A 5IYBJ 2X48A 3Q3SA 2M8GX 2NS7A 5FJ8J 2JMWA 3BG3A 4A3IJ 1U78A 5E3MA 2GLOA 2FQ4A 2MG4A 5M5YJ 3L1PA 3S15J 2MSYA 1JTYA 4D7NA 2HOTA 3BR0A 2K9SA 1UG2A 5FKKA 3BQZA 4JYKA 2FJ1A 1RETA 1ITYA 2DMUA 2CRGA 2TRTA 5DTDA 1JKQC 2YU9J 5K7FA 1ZKGA 1GDTA 2EZIA 3S14J 2X6OA 2XRLA 1JKOC 2FD5A 3FK6A 4IEJA 2DA3A 2K40A 4M3EA 5EYRA 3BTLA 4FTHA 1H88C 3RQIA 1G2HA 2VI6A 4V2FA 3MN2A 3S1MJ 1HOMA 3PO3J 5F0CA 2AO9A 4GFBA 5E3LA 2K9NA 1P7JA 4A3KJ 3LOCA 4BY7J 4AUXA 3K2AA 1POGA 1ENHA 3NARA 2DA4A 2NOGA 5GPAA 1MBFA 2Y9ZA 4FE7A 4M3FA 4XIDA 3JRFA 4XK4A 1XG1A 3VPRA 2QCOA 1HDDC 3TW6A 1MSFC 1MSEC 3JRHA 2XPUA 3HBLA 3RKQA 3ZQLA 3S1NJ 5IOZA 3LSPA 2L9RA 4HNVA 2ZB9A 1NTCA 1TWAJ 1ZGWA 3ZQFA 3JREA 5IPAA 4IHXA 2LR8A 3MKLA 1T33A 1BL0A 1MH4A 1FJLA 3GTQJ 2IEKA 2K9QA 1DU6A 4A93J 5GP9A 2NVTJ 1Q1VA 1K61A 3HOXJ 4CYCB 1FIAA 2RAEA 1HLVA 3G1OA 2OF7A 4MLOA 5C3EJ 1I3QJ 2O7OA 3BTIA 2HXIA 5IYDJ 2O8KA 1GUUA 3BQYA 1VI0A 5IYCJ 3BT9A 1WH7A 4W97A 1DU0A 2LVSA 1GT0C 4C2MJ 1U9NA 3SDGA 2JWTA 5EEAA 1TC3C 3GTGJ 4L5EA 1RKTA 3S2DJ 1MBGA 3M3YJ 1LFUP 1ZTRA 1FIPA 1ZR2A 4DZJA 3O8GA 1SANA 5K7ZA 1BW6A 2IBDA 3HOYJ 3K7AJ 3LSRA 1RKWA 2XGEA 1SFOJ 1MH3A 2VKEA 4A3FJ 1R9TJ 1UHSA 3MVPA 4A3GJ 2JN6A 2HXOA 1OFCX 2DMQA 2WB1N 4CYCA 2I10A 1K83J 5C44J 3BG5A 5HODA 1I50J 4AYBN 1D5YA 4BY1J 2E1OA 1IV6A 1RR7A 3CQZJ 4I6ZA 3GBGA 2XGCA 5F08A 3Q0WA 3IH2A 1TWGJ 3HM5A 3JRIA 3RZDJ 4V2GA 4D5FA 5BNGA 3OSFA 5J3LA 2ID6A 1U8BA 3C2BA 1ETQA 2EZLA 1WCMJ 2ME0A 2LY9A 5FKLA 5EGOA 2M9HA 1QRYA 4JX6A 2L0KA 2ECCA 1XS9A 2DA5A 1WI3A 2R92J 1RPWA 3GTJJ 3UKGA 2LD5A 3DEWA 5M3MJ 2HI3A 1WH5A 4M3BA 3CCYA 4QSHA 2NVYJ 4A3JJ 2PMZN 2Y0SN 4FE4A 3F0CA 1W0TA 1H8AC 1B72A 2DA2A 2E2HJ 2NS8A 4A3DJ 2VPRA 2HYJA 3FISA 3LSJA 4X6AJ 1W0UA 3M4OJ 1NK2P 1UMQA 2R5ZB 4UUTA 1E3OC 1JUMA 3TEDA 3QQAA 2WV1A 2X9DA 4A3MJ 4B1RA 1FTTA 2R5YB 1ETYA 1XC5A 1F43A 2JJ7A 4JX4A 1WPKA 2CUEA 2CUFA 1BJZA 5EZGA 1CQTA 4Y52J 4IHVA 2XSDC 3CDLA 1JJ6C 9ANTA 3ZQCA 4C3IJ 4RDUA 3H3VK 3GTKJ 1PUFA 2D5VA 3SJMA 4BBRJ 5IP9J 3I4MJ 3HDDA 3IH4A 3HOUJ 5J1YA 5M3FJ 1T56A 5M5XJ 2YUSA 1GV5A 1Y1VJ 2DA7A 4M3DA 1HF0A 4A3LJ 4J19A 1GV2A 2L7MP 5GPCA 4A3BJ 2R5ZA 5F1JA 4IHYA 2L7ZA 3H0GJ 4DYRA 5C4JJ 3BTJA 2Y30A 3OIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK2 A;  1IGN A;  3NAU A;  5DS9 A;  2VKV A;  2TCT A;  3S1R J;  1HCR A;  1JT0 A;  4C3H J;  3JRA A;  2R5Y A;  3QPS A;  1ORK A;  2H8R A;  4QIW N;  3HB9 A;  1JKR C;  1MBK A;  5E3O A;  5EDN A;  1VF9 A;  1X2M A;  2CJJ A;  3DCF A;  3S17 J;  4W1U A;  3Q0V A;  1QPI A;  2DA6 A;  1QVT A;  2E19 A;  3JRG A;  5EGO B;  2FX0 A;  2JK3 A;  1APL C;  2LFB A;  4B3A A;  1QVU A;  3A03 A;  1IG7 A;  4UUS B;  4MFD A;  1MBE A;  3PO2 J;  1ZR4 A;  2LTP A;  3WHC A;  4JP0 A;  2LKX A;  3HGG A;  1LE8 B;  5IP6 A;  1EF4 A;  2IAI A;  4BKX A;  4X1E A;  2DJN A;  1ETK A;  2XGD A;  3HGY A;  1LFB A;  1B72 B;  3S1Q J;  2M2E A;  3HOV J;  4XRS A;  1S7E A;  5IP7 J;  2NVQ J;  3TW7 A;  3S16 J;  3JRC A;  5FKN A;  2GM4 A;  2E2I J;  2N8G A;  5E3N A;  5IOY A;  1TWH J;  2JA8 J;  2E2J J;  2HOS A;  2CQQ A;  2GBY A;  5K7H A;  2ELK A;  2COB A;  1X2N A;  2QF7 A;  2R7Z J;  4S0H B;  1WGX A;  3BR3 A;  4UUS A;  1RES A;  1ETO A;  4D5C A;  1U9O A;  4JX5 A;  5EG0 B;  3Q0U A;  1X58 A;  1AHD P;  3I4N J;  3W6V A;  1ETV A;  1AU7 A;  1LE8 A;  2M34 A;  3GTO J;  3TP3 A;  4NDL A;  3HOW J;  1PUF B;  3IH3 A;  1F36 A;  1GVD A;  2R0Q C;  2DTZ A;  1AKH B;  1FEX A;  1YRN B;  2EBI A;  3BR2 A;  5EZH A;  1H89 C;  2W48 A;  4IHW A;  4AC0 A;  5M5W J;  4D7M A;  5F27 A;  2DN0 A;  1Y1W J;  2DA1 A;  4A69 C;  4C3J J;  2VUM J;  2Y2Z A;  2OPT A;  4BXX J;  1ETW A;  2H1K A;  2XB5 A;  3QPL A;  1B8I B;  1BA5 A;  3A01 B;  1MBH A;  5EG0 A;  1JKP C;  5JLW A;  3GTM J;  2JA5 J;  5C4X J;  1TWC J;  3WHB A;  3SFI A;  3HKZ N;  1JGG A;  2P81 A;  2R93 J;  2JA6 J;  3LNQ A;  3GTL J;  2WAQ N;  4MIM A;  1IUF A;  4RBO A;  4B4C A;  3G1M A;  2Y9Y A;  2EH3 A;  3GTP J;  3B6A A;  1FTZ A;  2LLK A;  1AKH A;  1A5J A;  1YRN A;  2O9L A;  4BBS J;  3ZQG A;  1ZQ3 P;  2XPV A;  1IDZ A;  4A3C J;  3BG9 A;  2EZK A;  3HOZ J;  4M6V A;  5FLV A;  2NVX J;  2JA7 J;  1TWF J;  1IJW C;  1B8I A;  3JRB A;  2CQX A;  3BTC A;  4EEF G;  3A01 A;  1ZK8 A;  3LSG A;  1JT6 A;  1VFC A;  5JLX A;  1VND A;  2EQR A;  1IC8 A;  4DYC A;  5FKO A;  3E7L A;  3OOU A;  3OSG A;  2B63 J;  2HQ5 A;  1P7I A;  4FIS A;  4XRM A;  2M0C A;  1ETX A;  1OCP A;  4LOC A;  1BW5 A;  3A02 A;  2DMT A;  3TP0 A;  5F0F A;  4A3E J;  3BR5 A;  4G12 A;  2KDZ A;  2DMN A;  3JR9 A;  4Y7N J;  1A6I A;  2LP0 A;  2HOA A;  5J1R A;  1JUS A;  1JJ8 C;  1I6H J;  3FK7 A;  4XIC A;  1O4X A;  2DMP A;  2ID3 A;  1OJL A;  3O8H A;  2XPW A;  1OCT C;  2XB0 X;  3ZOB A;  4ABZ A;  3FKI J;  2EZH A;  1JTX A;  2L7F P;  1MBJ A;  5J1U A;  2ME6 A;  4FCY A;  3HEF A;  1IRZ A;  2CU7 A;  3PM1 A;  4DYQ A;  3BR1 A;  3S2H J;  4M3G A;  2HDD A;  2KT0 A;  3G1L A;  1IDY A;  1MNM C;  4I76 A;  1JUP A;  2Y31 A;  3D1N I;  4XRS G;  3ZQI A;  1NK3 P;  1Z77 A;  4MO7 A;  5F04 A;  3FIW A;  5EF6 A;  5FKM A;  2MGQ A;  5FLM J;  3BR6 A;  4QTR A;  3JRD A;  4DZP A;  3RZO J;  5F0H A;  1HDP A;  2ECB A;  2AHQ A;  2MW8 A;  4MFE A;  4DW6 A;  2G0E A;  1Z0X A;  3ZQH A;  3CMY A;  2YS9 A;  3B6C A;  3IV5 A;  5IYB J;  2X48 A;  3Q3S A;  2M8G X;  2NS7 A;  5FJ8 J;  2JMW A;  3BG3 A;  4A3I J;  1U78 A;  5E3M A;  2GLO A;  2FQ4 A;  2MG4 A;  5M5Y J;  3L1P A;  3S15 J;  2MSY A;  1JTY A;  4D7N A;  2HOT A;  3BR0 A;  2K9S A;  1UG2 A;  5FKK A;  3BQZ A;  4JYK A;  2FJ1 A;  1RET A;  1ITY A;  2DMU A;  2CRG A;  2TRT A;  5DTD A;  1JKQ C;  2YU9 J;  5K7F A;  1ZKG A;  1GDT A;  2EZI A;  3S14 J;  2X6O A;  2XRL A;  1JKO C;  2FD5 A;  3FK6 A;  4IEJ A;  2DA3 A;  2K40 A;  4M3E A;  5EYR A;  3BTL A;  4FTH A;  1H88 C;  3RQI A;  1G2H A;  2VI6 A;  4V2F A;  3MN2 A;  3S1M J;  1HOM A;  3PO3 J;  5F0C A;  2AO9 A;  4GFB A;  5E3L A;  2K9N A;  1P7J A;  4A3K J;  3LOC A;  4BY7 J;  4AUX A;  3K2A A;  1POG A;  1ENH A;  3NAR A;  2DA4 A;  2NOG A;  5GPA A;  1MBF A;  2Y9Z A;  4FE7 A;  4M3F A;  4XID A;  3JRF A;  4XK4 A;  1XG1 A;  3VPR A;  2QCO A;  1HDD C;  3TW6 A;  1MSF C;  1MSE C;  3JRH A;  2XPU A;  3HBL A;  3RKQ A;  3ZQL A;  3S1N J;  5IOZ A;  3LSP A;  2L9R A;  4HNV A;  2ZB9 A;  1NTC A;  1TWA J;  1ZGW A;  3ZQF A;  3JRE A;  5IPA A;  4IHX A;  2LR8 A;  3MKL A;  1T33 A;  1BL0 A;  1MH4 A;  1FJL A;  3GTQ J;  2IEK A;  2K9Q A;  1DU6 A;  4A93 J;  5GP9 A;  2NVT J;  1Q1V A;  1K61 A;  3HOX J;  4CYC B;  1FIA A;  2RAE A;  1HLV A;  3G1O A;  2OF7 A;  4MLO A;  5C3E J;  1I3Q J;  2O7O A;  3BTI A;  2HXI A;  5IYD J;  2O8K A;  1GUU A;  3BQY A;  1VI0 A;  5IYC J;  3BT9 A;  1WH7 A;  4W97 A;  1DU0 A;  2LVS A;  1GT0 C;  4C2M J;  1U9N A;  3SDG A;  2JWT A;  5EEA A;  1TC3 C;  3GTG J;  4L5E A;  1RKT A;  3S2D J;  1MBG A;  3M3Y J;  1LFU P;  1ZTR A;  1FIP A;  1ZR2 A;  4DZJ A;  3O8G A;  1SAN A;  5K7Z A;  1BW6 A;  2IBD A;  3HOY J;  3K7A J;  3LSR A;  1RKW A;  2XGE A;  1SFO J;  1MH3 A;  2VKE A;  4A3F J;  1R9T J;  1UHS A;  3MVP A;  4A3G J;  2JN6 A;  2HXO A;  1OFC X;  2DMQ A;  2WB1 N;  4CYC A;  2I10 A;  1K83 J;  5C44 J;  3BG5 A;  5HOD A;  1I50 J;  4AYB N;  1D5Y A;  4BY1 J;  2E1O A;  1IV6 A;  1RR7 A;  3CQZ J;  4I6Z A;  3GBG A;  2XGC A;  5F08 A;  3Q0W A;  3IH2 A;  1TWG J;  3HM5 A;  3JRI A;  3RZD J;  4V2G A;  4D5F A;  5BNG A;  3OSF A;  5J3L A;  2ID6 A;  1U8B A;  3C2B A;  1ETQ A;  2EZL A;  1WCM J;  2ME0 A;  2LY9 A;  5FKL A;  5EGO A;  2M9H A;  1QRY A;  4JX6 A;  2L0K A;  2ECC A;  1XS9 A;  2DA5 A;  1WI3 A;  2R92 J;  1RPW A;  3GTJ J;  3UKG A;  2LD5 A;  3DEW A;  5M3M J;  2HI3 A;  1WH5 A;  4M3B A;  3CCY A;  4QSH A;  2NVY J;  4A3J J;  2PMZ N;  2Y0S N;  4FE4 A;  3F0C A;  1W0T A;  1H8A C;  1B72 A;  2DA2 A;  2E2H J;  2NS8 A;  4A3D J;  2VPR A;  2HYJ A;  3FIS A;  3LSJ A;  4X6A J;  1W0U A;  3M4O J;  1NK2 P;  1UMQ A;  2R5Z B;  4UUT A;  1E3O C;  1JUM A;  3TED A;  3QQA A;  2WV1 A;  2X9D A;  4A3M J;  4B1R A;  1FTT A;  2R5Y B;  1ETY A;  1XC5 A;  1F43 A;  2JJ7 A;  4JX4 A;  1WPK A;  2CUE A;  2CUF A;  1BJZ A;  5EZG A;  1CQT A;  4Y52 J;  4IHV A;  2XSD C;  3CDL A;  1JJ6 C;  9ANT A;  3ZQC A;  4C3I J;  4RDU A;  3H3V K;  3GTK J;  1PUF A;  2D5V A;  3SJM A;  4BBR J;  5IP9 J;  3I4M J;  3HDD A;  3IH4 A;  3HOU J;  5J1Y A;  5M3F J;  1T56 A;  5M5X J;  2YUS A;  1GV5 A;  1Y1V J;  2DA7 A;  4M3D A;  1HF0 A;  4A3L J;  4J19 A;  1GV2 A;  2L7M P;  5GPC A;  4A3B J;  2R5Z A;  5F1J A;  4IHY A;  2L7Z A;  3H0G J;  4DYR A;  5C4J J;  3BTJ A;  2Y30 A;  3OIO A; 
#chains in the Genus database with same CATH topology
 2F4M B;  4J01 A;  4KIS A;  1W36 D;  3V7C A;  2BBY A;  3HIF A;  4HQM A;  1IGN A;  3CCE I;  2VKV A;  2TCT A;  4OU0 A;  4XRF A;  2JA2 A;  4CHU A;  3PNY A;  3QPS A;  3D0S A;  3FWE A;  1ORK A;  4XN0 A;  2KIM A;  3FBN B;  3H35 A;  3OYI A;  1E3P A;  3V4G A;  1JKR C;  1MBK A;  5E3O A;  2D45 A;  1KQ9 A;  3HHG A;  2R4G A;  3F6O A;  3GO5 A;  3VOE A;  5EDN A;  4Y33 A;  1SD6 A;  3DCF A;  3W2A A;  2FBI A;  1OCC H;  4IX7 A;  2E19 A;  3JRG A;  3F8F A;  3AAF A;  3F8B A;  1S7O A;  2QSH X;  2W1O A;  1ZG5 A;  1RUN A;  3C2H A;  1IN7 A;  3A03 A;  4XM3 A;  2B0L A;  3DPU A;  3X2Q H;  3NRV A;  4C2T A;  1FT9 A;  3COA C;  3WG9 A;  1EH6 A;  3SYT A;  4NC6 A;  2W00 A;  4JP0 A;  2GA2 A;  2G7H A;  4EVI A;  1W7P B;  3E0J B;  2L54 A;  1LNW A;  5FRM A;  1G3Y A;  2YPR A;  2VT2 A;  2M2E A;  2BZT A;  4XRS A;  4ANJ A;  2P0W A;  5FO5 A;  3S16 J;  2F5D A;  4I98 B;  2L7K A;  4NC7 A;  2GM4 A;  2V1X A;  2ZKZ A;  1E3H A;  2ZFW A;  2QYO A;  1FY7 A;  2HQN A;  3IC7 A;  5BMZ A;  2IP2 A;  3MKY B;  2K85 A;  5CLS A;  4PZJ A;  4WCG A;  2NNN A;  1FPQ A;  4E7S A;  2OJE D;  2ELK A;  2COB A;  3MD2 A;  4UUS A;  4LLN A;  1WKM A;  3ONQ A;  2QQ8 A;  2ZME C;  3W6V A;  3L2U A;  2XF5 A;  4PUS A;  5L3F A;  5K1Y A;  1AU7 A;  1LE8 A;  5B3S H;  3JAM K;  4NDL A;  1PUF B;  3H3U A;  3IH3 A;  2E7W A;  4BYY A;  4XNF A;  1WRJ A;  3U9G A;  2X6W A;  4Z2Y A;  2DTZ A;  4AU7 A;  4F3Q A;  1FEX A;  5HS9 A;  2DFI A;  1TQM A;  2EIL H;  5F27 A;  2DN0 A;  1SC7 A;  2DA1 A;  4C3J J;  3BRO A;  2VKD A;  4XKV A;  4CH7 A;  2XV4 S;  2BY2 A;  1JGS A;  1ETW A;  4D1Q A;  3HJE A;  2R7R A;  1TTY A;  2OQR A;  2XB5 A;  2H1K A;  1BA5 A;  1XSX A;  3A01 B;  3LA7 A;  1G4D A;  1YX3 A;  5EG0 A;  4RGU A;  5JLW A;  2X85 A;  2X1C A;  3GTM J;  4ZZL A;  3M8J A;  3WHB A;  2VBY A;  3SFI A;  1VQ8 I;  1X3Z B;  4K2E A;  1TBX A;  2DQR A;  2PX9 A;  2HZT A;  3RQ4 A;  5FRN A;  3GTL J;  2WAQ N;  3DTK A;  4MIM A;  2MH9 A;  4D0P A;  4CXF A;  4XLP F;  2AXT C;  3GEZ A;  3GVA A;  4LLG F;  4B4C A;  3G1M A;  4PCQ A;  3I64 A;  3KFW X;  2LRD A;  4JOM A;  3K70 D;  4FQG A;  5CPR B;  4YIR X;  2IGN A;  2MD0 A;  1Y8R B;  2P4W A;  2IGM A;  1HW5 A;  1S3J A;  2Y0M A;  3ZQG A;  3LL7 A;  2KMU A;  3DU5 A;  4HA8 A;  3KP7 A;  3BG9 A;  3RJP A;  2VQC A;  4M6V A;  2E71 A;  2IPQ X;  5FLV A;  4U0W A;  3F21 A;  3J7Z I;  2DOE A;  4KYW A;  3EET A;  3S3M A;  3EUA A;  1B8I A;  3U1K A;  3BTC A;  3WTY C;  1DPR A;  3DPL C;  1LQ1 A;  1JT6 A;  1VFC A;  1MMS A;  1OR7 C;  1VND A;  4N9I A;  5J4V A;  2DDA A;  1U8R A;  3IRQ A;  2YR2 A;  3I55 I;  5JHF A;  2B63 J;  4FAS D;  2IS2 A;  2HQ5 A;  4A0X A;  2A5W A;  4XRM A;  2RVC A;  2WV0 A;  4LOC A;  1W1W E;  4A0Z A;  4DQ2 A;  1Z1D A;  2F48 A;  2FF4 A;  2RNG A;  3TO9 A;  3I4P A;  3MQ0 A;  3WTV C;  1K7A A;  2WC2 A;  3JR9 A;  5J40 A;  1UCR A;  3K1P A;  4BJ6 C;  3AL0 B;  4PGH A;  2V4J C;  1JJ8 C;  1UB9 A;  4XIC A;  2XAQ A;  2VON A;  1EKE A;  3CC7 I;  2DMP A;  4ESB A;  1SFK A;  2ID3 A;  1OJL A;  2XB0 X;  3O3K A;  3FKI J;  2EZH A;  1MJB A;  3E6M A;  3IKV A;  2ME6 A;  3TDU C;  2ACJ A;  1IRZ A;  1ERD A;  3DEU A;  1ZYR F;  2FUG 2;  2HKX A;  4LG0 A;  1FOX A;  4M3G A;  1IXC A;  1X3U A;  2QZ8 A;  3F3X A;  2IRF G;  3LA2 A;  3D5S C;  1FYK A;  1VQ7 I;  1R23 A;  5CYV A;  1ZRC A;  1MNM C;  2K02 A;  2Y31 A;  4XRS G;  1Y8Q B;  1NHA A;  1MMG A;  3A2K A;  1IZ1 A;  1V54 H;  2ELJ A;  3L2C A;  4NQW A;  4RB2 C;  1ODD A;  1FP1 D;  3DU6 A;  1Y39 A;  3EDP A;  5FLM J;  3K4C A;  2DT5 A;  1D1A A;  3J7A O;  1VZ0 A;  1FX7 A;  4IXA A;  3K0L A;  2JUC A;  2ECB A;  4DJA A;  5TIS C;  1IN8 A;  2BW3 A;  2BOL A;  2CS3 A;  2HDW A;  5CJ9 A;  2YS9 A;  5E8G A;  5D8K B;  2J5O A;  5IYB J;  1BR4 A;  3J81 Z;  2X0L A;  3DBH B;  3Q3S A;  2M8G X;  2D1H A;  4FT8 A;  1LFP A;  3BG3 A;  5LHI A;  2CO5 A;  5E3M A;  3ZN0 A;  1X1B A;  1Z7L A;  5M5Y J;  3S15 J;  1VQ5 I;  4PGG A;  4RAG A;  1G59 A;  4O5V A;  1JTY A;  4D7N A;  1HKQ A;  4YRV A;  5FKK A;  4JYK A;  2HYG D;  1RET A;  1Z6T A;  1O3Q A;  2LC2 A;  2H8W A;  2A5Y B;  1JKQ C;  1ZKG A;  4II2 A;  3S14 J;  3DTI A;  2W82 A;  1T6S A;  3MFK A;  1JKO C;  1UHW A;  3KIO A;  4KNY A;  4E7K A;  2DA3 A;  2ZJ2 A;  2PLY A;  4M3E A;  2EJR A;  1H88 C;  3DQV C;  5BOX A;  4V2F A;  3P5J A;  4IZZ A;  4OAY A;  1D8K A;  1SD4 A;  2MA3 A;  1MGT A;  1XTA A;  2YX4 A;  4N4O B;  4HX4 A;  2Y75 A;  4LJZ F;  4GFB A;  3GX4 X;  2NXN B;  3LOC A;  1PVE A;  2Q8K A;  1VTN C;  2HEO A;  2H09 A;  1MBF A;  2D2W A;  2ZNZ A;  3BZK A;  3FM3 A;  4M3F A;  3H0D A;  4BHB A;  5J8F A;  4HNU A;  3EUK L;  5FRO A;  5CVU A;  5IOZ A;  3AG4 H;  1XB4 A;  2V79 A;  2ZB9 A;  4XON A;  3CCJ I;  4EJV A;  3T0Y A;  1TW3 A;  1HKT A;  3L7W A;  4UXN A;  3HTU A;  1MH4 A;  4XKW A;  2PEX A;  2JPB A;  1XCV A;  3OIQ A;  2IEK A;  1MDM B;  2K9Q A;  1H9T A;  2LY2 A;  5GP9 A;  3E6B A;  1R5I D;  3GFI A;  2Q0O A;  1K61 A;  2BY3 A;  3CCS I;  2RC4 A;  3G1O A;  2OF7 A;  3ZP5 A;  3FF5 A;  2LSO A;  1I3Q J;  3CO6 C;  1ULY A;  2W4S A;  1EH8 A;  3H9G A;  3OYJ A;  2ISY A;  3HKZ A;  1KYZ A;  5D8L B;  2DLL A;  2XC7 A;  2L3D A;  1DU0 A;  1YS7 A;  2LVS A;  3OYH A;  4KMF A;  5EEA A;  4PK4 A;  2DQL A;  4XL9 A;  1Q1H A;  3GTG J;  3ML6 A;  1T0F A;  2HQA A;  5KNL A;  3CJQ B;  4BQO A;  4P9U A;  3M3Y J;  1EA3 A;  2Q2E B;  3PNT A;  2DFF A;  4BXF A;  1LFU P;  3BWG A;  1HBX G;  4CCK A;  1G6N A;  1OMI A;  2ZNY A;  1MMA A;  1SAN A;  4ZDO A;  3FDY A;  4RLQ A;  1BW6 A;  3BJA A;  4EMS A;  4AVZ A;  5DEQ A;  5LRR A;  3WTS C;  3LSR A;  3JW4 A;  1MH3 A;  2KZG A;  1BI0 A;  1J9I A;  2JVH A;  4B3X A;  1R9T J;  2HXO A;  2DMQ A;  5HS7 A;  4R79 A;  3ABL H;  3GW2 A;  2I10 A;  1DP3 A;  1IO2 A;  2JVG A;  2MD5 A;  1WJB A;  5HOD A;  4ZDP A;  4AYB N;  1BIB A;  5KAF C;  3L2Q A;  2KJB A;  1T38 A;  1KON A;  2HYF A;  4I6Z A;  1XCB A;  1OIS A;  3PNV A;  3FXO A;  4M9Z A;  3G71 I;  3OYE A;  3RZD J;  2FNA A;  4R1H A;  1WQ2 A;  1O7L A;  4BGD A;  5CVV A;  3C2B A;  2D1V A;  5B1B H;  3OYM A;  2EZL A;  4OIP F;  4RAZ A;  2V9V A;  3ERM A;  5FFX A;  3ZQQ A;  5HOO A;  2LRE A;  1JHF A;  3PL8 A;  4CYD A;  4N9H A;  4E4H A;  2A69 F;  1QRY A;  2PN6 A;  3ZR8 X;  2RKH A;  4F92 B;  2MLK A;  2L9V A;  6PAX A;  1XMA A;  2M4G A;  4IRH A;  2O5R A;  3H5N A;  4P96 A;  4J00 A;  2R92 J;  2VE9 A;  3BPX A;  1W7P A;  3DEW A;  1KQ0 A;  4I99 C;  1IN6 A;  4WXH A;  1WH5 A;  2X1E A;  1VQO I;  3BZ6 A;  4XBF A;  3RYP A;  3F0C A;  2DA2 A;  1S29 A;  2P6T A;  2NS8 A;  4A3D J;  2COM A;  4BU2 A;  3KEQ A;  3FIS A;  3AG3 H;  1ZRE A;  1VQ9 I;  3E97 A;  5LGN A;  1AWC A;  1NK2 P;  1YX5 A;  2GAU A;  2FRH A;  1JUM A;  4G9Y A;  3TED A;  2WTE A;  2Z9O A;  3IKT A;  2XKP A;  3OYL A;  3GLX A;  3V8L A;  2HKO A;  2R3S A;  1U5T B;  1I3A A;  5ERI A;  3AKZ A;  1FTT A;  1JE8 A;  1XC5 A;  4JX4 A;  1WPK A;  3L9F A;  4CSW A;  3R4K A;  2XUB A;  3V7S A;  4YFX F;  1JJ6 C;  2IW5 A;  2LF7 A;  2EFW A;  1EJ9 A;  3GTK J;  3JCU C;  1PUF A;  2D5V A;  3BOQ A;  4BBR J;  4FX4 A;  5IP9 J;  3I4M J;  3VSL A;  3IHU A;  4IHT A;  2E5N A;  1GV5 A;  3RPU D;  3LAJ A;  2L01 A;  4A3L J;  4J19 A;  2VJ5 A;  2CQN A;  2ZJQ F;  3JTH A;  3F9K A;  5F1J A;  4ETS A;  4IHY A;  1YJN I;  4BEH B;  4DYR A;  5C4J J;  2Y30 A;  3OIO A;  2R7D A;  1IW7 F;  5HLH A;  3NEU A;  2R7F A;  2L9N A;  3S1R J;  4C3H J;  3JRA A;  1RC9 A;  3ZN1 A;  2XRO A;  2FSW A;  2OV7 A;  2L02 A;  3HB9 A;  2CG4 A;  2X6Y A;  5D5X B;  1FYL A;  4G94 A;  3TGN A;  2EV5 A;  3VEP A;  1X2M A;  2OC6 A;  4W1U A;  4BXU A;  3NQO A;  1QVT A;  2BGC A;  4BHP A;  1YYV A;  2NOJ B;  3EUH C;  3M8F A;  5FD5 A;  5EGO B;  2LFB A;  2OUM A;  3OWT A;  1JXS A;  4HDV A;  2HNH A;  1QVU A;  2HFH A;  4MFD A;  2AXL A;  2KIQ A;  4RB0 A;  1U3E M;  3PO2 J;  1UHM A;  1Y56 A;  3BJ6 A;  2LTP A;  2XDV A;  1UEL B;  1QPM A;  2ESH A;  2LKX A;  3DKX A;  4PSW A;  2IAI A;  3E1S A;  2ADU A;  4X1E A;  1HKS A;  2DJN A;  4M72 A;  3VFZ A;  3WGG A;  3TO7 A;  3H5A A;  4HPQ A;  1LFB A;  3OYB A;  4ENN A;  1B72 B;  2P7C B;  3S1Q J;  4HV5 A;  1NG7 A;  1P4X A;  1FZP B;  1BI2 A;  1K78 A;  1S7E A;  4GCV A;  4Y4R A;  3JRC A;  4YG2 F;  2N8G A;  4AVP A;  5E3N A;  2E1M C;  1XGO A;  3W6K B;  2IA2 A;  2CW0 F;  3A1Y A;  2JPC A;  2Z5U A;  1WWX A;  2GQQ A;  5LGU A;  5FB2 A;  2OQG A;  4N4N B;  3R0A A;  1O3T A;  2QF7 A;  4PJ0 C;  1WGX A;  2KDO A;  1ETO A;  1KU7 A;  5LGT A;  1X1D A;  4H4K C;  4PFO A;  1REP C;  4RAY A;  4WXD A;  4U0Y A;  2KP6 A;  4IHS A;  1TQI A;  3QU6 A;  3HSF A;  4RGS A;  5KK1 A;  5ED4 A;  2W25 A;  5CVI A;  2MBF A;  3GTO J;  4E7L A;  4XSX F;  2A6H F;  2ZO4 A;  3LQR A;  1PP8 F;  2ZFU A;  4H0E A;  3I53 A;  2XF7 A;  1F36 A;  1GVD A;  4OIR F;  4JBA A;  4WK8 F;  3J80 K;  1T08 B;  1AKH B;  3REO A;  3K1N A;  1ON2 A;  2L4A A;  4LIT A;  4AC0 A;  2CQK A;  2V6C A;  3FKJ A;  4IL6 C;  4EJU A;  4RGR A;  2ISZ A;  2RV8 A;  3MZY A;  4A69 C;  4A5N A;  3PUF A;  2Y2Z A;  3CF2 A;  4RGX A;  3CUO A;  2QQA A;  2HDC A;  3T5X A;  2DJI A;  2LKP A;  2WY7 Q;  1MBH A;  1KGS A;  3I54 A;  2JA5 J;  4CCO A;  4BNC A;  4LK0 F;  1IXS B;  4MTE A;  3CUQ C;  5BS6 A;  3F6V A;  1TNT A;  4GDF A;  2AQE A;  3EYI A;  3PUB A;  3L2W A;  4TV7 A;  4MTD A;  4RBO A;  3B73 A;  4HYE A;  2EH3 A;  1DUX C;  1K6Y A;  3GTP J;  1WJC A;  2DOD A;  2L2O A;  2KJC A;  3B6A A;  4XLF A;  1FTZ A;  3ASN H;  2STW A;  1USS A;  1YRN A;  1YIJ I;  2O9L A;  4BBS J;  5J8C A;  2KIF A;  3WTT C;  4L9T A;  1VQN I;  2Y0S A;  1LEB A;  3QPH A;  5IT3 A;  3N05 A;  2JA7 J;  3TMO A;  1QZZ A;  2IS4 A;  2IXS A;  1IJW C;  1IRX A;  3HXL A;  1FSE A;  3HUG B;  5F1R A;  3R6S A;  2VBX A;  3HC7 A;  1XGM A;  2QQB A;  2EQR A;  1IC8 A;  5ILU A;  2OD5 A;  2QBY B;  4UVC A;  5TGT A;  3UR3 C;  3RKX A;  3A0H C;  1SFU A;  1Z9C A;  1SFE A;  2M0C A;  2A05 A;  1V4R A;  1LKX A;  2HGC A;  1LVA A;  1OYI A;  1BW5 A;  3A02 A;  3CDI A;  2M45 A;  2EV6 A;  5D6F A;  2DMN A;  4EJT A;  3WG7 H;  5DCM B;  3E5X A;  4IF4 A;  2O61 A;  2VQH A;  2LP0 A;  3FMS A;  2HWV A;  5J1R A;  4F93 B;  2V1D A;  3FK7 A;  4II3 A;  3S8P A;  2O03 A;  1O4X A;  2ZXW H;  2Z99 A;  4RMN A;  4A6E A;  3HTS B;  5FLX Z;  3LSK A;  1ON1 A;  3OR1 C;  5DYM A;  3ZOB A;  2E5Z A;  3HEF A;  2CU7 A;  3PM1 A;  3OOP A;  4ITV A;  3PSF A;  3N4M A;  3P9C A;  1YJW I;  4DYQ A;  4NC8 A;  3QRF F;  3BR1 A;  3S2H J;  3SHF A;  5CQE A;  4MGR A;  1S9H A;  1YE9 A;  1MDM A;  2HDD A;  4KIT B;  4XOR A;  4S04 A;  2ZCW A;  2EPF A;  4XKC A;  4I76 A;  3LFU A;  2G9W A;  2VXZ A;  3ZQI A;  1NK3 P;  1Z77 A;  2IS6 A;  1W5T A;  5F04 A;  3CCL I;  4G6D A;  1RIO H;  3W2V A;  4YIF A;  2VJ4 A;  3H36 A;  3OL3 A;  3BJO A;  4XKB A;  2PG4 A;  3ZMT A;  5L3E A;  4EM0 B;  1K6O A;  4UV8 A;  5BQT A;  3KP6 A;  3TL4 X;  3U1D A;  3BG7 A;  1I1G A;  2A6T A;  5E1W A;  3GZ5 A;  3VOD A;  1S8N A;  3G2B A;  1R6R A;  2MW8 A;  4DW6 A;  2G0E A;  3DWL E;  1Z0X A;  2DYR H;  2OAZ A;  1R00 A;  3ZQH A;  3B6C A;  3IV5 A;  2X48 A;  3CP8 A;  2BE5 F;  3OYF A;  2E60 A;  4L0Y B;  2VAS A;  1H0M A;  4ZTF A;  2GLO A;  2EFO A;  2MG4 A;  1QHH D;  4CCL A;  3CLO A;  2F5V A;  2JT1 A;  3WTZ A;  3L09 A;  2K9S A;  1W5C C;  5F64 A;  5ILV A;  2CW7 A;  2LBF A;  1B4A A;  2QQ9 A;  3BQZ A;  1ZN2 A;  1X1C A;  3J7A Y;  2CRG A;  4IQ4 A;  3F8C A;  2TRT A;  5DTD A;  1O3R A;  2YU9 J;  5K7F A;  3QP6 A;  4U88 A;  2X6O A;  3IWZ A;  1GVJ A;  5EYR A;  1DGW Y;  3BTL A;  4FTH A;  1G2H A;  3KX2 A;  2C6Y A;  2UXN A;  2VI6 A;  1MIJ A;  2RDP A;  3MN2 A;  1CF7 B;  3CMA I;  2F5E A;  5E3L A;  1P7J A;  2M7B A;  2QSF X;  1ZGA A;  3KZI C;  4EM2 A;  4RM3 A;  2V9P A;  3G6E I;  1R4M B;  1K79 A;  1YS6 A;  1D3Y A;  3M8E A;  4HAM A;  3CC2 I;  1U6G A;  2ZME B;  1HDD C;  4ENK A;  1PUE E;  5A2Q K;  2AS5 F;  3RKQ A;  1DGR M;  3S1N J;  3LSP A;  1TL8 A;  5B5E C;  1TWA J;  2F6C A;  3CMM A;  2Z1D A;  3KP5 A;  3ZQF A;  1ZGW A;  4V19 K;  2P8T A;  2YX7 A;  3CES A;  3GME A;  5HS8 A;  1I27 A;  1BL0 A;  4A0Y A;  2XSJ C;  3M1C A;  3GTQ J;  2J5P A;  4XLA A;  1DU6 A;  1FMV A;  1R7J A;  3ISP A;  4A93 J;  2FBK A;  5AIQ A;  1ZAR A;  5F6F A;  3QAH A;  1F4K A;  4MHG A;  1Q1V A;  1T98 A;  4MLO A;  3QPT A;  5C3E J;  3LAP A;  5IYD J;  2HXI A;  4PJJ A;  4BE2 A;  2PMH A;  2JQ7 A;  1GUU A;  1VI0 A;  5IYC J;  3BT9 A;  1WH7 A;  2VL8 A;  4Q48 A;  2FU4 A;  1DP7 P;  1FSH A;  4C2M J;  2JWT A;  1ACI A;  1QA6 A;  3CCU I;  2WWY A;  1RKT A;  1QQI A;  3K2Z A;  3U21 A;  2KRH A;  1ZTR A;  2QUF A;  2HVQ A;  4YII A;  1ZR2 A;  4DZJ A;  1XSD A;  2LY1 A;  2W84 A;  1K4S A;  5LEK A;  2F4O B;  3HOY J;  2Y69 H;  1RKW A;  2KRF A;  1X1A A;  2LNB A;  2XGE A;  1SFO J;  2EA4 A;  2XIG A;  4ZDL A;  2PBI A;  1UHS A;  1OYW A;  4A3G J;  2JN6 A;  3K4N A;  3G3Z A;  1OFC X;  4XR6 A;  1ZRD A;  5LRS A;  2XVC A;  4N0B A;  4CYC A;  4BEH A;  1K83 J;  2K4J A;  4YEL A;  5DD8 A;  4KFC A;  1WJE A;  3P9K A;  3FMQ A;  2KIS A;  1D5Y A;  5JFR A;  3VSK A;  4A5M A;  2BY0 A;  2IA0 A;  2M30 A;  1IV6 A;  3CQZ J;  5E17 F;  3GBG A;  2XGC A;  3HRS A;  3VYS B;  3OS1 A;  1YIT I;  5IT9 K;  4CCJ A;  2MYS A;  2KL4 A;  1J7K A;  1M1E B;  4OWR B;  4V2G A;  1ZHF A;  4EJO A;  5BNG A;  1E2X A;  1TT0 A;  2E36 A;  2K4B A;  3W3C A;  2IGO A;  1Z91 A;  1S7A A;  3SEZ A;  2ME0 A;  5E8I A;  4RS8 A;  2LY9 A;  4A6D A;  1PP7 U;  5EGO A;  2P7V B;  2M9H A;  3N97 A;  3H9Q A;  2PJR A;  3FZV A;  3GZN B;  4XLN F;  4A12 A;  3M1E A;  4PSX A;  1A35 A;  2DA5 A;  2NS0 A;  4I02 A;  2QGU A;  3PQK A;  4NBQ A;  1FOY A;  2B7E A;  3GFL A;  3UKG A;  3M07 A;  1LVK A;  1FBQ A;  2LD5 A;  1HXD A;  2GOM A;  4OIO F;  4ZYG A;  4L9V A;  3CCY A;  2HR3 A;  4M3B A;  2NVY J;  4A3J J;  1W36 C;  2WY8 Q;  4P55 A;  4U0V A;  1B72 A;  4L18 B;  2O8X A;  1FC3 A;  2R7O A;  2VPR A;  2ZSI B;  2OU2 A;  1WJA A;  2CFO A;  2XAH A;  1RI7 A;  4OAZ A;  2HYJ A;  4AM3 A;  3LSJ A;  5EEG A;  1YW8 A;  3M4O J;  4RB1 A;  4EGZ A;  1AOY A;  5HLG A;  1UMQ A;  2R5Z B;  1GLN A;  3QQA A;  4MEY F;  2WV1 A;  2ZJR F;  3E6C C;  1UG0 A;  3V7R A;  1PDN C;  5DM6 F;  1ZLK A;  2RGV A;  1YW9 A;  3HZJ A;  3IWF A;  4ZC3 A;  4CCN A;  3KLO A;  1QU3 A;  1F43 A;  3IP4 B;  3RYR A;  4M74 A;  2BVL A;  4IKF A;  3EQL F;  2WAD A;  2DFH A;  4LLL A;  4Q5S F;  2XSD C;  3RIR A;  4C3I J;  2CSO A;  4HLX A;  3OYG A;  2UZK A;  2G7U A;  5H6R A;  5CKT A;  1RNL A;  1T8I A;  3MAJ A;  2HOE A;  4HEA 2;  1U2W A;  2R7X A;  3HOU J;  5JVT A;  4E6K G;  5LHG A;  3QYB A;  4DGW B;  2DK5 A;  2DA7 A;  2L7M P;  5GPC A;  3U2R A;  4A3B J;  1MD0 A;  4KJZ A;  2VJJ A;  4NUB A;  2L7Z A;  2OA4 A;  2XAG A;  3BTJ A;  3I0T A;  4BAY A;  4KIC A;  3F72 A;  2DAO A;  4G7H F;  2O6G E;  3NAU A;  4CDG A;  1WJF A;  1YOV B;  4BJT A;  1JT0 A;  2KKO A;  2ZBK A;  2R5Y A;  5TJJ A;  1G8X A;  4NNJ A;  2H8R A;  2X4H A;  2LDU A;  5GTI C;  2VBW A;  4HF0 A;  4LB6 B;  1VF9 A;  5ICF A;  2R7S A;  3S17 J;  1QPI A;  3Q0V A;  3O6B B;  1XN7 A;  1W5S A;  2JK3 A;  2IA1 A;  1TQP A;  3P9I A;  4LMY A;  3SDB A;  3HHH A;  4UUS B;  4IRI A;  3TQN A;  4BS9 A;  1ZR4 A;  3KYD B;  5FLX K;  1G3T A;  4WWC A;  1YHQ I;  5H2F C;  3WHC A;  4HNT A;  2EIN H;  1LE8 B;  3CDH A;  5IP6 A;  2EFP A;  1G3S A;  2HU9 A;  2UXX A;  2QKM B;  4XLE A;  1EF4 A;  1FP2 A;  1ETK A;  2BXY A;  4IOC F;  5BPD A;  3OYN A;  4UV9 A;  2EB7 A;  4BH9 A;  5FGM A;  5FKN A;  5D5V B;  3KP3 A;  1XDS A;  5DD4 A;  2E2I J;  2QBY A;  1Z05 A;  2MFZ A;  4PJN A;  4XSZ F;  5IOY A;  4FX0 A;  1YI2 I;  3OYC A;  4G7O F;  2HZD A;  4KIB A;  3DKY A;  4ZZD A;  5K7H A;  1A36 A;  3OYD A;  3GUD A;  1X2N A;  3GWZ A;  3K70 C;  2R7Z J;  4S0H B;  3BR3 A;  1JI8 A;  4M71 A;  1RZ4 A;  4D5C A;  4JX5 A;  5EG0 B;  3KP2 A;  3Q0U A;  5E1X A;  3KLN A;  1X58 A;  3KPH A;  1AHD P;  4YEJ A;  2M7A A;  2OZU A;  5GTH C;  4CIC A;  3OR2 C;  3V8K A;  2VKH A;  4P5O A;  3HPG A;  4HX8 A;  4GYG A;  3TP3 A;  1OPC A;  1KQ8 A;  3CO7 C;  1YFH A;  1WI9 A;  4PFP A;  2ELH A;  4G6Q A;  1Z3Y A;  4BE1 A;  4BQA A;  2R0Q C;  4Q47 A;  3AG2 H;  3TOA A;  2ZXJ A;  5EZH A;  1H89 C;  2JTV A;  4OMZ A;  4MNU A;  5M5W J;  5LHH A;  3G4S I;  2CH0 A;  4AIK A;  3H5R A;  1Y1W J;  3ZCO A;  3RKW A;  2E1C A;  2AQF A;  2WAE A;  2VUM J;  3MCZ A;  4LIV A;  2OPT A;  4BXX J;  3L00 A;  3ZQ7 A;  5HNF A;  1ZLJ A;  4WF2 A;  3QPL A;  4RA2 A;  1B8I B;  2GA1 A;  2ZXI A;  4UVB A;  3F22 A;  4C30 A;  1HW1 A;  5C4X J;  4UNO A;  3HKZ N;  2CGP A;  3C3W A;  2EWN A;  2JA6 J;  3LNQ A;  1FNN A;  5E1Z B;  2TDX A;  2VN2 A;  4DOZ A;  5JI6 A;  1IUF A;  4I09 A;  2M87 A;  3VYT B;  1VQM I;  3SZT A;  2Y9Y A;  2VLA A;  1FBS A;  1VQ6 I;  1SVO A;  3K9T A;  2KQR A;  5D4R A;  3IUO A;  1E17 A;  1R71 A;  3I59 B;  4FET A;  3C2G A;  5E79 C;  5J6X A;  2E7X A;  2XPV A;  5JR3 A;  1IDZ A;  4U7B A;  4A3C J;  2EZK A;  4HOB A;  4DIQ A;  2JRT A;  2GIZ A;  3HOZ J;  1R1V A;  3KCC A;  1EH7 A;  1TWF J;  3HOS A;  2W7N A;  1HSJ A;  2CQX A;  3A01 A;  1SFX A;  3LSG A;  2FOW A;  1WVR A;  4LG0 B;  1YO5 C;  1QZE A;  3MEX A;  4DYC A;  2VB6 A;  1CF7 A;  2F4I A;  1P2F A;  2MC3 A;  3OSG A;  1FLI A;  3KZY A;  2CUJ A;  1ETX A;  1UST A;  5L3B A;  2PJP A;  1BJA A;  2DMT A;  4A3E J;  4MQ9 F;  1YLF A;  3RPU A;  2ZME A;  2R7W A;  1A6I A;  2VC1 A;  2FNP A;  3FXR A;  1I6H J;  1R4N B;  1QHG A;  1LJ9 A;  2I8D A;  2V7F A;  1HC8 A;  2XPW A;  4ABZ A;  2L7F P;  1LDJ A;  2FXA A;  2RNJ A;  1BIA A;  3KEO A;  1KZH A;  4QPQ A;  4KUM A;  3TO6 A;  3PQJ A;  3WGH A;  3G1L A;  1IN5 A;  1U0J A;  3D1N I;  4PDK A;  2GXG A;  5GAD J;  5EF6 A;  4HX7 A;  2M4K A;  5FKM A;  2MGQ A;  4BJ5 C;  1SVL A;  3BR6 A;  5CVR A;  4QTR A;  3JRD A;  3CCQ I;  4X0G A;  1WSU A;  3BPV A;  4R8H A;  3D5R C;  3WTX C;  2H6C A;  4HF2 A;  4IRG A;  1QBJ A;  2NAZ A;  1HDP A;  1OCR H;  3J81 K;  3ZPL A;  2LF8 A;  3GLL A;  1S6L A;  2V9K A;  3IAM 2;  5J47 A;  4MFE A;  1T0F C;  2QM3 A;  3CMY A;  4B43 A;  3QU3 A;  2EV0 A;  5LD2 C;  5D5U B;  4EAT A;  4A3I J;  5JVG F;  2WB1 A;  2DT6 A;  3ECO A;  1YJ9 I;  2FQ4 A;  3S3O A;  3L1P A;  2GOX B;  5KVR A;  4GXO A;  3CLQ A;  2HOT A;  1STZ A;  1UG2 A;  3DP7 A;  3GFM A;  4Y15 A;  4F55 A;  3KET A;  3QOP A;  1ZH5 A;  3MZ8 A;  1ITY A;  5L3D A;  3H92 A;  3ZRG A;  1GXQ A;  2O3F A;  3H3Z A;  1LB2 A;  1WJ5 A;  2QVO A;  2JSP A;  2P5V A;  1N77 A;  2XRL A;  3I3L A;  4E70 A;  1BR1 A;  2E1N A;  2FD5 A;  3VDX A;  1OR7 A;  4UB6 C;  3MKZ A;  3S1M J;  4G8X A;  3PO3 J;  2E1M B;  5F0C A;  2AO9 A;  3ULQ B;  4HV6 A;  4A3K J;  1J0R A;  3PJR A;  4AUX A;  1LDK B;  3QOE A;  2DBB A;  1SAX A;  3OS2 A;  2VQG A;  3WTU C;  2DA4 A;  2ICW G;  5GPA A;  2VE8 A;  2DPD A;  1D1B A;  3ZMD A;  2Y9Z A;  4FE7 A;  1XGS A;  3EYY A;  5DV5 A;  4AD9 A;  1A31 A;  3VPR A;  3BG6 A;  1R1T A;  3JRH A;  2XPU A;  1D0Z A;  3HBL A;  1RUO A;  2PMZ A;  3TOB A;  3ZQL A;  2VPL A;  1A04 A;  1X19 A;  2QA4 I;  3OY9 A;  4HNV A;  4HLY A;  1NTC A;  2QWW A;  2BHY A;  4KN4 X;  3GYH X;  1R36 A;  3QYE A;  2LR8 A;  1IUY A;  3MKL A;  1B9N A;  1FJL A;  1I5Z A;  4C9Y A;  5GAE J;  2L9S A;  3K4B A;  2NVT J;  4I01 A;  3SZG A;  3HOX J;  2KPM A;  1FIA A;  3ABK H;  1RR8 C;  2BYV E;  2FQ3 A;  4GYI A;  1HLV A;  2H27 A;  2IVM A;  3K1M A;  3RPQ A;  2QSG X;  2K27 A;  3R61 A;  4OOI A;  5GAH J;  3DKW A;  3K4L A;  2LKS A;  2KLO A;  3K6G A;  1FWZ A;  1GT0 C;  3A4C A;  2WAQ A;  3KE2 A;  3CUQ B;  2Z16 A;  1U9N A;  4I7H A;  2RRE A;  1F9N A;  1O7F A;  1ONV A;  2MH2 A;  1VQ4 I;  2GXA A;  3S2D J;  1MBG A;  4M6X A;  4I2O A;  3O8G A;  3WU2 C;  3CJN A;  3CCV I;  3RKY A;  4B48 A;  2NRA C;  3K7A J;  4F7Z A;  1XPX A;  1FMW A;  1V3F A;  1TZL A;  2VKE A;  3K4K A;  3KP4 A;  3VYR B;  3VWB A;  4A3F J;  1R5H A;  4BUP A;  3KYC B;  3MVP A;  4RLF A;  4OIN F;  3FXJ A;  2WB1 N;  5DUI A;  3DBR B;  1OLT A;  4HF1 A;  3SZP A;  1L0O C;  1X4P A;  4S05 A;  2OTJ I;  2FBH A;  5C44 J;  3BG5 A;  4O3M A;  1I50 J;  2K3P A;  5D4S A;  2DI3 A;  5ICC A;  5K5O A;  3UNG C;  2E1O A;  1RR7 A;  5KCM A;  2LYC A;  3HSE A;  3R0J A;  1MKM A;  1XDU A;  2XKO A;  3HM5 A;  1R49 A;  3OMY A;  5J3L A;  4UUV A;  4XN3 A;  2KZV A;  1TW2 A;  1U8B A;  1ETQ A;  2Q2E A;  4XQF A;  3H1C A;  4EGY A;  3V42 A;  5HVQ C;  5FKL A;  1I6X A;  1DQU A;  1TNS A;  5DDG A;  4AIJ A;  3GFJ A;  4E7H A;  2XGX A;  4JX6 A;  1DDN A;  2FEZ A;  5HDG A;  2Z33 A;  2ECC A;  1X4O A;  2MC4 A;  4I0A A;  1XS9 A;  1IAW A;  3CC4 I;  4QLC U;  5LBQ A;  2K5C A;  1P6R A;  5E18 F;  3M7G A;  1RPW A;  4WX9 A;  3RSN A;  3T8R A;  2UV1 A;  4LB5 A;  4QSH A;  4UY8 I;  4KT5 C;  2PMZ N;  2Y0S N;  1W0T A;  2VC0 A;  1H8A C;  1VQK I;  1J09 A;  3E3V A;  1L3L A;  1HST A;  3E5U A;  3BCB A;  2BV6 A;  2BHZ A;  4CUG A;  1QNT A;  2P5K A;  1VQL I;  1ZAO A;  4UUT A;  1E3O C;  3S93 A;  1BC7 C;  1P4A A;  3DFG A;  2X9D A;  4IO9 F;  1JHH A;  2L5Q A;  4B1R A;  2VOO A;  1A6Q A;  3LFK A;  2CUZ A;  3FXQ A;  1J5Y A;  3BLY A;  4CZZ A;  2JZY A;  1ETY A;  3FXL A;  3W6J B;  4Y13 A;  2JJ7 A;  3C18 A;  3JTG A;  2CUE A;  1BJZ A;  4DBQ A;  1CQT A;  4C2U A;  3AL0 C;  1BR2 A;  3LST A;  4Y52 J;  3A0B C;  3KEY A;  3LQQ A;  2M3A A;  3BY6 A;  3F8N A;  3ZQC A;  1O3S A;  2QKL B;  4RDU A;  3H3V K;  3IAS 2;  4Y3O A;  2DXI A;  1B1B A;  3SFZ A;  1NH3 A;  2X6X A;  3HDD A;  3IH4 A;  5K5Q A;  2H94 A;  3HRU A;  1KU2 A;  3ABU A;  1T56 A;  1UAA A;  2YUS A;  1V5F A;  1HF0 A;  1BBY A;  2ZSH B;  5IY5 H;  1GV2 A;  3QYF A;  2RQQ A;  1LEA A;  2OTL I;  2KIU A;  1FOW A;  2CYY A;  3JSP A;  2HTJ A;  3Q5F A;  2XHK A;  2VXD A;  1BN5 A;  3C1D A;  2LK2 A;  1D5V A;  2DU9 A;  1U5T A;  2XRN A;  3F23 A;  3F8M A;  5DS9 A;  1HCR A;  3OYK A;  2V1N A;  3SQN A;  4NB5 A;  4Z6Y A;  3CJT B;  3HG9 A;  3PSI A;  4YFK F;  3PIO F;  3S3N A;  2DOF A;  1V5E A;  1K78 B;  2IS1 A;  4QWQ A;  3SEQ A;  4QIW N;  3ESW B;  4IVN A;  2EFN A;  4KDP A;  1R1U A;  2K3F A;  2WBM A;  2YU3 A;  3LMM A;  2X51 A;  2HS5 A;  2CJJ A;  3CCR I;  1LPQ A;  3FX3 A;  4HW0 A;  2WA0 A;  2DA6 A;  3DEE A;  3IRR A;  1QZY A;  3J7Y J;  2FX0 A;  1TT5 B;  1APL C;  4B3A A;  2RN7 A;  1E0E A;  1R58 A;  5L3G A;  1IG7 A;  3DV8 A;  1MBE A;  3I59 A;  3I58 A;  5H20 A;  4M9X A;  1OQY A;  3BCA A;  3HGG A;  2A3S A;  2VOD A;  5HNH A;  4BKX A;  4E7I A;  2XGD A;  3HGY A;  2HQR A;  2HPI A;  5D5W B;  2VJI A;  3FXU A;  2BEO A;  4HZF A;  2ZJP F;  2LG4 A;  1D0Y A;  3HOV J;  3WE2 A;  3KYL A;  2X1D A;  5IP7 J;  2DPU A;  3TW7 A;  2F5C A;  2NVQ J;  4GGG A;  4LG3 A;  2M0M A;  1J59 A;  1X3W B;  1G3W A;  1W4M A;  2CW8 A;  3WU0 A;  1TWH J;  2JA8 J;  2E2J J;  3OYA A;  1P92 A;  2CQQ A;  2GBY A;  2HOS A;  3WOD F;  2ESN A;  1SVM A;  3BP8 A;  2DT7 B;  3LWF A;  2K9M A;  2PFB A;  2GXB A;  3I9V 2;  3DXJ F;  1RES A;  2PMU A;  2KHM A;  1F1Z A;  1U9O A;  3FMR A;  3ERE D;  2PI0 A;  5EEH A;  3I4N J;  1HQC A;  4KN7 X;  3S2W A;  1ETV A;  1OCZ H;  5E20 A;  3FHZ A;  4ON0 A;  4IOA F;  2M34 A;  3ZMS A;  5FD6 A;  2MAB A;  3MKW B;  4P1W A;  1UJ8 A;  1MZB A;  3HOW J;  3NWS A;  3LSH A;  1IXR C;  3I56 I;  5JHU A;  1BI1 A;  2R7Q A;  1IV8 A;  2P6S A;  1UZC A;  1YRN B;  2EBI A;  3BR2 A;  4IHW A;  3QP5 A;  2W48 A;  4D7M A;  2IJL A;  1SD5 A;  4AYB A;  4CZC A;  1Y0U A;  5KHD A;  1C0W A;  2EIM H;  2A07 F;  3PFY A;  4JQF A;  1H9G A;  3J80 Z;  1OCO H;  2DFE A;  2XAJ A;  3S32 A;  1MMN A;  1Z7U A;  4DNC A;  4UHT A;  2VOP A;  4BHC A;  1JKP C;  3RCO A;  3FXM A;  2CV1 A;  1XGN A;  4CCM A;  3OV8 A;  1TWC J;  1JGG A;  2P81 A;  2R93 J;  2IT0 A;  4LFU A;  4E7J A;  2K7L A;  1Z67 A;  3HPH A;  4ESF A;  3EUH A;  3OS0 A;  4BE0 A;  1ZGJ A;  2M8E A;  3ECH A;  4D9J A;  2LLK A;  3I71 A;  1AKH A;  1A5J A;  2FA5 A;  1T39 A;  4QPO A;  4XLC A;  4EM1 A;  2A68 F;  2VT3 A;  1ZQ3 P;  5CVJ A;  1PYV A;  3RTR A;  4M6Y A;  2HVS A;  2KRC A;  2WAF A;  1FOK A;  2NVX J;  4L0Z B;  1S5L C;  3JSO A;  2F5F A;  2YSR A;  3JRB A;  5HLI A;  4EEF G;  1ZK8 A;  4PJL A;  2ZXH A;  2R7U A;  5JLX A;  4Q4Z F;  2XF6 A;  1B6A A;  5FKO A;  3E7L A;  1WJD A;  1I39 A;  3OOU A;  1KYW A;  5DUK A;  3EPZ A;  3LA3 A;  4ZTJ A;  4FIS A;  2HTS A;  1OCP A;  3FM5 A;  3KZZ A;  1GXP A;  5HDN A;  4RM2 A;  2IGK A;  1Y6I A;  3TP0 A;  5F0F A;  2R7V A;  3CD6 I;  3BR5 A;  5EJC A;  4G12 A;  3DBL B;  2KDZ A;  4ENJ A;  2XAU A;  4AIH A;  2OZ6 A;  3HSR A;  3WE3 A;  3VYU B;  3ZMU A;  4Y7N J;  4LIU A;  5ICE A;  2HOA A;  2W57 A;  1JUS A;  4JK1 X;  2EIJ H;  1QGP A;  3ZXS A;  3BZC A;  3WU1 B;  3DLL F;  1BOA A;  2QEX I;  3CF5 F;  3Q9S A;  3O8H A;  1OCT C;  1ZEL A;  4FCY A;  2NYX A;  5J1U A;  1JTX A;  1MBJ A;  3ROU A;  4F91 B;  2V6E A;  2VBZ A;  2EFQ A;  3HUG A;  3AG1 H;  4HST A;  1IN4 A;  1BI3 A;  1XX5 A;  2KT0 A;  1IDY A;  2LBF B;  1MND A;  4ASN A;  4AID A;  1JUP A;  1NG6 A;  1MW7 A;  1W7P D;  4E7Z A;  4MO7 A;  1SMY F;  3FIW A;  4HRI A;  2LH9 A;  1U5T C;  1Y0N A;  3WTW C;  5DCM A;  4DZP A;  2JRM A;  4HBL A;  3RZO J;  5F0H A;  4MEX F;  3CUQ A;  2DYS H;  2EA2 A;  2Y48 A;  4UVA A;  1AA7 A;  4B8X A;  2AHQ A;  4B09 A;  4DBR A;  1YW7 A;  1SMT A;  5DCF A;  1F5T A;  2B9S A;  1HA8 A;  3CTA A;  3NWT A;  5AON A;  2FML A;  2NS7 A;  1Z3X A;  1DPU A;  5FJ8 J;  2JMW A;  2NVU B;  3LSI A;  1OYY A;  3MZH A;  1U78 A;  4F52 A;  4BDY A;  5H6Q A;  1LDD A;  4L9N A;  4B44 A;  3JAM Z;  3G73 A;  3DLA A;  2CV0 A;  2MSY A;  1IF1 A;  1P4W A;  3BR0 A;  2DOA A;  4A2U A;  5GAG J;  1FBU A;  3DF8 A;  1EV7 A;  4RB3 C;  2FJ1 A;  1Z6R A;  1IRF A;  2DMU A;  3C7J A;  2ZC2 A;  1MMD A;  1ZG1 A;  4XLH A;  1MJ9 A;  4ZYH A;  3ELK A;  1XSV A;  1GDT A;  2EZI A;  2CFX A;  4ZJZ A;  2EIK H;  3ABM H;  3FK6 A;  3CP2 A;  4IEJ A;  3AFH A;  2K40 A;  2W24 A;  3RQI A;  1QO0 D;  1HOM A;  2PQ8 A;  4EQQ A;  4L5I A;  1B9M A;  3FHN A;  2K9N A;  4EV0 A;  3ABT A;  3K10 A;  4BL0 B;  4BY7 J;  4YFN F;  3BDD A;  2CV2 A;  2L4M A;  3K2A A;  2NNY A;  1POG A;  1ENH A;  3NAR A;  2NOG A;  5DM7 F;  4P9F A;  1O57 A;  2H1L A;  4XID A;  1BOB A;  3JRF A;  3CJR B;  4XK4 A;  2FMY A;  1N75 A;  1P9Q C;  1WFX A;  1XG1 A;  2QCO A;  4U7D A;  3TW6 A;  1MSF C;  1MSE C;  4M73 A;  3BC8 A;  4BQQ A;  3K4M A;  1KA8 A;  3DTE A;  1IRG A;  4LD5 A;  1R5G A;  2OBP A;  1MJA A;  2L9R A;  2DW4 A;  2HPM A;  4KIG A;  2V1U A;  3PIP F;  3QOD A;  5A2Q Z;  3JRE A;  5IPA A;  2FE3 A;  4IHX A;  2CWE A;  2E35 A;  3DPT A;  2MLG A;  2O0Y A;  4IJA A;  3RDI A;  2ETH A;  5ICG A;  1T33 A;  1YIO A;  4IPA A;  4WXC A;  4OMY A;  2JSC A;  3FBI B;  2GZW A;  4EJW A;  2VQL A;  2Z3Y A;  4MQV A;  4LK1 F;  3D5L A;  1ZRF A;  1KU9 A;  4G6T B;  2RAE A;  4CYC B;  3RI4 A;  3B02 A;  2STT A;  3HOT A;  2O7O A;  4NQW B;  4UB8 C;  3BTI A;  2OCC H;  3QWL A;  3K4J A;  4FHT A;  1T2K A;  2O8K A;  1YTY A;  3BQY A;  2HVR A;  2K9L A;  3ZMV A;  4W97 A;  3LSM A;  4PJM A;  1J2X A;  4ZYD A;  1J75 A;  5TRD A;  2CQ7 A;  4KIF A;  3SDG A;  2I5U A;  1TC3 C;  2A61 A;  4L5E A;  4IQJ A;  4I0B A;  4U87 A;  3W2W A;  2BW3 B;  2QLZ A;  1FIP A;  2DDB A;  3CZ6 A;  1GHC A;  1YQA A;  3OL4 A;  4CA0 A;  5BPI A;  2BVM A;  5K7Z A;  2IBD A;  4KT6 A;  4Y17 A;  3R60 A;  2PJR B;  2Z2S B;  3HYI A;  4GRI A;  2M5W A;  4CO8 A;  3OIP A;  4BDZ A;  5LLQ A;  1S72 I;  2R7T A;  4ESJ A;  2JUG A;  5D6E A;  1D8J A;  1N78 A;  1I1S A;  1TP4 A;  2A6E F;  4HSR A;  5L3C A;  5LFA A;  2P5L C;  2Q1Z B;  4BY1 J;  2UWM A;  3TKY A;  2RQP A;  4CGZ A;  3O2P E;  4KMU X;  5F08 A;  1PJR A;  3Q0W A;  2OCE A;  5K5R A;  3GXO A;  4M9S A;  3IH2 A;  1TWG J;  3MWM A;  4XOP A;  2LOO A;  2CMP A;  2UUZ A;  4KA4 A;  3JRI A;  1WHU A;  3L2R A;  4D5F A;  3OSF A;  4NHJ A;  2ID6 A;  2QEN A;  1N25 A;  5LEJ A;  3V8J A;  4G7Z F;  1T95 A;  1R22 A;  5IT9 Z;  5CQG A;  1V55 H;  4XMY A;  1WCM J;  5B1A H;  2H6B A;  1XD7 A;  2XAS A;  5B66 C;  3T1B A;  1OKR A;  2GWR A;  2V26 A;  4L5J A;  2L0K A;  3HRM A;  3HL2 A;  3GCM A;  3ASO H;  1WI3 A;  5ILS A;  3P7N A;  4HG2 A;  3GTJ J;  4HQE A;  2DTR A;  1D1C A;  3Q9V A;  2EK5 A;  1VQP I;  5M3M J;  3VB2 A;  2HI3 A;  3WGI A;  4RAF A;  3E5Q A;  4LGW A;  1RRJ A;  3K69 A;  3CME I;  1Z21 A;  3GZ6 A;  1B59 A;  2M1B A;  1XMK A;  4FE4 A;  5J4Y A;  1D0X A;  1ZG3 A;  3E6D A;  4ZYE A;  4ENM A;  1SD7 A;  2E2H J;  3FXK A;  4X6A J;  2BXZ A;  1W0U A;  5HDK A;  2XAF A;  4BAC A;  3TDZ C;  3HRT A;  4HDU A;  2K86 A;  1HW2 A;  1UFM A;  1V5G A;  3L2V A;  2FOK A;  3H9J A;  4A3M J;  4OIQ F;  2DK8 A;  1X1P A;  4B47 A;  1MNE A;  2DCE A;  1YG2 A;  2E34 A;  2VIX A;  1SEU A;  2R5Y B;  1BM9 A;  3TBI A;  1WZ2 A;  2CUF A;  5EZG A;  3ZMZ A;  1LUJ B;  3I5U A;  4L9J A;  4IHV A;  3CDL A;  9ANT A;  1FYM A;  1BC8 C;  3GF2 A;  4ZYA A;  3SXY A;  3T8T A;  1TLH B;  2W85 A;  5FFZ A;  3SJM A;  4XOT A;  1CGP A;  4ZH4 F;  4AWX B;  3IL2 A;  2KFD A;  4BQN A;  3MMY B;  5J1Y A;  5M3F J;  2DO7 A;  5M5X J;  2GIV A;  1KU3 A;  1Y1V J;  3CCM I;  1K4T A;  4M3D A;  3PFI A;  1XMX A;  5AIP A;  2LMD A;  4O6J A;  2R5Z A;  5KAI C;  1SAU A;  2F2E A;  5HLT A;  3H0G J;  3M9A A;  4GO1 A;  1P7I A;  2BY1 A;  3ZGK A; 
#chains in the Genus database with same CATH homology
 2LK2 A;  1IGN A;  3NAU A;  5DS9 A;  2VKV A;  2TCT A;  3S1R J;  1HCR A;  1JT0 A;  4C3H J;  3JRA A;  2R5Y A;  3QPS A;  1ORK A;  2H8R A;  4QIW N;  3HB9 A;  1JKR C;  1MBK A;  5E3O A;  5EDN A;  1VF9 A;  1X2M A;  2CJJ A;  3DCF A;  3S17 J;  4W1U A;  3Q0V A;  1QPI A;  2DA6 A;  1QVT A;  2E19 A;  3JRG A;  5EGO B;  2FX0 A;  2JK3 A;  1APL C;  2LFB A;  4B3A A;  1QVU A;  3A03 A;  1IG7 A;  4UUS B;  4MFD A;  1MBE A;  3PO2 J;  1ZR4 A;  2LTP A;  3WHC A;  4JP0 A;  2LKX A;  3HGG A;  1LE8 B;  5IP6 A;  1EF4 A;  2IAI A;  4BKX A;  4X1E A;  2DJN A;  1ETK A;  2XGD A;  3HGY A;  1LFB A;  1B72 B;  3S1Q J;  2M2E A;  3HOV J;  4XRS A;  1S7E A;  5IP7 J;  2NVQ J;  3TW7 A;  3S16 J;  3JRC A;  5FKN A;  2GM4 A;  2E2I J;  2N8G A;  5E3N A;  5IOY A;  1TWH J;  2JA8 J;  2E2J J;  2HOS A;  2CQQ A;  2GBY A;  5K7H A;  2ELK A;  2COB A;  1X2N A;  2QF7 A;  2R7Z J;  4S0H B;  1WGX A;  3BR3 A;  4UUS A;  1RES A;  1ETO A;  4D5C A;  1U9O A;  4JX5 A;  5EG0 B;  3Q0U A;  1X58 A;  1AHD P;  3I4N J;  3W6V A;  1ETV A;  1AU7 A;  1LE8 A;  2M34 A;  3GTO J;  3TP3 A;  4NDL A;  3HOW J;  1PUF B;  3IH3 A;  1F36 A;  1GVD A;  2R0Q C;  2DTZ A;  1AKH B;  1FEX A;  1YRN B;  2EBI A;  3BR2 A;  5EZH A;  1H89 C;  2W48 A;  4IHW A;  4AC0 A;  5M5W J;  4D7M A;  5F27 A;  2DN0 A;  1Y1W J;  2DA1 A;  4A69 C;  4C3J J;  2VUM J;  2Y2Z A;  2OPT A;  4BXX J;  1ETW A;  2H1K A;  2XB5 A;  3QPL A;  1B8I B;  1BA5 A;  3A01 B;  1MBH A;  5EG0 A;  1JKP C;  5JLW A;  3GTM J;  2JA5 J;  5C4X J;  1TWC J;  3WHB A;  3SFI A;  3HKZ N;  1JGG A;  2P81 A;  2R93 J;  2JA6 J;  3LNQ A;  3GTL J;  2WAQ N;  4MIM A;  1IUF A;  4RBO A;  4B4C A;  3G1M A;  2Y9Y A;  2EH3 A;  3GTP J;  3B6A A;  1FTZ A;  2LLK A;  1AKH A;  1A5J A;  1YRN A;  2O9L A;  4BBS J;  3ZQG A;  1ZQ3 P;  2XPV A;  1IDZ A;  4A3C J;  3BG9 A;  2EZK A;  3HOZ J;  4M6V A;  5FLV A;  2NVX J;  2JA7 J;  1TWF J;  1IJW C;  1B8I A;  3JRB A;  2CQX A;  3BTC A;  4EEF G;  3A01 A;  1ZK8 A;  3LSG A;  1JT6 A;  1VFC A;  5JLX A;  1VND A;  2EQR A;  1IC8 A;  4DYC A;  5FKO A;  3E7L A;  3OOU A;  3OSG A;  2B63 J;  2HQ5 A;  1P7I A;  4FIS A;  4XRM A;  2M0C A;  1ETX A;  1OCP A;  4LOC A;  1BW5 A;  3A02 A;  2DMT A;  3TP0 A;  5F0F A;  4A3E J;  3BR5 A;  4G12 A;  2KDZ A;  2DMN A;  3JR9 A;  4Y7N J;  1A6I A;  2LP0 A;  2HOA A;  5J1R A;  1JUS A;  1JJ8 C;  1I6H J;  3FK7 A;  4XIC A;  1O4X A;  2DMP A;  2ID3 A;  1OJL A;  3O8H A;  2XPW A;  1OCT C;  2XB0 X;  3ZOB A;  4ABZ A;  3FKI J;  2EZH A;  1JTX A;  2L7F P;  1MBJ A;  5J1U A;  2ME6 A;  4FCY A;  3HEF A;  1IRZ A;  2CU7 A;  3PM1 A;  4DYQ A;  3BR1 A;  3S2H J;  4M3G A;  2HDD A;  2KT0 A;  3G1L A;  1IDY A;  1MNM C;  4I76 A;  1JUP A;  2Y31 A;  3D1N I;  4XRS G;  3ZQI A;  1NK3 P;  1Z77 A;  4MO7 A;  5F04 A;  3FIW A;  5EF6 A;  5FKM A;  2MGQ A;  5FLM J;  3BR6 A;  4QTR A;  3JRD A;  4DZP A;  3RZO J;  5F0H A;  1HDP A;  2ECB A;  2AHQ A;  2MW8 A;  4MFE A;  4DW6 A;  2G0E A;  1Z0X A;  3ZQH A;  3CMY A;  2YS9 A;  3B6C A;  3IV5 A;  5IYB J;  2X48 A;  3Q3S A;  2M8G X;  2NS7 A;  5FJ8 J;  2JMW A;  3BG3 A;  4A3I J;  1U78 A;  5E3M A;  2GLO A;  2FQ4 A;  2MG4 A;  5M5Y J;  3L1P A;  3S15 J;  2MSY A;  1JTY A;  4D7N A;  2HOT A;  3BR0 A;  2K9S A;  1UG2 A;  5FKK A;  3BQZ A;  4JYK A;  2FJ1 A;  1RET A;  1ITY A;  2DMU A;  2CRG A;  2TRT A;  5DTD A;  1JKQ C;  2YU9 J;  5K7F A;  1ZKG A;  1GDT A;  2EZI A;  3S14 J;  2X6O A;  2XRL A;  1JKO C;  2FD5 A;  3FK6 A;  4IEJ A;  2DA3 A;  2K40 A;  4M3E A;  5EYR A;  3BTL A;  4FTH A;  1H88 C;  3RQI A;  1G2H A;  2VI6 A;  4V2F A;  3MN2 A;  3S1M J;  1HOM A;  3PO3 J;  5F0C A;  2AO9 A;  4GFB A;  5E3L A;  2K9N A;  1P7J A;  4A3K J;  3LOC A;  4BY7 J;  4AUX A;  3K2A A;  1POG A;  1ENH A;  3NAR A;  2DA4 A;  2NOG A;  5GPA A;  1MBF A;  2Y9Z A;  4FE7 A;  4M3F A;  4XID A;  3JRF A;  4XK4 A;  1XG1 A;  3VPR A;  2QCO A;  1HDD C;  3TW6 A;  1MSF C;  1MSE C;  3JRH A;  2XPU A;  3HBL A;  3RKQ A;  3ZQL A;  3S1N J;  5IOZ A;  3LSP A;  2L9R A;  4HNV A;  2ZB9 A;  1NTC A;  1TWA J;  1ZGW A;  3ZQF A;  3JRE A;  5IPA A;  4IHX A;  2LR8 A;  3MKL A;  1T33 A;  1BL0 A;  1MH4 A;  1FJL A;  3GTQ J;  2IEK A;  2K9Q A;  1DU6 A;  4A93 J;  5GP9 A;  2NVT J;  1Q1V A;  1K61 A;  3HOX J;  4CYC B;  1FIA A;  2RAE A;  1HLV A;  3G1O A;  2OF7 A;  4MLO A;  5C3E J;  1I3Q J;  2O7O A;  3BTI A;  2HXI A;  5IYD J;  2O8K A;  1GUU A;  3BQY A;  1VI0 A;  5IYC J;  3BT9 A;  1WH7 A;  4W97 A;  1DU0 A;  2LVS A;  1GT0 C;  4C2M J;  1U9N A;  3SDG A;  2JWT A;  5EEA A;  1TC3 C;  3GTG J;  4L5E A;  1RKT A;  3S2D J;  1MBG A;  3M3Y J;  1LFU P;  1ZTR A;  1FIP A;  1ZR2 A;  4DZJ A;  3O8G A;  1SAN A;  5K7Z A;  1BW6 A;  2IBD A;  3HOY J;  3K7A J;  3LSR A;  1RKW A;  2XGE A;  1SFO J;  1MH3 A;  2VKE A;  4A3F J;  1R9T J;  1UHS A;  3MVP A;  4A3G J;  2JN6 A;  2HXO A;  1OFC X;  2DMQ A;  2WB1 N;  4CYC A;  2I10 A;  1K83 J;  5C44 J;  3BG5 A;  5HOD A;  1I50 J;  4AYB N;  1D5Y A;  4BY1 J;  2E1O A;  1IV6 A;  1RR7 A;  3CQZ J;  4I6Z A;  3GBG A;  2XGC A;  5F08 A;  3Q0W A;  3IH2 A;  1TWG J;  3HM5 A;  3JRI A;  3RZD J;  4V2G A;  4D5F A;  5BNG A;  3OSF A;  5J3L A;  2ID6 A;  1U8B A;  3C2B A;  1ETQ A;  2EZL A;  1WCM J;  2ME0 A;  2LY9 A;  5FKL A;  5EGO A;  2M9H A;  1QRY A;  4JX6 A;  2L0K A;  2ECC A;  1XS9 A;  2DA5 A;  1WI3 A;  2R92 J;  1RPW A;  3GTJ J;  3UKG A;  2LD5 A;  3DEW A;  5M3M J;  2HI3 A;  1WH5 A;  4M3B A;  3CCY A;  4QSH A;  2NVY J;  4A3J J;  2PMZ N;  2Y0S N;  4FE4 A;  3F0C A;  1W0T A;  1H8A C;  1B72 A;  2DA2 A;  2E2H J;  2NS8 A;  4A3D J;  2VPR A;  2HYJ A;  3FIS A;  3LSJ A;  4X6A J;  1W0U A;  3M4O J;  1NK2 P;  1UMQ A;  2R5Z B;  4UUT A;  1E3O C;  1JUM A;  3TED A;  3QQA A;  2WV1 A;  2X9D A;  4A3M J;  4B1R A;  1FTT A;  2R5Y B;  1ETY A;  1XC5 A;  1F43 A;  2JJ7 A;  4JX4 A;  1WPK A;  2CUE A;  2CUF A;  1BJZ A;  5EZG A;  1CQT A;  4Y52 J;  4IHV A;  2XSD C;  3CDL A;  1JJ6 C;  9ANT A;  3ZQC A;  4C3I J;  4RDU A;  3H3V K;  3GTK J;  1PUF A;  2D5V A;  3SJM A;  4BBR J;  5IP9 J;  3I4M J;  3HDD A;  3IH4 A;  3HOU J;  5J1Y A;  5M3F J;  1T56 A;  5M5X J;  2YUS A;  1GV5 A;  1Y1V J;  2DA7 A;  4M3D A;  1HF0 A;  4A3L J;  4J19 A;  1GV2 A;  2L7M P;  5GPC A;  4A3B J;  2R5Z A;  5F1J A;  4IHY A;  2L7Z A;  3H0G J;  4DYR A;  5C4J J;  3BTJ A;  2Y30 A;  3OIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...