2OUMA

The first domain of l1 from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
129
structure length
129
Chain Sequence
b'ALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Domain I of ribosomal protein L1 is sufficient for specific RNA binding.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 25
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oumA01
2OV7A 2OUMA 2VPLA
chains in the Genus database with same CATH superfamily
5JVTA 4RM2A 1FYLA 2H1LA 1XN7A 5LEJA 3CF2A 4DGWB 3C7JA 3OS0A 3K70D 4C2TA 3KE2A 4M3DA 2NVQJ 3EPZA 1MGTA 2CFXA 1LFBA 1R9TJ 2R7FA 2R7SA 1BI2A 1VQKI 3BZ6A 1WQ2A 1MMNA 1P7JA 5M5YJ 1ERDA 2L7FP 2K5CA 1GV5A 3G1MA 3MKZA 4EGYA 2JVGA 1MNMC 3OYHA 4HLYA 1OJLA 4GCVA 4XK4A 1RUNA 3KZIC 2FMYA 2KIUA 4BE1A 4U7DA 1D5YA 2NVTJ 3V7RA 1VQ4I 1HBXG 1S3JA 2DA7A 2CH0A 1DPUA 2FUG2 1OYWA 3KYCB 1LEBA 4RAGA 1A6QA 3EUHC 1T33A 3ASNH 3RZDJ 3BTCA 1X19A 1NG7A 2RQPA 4XKBA 3ZQQA 2D2WA 5FKMA 1TWCJ 2CV0A 2STWA 2HOEA 4A6DA 4ENJA 2HKXA 1QVTA 2YSRA 3OMYA 3PM1A 1AU7A 4OIQF 5LBQA 3RTRA 4KMFA 2FBIA 2O61A 2XB5A 2FRHA 2GLOA 2HWVA 2EA2A 1UHWA 2ZMEC 3DP7A 1AOYA 2DYSH 2RNGA 2TDXA 4AU7A 2YX7A 4EMSA 3O6BB 3WHCA 1U5TC 2W25A 2Y69H 1G4DA 4XKCA 3LSJA 4CGZA 4HF0A 1X1AA 2XF6A 3ISPA 1B4AA 1ZLKA 2HEOA 1S7AA 3H5NA 4FTHA 2W82A 2QM3A 2FMLA 3G4SI 4Y4RA 2E60A 4NB5A 1JTYA 4RB2C 3ZMSA 1FWZA 1PUEE 3ZMUA 1SFEA 4R1HA 3SDGA 3WU0A 5F0HA 3A2KA 4ZDOA 1WI3A 1MNEA 4XQFA 5KNLA 2PMUA 2NXNB 5D4RA 3NARA 2L4AA 4FHTA 1ZRCA 5DD8A 2ELHA 3QAHA 2FBKA 4XLEA 1P4XA 4BEHB 3JTGA 3GLXA 1S29A 5H2FC 3U9GA 3SYTA 5DEQA 1R58A 5E3MA 3P9IA 1ZH5A 4A3DJ 5TRDA 2IS6A 1HKSA 1FTTA 3BR6A 2MH2A 5HDKA 2XRNA 3CUQA 2CYYA 4QSHA 2GM4A 1Z91A 3K70C 1F43A 1D0YA 1OCPA 4BDZA 2XVCA 2OJED 4UUVA 3G1LA 5FLMJ 4M9XA 3UNGC 1IDYA 1XDUA 2F5CA 2R0QC 5IOYA 3W6VA 2HR3A 3W6JB 1C0WA 2XDVA 2IRFG 4EJOA 2JVHA 3TP3A 4C2UA 1TBXA 1G3SA 3CJRB 1Z3YA 4LJZF 2M0CA 4Z2YA 1X2NA 2E71A 2KPMA 1S9HA 3IAS2 2RREA 3CO6C 2HPMA 2QBYA 3LA2A 3ZQFA 3ERMA 4XLHA 1B6AA 5EZHA 4IHVA 4DZJA 1SFXA 1EH8A 3DTKA 1MSFC 3BG9A 2Y9YA 4DYQA 3CJNA 4I2OA 5FLXK 1VI0A 1W5CC 4CSWA 3MVPA 4Q47A 3FXQA 4HRIA 5HVQC 3MWMA 4KJZA 3K1NA 4A3CJ 3EUKL 5JHFA 2XAQA 3TW7A 5DM7F 5K7ZA 3C3WA 3U1KA 4C3JJ 2O5RA 2WAEA 4YFXF 3CMYA 2HVQA 3F21A 4RGSA 1HOMA 4I76A 2HVRA 4Q5SF 2CRGA 2JA7J 2R5ZB 1IF1A 1OYYA 4ENKA 1P92A 3KEQA 1K83J 1BC8C 2CQXA 1KZHA 1VQOI 3HBLA 2PMZN 3MKLA 3RPUA 2L9VA 2EILH 3OYAA 2RVCA 2OC6A 4CA0A 4RB3C 5F6FA 1AHDP 1JKOC 3BG5A 2JT1A 3H3ZA 1VQ9I 4GXOA 2BYVE 4D9JA 4ZYDA 3K4MA 2H8RA 2JQ7A 1XSXA 3FBIB 1ON2A 1JI8A 2VODA 1TP4A 1PYVA 2AXLA 5E1ZB 1J5YA 1FY7A 1ZTRA 2GZWA 3M8EA 3LQRA 2KZGA 2XV4S 5JI6A 3ECHA 3V8JA 2FNAA 2DW4A 3TL4X 4BL0B 3O3KA 4XMYA 2E1MC 4I09A 1BJZA 3ASOH 2R4GA 4M6YA 5CLSA 2VJJA 3ZXSA 5EZGA 4P5OA 5EGOA 3ELKA 3CQZJ 2VJ4A 3HM5A 5E20A 2WAQA 3PSIA 4LFUA 3M8FA 4N9HA 2BW3A 4BH9A 1BOAA 1OR7A 2F5FA 1ZKGA 2F4IA 2K27A 5IYCJ 1DP3A 2FNPA 3GFMA 2KL4A 2K40A 3X2QH 1UB9A 4CHUA 4ZH4F 1YX3A 1RR8C 2WY7Q 5HNFA 2EV0A 3R0AA 2E2IJ 1PVEA 4AC0A 2EIMH 1YRNB 1YIJI 4FCYA 5F0FA 3CO7C 2JA2A 4J00A 2E7WA 3TOAA 3E5UA 1UHSA 1IGNA 1X4OA 3OV8A 2NOJB 1JKRC 3IL2A 2UWMA 3N4MA 3GVAA 3R60A 1YFHA 1JJ6C 1HKTA 1ZG1A 3I59A 1Z67A 2IVMA 2VL8A 4I0BA 3F6OA 2JWTA 2CMPA 2CV1A 5BNGA 3H1CA 4P96A 4L0YB 5LHGA 1UZCA 3DF8A 5IT9Z 2EFQA 2VQHA 3GEZA 3IP4B 3HOTA 2CWEA 4B09A 5K5OA 2VKHA 3H36A 3K4NA 1LB2A 4EQQA 2GQQA 5LHHA 1A35A 3A0BC 2FX0A 2DTZA 1JTXA 4GYGA 1U9NA 2AQEA 1BM9A 1SC7A 2LKPA 3ZMZA 2HVSA 1H8AC 2BEOA 1MKMA 2QQ9A 4F91B 2D1VA 5JLXA 3P9KA 1A6IA 4M3BA 4XM3A 5DYMA 4YFKF 3PUFA 4ZYAA 4KA4A 3S93A 5E3OA 1EH7A 3SDBA 4DBQA 3Q0UA 4BXXJ 4JP0A 1V3FA 1Y0NA 1GUUA 2Q8KA 4L9TA 4IEJA 4OMZA 4X1EA 2XGXA 5B1BH 2DOAA 5FKKA 2D45A 3N05A 4BACA 1ETOA 3P7NA 3KZYA 2O0YA 3H5RA 5A2QK 3GUDA 1BIBA 2O8XA 3CLQA 3FWEA 1BR4A 4HZFA 3CDHA 5FKOA 2ZSIB 5IP9J 3OYEA 4LLNA 4MLOA 1OMIA 2N8GA 3BR1A 1ZR2A 3DV8A 3WGHA 2HQAA 1O3SA 1AKHA 1JHHA 3MQ0A 3BOQA 4WF2A 4FE7A 4G9YA 3MEXA 3A01A 5DCMA 5BS6A 1WPKA 3PFIA 5B1AH 4DOZA 3H9JA 4LG0A 3K1MA 4HLXA 2ZFUA 2FD5A 4LOCA 1GDTA 2HDWA 1KONA 2F4MB 5LRSA 3BR0A 5EEGA 5IT3A 3WTSC 1O4XA 3ONQA 4MFEA 4A6EA 2HFHA 2E1CA 5F04A 4HDUA 2V6EA 1DGWY 1I27A 4A69C 4DYRA 4ESFA 1CGPA 2YU9J 3S32A 2MD5A 1IXSB 4XICA 3JRDA 1PJRA 1EKEA 1J75A 5DTDA 1HDPA 2G9WA 3IC7A 5L3BA 3VFZA 3WHBA 3H3VK 1HA8A 1UMQA 1W36C 3I64A 3CCLI 3FXRA 4KDPA 2DK5A 4MGRA 3DLLF 2XB0X 3CUQB 2IGNA 4FETA 5DDGA 5F1JA 2Y31A 2HTSA 2X1CA 2CQNA 1LNWA 4OINF 1HC8A 1G3TA 1JKQC 4DJAA 2JPCA 1IUYA 3FHZA 2R5YA 1EV7A 5H6RA 3CMEI 3I71A 1O7LA 1NH3A 1RZ4A 2PQ8A 1QVUA 4E4HA 3WTYC 3FXJA 4LMYA 4D7NA 4B47A 3JRFA 3M8JA 5J6XA 1IRGA 1QO0D 3LSPA 1JGGA 2VXZA 3EETA 1FEXA 2QBYB 3F72A 4KYWA 1NTCA 2W84A 4LK1F 5BPIA 3AAFA 4AWXB 1ZYRF 2HKOA 3DBRB 3QYFA 1RIOH 4PSWA 3QPHA 3ZOBA 1J2XA 4A5NA 4WXHA 5M3MJ 3QPSA 1XGNA 4C9YA 2MC4A 1MBFA 3K1PA 3I56I 5JVGF 4ESBA 3PNTA 3ZGKA 3SEQA 3SQNA 1MBGA 1IDZA 1WWXA 4AD9A 3A1YA 3DPTA 1ZGWA 2GAUA 4JOMA 1FT9A 1TW3A 2XPVA 5L3GA 2BY3A 2VXDA 5CVVA 4ZYGA 4OOIA 3IHUA 1F5TA 3GYHX 1DQUA 4MNUA 5E17F 5IYDJ 5ED4A 4IKFA 3I4PA 1SMTA 1IW7F 1OLTA 2JRMA 4L9JA 5B5EC 2R3SA 2Q0OA 5FLXZ 2W48A 1TNSA 2QQAA 1B9NA 4X0GA 2VUMJ 1X1PA 4U0VA 1SVOA 2COBA 1Y6IA 3LSRA 5FB2A 2X51A 1KA8A 2DDAA 4UB6C 3G1OA 1OCZH 3DBLB 2VQCA 4Y3OA 1FBUA 1L0OC 1R6RA 3VDXA 2V1DA 5DD4A 2XPUA 1DUXC 2LG4A 3Q5FA 3F6VA 1UFMA 2OF7A 3JRGA 3QYEA 2DT6A 1XSDA 3OL3A 2PEXA 4U7BA 4WXDA 2XKPA 3HSFA 5F1RA 1DU6A 2DPUA 2M1BA 5CPRB 1FLIA 1YOVB 1W5SA 4OMYA 4CCOA 1J9IA 3F23A 2XASA 1V54H 3W2AA 2A68F 2K3PA 3GZNB 2G0EA 3CC7I 3DKYA 4N0BA 2L4MA 1JUSA 3GMEA 2KRCA 1UHMA 3TP0A 4M3EA 1W5TA 3EYYA 2R5ZA 2WC2A 4G7ZF 1H9GA 5EGOB 3S1QJ 1ETKA 1WJBA 3CJTB 3CCJI 4E7JA 3QU3A 3EYIA 3KP3A 2X48A 4KUMA 5F64A 2BW3B 4HG2A 4M9SA 2ME0A 2Y75A 3MZ8A 3KYLA 1POGA 4F52A 2W4SA 3QWLA 2GIVA 4BAYA 4YELA 2DMNA 3S17J 1FPQA 2I5UA 4KICA 2BXYA 1X58A 1BL0A 3Q0VA 4EM0B 3D5RC 3B73A 4B4CA 5E79C 5L3CA 3BP8A 1WJDA 2JN6A 2K7LA 3WU2C 4XL9A 1LKXA 2CS3A 2DODA 2J5OA 3ML6A 3RPUD 3PIPF 3ZQCA 1VQ5I 4V2GA 1SD6A 3HRUA 2MC3A 1VQ7I 1IXCA 1Q1VA 2M0MA 2VE9A 3I59B 1D8JA 1SEUA 2IGOA 2EIKH 2DJIA 1WH5A 2DI3A 2MFZA 3GTOJ 4LB5A 3GZ5A 2FBHA 2VJ5A 4NUBA 5KAIC 1S7EA 3T8TA 1IO2A 2A05A 5ICGA 4HX4A 1IRZA 1RKTA 4S0HB 5FROA 4PCQA 3K2AA 4RLFA 1SAXA 2WB1A 2VI6A 3OYIA 1ZR4A 4JX6A 3KYDB 1DDNA 2UXXA 4BUPA 5M5WJ 2XGCA 5C4XJ 1IN4A 1MIJA 2B63J 3GTKJ 3FMSA 4A3EJ 3VWBA 4V19K 2DLLA 3OIPA 5GAEJ 1XPXA 2ZKZA 3H9GA 4IHXA 1HQCA 4L9NA 2ZBKA 1IJWC 4EATA 4CH7A 3E6DA 3L2UA 3HB9A 1ULYA 3LSHA 4ENNA 4D0PA 3I55I 3V4GA 2UV1A 3K69A 2BY2A 4ZC3A 2M34A 2ECBA 2IAIA 3G2BA 4A3FJ 3ZN1A 3QRFF 4U88A 3I5UA 2KQRA 1X1CA 3SZGA 2F5EA 5L3FA 2V9PA 2K85A 3C2HA 3L9FA 3PNVA 2LKSA 2DFEA 4PFOA 1RC9A 1APLC 2Z2SB 3OYDA 2A3SA 3SZPA 4QIWN 2QUFA 2A07F 4NHJA 2QCOA 3FDYA 2IEKA 2ZXWH 1KU9A 2XKOA 4B3AA 1TL8A 1AKHB 4A3GJ 4D5CA 1YITI 3BC8A 1GV2A 3A01B 3AL0B 5DCMB 1J59A 3HRTA 1A5JA 4L5EA 1P4AA 2AQFA 2JPBA 4LG0B 2V9VA 3SZTA 3OYMA 1MH3A 3JRIA 3E6CC 1LDDA 5KK1A 3LSGA 4F55A 3FMQA 4BY7J 1MD0A 5A2QZ 1RRJA 2ZJQF 3C2GA 1VNDA 3IAM2 2DA6A 1XCVA 5H20A 1HXDA 2GXGA 3SEZA 4IPAA 1ITYA 4ZDPA 4PGGA 3JSOA 3NQOA 2LLKA 4A93J 3R61A 2BZTA 3JRAA 1Z7UA 4XN3A 4E7IA 1MBJA 1W4MA 1YE9A 4CICA 1RUOA 2VQGA 4U0WA 2HYFA 2BE5F 4MIMA 4AIJA 2QSHX 2X4HA 4IOAF 2VOPA 1LFPA 2GIZA 2IBDA 4P55A 2V9KA 1JKPC 3UR3C 4ENMA 2E1OA 4G6QA 4BQQA 4WK8F 3EUAA 3OYJA 2HYJA 3LWFA 3FK7A 4L5IA 2VT3A 5JLWA 1LFUP 4F7ZA 2DMTA 2OCEA 3WG7H 3HOWJ 4RGRA 3JAMK 2LY2A 5EDNA 1B59A 1GXPA 1IRXA 2EZIA 2R5YB 5CQGA 4DNCA 2A61A 2IS1A 1G8XA 2GWRA 4IRGA 2E19A 2GBYA 1FP2A 5H6QA 5LRRA 4XRSA 3OS2A 4CDGA 1KYZA 1FBSA 1OR7C 3PNYA 2P6TA 1TT5B 1QQIA 3IKVA 3JCUC 3AG2H 5ERIA 2Q1ZB 3B6CA 3E7LA 4O5VA 5IY5H 1MDMA 4BQAA 3BPVA 3K4JA 2EQRA 5ILUA 2LOOA 3FBNB 3DEEA 2K86A 4EM1A 1I5ZA 2CW0F 1BBYA 3FISA 2C6YA 5K7FA 2K9LA 4C3IJ 1YG2A 1QGPA 1KU2A 1KYWA 3ABMH 3HUGB 1ZARA 2BOLA 1R4MB 2NVUB 1A04A 2DOEA 2D1HA 3QQAA 1QZYA 2DK8A 3M1CA 2GXBA 1IUFA 1YJWI 3RKYA 1N77A 3BLYA 2HTJA 5GPAA 5L3EA 4BDYA 3J7AO 1PUFB 5J8CA 3F8BA 3BZCA 4FX4A 3J81K 2LTPA 1FBQA 2DMUA 2W1OA 2RQQA 3LMMA 3J80K 2R7VA 1ODDA 1HF0A 1X1BA 2EH3A 3FZVA 4UY8I 3DKXA 1P9QC 2H6BA 1ETVA 1QPMA 2K3FA 2W7NA 1MSEC 2XIGA 2YPRA 2DO7A 3AG1H 3E5QA 3FXLA 3M9AA 4WCGA 3AG4H 1ZELA 3T8RA 3ZN0A 1VQPI 4LLLA 5K7HA 1I50J 3K2ZA 3ZQGA 2IGKA 5CYVA 4NDLA 2KIMA 4FISA 1FOWA 1WSUA 1K6OA 4OIPF 1Q1HA 2DN0A 3OWTA 3ABKH 1CF7A 1FIPA 3KLOA 2ETHA 2M45A 3OYKA 1N78A 3MN2A 1HSJA 3G6EI 1QZZA 3RKWA 4CYCA 3AKZA 2CQKA 1E17A 5ILSA 5CKTA 2VIXA 3H92A 3JSPA 2DFHA 3BT9A 1R1TA 4XRSG 2CQQA 1U0JA 4EJUA 3WTWC 3FM5A 4IHYA 1I6HJ 3BCBA 5F27A 4RLQA 3A0HC 1X3WB 4ZYEA 5EEAA 2CQ7A 1X1DA 3BROA 1TQPA 1Y56A 4E70A 4CCJA 1U3EM 1Y8RB 1LEAA 2IS2A 3FF5A 4N4NB 2O3FA 1TWAJ 2ZO4A 4L0ZB 2ELJA 3ERED 3GFLA 1SFKA 4HX7A 3OYLA 5D6FA 1NG6A 2FU4A 3GWZA 2BVMA 4HX8A 1D1BA 4F3QA 3CC4I 3VYTB 1W0TA 4CUGA 3WODF 2XC7A 1M1EB 3TKYA 3MZHA 3S3MA 3E5XA 3QODA 3QP5A 3O8HA 1J0RA 3CCSI 4RAZA 3RI4A 3OYBA 2CV2A 2H27A 2MGQA 1ZN2A 3PIOF 5FO5A 4I01A 2I8DA 1Z6TA 1D8KA 1SVMA 2LREA 4GDFA 2WAQN 3FXUA 4D5FA 1YYVA 5LD2C 4PJJA 3REOA 3SJMA 3BQZA 2IA1A 3C2BA 1U6GA 3NWSA 1WJFA 2L9SA 2LDUA 4PDKA 4ZTJA 2MW8A 2MA3A 3CZ6A 2ZC2A 3MZYA 4HNUA 2LY9A 4IF4A 4GRIA 3HZJA 3LSMA 4AYBA 5C4JJ 5J1RA 3TO6A 2R7UA 2EFNA 5C44J 3FHNA 1SFUA 1OPCA 4NC7A 2VT2A 2K4BA 2VONA 4I7HA 3ZMTA 1JT0A 2CU7A 4BKXA 3G71I 3K10A 4J01A 3LA3A 3BTIA 4P9FA 2HQNA 3IRQA 2O7OA 2X6WA 1IN7A 1QA6A 4A3MJ 2DAOA 3PUBA 1YTYA 3OOUA 1X3ZB 4EEFG 3O2PE 1OYIA 3CESA 3IWFA 4PGHA 3LSIA 3IH3A 5FKNA 1H89C 2M4KA 4CYDA 3VPRA 3HRSA 3T5XA 5IP7J 4Z6YA 2PBIA 1IV8A 4K2EA 2R7DA 3F0CA 1YHQI 4FASD 2MD0A 3DCFA 3NAUA 2CJJA 4LK0F 2EV6A 4CCLA 2Z99A 1ZG5A 1QNTA 2EK5A 3MCZA 1MJ9A 3HL2A 1ZAOA 4RGXA 4JX5A 1R22A 5AIQA 3V7SA 3OYCA 1V5EA 1ZG3A 3L2QA 1EJ9A 2KJBA 2HZTA 1N25A 4A3IJ 3GTGJ 4G7HF 2HGCA 2KJCA 2KT0A 5ICFA 1R71A 2PG4A 4HEA2 5BQTA 4HNVA 1RPWA 4CZCA 2E2HJ 1R5ID 4M9ZA 2MYSA 4KITB 1Y1VJ 4NNJA 4H4KC 4A3KJ 2JA5J 1LUJB 2M30A 4A3BJ 2LRDA 2HOTA 2Z5UA 3VSKA 1VTNC 5ILVA 3GXOA 3W2WA 3KP5A 2NVXJ 3I4NJ 4KT6A 2LK2A 3ZQHA 2LBFA 5GP9A 1VQ6I 2BXZA 1MMAA 3KFWX 1R5GA 2P81A 2RC4A 4MEXF 2CUJA 2CFOA 4PJMA 1MW7A 3W6KB 3HOYJ 2AO9A 2P5VA 4CXFA 2BGCA 3I53A 2MBFA 3HOSA 1RNLA 3ABLH 2RGVA 3Q3SA 1T08B 2DFIA 4XLAA 1WZ2A 2JTVA 3P9CA 2ID3A 3K6GA 4PZJA 2CW7A 4YIRX 1FYMA 3ZPLA 3GTMJ 3GTJJ 4BJ6C 3RSNA 4F92B 2VJIA 2EIJH 1KU7A 2L54A 2FF4A 4IHWA 1WJEA 1XG1A 3HOUJ 4QLCU 1G6NA 2XUBA 1T6SA 4BE0A 3HRMA 2ZFWA 2DPDA 3TQNA 1GXQA 1CQTA 1SD7A 2KKOA 4HA8A 2EA4A 1MH4A 3FIWA 3FXKA 4XN0A 4PJLA 4ABZA 2D5VA 2E34A 4WWCA 3WGIA 3CP2A 3S1RJ 4LGWA 4GO1A 1TTYA 4AIHA 4BU2A 1BW6A 4I6ZA 2QZ8A 2DMQA 1XDSA 5CVIA 2DA3A 2H09A 1MDMB 3S2HJ 5HS8A 5CVJA 2X6OA 2ZJ2A 4XSXF 4BJTA 4IHTA 4A0XA 2EB7A 1WCMJ 3O8GA 4PFPA 1TWHJ 3S1NJ 1R5HA 4XOTA 2STTA 4EJVA 3VEPA 4Y17A 3JAMZ 2DOFA 1O3TA 2A5WA 3OS1A 1ACIA 3PJRA 2E1NA 3D5SC 4HPQA 4BY1J 3COAC 3F8FA 4EVIA 2QQ8A 3S1MJ 1TQMA 2WV0A 1E3HA 2KDZA 3VOEA 1UAAA 1ZGAA 2OCCH 4R79A 3JTHA 3F8CA 3G3ZA 1J7KA 1D1CA 4XIDA 4W1UA 4EV0A 2CW8A 4KN4X 4BS9A 2K4JA 2EV5A 3ZRGA 3FMRA 2HDDA 2ME6A 1BN5A 1D1AA 4BE2A 4BBRJ 2XHKA 4HNTA 1GHCA 5LGNA 2O6GE 5M5XJ 4KFCA 2KRFA 5B3SH 4EM2A 1SD4A 2HYGD 4HYEA 4NQWA 3JR9A 5HLHA 3KLNA 1IXRC 2GA2A 4O3MA 3HUGA 3J81Z 1CF7B 4XBFA 1JUPA 2DQLA 3WGGA 3K0LA 4PJNA 3D5LA 5ICCA 1ETYA 4R8HA 4IX7A 3QP6A 4CYCB 5TGTA 2NRAC 1FOXA 5E18F 1R00A 1QHHD 2XAGA 3HOXJ 2EZKA 1H88C 2Y0SN 4G8XA 1PUFA 2R7RA 2VPRA 1P7IA 2JA6J 5DS9A 1FOKA 2A6EF 1U8BA 2PN6A 3KEOA 1F36A 1RKWA 4KN7X 4G7OF 5FRNA 5HS7A 5D5UB 2ESHA 2F2EA 5D6EA 2QKLB 1XS9A 1Z77A 2XAFA 2IT0A 3E97A 4D1QA 2Y0SA 1E0EA 4CO8A 3BJOA 1BA5A 2IA2A 2RDPA 5FJ8J 3WTZA 3DTIA 4UV9A 1E3OC 4S05A 4AIKA 3KETA 3QU6A 3CDIA 5LGTA 3ROUA 1EF4A 4XKWA 2EINH 5EG0B 3OY9A 2R93J 1JHFA 3ABUA 3L2CA 3ZCOA 2GA1A 4ZYHA 2LVSA 4XKVA 3IV5A 2X6XA 4PJ0C 1Y39A 2E5NA 2L9RA 1Z6RA 4HAMA 1USTA 2OAZA 1J09A 2DBBA 3M1EA 5FD5A 3DQVC 1G59A 3TO9A 4C30A 1ETXA 1N75A 5B66C 4A3JJ 3F8NA 3PO3J 1BI0A 1X3UA 2PI0A 2VBZA 3HXLA 2G7UA 4BJ5C 3OR1C 4IRIA 2M8EA 2EPFA 2ICWG 2W57A 3VYUB 2M2EA 2WADA 5D4SA 2XF7A 3L2RA 3JRCA 1X2MA 1WJCA 2R7XA 5CJ9A 1UJ8A 2NOGA 3U21A 2R7WA 4E7KA 3C1DA 3LSKA 1U8RA 4BXUA 2Z33A 1LQ1A 3M07A 5GAGJ 3QPTA 2P5LC 3LSTA 4WXCA 5D8LB 1I6XA 1Z3XA 1E3PA 1P4WA 3IUOA 2NNYA 2F5VA 2IJLA 2LY1A 2KP6A 3GW2A 4FT8A 1SANA 1T39A 5K5QA 5BOXA 1XC5A 3RYPA 2NVYJ 1EH6A 1KGSA 1P2FA 4ZDLA 1ORKA 1WGXA 3DBHB 2M5WA 3P5JA 5HDNA 3S14J 1ETQA 4JBAA 4XORA 5KHDA 3JREA 2LD5A 5GAHJ 2Z9OA 3K9TA 3HGYA 3GZ6A 1YI2I 4XOPA 2LC2A 2OZUA 3OYNA 2WB1N 2IPQX 1LE8A 4YIIA 1OQYA 4IQ4A 1DGRM 2HOSA 4B48A 2VC0A 2ZXHA 1VF9A 2HPIA 3I0TA 2E36A 2NYXA 1L3LA 1V5GA 1R4NB 3GTQJ 2E35A 1BJAA 3ZQLA 2QSFX 4MTEA 3WG9A 4NC8A 2HQ5A 2QGUA 4RB1A 2PJPA 4YEJA 5D8KB 1O3RA 1YJNI 2B7EA 2O8KA 1STZA 2LSOA 2LFBA 4RMNA 1D5VA 3LFUA 3CUQC 1WH7A 2A5YB 3AG3H 5GTIC 2L7KA 2P4WA 1OKRA 1LDKB 1MJAA 4N9IA 4UXNA 4IOCF 1FNNA 1Z1DA 1IAWA 5J47A 3OR2C 1T0FA 4JK1X 3IH4A 3F22A 4I99C 4N4OB 4G6TB 2BVLA 3HJEA 4HSTA 4MHGA 1WFXA 3T1BA 2FE3A 4M3FA 3CTAA 2X9DA 4F93B 5EYRA 1GVDA 1W0UA 4KIBA 3JW4A 3V8LA 1XB4A 4MQVA 3QYBA 2JSCA 3U1DA 1DPRA 5F08A 2LBFB 5IYBJ 4A12A 3S16J 2JRTA 1A31A 1NK2P 3BR5A 4UB8C 2F6CA 1U9OA 1ZRFA 1VFCA 2ZJRF 5FKLA 2FEZA 4V2FA 3D0SA 2QF7A 3J7ZI 5J40A 3IRRA 3CCQI 1BOBA 3CCYA 1S7OA 4DW6A 3W2VA 2LP0A 2MABA 2O03A 1FP1D 4OU0A 1WI9A 4P9UA 1FIAA 1OCCH 2ZNZA 1K4SA 4M3GA 2FA5A 1FC3A 2KZVA 3V8KA 3WU1B 2M3AA 4MFDA 1BI3A 2R7TA 2NAZA 5J1YA 3A4CA 4X6AJ 5J4VA 4M74A 3MKWB 4XSZF 3G73A 1MNDA 2XSJC 4M6VA 2L2OA 4RM3A 4L5JA 1H0MA 1K79A 3MKYB 2EZHA 2X0LA 3WE3A 1AWCA 2HI3A 3PSFA 3CUOA 3WTTC 2A69F 3GLLA 4I02A 2VOOA 1QHGA 4UVCA 5D5XB 4A3LJ 3E6MA 4YRVA 3RCOA 2BY1A 2L9NA 1ON1A 1FSEA 1XMAA 2P5KA 3GO5A 4S04A 2LKXA 1H9TA 1FTZA 2BBYA 3LFKA 3KEYA 1Z7LA 4QPQA 4L18B 2M4GA 1IV6A 3HOVJ 2VPLA 1YO5C 2AXTC 1SD5A 2VB6A 1R1UA 3HPHA 3BJ6A 4W97A 3CP8A 5GPCA 3A02A 2ZSHB 4IVNA 1UELB 2JK3A 4BXFA 2M7BA 4LD5A 3MD2A 1YQAA 2V26A 3CCEI 2E1MB 3QOEA 3PL8A 1YJ9I 4BYYA 2XPWA 3VYRB 3CDLA 1OCOH 2QWWA 3OIOA 4E7SA 2HDCA 1NHAA 2YR2A 2DQRA 4PK4A 2MG4A 4OAYA 2JSPA 1T8IA 4Y52J 3HGGA 1FYKA 2QVOA 1ZHFA 4A0ZA 2DXIA 2OTJI 3J7AY 4HDVA 5AIPA 4QPOA 3ECOA 4NQWB 1LVAA 2RKHA 2UZKA 2DT7B 1ZLJA 2JUGA 5JHUA 2Z3YA 5HODA 2L7ZA 1R7JA 2KRHA 4M73A 1PP7U 1HLVA 2J5PA 2ISZA 4DZPA 1USSA 3KX2A 2Z16A 2LYCA 1P6RA 3DEUA 3TDUC 5HLTA 3DPUA 2G7HA 5FRMA 1LVKA 1MMGA 2FOKA 3RQ4A 1T2KA 1R49A 2HU9A 2HOAA 1OCRH 1BI1A 2VKVA 4ON0A 3B02A 1G2HA 2YUSA 5IPAA 1IN8A 2ADUA 1AA7A 4HBLA 4I0AA 4MQ9F 4UUTA 5E1WA 5DM6F 4BQNA 1Z21A 2DA4A 3TGNA 4WX9A 2QSGX 2CUFA 3GTPJ 1B1BA 3L09A 4IL6C 2M9HA 1YW9A 2ELKA 2W85A 4A2UA 4Q4ZF 3N97A 2VN2A 2DDBA 4FE4A 4NC6A 2V6CA 2ZCWA 4XLFA 5FGMA 3E3VA 5M3FJ 3TW6A 3CJQB 3I4MJ 3SFZA 4XLNF 1FOYA 4G12A 1BR2A 3OIQA 1HKQA 3KZZA 1ZGJA 2ESNA 2P7CB 4MO7A 3HTSB 1B8IA 4KISA 1VQMI 2L02A 2PX9A 3MMYB 1JUMA 1Z05A 4OIOF 2CSOA 2Y2ZA 4IXAA 4UHTA 4NBQA 4AVPA 1XMKA 3CD6I 1YW8A 2EWNA 3ZP5A 2Y0MA 5LGUA 2UXNA 2EFPA 2QLZA 3ZMDA 2VLAA 1K78B 1DU0A 3JRHA 5DV5A 1K6YA 4CCMA 4KIGA 2OTLI 4LIUA 5CVRA 1MJBA 3LL7A 3FK6A 5EF6A 2WAFA 2PFBA 2F48A 3GCMA 5DUKA 2XAUA 2NS7A 1R1VA 3DPLC 1FZPB 2CO5A 3DTEA 3BZKA 4HF1A 4XRMA 3HHHA 2R7OA 3KCCA 4RAFA 4BHBA 3CLOA 5EG0A 3AL0C 5J3LA 1B72A 4LG3A 4RAYA 1UG0A 4I98B 4Q48A 2ACJA 5TISC 2JZYA 2LMDA 3T0YA 2GOMA 1KQ9A 3HKZN 4II2A 4AVZA 3F3XA 2X1EA 3IWZA 4XR6A 4B3XA 2TRTA 2KLOA 4AYBN 3BPXA 1KU3A 2OPTA 3RPQA 1YX5A 3FKIJ 1XGSA 2QYOA 4Y15A 2A6HF 3I58A 2Q2EA 3M3YJ 4ANJA 1WJ5A 5FLVA 1FMVA 1TZLA 3EQLF 3OYFA 4C2MJ 2M8GX 2P0WA 4AM3A 1XX5A 1LE8B 1OISA 1ENHA 1E2XA 4RDUA 1ETWA 1MBEA 2AS5F 3HOZJ 3HSEA 3B6AA 3HKZA 3ZQIA 1EA3A 5DCFA 3CF5F 5J4YA 3R6SA 1GVJA 2WA0A 3EUHA 4DYCA 4JQFA 2V1NA 5EJCA 5IP6A 2KIQA 2OV7A 2VASA 2PMZA 3IKTA 1K4TA 2Z1DA 3D1NI 2WTEA 4HQMA 3VYSB 5BPDA 3VSLA 2E2JJ 2W24A 5E8GA 5HNHA 4RBOA 2LH9A 3S2WA 5HDGA 3RIRA 1X4PA 3GF2A 1SFOJ 4RB0A 4TV7A 3U2RA 1KQ0A 1RETA 2DA1A 2FOWA 2ZMEA 1S6LA 4BGDA 3TBIA 2ISYA 2XAHA 3L1PA 2XROA 2DU9A 4PUSA 1U5TA 4JX4A 1W7PA 1UG2A 2LNBA 5LHIA 5E3NA 3F8MA 1IG7A 3LNQA 3LAJA 4B43A 2BY0A 2F4OB 2Y9ZA 4MEYF 4E6KG 1ONVA 2K9QA 3K4KA 1JXSA 3ULQB 2PJRB 2L3DA 2XRLA 4CZZA 4LIVA 4U87A 1UCRA 2P6SA 3Q0WA 2O9LA 3H35A 5TJJA 4AIDA 3VODA 5LFAA 1QZEA 1G3YA 5DUIA 3GBGA 3HG9A 4XRFA 3LQQA 2FSWA 2PLYA 3IH2A 1FMWA 3FKJA 1ZQ3P 1WKMA 1JGSA 2A6TA 3BJAA 1VQNI 2VC1A 5EEHA 2KDOA 3BG6A 2EFOA 2MLGA 2V7FA 1I1SA 3TDZC 3OSFA 3H0GJ 1HW1A 2OQGA 2B0LA 3KPHA 1BW5A 4UUSA 3S8PA 3A03A 4QTRA 3GTLJ 4OWRB 2IP2A 3HYIA 4XLPF 4HV6A 3CC2I 2NS8A 2OQRA 4EJWA 4AUXA 3VB2A 4KIFA 4ZZDA 1TWFJ 3WTUC 3TEDA 1VQLI 5JFRA 4ZZLA 3CMAI 5D5VB 1W36D 3SXYA 3TMOA 4B8XA 1T56A 2ZB9A 1MBKA 2L01A 3BTJA 3SHFA 4UVBA 4EGZA 1ZRDA 4UNOA 2LF8A 3DU5A 3LAPA 3H0DA 1V4RA 2I10A 1K7AA 4M72A 3RZOJ 2HQRA 3BY6A 3DU6A 1JJ8C 4GGGA 1OFCX 1Y0UA 4YG2F 3DEWA 2AHQA 4KMUX 1MBHA 9ANTA 4Y13A 1D0ZA 1GT0C 1RI7A 2NNNA 1TQIA 2KISA 4HF2A 5CQEA 4FX0A 4JYKA 4ZTFA 1JT6A 1YIOA 2JMWA 1U2WA 1XCBA 2R7QA 2YS9A 1IZ1A 2FXAA 2F5DA 3E1SA 4A0YA 4XLCA 1FJLA 1MMSA 3Q9SA 3L2VA 1GLNA 3PQJA 3K4BA 1TW2A 1TC3C 2K9SA 2EJRA 2ZJPF 1YLFA 4GYIA 1W1WE 3S2DJ 3HIFA 1YS6A 2MSYA 2LR8A 3K4LA 1O57A 4II3A 3E0JB 3BG7A 1PDNC 1XGOA 1QRYA 1S5LC 3CCUI 2QENA 2P8TA 3FXOA 1SVLA 1HW5A 4M6XA 1YW7A 5KAFC 1VZ0A 2CUEA 2EBIA 3TO7A 2HZDA 2VBXA 5E1XA 1IN5A 4OAZA 1IC8A 4P1WA 2R92J 3L00A 1IN6A 2KMUA 4IHSA 2PMHA 3H5AA 2H94A 1LDJA 3K7AJ 3PFYA 1F9NA 3ZMVA 3KIOA 2HNHA 3HSRA 2VKEA 4ZJZA 1OCTC 5JR3A 2GXAA 3WE2A 1WRJA 4RA2A 3L2WA 3M4OJ 1B9MA 2MH9A 2QA4I 5K1YA 4RS8A 4BHCA 4DBRA 2RV8A 2DMPA 2QEXI 1O3QA 2DA5A 3CMMA 4CCKA 5HLGA 3BTLA 3KP6A 5KVRA 3CCMI 5FFXA 1T0FC 2DYRH 2V1XA 1NK3P 2X6YA 1S72I 5AONA 1B8IB 2VKDA 1F1ZA 2V4JC 2VE8A 2V79A 1D0XA 3I54A 3LOCA 2ZNYA 4UV8A 4YIFA 1Z9CA 3J80Z 3WTVC 3RYRA 2K9NA 4KT5C 4O6JA 4BNCA 4DIQA 3V7CA 1XTAA 4EJTA 2WBMA 4XONA 1R23A 1BIAA 1T95A 4IRHA 4IQJA 3NEUA 4HW0A 3E6BA 2XSDC 3ESWB 4BEHA 2DTRA 4L9VA 2QKMB 5CVUA 1MMDA 5GADJ 4A5MA 1SMYF 2XGEA 4Y7NJ 5LLQA 2XF5A 2Y48A 1T98A 2TCTA 4C3HJ 1TWGJ 3RKQA 2NS0A 1V55H 2RN7A 4LITA 1VQ8I 5D5WB 2L0KA 1QPIA 2DJNA 3OOPA 3HDDA 6PAXA 4BBSJ 2FQ3A 4PSXA 3I3LA 3KP7A 2VBWA 5J1UA 4MTDA 3QOPA 1B72B 1Z0XA 2X85A 3NRVA 3SFIA 2X1DA 3PO2J 3OL4A 1WJAA 1A36A 2K02A 3RDIA 5FD6A 3MFKA 2VQLA 5HS9A 3S15J 5KCMA 4ITVA 3OYGA 1V5FA 2VBYA 5F0CA 2GOXB 2H6CA 2IGMA 1T38A 2Q2EB 2V1UA 4ETSA 1HCRA 1QU3A 2KIFA 2IS4A 4HQEA 1K78A 2CG4A 2DFFA 3EDPA 3NWTA 4XNFA 5E3LA 3DXJF 3HC7A 2HXOA 2ID6A 2H8WA 4GFBA 2UUZA 1BC7C 5E8IA 3BDDA 4LLGF 4CCNA 5K5RA 1IRFA 3OSGA 1TLHB 2WWYA 4HSRA 5IOZA 3GFIA 2OD5A 2KFDA 1S8NA 4Y33A 1ZREA 2HS5A 1XGMA 3BQYA 1RESA 5GTHC 4DQ2A 1XMXA 3KP2A 1MZBA 4E7HA 4E7ZA 2M7AA 2B9SA 1G3WA 3BCAA 1FSHA 2ZMEB 4UVAA 4E7LA 1K61A 3RKXA 2KHMA 5L3DA 4FQGA 2E5ZA 5LEKA 1R36A 1U5TB 1QBJA 3DFGA 1HSTA 1W7PB 5FFZA 2HXIA 2H1KA 2DA2A 3M7GA 3LA7A 3TOBA 2COMA 3JRBA 3FM3A 1WHUA 4U0YA 4ASNA 3CCRI 1I3AA 1ZK8A 4QWQA 2FJ1A 2W00A 4IJAA 4BQOA 1HW2A 1REPC 2RAEA 3FXMA 2L5QA 2XAJA 5C3EJ 3KP4A 3QPLA 2OU2A 1I39A 2L7MP 1LJ9A 4IZZA 1XSVA 3GFJA 4HOBA 2M87A 1WVRA 2IXSA 2JJ7A 4G94A 4RGUA 4M71A 1Y8QB 3UKGA 3DWLE 1I3QJ 1HDDC 1TT0A 3I9V2 3HEFA 3K4CA 3PQKA 2ECCA 2RNJA 3F9KA 3ZQ7A 4UUSB 4J19A 2BHYA 5HOOA 3H3UA 3DLAA 2P7VB 1BR1A 4H0EA 3HTUA 3BG3A 4IO9F 3CCVI 1PP8F 2LF7A 1I1GA 5J8FA 2ZXJA 2WV1A 3R4KA 3S3OA 2OUMA 3HPGA 4KNYA 4LB6B 1FX7A 2YU3A 2PJRA 5HLIA 4YFNF 3DKWA 2MLKA 2K9MA 1F4KA 2OA4A 2R7ZJ 2Y30A 3BWGA 5IT9K 5BMZA 3GX4X 3L7WA 1JE8A 2WY8Q 2BV6A 3C18A 4ESJA 3BR3A 4D7MA 1W7PD 3ABTA 4BHPA 3WTXC 2FQ4A 1YRNA 5ICEA 2BHZA 3V42A 3S3NA 1YS7A 4B44A 2IW5A 3AFHA 2JUCA 1TNTA 2YX4A 3H9QA 4B1RA 2DT5A 3Q9VA 2OBPA 2OZ6A 2IA0A 1D3YA 2DCEA 1SAUA 2EZLA 3ZR8X 1XD7A 3J7YJ 1U78A 4HV5A 2QQBA 3RJPA 2CGPA 3BR2A 3FX3A 4OIRF 2EFWA 2ZXIA 3RQIA 1LPQA 1DP7P 2JA8J 1KQ8A 1Y1WJ 4G6DA 3HHGA 3MAJA 3R0JA 2E7XA 2XGDA 1O7FA 1RR7A 2CUZA 3W3CA
chains in the Genus database with same CATH topology
4RM2A 1Y6IA 2X51A 2WAFA 3HOSA 2VQCA 3CF2A 4Y3OA 4DGWB 3VDXA 1R6RA 2XAUA 3OS0A 4XLAA 3K70D 4C2TA 2LG4A 3DPLC 3EPZA 3K6GA 2CW7A 3DTEA 3QYEA 2DT6A 2R7OA 4BJ6C 3RSNA 4F92B 3OL3A 2VJIA 4U7BA 3AL0C 2R7SA 4LG3A 1UG0A 2CFOA 1WJEA 1MMNA 2GOMA 4II2A 5CPRB 4AVZA 4BE0A 2X1EA 1ERDA 2K5CA 4XR6A 4B3XA 4CCOA 3MKZA 2JVGA 2KLOA 3W2AA 2K3PA 3OYHA 1YX5A 3DKYA 4XN0A 4PJLA 4BE1A 4ANJA 2KRCA 1WJ5A 3CP2A 1FMVA 1TZLA 3OYFA 2CH0A 2FUG2 4BU2A 2P0WA 1WJBA 3EUHC 3HKZA 4E7JA 1EA3A 1X19A 1NG7A 2BW3B 4XKBA 3ZQQA 4HG2A 2CV0A 4BJTA 3KYLA 2WA0A 4JQFA 2V1NA 2OV7A 2VASA 2PMZA 3OMYA 4F52A 2W4SA 2Z1DA 4PFPA 4XOTA 4YELA 3RTRA 3VYSB 3VSLA 5HNHA 2LH9A 2A5WA 2RNGA 3OS1A 4AU7A 1X4PA 3D5RC 3PJRA 3D5SC 4HPQA 4XKCA 1WJDA 1X1AA 2XF6A 4BGDA 4XL9A 3TBIA 1LKXA 2CS3A 3RPUD 3H5NA 4PUSA 1UAAA 2W82A 4Y4RA 2E60A 2M0MA 4B43A 4R79A 1D1CA 4ZDOA 3A2KA 2IGOA 1MNEA 4E6KG 2CW8A 2DJIA 4XQFA 3K4KA 5KNLA 2PJRB 2MFZA 4BS9A 4LIVA 4U87A 3ZRGA 2VJ5A 4NUBA 4XLEA 1D1AA 4BEHB 3H35A 4BE2A 5LFAA 5FROA 3SYTA 4RLFA 4HNTA 2WB1A 3OYIA 3GBGA 3HG9A 4BUPA 2IS6A 1FMWA 3FKJA 2A6TA 3VWBA 2KDOA 3BG6A 3K70C 1D0YA 3OIPA 2V7FA 4PJNA 4BDZA 3H9GA 3D5LA 4EATA 4IX7A 4CH7A 5TGTA 3L2UA 1QHHD 3LSHA 3S8PA 3UNGC 4OWRB 2UV1A 2R7RA 4ZC3A 2XDVA 3G2BA 2JVHA 4C2UA 2KQRA 3CJRB 1X1CA 1Z3YA 3SZGA 2KPMA 2HPMA 5FRNA 1S9HA 3IAS2 2RREA 1W36D 3C2HA 2QKLB 3PNVA 3TMOA 4XLHA 4D1QA 4PFOA 2Y0SA 3DTKA 1E0EA 2Z2SB 3OYDA 3DTIA 3DU5A 3H0DA 3FDYA 4CSWA 4XKWA 3OY9A 4HRIA 5HVQC 3DU6A 4KJZA 3ZCOA 4XKVA 3BC8A 2X6XA 3EUKL 2E5NA 5JHFA 3AL0B 1J09A 1D0ZA 2O5RA 2WAEA 3DQVC 1G59A 2HVQA 2AQFA 4C30A 3OYMA 1N75A 2HVRA 5CQEA 4ZTFA 3HXLA 3LSGA 4F55A 4BJ5C 3OR1C 3C2GA 2R7QA 3IAM2 3E1SA 3VYUB 4XLCA 2WADA 3OYAA 2XF7A 2OC6A 3L2RA 1GLNA 4CA0A 3L2VA 1WJCA 3K4BA 2R7XA 3SEZA 3U21A 2R7WA 4E7KA 3LSKA 4ZDPA 4XN3A 4D9JA 4E7IA 1YE9A 3K4MA 2VQGA 3FBIB 1JI8A 1LFPA 1PYVA 1Z3XA 2V9KA 3K4LA 3UR3C 3IUOA 4BQQA 4II3A 2F5VA 3E0JB 3BG7A 3EUAA 3OYJA 2LY1A 2KP6A 3TL4X 4BL0B 2LY2A 1VZ0A 4XMYA 4ZDLA 2E1MC 2HZDA 1IRXA 5CQGA 4XORA 2IS1A 5KHDA 4OAZA 1G8XA 4P1WA 2R4GA 2KMUA 3OS2A 4XOPA 2VJJA 2LC2A 3H5AA 3ZXSA 3OYNA 4P5OA 1OR7C 3PNYA 3PFYA 2HNHA 2VJ4A 4ZJZA 4IQ4A 1DGRM 2WAQA 3PSIA 2Q1ZB 2BW3A 4B48A 2ZXHA 3L2WA 2HPIA 3K4JA 2LOOA 1V5GA 3FBNB 2F4IA 3DEEA 4DBRA 1DP3A 4NC8A 2KL4A 2K9LA 3CMMA 4YEJA 4CCKA 3HUGB 4RMNA 1YX3A 3LFUA 2BOLA 2WY7Q 5HNFA 1T0FC 3M1CA 2L7KA 1LDKB 2X6YA 1N77A 3BLYA 3OR2C 2JA2A 2VKDA 4BDYA 4J00A 4N4OB 2V4JC 4G6TB 2BVLA 4HSTA 1X4OA 1D0XA 1WFXA 2NOJB 2UWMA 2W1OA 4F93B 2RQQA 3LMMA 4DIQA 2VL8A 2R7VA 2WBMA 1X1BA 4XONA 2CMPA 3DKXA 1P9QC 2CV1A 3QYBA 1T95A 4IQJA 2LBFB 2VQHA 3IP4B 3HOTA 2W7NA 4BEHA 2QKMB 1MMDA 2VKHA 1ZELA 2F6CA 3K4NA 2XF5A 2IGKA 2AQEA 1BOBA 4LITA 3W2VA 3OWTA 2MABA 2HVSA 3OYKA 1N78A 4PSXA 3I3LA 4F91B 3AKZA 4XM3A 5CKTA 2VIXA 2X85A 2X1DA 4ZYAA 3OL4A 1U0JA 1WJAA 3S93A 2KZVA 2VQLA 2M3AA 3BCBA 3SDBA 2R7TA 4DBQA 5KCMA 4ITVA 4RLQA 3OYGA 1V5FA 3A4CA 2GOXB 1X1DA 2IGMA 3MKWB 2Q2EB 1MNDA 1Y56A 2XSJC 2L2OA 4RM3A 4CCJA 2DOAA 3MKYB 1QU3A 2IS2A 4N4NB 2IS4A 3PSFA 3NWTA 3N05A 4XNFA 4BACA 3HC7A 3H5RA 2UUZA 2ELJA 1QHGA 1BR4A 1SFKA 2ZSIB 3OYEA 4CCNA 4YRVA 4MLOA 3OYLA 3RCOA 1NG6A 4HSRA 2L9NA 2BVMA 2HQAA 1D1BA 4F3QA 4Y33A 3VYTB 4CUGA 3KEYA 1Z7LA 4QPQA 2XC7A 2M4GA 2VPLA 3S3MA 3QODA 2VB6A 4E7HA 4DOZA 3HPHA 2CV2A 3OYBA 3CP8A 3H9JA 4E7ZA 2M7AA 2I8DA 3BCAA 2ZFUA 2ZSHB 2HDWA 1UELB 2LREA 4E7LA 4BXFA 1KONA 2M7BA 2KHMA 5LD2C 3MD2A 3ONQA 2E5ZA 4PJJA 2V26A 2E1MB 3NWSA 1DGWY 4ZTJA 2V6EA 1WJFA 2L9SA 3QOEA 3PL8A 3CZ6A 3VYRB 4HNUA 3S32A 4GRIA 3LSMA 4E7SA 4AYBA 1PJRA 4PK4A 2R7UA 2W00A 4OAYA 3FHNA 4BQOA 2JSPA 2L5QA 4NC7A 2DXIA 3J7AY 1HA8A 1W36C 4QPOA 4NQWB 4IZZA 2DT7B 2JUGA 3K10A 4J01A 2IGNA 2KRHA 2X6WA 4FETA 2IXSA 2X1CA 3PUBA 3KX2A 2Z16A 2LYCA 5HLTA 3OOUA 3DWLE 1TT0A 3DPUA 3I9V2 5FRMA 1LVKA 1MMGA 3RQ4A 3K4CA 4DJAA 3F9KA 3CESA 5HOOA 3LSIA 2HU9A 2M4KA 3DLAA 1BR1A 4E4HA 4B47A 3M8JA 4FASD 2MD0A 1AA7A 2VXZA 4BQNA 2OUMA 4CCLA 1Z21A 3S3OA 3HPGA 2PJRA 3HL2A 3OYCA 1V5EA 2K9MA 3L2QA 3QYFA 4XLFA 4PSWA 2WY8Q 3CJQB 4C9YA 2MC4A 1BR2A 3OIQA 4HEA2 3PNTA 3ZGKA 3SEQA 4KISA 4CZCA 3V42A 3S3NA 2MYSA 4B44A 4KITB 3AFHA 3MMYB 3H9QA 4NNJA 3A1YA 3DPTA 4H4KC 4JOMA 2VXDA 2DCEA 2LRDA 1SAUA 3VSKA 1DQUA 3ZR8X 3W2WA 2VLAA 4KT6A 2ZXIA 4IKFA 2LBFA 1K6YA 1MMAA 4CCMA 1OLTA 4LIUA 3LL7A 4X0GA 2CUJA 4PJMA 1MW7A 2CUZA 3W3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OV7 A;  2OUM A;  2VPL A; 
#chains in the Genus database with same CATH topology
 5JVT A;  4RM2 A;  1FYL A;  2H1L A;  1XN7 A;  5LEJ A;  3CF2 A;  4DGW B;  3C7J A;  3OS0 A;  3K70 D;  4C2T A;  3KE2 A;  4M3D A;  2NVQ J;  3EPZ A;  1MGT A;  2CFX A;  1LFB A;  1R9T J;  2R7F A;  2R7S A;  1BI2 A;  1VQK I;  3BZ6 A;  1WQ2 A;  1MMN A;  1P7J A;  5M5Y J;  1ERD A;  2L7F P;  2K5C A;  1GV5 A;  3G1M A;  3MKZ A;  4EGY A;  2JVG A;  1MNM C;  3OYH A;  4HLY A;  1OJL A;  4GCV A;  4XK4 A;  1RUN A;  3KZI C;  2FMY A;  2KIU A;  4BE1 A;  4U7D A;  1D5Y A;  2NVT J;  3V7R A;  1VQ4 I;  1HBX G;  1S3J A;  2DA7 A;  2CH0 A;  1DPU A;  2FUG 2;  1OYW A;  3KYC B;  1LEB A;  4RAG A;  1A6Q A;  3EUH C;  1T33 A;  3ASN H;  3RZD J;  3BTC A;  1X19 A;  1NG7 A;  2RQP A;  4XKB A;  3ZQQ A;  2D2W A;  5FKM A;  1TWC J;  2CV0 A;  2STW A;  2HOE A;  4A6D A;  4ENJ A;  2HKX A;  1QVT A;  2YSR A;  3OMY A;  3PM1 A;  1AU7 A;  4OIQ F;  5LBQ A;  3RTR A;  4KMF A;  2FBI A;  2O61 A;  2XB5 A;  2FRH A;  2GLO A;  2HWV A;  2EA2 A;  1UHW A;  2ZME C;  3DP7 A;  1AOY A;  2DYS H;  2RNG A;  2TDX A;  4AU7 A;  2YX7 A;  4EMS A;  3O6B B;  3WHC A;  1U5T C;  2W25 A;  2Y69 H;  1G4D A;  4XKC A;  3LSJ A;  4CGZ A;  4HF0 A;  1X1A A;  2XF6 A;  3ISP A;  1B4A A;  1ZLK A;  2HEO A;  1S7A A;  3H5N A;  4FTH A;  2W82 A;  2QM3 A;  2FML A;  3G4S I;  4Y4R A;  2E60 A;  4NB5 A;  1JTY A;  4RB2 C;  3ZMS A;  1FWZ A;  1PUE E;  3ZMU A;  1SFE A;  4R1H A;  3SDG A;  3WU0 A;  5F0H A;  3A2K A;  4ZDO A;  1WI3 A;  1MNE A;  4XQF A;  5KNL A;  2PMU A;  2NXN B;  5D4R A;  3NAR A;  2L4A A;  4FHT A;  1ZRC A;  5DD8 A;  2ELH A;  3QAH A;  2FBK A;  4XLE A;  1P4X A;  4BEH B;  3JTG A;  3GLX A;  1S29 A;  5H2F C;  3U9G A;  3SYT A;  5DEQ A;  1R58 A;  5E3M A;  3P9I A;  1ZH5 A;  4A3D J;  5TRD A;  2IS6 A;  1HKS A;  1FTT A;  3BR6 A;  2MH2 A;  5HDK A;  2XRN A;  3CUQ A;  2CYY A;  4QSH A;  2GM4 A;  1Z91 A;  3K70 C;  1F43 A;  1D0Y A;  1OCP A;  4BDZ A;  2XVC A;  2OJE D;  4UUV A;  3G1L A;  5FLM J;  4M9X A;  3UNG C;  1IDY A;  1XDU A;  2F5C A;  2R0Q C;  5IOY A;  3W6V A;  2HR3 A;  3W6J B;  1C0W A;  2XDV A;  2IRF G;  4EJO A;  2JVH A;  3TP3 A;  4C2U A;  1TBX A;  1G3S A;  3CJR B;  1Z3Y A;  4LJZ F;  2M0C A;  4Z2Y A;  1X2N A;  2E71 A;  2KPM A;  1S9H A;  3IAS 2;  2RRE A;  3CO6 C;  2HPM A;  2QBY A;  3LA2 A;  3ZQF A;  3ERM A;  4XLH A;  1B6A A;  5EZH A;  4IHV A;  4DZJ A;  1SFX A;  1EH8 A;  3DTK A;  1MSF C;  3BG9 A;  2Y9Y A;  4DYQ A;  3CJN A;  4I2O A;  5FLX K;  1VI0 A;  1W5C C;  4CSW A;  3MVP A;  4Q47 A;  3FXQ A;  4HRI A;  5HVQ C;  3MWM A;  4KJZ A;  3K1N A;  4A3C J;  3EUK L;  5JHF A;  2XAQ A;  3TW7 A;  5DM7 F;  5K7Z A;  3C3W A;  3U1K A;  4C3J J;  2O5R A;  2WAE A;  4YFX F;  3CMY A;  2HVQ A;  3F21 A;  4RGS A;  1HOM A;  4I76 A;  2HVR A;  4Q5S F;  2CRG A;  2JA7 J;  2R5Z B;  1IF1 A;  1OYY A;  4ENK A;  1P92 A;  3KEQ A;  1K83 J;  1BC8 C;  2CQX A;  1KZH A;  1VQO I;  3HBL A;  2PMZ N;  3MKL A;  3RPU A;  2L9V A;  2EIL H;  3OYA A;  2RVC A;  2OC6 A;  4CA0 A;  4RB3 C;  5F6F A;  1AHD P;  1JKO C;  3BG5 A;  2JT1 A;  3H3Z A;  1VQ9 I;  4GXO A;  2BYV E;  4D9J A;  4ZYD A;  3K4M A;  2H8R A;  2JQ7 A;  1XSX A;  3FBI B;  1ON2 A;  1JI8 A;  2VOD A;  1TP4 A;  1PYV A;  2AXL A;  5E1Z B;  1J5Y A;  1FY7 A;  1ZTR A;  2GZW A;  3M8E A;  3LQR A;  2KZG A;  2XV4 S;  5JI6 A;  3ECH A;  3V8J A;  2FNA A;  2DW4 A;  3TL4 X;  4BL0 B;  3O3K A;  4XMY A;  2E1M C;  4I09 A;  1BJZ A;  3ASO H;  2R4G A;  4M6Y A;  5CLS A;  2VJJ A;  3ZXS A;  5EZG A;  4P5O A;  5EGO A;  3ELK A;  3CQZ J;  2VJ4 A;  3HM5 A;  5E20 A;  2WAQ A;  3PSI A;  4LFU A;  3M8F A;  4N9H A;  2BW3 A;  4BH9 A;  1BOA A;  1OR7 A;  2F5F A;  1ZKG A;  2F4I A;  2K27 A;  5IYC J;  1DP3 A;  2FNP A;  3GFM A;  2KL4 A;  2K40 A;  3X2Q H;  1UB9 A;  4CHU A;  4ZH4 F;  1YX3 A;  1RR8 C;  2WY7 Q;  5HNF A;  2EV0 A;  3R0A A;  2E2I J;  1PVE A;  4AC0 A;  2EIM H;  1YRN B;  1YIJ I;  4FCY A;  5F0F A;  3CO7 C;  2JA2 A;  4J00 A;  2E7W A;  3TOA A;  3E5U A;  1UHS A;  1IGN A;  1X4O A;  3OV8 A;  2NOJ B;  1JKR C;  3IL2 A;  2UWM A;  3N4M A;  3GVA A;  3R60 A;  1YFH A;  1JJ6 C;  1HKT A;  1ZG1 A;  3I59 A;  1Z67 A;  2IVM A;  2VL8 A;  4I0B A;  3F6O A;  2JWT A;  2CMP A;  2CV1 A;  5BNG A;  3H1C A;  4P96 A;  4L0Y B;  5LHG A;  1UZC A;  3DF8 A;  5IT9 Z;  2EFQ A;  2VQH A;  3GEZ A;  3IP4 B;  3HOT A;  2CWE A;  4B09 A;  5K5O A;  2VKH A;  3H36 A;  3K4N A;  1LB2 A;  4EQQ A;  2GQQ A;  5LHH A;  1A35 A;  3A0B C;  2FX0 A;  2DTZ A;  1JTX A;  4GYG A;  1U9N A;  2AQE A;  1BM9 A;  1SC7 A;  2LKP A;  3ZMZ A;  2HVS A;  1H8A C;  2BEO A;  1MKM A;  2QQ9 A;  4F91 B;  2D1V A;  5JLX A;  3P9K A;  1A6I A;  4M3B A;  4XM3 A;  5DYM A;  4YFK F;  3PUF A;  4ZYA A;  4KA4 A;  3S93 A;  5E3O A;  1EH7 A;  3SDB A;  4DBQ A;  3Q0U A;  4BXX J;  4JP0 A;  1V3F A;  1Y0N A;  1GUU A;  2Q8K A;  4L9T A;  4IEJ A;  4OMZ A;  4X1E A;  2XGX A;  5B1B H;  2DOA A;  5FKK A;  2D45 A;  3N05 A;  4BAC A;  1ETO A;  3P7N A;  3KZY A;  2O0Y A;  3H5R A;  5A2Q K;  3GUD A;  1BIB A;  2O8X A;  3CLQ A;  3FWE A;  1BR4 A;  4HZF A;  3CDH A;  5FKO A;  2ZSI B;  5IP9 J;  3OYE A;  4LLN A;  4MLO A;  1OMI A;  2N8G A;  3BR1 A;  1ZR2 A;  3DV8 A;  3WGH A;  2HQA A;  1O3S A;  1AKH A;  1JHH A;  3MQ0 A;  3BOQ A;  4WF2 A;  4FE7 A;  4G9Y A;  3MEX A;  3A01 A;  5DCM A;  5BS6 A;  1WPK A;  3PFI A;  5B1A H;  4DOZ A;  3H9J A;  4LG0 A;  3K1M A;  4HLX A;  2ZFU A;  2FD5 A;  4LOC A;  1GDT A;  2HDW A;  1KON A;  2F4M B;  5LRS A;  3BR0 A;  5EEG A;  5IT3 A;  3WTS C;  1O4X A;  3ONQ A;  4MFE A;  4A6E A;  2HFH A;  2E1C A;  5F04 A;  4HDU A;  2V6E A;  1DGW Y;  1I27 A;  4A69 C;  4DYR A;  4ESF A;  1CGP A;  2YU9 J;  3S32 A;  2MD5 A;  1IXS B;  4XIC A;  3JRD A;  1PJR A;  1EKE A;  1J75 A;  5DTD A;  1HDP A;  2G9W A;  3IC7 A;  5L3B A;  3VFZ A;  3WHB A;  3H3V K;  1HA8 A;  1UMQ A;  1W36 C;  3I64 A;  3CCL I;  3FXR A;  4KDP A;  2DK5 A;  4MGR A;  3DLL F;  2XB0 X;  3CUQ B;  2IGN A;  4FET A;  5DDG A;  5F1J A;  2Y31 A;  2HTS A;  2X1C A;  2CQN A;  1LNW A;  4OIN F;  1HC8 A;  1G3T A;  1JKQ C;  4DJA A;  2JPC A;  1IUY A;  3FHZ A;  2R5Y A;  1EV7 A;  5H6R A;  3CME I;  3I71 A;  1O7L A;  1NH3 A;  1RZ4 A;  2PQ8 A;  1QVU A;  4E4H A;  3WTY C;  3FXJ A;  4LMY A;  4D7N A;  4B47 A;  3JRF A;  3M8J A;  5J6X A;  1IRG A;  1QO0 D;  3LSP A;  1JGG A;  2VXZ A;  3EET A;  1FEX A;  2QBY B;  3F72 A;  4KYW A;  1NTC A;  2W84 A;  4LK1 F;  5BPI A;  3AAF A;  4AWX B;  1ZYR F;  2HKO A;  3DBR B;  3QYF A;  1RIO H;  4PSW A;  3QPH A;  3ZOB A;  1J2X A;  4A5N A;  4WXH A;  5M3M J;  3QPS A;  1XGN A;  4C9Y A;  2MC4 A;  1MBF A;  3K1P A;  3I56 I;  5JVG F;  4ESB A;  3PNT A;  3ZGK A;  3SEQ A;  3SQN A;  1MBG A;  1IDZ A;  1WWX A;  4AD9 A;  3A1Y A;  3DPT A;  1ZGW A;  2GAU A;  4JOM A;  1FT9 A;  1TW3 A;  2XPV A;  5L3G A;  2BY3 A;  2VXD A;  5CVV A;  4ZYG A;  4OOI A;  3IHU A;  1F5T A;  3GYH X;  1DQU A;  4MNU A;  5E17 F;  5IYD J;  5ED4 A;  4IKF A;  3I4P A;  1SMT A;  1IW7 F;  1OLT A;  2JRM A;  4L9J A;  5B5E C;  2R3S A;  2Q0O A;  5FLX Z;  2W48 A;  1TNS A;  2QQA A;  1B9N A;  4X0G A;  2VUM J;  1X1P A;  4U0V A;  1SVO A;  2COB A;  1Y6I A;  3LSR A;  5FB2 A;  2X51 A;  1KA8 A;  2DDA A;  4UB6 C;  3G1O A;  1OCZ H;  3DBL B;  2VQC A;  4Y3O A;  1FBU A;  1L0O C;  1R6R A;  3VDX A;  2V1D A;  5DD4 A;  2XPU A;  1DUX C;  2LG4 A;  3Q5F A;  3F6V A;  1UFM A;  2OF7 A;  3JRG A;  3QYE A;  2DT6 A;  1XSD A;  3OL3 A;  2PEX A;  4U7B A;  4WXD A;  2XKP A;  3HSF A;  5F1R A;  1DU6 A;  2DPU A;  2M1B A;  5CPR B;  1FLI A;  1YOV B;  1W5S A;  4OMY A;  4CCO A;  1J9I A;  3F23 A;  2XAS A;  1V54 H;  3W2A A;  2A68 F;  2K3P A;  3GZN B;  2G0E A;  3CC7 I;  3DKY A;  4N0B A;  2L4M A;  1JUS A;  3GME A;  2KRC A;  1UHM A;  3TP0 A;  4M3E A;  1W5T A;  3EYY A;  2R5Z A;  2WC2 A;  4G7Z F;  1H9G A;  5EGO B;  3S1Q J;  1ETK A;  1WJB A;  3CJT B;  3CCJ I;  4E7J A;  3QU3 A;  3EYI A;  3KP3 A;  2X48 A;  4KUM A;  5F64 A;  2BW3 B;  4HG2 A;  4M9S A;  2ME0 A;  2Y75 A;  3MZ8 A;  3KYL A;  1POG A;  4F52 A;  2W4S A;  3QWL A;  2GIV A;  4BAY A;  4YEL A;  2DMN A;  3S17 J;  1FPQ A;  2I5U A;  4KIC A;  2BXY A;  1X58 A;  1BL0 A;  3Q0V A;  4EM0 B;  3D5R C;  3B73 A;  4B4C A;  5E79 C;  5L3C A;  3BP8 A;  1WJD A;  2JN6 A;  2K7L A;  3WU2 C;  4XL9 A;  1LKX A;  2CS3 A;  2DOD A;  2J5O A;  3ML6 A;  3RPU D;  3PIP F;  3ZQC A;  1VQ5 I;  4V2G A;  1SD6 A;  3HRU A;  2MC3 A;  1VQ7 I;  1IXC A;  1Q1V A;  2M0M A;  2VE9 A;  3I59 B;  1D8J A;  1SEU A;  2IGO A;  2EIK H;  2DJI A;  1WH5 A;  2DI3 A;  2MFZ A;  3GTO J;  4LB5 A;  3GZ5 A;  2FBH A;  2VJ5 A;  4NUB A;  5KAI C;  1S7E A;  3T8T A;  1IO2 A;  2A05 A;  5ICG A;  4HX4 A;  1IRZ A;  1RKT A;  4S0H B;  5FRO A;  4PCQ A;  3K2A A;  4RLF A;  1SAX A;  2WB1 A;  2VI6 A;  3OYI A;  1ZR4 A;  4JX6 A;  3KYD B;  1DDN A;  2UXX A;  4BUP A;  5M5W J;  2XGC A;  5C4X J;  1IN4 A;  1MIJ A;  2B63 J;  3GTK J;  3FMS A;  4A3E J;  3VWB A;  4V19 K;  2DLL A;  3OIP A;  5GAE J;  1XPX A;  2ZKZ A;  3H9G A;  4IHX A;  1HQC A;  4L9N A;  2ZBK A;  1IJW C;  4EAT A;  4CH7 A;  3E6D A;  3L2U A;  3HB9 A;  1ULY A;  3LSH A;  4ENN A;  4D0P A;  3I55 I;  3V4G A;  2UV1 A;  3K69 A;  2BY2 A;  4ZC3 A;  2M34 A;  2ECB A;  2IAI A;  3G2B A;  4A3F J;  3ZN1 A;  3QRF F;  4U88 A;  3I5U A;  2KQR A;  1X1C A;  3SZG A;  2F5E A;  5L3F A;  2V9P A;  2K85 A;  3C2H A;  3L9F A;  3PNV A;  2LKS A;  2DFE A;  4PFO A;  1RC9 A;  1APL C;  2Z2S B;  3OYD A;  2A3S A;  3SZP A;  4QIW N;  2QUF A;  2A07 F;  4NHJ A;  2QCO A;  3FDY A;  2IEK A;  2ZXW H;  1KU9 A;  2XKO A;  4B3A A;  1TL8 A;  1AKH B;  4A3G J;  4D5C A;  1YIT I;  3BC8 A;  1GV2 A;  3A01 B;  3AL0 B;  5DCM B;  1J59 A;  3HRT A;  1A5J A;  4L5E A;  1P4A A;  2AQF A;  2JPB A;  4LG0 B;  2V9V A;  3SZT A;  3OYM A;  1MH3 A;  3JRI A;  3E6C C;  1LDD A;  5KK1 A;  3LSG A;  4F55 A;  3FMQ A;  4BY7 J;  1MD0 A;  5A2Q Z;  1RRJ A;  2ZJQ F;  3C2G A;  1VND A;  3IAM 2;  2DA6 A;  1XCV A;  5H20 A;  1HXD A;  2GXG A;  3SEZ A;  4IPA A;  1ITY A;  4ZDP A;  4PGG A;  3JSO A;  3NQO A;  2LLK A;  4A93 J;  3R61 A;  2BZT A;  3JRA A;  1Z7U A;  4XN3 A;  4E7I A;  1MBJ A;  1W4M A;  1YE9 A;  4CIC A;  1RUO A;  2VQG A;  4U0W A;  2HYF A;  2BE5 F;  4MIM A;  4AIJ A;  2QSH X;  2X4H A;  4IOA F;  2VOP A;  1LFP A;  2GIZ A;  2IBD A;  4P55 A;  2V9K A;  1JKP C;  3UR3 C;  4ENM A;  2E1O A;  4G6Q A;  4BQQ A;  4WK8 F;  3EUA A;  3OYJ A;  2HYJ A;  3LWF A;  3FK7 A;  4L5I A;  2VT3 A;  5JLW A;  1LFU P;  4F7Z A;  2DMT A;  2OCE A;  3WG7 H;  3HOW J;  4RGR A;  3JAM K;  2LY2 A;  5EDN A;  1B59 A;  1GXP A;  1IRX A;  2EZI A;  2R5Y B;  5CQG A;  4DNC A;  2A61 A;  2IS1 A;  1G8X A;  2GWR A;  4IRG A;  2E19 A;  2GBY A;  1FP2 A;  5H6Q A;  5LRR A;  4XRS A;  3OS2 A;  4CDG A;  1KYZ A;  1FBS A;  1OR7 C;  3PNY A;  2P6T A;  1TT5 B;  1QQI A;  3IKV A;  3JCU C;  3AG2 H;  5ERI A;  2Q1Z B;  3B6C A;  3E7L A;  4O5V A;  5IY5 H;  1MDM A;  4BQA A;  3BPV A;  3K4J A;  2EQR A;  5ILU A;  2LOO A;  3FBN B;  3DEE A;  2K86 A;  4EM1 A;  1I5Z A;  2CW0 F;  1BBY A;  3FIS A;  2C6Y A;  5K7F A;  2K9L A;  4C3I J;  1YG2 A;  1QGP A;  1KU2 A;  1KYW A;  3ABM H;  3HUG B;  1ZAR A;  2BOL A;  1R4M B;  2NVU B;  1A04 A;  2DOE A;  2D1H A;  3QQA A;  1QZY A;  2DK8 A;  3M1C A;  2GXB A;  1IUF A;  1YJW I;  3RKY A;  1N77 A;  3BLY A;  2HTJ A;  5GPA A;  5L3E A;  4BDY A;  3J7A O;  1PUF B;  5J8C A;  3F8B A;  3BZC A;  4FX4 A;  3J81 K;  2LTP A;  1FBQ A;  2DMU A;  2W1O A;  2RQQ A;  3LMM A;  3J80 K;  2R7V A;  1ODD A;  1HF0 A;  1X1B A;  2EH3 A;  3FZV A;  4UY8 I;  3DKX A;  1P9Q C;  2H6B A;  1ETV A;  1QPM A;  2K3F A;  2W7N A;  1MSE C;  2XIG A;  2YPR A;  2DO7 A;  3AG1 H;  3E5Q A;  3FXL A;  3M9A A;  4WCG A;  3AG4 H;  1ZEL A;  3T8R A;  3ZN0 A;  1VQP I;  4LLL A;  5K7H A;  1I50 J;  3K2Z A;  3ZQG A;  2IGK A;  5CYV A;  4NDL A;  2KIM A;  4FIS A;  1FOW A;  1WSU A;  1K6O A;  4OIP F;  1Q1H A;  2DN0 A;  3OWT A;  3ABK H;  1CF7 A;  1FIP A;  3KLO A;  2ETH A;  2M45 A;  3OYK A;  1N78 A;  3MN2 A;  1HSJ A;  3G6E I;  1QZZ A;  3RKW A;  4CYC A;  3AKZ A;  2CQK A;  1E17 A;  5ILS A;  5CKT A;  2VIX A;  3H92 A;  3JSP A;  2DFH A;  3BT9 A;  1R1T A;  4XRS G;  2CQQ A;  1U0J A;  4EJU A;  3WTW C;  3FM5 A;  4IHY A;  1I6H J;  3BCB A;  5F27 A;  4RLQ A;  3A0H C;  1X3W B;  4ZYE A;  5EEA A;  2CQ7 A;  1X1D A;  3BRO A;  1TQP A;  1Y56 A;  4E70 A;  4CCJ A;  1U3E M;  1Y8R B;  1LEA A;  2IS2 A;  3FF5 A;  4N4N B;  2O3F A;  1TWA J;  2ZO4 A;  4L0Z B;  2ELJ A;  3ERE D;  3GFL A;  1SFK A;  4HX7 A;  3OYL A;  5D6F A;  1NG6 A;  2FU4 A;  3GWZ A;  2BVM A;  4HX8 A;  1D1B A;  4F3Q A;  3CC4 I;  3VYT B;  1W0T A;  4CUG A;  3WOD F;  2XC7 A;  1M1E B;  3TKY A;  3MZH A;  3S3M A;  3E5X A;  3QOD A;  3QP5 A;  3O8H A;  1J0R A;  3CCS I;  4RAZ A;  3RI4 A;  3OYB A;  2CV2 A;  2H27 A;  2MGQ A;  1ZN2 A;  3PIO F;  5FO5 A;  4I01 A;  2I8D A;  1Z6T A;  1D8K A;  1SVM A;  2LRE A;  4GDF A;  2WAQ N;  3FXU A;  4D5F A;  1YYV A;  5LD2 C;  4PJJ A;  3REO A;  3SJM A;  3BQZ A;  2IA1 A;  3C2B A;  1U6G A;  3NWS A;  1WJF A;  2L9S A;  2LDU A;  4PDK A;  4ZTJ A;  2MW8 A;  2MA3 A;  3CZ6 A;  2ZC2 A;  3MZY A;  4HNU A;  2LY9 A;  4IF4 A;  4GRI A;  3HZJ A;  3LSM A;  4AYB A;  5C4J J;  5J1R A;  3TO6 A;  2R7U A;  2EFN A;  5C44 J;  3FHN A;  1SFU A;  1OPC A;  4NC7 A;  2VT2 A;  2K4B A;  2VON A;  4I7H A;  3ZMT A;  1JT0 A;  2CU7 A;  4BKX A;  3G71 I;  3K10 A;  4J01 A;  3LA3 A;  3BTI A;  4P9F A;  2HQN A;  3IRQ A;  2O7O A;  2X6W A;  1IN7 A;  1QA6 A;  4A3M J;  2DAO A;  3PUB A;  1YTY A;  3OOU A;  1X3Z B;  4EEF G;  3O2P E;  1OYI A;  3CES A;  3IWF A;  4PGH A;  3LSI A;  3IH3 A;  5FKN A;  1H89 C;  2M4K A;  4CYD A;  3VPR A;  3HRS A;  3T5X A;  5IP7 J;  4Z6Y A;  2PBI A;  1IV8 A;  4K2E A;  2R7D A;  3F0C A;  1YHQ I;  4FAS D;  2MD0 A;  3DCF A;  3NAU A;  2CJJ A;  4LK0 F;  2EV6 A;  4CCL A;  2Z99 A;  1ZG5 A;  1QNT A;  2EK5 A;  3MCZ A;  1MJ9 A;  3HL2 A;  1ZAO A;  4RGX A;  4JX5 A;  1R22 A;  5AIQ A;  3V7S A;  3OYC A;  1V5E A;  1ZG3 A;  3L2Q A;  1EJ9 A;  2KJB A;  2HZT A;  1N25 A;  4A3I J;  3GTG J;  4G7H F;  2HGC A;  2KJC A;  2KT0 A;  5ICF A;  1R71 A;  2PG4 A;  4HEA 2;  5BQT A;  4HNV A;  1RPW A;  4CZC A;  2E2H J;  1R5I D;  4M9Z A;  2MYS A;  4KIT B;  1Y1V J;  4NNJ A;  4H4K C;  4A3K J;  2JA5 J;  1LUJ B;  2M30 A;  4A3B J;  2LRD A;  2HOT A;  2Z5U A;  3VSK A;  1VTN C;  5ILV A;  3GXO A;  3W2W A;  3KP5 A;  2NVX J;  3I4N J;  4KT6 A;  2LK2 A;  3ZQH A;  2LBF A;  5GP9 A;  1VQ6 I;  2BXZ A;  1MMA A;  3KFW X;  1R5G A;  2P81 A;  2RC4 A;  4MEX F;  2CUJ A;  2CFO A;  4PJM A;  1MW7 A;  3W6K B;  3HOY J;  2AO9 A;  2P5V A;  4CXF A;  2BGC A;  3I53 A;  2MBF A;  3HOS A;  1RNL A;  3ABL H;  2RGV A;  3Q3S A;  1T08 B;  2DFI A;  4XLA A;  1WZ2 A;  2JTV A;  3P9C A;  2ID3 A;  3K6G A;  4PZJ A;  2CW7 A;  4YIR X;  1FYM A;  3ZPL A;  3GTM J;  3GTJ J;  4BJ6 C;  3RSN A;  4F92 B;  2VJI A;  2EIJ H;  1KU7 A;  2L54 A;  2FF4 A;  4IHW A;  1WJE A;  1XG1 A;  3HOU J;  4QLC U;  1G6N A;  2XUB A;  1T6S A;  4BE0 A;  3HRM A;  2ZFW A;  2DPD A;  3TQN A;  1GXQ A;  1CQT A;  1SD7 A;  2KKO A;  4HA8 A;  2EA4 A;  1MH4 A;  3FIW A;  3FXK A;  4XN0 A;  4PJL A;  4ABZ A;  2D5V A;  2E34 A;  4WWC A;  3WGI A;  3CP2 A;  3S1R J;  4LGW A;  4GO1 A;  1TTY A;  4AIH A;  4BU2 A;  1BW6 A;  4I6Z A;  2QZ8 A;  2DMQ A;  1XDS A;  5CVI A;  2DA3 A;  2H09 A;  1MDM B;  3S2H J;  5HS8 A;  5CVJ A;  2X6O A;  2ZJ2 A;  4XSX F;  4BJT A;  4IHT A;  4A0X A;  2EB7 A;  1WCM J;  3O8G A;  4PFP A;  1TWH J;  3S1N J;  1R5H A;  4XOT A;  2STT A;  4EJV A;  3VEP A;  4Y17 A;  3JAM Z;  2DOF A;  1O3T A;  2A5W A;  3OS1 A;  1ACI A;  3PJR A;  2E1N A;  3D5S C;  4HPQ A;  4BY1 J;  3COA C;  3F8F A;  4EVI A;  2QQ8 A;  3S1M J;  1TQM A;  2WV0 A;  1E3H A;  2KDZ A;  3VOE A;  1UAA A;  1ZGA A;  2OCC H;  4R79 A;  3JTH A;  3F8C A;  3G3Z A;  1J7K A;  1D1C A;  4XID A;  4W1U A;  4EV0 A;  2CW8 A;  4KN4 X;  4BS9 A;  2K4J A;  2EV5 A;  3ZRG A;  3FMR A;  2HDD A;  2ME6 A;  1BN5 A;  1D1A A;  4BE2 A;  4BBR J;  2XHK A;  4HNT A;  1GHC A;  5LGN A;  2O6G E;  5M5X J;  4KFC A;  2KRF A;  5B3S H;  4EM2 A;  1SD4 A;  2HYG D;  4HYE A;  4NQW A;  3JR9 A;  5HLH A;  3KLN A;  1IXR C;  2GA2 A;  4O3M A;  3HUG A;  3J81 Z;  1CF7 B;  4XBF A;  1JUP A;  2DQL A;  3WGG A;  3K0L A;  4PJN A;  3D5L A;  5ICC A;  1ETY A;  4R8H A;  4IX7 A;  3QP6 A;  4CYC B;  5TGT A;  2NRA C;  1FOX A;  5E18 F;  1R00 A;  1QHH D;  2XAG A;  3HOX J;  2EZK A;  1H88 C;  2Y0S N;  4G8X A;  1PUF A;  2R7R A;  2VPR A;  1P7I A;  2JA6 J;  5DS9 A;  1FOK A;  2A6E F;  1U8B A;  2PN6 A;  3KEO A;  1F36 A;  1RKW A;  4KN7 X;  4G7O F;  5FRN A;  5HS7 A;  5D5U B;  2ESH A;  2F2E A;  5D6E A;  2QKL B;  1XS9 A;  1Z77 A;  2XAF A;  2IT0 A;  3E97 A;  4D1Q A;  2Y0S A;  1E0E A;  4CO8 A;  3BJO A;  1BA5 A;  2IA2 A;  2RDP A;  5FJ8 J;  3WTZ A;  3DTI A;  4UV9 A;  1E3O C;  4S05 A;  4AIK A;  3KET A;  3QU6 A;  3CDI A;  5LGT A;  3ROU A;  1EF4 A;  4XKW A;  2EIN H;  5EG0 B;  3OY9 A;  2R93 J;  1JHF A;  3ABU A;  3L2C A;  3ZCO A;  2GA1 A;  4ZYH A;  2LVS A;  4XKV A;  3IV5 A;  2X6X A;  4PJ0 C;  1Y39 A;  2E5N A;  2L9R A;  1Z6R A;  4HAM A;  1UST A;  2OAZ A;  1J09 A;  2DBB A;  3M1E A;  5FD5 A;  3DQV C;  1G59 A;  3TO9 A;  4C30 A;  1ETX A;  1N75 A;  5B66 C;  4A3J J;  3F8N A;  3PO3 J;  1BI0 A;  1X3U A;  2PI0 A;  2VBZ A;  3HXL A;  2G7U A;  4BJ5 C;  3OR1 C;  4IRI A;  2M8E A;  2EPF A;  2ICW G;  2W57 A;  3VYU B;  2M2E A;  2WAD A;  5D4S A;  2XF7 A;  3L2R A;  3JRC A;  1X2M A;  1WJC A;  2R7X A;  5CJ9 A;  1UJ8 A;  2NOG A;  3U21 A;  2R7W A;  4E7K A;  3C1D A;  3LSK A;  1U8R A;  4BXU A;  2Z33 A;  1LQ1 A;  3M07 A;  5GAG J;  3QPT A;  2P5L C;  3LST A;  4WXC A;  5D8L B;  1I6X A;  1Z3X A;  1E3P A;  1P4W A;  3IUO A;  2NNY A;  2F5V A;  2IJL A;  2LY1 A;  2KP6 A;  3GW2 A;  4FT8 A;  1SAN A;  1T39 A;  5K5Q A;  5BOX A;  1XC5 A;  3RYP A;  2NVY J;  1EH6 A;  1KGS A;  1P2F A;  4ZDL A;  1ORK A;  1WGX A;  3DBH B;  2M5W A;  3P5J A;  5HDN A;  3S14 J;  1ETQ A;  4JBA A;  4XOR A;  5KHD A;  3JRE A;  2LD5 A;  5GAH J;  2Z9O A;  3K9T A;  3HGY A;  3GZ6 A;  1YI2 I;  4XOP A;  2LC2 A;  2OZU A;  3OYN A;  2WB1 N;  2IPQ X;  1LE8 A;  4YII A;  1OQY A;  4IQ4 A;  1DGR M;  2HOS A;  4B48 A;  2VC0 A;  2ZXH A;  1VF9 A;  2HPI A;  3I0T A;  2E36 A;  2NYX A;  1L3L A;  1V5G A;  1R4N B;  3GTQ J;  2E35 A;  1BJA A;  3ZQL A;  2QSF X;  4MTE A;  3WG9 A;  4NC8 A;  2HQ5 A;  2QGU A;  4RB1 A;  2PJP A;  4YEJ A;  5D8K B;  1O3R A;  1YJN I;  2B7E A;  2O8K A;  1STZ A;  2LSO A;  2LFB A;  4RMN A;  1D5V A;  3LFU A;  3CUQ C;  1WH7 A;  2A5Y B;  3AG3 H;  5GTI C;  2L7K A;  2P4W A;  1OKR A;  1LDK B;  1MJA A;  4N9I A;  4UXN A;  4IOC F;  1FNN A;  1Z1D A;  1IAW A;  5J47 A;  3OR2 C;  1T0F A;  4JK1 X;  3IH4 A;  3F22 A;  4I99 C;  4N4O B;  4G6T B;  2BVL A;  3HJE A;  4HST A;  4MHG A;  1WFX A;  3T1B A;  2FE3 A;  4M3F A;  3CTA A;  2X9D A;  4F93 B;  5EYR A;  1GVD A;  1W0U A;  4KIB A;  3JW4 A;  3V8L A;  1XB4 A;  4MQV A;  3QYB A;  2JSC A;  3U1D A;  1DPR A;  5F08 A;  2LBF B;  5IYB J;  4A12 A;  3S16 J;  2JRT A;  1A31 A;  1NK2 P;  3BR5 A;  4UB8 C;  2F6C A;  1U9O A;  1ZRF A;  1VFC A;  2ZJR F;  5FKL A;  2FEZ A;  4V2F A;  3D0S A;  2QF7 A;  3J7Z I;  5J40 A;  3IRR A;  3CCQ I;  1BOB A;  3CCY A;  1S7O A;  4DW6 A;  3W2V A;  2LP0 A;  2MAB A;  2O03 A;  1FP1 D;  4OU0 A;  1WI9 A;  4P9U A;  1FIA A;  1OCC H;  2ZNZ A;  1K4S A;  4M3G A;  2FA5 A;  1FC3 A;  2KZV A;  3V8K A;  3WU1 B;  2M3A A;  4MFD A;  1BI3 A;  2R7T A;  2NAZ A;  5J1Y A;  3A4C A;  4X6A J;  5J4V A;  4M74 A;  3MKW B;  4XSZ F;  3G73 A;  1MND A;  2XSJ C;  4M6V A;  2L2O A;  4RM3 A;  4L5J A;  1H0M A;  1K79 A;  3MKY B;  2EZH A;  2X0L A;  3WE3 A;  1AWC A;  2HI3 A;  3PSF A;  3CUO A;  3WTT C;  2A69 F;  3GLL A;  4I02 A;  2VOO A;  1QHG A;  4UVC A;  5D5X B;  4A3L J;  3E6M A;  4YRV A;  3RCO A;  2BY1 A;  2L9N A;  1ON1 A;  1FSE A;  1XMA A;  2P5K A;  3GO5 A;  4S04 A;  2LKX A;  1H9T A;  1FTZ A;  2BBY A;  3LFK A;  3KEY A;  1Z7L A;  4QPQ A;  4L18 B;  2M4G A;  1IV6 A;  3HOV J;  2VPL A;  1YO5 C;  2AXT C;  1SD5 A;  2VB6 A;  1R1U A;  3HPH A;  3BJ6 A;  4W97 A;  3CP8 A;  5GPC A;  3A02 A;  2ZSH B;  4IVN A;  1UEL B;  2JK3 A;  4BXF A;  2M7B A;  4LD5 A;  3MD2 A;  1YQA A;  2V26 A;  3CCE I;  2E1M B;  3QOE A;  3PL8 A;  1YJ9 I;  4BYY A;  2XPW A;  3VYR B;  3CDL A;  1OCO H;  2QWW A;  3OIO A;  4E7S A;  2HDC A;  1NHA A;  2YR2 A;  2DQR A;  4PK4 A;  2MG4 A;  4OAY A;  2JSP A;  1T8I A;  4Y52 J;  3HGG A;  1FYK A;  2QVO A;  1ZHF A;  4A0Z A;  2DXI A;  2OTJ I;  3J7A Y;  4HDV A;  5AIP A;  4QPO A;  3ECO A;  4NQW B;  1LVA A;  2RKH A;  2UZK A;  2DT7 B;  1ZLJ A;  2JUG A;  5JHU A;  2Z3Y A;  5HOD A;  2L7Z A;  1R7J A;  2KRH A;  4M73 A;  1PP7 U;  1HLV A;  2J5P A;  2ISZ A;  4DZP A;  1USS A;  3KX2 A;  2Z16 A;  2LYC A;  1P6R A;  3DEU A;  3TDU C;  5HLT A;  3DPU A;  2G7H A;  5FRM A;  1LVK A;  1MMG A;  2FOK A;  3RQ4 A;  1T2K A;  1R49 A;  2HU9 A;  2HOA A;  1OCR H;  1BI1 A;  2VKV A;  4ON0 A;  3B02 A;  1G2H A;  2YUS A;  5IPA A;  1IN8 A;  2ADU A;  1AA7 A;  4HBL A;  4I0A A;  4MQ9 F;  4UUT A;  5E1W A;  5DM6 F;  4BQN A;  1Z21 A;  2DA4 A;  3TGN A;  4WX9 A;  2QSG X;  2CUF A;  3GTP J;  1B1B A;  3L09 A;  4IL6 C;  2M9H A;  1YW9 A;  2ELK A;  2W85 A;  4A2U A;  4Q4Z F;  3N97 A;  2VN2 A;  2DDB A;  4FE4 A;  4NC6 A;  2V6C A;  2ZCW A;  4XLF A;  5FGM A;  3E3V A;  5M3F J;  3TW6 A;  3CJQ B;  3I4M J;  3SFZ A;  4XLN F;  1FOY A;  4G12 A;  1BR2 A;  3OIQ A;  1HKQ A;  3KZZ A;  1ZGJ A;  2ESN A;  2P7C B;  4MO7 A;  3HTS B;  1B8I A;  4KIS A;  1VQM I;  2L02 A;  2PX9 A;  3MMY B;  1JUM A;  1Z05 A;  4OIO F;  2CSO A;  2Y2Z A;  4IXA A;  4UHT A;  4NBQ A;  4AVP A;  1XMK A;  3CD6 I;  1YW8 A;  2EWN A;  3ZP5 A;  2Y0M A;  5LGU A;  2UXN A;  2EFP A;  2QLZ A;  3ZMD A;  2VLA A;  1K78 B;  1DU0 A;  3JRH A;  5DV5 A;  1K6Y A;  4CCM A;  4KIG A;  2OTL I;  4LIU A;  5CVR A;  1MJB A;  3LL7 A;  3FK6 A;  5EF6 A;  2WAF A;  2PFB A;  2F48 A;  3GCM A;  5DUK A;  2XAU A;  2NS7 A;  1R1V A;  3DPL C;  1FZP B;  2CO5 A;  3DTE A;  3BZK A;  4HF1 A;  4XRM A;  3HHH A;  2R7O A;  3KCC A;  4RAF A;  4BHB A;  3CLO A;  5EG0 A;  3AL0 C;  5J3L A;  1B72 A;  4LG3 A;  4RAY A;  1UG0 A;  4I98 B;  4Q48 A;  2ACJ A;  5TIS C;  2JZY A;  2LMD A;  3T0Y A;  2GOM A;  1KQ9 A;  3HKZ N;  4II2 A;  4AVZ A;  3F3X A;  2X1E A;  3IWZ A;  4XR6 A;  4B3X A;  2TRT A;  2KLO A;  4AYB N;  3BPX A;  1KU3 A;  2OPT A;  3RPQ A;  1YX5 A;  3FKI J;  1XGS A;  2QYO A;  4Y15 A;  2A6H F;  3I58 A;  2Q2E A;  3M3Y J;  4ANJ A;  1WJ5 A;  5FLV A;  1FMV A;  1TZL A;  3EQL F;  3OYF A;  4C2M J;  2M8G X;  2P0W A;  4AM3 A;  1XX5 A;  1LE8 B;  1OIS A;  1ENH A;  1E2X A;  4RDU A;  1ETW A;  1MBE A;  2AS5 F;  3HOZ J;  3HSE A;  3B6A A;  3HKZ A;  3ZQI A;  1EA3 A;  5DCF A;  3CF5 F;  5J4Y A;  3R6S A;  1GVJ A;  2WA0 A;  3EUH A;  4DYC A;  4JQF A;  2V1N A;  5EJC A;  5IP6 A;  2KIQ A;  2OV7 A;  2VAS A;  2PMZ A;  3IKT A;  1K4T A;  2Z1D A;  3D1N I;  2WTE A;  4HQM A;  3VYS B;  5BPD A;  3VSL A;  2E2J J;  2W24 A;  5E8G A;  5HNH A;  4RBO A;  2LH9 A;  3S2W A;  5HDG A;  3RIR A;  1X4P A;  3GF2 A;  1SFO J;  4RB0 A;  4TV7 A;  3U2R A;  1KQ0 A;  1RET A;  2DA1 A;  2FOW A;  2ZME A;  1S6L A;  4BGD A;  3TBI A;  2ISY A;  2XAH A;  3L1P A;  2XRO A;  2DU9 A;  4PUS A;  1U5T A;  4JX4 A;  1W7P A;  1UG2 A;  2LNB A;  5LHI A;  5E3N A;  3F8M A;  1IG7 A;  3LNQ A;  3LAJ A;  4B43 A;  2BY0 A;  2F4O B;  2Y9Z A;  4MEY F;  4E6K G;  1ONV A;  2K9Q A;  3K4K A;  1JXS A;  3ULQ B;  2PJR B;  2L3D A;  2XRL A;  4CZZ A;  4LIV A;  4U87 A;  1UCR A;  2P6S A;  3Q0W A;  2O9L A;  3H35 A;  5TJJ A;  4AID A;  3VOD A;  5LFA A;  1QZE A;  1G3Y A;  5DUI A;  3GBG A;  3HG9 A;  4XRF A;  3LQQ A;  2FSW A;  2PLY A;  3IH2 A;  1FMW A;  3FKJ A;  1ZQ3 P;  1WKM A;  1JGS A;  2A6T A;  3BJA A;  1VQN I;  2VC1 A;  5EEH A;  2KDO A;  3BG6 A;  2EFO A;  2MLG A;  2V7F A;  1I1S A;  3TDZ C;  3OSF A;  3H0G J;  1HW1 A;  2OQG A;  2B0L A;  3KPH A;  1BW5 A;  4UUS A;  3S8P A;  3A03 A;  4QTR A;  3GTL J;  4OWR B;  2IP2 A;  3HYI A;  4XLP F;  4HV6 A;  3CC2 I;  2NS8 A;  2OQR A;  4EJW A;  4AUX A;  3VB2 A;  4KIF A;  4ZZD A;  1TWF J;  3WTU C;  3TED A;  1VQL I;  5JFR A;  4ZZL A;  3CMA I;  5D5V B;  1W36 D;  3SXY A;  3TMO A;  4B8X A;  1T56 A;  2ZB9 A;  1MBK A;  2L01 A;  3BTJ A;  3SHF A;  4UVB A;  4EGZ A;  1ZRD A;  4UNO A;  2LF8 A;  3DU5 A;  3LAP A;  3H0D A;  1V4R A;  2I10 A;  1K7A A;  4M72 A;  3RZO J;  2HQR A;  3BY6 A;  3DU6 A;  1JJ8 C;  4GGG A;  1OFC X;  1Y0U A;  4YG2 F;  3DEW A;  2AHQ A;  4KMU X;  1MBH A;  9ANT A;  4Y13 A;  1D0Z A;  1GT0 C;  1RI7 A;  2NNN A;  1TQI A;  2KIS A;  4HF2 A;  5CQE A;  4FX0 A;  4JYK A;  4ZTF A;  1JT6 A;  1YIO A;  2JMW A;  1U2W A;  1XCB A;  2R7Q A;  2YS9 A;  1IZ1 A;  2FXA A;  2F5D A;  3E1S A;  4A0Y A;  4XLC A;  1FJL A;  1MMS A;  3Q9S A;  3L2V A;  1GLN A;  3PQJ A;  3K4B A;  1TW2 A;  1TC3 C;  2K9S A;  2EJR A;  2ZJP F;  1YLF A;  4GYI A;  1W1W E;  3S2D J;  3HIF A;  1YS6 A;  2MSY A;  2LR8 A;  3K4L A;  1O57 A;  4II3 A;  3E0J B;  3BG7 A;  1PDN C;  1XGO A;  1QRY A;  1S5L C;  3CCU I;  2QEN A;  2P8T A;  3FXO A;  1SVL A;  1HW5 A;  4M6X A;  1YW7 A;  5KAF C;  1VZ0 A;  2CUE A;  2EBI A;  3TO7 A;  2HZD A;  2VBX A;  5E1X A;  1IN5 A;  4OAZ A;  1IC8 A;  4P1W A;  2R92 J;  3L00 A;  1IN6 A;  2KMU A;  4IHS A;  2PMH A;  3H5A A;  2H94 A;  1LDJ A;  3K7A J;  3PFY A;  1F9N A;  3ZMV A;  3KIO A;  2HNH A;  3HSR A;  2VKE A;  4ZJZ A;  1OCT C;  5JR3 A;  2GXA A;  3WE2 A;  1WRJ A;  4RA2 A;  3L2W A;  3M4O J;  1B9M A;  2MH9 A;  2QA4 I;  5K1Y A;  4RS8 A;  4BHC A;  4DBR A;  2RV8 A;  2DMP A;  2QEX I;  1O3Q A;  2DA5 A;  3CMM A;  4CCK A;  5HLG A;  3BTL A;  3KP6 A;  5KVR A;  3CCM I;  5FFX A;  1T0F C;  2DYR H;  2V1X A;  1NK3 P;  2X6Y A;  1S72 I;  5AON A;  1B8I B;  2VKD A;  1F1Z A;  2V4J C;  2VE8 A;  2V79 A;  1D0X A;  3I54 A;  3LOC A;  2ZNY A;  4UV8 A;  4YIF A;  1Z9C A;  3J80 Z;  3WTV C;  3RYR A;  2K9N A;  4KT5 C;  4O6J A;  4BNC A;  4DIQ A;  3V7C A;  1XTA A;  4EJT A;  2WBM A;  4XON A;  1R23 A;  1BIA A;  1T95 A;  4IRH A;  4IQJ A;  3NEU A;  4HW0 A;  3E6B A;  2XSD C;  3ESW B;  4BEH A;  2DTR A;  4L9V A;  2QKM B;  5CVU A;  1MMD A;  5GAD J;  4A5M A;  1SMY F;  2XGE A;  4Y7N J;  5LLQ A;  2XF5 A;  2Y48 A;  1T98 A;  2TCT A;  4C3H J;  1TWG J;  3RKQ A;  2NS0 A;  1V55 H;  2RN7 A;  4LIT A;  1VQ8 I;  5D5W B;  2L0K A;  1QPI A;  2DJN A;  3OOP A;  3HDD A;  6PAX A;  4BBS J;  2FQ3 A;  4PSX A;  3I3L A;  3KP7 A;  2VBW A;  5J1U A;  4MTD A;  3QOP A;  1B72 B;  1Z0X A;  2X85 A;  3NRV A;  3SFI A;  2X1D A;  3PO2 J;  3OL4 A;  1WJA A;  1A36 A;  2K02 A;  3RDI A;  5FD6 A;  3MFK A;  2VQL A;  5HS9 A;  3S15 J;  5KCM A;  4ITV A;  3OYG A;  1V5F A;  2VBY A;  5F0C A;  2GOX B;  2H6C A;  2IGM A;  1T38 A;  2Q2E B;  2V1U A;  4ETS A;  1HCR A;  1QU3 A;  2KIF A;  2IS4 A;  4HQE A;  1K78 A;  2CG4 A;  2DFF A;  3EDP A;  3NWT A;  4XNF A;  5E3L A;  3DXJ F;  3HC7 A;  2HXO A;  2ID6 A;  2H8W A;  4GFB A;  2UUZ A;  1BC7 C;  5E8I A;  3BDD A;  4LLG F;  4CCN A;  5K5R A;  1IRF A;  3OSG A;  1TLH B;  2WWY A;  4HSR A;  5IOZ A;  3GFI A;  2OD5 A;  2KFD A;  1S8N A;  4Y33 A;  1ZRE A;  2HS5 A;  1XGM A;  3BQY A;  1RES A;  5GTH C;  4DQ2 A;  1XMX A;  3KP2 A;  1MZB A;  4E7H A;  4E7Z A;  2M7A A;  2B9S A;  1G3W A;  3BCA A;  1FSH A;  2ZME B;  4UVA A;  4E7L A;  1K61 A;  3RKX A;  2KHM A;  5L3D A;  4FQG A;  2E5Z A;  5LEK A;  1R36 A;  1U5T B;  1QBJ A;  3DFG A;  1HST A;  1W7P B;  5FFZ A;  2HXI A;  2H1K A;  2DA2 A;  3M7G A;  3LA7 A;  3TOB A;  2COM A;  3JRB A;  3FM3 A;  1WHU A;  4U0Y A;  4ASN A;  3CCR I;  1I3A A;  1ZK8 A;  4QWQ A;  2FJ1 A;  2W00 A;  4IJA A;  4BQO A;  1HW2 A;  1REP C;  2RAE A;  3FXM A;  2L5Q A;  2XAJ A;  5C3E J;  3KP4 A;  3QPL A;  2OU2 A;  1I39 A;  2L7M P;  1LJ9 A;  4IZZ A;  1XSV A;  3GFJ A;  4HOB A;  2M87 A;  1WVR A;  2IXS A;  2JJ7 A;  4G94 A;  4RGU A;  4M71 A;  1Y8Q B;  3UKG A;  3DWL E;  1I3Q J;  1HDD C;  1TT0 A;  3I9V 2;  3HEF A;  3K4C A;  3PQK A;  2ECC A;  2RNJ A;  3F9K A;  3ZQ7 A;  4UUS B;  4J19 A;  2BHY A;  5HOO A;  3H3U A;  3DLA A;  2P7V B;  1BR1 A;  4H0E A;  3HTU A;  3BG3 A;  4IO9 F;  3CCV I;  1PP8 F;  2LF7 A;  1I1G A;  5J8F A;  2ZXJ A;  2WV1 A;  3R4K A;  3S3O A;  2OUM A;  3HPG A;  4KNY A;  4LB6 B;  1FX7 A;  2YU3 A;  2PJR A;  5HLI A;  4YFN F;  3DKW A;  2MLK A;  2K9M A;  1F4K A;  2OA4 A;  2R7Z J;  2Y30 A;  3BWG A;  5IT9 K;  5BMZ A;  3GX4 X;  3L7W A;  1JE8 A;  2WY8 Q;  2BV6 A;  3C18 A;  4ESJ A;  3BR3 A;  4D7M A;  1W7P D;  3ABT A;  4BHP A;  3WTX C;  2FQ4 A;  1YRN A;  5ICE A;  2BHZ A;  3V42 A;  3S3N A;  1YS7 A;  4B44 A;  2IW5 A;  3AFH A;  2JUC A;  1TNT A;  2YX4 A;  3H9Q A;  4B1R A;  2DT5 A;  3Q9V A;  2OBP A;  2OZ6 A;  2IA0 A;  1D3Y A;  2DCE A;  1SAU A;  2EZL A;  3ZR8 X;  1XD7 A;  3J7Y J;  1U78 A;  4HV5 A;  2QQB A;  3RJP A;  2CGP A;  3BR2 A;  3FX3 A;  4OIR F;  2EFW A;  2ZXI A;  3RQI A;  1LPQ A;  1DP7 P;  2JA8 J;  1KQ8 A;  1Y1W J;  4G6D A;  3HHG A;  3MAJ A;  3R0J A;  2E7X A;  2XGD A;  1O7F A;  1RR7 A;  2CUZ A;  3W3C A; 
#chains in the Genus database with same CATH homology
 4RM2 A;  1Y6I A;  2X51 A;  2WAF A;  3HOS A;  2VQC A;  3CF2 A;  4Y3O A;  4DGW B;  3VDX A;  1R6R A;  2XAU A;  3OS0 A;  4XLA A;  3K70 D;  4C2T A;  2LG4 A;  3DPL C;  3EPZ A;  3K6G A;  2CW7 A;  3DTE A;  3QYE A;  2DT6 A;  2R7O A;  4BJ6 C;  3RSN A;  4F92 B;  3OL3 A;  2VJI A;  4U7B A;  3AL0 C;  2R7S A;  4LG3 A;  1UG0 A;  2CFO A;  1WJE A;  1MMN A;  2GOM A;  4II2 A;  5CPR B;  4AVZ A;  4BE0 A;  2X1E A;  1ERD A;  2K5C A;  4XR6 A;  4B3X A;  4CCO A;  3MKZ A;  2JVG A;  2KLO A;  3W2A A;  2K3P A;  3OYH A;  1YX5 A;  3DKY A;  4XN0 A;  4PJL A;  4BE1 A;  4ANJ A;  2KRC A;  1WJ5 A;  3CP2 A;  1FMV A;  1TZL A;  3OYF A;  2CH0 A;  2FUG 2;  4BU2 A;  2P0W A;  1WJB A;  3EUH C;  3HKZ A;  4E7J A;  1EA3 A;  1X19 A;  1NG7 A;  2BW3 B;  4XKB A;  3ZQQ A;  4HG2 A;  2CV0 A;  4BJT A;  3KYL A;  2WA0 A;  4JQF A;  2V1N A;  2OV7 A;  2VAS A;  2PMZ A;  3OMY A;  4F52 A;  2W4S A;  2Z1D A;  4PFP A;  4XOT A;  4YEL A;  3RTR A;  3VYS B;  3VSL A;  5HNH A;  2LH9 A;  2A5W A;  2RNG A;  3OS1 A;  4AU7 A;  1X4P A;  3D5R C;  3PJR A;  3D5S C;  4HPQ A;  4XKC A;  1WJD A;  1X1A A;  2XF6 A;  4BGD A;  4XL9 A;  3TBI A;  1LKX A;  2CS3 A;  3RPU D;  3H5N A;  4PUS A;  1UAA A;  2W82 A;  4Y4R A;  2E60 A;  2M0M A;  4B43 A;  4R79 A;  1D1C A;  4ZDO A;  3A2K A;  2IGO A;  1MNE A;  4E6K G;  2CW8 A;  2DJI A;  4XQF A;  3K4K A;  5KNL A;  2PJR B;  2MFZ A;  4BS9 A;  4LIV A;  4U87 A;  3ZRG A;  2VJ5 A;  4NUB A;  4XLE A;  1D1A A;  4BEH B;  3H35 A;  4BE2 A;  5LFA A;  5FRO A;  3SYT A;  4RLF A;  4HNT A;  2WB1 A;  3OYI A;  3GBG A;  3HG9 A;  4BUP A;  2IS6 A;  1FMW A;  3FKJ A;  2A6T A;  3VWB A;  2KDO A;  3BG6 A;  3K70 C;  1D0Y A;  3OIP A;  2V7F A;  4PJN A;  4BDZ A;  3H9G A;  3D5L A;  4EAT A;  4IX7 A;  4CH7 A;  5TGT A;  3L2U A;  1QHH D;  3LSH A;  3S8P A;  3UNG C;  4OWR B;  2UV1 A;  2R7R A;  4ZC3 A;  2XDV A;  3G2B A;  2JVH A;  4C2U A;  2KQR A;  3CJR B;  1X1C A;  1Z3Y A;  3SZG A;  2KPM A;  2HPM A;  5FRN A;  1S9H A;  3IAS 2;  2RRE A;  1W36 D;  3C2H A;  2QKL B;  3PNV A;  3TMO A;  4XLH A;  4D1Q A;  4PFO A;  2Y0S A;  3DTK A;  1E0E A;  2Z2S B;  3OYD A;  3DTI A;  3DU5 A;  3H0D A;  3FDY A;  4CSW A;  4XKW A;  3OY9 A;  4HRI A;  5HVQ C;  3DU6 A;  4KJZ A;  3ZCO A;  4XKV A;  3BC8 A;  2X6X A;  3EUK L;  2E5N A;  5JHF A;  3AL0 B;  1J09 A;  1D0Z A;  2O5R A;  2WAE A;  3DQV C;  1G59 A;  2HVQ A;  2AQF A;  4C30 A;  3OYM A;  1N75 A;  2HVR A;  5CQE A;  4ZTF A;  3HXL A;  3LSG A;  4F55 A;  4BJ5 C;  3OR1 C;  3C2G A;  2R7Q A;  3IAM 2;  3E1S A;  3VYU B;  4XLC A;  2WAD A;  3OYA A;  2XF7 A;  2OC6 A;  3L2R A;  1GLN A;  4CA0 A;  3L2V A;  1WJC A;  3K4B A;  2R7X A;  3SEZ A;  3U21 A;  2R7W A;  4E7K A;  3LSK A;  4ZDP A;  4XN3 A;  4D9J A;  4E7I A;  1YE9 A;  3K4M A;  2VQG A;  3FBI B;  1JI8 A;  1LFP A;  1PYV A;  1Z3X A;  2V9K A;  3K4L A;  3UR3 C;  3IUO A;  4BQQ A;  4II3 A;  2F5V A;  3E0J B;  3BG7 A;  3EUA A;  3OYJ A;  2LY1 A;  2KP6 A;  3TL4 X;  4BL0 B;  2LY2 A;  1VZ0 A;  4XMY A;  4ZDL A;  2E1M C;  2HZD A;  1IRX A;  5CQG A;  4XOR A;  2IS1 A;  5KHD A;  4OAZ A;  1G8X A;  4P1W A;  2R4G A;  2KMU A;  3OS2 A;  4XOP A;  2VJJ A;  2LC2 A;  3H5A A;  3ZXS A;  3OYN A;  4P5O A;  1OR7 C;  3PNY A;  3PFY A;  2HNH A;  2VJ4 A;  4ZJZ A;  4IQ4 A;  1DGR M;  2WAQ A;  3PSI A;  2Q1Z B;  2BW3 A;  4B48 A;  2ZXH A;  3L2W A;  2HPI A;  3K4J A;  2LOO A;  1V5G A;  3FBN B;  2F4I A;  3DEE A;  4DBR A;  1DP3 A;  4NC8 A;  2KL4 A;  2K9L A;  3CMM A;  4YEJ A;  4CCK A;  3HUG B;  4RMN A;  1YX3 A;  3LFU A;  2BOL A;  2WY7 Q;  5HNF A;  1T0F C;  3M1C A;  2L7K A;  1LDK B;  2X6Y A;  1N77 A;  3BLY A;  3OR2 C;  2JA2 A;  2VKD A;  4BDY A;  4J00 A;  4N4O B;  2V4J C;  4G6T B;  2BVL A;  4HST A;  1X4O A;  1D0X A;  1WFX A;  2NOJ B;  2UWM A;  2W1O A;  4F93 B;  2RQQ A;  3LMM A;  4DIQ A;  2VL8 A;  2R7V A;  2WBM A;  1X1B A;  4XON A;  2CMP A;  3DKX A;  1P9Q C;  2CV1 A;  3QYB A;  1T95 A;  4IQJ A;  2LBF B;  2VQH A;  3IP4 B;  3HOT A;  2W7N A;  4BEH A;  2QKM B;  1MMD A;  2VKH A;  1ZEL A;  2F6C A;  3K4N A;  2XF5 A;  2IGK A;  2AQE A;  1BOB A;  4LIT A;  3W2V A;  3OWT A;  2MAB A;  2HVS A;  3OYK A;  1N78 A;  4PSX A;  3I3L A;  4F91 B;  3AKZ A;  4XM3 A;  5CKT A;  2VIX A;  2X85 A;  2X1D A;  4ZYA A;  3OL4 A;  1U0J A;  1WJA A;  3S93 A;  2KZV A;  2VQL A;  2M3A A;  3BCB A;  3SDB A;  2R7T A;  4DBQ A;  5KCM A;  4ITV A;  4RLQ A;  3OYG A;  1V5F A;  3A4C A;  2GOX B;  1X1D A;  2IGM A;  3MKW B;  2Q2E B;  1MND A;  1Y56 A;  2XSJ C;  2L2O A;  4RM3 A;  4CCJ A;  2DOA A;  3MKY B;  1QU3 A;  2IS2 A;  4N4N B;  2IS4 A;  3PSF A;  3NWT A;  3N05 A;  4XNF A;  4BAC A;  3HC7 A;  3H5R A;  2UUZ A;  2ELJ A;  1QHG A;  1BR4 A;  1SFK A;  2ZSI B;  3OYE A;  4CCN A;  4YRV A;  4MLO A;  3OYL A;  3RCO A;  1NG6 A;  4HSR A;  2L9N A;  2BVM A;  2HQA A;  1D1B A;  4F3Q A;  4Y33 A;  3VYT B;  4CUG A;  3KEY A;  1Z7L A;  4QPQ A;  2XC7 A;  2M4G A;  2VPL A;  3S3M A;  3QOD A;  2VB6 A;  4E7H A;  4DOZ A;  3HPH A;  2CV2 A;  3OYB A;  3CP8 A;  3H9J A;  4E7Z A;  2M7A A;  2I8D A;  3BCA A;  2ZFU A;  2ZSH B;  2HDW A;  1UEL B;  2LRE A;  4E7L A;  4BXF A;  1KON A;  2M7B A;  2KHM A;  5LD2 C;  3MD2 A;  3ONQ A;  2E5Z A;  4PJJ A;  2V26 A;  2E1M B;  3NWS A;  1DGW Y;  4ZTJ A;  2V6E A;  1WJF A;  2L9S A;  3QOE A;  3PL8 A;  3CZ6 A;  3VYR B;  4HNU A;  3S32 A;  4GRI A;  3LSM A;  4E7S A;  4AYB A;  1PJR A;  4PK4 A;  2R7U A;  2W00 A;  4OAY A;  3FHN A;  4BQO A;  2JSP A;  2L5Q A;  4NC7 A;  2DXI A;  3J7A Y;  1HA8 A;  1W36 C;  4QPO A;  4NQW B;  4IZZ A;  2DT7 B;  2JUG A;  3K10 A;  4J01 A;  2IGN A;  2KRH A;  2X6W A;  4FET A;  2IXS A;  2X1C A;  3PUB A;  3KX2 A;  2Z16 A;  2LYC A;  5HLT A;  3OOU A;  3DWL E;  1TT0 A;  3DPU A;  3I9V 2;  5FRM A;  1LVK A;  1MMG A;  3RQ4 A;  3K4C A;  4DJA A;  3F9K A;  3CES A;  5HOO A;  3LSI A;  2HU9 A;  2M4K A;  3DLA A;  1BR1 A;  4E4H A;  4B47 A;  3M8J A;  4FAS D;  2MD0 A;  1AA7 A;  2VXZ A;  4BQN A;  2OUM A;  4CCL A;  1Z21 A;  3S3O A;  3HPG A;  2PJR A;  3HL2 A;  3OYC A;  1V5E A;  2K9M A;  3L2Q A;  3QYF A;  4XLF A;  4PSW A;  2WY8 Q;  3CJQ B;  4C9Y A;  2MC4 A;  1BR2 A;  3OIQ A;  4HEA 2;  3PNT A;  3ZGK A;  3SEQ A;  4KIS A;  4CZC A;  3V42 A;  3S3N A;  2MYS A;  4B44 A;  4KIT B;  3AFH A;  3MMY B;  3H9Q A;  4NNJ A;  3A1Y A;  3DPT A;  4H4K C;  4JOM A;  2VXD A;  2DCE A;  2LRD A;  1SAU A;  3VSK A;  1DQU A;  3ZR8 X;  3W2W A;  2VLA A;  4KT6 A;  2ZXI A;  4IKF A;  2LBF A;  1K6Y A;  1MMA A;  4CCM A;  1OLT A;  4LIU A;  3LL7 A;  4X0G A;  2CUJ A;  4PJM A;  1MW7 A;  2CUZ A;  3W3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...