2OUMA

The first domain of l1 from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
129
structure length
129
Chain Sequence
ALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Domain I of ribosomal protein L1 is sufficient for specific RNA binding.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 25
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oumA01
2OV7A 2VPLA 2OUMA
chains in the Genus database with same CATH superfamily
4F3QA 3PSIA 4U0WA 2NYXA 2F5DA 3WGIA 2P5VA 3QP5A 1TQIA 1VF9A 3ZN1A 1RR8C 3HSEA 1TWHJ 4PDKA 2XASA 2KZVA 3CCYA 3RDIA 2EZKA 3WTUC 3ZP5A 4HAMA 2R3SA 1T39A 2WB1N 3DLAA 1SAUA 2DLLA 3F8MA 1QGPA 2M1BA 2W84A 4MEYF 3VSKA 3TO9A 1FNNA 4UV9A 4EJTA 2LDUA 2DQLA 4RAZA 4L0YB 2FBHA 2IS6A 1J0RA 3WTSC 1A5JA 3ABKH 3TDZC 2JVGA 2V1DA 1VQ6I 2AHQA 2DMUA 4IQ4A 2CV0A 3EUAA 2E5ZA 1D1CA 3PSFA 3HOZJ 5J8FA 2FNAA 3ZRGA 1DU0A 1S29A 2LD5A 2GWRA 4IHYA 2D1HA 3W3CA 1W36D 1AA7A 4QPQA 2A05A 2GZWA 4M3GA 2CH0A 3BPVA 3BR5A 1TT0A 1HOMA 3CMMA 1FZPB 3GFMA 4C9YA 2HS5A 2ISZA 5IYDJ 2VJJA 4DZPA 5IOYA 4S04A 2VOOA 2EV6A 5A2QZ 1O3SA 2WAFA 2AXTC 4HZFA 3V8KA 1FYLA 2DXIA 3OYGA 2H6CA 4MHGA 3FM3A 1XG1A 1JI8A 2UZKA 2QA4I 3RJPA 1T56A 2EH3A 2ACJA 3A01B 2VXDA 4R8HA 4B09A 2MH2A 3LA7A 4EJWA 2BW3A 1W0TA 3CCQI 2JJ7A 4BQAA 3TO7A 4BQQA 4MIMA 3LSPA 1A36A 3OL4A 5M3FJ 4P1WA 2K9MA 3OIQA 5HOOA 3M8EA 3OYLA 2W82A 4IJAA 2EBIA 2EFWA 3GZ5A 4L0ZB 2E7WA 3K2ZA 5TJJA 4MFEA 2IA2A 4RB0A 2AS5F 2LFBA 2QGUA 2P8TA 3FXUA 2M7AA 3SZPA 1BR2A 2CQQA 5ILVA 3WTWC 4A5NA 2EZLA 5B3SH 5D4SA 3LSRA 1ZTRA 1HW1A 3P9CA 4AYBA 4BYYA 2FXAA 4OOIA 4YEJA 3HEFA 2DBBA 2Q2EA 2ZKZA 3OV8A 4QWQA 4OIRF 4QPOA 2KDZA 2PEXA 4MTDA 3SDGA 1TWFJ 2E36A 1RR7A 2CG4A 4OAZA 1IZ1A 3K9TA 5JFRA 4ENKA 3J80Z 2K7LA 3L2CA 3I58A 1QZYA 3K4MA 3RKXA 2JA7J 3FXQA 1EJ9A 2LF7A 4BXXJ 1S9HA 3ISPA 3LFUA 4KJZA 2XAGA 4HQMA 3D5LA 1ZR2A 2E1MB 3B6CA 4N4NB 1PUFA 4DJAA 1TWGJ 5KCMA 3D0SA 3KP2A 3PIOF 2K3PA 2HZDA 1R5HA 2IVMA 2VASA 3OYMA 3FK7A 2ZXJA 3DU6A 2QEXI 3KP7A 1T8IA 4F52A 4HNUA 4HX8A 2LNBA 4AYBN 4E70A 4I2OA 4B3XA 5EEGA 4FE4A 3RYRA 3MKYB 2LY2A 1IUYA 4J19A 1P6RA 2MD0A 4DBRA 1NK2P 1E3PA 3FMSA 4FQGA 4AD9A 3GTPJ 3IWZA 5JI6A 4RB3C 3S17J 3BG3A 5FGMA 3CJTB 1J5YA 3F6OA 4RGUA 2XROA 2K40A 4HX7A 4XM3A 1IW7F 2B9SA 2IGMA 2LLKA 4CHUA 2HZTA 4UVBA 1WJCA 2CWEA 1KQ9A 2PG4A 1XGNA 2R92J 3CCEI 4I0BA 2VBZA 3E1SA 3NQOA 1UG0A 3GZ6A 3AL0B 1OCCH 2B0LA 2OQGA 2KHMA 1B59A 3D1NI 5DCMA 1ZGWA 3HOSA 2ZMEA 3F8CA 5FJ8J 1Z05A 3FM5A 2JT1A 2BY1A 2L7KA 3E3VA 3K10A 2DK8A 4BL0B 1W7PA 2L9RA 2LSOA 3ZMDA 4M71A 4LG3A 3EDPA 5D5UB 1MH4A 2YX7A 1IN6A 2ZO4A 3GTOJ 3HGGA 2PMZA 2V9KA 3SHFA 3KP6A 4ZDOA 3RTRA 2BV6A 5HDKA 3ZQ7A 3GXOA 2WAQA 1JKPC 2UV1A 3U1DA 2ZJPF 5HS7A 3LL7A 3PJRA 5DDGA 3LWFA 1ENHA 3ROUA 1YYVA 2D2WA 4G6DA 3FWEA 5DD4A 3CJQB 2XAJA 3O8GA 4NC8A 4CSWA 2QLZA 2ZFUA 4UB6C 4HF1A 3LSHA 3P9KA 4FE7A 2VOPA 5EG0B 3HIFA 3OIPA 3NWSA 1VQ4I 2XGEA 3TP3A 4G7ZF 3ZQCA 3MEXA 2R7OA 1UMQA 1E3HA 4G7OF 1W7PD 3GUDA 4U0YA 3L1PA 3BR6A 3P7NA 4JYKA 4QTRA 2VKVA 1IRFA 4NHJA 3BWGA 3V8LA 1Y6IA 1X1CA 3EYYA 5KAIC 4UY8I 2AQEA 1SFUA 4ESJA 1K83J 4U7BA 3GFIA 2OJED 3B02A 2NAZA 3I54A 4U7DA 3G3ZA 3WTYC 4C3JJ 3G6EI 3AG4H 5LRSA 2DDBA 9ANTA 1D0ZA 1OMIA 2ZXIA 2JRTA 2D1VA 2QENA 2H27A 1YJNI 1FSEA 2BVLA 5HLHA 2QKLB 4CH7A 1QVUA 1WJEA 2ELKA 1HC8A 3ZPLA 1OCZH 2DA7A 1R6RA 2E71A 2XRNA 2Q1ZB 1KONA 3ECOA 3FKIJ 2DA2A 1YRNB 4O5VA 3VB2A 1JHFA 1QRYA 2FU4A 5AIPA 1Z0XA 3LSKA 3NARA 2VE9A 2BYVE 4G6QA 3TEDA 5L3GA 1J09A 3S93A 5EJCA 3LAJA 2LY9A 2Z5UA 5LHIA 2CV1A 1O57A 2Y30A 4CGZA 4EEFG 1ZH5A 4A0XA 1VZ0A 3A1YA 2WADA 3S3NA 1SVMA 5FKLA 1QPMA 3H9GA 5LHGA 3TW7A 4D1QA 1B9NA 1HQCA 3V7RA 4GXOA 1BIBA 4OU0A 3GO5A 1E3OC 1T38A 2V1UA 2XGXA 2CS3A 4JP0A 2X1EA 1TQMA 2CW0F 1HCRA 4P9UA 1MBFA 4XLFA 3QPLA 1U8RA 1Y39A 2AQFA 4IQJA 2H09A 2DQRA 3J7AY 3RZDJ 3WHCA 1WJFA 4P5OA 2DDAA 2W1OA 2RNJA 3HUGB 1BN5A 2A5YB 1SC7A 1HDPA 3ERMA 1FIAA 3U2RA 1VQPI 2XGCA 5CJ9A 2MSYA 4ZZDA 3W2VA 1Y1WJ 1OR7C 1CF7B 2EJRA 3BDDA 2ZCWA 4OMZA 5DV5A 4XBFA 4OMYA 1FC3A 5F27A 1KYZA 4H0EA 2JRMA 3BR0A 3V4GA 3TP0A 2DPDA 5IT3A 3G1OA 3LSGA 1IO2A 2F5CA 1UB9A 1RKWA 2QUFA 1R9TJ 4HSRA 4RM3A 4MNUA 2R4GA 1LE8B 2P7VB 3CUOA 2BHZA 2X1DA 4W97A 3BR3A 3FIWA 1UHWA 1JHHA 1A31A 1E17A 2MYSA 2DK5A 4ABZA 4DZJA 5LEJA 3BTCA 1YTYA 4LLNA 2DA1A 3FMRA 5IT9K 1FPQA 2BXYA 4AIKA 1J59A 2R7UA 3JCUC 4ZTJA 1DP7P 2JUCA 1AWCA 3FXOA 5DM6F 4Y3OA 1JUMA 2X0LA 2ZJRF 3S1RJ 5BMZA 2EV5A 3ABLH 4UUSB 1IRZA 4A12A 1J2XA 3WTTC 2OCEA 4XLHA 5HNFA 2EPFA 1O3RA 4BGDA 1UHMA 1S7AA 4A3IJ 4CZCA 1YQAA 2H6BA 2O6GE 3W6VA 3LFKA 1JT0A 2E34A 3SZTA 4DYCA 2ZSIB 1O3QA 3IV5A 4CZZA 4C2TA 1X1DA 3T8RA 1SD6A 1D5VA 3DU5A 2DODA 3DBLB 5E17F 3HZJA 4M73A 3DPLC 1BIAA 1Z6TA 2KRHA 1ZG5A 4M6VA 1ZLJA 4ASNA 3ZMVA 2LRDA 1K7AA 4GYGA 4D5FA 1SAXA 4EJVA 2YU3A 4A3KJ 3BG7A 3HRUA 1GVDA 3MCZA 3RKWA 5EG0A 4G94A 2IA1A 2PBIA 4N9IA 2LG4A 1EKEA 2Y75A 1JXSA 3C2BA 1WKMA 1ZAOA 2L2OA 3FHNA 2X9DA 1BI1A 1BI2A 1I27A 5HS9A 3ABTA 3TKYA 1V5FA 1FYKA 3T5XA 2ICWG 2FUG2 1IC8A 2KKOA 1VQ5I 2X48A 1Z3YA 3SFZA 4ZTFA 5FKKA 2CSOA 3IWFA 4CICA 5EEAA 3H0DA 2HYJA 3ZQGA 2H8RA 2B63J 5JHFA 1L0OC 2YPRA 4LG0B 2GOXB 1APLC 3WTZA 3HDDA 2HTSA 3QAHA 2IGKA 2O61A 1D0YA 1KGSA 3IC7A 4MFDA 2AO9A 1MBGA 4L18B 2CUJA 2DJIA 2GIZA 4XRSA 4I7HA 4CCNA 3QQAA 3BTLA 2MG4A 4HV6A 2K27A 1FOXA 4XLAA 2VN2A 1BC7C 1X1PA 4M9ZA 2Q8KA 5F0FA 3S1MJ 2XF5A 2F4MB 2WY8Q 3QODA 4E7IA 3EETA 1QHHD 5ERIA 5KAFC 2XRLA 3ZMSA 2RV8A 3RIRA 1YRNA 1R1TA 3DKYA 1W36C 1DU6A 3GLLA 2XUBA 2ELJA 3IRRA 3C7JA 1TWCJ 1UZCA 3FMQA 4Q47A 4BNCA 1DP3A 3ZQQA 2XGDA 3BG6A 1XPXA 1H0MA 2ID6A 4HQEA 3KP4A 2K02A 2KRFA 2LH9A 1MJ9A 4F92B 3R60A 2DTZA 3BJ6A 4XMYA 3JAMK 4JX4A 1MBKA 2DFIA 2XIGA 1A6QA 4BXUA 2Z9OA 2FMYA 3U1KA 4LIVA 1IXSB 2DPUA 3RKYA 1XMKA 1Y0UA 3HC7A 2K5CA 4M3EA 3X2QH 4EM1A 4M9XA 2L0KA 5C4JJ 5E3OA 2LR8A 3WGGA 2DO7A 3GYHX 1YFHA 2L54A 1RKTA 3H3UA 1UCRA 1RESA 2JQ7A 1YS6A 3Q9SA 1ITYA 3HUGA 3ZCOA 1SMTA 1U0JA 4BJ5C 4NUBA 2WTEA 1X3UA 3K4LA 1ON2A 3OYIA 3H35A 5IPAA 1Z91A 1ETOA 1JGSA 3BLYA 3PUFA 5L3DA 1CF7A 3ULQB 5D4RA 1USTA 4E7ZA 1Q1VA 2BY2A 2ESNA 3KZYA 3RI4A 2W25A 1HSTA 2DA3A 3IL2A 2VUMJ 1GXPA 1HKTA 2KPMA 1U5TA 1XSVA 2COBA 3I4MJ 1O4XA 1FYMA 4XL9A 3EUHA 2XB0X 2HDDA 4Y7NJ 2BBYA 2IW5A 1TW2A 2L02A 1LE8A 2ZFWA 3I5UA 3CP8A 3F22A 1BC8C 5D6FA 1S6LA 4K2EA 3SQNA 2M9HA 1BJAA 1ZGAA 2KIUA 2V26A 3I55I 4I99C 2NS0A 4U87A 4DNCA 4DYRA 4G8XA 2X6OA 1VTNC 1HDDC 2EIJH 1OKRA 1MMDA 3KEOA 1YOVB 2DT6A 2F4IA 1FMWA 4XRSG 3LNQA 1VQMI 4ZDPA 4IKFA 2J5PA 1XGOA 3W2AA 5CVJA 2E35A 2HYFA 1FLIA 1MZBA 3F8FA 1A6IA 3HHHA 2VJ4A 3OOUA 5J8CA 1WJ5A 2HWVA 2HOEA 2VJIA 2A07F 3BQZA 4CYDA 4I01A 4UUSA 3F23A 1ZR4A 5IP7J 2X6XA 2KJBA 2LF8A 4HNTA 2V9PA 3OSFA 2WB1A 1Z6RA 2GLOA 3RKQA 4RMNA 2JSCA 3IH2A 3W2WA 2FE3A 3MAJA 4F93B 1J7KA 5GADJ 4BE1A 1ZN2A 2NVTJ 1WI3A 5FLMJ 1XSXA 4XR6A 5F0HA 5LEKA 3FXLA 2OBPA 4AIJA 2CV2A 1SD5A 1IG7A 2YR2A 5LLQA 2LK2A 3KE2A 4WCGA 3OYBA 2HNHA 4UV8A 5EZHA 5GAGJ 5K5QA 2R7XA 3BQYA 3ZQFA 1IJWC 1FTZA 4KN7X 3NWTA 4G12A 3OYNA 2E1CA 1YHQI 3M3YJ 3CCSI 2L7MP 5DM7F 3S2DJ 1ERDA 5EDNA 1P7JA 3WTVC 3DBHB 3O8HA 3HPGA 3CMYA 5ICGA 1T33A 3PO2J 1VQOI 1HKSA 2E2HJ 3G73A 1O7FA 3I4PA 3IP4B 1UG2A 2HQRA 3VODA 5FKMA 1YE9A 4EVIA 4GO1A 4A3LJ 3J7ZI 1MNMC 4I98B 4PJLA 3V7SA 2RVCA 5C3EJ 2JA8J 3S1QJ 3CD6I 3HSRA 2OV7A 3CC4I 5LGTA 4NBQA 3CO7C 2VBWA 4PJMA 4G7HF 1YW8A 3J80K 2M4GA 3J81Z 4YFXF 4XICA 1GDTA 5M5XJ 4KIBA 1ZG1A 1G6NA 1I50J 1KQ8A 2EK5A 5J4VA 4Q4ZF 2ELHA 3QU3A 2M30A 1CQTA 2WBMA 1Q1HA 2FQ3A 1NG7A 2CU7A 1V55H 2K3FA 1I6HJ 5CVVA 4RA2A 2K9NA 3TOBA 1KQ0A 1P9QC 1I6XA 1U78A 2EIKH 1WCMJ 3BG9A 5E3NA 5JVGF 3BPXA 4CCOA 3JRGA 1FP2A 5C4XJ 2O5RA 2W48A 3DKXA 1OCRH 1ACIA 2K4JA 2ZMEC 3QWLA 2QF7A 2TRTA 1NTCA 2XPVA 5J1YA 4BDZA 1YITI 1IDZA 1MKMA 5E20A 2UXNA 2FOWA 1LNWA 2HVQA 2M8GX 4UXNA 4I02A 2ECCA 4PJJA 4HF0A 1QNTA 3EUKL 4RAYA 3HKZN 1POGA 5J1UA 4PCQA 3HTSB 2HQAA 2O8KA 1ZG3A 2PQ8A 1XSDA 3ZQHA 3LA2A 4FHTA 3HGYA 1SEUA 4M72A 3VSLA 3EYIA 4KMFA 1PYVA 3SEQA 1D5YA 1REPC 2RAEA 4ZH4F 1W1WE 1X4OA 5E1XA 4FTHA 1MD0A 2OD5A 3I59A 2IEKA 1D3YA 3OYEA 4IHTA 1VQLI 1X1AA 2HTJA 4KNYA 2DAOA 1OJLA 3O2PE 3HRMA 2K85A 2KZGA 4GCVA 3L7WA 4Y15A 2IA0A 5H20A 1LVAA 1ETYA 2Z1DA 2R7SA 2IT0A 5CPRB 4D5CA 2IP2A 4DOZA 1KU9A 3ASNH 4MGRA 3RPUA 2VPRA 5EEHA 2HOAA 5LRRA 2EIMH 2Y9YA 2OCCH 5E79C 1JKRC 2J5OA 2XV4S 3E7LA 4XOTA 3OS2A 1R1VA 2LVSA 3JR9A 4A3JJ 3IAM2 5HDNA 1R58A 1SMYF 2A6HF 2JA2A 1LEBA 3PNYA 4A3CJ 5DUKA 1XC5A 2PJPA 5HLGA 1KZHA 4YELA 2QSHX 3JRFA 4BBSJ 1TBXA 4OINF 4IHXA 1SFOJ 2KLOA 4JQFA 3ZMTA 5M3MJ 1T2KA 1T08B 2PFBA 1E2XA 4IRHA 3CUQC 5ILSA 2L3DA 2DA6A 2ZBKA 3L09A 5J47A 3SJMA 4IZZA 2LP0A 2Y69H 4LD5A 4EATA 4BACA 3CLOA 2FBKA 3MZHA 5DYMA 4A93J 1MJBA 3P9IA 1DQUA 4UVCA 4L9TA 4EQQA 1ON1A 5EYRA 3OS1A 4CCKA 2IS2A 1W4MA 3RPUD 1WRJA 2ZNYA 3R4KA 3BOQA 1JE8A 5B5EC 2EWNA 2XKPA 3OR2C 2GM4A 4XIDA 2FJ1A 1DGRM 1IV6A 2WC2A 3JRHA 4OWRB 4HYEA 4UUVA 2JWTA 1K78B 4XLEA 4IHWA 1FBSA 5FKNA 3WU0A 2KIQA 3GFLA 4FCYA 2DOFA 1R22A 3FBIB 2ECBA 3MQ0A 1B9MA 1BJZA 3ZQIA 3OYDA 2HOSA 1PVEA 1TP4A 3M1EA 4RB2C 1W5TA 1F1ZA 3JTHA 5CVIA 5HVQC 2VL8A 2XSJC 4FX0A 1XDSA 3CMEI 3ZN0A 3T0YA 5HODA 1JJ6C 3K69A 3QYBA 2IRFG 3P5JA 3ERED 2LREA 3SYTA 1RUNA 3DEWA 1N78A 4E7LA 2DA5A 4ESBA 3AKZA 2RQPA 2IBDA 1EH8A 3RPQA 4OIOF 3CCJI 2E60A 3DXJF 4XKWA 2O8XA 3CESA 1MSEC 1LEAA 2YX4A 4LB6B 4S05A 1S72I 2Y0MA 3HOXJ 5F04A 4BH9A 3K1PA 2BVMA 4IL6C 2CGPA 1Z1DA 1IRGA 3MFKA 3DBRB 5JR3A 1PUEE 3H3VK 3F72A 2E1OA 2OUMA 3VYTB 1IXCA 4XONA 1WVRA 2A6EF 1N25A 4PSWA 4DIQA 2BOLA 3G1LA 4KIGA 2NVQJ 1OYYA 3VYRB 2PX9A 1QA6A 5IOZA 3M4OJ 2QKMB 2CJJA 2ZNZA 1HXDA 1FY7A 3GLXA 4RBOA 5JHUA 3AL0C 2MGQA 2DTRA 1GT0C 1Y8RB 4ENMA 2GOMA 1OYIA 1MDMB 2DJNA 2Y48A 3IH4A 5K1YA 3A01A 1MNDA 2VI6A 3PFIA 3TBIA 4XN3A 1OPCA 1MBHA 2PI0A 5FD5A 2X51A 2I10A 1YLFA 4NQWB 2ESHA 3CCMI 4RLQA 2DFHA 2EILH 3KEYA 1XTAA 5CKTA 2GXAA 2QCOA 2AXLA 2RKHA 4J01A 3BJAA 4CXFA 3OYAA 4EJOA 4XRMA 1P7IA 4XLNF 2VXZA 1B72B 2HYGD 3J7AO 4KT5C 3E5UA 2LKPA 3VDXA 4ANJA 2GXBA 4PGGA 4CA0A 2HR3A 2F5FA 2L4AA 2TDXA 2KJCA 2LTPA 1T98A 1X3WB 3HBLA 4B48A 1EA3A 3H0GJ 3H36A 1YW7A 4IRGA 5BOXA 1YJ9I 3PNVA 4UUTA 2E2IJ 4LOCA 3LA3A 4GRIA 2JMWA 4N9HA 4BHPA 1USSA 1ZRFA 1W5SA 3SZGA 4ZJZA 3R0AA 1B1BA 2Z2SB 4JK1X 4KIFA 2P6SA 4RGXA 4CUGA 5F0CA 2I8DA 3KYDB 5KVRA 3DWLE 2BY3A 3M1CA 3MVPA 4L5JA 3S3MA 3RZOJ 2VKHA 5FD6A 1ZRDA 3S15J 1LJ9A 4HDVA 4Y33A 2LC2A 1MSFC 2YS9A 2OA4A 5DS9A 4IOAF 2R93J 1EH6A 3OWTA 2JVHA 2A6TA 1XD7A 2KDOA 1LDDA 1B4AA 1YJWI 2JSPA 1D1BA 3VEPA 2F2EA 2NRAC 1QQIA 3TGNA 3L2WA 4ESFA 2YU9J 1Y8QB 4PK4A 4RGSA 2RREA 3IKVA 1RRJA 3IH3A 2OU2A 1WWXA 2FBIA 1X3ZB 1MMGA 1WJDA 1UELB 4EM2A 1A35A 2M4KA 3KZIC 4CCMA 2VONA 2NNYA 2DOEA 1OCOH 3K2AA 5BNGA 2R7DA 1BBYA 2KIFA 3ASOH 3OYCA 1K4SA 1X2NA 3LSTA 4PFPA 5E8GA 1R4MB 2W7NA 5FLXK 3IHUA 3F9KA 5HLTA 2STWA 2DCEA 2VE8A 3QPHA 1WSUA 1FOKA 1K6YA 2F4OB 4YFKF 1VQ7I 2HXIA 2CQXA 2M2EA 4ZC3A 1FWZA 2HU9A 4D7NA 1XN7A 4YRVA 4HSTA 5B1BH 3SFIA 5LD2C 2KRCA 1L3LA 3JREA 1FTTA 4ZYAA 3G2BA 4DBQA 1BL0A 2M5WA 4KUMA 1K78A 4IVNA 3EPZA 4BY1J 1U9NA 1JKOC 2ZXWH 3T8TA 2EZHA 1LFPA 1SANA 3TMOA 5ED4A 2A3SA 2UXXA 1MJAA 4XSZF 4PJNA 1WGXA 3LMMA 1ZHFA 3I3LA 1XGMA 3HYIA 3OSGA 3MKZA 5KNLA 4B1RA 3WG9A 3K4CA 2COMA 2MH9A 3CF2A 2DT7B 1X4PA 3JRCA 3DF8A 4ZYDA 1LUJB 1HW2A 5E8IA 1XDUA 4CYCB 1MIJA 3CCUI 3KP5A 4X1EA 1LFUP 3K0LA 4WXDA 3S1NJ 4P55A 1ZRCA 3TO6A 1WFXA 4RLFA 2LYCA 3LQRA 2HEOA 4G9YA 4KT6A 3WTXC 1S7EA 1BI0A 1SFKA 4ENNA 2XC7A 5E3LA 2Y9ZA 4U0VA 1IAWA 4BXFA 2DW4A 3M07A 4BY7J 3GX4X 3DTEA 1U5TC 2FMLA 1UFMA 3EUHC 4A69C 3BZ6A 3R61A 4IHVA 3AAFA 2PLYA 3BJOA 4LLLA 2F5VA 3CCVI 2NOGA 4LJZF 1TC3C 3GZNB 1RIOH 3B6AA 4EV0A 2E2JJ 3CC7I 2JK3A 4QLCU 2VJ5A 3VYSB 2EFOA 2BEOA 1D8JA 2CW8A 3W6JB 1I39A 3F21A 1VQNI 5E18F 1IN7A 1MDMA 3L2RA 2KQRA 5F08A 1K4TA 2QZ8A 2YUSA 4JBAA 4E7SA 2TCTA 1YX5A 2FNPA 5IP6A 4XN0A 1G3TA 1XX5A 4XKVA 1VNDA 1Y56A 2WV1A 2IAIA 3E6BA 2CRGA 1BOBA 3HRTA 4NQWA 2A61A 2DMPA 3A4CA 2Z33A 2QBYB 2R7RA 4IRIA 1T0FA 1JUSA 1MNEA 1X1BA 2Y31A 1ETKA 3ONQA 4HEA2 4DQ2A 4EGYA 4YIFA 1X58A 3HOYJ 1B72A 2XDVA 4FETA 2NVUB 3PL8A 1X19A 2GQQA 2NS7A 2Z3YA 5FRMA 3I0TA 5K7FA 1PDNC 1EH7A 4X0GA 4EM0B 4Z6YA 2M45A 3JW4A 2MLKA 2EA4A 4M6YA 2D5VA 4P9FA 4UNOA 1YO5C 5M5YJ 3OMYA 3FXRA 2R7TA 3H5NA 3CJRB 5K5OA 2HVSA 2DMQA 3FXMA 1TQPA 2VBYA 3K70D 1AU7A 4XORA 1BA5A 1LDKB 2Q0OA 2G9WA 1K6OA 3FXJA 4MQVA 5FKOA 3WG7H 2QYOA 4B4CA 4YFNF 4BE0A 1N77A 3Q9VA 1IDYA 2BGCA 4Y52J 4AIHA 1R5ID 2Z16A 4L5EA 3S3OA 3HG9A 3KLOA 4WX9A 2NXNB 4ZDLA 4B3AA 3HB9A 4R1HA 3WODF 4ZYHA 2E7XA 3GMEA 4IX7A 4V19K 2JZYA 3ECHA 3IUOA 4ZYEA 1H89C 2GXGA 5B66C 2V6CA 2L9VA 2DA4A 4M3DA 4HLYA 2BE5F 3Q5FA 2ZSHB 2EFQA 3H5AA 4BEHB 5J4YA 3CTAA 4HW0A 3OS0A 2L5QA 1DPRA 4Q5SF 1OCPA 3D5SC 3OYKA 2PJRB 1U8BA 4M3FA 5ICEA 4KICA 1SD7A 4RS8A 3WE3A 3CQZJ 3WU2C 1TWAJ 1XMAA 1V5GA 3HXLA 2L4MA 3LQQA 4DGWB 4IEJA 1U3EM 4MEXF 2K9SA 3CDIA 3EQLF 2L7FP 2OAZA 1S3JA 2JTVA 2FD5A 2E5NA 1MGTA 2MA3A 2DMNA 2HOTA 2BHYA 3O3KA 5EF6A 2P4WA 3K1NA 1PUFB 1Y1VJ 2EQRA 3CZ6A 1G3WA 5CVRA 2KMUA 5IYBJ 5K7HA 5C44J 4KYWA 6PAXA 5KHDA 1Z9CA 1FX7A 2UWMA 2VQCA 4RDUA 1HF0A 1C0WA 4RAFA 1OQYA 2L9SA 3ZOBA 4GFBA 2A68F 4DW6A 3PQJA 1ZARA 5FROA 2HDWA 4FX4A 5HDGA 3FISA 3J81K 4RGRA 2OTLI 3AG2H 3V8JA 3CO6C 2NVXJ 4A3BJ 3BY6A 4ENJA 3K6GA 3JAMZ 1Z77A 4N0BA 1TNTA 1WJAA 4HOBA 1G59A 2JA5J 4NC6A 3QPSA 3I9V2 5A2QK 5BPIA 5DTDA 2O3FA 4RAGA 3A2KA 5FLVA 2CW7A 2DFFA 1W5CC 3KPHA 4LIUA 3ZGKA 2D45A 3FF5A 5HLIA 2LKXA 4B47A 4D0PA 2OZ6A 2WWYA 1WHUA 3E6DA 3PQKA 1SFXA 1ODDA 1TTYA 4B8XA 4XQFA 1NK3P 3DLLF 1RI7A 4BHCA 3PIPF 2E1NA 3C1DA 3IKTA 1KU3A 2M3AA 4Q48A 3Q0VA 2O9LA 1ZKGA 3KEQA 2XAUA 1LDJA 2K86A 2HGCA 3VFZA 4BUPA 1J75A 1W7PB 1IF1A 2WY7Q 3BCAA 4LGWA 5L3CA 3KP3A 4L9JA 1GHCA 4PUSA 5GPCA 4M9SA 3LSMA 1M1EB 3UR3C 4BQOA 3PUBA 1ZK8A 2QM3A 4LG0A 3BCBA 2FOKA 5GTIC 1HSJA 4M74A 2KP6A 2JN6A 3DCFA 1R4NB 4BAYA 1ETQA 1PJRA 3A02A 2M8EA 4HA8A 3HKZA 4UB8C 1SVOA 2QBYA 4B44A 5F1JA 1X2MA 3K7AJ 1Z21A 2ZJ2A 4KITB 3CJNA 5F1RA 3MMYB 1MMSA 4AC0A 2EZIA 4CCLA 3TDUC 1ULYA 3I56I 4A3FJ 3T1BA 2JPBA 2A5WA 3VYUB 3IRQA 3S8PA 1A04A 5HS8A 1XB4A 5LHHA 1Z7LA 1MBEA 1WH7A 4E7JA 2HXOA 3E6CC 3ABMH 1TZLA 1H9TA 5J3LA 3UNGC 1JGGA 1BM9A 2BXZA 3CLQA 2EINH 5DEQA 2PN6A 4C30A 2G7HA 3FBNB 3V42A 1QPIA 3PNTA 4LFUA 4JX5A 1R49A 4FASD 5E3MA 2XVCA 1RUOA 2KL4A 2V1NA 4QIWN 3O6BB 2M0CA 3FZVA 2VQLA 2FA5A 3KCCA 3H9JA 4V2FA 4E7HA 5IP9J 1OFCX 4L9VA 5GPAA 3PFYA 4AUXA 3G71I 3RCOA 5GP9A 5AONA 2VKDA 3GTQJ 1I1GA 1TNSA 2XB5A 1BR1A 2CFXA 3A0BC 3CUQB 4BEHA 2V9VA 2ISYA 2HQNA 3MZYA 2ETHA 2DT5A 1FT9A 4ETSA 2VBXA 2BY0A 5ICFA 2PJRA 1WH5A 1O3TA 1ZELA 3MKLA 4WXHA 4JOMA 2XF7A 1FSHA 2X6YA 2XAFA 1QZEA 3FX3A 3GVAA 3JRBA 1P92A 4BU2A 4HF2A 5E1WA 3F6VA 2VC0A 5FO5A 5GAEJ 2GIVA 1QZZA 4HDUA 2VT3A 3VWBA 1MH3A 3BZCA 3E5QA 3OL3A 4JX6A 1WI9A 1ETVA 3OOPA 4Y4RA 2O0YA 1HBXG 1IGNA 2Z99A 4HRIA 3GFJA 1H9GA 4WWCA 3M8FA 2V7FA 3E97A 2JA6J 2H1LA 2IXSA 2HKXA 4A3MJ 2CUFA 2L9NA 2ZC2A 4AIDA 5FRNA 4NDLA 5D8LB 4BQNA 1OCTC 3KYLA 4BKXA 3KETA 1RPWA 4HX4A 3I4NJ 2NVYJ 1RC9A 2L01A 3K1MA 5TGTA 1RZ4A 3IAS2 3QOPA 2P6TA 2PMUA 4WF2A 3GTJJ 1I1SA 1GUUA 2R7QA 3AG1H 1STZA 3A0HC 2STTA 4H4KC 4HBLA 3ABUA 1P4XA 1T95A 3BTIA 1IRXA 5K7ZA 2MW8A 1IN4A 1ZQ3P 1LB2A 1MW7A 1S7OA 4NB5A 4HNVA 4F91B 1YS7A 2VQGA 3L2UA 4OIQF 3JRIA 1E0EA 2MC4A 3DFGA 2GAUA 1D1AA 3H1CA 3OR1C 1WPKA 2GA2A 3ZMZA 3AG3H 3QPTA 2QQAA 1FIPA 1TL8A 3HJEA 2FRHA 5M5WJ 2WAEA 2EFPA 2MABA 3WE2A 3F8NA 2E1MC 2G7UA 1QU3A 3CDHA 3F0CA 3HTUA 1QBJA 4PSXA 3ESWB 5L3EA 2P7CB 1T6SA 3E0JB 2ZB9A 5J6XA 2QSGX 4O3MA 1U9OA 2OF7A 3DQVC 2NNNA 3COAC 2XAHA 4G6TB 1EF4A 2W85A 1NHAA 2MBFA 4KISA 2A69F 3ZR8X 1WQ2A 2FEZA 3JTGA 2R5YB 4EGZA 4UHTA 3GTMJ 3A03A 1UHSA 1FBQA 4CCJA 3CCLI 2XF6A 4AWXB 1K61A 3HHGA 3BT9A 3DKWA 3FDYA 1DDNA 1G3SA 1XCVA 2R7FA 2XAQA 3BR1A 3MKWB 5B1AH 4MO7A 2RQQA 3BG5A 3ML6A 1G2HA 5E1ZB 5LGUA 1P4AA 1CGPA 1FJLA 5IY5H 4XNFA 1SVLA 3DPTA 3L2VA 4V2GA 4XRFA 2HKOA 1JT6A 4F7ZA 2CUZA 3M9AA 2EA2A 4C3HJ 4KMUX 3C18A 1KA8A 2NOJB 1JUPA 3BC8A 1K79A 3V7CA 3D5RC 4ON0A 3SEZA 3FHZA 3G1MA 4BE2A 1F4KA 4MLOA 3CF5F 3HOUJ 2K4BA 1S8NA 2CQ7A 3RSNA 2NS8A 1NH3A 2EB7A 4AVZA 4TV7A 1N75A 2PMZN 2W24A 1DGWY 1R1UA 3E5XA 3H9QA 2W4SA 4AU7A 3DPUA 1FP1D 3H92A 4I0AA 2WAQN 1XS9A 3TOAA 1R5GA 1HKQA 4HV5A 4W1UA 4EMSA 3NAUA 2DOAA 2LMDA 3Q3SA 3LSIA 3I71A 4EJUA 1XGSA 2WV0A 4RB1A 3KX2A 1G4DA 2X85A 5LBQA 2YSRA 3SDBA 4A0YA 2OTJI 2XSDC 1YX3A 4O6JA 3K4BA 1U6GA 1TLHB 3CUQA 4N4OB 3OYJA 4KA4A 4BHBA 3QU6A 2CFOA 2XHKA 3BP8A 1XCBA 2QWWA 4L5IA 2L7ZA 5CYVA 3GEZA 2RDPA 3HM5A 2B7EA 4IXAA 4QSHA 1R71A 2JUGA 5F64A 2VPLA 1SD4A 2K9QA 4OAYA 5L3BA 5CVUA 4A6DA 5JVTA 2OC6A 2C6YA 3DEUA 4Y17A 5F6FA 1WZ2A 1V3FA 2CYYA 2V79A 1GV5A 4IPAA 4R79A 3S2WA 3HSFA 4UVAA 1OISA 2Y0SA 2DN0A 3KLNA 5FB2A 2OPTA 2RGVA 2FX0A 1B8IB 2H8WA 3K70C 1S5LC 3L00A 2BZTA 3H5RA 1SFEA 2M34A 4E6KG 4M3BA 3U9GA 1KU7A 3ELKA 3F8BA 1Z67A 4S0HB 3UKGA 3QRFF 3HPHA 2IJLA 2M0MA 2HFHA 3K4NA 4IOCF 2CQNA 3W6KB 1Z3XA 4MQ9F 2W00A 3GTLJ 5D5VB 4DYQA 2IS1A 3TL4X 3OIOA 3MN2A 4YIRX 3RYPA 3WHBA 1LFBA 4HLXA 1T0FC 5FFZA 4ZZLA 2MC3A 2CUEA 4E4HA 2VODA 1JTYA 2WA0A 1D8KA 4BS9A 3RQIA 5D5XB 1O7LA 3N05A 4L9NA 4PGHA 1OYWA 2MLGA 3TW6A 2R5ZB 2LBFB 3CC2I 4RM2A 1VFCA 2Y0SN 2HPIA 3WGHA 2X1CA 5BQTA 3GTKJ 3QYFA 4IF4A 1YIJI 3REOA 1FOYA 2IGNA 2LKSA 3I53A 2XPWA 3VPRA 2ID3A 4HPQA 2HQ5A 5CQEA 4AM3A 1GV2A 5DD8A 4C2UA 1I3QJ 2LOOA 1B6AA 1U5TB 2GBYA 3DTKA 1R36A 2QQBA 1QHGA 3KFWX 3MZ8A 2CO5A 4II3A 3RQ4A 2QQ9A 3HOWJ 3WU1B 4YIIA 3S14J 2F6CA 4GGGA 5KK1A 2MFZA 1F5TA 4AVPA 1ZYRF 3AFHA 4P96A 1PP7U 1VQ8I 4J00A 2CMPA 2I5UA 1JKQC 4LITA 5CLSA 4D9JA 5J1RA 3FK6A 1RNLA 4NC7A 4I76A 3SXYA 2VT2A 4XKCA 1V54H 1ETWA 3S16J 2R5YA 1BW5A 5L3FA 4CDGA 1TT5B 1AOYA 2EV0A 3Q0WA 4WK8F 4II2A 3DEEA 2FF4A 1I5ZA 1KU2A 2DFEA 2QQ8A 1RETA 4A6EA 3GTGJ 4MTEA 1TW3A 1VQKI 5EGOB 2RC4A 2P5KA 4YG2F 4KDPA 1BW6A 4XKBA 3CMAI 1V4RA 1ZGJA 2HVRA 3GCMA 3BR2A 2CQKA 3E6MA 1FEXA 2P81A 1QO0D 4BJTA 1AHDP 1YI2I 4XK4A 2VKEA 5DUIA 1F36A 3G4SI 1R23A 2M7BA 1PP8F 1UAAA 4D7MA 2ME6A 1IN5A 3LAPA 1U2WA 1AKHB 1LVKA 1IV8A 2E19A 4XSXF 3L9FA 4E7KA 4NNJA 1J9IA 2DMTA 1H88C 1ONVA 3HOTA 5FFXA 1FOWA 4XLCA 3FKJA 5FLXZ 4IHSA 5EZGA 4XLPF 2UUZA 3ZXSA 2JPCA 2ADUA 4BJ6C 1WJBA 1ZLKA 1XMXA 4GYIA 5LFAA 2DYRH 3M7GA 5DCFA 4LMYA 5TRDA 4LK1F 5GAHJ 3BZKA 3HRSA 4C2MJ 5JLWA 1HA8A 4Y13A 3PM1A 4A0ZA 5K5RA 3QP6A 5BPDA 5IYCJ 3MWMA 5IT9Z 4KN4X 3JSPA 4A3GJ 1LPQA 4PJ0C 4C3IJ 2DYSH 2F5EA 1UJ8A 2V6EA 3TQNA 2KIMA 5D6EA 1QVTA 2GA1A 3QOEA 4LLGF 1P2FA 1VI0A 4LK0F 1OR7A 1VQ9I 5LGNA 5TISC 1H8AC 3B73A 2IGOA 4A2UA 5BS6A 1YG2A 1YW9A 2FSWA 1W0UA 1OLTA 5D8KB 1BR4A 2HI3A 1G8XA 1IXRC 4PZJA 1MMAA 4A3DJ 3OY9A 3MD2A 1BOAA 3OYFA 4Z2YA 1FMVA 2VC1A 4BBRJ 3PO3J 3R6SA 2Y2ZA 1GLNA 3DV8A 4LB5A 1R00A 1FBUA 1B8IA 2BW3B 2XPUA 3DTIA 2XKOA 5GTHC 1G3YA 1V5EA 3JRAA 3L2QA 1LKXA 1D0XA 2RN7A 1R7JA 3C2HA 5J40A 2R0QC 5ICCA 2HPMA 2M87A 3C2GA 3C3WA 2P5LC 4WXCA 2VLAA 3K4JA 4ITVA 2RNGA 2W57A 3LSJA 2LY1A 1JJ8C 3HOVJ 4IO9F 5H2FC 2DU9A 2H94A 5JLXA 3GW2A 1I3AA 1BI3A 2Q2EB 1F43A 3NEUA 2V1XA 4I09A 2X4HA 2R7ZJ 2OQRA 4FT8A 2V4JC 3F3XA 5CQGA 3KYCB 1F9NA 4U88A 3JSOA 2O7OA 3FXKA 3I59B 2R5ZA 2LBFA 2H1KA 2O03A 3U21A 3N97A 4FISA 4KFCA 3BROA 2N8GA 1P4WA 1ETXA 2IPQX 4A5MA 3CP2A 3GBGA 3KZZA 1KYWA 2PMHA 3BTJA 4M6XA 1HLVA 5HNHA 3CDLA 3HL2A 1Y0NA 1ZREA 4GDFA 2G0EA 3GWZA 2VQHA 2R7WA 3LOCA 5D5WB 4HG2A 2K9LA 1LQ1A 2QSFX 3VOEA 1IN8A 2P0WA 4XOPA 2ME0A 1GVJA 2R7VA 2OZUA 2FQ4A 5ILUA 1HW5A 1NG6A 4ZYGA 4CO8A 2HDCA 1ORKA 4X6AJ 1Z7UA 5AIQA 2KFDA 3KIOA 3OYHA 3JRDA 2DI3A 1DPUA 2ZJQF 4I6ZA 1EV7A 2KISA 1MMNA 4PFOA 4CYCA 4F55A 3J7YJ 4B43A 1JTXA 2ZXHA 3ZQLA 2QVOA 3I64A 1DUXC 3S32A 5EGOA 2MD5A 3H3ZA 3CCRI 2X6WA 3Q0UA 4BDYA 1GXQA 2VIXA 2EFNA 1YIOA 3DP7A 3NRVA 5H6QA 3GF2A 2F48A 4OIPF 3M8JA 4A3EJ 2KT0A 2IS4A 3S2HJ 3K4KA 2VB6A 1IUFA 3QYEA 3ZMUA 3R0JA 5DCMB 1AKHA 1MBJA 5H6RA 2ZMEB 3N4MA
chains in the Genus database with same CATH topology
4F3QA 1T95A 3PSIA 4Y33A 1IRXA 2LC2A 2CUJA 2DJIA 4CCNA 4XLAA 1MW7A 3L2UA 4F91B 2KZVA 2VQGA 3OWTA 2JVHA 2A6TA 1E0EA 2KDOA 2XF5A 2MC4A 2WY8Q 3QODA 2JSPA 4E7IA 1D1AA 1QHHD 3OR1C 1D1BA 3DLAA 1SAUA 3L2WA 3DKYA 4PK4A 1W36C 2RREA 3VSKA 2ELJA 2WAEA 2MABA 1DP3A 3ZQQA 2E1MC 1MMGA 1WJDA 1UELB 2IS6A 2M4KA 3BG6A 1QU3A 4CCMA 4PSXA 3E0JB 2JVGA 2LH9A 4F92B 2CV0A 4IQ4A 3EUAA 2E5ZA 1D1CA 3PSFA 4XMYA 3DQVC 3OYCA 4G6TB 3ZRGA 4KISA 4PFPA 2W7NA 4LIVA 3W3CA 3ZR8X 1W36D 3F9KA 5HLTA 2DCEA 1AA7A 4QPQA 1K6YA 3HC7A 4CCJA 2K5CA 2CH0A 2XF6A 4ZC3A 1TT0A 3FDYA 2HU9A 3CMMA 3MKWB 4C9YA 4YRVA 4HSTA 5LD2C 2VJJA 2KRCA 2RQQA 4ZYAA 3G2BA 2WAFA 4DBQA 3ZCOA 2DXIA 1U0JA 3EPZA 4BJ5C 4XNFA 4NUBA 3OYGA 3DPTA 3K4LA 3L2VA 3OYIA 3H35A 1JI8A 1LFPA 3BLYA 2CUZA 3TMOA 2VXDA 2NOJB 4E7ZA 2BW3A 4BQQA 3BC8A 4PJNA 2KPMA 3LMMA 3D5RC 3I3LA 3OL4A 3SEZA 4P1WA 2K9MA 3OIQA 5HOOA 3OYLA 4BE2A 2W82A 4MLOA 4XL9A 3MKZA 5KNLA 3K4CA 3CF2A 2DT7B 3RSNA 1X4PA 3CP8A 4AVZA 2M7AA 1BR2A 4AYBA 1N75A 2V26A 4YEJA 1DGWY 4U87A 1WFXA 4RLFA 2LYCA 3H9QA 2W4SA 4AU7A 3DPUA 4QPOA 4KT6A 1MMDA 2F4IA 2DT6A 1FMWA 1SFKA 4OAZA 4ZDPA 2XC7A 4IKFA 3W2AA 4BXFA 2VJ4A 3OOUA 1WJ5A 2DOAA 2VJIA 3DTEA 3LSIA 3K4MA 3EUHC 1S9HA 2X6XA 3KX2A 4HNTA 2X85A 3LFUA 4KJZA 3D5LA 2E1MB 4N4NB 2WB1A 3SDBA 2F5VA 1YX3A 4RMNA 4DJAA 5KCMA 3K4BA 3W2WA 2VJ5A 4N4OB 3VYSB 3OYJA 2CW8A 4F93B 2K3PA 2HZDA 4BE1A 2CFOA 2VASA 3OYMA 4XR6A 3DU6A 3L2RA 2KQRA 2CV2A 4F52A 4HNUA 4E7SA 1YX5A 3OYBA 2HNHA 4XN0A 2R7XA 4B3XA 4XKVA 2JUGA 2VPLA 4OAYA 3MKYB 1Y56A 2LY2A 1BOBA 2OC6A 3NWTA 2MD0A 3A4CA 4DBRA 2R7RA 3OYNA 3ONQA 1MNEA 1X1BA 4R79A 4HEA2 2Y0SA 1ERDA 3HPGA 3K70C 2XDVA 4FETA 3PL8A 1X19A 3H5RA 4XM3A 4E6KG 5FRMA 2IGMA 4X0GA 3IP4B 1YE9A 1WJCA 3HPHA 2M0MA 3K4NA 3OMYA 4PJLA 2R7TA 3H5NA 1Z3XA 3CJRB 2W00A 2HVSA 2IS1A 3TL4X 3K70D 3E1SA 2OV7A 1UG0A 4XORA 3AL0B 1LDKB 1T0FC 4BE0A 1N77A 2KHMA 4E4HA 2WA0A 4PJMA 4BS9A 3HOSA 2Z16A 2M4GA 3N05A 2L7KA 3S3OA 3HG9A 3K10A 4BL0B 2LBFB 4ZDLA 4RM2A 2HPIA 2X1CA 4IX7A 3IUOA 2WBMA 3QYFA 4LG3A 1NG7A 2IGNA 2PMZA 2V9KA 4HPQA 5CQEA 4ZDOA 3RTRA 4C2UA 2LOOA 2ZSHB 2WAQA 2UV1A 1P9QC 3H5AA 3DTKA 4BEHB 3OS0A 2L5QA 1QHGA 3LL7A 3PJRA 4CCOA 3D5SC 4II3A 3RQ4A 3OYKA 2PJRB 2O5RA 2F6CA 3DKXA 2MFZA 3AFHA 4J00A 4BDZA 2CMPA 4LITA 1V5GA 3CJQB 3HXLA 4NC8A 4CSWA 4D9JA 2HVQA 4DGWB 2ZFUA 4NC7A 4PJJA 4XKCA 3EUKL 3LSHA 2HQAA 3OIPA 3NWSA 2E5NA 4II2A 3DEEA 2R7OA 3VSLA 1PYVA 3SEQA 3CZ6A 4XKBA 2KMUA 1Y6IA 2HVRA 1X1CA 5KHDA 1X4OA 2AQEA 4U7BA 2UWMA 2VQCA 4BJTA 3OYEA 2L9SA 1X1AA 2M7BA 1UAAA 5FROA 1D0ZA 2ZXIA 2HDWA 2Z1DA 1LVKA 4E7KA 2R7SA 5CPRB 4NNJA 2BVLA 4DOZA 2QKLB 4CH7A 3K6GA 1WJEA 3HOTA 1WJAA 1G59A 4XLCA 3FKJA 1R6RA 3I9V2 2Q1ZB 4XOTA 3OS2A 2UUZA 1KONA 3ZXSA 3A2KA 2CW7A 4BJ6C 1WJBA 5LFAA 3IAM2 4LIUA 3ZGKA 2JA2A 3PNYA 4B47A 1HA8A 4YELA 3LSKA 2KLOA 4JQFA 4XQFA 1J09A 3S93A 2CV1A 2V6EA 2M3AA 3QOEA 4IZZA 1VZ0A 3A1YA 2WADA 3S3NA 2XAUA 4EATA 4BACA 3H9GA 4D1QA 2IGOA 4BUPA 2WY7Q 3BCAA 1DQUA 2CS3A 4PUSA 2X1EA 3LSMA 1OLTA 4XLFA 4CCKA 3OS1A 4IQJA 2AQFA 3RPUD 3J7AY 3UR3C 1BR4A 4BQOA 2IS2A 1G8XA 1WJFA 3PUBA 4P5OA 3BCBA 3OR2C 1DGRM 2W1OA 2KP6A 3HUGB 4OWRB 1MMAA 1PJRA 4XLEA 3OY9A 3HKZA 3MD2A 3OYFA 1FMVA 4B44A 3FBIB 1Z21A 4KITB 1GLNA 3MMYB 3W2VA 1OR7C 3OYDA 4CCLA 2BW3B 3DTIA 5HVQC 1V5EA 2VL8A 2XSJC 2A5WA 1LKXA 1D0XA 3C2HA 3VYUB 3L2QA 3LSGA 2HPMA 3C2GA 3S8PA 2VLAA 3K4JA 3QYBA 2RNGA 4ITVA 4HSRA 4RM3A 1Z7LA 4E7JA 2R4GA 2LY1A 2LREA 3SYTA 1TZLA 1N78A 4E7LA 2X1DA 3UNGC 3AKZA 2MYSA 2Q2EB 4C30A 2E60A 3FBNB 3V42A 4XKWA 3PNTA 3CESA 2V4JC 4FASD 5CQGA 2R7UA 2KL4A 4ZTJA 2BVMA 2V1NA 2LBFA 2VQLA 4Y3OA 3H9JA 2OUMA 3VYTB 4DIQA 3U21A 4XONA 4E7HA 4PSWA 2BOLA 3PFYA 3CP2A 4XLHA 3VYRB 3GBGA 3RCOA 5HNFA 2VKDA 5HNHA 2QKMB 4BGDA 3HL2A 1BR1A 4CZCA 4BEHA 3AL0C 2VQHA 2ZSIB 2GOMA 2R7WA 4C2TA 1X1DA 2PJRA 3DU5A 1ZELA 2K9LA 4HG2A 1MNDA 2P0WA 2XF7A 4JOMA 2X6YA 3DPLC 3TBIA 4XN3A 4XOPA 2KRHA 2R7VA 4BU2A 2X51A 2LRDA 1NG6A 4NQWB 4RLQA 3BG7A 3KEYA 5CKTA 3OYHA 3VWBA 4J01A 2LG4A 3OYAA 3OL3A 1MMNA 4PFOA 2VXZA 4Y4RA 4F55A 2L2OA 2ZXHA 4B43A 3FHNA 3VDXA 4ANJA 4CA0A 4HRIA 3S32A 1V5FA 2V7FA 2X6WA 4B48A 2FUG2 1EA3A 2IXSA 4BDYA 3PNVA 2VIXA 2L9NA 1Z3YA 5FRNA 4ZTFA 4BQNA 4GRIA 3KYLA 3H0DA 3M8JA 5JHFA 2IS4A 3SZGA 4ZJZA 3K4KA 2Z2SB 2VB6A 2GOXB 3QYEA 5TGTA 4CUGA 3IAS2 2I8DA 3DWLE 2IGKA 2R7QA 3M1CA 3S3MA 1D0YA 4H4KC 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OV7 A;  2VPL A;  2OUM A; 
#chains in the Genus database with same CATH topology
 4F3Q A;  3PSI A;  4U0W A;  2NYX A;  2F5D A;  3WGI A;  2P5V A;  3QP5 A;  1TQI A;  1VF9 A;  3ZN1 A;  1RR8 C;  3HSE A;  1TWH J;  4PDK A;  2XAS A;  2KZV A;  3CCY A;  3RDI A;  2EZK A;  3WTU C;  3ZP5 A;  4HAM A;  2R3S A;  1T39 A;  2WB1 N;  3DLA A;  1SAU A;  2DLL A;  3F8M A;  1QGP A;  2M1B A;  2W84 A;  4MEY F;  3VSK A;  3TO9 A;  1FNN A;  4UV9 A;  4EJT A;  2LDU A;  2DQL A;  4RAZ A;  4L0Y B;  2FBH A;  2IS6 A;  1J0R A;  3WTS C;  1A5J A;  3ABK H;  3TDZ C;  2JVG A;  2V1D A;  1VQ6 I;  2AHQ A;  2DMU A;  4IQ4 A;  2CV0 A;  3EUA A;  2E5Z A;  1D1C A;  3PSF A;  3HOZ J;  5J8F A;  2FNA A;  3ZRG A;  1DU0 A;  1S29 A;  2LD5 A;  2GWR A;  4IHY A;  2D1H A;  3W3C A;  1W36 D;  1AA7 A;  4QPQ A;  2A05 A;  2GZW A;  4M3G A;  2CH0 A;  3BPV A;  3BR5 A;  1TT0 A;  1HOM A;  3CMM A;  1FZP B;  3GFM A;  4C9Y A;  2HS5 A;  2ISZ A;  5IYD J;  2VJJ A;  4DZP A;  5IOY A;  4S04 A;  2VOO A;  2EV6 A;  5A2Q Z;  1O3S A;  2WAF A;  2AXT C;  4HZF A;  3V8K A;  1FYL A;  2DXI A;  3OYG A;  2H6C A;  4MHG A;  3FM3 A;  1XG1 A;  1JI8 A;  2UZK A;  2QA4 I;  3RJP A;  1T56 A;  2EH3 A;  2ACJ A;  3A01 B;  2VXD A;  4R8H A;  4B09 A;  2MH2 A;  3LA7 A;  4EJW A;  2BW3 A;  1W0T A;  3CCQ I;  2JJ7 A;  4BQA A;  3TO7 A;  4BQQ A;  4MIM A;  3LSP A;  1A36 A;  3OL4 A;  5M3F J;  4P1W A;  2K9M A;  3OIQ A;  5HOO A;  3M8E A;  3OYL A;  2W82 A;  4IJA A;  2EBI A;  2EFW A;  3GZ5 A;  4L0Z B;  2E7W A;  3K2Z A;  5TJJ A;  4MFE A;  2IA2 A;  4RB0 A;  2AS5 F;  2LFB A;  2QGU A;  2P8T A;  3FXU A;  2M7A A;  3SZP A;  1BR2 A;  2CQQ A;  5ILV A;  3WTW C;  4A5N A;  2EZL A;  5B3S H;  5D4S A;  3LSR A;  1ZTR A;  1HW1 A;  3P9C A;  4AYB A;  4BYY A;  2FXA A;  4OOI A;  4YEJ A;  3HEF A;  2DBB A;  2Q2E A;  2ZKZ A;  3OV8 A;  4QWQ A;  4OIR F;  4QPO A;  2KDZ A;  2PEX A;  4MTD A;  3SDG A;  1TWF J;  2E36 A;  1RR7 A;  2CG4 A;  4OAZ A;  1IZ1 A;  3K9T A;  5JFR A;  4ENK A;  3J80 Z;  2K7L A;  3L2C A;  3I58 A;  1QZY A;  3K4M A;  3RKX A;  2JA7 J;  3FXQ A;  1EJ9 A;  2LF7 A;  4BXX J;  1S9H A;  3ISP A;  3LFU A;  4KJZ A;  2XAG A;  4HQM A;  3D5L A;  1ZR2 A;  2E1M B;  3B6C A;  4N4N B;  1PUF A;  4DJA A;  1TWG J;  5KCM A;  3D0S A;  3KP2 A;  3PIO F;  2K3P A;  2HZD A;  1R5H A;  2IVM A;  2VAS A;  3OYM A;  3FK7 A;  2ZXJ A;  3DU6 A;  2QEX I;  3KP7 A;  1T8I A;  4F52 A;  4HNU A;  4HX8 A;  2LNB A;  4AYB N;  4E70 A;  4I2O A;  4B3X A;  5EEG A;  4FE4 A;  3RYR A;  3MKY B;  2LY2 A;  1IUY A;  4J19 A;  1P6R A;  2MD0 A;  4DBR A;  1NK2 P;  1E3P A;  3FMS A;  4FQG A;  4AD9 A;  3GTP J;  3IWZ A;  5JI6 A;  4RB3 C;  3S17 J;  3BG3 A;  5FGM A;  3CJT B;  1J5Y A;  3F6O A;  4RGU A;  2XRO A;  2K40 A;  4HX7 A;  4XM3 A;  1IW7 F;  2B9S A;  2IGM A;  2LLK A;  4CHU A;  2HZT A;  4UVB A;  1WJC A;  2CWE A;  1KQ9 A;  2PG4 A;  1XGN A;  2R92 J;  3CCE I;  4I0B A;  2VBZ A;  3E1S A;  3NQO A;  1UG0 A;  3GZ6 A;  3AL0 B;  1OCC H;  2B0L A;  2OQG A;  2KHM A;  1B59 A;  3D1N I;  5DCM A;  1ZGW A;  3HOS A;  2ZME A;  3F8C A;  5FJ8 J;  1Z05 A;  3FM5 A;  2JT1 A;  2BY1 A;  2L7K A;  3E3V A;  3K10 A;  2DK8 A;  4BL0 B;  1W7P A;  2L9R A;  2LSO A;  3ZMD A;  4M71 A;  4LG3 A;  3EDP A;  5D5U B;  1MH4 A;  2YX7 A;  1IN6 A;  2ZO4 A;  3GTO J;  3HGG A;  2PMZ A;  2V9K A;  3SHF A;  3KP6 A;  4ZDO A;  3RTR A;  2BV6 A;  5HDK A;  3ZQ7 A;  3GXO A;  2WAQ A;  1JKP C;  2UV1 A;  3U1D A;  2ZJP F;  5HS7 A;  3LL7 A;  3PJR A;  5DDG A;  3LWF A;  1ENH A;  3ROU A;  1YYV A;  2D2W A;  4G6D A;  3FWE A;  5DD4 A;  3CJQ B;  2XAJ A;  3O8G A;  4NC8 A;  4CSW A;  2QLZ A;  2ZFU A;  4UB6 C;  4HF1 A;  3LSH A;  3P9K A;  4FE7 A;  2VOP A;  5EG0 B;  3HIF A;  3OIP A;  3NWS A;  1VQ4 I;  2XGE A;  3TP3 A;  4G7Z F;  3ZQC A;  3MEX A;  2R7O A;  1UMQ A;  1E3H A;  4G7O F;  1W7P D;  3GUD A;  4U0Y A;  3L1P A;  3BR6 A;  3P7N A;  4JYK A;  4QTR A;  2VKV A;  1IRF A;  4NHJ A;  3BWG A;  3V8L A;  1Y6I A;  1X1C A;  3EYY A;  5KAI C;  4UY8 I;  2AQE A;  1SFU A;  4ESJ A;  1K83 J;  4U7B A;  3GFI A;  2OJE D;  3B02 A;  2NAZ A;  3I54 A;  4U7D A;  3G3Z A;  3WTY C;  4C3J J;  3G6E I;  3AG4 H;  5LRS A;  2DDB A;  9ANT A;  1D0Z A;  1OMI A;  2ZXI A;  2JRT A;  2D1V A;  2QEN A;  2H27 A;  1YJN I;  1FSE A;  2BVL A;  5HLH A;  2QKL B;  4CH7 A;  1QVU A;  1WJE A;  2ELK A;  1HC8 A;  3ZPL A;  1OCZ H;  2DA7 A;  1R6R A;  2E71 A;  2XRN A;  2Q1Z B;  1KON A;  3ECO A;  3FKI J;  2DA2 A;  1YRN B;  4O5V A;  3VB2 A;  1JHF A;  1QRY A;  2FU4 A;  5AIP A;  1Z0X A;  3LSK A;  3NAR A;  2VE9 A;  2BYV E;  4G6Q A;  3TED A;  5L3G A;  1J09 A;  3S93 A;  5EJC A;  3LAJ A;  2LY9 A;  2Z5U A;  5LHI A;  2CV1 A;  1O57 A;  2Y30 A;  4CGZ A;  4EEF G;  1ZH5 A;  4A0X A;  1VZ0 A;  3A1Y A;  2WAD A;  3S3N A;  1SVM A;  5FKL A;  1QPM A;  3H9G A;  5LHG A;  3TW7 A;  4D1Q A;  1B9N A;  1HQC A;  3V7R A;  4GXO A;  1BIB A;  4OU0 A;  3GO5 A;  1E3O C;  1T38 A;  2V1U A;  2XGX A;  2CS3 A;  4JP0 A;  2X1E A;  1TQM A;  2CW0 F;  1HCR A;  4P9U A;  1MBF A;  4XLF A;  3QPL A;  1U8R A;  1Y39 A;  2AQF A;  4IQJ A;  2H09 A;  2DQR A;  3J7A Y;  3RZD J;  3WHC A;  1WJF A;  4P5O A;  2DDA A;  2W1O A;  2RNJ A;  3HUG B;  1BN5 A;  2A5Y B;  1SC7 A;  1HDP A;  3ERM A;  1FIA A;  3U2R A;  1VQP I;  2XGC A;  5CJ9 A;  2MSY A;  4ZZD A;  3W2V A;  1Y1W J;  1OR7 C;  1CF7 B;  2EJR A;  3BDD A;  2ZCW A;  4OMZ A;  5DV5 A;  4XBF A;  4OMY A;  1FC3 A;  5F27 A;  1KYZ A;  4H0E A;  2JRM A;  3BR0 A;  3V4G A;  3TP0 A;  2DPD A;  5IT3 A;  3G1O A;  3LSG A;  1IO2 A;  2F5C A;  1UB9 A;  1RKW A;  2QUF A;  1R9T J;  4HSR A;  4RM3 A;  4MNU A;  2R4G A;  1LE8 B;  2P7V B;  3CUO A;  2BHZ A;  2X1D A;  4W97 A;  3BR3 A;  3FIW A;  1UHW A;  1JHH A;  1A31 A;  1E17 A;  2MYS A;  2DK5 A;  4ABZ A;  4DZJ A;  5LEJ A;  3BTC A;  1YTY A;  4LLN A;  2DA1 A;  3FMR A;  5IT9 K;  1FPQ A;  2BXY A;  4AIK A;  1J59 A;  2R7U A;  3JCU C;  4ZTJ A;  1DP7 P;  2JUC A;  1AWC A;  3FXO A;  5DM6 F;  4Y3O A;  1JUM A;  2X0L A;  2ZJR F;  3S1R J;  5BMZ A;  2EV5 A;  3ABL H;  4UUS B;  1IRZ A;  4A12 A;  1J2X A;  3WTT C;  2OCE A;  4XLH A;  5HNF A;  2EPF A;  1O3R A;  4BGD A;  1UHM A;  1S7A A;  4A3I J;  4CZC A;  1YQA A;  2H6B A;  2O6G E;  3W6V A;  3LFK A;  1JT0 A;  2E34 A;  3SZT A;  4DYC A;  2ZSI B;  1O3Q A;  3IV5 A;  4CZZ A;  4C2T A;  1X1D A;  3T8R A;  1SD6 A;  1D5V A;  3DU5 A;  2DOD A;  3DBL B;  5E17 F;  3HZJ A;  4M73 A;  3DPL C;  1BIA A;  1Z6T A;  2KRH A;  1ZG5 A;  4M6V A;  1ZLJ A;  4ASN A;  3ZMV A;  2LRD A;  1K7A A;  4GYG A;  4D5F A;  1SAX A;  4EJV A;  2YU3 A;  4A3K J;  3BG7 A;  3HRU A;  1GVD A;  3MCZ A;  3RKW A;  5EG0 A;  4G94 A;  2IA1 A;  2PBI A;  4N9I A;  2LG4 A;  1EKE A;  2Y75 A;  1JXS A;  3C2B A;  1WKM A;  1ZAO A;  2L2O A;  3FHN A;  2X9D A;  1BI1 A;  1BI2 A;  1I27 A;  5HS9 A;  3ABT A;  3TKY A;  1V5F A;  1FYK A;  3T5X A;  2ICW G;  2FUG 2;  1IC8 A;  2KKO A;  1VQ5 I;  2X48 A;  1Z3Y A;  3SFZ A;  4ZTF A;  5FKK A;  2CSO A;  3IWF A;  4CIC A;  5EEA A;  3H0D A;  2HYJ A;  3ZQG A;  2H8R A;  2B63 J;  5JHF A;  1L0O C;  2YPR A;  4LG0 B;  2GOX B;  1APL C;  3WTZ A;  3HDD A;  2HTS A;  3QAH A;  2IGK A;  2O61 A;  1D0Y A;  1KGS A;  3IC7 A;  4MFD A;  2AO9 A;  1MBG A;  4L18 B;  2CUJ A;  2DJI A;  2GIZ A;  4XRS A;  4I7H A;  4CCN A;  3QQA A;  3BTL A;  2MG4 A;  4HV6 A;  2K27 A;  1FOX A;  4XLA A;  2VN2 A;  1BC7 C;  1X1P A;  4M9Z A;  2Q8K A;  5F0F A;  3S1M J;  2XF5 A;  2F4M B;  2WY8 Q;  3QOD A;  4E7I A;  3EET A;  1QHH D;  5ERI A;  5KAF C;  2XRL A;  3ZMS A;  2RV8 A;  3RIR A;  1YRN A;  1R1T A;  3DKY A;  1W36 C;  1DU6 A;  3GLL A;  2XUB A;  2ELJ A;  3IRR A;  3C7J A;  1TWC J;  1UZC A;  3FMQ A;  4Q47 A;  4BNC A;  1DP3 A;  3ZQQ A;  2XGD A;  3BG6 A;  1XPX A;  1H0M A;  2ID6 A;  4HQE A;  3KP4 A;  2K02 A;  2KRF A;  2LH9 A;  1MJ9 A;  4F92 B;  3R60 A;  2DTZ A;  3BJ6 A;  4XMY A;  3JAM K;  4JX4 A;  1MBK A;  2DFI A;  2XIG A;  1A6Q A;  4BXU A;  2Z9O A;  2FMY A;  3U1K A;  4LIV A;  1IXS B;  2DPU A;  3RKY A;  1XMK A;  1Y0U A;  3HC7 A;  2K5C A;  4M3E A;  3X2Q H;  4EM1 A;  4M9X A;  2L0K A;  5C4J J;  5E3O A;  2LR8 A;  3WGG A;  2DO7 A;  3GYH X;  1YFH A;  2L54 A;  1RKT A;  3H3U A;  1UCR A;  1RES A;  2JQ7 A;  1YS6 A;  3Q9S A;  1ITY A;  3HUG A;  3ZCO A;  1SMT A;  1U0J A;  4BJ5 C;  4NUB A;  2WTE A;  1X3U A;  3K4L A;  1ON2 A;  3OYI A;  3H35 A;  5IPA A;  1Z91 A;  1ETO A;  1JGS A;  3BLY A;  3PUF A;  5L3D A;  1CF7 A;  3ULQ B;  5D4R A;  1UST A;  4E7Z A;  1Q1V A;  2BY2 A;  2ESN A;  3KZY A;  3RI4 A;  2W25 A;  1HST A;  2DA3 A;  3IL2 A;  2VUM J;  1GXP A;  1HKT A;  2KPM A;  1U5T A;  1XSV A;  2COB A;  3I4M J;  1O4X A;  1FYM A;  4XL9 A;  3EUH A;  2XB0 X;  2HDD A;  4Y7N J;  2BBY A;  2IW5 A;  1TW2 A;  2L02 A;  1LE8 A;  2ZFW A;  3I5U A;  3CP8 A;  3F22 A;  1BC8 C;  5D6F A;  1S6L A;  4K2E A;  3SQN A;  2M9H A;  1BJA A;  1ZGA A;  2KIU A;  2V26 A;  3I55 I;  4I99 C;  2NS0 A;  4U87 A;  4DNC A;  4DYR A;  4G8X A;  2X6O A;  1VTN C;  1HDD C;  2EIJ H;  1OKR A;  1MMD A;  3KEO A;  1YOV B;  2DT6 A;  2F4I A;  1FMW A;  4XRS G;  3LNQ A;  1VQM I;  4ZDP A;  4IKF A;  2J5P A;  1XGO A;  3W2A A;  5CVJ A;  2E35 A;  2HYF A;  1FLI A;  1MZB A;  3F8F A;  1A6I A;  3HHH A;  2VJ4 A;  3OOU A;  5J8C A;  1WJ5 A;  2HWV A;  2HOE A;  2VJI A;  2A07 F;  3BQZ A;  4CYD A;  4I01 A;  4UUS A;  3F23 A;  1ZR4 A;  5IP7 J;  2X6X A;  2KJB A;  2LF8 A;  4HNT A;  2V9P A;  3OSF A;  2WB1 A;  1Z6R A;  2GLO A;  3RKQ A;  4RMN A;  2JSC A;  3IH2 A;  3W2W A;  2FE3 A;  3MAJ A;  4F93 B;  1J7K A;  5GAD J;  4BE1 A;  1ZN2 A;  2NVT J;  1WI3 A;  5FLM J;  1XSX A;  4XR6 A;  5F0H A;  5LEK A;  3FXL A;  2OBP A;  4AIJ A;  2CV2 A;  1SD5 A;  1IG7 A;  2YR2 A;  5LLQ A;  2LK2 A;  3KE2 A;  4WCG A;  3OYB A;  2HNH A;  4UV8 A;  5EZH A;  5GAG J;  5K5Q A;  2R7X A;  3BQY A;  3ZQF A;  1IJW C;  1FTZ A;  4KN7 X;  3NWT A;  4G12 A;  3OYN A;  2E1C A;  1YHQ I;  3M3Y J;  3CCS I;  2L7M P;  5DM7 F;  3S2D J;  1ERD A;  5EDN A;  1P7J A;  3WTV C;  3DBH B;  3O8H A;  3HPG A;  3CMY A;  5ICG A;  1T33 A;  3PO2 J;  1VQO I;  1HKS A;  2E2H J;  3G73 A;  1O7F A;  3I4P A;  3IP4 B;  1UG2 A;  2HQR A;  3VOD A;  5FKM A;  1YE9 A;  4EVI A;  4GO1 A;  4A3L J;  3J7Z I;  1MNM C;  4I98 B;  4PJL A;  3V7S A;  2RVC A;  5C3E J;  2JA8 J;  3S1Q J;  3CD6 I;  3HSR A;  2OV7 A;  3CC4 I;  5LGT A;  4NBQ A;  3CO7 C;  2VBW A;  4PJM A;  4G7H F;  1YW8 A;  3J80 K;  2M4G A;  3J81 Z;  4YFX F;  4XIC A;  1GDT A;  5M5X J;  4KIB A;  1ZG1 A;  1G6N A;  1I50 J;  1KQ8 A;  2EK5 A;  5J4V A;  4Q4Z F;  2ELH A;  3QU3 A;  2M30 A;  1CQT A;  2WBM A;  1Q1H A;  2FQ3 A;  1NG7 A;  2CU7 A;  1V55 H;  2K3F A;  1I6H J;  5CVV A;  4RA2 A;  2K9N A;  3TOB A;  1KQ0 A;  1P9Q C;  1I6X A;  1U78 A;  2EIK H;  1WCM J;  3BG9 A;  5E3N A;  5JVG F;  3BPX A;  4CCO A;  3JRG A;  1FP2 A;  5C4X J;  2O5R A;  2W48 A;  3DKX A;  1OCR H;  1ACI A;  2K4J A;  2ZME C;  3QWL A;  2QF7 A;  2TRT A;  1NTC A;  2XPV A;  5J1Y A;  4BDZ A;  1YIT I;  1IDZ A;  1MKM A;  5E20 A;  2UXN A;  2FOW A;  1LNW A;  2HVQ A;  2M8G X;  4UXN A;  4I02 A;  2ECC A;  4PJJ A;  4HF0 A;  1QNT A;  3EUK L;  4RAY A;  3HKZ N;  1POG A;  5J1U A;  4PCQ A;  3HTS B;  2HQA A;  2O8K A;  1ZG3 A;  2PQ8 A;  1XSD A;  3ZQH A;  3LA2 A;  4FHT A;  3HGY A;  1SEU A;  4M72 A;  3VSL A;  3EYI A;  4KMF A;  1PYV A;  3SEQ A;  1D5Y A;  1REP C;  2RAE A;  4ZH4 F;  1W1W E;  1X4O A;  5E1X A;  4FTH A;  1MD0 A;  2OD5 A;  3I59 A;  2IEK A;  1D3Y A;  3OYE A;  4IHT A;  1VQL I;  1X1A A;  2HTJ A;  4KNY A;  2DAO A;  1OJL A;  3O2P E;  3HRM A;  2K85 A;  2KZG A;  4GCV A;  3L7W A;  4Y15 A;  2IA0 A;  5H20 A;  1LVA A;  1ETY A;  2Z1D A;  2R7S A;  2IT0 A;  5CPR B;  4D5C A;  2IP2 A;  4DOZ A;  1KU9 A;  3ASN H;  4MGR A;  3RPU A;  2VPR A;  5EEH A;  2HOA A;  5LRR A;  2EIM H;  2Y9Y A;  2OCC H;  5E79 C;  1JKR C;  2J5O A;  2XV4 S;  3E7L A;  4XOT A;  3OS2 A;  1R1V A;  2LVS A;  3JR9 A;  4A3J J;  3IAM 2;  5HDN A;  1R58 A;  1SMY F;  2A6H F;  2JA2 A;  1LEB A;  3PNY A;  4A3C J;  5DUK A;  1XC5 A;  2PJP A;  5HLG A;  1KZH A;  4YEL A;  2QSH X;  3JRF A;  4BBS J;  1TBX A;  4OIN F;  4IHX A;  1SFO J;  2KLO A;  4JQF A;  3ZMT A;  5M3M J;  1T2K A;  1T08 B;  2PFB A;  1E2X A;  4IRH A;  3CUQ C;  5ILS A;  2L3D A;  2DA6 A;  2ZBK A;  3L09 A;  5J47 A;  3SJM A;  4IZZ A;  2LP0 A;  2Y69 H;  4LD5 A;  4EAT A;  4BAC A;  3CLO A;  2FBK A;  3MZH A;  5DYM A;  4A93 J;  1MJB A;  3P9I A;  1DQU A;  4UVC A;  4L9T A;  4EQQ A;  1ON1 A;  5EYR A;  3OS1 A;  4CCK A;  2IS2 A;  1W4M A;  3RPU D;  1WRJ A;  2ZNY A;  3R4K A;  3BOQ A;  1JE8 A;  5B5E C;  2EWN A;  2XKP A;  3OR2 C;  2GM4 A;  4XID A;  2FJ1 A;  1DGR M;  1IV6 A;  2WC2 A;  3JRH A;  4OWR B;  4HYE A;  4UUV A;  2JWT A;  1K78 B;  4XLE A;  4IHW A;  1FBS A;  5FKN A;  3WU0 A;  2KIQ A;  3GFL A;  4FCY A;  2DOF A;  1R22 A;  3FBI B;  2ECB A;  3MQ0 A;  1B9M A;  1BJZ A;  3ZQI A;  3OYD A;  2HOS A;  1PVE A;  1TP4 A;  3M1E A;  4RB2 C;  1W5T A;  1F1Z A;  3JTH A;  5CVI A;  5HVQ C;  2VL8 A;  2XSJ C;  4FX0 A;  1XDS A;  3CME I;  3ZN0 A;  3T0Y A;  5HOD A;  1JJ6 C;  3K69 A;  3QYB A;  2IRF G;  3P5J A;  3ERE D;  2LRE A;  3SYT A;  1RUN A;  3DEW A;  1N78 A;  4E7L A;  2DA5 A;  4ESB A;  3AKZ A;  2RQP A;  2IBD A;  1EH8 A;  3RPQ A;  4OIO F;  3CCJ I;  2E60 A;  3DXJ F;  4XKW A;  2O8X A;  3CES A;  1MSE C;  1LEA A;  2YX4 A;  4LB6 B;  4S05 A;  1S72 I;  2Y0M A;  3HOX J;  5F04 A;  4BH9 A;  3K1P A;  2BVM A;  4IL6 C;  2CGP A;  1Z1D A;  1IRG A;  3MFK A;  3DBR B;  5JR3 A;  1PUE E;  3H3V K;  3F72 A;  2E1O A;  2OUM A;  3VYT B;  1IXC A;  4XON A;  1WVR A;  2A6E F;  1N25 A;  4PSW A;  4DIQ A;  2BOL A;  3G1L A;  4KIG A;  2NVQ J;  1OYY A;  3VYR B;  2PX9 A;  1QA6 A;  5IOZ A;  3M4O J;  2QKM B;  2CJJ A;  2ZNZ A;  1HXD A;  1FY7 A;  3GLX A;  4RBO A;  5JHU A;  3AL0 C;  2MGQ A;  2DTR A;  1GT0 C;  1Y8R B;  4ENM A;  2GOM A;  1OYI A;  1MDM B;  2DJN A;  2Y48 A;  3IH4 A;  5K1Y A;  3A01 A;  1MND A;  2VI6 A;  3PFI A;  3TBI A;  4XN3 A;  1OPC A;  1MBH A;  2PI0 A;  5FD5 A;  2X51 A;  2I10 A;  1YLF A;  4NQW B;  2ESH A;  3CCM I;  4RLQ A;  2DFH A;  2EIL H;  3KEY A;  1XTA A;  5CKT A;  2GXA A;  2QCO A;  2AXL A;  2RKH A;  4J01 A;  3BJA A;  4CXF A;  3OYA A;  4EJO A;  4XRM A;  1P7I A;  4XLN F;  2VXZ A;  1B72 B;  2HYG D;  3J7A O;  4KT5 C;  3E5U A;  2LKP A;  3VDX A;  4ANJ A;  2GXB A;  4PGG A;  4CA0 A;  2HR3 A;  2F5F A;  2L4A A;  2TDX A;  2KJC A;  2LTP A;  1T98 A;  1X3W B;  3HBL A;  4B48 A;  1EA3 A;  3H0G J;  3H36 A;  1YW7 A;  4IRG A;  5BOX A;  1YJ9 I;  3PNV A;  4UUT A;  2E2I J;  4LOC A;  3LA3 A;  4GRI A;  2JMW A;  4N9H A;  4BHP A;  1USS A;  1ZRF A;  1W5S A;  3SZG A;  4ZJZ A;  3R0A A;  1B1B A;  2Z2S B;  4JK1 X;  4KIF A;  2P6S A;  4RGX A;  4CUG A;  5F0C A;  2I8D A;  3KYD B;  5KVR A;  3DWL E;  2BY3 A;  3M1C A;  3MVP A;  4L5J A;  3S3M A;  3RZO J;  2VKH A;  5FD6 A;  1ZRD A;  3S15 J;  1LJ9 A;  4HDV A;  4Y33 A;  2LC2 A;  1MSF C;  2YS9 A;  2OA4 A;  5DS9 A;  4IOA F;  2R93 J;  1EH6 A;  3OWT A;  2JVH A;  2A6T A;  1XD7 A;  2KDO A;  1LDD A;  1B4A A;  1YJW I;  2JSP A;  1D1B A;  3VEP A;  2F2E A;  2NRA C;  1QQI A;  3TGN A;  3L2W A;  4ESF A;  2YU9 J;  1Y8Q B;  4PK4 A;  4RGS A;  2RRE A;  3IKV A;  1RRJ A;  3IH3 A;  2OU2 A;  1WWX A;  2FBI A;  1X3Z B;  1MMG A;  1WJD A;  1UEL B;  4EM2 A;  1A35 A;  2M4K A;  3KZI C;  4CCM A;  2VON A;  2NNY A;  2DOE A;  1OCO H;  3K2A A;  5BNG A;  2R7D A;  1BBY A;  2KIF A;  3ASO H;  3OYC A;  1K4S A;  1X2N A;  3LST A;  4PFP A;  5E8G A;  1R4M B;  2W7N A;  5FLX K;  3IHU A;  3F9K A;  5HLT A;  2STW A;  2DCE A;  2VE8 A;  3QPH A;  1WSU A;  1FOK A;  1K6Y A;  2F4O B;  4YFK F;  1VQ7 I;  2HXI A;  2CQX A;  2M2E A;  4ZC3 A;  1FWZ A;  2HU9 A;  4D7N A;  1XN7 A;  4YRV A;  4HST A;  5B1B H;  3SFI A;  5LD2 C;  2KRC A;  1L3L A;  3JRE A;  1FTT A;  4ZYA A;  3G2B A;  4DBQ A;  1BL0 A;  2M5W A;  4KUM A;  1K78 A;  4IVN A;  3EPZ A;  4BY1 J;  1U9N A;  1JKO C;  2ZXW H;  3T8T A;  2EZH A;  1LFP A;  1SAN A;  3TMO A;  5ED4 A;  2A3S A;  2UXX A;  1MJA A;  4XSZ F;  4PJN A;  1WGX A;  3LMM A;  1ZHF A;  3I3L A;  1XGM A;  3HYI A;  3OSG A;  3MKZ A;  5KNL A;  4B1R A;  3WG9 A;  3K4C A;  2COM A;  2MH9 A;  3CF2 A;  2DT7 B;  1X4P A;  3JRC A;  3DF8 A;  4ZYD A;  1LUJ B;  1HW2 A;  5E8I A;  1XDU A;  4CYC B;  1MIJ A;  3CCU I;  3KP5 A;  4X1E A;  1LFU P;  3K0L A;  4WXD A;  3S1N J;  4P55 A;  1ZRC A;  3TO6 A;  1WFX A;  4RLF A;  2LYC A;  3LQR A;  2HEO A;  4G9Y A;  4KT6 A;  3WTX C;  1S7E A;  1BI0 A;  1SFK A;  4ENN A;  2XC7 A;  5E3L A;  2Y9Z A;  4U0V A;  1IAW A;  4BXF A;  2DW4 A;  3M07 A;  4BY7 J;  3GX4 X;  3DTE A;  1U5T C;  2FML A;  1UFM A;  3EUH C;  4A69 C;  3BZ6 A;  3R61 A;  4IHV A;  3AAF A;  2PLY A;  3BJO A;  4LLL A;  2F5V A;  3CCV I;  2NOG A;  4LJZ F;  1TC3 C;  3GZN B;  1RIO H;  3B6A A;  4EV0 A;  2E2J J;  3CC7 I;  2JK3 A;  4QLC U;  2VJ5 A;  3VYS B;  2EFO A;  2BEO A;  1D8J A;  2CW8 A;  3W6J B;  1I39 A;  3F21 A;  1VQN I;  5E18 F;  1IN7 A;  1MDM A;  3L2R A;  2KQR A;  5F08 A;  1K4T A;  2QZ8 A;  2YUS A;  4JBA A;  4E7S A;  2TCT A;  1YX5 A;  2FNP A;  5IP6 A;  4XN0 A;  1G3T A;  1XX5 A;  4XKV A;  1VND A;  1Y56 A;  2WV1 A;  2IAI A;  3E6B A;  2CRG A;  1BOB A;  3HRT A;  4NQW A;  2A61 A;  2DMP A;  3A4C A;  2Z33 A;  2QBY B;  2R7R A;  4IRI A;  1T0F A;  1JUS A;  1MNE A;  1X1B A;  2Y31 A;  1ETK A;  3ONQ A;  4HEA 2;  4DQ2 A;  4EGY A;  4YIF A;  1X58 A;  3HOY J;  1B72 A;  2XDV A;  4FET A;  2NVU B;  3PL8 A;  1X19 A;  2GQQ A;  2NS7 A;  2Z3Y A;  5FRM A;  3I0T A;  5K7F A;  1PDN C;  1EH7 A;  4X0G A;  4EM0 B;  4Z6Y A;  2M45 A;  3JW4 A;  2MLK A;  2EA4 A;  4M6Y A;  2D5V A;  4P9F A;  4UNO A;  1YO5 C;  5M5Y J;  3OMY A;  3FXR A;  2R7T A;  3H5N A;  3CJR B;  5K5O A;  2HVS A;  2DMQ A;  3FXM A;  1TQP A;  2VBY A;  3K70 D;  1AU7 A;  4XOR A;  1BA5 A;  1LDK B;  2Q0O A;  2G9W A;  1K6O A;  3FXJ A;  4MQV A;  5FKO A;  3WG7 H;  2QYO A;  4B4C A;  4YFN F;  4BE0 A;  1N77 A;  3Q9V A;  1IDY A;  2BGC A;  4Y52 J;  4AIH A;  1R5I D;  2Z16 A;  4L5E A;  3S3O A;  3HG9 A;  3KLO A;  4WX9 A;  2NXN B;  4ZDL A;  4B3A A;  3HB9 A;  4R1H A;  3WOD F;  4ZYH A;  2E7X A;  3GME A;  4IX7 A;  4V19 K;  2JZY A;  3ECH A;  3IUO A;  4ZYE A;  1H89 C;  2GXG A;  5B66 C;  2V6C A;  2L9V A;  2DA4 A;  4M3D A;  4HLY A;  2BE5 F;  3Q5F A;  2ZSH B;  2EFQ A;  3H5A A;  4BEH B;  5J4Y A;  3CTA A;  4HW0 A;  3OS0 A;  2L5Q A;  1DPR A;  4Q5S F;  1OCP A;  3D5S C;  3OYK A;  2PJR B;  1U8B A;  4M3F A;  5ICE A;  4KIC A;  1SD7 A;  4RS8 A;  3WE3 A;  3CQZ J;  3WU2 C;  1TWA J;  1XMA A;  1V5G A;  3HXL A;  2L4M A;  3LQQ A;  4DGW B;  4IEJ A;  1U3E M;  4MEX F;  2K9S A;  3CDI A;  3EQL F;  2L7F P;  2OAZ A;  1S3J A;  2JTV A;  2FD5 A;  2E5N A;  1MGT A;  2MA3 A;  2DMN A;  2HOT A;  2BHY A;  3O3K A;  5EF6 A;  2P4W A;  3K1N A;  1PUF B;  1Y1V J;  2EQR A;  3CZ6 A;  1G3W A;  5CVR A;  2KMU A;  5IYB J;  5K7H A;  5C44 J;  4KYW A;  6PAX A;  5KHD A;  1Z9C A;  1FX7 A;  2UWM A;  2VQC A;  4RDU A;  1HF0 A;  1C0W A;  4RAF A;  1OQY A;  2L9S A;  3ZOB A;  4GFB A;  2A68 F;  4DW6 A;  3PQJ A;  1ZAR A;  5FRO A;  2HDW A;  4FX4 A;  5HDG A;  3FIS A;  3J81 K;  4RGR A;  2OTL I;  3AG2 H;  3V8J A;  3CO6 C;  2NVX J;  4A3B J;  3BY6 A;  4ENJ A;  3K6G A;  3JAM Z;  1Z77 A;  4N0B A;  1TNT A;  1WJA A;  4HOB A;  1G59 A;  2JA5 J;  4NC6 A;  3QPS A;  3I9V 2;  5A2Q K;  5BPI A;  5DTD A;  2O3F A;  4RAG A;  3A2K A;  5FLV A;  2CW7 A;  2DFF A;  1W5C C;  3KPH A;  4LIU A;  3ZGK A;  2D45 A;  3FF5 A;  5HLI A;  2LKX A;  4B47 A;  4D0P A;  2OZ6 A;  2WWY A;  1WHU A;  3E6D A;  3PQK A;  1SFX A;  1ODD A;  1TTY A;  4B8X A;  4XQF A;  1NK3 P;  3DLL F;  1RI7 A;  4BHC A;  3PIP F;  2E1N A;  3C1D A;  3IKT A;  1KU3 A;  2M3A A;  4Q48 A;  3Q0V A;  2O9L A;  1ZKG A;  3KEQ A;  2XAU A;  1LDJ A;  2K86 A;  2HGC A;  3VFZ A;  4BUP A;  1J75 A;  1W7P B;  1IF1 A;  2WY7 Q;  3BCA A;  4LGW A;  5L3C A;  3KP3 A;  4L9J A;  1GHC A;  4PUS A;  5GPC A;  4M9S A;  3LSM A;  1M1E B;  3UR3 C;  4BQO A;  3PUB A;  1ZK8 A;  2QM3 A;  4LG0 A;  3BCB A;  2FOK A;  5GTI C;  1HSJ A;  4M74 A;  2KP6 A;  2JN6 A;  3DCF A;  1R4N B;  4BAY A;  1ETQ A;  1PJR A;  3A02 A;  2M8E A;  4HA8 A;  3HKZ A;  4UB8 C;  1SVO A;  2QBY A;  4B44 A;  5F1J A;  1X2M A;  3K7A J;  1Z21 A;  2ZJ2 A;  4KIT B;  3CJN A;  5F1R A;  3MMY B;  1MMS A;  4AC0 A;  2EZI A;  4CCL A;  3TDU C;  1ULY A;  3I56 I;  4A3F J;  3T1B A;  2JPB A;  2A5W A;  3VYU B;  3IRQ A;  3S8P A;  1A04 A;  5HS8 A;  1XB4 A;  5LHH A;  1Z7L A;  1MBE A;  1WH7 A;  4E7J A;  2HXO A;  3E6C C;  3ABM H;  1TZL A;  1H9T A;  5J3L A;  3UNG C;  1JGG A;  1BM9 A;  2BXZ A;  3CLQ A;  2EIN H;  5DEQ A;  2PN6 A;  4C30 A;  2G7H A;  3FBN B;  3V42 A;  1QPI A;  3PNT A;  4LFU A;  4JX5 A;  1R49 A;  4FAS D;  5E3M A;  2XVC A;  1RUO A;  2KL4 A;  2V1N A;  4QIW N;  3O6B B;  2M0C A;  3FZV A;  2VQL A;  2FA5 A;  3KCC A;  3H9J A;  4V2F A;  4E7H A;  5IP9 J;  1OFC X;  4L9V A;  5GPA A;  3PFY A;  4AUX A;  3G71 I;  3RCO A;  5GP9 A;  5AON A;  2VKD A;  3GTQ J;  1I1G A;  1TNS A;  2XB5 A;  1BR1 A;  2CFX A;  3A0B C;  3CUQ B;  4BEH A;  2V9V A;  2ISY A;  2HQN A;  3MZY A;  2ETH A;  2DT5 A;  1FT9 A;  4ETS A;  2VBX A;  2BY0 A;  5ICF A;  2PJR A;  1WH5 A;  1O3T A;  1ZEL A;  3MKL A;  4WXH A;  4JOM A;  2XF7 A;  1FSH A;  2X6Y A;  2XAF A;  1QZE A;  3FX3 A;  3GVA A;  3JRB A;  1P92 A;  4BU2 A;  4HF2 A;  5E1W A;  3F6V A;  2VC0 A;  5FO5 A;  5GAE J;  2GIV A;  1QZZ A;  4HDU A;  2VT3 A;  3VWB A;  1MH3 A;  3BZC A;  3E5Q A;  3OL3 A;  4JX6 A;  1WI9 A;  1ETV A;  3OOP A;  4Y4R A;  2O0Y A;  1HBX G;  1IGN A;  2Z99 A;  4HRI A;  3GFJ A;  1H9G A;  4WWC A;  3M8F A;  2V7F A;  3E97 A;  2JA6 J;  2H1L A;  2IXS A;  2HKX A;  4A3M J;  2CUF A;  2L9N A;  2ZC2 A;  4AID A;  5FRN A;  4NDL A;  5D8L B;  4BQN A;  1OCT C;  3KYL A;  4BKX A;  3KET A;  1RPW A;  4HX4 A;  3I4N J;  2NVY J;  1RC9 A;  2L01 A;  3K1M A;  5TGT A;  1RZ4 A;  3IAS 2;  3QOP A;  2P6T A;  2PMU A;  4WF2 A;  3GTJ J;  1I1S A;  1GUU A;  2R7Q A;  3AG1 H;  1STZ A;  3A0H C;  2STT A;  4H4K C;  4HBL A;  3ABU A;  1P4X A;  1T95 A;  3BTI A;  1IRX A;  5K7Z A;  2MW8 A;  1IN4 A;  1ZQ3 P;  1LB2 A;  1MW7 A;  1S7O A;  4NB5 A;  4HNV A;  4F91 B;  1YS7 A;  2VQG A;  3L2U A;  4OIQ F;  3JRI A;  1E0E A;  2MC4 A;  3DFG A;  2GAU A;  1D1A A;  3H1C A;  3OR1 C;  1WPK A;  2GA2 A;  3ZMZ A;  3AG3 H;  3QPT A;  2QQA A;  1FIP A;  1TL8 A;  3HJE A;  2FRH A;  5M5W J;  2WAE A;  2EFP A;  2MAB A;  3WE2 A;  3F8N A;  2E1M C;  2G7U A;  1QU3 A;  3CDH A;  3F0C A;  3HTU A;  1QBJ A;  4PSX A;  3ESW B;  5L3E A;  2P7C B;  1T6S A;  3E0J B;  2ZB9 A;  5J6X A;  2QSG X;  4O3M A;  1U9O A;  2OF7 A;  3DQV C;  2NNN A;  3COA C;  2XAH A;  4G6T B;  1EF4 A;  2W85 A;  1NHA A;  2MBF A;  4KIS A;  2A69 F;  3ZR8 X;  1WQ2 A;  2FEZ A;  3JTG A;  2R5Y B;  4EGZ A;  4UHT A;  3GTM J;  3A03 A;  1UHS A;  1FBQ A;  4CCJ A;  3CCL I;  2XF6 A;  4AWX B;  1K61 A;  3HHG A;  3BT9 A;  3DKW A;  3FDY A;  1DDN A;  1G3S A;  1XCV A;  2R7F A;  2XAQ A;  3BR1 A;  3MKW B;  5B1A H;  4MO7 A;  2RQQ A;  3BG5 A;  3ML6 A;  1G2H A;  5E1Z B;  5LGU A;  1P4A A;  1CGP A;  1FJL A;  5IY5 H;  4XNF A;  1SVL A;  3DPT A;  3L2V A;  4V2G A;  4XRF A;  2HKO A;  1JT6 A;  4F7Z A;  2CUZ A;  3M9A A;  2EA2 A;  4C3H J;  4KMU X;  3C18 A;  1KA8 A;  2NOJ B;  1JUP A;  3BC8 A;  1K79 A;  3V7C A;  3D5R C;  4ON0 A;  3SEZ A;  3FHZ A;  3G1M A;  4BE2 A;  1F4K A;  4MLO A;  3CF5 F;  3HOU J;  2K4B A;  1S8N A;  2CQ7 A;  3RSN A;  2NS8 A;  1NH3 A;  2EB7 A;  4AVZ A;  4TV7 A;  1N75 A;  2PMZ N;  2W24 A;  1DGW Y;  1R1U A;  3E5X A;  3H9Q A;  2W4S A;  4AU7 A;  3DPU A;  1FP1 D;  3H92 A;  4I0A A;  2WAQ N;  1XS9 A;  3TOA A;  1R5G A;  1HKQ A;  4HV5 A;  4W1U A;  4EMS A;  3NAU A;  2DOA A;  2LMD A;  3Q3S A;  3LSI A;  3I71 A;  4EJU A;  1XGS A;  2WV0 A;  4RB1 A;  3KX2 A;  1G4D A;  2X85 A;  5LBQ A;  2YSR A;  3SDB A;  4A0Y A;  2OTJ I;  2XSD C;  1YX3 A;  4O6J A;  3K4B A;  1U6G A;  1TLH B;  3CUQ A;  4N4O B;  3OYJ A;  4KA4 A;  4BHB A;  3QU6 A;  2CFO A;  2XHK A;  3BP8 A;  1XCB A;  2QWW A;  4L5I A;  2L7Z A;  5CYV A;  3GEZ A;  2RDP A;  3HM5 A;  2B7E A;  4IXA A;  4QSH A;  1R71 A;  2JUG A;  5F64 A;  2VPL A;  1SD4 A;  2K9Q A;  4OAY A;  5L3B A;  5CVU A;  4A6D A;  5JVT A;  2OC6 A;  2C6Y A;  3DEU A;  4Y17 A;  5F6F A;  1WZ2 A;  1V3F A;  2CYY A;  2V79 A;  1GV5 A;  4IPA A;  4R79 A;  3S2W A;  3HSF A;  4UVA A;  1OIS A;  2Y0S A;  2DN0 A;  3KLN A;  5FB2 A;  2OPT A;  2RGV A;  2FX0 A;  1B8I B;  2H8W A;  3K70 C;  1S5L C;  3L00 A;  2BZT A;  3H5R A;  1SFE A;  2M34 A;  4E6K G;  4M3B A;  3U9G A;  1KU7 A;  3ELK A;  3F8B A;  1Z67 A;  4S0H B;  3UKG A;  3QRF F;  3HPH A;  2IJL A;  2M0M A;  2HFH A;  3K4N A;  4IOC F;  2CQN A;  3W6K B;  1Z3X A;  4MQ9 F;  2W00 A;  3GTL J;  5D5V B;  4DYQ A;  2IS1 A;  3TL4 X;  3OIO A;  3MN2 A;  4YIR X;  3RYP A;  3WHB A;  1LFB A;  4HLX A;  1T0F C;  5FFZ A;  4ZZL A;  2MC3 A;  2CUE A;  4E4H A;  2VOD A;  1JTY A;  2WA0 A;  1D8K A;  4BS9 A;  3RQI A;  5D5X B;  1O7L A;  3N05 A;  4L9N A;  4PGH A;  1OYW A;  2MLG A;  3TW6 A;  2R5Z B;  2LBF B;  3CC2 I;  4RM2 A;  1VFC A;  2Y0S N;  2HPI A;  3WGH A;  2X1C A;  5BQT A;  3GTK J;  3QYF A;  4IF4 A;  1YIJ I;  3REO A;  1FOY A;  2IGN A;  2LKS A;  3I53 A;  2XPW A;  3VPR A;  2ID3 A;  4HPQ A;  2HQ5 A;  5CQE A;  4AM3 A;  1GV2 A;  5DD8 A;  4C2U A;  1I3Q J;  2LOO A;  1B6A A;  1U5T B;  2GBY A;  3DTK A;  1R36 A;  2QQB A;  1QHG A;  3KFW X;  3MZ8 A;  2CO5 A;  4II3 A;  3RQ4 A;  2QQ9 A;  3HOW J;  3WU1 B;  4YII A;  3S14 J;  2F6C A;  4GGG A;  5KK1 A;  2MFZ A;  1F5T A;  4AVP A;  1ZYR F;  3AFH A;  4P96 A;  1PP7 U;  1VQ8 I;  4J00 A;  2CMP A;  2I5U A;  1JKQ C;  4LIT A;  5CLS A;  4D9J A;  5J1R A;  3FK6 A;  1RNL A;  4NC7 A;  4I76 A;  3SXY A;  2VT2 A;  4XKC A;  1V54 H;  1ETW A;  3S16 J;  2R5Y A;  1BW5 A;  5L3F A;  4CDG A;  1TT5 B;  1AOY A;  2EV0 A;  3Q0W A;  4WK8 F;  4II2 A;  3DEE A;  2FF4 A;  1I5Z A;  1KU2 A;  2DFE A;  2QQ8 A;  1RET A;  4A6E A;  3GTG J;  4MTE A;  1TW3 A;  1VQK I;  5EGO B;  2RC4 A;  2P5K A;  4YG2 F;  4KDP A;  1BW6 A;  4XKB A;  3CMA I;  1V4R A;  1ZGJ A;  2HVR A;  3GCM A;  3BR2 A;  2CQK A;  3E6M A;  1FEX A;  2P81 A;  1QO0 D;  4BJT A;  1AHD P;  1YI2 I;  4XK4 A;  2VKE A;  5DUI A;  1F36 A;  3G4S I;  1R23 A;  2M7B A;  1PP8 F;  1UAA A;  4D7M A;  2ME6 A;  1IN5 A;  3LAP A;  1U2W A;  1AKH B;  1LVK A;  1IV8 A;  2E19 A;  4XSX F;  3L9F A;  4E7K A;  4NNJ A;  1J9I A;  2DMT A;  1H88 C;  1ONV A;  3HOT A;  5FFX A;  1FOW A;  4XLC A;  3FKJ A;  5FLX Z;  4IHS A;  5EZG A;  4XLP F;  2UUZ A;  3ZXS A;  2JPC A;  2ADU A;  4BJ6 C;  1WJB A;  1ZLK A;  1XMX A;  4GYI A;  5LFA A;  2DYR H;  3M7G A;  5DCF A;  4LMY A;  5TRD A;  4LK1 F;  5GAH J;  3BZK A;  3HRS A;  4C2M J;  5JLW A;  1HA8 A;  4Y13 A;  3PM1 A;  4A0Z A;  5K5R A;  3QP6 A;  5BPD A;  5IYC J;  3MWM A;  5IT9 Z;  4KN4 X;  3JSP A;  4A3G J;  1LPQ A;  4PJ0 C;  4C3I J;  2DYS H;  2F5E A;  1UJ8 A;  2V6E A;  3TQN A;  2KIM A;  5D6E A;  1QVT A;  2GA1 A;  3QOE A;  4LLG F;  1P2F A;  1VI0 A;  4LK0 F;  1OR7 A;  1VQ9 I;  5LGN A;  5TIS C;  1H8A C;  3B73 A;  2IGO A;  4A2U A;  5BS6 A;  1YG2 A;  1YW9 A;  2FSW A;  1W0U A;  1OLT A;  5D8K B;  1BR4 A;  2HI3 A;  1G8X A;  1IXR C;  4PZJ A;  1MMA A;  4A3D J;  3OY9 A;  3MD2 A;  1BOA A;  3OYF A;  4Z2Y A;  1FMV A;  2VC1 A;  4BBR J;  3PO3 J;  3R6S A;  2Y2Z A;  1GLN A;  3DV8 A;  4LB5 A;  1R00 A;  1FBU A;  1B8I A;  2BW3 B;  2XPU A;  3DTI A;  2XKO A;  5GTH C;  1G3Y A;  1V5E A;  3JRA A;  3L2Q A;  1LKX A;  1D0X A;  2RN7 A;  1R7J A;  3C2H A;  5J40 A;  2R0Q C;  5ICC A;  2HPM A;  2M87 A;  3C2G A;  3C3W A;  2P5L C;  4WXC A;  2VLA A;  3K4J A;  4ITV A;  2RNG A;  2W57 A;  3LSJ A;  2LY1 A;  1JJ8 C;  3HOV J;  4IO9 F;  5H2F C;  2DU9 A;  2H94 A;  5JLX A;  3GW2 A;  1I3A A;  1BI3 A;  2Q2E B;  1F43 A;  3NEU A;  2V1X A;  4I09 A;  2X4H A;  2R7Z J;  2OQR A;  4FT8 A;  2V4J C;  3F3X A;  5CQG A;  3KYC B;  1F9N A;  4U88 A;  3JSO A;  2O7O A;  3FXK A;  3I59 B;  2R5Z A;  2LBF A;  2H1K A;  2O03 A;  3U21 A;  3N97 A;  4FIS A;  4KFC A;  3BRO A;  2N8G A;  1P4W A;  1ETX A;  2IPQ X;  4A5M A;  3CP2 A;  3GBG A;  3KZZ A;  1KYW A;  2PMH A;  3BTJ A;  4M6X A;  1HLV A;  5HNH A;  3CDL A;  3HL2 A;  1Y0N A;  1ZRE A;  4GDF A;  2G0E A;  3GWZ A;  2VQH A;  2R7W A;  3LOC A;  5D5W B;  4HG2 A;  2K9L A;  1LQ1 A;  2QSF X;  3VOE A;  1IN8 A;  2P0W A;  4XOP A;  2ME0 A;  1GVJ A;  2R7V A;  2OZU A;  2FQ4 A;  5ILU A;  1HW5 A;  1NG6 A;  4ZYG A;  4CO8 A;  2HDC A;  1ORK A;  4X6A J;  1Z7U A;  5AIQ A;  2KFD A;  3KIO A;  3OYH A;  3JRD A;  2DI3 A;  1DPU A;  2ZJQ F;  4I6Z A;  1EV7 A;  2KIS A;  1MMN A;  4PFO A;  4CYC A;  4F55 A;  3J7Y J;  4B43 A;  1JTX A;  2ZXH A;  3ZQL A;  2QVO A;  3I64 A;  1DUX C;  3S32 A;  5EGO A;  2MD5 A;  3H3Z A;  3CCR I;  2X6W A;  3Q0U A;  4BDY A;  1GXQ A;  2VIX A;  2EFN A;  1YIO A;  3DP7 A;  3NRV A;  5H6Q A;  3GF2 A;  2F48 A;  4OIP F;  3M8J A;  4A3E J;  2KT0 A;  2IS4 A;  3S2H J;  3K4K A;  2VB6 A;  1IUF A;  3QYE A;  3ZMU A;  3R0J A;  5DCM B;  1AKH A;  1MBJ A;  5H6R A;  2ZME B;  3N4M A; 
#chains in the Genus database with same CATH homology
 4F3Q A;  1T95 A;  3PSI A;  4Y33 A;  1IRX A;  2LC2 A;  2CUJ A;  2DJI A;  4CCN A;  4XLA A;  1MW7 A;  3L2U A;  4F91 B;  2KZV A;  2VQG A;  3OWT A;  2JVH A;  2A6T A;  1E0E A;  2KDO A;  2XF5 A;  2MC4 A;  2WY8 Q;  3QOD A;  2JSP A;  4E7I A;  1D1A A;  1QHH D;  3OR1 C;  1D1B A;  3DLA A;  1SAU A;  3L2W A;  3DKY A;  4PK4 A;  1W36 C;  2RRE A;  3VSK A;  2ELJ A;  2WAE A;  2MAB A;  1DP3 A;  3ZQQ A;  2E1M C;  1MMG A;  1WJD A;  1UEL B;  2IS6 A;  2M4K A;  3BG6 A;  1QU3 A;  4CCM A;  4PSX A;  3E0J B;  2JVG A;  2LH9 A;  4F92 B;  2CV0 A;  4IQ4 A;  3EUA A;  2E5Z A;  1D1C A;  3PSF A;  4XMY A;  3DQV C;  3OYC A;  4G6T B;  3ZRG A;  4KIS A;  4PFP A;  2W7N A;  4LIV A;  3W3C A;  3ZR8 X;  1W36 D;  3F9K A;  5HLT A;  2DCE A;  1AA7 A;  4QPQ A;  1K6Y A;  3HC7 A;  4CCJ A;  2K5C A;  2CH0 A;  2XF6 A;  4ZC3 A;  1TT0 A;  3FDY A;  2HU9 A;  3CMM A;  3MKW B;  4C9Y A;  4YRV A;  4HST A;  5LD2 C;  2VJJ A;  2KRC A;  2RQQ A;  4ZYA A;  3G2B A;  2WAF A;  4DBQ A;  3ZCO A;  2DXI A;  1U0J A;  3EPZ A;  4BJ5 C;  4XNF A;  4NUB A;  3OYG A;  3DPT A;  3K4L A;  3L2V A;  3OYI A;  3H35 A;  1JI8 A;  1LFP A;  3BLY A;  2CUZ A;  3TMO A;  2VXD A;  2NOJ B;  4E7Z A;  2BW3 A;  4BQQ A;  3BC8 A;  4PJN A;  2KPM A;  3LMM A;  3D5R C;  3I3L A;  3OL4 A;  3SEZ A;  4P1W A;  2K9M A;  3OIQ A;  5HOO A;  3OYL A;  4BE2 A;  2W82 A;  4MLO A;  4XL9 A;  3MKZ A;  5KNL A;  3K4C A;  3CF2 A;  2DT7 B;  3RSN A;  1X4P A;  3CP8 A;  4AVZ A;  2M7A A;  1BR2 A;  4AYB A;  1N75 A;  2V26 A;  4YEJ A;  1DGW Y;  4U87 A;  1WFX A;  4RLF A;  2LYC A;  3H9Q A;  2W4S A;  4AU7 A;  3DPU A;  4QPO A;  4KT6 A;  1MMD A;  2F4I A;  2DT6 A;  1FMW A;  1SFK A;  4OAZ A;  4ZDP A;  2XC7 A;  4IKF A;  3W2A A;  4BXF A;  2VJ4 A;  3OOU A;  1WJ5 A;  2DOA A;  2VJI A;  3DTE A;  3LSI A;  3K4M A;  3EUH C;  1S9H A;  2X6X A;  3KX2 A;  4HNT A;  2X85 A;  3LFU A;  4KJZ A;  3D5L A;  2E1M B;  4N4N B;  2WB1 A;  3SDB A;  2F5V A;  1YX3 A;  4RMN A;  4DJA A;  5KCM A;  3K4B A;  3W2W A;  2VJ5 A;  4N4O B;  3VYS B;  3OYJ A;  2CW8 A;  4F93 B;  2K3P A;  2HZD A;  4BE1 A;  2CFO A;  2VAS A;  3OYM A;  4XR6 A;  3DU6 A;  3L2R A;  2KQR A;  2CV2 A;  4F52 A;  4HNU A;  4E7S A;  1YX5 A;  3OYB A;  2HNH A;  4XN0 A;  2R7X A;  4B3X A;  4XKV A;  2JUG A;  2VPL A;  4OAY A;  3MKY B;  1Y56 A;  2LY2 A;  1BOB A;  2OC6 A;  3NWT A;  2MD0 A;  3A4C A;  4DBR A;  2R7R A;  3OYN A;  3ONQ A;  1MNE A;  1X1B A;  4R79 A;  4HEA 2;  2Y0S A;  1ERD A;  3HPG A;  3K70 C;  2XDV A;  4FET A;  3PL8 A;  1X19 A;  3H5R A;  4XM3 A;  4E6K G;  5FRM A;  2IGM A;  4X0G A;  3IP4 B;  1YE9 A;  1WJC A;  3HPH A;  2M0M A;  3K4N A;  3OMY A;  4PJL A;  2R7T A;  3H5N A;  1Z3X A;  3CJR B;  2W00 A;  2HVS A;  2IS1 A;  3TL4 X;  3K70 D;  3E1S A;  2OV7 A;  1UG0 A;  4XOR A;  3AL0 B;  1LDK B;  1T0F C;  4BE0 A;  1N77 A;  2KHM A;  4E4H A;  2WA0 A;  4PJM A;  4BS9 A;  3HOS A;  2Z16 A;  2M4G A;  3N05 A;  2L7K A;  3S3O A;  3HG9 A;  3K10 A;  4BL0 B;  2LBF B;  4ZDL A;  4RM2 A;  2HPI A;  2X1C A;  4IX7 A;  3IUO A;  2WBM A;  3QYF A;  4LG3 A;  1NG7 A;  2IGN A;  2PMZ A;  2V9K A;  4HPQ A;  5CQE A;  4ZDO A;  3RTR A;  4C2U A;  2LOO A;  2ZSH B;  2WAQ A;  2UV1 A;  1P9Q C;  3H5A A;  3DTK A;  4BEH B;  3OS0 A;  2L5Q A;  1QHG A;  3LL7 A;  3PJR A;  4CCO A;  3D5S C;  4II3 A;  3RQ4 A;  3OYK A;  2PJR B;  2O5R A;  2F6C A;  3DKX A;  2MFZ A;  3AFH A;  4J00 A;  4BDZ A;  2CMP A;  4LIT A;  1V5G A;  3CJQ B;  3HXL A;  4NC8 A;  4CSW A;  4D9J A;  2HVQ A;  4DGW B;  2ZFU A;  4NC7 A;  4PJJ A;  4XKC A;  3EUK L;  3LSH A;  2HQA A;  3OIP A;  3NWS A;  2E5N A;  4II2 A;  3DEE A;  2R7O A;  3VSL A;  1PYV A;  3SEQ A;  3CZ6 A;  4XKB A;  2KMU A;  1Y6I A;  2HVR A;  1X1C A;  5KHD A;  1X4O A;  2AQE A;  4U7B A;  2UWM A;  2VQC A;  4BJT A;  3OYE A;  2L9S A;  1X1A A;  2M7B A;  1UAA A;  5FRO A;  1D0Z A;  2ZXI A;  2HDW A;  2Z1D A;  1LVK A;  4E7K A;  2R7S A;  5CPR B;  4NNJ A;  2BVL A;  4DOZ A;  2QKL B;  4CH7 A;  3K6G A;  1WJE A;  3HOT A;  1WJA A;  1G59 A;  4XLC A;  3FKJ A;  1R6R A;  3I9V 2;  2Q1Z B;  4XOT A;  3OS2 A;  2UUZ A;  1KON A;  3ZXS A;  3A2K A;  2CW7 A;  4BJ6 C;  1WJB A;  5LFA A;  3IAM 2;  4LIU A;  3ZGK A;  2JA2 A;  3PNY A;  4B47 A;  1HA8 A;  4YEL A;  3LSK A;  2KLO A;  4JQF A;  4XQF A;  1J09 A;  3S93 A;  2CV1 A;  2V6E A;  2M3A A;  3QOE A;  4IZZ A;  1VZ0 A;  3A1Y A;  2WAD A;  3S3N A;  2XAU A;  4EAT A;  4BAC A;  3H9G A;  4D1Q A;  2IGO A;  4BUP A;  2WY7 Q;  3BCA A;  1DQU A;  2CS3 A;  4PUS A;  2X1E A;  3LSM A;  1OLT A;  4XLF A;  4CCK A;  3OS1 A;  4IQJ A;  2AQF A;  3RPU D;  3J7A Y;  3UR3 C;  1BR4 A;  4BQO A;  2IS2 A;  1G8X A;  1WJF A;  3PUB A;  4P5O A;  3BCB A;  3OR2 C;  1DGR M;  2W1O A;  2KP6 A;  3HUG B;  4OWR B;  1MMA A;  1PJR A;  4XLE A;  3OY9 A;  3HKZ A;  3MD2 A;  3OYF A;  1FMV A;  4B44 A;  3FBI B;  1Z21 A;  4KIT B;  1GLN A;  3MMY B;  3W2V A;  1OR7 C;  3OYD A;  4CCL A;  2BW3 B;  3DTI A;  5HVQ C;  1V5E A;  2VL8 A;  2XSJ C;  2A5W A;  1LKX A;  1D0X A;  3C2H A;  3VYU B;  3L2Q A;  3LSG A;  2HPM A;  3C2G A;  3S8P A;  2VLA A;  3K4J A;  3QYB A;  2RNG A;  4ITV A;  4HSR A;  4RM3 A;  1Z7L A;  4E7J A;  2R4G A;  2LY1 A;  2LRE A;  3SYT A;  1TZL A;  1N78 A;  4E7L A;  2X1D A;  3UNG C;  3AKZ A;  2MYS A;  2Q2E B;  4C30 A;  2E60 A;  3FBN B;  3V42 A;  4XKW A;  3PNT A;  3CES A;  2V4J C;  4FAS D;  5CQG A;  2R7U A;  2KL4 A;  4ZTJ A;  2BVM A;  2V1N A;  2LBF A;  2VQL A;  4Y3O A;  3H9J A;  2OUM A;  3VYT B;  4DIQ A;  3U21 A;  4XON A;  4E7H A;  4PSW A;  2BOL A;  3PFY A;  3CP2 A;  4XLH A;  3VYR B;  3GBG A;  3RCO A;  5HNF A;  2VKD A;  5HNH A;  2QKM B;  4BGD A;  3HL2 A;  1BR1 A;  4CZC A;  4BEH A;  3AL0 C;  2VQH A;  2ZSI B;  2GOM A;  2R7W A;  4C2T A;  1X1D A;  2PJR A;  3DU5 A;  1ZEL A;  2K9L A;  4HG2 A;  1MND A;  2P0W A;  2XF7 A;  4JOM A;  2X6Y A;  3DPL C;  3TBI A;  4XN3 A;  4XOP A;  2KRH A;  2R7V A;  4BU2 A;  2X51 A;  2LRD A;  1NG6 A;  4NQW B;  4RLQ A;  3BG7 A;  3KEY A;  5CKT A;  3OYH A;  3VWB A;  4J01 A;  2LG4 A;  3OYA A;  3OL3 A;  1MMN A;  4PFO A;  2VXZ A;  4Y4R A;  4F55 A;  2L2O A;  2ZXH A;  4B43 A;  3FHN A;  3VDX A;  4ANJ A;  4CA0 A;  4HRI A;  3S32 A;  1V5F A;  2V7F A;  2X6W A;  4B48 A;  2FUG 2;  1EA3 A;  2IXS A;  4BDY A;  3PNV A;  2VIX A;  2L9N A;  1Z3Y A;  5FRN A;  4ZTF A;  4BQN A;  4GRI A;  3KYL A;  3H0D A;  3M8J A;  5JHF A;  2IS4 A;  3SZG A;  4ZJZ A;  3K4K A;  2Z2S B;  2VB6 A;  2GOX B;  3QYE A;  5TGT A;  4CUG A;  3IAS 2;  2I8D A;  3DWL E;  2IGK A;  2R7Q A;  3M1C A;  3S3M A;  1D0Y A;  4H4K C;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...