4KDPA

Tcar-ssdna complex crystal structure reveals the novel ssdna binding mechanism of the marr family proteins
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
b'MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TcaR transcription regulator
publication title TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription/dna
total genus 41
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kdpA00
4A5NA 2OBPA 2A6EF 3KP2A 2P5KA 2BE5F 2H09A 4LLLA 2JPCA 1KU7A 5ERIA 4FX4A 1SD6A 2LNBA 3M8EA 4KNYA 1FY7A 4HA8A 5A2QK 1U5TB 4L0YB 4A0YA 1R36A 3WTXC 4A0XA 2L02A 3PQJA 3P9CA 2QVOA 2W85A 4CDGA 4HX7A 4UUVA 1RZ4A 3I59B 1MDMA 1G3SA 2FNAA 3EETA 3T8RA 2IA0A 5D4RA 3DV8A 3GFJA 3RYRA 2D45A 3FZVA 5LHIA 4LGWA 2YR2A 5FGMA 4AWXB 5DD4A 1U6GA 4EVIA 1XGOA 1J0RA 3WTUC 5AONA 2PQ8A 2DFIA 4EM2A 4A5MA 3B02A 1T98A 5D5UB 4MGRA 4G8XA 3CTAA 1G4DA 3KEOA 4DNCA 1TQIA 4HOBA 5E1XA 1Z7UA 3ZMVA 4HLYA 2M30A 4WXHA 3MFKA 5LHHA 2EA4A 1HW1A 1MJ9A 3IL2A 1XMAA 4M9SA 1B9MA 3KP7A 3HRSA 4IJAA 1ON1A 1K6OA 3VFZA 1R1TA 2O8XA 1Y0UA 1SD5A 2HWVA 4RGUA 4Z2YA 1Q1HA 2ADUA 2O0YA 3P7NA 1XB4A 3QP6A 3V8KA 4HDUA 2F5EA 3LQQA 2RC4A 5ILUA 1UB9A 3KP6A 3E97A 3E5UA 2A5YB 2GXGA 1E2XA 3GZ6A 4LLNA 1JGSA 5J8FA 1I5ZA 1W7PD 5CJ9A 2XAQA 2GAUA 2MC3A 3MZYA 5HLIA 1F4KA 4LK1F 3ZMZA 1YW8A 3FXRA 4HBLA 4XLNF 1KGSA 1WI9A 2PLYA 2HTJA 3B73A 2ZNZA 3WODF 2HQNA 1L3LA 3OOPA 1USSA 2EK5A 5DD8A 1ZHFA 3TGNA 4IHTA 1S7AA 2FOKA 4LLGF 3E6MA 2V79A 3L2CA 2L54A 1BC8C 1FOKA 5K1YA 1U78A 2VXZA 4U7DA 3FM5A 1J5YA 3RKWA 1GXQA 5L3FA 3ZMUA 2Z99A 4BAYA 3I0TA 2M8EA 3HOSA 4PZJA 4MTEA 4BHPA 2QWWA 2XIGA 2BEOA 5FFXA 2DU9A 2FXAA 4UVBA 5K5RA 4I7HA 5E18F 1FYLA 1D3YA 4RGRA 1RNLA 2EV6A 4EJWA 5H6QA 4WF2A 2STWA 2O03A 3G3ZA 2FF4A 4KT5C 4OINF 1SFUA 4G6DA 2VE9A 3KCCA 4EQQA 4HAMA 3IRRA 2CFXA 3GZ5A 1IUYA 5E20A 3GEZA 4KYWA 2PN6A 3GYHX 4LJZF 2O3FA 3FM3A 4KICA 2RV8A 1FYMA 1PP8F 2P6TA 2ELHA 3HOTA 3L9FA 3PFIA 3M1EA 2VOOA 2YSRA 1TQMA 2XRNA 1IN5A 2FEZA 2HYFA 2BYVE 4HDVA 2LF8A 3ABUA 5J8CA 1MDMB 1LQ1A 4YG2F 2VOPA 5DUKA 4D0PA 2P7CB 3IRQA 3PQKA 2J5PA 2QQAA 3F8NA 1IRFA 4CZZA 2P5LC 3ZP5A 1SMYF 1IF1A 5D5WB 2OAZA 2FSWA 5CLSA 1CGPA 4AVPA 1WWXA 1D5VA 3WTVC 1IN8A 1I1GA 1S7OA 2MLKA 1YFHA 4BNCA 1IXCA 4KMUX 4I0BA 5IT9K 5HDGA 1P4XA 1HW5A 3VB2A 5BS6A 1PUEE 3JW4A 1PP7U 1G6NA 4GGGA 3BP8A 5L3EA 5DCMA 1T38A 3RDIA 2YPRA 2L3DA 2IT0A 1DDNA 5HLGA 1CF7A 1T0FA 1ODDA 1QBJA 2MH2A 2WTEA 1QQIA 3I53A 4G94A 4Y17A 1NHAA 4L18B 3DFGA 3VODA 3DXJF 5E8IA 4ZYHA 2FA5A 3W6KB 2D1VA 2VBZA 3WGIA 2IJLA 4MQ9F 2ACJA 1KU9A 1IN4A 5CVVA 1FNNA 4KDPA 3MCZA 4R8HA 2HEOA 5TJJA 1ZH5A 1ON2A 3R6SA 1C0WA 2HFHA 3BDDA 1BBYA 3CO6C 4KIBA 4F7ZA 5BQTA 2ZNYA 3HSFA 1TNSA 3M9AA 5HS9A 4HYEA 2MA3A 4P5OA 2FNPA 3JAMK 2VONA 4XSXF 3E6DA 4EM0B 2VBYA 2M87A 3CUQA 3L09A 2Y0MA 2LKPA 3TDZC 3LFKA 1Z91A 1MJAA 5ICEA 4KUMA 5D8KB 1KQ0A 3D0SA 3SFZA 1G3WA 4G6QA 3I58A 1XCVA 4Q5SF 3EDPA 2XAFA 5H20A 2HOEA 1FBSA 1ZRCA 2ZJ2A 1J2XA 3WU0A 2ZFWA 4CYDA 2VBXA 2CYYA 4L0ZB 2JRTA 2JZYA 1FX7A 1LDDA 4XLPF 1JXSA 1U8RA 4HX4A 4KFCA 1EH8A 1U5TC 4OIOF 2K02A 4JQFA 4GXOA 4ZZLA 1R1UA 1BIBA 2HZTA 4OMYA 2M5WA 4YIFA 5FB2A 1XMKA 2VT2A 3JTHA 2FMLA 2VC0A 3K69A 4RGSA 1KQ9A 4L5IA 2KRFA 3VEPA 2JPBA 1J9IA 1P6RA 3N97A 1F1ZA 1QGPA 1QZZA 2R7DA 3KLOA 1YQAA 3RKYA 1YS7A 5D6FA 2VT3A 3QPTA 2IA2A 4RGXA 3FMQA 4RB0A 3C7JA 1O7FA 1OMIA 5CVIA 4M73A 1RUNA 3J81K 2MH9A 5DCMB 3IC7A 3JTGA 3BOQA 4TV7A 4EGZA 1B9NA 3KP5A 3C1DA 1XGMA 1CF7B 5CVRA 4WK8F 4CO8A 1UHWA 3C3WA 1ZG3A 1B59A 2XV4S 3SQNA 5IT9Z 4U0VA 1ZAOA 3R60A 4L5JA 2IW5A 3L7WA 1HKQA 3R0AA 1J75A 2P4WA 4N0BA 2PJPA 4UVAA 1LEAA 1YW9A 5LGNA 3P9KA 3MAJA 1P4WA 2XGXA 5LBQA 2NNYA 2W25A 4PGHA 2L4AA 4HF0A 3FMSA 3O2PE 4B09A 3REOA 3QOPA 1P4AA 4L9NA 1K78B 2GQQA 3V8LA 2EV0A 2MD5A 3ZMDA 2OQGA 2EB7A 4IF4A 1WKMA 4ASNA 3FMRA 5FLXK 2L4MA 2P6SA 4P9UA 2QZ8A 5CYVA 1JHHA 2CGPA 3WG9A 2HS5A 3CUQB 1RI7A 2KKOA 1OR7A 4RS8A 2E7XA 2Z5UA 2CO5A 2K4BA 4UV9A 1FBQA 5LLQA 3RJPA 3ERED 1P92A 3FX3A 3I5UA 4ZYDA 3F8CA 4O3MA 2OA4A 5ED4A 2FBHA 3JAMZ 5LEJA 1T6SA 3WTYC 4L9VA 5JR3A 5HDNA 1ZN2A 2AS5F 4R79A 4HV6A 4L9TA 2RN7A 3TOAA 5JHUA 3MZHA 4MQVA 3IWZA 1OYWA 4KA4A 3HTSB 4I09A 4N9HA 1ZLJA 3HUGA 3HYIA 1QZYA 1W5SA 5ICGA 1T39A 1RIOH 1BI3A 5DEQA 1O3QA 3ZPLA 2NRAC 2EFWA 1KQ8A 3M8FA 1FT9A 3EYYA 2A61A 2NYXA 5HS8A 4IHSA 3EQLF 3FF5A 1WSUA 1BC7C 3GFMA 4QWQA 4NHJA 5JI6A 3IWFA 3FHZA 1QPMA 2PMHA 1FP2A 2V6CA 3GXOA 4RB1A 5LGTA 3WTZA 3KFWX 3HRTA 4UVCA 2L01A 4RB2C 4Q4ZF 4ENMA 1IN6A 3KZYA 2A07F 4DQ2A 3LAPA 1XD7A 4HQMA 1SAXA 3KLNA 3V7SA 5L3GA 2RDPA 1QO0D 1FSHA 3QU6A 2PFBA 3BJOA 5K5QA 4ZYEA 4YFXF 2H6BA 5DCFA 3GW2A 2G7HA 3KP3A 4JBAA 1ZGJA 4EMSA 5KVRA 2ZO4A 4P55A 3J81Z 2HGCA 2KIUA 5LGUA 4LD5A 4H0EA 2H27A 4ESFA 1DUXC 3J7AO 2VE8A 2HR3A 3T8TA 2VODA 2XKOA 3CUOA 4UXNA 3TKYA 4A6DA 2WWYA 5A2QZ 4WXDA 3R61A 3U2RA 3L00A 5ICCA 5L3BA 3F21A 3M7GA 2NAZA 1BI1A 2C6YA 4ZH4F 3BROA 2DT5A 3GLXA 3J80K 1F5TA 1R7JA 2OQRA 3GX4X 3H92A 4IVNA 3RKXA 3ZMSA 1IAWA 1ZRFA 4HZFA 2WC2A 5DUIA 3ZQ7A 2FU4A 4U0WA 4NB5A 2VN2A 4MNUA 1HQCA 1ZRDA 4WCGA 3T0YA 1EH7A 1MD0A 2H94A 3MQ0A 4BH9A 4G7HF 5HVQC 4ENKA 2NNNA 1FWZA 1E17A 2JT1A 4U0YA 3GFIA 2P7VB 3TDUC 3H3UA 4I02A 5CVJA 1H9GA 2DO7A 2EFOA 1B1BA 1UFMA 1FPQA 2GA2A 4P9FA 2A69F 2HKXA 2Y75A 3WTWC 1R1VA 1D8JA 2R3SA 2PMUA 4U88A 1DPUA 1DP7P 1AOYA 3IHUA 3RPQA 3TQNA 1F9NA 2UZKA 1H9TA 5L3DA 3HIFA 5BPDA 3V4GA 5E17F 1LJ9A 1GVJA 2R7FA 4IRIA 1HKSA 4YIIA 4E70A 1XGSA 4NQWA 1K78A 1MJBA 5D5XB 3CJNA 3QP5A 3CDHA 4YFKF 1YIOA 2LF7A 1DPRA 3O6BB 2RGVA 4IPAA 2DPDA 2Y48A 3ULQB 2K86A 1W5TA 2CG4A 4WWCA 1XDUA 4AD9A 2RNJA 5FD6A 3SHFA 1I1SA 1ZLKA 2DK5A 2YU3A 4A0ZA 3KE2A 4OIRF 2G7UA 2EWNA 4ESJA 3F23A 3GF2A 2XASA 1Z05A 1HW2A 1IN7A 4HV5A 2PG4A 3HSEA 5LEKA 4OU0A 5BMZA 1U2WA 5AIPA 4IXAA 2FQ3A 3R0JA 1YS6A 1LNWA 2KIFA 2FBIA 1R23A 4Y13A 4WX9A 3H3ZA 2GXBA 4M6XA 1TW2A 5E8GA 4I2OA 4I01A 1P2FA 4LG0A 5DV5A 3F6VA 3K2ZA 1IW7F 1S6LA 5FFZA 5D4SA 2ESHA 2A3SA 2GWRA 5LRSA 3GFLA 2XAHA 5DYMA 3I64A 1KU2A 4UV8A 3ELKA 2OZ6A 3ZMTA 1UHMA 4CHUA 4AIHA 2HYGD 3BJAA 3V7CA 2YX7A 5J6XA 3COAC 4G9YA 4IRGA 1EV7A 4MHGA 5L3CA 1USTA 5H6RA 2STTA 5D8LB 1YG2A 4XBFA 3C18A 5HOOA 2GA1A 3U1DA 3CUQC 3VOEA 3BY6A 2KJBA 3F8FA 1BIAA 3K9TA 1SFEA 4OOIA 1KYZA 1JHFA 2TDXA 1I27A 3IKVA 4A6EA 1ZG5A 4BXUA 2VBWA 1OKRA 4M9ZA 1PDNC 3LA2A 5TRDA 4K2EA 2WV0A 2H6CA 1XSXA 4ESBA 1FP1D 2UXXA 3DPLC 3RTRA 1D8KA 2Z33A 2W84A 3RPUA 2XUBA 3ML6A 2OU2A 3LSTA 4M72A 2HDCA 1R00A 2DBBA 4L9JA 2LDUA 3I54A 2P5VA 5ILSA 3JSPA 1O3SA 1YO5C 2EFPA 2EV5A 2DLLA 3HHGA 1ULYA 2O6GE 2NS0A 4ETSA 5HLHA 1XSDA 2MBFA 2XROA 2GIVA 1Z6RA 3GUDA 1EH6A 3DEUA 2QQ9A 1BI2A 3TO6A 3T1BA 3U9GA 3WGGA 1GHCA 3K0LA 5BPIA 5HS7A 3NQOA 1BN5A 1GXPA 4M9XA 6PAXA 4QLCU 1REPC 3I4PA 1J59A 5D6EA 4G7OF 1S8NA 1S3JA 2ZXJA 4OIQF 3IKTA 1FC3A 2QBYB 2HQRA 2XAJA 1QNTA 1G3YA 4KIGA 2PI0A 5JFRA 2RKHA 4O5VA 4BYYA 2KIMA 1ZREA 2CQKA 3HRMA 3FXQA 1TQPA 4PGGA 3LQRA 5E1WA 3RYPA 2DW4A 1BM9A 2YX4A 3Q9VA 3RI4A 1L0OC 3MWMA 3QRFF 3DP7A 1FZPB 2Q8KA 4EM1A 3V7RA 2E1NA 4HLXA 4HF1A 2HKOA 3JSOA 1TLHB 2HTSA 1XSVA 4HX8A 4GYIA 4LG0B 1LDKB 1LVAA 2A6HF 1KU3A 5AIQA 2IRFG 4N9IA 3RIRA 2AXLA 3K1NA 5LRRA 1I6XA 3K1PA 2K4JA 3GVAA 3CLOA 1ZARA 2Z9OA 1T2KA 1LB2A 2A68F 4PDKA 2IA1A 3FWEA 5FD5A 3QPHA 1U3EM 2OZUA 2QQBA 4BQAA 4S05A 3P9IA 1AWCA 4A12A 4R1HA 5ILVA 4U7BA 4P96A 5ICFA 1O3RA 4RAYA 4LB6B 3LAJA 3LA7A 4ON0A 5CVUA 4GYGA 2XHKA 3S2WA 3HSRA 2QLZA 4KIFA 2KJCA 4LFUA 1YYVA 3E5QA 1X3UA 3DKWA 5HDKA 1XCBA 3BWGA 3HTUA 4KN4X 1TW3A 2D2WA 3F72A 2DAOA 3F6OA 5D5VB 4UNOA 4G7ZF 3K1MA 2ISZA 4AIJA 5KK1A 1HBXG 3Q5FA 4LMYA 3F22A 1XDSA 2ZCWA 2EFQA 1R5HA 1TBXA 1YLFA 1W7PA 2FRHA 1K79A 3KP4A 3WE2A 2FBKA 5EEHA 1STZA 2VC1A 4I0AA 4HQEA 2J5OA 3LWFA 5IT3A 1Z9CA 2ZMEA 3E3VA 1J7KA 1Z6TA 3Q9SA 1HSTA 3NRVA 2F2EA 2EFNA 2IPQX 1FLIA 3ZN0A 2MLGA 4M74A 1ONVA 1R22A 4HW0A 3WTTC 4MEXF 3ECHA 1IXSB 2BBYA 3F8MA 1FBUA 2Z3YA 3TOBA 3V8JA 3HHHA 3O3KA 3WE3A 1IXRC 2P8TA 2DQRA 4M6YA 4I98B 4EJTA 2IP2A 3HRUA 2FE3A 4OIPF 2BV6A 4FX0A 1RUOA 1JE8A 2X4HA 1G3TA 2D1HA 2JTVA 1SD4A 1BJAA 1ZG1A 1OPCA 4EGYA 2COMA 5FLXZ 3OV8A 2FMYA 2GZWA 2XVCA 3BZ6A 5BOXA 3R4KA 5E1ZB 1O3TA 3W6JB 4B8XA 2W57A 1LEBA 4LB5A 4LK0F 2UXNA 3SZPA 2F5FA 3WU1B 5LHGA 2DK8A 2QENA 1KYWA 3E5XA 1HSJA 1SFXA 4PCQA 3DF8A 4BHBA 1TNTA 2M1BA 4CXFA 5F64A 2E7WA 2CW0F 2ZKZA 2PBIA 4YFNF 1H0MA 4IRHA 4AIKA 3ABTA 4RAZA 4XSZF 5FO5A 2F5DA 3KEQA 3TO7A 1U5TA 2EA2A 3MEXA 4ZYGA 3EYIA 3G73A 4Q47A 2OD5A 1R58A 4GCVA 3SZTA 4Y15A 4GO1A 1WQ2A 1S29A 2F5CA 2ISYA 2G9WA 3I59A 4MEYF 3BPVA 2O61A 3CO7C 1KA8A 1YW7A 4ENNA 4FHTA 1SMTA 2DI3A 1B4AA 1UCRA 4JK1X 1V4RA 3I71A 1FYKA 5F1RA 1BI0A 2QBYA 2XKPA 2X0LA 1ZYRF 1IZ1A 1Z1DA 2JSCA 1A04A 2XAGA 3DQVC 3GO5A 2QM3A 5K5OA 2DQLA 2BGCA 3KZZA 1VTNC 2QYOA 2ETHA 4Q48A 2ZBKA 3WTSC 2IVMA 4BHCA 4EJVA 1HKTA 2LSOA 4OMZA 1MGTA 1OYYA 3KETA 2V1UA 1O57A 3WGHA 4UHTA 4FT8A 3LA3A 1W7PB 1OYIA 2V1XA 1O7LA 1TTYA 1HXDA 2Q0OA 2RVCA 2ZMEB 3ROUA 1W4MA 2W24A 4CGZA 3ECOA 4M71A 4ZZDA 4HF2A 4MTDA 4RB3C 2UWMA 3D5LA 4EJOA 3E6CC 4S04A 1WRJA 1R5GA 1XGNA 1B6AA 3QU3A 2K27A 4O6JA 2EJRA 1LDJA 3EUHA 3F3XA 1ZGAA 3DPTA 3ISPA 4CICA 5JVTA 2V1DA 4EV0A 3BJ6A 2K7LA 2DPUA 1MKMA 3F8BA 2V9VA 4KN7X 3TO9A 2RQPA 4KMFA 3FXUA 2B0LA 3BPXA 1BOAA 3N4MA 2Q2EA 3GWZA 2E1CA 1YTYA 1IRGA 2CWEA 5F6FA 3AAFA 5EEGA 1V3FA 4XRFA 3NEUA 4ENJA 3QAHA 3E6BA 2QUFA 3J80Z 1FSEA 4WXCA 2ESNA 1SD7A 2DTRA 4A2UA 1MZBA 2CSOA 3SXYA 4EJUA 1K7AA 2M45A 3ZN1A 2PEXA 3T5XA 5DDGA 1XN7A
chains in the Genus database with same CATH superfamily
4A5NA 2DOEA 2I8DA 2OBPA 2A6EF 1K4SA 3KP2A 3B6CA 2P5KA 3OS0A 3FBIB 2BE5F 1R4MB 1NG7A 2H09A 4LLLA 2JPCA 4UY8I 1KU7A 5ERIA 4FX4A 2CS3A 3BG7A 3DEWA 2EZIA 2BXZA 3Q3SA 1SD6A 1A36A 2E1MC 2LNBA 1B8IB 1SANA 3M8EA 4KNYA 4E7IA 1X1BA 3OYBA 1FY7A 1UJ8A 4HA8A 2VB6A 5A2QK 2WADA 1U5TB 4L0YB 3G71I 2MGQA 4XRSG 4A0YA 1R36A 1X4PA 3WTXC 4A0XA 2L02A 2NVQJ 5GP9A 3PQJA 3PO3J 3P9CA 2DOFA 2QVOA 2O8KA 2W85A 3DEEA 3PFYA 3Q0WA 4CDGA 3GTMJ 4HX7A 3GTLJ 4BBRJ 1DP3A 3TW7A 3K70C 1U8BA 3A0HC 5J4VA 3CCMI 2VPLA 4UUVA 2BW3A 1RZ4A 4M3BA 1ETWA 3ASOH 1LKXA 3I59B 2VIXA 1MDMA 5F04A 1G3SA 2FNAA 3EETA 4M3FA 2IAIA 2IA0A 3T8RA 5D4RA 3DV8A 1ETYA 3GFJA 3RYRA 3PNTA 2D45A 3FZVA 1HOMA 5LHIA 4LGWA 2YR2A 3PNYA 4BY7J 4II2A 5FGMA 4AWXB 5DD4A 1U6GA 3A02A 4EVIA 1XGOA 2M9HA 1J0RA 4E7ZA 4AC0A 3WTUC 2DMTA 3VYSB 2M8GX 1QZEA 5AONA 2PQ8A 5DM7F 1I3AA 1I3QJ 4E7HA 3S16J 2DFIA 3NWTA 4IQJA 4EM2A 4A5MA 3B02A 2OTJI 1T98A 4A69C 2HVRA 5D5UB 3HKZA 5FKLA 3WU2C 3A0BC 2L5QA 4MGRA 4G8XA 3CTAA 1G4DA 4XK4A 3KEOA 4DNCA 1G8XA 1TQIA 4HOBA 5E1XA 1Z7UA 4XOTA 3ZMVA 4HLYA 2M30A 4WXHA 3HL2A 1E3HA 2CW7A 3MFKA 5LHHA 1TZLA 4KT6A 1AHDP 4AU7A 2EA4A 1HW1A 3HBLA 1MJ9A 3A01A 3IL2A 1XMAA 1TWFJ 4M9SA 1B9MA 1F36A 1X3WB 3KP7A 3HRSA 4IJAA 2HQAA 1ON1A 1K6OA 1VQ5I 1LFPA 3VFZA 1R1TA 2O8XA 2RNGA 4XLHA 1Y0UA 1SD5A 2HWVA 4RGUA 4Z2YA 1Q1HA 5JLWA 3JRFA 2ADUA 2O0YA 2NS8A 3P7NA 2R5YA 1XB4A 3QP6A 1OQYA 3V8KA 3S1NJ 1R71A 4HDUA 4BQOA 4ZC3A 3H5NA 2LY2A 2F5EA 1WJBA 3LQQA 3SEZA 2RC4A 2H1LA 1JT0A 5ILUA 1UB9A 5E79C 3KEYA 2WAFA 2JA5J 3KP6A 3K4MA 3E97A 3E5UA 2A5YB 4S0HB 1X2MA 3HKZN 2E5ZA 3GLLA 5DM6F 4I6ZA 2GXGA 1E2XA 3GZ6A 1ORKA 4LLNA 1JGSA 5J8FA 1I5ZA 1W7PD 3FHNA 3IAS2 5CJ9A 3RQIA 2XAQA 4FE7A 5TISC 2H8RA 2GAUA 4M6VA 2NVUB 2MC3A 1SFKA 4FCYA 3MZYA 5HLIA 1F4KA 4LK1F 3ZMZA 1YW8A 2QKLB 1OLTA 4ABZA 2IS1A 4X6AJ 3FXRA 4HBLA 4XLNF 1KGSA 1WI9A 3QQAA 2PLYA 2HTJA 3O8GA 3B73A 2ZNZA 4Y3OA 3WODF 2HQNA 1L3LA 3OOPA 1USSA 2EK5A 2CQ7A 3S1MJ 5DD8A 1ZHFA 3TGNA 4IHTA 1IV6A 2V1NA 2HZDA 2ZJPF 1VQ9I 2MABA 2CRGA 5IY5H 1BR2A 1U9OA 1YRNA 2LR8A 1S7AA 1KONA 2FOKA 2NVXJ 4LLGF 3E6MA 2Q2EB 3E1SA 2WB1A 2V79A 3L2CA 4GRIA 2L9VA 2VKVA 4BY1J 2L54A 1BC8C 1BW6A 1FOKA 4XLAA 5K1YA 1B72B 3H1CA 1MBKA 1Z3YA 1U78A 4LG3A 2VXZA 4U7DA 3FM5A 1J5YA 2CUZA 3PUFA 3RKWA 1GXQA 5L3FA 2VJJA 3ZMUA 3K7AJ 4J01A 2Z99A 2CFOA 4BAYA 3I0TA 1MMGA 2M8EA 4J00A 1FEXA 2R7UA 3HOSA 4PZJA 2XAUA 4PJJA 2M7BA 4MTEA 2QWWA 2XIGA 4BHPA 4BJ6C 2BEOA 3GCMA 5FFXA 3SFIA 3I56I 2DU9A 2FXAA 4UVBA 5HLTA 5K5RA 3IV5A 5B1AH 2BOLA 3CCYA 4NC8A 3M07A 3HZJA 2W4SA 4I7HA 2CV1A 3BQZA 2D5VA 5E18F 3MZ8A 3ABKH 4MFEA 1FYLA 1D3YA 4RGRA 1RNLA 2EV6A 4EJWA 5H6QA 1VF9A 4A3EJ 4WF2A 3I9V2 2STWA 2O03A 3O8HA 3G3ZA 2FF4A 2DFFA 4KT5C 2F48A 4OINF 1SFUA 2LBFB 4G6DA 3D1NI 3KCCA 2VE9A 3LSGA 4EQQA 5M3FJ 4HAMA 3IRRA 2CFXA 2WB1N 3GZ5A 1IUYA 1EJ9A 5E20A 3GEZA 4KYWA 2CUJA 2PN6A 3GYHX 3LSJA 2R7ZJ 4LJZF 3AG4H 3OYMA 3OYCA 1D0XA 2O3FA 3RQ4A 3FM3A 4KICA 4JX4A 2RV8A 1FYMA 1PP8F 1VI0A 2P6TA 2XSJC 2ELHA 1XX5A 3HOTA 3OY9A 4I76A 3VYUB 3L9FA 3PFIA 3M1EA 1T08B 3OYEA 2R7SA 2R7WA 2VOOA 4HG2A 3H5RA 5KAIC 3W3CA 3IP4B 3FXJA 5J47A 2YSRA 1TQMA 2XRNA 1IN5A 1VFCA 2QCOA 2FEZA 2HYFA 2BYVE 4HDVA 2BW3B 3JRDA 2LF8A 2JWTA 2E35A 3ABUA 5J8CA 1MDMB 3MKLA 1LQ1A 3AG1H 1Y6IA 3MD2A 4YG2F 2VOPA 2BHZA 4GFBA 5DUKA 2XPVA 4D0PA 2P7CB 3BR3A 1WCMJ 2YS9A 3ABLH 4PSXA 3IRQA 3PQKA 2Z1DA 2J5PA 3TEDA 2QQAA 2UV1A 4LOCA 3F8NA 1GT0C 3JRHA 1IRFA 3NAUA 2DA5A 4CZZA 2P5LC 3ZP5A 1SMYF 4BJ5C 1SFOJ 1IF1A 5D5WB 2GIZA 2OAZA 2FSWA 4IHYA 2EIJH 5CLSA 1CGPA 2JJ7A 2KPMA 4AVPA 1WWXA 1IRZA 1D5VA 3PM1A 1UHSA 3WTVC 1GLNA 1IN8A 1I1GA 1S7OA 2DMPA 3S14J 2MLKA 1YFHA 3GTJJ 4BNCA 5J1UA 1NH3A 1OCRH 1IXCA 1SEUA 4RM3A 3QYFA 1YE9A 4KMUX 5B66C 2BZTA 4I0BA 2VXDA 3S2HJ 5IT9K 2JMWA 1MIJA 1BW5A 5HDGA 1RR7A 1P4XA 3OYDA 1HW5A 1LPQA 3P5JA 3VB2A 4DGWB 5BS6A 4XMYA 1PUEE 3JW4A 1PP7U 1OFCX 4FE4A 1G6NA 2EILH 2JSPA 4GGGA 3A01B 1R6RA 3BP8A 5IYBJ 2WAQN 5L3EA 2M34A 5DCMA 3AG3H 3RDIA 1T38A 2A5WA 5IP7J 5DS9A 5EDNA 2YPRA 2L3DA 2CUFA 5E3MA 2FX0A 2GLOA 4F55A 2IT0A 3G1MA 3VSLA 1DDNA 4BXFA 5HLGA 1CF7A 2K9LA 2R5YB 2K40A 5IP9J 1T0FA 2MC4A 3K10A 1ODDA 1QBJA 2LOOA 5HNFA 2MH2A 2EPFA 2WTEA 1QQIA 3I53A 3N05A 4G94A 3CF5F 2ZMEC 4Y17A 1NK2P 4QPOA 4KJZA 2I10A 3BG5A 2DN0A 1NHAA 2H1KA 3DFGA 4L18B 3VODA 3DXJF 2CV2A 5E8IA 1ETKA 4ZYHA 2FA5A 3W6KB 2D1VA 4FQGA 2VBZA 1LFUP 4Y52J 1R9TJ 3WGIA 1M1EB 2IJLA 4MQ9F 3NWSA 2DOAA 1KU9A 2ACJA 3PUBA 1WJEA 2KP6A 4X1EA 1IN4A 3D5RC 5CVVA 2OV7A 1FNNA 3CC7I 4KDPA 3MCZA 3Q0VA 4R8HA 2HEOA 3AL0B 2OF7A 3D5SC 2FJ1A 1Y1VJ 4G12A 4V2GA 4V2FA 2E36A 5TJJA 1ZH5A 1ON2A 3R6SA 4XONA 1C0WA 4IO9F 2HFHA 3BCAA 3BDDA 4LIUA 3SJMA 4BDYA 1BBYA 2KDOA 3CO6C 1TT5B 2F6CA 1VQPI 1YRNB 3CCEI 4PJ0C 2NS7A 4KIBA 4DYQA 4F7ZA 2ZXWH 2LFBA 5BQTA 2ZNYA 4YRVA 2DT7B 3HSFA 3BR0A 1TNSA 4BQNA 4BKXA 4JOMA 3M9AA 5HS9A 4HYEA 2MA3A 4XQFA 2CH0A 4P5OA 2F4OB 2FNPA 3JAMK 4XSXF 2VONA 1QHHD 3E6DA 4EM0B 2VBYA 3CCLI 2M87A 1PVEA 3CUQA 3L09A 1YX5A 3H0GJ 5FJ8J 2XC7A 2DYRH 3WG7H 2Z2SB 4JP0A 1Y8QB 5J40A 2Y0MA 1W1WE 1FOYA 2LKPA 1POGA 1F43A 3TDZC 4A3IJ 3LFKA 1Z91A 1MJAA 5ICEA 4KUMA 1T56A 5D8KB 1KQ0A 3E0JB 3D0SA 3SFZA 1G3WA 2YUSA 4G6QA 4M3GA 1YHQI 3CJQB 3I58A 4RLQA 1XCVA 2EIKH 3ZOBA 2VQLA 2VJIA 3DPUA 3CCVI 4Q5SF 3EDPA 3C2BA 4C9YA 1IO2A 2XAFA 2JVHA 4HNTA 3HOZJ 5H20A 2HOEA 3IH2A 2DCEA 3FXMA 1FBSA 1IDYA 1S7EA 4IZZA 1ZRCA 3FDYA 1A6IA 1IJWC 2ZJ2A 1J2XA 3HC7A 3WU0A 2ZFWA 3DKYA 4CYDA 2DJNA 2ME0A 2VBXA 3K4CA 1Y0NA 1X1DA 2CYYA 1D5YA 1MSFC 4EATA 2LP0A 4L0ZB 4BGDA 2JRTA 2JZYA 1FX7A 1LDDA 4XLPF 2NVYJ 1JXSA 1U8RA 4HX4A 1QPIA 4KFCA 2DDBA 1EH8A 2R7TA 1U5TC 3BR5A 1EF4A 1ETVA 1YITI 4OIOF 2K02A 2X6YA 5KHDA 4F93B 4KITB 2A6TA 4JQFA 4GXOA 4ZZLA 3S17J 3X2QH 1R1UA 1BIBA 2ELJA 2HZTA 4OMYA 4XL9A 2M5WA 3S15J 4YIFA 2IS2A 5GAHJ 3UR3C 5FB2A 1XMKA 2VT2A 3JTHA 2FMLA 2VC0A 2WAEA 5CQEA 4DOZA 1W0UA 4A93J 2V4JC 3K69A 2EQRA 1KQ9A 4RGSA 5EEAA 4L5IA 1X1AA 2KRFA 2WV1A 1YIJI 2IGKA 3BG3A 5KCMA 3DBHB 3VEPA 3CESA 4AYBA 2MD0A 2GBYA 2HPIA 2VKDA 2R7XA 2JPBA 1VQOI 3JRAA 1J9IA 2CW8A 3QODA 2UUZA 1OCTC 3ZQGA 2B7EA 1P6RA 1UMQA 1N77A 5FRNA 3QYEA 3N97A 1F1ZA 1QGPA 1QZZA 2ZSIB 3G2BA 2R7DA 3OYJA 4RLFA 3KLOA 3OOUA 2LRDA 5K7HA 3LSIA 4QIWN 2QGUA 1BJZA 1QA6A 1RR8C 1YQAA 2E1OA 3RKYA 1YS7A 5D6FA 5FKMA 2VT3A 3QPTA 2IA2A 3BR1A 4JYKA 4QTRA 5TGTA 4RGXA 3CCRI 3GMEA 3BTLA 4A3BJ 4BQQA 1XTAA 3FMQA 4RB0A 3C7JA 5JHFA 1O7FA 1OMIA 2HXIA 4M73A 5CVIA 4ZYAA 1RUNA 3ZQIA 3LFUA 3DU6A 1Y56A 3J81K 2MH9A 5DCMB 3IC7A 3JTGA 3BOQA 1PJRA 3J7AY 4TV7A 4EGZA 1B9NA 2CQXA 3CF2A 3KP5A 3KYDB 3C1DA 1XGMA 1VQLI 1O4XA 2X9DA 2RQQA 2CMPA 1CF7B 2LBFA 5CVRA 4WK8F 5LFAA 1ERDA 4AYBN 4CO8A 1UHWA 3C3WA 2GM4A 3OL4A 1ZG3A 1B59A 2XV4S 2L9SA 3I4MJ 3SQNA 5IT9Z 4U0VA 1ZAOA 2DODA 1FMVA 3R60A 4FISA 4L5JA 2H8WA 2IW5A 3L7WA 4XLFA 1HKQA 4DBRA 2R7RA 3R0AA 1J75A 2P4WA 4BDZA 4N0BA 2Q1ZB 1PYVA 3OYHA 4ZDLA 2DYSH 1OCZH 2PJPA 3LNQA 1K83J 4UVAA 1LEAA 3B6AA 3CJRB 1YW9A 2V7FA 4V19K 5LGNA 3P9KA 3FXLA 3MKZA 3MAJA 4XKCA 3WHCA 1G59A 1E3PA 2X48A 2XPWA 1P4WA 1BR4A 2HVQA 4E7KA 3EUHC 1P7JA 2XGXA 2XF5A 5LBQA 2R93J 2NNYA 2W25A 4PGHA 2L4AA 5BNGA 4HF0A 3FMSA 2LVSA 3O2PE 5E3LA 2M2EA 3H36A 4B09A 3LSRA 3RZDJ 2E34A 3REOA 4A3GJ 1K4TA 3JREA 3QOPA 1P4AA 4L9NA 1K78B 2GQQA 3HM5A 3SZGA 3V8LA 2EV0A 2MD5A 3ZMDA 2KT0A 4IHVA 2OQGA 3GTOJ 2EB7A 4IF4A 1LUJB 1WKMA 4C2TA 3ZCOA 4ASNA 3FMRA 3H35A 5FLXK 4NBQA 2X1EA 2L4MA 3L2RA 2LH9A 2P6SA 4P9UA 2QZ8A 4QSHA 1X1CA 5CYVA 1WVRA 1JHHA 3L2VA 2CGPA 3WG9A 2HS5A 3CUQB 1RI7A 2KKOA 4AIDA 2NVTJ 1OR7A 4CH7A 3KIOA 4RS8A 3CDLA 2FD5A 2E7XA 2Z5UA 4D7MA 3PJRA 1JT6A 3DTEA 2JN6A 1R49A 4XKVA 2GOMA 1RESA 2CO5A 4MFDA 3W2VA 3S3MA 1V54H 2K4BA 4UV9A 3MN2A 1FBQA 5LLQA 1IUFA 4HNVA 3RJPA 3ERED 2HQ5A 1HLVA 1AKHA 1P92A 4RA2A 2L7MP 2V26A 3FX3A 3I5UA 3SDBA 4ZYDA 1K6YA 1HDDC 3F8CA 4O3MA 1WGXA 2M4KA 1Z21A 2OA4A 3S32A 5ED4A 2X6WA 2FBHA 3JAMZ 2BXYA 2W48A 2IGOA 1T6SA 5LEJA 5IOYA 3WTYC 4L9VA 1UZCA 5JR3A 2DA3A 5HDNA 4U87A 5FKOA 4RAFA 3CCSI 1ZN2A 5IP6A 2AS5F 4R79A 3FKIJ 4B4CA 1ITYA 3BQYA 4HV6A 4L9TA 3EUAA 5KAFC 2RN7A 3TOAA 5JHUA 5C44J 2XB5A 3MZHA 1UAAA 2AQEA 2EZHA 4MQVA 1KZHA 3IWZA 1OYWA 4KA4A 3OYKA 3G1OA 3HTSB 4I09A 3VPRA 4N9HA 4CCJA 4B3AA 4M3EA 4IKFA 5GAEJ 1ZLJA 2L2OA 2E1MB 3HUGA 4BBSJ 4F92B 3HYIA 1QZYA 4A3FJ 1I50J 2OUMA 1WJFA 1W5SA 1W5CC 5ICGA 4DIQA 1T39A 1ZKGA 2TCTA 3HPGA 1RIOH 1OCPA 4I99C 4F91B 5CKTA 1BI3A 1LFBA 1QHGA 1VQ4I 5DEQA 4RBOA 1O3QA 4IHXA 3ZPLA 2NRAC 4UUTA 2EFWA 1KQ8A 3OYFA 3M8FA 1FT9A 4BE1A 3E7LA 1ACIA 2L9NA 2VJ4A 3EYYA 2A61A 4H4KC 4B44A 2BY2A 2NYXA 5HS8A 4IHSA 2ZXIA 3EQLF 3FF5A 3VYRB 1WSUA 2YU9J 2BVMA 1BC7C 1MSEC 2K5CA 3GFMA 5C4JJ 2LG4A 3H9GA 4QWQA 4NHJA 2ELKA 3FK6A 5JI6A 3IWFA 1R5ID 3FHZA 3PNVA 1CQTA 1QPMA 3K4JA 2PMHA 3JR9A 1FP2A 4OWRB 2V6CA 3GXOA 4RB1A 1YJWI 5LGTA 3VSKA 3WTZA 4PSWA 3KFWX 3HRTA 4UVCA 2L01A 5JLXA 2EINH 4RB2C 4Q4ZF 4ENMA 1IN6A 3HEFA 3KZYA 2BHYA 2B9SA 2A07F 4RDUA 1NTCA 2DA2A 1W36C 4L5EA 1FOWA 4DQ2A 1TWCJ 3LAPA 1FMWA 1XD7A 5FROA 1TC3C 3UNGC 1JKRC 4HQMA 2JVGA 1SAXA 3DBLB 3KLNA 2Y0SA 3U21A 4XKWA 1JKPC 2F4MB 3V7SA 5L3GA 2RDPA 1P9QC 2BY3A 3WHBA 1QO0D 1FSHA 3QU6A 2PFBA 1X3ZB 3BJOA 3LSKA 5K5QA 1Z77A 3DU5A 5GTHC 4ZYEA 2W1OA 4YFXF 1E3OC 2H6BA 5DCFA 3GW2A 2G7HA 3IAM2 3KP3A 3KPHA 2FUG2 4NDLA 2HDWA 2X6OA 4JBAA 1IGNA 2Y9YA 2LC2A 3LL7A 4DJAA 5GADJ 1X4OA 2ZC2A 3DTKA 5GTIC 3CCUI 1ZGJA 4EMSA 2F5VA 2Y2ZA 1BA5A 1MH3A 3S1QJ 5KVRA 2LMDA 2ZO4A 3OWTA 1MNEA 4P55A 3J81Z 2X6XA 1OISA 2HGCA 1ETOA 2N8GA 2KIUA 5LGUA 2MG4A 1FIAA 4LD5A 2PMZA 5F08A 3TBIA 4H0EA 2MYSA 3DLAA 1ETQA 2H27A 2P0WA 2ZSHB 4ESFA 1DUXC 3J7AO 3ZXSA 3AL0C 2AXTC 2VE8A 2HR3A 3T8TA 2VODA 2CUEA 2XKOA 3CUOA 1HF0A 2DA6A 3L2WA 2V6EA 2GOXB 3ABMH 2HVSA 1WZ2A 4AM3A 4UXNA 3TKYA 2CJJA 1X19A 3FK7A 2Y0SN 5B5EC 4A6DA 3L2QA 2WWYA 5A2QZ 4WXDA 3R61A 3U2RA 4Y7NJ 3L00A 5ICCA 5L3BA 3F21A 2KRCA 2QKMB 3M7GA 2NAZA 1A35A 2KZGA 1VZ0A 5FLVA 3OS2A 3AG2H 1BI1A 2C6YA 1IG7A 4ZH4F 1K61A 3BROA 3H9QA 2DT5A 2NXNB 3GLXA 3J80K 1F5TA 1R7JA 2OQRA 3GX4X 3H92A 4IVNA 4GDFA 3RKXA 3ZMSA 1VQ8I 1IAWA 1ZRFA 4HZFA 2WC2A 3OIOA 5HODA 5DUIA 3LSPA 3ZQ7A 2JA2A 2FU4A 2V9KA 4U0WA 4NB5A 2CQQA 2VN2A 3CC4I 4MNUA 1HQCA 1ZRDA 4WCGA 2O5RA 3T0YA 3CJTB 3G4SI 1EH7A 1MD0A 1Z7LA 2H94A 3MQ0A 4BH9A 4D5FA 4G7HF 5HVQC 3QWLA 3CD6I 4ENKA 2IEKA 2NNNA 1AKHB 2AHQA 1FWZA 4B1RA 3SEQA 3GTGJ 2XSDC 1E17A 2JT1A 4U0YA 3GFIA 1IV8A 3DWLE 2P7VB 1Y8RB 3A4CA 4RAGA 3S1RJ 3TDUC 3H3UA 1WHUA 4I02A 1ZTRA 2K85A 1S72I 2LTPA 5CVJA 3J7ZI 1H9GA 3HXLA 2DO7A 2EFOA 1NK3P 1B1BA 4A3KJ 1UFMA 4FETA 1H8AC 1FPQA 5JVGF 3TP3A 3OYNA 2GA2A 3JRIA 4P9FA 2A69F 2HKXA 1QRYA 2Y75A 2QSHX 1SC7A 3WTWC 3HDDA 1R1VA 1D8JA 1WJDA 1MBJA 2R3SA 3SYTA 2OCEA 1D0YA 2PMUA 3CZ6A 4U88A 1HC8A 3HUGB 1DPUA 5IOZA 4PK4A 2L9RA 3OMYA 1DP7P 1I39A 4XKBA 5B1BH 3W2AA 1AOYA 3IHUA 3RPQA 3TQNA 1F9NA 2UZKA 1H9TA 5EG0A 5J1YA 1H88C 2DXIA 5L3DA 3HIFA 5BPDA 3V4GA 5E17F 1LJ9A 1GVJA 1HCRA 1BR1A 4Y4RA 2R7FA 4IRIA 1HKSA 4YIIA 4E70A 1XGSA 4NQWA 1K78A 1MJBA 5D5XB 3CJNA 2WBMA 3QP5A 2XF7A 3CDHA 3CQZJ 3F0CA 5EGOA 4C2UA 4YFKF 1YIOA 1A6QA 4IQ4A 2LF7A 1DPRA 1QVTA 2XGDA 2XB0X 3O6BB 2XGCA 2ZJQF 4B43A 2RGVA 4IPAA 2DPDA 2Y48A 1JUMA 2HNHA 3ULQB 2K86A 1W5TA 2CG4A 4CZCA 4WWCA 1XDUA 4AD9A 2RNJA 3UKGA 5FD6A 3SHFA 1I1SA 1V55H 3BG9A 3CMMA 4J19A 1ZLKA 2DK5A 2YU3A 3PSFA 3HJEA 2DTZA 4A0ZA 3HGGA 4DW6A 2MW8A 3KE2A 1D1BA 5F1JA 1TT0A 4OIRF 2G7UA 3FIWA 1R4NB 2EWNA 4ESJA 3JRCA 3F23A 4PJLA 1D1CA 1JUSA 3PL8A 2VASA 4D1QA 3GF2A 2XASA 1Z05A 3M4OJ 1Q1VA 1MNDA 1HW2A 3GTKJ 4CSWA 2VQHA 1IN7A 3TW6A 3PIPF 2XGEA 4HSRA 3BLYA 4HV5A 2PG4A 4ANJA 3DKXA 3HSEA 3ONQA 5EYRA 3IH3A 1MMSA 5LEKA 4OU0A 4PJMA 5BMZA 1DQUA 1U2WA 5M5XJ 3ASNH 5AIPA 4IXAA 1YJ9I 4XLCA 1OCOH 2HXOA 2FQ3A 3K4LA 2QSGX 3R0JA 2DMQA 3IUOA 1YS6A 1T0FC 1LNWA 2KIFA 2FBIA 1R23A 4Y13A 4WX9A 3H3ZA 4NC7A 2P81A 2GXBA 3L2UA 4M6XA 1TW2A 3QPSA 3DCFA 2ID3A 3PIOF 3G1LA 3ZQQA 5E8GA 4IX7A 3ZQFA 4I2OA 1RPWA 4I01A 1P2FA 4NNJA 2OJED 4LIVA 4LG0A 1VNDA 5DV5A 3F6VA 3K2ZA 1IW7F 1S6LA 2JUGA 4OAZA 3IH4A 3S3NA 1MH4A 2X51A 1MNMC 5FFZA 5D4SA 1JTYA 3MMYB 2ESHA 2A3SA 5EZHA 2GWRA 5LRSA 3OYLA 2ZJRF 3KX2A 1DU0A 3GFLA 1JJ6C 2XAHA 5DYMA 5FKNA 3OIQA 4E6KG 3I64A 4ZDPA 4QPQA 4MO7A 1BOBA 1KU2A 4UV8A 3U1KA 3ELKA 2PX9A 2OZ6A 5FLMJ 1SVOA 1VQKI 3ZMTA 1RKWA 2COBA 2KQRA 1UHMA 2M3AA 4CHUA 4AIHA 3CLQA 2HI3A 3VDXA 4PFOA 2BY1A 1WJAA 2JA7J 1AA7A 2M7AA 2HYGD 3BJAA 3S93A 3V7CA 2YX7A 5GPAA 2ICWG 2NOGA 2XDVA 5J6XA 3COAC 3K4NA 4G9YA 4IRGA 1EV7A 3BZCA 4MHGA 5L3CA 1USTA 5KNLA 5H6RA 1A31A 3HG9A 1DGRM 4Y33A 1IC8A 2STTA 1Y1WJ 3KZIC 2EZKA 5D8LB 1YG2A 4XBFA 3C18A 5HOOA 2GA1A 3U1DA 3CUQC 3VOEA 1ZK8A 2A05A 3BY6A 5IYDJ 2KJBA 2MSYA 3F8FA 4DBQA 4AVZA 1QVUA 2VQCA 3ERMA 4FTHA 3H5AA 1BIAA 2QF7A 3K9TA 1SFEA 1GV5A 2K9MA 4C30A 4F52A 4OOIA 1KYZA 1JHFA 2BY0A 2VQGA 2TDXA 1I27A 4XORA 3IKVA 4A6EA 1ZG5A 1T33A 4BXUA 2VBWA 1OKRA 4ITVA 4M9ZA 1PDNC 5E3OA 3LA2A 3BG6A 5TRDA 4K2EA 4MLOA 2WV0A 3MKWB 1JTXA 2H6CA 3DBRB 3OR2C 1XSXA 2X85A 4ESBA 2DDAA 1FP1D 1WJ5A 2UXXA 4E7JA 1W36D 2K3FA 3OSFA 1W0TA 4BUPA 2ECCA 3DPLC 3MKYB 2FOWA 4A3JJ 3RTRA 1D8KA 4XOPA 2Z33A 2OTLI 1MMNA 2W84A 2MFZA 1LE8A 4BEHA 2ME6A 3RPUA 3RSNA 3K6GA 2E2HJ 2XUBA 3LSMA 3ML6A 5HNHA 2OU2A 3LSTA 1Z3XA 2RREA 4M72A 3HOXJ 2HDCA 1R00A 2HU9A 2DBBA 4L9JA 3ZQHA 2LDUA 3I54A 3RZOJ 2E5NA 2P5VA 4X0GA 5ILSA 1EKEA 2R5ZA 4F3QA 5EG0B 3JSPA 2IS6A 1O3SA 1YO5C 2EFPA 2EV5A 4IEJA 5DTDA 2W7NA 2LY9A 2DLLA 2DFHA 3HHGA 1ULYA 3BTCA 2O6GE 2K3PA 2NS0A 4ETSA 3ZR8X 1D1AA 5HLHA 4NQWB 3HOUJ 2LY1A 2DA1A 1XSDA 2MBFA 2XROA 1IDZA 2F4IA 4DZJA 1WPKA 5EGOB 2GIVA 1Z6RA 3GUDA 1T95A 1EH6A 5EF6A 3OL3A 2ZXHA 2QQ9A 3DEUA 4XM3A 1BI2A 3TO6A 2KISA 2GXAA 3T1BA 4N4NB 1PUFA 3U9GA 5H2FC 3WGGA 1GHCA 1WFXA 1VQ7I 3K0LA 3FXKA 5BPIA 1VQMI 5HS7A 3NQOA 4NC6A 1BN5A 1GXPA 4M9XA 6PAXA 4QLCU 1REPC 5J3LA 1SVLA 2ZB9A 3I4PA 1J59A 1YI2I 5D6EA 4G7OF 1S8NA 1S3JA 2ZXJA 3TMOA 4OIQF 1S5LC 3IKTA 1FC3A 2QBYB 2JA8J 4XLEA 2HQRA 3LOCA 4HNUA 1MMDA 1V5EA 2XAJA 2ZFUA 2E71A 1QNTA 1G3YA 4KIGA 2PI0A 2IGMA 5JFRA 1ZR2A 2RKHA 4O5VA 3OR1C 4C3JJ 4BYYA 2KIMA 1ZREA 2CQKA 2L7ZA 3HRMA 3FXQA 1ENHA 1TQPA 4CCKA 4PGGA 2EIMH 3OYGA 4KISA 3LQRA 5E1WA 3MVPA 4BS9A 4NUBA 2DW4A 3RYPA 1BM9A 1I6HJ 2YX4A 3G6EI 5M5WJ 3Q9VA 1UG0A 4A3MJ 3CCQI 3RI4A 2Z16A 1L0OC 3MWMA 3QRFF 3DP7A 3M1CA 3PSIA 3BCBA 1FZPB 5F0HA 2Q8KA 4EM1A 3V7RA 3FBNB 2E1NA 3EPZA 2IGNA 4HLXA 1G2HA 4BE0A 4HF1A 2R92J 3ZRGA 2HKOA 3JSOA 1TLHB 2HTSA 1XSVA 4HX8A 2KIQA 4GYIA 1LDKB 4LG0B 3CP8A 1LVAA 2DA4A 2A6HF 3BR2A 3QOEA 1BL0A 1KU3A 5AIQA 2IRFG 4N9IA 2DMNA 3RIRA 2AXLA 1TWGJ 3K1NA 3OS1A 1JJ8C 5LRRA 1I6XA 3K1PA 2K4JA 3CLOA 3FISA 3GVAA 4XNFA 2KL4A 1ZARA 2R0QC 2Z9OA 1T2KA 1LB2A 3FXOA 2A68F 4BU2A 5C4XJ 4PDKA 1IRXA 2IA1A 3FWEA 5FD5A 3QPHA 1U3EM 2B63J 2OZUA 3AKZA 1AU7A 3PO2J 2QQBA 1GDTA 4BQAA 2LK2A 3C2GA 3KYLA 4S05A 3P9IA 2R4GA 1AWCA 4A12A 4R1HA 5ILVA 5IYCJ 2KZVA 4XR6A 4U7BA 4E7LA 3ESWB 4P96A 5ICFA 3CMYA 1O3RA 2E2IJ 1XS9A 4RAYA 4LB6B 3LAJA 2JK3A 3LA7A 4D5CA 2KHMA 4ON0A 3CP2A 2BVLA 1UELB 3GBGA 5CVUA 4GYGA 1A5JA 2XHKA 1OR7C 4II3A 2LKSA 3S2WA 3HOWJ 3BZKA 1Z0XA 5EZGA 3HSRA 2QLZA 4KIFA 1MW7A 5CQGA 1TWHJ 2M0CA 2KJCA 4LFUA 1YYVA 1GV2A 3E5QA 1X3UA 3DKWA 2WA0A 5HDKA 1XCBA 3BWGA 2OC6A 1Z67A 3HTUA 2QSFX 4KN4X 1ZQ3P 1TW3A 2D2WA 3F72A 2DAOA 3F6OA 2HOSA 5D5VB 2WY8Q 2VKEA 1RC9A 2VKHA 4UB6C 4UNOA 4G7ZF 3K1MA 4C2MJ 2VJ5A 2W82A 2ISZA 4AIJA 5F27A 2VLAA 3H3VK 5KK1A 4DZPA 1HBXG 3Q5FA 4LMYA 3F22A 1N75A 1XDSA 1U9NA 4C3IJ 2LLKA 2ZCWA 2EFQA 4UUSA 3J7YJ 1R5HA 4RM2A 2HDDA 1TBXA 1YLFA 1ZGWA 4AUXA 1W7PA 2FRHA 2VL8A 1K79A 3KP4A 3WE2A 4B3XA 1V5FA 2FBKA 5EEHA 1STZA 2VC1A 4I0AA 4HQEA 1GUUA 2J5OA 1LE8B 4BEHB 2Y31A 3C2HA 3LWFA 2DFEA 5IT3A 5FRMA 3I3LA 2ZMEA 1Z9CA 3E3VA 1J7KA 2FQ4A 1Z6TA 1TL8A 2L0KA 2OPTA 3Q9SA 3S3OA 3GTQJ 1HSTA 2K9NA 4BJTA 3NRVA 1SVMA 2F2EA 2EFNA 2IPQX 2R5ZB 1Y39A 3ZN0A 2MLGA 4M74A 1FLIA 1ONVA 1R22A 2KLOA 4HW0A 3WTTC 5LD2C 3ZQLA 4MEXF 3ECHA 2LD5A 3QYBA 4ZTFA 3FKJA 1IXSB 1T8IA 2BBYA 3GZNB 1X2NA 3F8MA 3NARA 1FBUA 3A03A 4IL6C 4XICA 1JKQC 2Z3YA 3TOBA 1MBHA 1H89C 3V8JA 3TP0A 3HHHA 3O3KA 1RETA 3WE3A 2IXSA 4CYCA 1LVKA 1PUFB 2EH3A 1IXRC 2HYJA 2DQRA 2P8TA 2WAQA 4M6YA 4PUSA 4I98B 4EJTA 3LMMA 4D7NA 2G0EA 2IP2A 4RMNA 4G6TB 3HRUA 2FE3A 4P1WA 4BL0B 4OIPF 2BV6A 4FX0A 1RUOA 4E7SA 2PJRA 4ZJZA 1JE8A 2VUMJ 1ZR4A 2X4HA 2KFDA 1G3TA 2D1HA 3BR6A 2KDZA 2JTVA 3HGYA 1JGGA 1SD4A 2CU7A 2PMZN 3HOVJ 4IHWA 1BJAA 1XC5A 4BACA 1ZG1A 1XMXA 1OPCA 2X1DA 4EGYA 1YX3A 2COMA 4A3LJ 2TRTA 1N78A 5FLXZ 3OV8A 4C3HJ 2FMYA 2GZWA 3KYCB 1HA8A 1U0JA 2ID6A 2LYCA 2XVCA 3BZ6A 5BOXA 3R4KA 5E1ZB 1O3TA 3W6JB 4B8XA 4ZTJA 2EBIA 2K9SA 4N4OB 5IPAA 2W57A 1MBFA 3HB9A 5J4YA 4ZDOA 1LEBA 4LB5A 4LK0F 2UXNA 3SZPA 2M4GA 3OYIA 2VI6A 3M3YJ 2F5FA 1VQNI 1QU3A 3WU1B 5LHGA 2XPUA 2DK8A 3OSGA 2QENA 1D0ZA 4YEJA 3RCOA 1KYWA 3E5XA 1HSJA 1SFXA 4PCQA 3DF8A 4BHBA 4UB8C 3ZQCA 1N25A 1TNTA 2M1BA 4W97A 3CMEI 4CXFA 2ECBA 2VPRA 2AQFA 1OCCH 1WJCA 2JRMA 5F64A 2E7WA 2CW0F 2ZKZA 2PBIA 3OYAA 1P7IA 4CCNA 4JX6A 4YFNF 1H0MA 3DLLF 2DJIA 4IRHA 4AIKA 4MIMA 3W6VA 3ABTA 1B8IA 4YELA 5EJCA 3CC2I 4M3DA 4JX5A 4RAZA 1X1PA 4XSZF 2DMUA 2HPMA 2QA4I 2W00A 5FO5A 2F5DA 3KEQA 3TO7A 2JA6J 4CCOA 3CDIA 2DT6A 3L1PA 2I5UA 1U5TA 2EA2A 2IBDA 3MEXA 5CPRB 4ZYGA 2E60A 2E2JJ 2M0MA 3EYIA 3G73A 4Q47A 3F9KA 4PJNA 2Y30A 5GAGJ 3AFHA 3BTIA 3DTIA 4IOAF 1HDPA 3CMAI 2OD5A 3A2KA 1FTTA 2DA7A 1R58A 4GCVA 3SZTA 1JUPA 3JCUC 4Y15A 4GO1A 1WQ2A 1S29A 2F5CA 1WI3A 4D9JA 2ISYA 5M5YJ 1MBEA 1J09A 4CCMA 2G9WA 3I59A 4XRSA 3BTJA 4MEYF 2JQ7A 3BPVA 2O61A 1ZELA 2KMUA 4W1UA 3CO7C 1KA8A 3ZGKA 1YW7A 3S8PA 4ENNA 4FHTA 1SMTA 2DI3A 2HOTA 1B4AA 5C3EJ 1UCRA 3OIPA 4JK1X 3VYTB 1V4RA 3BT9A 1V5GA 3I71A 2WY7Q 1FYKA 3HOYJ 2L7KA 1BI0A 5F1RA 2CV0A 2QBYA 2XKPA 3JRGA 9ANTA 1APLC 3K70D 2X0LA 1ZYRF 1IZ1A 3I55I 1Z1DA 2JSCA 1A04A 1X58A 2XAGA 3DQVC 3GO5A 2QM3A 1MMAA 5K5OA 1S9HA 2DQLA 4BE2A 2BGCA 3KZZA 1VTNC 2QYOA 2ETHA 4Q48A 2ZBKA 3WTSC 2IVMA 3S2DJ 2R7OA 3GTPJ 2HOAA 3H0DA 4BHCA 4XIDA 4EJVA 1HKTA 2LSOA 4OMZA 1MGTA 1OYYA 3RKQA 3KETA 1WH5A 2V1UA 1O57A 1GVDA 3WGHA 4UHTA 4FT8A 4UUSB 1DU6A 1JKOC 3LA3A 1W7PB 1OYIA 2JUCA 2V1XA 1O7LA 4IOCF 4B48A 1TTYA 3K2AA 2O9LA 1SAUA 1HXDA 1XPXA 2Q0OA 4HSTA 4CA0A 2RVCA 2ZMEB 3ROUA 1W4MA 2W24A 3QPLA 1RRJA 4CGZA 4YIRX 2QEXI 1RKTA 3ECOA 2EZLA 2R7QA 4M71A 4ZZDA 4HEA2 4HF2A 4MTDA 4RB3C 2UWMA 1NG6A 3Q0UA 1OJLA 5E3NA 3D5LA 4EJOA 2E19A 1TP4A 4DYRA 3E6CC 1VQ6I 4Z6YA 1XG1A 1WRJA 1R5GA 4S04A 2V9PA 1XGNA 1B6AA 3QU3A 2K27A 4O6JA 4PFPA 4CCLA 2IS4A 2AO9A 2EJRA 5B3SH 1LDJA 3EUHA 3F3XA 1ZGAA 3DPTA 5FKKA 1ETXA 3H9JA 4A3DJ 3ISPA 4CICA 3RPUD 4XN0A 3K4KA 5JVTA 4BXXJ 2LKXA 2V1DA 4CYCB 4EV0A 1EA3A 3BJ6A 4FASD 3VWBA 2K7LA 2DPUA 5F0CA 1E0EA 1MKMA 3F8BA 4HRIA 1FOXA 2V9VA 3M8JA 2XRLA 4KN7X 5M3MJ 3TO9A 1WH7A 2RQPA 3EUKL 1UG2A 4KMFA 3K4BA 3FXUA 2RAEA 2B0LA 3BPXA 1BOAA 2PJRB 3N4MA 1YOVB 2Q2EA 3GWZA 1YJNI 2E1CA 1YTYA 2XF6A 1IRGA 3HPHA 2CWEA 2CQNA 3JRBA 5F6FA 3W2WA 2LREA 2Y9ZA 3TL4X 3V42A 3AAFA 3A1YA 1B72A 1JI8A 5EEGA 2Y69H 1TWAJ 1V3FA 4XRFA 4XN3A 2X1CA 1FJLA 3NEUA 4ENJA 3QAHA 2NOJB 2L7FP 3E6BA 2O7OA 2QUFA 1MBGA 2K9QA 3J80Z 4HPQA 5K7FA 1FSEA 4LITA 4WXCA 4A3CJ 2ESNA 3I4NJ 1SD7A 2DTRA 4A2UA 5J1RA 5GPCA 1DGWY 4XRMA 5F0FA 1MZBA 2CSOA 4OAYA 2QQ8A 3SXYA 3LSHA 4B47A 2KRHA 4EJUA 1K7AA 2M45A 3CCJI 3ZN1A 2R7VA 4E4HA 2PEXA 4CUGA 1FIPA 3T5XA 4DYCA 2OCCH 5K7ZA 3BC8A 5DDGA 1FTZA 4EEFG 3SDGA 1XN7A
chains in the Genus database with same CATH topology
4A5NA 2OBPA 2A6EF 3KP2A 2P5KA 2BE5F 2H09A 4LLLA 2JPCA 1KU7A 5ERIA 4FX4A 1SD6A 2LNBA 3M8EA 4KNYA 1FY7A 4HA8A 5A2QK 1U5TB 4L0YB 4A0YA 1R36A 3WTXC 4A0XA 2L02A 3PQJA 3P9CA 2QVOA 2W85A 4CDGA 4HX7A 4UUVA 1RZ4A 3I59B 1MDMA 1G3SA 2FNAA 3EETA 3T8RA 2IA0A 5D4RA 3DV8A 3GFJA 3RYRA 2D45A 3FZVA 5LHIA 4LGWA 2YR2A 5FGMA 4AWXB 5DD4A 1U6GA 4EVIA 1XGOA 1J0RA 3WTUC 5AONA 2PQ8A 2DFIA 4EM2A 4A5MA 3B02A 1T98A 5D5UB 4MGRA 4G8XA 3CTAA 1G4DA 3KEOA 4DNCA 1TQIA 4HOBA 5E1XA 1Z7UA 3ZMVA 4HLYA 2M30A 4WXHA 3MFKA 5LHHA 2EA4A 1HW1A 1MJ9A 3IL2A 1XMAA 4M9SA 1B9MA 3KP7A 3HRSA 4IJAA 1ON1A 1K6OA 3VFZA 1R1TA 2O8XA 1Y0UA 1SD5A 2HWVA 4RGUA 4Z2YA 1Q1HA 2ADUA 2O0YA 3P7NA 1XB4A 3QP6A 3V8KA 4HDUA 2F5EA 3LQQA 2RC4A 5ILUA 1UB9A 3KP6A 3E97A 3E5UA 2A5YB 2GXGA 1E2XA 3GZ6A 4LLNA 1JGSA 5J8FA 1I5ZA 1W7PD 5CJ9A 2XAQA 2GAUA 2MC3A 3MZYA 5HLIA 1F4KA 4LK1F 3ZMZA 1YW8A 3FXRA 4HBLA 4XLNF 1KGSA 1WI9A 2PLYA 2HTJA 3B73A 2ZNZA 3WODF 2HQNA 1L3LA 3OOPA 1USSA 2EK5A 5DD8A 1ZHFA 3TGNA 4IHTA 1S7AA 2FOKA 4LLGF 3E6MA 2V79A 3L2CA 2L54A 1BC8C 1FOKA 5K1YA 1U78A 2VXZA 4U7DA 3FM5A 1J5YA 3RKWA 1GXQA 5L3FA 3ZMUA 2Z99A 4BAYA 3I0TA 2M8EA 3HOSA 4PZJA 4MTEA 4BHPA 2QWWA 2XIGA 2BEOA 5FFXA 2DU9A 2FXAA 4UVBA 5K5RA 4I7HA 5E18F 1FYLA 1D3YA 4RGRA 1RNLA 2EV6A 4EJWA 5H6QA 4WF2A 2STWA 2O03A 3G3ZA 2FF4A 4KT5C 4OINF 1SFUA 4G6DA 2VE9A 3KCCA 4EQQA 4HAMA 3IRRA 2CFXA 3GZ5A 1IUYA 5E20A 3GEZA 4KYWA 2PN6A 3GYHX 4LJZF 2O3FA 3FM3A 4KICA 2RV8A 1FYMA 1PP8F 2P6TA 2ELHA 3HOTA 3L9FA 3PFIA 3M1EA 2VOOA 2YSRA 1TQMA 2XRNA 1IN5A 2FEZA 2HYFA 2BYVE 4HDVA 2LF8A 3ABUA 5J8CA 1MDMB 1LQ1A 4YG2F 2VOPA 5DUKA 4D0PA 2P7CB 3IRQA 3PQKA 2J5PA 2QQAA 3F8NA 1IRFA 4CZZA 2P5LC 3ZP5A 1SMYF 1IF1A 5D5WB 2OAZA 2FSWA 5CLSA 1CGPA 4AVPA 1WWXA 1D5VA 3WTVC 1IN8A 1I1GA 1S7OA 2MLKA 1YFHA 4BNCA 1IXCA 4KMUX 4I0BA 5IT9K 5HDGA 1P4XA 1HW5A 3VB2A 5BS6A 1PUEE 3JW4A 1PP7U 1G6NA 4GGGA 3BP8A 5L3EA 5DCMA 1T38A 3RDIA 2YPRA 2L3DA 2IT0A 1DDNA 5HLGA 1CF7A 1T0FA 1ODDA 1QBJA 2MH2A 2WTEA 1QQIA 3I53A 4G94A 4Y17A 1NHAA 4L18B 3DFGA 3VODA 3DXJF 5E8IA 4ZYHA 2FA5A 3W6KB 2D1VA 2VBZA 3WGIA 2IJLA 4MQ9F 2ACJA 1KU9A 1IN4A 5CVVA 1FNNA 4KDPA 3MCZA 4R8HA 2HEOA 5TJJA 1ZH5A 1ON2A 3R6SA 1C0WA 2HFHA 3BDDA 1BBYA 3CO6C 4KIBA 4F7ZA 5BQTA 2ZNYA 3HSFA 1TNSA 3M9AA 5HS9A 4HYEA 2MA3A 4P5OA 2FNPA 3JAMK 2VONA 4XSXF 3E6DA 4EM0B 2VBYA 2M87A 3CUQA 3L09A 2Y0MA 2LKPA 3TDZC 3LFKA 1Z91A 1MJAA 5ICEA 4KUMA 5D8KB 1KQ0A 3D0SA 3SFZA 1G3WA 4G6QA 3I58A 1XCVA 4Q5SF 3EDPA 2XAFA 5H20A 2HOEA 1FBSA 1ZRCA 2ZJ2A 1J2XA 3WU0A 2ZFWA 4CYDA 2VBXA 2CYYA 4L0ZB 2JRTA 2JZYA 1FX7A 1LDDA 4XLPF 1JXSA 1U8RA 4HX4A 4KFCA 1EH8A 1U5TC 4OIOF 2K02A 4JQFA 4GXOA 4ZZLA 1R1UA 1BIBA 2HZTA 4OMYA 2M5WA 4YIFA 5FB2A 1XMKA 2VT2A 3JTHA 2FMLA 2VC0A 3K69A 4RGSA 1KQ9A 4L5IA 2KRFA 3VEPA 2JPBA 1J9IA 1P6RA 3N97A 1F1ZA 1QGPA 1QZZA 2R7DA 3KLOA 1YQAA 3RKYA 1YS7A 5D6FA 2VT3A 3QPTA 2IA2A 4RGXA 3FMQA 4RB0A 3C7JA 1O7FA 1OMIA 5CVIA 4M73A 1RUNA 3J81K 2MH9A 5DCMB 3IC7A 3JTGA 3BOQA 4TV7A 4EGZA 1B9NA 3KP5A 3C1DA 1XGMA 1CF7B 5CVRA 4WK8F 4CO8A 1UHWA 3C3WA 1ZG3A 1B59A 2XV4S 3SQNA 5IT9Z 4U0VA 1ZAOA 3R60A 4L5JA 2IW5A 3L7WA 1HKQA 3R0AA 1J75A 2P4WA 4N0BA 2PJPA 4UVAA 1LEAA 1YW9A 5LGNA 3P9KA 3MAJA 1P4WA 2XGXA 5LBQA 2NNYA 2W25A 4PGHA 2L4AA 4HF0A 3FMSA 3O2PE 4B09A 3REOA 3QOPA 1P4AA 4L9NA 1K78B 2GQQA 3V8LA 2EV0A 2MD5A 3ZMDA 2OQGA 2EB7A 4IF4A 1WKMA 4ASNA 3FMRA 5FLXK 2L4MA 2P6SA 4P9UA 2QZ8A 5CYVA 1JHHA 2CGPA 3WG9A 2HS5A 3CUQB 1RI7A 2KKOA 1OR7A 4RS8A 2E7XA 2Z5UA 2CO5A 2K4BA 4UV9A 1FBQA 5LLQA 3RJPA 3ERED 1P92A 3FX3A 3I5UA 4ZYDA 3F8CA 4O3MA 2OA4A 5ED4A 2FBHA 3JAMZ 5LEJA 1T6SA 3WTYC 4L9VA 5JR3A 5HDNA 1ZN2A 2AS5F 4R79A 4HV6A 4L9TA 2RN7A 3TOAA 5JHUA 3MZHA 4MQVA 3IWZA 1OYWA 4KA4A 3HTSB 4I09A 4N9HA 1ZLJA 3HUGA 3HYIA 1QZYA 1W5SA 5ICGA 1T39A 1RIOH 1BI3A 5DEQA 1O3QA 3ZPLA 2NRAC 2EFWA 1KQ8A 3M8FA 1FT9A 3EYYA 2A61A 2NYXA 5HS8A 4IHSA 3EQLF 3FF5A 1WSUA 1BC7C 3GFMA 4QWQA 4NHJA 5JI6A 3IWFA 3FHZA 1QPMA 2PMHA 1FP2A 2V6CA 3GXOA 4RB1A 5LGTA 3WTZA 3KFWX 3HRTA 4UVCA 2L01A 4RB2C 4Q4ZF 4ENMA 1IN6A 3KZYA 2A07F 4DQ2A 3LAPA 1XD7A 4HQMA 1SAXA 3KLNA 3V7SA 5L3GA 2RDPA 1QO0D 1FSHA 3QU6A 2PFBA 3BJOA 5K5QA 4ZYEA 4YFXF 2H6BA 5DCFA 3GW2A 2G7HA 3KP3A 4JBAA 1ZGJA 4EMSA 5KVRA 2ZO4A 4P55A 3J81Z 2HGCA 2KIUA 5LGUA 4LD5A 4H0EA 2H27A 4ESFA 1DUXC 3J7AO 2VE8A 2HR3A 3T8TA 2VODA 2XKOA 3CUOA 4UXNA 3TKYA 4A6DA 2WWYA 5A2QZ 4WXDA 3R61A 3U2RA 3L00A 5ICCA 5L3BA 3F21A 3M7GA 2NAZA 1BI1A 2C6YA 4ZH4F 3BROA 2DT5A 3GLXA 3J80K 1F5TA 1R7JA 2OQRA 3GX4X 3H92A 4IVNA 3RKXA 3ZMSA 1IAWA 1ZRFA 4HZFA 2WC2A 5DUIA 3ZQ7A 2FU4A 4U0WA 4NB5A 2VN2A 4MNUA 1HQCA 1ZRDA 4WCGA 3T0YA 1EH7A 1MD0A 2H94A 3MQ0A 4BH9A 4G7HF 5HVQC 4ENKA 2NNNA 1FWZA 1E17A 2JT1A 4U0YA 3GFIA 2P7VB 3TDUC 3H3UA 4I02A 5CVJA 1H9GA 2DO7A 2EFOA 1B1BA 1UFMA 1FPQA 2GA2A 4P9FA 2A69F 2HKXA 2Y75A 3WTWC 1R1VA 1D8JA 2R3SA 2PMUA 4U88A 1DPUA 1DP7P 1AOYA 3IHUA 3RPQA 3TQNA 1F9NA 2UZKA 1H9TA 5L3DA 3HIFA 5BPDA 3V4GA 5E17F 1LJ9A 1GVJA 2R7FA 4IRIA 1HKSA 4YIIA 4E70A 1XGSA 4NQWA 1K78A 1MJBA 5D5XB 3CJNA 3QP5A 3CDHA 4YFKF 1YIOA 2LF7A 1DPRA 3O6BB 2RGVA 4IPAA 2DPDA 2Y48A 3ULQB 2K86A 1W5TA 2CG4A 4WWCA 1XDUA 4AD9A 2RNJA 5FD6A 3SHFA 1I1SA 1ZLKA 2DK5A 2YU3A 4A0ZA 3KE2A 4OIRF 2G7UA 2EWNA 4ESJA 3F23A 3GF2A 2XASA 1Z05A 1HW2A 1IN7A 4HV5A 2PG4A 3HSEA 5LEKA 4OU0A 5BMZA 1U2WA 5AIPA 4IXAA 2FQ3A 3R0JA 1YS6A 1LNWA 2KIFA 2FBIA 1R23A 4Y13A 4WX9A 3H3ZA 2GXBA 4M6XA 1TW2A 5E8GA 4I2OA 4I01A 1P2FA 4LG0A 5DV5A 3F6VA 3K2ZA 1IW7F 1S6LA 5FFZA 5D4SA 2ESHA 2A3SA 2GWRA 5LRSA 3GFLA 2XAHA 5DYMA 3I64A 1KU2A 4UV8A 3ELKA 2OZ6A 3ZMTA 1UHMA 4CHUA 4AIHA 2HYGD 3BJAA 3V7CA 2YX7A 5J6XA 3COAC 4G9YA 4IRGA 1EV7A 4MHGA 5L3CA 1USTA 5H6RA 2STTA 5D8LB 1YG2A 4XBFA 3C18A 5HOOA 2GA1A 3U1DA 3CUQC 3VOEA 3BY6A 2KJBA 3F8FA 1BIAA 3K9TA 1SFEA 4OOIA 1KYZA 1JHFA 2TDXA 1I27A 3IKVA 4A6EA 1ZG5A 4BXUA 2VBWA 1OKRA 4M9ZA 1PDNC 3LA2A 5TRDA 4K2EA 2WV0A 2H6CA 1XSXA 4ESBA 1FP1D 2UXXA 3DPLC 3RTRA 1D8KA 2Z33A 2W84A 3RPUA 2XUBA 3ML6A 2OU2A 3LSTA 4M72A 2HDCA 1R00A 2DBBA 4L9JA 2LDUA 3I54A 2P5VA 5ILSA 3JSPA 1O3SA 1YO5C 2EFPA 2EV5A 2DLLA 3HHGA 1ULYA 2O6GE 2NS0A 4ETSA 5HLHA 1XSDA 2MBFA 2XROA 2GIVA 1Z6RA 3GUDA 1EH6A 3DEUA 2QQ9A 1BI2A 3TO6A 3T1BA 3U9GA 3WGGA 1GHCA 3K0LA 5BPIA 5HS7A 3NQOA 1BN5A 1GXPA 4M9XA 6PAXA 4QLCU 1REPC 3I4PA 1J59A 5D6EA 4G7OF 1S8NA 1S3JA 2ZXJA 4OIQF 3IKTA 1FC3A 2QBYB 2HQRA 2XAJA 1QNTA 1G3YA 4KIGA 2PI0A 5JFRA 2RKHA 4O5VA 4BYYA 2KIMA 1ZREA 2CQKA 3HRMA 3FXQA 1TQPA 4PGGA 3LQRA 5E1WA 3RYPA 2DW4A 1BM9A 2YX4A 3Q9VA 3RI4A 1L0OC 3MWMA 3QRFF 3DP7A 1FZPB 2Q8KA 4EM1A 3V7RA 2E1NA 4HLXA 4HF1A 2HKOA 3JSOA 1TLHB 2HTSA 1XSVA 4HX8A 4GYIA 4LG0B 1LDKB 1LVAA 2A6HF 1KU3A 5AIQA 2IRFG 4N9IA 3RIRA 2AXLA 3K1NA 5LRRA 1I6XA 3K1PA 2K4JA 3GVAA 3CLOA 1ZARA 2Z9OA 1T2KA 1LB2A 2A68F 4PDKA 2IA1A 3FWEA 5FD5A 3QPHA 1U3EM 2OZUA 2QQBA 4BQAA 4S05A 3P9IA 1AWCA 4A12A 4R1HA 5ILVA 4U7BA 4P96A 5ICFA 1O3RA 4RAYA 4LB6B 3LAJA 3LA7A 4ON0A 5CVUA 4GYGA 2XHKA 3S2WA 3HSRA 2QLZA 4KIFA 2KJCA 4LFUA 1YYVA 3E5QA 1X3UA 3DKWA 5HDKA 1XCBA 3BWGA 3HTUA 4KN4X 1TW3A 2D2WA 3F72A 2DAOA 3F6OA 5D5VB 4UNOA 4G7ZF 3K1MA 2ISZA 4AIJA 5KK1A 1HBXG 3Q5FA 4LMYA 3F22A 1XDSA 2ZCWA 2EFQA 1R5HA 1TBXA 1YLFA 1W7PA 2FRHA 1K79A 3KP4A 3WE2A 2FBKA 5EEHA 1STZA 2VC1A 4I0AA 4HQEA 2J5OA 3LWFA 5IT3A 1Z9CA 2ZMEA 3E3VA 1J7KA 1Z6TA 3Q9SA 1HSTA 3NRVA 2F2EA 2EFNA 2IPQX 1FLIA 3ZN0A 2MLGA 4M74A 1ONVA 1R22A 4HW0A 3WTTC 4MEXF 3ECHA 1IXSB 2BBYA 3F8MA 1FBUA 2Z3YA 3TOBA 3V8JA 3HHHA 3O3KA 3WE3A 1IXRC 2P8TA 2DQRA 4M6YA 4I98B 4EJTA 2IP2A 3HRUA 2FE3A 4OIPF 2BV6A 4FX0A 1RUOA 1JE8A 2X4HA 1G3TA 2D1HA 2JTVA 1SD4A 1BJAA 1ZG1A 1OPCA 4EGYA 2COMA 5FLXZ 3OV8A 2FMYA 2GZWA 2XVCA 3BZ6A 5BOXA 3R4KA 5E1ZB 1O3TA 3W6JB 4B8XA 2W57A 1LEBA 4LB5A 4LK0F 2UXNA 3SZPA 2F5FA 3WU1B 5LHGA 2DK8A 2QENA 1KYWA 3E5XA 1HSJA 1SFXA 4PCQA 3DF8A 4BHBA 1TNTA 2M1BA 4CXFA 5F64A 2E7WA 2CW0F 2ZKZA 2PBIA 4YFNF 1H0MA 4IRHA 4AIKA 3ABTA 4RAZA 4XSZF 5FO5A 2F5DA 3KEQA 3TO7A 1U5TA 2EA2A 3MEXA 4ZYGA 3EYIA 3G73A 4Q47A 2OD5A 1R58A 4GCVA 3SZTA 4Y15A 4GO1A 1WQ2A 1S29A 2F5CA 2ISYA 2G9WA 3I59A 4MEYF 3BPVA 2O61A 3CO7C 1KA8A 1YW7A 4ENNA 4FHTA 1SMTA 2DI3A 1B4AA 1UCRA 4JK1X 1V4RA 3I71A 1FYKA 5F1RA 1BI0A 2QBYA 2XKPA 2X0LA 1ZYRF 1IZ1A 1Z1DA 2JSCA 1A04A 2XAGA 3DQVC 3GO5A 2QM3A 5K5OA 2DQLA 2BGCA 3KZZA 1VTNC 2QYOA 2ETHA 4Q48A 2ZBKA 3WTSC 2IVMA 4BHCA 4EJVA 1HKTA 2LSOA 4OMZA 1MGTA 1OYYA 3KETA 2V1UA 1O57A 3WGHA 4UHTA 4FT8A 3LA3A 1W7PB 1OYIA 2V1XA 1O7LA 1TTYA 1HXDA 2Q0OA 2RVCA 2ZMEB 3ROUA 1W4MA 2W24A 4CGZA 3ECOA 4M71A 4ZZDA 4HF2A 4MTDA 4RB3C 2UWMA 3D5LA 4EJOA 3E6CC 4S04A 1WRJA 1R5GA 1XGNA 1B6AA 3QU3A 2K27A 4O6JA 2EJRA 1LDJA 3EUHA 3F3XA 1ZGAA 3DPTA 3ISPA 4CICA 5JVTA 2V1DA 4EV0A 3BJ6A 2K7LA 2DPUA 1MKMA 3F8BA 2V9VA 4KN7X 3TO9A 2RQPA 4KMFA 3FXUA 2B0LA 3BPXA 1BOAA 3N4MA 2Q2EA 3GWZA 2E1CA 1YTYA 1IRGA 2CWEA 5F6FA 3AAFA 5EEGA 1V3FA 4XRFA 3NEUA 4ENJA 3QAHA 3E6BA 2QUFA 3J80Z 1FSEA 4WXCA 2ESNA 1SD7A 2DTRA 4A2UA 1MZBA 2CSOA 3SXYA 4EJUA 1K7AA 2M45A 3ZN1A 2PEXA 3T5XA 5DDGA 1XN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5N A;  2OBP A;  2A6E F;  3KP2 A;  2P5K A;  2BE5 F;  2H09 A;  4LLL A;  2JPC A;  1KU7 A;  5ERI A;  4FX4 A;  1SD6 A;  2LNB A;  3M8E A;  4KNY A;  1FY7 A;  4HA8 A;  5A2Q K;  1U5T B;  4L0Y B;  4A0Y A;  1R36 A;  3WTX C;  4A0X A;  2L02 A;  3PQJ A;  3P9C A;  2QVO A;  2W85 A;  4CDG A;  4HX7 A;  4UUV A;  1RZ4 A;  3I59 B;  1MDM A;  1G3S A;  2FNA A;  3EET A;  3T8R A;  2IA0 A;  5D4R A;  3DV8 A;  3GFJ A;  3RYR A;  2D45 A;  3FZV A;  5LHI A;  4LGW A;  2YR2 A;  5FGM A;  4AWX B;  5DD4 A;  1U6G A;  4EVI A;  1XGO A;  1J0R A;  3WTU C;  5AON A;  2PQ8 A;  2DFI A;  4EM2 A;  4A5M A;  3B02 A;  1T98 A;  5D5U B;  4MGR A;  4G8X A;  3CTA A;  1G4D A;  3KEO A;  4DNC A;  1TQI A;  4HOB A;  5E1X A;  1Z7U A;  3ZMV A;  4HLY A;  2M30 A;  4WXH A;  3MFK A;  5LHH A;  2EA4 A;  1HW1 A;  1MJ9 A;  3IL2 A;  1XMA A;  4M9S A;  1B9M A;  3KP7 A;  3HRS A;  4IJA A;  1ON1 A;  1K6O A;  3VFZ A;  1R1T A;  2O8X A;  1Y0U A;  1SD5 A;  2HWV A;  4RGU A;  4Z2Y A;  1Q1H A;  2ADU A;  2O0Y A;  3P7N A;  1XB4 A;  3QP6 A;  3V8K A;  4HDU A;  2F5E A;  3LQQ A;  2RC4 A;  5ILU A;  1UB9 A;  3KP6 A;  3E97 A;  3E5U A;  2A5Y B;  2GXG A;  1E2X A;  3GZ6 A;  4LLN A;  1JGS A;  5J8F A;  1I5Z A;  1W7P D;  5CJ9 A;  2XAQ A;  2GAU A;  2MC3 A;  3MZY A;  5HLI A;  1F4K A;  4LK1 F;  3ZMZ A;  1YW8 A;  3FXR A;  4HBL A;  4XLN F;  1KGS A;  1WI9 A;  2PLY A;  2HTJ A;  3B73 A;  2ZNZ A;  3WOD F;  2HQN A;  1L3L A;  3OOP A;  1USS A;  2EK5 A;  5DD8 A;  1ZHF A;  3TGN A;  4IHT A;  1S7A A;  2FOK A;  4LLG F;  3E6M A;  2V79 A;  3L2C A;  2L54 A;  1BC8 C;  1FOK A;  5K1Y A;  1U78 A;  2VXZ A;  4U7D A;  3FM5 A;  1J5Y A;  3RKW A;  1GXQ A;  5L3F A;  3ZMU A;  2Z99 A;  4BAY A;  3I0T A;  2M8E A;  3HOS A;  4PZJ A;  4MTE A;  4BHP A;  2QWW A;  2XIG A;  2BEO A;  5FFX A;  2DU9 A;  2FXA A;  4UVB A;  5K5R A;  4I7H A;  5E18 F;  1FYL A;  1D3Y A;  4RGR A;  1RNL A;  2EV6 A;  4EJW A;  5H6Q A;  4WF2 A;  2STW A;  2O03 A;  3G3Z A;  2FF4 A;  4KT5 C;  4OIN F;  1SFU A;  4G6D A;  2VE9 A;  3KCC A;  4EQQ A;  4HAM A;  3IRR A;  2CFX A;  3GZ5 A;  1IUY A;  5E20 A;  3GEZ A;  4KYW A;  2PN6 A;  3GYH X;  4LJZ F;  2O3F A;  3FM3 A;  4KIC A;  2RV8 A;  1FYM A;  1PP8 F;  2P6T A;  2ELH A;  3HOT A;  3L9F A;  3PFI A;  3M1E A;  2VOO A;  2YSR A;  1TQM A;  2XRN A;  1IN5 A;  2FEZ A;  2HYF A;  2BYV E;  4HDV A;  2LF8 A;  3ABU A;  5J8C A;  1MDM B;  1LQ1 A;  4YG2 F;  2VOP A;  5DUK A;  4D0P A;  2P7C B;  3IRQ A;  3PQK A;  2J5P A;  2QQA A;  3F8N A;  1IRF A;  4CZZ A;  2P5L C;  3ZP5 A;  1SMY F;  1IF1 A;  5D5W B;  2OAZ A;  2FSW A;  5CLS A;  1CGP A;  4AVP A;  1WWX A;  1D5V A;  3WTV C;  1IN8 A;  1I1G A;  1S7O A;  2MLK A;  1YFH A;  4BNC A;  1IXC A;  4KMU X;  4I0B A;  5IT9 K;  5HDG A;  1P4X A;  1HW5 A;  3VB2 A;  5BS6 A;  1PUE E;  3JW4 A;  1PP7 U;  1G6N A;  4GGG A;  3BP8 A;  5L3E A;  5DCM A;  1T38 A;  3RDI A;  2YPR A;  2L3D A;  2IT0 A;  1DDN A;  5HLG A;  1CF7 A;  1T0F A;  1ODD A;  1QBJ A;  2MH2 A;  2WTE A;  1QQI A;  3I53 A;  4G94 A;  4Y17 A;  1NHA A;  4L18 B;  3DFG A;  3VOD A;  3DXJ F;  5E8I A;  4ZYH A;  2FA5 A;  3W6K B;  2D1V A;  2VBZ A;  3WGI A;  2IJL A;  4MQ9 F;  2ACJ A;  1KU9 A;  1IN4 A;  5CVV A;  1FNN A;  4KDP A;  3MCZ A;  4R8H A;  2HEO A;  5TJJ A;  1ZH5 A;  1ON2 A;  3R6S A;  1C0W A;  2HFH A;  3BDD A;  1BBY A;  3CO6 C;  4KIB A;  4F7Z A;  5BQT A;  2ZNY A;  3HSF A;  1TNS A;  3M9A A;  5HS9 A;  4HYE A;  2MA3 A;  4P5O A;  2FNP A;  3JAM K;  2VON A;  4XSX F;  3E6D A;  4EM0 B;  2VBY A;  2M87 A;  3CUQ A;  3L09 A;  2Y0M A;  2LKP A;  3TDZ C;  3LFK A;  1Z91 A;  1MJA A;  5ICE A;  4KUM A;  5D8K B;  1KQ0 A;  3D0S A;  3SFZ A;  1G3W A;  4G6Q A;  3I58 A;  1XCV A;  4Q5S F;  3EDP A;  2XAF A;  5H20 A;  2HOE A;  1FBS A;  1ZRC A;  2ZJ2 A;  1J2X A;  3WU0 A;  2ZFW A;  4CYD A;  2VBX A;  2CYY A;  4L0Z B;  2JRT A;  2JZY A;  1FX7 A;  1LDD A;  4XLP F;  1JXS A;  1U8R A;  4HX4 A;  4KFC A;  1EH8 A;  1U5T C;  4OIO F;  2K02 A;  4JQF A;  4GXO A;  4ZZL A;  1R1U A;  1BIB A;  2HZT A;  4OMY A;  2M5W A;  4YIF A;  5FB2 A;  1XMK A;  2VT2 A;  3JTH A;  2FML A;  2VC0 A;  3K69 A;  4RGS A;  1KQ9 A;  4L5I A;  2KRF A;  3VEP A;  2JPB A;  1J9I A;  1P6R A;  3N97 A;  1F1Z A;  1QGP A;  1QZZ A;  2R7D A;  3KLO A;  1YQA A;  3RKY A;  1YS7 A;  5D6F A;  2VT3 A;  3QPT A;  2IA2 A;  4RGX A;  3FMQ A;  4RB0 A;  3C7J A;  1O7F A;  1OMI A;  5CVI A;  4M73 A;  1RUN A;  3J81 K;  2MH9 A;  5DCM B;  3IC7 A;  3JTG A;  3BOQ A;  4TV7 A;  4EGZ A;  1B9N A;  3KP5 A;  3C1D A;  1XGM A;  1CF7 B;  5CVR A;  4WK8 F;  4CO8 A;  1UHW A;  3C3W A;  1ZG3 A;  1B59 A;  2XV4 S;  3SQN A;  5IT9 Z;  4U0V A;  1ZAO A;  3R60 A;  4L5J A;  2IW5 A;  3L7W A;  1HKQ A;  3R0A A;  1J75 A;  2P4W A;  4N0B A;  2PJP A;  4UVA A;  1LEA A;  1YW9 A;  5LGN A;  3P9K A;  3MAJ A;  1P4W A;  2XGX A;  5LBQ A;  2NNY A;  2W25 A;  4PGH A;  2L4A A;  4HF0 A;  3FMS A;  3O2P E;  4B09 A;  3REO A;  3QOP A;  1P4A A;  4L9N A;  1K78 B;  2GQQ A;  3V8L A;  2EV0 A;  2MD5 A;  3ZMD A;  2OQG A;  2EB7 A;  4IF4 A;  1WKM A;  4ASN A;  3FMR A;  5FLX K;  2L4M A;  2P6S A;  4P9U A;  2QZ8 A;  5CYV A;  1JHH A;  2CGP A;  3WG9 A;  2HS5 A;  3CUQ B;  1RI7 A;  2KKO A;  1OR7 A;  4RS8 A;  2E7X A;  2Z5U A;  2CO5 A;  2K4B A;  4UV9 A;  1FBQ A;  5LLQ A;  3RJP A;  3ERE D;  1P92 A;  3FX3 A;  3I5U A;  4ZYD A;  3F8C A;  4O3M A;  2OA4 A;  5ED4 A;  2FBH A;  3JAM Z;  5LEJ A;  1T6S A;  3WTY C;  4L9V A;  5JR3 A;  5HDN A;  1ZN2 A;  2AS5 F;  4R79 A;  4HV6 A;  4L9T A;  2RN7 A;  3TOA A;  5JHU A;  3MZH A;  4MQV A;  3IWZ A;  1OYW A;  4KA4 A;  3HTS B;  4I09 A;  4N9H A;  1ZLJ A;  3HUG A;  3HYI A;  1QZY A;  1W5S A;  5ICG A;  1T39 A;  1RIO H;  1BI3 A;  5DEQ A;  1O3Q A;  3ZPL A;  2NRA C;  2EFW A;  1KQ8 A;  3M8F A;  1FT9 A;  3EYY A;  2A61 A;  2NYX A;  5HS8 A;  4IHS A;  3EQL F;  3FF5 A;  1WSU A;  1BC7 C;  3GFM A;  4QWQ A;  4NHJ A;  5JI6 A;  3IWF A;  3FHZ A;  1QPM A;  2PMH A;  1FP2 A;  2V6C A;  3GXO A;  4RB1 A;  5LGT A;  3WTZ A;  3KFW X;  3HRT A;  4UVC A;  2L01 A;  4RB2 C;  4Q4Z F;  4ENM A;  1IN6 A;  3KZY A;  2A07 F;  4DQ2 A;  3LAP A;  1XD7 A;  4HQM A;  1SAX A;  3KLN A;  3V7S A;  5L3G A;  2RDP A;  1QO0 D;  1FSH A;  3QU6 A;  2PFB A;  3BJO A;  5K5Q A;  4ZYE A;  4YFX F;  2H6B A;  5DCF A;  3GW2 A;  2G7H A;  3KP3 A;  4JBA A;  1ZGJ A;  4EMS A;  5KVR A;  2ZO4 A;  4P55 A;  3J81 Z;  2HGC A;  2KIU A;  5LGU A;  4LD5 A;  4H0E A;  2H27 A;  4ESF A;  1DUX C;  3J7A O;  2VE8 A;  2HR3 A;  3T8T A;  2VOD A;  2XKO A;  3CUO A;  4UXN A;  3TKY A;  4A6D A;  2WWY A;  5A2Q Z;  4WXD A;  3R61 A;  3U2R A;  3L00 A;  5ICC A;  5L3B A;  3F21 A;  3M7G A;  2NAZ A;  1BI1 A;  2C6Y A;  4ZH4 F;  3BRO A;  2DT5 A;  3GLX A;  3J80 K;  1F5T A;  1R7J A;  2OQR A;  3GX4 X;  3H92 A;  4IVN A;  3RKX A;  3ZMS A;  1IAW A;  1ZRF A;  4HZF A;  2WC2 A;  5DUI A;  3ZQ7 A;  2FU4 A;  4U0W A;  4NB5 A;  2VN2 A;  4MNU A;  1HQC A;  1ZRD A;  4WCG A;  3T0Y A;  1EH7 A;  1MD0 A;  2H94 A;  3MQ0 A;  4BH9 A;  4G7H F;  5HVQ C;  4ENK A;  2NNN A;  1FWZ A;  1E17 A;  2JT1 A;  4U0Y A;  3GFI A;  2P7V B;  3TDU C;  3H3U A;  4I02 A;  5CVJ A;  1H9G A;  2DO7 A;  2EFO A;  1B1B A;  1UFM A;  1FPQ A;  2GA2 A;  4P9F A;  2A69 F;  2HKX A;  2Y75 A;  3WTW C;  1R1V A;  1D8J A;  2R3S A;  2PMU A;  4U88 A;  1DPU A;  1DP7 P;  1AOY A;  3IHU A;  3RPQ A;  3TQN A;  1F9N A;  2UZK A;  1H9T A;  5L3D A;  3HIF A;  5BPD A;  3V4G A;  5E17 F;  1LJ9 A;  1GVJ A;  2R7F A;  4IRI A;  1HKS A;  4YII A;  4E70 A;  1XGS A;  4NQW A;  1K78 A;  1MJB A;  5D5X B;  3CJN A;  3QP5 A;  3CDH A;  4YFK F;  1YIO A;  2LF7 A;  1DPR A;  3O6B B;  2RGV A;  4IPA A;  2DPD A;  2Y48 A;  3ULQ B;  2K86 A;  1W5T A;  2CG4 A;  4WWC A;  1XDU A;  4AD9 A;  2RNJ A;  5FD6 A;  3SHF A;  1I1S A;  1ZLK A;  2DK5 A;  2YU3 A;  4A0Z A;  3KE2 A;  4OIR F;  2G7U A;  2EWN A;  4ESJ A;  3F23 A;  3GF2 A;  2XAS A;  1Z05 A;  1HW2 A;  1IN7 A;  4HV5 A;  2PG4 A;  3HSE A;  5LEK A;  4OU0 A;  5BMZ A;  1U2W A;  5AIP A;  4IXA A;  2FQ3 A;  3R0J A;  1YS6 A;  1LNW A;  2KIF A;  2FBI A;  1R23 A;  4Y13 A;  4WX9 A;  3H3Z A;  2GXB A;  4M6X A;  1TW2 A;  5E8G A;  4I2O A;  4I01 A;  1P2F A;  4LG0 A;  5DV5 A;  3F6V A;  3K2Z A;  1IW7 F;  1S6L A;  5FFZ A;  5D4S A;  2ESH A;  2A3S A;  2GWR A;  5LRS A;  3GFL A;  2XAH A;  5DYM A;  3I64 A;  1KU2 A;  4UV8 A;  3ELK A;  2OZ6 A;  3ZMT A;  1UHM A;  4CHU A;  4AIH A;  2HYG D;  3BJA A;  3V7C A;  2YX7 A;  5J6X A;  3COA C;  4G9Y A;  4IRG A;  1EV7 A;  4MHG A;  5L3C A;  1UST A;  5H6R A;  2STT A;  5D8L B;  1YG2 A;  4XBF A;  3C18 A;  5HOO A;  2GA1 A;  3U1D A;  3CUQ C;  3VOE A;  3BY6 A;  2KJB A;  3F8F A;  1BIA A;  3K9T A;  1SFE A;  4OOI A;  1KYZ A;  1JHF A;  2TDX A;  1I27 A;  3IKV A;  4A6E A;  1ZG5 A;  4BXU A;  2VBW A;  1OKR A;  4M9Z A;  1PDN C;  3LA2 A;  5TRD A;  4K2E A;  2WV0 A;  2H6C A;  1XSX A;  4ESB A;  1FP1 D;  2UXX A;  3DPL C;  3RTR A;  1D8K A;  2Z33 A;  2W84 A;  3RPU A;  2XUB A;  3ML6 A;  2OU2 A;  3LST A;  4M72 A;  2HDC A;  1R00 A;  2DBB A;  4L9J A;  2LDU A;  3I54 A;  2P5V A;  5ILS A;  3JSP A;  1O3S A;  1YO5 C;  2EFP A;  2EV5 A;  2DLL A;  3HHG A;  1ULY A;  2O6G E;  2NS0 A;  4ETS A;  5HLH A;  1XSD A;  2MBF A;  2XRO A;  2GIV A;  1Z6R A;  3GUD A;  1EH6 A;  3DEU A;  2QQ9 A;  1BI2 A;  3TO6 A;  3T1B A;  3U9G A;  3WGG A;  1GHC A;  3K0L A;  5BPI A;  5HS7 A;  3NQO A;  1BN5 A;  1GXP A;  4M9X A;  6PAX A;  4QLC U;  1REP C;  3I4P A;  1J59 A;  5D6E A;  4G7O F;  1S8N A;  1S3J A;  2ZXJ A;  4OIQ F;  3IKT A;  1FC3 A;  2QBY B;  2HQR A;  2XAJ A;  1QNT A;  1G3Y A;  4KIG A;  2PI0 A;  5JFR A;  2RKH A;  4O5V A;  4BYY A;  2KIM A;  1ZRE A;  2CQK A;  3HRM A;  3FXQ A;  1TQP A;  4PGG A;  3LQR A;  5E1W A;  3RYP A;  2DW4 A;  1BM9 A;  2YX4 A;  3Q9V A;  3RI4 A;  1L0O C;  3MWM A;  3QRF F;  3DP7 A;  1FZP B;  2Q8K A;  4EM1 A;  3V7R A;  2E1N A;  4HLX A;  4HF1 A;  2HKO A;  3JSO A;  1TLH B;  2HTS A;  1XSV A;  4HX8 A;  4GYI A;  4LG0 B;  1LDK B;  1LVA A;  2A6H F;  1KU3 A;  5AIQ A;  2IRF G;  4N9I A;  3RIR A;  2AXL A;  3K1N A;  5LRR A;  1I6X A;  3K1P A;  2K4J A;  3GVA A;  3CLO A;  1ZAR A;  2Z9O A;  1T2K A;  1LB2 A;  2A68 F;  4PDK A;  2IA1 A;  3FWE A;  5FD5 A;  3QPH A;  1U3E M;  2OZU A;  2QQB A;  4BQA A;  4S05 A;  3P9I A;  1AWC A;  4A12 A;  4R1H A;  5ILV A;  4U7B A;  4P96 A;  5ICF A;  1O3R A;  4RAY A;  4LB6 B;  3LAJ A;  3LA7 A;  4ON0 A;  5CVU A;  4GYG A;  2XHK A;  3S2W A;  3HSR A;  2QLZ A;  4KIF A;  2KJC A;  4LFU A;  1YYV A;  3E5Q A;  1X3U A;  3DKW A;  5HDK A;  1XCB A;  3BWG A;  3HTU A;  4KN4 X;  1TW3 A;  2D2W A;  3F72 A;  2DAO A;  3F6O A;  5D5V B;  4UNO A;  4G7Z F;  3K1M A;  2ISZ A;  4AIJ A;  5KK1 A;  1HBX G;  3Q5F A;  4LMY A;  3F22 A;  1XDS A;  2ZCW A;  2EFQ A;  1R5H A;  1TBX A;  1YLF A;  1W7P A;  2FRH A;  1K79 A;  3KP4 A;  3WE2 A;  2FBK A;  5EEH A;  1STZ A;  2VC1 A;  4I0A A;  4HQE A;  2J5O A;  3LWF A;  5IT3 A;  1Z9C A;  2ZME A;  3E3V A;  1J7K A;  1Z6T A;  3Q9S A;  1HST A;  3NRV A;  2F2E A;  2EFN A;  2IPQ X;  1FLI A;  3ZN0 A;  2MLG A;  4M74 A;  1ONV A;  1R22 A;  4HW0 A;  3WTT C;  4MEX F;  3ECH A;  1IXS B;  2BBY A;  3F8M A;  1FBU A;  2Z3Y A;  3TOB A;  3V8J A;  3HHH A;  3O3K A;  3WE3 A;  1IXR C;  2P8T A;  2DQR A;  4M6Y A;  4I98 B;  4EJT A;  2IP2 A;  3HRU A;  2FE3 A;  4OIP F;  2BV6 A;  4FX0 A;  1RUO A;  1JE8 A;  2X4H A;  1G3T A;  2D1H A;  2JTV A;  1SD4 A;  1BJA A;  1ZG1 A;  1OPC A;  4EGY A;  2COM A;  5FLX Z;  3OV8 A;  2FMY A;  2GZW A;  2XVC A;  3BZ6 A;  5BOX A;  3R4K A;  5E1Z B;  1O3T A;  3W6J B;  4B8X A;  2W57 A;  1LEB A;  4LB5 A;  4LK0 F;  2UXN A;  3SZP A;  2F5F A;  3WU1 B;  5LHG A;  2DK8 A;  2QEN A;  1KYW A;  3E5X A;  1HSJ A;  1SFX A;  4PCQ A;  3DF8 A;  4BHB A;  1TNT A;  2M1B A;  4CXF A;  5F64 A;  2E7W A;  2CW0 F;  2ZKZ A;  2PBI A;  4YFN F;  1H0M A;  4IRH A;  4AIK A;  3ABT A;  4RAZ A;  4XSZ F;  5FO5 A;  2F5D A;  3KEQ A;  3TO7 A;  1U5T A;  2EA2 A;  3MEX A;  4ZYG A;  3EYI A;  3G73 A;  4Q47 A;  2OD5 A;  1R58 A;  4GCV A;  3SZT A;  4Y15 A;  4GO1 A;  1WQ2 A;  1S29 A;  2F5C A;  2ISY A;  2G9W A;  3I59 A;  4MEY F;  3BPV A;  2O61 A;  3CO7 C;  1KA8 A;  1YW7 A;  4ENN A;  4FHT A;  1SMT A;  2DI3 A;  1B4A A;  1UCR A;  4JK1 X;  1V4R A;  3I71 A;  1FYK A;  5F1R A;  1BI0 A;  2QBY A;  2XKP A;  2X0L A;  1ZYR F;  1IZ1 A;  1Z1D A;  2JSC A;  1A04 A;  2XAG A;  3DQV C;  3GO5 A;  2QM3 A;  5K5O A;  2DQL A;  2BGC A;  3KZZ A;  1VTN C;  2QYO A;  2ETH A;  4Q48 A;  2ZBK A;  3WTS C;  2IVM A;  4BHC A;  4EJV A;  1HKT A;  2LSO A;  4OMZ A;  1MGT A;  1OYY A;  3KET A;  2V1U A;  1O57 A;  3WGH A;  4UHT A;  4FT8 A;  3LA3 A;  1W7P B;  1OYI A;  2V1X A;  1O7L A;  1TTY A;  1HXD A;  2Q0O A;  2RVC A;  2ZME B;  3ROU A;  1W4M A;  2W24 A;  4CGZ A;  3ECO A;  4M71 A;  4ZZD A;  4HF2 A;  4MTD A;  4RB3 C;  2UWM A;  3D5L A;  4EJO A;  3E6C C;  4S04 A;  1WRJ A;  1R5G A;  1XGN A;  1B6A A;  3QU3 A;  2K27 A;  4O6J A;  2EJR A;  1LDJ A;  3EUH A;  3F3X A;  1ZGA A;  3DPT A;  3ISP A;  4CIC A;  5JVT A;  2V1D A;  4EV0 A;  3BJ6 A;  2K7L A;  2DPU A;  1MKM A;  3F8B A;  2V9V A;  4KN7 X;  3TO9 A;  2RQP A;  4KMF A;  3FXU A;  2B0L A;  3BPX A;  1BOA A;  3N4M A;  2Q2E A;  3GWZ A;  2E1C A;  1YTY A;  1IRG A;  2CWE A;  5F6F A;  3AAF A;  5EEG A;  1V3F A;  4XRF A;  3NEU A;  4ENJ A;  3QAH A;  3E6B A;  2QUF A;  3J80 Z;  1FSE A;  4WXC A;  2ESN A;  1SD7 A;  2DTR A;  4A2U A;  1MZB A;  2CSO A;  3SXY A;  4EJU A;  1K7A A;  2M45 A;  3ZN1 A;  2PEX A;  3T5X A;  5DDG A;  1XN7 A; 
#chains in the Genus database with same CATH topology
 4A5N A;  2DOE A;  2I8D A;  2OBP A;  2A6E F;  1K4S A;  3KP2 A;  3B6C A;  2P5K A;  3OS0 A;  3FBI B;  2BE5 F;  1R4M B;  1NG7 A;  2H09 A;  4LLL A;  2JPC A;  4UY8 I;  1KU7 A;  5ERI A;  4FX4 A;  2CS3 A;  3BG7 A;  3DEW A;  2EZI A;  2BXZ A;  3Q3S A;  1SD6 A;  1A36 A;  2E1M C;  2LNB A;  1B8I B;  1SAN A;  3M8E A;  4KNY A;  4E7I A;  1X1B A;  3OYB A;  1FY7 A;  1UJ8 A;  4HA8 A;  2VB6 A;  5A2Q K;  2WAD A;  1U5T B;  4L0Y B;  3G71 I;  2MGQ A;  4XRS G;  4A0Y A;  1R36 A;  1X4P A;  3WTX C;  4A0X A;  2L02 A;  2NVQ J;  5GP9 A;  3PQJ A;  3PO3 J;  3P9C A;  2DOF A;  2QVO A;  2O8K A;  2W85 A;  3DEE A;  3PFY A;  3Q0W A;  4CDG A;  3GTM J;  4HX7 A;  3GTL J;  4BBR J;  1DP3 A;  3TW7 A;  3K70 C;  1U8B A;  3A0H C;  5J4V A;  3CCM I;  2VPL A;  4UUV A;  2BW3 A;  1RZ4 A;  4M3B A;  1ETW A;  3ASO H;  1LKX A;  3I59 B;  2VIX A;  1MDM A;  5F04 A;  1G3S A;  2FNA A;  3EET A;  4M3F A;  2IAI A;  2IA0 A;  3T8R A;  5D4R A;  3DV8 A;  1ETY A;  3GFJ A;  3RYR A;  3PNT A;  2D45 A;  3FZV A;  1HOM A;  5LHI A;  4LGW A;  2YR2 A;  3PNY A;  4BY7 J;  4II2 A;  5FGM A;  4AWX B;  5DD4 A;  1U6G A;  3A02 A;  4EVI A;  1XGO A;  2M9H A;  1J0R A;  4E7Z A;  4AC0 A;  3WTU C;  2DMT A;  3VYS B;  2M8G X;  1QZE A;  5AON A;  2PQ8 A;  5DM7 F;  1I3A A;  1I3Q J;  4E7H A;  3S16 J;  2DFI A;  3NWT A;  4IQJ A;  4EM2 A;  4A5M A;  3B02 A;  2OTJ I;  1T98 A;  4A69 C;  2HVR A;  5D5U B;  3HKZ A;  5FKL A;  3WU2 C;  3A0B C;  2L5Q A;  4MGR A;  4G8X A;  3CTA A;  1G4D A;  4XK4 A;  3KEO A;  4DNC A;  1G8X A;  1TQI A;  4HOB A;  5E1X A;  1Z7U A;  4XOT A;  3ZMV A;  4HLY A;  2M30 A;  4WXH A;  3HL2 A;  1E3H A;  2CW7 A;  3MFK A;  5LHH A;  1TZL A;  4KT6 A;  1AHD P;  4AU7 A;  2EA4 A;  1HW1 A;  3HBL A;  1MJ9 A;  3A01 A;  3IL2 A;  1XMA A;  1TWF J;  4M9S A;  1B9M A;  1F36 A;  1X3W B;  3KP7 A;  3HRS A;  4IJA A;  2HQA A;  1ON1 A;  1K6O A;  1VQ5 I;  1LFP A;  3VFZ A;  1R1T A;  2O8X A;  2RNG A;  4XLH A;  1Y0U A;  1SD5 A;  2HWV A;  4RGU A;  4Z2Y A;  1Q1H A;  5JLW A;  3JRF A;  2ADU A;  2O0Y A;  2NS8 A;  3P7N A;  2R5Y A;  1XB4 A;  3QP6 A;  1OQY A;  3V8K A;  3S1N J;  1R71 A;  4HDU A;  4BQO A;  4ZC3 A;  3H5N A;  2LY2 A;  2F5E A;  1WJB A;  3LQQ A;  3SEZ A;  2RC4 A;  2H1L A;  1JT0 A;  5ILU A;  1UB9 A;  5E79 C;  3KEY A;  2WAF A;  2JA5 J;  3KP6 A;  3K4M A;  3E97 A;  3E5U A;  2A5Y B;  4S0H B;  1X2M A;  3HKZ N;  2E5Z A;  3GLL A;  5DM6 F;  4I6Z A;  2GXG A;  1E2X A;  3GZ6 A;  1ORK A;  4LLN A;  1JGS A;  5J8F A;  1I5Z A;  1W7P D;  3FHN A;  3IAS 2;  5CJ9 A;  3RQI A;  2XAQ A;  4FE7 A;  5TIS C;  2H8R A;  2GAU A;  4M6V A;  2NVU B;  2MC3 A;  1SFK A;  4FCY A;  3MZY A;  5HLI A;  1F4K A;  4LK1 F;  3ZMZ A;  1YW8 A;  2QKL B;  1OLT A;  4ABZ A;  2IS1 A;  4X6A J;  3FXR A;  4HBL A;  4XLN F;  1KGS A;  1WI9 A;  3QQA A;  2PLY A;  2HTJ A;  3O8G A;  3B73 A;  2ZNZ A;  4Y3O A;  3WOD F;  2HQN A;  1L3L A;  3OOP A;  1USS A;  2EK5 A;  2CQ7 A;  3S1M J;  5DD8 A;  1ZHF A;  3TGN A;  4IHT A;  1IV6 A;  2V1N A;  2HZD A;  2ZJP F;  1VQ9 I;  2MAB A;  2CRG A;  5IY5 H;  1BR2 A;  1U9O A;  1YRN A;  2LR8 A;  1S7A A;  1KON A;  2FOK A;  2NVX J;  4LLG F;  3E6M A;  2Q2E B;  3E1S A;  2WB1 A;  2V79 A;  3L2C A;  4GRI A;  2L9V A;  2VKV A;  4BY1 J;  2L54 A;  1BC8 C;  1BW6 A;  1FOK A;  4XLA A;  5K1Y A;  1B72 B;  3H1C A;  1MBK A;  1Z3Y A;  1U78 A;  4LG3 A;  2VXZ A;  4U7D A;  3FM5 A;  1J5Y A;  2CUZ A;  3PUF A;  3RKW A;  1GXQ A;  5L3F A;  2VJJ A;  3ZMU A;  3K7A J;  4J01 A;  2Z99 A;  2CFO A;  4BAY A;  3I0T A;  1MMG A;  2M8E A;  4J00 A;  1FEX A;  2R7U A;  3HOS A;  4PZJ A;  2XAU A;  4PJJ A;  2M7B A;  4MTE A;  2QWW A;  2XIG A;  4BHP A;  4BJ6 C;  2BEO A;  3GCM A;  5FFX A;  3SFI A;  3I56 I;  2DU9 A;  2FXA A;  4UVB A;  5HLT A;  5K5R A;  3IV5 A;  5B1A H;  2BOL A;  3CCY A;  4NC8 A;  3M07 A;  3HZJ A;  2W4S A;  4I7H A;  2CV1 A;  3BQZ A;  2D5V A;  5E18 F;  3MZ8 A;  3ABK H;  4MFE A;  1FYL A;  1D3Y A;  4RGR A;  1RNL A;  2EV6 A;  4EJW A;  5H6Q A;  1VF9 A;  4A3E J;  4WF2 A;  3I9V 2;  2STW A;  2O03 A;  3O8H A;  3G3Z A;  2FF4 A;  2DFF A;  4KT5 C;  2F48 A;  4OIN F;  1SFU A;  2LBF B;  4G6D A;  3D1N I;  3KCC A;  2VE9 A;  3LSG A;  4EQQ A;  5M3F J;  4HAM A;  3IRR A;  2CFX A;  2WB1 N;  3GZ5 A;  1IUY A;  1EJ9 A;  5E20 A;  3GEZ A;  4KYW A;  2CUJ A;  2PN6 A;  3GYH X;  3LSJ A;  2R7Z J;  4LJZ F;  3AG4 H;  3OYM A;  3OYC A;  1D0X A;  2O3F A;  3RQ4 A;  3FM3 A;  4KIC A;  4JX4 A;  2RV8 A;  1FYM A;  1PP8 F;  1VI0 A;  2P6T A;  2XSJ C;  2ELH A;  1XX5 A;  3HOT A;  3OY9 A;  4I76 A;  3VYU B;  3L9F A;  3PFI A;  3M1E A;  1T08 B;  3OYE A;  2R7S A;  2R7W A;  2VOO A;  4HG2 A;  3H5R A;  5KAI C;  3W3C A;  3IP4 B;  3FXJ A;  5J47 A;  2YSR A;  1TQM A;  2XRN A;  1IN5 A;  1VFC A;  2QCO A;  2FEZ A;  2HYF A;  2BYV E;  4HDV A;  2BW3 B;  3JRD A;  2LF8 A;  2JWT A;  2E35 A;  3ABU A;  5J8C A;  1MDM B;  3MKL A;  1LQ1 A;  3AG1 H;  1Y6I A;  3MD2 A;  4YG2 F;  2VOP A;  2BHZ A;  4GFB A;  5DUK A;  2XPV A;  4D0P A;  2P7C B;  3BR3 A;  1WCM J;  2YS9 A;  3ABL H;  4PSX A;  3IRQ A;  3PQK A;  2Z1D A;  2J5P A;  3TED A;  2QQA A;  2UV1 A;  4LOC A;  3F8N A;  1GT0 C;  3JRH A;  1IRF A;  3NAU A;  2DA5 A;  4CZZ A;  2P5L C;  3ZP5 A;  1SMY F;  4BJ5 C;  1SFO J;  1IF1 A;  5D5W B;  2GIZ A;  2OAZ A;  2FSW A;  4IHY A;  2EIJ H;  5CLS A;  1CGP A;  2JJ7 A;  2KPM A;  4AVP A;  1WWX A;  1IRZ A;  1D5V A;  3PM1 A;  1UHS A;  3WTV C;  1GLN A;  1IN8 A;  1I1G A;  1S7O A;  2DMP A;  3S14 J;  2MLK A;  1YFH A;  3GTJ J;  4BNC A;  5J1U A;  1NH3 A;  1OCR H;  1IXC A;  1SEU A;  4RM3 A;  3QYF A;  1YE9 A;  4KMU X;  5B66 C;  2BZT A;  4I0B A;  2VXD A;  3S2H J;  5IT9 K;  2JMW A;  1MIJ A;  1BW5 A;  5HDG A;  1RR7 A;  1P4X A;  3OYD A;  1HW5 A;  1LPQ A;  3P5J A;  3VB2 A;  4DGW B;  5BS6 A;  4XMY A;  1PUE E;  3JW4 A;  1PP7 U;  1OFC X;  4FE4 A;  1G6N A;  2EIL H;  2JSP A;  4GGG A;  3A01 B;  1R6R A;  3BP8 A;  5IYB J;  2WAQ N;  5L3E A;  2M34 A;  5DCM A;  3AG3 H;  3RDI A;  1T38 A;  2A5W A;  5IP7 J;  5DS9 A;  5EDN A;  2YPR A;  2L3D A;  2CUF A;  5E3M A;  2FX0 A;  2GLO A;  4F55 A;  2IT0 A;  3G1M A;  3VSL A;  1DDN A;  4BXF A;  5HLG A;  1CF7 A;  2K9L A;  2R5Y B;  2K40 A;  5IP9 J;  1T0F A;  2MC4 A;  3K10 A;  1ODD A;  1QBJ A;  2LOO A;  5HNF A;  2MH2 A;  2EPF A;  2WTE A;  1QQI A;  3I53 A;  3N05 A;  4G94 A;  3CF5 F;  2ZME C;  4Y17 A;  1NK2 P;  4QPO A;  4KJZ A;  2I10 A;  3BG5 A;  2DN0 A;  1NHA A;  2H1K A;  3DFG A;  4L18 B;  3VOD A;  3DXJ F;  2CV2 A;  5E8I A;  1ETK A;  4ZYH A;  2FA5 A;  3W6K B;  2D1V A;  4FQG A;  2VBZ A;  1LFU P;  4Y52 J;  1R9T J;  3WGI A;  1M1E B;  2IJL A;  4MQ9 F;  3NWS A;  2DOA A;  1KU9 A;  2ACJ A;  3PUB A;  1WJE A;  2KP6 A;  4X1E A;  1IN4 A;  3D5R C;  5CVV A;  2OV7 A;  1FNN A;  3CC7 I;  4KDP A;  3MCZ A;  3Q0V A;  4R8H A;  2HEO A;  3AL0 B;  2OF7 A;  3D5S C;  2FJ1 A;  1Y1V J;  4G12 A;  4V2G A;  4V2F A;  2E36 A;  5TJJ A;  1ZH5 A;  1ON2 A;  3R6S A;  4XON A;  1C0W A;  4IO9 F;  2HFH A;  3BCA A;  3BDD A;  4LIU A;  3SJM A;  4BDY A;  1BBY A;  2KDO A;  3CO6 C;  1TT5 B;  2F6C A;  1VQP I;  1YRN B;  3CCE I;  4PJ0 C;  2NS7 A;  4KIB A;  4DYQ A;  4F7Z A;  2ZXW H;  2LFB A;  5BQT A;  2ZNY A;  4YRV A;  2DT7 B;  3HSF A;  3BR0 A;  1TNS A;  4BQN A;  4BKX A;  4JOM A;  3M9A A;  5HS9 A;  4HYE A;  2MA3 A;  4XQF A;  2CH0 A;  4P5O A;  2F4O B;  2FNP A;  3JAM K;  4XSX F;  2VON A;  1QHH D;  3E6D A;  4EM0 B;  2VBY A;  3CCL I;  2M87 A;  1PVE A;  3CUQ A;  3L09 A;  1YX5 A;  3H0G J;  5FJ8 J;  2XC7 A;  2DYR H;  3WG7 H;  2Z2S B;  4JP0 A;  1Y8Q B;  5J40 A;  2Y0M A;  1W1W E;  1FOY A;  2LKP A;  1POG A;  1F43 A;  3TDZ C;  4A3I J;  3LFK A;  1Z91 A;  1MJA A;  5ICE A;  4KUM A;  1T56 A;  5D8K B;  1KQ0 A;  3E0J B;  3D0S A;  3SFZ A;  1G3W A;  2YUS A;  4G6Q A;  4M3G A;  1YHQ I;  3CJQ B;  3I58 A;  4RLQ A;  1XCV A;  2EIK H;  3ZOB A;  2VQL A;  2VJI A;  3DPU A;  3CCV I;  4Q5S F;  3EDP A;  3C2B A;  4C9Y A;  1IO2 A;  2XAF A;  2JVH A;  4HNT A;  3HOZ J;  5H20 A;  2HOE A;  3IH2 A;  2DCE A;  3FXM A;  1FBS A;  1IDY A;  1S7E A;  4IZZ A;  1ZRC A;  3FDY A;  1A6I A;  1IJW C;  2ZJ2 A;  1J2X A;  3HC7 A;  3WU0 A;  2ZFW A;  3DKY A;  4CYD A;  2DJN A;  2ME0 A;  2VBX A;  3K4C A;  1Y0N A;  1X1D A;  2CYY A;  1D5Y A;  1MSF C;  4EAT A;  2LP0 A;  4L0Z B;  4BGD A;  2JRT A;  2JZY A;  1FX7 A;  1LDD A;  4XLP F;  2NVY J;  1JXS A;  1U8R A;  4HX4 A;  1QPI A;  4KFC A;  2DDB A;  1EH8 A;  2R7T A;  1U5T C;  3BR5 A;  1EF4 A;  1ETV A;  1YIT I;  4OIO F;  2K02 A;  2X6Y A;  5KHD A;  4F93 B;  4KIT B;  2A6T A;  4JQF A;  4GXO A;  4ZZL A;  3S17 J;  3X2Q H;  1R1U A;  1BIB A;  2ELJ A;  2HZT A;  4OMY A;  4XL9 A;  2M5W A;  3S15 J;  4YIF A;  2IS2 A;  5GAH J;  3UR3 C;  5FB2 A;  1XMK A;  2VT2 A;  3JTH A;  2FML A;  2VC0 A;  2WAE A;  5CQE A;  4DOZ A;  1W0U A;  4A93 J;  2V4J C;  3K69 A;  2EQR A;  1KQ9 A;  4RGS A;  5EEA A;  4L5I A;  1X1A A;  2KRF A;  2WV1 A;  1YIJ I;  2IGK A;  3BG3 A;  5KCM A;  3DBH B;  3VEP A;  3CES A;  4AYB A;  2MD0 A;  2GBY A;  2HPI A;  2VKD A;  2R7X A;  2JPB A;  1VQO I;  3JRA A;  1J9I A;  2CW8 A;  3QOD A;  2UUZ A;  1OCT C;  3ZQG A;  2B7E A;  1P6R A;  1UMQ A;  1N77 A;  5FRN A;  3QYE A;  3N97 A;  1F1Z A;  1QGP A;  1QZZ A;  2ZSI B;  3G2B A;  2R7D A;  3OYJ A;  4RLF A;  3KLO A;  3OOU A;  2LRD A;  5K7H A;  3LSI A;  4QIW N;  2QGU A;  1BJZ A;  1QA6 A;  1RR8 C;  1YQA A;  2E1O A;  3RKY A;  1YS7 A;  5D6F A;  5FKM A;  2VT3 A;  3QPT A;  2IA2 A;  3BR1 A;  4JYK A;  4QTR A;  5TGT A;  4RGX A;  3CCR I;  3GME A;  3BTL A;  4A3B J;  4BQQ A;  1XTA A;  3FMQ A;  4RB0 A;  3C7J A;  5JHF A;  1O7F A;  1OMI A;  2HXI A;  4M73 A;  5CVI A;  4ZYA A;  1RUN A;  3ZQI A;  3LFU A;  3DU6 A;  1Y56 A;  3J81 K;  2MH9 A;  5DCM B;  3IC7 A;  3JTG A;  3BOQ A;  1PJR A;  3J7A Y;  4TV7 A;  4EGZ A;  1B9N A;  2CQX A;  3CF2 A;  3KP5 A;  3KYD B;  3C1D A;  1XGM A;  1VQL I;  1O4X A;  2X9D A;  2RQQ A;  2CMP A;  1CF7 B;  2LBF A;  5CVR A;  4WK8 F;  5LFA A;  1ERD A;  4AYB N;  4CO8 A;  1UHW A;  3C3W A;  2GM4 A;  3OL4 A;  1ZG3 A;  1B59 A;  2XV4 S;  2L9S A;  3I4M J;  3SQN A;  5IT9 Z;  4U0V A;  1ZAO A;  2DOD A;  1FMV A;  3R60 A;  4FIS A;  4L5J A;  2H8W A;  2IW5 A;  3L7W A;  4XLF A;  1HKQ A;  4DBR A;  2R7R A;  3R0A A;  1J75 A;  2P4W A;  4BDZ A;  4N0B A;  2Q1Z B;  1PYV A;  3OYH A;  4ZDL A;  2DYS H;  1OCZ H;  2PJP A;  3LNQ A;  1K83 J;  4UVA A;  1LEA A;  3B6A A;  3CJR B;  1YW9 A;  2V7F A;  4V19 K;  5LGN A;  3P9K A;  3FXL A;  3MKZ A;  3MAJ A;  4XKC A;  3WHC A;  1G59 A;  1E3P A;  2X48 A;  2XPW A;  1P4W A;  1BR4 A;  2HVQ A;  4E7K A;  3EUH C;  1P7J A;  2XGX A;  2XF5 A;  5LBQ A;  2R93 J;  2NNY A;  2W25 A;  4PGH A;  2L4A A;  5BNG A;  4HF0 A;  3FMS A;  2LVS A;  3O2P E;  5E3L A;  2M2E A;  3H36 A;  4B09 A;  3LSR A;  3RZD J;  2E34 A;  3REO A;  4A3G J;  1K4T A;  3JRE A;  3QOP A;  1P4A A;  4L9N A;  1K78 B;  2GQQ A;  3HM5 A;  3SZG A;  3V8L A;  2EV0 A;  2MD5 A;  3ZMD A;  2KT0 A;  4IHV A;  2OQG A;  3GTO J;  2EB7 A;  4IF4 A;  1LUJ B;  1WKM A;  4C2T A;  3ZCO A;  4ASN A;  3FMR A;  3H35 A;  5FLX K;  4NBQ A;  2X1E A;  2L4M A;  3L2R A;  2LH9 A;  2P6S A;  4P9U A;  2QZ8 A;  4QSH A;  1X1C A;  5CYV A;  1WVR A;  1JHH A;  3L2V A;  2CGP A;  3WG9 A;  2HS5 A;  3CUQ B;  1RI7 A;  2KKO A;  4AID A;  2NVT J;  1OR7 A;  4CH7 A;  3KIO A;  4RS8 A;  3CDL A;  2FD5 A;  2E7X A;  2Z5U A;  4D7M A;  3PJR A;  1JT6 A;  3DTE A;  2JN6 A;  1R49 A;  4XKV A;  2GOM A;  1RES A;  2CO5 A;  4MFD A;  3W2V A;  3S3M A;  1V54 H;  2K4B A;  4UV9 A;  3MN2 A;  1FBQ A;  5LLQ A;  1IUF A;  4HNV A;  3RJP A;  3ERE D;  2HQ5 A;  1HLV A;  1AKH A;  1P92 A;  4RA2 A;  2L7M P;  2V26 A;  3FX3 A;  3I5U A;  3SDB A;  4ZYD A;  1K6Y A;  1HDD C;  3F8C A;  4O3M A;  1WGX A;  2M4K A;  1Z21 A;  2OA4 A;  3S32 A;  5ED4 A;  2X6W A;  2FBH A;  3JAM Z;  2BXY A;  2W48 A;  2IGO A;  1T6S A;  5LEJ A;  5IOY A;  3WTY C;  4L9V A;  1UZC A;  5JR3 A;  2DA3 A;  5HDN A;  4U87 A;  5FKO A;  4RAF A;  3CCS I;  1ZN2 A;  5IP6 A;  2AS5 F;  4R79 A;  3FKI J;  4B4C A;  1ITY A;  3BQY A;  4HV6 A;  4L9T A;  3EUA A;  5KAF C;  2RN7 A;  3TOA A;  5JHU A;  5C44 J;  2XB5 A;  3MZH A;  1UAA A;  2AQE A;  2EZH A;  4MQV A;  1KZH A;  3IWZ A;  1OYW A;  4KA4 A;  3OYK A;  3G1O A;  3HTS B;  4I09 A;  3VPR A;  4N9H A;  4CCJ A;  4B3A A;  4M3E A;  4IKF A;  5GAE J;  1ZLJ A;  2L2O A;  2E1M B;  3HUG A;  4BBS J;  4F92 B;  3HYI A;  1QZY A;  4A3F J;  1I50 J;  2OUM A;  1WJF A;  1W5S A;  1W5C C;  5ICG A;  4DIQ A;  1T39 A;  1ZKG A;  2TCT A;  3HPG A;  1RIO H;  1OCP A;  4I99 C;  4F91 B;  5CKT A;  1BI3 A;  1LFB A;  1QHG A;  1VQ4 I;  5DEQ A;  4RBO A;  1O3Q A;  4IHX A;  3ZPL A;  2NRA C;  4UUT A;  2EFW A;  1KQ8 A;  3OYF A;  3M8F A;  1FT9 A;  4BE1 A;  3E7L A;  1ACI A;  2L9N A;  2VJ4 A;  3EYY A;  2A61 A;  4H4K C;  4B44 A;  2BY2 A;  2NYX A;  5HS8 A;  4IHS A;  2ZXI A;  3EQL F;  3FF5 A;  3VYR B;  1WSU A;  2YU9 J;  2BVM A;  1BC7 C;  1MSE C;  2K5C A;  3GFM A;  5C4J J;  2LG4 A;  3H9G A;  4QWQ A;  4NHJ A;  2ELK A;  3FK6 A;  5JI6 A;  3IWF A;  1R5I D;  3FHZ A;  3PNV A;  1CQT A;  1QPM A;  3K4J A;  2PMH A;  3JR9 A;  1FP2 A;  4OWR B;  2V6C A;  3GXO A;  4RB1 A;  1YJW I;  5LGT A;  3VSK A;  3WTZ A;  4PSW A;  3KFW X;  3HRT A;  4UVC A;  2L01 A;  5JLX A;  2EIN H;  4RB2 C;  4Q4Z F;  4ENM A;  1IN6 A;  3HEF A;  3KZY A;  2BHY A;  2B9S A;  2A07 F;  4RDU A;  1NTC A;  2DA2 A;  1W36 C;  4L5E A;  1FOW A;  4DQ2 A;  1TWC J;  3LAP A;  1FMW A;  1XD7 A;  5FRO A;  1TC3 C;  3UNG C;  1JKR C;  4HQM A;  2JVG A;  1SAX A;  3DBL B;  3KLN A;  2Y0S A;  3U21 A;  4XKW A;  1JKP C;  2F4M B;  3V7S A;  5L3G A;  2RDP A;  1P9Q C;  2BY3 A;  3WHB A;  1QO0 D;  1FSH A;  3QU6 A;  2PFB A;  1X3Z B;  3BJO A;  3LSK A;  5K5Q A;  1Z77 A;  3DU5 A;  5GTH C;  4ZYE A;  2W1O A;  4YFX F;  1E3O C;  2H6B A;  5DCF A;  3GW2 A;  2G7H A;  3IAM 2;  3KP3 A;  3KPH A;  2FUG 2;  4NDL A;  2HDW A;  2X6O A;  4JBA A;  1IGN A;  2Y9Y A;  2LC2 A;  3LL7 A;  4DJA A;  5GAD J;  1X4O A;  2ZC2 A;  3DTK A;  5GTI C;  3CCU I;  1ZGJ A;  4EMS A;  2F5V A;  2Y2Z A;  1BA5 A;  1MH3 A;  3S1Q J;  5KVR A;  2LMD A;  2ZO4 A;  3OWT A;  1MNE A;  4P55 A;  3J81 Z;  2X6X A;  1OIS A;  2HGC A;  1ETO A;  2N8G A;  2KIU A;  5LGU A;  2MG4 A;  1FIA A;  4LD5 A;  2PMZ A;  5F08 A;  3TBI A;  4H0E A;  2MYS A;  3DLA A;  1ETQ A;  2H27 A;  2P0W A;  2ZSH B;  4ESF A;  1DUX C;  3J7A O;  3ZXS A;  3AL0 C;  2AXT C;  2VE8 A;  2HR3 A;  3T8T A;  2VOD A;  2CUE A;  2XKO A;  3CUO A;  1HF0 A;  2DA6 A;  3L2W A;  2V6E A;  2GOX B;  3ABM H;  2HVS A;  1WZ2 A;  4AM3 A;  4UXN A;  3TKY A;  2CJJ A;  1X19 A;  3FK7 A;  2Y0S N;  5B5E C;  4A6D A;  3L2Q A;  2WWY A;  5A2Q Z;  4WXD A;  3R61 A;  3U2R A;  4Y7N J;  3L00 A;  5ICC A;  5L3B A;  3F21 A;  2KRC A;  2QKM B;  3M7G A;  2NAZ A;  1A35 A;  2KZG A;  1VZ0 A;  5FLV A;  3OS2 A;  3AG2 H;  1BI1 A;  2C6Y A;  1IG7 A;  4ZH4 F;  1K61 A;  3BRO A;  3H9Q A;  2DT5 A;  2NXN B;  3GLX A;  3J80 K;  1F5T A;  1R7J A;  2OQR A;  3GX4 X;  3H92 A;  4IVN A;  4GDF A;  3RKX A;  3ZMS A;  1VQ8 I;  1IAW A;  1ZRF A;  4HZF A;  2WC2 A;  3OIO A;  5HOD A;  5DUI A;  3LSP A;  3ZQ7 A;  2JA2 A;  2FU4 A;  2V9K A;  4U0W A;  4NB5 A;  2CQQ A;  2VN2 A;  3CC4 I;  4MNU A;  1HQC A;  1ZRD A;  4WCG A;  2O5R A;  3T0Y A;  3CJT B;  3G4S I;  1EH7 A;  1MD0 A;  1Z7L A;  2H94 A;  3MQ0 A;  4BH9 A;  4D5F A;  4G7H F;  5HVQ C;  3QWL A;  3CD6 I;  4ENK A;  2IEK A;  2NNN A;  1AKH B;  2AHQ A;  1FWZ A;  4B1R A;  3SEQ A;  3GTG J;  2XSD C;  1E17 A;  2JT1 A;  4U0Y A;  3GFI A;  1IV8 A;  3DWL E;  2P7V B;  1Y8R B;  3A4C A;  4RAG A;  3S1R J;  3TDU C;  3H3U A;  1WHU A;  4I02 A;  1ZTR A;  2K85 A;  1S72 I;  2LTP A;  5CVJ A;  3J7Z I;  1H9G A;  3HXL A;  2DO7 A;  2EFO A;  1NK3 P;  1B1B A;  4A3K J;  1UFM A;  4FET A;  1H8A C;  1FPQ A;  5JVG F;  3TP3 A;  3OYN A;  2GA2 A;  3JRI A;  4P9F A;  2A69 F;  2HKX A;  1QRY A;  2Y75 A;  2QSH X;  1SC7 A;  3WTW C;  3HDD A;  1R1V A;  1D8J A;  1WJD A;  1MBJ A;  2R3S A;  3SYT A;  2OCE A;  1D0Y A;  2PMU A;  3CZ6 A;  4U88 A;  1HC8 A;  3HUG B;  1DPU A;  5IOZ A;  4PK4 A;  2L9R A;  3OMY A;  1DP7 P;  1I39 A;  4XKB A;  5B1B H;  3W2A A;  1AOY A;  3IHU A;  3RPQ A;  3TQN A;  1F9N A;  2UZK A;  1H9T A;  5EG0 A;  5J1Y A;  1H88 C;  2DXI A;  5L3D A;  3HIF A;  5BPD A;  3V4G A;  5E17 F;  1LJ9 A;  1GVJ A;  1HCR A;  1BR1 A;  4Y4R A;  2R7F A;  4IRI A;  1HKS A;  4YII A;  4E70 A;  1XGS A;  4NQW A;  1K78 A;  1MJB A;  5D5X B;  3CJN A;  2WBM A;  3QP5 A;  2XF7 A;  3CDH A;  3CQZ J;  3F0C A;  5EGO A;  4C2U A;  4YFK F;  1YIO A;  1A6Q A;  4IQ4 A;  2LF7 A;  1DPR A;  1QVT A;  2XGD A;  2XB0 X;  3O6B B;  2XGC A;  2ZJQ F;  4B43 A;  2RGV A;  4IPA A;  2DPD A;  2Y48 A;  1JUM A;  2HNH A;  3ULQ B;  2K86 A;  1W5T A;  2CG4 A;  4CZC A;  4WWC A;  1XDU A;  4AD9 A;  2RNJ A;  3UKG A;  5FD6 A;  3SHF A;  1I1S A;  1V55 H;  3BG9 A;  3CMM A;  4J19 A;  1ZLK A;  2DK5 A;  2YU3 A;  3PSF A;  3HJE A;  2DTZ A;  4A0Z A;  3HGG A;  4DW6 A;  2MW8 A;  3KE2 A;  1D1B A;  5F1J A;  1TT0 A;  4OIR F;  2G7U A;  3FIW A;  1R4N B;  2EWN A;  4ESJ A;  3JRC A;  3F23 A;  4PJL A;  1D1C A;  1JUS A;  3PL8 A;  2VAS A;  4D1Q A;  3GF2 A;  2XAS A;  1Z05 A;  3M4O J;  1Q1V A;  1MND A;  1HW2 A;  3GTK J;  4CSW A;  2VQH A;  1IN7 A;  3TW6 A;  3PIP F;  2XGE A;  4HSR A;  3BLY A;  4HV5 A;  2PG4 A;  4ANJ A;  3DKX A;  3HSE A;  3ONQ A;  5EYR A;  3IH3 A;  1MMS A;  5LEK A;  4OU0 A;  4PJM A;  5BMZ A;  1DQU A;  1U2W A;  5M5X J;  3ASN H;  5AIP A;  4IXA A;  1YJ9 I;  4XLC A;  1OCO H;  2HXO A;  2FQ3 A;  3K4L A;  2QSG X;  3R0J A;  2DMQ A;  3IUO A;  1YS6 A;  1T0F C;  1LNW A;  2KIF A;  2FBI A;  1R23 A;  4Y13 A;  4WX9 A;  3H3Z A;  4NC7 A;  2P81 A;  2GXB A;  3L2U A;  4M6X A;  1TW2 A;  3QPS A;  3DCF A;  2ID3 A;  3PIO F;  3G1L A;  3ZQQ A;  5E8G A;  4IX7 A;  3ZQF A;  4I2O A;  1RPW A;  4I01 A;  1P2F A;  4NNJ A;  2OJE D;  4LIV A;  4LG0 A;  1VND A;  5DV5 A;  3F6V A;  3K2Z A;  1IW7 F;  1S6L A;  2JUG A;  4OAZ A;  3IH4 A;  3S3N A;  1MH4 A;  2X51 A;  1MNM C;  5FFZ A;  5D4S A;  1JTY A;  3MMY B;  2ESH A;  2A3S A;  5EZH A;  2GWR A;  5LRS A;  3OYL A;  2ZJR F;  3KX2 A;  1DU0 A;  3GFL A;  1JJ6 C;  2XAH A;  5DYM A;  5FKN A;  3OIQ A;  4E6K G;  3I64 A;  4ZDP A;  4QPQ A;  4MO7 A;  1BOB A;  1KU2 A;  4UV8 A;  3U1K A;  3ELK A;  2PX9 A;  2OZ6 A;  5FLM J;  1SVO A;  1VQK I;  3ZMT A;  1RKW A;  2COB A;  2KQR A;  1UHM A;  2M3A A;  4CHU A;  4AIH A;  3CLQ A;  2HI3 A;  3VDX A;  4PFO A;  2BY1 A;  1WJA A;  2JA7 J;  1AA7 A;  2M7A A;  2HYG D;  3BJA A;  3S93 A;  3V7C A;  2YX7 A;  5GPA A;  2ICW G;  2NOG A;  2XDV A;  5J6X A;  3COA C;  3K4N A;  4G9Y A;  4IRG A;  1EV7 A;  3BZC A;  4MHG A;  5L3C A;  1UST A;  5KNL A;  5H6R A;  1A31 A;  3HG9 A;  1DGR M;  4Y33 A;  1IC8 A;  2STT A;  1Y1W J;  3KZI C;  2EZK A;  5D8L B;  1YG2 A;  4XBF A;  3C18 A;  5HOO A;  2GA1 A;  3U1D A;  3CUQ C;  3VOE A;  1ZK8 A;  2A05 A;  3BY6 A;  5IYD J;  2KJB A;  2MSY A;  3F8F A;  4DBQ A;  4AVZ A;  1QVU A;  2VQC A;  3ERM A;  4FTH A;  3H5A A;  1BIA A;  2QF7 A;  3K9T A;  1SFE A;  1GV5 A;  2K9M A;  4C30 A;  4F52 A;  4OOI A;  1KYZ A;  1JHF A;  2BY0 A;  2VQG A;  2TDX A;  1I27 A;  4XOR A;  3IKV A;  4A6E A;  1ZG5 A;  1T33 A;  4BXU A;  2VBW A;  1OKR A;  4ITV A;  4M9Z A;  1PDN C;  5E3O A;  3LA2 A;  3BG6 A;  5TRD A;  4K2E A;  4MLO A;  2WV0 A;  3MKW B;  1JTX A;  2H6C A;  3DBR B;  3OR2 C;  1XSX A;  2X85 A;  4ESB A;  2DDA A;  1FP1 D;  1WJ5 A;  2UXX A;  4E7J A;  1W36 D;  2K3F A;  3OSF A;  1W0T A;  4BUP A;  2ECC A;  3DPL C;  3MKY B;  2FOW A;  4A3J J;  3RTR A;  1D8K A;  4XOP A;  2Z33 A;  2OTL I;  1MMN A;  2W84 A;  2MFZ A;  1LE8 A;  4BEH A;  2ME6 A;  3RPU A;  3RSN A;  3K6G A;  2E2H J;  2XUB A;  3LSM A;  3ML6 A;  5HNH A;  2OU2 A;  3LST A;  1Z3X A;  2RRE A;  4M72 A;  3HOX J;  2HDC A;  1R00 A;  2HU9 A;  2DBB A;  4L9J A;  3ZQH A;  2LDU A;  3I54 A;  3RZO J;  2E5N A;  2P5V A;  4X0G A;  5ILS A;  1EKE A;  2R5Z A;  4F3Q A;  5EG0 B;  3JSP A;  2IS6 A;  1O3S A;  1YO5 C;  2EFP A;  2EV5 A;  4IEJ A;  5DTD A;  2W7N A;  2LY9 A;  2DLL A;  2DFH A;  3HHG A;  1ULY A;  3BTC A;  2O6G E;  2K3P A;  2NS0 A;  4ETS A;  3ZR8 X;  1D1A A;  5HLH A;  4NQW B;  3HOU J;  2LY1 A;  2DA1 A;  1XSD A;  2MBF A;  2XRO A;  1IDZ A;  2F4I A;  4DZJ A;  1WPK A;  5EGO B;  2GIV A;  1Z6R A;  3GUD A;  1T95 A;  1EH6 A;  5EF6 A;  3OL3 A;  2ZXH A;  2QQ9 A;  3DEU A;  4XM3 A;  1BI2 A;  3TO6 A;  2KIS A;  2GXA A;  3T1B A;  4N4N B;  1PUF A;  3U9G A;  5H2F C;  3WGG A;  1GHC A;  1WFX A;  1VQ7 I;  3K0L A;  3FXK A;  5BPI A;  1VQM I;  5HS7 A;  3NQO A;  4NC6 A;  1BN5 A;  1GXP A;  4M9X A;  6PAX A;  4QLC U;  1REP C;  5J3L A;  1SVL A;  2ZB9 A;  3I4P A;  1J59 A;  1YI2 I;  5D6E A;  4G7O F;  1S8N A;  1S3J A;  2ZXJ A;  3TMO A;  4OIQ F;  1S5L C;  3IKT A;  1FC3 A;  2QBY B;  2JA8 J;  4XLE A;  2HQR A;  3LOC A;  4HNU A;  1MMD A;  1V5E A;  2XAJ A;  2ZFU A;  2E71 A;  1QNT A;  1G3Y A;  4KIG A;  2PI0 A;  2IGM A;  5JFR A;  1ZR2 A;  2RKH A;  4O5V A;  3OR1 C;  4C3J J;  4BYY A;  2KIM A;  1ZRE A;  2CQK A;  2L7Z A;  3HRM A;  3FXQ A;  1ENH A;  1TQP A;  4CCK A;  4PGG A;  2EIM H;  3OYG A;  4KIS A;  3LQR A;  5E1W A;  3MVP A;  4BS9 A;  4NUB A;  2DW4 A;  3RYP A;  1BM9 A;  1I6H J;  2YX4 A;  3G6E I;  5M5W J;  3Q9V A;  1UG0 A;  4A3M J;  3CCQ I;  3RI4 A;  2Z16 A;  1L0O C;  3MWM A;  3QRF F;  3DP7 A;  3M1C A;  3PSI A;  3BCB A;  1FZP B;  5F0H A;  2Q8K A;  4EM1 A;  3V7R A;  3FBN B;  2E1N A;  3EPZ A;  2IGN A;  4HLX A;  1G2H A;  4BE0 A;  4HF1 A;  2R92 J;  3ZRG A;  2HKO A;  3JSO A;  1TLH B;  2HTS A;  1XSV A;  4HX8 A;  2KIQ A;  4GYI A;  1LDK B;  4LG0 B;  3CP8 A;  1LVA A;  2DA4 A;  2A6H F;  3BR2 A;  3QOE A;  1BL0 A;  1KU3 A;  5AIQ A;  2IRF G;  4N9I A;  2DMN A;  3RIR A;  2AXL A;  1TWG J;  3K1N A;  3OS1 A;  1JJ8 C;  5LRR A;  1I6X A;  3K1P A;  2K4J A;  3CLO A;  3FIS A;  3GVA A;  4XNF A;  2KL4 A;  1ZAR A;  2R0Q C;  2Z9O A;  1T2K A;  1LB2 A;  3FXO A;  2A68 F;  4BU2 A;  5C4X J;  4PDK A;  1IRX A;  2IA1 A;  3FWE A;  5FD5 A;  3QPH A;  1U3E M;  2B63 J;  2OZU A;  3AKZ A;  1AU7 A;  3PO2 J;  2QQB A;  1GDT A;  4BQA A;  2LK2 A;  3C2G A;  3KYL A;  4S05 A;  3P9I A;  2R4G A;  1AWC A;  4A12 A;  4R1H A;  5ILV A;  5IYC J;  2KZV A;  4XR6 A;  4U7B A;  4E7L A;  3ESW B;  4P96 A;  5ICF A;  3CMY A;  1O3R A;  2E2I J;  1XS9 A;  4RAY A;  4LB6 B;  3LAJ A;  2JK3 A;  3LA7 A;  4D5C A;  2KHM A;  4ON0 A;  3CP2 A;  2BVL A;  1UEL B;  3GBG A;  5CVU A;  4GYG A;  1A5J A;  2XHK A;  1OR7 C;  4II3 A;  2LKS A;  3S2W A;  3HOW J;  3BZK A;  1Z0X A;  5EZG A;  3HSR A;  2QLZ A;  4KIF A;  1MW7 A;  5CQG A;  1TWH J;  2M0C A;  2KJC A;  4LFU A;  1YYV A;  1GV2 A;  3E5Q A;  1X3U A;  3DKW A;  2WA0 A;  5HDK A;  1XCB A;  3BWG A;  2OC6 A;  1Z67 A;  3HTU A;  2QSF X;  4KN4 X;  1ZQ3 P;  1TW3 A;  2D2W A;  3F72 A;  2DAO A;  3F6O A;  2HOS A;  5D5V B;  2WY8 Q;  2VKE A;  1RC9 A;  2VKH A;  4UB6 C;  4UNO A;  4G7Z F;  3K1M A;  4C2M J;  2VJ5 A;  2W82 A;  2ISZ A;  4AIJ A;  5F27 A;  2VLA A;  3H3V K;  5KK1 A;  4DZP A;  1HBX G;  3Q5F A;  4LMY A;  3F22 A;  1N75 A;  1XDS A;  1U9N A;  4C3I J;  2LLK A;  2ZCW A;  2EFQ A;  4UUS A;  3J7Y J;  1R5H A;  4RM2 A;  2HDD A;  1TBX A;  1YLF A;  1ZGW A;  4AUX A;  1W7P A;  2FRH A;  2VL8 A;  1K79 A;  3KP4 A;  3WE2 A;  4B3X A;  1V5F A;  2FBK A;  5EEH A;  1STZ A;  2VC1 A;  4I0A A;  4HQE A;  1GUU A;  2J5O A;  1LE8 B;  4BEH B;  2Y31 A;  3C2H A;  3LWF A;  2DFE A;  5IT3 A;  5FRM A;  3I3L A;  2ZME A;  1Z9C A;  3E3V A;  1J7K A;  2FQ4 A;  1Z6T A;  1TL8 A;  2L0K A;  2OPT A;  3Q9S A;  3S3O A;  3GTQ J;  1HST A;  2K9N A;  4BJT A;  3NRV A;  1SVM A;  2F2E A;  2EFN A;  2IPQ X;  2R5Z B;  1Y39 A;  3ZN0 A;  2MLG A;  4M74 A;  1FLI A;  1ONV A;  1R22 A;  2KLO A;  4HW0 A;  3WTT C;  5LD2 C;  3ZQL A;  4MEX F;  3ECH A;  2LD5 A;  3QYB A;  4ZTF A;  3FKJ A;  1IXS B;  1T8I A;  2BBY A;  3GZN B;  1X2N A;  3F8M A;  3NAR A;  1FBU A;  3A03 A;  4IL6 C;  4XIC A;  1JKQ C;  2Z3Y A;  3TOB A;  1MBH A;  1H89 C;  3V8J A;  3TP0 A;  3HHH A;  3O3K A;  1RET A;  3WE3 A;  2IXS A;  4CYC A;  1LVK A;  1PUF B;  2EH3 A;  1IXR C;  2HYJ A;  2DQR A;  2P8T A;  2WAQ A;  4M6Y A;  4PUS A;  4I98 B;  4EJT A;  3LMM A;  4D7N A;  2G0E A;  2IP2 A;  4RMN A;  4G6T B;  3HRU A;  2FE3 A;  4P1W A;  4BL0 B;  4OIP F;  2BV6 A;  4FX0 A;  1RUO A;  4E7S A;  2PJR A;  4ZJZ A;  1JE8 A;  2VUM J;  1ZR4 A;  2X4H A;  2KFD A;  1G3T A;  2D1H A;  3BR6 A;  2KDZ A;  2JTV A;  3HGY A;  1JGG A;  1SD4 A;  2CU7 A;  2PMZ N;  3HOV J;  4IHW A;  1BJA A;  1XC5 A;  4BAC A;  1ZG1 A;  1XMX A;  1OPC A;  2X1D A;  4EGY A;  1YX3 A;  2COM A;  4A3L J;  2TRT A;  1N78 A;  5FLX Z;  3OV8 A;  4C3H J;  2FMY A;  2GZW A;  3KYC B;  1HA8 A;  1U0J A;  2ID6 A;  2LYC A;  2XVC A;  3BZ6 A;  5BOX A;  3R4K A;  5E1Z B;  1O3T A;  3W6J B;  4B8X A;  4ZTJ A;  2EBI A;  2K9S A;  4N4O B;  5IPA A;  2W57 A;  1MBF A;  3HB9 A;  5J4Y A;  4ZDO A;  1LEB A;  4LB5 A;  4LK0 F;  2UXN A;  3SZP A;  2M4G A;  3OYI A;  2VI6 A;  3M3Y J;  2F5F A;  1VQN I;  1QU3 A;  3WU1 B;  5LHG A;  2XPU A;  2DK8 A;  3OSG A;  2QEN A;  1D0Z A;  4YEJ A;  3RCO A;  1KYW A;  3E5X A;  1HSJ A;  1SFX A;  4PCQ A;  3DF8 A;  4BHB A;  4UB8 C;  3ZQC A;  1N25 A;  1TNT A;  2M1B A;  4W97 A;  3CME I;  4CXF A;  2ECB A;  2VPR A;  2AQF A;  1OCC H;  1WJC A;  2JRM A;  5F64 A;  2E7W A;  2CW0 F;  2ZKZ A;  2PBI A;  3OYA A;  1P7I A;  4CCN A;  4JX6 A;  4YFN F;  1H0M A;  3DLL F;  2DJI A;  4IRH A;  4AIK A;  4MIM A;  3W6V A;  3ABT A;  1B8I A;  4YEL A;  5EJC A;  3CC2 I;  4M3D A;  4JX5 A;  4RAZ A;  1X1P A;  4XSZ F;  2DMU A;  2HPM A;  2QA4 I;  2W00 A;  5FO5 A;  2F5D A;  3KEQ A;  3TO7 A;  2JA6 J;  4CCO A;  3CDI A;  2DT6 A;  3L1P A;  2I5U A;  1U5T A;  2EA2 A;  2IBD A;  3MEX A;  5CPR B;  4ZYG A;  2E60 A;  2E2J J;  2M0M A;  3EYI A;  3G73 A;  4Q47 A;  3F9K A;  4PJN A;  2Y30 A;  5GAG J;  3AFH A;  3BTI A;  3DTI A;  4IOA F;  1HDP A;  3CMA I;  2OD5 A;  3A2K A;  1FTT A;  2DA7 A;  1R58 A;  4GCV A;  3SZT A;  1JUP A;  3JCU C;  4Y15 A;  4GO1 A;  1WQ2 A;  1S29 A;  2F5C A;  1WI3 A;  4D9J A;  2ISY A;  5M5Y J;  1MBE A;  1J09 A;  4CCM A;  2G9W A;  3I59 A;  4XRS A;  3BTJ A;  4MEY F;  2JQ7 A;  3BPV A;  2O61 A;  1ZEL A;  2KMU A;  4W1U A;  3CO7 C;  1KA8 A;  3ZGK A;  1YW7 A;  3S8P A;  4ENN A;  4FHT A;  1SMT A;  2DI3 A;  2HOT A;  1B4A A;  5C3E J;  1UCR A;  3OIP A;  4JK1 X;  3VYT B;  1V4R A;  3BT9 A;  1V5G A;  3I71 A;  2WY7 Q;  1FYK A;  3HOY J;  2L7K A;  1BI0 A;  5F1R A;  2CV0 A;  2QBY A;  2XKP A;  3JRG A;  9ANT A;  1APL C;  3K70 D;  2X0L A;  1ZYR F;  1IZ1 A;  3I55 I;  1Z1D A;  2JSC A;  1A04 A;  1X58 A;  2XAG A;  3DQV C;  3GO5 A;  2QM3 A;  1MMA A;  5K5O A;  1S9H A;  2DQL A;  4BE2 A;  2BGC A;  3KZZ A;  1VTN C;  2QYO A;  2ETH A;  4Q48 A;  2ZBK A;  3WTS C;  2IVM A;  3S2D J;  2R7O A;  3GTP J;  2HOA A;  3H0D A;  4BHC A;  4XID A;  4EJV A;  1HKT A;  2LSO A;  4OMZ A;  1MGT A;  1OYY A;  3RKQ A;  3KET A;  1WH5 A;  2V1U A;  1O57 A;  1GVD A;  3WGH A;  4UHT A;  4FT8 A;  4UUS B;  1DU6 A;  1JKO C;  3LA3 A;  1W7P B;  1OYI A;  2JUC A;  2V1X A;  1O7L A;  4IOC F;  4B48 A;  1TTY A;  3K2A A;  2O9L A;  1SAU A;  1HXD A;  1XPX A;  2Q0O A;  4HST A;  4CA0 A;  2RVC A;  2ZME B;  3ROU A;  1W4M A;  2W24 A;  3QPL A;  1RRJ A;  4CGZ A;  4YIR X;  2QEX I;  1RKT A;  3ECO A;  2EZL A;  2R7Q A;  4M71 A;  4ZZD A;  4HEA 2;  4HF2 A;  4MTD A;  4RB3 C;  2UWM A;  1NG6 A;  3Q0U A;  1OJL A;  5E3N A;  3D5L A;  4EJO A;  2E19 A;  1TP4 A;  4DYR A;  3E6C C;  1VQ6 I;  4Z6Y A;  1XG1 A;  1WRJ A;  1R5G A;  4S04 A;  2V9P A;  1XGN A;  1B6A A;  3QU3 A;  2K27 A;  4O6J A;  4PFP A;  4CCL A;  2IS4 A;  2AO9 A;  2EJR A;  5B3S H;  1LDJ A;  3EUH A;  3F3X A;  1ZGA A;  3DPT A;  5FKK A;  1ETX A;  3H9J A;  4A3D J;  3ISP A;  4CIC A;  3RPU D;  4XN0 A;  3K4K A;  5JVT A;  4BXX J;  2LKX A;  2V1D A;  4CYC B;  4EV0 A;  1EA3 A;  3BJ6 A;  4FAS D;  3VWB A;  2K7L A;  2DPU A;  5F0C A;  1E0E A;  1MKM A;  3F8B A;  4HRI A;  1FOX A;  2V9V A;  3M8J A;  2XRL A;  4KN7 X;  5M3M J;  3TO9 A;  1WH7 A;  2RQP A;  3EUK L;  1UG2 A;  4KMF A;  3K4B A;  3FXU A;  2RAE A;  2B0L A;  3BPX A;  1BOA A;  2PJR B;  3N4M A;  1YOV B;  2Q2E A;  3GWZ A;  1YJN I;  2E1C A;  1YTY A;  2XF6 A;  1IRG A;  3HPH A;  2CWE A;  2CQN A;  3JRB A;  5F6F A;  3W2W A;  2LRE A;  2Y9Z A;  3TL4 X;  3V42 A;  3AAF A;  3A1Y A;  1B72 A;  1JI8 A;  5EEG A;  2Y69 H;  1TWA J;  1V3F A;  4XRF A;  4XN3 A;  2X1C A;  1FJL A;  3NEU A;  4ENJ A;  3QAH A;  2NOJ B;  2L7F P;  3E6B A;  2O7O A;  2QUF A;  1MBG A;  2K9Q A;  3J80 Z;  4HPQ A;  5K7F A;  1FSE A;  4LIT A;  4WXC A;  4A3C J;  2ESN A;  3I4N J;  1SD7 A;  2DTR A;  4A2U A;  5J1R A;  5GPC A;  1DGW Y;  4XRM A;  5F0F A;  1MZB A;  2CSO A;  4OAY A;  2QQ8 A;  3SXY A;  3LSH A;  4B47 A;  2KRH A;  4EJU A;  1K7A A;  2M45 A;  3CCJ I;  3ZN1 A;  2R7V A;  4E4H A;  2PEX A;  4CUG A;  1FIP A;  3T5X A;  4DYC A;  2OCC H;  5K7Z A;  3BC8 A;  5DDG A;  1FTZ A;  4EEF G;  3SDG A;  1XN7 A; 
#chains in the Genus database with same CATH homology
 4A5N A;  2OBP A;  2A6E F;  3KP2 A;  2P5K A;  2BE5 F;  2H09 A;  4LLL A;  2JPC A;  1KU7 A;  5ERI A;  4FX4 A;  1SD6 A;  2LNB A;  3M8E A;  4KNY A;  1FY7 A;  4HA8 A;  5A2Q K;  1U5T B;  4L0Y B;  4A0Y A;  1R36 A;  3WTX C;  4A0X A;  2L02 A;  3PQJ A;  3P9C A;  2QVO A;  2W85 A;  4CDG A;  4HX7 A;  4UUV A;  1RZ4 A;  3I59 B;  1MDM A;  1G3S A;  2FNA A;  3EET A;  3T8R A;  2IA0 A;  5D4R A;  3DV8 A;  3GFJ A;  3RYR A;  2D45 A;  3FZV A;  5LHI A;  4LGW A;  2YR2 A;  5FGM A;  4AWX B;  5DD4 A;  1U6G A;  4EVI A;  1XGO A;  1J0R A;  3WTU C;  5AON A;  2PQ8 A;  2DFI A;  4EM2 A;  4A5M A;  3B02 A;  1T98 A;  5D5U B;  4MGR A;  4G8X A;  3CTA A;  1G4D A;  3KEO A;  4DNC A;  1TQI A;  4HOB A;  5E1X A;  1Z7U A;  3ZMV A;  4HLY A;  2M30 A;  4WXH A;  3MFK A;  5LHH A;  2EA4 A;  1HW1 A;  1MJ9 A;  3IL2 A;  1XMA A;  4M9S A;  1B9M A;  3KP7 A;  3HRS A;  4IJA A;  1ON1 A;  1K6O A;  3VFZ A;  1R1T A;  2O8X A;  1Y0U A;  1SD5 A;  2HWV A;  4RGU A;  4Z2Y A;  1Q1H A;  2ADU A;  2O0Y A;  3P7N A;  1XB4 A;  3QP6 A;  3V8K A;  4HDU A;  2F5E A;  3LQQ A;  2RC4 A;  5ILU A;  1UB9 A;  3KP6 A;  3E97 A;  3E5U A;  2A5Y B;  2GXG A;  1E2X A;  3GZ6 A;  4LLN A;  1JGS A;  5J8F A;  1I5Z A;  1W7P D;  5CJ9 A;  2XAQ A;  2GAU A;  2MC3 A;  3MZY A;  5HLI A;  1F4K A;  4LK1 F;  3ZMZ A;  1YW8 A;  3FXR A;  4HBL A;  4XLN F;  1KGS A;  1WI9 A;  2PLY A;  2HTJ A;  3B73 A;  2ZNZ A;  3WOD F;  2HQN A;  1L3L A;  3OOP A;  1USS A;  2EK5 A;  5DD8 A;  1ZHF A;  3TGN A;  4IHT A;  1S7A A;  2FOK A;  4LLG F;  3E6M A;  2V79 A;  3L2C A;  2L54 A;  1BC8 C;  1FOK A;  5K1Y A;  1U78 A;  2VXZ A;  4U7D A;  3FM5 A;  1J5Y A;  3RKW A;  1GXQ A;  5L3F A;  3ZMU A;  2Z99 A;  4BAY A;  3I0T A;  2M8E A;  3HOS A;  4PZJ A;  4MTE A;  4BHP A;  2QWW A;  2XIG A;  2BEO A;  5FFX A;  2DU9 A;  2FXA A;  4UVB A;  5K5R A;  4I7H A;  5E18 F;  1FYL A;  1D3Y A;  4RGR A;  1RNL A;  2EV6 A;  4EJW A;  5H6Q A;  4WF2 A;  2STW A;  2O03 A;  3G3Z A;  2FF4 A;  4KT5 C;  4OIN F;  1SFU A;  4G6D A;  2VE9 A;  3KCC A;  4EQQ A;  4HAM A;  3IRR A;  2CFX A;  3GZ5 A;  1IUY A;  5E20 A;  3GEZ A;  4KYW A;  2PN6 A;  3GYH X;  4LJZ F;  2O3F A;  3FM3 A;  4KIC A;  2RV8 A;  1FYM A;  1PP8 F;  2P6T A;  2ELH A;  3HOT A;  3L9F A;  3PFI A;  3M1E A;  2VOO A;  2YSR A;  1TQM A;  2XRN A;  1IN5 A;  2FEZ A;  2HYF A;  2BYV E;  4HDV A;  2LF8 A;  3ABU A;  5J8C A;  1MDM B;  1LQ1 A;  4YG2 F;  2VOP A;  5DUK A;  4D0P A;  2P7C B;  3IRQ A;  3PQK A;  2J5P A;  2QQA A;  3F8N A;  1IRF A;  4CZZ A;  2P5L C;  3ZP5 A;  1SMY F;  1IF1 A;  5D5W B;  2OAZ A;  2FSW A;  5CLS A;  1CGP A;  4AVP A;  1WWX A;  1D5V A;  3WTV C;  1IN8 A;  1I1G A;  1S7O A;  2MLK A;  1YFH A;  4BNC A;  1IXC A;  4KMU X;  4I0B A;  5IT9 K;  5HDG A;  1P4X A;  1HW5 A;  3VB2 A;  5BS6 A;  1PUE E;  3JW4 A;  1PP7 U;  1G6N A;  4GGG A;  3BP8 A;  5L3E A;  5DCM A;  1T38 A;  3RDI A;  2YPR A;  2L3D A;  2IT0 A;  1DDN A;  5HLG A;  1CF7 A;  1T0F A;  1ODD A;  1QBJ A;  2MH2 A;  2WTE A;  1QQI A;  3I53 A;  4G94 A;  4Y17 A;  1NHA A;  4L18 B;  3DFG A;  3VOD A;  3DXJ F;  5E8I A;  4ZYH A;  2FA5 A;  3W6K B;  2D1V A;  2VBZ A;  3WGI A;  2IJL A;  4MQ9 F;  2ACJ A;  1KU9 A;  1IN4 A;  5CVV A;  1FNN A;  4KDP A;  3MCZ A;  4R8H A;  2HEO A;  5TJJ A;  1ZH5 A;  1ON2 A;  3R6S A;  1C0W A;  2HFH A;  3BDD A;  1BBY A;  3CO6 C;  4KIB A;  4F7Z A;  5BQT A;  2ZNY A;  3HSF A;  1TNS A;  3M9A A;  5HS9 A;  4HYE A;  2MA3 A;  4P5O A;  2FNP A;  3JAM K;  2VON A;  4XSX F;  3E6D A;  4EM0 B;  2VBY A;  2M87 A;  3CUQ A;  3L09 A;  2Y0M A;  2LKP A;  3TDZ C;  3LFK A;  1Z91 A;  1MJA A;  5ICE A;  4KUM A;  5D8K B;  1KQ0 A;  3D0S A;  3SFZ A;  1G3W A;  4G6Q A;  3I58 A;  1XCV A;  4Q5S F;  3EDP A;  2XAF A;  5H20 A;  2HOE A;  1FBS A;  1ZRC A;  2ZJ2 A;  1J2X A;  3WU0 A;  2ZFW A;  4CYD A;  2VBX A;  2CYY A;  4L0Z B;  2JRT A;  2JZY A;  1FX7 A;  1LDD A;  4XLP F;  1JXS A;  1U8R A;  4HX4 A;  4KFC A;  1EH8 A;  1U5T C;  4OIO F;  2K02 A;  4JQF A;  4GXO A;  4ZZL A;  1R1U A;  1BIB A;  2HZT A;  4OMY A;  2M5W A;  4YIF A;  5FB2 A;  1XMK A;  2VT2 A;  3JTH A;  2FML A;  2VC0 A;  3K69 A;  4RGS A;  1KQ9 A;  4L5I A;  2KRF A;  3VEP A;  2JPB A;  1J9I A;  1P6R A;  3N97 A;  1F1Z A;  1QGP A;  1QZZ A;  2R7D A;  3KLO A;  1YQA A;  3RKY A;  1YS7 A;  5D6F A;  2VT3 A;  3QPT A;  2IA2 A;  4RGX A;  3FMQ A;  4RB0 A;  3C7J A;  1O7F A;  1OMI A;  5CVI A;  4M73 A;  1RUN A;  3J81 K;  2MH9 A;  5DCM B;  3IC7 A;  3JTG A;  3BOQ A;  4TV7 A;  4EGZ A;  1B9N A;  3KP5 A;  3C1D A;  1XGM A;  1CF7 B;  5CVR A;  4WK8 F;  4CO8 A;  1UHW A;  3C3W A;  1ZG3 A;  1B59 A;  2XV4 S;  3SQN A;  5IT9 Z;  4U0V A;  1ZAO A;  3R60 A;  4L5J A;  2IW5 A;  3L7W A;  1HKQ A;  3R0A A;  1J75 A;  2P4W A;  4N0B A;  2PJP A;  4UVA A;  1LEA A;  1YW9 A;  5LGN A;  3P9K A;  3MAJ A;  1P4W A;  2XGX A;  5LBQ A;  2NNY A;  2W25 A;  4PGH A;  2L4A A;  4HF0 A;  3FMS A;  3O2P E;  4B09 A;  3REO A;  3QOP A;  1P4A A;  4L9N A;  1K78 B;  2GQQ A;  3V8L A;  2EV0 A;  2MD5 A;  3ZMD A;  2OQG A;  2EB7 A;  4IF4 A;  1WKM A;  4ASN A;  3FMR A;  5FLX K;  2L4M A;  2P6S A;  4P9U A;  2QZ8 A;  5CYV A;  1JHH A;  2CGP A;  3WG9 A;  2HS5 A;  3CUQ B;  1RI7 A;  2KKO A;  1OR7 A;  4RS8 A;  2E7X A;  2Z5U A;  2CO5 A;  2K4B A;  4UV9 A;  1FBQ A;  5LLQ A;  3RJP A;  3ERE D;  1P92 A;  3FX3 A;  3I5U A;  4ZYD A;  3F8C A;  4O3M A;  2OA4 A;  5ED4 A;  2FBH A;  3JAM Z;  5LEJ A;  1T6S A;  3WTY C;  4L9V A;  5JR3 A;  5HDN A;  1ZN2 A;  2AS5 F;  4R79 A;  4HV6 A;  4L9T A;  2RN7 A;  3TOA A;  5JHU A;  3MZH A;  4MQV A;  3IWZ A;  1OYW A;  4KA4 A;  3HTS B;  4I09 A;  4N9H A;  1ZLJ A;  3HUG A;  3HYI A;  1QZY A;  1W5S A;  5ICG A;  1T39 A;  1RIO H;  1BI3 A;  5DEQ A;  1O3Q A;  3ZPL A;  2NRA C;  2EFW A;  1KQ8 A;  3M8F A;  1FT9 A;  3EYY A;  2A61 A;  2NYX A;  5HS8 A;  4IHS A;  3EQL F;  3FF5 A;  1WSU A;  1BC7 C;  3GFM A;  4QWQ A;  4NHJ A;  5JI6 A;  3IWF A;  3FHZ A;  1QPM A;  2PMH A;  1FP2 A;  2V6C A;  3GXO A;  4RB1 A;  5LGT A;  3WTZ A;  3KFW X;  3HRT A;  4UVC A;  2L01 A;  4RB2 C;  4Q4Z F;  4ENM A;  1IN6 A;  3KZY A;  2A07 F;  4DQ2 A;  3LAP A;  1XD7 A;  4HQM A;  1SAX A;  3KLN A;  3V7S A;  5L3G A;  2RDP A;  1QO0 D;  1FSH A;  3QU6 A;  2PFB A;  3BJO A;  5K5Q A;  4ZYE A;  4YFX F;  2H6B A;  5DCF A;  3GW2 A;  2G7H A;  3KP3 A;  4JBA A;  1ZGJ A;  4EMS A;  5KVR A;  2ZO4 A;  4P55 A;  3J81 Z;  2HGC A;  2KIU A;  5LGU A;  4LD5 A;  4H0E A;  2H27 A;  4ESF A;  1DUX C;  3J7A O;  2VE8 A;  2HR3 A;  3T8T A;  2VOD A;  2XKO A;  3CUO A;  4UXN A;  3TKY A;  4A6D A;  2WWY A;  5A2Q Z;  4WXD A;  3R61 A;  3U2R A;  3L00 A;  5ICC A;  5L3B A;  3F21 A;  3M7G A;  2NAZ A;  1BI1 A;  2C6Y A;  4ZH4 F;  3BRO A;  2DT5 A;  3GLX A;  3J80 K;  1F5T A;  1R7J A;  2OQR A;  3GX4 X;  3H92 A;  4IVN A;  3RKX A;  3ZMS A;  1IAW A;  1ZRF A;  4HZF A;  2WC2 A;  5DUI A;  3ZQ7 A;  2FU4 A;  4U0W A;  4NB5 A;  2VN2 A;  4MNU A;  1HQC A;  1ZRD A;  4WCG A;  3T0Y A;  1EH7 A;  1MD0 A;  2H94 A;  3MQ0 A;  4BH9 A;  4G7H F;  5HVQ C;  4ENK A;  2NNN A;  1FWZ A;  1E17 A;  2JT1 A;  4U0Y A;  3GFI A;  2P7V B;  3TDU C;  3H3U A;  4I02 A;  5CVJ A;  1H9G A;  2DO7 A;  2EFO A;  1B1B A;  1UFM A;  1FPQ A;  2GA2 A;  4P9F A;  2A69 F;  2HKX A;  2Y75 A;  3WTW C;  1R1V A;  1D8J A;  2R3S A;  2PMU A;  4U88 A;  1DPU A;  1DP7 P;  1AOY A;  3IHU A;  3RPQ A;  3TQN A;  1F9N A;  2UZK A;  1H9T A;  5L3D A;  3HIF A;  5BPD A;  3V4G A;  5E17 F;  1LJ9 A;  1GVJ A;  2R7F A;  4IRI A;  1HKS A;  4YII A;  4E70 A;  1XGS A;  4NQW A;  1K78 A;  1MJB A;  5D5X B;  3CJN A;  3QP5 A;  3CDH A;  4YFK F;  1YIO A;  2LF7 A;  1DPR A;  3O6B B;  2RGV A;  4IPA A;  2DPD A;  2Y48 A;  3ULQ B;  2K86 A;  1W5T A;  2CG4 A;  4WWC A;  1XDU A;  4AD9 A;  2RNJ A;  5FD6 A;  3SHF A;  1I1S A;  1ZLK A;  2DK5 A;  2YU3 A;  4A0Z A;  3KE2 A;  4OIR F;  2G7U A;  2EWN A;  4ESJ A;  3F23 A;  3GF2 A;  2XAS A;  1Z05 A;  1HW2 A;  1IN7 A;  4HV5 A;  2PG4 A;  3HSE A;  5LEK A;  4OU0 A;  5BMZ A;  1U2W A;  5AIP A;  4IXA A;  2FQ3 A;  3R0J A;  1YS6 A;  1LNW A;  2KIF A;  2FBI A;  1R23 A;  4Y13 A;  4WX9 A;  3H3Z A;  2GXB A;  4M6X A;  1TW2 A;  5E8G A;  4I2O A;  4I01 A;  1P2F A;  4LG0 A;  5DV5 A;  3F6V A;  3K2Z A;  1IW7 F;  1S6L A;  5FFZ A;  5D4S A;  2ESH A;  2A3S A;  2GWR A;  5LRS A;  3GFL A;  2XAH A;  5DYM A;  3I64 A;  1KU2 A;  4UV8 A;  3ELK A;  2OZ6 A;  3ZMT A;  1UHM A;  4CHU A;  4AIH A;  2HYG D;  3BJA A;  3V7C A;  2YX7 A;  5J6X A;  3COA C;  4G9Y A;  4IRG A;  1EV7 A;  4MHG A;  5L3C A;  1UST A;  5H6R A;  2STT A;  5D8L B;  1YG2 A;  4XBF A;  3C18 A;  5HOO A;  2GA1 A;  3U1D A;  3CUQ C;  3VOE A;  3BY6 A;  2KJB A;  3F8F A;  1BIA A;  3K9T A;  1SFE A;  4OOI A;  1KYZ A;  1JHF A;  2TDX A;  1I27 A;  3IKV A;  4A6E A;  1ZG5 A;  4BXU A;  2VBW A;  1OKR A;  4M9Z A;  1PDN C;  3LA2 A;  5TRD A;  4K2E A;  2WV0 A;  2H6C A;  1XSX A;  4ESB A;  1FP1 D;  2UXX A;  3DPL C;  3RTR A;  1D8K A;  2Z33 A;  2W84 A;  3RPU A;  2XUB A;  3ML6 A;  2OU2 A;  3LST A;  4M72 A;  2HDC A;  1R00 A;  2DBB A;  4L9J A;  2LDU A;  3I54 A;  2P5V A;  5ILS A;  3JSP A;  1O3S A;  1YO5 C;  2EFP A;  2EV5 A;  2DLL A;  3HHG A;  1ULY A;  2O6G E;  2NS0 A;  4ETS A;  5HLH A;  1XSD A;  2MBF A;  2XRO A;  2GIV A;  1Z6R A;  3GUD A;  1EH6 A;  3DEU A;  2QQ9 A;  1BI2 A;  3TO6 A;  3T1B A;  3U9G A;  3WGG A;  1GHC A;  3K0L A;  5BPI A;  5HS7 A;  3NQO A;  1BN5 A;  1GXP A;  4M9X A;  6PAX A;  4QLC U;  1REP C;  3I4P A;  1J59 A;  5D6E A;  4G7O F;  1S8N A;  1S3J A;  2ZXJ A;  4OIQ F;  3IKT A;  1FC3 A;  2QBY B;  2HQR A;  2XAJ A;  1QNT A;  1G3Y A;  4KIG A;  2PI0 A;  5JFR A;  2RKH A;  4O5V A;  4BYY A;  2KIM A;  1ZRE A;  2CQK A;  3HRM A;  3FXQ A;  1TQP A;  4PGG A;  3LQR A;  5E1W A;  3RYP A;  2DW4 A;  1BM9 A;  2YX4 A;  3Q9V A;  3RI4 A;  1L0O C;  3MWM A;  3QRF F;  3DP7 A;  1FZP B;  2Q8K A;  4EM1 A;  3V7R A;  2E1N A;  4HLX A;  4HF1 A;  2HKO A;  3JSO A;  1TLH B;  2HTS A;  1XSV A;  4HX8 A;  4GYI A;  4LG0 B;  1LDK B;  1LVA A;  2A6H F;  1KU3 A;  5AIQ A;  2IRF G;  4N9I A;  3RIR A;  2AXL A;  3K1N A;  5LRR A;  1I6X A;  3K1P A;  2K4J A;  3GVA A;  3CLO A;  1ZAR A;  2Z9O A;  1T2K A;  1LB2 A;  2A68 F;  4PDK A;  2IA1 A;  3FWE A;  5FD5 A;  3QPH A;  1U3E M;  2OZU A;  2QQB A;  4BQA A;  4S05 A;  3P9I A;  1AWC A;  4A12 A;  4R1H A;  5ILV A;  4U7B A;  4P96 A;  5ICF A;  1O3R A;  4RAY A;  4LB6 B;  3LAJ A;  3LA7 A;  4ON0 A;  5CVU A;  4GYG A;  2XHK A;  3S2W A;  3HSR A;  2QLZ A;  4KIF A;  2KJC A;  4LFU A;  1YYV A;  3E5Q A;  1X3U A;  3DKW A;  5HDK A;  1XCB A;  3BWG A;  3HTU A;  4KN4 X;  1TW3 A;  2D2W A;  3F72 A;  2DAO A;  3F6O A;  5D5V B;  4UNO A;  4G7Z F;  3K1M A;  2ISZ A;  4AIJ A;  5KK1 A;  1HBX G;  3Q5F A;  4LMY A;  3F22 A;  1XDS A;  2ZCW A;  2EFQ A;  1R5H A;  1TBX A;  1YLF A;  1W7P A;  2FRH A;  1K79 A;  3KP4 A;  3WE2 A;  2FBK A;  5EEH A;  1STZ A;  2VC1 A;  4I0A A;  4HQE A;  2J5O A;  3LWF A;  5IT3 A;  1Z9C A;  2ZME A;  3E3V A;  1J7K A;  1Z6T A;  3Q9S A;  1HST A;  3NRV A;  2F2E A;  2EFN A;  2IPQ X;  1FLI A;  3ZN0 A;  2MLG A;  4M74 A;  1ONV A;  1R22 A;  4HW0 A;  3WTT C;  4MEX F;  3ECH A;  1IXS B;  2BBY A;  3F8M A;  1FBU A;  2Z3Y A;  3TOB A;  3V8J A;  3HHH A;  3O3K A;  3WE3 A;  1IXR C;  2P8T A;  2DQR A;  4M6Y A;  4I98 B;  4EJT A;  2IP2 A;  3HRU A;  2FE3 A;  4OIP F;  2BV6 A;  4FX0 A;  1RUO A;  1JE8 A;  2X4H A;  1G3T A;  2D1H A;  2JTV A;  1SD4 A;  1BJA A;  1ZG1 A;  1OPC A;  4EGY A;  2COM A;  5FLX Z;  3OV8 A;  2FMY A;  2GZW A;  2XVC A;  3BZ6 A;  5BOX A;  3R4K A;  5E1Z B;  1O3T A;  3W6J B;  4B8X A;  2W57 A;  1LEB A;  4LB5 A;  4LK0 F;  2UXN A;  3SZP A;  2F5F A;  3WU1 B;  5LHG A;  2DK8 A;  2QEN A;  1KYW A;  3E5X A;  1HSJ A;  1SFX A;  4PCQ A;  3DF8 A;  4BHB A;  1TNT A;  2M1B A;  4CXF A;  5F64 A;  2E7W A;  2CW0 F;  2ZKZ A;  2PBI A;  4YFN F;  1H0M A;  4IRH A;  4AIK A;  3ABT A;  4RAZ A;  4XSZ F;  5FO5 A;  2F5D A;  3KEQ A;  3TO7 A;  1U5T A;  2EA2 A;  3MEX A;  4ZYG A;  3EYI A;  3G73 A;  4Q47 A;  2OD5 A;  1R58 A;  4GCV A;  3SZT A;  4Y15 A;  4GO1 A;  1WQ2 A;  1S29 A;  2F5C A;  2ISY A;  2G9W A;  3I59 A;  4MEY F;  3BPV A;  2O61 A;  3CO7 C;  1KA8 A;  1YW7 A;  4ENN A;  4FHT A;  1SMT A;  2DI3 A;  1B4A A;  1UCR A;  4JK1 X;  1V4R A;  3I71 A;  1FYK A;  5F1R A;  1BI0 A;  2QBY A;  2XKP A;  2X0L A;  1ZYR F;  1IZ1 A;  1Z1D A;  2JSC A;  1A04 A;  2XAG A;  3DQV C;  3GO5 A;  2QM3 A;  5K5O A;  2DQL A;  2BGC A;  3KZZ A;  1VTN C;  2QYO A;  2ETH A;  4Q48 A;  2ZBK A;  3WTS C;  2IVM A;  4BHC A;  4EJV A;  1HKT A;  2LSO A;  4OMZ A;  1MGT A;  1OYY A;  3KET A;  2V1U A;  1O57 A;  3WGH A;  4UHT A;  4FT8 A;  3LA3 A;  1W7P B;  1OYI A;  2V1X A;  1O7L A;  1TTY A;  1HXD A;  2Q0O A;  2RVC A;  2ZME B;  3ROU A;  1W4M A;  2W24 A;  4CGZ A;  3ECO A;  4M71 A;  4ZZD A;  4HF2 A;  4MTD A;  4RB3 C;  2UWM A;  3D5L A;  4EJO A;  3E6C C;  4S04 A;  1WRJ A;  1R5G A;  1XGN A;  1B6A A;  3QU3 A;  2K27 A;  4O6J A;  2EJR A;  1LDJ A;  3EUH A;  3F3X A;  1ZGA A;  3DPT A;  3ISP A;  4CIC A;  5JVT A;  2V1D A;  4EV0 A;  3BJ6 A;  2K7L A;  2DPU A;  1MKM A;  3F8B A;  2V9V A;  4KN7 X;  3TO9 A;  2RQP A;  4KMF A;  3FXU A;  2B0L A;  3BPX A;  1BOA A;  3N4M A;  2Q2E A;  3GWZ A;  2E1C A;  1YTY A;  1IRG A;  2CWE A;  5F6F A;  3AAF A;  5EEG A;  1V3F A;  4XRF A;  3NEU A;  4ENJ A;  3QAH A;  3E6B A;  2QUF A;  3J80 Z;  1FSE A;  4WXC A;  2ESN A;  1SD7 A;  2DTR A;  4A2U A;  1MZB A;  2CSO A;  3SXY A;  4EJU A;  1K7A A;  2M45 A;  3ZN1 A;  2PEX A;  3T5X A;  5DDG A;  1XN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...