2QSGX

Crystal structure of rad4-rad23 bound to a uv-damaged dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
54
structure length
54
Chain Sequence
GLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords native strand of the CPD-mismatch DNA
publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 18
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qsgX00
2QSHX 1QZEA 2F4MB 1PVEA 3ESWB 2F4OB 1TP4A 1OQYA 1X3ZB 4YIRX 1X3WB 2QSFX 2QSGX
chains in the Genus database with same CATH superfamily
2VQLA 2VXZA 4YEJA 3RKWA 1ZQ3P 3P9CA 3BPXA 3S14J 1ETOA 4Y15A 4EQQA 1F43A 3E5UA 5HDGA 5HS8A 1Y1VJ 2FRHA 1QVUA 3GBGA 3HUGA 3O6BB 1GT0C 4CCKA 1W5TA 5EG0A 5F64A 5KCMA 1Z3YA 4WXHA 4UUVA 2IS1A 4HX7A 3IKTA 2W25A 2QCOA 1FT9A 3GF2A 3OSFA 3SDBA 4HEA2 2ZXJA 3HOUJ 2W57A 1QZEA 4FCYA 3TO9A 3FK7A 2HQAA 2H1LA 2LYCA 5CPRB 4ZDOA 2I8DA 3A0BC 4WXDA 4E7ZA 1I6XA 1BC8C 2ZKZA 2DA3A 3W6KB 3KP2A 2W48A 3IV5A 2LTPA 5E1ZB 3GTJJ 1XCVA 4LK0F 4G6QA 2YX7A 1T6SA 4X1EA 4RAZA 2PJRA 4XN3A 5DV5A 2XPVA 2KKOA 3JW4A 2EZLA 3KYLA 2BEOA 3TW7A 5LD2C 5LHHA 4J00A 2C6YA 4MQ9F 4ESJA 4HSTA 1HOMA 3CCJI 3ZQHA 1NK3P 2XUBA 2R5ZB 1IV6A 4ZYGA 2QEXI 3HEFA 1VQKI 3TDUC 4F3QA 1O4XA 5HODA 3C18A 5HLGA 5AIPA 2G0EA 1Z91A 2XPUA 1FBUA 1V3FA 1LNWA 1ZGJA 5A2QZ 3PO2J 3TDZC 3I3LA 1U9NA 2BXYA 2LY1A 2XKOA 1MW7A 3K2ZA 4MGRA 1VFCA 3TEDA 4NDLA 1X58A 5K7HA 5E1XA 4EEFG 1FIPA 5ICCA 1SAUA 2DXIA 4KMFA 1MH4A 3DTIA 2VODA 4F92B 2BHZA 4XRFA 3RIRA 1TQIA 4IXAA 2L7KA 1NK2P 1YX5A 3ZN0A 4K2EA 4NNJA 1BM9A 1TQPA 1DGRM 1WJDA 2KIUA 1LFBA 4A3CJ 1W0TA 3S1QJ 2Z5UA 1U2WA 3OIOA 5K5OA 2DTZA 2PMZA 3KP6A 4XK4A 4EMSA 4CH7A 3HJEA 4OWRB 1YIJI 2UXNA 1HW5A 2MC4A 4BKXA 4UV9A 3FHZA 1DGWY 1VQOI 3JRBA 1MDMB 3KZIC 5EGOB 1D8JA 2NVTJ 2GAUA 3OR1C 1Z7LA 1ZG3A 2JUGA 3F21A 1ERDA 4XSXF 3CESA 2NOJB 1ZAOA 2HR3A 5E20A 1WJEA 1IXCA 3WGIA 2ZO4A 3BC8A 2R5YB 1PJRA 2JVGA 2P5VA 5FKLA 5K7ZA 4XKWA 1ETWA 2K4BA 3ECOA 3ZQQA 2A6HF 1DP3A 2F5EA 3GTPJ 4E6KG 2KDZA 3CO6C 3HPHA 2DN0A 3E6CC 4GCVA 1AWCA 4B48A 4N9IA 5L3CA 3OYHA 2QKLB 5J1UA 3FMSA 3TL4X 3RPQA 1FYKA 1P7JA 4JX4A 3QQAA 3SFIA 3PQJA 4MTDA 2JSCA 4L9JA 4IRHA 4XICA 4WK8F 1S6LA 3LSRA 4XRMA 3IP4B 1D3YA 1V55H 2KMUA 2XGDA 1ZELA 4CGZA 4ZTJA 2LSOA 1MKMA 1TW3A 1Y8RB 2DK8A 1FPQA 1LFPA 3JRFA 3MD2A 2WAFA 3S3MA 4MFDA 2ECCA 3CTAA 1I39A 4QTRA 1H89C 4HF1A 1LKXA 1QVTA 3BJOA 2YPRA 1J2XA 3CUQA 3I0TA 2BXZA 2WAEA 2K9LA 2M7BA 3ASNH 4I7HA 1WKMA 2L3DA 1FYMA 1XG1A 3ZN1A 2R7RA 1O3SA 3OYFA 4DW6A 2ZC2A 3LMMA 1E3OC 3I59A 4F7ZA 2V26A 1MMGA 3A01B 3E1SA 3NQOA 4XLAA 4BJ5C 5J8FA 4RAYA 4IRIA 2Z3YA 2CQKA 2Q2EB 4CHUA 3JAMZ 4I09A 3VSKA 3ZGKA 5BOXA 1E0EA 3VB2A 3NEUA 1XMKA 4U0WA 5EYRA 3FF5A 1XC5A 3M9AA 4OAYA 5JVGF 1U5TC 4A3EJ 3FXKA 5JHFA 5LRSA 4JBAA 4AU7A 5CQEA 4LGWA 2MD5A 2FNPA 2F6CA 2E35A 3GFLA 2NVXJ 2LFBA 2RREA 2OV7A 4EGYA 2R7UA 2HFHA 3DBHB 1MGTA 5KAIC 3WG7H 4EM1A 4R79A 2DA5A 4BDZA 1X3ZB 3DKXA 1DQUA 1MSFC 2F48A 1YS6A 2YR2A 3CUOA 3KP7A 5ILVA 1SD5A 3DPTA 3LAJA 3TO6A 4HLXA 3ZQFA 5D6FA 1Z6TA 2VIXA 4CZCA 4ENMA 1EH7A 4C2MJ 2Y69H 1RNLA 2DA1A 3KYCB 3I5UA 5DS9A 3BTCA 5B66C 4DJAA 3SEQA 3C3WA 1P92A 4E7SA 1Z7UA 5TRDA 3WE3A 2Y0MA 1MMSA 2FU4A 1OLTA 2D5VA 2QBYA 2IBDA 4GYGA 4FISA 2DDBA 4ESBA 2STWA 2GBYA 3Q9SA 1Q1VA 2LDUA 4MTEA 9ANTA 1D1CA 2DBBA 2E1MC 2Y2ZA 4RB3C 4AC0A 1ZTRA 3A03A 3COAC 1UJ8A 3CC4I 4IQJA 4N0BA 2DYSH 4DYQA 4UVCA 4KJZA 5GAHJ 4YFKF 3J81Z 3O3KA 3LSIA 5F08A 1X1DA 1F9NA 1GDTA 2F4MB 2FJ1A 4FTHA 2VXDA 1R4MB 5CLSA 3GTGJ 4P55A 3A1YA 3K70C 3CCMI 2ZB9A 1BW5A 3O8GA 5B1AH 1HKQA 1W36D 2VN2A 4A3LJ 1O57A 4AM3A 4L9TA 2GIZA 4ENKA 1ZRCA 4XN0A 3RQ4A 4A6DA 1WJFA 1SVOA 2O03A 4RLQA 2H6CA 2JRTA 3WODF 2VPRA 5D6EA 3DPUA 2I5UA 2EJRA 3FIWA 3KZZA 2NOGA 4BU2A 2LNBA 2BY1A 1E17A 2LOOA 2ZFWA 1F5TA 1ETYA 1R71A 2KISA 1R9TJ 1XSDA 3D5LA 2YUSA 1NHAA 3QOPA 4A3MJ 2JVHA 1WCMJ 5FD5A 2QQ9A 2HQRA 2J5PA 3EETA 5IPAA 4BDYA 1QPMA 2ZMEC 1QA6A 3OYMA 2FXAA 3L2CA 1OPCA 4KIFA 2CS3A 2VQGA 4BQNA 4RB1A 2PBIA 2Y31A 2ZXIA 3NARA 5C44J 3DU5A 3CMYA 2MW8A 4IEJA 2XGXA 2LBFA 2VC1A 2LKPA 1TWGJ 2FMYA 1H9TA 2BW3B 5HLIA 1IO2A 2FE3A 2QA4I 2HVQA 2CGPA 2RDPA 1TC3C 3TKYA 3BG7A 5K5QA 2DT5A 1MMDA 4S04A 2V1UA 2DODA 3FBIB 4YFXF 1B8IA 3C7JA 2XC7A 3E0JB 3KP3A 4PCQA 2EH3A 2RQPA 3PFIA 4IQ4A 2OBPA 1MBFA 2WB1A 2IP2A 4I0AA 3MKLA 2QQAA 3QYFA 2L02A 3HC7A 1ZG5A 3Q9VA 3FDYA 2PEXA 2XB0X 5GTHC 4QSHA 3ABKH 1IXRC 2HWVA 2NAZA 2VJJA 2IA0A 3QPTA 4AWXB 4CYDA 2H94A 1Y0NA 1KU2A 3O2PE 3G71I 3CCEI 2EPFA 4GRIA 4IF4A 1DUXC 3OYCA 4M9ZA 3E3VA 4A3JJ 5CVJA 4KIBA 3HRSA 4PFOA 1XSXA 4Q5SF 1S29A 2LKSA 3BCBA 2GZWA 3TOBA 1BC7C 1ZR4A 1IRXA 1WZ2A 4RMNA 4CCJA 3HRTA 2A07F 1E3PA 4OINF 1LDKB 2Q8KA 2E1OA 2WADA 5HOOA 1LDDA 3JRHA 2IS2A 5KK1A 3L00A 2R7OA 3ZMSA 1IG7A 1OCZH 1A04A 4PJMA 1BI1A 1GV2A 4GFBA 5E1WA 1W7PD 4Y33A 3DTKA 3S2DJ 1G8XA 4NB5A 1LEAA 1YG2A 3CMMA 2X6WA 4BL0B 3OYIA 4LITA 5E3LA 1UELB 2LREA 2WAQN 2OPTA 3C2GA 2OQRA 4M3DA 2AXTC 2EILH 1FBSA 2RN7A 2BV6A 3IUOA 4UB6C 4ABZA 3HGYA 4NQWA 4S05A 3F6OA 4U87A 1K61A 1FC3A 3WGGA 3DPLC 2LF7A 5DUKA 1ZG1A 5JFRA 4BS9A 4C2UA 2E19A 3RTRA 3L2VA 2BZTA 4A3DJ 4ZJZA 3W3CA 2R7QA 1LFUP 4DNCA 5HNFA 1W7PB 5HLTA 1U5TA 2JA7J 4DYRA 4KITB 4G8XA 2M2EA 1ZGAA 4BY7J 1P2FA 1WH5A 1IV8A 2YX4A 4KICA 2HYGD 4LIVA 2HDCA 3RDIA 1YW8A 4B8XA 5HVQC 1I3AA 2HDWA 2DMUA 2OAZA 4HYEA 4LIUA 5GP9A 5E3NA 2B9SA 1VQ7I 5C4JJ 3A2KA 2R7SA 1ORKA 2FEZA 3I53A 3K4NA 1YIOA 1ZKGA 3MKYB 4D5CA 3AG2H 2CQQA 2JPBA 1BW6A 3CF2A 5IYDJ 4LK1F 5FLXK 3IH3A 4XLHA 4XRSG 2UZKA 2F4OB 3HM5A 2L9NA 3V7RA 1S9HA 4UB8C 4RS8A 4A0YA 2DFIA 1FSHA 1AKHB 3TQNA 3AL0B 3HSEA 1OR7C 2IA1A 2K02A 2A69F 4N4OB 2CQ7A 4H0EA 1S7OA 3I54A 4DGWB 2XSDC 4QWQA 2HVRA 2HYFA 2XGCA 1MNDA 2JPCA 4RM3A 4RB2C 5EEHA 2UUZA 4D9JA 1KZHA 4M6VA 3OIQA 2CW8A 3MN2A 1FJLA 1B72A 2WY8Q 4W1UA 3UR3C 5BPIA 1SFOJ 2CV2A 3K4MA 1TLHB 2IPQX 3NWTA 4XR6A 4D5FA 3DTEA 1TWCJ 3EDPA 4IHXA 3ERMA 3MKWB 4DIQA 2H8RA 2VKEA 2D1VA 2LKXA 3GFIA 1HLVA 2EIKH 2E34A 5HDNA 3OYGA 4AYBN 1WQ2A 2DLLA 5IT9K 4UVBA 4WF2A 3CUQB 1IDZA 2W7NA 2MLGA 1B1BA 4LD5A 1IJWC 4Q4ZF 2ZSHB 3Q5FA 1X1BA 2NYXA 4H4KC 5IP9J 1HA8A 4LOCA 2AQFA 2LVSA 1XMAA 2ZCWA 1FTTA 1H8AC 4ZC3A 4MQVA 3CDIA 4LLLA 3K6GA 3OOUA 3LQQA 1G3TA 2NNYA 2M45A 3OYEA 2ZMEA 1W1WE 1ZK8A 3CCUI 1LE8A 2H1KA 1T0FC 2HOAA 3D5RC 5HS9A 1N77A 2CQXA 2RKHA 2HXIA 1R23A 5EZGA 4O6JA 2XDVA 3RZOJ 3SYTA 1MJAA 1YYVA 3PUBA 5F27A 1POGA 3L09A 4LG3A 2LLKA 1VQ6I 2IGNA 4CYCA 3BROA 4I6ZA 4A0ZA 4F91B 3QODA 1O3QA 2CV0A 5GAEJ 5J4VA 1U0JA 4B3XA 3CMAI 1D0ZA 3DEWA 3RCOA 1IN7A 2P5KA 2XB5A 4MNUA 4NC8A 3E6DA 4B47A 4Y7NJ 3ZRGA 1HBXG 1MZBA 3OL4A 3E97A 4RGRA 3GTKJ 5L3BA 5F0FA 3F3XA 2ZJRF 4M6XA 1A6IA 1D1AA 4GGGA 2E7XA 3G73A 3HHGA 1XPXA 4M71A 4CSWA 2ADUA 1VNDA 4QPQA 1FX7A 1FNNA 2FA5A 5AIQA 1TNTA 2QBYB 4ZYAA 4YG2F 3LSJA 4IL6C 1I1SA 3G1LA 2HYJA 1QRYA 3GTOJ 2O8XA 4XLCA 2DYRH 2E7WA 2HKXA 3MZ8A 1R1UA 5ERIA 4YIIA 3VODA 2FBHA 2DK5A 2M1BA 3ZMTA 3WTXC 2A6EF 4XM3A 4FX0A 4M3BA 4HZFA 4EV0A 3OMYA 2Y9ZA 2EA4A 4ZZLA 2JQ7A 1YI2I 2BBYA 4IHYA 3BZKA 2WAQA 3J7AY 3ZQCA 3HOSA 3H3ZA 3VYTB 1QHHD 2HU9A 3ASOH 3FM5A 1R58A 2A6TA 3K2AA 5LBQA 3K4LA 5M5XJ 4PK4A 3K4JA 4LB5A 1MBHA 1UG2A 3BLYA 2KFDA 2KP6A 2L7ZA 4HNUA 1I3QJ 3ZMVA 2BY0A 1B59A 3DU6A 5FFZA 4HG2A 1DU0A 3PIOF 4NC7A 4R1HA 3REOA 4PJNA 5DEQA 1ON1A 3VYRB 1SANA 2P8TA 2DFEA 1Z3XA 1XCBA 2XROA 2ESHA 3ZMUA 2NNNA 2ID6A 5TISC 5D5UB 2WWYA 4MEXF 1HCRA 2LMDA 1SD4A 4V2FA 2L5QA 4EATA 1JT6A 4E7LA 1T56A 1RRJA 3LA2A 1ODDA 2OC6A 3AG3H 3GO5A 4AVZA 3PFYA 3GTMJ 3I71A 3EYIA 5DD8A 2KIQA 3LSGA 3QYBA 1OMIA 3QP6A 2M8EA 3WHBA 2R7VA 3BR6A 5C4XJ 3IC7A 3KIOA 5LLQA 5DCMB 3AG1H 3BR2A 1JKRC 4Q47A 2CFOA 1X1CA 4V2GA 1K4SA 3T8TA 4II2A 1YTYA 1MH3A 2A5WA 1YE9A 1CF7B 1FMWA 1VQNI 2L7FP 3GVAA 3H1CA 5JVTA 2E36A 5LRRA 1BIAA 2V9PA 2M9HA 2O3FA 3TMOA 1UB9A 5J40A 4LG0A 3VOEA 4ZZDA 4QLCU 1CQTA 3G3ZA 2TDXA 1FEXA 5IYBJ 1UMQA 2LF8A 1QQIA 1WI9A 1OR7A 1ON2A 2QM3A 3F8FA 1IC8A 3S15J 1ZLJA 3DWLE 1VQ8I 2VI6A 3OYKA 5FD6A 3FXOA 3GUDA 4ZYEA 3H9GA 4AYBA 5ED4A 3OIPA 3J7AO 4A5MA 2AHQA 2O8KA 2BYVE 3PNVA 1RZ4A 3GFMA 3QPSA 3NWSA 2ICWG 4HV6A 1NG6A 3LL7A 4ENNA 2D2WA 2DOAA 3Q3SA 5FRNA 2KLOA 2OTJI 4U88A 1USTA 2X6YA 2EFQA 5M5YJ 2HOTA 3UNGC 2L4AA 3LSKA 2NS7A 5BMZA 2VONA 3S16J 3BZ6A 2PX9A 2NRAC 3RKYA 4G7OF 1OCPA 4KIGA 4BUPA 1R4NB 1TTYA 3QPLA 1D5VA 5FLXZ 4R8HA 1H88C 2DOEA 3MEXA 1G3WA 1X3WB 1WI3A 3DXJF 3SZTA 1ETQA 2EV5A 2ETHA 2G7UA 2WB1N 2VE8A 3K0LA 1KQ8A 2HKOA 3PIPF 3S17J 2MFZA 1LQ1A 2K3PA 2AXLA 3RPUD 1L3LA 3VYUB 4NQWB 2EIJH 1FOWA 1PDNC 2FNAA 2HVSA 2W1OA 2QYOA 2X51A 3DLAA 4G6TB 1SC7A 3HOZJ 2GLOA 1FSEA 1UHSA 1ZR2A 1PVEA 1YHQI 1JE8A 1T0FA 3LNQA 3G4SI 4CCMA 2V1NA 4NC6A 4ON0A 1A5JA 1LVAA 3G6EI 3KZYA 5EJCA 5ICGA 1G6NA 1Y0UA 1YQAA 3P9KA 4XORA 1U5TB 1EKEA 3PL8A 2CUFA 3WTUC 1Z67A 3JCUC 4HNTA 1XMXA 2LG4A 1O7LA 2COBA 3SEZA 4AD9A 1Z77A 1KONA 1IUYA 1TWHJ 3RSNA 3FXLA 3KX2A 3R60A 3IRQA 1O3TA 2PLYA 4ASNA 1FZPB 1QO0D 1Z6RA 5IT9Z 2DMPA 5K1YA 5L3FA 3OYBA 3K70D 5IOYA 1YW7A 3QP5A 4LLGF 2ZFUA 5DM7F 2ZXWH 1APLC 1TP4A 4G94A 2KIFA 2WV1A 1FP1D 4A3KJ 4PJLA 4Z6YA 4E7JA 1YRNA 1QNTA 1WVRA 3LSHA 1G3YA 3PQKA 4HW0A 2M34A 4Y52J 2L2OA 2ACJA 2V9VA 4HPQA 1GVDA 1QPIA 3TP0A 1USSA 5D4SA 1MNMC 4UY8I 2X48A 2E1MB 1MNEA 1FMVA 1WH7A 1P4AA 3OYJA 5J6XA 2E2IJ 4OIRF 1B9NA 4MIMA 2PJPA 4OU0A 3P5JA 1T98A 5D4RA 1K78A 4OIQF 3VSLA 1U8BA 5B3SH 3J80K 5FLVA 3HTUA 2V1XA 3FHNA 5M3FJ 3Q0VA 1SFKA 1L0OC 4JYKA 3S93A 2Z16A 1N75A 1FOKA 1J7KA 2A5YB 3K4CA 2XGEA 4C2TA 2XAQA 2PMHA 5J4YA 2F2EA 3JTHA 4C3IJ 3OS2A 1JTYA 4F55A 4QIWN 1PUFB 1SD6A 2DA6A 4EM0B 3BT9A 4DQ2A 1XDUA 4A6EA 3ZOBA 1I50J 1C0WA 1N25A 4A12A 3RKXA 1JXSA 2K27A 3SZGA 3HOYJ 3M4OJ 5EF6A 2H27A 2MG4A 2V4JC 1XGOA 2G7HA 3LA3A 2VKDA 1ZHFA 1RESA 1LE8B 2ME0A 5DTDA 4I76A 4B1RA 2Z9OA 1RETA 2W85A 3HGGA 2KHMA 5J1RA 2K9NA 1IDYA 5HLHA 3I64A 4A3GJ 3BTIA 2M7AA 4M9XA 5L3EA 1K7AA 1IAWA 1Y56A 4MFEA 2DFFA 3CO7C 1DPUA 1S8NA 3B02A 2YS9A 3S3OA 2X85A 5GAGJ 1W4MA 1PP8F 1DP7P 1EJ9A 2X1DA 1A36A 4YRVA 5FB2A 1ULYA 1BJZA 4FHTA 4UUTA 4BHBA 5BPDA 2F5VA 3QWLA 3C2BA 4HQEA 1JGSA 2DMTA 4YIFA 2HQ5A 3F8NA 1T2KA 2IA2A 3HL2A 4A69C 1VI0A 2IS4A 1OCRH 2ZNZA 1E3HA 3SXYA 4IVNA 2CH0A 3SZPA 4M72A 3V8KA 4IPAA 2JUCA 1YW9A 4FE7A 3D5SC 1ZGWA 3VWBA 2KRHA 2L01A 2XVCA 1Z1DA 1Y8QB 3BG9A 4A93J 2EZKA 3ZMDA 2W82A 2IJLA 4IHSA 3HB9A 2DJIA 5JHUA 5J3LA 1R5GA 2DA4A 2WV0A 3BG6A 4CZZA 1MMAA 3C2HA 2JA8J 1GHCA 4AIKA 2GQQA 1N78A 2RNGA 5E3OA 4ZDLA 1TBXA 1V54H 2MBFA 4KISA 1HDDC 1R1TA 3HZJA 2EZIA 4CCOA 3DP7A 3OS1A 1QZZA 3EYYA 1EA3A 4B3AA 1I1GA 1GVJA 4E70A 1MBJA 4XKBA 3ML6A 1J0RA 3HUGB 2IRFG 1V5FA 2VBYA 1RPWA 1WGXA 4XLEA 3K4KA 2QSGX 1T38A 5EG0B 4Y3OA 2VQCA 3H35A 3CMEI 2BE5F 4A5NA 1WJCA 2Y30A 2ZBKA 3PSIA 2P7VB 4RM2A 1D0XA 2CUZA 2MYSA 2NS8A 2PI0A 5K5RA 3CCSI 5ICFA 3ESWB 1LJ9A 1OQYA 4KN4X 2EB7A 4HF2A 1T95A 4FASD 2HQNA 1LDJA 2YU9J 4JX5A 3V42A 4L0YB 3IWZA 1WHUA 4BE2A 2Y75A 3GLXA 4P96A 1X4OA 3QU6A 2PJRB 2V6CA 3B6CA 4XOTA 3JTGA 3W6VA 3GTQJ 3JSOA 3AAFA 2GA1A 5FKNA 5IP7J 4IOAF 5IT3A 3GWZA 3VFZA 1U6GA 4D7NA 1P4XA 2GWRA 5KAFC 4NHJA 1MMNA 3KYDB 3E6BA 3Q0WA 4AIDA 1OCCH 1RI7A 2ECBA 4EJOA 5FKKA 4E7HA 2R7TA 2NVYJ 2RQQA 3HTSB 3MQ0A 1Q1HA 1F1ZA 4BH9A 3FISA 1GLNA 4HA8A 2VJIA 2I10A 3FXJA 2QGUA 4E7IA 3JRAA 2EIMH 3V7SA 5E8IA 1MDMA 2W00A 1KGSA 4P9FA 5EGOA 1V5EA 2XKPA 2VASA 3EQLF 5IYCJ 2QSHX 2A68F 5H6QA 3LSPA 2BOLA 2ZSIB 4IZZA 3BOQA 5BS6A 5EEGA 4I01A 1RR7A 3KEOA 3OYDA 1EH8A 1XX5A 3IWFA 4JK1X 3HKZN 4OIOF 3GX4X 3M07A 2R5YA 3DKWA 5DM6F 2V1DA 3GZNB 3U2RA 3NAUA 4IHTA 2LR8A 3ZCOA 4G12A 5ILSA 1Y39A 1J59A 1TW2A 1K6YA 3KEYA 5EZHA 1D5YA 1FOXA 3KETA 3QOEA 3FX3A 1ZREA 1JUMA 3L2RA 2EFOA 2FSWA 2ZNYA 1HSTA 2A3SA 3LQRA 1XSVA 3F8MA 4P1WA 5FROA 3J7ZI 1AOYA 3IH4A 1KYWA 2PG4A 2EZHA 2DPDA 4C30A 1G3SA 3CLQA 5GPCA 2FBIA 1REPC 1SFEA 1P7IA 2MD0A 3K1PA 4KYWA 5F0HA 4M3EA 4LJZF 5HS7A 1MSEC 3GXOA 3ABUA 2QVOA 1ZH5A 4BNCA 3K9TA 4PGGA 1F4KA 3VYSB 5LFAA 5D8LB 5GADJ 2DMNA 2M0MA 3ZQIA 4CDGA 3FWEA 4B43A 1QHGA 2MLKA 2VBZA 2XAGA 3F9KA 2LY9A 2JA2A 3MAJA 4RA2A 3HPGA 1VZ0A 3HDDA 4Y17A 2MA3A 4PSXA 1VQMI 1K83J 2XIGA 3EUHC 5KNLA 1JKPC 3ZQGA 3WU2C 3D0SA 2L9SA 1R36A 3OV8A 1ZRFA 2TCTA 2XRNA 2HXOA 2VUMJ 1WPKA 3AKZA 2Y48A 4X6AJ 3M8EA 3LAPA 2F5FA 1R49A 2BHYA 2FD5A 2DQRA 2XRLA 3J80Z 3FXMA 1SFUA 1BOAA 2DAOA 4ETSA 1IN8A 3WTWC 3CZ6A 2L9VA 3L2QA 1YO5C 2ID3A 4UHTA 1RR8C 3F8BA 3GFJA 2K9SA 1ETXA 1A31A 2IW5A 3M1EA 4HNVA 1ACIA 2OD5A 4UXNA 3G1OA 4U7BA 3CJRB 5CVRA 3M7GA 2JT1A 5DYMA 5IP6A 2QF7A 4C9YA 2Y0SN 1V5GA 3HIFA 3HOXJ 1T39A 5M3MJ 1S7AA 3S32A 2H8WA 4N4NB 3I59B 2JJ7A 2IXSA 2TRTA 2CUJA 2NS0A 1E2XA 1RC9A 2Z99A 2K86A 5L3GA 5E3MA 3S3NA 4EJWA 2XF6A 1VTNC 3OR2C 1BR2A 4HRIA 2QUFA 3L1PA 4A3IJ 1Z05A 2ME6A 3D1NI 1W5SA 2VC0A 3A0HC 1BI3A 1P4WA 4J01A 3V8LA 3GTLJ 3HHHA 1Z21A 4DBQA 1YFHA 3BR5A 5CKTA 4ITVA 2PMUA 4KNYA 2E71A 2KIMA 2XASA 1VQLI 3WGHA 5GTIC 3IHUA 2EQRA 1JJ6C 1IW7F 5E18F 5DDGA 5CQGA 3BZCA 1Y6IA 2VJ4A 3ABLH 2YU3A 2CFXA 5ICEA 3PJRA 1XDSA 4U0YA 4OMYA 3HSRA 2EV0A 3P7NA 5K7FA 2AS5F 4HQMA 1HDPA 3JR9A 1MIJA 1ETVA 3W2WA 1UAAA 2M4KA 4XKVA 5CJ9A 2ZJQF 3HG9A 3KPHA 2RVCA 4BBSJ 1UHMA 2CU7A 3KLNA 3A4CA 1QZYA 4E7KA 2ELKA 5AONA 3TW6A 3WTSC 3G2BA 1VQ4I 1IRFA 2WTEA 4BHPA 3BG5A 4J19A 4EGZA 1S72I 2JN6A 5J8CA 4KMUX 2E1CA 3L2WA 4L9VA 4F93B 1S7EA 2PFBA 1W0UA 2V7FA 1WJBA 1IRZA 4QPOA 4XLFA 3WTYC 4BQAA 3KP4A 1O7FA 1SD7A 1PUEE 1JKOC 4IOCF 2R7DA 4ZH4F 4BEHA 4UUSA 5EEAA 2A05A 4UV8A 1U3EM 3CF5F 3W2VA 1TQMA 4FE4A 5LHGA 4MLOA 4HDVA 5KHDA 2E5ZA 2FMLA 3CCYA 3F23A 1MBEA 2IT0A 1YITI 1XN7A 2IGMA 2V79A 3V7CA 4X0GA 3I4PA 1IZ1A 2BW3A 3CJNA 2P4WA 2XAHA 5DCFA 4EJVA 4IHVA 3GEZA 3F0CA 4BXFA 4NUBA 3CJTB 3SQNA 3H5RA 1A35A 2FOKA 2X0LA 3KP5A 4CUGA 1JHFA 3QYEA 3H9QA 4HBLA 3HKZA 4OMZA 1HXDA 3LOCA 3CLOA 2HPMA 1HKSA 2CMPA 2X9DA 2UV1A 2X4HA 5JLWA 2M5WA 4FETA 3ZP5A 2HI3A 2ISYA 2DPUA 2IVMA 4P9UA 3H3VK 1J9IA 1LVKA 4EM2A 2P6TA 2D1HA 3DCFA 4Y13A 2Z33A 3S1MJ 3BWGA 5H2FC 2LBFB 2OF7A 2X6XA 4BJ6C 3O8HA 1ZN2A 2RGVA 4XIDA 3CCQI 4XLNF 1BL0A 1EV7A 3PNTA 3DBLB 5GPAA 3ZQ7A 3CD6I 2OA4A 1M1EB 1UFMA 4KFCA 1B8IB 3L9FA 2FX0A 2ZJPF 3CDLA 3F22A 2BY2A 3L7WA 1SMYF 2CWEA 3IH2A 5HDKA 2CW7A 5FJ8J 5FFXA 1HC8A 1YJNI 1R22A 1I6HJ 2FF4A 4IRGA 4RGXA 2HOEA 2XAJA 2E2JJ 3TP3A 2BY3A 1IN6A 3TBIA 3T1BA 2MGQA 1XGNA 2LK2A 4GXOA 4C3JJ 2MSYA 4RAFA 3SJMA 4A2UA 3L2UA 1GXQA 3MZYA 4S0HB 1P9QC 3CC2I 2VQHA 1VQ5I 1FTZA 4AUXA 4PJJA 3EUHA 2RAEA 1P6RA 2X6OA 1OCOH 2KJCA 1GV5A 3GZ5A 4ANJA 3I55I 4RLFA 2DA2A 5D8KB 4HDUA 2EFNA 3BG3A 5CVVA 2CRGA 4PZJA 3ULQB 2GOXB 1GUUA 3ZPLA 2M3AA 2Y0SA 1JGGA 4UVAA 1GXPA 2OQGA 1QBJA 2QZ8A 2R0QC 4OIPF 1W7PA 3WTTC 3U9GA 3IKVA 1FWZA 1MD0A 4HF0A 4D1QA 4I2OA 2E5NA 2KRCA 1OISA 2JZYA 2FUG2 4EVIA 5FLMJ 1YJWI 2X1EA 5F04A 3IRRA 2VOPA 2OTLI 2R7WA 1S3JA 1UZCA 2XSJC 3FMRA 2OZ6A 2K85A 1AA7A 5KVRA 2IGOA 4XONA 2EA2A 1CGPA 3I9V2 3BR0A 2VBXA 3W6JB 1FP2A 2KDOA 1OCTC 3PSFA 1RKWA 3ISPA 3RKQA 5E17F 2O0YA 5H6RA 3T8RA 1BR4A 2JRMA 1F36A 6PAXA 2FQ4A 1OYIA 4P5OA 1WWXA 5M5WJ 3H5NA 1YOVB 1TWFJ 4LMYA 4BBRJ 3HYIA 5FO5A 2GIVA 1SVLA 2DQLA 2B7EA 4JP0A 4V19K 2GXAA 1AKHA 3FXQA 1IRGA 4PDKA 4JOMA 1H0MA 3WU0A 3RZDJ 4NBQA 4U0VA 2EWNA 5LEKA 2DTRA 5DD4A 4LFUA 3GLLA 3N4MA 5EDNA 4BXXJ 4OOIA 2XAFA 1SFXA 4DZJA 3RYRA 4D0PA 3LFUA 5D5VB 1B6AA 4A0XA 4PUSA 2P0WA 1ONVA 2VBWA 4KUMA 1HW2A 2GXBA 2K7LA 1VF9A 1MBGA 2K40A 3H92A 3HOWJ 4IX7A 1S5LC 3HOVJ 3U21A 2WY7Q 1HW1A 3JRDA 3B73A 4PGHA 1KU7A 2MH2A 3BPVA 1JUPA 2JMWA 2F5CA 4XBFA 1G4DA 4IHWA 2H6BA 4KA4A 4WXCA 2OJED 1LEBA 4LLNA 2X1CA 2EV6A 2DO7A 4TV7A 3FBNB 5JI6A 2VKHA 1T33A 2CO5A 1BJAA 1WRJA 2DA7A 3WTZA 4XLPF 4D7MA 1R00A 4BXUA 4KDPA 1I27A 2O7OA 5C3EJ 3OY9A 3GYHX 1B72B 4L5EA 1D1BA 1R5ID 1X2MA 3CP8A 1D0YA 1BBYA 1ZLKA 3N97A 3BTJA 4JX6A 5TGTA 1WJAA 2DCEA 3TOAA 3T5XA 3TO7A 3CCRI 3SDGA 2DOFA 2CYYA 3FK6A 1OFCX 4PJ0C 3CJQB 1VQ9I 1JHHA 3AG4H 2CUEA 2FBKA 4RDUA 4RGSA 5E79C 3UKGA 3GZ6A 1ZRDA 1ITYA 5LGUA 1BA5A 3FKIJ 4BE0A 2F5DA 3KCCA 4B44A 3WTVC 2MC3A 1ENHA 1TZLA 2XPWA 5BNGA 2HTSA 3WU1B 5LGNA 2RC4A 3CP2A 5J47A 3LWFA 2ELJA 1HSJA 2L4MA 4G7ZF 3EUAA 4FT8A 4AVPA 1KYZA 2KZGA 3TGNA 1ZYRF 2PQ8A 1SMTA 1ETKA 3BJAA 1IN4A 3IAS2 1XS9A 3R61A 2ZMEB 2XV4S 2STTA 2LY2A 2DW4A 3VDXA 3Q0UA 4GDFA 3E5XA 4ZTFA 1X2NA 2BVLA 2G9WA 4W97A 4ZYHA 1NG7A 2HPIA 2DJNA 2CW0F 2JA6J 4DBRA 4MHGA 4CICA 4XNFA 1STZA 4E4HA 2E2HJ 4FQGA 1NTCA 4KT5C 3HOTA 4IO9F 4M6YA 4CYCB 4YFNF 5LGTA 3JSPA 1I5ZA 1TL8A 2Q1ZB 2IGKA 3K10A 3ZR8X 4BAYA 4DZPA 4A3FJ 4I98B 2QKMB 2ELHA 1A6QA 1U9OA 2IEKA 4L5IA 2VT3A 3CC7I 3F8CA 1B4AA 3RYPA 3ABMH 2R7ZJ 2CQNA 2M0CA 1IUFA 3CCVI 2N8GA 4BQOA 3M8FA 3WHCA 2QENA 1JUSA 2KL4A 3JREA 2HDDA 4WCGA 4HX4A 3KFWX 3K1NA 2K4JA 3H9JA 2COMA 2DMQA 2HOSA 2MH9A 3JRGA 4MO7A 5FKOA 1LPQA 3I56I 3BR3A 2NVQJ 1K6OA 2FQ3A 4BEHB 4UUSB 2GM4A 1OYWA 2LC2A 3I58A 2K9MA 4BQQA 3K7AJ 3BTLA 3MVPA 3U1DA 4BHCA 2B63J 2VPLA 1OYYA 3BCAA 1BI0A 3FKJA 1O3RA 3H0DA 2Z2SB 5IY5H 3OS0A 1FLIA 2R3SA 4IKFA 2DT7B 2K5CA 2O61A 2HNHA 1UHWA 4WWCA 2O5RA 3WG9A 3RQIA 2JK3A 2R5ZA 3M1CA 2L9RA 3V4GA 4ESFA 3H36A 5DCMA 3GW2A 1X4PA 5DUIA 3VPRA 5F1JA 4RBOA 2KT0A 3MMYB 3CDHA 4BACA 1JTXA 1CF7A 1J75A 5CVUA 2B0LA 1BR1A 4XMYA 1TT5B 2A61A 1WSUA 4GO1A 2VL8A 2VE9A 4BY1J 2AO9A 2E60A 2GXGA 3RI4A 2P7CB 3H3UA 3T0YA 3MZHA 4CO8A 4MEYF 2OCEA 4UNOA 2Q0OA 3H0GJ 2M87A 1W36C 4I99C 2JA5J 2VKVA 2ZXHA 4Z2YA 2M30A 3EPZA 1IGNA 1XD7A 2LD5A 2R93J 5E8GA 3DEEA 3CQZJ 4CCLA 3S1RJ 1KA8A 2EK5A 3LSMA 2ZJ2A 2FOWA 1AHDP 2GOMA 2O9LA 1SVMA 2M4GA 1DDNA 3OWTA 1R1VA 5J1YA 1PYVA 4HV5A 3MKZA 2QWWA 2NXNB 1BI2A 1YLFA 1FIAA 4CXFA 3G1MA 2GA2A 1OJLA 1LUJB 3DEUA 1KQ9A 2AQEA 1QGPA 3S2HJ 4G7HF 4AIHA 4Y4RA 2DT6A 2L54A 3E6MA 4ZDPA 3I4MJ 2EBIA 2KZVA 1X1AA 2R92J 1KU9A 3OYNA 3FZVA 2R7XA 1JI8A 2UXXA 3E7LA 4DYCA 1EH6A 4LG0B 3ROUA 2VJ5A 4YELA 1IN5A 1DPRA 5TJJA 1XB4A 2L0KA 2JWTA 4AIJA 4GYIA 5A2QK 4F52A 5F1RA 3OYLA 4M9SA 3QAHA 2VT2A 3DKYA 3ZXSA 4L5JA 4M3FA 2JTVA 1K79A 4RAGA 2QSFX 3I4NJ 4B09A 3K1MA 1PP7U 1QU3A 3ZMZA 4G9YA 3JRIA 5CYVA 2DI3A 2F4IA 2OUMA 4M3GA 2XF5A 3DLLF 4EJTA 3MCZA 3BY6A 4HSRA 3DFGA 2DDAA 3CCLI 2KRFA 3PUFA 2V6EA 1IXSB 1X1PA 1RIOH 3WE2A 1R7JA 3OSGA 3DF8A 4BGDA 1KQ0A 1XTAA 3V8JA 2E1NA 3KLOA 2W84A 2J5OA 1EF4A 2ESNA 2IAIA 5B5EC 1SAXA 4L18B 4CA0A 1Z9CA 5ILUA 3M8JA 1OKRA 3BP8A 3MFKA 3ELKA 1V4RA 2XAUA 1MJBA 2KQRA 3EUKL 4G6DA 3LA7A 2XF7A 2CSOA 1XGSA 2Z1DA 3RPUA 3C1DA 5L3DA 3BDDA 1TNSA 2PN6A 4PSWA 4M73A 1ZARA 2HZTA 2VB6A 2MABA 2DFHA 3DQVC 3A01A 4JQFA 1X19A 2OZUA 3BQYA 3FXRA 3DV8A 4LB6B 3E5QA 1BOBA 2Q2EA 3VEPA 1K4TA 5CVIA 4Q48A 1WFXA 3FM3A 1HKTA 2CJJA 2HZDA 4WX9A 2EFWA 5D5XB 1TT0A 3A02A 3K4BA 3OOPA 1RUNA 2LH9A 2RV8A 4U7DA 3MWMA 2L7MP 4EJUA 1R6RA 2EINH 3ONQA 2WC2A 1FOYA 2HTJA 3LFKA 4XOPA 1TWAJ 2VOOA 2R4GA 4DOZA 3FXUA 5IOZA 1IF1A 4RB0A 3ERED 3SFZA 1D8KA 2H09A 3R0JA 4XSZF 3HSFA 2W4SA 1WJ5A 4I0BA 4PFPA 2EFPA 5F0CA 1KU3A 2HS5A 1RUOA 2BGCA 4KN7X 1Y1WJ 3R6SA 3FMQA 2LRDA 3GMEA 4HAMA 4N9HA 3KEQA 2JSPA 3PNYA 4XQFA 5FRMA 2D45A 2O6GE 3J7YJ 1FYLA 1FY7A 5B1BH 5BQTA 2HGCA 1U8RA 1FBQA 5JLXA 2YSRA 3HBLA 1YRNB 1B9MA 2PMZN 4XRSA 4XL9A 2CV1A 1PUFA 1MJ9A 2K9QA 5FGMA 4YIRX 4BE1A 2Y9YA 1VQPI 3AL0C 2NVUB 1YX3A 2HEOA 3BJ6A 3QRFF 3KE2A 3QPHA 3PM1A 2OCCH 2R7FA 3P9IA 4XKCA 1JT0A 2RNJA 1SEUA 3JAMK 3B6AA 3NRVA 4M74A 1Z0XA 1R5HA 2LP0A 1JKQC 1W5CC 3RJPA 1XGMA 5HNHA 3BR1A 3IL2A 1K78B 1T08B 2P81A 2WBMA 4I02A 3S1NJ 1T8IA 4O3MA 4BJTA 3PO3J 1J09A 3HRMA 2V9KA 2KJBA 3R0AA 3F6VA 2XHKA 1G2HA 2OU2A 5D5WB 5LEJA 2QQ8A 3GCMA 5FKMA 1LB2A 3AFHA 4ZYDA 2BVMA 1JJ8C 4C3HJ 1AU7A 3ZQLA 1YS7A 2IS6A 4O5VA 2W24A 4IJAA 4HX8A 3F72A 3CUQC 3DBRB 1J5YA 3IAM2 1UCRA 2K3FA 4CCNA 3X2QH 1DU6A 1RKTA 2P6SA 1UG0A 3LSTA 3H5AA 1HQCA 3ECHA 4HOBA 1BIBA 1X3UA 4OAZA 3OYAA 3N05A 4L0ZB 1H9GA 3U1KA 1BN5A 2P5LC 1YJ9I 3HRUA 1NH3A 2QQBA 1U78A 3OL3A 2UWMA 2DU9A 4II3A 1HF0A 2KPMA 3SHFA 4L9NA 3S2WA 3R4KA 2M8GX 3ABTA 3S8PA 1MBKA 4KT6A 4ENJA 2CG4A 4FX4A 3K69A 5F6FA 3J81K 2ISZA 5JR3A 4B4CA 3M3YJ 2QLZA 3QU3A 2WA0A 3JRCA 4RGUA 4A3BJ 3BQZA 5H20A 4BYYA 1G59A 3W2AA 5LHIA 2VLAA 4HLYA 3HXLA
chains in the Genus database with same CATH topology
2QSHX 1QZEA 2F4MB 1PVEA 3ESWB 2F4OB 1TP4A 1OQYA 1X3ZB 4YIRX 1X3WB 2QSFX 2QSGX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSH X;  1QZE A;  2F4M B;  1PVE A;  3ESW B;  2F4O B;  1TP4 A;  1OQY A;  1X3Z B;  4YIR X;  1X3W B;  2QSF X;  2QSG X; 
#chains in the Genus database with same CATH topology
 2VQL A;  2VXZ A;  4YEJ A;  3RKW A;  1ZQ3 P;  3P9C A;  3BPX A;  3S14 J;  1ETO A;  4Y15 A;  4EQQ A;  1F43 A;  3E5U A;  5HDG A;  5HS8 A;  1Y1V J;  2FRH A;  1QVU A;  3GBG A;  3HUG A;  3O6B B;  1GT0 C;  4CCK A;  1W5T A;  5EG0 A;  5F64 A;  5KCM A;  1Z3Y A;  4WXH A;  4UUV A;  2IS1 A;  4HX7 A;  3IKT A;  2W25 A;  2QCO A;  1FT9 A;  3GF2 A;  3OSF A;  3SDB A;  4HEA 2;  2ZXJ A;  3HOU J;  2W57 A;  1QZE A;  4FCY A;  3TO9 A;  3FK7 A;  2HQA A;  2H1L A;  2LYC A;  5CPR B;  4ZDO A;  2I8D A;  3A0B C;  4WXD A;  4E7Z A;  1I6X A;  1BC8 C;  2ZKZ A;  2DA3 A;  3W6K B;  3KP2 A;  2W48 A;  3IV5 A;  2LTP A;  5E1Z B;  3GTJ J;  1XCV A;  4LK0 F;  4G6Q A;  2YX7 A;  1T6S A;  4X1E A;  4RAZ A;  2PJR A;  4XN3 A;  5DV5 A;  2XPV A;  2KKO A;  3JW4 A;  2EZL A;  3KYL A;  2BEO A;  3TW7 A;  5LD2 C;  5LHH A;  4J00 A;  2C6Y A;  4MQ9 F;  4ESJ A;  4HST A;  1HOM A;  3CCJ I;  3ZQH A;  1NK3 P;  2XUB A;  2R5Z B;  1IV6 A;  4ZYG A;  2QEX I;  3HEF A;  1VQK I;  3TDU C;  4F3Q A;  1O4X A;  5HOD A;  3C18 A;  5HLG A;  5AIP A;  2G0E A;  1Z91 A;  2XPU A;  1FBU A;  1V3F A;  1LNW A;  1ZGJ A;  5A2Q Z;  3PO2 J;  3TDZ C;  3I3L A;  1U9N A;  2BXY A;  2LY1 A;  2XKO A;  1MW7 A;  3K2Z A;  4MGR A;  1VFC A;  3TED A;  4NDL A;  1X58 A;  5K7H A;  5E1X A;  4EEF G;  1FIP A;  5ICC A;  1SAU A;  2DXI A;  4KMF A;  1MH4 A;  3DTI A;  2VOD A;  4F92 B;  2BHZ A;  4XRF A;  3RIR A;  1TQI A;  4IXA A;  2L7K A;  1NK2 P;  1YX5 A;  3ZN0 A;  4K2E A;  4NNJ A;  1BM9 A;  1TQP A;  1DGR M;  1WJD A;  2KIU A;  1LFB A;  4A3C J;  1W0T A;  3S1Q J;  2Z5U A;  1U2W A;  3OIO A;  5K5O A;  2DTZ A;  2PMZ A;  3KP6 A;  4XK4 A;  4EMS A;  4CH7 A;  3HJE A;  4OWR B;  1YIJ I;  2UXN A;  1HW5 A;  2MC4 A;  4BKX A;  4UV9 A;  3FHZ A;  1DGW Y;  1VQO I;  3JRB A;  1MDM B;  3KZI C;  5EGO B;  1D8J A;  2NVT J;  2GAU A;  3OR1 C;  1Z7L A;  1ZG3 A;  2JUG A;  3F21 A;  1ERD A;  4XSX F;  3CES A;  2NOJ B;  1ZAO A;  2HR3 A;  5E20 A;  1WJE A;  1IXC A;  3WGI A;  2ZO4 A;  3BC8 A;  2R5Y B;  1PJR A;  2JVG A;  2P5V A;  5FKL A;  5K7Z A;  4XKW A;  1ETW A;  2K4B A;  3ECO A;  3ZQQ A;  2A6H F;  1DP3 A;  2F5E A;  3GTP J;  4E6K G;  2KDZ A;  3CO6 C;  3HPH A;  2DN0 A;  3E6C C;  4GCV A;  1AWC A;  4B48 A;  4N9I A;  5L3C A;  3OYH A;  2QKL B;  5J1U A;  3FMS A;  3TL4 X;  3RPQ A;  1FYK A;  1P7J A;  4JX4 A;  3QQA A;  3SFI A;  3PQJ A;  4MTD A;  2JSC A;  4L9J A;  4IRH A;  4XIC A;  4WK8 F;  1S6L A;  3LSR A;  4XRM A;  3IP4 B;  1D3Y A;  1V55 H;  2KMU A;  2XGD A;  1ZEL A;  4CGZ A;  4ZTJ A;  2LSO A;  1MKM A;  1TW3 A;  1Y8R B;  2DK8 A;  1FPQ A;  1LFP A;  3JRF A;  3MD2 A;  2WAF A;  3S3M A;  4MFD A;  2ECC A;  3CTA A;  1I39 A;  4QTR A;  1H89 C;  4HF1 A;  1LKX A;  1QVT A;  3BJO A;  2YPR A;  1J2X A;  3CUQ A;  3I0T A;  2BXZ A;  2WAE A;  2K9L A;  2M7B A;  3ASN H;  4I7H A;  1WKM A;  2L3D A;  1FYM A;  1XG1 A;  3ZN1 A;  2R7R A;  1O3S A;  3OYF A;  4DW6 A;  2ZC2 A;  3LMM A;  1E3O C;  3I59 A;  4F7Z A;  2V26 A;  1MMG A;  3A01 B;  3E1S A;  3NQO A;  4XLA A;  4BJ5 C;  5J8F A;  4RAY A;  4IRI A;  2Z3Y A;  2CQK A;  2Q2E B;  4CHU A;  3JAM Z;  4I09 A;  3VSK A;  3ZGK A;  5BOX A;  1E0E A;  3VB2 A;  3NEU A;  1XMK A;  4U0W A;  5EYR A;  3FF5 A;  1XC5 A;  3M9A A;  4OAY A;  5JVG F;  1U5T C;  4A3E J;  3FXK A;  5JHF A;  5LRS A;  4JBA A;  4AU7 A;  5CQE A;  4LGW A;  2MD5 A;  2FNP A;  2F6C A;  2E35 A;  3GFL A;  2NVX J;  2LFB A;  2RRE A;  2OV7 A;  4EGY A;  2R7U A;  2HFH A;  3DBH B;  1MGT A;  5KAI C;  3WG7 H;  4EM1 A;  4R79 A;  2DA5 A;  4BDZ A;  1X3Z B;  3DKX A;  1DQU A;  1MSF C;  2F48 A;  1YS6 A;  2YR2 A;  3CUO A;  3KP7 A;  5ILV A;  1SD5 A;  3DPT A;  3LAJ A;  3TO6 A;  4HLX A;  3ZQF A;  5D6F A;  1Z6T A;  2VIX A;  4CZC A;  4ENM A;  1EH7 A;  4C2M J;  2Y69 H;  1RNL A;  2DA1 A;  3KYC B;  3I5U A;  5DS9 A;  3BTC A;  5B66 C;  4DJA A;  3SEQ A;  3C3W A;  1P92 A;  4E7S A;  1Z7U A;  5TRD A;  3WE3 A;  2Y0M A;  1MMS A;  2FU4 A;  1OLT A;  2D5V A;  2QBY A;  2IBD A;  4GYG A;  4FIS A;  2DDB A;  4ESB A;  2STW A;  2GBY A;  3Q9S A;  1Q1V A;  2LDU A;  4MTE A;  9ANT A;  1D1C A;  2DBB A;  2E1M C;  2Y2Z A;  4RB3 C;  4AC0 A;  1ZTR A;  3A03 A;  3COA C;  1UJ8 A;  3CC4 I;  4IQJ A;  4N0B A;  2DYS H;  4DYQ A;  4UVC A;  4KJZ A;  5GAH J;  4YFK F;  3J81 Z;  3O3K A;  3LSI A;  5F08 A;  1X1D A;  1F9N A;  1GDT A;  2F4M B;  2FJ1 A;  4FTH A;  2VXD A;  1R4M B;  5CLS A;  3GTG J;  4P55 A;  3A1Y A;  3K70 C;  3CCM I;  2ZB9 A;  1BW5 A;  3O8G A;  5B1A H;  1HKQ A;  1W36 D;  2VN2 A;  4A3L J;  1O57 A;  4AM3 A;  4L9T A;  2GIZ A;  4ENK A;  1ZRC A;  4XN0 A;  3RQ4 A;  4A6D A;  1WJF A;  1SVO A;  2O03 A;  4RLQ A;  2H6C A;  2JRT A;  3WOD F;  2VPR A;  5D6E A;  3DPU A;  2I5U A;  2EJR A;  3FIW A;  3KZZ A;  2NOG A;  4BU2 A;  2LNB A;  2BY1 A;  1E17 A;  2LOO A;  2ZFW A;  1F5T A;  1ETY A;  1R71 A;  2KIS A;  1R9T J;  1XSD A;  3D5L A;  2YUS A;  1NHA A;  3QOP A;  4A3M J;  2JVH A;  1WCM J;  5FD5 A;  2QQ9 A;  2HQR A;  2J5P A;  3EET A;  5IPA A;  4BDY A;  1QPM A;  2ZME C;  1QA6 A;  3OYM A;  2FXA A;  3L2C A;  1OPC A;  4KIF A;  2CS3 A;  2VQG A;  4BQN A;  4RB1 A;  2PBI A;  2Y31 A;  2ZXI A;  3NAR A;  5C44 J;  3DU5 A;  3CMY A;  2MW8 A;  4IEJ A;  2XGX A;  2LBF A;  2VC1 A;  2LKP A;  1TWG J;  2FMY A;  1H9T A;  2BW3 B;  5HLI A;  1IO2 A;  2FE3 A;  2QA4 I;  2HVQ A;  2CGP A;  2RDP A;  1TC3 C;  3TKY A;  3BG7 A;  5K5Q A;  2DT5 A;  1MMD A;  4S04 A;  2V1U A;  2DOD A;  3FBI B;  4YFX F;  1B8I A;  3C7J A;  2XC7 A;  3E0J B;  3KP3 A;  4PCQ A;  2EH3 A;  2RQP A;  3PFI A;  4IQ4 A;  2OBP A;  1MBF A;  2WB1 A;  2IP2 A;  4I0A A;  3MKL A;  2QQA A;  3QYF A;  2L02 A;  3HC7 A;  1ZG5 A;  3Q9V A;  3FDY A;  2PEX A;  2XB0 X;  5GTH C;  4QSH A;  3ABK H;  1IXR C;  2HWV A;  2NAZ A;  2VJJ A;  2IA0 A;  3QPT A;  4AWX B;  4CYD A;  2H94 A;  1Y0N A;  1KU2 A;  3O2P E;  3G71 I;  3CCE I;  2EPF A;  4GRI A;  4IF4 A;  1DUX C;  3OYC A;  4M9Z A;  3E3V A;  4A3J J;  5CVJ A;  4KIB A;  3HRS A;  4PFO A;  1XSX A;  4Q5S F;  1S29 A;  2LKS A;  3BCB A;  2GZW A;  3TOB A;  1BC7 C;  1ZR4 A;  1IRX A;  1WZ2 A;  4RMN A;  4CCJ A;  3HRT A;  2A07 F;  1E3P A;  4OIN F;  1LDK B;  2Q8K A;  2E1O A;  2WAD A;  5HOO A;  1LDD A;  3JRH A;  2IS2 A;  5KK1 A;  3L00 A;  2R7O A;  3ZMS A;  1IG7 A;  1OCZ H;  1A04 A;  4PJM A;  1BI1 A;  1GV2 A;  4GFB A;  5E1W A;  1W7P D;  4Y33 A;  3DTK A;  3S2D J;  1G8X A;  4NB5 A;  1LEA A;  1YG2 A;  3CMM A;  2X6W A;  4BL0 B;  3OYI A;  4LIT A;  5E3L A;  1UEL B;  2LRE A;  2WAQ N;  2OPT A;  3C2G A;  2OQR A;  4M3D A;  2AXT C;  2EIL H;  1FBS A;  2RN7 A;  2BV6 A;  3IUO A;  4UB6 C;  4ABZ A;  3HGY A;  4NQW A;  4S05 A;  3F6O A;  4U87 A;  1K61 A;  1FC3 A;  3WGG A;  3DPL C;  2LF7 A;  5DUK A;  1ZG1 A;  5JFR A;  4BS9 A;  4C2U A;  2E19 A;  3RTR A;  3L2V A;  2BZT A;  4A3D J;  4ZJZ A;  3W3C A;  2R7Q A;  1LFU P;  4DNC A;  5HNF A;  1W7P B;  5HLT A;  1U5T A;  2JA7 J;  4DYR A;  4KIT B;  4G8X A;  2M2E A;  1ZGA A;  4BY7 J;  1P2F A;  1WH5 A;  1IV8 A;  2YX4 A;  4KIC A;  2HYG D;  4LIV A;  2HDC A;  3RDI A;  1YW8 A;  4B8X A;  5HVQ C;  1I3A A;  2HDW A;  2DMU A;  2OAZ A;  4HYE A;  4LIU A;  5GP9 A;  5E3N A;  2B9S A;  1VQ7 I;  5C4J J;  3A2K A;  2R7S A;  1ORK A;  2FEZ A;  3I53 A;  3K4N A;  1YIO A;  1ZKG A;  3MKY B;  4D5C A;  3AG2 H;  2CQQ A;  2JPB A;  1BW6 A;  3CF2 A;  5IYD J;  4LK1 F;  5FLX K;  3IH3 A;  4XLH A;  4XRS G;  2UZK A;  2F4O B;  3HM5 A;  2L9N A;  3V7R A;  1S9H A;  4UB8 C;  4RS8 A;  4A0Y A;  2DFI A;  1FSH A;  1AKH B;  3TQN A;  3AL0 B;  3HSE A;  1OR7 C;  2IA1 A;  2K02 A;  2A69 F;  4N4O B;  2CQ7 A;  4H0E A;  1S7O A;  3I54 A;  4DGW B;  2XSD C;  4QWQ A;  2HVR A;  2HYF A;  2XGC A;  1MND A;  2JPC A;  4RM3 A;  4RB2 C;  5EEH A;  2UUZ A;  4D9J A;  1KZH A;  4M6V A;  3OIQ A;  2CW8 A;  3MN2 A;  1FJL A;  1B72 A;  2WY8 Q;  4W1U A;  3UR3 C;  5BPI A;  1SFO J;  2CV2 A;  3K4M A;  1TLH B;  2IPQ X;  3NWT A;  4XR6 A;  4D5F A;  3DTE A;  1TWC J;  3EDP A;  4IHX A;  3ERM A;  3MKW B;  4DIQ A;  2H8R A;  2VKE A;  2D1V A;  2LKX A;  3GFI A;  1HLV A;  2EIK H;  2E34 A;  5HDN A;  3OYG A;  4AYB N;  1WQ2 A;  2DLL A;  5IT9 K;  4UVB A;  4WF2 A;  3CUQ B;  1IDZ A;  2W7N A;  2MLG A;  1B1B A;  4LD5 A;  1IJW C;  4Q4Z F;  2ZSH B;  3Q5F A;  1X1B A;  2NYX A;  4H4K C;  5IP9 J;  1HA8 A;  4LOC A;  2AQF A;  2LVS A;  1XMA A;  2ZCW A;  1FTT A;  1H8A C;  4ZC3 A;  4MQV A;  3CDI A;  4LLL A;  3K6G A;  3OOU A;  3LQQ A;  1G3T A;  2NNY A;  2M45 A;  3OYE A;  2ZME A;  1W1W E;  1ZK8 A;  3CCU I;  1LE8 A;  2H1K A;  1T0F C;  2HOA A;  3D5R C;  5HS9 A;  1N77 A;  2CQX A;  2RKH A;  2HXI A;  1R23 A;  5EZG A;  4O6J A;  2XDV A;  3RZO J;  3SYT A;  1MJA A;  1YYV A;  3PUB A;  5F27 A;  1POG A;  3L09 A;  4LG3 A;  2LLK A;  1VQ6 I;  2IGN A;  4CYC A;  3BRO A;  4I6Z A;  4A0Z A;  4F91 B;  3QOD A;  1O3Q A;  2CV0 A;  5GAE J;  5J4V A;  1U0J A;  4B3X A;  3CMA I;  1D0Z A;  3DEW A;  3RCO A;  1IN7 A;  2P5K A;  2XB5 A;  4MNU A;  4NC8 A;  3E6D A;  4B47 A;  4Y7N J;  3ZRG A;  1HBX G;  1MZB A;  3OL4 A;  3E97 A;  4RGR A;  3GTK J;  5L3B A;  5F0F A;  3F3X A;  2ZJR F;  4M6X A;  1A6I A;  1D1A A;  4GGG A;  2E7X A;  3G73 A;  3HHG A;  1XPX A;  4M71 A;  4CSW A;  2ADU A;  1VND A;  4QPQ A;  1FX7 A;  1FNN A;  2FA5 A;  5AIQ A;  1TNT A;  2QBY B;  4ZYA A;  4YG2 F;  3LSJ A;  4IL6 C;  1I1S A;  3G1L A;  2HYJ A;  1QRY A;  3GTO J;  2O8X A;  4XLC A;  2DYR H;  2E7W A;  2HKX A;  3MZ8 A;  1R1U A;  5ERI A;  4YII A;  3VOD A;  2FBH A;  2DK5 A;  2M1B A;  3ZMT A;  3WTX C;  2A6E F;  4XM3 A;  4FX0 A;  4M3B A;  4HZF A;  4EV0 A;  3OMY A;  2Y9Z A;  2EA4 A;  4ZZL A;  2JQ7 A;  1YI2 I;  2BBY A;  4IHY A;  3BZK A;  2WAQ A;  3J7A Y;  3ZQC A;  3HOS A;  3H3Z A;  3VYT B;  1QHH D;  2HU9 A;  3ASO H;  3FM5 A;  1R58 A;  2A6T A;  3K2A A;  5LBQ A;  3K4L A;  5M5X J;  4PK4 A;  3K4J A;  4LB5 A;  1MBH A;  1UG2 A;  3BLY A;  2KFD A;  2KP6 A;  2L7Z A;  4HNU A;  1I3Q J;  3ZMV A;  2BY0 A;  1B59 A;  3DU6 A;  5FFZ A;  4HG2 A;  1DU0 A;  3PIO F;  4NC7 A;  4R1H A;  3REO A;  4PJN A;  5DEQ A;  1ON1 A;  3VYR B;  1SAN A;  2P8T A;  2DFE A;  1Z3X A;  1XCB A;  2XRO A;  2ESH A;  3ZMU A;  2NNN A;  2ID6 A;  5TIS C;  5D5U B;  2WWY A;  4MEX F;  1HCR A;  2LMD A;  1SD4 A;  4V2F A;  2L5Q A;  4EAT A;  1JT6 A;  4E7L A;  1T56 A;  1RRJ A;  3LA2 A;  1ODD A;  2OC6 A;  3AG3 H;  3GO5 A;  4AVZ A;  3PFY A;  3GTM J;  3I71 A;  3EYI A;  5DD8 A;  2KIQ A;  3LSG A;  3QYB A;  1OMI A;  3QP6 A;  2M8E A;  3WHB A;  2R7V A;  3BR6 A;  5C4X J;  3IC7 A;  3KIO A;  5LLQ A;  5DCM B;  3AG1 H;  3BR2 A;  1JKR C;  4Q47 A;  2CFO A;  1X1C A;  4V2G A;  1K4S A;  3T8T A;  4II2 A;  1YTY A;  1MH3 A;  2A5W A;  1YE9 A;  1CF7 B;  1FMW A;  1VQN I;  2L7F P;  3GVA A;  3H1C A;  5JVT A;  2E36 A;  5LRR A;  1BIA A;  2V9P A;  2M9H A;  2O3F A;  3TMO A;  1UB9 A;  5J40 A;  4LG0 A;  3VOE A;  4ZZD A;  4QLC U;  1CQT A;  3G3Z A;  2TDX A;  1FEX A;  5IYB J;  1UMQ A;  2LF8 A;  1QQI A;  1WI9 A;  1OR7 A;  1ON2 A;  2QM3 A;  3F8F A;  1IC8 A;  3S15 J;  1ZLJ A;  3DWL E;  1VQ8 I;  2VI6 A;  3OYK A;  5FD6 A;  3FXO A;  3GUD A;  4ZYE A;  3H9G A;  4AYB A;  5ED4 A;  3OIP A;  3J7A O;  4A5M A;  2AHQ A;  2O8K A;  2BYV E;  3PNV A;  1RZ4 A;  3GFM A;  3QPS A;  3NWS A;  2ICW G;  4HV6 A;  1NG6 A;  3LL7 A;  4ENN A;  2D2W A;  2DOA A;  3Q3S A;  5FRN A;  2KLO A;  2OTJ I;  4U88 A;  1UST A;  2X6Y A;  2EFQ A;  5M5Y J;  2HOT A;  3UNG C;  2L4A A;  3LSK A;  2NS7 A;  5BMZ A;  2VON A;  3S16 J;  3BZ6 A;  2PX9 A;  2NRA C;  3RKY A;  4G7O F;  1OCP A;  4KIG A;  4BUP A;  1R4N B;  1TTY A;  3QPL A;  1D5V A;  5FLX Z;  4R8H A;  1H88 C;  2DOE A;  3MEX A;  1G3W A;  1X3W B;  1WI3 A;  3DXJ F;  3SZT A;  1ETQ A;  2EV5 A;  2ETH A;  2G7U A;  2WB1 N;  2VE8 A;  3K0L A;  1KQ8 A;  2HKO A;  3PIP F;  3S17 J;  2MFZ A;  1LQ1 A;  2K3P A;  2AXL A;  3RPU D;  1L3L A;  3VYU B;  4NQW B;  2EIJ H;  1FOW A;  1PDN C;  2FNA A;  2HVS A;  2W1O A;  2QYO A;  2X51 A;  3DLA A;  4G6T B;  1SC7 A;  3HOZ J;  2GLO A;  1FSE A;  1UHS A;  1ZR2 A;  1PVE A;  1YHQ I;  1JE8 A;  1T0F A;  3LNQ A;  3G4S I;  4CCM A;  2V1N A;  4NC6 A;  4ON0 A;  1A5J A;  1LVA A;  3G6E I;  3KZY A;  5EJC A;  5ICG A;  1G6N A;  1Y0U A;  1YQA A;  3P9K A;  4XOR A;  1U5T B;  1EKE A;  3PL8 A;  2CUF A;  3WTU C;  1Z67 A;  3JCU C;  4HNT A;  1XMX A;  2LG4 A;  1O7L A;  2COB A;  3SEZ A;  4AD9 A;  1Z77 A;  1KON A;  1IUY A;  1TWH J;  3RSN A;  3FXL A;  3KX2 A;  3R60 A;  3IRQ A;  1O3T A;  2PLY A;  4ASN A;  1FZP B;  1QO0 D;  1Z6R A;  5IT9 Z;  2DMP A;  5K1Y A;  5L3F A;  3OYB A;  3K70 D;  5IOY A;  1YW7 A;  3QP5 A;  4LLG F;  2ZFU A;  5DM7 F;  2ZXW H;  1APL C;  1TP4 A;  4G94 A;  2KIF A;  2WV1 A;  1FP1 D;  4A3K J;  4PJL A;  4Z6Y A;  4E7J A;  1YRN A;  1QNT A;  1WVR A;  3LSH A;  1G3Y A;  3PQK A;  4HW0 A;  2M34 A;  4Y52 J;  2L2O A;  2ACJ A;  2V9V A;  4HPQ A;  1GVD A;  1QPI A;  3TP0 A;  1USS A;  5D4S A;  1MNM C;  4UY8 I;  2X48 A;  2E1M B;  1MNE A;  1FMV A;  1WH7 A;  1P4A A;  3OYJ A;  5J6X A;  2E2I J;  4OIR F;  1B9N A;  4MIM A;  2PJP A;  4OU0 A;  3P5J A;  1T98 A;  5D4R A;  1K78 A;  4OIQ F;  3VSL A;  1U8B A;  5B3S H;  3J80 K;  5FLV A;  3HTU A;  2V1X A;  3FHN A;  5M3F J;  3Q0V A;  1SFK A;  1L0O C;  4JYK A;  3S93 A;  2Z16 A;  1N75 A;  1FOK A;  1J7K A;  2A5Y B;  3K4C A;  2XGE A;  4C2T A;  2XAQ A;  2PMH A;  5J4Y A;  2F2E A;  3JTH A;  4C3I J;  3OS2 A;  1JTY A;  4F55 A;  4QIW N;  1PUF B;  1SD6 A;  2DA6 A;  4EM0 B;  3BT9 A;  4DQ2 A;  1XDU A;  4A6E A;  3ZOB A;  1I50 J;  1C0W A;  1N25 A;  4A12 A;  3RKX A;  1JXS A;  2K27 A;  3SZG A;  3HOY J;  3M4O J;  5EF6 A;  2H27 A;  2MG4 A;  2V4J C;  1XGO A;  2G7H A;  3LA3 A;  2VKD A;  1ZHF A;  1RES A;  1LE8 B;  2ME0 A;  5DTD A;  4I76 A;  4B1R A;  2Z9O A;  1RET A;  2W85 A;  3HGG A;  2KHM A;  5J1R A;  2K9N A;  1IDY A;  5HLH A;  3I64 A;  4A3G J;  3BTI A;  2M7A A;  4M9X A;  5L3E A;  1K7A A;  1IAW A;  1Y56 A;  4MFE A;  2DFF A;  3CO7 C;  1DPU A;  1S8N A;  3B02 A;  2YS9 A;  3S3O A;  2X85 A;  5GAG J;  1W4M A;  1PP8 F;  1DP7 P;  1EJ9 A;  2X1D A;  1A36 A;  4YRV A;  5FB2 A;  1ULY A;  1BJZ A;  4FHT A;  4UUT A;  4BHB A;  5BPD A;  2F5V A;  3QWL A;  3C2B A;  4HQE A;  1JGS A;  2DMT A;  4YIF A;  2HQ5 A;  3F8N A;  1T2K A;  2IA2 A;  3HL2 A;  4A69 C;  1VI0 A;  2IS4 A;  1OCR H;  2ZNZ A;  1E3H A;  3SXY A;  4IVN A;  2CH0 A;  3SZP A;  4M72 A;  3V8K A;  4IPA A;  2JUC A;  1YW9 A;  4FE7 A;  3D5S C;  1ZGW A;  3VWB A;  2KRH A;  2L01 A;  2XVC A;  1Z1D A;  1Y8Q B;  3BG9 A;  4A93 J;  2EZK A;  3ZMD A;  2W82 A;  2IJL A;  4IHS A;  3HB9 A;  2DJI A;  5JHU A;  5J3L A;  1R5G A;  2DA4 A;  2WV0 A;  3BG6 A;  4CZZ A;  1MMA A;  3C2H A;  2JA8 J;  1GHC A;  4AIK A;  2GQQ A;  1N78 A;  2RNG A;  5E3O A;  4ZDL A;  1TBX A;  1V54 H;  2MBF A;  4KIS A;  1HDD C;  1R1T A;  3HZJ A;  2EZI A;  4CCO A;  3DP7 A;  3OS1 A;  1QZZ A;  3EYY A;  1EA3 A;  4B3A A;  1I1G A;  1GVJ A;  4E70 A;  1MBJ A;  4XKB A;  3ML6 A;  1J0R A;  3HUG B;  2IRF G;  1V5F A;  2VBY A;  1RPW A;  1WGX A;  4XLE A;  3K4K A;  2QSG X;  1T38 A;  5EG0 B;  4Y3O A;  2VQC A;  3H35 A;  3CME I;  2BE5 F;  4A5N A;  1WJC A;  2Y30 A;  2ZBK A;  3PSI A;  2P7V B;  4RM2 A;  1D0X A;  2CUZ A;  2MYS A;  2NS8 A;  2PI0 A;  5K5R A;  3CCS I;  5ICF A;  3ESW B;  1LJ9 A;  1OQY A;  4KN4 X;  2EB7 A;  4HF2 A;  1T95 A;  4FAS D;  2HQN A;  1LDJ A;  2YU9 J;  4JX5 A;  3V42 A;  4L0Y B;  3IWZ A;  1WHU A;  4BE2 A;  2Y75 A;  3GLX A;  4P96 A;  1X4O A;  3QU6 A;  2PJR B;  2V6C A;  3B6C A;  4XOT A;  3JTG A;  3W6V A;  3GTQ J;  3JSO A;  3AAF A;  2GA1 A;  5FKN A;  5IP7 J;  4IOA F;  5IT3 A;  3GWZ A;  3VFZ A;  1U6G A;  4D7N A;  1P4X A;  2GWR A;  5KAF C;  4NHJ A;  1MMN A;  3KYD B;  3E6B A;  3Q0W A;  4AID A;  1OCC H;  1RI7 A;  2ECB A;  4EJO A;  5FKK A;  4E7H A;  2R7T A;  2NVY J;  2RQQ A;  3HTS B;  3MQ0 A;  1Q1H A;  1F1Z A;  4BH9 A;  3FIS A;  1GLN A;  4HA8 A;  2VJI A;  2I10 A;  3FXJ A;  2QGU A;  4E7I A;  3JRA A;  2EIM H;  3V7S A;  5E8I A;  1MDM A;  2W00 A;  1KGS A;  4P9F A;  5EGO A;  1V5E A;  2XKP A;  2VAS A;  3EQL F;  5IYC J;  2QSH X;  2A68 F;  5H6Q A;  3LSP A;  2BOL A;  2ZSI B;  4IZZ A;  3BOQ A;  5BS6 A;  5EEG A;  4I01 A;  1RR7 A;  3KEO A;  3OYD A;  1EH8 A;  1XX5 A;  3IWF A;  4JK1 X;  3HKZ N;  4OIO F;  3GX4 X;  3M07 A;  2R5Y A;  3DKW A;  5DM6 F;  2V1D A;  3GZN B;  3U2R A;  3NAU A;  4IHT A;  2LR8 A;  3ZCO A;  4G12 A;  5ILS A;  1Y39 A;  1J59 A;  1TW2 A;  1K6Y A;  3KEY A;  5EZH A;  1D5Y A;  1FOX A;  3KET A;  3QOE A;  3FX3 A;  1ZRE A;  1JUM A;  3L2R A;  2EFO A;  2FSW A;  2ZNY A;  1HST A;  2A3S A;  3LQR A;  1XSV A;  3F8M A;  4P1W A;  5FRO A;  3J7Z I;  1AOY A;  3IH4 A;  1KYW A;  2PG4 A;  2EZH A;  2DPD A;  4C30 A;  1G3S A;  3CLQ A;  5GPC A;  2FBI A;  1REP C;  1SFE A;  1P7I A;  2MD0 A;  3K1P A;  4KYW A;  5F0H A;  4M3E A;  4LJZ F;  5HS7 A;  1MSE C;  3GXO A;  3ABU A;  2QVO A;  1ZH5 A;  4BNC A;  3K9T A;  4PGG A;  1F4K A;  3VYS B;  5LFA A;  5D8L B;  5GAD J;  2DMN A;  2M0M A;  3ZQI A;  4CDG A;  3FWE A;  4B43 A;  1QHG A;  2MLK A;  2VBZ A;  2XAG A;  3F9K A;  2LY9 A;  2JA2 A;  3MAJ A;  4RA2 A;  3HPG A;  1VZ0 A;  3HDD A;  4Y17 A;  2MA3 A;  4PSX A;  1VQM I;  1K83 J;  2XIG A;  3EUH C;  5KNL A;  1JKP C;  3ZQG A;  3WU2 C;  3D0S A;  2L9S A;  1R36 A;  3OV8 A;  1ZRF A;  2TCT A;  2XRN A;  2HXO A;  2VUM J;  1WPK A;  3AKZ A;  2Y48 A;  4X6A J;  3M8E A;  3LAP A;  2F5F A;  1R49 A;  2BHY A;  2FD5 A;  2DQR A;  2XRL A;  3J80 Z;  3FXM A;  1SFU A;  1BOA A;  2DAO A;  4ETS A;  1IN8 A;  3WTW C;  3CZ6 A;  2L9V A;  3L2Q A;  1YO5 C;  2ID3 A;  4UHT A;  1RR8 C;  3F8B A;  3GFJ A;  2K9S A;  1ETX A;  1A31 A;  2IW5 A;  3M1E A;  4HNV A;  1ACI A;  2OD5 A;  4UXN A;  3G1O A;  4U7B A;  3CJR B;  5CVR A;  3M7G A;  2JT1 A;  5DYM A;  5IP6 A;  2QF7 A;  4C9Y A;  2Y0S N;  1V5G A;  3HIF A;  3HOX J;  1T39 A;  5M3M J;  1S7A A;  3S32 A;  2H8W A;  4N4N B;  3I59 B;  2JJ7 A;  2IXS A;  2TRT A;  2CUJ A;  2NS0 A;  1E2X A;  1RC9 A;  2Z99 A;  2K86 A;  5L3G A;  5E3M A;  3S3N A;  4EJW A;  2XF6 A;  1VTN C;  3OR2 C;  1BR2 A;  4HRI A;  2QUF A;  3L1P A;  4A3I J;  1Z05 A;  2ME6 A;  3D1N I;  1W5S A;  2VC0 A;  3A0H C;  1BI3 A;  1P4W A;  4J01 A;  3V8L A;  3GTL J;  3HHH A;  1Z21 A;  4DBQ A;  1YFH A;  3BR5 A;  5CKT A;  4ITV A;  2PMU A;  4KNY A;  2E71 A;  2KIM A;  2XAS A;  1VQL I;  3WGH A;  5GTI C;  3IHU A;  2EQR A;  1JJ6 C;  1IW7 F;  5E18 F;  5DDG A;  5CQG A;  3BZC A;  1Y6I A;  2VJ4 A;  3ABL H;  2YU3 A;  2CFX A;  5ICE A;  3PJR A;  1XDS A;  4U0Y A;  4OMY A;  3HSR A;  2EV0 A;  3P7N A;  5K7F A;  2AS5 F;  4HQM A;  1HDP A;  3JR9 A;  1MIJ A;  1ETV A;  3W2W A;  1UAA A;  2M4K A;  4XKV A;  5CJ9 A;  2ZJQ F;  3HG9 A;  3KPH A;  2RVC A;  4BBS J;  1UHM A;  2CU7 A;  3KLN A;  3A4C A;  1QZY A;  4E7K A;  2ELK A;  5AON A;  3TW6 A;  3WTS C;  3G2B A;  1VQ4 I;  1IRF A;  2WTE A;  4BHP A;  3BG5 A;  4J19 A;  4EGZ A;  1S72 I;  2JN6 A;  5J8C A;  4KMU X;  2E1C A;  3L2W A;  4L9V A;  4F93 B;  1S7E A;  2PFB A;  1W0U A;  2V7F A;  1WJB A;  1IRZ A;  4QPO A;  4XLF A;  3WTY C;  4BQA A;  3KP4 A;  1O7F A;  1SD7 A;  1PUE E;  1JKO C;  4IOC F;  2R7D A;  4ZH4 F;  4BEH A;  4UUS A;  5EEA A;  2A05 A;  4UV8 A;  1U3E M;  3CF5 F;  3W2V A;  1TQM A;  4FE4 A;  5LHG A;  4MLO A;  4HDV A;  5KHD A;  2E5Z A;  2FML A;  3CCY A;  3F23 A;  1MBE A;  2IT0 A;  1YIT I;  1XN7 A;  2IGM A;  2V79 A;  3V7C A;  4X0G A;  3I4P A;  1IZ1 A;  2BW3 A;  3CJN A;  2P4W A;  2XAH A;  5DCF A;  4EJV A;  4IHV A;  3GEZ A;  3F0C A;  4BXF A;  4NUB A;  3CJT B;  3SQN A;  3H5R A;  1A35 A;  2FOK A;  2X0L A;  3KP5 A;  4CUG A;  1JHF A;  3QYE A;  3H9Q A;  4HBL A;  3HKZ A;  4OMZ A;  1HXD A;  3LOC A;  3CLO A;  2HPM A;  1HKS A;  2CMP A;  2X9D A;  2UV1 A;  2X4H A;  5JLW A;  2M5W A;  4FET A;  3ZP5 A;  2HI3 A;  2ISY A;  2DPU A;  2IVM A;  4P9U A;  3H3V K;  1J9I A;  1LVK A;  4EM2 A;  2P6T A;  2D1H A;  3DCF A;  4Y13 A;  2Z33 A;  3S1M J;  3BWG A;  5H2F C;  2LBF B;  2OF7 A;  2X6X A;  4BJ6 C;  3O8H A;  1ZN2 A;  2RGV A;  4XID A;  3CCQ I;  4XLN F;  1BL0 A;  1EV7 A;  3PNT A;  3DBL B;  5GPA A;  3ZQ7 A;  3CD6 I;  2OA4 A;  1M1E B;  1UFM A;  4KFC A;  1B8I B;  3L9F A;  2FX0 A;  2ZJP F;  3CDL A;  3F22 A;  2BY2 A;  3L7W A;  1SMY F;  2CWE A;  3IH2 A;  5HDK A;  2CW7 A;  5FJ8 J;  5FFX A;  1HC8 A;  1YJN I;  1R22 A;  1I6H J;  2FF4 A;  4IRG A;  4RGX A;  2HOE A;  2XAJ A;  2E2J J;  3TP3 A;  2BY3 A;  1IN6 A;  3TBI A;  3T1B A;  2MGQ A;  1XGN A;  2LK2 A;  4GXO A;  4C3J J;  2MSY A;  4RAF A;  3SJM A;  4A2U A;  3L2U A;  1GXQ A;  3MZY A;  4S0H B;  1P9Q C;  3CC2 I;  2VQH A;  1VQ5 I;  1FTZ A;  4AUX A;  4PJJ A;  3EUH A;  2RAE A;  1P6R A;  2X6O A;  1OCO H;  2KJC A;  1GV5 A;  3GZ5 A;  4ANJ A;  3I55 I;  4RLF A;  2DA2 A;  5D8K B;  4HDU A;  2EFN A;  3BG3 A;  5CVV A;  2CRG A;  4PZJ A;  3ULQ B;  2GOX B;  1GUU A;  3ZPL A;  2M3A A;  2Y0S A;  1JGG A;  4UVA A;  1GXP A;  2OQG A;  1QBJ A;  2QZ8 A;  2R0Q C;  4OIP F;  1W7P A;  3WTT C;  3U9G A;  3IKV A;  1FWZ A;  1MD0 A;  4HF0 A;  4D1Q A;  4I2O A;  2E5N A;  2KRC A;  1OIS A;  2JZY A;  2FUG 2;  4EVI A;  5FLM J;  1YJW I;  2X1E A;  5F04 A;  3IRR A;  2VOP A;  2OTL I;  2R7W A;  1S3J A;  1UZC A;  2XSJ C;  3FMR A;  2OZ6 A;  2K85 A;  1AA7 A;  5KVR A;  2IGO A;  4XON A;  2EA2 A;  1CGP A;  3I9V 2;  3BR0 A;  2VBX A;  3W6J B;  1FP2 A;  2KDO A;  1OCT C;  3PSF A;  1RKW A;  3ISP A;  3RKQ A;  5E17 F;  2O0Y A;  5H6R A;  3T8R A;  1BR4 A;  2JRM A;  1F36 A;  6PAX A;  2FQ4 A;  1OYI A;  4P5O A;  1WWX A;  5M5W J;  3H5N A;  1YOV B;  1TWF J;  4LMY A;  4BBR J;  3HYI A;  5FO5 A;  2GIV A;  1SVL A;  2DQL A;  2B7E A;  4JP0 A;  4V19 K;  2GXA A;  1AKH A;  3FXQ A;  1IRG A;  4PDK A;  4JOM A;  1H0M A;  3WU0 A;  3RZD J;  4NBQ A;  4U0V A;  2EWN A;  5LEK A;  2DTR A;  5DD4 A;  4LFU A;  3GLL A;  3N4M A;  5EDN A;  4BXX J;  4OOI A;  2XAF A;  1SFX A;  4DZJ A;  3RYR A;  4D0P A;  3LFU A;  5D5V B;  1B6A A;  4A0X A;  4PUS A;  2P0W A;  1ONV A;  2VBW A;  4KUM A;  1HW2 A;  2GXB A;  2K7L A;  1VF9 A;  1MBG A;  2K40 A;  3H92 A;  3HOW J;  4IX7 A;  1S5L C;  3HOV J;  3U21 A;  2WY7 Q;  1HW1 A;  3JRD A;  3B73 A;  4PGH A;  1KU7 A;  2MH2 A;  3BPV A;  1JUP A;  2JMW A;  2F5C A;  4XBF A;  1G4D A;  4IHW A;  2H6B A;  4KA4 A;  4WXC A;  2OJE D;  1LEB A;  4LLN A;  2X1C A;  2EV6 A;  2DO7 A;  4TV7 A;  3FBN B;  5JI6 A;  2VKH A;  1T33 A;  2CO5 A;  1BJA A;  1WRJ A;  2DA7 A;  3WTZ A;  4XLP F;  4D7M A;  1R00 A;  4BXU A;  4KDP A;  1I27 A;  2O7O A;  5C3E J;  3OY9 A;  3GYH X;  1B72 B;  4L5E A;  1D1B A;  1R5I D;  1X2M A;  3CP8 A;  1D0Y A;  1BBY A;  1ZLK A;  3N97 A;  3BTJ A;  4JX6 A;  5TGT A;  1WJA A;  2DCE A;  3TOA A;  3T5X A;  3TO7 A;  3CCR I;  3SDG A;  2DOF A;  2CYY A;  3FK6 A;  1OFC X;  4PJ0 C;  3CJQ B;  1VQ9 I;  1JHH A;  3AG4 H;  2CUE A;  2FBK A;  4RDU A;  4RGS A;  5E79 C;  3UKG A;  3GZ6 A;  1ZRD A;  1ITY A;  5LGU A;  1BA5 A;  3FKI J;  4BE0 A;  2F5D A;  3KCC A;  4B44 A;  3WTV C;  2MC3 A;  1ENH A;  1TZL A;  2XPW A;  5BNG A;  2HTS A;  3WU1 B;  5LGN A;  2RC4 A;  3CP2 A;  5J47 A;  3LWF A;  2ELJ A;  1HSJ A;  2L4M A;  4G7Z F;  3EUA A;  4FT8 A;  4AVP A;  1KYZ A;  2KZG A;  3TGN A;  1ZYR F;  2PQ8 A;  1SMT A;  1ETK A;  3BJA A;  1IN4 A;  3IAS 2;  1XS9 A;  3R61 A;  2ZME B;  2XV4 S;  2STT A;  2LY2 A;  2DW4 A;  3VDX A;  3Q0U A;  4GDF A;  3E5X A;  4ZTF A;  1X2N A;  2BVL A;  2G9W A;  4W97 A;  4ZYH A;  1NG7 A;  2HPI A;  2DJN A;  2CW0 F;  2JA6 J;  4DBR A;  4MHG A;  4CIC A;  4XNF A;  1STZ A;  4E4H A;  2E2H J;  4FQG A;  1NTC A;  4KT5 C;  3HOT A;  4IO9 F;  4M6Y A;  4CYC B;  4YFN F;  5LGT A;  3JSP A;  1I5Z A;  1TL8 A;  2Q1Z B;  2IGK A;  3K10 A;  3ZR8 X;  4BAY A;  4DZP A;  4A3F J;  4I98 B;  2QKM B;  2ELH A;  1A6Q A;  1U9O A;  2IEK A;  4L5I A;  2VT3 A;  3CC7 I;  3F8C A;  1B4A A;  3RYP A;  3ABM H;  2R7Z J;  2CQN A;  2M0C A;  1IUF A;  3CCV I;  2N8G A;  4BQO A;  3M8F A;  3WHC A;  2QEN A;  1JUS A;  2KL4 A;  3JRE A;  2HDD A;  4WCG A;  4HX4 A;  3KFW X;  3K1N A;  2K4J A;  3H9J A;  2COM A;  2DMQ A;  2HOS A;  2MH9 A;  3JRG A;  4MO7 A;  5FKO A;  1LPQ A;  3I56 I;  3BR3 A;  2NVQ J;  1K6O A;  2FQ3 A;  4BEH B;  4UUS B;  2GM4 A;  1OYW A;  2LC2 A;  3I58 A;  2K9M A;  4BQQ A;  3K7A J;  3BTL A;  3MVP A;  3U1D A;  4BHC A;  2B63 J;  2VPL A;  1OYY A;  3BCA A;  1BI0 A;  3FKJ A;  1O3R A;  3H0D A;  2Z2S B;  5IY5 H;  3OS0 A;  1FLI A;  2R3S A;  4IKF A;  2DT7 B;  2K5C A;  2O61 A;  2HNH A;  1UHW A;  4WWC A;  2O5R A;  3WG9 A;  3RQI A;  2JK3 A;  2R5Z A;  3M1C A;  2L9R A;  3V4G A;  4ESF A;  3H36 A;  5DCM A;  3GW2 A;  1X4P A;  5DUI A;  3VPR A;  5F1J A;  4RBO A;  2KT0 A;  3MMY B;  3CDH A;  4BAC A;  1JTX A;  1CF7 A;  1J75 A;  5CVU A;  2B0L A;  1BR1 A;  4XMY A;  1TT5 B;  2A61 A;  1WSU A;  4GO1 A;  2VL8 A;  2VE9 A;  4BY1 J;  2AO9 A;  2E60 A;  2GXG A;  3RI4 A;  2P7C B;  3H3U A;  3T0Y A;  3MZH A;  4CO8 A;  4MEY F;  2OCE A;  4UNO A;  2Q0O A;  3H0G J;  2M87 A;  1W36 C;  4I99 C;  2JA5 J;  2VKV A;  2ZXH A;  4Z2Y A;  2M30 A;  3EPZ A;  1IGN A;  1XD7 A;  2LD5 A;  2R93 J;  5E8G A;  3DEE A;  3CQZ J;  4CCL A;  3S1R J;  1KA8 A;  2EK5 A;  3LSM A;  2ZJ2 A;  2FOW A;  1AHD P;  2GOM A;  2O9L A;  1SVM A;  2M4G A;  1DDN A;  3OWT A;  1R1V A;  5J1Y A;  1PYV A;  4HV5 A;  3MKZ A;  2QWW A;  2NXN B;  1BI2 A;  1YLF A;  1FIA A;  4CXF A;  3G1M A;  2GA2 A;  1OJL A;  1LUJ B;  3DEU A;  1KQ9 A;  2AQE A;  1QGP A;  3S2H J;  4G7H F;  4AIH A;  4Y4R A;  2DT6 A;  2L54 A;  3E6M A;  4ZDP A;  3I4M J;  2EBI A;  2KZV A;  1X1A A;  2R92 J;  1KU9 A;  3OYN A;  3FZV A;  2R7X A;  1JI8 A;  2UXX A;  3E7L A;  4DYC A;  1EH6 A;  4LG0 B;  3ROU A;  2VJ5 A;  4YEL A;  1IN5 A;  1DPR A;  5TJJ A;  1XB4 A;  2L0K A;  2JWT A;  4AIJ A;  4GYI A;  5A2Q K;  4F52 A;  5F1R A;  3OYL A;  4M9S A;  3QAH A;  2VT2 A;  3DKY A;  3ZXS A;  4L5J A;  4M3F A;  2JTV A;  1K79 A;  4RAG A;  2QSF X;  3I4N J;  4B09 A;  3K1M A;  1PP7 U;  1QU3 A;  3ZMZ A;  4G9Y A;  3JRI A;  5CYV A;  2DI3 A;  2F4I A;  2OUM A;  4M3G A;  2XF5 A;  3DLL F;  4EJT A;  3MCZ A;  3BY6 A;  4HSR A;  3DFG A;  2DDA A;  3CCL I;  2KRF A;  3PUF A;  2V6E A;  1IXS B;  1X1P A;  1RIO H;  3WE2 A;  1R7J A;  3OSG A;  3DF8 A;  4BGD A;  1KQ0 A;  1XTA A;  3V8J A;  2E1N A;  3KLO A;  2W84 A;  2J5O A;  1EF4 A;  2ESN A;  2IAI A;  5B5E C;  1SAX A;  4L18 B;  4CA0 A;  1Z9C A;  5ILU A;  3M8J A;  1OKR A;  3BP8 A;  3MFK A;  3ELK A;  1V4R A;  2XAU A;  1MJB A;  2KQR A;  3EUK L;  4G6D A;  3LA7 A;  2XF7 A;  2CSO A;  1XGS A;  2Z1D A;  3RPU A;  3C1D A;  5L3D A;  3BDD A;  1TNS A;  2PN6 A;  4PSW A;  4M73 A;  1ZAR A;  2HZT A;  2VB6 A;  2MAB A;  2DFH A;  3DQV C;  3A01 A;  4JQF A;  1X19 A;  2OZU A;  3BQY A;  3FXR A;  3DV8 A;  4LB6 B;  3E5Q A;  1BOB A;  2Q2E A;  3VEP A;  1K4T A;  5CVI A;  4Q48 A;  1WFX A;  3FM3 A;  1HKT A;  2CJJ A;  2HZD A;  4WX9 A;  2EFW A;  5D5X B;  1TT0 A;  3A02 A;  3K4B A;  3OOP A;  1RUN A;  2LH9 A;  2RV8 A;  4U7D A;  3MWM A;  2L7M P;  4EJU A;  1R6R A;  2EIN H;  3ONQ A;  2WC2 A;  1FOY A;  2HTJ A;  3LFK A;  4XOP A;  1TWA J;  2VOO A;  2R4G A;  4DOZ A;  3FXU A;  5IOZ A;  1IF1 A;  4RB0 A;  3ERE D;  3SFZ A;  1D8K A;  2H09 A;  3R0J A;  4XSZ F;  3HSF A;  2W4S A;  1WJ5 A;  4I0B A;  4PFP A;  2EFP A;  5F0C A;  1KU3 A;  2HS5 A;  1RUO A;  2BGC A;  4KN7 X;  1Y1W J;  3R6S A;  3FMQ A;  2LRD A;  3GME A;  4HAM A;  4N9H A;  3KEQ A;  2JSP A;  3PNY A;  4XQF A;  5FRM A;  2D45 A;  2O6G E;  3J7Y J;  1FYL A;  1FY7 A;  5B1B H;  5BQT A;  2HGC A;  1U8R A;  1FBQ A;  5JLX A;  2YSR A;  3HBL A;  1YRN B;  1B9M A;  2PMZ N;  4XRS A;  4XL9 A;  2CV1 A;  1PUF A;  1MJ9 A;  2K9Q A;  5FGM A;  4YIR X;  4BE1 A;  2Y9Y A;  1VQP I;  3AL0 C;  2NVU B;  1YX3 A;  2HEO A;  3BJ6 A;  3QRF F;  3KE2 A;  3QPH A;  3PM1 A;  2OCC H;  2R7F A;  3P9I A;  4XKC A;  1JT0 A;  2RNJ A;  1SEU A;  3JAM K;  3B6A A;  3NRV A;  4M74 A;  1Z0X A;  1R5H A;  2LP0 A;  1JKQ C;  1W5C C;  3RJP A;  1XGM A;  5HNH A;  3BR1 A;  3IL2 A;  1K78 B;  1T08 B;  2P81 A;  2WBM A;  4I02 A;  3S1N J;  1T8I A;  4O3M A;  4BJT A;  3PO3 J;  1J09 A;  3HRM A;  2V9K A;  2KJB A;  3R0A A;  3F6V A;  2XHK A;  1G2H A;  2OU2 A;  5D5W B;  5LEJ A;  2QQ8 A;  3GCM A;  5FKM A;  1LB2 A;  3AFH A;  4ZYD A;  2BVM A;  1JJ8 C;  4C3H J;  1AU7 A;  3ZQL A;  1YS7 A;  2IS6 A;  4O5V A;  2W24 A;  4IJA A;  4HX8 A;  3F72 A;  3CUQ C;  3DBR B;  1J5Y A;  3IAM 2;  1UCR A;  2K3F A;  4CCN A;  3X2Q H;  1DU6 A;  1RKT A;  2P6S A;  1UG0 A;  3LST A;  3H5A A;  1HQC A;  3ECH A;  4HOB A;  1BIB A;  1X3U A;  4OAZ A;  3OYA A;  3N05 A;  4L0Z B;  1H9G A;  3U1K A;  1BN5 A;  2P5L C;  1YJ9 I;  3HRU A;  1NH3 A;  2QQB A;  1U78 A;  3OL3 A;  2UWM A;  2DU9 A;  4II3 A;  1HF0 A;  2KPM A;  3SHF A;  4L9N A;  3S2W A;  3R4K A;  2M8G X;  3ABT A;  3S8P A;  1MBK A;  4KT6 A;  4ENJ A;  2CG4 A;  4FX4 A;  3K69 A;  5F6F A;  3J81 K;  2ISZ A;  5JR3 A;  4B4C A;  3M3Y J;  2QLZ A;  3QU3 A;  2WA0 A;  3JRC A;  4RGU A;  4A3B J;  3BQZ A;  5H20 A;  4BYY A;  1G59 A;  3W2A A;  5LHI A;  2VLA A;  4HLY A;  3HXL A; 
#chains in the Genus database with same CATH homology
 2QSH X;  1QZE A;  2F4M B;  1PVE A;  3ESW B;  2F4O B;  1TP4 A;  1OQY A;  1X3Z B;  4YIR X;  1X3W B;  2QSF X;  2QSG X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...