4UUTA

Crystal structure of the ultrabithorax protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
TYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HOMEOTIC PROTEIN ULTRABITHORAX
publication title A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 29
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4uutA00
2DA4A 5K7HA 4M3FA 2Y30A 1HDPA 2HI3A 1IDYA 4IHVA 4RDUA 3D1NI 1GV5A 1XG1A 3VPRA 2DN0A 4IHXA 4XICA 2ID6A 2ID3A 2Y31A 4M3EA 5E3NA 1JT6A 1ORKA 2M9HA 1Z77A 4B3AA 2KDZA 4A3KJ 3K2AA 5FKMA 4BBSJ 3K7AJ 2K40A 1D5YA 1LFUP 1JUMA 1B72B 3HOVJ 2O9LA 1RPWA 2EQRA 3A02A 2Y0SN 1P7JA 1IG7A 1IGNA 2L9RA 4BXXJ 1OCPA 2MGQA 5FKLA 3JRAA 1ETVA 1TWFJ 3BTLA 3G1LA 1JJ6C 1AHDP 2Y9ZA 2M2EA 2LLKA 2VKEA 3MVPA 1FIPA 2NVXJ 2ME6A 1TWGJ 4QTRA 1U78A 4A3EJ 3ZOBA 1T33A 5E3MA 3B6CA 1FEXA 2R93J 3BQZA 2JK3A 4ABZA 1MBHA 5F27A 3BR2A 2VPRA 4JP0A 2L7FP 1X2MA 4XRSG 1RETA 4HNVA 3RZOJ 2R5ZA 1GUUA 3ZQGA 2Y9YA 2JN6A 5K7ZA 4A3GJ 1HCRA 1A6IA 3BR5A 2DA6A 3CQZJ 3S14J 1MBFA 3JRHA 4GFBA 3Q0WA 3CMYA 2AHQA 2CRGA 2DA3A 4QSHA 4NDLA 1U9OA 2DTZA 4BKXA 4MLOA 5F1JA 5C44J 3RKQA 1VFCA 4A3CJ 5IOYA 1BJZA 1HOMA 2E2HJ 5GP9A 1FIAA 1HF0A 5M5XJ 2R92J 3S1NJ 4XIDA 1QVTA 1WH5A 3DEWA 1ZK8A 1MH3A 2EH3A 5C4XJ 4CYCB 3BG3A 3W6VA 3JRIA 3OOUA 1I50J 4V2GA 1DU6A 3HOXJ 2DJNA 4MFEA 1FTZA 2TCTA 2ELKA 1BW5A 2CU7A 5FLVA 5IP7J 1ZR2A 1T56A 5K7FA 1GVDA 2G0EA 2R0QC 2AO9A 2LVSA 3FIWA 2LD5A 2D5VA 2NVTJ 5FKNA 2M0CA 3DCFA 1LE8B 4C3IJ 3B6AA 1AKHB 3H3VK 1ENHA 2XGCA 4UUTA 2LK2A 5M5YJ 1YRNB 3GTOJ 3ZQLA 4IHYA 4C2MJ 3LNQA 2EZLA 2H1KA 4LOCA 1MBKA 5EG0A 3S17J 2E2JJ 2JA6J 2R5YA 2M8GX 2X48A 4A3MJ 2DA1A 1B8IB 1AU7A 2DMNA 4XRMA 5IYDJ 1I3QJ 3NAUA 3A01B 2FX0A 1LFBA 1OCTC 3GTKJ 1JUPA 2HOSA 2MW8A 2R7ZJ 1QPIA 2LFBA 1E3OC 5HODA 3FK7A 4AC0A 3HEFA 5DS9A 3BG5A 4A93J 2FD5A 2FQ4A 2DMTA 1FTTA 2XGEA 1ZTRA 5FLMJ 2EZKA 3BQYA 1JJ8C 1IRZA 5JLWA 3HDDA 4A3FJ 1NK3P 2EZIA 2XB5A 3S1RJ 2ZB9A 1FJLA 5FKKA 2I10A 1ITYA 3MKLA 2K9SA 2RAEA 2HXIA 3JRBA 3IH2A 4S0HB 1BA5A 4I76A 1MNMC 1POGA 2KT0A 2JWTA 2L0KA 1QRYA 4BY7J 2JA5J 4DYCA 1H88C 4MO7A 4M3GA 1PUFA 2O7OA 4FTHA 2QF7A 4MFDA 3L1PA 3TW7A 1MSEC 2B63J 3G1OA 1GDTA 1APLC 2WB1N 1UG2A 1JUSA 1ZKGA 5IOZA 1IJWC 4B1RA 1I6HJ 5IYCJ 4UUSA 1WH7A 3HKZN 4I6ZA 2IEKA 4DW6A 2E2IJ 3HOWJ 1AKHA 3ZQIA 2NVYJ 2XPWA 3M3YJ 2X9DA 5E3OA 4JX5A 3FK6A 3SDGA 5IP6A 3NARA 5IPAA 1F43A 1K83J 4X6AJ 2PMZN 1B8IA 2DMPA 4JX6A 1RKTA 4A3IJ 2XSDC 2ECBA 4XK4A 2ECCA 2W48A 2VKVA 3Q0VA 2E19A 3HM5A 5F08A 3JRGA 4A3JJ 3BR3A 3PO3J 3Q0UA 2XPVA 1K61A 2VUMJ 2LR8A 2IAIA 2COBA 4A69C 3S2HJ 1MBEA 2DMUA 3C2BA 5EEAA 5EYRA 3BT9A 1B72A 3O8GA 3CDLA 2M34A 4FCYA 5GPCA 3CCYA 2DA5A 1WPKA 2CUFA 3HGYA 3QPLA 4D7NA 3LSPA 4A3DJ 2L7ZA 1BW6A 2NOGA 5EGOB 3M4OJ 2DA2A 5EF6A 1IV6A 4M3BA 2HYJA 3BTJA 1GT0C 2K9QA 4L5EA 1NTCA 2GM4A 1JTXA 3I4MJ 1JTYA 1WCMJ 2MSYA 3S16J 1TWAJ 1MBJA 1DU0A 5FKOA 1S7EA 3TP3A 2NS8A 2QCOA 2XRLA 1XS9A 2YU9J 4JX4A 1P7IA 2MG4A 5F04A 2O8KA 3Q3SA 1WI3A 2LP0A 1ETKA 1JKPC 1EF4A 3PM1A 2E1OA 4XRSA 3S2DJ 4C3HJ 4C3JJ 1MH4A 3JRDA 1G2HA 3G1MA 3GTJJ 3QPSA 2X6OA 3BR6A 3TP0A 2YUSA 1RKWA 3BTIA 5M5WJ 5EDNA 1JKQC 1QVUA 3GTGJ 1HLVA 2YS9A 2CUEA 2LY9A 1ETWA 1H8AC 3LSGA 3UKGA 3F0CA 1GV2A 2FJ1A 2K9NA 3FKIJ 4DZJA 1MSFC 2OF7A 3H0GJ 4BY1J 4A3BJ 4QIWN 3QQAA 3JREA 5C4JJ 2NS7A 5F0CA 3GTLJ 1A5JA 1ZR4A 3RZDJ 5F0FA 2XPUA 1IUFA 1F36A 3HOUJ 1TWCJ 3HBLA 4IEJA 4FISA 2Y2ZA 3SFIA 3S1QJ 5M3FJ 4Y7NJ 4FE7A 1OFCX 2P81A 4X1EA 4CYCA 2HOTA 1Y1VJ 2HDDA 2EZHA 3TEDA 5GPAA 4G12A 4FE4A 1ETOA 1UHSA 4M6VA 3FISA 2OPTA 1XC5A 5J1RA 4M3DA 1U9NA 4Y52J 3BR1A 5EGOA 2TRTA 1Y1WJ 1ZQ3P 2HOAA 1MBGA 3TW6A 1W0UA 4DZPA 2JA7J 4IHWA 3OSFA 5IYBJ 1JGGA 2H8RA 3HOYJ 1JT0A 3JR9A 5J1YA 1X2NA 1LE8A 1WGXA 2VI6A 2GBYA 1IDZA 1X58A 2WV1A 1YRNA 3JRCA 5J3LA 1TC3C 2XB0X 3ZQHA 1VNDA 4RBOA 3ZQCA 1SANA 5EG0B 1BL0A 1ETYA 2R5YB 9ANTA 3E7LA 1JKRC 3S15J 2JMWA 5BNGA 3IV5A 5FJ8J 2N8GA 3A01A 1Q1VA 5EZGA 4BBRJ 1U8BA 3SJMA 2HXOA 1R9TJ 4EEFG 5M3MJ 2LKXA 1H89C 2XGDA 1TWHJ 4B4CA 4W97A 1RESA 5E3LA 1NK2P 2JJ7A 4DYRA 4A3LJ 1IC8A 1OJLA 3LOCA 4AYBN 5EZHA 3S1MJ 3I4NJ 1VF9A 1ETXA 3HB9A 3HGGA 1RR7A 4J19A 5JLXA 2DMQA 2GLOA 3LSJA 4AUXA 2IBDA 4JYKA 5IP9J 3OSGA 1VI0A 5DTDA 2EBIA 5F0HA 4DYQA 2ME0A 3LSRA 4V2FA 3GTQJ 3GTPJ 3GBGA 1Z0XA 1W0TA 2HQ5A 3BTCA 3IH4A 1JKOC 3ZQFA 1SFOJ 2CQQA 4D5CA 1PUFB 1HDDC 1ZGWA 1UMQA 2DA7A 2JA8J 2CQXA 5C3EJ 3HOZJ 4D7MA 3JRFA 2L7MP 2LTPA 2WAQN 4MIMA 3GTMJ 1O4XA 5J1UA 3WHBA 4UUSB 3PO2J 2R5ZB 3OIOA 3O8HA 3IH3A 1ETQA 3A03A 3WHCA 3RQIA 2NVQJ 3BR0A 3MN2A 4W1UA 2CJJA 1CQTA 4D5FA 3BG9A
chains in the Genus database with same CATH superfamily
2DA4A 5K7HA 2VXZA 4M74A 1GLNA 1IDYA 1S5LC 3OV8A 4DJAA 3F21A 4XLFA 3H9JA 4XICA 2QA4I 2VOPA 1FP2A 1JT6A 2Z99A 3QOPA 3QPTA 4RGRA 3GLXA 1VTNC 4IHTA 1QZYA 2JVHA 1I1SA 2IA0A 1S8NA 3I59A 2KDZA 4A3KJ 3K2AA 4HX8A 1T0FA 1BM9A 2K40A 2JZYA 2WB1A 2ICWG 4P96A 2LC2A 3HSRA 1D5YA 3L2VA 3JSOA 1JUMA 4D9JA 3HOVJ 1ZG5A 2EQRA 2Y0SN 1P7JA 2H94A 2Q2EA 1ZG3A 3HXLA 1IGNA 3FXLA 4Z2YA 5FKLA 4HAMA 4KISA 1EV7A 4HA8A 2Y9ZA 2M2EA 3QPHA 1ZN2A 1MMDA 2A68F 4RA2A 2QQ8A 2KPMA 5FGMA 3CC4I 3OY9A 1JXSA 5K1YA 1XDSA 3TO9A 4ZYHA 2ME6A 4ZTFA 1SD4A 1W5TA 5E3MA 2LRDA 3B6CA 1WKMA 2HU9A 3HJEA 3K69A 3BQZA 1S3JA 3H36A 1FSEA 1WJBA 3QWLA 4JP0A 3J7ZI 3ML6A 3I5UA 3VYTB 4CCKA 3RZOJ 4JK1X 5TGTA 1UELB 2R5ZA 1R1VA 3VFZA 3WTTC 1NG7A 4AYBA 3CO7C 1O7FA 4N9HA 3PUBA 3K2ZA 4GCVA 1P6RA 1A6IA 2R7XA 2DA6A 1C0WA 3T5XA 3K70C 3JRHA 3OL4A 1ACIA 1I3AA 4GFBA 4ZYAA 1YHQI 1R5ID 2AHQA 5E17F 1R22A 3GO5A 2VJ4A 3M8JA 2JVGA 2CV1A 2XUBA 2XVCA 2X6WA 2DTZA 5D5VB 3S3NA 5C44J 2JUCA 5IOYA 2J5OA 1Y8QB 1HOMA 2IA2A 2M4GA 2XSJC 1ZREA 1TP4A 4I0AA 3OYHA 4OMYA 2V9VA 4YFNF 1JHFA 2VBWA 3S1NJ 2RN7A 2RV8A 3IL2A 1DPUA 1ZK8A 1O57A 1PP7U 4A5NA 1MH3A 4BU2A 3BG3A 4G6TB 4RGXA 2GZWA 1SAUA 3D0SA 5H20A 1I50J 1BIAA 3WTXC 1RR8C 4GYGA 3VODA 1DU6A 2KJCA 4MFEA 4B44A 3I53A 2RREA 2P5VA 5IP7J 2QZ8A 4ZJZA 1IV8A 3GVAA 5KCMA 1XB4A 2GXAA 3HHGA 2WY8Q 3F23A 1GVJA 3PUFA 4OMZA 3C1DA 1VQMI 2DBBA 5E1ZB 3M7GA 1G3SA 2P6SA 2HTSA 3F9KA 3WODF 3GZ5A 2HZTA 3TO6A 2NNNA 4IHYA 4U0VA 5BQTA 3LNQA 1J7KA 5AIQA 4LOCA 2H1KA 2WAEA 4XQFA 3W2VA 2E2JJ 2R5YA 1FPQA 4LIUA 2M8GX 2P6TA 2X48A 2HVQA 2DO7A 1B8IB 3TO7A 2L02A 3CLQA 2UZKA 2QLZA 4AIDA 2VC1A 2A6EF 3K10A 1LFBA 1JUPA 1P4WA 1RC9A 2FNAA 3ELKA 1JHHA 2R7SA 1K79A 1UCRA 1TZLA 2M30A 2XASA 3QU6A 2DOEA 4UV8A 3MKWB 3E0JB 2FD5A 3ZN0A 2IGKA 2JPCA 2STTA 2XGEA 1X3UA 5ICGA 2EZKA 2W7NA 1JJ8C 3OYKA 2K4BA 4A3FJ 2XB5A 2ZSHB 4C2TA 3S1RJ 2GWRA 2LSOA 4G8XA 5J8FA 2HXIA 3GFIA 3ABLH 4GYIA 2FMYA 4EVIA 1BC8C 4OIQF 4I76A 4XLEA 1MNMC 2HPIA 1FP1D 1O7LA 5LEKA 1YLFA 4DYCA 4M3GA 1PUFA 2PJRB 5LGTA 4FTHA 4MFDA 3TW7A 3OYNA 1MSEC 1IN7A 1Y39A 1GDTA 1APLC 2DFEA 3L00A 2BBYA 1JUSA 1ZKGA 2MH2A 1V3FA 1OR7A 1KYZA 4Z6YA 1WH7A 3HKZN 2X1DA 3F8BA 4DW6A 4HV5A 2L9VA 3TMOA 1XX5A 5B3SH 4HF2A 2XF5A 3CUOA 1MGTA 4UUVA 1IXCA 4E7LA 1FZPB 4Q4ZF 1B4AA 2X9DA 4PDKA 3CP8A 3T8TA 3RQ4A 2KP6A 1G4DA 2DODA 2YX7A 5IPAA 3AKZA 1F5TA 4HPQA 1R7JA 2OQGA 1J5YA 2PMZN 1DQUA 1B8IA 3BCBA 2MLKA 1WQ2A 2F5DA 3ASOH 4U0YA 2ZXWH 4KMUX 2VQHA 2CYYA 2PBIA 2W48A 2XAGA 2Y75A 3IC7A 1WJDA 5F08A 1FOWA 1LUJB 2IVMA 1T95A 4A3JJ 1D1AA 4ZTJA 4KFCA 3PO3J 5CVVA 2VUMJ 3CJNA 2HQAA 3BJ6A 1MBEA 1OR7C 2DMUA 3K4BA 5EEAA 5EYRA 3BT9A 1B72A 3CDLA 4IZZA 4PGGA 4A5MA 4FCYA 1VQNI 3K4KA 2NS0A 3K4CA 1R36A 1WPKA 1ZH5A 1GXQA 3HGYA 3QPLA 3SQNA 3WTWC 5TRDA 4A0ZA 4D7NA 3LSPA 2CWEA 4AM3A 1HXDA 3BZCA 3M4OJ 1EH7A 2CV0A 1MDMA 3CO6C 4M3BA 2EFQA 3SEQA 4WWCA 1V54H 1UFMA 4CA0A 1B59A 2AXTC 3KYLA 4UV9A 3J7AO 5JR3A 2WV0A 1JTYA 1MJ9A 2PJRA 1LDDA 3CLOA 1MBJA 3TL4X 4QWQA 5EEHA 2YU9J 4JX4A 4WXHA 4BQNA 1N75A 4D0PA 2VJJA 3Q3SA 3LSMA 2KKOA 2EFWA 4NB5A 1UHMA 3J81K 3O3KA 2HWVA 1E0EA 1Z7UA 5E8GA 3VDXA 2NRAC 3QP5A 1EKEA 3U9GA 2V26A 3HYIA 5FFXA 3CJRB 3L9FA 3TP0A 4CH7A 3GMEA 2OQRA 5EDNA 2X0LA 1FY7A 2CUEA 2LY9A 3QODA 1ETWA 4ENMA 3CC7I 3DKWA 3E5UA 1J2XA 2K9NA 2FJ1A 3OYLA 3FKIJ 4JBAA 2QGUA 1BN5A 5FROA 1QPMA 4GRIA 3GTLJ 1A5JA 3GFLA 2VXDA 2XPUA 3HBLA 1QHGA 1R1UA 3AG1H 4E7ZA 1USSA 1ZRCA 1FOXA 3J80Z 1DP3A 4J01A 3ESWB 3BP8A 4X1EA 4CYCA 3ONQA 4M9ZA 1Y1VJ 3EETA 2EZHA 3HG9A 4E7IA 3TEDA 3IUOA 4G12A 4FE4A 3ZMSA 3DBRB 5F64A 4E6KG 3GX4X 4HW0A 4M3DA 1D0XA 1OMIA 1LEBA 1XGNA 2ZCWA 3H0DA 1V5GA 2WC2A 3OIQA 3FMRA 3H3ZA 2L7KA 2JA7J 4YIFA 2CH0A 2FE3A 4IHWA 2V9KA 4M9SA 2LF7A 2ZXJA 1TL8A 2H8RA 1JT0A 3JR9A 2R7WA 2AS5F 3LA2A 1UJ8A 2V1XA 5J1YA 2O0YA 1L3LA 1LE8A 1KONA 1VQ7I 4M6YA 3O2PE 4HDUA 2E1MB 4AU7A 5CYVA 4M72A 2XROA 1XCBA 3CCVI 1BI2A 1YRNA 1KQ9A 1U6GA 2UV1A 5J3LA 2E5ZA 2EIJH 2XB0X 4ENNA 1VNDA 3ZQCA 1HA8A 5EG0B 1SD6A 4F55A 5CVJA 1ETYA 9ANTA 2LKPA 4Y33A 4ZC3A 5F1RA 3GW2A 5LLQA 4RGSA 2BVLA 1X19A 2DI3A 5ED4A 2XHKA 4BUPA 5GTHC 1MMNA 1XMAA 2EFPA 2OAZA 4XRFA 4BS9A 1U8BA 4BJTA 2HFHA 3SJMA 1R9TJ 4BDZA 3E6MA 4Q48A 3DPLC 5M3MJ 2LKXA 4L9TA 3RYRA 4B4CA 4RAFA 4W97A 3N97A 5D4RA 3PL8A 1RESA 5E3LA 1RUNA 1NK2P 3DBLB 4ZYEA 1U8RA 5HLIA 3LOCA 1JGSA 1VF9A 4K2EA 3HRUA 2ELHA 1A6QA 1RR7A 2QUFA 5IT9Z 3R0AA 2KL4A 3PNVA 3U1KA 5HOOA 1RIOH 3H5AA 2IA1A 2LOOA 3S8PA 4Y4RA 5IP9J 1TTYA 3HRTA 4P5OA 1W7PD 1XMXA 3JSPA 1YFHA 4CXFA 5F0HA 2YR2A 3LSRA 2BVMA 3GTQJ 2CS3A 4MQVA 5H6RA 1LPQA 2L9NA 1AWCA 1W0TA 3GEZA 3BTCA 1SEUA 3VYSB 1SFOJ 1EH8A 3CD6I 4F3QA 1PJRA 3QOEA 2LBFB 2R7OA 4IO9F 1HKQA 2XC7A 2CQXA 5C3EJ 2R7UA 2L7MP 1BR4A 3RYPA 3GTMJ 1P9QC 3MMYB 3IH3A 1ETQA 3A03A 5ILUA 3MWMA 3WHCA 1DUXC 2DFFA 3BDDA 3SDBA 4EJWA 5J4YA 4W1UA 3U2RA 1PP8F 3LL7A 2CJJA 2F5EA 1YJNI 3H3UA 2VODA 1OPCA 2VT3A 1CQTA 2IXSA 2WY7Q 4MGRA 1OLTA 3ABMH 4BL0B 1FT9A 3LSTA 2H09A 4LLNA 2BY1A 4CSWA 2HI3A 4BYYA 3D1NI 5FLXZ 1GV5A 3WU0A 3A4CA 4LB6B 3RIRA 3ZP5A 1MNDA 2BXYA 3FHZA 5E3NA 1ORKA 4ASNA 2CMPA 3LSIA 5A2QK 3OYCA 3TGNA 4B3AA 2UUZA 1Z1DA 3BJOA 3PIPF 2IS6A 3NQOA 4I99C 1QQIA 1LFUP 1G59A 1WZ2A 1RPWA 3I3LA 3AFHA 2E1MC 3JRAA 3FWEA 3BTLA 5LBQA 1JJ6C 1RZ4A 3DEEA 4LIVA 1F1ZA 2LLKA 4KIBA 4CCMA 4HOBA 2JRMA 2OA4A 3KEYA 5HNHA 2DDAA 3P9CA 2OC6A 2DK8A 2W85A 3LFKA 4C9YA 1Z3XA 1U78A 1HW1A 1XGMA 1T33A 3DFGA 1BI1A 3IHUA 2LBFA 1TW3A 2FA5A 4ABZA 3IKTA 2OV7A 2L7FP 4XRSG 3HOSA 1RETA 2E7WA 2CV2A 4HNVA 3LAJA 2M0MA 3K4JA 2W00A 4E7SA 2JN6A 1W5SA 3N05A 5K7ZA 3ZGKA 4A3GJ 1ZG1A 3K0LA 3BR5A 2VC0A 3EYIA 5FRNA 3OIPA 3CJTB 3RKWA 1Y0UA 5AONA 2W82A 5HS9A 1W36D 3LSHA 1VQPI 2DPUA 1W5CC 1QBJA 2G7HA 4L5JA 4BKXA 5JFRA 3KP5A 2CFXA 4MHGA 4MLOA 2Z16A 3V7SA 1VFCA 4L9NA 4B09A 5KNLA 2L5QA 2LREA 4CCNA 2D45A 5M5XJ 2R92J 4XIDA 1QVTA 1WH5A 4UB8C 5DCFA 1MIJA 3KX2A 3ECOA 1Y0NA 4EM0B 3W6VA 2EJRA 3JRIA 4MEYF 1K6OA 1MKMA 2HEOA 1WVRA 2ZNZA 1HKSA 2A05A 3AG4H 2DJNA 3GYHX 1IAWA 3CJQB 2TCTA 4L18B 2ELKA 2KZGA 1FX7A 2HGCA 1J0RA 1T56A 2ETHA 2AQEA 1GVDA 4KA4A 1OCRH 2BY3A 2BY0A 3PFIA 3VEPA 3KP4A 1BR1A 3FIWA 3G2BA 5J4VA 2LD5A 2NOJB 3RJPA 5EJCA 5TJJA 5FKNA 3DCFA 2DOAA 2GQQA 4WCGA 2F6CA 1AKHB 1USTA 3B6AA 1SMYF 4Y17A 5M5YJ 1D3YA 2P4WA 2QQBA 2W25A 4G7HF 3ZQLA 4QPOA 2P0WA 2OZUA 3Q5FA 1MBKA 3S17J 2D2WA 2JA6J 4A3MJ 1BI3A 3PIOF 2DA1A 2KLOA 4XSXF 4LITA 1FOYA 4CZZA 2VOOA 3OOPA 1R4NB 1T38A 5FD5A 1I3QJ 4D1QA 3A01B 3K9TA 2FX0A 2R7QA 1OCTC 2K7LA 4RB3C 2MW8A 1YIOA 2ZBKA 4YEJA 1O3RA 4I0BA 5HODA 3BG6A 3PSIA 3I58A 5DS9A 5ICCA 3BG5A 2H6BA 2KZVA 4DOZA 4ETSA 4A93J 4NC6A 2L4MA 1ZTRA 2XAJA 1MNEA 2ESNA 3GUDA 4NQWB 3BQYA 2VBZA 2ZFUA 5B66C 2AXLA 2D1HA 3HDDA 2F5VA 2EZIA 1NK3P 4XLCA 2HZDA 2ZB9A 4LG3A 5FKKA 1FJLA 4ENJA 5B1BH 2Z1DA 3MKLA 4ZDPA 3JRBA 5DM7F 4S0HB 1V5FA 4RM3A 1MD0A 2FSWA 4CHUA 1T08B 2L0KA 2VKHA 1QRYA 2JA5J 3HPHA 1H88C 4AIKA 3FXKA 2QF7A 1Z7LA 1D0YA 2KIFA 4WXCA 2B63J 1ZLJA 3V7CA 2WB1N 1UG2A 3OR1C 4U7BA 3CCEI 3TBIA 1FMVA 1REPC 3WTZA 4UUSA 2FU4A 3P5JA 3IWFA 4EQQA 4I6ZA 2BXZA 3F6OA 2GA2A 2E2IJ 5L3FA 2HKOA 4FHTA 1K7AA 1AKHA 1XGSA 4ZYDA 3Q9SA 3S2WA 4CZCA 4RB0A 3CC2I 2IGNA 3FK6A 3SDGA 5IP6A 1QA6A 3NARA 1VQ6I 3SZTA 4XLPF 3CESA 4PFPA 2DMPA 3JTGA 4BNCA 3TDUC 5ILVA 4A3IJ 2XSDC 4XK4A 1EJ9A 2OD5A 4PSWA 2E7XA 3Q0VA 2E19A 4RLFA 4CDGA 2Y48A 3ULQB 5DD4A 3LA7A 2CQ7A 4IVNA 3BR3A 1WSUA 3Q0UA 1V5EA 4NC8A 4ENKA 5FFZA 2UXXA 3MCZA 1BIBA 3A2KA 5H2FC 2M34A 4BGDA 4IQ4A 2O61A 4ANJA 2RNJA 2CUFA 1YX3A 4DIQA 2L54A 3KEQA 1HSTA 1BW6A 4S04A 1ULYA 4KN4X 1TLHB 2DA2A 4NNJA 2R7FA 3K70D 3CCLI 2PLYA 1S29A 4IHSA 1E3PA 3S32A 4Q5SF 2P5LC 5BOXA 1GT0C 2FXAA 2K86A 1YOVB 2K9QA 4E7HA 1LB2A 3GZ6A 1WCMJ 2MSYA 3COAC 1TWAJ 3H1CA 2V6EA 1BI0A 2MFZA 2YSRA 1DU0A 3TP3A 2QCOA 4ESJA 1XS9A 4V19K 2CW8A 2JSPA 2CFOA 3H5NA 1SC7A 5F6FA 2VN2A 5CVIA 3DTKA 1WI3A 4DQ2A 1GHCA 1LKXA 2K5CA 3QYFA 4RS8A 2M8EA 3OS0A 2FMLA 4BHCA 3G3ZA 4C3JJ 3BC8A 3TKYA 4IPAA 3QAHA 2CQKA 3K4MA 2YUSA 3BTIA 5M5WJ 1ZYRF 3AL0B 1JKQC 1QVUA 1MJBA 4JOMA 2YS9A 1VZ0A 1HW5A 1KU7A 3LSGA 3WG9A 3UKGA 2LNBA 2COMA 1KU3A 1WFXA 4DZJA 2Q0OA 3DPUA 4BH9A 4HG2A 4ZYGA 4YIIA 1R1TA 2XIGA 5DD8A 4A3BJ 3J80K 1FSHA 2WAFA 5C4JJ 3JREA 3MKYB 5GAHJ 3DBHB 1TWCJ 1D1BA 1XCVA 3S1QJ 2L9SA 2W4SA 2Z33A 2R7DA 2FRHA 2DFIA 2E71A 2XV4S 4Y7NJ 4E70A 2E1NA 3SYTA 4FE7A 1OFCX 1A35A 3FMSA 4XSZF 1WI9A 4I7HA 1QZZA 2PG4A 4II2A 5GPAA 5LEJA 1UHSA 4M6VA 3A0HC 1XC5A 2OTJI 3M8EA 1D8KA 2VIXA 1IO2A 4MTDA 4EJUA 1I27A 2V7FA 4C2UA 2VL8A 1ON2A 4UVAA 2W1OA 2HOAA 4HRIA 1N77A 2RDPA 3DP7A 5IY5H 2QSHX 3FBNB 2O8XA 2QBYB 3HHHA 2R7RA 4ZZDA 1X2NA 5BPDA 1YIJI 1WGXA 2PMZA 1N78A 2GBYA 1IDZA 3QYEA 4UB6C 3MKZA 3FF5A 3JRCA 1TC3C 4YFKF 3ZQHA 4RBOA 1R5GA 1SANA 1BL0A 1XTAA 3HC7A 1MMAA 3E7LA 1R00A 2KQRA 5FB2A 2JMWA 5GAGJ 2DYRH 1WJ5A 2FUG2 4NC7A 4PJMA 3HUGB 1I6XA 5LHIA 4XNFA 4F91B 2EFNA 2ESHA 4AD9A 1Q1VA 1T39A 1IN8A 1YS7A 4F93B 2HXOA 1IRXA 1X3ZB 4BHBA 3F8MA 4A6DA 4DNCA 5IT9K 4A3LJ 1OJLA 2CUZA 4IJAA 5EZHA 3VB2A 1ETXA 2IJLA 5E8IA 5KAIC 3ZN1A 4J19A 1SVLA 2LG4A 5HS8A 5LRSA 2NAZA 1SVOA 3G6EI 4MEXF 2ZKZA 4BE1A 4AUXA 1W7PB 4A12A 1T98A 1WWXA 4DBRA 3BJAA 3ZRGA 1ON1A 5LHHA 1KGSA 2EBIA 3MZYA 2DJIA 2GA1A 4E4HA 1Z0XA 3C7JA 2HQ5A 3JAMK 3IH4A 1OCZH 4HLYA 3P9IA 3OYMA 1W4MA 1ZARA 4D5CA 1ZGWA 5J6XA 1UMQA 2IW5A 3F8FA 1D1CA 1YJWI 3M8FA 3I64A 2BV6A 3HTUA 3U1DA 2LTPA 2WAQN 4N9IA 5E79C 3AL0C 1O4XA 2ACJA 1G8XA 1U3EM 3PO2J 2DOFA 3FXMA 3O8HA 1IXSB 1BC7C 2I8DA 4B8XA 2VQCA 1LVKA 2B0LA 3MN2A 4HDVA 2KFDA 4HYEA 4IRGA 5DDGA 4CCOA 5FLXK 1SD5A 4IL6C 1TNSA 4MQ9F 2Y30A 3L2UA 2CGPA 5D8KB 3V7RA 4IHVA 4RDUA 3HUGA 1YQAA 3LQQA 4GDFA 4KICA 1XG1A 4A6EA 3HRMA 4M73A 4IHXA 3PQKA 2ID3A 4OIOF 1VQLI 4LLLA 4EJTA 1A04A 1Z77A 2VQGA 1HSJA 2X1CA 2X85A 2E35A 2Q1ZB 4BBSJ 2DPDA 1F4KA 1G3YA 1M1EB 3WU2C 2LDUA 3HOTA 2GXBA 5ICEA 2M45A 4BDYA 4AVPA 2PX9A 2O9LA 1ZLKA 3KFWX 3A0BC 3ZMUA 1XSVA 1IG7A 2VQLA 2E60A 1PYVA 4XKCA 2L9RA 1Z91A 3FBIB 4BXXJ 5CPRB 1JE8A 2MGQA 1AHDP 3G1LA 2YX4A 1P4AA 1R4MB 1S7OA 1R6RA 4WF2A 2XF7A 2R7VA 1XGOA 4BAYA 3E5XA 2DXIA 4NHJA 3KZZA 3CMAI 1TWGJ 2E36A 4QTRA 4A3EJ 4EM1A 1R58A 3DXJF 5JHUA 4LGWA 2FBKA 2UXNA 1QU3A 5HDGA 2JK3A 4P9FA 3A1YA 5F27A 3ABTA 3P9KA 3BR2A 2VPRA 3TQNA 1H0MA 2BYVE 2M3AA 1X2MA 1IXRC 1YO5C 4LLGF 4P1WA 3RCOA 4XL9A 4IF4A 2ZJ2A 3NRVA 4BE2A 2PJPA 3DV8A 4AVZA 3BG7A 2OTLI 2K3PA 4F52A 1HCRA 2BOLA 2I5UA 3CCJI 5FO5A 1MBFA 3RSNA 4EV0A 2PMHA 3Q0WA 3VOEA 2G7UA 1SVMA 5HDNA 2KDOA 2CRGA 2DA3A 4FQGA 4EJVA 4QSHA 1ZELA 3HIFA 3ABUA 4NDLA 4R1HA 3ZCOA 1FLIA 2RGVA 4OINF 5F1JA 2QSGX 3BPXA 5DEQA 4A3CJ 4KNYA 2L2OA 4XM3A 3AAFA 5GP9A 4RB2C 4XKVA 3PJRA 1BOAA 5B5EC 1HW2A 3GFMA 2VT2A 5CQEA 4YELA 4HSTA 2EA4A 3OOUA 2OCCH 1DGRM 2K4JA 4V2GA 3H9QA 2Z5UA 2QENA 3CTAA 3KZIC 1FTZA 2VONA 1F9NA 1BW5A 2CU7A 5FLVA 3LFUA 1ZR2A 3KP7A 5K7FA 2QM3A 2HNHA 2XRNA 2G0EA 1WJEA 1R23A 2QQAA 3ZMZA 4I2OA 5FRMA 2GOXB 2VE8A 5DV5A 2QEXI 2R0QC 2LVSA 3W2WA 2D5VA 3CCMI 3ROUA 2B7EA 4C3IJ 5E20A 2XGCA 3DU6A 1KQ8A 2FBIA 3GTOJ 4C2MJ 2EZLA 1IRFA 2F48A 5LHGA 5EG0A 3WE3A 2BEOA 2NXNB 5BPIA 2E1CA 4KDPA 1UB9A 3KIOA 1E17A 2ELJA 4ZDLA 4LFUA 3NAUA 2D1VA 1A31A 3EDPA 1T2KA 1ZRFA 2EPFA 3J81Z 2XGXA 3D5SC 4WK8F 1QPIA 5E18F 3QP6A 1MMGA 4S05A 3V42A 4AC0A 1YW8A 4XR6A 3HSEA 4ZZLA 1OCCH 2F4MB 2FQ4A 3RI4A 2DAOA 1BJAA 1FTTA 2BW3B 4OIPF 2QWWA 4HQMA 4KYWA 3CF5F 3S3MA 4IOCF 2DT7B 2X4HA 3M9AA 5KHDA 4LMYA 4G94A 4Y13A 1ITYA 2XAHA 3IH2A 4PJNA 3FZVA 3RPUA 3N4MA 1BA5A 2L3DA 2F2EA 1FBQA 2JWTA 3F72A 1TQIA 4BE0A 1B6AA 1T6SA 1D8JA 2CW0F 4HF0A 4MO7A 2CG4A 1TT0A 4HEA2 4CCLA 5GAEJ 2BE5F 4IQJA 4TV7A 3L1PA 1IRGA 2DK5A 3GFJA 1YW7A 2EV5A 2KIQA 3CMMA 1MZBA 3E6CC 2FNPA 1YE9A 2QVOA 2KIUA 2FOKA 2ZJPF 1K78B 2IS4A 3OWTA 4XLHA 5IOZA 1IJWC 2HDWA 4B1RA 2KHMA 3CCSI 2LYCA 4WX9A 5IYCJ 2JA2A 4L5IA 2DDBA 5ERIA 2IEKA 3OS1A 2WBMA 3C2HA 1QGPA 4KIFA 1RUOA 4CGZA 2PFBA 3HOWJ 2A3SA 2IS2A 2EWNA 3ZQIA 2LF8A 2NVYJ 2MD5A 2QQ9A 1I1GA 4AIJA 4HLXA 2P7CB 1EH6A 1IN5A 1YW9A 5KAFC 4HV6A 1FYKA 2ECBA 1PVEA 1BR2A 2KIMA 2VKVA 1H9TA 1K4SA 4OWRB 1TQMA 3JRGA 4G6DA 2XAUA 3CCQI 3W6KB 3CZ6A 2LR8A 1STZA 4A69C 3K1PA 1X3WB 2HYFA 4HX4A 3WTUC 4YFXF 3O8GA 3IAM2 3F6VA 2K02A 3WU1B 3SXYA 3CCYA 4F7ZA 2F5CA 2KRCA 2DU9A 2RNGA 3FKJA 4A3DJ 2L7ZA 2VBYA 2NOGA 2EIMH 4OOIA 1SMTA 5CVUA 5EF6A 1MJAA 3ERMA 2HYJA 3LSKA 4M9XA 1J75A 2X6XA 2DQRA 1P92A 4L5EA 1NTCA 4HX7A 3I4MJ 1X1DA 3S16J 2BZTA 3DF8A 1MW7A 3KYDB 4YIRX 4R79A 2LY1A 5FKOA 1S7EA 2NS8A 3JCUC 2XRLA 2Q8KA 4BQAA 1XMKA 2AQFA 2MG4A 5F04A 3HTSB 2O8KA 1JKPC 1XPXA 3L2WA 4KITB 4XN3A 1HQCA 3ZMTA 3KETA 2HOEA 2NYXA 3B02A 4XRSA 4C3HJ 3IAS2 1ERDA 3R0JA 4ESFA 1GXPA 3ABKH 1MH4A 1G2HA 3OYDA 2DYSH 2VE9A 3EQLF 1YTYA 3G1MA 4RGUA 3QPSA 3BR6A 1RKWA 2Y0SA 3KYCB 1W1WE 3I55I 2EIKH 4O6JA 2JUGA 1HLVA 2HVRA 3KLOA 2OU2A 3AG2H 1LFPA 3GCMA 3QU3A 3LWFA 1MSFC 4G9YA 3H0GJ 3VSKA 1FMWA 2OZ6A 2K9MA 2FQ3A 3QQAA 3TOBA 5F0CA 3RZDJ 1YITI 2A61A 3EYYA 4RAGA 2UWMA 4HBLA 3BLYA 3HOUJ 2HYGD 1G3TA 2XKOA 4KMFA 4FISA 3SFIA 3L2QA 3BZKA 2FOWA 4I98B 4NBQA 4PZJA 5M3FJ 1K4TA 3I0TA 4HF1A 3FM5A 4LK0F 2P81A 1FOKA 1A36A 2WA0A 2HOTA 2V1DA 2DTRA 5A2QZ 1J9IA 3H92A 3K4NA 4CYDA 2MA3A 3M1EA 4AWXB 1SFKA 1Y8RB 5J1RA 2VASA 1U9NA 4UNOA 2W24A 4Y52J 3BR1A 2R7TA 1QZEA 4JQFA 1Y1WJ 2GOMA 1ZQ3P 5K5QA 3DLAA 2FEZA 3TW6A 3EUHA 3J7YJ 2VBXA 4J00A 5HLGA 3I56I 4U87A 3OSFA 1CGPA 2HKXA 2OJED 3KEOA 4IXAA 4A2UA 3ZPLA 3HOYJ 1KZHA 1X4OA 2PEXA 3GZNB 2HS5A 1YYVA 2X1EA 2XKPA 3JTHA 1ZAOA 1X58A 2RVCA 4OU0A 5EEGA 1SFUA 4IRHA 1OYYA 3J7AY 4FX0A 1E2XA 2EILH 2R5YB 2TDXA 1QHHD 3NWSA 5J8CA 2NNYA 1NHAA 4HZFA 1T0FC 2H8WA 3IV5A 3DPTA 1QNTA 1FBSA 5FJ8J 3MEXA 2N8GA 4XKWA 5HLTA 3A01A 5DCMB 3R4KA 2K27A 4PJLA 5EZGA 4BBRJ 3HL2A 5TISC 4IKFA 2MC3A 3DWLE 3DKXA 3VSLA 2H1LA 4EEFG 3KPHA 1H89C 1DPRA 3F8NA 1TWHJ 2E34A 4KN7X 4WXDA 2JJ7A 4R8HA 2RQPA 2M5WA 4AYBN 4PUSA 3EUHC 4L9JA 4L0ZB 2WTEA 3S3OA 4RAYA 5CKTA 3E6BA 1D0ZA 5JLXA 3ASNH 3H5RA 1FNNA 1T8IA 2DMQA 4NQWA 2H6CA 4A0XA 2HPMA 1QO0D 2EINH 2IBDA 3OYIA 3OSGA 1VI0A 5DTDA 3X2QH 2DT5A 1EA3A 1TQPA 2V79A 3DTIA 4DYQA 4XBFA 2C6YA 5D4SA 1VQOI 4M71A 3KZYA 2GAUA 3NWTA 5AIPA 4LK1F 3ZQFA 3GLLA 1PUFB 1HDDC 3IWZA 2DA7A 6PAXA 3H9GA 3F8CA 4LD5A 4HNUA 3HOZJ 4XLAA 4D7MA 2BY2A 3VYRB 1SAXA 2ZJQF 1SFXA 5J1UA 1FBUA 3WHBA 3R60A 1RRJA 2FBHA 3OIOA 2K9LA 2EV0A 2KRHA 2LMDA 3CUQB 3SHFA 2KRFA 4G7OF 1VQ9I 1S9HA 3K1NA 2XF6A 2GIVA 5LD2C 2BGCA 1KA8A 3BR0A 3SZPA 4EGZA 4II3A 3V8LA 1FYLA 5LGUA 3IRRA 3OR2C 5HNFA 4RM2A 3BG9A 2XAQA 1V55H 5J47A 1KU9A 1FC3A 3G71I 3F22A 4M3FA 2LY2A 4GO1A 4CCJA 2ZJRF 2NVUB 4BXUA 1HDPA 2DCEA 2JSCA 4XMYA 3LAPA 1S72I 1FYMA 1AOYA 1IW7F 2A07F 3VPRA 4PCQA 2DN0A 5DCMA 4KUMA 3CDHA 2F4IA 4B43A 2ID6A 3KP2A 3OMYA 2Y31A 4M3EA 4B3XA 4L0YB 2M9HA 1VQ4I 2DT6A 1U2WA 2DQLA 4BQQA 3G73A 5CJ9A 4E7KA 4UVBA 5FKMA 1YI2I 3K7AJ 1P4XA 2ISYA 2YU3A 1B72B 4MNUA 2JPBA 2Y69H 3I71A 5BMZA 4IRIA 3FXQA 4N4NB 4XLNF 2VKDA 3RPQA 3A02A 3HKZA 4CUGA 4FETA 3WGHA 3V8JA 2CQNA 3V8KA 2QKMB 4KJZA 5L3CA 1OCPA 3U21A 1ETVA 1TWFJ 3LA3A 4I02A 3RTRA 3T8RA 5DUKA 2HVSA 1MDMB 3FM3A 2IRFG 4IOAF 2VKEA 5KVRA 3FDYA 5L3DA 1Y56A 3MVPA 2V1UA 5LGNA 2MABA 3G4SI 3WTYC 3FMQA 1FIPA 2NVXJ 1KYWA 4N0BA 5J40A 3DLLF 3ZOBA 4P55A 1FEXA 4AIHA 2R93J 1MBHA 4O5VA 5D8LB 5HVQC 3T1BA 1Z21A 5BS6A 5L3BA 4FX4A 2MYSA 2LH9A 3OL3A 3CUQA 3K6GA 2STWA 1GUUA 3ZQGA 4BJ5C 4BEHB 3S93A 2Y9YA 1ZHFA 3KP3A 4XN0A 3L09A 3CQZJ 3S14J 4BXFA 2O03A 1U5TB 5GTIC 1DDNA 2O3FA 3GXOA 4NUBA 3WGIA 3CMYA 3ECHA 4CICA 1Z3YA 1JI8A 1L0OC 1V4RA 1R49A 5JHFA 1OQYA 4RAZA 1E3HA 2EFOA 2V9PA 1U9OA 2OUMA 3OS2A 3E1SA 3CMEI 4RB1A 1CF7B 1NG6A 3EPZA 1MMSA 2K3FA 2XAFA 3RKQA 3JW4A 2HTJA 1BJZA 1LNWA 4E7JA 3ZQQA 2E2HJ 3W3CA 1TNTA 1FIAA 1HF0A 1SD7A 4XONA 2QSFX 3DEWA 1RNLA 3ZXSA 3ZR8X 2EH3A 3I4PA 5C4XJ 4CYCB 2WAQA 4EATA 2EK5A 3CUQC 2ZXIA 2P7VB 3C3WA 3O6BB 3HOXJ 2OCEA 4L9VA 4PJ0C 3NEUA 3BROA 3VWBA 4XOTA 1XN7A 5JI6A 3EUAA 5HS7A 1IZ1A 3E3VA 4EMSA 2PMUA 4OIRF 3DTEA 3P7NA 3FXUA 2AO9A 1OKRA 2QBYA 2MLGA 3E97A 2ZXHA 2NVTJ 1X1BA 2M0CA 1J09A 4BHPA 1LE8B 3H3VK 3LQRA 1PUEE 1ENHA 1WJCA 1OYIA 3R61A 4UUTA 4EJOA 2LK2A 1N25A 4KIGA 1YRNB 4B47A 4YG2F 1R5HA 2ZO4A 1O3QA 3KCCA 2V1NA 5L3EA 2MBFA 1ZRDA 1IF1A 3I54A 4MTEA 2G9WA 3MZ8A 2W84A 3VYUB 2A5WA 2DMNA 4UHTA 5KK1A 4ITVA 3RKYA 4XRMA 4X0GA 1AU7A 2Z9OA 2KJBA 3BZ6A 4N4OB 5IYDJ 2A5YB 4BEHA 3OYJA 2CSOA 2ZMEB 3GTKJ 2HOSA 2O6GE 2R7ZJ 1UHWA 2L4AA 3TDZC 2LFBA 1E3OC 3BOQA 2RQQA 3FK7A 1LJ9A 1U5TA 5K5RA 3HEFA 3TOAA 1IN6A 3GWZA 2M1BA 5D5WB 2DMTA 3MQ0A 1Z6TA 3C18A 2Z3YA 5FLMJ 3L2CA 4UVCA 1CF7A 1ZGAA 3CCUI 1IRZA 2DLLA 5JLWA 1W7PA 3IRQA 3L2RA 2IS1A 2I10A 5HLHA 2K9SA 2RAEA 5ILSA 5DUIA 3UR3C 1P2FA 2KT0A 1POGA 4BY7J 1TW2A 2FF4A 2O7OA 5FD6A 1X1CA 1G3WA 3OYFA 3G1OA 2HQNA 4I09A 1U0JA 2BHYA 3L7WA 1H9GA 1TBXA 2YPRA 4GXOA 3BPVA 4ON0A 5CLSA 4CO8A 4HNTA 3MZHA 1SFEA 1U5TC 1X1AA 2MD0A 1I6HJ 1X4PA 3W2AA 4XKBA 3I9V2 4XORA 2P5KA 2O5RA 4ZH4F 1VQ8I 4PK4A 4FT8A 2ZNYA 1KQ0A 2ZSIB 5CQGA 3ISPA 5JVTA 2VLAA 3E5QA 2XDVA 2XPWA 4OAYA 1NH3A 3M3YJ 1WJFA 1ZGJA 5E3OA 1HKTA 4JX5A 2B9SA 1F43A 2MC4A 1BOBA 3BCAA 1UZCA 3SFZA 1IUYA 1K83J 4X6AJ 3BY6A 3CP2A 3MD2A 2HDCA 2IGMA 4JX6A 1R71A 1K6YA 1RKTA 4IX7A 2ZFWA 2ECCA 2ZMEA 2KMUA 2A6TA 4OAZA 3HM5A 2WWYA 1X1PA 2LKSA 2W57A 2XPVA 2JTVA 1Y6IA 1YX5A 1K61A 3EUKL 5E1WA 4B48A 2EB7A 2IAIA 2COBA 3CCRI 4LG0B 3S2HJ 3C2BA 2X51A 5DM6F 5ICFA 2CUJA 2X6YA 3GF2A 3FXRA 2L01A 3IP4B 5D6FA 1B9NA 5GPCA 2DA5A 3W6JB 2Y0MA 1LVAA 2HR3A 3D5RC 5EGOB 1UG0A 2P8TA 4P9UA 1IV6A 1LEAA 3PFYA 4FASD 1O3SA 2A69F 4C30A 2IT0A 1RI7A 3QRFF 4O3MA 3BTJA 1WRJA 4YRVA 1Z9CA 2GM4A 1JTXA 3WG7H 1B9MA 5D5XB 5HDKA 3QYBA 2F4OB 4GGGA 2CO5A 3DKYA 3ZQ7A 4DBQA 3B73A 2ZMEC 2QKLB 1Q1HA 1OCOH 2VPLA 3MFKA 2WADA 2JQ7A 3JAMZ 2PI0A 1P7IA 4H0EA 2LP0A 1ETKA 4RLQA 5GADJ 1EF4A 3PM1A 3FXJA 3PNTA 2E1OA 3S2DJ 2EA2A 1J59A 2RKHA 2PQ8A 2PN6A 3JRDA 2M7BA 5LFAA 5D6EA 2RC4A 4ZDOA 2VB6A 3GTJJ 3SEZA 4HSRA 1WHUA 2EV6A 2X6OA 2M87A 5JVGF 2E5NA 3RKXA 3GTGJ 1DGWY 3BWGA 4KT5C 3KE2A 3PNYA 1H8AC 1Z67A 3CDIA 3K1MA 3F0CA 3KLNA 1GV2A 5L3GA 4Y15A 4EM2A 4U0WA 1I39A 2Z2SB 2OF7A 2HQRA 3R6SA 3OYGA 4BY1J 1YJ9I 4QIWN 3OYBA 2NS7A 4M6XA 4PJJA 1VQ5I 3FHNA 1ZR4A 3LMMA 5F0FA 3PSFA 1IUFA 2JT1A 1F36A 3Q9VA 3WE2A 3OYAA 2V4JC 1YS6A 2ADUA 2IGOA 3HSFA 2Y2ZA 3MAJA 4IEJA 4HQEA 4A0YA 4BACA 5E1XA 4LG0A 3RDIA 2VJ5A 1IN4A 4G7ZF 2HDDA 3HZJA 1XD7A 1ETOA 3ZMVA 5CVRA 3FISA 2OPTA 1O3TA 3KP6A 4I01A 5EGOA 2TRTA 3T0YA 4QPQA 2F5FA 1W36C 3F3XA 3WTVC 1MBGA 4Y3OA 1W0UA 3IKVA 4DZPA 4UY8I 3WGGA 2BHZA 2IP2A 5IYBJ 3PQJA 1JGGA 2V6CA 4UXNA 2VI6A 2KISA 2J5PA 2WV1A 2GIZA 3DEUA 4RMNA 1S6LA 4Q47A 1DP7P 5DYMA 3HRSA 5LRRA 1HBXG 1JKRC 1D5VA 3S15J 5BNGA 3D5LA 3M07A 1UAAA 2DFHA 2ISZA 1PDNC 1HC8A 4BQOA 2QYOA 2ZC2A 4DGWB 3C2GA 2R4GA 5D5UB 2IPQX 2XGDA 4KT6A 4LB5A 3DQVC 3I59B 3M1CA 1LDKB 3E6DA 4DYRA 3OYEA 3FXOA 1IC8A 1WJAA 4LJZF 3S1MJ 3I4NJ 3HB9A 4U88A 2JRTA 1XSDA 5K5OA 4G6QA 1KU2A 3HGGA 1XDUA 3UNGC 2BW3A 2Q2EB 3DU5A 4ESBA 1S7AA 3WTSC 2GLOA 4XOPA 3LSJA 3ZMDA 4JYKA 1XSXA 4BJ6C 5IT3A 1G6NA 1LDJA 4F92B 2ME0A 1B1BA 2DW4A 3V4GA 4V2FA 1I5ZA 2A6HF 3GTPJ 3GBGA 2GXGA 3K4LA 3RPUD 3AG3H 1Z6RA 1TT5B 3SZGA 1JKOC 1ONVA 2CQQA 2M7AA 5H6QA 3H35A 4U7DA 2JA8J 2MH9A 1ODDA 1K78A 3JRFA 4EGYA 1Z05A 1VQKI 3HPGA 4MIMA 1BBYA 1FWZA 1LQ1A 1AA7A 4UUSB 3FX3A 1OISA 2R5ZB 4PGHA 3ERED 3CF2A 3RQIA 2NVQJ 4H4KC 2OBPA 4QLCU 4PFOA 2CW7A 1OYWA 4PSXA 1YG2A 2R3SA 2VJIA 2M4KA 5B1AH 2H27A 4D5FA 2K85A 3REOA
chains in the Genus database with same CATH topology
2DA4A 5K7HA 4M3FA 2Y30A 1HDPA 2HI3A 1IDYA 4IHVA 4RDUA 3D1NI 1GV5A 1XG1A 3VPRA 2DN0A 4IHXA 4XICA 2ID6A 2ID3A 2Y31A 4M3EA 5E3NA 1JT6A 1ORKA 2M9HA 1Z77A 4B3AA 2KDZA 4A3KJ 3K2AA 5FKMA 4BBSJ 3K7AJ 2K40A 1D5YA 1LFUP 1JUMA 1B72B 3HOVJ 2O9LA 1RPWA 2EQRA 3A02A 2Y0SN 1P7JA 1IG7A 1IGNA 2L9RA 4BXXJ 1OCPA 2MGQA 5FKLA 3JRAA 1ETVA 1TWFJ 3BTLA 3G1LA 1JJ6C 1AHDP 2Y9ZA 2M2EA 2LLKA 2VKEA 3MVPA 1FIPA 2NVXJ 2ME6A 1TWGJ 4QTRA 1U78A 4A3EJ 3ZOBA 1T33A 5E3MA 3B6CA 1FEXA 2R93J 3BQZA 2JK3A 4ABZA 1MBHA 5F27A 3BR2A 2VPRA 4JP0A 2L7FP 1X2MA 4XRSG 1RETA 4HNVA 3RZOJ 2R5ZA 1GUUA 3ZQGA 2Y9YA 2JN6A 5K7ZA 4A3GJ 1HCRA 1A6IA 3BR5A 2DA6A 3CQZJ 3S14J 1MBFA 3JRHA 4GFBA 3Q0WA 3CMYA 2AHQA 2CRGA 2DA3A 4QSHA 4NDLA 1U9OA 2DTZA 4BKXA 4MLOA 5F1JA 5C44J 3RKQA 1VFCA 4A3CJ 5IOYA 1BJZA 1HOMA 2E2HJ 5GP9A 1FIAA 1HF0A 5M5XJ 2R92J 3S1NJ 4XIDA 1QVTA 1WH5A 3DEWA 1ZK8A 1MH3A 2EH3A 5C4XJ 4CYCB 3BG3A 3W6VA 3JRIA 3OOUA 1I50J 4V2GA 1DU6A 3HOXJ 2DJNA 4MFEA 1FTZA 2TCTA 2ELKA 1BW5A 2CU7A 5FLVA 5IP7J 1ZR2A 1T56A 5K7FA 1GVDA 2G0EA 2R0QC 2AO9A 2LVSA 3FIWA 2LD5A 2D5VA 2NVTJ 5FKNA 2M0CA 3DCFA 1LE8B 4C3IJ 3B6AA 1AKHB 3H3VK 1ENHA 2XGCA 4UUTA 2LK2A 5M5YJ 1YRNB 3GTOJ 3ZQLA 4IHYA 4C2MJ 3LNQA 2EZLA 2H1KA 4LOCA 1MBKA 5EG0A 3S17J 2E2JJ 2JA6J 2R5YA 2M8GX 2X48A 4A3MJ 2DA1A 1B8IB 1AU7A 2DMNA 4XRMA 5IYDJ 1I3QJ 3NAUA 3A01B 2FX0A 1LFBA 1OCTC 3GTKJ 1JUPA 2HOSA 2MW8A 2R7ZJ 1QPIA 2LFBA 1E3OC 5HODA 3FK7A 4AC0A 3HEFA 5DS9A 3BG5A 4A93J 2FD5A 2FQ4A 2DMTA 1FTTA 2XGEA 1ZTRA 5FLMJ 2EZKA 3BQYA 1JJ8C 1IRZA 5JLWA 3HDDA 4A3FJ 1NK3P 2EZIA 2XB5A 3S1RJ 2ZB9A 1FJLA 5FKKA 2I10A 1ITYA 3MKLA 2K9SA 2RAEA 2HXIA 3JRBA 3IH2A 4S0HB 1BA5A 4I76A 1MNMC 1POGA 2KT0A 2JWTA 2L0KA 1QRYA 4BY7J 2JA5J 4DYCA 1H88C 4MO7A 4M3GA 1PUFA 2O7OA 4FTHA 2QF7A 4MFDA 3L1PA 3TW7A 1MSEC 2B63J 3G1OA 1GDTA 1APLC 2WB1N 1UG2A 1JUSA 1ZKGA 5IOZA 1IJWC 4B1RA 1I6HJ 5IYCJ 4UUSA 1WH7A 3HKZN 4I6ZA 2IEKA 4DW6A 2E2IJ 3HOWJ 1AKHA 3ZQIA 2NVYJ 2XPWA 3M3YJ 2X9DA 5E3OA 4JX5A 3FK6A 3SDGA 5IP6A 3NARA 5IPAA 1F43A 1K83J 4X6AJ 2PMZN 1B8IA 2DMPA 4JX6A 1RKTA 4A3IJ 2XSDC 2ECBA 4XK4A 2ECCA 2W48A 2VKVA 3Q0VA 2E19A 3HM5A 5F08A 3JRGA 4A3JJ 3BR3A 3PO3J 3Q0UA 2XPVA 1K61A 2VUMJ 2LR8A 2IAIA 2COBA 4A69C 3S2HJ 1MBEA 2DMUA 3C2BA 5EEAA 5EYRA 3BT9A 1B72A 3O8GA 3CDLA 2M34A 4FCYA 5GPCA 3CCYA 2DA5A 1WPKA 2CUFA 3HGYA 3QPLA 4D7NA 3LSPA 4A3DJ 2L7ZA 1BW6A 2NOGA 5EGOB 3M4OJ 2DA2A 5EF6A 1IV6A 4M3BA 2HYJA 3BTJA 1GT0C 2K9QA 4L5EA 1NTCA 2GM4A 1JTXA 3I4MJ 1JTYA 1WCMJ 2MSYA 3S16J 1TWAJ 1MBJA 1DU0A 5FKOA 1S7EA 3TP3A 2NS8A 2QCOA 2XRLA 1XS9A 2YU9J 4JX4A 1P7IA 2MG4A 5F04A 2O8KA 3Q3SA 1WI3A 2LP0A 1ETKA 1JKPC 1EF4A 3PM1A 2E1OA 4XRSA 3S2DJ 4C3HJ 4C3JJ 1MH4A 3JRDA 1G2HA 3G1MA 3GTJJ 3QPSA 2X6OA 3BR6A 3TP0A 2YUSA 1RKWA 3BTIA 5M5WJ 5EDNA 1JKQC 1QVUA 3GTGJ 1HLVA 2YS9A 2CUEA 2LY9A 1ETWA 1H8AC 3LSGA 3UKGA 3F0CA 1GV2A 2FJ1A 2K9NA 3FKIJ 4DZJA 1MSFC 2OF7A 3H0GJ 4BY1J 4A3BJ 4QIWN 3QQAA 3JREA 5C4JJ 2NS7A 5F0CA 3GTLJ 1A5JA 1ZR4A 3RZDJ 5F0FA 2XPUA 1IUFA 1F36A 3HOUJ 1TWCJ 3HBLA 4IEJA 4FISA 2Y2ZA 3SFIA 3S1QJ 5M3FJ 4Y7NJ 4FE7A 1OFCX 2P81A 4X1EA 4CYCA 2HOTA 1Y1VJ 2HDDA 2EZHA 3TEDA 5GPAA 4G12A 4FE4A 1ETOA 1UHSA 4M6VA 3FISA 2OPTA 1XC5A 5J1RA 4M3DA 1U9NA 4Y52J 3BR1A 5EGOA 2TRTA 1Y1WJ 1ZQ3P 2HOAA 1MBGA 3TW6A 1W0UA 4DZPA 2JA7J 4IHWA 3OSFA 5IYBJ 1JGGA 2H8RA 3HOYJ 1JT0A 3JR9A 5J1YA 1X2NA 1LE8A 1WGXA 2VI6A 2GBYA 1IDZA 1X58A 2WV1A 1YRNA 3JRCA 5J3LA 1TC3C 2XB0X 3ZQHA 1VNDA 4RBOA 3ZQCA 1SANA 5EG0B 1BL0A 1ETYA 2R5YB 9ANTA 3E7LA 1JKRC 3S15J 2JMWA 5BNGA 3IV5A 5FJ8J 2N8GA 3A01A 1Q1VA 5EZGA 4BBRJ 1U8BA 3SJMA 2HXOA 1R9TJ 4EEFG 5M3MJ 2LKXA 1H89C 2XGDA 1TWHJ 4B4CA 4W97A 1RESA 5E3LA 1NK2P 2JJ7A 4DYRA 4A3LJ 1IC8A 1OJLA 3LOCA 4AYBN 5EZHA 3S1MJ 3I4NJ 1VF9A 1ETXA 3HB9A 3HGGA 1RR7A 4J19A 5JLXA 2DMQA 2GLOA 3LSJA 4AUXA 2IBDA 4JYKA 5IP9J 3OSGA 1VI0A 5DTDA 2EBIA 5F0HA 4DYQA 2ME0A 3LSRA 4V2FA 3GTQJ 3GTPJ 3GBGA 1Z0XA 1W0TA 2HQ5A 3BTCA 3IH4A 1JKOC 3ZQFA 1SFOJ 2CQQA 4D5CA 1PUFB 1HDDC 1ZGWA 1UMQA 2DA7A 2JA8J 2CQXA 5C3EJ 3HOZJ 4D7MA 3JRFA 2L7MP 2LTPA 2WAQN 4MIMA 3GTMJ 1O4XA 5J1UA 3WHBA 4UUSB 3PO2J 2R5ZB 3OIOA 3O8HA 3IH3A 1ETQA 3A03A 3WHCA 3RQIA 2NVQJ 3BR0A 3MN2A 4W1UA 2CJJA 1CQTA 4D5FA 3BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA4 A;  5K7H A;  4M3F A;  2Y30 A;  1HDP A;  2HI3 A;  1IDY A;  4IHV A;  4RDU A;  3D1N I;  1GV5 A;  1XG1 A;  3VPR A;  2DN0 A;  4IHX A;  4XIC A;  2ID6 A;  2ID3 A;  2Y31 A;  4M3E A;  5E3N A;  1JT6 A;  1ORK A;  2M9H A;  1Z77 A;  4B3A A;  2KDZ A;  4A3K J;  3K2A A;  5FKM A;  4BBS J;  3K7A J;  2K40 A;  1D5Y A;  1LFU P;  1JUM A;  1B72 B;  3HOV J;  2O9L A;  1RPW A;  2EQR A;  3A02 A;  2Y0S N;  1P7J A;  1IG7 A;  1IGN A;  2L9R A;  4BXX J;  1OCP A;  2MGQ A;  5FKL A;  3JRA A;  1ETV A;  1TWF J;  3BTL A;  3G1L A;  1JJ6 C;  1AHD P;  2Y9Z A;  2M2E A;  2LLK A;  2VKE A;  3MVP A;  1FIP A;  2NVX J;  2ME6 A;  1TWG J;  4QTR A;  1U78 A;  4A3E J;  3ZOB A;  1T33 A;  5E3M A;  3B6C A;  1FEX A;  2R93 J;  3BQZ A;  2JK3 A;  4ABZ A;  1MBH A;  5F27 A;  3BR2 A;  2VPR A;  4JP0 A;  2L7F P;  1X2M A;  4XRS G;  1RET A;  4HNV A;  3RZO J;  2R5Z A;  1GUU A;  3ZQG A;  2Y9Y A;  2JN6 A;  5K7Z A;  4A3G J;  1HCR A;  1A6I A;  3BR5 A;  2DA6 A;  3CQZ J;  3S14 J;  1MBF A;  3JRH A;  4GFB A;  3Q0W A;  3CMY A;  2AHQ A;  2CRG A;  2DA3 A;  4QSH A;  4NDL A;  1U9O A;  2DTZ A;  4BKX A;  4MLO A;  5F1J A;  5C44 J;  3RKQ A;  1VFC A;  4A3C J;  5IOY A;  1BJZ A;  1HOM A;  2E2H J;  5GP9 A;  1FIA A;  1HF0 A;  5M5X J;  2R92 J;  3S1N J;  4XID A;  1QVT A;  1WH5 A;  3DEW A;  1ZK8 A;  1MH3 A;  2EH3 A;  5C4X J;  4CYC B;  3BG3 A;  3W6V A;  3JRI A;  3OOU A;  1I50 J;  4V2G A;  1DU6 A;  3HOX J;  2DJN A;  4MFE A;  1FTZ A;  2TCT A;  2ELK A;  1BW5 A;  2CU7 A;  5FLV A;  5IP7 J;  1ZR2 A;  1T56 A;  5K7F A;  1GVD A;  2G0E A;  2R0Q C;  2AO9 A;  2LVS A;  3FIW A;  2LD5 A;  2D5V A;  2NVT J;  5FKN A;  2M0C A;  3DCF A;  1LE8 B;  4C3I J;  3B6A A;  1AKH B;  3H3V K;  1ENH A;  2XGC A;  4UUT A;  2LK2 A;  5M5Y J;  1YRN B;  3GTO J;  3ZQL A;  4IHY A;  4C2M J;  3LNQ A;  2EZL A;  2H1K A;  4LOC A;  1MBK A;  5EG0 A;  3S17 J;  2E2J J;  2JA6 J;  2R5Y A;  2M8G X;  2X48 A;  4A3M J;  2DA1 A;  1B8I B;  1AU7 A;  2DMN A;  4XRM A;  5IYD J;  1I3Q J;  3NAU A;  3A01 B;  2FX0 A;  1LFB A;  1OCT C;  3GTK J;  1JUP A;  2HOS A;  2MW8 A;  2R7Z J;  1QPI A;  2LFB A;  1E3O C;  5HOD A;  3FK7 A;  4AC0 A;  3HEF A;  5DS9 A;  3BG5 A;  4A93 J;  2FD5 A;  2FQ4 A;  2DMT A;  1FTT A;  2XGE A;  1ZTR A;  5FLM J;  2EZK A;  3BQY A;  1JJ8 C;  1IRZ A;  5JLW A;  3HDD A;  4A3F J;  1NK3 P;  2EZI A;  2XB5 A;  3S1R J;  2ZB9 A;  1FJL A;  5FKK A;  2I10 A;  1ITY A;  3MKL A;  2K9S A;  2RAE A;  2HXI A;  3JRB A;  3IH2 A;  4S0H B;  1BA5 A;  4I76 A;  1MNM C;  1POG A;  2KT0 A;  2JWT A;  2L0K A;  1QRY A;  4BY7 J;  2JA5 J;  4DYC A;  1H88 C;  4MO7 A;  4M3G A;  1PUF A;  2O7O A;  4FTH A;  2QF7 A;  4MFD A;  3L1P A;  3TW7 A;  1MSE C;  2B63 J;  3G1O A;  1GDT A;  1APL C;  2WB1 N;  1UG2 A;  1JUS A;  1ZKG A;  5IOZ A;  1IJW C;  4B1R A;  1I6H J;  5IYC J;  4UUS A;  1WH7 A;  3HKZ N;  4I6Z A;  2IEK A;  4DW6 A;  2E2I J;  3HOW J;  1AKH A;  3ZQI A;  2NVY J;  2XPW A;  3M3Y J;  2X9D A;  5E3O A;  4JX5 A;  3FK6 A;  3SDG A;  5IP6 A;  3NAR A;  5IPA A;  1F43 A;  1K83 J;  4X6A J;  2PMZ N;  1B8I A;  2DMP A;  4JX6 A;  1RKT A;  4A3I J;  2XSD C;  2ECB A;  4XK4 A;  2ECC A;  2W48 A;  2VKV A;  3Q0V A;  2E19 A;  3HM5 A;  5F08 A;  3JRG A;  4A3J J;  3BR3 A;  3PO3 J;  3Q0U A;  2XPV A;  1K61 A;  2VUM J;  2LR8 A;  2IAI A;  2COB A;  4A69 C;  3S2H J;  1MBE A;  2DMU A;  3C2B A;  5EEA A;  5EYR A;  3BT9 A;  1B72 A;  3O8G A;  3CDL A;  2M34 A;  4FCY A;  5GPC A;  3CCY A;  2DA5 A;  1WPK A;  2CUF A;  3HGY A;  3QPL A;  4D7N A;  3LSP A;  4A3D J;  2L7Z A;  1BW6 A;  2NOG A;  5EGO B;  3M4O J;  2DA2 A;  5EF6 A;  1IV6 A;  4M3B A;  2HYJ A;  3BTJ A;  1GT0 C;  2K9Q A;  4L5E A;  1NTC A;  2GM4 A;  1JTX A;  3I4M J;  1JTY A;  1WCM J;  2MSY A;  3S16 J;  1TWA J;  1MBJ A;  1DU0 A;  5FKO A;  1S7E A;  3TP3 A;  2NS8 A;  2QCO A;  2XRL A;  1XS9 A;  2YU9 J;  4JX4 A;  1P7I A;  2MG4 A;  5F04 A;  2O8K A;  3Q3S A;  1WI3 A;  2LP0 A;  1ETK A;  1JKP C;  1EF4 A;  3PM1 A;  2E1O A;  4XRS A;  3S2D J;  4C3H J;  4C3J J;  1MH4 A;  3JRD A;  1G2H A;  3G1M A;  3GTJ J;  3QPS A;  2X6O A;  3BR6 A;  3TP0 A;  2YUS A;  1RKW A;  3BTI A;  5M5W J;  5EDN A;  1JKQ C;  1QVU A;  3GTG J;  1HLV A;  2YS9 A;  2CUE A;  2LY9 A;  1ETW A;  1H8A C;  3LSG A;  3UKG A;  3F0C A;  1GV2 A;  2FJ1 A;  2K9N A;  3FKI J;  4DZJ A;  1MSF C;  2OF7 A;  3H0G J;  4BY1 J;  4A3B J;  4QIW N;  3QQA A;  3JRE A;  5C4J J;  2NS7 A;  5F0C A;  3GTL J;  1A5J A;  1ZR4 A;  3RZD J;  5F0F A;  2XPU A;  1IUF A;  1F36 A;  3HOU J;  1TWC J;  3HBL A;  4IEJ A;  4FIS A;  2Y2Z A;  3SFI A;  3S1Q J;  5M3F J;  4Y7N J;  4FE7 A;  1OFC X;  2P81 A;  4X1E A;  4CYC A;  2HOT A;  1Y1V J;  2HDD A;  2EZH A;  3TED A;  5GPA A;  4G12 A;  4FE4 A;  1ETO A;  1UHS A;  4M6V A;  3FIS A;  2OPT A;  1XC5 A;  5J1R A;  4M3D A;  1U9N A;  4Y52 J;  3BR1 A;  5EGO A;  2TRT A;  1Y1W J;  1ZQ3 P;  2HOA A;  1MBG A;  3TW6 A;  1W0U A;  4DZP A;  2JA7 J;  4IHW A;  3OSF A;  5IYB J;  1JGG A;  2H8R A;  3HOY J;  1JT0 A;  3JR9 A;  5J1Y A;  1X2N A;  1LE8 A;  1WGX A;  2VI6 A;  2GBY A;  1IDZ A;  1X58 A;  2WV1 A;  1YRN A;  3JRC A;  5J3L A;  1TC3 C;  2XB0 X;  3ZQH A;  1VND A;  4RBO A;  3ZQC A;  1SAN A;  5EG0 B;  1BL0 A;  1ETY A;  2R5Y B;  9ANT A;  3E7L A;  1JKR C;  3S15 J;  2JMW A;  5BNG A;  3IV5 A;  5FJ8 J;  2N8G A;  3A01 A;  1Q1V A;  5EZG A;  4BBR J;  1U8B A;  3SJM A;  2HXO A;  1R9T J;  4EEF G;  5M3M J;  2LKX A;  1H89 C;  2XGD A;  1TWH J;  4B4C A;  4W97 A;  1RES A;  5E3L A;  1NK2 P;  2JJ7 A;  4DYR A;  4A3L J;  1IC8 A;  1OJL A;  3LOC A;  4AYB N;  5EZH A;  3S1M J;  3I4N J;  1VF9 A;  1ETX A;  3HB9 A;  3HGG A;  1RR7 A;  4J19 A;  5JLX A;  2DMQ A;  2GLO A;  3LSJ A;  4AUX A;  2IBD A;  4JYK A;  5IP9 J;  3OSG A;  1VI0 A;  5DTD A;  2EBI A;  5F0H A;  4DYQ A;  2ME0 A;  3LSR A;  4V2F A;  3GTQ J;  3GTP J;  3GBG A;  1Z0X A;  1W0T A;  2HQ5 A;  3BTC A;  3IH4 A;  1JKO C;  3ZQF A;  1SFO J;  2CQQ A;  4D5C A;  1PUF B;  1HDD C;  1ZGW A;  1UMQ A;  2DA7 A;  2JA8 J;  2CQX A;  5C3E J;  3HOZ J;  4D7M A;  3JRF A;  2L7M P;  2LTP A;  2WAQ N;  4MIM A;  3GTM J;  1O4X A;  5J1U A;  3WHB A;  4UUS B;  3PO2 J;  2R5Z B;  3OIO A;  3O8H A;  3IH3 A;  1ETQ A;  3A03 A;  3WHC A;  3RQI A;  2NVQ J;  3BR0 A;  3MN2 A;  4W1U A;  2CJJ A;  1CQT A;  4D5F A;  3BG9 A; 
#chains in the Genus database with same CATH topology
 2DA4 A;  5K7H A;  2VXZ A;  4M74 A;  1GLN A;  1IDY A;  1S5L C;  3OV8 A;  4DJA A;  3F21 A;  4XLF A;  3H9J A;  4XIC A;  2QA4 I;  2VOP A;  1FP2 A;  1JT6 A;  2Z99 A;  3QOP A;  3QPT A;  4RGR A;  3GLX A;  1VTN C;  4IHT A;  1QZY A;  2JVH A;  1I1S A;  2IA0 A;  1S8N A;  3I59 A;  2KDZ A;  4A3K J;  3K2A A;  4HX8 A;  1T0F A;  1BM9 A;  2K40 A;  2JZY A;  2WB1 A;  2ICW G;  4P96 A;  2LC2 A;  3HSR A;  1D5Y A;  3L2V A;  3JSO A;  1JUM A;  4D9J A;  3HOV J;  1ZG5 A;  2EQR A;  2Y0S N;  1P7J A;  2H94 A;  2Q2E A;  1ZG3 A;  3HXL A;  1IGN A;  3FXL A;  4Z2Y A;  5FKL A;  4HAM A;  4KIS A;  1EV7 A;  4HA8 A;  2Y9Z A;  2M2E A;  3QPH A;  1ZN2 A;  1MMD A;  2A68 F;  4RA2 A;  2QQ8 A;  2KPM A;  5FGM A;  3CC4 I;  3OY9 A;  1JXS A;  5K1Y A;  1XDS A;  3TO9 A;  4ZYH A;  2ME6 A;  4ZTF A;  1SD4 A;  1W5T A;  5E3M A;  2LRD A;  3B6C A;  1WKM A;  2HU9 A;  3HJE A;  3K69 A;  3BQZ A;  1S3J A;  3H36 A;  1FSE A;  1WJB A;  3QWL A;  4JP0 A;  3J7Z I;  3ML6 A;  3I5U A;  3VYT B;  4CCK A;  3RZO J;  4JK1 X;  5TGT A;  1UEL B;  2R5Z A;  1R1V A;  3VFZ A;  3WTT C;  1NG7 A;  4AYB A;  3CO7 C;  1O7F A;  4N9H A;  3PUB A;  3K2Z A;  4GCV A;  1P6R A;  1A6I A;  2R7X A;  2DA6 A;  1C0W A;  3T5X A;  3K70 C;  3JRH A;  3OL4 A;  1ACI A;  1I3A A;  4GFB A;  4ZYA A;  1YHQ I;  1R5I D;  2AHQ A;  5E17 F;  1R22 A;  3GO5 A;  2VJ4 A;  3M8J A;  2JVG A;  2CV1 A;  2XUB A;  2XVC A;  2X6W A;  2DTZ A;  5D5V B;  3S3N A;  5C44 J;  2JUC A;  5IOY A;  2J5O A;  1Y8Q B;  1HOM A;  2IA2 A;  2M4G A;  2XSJ C;  1ZRE A;  1TP4 A;  4I0A A;  3OYH A;  4OMY A;  2V9V A;  4YFN F;  1JHF A;  2VBW A;  3S1N J;  2RN7 A;  2RV8 A;  3IL2 A;  1DPU A;  1ZK8 A;  1O57 A;  1PP7 U;  4A5N A;  1MH3 A;  4BU2 A;  3BG3 A;  4G6T B;  4RGX A;  2GZW A;  1SAU A;  3D0S A;  5H20 A;  1I50 J;  1BIA A;  3WTX C;  1RR8 C;  4GYG A;  3VOD A;  1DU6 A;  2KJC A;  4MFE A;  4B44 A;  3I53 A;  2RRE A;  2P5V A;  5IP7 J;  2QZ8 A;  4ZJZ A;  1IV8 A;  3GVA A;  5KCM A;  1XB4 A;  2GXA A;  3HHG A;  2WY8 Q;  3F23 A;  1GVJ A;  3PUF A;  4OMZ A;  3C1D A;  1VQM I;  2DBB A;  5E1Z B;  3M7G A;  1G3S A;  2P6S A;  2HTS A;  3F9K A;  3WOD F;  3GZ5 A;  2HZT A;  3TO6 A;  2NNN A;  4IHY A;  4U0V A;  5BQT A;  3LNQ A;  1J7K A;  5AIQ A;  4LOC A;  2H1K A;  2WAE A;  4XQF A;  3W2V A;  2E2J J;  2R5Y A;  1FPQ A;  4LIU A;  2M8G X;  2P6T A;  2X48 A;  2HVQ A;  2DO7 A;  1B8I B;  3TO7 A;  2L02 A;  3CLQ A;  2UZK A;  2QLZ A;  4AID A;  2VC1 A;  2A6E F;  3K10 A;  1LFB A;  1JUP A;  1P4W A;  1RC9 A;  2FNA A;  3ELK A;  1JHH A;  2R7S A;  1K79 A;  1UCR A;  1TZL A;  2M30 A;  2XAS A;  3QU6 A;  2DOE A;  4UV8 A;  3MKW B;  3E0J B;  2FD5 A;  3ZN0 A;  2IGK A;  2JPC A;  2STT A;  2XGE A;  1X3U A;  5ICG A;  2EZK A;  2W7N A;  1JJ8 C;  3OYK A;  2K4B A;  4A3F J;  2XB5 A;  2ZSH B;  4C2T A;  3S1R J;  2GWR A;  2LSO A;  4G8X A;  5J8F A;  2HXI A;  3GFI A;  3ABL H;  4GYI A;  2FMY A;  4EVI A;  1BC8 C;  4OIQ F;  4I76 A;  4XLE A;  1MNM C;  2HPI A;  1FP1 D;  1O7L A;  5LEK A;  1YLF A;  4DYC A;  4M3G A;  1PUF A;  2PJR B;  5LGT A;  4FTH A;  4MFD A;  3TW7 A;  3OYN A;  1MSE C;  1IN7 A;  1Y39 A;  1GDT A;  1APL C;  2DFE A;  3L00 A;  2BBY A;  1JUS A;  1ZKG A;  2MH2 A;  1V3F A;  1OR7 A;  1KYZ A;  4Z6Y A;  1WH7 A;  3HKZ N;  2X1D A;  3F8B A;  4DW6 A;  4HV5 A;  2L9V A;  3TMO A;  1XX5 A;  5B3S H;  4HF2 A;  2XF5 A;  3CUO A;  1MGT A;  4UUV A;  1IXC A;  4E7L A;  1FZP B;  4Q4Z F;  1B4A A;  2X9D A;  4PDK A;  3CP8 A;  3T8T A;  3RQ4 A;  2KP6 A;  1G4D A;  2DOD A;  2YX7 A;  5IPA A;  3AKZ A;  1F5T A;  4HPQ A;  1R7J A;  2OQG A;  1J5Y A;  2PMZ N;  1DQU A;  1B8I A;  3BCB A;  2MLK A;  1WQ2 A;  2F5D A;  3ASO H;  4U0Y A;  2ZXW H;  4KMU X;  2VQH A;  2CYY A;  2PBI A;  2W48 A;  2XAG A;  2Y75 A;  3IC7 A;  1WJD A;  5F08 A;  1FOW A;  1LUJ B;  2IVM A;  1T95 A;  4A3J J;  1D1A A;  4ZTJ A;  4KFC A;  3PO3 J;  5CVV A;  2VUM J;  3CJN A;  2HQA A;  3BJ6 A;  1MBE A;  1OR7 C;  2DMU A;  3K4B A;  5EEA A;  5EYR A;  3BT9 A;  1B72 A;  3CDL A;  4IZZ A;  4PGG A;  4A5M A;  4FCY A;  1VQN I;  3K4K A;  2NS0 A;  3K4C A;  1R36 A;  1WPK A;  1ZH5 A;  1GXQ A;  3HGY A;  3QPL A;  3SQN A;  3WTW C;  5TRD A;  4A0Z A;  4D7N A;  3LSP A;  2CWE A;  4AM3 A;  1HXD A;  3BZC A;  3M4O J;  1EH7 A;  2CV0 A;  1MDM A;  3CO6 C;  4M3B A;  2EFQ A;  3SEQ A;  4WWC A;  1V54 H;  1UFM A;  4CA0 A;  1B59 A;  2AXT C;  3KYL A;  4UV9 A;  3J7A O;  5JR3 A;  2WV0 A;  1JTY A;  1MJ9 A;  2PJR A;  1LDD A;  3CLO A;  1MBJ A;  3TL4 X;  4QWQ A;  5EEH A;  2YU9 J;  4JX4 A;  4WXH A;  4BQN A;  1N75 A;  4D0P A;  2VJJ A;  3Q3S A;  3LSM A;  2KKO A;  2EFW A;  4NB5 A;  1UHM A;  3J81 K;  3O3K A;  2HWV A;  1E0E A;  1Z7U A;  5E8G A;  3VDX A;  2NRA C;  3QP5 A;  1EKE A;  3U9G A;  2V26 A;  3HYI A;  5FFX A;  3CJR B;  3L9F A;  3TP0 A;  4CH7 A;  3GME A;  2OQR A;  5EDN A;  2X0L A;  1FY7 A;  2CUE A;  2LY9 A;  3QOD A;  1ETW A;  4ENM A;  3CC7 I;  3DKW A;  3E5U A;  1J2X A;  2K9N A;  2FJ1 A;  3OYL A;  3FKI J;  4JBA A;  2QGU A;  1BN5 A;  5FRO A;  1QPM A;  4GRI A;  3GTL J;  1A5J A;  3GFL A;  2VXD A;  2XPU A;  3HBL A;  1QHG A;  1R1U A;  3AG1 H;  4E7Z A;  1USS A;  1ZRC A;  1FOX A;  3J80 Z;  1DP3 A;  4J01 A;  3ESW B;  3BP8 A;  4X1E A;  4CYC A;  3ONQ A;  4M9Z A;  1Y1V J;  3EET A;  2EZH A;  3HG9 A;  4E7I A;  3TED A;  3IUO A;  4G12 A;  4FE4 A;  3ZMS A;  3DBR B;  5F64 A;  4E6K G;  3GX4 X;  4HW0 A;  4M3D A;  1D0X A;  1OMI A;  1LEB A;  1XGN A;  2ZCW A;  3H0D A;  1V5G A;  2WC2 A;  3OIQ A;  3FMR A;  3H3Z A;  2L7K A;  2JA7 J;  4YIF A;  2CH0 A;  2FE3 A;  4IHW A;  2V9K A;  4M9S A;  2LF7 A;  2ZXJ A;  1TL8 A;  2H8R A;  1JT0 A;  3JR9 A;  2R7W A;  2AS5 F;  3LA2 A;  1UJ8 A;  2V1X A;  5J1Y A;  2O0Y A;  1L3L A;  1LE8 A;  1KON A;  1VQ7 I;  4M6Y A;  3O2P E;  4HDU A;  2E1M B;  4AU7 A;  5CYV A;  4M72 A;  2XRO A;  1XCB A;  3CCV I;  1BI2 A;  1YRN A;  1KQ9 A;  1U6G A;  2UV1 A;  5J3L A;  2E5Z A;  2EIJ H;  2XB0 X;  4ENN A;  1VND A;  3ZQC A;  1HA8 A;  5EG0 B;  1SD6 A;  4F55 A;  5CVJ A;  1ETY A;  9ANT A;  2LKP A;  4Y33 A;  4ZC3 A;  5F1R A;  3GW2 A;  5LLQ A;  4RGS A;  2BVL A;  1X19 A;  2DI3 A;  5ED4 A;  2XHK A;  4BUP A;  5GTH C;  1MMN A;  1XMA A;  2EFP A;  2OAZ A;  4XRF A;  4BS9 A;  1U8B A;  4BJT A;  2HFH A;  3SJM A;  1R9T J;  4BDZ A;  3E6M A;  4Q48 A;  3DPL C;  5M3M J;  2LKX A;  4L9T A;  3RYR A;  4B4C A;  4RAF A;  4W97 A;  3N97 A;  5D4R A;  3PL8 A;  1RES A;  5E3L A;  1RUN A;  1NK2 P;  3DBL B;  4ZYE A;  1U8R A;  5HLI A;  3LOC A;  1JGS A;  1VF9 A;  4K2E A;  3HRU A;  2ELH A;  1A6Q A;  1RR7 A;  2QUF A;  5IT9 Z;  3R0A A;  2KL4 A;  3PNV A;  3U1K A;  5HOO A;  1RIO H;  3H5A A;  2IA1 A;  2LOO A;  3S8P A;  4Y4R A;  5IP9 J;  1TTY A;  3HRT A;  4P5O A;  1W7P D;  1XMX A;  3JSP A;  1YFH A;  4CXF A;  5F0H A;  2YR2 A;  3LSR A;  2BVM A;  3GTQ J;  2CS3 A;  4MQV A;  5H6R A;  1LPQ A;  2L9N A;  1AWC A;  1W0T A;  3GEZ A;  3BTC A;  1SEU A;  3VYS B;  1SFO J;  1EH8 A;  3CD6 I;  4F3Q A;  1PJR A;  3QOE A;  2LBF B;  2R7O A;  4IO9 F;  1HKQ A;  2XC7 A;  2CQX A;  5C3E J;  2R7U A;  2L7M P;  1BR4 A;  3RYP A;  3GTM J;  1P9Q C;  3MMY B;  3IH3 A;  1ETQ A;  3A03 A;  5ILU A;  3MWM A;  3WHC A;  1DUX C;  2DFF A;  3BDD A;  3SDB A;  4EJW A;  5J4Y A;  4W1U A;  3U2R A;  1PP8 F;  3LL7 A;  2CJJ A;  2F5E A;  1YJN I;  3H3U A;  2VOD A;  1OPC A;  2VT3 A;  1CQT A;  2IXS A;  2WY7 Q;  4MGR A;  1OLT A;  3ABM H;  4BL0 B;  1FT9 A;  3LST A;  2H09 A;  4LLN A;  2BY1 A;  4CSW A;  2HI3 A;  4BYY A;  3D1N I;  5FLX Z;  1GV5 A;  3WU0 A;  3A4C A;  4LB6 B;  3RIR A;  3ZP5 A;  1MND A;  2BXY A;  3FHZ A;  5E3N A;  1ORK A;  4ASN A;  2CMP A;  3LSI A;  5A2Q K;  3OYC A;  3TGN A;  4B3A A;  2UUZ A;  1Z1D A;  3BJO A;  3PIP F;  2IS6 A;  3NQO A;  4I99 C;  1QQI A;  1LFU P;  1G59 A;  1WZ2 A;  1RPW A;  3I3L A;  3AFH A;  2E1M C;  3JRA A;  3FWE A;  3BTL A;  5LBQ A;  1JJ6 C;  1RZ4 A;  3DEE A;  4LIV A;  1F1Z A;  2LLK A;  4KIB A;  4CCM A;  4HOB A;  2JRM A;  2OA4 A;  3KEY A;  5HNH A;  2DDA A;  3P9C A;  2OC6 A;  2DK8 A;  2W85 A;  3LFK A;  4C9Y A;  1Z3X A;  1U78 A;  1HW1 A;  1XGM A;  1T33 A;  3DFG A;  1BI1 A;  3IHU A;  2LBF A;  1TW3 A;  2FA5 A;  4ABZ A;  3IKT A;  2OV7 A;  2L7F P;  4XRS G;  3HOS A;  1RET A;  2E7W A;  2CV2 A;  4HNV A;  3LAJ A;  2M0M A;  3K4J A;  2W00 A;  4E7S A;  2JN6 A;  1W5S A;  3N05 A;  5K7Z A;  3ZGK A;  4A3G J;  1ZG1 A;  3K0L A;  3BR5 A;  2VC0 A;  3EYI A;  5FRN A;  3OIP A;  3CJT B;  3RKW A;  1Y0U A;  5AON A;  2W82 A;  5HS9 A;  1W36 D;  3LSH A;  1VQP I;  2DPU A;  1W5C C;  1QBJ A;  2G7H A;  4L5J A;  4BKX A;  5JFR A;  3KP5 A;  2CFX A;  4MHG A;  4MLO A;  2Z16 A;  3V7S A;  1VFC A;  4L9N A;  4B09 A;  5KNL A;  2L5Q A;  2LRE A;  4CCN A;  2D45 A;  5M5X J;  2R92 J;  4XID A;  1QVT A;  1WH5 A;  4UB8 C;  5DCF A;  1MIJ A;  3KX2 A;  3ECO A;  1Y0N A;  4EM0 B;  3W6V A;  2EJR A;  3JRI A;  4MEY F;  1K6O A;  1MKM A;  2HEO A;  1WVR A;  2ZNZ A;  1HKS A;  2A05 A;  3AG4 H;  2DJN A;  3GYH X;  1IAW A;  3CJQ B;  2TCT A;  4L18 B;  2ELK A;  2KZG A;  1FX7 A;  2HGC A;  1J0R A;  1T56 A;  2ETH A;  2AQE A;  1GVD A;  4KA4 A;  1OCR H;  2BY3 A;  2BY0 A;  3PFI A;  3VEP A;  3KP4 A;  1BR1 A;  3FIW A;  3G2B A;  5J4V A;  2LD5 A;  2NOJ B;  3RJP A;  5EJC A;  5TJJ A;  5FKN A;  3DCF A;  2DOA A;  2GQQ A;  4WCG A;  2F6C A;  1AKH B;  1UST A;  3B6A A;  1SMY F;  4Y17 A;  5M5Y J;  1D3Y A;  2P4W A;  2QQB A;  2W25 A;  4G7H F;  3ZQL A;  4QPO A;  2P0W A;  2OZU A;  3Q5F A;  1MBK A;  3S17 J;  2D2W A;  2JA6 J;  4A3M J;  1BI3 A;  3PIO F;  2DA1 A;  2KLO A;  4XSX F;  4LIT A;  1FOY A;  4CZZ A;  2VOO A;  3OOP A;  1R4N B;  1T38 A;  5FD5 A;  1I3Q J;  4D1Q A;  3A01 B;  3K9T A;  2FX0 A;  2R7Q A;  1OCT C;  2K7L A;  4RB3 C;  2MW8 A;  1YIO A;  2ZBK A;  4YEJ A;  1O3R A;  4I0B A;  5HOD A;  3BG6 A;  3PSI A;  3I58 A;  5DS9 A;  5ICC A;  3BG5 A;  2H6B A;  2KZV A;  4DOZ A;  4ETS A;  4A93 J;  4NC6 A;  2L4M A;  1ZTR A;  2XAJ A;  1MNE A;  2ESN A;  3GUD A;  4NQW B;  3BQY A;  2VBZ A;  2ZFU A;  5B66 C;  2AXL A;  2D1H A;  3HDD A;  2F5V A;  2EZI A;  1NK3 P;  4XLC A;  2HZD A;  2ZB9 A;  4LG3 A;  5FKK A;  1FJL A;  4ENJ A;  5B1B H;  2Z1D A;  3MKL A;  4ZDP A;  3JRB A;  5DM7 F;  4S0H B;  1V5F A;  4RM3 A;  1MD0 A;  2FSW A;  4CHU A;  1T08 B;  2L0K A;  2VKH A;  1QRY A;  2JA5 J;  3HPH A;  1H88 C;  4AIK A;  3FXK A;  2QF7 A;  1Z7L A;  1D0Y A;  2KIF A;  4WXC A;  2B63 J;  1ZLJ A;  3V7C A;  2WB1 N;  1UG2 A;  3OR1 C;  4U7B A;  3CCE I;  3TBI A;  1FMV A;  1REP C;  3WTZ A;  4UUS A;  2FU4 A;  3P5J A;  3IWF A;  4EQQ A;  4I6Z A;  2BXZ A;  3F6O A;  2GA2 A;  2E2I J;  5L3F A;  2HKO A;  4FHT A;  1K7A A;  1AKH A;  1XGS A;  4ZYD A;  3Q9S A;  3S2W A;  4CZC A;  4RB0 A;  3CC2 I;  2IGN A;  3FK6 A;  3SDG A;  5IP6 A;  1QA6 A;  3NAR A;  1VQ6 I;  3SZT A;  4XLP F;  3CES A;  4PFP A;  2DMP A;  3JTG A;  4BNC A;  3TDU C;  5ILV A;  4A3I J;  2XSD C;  4XK4 A;  1EJ9 A;  2OD5 A;  4PSW A;  2E7X A;  3Q0V A;  2E19 A;  4RLF A;  4CDG A;  2Y48 A;  3ULQ B;  5DD4 A;  3LA7 A;  2CQ7 A;  4IVN A;  3BR3 A;  1WSU A;  3Q0U A;  1V5E A;  4NC8 A;  4ENK A;  5FFZ A;  2UXX A;  3MCZ A;  1BIB A;  3A2K A;  5H2F C;  2M34 A;  4BGD A;  4IQ4 A;  2O61 A;  4ANJ A;  2RNJ A;  2CUF A;  1YX3 A;  4DIQ A;  2L54 A;  3KEQ A;  1HST A;  1BW6 A;  4S04 A;  1ULY A;  4KN4 X;  1TLH B;  2DA2 A;  4NNJ A;  2R7F A;  3K70 D;  3CCL I;  2PLY A;  1S29 A;  4IHS A;  1E3P A;  3S32 A;  4Q5S F;  2P5L C;  5BOX A;  1GT0 C;  2FXA A;  2K86 A;  1YOV B;  2K9Q A;  4E7H A;  1LB2 A;  3GZ6 A;  1WCM J;  2MSY A;  3COA C;  1TWA J;  3H1C A;  2V6E A;  1BI0 A;  2MFZ A;  2YSR A;  1DU0 A;  3TP3 A;  2QCO A;  4ESJ A;  1XS9 A;  4V19 K;  2CW8 A;  2JSP A;  2CFO A;  3H5N A;  1SC7 A;  5F6F A;  2VN2 A;  5CVI A;  3DTK A;  1WI3 A;  4DQ2 A;  1GHC A;  1LKX A;  2K5C A;  3QYF A;  4RS8 A;  2M8E A;  3OS0 A;  2FML A;  4BHC A;  3G3Z A;  4C3J J;  3BC8 A;  3TKY A;  4IPA A;  3QAH A;  2CQK A;  3K4M A;  2YUS A;  3BTI A;  5M5W J;  1ZYR F;  3AL0 B;  1JKQ C;  1QVU A;  1MJB A;  4JOM A;  2YS9 A;  1VZ0 A;  1HW5 A;  1KU7 A;  3LSG A;  3WG9 A;  3UKG A;  2LNB A;  2COM A;  1KU3 A;  1WFX A;  4DZJ A;  2Q0O A;  3DPU A;  4BH9 A;  4HG2 A;  4ZYG A;  4YII A;  1R1T A;  2XIG A;  5DD8 A;  4A3B J;  3J80 K;  1FSH A;  2WAF A;  5C4J J;  3JRE A;  3MKY B;  5GAH J;  3DBH B;  1TWC J;  1D1B A;  1XCV A;  3S1Q J;  2L9S A;  2W4S A;  2Z33 A;  2R7D A;  2FRH A;  2DFI A;  2E71 A;  2XV4 S;  4Y7N J;  4E70 A;  2E1N A;  3SYT A;  4FE7 A;  1OFC X;  1A35 A;  3FMS A;  4XSZ F;  1WI9 A;  4I7H A;  1QZZ A;  2PG4 A;  4II2 A;  5GPA A;  5LEJ A;  1UHS A;  4M6V A;  3A0H C;  1XC5 A;  2OTJ I;  3M8E A;  1D8K A;  2VIX A;  1IO2 A;  4MTD A;  4EJU A;  1I27 A;  2V7F A;  4C2U A;  2VL8 A;  1ON2 A;  4UVA A;  2W1O A;  2HOA A;  4HRI A;  1N77 A;  2RDP A;  3DP7 A;  5IY5 H;  2QSH X;  3FBN B;  2O8X A;  2QBY B;  3HHH A;  2R7R A;  4ZZD A;  1X2N A;  5BPD A;  1YIJ I;  1WGX A;  2PMZ A;  1N78 A;  2GBY A;  1IDZ A;  3QYE A;  4UB6 C;  3MKZ A;  3FF5 A;  3JRC A;  1TC3 C;  4YFK F;  3ZQH A;  4RBO A;  1R5G A;  1SAN A;  1BL0 A;  1XTA A;  3HC7 A;  1MMA A;  3E7L A;  1R00 A;  2KQR A;  5FB2 A;  2JMW A;  5GAG J;  2DYR H;  1WJ5 A;  2FUG 2;  4NC7 A;  4PJM A;  3HUG B;  1I6X A;  5LHI A;  4XNF A;  4F91 B;  2EFN A;  2ESH A;  4AD9 A;  1Q1V A;  1T39 A;  1IN8 A;  1YS7 A;  4F93 B;  2HXO A;  1IRX A;  1X3Z B;  4BHB A;  3F8M A;  4A6D A;  4DNC A;  5IT9 K;  4A3L J;  1OJL A;  2CUZ A;  4IJA A;  5EZH A;  3VB2 A;  1ETX A;  2IJL A;  5E8I A;  5KAI C;  3ZN1 A;  4J19 A;  1SVL A;  2LG4 A;  5HS8 A;  5LRS A;  2NAZ A;  1SVO A;  3G6E I;  4MEX F;  2ZKZ A;  4BE1 A;  4AUX A;  1W7P B;  4A12 A;  1T98 A;  1WWX A;  4DBR A;  3BJA A;  3ZRG A;  1ON1 A;  5LHH A;  1KGS A;  2EBI A;  3MZY A;  2DJI A;  2GA1 A;  4E4H A;  1Z0X A;  3C7J A;  2HQ5 A;  3JAM K;  3IH4 A;  1OCZ H;  4HLY A;  3P9I A;  3OYM A;  1W4M A;  1ZAR A;  4D5C A;  1ZGW A;  5J6X A;  1UMQ A;  2IW5 A;  3F8F A;  1D1C A;  1YJW I;  3M8F A;  3I64 A;  2BV6 A;  3HTU A;  3U1D A;  2LTP A;  2WAQ N;  4N9I A;  5E79 C;  3AL0 C;  1O4X A;  2ACJ A;  1G8X A;  1U3E M;  3PO2 J;  2DOF A;  3FXM A;  3O8H A;  1IXS B;  1BC7 C;  2I8D A;  4B8X A;  2VQC A;  1LVK A;  2B0L A;  3MN2 A;  4HDV A;  2KFD A;  4HYE A;  4IRG A;  5DDG A;  4CCO A;  5FLX K;  1SD5 A;  4IL6 C;  1TNS A;  4MQ9 F;  2Y30 A;  3L2U A;  2CGP A;  5D8K B;  3V7R A;  4IHV A;  4RDU A;  3HUG A;  1YQA A;  3LQQ A;  4GDF A;  4KIC A;  1XG1 A;  4A6E A;  3HRM A;  4M73 A;  4IHX A;  3PQK A;  2ID3 A;  4OIO F;  1VQL I;  4LLL A;  4EJT A;  1A04 A;  1Z77 A;  2VQG A;  1HSJ A;  2X1C A;  2X85 A;  2E35 A;  2Q1Z B;  4BBS J;  2DPD A;  1F4K A;  1G3Y A;  1M1E B;  3WU2 C;  2LDU A;  3HOT A;  2GXB A;  5ICE A;  2M45 A;  4BDY A;  4AVP A;  2PX9 A;  2O9L A;  1ZLK A;  3KFW X;  3A0B C;  3ZMU A;  1XSV A;  1IG7 A;  2VQL A;  2E60 A;  1PYV A;  4XKC A;  2L9R A;  1Z91 A;  3FBI B;  4BXX J;  5CPR B;  1JE8 A;  2MGQ A;  1AHD P;  3G1L A;  2YX4 A;  1P4A A;  1R4M B;  1S7O A;  1R6R A;  4WF2 A;  2XF7 A;  2R7V A;  1XGO A;  4BAY A;  3E5X A;  2DXI A;  4NHJ A;  3KZZ A;  3CMA I;  1TWG J;  2E36 A;  4QTR A;  4A3E J;  4EM1 A;  1R58 A;  3DXJ F;  5JHU A;  4LGW A;  2FBK A;  2UXN A;  1QU3 A;  5HDG A;  2JK3 A;  4P9F A;  3A1Y A;  5F27 A;  3ABT A;  3P9K A;  3BR2 A;  2VPR A;  3TQN A;  1H0M A;  2BYV E;  2M3A A;  1X2M A;  1IXR C;  1YO5 C;  4LLG F;  4P1W A;  3RCO A;  4XL9 A;  4IF4 A;  2ZJ2 A;  3NRV A;  4BE2 A;  2PJP A;  3DV8 A;  4AVZ A;  3BG7 A;  2OTL I;  2K3P A;  4F52 A;  1HCR A;  2BOL A;  2I5U A;  3CCJ I;  5FO5 A;  1MBF A;  3RSN A;  4EV0 A;  2PMH A;  3Q0W A;  3VOE A;  2G7U A;  1SVM A;  5HDN A;  2KDO A;  2CRG A;  2DA3 A;  4FQG A;  4EJV A;  4QSH A;  1ZEL A;  3HIF A;  3ABU A;  4NDL A;  4R1H A;  3ZCO A;  1FLI A;  2RGV A;  4OIN F;  5F1J A;  2QSG X;  3BPX A;  5DEQ A;  4A3C J;  4KNY A;  2L2O A;  4XM3 A;  3AAF A;  5GP9 A;  4RB2 C;  4XKV A;  3PJR A;  1BOA A;  5B5E C;  1HW2 A;  3GFM A;  2VT2 A;  5CQE A;  4YEL A;  4HST A;  2EA4 A;  3OOU A;  2OCC H;  1DGR M;  2K4J A;  4V2G A;  3H9Q A;  2Z5U A;  2QEN A;  3CTA A;  3KZI C;  1FTZ A;  2VON A;  1F9N A;  1BW5 A;  2CU7 A;  5FLV A;  3LFU A;  1ZR2 A;  3KP7 A;  5K7F A;  2QM3 A;  2HNH A;  2XRN A;  2G0E A;  1WJE A;  1R23 A;  2QQA A;  3ZMZ A;  4I2O A;  5FRM A;  2GOX B;  2VE8 A;  5DV5 A;  2QEX I;  2R0Q C;  2LVS A;  3W2W A;  2D5V A;  3CCM I;  3ROU A;  2B7E A;  4C3I J;  5E20 A;  2XGC A;  3DU6 A;  1KQ8 A;  2FBI A;  3GTO J;  4C2M J;  2EZL A;  1IRF A;  2F48 A;  5LHG A;  5EG0 A;  3WE3 A;  2BEO A;  2NXN B;  5BPI A;  2E1C A;  4KDP A;  1UB9 A;  3KIO A;  1E17 A;  2ELJ A;  4ZDL A;  4LFU A;  3NAU A;  2D1V A;  1A31 A;  3EDP A;  1T2K A;  1ZRF A;  2EPF A;  3J81 Z;  2XGX A;  3D5S C;  4WK8 F;  1QPI A;  5E18 F;  3QP6 A;  1MMG A;  4S05 A;  3V42 A;  4AC0 A;  1YW8 A;  4XR6 A;  3HSE A;  4ZZL A;  1OCC H;  2F4M B;  2FQ4 A;  3RI4 A;  2DAO A;  1BJA A;  1FTT A;  2BW3 B;  4OIP F;  2QWW A;  4HQM A;  4KYW A;  3CF5 F;  3S3M A;  4IOC F;  2DT7 B;  2X4H A;  3M9A A;  5KHD A;  4LMY A;  4G94 A;  4Y13 A;  1ITY A;  2XAH A;  3IH2 A;  4PJN A;  3FZV A;  3RPU A;  3N4M A;  1BA5 A;  2L3D A;  2F2E A;  1FBQ A;  2JWT A;  3F72 A;  1TQI A;  4BE0 A;  1B6A A;  1T6S A;  1D8J A;  2CW0 F;  4HF0 A;  4MO7 A;  2CG4 A;  1TT0 A;  4HEA 2;  4CCL A;  5GAE J;  2BE5 F;  4IQJ A;  4TV7 A;  3L1P A;  1IRG A;  2DK5 A;  3GFJ A;  1YW7 A;  2EV5 A;  2KIQ A;  3CMM A;  1MZB A;  3E6C C;  2FNP A;  1YE9 A;  2QVO A;  2KIU A;  2FOK A;  2ZJP F;  1K78 B;  2IS4 A;  3OWT A;  4XLH A;  5IOZ A;  1IJW C;  2HDW A;  4B1R A;  2KHM A;  3CCS I;  2LYC A;  4WX9 A;  5IYC J;  2JA2 A;  4L5I A;  2DDB A;  5ERI A;  2IEK A;  3OS1 A;  2WBM A;  3C2H A;  1QGP A;  4KIF A;  1RUO A;  4CGZ A;  2PFB A;  3HOW J;  2A3S A;  2IS2 A;  2EWN A;  3ZQI A;  2LF8 A;  2NVY J;  2MD5 A;  2QQ9 A;  1I1G A;  4AIJ A;  4HLX A;  2P7C B;  1EH6 A;  1IN5 A;  1YW9 A;  5KAF C;  4HV6 A;  1FYK A;  2ECB A;  1PVE A;  1BR2 A;  2KIM A;  2VKV A;  1H9T A;  1K4S A;  4OWR B;  1TQM A;  3JRG A;  4G6D A;  2XAU A;  3CCQ I;  3W6K B;  3CZ6 A;  2LR8 A;  1STZ A;  4A69 C;  3K1P A;  1X3W B;  2HYF A;  4HX4 A;  3WTU C;  4YFX F;  3O8G A;  3IAM 2;  3F6V A;  2K02 A;  3WU1 B;  3SXY A;  3CCY A;  4F7Z A;  2F5C A;  2KRC A;  2DU9 A;  2RNG A;  3FKJ A;  4A3D J;  2L7Z A;  2VBY A;  2NOG A;  2EIM H;  4OOI A;  1SMT A;  5CVU A;  5EF6 A;  1MJA A;  3ERM A;  2HYJ A;  3LSK A;  4M9X A;  1J75 A;  2X6X A;  2DQR A;  1P92 A;  4L5E A;  1NTC A;  4HX7 A;  3I4M J;  1X1D A;  3S16 J;  2BZT A;  3DF8 A;  1MW7 A;  3KYD B;  4YIR X;  4R79 A;  2LY1 A;  5FKO A;  1S7E A;  2NS8 A;  3JCU C;  2XRL A;  2Q8K A;  4BQA A;  1XMK A;  2AQF A;  2MG4 A;  5F04 A;  3HTS B;  2O8K A;  1JKP C;  1XPX A;  3L2W A;  4KIT B;  4XN3 A;  1HQC A;  3ZMT A;  3KET A;  2HOE A;  2NYX A;  3B02 A;  4XRS A;  4C3H J;  3IAS 2;  1ERD A;  3R0J A;  4ESF A;  1GXP A;  3ABK H;  1MH4 A;  1G2H A;  3OYD A;  2DYS H;  2VE9 A;  3EQL F;  1YTY A;  3G1M A;  4RGU A;  3QPS A;  3BR6 A;  1RKW A;  2Y0S A;  3KYC B;  1W1W E;  3I55 I;  2EIK H;  4O6J A;  2JUG A;  1HLV A;  2HVR A;  3KLO A;  2OU2 A;  3AG2 H;  1LFP A;  3GCM A;  3QU3 A;  3LWF A;  1MSF C;  4G9Y A;  3H0G J;  3VSK A;  1FMW A;  2OZ6 A;  2K9M A;  2FQ3 A;  3QQA A;  3TOB A;  5F0C A;  3RZD J;  1YIT I;  2A61 A;  3EYY A;  4RAG A;  2UWM A;  4HBL A;  3BLY A;  3HOU J;  2HYG D;  1G3T A;  2XKO A;  4KMF A;  4FIS A;  3SFI A;  3L2Q A;  3BZK A;  2FOW A;  4I98 B;  4NBQ A;  4PZJ A;  5M3F J;  1K4T A;  3I0T A;  4HF1 A;  3FM5 A;  4LK0 F;  2P81 A;  1FOK A;  1A36 A;  2WA0 A;  2HOT A;  2V1D A;  2DTR A;  5A2Q Z;  1J9I A;  3H92 A;  3K4N A;  4CYD A;  2MA3 A;  3M1E A;  4AWX B;  1SFK A;  1Y8R B;  5J1R A;  2VAS A;  1U9N A;  4UNO A;  2W24 A;  4Y52 J;  3BR1 A;  2R7T A;  1QZE A;  4JQF A;  1Y1W J;  2GOM A;  1ZQ3 P;  5K5Q A;  3DLA A;  2FEZ A;  3TW6 A;  3EUH A;  3J7Y J;  2VBX A;  4J00 A;  5HLG A;  3I56 I;  4U87 A;  3OSF A;  1CGP A;  2HKX A;  2OJE D;  3KEO A;  4IXA A;  4A2U A;  3ZPL A;  3HOY J;  1KZH A;  1X4O A;  2PEX A;  3GZN B;  2HS5 A;  1YYV A;  2X1E A;  2XKP A;  3JTH A;  1ZAO A;  1X58 A;  2RVC A;  4OU0 A;  5EEG A;  1SFU A;  4IRH A;  1OYY A;  3J7A Y;  4FX0 A;  1E2X A;  2EIL H;  2R5Y B;  2TDX A;  1QHH D;  3NWS A;  5J8C A;  2NNY A;  1NHA A;  4HZF A;  1T0F C;  2H8W A;  3IV5 A;  3DPT A;  1QNT A;  1FBS A;  5FJ8 J;  3MEX A;  2N8G A;  4XKW A;  5HLT A;  3A01 A;  5DCM B;  3R4K A;  2K27 A;  4PJL A;  5EZG A;  4BBR J;  3HL2 A;  5TIS C;  4IKF A;  2MC3 A;  3DWL E;  3DKX A;  3VSL A;  2H1L A;  4EEF G;  3KPH A;  1H89 C;  1DPR A;  3F8N A;  1TWH J;  2E34 A;  4KN7 X;  4WXD A;  2JJ7 A;  4R8H A;  2RQP A;  2M5W A;  4AYB N;  4PUS A;  3EUH C;  4L9J A;  4L0Z B;  2WTE A;  3S3O A;  4RAY A;  5CKT A;  3E6B A;  1D0Z A;  5JLX A;  3ASN H;  3H5R A;  1FNN A;  1T8I A;  2DMQ A;  4NQW A;  2H6C A;  4A0X A;  2HPM A;  1QO0 D;  2EIN H;  2IBD A;  3OYI A;  3OSG A;  1VI0 A;  5DTD A;  3X2Q H;  2DT5 A;  1EA3 A;  1TQP A;  2V79 A;  3DTI A;  4DYQ A;  4XBF A;  2C6Y A;  5D4S A;  1VQO I;  4M71 A;  3KZY A;  2GAU A;  3NWT A;  5AIP A;  4LK1 F;  3ZQF A;  3GLL A;  1PUF B;  1HDD C;  3IWZ A;  2DA7 A;  6PAX A;  3H9G A;  3F8C A;  4LD5 A;  4HNU A;  3HOZ J;  4XLA A;  4D7M A;  2BY2 A;  3VYR B;  1SAX A;  2ZJQ F;  1SFX A;  5J1U A;  1FBU A;  3WHB A;  3R60 A;  1RRJ A;  2FBH A;  3OIO A;  2K9L A;  2EV0 A;  2KRH A;  2LMD A;  3CUQ B;  3SHF A;  2KRF A;  4G7O F;  1VQ9 I;  1S9H A;  3K1N A;  2XF6 A;  2GIV A;  5LD2 C;  2BGC A;  1KA8 A;  3BR0 A;  3SZP A;  4EGZ A;  4II3 A;  3V8L A;  1FYL A;  5LGU A;  3IRR A;  3OR2 C;  5HNF A;  4RM2 A;  3BG9 A;  2XAQ A;  1V55 H;  5J47 A;  1KU9 A;  1FC3 A;  3G71 I;  3F22 A;  4M3F A;  2LY2 A;  4GO1 A;  4CCJ A;  2ZJR F;  2NVU B;  4BXU A;  1HDP A;  2DCE A;  2JSC A;  4XMY A;  3LAP A;  1S72 I;  1FYM A;  1AOY A;  1IW7 F;  2A07 F;  3VPR A;  4PCQ A;  2DN0 A;  5DCM A;  4KUM A;  3CDH A;  2F4I A;  4B43 A;  2ID6 A;  3KP2 A;  3OMY A;  2Y31 A;  4M3E A;  4B3X A;  4L0Y B;  2M9H A;  1VQ4 I;  2DT6 A;  1U2W A;  2DQL A;  4BQQ A;  3G73 A;  5CJ9 A;  4E7K A;  4UVB A;  5FKM A;  1YI2 I;  3K7A J;  1P4X A;  2ISY A;  2YU3 A;  1B72 B;  4MNU A;  2JPB A;  2Y69 H;  3I71 A;  5BMZ A;  4IRI A;  3FXQ A;  4N4N B;  4XLN F;  2VKD A;  3RPQ A;  3A02 A;  3HKZ A;  4CUG A;  4FET A;  3WGH A;  3V8J A;  2CQN A;  3V8K A;  2QKM B;  4KJZ A;  5L3C A;  1OCP A;  3U21 A;  1ETV A;  1TWF J;  3LA3 A;  4I02 A;  3RTR A;  3T8R A;  5DUK A;  2HVS A;  1MDM B;  3FM3 A;  2IRF G;  4IOA F;  2VKE A;  5KVR A;  3FDY A;  5L3D A;  1Y56 A;  3MVP A;  2V1U A;  5LGN A;  2MAB A;  3G4S I;  3WTY C;  3FMQ A;  1FIP A;  2NVX J;  1KYW A;  4N0B A;  5J40 A;  3DLL F;  3ZOB A;  4P55 A;  1FEX A;  4AIH A;  2R93 J;  1MBH A;  4O5V A;  5D8L B;  5HVQ C;  3T1B A;  1Z21 A;  5BS6 A;  5L3B A;  4FX4 A;  2MYS A;  2LH9 A;  3OL3 A;  3CUQ A;  3K6G A;  2STW A;  1GUU A;  3ZQG A;  4BJ5 C;  4BEH B;  3S93 A;  2Y9Y A;  1ZHF A;  3KP3 A;  4XN0 A;  3L09 A;  3CQZ J;  3S14 J;  4BXF A;  2O03 A;  1U5T B;  5GTI C;  1DDN A;  2O3F A;  3GXO A;  4NUB A;  3WGI A;  3CMY A;  3ECH A;  4CIC A;  1Z3Y A;  1JI8 A;  1L0O C;  1V4R A;  1R49 A;  5JHF A;  1OQY A;  4RAZ A;  1E3H A;  2EFO A;  2V9P A;  1U9O A;  2OUM A;  3OS2 A;  3E1S A;  3CME I;  4RB1 A;  1CF7 B;  1NG6 A;  3EPZ A;  1MMS A;  2K3F A;  2XAF A;  3RKQ A;  3JW4 A;  2HTJ A;  1BJZ A;  1LNW A;  4E7J A;  3ZQQ A;  2E2H J;  3W3C A;  1TNT A;  1FIA A;  1HF0 A;  1SD7 A;  4XON A;  2QSF X;  3DEW A;  1RNL A;  3ZXS A;  3ZR8 X;  2EH3 A;  3I4P A;  5C4X J;  4CYC B;  2WAQ A;  4EAT A;  2EK5 A;  3CUQ C;  2ZXI A;  2P7V B;  3C3W A;  3O6B B;  3HOX J;  2OCE A;  4L9V A;  4PJ0 C;  3NEU A;  3BRO A;  3VWB A;  4XOT A;  1XN7 A;  5JI6 A;  3EUA A;  5HS7 A;  1IZ1 A;  3E3V A;  4EMS A;  2PMU A;  4OIR F;  3DTE A;  3P7N A;  3FXU A;  2AO9 A;  1OKR A;  2QBY A;  2MLG A;  3E97 A;  2ZXH A;  2NVT J;  1X1B A;  2M0C A;  1J09 A;  4BHP A;  1LE8 B;  3H3V K;  3LQR A;  1PUE E;  1ENH A;  1WJC A;  1OYI A;  3R61 A;  4UUT A;  4EJO A;  2LK2 A;  1N25 A;  4KIG A;  1YRN B;  4B47 A;  4YG2 F;  1R5H A;  2ZO4 A;  1O3Q A;  3KCC A;  2V1N A;  5L3E A;  2MBF A;  1ZRD A;  1IF1 A;  3I54 A;  4MTE A;  2G9W A;  3MZ8 A;  2W84 A;  3VYU B;  2A5W A;  2DMN A;  4UHT A;  5KK1 A;  4ITV A;  3RKY A;  4XRM A;  4X0G A;  1AU7 A;  2Z9O A;  2KJB A;  3BZ6 A;  4N4O B;  5IYD J;  2A5Y B;  4BEH A;  3OYJ A;  2CSO A;  2ZME B;  3GTK J;  2HOS A;  2O6G E;  2R7Z J;  1UHW A;  2L4A A;  3TDZ C;  2LFB A;  1E3O C;  3BOQ A;  2RQQ A;  3FK7 A;  1LJ9 A;  1U5T A;  5K5R A;  3HEF A;  3TOA A;  1IN6 A;  3GWZ A;  2M1B A;  5D5W B;  2DMT A;  3MQ0 A;  1Z6T A;  3C18 A;  2Z3Y A;  5FLM J;  3L2C A;  4UVC A;  1CF7 A;  1ZGA A;  3CCU I;  1IRZ A;  2DLL A;  5JLW A;  1W7P A;  3IRQ A;  3L2R A;  2IS1 A;  2I10 A;  5HLH A;  2K9S A;  2RAE A;  5ILS A;  5DUI A;  3UR3 C;  1P2F A;  2KT0 A;  1POG A;  4BY7 J;  1TW2 A;  2FF4 A;  2O7O A;  5FD6 A;  1X1C A;  1G3W A;  3OYF A;  3G1O A;  2HQN A;  4I09 A;  1U0J A;  2BHY A;  3L7W A;  1H9G A;  1TBX A;  2YPR A;  4GXO A;  3BPV A;  4ON0 A;  5CLS A;  4CO8 A;  4HNT A;  3MZH A;  1SFE A;  1U5T C;  1X1A A;  2MD0 A;  1I6H J;  1X4P A;  3W2A A;  4XKB A;  3I9V 2;  4XOR A;  2P5K A;  2O5R A;  4ZH4 F;  1VQ8 I;  4PK4 A;  4FT8 A;  2ZNY A;  1KQ0 A;  2ZSI B;  5CQG A;  3ISP A;  5JVT A;  2VLA A;  3E5Q A;  2XDV A;  2XPW A;  4OAY A;  1NH3 A;  3M3Y J;  1WJF A;  1ZGJ A;  5E3O A;  1HKT A;  4JX5 A;  2B9S A;  1F43 A;  2MC4 A;  1BOB A;  3BCA A;  1UZC A;  3SFZ A;  1IUY A;  1K83 J;  4X6A J;  3BY6 A;  3CP2 A;  3MD2 A;  2HDC A;  2IGM A;  4JX6 A;  1R71 A;  1K6Y A;  1RKT A;  4IX7 A;  2ZFW A;  2ECC A;  2ZME A;  2KMU A;  2A6T A;  4OAZ A;  3HM5 A;  2WWY A;  1X1P A;  2LKS A;  2W57 A;  2XPV A;  2JTV A;  1Y6I A;  1YX5 A;  1K61 A;  3EUK L;  5E1W A;  4B48 A;  2EB7 A;  2IAI A;  2COB A;  3CCR I;  4LG0 B;  3S2H J;  3C2B A;  2X51 A;  5DM6 F;  5ICF A;  2CUJ A;  2X6Y A;  3GF2 A;  3FXR A;  2L01 A;  3IP4 B;  5D6F A;  1B9N A;  5GPC A;  2DA5 A;  3W6J B;  2Y0M A;  1LVA A;  2HR3 A;  3D5R C;  5EGO B;  1UG0 A;  2P8T A;  4P9U A;  1IV6 A;  1LEA A;  3PFY A;  4FAS D;  1O3S A;  2A69 F;  4C30 A;  2IT0 A;  1RI7 A;  3QRF F;  4O3M A;  3BTJ A;  1WRJ A;  4YRV A;  1Z9C A;  2GM4 A;  1JTX A;  3WG7 H;  1B9M A;  5D5X B;  5HDK A;  3QYB A;  2F4O B;  4GGG A;  2CO5 A;  3DKY A;  3ZQ7 A;  4DBQ A;  3B73 A;  2ZME C;  2QKL B;  1Q1H A;  1OCO H;  2VPL A;  3MFK A;  2WAD A;  2JQ7 A;  3JAM Z;  2PI0 A;  1P7I A;  4H0E A;  2LP0 A;  1ETK A;  4RLQ A;  5GAD J;  1EF4 A;  3PM1 A;  3FXJ A;  3PNT A;  2E1O A;  3S2D J;  2EA2 A;  1J59 A;  2RKH A;  2PQ8 A;  2PN6 A;  3JRD A;  2M7B A;  5LFA A;  5D6E A;  2RC4 A;  4ZDO A;  2VB6 A;  3GTJ J;  3SEZ A;  4HSR A;  1WHU A;  2EV6 A;  2X6O A;  2M87 A;  5JVG F;  2E5N A;  3RKX A;  3GTG J;  1DGW Y;  3BWG A;  4KT5 C;  3KE2 A;  3PNY A;  1H8A C;  1Z67 A;  3CDI A;  3K1M A;  3F0C A;  3KLN A;  1GV2 A;  5L3G A;  4Y15 A;  4EM2 A;  4U0W A;  1I39 A;  2Z2S B;  2OF7 A;  2HQR A;  3R6S A;  3OYG A;  4BY1 J;  1YJ9 I;  4QIW N;  3OYB A;  2NS7 A;  4M6X A;  4PJJ A;  1VQ5 I;  3FHN A;  1ZR4 A;  3LMM A;  5F0F A;  3PSF A;  1IUF A;  2JT1 A;  1F36 A;  3Q9V A;  3WE2 A;  3OYA A;  2V4J C;  1YS6 A;  2ADU A;  2IGO A;  3HSF A;  2Y2Z A;  3MAJ A;  4IEJ A;  4HQE A;  4A0Y A;  4BAC A;  5E1X A;  4LG0 A;  3RDI A;  2VJ5 A;  1IN4 A;  4G7Z F;  2HDD A;  3HZJ A;  1XD7 A;  1ETO A;  3ZMV A;  5CVR A;  3FIS A;  2OPT A;  1O3T A;  3KP6 A;  4I01 A;  5EGO A;  2TRT A;  3T0Y A;  4QPQ A;  2F5F A;  1W36 C;  3F3X A;  3WTV C;  1MBG A;  4Y3O A;  1W0U A;  3IKV A;  4DZP A;  4UY8 I;  3WGG A;  2BHZ A;  2IP2 A;  5IYB J;  3PQJ A;  1JGG A;  2V6C A;  4UXN A;  2VI6 A;  2KIS A;  2J5P A;  2WV1 A;  2GIZ A;  3DEU A;  4RMN A;  1S6L A;  4Q47 A;  1DP7 P;  5DYM A;  3HRS A;  5LRR A;  1HBX G;  1JKR C;  1D5V A;  3S15 J;  5BNG A;  3D5L A;  3M07 A;  1UAA A;  2DFH A;  2ISZ A;  1PDN C;  1HC8 A;  4BQO A;  2QYO A;  2ZC2 A;  4DGW B;  3C2G A;  2R4G A;  5D5U B;  2IPQ X;  2XGD A;  4KT6 A;  4LB5 A;  3DQV C;  3I59 B;  3M1C A;  1LDK B;  3E6D A;  4DYR A;  3OYE A;  3FXO A;  1IC8 A;  1WJA A;  4LJZ F;  3S1M J;  3I4N J;  3HB9 A;  4U88 A;  2JRT A;  1XSD A;  5K5O A;  4G6Q A;  1KU2 A;  3HGG A;  1XDU A;  3UNG C;  2BW3 A;  2Q2E B;  3DU5 A;  4ESB A;  1S7A A;  3WTS C;  2GLO A;  4XOP A;  3LSJ A;  3ZMD A;  4JYK A;  1XSX A;  4BJ6 C;  5IT3 A;  1G6N A;  1LDJ A;  4F92 B;  2ME0 A;  1B1B A;  2DW4 A;  3V4G A;  4V2F A;  1I5Z A;  2A6H F;  3GTP J;  3GBG A;  2GXG A;  3K4L A;  3RPU D;  3AG3 H;  1Z6R A;  1TT5 B;  3SZG A;  1JKO C;  1ONV A;  2CQQ A;  2M7A A;  5H6Q A;  3H35 A;  4U7D A;  2JA8 J;  2MH9 A;  1ODD A;  1K78 A;  3JRF A;  4EGY A;  1Z05 A;  1VQK I;  3HPG A;  4MIM A;  1BBY A;  1FWZ A;  1LQ1 A;  1AA7 A;  4UUS B;  3FX3 A;  1OIS A;  2R5Z B;  4PGH A;  3ERE D;  3CF2 A;  3RQI A;  2NVQ J;  4H4K C;  2OBP A;  4QLC U;  4PFO A;  2CW7 A;  1OYW A;  4PSX A;  1YG2 A;  2R3S A;  2VJI A;  2M4K A;  5B1A H;  2H27 A;  4D5F A;  2K85 A;  3REO A; 
#chains in the Genus database with same CATH homology
 2DA4 A;  5K7H A;  4M3F A;  2Y30 A;  1HDP A;  2HI3 A;  1IDY A;  4IHV A;  4RDU A;  3D1N I;  1GV5 A;  1XG1 A;  3VPR A;  2DN0 A;  4IHX A;  4XIC A;  2ID6 A;  2ID3 A;  2Y31 A;  4M3E A;  5E3N A;  1JT6 A;  1ORK A;  2M9H A;  1Z77 A;  4B3A A;  2KDZ A;  4A3K J;  3K2A A;  5FKM A;  4BBS J;  3K7A J;  2K40 A;  1D5Y A;  1LFU P;  1JUM A;  1B72 B;  3HOV J;  2O9L A;  1RPW A;  2EQR A;  3A02 A;  2Y0S N;  1P7J A;  1IG7 A;  1IGN A;  2L9R A;  4BXX J;  1OCP A;  2MGQ A;  5FKL A;  3JRA A;  1ETV A;  1TWF J;  3BTL A;  3G1L A;  1JJ6 C;  1AHD P;  2Y9Z A;  2M2E A;  2LLK A;  2VKE A;  3MVP A;  1FIP A;  2NVX J;  2ME6 A;  1TWG J;  4QTR A;  1U78 A;  4A3E J;  3ZOB A;  1T33 A;  5E3M A;  3B6C A;  1FEX A;  2R93 J;  3BQZ A;  2JK3 A;  4ABZ A;  1MBH A;  5F27 A;  3BR2 A;  2VPR A;  4JP0 A;  2L7F P;  1X2M A;  4XRS G;  1RET A;  4HNV A;  3RZO J;  2R5Z A;  1GUU A;  3ZQG A;  2Y9Y A;  2JN6 A;  5K7Z A;  4A3G J;  1HCR A;  1A6I A;  3BR5 A;  2DA6 A;  3CQZ J;  3S14 J;  1MBF A;  3JRH A;  4GFB A;  3Q0W A;  3CMY A;  2AHQ A;  2CRG A;  2DA3 A;  4QSH A;  4NDL A;  1U9O A;  2DTZ A;  4BKX A;  4MLO A;  5F1J A;  5C44 J;  3RKQ A;  1VFC A;  4A3C J;  5IOY A;  1BJZ A;  1HOM A;  2E2H J;  5GP9 A;  1FIA A;  1HF0 A;  5M5X J;  2R92 J;  3S1N J;  4XID A;  1QVT A;  1WH5 A;  3DEW A;  1ZK8 A;  1MH3 A;  2EH3 A;  5C4X J;  4CYC B;  3BG3 A;  3W6V A;  3JRI A;  3OOU A;  1I50 J;  4V2G A;  1DU6 A;  3HOX J;  2DJN A;  4MFE A;  1FTZ A;  2TCT A;  2ELK A;  1BW5 A;  2CU7 A;  5FLV A;  5IP7 J;  1ZR2 A;  1T56 A;  5K7F A;  1GVD A;  2G0E A;  2R0Q C;  2AO9 A;  2LVS A;  3FIW A;  2LD5 A;  2D5V A;  2NVT J;  5FKN A;  2M0C A;  3DCF A;  1LE8 B;  4C3I J;  3B6A A;  1AKH B;  3H3V K;  1ENH A;  2XGC A;  4UUT A;  2LK2 A;  5M5Y J;  1YRN B;  3GTO J;  3ZQL A;  4IHY A;  4C2M J;  3LNQ A;  2EZL A;  2H1K A;  4LOC A;  1MBK A;  5EG0 A;  3S17 J;  2E2J J;  2JA6 J;  2R5Y A;  2M8G X;  2X48 A;  4A3M J;  2DA1 A;  1B8I B;  1AU7 A;  2DMN A;  4XRM A;  5IYD J;  1I3Q J;  3NAU A;  3A01 B;  2FX0 A;  1LFB A;  1OCT C;  3GTK J;  1JUP A;  2HOS A;  2MW8 A;  2R7Z J;  1QPI A;  2LFB A;  1E3O C;  5HOD A;  3FK7 A;  4AC0 A;  3HEF A;  5DS9 A;  3BG5 A;  4A93 J;  2FD5 A;  2FQ4 A;  2DMT A;  1FTT A;  2XGE A;  1ZTR A;  5FLM J;  2EZK A;  3BQY A;  1JJ8 C;  1IRZ A;  5JLW A;  3HDD A;  4A3F J;  1NK3 P;  2EZI A;  2XB5 A;  3S1R J;  2ZB9 A;  1FJL A;  5FKK A;  2I10 A;  1ITY A;  3MKL A;  2K9S A;  2RAE A;  2HXI A;  3JRB A;  3IH2 A;  4S0H B;  1BA5 A;  4I76 A;  1MNM C;  1POG A;  2KT0 A;  2JWT A;  2L0K A;  1QRY A;  4BY7 J;  2JA5 J;  4DYC A;  1H88 C;  4MO7 A;  4M3G A;  1PUF A;  2O7O A;  4FTH A;  2QF7 A;  4MFD A;  3L1P A;  3TW7 A;  1MSE C;  2B63 J;  3G1O A;  1GDT A;  1APL C;  2WB1 N;  1UG2 A;  1JUS A;  1ZKG A;  5IOZ A;  1IJW C;  4B1R A;  1I6H J;  5IYC J;  4UUS A;  1WH7 A;  3HKZ N;  4I6Z A;  2IEK A;  4DW6 A;  2E2I J;  3HOW J;  1AKH A;  3ZQI A;  2NVY J;  2XPW A;  3M3Y J;  2X9D A;  5E3O A;  4JX5 A;  3FK6 A;  3SDG A;  5IP6 A;  3NAR A;  5IPA A;  1F43 A;  1K83 J;  4X6A J;  2PMZ N;  1B8I A;  2DMP A;  4JX6 A;  1RKT A;  4A3I J;  2XSD C;  2ECB A;  4XK4 A;  2ECC A;  2W48 A;  2VKV A;  3Q0V A;  2E19 A;  3HM5 A;  5F08 A;  3JRG A;  4A3J J;  3BR3 A;  3PO3 J;  3Q0U A;  2XPV A;  1K61 A;  2VUM J;  2LR8 A;  2IAI A;  2COB A;  4A69 C;  3S2H J;  1MBE A;  2DMU A;  3C2B A;  5EEA A;  5EYR A;  3BT9 A;  1B72 A;  3O8G A;  3CDL A;  2M34 A;  4FCY A;  5GPC A;  3CCY A;  2DA5 A;  1WPK A;  2CUF A;  3HGY A;  3QPL A;  4D7N A;  3LSP A;  4A3D J;  2L7Z A;  1BW6 A;  2NOG A;  5EGO B;  3M4O J;  2DA2 A;  5EF6 A;  1IV6 A;  4M3B A;  2HYJ A;  3BTJ A;  1GT0 C;  2K9Q A;  4L5E A;  1NTC A;  2GM4 A;  1JTX A;  3I4M J;  1JTY A;  1WCM J;  2MSY A;  3S16 J;  1TWA J;  1MBJ A;  1DU0 A;  5FKO A;  1S7E A;  3TP3 A;  2NS8 A;  2QCO A;  2XRL A;  1XS9 A;  2YU9 J;  4JX4 A;  1P7I A;  2MG4 A;  5F04 A;  2O8K A;  3Q3S A;  1WI3 A;  2LP0 A;  1ETK A;  1JKP C;  1EF4 A;  3PM1 A;  2E1O A;  4XRS A;  3S2D J;  4C3H J;  4C3J J;  1MH4 A;  3JRD A;  1G2H A;  3G1M A;  3GTJ J;  3QPS A;  2X6O A;  3BR6 A;  3TP0 A;  2YUS A;  1RKW A;  3BTI A;  5M5W J;  5EDN A;  1JKQ C;  1QVU A;  3GTG J;  1HLV A;  2YS9 A;  2CUE A;  2LY9 A;  1ETW A;  1H8A C;  3LSG A;  3UKG A;  3F0C A;  1GV2 A;  2FJ1 A;  2K9N A;  3FKI J;  4DZJ A;  1MSF C;  2OF7 A;  3H0G J;  4BY1 J;  4A3B J;  4QIW N;  3QQA A;  3JRE A;  5C4J J;  2NS7 A;  5F0C A;  3GTL J;  1A5J A;  1ZR4 A;  3RZD J;  5F0F A;  2XPU A;  1IUF A;  1F36 A;  3HOU J;  1TWC J;  3HBL A;  4IEJ A;  4FIS A;  2Y2Z A;  3SFI A;  3S1Q J;  5M3F J;  4Y7N J;  4FE7 A;  1OFC X;  2P81 A;  4X1E A;  4CYC A;  2HOT A;  1Y1V J;  2HDD A;  2EZH A;  3TED A;  5GPA A;  4G12 A;  4FE4 A;  1ETO A;  1UHS A;  4M6V A;  3FIS A;  2OPT A;  1XC5 A;  5J1R A;  4M3D A;  1U9N A;  4Y52 J;  3BR1 A;  5EGO A;  2TRT A;  1Y1W J;  1ZQ3 P;  2HOA A;  1MBG A;  3TW6 A;  1W0U A;  4DZP A;  2JA7 J;  4IHW A;  3OSF A;  5IYB J;  1JGG A;  2H8R A;  3HOY J;  1JT0 A;  3JR9 A;  5J1Y A;  1X2N A;  1LE8 A;  1WGX A;  2VI6 A;  2GBY A;  1IDZ A;  1X58 A;  2WV1 A;  1YRN A;  3JRC A;  5J3L A;  1TC3 C;  2XB0 X;  3ZQH A;  1VND A;  4RBO A;  3ZQC A;  1SAN A;  5EG0 B;  1BL0 A;  1ETY A;  2R5Y B;  9ANT A;  3E7L A;  1JKR C;  3S15 J;  2JMW A;  5BNG A;  3IV5 A;  5FJ8 J;  2N8G A;  3A01 A;  1Q1V A;  5EZG A;  4BBR J;  1U8B A;  3SJM A;  2HXO A;  1R9T J;  4EEF G;  5M3M J;  2LKX A;  1H89 C;  2XGD A;  1TWH J;  4B4C A;  4W97 A;  1RES A;  5E3L A;  1NK2 P;  2JJ7 A;  4DYR A;  4A3L J;  1IC8 A;  1OJL A;  3LOC A;  4AYB N;  5EZH A;  3S1M J;  3I4N J;  1VF9 A;  1ETX A;  3HB9 A;  3HGG A;  1RR7 A;  4J19 A;  5JLX A;  2DMQ A;  2GLO A;  3LSJ A;  4AUX A;  2IBD A;  4JYK A;  5IP9 J;  3OSG A;  1VI0 A;  5DTD A;  2EBI A;  5F0H A;  4DYQ A;  2ME0 A;  3LSR A;  4V2F A;  3GTQ J;  3GTP J;  3GBG A;  1Z0X A;  1W0T A;  2HQ5 A;  3BTC A;  3IH4 A;  1JKO C;  3ZQF A;  1SFO J;  2CQQ A;  4D5C A;  1PUF B;  1HDD C;  1ZGW A;  1UMQ A;  2DA7 A;  2JA8 J;  2CQX A;  5C3E J;  3HOZ J;  4D7M A;  3JRF A;  2L7M P;  2LTP A;  2WAQ N;  4MIM A;  3GTM J;  1O4X A;  5J1U A;  3WHB A;  4UUS B;  3PO2 J;  2R5Z B;  3OIO A;  3O8H A;  3IH3 A;  1ETQ A;  3A03 A;  3WHC A;  3RQI A;  2NVQ J;  3BR0 A;  3MN2 A;  4W1U A;  2CJJ A;  1CQT A;  4D5F A;  3BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...