4UUTA

Crystal structure of the ultrabithorax protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
TYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOTIC PROTEIN ULTRABITHORAX
publication title A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 29
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4uutA00
3HOVJ 3PO3J 1SFOJ 5IYBJ 1WH7A 2CJJA 2E19A 2CUEA 3BTLA 3BR5A 1X58A 2HQ5A 2ECCA 1MSFC 2K9QA 4B4CA 4X6AJ 1ETYA 3S2DJ 3HOZJ 3Q0VA 4XRSG 2XGDA 3IV5A 2R5YB 4A3LJ 2DMNA 3RQIA 2NS7A 1GV2A 2YUSA 5IP9J 1YRNB 3HOWJ 3BR3A 2WAQN 2DMQA 2QCOA 3I4NJ 2E2JJ 1JGGA 2LFBA 2LLKA 1WI3A 4D5CA 1JJ8C 1B72A 2ECBA 2XPUA 4FE7A 4ABZA 2IBDA 2ID3A 2DA5A 5GPCA 3HOUJ 4UUSA 4BY7J 5EGOB 3I4MJ 1Z77A 3D1NI 4IHXA 3CQZJ 1GUUA 1JUSA 3TP0A 4MIMA 1JT0A 1TWFJ 2DA1A 1R9TJ 2MW8A 4JX4A 2CQQA 1ETVA 2MGQA 1QPIA 1VNDA 3QQAA 2CQXA 4D5FA 1OFCX 5FKNA 1EF4A 1UG2A 2I10A 1GT0C 1GVDA 3M3YJ 4EEFG 1ENHA 2CU7A 3ZQHA 1MH3A 1IG7A 2XGEA 3WHBA 1AKHB 1QRYA 2LR8A 4MLOA 3LNQA 3QPLA 5J1RA 1B8IB 2JMWA 2B63J 3MKLA 3GTQJ 5F0HA 5K7ZA 3FK7A 4BY1J 1IJWC 2N8GA 4IHVA 2O9LA 1UHSA 4C3JJ 5K7FA 1CQTA 2O7OA 2DA2A 1MBJA 4A3GJ 2DN0A 1ETXA 1U9OA 4RBOA 4CYCA 4Y52J 5FKKA 2GLOA 4A3KJ 5IYCJ 1WCMJ 1XG1A 1Y1WJ 3S15J 2Y31A 1U8BA 1FTZA 4BBSJ 2R92J 2XRLA 3E7LA 1MNMC 1JUMA 3LSGA 3SJMA 3HDDA 4S0HB 1MH4A 4W1UA 1P7JA 3HEFA 3MVPA 1Z0XA 2EZLA 2X48A 5GP9A 2R5ZA 1MBGA 3LSRA 4AUXA 5IOZA 2YU9J 2LK2A 1POGA 1HLVA 2DMPA 4A3JJ 1G2HA 5E3MA 3PO2J 3W6VA 4DYQA 5K7HA 3G1OA 3G1LA 4W97A 2IAIA 1UMQA 2XGCA 4Y7NJ 3BTIA 5EF6A 1BA5A 1W0TA 3DCFA 3GBGA 3ZQFA 1LE8A 1QVUA 1LFBA 5FJ8J 5M5WJ 1VFCA 4XIDA 1XS9A 3GTJJ 5DTDA 1PUFA 1MBEA 2XSDC 3ZQGA 3JRCA 1DU6A 3IH2A 5E3NA 2OF7A 2Y9ZA 4C3HJ 3DEWA 5C44J 2R0QC 5DS9A 2HOAA 1ZTRA 2LP0A 1ZQ3P 3JRDA 5EG0A 3C2BA 2LD5A 5IOYA 2HDDA 2FX0A 5EZGA 4G12A 5BNGA 1LFUP 2Y9YA 3BG5A 3QPSA 2DA4A 3G1MA 3RZDJ 2WB1N 4C2MJ 1JKQC 1E3OC 2VKEA 4M3DA 3IH3A 2ME0A 3BR6A 4V2GA 3ZQIA 1IUFA 4I6ZA 3OSFA 4LOCA 1AHDP 4GFBA 4AYBN 2EBIA 2M34A 4IHYA 1IRZA 2PMZN 3RKQA 4IEJA 1ETKA 3Q3SA 4A93J 4BXXJ 2VKVA 2XB5A 1H8AC 1Q1VA 2DJNA 4C3IJ 1TWHJ 3HGGA 2DA6A 4B3AA 1HCRA 5F27A 1ETOA 3JRIA 2JJ7A 3FIWA 5J3LA 2CRGA 2KDZA 1HDDC 1A6IA 4QTRA 2R5YA 4XRMA 2ME6A 2JA7J 1YRNA 3WHCA 5IYDJ 1TWCJ 3GTPJ 5F1JA 2WV1A 2HOTA 4A3FJ 2NVXJ 2ELKA 2NS8A 3HOXJ 5FKLA 2W48A 5C4XJ 5FLMJ 2E2HJ 1HDPA 2LY9A 1RPWA 2JWTA 2JK3A 4D7MA 4JYKA 3OOUA 3Q0WA 1SANA 1JKPC 1ITYA 5C3EJ 2M2EA 2TCTA 2LKXA 2X6OA 3S1RJ 4MFEA 1H88C 1I6HJ 5EGOA 2HOSA 3FISA 4A3BJ 1WPKA 5JLXA 3A01B 3BG9A 1MBFA 4MFDA 4DYCA 1JJ6C 1MSEC 1WH5A 3VPRA 3JRFA 1NK3P 3H0GJ 2O8KA 4XICA 3LSPA 1IGNA 3BQZA 3BR0A 2DTZA 3A03A 2L7MP 3PM1A 2HYJA 4JP0A 3S17J 3HOYJ 3BTCA 1JT6A 3HB9A 5F08A 2P81A 2K9NA 2M9HA 4XRSA 3O8HA 1AKHA 1RKTA 2EQRA 1FIPA 1BL0A 5IPAA 2JA6J 2AHQA 2EH3A 4QIWN 5GPAA 1PUFB 3NARA 3OSGA 1B8IA 5F0FA 3HGYA 3M4OJ 1DU0A 1FTTA 4UUTA 1K61A 1ZR2A 3NAUA 1S7EA 2NVTJ 5E3LA 3S1NJ 2EZKA 1JTXA 3GTGJ 2AO9A 1VF9A 1OCPA 1BW6A 1F43A 3GTMJ 3B6AA 2XPWA 3JR9A 1FEXA 1JTYA 5EG0B 2COBA 2L7FP 3CDLA 1ETQA 3ZQLA 1B72B 1T33A 3JRAA 1F36A 3L1PA 2KT0A 4V2FA 2FJ1A 3LOCA 1RESA 2L9RA 4UUSB 3TW7A 2M8GX 5M5XJ 2VUMJ 1T56A 1XC5A 2HI3A 2RAEA 3B6CA 2MG4A 1FJLA 2H1KA 4DW6A 2VPRA 1IDZA 1X2MA 3CMYA 3GTOJ 3BT9A 5EDNA 3K7AJ 3BG3A 3S14J 4M6VA 2Y0SN 3ZQCA 4M3GA 5IP7J 2QF7A 5M3MJ 1ORKA 2FD5A 2YS9A 3IH4A 4M3BA 3S2HJ 3FKIJ 5J1UA 3S1MJ 5JLWA 3RZOJ 1RETA 1OCTC 2H8RA 3TP3A 4FCYA 4AC0A 4RDUA 2XB0X 2DA7A 4HNVA 4IHWA 1OJLA 2HXOA 2VI6A 3JRBA 5C4JJ 3HBLA 2E2IJ 2ZB9A 3JRGA 2ID6A 4X1EA 3TEDA 1BJZA 1IC8A 3F0CA 1RR7A 2Y2ZA 3LSJA 3H3VK 4DZJA 1WGXA 2M0CA 2NVYJ 3HKZN 4DYRA 4A3IJ 3UKGA 2FQ4A 1MBHA 2DMTA 4JX6A 4J19A 1IV6A 4A69C 5IP6A 5E3OA 2TRTA 4A3MJ 4CYCB 2JN6A 1JKRC 1HOMA 1A5JA 2GBYA 3BTJA 1X2NA 4DZPA 2CUFA 3CCYA 2K40A 2R7ZJ 2JA8J 1ZGWA 3SDGA 1TC3C 2MSYA 1TWAJ 2NOGA 3TW6A 3O8GA 1GDTA 2GM4A 1NTCA 1FIAA 1HF0A 3BR2A 2D5VA 1JUPA 5FKOA 2JA5J 4NDLA 2R5ZB 3K2AA 2L0KA 4BKXA 2E1OA 1ZK8A 3GTKJ 1MBKA 1U9NA 2DMUA 1P7IA 2XPVA 1QVTA 3JRHA 5F0CA 4FTHA 1JKOC 3Q0UA 1AU7A 4FE4A 4A3CJ 1Y1VJ 4A3DJ 1BW5A 4M3EA 2Y30A 4QSHA 1LE8B 4M3FA 2L7ZA 5F04A 5J1YA 5EYRA 1K83J 5FKMA 3GTLJ 1GV5A 1U78A 4FISA 4A3EJ 5FLVA 2DA3A 4JX5A 1W0UA 5EEAA 5EZHA 4I76A 5M3FJ 1H89C 4L5EA 3A02A 2X9DA 2EZIA 2OPTA 5HODA 3OIOA 1TWGJ 9ANTA 3A01A 1APLC 1I3QJ 1IDYA 1I50J 3BQYA 2NVQJ 4MO7A 1NK2P 4D7NA 2LTPA 1ZR4A 1ZKGA 4B1RA 3SFIA 2HXIA 2K9SA 3MN2A 3BR1A 1ETWA 3ZOBA 2IEKA 5M5YJ 2R93J 2EZHA 3S1QJ 2G0EA 1VI0A 1O4XA 1RKWA 3HM5A 3JREA 2LVSA 1D5YA 4XK4A 3S16J 3FK6A 4BBRJ
chains in the Genus database with same CATH superfamily
3I58A 4CA0A 2XIGA 3M1CA 3S93A 2LH9A 4RA2A 2A5WA 1XMKA 1IN4A 2ECCA 1FBUA 2NNNA 4ETSA 4CCNA 2RQQA 1TNSA 1O7LA 3DBRB 3RKXA 1MJ9A 1SD7A 2XGDA 4OINF 1VQ6I 4ENMA 1P4AA 1WJDA 1GV2A 5IP9J 4A2UA 5BOXA 3TOBA 4ZTFA 2QZ8A 3I4NJ 3GLLA 2PMHA 4D5CA 1B72A 1WZ2A 2V1UA 1WQ2A 1YLFA 2DA5A 5GPCA 5E79C 3G4SI 3HOUJ 2OQRA 1VQOI 2K86A 4UUSA 4LITA 4AD9A 2FXAA 2W25A 2L01A 2CQNA 3GWZA 3TP0A 4CCOA 4HDVA 1QU3A 1O3QA 2Y75A 1RUOA 4G7HF 3K4BA 1ETVA 2CMPA 4EGYA 1V3FA 3CF2A 5D5WB 1BIBA 3KCCA 3FXLA 1EF4A 1LKXA 2D1HA 5LGUA 1GVDA 3TBIA 4BXFA 1IG7A 4BACA 1LEAA 1DGRM 3J81K 2PJRA 1AKHB 4EVIA 1QRYA 2RV8A 3HKZA 3I5UA 1YJWI 3U1DA 3BROA 3ZCOA 4AVPA 3FM3A 2WAEA 5KNLA 2H8WA 3LNQA 3QPLA 5J1RA 1MJAA 1TLHB 2JMWA 2VBWA 3I59A 5F0HA 3LSHA 4PUSA 5LFAA 4UVAA 2H6CA 2XUBA 1GXPA 1UHSA 3C3WA 1DUXC 2Z2SB 1MDMA 3LSMA 3IWZA 1WRJA 2UV1A 1Y8RB 3H36A 3FXMA 4Z2YA 4RBOA 1B59A 4HF1A 2M30A 3PNTA 3DFGA 4NUBA 1R71A 1EH8A 2GAUA 3PQKA 1XG1A 3S15J 1XGSA 1U8BA 4KIBA 2K3FA 4BBSJ 2XRLA 3E7LA 1MNMC 3LSGA 1BN5A 4GGGA 3CCQI 2PG4A 2R7DA 4IRGA 3OS0A 3ASNH 3SZPA 3KX2A 4W1UA 1H0MA 1ERDA 3H5NA 1KQ8A 1UB9A 2HDCA 1EKEA 1ZELA 4R79A 2VC1A 5DYMA 1Z0XA 2EFNA 4HNUA 2X48A 3OMYA 1UAAA 4XBFA 1MBGA 3SQNA 5E1WA 3U1KA 5DD8A 3PIPF 3RI4A 5L3FA 4FETA 2XROA 2DMPA 4PJNA 3R61A 2JVGA 3OOPA 4A3JJ 1G2HA 5E3MA 3PO2J 1IAWA 3G1OA 4W97A 1ZAOA 2IAIA 2MD5A 4WF2A 4BEHB 3CJQB 1MMSA 3W2AA 2R7TA 2RNJA 1P4WA 3E3VA 1W0TA 3I0TA 1F5TA 1VQ5I 4WCGA 4LGWA 3DPTA 3ZQFA 2IVMA 1LFBA 2DYSH 3E6BA 5FJ8J 3JAMK 5M5WJ 5EEHA 1VFCA 1X19A 4HQMA 3QWLA 2UXXA 4XIDA 1MMGA 1XS9A 1PUFA 3D5SC 3OYAA 1LDKB 2E5NA 2KJCA 4KT5C 4L5JA 2XSDC 4LIVA 2IA1A 2BYVE 3WTYC 2HYFA 2IJLA 3EYYA 1MIJA 1BR2A 3I54A 3SZGA 1MD0A 3GF2A 5C44J 2DU9A 2HOAA 5LGNA 1ZTRA 4XMYA 2DT5A 2LP0A 1ZQ3P 4HBLA 3JRDA 2JUGA 3IC7A 1R36A 1KA8A 2YR2A 2EIJH 4BS9A 2FX0A 4E7KA 1NH3A 1MW7A 4G12A 1DP7P 2PFBA 2X4HA 2HOEA 3RIRA 4IRIA 3F8FA 3HZJA 3QPTA 2A69F 2DK5A 3FXQA 3N4MA 1MJBA 2WB1N 4C2MJ 1JKQC 1PUEE 2DOAA 1OYWA 1W7PB 5B66C 1XMXA 2CS3A 3N05A 1KU3A 4M9XA 4I6ZA 4IKFA 1Z9CA 2DCEA 1AHDP 3ECHA 3L7WA 1X3UA 4L0ZB 1XGMA 4IHYA 5F64A 2BOLA 4RAFA 3ZP5A 3RKYA 2PMZN 2W00A 4IEJA 3HTSB 1J5YA 2XHKA 3BPVA 3OYLA 4A93J 1J09A 2XF6A 4BXXJ 3QYBA 2VKVA 3AKZA 2XB5A 4WWCA 1Q1VA 4C3IJ 1KONA 2KMUA 1TWHJ 2MA3A 2CSOA 1JGSA 4EJTA 4B3AA 1BOAA 1U5TC 2EFQA 1YG2A 2CRGA 4QTRA 2R5YA 2E1CA 2ME6A 3V42A 2DAOA 4HRIA 5IYDJ 2EILH 2VJ5A 2VQCA 2BGCA 5F1JA 2LBFB 2DXIA 1XSXA 2NS8A 3K69A 3TQNA 5FKLA 5C4XJ 1CF7B 1DPUA 1HDPA 3A0BC 5AIPA 1RI7A 3I4PA 1RPWA 4U7BA 5ICCA 4B44A 3FX3A 4JYKA 1JKPC 4N0BA 1L3LA 2QA4I 1HXDA 4KJZA 2M2EA 4L9TA 2X6OA 4MFEA 2HOSA 2H09A 4ESJA 3UR3C 4BHCA 5HLGA 1B6AA 1TQMA 1FP1D 1I6XA 3VPRA 3JRFA 3WTTC 5CPRB 4XICA 5LEKA 2ADUA 2FF4A 4O3MA 4M9ZA 1J9IA 1S9HA 4FHTA 2E1NA 4JP0A 1WJBA 3BTCA 1K6YA 4RB0A 3JSPA 3WODF 2HFHA 5JFRA 4FX0A 1FIPA 2Q8KA 1TTYA 2BBYA 3T5XA 4CCLA 5IPAA 3L00A 1QNTA 2H6BA 3K2ZA 5HLIA 3OSGA 5D6EA 3HGYA 1ZR2A 3BZ6A 2X1CA 2ZFUA 5IT9K 3NAUA 2GXGA 3LAPA 5E3LA 1WKMA 1JTXA 1JXSA 1R4NB 4Y15A 5D6FA 3GZ6A 3GTGJ 2A05A 2VXZA 3V4GA 1BW6A 1XB4A 1F43A 2ZMEB 4BJ6C 3LA3A 4IXAA 4MQ9F 3H35A 2OZUA 3G3ZA 2F4IA 5L3GA 5LGTA 2BEOA 4FT8A 4PGGA 5HS8A 3I56I 5FFXA 2XAQA 4XSZF 4YFKF 4HQEA 1R23A 5DCMB 3M7GA 2R7XA 4EJVA 4DW6A 1SFXA 2VPRA 4MNUA 4RB2C 1MMAA 2QVOA 3QODA 2ZNYA 3VYTB 3REOA 5EDNA 3K7AJ 1V4RA 3ABLH 1HBXG 3S14J 1Z3XA 4G6QA 4M3GA 1WJAA 4JOMA 3VYUB 5CVIA 2M4GA 4S04A 3EPZA 2K02A 3IH4A 1K4TA 2OTJI 5TGTA 1FBSA 4UHTA 4PK4A 1HSTA 3FKIJ 2V4JC 4GO1A 3ZQQA 4AVZA 2VT2A 3KEOA 3ABTA 3K70D 3AAFA 4DOZA 1VQ9I 4FCYA 4RDUA 1N25A 2EPFA 1UCRA 1MMDA 3ONQA 1STZA 1FYLA 1RUNA 1H9GA 3B02A 4P9UA 3ZMSA 2IS1A 5C4JJ 1QZYA 3H3ZA 3SHFA 3KE2A 1TT0A 4X1EA 1ZRFA 1BJZA 1S3JA 1IC8A 1ON2A 2HKXA 3H3UA 3H3VK 2DFIA 4DZJA 2QLZA 3KP3A 4NQWA 5BMZA 2WB1A 4A3IJ 1E0EA 2FQ4A 2ZXWH 3LL7A 3NRVA 4AIKA 4A69C 3J7AY 3GFLA 3GZNB 3K1MA 3GW2A 2ESHA 2GOMA 3P9CA 3J7ZI 1A5JA 4CCKA 4ZDLA 3CCRI 4IZZA 1R4MB 5ICGA 2DPUA 1YITI 1VTNC 1X1AA 4L0YB 2QEXI 3KP6A 3COAC 2R7ZJ 1XTAA 2FNPA 1HSJA 3DKYA 3LFKA 3CC4I 4GRIA 3K6GA 1RIOH 2HEOA 2P5KA 1NTCA 1FIAA 2VJJA 3KZYA 4ZYHA 2OAZA 4KIGA 2A5YB 2R5ZB 4P1WA 1MBKA 2CGPA 1U9NA 1QA6A 2Y69H 4HF0A 1P7IA 1WJCA 2HQAA 4Y4RA 3S3MA 1FPQA 2CYYA 3BPXA 1FP2A 2UXNA 3WTWC 1XD7A 1AU7A 4FE4A 3VB2A 2LREA 1AOYA 2JA2A 1GLNA 4M3EA 2Y30A 5A2QZ 1LE8B 1XCVA 4M3FA 3RKWA 1YFHA 2QSGX 3QAHA 3ZMZA 4A5NA 5EYRA 1K83J 4YFNF 3OYFA 2QQ8A 1GV5A 1W5SA 3K4KA 1U78A 4FISA 1TQPA 1R1VA 3GVAA 2PQ8A 1HA8A 4PJMA 4L5EA 2ZJPF 3I53A 2RC4A 3LWFA 5BPDA 2ELJA 3H9QA 2OPTA 2P7VB 2IRFG 1B1BA 1U8RA 2BW3B 4RGUA 1FZPB 2Z33A 4XLNF 3R0JA 3HSEA 2HU9A 4UV8A 2YPRA 4CZZA 2NVQJ 5KK1A 3DEUA 4OIOF 4MO7A 5E8GA 3SFZA 5HOOA 4F93B 5LHHA 1Z67A 4D1QA 2LTPA 3H1CA 1ZR4A 4B1RA 2R3SA 2HXIA 2FBIA 4C2TA 1R58A 1A04A 2IEKA 4XOTA 2KRFA 3KP7A 1IXSB 2F5EA 5M5YJ 3V8LA 2FQ3A 2XF5A 5K5RA 1VI0A 4E6KG 1O4XA 1N77A 3HM5A 5ICEA 4L18B 2W85A 4XK4A 5B3SH 4FASD 3A1YA 4BBRJ 3HOVJ 5IYBJ 3HPHA 2E19A 3BTLA 4LLLA 3CJTB 3AG3H 1BBYA 1X58A 2BY1A 2ZBKA 2HQ5A 4B4CA 4G94A 4LG0A 3DPLC 3HOZJ 2STWA 1T0FA 2XAGA 4XRSG 3WTUC 2VJIA 4A3LJ 1U6GA 5D4RA 1YRNB 1J7KA 3HOWJ 3KFWX 1FSEA 4KUMA 1ZG1A 4YIFA 2DMQA 3HYIA 3FMRA 3GMEA 1USTA 2TDXA 5DEQA 3SYTA 2LFBA 1JJ8C 2WY8Q 3ZRGA 2KL4A 1D8KA 1UJ8A 2D2WA 4HG2A 1IN5A 1XSVA 2K4BA 4KN4X 1T08B 4V19K 3AL0C 1L0OC 5JVTA 2IBDA 2ETHA 2ID3A 2W7NA 3L09A 2FOKA 4BY7J 3VYRB 3ELKA 1TBXA 5EGOB 3I4MJ 1O57A 1Y0NA 4RAGA 4IHXA 1JUSA 1JE8A 3WGGA 2W1OA 1R9TJ 2MW8A 4JX4A 1VNDA 4L9VA 3BY6A 4MTEA 3DPUA 3R4KA 2DT7B 2EIKH 3H5RA 3QQAA 1LVKA 2CQXA 3ML6A 4D5FA 1OFCX 5FKNA 1FWZA 2I10A 4IQ4A 1R5GA 2F48A 4BHPA 3M3YJ 2F5VA 4EEFG 3OYDA 3V8JA 4YFXF 3ZQHA 2NYXA 4C9YA 1J0RA 4XSXF 3WHBA 3TDUC 5BQTA 4G6DA 3NWSA 1U5TB 3U2RA 2NAZA 5CLSA 2BXYA 3G71I 1BI1A 5D4SA 5CJ9A 4ANJA 2B63J 2B0LA 4NC7A 3MKLA 3GTQJ 1XDSA 3FK7A 2DI3A 4IHVA 2N8GA 3HUGB 2O8XA 4I0BA 2FU4A 4CICA 3OYGA 4XN0A 2VKHA 3PQJA 2CUJA 5H6QA 3O2PE 1VQ7I 1ACIA 2EV0A 4UY8I 3DBLB 4ENKA 2V26A 4CYCA 3HC7A 2FE3A 3DV8A 3CO7C 1OPCA 2BVLA 4RAZA 1RC9A 5FLXZ 3BDDA 4XR6A 1LJ9A 2VE9A 2HWVA 5K5QA 3M8EA 2OD5A 2FBHA 3C1DA 2EJRA 3DP7A 2M7BA 3QOPA 4RGSA 4B48A 1BI3A 4S0HB 2LG4A 3QU6A 2XF7A 1NG6A 4BQAA 3DTKA 2EZLA 5GP9A 2GOXB 4E7LA 3GXOA 5JR3A 3LSRA 1FMVA 3KP2A 4AUXA 5IOZA 4LB5A 2LK2A 1WSUA 1FLIA 1POGA 1HLVA 2VPLA 1X1BA 3ZGKA 1YW8A 4N9IA 4QLCU 1YO5C 1EV7A 2H1LA 2IT0A 3C2GA 4BE1A 1A31A 3W6JB 3CCEI 2WA0A 4G8XA 2XGCA 2CV1A 1BA5A 4HLXA 3DCFA 3OR2C 1QVUA 3MEXA 2RDPA 3QPHA 2JSCA 2X0LA 3MAJA 4RLQA 5DTDA 3GTJJ 2UWMA 3OIQA 3CCUI 3GO5A 3HRSA 4BGDA 1R49A 1DU6A 2GXBA 2P6TA 2OZ6A 4JBAA 5FD5A 1ULYA 5E3NA 3H92A 2AQEA 3K4JA 2ZCWA 1J75A 2Y9ZA 4DQ2A 3GFIA 2XAUA 3DEWA 3CCJI 5FRMA 3R0AA 5DS9A 4CDGA 2CFXA 2HQNA 1VQPI 4GXOA 1WFXA 3T1BA 4ZDOA 2EIMH 4KITB 3C2BA 5EG0A 3OS1A 1PVEA 1DDNA 1BOBA 2W82A 4S05A 3BJAA 3VWBA 1KU7A 3J80Z 4QPQA 2M1BA 4U0YA 1RRJA 2R7FA 3WG9A 3MKWB 2ISYA 3QPSA 4PSWA 1OR7A 3PL8A 2ZO4A 4ZYAA 3IWFA 1MZBA 3LAJA 2IPQX 5D5XB 3HOSA 3RPUD 2ZFWA 4P96A 2ICWG 3BR6A 4QPOA 4V2GA 4IJAA 4PJLA 4A5MA 2AQFA 2EBIA 4AYBN 2ZJQF 2L4AA 2GWRA 4XNFA 2VODA 1ETKA 2H27A 1D5VA 3PUFA 4II3A 5DD4A 3QOEA 4LFUA 2DJNA 3CMMA 3HGGA 2DA6A 2VB6A 2CUZA 1HKSA 1HCRA 4M71A 3FIWA 2BY0A 2KDZA 2QSFX 4P9FA 4E7IA 1E3PA 2K9LA 1TWCJ 3S3OA 3VEPA 1ZLKA 3GTPJ 4I2OA 5FO5A 1NG7A 4LG3A 1P92A 4OIRF 1I39A 4YELA 3WU0A 5J8FA 3K4CA 1PDNC 3LFUA 1D0XA 5E17F 2LY9A 2EA4A 1G4DA 4EMSA 3P5JA 2R4GA 5B5EC 4D7MA 2MH9A 3DKXA 2F6CA 1LFPA 1ITYA 3RPUA 4IL6C 4G6TB 2TCTA 1YQAA 2LKXA 1QBJA 4A3BJ 3CUOA 3A01B 3ZPLA 3MFKA 3TMOA 5DM7F 2MFZA 4KMUX 3LSIA 3H0GJ 2WADA 1IN8A 2QYOA 2FSWA 3NWTA 3H9GA 3DWLE 3A03A 5HS9A 2L7MP 4HLYA 3GX4X 2HYJA 2VBZA 5E8IA 2QBYB 3HOYJ 1JT6A 3HB9A 2LOOA 3SDBA 4EM0B 4PSXA 1AKHA 1EJ9A 1RKTA 5FD6A 1BL0A 1SMTA 4UV9A 3X2QH 4HX7A 4HEA2 4XLCA 1PUFB 3NARA 1XN7A 5BS6A 3M4OJ 2FNAA 1DU0A 1K61A 3A0HC 5E1XA 4G7OF 4CUGA 2VC0A 3KLOA 1XGNA 2WBMA 1K7AA 4FX4A 1OCPA 3B6AA 4O5VA 2XPWA 2K7LA 4LK0F 3BJOA 2M45A 1TL8A 4JK1X 1LPQA 1REPC 1FEXA 4B43A 4HNTA 2QQAA 5LBQA 2ZSIB 1QHHD 2COBA 1SMYF 2HKOA 2L7FP 2W84A 4P5OA 4E70A 3L2CA 2M3AA 3ZQLA 3JRAA 3L1PA 5ILVA 2RREA 3JTGA 4I98B 1TP4A 1RESA 3W3CA 4RMNA 5M5XJ 3PSIA 2VUMJ 1XC5A 3B6CA 1FOXA 1X3WB 1IDZA 3IRRA 4G9YA 3FXKA 4MEYF 2O6GE 3BT9A 2GQQA 2A6TA 3JAMZ 1ZG5A 4M6VA 1Z6TA 2HYGD 2DDAA 1TNTA 4XONA 2QF7A 1GHCA 2FD5A 2L9VA 2Z5UA 2F5FA 3HRTA 2QUFA 4XKCA 2NRAC 1R6RA 5JHFA 2WWYA 2P5LC 3ESWB 3M8FA 1QQIA 4BEHA 3E1SA 3RZOJ 3FBIB 3HL2A 4NNJA 4I7HA 2M8EA 1OCTC 1FOYA 3TP3A 3EUHA 5CYVA 2XB0X 3FDYA 2DA7A 3F8CA 3LQQA 2ZSHB 3ULQB 4LK1F 1OJLA 2HXOA 4RLFA 3JRBA 2DK8A 3IKTA 2Y0SA 5GTHC 3TEDA 1WVRA 3F0CA 1RR7A 2JQ7A 1SVMA 3ROUA 2KZVA 2NVYJ 3AL0B 3CD6I 3OYMA 4DYRA 3ECOA 3UKGA 1IV6A 1ZREA 4J19A 2YX4A 5IP6A 2VQGA 4KN7X 1DQUA 2F4OB 5E3OA 4A3MJ 3IKVA 4CCJA 1JKRC 4AYBA 4F3QA 5J4VA 2P5VA 1D8JA 3IAM2 4LD5A 3GCMA 3I71A 2E1MB 4M9SA 4IO9F 2FUG2 4IQJA 2X51A 3LA2A 3CCYA 2DOFA 1E3HA 3PNYA 3CCMI 4OAZA 4ZZDA 1ZGWA 1VQNI 3WU1B 4XLEA 2WC2A 1W7PA 2LMDA 4R1HA 3SDGA 4L9JA 2MSYA 3KYLA 1GDTA 2FBKA 4E7SA 3OYCA 1ZGJA 3BR2A 3GYHX 3EDPA 3CUQC 2VKDA 4BKXA 3P9IA 4YRVA 3GTKJ 3D5LA 3J7YJ 4X0GA 2XPVA 1T2KA 2JSPA 1YOVB 5L3CA 4Q48A 4UB8C 1D1AA 4HX4A 1IZ1A 2LBFA 1Y1VJ 1VQMI 2CW7A 2VOOA 1T8IA 4WK8F 3MZHA 5KCMA 1DPRA 4B3XA 4NC6A 1CF7A 3BZKA 1WHUA 3NQOA 2L54A 4JX5A 5KVRA 3RTRA 4BDYA 5EEAA 4KISA 3ABKH 1IXRC 1IXCA 2CQ7A 3A02A 2RNGA 2X9DA 1MKMA 1LDDA 1G6NA 3Q5FA 1Z6RA 1I1SA 3H9JA 5KAIC 3CLQA 2ZJ2A 1G59A 3QYEA 1APLC 1EA3A 1I3QJ 3IAS2 2BZTA 2QQ9A 1QPMA 2IGNA 4BUPA 1O3SA 2LRDA 3F21A 3L2VA 3DLLF 4BU2A 4OIPF 4N4OB 5KAFC 2QQBA 2IP2A 2KIFA 4BQNA 5DUIA 2OCEA 4ZYEA 4H0EA 2EK5A 3MN2A 4M6YA 1ETWA 5HVQC 2YU3A 4CO8A 2EZHA 4PDKA 2G0EA 1RKWA 3WGHA 4A6EA 3HPGA 2C6YA 2JT1A 2L4MA 3DU5A 5H2FC 2M0MA 4ZYDA 4RM3A 2DFHA 1D5YA 4AM3A 4AU7A 3PO3J 1SFOJ 2CJJA 2CUEA 4U7DA 3ZQ7A 4BQOA 4F92B 4I99C 2K9MA 1MSFC 2K9QA 1ETYA 1YW7A 2CO5A 4OOIA 2UUZA 3S2DJ 4A0XA 1OLTA 3DXJF 3Q0VA 1AA7A 3G73A 5K1YA 2Y48A 2ZMEA 3IV5A 4UUVA 1BR4A 2DMNA 4NBQA 3RQIA 2NS7A 1LQ1A 4CXFA 2R7OA 1WWXA 3DU6A 3BR3A 1NHAA 3DTEA 2O61A 1GVJA 1Y8QB 2O5RA 2E2JJ 1JGGA 2LLKA 1WI3A 3F72A 3J7AO 2ECBA 4B8XA 4OMYA 1TW2A 4FE7A 1YE9A 4ABZA 1DP3A 2YSRA 2HTJA 2P0WA 1FYMA 1H9TA 3T0YA 2DYRH 1YX3A 5DCMA 1S8NA 2DLLA 3MCZA 1Z77A 3D1NI 4IOAF 2BXZA 1Y0UA 1D1BA 3CQZJ 4O6JA 1GUUA 4MIMA 2K5CA 5HDKA 1YJNI 2DA1A 2PMUA 3PFIA 1KQ0A 2BY2A 2WAQA 1MNEA 4KFCA 4Y3OA 2MBFA 1QPIA 4CGZA 2V1NA 3SEQA 1Z05A 2O0YA 2QKMB 1TT5B 2X1EA 2ACJA 4HZFA 1OYYA 2MH2A 4MEXF 1UG2A 3F6OA 1ENHA 1SFKA 2JTVA 2Z3YA 3HJEA 3MZYA 2VXDA 4PJJA 1WJFA 2CFOA 1YTYA 2LR8A 4KIFA 3WE3A 3I3LA 4MLOA 1HC8A 5LRSA 1B8IB 4XRFA 1Y56A 5HDGA 1U3EM 3EETA 1P6RA 5K7ZA 2E7WA 5J8CA 4RB3C 5HS7A 1YX5A 1IJWC 2KJBA 5AONA 2O9LA 5TISC 4C3JJ 5K7FA 3CJRB 2FEZA 4IHTA 4IHSA 1CQTA 4XKBA 3F3XA 3FF5A 1S72I 2H94A 5FB2A 2DN0A 1ETXA 4ZH4F 4A12A 4Y52J 3BOQA 5IY5H 3KYDB 3F9KA 3I55I 2HZTA 4A3KJ 3CC7I 5E18F 5IYCJ 1WCMJ 1Y1WJ 3JCUC 2Y31A 2EINH 2ZXHA 4BJ5C 3E5XA 5ERIA 3HRUA 1T98A 1YW9A 2YX7A 3F8BA 5DUKA 1D3YA 3SJMA 2A07F 5D8LB 2L9SA 1IN6A 1SD5A 3GFMA 3V7RA 1P7JA 3HEFA 3MVPA 3RCOA 2WTEA 5LEJA 4ASNA 2HTSA 2DODA 1A35A 2R5ZA 3FKJA 5GAHJ 2YU9J 2DFEA 2EB7A 3WG7H 1G8XA 4RB1A 4I09A 5DCFA 2A6HF 5K7HA 3EUHC 3G1LA 2M7AA 2IS2A 2BVMA 2G7UA 2KRHA 5EF6A 5ED4A 3M8JA 2K3PA 3CCVI 1K4SA 1LE8A 2R7SA 5GAEJ 2NS0A 3ISPA 4TV7A 1VQLI 2XC7A 3QYFA 3S2WA 4BHBA 4Q47A 2JPBA 4A0YA 5CVJA 3JRCA 3ZQGA 3LSKA 1IN7A 3IH2A 3G2BA 3KP4A 2P4WA 2OF7A 3S3NA 1S6LA 2HDWA 2BW3A 1OCOH 4E7HA 3I64A 2VE8A 2R0QC 2WV0A 4ZJZA 3ZN0A 2NOJB 3OWTA 2LD5A 3VDXA 4YIRX 1FMWA 5EZGA 2Z1DA 5JI6A 2XKPA 1LFUP 1OQYA 2Y9YA 1V5FA 3MD2A 2Z16A 2DA4A 3AG2H 3CO6C 4H4KC 4BH9A 3RZDJ 2X85A 1WJEA 1LDJA 3TDZC 1BM9A 1OISA 2MC4A 2ME0A 1ZGAA 4GFBA 4KDPA 2M34A 1UELB 3BWGA 1M1EB 3P7NA 2R7UA 2RQPA 3RKQA 1G3SA 2VIXA 3Q3SA 2F5DA 4GDFA 1W5CC 2CV0A 4CH7A 1Y39A 1H8AC 2GA2A 3D5RC 4BYYA 5F27A 1ETOA 2JJ7A 5J3LA 3T8TA 1HDDC 2VASA 4PJ0C 3F8NA 4XRMA 2LY2A 3F6VA 3MKZA 2JA7J 2E36A 1YRNA 2IGOA 4LB6B 2WV1A 1KU2A 1D0ZA 2D1VA 2E34A 3R6SA 1JHHA 2ELKA 4A3FJ 3WTSC 2NVXJ 1V55H 1PJRA 4Z6YA 2WAFA 3PUBA 2VQHA 2JWTA 2JK3A 2AXLA 4HAMA 3OIPA 2A61A 2FMYA 1B9MA 1KU9A 5K5OA 5EGOA 2EFOA 3FISA 2Q2EB 5ICFA 5JLXA 2XVCA 1YYVA 1MBFA 2ZC2A 3E0JB 4MFDA 4A6DA 2OQGA 4DYCA 1MSEC 1NK3P 5FLXK 3KYCB 2VLAA 2O8KA 5FRNA 4PGHA 4BXUA 3EUAA 1BI0A 3LMMA 2IS6A 2DTZA 4ZC3A 1B4AA 3K0LA 3PM1A 2HVQA 5CQEA 4E7JA 1QGPA 3CUQB 3JTHA 3QP5A 2HPMA 4CHUA 2CH0A 1K78B 3O3KA 3DTIA 5DV5A 4XRSA 3O8HA 1E17A 2LKSA 5E1ZB 2P6SA 4HF2A 2HS5A 2IXSA 2WY7Q 3CESA 5TRDA 3EYIA 4ZTJA 1XMAA 2AHQA 3ZMTA 2FOWA 3F8MA 1XSDA 3L2WA 1D0YA 5F0FA 2COMA 2ZMEC 4MHGA 2KDOA 2OU2A 4UUTA 5GAGJ 4IRHA 4II2A 3V7CA 1ZG3A 2KFDA 2NVTJ 3S1NJ 1SD6A 4XKWA 3HUGA 4EM1A 3MZ8A 1G3WA 2AO9A 1W4MA 2V9KA 4AWXB 3GTMJ 2Q0OA 4CCMA 2VT3A 2XSJC 3HRMA 1T38A 3A4CA 2A6EF 2X1DA 1JTYA 1YS6A 2L9NA 5EG0B 2XAJA 1V5GA 4HPQA 1UZCA 1B72B 1T33A 3ERED 4RM2A 4V2FA 1T39A 2HNHA 1FOKA 2FJ1A 2L9RA 2E7XA 3KP5A 3TW7A 4UUSB 1R00A 4HYEA 1T56A 2RAEA 3CMYA 1R1TA 2KIMA 3J80K 2HVSA 3ZMVA 2QM3A 3GTOJ 2IGKA 2X6WA 2Y0SN 3K70C 1TW3A 2UZKA 4UB6C 3R60A 1FX7A 1FOWA 1O3RA 1ZRCA 3CDIA 1VQ8I 1ORKA 2PLYA 3E6MA 1OCZH 2XDVA 1ON1A 1RNLA 5CVVA 3TKYA 4EJWA 3S2HJ 4WX9A 3S1MJ 3OYIA 3SZTA 3SXYA 2D45A 1A36A 3LSTA 2X6XA 2PJRB 4K2EA 1IRGA 3SEZA 4EV0A 4ZZLA 2OUMA 2H8RA 3RDIA 4AC0A 2JVHA 4KT6A 3C2HA 4XLFA 2LF7A 2R7RA 4BQQA 2DBBA 2VI6A 2BV6A 2E2IJ 3HBLA 3RJPA 3CLOA 3I59B 3K9TA 3JRGA 1LNWA 3CMAI 2ID6A 3HHHA 1C0WA 2GIZA 1P2FA 2L02A 2M0CA 1JHFA 4UVCA 2R7VA 1MDMB 3MQ0A 1UHMA 1N75A 2DMTA 2GXAA 1D1CA 2MYSA 3GZ5A 2L2OA 2JN6A 3KLNA 1EH7A 1HOMA 1K79A 2DOEA 2GBYA 3BTJA 4Q5SF 1X2NA 3GUDA 1IO2A 2CUFA 3ZXSA 4L5IA 2DDBA 3BG6A 2XASA 2JA8J 2R7QA 4Y33A 5BPIA 3HHGA 3NEUA 1TWAJ 1ODDA 4LJZF 3O8GA 3TW6A 2GM4A 1ZN2A 2VL8A 3J81Z 3WTXC 1S29A 3CP2A 3HXLA 2D5VA 3OR1C 2JA5J 3OV8A 4NDLA 4DBQA 4XQFA 2KPMA 2AXTC 1BC8C 3CTAA 2QENA 2L0KA 4E7ZA 4HSRA 1ZK8A 2ZKZA 3OYEA 3IHUA 3DQVC 1QVTA 3JRHA 2DTRA 1KGSA 2GA1A 3QU3A 5F0CA 3V8KA 4FTHA 3E6CC 3DBHB 4LLGF 4U0WA 1VQ4I 3KZZA 2ZXIA 4DBRA 2LKPA 3BJ6A 4A3CJ 3FHZA 3S8PA 4A3DJ 1BW5A 4Y17A 3RSNA 4B09A 2LY1A 3E5UA 5JHUA 5FKMA 1YJ9I 3GTLJ 1T0FC 1I27A 3ZN1A 3FMSA 5FLVA 3E6DA 1R22A 4G7ZF 2DPDA 5EZHA 4I76A 5M3FJ 3AG1H 1H89C 2IS4A 2LF8A 2BHZA 1BR1A 1F9NA 4MGRA 1QO0D 1FNNA 4D0PA 2O3FA 3L2UA 2M4KA 9ANTA 4F91B 3A01A 3QP6A 3IP4B 1IDYA 5L3DA 3S32A 1I50J 2JRTA 2IA2A 3BQYA 2A3SA 3PFYA 2BHYA 3TOAA 2G7HA 1W5TA 3JW4A 1U0JA 1ZKGA 4RAYA 2VONA 1N78A 2RGVA 2XKOA 3SFIA 1Z1DA 3CC2I 3MMYB 3BR1A 3FBNB 1J59A 2QBYA 4OIQF 2E35A 2Y0MA 2V9PA 4XLHA 1B9NA 1TQIA 3TO9A 2LVSA 1X1DA 4IPAA 2XGXA 3S16J 4OWRB 2DQRA 5TJJA 3T8RA 1HQCA 1WH7A 3BR5A 2PN6A 3L9FA 4ESBA 1ZLJA 2KQRA 1HW5A 1Z91A 1T95A 3AFHA 3K4NA 4GYIA 4X6AJ 2K27A 1FC3A 3VSKA 1A6QA 1VZ0A 1QZEA 1MNDA 3RPQA 4AIHA 1OKRA 3TL4X 2R5YB 2HR3A 3ABMH 2V9VA 2M5WA 3MKYB 1YS7A 4ZDPA 2YUSA 4BL0B 3VOEA 4EATA 1W7PD 2KP6A 3CDHA 5B1BH 4ZYGA 2WAQN 2QCOA 5J40A 1S7OA 3IL2A 4HA8A 4F7ZA 2XV4S 4MQVA 5D5VB 1HKTA 1X1CA 2V1DA 2XPUA 3K4LA 3TGNA 3FM5A 4C30A 5EEGA 2R7WA 4JQFA 2V6EA 4XN3A 4R8HA 2DFFA 3FXUA 3FXOA 3P9KA 2RN7A 2V79A 4I02A 2Z9OA 3ERMA 1JT0A 1TWFJ 3ASOH 4PFPA 2LSOA 2CQQA 2NVUB 2MGQA 3I9V2 2PBIA 4DGWB 3QRFF 1ZRDA 2QGUA 4BJTA 2XAHA 2KLOA 2PEXA 1R5HA 1R5ID 1GT0C 1Z7UA 1W36D 2CV2A 2LC2A 1SAXA 2CU7A 2ZXJA 1MH3A 2O03A 4L9NA 2FA5A 2XGEA 1Z3YA 5H6RA 2X6YA 3WTZA 1HW2A 3HSRA 3F22A 4KA4A 4HX8A 4M6XA 1G3YA 1UHWA 3WTVC 3HOTA 1PYVA 2W57A 3PSFA 1J2XA 1QZZA 4BE2A 3E97A 2NNYA 4BY1J 3W2WA 3OL4A 1YIOA 2LYCA 1YI2I 5GTIC 2L3DA 2O7OA 2B9SA 4N4NB 2DA2A 4Q4ZF 2CW8A 1MBJA 2DW4A 3MWMA 5GADJ 1OYIA 4A3GJ 4GYGA 1U9OA 4RGXA 4CSWA 4EJUA 3OYNA 2VOPA 5CQGA 1SD4A 2G9WA 4UVBA 3K1NA 5FKKA 2GLOA 4IVNA 2JRMA 2P8TA 2OA4A 1FTZA 4EM2A 2R92J 2DO7A 3OY9A 1AWCA 1JUMA 3M1EA 3M9AA 2STTA 3TO7A 3FMQA 2DQLA 5J6XA 3HDDA 1MH4A 3W6KB 2IGMA 5CVUA 3HIFA 4DNCA 2HPIA 2MLGA 2VJ4A 1OR7C 1PP7U 3VSLA 5B1AH 3CCSI 1I3AA 1PP8F 1I1GA 4KICA 1LVAA 1V54H 3F23A 3W6VA 4DYQA 4NHJA 5IT9Z 1SVLA 5EJCA 4M74A 4ENJA 1UMQA 4F52A 4Y7NJ 1Q1HA 4XL9A 1FSHA 3BTIA 2IA0A 2I8DA 3GBGA 4UNOA 4OAYA 4B47A 5HNFA 4J00A 2K85A 2KIQA 4LIUA 1SVOA 1ZH5A 3FZVA 3DKWA 2ELHA 4NB5A 4PFOA 3PIOF 2V7FA 3OYHA 4D9JA 1MBEA 1XGOA 1FT9A 3L2QA 2XRNA 2FMLA 1XX5A 3W2VA 3K1PA 3OYBA 3H5AA 4C3HJ 5KHDA 2V6CA 2IW5A 2B7EA 1IW7F 4NQWB 1XDUA 4A0ZA 4BNCA 2KHMA 5IT3A 3FXJA 4PZJA 1OCRH 3K10A 2W24A 2V1XA 3C7JA 5IOYA 2HDDA 1LEBA 1WJ5A 5F6FA 3EUKL 3RQ4A 5BNGA 2EFWA 1YHQI 3BG5A 4HW0A 2BE5F 3EQLF 3G1MA 4J01A 1R1UA 1Y6IA 3DEEA 3LA7A 1E3OC 2VKEA 4M3DA 2LNBA 1O7FA 2OTLI 3IH3A 3RYPA 4KNYA 1KYWA 2HVRA 3C18A 3ZQIA 1IUFA 1P4XA 3OSFA 2J5OA 4LOCA 1ZHFA 1X4OA 1IRZA 2CWEA 3OL3A 4AIDA 4BE0A 4M73A 4BAYA 4EQQA 3M07A 3ZMUA 1BJAA 2DT6A 3KZIC 3LQRA 3JRIA 2E60A 1A6IA 1CGPA 5L3BA 2F4MB 1E2XA 1F1ZA 3WHCA 2JZYA 3CJNA 2HOTA 4XORA 2AS5F 3AG4H 4XLPF 2EFPA 3HOXJ 2W48A 5FLMJ 2PJPA 2J5PA 2VBXA 2E2HJ 3CZ6A 4EJOA 2PMZA 3BG7A 2P7CB 4FQGA 3OOUA 1SANA 3Q0WA 3U21A 5C3EJ 3CCLI 1R7JA 3S1RJ 1H88C 4KYWA 3KEYA 1I6HJ 1WPKA 5A2QK 5CVRA 2OJED 1EH6A 3BG9A 4ON0A 1JJ6C 1WH5A 1Z21A 4U88A 3LSPA 1IGNA 3BQZA 5HNHA 3BR0A 3KETA 3O6BB 1O3TA 2EWNA 2E71A 5FFZA 4LMYA 2CW0F 4BDZA 1IF1A 3S17J 5LHIA 3BZCA 1JI8A 1SFEA 3CF5F 5F08A 3B73A 2P81A 2K9NA 2M9HA 3PNVA 4ITVA 4N9HA 4DIQA 5HLHA 3KEQA 2PI0A 1KYZA 4HV5A 2EQRA 3RYRA 3ABUA 3IRQA 1IRFA 2W4SA 2JA6J 2EH3A 3GEZA 2DJIA 4KMFA 3K4MA 4U87A 5GPAA 4QIWN 5F1RA 2CG4A 2I5UA 3VFZA 1B8IA 1SC7A 1FTTA 1S7EA 3BP8A 2BY3A 5D8KB 4LG0B 1U2WA 2EZKA 2JUCA 2EA2A 1OCCH 3A2KA 1VF9A 3HTUA 5LD2C 4F55A 1W1WE 2MLKA 4HOBA 3ZMDA 4IF4A 3JR9A 1G3TA 4LLNA 1SAUA 2KZGA 1FY7A 4IX7A 3CDLA 1Z7LA 1ETQA 1RZ4A 1HKQA 4NC8A 6PAXA 1F36A 1P9QC 5D5UB 3KIOA 1IUYA 2PX9A 2NXNB 2KT0A 3E5QA 5HLTA 2ESNA 1S5LC 3LOCA 1X1PA 1VQKI 2M8GX 2A68F 2HI3A 1IV8A 1FJLA 2MG4A 3DLAA 2H1KA 2E5ZA 4Y13A 2QWWA 4YG2F 5JVGF 3D0SA 1X2MA 3BG3A 3HG9A 5L3EA 3IUOA 3ZQCA 3HSFA 3FHNA 3TO6A 4I0AA 5IP7J 5M3MJ 1BIAA 2YS9A 1XPXA 2VN2A 1K6OA 4M3BA 4HV6A 2KKOA 5J1UA 3L2RA 5JLWA 2EV5A 4MTDA 2MABA 4DJAA 1USSA 1RETA 2Q1ZB 4P55A 5J4YA 2RKHA 1YIJI 1FBQA 2MC3A 1UFMA 4HNVA 2HGCA 4IHWA 2VQLA 2HQRA 3JSOA 5FGMA 2ZB9A 2L5QA 4WXCA 5ILSA 2Y2ZA 3LSJA 1MMNA 1F4KA 4GCVA 4XM3A 1WGXA 5J47A 4OMZA 4WXHA 3VODA 1BI2A 3BCBA 3HKZN 2E1MC 1MBHA 3BLYA 4JX6A 4C2UA 2EV6A 4XOPA 2TRTA 5LLQA 4CYCB 1W36C 3CP8A 1I5ZA 3UNGC 4RS8A 2F2EA 4HSTA 1TZLA 2Z99A 3BC8A 1DGWY 4DZPA 1KZHA 2ISZA 4YIIA 2K40A 3VYSB 3WGIA 3PJRA 1ZARA 3N97A 4RGRA 1V5EA 1LUJB 3FXRA 4QWQA 1TC3C 2QSHX 4CZCA 3Q9VA 2NOGA 4M72A 2HZDA 4PCQA 1HF0A 2GZWA 3OYKA 1RR8C 3G6EI 1JUPA 5FKOA 1ZYRF 1IRXA 2KISA 4E4HA 2OCCH 1MGTA 3K2AA 2E1OA 1HW1A 3CMEI 2DMUA 4OU0A 3V7SA 1FYKA 4UXNA 1ONVA 5AIQA 1X4PA 1GXQA 3ZR8X 1JKOC 4IOCF 2KIUA 3Q0UA 3Q9SA 3OS2A 3WE2A 2JPCA 1UG0A 2L7KA 1U5TA 4U0VA 4QSHA 5CKTA 2L7ZA 5H20A 5F04A 5J1YA 4HDUA 4I01A 3KPHA 1T6SA 2KRCA 2LDUA 5FROA 1XCBA 2RVCA 3OYJA 2DA3A 4A3EJ 1W0UA 5LRRA 2VBYA 1KQ9A 4EGZA 2F5CA 2OC6A 3FWEA 2CQKA 2EZIA 3GFJA 5HODA 3H0DA 3OIOA 3U9GA 1TWGJ 2XAFA 2Q2EA 5HDNA 5DM6F 4ESFA 2QKLB 3GLXA 4YEJA 5ILUA 2GIVA 1LB2A 4AIJA 1BC7C 1NK2P 2MD0A 4D7NA 3BCAA 3WU2C 2OBPA 4ENNA 4WXDA 1OMIA 1X3ZB 2ZNZA 5LHGA 2M87A 1WI9A 4CYDA 2K9SA 2OV7A 5DDGA 3CUQA 3ZOBA 1SEUA 1K78A 2R93J 3S1QJ 2ZJRF 1S7AA 3DF8A 3JREA 2FRHA 4XKVA 2K4JA 3FK6A 1SFUA 4XLAA 1QHGA 5E20A
chains in the Genus database with same CATH topology
3HOVJ 3PO3J 1SFOJ 5IYBJ 1WH7A 2CJJA 2E19A 2CUEA 3BTLA 3BR5A 1X58A 2HQ5A 2ECCA 1MSFC 2K9QA 4B4CA 4X6AJ 1ETYA 3S2DJ 3HOZJ 3Q0VA 4XRSG 2XGDA 3IV5A 2R5YB 4A3LJ 2DMNA 3RQIA 2NS7A 1GV2A 2YUSA 5IP9J 1YRNB 3HOWJ 3BR3A 2WAQN 2DMQA 2QCOA 3I4NJ 2E2JJ 1JGGA 2LFBA 2LLKA 1WI3A 4D5CA 1JJ8C 1B72A 2ECBA 2XPUA 4FE7A 4ABZA 2IBDA 2ID3A 2DA5A 5GPCA 3HOUJ 4UUSA 4BY7J 5EGOB 3I4MJ 1Z77A 3D1NI 4IHXA 3CQZJ 1GUUA 1JUSA 3TP0A 4MIMA 1JT0A 1TWFJ 2DA1A 1R9TJ 2MW8A 4JX4A 2CQQA 1ETVA 2MGQA 1QPIA 1VNDA 3QQAA 2CQXA 4D5FA 1OFCX 5FKNA 1EF4A 1UG2A 2I10A 1GT0C 1GVDA 3M3YJ 4EEFG 1ENHA 2CU7A 3ZQHA 1MH3A 1IG7A 2XGEA 3WHBA 1AKHB 1QRYA 2LR8A 4MLOA 3LNQA 3QPLA 5J1RA 1B8IB 2JMWA 2B63J 3MKLA 3GTQJ 5F0HA 5K7ZA 3FK7A 4BY1J 1IJWC 2N8GA 4IHVA 2O9LA 1UHSA 4C3JJ 5K7FA 1CQTA 2O7OA 2DA2A 1MBJA 4A3GJ 2DN0A 1ETXA 1U9OA 4RBOA 4CYCA 4Y52J 5FKKA 2GLOA 4A3KJ 5IYCJ 1WCMJ 1XG1A 1Y1WJ 3S15J 2Y31A 1U8BA 1FTZA 4BBSJ 2R92J 2XRLA 3E7LA 1MNMC 1JUMA 3LSGA 3SJMA 3HDDA 4S0HB 1MH4A 4W1UA 1P7JA 3HEFA 3MVPA 1Z0XA 2EZLA 2X48A 5GP9A 2R5ZA 1MBGA 3LSRA 4AUXA 5IOZA 2YU9J 2LK2A 1POGA 1HLVA 2DMPA 4A3JJ 1G2HA 5E3MA 3PO2J 3W6VA 4DYQA 5K7HA 3G1OA 3G1LA 4W97A 2IAIA 1UMQA 2XGCA 4Y7NJ 3BTIA 5EF6A 1BA5A 1W0TA 3DCFA 3GBGA 3ZQFA 1LE8A 1QVUA 1LFBA 5FJ8J 5M5WJ 1VFCA 4XIDA 1XS9A 3GTJJ 5DTDA 1PUFA 1MBEA 2XSDC 3ZQGA 3JRCA 1DU6A 3IH2A 5E3NA 2OF7A 2Y9ZA 4C3HJ 3DEWA 5C44J 2R0QC 5DS9A 2HOAA 1ZTRA 2LP0A 1ZQ3P 3JRDA 5EG0A 3C2BA 2LD5A 5IOYA 2HDDA 2FX0A 5EZGA 4G12A 5BNGA 1LFUP 2Y9YA 3BG5A 3QPSA 2DA4A 3G1MA 3RZDJ 2WB1N 4C2MJ 1JKQC 1E3OC 2VKEA 4M3DA 3IH3A 2ME0A 3BR6A 4V2GA 3ZQIA 1IUFA 4I6ZA 3OSFA 4LOCA 1AHDP 4GFBA 4AYBN 2EBIA 2M34A 4IHYA 1IRZA 2PMZN 3RKQA 4IEJA 1ETKA 3Q3SA 4A93J 4BXXJ 2VKVA 2XB5A 1H8AC 1Q1VA 2DJNA 4C3IJ 1TWHJ 3HGGA 2DA6A 4B3AA 1HCRA 5F27A 1ETOA 3JRIA 2JJ7A 3FIWA 5J3LA 2CRGA 2KDZA 1HDDC 1A6IA 4QTRA 2R5YA 4XRMA 2ME6A 2JA7J 1YRNA 3WHCA 5IYDJ 1TWCJ 3GTPJ 5F1JA 2WV1A 2HOTA 4A3FJ 2NVXJ 2ELKA 2NS8A 3HOXJ 5FKLA 2W48A 5C4XJ 5FLMJ 2E2HJ 1HDPA 2LY9A 1RPWA 2JWTA 2JK3A 4D7MA 4JYKA 3OOUA 3Q0WA 1SANA 1JKPC 1ITYA 5C3EJ 2M2EA 2TCTA 2LKXA 2X6OA 3S1RJ 4MFEA 1H88C 1I6HJ 5EGOA 2HOSA 3FISA 4A3BJ 1WPKA 5JLXA 3A01B 3BG9A 1MBFA 4MFDA 4DYCA 1JJ6C 1MSEC 1WH5A 3VPRA 3JRFA 1NK3P 3H0GJ 2O8KA 4XICA 3LSPA 1IGNA 3BQZA 3BR0A 2DTZA 3A03A 2L7MP 3PM1A 2HYJA 4JP0A 3S17J 3HOYJ 3BTCA 1JT6A 3HB9A 5F08A 2P81A 2K9NA 2M9HA 4XRSA 3O8HA 1AKHA 1RKTA 2EQRA 1FIPA 1BL0A 5IPAA 2JA6J 2AHQA 2EH3A 4QIWN 5GPAA 1PUFB 3NARA 3OSGA 1B8IA 5F0FA 3HGYA 3M4OJ 1DU0A 1FTTA 4UUTA 1K61A 1ZR2A 3NAUA 1S7EA 2NVTJ 5E3LA 3S1NJ 2EZKA 1JTXA 3GTGJ 2AO9A 1VF9A 1OCPA 1BW6A 1F43A 3GTMJ 3B6AA 2XPWA 3JR9A 1FEXA 1JTYA 5EG0B 2COBA 2L7FP 3CDLA 1ETQA 3ZQLA 1B72B 1T33A 3JRAA 1F36A 3L1PA 2KT0A 4V2FA 2FJ1A 3LOCA 1RESA 2L9RA 4UUSB 3TW7A 2M8GX 5M5XJ 2VUMJ 1T56A 1XC5A 2HI3A 2RAEA 3B6CA 2MG4A 1FJLA 2H1KA 4DW6A 2VPRA 1IDZA 1X2MA 3CMYA 3GTOJ 3BT9A 5EDNA 3K7AJ 3BG3A 3S14J 4M6VA 2Y0SN 3ZQCA 4M3GA 5IP7J 2QF7A 5M3MJ 1ORKA 2FD5A 2YS9A 3IH4A 4M3BA 3S2HJ 3FKIJ 5J1UA 3S1MJ 5JLWA 3RZOJ 1RETA 1OCTC 2H8RA 3TP3A 4FCYA 4AC0A 4RDUA 2XB0X 2DA7A 4HNVA 4IHWA 1OJLA 2HXOA 2VI6A 3JRBA 5C4JJ 3HBLA 2E2IJ 2ZB9A 3JRGA 2ID6A 4X1EA 3TEDA 1BJZA 1IC8A 3F0CA 1RR7A 2Y2ZA 3LSJA 3H3VK 4DZJA 1WGXA 2M0CA 2NVYJ 3HKZN 4DYRA 4A3IJ 3UKGA 2FQ4A 1MBHA 2DMTA 4JX6A 4J19A 1IV6A 4A69C 5IP6A 5E3OA 2TRTA 4A3MJ 4CYCB 2JN6A 1JKRC 1HOMA 1A5JA 2GBYA 3BTJA 1X2NA 4DZPA 2CUFA 3CCYA 2K40A 2R7ZJ 2JA8J 1ZGWA 3SDGA 1TC3C 2MSYA 1TWAJ 2NOGA 3TW6A 3O8GA 1GDTA 2GM4A 1NTCA 1FIAA 1HF0A 3BR2A 2D5VA 1JUPA 5FKOA 2JA5J 4NDLA 2R5ZB 3K2AA 2L0KA 4BKXA 2E1OA 1ZK8A 3GTKJ 1MBKA 1U9NA 2DMUA 1P7IA 2XPVA 1QVTA 3JRHA 5F0CA 4FTHA 1JKOC 3Q0UA 1AU7A 4FE4A 4A3CJ 1Y1VJ 4A3DJ 1BW5A 4M3EA 2Y30A 4QSHA 1LE8B 4M3FA 2L7ZA 5F04A 5J1YA 5EYRA 1K83J 5FKMA 3GTLJ 1GV5A 1U78A 4FISA 4A3EJ 5FLVA 2DA3A 4JX5A 1W0UA 5EEAA 5EZHA 4I76A 5M3FJ 1H89C 4L5EA 3A02A 2X9DA 2EZIA 2OPTA 5HODA 3OIOA 1TWGJ 9ANTA 3A01A 1APLC 1I3QJ 1IDYA 1I50J 3BQYA 2NVQJ 4MO7A 1NK2P 4D7NA 2LTPA 1ZR4A 1ZKGA 4B1RA 3SFIA 2HXIA 2K9SA 3MN2A 3BR1A 1ETWA 3ZOBA 2IEKA 5M5YJ 2R93J 2EZHA 3S1QJ 2G0EA 1VI0A 1O4XA 1RKWA 3HM5A 3JREA 2LVSA 1D5YA 4XK4A 3S16J 3FK6A 4BBRJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV J;  3PO3 J;  1SFO J;  5IYB J;  1WH7 A;  2CJJ A;  2E19 A;  2CUE A;  3BTL A;  3BR5 A;  1X58 A;  2HQ5 A;  2ECC A;  1MSF C;  2K9Q A;  4B4C A;  4X6A J;  1ETY A;  3S2D J;  3HOZ J;  3Q0V A;  4XRS G;  2XGD A;  3IV5 A;  2R5Y B;  4A3L J;  2DMN A;  3RQI A;  2NS7 A;  1GV2 A;  2YUS A;  5IP9 J;  1YRN B;  3HOW J;  3BR3 A;  2WAQ N;  2DMQ A;  2QCO A;  3I4N J;  2E2J J;  1JGG A;  2LFB A;  2LLK A;  1WI3 A;  4D5C A;  1JJ8 C;  1B72 A;  2ECB A;  2XPU A;  4FE7 A;  4ABZ A;  2IBD A;  2ID3 A;  2DA5 A;  5GPC A;  3HOU J;  4UUS A;  4BY7 J;  5EGO B;  3I4M J;  1Z77 A;  3D1N I;  4IHX A;  3CQZ J;  1GUU A;  1JUS A;  3TP0 A;  4MIM A;  1JT0 A;  1TWF J;  2DA1 A;  1R9T J;  2MW8 A;  4JX4 A;  2CQQ A;  1ETV A;  2MGQ A;  1QPI A;  1VND A;  3QQA A;  2CQX A;  4D5F A;  1OFC X;  5FKN A;  1EF4 A;  1UG2 A;  2I10 A;  1GT0 C;  1GVD A;  3M3Y J;  4EEF G;  1ENH A;  2CU7 A;  3ZQH A;  1MH3 A;  1IG7 A;  2XGE A;  3WHB A;  1AKH B;  1QRY A;  2LR8 A;  4MLO A;  3LNQ A;  3QPL A;  5J1R A;  1B8I B;  2JMW A;  2B63 J;  3MKL A;  3GTQ J;  5F0H A;  5K7Z A;  3FK7 A;  4BY1 J;  1IJW C;  2N8G A;  4IHV A;  2O9L A;  1UHS A;  4C3J J;  5K7F A;  1CQT A;  2O7O A;  2DA2 A;  1MBJ A;  4A3G J;  2DN0 A;  1ETX A;  1U9O A;  4RBO A;  4CYC A;  4Y52 J;  5FKK A;  2GLO A;  4A3K J;  5IYC J;  1WCM J;  1XG1 A;  1Y1W J;  3S15 J;  2Y31 A;  1U8B A;  1FTZ A;  4BBS J;  2R92 J;  2XRL A;  3E7L A;  1MNM C;  1JUM A;  3LSG A;  3SJM A;  3HDD A;  4S0H B;  1MH4 A;  4W1U A;  1P7J A;  3HEF A;  3MVP A;  1Z0X A;  2EZL A;  2X48 A;  5GP9 A;  2R5Z A;  1MBG A;  3LSR A;  4AUX A;  5IOZ A;  2YU9 J;  2LK2 A;  1POG A;  1HLV A;  2DMP A;  4A3J J;  1G2H A;  5E3M A;  3PO2 J;  3W6V A;  4DYQ A;  5K7H A;  3G1O A;  3G1L A;  4W97 A;  2IAI A;  1UMQ A;  2XGC A;  4Y7N J;  3BTI A;  5EF6 A;  1BA5 A;  1W0T A;  3DCF A;  3GBG A;  3ZQF A;  1LE8 A;  1QVU A;  1LFB A;  5FJ8 J;  5M5W J;  1VFC A;  4XID A;  1XS9 A;  3GTJ J;  5DTD A;  1PUF A;  1MBE A;  2XSD C;  3ZQG A;  3JRC A;  1DU6 A;  3IH2 A;  5E3N A;  2OF7 A;  2Y9Z A;  4C3H J;  3DEW A;  5C44 J;  2R0Q C;  5DS9 A;  2HOA A;  1ZTR A;  2LP0 A;  1ZQ3 P;  3JRD A;  5EG0 A;  3C2B A;  2LD5 A;  5IOY A;  2HDD A;  2FX0 A;  5EZG A;  4G12 A;  5BNG A;  1LFU P;  2Y9Y A;  3BG5 A;  3QPS A;  2DA4 A;  3G1M A;  3RZD J;  2WB1 N;  4C2M J;  1JKQ C;  1E3O C;  2VKE A;  4M3D A;  3IH3 A;  2ME0 A;  3BR6 A;  4V2G A;  3ZQI A;  1IUF A;  4I6Z A;  3OSF A;  4LOC A;  1AHD P;  4GFB A;  4AYB N;  2EBI A;  2M34 A;  4IHY A;  1IRZ A;  2PMZ N;  3RKQ A;  4IEJ A;  1ETK A;  3Q3S A;  4A93 J;  4BXX J;  2VKV A;  2XB5 A;  1H8A C;  1Q1V A;  2DJN A;  4C3I J;  1TWH J;  3HGG A;  2DA6 A;  4B3A A;  1HCR A;  5F27 A;  1ETO A;  3JRI A;  2JJ7 A;  3FIW A;  5J3L A;  2CRG A;  2KDZ A;  1HDD C;  1A6I A;  4QTR A;  2R5Y A;  4XRM A;  2ME6 A;  2JA7 J;  1YRN A;  3WHC A;  5IYD J;  1TWC J;  3GTP J;  5F1J A;  2WV1 A;  2HOT A;  4A3F J;  2NVX J;  2ELK A;  2NS8 A;  3HOX J;  5FKL A;  2W48 A;  5C4X J;  5FLM J;  2E2H J;  1HDP A;  2LY9 A;  1RPW A;  2JWT A;  2JK3 A;  4D7M A;  4JYK A;  3OOU A;  3Q0W A;  1SAN A;  1JKP C;  1ITY A;  5C3E J;  2M2E A;  2TCT A;  2LKX A;  2X6O A;  3S1R J;  4MFE A;  1H88 C;  1I6H J;  5EGO A;  2HOS A;  3FIS A;  4A3B J;  1WPK A;  5JLX A;  3A01 B;  3BG9 A;  1MBF A;  4MFD A;  4DYC A;  1JJ6 C;  1MSE C;  1WH5 A;  3VPR A;  3JRF A;  1NK3 P;  3H0G J;  2O8K A;  4XIC A;  3LSP A;  1IGN A;  3BQZ A;  3BR0 A;  2DTZ A;  3A03 A;  2L7M P;  3PM1 A;  2HYJ A;  4JP0 A;  3S17 J;  3HOY J;  3BTC A;  1JT6 A;  3HB9 A;  5F08 A;  2P81 A;  2K9N A;  2M9H A;  4XRS A;  3O8H A;  1AKH A;  1RKT A;  2EQR A;  1FIP A;  1BL0 A;  5IPA A;  2JA6 J;  2AHQ A;  2EH3 A;  4QIW N;  5GPA A;  1PUF B;  3NAR A;  3OSG A;  1B8I A;  5F0F A;  3HGY A;  3M4O J;  1DU0 A;  1FTT A;  4UUT A;  1K61 A;  1ZR2 A;  3NAU A;  1S7E A;  2NVT J;  5E3L A;  3S1N J;  2EZK A;  1JTX A;  3GTG J;  2AO9 A;  1VF9 A;  1OCP A;  1BW6 A;  1F43 A;  3GTM J;  3B6A A;  2XPW A;  3JR9 A;  1FEX A;  1JTY A;  5EG0 B;  2COB A;  2L7F P;  3CDL A;  1ETQ A;  3ZQL A;  1B72 B;  1T33 A;  3JRA A;  1F36 A;  3L1P A;  2KT0 A;  4V2F A;  2FJ1 A;  3LOC A;  1RES A;  2L9R A;  4UUS B;  3TW7 A;  2M8G X;  5M5X J;  2VUM J;  1T56 A;  1XC5 A;  2HI3 A;  2RAE A;  3B6C A;  2MG4 A;  1FJL A;  2H1K A;  4DW6 A;  2VPR A;  1IDZ A;  1X2M A;  3CMY A;  3GTO J;  3BT9 A;  5EDN A;  3K7A J;  3BG3 A;  3S14 J;  4M6V A;  2Y0S N;  3ZQC A;  4M3G A;  5IP7 J;  2QF7 A;  5M3M J;  1ORK A;  2FD5 A;  2YS9 A;  3IH4 A;  4M3B A;  3S2H J;  3FKI J;  5J1U A;  3S1M J;  5JLW A;  3RZO J;  1RET A;  1OCT C;  2H8R A;  3TP3 A;  4FCY A;  4AC0 A;  4RDU A;  2XB0 X;  2DA7 A;  4HNV A;  4IHW A;  1OJL A;  2HXO A;  2VI6 A;  3JRB A;  5C4J J;  3HBL A;  2E2I J;  2ZB9 A;  3JRG A;  2ID6 A;  4X1E A;  3TED A;  1BJZ A;  1IC8 A;  3F0C A;  1RR7 A;  2Y2Z A;  3LSJ A;  3H3V K;  4DZJ A;  1WGX A;  2M0C A;  2NVY J;  3HKZ N;  4DYR A;  4A3I J;  3UKG A;  2FQ4 A;  1MBH A;  2DMT A;  4JX6 A;  4J19 A;  1IV6 A;  4A69 C;  5IP6 A;  5E3O A;  2TRT A;  4A3M J;  4CYC B;  2JN6 A;  1JKR C;  1HOM A;  1A5J A;  2GBY A;  3BTJ A;  1X2N A;  4DZP A;  2CUF A;  3CCY A;  2K40 A;  2R7Z J;  2JA8 J;  1ZGW A;  3SDG A;  1TC3 C;  2MSY A;  1TWA J;  2NOG A;  3TW6 A;  3O8G A;  1GDT A;  2GM4 A;  1NTC A;  1FIA A;  1HF0 A;  3BR2 A;  2D5V A;  1JUP A;  5FKO A;  2JA5 J;  4NDL A;  2R5Z B;  3K2A A;  2L0K A;  4BKX A;  2E1O A;  1ZK8 A;  3GTK J;  1MBK A;  1U9N A;  2DMU A;  1P7I A;  2XPV A;  1QVT A;  3JRH A;  5F0C A;  4FTH A;  1JKO C;  3Q0U A;  1AU7 A;  4FE4 A;  4A3C J;  1Y1V J;  4A3D J;  1BW5 A;  4M3E A;  2Y30 A;  4QSH A;  1LE8 B;  4M3F A;  2L7Z A;  5F04 A;  5J1Y A;  5EYR A;  1K83 J;  5FKM A;  3GTL J;  1GV5 A;  1U78 A;  4FIS A;  4A3E J;  5FLV A;  2DA3 A;  4JX5 A;  1W0U A;  5EEA A;  5EZH A;  4I76 A;  5M3F J;  1H89 C;  4L5E A;  3A02 A;  2X9D A;  2EZI A;  2OPT A;  5HOD A;  3OIO A;  1TWG J;  9ANT A;  3A01 A;  1APL C;  1I3Q J;  1IDY A;  1I50 J;  3BQY A;  2NVQ J;  4MO7 A;  1NK2 P;  4D7N A;  2LTP A;  1ZR4 A;  1ZKG A;  4B1R A;  3SFI A;  2HXI A;  2K9S A;  3MN2 A;  3BR1 A;  1ETW A;  3ZOB A;  2IEK A;  5M5Y J;  2R93 J;  2EZH A;  3S1Q J;  2G0E A;  1VI0 A;  1O4X A;  1RKW A;  3HM5 A;  3JRE A;  2LVS A;  1D5Y A;  4XK4 A;  3S16 J;  3FK6 A;  4BBR J; 
#chains in the Genus database with same CATH topology
 3I58 A;  4CA0 A;  2XIG A;  3M1C A;  3S93 A;  2LH9 A;  4RA2 A;  2A5W A;  1XMK A;  1IN4 A;  2ECC A;  1FBU A;  2NNN A;  4ETS A;  4CCN A;  2RQQ A;  1TNS A;  1O7L A;  3DBR B;  3RKX A;  1MJ9 A;  1SD7 A;  2XGD A;  4OIN F;  1VQ6 I;  4ENM A;  1P4A A;  1WJD A;  1GV2 A;  5IP9 J;  4A2U A;  5BOX A;  3TOB A;  4ZTF A;  2QZ8 A;  3I4N J;  3GLL A;  2PMH A;  4D5C A;  1B72 A;  1WZ2 A;  2V1U A;  1WQ2 A;  1YLF A;  2DA5 A;  5GPC A;  5E79 C;  3G4S I;  3HOU J;  2OQR A;  1VQO I;  2K86 A;  4UUS A;  4LIT A;  4AD9 A;  2FXA A;  2W25 A;  2L01 A;  2CQN A;  3GWZ A;  3TP0 A;  4CCO A;  4HDV A;  1QU3 A;  1O3Q A;  2Y75 A;  1RUO A;  4G7H F;  3K4B A;  1ETV A;  2CMP A;  4EGY A;  1V3F A;  3CF2 A;  5D5W B;  1BIB A;  3KCC A;  3FXL A;  1EF4 A;  1LKX A;  2D1H A;  5LGU A;  1GVD A;  3TBI A;  4BXF A;  1IG7 A;  4BAC A;  1LEA A;  1DGR M;  3J81 K;  2PJR A;  1AKH B;  4EVI A;  1QRY A;  2RV8 A;  3HKZ A;  3I5U A;  1YJW I;  3U1D A;  3BRO A;  3ZCO A;  4AVP A;  3FM3 A;  2WAE A;  5KNL A;  2H8W A;  3LNQ A;  3QPL A;  5J1R A;  1MJA A;  1TLH B;  2JMW A;  2VBW A;  3I59 A;  5F0H A;  3LSH A;  4PUS A;  5LFA A;  4UVA A;  2H6C A;  2XUB A;  1GXP A;  1UHS A;  3C3W A;  1DUX C;  2Z2S B;  1MDM A;  3LSM A;  3IWZ A;  1WRJ A;  2UV1 A;  1Y8R B;  3H36 A;  3FXM A;  4Z2Y A;  4RBO A;  1B59 A;  4HF1 A;  2M30 A;  3PNT A;  3DFG A;  4NUB A;  1R71 A;  1EH8 A;  2GAU A;  3PQK A;  1XG1 A;  3S15 J;  1XGS A;  1U8B A;  4KIB A;  2K3F A;  4BBS J;  2XRL A;  3E7L A;  1MNM C;  3LSG A;  1BN5 A;  4GGG A;  3CCQ I;  2PG4 A;  2R7D A;  4IRG A;  3OS0 A;  3ASN H;  3SZP A;  3KX2 A;  4W1U A;  1H0M A;  1ERD A;  3H5N A;  1KQ8 A;  1UB9 A;  2HDC A;  1EKE A;  1ZEL A;  4R79 A;  2VC1 A;  5DYM A;  1Z0X A;  2EFN A;  4HNU A;  2X48 A;  3OMY A;  1UAA A;  4XBF A;  1MBG A;  3SQN A;  5E1W A;  3U1K A;  5DD8 A;  3PIP F;  3RI4 A;  5L3F A;  4FET A;  2XRO A;  2DMP A;  4PJN A;  3R61 A;  2JVG A;  3OOP A;  4A3J J;  1G2H A;  5E3M A;  3PO2 J;  1IAW A;  3G1O A;  4W97 A;  1ZAO A;  2IAI A;  2MD5 A;  4WF2 A;  4BEH B;  3CJQ B;  1MMS A;  3W2A A;  2R7T A;  2RNJ A;  1P4W A;  3E3V A;  1W0T A;  3I0T A;  1F5T A;  1VQ5 I;  4WCG A;  4LGW A;  3DPT A;  3ZQF A;  2IVM A;  1LFB A;  2DYS H;  3E6B A;  5FJ8 J;  3JAM K;  5M5W J;  5EEH A;  1VFC A;  1X19 A;  4HQM A;  3QWL A;  2UXX A;  4XID A;  1MMG A;  1XS9 A;  1PUF A;  3D5S C;  3OYA A;  1LDK B;  2E5N A;  2KJC A;  4KT5 C;  4L5J A;  2XSD C;  4LIV A;  2IA1 A;  2BYV E;  3WTY C;  2HYF A;  2IJL A;  3EYY A;  1MIJ A;  1BR2 A;  3I54 A;  3SZG A;  1MD0 A;  3GF2 A;  5C44 J;  2DU9 A;  2HOA A;  5LGN A;  1ZTR A;  4XMY A;  2DT5 A;  2LP0 A;  1ZQ3 P;  4HBL A;  3JRD A;  2JUG A;  3IC7 A;  1R36 A;  1KA8 A;  2YR2 A;  2EIJ H;  4BS9 A;  2FX0 A;  4E7K A;  1NH3 A;  1MW7 A;  4G12 A;  1DP7 P;  2PFB A;  2X4H A;  2HOE A;  3RIR A;  4IRI A;  3F8F A;  3HZJ A;  3QPT A;  2A69 F;  2DK5 A;  3FXQ A;  3N4M A;  1MJB A;  2WB1 N;  4C2M J;  1JKQ C;  1PUE E;  2DOA A;  1OYW A;  1W7P B;  5B66 C;  1XMX A;  2CS3 A;  3N05 A;  1KU3 A;  4M9X A;  4I6Z A;  4IKF A;  1Z9C A;  2DCE A;  1AHD P;  3ECH A;  3L7W A;  1X3U A;  4L0Z B;  1XGM A;  4IHY A;  5F64 A;  2BOL A;  4RAF A;  3ZP5 A;  3RKY A;  2PMZ N;  2W00 A;  4IEJ A;  3HTS B;  1J5Y A;  2XHK A;  3BPV A;  3OYL A;  4A93 J;  1J09 A;  2XF6 A;  4BXX J;  3QYB A;  2VKV A;  3AKZ A;  2XB5 A;  4WWC A;  1Q1V A;  4C3I J;  1KON A;  2KMU A;  1TWH J;  2MA3 A;  2CSO A;  1JGS A;  4EJT A;  4B3A A;  1BOA A;  1U5T C;  2EFQ A;  1YG2 A;  2CRG A;  4QTR A;  2R5Y A;  2E1C A;  2ME6 A;  3V42 A;  2DAO A;  4HRI A;  5IYD J;  2EIL H;  2VJ5 A;  2VQC A;  2BGC A;  5F1J A;  2LBF B;  2DXI A;  1XSX A;  2NS8 A;  3K69 A;  3TQN A;  5FKL A;  5C4X J;  1CF7 B;  1DPU A;  1HDP A;  3A0B C;  5AIP A;  1RI7 A;  3I4P A;  1RPW A;  4U7B A;  5ICC A;  4B44 A;  3FX3 A;  4JYK A;  1JKP C;  4N0B A;  1L3L A;  2QA4 I;  1HXD A;  4KJZ A;  2M2E A;  4L9T A;  2X6O A;  4MFE A;  2HOS A;  2H09 A;  4ESJ A;  3UR3 C;  4BHC A;  5HLG A;  1B6A A;  1TQM A;  1FP1 D;  1I6X A;  3VPR A;  3JRF A;  3WTT C;  5CPR B;  4XIC A;  5LEK A;  2ADU A;  2FF4 A;  4O3M A;  4M9Z A;  1J9I A;  1S9H A;  4FHT A;  2E1N A;  4JP0 A;  1WJB A;  3BTC A;  1K6Y A;  4RB0 A;  3JSP A;  3WOD F;  2HFH A;  5JFR A;  4FX0 A;  1FIP A;  2Q8K A;  1TTY A;  2BBY A;  3T5X A;  4CCL A;  5IPA A;  3L00 A;  1QNT A;  2H6B A;  3K2Z A;  5HLI A;  3OSG A;  5D6E A;  3HGY A;  1ZR2 A;  3BZ6 A;  2X1C A;  2ZFU A;  5IT9 K;  3NAU A;  2GXG A;  3LAP A;  5E3L A;  1WKM A;  1JTX A;  1JXS A;  1R4N B;  4Y15 A;  5D6F A;  3GZ6 A;  3GTG J;  2A05 A;  2VXZ A;  3V4G A;  1BW6 A;  1XB4 A;  1F43 A;  2ZME B;  4BJ6 C;  3LA3 A;  4IXA A;  4MQ9 F;  3H35 A;  2OZU A;  3G3Z A;  2F4I A;  5L3G A;  5LGT A;  2BEO A;  4FT8 A;  4PGG A;  5HS8 A;  3I56 I;  5FFX A;  2XAQ A;  4XSZ F;  4YFK F;  4HQE A;  1R23 A;  5DCM B;  3M7G A;  2R7X A;  4EJV A;  4DW6 A;  1SFX A;  2VPR A;  4MNU A;  4RB2 C;  1MMA A;  2QVO A;  3QOD A;  2ZNY A;  3VYT B;  3REO A;  5EDN A;  3K7A J;  1V4R A;  3ABL H;  1HBX G;  3S14 J;  1Z3X A;  4G6Q A;  4M3G A;  1WJA A;  4JOM A;  3VYU B;  5CVI A;  2M4G A;  4S04 A;  3EPZ A;  2K02 A;  3IH4 A;  1K4T A;  2OTJ I;  5TGT A;  1FBS A;  4UHT A;  4PK4 A;  1HST A;  3FKI J;  2V4J C;  4GO1 A;  3ZQQ A;  4AVZ A;  2VT2 A;  3KEO A;  3ABT A;  3K70 D;  3AAF A;  4DOZ A;  1VQ9 I;  4FCY A;  4RDU A;  1N25 A;  2EPF A;  1UCR A;  1MMD A;  3ONQ A;  1STZ A;  1FYL A;  1RUN A;  1H9G A;  3B02 A;  4P9U A;  3ZMS A;  2IS1 A;  5C4J J;  1QZY A;  3H3Z A;  3SHF A;  3KE2 A;  1TT0 A;  4X1E A;  1ZRF A;  1BJZ A;  1S3J A;  1IC8 A;  1ON2 A;  2HKX A;  3H3U A;  3H3V K;  2DFI A;  4DZJ A;  2QLZ A;  3KP3 A;  4NQW A;  5BMZ A;  2WB1 A;  4A3I J;  1E0E A;  2FQ4 A;  2ZXW H;  3LL7 A;  3NRV A;  4AIK A;  4A69 C;  3J7A Y;  3GFL A;  3GZN B;  3K1M A;  3GW2 A;  2ESH A;  2GOM A;  3P9C A;  3J7Z I;  1A5J A;  4CCK A;  4ZDL A;  3CCR I;  4IZZ A;  1R4M B;  5ICG A;  2DPU A;  1YIT I;  1VTN C;  1X1A A;  4L0Y B;  2QEX I;  3KP6 A;  3COA C;  2R7Z J;  1XTA A;  2FNP A;  1HSJ A;  3DKY A;  3LFK A;  3CC4 I;  4GRI A;  3K6G A;  1RIO H;  2HEO A;  2P5K A;  1NTC A;  1FIA A;  2VJJ A;  3KZY A;  4ZYH A;  2OAZ A;  4KIG A;  2A5Y B;  2R5Z B;  4P1W A;  1MBK A;  2CGP A;  1U9N A;  1QA6 A;  2Y69 H;  4HF0 A;  1P7I A;  1WJC A;  2HQA A;  4Y4R A;  3S3M A;  1FPQ A;  2CYY A;  3BPX A;  1FP2 A;  2UXN A;  3WTW C;  1XD7 A;  1AU7 A;  4FE4 A;  3VB2 A;  2LRE A;  1AOY A;  2JA2 A;  1GLN A;  4M3E A;  2Y30 A;  5A2Q Z;  1LE8 B;  1XCV A;  4M3F A;  3RKW A;  1YFH A;  2QSG X;  3QAH A;  3ZMZ A;  4A5N A;  5EYR A;  1K83 J;  4YFN F;  3OYF A;  2QQ8 A;  1GV5 A;  1W5S A;  3K4K A;  1U78 A;  4FIS A;  1TQP A;  1R1V A;  3GVA A;  2PQ8 A;  1HA8 A;  4PJM A;  4L5E A;  2ZJP F;  3I53 A;  2RC4 A;  3LWF A;  5BPD A;  2ELJ A;  3H9Q A;  2OPT A;  2P7V B;  2IRF G;  1B1B A;  1U8R A;  2BW3 B;  4RGU A;  1FZP B;  2Z33 A;  4XLN F;  3R0J A;  3HSE A;  2HU9 A;  4UV8 A;  2YPR A;  4CZZ A;  2NVQ J;  5KK1 A;  3DEU A;  4OIO F;  4MO7 A;  5E8G A;  3SFZ A;  5HOO A;  4F93 B;  5LHH A;  1Z67 A;  4D1Q A;  2LTP A;  3H1C A;  1ZR4 A;  4B1R A;  2R3S A;  2HXI A;  2FBI A;  4C2T A;  1R58 A;  1A04 A;  2IEK A;  4XOT A;  2KRF A;  3KP7 A;  1IXS B;  2F5E A;  5M5Y J;  3V8L A;  2FQ3 A;  2XF5 A;  5K5R A;  1VI0 A;  4E6K G;  1O4X A;  1N77 A;  3HM5 A;  5ICE A;  4L18 B;  2W85 A;  4XK4 A;  5B3S H;  4FAS D;  3A1Y A;  4BBR J;  3HOV J;  5IYB J;  3HPH A;  2E19 A;  3BTL A;  4LLL A;  3CJT B;  3AG3 H;  1BBY A;  1X58 A;  2BY1 A;  2ZBK A;  2HQ5 A;  4B4C A;  4G94 A;  4LG0 A;  3DPL C;  3HOZ J;  2STW A;  1T0F A;  2XAG A;  4XRS G;  3WTU C;  2VJI A;  4A3L J;  1U6G A;  5D4R A;  1YRN B;  1J7K A;  3HOW J;  3KFW X;  1FSE A;  4KUM A;  1ZG1 A;  4YIF A;  2DMQ A;  3HYI A;  3FMR A;  3GME A;  1UST A;  2TDX A;  5DEQ A;  3SYT A;  2LFB A;  1JJ8 C;  2WY8 Q;  3ZRG A;  2KL4 A;  1D8K A;  1UJ8 A;  2D2W A;  4HG2 A;  1IN5 A;  1XSV A;  2K4B A;  4KN4 X;  1T08 B;  4V19 K;  3AL0 C;  1L0O C;  5JVT A;  2IBD A;  2ETH A;  2ID3 A;  2W7N A;  3L09 A;  2FOK A;  4BY7 J;  3VYR B;  3ELK A;  1TBX A;  5EGO B;  3I4M J;  1O57 A;  1Y0N A;  4RAG A;  4IHX A;  1JUS A;  1JE8 A;  3WGG A;  2W1O A;  1R9T J;  2MW8 A;  4JX4 A;  1VND A;  4L9V A;  3BY6 A;  4MTE A;  3DPU A;  3R4K A;  2DT7 B;  2EIK H;  3H5R A;  3QQA A;  1LVK A;  2CQX A;  3ML6 A;  4D5F A;  1OFC X;  5FKN A;  1FWZ A;  2I10 A;  4IQ4 A;  1R5G A;  2F48 A;  4BHP A;  3M3Y J;  2F5V A;  4EEF G;  3OYD A;  3V8J A;  4YFX F;  3ZQH A;  2NYX A;  4C9Y A;  1J0R A;  4XSX F;  3WHB A;  3TDU C;  5BQT A;  4G6D A;  3NWS A;  1U5T B;  3U2R A;  2NAZ A;  5CLS A;  2BXY A;  3G71 I;  1BI1 A;  5D4S A;  5CJ9 A;  4ANJ A;  2B63 J;  2B0L A;  4NC7 A;  3MKL A;  3GTQ J;  1XDS A;  3FK7 A;  2DI3 A;  4IHV A;  2N8G A;  3HUG B;  2O8X A;  4I0B A;  2FU4 A;  4CIC A;  3OYG A;  4XN0 A;  2VKH A;  3PQJ A;  2CUJ A;  5H6Q A;  3O2P E;  1VQ7 I;  1ACI A;  2EV0 A;  4UY8 I;  3DBL B;  4ENK A;  2V26 A;  4CYC A;  3HC7 A;  2FE3 A;  3DV8 A;  3CO7 C;  1OPC A;  2BVL A;  4RAZ A;  1RC9 A;  5FLX Z;  3BDD A;  4XR6 A;  1LJ9 A;  2VE9 A;  2HWV A;  5K5Q A;  3M8E A;  2OD5 A;  2FBH A;  3C1D A;  2EJR A;  3DP7 A;  2M7B A;  3QOP A;  4RGS A;  4B48 A;  1BI3 A;  4S0H B;  2LG4 A;  3QU6 A;  2XF7 A;  1NG6 A;  4BQA A;  3DTK A;  2EZL A;  5GP9 A;  2GOX B;  4E7L A;  3GXO A;  5JR3 A;  3LSR A;  1FMV A;  3KP2 A;  4AUX A;  5IOZ A;  4LB5 A;  2LK2 A;  1WSU A;  1FLI A;  1POG A;  1HLV A;  2VPL A;  1X1B A;  3ZGK A;  1YW8 A;  4N9I A;  4QLC U;  1YO5 C;  1EV7 A;  2H1L A;  2IT0 A;  3C2G A;  4BE1 A;  1A31 A;  3W6J B;  3CCE I;  2WA0 A;  4G8X A;  2XGC A;  2CV1 A;  1BA5 A;  4HLX A;  3DCF A;  3OR2 C;  1QVU A;  3MEX A;  2RDP A;  3QPH A;  2JSC A;  2X0L A;  3MAJ A;  4RLQ A;  5DTD A;  3GTJ J;  2UWM A;  3OIQ A;  3CCU I;  3GO5 A;  3HRS A;  4BGD A;  1R49 A;  1DU6 A;  2GXB A;  2P6T A;  2OZ6 A;  4JBA A;  5FD5 A;  1ULY A;  5E3N A;  3H92 A;  2AQE A;  3K4J A;  2ZCW A;  1J75 A;  2Y9Z A;  4DQ2 A;  3GFI A;  2XAU A;  3DEW A;  3CCJ I;  5FRM A;  3R0A A;  5DS9 A;  4CDG A;  2CFX A;  2HQN A;  1VQP I;  4GXO A;  1WFX A;  3T1B A;  4ZDO A;  2EIM H;  4KIT B;  3C2B A;  5EG0 A;  3OS1 A;  1PVE A;  1DDN A;  1BOB A;  2W82 A;  4S05 A;  3BJA A;  3VWB A;  1KU7 A;  3J80 Z;  4QPQ A;  2M1B A;  4U0Y A;  1RRJ A;  2R7F A;  3WG9 A;  3MKW B;  2ISY A;  3QPS A;  4PSW A;  1OR7 A;  3PL8 A;  2ZO4 A;  4ZYA A;  3IWF A;  1MZB A;  3LAJ A;  2IPQ X;  5D5X B;  3HOS A;  3RPU D;  2ZFW A;  4P96 A;  2ICW G;  3BR6 A;  4QPO A;  4V2G A;  4IJA A;  4PJL A;  4A5M A;  2AQF A;  2EBI A;  4AYB N;  2ZJQ F;  2L4A A;  2GWR A;  4XNF A;  2VOD A;  1ETK A;  2H27 A;  1D5V A;  3PUF A;  4II3 A;  5DD4 A;  3QOE A;  4LFU A;  2DJN A;  3CMM A;  3HGG A;  2DA6 A;  2VB6 A;  2CUZ A;  1HKS A;  1HCR A;  4M71 A;  3FIW A;  2BY0 A;  2KDZ A;  2QSF X;  4P9F A;  4E7I A;  1E3P A;  2K9L A;  1TWC J;  3S3O A;  3VEP A;  1ZLK A;  3GTP J;  4I2O A;  5FO5 A;  1NG7 A;  4LG3 A;  1P92 A;  4OIR F;  1I39 A;  4YEL A;  3WU0 A;  5J8F A;  3K4C A;  1PDN C;  3LFU A;  1D0X A;  5E17 F;  2LY9 A;  2EA4 A;  1G4D A;  4EMS A;  3P5J A;  2R4G A;  5B5E C;  4D7M A;  2MH9 A;  3DKX A;  2F6C A;  1LFP A;  1ITY A;  3RPU A;  4IL6 C;  4G6T B;  2TCT A;  1YQA A;  2LKX A;  1QBJ A;  4A3B J;  3CUO A;  3A01 B;  3ZPL A;  3MFK A;  3TMO A;  5DM7 F;  2MFZ A;  4KMU X;  3LSI A;  3H0G J;  2WAD A;  1IN8 A;  2QYO A;  2FSW A;  3NWT A;  3H9G A;  3DWL E;  3A03 A;  5HS9 A;  2L7M P;  4HLY A;  3GX4 X;  2HYJ A;  2VBZ A;  5E8I A;  2QBY B;  3HOY J;  1JT6 A;  3HB9 A;  2LOO A;  3SDB A;  4EM0 B;  4PSX A;  1AKH A;  1EJ9 A;  1RKT A;  5FD6 A;  1BL0 A;  1SMT A;  4UV9 A;  3X2Q H;  4HX7 A;  4HEA 2;  4XLC A;  1PUF B;  3NAR A;  1XN7 A;  5BS6 A;  3M4O J;  2FNA A;  1DU0 A;  1K61 A;  3A0H C;  5E1X A;  4G7O F;  4CUG A;  2VC0 A;  3KLO A;  1XGN A;  2WBM A;  1K7A A;  4FX4 A;  1OCP A;  3B6A A;  4O5V A;  2XPW A;  2K7L A;  4LK0 F;  3BJO A;  2M45 A;  1TL8 A;  4JK1 X;  1LPQ A;  1REP C;  1FEX A;  4B43 A;  4HNT A;  2QQA A;  5LBQ A;  2ZSI B;  1QHH D;  2COB A;  1SMY F;  2HKO A;  2L7F P;  2W84 A;  4P5O A;  4E70 A;  3L2C A;  2M3A A;  3ZQL A;  3JRA A;  3L1P A;  5ILV A;  2RRE A;  3JTG A;  4I98 B;  1TP4 A;  1RES A;  3W3C A;  4RMN A;  5M5X J;  3PSI A;  2VUM J;  1XC5 A;  3B6C A;  1FOX A;  1X3W B;  1IDZ A;  3IRR A;  4G9Y A;  3FXK A;  4MEY F;  2O6G E;  3BT9 A;  2GQQ A;  2A6T A;  3JAM Z;  1ZG5 A;  4M6V A;  1Z6T A;  2HYG D;  2DDA A;  1TNT A;  4XON A;  2QF7 A;  1GHC A;  2FD5 A;  2L9V A;  2Z5U A;  2F5F A;  3HRT A;  2QUF A;  4XKC A;  2NRA C;  1R6R A;  5JHF A;  2WWY A;  2P5L C;  3ESW B;  3M8F A;  1QQI A;  4BEH A;  3E1S A;  3RZO J;  3FBI B;  3HL2 A;  4NNJ A;  4I7H A;  2M8E A;  1OCT C;  1FOY A;  3TP3 A;  3EUH A;  5CYV A;  2XB0 X;  3FDY A;  2DA7 A;  3F8C A;  3LQQ A;  2ZSH B;  3ULQ B;  4LK1 F;  1OJL A;  2HXO A;  4RLF A;  3JRB A;  2DK8 A;  3IKT A;  2Y0S A;  5GTH C;  3TED A;  1WVR A;  3F0C A;  1RR7 A;  2JQ7 A;  1SVM A;  3ROU A;  2KZV A;  2NVY J;  3AL0 B;  3CD6 I;  3OYM A;  4DYR A;  3ECO A;  3UKG A;  1IV6 A;  1ZRE A;  4J19 A;  2YX4 A;  5IP6 A;  2VQG A;  4KN7 X;  1DQU A;  2F4O B;  5E3O A;  4A3M J;  3IKV A;  4CCJ A;  1JKR C;  4AYB A;  4F3Q A;  5J4V A;  2P5V A;  1D8J A;  3IAM 2;  4LD5 A;  3GCM A;  3I71 A;  2E1M B;  4M9S A;  4IO9 F;  2FUG 2;  4IQJ A;  2X51 A;  3LA2 A;  3CCY A;  2DOF A;  1E3H A;  3PNY A;  3CCM I;  4OAZ A;  4ZZD A;  1ZGW A;  1VQN I;  3WU1 B;  4XLE A;  2WC2 A;  1W7P A;  2LMD A;  4R1H A;  3SDG A;  4L9J A;  2MSY A;  3KYL A;  1GDT A;  2FBK A;  4E7S A;  3OYC A;  1ZGJ A;  3BR2 A;  3GYH X;  3EDP A;  3CUQ C;  2VKD A;  4BKX A;  3P9I A;  4YRV A;  3GTK J;  3D5L A;  3J7Y J;  4X0G A;  2XPV A;  1T2K A;  2JSP A;  1YOV B;  5L3C A;  4Q48 A;  4UB8 C;  1D1A A;  4HX4 A;  1IZ1 A;  2LBF A;  1Y1V J;  1VQM I;  2CW7 A;  2VOO A;  1T8I A;  4WK8 F;  3MZH A;  5KCM A;  1DPR A;  4B3X A;  4NC6 A;  1CF7 A;  3BZK A;  1WHU A;  3NQO A;  2L54 A;  4JX5 A;  5KVR A;  3RTR A;  4BDY A;  5EEA A;  4KIS A;  3ABK H;  1IXR C;  1IXC A;  2CQ7 A;  3A02 A;  2RNG A;  2X9D A;  1MKM A;  1LDD A;  1G6N A;  3Q5F A;  1Z6R A;  1I1S A;  3H9J A;  5KAI C;  3CLQ A;  2ZJ2 A;  1G59 A;  3QYE A;  1APL C;  1EA3 A;  1I3Q J;  3IAS 2;  2BZT A;  2QQ9 A;  1QPM A;  2IGN A;  4BUP A;  1O3S A;  2LRD A;  3F21 A;  3L2V A;  3DLL F;  4BU2 A;  4OIP F;  4N4O B;  5KAF C;  2QQB A;  2IP2 A;  2KIF A;  4BQN A;  5DUI A;  2OCE A;  4ZYE A;  4H0E A;  2EK5 A;  3MN2 A;  4M6Y A;  1ETW A;  5HVQ C;  2YU3 A;  4CO8 A;  2EZH A;  4PDK A;  2G0E A;  1RKW A;  3WGH A;  4A6E A;  3HPG A;  2C6Y A;  2JT1 A;  2L4M A;  3DU5 A;  5H2F C;  2M0M A;  4ZYD A;  4RM3 A;  2DFH A;  1D5Y A;  4AM3 A;  4AU7 A;  3PO3 J;  1SFO J;  2CJJ A;  2CUE A;  4U7D A;  3ZQ7 A;  4BQO A;  4F92 B;  4I99 C;  2K9M A;  1MSF C;  2K9Q A;  1ETY A;  1YW7 A;  2CO5 A;  4OOI A;  2UUZ A;  3S2D J;  4A0X A;  1OLT A;  3DXJ F;  3Q0V A;  1AA7 A;  3G73 A;  5K1Y A;  2Y48 A;  2ZME A;  3IV5 A;  4UUV A;  1BR4 A;  2DMN A;  4NBQ A;  3RQI A;  2NS7 A;  1LQ1 A;  4CXF A;  2R7O A;  1WWX A;  3DU6 A;  3BR3 A;  1NHA A;  3DTE A;  2O61 A;  1GVJ A;  1Y8Q B;  2O5R A;  2E2J J;  1JGG A;  2LLK A;  1WI3 A;  3F72 A;  3J7A O;  2ECB A;  4B8X A;  4OMY A;  1TW2 A;  4FE7 A;  1YE9 A;  4ABZ A;  1DP3 A;  2YSR A;  2HTJ A;  2P0W A;  1FYM A;  1H9T A;  3T0Y A;  2DYR H;  1YX3 A;  5DCM A;  1S8N A;  2DLL A;  3MCZ A;  1Z77 A;  3D1N I;  4IOA F;  2BXZ A;  1Y0U A;  1D1B A;  3CQZ J;  4O6J A;  1GUU A;  4MIM A;  2K5C A;  5HDK A;  1YJN I;  2DA1 A;  2PMU A;  3PFI A;  1KQ0 A;  2BY2 A;  2WAQ A;  1MNE A;  4KFC A;  4Y3O A;  2MBF A;  1QPI A;  4CGZ A;  2V1N A;  3SEQ A;  1Z05 A;  2O0Y A;  2QKM B;  1TT5 B;  2X1E A;  2ACJ A;  4HZF A;  1OYY A;  2MH2 A;  4MEX F;  1UG2 A;  3F6O A;  1ENH A;  1SFK A;  2JTV A;  2Z3Y A;  3HJE A;  3MZY A;  2VXD A;  4PJJ A;  1WJF A;  2CFO A;  1YTY A;  2LR8 A;  4KIF A;  3WE3 A;  3I3L A;  4MLO A;  1HC8 A;  5LRS A;  1B8I B;  4XRF A;  1Y56 A;  5HDG A;  1U3E M;  3EET A;  1P6R A;  5K7Z A;  2E7W A;  5J8C A;  4RB3 C;  5HS7 A;  1YX5 A;  1IJW C;  2KJB A;  5AON A;  2O9L A;  5TIS C;  4C3J J;  5K7F A;  3CJR B;  2FEZ A;  4IHT A;  4IHS A;  1CQT A;  4XKB A;  3F3X A;  3FF5 A;  1S72 I;  2H94 A;  5FB2 A;  2DN0 A;  1ETX A;  4ZH4 F;  4A12 A;  4Y52 J;  3BOQ A;  5IY5 H;  3KYD B;  3F9K A;  3I55 I;  2HZT A;  4A3K J;  3CC7 I;  5E18 F;  5IYC J;  1WCM J;  1Y1W J;  3JCU C;  2Y31 A;  2EIN H;  2ZXH A;  4BJ5 C;  3E5X A;  5ERI A;  3HRU A;  1T98 A;  1YW9 A;  2YX7 A;  3F8B A;  5DUK A;  1D3Y A;  3SJM A;  2A07 F;  5D8L B;  2L9S A;  1IN6 A;  1SD5 A;  3GFM A;  3V7R A;  1P7J A;  3HEF A;  3MVP A;  3RCO A;  2WTE A;  5LEJ A;  4ASN A;  2HTS A;  2DOD A;  1A35 A;  2R5Z A;  3FKJ A;  5GAH J;  2YU9 J;  2DFE A;  2EB7 A;  3WG7 H;  1G8X A;  4RB1 A;  4I09 A;  5DCF A;  2A6H F;  5K7H A;  3EUH C;  3G1L A;  2M7A A;  2IS2 A;  2BVM A;  2G7U A;  2KRH A;  5EF6 A;  5ED4 A;  3M8J A;  2K3P A;  3CCV I;  1K4S A;  1LE8 A;  2R7S A;  5GAE J;  2NS0 A;  3ISP A;  4TV7 A;  1VQL I;  2XC7 A;  3QYF A;  3S2W A;  4BHB A;  4Q47 A;  2JPB A;  4A0Y A;  5CVJ A;  3JRC A;  3ZQG A;  3LSK A;  1IN7 A;  3IH2 A;  3G2B A;  3KP4 A;  2P4W A;  2OF7 A;  3S3N A;  1S6L A;  2HDW A;  2BW3 A;  1OCO H;  4E7H A;  3I64 A;  2VE8 A;  2R0Q C;  2WV0 A;  4ZJZ A;  3ZN0 A;  2NOJ B;  3OWT A;  2LD5 A;  3VDX A;  4YIR X;  1FMW A;  5EZG A;  2Z1D A;  5JI6 A;  2XKP A;  1LFU P;  1OQY A;  2Y9Y A;  1V5F A;  3MD2 A;  2Z16 A;  2DA4 A;  3AG2 H;  3CO6 C;  4H4K C;  4BH9 A;  3RZD J;  2X85 A;  1WJE A;  1LDJ A;  3TDZ C;  1BM9 A;  1OIS A;  2MC4 A;  2ME0 A;  1ZGA A;  4GFB A;  4KDP A;  2M34 A;  1UEL B;  3BWG A;  1M1E B;  3P7N A;  2R7U A;  2RQP A;  3RKQ A;  1G3S A;  2VIX A;  3Q3S A;  2F5D A;  4GDF A;  1W5C C;  2CV0 A;  4CH7 A;  1Y39 A;  1H8A C;  2GA2 A;  3D5R C;  4BYY A;  5F27 A;  1ETO A;  2JJ7 A;  5J3L A;  3T8T A;  1HDD C;  2VAS A;  4PJ0 C;  3F8N A;  4XRM A;  2LY2 A;  3F6V A;  3MKZ A;  2JA7 J;  2E36 A;  1YRN A;  2IGO A;  4LB6 B;  2WV1 A;  1KU2 A;  1D0Z A;  2D1V A;  2E34 A;  3R6S A;  1JHH A;  2ELK A;  4A3F J;  3WTS C;  2NVX J;  1V55 H;  1PJR A;  4Z6Y A;  2WAF A;  3PUB A;  2VQH A;  2JWT A;  2JK3 A;  2AXL A;  4HAM A;  3OIP A;  2A61 A;  2FMY A;  1B9M A;  1KU9 A;  5K5O A;  5EGO A;  2EFO A;  3FIS A;  2Q2E B;  5ICF A;  5JLX A;  2XVC A;  1YYV A;  1MBF A;  2ZC2 A;  3E0J B;  4MFD A;  4A6D A;  2OQG A;  4DYC A;  1MSE C;  1NK3 P;  5FLX K;  3KYC B;  2VLA A;  2O8K A;  5FRN A;  4PGH A;  4BXU A;  3EUA A;  1BI0 A;  3LMM A;  2IS6 A;  2DTZ A;  4ZC3 A;  1B4A A;  3K0L A;  3PM1 A;  2HVQ A;  5CQE A;  4E7J A;  1QGP A;  3CUQ B;  3JTH A;  3QP5 A;  2HPM A;  4CHU A;  2CH0 A;  1K78 B;  3O3K A;  3DTI A;  5DV5 A;  4XRS A;  3O8H A;  1E17 A;  2LKS A;  5E1Z B;  2P6S A;  4HF2 A;  2HS5 A;  2IXS A;  2WY7 Q;  3CES A;  5TRD A;  3EYI A;  4ZTJ A;  1XMA A;  2AHQ A;  3ZMT A;  2FOW A;  3F8M A;  1XSD A;  3L2W A;  1D0Y A;  5F0F A;  2COM A;  2ZME C;  4MHG A;  2KDO A;  2OU2 A;  4UUT A;  5GAG J;  4IRH A;  4II2 A;  3V7C A;  1ZG3 A;  2KFD A;  2NVT J;  3S1N J;  1SD6 A;  4XKW A;  3HUG A;  4EM1 A;  3MZ8 A;  1G3W A;  2AO9 A;  1W4M A;  2V9K A;  4AWX B;  3GTM J;  2Q0O A;  4CCM A;  2VT3 A;  2XSJ C;  3HRM A;  1T38 A;  3A4C A;  2A6E F;  2X1D A;  1JTY A;  1YS6 A;  2L9N A;  5EG0 B;  2XAJ A;  1V5G A;  4HPQ A;  1UZC A;  1B72 B;  1T33 A;  3ERE D;  4RM2 A;  4V2F A;  1T39 A;  2HNH A;  1FOK A;  2FJ1 A;  2L9R A;  2E7X A;  3KP5 A;  3TW7 A;  4UUS B;  1R00 A;  4HYE A;  1T56 A;  2RAE A;  3CMY A;  1R1T A;  2KIM A;  3J80 K;  2HVS A;  3ZMV A;  2QM3 A;  3GTO J;  2IGK A;  2X6W A;  2Y0S N;  3K70 C;  1TW3 A;  2UZK A;  4UB6 C;  3R60 A;  1FX7 A;  1FOW A;  1O3R A;  1ZRC A;  3CDI A;  1VQ8 I;  1ORK A;  2PLY A;  3E6M A;  1OCZ H;  2XDV A;  1ON1 A;  1RNL A;  5CVV A;  3TKY A;  4EJW A;  3S2H J;  4WX9 A;  3S1M J;  3OYI A;  3SZT A;  3SXY A;  2D45 A;  1A36 A;  3LST A;  2X6X A;  2PJR B;  4K2E A;  1IRG A;  3SEZ A;  4EV0 A;  4ZZL A;  2OUM A;  2H8R A;  3RDI A;  4AC0 A;  2JVH A;  4KT6 A;  3C2H A;  4XLF A;  2LF7 A;  2R7R A;  4BQQ A;  2DBB A;  2VI6 A;  2BV6 A;  2E2I J;  3HBL A;  3RJP A;  3CLO A;  3I59 B;  3K9T A;  3JRG A;  1LNW A;  3CMA I;  2ID6 A;  3HHH A;  1C0W A;  2GIZ A;  1P2F A;  2L02 A;  2M0C A;  1JHF A;  4UVC A;  2R7V A;  1MDM B;  3MQ0 A;  1UHM A;  1N75 A;  2DMT A;  2GXA A;  1D1C A;  2MYS A;  3GZ5 A;  2L2O A;  2JN6 A;  3KLN A;  1EH7 A;  1HOM A;  1K79 A;  2DOE A;  2GBY A;  3BTJ A;  4Q5S F;  1X2N A;  3GUD A;  1IO2 A;  2CUF A;  3ZXS A;  4L5I A;  2DDB A;  3BG6 A;  2XAS A;  2JA8 J;  2R7Q A;  4Y33 A;  5BPI A;  3HHG A;  3NEU A;  1TWA J;  1ODD A;  4LJZ F;  3O8G A;  3TW6 A;  2GM4 A;  1ZN2 A;  2VL8 A;  3J81 Z;  3WTX C;  1S29 A;  3CP2 A;  3HXL A;  2D5V A;  3OR1 C;  2JA5 J;  3OV8 A;  4NDL A;  4DBQ A;  4XQF A;  2KPM A;  2AXT C;  1BC8 C;  3CTA A;  2QEN A;  2L0K A;  4E7Z A;  4HSR A;  1ZK8 A;  2ZKZ A;  3OYE A;  3IHU A;  3DQV C;  1QVT A;  3JRH A;  2DTR A;  1KGS A;  2GA1 A;  3QU3 A;  5F0C A;  3V8K A;  4FTH A;  3E6C C;  3DBH B;  4LLG F;  4U0W A;  1VQ4 I;  3KZZ A;  2ZXI A;  4DBR A;  2LKP A;  3BJ6 A;  4A3C J;  3FHZ A;  3S8P A;  4A3D J;  1BW5 A;  4Y17 A;  3RSN A;  4B09 A;  2LY1 A;  3E5U A;  5JHU A;  5FKM A;  1YJ9 I;  3GTL J;  1T0F C;  1I27 A;  3ZN1 A;  3FMS A;  5FLV A;  3E6D A;  1R22 A;  4G7Z F;  2DPD A;  5EZH A;  4I76 A;  5M3F J;  3AG1 H;  1H89 C;  2IS4 A;  2LF8 A;  2BHZ A;  1BR1 A;  1F9N A;  4MGR A;  1QO0 D;  1FNN A;  4D0P A;  2O3F A;  3L2U A;  2M4K A;  9ANT A;  4F91 B;  3A01 A;  3QP6 A;  3IP4 B;  1IDY A;  5L3D A;  3S32 A;  1I50 J;  2JRT A;  2IA2 A;  3BQY A;  2A3S A;  3PFY A;  2BHY A;  3TOA A;  2G7H A;  1W5T A;  3JW4 A;  1U0J A;  1ZKG A;  4RAY A;  2VON A;  1N78 A;  2RGV A;  2XKO A;  3SFI A;  1Z1D A;  3CC2 I;  3MMY B;  3BR1 A;  3FBN B;  1J59 A;  2QBY A;  4OIQ F;  2E35 A;  2Y0M A;  2V9P A;  4XLH A;  1B9N A;  1TQI A;  3TO9 A;  2LVS A;  1X1D A;  4IPA A;  2XGX A;  3S16 J;  4OWR B;  2DQR A;  5TJJ A;  3T8R A;  1HQC A;  1WH7 A;  3BR5 A;  2PN6 A;  3L9F A;  4ESB A;  1ZLJ A;  2KQR A;  1HW5 A;  1Z91 A;  1T95 A;  3AFH A;  3K4N A;  4GYI A;  4X6A J;  2K27 A;  1FC3 A;  3VSK A;  1A6Q A;  1VZ0 A;  1QZE A;  1MND A;  3RPQ A;  4AIH A;  1OKR A;  3TL4 X;  2R5Y B;  2HR3 A;  3ABM H;  2V9V A;  2M5W A;  3MKY B;  1YS7 A;  4ZDP A;  2YUS A;  4BL0 B;  3VOE A;  4EAT A;  1W7P D;  2KP6 A;  3CDH A;  5B1B H;  4ZYG A;  2WAQ N;  2QCO A;  5J40 A;  1S7O A;  3IL2 A;  4HA8 A;  4F7Z A;  2XV4 S;  4MQV A;  5D5V B;  1HKT A;  1X1C A;  2V1D A;  2XPU A;  3K4L A;  3TGN A;  3FM5 A;  4C30 A;  5EEG A;  2R7W A;  4JQF A;  2V6E A;  4XN3 A;  4R8H A;  2DFF A;  3FXU A;  3FXO A;  3P9K A;  2RN7 A;  2V79 A;  4I02 A;  2Z9O A;  3ERM A;  1JT0 A;  1TWF J;  3ASO H;  4PFP A;  2LSO A;  2CQQ A;  2NVU B;  2MGQ A;  3I9V 2;  2PBI A;  4DGW B;  3QRF F;  1ZRD A;  2QGU A;  4BJT A;  2XAH A;  2KLO A;  2PEX A;  1R5H A;  1R5I D;  1GT0 C;  1Z7U A;  1W36 D;  2CV2 A;  2LC2 A;  1SAX A;  2CU7 A;  2ZXJ A;  1MH3 A;  2O03 A;  4L9N A;  2FA5 A;  2XGE A;  1Z3Y A;  5H6R A;  2X6Y A;  3WTZ A;  1HW2 A;  3HSR A;  3F22 A;  4KA4 A;  4HX8 A;  4M6X A;  1G3Y A;  1UHW A;  3WTV C;  3HOT A;  1PYV A;  2W57 A;  3PSF A;  1J2X A;  1QZZ A;  4BE2 A;  3E97 A;  2NNY A;  4BY1 J;  3W2W A;  3OL4 A;  1YIO A;  2LYC A;  1YI2 I;  5GTI C;  2L3D A;  2O7O A;  2B9S A;  4N4N B;  2DA2 A;  4Q4Z F;  2CW8 A;  1MBJ A;  2DW4 A;  3MWM A;  5GAD J;  1OYI A;  4A3G J;  4GYG A;  1U9O A;  4RGX A;  4CSW A;  4EJU A;  3OYN A;  2VOP A;  5CQG A;  1SD4 A;  2G9W A;  4UVB A;  3K1N A;  5FKK A;  2GLO A;  4IVN A;  2JRM A;  2P8T A;  2OA4 A;  1FTZ A;  4EM2 A;  2R92 J;  2DO7 A;  3OY9 A;  1AWC A;  1JUM A;  3M1E A;  3M9A A;  2STT A;  3TO7 A;  3FMQ A;  2DQL A;  5J6X A;  3HDD A;  1MH4 A;  3W6K B;  2IGM A;  5CVU A;  3HIF A;  4DNC A;  2HPI A;  2MLG A;  2VJ4 A;  1OR7 C;  1PP7 U;  3VSL A;  5B1A H;  3CCS I;  1I3A A;  1PP8 F;  1I1G A;  4KIC A;  1LVA A;  1V54 H;  3F23 A;  3W6V A;  4DYQ A;  4NHJ A;  5IT9 Z;  1SVL A;  5EJC A;  4M74 A;  4ENJ A;  1UMQ A;  4F52 A;  4Y7N J;  1Q1H A;  4XL9 A;  1FSH A;  3BTI A;  2IA0 A;  2I8D A;  3GBG A;  4UNO A;  4OAY A;  4B47 A;  5HNF A;  4J00 A;  2K85 A;  2KIQ A;  4LIU A;  1SVO A;  1ZH5 A;  3FZV A;  3DKW A;  2ELH A;  4NB5 A;  4PFO A;  3PIO F;  2V7F A;  3OYH A;  4D9J A;  1MBE A;  1XGO A;  1FT9 A;  3L2Q A;  2XRN A;  2FML A;  1XX5 A;  3W2V A;  3K1P A;  3OYB A;  3H5A A;  4C3H J;  5KHD A;  2V6C A;  2IW5 A;  2B7E A;  1IW7 F;  4NQW B;  1XDU A;  4A0Z A;  4BNC A;  2KHM A;  5IT3 A;  3FXJ A;  4PZJ A;  1OCR H;  3K10 A;  2W24 A;  2V1X A;  3C7J A;  5IOY A;  2HDD A;  1LEB A;  1WJ5 A;  5F6F A;  3EUK L;  3RQ4 A;  5BNG A;  2EFW A;  1YHQ I;  3BG5 A;  4HW0 A;  2BE5 F;  3EQL F;  3G1M A;  4J01 A;  1R1U A;  1Y6I A;  3DEE A;  3LA7 A;  1E3O C;  2VKE A;  4M3D A;  2LNB A;  1O7F A;  2OTL I;  3IH3 A;  3RYP A;  4KNY A;  1KYW A;  2HVR A;  3C18 A;  3ZQI A;  1IUF A;  1P4X A;  3OSF A;  2J5O A;  4LOC A;  1ZHF A;  1X4O A;  1IRZ A;  2CWE A;  3OL3 A;  4AID A;  4BE0 A;  4M73 A;  4BAY A;  4EQQ A;  3M07 A;  3ZMU A;  1BJA A;  2DT6 A;  3KZI C;  3LQR A;  3JRI A;  2E60 A;  1A6I A;  1CGP A;  5L3B A;  2F4M B;  1E2X A;  1F1Z A;  3WHC A;  2JZY A;  3CJN A;  2HOT A;  4XOR A;  2AS5 F;  3AG4 H;  4XLP F;  2EFP A;  3HOX J;  2W48 A;  5FLM J;  2PJP A;  2J5P A;  2VBX A;  2E2H J;  3CZ6 A;  4EJO A;  2PMZ A;  3BG7 A;  2P7C B;  4FQG A;  3OOU A;  1SAN A;  3Q0W A;  3U21 A;  5C3E J;  3CCL I;  1R7J A;  3S1R J;  1H88 C;  4KYW A;  3KEY A;  1I6H J;  1WPK A;  5A2Q K;  5CVR A;  2OJE D;  1EH6 A;  3BG9 A;  4ON0 A;  1JJ6 C;  1WH5 A;  1Z21 A;  4U88 A;  3LSP A;  1IGN A;  3BQZ A;  5HNH A;  3BR0 A;  3KET A;  3O6B B;  1O3T A;  2EWN A;  2E71 A;  5FFZ A;  4LMY A;  2CW0 F;  4BDZ A;  1IF1 A;  3S17 J;  5LHI A;  3BZC A;  1JI8 A;  1SFE A;  3CF5 F;  5F08 A;  3B73 A;  2P81 A;  2K9N A;  2M9H A;  3PNV A;  4ITV A;  4N9H A;  4DIQ A;  5HLH A;  3KEQ A;  2PI0 A;  1KYZ A;  4HV5 A;  2EQR A;  3RYR A;  3ABU A;  3IRQ A;  1IRF A;  2W4S A;  2JA6 J;  2EH3 A;  3GEZ A;  2DJI A;  4KMF A;  3K4M A;  4U87 A;  5GPA A;  4QIW N;  5F1R A;  2CG4 A;  2I5U A;  3VFZ A;  1B8I A;  1SC7 A;  1FTT A;  1S7E A;  3BP8 A;  2BY3 A;  5D8K B;  4LG0 B;  1U2W A;  2EZK A;  2JUC A;  2EA2 A;  1OCC H;  3A2K A;  1VF9 A;  3HTU A;  5LD2 C;  4F55 A;  1W1W E;  2MLK A;  4HOB A;  3ZMD A;  4IF4 A;  3JR9 A;  1G3T A;  4LLN A;  1SAU A;  2KZG A;  1FY7 A;  4IX7 A;  3CDL A;  1Z7L A;  1ETQ A;  1RZ4 A;  1HKQ A;  4NC8 A;  6PAX A;  1F36 A;  1P9Q C;  5D5U B;  3KIO A;  1IUY A;  2PX9 A;  2NXN B;  2KT0 A;  3E5Q A;  5HLT A;  2ESN A;  1S5L C;  3LOC A;  1X1P A;  1VQK I;  2M8G X;  2A68 F;  2HI3 A;  1IV8 A;  1FJL A;  2MG4 A;  3DLA A;  2H1K A;  2E5Z A;  4Y13 A;  2QWW A;  4YG2 F;  5JVG F;  3D0S A;  1X2M A;  3BG3 A;  3HG9 A;  5L3E A;  3IUO A;  3ZQC A;  3HSF A;  3FHN A;  3TO6 A;  4I0A A;  5IP7 J;  5M3M J;  1BIA A;  2YS9 A;  1XPX A;  2VN2 A;  1K6O A;  4M3B A;  4HV6 A;  2KKO A;  5J1U A;  3L2R A;  5JLW A;  2EV5 A;  4MTD A;  2MAB A;  4DJA A;  1USS A;  1RET A;  2Q1Z B;  4P55 A;  5J4Y A;  2RKH A;  1YIJ I;  1FBQ A;  2MC3 A;  1UFM A;  4HNV A;  2HGC A;  4IHW A;  2VQL A;  2HQR A;  3JSO A;  5FGM A;  2ZB9 A;  2L5Q A;  4WXC A;  5ILS A;  2Y2Z A;  3LSJ A;  1MMN A;  1F4K A;  4GCV A;  4XM3 A;  1WGX A;  5J47 A;  4OMZ A;  4WXH A;  3VOD A;  1BI2 A;  3BCB A;  3HKZ N;  2E1M C;  1MBH A;  3BLY A;  4JX6 A;  4C2U A;  2EV6 A;  4XOP A;  2TRT A;  5LLQ A;  4CYC B;  1W36 C;  3CP8 A;  1I5Z A;  3UNG C;  4RS8 A;  2F2E A;  4HST A;  1TZL A;  2Z99 A;  3BC8 A;  1DGW Y;  4DZP A;  1KZH A;  2ISZ A;  4YII A;  2K40 A;  3VYS B;  3WGI A;  3PJR A;  1ZAR A;  3N97 A;  4RGR A;  1V5E A;  1LUJ B;  3FXR A;  4QWQ A;  1TC3 C;  2QSH X;  4CZC A;  3Q9V A;  2NOG A;  4M72 A;  2HZD A;  4PCQ A;  1HF0 A;  2GZW A;  3OYK A;  1RR8 C;  3G6E I;  1JUP A;  5FKO A;  1ZYR F;  1IRX A;  2KIS A;  4E4H A;  2OCC H;  1MGT A;  3K2A A;  2E1O A;  1HW1 A;  3CME I;  2DMU A;  4OU0 A;  3V7S A;  1FYK A;  4UXN A;  1ONV A;  5AIQ A;  1X4P A;  1GXQ A;  3ZR8 X;  1JKO C;  4IOC F;  2KIU A;  3Q0U A;  3Q9S A;  3OS2 A;  3WE2 A;  2JPC A;  1UG0 A;  2L7K A;  1U5T A;  4U0V A;  4QSH A;  5CKT A;  2L7Z A;  5H20 A;  5F04 A;  5J1Y A;  4HDU A;  4I01 A;  3KPH A;  1T6S A;  2KRC A;  2LDU A;  5FRO A;  1XCB A;  2RVC A;  3OYJ A;  2DA3 A;  4A3E J;  1W0U A;  5LRR A;  2VBY A;  1KQ9 A;  4EGZ A;  2F5C A;  2OC6 A;  3FWE A;  2CQK A;  2EZI A;  3GFJ A;  5HOD A;  3H0D A;  3OIO A;  3U9G A;  1TWG J;  2XAF A;  2Q2E A;  5HDN A;  5DM6 F;  4ESF A;  2QKL B;  3GLX A;  4YEJ A;  5ILU A;  2GIV A;  1LB2 A;  4AIJ A;  1BC7 C;  1NK2 P;  2MD0 A;  4D7N A;  3BCA A;  3WU2 C;  2OBP A;  4ENN A;  4WXD A;  1OMI A;  1X3Z B;  2ZNZ A;  5LHG A;  2M87 A;  1WI9 A;  4CYD A;  2K9S A;  2OV7 A;  5DDG A;  3CUQ A;  3ZOB A;  1SEU A;  1K78 A;  2R93 J;  3S1Q J;  2ZJR F;  1S7A A;  3DF8 A;  3JRE A;  2FRH A;  4XKV A;  2K4J A;  3FK6 A;  1SFU A;  4XLA A;  1QHG A;  5E20 A; 
#chains in the Genus database with same CATH homology
 3HOV J;  3PO3 J;  1SFO J;  5IYB J;  1WH7 A;  2CJJ A;  2E19 A;  2CUE A;  3BTL A;  3BR5 A;  1X58 A;  2HQ5 A;  2ECC A;  1MSF C;  2K9Q A;  4B4C A;  4X6A J;  1ETY A;  3S2D J;  3HOZ J;  3Q0V A;  4XRS G;  2XGD A;  3IV5 A;  2R5Y B;  4A3L J;  2DMN A;  3RQI A;  2NS7 A;  1GV2 A;  2YUS A;  5IP9 J;  1YRN B;  3HOW J;  3BR3 A;  2WAQ N;  2DMQ A;  2QCO A;  3I4N J;  2E2J J;  1JGG A;  2LFB A;  2LLK A;  1WI3 A;  4D5C A;  1JJ8 C;  1B72 A;  2ECB A;  2XPU A;  4FE7 A;  4ABZ A;  2IBD A;  2ID3 A;  2DA5 A;  5GPC A;  3HOU J;  4UUS A;  4BY7 J;  5EGO B;  3I4M J;  1Z77 A;  3D1N I;  4IHX A;  3CQZ J;  1GUU A;  1JUS A;  3TP0 A;  4MIM A;  1JT0 A;  1TWF J;  2DA1 A;  1R9T J;  2MW8 A;  4JX4 A;  2CQQ A;  1ETV A;  2MGQ A;  1QPI A;  1VND A;  3QQA A;  2CQX A;  4D5F A;  1OFC X;  5FKN A;  1EF4 A;  1UG2 A;  2I10 A;  1GT0 C;  1GVD A;  3M3Y J;  4EEF G;  1ENH A;  2CU7 A;  3ZQH A;  1MH3 A;  1IG7 A;  2XGE A;  3WHB A;  1AKH B;  1QRY A;  2LR8 A;  4MLO A;  3LNQ A;  3QPL A;  5J1R A;  1B8I B;  2JMW A;  2B63 J;  3MKL A;  3GTQ J;  5F0H A;  5K7Z A;  3FK7 A;  4BY1 J;  1IJW C;  2N8G A;  4IHV A;  2O9L A;  1UHS A;  4C3J J;  5K7F A;  1CQT A;  2O7O A;  2DA2 A;  1MBJ A;  4A3G J;  2DN0 A;  1ETX A;  1U9O A;  4RBO A;  4CYC A;  4Y52 J;  5FKK A;  2GLO A;  4A3K J;  5IYC J;  1WCM J;  1XG1 A;  1Y1W J;  3S15 J;  2Y31 A;  1U8B A;  1FTZ A;  4BBS J;  2R92 J;  2XRL A;  3E7L A;  1MNM C;  1JUM A;  3LSG A;  3SJM A;  3HDD A;  4S0H B;  1MH4 A;  4W1U A;  1P7J A;  3HEF A;  3MVP A;  1Z0X A;  2EZL A;  2X48 A;  5GP9 A;  2R5Z A;  1MBG A;  3LSR A;  4AUX A;  5IOZ A;  2YU9 J;  2LK2 A;  1POG A;  1HLV A;  2DMP A;  4A3J J;  1G2H A;  5E3M A;  3PO2 J;  3W6V A;  4DYQ A;  5K7H A;  3G1O A;  3G1L A;  4W97 A;  2IAI A;  1UMQ A;  2XGC A;  4Y7N J;  3BTI A;  5EF6 A;  1BA5 A;  1W0T A;  3DCF A;  3GBG A;  3ZQF A;  1LE8 A;  1QVU A;  1LFB A;  5FJ8 J;  5M5W J;  1VFC A;  4XID A;  1XS9 A;  3GTJ J;  5DTD A;  1PUF A;  1MBE A;  2XSD C;  3ZQG A;  3JRC A;  1DU6 A;  3IH2 A;  5E3N A;  2OF7 A;  2Y9Z A;  4C3H J;  3DEW A;  5C44 J;  2R0Q C;  5DS9 A;  2HOA A;  1ZTR A;  2LP0 A;  1ZQ3 P;  3JRD A;  5EG0 A;  3C2B A;  2LD5 A;  5IOY A;  2HDD A;  2FX0 A;  5EZG A;  4G12 A;  5BNG A;  1LFU P;  2Y9Y A;  3BG5 A;  3QPS A;  2DA4 A;  3G1M A;  3RZD J;  2WB1 N;  4C2M J;  1JKQ C;  1E3O C;  2VKE A;  4M3D A;  3IH3 A;  2ME0 A;  3BR6 A;  4V2G A;  3ZQI A;  1IUF A;  4I6Z A;  3OSF A;  4LOC A;  1AHD P;  4GFB A;  4AYB N;  2EBI A;  2M34 A;  4IHY A;  1IRZ A;  2PMZ N;  3RKQ A;  4IEJ A;  1ETK A;  3Q3S A;  4A93 J;  4BXX J;  2VKV A;  2XB5 A;  1H8A C;  1Q1V A;  2DJN A;  4C3I J;  1TWH J;  3HGG A;  2DA6 A;  4B3A A;  1HCR A;  5F27 A;  1ETO A;  3JRI A;  2JJ7 A;  3FIW A;  5J3L A;  2CRG A;  2KDZ A;  1HDD C;  1A6I A;  4QTR A;  2R5Y A;  4XRM A;  2ME6 A;  2JA7 J;  1YRN A;  3WHC A;  5IYD J;  1TWC J;  3GTP J;  5F1J A;  2WV1 A;  2HOT A;  4A3F J;  2NVX J;  2ELK A;  2NS8 A;  3HOX J;  5FKL A;  2W48 A;  5C4X J;  5FLM J;  2E2H J;  1HDP A;  2LY9 A;  1RPW A;  2JWT A;  2JK3 A;  4D7M A;  4JYK A;  3OOU A;  3Q0W A;  1SAN A;  1JKP C;  1ITY A;  5C3E J;  2M2E A;  2TCT A;  2LKX A;  2X6O A;  3S1R J;  4MFE A;  1H88 C;  1I6H J;  5EGO A;  2HOS A;  3FIS A;  4A3B J;  1WPK A;  5JLX A;  3A01 B;  3BG9 A;  1MBF A;  4MFD A;  4DYC A;  1JJ6 C;  1MSE C;  1WH5 A;  3VPR A;  3JRF A;  1NK3 P;  3H0G J;  2O8K A;  4XIC A;  3LSP A;  1IGN A;  3BQZ A;  3BR0 A;  2DTZ A;  3A03 A;  2L7M P;  3PM1 A;  2HYJ A;  4JP0 A;  3S17 J;  3HOY J;  3BTC A;  1JT6 A;  3HB9 A;  5F08 A;  2P81 A;  2K9N A;  2M9H A;  4XRS A;  3O8H A;  1AKH A;  1RKT A;  2EQR A;  1FIP A;  1BL0 A;  5IPA A;  2JA6 J;  2AHQ A;  2EH3 A;  4QIW N;  5GPA A;  1PUF B;  3NAR A;  3OSG A;  1B8I A;  5F0F A;  3HGY A;  3M4O J;  1DU0 A;  1FTT A;  4UUT A;  1K61 A;  1ZR2 A;  3NAU A;  1S7E A;  2NVT J;  5E3L A;  3S1N J;  2EZK A;  1JTX A;  3GTG J;  2AO9 A;  1VF9 A;  1OCP A;  1BW6 A;  1F43 A;  3GTM J;  3B6A A;  2XPW A;  3JR9 A;  1FEX A;  1JTY A;  5EG0 B;  2COB A;  2L7F P;  3CDL A;  1ETQ A;  3ZQL A;  1B72 B;  1T33 A;  3JRA A;  1F36 A;  3L1P A;  2KT0 A;  4V2F A;  2FJ1 A;  3LOC A;  1RES A;  2L9R A;  4UUS B;  3TW7 A;  2M8G X;  5M5X J;  2VUM J;  1T56 A;  1XC5 A;  2HI3 A;  2RAE A;  3B6C A;  2MG4 A;  1FJL A;  2H1K A;  4DW6 A;  2VPR A;  1IDZ A;  1X2M A;  3CMY A;  3GTO J;  3BT9 A;  5EDN A;  3K7A J;  3BG3 A;  3S14 J;  4M6V A;  2Y0S N;  3ZQC A;  4M3G A;  5IP7 J;  2QF7 A;  5M3M J;  1ORK A;  2FD5 A;  2YS9 A;  3IH4 A;  4M3B A;  3S2H J;  3FKI J;  5J1U A;  3S1M J;  5JLW A;  3RZO J;  1RET A;  1OCT C;  2H8R A;  3TP3 A;  4FCY A;  4AC0 A;  4RDU A;  2XB0 X;  2DA7 A;  4HNV A;  4IHW A;  1OJL A;  2HXO A;  2VI6 A;  3JRB A;  5C4J J;  3HBL A;  2E2I J;  2ZB9 A;  3JRG A;  2ID6 A;  4X1E A;  3TED A;  1BJZ A;  1IC8 A;  3F0C A;  1RR7 A;  2Y2Z A;  3LSJ A;  3H3V K;  4DZJ A;  1WGX A;  2M0C A;  2NVY J;  3HKZ N;  4DYR A;  4A3I J;  3UKG A;  2FQ4 A;  1MBH A;  2DMT A;  4JX6 A;  4J19 A;  1IV6 A;  4A69 C;  5IP6 A;  5E3O A;  2TRT A;  4A3M J;  4CYC B;  2JN6 A;  1JKR C;  1HOM A;  1A5J A;  2GBY A;  3BTJ A;  1X2N A;  4DZP A;  2CUF A;  3CCY A;  2K40 A;  2R7Z J;  2JA8 J;  1ZGW A;  3SDG A;  1TC3 C;  2MSY A;  1TWA J;  2NOG A;  3TW6 A;  3O8G A;  1GDT A;  2GM4 A;  1NTC A;  1FIA A;  1HF0 A;  3BR2 A;  2D5V A;  1JUP A;  5FKO A;  2JA5 J;  4NDL A;  2R5Z B;  3K2A A;  2L0K A;  4BKX A;  2E1O A;  1ZK8 A;  3GTK J;  1MBK A;  1U9N A;  2DMU A;  1P7I A;  2XPV A;  1QVT A;  3JRH A;  5F0C A;  4FTH A;  1JKO C;  3Q0U A;  1AU7 A;  4FE4 A;  4A3C J;  1Y1V J;  4A3D J;  1BW5 A;  4M3E A;  2Y30 A;  4QSH A;  1LE8 B;  4M3F A;  2L7Z A;  5F04 A;  5J1Y A;  5EYR A;  1K83 J;  5FKM A;  3GTL J;  1GV5 A;  1U78 A;  4FIS A;  4A3E J;  5FLV A;  2DA3 A;  4JX5 A;  1W0U A;  5EEA A;  5EZH A;  4I76 A;  5M3F J;  1H89 C;  4L5E A;  3A02 A;  2X9D A;  2EZI A;  2OPT A;  5HOD A;  3OIO A;  1TWG J;  9ANT A;  3A01 A;  1APL C;  1I3Q J;  1IDY A;  1I50 J;  3BQY A;  2NVQ J;  4MO7 A;  1NK2 P;  4D7N A;  2LTP A;  1ZR4 A;  1ZKG A;  4B1R A;  3SFI A;  2HXI A;  2K9S A;  3MN2 A;  3BR1 A;  1ETW A;  3ZOB A;  2IEK A;  5M5Y J;  2R93 J;  2EZH A;  3S1Q J;  2G0E A;  1VI0 A;  1O4X A;  1RKW A;  3HM5 A;  3JRE A;  2LVS A;  1D5Y A;  4XK4 A;  3S16 J;  3FK6 A;  4BBR J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...