2OUMA

The first domain of l1 from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
129
structure length
129
Chain Sequence
ALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain I of ribosomal protein L1 is sufficient for specific RNA binding.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L1
total genus 25
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oumA01
2OV7A 2OUMA 2VPLA
chains in the Genus database with same CATH superfamily
3K7AJ 5LHIA 2ZKZA 2Q2EB 4UVAA 1BI1A 2FMLA 1V3FA 3FXUA 3IRRA 1P92A 3PO2J 4HPQA 1Z6TA 3M1EA 5FKKA 3V7RA 4A6DA 1ZLJA 2CSOA 3OYBA 5F1JA 2XC7A 2BW3A 3BCAA 4I7HA 4BQAA 2CV1A 2P5KA 1YS7A 2MD5A 2V4JC 5L3EA 3LA2A 3ML6A 4WXCA 4IF4A 4B44A 4Y15A 1SFKA 2OC6A 1QA6A 3K4JA 4PGGA 1K4TA 4ENMA 2HVSA 2PX9A 3UNGC 2ZNYA 3AL0C 3HZJA 4F3QA 4C2MJ 3K1NA 4XNFA 2XUBA 3W2VA 5EZGA 2EIMH 5FROA 5FRMA 2VONA 3WTXC 3TDUC 4D5CA 3WTTC 5F0CA 3LA7A 2A68F 2F4OB 2L7MP 1PYVA 1YRNA 5HOOA 4L5JA 1TQPA 2GXAA 2K02A 2MYSA 4LB6B 1K79A 3FWEA 1I6XA 2EFPA 5D8KB 3FK7A 1Z9CA 1X1PA 2M0CA 1R4NB 2FU4A 3Q0WA 4LK0F 4QPOA 5JHFA 2K85A 3BQYA 5LRRA 2H6BA 4XRFA 3K4NA 1B9NA 3T8RA 4MFEA 3CZ6A 4ZTFA 3MAJA 1FOXA 1F5TA 3PUBA 3CTAA 1FNNA 3FM5A 3GXOA 3EQLF 2F5EA 1T6SA 4CDGA 4BUPA 1WSUA 1FZPB 3A03A 1XX5A 1OQYA 3HPHA 2UWMA 2ZNZA 2W57A 1T08B 2VKDA 1U5TC 5GP9A 3ZR8X 2M8GX 1D0ZA 3S16J 3DKWA 4M6YA 3KCCA 3K2AA 1K6OA 2FRHA 2L7ZA 1HXDA 3WU2C 4OAZA 2E5NA 3ZQHA 1MSFC 2CV2A 5ICGA 3BG5A 4YG2F 3BG7A 3L2QA 1ZHFA 3FK6A 3QOPA 1J7KA 2V9PA 5DCFA 1K7AA 1XGNA 1M1EB 2WADA 3HOUJ 1KONA 2W48A 1K4SA 5M3MJ 1OKRA 4U88A 3CCSI 1ZARA 2QKLB 3ZPLA 3BT9A 3GZNB 5K1YA 2VE8A 3KX2A 3E5XA 3CMAI 1X3ZB 2X0LA 2PLYA 5HLIA 3CCJI 3DU5A 1H89C 5GTHC 1AKHA 3OOUA 1F36A 3GZ6A 3P7NA 1IRFA 4PZJA 1JUSA 2MBFA 2TCTA 5B1AH 2RKHA 3OWTA 4DYQA 2Z33A 5GPAA 4W1UA 2Y0SA 5DV5A 1WJFA 1NHAA 2M7AA 3CDLA 5HS8A 4N4OB 2CQQA 2IP2A 3WTWC 2MGQA 2WWYA 2R7SA 1QZZA 3O2PE 2WAEA 3SDBA 4C3IJ 1IRXA 3OR1C 1D1CA 1G3TA 4C2UA 2PI0A 4V2GA 2K3PA 2FBKA 1JJ6C 5KVRA 3TMOA 4D5FA 1XSVA 4G6TB 5A2QK 4M6VA 4P9UA 4KJZA 2NS8A 1STZA 3K4BA 1LUJB 2DK5A 3J7AO 3RI4A 2XV4S 4BHPA 1TL8A 1YTYA 3H5AA 4BEHB 2CO5A 1EH6A 3QPTA 4RGXA 1B4AA 5EEHA 2TRTA 1Z3XA 1AU7A 2KT0A 3NRVA 1RZ4A 3HPGA 3I71A 2V26A 4Z2YA 1EH7A 2OZUA 3GTJJ 3U21A 3TP3A 2HTSA 1JT0A 3FXRA 3HXLA 3CC2I 1R4MB 3L2CA 1VQMI 5IPAA 3PQJA 3FISA 2FQ4A 1FX7A 1WVRA 1TLHB 4HX4A 2VBXA 2DU9A 2ISZA 2CJJA 3EUKL 2IS4A 1XGOA 4DOZA 3KEQA 4AU7A 3FXJA 3H9QA 4LD5A 1GT0C 4FQGA 3ASOH 4UB8C 4OAYA 3DPLC 2XRLA 1W0TA 1LJ9A 1RKWA 2FE3A 3OL3A 2EBIA 1SD7A 2Q8KA 1X2NA 3OL4A 4D0PA 1WRJA 3KYCB 1T0FA 1R1VA 5A2QZ 1YYVA 2VUMJ 4P1WA 1S9HA 4I02A 2JA5J 3QP6A 4ZZLA 3W3CA 2CUFA 3BTJA 2DA2A 1SFUA 3BROA 1JGGA 2XROA 3HTSB 4G7OF 2X1EA 3GFJA 3K10A 2CQNA 2RDPA 3PNTA 3I58A 4EEFG 2DA3A 3C2GA 1QZEA 1QRYA 1OFCX 1KU9A 1WWXA 2X48A 1PP8F 2AQEA 2EFQA 2OU2A 3KPHA 3JRDA 1VQKI 1XSXA 2W7NA 1G8XA 3L9FA 1K83J 2HI3A 1FOKA 1I1SA 1O3RA 3NEUA 3F9KA 3H92A 3KYLA 4O5VA 1TT0A 5EDNA 3M07A 3ZGKA 4BKXA 4YELA 1EH8A 2P5LC 1H9GA 2N8GA 2CQXA 4ZYAA 2P4WA 2W85A 3C2HA 5AONA 4UVBA 3ZMTA 4Y4RA 4AYBN 2QQAA 1ZG5A 1P2FA 4L5EA 4U0YA 1IDZA 2H6CA 5M3FJ 3JREA 2XPWA 3G1MA 1QPMA 3ZMDA 3F8BA 3SEZA 3LSRA 2X6YA 1J75A 2P7CB 1W5TA 1ZKGA 2EFNA 3QPHA 1BW5A 4AIHA 4LIUA 2GWRA 5F6FA 5HDKA 4BNCA 1JTXA 3RYPA 2PQ8A 1MMDA 3KP7A 1TZLA 4BDYA 2O8KA 2BXZA 4G9YA 3CCVI 4Q5SF 1FYLA 2PJPA 4IHXA 3FM3A 4OIPF 1HW1A 1SAUA 1YIOA 5J4YA 2KIUA 4A3CJ 3CC7I 1U9NA 1X19A 5E18F 1XB4A 4EV0A 2CRGA 1USSA 4LIVA 2G9WA 1PUEE 4BBRJ 1VQ5I 3MZ8A 3PSIA 2LF8A 1ETWA 4XN0A 4D9JA 1JTYA 1P7JA 2XAJA 3FIWA 1YW9A 1SC7A 2BY3A 1XC5A 2MFZA 4XKVA 3ZXSA 2JRTA 3VB2A 4RB0A 2Y75A 5DEQA 2DODA 4C3HJ 2VQCA 2Z2SB 2LSOA 3S2DJ 3H35A 3CUQA 1WJBA 2OCEA 1OYYA 2DA7A 3F8CA 4I0BA 5GAGJ 2YUSA 3S15J 3GTKJ 3BR3A 3J81Z 2M45A 2QUFA 2DYRH 1W5SA 2UV1A 4FX0A 4HV5A 3R6SA 4HQMA 1MSEC 4DQ2A 3G4SI 2E7WA 4L9NA 4HA8A 1BOBA 3ESWB 2XPUA 1JKOC 1CF7A 2ZJ2A 3WU1B 4E7KA 4YFKF 5CQEA 4BEHA 1LE8B 3O8HA 2KRCA 2BHZA 1TWAJ 2VJ5A 3I54A 1TW3A 5E3MA 3HG9A 2VKVA 4QTRA 1F4KA 3EUAA 2BVLA 2EK5A 2Y30A 4HBLA 2YU3A 3F8FA 2R7DA 4CYDA 1A04A 3ZMZA 4YIFA 3S32A 3J7YJ 1E2XA 3PO3J 4FT8A 3GX4X 1TNSA 3MZHA 1TWFJ 3LMMA 3GO5A 3FXKA 5D8LB 2F48A 3LWFA 3F6VA 1G59A 1BR1A 3QOEA 3Q3SA 4C2TA 2L9VA 2H8RA 4DZPA 2VOOA 4XKBA 4AUXA 3IUOA 4J19A 3CUQC 4G8XA 4WX9A 3HOYJ 4P9FA 3SZGA 2IS2A 1XCBA 3FHNA 2NAZA 2WAQA 3X2QH 4HDUA 1N78A 3EUHA 4KYWA 4XOPA 1W7PA 1Q1VA 2QBYB 2VBYA 3GTLJ 1ZGAA 5CVUA 1QHHD 4BE0A 4BL0B 1IG7A 1OCTC 3M3YJ 3PFIA 4FX4A 1I3AA 4I09A 5KAIC 4XRSG 3SDGA 4ENKA 2L9RA 2HOSA 1ZG3A 3HRTA 2LKXA 2STWA 2ETHA 2QSHX 3FDYA 1U3EM 1YFHA 2LYCA 1ZH5A 3EETA 3U1KA 2FSWA 2CV0A 1YW8A 3RKYA 2KLOA 1MKMA 2LY1A 3LSGA 2F6CA 2YSRA 1A31A 2JA8J 2M34A 2X6OA 2EFOA 1RKTA 3BR2A 5D5VB 1UZCA 4A12A 3IH4A 1NH3A 3BZ6A 2R7XA 4OOIA 4PDKA 2CWEA 3M8FA 1KU7A 4PJ0C 1FJLA 5E79C 2QSFX 1Z0XA 2DCEA 2BYVE 3JCUC 1R7JA 4ENJA 4JX6A 1FBSA 2DO7A 2UUZA 1YG2A 4JYKA 1ULYA 4G7HF 1U5TB 1HDPA 4LGWA 5DS9A 3SFIA 3R4KA 4K2EA 2EFWA 2VKEA 3IKVA 4UV8A 3C7JA 3JRIA 3BP8A 4XKWA 5ICFA 2WAFA 1Y39A 2HZTA 1FTTA 5LLQA 3DLLF 1ONVA 4FE7A 5C44J 1VQ9I 2V9VA 3VYUB 1KA8A 3M8JA 4B8XA 4IHSA 3G1LA 3FBIB 4RM3A 5D5UB 3LQQA 1V55H 4G12A 1AKHB 3DEUA 3DTKA 2E5ZA 4DBQA 3I59A 4IX7A 3CJQB 2ZSHB 3K2ZA 3AG4H 2ZMEA 1MW7A 2ZXWH 2EV0A 2XGCA 3M9AA 4PGHA 3WG9A 1POGA 5EEGA 3HRSA 2XF5A 1ZK8A 3CUOA 1ZRDA 3UKGA 1QVUA 1BC7C 1Z7UA 2IA0A 2ZSIB 2XASA 1T8IA 2CW0F 3HKZN 3RIRA 1XCVA 2UXXA 3VYTB 3TKYA 5FD6A 2B0LA 2DFEA 3VDXA 3OYGA 3HGGA 3BTCA 2VXDA 3OR2C 3E5UA 2KPMA 1IW7F 1OMIA 5JR3A 2R3SA 1C0WA 1IZ1A 3CDHA 3E97A 3LQRA 2A05A 2DDAA 2L0KA 1G3SA 2MSYA 2H09A 2WV0A 3DU6A 2KL4A 3KE2A 3OYHA 2RQPA 2EZKA 2DBBA 2HYGD 3VSKA 1UCRA 3LFUA 5LGTA 2HXIA 4QPQA 1LDJA 1UFMA 1ZELA 2Q1ZB 1BI2A 3QODA 4XK4A 4X6AJ 3VPRA 2VQHA 4ESFA 2FMYA 3KP5A 5IYBJ 5JLXA 4DYCA 1WJEA 2L5QA 1QPIA 3A01B 2DMQA 2R0QC 2CGPA 4JK1X 2A07F 4KNYA 5D6FA 2HDWA 2MG4A 5BPIA 2LFBA 5M5XJ 2IGKA 2A5YB 2P0WA 3LFKA 3PUFA 3LSIA 3ZMUA 4KDPA 1LNWA 2MABA 4F93B 5M5WJ 4IHWA 2JWTA 1FYKA 2E2JJ 4KISA 2MLKA 3F8NA 5F27A 1Z7LA 2E19A 3KEYA 4HNVA 1GV5A 4NDLA 4CCKA 3QPSA 5J8CA 5IOZA 2Z9OA 1OR7C 3WTZA 5ERIA 1LVKA 3M1CA 2ZBKA 1UMQA 3H9GA 4M73A 4WXDA 5L3FA 5CLSA 4ZDPA 3GYHX 2G0EA 2HKOA 1SAXA 3OYIA 1WJCA 4UY8I 4PFPA 4A0XA 2RAEA 1B1BA 2V1NA 1RRJA 2NVTJ 2ZXHA 4E7JA 1D0XA 2L01A 2J5PA 1P6RA 1B8IB 4FETA 4I01A 2FOKA 2R7TA 1QZYA 5FLXK 3OS1A 4MEXF 5ED4A 4H0EA 3BOQA 3DPTA 2QZ8A 3CESA 4KFCA 1BR4A 4CHUA 2BGCA 5IOYA 2CH0A 1G2HA 3GBGA 1W36D 4DBRA 3LNQA 4W97A 2AO9A 2VC0A 2X6WA 3LSTA 2K9QA 2OTJI 4M9XA 3IAS2 2H1KA 3WE2A 3JRCA 1IN5A 3HEFA 4ITVA 4IQJA 2L02A 4RS8A 2J5OA 4MQVA 1TWHJ 2DQLA 3SZTA 4ZYGA 1ETVA 1UG0A 1A6IA 2COMA 3M8EA 2JMWA 2PMUA 3S3MA 4BHBA 1D3YA 1R5ID 4LOCA 1U5TA 2ID3A 1MBGA 4U0VA 1SFEA 1V5FA 2BEOA 2HPIA 1R1UA 4PUSA 2HOAA 4J01A 1B72A 4NC6A 4A93J 2M8EA 2HDCA 5JVTA 2DTRA 2E1CA 2DPUA 2DJIA 5ILUA 1HQCA 4KMUX 3AKZA 3HIFA 3TGNA 4PJNA 5DM6F 3NQOA 5F0FA 4BQOA 4A3EJ 3C18A 3D5RC 1R58A 2QM3A 2DT5A 2QF7A 1E3OC 2XGDA 2XGXA 2L2OA 1BW6A 2HQ5A 3DXJF 1HOMA 3ZRGA 1W4MA 1X1DA 3DKYA 2HTJA 1MIJA 1RETA 3BR6A 5L3CA 1JUPA 5J1YA 4GO1A 2ADUA 4XIDA 1IJWC 3RZOJ 5JHUA 1WGXA 1B6AA 3V4GA 1T38A 1SVMA 4LMYA 4Q48A 4A3IJ 1DUXC 3HSRA 4B4CA 4PJJA 3D1NI 1S29A 3TO7A 5J6XA 2FBIA 3RQ4A 4EM0B 4NHJA 4PFOA 3WTUC 4ABZA 1JKRC 4D7MA 4IZZA 1MMAA 3KYDB 1MJBA 2BV6A 1XGSA 3RYRA 2IVMA 3TP0A 4LLNA 2XF7A 2EV5A 1DU0A 4YFNF 1MMSA 1F43A 3G71I 2GBYA 4A3LJ 2EA4A 1F1ZA 5C3EJ 3Q0UA 5KAFC 3SZPA 4JBAA 2LLKA 1BOAA 5E17F 2EPFA 5B1BH 1MBHA 4TV7A 3CF2A 2BY1A 5HDGA 1DPRA 2XIGA 2VJ4A 2VODA 3I0TA 2IGMA 5GAEJ 4IRIA 4MGRA 3HOZJ 4YFXF 2VL8A 5EZHA 3TBIA 2IEKA 4CXFA 2BBYA 2XSDC 4KMFA 3DTEA 4XLFA 4CH7A 3BTLA 1QU3A 1IN8A 2X4HA 3WGHA 5LRSA 2QBYA 1K78A 3DP7A 1O3SA 2PMZN 3KZZA 4AVPA 4HNUA 2ZB9A 1ZQ3P 5K7ZA 2E7XA 3KEOA 2Y2ZA 4A69C 3K4LA 5FD5A 2OQRA 3U1DA 2LKPA 3K1PA 3K1MA 2DA4A 4GYIA 5LHGA 2KHMA 2DJNA 2XGEA 2UXNA 1EF4A 3HB9A 2EQRA 2LVSA 4HSRA 1P4XA 4ETSA 1ACIA 5DCMA 5E3NA 3DCFA 3PL8A 3ASNH 1TWGJ 2R7ZJ 1UHSA 2DMTA 3LSHA 4V2FA 5B66C 3CLOA 5HVQC 1TQMA 3EDPA 2O5RA 5FLVA 2B7EA 3E7LA 4HAMA 4ZDLA 2V9KA 3CCQI 2OAZA 5D4RA 2KZGA 2HGCA 2MC3A 3MKZA 5FRNA 3Q0VA 1J59A 1DGRM 3F8MA 2FA5A 3RDIA 2LREA 3OSFA 4IKFA 1XPXA 2LK2A 3VYRB 5DM7F 1Q1HA 3LSKA 3HBLA 1UG2A 1Y8RB 2ZXJA 1X2MA 3TL4X 4MTEA 3ZN0A 4XLAA 1ZR4A 4BQNA 4CICA 4XOTA 2EIJH 1AA7A 5F64A 1HSJA 1KQ9A 3LAPA 1OCCH 2XKOA 3BZCA 3HKZA 1B72B 1X3UA 1HKQA 2E60A 4C9YA 3T0YA 2CFOA 5IYCJ 4B3XA 1SVOA 2DN0A 2KZVA 1LDKB 3CMMA 1V5EA 5LEKA 1WHUA 2O03A 3WG7H 1YJWI 3HTUA 1HC8A 4E7SA 3JSPA 1U8BA 2A5WA 3HRMA 3RZDJ 4D7NA 1BC8C 3SYTA 3ZCOA 2RVCA 3H0GJ 1TC3C 5CVVA 5LGNA 1VQ4I 2L9SA 3BG3A 3L1PA 1XSDA 2E71A 2E2HJ 3GTMJ 1RUNA 5F08A 4BH9A 1NG6A 2W00A 2IA2A 2YX7A 2L3DA 5IYDJ 2NVYJ 2KRFA 2VKHA 1BN5A 4CCMA 4UVCA 1IV6A 1XMXA 3CDIA 1L0OC 2CW8A 3FKJA 3OIOA 1IGNA 2GIZA 4S04A 4GYGA 3KFWX 4FCYA 1U2WA 3DEWA 2CUZA 2DA6A 4A6EA 2YU9J 1D8KA 2LY9A 3DWLE 3I4NJ 3QAHA 1GUUA 1IF1A 2UZKA 3HOWJ 2IT0A 5DUKA 2F5DA 1MD0A 1ON2A 1OLTA 4HYEA 2JVGA 3PIPF 2HEOA 5IT9Z 3I53A 2L9NA 3V7SA 4RAZA 2GZWA 2O7OA 1KU2A 2RV8A 5JI6A 2K9LA 3CMEI 3IHUA 3QRFF 5K5RA 3A01A 4MFDA 1JE8A 1Y0NA 1OJLA 1NG7A 4RLQA 5EEAA 2I5UA 2V7FA 1WJDA 3V8KA 2ACJA 1GLNA 5LHHA 4R8HA 1DU6A 4ON0A 1V54H 1AOYA 4CSWA 4ANJA 1BA5A 4HX7A 4IRHA 5CQGA 3FF5A 1N75A 2MD0A 4Y52J 5D4SA 1ODDA 3BC8A 1FYMA 1BJAA 3A2KA 2O8XA 2RREA 5FO5A 1FMVA 4PCQA 2CMPA 1EV7A 3L2UA 2Y9YA 3A1YA 1YW7A 4MQ9F 2RQQA 2CQ7A 2DTZA 4II2A 5TGTA 1IV8A 4CGZA 2FX0A 1UELB 1W5CC 2O9LA 3UR3C 5BS6A 5K7FA 2D2WA 3ZMVA 2R93J 2ZFWA 1Z91A 2JA6J 1XDUA 3T5XA 5LGUA 3HL2A 2WAQN 3IH2A 3S1MJ 1JUMA 3H1CA 4ZJZA 2VASA 1O3TA 2M7BA 3QYBA 4RLFA 2M30A 2XKPA 4DIQA 4XORA 2MH2A 2DFHA 1SFOJ 1RESA 5J8FA 1Z3YA 3CUQB 2QQBA 2R7FA 2LY2A 3CLQA 3CMYA 4RAGA 1SD5A 1JJ8C 2IA1A 1IXCA 3OSGA 1U0JA 2KIMA 2LTPA 3TW6A 1WH7A 1LFPA 2IXSA 5L3BA 2X1CA 3GZ5A 5ICEA 1E3HA 4AD9A 5EGOA 4A0YA 2GA1A 3GTGJ 4LLGF 4BY7J 1WJ5A 1UAAA 2R7OA 2DAOA 2VIXA 5CJ9A 4LK1F 2K86A 2TDXA 3HSFA 2KJCA 2PG4A 2XAFA 1K6YA 2ECBA 5HODA 3NWSA 4A0ZA 1ETQA 1BR2A 3L2RA 1VZ0A 3IP4B 3ECOA 4I0AA 2KMUA 3N97A 5HS7A 4AYBA 4ZZDA 3HDDA 3H0DA 3PSFA 2GXBA 4G7ZF 1HA8A 4DNCA 5J4VA 5H2FC 2VLAA 1SD6A 2ELKA 4KIFA 2Y9ZA 4F55A 3BG9A 5E1WA 2M4GA 5DTDA 2OTLI 4MIMA 1W7PB 3DBLB 1P4AA 3MEXA 1MH3A 4KA4A 2O3FA 3FXMA 4AC0A 2GOXB 4M6XA 3CC4I 1W1WE 1X1CA 3D5LA 1YJNI 3ERMA 3K4CA 3RKXA 2HU9A 2X6XA 4NB5A 3VODA 1K61A 2YX4A 5BOXA 2DT7B 2QSGX 3K9TA 4A3JJ 4O3MA 4I6ZA 2HVQA 5J1RA 1D1BA 3OS0A 2STTA 1N25A 2KQRA 4M3GA 2PEXA 4Z6YA 1WQ2A 3TOAA 3TW7A 3GFIA 3V8JA 1I5ZA 2KFDA 4CYCB 2H94A 2FNAA 3RQIA 1A6QA 2QKMB 4OIRF 2NVQJ 4GGGA 3LSPA 1DGWY 3MQ0A 1X1AA 4AM3A 1R23A 4LG0A 1ON1A 5GPCA 2JUGA 3S1QJ 2O61A 1UHMA 3BR0A 3QQAA 1LEAA 4LFUA 3HUGB 4BXUA 3DPUA 3GEZA 4R1HA 3IWZA 2MW8A 3J7AY 4AWXB 1IXRC 2V1DA 1FT9A 5LFAA 4CCNA 2BW3B 4CUGA 4EGZA 1W0UA 1FPQA 3IAM2 2K4JA 4PJLA 1R36A 3P9CA 1OCRH 2X85A 4XSZF 3HC7A 2E1OA 4Y17A 1X1BA 5J1UA 1I6HJ 1KYZA 3DKXA 2EZIA 2DFFA 4RB2C 1SANA 2QENA 3BY6A 4PSWA 3WHBA 2B63J 5IT9K 3ONQA 3AAFA 1VQ6I 3B02A 1ORKA 1REPC 1MJAA 1SVLA 2JJ7A 3KZYA 3NAUA 1YX3A 1V4RA 1ETKA 2ZMEB 1ZYRF 2DLLA 4L9TA 3WTSC 1HLVA 4HF1A 2JK3A 5TJJA 3L7WA 5EG0B 1YJ9I 1TTYA 1WI3A 3FXOA 2F2EA 3SHFA 3F21A 1X4OA 2QVOA 3A0HC 3Q9SA 1YX5A 3BPXA 1FP1D 1MNDA 4NNJA 2E34A 3T1BA 5E3OA 3J80Z 3ABMH 4WCGA 2EJRA 4E7LA 2G7HA 5J47A 2CS3A 2GLOA 2Z1DA 2IGOA 2F5VA 1WJAA 4HEA2 1UB9A 2CU7A 4BDZA 4G6DA 4RA2A 2F5CA 2OV7A 1GV2A 1FOYA 3J81K 2FF4A 3F72A 1S72I 1J9IA 1QNTA 1T95A 1FP2A 1YQAA 4IPAA 4NC8A 1OCPA 4WXHA 3U2RA 1FBQA 1IC8A 4HG2A 1VQ7I 2L54A 5B5EC 4U7DA 4IL6C 1PUFB 4EATA 3HYIA 3W2AA 4Q4ZF 5ILVA 1KYWA 4N9IA 2E1NA 1APLC 5TRDA 4NQWA 4UUSA 3ZQLA 3F0CA 3O6BB 1DP3A 3KLOA 4S0HB 2WY7Q 4YEJA 5C4JJ 1SMTA 2ME6A 4AIKA 5KNLA 5J40A 4QSHA 2W4SA 3S1NJ 1QHGA 1HSTA 3GLXA 2ZFUA 1IN7A 2WY8Q 2BOLA 3S14J 3CCRI 3J80K 1MZBA 1TP4A 1BIBA 1B59A 3GMEA 3PFYA 4GCVA 3A02A 2MA3A 1QO0D 2D5VA 2DXIA 2JA7J 2F5FA 3C3WA 2OZ6A 5ILSA 3ZQCA 4XONA 4ESBA 3CCEI 1VQPI 2HVRA 3R0AA 3M4OJ 2OPTA 3OYNA 3SEQA 4XR6A 1ENHA 2DOEA 3GWZA 3GTQJ 2ESHA 3IV5A 2M1BA 1RC9A 4J00A 4MEYF 3HSEA 4A3FJ 4CCOA 1VFCA 3E6MA 1HF0A 4B48A 4M3BA 4ASNA 3KZIC 1IAWA 2DOAA 2MC4A 2X9DA 2NS0A 2RNJA 2F4MB 5FB2A 1IN6A 3JRAA 3OMYA 1O4XA 1UHWA 2VBWA 3HOVJ 2MH9A 1XG1A 4KN7X 4B3AA 2Z16A 3I4MJ 4YIRX 1IUYA 2ECCA 3CD6I 1WKMA 3IL2A 4MTDA 2XB5A 4JP0A 3I56I 2XPVA 4F7ZA 2LDUA 2QCOA 1OCZH 1G3WA 9ANTA 4XRSA 3CP2A 4IO9F 3MMYB 3BCBA 4WK8F 1J5YA 2OQGA 2NVUB 4XMYA 4RGUA 3HUGA 3KIOA 1PP7U 3TOBA 1PJRA 3KP4A 4LITA 2FUG2 1VQOI 3VOEA 2DMNA 4CCLA 5FLMJ 4E70A 1SEUA 3HOXJ 4I99C 3FMQA 1X3WB 1RUOA 1BI3A 4BAYA 2EA2A 2PMZA 2DW4A 3D0SA 3RPUA 5H6QA 1LVAA 1FMWA 1TT5B 3FXLA 1ZAOA 2P7VB 4B09A 1QVTA 3F22A 1Y0UA 2LR8A 3I5UA 1GXPA 6PAXA 5BQTA 4RGRA 2H1LA 2XDVA 4PK4A 2HQRA 4RDUA 1TQIA 1P4WA 4AVZA 3ZQGA 2NVXJ 4FE4A 2XVCA 3V42A 2D1VA 3WODF 2P6TA 1S8NA 3QYFA 4NC7A 4L9JA 5K7HA 2K5CA 3ABLH 5FFXA 3K70D 1HDDC 2CQKA 3S3OA 1QGPA 1D1AA 1OCOH 2VN2A 4M9ZA 2M5WA 1YI2I 2A69F 2X51A 2KIFA 2DT6A 3BTIA 1R71A 2EB7A 2WB1A 1U6GA 5E3LA 3E6BA 4JOMA 1YO5C 1ZLKA 4OMZA 2VBZA 2RN7A 3DBHB 2CFXA 3H9JA 2IPQX 4BXFA 4GXOA 1VI0A 2Q0OA 3G2BA 4FHTA 3V8LA 2QA4I 3DLAA 3K70C 3GCMA 2JZYA 3TDZC 4EM2A 1X4PA 1HCRA 2GA2A 3H3VK 1OYIA 4JX4A 1VF9A 4DGWB 3BR5A 3EUHC 3P9KA 3L2WA 5FFZA 2DMUA 3OYCA 5FKNA 1IO2A 2R5YA 4UUVA 2BY0A 2PFBA 3VWBA 2AXLA 3PNVA 4DYRA 4EJUA 3AG2H 2VJIA 1SFXA 4JQFA 1D5VA 2IS6A 3EPZA 4U7BA 1ETYA 2Y0MA 3DEEA 2KJBA 2VI6A 2LH9A 3PNYA 1MMNA 2P5VA 3MKLA 3T8TA 3PJRA 2A3SA 2M9HA 2NRAC 2A61A 1ZTRA 1PUFA 4L18B 4HDVA 2QYOA 4EQQA 4M9SA 1T56A 4XLHA 2OUMA 1W7PD 2WA0A 3HOSA 4M3DA 4OU0A 1N77A 2BE5F 1JHFA 2XHKA 1QQIA 2JSPA 5E20A 2DPDA 1MDMB 3H3ZA 5D5WB 3ZOBA 2P81A 1FWZA 4HZFA 1R9TJ 1D5YA 4A3MJ 4FISA 3U9GA 3IRQA 3MKWB 1JKPC 2GQQA 3DTIA 2W84A 3FZVA 2IBDA 1I39A 2CG4A 1BBYA 1IXSB 1X58A 4XICA 2JTVA 3CO6C 5TISC 4S05A 3MFKA 3AFHA 2O6GE 3QU3A 2K9MA 4IQ4A 4MO7A 3OYKA 4RBOA 2BY2A 5DCMB 3VFZA 5H6RA 4GFBA 1R22A 1JI8A 4BJ5C 2JN6A 2DQRA 2V6CA 1AWCA 1WFXA 2EZLA 4V19K 3S8PA 1G3YA 2ELJA 1FY7A 3COAC 3RTRA 2VT2A 1RPWA 2R7QA 3W6JB 1YITI 3BJ6A 4DJAA 1ETXA 1ZRCA 2XAGA 1USTA 1WZ2A 1PDNC 4O6JA 1YLFA 3E5QA 4ZH4F 5HLHA 2KISA 1JT6A 1OYWA 3OYAA 3I55I 1XN7A 2ZCWA 4XQFA 3VEPA 1R5GA 3OOPA 3E1SA 1ZG1A 2V1UA 2OA4A 5M5YJ 2VT3A 5F0HA 3BDDA 3BR1A 2DFIA 5HDNA 4G94A 2O0YA 5B3SH 3R0JA 2IRFG 1GDTA 1A5JA 5L3GA 1KZHA 1CGPA 1KU3A 2RNGA 1F9NA 1HW5A 4IJAA 2VC1A 2V79A 2LBFA 2GOMA 3MKYB 2EINH 1TBXA 4Y7NJ 4KIBA 3A0BC 2V6EA 3I9V2 4XN3A 2OD5A 5J3LA 3RPUD 4X0GA 4EVIA 1BI0A 1UJ8A 4EJWA 4BJTA 1TNTA 1FIAA 2VB6A 2QQ8A 3KP3A 3BG6A 4LJZF 1EJ9A 4BGDA 3EYYA 1NK2P 3MCZA 3HJEA 4C30A 3G73A 5E8IA 2W25A 2ICWG 3S93A 3O3KA 3P5JA 3CJNA 1OPCA 2VOPA 2LP0A 4U87A 2XF6A 4OMYA 3B6AA 1MJ9A 4II3A 2E1MB 1H88C 1YOVB 3OIPA 4M71A 2KDOA 1D8JA 4QIWN 4HOBA 4A5NA 2JSCA 2W1OA 3IC7A 2M0MA 4HF0A 3SXYA 3K4MA 3CCMI 4L0YB 2BXYA 3W6KB 3J7ZI 2FNPA 5KK1A 5H20A 1VTNC 3WTVC 4MLOA 4H4KC 2L4MA 3ULQB 2K7LA 1T2KA 3GFMA 2AHQA 4OIOF 3LAJA 3GLLA 1YE9A 2FEZA 4LB5A 3GW2A 4IXAA 2RC4A 1FSHA 2H8WA 4BY1J 3RSNA 2W82A 4EJVA 3HHGA 4EM1A 1I1GA 1BM9A 1NTCA 4HRIA 2R5YB 2OCCH 5E8GA 2F4IA 2ZMEC 4XKCA 5D5XB 3K0LA 3FMRA 3CP8A 3OYMA 3FHZA 1ZGJA 4E7IA 4I98B 4UV9A 4IHVA 4M72A 1R6RA 4N0BA 3BQZA 2XRNA 1HKSA 3E6DA 2QGUA 2IAIA 5HNHA 1CQTA 5CVRA 5FKLA 2FXAA 4CA0A 4IRGA 1XS9A 4ZTJA 3AG3H 2BZTA 5DYMA 4RAFA 2NOGA 3F3XA 4N4NB 2QLZA 5LEJA 1A35A 3ZQFA 4ZYHA 2LKSA 3HGYA 3FKIJ 4KT6A 2HFHA 2K40A 4NQWB 4UUSB 1HKTA 4E6KG 4XLNF 2ZJQF 1GVJA 3JAMK 2ID6A 1VQNI 1RR7A 2KIQA 5EYRA 3QP5A 2RGVA 2R7WA 4DW6A 2Y48A 1O7LA 4Q47A 2R5ZB 2IJLA 3K4KA 4M3FA 4M74A 4NBQA 4QWQA 5E1XA 5IT3A 5EGOB 2HKXA 1XDSA 1L3LA 1XTAA 2R4GA 1FLIA 3ABKH 4HLXA 2VE9A 2HYJA 5DD4A 1D0YA 2ME0A 2VQGA 3FXQA 1ZGWA 1GHCA 4ZYDA 2V1XA 4MHGA 2PN6A 3KP6A 1WPKA 3KETA 4IHTA 4UNOA 2R5ZA 3DFGA 3SJMA 4WWCA 4IEJA 2LG4A 4LLLA 3BJAA 3BWGA 3WTYC 1IDYA 3JR9A 3VYSB 1EKEA 1Z6RA 2BVMA 3P9IA 5KCMA 5GTIC 5HS9A 1GVDA 4PSXA 2HQAA 3OIQA 2ISYA 5FKMA 2NS7A 3MVPA 1OR7A 3GUDA 4RMNA 3LL7A 2Y69H 2HOTA 3PQKA 1KGSA 4OWRB 2XSJC 4HSTA 1MDMA 3ELKA 3G6EI 1LQ1A 4E7ZA 2CYYA 4GRIA 1J2XA 2JPBA 1S7EA 1WCMJ 2HQNA 4X1EA 3OYFA 1SD4A 2YR2A 2Y0SN 3NWTA 1LFBA 4CCJA 2LBFB 1XMAA 4EJOA 3GF2A 3E6CC 5CPRB 2WBMA 3JRHA 2JVHA 3G1OA 5FLXZ 5HLGA 1JGSA 5HNFA 2LNBA 2A6EF 1WH5A 1LEBA 1XD7A 3H36A 4IVNA 2DI3A 1IRZA 3OV8A 2QQ9A 1WI9A 1GXQA 2YS9A 4FTHA 3IKTA 1MMGA 4B47A 2M3AA 4HQEA 1T98A 3ZQ7A 3FBNB 4HLYA 1G6NA 4A3KJ 3C1DA 4XM3A 4KITB 1YIJI 3CJTB 2MLGA 3SQNA 4ESJA 3FX3A 4F91B 2IS1A 4M3EA 4AIJA 5GADJ 5CVIA 2R7RA 5CYVA 2JQ7A 2HXOA 2EWNA 1VQ8I 2KKOA 3M7GA 4BQQA 3I64A 3S3NA 4C3JJ 3S2WA 3G3ZA 3LSMA 1I50J 2ZO4A 5JVGF 4JX5A 2XAHA 2XAUA 3A4CA 3QPLA 2LRDA 4UXNA 4A3DJ 1NK3P 4FASD 4UUTA 2XB0X 1BIAA 2YPRA 2WTEA 2FQ3A 3PIOF 2LF7A 3K69A 3CO7C 1U8RA 3ABTA 3N05A 1LDDA 3CCYA 1EA3A 3OYJA 2BHYA 2QWWA 3AG1H 4F92B 4I2OA 2JA2A 2M87A 2E36A 2G7UA 5L3DA 2PMHA 3RJPA 5C4XJ 3ROUA 1H9TA 3QWLA 2A6HF 4F52A 5AIPA 1H0MA 4ZYEA 1XMKA 3ZQIA 2NNYA 4RB1A 3AL0B 4U0WA 3JTGA 3CCLI 2X1DA 2GXGA 5F04A 3Q9VA 1LFUP 3RCOA 1W36C 2L7KA 2GAUA 4BE1A 2Q2EA 1G4DA 2R7VA 3N4MA 4IOCF 1K78B 4XLEA 1SMYF 4XL9A 3K6GA 1ZRFA 3S17J 1KQ8A 2HOEA 2JUCA 5GAHJ 1Y1VJ 3OY9A 1E17A 1Z67A 3B6CA 3BLYA 3JRGA 4EJTA 3DV8A 5EG0A 3LSJA 2E2IJ 2Z5UA 3H5NA 1A36A 1MBJA 2AXTC 5BMZA 1DP7P 3WU0A 5JFRA 1FBUA 1T33A 1BL0A 3MZYA 3NARA 1FIPA 1KQ0A 1T0FC 1E0EA 2CUEA 1E3PA 1PVEA 2JRMA 3TO9A 1JXSA 3B73A 2DYSH 4YRVA 3TO6A 1JHHA 3KP2A 3W6VA 4ENNA 2I8DA 4L9VA 3PM1A 4L0ZB 1FEXA 1LB2A 4XRMA 4YIIA 2AS5F 3ZQQA 2M4KA 3JW4A 4ZC3A 3WGGA 4NUBA 2VPLA 2K4BA 4P5OA 3HRUA 1RIOH 3LA3A 3JAMZ 4KICA 5ICCA 4RB3C 1Z1DA 1J09A 1MBKA 1ITYA 1IN4A 2GIVA 4XLCA 4HW0A 1Y56A 4A3GJ 2H27A 5IP6A 2DA1A 3DF8A 2IGNA 3V7CA 3OYLA 3LOCA 1J0RA 4MNUA 3E0JB 1HBXG 1ERDA 4QLCU 3C2BA 4B43A 4BU2A 3GTPJ 2VQLA 3R60A 3CQZJ 2NXNB 4LG3A 5EJCA 2LOOA 4OIQF 4BE2A 3QU6A 2R92J 3JTHA 2PBIA 2FJ1A 2L4AA 3F23A 3OS2A 3D5SC 2FD5A 1LPQA 1FTZA 1O57A 1Y8QB 1B8IA 2E1MC 3CJRB 3S1RJ 4UB6C 4RM2A 4CZZA 3ABUA 4CO8A 4BXXJ 2EIKH 3QYEA 2Z3YA 3ERED 2OJED 2D1HA 4HX8A 4IOAF 3SFZA 4EMSA 3L00A 3CF5F 2R7UA 2NOJB 3RKWA 1U78A 1S6LA 2M2EA 4P96A 2KRHA 3RPQA 5F1RA 3ISPA 4KN4X 5EF6A 3TQNA 1FOWA 3L09A 2ZXIA 3CCUI 1R5HA 4Y13A 5HLTA 2K3FA 2P8TA 2HR3A 1R1TA 2WV1A 2COBA 1P7IA 3JSOA 4EGYA 3RKQA 1Z05A 2A6TA 2OF7A 1MGTA 4XBFA 4CYCA 4Y3OA 2DA5A 1QBJA 3KLNA 1TWCJ 2LD5A 2AQFA 1FC3A 2WB1N 1BJZA 3HOTA 2HDDA 2EILH 2DMPA 1IUFA 3ECHA 3GFLA 3MWMA 4R79A 2Y31A 2ELHA 5DUIA 2C6YA 5DDGA 1ZN2A 2P6SA 5FKOA 2WC2A 2VPRA 2FBHA 3WGIA 5DD8A 1ZR2A 3HHHA 2K9SA 5KHDA 4HV6A 4A5MA 2I10A 2B9SA 4HF2A 1T39A 4BACA 3L2VA 4BYYA 5FJ8J 3IWFA 3W2WA 1I3QJ 2ZC2A 3WE3A 2HNHA 4AIDA 2EV6A 2E35A 3GTOJ 1ZREA 3HM5A 2DOFA 4KIGA 3JRBA 3ZP5A 5CKTA 2HS5A 5LBQA 3I4PA 4CZCA 2L7FP 4A3BJ 1FSEA 1JKQC 2K27A 1CF7B 2ESNA 3MD2A 2JT1A 4DZJA 4D1QA 1U9OA 2HZDA 2JPCA 3I3LA 4ZDOA 2DK8A 1VQLI 4OINF 1O3QA 2KP6A 4N9HA 2HPMA 1Z21A 1I27A 1XGMA 3I59B 1DPUA 2OBPA 3S2HJ 3TEDA 2EZHA 3H3UA 5D6EA 1O7FA 3FMSA 4WF2A 1S7AA 1ETOA 4E4HA 1S3JA 2W24A 1Z77A 4XSXF 4B1RA 2KDZA 3EYIA 1RR8C 2EH3A 2NYXA 5IP7J 4BS9A 4RGSA 1LKXA 3F6OA 1Y1WJ 4E7HA 2PJRA 1MBEA 1TW2A 3R61A 1H8AC 1IRGA 5AIQA 3DQVC 4IHYA 1DQUA 2CW7A 3BJOA 1Y6IA 1V5GA 4BBSJ 2XAQA 4BJ6C 2LMDA 2Z99A 5IP9J 2K9NA 1YS6A 5K5QA 5CVJA 4KT5C 3MN2A 5E1ZB 3Q5FA 3E3VA 1S5LC 5JLWA 3VSLA 3H5RA 2D45A 2GM4A 3GVAA 4XLPF 4Y33A 2QEXI 2DDBA 2PJRB 4RAYA 1OISA 1S7OA 4KUMA 2HYFA 1MNEA 2NNNA 1DDNA 1MH4A 4L5IA 4PJMA 1AHDP 3OYEA 3IH3A 1P9QC 2ZJRF 1R49A 3BPVA 1YHQI 1RNLA 2LC2A 4HNTA 2VXZA 3REOA 4GDFA 5BNGA 2CUJA 3O8GA 2VJJA 3WHCA 5K5OA 1B9MA 2ZJPF 4P55A 1HW2A 4G6QA 5IY5H 3JRFA 5BPDA 1YRNB 1RI7A 2IW5A 1R00A 3DBRB 5FGMA 4BHCA 3ZMSA 4A2UA 1LE8A 4UHTA 4I76A 2HWVA 4LG0B 1VNDA 1MNMC 5LD2C 2FOWA 3ZN1A 1MBFA 3OYDA 3BZKA
chains in the Genus database with same CATH topology
4AYBA 3H0DA 3PSFA 3OIPA 2KDOA 2Q2EB 3VYTB 1HA8A 2W1OA 2M0MA 2VLAA 3K4MA 4HPQA 3VDXA 3OYGA 3OYBA 4MLOA 4F55A 2XC7A 2BW3A 2VXDA 3BCAA 2M4GA 4H4KC 3OR2C 2CV1A 2KPMA 2V4JC 2GOXB 1X1CA 3D5LA 4B44A 1YE9A 1SFKA 2OC6A 3DU6A 2KL4A 3OYHA 3K4JA 2HVSA 3VSKA 3K4CA 3LFUA 3UNGC 3AL0C 4F3QA 2HU9A 2X6XA 4QPQA 2W82A 3RSNA 1ZELA 2Q1ZB 4XNFA 3QODA 4HRIA 3W2VA 2DT7B 5FROA 4II3A 5FRMA 2F4IA 2VQHA 4XKCA 1WJEA 2L5QA 2HVQA 3OYMA 1D1BA 3CP8A 3OS0A 4E7IA 2KQRA 1PYVA 5HOOA 2HDWA 2MYSA 1R6RA 2IGKA 2P0WA 5HNHA 4QPOA 4CA0A 5JHFA 3LSIA 4ZTJA 2QKMB 1DGWY 1X1AA 2MABA 4F93B 3K4NA 4KISA 4N4NB 1Z7LA 2JUGA 3CZ6A 3KEYA 4ZTFA 3PUBA 4CCKA 3HUGB 4KT6A 3DPUA 1OR7C 4NQWB 3J7AY 1LVKA 4E6KG 4BUPA 3M1CA 3HPHA 5LFAA 2UWMA 3H9GA 2VKDA 4CCNA 2BW3B 4CUGA 3ZR8X 4ZDPA 2R7WA 1D0ZA 3IAM2 4PJLA 3OYIA 1WJCA 3K4KA 4PFPA 4OAZA 2E5NA 2V1NA 2CV2A 2X85A 3HC7A 3BG7A 3L2QA 2ZXHA 4E7JA 1D0XA 1X1BA 2R4GA 3DKXA 1D0YA 2VQGA 4FETA 2R7TA 4PSWA 3ONQA 2WADA 3OS1A 1KONA 2QKLB 3DPTA 3CESA 1BR4A 2LG4A 2CH0A 3GBGA 1YX3A 3KX2A 1W36D 3VYSB 4DBRA 2BVMA 5KCMA 2X6WA 4PSXA 2HQAA 3DU5A 3OOUA 3IAS2 3OIQA 4ITVA 4IQJA 4RMNA 3LL7A 3OWTA 1X4OA 1G59A 1YX5A 1UG0A 2Y0SA 3S3MA 1MNDA 4OWRB 4NNJA 2XSJC 1WJFA 2M7AA 4HSTA 4N4OB 4E7ZA 2R7SA 4GRIA 2WAEA 3SDBA 4E7LA 1V5FA 1IRXA 2CS3A 3OR1C 1D1CA 2HPIA 3OYFA 2Z1DA 2IGOA 4PUSA 4C2UA 4J01A 2F5VA 1WJAA 4HEA2 2K3PA 3NWTA 3TMOA 4BDZA 4CCJA 2LBFB 4G6TB 2DJIA 5CPRB 3AKZA 2WBMA 2OV7A 4KJZA 3K4BA 4PJNA 2JVHA 4BQOA 1T95A 4NC8A 3D5RC 5HNFA 4HG2A 2E1MB 3H5AA 4BEHB 2L2OA 3ZRGA 4EATA 1MMGA 1X1DA 4B47A 3DKYA 3W2AA 2M3AA 1Z3XA 3FBNB 3HPGA 4XM3A 4KITB 2V26A 3U21A 3HXLA 1DP3A 4F91B 2IS1A 2WY7Q 2R7RA 4YEJA 4BQQA 4PJJA 5KNLA 3S3NA 3EUKL 2IS4A 4DOZA 2W4SA 3LSMA 1QHGA 4AU7A 3H9QA 3RQ4A 2ZFUA 2XAUA 2WY8Q 2BOLA 3A4CA 2LRDA 4OAYA 3DPLC 4PFOA 4IZZA 1MMAA 3PFYA 4FASD 2DXIA 3OL3A 3OL4A 4XONA 2XF7A 2HVRA 3N05A 1EA3A 3OYNA 3SEQA 4P1WA 4XR6A 3OYJA 1S9HA 4F92B 3W3CA 4J00A 2JA2A 4CCOA 4B48A 3CF2A 2X1EA 2DOAA 2MC4A 4F52A 3K10A 2VJ4A 2IGMA 3PNTA 3OMYA 3C2GA 3AL0B 2AQEA 2Z16A 2X1DA 2W7NA 1G8XA 2VL8A 3TBIA 3RCOA 1W36C 2L7KA 4BE1A 2R7VA 3CP2A 3DTEA 3F9KA 4XLEA 3MMYB 3BCBA 4XLFA 4CH7A 4XL9A 3K6GA 3KYLA 1QU3A 1TT0A 4XMYA 3ZGKA 4YELA 3OY9A 3BLYA 1PJRA 4LITA 2FUG2 3H5NA 4ZYAA 3C2HA 4HNUA 4CCLA 4Y4RA 3K4LA 1T0FC 1E0EA 3SEZA 2X6YA 2PMZA 4YRVA 2KHMA 4LIUA 1FMWA 2I8DA 1MMDA 4HSRA 1TZLA 4BDYA 3ZQQA 2M4KA 4ZC3A 2VPLA 2XDVA 4NUBA 4PK4A 4P5OA 3PL8A 4AVZA 1SAUA 1J09A 3V42A 3LSHA 4XLCA 1X19A 5HVQC 3QYFA 1Y56A 4LIVA 2O5RA 4NC7A 4ZDLA 2K5CA 2V9KA 2IGNA 3PSIA 3OYLA 3K70D 3E0JB 3MKZA 5FRNA 4XN0A 1ERDA 4D9JA 4B43A 1DGRM 4BU2A 1D1AA 3S3OA 2VQLA 2LREA 2X51A 4IKFA 2DT6A 4LG3A 3VYRB 2LOOA 3LSKA 2MFZA 4XKVA 3ZXSA 2WB1A 4BE2A 3TL4X 4JOMA 4XLAA 4BQNA 2VQCA 4XOTA 1AA7A 3H9JA 2Z2SB 3D5SC 4BXFA 3OS2A 3G2BA 2E1MC 3CJRB 3H35A 1WJBA 3HKZA 4RM2A 2E60A 4C9YA 3QYEA 3DLAA 3K70C 2CFOA 1X4PA 4B3XA 2KZVA 1LDKB 3CMMA 2UV1A 4DGWB 1V5EA 3EUHC 2R7UA 2NOJB 1BOBA 4E7SA 3L2WA 2A5WA 3OYCA 3SYTA 3ZCOA 4E7KA 3VWBA 5CQEA 2L9SA 3PNVA 4BEHA 2KRHA 2VJIA 2KRCA 4JQFA 2IS6A 3EPZA 4U7BA 2VJ5A 2ZXIA 3DEEA 5HLTA 1NG6A 3HG9A 2LH9A 2W00A 1MMNA 3PNYA 2BVLA 3EUAA 3PJRA 2VKHA 2A6TA 4CCMA 3S32A 2CW8A 3FKJA 4Y3OA 2AQFA 4XLHA 2OUMA 3HOTA 3LMMA 2WA0A 3HOSA 2CUZA 1N77A 4R79A 1BR1A 3QOEA 4C2TA 2JSPA 3DWLE 4XKBA 3IUOA 3MKWB 3DTIA 5KHDA 1OLTA 2JVGA 3SZGA 4BACA 2L9NA 3L2VA 2IS2A 3FHNA 2WAQA 1N78A 2K9LA 3W2WA 2HNHA 3AFHA 4IQ4A 2K9MA 4XOPA 3OYKA 1NG7A 4RLQA 2V7FA 1WJDA 1JI8A 1QHHD 4BJ5C 1GLNA 4BE0A 5CKTA 4BL0B 1WFXA 4CZCA 3S8PA 2ELJA 3RTRA 2R7QA 4CSWA 3MD2A 4ANJA 4D1QA 5CQGA 4DJAA 1N75A 2HZDA 2MD0A 3I3LA 4ZDOA 3BC8A 2HPMA 2KP6A 3A2KA 1Z21A 3FDYA 2LYCA 2RREA 3OYAA 1FMVA 2CV0A 2KLOA 2CMPA 2LY1A 3LSGA 3L2UA 2F6CA 4XQFA 3A1YA 2RQQA 3E1SA 4E4HA 4II2A 5TGTA 4BS9A 2R7XA 1UELB 1LKXA 3UR3C 4E7HA 2PJRA 3HL2A 4ZJZA 3DQVC 2VASA 2M7BA 3QYBA 1DQUA 2DCEA 2CW7A 4RLFA 1Y6IA 2RNGA 1V5GA 4DIQA 4BJ6C 2UUZA 4XORA 2LBFA 2GOMA 3MKYB 3VSLA 3H5RA 1Z3YA 2V6EA 3I9V2 4XN3A 4Y33A 2LY2A 2PJRB 3RPUD 4X0GA 4XKWA 2WAFA 2VB6A 4BJTA 1U0JA 1MNEA 1LFPA 2IXSA 3VYUB 4PJMA 3BG6A 3M8JA 3OYEA 1P9QC 2X1CA 3FBIB 4RM3A 4BGDA 2LC2A 4HNTA 2VXZA 3DTKA 4C30A 2CUJA 1WJ5A 2E5ZA 2R7OA 4DBQA 1UAAA 4IX7A 2VIXA 2ZSHB 3CJQB 2VJJA 1MW7A 3S93A 1K6YA 2XF5A 3NWSA 4U87A 2XF6A 1BR2A 3L2RA 5LD2C 1VZ0A 3IP4B 2ZSIB 2KMUA 3OYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OV7 A;  2OUM A;  2VPL A; 
#chains in the Genus database with same CATH topology
 3K7A J;  5LHI A;  2ZKZ A;  2Q2E B;  4UVA A;  1BI1 A;  2FML A;  1V3F A;  3FXU A;  3IRR A;  1P92 A;  3PO2 J;  4HPQ A;  1Z6T A;  3M1E A;  5FKK A;  3V7R A;  4A6D A;  1ZLJ A;  2CSO A;  3OYB A;  5F1J A;  2XC7 A;  2BW3 A;  3BCA A;  4I7H A;  4BQA A;  2CV1 A;  2P5K A;  1YS7 A;  2MD5 A;  2V4J C;  5L3E A;  3LA2 A;  3ML6 A;  4WXC A;  4IF4 A;  4B44 A;  4Y15 A;  1SFK A;  2OC6 A;  1QA6 A;  3K4J A;  4PGG A;  1K4T A;  4ENM A;  2HVS A;  2PX9 A;  3UNG C;  2ZNY A;  3AL0 C;  3HZJ A;  4F3Q A;  4C2M J;  3K1N A;  4XNF A;  2XUB A;  3W2V A;  5EZG A;  2EIM H;  5FRO A;  5FRM A;  2VON A;  3WTX C;  3TDU C;  4D5C A;  3WTT C;  5F0C A;  3LA7 A;  2A68 F;  2F4O B;  2L7M P;  1PYV A;  1YRN A;  5HOO A;  4L5J A;  1TQP A;  2GXA A;  2K02 A;  2MYS A;  4LB6 B;  1K79 A;  3FWE A;  1I6X A;  2EFP A;  5D8K B;  3FK7 A;  1Z9C A;  1X1P A;  2M0C A;  1R4N B;  2FU4 A;  3Q0W A;  4LK0 F;  4QPO A;  5JHF A;  2K85 A;  3BQY A;  5LRR A;  2H6B A;  4XRF A;  3K4N A;  1B9N A;  3T8R A;  4MFE A;  3CZ6 A;  4ZTF A;  3MAJ A;  1FOX A;  1F5T A;  3PUB A;  3CTA A;  1FNN A;  3FM5 A;  3GXO A;  3EQL F;  2F5E A;  1T6S A;  4CDG A;  4BUP A;  1WSU A;  1FZP B;  3A03 A;  1XX5 A;  1OQY A;  3HPH A;  2UWM A;  2ZNZ A;  2W57 A;  1T08 B;  2VKD A;  1U5T C;  5GP9 A;  3ZR8 X;  2M8G X;  1D0Z A;  3S16 J;  3DKW A;  4M6Y A;  3KCC A;  3K2A A;  1K6O A;  2FRH A;  2L7Z A;  1HXD A;  3WU2 C;  4OAZ A;  2E5N A;  3ZQH A;  1MSF C;  2CV2 A;  5ICG A;  3BG5 A;  4YG2 F;  3BG7 A;  3L2Q A;  1ZHF A;  3FK6 A;  3QOP A;  1J7K A;  2V9P A;  5DCF A;  1K7A A;  1XGN A;  1M1E B;  2WAD A;  3HOU J;  1KON A;  2W48 A;  1K4S A;  5M3M J;  1OKR A;  4U88 A;  3CCS I;  1ZAR A;  2QKL B;  3ZPL A;  3BT9 A;  3GZN B;  5K1Y A;  2VE8 A;  3KX2 A;  3E5X A;  3CMA I;  1X3Z B;  2X0L A;  2PLY A;  5HLI A;  3CCJ I;  3DU5 A;  1H89 C;  5GTH C;  1AKH A;  3OOU A;  1F36 A;  3GZ6 A;  3P7N A;  1IRF A;  4PZJ A;  1JUS A;  2MBF A;  2TCT A;  5B1A H;  2RKH A;  3OWT A;  4DYQ A;  2Z33 A;  5GPA A;  4W1U A;  2Y0S A;  5DV5 A;  1WJF A;  1NHA A;  2M7A A;  3CDL A;  5HS8 A;  4N4O B;  2CQQ A;  2IP2 A;  3WTW C;  2MGQ A;  2WWY A;  2R7S A;  1QZZ A;  3O2P E;  2WAE A;  3SDB A;  4C3I J;  1IRX A;  3OR1 C;  1D1C A;  1G3T A;  4C2U A;  2PI0 A;  4V2G A;  2K3P A;  2FBK A;  1JJ6 C;  5KVR A;  3TMO A;  4D5F A;  1XSV A;  4G6T B;  5A2Q K;  4M6V A;  4P9U A;  4KJZ A;  2NS8 A;  1STZ A;  3K4B A;  1LUJ B;  2DK5 A;  3J7A O;  3RI4 A;  2XV4 S;  4BHP A;  1TL8 A;  1YTY A;  3H5A A;  4BEH B;  2CO5 A;  1EH6 A;  3QPT A;  4RGX A;  1B4A A;  5EEH A;  2TRT A;  1Z3X A;  1AU7 A;  2KT0 A;  3NRV A;  1RZ4 A;  3HPG A;  3I71 A;  2V26 A;  4Z2Y A;  1EH7 A;  2OZU A;  3GTJ J;  3U21 A;  3TP3 A;  2HTS A;  1JT0 A;  3FXR A;  3HXL A;  3CC2 I;  1R4M B;  3L2C A;  1VQM I;  5IPA A;  3PQJ A;  3FIS A;  2FQ4 A;  1FX7 A;  1WVR A;  1TLH B;  4HX4 A;  2VBX A;  2DU9 A;  2ISZ A;  2CJJ A;  3EUK L;  2IS4 A;  1XGO A;  4DOZ A;  3KEQ A;  4AU7 A;  3FXJ A;  3H9Q A;  4LD5 A;  1GT0 C;  4FQG A;  3ASO H;  4UB8 C;  4OAY A;  3DPL C;  2XRL A;  1W0T A;  1LJ9 A;  1RKW A;  2FE3 A;  3OL3 A;  2EBI A;  1SD7 A;  2Q8K A;  1X2N A;  3OL4 A;  4D0P A;  1WRJ A;  3KYC B;  1T0F A;  1R1V A;  5A2Q Z;  1YYV A;  2VUM J;  4P1W A;  1S9H A;  4I02 A;  2JA5 J;  3QP6 A;  4ZZL A;  3W3C A;  2CUF A;  3BTJ A;  2DA2 A;  1SFU A;  3BRO A;  1JGG A;  2XRO A;  3HTS B;  4G7O F;  2X1E A;  3GFJ A;  3K10 A;  2CQN A;  2RDP A;  3PNT A;  3I58 A;  4EEF G;  2DA3 A;  3C2G A;  1QZE A;  1QRY A;  1OFC X;  1KU9 A;  1WWX A;  2X48 A;  1PP8 F;  2AQE A;  2EFQ A;  2OU2 A;  3KPH A;  3JRD A;  1VQK I;  1XSX A;  2W7N A;  1G8X A;  3L9F A;  1K83 J;  2HI3 A;  1FOK A;  1I1S A;  1O3R A;  3NEU A;  3F9K A;  3H92 A;  3KYL A;  4O5V A;  1TT0 A;  5EDN A;  3M07 A;  3ZGK A;  4BKX A;  4YEL A;  1EH8 A;  2P5L C;  1H9G A;  2N8G A;  2CQX A;  4ZYA A;  2P4W A;  2W85 A;  3C2H A;  5AON A;  4UVB A;  3ZMT A;  4Y4R A;  4AYB N;  2QQA A;  1ZG5 A;  1P2F A;  4L5E A;  4U0Y A;  1IDZ A;  2H6C A;  5M3F J;  3JRE A;  2XPW A;  3G1M A;  1QPM A;  3ZMD A;  3F8B A;  3SEZ A;  3LSR A;  2X6Y A;  1J75 A;  2P7C B;  1W5T A;  1ZKG A;  2EFN A;  3QPH A;  1BW5 A;  4AIH A;  4LIU A;  2GWR A;  5F6F A;  5HDK A;  4BNC A;  1JTX A;  3RYP A;  2PQ8 A;  1MMD A;  3KP7 A;  1TZL A;  4BDY A;  2O8K A;  2BXZ A;  4G9Y A;  3CCV I;  4Q5S F;  1FYL A;  2PJP A;  4IHX A;  3FM3 A;  4OIP F;  1HW1 A;  1SAU A;  1YIO A;  5J4Y A;  2KIU A;  4A3C J;  3CC7 I;  1U9N A;  1X19 A;  5E18 F;  1XB4 A;  4EV0 A;  2CRG A;  1USS A;  4LIV A;  2G9W A;  1PUE E;  4BBR J;  1VQ5 I;  3MZ8 A;  3PSI A;  2LF8 A;  1ETW A;  4XN0 A;  4D9J A;  1JTY A;  1P7J A;  2XAJ A;  3FIW A;  1YW9 A;  1SC7 A;  2BY3 A;  1XC5 A;  2MFZ A;  4XKV A;  3ZXS A;  2JRT A;  3VB2 A;  4RB0 A;  2Y75 A;  5DEQ A;  2DOD A;  4C3H J;  2VQC A;  2Z2S B;  2LSO A;  3S2D J;  3H35 A;  3CUQ A;  1WJB A;  2OCE A;  1OYY A;  2DA7 A;  3F8C A;  4I0B A;  5GAG J;  2YUS A;  3S15 J;  3GTK J;  3BR3 A;  3J81 Z;  2M45 A;  2QUF A;  2DYR H;  1W5S A;  2UV1 A;  4FX0 A;  4HV5 A;  3R6S A;  4HQM A;  1MSE C;  4DQ2 A;  3G4S I;  2E7W A;  4L9N A;  4HA8 A;  1BOB A;  3ESW B;  2XPU A;  1JKO C;  1CF7 A;  2ZJ2 A;  3WU1 B;  4E7K A;  4YFK F;  5CQE A;  4BEH A;  1LE8 B;  3O8H A;  2KRC A;  2BHZ A;  1TWA J;  2VJ5 A;  3I54 A;  1TW3 A;  5E3M A;  3HG9 A;  2VKV A;  4QTR A;  1F4K A;  3EUA A;  2BVL A;  2EK5 A;  2Y30 A;  4HBL A;  2YU3 A;  3F8F A;  2R7D A;  4CYD A;  1A04 A;  3ZMZ A;  4YIF A;  3S32 A;  3J7Y J;  1E2X A;  3PO3 J;  4FT8 A;  3GX4 X;  1TNS A;  3MZH A;  1TWF J;  3LMM A;  3GO5 A;  3FXK A;  5D8L B;  2F48 A;  3LWF A;  3F6V A;  1G59 A;  1BR1 A;  3QOE A;  3Q3S A;  4C2T A;  2L9V A;  2H8R A;  4DZP A;  2VOO A;  4XKB A;  4AUX A;  3IUO A;  4J19 A;  3CUQ C;  4G8X A;  4WX9 A;  3HOY J;  4P9F A;  3SZG A;  2IS2 A;  1XCB A;  3FHN A;  2NAZ A;  2WAQ A;  3X2Q H;  4HDU A;  1N78 A;  3EUH A;  4KYW A;  4XOP A;  1W7P A;  1Q1V A;  2QBY B;  2VBY A;  3GTL J;  1ZGA A;  5CVU A;  1QHH D;  4BE0 A;  4BL0 B;  1IG7 A;  1OCT C;  3M3Y J;  3PFI A;  4FX4 A;  1I3A A;  4I09 A;  5KAI C;  4XRS G;  3SDG A;  4ENK A;  2L9R A;  2HOS A;  1ZG3 A;  3HRT A;  2LKX A;  2STW A;  2ETH A;  2QSH X;  3FDY A;  1U3E M;  1YFH A;  2LYC A;  1ZH5 A;  3EET A;  3U1K A;  2FSW A;  2CV0 A;  1YW8 A;  3RKY A;  2KLO A;  1MKM A;  2LY1 A;  3LSG A;  2F6C A;  2YSR A;  1A31 A;  2JA8 J;  2M34 A;  2X6O A;  2EFO A;  1RKT A;  3BR2 A;  5D5V B;  1UZC A;  4A12 A;  3IH4 A;  1NH3 A;  3BZ6 A;  2R7X A;  4OOI A;  4PDK A;  2CWE A;  3M8F A;  1KU7 A;  4PJ0 C;  1FJL A;  5E79 C;  2QSF X;  1Z0X A;  2DCE A;  2BYV E;  3JCU C;  1R7J A;  4ENJ A;  4JX6 A;  1FBS A;  2DO7 A;  2UUZ A;  1YG2 A;  4JYK A;  1ULY A;  4G7H F;  1U5T B;  1HDP A;  4LGW A;  5DS9 A;  3SFI A;  3R4K A;  4K2E A;  2EFW A;  2VKE A;  3IKV A;  4UV8 A;  3C7J A;  3JRI A;  3BP8 A;  4XKW A;  5ICF A;  2WAF A;  1Y39 A;  2HZT A;  1FTT A;  5LLQ A;  3DLL F;  1ONV A;  4FE7 A;  5C44 J;  1VQ9 I;  2V9V A;  3VYU B;  1KA8 A;  3M8J A;  4B8X A;  4IHS A;  3G1L A;  3FBI B;  4RM3 A;  5D5U B;  3LQQ A;  1V55 H;  4G12 A;  1AKH B;  3DEU A;  3DTK A;  2E5Z A;  4DBQ A;  3I59 A;  4IX7 A;  3CJQ B;  2ZSH B;  3K2Z A;  3AG4 H;  2ZME A;  1MW7 A;  2ZXW H;  2EV0 A;  2XGC A;  3M9A A;  4PGH A;  3WG9 A;  1POG A;  5EEG A;  3HRS A;  2XF5 A;  1ZK8 A;  3CUO A;  1ZRD A;  3UKG A;  1QVU A;  1BC7 C;  1Z7U A;  2IA0 A;  2ZSI B;  2XAS A;  1T8I A;  2CW0 F;  3HKZ N;  3RIR A;  1XCV A;  2UXX A;  3VYT B;  3TKY A;  5FD6 A;  2B0L A;  2DFE A;  3VDX A;  3OYG A;  3HGG A;  3BTC A;  2VXD A;  3OR2 C;  3E5U A;  2KPM A;  1IW7 F;  1OMI A;  5JR3 A;  2R3S A;  1C0W A;  1IZ1 A;  3CDH A;  3E97 A;  3LQR A;  2A05 A;  2DDA A;  2L0K A;  1G3S A;  2MSY A;  2H09 A;  2WV0 A;  3DU6 A;  2KL4 A;  3KE2 A;  3OYH A;  2RQP A;  2EZK A;  2DBB A;  2HYG D;  3VSK A;  1UCR A;  3LFU A;  5LGT A;  2HXI A;  4QPQ A;  1LDJ A;  1UFM A;  1ZEL A;  2Q1Z B;  1BI2 A;  3QOD A;  4XK4 A;  4X6A J;  3VPR A;  2VQH A;  4ESF A;  2FMY A;  3KP5 A;  5IYB J;  5JLX A;  4DYC A;  1WJE A;  2L5Q A;  1QPI A;  3A01 B;  2DMQ A;  2R0Q C;  2CGP A;  4JK1 X;  2A07 F;  4KNY A;  5D6F A;  2HDW A;  2MG4 A;  5BPI A;  2LFB A;  5M5X J;  2IGK A;  2A5Y B;  2P0W A;  3LFK A;  3PUF A;  3LSI A;  3ZMU A;  4KDP A;  1LNW A;  2MAB A;  4F93 B;  5M5W J;  4IHW A;  2JWT A;  1FYK A;  2E2J J;  4KIS A;  2MLK A;  3F8N A;  5F27 A;  1Z7L A;  2E19 A;  3KEY A;  4HNV A;  1GV5 A;  4NDL A;  4CCK A;  3QPS A;  5J8C A;  5IOZ A;  2Z9O A;  1OR7 C;  3WTZ A;  5ERI A;  1LVK A;  3M1C A;  2ZBK A;  1UMQ A;  3H9G A;  4M73 A;  4WXD A;  5L3F A;  5CLS A;  4ZDP A;  3GYH X;  2G0E A;  2HKO A;  1SAX A;  3OYI A;  1WJC A;  4UY8 I;  4PFP A;  4A0X A;  2RAE A;  1B1B A;  2V1N A;  1RRJ A;  2NVT J;  2ZXH A;  4E7J A;  1D0X A;  2L01 A;  2J5P A;  1P6R A;  1B8I B;  4FET A;  4I01 A;  2FOK A;  2R7T A;  1QZY A;  5FLX K;  3OS1 A;  4MEX F;  5ED4 A;  4H0E A;  3BOQ A;  3DPT A;  2QZ8 A;  3CES A;  4KFC A;  1BR4 A;  4CHU A;  2BGC A;  5IOY A;  2CH0 A;  1G2H A;  3GBG A;  1W36 D;  4DBR A;  3LNQ A;  4W97 A;  2AO9 A;  2VC0 A;  2X6W A;  3LST A;  2K9Q A;  2OTJ I;  4M9X A;  3IAS 2;  2H1K A;  3WE2 A;  3JRC A;  1IN5 A;  3HEF A;  4ITV A;  4IQJ A;  2L02 A;  4RS8 A;  2J5O A;  4MQV A;  1TWH J;  2DQL A;  3SZT A;  4ZYG A;  1ETV A;  1UG0 A;  1A6I A;  2COM A;  3M8E A;  2JMW A;  2PMU A;  3S3M A;  4BHB A;  1D3Y A;  1R5I D;  4LOC A;  1U5T A;  2ID3 A;  1MBG A;  4U0V A;  1SFE A;  1V5F A;  2BEO A;  2HPI A;  1R1U A;  4PUS A;  2HOA A;  4J01 A;  1B72 A;  4NC6 A;  4A93 J;  2M8E A;  2HDC A;  5JVT A;  2DTR A;  2E1C A;  2DPU A;  2DJI A;  5ILU A;  1HQC A;  4KMU X;  3AKZ A;  3HIF A;  3TGN A;  4PJN A;  5DM6 F;  3NQO A;  5F0F A;  4BQO A;  4A3E J;  3C18 A;  3D5R C;  1R58 A;  2QM3 A;  2DT5 A;  2QF7 A;  1E3O C;  2XGD A;  2XGX A;  2L2O A;  1BW6 A;  2HQ5 A;  3DXJ F;  1HOM A;  3ZRG A;  1W4M A;  1X1D A;  3DKY A;  2HTJ A;  1MIJ A;  1RET A;  3BR6 A;  5L3C A;  1JUP A;  5J1Y A;  4GO1 A;  2ADU A;  4XID A;  1IJW C;  3RZO J;  5JHU A;  1WGX A;  1B6A A;  3V4G A;  1T38 A;  1SVM A;  4LMY A;  4Q48 A;  4A3I J;  1DUX C;  3HSR A;  4B4C A;  4PJJ A;  3D1N I;  1S29 A;  3TO7 A;  5J6X A;  2FBI A;  3RQ4 A;  4EM0 B;  4NHJ A;  4PFO A;  3WTU C;  4ABZ A;  1JKR C;  4D7M A;  4IZZ A;  1MMA A;  3KYD B;  1MJB A;  2BV6 A;  1XGS A;  3RYR A;  2IVM A;  3TP0 A;  4LLN A;  2XF7 A;  2EV5 A;  1DU0 A;  4YFN F;  1MMS A;  1F43 A;  3G71 I;  2GBY A;  4A3L J;  2EA4 A;  1F1Z A;  5C3E J;  3Q0U A;  5KAF C;  3SZP A;  4JBA A;  2LLK A;  1BOA A;  5E17 F;  2EPF A;  5B1B H;  1MBH A;  4TV7 A;  3CF2 A;  2BY1 A;  5HDG A;  1DPR A;  2XIG A;  2VJ4 A;  2VOD A;  3I0T A;  2IGM A;  5GAE J;  4IRI A;  4MGR A;  3HOZ J;  4YFX F;  2VL8 A;  5EZH A;  3TBI A;  2IEK A;  4CXF A;  2BBY A;  2XSD C;  4KMF A;  3DTE A;  4XLF A;  4CH7 A;  3BTL A;  1QU3 A;  1IN8 A;  2X4H A;  3WGH A;  5LRS A;  2QBY A;  1K78 A;  3DP7 A;  1O3S A;  2PMZ N;  3KZZ A;  4AVP A;  4HNU A;  2ZB9 A;  1ZQ3 P;  5K7Z A;  2E7X A;  3KEO A;  2Y2Z A;  4A69 C;  3K4L A;  5FD5 A;  2OQR A;  3U1D A;  2LKP A;  3K1P A;  3K1M A;  2DA4 A;  4GYI A;  5LHG A;  2KHM A;  2DJN A;  2XGE A;  2UXN A;  1EF4 A;  3HB9 A;  2EQR A;  2LVS A;  4HSR A;  1P4X A;  4ETS A;  1ACI A;  5DCM A;  5E3N A;  3DCF A;  3PL8 A;  3ASN H;  1TWG J;  2R7Z J;  1UHS A;  2DMT A;  3LSH A;  4V2F A;  5B66 C;  3CLO A;  5HVQ C;  1TQM A;  3EDP A;  2O5R A;  5FLV A;  2B7E A;  3E7L A;  4HAM A;  4ZDL A;  2V9K A;  3CCQ I;  2OAZ A;  5D4R A;  2KZG A;  2HGC A;  2MC3 A;  3MKZ A;  5FRN A;  3Q0V A;  1J59 A;  1DGR M;  3F8M A;  2FA5 A;  3RDI A;  2LRE A;  3OSF A;  4IKF A;  1XPX A;  2LK2 A;  3VYR B;  5DM7 F;  1Q1H A;  3LSK A;  3HBL A;  1UG2 A;  1Y8R B;  2ZXJ A;  1X2M A;  3TL4 X;  4MTE A;  3ZN0 A;  4XLA A;  1ZR4 A;  4BQN A;  4CIC A;  4XOT A;  2EIJ H;  1AA7 A;  5F64 A;  1HSJ A;  1KQ9 A;  3LAP A;  1OCC H;  2XKO A;  3BZC A;  3HKZ A;  1B72 B;  1X3U A;  1HKQ A;  2E60 A;  4C9Y A;  3T0Y A;  2CFO A;  5IYC J;  4B3X A;  1SVO A;  2DN0 A;  2KZV A;  1LDK B;  3CMM A;  1V5E A;  5LEK A;  1WHU A;  2O03 A;  3WG7 H;  1YJW I;  3HTU A;  1HC8 A;  4E7S A;  3JSP A;  1U8B A;  2A5W A;  3HRM A;  3RZD J;  4D7N A;  1BC8 C;  3SYT A;  3ZCO A;  2RVC A;  3H0G J;  1TC3 C;  5CVV A;  5LGN A;  1VQ4 I;  2L9S A;  3BG3 A;  3L1P A;  1XSD A;  2E71 A;  2E2H J;  3GTM J;  1RUN A;  5F08 A;  4BH9 A;  1NG6 A;  2W00 A;  2IA2 A;  2YX7 A;  2L3D A;  5IYD J;  2NVY J;  2KRF A;  2VKH A;  1BN5 A;  4CCM A;  4UVC A;  1IV6 A;  1XMX A;  3CDI A;  1L0O C;  2CW8 A;  3FKJ A;  3OIO A;  1IGN A;  2GIZ A;  4S04 A;  4GYG A;  3KFW X;  4FCY A;  1U2W A;  3DEW A;  2CUZ A;  2DA6 A;  4A6E A;  2YU9 J;  1D8K A;  2LY9 A;  3DWL E;  3I4N J;  3QAH A;  1GUU A;  1IF1 A;  2UZK A;  3HOW J;  2IT0 A;  5DUK A;  2F5D A;  1MD0 A;  1ON2 A;  1OLT A;  4HYE A;  2JVG A;  3PIP F;  2HEO A;  5IT9 Z;  3I53 A;  2L9N A;  3V7S A;  4RAZ A;  2GZW A;  2O7O A;  1KU2 A;  2RV8 A;  5JI6 A;  2K9L A;  3CME I;  3IHU A;  3QRF F;  5K5R A;  3A01 A;  4MFD A;  1JE8 A;  1Y0N A;  1OJL A;  1NG7 A;  4RLQ A;  5EEA A;  2I5U A;  2V7F A;  1WJD A;  3V8K A;  2ACJ A;  1GLN A;  5LHH A;  4R8H A;  1DU6 A;  4ON0 A;  1V54 H;  1AOY A;  4CSW A;  4ANJ A;  1BA5 A;  4HX7 A;  4IRH A;  5CQG A;  3FF5 A;  1N75 A;  2MD0 A;  4Y52 J;  5D4S A;  1ODD A;  3BC8 A;  1FYM A;  1BJA A;  3A2K A;  2O8X A;  2RRE A;  5FO5 A;  1FMV A;  4PCQ A;  2CMP A;  1EV7 A;  3L2U A;  2Y9Y A;  3A1Y A;  1YW7 A;  4MQ9 F;  2RQQ A;  2CQ7 A;  2DTZ A;  4II2 A;  5TGT A;  1IV8 A;  4CGZ A;  2FX0 A;  1UEL B;  1W5C C;  2O9L A;  3UR3 C;  5BS6 A;  5K7F A;  2D2W A;  3ZMV A;  2R93 J;  2ZFW A;  1Z91 A;  2JA6 J;  1XDU A;  3T5X A;  5LGU A;  3HL2 A;  2WAQ N;  3IH2 A;  3S1M J;  1JUM A;  3H1C A;  4ZJZ A;  2VAS A;  1O3T A;  2M7B A;  3QYB A;  4RLF A;  2M30 A;  2XKP A;  4DIQ A;  4XOR A;  2MH2 A;  2DFH A;  1SFO J;  1RES A;  5J8F A;  1Z3Y A;  3CUQ B;  2QQB A;  2R7F A;  2LY2 A;  3CLQ A;  3CMY A;  4RAG A;  1SD5 A;  1JJ8 C;  2IA1 A;  1IXC A;  3OSG A;  1U0J A;  2KIM A;  2LTP A;  3TW6 A;  1WH7 A;  1LFP A;  2IXS A;  5L3B A;  2X1C A;  3GZ5 A;  5ICE A;  1E3H A;  4AD9 A;  5EGO A;  4A0Y A;  2GA1 A;  3GTG J;  4LLG F;  4BY7 J;  1WJ5 A;  1UAA A;  2R7O A;  2DAO A;  2VIX A;  5CJ9 A;  4LK1 F;  2K86 A;  2TDX A;  3HSF A;  2KJC A;  2PG4 A;  2XAF A;  1K6Y A;  2ECB A;  5HOD A;  3NWS A;  4A0Z A;  1ETQ A;  1BR2 A;  3L2R A;  1VZ0 A;  3IP4 B;  3ECO A;  4I0A A;  2KMU A;  3N97 A;  5HS7 A;  4AYB A;  4ZZD A;  3HDD A;  3H0D A;  3PSF A;  2GXB A;  4G7Z F;  1HA8 A;  4DNC A;  5J4V A;  5H2F C;  2VLA A;  1SD6 A;  2ELK A;  4KIF A;  2Y9Z A;  4F55 A;  3BG9 A;  5E1W A;  2M4G A;  5DTD A;  2OTL I;  4MIM A;  1W7P B;  3DBL B;  1P4A A;  3MEX A;  1MH3 A;  4KA4 A;  2O3F A;  3FXM A;  4AC0 A;  2GOX B;  4M6X A;  3CC4 I;  1W1W E;  1X1C A;  3D5L A;  1YJN I;  3ERM A;  3K4C A;  3RKX A;  2HU9 A;  2X6X A;  4NB5 A;  3VOD A;  1K61 A;  2YX4 A;  5BOX A;  2DT7 B;  2QSG X;  3K9T A;  4A3J J;  4O3M A;  4I6Z A;  2HVQ A;  5J1R A;  1D1B A;  3OS0 A;  2STT A;  1N25 A;  2KQR A;  4M3G A;  2PEX A;  4Z6Y A;  1WQ2 A;  3TOA A;  3TW7 A;  3GFI A;  3V8J A;  1I5Z A;  2KFD A;  4CYC B;  2H94 A;  2FNA A;  3RQI A;  1A6Q A;  2QKM B;  4OIR F;  2NVQ J;  4GGG A;  3LSP A;  1DGW Y;  3MQ0 A;  1X1A A;  4AM3 A;  1R23 A;  4LG0 A;  1ON1 A;  5GPC A;  2JUG A;  3S1Q J;  2O61 A;  1UHM A;  3BR0 A;  3QQA A;  1LEA A;  4LFU A;  3HUG B;  4BXU A;  3DPU A;  3GEZ A;  4R1H A;  3IWZ A;  2MW8 A;  3J7A Y;  4AWX B;  1IXR C;  2V1D A;  1FT9 A;  5LFA A;  4CCN A;  2BW3 B;  4CUG A;  4EGZ A;  1W0U A;  1FPQ A;  3IAM 2;  2K4J A;  4PJL A;  1R36 A;  3P9C A;  1OCR H;  2X85 A;  4XSZ F;  3HC7 A;  2E1O A;  4Y17 A;  1X1B A;  5J1U A;  1I6H J;  1KYZ A;  3DKX A;  2EZI A;  2DFF A;  4RB2 C;  1SAN A;  2QEN A;  3BY6 A;  4PSW A;  3WHB A;  2B63 J;  5IT9 K;  3ONQ A;  3AAF A;  1VQ6 I;  3B02 A;  1ORK A;  1REP C;  1MJA A;  1SVL A;  2JJ7 A;  3KZY A;  3NAU A;  1YX3 A;  1V4R A;  1ETK A;  2ZME B;  1ZYR F;  2DLL A;  4L9T A;  3WTS C;  1HLV A;  4HF1 A;  2JK3 A;  5TJJ A;  3L7W A;  5EG0 B;  1YJ9 I;  1TTY A;  1WI3 A;  3FXO A;  2F2E A;  3SHF A;  3F21 A;  1X4O A;  2QVO A;  3A0H C;  3Q9S A;  1YX5 A;  3BPX A;  1FP1 D;  1MND A;  4NNJ A;  2E34 A;  3T1B A;  5E3O A;  3J80 Z;  3ABM H;  4WCG A;  2EJR A;  4E7L A;  2G7H A;  5J47 A;  2CS3 A;  2GLO A;  2Z1D A;  2IGO A;  2F5V A;  1WJA A;  4HEA 2;  1UB9 A;  2CU7 A;  4BDZ A;  4G6D A;  4RA2 A;  2F5C A;  2OV7 A;  1GV2 A;  1FOY A;  3J81 K;  2FF4 A;  3F72 A;  1S72 I;  1J9I A;  1QNT A;  1T95 A;  1FP2 A;  1YQA A;  4IPA A;  4NC8 A;  1OCP A;  4WXH A;  3U2R A;  1FBQ A;  1IC8 A;  4HG2 A;  1VQ7 I;  2L54 A;  5B5E C;  4U7D A;  4IL6 C;  1PUF B;  4EAT A;  3HYI A;  3W2A A;  4Q4Z F;  5ILV A;  1KYW A;  4N9I A;  2E1N A;  1APL C;  5TRD A;  4NQW A;  4UUS A;  3ZQL A;  3F0C A;  3O6B B;  1DP3 A;  3KLO A;  4S0H B;  2WY7 Q;  4YEJ A;  5C4J J;  1SMT A;  2ME6 A;  4AIK A;  5KNL A;  5J40 A;  4QSH A;  2W4S A;  3S1N J;  1QHG A;  1HST A;  3GLX A;  2ZFU A;  1IN7 A;  2WY8 Q;  2BOL A;  3S14 J;  3CCR I;  3J80 K;  1MZB A;  1TP4 A;  1BIB A;  1B59 A;  3GME A;  3PFY A;  4GCV A;  3A02 A;  2MA3 A;  1QO0 D;  2D5V A;  2DXI A;  2JA7 J;  2F5F A;  3C3W A;  2OZ6 A;  5ILS A;  3ZQC A;  4XON A;  4ESB A;  3CCE I;  1VQP I;  2HVR A;  3R0A A;  3M4O J;  2OPT A;  3OYN A;  3SEQ A;  4XR6 A;  1ENH A;  2DOE A;  3GWZ A;  3GTQ J;  2ESH A;  3IV5 A;  2M1B A;  1RC9 A;  4J00 A;  4MEY F;  3HSE A;  4A3F J;  4CCO A;  1VFC A;  3E6M A;  1HF0 A;  4B48 A;  4M3B A;  4ASN A;  3KZI C;  1IAW A;  2DOA A;  2MC4 A;  2X9D A;  2NS0 A;  2RNJ A;  2F4M B;  5FB2 A;  1IN6 A;  3JRA A;  3OMY A;  1O4X A;  1UHW A;  2VBW A;  3HOV J;  2MH9 A;  1XG1 A;  4KN7 X;  4B3A A;  2Z16 A;  3I4M J;  4YIR X;  1IUY A;  2ECC A;  3CD6 I;  1WKM A;  3IL2 A;  4MTD A;  2XB5 A;  4JP0 A;  3I56 I;  2XPV A;  4F7Z A;  2LDU A;  2QCO A;  1OCZ H;  1G3W A;  9ANT A;  4XRS A;  3CP2 A;  4IO9 F;  3MMY B;  3BCB A;  4WK8 F;  1J5Y A;  2OQG A;  2NVU B;  4XMY A;  4RGU A;  3HUG A;  3KIO A;  1PP7 U;  3TOB A;  1PJR A;  3KP4 A;  4LIT A;  2FUG 2;  1VQO I;  3VOE A;  2DMN A;  4CCL A;  5FLM J;  4E70 A;  1SEU A;  3HOX J;  4I99 C;  3FMQ A;  1X3W B;  1RUO A;  1BI3 A;  4BAY A;  2EA2 A;  2PMZ A;  2DW4 A;  3D0S A;  3RPU A;  5H6Q A;  1LVA A;  1FMW A;  1TT5 B;  3FXL A;  1ZAO A;  2P7V B;  4B09 A;  1QVT A;  3F22 A;  1Y0U A;  2LR8 A;  3I5U A;  1GXP A;  6PAX A;  5BQT A;  4RGR A;  2H1L A;  2XDV A;  4PK4 A;  2HQR A;  4RDU A;  1TQI A;  1P4W A;  4AVZ A;  3ZQG A;  2NVX J;  4FE4 A;  2XVC A;  3V42 A;  2D1V A;  3WOD F;  2P6T A;  1S8N A;  3QYF A;  4NC7 A;  4L9J A;  5K7H A;  2K5C A;  3ABL H;  5FFX A;  3K70 D;  1HDD C;  2CQK A;  3S3O A;  1QGP A;  1D1A A;  1OCO H;  2VN2 A;  4M9Z A;  2M5W A;  1YI2 I;  2A69 F;  2X51 A;  2KIF A;  2DT6 A;  3BTI A;  1R71 A;  2EB7 A;  2WB1 A;  1U6G A;  5E3L A;  3E6B A;  4JOM A;  1YO5 C;  1ZLK A;  4OMZ A;  2VBZ A;  2RN7 A;  3DBH B;  2CFX A;  3H9J A;  2IPQ X;  4BXF A;  4GXO A;  1VI0 A;  2Q0O A;  3G2B A;  4FHT A;  3V8L A;  2QA4 I;  3DLA A;  3K70 C;  3GCM A;  2JZY A;  3TDZ C;  4EM2 A;  1X4P A;  1HCR A;  2GA2 A;  3H3V K;  1OYI A;  4JX4 A;  1VF9 A;  4DGW B;  3BR5 A;  3EUH C;  3P9K A;  3L2W A;  5FFZ A;  2DMU A;  3OYC A;  5FKN A;  1IO2 A;  2R5Y A;  4UUV A;  2BY0 A;  2PFB A;  3VWB A;  2AXL A;  3PNV A;  4DYR A;  4EJU A;  3AG2 H;  2VJI A;  1SFX A;  4JQF A;  1D5V A;  2IS6 A;  3EPZ A;  4U7B A;  1ETY A;  2Y0M A;  3DEE A;  2KJB A;  2VI6 A;  2LH9 A;  3PNY A;  1MMN A;  2P5V A;  3MKL A;  3T8T A;  3PJR A;  2A3S A;  2M9H A;  2NRA C;  2A61 A;  1ZTR A;  1PUF A;  4L18 B;  4HDV A;  2QYO A;  4EQQ A;  4M9S A;  1T56 A;  4XLH A;  2OUM A;  1W7P D;  2WA0 A;  3HOS A;  4M3D A;  4OU0 A;  1N77 A;  2BE5 F;  1JHF A;  2XHK A;  1QQI A;  2JSP A;  5E20 A;  2DPD A;  1MDM B;  3H3Z A;  5D5W B;  3ZOB A;  2P81 A;  1FWZ A;  4HZF A;  1R9T J;  1D5Y A;  4A3M J;  4FIS A;  3U9G A;  3IRQ A;  3MKW B;  1JKP C;  2GQQ A;  3DTI A;  2W84 A;  3FZV A;  2IBD A;  1I39 A;  2CG4 A;  1BBY A;  1IXS B;  1X58 A;  4XIC A;  2JTV A;  3CO6 C;  5TIS C;  4S05 A;  3MFK A;  3AFH A;  2O6G E;  3QU3 A;  2K9M A;  4IQ4 A;  4MO7 A;  3OYK A;  4RBO A;  2BY2 A;  5DCM B;  3VFZ A;  5H6R A;  4GFB A;  1R22 A;  1JI8 A;  4BJ5 C;  2JN6 A;  2DQR A;  2V6C A;  1AWC A;  1WFX A;  2EZL A;  4V19 K;  3S8P A;  1G3Y A;  2ELJ A;  1FY7 A;  3COA C;  3RTR A;  2VT2 A;  1RPW A;  2R7Q A;  3W6J B;  1YIT I;  3BJ6 A;  4DJA A;  1ETX A;  1ZRC A;  2XAG A;  1UST A;  1WZ2 A;  1PDN C;  4O6J A;  1YLF A;  3E5Q A;  4ZH4 F;  5HLH A;  2KIS A;  1JT6 A;  1OYW A;  3OYA A;  3I55 I;  1XN7 A;  2ZCW A;  4XQF A;  3VEP A;  1R5G A;  3OOP A;  3E1S A;  1ZG1 A;  2V1U A;  2OA4 A;  5M5Y J;  2VT3 A;  5F0H A;  3BDD A;  3BR1 A;  2DFI A;  5HDN A;  4G94 A;  2O0Y A;  5B3S H;  3R0J A;  2IRF G;  1GDT A;  1A5J A;  5L3G A;  1KZH A;  1CGP A;  1KU3 A;  2RNG A;  1F9N A;  1HW5 A;  4IJA A;  2VC1 A;  2V79 A;  2LBF A;  2GOM A;  3MKY B;  2EIN H;  1TBX A;  4Y7N J;  4KIB A;  3A0B C;  2V6E A;  3I9V 2;  4XN3 A;  2OD5 A;  5J3L A;  3RPU D;  4X0G A;  4EVI A;  1BI0 A;  1UJ8 A;  4EJW A;  4BJT A;  1TNT A;  1FIA A;  2VB6 A;  2QQ8 A;  3KP3 A;  3BG6 A;  4LJZ F;  1EJ9 A;  4BGD A;  3EYY A;  1NK2 P;  3MCZ A;  3HJE A;  4C30 A;  3G73 A;  5E8I A;  2W25 A;  2ICW G;  3S93 A;  3O3K A;  3P5J A;  3CJN A;  1OPC A;  2VOP A;  2LP0 A;  4U87 A;  2XF6 A;  4OMY A;  3B6A A;  1MJ9 A;  4II3 A;  2E1M B;  1H88 C;  1YOV B;  3OIP A;  4M71 A;  2KDO A;  1D8J A;  4QIW N;  4HOB A;  4A5N A;  2JSC A;  2W1O A;  3IC7 A;  2M0M A;  4HF0 A;  3SXY A;  3K4M A;  3CCM I;  4L0Y B;  2BXY A;  3W6K B;  3J7Z I;  2FNP A;  5KK1 A;  5H20 A;  1VTN C;  3WTV C;  4MLO A;  4H4K C;  2L4M A;  3ULQ B;  2K7L A;  1T2K A;  3GFM A;  2AHQ A;  4OIO F;  3LAJ A;  3GLL A;  1YE9 A;  2FEZ A;  4LB5 A;  3GW2 A;  4IXA A;  2RC4 A;  1FSH A;  2H8W A;  4BY1 J;  3RSN A;  2W82 A;  4EJV A;  3HHG A;  4EM1 A;  1I1G A;  1BM9 A;  1NTC A;  4HRI A;  2R5Y B;  2OCC H;  5E8G A;  2F4I A;  2ZME C;  4XKC A;  5D5X B;  3K0L A;  3FMR A;  3CP8 A;  3OYM A;  3FHZ A;  1ZGJ A;  4E7I A;  4I98 B;  4UV9 A;  4IHV A;  4M72 A;  1R6R A;  4N0B A;  3BQZ A;  2XRN A;  1HKS A;  3E6D A;  2QGU A;  2IAI A;  5HNH A;  1CQT A;  5CVR A;  5FKL A;  2FXA A;  4CA0 A;  4IRG A;  1XS9 A;  4ZTJ A;  3AG3 H;  2BZT A;  5DYM A;  4RAF A;  2NOG A;  3F3X A;  4N4N B;  2QLZ A;  5LEJ A;  1A35 A;  3ZQF A;  4ZYH A;  2LKS A;  3HGY A;  3FKI J;  4KT6 A;  2HFH A;  2K40 A;  4NQW B;  4UUS B;  1HKT A;  4E6K G;  4XLN F;  2ZJQ F;  1GVJ A;  3JAM K;  2ID6 A;  1VQN I;  1RR7 A;  2KIQ A;  5EYR A;  3QP5 A;  2RGV A;  2R7W A;  4DW6 A;  2Y48 A;  1O7L A;  4Q47 A;  2R5Z B;  2IJL A;  3K4K A;  4M3F A;  4M74 A;  4NBQ A;  4QWQ A;  5E1X A;  5IT3 A;  5EGO B;  2HKX A;  1XDS A;  1L3L A;  1XTA A;  2R4G A;  1FLI A;  3ABK H;  4HLX A;  2VE9 A;  2HYJ A;  5DD4 A;  1D0Y A;  2ME0 A;  2VQG A;  3FXQ A;  1ZGW A;  1GHC A;  4ZYD A;  2V1X A;  4MHG A;  2PN6 A;  3KP6 A;  1WPK A;  3KET A;  4IHT A;  4UNO A;  2R5Z A;  3DFG A;  3SJM A;  4WWC A;  4IEJ A;  2LG4 A;  4LLL A;  3BJA A;  3BWG A;  3WTY C;  1IDY A;  3JR9 A;  3VYS B;  1EKE A;  1Z6R A;  2BVM A;  3P9I A;  5KCM A;  5GTI C;  5HS9 A;  1GVD A;  4PSX A;  2HQA A;  3OIQ A;  2ISY A;  5FKM A;  2NS7 A;  3MVP A;  1OR7 A;  3GUD A;  4RMN A;  3LL7 A;  2Y69 H;  2HOT A;  3PQK A;  1KGS A;  4OWR B;  2XSJ C;  4HST A;  1MDM A;  3ELK A;  3G6E I;  1LQ1 A;  4E7Z A;  2CYY A;  4GRI A;  1J2X A;  2JPB A;  1S7E A;  1WCM J;  2HQN A;  4X1E A;  3OYF A;  1SD4 A;  2YR2 A;  2Y0S N;  3NWT A;  1LFB A;  4CCJ A;  2LBF B;  1XMA A;  4EJO A;  3GF2 A;  3E6C C;  5CPR B;  2WBM A;  3JRH A;  2JVH A;  3G1O A;  5FLX Z;  5HLG A;  1JGS A;  5HNF A;  2LNB A;  2A6E F;  1WH5 A;  1LEB A;  1XD7 A;  3H36 A;  4IVN A;  2DI3 A;  1IRZ A;  3OV8 A;  2QQ9 A;  1WI9 A;  1GXQ A;  2YS9 A;  4FTH A;  3IKT A;  1MMG A;  4B47 A;  2M3A A;  4HQE A;  1T98 A;  3ZQ7 A;  3FBN B;  4HLY A;  1G6N A;  4A3K J;  3C1D A;  4XM3 A;  4KIT B;  1YIJ I;  3CJT B;  2MLG A;  3SQN A;  4ESJ A;  3FX3 A;  4F91 B;  2IS1 A;  4M3E A;  4AIJ A;  5GAD J;  5CVI A;  2R7R A;  5CYV A;  2JQ7 A;  2HXO A;  2EWN A;  1VQ8 I;  2KKO A;  3M7G A;  4BQQ A;  3I64 A;  3S3N A;  4C3J J;  3S2W A;  3G3Z A;  3LSM A;  1I50 J;  2ZO4 A;  5JVG F;  4JX5 A;  2XAH A;  2XAU A;  3A4C A;  3QPL A;  2LRD A;  4UXN A;  4A3D J;  1NK3 P;  4FAS D;  4UUT A;  2XB0 X;  1BIA A;  2YPR A;  2WTE A;  2FQ3 A;  3PIO F;  2LF7 A;  3K69 A;  3CO7 C;  1U8R A;  3ABT A;  3N05 A;  1LDD A;  3CCY A;  1EA3 A;  3OYJ A;  2BHY A;  2QWW A;  3AG1 H;  4F92 B;  4I2O A;  2JA2 A;  2M87 A;  2E36 A;  2G7U A;  5L3D A;  2PMH A;  3RJP A;  5C4X J;  3ROU A;  1H9T A;  3QWL A;  2A6H F;  4F52 A;  5AIP A;  1H0M A;  4ZYE A;  1XMK A;  3ZQI A;  2NNY A;  4RB1 A;  3AL0 B;  4U0W A;  3JTG A;  3CCL I;  2X1D A;  2GXG A;  5F04 A;  3Q9V A;  1LFU P;  3RCO A;  1W36 C;  2L7K A;  2GAU A;  4BE1 A;  2Q2E A;  1G4D A;  2R7V A;  3N4M A;  4IOC F;  1K78 B;  4XLE A;  1SMY F;  4XL9 A;  3K6G A;  1ZRF A;  3S17 J;  1KQ8 A;  2HOE A;  2JUC A;  5GAH J;  1Y1V J;  3OY9 A;  1E17 A;  1Z67 A;  3B6C A;  3BLY A;  3JRG A;  4EJT A;  3DV8 A;  5EG0 A;  3LSJ A;  2E2I J;  2Z5U A;  3H5N A;  1A36 A;  1MBJ A;  2AXT C;  5BMZ A;  1DP7 P;  3WU0 A;  5JFR A;  1FBU A;  1T33 A;  1BL0 A;  3MZY A;  3NAR A;  1FIP A;  1KQ0 A;  1T0F C;  1E0E A;  2CUE A;  1E3P A;  1PVE A;  2JRM A;  3TO9 A;  1JXS A;  3B73 A;  2DYS H;  4YRV A;  3TO6 A;  1JHH A;  3KP2 A;  3W6V A;  4ENN A;  2I8D A;  4L9V A;  3PM1 A;  4L0Z B;  1FEX A;  1LB2 A;  4XRM A;  4YII A;  2AS5 F;  3ZQQ A;  2M4K A;  3JW4 A;  4ZC3 A;  3WGG A;  4NUB A;  2VPL A;  2K4B A;  4P5O A;  3HRU A;  1RIO H;  3LA3 A;  3JAM Z;  4KIC A;  5ICC A;  4RB3 C;  1Z1D A;  1J09 A;  1MBK A;  1ITY A;  1IN4 A;  2GIV A;  4XLC A;  4HW0 A;  1Y56 A;  4A3G J;  2H27 A;  5IP6 A;  2DA1 A;  3DF8 A;  2IGN A;  3V7C A;  3OYL A;  3LOC A;  1J0R A;  4MNU A;  3E0J B;  1HBX G;  1ERD A;  4QLC U;  3C2B A;  4B43 A;  4BU2 A;  3GTP J;  2VQL A;  3R60 A;  3CQZ J;  2NXN B;  4LG3 A;  5EJC A;  2LOO A;  4OIQ F;  4BE2 A;  3QU6 A;  2R92 J;  3JTH A;  2PBI A;  2FJ1 A;  2L4A A;  3F23 A;  3OS2 A;  3D5S C;  2FD5 A;  1LPQ A;  1FTZ A;  1O57 A;  1Y8Q B;  1B8I A;  2E1M C;  3CJR B;  3S1R J;  4UB6 C;  4RM2 A;  4CZZ A;  3ABU A;  4CO8 A;  4BXX J;  2EIK H;  3QYE A;  2Z3Y A;  3ERE D;  2OJE D;  2D1H A;  4HX8 A;  4IOA F;  3SFZ A;  4EMS A;  3L00 A;  3CF5 F;  2R7U A;  2NOJ B;  3RKW A;  1U78 A;  1S6L A;  2M2E A;  4P96 A;  2KRH A;  3RPQ A;  5F1R A;  3ISP A;  4KN4 X;  5EF6 A;  3TQN A;  1FOW A;  3L09 A;  2ZXI A;  3CCU I;  1R5H A;  4Y13 A;  5HLT A;  2K3F A;  2P8T A;  2HR3 A;  1R1T A;  2WV1 A;  2COB A;  1P7I A;  3JSO A;  4EGY A;  3RKQ A;  1Z05 A;  2A6T A;  2OF7 A;  1MGT A;  4XBF A;  4CYC A;  4Y3O A;  2DA5 A;  1QBJ A;  3KLN A;  1TWC J;  2LD5 A;  2AQF A;  1FC3 A;  2WB1 N;  1BJZ A;  3HOT A;  2HDD A;  2EIL H;  2DMP A;  1IUF A;  3ECH A;  3GFL A;  3MWM A;  4R79 A;  2Y31 A;  2ELH A;  5DUI A;  2C6Y A;  5DDG A;  1ZN2 A;  2P6S A;  5FKO A;  2WC2 A;  2VPR A;  2FBH A;  3WGI A;  5DD8 A;  1ZR2 A;  3HHH A;  2K9S A;  5KHD A;  4HV6 A;  4A5M A;  2I10 A;  2B9S A;  4HF2 A;  1T39 A;  4BAC A;  3L2V A;  4BYY A;  5FJ8 J;  3IWF A;  3W2W A;  1I3Q J;  2ZC2 A;  3WE3 A;  2HNH A;  4AID A;  2EV6 A;  2E35 A;  3GTO J;  1ZRE A;  3HM5 A;  2DOF A;  4KIG A;  3JRB A;  3ZP5 A;  5CKT A;  2HS5 A;  5LBQ A;  3I4P A;  4CZC A;  2L7F P;  4A3B J;  1FSE A;  1JKQ C;  2K27 A;  1CF7 B;  2ESN A;  3MD2 A;  2JT1 A;  4DZJ A;  4D1Q A;  1U9O A;  2HZD A;  2JPC A;  3I3L A;  4ZDO A;  2DK8 A;  1VQL I;  4OIN F;  1O3Q A;  2KP6 A;  4N9H A;  2HPM A;  1Z21 A;  1I27 A;  1XGM A;  3I59 B;  1DPU A;  2OBP A;  3S2H J;  3TED A;  2EZH A;  3H3U A;  5D6E A;  1O7F A;  3FMS A;  4WF2 A;  1S7A A;  1ETO A;  4E4H A;  1S3J A;  2W24 A;  1Z77 A;  4XSX F;  4B1R A;  2KDZ A;  3EYI A;  1RR8 C;  2EH3 A;  2NYX A;  5IP7 J;  4BS9 A;  4RGS A;  1LKX A;  3F6O A;  1Y1W J;  4E7H A;  2PJR A;  1MBE A;  1TW2 A;  3R61 A;  1H8A C;  1IRG A;  5AIQ A;  3DQV C;  4IHY A;  1DQU A;  2CW7 A;  3BJO A;  1Y6I A;  1V5G A;  4BBS J;  2XAQ A;  4BJ6 C;  2LMD A;  2Z99 A;  5IP9 J;  2K9N A;  1YS6 A;  5K5Q A;  5CVJ A;  4KT5 C;  3MN2 A;  5E1Z B;  3Q5F A;  3E3V A;  1S5L C;  5JLW A;  3VSL A;  3H5R A;  2D45 A;  2GM4 A;  3GVA A;  4XLP F;  4Y33 A;  2QEX I;  2DDB A;  2PJR B;  4RAY A;  1OIS A;  1S7O A;  4KUM A;  2HYF A;  1MNE A;  2NNN A;  1DDN A;  1MH4 A;  4L5I A;  4PJM A;  1AHD P;  3OYE A;  3IH3 A;  1P9Q C;  2ZJR F;  1R49 A;  3BPV A;  1YHQ I;  1RNL A;  2LC2 A;  4HNT A;  2VXZ A;  3REO A;  4GDF A;  5BNG A;  2CUJ A;  3O8G A;  2VJJ A;  3WHC A;  5K5O A;  1B9M A;  2ZJP F;  4P55 A;  1HW2 A;  4G6Q A;  5IY5 H;  3JRF A;  5BPD A;  1YRN B;  1RI7 A;  2IW5 A;  1R00 A;  3DBR B;  5FGM A;  4BHC A;  3ZMS A;  4A2U A;  1LE8 A;  4UHT A;  4I76 A;  2HWV A;  4LG0 B;  1VND A;  1MNM C;  5LD2 C;  2FOW A;  3ZN1 A;  1MBF A;  3OYD A;  3BZK A; 
#chains in the Genus database with same CATH homology
 4AYB A;  3H0D A;  3PSF A;  3OIP A;  2KDO A;  2Q2E B;  3VYT B;  1HA8 A;  2W1O A;  2M0M A;  2VLA A;  3K4M A;  4HPQ A;  3VDX A;  3OYG A;  3OYB A;  4MLO A;  4F55 A;  2XC7 A;  2BW3 A;  2VXD A;  3BCA A;  2M4G A;  4H4K C;  3OR2 C;  2CV1 A;  2KPM A;  2V4J C;  2GOX B;  1X1C A;  3D5L A;  4B44 A;  1YE9 A;  1SFK A;  2OC6 A;  3DU6 A;  2KL4 A;  3OYH A;  3K4J A;  2HVS A;  3VSK A;  3K4C A;  3LFU A;  3UNG C;  3AL0 C;  4F3Q A;  2HU9 A;  2X6X A;  4QPQ A;  2W82 A;  3RSN A;  1ZEL A;  2Q1Z B;  4XNF A;  3QOD A;  4HRI A;  3W2V A;  2DT7 B;  5FRO A;  4II3 A;  5FRM A;  2F4I A;  2VQH A;  4XKC A;  1WJE A;  2L5Q A;  2HVQ A;  3OYM A;  1D1B A;  3CP8 A;  3OS0 A;  4E7I A;  2KQR A;  1PYV A;  5HOO A;  2HDW A;  2MYS A;  1R6R A;  2IGK A;  2P0W A;  5HNH A;  4QPO A;  4CA0 A;  5JHF A;  3LSI A;  4ZTJ A;  2QKM B;  1DGW Y;  1X1A A;  2MAB A;  4F93 B;  3K4N A;  4KIS A;  4N4N B;  1Z7L A;  2JUG A;  3CZ6 A;  3KEY A;  4ZTF A;  3PUB A;  4CCK A;  3HUG B;  4KT6 A;  3DPU A;  1OR7 C;  4NQW B;  3J7A Y;  1LVK A;  4E6K G;  4BUP A;  3M1C A;  3HPH A;  5LFA A;  2UWM A;  3H9G A;  2VKD A;  4CCN A;  2BW3 B;  4CUG A;  3ZR8 X;  4ZDP A;  2R7W A;  1D0Z A;  3IAM 2;  4PJL A;  3OYI A;  1WJC A;  3K4K A;  4PFP A;  4OAZ A;  2E5N A;  2V1N A;  2CV2 A;  2X85 A;  3HC7 A;  3BG7 A;  3L2Q A;  2ZXH A;  4E7J A;  1D0X A;  1X1B A;  2R4G A;  3DKX A;  1D0Y A;  2VQG A;  4FET A;  2R7T A;  4PSW A;  3ONQ A;  2WAD A;  3OS1 A;  1KON A;  2QKL B;  3DPT A;  3CES A;  1BR4 A;  2LG4 A;  2CH0 A;  3GBG A;  1YX3 A;  3KX2 A;  1W36 D;  3VYS B;  4DBR A;  2BVM A;  5KCM A;  2X6W A;  4PSX A;  2HQA A;  3DU5 A;  3OOU A;  3IAS 2;  3OIQ A;  4ITV A;  4IQJ A;  4RMN A;  3LL7 A;  3OWT A;  1X4O A;  1G59 A;  1YX5 A;  1UG0 A;  2Y0S A;  3S3M A;  1MND A;  4OWR B;  4NNJ A;  2XSJ C;  1WJF A;  2M7A A;  4HST A;  4N4O B;  4E7Z A;  2R7S A;  4GRI A;  2WAE A;  3SDB A;  4E7L A;  1V5F A;  1IRX A;  2CS3 A;  3OR1 C;  1D1C A;  2HPI A;  3OYF A;  2Z1D A;  2IGO A;  4PUS A;  4C2U A;  4J01 A;  2F5V A;  1WJA A;  4HEA 2;  2K3P A;  3NWT A;  3TMO A;  4BDZ A;  4CCJ A;  2LBF B;  4G6T B;  2DJI A;  5CPR B;  3AKZ A;  2WBM A;  2OV7 A;  4KJZ A;  3K4B A;  4PJN A;  2JVH A;  4BQO A;  1T95 A;  4NC8 A;  3D5R C;  5HNF A;  4HG2 A;  2E1M B;  3H5A A;  4BEH B;  2L2O A;  3ZRG A;  4EAT A;  1MMG A;  1X1D A;  4B47 A;  3DKY A;  3W2A A;  2M3A A;  1Z3X A;  3FBN B;  3HPG A;  4XM3 A;  4KIT B;  2V26 A;  3U21 A;  3HXL A;  1DP3 A;  4F91 B;  2IS1 A;  2WY7 Q;  2R7R A;  4YEJ A;  4BQQ A;  4PJJ A;  5KNL A;  3S3N A;  3EUK L;  2IS4 A;  4DOZ A;  2W4S A;  3LSM A;  1QHG A;  4AU7 A;  3H9Q A;  3RQ4 A;  2ZFU A;  2XAU A;  2WY8 Q;  2BOL A;  3A4C A;  2LRD A;  4OAY A;  3DPL C;  4PFO A;  4IZZ A;  1MMA A;  3PFY A;  4FAS D;  2DXI A;  3OL3 A;  3OL4 A;  4XON A;  2XF7 A;  2HVR A;  3N05 A;  1EA3 A;  3OYN A;  3SEQ A;  4P1W A;  4XR6 A;  3OYJ A;  1S9H A;  4F92 B;  3W3C A;  4J00 A;  2JA2 A;  4CCO A;  4B48 A;  3CF2 A;  2X1E A;  2DOA A;  2MC4 A;  4F52 A;  3K10 A;  2VJ4 A;  2IGM A;  3PNT A;  3OMY A;  3C2G A;  3AL0 B;  2AQE A;  2Z16 A;  2X1D A;  2W7N A;  1G8X A;  2VL8 A;  3TBI A;  3RCO A;  1W36 C;  2L7K A;  4BE1 A;  2R7V A;  3CP2 A;  3DTE A;  3F9K A;  4XLE A;  3MMY B;  3BCB A;  4XLF A;  4CH7 A;  4XL9 A;  3K6G A;  3KYL A;  1QU3 A;  1TT0 A;  4XMY A;  3ZGK A;  4YEL A;  3OY9 A;  3BLY A;  1PJR A;  4LIT A;  2FUG 2;  3H5N A;  4ZYA A;  3C2H A;  4HNU A;  4CCL A;  4Y4R A;  3K4L A;  1T0F C;  1E0E A;  3SEZ A;  2X6Y A;  2PMZ A;  4YRV A;  2KHM A;  4LIU A;  1FMW A;  2I8D A;  1MMD A;  4HSR A;  1TZL A;  4BDY A;  3ZQQ A;  2M4K A;  4ZC3 A;  2VPL A;  2XDV A;  4NUB A;  4PK4 A;  4P5O A;  3PL8 A;  4AVZ A;  1SAU A;  1J09 A;  3V42 A;  3LSH A;  4XLC A;  1X19 A;  5HVQ C;  3QYF A;  1Y56 A;  4LIV A;  2O5R A;  4NC7 A;  4ZDL A;  2K5C A;  2V9K A;  2IGN A;  3PSI A;  3OYL A;  3K70 D;  3E0J B;  3MKZ A;  5FRN A;  4XN0 A;  1ERD A;  4D9J A;  4B43 A;  1DGR M;  4BU2 A;  1D1A A;  3S3O A;  2VQL A;  2LRE A;  2X51 A;  4IKF A;  2DT6 A;  4LG3 A;  3VYR B;  2LOO A;  3LSK A;  2MFZ A;  4XKV A;  3ZXS A;  2WB1 A;  4BE2 A;  3TL4 X;  4JOM A;  4XLA A;  4BQN A;  2VQC A;  4XOT A;  1AA7 A;  3H9J A;  2Z2S B;  3D5S C;  4BXF A;  3OS2 A;  3G2B A;  2E1M C;  3CJR B;  3H35 A;  1WJB A;  3HKZ A;  4RM2 A;  2E60 A;  4C9Y A;  3QYE A;  3DLA A;  3K70 C;  2CFO A;  1X4P A;  4B3X A;  2KZV A;  1LDK B;  3CMM A;  2UV1 A;  4DGW B;  1V5E A;  3EUH C;  2R7U A;  2NOJ B;  1BOB A;  4E7S A;  3L2W A;  2A5W A;  3OYC A;  3SYT A;  3ZCO A;  4E7K A;  3VWB A;  5CQE A;  2L9S A;  3PNV A;  4BEH A;  2KRH A;  2VJI A;  2KRC A;  4JQF A;  2IS6 A;  3EPZ A;  4U7B A;  2VJ5 A;  2ZXI A;  3DEE A;  5HLT A;  1NG6 A;  3HG9 A;  2LH9 A;  2W00 A;  1MMN A;  3PNY A;  2BVL A;  3EUA A;  3PJR A;  2VKH A;  2A6T A;  4CCM A;  3S32 A;  2CW8 A;  3FKJ A;  4Y3O A;  2AQF A;  4XLH A;  2OUM A;  3HOT A;  3LMM A;  2WA0 A;  3HOS A;  2CUZ A;  1N77 A;  4R79 A;  1BR1 A;  3QOE A;  4C2T A;  2JSP A;  3DWL E;  4XKB A;  3IUO A;  3MKW B;  3DTI A;  5KHD A;  1OLT A;  2JVG A;  3SZG A;  4BAC A;  2L9N A;  3L2V A;  2IS2 A;  3FHN A;  2WAQ A;  1N78 A;  2K9L A;  3W2W A;  2HNH A;  3AFH A;  4IQ4 A;  2K9M A;  4XOP A;  3OYK A;  1NG7 A;  4RLQ A;  2V7F A;  1WJD A;  1JI8 A;  1QHH D;  4BJ5 C;  1GLN A;  4BE0 A;  5CKT A;  4BL0 B;  1WFX A;  4CZC A;  3S8P A;  2ELJ A;  3RTR A;  2R7Q A;  4CSW A;  3MD2 A;  4ANJ A;  4D1Q A;  5CQG A;  4DJA A;  1N75 A;  2HZD A;  2MD0 A;  3I3L A;  4ZDO A;  3BC8 A;  2HPM A;  2KP6 A;  3A2K A;  1Z21 A;  3FDY A;  2LYC A;  2RRE A;  3OYA A;  1FMV A;  2CV0 A;  2KLO A;  2CMP A;  2LY1 A;  3LSG A;  3L2U A;  2F6C A;  4XQF A;  3A1Y A;  2RQQ A;  3E1S A;  4E4H A;  4II2 A;  5TGT A;  4BS9 A;  2R7X A;  1UEL B;  1LKX A;  3UR3 C;  4E7H A;  2PJR A;  3HL2 A;  4ZJZ A;  3DQV C;  2VAS A;  2M7B A;  3QYB A;  1DQU A;  2DCE A;  2CW7 A;  4RLF A;  1Y6I A;  2RNG A;  1V5G A;  4DIQ A;  4BJ6 C;  2UUZ A;  4XOR A;  2LBF A;  2GOM A;  3MKY B;  3VSL A;  3H5R A;  1Z3Y A;  2V6E A;  3I9V 2;  4XN3 A;  4Y33 A;  2LY2 A;  2PJR B;  3RPU D;  4X0G A;  4XKW A;  2WAF A;  2VB6 A;  4BJT A;  1U0J A;  1MNE A;  1LFP A;  2IXS A;  3VYU B;  4PJM A;  3BG6 A;  3M8J A;  3OYE A;  1P9Q C;  2X1C A;  3FBI B;  4RM3 A;  4BGD A;  2LC2 A;  4HNT A;  2VXZ A;  3DTK A;  4C30 A;  2CUJ A;  1WJ5 A;  2E5Z A;  2R7O A;  4DBQ A;  1UAA A;  4IX7 A;  2VIX A;  2ZSH B;  3CJQ B;  2VJJ A;  1MW7 A;  3S93 A;  1K6Y A;  2XF5 A;  3NWS A;  4U87 A;  2XF6 A;  1BR2 A;  3L2R A;  5LD2 C;  1VZ0 A;  3IP4 B;  2ZSI B;  2KMU A;  3OYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...