4UUTA

Crystal structure of the ultrabithorax protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
TYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOTIC PROTEIN ULTRABITHORAX
publication title A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 29
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4uutA00
4XRSA 2MSYA 2LY9A 1NK3P 3BTIA 2CQXA 2HQ5A 2CU7A 2DA6A 2HOSA 5DTDA 3SFIA 3GTLJ 3TEDA 1GUUA 4D5CA 3IV5A 1FEXA 1BL0A 2R5ZA 4IHWA 3IH3A 4B1RA 3BT9A 5K7HA 2JN6A 4V2GA 1RESA 1LE8B 4FCYA 5BNGA 4W1UA 2QCOA 2X6OA 4XRMA 1I50J 3LNQA 2FJ1A 5E3LA 4C3IJ 1RKWA 2B63J 1JUSA 5F0FA 4MO7A 1UMQA 5K7ZA 3GTPJ 1TWHJ 1ETVA 2DA5A 1O4XA 1IC8A 5K7FA 4J19A 4UUTA 5GP9A 3BR2A 4QIWN 1FIPA 3G1OA 2E1OA 3FIWA 2K9NA 4X1EA 2NVQJ 5M5XJ 3BG5A 4GFBA 3LSJA 1F43A 4A93J 5FKLA 2IEKA 1MBEA 1ORKA 4V2FA 1ZR4A 2CQQA 3HB9A 3ZQGA 4RDUA 4BBRJ 2XGCA 3ZOBA 2XB5A 2XGEA 4M3FA 4HNVA 2NS7A 1IRZA 2O7OA 2VPRA 5IOYA 2JA6J 2Y31A 2DJNA 4ABZA 1HCRA 5E3OA 2ELKA 3OIOA 5J1RA 1WPKA 4CYCB 2AO9A 2EH3A 1AU7A 4AC0A 1TWFJ 1I3QJ 3S14J 1QRYA 4DW6A 4A3KJ 3FK6A 1RR7A 3LSRA 2I10A 3BTCA 4D7NA 1VNDA 1ZKGA 1AKHB 1IV6A 2JK3A 1AHDP 2JA7J 5EEAA 2R92J 1A6IA 1MSEC 4C2MJ 4B3AA 3ZQIA 3FK7A 2CUFA 1H88C 1VI0A 1VFCA 1PUFA 2P81A 3MVPA 4A3FJ 3H3VK 2O9LA 3ZQCA 1TWGJ 2M2EA 4W97A 4QSHA 5IOZA 1ETKA 1ETOA 2LK2A 1HF0A 2LTPA 2LKXA 2M9HA 4S0HB 3HOYJ 3S16J 2ME6A 5IP9J 5EDNA 1IDZA 3LSPA 1FTZA 1JJ8C 1IJWC 1MBHA 5FJ8J 4Y52J 2M0CA 1ENHA 3HOXJ 4BY7J 3RKQA 5C44J 3JREA 5EGOA 2VI6A 2COBA 5FLVA 5EF6A 5FLMJ 1BW5A 1MBGA 2NVTJ 1Q1VA 4JYKA 2EQRA 3NAUA 1JKPC 1Y1WJ 4M3EA 3DEWA 1B8IB 3OSGA 5JLWA 3I4MJ 1UHSA 2OF7A 2CUEA 3HM5A 3JRAA 1HOMA 2XB0X 3S1NJ 3GTQJ 2AHQA 3SJMA 3K7AJ 5J3LA 1U9OA 2EZLA 3BQZA 3A01B 4M6VA 5IPAA 3GTKJ 3JRIA 1T56A 1IDYA 1OFCX 3FISA 1OJLA 4UUSB 2JMWA 4M3BA 3BQYA 2G0EA 1OCTC 1ZTRA 4A3CJ 1UG2A 1DU0A 2N8GA 1JKOC 3GBGA 3Q0UA 2KT0A 5GPAA 4C3HJ 1HDDC 3LSGA 5GPCA 2R5YA 5F04A 3BR6A 1RETA 3HOUJ 2ECCA 5IP7J 2R0QC 4RBOA 2VUMJ 2TRTA 2LFBA 5E3NA 4M3DA 2L0KA 3WHBA 1JKQC 1Y1VJ 1Z77A 4JP0A 3TW7A 1VF9A 3DCFA 1BW6A 2PMZN 2LLKA 1H8AC 1SANA 1X2MA 3HDDA 1POGA 3M4OJ 1TWAJ 3SDGA 2HXIA 4IHVA 3HBLA 4CYCA 1FTTA 1GV2A 3NARA 3I4NJ 3B6AA 1ZR2A 1GDTA 2EZIA 1IGNA 1I6HJ 2FQ4A 2DA1A 2E2JJ 4FISA 1AKHA 4IHXA 4AUXA 2DMTA 1P7JA 1IUFA 3S1MJ 2DTZA 4AYBN 3HGGA 4I76A 4A3EJ 3RZOJ 5M5WJ 4XRSG 2DA7A 4DZPA 2VKVA 4A3DJ 5EG0A 1NTCA 2XRLA 2R5ZB 2MG4A 2L7FP 2FX0A 1ETXA 5IYBJ 3MN2A 1H89C 1YRNA 2DMPA 3S1QJ 3GTJJ 5IYCJ 1JTXA 3TP3A 2Y2ZA 2JJ7A 4L5EA 2YU9J 4FTHA 4X6AJ 2ID3A 1MBJA 5F0HA 1GVDA 2GBYA 3IH2A 2OPTA 2Y9YA 3GTMJ 1WI3A 5F0CA 4MIMA 1T33A 2HOTA 5M5YJ 4A3JJ 1HDPA 5M3FJ 2ME0A 2M8GX 2VKEA 3L1PA 2W48A 3TW6A 3JRFA 4DYRA 3A03A 4DZJA 4XIDA 3M3YJ 2WV1A 1JGGA 5F27A 1D5YA 4B4CA 2ID6A 5EYRA 3HKZN 2RAEA 1RPWA 5EZHA 4EEFG 1EF4A 2YS9A 4FE4A 2QF7A 1QVTA 1CQTA 1X58A 4UUSA 3PO2J 1A5JA 2E19A 3HOWJ 1OCPA 4FE7A 2X9DA 2XGDA 3BG3A 1R9TJ 1WCMJ 5E3MA 1LE8A 3IH4A 1W0TA 1ZQ3P 4IEJA 3HEFA 4A3GJ 4BXXJ 3F0CA 4IHYA 1B72B 2L7ZA 2R7ZJ 1ETWA 2YUSA 2WAQN 3LOCA 2JA5J 2K9QA 1JUMA 1G2HA 2DMUA 1WH5A 1Z0XA 1JTYA 1NK2P 4C3JJ 2DMNA 1MNMC 3PO3J 5IP6A 4JX5A 1W0UA 3HOVJ 1LFUP 1DU6A 1K61A 1U9NA 1ETQA 4XK4A 2NVYJ 4JX4A 4NDLA 3UKGA 4A3MJ 2D5VA 3PM1A 1XG1A 3FKIJ 3QPSA 2JA8J 3E7LA 3O8HA 5EGOB 2KDZA 3RZDJ 3S2HJ 4G12A 4XICA 2XSDC 2K9SA 3ZQFA 2Y30A 3GTGJ 3BTLA 1TC3C 2ECBA 3BR3A 3G1MA 1JT0A 1LFBA 2EZKA 2ZB9A 3BR5A 5FKMA 2HXOA 2JWTA 2DA3A 1XC5A 2CRGA 3CQZJ 5FKOA 5J1YA 5DS9A 1ZGWA 5C4JJ 4M3GA 2HDDA 3HGYA 2NOGA 2MGQA 2Y9ZA 3C2BA 2K40A 5F08A 2HI3A 2LVSA 4BBSJ 2NS8A 4D5FA 3CMYA 5HODA 2IBDA 3BG9A 3CCYA 3CDLA 3RQIA 2EZHA 5EZGA 4DYQA 4JX6A 3QQAA 1WGXA 2Y0SN 3S1RJ 3HOZJ 3JRHA 2H8RA 5C4XJ 5IYDJ 2XPWA 1GT0C 2R5YB 2H1KA 3A02A 1FJLA 3OOUA 5JLXA 2E2HJ 1MSFC 1JUPA 2L7MP 3WHCA 1JT6A 1SFOJ 3BR1A 1MH3A 2IAIA 1MBKA 2GM4A 4I6ZA 2L9RA 3JRBA 2NVXJ 1BA5A 3MKLA 1ETYA 2LD5A 4QTRA 1JJ6C 2GLOA 1TWCJ 2DA4A 2DMQA 2EBIA 3O8GA 1JKRC 4MFDA 1QPIA 3H0GJ 3Q3SA 4LOCA 4MLOA 1B8IA 1ITYA 3B6CA 1GV5A 5F1JA 2HOAA 5M3MJ 2MW8A 4MFEA 3VPRA 2O8KA 1E3OC 1B72A 1FIAA 3S17J 2XPUA 5C3EJ 3JRGA 1BJZA 3JRCA 3A01A 4A3LJ 1U78A 5EG0B 1WH7A 3BTJA 4A3IJ 4A69C 3S15J 2XPVA 1XS9A 1P7IA 1YRNB 2HYJA 3QPLA 2DA2A 1K83J 2TCTA 1APLC 4D7MA 2X48A 3W6VA 1HLVA 5FKKA 2E2IJ 4A3BJ 5FKNA 2R93J 1F36A 1IG7A 3Q0WA 2WB1N 3Q0VA 3JRDA 1U8BA 9ANTA 4DYCA 3BR0A 4BY1J 3G1LA 3K2AA 3JR9A 1S7EA 3OSFA 2LR8A 2M34A 1RKTA 2CJJA 4Y7NJ 2FD5A 5J1UA 3TP0A 1MH4A 1QVUA 3S2DJ 1ZK8A 1X2NA 4BKXA 1PUFB 2DN0A 3ZQHA 3D1NI 1MBFA 2LP0A 3ZQLA 3GTOJ
chains in the Genus database with same CATH superfamily
1XSVA 1A36A 1Z3YA 1DGWY 1NK3P 4Q48A 1ZG1A 3BJ6A 3QWLA 4CCMA 2DA6A 1WVRA 3P9KA 1X4OA 5DTDA 1IO2A 3TEDA 2QUFA 4HX8A 1GUUA 2XUBA 1T08B 2F5FA 4NHJA 1FEXA 1BL0A 4II2A 4PFOA 4B1RA 2FU4A 5K7HA 2RGVA 4AIKA 2X6YA 1SD5A 2KIQA 2YR2A 3VOEA 1RESA 4UVCA 3RPQA 4RLQA 4BQAA 1XPXA 3CMMA 5BNGA 4FCYA 3GLXA 2HKXA 3H9GA 4W1UA 4KIFA 4B8XA 5E3LA 4C3IJ 3ABLH 1JUSA 2DOEA 5LHIA 1K4TA 1XN7A 4Y17A 3L09A 1QHHD 1IC8A 2OCEA 4IZZA 4QIWN 1FX7A 4BDYA 1KQ9A 3CCLI 2V26A 3G1OA 3CCEI 2QKMB 3BG5A 2ZFUA 5FKLA 2E60A 2YX4A 2P6TA 1KQ8A 3SHFA 2EINH 3WTUC 3CLQA 4BBRJ 1BI3A 2E7XA 3BCAA 3ONQA 2XGEA 3O3KA 2ZJ2A 1K78A 4QLCU 2DI3A 2KJCA 2JA6J 2X51A 2KRFA 1T98A 2DJNA 1A35A 3F8FA 1W5SA 4HQMA 2FUG2 5E3OA 2A69F 2XF6A 4MQ9F 4CICA 2HOEA 4HV6A 1XMKA 2P4WA 4U0VA 1TZLA 5LRSA 4HLYA 2X1CA 1QRYA 2O3FA 1PJRA 3FK6A 3LSRA 3HSEA 1LDDA 4D7NA 3FMRA 1Q1HA 1QNTA 3WE2A 1R23A 4MQVA 3U21A 4HW0A 2JA7J 3T8RA 1R5GA 2JSPA 1T8IA 2CFXA 3M1CA 1FZPB 3PIPF 5KNLA 2R3SA 3VYUB 3ZRGA 4YRVA 4G6QA 1NHAA 3L2UA 1VFCA 3OYIA 3HG9A 3V7SA 3MVPA 4BXUA 1Z05A 2M45A 3KEYA 2P5KA 3ZQCA 5DD4A 4WXHA 3PJRA 5IOZA 3RCOA 3SDBA 4QWQA 4S0HB 3HOYJ 3KFWX 3MFKA 3S16J 1MIJA 2PBIA 5EDNA 4XN3A 3LSPA 3LFUA 2IW5A 4AIDA 1FTZA 1JJ8C 4HDVA 2M0CA 3PFIA 3KX2A 4PZJA 4BY7J 3RKQA 3JREA 2QBYA 4ENMA 4D1QA 3BG6A 3OYFA 1S5LC 2W85A 4RGRA 2WAFA 1IN7A 2WAQA 4K2EA 2NVTJ 3K4LA 1SAXA 2EQRA 3NAUA 5JHFA 3LMMA 3CMEI 3JAMZ 2H09A 2GAUA 2L3DA 3FHNA 1G3WA 5JLWA 2VE9A 4ZDLA 1F4KA 5ICFA 4L18B 1MMNA 2XGXA 5CKTA 4OOIA 2XRNA 4M72A 1WJBA 2XB0X 1WZ2A 3GTQJ 1P9QC 4Q47A 3MMYB 3K7AJ 1U9OA 1TW2A 2JPCA 2EZLA 2PLYA 3BQZA 2F4MB 2RNGA 3BZKA 5CQGA 3R60A 3BC8A 3GTKJ 3JRIA 4X0GA 2HZTA 5DUKA 3I9V2 1OCTC 2G0EA 4L9VA 1UG2A 1WJEA 1IN5A 5FFZA 1QPMA 4LK0F 3CDHA 3KP6A 2MD0A 1HW5A 4OIRF 3VFZA 3OYKA 3DV8A 5GPAA 4EQQA 4C3HJ 2V9KA 3NRVA 5GPCA 2R7FA 3OS2A 4HOBA 3BR6A 3OYEA 3ZMZA 4P5OA 2ECCA 2R0QC 3FM3A 3HOSA 5E3NA 2HGCA 4OIQF 5BPIA 3I0TA 1LEAA 1XGOA 1J5YA 2VJ4A 2PJRB 4FX0A 2DJIA 1Z77A 3KLNA 1O3TA 2MH9A 4L5IA 2IXSA 5D6EA 4KITB 3M4OJ 4IHVA 2HXIA 5K5OA 2VXZA 1GV2A 1MGTA 4FHTA 4A0ZA 3ZXSA 3B6AA 5JR3A 4IRHA 2NRAC 5J4VA 2FQ4A 2DA1A 4XORA 2EK5A 4XKWA 4FISA 2E5ZA 2A6HF 4R8HA 1OQYA 1SVOA 2DMTA 5B66C 1IUFA 2D1VA 4H4KC 4HNTA 3S1MJ 2Z33A 5M5WJ 4A12A 3J7AO 3ECHA 5EG0A 2WY7Q 1NTCA 3J81K 4JBAA 3WG9A 1UZCA 5IYBJ 3R61A 1SAUA 1H89C 1SD7A 1YRNA 2DMPA 3DPUA 3S1QJ 4LLLA 1B9NA 3FKJA 1HW2A 2IA0A 3KLOA 5HS9A 2W24A 1Z67A 2H6BA 3FMQA 2KL4A 1ZLJA 2ZJPF 5IY5H 1MBJA 1YTYA 1Y0NA 2EV6A 3GTMJ 3ASNH 4RS8A 3KZZA 1MMDA 5M5YJ 2K3PA 2VBZA 4NC7A 1W7PB 3EPZA 4PJMA 2L01A 1XGSA 3S3OA 3D5RC 2QSGX 1STZA 2GOXB 5DEQA 4LG0A 2EV5A 3H3UA 2MC4A 4BL0B 4U88A 4CZCA 2IGOA 2CS3A 2WV1A 2HDCA 1LVKA 1N77A 1D5YA 1EJ9A 2CMPA 4E7LA 2LREA 4G9YA 5EEGA 1BI1A 1VQMI 2PN6A 4A5MA 3H5NA 4FE4A 4GCVA 1SFUA 1QVTA 1CQTA 2YX7A 1O7LA 3KP3A 4B44A 3GX4X 1HKQA 2E19A 2F4OB 3HOWJ 1OCPA 4FE7A 4E7HA 2FNAA 2ZFWA 2X9DA 3LSTA 1ZLKA 2F2EA 1FP2A 2V1UA 1WCMJ 4ZYGA 1WJAA 2VQCA 5E3MA 2JRTA 1PUEE 2VC1A 2VT2A 2M87A 3K10A 2E5NA 2J5OA 1P92A 5LRRA 4BE0A 3Q5FA 3F0CA 4IHYA 2OZUA 2IS1A 1N25A 2L7ZA 1HKTA 1ETWA 1V5GA 2UV1A 3IUOA 4KUMA 2VJ5A 4IOCF 2D45A 4MNUA 2JA2A 1T6SA 1G2HA 1K6YA 3DLLF 1KU7A 3KP2A 2VKHA 2PJRA 1FYKA 3DLAA 4I02A 3OYCA 4U7BA 5D4SA 5DCFA 3MKZA 4FASD 1FWZA 4ESFA 2HYFA 2K4BA 3KEQA 4B3XA 1MNMC 5LBQA 3SZPA 1LEBA 1EH6A 4I2OA 3WTXC 1VQ4I 4NQWA 1JHFA 5H6RA 3I3LA 4O5VA 1U9NA 1XDSA 2ZBKA 4UV9A 5F64A 2E35A 4IX7A 1H9GA 3OYNA 3IKVA 1PP7U 3U9GA 1ZYRF 3RJPA 2KRCA 3OYGA 2XAUA 3V7RA 2JPBA 2JA8J 3E7LA 3WTYC 5ICGA 3V8LA 4UHTA 2XSDC 1YOVB 2GXBA 2K9SA 2DODA 3GTGJ 4OINF 1JT0A 3E0JB 4ZDOA 3D0SA 2ZB9A 5KHDA 2HNHA 3GWZA 3HJEA 4D0PA 1T38A 4RGUA 2NNNA 2CUZA 5FKOA 5DS9A 1ZGWA 2LBFA 3QYEA 2LSOA 2OU2A 2EIJH 2FQ3A 3WE3A 3CC7I 2NOGA 1EV7A 2K86A 5IT9K 2Y9ZA 3C2BA 2BW3B 1KU2A 2DT5A 1YQAA 3LAJA 3GFIA 4BBSJ 4PSXA 4PJLA 2HWVA 4D5FA 1QO0D 3CMYA 5HODA 3CCYA 3IRRA 3G2BA 3DPTA 3QQAA 3J7YJ 3IL2A 3BOQA 4DBQA 4KJZA 2DYRH 3MZYA 2OUMA 3HOZJ 2H8RA 2DK5A 1Z21A 2G9WA 1MDMA 5IYDJ 1YW9A 2NAZA 3VB2A 3F22A 4L0YB 3FXJA 1ZN2A 4ENKA 1MSFC 1SFOJ 5D4RA 3PNYA 5K5QA 1W36D 2FNPA 2W4SA 2X6XA 3U1DA 1X1CA 2IAIA 1MBKA 2E36A 3C3WA 2ZCWA 3TMOA 1RRJA 2F5EA 3ASOH 3LSMA 3HRTA 4A5NA 4QTRA 2PI0A 2VBYA 4HSTA 1TWCJ 2X0LA 4R1HA 2DMQA 3R6SA 1KGSA 1R1VA 1P6RA 3S93A 4CCKA 3Q3SA 1ZRDA 4L5JA 2Y69H 2Z9OA 2P5LC 1KZHA 3J81Z 2O6GE 5AIPA 2HOAA 5IT3A 5M3MJ 1RI7A 1BC8C 4YIFA 1E3OC 5C3EJ 1YHQI 4HLXA 3MAJA 2ZSHB 1REPC 2PFBA 4A0XA 3JRCA 3A01A 2RV8A 4A3LJ 3OS0A 4WK8F 3A4CA 3WU1B 2DOAA 3NQOA 2EFQA 4A69C 4HF1A 3DU5A 3A2KA 1Y0UA 2XPVA 4XKVA 1P7IA 5FD6A 2XAFA 2BOLA 4D7MA 1KQ0A 3W6VA 3OL3A 2E2IJ 1E3PA 5J8CA 3H5AA 1IG7A 4EATA 1S3JA 3DTKA 3I4PA 4PJNA 1MJBA 1D0YA 2VC0A 2HQRA 3HUGA 4RM3A 3K2AA 3JR9A 5HDNA 1FSEA 2W7NA 4M6XA 3E97A 3TGNA 1RKTA 5J1UA 5GAEJ 1DPRA 1X3ZB 1MH4A 3ULQB 3S2DJ 1GLNA 2FE3A 3GEZA 1W5TA 4BKXA 4O6JA 5LD2C 4F7ZA 3WU2C 4XLPF 3OOPA 4EM0B 3PSIA 3GTOJ 3I59B 2H1LA 2V1DA 4BDZA 1G3YA 1X1PA 3BP8A 2CGPA 2JVHA 1S7OA 4ZDPA 2QQAA 3BJOA 3ZMSA 2HQ5A 3M8JA 4PJ0C 3W6JB 1QHGA 3V8KA 2HOSA 2BBYA 2DBBA 1ZREA 4UB8C 1MNEA 3CC2I 5FB2A 1QQIA 4BJTA 1E3HA 4ENJA 2R5ZA 3IH3A 4LG3A 3BT9A 3AKZA 2E7WA 2VASA 1QGPA 2IA1A 2PMZA 2R7WA 1PP8F 3GYHX 1OYIA 2ZXIA 4AM3A 2X6OA 2OAZA 2PMHA 2ZJQF 3PIOF 1RKWA 2Q8KA 2R7XA 5L3FA 5GTIC 3HOTA 3DTIA 2DQRA 2LKSA 4I0BA 3MEXA 2IS4A 3S8PA 4CUGA 3GMEA 3HL2A 2VODA 1XDUA 3CESA 4HA8A 4J19A 5FGMA 4RM2A 5GP9A 5LLQA 4XSXF 2R7OA 3AAFA 1FIPA 2CWEA 2E1OA 3FIWA 4X1EA 1K4SA 2GA1A 4GFBA 4LB5A 1F43A 3W3CA 1EH8A 3LWFA 2E1CA 2PMUA 3TOBA 3ZN1A 1G3TA 2CQQA 3SXYA 2E1MC 3ZQGA 4RDUA 1LFPA 1ZHFA 2XGCA 4Y4RA 3ZOBA 2LDUA 4M3FA 1IRZA 2NS7A 3CF2A 2VPRA 3EQLF 2Y48A 5GAHJ 4BNCA 2H27A 1G6NA 1IW7F 3QU6A 2M1BA 4A6DA 3BDDA 1YX5A 4ZYAA 5IT9Z 1YI2I 4MTEA 5CVIA 1NG6A 2ELKA 2LNBA 4IO9F 1BIBA 4XQFA 2AO9A 2EH3A 1EH7A 1I3QJ 1RR7A 3QYBA 3BTCA 3EDPA 3E1SA 4DNCA 1ZKGA 1AKHB 5HLHA 1Z6TA 2JK3A 3DPLC 3REOA 4BHBA 2L2OA 2IT0A 1P4AA 1D1AA 2WWYA 5FD5A 1J59A 1T95A 4LFUA 1KA8A 3ZQIA 3KZIC 3ABUA 4KN7X 3NWTA 3ECOA 2P81A 4A3FJ 3H3VK 4GYGA 4DJAA 1TWGJ 3F6OA 1BR2A 4QSHA 2L4MA 4HDUA 1ETKA 1I1GA 2CSOA 2LK2A 2XAGA 3O6BB 2K5CA 2LKXA 2M9HA 3K1MA 3CJQB 3P9IA 4AD9A 1VQ6I 5KAFC 5F6FA 3ZMVA 3DU6A 1XB4A 2HZDA 1MZBA 2GQQA 2VI6A 3BWGA 2OTJI 1BW5A 1P4WA 1XGNA 3ABMH 2K7LA 1ON1A 3ESWB 1MBGA 3G6EI 2VJIA 3BLYA 1JKPC 3NEUA 2H8WA 2L5QA 4NB5A 2VPLA 5TJJA 4IPAA 2RQQA 2LG4A 3PSFA 3OR2C 4P9UA 3HM5A 4L0ZB 2AHQA 4C9YA 4IQJA 1J0RA 5J3LA 1SFKA 3FM5A 4CCLA 1OCOH 2BHYA 4RAYA 1PDNC 3RYRA 4ZYHA 5CVRA 5IPAA 3N4MA 1J75A 1T56A 3CCSI 1G59A 4AIHA 1OFCX 4UUSB 2JMWA 2XF5A 3BQYA 1Z9CA 4A3CJ 5DCMA 2N8GA 4YIIA 4GDFA 4PUSA 1JKOC 4M73A 4KFCA 2KT0A 4XLHA 4EVIA 2HPIA 3DFGA 1R4MB 3ML6A 3CZ6A 1ACIA 4XKBA 3LSGA 3BPVA 1ZG5A 1FNNA 2BY0A 2K27A 1LJ9A 3MZHA 3I64A 3K4MA 4MTDA 3M8EA 2LFBA 4CCOA 5FFXA 4OAZA 2P7VB 2UXNA 5A2QK 1Y39A 2IVMA 5TISC 2B7EA 1BW6A 3QRFF 3K4NA 1Z91A 3BCBA 5DYMA 4C30A 2UXXA 5ILUA 1POGA 5HDGA 1MNDA 4BQQA 4KIBA 4YIRX 1HQCA 4HV5A 1GDTA 2BY1A 2O8XA 1YS7A 3ZQ7A 4R79A 2ZNYA 3GW2A 2I5UA 1AKHA 4IHXA 1LDKB 1D0ZA 2ESNA 1J7KA 1YIJI 1SEUA 1P7JA 4A6EA 1S7AA 4A3EJ 2AXLA 1N78A 4RGXA 2DA7A 4DZPA 3K1NA 1OCZH 2XRLA 3HHGA 1R58A 2OJED 1FT9A 3J80K 4P1WA 2FX0A 1ONVA 4YG2F 2VONA 2RN7A 2E34A 3TP3A 2RDPA 1W4MA 2GOMA 2Y2ZA 1QA6A 4L5EA 2VIXA 1ERDA 1LUJB 4FTHA 2HTJA 2M4KA 3KCCA 1UFMA 4E4HA 3SZGA 1SVLA 2ID3A 3X2QH 4ZZDA 1V55H 3CDIA 2CUJA 1D3YA 3LSHA 2M7AA 5AONA 4HPQA 5F0CA 4MIMA 5CLSA 3AG4H 1HSJA 2XSJC 3ISPA 5E1XA 1P4XA 4PSWA 4Q5SF 1YIOA 4NC8A 5M3FJ 2JRMA 2ME0A 2EV0A 4S05A 2HYGD 4BACA 3JRFA 2D2WA 4DGWB 3E5UA 4HNUA 2W1OA 1F5TA 1PYVA 1TT5B 4XONA 3M3YJ 3P5JA 2KQRA 5KK1A 3KYDB 1B59A 2B9SA 3TDZC 2KFDA 3FHZA 2ID6A 1RPWA 1GXQA 5EZHA 4EEFG 2XAQA 2W84A 1USTA 3OYAA 3RTRA 3T8TA 2QM3A 2QF7A 2EFNA 3K1PA 1Z7LA 4UUSA 3CCRI 2EJRA 3CJTB 1A5JA 1ON2A 2Z16A 3DKXA 4HX7A 5TGTA 1D5VA 2BHZA 1R1TA 3NWSA 5E20A 1TP4A 1NH3A 1UAAA 4J00A 1O57A 3M07A 1MJAA 3SEZA 3CO7C 1S72I 1IAWA 3S3NA 1ZQ3P 2HVSA 3HEFA 4JOMA 4BXXJ 3KE2A 4KMUX 4YFXF 2GIZA 3CJRB 4RAZA 2WAQN 3OYDA 2Z2SB 2VOPA 2JA5J 3DKWA 3EYIA 2L02A 2QSFX 2QGUA 3M8FA 1RUNA 3K6GA 5D6FA 4C3JJ 3GZNB 3ZMTA 3WTWC 1USSA 2KZVA 4XLAA 5IP6A 4JX5A 3HOVJ 1I3AA 5B3SH 2CV0A 3HYIA 3CCMI 5HLGA 3GLLA 1R49A 4N4NB 1LFUP 4H0EA 4PK4A 3CC4I 1O3SA 1R36A 4HQEA 2CO5A 2NVYJ 2OZ6A 3OIQA 1FOKA 2A5WA 3CF5F 2D5VA 4LLNA 1HC8A 3QPSA 1L0OC 3I54A 5EGOB 3S2HJ 4G12A 1ZG3A 4UXNA 2ZC2A 3BTLA 3BR3A 4FQGA 2EZKA 3T1BA 2CV1A 2HXOA 3WODF 1RR8C 4WX9A 1X19A 2JWTA 2QKLB 4YFKF 2GIVA 1XC5A 5HOOA 5C4JJ 1I6XA 2HDDA 1IN4A 3KP4A 2Y75A 4ENNA 3I58A 3KEOA 1WRJA 4KN4X 1K6OA 2HI3A 2ZXWH 2LVSA 5KVRA 2DFFA 2ELJA 1UHMA 3CDLA 3FXLA 2IPQX 2EZHA 5J8FA 2HQNA 1FBQA 1WGXA 2STTA 4LLGF 2Q2EB 3M7GA 3S1RJ 3JRHA 4EM1A 4IHTA 5C4XJ 2MLGA 1U0JA 3Q9VA 5A2QZ 2R5YB 3PFYA 1FJLA 1UB9A 1FBUA 5JLXA 2E2HJ 1JT6A 4OAYA 2G7HA 4F92B 1VQ8I 2ZMEB 1RC9A 4I6ZA 3QODA 3LA2A 1V5EA 3C2HA 3HRUA 1HW1A 3QPTA 3JRBA 1AA7A 1ZELA 2XC7A 4F91B 1G8XA 4YELA 3QP6A 2RC4A 4EJOA 2LD5A 1XD7A 3OV8A 3F23A 2GLOA 4OWRB 3CUQB 2DA4A 2EA2A 2VQLA 4XRFA 3Q9SA 4CCNA 2NVUB 2E71A 4M9ZA 5CVVA 2K85A 4MLOA 1WFXA 4LOCA 1ITYA 4CO8A 1BIAA 2YSRA 5F1JA 3J80Z 3DEUA 1KU9A 2KISA 2ZJRF 2RVCA 4KNYA 1YFHA 3RKWA 3OIPA 4AVPA 1IN6A 4KISA 4HZFA 1U78A 2XKPA 3TKYA 1WH7A 3BTJA 2HVRA 4XNFA 4AU7A 1ZARA 1B6AA 1XS9A 2HYJA 3K70D 3DP7A 2HDWA 1K83J 4B09A 4FT8A 1YITI 1WQ2A 3ABKH 3IAM2 4UY8I 4HAMA 1VQ7I 4KYWA 2R93J 3V4GA 4U0YA 2O5RA 4RMNA 5BPDA 4U87A 2XAJA 1ULYA 2WAEA 4BAYA 1IRGA 3BR0A 4I99C 3BJAA 1U5TB 1S7EA 2BY3A 2WC2A 2LR8A 2M34A 3FDYA 4QPOA 4C2UA 3H9JA 2G7UA 1V3FA 4F55A 1F9NA 1ZK8A 4S04A 3FXKA 3F21A 3FXQA 1PUFB 1CGPA 3EETA 1NG7A 1PVEA 2CYYA 2DN0A 3ZQHA 4AWXB 1MBFA 5B1BH 5D8LB 2LY1A 3L2VA 4OU0A 4MEXF 3B02A 3ZQLA 4BEHB 1XX5A 1YW8A 2MABA 3HC7A 2LY9A 5J4YA 2CQXA 4KIGA 4AVZA 5HLTA 3WGIA 2IP2A 4IRGA 2KIMA 1VQPI 2R7DA 2L9VA 4KT6A 1C0WA 2DPUA 2EPFA 5E17F 3BY6A 1KU3A 3JW4A 3V7CA 4D5CA 2GXAA 1SD6A 3EYYA 1SD4A 3IWZA 1BC7C 2QYOA 3PQKA 2JN6A 4V2GA 4CGZA 1IZ1A 4I98B 3RQ4A 1LE8B 5E8IA 4D9JA 3QOEA 3S3MA 4E7KA 5HS7A 1R00A 4XRMA 1I50J 2IGNA 1ZRFA 3A0BC 2GXGA 4B47A 2VE8A 5DDGA 5F0FA 2B63J 1BI2A 2DFEA 2KZGA 4MO7A 3OMYA 3GXOA 1B1BA 3HXLA 3E5QA 5K7ZA 3GTPJ 2ETHA 4RAFA 4F3QA 2LOOA 5H20A 5K7FA 2UZKA 1W7PA 1Y8QB 4AYBA 3CUQA 2W82A 5DD8A 4MGRA 3OYMA 2ZXJA 4J01A 3FXOA 1I5ZA 3DF8A 4UB6C 3LSJA 1OMIA 2X1EA 2DT6A 2IEKA 3FXRA 3VWBA 1G4DA 3SZTA 2RREA 4GGGA 1ZR4A 3FX3A 4HYEA 3PL8A 2GWRA 2XAHA 3BZCA 5ILVA 3MD2A 1TQIA 2XB5A 4L9NA 3ZMUA 5TRDA 4KICA 3F8NA 1OCRH 2A5YB 1UELB 1U3EM 5HDKA 4KDPA 3L9FA 4HRIA 1HCRA 1WHUA 3CCJI 4CSWA 5JVGF 5J1RA 5JI6A 1WPKA 2QWWA 4CYCB 2R4GA 2R7RA 3LA7A 3S14J 1TLHB 4DW6A 3QPHA 4EGYA 2I10A 2A6EF 1VNDA 3W2VA 4E7IA 4M9XA 3PUFA 3I55I 1IV6A 4UNOA 4XOTA 4OIPF 2XHKA 1XCBA 2R7VA 4XBFA 2R7QA 2R92J 2QVOA 2JT1A 1MSEC 2H6CA 3WGHA 2PQ8A 3HKZA 3FK7A 2CUFA 2Z1DA 1M1EB 3K2ZA 1L3LA 4ASNA 1PUFA 4U0WA 2EIMH 3AG1H 4BE2A 3OYHA 3ZPLA 3VYTB 2M2EA 4DOZA 4W97A 5ICCA 2K4JA 3SQNA 1ETOA 2NXNB 3KZYA 3CUQC 3MCZA 5IP9J 2IJLA 3WGGA 1IDZA 1LPQA 1TTYA 1MBHA 5FJ8J 5ILSA 3HOXJ 1ENHA 2UUZA 4E7ZA 5C44J 2W25A 1S8NA 1XMXA 3CP2A 5JFRA 2COBA 1HSTA 4PDKA 5FLVA 6PAXA 3W2WA 1J2XA 3E6BA 2P0WA 1Q1VA 1UG0A 4JYKA 2LRDA 4GXOA 1Y1WJ 3TOAA 3DEWA 1YJWI 1B8IB 4NC6A 3P9CA 5K1YA 2CUEA 2KHMA 2DFHA 4M74A 1LVAA 3JRAA 1HOMA 3S1NJ 3SJMA 2HVQA 1JE8A 1ZRCA 3KYCB 2EA4A 3WTVC 1A31A 2B0LA 4P55A 2K9MA 2BW3A 5ED4A 4GRIA 1YG2A 1IDYA 3HSRA 3M1EA 3JCUC 1OJLA 3E3VA 2IRFG 1E2XA 2MFZA 4M3BA 1OYWA 3DWLE 3ELKA 4U7DA 3CJNA 4XN0A 4JK1X 3Q0UA 2R7SA 3RDIA 2EIKH 3ROUA 1YE9A 3DBRB 2WTEA 2COMA 5DM7F 1OR7A 3EUAA 4WWCA 2BE5F 3I5UA 4LIVA 4HF2A 1MMGA 5F04A 1R5ID 1T39A 1RETA 5IP7J 2QQ9A 4RBOA 3R0AA 2KRHA 1DP7P 4IVNA 3FWEA 4N9HA 2HPMA 3EUKL 2ELHA 4IJAA 1JKQC 2TDXA 2LF7A 5E1ZB 2CW8A 2Q0OA 1Y1VJ 2XF7A 1BJAA 2EFOA 1VF9A 2PMZN 2LLKA 3DBLB 1CF7B 3P7NA 4V19K 1SANA 3HDDA 1BBYA 1SFXA 3K4CA 4BXFA 3S32A 1FTTA 2L54A 4CYCA 4Z2YA 3I4NJ 2EZIA 4EM2A 1X4PA 1I6HJ 3LQRA 4XLNF 2E2JJ 2Y0SA 3TO9A 3FF5A 1E0EA 3HSFA 2MD5A 2NYXA 3SFZA 3FBNB 3I56I 5LFAA 2DTZA 2MLKA 5DM6F 2Z99A 4IQ4A 4PJJA 3TO6A 1JHHA 4XRSG 1RIOH 2NOJB 1KYZA 3KETA 1ODDA 2MG4A 2L7FP 4OMYA 2DYSH 3F72A 1FMVA 1ETXA 3MN2A 5HVQC 3DBHB 2FBHA 5IYCJ 1QZYA 1JTXA 2XV4S 3I71A 2KMUA 2VBWA 2XIGA 2JJ7A 2LC2A 3ZMDA 2E1NA 3H36A 3L2CA 3K4JA 3H1CA 4X6AJ 1BI0A 2RNJA 5F0HA 2A05A 4E70A 3KP7A 3RPUD 1FYMA 3IH2A 1OR7C 2OPTA 4IL6C 2JSCA 3KP5A 1T33A 2HOTA 4A3JJ 2VJJA 3A1YA 3L1PA 2J5PA 2MH2A 1K7AA 4G7OF 1F1ZA 4DYRA 5BOXA 2V6EA 4I0AA 2VLAA 4DZJA 1E17A 1V5FA 4XIDA 3I59A 4UV8A 2DFIA 1J9IA 1JGGA 1ZH5A 5BQTA 2BEOA 1IXSB 3L7WA 2LH9A 2BZTA 2RAEA 2HKOA 2EFWA 1Z7UA 1K78B 2YS9A 3WTZA 2VQGA 5CVJA 4PFPA 4EJUA 2V4JC 4KT5C 1TQMA 3PO2J 1DUXC 2O03A 5HS8A 2WB1A 1U2WA 3MQ0A 3V8JA 3L2WA 1SMYF 2DW4A 2XGDA 4G8XA 1OLTA 1R9TJ 2CV2A 5DV5A 1G3SA 4GYIA 3IH4A 1XSDA 1W0TA 2L7KA 5L3CA 2A61A 1BR4A 3L2RA 3OYBA 2R7ZJ 3WU0A 4Y13A 2XKOA 3LOCA 2CFOA 2K9QA 4UVAA 1JUMA 1H9TA 1UCRA 1WH5A 1JTYA 2OQGA 2OV7A 4CA0A 4DQ2A 1NK2P 4A2UA 2DMNA 2VOOA 4LJZF 3F3XA 1CF7A 1W0UA 1ZGAA 3JTHA 2BV6A 1DU6A 4ESBA 1K61A 2A07F 2PJPA 5FROA 4XR6A 4XK4A 3LQQA 4NDLA 2A3SA 4A3MJ 1X1DA 5L3EA 3PM1A 1XG1A 3FKIJ 1YLFA 3COAC 2P8TA 2RQPA 4ZC3A 4G6TB 3AL0B 3O8HA 2QBYB 4XLCA 3RZDJ 4DBRA 2GZWA 4YEJA 4XICA 3C18A 1A6QA 1FMWA 2Y30A 3H3ZA 3A0HC 3ZQFA 2ECBA 1YJNI 1OYYA 4E7JA 1WWXA 5E79C 4B48A 2DPDA 3FXMA 1IXCA 3BR5A 5K5RA 5FKMA 2WY8Q 2LYCA 1Y56A 3IC7A 4XMYA 5CVUA 2R7TA 4EGZA 1ZGJA 3MZ8A 2CRGA 2BYVE 3CQZJ 1RUOA 3LL7A 4M3GA 1T0FA 2KIUA 2W00A 2HR3A 3VODA 2MGQA 3ERMA 1HBXG 2KP6A 4Y33A 2K40A 3BPXA 2L9NA 4RLFA 5E8GA 1MD0A 5CPRB 5B5EC 3CP8A 2IBDA 1O7FA 4BS9A 3G71I 5EZGA 3GZ5A 5FLXK 4LIUA 3TO7A 1R6RA 4BHCA 2X85A 1EKEA 2VBXA 3G73A 2MC3A 5CJ9A 3TDUC 2XPWA 4WXDA 4CDGA 2FA5A 2CQKA 3U1KA 3A02A 2VQHA 3OOUA 2ACJA 4NNJA 2L7MP 2M0MA 1YYVA 2X4HA 1MH3A 1B9MA 3H5RA 5KCMA 3RYPA 2L9RA 3IKTA 2NVXJ 5B1AH 3CCQI 3ZN0A 3MKLA 3T5XA 2QLZA 2BGCA 3HTUA 3ZGKA 4ZTJA 1YJ9I 2CH0A 2EILH 1JJ6C 1HXDA 2OC6A 2DCEA 2EBIA 1XMAA 3O8GA 4ESJA 3F8MA 1IUYA 1VQ9I 4MFDA 2ZSIB 4CCJA 2R7UA 1QPIA 2V1XA 4BE1A 3B6CA 1QZZA 2WV0A 2ZKZA 1GV5A 1RZ4A 4HEA2 3GZ6A 1Z1DA 2PG4A 3F8CA 4IF4A 1ZAOA 2MW8A 3GFLA 4MFEA 3DEEA 1S9HA 2O8KA 4EMSA 3K9TA 1FIAA 4M71A 4E6KG 2XPUA 3S17J 4E7SA 2CG4A 5LGTA 1K79A 1BJZA 2DTRA 5LEKA 3BROA 5EG0B 4A3IJ 1T0FC 3S15J 4YFNF 4PGHA 4JQFA 1J09A 3HPHA 4BH9A 5LHHA 1YRNB 2DA2A 2H94A 2DAOA 4XM3A 1HLVA 5FKKA 1S6LA 1JI8A 4XKCA 4HF0A 4KA4A 1IRXA 2OA4A 1W1WE 3Q0WA 3Q0VA 3JRDA 4DYCA 2V79A 3QU3A 2XDVA 4BY1J 4ON0A 4NBQA 4XL9A 3OSFA 1MMSA 1JXSA 4LK1F 2CJJA 4Y7NJ 2FD5A 2DK8A 1DGRM 5LHGA 1QVUA 3UNGC 3K69A 3VSKA 1X2NA 3K70C 1FOYA 2BVLA 4LG0B 5CYVA 1SMTA 3F9KA 3G4SI 2FOWA 3HPGA 2IA2A 3RSNA 2JZYA 4XRSA 2PEXA 2MSYA 3ABTA 3SYTA 3BTIA 3IRQA 3HRMA 4HBLA 2M4GA 4XOPA 1IXRC 2MBFA 2CU7A 4XSZF 2ADUA 3J7ZI 3HIFA 1SVMA 3SFIA 1MW7A 3GTLJ 4GO1A 3IV5A 1XGMA 5AIQA 2BXYA 1WI9A 3GFMA 4IHWA 3GO5A 4F52A 2L9SA 5H2FC 1LNWA 4CXFA 1GHCA 1X1AA 3QP5A 1FOXA 2DQLA 1VQOI 2EFPA 1XSXA 3HZJA 4ITVA 4I09A 3LNQA 2QCOA 3BZ6A 2QEXI 4BQOA 3E6DA 2FJ1A 4CYDA 3AG3H 3D5LA 1W5CC 1X1BA 4M9SA 1UMQA 2HQAA 3OS1A 2L4AA 3EUHA 5J47A 4LGWA 1TWHJ 3DTEA 3F6VA 1ETVA 2DA5A 1UJ8A 2FRHA 3JTGA 1BOBA 1O4XA 3JSOA 4ANJA 1VQNI 2NS0A 4UUTA 2M5WA 1MJ9A 3BR2A 3CO6C 1T2KA 4NQWB 3AL0C 2NVQJ 2K9NA 3E5XA 2VXDA 2K9LA 5M5XJ 4EJWA 1DQUA 4A93J 3RKXA 1MBEA 1ORKA 4V2FA 2IGMA 4O3MA 5CQEA 5L3BA 3L2QA 3HB9A 4C2TA 2QENA 3IP4B 4HNVA 1FLIA 4BGDA 2O7OA 5IOYA 2Y31A 3FXUA 2DT7B 5LGUA 2V9VA 4ABZA 2DDBA 2XROA 2HFHA 3OIOA 1TW3A 3GCMA 1AU7A 4AC0A 4G94A 4L9JA 3LFKA 1TWFJ 1FPQA 4A3KJ 2LBFB 1W36C 5FLXZ 1IRFA 3QAHA 2F48A 3OR1C 1KONA 3CCVI 1YX3A 3FBIB 1AHDP 5EEAA 2WA0A 4QPQA 1A6IA 4IOAF 4N9IA 4RB3C 4C2MJ 4B3AA 1R4NB 2DU9A 4EJTA 5HNFA 1AOYA 4B43A 1V4RA 3GFJA 1VI0A 1H88C 1MDMB 3UR3C 1BM9A 1TT0A 3EUHC 5ICEA 1AWCA 1FP1D 3IHUA 5D5WB 2O9LA 3IAS2 3CLOA 2P7CB 2FXAA 1QBJA 4CHUA 1HF0A 2LTPA 3TL4X 3LA3A 5L3GA 4P96A 1RNLA 2ME6A 3RI4A 4KMFA 2F6CA 3HTSB 1IJWC 3OWTA 4RA2A 2AQFA 4IRIA 4Y52J 3IWFA 1TBXA 1VZ0A 3WTTC 5GADJ 1DDNA 3BG7A 2KIFA 3C7JA 5EGOA 1EA3A 2CQ7A 5EF6A 4G7HF 5FLMJ 4IXAA 1TNTA 3OYLA 4M3EA 4ZZLA 1LQ1A 2MA3A 5LEJA 3OSGA 3I4MJ 1UHSA 2OF7A 2FSWA 3F8BA 2X6WA 1OPCA 1WJ5A 4N4OB 1MKMA 4LD5A 4I01A 4ETSA 2ZNZA 2QQ8A 4UUVA 1X3WB 4RB0A 1D1BA 3A01B 4M6VA 1O3RA 2PX9A 3FISA 1GXPA 1HA8A 2KJBA 4P9FA 2M3AA 1ZTRA 1DU0A 3GBGA 3U2RA 2AXTC 2Q2EA 3I53A 2Q1ZB 1JGSA 1HDDC 1OKRA 2F5CA 4LMYA 3WG7H 1I27A 3H0DA 2ESHA 2R5YA 2BY2A 3MKYB 2M7BA 3HOUJ 4ZYDA 2VUMJ 2TRTA 3SEQA 5BMZA 3HUGB 2ZMEA 4M3DA 2L0KA 3WHBA 5EJCA 3RKYA 4MEYF 1YO5C 2P5VA 4BJ6C 1Z3XA 4G6DA 4JP0A 3TW7A 3DQVC 3DCFA 2DOFA 1D8KA 3OYJA 1H8AC 1U6GA 2FOKA 1X2MA 1TWAJ 2E1MB 3RPUA 3FZVA 3SDGA 3HBLA 1VQKI 2VB6A 1KYWA 2OBPA 3H92A 3NARA 5E18F 1WJCA 1ZR2A 1OISA 4MHGA 2O0YA 1IGNA 3VSLA 1BR1A 2IGKA 4BU2A 5JVTA 4AUXA 2P6SA 2WBMA 1O3QA 4HG2A 5HNHA 4AYBN 3HGGA 3E6MA 1LDJA 4I76A 5H6QA 5GAGJ 3RZOJ 1I1SA 3HHHA 2VKVA 4XLEA 4A3DJ 5GTHC 2R5ZB 3LSKA 2UWMA 1R7JA 3AG2H 4BUPA 1YW7A 3PQJA 3TQNA 2BVMA 3GTJJ 2JQ7A 4Q4ZF 3HRSA 4OIOF 2YU9J 1Y6IA 2WADA 3H35A 2STWA 2F5DA 1U8RA 1QU3A 3N05A 2LMDA 1XTAA 1GVDA 2GBYA 4LITA 2Y9YA 1WI3A 4PGGA 1U5TA 2FMYA 4HSRA 2KPMA 1HDPA 4UVBA 2W57A 2M8GX 1WJDA 2QQBA 2VKEA 2ZMEC 3ERED 2W48A 4OMZA 3TW6A 2GA2A 3D5SC 2VL8A 2A68F 3A03A 3GUDA 3CD6I 2AS5F 1A04A 1GVJA 3QYFA 4BEHA 1I39A 2HTSA 5F27A 5FRMA 3O2PE 5F1RA 5JHUA 4RGSA 4B4CA 5EYRA 3HKZN 3FMSA 2F5VA 3MWMA 5FRNA 5HLIA 1EF4A 4CH7A 2V1NA 2XASA 2VT3A 3G3ZA 4DIQA 1X58A 1MMAA 1R5HA 4AIJA 3OY9A 2DXIA 3KYLA 2OTLI 3BG3A 1FOWA 3ZR8X 4CZZA 1DP3A 4EV0A 1LE8A 1FC3A 2V7FA 4IEJA 1BOAA 4RB2C 1VQ5I 4A3GJ 2FMLA 2V6CA 1VQLI 1B72B 2JVGA 2CQNA 2F4IA 5D5UB 2YUSA 4EJVA 3C2GA 2DMUA 3S2WA 1Z0XA 2OCCH 1IN8A 2EB7A 3VYRB 5D8KB 2KDOA 2QZ8A 3C1DA 2VKDA 4ZTFA 1R71A 4L9TA 1H0MA 3PO3J 1WJFA 4PCQA 4Y15A 5J40A 1U5TC 3R0JA 2EWNA 4FX4A 2KLOA 2ICWG 1IV8A 2RKHA 1ETQA 1X3UA 3KPHA 1D1CA 3W2AA 1V54H 3T0YA 3PUBA 4JX4A 3UKGA 1DPUA 4FETA 1D8JA 2OQRA 1P2FA 2X1DA 4WCGA 1TNSA 1Y8RB 5EEHA 2KDZA 4IHSA 3WTSC 2LF8A 1TC3C 2IS6A 3G1MA 1VTNC 3W6KB 1LFBA 4WXCA 4G7ZF 2Z5UA 4II3A 1B4AA 1TL8A 2IS2A 2DA3A 3RIRA 5L3DA 2Z3YA 3VEPA 4XLFA 3ZCOA 5J1YA 3TBIA 2LY2A 3HGYA 4I7HA 4WF2A 1FSHA 4RAGA 1LKXA 1FYLA 5F08A 3MKWB 3CUOA 2JTVA 3VYSB 4NUBA 1S29A 5D5XB 1FBSA 2NS8A 1N75A 2LKPA 5ERIA 2ZXHA 3RQIA 3BG9A 4RB1A 4BJ5C 2CW0F 2DDAA 4DYQA 2DLLA 3ZQQA 1TQPA 4Y3OA 4JX6A 5DCMB 4Z6YA 5E1WA 1LB2A 3K4KA 2BXZA 2Y0SN 2FBIA 2MYSA 2Y0MA 3V42A 1BN5A 2V9PA 5DUIA 3B73A 4M6YA 2A6TA 1GT0C 3LAPA 2H1KA 2K3FA 1WSUA 1IF1A 3CTAA 3CMAI 2HS5A 3GF2A 1JUPA 2VN2A 3WHCA 2QSHX 3M9AA 5BS6A 3BR1A 1XCVA 2GM4A 4BQNA 2KKOA 4HX4A 4IKFA 2C6YA 2D1HA 1FY7A 1BA5A 3PNVA 2YPRA 4BYYA 1ETYA 3E6CC 3DXJF 4ZJZA 2XVCA 1D0XA 1UHWA 1Z6RA 2M30A 2ZO4A 3R4KA 1OCCH 3AFHA 3K4BA 3L00A 3KIOA 1SFEA 1JKRC 3VDXA 3H0GJ 1B8IA 2HU9A 4BHPA 2OD5A 2JUGA 2NNYA 2FBKA 3JSPA 1W7PD 3VPRA 4TV7A 1B72A 3JRGA 2FEZA 3J7AY 3JAMK 3H9QA 3ZP5A 3N97A 5KAIC 5D5VB 2JUCA 1R1UA 4A0YA 4ZYEA 1HKSA 1SC7A 3QPLA 2FF4A 3PNTA 2TCTA 1WKMA 2K02A 3OL4A 2X48A 1APLC 5LGNA 4A3BJ 1QZEA 4ZH4F 5FKNA 2M8EA 1F36A 5FO5A 2HEOA 3K0LA 3GVAA 3LSIA 2WB1N 1U8BA 9ANTA 2ISYA 2YU3A 1YS6A 3G1LA 4F93B 4LB6B 1R22A 2I8DA 3DKYA 3TP0A 2CW7A 2AQEA 3QOPA 5J6XA 3D1NI 4N0BA 2ISZA 2LP0A 3CCUI 2QA4I 2O61A 2DO7A
chains in the Genus database with same CATH topology
4XRSA 2MSYA 2LY9A 1NK3P 3BTIA 2CQXA 2HQ5A 2CU7A 2DA6A 2HOSA 5DTDA 3SFIA 3GTLJ 3TEDA 1GUUA 4D5CA 3IV5A 1FEXA 1BL0A 2R5ZA 4IHWA 3IH3A 4B1RA 3BT9A 5K7HA 2JN6A 4V2GA 1RESA 1LE8B 4FCYA 5BNGA 4W1UA 2QCOA 2X6OA 4XRMA 1I50J 3LNQA 2FJ1A 5E3LA 4C3IJ 1RKWA 2B63J 1JUSA 5F0FA 4MO7A 1UMQA 5K7ZA 3GTPJ 1TWHJ 1ETVA 2DA5A 1O4XA 1IC8A 5K7FA 4J19A 4UUTA 5GP9A 3BR2A 4QIWN 1FIPA 3G1OA 2E1OA 3FIWA 2K9NA 4X1EA 2NVQJ 5M5XJ 3BG5A 4GFBA 3LSJA 1F43A 4A93J 5FKLA 2IEKA 1MBEA 1ORKA 4V2FA 1ZR4A 2CQQA 3HB9A 3ZQGA 4RDUA 4BBRJ 2XGCA 3ZOBA 2XB5A 2XGEA 4M3FA 4HNVA 2NS7A 1IRZA 2O7OA 2VPRA 5IOYA 2JA6J 2Y31A 2DJNA 4ABZA 1HCRA 5E3OA 2ELKA 3OIOA 5J1RA 1WPKA 4CYCB 2AO9A 2EH3A 1AU7A 4AC0A 1TWFJ 1I3QJ 3S14J 1QRYA 4DW6A 4A3KJ 3FK6A 1RR7A 3LSRA 2I10A 3BTCA 4D7NA 1VNDA 1ZKGA 1AKHB 1IV6A 2JK3A 1AHDP 2JA7J 5EEAA 2R92J 1A6IA 1MSEC 4C2MJ 4B3AA 3ZQIA 3FK7A 2CUFA 1H88C 1VI0A 1VFCA 1PUFA 2P81A 3MVPA 4A3FJ 3H3VK 2O9LA 3ZQCA 1TWGJ 2M2EA 4W97A 4QSHA 5IOZA 1ETKA 1ETOA 2LK2A 1HF0A 2LTPA 2LKXA 2M9HA 4S0HB 3HOYJ 3S16J 2ME6A 5IP9J 5EDNA 1IDZA 3LSPA 1FTZA 1JJ8C 1IJWC 1MBHA 5FJ8J 4Y52J 2M0CA 1ENHA 3HOXJ 4BY7J 3RKQA 5C44J 3JREA 5EGOA 2VI6A 2COBA 5FLVA 5EF6A 5FLMJ 1BW5A 1MBGA 2NVTJ 1Q1VA 4JYKA 2EQRA 3NAUA 1JKPC 1Y1WJ 4M3EA 3DEWA 1B8IB 3OSGA 5JLWA 3I4MJ 1UHSA 2OF7A 2CUEA 3HM5A 3JRAA 1HOMA 2XB0X 3S1NJ 3GTQJ 2AHQA 3SJMA 3K7AJ 5J3LA 1U9OA 2EZLA 3BQZA 3A01B 4M6VA 5IPAA 3GTKJ 3JRIA 1T56A 1IDYA 1OFCX 3FISA 1OJLA 4UUSB 2JMWA 4M3BA 3BQYA 2G0EA 1OCTC 1ZTRA 4A3CJ 1UG2A 1DU0A 2N8GA 1JKOC 3GBGA 3Q0UA 2KT0A 5GPAA 4C3HJ 1HDDC 3LSGA 5GPCA 2R5YA 5F04A 3BR6A 1RETA 3HOUJ 2ECCA 5IP7J 2R0QC 4RBOA 2VUMJ 2TRTA 2LFBA 5E3NA 4M3DA 2L0KA 3WHBA 1JKQC 1Y1VJ 1Z77A 4JP0A 3TW7A 1VF9A 3DCFA 1BW6A 2PMZN 2LLKA 1H8AC 1SANA 1X2MA 3HDDA 1POGA 3M4OJ 1TWAJ 3SDGA 2HXIA 4IHVA 3HBLA 4CYCA 1FTTA 1GV2A 3NARA 3I4NJ 3B6AA 1ZR2A 1GDTA 2EZIA 1IGNA 1I6HJ 2FQ4A 2DA1A 2E2JJ 4FISA 1AKHA 4IHXA 4AUXA 2DMTA 1P7JA 1IUFA 3S1MJ 2DTZA 4AYBN 3HGGA 4I76A 4A3EJ 3RZOJ 5M5WJ 4XRSG 2DA7A 4DZPA 2VKVA 4A3DJ 5EG0A 1NTCA 2XRLA 2R5ZB 2MG4A 2L7FP 2FX0A 1ETXA 5IYBJ 3MN2A 1H89C 1YRNA 2DMPA 3S1QJ 3GTJJ 5IYCJ 1JTXA 3TP3A 2Y2ZA 2JJ7A 4L5EA 2YU9J 4FTHA 4X6AJ 2ID3A 1MBJA 5F0HA 1GVDA 2GBYA 3IH2A 2OPTA 2Y9YA 3GTMJ 1WI3A 5F0CA 4MIMA 1T33A 2HOTA 5M5YJ 4A3JJ 1HDPA 5M3FJ 2ME0A 2M8GX 2VKEA 3L1PA 2W48A 3TW6A 3JRFA 4DYRA 3A03A 4DZJA 4XIDA 3M3YJ 2WV1A 1JGGA 5F27A 1D5YA 4B4CA 2ID6A 5EYRA 3HKZN 2RAEA 1RPWA 5EZHA 4EEFG 1EF4A 2YS9A 4FE4A 2QF7A 1QVTA 1CQTA 1X58A 4UUSA 3PO2J 1A5JA 2E19A 3HOWJ 1OCPA 4FE7A 2X9DA 2XGDA 3BG3A 1R9TJ 1WCMJ 5E3MA 1LE8A 3IH4A 1W0TA 1ZQ3P 4IEJA 3HEFA 4A3GJ 4BXXJ 3F0CA 4IHYA 1B72B 2L7ZA 2R7ZJ 1ETWA 2YUSA 2WAQN 3LOCA 2JA5J 2K9QA 1JUMA 1G2HA 2DMUA 1WH5A 1Z0XA 1JTYA 1NK2P 4C3JJ 2DMNA 1MNMC 3PO3J 5IP6A 4JX5A 1W0UA 3HOVJ 1LFUP 1DU6A 1K61A 1U9NA 1ETQA 4XK4A 2NVYJ 4JX4A 4NDLA 3UKGA 4A3MJ 2D5VA 3PM1A 1XG1A 3FKIJ 3QPSA 2JA8J 3E7LA 3O8HA 5EGOB 2KDZA 3RZDJ 3S2HJ 4G12A 4XICA 2XSDC 2K9SA 3ZQFA 2Y30A 3GTGJ 3BTLA 1TC3C 2ECBA 3BR3A 3G1MA 1JT0A 1LFBA 2EZKA 2ZB9A 3BR5A 5FKMA 2HXOA 2JWTA 2DA3A 1XC5A 2CRGA 3CQZJ 5FKOA 5J1YA 5DS9A 1ZGWA 5C4JJ 4M3GA 2HDDA 3HGYA 2NOGA 2MGQA 2Y9ZA 3C2BA 2K40A 5F08A 2HI3A 2LVSA 4BBSJ 2NS8A 4D5FA 3CMYA 5HODA 2IBDA 3BG9A 3CCYA 3CDLA 3RQIA 2EZHA 5EZGA 4DYQA 4JX6A 3QQAA 1WGXA 2Y0SN 3S1RJ 3HOZJ 3JRHA 2H8RA 5C4XJ 5IYDJ 2XPWA 1GT0C 2R5YB 2H1KA 3A02A 1FJLA 3OOUA 5JLXA 2E2HJ 1MSFC 1JUPA 2L7MP 3WHCA 1JT6A 1SFOJ 3BR1A 1MH3A 2IAIA 1MBKA 2GM4A 4I6ZA 2L9RA 3JRBA 2NVXJ 1BA5A 3MKLA 1ETYA 2LD5A 4QTRA 1JJ6C 2GLOA 1TWCJ 2DA4A 2DMQA 2EBIA 3O8GA 1JKRC 4MFDA 1QPIA 3H0GJ 3Q3SA 4LOCA 4MLOA 1B8IA 1ITYA 3B6CA 1GV5A 5F1JA 2HOAA 5M3MJ 2MW8A 4MFEA 3VPRA 2O8KA 1E3OC 1B72A 1FIAA 3S17J 2XPUA 5C3EJ 3JRGA 1BJZA 3JRCA 3A01A 4A3LJ 1U78A 5EG0B 1WH7A 3BTJA 4A3IJ 4A69C 3S15J 2XPVA 1XS9A 1P7IA 1YRNB 2HYJA 3QPLA 2DA2A 1K83J 2TCTA 1APLC 4D7MA 2X48A 3W6VA 1HLVA 5FKKA 2E2IJ 4A3BJ 5FKNA 2R93J 1F36A 1IG7A 3Q0WA 2WB1N 3Q0VA 3JRDA 1U8BA 9ANTA 4DYCA 3BR0A 4BY1J 3G1LA 3K2AA 3JR9A 1S7EA 3OSFA 2LR8A 2M34A 1RKTA 2CJJA 4Y7NJ 2FD5A 5J1UA 3TP0A 1MH4A 1QVUA 3S2DJ 1ZK8A 1X2NA 4BKXA 1PUFB 2DN0A 3ZQHA 3D1NI 1MBFA 2LP0A 3ZQLA 3GTOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS A;  2MSY A;  2LY9 A;  1NK3 P;  3BTI A;  2CQX A;  2HQ5 A;  2CU7 A;  2DA6 A;  2HOS A;  5DTD A;  3SFI A;  3GTL J;  3TED A;  1GUU A;  4D5C A;  3IV5 A;  1FEX A;  1BL0 A;  2R5Z A;  4IHW A;  3IH3 A;  4B1R A;  3BT9 A;  5K7H A;  2JN6 A;  4V2G A;  1RES A;  1LE8 B;  4FCY A;  5BNG A;  4W1U A;  2QCO A;  2X6O A;  4XRM A;  1I50 J;  3LNQ A;  2FJ1 A;  5E3L A;  4C3I J;  1RKW A;  2B63 J;  1JUS A;  5F0F A;  4MO7 A;  1UMQ A;  5K7Z A;  3GTP J;  1TWH J;  1ETV A;  2DA5 A;  1O4X A;  1IC8 A;  5K7F A;  4J19 A;  4UUT A;  5GP9 A;  3BR2 A;  4QIW N;  1FIP A;  3G1O A;  2E1O A;  3FIW A;  2K9N A;  4X1E A;  2NVQ J;  5M5X J;  3BG5 A;  4GFB A;  3LSJ A;  1F43 A;  4A93 J;  5FKL A;  2IEK A;  1MBE A;  1ORK A;  4V2F A;  1ZR4 A;  2CQQ A;  3HB9 A;  3ZQG A;  4RDU A;  4BBR J;  2XGC A;  3ZOB A;  2XB5 A;  2XGE A;  4M3F A;  4HNV A;  2NS7 A;  1IRZ A;  2O7O A;  2VPR A;  5IOY A;  2JA6 J;  2Y31 A;  2DJN A;  4ABZ A;  1HCR A;  5E3O A;  2ELK A;  3OIO A;  5J1R A;  1WPK A;  4CYC B;  2AO9 A;  2EH3 A;  1AU7 A;  4AC0 A;  1TWF J;  1I3Q J;  3S14 J;  1QRY A;  4DW6 A;  4A3K J;  3FK6 A;  1RR7 A;  3LSR A;  2I10 A;  3BTC A;  4D7N A;  1VND A;  1ZKG A;  1AKH B;  1IV6 A;  2JK3 A;  1AHD P;  2JA7 J;  5EEA A;  2R92 J;  1A6I A;  1MSE C;  4C2M J;  4B3A A;  3ZQI A;  3FK7 A;  2CUF A;  1H88 C;  1VI0 A;  1VFC A;  1PUF A;  2P81 A;  3MVP A;  4A3F J;  3H3V K;  2O9L A;  3ZQC A;  1TWG J;  2M2E A;  4W97 A;  4QSH A;  5IOZ A;  1ETK A;  1ETO A;  2LK2 A;  1HF0 A;  2LTP A;  2LKX A;  2M9H A;  4S0H B;  3HOY J;  3S16 J;  2ME6 A;  5IP9 J;  5EDN A;  1IDZ A;  3LSP A;  1FTZ A;  1JJ8 C;  1IJW C;  1MBH A;  5FJ8 J;  4Y52 J;  2M0C A;  1ENH A;  3HOX J;  4BY7 J;  3RKQ A;  5C44 J;  3JRE A;  5EGO A;  2VI6 A;  2COB A;  5FLV A;  5EF6 A;  5FLM J;  1BW5 A;  1MBG A;  2NVT J;  1Q1V A;  4JYK A;  2EQR A;  3NAU A;  1JKP C;  1Y1W J;  4M3E A;  3DEW A;  1B8I B;  3OSG A;  5JLW A;  3I4M J;  1UHS A;  2OF7 A;  2CUE A;  3HM5 A;  3JRA A;  1HOM A;  2XB0 X;  3S1N J;  3GTQ J;  2AHQ A;  3SJM A;  3K7A J;  5J3L A;  1U9O A;  2EZL A;  3BQZ A;  3A01 B;  4M6V A;  5IPA A;  3GTK J;  3JRI A;  1T56 A;  1IDY A;  1OFC X;  3FIS A;  1OJL A;  4UUS B;  2JMW A;  4M3B A;  3BQY A;  2G0E A;  1OCT C;  1ZTR A;  4A3C J;  1UG2 A;  1DU0 A;  2N8G A;  1JKO C;  3GBG A;  3Q0U A;  2KT0 A;  5GPA A;  4C3H J;  1HDD C;  3LSG A;  5GPC A;  2R5Y A;  5F04 A;  3BR6 A;  1RET A;  3HOU J;  2ECC A;  5IP7 J;  2R0Q C;  4RBO A;  2VUM J;  2TRT A;  2LFB A;  5E3N A;  4M3D A;  2L0K A;  3WHB A;  1JKQ C;  1Y1V J;  1Z77 A;  4JP0 A;  3TW7 A;  1VF9 A;  3DCF A;  1BW6 A;  2PMZ N;  2LLK A;  1H8A C;  1SAN A;  1X2M A;  3HDD A;  1POG A;  3M4O J;  1TWA J;  3SDG A;  2HXI A;  4IHV A;  3HBL A;  4CYC A;  1FTT A;  1GV2 A;  3NAR A;  3I4N J;  3B6A A;  1ZR2 A;  1GDT A;  2EZI A;  1IGN A;  1I6H J;  2FQ4 A;  2DA1 A;  2E2J J;  4FIS A;  1AKH A;  4IHX A;  4AUX A;  2DMT A;  1P7J A;  1IUF A;  3S1M J;  2DTZ A;  4AYB N;  3HGG A;  4I76 A;  4A3E J;  3RZO J;  5M5W J;  4XRS G;  2DA7 A;  4DZP A;  2VKV A;  4A3D J;  5EG0 A;  1NTC A;  2XRL A;  2R5Z B;  2MG4 A;  2L7F P;  2FX0 A;  1ETX A;  5IYB J;  3MN2 A;  1H89 C;  1YRN A;  2DMP A;  3S1Q J;  3GTJ J;  5IYC J;  1JTX A;  3TP3 A;  2Y2Z A;  2JJ7 A;  4L5E A;  2YU9 J;  4FTH A;  4X6A J;  2ID3 A;  1MBJ A;  5F0H A;  1GVD A;  2GBY A;  3IH2 A;  2OPT A;  2Y9Y A;  3GTM J;  1WI3 A;  5F0C A;  4MIM A;  1T33 A;  2HOT A;  5M5Y J;  4A3J J;  1HDP A;  5M3F J;  2ME0 A;  2M8G X;  2VKE A;  3L1P A;  2W48 A;  3TW6 A;  3JRF A;  4DYR A;  3A03 A;  4DZJ A;  4XID A;  3M3Y J;  2WV1 A;  1JGG A;  5F27 A;  1D5Y A;  4B4C A;  2ID6 A;  5EYR A;  3HKZ N;  2RAE A;  1RPW A;  5EZH A;  4EEF G;  1EF4 A;  2YS9 A;  4FE4 A;  2QF7 A;  1QVT A;  1CQT A;  1X58 A;  4UUS A;  3PO2 J;  1A5J A;  2E19 A;  3HOW J;  1OCP A;  4FE7 A;  2X9D A;  2XGD A;  3BG3 A;  1R9T J;  1WCM J;  5E3M A;  1LE8 A;  3IH4 A;  1W0T A;  1ZQ3 P;  4IEJ A;  3HEF A;  4A3G J;  4BXX J;  3F0C A;  4IHY A;  1B72 B;  2L7Z A;  2R7Z J;  1ETW A;  2YUS A;  2WAQ N;  3LOC A;  2JA5 J;  2K9Q A;  1JUM A;  1G2H A;  2DMU A;  1WH5 A;  1Z0X A;  1JTY A;  1NK2 P;  4C3J J;  2DMN A;  1MNM C;  3PO3 J;  5IP6 A;  4JX5 A;  1W0U A;  3HOV J;  1LFU P;  1DU6 A;  1K61 A;  1U9N A;  1ETQ A;  4XK4 A;  2NVY J;  4JX4 A;  4NDL A;  3UKG A;  4A3M J;  2D5V A;  3PM1 A;  1XG1 A;  3FKI J;  3QPS A;  2JA8 J;  3E7L A;  3O8H A;  5EGO B;  2KDZ A;  3RZD J;  3S2H J;  4G12 A;  4XIC A;  2XSD C;  2K9S A;  3ZQF A;  2Y30 A;  3GTG J;  3BTL A;  1TC3 C;  2ECB A;  3BR3 A;  3G1M A;  1JT0 A;  1LFB A;  2EZK A;  2ZB9 A;  3BR5 A;  5FKM A;  2HXO A;  2JWT A;  2DA3 A;  1XC5 A;  2CRG A;  3CQZ J;  5FKO A;  5J1Y A;  5DS9 A;  1ZGW A;  5C4J J;  4M3G A;  2HDD A;  3HGY A;  2NOG A;  2MGQ A;  2Y9Z A;  3C2B A;  2K40 A;  5F08 A;  2HI3 A;  2LVS A;  4BBS J;  2NS8 A;  4D5F A;  3CMY A;  5HOD A;  2IBD A;  3BG9 A;  3CCY A;  3CDL A;  3RQI A;  2EZH A;  5EZG A;  4DYQ A;  4JX6 A;  3QQA A;  1WGX A;  2Y0S N;  3S1R J;  3HOZ J;  3JRH A;  2H8R A;  5C4X J;  5IYD J;  2XPW A;  1GT0 C;  2R5Y B;  2H1K A;  3A02 A;  1FJL A;  3OOU A;  5JLX A;  2E2H J;  1MSF C;  1JUP A;  2L7M P;  3WHC A;  1JT6 A;  1SFO J;  3BR1 A;  1MH3 A;  2IAI A;  1MBK A;  2GM4 A;  4I6Z A;  2L9R A;  3JRB A;  2NVX J;  1BA5 A;  3MKL A;  1ETY A;  2LD5 A;  4QTR A;  1JJ6 C;  2GLO A;  1TWC J;  2DA4 A;  2DMQ A;  2EBI A;  3O8G A;  1JKR C;  4MFD A;  1QPI A;  3H0G J;  3Q3S A;  4LOC A;  4MLO A;  1B8I A;  1ITY A;  3B6C A;  1GV5 A;  5F1J A;  2HOA A;  5M3M J;  2MW8 A;  4MFE A;  3VPR A;  2O8K A;  1E3O C;  1B72 A;  1FIA A;  3S17 J;  2XPU A;  5C3E J;  3JRG A;  1BJZ A;  3JRC A;  3A01 A;  4A3L J;  1U78 A;  5EG0 B;  1WH7 A;  3BTJ A;  4A3I J;  4A69 C;  3S15 J;  2XPV A;  1XS9 A;  1P7I A;  1YRN B;  2HYJ A;  3QPL A;  2DA2 A;  1K83 J;  2TCT A;  1APL C;  4D7M A;  2X48 A;  3W6V A;  1HLV A;  5FKK A;  2E2I J;  4A3B J;  5FKN A;  2R93 J;  1F36 A;  1IG7 A;  3Q0W A;  2WB1 N;  3Q0V A;  3JRD A;  1U8B A;  9ANT A;  4DYC A;  3BR0 A;  4BY1 J;  3G1L A;  3K2A A;  3JR9 A;  1S7E A;  3OSF A;  2LR8 A;  2M34 A;  1RKT A;  2CJJ A;  4Y7N J;  2FD5 A;  5J1U A;  3TP0 A;  1MH4 A;  1QVU A;  3S2D J;  1ZK8 A;  1X2N A;  4BKX A;  1PUF B;  2DN0 A;  3ZQH A;  3D1N I;  1MBF A;  2LP0 A;  3ZQL A;  3GTO J; 
#chains in the Genus database with same CATH topology
 1XSV A;  1A36 A;  1Z3Y A;  1DGW Y;  1NK3 P;  4Q48 A;  1ZG1 A;  3BJ6 A;  3QWL A;  4CCM A;  2DA6 A;  1WVR A;  3P9K A;  1X4O A;  5DTD A;  1IO2 A;  3TED A;  2QUF A;  4HX8 A;  1GUU A;  2XUB A;  1T08 B;  2F5F A;  4NHJ A;  1FEX A;  1BL0 A;  4II2 A;  4PFO A;  4B1R A;  2FU4 A;  5K7H A;  2RGV A;  4AIK A;  2X6Y A;  1SD5 A;  2KIQ A;  2YR2 A;  3VOE A;  1RES A;  4UVC A;  3RPQ A;  4RLQ A;  4BQA A;  1XPX A;  3CMM A;  5BNG A;  4FCY A;  3GLX A;  2HKX A;  3H9G A;  4W1U A;  4KIF A;  4B8X A;  5E3L A;  4C3I J;  3ABL H;  1JUS A;  2DOE A;  5LHI A;  1K4T A;  1XN7 A;  4Y17 A;  3L09 A;  1QHH D;  1IC8 A;  2OCE A;  4IZZ A;  4QIW N;  1FX7 A;  4BDY A;  1KQ9 A;  3CCL I;  2V26 A;  3G1O A;  3CCE I;  2QKM B;  3BG5 A;  2ZFU A;  5FKL A;  2E60 A;  2YX4 A;  2P6T A;  1KQ8 A;  3SHF A;  2EIN H;  3WTU C;  3CLQ A;  4BBR J;  1BI3 A;  2E7X A;  3BCA A;  3ONQ A;  2XGE A;  3O3K A;  2ZJ2 A;  1K78 A;  4QLC U;  2DI3 A;  2KJC A;  2JA6 J;  2X51 A;  2KRF A;  1T98 A;  2DJN A;  1A35 A;  3F8F A;  1W5S A;  4HQM A;  2FUG 2;  5E3O A;  2A69 F;  2XF6 A;  4MQ9 F;  4CIC A;  2HOE A;  4HV6 A;  1XMK A;  2P4W A;  4U0V A;  1TZL A;  5LRS A;  4HLY A;  2X1C A;  1QRY A;  2O3F A;  1PJR A;  3FK6 A;  3LSR A;  3HSE A;  1LDD A;  4D7N A;  3FMR A;  1Q1H A;  1QNT A;  3WE2 A;  1R23 A;  4MQV A;  3U21 A;  4HW0 A;  2JA7 J;  3T8R A;  1R5G A;  2JSP A;  1T8I A;  2CFX A;  3M1C A;  1FZP B;  3PIP F;  5KNL A;  2R3S A;  3VYU B;  3ZRG A;  4YRV A;  4G6Q A;  1NHA A;  3L2U A;  1VFC A;  3OYI A;  3HG9 A;  3V7S A;  3MVP A;  4BXU A;  1Z05 A;  2M45 A;  3KEY A;  2P5K A;  3ZQC A;  5DD4 A;  4WXH A;  3PJR A;  5IOZ A;  3RCO A;  3SDB A;  4QWQ A;  4S0H B;  3HOY J;  3KFW X;  3MFK A;  3S16 J;  1MIJ A;  2PBI A;  5EDN A;  4XN3 A;  3LSP A;  3LFU A;  2IW5 A;  4AID A;  1FTZ A;  1JJ8 C;  4HDV A;  2M0C A;  3PFI A;  3KX2 A;  4PZJ A;  4BY7 J;  3RKQ A;  3JRE A;  2QBY A;  4ENM A;  4D1Q A;  3BG6 A;  3OYF A;  1S5L C;  2W85 A;  4RGR A;  2WAF A;  1IN7 A;  2WAQ A;  4K2E A;  2NVT J;  3K4L A;  1SAX A;  2EQR A;  3NAU A;  5JHF A;  3LMM A;  3CME I;  3JAM Z;  2H09 A;  2GAU A;  2L3D A;  3FHN A;  1G3W A;  5JLW A;  2VE9 A;  4ZDL A;  1F4K A;  5ICF A;  4L18 B;  1MMN A;  2XGX A;  5CKT A;  4OOI A;  2XRN A;  4M72 A;  1WJB A;  2XB0 X;  1WZ2 A;  3GTQ J;  1P9Q C;  4Q47 A;  3MMY B;  3K7A J;  1U9O A;  1TW2 A;  2JPC A;  2EZL A;  2PLY A;  3BQZ A;  2F4M B;  2RNG A;  3BZK A;  5CQG A;  3R60 A;  3BC8 A;  3GTK J;  3JRI A;  4X0G A;  2HZT A;  5DUK A;  3I9V 2;  1OCT C;  2G0E A;  4L9V A;  1UG2 A;  1WJE A;  1IN5 A;  5FFZ A;  1QPM A;  4LK0 F;  3CDH A;  3KP6 A;  2MD0 A;  1HW5 A;  4OIR F;  3VFZ A;  3OYK A;  3DV8 A;  5GPA A;  4EQQ A;  4C3H J;  2V9K A;  3NRV A;  5GPC A;  2R7F A;  3OS2 A;  4HOB A;  3BR6 A;  3OYE A;  3ZMZ A;  4P5O A;  2ECC A;  2R0Q C;  3FM3 A;  3HOS A;  5E3N A;  2HGC A;  4OIQ F;  5BPI A;  3I0T A;  1LEA A;  1XGO A;  1J5Y A;  2VJ4 A;  2PJR B;  4FX0 A;  2DJI A;  1Z77 A;  3KLN A;  1O3T A;  2MH9 A;  4L5I A;  2IXS A;  5D6E A;  4KIT B;  3M4O J;  4IHV A;  2HXI A;  5K5O A;  2VXZ A;  1GV2 A;  1MGT A;  4FHT A;  4A0Z A;  3ZXS A;  3B6A A;  5JR3 A;  4IRH A;  2NRA C;  5J4V A;  2FQ4 A;  2DA1 A;  4XOR A;  2EK5 A;  4XKW A;  4FIS A;  2E5Z A;  2A6H F;  4R8H A;  1OQY A;  1SVO A;  2DMT A;  5B66 C;  1IUF A;  2D1V A;  4H4K C;  4HNT A;  3S1M J;  2Z33 A;  5M5W J;  4A12 A;  3J7A O;  3ECH A;  5EG0 A;  2WY7 Q;  1NTC A;  3J81 K;  4JBA A;  3WG9 A;  1UZC A;  5IYB J;  3R61 A;  1SAU A;  1H89 C;  1SD7 A;  1YRN A;  2DMP A;  3DPU A;  3S1Q J;  4LLL A;  1B9N A;  3FKJ A;  1HW2 A;  2IA0 A;  3KLO A;  5HS9 A;  2W24 A;  1Z67 A;  2H6B A;  3FMQ A;  2KL4 A;  1ZLJ A;  2ZJP F;  5IY5 H;  1MBJ A;  1YTY A;  1Y0N A;  2EV6 A;  3GTM J;  3ASN H;  4RS8 A;  3KZZ A;  1MMD A;  5M5Y J;  2K3P A;  2VBZ A;  4NC7 A;  1W7P B;  3EPZ A;  4PJM A;  2L01 A;  1XGS A;  3S3O A;  3D5R C;  2QSG X;  1STZ A;  2GOX B;  5DEQ A;  4LG0 A;  2EV5 A;  3H3U A;  2MC4 A;  4BL0 B;  4U88 A;  4CZC A;  2IGO A;  2CS3 A;  2WV1 A;  2HDC A;  1LVK A;  1N77 A;  1D5Y A;  1EJ9 A;  2CMP A;  4E7L A;  2LRE A;  4G9Y A;  5EEG A;  1BI1 A;  1VQM I;  2PN6 A;  4A5M A;  3H5N A;  4FE4 A;  4GCV A;  1SFU A;  1QVT A;  1CQT A;  2YX7 A;  1O7L A;  3KP3 A;  4B44 A;  3GX4 X;  1HKQ A;  2E19 A;  2F4O B;  3HOW J;  1OCP A;  4FE7 A;  4E7H A;  2FNA A;  2ZFW A;  2X9D A;  3LST A;  1ZLK A;  2F2E A;  1FP2 A;  2V1U A;  1WCM J;  4ZYG A;  1WJA A;  2VQC A;  5E3M A;  2JRT A;  1PUE E;  2VC1 A;  2VT2 A;  2M87 A;  3K10 A;  2E5N A;  2J5O A;  1P92 A;  5LRR A;  4BE0 A;  3Q5F A;  3F0C A;  4IHY A;  2OZU A;  2IS1 A;  1N25 A;  2L7Z A;  1HKT A;  1ETW A;  1V5G A;  2UV1 A;  3IUO A;  4KUM A;  2VJ5 A;  4IOC F;  2D45 A;  4MNU A;  2JA2 A;  1T6S A;  1G2H A;  1K6Y A;  3DLL F;  1KU7 A;  3KP2 A;  2VKH A;  2PJR A;  1FYK A;  3DLA A;  4I02 A;  3OYC A;  4U7B A;  5D4S A;  5DCF A;  3MKZ A;  4FAS D;  1FWZ A;  4ESF A;  2HYF A;  2K4B A;  3KEQ A;  4B3X A;  1MNM C;  5LBQ A;  3SZP A;  1LEB A;  1EH6 A;  4I2O A;  3WTX C;  1VQ4 I;  4NQW A;  1JHF A;  5H6R A;  3I3L A;  4O5V A;  1U9N A;  1XDS A;  2ZBK A;  4UV9 A;  5F64 A;  2E35 A;  4IX7 A;  1H9G A;  3OYN A;  3IKV A;  1PP7 U;  3U9G A;  1ZYR F;  3RJP A;  2KRC A;  3OYG A;  2XAU A;  3V7R A;  2JPB A;  2JA8 J;  3E7L A;  3WTY C;  5ICG A;  3V8L A;  4UHT A;  2XSD C;  1YOV B;  2GXB A;  2K9S A;  2DOD A;  3GTG J;  4OIN F;  1JT0 A;  3E0J B;  4ZDO A;  3D0S A;  2ZB9 A;  5KHD A;  2HNH A;  3GWZ A;  3HJE A;  4D0P A;  1T38 A;  4RGU A;  2NNN A;  2CUZ A;  5FKO A;  5DS9 A;  1ZGW A;  2LBF A;  3QYE A;  2LSO A;  2OU2 A;  2EIJ H;  2FQ3 A;  3WE3 A;  3CC7 I;  2NOG A;  1EV7 A;  2K86 A;  5IT9 K;  2Y9Z A;  3C2B A;  2BW3 B;  1KU2 A;  2DT5 A;  1YQA A;  3LAJ A;  3GFI A;  4BBS J;  4PSX A;  4PJL A;  2HWV A;  4D5F A;  1QO0 D;  3CMY A;  5HOD A;  3CCY A;  3IRR A;  3G2B A;  3DPT A;  3QQA A;  3J7Y J;  3IL2 A;  3BOQ A;  4DBQ A;  4KJZ A;  2DYR H;  3MZY A;  2OUM A;  3HOZ J;  2H8R A;  2DK5 A;  1Z21 A;  2G9W A;  1MDM A;  5IYD J;  1YW9 A;  2NAZ A;  3VB2 A;  3F22 A;  4L0Y B;  3FXJ A;  1ZN2 A;  4ENK A;  1MSF C;  1SFO J;  5D4R A;  3PNY A;  5K5Q A;  1W36 D;  2FNP A;  2W4S A;  2X6X A;  3U1D A;  1X1C A;  2IAI A;  1MBK A;  2E36 A;  3C3W A;  2ZCW A;  3TMO A;  1RRJ A;  2F5E A;  3ASO H;  3LSM A;  3HRT A;  4A5N A;  4QTR A;  2PI0 A;  2VBY A;  4HST A;  1TWC J;  2X0L A;  4R1H A;  2DMQ A;  3R6S A;  1KGS A;  1R1V A;  1P6R A;  3S93 A;  4CCK A;  3Q3S A;  1ZRD A;  4L5J A;  2Y69 H;  2Z9O A;  2P5L C;  1KZH A;  3J81 Z;  2O6G E;  5AIP A;  2HOA A;  5IT3 A;  5M3M J;  1RI7 A;  1BC8 C;  4YIF A;  1E3O C;  5C3E J;  1YHQ I;  4HLX A;  3MAJ A;  2ZSH B;  1REP C;  2PFB A;  4A0X A;  3JRC A;  3A01 A;  2RV8 A;  4A3L J;  3OS0 A;  4WK8 F;  3A4C A;  3WU1 B;  2DOA A;  3NQO A;  2EFQ A;  4A69 C;  4HF1 A;  3DU5 A;  3A2K A;  1Y0U A;  2XPV A;  4XKV A;  1P7I A;  5FD6 A;  2XAF A;  2BOL A;  4D7M A;  1KQ0 A;  3W6V A;  3OL3 A;  2E2I J;  1E3P A;  5J8C A;  3H5A A;  1IG7 A;  4EAT A;  1S3J A;  3DTK A;  3I4P A;  4PJN A;  1MJB A;  1D0Y A;  2VC0 A;  2HQR A;  3HUG A;  4RM3 A;  3K2A A;  3JR9 A;  5HDN A;  1FSE A;  2W7N A;  4M6X A;  3E97 A;  3TGN A;  1RKT A;  5J1U A;  5GAE J;  1DPR A;  1X3Z B;  1MH4 A;  3ULQ B;  3S2D J;  1GLN A;  2FE3 A;  3GEZ A;  1W5T A;  4BKX A;  4O6J A;  5LD2 C;  4F7Z A;  3WU2 C;  4XLP F;  3OOP A;  4EM0 B;  3PSI A;  3GTO J;  3I59 B;  2H1L A;  2V1D A;  4BDZ A;  1G3Y A;  1X1P A;  3BP8 A;  2CGP A;  2JVH A;  1S7O A;  4ZDP A;  2QQA A;  3BJO A;  3ZMS A;  2HQ5 A;  3M8J A;  4PJ0 C;  3W6J B;  1QHG A;  3V8K A;  2HOS A;  2BBY A;  2DBB A;  1ZRE A;  4UB8 C;  1MNE A;  3CC2 I;  5FB2 A;  1QQI A;  4BJT A;  1E3H A;  4ENJ A;  2R5Z A;  3IH3 A;  4LG3 A;  3BT9 A;  3AKZ A;  2E7W A;  2VAS A;  1QGP A;  2IA1 A;  2PMZ A;  2R7W A;  1PP8 F;  3GYH X;  1OYI A;  2ZXI A;  4AM3 A;  2X6O A;  2OAZ A;  2PMH A;  2ZJQ F;  3PIO F;  1RKW A;  2Q8K A;  2R7X A;  5L3F A;  5GTI C;  3HOT A;  3DTI A;  2DQR A;  2LKS A;  4I0B A;  3MEX A;  2IS4 A;  3S8P A;  4CUG A;  3GME A;  3HL2 A;  2VOD A;  1XDU A;  3CES A;  4HA8 A;  4J19 A;  5FGM A;  4RM2 A;  5GP9 A;  5LLQ A;  4XSX F;  2R7O A;  3AAF A;  1FIP A;  2CWE A;  2E1O A;  3FIW A;  4X1E A;  1K4S A;  2GA1 A;  4GFB A;  4LB5 A;  1F43 A;  3W3C A;  1EH8 A;  3LWF A;  2E1C A;  2PMU A;  3TOB A;  3ZN1 A;  1G3T A;  2CQQ A;  3SXY A;  2E1M C;  3ZQG A;  4RDU A;  1LFP A;  1ZHF A;  2XGC A;  4Y4R A;  3ZOB A;  2LDU A;  4M3F A;  1IRZ A;  2NS7 A;  3CF2 A;  2VPR A;  3EQL F;  2Y48 A;  5GAH J;  4BNC A;  2H27 A;  1G6N A;  1IW7 F;  3QU6 A;  2M1B A;  4A6D A;  3BDD A;  1YX5 A;  4ZYA A;  5IT9 Z;  1YI2 I;  4MTE A;  5CVI A;  1NG6 A;  2ELK A;  2LNB A;  4IO9 F;  1BIB A;  4XQF A;  2AO9 A;  2EH3 A;  1EH7 A;  1I3Q J;  1RR7 A;  3QYB A;  3BTC A;  3EDP A;  3E1S A;  4DNC A;  1ZKG A;  1AKH B;  5HLH A;  1Z6T A;  2JK3 A;  3DPL C;  3REO A;  4BHB A;  2L2O A;  2IT0 A;  1P4A A;  1D1A A;  2WWY A;  5FD5 A;  1J59 A;  1T95 A;  4LFU A;  1KA8 A;  3ZQI A;  3KZI C;  3ABU A;  4KN7 X;  3NWT A;  3ECO A;  2P81 A;  4A3F J;  3H3V K;  4GYG A;  4DJA A;  1TWG J;  3F6O A;  1BR2 A;  4QSH A;  2L4M A;  4HDU A;  1ETK A;  1I1G A;  2CSO A;  2LK2 A;  2XAG A;  3O6B B;  2K5C A;  2LKX A;  2M9H A;  3K1M A;  3CJQ B;  3P9I A;  4AD9 A;  1VQ6 I;  5KAF C;  5F6F A;  3ZMV A;  3DU6 A;  1XB4 A;  2HZD A;  1MZB A;  2GQQ A;  2VI6 A;  3BWG A;  2OTJ I;  1BW5 A;  1P4W A;  1XGN A;  3ABM H;  2K7L A;  1ON1 A;  3ESW B;  1MBG A;  3G6E I;  2VJI A;  3BLY A;  1JKP C;  3NEU A;  2H8W A;  2L5Q A;  4NB5 A;  2VPL A;  5TJJ A;  4IPA A;  2RQQ A;  2LG4 A;  3PSF A;  3OR2 C;  4P9U A;  3HM5 A;  4L0Z B;  2AHQ A;  4C9Y A;  4IQJ A;  1J0R A;  5J3L A;  1SFK A;  3FM5 A;  4CCL A;  1OCO H;  2BHY A;  4RAY A;  1PDN C;  3RYR A;  4ZYH A;  5CVR A;  5IPA A;  3N4M A;  1J75 A;  1T56 A;  3CCS I;  1G59 A;  4AIH A;  1OFC X;  4UUS B;  2JMW A;  2XF5 A;  3BQY A;  1Z9C A;  4A3C J;  5DCM A;  2N8G A;  4YII A;  4GDF A;  4PUS A;  1JKO C;  4M73 A;  4KFC A;  2KT0 A;  4XLH A;  4EVI A;  2HPI A;  3DFG A;  1R4M B;  3ML6 A;  3CZ6 A;  1ACI A;  4XKB A;  3LSG A;  3BPV A;  1ZG5 A;  1FNN A;  2BY0 A;  2K27 A;  1LJ9 A;  3MZH A;  3I64 A;  3K4M A;  4MTD A;  3M8E A;  2LFB A;  4CCO A;  5FFX A;  4OAZ A;  2P7V B;  2UXN A;  5A2Q K;  1Y39 A;  2IVM A;  5TIS C;  2B7E A;  1BW6 A;  3QRF F;  3K4N A;  1Z91 A;  3BCB A;  5DYM A;  4C30 A;  2UXX A;  5ILU A;  1POG A;  5HDG A;  1MND A;  4BQQ A;  4KIB A;  4YIR X;  1HQC A;  4HV5 A;  1GDT A;  2BY1 A;  2O8X A;  1YS7 A;  3ZQ7 A;  4R79 A;  2ZNY A;  3GW2 A;  2I5U A;  1AKH A;  4IHX A;  1LDK B;  1D0Z A;  2ESN A;  1J7K A;  1YIJ I;  1SEU A;  1P7J A;  4A6E A;  1S7A A;  4A3E J;  2AXL A;  1N78 A;  4RGX A;  2DA7 A;  4DZP A;  3K1N A;  1OCZ H;  2XRL A;  3HHG A;  1R58 A;  2OJE D;  1FT9 A;  3J80 K;  4P1W A;  2FX0 A;  1ONV A;  4YG2 F;  2VON A;  2RN7 A;  2E34 A;  3TP3 A;  2RDP A;  1W4M A;  2GOM A;  2Y2Z A;  1QA6 A;  4L5E A;  2VIX A;  1ERD A;  1LUJ B;  4FTH A;  2HTJ A;  2M4K A;  3KCC A;  1UFM A;  4E4H A;  3SZG A;  1SVL A;  2ID3 A;  3X2Q H;  4ZZD A;  1V55 H;  3CDI A;  2CUJ A;  1D3Y A;  3LSH A;  2M7A A;  5AON A;  4HPQ A;  5F0C A;  4MIM A;  5CLS A;  3AG4 H;  1HSJ A;  2XSJ C;  3ISP A;  5E1X A;  1P4X A;  4PSW A;  4Q5S F;  1YIO A;  4NC8 A;  5M3F J;  2JRM A;  2ME0 A;  2EV0 A;  4S05 A;  2HYG D;  4BAC A;  3JRF A;  2D2W A;  4DGW B;  3E5U A;  4HNU A;  2W1O A;  1F5T A;  1PYV A;  1TT5 B;  4XON A;  3M3Y J;  3P5J A;  2KQR A;  5KK1 A;  3KYD B;  1B59 A;  2B9S A;  3TDZ C;  2KFD A;  3FHZ A;  2ID6 A;  1RPW A;  1GXQ A;  5EZH A;  4EEF G;  2XAQ A;  2W84 A;  1UST A;  3OYA A;  3RTR A;  3T8T A;  2QM3 A;  2QF7 A;  2EFN A;  3K1P A;  1Z7L A;  4UUS A;  3CCR I;  2EJR A;  3CJT B;  1A5J A;  1ON2 A;  2Z16 A;  3DKX A;  4HX7 A;  5TGT A;  1D5V A;  2BHZ A;  1R1T A;  3NWS A;  5E20 A;  1TP4 A;  1NH3 A;  1UAA A;  4J00 A;  1O57 A;  3M07 A;  1MJA A;  3SEZ A;  3CO7 C;  1S72 I;  1IAW A;  3S3N A;  1ZQ3 P;  2HVS A;  3HEF A;  4JOM A;  4BXX J;  3KE2 A;  4KMU X;  4YFX F;  2GIZ A;  3CJR B;  4RAZ A;  2WAQ N;  3OYD A;  2Z2S B;  2VOP A;  2JA5 J;  3DKW A;  3EYI A;  2L02 A;  2QSF X;  2QGU A;  3M8F A;  1RUN A;  3K6G A;  5D6F A;  4C3J J;  3GZN B;  3ZMT A;  3WTW C;  1USS A;  2KZV A;  4XLA A;  5IP6 A;  4JX5 A;  3HOV J;  1I3A A;  5B3S H;  2CV0 A;  3HYI A;  3CCM I;  5HLG A;  3GLL A;  1R49 A;  4N4N B;  1LFU P;  4H0E A;  4PK4 A;  3CC4 I;  1O3S A;  1R36 A;  4HQE A;  2CO5 A;  2NVY J;  2OZ6 A;  3OIQ A;  1FOK A;  2A5W A;  3CF5 F;  2D5V A;  4LLN A;  1HC8 A;  3QPS A;  1L0O C;  3I54 A;  5EGO B;  3S2H J;  4G12 A;  1ZG3 A;  4UXN A;  2ZC2 A;  3BTL A;  3BR3 A;  4FQG A;  2EZK A;  3T1B A;  2CV1 A;  2HXO A;  3WOD F;  1RR8 C;  4WX9 A;  1X19 A;  2JWT A;  2QKL B;  4YFK F;  2GIV A;  1XC5 A;  5HOO A;  5C4J J;  1I6X A;  2HDD A;  1IN4 A;  3KP4 A;  2Y75 A;  4ENN A;  3I58 A;  3KEO A;  1WRJ A;  4KN4 X;  1K6O A;  2HI3 A;  2ZXW H;  2LVS A;  5KVR A;  2DFF A;  2ELJ A;  1UHM A;  3CDL A;  3FXL A;  2IPQ X;  2EZH A;  5J8F A;  2HQN A;  1FBQ A;  1WGX A;  2STT A;  4LLG F;  2Q2E B;  3M7G A;  3S1R J;  3JRH A;  4EM1 A;  4IHT A;  5C4X J;  2MLG A;  1U0J A;  3Q9V A;  5A2Q Z;  2R5Y B;  3PFY A;  1FJL A;  1UB9 A;  1FBU A;  5JLX A;  2E2H J;  1JT6 A;  4OAY A;  2G7H A;  4F92 B;  1VQ8 I;  2ZME B;  1RC9 A;  4I6Z A;  3QOD A;  3LA2 A;  1V5E A;  3C2H A;  3HRU A;  1HW1 A;  3QPT A;  3JRB A;  1AA7 A;  1ZEL A;  2XC7 A;  4F91 B;  1G8X A;  4YEL A;  3QP6 A;  2RC4 A;  4EJO A;  2LD5 A;  1XD7 A;  3OV8 A;  3F23 A;  2GLO A;  4OWR B;  3CUQ B;  2DA4 A;  2EA2 A;  2VQL A;  4XRF A;  3Q9S A;  4CCN A;  2NVU B;  2E71 A;  4M9Z A;  5CVV A;  2K85 A;  4MLO A;  1WFX A;  4LOC A;  1ITY A;  4CO8 A;  1BIA A;  2YSR A;  5F1J A;  3J80 Z;  3DEU A;  1KU9 A;  2KIS A;  2ZJR F;  2RVC A;  4KNY A;  1YFH A;  3RKW A;  3OIP A;  4AVP A;  1IN6 A;  4KIS A;  4HZF A;  1U78 A;  2XKP A;  3TKY A;  1WH7 A;  3BTJ A;  2HVR A;  4XNF A;  4AU7 A;  1ZAR A;  1B6A A;  1XS9 A;  2HYJ A;  3K70 D;  3DP7 A;  2HDW A;  1K83 J;  4B09 A;  4FT8 A;  1YIT I;  1WQ2 A;  3ABK H;  3IAM 2;  4UY8 I;  4HAM A;  1VQ7 I;  4KYW A;  2R93 J;  3V4G A;  4U0Y A;  2O5R A;  4RMN A;  5BPD A;  4U87 A;  2XAJ A;  1ULY A;  2WAE A;  4BAY A;  1IRG A;  3BR0 A;  4I99 C;  3BJA A;  1U5T B;  1S7E A;  2BY3 A;  2WC2 A;  2LR8 A;  2M34 A;  3FDY A;  4QPO A;  4C2U A;  3H9J A;  2G7U A;  1V3F A;  4F55 A;  1F9N A;  1ZK8 A;  4S04 A;  3FXK A;  3F21 A;  3FXQ A;  1PUF B;  1CGP A;  3EET A;  1NG7 A;  1PVE A;  2CYY A;  2DN0 A;  3ZQH A;  4AWX B;  1MBF A;  5B1B H;  5D8L B;  2LY1 A;  3L2V A;  4OU0 A;  4MEX F;  3B02 A;  3ZQL A;  4BEH B;  1XX5 A;  1YW8 A;  2MAB A;  3HC7 A;  2LY9 A;  5J4Y A;  2CQX A;  4KIG A;  4AVZ A;  5HLT A;  3WGI A;  2IP2 A;  4IRG A;  2KIM A;  1VQP I;  2R7D A;  2L9V A;  4KT6 A;  1C0W A;  2DPU A;  2EPF A;  5E17 F;  3BY6 A;  1KU3 A;  3JW4 A;  3V7C A;  4D5C A;  2GXA A;  1SD6 A;  3EYY A;  1SD4 A;  3IWZ A;  1BC7 C;  2QYO A;  3PQK A;  2JN6 A;  4V2G A;  4CGZ A;  1IZ1 A;  4I98 B;  3RQ4 A;  1LE8 B;  5E8I A;  4D9J A;  3QOE A;  3S3M A;  4E7K A;  5HS7 A;  1R00 A;  4XRM A;  1I50 J;  2IGN A;  1ZRF A;  3A0B C;  2GXG A;  4B47 A;  2VE8 A;  5DDG A;  5F0F A;  2B63 J;  1BI2 A;  2DFE A;  2KZG A;  4MO7 A;  3OMY A;  3GXO A;  1B1B A;  3HXL A;  3E5Q A;  5K7Z A;  3GTP J;  2ETH A;  4RAF A;  4F3Q A;  2LOO A;  5H20 A;  5K7F A;  2UZK A;  1W7P A;  1Y8Q B;  4AYB A;  3CUQ A;  2W82 A;  5DD8 A;  4MGR A;  3OYM A;  2ZXJ A;  4J01 A;  3FXO A;  1I5Z A;  3DF8 A;  4UB6 C;  3LSJ A;  1OMI A;  2X1E A;  2DT6 A;  2IEK A;  3FXR A;  3VWB A;  1G4D A;  3SZT A;  2RRE A;  4GGG A;  1ZR4 A;  3FX3 A;  4HYE A;  3PL8 A;  2GWR A;  2XAH A;  3BZC A;  5ILV A;  3MD2 A;  1TQI A;  2XB5 A;  4L9N A;  3ZMU A;  5TRD A;  4KIC A;  3F8N A;  1OCR H;  2A5Y B;  1UEL B;  1U3E M;  5HDK A;  4KDP A;  3L9F A;  4HRI A;  1HCR A;  1WHU A;  3CCJ I;  4CSW A;  5JVG F;  5J1R A;  5JI6 A;  1WPK A;  2QWW A;  4CYC B;  2R4G A;  2R7R A;  3LA7 A;  3S14 J;  1TLH B;  4DW6 A;  3QPH A;  4EGY A;  2I10 A;  2A6E F;  1VND A;  3W2V A;  4E7I A;  4M9X A;  3PUF A;  3I55 I;  1IV6 A;  4UNO A;  4XOT A;  4OIP F;  2XHK A;  1XCB A;  2R7V A;  4XBF A;  2R7Q A;  2R92 J;  2QVO A;  2JT1 A;  1MSE C;  2H6C A;  3WGH A;  2PQ8 A;  3HKZ A;  3FK7 A;  2CUF A;  2Z1D A;  1M1E B;  3K2Z A;  1L3L A;  4ASN A;  1PUF A;  4U0W A;  2EIM H;  3AG1 H;  4BE2 A;  3OYH A;  3ZPL A;  3VYT B;  2M2E A;  4DOZ A;  4W97 A;  5ICC A;  2K4J A;  3SQN A;  1ETO A;  2NXN B;  3KZY A;  3CUQ C;  3MCZ A;  5IP9 J;  2IJL A;  3WGG A;  1IDZ A;  1LPQ A;  1TTY A;  1MBH A;  5FJ8 J;  5ILS A;  3HOX J;  1ENH A;  2UUZ A;  4E7Z A;  5C44 J;  2W25 A;  1S8N A;  1XMX A;  3CP2 A;  5JFR A;  2COB A;  1HST A;  4PDK A;  5FLV A;  6PAX A;  3W2W A;  1J2X A;  3E6B A;  2P0W A;  1Q1V A;  1UG0 A;  4JYK A;  2LRD A;  4GXO A;  1Y1W J;  3TOA A;  3DEW A;  1YJW I;  1B8I B;  4NC6 A;  3P9C A;  5K1Y A;  2CUE A;  2KHM A;  2DFH A;  4M74 A;  1LVA A;  3JRA A;  1HOM A;  3S1N J;  3SJM A;  2HVQ A;  1JE8 A;  1ZRC A;  3KYC B;  2EA4 A;  3WTV C;  1A31 A;  2B0L A;  4P55 A;  2K9M A;  2BW3 A;  5ED4 A;  4GRI A;  1YG2 A;  1IDY A;  3HSR A;  3M1E A;  3JCU C;  1OJL A;  3E3V A;  2IRF G;  1E2X A;  2MFZ A;  4M3B A;  1OYW A;  3DWL E;  3ELK A;  4U7D A;  3CJN A;  4XN0 A;  4JK1 X;  3Q0U A;  2R7S A;  3RDI A;  2EIK H;  3ROU A;  1YE9 A;  3DBR B;  2WTE A;  2COM A;  5DM7 F;  1OR7 A;  3EUA A;  4WWC A;  2BE5 F;  3I5U A;  4LIV A;  4HF2 A;  1MMG A;  5F04 A;  1R5I D;  1T39 A;  1RET A;  5IP7 J;  2QQ9 A;  4RBO A;  3R0A A;  2KRH A;  1DP7 P;  4IVN A;  3FWE A;  4N9H A;  2HPM A;  3EUK L;  2ELH A;  4IJA A;  1JKQ C;  2TDX A;  2LF7 A;  5E1Z B;  2CW8 A;  2Q0O A;  1Y1V J;  2XF7 A;  1BJA A;  2EFO A;  1VF9 A;  2PMZ N;  2LLK A;  3DBL B;  1CF7 B;  3P7N A;  4V19 K;  1SAN A;  3HDD A;  1BBY A;  1SFX A;  3K4C A;  4BXF A;  3S32 A;  1FTT A;  2L54 A;  4CYC A;  4Z2Y A;  3I4N J;  2EZI A;  4EM2 A;  1X4P A;  1I6H J;  3LQR A;  4XLN F;  2E2J J;  2Y0S A;  3TO9 A;  3FF5 A;  1E0E A;  3HSF A;  2MD5 A;  2NYX A;  3SFZ A;  3FBN B;  3I56 I;  5LFA A;  2DTZ A;  2MLK A;  5DM6 F;  2Z99 A;  4IQ4 A;  4PJJ A;  3TO6 A;  1JHH A;  4XRS G;  1RIO H;  2NOJ B;  1KYZ A;  3KET A;  1ODD A;  2MG4 A;  2L7F P;  4OMY A;  2DYS H;  3F72 A;  1FMV A;  1ETX A;  3MN2 A;  5HVQ C;  3DBH B;  2FBH A;  5IYC J;  1QZY A;  1JTX A;  2XV4 S;  3I71 A;  2KMU A;  2VBW A;  2XIG A;  2JJ7 A;  2LC2 A;  3ZMD A;  2E1N A;  3H36 A;  3L2C A;  3K4J A;  3H1C A;  4X6A J;  1BI0 A;  2RNJ A;  5F0H A;  2A05 A;  4E70 A;  3KP7 A;  3RPU D;  1FYM A;  3IH2 A;  1OR7 C;  2OPT A;  4IL6 C;  2JSC A;  3KP5 A;  1T33 A;  2HOT A;  4A3J J;  2VJJ A;  3A1Y A;  3L1P A;  2J5P A;  2MH2 A;  1K7A A;  4G7O F;  1F1Z A;  4DYR A;  5BOX A;  2V6E A;  4I0A A;  2VLA A;  4DZJ A;  1E17 A;  1V5F A;  4XID A;  3I59 A;  4UV8 A;  2DFI A;  1J9I A;  1JGG A;  1ZH5 A;  5BQT A;  2BEO A;  1IXS B;  3L7W A;  2LH9 A;  2BZT A;  2RAE A;  2HKO A;  2EFW A;  1Z7U A;  1K78 B;  2YS9 A;  3WTZ A;  2VQG A;  5CVJ A;  4PFP A;  4EJU A;  2V4J C;  4KT5 C;  1TQM A;  3PO2 J;  1DUX C;  2O03 A;  5HS8 A;  2WB1 A;  1U2W A;  3MQ0 A;  3V8J A;  3L2W A;  1SMY F;  2DW4 A;  2XGD A;  4G8X A;  1OLT A;  1R9T J;  2CV2 A;  5DV5 A;  1G3S A;  4GYI A;  3IH4 A;  1XSD A;  1W0T A;  2L7K A;  5L3C A;  2A61 A;  1BR4 A;  3L2R A;  3OYB A;  2R7Z J;  3WU0 A;  4Y13 A;  2XKO A;  3LOC A;  2CFO A;  2K9Q A;  4UVA A;  1JUM A;  1H9T A;  1UCR A;  1WH5 A;  1JTY A;  2OQG A;  2OV7 A;  4CA0 A;  4DQ2 A;  1NK2 P;  4A2U A;  2DMN A;  2VOO A;  4LJZ F;  3F3X A;  1CF7 A;  1W0U A;  1ZGA A;  3JTH A;  2BV6 A;  1DU6 A;  4ESB A;  1K61 A;  2A07 F;  2PJP A;  5FRO A;  4XR6 A;  4XK4 A;  3LQQ A;  4NDL A;  2A3S A;  4A3M J;  1X1D A;  5L3E A;  3PM1 A;  1XG1 A;  3FKI J;  1YLF A;  3COA C;  2P8T A;  2RQP A;  4ZC3 A;  4G6T B;  3AL0 B;  3O8H A;  2QBY B;  4XLC A;  3RZD J;  4DBR A;  2GZW A;  4YEJ A;  4XIC A;  3C18 A;  1A6Q A;  1FMW A;  2Y30 A;  3H3Z A;  3A0H C;  3ZQF A;  2ECB A;  1YJN I;  1OYY A;  4E7J A;  1WWX A;  5E79 C;  4B48 A;  2DPD A;  3FXM A;  1IXC A;  3BR5 A;  5K5R A;  5FKM A;  2WY8 Q;  2LYC A;  1Y56 A;  3IC7 A;  4XMY A;  5CVU A;  2R7T A;  4EGZ A;  1ZGJ A;  3MZ8 A;  2CRG A;  2BYV E;  3CQZ J;  1RUO A;  3LL7 A;  4M3G A;  1T0F A;  2KIU A;  2W00 A;  2HR3 A;  3VOD A;  2MGQ A;  3ERM A;  1HBX G;  2KP6 A;  4Y33 A;  2K40 A;  3BPX A;  2L9N A;  4RLF A;  5E8G A;  1MD0 A;  5CPR B;  5B5E C;  3CP8 A;  2IBD A;  1O7F A;  4BS9 A;  3G71 I;  5EZG A;  3GZ5 A;  5FLX K;  4LIU A;  3TO7 A;  1R6R A;  4BHC A;  2X85 A;  1EKE A;  2VBX A;  3G73 A;  2MC3 A;  5CJ9 A;  3TDU C;  2XPW A;  4WXD A;  4CDG A;  2FA5 A;  2CQK A;  3U1K A;  3A02 A;  2VQH A;  3OOU A;  2ACJ A;  4NNJ A;  2L7M P;  2M0M A;  1YYV A;  2X4H A;  1MH3 A;  1B9M A;  3H5R A;  5KCM A;  3RYP A;  2L9R A;  3IKT A;  2NVX J;  5B1A H;  3CCQ I;  3ZN0 A;  3MKL A;  3T5X A;  2QLZ A;  2BGC A;  3HTU A;  3ZGK A;  4ZTJ A;  1YJ9 I;  2CH0 A;  2EIL H;  1JJ6 C;  1HXD A;  2OC6 A;  2DCE A;  2EBI A;  1XMA A;  3O8G A;  4ESJ A;  3F8M A;  1IUY A;  1VQ9 I;  4MFD A;  2ZSI B;  4CCJ A;  2R7U A;  1QPI A;  2V1X A;  4BE1 A;  3B6C A;  1QZZ A;  2WV0 A;  2ZKZ A;  1GV5 A;  1RZ4 A;  4HEA 2;  3GZ6 A;  1Z1D A;  2PG4 A;  3F8C A;  4IF4 A;  1ZAO A;  2MW8 A;  3GFL A;  4MFE A;  3DEE A;  1S9H A;  2O8K A;  4EMS A;  3K9T A;  1FIA A;  4M71 A;  4E6K G;  2XPU A;  3S17 J;  4E7S A;  2CG4 A;  5LGT A;  1K79 A;  1BJZ A;  2DTR A;  5LEK A;  3BRO A;  5EG0 B;  4A3I J;  1T0F C;  3S15 J;  4YFN F;  4PGH A;  4JQF A;  1J09 A;  3HPH A;  4BH9 A;  5LHH A;  1YRN B;  2DA2 A;  2H94 A;  2DAO A;  4XM3 A;  1HLV A;  5FKK A;  1S6L A;  1JI8 A;  4XKC A;  4HF0 A;  4KA4 A;  1IRX A;  2OA4 A;  1W1W E;  3Q0W A;  3Q0V A;  3JRD A;  4DYC A;  2V79 A;  3QU3 A;  2XDV A;  4BY1 J;  4ON0 A;  4NBQ A;  4XL9 A;  3OSF A;  1MMS A;  1JXS A;  4LK1 F;  2CJJ A;  4Y7N J;  2FD5 A;  2DK8 A;  1DGR M;  5LHG A;  1QVU A;  3UNG C;  3K69 A;  3VSK A;  1X2N A;  3K70 C;  1FOY A;  2BVL A;  4LG0 B;  5CYV A;  1SMT A;  3F9K A;  3G4S I;  2FOW A;  3HPG A;  2IA2 A;  3RSN A;  2JZY A;  4XRS A;  2PEX A;  2MSY A;  3ABT A;  3SYT A;  3BTI A;  3IRQ A;  3HRM A;  4HBL A;  2M4G A;  4XOP A;  1IXR C;  2MBF A;  2CU7 A;  4XSZ F;  2ADU A;  3J7Z I;  3HIF A;  1SVM A;  3SFI A;  1MW7 A;  3GTL J;  4GO1 A;  3IV5 A;  1XGM A;  5AIQ A;  2BXY A;  1WI9 A;  3GFM A;  4IHW A;  3GO5 A;  4F52 A;  2L9S A;  5H2F C;  1LNW A;  4CXF A;  1GHC A;  1X1A A;  3QP5 A;  1FOX A;  2DQL A;  1VQO I;  2EFP A;  1XSX A;  3HZJ A;  4ITV A;  4I09 A;  3LNQ A;  2QCO A;  3BZ6 A;  2QEX I;  4BQO A;  3E6D A;  2FJ1 A;  4CYD A;  3AG3 H;  3D5L A;  1W5C C;  1X1B A;  4M9S A;  1UMQ A;  2HQA A;  3OS1 A;  2L4A A;  3EUH A;  5J47 A;  4LGW A;  1TWH J;  3DTE A;  3F6V A;  1ETV A;  2DA5 A;  1UJ8 A;  2FRH A;  3JTG A;  1BOB A;  1O4X A;  3JSO A;  4ANJ A;  1VQN I;  2NS0 A;  4UUT A;  2M5W A;  1MJ9 A;  3BR2 A;  3CO6 C;  1T2K A;  4NQW B;  3AL0 C;  2NVQ J;  2K9N A;  3E5X A;  2VXD A;  2K9L A;  5M5X J;  4EJW A;  1DQU A;  4A93 J;  3RKX A;  1MBE A;  1ORK A;  4V2F A;  2IGM A;  4O3M A;  5CQE A;  5L3B A;  3L2Q A;  3HB9 A;  4C2T A;  2QEN A;  3IP4 B;  4HNV A;  1FLI A;  4BGD A;  2O7O A;  5IOY A;  2Y31 A;  3FXU A;  2DT7 B;  5LGU A;  2V9V A;  4ABZ A;  2DDB A;  2XRO A;  2HFH A;  3OIO A;  1TW3 A;  3GCM A;  1AU7 A;  4AC0 A;  4G94 A;  4L9J A;  3LFK A;  1TWF J;  1FPQ A;  4A3K J;  2LBF B;  1W36 C;  5FLX Z;  1IRF A;  3QAH A;  2F48 A;  3OR1 C;  1KON A;  3CCV I;  1YX3 A;  3FBI B;  1AHD P;  5EEA A;  2WA0 A;  4QPQ A;  1A6I A;  4IOA F;  4N9I A;  4RB3 C;  4C2M J;  4B3A A;  1R4N B;  2DU9 A;  4EJT A;  5HNF A;  1AOY A;  4B43 A;  1V4R A;  3GFJ A;  1VI0 A;  1H88 C;  1MDM B;  3UR3 C;  1BM9 A;  1TT0 A;  3EUH C;  5ICE A;  1AWC A;  1FP1 D;  3IHU A;  5D5W B;  2O9L A;  3IAS 2;  3CLO A;  2P7C B;  2FXA A;  1QBJ A;  4CHU A;  1HF0 A;  2LTP A;  3TL4 X;  3LA3 A;  5L3G A;  4P96 A;  1RNL A;  2ME6 A;  3RI4 A;  4KMF A;  2F6C A;  3HTS B;  1IJW C;  3OWT A;  4RA2 A;  2AQF A;  4IRI A;  4Y52 J;  3IWF A;  1TBX A;  1VZ0 A;  3WTT C;  5GAD J;  1DDN A;  3BG7 A;  2KIF A;  3C7J A;  5EGO A;  1EA3 A;  2CQ7 A;  5EF6 A;  4G7H F;  5FLM J;  4IXA A;  1TNT A;  3OYL A;  4M3E A;  4ZZL A;  1LQ1 A;  2MA3 A;  5LEJ A;  3OSG A;  3I4M J;  1UHS A;  2OF7 A;  2FSW A;  3F8B A;  2X6W A;  1OPC A;  1WJ5 A;  4N4O B;  1MKM A;  4LD5 A;  4I01 A;  4ETS A;  2ZNZ A;  2QQ8 A;  4UUV A;  1X3W B;  4RB0 A;  1D1B A;  3A01 B;  4M6V A;  1O3R A;  2PX9 A;  3FIS A;  1GXP A;  1HA8 A;  2KJB A;  4P9F A;  2M3A A;  1ZTR A;  1DU0 A;  3GBG A;  3U2R A;  2AXT C;  2Q2E A;  3I53 A;  2Q1Z B;  1JGS A;  1HDD C;  1OKR A;  2F5C A;  4LMY A;  3WG7 H;  1I27 A;  3H0D A;  2ESH A;  2R5Y A;  2BY2 A;  3MKY B;  2M7B A;  3HOU J;  4ZYD A;  2VUM J;  2TRT A;  3SEQ A;  5BMZ A;  3HUG B;  2ZME A;  4M3D A;  2L0K A;  3WHB A;  5EJC A;  3RKY A;  4MEY F;  1YO5 C;  2P5V A;  4BJ6 C;  1Z3X A;  4G6D A;  4JP0 A;  3TW7 A;  3DQV C;  3DCF A;  2DOF A;  1D8K A;  3OYJ A;  1H8A C;  1U6G A;  2FOK A;  1X2M A;  1TWA J;  2E1M B;  3RPU A;  3FZV A;  3SDG A;  3HBL A;  1VQK I;  2VB6 A;  1KYW A;  2OBP A;  3H92 A;  3NAR A;  5E18 F;  1WJC A;  1ZR2 A;  1OIS A;  4MHG A;  2O0Y A;  1IGN A;  3VSL A;  1BR1 A;  2IGK A;  4BU2 A;  5JVT A;  4AUX A;  2P6S A;  2WBM A;  1O3Q A;  4HG2 A;  5HNH A;  4AYB N;  3HGG A;  3E6M A;  1LDJ A;  4I76 A;  5H6Q A;  5GAG J;  3RZO J;  1I1S A;  3HHH A;  2VKV A;  4XLE A;  4A3D J;  5GTH C;  2R5Z B;  3LSK A;  2UWM A;  1R7J A;  3AG2 H;  4BUP A;  1YW7 A;  3PQJ A;  3TQN A;  2BVM A;  3GTJ J;  2JQ7 A;  4Q4Z F;  3HRS A;  4OIO F;  2YU9 J;  1Y6I A;  2WAD A;  3H35 A;  2STW A;  2F5D A;  1U8R A;  1QU3 A;  3N05 A;  2LMD A;  1XTA A;  1GVD A;  2GBY A;  4LIT A;  2Y9Y A;  1WI3 A;  4PGG A;  1U5T A;  2FMY A;  4HSR A;  2KPM A;  1HDP A;  4UVB A;  2W57 A;  2M8G X;  1WJD A;  2QQB A;  2VKE A;  2ZME C;  3ERE D;  2W48 A;  4OMZ A;  3TW6 A;  2GA2 A;  3D5S C;  2VL8 A;  2A68 F;  3A03 A;  3GUD A;  3CD6 I;  2AS5 F;  1A04 A;  1GVJ A;  3QYF A;  4BEH A;  1I39 A;  2HTS A;  5F27 A;  5FRM A;  3O2P E;  5F1R A;  5JHU A;  4RGS A;  4B4C A;  5EYR A;  3HKZ N;  3FMS A;  2F5V A;  3MWM A;  5FRN A;  5HLI A;  1EF4 A;  4CH7 A;  2V1N A;  2XAS A;  2VT3 A;  3G3Z A;  4DIQ A;  1X58 A;  1MMA A;  1R5H A;  4AIJ A;  3OY9 A;  2DXI A;  3KYL A;  2OTL I;  3BG3 A;  1FOW A;  3ZR8 X;  4CZZ A;  1DP3 A;  4EV0 A;  1LE8 A;  1FC3 A;  2V7F A;  4IEJ A;  1BOA A;  4RB2 C;  1VQ5 I;  4A3G J;  2FML A;  2V6C A;  1VQL I;  1B72 B;  2JVG A;  2CQN A;  2F4I A;  5D5U B;  2YUS A;  4EJV A;  3C2G A;  2DMU A;  3S2W A;  1Z0X A;  2OCC H;  1IN8 A;  2EB7 A;  3VYR B;  5D8K B;  2KDO A;  2QZ8 A;  3C1D A;  2VKD A;  4ZTF A;  1R71 A;  4L9T A;  1H0M A;  3PO3 J;  1WJF A;  4PCQ A;  4Y15 A;  5J40 A;  1U5T C;  3R0J A;  2EWN A;  4FX4 A;  2KLO A;  2ICW G;  1IV8 A;  2RKH A;  1ETQ A;  1X3U A;  3KPH A;  1D1C A;  3W2A A;  1V54 H;  3T0Y A;  3PUB A;  4JX4 A;  3UKG A;  1DPU A;  4FET A;  1D8J A;  2OQR A;  1P2F A;  2X1D A;  4WCG A;  1TNS A;  1Y8R B;  5EEH A;  2KDZ A;  4IHS A;  3WTS C;  2LF8 A;  1TC3 C;  2IS6 A;  3G1M A;  1VTN C;  3W6K B;  1LFB A;  4WXC A;  4G7Z F;  2Z5U A;  4II3 A;  1B4A A;  1TL8 A;  2IS2 A;  2DA3 A;  3RIR A;  5L3D A;  2Z3Y A;  3VEP A;  4XLF A;  3ZCO A;  5J1Y A;  3TBI A;  2LY2 A;  3HGY A;  4I7H A;  4WF2 A;  1FSH A;  4RAG A;  1LKX A;  1FYL A;  5F08 A;  3MKW B;  3CUO A;  2JTV A;  3VYS B;  4NUB A;  1S29 A;  5D5X B;  1FBS A;  2NS8 A;  1N75 A;  2LKP A;  5ERI A;  2ZXH A;  3RQI A;  3BG9 A;  4RB1 A;  4BJ5 C;  2CW0 F;  2DDA A;  4DYQ A;  2DLL A;  3ZQQ A;  1TQP A;  4Y3O A;  4JX6 A;  5DCM B;  4Z6Y A;  5E1W A;  1LB2 A;  3K4K A;  2BXZ A;  2Y0S N;  2FBI A;  2MYS A;  2Y0M A;  3V42 A;  1BN5 A;  2V9P A;  5DUI A;  3B73 A;  4M6Y A;  2A6T A;  1GT0 C;  3LAP A;  2H1K A;  2K3F A;  1WSU A;  1IF1 A;  3CTA A;  3CMA I;  2HS5 A;  3GF2 A;  1JUP A;  2VN2 A;  3WHC A;  2QSH X;  3M9A A;  5BS6 A;  3BR1 A;  1XCV A;  2GM4 A;  4BQN A;  2KKO A;  4HX4 A;  4IKF A;  2C6Y A;  2D1H A;  1FY7 A;  1BA5 A;  3PNV A;  2YPR A;  4BYY A;  1ETY A;  3E6C C;  3DXJ F;  4ZJZ A;  2XVC A;  1D0X A;  1UHW A;  1Z6R A;  2M30 A;  2ZO4 A;  3R4K A;  1OCC H;  3AFH A;  3K4B A;  3L00 A;  3KIO A;  1SFE A;  1JKR C;  3VDX A;  3H0G J;  1B8I A;  2HU9 A;  4BHP A;  2OD5 A;  2JUG A;  2NNY A;  2FBK A;  3JSP A;  1W7P D;  3VPR A;  4TV7 A;  1B72 A;  3JRG A;  2FEZ A;  3J7A Y;  3JAM K;  3H9Q A;  3ZP5 A;  3N97 A;  5KAI C;  5D5V B;  2JUC A;  1R1U A;  4A0Y A;  4ZYE A;  1HKS A;  1SC7 A;  3QPL A;  2FF4 A;  3PNT A;  2TCT A;  1WKM A;  2K02 A;  3OL4 A;  2X48 A;  1APL C;  5LGN A;  4A3B J;  1QZE A;  4ZH4 F;  5FKN A;  2M8E A;  1F36 A;  5FO5 A;  2HEO A;  3K0L A;  3GVA A;  3LSI A;  2WB1 N;  1U8B A;  9ANT A;  2ISY A;  2YU3 A;  1YS6 A;  3G1L A;  4F93 B;  4LB6 B;  1R22 A;  2I8D A;  3DKY A;  3TP0 A;  2CW7 A;  2AQE A;  3QOP A;  5J6X A;  3D1N I;  4N0B A;  2ISZ A;  2LP0 A;  3CCU I;  2QA4 I;  2O61 A;  2DO7 A; 
#chains in the Genus database with same CATH homology
 4XRS A;  2MSY A;  2LY9 A;  1NK3 P;  3BTI A;  2CQX A;  2HQ5 A;  2CU7 A;  2DA6 A;  2HOS A;  5DTD A;  3SFI A;  3GTL J;  3TED A;  1GUU A;  4D5C A;  3IV5 A;  1FEX A;  1BL0 A;  2R5Z A;  4IHW A;  3IH3 A;  4B1R A;  3BT9 A;  5K7H A;  2JN6 A;  4V2G A;  1RES A;  1LE8 B;  4FCY A;  5BNG A;  4W1U A;  2QCO A;  2X6O A;  4XRM A;  1I50 J;  3LNQ A;  2FJ1 A;  5E3L A;  4C3I J;  1RKW A;  2B63 J;  1JUS A;  5F0F A;  4MO7 A;  1UMQ A;  5K7Z A;  3GTP J;  1TWH J;  1ETV A;  2DA5 A;  1O4X A;  1IC8 A;  5K7F A;  4J19 A;  4UUT A;  5GP9 A;  3BR2 A;  4QIW N;  1FIP A;  3G1O A;  2E1O A;  3FIW A;  2K9N A;  4X1E A;  2NVQ J;  5M5X J;  3BG5 A;  4GFB A;  3LSJ A;  1F43 A;  4A93 J;  5FKL A;  2IEK A;  1MBE A;  1ORK A;  4V2F A;  1ZR4 A;  2CQQ A;  3HB9 A;  3ZQG A;  4RDU A;  4BBR J;  2XGC A;  3ZOB A;  2XB5 A;  2XGE A;  4M3F A;  4HNV A;  2NS7 A;  1IRZ A;  2O7O A;  2VPR A;  5IOY A;  2JA6 J;  2Y31 A;  2DJN A;  4ABZ A;  1HCR A;  5E3O A;  2ELK A;  3OIO A;  5J1R A;  1WPK A;  4CYC B;  2AO9 A;  2EH3 A;  1AU7 A;  4AC0 A;  1TWF J;  1I3Q J;  3S14 J;  1QRY A;  4DW6 A;  4A3K J;  3FK6 A;  1RR7 A;  3LSR A;  2I10 A;  3BTC A;  4D7N A;  1VND A;  1ZKG A;  1AKH B;  1IV6 A;  2JK3 A;  1AHD P;  2JA7 J;  5EEA A;  2R92 J;  1A6I A;  1MSE C;  4C2M J;  4B3A A;  3ZQI A;  3FK7 A;  2CUF A;  1H88 C;  1VI0 A;  1VFC A;  1PUF A;  2P81 A;  3MVP A;  4A3F J;  3H3V K;  2O9L A;  3ZQC A;  1TWG J;  2M2E A;  4W97 A;  4QSH A;  5IOZ A;  1ETK A;  1ETO A;  2LK2 A;  1HF0 A;  2LTP A;  2LKX A;  2M9H A;  4S0H B;  3HOY J;  3S16 J;  2ME6 A;  5IP9 J;  5EDN A;  1IDZ A;  3LSP A;  1FTZ A;  1JJ8 C;  1IJW C;  1MBH A;  5FJ8 J;  4Y52 J;  2M0C A;  1ENH A;  3HOX J;  4BY7 J;  3RKQ A;  5C44 J;  3JRE A;  5EGO A;  2VI6 A;  2COB A;  5FLV A;  5EF6 A;  5FLM J;  1BW5 A;  1MBG A;  2NVT J;  1Q1V A;  4JYK A;  2EQR A;  3NAU A;  1JKP C;  1Y1W J;  4M3E A;  3DEW A;  1B8I B;  3OSG A;  5JLW A;  3I4M J;  1UHS A;  2OF7 A;  2CUE A;  3HM5 A;  3JRA A;  1HOM A;  2XB0 X;  3S1N J;  3GTQ J;  2AHQ A;  3SJM A;  3K7A J;  5J3L A;  1U9O A;  2EZL A;  3BQZ A;  3A01 B;  4M6V A;  5IPA A;  3GTK J;  3JRI A;  1T56 A;  1IDY A;  1OFC X;  3FIS A;  1OJL A;  4UUS B;  2JMW A;  4M3B A;  3BQY A;  2G0E A;  1OCT C;  1ZTR A;  4A3C J;  1UG2 A;  1DU0 A;  2N8G A;  1JKO C;  3GBG A;  3Q0U A;  2KT0 A;  5GPA A;  4C3H J;  1HDD C;  3LSG A;  5GPC A;  2R5Y A;  5F04 A;  3BR6 A;  1RET A;  3HOU J;  2ECC A;  5IP7 J;  2R0Q C;  4RBO A;  2VUM J;  2TRT A;  2LFB A;  5E3N A;  4M3D A;  2L0K A;  3WHB A;  1JKQ C;  1Y1V J;  1Z77 A;  4JP0 A;  3TW7 A;  1VF9 A;  3DCF A;  1BW6 A;  2PMZ N;  2LLK A;  1H8A C;  1SAN A;  1X2M A;  3HDD A;  1POG A;  3M4O J;  1TWA J;  3SDG A;  2HXI A;  4IHV A;  3HBL A;  4CYC A;  1FTT A;  1GV2 A;  3NAR A;  3I4N J;  3B6A A;  1ZR2 A;  1GDT A;  2EZI A;  1IGN A;  1I6H J;  2FQ4 A;  2DA1 A;  2E2J J;  4FIS A;  1AKH A;  4IHX A;  4AUX A;  2DMT A;  1P7J A;  1IUF A;  3S1M J;  2DTZ A;  4AYB N;  3HGG A;  4I76 A;  4A3E J;  3RZO J;  5M5W J;  4XRS G;  2DA7 A;  4DZP A;  2VKV A;  4A3D J;  5EG0 A;  1NTC A;  2XRL A;  2R5Z B;  2MG4 A;  2L7F P;  2FX0 A;  1ETX A;  5IYB J;  3MN2 A;  1H89 C;  1YRN A;  2DMP A;  3S1Q J;  3GTJ J;  5IYC J;  1JTX A;  3TP3 A;  2Y2Z A;  2JJ7 A;  4L5E A;  2YU9 J;  4FTH A;  4X6A J;  2ID3 A;  1MBJ A;  5F0H A;  1GVD A;  2GBY A;  3IH2 A;  2OPT A;  2Y9Y A;  3GTM J;  1WI3 A;  5F0C A;  4MIM A;  1T33 A;  2HOT A;  5M5Y J;  4A3J J;  1HDP A;  5M3F J;  2ME0 A;  2M8G X;  2VKE A;  3L1P A;  2W48 A;  3TW6 A;  3JRF A;  4DYR A;  3A03 A;  4DZJ A;  4XID A;  3M3Y J;  2WV1 A;  1JGG A;  5F27 A;  1D5Y A;  4B4C A;  2ID6 A;  5EYR A;  3HKZ N;  2RAE A;  1RPW A;  5EZH A;  4EEF G;  1EF4 A;  2YS9 A;  4FE4 A;  2QF7 A;  1QVT A;  1CQT A;  1X58 A;  4UUS A;  3PO2 J;  1A5J A;  2E19 A;  3HOW J;  1OCP A;  4FE7 A;  2X9D A;  2XGD A;  3BG3 A;  1R9T J;  1WCM J;  5E3M A;  1LE8 A;  3IH4 A;  1W0T A;  1ZQ3 P;  4IEJ A;  3HEF A;  4A3G J;  4BXX J;  3F0C A;  4IHY A;  1B72 B;  2L7Z A;  2R7Z J;  1ETW A;  2YUS A;  2WAQ N;  3LOC A;  2JA5 J;  2K9Q A;  1JUM A;  1G2H A;  2DMU A;  1WH5 A;  1Z0X A;  1JTY A;  1NK2 P;  4C3J J;  2DMN A;  1MNM C;  3PO3 J;  5IP6 A;  4JX5 A;  1W0U A;  3HOV J;  1LFU P;  1DU6 A;  1K61 A;  1U9N A;  1ETQ A;  4XK4 A;  2NVY J;  4JX4 A;  4NDL A;  3UKG A;  4A3M J;  2D5V A;  3PM1 A;  1XG1 A;  3FKI J;  3QPS A;  2JA8 J;  3E7L A;  3O8H A;  5EGO B;  2KDZ A;  3RZD J;  3S2H J;  4G12 A;  4XIC A;  2XSD C;  2K9S A;  3ZQF A;  2Y30 A;  3GTG J;  3BTL A;  1TC3 C;  2ECB A;  3BR3 A;  3G1M A;  1JT0 A;  1LFB A;  2EZK A;  2ZB9 A;  3BR5 A;  5FKM A;  2HXO A;  2JWT A;  2DA3 A;  1XC5 A;  2CRG A;  3CQZ J;  5FKO A;  5J1Y A;  5DS9 A;  1ZGW A;  5C4J J;  4M3G A;  2HDD A;  3HGY A;  2NOG A;  2MGQ A;  2Y9Z A;  3C2B A;  2K40 A;  5F08 A;  2HI3 A;  2LVS A;  4BBS J;  2NS8 A;  4D5F A;  3CMY A;  5HOD A;  2IBD A;  3BG9 A;  3CCY A;  3CDL A;  3RQI A;  2EZH A;  5EZG A;  4DYQ A;  4JX6 A;  3QQA A;  1WGX A;  2Y0S N;  3S1R J;  3HOZ J;  3JRH A;  2H8R A;  5C4X J;  5IYD J;  2XPW A;  1GT0 C;  2R5Y B;  2H1K A;  3A02 A;  1FJL A;  3OOU A;  5JLX A;  2E2H J;  1MSF C;  1JUP A;  2L7M P;  3WHC A;  1JT6 A;  1SFO J;  3BR1 A;  1MH3 A;  2IAI A;  1MBK A;  2GM4 A;  4I6Z A;  2L9R A;  3JRB A;  2NVX J;  1BA5 A;  3MKL A;  1ETY A;  2LD5 A;  4QTR A;  1JJ6 C;  2GLO A;  1TWC J;  2DA4 A;  2DMQ A;  2EBI A;  3O8G A;  1JKR C;  4MFD A;  1QPI A;  3H0G J;  3Q3S A;  4LOC A;  4MLO A;  1B8I A;  1ITY A;  3B6C A;  1GV5 A;  5F1J A;  2HOA A;  5M3M J;  2MW8 A;  4MFE A;  3VPR A;  2O8K A;  1E3O C;  1B72 A;  1FIA A;  3S17 J;  2XPU A;  5C3E J;  3JRG A;  1BJZ A;  3JRC A;  3A01 A;  4A3L J;  1U78 A;  5EG0 B;  1WH7 A;  3BTJ A;  4A3I J;  4A69 C;  3S15 J;  2XPV A;  1XS9 A;  1P7I A;  1YRN B;  2HYJ A;  3QPL A;  2DA2 A;  1K83 J;  2TCT A;  1APL C;  4D7M A;  2X48 A;  3W6V A;  1HLV A;  5FKK A;  2E2I J;  4A3B J;  5FKN A;  2R93 J;  1F36 A;  1IG7 A;  3Q0W A;  2WB1 N;  3Q0V A;  3JRD A;  1U8B A;  9ANT A;  4DYC A;  3BR0 A;  4BY1 J;  3G1L A;  3K2A A;  3JR9 A;  1S7E A;  3OSF A;  2LR8 A;  2M34 A;  1RKT A;  2CJJ A;  4Y7N J;  2FD5 A;  5J1U A;  3TP0 A;  1MH4 A;  1QVU A;  3S2D J;  1ZK8 A;  1X2N A;  4BKX A;  1PUF B;  2DN0 A;  3ZQH A;  3D1N I;  1MBF A;  2LP0 A;  3ZQL A;  3GTO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...