2OUMA

The first domain of l1 from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
129
structure length
129
Chain Sequence
ALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L1
publication title Domain I of ribosomal protein L1 is sufficient for specific RNA binding.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 25
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oumA01
2OUMA 2OV7A 2VPLA
chains in the Genus database with same CATH superfamily
4XSZF 2CG4A 4HG2A 1O7LA 3S2DJ 1VNDA 1NK3P 3F8NA 2L9RA 1U8BA 4BQOA 3ZQCA 1DQUA 3HJEA 3HTSB 5JR3A 1R9TJ 1U78A 4E4HA 2JVGA 1WJCA 2ESNA 5GAEJ 3WGIA 1UHWA 2A6HF 2ZXWH 4MTEA 3SJMA 4X1EA 4WCGA 4M6XA 4IOCF 2KPMA 1K6YA 2AXTC 5KAFC 1MJAA 5FROA 1Z67A 4HBLA 1ETWA 4ENNA 3VSLA 5FKNA 3K1PA 4DZPA 3PUBA 3HUGA 4U87A 2L01A 4NC6A 2X1EA 2DT5A 3DPUA 2R3SA 4QTRA 1FBSA 2CQXA 1JE8A 4BACA 4ENMA 2V9KA 5FJ8J 4B43A 1UZCA 2WBMA 1BBYA 4O3MA 5LD2C 4RBOA 4OOIA 3GTPJ 2CW7A 4LIUA 1SVMA 1NHAA 1ZR2A 1AA7A 3A03A 2HQNA 3BT9A 2BE5F 3GCMA 3HRTA 2KISA 1I50J 1ZKGA 3ONQA 5EEAA 3CTAA 3H92A 2ECCA 3S32A 3G3ZA 5K5QA 4ETSA 2DA7A 1TQMA 4UV8A 2GA1A 5JLXA 3BCAA 1PDNC 4I0AA 1X3UA 2GOMA 2ZJRF 2A07F 1NTCA 2Y69H 2V1NA 5GAGJ 4IX7A 4ZDOA 3FXLA 4GO1A 4ZYHA 4HNVA 4C9YA 3K4LA 2Y31A 3WE2A 2CRGA 2MH9A 1X1PA 2UV1A 1NH3A 1MSEC 4B48A 1IN5A 4AYBA 3FBNB 2HEOA 2BOLA 4PDKA 2BXYA 2NRAC 3E5UA 2TDXA 5KVRA 2CV2A 3BPXA 1G3WA 1ULYA 2VQLA 3P9IA 4MFDA 1XCVA 2VN2A 5FLMJ 2QKLB 1XGOA 4F3QA 3E5QA 2V26A 2B9SA 4PK4A 4BAYA 4KIFA 4BQAA 5DCMA 4XOPA 3OSFA 3HC7A 3N97A 4C3JJ 3AG2H 4ZZLA 2WAQN 1XGNA 4MGRA 4DW6A 2UUZA 2MD5A 4MIMA 2XAJA 1JKQC 2LVSA 5AONA 2CYYA 2F6CA 1W1WE 1LUJB 3ZN0A 1FTZA 5E3LA 1OYIA 1OISA 1TBXA 1ETXA 4CHUA 3HOXJ 4L9JA 4U88A 2VPLA 3L2UA 3JW4A 3GFMA 1K78B 2WB1N 2PJRA 5B1AH 2RKHA 4M74A 2MD0A 3Q0WA 2VOOA 4IOAF 2XAFA 5IT9Z 5C4JJ 1NK2P 3KP2A 1OCCH 4UY8I 1SAXA 2XGCA 1MMSA 3GVAA 2GM4A 5ICGA 3FKJA 3DPLC 4EGYA 3DXJF 2Y9ZA 3AAFA 4EMSA 3S1MJ 2G7UA 2J5PA 3P5JA 2VQCA 4PFPA 1DU6A 5HLGA 2RAEA 2CGPA 5JI6A 2QQBA 5GAHJ 3E6DA 4C3HJ 4BL0B 4AIKA 3KLOA 4KT6A 5FKOA 5LGNA 2M34A 4HYEA 1IC8A 4J19A 2W84A 1KU3A 1SFOJ 2E7WA 2QENA 4BJTA 1X1DA 2V79A 2DMQA 3I59B 4AUXA 3ZGKA 4BYYA 5K5RA 1BW5A 4KA4A 4BE2A 3KLNA 3U9GA 2JQ7A 2QZ8A 4JYKA 2K4JA 2QKMB 3JREA 1H9TA 4RM2A 1T2KA 2JPCA 1J7KA 2ZSIB 3Q9VA 4S05A 2JA8J 2F4OB 3BZ6A 4S04A 2VKVA 2M5WA 2ZMEC 1TNTA 4XR6A 1W0TA 3H3VK 3OIPA 2GBYA 1V55H 2PQ8A 4F7ZA 3M8FA 4HAMA 1R49A 2VI6A 1IN4A 4LIVA 2XAUA 3S3NA 2PG4A 2IPQX 2EJRA 4FASD 5EEHA 3DF8A 3E0JB 4LK0F 1PUFB 1WGXA 2ESHA 1FNNA 1ZYRF 3HEFA 3M7GA 2R5YB 3OL4A 2L7ZA 2YUSA 3LSKA 3I55I 4M9XA 1UB9A 3CCEI 4XLEA 3E6MA 1YI2I 3ZN1A 4QPOA 3KP6A 3CJTB 4D0PA 3HPHA 3SFZA 1S29A 5LEKA 4WXHA 1HBXG 4Y52J 2IRFG 1ETYA 3LSPA 2OZ6A 3LQQA 2PBIA 4MTDA 2DOEA 4HX7A 4KN4X 1MH4A 1A36A 2E5NA 5F1RA 5JHUA 2L5QA 2NNYA 3PSFA 5D6EA 4MQVA 4DOZA 1LKXA 2KP6A 3SEZA 1ZARA 2JK3A 2X6OA 4F91B 2DPUA 3LMMA 2XDVA 4UUVA 1FOXA 2LC2A 2QQ9A 2Y2ZA 3CCMI 1U5TB 1KU2A 4BJ5C 1U6GA 3V8LA 4ENKA 3GTOJ 2K9LA 4I09A 5HVQC 3GFIA 1X1AA 4JQFA 3ECHA 3LSHA 4LLGF 4Y7NJ 3ABKH 1XSDA 1RKTA 2STTA 4ZZDA 3F9KA 1QPMA 4A3CJ 3H5NA 3J80Z 2R7DA 4NQWB 1TTYA 5TRDA 2EFOA 2GXGA 4ZYDA 4CCJA 2A6TA 2YX7A 2V7FA 2VKHA 4D7NA 3OYGA 3E3VA 2XAHA 5EEGA 3WTSC 1OPCA 1OCTC 3RPUA 2VC1A 2GWRA 3HXLA 4CGZA 4EV0A 4FETA 2RV8A 1D0XA 2KIMA 2DJIA 1ACIA 4AWXB 3DTEA 4PUSA 3JRDA 4BS9A 3ECOA 3GTGJ 5J4YA 4BHPA 1MSFC 2OJED 1FWZA 2FUG2 3ML6A 2L9NA 1MDMB 2Q2EB 1D1BA 5C44J 3QAHA 3OOPA 1USTA 2D1VA 3SQNA 1FIAA 3C1DA 2TRTA 1TW3A 3L2CA 3CDIA 5F64A 1FP1D 1TWHJ 1WJEA 3FK6A 1RESA 2IS4A 3VWBA 5IP6A 2VJIA 3CP2A 3VDXA 2X0LA 2KRFA 1PJRA 4YFKF 1FMVA 1HC8A 5F0CA 1WI9A 2QCOA 4EEFG 1JTXA 1V4RA 2FBIA 3JRHA 1ZR4A 4A5MA 1SAUA 3OYHA 4R79A 5H6QA 2E7XA 4C30A 1TP4A 4LLLA 2IW5A 4HEA2 3SZGA 3K70D 1ZAOA 3VODA 2ZJQF 1SFUA 1ONVA 2DA1A 1Y1VJ 2P5LC 3WODF 2GXBA 2OA4A 2LBFB 2PJPA 5E17F 2FD5A 1AU7A 2A61A 2EQRA 3H3ZA 2X1DA 4RA2A 2DQLA 2XAQA 1YHQI 3ZQ7A 5H20A 2BW3B 3COAC 2HDCA 1IV6A 1IXCA 4BQNA 4N9IA 5F1JA 2HDDA 2F5FA 3W6KB 2JZYA 2BHYA 1YRNB 2X85A 1Y0UA 4WF2A 2V9PA 2DMUA 2HOTA 4PJMA 4E7JA 1GV5A 3ZMVA 5E3NA 2IP2A 2X1CA 1D1CA 2E34A 5AIQA 2QWWA 3CC2I 4XKBA 2XUBA 4XM3A 5FLXZ 1K83J 3ULQB 1ZRCA 1EH8A 1SFXA 4A6EA 2VBYA 4CZCA 2MGQA 1LNWA 2NOGA 2M0MA 4KNYA 2KFDA 4B8XA 1FSHA 3IHUA 3IH2A 2AQFA 1P4AA 3GTLJ 4BY7J 2R0QC 2RDPA 1H9GA 2DDBA 2V9VA 3HTUA 1B72B 1S6LA 3CZ6A 3K4JA 2QM3A 2VONA 3H35A 1LB2A 3HOZJ 3RKYA 1MH3A 2B63J 5FLXK 1IRFA 2K02A 4IRHA 5B3SH 4DYQA 2HWVA 4D1QA 1I1SA 1TWAJ 5HLTA 1QZEA 2W24A 1MBEA 3PQKA 1ZLJA 5A2QZ 2DA4A 4PZJA 3LSGA 4HLXA 5B5EC 1YIOA 3F0CA 1OCPA 3HSRA 3G73A 1B4AA 2V6CA 2RNGA 3WU2C 2R5YA 2OUMA 4LB6B 1GUUA 1V5EA 2KMUA 4AIDA 3JSOA 1QZYA 1LDKB 1BOAA 2L7KA 2COBA 4E7SA 1FYKA 1IUFA 3EUAA 2DA2A 3H5RA 3HRMA 4WK8F 3HOUJ 3F6OA 3QPHA 2RC4A 2VKDA 1A5JA 2HKOA 1B59A 3I3LA 3OIQA 5J8FA 4G6DA 2DJNA 2GAUA 2PEXA 3A1YA 1ZRFA 3DTKA 4P9UA 3CJNA 3DBLB 2M4GA 3BC8A 5CJ9A 4DBQA 2BY3A 3RCOA 4CZZA 1Z0XA 3OS2A 2WC2A 4KFCA 1Z05A 1MJBA 3ELKA 1LQ1A 2GZWA 4RAGA 4UXNA 3OYFA 4I01A 1KU7A 4FT8A 4CDGA 3CO7C 2QVOA 3EQLF 3DBRB 3RZOJ 4QIWN 1BIBA 2EPFA 4HF2A 2HYGD 3BR3A 5LRRA 5L3CA 2IGNA 1K79A 3PJRA 4NQWA 1TT5B 3ZMUA 2XC7A 2KDOA 4UVAA 4CCMA 4YFNF 2NVXJ 2HPIA 4DNCA 2LY2A 5E79C 3LFUA 2UWMA 3ABUA 4MNUA 4OMZA 4V2FA 2JSCA 2M9HA 1D1AA 5D5UB 2R7TA 1BIAA 3A01A 1Y39A 1BJAA 4LG0B 1ETKA 5E1XA 3IH4A 2OQRA 3PL8A 4KIBA 1XMKA 4QPQA 3KCCA 2LDUA 2O03A 2I8DA 3ZQIA 5BOXA 1OFCX 1NG6A 1MBKA 1IRZA 1QVUA 2CQQA 2QLZA 2KKOA 1R00A 5F08A 4CA0A 1E17A 1MDMA 2Q2EA 2L9VA 1XMAA 3LQRA 1MNMC 3CMMA 1JTYA 5CVVA 1ZRDA 1P7IA 4L5JA 4FHTA 3BQZA 5J6XA 1WPKA 1N77A 1FY7A 1BN5A 1B9MA 4YIRX 3KYCB 2HVRA 5FLVA 4G7OF 2DFIA 1JI8A 4HNTA 1Z9CA 4E7ZA 1T08B 3F72A 2O8XA 5DDGA 4QLCU 5DUIA 2O7OA 5K7HA 1R22A 4BHCA 5TISC 2P7CB 2ACJA 2IS6A 1O7FA 1YX5A 3JCUC 3FZVA 3PFIA 1U3EM 2CFOA 3V42A 1MBJA 2E2HJ 4DJAA 3E6CC 1YX3A 4Y3OA 2XRLA 4RM3A 3FMQA 2LBFA 4XOTA 1T0FC 1BI2A 5HLIA 1KQ0A 2CW0F 4RB3C 2ZJ2A 4XORA 2E71A 2L4AA 4M72A 2H27A 1WJDA 3CF2A 3DEUA 3DQVC 2BW3A 4AYBN 3KYLA 2QQAA 4XLHA 1S3JA 1WWXA 1LE8A 1VQLI 2DAOA 2R4GA 3C18A 1OCRH 3B6CA 4ZYGA 3OSGA 1RI7A 1S9HA 3RI4A 1T0FA 1UG2A 3T8RA 2VASA 2P4WA 4EJTA 5HS9A 4RDUA 1RKWA 2VL8A 1N75A 3K69A 1ETVA 1BL0A 1A04A 2DFHA 1IW7F 3J81Z 2DODA 3EYIA 1OJLA 3B73A 2DK8A 2A3SA 2HOEA 2LFBA 2Z1DA 2O9LA 1S8NA 1TWFJ 4BEHB 2KRHA 5FFZA 3LA3A 4CCNA 4U7BA 4XIDA 2VT2A 4A3DJ 4MFEA 3L2RA 2Y48A 1RNLA 2VBXA 3O3KA 1XGMA 3FXKA 3LSTA 1K6OA 3FK7A 3J81K 1TWCJ 1HW2A 2WV1A 1B72A 3CCJI 3RKQA 1ZN2A 4R1HA 4L9NA 2FSWA 1OR7C 2JTVA 4HX8A 4BDZA 3F8BA 2X51A 3J7ZI 1X1CA 3FIWA 4IEJA 3TEDA 2OCEA 2E19A 2F5DA 4CCKA 2X9DA 4EGZA 3K2AA 2BVLA 2ELJA 1BJZA 4G9YA 3OYEA 3NWSA 3S3MA 1RIOH 4R8HA 2EIMH 2QUFA 3PNTA 1S7OA 2DFEA 1T6SA 4Z6YA 4XLPF 3S2HJ 1OR7A 3M8EA 1HOMA 3HSEA 1KQ8A 4JK1X 1W5SA 3NARA 4V2GA 5LHHA 2XSJC 5E1WA 2R7UA 3AG1H 4FX4A 3SZPA 2VKEA 4CUGA 4M3EA 1H89C 3X2QH 1VFCA 4OIQF 3LWFA 3ERED 2D5VA 3SHFA 3GLLA 4NDLA 3C2HA 1BOBA 4NBQA 2HZDA 3MD2A 1ZELA 4L18B 3L7WA 3VFZA 1IRXA 3I54A 3QU6A 4F92B 2DT6A 3IKVA 2YU9J 1X19A 4M9SA 1J09A 2BZTA 4C2UA 1A6QA 3DKYA 4BBSJ 1KU9A 3GF2A 2K9SA 4L5EA 4XK4A 4WX9A 2FU4A 3TBIA 1YJWI 3HKZA 3CMYA 1XCBA 2R7FA 5HOOA 3FXMA 1I27A 2LP0A 5HS8A 4BE0A 3DPTA 3K6GA 3MCZA 1WJBA 1STZA 2JUCA 2V6EA 2QBYB 1VQ7I 1BW6A 1U8RA 3BR5A 2ZXIA 2IS1A 3JRGA 2VE8A 5D8KB 1B1BA 3OY9A 2CS3A 1FOKA 4IHVA 1YW7A 4RGSA 2ME6A 1G3TA 2TCTA 1A6IA 4HDVA 3VEPA 2HXIA 1BR2A 4KT5C 1ZH5A 1YTYA 2LRDA 4LG0A 2R92J 3SZTA 1T38A 3W2WA 5K7ZA 1U9OA 3OYCA 2VXZA 3HHGA 3FKIJ 4A6DA 3OYKA 3JAMZ 2W25A 1XPXA 1W5TA 2O3FA 4LK1F 4BH9A 2YS9A 1QHHD 1UG0A 3A0BC 3EDPA 1HF0A 1KQ9A 3FWEA 2NOJB 1SD7A 5ILSA 4BJ6C 5JVGF 4GXOA 2M7BA 3W6VA 3GO5A 1RUNA 2PMZA 1XTAA 3QRFF 2H94A 3CJRB 3BZKA 3ESWB 1E3HA 4XRFA 1JHHA 2RGVA 3BDDA 4DQ2A 4XLNF 3GZ6A 2XB0X 1XS9A 1GHCA 4PJ0C 3HZJA 1Z91A 4B3XA 5EGOA 4AC0A 1H0MA 4OWRB 4U0YA 1ERDA 3Q0VA 2VBZA 4CCOA 2O6GE 1XDSA 3BTCA 5E8GA 3BR6A 3L2QA 3VB2A 3ROUA 2NVTJ 2NVYJ 4P55A 1LFPA 3KP4A 2O0YA 4Y13A 3I53A 4L5IA 1GVJA 3U1DA 3HOTA 1JT6A 3K9TA 2H1KA 4EATA 4FX0A 5DM6F 1KGSA 3H9JA 3G4SI 3CC4I 1IF1A 1X3WB 4RLQA 1HCRA 4HSRA 1P9QC 3MKYB 2F5VA 2L9SA 3TW6A 5HNFA 3ASNH 4N0BA 5E3OA 2EA4A 4OMYA 1JT0A 3E7LA 1FOWA 1Y1WJ 3NAUA 2AQEA 3TGNA 1XDUA 1YFHA 4B3AA 2NNNA 2HVSA 3FXJA 4QSHA 3GX4X 2OC6A 2XGDA 2DDAA 4M3BA 5GPAA 3JTHA 5KK1A 2DPDA 2CU7A 3TO9A 5M5XJ 2HFHA 3AL0B 4AVZA 2AXLA 3HRSA 1AKHB 1QGPA 1O3SA 4CYCB 2EZHA 3K10A 5IT9K 3DV8A 5D5WB 3FX3A 2GQQA 3NRVA 2OAZA 4OAYA 3EYYA 2HGCA 2KIQA 3AKZA 3WU1B 3BG7A 3DCFA 2JA2A 3FM5A 3QU3A 4BEHA 3LSRA 1O57A 3TO6A 1MKMA 3E5XA 3KP7A 3GTKJ 1W7PB 4GDFA 2CO5A 5KCMA 2ID3A 3ASOH 2GA2A 2K9NA 1OLTA 4LITA 4RLFA 3ABLH 3S93A 1BI1A 2XF6A 5E1ZB 3CCYA 5TGTA 3WTVC 3BP8A 4IRGA 5FGMA 2AHQA 4UV9A 3DTIA 3S8PA 3BG6A 3T5XA 1IJWC 1FYLA 6PAXA 1OYWA 4CXFA 2FMLA 5FRNA 3CJQB 3F8FA 3ZQGA 3JRBA 4LG3A 4K2EA 4KN7X 1G3SA 1ZG1A 1VTNC 2HQRA 3GTMJ 2VODA 4FTHA 1B9NA 2P0WA 2VB6A 3OYLA 1VQ6I 2HQAA 2JPBA 3F8MA 4F52A 4IHYA 1B6AA 2M4KA 3U1KA 3KIOA 2OPTA 1R23A 2D1HA 5LRSA 1W4MA 1ZTRA 1LFBA 1GV2A 1IN8A 3G1OA 3IUOA 2B0LA 3DP7A 5J1RA 3VYSB 3D5RC 2EA2A 2LY1A 4UUSB 2ZJPF 2DXIA 1GXPA 2DLLA 3KEYA 1XN7A 2CH0A 3CMEI 4E7LA 1WHUA 3PIOF 4BDYA 1SMTA 1HXDA 2PX9A 3HBLA 2RQQA 3S1NJ 3M9AA 4EJWA 5F0FA 1ZGJA 2XHKA 4PJNA 2K27A 4XRSG 5FB2A 2YR2A 2CUEA 2XPUA 2NS8A 4BBRJ 4CYDA 1ZQ3P 2BY2A 2HTJA 2QBYA 1VQ9I 1O4XA 1WKMA 2KT0A 3PNYA 5GTIC 1VQPI 4YIFA 1VF9A 3GW2A 4P9FA 5CVUA 2W00A 1XX5A 4DZJA 4DYCA 4BGDA 5LHGA 9ANTA 2XKPA 5TJJA 1B8IB 2W85A 4A69C 2Q8KA 5BQTA 5IP9J 2VQHA 2ZSHB 5FFXA 1S7AA 3A01B 1H88C 2JSPA 4XBFA 4II2A 5E18F 5BS6A 2O5RA 1EV7A 3J80K 3BTJA 1LVKA 4RMNA 1L0OC 2KJBA 2H8RA 3CC7I 4C3IJ 3HSFA 1UELB 4YELA 1MZBA 2R5ZA 1OKRA 2Z99A 2P6SA 2EK5A 4HF0A 4RAFA 1I6XA 5GP9A 3RSNA 3DFGA 1LEBA 1SD5A 3ZMSA 1YQAA 3F6VA 1HKSA 3GTJJ 3OR2C 4OIPF 1E0EA 1K4SA 3RPUD 3LAPA 3CCRI 3R60A 2PFBA 3CQZJ 5JHFA 4I7HA 4A3LJ 4I02A 2QSFX 3DEEA 1X2MA 1X2NA 3OL3A 3Q9SA 1HW5A 3MMYB 3TW7A 4MLOA 2FNPA 3CDHA 3NEUA 1YJNI 1T39A 2NS7A 3RQIA 1ZLKA 4A3MJ 3HPGA 2H6CA 4I99C 3JRFA 3JR9A 2JA6J 5D5VB 1BR1A 2A6EF 4ITVA 2QF7A 2VC0A 4CCLA 2OTLI 5IOZA 3WTTC 1Z1DA 2LKXA 1R5HA 3S3OA 2B7EA 4JX4A 1MMAA 2DBBA 3AL0C 2IA0A 1R1UA 1O3QA 3U21A 5GTHC 5HLHA 4D9JA 4RB1A 2NVQJ 4CH7A 1K61A 2DYRH 3WHBA 2EZIA 2VUMJ 2P5VA 3LOCA 2DQRA 4QWQA 4NUBA 3RPQA 4XRSA 4HV5A 3SXYA 3H0DA 3GXOA 3P7NA 2PMUA 2LK2A 1LE8B 5J8CA 1WH5A 4GCVA 5ILVA 2K3FA 4A3EJ 3OWTA 1RR8C 1AKHA 3ABMH 1LPQA 4CYCA 2L54A 2XPVA 4V19K 3IRQA 1HSTA 3DU6A 2E36A 3OYJA 3GFLA 3H9QA 4N4OB 2HVQA 1UHSA 3OYDA 2FF4A 1MMGA 3L2WA 3IAM2 3NQOA 3CF5F 3EUHC 3T1BA 1APLC 4I76A 4B44A 2JVHA 2NXNB 4A3KJ 1J9IA 1TLHB 4FISA 1W7PA 1HKQA 4YFXF 2W7NA 3L9FA 1Z7UA 3GBGA 3K4MA 2BXZA 3V8KA 3TL4X 1FBQA 1N78A 2IGOA 1RETA 2DTRA 3QODA 3M4OJ 3EUHA 4KITB 1FT9A 2Y0MA 3L1PA 1TC3C 1IN7A 1V54H 3GEZA 4ZYEA 4PSWA 3E97A 1HW1A 2C6YA 3I9V2 3MWMA 4EJOA 4J01A 5EYRA 3G71I 1JXSA 4HOBA 2A5WA 2GIVA 1I3QJ 2ZNZA 2E1OA 4FE7A 4LFUA 3PNVA 2ZKZA 2M45A 4NC7A 1CF7B 2Z33A 2G9WA 2JWTA 4WXDA 4HPQA 4L0YB 2L02A 2PMHA 4BQQA 2XV4S 4YG2F 4BUPA 1EF4A 5A2QK 4RAZA 3ZQFA 3R61A 2DCEA 1G6NA 3VPRA 1IZ1A 2OV7A 3OR1C 2HOSA 2VJ5A 2CUJA 3MQ0A 3CLOA 1SANA 4PFOA 3ZQHA 4A0YA 3MEXA 1JUSA 1NG7A 3KZIC 4G8XA 4CSWA 4UUSA 4I0BA 3TDZC 3O8HA 4G94A 2FJ1A 2DYSH 4J00A 1YS7A 4XICA 2PN6A 2HQ5A 1QPIA 4BKXA 2WTEA 5F27A 3S1RJ 2Y0SN 2OD5A 3TP3A 2EFQA 5DS9A 3CCUI 5J40A 2XRNA 4HLYA 4ENJA 2FBHA 5C4XJ 4UHTA 5FKLA 2BY1A 3KZZA 1JKPC 2E1CA 5DCFA 3QOEA 1VQ8I 3PFYA 3F8CA 2K4BA 4E7KA 1OCOH 3PIPF 2NYXA 1Z7LA 1Y6IA 2STWA 2OTJI 2ZC2A 2DA6A 2H8WA 2VPRA 2UXXA 1G59A 2H6BA 3GLXA 4GYGA 3D0SA 2ETHA 3W3CA 2W1OA 2RNJA 1DDNA 4BNCA 1B8IA 1LFUP 1R7JA 2WV0A 1I39A 3KYDB 1BC8C 3J7YJ 3H3UA 2Y9YA 2G0EA 4XRMA 3BJOA 2K9MA 3TOAA 2IA2A 2E5ZA 2K9QA 3HL2A 3ZPLA 4JOMA 1F43A 3HHHA 2LF8A 2OBPA 3MKZA 1JKRC 2L7FP 4RS8A 2QYOA 3BZCA 2GOXB 2DTZA 1EJ9A 1H8AC 2E2JJ 2MBFA 1PUEE 3BCBA 4RB2C 1UFMA 4IL6C 4BY1J 3OIOA 2R7SA 3HKZN 1IG7A 3ZRGA 3BQYA 3AG3H 2IAIA 1R6RA 1Z6RA 2WWYA 1BI0A 3TQNA 1RRJA 2XF7A 1ZGAA 3AG4H 4RGXA 4EJUA 3G1LA 1MNDA 4JBAA 2K86A 1XSXA 1QRYA 2BY0A 5L3EA 5EGOB 3V7RA 2HPMA 4UNOA 1S7EA 3K7AJ 1GT0C 3SEQA 1P4XA 5B66C 4XKCA 3GYHX 1XG1A 2CWEA 3DKXA 5JFRA 3IRRA 1WSUA 1R4NB 3EPZA 2QSHX 1VQNI 2XROA 1ZK8A 4N9HA 2F2EA 3MZ8A 2HOAA 2EZKA 4E7IA 4II3A 4IVNA 4A3BJ 1WRJA 4BHBA 1SFEA 3BROA 3I0TA 2QA4I 3A0HC 1WZ2A 4OINF 1UHMA 3OYMA 1XD7A 5H2FC 4OU0A 4JX6A 4P1WA 3SDGA 2KIFA 4IJAA 5LEJA 1JHFA 1W36C 3TMOA 3LSJA 2V1UA 2CFXA 1PYVA 2ZB9A 4A12A 1W0UA 2DOAA 2QSGX 1G8XA 1ORKA 1R5GA 2NS0A 4HW0A 5IYDJ 3QYFA 4JX5A 3FXUA 4XONA 4I6ZA 4IXAA 4ZC3A 4XN3A 2IJLA 1U0JA 1Z3XA 2IXSA 2KZVA 2ZBKA 4YEJA 2PMZN 4L9VA 1DP7P 4Y4RA 5IOYA 3OYBA 2XKOA 2XGXA 2XPWA 1TWGJ 3H5AA 4H4KC 1YW8A 4AU7A 1MBFA 2VT3A 1F5TA 4U0VA 4KMFA 3KEQA 4EM2A 2KZGA 2BV6A 3IKTA 1SD4A 5M5WJ 1WFXA 3ZR8X 4MQ9F 4BE1A 4MEYF 4M3DA 2LKPA 4Z2YA 1N25A 3PUFA 4X0GA 1VZ0A 3DLLF 1FJLA 5ICCA 3FDYA 4NB5A 2F5CA 3BTLA 5EF6A 1X1BA 2FA5A 1V5GA 4ABZA 3S15J 3QPTA 2CSOA 2MH2A 3QPSA 3WTWC 2MW8A 1J0RA 2KL4A 1SEUA 4Y33A 1IXSB 3FF5A 4KYWA 2Y0SA 3MFKA 2X4HA 3I71A 3Q0UA 2XVCA 5HNHA 2HYFA 2LSOA 3OOUA 3O2PE 5FD5A 3UKGA 5HODA 2HU9A 3I56I 4CICA 4D7MA 1VQKI 2KJCA 4WWCA 2H09A 2MFZA 3CUQB 5FO5A 2OU2A 2F4MB 2ZFWA 4RGRA 1JJ8C 1T56A 2HI3A 3RYRA 4B4CA 2ECBA 3CD6I 1DPUA 3RKXA 4Q47A 3B02A 3L09A 2P5KA 1CF7A 3H36A 4LOCA 1DGWY 2CUZA 3PM1A 4FCYA 4PJJA 2DMNA 1YG2A 3ZMZA 2M2EA 5HDGA 3KP3A 2F48A 4G6QA 3WG7H 3LFKA 4ZH4F 2DN0A 1X58A 2VBWA 5BPIA 5CLSA 5CKTA 3WTYC 3BG5A 2DO7A 3S2WA 2ME0A 3FHZA 1Z77A 2MYSA 4N4NB 5KAIC 4KISA 1D0YA 1RPWA 2DI3A 4PCQA 4A93J 2A69F 1USSA 2W48A 5FKKA 5H6RA 2FQ3A 3FM3A 2R7RA 3BPVA 4LB5A 2JA7J 2VIXA 2VXDA 5BPDA 2OQGA 2H1LA 2CUFA 4P5OA 2M7AA 1I3AA 3M1CA 5IYCJ 1ETQA 3OYIA 1U2WA 1R5ID 2EBIA 2L2OA 2V4JC 1D0ZA 1EKEA 2HTSA 5FD6A 2RN7A 3M3YJ 4BU2A 1E3OC 5IYBJ 1YOVB 2EIJH 3VYRB 1YITI 3EUKL 2RVCA 4D5CA 2CQKA 2FXAA 3E6BA 4M3FA 2QEXI 1A31A 4HSTA 1WJ5A 3HGYA 4BXUA 1MMNA 2FRHA 4A3FJ 4IHTA 3ZXSA 5DUKA 2Z16A 1IO2A 4PJLA 3VSKA 3FHNA 2BVMA 1ENHA 3V7CA 1YJ9I 5DD4A 5FRMA 2EFPA 4ZTFA 3GZNB 2BBYA 1KZHA 2OF7A 4U0WA 3Q5FA 4CO8A 2CV0A 4G6TB 5E8IA 4C2MJ 1QU3A 5LGTA 2R5ZB 2WA0A 4IF4A 1K7AA 4U7DA 4IRIA 2Y30A 3FXQA 1E2XA 2FOKA 3JAMK 4XSXF 3RIRA 2FE3A 4F93B 2Y75A 2KHMA 2DMTA 4A0ZA 5M5YJ 4KJZA 4FQGA 4XNFA 1BI3A 3I4MJ 4Q48A 3IWFA 1RUOA 2HS5A 1IDYA 1WQ2A 5LGUA 1HLVA 5IPAA 5EG0B 3R0JA 4F55A 1P2FA 3BY6A 4W1UA 3TKYA 1MMDA 3MZYA 2L7MP 2EV5A 4D5FA 3BG3A 3KETA 2QGUA 1FP2A 1VQOI 2K40A 2HDWA 3N4MA 2W4SA 2KQRA 1UJ8A 3QP5A 1YO5C 2M8EA 5JVTA 1IUYA 4A3GJ 3FBIB 3D5SC 2WADA 1RC9A 2ZXHA 3B6AA 3C2BA 1QA6A 4UB8C 4LJZF 1Q1HA 3O6BB 1T8IA 3DEWA 1TQIA 3CP8A 2W82A 1DUXC 1O3RA 1GLNA 2CQ7A 2NVUB 1R71A 3FMRA 1LDDA 3KE2A 1FBUA 4FE4A 1DU0A 4UVBA 2IVMA 4L0ZB 2ZCWA 3RTRA 5D6FA 2VOPA 5F04A 1Z6TA 2FNAA 4XLAA 3HDDA 4Q4ZF 1F36A 3HOWJ 2IEKA 3C2GA 3D5LA 4ASNA 1LVAA 2P6TA 1UAAA 3WGGA 3A4CA 1DGRM 1F1ZA 1QHGA 1R36A 2E1NA 3BG9A 2EIKH 4UB6C 1R1TA 4A3IJ 4O6JA 3OYAA 3Q3SA 3ERMA 3ZOBA 1X4OA 3JSPA 3MKWB 2VLAA 1JJ6C 2ID6A 4W97A 2EILH 2EH3A 3QPLA 3DWLE 4ZJZA 2EWNA 2LNBA 4HV6A 2JT1A 4B47A 4KDPA 3CUQC 1I6HJ 3EETA 1XC5A 4IPAA 1IAWA 5BNGA 5E3MA 1FZPB 1XMXA 3P9CA 2F5EA 3IAS2 3KPHA 2A5YB 2DA5A 2JN6A 2XAGA 3VYUB 2Z3YA 3UR3C 3K2ZA 2R7VA 2X6XA 3SDBA 3IP4B 4IZZA 1WI3A 3BWGA 3BOQA 3CUQA 1P7JA 3M07A 5L3GA 3FXOA 4UVCA 1GVDA 5CPRB 2ADUA 5ERIA 1RR7A 2D45A 4Y17A 1QNTA 3RDIA 2DU9A 4XL9A 1EH7A 5J1YA 3GFJA 1YW9A 2O61A 2LMDA 4AM3A 3L00A 2JRTA 3CLQA 1MBHA 3L2VA 2LKSA 5IY5H 2KDZA 2GXAA 2COMA 1UMQA 2P7VB 2MG4A 3U2RA 3J7AO 1IN6A 1ODDA 4HQEA 1YE9A 4ZTJA 1Y56A 1Z3YA 4MEXF 3JRAA 3SYTA 1KYWA 3K4NA 3BLYA 4M9ZA 4UUTA 2ZMEA 2R7ZJ 5D4RA 2EZLA 3RJPA 2ICWG 1BR4A 3GTQJ 1WCMJ 5L3FA 3CCSI 1RZ4A 2ISZA 3W6JB 1QZZA 4WXCA 5M3MJ 4M73A 2VE9A 4ESFA 5LLQA 1AWCA 3F23A 4ESBA 1D5VA 2ELKA 2FBKA 3HIFA 5HDKA 3IV5A 3PQJA 2L0KA 1L3LA 1FIPA 1QBJA 1KYZA 3RKWA 3JRIA 3QYBA 4JP0A 1P4WA 2V1XA 5ED4A 2QQ8A 1HA8A 5KHDA 5ICFA 1EA3A 1EH6A 2X48A 5CVJA 2P8TA 2DOFA 3S14J 2LF7A 3IL2A 5DV5A 1YYVA 1J59A 3K4KA 3V7SA 2YU3A 3V4GA 2V1DA 3DKWA 5DYMA 2M8GX 2LTPA 4MHGA 3RYPA 3HOVJ 3KEOA 2EFNA 1SMYF 4E70A 1OYYA 5LHIA 2X6YA 5DD8A 3KX2A 4IHWA 1Y0NA 3MAJA 3UNGC 1J5YA 3S17J 1OMIA 2WAQA 4KMUX 4G7ZF 4DIQA 5J1UA 1ETOA 2D2WA 1LEAA 3FMSA 4Q5SF 1BA5A 3P9KA 1MGTA 3CCLI 3HOYJ 4X6AJ 2LH9A 2ELHA 1R58A 5EZHA 2WY8Q 1SVLA 3K70C 2CJJA 3BR0A 2AS5F 3BTIA 1FOYA 2WB1A 3K4BA 3AFHA 4S0HB 5EG0A 3JTGA 2BGCA 5ILUA 1QO0D 3KZYA 3BR2A 1FTTA 4M6VA 2A05A 2UXNA 2M3AA 5C3EJ 1Z21A 2WY7Q 5AIPA 3D1NI 2E60A 1J2XA 4GRIA 4M6YA 5K7FA 4KUMA 3LSIA 2HR3A 1V3FA 4E6KG 3G6EI 1E3PA 2NAZA 3G1MA 3ISPA 3CCQI 1I5ZA 3VOEA 5GADJ 2A68F 1Y8QB 3M1EA 1MNEA 3IC7A 2M0CA 3KP5A 5DM7F 4YRVA 4I2OA 2CMPA 4XQFA 3MN2A 2DW4A 3WG9A 3K1MA 3I4NJ 1O3TA 2YSRA 2Q1ZB 5F0HA 1C0WA 3JRCA 5J47A 1MIJA 4NC8A 2LYCA 3K1NA 4GYIA 2E2IJ 1G4DA 3TO7A 1MW7A 3O8GA 4P96A 4NNJA 1T98A 1K78A 3FISA 3HOSA 2AO9A 2FEZA 2XB5A 4MO7A 3PO2J 1D8KA 4O5VA 1R4MB 1QVTA 1XGSA 5K1YA 1HDDC 3IWZA 1ZREA 2J5OA 3HYIA 4EQQA 3ZQQA 3R4KA 1JUMA 3GWZA 4L9TA 4DGWB 1OCZH 2CW8A 5EJCA 2RQPA 1X3ZB 3HM5A 1TT0A 4A2UA 2DK5A 3QP6A 1X4PA 5D5XB 2EINH 2XSDC 1YS6A 4I98B 1UCRA 2LD5A 2IGMA 3GMEA 2MSYA 5L3DA 2OCCH 3K0LA 2BYVE 3ZCOA 4XLFA 3LSMA 3I59A 3A2KA 2ZO4A 3I64A 5HDNA 4XMYA 1VQ5I 2PLYA 3GZ5A 3MKLA 3M8JA 1CQTA 2I10A 1IDZA 4LGWA 4ESJA 1JGGA 5DTDA 2HZTA 1WH7A 3S16J 1FEXA 1DPRA 1F9NA 4AIJA 2LR8A 3ZP5A 4IKFA 1JGSA 2FOWA 1W7PD 3WGHA 3CDLA 1IGNA 4LLNA 2R7XA 3MVPA 2VJJA 5B1BH 2YX4A 2Z2SB 1Y8RB 3WTUC 1PP7U 1TL8A 2EV6A 4PSXA 3WE3A 2X6WA 3C3WA 4B1RA 3H1CA 5GPCA 1FC3A 2BEOA 3HRUA 2IGKA 4ON0A 2DFFA 1PUFA 4KICA 3SFIA 5JLWA 4IO9F 1D5YA 1YLFA 1D3YA 1TZLA 1G2HA 2JJ7A 4HNUA 4A0XA 3HG9A 1SD6A 4OIRF 5M3FJ 2R7OA 2LREA 3E1SA 1FYMA 2HXOA 2FQ4A 3HGGA 1D8JA 1JUPA 2E1MB 1U5TC 2P81A 1PP8F 2UZKA 2JMWA 2K5CA 3I5UA 4XKVA 2GLOA 3BJAA 2JUGA 3WU0A 4OIOF 4HA8A 1SC7A 4DBRA 2M1BA 2HYJA 4IQ4A 2EB7A 2IBDA 2HKXA 1GDTA 3FXRA 4EVIA 1AHDP 3OS1A 4RGUA 4AVPA 1YIJI 3HUGB 4A5NA 2ZFUA 1GXQA 2RREA 2MA3A 2N8GA 5FKMA 1U9NA 1U5TA 2MC3A 3PO3J 3TDUC 4PGHA 3CUOA 1JKOC 2XIGA 1K4TA 2JRMA 1BM9A 2HNHA 5DEQA 2XASA 1ZGWA 2LLKA 1HQCA 4KIGA 2DMPA 4M3GA 5D8LB 1HSJA 3H0GJ 5F6FA 2Z9OA 1WJFA 2O8KA 1POGA 1F4KA 1V5FA 1BC7C 5LFAA 2M30A 1ZHFA 2WAFA 3OMYA 4HF1A 2BHZA 2MLKA 4LD5A 3R6SA 3A02A 2KRCA 3N05A 3LAJA 2K3PA 1DP3A 3VYTB 3WTXC 1FX7A 3RQ4A 1T95A 5K5OA 1KONA 1FMWA 5IT3A 5IP7J 1WJAA 4ZYAA 2DA3A 4OAZA 4G7HF 4XN0A 2ISYA 2IT0A 3OYNA 1I1GA 2I5UA 2G7HA 4M71A 3GUDA 1P6RA 2LY9A 4EM1A 3S1QJ 4IQJA 3CMAI 3REOA 1QQIA 4HZFA 1LDJA 2MLGA 5L3BA 4EM0B 4HQMA 3RZDJ 1XSVA 4NHJA 1IRGA 3IH3A 2IA1A 3ZMDA 5LBQA 1A35A 2F4IA 1G3YA 4EJVA 4ZDLA 4HRIA 4IHSA 1AOYA 4ZDPA 1SVOA 3LA2A 3NWTA 3V8JA 4XLCA 2LOOA 3MZHA 5ICEA 1ZG3A 3ZQLA 4AD9A 1MD0A 5DCMB 3CO6C 2XGEA 2EFWA 5CQGA 3LA7A 1MJ9A 2E35A 1MBGA 1T33A 2JA5J 1VI0A 3H9GA 3OV8A 4LMYA 1FLIA 1HKTA 5HS7A 3QYEA 1VQ4I 3OS0A 2R7WA 1M1EB 1HDPA 3DLAA 5EDNA 3K4CA 1J75A 4B09A 4H0EA 1FPQA 1R1VA 2KIUA 5D4SA 3I58A 1W5CC 5EZGA 2PJRB 2Q0OA 5CVRA 2YPRA 1PVEA 3R0AA 2VJ4A 3C7JA 4C2TA 2CQNA 4E7HA 2R93J 2IS2A 5J3LA 4HX4A 1P92A 3T8TA 1LJ9A 2DT7B 2WAEA 3TP0A 3ZMTA 3LL7A 1OQYA 5E20A 2KLOA 1CGPA 1WVRA 5BMZA 2L3DA 3HB9A 1YRNA 2K85A 1W36D 2W57A 4YIIA 3QWLA 3J7AY 1ITYA 1S5LC 4XKWA 3WHCA 2LG4A 2MC4A 3QOPA 5CQEA 1KA8A 2MABA 3TOBA 1SFKA 1IXRC 4HDUA 3BJ6A 3CESA 1VQMI 3F21A 1ZG5A 5CYVA 4G12A 2GIZA 2ZNYA 5J4VA 3QQAA 2FX0A 4TV7A 2OZUA 3WTZA 3F3XA 4IHXA 1TW2A 1FSEA 1IV8A 2L4MA 1ON2A 4BXFA 4RB0A 3DBHB 3LNQA 3W2VA 2Z5UA 4DYRA 1S72I 2R7QA 2EV0A 3BR1A 4PGGA 4A3JJ 4ANJA 4GGGA 4BXXJ 2K7LA 3KFWX 2VQGA 2PI0A 3PSIA 3DU5A 5CVIA 3T0YA 3CCVI 2ZXJA 4GFBA 4RAYA 1ON1A 2M87A 4Y15A 5KNLA 1TQPA 2XF5A 1Q1VA 1REPC 2E1MC 3W2AA 1XB4A 3G2BA 1TNSA 3F22A 4AIHA 2CV1A 3ABTA 2ZMEB 3I4PA 2FMYA
chains in the Genus database with same CATH topology
4HG2A 1D1AA 4B47A 2R7TA 3S3OA 4BQOA 1DQUA 1MMAA 3AL0C 3PL8A 3U21A 2JVGA 4QPQA 1WJCA 4E4HA 4D9JA 3IAS2 2I8DA 4CH7A 3VYUB 1NG6A 3UR3C 2KPMA 1K6YA 2X6XA 2R7VA 3SDBA 5FROA 3IP4B 4IZZA 4NUBA 3VSLA 4CA0A 3H0DA 3PUBA 4U87A 3CMMA 2X1EA 5CPRB 3DPUA 3OWTA 4XL9A 1N77A 4BACA 2V9KA 4B43A 2WBMA 5LD2C 2CW7A 3L2VA 3DU6A 2HVRA 1JI8A 4LIUA 4HNTA 4E7ZA 3OYJA 4N4OB 3H9QA 2HVQA 3OYDA 1AA7A 1MMGA 3L2WA 3IAM2 1YE9A 4ZTJA 1Y56A 1Z3YA 3EUHC 4B44A 3SYTA 2JVHA 3K4NA 3ONQA 3BLYA 3S32A 2IS6A 2W7NA 1YX5A 1BR4A 2CFOA 3GBGA 3K4MA 3V42A 3BCAA 3TL4X 4DJAA 1YX3A 4Y3OA 2GOMA 1N78A 4RM3A 2IGOA 2LBFA 3QODA 4XOTA 2V1NA 4KITB 1T0FC 4IX7A 4ZDOA 4C9YA 3K4LA 4XORA 4PSWA 1WJDA 3CF2A 3DQVC 2BW3A 3KYLA 3QYBA 3I9V2 4XLHA 2UV1A 4J01A 4B48A 4AYBA 5KHDA 1HA8A 2R4GA 1EA3A 2A5WA 3FBNB 2BOLA 1S9HA 2VASA 3PNVA 4NC7A 2CV2A 3K4KA 2VL8A 2VQLA 4HPQA 1N75A 4BQQA 2QKLB 4BUPA 4F3QA 2Z1DA 2V26A 4PK4A 2DCEA 2OV7A 3OR1C 2VJ5A 2CUJA 4XOPA 4BEHB 3HC7A 2X6YA 4PFOA 2KRHA 3KX2A 4CCNA 4U7BA 1NG7A 3UNGC 2UUZA 4CSWA 3L2RA 2WAQA 4DIQA 2F6CA 4J00A 2VPLA 3L2UA 2LH9A 2PJRA 2WY8Q 3K70C 2MD0A 1OR7C 2WB1A 3K4BA 3AFHA 3QOEA 4BDZA 2X51A 3PFYA 1X1CA 4E7KA 1Z7LA 2M3AA 4CCKA 1Y6IA 1Z21A 2WY7Q 3FKJA 3DPLC 2BVLA 2ELJA 3OYEA 3S3MA 3NWSA 2E60A 2VQCA 4PFPA 1G59A 4GRIA 3PNTA 3LSIA 3W3CA 4BL0B 2W1OA 4E6KG 4KT6A 2XSJC 2R7UA 2K9MA 3HL2A 4CUGA 1MNEA 2E5ZA 4JOMA 4YRVA 2CMPA 4XQFA 3C2HA 3MKZA 4BJTA 1BOBA 1X1DA 2HZDA 3MD2A 1ZELA 3ZGKA 2GOXB 1IRXA 2Q1ZB 4F92B 4BE2A 2DT6A 3BCBA 4NC8A 2QKMB 2LYCA 4RM2A 1X19A 1J09A 4C2UA 3DKYA 2R7SA 2ZSIB 3ZRGA 1MW7A 4NNJA 3TBIA 1R6RA 3HKZA 4XR6A 3HOSA 5HOOA 3OIPA 2XF7A 1MNDA 4BE0A 3DPTA 3K6GA 2HPMA 1WJBA 3SEQA 3ZQQA 4LIVA 2XAUA 3S3NA 4DGWB 4XKCA 2V6EA 2CW8A 4FASD 3DKXA 2ZXIA 2IS1A 3EPZA 3E0JB 3OY9A 2CS3A 1TT0A 4E7IA 1BR2A 4II3A 1X4PA 3OL4A 3LSKA 2LRDA 3W2WA 4XLEA 3OYMA 3OYCA 2VXZA 4P1WA 4QPOA 3OYKA 2IGMA 1W36C 3TMOA 1PYVA 3HPHA 2DOAA 1G8XA 3ZCOA 4XLFA 3LSMA 3QYFA 4XONA 1QHHD 1UG0A 3A2KA 4XMYA 4ZC3A 3M8JA 4XN3A 2NOJB 4BJ6C 2E5NA 2L5QA 1U0JA 1Z3XA 3PSFA 2IXSA 2KZVA 4YEJA 4DOZA 2M7BA 1LKXA 2KP6A 4IKFA 4Y4RA 3SEZA 2PMZA 2R7XA 4F91B 3OYBA 3CJRB 3LMMA 2XDVA 3H5AA 4AU7A 2LC2A 4H4KC 2VJJA 2Z2SB 4BJ5C 2K9LA 5HVQC 1X1AA 4B3XA 4JQFA 4PSXA 1WFXA 3ZR8X 4BE1A 4OWRB 1ERDA 2X6WA 3LSHA 4CCOA 3L2QA 4X0GA 3F9KA 2IGKA 3H5NA 1VZ0A 1LFPA 4NQWB 3FDYA 3HOTA 4CCJA 2A6TA 1TZLA 4EATA 1X1BA 2V7FA 2VKHA 1V5GA 3H9JA 4HNUA 3OYGA 4RLQA 3HG9A 4HSRA 1P9QC 2R7OA 2LREA 2F5VA 3E1SA 3MKYB 2L9SA 5HNFA 3HXLA 2KL4A 4Y33A 2E1MB 2Y0SA 4FETA 5HNHA 2K5CA 1D0XA 4XKVA 2AQEA 3OOUA 2DJIA 2JUGA 2HU9A 3DTEA 4PUSA 4BS9A 2HVSA 4DBRA 4IQ4A 2OC6A 2FUG2 2MFZA 3OS1A 2L9NA 2Q2EB 1D1BA 3HUGB 2ZFUA 3AL0B 2RREA 4AVZA 1DGWY 2CUZA 2HNHA 3K10A 4PJJA 1WJEA 4OAYA 2IS4A 3AKZA 3VWBA 2VJIA 3BG7A 2JA2A 3CP2A 3VDXA 4BEHA 1PJRA 1WJFA 1FMVA 5CKTA 1V5FA 5LFAA 2MYSA 2WAFA 3OMYA 4N4NB 4KISA 3OYHA 1SAUA 1D0YA 4R79A 2KRCA 5KCMA 3N05A 1OLTA 4C30A 2K3PA 4LITA 4RLFA 1DP3A 4HEA2 3S93A 3SZGA 3VYTB 3K70D 2XF6A 2R7RA 3RQ4A 1T95A 1KONA 1FMWA 5TGTA 1WJAA 2VIXA 2VXDA 4ZYAA 4OAZA 4XN0A 2LBFB 4P5OA 2M7AA 3DTIA 3OYNA 3S8PA 3BG6A 3M1CA 3OYIA 2X1DA 5FRNA 2L2OA 2V4JC 3CJQB 1D0ZA 4LG3A 4IQJA 2BW3B 4BU2A 4BQNA 3VYRB 3EUKL 2VB6A 2P0WA 2F4IA 3OYLA 2X85A 4HSTA 1WJ5A 2HQAA 4ZDLA 4HRIA 4ZDPA 1MMNA 3NWTA 4XLCA 3ZXSA 2LOOA 4PJMA 4E7JA 2Z16A 4F52A 4PJLA 3VSKA 3FHNA 2BVMA 2X1CA 1D1CA 2M4KA 5FRMA 4ZTFA 4XKBA 4XM3A 5CQGA 2CV0A 4G6TB 3IUOA 4CZCA 1QU3A 3VYSB 2M0MA 3D5RC 2DXIA 2LY1A 2WA0A 3H9GA 3QYEA 3KEYA 3OS0A 2AQFA 2CH0A 2R7WA 4E7LA 3DLAA 3CZ6A 3K4CA 3K4JA 2KHMA 4F93B 3H35A 4BDYA 4KJZA 2PJRB 4XNFA 2RQQA 2VJ4A 4PJNA 4D1QA 4C2TA 4E7HA 4F55A 5HLTA 2IS2A 1MMDA 3LSGA 2DT7B 2WAEA 3PNYA 3LL7A 2KLOA 2HDWA 2RNGA 2W4SA 2KQRA 2W00A 2OUMA 1V5EA 2KMUA 1W36D 4BGDA 3J7AY 1LDKB 2L7KA 3FBIB 4E7SA 3D5SC 2WADA 2LG4A 2MC4A 4XKWA 2VQHA 2ZSHB 5CQEA 3EUAA 2ZXHA 2JSPA 2MABA 4II2A 3H5RA 2O5RA 1SFKA 1LVKA 2VKDA 3CESA 4RMNA 3I3LA 3OIQA 3CP8A 2W82A 1UELB 4YELA 3A1YA 1GLNA 3DTKA 4BXFA 2M4GA 3BC8A 3RSNA 3RTRA 4DBQA 3RCOA 3W2VA 4XLAA 3OS2A 3OR2C 3C2GA 3D5LA 1E0EA 2R7QA 3RPUD 1UAAA 3OYFA 3A4CA 4ANJA 1DGRM 5JHFA 2VQGA 3PSIA 1QHGA 3DU5A 3DEEA 3OL3A 3MMYB 5KNLA 4MLOA 2XF5A 2E1MC 2IGNA 3OYAA 3PJRA 3HPGA 3W2AA 2XC7A 1X4OA 2KDOA 4CCMA 3MKWB 1BR1A 3G2BA 2VLAA 2HPIA 2LY2A 2CV1A 3LFUA 2UWMA 4ITVA 4ZJZA 3DWLE 4CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OUM A;  2OV7 A;  2VPL A; 
#chains in the Genus database with same CATH topology
 4XSZ F;  2CG4 A;  4HG2 A;  1O7L A;  3S2D J;  1VND A;  1NK3 P;  3F8N A;  2L9R A;  1U8B A;  4BQO A;  3ZQC A;  1DQU A;  3HJE A;  3HTS B;  5JR3 A;  1R9T J;  1U78 A;  4E4H A;  2JVG A;  1WJC A;  2ESN A;  5GAE J;  3WGI A;  1UHW A;  2A6H F;  2ZXW H;  4MTE A;  3SJM A;  4X1E A;  4WCG A;  4M6X A;  4IOC F;  2KPM A;  1K6Y A;  2AXT C;  5KAF C;  1MJA A;  5FRO A;  1Z67 A;  4HBL A;  1ETW A;  4ENN A;  3VSL A;  5FKN A;  3K1P A;  4DZP A;  3PUB A;  3HUG A;  4U87 A;  2L01 A;  4NC6 A;  2X1E A;  2DT5 A;  3DPU A;  2R3S A;  4QTR A;  1FBS A;  2CQX A;  1JE8 A;  4BAC A;  4ENM A;  2V9K A;  5FJ8 J;  4B43 A;  1UZC A;  2WBM A;  1BBY A;  4O3M A;  5LD2 C;  4RBO A;  4OOI A;  3GTP J;  2CW7 A;  4LIU A;  1SVM A;  1NHA A;  1ZR2 A;  1AA7 A;  3A03 A;  2HQN A;  3BT9 A;  2BE5 F;  3GCM A;  3HRT A;  2KIS A;  1I50 J;  1ZKG A;  3ONQ A;  5EEA A;  3CTA A;  3H92 A;  2ECC A;  3S32 A;  3G3Z A;  5K5Q A;  4ETS A;  2DA7 A;  1TQM A;  4UV8 A;  2GA1 A;  5JLX A;  3BCA A;  1PDN C;  4I0A A;  1X3U A;  2GOM A;  2ZJR F;  2A07 F;  1NTC A;  2Y69 H;  2V1N A;  5GAG J;  4IX7 A;  4ZDO A;  3FXL A;  4GO1 A;  4ZYH A;  4HNV A;  4C9Y A;  3K4L A;  2Y31 A;  3WE2 A;  2CRG A;  2MH9 A;  1X1P A;  2UV1 A;  1NH3 A;  1MSE C;  4B48 A;  1IN5 A;  4AYB A;  3FBN B;  2HEO A;  2BOL A;  4PDK A;  2BXY A;  2NRA C;  3E5U A;  2TDX A;  5KVR A;  2CV2 A;  3BPX A;  1G3W A;  1ULY A;  2VQL A;  3P9I A;  4MFD A;  1XCV A;  2VN2 A;  5FLM J;  2QKL B;  1XGO A;  4F3Q A;  3E5Q A;  2V26 A;  2B9S A;  4PK4 A;  4BAY A;  4KIF A;  4BQA A;  5DCM A;  4XOP A;  3OSF A;  3HC7 A;  3N97 A;  4C3J J;  3AG2 H;  4ZZL A;  2WAQ N;  1XGN A;  4MGR A;  4DW6 A;  2UUZ A;  2MD5 A;  4MIM A;  2XAJ A;  1JKQ C;  2LVS A;  5AON A;  2CYY A;  2F6C A;  1W1W E;  1LUJ B;  3ZN0 A;  1FTZ A;  5E3L A;  1OYI A;  1OIS A;  1TBX A;  1ETX A;  4CHU A;  3HOX J;  4L9J A;  4U88 A;  2VPL A;  3L2U A;  3JW4 A;  3GFM A;  1K78 B;  2WB1 N;  2PJR A;  5B1A H;  2RKH A;  4M74 A;  2MD0 A;  3Q0W A;  2VOO A;  4IOA F;  2XAF A;  5IT9 Z;  5C4J J;  1NK2 P;  3KP2 A;  1OCC H;  4UY8 I;  1SAX A;  2XGC A;  1MMS A;  3GVA A;  2GM4 A;  5ICG A;  3FKJ A;  3DPL C;  4EGY A;  3DXJ F;  2Y9Z A;  3AAF A;  4EMS A;  3S1M J;  2G7U A;  2J5P A;  3P5J A;  2VQC A;  4PFP A;  1DU6 A;  5HLG A;  2RAE A;  2CGP A;  5JI6 A;  2QQB A;  5GAH J;  3E6D A;  4C3H J;  4BL0 B;  4AIK A;  3KLO A;  4KT6 A;  5FKO A;  5LGN A;  2M34 A;  4HYE A;  1IC8 A;  4J19 A;  2W84 A;  1KU3 A;  1SFO J;  2E7W A;  2QEN A;  4BJT A;  1X1D A;  2V79 A;  2DMQ A;  3I59 B;  4AUX A;  3ZGK A;  4BYY A;  5K5R A;  1BW5 A;  4KA4 A;  4BE2 A;  3KLN A;  3U9G A;  2JQ7 A;  2QZ8 A;  4JYK A;  2K4J A;  2QKM B;  3JRE A;  1H9T A;  4RM2 A;  1T2K A;  2JPC A;  1J7K A;  2ZSI B;  3Q9V A;  4S05 A;  2JA8 J;  2F4O B;  3BZ6 A;  4S04 A;  2VKV A;  2M5W A;  2ZME C;  1TNT A;  4XR6 A;  1W0T A;  3H3V K;  3OIP A;  2GBY A;  1V55 H;  2PQ8 A;  4F7Z A;  3M8F A;  4HAM A;  1R49 A;  2VI6 A;  1IN4 A;  4LIV A;  2XAU A;  3S3N A;  2PG4 A;  2IPQ X;  2EJR A;  4FAS D;  5EEH A;  3DF8 A;  3E0J B;  4LK0 F;  1PUF B;  1WGX A;  2ESH A;  1FNN A;  1ZYR F;  3HEF A;  3M7G A;  2R5Y B;  3OL4 A;  2L7Z A;  2YUS A;  3LSK A;  3I55 I;  4M9X A;  1UB9 A;  3CCE I;  4XLE A;  3E6M A;  1YI2 I;  3ZN1 A;  4QPO A;  3KP6 A;  3CJT B;  4D0P A;  3HPH A;  3SFZ A;  1S29 A;  5LEK A;  4WXH A;  1HBX G;  4Y52 J;  2IRF G;  1ETY A;  3LSP A;  2OZ6 A;  3LQQ A;  2PBI A;  4MTD A;  2DOE A;  4HX7 A;  4KN4 X;  1MH4 A;  1A36 A;  2E5N A;  5F1R A;  5JHU A;  2L5Q A;  2NNY A;  3PSF A;  5D6E A;  4MQV A;  4DOZ A;  1LKX A;  2KP6 A;  3SEZ A;  1ZAR A;  2JK3 A;  2X6O A;  4F91 B;  2DPU A;  3LMM A;  2XDV A;  4UUV A;  1FOX A;  2LC2 A;  2QQ9 A;  2Y2Z A;  3CCM I;  1U5T B;  1KU2 A;  4BJ5 C;  1U6G A;  3V8L A;  4ENK A;  3GTO J;  2K9L A;  4I09 A;  5HVQ C;  3GFI A;  1X1A A;  4JQF A;  3ECH A;  3LSH A;  4LLG F;  4Y7N J;  3ABK H;  1XSD A;  1RKT A;  2STT A;  4ZZD A;  3F9K A;  1QPM A;  4A3C J;  3H5N A;  3J80 Z;  2R7D A;  4NQW B;  1TTY A;  5TRD A;  2EFO A;  2GXG A;  4ZYD A;  4CCJ A;  2A6T A;  2YX7 A;  2V7F A;  2VKH A;  4D7N A;  3OYG A;  3E3V A;  2XAH A;  5EEG A;  3WTS C;  1OPC A;  1OCT C;  3RPU A;  2VC1 A;  2GWR A;  3HXL A;  4CGZ A;  4EV0 A;  4FET A;  2RV8 A;  1D0X A;  2KIM A;  2DJI A;  1ACI A;  4AWX B;  3DTE A;  4PUS A;  3JRD A;  4BS9 A;  3ECO A;  3GTG J;  5J4Y A;  4BHP A;  1MSF C;  2OJE D;  1FWZ A;  2FUG 2;  3ML6 A;  2L9N A;  1MDM B;  2Q2E B;  1D1B A;  5C44 J;  3QAH A;  3OOP A;  1UST A;  2D1V A;  3SQN A;  1FIA A;  3C1D A;  2TRT A;  1TW3 A;  3L2C A;  3CDI A;  5F64 A;  1FP1 D;  1TWH J;  1WJE A;  3FK6 A;  1RES A;  2IS4 A;  3VWB A;  5IP6 A;  2VJI A;  3CP2 A;  3VDX A;  2X0L A;  2KRF A;  1PJR A;  4YFK F;  1FMV A;  1HC8 A;  5F0C A;  1WI9 A;  2QCO A;  4EEF G;  1JTX A;  1V4R A;  2FBI A;  3JRH A;  1ZR4 A;  4A5M A;  1SAU A;  3OYH A;  4R79 A;  5H6Q A;  2E7X A;  4C30 A;  1TP4 A;  4LLL A;  2IW5 A;  4HEA 2;  3SZG A;  3K70 D;  1ZAO A;  3VOD A;  2ZJQ F;  1SFU A;  1ONV A;  2DA1 A;  1Y1V J;  2P5L C;  3WOD F;  2GXB A;  2OA4 A;  2LBF B;  2PJP A;  5E17 F;  2FD5 A;  1AU7 A;  2A61 A;  2EQR A;  3H3Z A;  2X1D A;  4RA2 A;  2DQL A;  2XAQ A;  1YHQ I;  3ZQ7 A;  5H20 A;  2BW3 B;  3COA C;  2HDC A;  1IV6 A;  1IXC A;  4BQN A;  4N9I A;  5F1J A;  2HDD A;  2F5F A;  3W6K B;  2JZY A;  2BHY A;  1YRN B;  2X85 A;  1Y0U A;  4WF2 A;  2V9P A;  2DMU A;  2HOT A;  4PJM A;  4E7J A;  1GV5 A;  3ZMV A;  5E3N A;  2IP2 A;  2X1C A;  1D1C A;  2E34 A;  5AIQ A;  2QWW A;  3CC2 I;  4XKB A;  2XUB A;  4XM3 A;  5FLX Z;  1K83 J;  3ULQ B;  1ZRC A;  1EH8 A;  1SFX A;  4A6E A;  2VBY A;  4CZC A;  2MGQ A;  1LNW A;  2NOG A;  2M0M A;  4KNY A;  2KFD A;  4B8X A;  1FSH A;  3IHU A;  3IH2 A;  2AQF A;  1P4A A;  3GTL J;  4BY7 J;  2R0Q C;  2RDP A;  1H9G A;  2DDB A;  2V9V A;  3HTU A;  1B72 B;  1S6L A;  3CZ6 A;  3K4J A;  2QM3 A;  2VON A;  3H35 A;  1LB2 A;  3HOZ J;  3RKY A;  1MH3 A;  2B63 J;  5FLX K;  1IRF A;  2K02 A;  4IRH A;  5B3S H;  4DYQ A;  2HWV A;  4D1Q A;  1I1S A;  1TWA J;  5HLT A;  1QZE A;  2W24 A;  1MBE A;  3PQK A;  1ZLJ A;  5A2Q Z;  2DA4 A;  4PZJ A;  3LSG A;  4HLX A;  5B5E C;  1YIO A;  3F0C A;  1OCP A;  3HSR A;  3G73 A;  1B4A A;  2V6C A;  2RNG A;  3WU2 C;  2R5Y A;  2OUM A;  4LB6 B;  1GUU A;  1V5E A;  2KMU A;  4AID A;  3JSO A;  1QZY A;  1LDK B;  1BOA A;  2L7K A;  2COB A;  4E7S A;  1FYK A;  1IUF A;  3EUA A;  2DA2 A;  3H5R A;  3HRM A;  4WK8 F;  3HOU J;  3F6O A;  3QPH A;  2RC4 A;  2VKD A;  1A5J A;  2HKO A;  1B59 A;  3I3L A;  3OIQ A;  5J8F A;  4G6D A;  2DJN A;  2GAU A;  2PEX A;  3A1Y A;  1ZRF A;  3DTK A;  4P9U A;  3CJN A;  3DBL B;  2M4G A;  3BC8 A;  5CJ9 A;  4DBQ A;  2BY3 A;  3RCO A;  4CZZ A;  1Z0X A;  3OS2 A;  2WC2 A;  4KFC A;  1Z05 A;  1MJB A;  3ELK A;  1LQ1 A;  2GZW A;  4RAG A;  4UXN A;  3OYF A;  4I01 A;  1KU7 A;  4FT8 A;  4CDG A;  3CO7 C;  2QVO A;  3EQL F;  3DBR B;  3RZO J;  4QIW N;  1BIB A;  2EPF A;  4HF2 A;  2HYG D;  3BR3 A;  5LRR A;  5L3C A;  2IGN A;  1K79 A;  3PJR A;  4NQW A;  1TT5 B;  3ZMU A;  2XC7 A;  2KDO A;  4UVA A;  4CCM A;  4YFN F;  2NVX J;  2HPI A;  4DNC A;  2LY2 A;  5E79 C;  3LFU A;  2UWM A;  3ABU A;  4MNU A;  4OMZ A;  4V2F A;  2JSC A;  2M9H A;  1D1A A;  5D5U B;  2R7T A;  1BIA A;  3A01 A;  1Y39 A;  1BJA A;  4LG0 B;  1ETK A;  5E1X A;  3IH4 A;  2OQR A;  3PL8 A;  4KIB A;  1XMK A;  4QPQ A;  3KCC A;  2LDU A;  2O03 A;  2I8D A;  3ZQI A;  5BOX A;  1OFC X;  1NG6 A;  1MBK A;  1IRZ A;  1QVU A;  2CQQ A;  2QLZ A;  2KKO A;  1R00 A;  5F08 A;  4CA0 A;  1E17 A;  1MDM A;  2Q2E A;  2L9V A;  1XMA A;  3LQR A;  1MNM C;  3CMM A;  1JTY A;  5CVV A;  1ZRD A;  1P7I A;  4L5J A;  4FHT A;  3BQZ A;  5J6X A;  1WPK A;  1N77 A;  1FY7 A;  1BN5 A;  1B9M A;  4YIR X;  3KYC B;  2HVR A;  5FLV A;  4G7O F;  2DFI A;  1JI8 A;  4HNT A;  1Z9C A;  4E7Z A;  1T08 B;  3F72 A;  2O8X A;  5DDG A;  4QLC U;  5DUI A;  2O7O A;  5K7H A;  1R22 A;  4BHC A;  5TIS C;  2P7C B;  2ACJ A;  2IS6 A;  1O7F A;  1YX5 A;  3JCU C;  3FZV A;  3PFI A;  1U3E M;  2CFO A;  3V42 A;  1MBJ A;  2E2H J;  4DJA A;  3E6C C;  1YX3 A;  4Y3O A;  2XRL A;  4RM3 A;  3FMQ A;  2LBF A;  4XOT A;  1T0F C;  1BI2 A;  5HLI A;  1KQ0 A;  2CW0 F;  4RB3 C;  2ZJ2 A;  4XOR A;  2E71 A;  2L4A A;  4M72 A;  2H27 A;  1WJD A;  3CF2 A;  3DEU A;  3DQV C;  2BW3 A;  4AYB N;  3KYL A;  2QQA A;  4XLH A;  1S3J A;  1WWX A;  1LE8 A;  1VQL I;  2DAO A;  2R4G A;  3C18 A;  1OCR H;  3B6C A;  4ZYG A;  3OSG A;  1RI7 A;  1S9H A;  3RI4 A;  1T0F A;  1UG2 A;  3T8R A;  2VAS A;  2P4W A;  4EJT A;  5HS9 A;  4RDU A;  1RKW A;  2VL8 A;  1N75 A;  3K69 A;  1ETV A;  1BL0 A;  1A04 A;  2DFH A;  1IW7 F;  3J81 Z;  2DOD A;  3EYI A;  1OJL A;  3B73 A;  2DK8 A;  2A3S A;  2HOE A;  2LFB A;  2Z1D A;  2O9L A;  1S8N A;  1TWF J;  4BEH B;  2KRH A;  5FFZ A;  3LA3 A;  4CCN A;  4U7B A;  4XID A;  2VT2 A;  4A3D J;  4MFE A;  3L2R A;  2Y48 A;  1RNL A;  2VBX A;  3O3K A;  1XGM A;  3FXK A;  3LST A;  1K6O A;  3FK7 A;  3J81 K;  1TWC J;  1HW2 A;  2WV1 A;  1B72 A;  3CCJ I;  3RKQ A;  1ZN2 A;  4R1H A;  4L9N A;  2FSW A;  1OR7 C;  2JTV A;  4HX8 A;  4BDZ A;  3F8B A;  2X51 A;  3J7Z I;  1X1C A;  3FIW A;  4IEJ A;  3TED A;  2OCE A;  2E19 A;  2F5D A;  4CCK A;  2X9D A;  4EGZ A;  3K2A A;  2BVL A;  2ELJ A;  1BJZ A;  4G9Y A;  3OYE A;  3NWS A;  3S3M A;  1RIO H;  4R8H A;  2EIM H;  2QUF A;  3PNT A;  1S7O A;  2DFE A;  1T6S A;  4Z6Y A;  4XLP F;  3S2H J;  1OR7 A;  3M8E A;  1HOM A;  3HSE A;  1KQ8 A;  4JK1 X;  1W5S A;  3NAR A;  4V2G A;  5LHH A;  2XSJ C;  5E1W A;  2R7U A;  3AG1 H;  4FX4 A;  3SZP A;  2VKE A;  4CUG A;  4M3E A;  1H89 C;  3X2Q H;  1VFC A;  4OIQ F;  3LWF A;  3ERE D;  2D5V A;  3SHF A;  3GLL A;  4NDL A;  3C2H A;  1BOB A;  4NBQ A;  2HZD A;  3MD2 A;  1ZEL A;  4L18 B;  3L7W A;  3VFZ A;  1IRX A;  3I54 A;  3QU6 A;  4F92 B;  2DT6 A;  3IKV A;  2YU9 J;  1X19 A;  4M9S A;  1J09 A;  2BZT A;  4C2U A;  1A6Q A;  3DKY A;  4BBS J;  1KU9 A;  3GF2 A;  2K9S A;  4L5E A;  4XK4 A;  4WX9 A;  2FU4 A;  3TBI A;  1YJW I;  3HKZ A;  3CMY A;  1XCB A;  2R7F A;  5HOO A;  3FXM A;  1I27 A;  2LP0 A;  5HS8 A;  4BE0 A;  3DPT A;  3K6G A;  3MCZ A;  1WJB A;  1STZ A;  2JUC A;  2V6E A;  2QBY B;  1VQ7 I;  1BW6 A;  1U8R A;  3BR5 A;  2ZXI A;  2IS1 A;  3JRG A;  2VE8 A;  5D8K B;  1B1B A;  3OY9 A;  2CS3 A;  1FOK A;  4IHV A;  1YW7 A;  4RGS A;  2ME6 A;  1G3T A;  2TCT A;  1A6I A;  4HDV A;  3VEP A;  2HXI A;  1BR2 A;  4KT5 C;  1ZH5 A;  1YTY A;  2LRD A;  4LG0 A;  2R92 J;  3SZT A;  1T38 A;  3W2W A;  5K7Z A;  1U9O A;  3OYC A;  2VXZ A;  3HHG A;  3FKI J;  4A6D A;  3OYK A;  3JAM Z;  2W25 A;  1XPX A;  1W5T A;  2O3F A;  4LK1 F;  4BH9 A;  2YS9 A;  1QHH D;  1UG0 A;  3A0B C;  3EDP A;  1HF0 A;  1KQ9 A;  3FWE A;  2NOJ B;  1SD7 A;  5ILS A;  4BJ6 C;  5JVG F;  4GXO A;  2M7B A;  3W6V A;  3GO5 A;  1RUN A;  2PMZ A;  1XTA A;  3QRF F;  2H94 A;  3CJR B;  3BZK A;  3ESW B;  1E3H A;  4XRF A;  1JHH A;  2RGV A;  3BDD A;  4DQ2 A;  4XLN F;  3GZ6 A;  2XB0 X;  1XS9 A;  1GHC A;  4PJ0 C;  3HZJ A;  1Z91 A;  4B3X A;  5EGO A;  4AC0 A;  1H0M A;  4OWR B;  4U0Y A;  1ERD A;  3Q0V A;  2VBZ A;  4CCO A;  2O6G E;  1XDS A;  3BTC A;  5E8G A;  3BR6 A;  3L2Q A;  3VB2 A;  3ROU A;  2NVT J;  2NVY J;  4P55 A;  1LFP A;  3KP4 A;  2O0Y A;  4Y13 A;  3I53 A;  4L5I A;  1GVJ A;  3U1D A;  3HOT A;  1JT6 A;  3K9T A;  2H1K A;  4EAT A;  4FX0 A;  5DM6 F;  1KGS A;  3H9J A;  3G4S I;  3CC4 I;  1IF1 A;  1X3W B;  4RLQ A;  1HCR A;  4HSR A;  1P9Q C;  3MKY B;  2F5V A;  2L9S A;  3TW6 A;  5HNF A;  3ASN H;  4N0B A;  5E3O A;  2EA4 A;  4OMY A;  1JT0 A;  3E7L A;  1FOW A;  1Y1W J;  3NAU A;  2AQE A;  3TGN A;  1XDU A;  1YFH A;  4B3A A;  2NNN A;  2HVS A;  3FXJ A;  4QSH A;  3GX4 X;  2OC6 A;  2XGD A;  2DDA A;  4M3B A;  5GPA A;  3JTH A;  5KK1 A;  2DPD A;  2CU7 A;  3TO9 A;  5M5X J;  2HFH A;  3AL0 B;  4AVZ A;  2AXL A;  3HRS A;  1AKH B;  1QGP A;  1O3S A;  4CYC B;  2EZH A;  3K10 A;  5IT9 K;  3DV8 A;  5D5W B;  3FX3 A;  2GQQ A;  3NRV A;  2OAZ A;  4OAY A;  3EYY A;  2HGC A;  2KIQ A;  3AKZ A;  3WU1 B;  3BG7 A;  3DCF A;  2JA2 A;  3FM5 A;  3QU3 A;  4BEH A;  3LSR A;  1O57 A;  3TO6 A;  1MKM A;  3E5X A;  3KP7 A;  3GTK J;  1W7P B;  4GDF A;  2CO5 A;  5KCM A;  2ID3 A;  3ASO H;  2GA2 A;  2K9N A;  1OLT A;  4LIT A;  4RLF A;  3ABL H;  3S93 A;  1BI1 A;  2XF6 A;  5E1Z B;  3CCY A;  5TGT A;  3WTV C;  3BP8 A;  4IRG A;  5FGM A;  2AHQ A;  4UV9 A;  3DTI A;  3S8P A;  3BG6 A;  3T5X A;  1IJW C;  1FYL A;  6PAX A;  1OYW A;  4CXF A;  2FML A;  5FRN A;  3CJQ B;  3F8F A;  3ZQG A;  3JRB A;  4LG3 A;  4K2E A;  4KN7 X;  1G3S A;  1ZG1 A;  1VTN C;  2HQR A;  3GTM J;  2VOD A;  4FTH A;  1B9N A;  2P0W A;  2VB6 A;  3OYL A;  1VQ6 I;  2HQA A;  2JPB A;  3F8M A;  4F52 A;  4IHY A;  1B6A A;  2M4K A;  3U1K A;  3KIO A;  2OPT A;  1R23 A;  2D1H A;  5LRS A;  1W4M A;  1ZTR A;  1LFB A;  1GV2 A;  1IN8 A;  3G1O A;  3IUO A;  2B0L A;  3DP7 A;  5J1R A;  3VYS B;  3D5R C;  2EA2 A;  2LY1 A;  4UUS B;  2ZJP F;  2DXI A;  1GXP A;  2DLL A;  3KEY A;  1XN7 A;  2CH0 A;  3CME I;  4E7L A;  1WHU A;  3PIO F;  4BDY A;  1SMT A;  1HXD A;  2PX9 A;  3HBL A;  2RQQ A;  3S1N J;  3M9A A;  4EJW A;  5F0F A;  1ZGJ A;  2XHK A;  4PJN A;  2K27 A;  4XRS G;  5FB2 A;  2YR2 A;  2CUE A;  2XPU A;  2NS8 A;  4BBR J;  4CYD A;  1ZQ3 P;  2BY2 A;  2HTJ A;  2QBY A;  1VQ9 I;  1O4X A;  1WKM A;  2KT0 A;  3PNY A;  5GTI C;  1VQP I;  4YIF A;  1VF9 A;  3GW2 A;  4P9F A;  5CVU A;  2W00 A;  1XX5 A;  4DZJ A;  4DYC A;  4BGD A;  5LHG A;  9ANT A;  2XKP A;  5TJJ A;  1B8I B;  2W85 A;  4A69 C;  2Q8K A;  5BQT A;  5IP9 J;  2VQH A;  2ZSH B;  5FFX A;  1S7A A;  3A01 B;  1H88 C;  2JSP A;  4XBF A;  4II2 A;  5E18 F;  5BS6 A;  2O5R A;  1EV7 A;  3J80 K;  3BTJ A;  1LVK A;  4RMN A;  1L0O C;  2KJB A;  2H8R A;  3CC7 I;  4C3I J;  3HSF A;  1UEL B;  4YEL A;  1MZB A;  2R5Z A;  1OKR A;  2Z99 A;  2P6S A;  2EK5 A;  4HF0 A;  4RAF A;  1I6X A;  5GP9 A;  3RSN A;  3DFG A;  1LEB A;  1SD5 A;  3ZMS A;  1YQA A;  3F6V A;  1HKS A;  3GTJ J;  3OR2 C;  4OIP F;  1E0E A;  1K4S A;  3RPU D;  3LAP A;  3CCR I;  3R60 A;  2PFB A;  3CQZ J;  5JHF A;  4I7H A;  4A3L J;  4I02 A;  2QSF X;  3DEE A;  1X2M A;  1X2N A;  3OL3 A;  3Q9S A;  1HW5 A;  3MMY B;  3TW7 A;  4MLO A;  2FNP A;  3CDH A;  3NEU A;  1YJN I;  1T39 A;  2NS7 A;  3RQI A;  1ZLK A;  4A3M J;  3HPG A;  2H6C A;  4I99 C;  3JRF A;  3JR9 A;  2JA6 J;  5D5V B;  1BR1 A;  2A6E F;  4ITV A;  2QF7 A;  2VC0 A;  4CCL A;  2OTL I;  5IOZ A;  3WTT C;  1Z1D A;  2LKX A;  1R5H A;  3S3O A;  2B7E A;  4JX4 A;  1MMA A;  2DBB A;  3AL0 C;  2IA0 A;  1R1U A;  1O3Q A;  3U21 A;  5GTH C;  5HLH A;  4D9J A;  4RB1 A;  2NVQ J;  4CH7 A;  1K61 A;  2DYR H;  3WHB A;  2EZI A;  2VUM J;  2P5V A;  3LOC A;  2DQR A;  4QWQ A;  4NUB A;  3RPQ A;  4XRS A;  4HV5 A;  3SXY A;  3H0D A;  3GXO A;  3P7N A;  2PMU A;  2LK2 A;  1LE8 B;  5J8C A;  1WH5 A;  4GCV A;  5ILV A;  2K3F A;  4A3E J;  3OWT A;  1RR8 C;  1AKH A;  3ABM H;  1LPQ A;  4CYC A;  2L54 A;  2XPV A;  4V19 K;  3IRQ A;  1HST A;  3DU6 A;  2E36 A;  3OYJ A;  3GFL A;  3H9Q A;  4N4O B;  2HVQ A;  1UHS A;  3OYD A;  2FF4 A;  1MMG A;  3L2W A;  3IAM 2;  3NQO A;  3CF5 F;  3EUH C;  3T1B A;  1APL C;  4I76 A;  4B44 A;  2JVH A;  2NXN B;  4A3K J;  1J9I A;  1TLH B;  4FIS A;  1W7P A;  1HKQ A;  4YFX F;  2W7N A;  3L9F A;  1Z7U A;  3GBG A;  3K4M A;  2BXZ A;  3V8K A;  3TL4 X;  1FBQ A;  1N78 A;  2IGO A;  1RET A;  2DTR A;  3QOD A;  3M4O J;  3EUH A;  4KIT B;  1FT9 A;  2Y0M A;  3L1P A;  1TC3 C;  1IN7 A;  1V54 H;  3GEZ A;  4ZYE A;  4PSW A;  3E97 A;  1HW1 A;  2C6Y A;  3I9V 2;  3MWM A;  4EJO A;  4J01 A;  5EYR A;  3G71 I;  1JXS A;  4HOB A;  2A5W A;  2GIV A;  1I3Q J;  2ZNZ A;  2E1O A;  4FE7 A;  4LFU A;  3PNV A;  2ZKZ A;  2M45 A;  4NC7 A;  1CF7 B;  2Z33 A;  2G9W A;  2JWT A;  4WXD A;  4HPQ A;  4L0Y B;  2L02 A;  2PMH A;  4BQQ A;  2XV4 S;  4YG2 F;  4BUP A;  1EF4 A;  5A2Q K;  4RAZ A;  3ZQF A;  3R61 A;  2DCE A;  1G6N A;  3VPR A;  1IZ1 A;  2OV7 A;  3OR1 C;  2HOS A;  2VJ5 A;  2CUJ A;  3MQ0 A;  3CLO A;  1SAN A;  4PFO A;  3ZQH A;  4A0Y A;  3MEX A;  1JUS A;  1NG7 A;  3KZI C;  4G8X A;  4CSW A;  4UUS A;  4I0B A;  3TDZ C;  3O8H A;  4G94 A;  2FJ1 A;  2DYS H;  4J00 A;  1YS7 A;  4XIC A;  2PN6 A;  2HQ5 A;  1QPI A;  4BKX A;  2WTE A;  5F27 A;  3S1R J;  2Y0S N;  2OD5 A;  3TP3 A;  2EFQ A;  5DS9 A;  3CCU I;  5J40 A;  2XRN A;  4HLY A;  4ENJ A;  2FBH A;  5C4X J;  4UHT A;  5FKL A;  2BY1 A;  3KZZ A;  1JKP C;  2E1C A;  5DCF A;  3QOE A;  1VQ8 I;  3PFY A;  3F8C A;  2K4B A;  4E7K A;  1OCO H;  3PIP F;  2NYX A;  1Z7L A;  1Y6I A;  2STW A;  2OTJ I;  2ZC2 A;  2DA6 A;  2H8W A;  2VPR A;  2UXX A;  1G59 A;  2H6B A;  3GLX A;  4GYG A;  3D0S A;  2ETH A;  3W3C A;  2W1O A;  2RNJ A;  1DDN A;  4BNC A;  1B8I A;  1LFU P;  1R7J A;  2WV0 A;  1I39 A;  3KYD B;  1BC8 C;  3J7Y J;  3H3U A;  2Y9Y A;  2G0E A;  4XRM A;  3BJO A;  2K9M A;  3TOA A;  2IA2 A;  2E5Z A;  2K9Q A;  3HL2 A;  3ZPL A;  4JOM A;  1F43 A;  3HHH A;  2LF8 A;  2OBP A;  3MKZ A;  1JKR C;  2L7F P;  4RS8 A;  2QYO A;  3BZC A;  2GOX B;  2DTZ A;  1EJ9 A;  1H8A C;  2E2J J;  2MBF A;  1PUE E;  3BCB A;  4RB2 C;  1UFM A;  4IL6 C;  4BY1 J;  3OIO A;  2R7S A;  3HKZ N;  1IG7 A;  3ZRG A;  3BQY A;  3AG3 H;  2IAI A;  1R6R A;  1Z6R A;  2WWY A;  1BI0 A;  3TQN A;  1RRJ A;  2XF7 A;  1ZGA A;  3AG4 H;  4RGX A;  4EJU A;  3G1L A;  1MND A;  4JBA A;  2K86 A;  1XSX A;  1QRY A;  2BY0 A;  5L3E A;  5EGO B;  3V7R A;  2HPM A;  4UNO A;  1S7E A;  3K7A J;  1GT0 C;  3SEQ A;  1P4X A;  5B66 C;  4XKC A;  3GYH X;  1XG1 A;  2CWE A;  3DKX A;  5JFR A;  3IRR A;  1WSU A;  1R4N B;  3EPZ A;  2QSH X;  1VQN I;  2XRO A;  1ZK8 A;  4N9H A;  2F2E A;  3MZ8 A;  2HOA A;  2EZK A;  4E7I A;  4II3 A;  4IVN A;  4A3B J;  1WRJ A;  4BHB A;  1SFE A;  3BRO A;  3I0T A;  2QA4 I;  3A0H C;  1WZ2 A;  4OIN F;  1UHM A;  3OYM A;  1XD7 A;  5H2F C;  4OU0 A;  4JX6 A;  4P1W A;  3SDG A;  2KIF A;  4IJA A;  5LEJ A;  1JHF A;  1W36 C;  3TMO A;  3LSJ A;  2V1U A;  2CFX A;  1PYV A;  2ZB9 A;  4A12 A;  1W0U A;  2DOA A;  2QSG X;  1G8X A;  1ORK A;  1R5G A;  2NS0 A;  4HW0 A;  5IYD J;  3QYF A;  4JX5 A;  3FXU A;  4XON A;  4I6Z A;  4IXA A;  4ZC3 A;  4XN3 A;  2IJL A;  1U0J A;  1Z3X A;  2IXS A;  2KZV A;  2ZBK A;  4YEJ A;  2PMZ N;  4L9V A;  1DP7 P;  4Y4R A;  5IOY A;  3OYB A;  2XKO A;  2XGX A;  2XPW A;  1TWG J;  3H5A A;  4H4K C;  1YW8 A;  4AU7 A;  1MBF A;  2VT3 A;  1F5T A;  4U0V A;  4KMF A;  3KEQ A;  4EM2 A;  2KZG A;  2BV6 A;  3IKT A;  1SD4 A;  5M5W J;  1WFX A;  3ZR8 X;  4MQ9 F;  4BE1 A;  4MEY F;  4M3D A;  2LKP A;  4Z2Y A;  1N25 A;  3PUF A;  4X0G A;  1VZ0 A;  3DLL F;  1FJL A;  5ICC A;  3FDY A;  4NB5 A;  2F5C A;  3BTL A;  5EF6 A;  1X1B A;  2FA5 A;  1V5G A;  4ABZ A;  3S15 J;  3QPT A;  2CSO A;  2MH2 A;  3QPS A;  3WTW C;  2MW8 A;  1J0R A;  2KL4 A;  1SEU A;  4Y33 A;  1IXS B;  3FF5 A;  4KYW A;  2Y0S A;  3MFK A;  2X4H A;  3I71 A;  3Q0U A;  2XVC A;  5HNH A;  2HYF A;  2LSO A;  3OOU A;  3O2P E;  5FD5 A;  3UKG A;  5HOD A;  2HU9 A;  3I56 I;  4CIC A;  4D7M A;  1VQK I;  2KJC A;  4WWC A;  2H09 A;  2MFZ A;  3CUQ B;  5FO5 A;  2OU2 A;  2F4M B;  2ZFW A;  4RGR A;  1JJ8 C;  1T56 A;  2HI3 A;  3RYR A;  4B4C A;  2ECB A;  3CD6 I;  1DPU A;  3RKX A;  4Q47 A;  3B02 A;  3L09 A;  2P5K A;  1CF7 A;  3H36 A;  4LOC A;  1DGW Y;  2CUZ A;  3PM1 A;  4FCY A;  4PJJ A;  2DMN A;  1YG2 A;  3ZMZ A;  2M2E A;  5HDG A;  3KP3 A;  2F48 A;  4G6Q A;  3WG7 H;  3LFK A;  4ZH4 F;  2DN0 A;  1X58 A;  2VBW A;  5BPI A;  5CLS A;  5CKT A;  3WTY C;  3BG5 A;  2DO7 A;  3S2W A;  2ME0 A;  3FHZ A;  1Z77 A;  2MYS A;  4N4N B;  5KAI C;  4KIS A;  1D0Y A;  1RPW A;  2DI3 A;  4PCQ A;  4A93 J;  2A69 F;  1USS A;  2W48 A;  5FKK A;  5H6R A;  2FQ3 A;  3FM3 A;  2R7R A;  3BPV A;  4LB5 A;  2JA7 J;  2VIX A;  2VXD A;  5BPD A;  2OQG A;  2H1L A;  2CUF A;  4P5O A;  2M7A A;  1I3A A;  3M1C A;  5IYC J;  1ETQ A;  3OYI A;  1U2W A;  1R5I D;  2EBI A;  2L2O A;  2V4J C;  1D0Z A;  1EKE A;  2HTS A;  5FD6 A;  2RN7 A;  3M3Y J;  4BU2 A;  1E3O C;  5IYB J;  1YOV B;  2EIJ H;  3VYR B;  1YIT I;  3EUK L;  2RVC A;  4D5C A;  2CQK A;  2FXA A;  3E6B A;  4M3F A;  2QEX I;  1A31 A;  4HST A;  1WJ5 A;  3HGY A;  4BXU A;  1MMN A;  2FRH A;  4A3F J;  4IHT A;  3ZXS A;  5DUK A;  2Z16 A;  1IO2 A;  4PJL A;  3VSK A;  3FHN A;  2BVM A;  1ENH A;  3V7C A;  1YJ9 I;  5DD4 A;  5FRM A;  2EFP A;  4ZTF A;  3GZN B;  2BBY A;  1KZH A;  2OF7 A;  4U0W A;  3Q5F A;  4CO8 A;  2CV0 A;  4G6T B;  5E8I A;  4C2M J;  1QU3 A;  5LGT A;  2R5Z B;  2WA0 A;  4IF4 A;  1K7A A;  4U7D A;  4IRI A;  2Y30 A;  3FXQ A;  1E2X A;  2FOK A;  3JAM K;  4XSX F;  3RIR A;  2FE3 A;  4F93 B;  2Y75 A;  2KHM A;  2DMT A;  4A0Z A;  5M5Y J;  4KJZ A;  4FQG A;  4XNF A;  1BI3 A;  3I4M J;  4Q48 A;  3IWF A;  1RUO A;  2HS5 A;  1IDY A;  1WQ2 A;  5LGU A;  1HLV A;  5IPA A;  5EG0 B;  3R0J A;  4F55 A;  1P2F A;  3BY6 A;  4W1U A;  3TKY A;  1MMD A;  3MZY A;  2L7M P;  2EV5 A;  4D5F A;  3BG3 A;  3KET A;  2QGU A;  1FP2 A;  1VQO I;  2K40 A;  2HDW A;  3N4M A;  2W4S A;  2KQR A;  1UJ8 A;  3QP5 A;  1YO5 C;  2M8E A;  5JVT A;  1IUY A;  4A3G J;  3FBI B;  3D5S C;  2WAD A;  1RC9 A;  2ZXH A;  3B6A A;  3C2B A;  1QA6 A;  4UB8 C;  4LJZ F;  1Q1H A;  3O6B B;  1T8I A;  3DEW A;  1TQI A;  3CP8 A;  2W82 A;  1DUX C;  1O3R A;  1GLN A;  2CQ7 A;  2NVU B;  1R71 A;  3FMR A;  1LDD A;  3KE2 A;  1FBU A;  4FE4 A;  1DU0 A;  4UVB A;  2IVM A;  4L0Z B;  2ZCW A;  3RTR A;  5D6F A;  2VOP A;  5F04 A;  1Z6T A;  2FNA A;  4XLA A;  3HDD A;  4Q4Z F;  1F36 A;  3HOW J;  2IEK A;  3C2G A;  3D5L A;  4ASN A;  1LVA A;  2P6T A;  1UAA A;  3WGG A;  3A4C A;  1DGR M;  1F1Z A;  1QHG A;  1R36 A;  2E1N A;  3BG9 A;  2EIK H;  4UB6 C;  1R1T A;  4A3I J;  4O6J A;  3OYA A;  3Q3S A;  3ERM A;  3ZOB A;  1X4O A;  3JSP A;  3MKW B;  2VLA A;  1JJ6 C;  2ID6 A;  4W97 A;  2EIL H;  2EH3 A;  3QPL A;  3DWL E;  4ZJZ A;  2EWN A;  2LNB A;  4HV6 A;  2JT1 A;  4B47 A;  4KDP A;  3CUQ C;  1I6H J;  3EET A;  1XC5 A;  4IPA A;  1IAW A;  5BNG A;  5E3M A;  1FZP B;  1XMX A;  3P9C A;  2F5E A;  3IAS 2;  3KPH A;  2A5Y B;  2DA5 A;  2JN6 A;  2XAG A;  3VYU B;  2Z3Y A;  3UR3 C;  3K2Z A;  2R7V A;  2X6X A;  3SDB A;  3IP4 B;  4IZZ A;  1WI3 A;  3BWG A;  3BOQ A;  3CUQ A;  1P7J A;  3M07 A;  5L3G A;  3FXO A;  4UVC A;  1GVD A;  5CPR B;  2ADU A;  5ERI A;  1RR7 A;  2D45 A;  4Y17 A;  1QNT A;  3RDI A;  2DU9 A;  4XL9 A;  1EH7 A;  5J1Y A;  3GFJ A;  1YW9 A;  2O61 A;  2LMD A;  4AM3 A;  3L00 A;  2JRT A;  3CLQ A;  1MBH A;  3L2V A;  2LKS A;  5IY5 H;  2KDZ A;  2GXA A;  2COM A;  1UMQ A;  2P7V B;  2MG4 A;  3U2R A;  3J7A O;  1IN6 A;  1ODD A;  4HQE A;  1YE9 A;  4ZTJ A;  1Y56 A;  1Z3Y A;  4MEX F;  3JRA A;  3SYT A;  1KYW A;  3K4N A;  3BLY A;  4M9Z A;  4UUT A;  2ZME A;  2R7Z J;  5D4R A;  2EZL A;  3RJP A;  2ICW G;  1BR4 A;  3GTQ J;  1WCM J;  5L3F A;  3CCS I;  1RZ4 A;  2ISZ A;  3W6J B;  1QZZ A;  4WXC A;  5M3M J;  4M73 A;  2VE9 A;  4ESF A;  5LLQ A;  1AWC A;  3F23 A;  4ESB A;  1D5V A;  2ELK A;  2FBK A;  3HIF A;  5HDK A;  3IV5 A;  3PQJ A;  2L0K A;  1L3L A;  1FIP A;  1QBJ A;  1KYZ A;  3RKW A;  3JRI A;  3QYB A;  4JP0 A;  1P4W A;  2V1X A;  5ED4 A;  2QQ8 A;  1HA8 A;  5KHD A;  5ICF A;  1EA3 A;  1EH6 A;  2X48 A;  5CVJ A;  2P8T A;  2DOF A;  3S14 J;  2LF7 A;  3IL2 A;  5DV5 A;  1YYV A;  1J59 A;  3K4K A;  3V7S A;  2YU3 A;  3V4G A;  2V1D A;  3DKW A;  5DYM A;  2M8G X;  2LTP A;  4MHG A;  3RYP A;  3HOV J;  3KEO A;  2EFN A;  1SMY F;  4E70 A;  1OYY A;  5LHI A;  2X6Y A;  5DD8 A;  3KX2 A;  4IHW A;  1Y0N A;  3MAJ A;  3UNG C;  1J5Y A;  3S17 J;  1OMI A;  2WAQ A;  4KMU X;  4G7Z F;  4DIQ A;  5J1U A;  1ETO A;  2D2W A;  1LEA A;  3FMS A;  4Q5S F;  1BA5 A;  3P9K A;  1MGT A;  3CCL I;  3HOY J;  4X6A J;  2LH9 A;  2ELH A;  1R58 A;  5EZH A;  2WY8 Q;  1SVL A;  3K70 C;  2CJJ A;  3BR0 A;  2AS5 F;  3BTI A;  1FOY A;  2WB1 A;  3K4B A;  3AFH A;  4S0H B;  5EG0 A;  3JTG A;  2BGC A;  5ILU A;  1QO0 D;  3KZY A;  3BR2 A;  1FTT A;  4M6V A;  2A05 A;  2UXN A;  2M3A A;  5C3E J;  1Z21 A;  2WY7 Q;  5AIP A;  3D1N I;  2E60 A;  1J2X A;  4GRI A;  4M6Y A;  5K7F A;  4KUM A;  3LSI A;  2HR3 A;  1V3F A;  4E6K G;  3G6E I;  1E3P A;  2NAZ A;  3G1M A;  3ISP A;  3CCQ I;  1I5Z A;  3VOE A;  5GAD J;  2A68 F;  1Y8Q B;  3M1E A;  1MNE A;  3IC7 A;  2M0C A;  3KP5 A;  5DM7 F;  4YRV A;  4I2O A;  2CMP A;  4XQF A;  3MN2 A;  2DW4 A;  3WG9 A;  3K1M A;  3I4N J;  1O3T A;  2YSR A;  2Q1Z B;  5F0H A;  1C0W A;  3JRC A;  5J47 A;  1MIJ A;  4NC8 A;  2LYC A;  3K1N A;  4GYI A;  2E2I J;  1G4D A;  3TO7 A;  1MW7 A;  3O8G A;  4P96 A;  4NNJ A;  1T98 A;  1K78 A;  3FIS A;  3HOS A;  2AO9 A;  2FEZ A;  2XB5 A;  4MO7 A;  3PO2 J;  1D8K A;  4O5V A;  1R4M B;  1QVT A;  1XGS A;  5K1Y A;  1HDD C;  3IWZ A;  1ZRE A;  2J5O A;  3HYI A;  4EQQ A;  3ZQQ A;  3R4K A;  1JUM A;  3GWZ A;  4L9T A;  4DGW B;  1OCZ H;  2CW8 A;  5EJC A;  2RQP A;  1X3Z B;  3HM5 A;  1TT0 A;  4A2U A;  2DK5 A;  3QP6 A;  1X4P A;  5D5X B;  2EIN H;  2XSD C;  1YS6 A;  4I98 B;  1UCR A;  2LD5 A;  2IGM A;  3GME A;  2MSY A;  5L3D A;  2OCC H;  3K0L A;  2BYV E;  3ZCO A;  4XLF A;  3LSM A;  3I59 A;  3A2K A;  2ZO4 A;  3I64 A;  5HDN A;  4XMY A;  1VQ5 I;  2PLY A;  3GZ5 A;  3MKL A;  3M8J A;  1CQT A;  2I10 A;  1IDZ A;  4LGW A;  4ESJ A;  1JGG A;  5DTD A;  2HZT A;  1WH7 A;  3S16 J;  1FEX A;  1DPR A;  1F9N A;  4AIJ A;  2LR8 A;  3ZP5 A;  4IKF A;  1JGS A;  2FOW A;  1W7P D;  3WGH A;  3CDL A;  1IGN A;  4LLN A;  2R7X A;  3MVP A;  2VJJ A;  5B1B H;  2YX4 A;  2Z2S B;  1Y8R B;  3WTU C;  1PP7 U;  1TL8 A;  2EV6 A;  4PSX A;  3WE3 A;  2X6W A;  3C3W A;  4B1R A;  3H1C A;  5GPC A;  1FC3 A;  2BEO A;  3HRU A;  2IGK A;  4ON0 A;  2DFF A;  1PUF A;  4KIC A;  3SFI A;  5JLW A;  4IO9 F;  1D5Y A;  1YLF A;  1D3Y A;  1TZL A;  1G2H A;  2JJ7 A;  4HNU A;  4A0X A;  3HG9 A;  1SD6 A;  4OIR F;  5M3F J;  2R7O A;  2LRE A;  3E1S A;  1FYM A;  2HXO A;  2FQ4 A;  3HGG A;  1D8J A;  1JUP A;  2E1M B;  1U5T C;  2P81 A;  1PP8 F;  2UZK A;  2JMW A;  2K5C A;  3I5U A;  4XKV A;  2GLO A;  3BJA A;  2JUG A;  3WU0 A;  4OIO F;  4HA8 A;  1SC7 A;  4DBR A;  2M1B A;  2HYJ A;  4IQ4 A;  2EB7 A;  2IBD A;  2HKX A;  1GDT A;  3FXR A;  4EVI A;  1AHD P;  3OS1 A;  4RGU A;  4AVP A;  1YIJ I;  3HUG B;  4A5N A;  2ZFU A;  1GXQ A;  2RRE A;  2MA3 A;  2N8G A;  5FKM A;  1U9N A;  1U5T A;  2MC3 A;  3PO3 J;  3TDU C;  4PGH A;  3CUO A;  1JKO C;  2XIG A;  1K4T A;  2JRM A;  1BM9 A;  2HNH A;  5DEQ A;  2XAS A;  1ZGW A;  2LLK A;  1HQC A;  4KIG A;  2DMP A;  4M3G A;  5D8L B;  1HSJ A;  3H0G J;  5F6F A;  2Z9O A;  1WJF A;  2O8K A;  1POG A;  1F4K A;  1V5F A;  1BC7 C;  5LFA A;  2M30 A;  1ZHF A;  2WAF A;  3OMY A;  4HF1 A;  2BHZ A;  2MLK A;  4LD5 A;  3R6S A;  3A02 A;  2KRC A;  3N05 A;  3LAJ A;  2K3P A;  1DP3 A;  3VYT B;  3WTX C;  1FX7 A;  3RQ4 A;  1T95 A;  5K5O A;  1KON A;  1FMW A;  5IT3 A;  5IP7 J;  1WJA A;  4ZYA A;  2DA3 A;  4OAZ A;  4G7H F;  4XN0 A;  2ISY A;  2IT0 A;  3OYN A;  1I1G A;  2I5U A;  2G7H A;  4M71 A;  3GUD A;  1P6R A;  2LY9 A;  4EM1 A;  3S1Q J;  4IQJ A;  3CMA I;  3REO A;  1QQI A;  4HZF A;  1LDJ A;  2MLG A;  5L3B A;  4EM0 B;  4HQM A;  3RZD J;  1XSV A;  4NHJ A;  1IRG A;  3IH3 A;  2IA1 A;  3ZMD A;  5LBQ A;  1A35 A;  2F4I A;  1G3Y A;  4EJV A;  4ZDL A;  4HRI A;  4IHS A;  1AOY A;  4ZDP A;  1SVO A;  3LA2 A;  3NWT A;  3V8J A;  4XLC A;  2LOO A;  3MZH A;  5ICE A;  1ZG3 A;  3ZQL A;  4AD9 A;  1MD0 A;  5DCM B;  3CO6 C;  2XGE A;  2EFW A;  5CQG A;  3LA7 A;  1MJ9 A;  2E35 A;  1MBG A;  1T33 A;  2JA5 J;  1VI0 A;  3H9G A;  3OV8 A;  4LMY A;  1FLI A;  1HKT A;  5HS7 A;  3QYE A;  1VQ4 I;  3OS0 A;  2R7W A;  1M1E B;  1HDP A;  3DLA A;  5EDN A;  3K4C A;  1J75 A;  4B09 A;  4H0E A;  1FPQ A;  1R1V A;  2KIU A;  5D4S A;  3I58 A;  1W5C C;  5EZG A;  2PJR B;  2Q0O A;  5CVR A;  2YPR A;  1PVE A;  3R0A A;  2VJ4 A;  3C7J A;  4C2T A;  2CQN A;  4E7H A;  2R93 J;  2IS2 A;  5J3L A;  4HX4 A;  1P92 A;  3T8T A;  1LJ9 A;  2DT7 B;  2WAE A;  3TP0 A;  3ZMT A;  3LL7 A;  1OQY A;  5E20 A;  2KLO A;  1CGP A;  1WVR A;  5BMZ A;  2L3D A;  3HB9 A;  1YRN A;  2K85 A;  1W36 D;  2W57 A;  4YII A;  3QWL A;  3J7A Y;  1ITY A;  1S5L C;  4XKW A;  3WHC A;  2LG4 A;  2MC4 A;  3QOP A;  5CQE A;  1KA8 A;  2MAB A;  3TOB A;  1SFK A;  1IXR C;  4HDU A;  3BJ6 A;  3CES A;  1VQM I;  3F21 A;  1ZG5 A;  5CYV A;  4G12 A;  2GIZ A;  2ZNY A;  5J4V A;  3QQA A;  2FX0 A;  4TV7 A;  2OZU A;  3WTZ A;  3F3X A;  4IHX A;  1TW2 A;  1FSE A;  1IV8 A;  2L4M A;  1ON2 A;  4BXF A;  4RB0 A;  3DBH B;  3LNQ A;  3W2V A;  2Z5U A;  4DYR A;  1S72 I;  2R7Q A;  2EV0 A;  3BR1 A;  4PGG A;  4A3J J;  4ANJ A;  4GGG A;  4BXX J;  2K7L A;  3KFW X;  2VQG A;  2PI0 A;  3PSI A;  3DU5 A;  5CVI A;  3T0Y A;  3CCV I;  2ZXJ A;  4GFB A;  4RAY A;  1ON1 A;  2M87 A;  4Y15 A;  5KNL A;  1TQP A;  2XF5 A;  1Q1V A;  1REP C;  2E1M C;  3W2A A;  1XB4 A;  3G2B A;  1TNS A;  3F22 A;  4AIH A;  2CV1 A;  3ABT A;  2ZME B;  3I4P A;  2FMY A; 
#chains in the Genus database with same CATH homology
 4HG2 A;  1D1A A;  4B47 A;  2R7T A;  3S3O A;  4BQO A;  1DQU A;  1MMA A;  3AL0 C;  3PL8 A;  3U21 A;  2JVG A;  4QPQ A;  1WJC A;  4E4H A;  4D9J A;  3IAS 2;  2I8D A;  4CH7 A;  3VYU B;  1NG6 A;  3UR3 C;  2KPM A;  1K6Y A;  2X6X A;  2R7V A;  3SDB A;  5FRO A;  3IP4 B;  4IZZ A;  4NUB A;  3VSL A;  4CA0 A;  3H0D A;  3PUB A;  4U87 A;  3CMM A;  2X1E A;  5CPR B;  3DPU A;  3OWT A;  4XL9 A;  1N77 A;  4BAC A;  2V9K A;  4B43 A;  2WBM A;  5LD2 C;  2CW7 A;  3L2V A;  3DU6 A;  2HVR A;  1JI8 A;  4LIU A;  4HNT A;  4E7Z A;  3OYJ A;  4N4O B;  3H9Q A;  2HVQ A;  3OYD A;  1AA7 A;  1MMG A;  3L2W A;  3IAM 2;  1YE9 A;  4ZTJ A;  1Y56 A;  1Z3Y A;  3EUH C;  4B44 A;  3SYT A;  2JVH A;  3K4N A;  3ONQ A;  3BLY A;  3S32 A;  2IS6 A;  2W7N A;  1YX5 A;  1BR4 A;  2CFO A;  3GBG A;  3K4M A;  3V42 A;  3BCA A;  3TL4 X;  4DJA A;  1YX3 A;  4Y3O A;  2GOM A;  1N78 A;  4RM3 A;  2IGO A;  2LBF A;  3QOD A;  4XOT A;  2V1N A;  4KIT B;  1T0F C;  4IX7 A;  4ZDO A;  4C9Y A;  3K4L A;  4XOR A;  4PSW A;  1WJD A;  3CF2 A;  3DQV C;  2BW3 A;  3KYL A;  3QYB A;  3I9V 2;  4XLH A;  2UV1 A;  4J01 A;  4B48 A;  4AYB A;  5KHD A;  1HA8 A;  2R4G A;  1EA3 A;  2A5W A;  3FBN B;  2BOL A;  1S9H A;  2VAS A;  3PNV A;  4NC7 A;  2CV2 A;  3K4K A;  2VL8 A;  2VQL A;  4HPQ A;  1N75 A;  4BQQ A;  2QKL B;  4BUP A;  4F3Q A;  2Z1D A;  2V26 A;  4PK4 A;  2DCE A;  2OV7 A;  3OR1 C;  2VJ5 A;  2CUJ A;  4XOP A;  4BEH B;  3HC7 A;  2X6Y A;  4PFO A;  2KRH A;  3KX2 A;  4CCN A;  4U7B A;  1NG7 A;  3UNG C;  2UUZ A;  4CSW A;  3L2R A;  2WAQ A;  4DIQ A;  2F6C A;  4J00 A;  2VPL A;  3L2U A;  2LH9 A;  2PJR A;  2WY8 Q;  3K70 C;  2MD0 A;  1OR7 C;  2WB1 A;  3K4B A;  3AFH A;  3QOE A;  4BDZ A;  2X51 A;  3PFY A;  1X1C A;  4E7K A;  1Z7L A;  2M3A A;  4CCK A;  1Y6I A;  1Z21 A;  2WY7 Q;  3FKJ A;  3DPL C;  2BVL A;  2ELJ A;  3OYE A;  3S3M A;  3NWS A;  2E60 A;  2VQC A;  4PFP A;  1G59 A;  4GRI A;  3PNT A;  3LSI A;  3W3C A;  4BL0 B;  2W1O A;  4E6K G;  4KT6 A;  2XSJ C;  2R7U A;  2K9M A;  3HL2 A;  4CUG A;  1MNE A;  2E5Z A;  4JOM A;  4YRV A;  2CMP A;  4XQF A;  3C2H A;  3MKZ A;  4BJT A;  1BOB A;  1X1D A;  2HZD A;  3MD2 A;  1ZEL A;  3ZGK A;  2GOX B;  1IRX A;  2Q1Z B;  4F92 B;  4BE2 A;  2DT6 A;  3BCB A;  4NC8 A;  2QKM B;  2LYC A;  4RM2 A;  1X19 A;  1J09 A;  4C2U A;  3DKY A;  2R7S A;  2ZSI B;  3ZRG A;  1MW7 A;  4NNJ A;  3TBI A;  1R6R A;  3HKZ A;  4XR6 A;  3HOS A;  5HOO A;  3OIP A;  2XF7 A;  1MND A;  4BE0 A;  3DPT A;  3K6G A;  2HPM A;  1WJB A;  3SEQ A;  3ZQQ A;  4LIV A;  2XAU A;  3S3N A;  4DGW B;  4XKC A;  2V6E A;  2CW8 A;  4FAS D;  3DKX A;  2ZXI A;  2IS1 A;  3EPZ A;  3E0J B;  3OY9 A;  2CS3 A;  1TT0 A;  4E7I A;  1BR2 A;  4II3 A;  1X4P A;  3OL4 A;  3LSK A;  2LRD A;  3W2W A;  4XLE A;  3OYM A;  3OYC A;  2VXZ A;  4P1W A;  4QPO A;  3OYK A;  2IGM A;  1W36 C;  3TMO A;  1PYV A;  3HPH A;  2DOA A;  1G8X A;  3ZCO A;  4XLF A;  3LSM A;  3QYF A;  4XON A;  1QHH D;  1UG0 A;  3A2K A;  4XMY A;  4ZC3 A;  3M8J A;  4XN3 A;  2NOJ B;  4BJ6 C;  2E5N A;  2L5Q A;  1U0J A;  1Z3X A;  3PSF A;  2IXS A;  2KZV A;  4YEJ A;  4DOZ A;  2M7B A;  1LKX A;  2KP6 A;  4IKF A;  4Y4R A;  3SEZ A;  2PMZ A;  2R7X A;  4F91 B;  3OYB A;  3CJR B;  3LMM A;  2XDV A;  3H5A A;  4AU7 A;  2LC2 A;  4H4K C;  2VJJ A;  2Z2S B;  4BJ5 C;  2K9L A;  5HVQ C;  1X1A A;  4B3X A;  4JQF A;  4PSX A;  1WFX A;  3ZR8 X;  4BE1 A;  4OWR B;  1ERD A;  2X6W A;  3LSH A;  4CCO A;  3L2Q A;  4X0G A;  3F9K A;  2IGK A;  3H5N A;  1VZ0 A;  1LFP A;  4NQW B;  3FDY A;  3HOT A;  4CCJ A;  2A6T A;  1TZL A;  4EAT A;  1X1B A;  2V7F A;  2VKH A;  1V5G A;  3H9J A;  4HNU A;  3OYG A;  4RLQ A;  3HG9 A;  4HSR A;  1P9Q C;  2R7O A;  2LRE A;  2F5V A;  3E1S A;  3MKY B;  2L9S A;  5HNF A;  3HXL A;  2KL4 A;  4Y33 A;  2E1M B;  2Y0S A;  4FET A;  5HNH A;  2K5C A;  1D0X A;  4XKV A;  2AQE A;  3OOU A;  2DJI A;  2JUG A;  2HU9 A;  3DTE A;  4PUS A;  4BS9 A;  2HVS A;  4DBR A;  4IQ4 A;  2OC6 A;  2FUG 2;  2MFZ A;  3OS1 A;  2L9N A;  2Q2E B;  1D1B A;  3HUG B;  2ZFU A;  3AL0 B;  2RRE A;  4AVZ A;  1DGW Y;  2CUZ A;  2HNH A;  3K10 A;  4PJJ A;  1WJE A;  4OAY A;  2IS4 A;  3AKZ A;  3VWB A;  2VJI A;  3BG7 A;  2JA2 A;  3CP2 A;  3VDX A;  4BEH A;  1PJR A;  1WJF A;  1FMV A;  5CKT A;  1V5F A;  5LFA A;  2MYS A;  2WAF A;  3OMY A;  4N4N B;  4KIS A;  3OYH A;  1SAU A;  1D0Y A;  4R79 A;  2KRC A;  5KCM A;  3N05 A;  1OLT A;  4C30 A;  2K3P A;  4LIT A;  4RLF A;  1DP3 A;  4HEA 2;  3S93 A;  3SZG A;  3VYT B;  3K70 D;  2XF6 A;  2R7R A;  3RQ4 A;  1T95 A;  1KON A;  1FMW A;  5TGT A;  1WJA A;  2VIX A;  2VXD A;  4ZYA A;  4OAZ A;  4XN0 A;  2LBF B;  4P5O A;  2M7A A;  3DTI A;  3OYN A;  3S8P A;  3BG6 A;  3M1C A;  3OYI A;  2X1D A;  5FRN A;  2L2O A;  2V4J C;  3CJQ B;  1D0Z A;  4LG3 A;  4IQJ A;  2BW3 B;  4BU2 A;  4BQN A;  3VYR B;  3EUK L;  2VB6 A;  2P0W A;  2F4I A;  3OYL A;  2X85 A;  4HST A;  1WJ5 A;  2HQA A;  4ZDL A;  4HRI A;  4ZDP A;  1MMN A;  3NWT A;  4XLC A;  3ZXS A;  2LOO A;  4PJM A;  4E7J A;  2Z16 A;  4F52 A;  4PJL A;  3VSK A;  3FHN A;  2BVM A;  2X1C A;  1D1C A;  2M4K A;  5FRM A;  4ZTF A;  4XKB A;  4XM3 A;  5CQG A;  2CV0 A;  4G6T B;  3IUO A;  4CZC A;  1QU3 A;  3VYS B;  2M0M A;  3D5R C;  2DXI A;  2LY1 A;  2WA0 A;  3H9G A;  3QYE A;  3KEY A;  3OS0 A;  2AQF A;  2CH0 A;  2R7W A;  4E7L A;  3DLA A;  3CZ6 A;  3K4C A;  3K4J A;  2KHM A;  4F93 B;  3H35 A;  4BDY A;  4KJZ A;  2PJR B;  4XNF A;  2RQQ A;  2VJ4 A;  4PJN A;  4D1Q A;  4C2T A;  4E7H A;  4F55 A;  5HLT A;  2IS2 A;  1MMD A;  3LSG A;  2DT7 B;  2WAE A;  3PNY A;  3LL7 A;  2KLO A;  2HDW A;  2RNG A;  2W4S A;  2KQR A;  2W00 A;  2OUM A;  1V5E A;  2KMU A;  1W36 D;  4BGD A;  3J7A Y;  1LDK B;  2L7K A;  3FBI B;  4E7S A;  3D5S C;  2WAD A;  2LG4 A;  2MC4 A;  4XKW A;  2VQH A;  2ZSH B;  5CQE A;  3EUA A;  2ZXH A;  2JSP A;  2MAB A;  4II2 A;  3H5R A;  2O5R A;  1SFK A;  1LVK A;  2VKD A;  3CES A;  4RMN A;  3I3L A;  3OIQ A;  3CP8 A;  2W82 A;  1UEL B;  4YEL A;  3A1Y A;  1GLN A;  3DTK A;  4BXF A;  2M4G A;  3BC8 A;  3RSN A;  3RTR A;  4DBQ A;  3RCO A;  3W2V A;  4XLA A;  3OS2 A;  3OR2 C;  3C2G A;  3D5L A;  1E0E A;  2R7Q A;  3RPU D;  1UAA A;  3OYF A;  3A4C A;  4ANJ A;  1DGR M;  5JHF A;  2VQG A;  3PSI A;  1QHG A;  3DU5 A;  3DEE A;  3OL3 A;  3MMY B;  5KNL A;  4MLO A;  2XF5 A;  2E1M C;  2IGN A;  3OYA A;  3PJR A;  3HPG A;  3W2A A;  2XC7 A;  1X4O A;  2KDO A;  4CCM A;  3MKW B;  1BR1 A;  3G2B A;  2VLA A;  2HPI A;  2LY2 A;  2CV1 A;  3LFU A;  2UWM A;  4ITV A;  4ZJZ A;  3DWL E;  4CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...