2QSGX

Crystal structure of rad4-rad23 bound to a uv-damaged dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
54
structure length
54
Chain Sequence
GLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords native strand of the CPD-mismatch DNA
publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsgX00
4YIRX 2QSHX 2QSGX 1OQYA 2F4OB 1PVEA 2F4MB 1TP4A 1QZEA 1X3ZB 2QSFX 1X3WB 3ESWB
chains in the Genus database with same CATH superfamily
2LKXA 3LQRA 3DLAA 1IRGA 2HYFA 1XC5A 3I3LA 1POGA 3LOCA 5LBQA 4XQFA 1FBSA 1IUFA 1P9QC 3VPRA 1XSXA 2QQ9A 3Q0UA 4B43A 3DEWA 3G71I 4G9YA 4I09A 3ZP5A 4I0BA 4LG3A 5F64A 2HWVA 1U78A 1MMDA 4HNVA 2UXNA 4G94A 1SFXA 4F91B 1WVRA 3CCLI 5FLMJ 1NHAA 2E1MB 3PIPF 3COAC 3JRAA 2FSWA 3BG3A 3F8MA 2ZSIB 5K5QA 2EZLA 3K4CA 5A2QK 2ZJRF 1OJLA 1A5JA 4L0YB 1ZK8A 4D7NA 3CMEI 3J7YJ 4MHGA 3S17J 1ERDA 1VQ5I 1JKPC 1K4TA 3JRHA 4V19K 2TCTA 3K69A 2DMUA 1ZG1A 4AIJA 3CCUI 1LE8B 1R1UA 2JRTA 4PUSA 4A3FJ 1OYYA 4BHBA 3JAMZ 2GOMA 2WY8Q 1CF7B 1DGWY 4IHTA 4FT8A 3D0SA 1G3TA 4LLNA 2W84A 1MKMA 1S29A 3DEEA 5JLXA 1Y8RB 3SHFA 3K70D 5HS9A 4IHYA 3ISPA 3CDHA 4LGWA 3SQNA 3CF5F 3O8GA 4CCMA 3CC7I 4HF1A 4LB5A 3WG9A 4WXHA 4KNYA 2IA1A 2Y48A 2DQRA 1YIOA 3CCRI 3EQLF 2CUZA 3E1SA 1ZRFA 3DFGA 2HPMA 3FZVA 1Z9CA 3VEPA 1J59A 1OYWA 1WJFA 3H3ZA 4CCOA 1JUSA 2JMWA 2DT5A 2O3FA 3IH4A 3IV5A 3EPZA 3RPUA 5DCMB 3HBLA 2PMZA 3A03A 1TC3C 4U0YA 5M5WJ 1V4RA 2HS5A 4B3XA 2VIXA 1Z67A 4C3IJ 1XMXA 4ANJA 1IXRC 4XLEA 3VYRB 1IF1A 2LY9A 1XDSA 4WXDA 1W36D 2VONA 1GVDA 5F27A 1O57A 5F0CA 5CQGA 2JA8J 1JXSA 2HOSA 4KN4X 3QOPA 5HDGA 4ABZA 2O8XA 1XB4A 2RGVA 2CQ7A 3MKYB 1KU9A 1S9HA 2M2EA 3ML6A 2A07F 3LAJA 3GFMA 2XRNA 1SD4A 1WGXA 2V1XA 3HXLA 3SFZA 3OYCA 5J3LA 3OIQA 4ENNA 2J5PA 4RMNA 1VQ9I 4M9XA 4B48A 2ESHA 2IP2A 1BM9A 2GA1A 2XPVA 1JUPA 2IAIA 2EPFA 1B1BA 3KPHA 3L09A 5FFXA 3HOVJ 2A6TA 5EGOA 2XV4S 1P6RA 2XRLA 2K85A 5E1ZB 1MGTA 1QZZA 1HF0A 5KHDA 3ERED 1FSHA 4U7BA 2PMUA 4HX7A 4E6KG 1B9MA 3K0LA 4D5FA 4ESBA 2IS1A 4EMSA 3BCBA 1SFOJ 2XASA 2K4BA 2XGDA 3TW7A 1U5TB 2H6CA 5TJJA 4DYQA 4M3GA 2HQNA 4G7OF 4Y52J 3DCFA 2OZ6A 2XF6A 4W97A 3GZ5A 1W1WE 2W57A 3ZMTA 1OISA 1R4MB 2Q2EA 4FTHA 3UR3C 2WBMA 3ZQGA 1TBXA 4AVPA 2KKOA 4AUXA 1RIOH 4CGZA 1YW8A 3EDPA 4OAYA 3RQIA 4A3KJ 2HZTA 4WXCA 4A93J 3V7CA 5C44J 5FKOA 2Y2ZA 3TL4X 1FMVA 3TOBA 1Z6RA 2Q8KA 2EIMH 2BW3A 4QPOA 2JT1A 3MKLA 2L7MP 2HXIA 3GXOA 1UB9A 4YFKF 1S7OA 3C18A 2GBYA 4L5EA 5LGNA 3K1MA 4C3HJ 2W82A 3DP7A 3JSOA 3TO7A 3VFZA 4IQJA 5GP9A 4U0VA 1MH3A 4A3CJ 3H3UA 4XKWA 1U0JA 4YEJA 2O5RA 1Z21A 5EGOB 2XHKA 2HOTA 2HFHA 3FXJA 1U2WA 3KP4A 4EEFG 4PJLA 2N8GA 2OAZA 4CHUA 5E1WA 1IXCA 3ZMZA 3DTEA 4XBFA 4XLFA 2G7UA 4CYCB 4H4KC 3I5UA 1WKMA 1O3QA 2RKHA 5FKNA 4RAFA 5L3DA 5F0FA 3TP3A 2ZMEC 3K2AA 1QU3A 2O6GE 1WRJA 3QP5A 1H9TA 2NOGA 5B1BH 2L2OA 3T8TA 5C4JJ 3ZXSA 3ASNH 1KZHA 2GAUA 4PJ0C 3MKWB 2UXXA 2NVYJ 5EG0A 3V8JA 1AOYA 4GYIA 5IPAA 1HLVA 4KISA 4EM1A 1F5TA 4A12A 5D8LB 3ZQLA 3BR3A 3CF2A 3TMOA 3L2VA 1BL0A 3BPXA 2CV1A 2IPQX 2JA2A 4A3GJ 3IC7A 1TZLA 3Q9SA 1ENHA 3E6CC 3S1NJ 3M1EA 4ON0A 3DTKA 4KJZA 1CGPA 2BBYA 5ICCA 1FJLA 3GTQJ 1TW2A 2BW3B 2F5CA 2DLLA 4RAGA 4KIBA 4ITVA 3MCZA 2HEOA 1Z6TA 3VOEA 2FQ4A 2NRAC 2VBXA 4IOCF 2P81A 1OKRA 2IW5A 3HOWJ 4S04A 3S32A 3ELKA 3FDYA 3DF8A 4Z6YA 1E2XA 1MZBA 2IA0A 2OQRA 1WI9A 2KZVA 3T8RA 2GQQA 1TP4A 2HXOA 5IYDJ 2VL8A 3CCYA 4ENKA 2FNAA 1VI0A 4X0GA 3Q9VA 3OS0A 2A3SA 3ZRGA 3ULQB 3WTYC 5FLVA 5TGTA 3TQNA 4ASNA 3FMRA 5D5VB 3F21A 4IRIA 3PNTA 4G12A 3GTPJ 1FYLA 3K4LA 5HLTA 1K61A 3LSKA 3PFYA 4BXUA 2IXSA 4IF4A 1HC8A 1YJNI 1H89C 2L7ZA 2DA7A 2LC2A 2VQGA 4Q4ZF 4F92B 2RREA 2V9KA 3W6VA 2JN6A 1OR7A 3V4GA 2JPBA 2L7KA 1N75A 5EG0B 2PFBA 2V7FA 4YFNF 3KP7A 3E5XA 1JGSA 3OY9A 1RC9A 3ZPLA 5FRNA 2XKOA 1P92A 4BEHA 2H27A 1LDKB 3S1MJ 3IL2A 2VQCA 4RLQA 2M0CA 1R58A 3QU6A 3I4PA 2R7UA 3FKIJ 3ZQCA 1IDZA 4KA4A 2D2WA 2EINH 1FP2A 3ZCOA 2CUFA 2PMHA 1B9NA 4II2A 2LRDA 2IRFG 4EQQA 1V54H 2VE9A 4L5JA 3SEQA 2IA2A 1YHQI 2HVSA 4IJAA 3RYPA 1XTAA 5FGMA 2BHZA 3H0GJ 1ZH5A 2HR3A 4E70A 5HOOA 2L01A 1ZRCA 4XR6A 2ZSHB 3J80Z 1R1VA 1KQ9A 4GGGA 4IVNA 4ZJZA 4IHWA 1HDPA 1ONVA 3MWMA 4MQ9F 3H92A 2JUGA 3JSPA 2VXZA 2XGEA 2L4AA 3LSIA 1I1SA 3GZ6A 1I6HJ 2E1MC 3P9CA 3DQVC 3HTUA 4BXFA 3E3VA 1QO0D 2HPIA 4J19A 3S3NA 4N9HA 2DT7B 5H2FC 3OYIA 3QRFF 1VFCA 2FOKA 3KP2A 3RDIA 4UY8I 2QZ8A 2BXYA 5CJ9A 3BZKA 1I1GA 1FZPB 2DQLA 5BS6A 1ZREA 5HNFA 3OSFA 4PFOA 2HKXA 3BCAA 1ORKA 1K79A 3RI4A 5E1XA 3AFHA 4A3JJ 1XG1A 1SD7A 5B3SH 4WK8F 4E7HA 3WODF 2KRFA 1LNWA 3K4MA 4M9ZA 4XLCA 1SFEA 2W00A 1YIJI 2CH0A 4R79A 3HJEA 5JHFA 3S2DJ 1J7KA 1SEUA 5IY5H 4RS8A 2EV0A 4BEHB 4PGHA 2DDBA 2B0LA 5ILUA 1EA3A 5FKMA 4M3BA 1VQPI 2AO9A 3GW2A 5CPRB 4Y7NJ 4CXFA 2RNJA 1MBKA 4XLNF 2DODA 5CQEA 3BP8A 3GTMJ 4A69C 1T95A 1UHSA 3HUGA 2Z3YA 3GCMA 1FNNA 2XVCA 2PG4A 3LFUA 1KQ8A 2QWWA 2FMLA 3EYIA 4PCQA 1ODDA 2ELHA 2RV8A 4PJJA 4EV0A 1ETXA 2F5EA 1IRZA 2X6XA 1P4WA 1T0FA 4ZTFA 1UG0A 2AXTC 4FQGA 3BG6A 3MD2A 1I39A 3FK7A 2YS9A 4UB6C 3F8CA 1ETOA 3JTHA 2GXBA 2DJNA 1AWCA 3KEYA 4Q48A 2O61A 2MC4A 5HODA 3HGGA 2JTVA 3A1YA 4AC0A 3AG3H 4CUGA 3WTUC 3PSFA 1ON1A 2AHQA 3KZYA 2K9MA 2CFXA 2CW7A 2XGXA 2BGCA 1WJAA 1RUOA 1YI2I 1E17A 1KU2A 1PP7U 3L9FA 3WU0A 3BG7A 5FD6A 4ETSA 3F22A 3GLXA 5DYMA 3FMSA 4RAYA 2X4HA 1ZRDA 2EH3A 3Q0WA 1U5TC 5C4XJ 1Z0XA 4HSRA 3L2RA 1FBQA 3QAHA 4NC8A 2CS3A 4M3FA 2QF7A 1FIAA 5B5EC 1LKXA 5FROA 5D5WB 2I10A 3IWFA 4A0YA 2QSHX 4A3EJ 1FWZA 2ISYA 4HNTA 3ZMSA 4B1RA 2ZXIA 5FB2A 3A0BC 3O2PE 2FU4A 3CESA 3A0HC 2MBFA 3OYDA 1KU7A 3J7ZI 4MO7A 1OYIA 3HUGB 2MH9A 4YG2F 4Y15A 3K70C 2QA4I 3E5UA 2XDVA 3LNQA 1GLNA 1W4MA 2HGCA 2VT2A 2DOAA 5L3CA 2K27A 1FLIA 4A2UA 3HDDA 4BYYA 1FBUA 4XICA 1QHHD 3E97A 5BNGA 2LVSA 4DJAA 3BJ6A 3QQAA 3RKYA 3CC2I 2V6CA 3ASOH 1YFHA 2OJED 3OWTA 5TRDA 4AIKA 5LRRA 4UV8A 3DPTA 2KRHA 3I9V2 1H8AC 2LBFA 2QSGX 1VQOI 1PUFB 3CQZJ 3CUQA 2UV1A 2E60A 4BNCA 3J7AO 3RYRA 2FEZA 4PK4A 1J2XA 2E7XA 1X2MA 1HSJA 3V7SA 1PJRA 5BPDA 3K7AJ 1G8XA 2X6OA 1JHFA 2L3DA 3Q3SA 1R4NB 2KIUA 5HVQC 1MNDA 3HB9A 2DAOA 4N4NB 4BE2A 1HW2A 2QKMB 3ABMH 2E1NA 1BJZA 4FASD 3JREA 1STZA 4JX6A 4UXNA 5LHIA 2W85A 3F9KA 3JR9A 2VBYA 1SFKA 4E7IA 4O5VA 1VQLI 2KMUA 3WTXC 1LVAA 4QSHA 1RRJA 2LFBA 1UJ8A 2HQ5A 2P7VB 2VC1A 1VQ8I 2STWA 4RB0A 4HEA2 1ZLKA 4DOZA 1FIPA 3B02A 1S8NA 2D45A 4WX9A 4E7LA 3HGYA 2XB5A 4B8XA 3OIPA 2P7CB 4HV6A 3BTIA 1DPUA 3JRCA 3VSLA 4F55A 1YRNB 2GOXB 2RVCA 1DDNA 4KFCA 3MZ8A 3R60A 4MLOA 2R7TA 2VBZA 1USSA 1LVKA 3PQJA 2P8TA 5HLIA 3KYDB 1AKHA 1FOWA 2XIGA 5GPCA 3O8HA 2LBFB 2E1CA 1RESA 4C2TA 3CLOA 1K78A 4IKFA 1OCCH 2Y75A 4YFXF 3HC7A 1BW6A 4XN0A 3N97A 1HKSA 3CUQB 4M9SA 1B8IA 4OOIA 4BDYA 4ZZLA 2X1CA 1FTTA 3HOTA 2JA5J 2ZCWA 3IAM2 2NOJB 2PX9A 5LHGA 2ZXHA 3CJQB 3M8EA 3H1CA 3MZYA 4A5MA 1BA5A 3UNGC 4UUTA 1EH8A 2HKOA 5F04A 5JFRA 2K4JA 4OIOF 1J9IA 5HLHA 3HRUA 3L2QA 5ILSA 3PNVA 4XKBA 3I55I 3EYYA 1FOKA 1QNTA 3PSIA 5CVVA 1D0ZA 3MAJA 3MMYB 2R7WA 1UHMA 2VOPA 1D5YA 3I56I 3UKGA 3VSKA 2Y0MA 2K9QA 4IX7A 4Q5SF 2F5DA 3IRQA 2V9PA 3F8NA 3SFIA 3I59B 2JK3A 1X3UA 2V1UA 3F72A 5E20A 1SVMA 1GXQA 1S7AA 3S3OA 5EEGA 3W2VA 2L7FP 2P0WA 2M5WA 1FTZA 4HW0A 1QBJA 4OWRB 4U7DA 2ZKZA 3OL3A 2OQGA 5EYRA 3HRTA 4BAYA 2F4IA 2EK5A 1ETKA 1YW9A 3TO9A 2BZTA 2XROA 2FUG2 1BI3A 1QGPA 1AKHB 2KQRA 2XKPA 1GV2A 4FE7A 4HA8A 1K78B 4NC7A 3VB2A 2VQLA 3RKXA 1KA8A 2EBIA 2VODA 4P1WA 4C2MJ 3DPUA 3HIFA 4BQAA 4LD5A 5H6RA 1LPQA 1HSTA 3ZQHA 2L5QA 3FWEA 2JPCA 4I6ZA 1OFCX 1N77A 4BY7J 2CV0A 3J7AY 2DU9A 4NQWA 2LKSA 4L5IA 1LDDA 5CVRA 3FX3A 5KAFC 1NH3A 3H5NA 1TW3A 2ME0A 3FHZA 1MJ9A 5J8FA 2ETHA 1IN8A 4GFBA 3CZ6A 2CG4A 2W25A 3F23A 4GCVA 4BQQA 2DJIA 3GVAA 1W7PB 3IH2A 1DPRA 2Q1ZB 1I5ZA 2H8RA 4ZZDA 5K7FA 3S15J 3IAS2 1IN5A 1MJBA 1BBYA 2CO5A 1RPWA 3ROUA 1WH5A 3CP2A 1SAXA 1RETA 2E2HJ 1OR7C 3FXKA 2C6YA 3CCVI 4E4HA 2MYSA 2JZYA 5HS8A 4UVBA 3FM3A 1SVLA 2EZIA 5AIQA 2LKPA 3ZN0A 3WGIA 5LHHA 4EGZA 2XF7A 2ID6A 1TLHB 2F4MB 4AWXB 1O3RA 1ETWA 2ECBA 2WTEA 1ZR2A 2Z5UA 3FBNB 2Y0SN 2AQEA 4WWCA 4MFDA 3N4MA 2ZB9A 2KPMA 3DU6A 4HBLA 1VQ7I 2F48A 1XPXA 1Z77A 1TWCJ 4RDUA 1XMKA 1IRFA 2CQNA 4BHPA 4JX4A 2X9DA 3HHHA 1FPQA 3FBIB 1WJBA 3QPSA 1WWXA 1TQPA 1X1PA 2XAGA 1U9OA 5FJ8J 3BZ6A 4NQWB 3O3KA 5LGTA 3CCSI 5FLXZ 1JKOC 4JP0A 1G3SA 2CQQA 2HTJA 3HZJA 2OCEA 3OYGA 2HZDA 3QPTA 4N0BA 2OD5A 3TGNA 2BVLA 5J1RA 3QYEA 4PSXA 4RLFA 4AU7A 3A2KA 1WHUA 3ERMA 5L3GA 4EM0B 4YELA 5IOYA 2QQBA 3BTCA 1D1CA 3HPHA 2WAEA 1ZGWA 2BV6A 2OV7A 1SD5A 5LLQA 4G7HF 1KYZA 4FISA 2VLAA 3RTRA 3OV8A 3PL8A 2B9SA 4OIPF 2H1LA 1ZG3A 1HBXG 1KU3A 3DKYA 2XC7A 2NS7A 1UMQA 1XMAA 3E7LA 3GWZA 1G4DA 2KHMA 2BHYA 5JI6A 3D1NI 2PJRA 2TDXA 4N9IA 2LP0A 3GZNB 3M8JA 1BI2A 3S16J 3LA7A 3PO2J 4HYEA 1JTXA 5D4RA 3EETA 1YS7A 1F43A 3TW6A 4BXXJ 4HLYA 2A6HF 4BE1A 1IO2A 2ID3A 2EFWA 1S7EA 5JHUA 3OS2A 3AG1H 3J81K 5EJCA 1PDNC 1KYWA 4S05A 4M6YA 2XGCA 3WHCA 3K4KA 3GLLA 4L9VA 3L7WA 5IT9K 3E6MA 1XD7A 4CZCA 1TQIA 2UWMA 3S1QJ 1UHWA 2QYOA 2CGPA 4U88A 3TDZC 5GAEJ 3S3MA 5CVUA 1LFUP 2B7EA 4EJVA 4DYRA 3GO5A 4HPQA 5B1AH 4BH9A 4Y13A 3NAUA 4IL6C 4M71A 5K5OA 2ZBKA 3F8FA 5BOXA 2L54A 1E0EA 4GRIA 2QBYA 3QWLA 1HW5A 2F2EA 2ZXJA 1JTYA 1L0OC 2BEOA 1FMWA 5B66C 3HOZJ 2LYCA 2OBPA 4CCNA 2M0MA 3BQYA 2DBBA 2WV1A 2BYVE 2DA2A 4XL9A 3GFIA 3PO3J 5TISC 4KDPA 1GUUA 3T0YA 4M73A 1UCRA 2FX0A 3RZDJ 2Q2EB 4PZJA 4F3QA 3JRGA 2DA5A 1X3ZB 2FQ3A 3FIWA 5CVJA 4EGYA 2VKDA 3ZQQA 3SDBA 2DFEA 3PUFA 2BY0A 4I98B 1GXPA 2DFFA 2VKEA 2V1DA 5F6FA 4OMYA 5IP6A 4EJOA 5AONA 2RQQA 1LEAA 2K5CA 2VUMJ 2BE5F 1YE9A 2V79A 2QKLB 3A01A 3WE3A 2E71A 2WAQA 1RR7A 3SDGA 1FC3A 2CW0F 2LD5A 2MD5A 5EEAA 4NDLA 3U2RA 1MBHA 2EV6A 2HTSA 3RJPA 2E1OA 3CJRB 3R6SA 4XMYA 2LDUA 1IDYA 3P9IA 5KAIC 3MQ0A 3VDXA 4Y4RA 2LK2A 2VT3A 5J1UA 4OU0A 2BY3A 1D3YA 5F1RA 1ZQ3P 4EJWA 1EV7A 5EF6A 5A2QZ 4A3MJ 3HOUJ 4MEXF 3LSHA 2ESNA 1BI1A 1VQMI 3TEDA 2JSCA 2E5ZA 1MBGA 1OCTC 1X3WB 3JW4A 1R5HA 3F6OA 4HAMA 2PI0A 3KEOA 2OA4A 2I5UA 3FISA 3U9GA 1IV6A 4JBAA 2QSFX 4A6DA 1LFBA 2CWEA 2YU9J 3EUHC 3KFWX 4CZZA 1W0UA 3CUQC 2F6CA 4UHTA 1XGMA 2EWNA 1IAWA 1APLC 3MN2A 1QZYA 2LH9A 3H0DA 2EA4A 2OU2A 2DDAA 3GUDA 1P4XA 3BPVA 3E6BA 3HSRA 2XAUA 1R36A 1P2FA 3G6EI 1ZGJA 4IEJA 3CJTB 2MLGA 3ABTA 1WCMJ 1QVTA 3QPHA 3PUBA 3M3YJ 2EV5A 1MBEA 5ED4A 3HKZA 4P9FA 4YIFA 1S72I 2NS8A 2M8GX 2CYYA 3C1DA 3I64A 1NG7A 4ZYHA 1FY7A 3DBHB 2ZFWA 4DGWB 5FKLA 1YX3A 4KT5C 4A3BJ 4PJMA 3RPQA 3ZQFA 4ZTJA 1SC7A 2YR2A 1ZYRF 2W4SA 1DQUA 1XN7A 1IW7F 2OZUA 2XPWA 1LUJB 2COMA 2GIZA 4QPQA 1MNMC 4JOMA 1YO5C 2WC2A 3LFKA 1QHGA 1N25A 4DBQA 1P7IA 3D5RC 3OYHA 4HZFA 3VYSB 4QLCU 1F4KA 3NRVA 1QPMA 4X1EA 2A69F 3BROA 4BJTA 4BJ5C 2Z16A 2PN6A 5K7ZA 1QRYA 2DPUA 4LIVA 4BU2A 3WG7H 4XKVA 4KYWA 3GX4X 1B6AA 5DD4A 2CQXA 4O3MA 4XLHA 1V5FA 4XSZF 2NVQJ 1MH4A 2EFPA 2EIKH 1H0MA 2H94A 2K9LA 5EEHA 1T08B 2CRGA 5ERIA 2GXAA 1EH6A 1H88C 3F6VA 2LY1A 1PYVA 3KZIC 2AS5F 4PGGA 5FD5A 4LOCA 1VQ4I 5EZGA 4XN3A 3VODA 1Y6IA 3NARA 3OL4A 3GYHX 1E3OC 2P5KA 2RNGA 2DMNA 4XRFA 1I3QJ 4BS9A 5F08A 4B09A 1R49A 2R7ZJ 2LNBA 3HRSA 3Q0VA 1MBJA 5L3BA 1JUMA 4XNFA 5BMZA 2M7BA 1WQ2A 2R7FA 4MIMA 2G9WA 3AKZA 1G2HA 1MMSA 5ILVA 2DT6A 3B6CA 4CICA 2DPDA 1A6IA 2Z9OA 1UZCA 2FA5A 3ABUA 3KX2A 2HOEA 2VB6A 3HPGA 3R0AA 2JA6J 2CSOA 2F4OB 2Y0SA 3FM5A 2GLOA 3S93A 3M07A 2ZJ2A 1VZ0A 2VQHA 4IHVA 3OYBA 1X19A 4KIFA 5J4YA 3H5RA 2X6YA 2RDPA 2HQAA 1GHCA 1FYMA 3E5QA 4RB3C 3OYEA 3SZGA 2GIVA 2KIMA 4A6EA 4XOTA 1FYKA 5HDKA 3F8BA 5IT3A 3BOQA 2RN7A 4G8XA 2ZC2A 3LAPA 3W6KB 3AG4H 5K1YA 2LG4A 4IRGA 2NVXJ 3BR5A 4OIQF 2KT0A 3FXMA 1V55H 3KLOA 1WPKA 3OOUA 1JT0A 2DMTA 3PJRA 2ME6A 3HYIA 4MTEA 1D0YA 2R7VA 2GXGA 4BBSJ 2FF4A 1U9NA 1BR2A 2CQKA 1Z3XA 3MEXA 2O9LA 1SVOA 5KK1A 4JYKA 3KP3A 5J47A 3I54A 3TBIA 1FX7A 4I2OA 3TDUC 1TWGJ 1WJDA 1G6NA 4HG2A 5IYBJ 2FNPA 2FE3A 2WADA 5LGUA 1XDUA 2D5VA 2RAEA 1T98A 5J6XA 4Q47A 5DTDA 2HNHA 1WJEA 4M3DA 5LD2C 4ZYEA 5ICGA 1ITYA 1RNLA 5H20A 1D0XA 2DFIA 2JRMA 3DBLB 4RGUA 1ETYA 3P5JA 4YIIA 3S2WA 3JAMK 1ZTRA 2YX4A 4BQOA 5M3FJ 2L0KA 2ZNZA 2DCEA 4B44A 4LLGF 4XRSG 2LLKA 1E3PA 1SFUA 1UELB 2ADUA 2OC6A 5ICFA 1ZR4A 3WTVC 4GYGA 3HEFA 1OPCA 3A02A 2VC0A 4BACA 2E2JJ 2M4KA 2WY7Q 1XGSA 3LSGA 2ZXWH 2QENA 3NWSA 3CLQA 4DIQA 4AIHA 4ESJA 4HX4A 2R3SA 4CH7A 1Y1VJ 4V2GA 2L9SA 2NYXA 2KZGA 2H09A 1QVUA 4KICA 2KIFA 1JT6A 1C0WA 1B72A 1IZ1A 3QODA 5H6QA 3OYNA 3RZOJ 5DDGA 1V5GA 1T39A 4IPAA 2R7QA 1MW7A 2QQAA 4IOAF 2O8KA 2FOWA 1W36C 2ZJPF 1Z91A 1O7FA 1TNTA 1LDJA 3SEZA 3OYMA 3WE2A 5J4VA 5LEJA 2WWYA 1VQKI 4A3DJ 2R7XA 1K7AA 2YPRA 1D8JA 4IHSA 2ZNYA 4XRMA 2VXDA 1H9GA 2HYGD 1FT9A 4F7ZA 3CUOA 3DTIA 1YYVA 3S2HJ 1D1AA 1Z1DA 3HSFA 4I76A 4B47A 4CCJA 2QGUA 4XORA 3GMEA 5J8CA 4M6VA 2O0YA 1IG7A 2YX7A 3MVPA 1X1CA 2CFOA 2ELKA 3H9GA 4BL0B 3DU5A 3Q5FA 3D5SC 2COBA 3BG5A 4QIWN 3NEUA 3KCCA 5DV5A 4UVCA 3ZR8X 1JJ8C 2DMQA 3H9JA 4D5CA 1YS6A 2XAFA 2FXAA 2ZJQF 1IGNA 3WTSC 2YUSA 1YTYA 3CMMA 3K4JA 2QVOA 2V4JC 4XONA 2IJLA 3MZHA 4R8HA 2WAQN 5K7HA 2JSPA 1WFXA 1SANA 3FMQA 3K1NA 2OCCH 1TNSA 3QP6A 1X1BA 2X0LA 4JQFA 5HS7A 4CYDA 4L18B 9ANTA 4RM2A 1A31A 1OCRH 1TL8A 2NVUB 1B72B 4HDVA 3BT9A 2DI3A 5M5XJ 3K4NA 3P7NA 3GFLA 5GTIC 1NG6A 4PDKA 3RKQA 3ECHA 3OYFA 2HVQA 3BLYA 4EJTA 1GV5A 3QOEA 2ACJA 4RGRA 3C3WA 2DW4A 2VKVA 1RUNA 2Z33A 3I4MJ 4DZJA 2KISA 3RKWA 2DTZA 2K3PA 2R5ZA 1DUXC 2A68F 1Y1WJ 4U87A 3S1RJ 2F5VA 1I3AA 4MGRA 4G6DA 3LL7A 2M8EA 4A3LJ 1IRXA 2E19A 2MG4A 4XK4A 1T38A 3CD6I 4D9JA 3OOPA 4LJZF 3NQOA 3H36A 4WCGA 4C2UA 5DS9A 1Y0UA 4XSXF 2EJRA 2EFNA 1T2KA 3BTLA 2V9VA 1LE8A 1V5EA 2LMDA 3HKZN 3G73A 3IWZA 2JWTA 2A5WA 4D1QA 1CF7A 3I58A 3LA3A 4BKXA 4I01A 2MGQA 1U3EM 4E7SA 2KP6A 1IXSB 1R7JA 4MEYF 2RC4A 1U8BA 2F5FA 3MKZA 4AM3A 1XX5A 3U1KA 5FKKA 4Y33A 1FP1D 3CO6C 2DN0A 3OSGA 4IXAA 4BE0A 3LSPA 1EKEA 2VN2A 2KDZA 1W5CC 2IT0A 1RR8C 2ZFUA 1RKWA 4F93B 3G1LA 1IN4A 2IS6A 2KFDA 2OUMA 3SXYA 2KL4A 4IZZA 1B8IB 3WTZA 3A4CA 5IP7J 3WTTC 4HSTA 2LOOA 3HRMA 3E0JB 3V8KA 3OYLA 1BR1A 3HOYJ 2NVTJ 1Y39A 3TKYA 2VJ4A 5GAGJ 1QPIA 3R61A 6PAXA 4GXOA 4L9JA 4X6AJ 4WF2A 1U8RA 2CV2A 3PIOF 3R4KA 4A3IJ 1O3SA 3N05A 3ECOA 4IRHA 3ZMUA 1G59A 2EA2A 2JQ7A 1XGOA 5JVGF 1FSEA 3D5LA 2G0EA 3KP5A 2R5ZB 1ZGAA 2L4MA 3B6AA 1MMNA 5GAHJ 1BI0A 1YG2A 2VI6A 2H6BA 3H5AA 4NNJA 2R7DA 2DK8A 2IGMA 3WU1B 1Z05A 2YSRA 3L00A 5E3OA 1A36A 4Y17A 1O7LA 2LF8A 1WJCA 1MSEC 1ETVA 5J40A 4AYBN 4DYCA 2HDCA 4E7KA 3BQZA 3ONQA 3KETA 1O4XA 1ULYA 3RPUD 4I7HA 1XS9A 2QEXI 1JJ6C 5LEKA 2V1NA 5IYCJ 4BJ6C 2HQRA 1ETQA 3OYJA 2ECCA 2X6WA 2VJIA 1U5TA 1HOMA 3V7RA 1OCZH 1T56A 2DK5A 2P4WA 2Y9YA 2MABA 1BC7C 5GTHC 4A0XA 5L3EA 3ZGKA 5C3EJ 5M5YJ 3FXLA 2XAHA 3F0CA 1YJ9I 3DWLE 3GBGA 4LIUA 1HA8A 2NNYA 1JGGA 4ZDPA 3ZQ7A 1IV8A 1IN7A 4PSWA 4RA2A 2PJPA 4ZDLA 1G3WA 2HU9A 2TRTA 5IOZA 1IUYA 5FO5A 2JUCA 2X85A 3ZQIA 4ZDOA 2X1DA 1K4SA 2VPLA 3CDLA 2J5OA 2E34A 2OF7A 1HQCA 2HOAA 4RGSA 1T33A 2VKHA 2L9RA 4G6QA 4BBRJ 3CCEI 1NK3P 4RBOA 1OLTA 1Z3YA 4I99C 2V26A 1Y0NA 5CLSA 3LA2A 3RIRA 3FK6A 3MFKA 1YW7A 1VQNI 2W48A 3IP4B 4Z2YA 2GM4A 1J0RA 3OMYA 3WHBA 4PFPA 4KT6A 2MD0A 2MH2A 3J80K 1I6XA 2O7OA 3AAFA 3IKVA 1V3FA 3K6GA 1DP7P 1LJ9A 4UVAA 1WH7A 4CCLA 3AL0B 1R1TA 2AXLA 3CP8A 3HG9A 1ZLJA 4XLAA 4HQMA 2EQRA 2R93J 4TV7A 3PNYA 1R5ID 4UNOA 3PM1A 5FRMA 1EH7A 2LTPA 2W1OA 2O03A 4P96A 3RSNA 1JI8A 3LSTA 3GTLJ 2EFQA 4IQ4A 4CYCA 5E18F 2X1EA 1NK2P 1IN6A 4W1UA 2DA3A 1SMYF 2KJBA 1TTYA 4L9TA 1EJ9A 1R23A 1D5VA 2M3AA 4I02A 4KMFA 5J1YA 3ABKH 4LB6B 3CMAI 4J00A 1BW5A 3KZZA 1BIBA 4DNCA 3GTOJ 1ZKGA 5E8IA 1SMTA 1MDMA 2EZHA 5D6EA 3BR2A 3OYKA 3IH3A 2P5VA 2IVMA 1GT0C 1T0FC 2CUEA 1XCVA 1T6SA 4CO8A 4FETA 4KMUX 5GPAA 4HV5A 2DA6A 2MFZA 3K1PA 3FXRA 1G3YA 2OPTA 3PFIA 4LG0A 4S0HB 4M72A 4KIGA 2VASA 2VJJA 1W5SA 4YIRX 2ICWG 1K6OA 4B4CA 2YU3A 1J09A 2E35A 2AQFA 4I0AA 5L3FA 1S3JA 3GEZA 3X2QH 4BDZA 4U0WA 2PJRB 3WU2C 3I71A 2LREA 4DQ2A 2M1BA 1TWAJ 2KIQA 4ZYAA 3WGHA 3HOSA 4ENMA 2H1KA 3OR1C 3KLNA 2Z1DA 2HDWA 1HKQA 3DV8A 2JVGA 4CDGA 2DOEA 1HDDC 1MMAA 4CCKA 2DO7A 2K40A 4QWQA 1QQIA 3VWBA 2K02A 1BC8C 5IP9J 1OCPA 2KLOA 2EIJH 3LSJA 5DM6F 4FCYA 1IC8A 1HCRA 1R5GA 1XSVA 3ESWB 1A6QA 5F0HA 1MDMB 2E2IJ 4XOPA 3LSRA 3CO7C 1F36A 4XLPF 2IGOA 1WSUA 3K2ZA 2G7HA 4HDUA 3TO6A 3VYTB 4XKCA 4AD9A 3IRRA 5BQTA 1BJAA 3KIOA 4BHCA 4OAZA 4LK1F 1Q1HA 2KRCA 3JTGA 4CA0A 2DA1A 1W5TA 4XM3A 2MW8A 5EDNA 3OIOA 3KYLA 3TOAA 4C30A 4RM3A 5LRSA 2IS2A 2QUFA 4XRSA 2QBYB 3S8PA 1R71A 4PJNA 3DBRB 4LG0B 3SYTA 2MLKA 4KUMA 5D4SA 1USTA 2Y9ZA 2K9SA 3QU3A 3L2WA 3RQ4A 4EATA 3H9QA 3JRFA 2BY2A 4KN7X 1B4AA 3ZMDA 2A5YB 2L9VA 1ZELA 3GFJA 3OYAA 4HQEA 2JA7J 4V2FA 2DA4A 3LMMA 1M1EB 2WB1N 3I0TA 4LMYA 2FBHA 2Y31A 4LFUA 1J5YA 5E3MA 1DU0A 4MTDA 2R7OA 5KVRA 3FXQA 1JE8A 1TWFJ 2Z99A 3U1DA 3A01B 1RZ4A 2VBWA 1DP3A 3BC8A 4O6JA 1Y8QB 1GDTA 1BOAA 2PLYA 4ZYGA 2P6SA 2ZO4A 3M9AA 3JRBA 3HTSB 4HLXA 3OS1A 3CCMI 4MNUA 2M7AA 2CUJA 1RI7A 1XGNA 2M9HA 2EZKA 2IEKA 2H8WA 2WAFA 2L02A 2Z2SB 3O6BB 1S5LC 2FMYA 5DD8A 3IKTA 3G4SI 1TT5B 2UZKA 3WTWC 4YRVA 5DUKA 3BR0A 3G3ZA 3L2CA 2A61A 2PQ8A 3G2BA 2STTA 4ESFA 5E8GA 3BR1A 4FX4A 1MNEA 3HHGA 3CTAA 1TT0A 1OQYA 1K6YA 4DZPA 2K7LA 3V42A 5JLWA 3QYBA 2R0QC 2QM3A 3T1BA 3C2BA 3REOA 2LR8A 3NWTA 4ZYDA 3WGGA 1MSFC 2PEXA 2CW8A 2QQ8A 3RCOA 1XCBA 1WZ2A 3FXUA 2DYRH 4AYBA 4JX5A 4ENJA 1GVJA 4BY1J 1MMGA 4BUPA 5DUIA 1FEXA 4NUBA 4UV9A 3IHUA 1YQAA 2E36A 4RAZA 1D1BA 1YITI 2R92J 5E3NA 4HF0A 2DOFA 1SAUA 1A35A 4NHJA 4EM2A 2OTJI 2LY2A 1X1DA 2EB7A 4HF2A 5DCFA 1OMIA 4EVIA 2Q0OA 3M4OJ 3CMYA 1SD6A 5E17F 2ISZA 1QA6A 1HKTA 4QTRA 1UG2A 1JHHA 1X4PA 3BWGA 4E7ZA 3J81Z 1MJAA 1W0TA 4OINF 3BR6A 3BJAA 4AVZA 5IT9Z 4L9NA 1R22A 1BOBA 3EUKL 3DXJF 2XAJA 4D7MA 1OCOH 1IJWC 3SZPA 2XB0X 2R4GA 4RGXA 2MC3A 4AIDA 2IGNA 4H0EA 3BZCA 2CU7A 1WJ5A 3M1CA 5D5XB 4XIDA 3ABLH 4J01A 4DBRA 1MD0A 3F3XA 1A04A 2PMZN 1YX5A 1X58A 1QZEA 3DLLF 3I4NJ 1FOYA 4P5OA 4NBQA 1JKQC 5F1JA 1UAAA 2A05A 2QLZA 4G7ZF 2HDDA 2FRHA 4LITA 1BIAA 2VOOA 5E79C 1D8KA 2MSYA 3KE2A 1PVEA 4HNUA 4OIRF 4DW6A 1U6GA 4FX0A 3EUAA 4ZC3A 4EJUA 2EFOA 1DU6A 3L1PA 5CKTA 5BPIA 3DPLC 2JJ7A 3C2GA 2P5LC 1F1ZA 2K86A 3BY6A 4E7JA 1K83J 3ZN1A 3KP6A 2WA0A 1TQMA 1BR4A 5FFZA 2CMPA 1PUFA 3M8FA 5M3MJ 1LB2A 3W3CA 2L9NA 2K3FA 1YOVB 2R5YA 1AHDP 2HYJA 5DEQA 3JCUC 3I53A 2ZMEA 2XUBA 3LWFA 2V6EA 3JRDA 3AL0C 3ZMVA 1VTNC 1P4AA 2GZWA 4FE4A 4C3JJ 5JVTA 2XAQA 3HM5A 3M7GA 2M45A 2XF5A 4GDFA 4LK0F 1VQ6I 5GADJ 4F52A 1T8IA 3FXOA 1KGSA 1EF4A 2M87A 2Y69H 1R6RA 5EZHA 4RB2C 3H3VK 1J75A 4A5NA 2VE8A 2CJJA 1L3LA 2BVMA 2DTRA 2FBKA 2DMPA 1LQ1A 4K2EA 3B73A 1VNDA 3BJOA 5HLGA 2JVHA 4GO1A 5JR3A 4UUSA 2R7RA 1ZG5A 2Y30A 1RKTA 2KJCA 2W24A 1E3HA 1X1AA 2E5NA 5CYVA 1MBFA 3BTJA 2VJ5A 1YRNA 1FOXA 4II3A 3CCQI 1NTCA 2XSDC 4P55A 4HRIA 3DKXA 3HSEA 1ZHFA 1X4OA 2FD5A 5D5UB 4UB8C 1ZARA 1TWHJ 5KCMA 1PUEE 3KYCB 5KNLA 3EUHA 2OTLI 2IBDA 5ICEA 5HDNA 2B63J 1B59A 2NXNB 2R5YB 1PP8F 1AA7A 3G1MA 3JRIA 2BOLA 4HOBA 4L0ZB 2ZMEB 3W2AA 2RQPA 5FLXK 3G1OA 3CJNA 3C2HA 2KDOA 2P6TA 1X2NA 1ZN2A 3BG9A 3ZOBA 2A6EF 3TP0A 2D1HA 2M34A 2GWRA 4M3EA 5D8KB 3LSMA 2M4GA 2NS0A 1P7JA 1Z7UA 3DKWA 1LFPA 2NAZA 2MA3A 2DXIA 2XSJC 3CCJI 3FKJA 3BDDA 2BXZA 3GF2A 3T5XA 2EILH 1LEBA 5K5RA 4JK1X 3SJMA 5E3LA 5LFAA 3KEQA 4ZH4F 4P9UA 3GTKJ 3S14J 1R9TJ 3FF5A 2LF7A 3I59A 1Z7LA 3VYUB 4D0PA 4RB1A 1JKRC 1YJWI 4UUSB 4M74A 3C7JA 4G6TB 1AU7A 4MQVA 2ELJA 3R0JA 5DM7F 2PBIA 3K4BA 4B3AA 2HVRA 3W6JB 1BN5A 2E7WA 2VPRA 4OMZA 1REPC 5D6FA 4Y3OA 3HL2A 3PQKA 3QYFA 2W7NA 3W2WA 2WB1A 1WI3A 3LQQA 1MIJA 1ZAOA 3GTGJ 4NB5A 2QCOA 2WV0A 1ON2A 2X51A 5CVIA 1XSDA 3QPLA 3V8LA 1W7PD 2XPUA 5AIPA 2IGKA 4CSWA 1I27A 2IS4A 3IUOA 1Y56A 2R7SA 1R00A 4UUVA 4N4OB 3OR2C 2X48A 2DFHA 2BY1A 4C9YA 1HXDA 3E6DA 2K9NA 4BQNA 1KONA 2HI3A 3HOXJ 1O3TA 3H35A 1YLFA 4HX8A 1F9NA 2M30A 4IHXA 1KQ0A 3FHNA 1ACIA 3AG2H 2GA2A 3CC4I 2UUZA 4M6XA 2FJ1A 3CDIA 4FHTA 1W7PA 4NC6A 4KITB 3GTJJ 1CQTA 3DEUA 3SZTA 2DYSH 5HNHA 1HW1A 2NNNA 3K9TA 4MFEA 1S6LA 1N78A 4IO9F 4BGDA 2D1VA 4A0ZA 4R1HA 2I8DA 5DCMA 3P9KA 1Q1VA 2LSOA 1DGRM 1UFMA 4LLLA 3K10A 3U21A 1VF9A 2FBIA 1I50J 3L2UA
chains in the Genus database with same CATH topology
4YIRX 2QSHX 2QSGX 1OQYA 2F4OB 1PVEA 2F4MB 1TP4A 1QZEA 1X3ZB 2QSFX 1X3WB 3ESWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIR X;  2QSH X;  2QSG X;  1OQY A;  2F4O B;  1PVE A;  2F4M B;  1TP4 A;  1QZE A;  1X3Z B;  2QSF X;  1X3W B;  3ESW B; 
#chains in the Genus database with same CATH topology
 2LKX A;  3LQR A;  3DLA A;  1IRG A;  2HYF A;  1XC5 A;  3I3L A;  1POG A;  3LOC A;  5LBQ A;  4XQF A;  1FBS A;  1IUF A;  1P9Q C;  3VPR A;  1XSX A;  2QQ9 A;  3Q0U A;  4B43 A;  3DEW A;  3G71 I;  4G9Y A;  4I09 A;  3ZP5 A;  4I0B A;  4LG3 A;  5F64 A;  2HWV A;  1U78 A;  1MMD A;  4HNV A;  2UXN A;  4G94 A;  1SFX A;  4F91 B;  1WVR A;  3CCL I;  5FLM J;  1NHA A;  2E1M B;  3PIP F;  3COA C;  3JRA A;  2FSW A;  3BG3 A;  3F8M A;  2ZSI B;  5K5Q A;  2EZL A;  3K4C A;  5A2Q K;  2ZJR F;  1OJL A;  1A5J A;  4L0Y B;  1ZK8 A;  4D7N A;  3CME I;  3J7Y J;  4MHG A;  3S17 J;  1ERD A;  1VQ5 I;  1JKP C;  1K4T A;  3JRH A;  4V19 K;  2TCT A;  3K69 A;  2DMU A;  1ZG1 A;  4AIJ A;  3CCU I;  1LE8 B;  1R1U A;  2JRT A;  4PUS A;  4A3F J;  1OYY A;  4BHB A;  3JAM Z;  2GOM A;  2WY8 Q;  1CF7 B;  1DGW Y;  4IHT A;  4FT8 A;  3D0S A;  1G3T A;  4LLN A;  2W84 A;  1MKM A;  1S29 A;  3DEE A;  5JLX A;  1Y8R B;  3SHF A;  3K70 D;  5HS9 A;  4IHY A;  3ISP A;  3CDH A;  4LGW A;  3SQN A;  3CF5 F;  3O8G A;  4CCM A;  3CC7 I;  4HF1 A;  4LB5 A;  3WG9 A;  4WXH A;  4KNY A;  2IA1 A;  2Y48 A;  2DQR A;  1YIO A;  3CCR I;  3EQL F;  2CUZ A;  3E1S A;  1ZRF A;  3DFG A;  2HPM A;  3FZV A;  1Z9C A;  3VEP A;  1J59 A;  1OYW A;  1WJF A;  3H3Z A;  4CCO A;  1JUS A;  2JMW A;  2DT5 A;  2O3F A;  3IH4 A;  3IV5 A;  3EPZ A;  3RPU A;  5DCM B;  3HBL A;  2PMZ A;  3A03 A;  1TC3 C;  4U0Y A;  5M5W J;  1V4R A;  2HS5 A;  4B3X A;  2VIX A;  1Z67 A;  4C3I J;  1XMX A;  4ANJ A;  1IXR C;  4XLE A;  3VYR B;  1IF1 A;  2LY9 A;  1XDS A;  4WXD A;  1W36 D;  2VON A;  1GVD A;  5F27 A;  1O57 A;  5F0C A;  5CQG A;  2JA8 J;  1JXS A;  2HOS A;  4KN4 X;  3QOP A;  5HDG A;  4ABZ A;  2O8X A;  1XB4 A;  2RGV A;  2CQ7 A;  3MKY B;  1KU9 A;  1S9H A;  2M2E A;  3ML6 A;  2A07 F;  3LAJ A;  3GFM A;  2XRN A;  1SD4 A;  1WGX A;  2V1X A;  3HXL A;  3SFZ A;  3OYC A;  5J3L A;  3OIQ A;  4ENN A;  2J5P A;  4RMN A;  1VQ9 I;  4M9X A;  4B48 A;  2ESH A;  2IP2 A;  1BM9 A;  2GA1 A;  2XPV A;  1JUP A;  2IAI A;  2EPF A;  1B1B A;  3KPH A;  3L09 A;  5FFX A;  3HOV J;  2A6T A;  5EGO A;  2XV4 S;  1P6R A;  2XRL A;  2K85 A;  5E1Z B;  1MGT A;  1QZZ A;  1HF0 A;  5KHD A;  3ERE D;  1FSH A;  4U7B A;  2PMU A;  4HX7 A;  4E6K G;  1B9M A;  3K0L A;  4D5F A;  4ESB A;  2IS1 A;  4EMS A;  3BCB A;  1SFO J;  2XAS A;  2K4B A;  2XGD A;  3TW7 A;  1U5T B;  2H6C A;  5TJJ A;  4DYQ A;  4M3G A;  2HQN A;  4G7O F;  4Y52 J;  3DCF A;  2OZ6 A;  2XF6 A;  4W97 A;  3GZ5 A;  1W1W E;  2W57 A;  3ZMT A;  1OIS A;  1R4M B;  2Q2E A;  4FTH A;  3UR3 C;  2WBM A;  3ZQG A;  1TBX A;  4AVP A;  2KKO A;  4AUX A;  1RIO H;  4CGZ A;  1YW8 A;  3EDP A;  4OAY A;  3RQI A;  4A3K J;  2HZT A;  4WXC A;  4A93 J;  3V7C A;  5C44 J;  5FKO A;  2Y2Z A;  3TL4 X;  1FMV A;  3TOB A;  1Z6R A;  2Q8K A;  2EIM H;  2BW3 A;  4QPO A;  2JT1 A;  3MKL A;  2L7M P;  2HXI A;  3GXO A;  1UB9 A;  4YFK F;  1S7O A;  3C18 A;  2GBY A;  4L5E A;  5LGN A;  3K1M A;  4C3H J;  2W82 A;  3DP7 A;  3JSO A;  3TO7 A;  3VFZ A;  4IQJ A;  5GP9 A;  4U0V A;  1MH3 A;  4A3C J;  3H3U A;  4XKW A;  1U0J A;  4YEJ A;  2O5R A;  1Z21 A;  5EGO B;  2XHK A;  2HOT A;  2HFH A;  3FXJ A;  1U2W A;  3KP4 A;  4EEF G;  4PJL A;  2N8G A;  2OAZ A;  4CHU A;  5E1W A;  1IXC A;  3ZMZ A;  3DTE A;  4XBF A;  4XLF A;  2G7U A;  4CYC B;  4H4K C;  3I5U A;  1WKM A;  1O3Q A;  2RKH A;  5FKN A;  4RAF A;  5L3D A;  5F0F A;  3TP3 A;  2ZME C;  3K2A A;  1QU3 A;  2O6G E;  1WRJ A;  3QP5 A;  1H9T A;  2NOG A;  5B1B H;  2L2O A;  3T8T A;  5C4J J;  3ZXS A;  3ASN H;  1KZH A;  2GAU A;  4PJ0 C;  3MKW B;  2UXX A;  2NVY J;  5EG0 A;  3V8J A;  1AOY A;  4GYI A;  5IPA A;  1HLV A;  4KIS A;  4EM1 A;  1F5T A;  4A12 A;  5D8L B;  3ZQL A;  3BR3 A;  3CF2 A;  3TMO A;  3L2V A;  1BL0 A;  3BPX A;  2CV1 A;  2IPQ X;  2JA2 A;  4A3G J;  3IC7 A;  1TZL A;  3Q9S A;  1ENH A;  3E6C C;  3S1N J;  3M1E A;  4ON0 A;  3DTK A;  4KJZ A;  1CGP A;  2BBY A;  5ICC A;  1FJL A;  3GTQ J;  1TW2 A;  2BW3 B;  2F5C A;  2DLL A;  4RAG A;  4KIB A;  4ITV A;  3MCZ A;  2HEO A;  1Z6T A;  3VOE A;  2FQ4 A;  2NRA C;  2VBX A;  4IOC F;  2P81 A;  1OKR A;  2IW5 A;  3HOW J;  4S04 A;  3S32 A;  3ELK A;  3FDY A;  3DF8 A;  4Z6Y A;  1E2X A;  1MZB A;  2IA0 A;  2OQR A;  1WI9 A;  2KZV A;  3T8R A;  2GQQ A;  1TP4 A;  2HXO A;  5IYD J;  2VL8 A;  3CCY A;  4ENK A;  2FNA A;  1VI0 A;  4X0G A;  3Q9V A;  3OS0 A;  2A3S A;  3ZRG A;  3ULQ B;  3WTY C;  5FLV A;  5TGT A;  3TQN A;  4ASN A;  3FMR A;  5D5V B;  3F21 A;  4IRI A;  3PNT A;  4G12 A;  3GTP J;  1FYL A;  3K4L A;  5HLT A;  1K61 A;  3LSK A;  3PFY A;  4BXU A;  2IXS A;  4IF4 A;  1HC8 A;  1YJN I;  1H89 C;  2L7Z A;  2DA7 A;  2LC2 A;  2VQG A;  4Q4Z F;  4F92 B;  2RRE A;  2V9K A;  3W6V A;  2JN6 A;  1OR7 A;  3V4G A;  2JPB A;  2L7K A;  1N75 A;  5EG0 B;  2PFB A;  2V7F A;  4YFN F;  3KP7 A;  3E5X A;  1JGS A;  3OY9 A;  1RC9 A;  3ZPL A;  5FRN A;  2XKO A;  1P92 A;  4BEH A;  2H27 A;  1LDK B;  3S1M J;  3IL2 A;  2VQC A;  4RLQ A;  2M0C A;  1R58 A;  3QU6 A;  3I4P A;  2R7U A;  3FKI J;  3ZQC A;  1IDZ A;  4KA4 A;  2D2W A;  2EIN H;  1FP2 A;  3ZCO A;  2CUF A;  2PMH A;  1B9N A;  4II2 A;  2LRD A;  2IRF G;  4EQQ A;  1V54 H;  2VE9 A;  4L5J A;  3SEQ A;  2IA2 A;  1YHQ I;  2HVS A;  4IJA A;  3RYP A;  1XTA A;  5FGM A;  2BHZ A;  3H0G J;  1ZH5 A;  2HR3 A;  4E70 A;  5HOO A;  2L01 A;  1ZRC A;  4XR6 A;  2ZSH B;  3J80 Z;  1R1V A;  1KQ9 A;  4GGG A;  4IVN A;  4ZJZ A;  4IHW A;  1HDP A;  1ONV A;  3MWM A;  4MQ9 F;  3H92 A;  2JUG A;  3JSP A;  2VXZ A;  2XGE A;  2L4A A;  3LSI A;  1I1S A;  3GZ6 A;  1I6H J;  2E1M C;  3P9C A;  3DQV C;  3HTU A;  4BXF A;  3E3V A;  1QO0 D;  2HPI A;  4J19 A;  3S3N A;  4N9H A;  2DT7 B;  5H2F C;  3OYI A;  3QRF F;  1VFC A;  2FOK A;  3KP2 A;  3RDI A;  4UY8 I;  2QZ8 A;  2BXY A;  5CJ9 A;  3BZK A;  1I1G A;  1FZP B;  2DQL A;  5BS6 A;  1ZRE A;  5HNF A;  3OSF A;  4PFO A;  2HKX A;  3BCA A;  1ORK A;  1K79 A;  3RI4 A;  5E1X A;  3AFH A;  4A3J J;  1XG1 A;  1SD7 A;  5B3S H;  4WK8 F;  4E7H A;  3WOD F;  2KRF A;  1LNW A;  3K4M A;  4M9Z A;  4XLC A;  1SFE A;  2W00 A;  1YIJ I;  2CH0 A;  4R79 A;  3HJE A;  5JHF A;  3S2D J;  1J7K A;  1SEU A;  5IY5 H;  4RS8 A;  2EV0 A;  4BEH B;  4PGH A;  2DDB A;  2B0L A;  5ILU A;  1EA3 A;  5FKM A;  4M3B A;  1VQP I;  2AO9 A;  3GW2 A;  5CPR B;  4Y7N J;  4CXF A;  2RNJ A;  1MBK A;  4XLN F;  2DOD A;  5CQE A;  3BP8 A;  3GTM J;  4A69 C;  1T95 A;  1UHS A;  3HUG A;  2Z3Y A;  3GCM A;  1FNN A;  2XVC A;  2PG4 A;  3LFU A;  1KQ8 A;  2QWW A;  2FML A;  3EYI A;  4PCQ A;  1ODD A;  2ELH A;  2RV8 A;  4PJJ A;  4EV0 A;  1ETX A;  2F5E A;  1IRZ A;  2X6X A;  1P4W A;  1T0F A;  4ZTF A;  1UG0 A;  2AXT C;  4FQG A;  3BG6 A;  3MD2 A;  1I39 A;  3FK7 A;  2YS9 A;  4UB6 C;  3F8C A;  1ETO A;  3JTH A;  2GXB A;  2DJN A;  1AWC A;  3KEY A;  4Q48 A;  2O61 A;  2MC4 A;  5HOD A;  3HGG A;  2JTV A;  3A1Y A;  4AC0 A;  3AG3 H;  4CUG A;  3WTU C;  3PSF A;  1ON1 A;  2AHQ A;  3KZY A;  2K9M A;  2CFX A;  2CW7 A;  2XGX A;  2BGC A;  1WJA A;  1RUO A;  1YI2 I;  1E17 A;  1KU2 A;  1PP7 U;  3L9F A;  3WU0 A;  3BG7 A;  5FD6 A;  4ETS A;  3F22 A;  3GLX A;  5DYM A;  3FMS A;  4RAY A;  2X4H A;  1ZRD A;  2EH3 A;  3Q0W A;  1U5T C;  5C4X J;  1Z0X A;  4HSR A;  3L2R A;  1FBQ A;  3QAH A;  4NC8 A;  2CS3 A;  4M3F A;  2QF7 A;  1FIA A;  5B5E C;  1LKX A;  5FRO A;  5D5W B;  2I10 A;  3IWF A;  4A0Y A;  2QSH X;  4A3E J;  1FWZ A;  2ISY A;  4HNT A;  3ZMS A;  4B1R A;  2ZXI A;  5FB2 A;  3A0B C;  3O2P E;  2FU4 A;  3CES A;  3A0H C;  2MBF A;  3OYD A;  1KU7 A;  3J7Z I;  4MO7 A;  1OYI A;  3HUG B;  2MH9 A;  4YG2 F;  4Y15 A;  3K70 C;  2QA4 I;  3E5U A;  2XDV A;  3LNQ A;  1GLN A;  1W4M A;  2HGC A;  2VT2 A;  2DOA A;  5L3C A;  2K27 A;  1FLI A;  4A2U A;  3HDD A;  4BYY A;  1FBU A;  4XIC A;  1QHH D;  3E97 A;  5BNG A;  2LVS A;  4DJA A;  3BJ6 A;  3QQA A;  3RKY A;  3CC2 I;  2V6C A;  3ASO H;  1YFH A;  2OJE D;  3OWT A;  5TRD A;  4AIK A;  5LRR A;  4UV8 A;  3DPT A;  2KRH A;  3I9V 2;  1H8A C;  2LBF A;  2QSG X;  1VQO I;  1PUF B;  3CQZ J;  3CUQ A;  2UV1 A;  2E60 A;  4BNC A;  3J7A O;  3RYR A;  2FEZ A;  4PK4 A;  1J2X A;  2E7X A;  1X2M A;  1HSJ A;  3V7S A;  1PJR A;  5BPD A;  3K7A J;  1G8X A;  2X6O A;  1JHF A;  2L3D A;  3Q3S A;  1R4N B;  2KIU A;  5HVQ C;  1MND A;  3HB9 A;  2DAO A;  4N4N B;  4BE2 A;  1HW2 A;  2QKM B;  3ABM H;  2E1N A;  1BJZ A;  4FAS D;  3JRE A;  1STZ A;  4JX6 A;  4UXN A;  5LHI A;  2W85 A;  3F9K A;  3JR9 A;  2VBY A;  1SFK A;  4E7I A;  4O5V A;  1VQL I;  2KMU A;  3WTX C;  1LVA A;  4QSH A;  1RRJ A;  2LFB A;  1UJ8 A;  2HQ5 A;  2P7V B;  2VC1 A;  1VQ8 I;  2STW A;  4RB0 A;  4HEA 2;  1ZLK A;  4DOZ A;  1FIP A;  3B02 A;  1S8N A;  2D45 A;  4WX9 A;  4E7L A;  3HGY A;  2XB5 A;  4B8X A;  3OIP A;  2P7C B;  4HV6 A;  3BTI A;  1DPU A;  3JRC A;  3VSL A;  4F55 A;  1YRN B;  2GOX B;  2RVC A;  1DDN A;  4KFC A;  3MZ8 A;  3R60 A;  4MLO A;  2R7T A;  2VBZ A;  1USS A;  1LVK A;  3PQJ A;  2P8T A;  5HLI A;  3KYD B;  1AKH A;  1FOW A;  2XIG A;  5GPC A;  3O8H A;  2LBF B;  2E1C A;  1RES A;  4C2T A;  3CLO A;  1K78 A;  4IKF A;  1OCC H;  2Y75 A;  4YFX F;  3HC7 A;  1BW6 A;  4XN0 A;  3N97 A;  1HKS A;  3CUQ B;  4M9S A;  1B8I A;  4OOI A;  4BDY A;  4ZZL A;  2X1C A;  1FTT A;  3HOT A;  2JA5 J;  2ZCW A;  3IAM 2;  2NOJ B;  2PX9 A;  5LHG A;  2ZXH A;  3CJQ B;  3M8E A;  3H1C A;  3MZY A;  4A5M A;  1BA5 A;  3UNG C;  4UUT A;  1EH8 A;  2HKO A;  5F04 A;  5JFR A;  2K4J A;  4OIO F;  1J9I A;  5HLH A;  3HRU A;  3L2Q A;  5ILS A;  3PNV A;  4XKB A;  3I55 I;  3EYY A;  1FOK A;  1QNT A;  3PSI A;  5CVV A;  1D0Z A;  3MAJ A;  3MMY B;  2R7W A;  1UHM A;  2VOP A;  1D5Y A;  3I56 I;  3UKG A;  3VSK A;  2Y0M A;  2K9Q A;  4IX7 A;  4Q5S F;  2F5D A;  3IRQ A;  2V9P A;  3F8N A;  3SFI A;  3I59 B;  2JK3 A;  1X3U A;  2V1U A;  3F72 A;  5E20 A;  1SVM A;  1GXQ A;  1S7A A;  3S3O A;  5EEG A;  3W2V A;  2L7F P;  2P0W A;  2M5W A;  1FTZ A;  4HW0 A;  1QBJ A;  4OWR B;  4U7D A;  2ZKZ A;  3OL3 A;  2OQG A;  5EYR A;  3HRT A;  4BAY A;  2F4I A;  2EK5 A;  1ETK A;  1YW9 A;  3TO9 A;  2BZT A;  2XRO A;  2FUG 2;  1BI3 A;  1QGP A;  1AKH B;  2KQR A;  2XKP A;  1GV2 A;  4FE7 A;  4HA8 A;  1K78 B;  4NC7 A;  3VB2 A;  2VQL A;  3RKX A;  1KA8 A;  2EBI A;  2VOD A;  4P1W A;  4C2M J;  3DPU A;  3HIF A;  4BQA A;  4LD5 A;  5H6R A;  1LPQ A;  1HST A;  3ZQH A;  2L5Q A;  3FWE A;  2JPC A;  4I6Z A;  1OFC X;  1N77 A;  4BY7 J;  2CV0 A;  3J7A Y;  2DU9 A;  4NQW A;  2LKS A;  4L5I A;  1LDD A;  5CVR A;  3FX3 A;  5KAF C;  1NH3 A;  3H5N A;  1TW3 A;  2ME0 A;  3FHZ A;  1MJ9 A;  5J8F A;  2ETH A;  1IN8 A;  4GFB A;  3CZ6 A;  2CG4 A;  2W25 A;  3F23 A;  4GCV A;  4BQQ A;  2DJI A;  3GVA A;  1W7P B;  3IH2 A;  1DPR A;  2Q1Z B;  1I5Z A;  2H8R A;  4ZZD A;  5K7F A;  3S15 J;  3IAS 2;  1IN5 A;  1MJB A;  1BBY A;  2CO5 A;  1RPW A;  3ROU A;  1WH5 A;  3CP2 A;  1SAX A;  1RET A;  2E2H J;  1OR7 C;  3FXK A;  2C6Y A;  3CCV I;  4E4H A;  2MYS A;  2JZY A;  5HS8 A;  4UVB A;  3FM3 A;  1SVL A;  2EZI A;  5AIQ A;  2LKP A;  3ZN0 A;  3WGI A;  5LHH A;  4EGZ A;  2XF7 A;  2ID6 A;  1TLH B;  2F4M B;  4AWX B;  1O3R A;  1ETW A;  2ECB A;  2WTE A;  1ZR2 A;  2Z5U A;  3FBN B;  2Y0S N;  2AQE A;  4WWC A;  4MFD A;  3N4M A;  2ZB9 A;  2KPM A;  3DU6 A;  4HBL A;  1VQ7 I;  2F48 A;  1XPX A;  1Z77 A;  1TWC J;  4RDU A;  1XMK A;  1IRF A;  2CQN A;  4BHP A;  4JX4 A;  2X9D A;  3HHH A;  1FPQ A;  3FBI B;  1WJB A;  3QPS A;  1WWX A;  1TQP A;  1X1P A;  2XAG A;  1U9O A;  5FJ8 J;  3BZ6 A;  4NQW B;  3O3K A;  5LGT A;  3CCS I;  5FLX Z;  1JKO C;  4JP0 A;  1G3S A;  2CQQ A;  2HTJ A;  3HZJ A;  2OCE A;  3OYG A;  2HZD A;  3QPT A;  4N0B A;  2OD5 A;  3TGN A;  2BVL A;  5J1R A;  3QYE A;  4PSX A;  4RLF A;  4AU7 A;  3A2K A;  1WHU A;  3ERM A;  5L3G A;  4EM0 B;  4YEL A;  5IOY A;  2QQB A;  3BTC A;  1D1C A;  3HPH A;  2WAE A;  1ZGW A;  2BV6 A;  2OV7 A;  1SD5 A;  5LLQ A;  4G7H F;  1KYZ A;  4FIS A;  2VLA A;  3RTR A;  3OV8 A;  3PL8 A;  2B9S A;  4OIP F;  2H1L A;  1ZG3 A;  1HBX G;  1KU3 A;  3DKY A;  2XC7 A;  2NS7 A;  1UMQ A;  1XMA A;  3E7L A;  3GWZ A;  1G4D A;  2KHM A;  2BHY A;  5JI6 A;  3D1N I;  2PJR A;  2TDX A;  4N9I A;  2LP0 A;  3GZN B;  3M8J A;  1BI2 A;  3S16 J;  3LA7 A;  3PO2 J;  4HYE A;  1JTX A;  5D4R A;  3EET A;  1YS7 A;  1F43 A;  3TW6 A;  4BXX J;  4HLY A;  2A6H F;  4BE1 A;  1IO2 A;  2ID3 A;  2EFW A;  1S7E A;  5JHU A;  3OS2 A;  3AG1 H;  3J81 K;  5EJC A;  1PDN C;  1KYW A;  4S05 A;  4M6Y A;  2XGC A;  3WHC A;  3K4K A;  3GLL A;  4L9V A;  3L7W A;  5IT9 K;  3E6M A;  1XD7 A;  4CZC A;  1TQI A;  2UWM A;  3S1Q J;  1UHW A;  2QYO A;  2CGP A;  4U88 A;  3TDZ C;  5GAE J;  3S3M A;  5CVU A;  1LFU P;  2B7E A;  4EJV A;  4DYR A;  3GO5 A;  4HPQ A;  5B1A H;  4BH9 A;  4Y13 A;  3NAU A;  4IL6 C;  4M71 A;  5K5O A;  2ZBK A;  3F8F A;  5BOX A;  2L54 A;  1E0E A;  4GRI A;  2QBY A;  3QWL A;  1HW5 A;  2F2E A;  2ZXJ A;  1JTY A;  1L0O C;  2BEO A;  1FMW A;  5B66 C;  3HOZ J;  2LYC A;  2OBP A;  4CCN A;  2M0M A;  3BQY A;  2DBB A;  2WV1 A;  2BYV E;  2DA2 A;  4XL9 A;  3GFI A;  3PO3 J;  5TIS C;  4KDP A;  1GUU A;  3T0Y A;  4M73 A;  1UCR A;  2FX0 A;  3RZD J;  2Q2E B;  4PZJ A;  4F3Q A;  3JRG A;  2DA5 A;  1X3Z B;  2FQ3 A;  3FIW A;  5CVJ A;  4EGY A;  2VKD A;  3ZQQ A;  3SDB A;  2DFE A;  3PUF A;  2BY0 A;  4I98 B;  1GXP A;  2DFF A;  2VKE A;  2V1D A;  5F6F A;  4OMY A;  5IP6 A;  4EJO A;  5AON A;  2RQQ A;  1LEA A;  2K5C A;  2VUM J;  2BE5 F;  1YE9 A;  2V79 A;  2QKL B;  3A01 A;  3WE3 A;  2E71 A;  2WAQ A;  1RR7 A;  3SDG A;  1FC3 A;  2CW0 F;  2LD5 A;  2MD5 A;  5EEA A;  4NDL A;  3U2R A;  1MBH A;  2EV6 A;  2HTS A;  3RJP A;  2E1O A;  3CJR B;  3R6S A;  4XMY A;  2LDU A;  1IDY A;  3P9I A;  5KAI C;  3MQ0 A;  3VDX A;  4Y4R A;  2LK2 A;  2VT3 A;  5J1U A;  4OU0 A;  2BY3 A;  1D3Y A;  5F1R A;  1ZQ3 P;  4EJW A;  1EV7 A;  5EF6 A;  5A2Q Z;  4A3M J;  3HOU J;  4MEX F;  3LSH A;  2ESN A;  1BI1 A;  1VQM I;  3TED A;  2JSC A;  2E5Z A;  1MBG A;  1OCT C;  1X3W B;  3JW4 A;  1R5H A;  3F6O A;  4HAM A;  2PI0 A;  3KEO A;  2OA4 A;  2I5U A;  3FIS A;  3U9G A;  1IV6 A;  4JBA A;  2QSF X;  4A6D A;  1LFB A;  2CWE A;  2YU9 J;  3EUH C;  3KFW X;  4CZZ A;  1W0U A;  3CUQ C;  2F6C A;  4UHT A;  1XGM A;  2EWN A;  1IAW A;  1APL C;  3MN2 A;  1QZY A;  2LH9 A;  3H0D A;  2EA4 A;  2OU2 A;  2DDA A;  3GUD A;  1P4X A;  3BPV A;  3E6B A;  3HSR A;  2XAU A;  1R36 A;  1P2F A;  3G6E I;  1ZGJ A;  4IEJ A;  3CJT B;  2MLG A;  3ABT A;  1WCM J;  1QVT A;  3QPH A;  3PUB A;  3M3Y J;  2EV5 A;  1MBE A;  5ED4 A;  3HKZ A;  4P9F A;  4YIF A;  1S72 I;  2NS8 A;  2M8G X;  2CYY A;  3C1D A;  3I64 A;  1NG7 A;  4ZYH A;  1FY7 A;  3DBH B;  2ZFW A;  4DGW B;  5FKL A;  1YX3 A;  4KT5 C;  4A3B J;  4PJM A;  3RPQ A;  3ZQF A;  4ZTJ A;  1SC7 A;  2YR2 A;  1ZYR F;  2W4S A;  1DQU A;  1XN7 A;  1IW7 F;  2OZU A;  2XPW A;  1LUJ B;  2COM A;  2GIZ A;  4QPQ A;  1MNM C;  4JOM A;  1YO5 C;  2WC2 A;  3LFK A;  1QHG A;  1N25 A;  4DBQ A;  1P7I A;  3D5R C;  3OYH A;  4HZF A;  3VYS B;  4QLC U;  1F4K A;  3NRV A;  1QPM A;  4X1E A;  2A69 F;  3BRO A;  4BJT A;  4BJ5 C;  2Z16 A;  2PN6 A;  5K7Z A;  1QRY A;  2DPU A;  4LIV A;  4BU2 A;  3WG7 H;  4XKV A;  4KYW A;  3GX4 X;  1B6A A;  5DD4 A;  2CQX A;  4O3M A;  4XLH A;  1V5F A;  4XSZ F;  2NVQ J;  1MH4 A;  2EFP A;  2EIK H;  1H0M A;  2H94 A;  2K9L A;  5EEH A;  1T08 B;  2CRG A;  5ERI A;  2GXA A;  1EH6 A;  1H88 C;  3F6V A;  2LY1 A;  1PYV A;  3KZI C;  2AS5 F;  4PGG A;  5FD5 A;  4LOC A;  1VQ4 I;  5EZG A;  4XN3 A;  3VOD A;  1Y6I A;  3NAR A;  3OL4 A;  3GYH X;  1E3O C;  2P5K A;  2RNG A;  2DMN A;  4XRF A;  1I3Q J;  4BS9 A;  5F08 A;  4B09 A;  1R49 A;  2R7Z J;  2LNB A;  3HRS A;  3Q0V A;  1MBJ A;  5L3B A;  1JUM A;  4XNF A;  5BMZ A;  2M7B A;  1WQ2 A;  2R7F A;  4MIM A;  2G9W A;  3AKZ A;  1G2H A;  1MMS A;  5ILV A;  2DT6 A;  3B6C A;  4CIC A;  2DPD A;  1A6I A;  2Z9O A;  1UZC A;  2FA5 A;  3ABU A;  3KX2 A;  2HOE A;  2VB6 A;  3HPG A;  3R0A A;  2JA6 J;  2CSO A;  2F4O B;  2Y0S A;  3FM5 A;  2GLO A;  3S93 A;  3M07 A;  2ZJ2 A;  1VZ0 A;  2VQH A;  4IHV A;  3OYB A;  1X19 A;  4KIF A;  5J4Y A;  3H5R A;  2X6Y A;  2RDP A;  2HQA A;  1GHC A;  1FYM A;  3E5Q A;  4RB3 C;  3OYE A;  3SZG A;  2GIV A;  2KIM A;  4A6E A;  4XOT A;  1FYK A;  5HDK A;  3F8B A;  5IT3 A;  3BOQ A;  2RN7 A;  4G8X A;  2ZC2 A;  3LAP A;  3W6K B;  3AG4 H;  5K1Y A;  2LG4 A;  4IRG A;  2NVX J;  3BR5 A;  4OIQ F;  2KT0 A;  3FXM A;  1V55 H;  3KLO A;  1WPK A;  3OOU A;  1JT0 A;  2DMT A;  3PJR A;  2ME6 A;  3HYI A;  4MTE A;  1D0Y A;  2R7V A;  2GXG A;  4BBS J;  2FF4 A;  1U9N A;  1BR2 A;  2CQK A;  1Z3X A;  3MEX A;  2O9L A;  1SVO A;  5KK1 A;  4JYK A;  3KP3 A;  5J47 A;  3I54 A;  3TBI A;  1FX7 A;  4I2O A;  3TDU C;  1TWG J;  1WJD A;  1G6N A;  4HG2 A;  5IYB J;  2FNP A;  2FE3 A;  2WAD A;  5LGU A;  1XDU A;  2D5V A;  2RAE A;  1T98 A;  5J6X A;  4Q47 A;  5DTD A;  2HNH A;  1WJE A;  4M3D A;  5LD2 C;  4ZYE A;  5ICG A;  1ITY A;  1RNL A;  5H20 A;  1D0X A;  2DFI A;  2JRM A;  3DBL B;  4RGU A;  1ETY A;  3P5J A;  4YII A;  3S2W A;  3JAM K;  1ZTR A;  2YX4 A;  4BQO A;  5M3F J;  2L0K A;  2ZNZ A;  2DCE A;  4B44 A;  4LLG F;  4XRS G;  2LLK A;  1E3P A;  1SFU A;  1UEL B;  2ADU A;  2OC6 A;  5ICF A;  1ZR4 A;  3WTV C;  4GYG A;  3HEF A;  1OPC A;  3A02 A;  2VC0 A;  4BAC A;  2E2J J;  2M4K A;  2WY7 Q;  1XGS A;  3LSG A;  2ZXW H;  2QEN A;  3NWS A;  3CLQ A;  4DIQ A;  4AIH A;  4ESJ A;  4HX4 A;  2R3S A;  4CH7 A;  1Y1V J;  4V2G A;  2L9S A;  2NYX A;  2KZG A;  2H09 A;  1QVU A;  4KIC A;  2KIF A;  1JT6 A;  1C0W A;  1B72 A;  1IZ1 A;  3QOD A;  5H6Q A;  3OYN A;  3RZO J;  5DDG A;  1V5G A;  1T39 A;  4IPA A;  2R7Q A;  1MW7 A;  2QQA A;  4IOA F;  2O8K A;  2FOW A;  1W36 C;  2ZJP F;  1Z91 A;  1O7F A;  1TNT A;  1LDJ A;  3SEZ A;  3OYM A;  3WE2 A;  5J4V A;  5LEJ A;  2WWY A;  1VQK I;  4A3D J;  2R7X A;  1K7A A;  2YPR A;  1D8J A;  4IHS A;  2ZNY A;  4XRM A;  2VXD A;  1H9G A;  2HYG D;  1FT9 A;  4F7Z A;  3CUO A;  3DTI A;  1YYV A;  3S2H J;  1D1A A;  1Z1D A;  3HSF A;  4I76 A;  4B47 A;  4CCJ A;  2QGU A;  4XOR A;  3GME A;  5J8C A;  4M6V A;  2O0Y A;  1IG7 A;  2YX7 A;  3MVP A;  1X1C A;  2CFO A;  2ELK A;  3H9G A;  4BL0 B;  3DU5 A;  3Q5F A;  3D5S C;  2COB A;  3BG5 A;  4QIW N;  3NEU A;  3KCC A;  5DV5 A;  4UVC A;  3ZR8 X;  1JJ8 C;  2DMQ A;  3H9J A;  4D5C A;  1YS6 A;  2XAF A;  2FXA A;  2ZJQ F;  1IGN A;  3WTS C;  2YUS A;  1YTY A;  3CMM A;  3K4J A;  2QVO A;  2V4J C;  4XON A;  2IJL A;  3MZH A;  4R8H A;  2WAQ N;  5K7H A;  2JSP A;  1WFX A;  1SAN A;  3FMQ A;  3K1N A;  2OCC H;  1TNS A;  3QP6 A;  1X1B A;  2X0L A;  4JQF A;  5HS7 A;  4CYD A;  4L18 B;  9ANT A;  4RM2 A;  1A31 A;  1OCR H;  1TL8 A;  2NVU B;  1B72 B;  4HDV A;  3BT9 A;  2DI3 A;  5M5X J;  3K4N A;  3P7N A;  3GFL A;  5GTI C;  1NG6 A;  4PDK A;  3RKQ A;  3ECH A;  3OYF A;  2HVQ A;  3BLY A;  4EJT A;  1GV5 A;  3QOE A;  2ACJ A;  4RGR A;  3C3W A;  2DW4 A;  2VKV A;  1RUN A;  2Z33 A;  3I4M J;  4DZJ A;  2KIS A;  3RKW A;  2DTZ A;  2K3P A;  2R5Z A;  1DUX C;  2A68 F;  1Y1W J;  4U87 A;  3S1R J;  2F5V A;  1I3A A;  4MGR A;  4G6D A;  3LL7 A;  2M8E A;  4A3L J;  1IRX A;  2E19 A;  2MG4 A;  4XK4 A;  1T38 A;  3CD6 I;  4D9J A;  3OOP A;  4LJZ F;  3NQO A;  3H36 A;  4WCG A;  4C2U A;  5DS9 A;  1Y0U A;  4XSX F;  2EJR A;  2EFN A;  1T2K A;  3BTL A;  2V9V A;  1LE8 A;  1V5E A;  2LMD A;  3HKZ N;  3G73 A;  3IWZ A;  2JWT A;  2A5W A;  4D1Q A;  1CF7 A;  3I58 A;  3LA3 A;  4BKX A;  4I01 A;  2MGQ A;  1U3E M;  4E7S A;  2KP6 A;  1IXS B;  1R7J A;  4MEY F;  2RC4 A;  1U8B A;  2F5F A;  3MKZ A;  4AM3 A;  1XX5 A;  3U1K A;  5FKK A;  4Y33 A;  1FP1 D;  3CO6 C;  2DN0 A;  3OSG A;  4IXA A;  4BE0 A;  3LSP A;  1EKE A;  2VN2 A;  2KDZ A;  1W5C C;  2IT0 A;  1RR8 C;  2ZFU A;  1RKW A;  4F93 B;  3G1L A;  1IN4 A;  2IS6 A;  2KFD A;  2OUM A;  3SXY A;  2KL4 A;  4IZZ A;  1B8I B;  3WTZ A;  3A4C A;  5IP7 J;  3WTT C;  4HST A;  2LOO A;  3HRM A;  3E0J B;  3V8K A;  3OYL A;  1BR1 A;  3HOY J;  2NVT J;  1Y39 A;  3TKY A;  2VJ4 A;  5GAG J;  1QPI A;  3R61 A;  6PAX A;  4GXO A;  4L9J A;  4X6A J;  4WF2 A;  1U8R A;  2CV2 A;  3PIO F;  3R4K A;  4A3I J;  1O3S A;  3N05 A;  3ECO A;  4IRH A;  3ZMU A;  1G59 A;  2EA2 A;  2JQ7 A;  1XGO A;  5JVG F;  1FSE A;  3D5L A;  2G0E A;  3KP5 A;  2R5Z B;  1ZGA A;  2L4M A;  3B6A A;  1MMN A;  5GAH J;  1BI0 A;  1YG2 A;  2VI6 A;  2H6B A;  3H5A A;  4NNJ A;  2R7D A;  2DK8 A;  2IGM A;  3WU1 B;  1Z05 A;  2YSR A;  3L00 A;  5E3O A;  1A36 A;  4Y17 A;  1O7L A;  2LF8 A;  1WJC A;  1MSE C;  1ETV A;  5J40 A;  4AYB N;  4DYC A;  2HDC A;  4E7K A;  3BQZ A;  3ONQ A;  3KET A;  1O4X A;  1ULY A;  3RPU D;  4I7H A;  1XS9 A;  2QEX I;  1JJ6 C;  5LEK A;  2V1N A;  5IYC J;  4BJ6 C;  2HQR A;  1ETQ A;  3OYJ A;  2ECC A;  2X6W A;  2VJI A;  1U5T A;  1HOM A;  3V7R A;  1OCZ H;  1T56 A;  2DK5 A;  2P4W A;  2Y9Y A;  2MAB A;  1BC7 C;  5GTH C;  4A0X A;  5L3E A;  3ZGK A;  5C3E J;  5M5Y J;  3FXL A;  2XAH A;  3F0C A;  1YJ9 I;  3DWL E;  3GBG A;  4LIU A;  1HA8 A;  2NNY A;  1JGG A;  4ZDP A;  3ZQ7 A;  1IV8 A;  1IN7 A;  4PSW A;  4RA2 A;  2PJP A;  4ZDL A;  1G3W A;  2HU9 A;  2TRT A;  5IOZ A;  1IUY A;  5FO5 A;  2JUC A;  2X85 A;  3ZQI A;  4ZDO A;  2X1D A;  1K4S A;  2VPL A;  3CDL A;  2J5O A;  2E34 A;  2OF7 A;  1HQC A;  2HOA A;  4RGS A;  1T33 A;  2VKH A;  2L9R A;  4G6Q A;  4BBR J;  3CCE I;  1NK3 P;  4RBO A;  1OLT A;  1Z3Y A;  4I99 C;  2V26 A;  1Y0N A;  5CLS A;  3LA2 A;  3RIR A;  3FK6 A;  3MFK A;  1YW7 A;  1VQN I;  2W48 A;  3IP4 B;  4Z2Y A;  2GM4 A;  1J0R A;  3OMY A;  3WHB A;  4PFP A;  4KT6 A;  2MD0 A;  2MH2 A;  3J80 K;  1I6X A;  2O7O A;  3AAF A;  3IKV A;  1V3F A;  3K6G A;  1DP7 P;  1LJ9 A;  4UVA A;  1WH7 A;  4CCL A;  3AL0 B;  1R1T A;  2AXL A;  3CP8 A;  3HG9 A;  1ZLJ A;  4XLA A;  4HQM A;  2EQR A;  2R93 J;  4TV7 A;  3PNY A;  1R5I D;  4UNO A;  3PM1 A;  5FRM A;  1EH7 A;  2LTP A;  2W1O A;  2O03 A;  4P96 A;  3RSN A;  1JI8 A;  3LST A;  3GTL J;  2EFQ A;  4IQ4 A;  4CYC A;  5E18 F;  2X1E A;  1NK2 P;  1IN6 A;  4W1U A;  2DA3 A;  1SMY F;  2KJB A;  1TTY A;  4L9T A;  1EJ9 A;  1R23 A;  1D5V A;  2M3A A;  4I02 A;  4KMF A;  5J1Y A;  3ABK H;  4LB6 B;  3CMA I;  4J00 A;  1BW5 A;  3KZZ A;  1BIB A;  4DNC A;  3GTO J;  1ZKG A;  5E8I A;  1SMT A;  1MDM A;  2EZH A;  5D6E A;  3BR2 A;  3OYK A;  3IH3 A;  2P5V A;  2IVM A;  1GT0 C;  1T0F C;  2CUE A;  1XCV A;  1T6S A;  4CO8 A;  4FET A;  4KMU X;  5GPA A;  4HV5 A;  2DA6 A;  2MFZ A;  3K1P A;  3FXR A;  1G3Y A;  2OPT A;  3PFI A;  4LG0 A;  4S0H B;  4M72 A;  4KIG A;  2VAS A;  2VJJ A;  1W5S A;  4YIR X;  2ICW G;  1K6O A;  4B4C A;  2YU3 A;  1J09 A;  2E35 A;  2AQF A;  4I0A A;  5L3F A;  1S3J A;  3GEZ A;  3X2Q H;  4BDZ A;  4U0W A;  2PJR B;  3WU2 C;  3I71 A;  2LRE A;  4DQ2 A;  2M1B A;  1TWA J;  2KIQ A;  4ZYA A;  3WGH A;  3HOS A;  4ENM A;  2H1K A;  3OR1 C;  3KLN A;  2Z1D A;  2HDW A;  1HKQ A;  3DV8 A;  2JVG A;  4CDG A;  2DOE A;  1HDD C;  1MMA A;  4CCK A;  2DO7 A;  2K40 A;  4QWQ A;  1QQI A;  3VWB A;  2K02 A;  1BC8 C;  5IP9 J;  1OCP A;  2KLO A;  2EIJ H;  3LSJ A;  5DM6 F;  4FCY A;  1IC8 A;  1HCR A;  1R5G A;  1XSV A;  3ESW B;  1A6Q A;  5F0H A;  1MDM B;  2E2I J;  4XOP A;  3LSR A;  3CO7 C;  1F36 A;  4XLP F;  2IGO A;  1WSU A;  3K2Z A;  2G7H A;  4HDU A;  3TO6 A;  3VYT B;  4XKC A;  4AD9 A;  3IRR A;  5BQT A;  1BJA A;  3KIO A;  4BHC A;  4OAZ A;  4LK1 F;  1Q1H A;  2KRC A;  3JTG A;  4CA0 A;  2DA1 A;  1W5T A;  4XM3 A;  2MW8 A;  5EDN A;  3OIO A;  3KYL A;  3TOA A;  4C30 A;  4RM3 A;  5LRS A;  2IS2 A;  2QUF A;  4XRS A;  2QBY B;  3S8P A;  1R71 A;  4PJN A;  3DBR B;  4LG0 B;  3SYT A;  2MLK A;  4KUM A;  5D4S A;  1UST A;  2Y9Z A;  2K9S A;  3QU3 A;  3L2W A;  3RQ4 A;  4EAT A;  3H9Q A;  3JRF A;  2BY2 A;  4KN7 X;  1B4A A;  3ZMD A;  2A5Y B;  2L9V A;  1ZEL A;  3GFJ A;  3OYA A;  4HQE A;  2JA7 J;  4V2F A;  2DA4 A;  3LMM A;  1M1E B;  2WB1 N;  3I0T A;  4LMY A;  2FBH A;  2Y31 A;  4LFU A;  1J5Y A;  5E3M A;  1DU0 A;  4MTD A;  2R7O A;  5KVR A;  3FXQ A;  1JE8 A;  1TWF J;  2Z99 A;  3U1D A;  3A01 B;  1RZ4 A;  2VBW A;  1DP3 A;  3BC8 A;  4O6J A;  1Y8Q B;  1GDT A;  1BOA A;  2PLY A;  4ZYG A;  2P6S A;  2ZO4 A;  3M9A A;  3JRB A;  3HTS B;  4HLX A;  3OS1 A;  3CCM I;  4MNU A;  2M7A A;  2CUJ A;  1RI7 A;  1XGN A;  2M9H A;  2EZK A;  2IEK A;  2H8W A;  2WAF A;  2L02 A;  2Z2S B;  3O6B B;  1S5L C;  2FMY A;  5DD8 A;  3IKT A;  3G4S I;  1TT5 B;  2UZK A;  3WTW C;  4YRV A;  5DUK A;  3BR0 A;  3G3Z A;  3L2C A;  2A61 A;  2PQ8 A;  3G2B A;  2STT A;  4ESF A;  5E8G A;  3BR1 A;  4FX4 A;  1MNE A;  3HHG A;  3CTA A;  1TT0 A;  1OQY A;  1K6Y A;  4DZP A;  2K7L A;  3V42 A;  5JLW A;  3QYB A;  2R0Q C;  2QM3 A;  3T1B A;  3C2B A;  3REO A;  2LR8 A;  3NWT A;  4ZYD A;  3WGG A;  1MSF C;  2PEX A;  2CW8 A;  2QQ8 A;  3RCO A;  1XCB A;  1WZ2 A;  3FXU A;  2DYR H;  4AYB A;  4JX5 A;  4ENJ A;  1GVJ A;  4BY1 J;  1MMG A;  4BUP A;  5DUI A;  1FEX A;  4NUB A;  4UV9 A;  3IHU A;  1YQA A;  2E36 A;  4RAZ A;  1D1B A;  1YIT I;  2R92 J;  5E3N A;  4HF0 A;  2DOF A;  1SAU A;  1A35 A;  4NHJ A;  4EM2 A;  2OTJ I;  2LY2 A;  1X1D A;  2EB7 A;  4HF2 A;  5DCF A;  1OMI A;  4EVI A;  2Q0O A;  3M4O J;  3CMY A;  1SD6 A;  5E17 F;  2ISZ A;  1QA6 A;  1HKT A;  4QTR A;  1UG2 A;  1JHH A;  1X4P A;  3BWG A;  4E7Z A;  3J81 Z;  1MJA A;  1W0T A;  4OIN F;  3BR6 A;  3BJA A;  4AVZ A;  5IT9 Z;  4L9N A;  1R22 A;  1BOB A;  3EUK L;  3DXJ F;  2XAJ A;  4D7M A;  1OCO H;  1IJW C;  3SZP A;  2XB0 X;  2R4G A;  4RGX A;  2MC3 A;  4AID A;  2IGN A;  4H0E A;  3BZC A;  2CU7 A;  1WJ5 A;  3M1C A;  5D5X B;  4XID A;  3ABL H;  4J01 A;  4DBR A;  1MD0 A;  3F3X A;  1A04 A;  2PMZ N;  1YX5 A;  1X58 A;  1QZE A;  3DLL F;  3I4N J;  1FOY A;  4P5O A;  4NBQ A;  1JKQ C;  5F1J A;  1UAA A;  2A05 A;  2QLZ A;  4G7Z F;  2HDD A;  2FRH A;  4LIT A;  1BIA A;  2VOO A;  5E79 C;  1D8K A;  2MSY A;  3KE2 A;  1PVE A;  4HNU A;  4OIR F;  4DW6 A;  1U6G A;  4FX0 A;  3EUA A;  4ZC3 A;  4EJU A;  2EFO A;  1DU6 A;  3L1P A;  5CKT A;  5BPI A;  3DPL C;  2JJ7 A;  3C2G A;  2P5L C;  1F1Z A;  2K86 A;  3BY6 A;  4E7J A;  1K83 J;  3ZN1 A;  3KP6 A;  2WA0 A;  1TQM A;  1BR4 A;  5FFZ A;  2CMP A;  1PUF A;  3M8F A;  5M3M J;  1LB2 A;  3W3C A;  2L9N A;  2K3F A;  1YOV B;  2R5Y A;  1AHD P;  2HYJ A;  5DEQ A;  3JCU C;  3I53 A;  2ZME A;  2XUB A;  3LWF A;  2V6E A;  3JRD A;  3AL0 C;  3ZMV A;  1VTN C;  1P4A A;  2GZW A;  4FE4 A;  4C3J J;  5JVT A;  2XAQ A;  3HM5 A;  3M7G A;  2M45 A;  2XF5 A;  4GDF A;  4LK0 F;  1VQ6 I;  5GAD J;  4F52 A;  1T8I A;  3FXO A;  1KGS A;  1EF4 A;  2M87 A;  2Y69 H;  1R6R A;  5EZH A;  4RB2 C;  3H3V K;  1J75 A;  4A5N A;  2VE8 A;  2CJJ A;  1L3L A;  2BVM A;  2DTR A;  2FBK A;  2DMP A;  1LQ1 A;  4K2E A;  3B73 A;  1VND A;  3BJO A;  5HLG A;  2JVH A;  4GO1 A;  5JR3 A;  4UUS A;  2R7R A;  1ZG5 A;  2Y30 A;  1RKT A;  2KJC A;  2W24 A;  1E3H A;  1X1A A;  2E5N A;  5CYV A;  1MBF A;  3BTJ A;  2VJ5 A;  1YRN A;  1FOX A;  4II3 A;  3CCQ I;  1NTC A;  2XSD C;  4P55 A;  4HRI A;  3DKX A;  3HSE A;  1ZHF A;  1X4O A;  2FD5 A;  5D5U B;  4UB8 C;  1ZAR A;  1TWH J;  5KCM A;  1PUE E;  3KYC B;  5KNL A;  3EUH A;  2OTL I;  2IBD A;  5ICE A;  5HDN A;  2B63 J;  1B59 A;  2NXN B;  2R5Y B;  1PP8 F;  1AA7 A;  3G1M A;  3JRI A;  2BOL A;  4HOB A;  4L0Z B;  2ZME B;  3W2A A;  2RQP A;  5FLX K;  3G1O A;  3CJN A;  3C2H A;  2KDO A;  2P6T A;  1X2N A;  1ZN2 A;  3BG9 A;  3ZOB A;  2A6E F;  3TP0 A;  2D1H A;  2M34 A;  2GWR A;  4M3E A;  5D8K B;  3LSM A;  2M4G A;  2NS0 A;  1P7J A;  1Z7U A;  3DKW A;  1LFP A;  2NAZ A;  2MA3 A;  2DXI A;  2XSJ C;  3CCJ I;  3FKJ A;  3BDD A;  2BXZ A;  3GF2 A;  3T5X A;  2EIL H;  1LEB A;  5K5R A;  4JK1 X;  3SJM A;  5E3L A;  5LFA A;  3KEQ A;  4ZH4 F;  4P9U A;  3GTK J;  3S14 J;  1R9T J;  3FF5 A;  2LF7 A;  3I59 A;  1Z7L A;  3VYU B;  4D0P A;  4RB1 A;  1JKR C;  1YJW I;  4UUS B;  4M74 A;  3C7J A;  4G6T B;  1AU7 A;  4MQV A;  2ELJ A;  3R0J A;  5DM7 F;  2PBI A;  3K4B A;  4B3A A;  2HVR A;  3W6J B;  1BN5 A;  2E7W A;  2VPR A;  4OMZ A;  1REP C;  5D6F A;  4Y3O A;  3HL2 A;  3PQK A;  3QYF A;  2W7N A;  3W2W A;  2WB1 A;  1WI3 A;  3LQQ A;  1MIJ A;  1ZAO A;  3GTG J;  4NB5 A;  2QCO A;  2WV0 A;  1ON2 A;  2X51 A;  5CVI A;  1XSD A;  3QPL A;  3V8L A;  1W7P D;  2XPU A;  5AIP A;  2IGK A;  4CSW A;  1I27 A;  2IS4 A;  3IUO A;  1Y56 A;  2R7S A;  1R00 A;  4UUV A;  4N4O B;  3OR2 C;  2X48 A;  2DFH A;  2BY1 A;  4C9Y A;  1HXD A;  3E6D A;  2K9N A;  4BQN A;  1KON A;  2HI3 A;  3HOX J;  1O3T A;  3H35 A;  1YLF A;  4HX8 A;  1F9N A;  2M30 A;  4IHX A;  1KQ0 A;  3FHN A;  1ACI A;  3AG2 H;  2GA2 A;  3CC4 I;  2UUZ A;  4M6X A;  2FJ1 A;  3CDI A;  4FHT A;  1W7P A;  4NC6 A;  4KIT B;  3GTJ J;  1CQT A;  3DEU A;  3SZT A;  2DYS H;  5HNH A;  1HW1 A;  2NNN A;  3K9T A;  4MFE A;  1S6L A;  1N78 A;  4IO9 F;  4BGD A;  2D1V A;  4A0Z A;  4R1H A;  2I8D A;  5DCM A;  3P9K A;  1Q1V A;  2LSO A;  1DGR M;  1UFM A;  4LLL A;  3K10 A;  3U21 A;  1VF9 A;  2FBI A;  1I50 J;  3L2U A; 
#chains in the Genus database with same CATH homology
 4YIR X;  2QSH X;  2QSG X;  1OQY A;  2F4O B;  1PVE A;  2F4M B;  1TP4 A;  1QZE A;  1X3Z B;  2QSF X;  1X3W B;  3ESW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...