4KDPA

Tcar-ssdna complex crystal structure reveals the novel ssdna binding mechanism of the marr family proteins
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription/dna
molecule keywords TcaR transcription regulator
total genus 41
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kdpA00
3K1MA 3HSFA 2ISZA 4HBLA 2FOKA 1RNLA 3ELKA 2NNYA 2XAGA 4HQMA 1L0OC 1TNSA 3F22A 1AWCA 1V4RA 2JRTA 4M9SA 2H27A 3D5LA 2H6BA 3BPVA 1P2FA 1R1TA 2JT1A 2J5OA 2HQNA 2KIUA 4OU0A 1XD7A 1MDMB 2L54A 3BJOA 3KP7A 4ESFA 4GYGA 2MH2A 4UV9A 4YG2F 2EA2A 3P9IA 5LBQA 1U3EM 3CO6C 1ZH5A 4RB0A 1XSDA 2PQ8A 3KETA 1FBSA 3F8MA 4ASNA 2QBYB 3EQLF 1I1SA 3KZYA 1FZPB 5IT9Z 2L4AA 2GWRA 3K9TA 3DF8A 1YIOA 2IA0A 2CO5A 3H3ZA 2VOPA 1DUXC 2HFHA 1I1GA 3WGIA 4EM1A 2ZCWA 3NQOA 4L5IA 1EH7A 3F8FA 5KVRA 3I54A 1OR7A 2D1VA 4R8HA 1FP1D 2MBFA 2HTJA 3O3KA 4ZZDA 2FA5A 1IF1A 1IXSB 5L3FA 1IN6A 4P96A 5HDGA 1ZREA 1IUYA 3VODA 2A68F 4A6DA 3HRTA 1ZARA 2A61A 3S2WA 4WXCA 2EB7A 4I0AA 2QWWA 3GWZA 3WTTC 2FRHA 1WRJA 2K4BA 1TW3A 1IZ1A 4L9TA 1QZZA 1Q1HA 3DFGA 2Z5UA 2D1HA 1KQ0A 1ULYA 4N0BA 4HV5A 3WTVC 4KN7X 2BE5F 3IKVA 4XBFA 2P4WA 3EETA 1FT9A 1DPUA 1R7JA 1XDUA 2UXNA 3ZMUA 2KJCA 3EYYA 1AOYA 5D6EA 3ZMZA 2FU4A 2X0LA 2F5EA 4EJVA 1BI1A 5DUKA 2XASA 4CICA 3QPTA 2DK5A 4UVBA 1YO5C 4WF2A 2HWVA 4CHUA 5FD5A 4Z2YA 2DBBA 3ZN0A 1JE8A 1WI9A 3JAMZ 3GX4X 1BIAA 4FX4A 2V1XA 4RGSA 2GZWA 1S29A 3M1EA 2G9WA 4G7ZF 3T1BA 4YFNF 1LVAA 2A3SA 3BY6A 2FXAA 1LDDA 1O7FA 3E6MA 2LF8A 4MTEA 5ILSA 5FFXA 3WTZA 5L3CA 1FSHA 1XGSA 2D2WA 3KFWX 5DYMA 4ZH4F 4GXOA 2Y48A 2RC4A 1ZGAA 4MNUA 2A69F 3V8KA 1YS6A 3C1DA 2OBPA 3CDHA 4UVCA 2P6TA 1K78B 3RPUA 2VONA 4LFUA 4IJAA 4TV7A 4MEYF 4AIHA 1EH8A 4ZYGA 3U2RA 4LLGF 2XVCA 4EJTA 4Y17A 1XCBA 5LLQA 3R61A 4LMYA 4PCQA 3QPHA 2QUFA 3J80K 1IW7F 4PGGA 2O3FA 3FM5A 1QQIA 2STTA 4ENMA 2UXXA 4K2EA 1HSTA 2A5YB 1Z05A 5CVUA 3KE2A 4G6QA 1B4AA 5DD4A 3WTUC 2HTSA 3TOAA 1WWXA 4KN4X 1FOKA 2WWYA 1XGOA 2HZTA 2Q2EA 1OYIA 3KEOA 3DKWA 4L18B 3T5XA 2MD5A 4MGRA 4GO1A 1RZ4A 2M30A 3Q9VA 1QBJA 1JGSA 2ADUA 1ZYRF 1KU3A 4L0ZB 1K79A 3HSRA 2LNBA 4HDUA 4GGGA 1KGSA 1FC3A 1QPMA 3Q5FA 4GYIA 2RGVA 1BIBA 1YFHA 4LLNA 4Q5SF 2A07F 2CYYA 1XCVA 2M45A 5IT9K 1WSUA 1UHWA 4KIGA 4IXAA 3SXYA 4OOIA 3F8NA 1FP2A 4A0YA 4HX8A 1J0RA 3QAHA 1W7PA 1Z1DA 1HKQA 4HX7A 1LDJA 4WXDA 1U2WA 1XMKA 3HHHA 2RV8A 1U5TA 2LSOA 2LKPA 1UCRA 5CJ9A 5K5RA 2VOOA 2RVCA 4RGXA 2L01A 3HSEA 3DPTA 5DEQA 1KYZA 2HQRA 3ISPA 2NRAC 1BBYA 1HXDA 3ZMVA 4G6DA 4YIIA 3CO7C 4Y13A 3P7NA 1X3UA 1TTYA 1P4WA 2RDPA 4P9UA 3CUQC 4MQ9F 1RUNA 4I02A 2P8TA 1CF7B 3I4PA 2P7VB 3G3ZA 3JTGA 1ONVA 2FBIA 1JHFA 4G7OF 5TJJA 2JSCA 4L9JA 3KCCA 1MKMA 1J75A 1D3YA 2XV4S 5ILUA 5DD8A 1YG2A 4O5VA 1ZGJA 2VBXA 5EEHA 3JTHA 2BYVE 2PBIA 1LEAA 2MC3A 4UXNA 3RYPA 3BDDA 3QOPA 4B09A 1LB2A 1R1UA 2QYOA 1HW5A 2HS5A 4XLPF 5H6RA 3ZMDA 4YIFA 2XROA 3WTYC 4JQFA 5HOOA 2G7HA 1V3FA 4HAMA 1VTNC 3DEUA 2ACJA 3FMRA 1B6AA 1FPQA 4OINF 2M1BA 4OIOF 4EGZA 2VC1A 4M71A 1OMIA 2NNNA 4WCGA 1BI3A 1BJAA 1PP8F 1JXSA 3CJNA 2F5CA 5DCFA 2ETHA 3AAFA 2GXBA 3WGGA 3GO5A 1KYWA 3WE3A 3CTAA 4HF1A 4EV0A 1XN7A 1BI0A 1Y0UA 3W6KB 3HIFA 1CGPA 4KA4A 3GUDA 5JR3A 1SMTA 3KP5A 2B0LA 4MQVA 4KYWA 2R3SA 3EYIA 2OAZA 3G73A 4ZYEA 1STZA 2XKOA 3FXUA 3R4KA 5ICGA 1PUEE 2NAZA 2VC0A 1SD5A 3KZZA 3MWMA 3T8RA 3J7AO 1XDSA 2FSWA 1SD4A 1LQ1A 3IKTA 1IRGA 4IRGA 4XSZF 1I5ZA 3BPXA 2QZ8A 3GEZA 3JSOA 4ON0A 1MJ9A 5FO5A 2W57A 3I0TA 3ML6A 1RIOH 2L3DA 2HKOA 2STWA 4EM0B 3V8LA 2JPCA 3KP4A 3L9FA 2KIFA 1SAXA 4KDPA 4R1HA 2ESHA 3HYIA 2EK5A 2BGCA 1RI7A 1EV7A 4L0YB 3IC7A 2WV0A 2VE9A 5D5XB 1IN7A 1FBQA 1W5SA 3V7RA 2A6EF 1R5GA 2AS5F 4KMFA 1F5TA 3I53A 2K27A 4HF2A 3FZVA 4A12A 4PGHA 3HTSB 1HKTA 4EGYA 1LNWA 3FF5A 4RAYA 1FYLA 1MJBA 3V7CA 1XMAA 4BQAA 2K4JA 5E8IA 3JSPA 4L9VA 4IVNA 4O6JA 4Q47A 4KMUX 4N9HA 5HDNA 1HW2A 5TRDA 3B73A 1F4KA 3R0AA 1JHHA 1TW2A 5D5WB 1T0FA 2V79A 5F1RA 4WXHA 6PAXA 1YW8A 1LJ9A 4KIFA 2IJLA 1GHCA 1S3JA 1S6LA 2IVMA 2WC2A 5J8CA 3SFZA 4BAYA 2QBYA 2J5PA 2RNJA 2E1NA 5CVVA 2H09A 1YLFA 4FT8A 2GA1A 2P6SA 1G6NA 4HW0A 2DLLA 1OKRA 4O3MA 4G8XA 4CXFA 2Z99A 3QU3A 3MZHA 5K5OA 3KLNA 5K5QA 1J7KA 2CWEA 2YR2A 2XUBA 4F7ZA 3MQ0A 3SHFA 5JHUA 2DQLA 2V6CA 3GVAA 3U9GA 5JI6A 3M9AA 1B59A 4B8XA 2C6YA 4GCVA 2Q0OA 1B9NA 5E1XA 1H0MA 4ETSA 4ZYDA 3LQQA 2DQRA 2IRFG 4U0WA 1P92A 2Q8KA 5CVJA 1IN8A 3QRFF 4HLYA 3ZMSA 4QLCU 1O3QA 4M74A 4BHCA 4RB1A 4U7DA 1UHMA 5LHHA 1DDNA 4M9XA 5ICFA 4WX9A 2QENA 4EJOA 4HDVA 1YS7A 2FE3A 1K7AA 2ZKZA 4I98B 5LRSA 3RKWA 5D6FA 4EMSA 1WQ2A 2GQQA 3F8BA 1YW9A 3RI4A 1SMYF 5E1WA 4DQ2A 2DT5A 2DFIA 3DXJF 2A6HF 1MGTA 1Z7UA 5AIQA 1USSA 2EFWA 3GFJA 3GW2A 3FWEA 1OYYA 2W85A 1SFUA 4U0VA 2P5VA 1BN5A 3GFIA 4G7HF 1KU9A 3RIRA 2XAFA 4ESJA 1G3WA 1ON2A 5LRRA 1SFEA 2DU9A 2YX4A 4FX0A 1HW1A 2W24A 3QP6A 1B1BA 2RQPA 2WTEA 3J81K 4AIKA 1KU7A 3TO9A 5HS8A 4UVAA 2O6GE 2EFQA 2QQAA 3IRQA 3VEPA 2E7WA 2ZXJA 4MTDA 2HDCA 2OZUA 5ICCA 5L3EA 1UFMA 3MEXA 5BPDA 4HX4A 4LGWA 2GAUA 3H3UA 1HQCA 3Q9SA 1IN4A 3FMSA 3VFZA 5HS7A 3LSTA 3FHZA 1R58A 1QNTA 2O8XA 2CFXA 5F6FA 2BEOA 2CSOA 1UB9A 2XAHA 4FHTA 4G94A 1XGMA 3I59A 3L2CA 2XGXA 5HS9A 2EFPA 1OPCA 4AD9A 3CUQB 3F23A 4UHTA 2CQKA 4HF0A 5AIPA 4P55A 1FX7A 2M5WA 4L5JA 3HHGA 3PQKA 3T8TA 3DPLC 5D4SA 2FBKA 2QVOA 4EJWA 4M9ZA 4N9IA 3V7SA 4ENKA 3ZP5A 1SFXA 4S05A 5E20A 3BJ6A 1D5VA 4OIRF 3HTUA 2BV6A 3WODF 3TQNA 1Z6TA 4XLNF 1P4AA 2DI3A 1YW7A 2HR3A 1XGNA 3CLOA 5DCMA 3NRVA 2DTRA 1I27A 2YX7A 1BC7C 3ZN1A 1W4MA 5E8GA 1XB4A 2VBWA 4I0BA 4U7BA 5H6QA 5J8FA 5BQTA 3E3VA 3NEUA 3E6CC 1TQMA 1IRFA 5D4RA 2IPQX 3WGHA 1B9MA 2X4HA 1S8NA 3RPQA 2ZNYA 3RKYA 4XRFA 2PJPA 1FYMA 1Z9CA 4AIJA 4BH9A 2AXLA 5LEKA 3K1NA 1W7PB 4U88A 4U0YA 4WK8F 1BOAA 5A2QK 4BYYA 2W84A 1S7AA 1H9TA 3KP6A 2HKXA 3HOSA 1FLIA 5CVIA 4ZZLA 3BJAA 2W25A 3I5UA 4AVPA 1D8KA 3PFIA 1P4XA 1MJAA 2XHKA 3ZQ7A 2HOEA 1CF7A 3DV8A 5H20A 5DUIA 3L7WA 1ZRDA 2H94A 2FNPA 5HDKA 3REOA 4UV8A 3LAJA 1NHAA 2JPBA 3DP7A 3M7GA 3R6SA 3IL2A 3CUOA 5D8LB 2FBHA 1LDKB 3BWGA 4CZZA 1ON1A 3U1DA 2V1UA 1SD7A 2CG4A 4KNYA 2VT2A 2VBYA 3HRSA 5BMZA 3F6VA 1KA8A 1BM9A 2XKPA 1GXPA 4A2UA 2Y0MA 4L9NA 3ERED 2PMHA 1TQPA 4HZFA 3ZMTA 1DPRA 3E5QA 2HGCA 1XSXA 3QP5A 5F64A 1A04A 2ESNA 1O3SA 4CDGA 2KIMA 5LEJA 5D8KB 3IWFA 5DV5A 4NQWA 5CYVA 3LWFA 3WTXC 2IT0A 2UWMA 1Z91A 2P5LC 2EA4A 2K02A 1R00A 2FF4A 3WTSC 4RGRA 2XAJA 3E5XA 2VN2A 4ZYHA 1HSJA 4MHGA 2D45A 4EVIA 3K69A 4D0PA 5E17F 3M8FA 1HBXG 3DQVC 3TGNA 3E5UA 4LB5A 4Q48A 2CGPA 1E2XA 1OYWA 3P9KA 3EDPA 1H9GA 2DW4A 4MEXF 3GZ6A 1ZLKA 1QGPA 1SD6A 4Y15A 2L4MA 4R79A 3QU6A 1TLHB 1FSEA 1BI2A 5L3GA 3OOPA 2OD5A 1ODDA 3ABTA 3JW4A 3WE2A 2P5KA 4KIBA 3J80Z 1G3YA 1J59A 4RB2C 2R7DA 1R36A 5IT3A 5BPIA 4A6EA 3OV8A 1MD0A 5K1YA 1ZLJA 2QLZA 3N4MA 3FM3A 3RDIA 4ENJA 1D8JA 2OA4A 2JTVA 2KRFA 1ZAOA 4P9FA 1KU2A 3CUQA 4KUMA 2NYXA 4BXUA 1O7LA 2V1DA 5FLXZ 1U5TB 1KQ8A 2HYGD 5FFZA 2EV0A 4LD5A 3P9CA 3R60A 5ICEA 1TBXA 1ZHFA 5FD6A 2G7UA 3H92A 2RN7A 3R0JA 3KEQA 3K1PA 2EFNA 2IA2A 3KP3A 3LAPA 5L3BA 4KT5C 4M6XA 4HV6A 4JK1X 1T2KA 5LGUA 2DO7A 2ZMEA 3TDUC 1IAWA 2O03A 2YSRA 1RUOA 3GLXA 1G4DA 3F72A 2DPUA 4YFXF 3E6BA 3F3XA 2FEZA 2ZMEB 3FX3A 4DNCA 3F6OA 4QWQA 2YPRA 2P7CB 2IW5A 3RJPA 1DP7P 1L3LA 2DK8A 2K7LA 5EEGA 2PI0A 4IHSA 3T0YA 3GYHX 4I7HA 5ILVA 3V8JA 1ZRCA 2FQ3A 2E7XA 4HA8A 2H6CA 1U78A 3E6DA 3TDZC 3SQNA 1QZYA 1EH6A 3BROA 4KFCA 4I2OA 5A2QZ 3LA3A 4LG0B 2XIGA 5HLIA 2OU2A 4OIQF 4LK0F 1T39A 2HYFA 3FXQA 3TOBA 5BS6A 5LGTA 4UNOA 1P6RA 5ED4A 3SZPA 2O61A 1PDNC 3HRUA 2XRNA 4EM2A 3SZTA 2V9VA 4A0XA 5HLHA 3ECHA 4EQQA 1E17A 5HLGA 2PLYA 1LEBA 5KK1A 2QQ9A 3KLOA 3O2PE 2KJBA 4RB3C 2JZYA 1F9NA 2PG4A 5D5UB 5LGNA 3JAMK 3I64A 1GXQA 2LDUA 3I71A 3IWZA 2DAOA 1GVJA 3ROUA 2F5DA 1Z6RA 5LHIA 3J81Z 4AWXB 5CVRA 4BHBA 2Z3YA 2MLKA 2R7FA 4I01A 2EJRA 3GFLA 3BZ6A 3TKYA 4ENNA 4E70A 2EV5A 4M73A 4PDKA 2PN6A 4EJUA 4OMZA 2EFOA 4A5MA 2L02A 2GXGA 2VE8A 5ERIA 1REPC 3RYRA 1G3SA 2RKHA 1S7OA 1R23A 3F21A 2COMA 3EUHA 4LB6B 2XAQA 2CW0F 1BC8C 3C18A 4P5OA 5FLXK 2YU3A 4IF4A 3HUGA 4G9YA 1C0WA 3MFKA 3IHUA 1ZN2A 3GZ5A 1KQ9A 3WU1B 2VT3A 1MDMA 4M6YA 1J9IA 3I58A 3C7JA 2FMYA 3C3WA 1WKMA 3MAJA 4BNCA 3LA7A 4BHPA 4IRIA 2F5FA 4HOBA 4RAZA 2ZO4A 2EV6A 4WWCA 1U6GA 2QQBA 3K2ZA 3LFKA 3KP2A 2UZKA 4OMYA 2GIVA 4A0ZA 2ELHA 4RGUA 4A5NA 3WG9A 5D5VB 1FYKA 4OIPF 1FWZA 2Y75A 1YYVA 2ZJ2A 5CLSA 4CO8A 3LQRA 3L00A 3V4GA 2M87A 3FXRA 2VXZA 1ZG1A 1YTYA 1ZG3A 2DPDA 3ZPLA 1J5YA 3O6BB 1O3TA 2MA3A 3HRMA 2NS0A 1IXRC 3LA2A 1T98A 4KICA 4RS8A 4CGZA 3IRRA 2O0YA 5BOXA 2IA1A 1FBUA 4S04A 3TO7A 1PP7U 2LF7A 1FY7A 3GF2A 4UUVA 5E1ZB 3VB2A 3WTWC 2FMLA 3WU0A 3ABUA 4I09A 4IPAA 2GA2A 1TQIA 2BBYA 3MZYA 3BOQA 3F8CA 3VOEA 1T6SA 2K86A 4XSXF 4YFKF 4IRHA 1USTA 3RKXA 4M72A 2OQGA 3RTRA 3GXOA 1ZRFA 1T38A 4JBAA 3TO6A 4LLLA 1U8RA 2VBZA 2OQRA 5E18F 1I6XA 3M8EA 2F2EA 2MH9A 2Z9OA 1IXCA 5FGMA 4HQEA 5DDGA 3MCZA 2IP2A 2FNAA 5JFRA 5DCMB 1W5TA 1R5HA 1YQAA 2VODA 5FB2A 1IN5A 4IHTA 5AONA 5LHGA 2EWNA 2ZNZA 3BP8A 1W7PD 1U5TC 2HEOA 4HYEA 1ZG5A 2E1CA 1F1ZA 4LG0A 4ESBA 2ZBKA 1G3TA 5HVQC 2ZFWA 3COAC 3W6JB 4PZJA 3HOTA 5L3DA 2PMUA 4HLXA 2M8EA 3D0SA 3B02A 3PQJA 1R22A 2ISYA 1K78A 1J2XA 2QM3A 3L09A 1QO0D 4H0EA 1FNNA 3K0LA 3I59B 3ECOA 2OZ6A 2Z33A 3ULQB 5JVTA 1K6OA 2TDXA 3N97A 4CYDA 4NB5A 2MLGA 1O57A 1MZBA 3FMQA 1TNTA 1HKSA 3GFMA 4Q4ZF 1O3RA 1R1VA 2PEXA 1XSVA 5J6XA 4LK1F 4LJZF 3E97A 2PFBA 4NHJA 2KKOA
chains in the Genus database with same CATH superfamily
3K1MA 3HSFA 2ISZA 3BR3A 2M4GA 2DN0A 3GCMA 4B44A 3CMEI 3ERMA 4DGWB 4HBLA 2FOKA 1RNLA 3ELKA 1MBHA 1F36A 2NNYA 3QQAA 4H4KC 5GPAA 2XAGA 4HQMA 1L0OC 1X58A 1ZK8A 1Y1WJ 2H1KA 3VYSB 1TNSA 3HOXJ 3F22A 1AWCA 2V7FA 3CP8A 3RZOJ 5J3LA 4MFDA 1V4RA 4XK4A 1WJ5A 3OL4A 3PFYA 2JRTA 4XL9A 2HPIA 4M9SA 2H27A 2HQ5A 2BXYA 3D5LA 2DMTA 2H6BA 3GTGJ 3BPVA 3TMOA 1P2FA 1R1TA 1YX3A 5TISC 1WI3A 2BW3B 1MIJA 2JT1A 2J5OA 2HQNA 2KIUA 4OU0A 3OS1A 2CUEA 4LG3A 2Y30A 2Y31A 4CCOA 3E1SA 1XD7A 1MDMB 2L54A 3BJOA 3KP7A 1A6QA 2F48A 4ESFA 2QSGX 2DA3A 4XRSA 2DT6A 4GYGA 2MH2A 1Y56A 4UV9A 4YG2F 4BGDA 5EF6A 2BHZA 2EA2A 1A5JA 3ZQIA 3VPRA 3P9IA 5LBQA 1U3EM 3CO6C 1ZH5A 2KIQA 4RB0A 4ZTFA 1XSDA 5GAHJ 2PQ8A 3KETA 1FBSA 3F8MA 4ASNA 1SVLA 2QBYB 3EQLF 1JUPA 1X1PA 1JJ6C 1I1SA 3KZYA 3DU6A 1XS9A 1FZPB 5IT9Z 2L4AA 2GWRA 3K9TA 3DF8A 1YIOA 2IA0A 4C2UA 2CO5A 3HZJA 1MMSA 4B48A 3H3ZA 2VOPA 1DUXC 2HFHA 5IP9J 1I1GA 1D5YA 3CJRB 3WGIA 1SANA 2V4JC 4EM1A 2ZCWA 4XN3A 5E3LA 3NQOA 3SDBA 4L5IA 4IZZA 4II3A 2K9NA 1EH7A 1M1EB 2ZFUA 5B66C 3F8FA 1JKQC 5KVRA 3I54A 1OR7A 2D1VA 4BS9A 2JA8J 4R8HA 4IHXA 1FP1D 4XLAA 2VB6A 1IGNA 2X1CA 2MBFA 2HTJA 3O3KA 4CSWA 4XLHA 4ZZDA 5GP9A 3OY9A 2FA5A 4RM2A 2KHMA 3CQZJ 1SEUA 1IF1A 1IXSB 1K83J 5L3FA 1IN6A 4P96A 5HDGA 1ZREA 1IUYA 3VODA 3S1QJ 5M5XJ 1HOMA 1JKOC 2A68F 4A6DA 5IP6A 3HRTA 1ZARA 2A61A 2BHYA 3S2WA 4WXCA 3HOZJ 4F52A 2EB7A 4I0AA 4BBRJ 3CCLI 1ERDA 2MG4A 5J1RA 2QWWA 4CH7A 3GWZA 3WTTC 3G1MA 2FRHA 1WRJA 2K4BA 4MIMA 4KJZA 1TW3A 1V55H 3HKZA 1YHQI 1IZ1A 4L9TA 1Z3XA 5EYRA 2IBDA 2KZGA 4ZC3A 1IDZA 1QZZA 1ZKGA 1Q1HA 2DFFA 3DFGA 2Z5UA 4V2GA 2D1HA 2HVRA 1KQ0A 2M7BA 1ULYA 4FISA 1YJ9I 1NK3P 4N0BA 4HV5A 2F6CA 3WTVC 3OR1C 4KN7X 2BE5F 4IL6C 3IKVA 4XBFA 4J01A 2P4WA 2LKSA 2W4SA 3EETA 1FT9A 4CA0A 3H9QA 1H8AC 3IAS2 1DPUA 2K40A 1R7JA 2M2EA 1IV6A 1XDUA 2K9LA 4AUXA 2E1MB 2UXNA 3ZMUA 3U21A 1JT6A 2KJCA 1WVRA 3EYYA 4LIVA 3RCOA 1AOYA 5D6EA 3ZMZA 2FU4A 2X0LA 2F5EA 4EJVA 1BI1A 3I3LA 5DUKA 2ME0A 2M0MA 5H2FC 3K4KA 3DWLE 3S3NA 5M5YJ 3HOVJ 2M34A 2XASA 1HC8A 3TL4X 4CICA 4UUSA 3BZCA 4BJ5C 3QPTA 4GDFA 2DK5A 5J1YA 4UVBA 1JI8A 2X6WA 1YO5C 4WF2A 1LUJB 4FCYA 2HWVA 1D0ZA 4CHUA 1EKEA 5FD5A 4XNFA 4Z2YA 2DBBA 2RNGA 2LD5A 1YRNB 3HOYJ 3HM5A 3ZN0A 1W1WE 1JE8A 2EINH 1WI9A 2ZMEC 2IEKA 4CCJA 3JAMZ 4XKWA 3GX4X 5M3FJ 1BIAA 2KISA 1ORKA 4FX4A 2V1XA 4IO9F 3CMYA 4IHWA 3QPLA 4RGSA 1Z21A 2GZWA 2KRHA 2GM4A 1S29A 3M1EA 2G9WA 4G7ZF 3T1BA 2LP0A 1LVAA 4YFNF 4BBSJ 2A3SA 3Q0WA 3BY6A 2FXAA 1LDDA 3BG5A 1O4XA 1Z0XA 4XONA 1O7FA 3E6MA 2LF8A 3BTCA 4MTEA 4E6KG 5ILSA 5FFXA 4Y52J 3WTZA 5L3CA 3CMMA 1FSHA 1XGSA 1IUFA 1MNEA 3TW6A 2D2WA 3KFWX 4D5CA 5DYMA 2XAUA 5JHFA 4ZH4F 1MH3A 1PJRA 2HOAA 5EG0B 1FTTA 4GXOA 2Y48A 2RC4A 5IPAA 1ZGAA 2L7ZA 3FDYA 4MNUA 4HPQA 2A69F 3V8KA 1YS6A 3C1DA 2OBPA 2HXOA 3CDHA 1X4PA 4UB6C 4UVCA 2YUSA 4C2TA 2P6TA 3PUBA 1K78B 2E2JJ 3CC2I 1OCRH 1T33A 1GT0C 1AKHA 3RPUA 3A03A 2E1MC 4UUTA 4E7IA 2VONA 4LFUA 4IJAA 4LIUA 4TV7A 3DKYA 1VF9A 1N77A 3IAM2 4MEYF 1JKPC 4AIHA 5EDNA 1EH8A 2W00A 4ZYGA 4B47A 1DGWY 2XGCA 2MYSA 3H35A 4LLGF 3U2RA 3W2VA 2PX9A 2BXZA 2VASA 2XVCA 3SFIA 4EJTA 1R9TJ 4Y17A 1ETKA 1XCBA 4AU7A 2O9LA 5LLQA 2ZJPF 1VQ8I 3R61A 3HPGA 4LMYA 3LSPA 3OYEA 3BTJA 2QSFX 4E4HA 4PCQA 3QPHA 4EEFG 1OISA 2QUFA 4MLOA 3J80K 1IW7F 3AFHA 4PGGA 1T95A 2O3FA 3MD2A 3QODA 3BR6A 1X3WB 3TP3A 2QA4I 3FM5A 3DTIA 1QQIA 3S8PA 3MKYB 2STTA 1X2NA 2MC4A 4ENMA 2ZSIB 3FXLA 3FK7A 1TWFJ 1IO2A 2BZTA 2UXXA 2RAEA 3LSRA 3UKGA 4DBQA 4K2EA 1MBEA 1FOXA 3TW7A 1HSTA 2A5YB 1Z05A 1XTAA 2R7RA 5CVUA 1WGXA 3KE2A 1B4AA 4G6QA 5DD4A 3WTUC 2DMPA 2HTSA 4G12A 5CPRB 1I50J 4KITB 3TOAA 1WWXA 4KN4X 3H5RA 2WWYA 3JRAA 1FOKA 1XGOA 2HZTA 4JX5A 3OOUA 4DYCA 3HJEA 1FTZA 2Q2EA 2HNHA 2FUG2 1OYIA 2LC2A 3QWLA 1FMWA 1VQOI 1X4OA 1YIJI 3KEOA 3DKWA 3D1NI 1Y0NA 2NVXJ 4L18B 3T5XA 2MD5A 3A01B 5F27A 4MGRA 4XORA 3W2AA 2QSHX 5E79C 4GO1A 4N4OB 2E60A 4AVZA 1WZ2A 1RZ4A 5BNGA 2M30A 4Z6YA 1DU6A 1MSFC 1W36C 3Q9VA 4B43A 3VYTB 4XICA 3UR3C 2XPVA 1POGA 3P5JA 4PJLA 1QBJA 3CLQA 1JGSA 2A5WA 2ADUA 1G8XA 1ZYRF 1ETYA 1KU3A 2O8KA 4L0ZB 3MKWB 1K79A 1I3AA 3HSRA 2X51A 2LNBA 4HDUA 2RQQA 5F1JA 4GGGA 2KT0A 1MMNA 3S32A 3PO2J 1KGSA 3EUHC 3K10A 3ZOBA 4A3FJ 1VZ0A 1FC3A 1QPMA 3Q5FA 4GYIA 2RGVA 1BIBA 3QOEA 1U0JA 2R4GA 1YFHA 2N8GA 4LLNA 1TT0A 3CCRI 2R5ZB 4Q5SF 1WH7A 2VXDA 2R93J 2E5ZA 5B1BH 2VQGA 2A07F 3VSLA 2CYYA 1XCVA 3S14J 4CCNA 2M45A 5IT9K 1WSUA 1UHWA 4KIGA 3JR9A 4IXAA 3SXYA 2NOJB 4OOIA 3F8NA 4D7NA 3JCUC 1FP2A 4A0YA 3GTLJ 4E7KA 4HX8A 1J0RA 3QAHA 1D0XA 1W7PA 1Z1DA 3QPSA 3LL7A 1HKQA 4HX7A 3J7YJ 3B6CA 1LDJA 4WXDA 1H88C 1U2WA 1XMKA 3IV5A 3HHHA 2RV8A 1VQ5I 1U5TA 2LSOA 2VJ5A 2LKPA 4U87A 2CUFA 5FKNA 1UCRA 5CJ9A 1R5ID 2OPTA 2RVCA 5K5RA 2VOOA 4RGXA 2L01A 3HSEA 3DTEA 3DPTA 4IHYA 1OJLA 5DEQA 1KYZA 2HQRA 3OMYA 3ISPA 2VPLA 2P81A 2NRAC 1N78A 1TWHJ 1BBYA 2QCOA 1HA8A 1HXDA 3ZMVA 3RZDJ 1F43A 4DZPA 2HDWA 4G6DA 2P0WA 4YIIA 3CO7C 3HB9A 4Y13A 3P7NA 1X3UA 1TTYA 2ECBA 1P4WA 4NC8A 2K5CA 2RDPA 2LTPA 4OAZA 4P9UA 3CUQC 4MQ9F 1RUNA 4IOAF 4I02A 2P8TA 2OV7A 1CF7B 4BACA 1JT0A 1HCRA 3I4PA 2P7VB 3G3ZA 2WB1N 1FMVA 3JTGA 1ZTRA 1ONVA 5EZGA 5IYCJ 2FBIA 1E0EA 3BG3A 4CCKA 1JHFA 4HSRA 2E5NA 1T08B 3LSIA 5TJJA 4G7OF 1I6HJ 1E3OC 3W2WA 3OYCA 2JSCA 2QGUA 4L9JA 1G59A 2CQ7A 3KCCA 3U1KA 1MKMA 3SJMA 1J75A 1D3YA 2XV4S 3F0CA 5ILUA 5DD8A 4V2FA 2W1OA 2XGEA 2K9MA 1YG2A 5K7ZA 4N4NB 1TP4A 1ZGJA 4O5VA 2VBXA 3A0BC 2DA2A 2OF7A 5EEHA 1T0FC 3JTHA 3OYIA 2BYVE 1QZEA 2PBIA 1LEAA 2MC3A 1PUFA 3I4NJ 2DJIA 4UXNA 3RYPA 3BDDA 4B1RA 3QOPA 4B09A 4C2MJ 1HF0A 1OCOH 3DEWA 2KZVA 1LB2A 1R1UA 3JREA 4IX7A 4A3GJ 5DTDA 3VDXA 3FKJA 2QYOA 1YRNA 2ZSHB 1HW5A 1D0YA 3GTJJ 2HS5A 4XLPF 5H6RA 5KHDA 4JOMA 3VWBA 5GTHC 3M1CA 3ZMDA 2M8GX 2DA7A 5K7HA 1X1DA 3PNVA 1J09A 2LYCA 4I6ZA 5GADJ 3A0HC 4YIFA 2I10A 2XROA 3WTYC 1YI2I 4JQFA 5HOOA 2G7HA 1V3FA 3TP0A 2H8WA 3AL0C 4HAMA 2ZC2A 1BJZA 2EIMH 2DJNA 1VTNC 3DEUA 2ACJA 4B4CA 1OFCX 2ZXIA 3FMRA 2WB1A 1B6AA 1FOYA 1FPQA 2Q1ZB 1ETQA 3IH4A 2M1BA 4OINF 4OIOF 4EGZA 2VC1A 1OCTC 4M71A 5KCMA 3S1NJ 4XLCA 1OMIA 2NNNA 5JLXA 4WCGA 3ESWB 1BI3A 2MD0A 3IUOA 3ZQCA 1BJAA 1MW7A 1PP8F 3S16J 1JXSA 3CJNA 2F5CA 3BR0A 2ETHA 5DCFA 3AAFA 2GXBA 1Y1VJ 3WGGA 3GO5A 1KYWA 3WE3A 2WY7Q 3QYFA 3CTAA 4HF1A 4EV0A 1XN7A 1BI0A 1Y0UA 3W6KB 1EJ9A 1WJFA 5FKKA 3HIFA 1AU7A 1CGPA 5F0FA 4KA4A 3GUDA 5JR3A 1WJAA 2IS2A 2OC6A 1SMTA 3KP5A 2B0LA 4MQVA 5CQGA 4KYWA 3K70C 2R3SA 3EYIA 2OAZA 3G73A 2Z2SB 4ZYEA 1STZA 2XKOA 3KIOA 3FXUA 3R4KA 5ICGA 3HOWJ 3A01A 2EQRA 1PUEE 2NAZA 2VC0A 1SD5A 1E3HA 3CJQB 3KZZA 3MWMA 2IS4A 3T8RA 3J7AO 4A3IJ 1XDSA 2FSWA 4XOTA 1IRZA 3CCSI 2DOFA 2JVGA 3W6VA 1SD4A 4DW6A 1LQ1A 3IKTA 2IS1A 3OYJA 1IRGA 3EUAA 4IRGA 2R92J 3MKLA 4XSZF 1SVMA 1FJLA 1VQPI 1I5ZA 3BPXA 2QZ8A 3GEZA 3JSOA 4RLFA 4ON0A 4M3FA 5FKOA 1B8IB 3B6AA 1MJ9A 4JX4A 5FO5A 4BXXJ 3NARA 2PJRA 2W57A 3I0TA 3ML6A 2LG4A 2L5QA 1RIOH 2L3DA 3HKZN 2HKOA 2M4KA 2STWA 4EM0B 3V8LA 2DCEA 2JPCA 4I76A 3KP4A 1YOVB 3L9FA 2F4MB 1UG0A 2KIFA 5HNHA 1SAXA 4KDPA 4R1HA 2ESHA 2DOEA 1RC9A 3HYIA 2EK5A 5FJ8J 2BGCA 2AO9A 1RI7A 1EV7A 4BKXA 4L0YB 3IC7A 2WV0A 2VE9A 2IGMA 1MBGA 1PVEA 5D5XB 2E2IJ 4M3DA 4YEJA 1FBQA 1IN7A 3S93A 1W5SA 3V7RA 2A6EF 1R5GA 3BTIA 4NBQA 2AS5F 4KMFA 5F0HA 3GLLA 1F5TA 1P9QC 1SAUA 3L2QA 3MVPA 2ID3A 3I53A 2K27A 3PIPF 4JYKA 1QA6A 4HF2A 1QHHD 3FZVA 2BOLA 4A12A 3AL0B 4PGHA 3HTSB 1ACIA 3MZ8A 1R4NB 1RKTA 4XLFA 2ZXWH 1HKTA 4EGYA 1LNWA 2VKHA 3FF5A 4RAYA 1FYLA 1MJBA 5E3NA 3V7CA 1XMAA 4BQAA 2K4JA 1D1AA 1VQ9I 5E8IA 3JSPA 2EILH 4L9VA 3CCUI 4XN0A 1R4MB 1R6RA 2L2OA 4IVNA 4O6JA 4Q47A 4KMUX 1Z7LA 3Q3SA 4N9HA 5HDNA 1HW2A 5TRDA 3B73A 1F4KA 3R0AA 4A3MJ 1JHHA 1TW2A 2CW7A 5J4VA 3L2UA 4AIDA 5D5WB 1LFPA 1T0FA 3PSFA 2V79A 5F1RA 4WXHA 6PAXA 1YW8A 1LJ9A 4KIFA 3CCJI 2IJLA 2HVSA 1GHCA 4C9YA 1S3JA 1S6LA 4ZDOA 4HNVA 3LSJA 2LR8A 4NUBA 2IVMA 2WC2A 5J8CA 1W0UA 5IYBJ 2EIKH 3SFZA 4BAYA 2QBYA 3KPHA 3M8JA 2J5PA 2RNJA 2CUZA 1K4TA 3ABMH 2E1NA 2HOTA 5CVVA 2H09A 1YLFA 4BJ6C 4FT8A 2GA1A 2P6SA 3CC4I 1Z77A 1HLVA 1G6NA 4HW0A 2VUMJ 2LBFB 2NVTJ 1BR4A 2DLLA 2E35A 2ZJQF 2DXIA 1MMGA 1LPQA 1OKRA 1TL8A 2O5RA 4O3MA 1GV5A 3AKZA 1RKWA 4G8XA 4CXFA 3S17J 2Z99A 4NNJA 3RQ4A 2DFEA 3ASOH 3QU3A 2NOGA 4RLQA 3MZHA 5K5OA 5C44J 3KLNA 2MABA 3BZKA 4BJTA 2WY8Q 5K5QA 2QQ8A 1J7KA 2CWEA 2YR2A 4ZDPA 2XUBA 1FOWA 2JMWA 4F7ZA 4C3IJ 3MQ0A 3SHFA 2R7XA 5JHUA 2DQLA 2LY2A 2V6CA 5TGTA 3GVAA 2E34A 2OCEA 3CCMI 4HNUA 1OQYA 3OR2C 1R49A 3U9GA 4PFPA 5JI6A 3M9AA 1HDDC 1B59A 4B8XA 3LFUA 2VKDA 2C6YA 3DCFA 4GCVA 2Q0OA 1LFUP 1B72A 1B9NA 1XG1A 2LMDA 4MO7A 5E1XA 2AQEA 1H0MA 4ETSA 3BG6A 2EBIA 4RMNA 3LQQA 4ZYDA 2DQRA 3RQIA 2HPMA 2IRFG 5J47A 4U0WA 1P92A 1NH3A 2Q8KA 5CVJA 1IN8A 2CW8A 3QRFF 1WFXA 2CMPA 2HYJA 3ZQQA 4HLYA 1SFOJ 2JA5J 2WV1A 2X1EA 3ZMSA 4QLCU 1PUFB 1TC3C 1O3QA 4M74A 4BHCA 4PJMA 1WJDA 4RB1A 4U7DA 2ME6A 1UHMA 5LHHA 1DDNA 2LRDA 4M9XA 5ICFA 4WX9A 2QENA 1FEXA 4EATA 4EJOA 3ABKH 4HDVA 1YS7A 2FE3A 2R7ZJ 1K7AA 4A3JJ 2ZKZA 4I98B 5LRSA 2JA6J 1Z3YA 1IRXA 1TZLA 2NVUB 3RKWA 3GBGA 5D6FA 4EMSA 1MMAA 1WQ2A 2R7VA 2K3PA 2GQQA 3X2QH 2Z16A 3PNYA 3GTKJ 3F8BA 4W1UA 1LE8B 1OCPA 5IYDJ 5B5EC 2KRCA 3HL2A 2NS7A 1Y39A 1YW9A 3RI4A 1ITYA 1SMYF 2LH9A 5E1WA 4DQ2A 2MGQA 2EZIA 4HG2A 2JRMA 2ZB9A 2VQHA 3D5RC 4FE4A 1QHGA 2DT5A 2DFIA 3DXJF 2A6HF 1MGTA 2XB5A 1Z7UA 4DBRA 5AIQA 3BQYA 1USSA 2EFWA 3VSKA 2B7EA 2DA4A 3FBNB 3GFJA 3GW2A 3FWEA 1OYYA 2X6YA 5B3SH 4CYCA 2W85A 2BY0A 2L9SA 2NS8A 4PK4A 2M9HA 1B8IA 2XB0X 2HOSA 2JVHA 1SFUA 1RETA 2D5VA 4U0VA 2KP6A 2P5VA 1BN5A 3CDLA 3GFIA 4G7HF 2EZHA 1KU9A 2XSDC 3RIRA 2XAFA 4ESJA 3D5SC 1G3WA 2FQ4A 1ON2A 5LRRA 4JP0A 1SFEA 2DU9A 4BUPA 2QKMB 5EZHA 2YX4A 3ASNH 4RAGA 2WAQN 2EZKA 4FX0A 1HW1A 2W24A 1QVTA 2VL8A 1B1BA 2RQPA 3QP6A 2DODA 3SZGA 2WTEA 4ZDLA 3G2BA 3K7AJ 4BDZA 1A35A 3CD6I 1ZELA 3J81K 1U8BA 4AIKA 1K4SA 1KU7A 3TO9A 3ABLH 4UVAA 5HS8A 2EFQA 2O6GE 2QQAA 3IRQA 3DBRB 2Y2ZA 3VEPA 3S3MA 2E7WA 4PSWA 2ZXJA 4MTDA 4C3HJ 2HDCA 2M3AA 1KONA 3F9KA 4Y3OA 2Y9ZA 2OTJI 1MMDA 2L9NA 2OZUA 5ICCA 5L3EA 2XPWA 1UFMA 1D1BA 1G2HA 2V9KA 4RDUA 3MEXA 2DYSH 2IAIA 3WHCA 2L7MP 1GV2A 5BPDA 1ETVA 2VJIA 4HX4A 4LGWA 3ZCOA 2GAUA 2E19A 3JRDA 3H3UA 2DMUA 1HQCA 2PJRB 3Q9SA 5EGOA 1IN4A 3FMSA 2QEXI 4B3AA 5GAEJ 3VFZA 5HLTA 2WBMA 5HS7A 3LSTA 3FHZA 1R58A 3BT9A 1APLC 1QNTA 2O8XA 2NVQJ 2CFXA 4XOPA 2H1LA 5F6FA 3OYMA 3JRHA 2BEOA 2CSOA 3HXLA 2B9SA 1UB9A 3TEDA 2XAHA 4FHTA 2FOWA 4G94A 3K4NA 1XGMA 2BY2A 3I59A 2GBYA 3L2CA 1B72B 4FE7A 2XGXA 5HS9A 2QF7A 2BW3A 2EFPA 4X1EA 1OPCA 3C2BA 2Y0SA 3OIOA 3DU5A 5GPCA 4AD9A 3CUQB 3F23A 1N75A 1MBKA 4J00A 3K4JA 3L1PA 4UHTA 2CQKA 2LFBA 4ANJA 3FXKA 4HF0A 1MNDA 4FQGA 5AIPA 4P55A 2X48A 1MSEC 1FX7A 2M5WA 4L5JA 3HHGA 3PQKA 3T8TA 1PYVA 3DPLC 4B3XA 5D4SA 2FBKA 2QVOA 4JX6A 2GOXB 4EJWA 1X1CA 4M9ZA 4N9IA 3FIWA 2FJ1A 3BCBA 3V7SA 1JUMA 3ZP5A 4ENKA 3QYBA 3SDGA 1SFXA 2VPRA 4S05A 5E20A 4BEHB 2ELJA 4A93J 3OYHA 5IOZA 2LBFA 3BJ6A 3S1RJ 1D5VA 2BY1A 4OIRF 3HTUA 1BR2A 4M3GA 5LD2C 3ZGKA 2BV6A 4BQNA 2LLKA 3FK6A 3PNTA 1ENHA 3WODF 1BOBA 3TQNA 4DOZA 4A3DJ 1Z6TA 4NC6A 4XLNF 2MFZA 5KAFC 1P4AA 2DI3A 1YW7A 4BE0A 2HR3A 3CESA 1AA7A 1XGNA 3CLOA 3V42A 1DGRM 5DCMA 5FLMJ 3NRVA 4XKBA 2DTRA 3CDIA 4YRVA 4PFOA 4XMYA 5FLVA 1I27A 3H5AA 2YX7A 3Q0VA 4BE1A 2VQLA 4BXFA 2LY1A 4IOCF 4F55A 2KL4A 3K4CA 1A6IA 1BC7C 3ZN1A 1TT5B 2XSJC 1W4MA 2MW8A 4RBOA 5E8GA 1U9OA 1XB4A 2VBWA 3BG9A 4MFEA 4I0BA 4U7BA 5H6QA 5J8FA 2XC7A 2XF7A 2L9RA 2F5VA 5BQTA 4A3CJ 3VYRB 3E3VA 3NEUA 2R0QC 1TQMA 5D4RA 1IRFA 3E6CC 4GFBA 3DTKA 2AXTC 2IPQX 3WGHA 1B9MA 1X1BA 2X4HA 5JVGF 4X6AJ 1S8NA 3RPQA 4J19A 1N25A 1FIPA 2ZNYA 2R5YA 3RKYA 4XRFA 2PJPA 1FYMA 1Z9CA 2Y9YA 3MN2A 2X1DA 4BH9A 4AIJA 2AXLA 4LOCA 5LEKA 3K1NA 1W7PB 2ECCA 5GAGJ 4U88A 4U0YA 4WK8F 1BOAA 3KYCB 2Z1DA 5DM6F 2PMZA 2FX0A 4RA2A 4BYYA 2CQNA 2K3FA 5A2QK 2W84A 1U9NA 1S7AA 1UG2A 3HBLA 2X6OA 5KAIC 1JJ8C 2VKVA 3ZR8X 1Y8QB 3K4LA 1H9TA 2CJJA 3OYGA 1YITI 1BR1A 3KP6A 1W0TA 1ZR4A 2HKXA 3BR2A 3HOSA 5IOYA 1FLIA 5CVIA 1IJWC 4ZZLA 3BJAA 3BR5A 4Y7NJ 1BW5A 1LVKA 2W25A 3I5UA 3CF2A 4AVPA 1D8KA 3PFIA 1AHDP 2DT7B 2A6TA 4XRSG 1P4XA 3CMAI 3ZQGA 1MJAA 2XHKA 3ZQ7A 1UJ8A 1V5EA 1RESA 2HOEA 1CF7A 3DV8A 5H20A 5DUIA 3L7WA 1ZRDA 5F04A 2H94A 2FNPA 2NVYJ 5HDKA 1TWCJ 1LKXA 3REOA 4UV8A 3LAJA 2L0KA 1IC8A 1NHAA 2JPBA 3DP7A 3M7GA 3O8GA 3R6SA 4HNTA 4XIDA 3IL2A 2X85A 1GVDA 3CUOA 4D7MA 5D8LB 1MH4A 2OCCH 2FBHA 3NWTA 2XF5A 1LDKB 3BWGA 5J40A 2WAEA 1UELB 4CZZA 1ON1A 2GLOA 3DEEA 3U1DA 2W82A 3A1YA 2V1UA 1Y8RB 3OS2A 1SD7A 2VJJA 2CU7A 2CG4A 4DJAA 4KNYA 2VT2A 2VBYA 5IY5H 3HRSA 1UZCA 4F91B 1X1AA 5BMZA 2X6XA 2M7AA 1OCZH 3F6VA 1KA8A 1BM9A 1CQTA 2F4OB 4PSXA 2XKPA 2DA1A 1GXPA 2PMZN 4A2UA 2Y0MA 4L9NA 3OIQA 3ERED 1VQNI 2PMHA 3AG1H 1TQPA 4HZFA 3ZMTA 3HDDA 1H89C 3JRBA 1XPXA 1DPRA 3E5QA 2HGCA 4XKVA 1XSXA 3QP5A 5F64A 1A04A 2ESNA 5B1AH 4CZCA 1O3SA 4CDGA 2KIMA 4V19K 5LEJA 3W3CA 2VJ4A 2E36A 4HRIA 4A69C 3WHBA 5D8KB 2IGKA 1K6YA 3IWFA 2JQ7A 1WCMJ 3MMYB 5DV5A 1YE9A 3GMEA 3M07A 2DFHA 2L7KA 3L2RA 3OYNA 4BE2A 2R5ZA 5EGOB 4NQWA 5CYVA 2V6EA 3LWFA 3WTXC 2IT0A 4IQJA 5HNFA 2LY9A 2FD5A 5F0CA 2UWMA 1DP3A 1Z91A 3KYDB 3FXMA 2JK3A 2P5LC 2E2HJ 2EA4A 2K02A 1R00A 2FF4A 3WTSC 2KQRA 3FBIB 4RGRA 1SFKA 4QIWN 5K7FA 2XAJA 2CV2A 3E5XA 2VN2A 3DLAA 4ZYHA 4CCMA 1HSJA 2KDOA 1S9HA 1VNDA 2UV1A 3HUGB 4MHGA 4C30A 4PUSA 3DLLF 2D45A 4EVIA 3K69A 4G6TB 2BVLA 1GLNA 4D0PA 3OYLA 3BG7A 3GTOJ 5E17F 3M8FA 1HBXG 3DQVC 4AC0A 3TGNA 4D5FA 3E5UA 4LB5A 4NDLA 4PJ0C 4Q48A 3OYAA 2CGPA 1E2XA 1OYWA 3P9KA 3EDPA 1H9GA 2DW4A 3ZQLA 5GTIC 4MEXF 3S3OA 3GZ6A 1ZLKA 1QGPA 3ZRGA 3I55I 1SD6A 4Y15A 2L4MA 4R79A 3O8HA 3PM1A 3QU6A 3E7LA 5C3EJ 3JRIA 1TLHB 1FSEA 4PJJA 1BI2A 1W5CC 3PUFA 5L3GA 3OOPA 4A3LJ 2W7NA 2OD5A 1ODDA 3ABTA 3JW4A 4BQQA 2CUJA 3WE2A 1A36A 2P5KA 3AG4H 4KIBA 3FHNA 3J80Z 1G3YA 1J59A 4RB2C 3JRFA 1UAAA 3DKXA 2R7DA 1R36A 2VQCA 4AYBA 5IT3A 5BPIA 3C2GA 3OV8A 3DBHB 4A6EA 3H3VK 1MD0A 5K1YA 2E1OA 1ZLJA 2QLZA 3N4MA 2JWTA 2KMUA 3CP2A 3M4OJ 3FM3A 3RDIA 2UUZA 2AQFA 4ENJA 1D8JA 1IDYA 3OYFA 3KX2A 1S7EA 1SC7A 2DTZA 2OA4A 3GZNB 2JTVA 2LOOA 2KRFA 4QPQA 4DYRA 4F92B 3PJRA 1ZAOA 4P9FA 3CUQA 1KU2A 1EF4A 2Y69H 4KUMA 1GDTA 2NYXA 3BR1A 2R7TA 4BXUA 1O7LA 3LOCA 2GIZA 2LVSA 2V1DA 4LITA 5FLXZ 1U5TB 1KQ8A 4D1QA 3DPUA 2HYGD 3OSFA 2JUCA 1IG7A 5FFZA 2EV0A 4LD5A 2V1NA 3P9CA 3R60A 3DBLB 3RPUD 5ICEA 1TBXA 3BCAA 4IQ4A 1ZHFA 5FD6A 2WAFA 4RM3A 4C3JJ 2G7UA 3PO3J 3H0GJ 3H92A 2XRLA 2CS3A 4GRIA 2RN7A 3R0JA 3KEQA 3K1PA 2EFNA 2IA2A 3KP3A 3WU2C 3LAPA 5L3BA 1RRJA 3K4BA 4KT5C 4M6XA 3H36A 5JLWA 1DQUA 3H9GA 3HG9A 4HV6A 4JK1X 5EJCA 2KFDA 1T2KA 2CFOA 4ABZA 1X19A 4NHJA 3SYTA 5LGUA 2DO7A 2ZMEA 3TDUC 1IAWA 2O03A 3MKZA 4ZTJA 1D1CA 1S5LC 2YSRA 3OSGA 1T8IA 1RUOA 1QPIA 9ANTA 3GTQJ 3GLXA 4IKFA 2DA6A 3KZIC 2CV1A 1G4DA 3F72A 3BLYA 2DPUA 2GXAA 1NG7A 4M6VA 4YFXF 3E6BA 1I39A 1X2MA 5HODA 2O7OA 3F3XA 2CH0A 2FEZA 3I4MJ 2ZMEB 3OWTA 1JUSA 3FX3A 4DNCA 3F6OA 4QWQA 2YPRA 1VI0A 1MBJA 2P7CB 2IW5A 2HZDA 1ZR2A 2XPUA 3RJPA 1DP7P 1L3LA 2R7SA 2DK8A 2K7LA 5EEGA 3J7ZI 2PI0A 4IHSA 4XM3A 3T0YA 1VFCA 1ETOA 2MSYA 2CRGA 4CYCB 1WH5A 3GYHX 4OWRB 2Y0SN 3RKQA 3FKIJ 4I7HA 5ILVA 3S2DJ 4DZJA 3V8JA 2LK2A 1OLTA 2G0EA 1RR8C 1ZRCA 3M3YJ 2FQ3A 1NTCA 4BU2A 2E7XA 3GTMJ 2ELKA 5M5WJ 4HA8A 2H6CA 1U78A 3E6DA 3HGGA 3TDZC 1X3ZB 5EG0A 1BA5A 3SQNA 1QZYA 1EH6A 3BROA 3K70D 4KFCA 4I2OA 2E71A 5A2QZ 3LA3A 3J7AY 4LG0B 4PJNA 4YELA 2XIGA 3AG2H 5HLIA 4AYBN 2DMQA 2OU2A 2Q2EB 4OIQF 4LK0F 1LE8A 1S72I 1T39A 1MBFA 2HYFA 3FXQA 3TOBA 5BS6A 1WJCA 5LGTA 3G1OA 3G1LA 2KLOA 3H1CA 1ETWA 4UNOA 1P6RA 5ED4A 2OJED 3SZPA 4IHVA 2CQQA 4E7SA 3CCVI 2O61A 1PDNC 4NQWB 3HRUA 1V54H 4RAFA 2CV0A 4E7HA 2XRNA 2HVQA 4EM2A 4ZYAA 2VIXA 3L2WA 2COBA 3SZTA 2V9VA 4A0XA 5HLHA 2JA2A 2NXNB 3ECHA 3LSKA 3CJTB 4EQQA 1E17A 5HLGA 2PLYA 2DDAA 1LEBA 4FASD 2K85A 3OS0A 3BTLA 5KK1A 3G6EI 2B63J 2QQ9A 1P7JA 3KLOA 3AG3H 3LSGA 3O2PE 5C4JJ 2KJBA 2JSPA 4CCLA 4RB3C 2R7OA 2JZYA 1KZHA 4KISA 1F9NA 2PG4A 1FIAA 5LGNA 5D5UB 4II2A 3JAMK 1TWGJ 3I64A 1GXQA 3H9JA 1W36D 5CKTA 2LDUA 3IP4B 3I71A 2BVMA 4QTRA 2TRTA 1WJBA 2IXSA 3IWZA 2DAOA 1GVJA 4XRMA 3ROUA 2F5DA 3EPZA 3PL8A 1Z6RA 5LHIA 3J81Z 2R7UA 2EZLA 2KPMA 4I99C 1LFBA 5FRMA 2X9DA 3CCQI 4Y33A 4AWXB 2W48A 2F4IA 3KEYA 5CVRA 4BHBA 2Z3YA 1JKRC 2MLKA 2A05A 5FROA 2R7FA 4I01A 2EJRA 3GFLA 3BZ6A 4F3QA 3TKYA 4ENNA 4A3BJ 4E70A 3A02A 4XKCA 2HDDA 5CQEA 2EV5A 3FXOA 4M73A 4P1WA 1WHUA 4PDKA 2R7WA 2DA5A 3ZQFA 3S2HJ 2PN6A 4EJUA 4OMZA 2EFOA 2XF6A 1E3PA 4UB8C 4A5MA 2L02A 3A2KA 2EIJH 2GXGA 2I8DA 1JTXA 2VE8A 5ERIA 5EEAA 1NK2P 3SEQA 2L7FP 1HDPA 5LFAA 1REPC 4AM3A 2ICWG 3TBIA 3RYRA 1WPKA 1G3SA 2BY3A 4M3BA 2RKHA 1ZGWA 1JGGA 5E3OA 1YJNI 1S7OA 1R23A 3F21A 5FKLA 2JA7J 2COMA 3EUHA 3LSHA 2V9PA 2XAQA 4LB6B 2CW0F 4BQOA 1BC8C 1BL0A 3C18A 4P5OA 2LKXA 5FLXK 3K2AA 1DU0A 2YU3A 1I3QJ 4IF4A 3HUGA 2K9QA 4G9YA 2EPFA 1C0WA 4DYQA 3MFKA 2LREA 3IHUA 1ZN2A 4A3KJ 3VYUB 4A3EJ 3GZ5A 1KQ9A 3WU1B 2VT3A 1MDMA 4M6YA 1ZQ3P 1J9IA 3I58A 2CQXA 2HU9A 3C7JA 2FMYA 3C3WA 1WKMA 3MAJA 1ETXA 4F93B 1AKHB 4BNCA 2JN6A 3LA7A 4BHPA 4QSHA 5FRNA 3S1MJ 2KDZA 2YU9J 2JJ7A 4IRIA 1QRYA 2F5FA 5FKMA 4HOBA 5J4YA 4FTHA 4RAZA 1VQLI 2ZO4A 2EV6A 2ID6A 1T56A 4WWCA 1U6GA 3K6GA 2QQBA 3K2ZA 1SVOA 3OYKA 3LFKA 3KP2A 4QPOA 2UZKA 2YS9A 4XQFA 2M0CA 4OMYA 2GIVA 4A0ZA 2ELHA 2H8RA 3A4CA 4RGUA 4A5NA 3WG9A 5D5VB 3LSMA 1FYKA 4OIPF 1FWZA 2Y75A 1QVUA 4UY8I 4M3EA 1YYVA 2ZJ2A 5CLSA 4CO8A 3HC7A 1GUUA 3LQRA 3Q0UA 3L00A 3I56I 3V4GA 2M87A 3FXRA 2VXZA 1ZG1A 1YTYA 2QKLB 2TCTA 1ZG3A 2DPDA 5M3MJ 3ZPLA 1J5YA 3O6BB 3PSIA 1VQMI 4X0GA 1O3TA 2MA3A 3HRMA 2NS0A 2K9SA 4CUGA 1IXRC 3LA2A 1T98A 4KICA 4RS8A 4CGZA 3CCEI 1JTYA 2O0YA 3IRRA 5BOXA 4BY1J 2IA1A 1FBUA 4S04A 3TO7A 1PP7U 2LF7A 1FY7A 2OTLI 3GF2A 4HEA2 1RR7A 3HGYA 4UUVA 1XX5A 5E1ZB 3VB2A 5J1UA 2EH3A 5C4XJ 3WTWC 3IH3A 2FMLA 3WU0A 5F08A 3ABUA 4I09A 4IPAA 2GA2A 1TQIA 2BBYA 4NC7A 4XLEA 3MZYA 3BOQA 3I9V2 3PIOF 3F8CA 4E7ZA 3VOEA 1T6SA 2I5UA 2K86A 2ZJRF 2L9VA 4XSXF 4YFKF 3GTPJ 4DIQA 4IRHA 1XC5A 3C2HA 1USTA 2WA0A 3RKXA 4M72A 1OR7C 2OQGA 3K4MA 3GXOA 3RTRA 4UUSB 1T38A 1ZRFA 1VQ6I 4JBAA 3TO6A 4LLLA 5DM7F 1V5GA 1U8RA 2VBZA 3OL3A 2OQRA 4IEJA 5E18F 1I6XA 3M8EA 2F2EA 2MH9A 3G71I 2Z9OA 1IXCA 5FGMA 3FISA 2IGOA 5DDGA 3MCZA 5IP7J 4HQEA 2IP2A 2FNAA 5JFRA 5DCMB 1Y6IA 1R5HA 1W5TA 1YQAA 2VODA 3OYDA 5FB2A 1IN5A 4IHTA 3ZQHA 3UNGC 4ZJZA 4ITVA 5AONA 5LHGA 2WADA 1YX5A 2IGNA 4OAYA 1OCCH 1VQKI 2EWNA 1UHSA 2ZNZA 4KT6A 3BP8A 2V26A 1YJWI 4YIRX 1UMQA 1W7PD 3BQZA 5DS9A 3IH2A 3LNQA 1U5TC 2HEOA 2R5YB 4HYEA 1ZG5A 2ZXHA 2E1CA 3NWSA 1F1ZA 2JUGA 5KNLA 4LG0A 3JRCA 2IS6A 4ESBA 1P7IA 3SEZA 2ZBKA 1G3TA 3H5NA 2DMNA 4HSTA 3HOUJ 3NAUA 3LMMA 5HVQC 2ZFWA 3COAC 3RSNA 3W6JB 3N05A 3H0DA 2VI6A 4PZJA 3HOTA 5L3DA 4FETA 1Q1VA 1TWAJ 2PMUA 3QYEA 3JRGA 2GOMA 4E7LA 1VQ4I 4HLXA 2M8EA 3D0SA 3B02A 3E0JB 3BC8A 1QU3A 3CC7I 1NG6A 2XGDA 3L2VA 4D9JA 2HI3A 2WAQA 3PQJA 1R22A 4XR6A 3EUKL 2XDVA 2ISYA 1K78A 1BW6A 1J2XA 2QM3A 1MNMC 3CCYA 3L09A 1QO0D 5E3MA 4H0EA 1FNNA 2HQAA 3K0LA 3I59B 2HXIA 3ECOA 4L5EA 2OZ6A 1R71A 2Z33A 3ULQB 5JVTA 1K6OA 1VQ7I 2TDXA 1K61A 2VKEA 3N97A 4CYDA 4BDYA 4NB5A 2AHQA 4S0HB 2MLGA 1A31A 4W97A 1IV8A 3ZXSA 3S15J 1EA3A 3G4SI 1O57A 3OIPA 1MZBA 1Z67A 3FMQA 1TNTA 3FXJA 1HKSA 3GFMA 4Q4ZF 1V5FA 2DDBA 1O3RA 3HPHA 4Y4RA 2DOAA 1R1VA 2PEXA 3KYLA 2DYRH 4E7JA 2VLAA 1RPWA 1XSVA 5J6XA 4LK1F 3WG7H 4BEHA 4BY7J 3OYBA 4LJZF 2OUMA 3E97A 3ONQA 3CZ6A 2PFBA 2RREA 1XMXA 1WJEA 3CF5F 3HEFA 2R7QA 2KKOA 4BL0B
chains in the Genus database with same CATH topology
3K1MA 3HSFA 2ISZA 4HBLA 2FOKA 1RNLA 3ELKA 2NNYA 2XAGA 4HQMA 1L0OC 1TNSA 3F22A 1AWCA 1V4RA 2JRTA 4M9SA 2H27A 3D5LA 2H6BA 3BPVA 1P2FA 1R1TA 2JT1A 2J5OA 2HQNA 2KIUA 4OU0A 1XD7A 1MDMB 2L54A 3BJOA 3KP7A 4ESFA 4GYGA 2MH2A 4UV9A 4YG2F 2EA2A 3P9IA 5LBQA 1U3EM 3CO6C 1ZH5A 4RB0A 1XSDA 2PQ8A 3KETA 1FBSA 3F8MA 4ASNA 2QBYB 3EQLF 1I1SA 3KZYA 1FZPB 5IT9Z 2L4AA 2GWRA 3K9TA 3DF8A 1YIOA 2IA0A 2CO5A 3H3ZA 2VOPA 1DUXC 2HFHA 1I1GA 3WGIA 4EM1A 2ZCWA 3NQOA 4L5IA 1EH7A 3F8FA 5KVRA 3I54A 1OR7A 2D1VA 4R8HA 1FP1D 2MBFA 2HTJA 3O3KA 4ZZDA 2FA5A 1IF1A 1IXSB 5L3FA 1IN6A 4P96A 5HDGA 1ZREA 1IUYA 3VODA 2A68F 4A6DA 3HRTA 1ZARA 2A61A 3S2WA 4WXCA 2EB7A 4I0AA 2QWWA 3GWZA 3WTTC 2FRHA 1WRJA 2K4BA 1TW3A 1IZ1A 4L9TA 1QZZA 1Q1HA 3DFGA 2Z5UA 2D1HA 1KQ0A 1ULYA 4N0BA 4HV5A 3WTVC 4KN7X 2BE5F 3IKVA 4XBFA 2P4WA 3EETA 1FT9A 1DPUA 1R7JA 1XDUA 2UXNA 3ZMUA 2KJCA 3EYYA 1AOYA 5D6EA 3ZMZA 2FU4A 2X0LA 2F5EA 4EJVA 1BI1A 5DUKA 2XASA 4CICA 3QPTA 2DK5A 4UVBA 1YO5C 4WF2A 2HWVA 4CHUA 5FD5A 4Z2YA 2DBBA 3ZN0A 1JE8A 1WI9A 3JAMZ 3GX4X 1BIAA 4FX4A 2V1XA 4RGSA 2GZWA 1S29A 3M1EA 2G9WA 4G7ZF 3T1BA 4YFNF 1LVAA 2A3SA 3BY6A 2FXAA 1LDDA 1O7FA 3E6MA 2LF8A 4MTEA 5ILSA 5FFXA 3WTZA 5L3CA 1FSHA 1XGSA 2D2WA 3KFWX 5DYMA 4ZH4F 4GXOA 2Y48A 2RC4A 1ZGAA 4MNUA 2A69F 3V8KA 1YS6A 3C1DA 2OBPA 3CDHA 4UVCA 2P6TA 1K78B 3RPUA 2VONA 4LFUA 4IJAA 4TV7A 4MEYF 4AIHA 1EH8A 4ZYGA 3U2RA 4LLGF 2XVCA 4EJTA 4Y17A 1XCBA 5LLQA 3R61A 4LMYA 4PCQA 3QPHA 2QUFA 3J80K 1IW7F 4PGGA 2O3FA 3FM5A 1QQIA 2STTA 4ENMA 2UXXA 4K2EA 1HSTA 2A5YB 1Z05A 5CVUA 3KE2A 4G6QA 1B4AA 5DD4A 3WTUC 2HTSA 3TOAA 1WWXA 4KN4X 1FOKA 2WWYA 1XGOA 2HZTA 2Q2EA 1OYIA 3KEOA 3DKWA 4L18B 3T5XA 2MD5A 4MGRA 4GO1A 1RZ4A 2M30A 3Q9VA 1QBJA 1JGSA 2ADUA 1ZYRF 1KU3A 4L0ZB 1K79A 3HSRA 2LNBA 4HDUA 4GGGA 1KGSA 1FC3A 1QPMA 3Q5FA 4GYIA 2RGVA 1BIBA 1YFHA 4LLNA 4Q5SF 2A07F 2CYYA 1XCVA 2M45A 5IT9K 1WSUA 1UHWA 4KIGA 4IXAA 3SXYA 4OOIA 3F8NA 1FP2A 4A0YA 4HX8A 1J0RA 3QAHA 1W7PA 1Z1DA 1HKQA 4HX7A 1LDJA 4WXDA 1U2WA 1XMKA 3HHHA 2RV8A 1U5TA 2LSOA 2LKPA 1UCRA 5CJ9A 5K5RA 2VOOA 2RVCA 4RGXA 2L01A 3HSEA 3DPTA 5DEQA 1KYZA 2HQRA 3ISPA 2NRAC 1BBYA 1HXDA 3ZMVA 4G6DA 4YIIA 3CO7C 4Y13A 3P7NA 1X3UA 1TTYA 1P4WA 2RDPA 4P9UA 3CUQC 4MQ9F 1RUNA 4I02A 2P8TA 1CF7B 3I4PA 2P7VB 3G3ZA 3JTGA 1ONVA 2FBIA 1JHFA 4G7OF 5TJJA 2JSCA 4L9JA 3KCCA 1MKMA 1J75A 1D3YA 2XV4S 5ILUA 5DD8A 1YG2A 4O5VA 1ZGJA 2VBXA 5EEHA 3JTHA 2BYVE 2PBIA 1LEAA 2MC3A 4UXNA 3RYPA 3BDDA 3QOPA 4B09A 1LB2A 1R1UA 2QYOA 1HW5A 2HS5A 4XLPF 5H6RA 3ZMDA 4YIFA 2XROA 3WTYC 4JQFA 5HOOA 2G7HA 1V3FA 4HAMA 1VTNC 3DEUA 2ACJA 3FMRA 1B6AA 1FPQA 4OINF 2M1BA 4OIOF 4EGZA 2VC1A 4M71A 1OMIA 2NNNA 4WCGA 1BI3A 1BJAA 1PP8F 1JXSA 3CJNA 2F5CA 5DCFA 2ETHA 3AAFA 2GXBA 3WGGA 3GO5A 1KYWA 3WE3A 3CTAA 4HF1A 4EV0A 1XN7A 1BI0A 1Y0UA 3W6KB 3HIFA 1CGPA 4KA4A 3GUDA 5JR3A 1SMTA 3KP5A 2B0LA 4MQVA 4KYWA 2R3SA 3EYIA 2OAZA 3G73A 4ZYEA 1STZA 2XKOA 3FXUA 3R4KA 5ICGA 1PUEE 2NAZA 2VC0A 1SD5A 3KZZA 3MWMA 3T8RA 3J7AO 1XDSA 2FSWA 1SD4A 1LQ1A 3IKTA 1IRGA 4IRGA 4XSZF 1I5ZA 3BPXA 2QZ8A 3GEZA 3JSOA 4ON0A 1MJ9A 5FO5A 2W57A 3I0TA 3ML6A 1RIOH 2L3DA 2HKOA 2STWA 4EM0B 3V8LA 2JPCA 3KP4A 3L9FA 2KIFA 1SAXA 4KDPA 4R1HA 2ESHA 3HYIA 2EK5A 2BGCA 1RI7A 1EV7A 4L0YB 3IC7A 2WV0A 2VE9A 5D5XB 1IN7A 1FBQA 1W5SA 3V7RA 2A6EF 1R5GA 2AS5F 4KMFA 1F5TA 3I53A 2K27A 4HF2A 3FZVA 4A12A 4PGHA 3HTSB 1HKTA 4EGYA 1LNWA 3FF5A 4RAYA 1FYLA 1MJBA 3V7CA 1XMAA 4BQAA 2K4JA 5E8IA 3JSPA 4L9VA 4IVNA 4O6JA 4Q47A 4KMUX 4N9HA 5HDNA 1HW2A 5TRDA 3B73A 1F4KA 3R0AA 1JHHA 1TW2A 5D5WB 1T0FA 2V79A 5F1RA 4WXHA 6PAXA 1YW8A 1LJ9A 4KIFA 2IJLA 1GHCA 1S3JA 1S6LA 2IVMA 2WC2A 5J8CA 3SFZA 4BAYA 2QBYA 2J5PA 2RNJA 2E1NA 5CVVA 2H09A 1YLFA 4FT8A 2GA1A 2P6SA 1G6NA 4HW0A 2DLLA 1OKRA 4O3MA 4G8XA 4CXFA 2Z99A 3QU3A 3MZHA 5K5OA 3KLNA 5K5QA 1J7KA 2CWEA 2YR2A 2XUBA 4F7ZA 3MQ0A 3SHFA 5JHUA 2DQLA 2V6CA 3GVAA 3U9GA 5JI6A 3M9AA 1B59A 4B8XA 2C6YA 4GCVA 2Q0OA 1B9NA 5E1XA 1H0MA 4ETSA 4ZYDA 3LQQA 2DQRA 2IRFG 4U0WA 1P92A 2Q8KA 5CVJA 1IN8A 3QRFF 4HLYA 3ZMSA 4QLCU 1O3QA 4M74A 4BHCA 4RB1A 4U7DA 1UHMA 5LHHA 1DDNA 4M9XA 5ICFA 4WX9A 2QENA 4EJOA 4HDVA 1YS7A 2FE3A 1K7AA 2ZKZA 4I98B 5LRSA 3RKWA 5D6FA 4EMSA 1WQ2A 2GQQA 3F8BA 1YW9A 3RI4A 1SMYF 5E1WA 4DQ2A 2DT5A 2DFIA 3DXJF 2A6HF 1MGTA 1Z7UA 5AIQA 1USSA 2EFWA 3GFJA 3GW2A 3FWEA 1OYYA 2W85A 1SFUA 4U0VA 2P5VA 1BN5A 3GFIA 4G7HF 1KU9A 3RIRA 2XAFA 4ESJA 1G3WA 1ON2A 5LRRA 1SFEA 2DU9A 2YX4A 4FX0A 1HW1A 2W24A 3QP6A 1B1BA 2RQPA 2WTEA 3J81K 4AIKA 1KU7A 3TO9A 5HS8A 4UVAA 2O6GE 2EFQA 2QQAA 3IRQA 3VEPA 2E7WA 2ZXJA 4MTDA 2HDCA 2OZUA 5ICCA 5L3EA 1UFMA 3MEXA 5BPDA 4HX4A 4LGWA 2GAUA 3H3UA 1HQCA 3Q9SA 1IN4A 3FMSA 3VFZA 5HS7A 3LSTA 3FHZA 1R58A 1QNTA 2O8XA 2CFXA 5F6FA 2BEOA 2CSOA 1UB9A 2XAHA 4FHTA 4G94A 1XGMA 3I59A 3L2CA 2XGXA 5HS9A 2EFPA 1OPCA 4AD9A 3CUQB 3F23A 4UHTA 2CQKA 4HF0A 5AIPA 4P55A 1FX7A 2M5WA 4L5JA 3HHGA 3PQKA 3T8TA 3DPLC 5D4SA 2FBKA 2QVOA 4EJWA 4M9ZA 4N9IA 3V7SA 4ENKA 3ZP5A 1SFXA 4S05A 5E20A 3BJ6A 1D5VA 4OIRF 3HTUA 2BV6A 3WODF 3TQNA 1Z6TA 4XLNF 1P4AA 2DI3A 1YW7A 2HR3A 1XGNA 3CLOA 5DCMA 3NRVA 2DTRA 1I27A 2YX7A 1BC7C 3ZN1A 1W4MA 5E8GA 1XB4A 2VBWA 4I0BA 4U7BA 5H6QA 5J8FA 5BQTA 3E3VA 3NEUA 3E6CC 1TQMA 1IRFA 5D4RA 2IPQX 3WGHA 1B9MA 2X4HA 1S8NA 3RPQA 2ZNYA 3RKYA 4XRFA 2PJPA 1FYMA 1Z9CA 4AIJA 4BH9A 2AXLA 5LEKA 3K1NA 1W7PB 4U88A 4U0YA 4WK8F 1BOAA 5A2QK 4BYYA 2W84A 1S7AA 1H9TA 3KP6A 2HKXA 3HOSA 1FLIA 5CVIA 4ZZLA 3BJAA 2W25A 3I5UA 4AVPA 1D8KA 3PFIA 1P4XA 1MJAA 2XHKA 3ZQ7A 2HOEA 1CF7A 3DV8A 5H20A 5DUIA 3L7WA 1ZRDA 2H94A 2FNPA 5HDKA 3REOA 4UV8A 3LAJA 1NHAA 2JPBA 3DP7A 3M7GA 3R6SA 3IL2A 3CUOA 5D8LB 2FBHA 1LDKB 3BWGA 4CZZA 1ON1A 3U1DA 2V1UA 1SD7A 2CG4A 4KNYA 2VT2A 2VBYA 3HRSA 5BMZA 3F6VA 1KA8A 1BM9A 2XKPA 1GXPA 4A2UA 2Y0MA 4L9NA 3ERED 2PMHA 1TQPA 4HZFA 3ZMTA 1DPRA 3E5QA 2HGCA 1XSXA 3QP5A 5F64A 1A04A 2ESNA 1O3SA 4CDGA 2KIMA 5LEJA 5D8KB 3IWFA 5DV5A 4NQWA 5CYVA 3LWFA 3WTXC 2IT0A 2UWMA 1Z91A 2P5LC 2EA4A 2K02A 1R00A 2FF4A 3WTSC 4RGRA 2XAJA 3E5XA 2VN2A 4ZYHA 1HSJA 4MHGA 2D45A 4EVIA 3K69A 4D0PA 5E17F 3M8FA 1HBXG 3DQVC 3TGNA 3E5UA 4LB5A 4Q48A 2CGPA 1E2XA 1OYWA 3P9KA 3EDPA 1H9GA 2DW4A 4MEXF 3GZ6A 1ZLKA 1QGPA 1SD6A 4Y15A 2L4MA 4R79A 3QU6A 1TLHB 1FSEA 1BI2A 5L3GA 3OOPA 2OD5A 1ODDA 3ABTA 3JW4A 3WE2A 2P5KA 4KIBA 3J80Z 1G3YA 1J59A 4RB2C 2R7DA 1R36A 5IT3A 5BPIA 4A6EA 3OV8A 1MD0A 5K1YA 1ZLJA 2QLZA 3N4MA 3FM3A 3RDIA 4ENJA 1D8JA 2OA4A 2JTVA 2KRFA 1ZAOA 4P9FA 1KU2A 3CUQA 4KUMA 2NYXA 4BXUA 1O7LA 2V1DA 5FLXZ 1U5TB 1KQ8A 2HYGD 5FFZA 2EV0A 4LD5A 3P9CA 3R60A 5ICEA 1TBXA 1ZHFA 5FD6A 2G7UA 3H92A 2RN7A 3R0JA 3KEQA 3K1PA 2EFNA 2IA2A 3KP3A 3LAPA 5L3BA 4KT5C 4M6XA 4HV6A 4JK1X 1T2KA 5LGUA 2DO7A 2ZMEA 3TDUC 1IAWA 2O03A 2YSRA 1RUOA 3GLXA 1G4DA 3F72A 2DPUA 4YFXF 3E6BA 3F3XA 2FEZA 2ZMEB 3FX3A 4DNCA 3F6OA 4QWQA 2YPRA 2P7CB 2IW5A 3RJPA 1DP7P 1L3LA 2DK8A 2K7LA 5EEGA 2PI0A 4IHSA 3T0YA 3GYHX 4I7HA 5ILVA 3V8JA 1ZRCA 2FQ3A 2E7XA 4HA8A 2H6CA 1U78A 3E6DA 3TDZC 3SQNA 1QZYA 1EH6A 3BROA 4KFCA 4I2OA 5A2QZ 3LA3A 4LG0B 2XIGA 5HLIA 2OU2A 4OIQF 4LK0F 1T39A 2HYFA 3FXQA 3TOBA 5BS6A 5LGTA 4UNOA 1P6RA 5ED4A 3SZPA 2O61A 1PDNC 3HRUA 2XRNA 4EM2A 3SZTA 2V9VA 4A0XA 5HLHA 3ECHA 4EQQA 1E17A 5HLGA 2PLYA 1LEBA 5KK1A 2QQ9A 3KLOA 3O2PE 2KJBA 4RB3C 2JZYA 1F9NA 2PG4A 5D5UB 5LGNA 3JAMK 3I64A 1GXQA 2LDUA 3I71A 3IWZA 2DAOA 1GVJA 3ROUA 2F5DA 1Z6RA 5LHIA 3J81Z 4AWXB 5CVRA 4BHBA 2Z3YA 2MLKA 2R7FA 4I01A 2EJRA 3GFLA 3BZ6A 3TKYA 4ENNA 4E70A 2EV5A 4M73A 4PDKA 2PN6A 4EJUA 4OMZA 2EFOA 4A5MA 2L02A 2GXGA 2VE8A 5ERIA 1REPC 3RYRA 1G3SA 2RKHA 1S7OA 1R23A 3F21A 2COMA 3EUHA 4LB6B 2XAQA 2CW0F 1BC8C 3C18A 4P5OA 5FLXK 2YU3A 4IF4A 3HUGA 4G9YA 1C0WA 3MFKA 3IHUA 1ZN2A 3GZ5A 1KQ9A 3WU1B 2VT3A 1MDMA 4M6YA 1J9IA 3I58A 3C7JA 2FMYA 3C3WA 1WKMA 3MAJA 4BNCA 3LA7A 4BHPA 4IRIA 2F5FA 4HOBA 4RAZA 2ZO4A 2EV6A 4WWCA 1U6GA 2QQBA 3K2ZA 3LFKA 3KP2A 2UZKA 4OMYA 2GIVA 4A0ZA 2ELHA 4RGUA 4A5NA 3WG9A 5D5VB 1FYKA 4OIPF 1FWZA 2Y75A 1YYVA 2ZJ2A 5CLSA 4CO8A 3LQRA 3L00A 3V4GA 2M87A 3FXRA 2VXZA 1ZG1A 1YTYA 1ZG3A 2DPDA 3ZPLA 1J5YA 3O6BB 1O3TA 2MA3A 3HRMA 2NS0A 1IXRC 3LA2A 1T98A 4KICA 4RS8A 4CGZA 3IRRA 2O0YA 5BOXA 2IA1A 1FBUA 4S04A 3TO7A 1PP7U 2LF7A 1FY7A 3GF2A 4UUVA 5E1ZB 3VB2A 3WTWC 2FMLA 3WU0A 3ABUA 4I09A 4IPAA 2GA2A 1TQIA 2BBYA 3MZYA 3BOQA 3F8CA 3VOEA 1T6SA 2K86A 4XSXF 4YFKF 4IRHA 1USTA 3RKXA 4M72A 2OQGA 3RTRA 3GXOA 1ZRFA 1T38A 4JBAA 3TO6A 4LLLA 1U8RA 2VBZA 2OQRA 5E18F 1I6XA 3M8EA 2F2EA 2MH9A 2Z9OA 1IXCA 5FGMA 4HQEA 5DDGA 3MCZA 2IP2A 2FNAA 5JFRA 5DCMB 1W5TA 1R5HA 1YQAA 2VODA 5FB2A 1IN5A 4IHTA 5AONA 5LHGA 2EWNA 2ZNZA 3BP8A 1W7PD 1U5TC 2HEOA 4HYEA 1ZG5A 2E1CA 1F1ZA 4LG0A 4ESBA 2ZBKA 1G3TA 5HVQC 2ZFWA 3COAC 3W6JB 4PZJA 3HOTA 5L3DA 2PMUA 4HLXA 2M8EA 3D0SA 3B02A 3PQJA 1R22A 2ISYA 1K78A 1J2XA 2QM3A 3L09A 1QO0D 4H0EA 1FNNA 3K0LA 3I59B 3ECOA 2OZ6A 2Z33A 3ULQB 5JVTA 1K6OA 2TDXA 3N97A 4CYDA 4NB5A 2MLGA 1O57A 1MZBA 3FMQA 1TNTA 1HKSA 3GFMA 4Q4ZF 1O3RA 1R1VA 2PEXA 1XSVA 5J6XA 4LK1F 4LJZF 3E97A 2PFBA 4NHJA 2KKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1M A;  3HSF A;  2ISZ A;  4HBL A;  2FOK A;  1RNL A;  3ELK A;  2NNY A;  2XAG A;  4HQM A;  1L0O C;  1TNS A;  3F22 A;  1AWC A;  1V4R A;  2JRT A;  4M9S A;  2H27 A;  3D5L A;  2H6B A;  3BPV A;  1P2F A;  1R1T A;  2JT1 A;  2J5O A;  2HQN A;  2KIU A;  4OU0 A;  1XD7 A;  1MDM B;  2L54 A;  3BJO A;  3KP7 A;  4ESF A;  4GYG A;  2MH2 A;  4UV9 A;  4YG2 F;  2EA2 A;  3P9I A;  5LBQ A;  1U3E M;  3CO6 C;  1ZH5 A;  4RB0 A;  1XSD A;  2PQ8 A;  3KET A;  1FBS A;  3F8M A;  4ASN A;  2QBY B;  3EQL F;  1I1S A;  3KZY A;  1FZP B;  5IT9 Z;  2L4A A;  2GWR A;  3K9T A;  3DF8 A;  1YIO A;  2IA0 A;  2CO5 A;  3H3Z A;  2VOP A;  1DUX C;  2HFH A;  1I1G A;  3WGI A;  4EM1 A;  2ZCW A;  3NQO A;  4L5I A;  1EH7 A;  3F8F A;  5KVR A;  3I54 A;  1OR7 A;  2D1V A;  4R8H A;  1FP1 D;  2MBF A;  2HTJ A;  3O3K A;  4ZZD A;  2FA5 A;  1IF1 A;  1IXS B;  5L3F A;  1IN6 A;  4P96 A;  5HDG A;  1ZRE A;  1IUY A;  3VOD A;  2A68 F;  4A6D A;  3HRT A;  1ZAR A;  2A61 A;  3S2W A;  4WXC A;  2EB7 A;  4I0A A;  2QWW A;  3GWZ A;  3WTT C;  2FRH A;  1WRJ A;  2K4B A;  1TW3 A;  1IZ1 A;  4L9T A;  1QZZ A;  1Q1H A;  3DFG A;  2Z5U A;  2D1H A;  1KQ0 A;  1ULY A;  4N0B A;  4HV5 A;  3WTV C;  4KN7 X;  2BE5 F;  3IKV A;  4XBF A;  2P4W A;  3EET A;  1FT9 A;  1DPU A;  1R7J A;  1XDU A;  2UXN A;  3ZMU A;  2KJC A;  3EYY A;  1AOY A;  5D6E A;  3ZMZ A;  2FU4 A;  2X0L A;  2F5E A;  4EJV A;  1BI1 A;  5DUK A;  2XAS A;  4CIC A;  3QPT A;  2DK5 A;  4UVB A;  1YO5 C;  4WF2 A;  2HWV A;  4CHU A;  5FD5 A;  4Z2Y A;  2DBB A;  3ZN0 A;  1JE8 A;  1WI9 A;  3JAM Z;  3GX4 X;  1BIA A;  4FX4 A;  2V1X A;  4RGS A;  2GZW A;  1S29 A;  3M1E A;  2G9W A;  4G7Z F;  3T1B A;  4YFN F;  1LVA A;  2A3S A;  3BY6 A;  2FXA A;  1LDD A;  1O7F A;  3E6M A;  2LF8 A;  4MTE A;  5ILS A;  5FFX A;  3WTZ A;  5L3C A;  1FSH A;  1XGS A;  2D2W A;  3KFW X;  5DYM A;  4ZH4 F;  4GXO A;  2Y48 A;  2RC4 A;  1ZGA A;  4MNU A;  2A69 F;  3V8K A;  1YS6 A;  3C1D A;  2OBP A;  3CDH A;  4UVC A;  2P6T A;  1K78 B;  3RPU A;  2VON A;  4LFU A;  4IJA A;  4TV7 A;  4MEY F;  4AIH A;  1EH8 A;  4ZYG A;  3U2R A;  4LLG F;  2XVC A;  4EJT A;  4Y17 A;  1XCB A;  5LLQ A;  3R61 A;  4LMY A;  4PCQ A;  3QPH A;  2QUF A;  3J80 K;  1IW7 F;  4PGG A;  2O3F A;  3FM5 A;  1QQI A;  2STT A;  4ENM A;  2UXX A;  4K2E A;  1HST A;  2A5Y B;  1Z05 A;  5CVU A;  3KE2 A;  4G6Q A;  1B4A A;  5DD4 A;  3WTU C;  2HTS A;  3TOA A;  1WWX A;  4KN4 X;  1FOK A;  2WWY A;  1XGO A;  2HZT A;  2Q2E A;  1OYI A;  3KEO A;  3DKW A;  4L18 B;  3T5X A;  2MD5 A;  4MGR A;  4GO1 A;  1RZ4 A;  2M30 A;  3Q9V A;  1QBJ A;  1JGS A;  2ADU A;  1ZYR F;  1KU3 A;  4L0Z B;  1K79 A;  3HSR A;  2LNB A;  4HDU A;  4GGG A;  1KGS A;  1FC3 A;  1QPM A;  3Q5F A;  4GYI A;  2RGV A;  1BIB A;  1YFH A;  4LLN A;  4Q5S F;  2A07 F;  2CYY A;  1XCV A;  2M45 A;  5IT9 K;  1WSU A;  1UHW A;  4KIG A;  4IXA A;  3SXY A;  4OOI A;  3F8N A;  1FP2 A;  4A0Y A;  4HX8 A;  1J0R A;  3QAH A;  1W7P A;  1Z1D A;  1HKQ A;  4HX7 A;  1LDJ A;  4WXD A;  1U2W A;  1XMK A;  3HHH A;  2RV8 A;  1U5T A;  2LSO A;  2LKP A;  1UCR A;  5CJ9 A;  5K5R A;  2VOO A;  2RVC A;  4RGX A;  2L01 A;  3HSE A;  3DPT A;  5DEQ A;  1KYZ A;  2HQR A;  3ISP A;  2NRA C;  1BBY A;  1HXD A;  3ZMV A;  4G6D A;  4YII A;  3CO7 C;  4Y13 A;  3P7N A;  1X3U A;  1TTY A;  1P4W A;  2RDP A;  4P9U A;  3CUQ C;  4MQ9 F;  1RUN A;  4I02 A;  2P8T A;  1CF7 B;  3I4P A;  2P7V B;  3G3Z A;  3JTG A;  1ONV A;  2FBI A;  1JHF A;  4G7O F;  5TJJ A;  2JSC A;  4L9J A;  3KCC A;  1MKM A;  1J75 A;  1D3Y A;  2XV4 S;  5ILU A;  5DD8 A;  1YG2 A;  4O5V A;  1ZGJ A;  2VBX A;  5EEH A;  3JTH A;  2BYV E;  2PBI A;  1LEA A;  2MC3 A;  4UXN A;  3RYP A;  3BDD A;  3QOP A;  4B09 A;  1LB2 A;  1R1U A;  2QYO A;  1HW5 A;  2HS5 A;  4XLP F;  5H6R A;  3ZMD A;  4YIF A;  2XRO A;  3WTY C;  4JQF A;  5HOO A;  2G7H A;  1V3F A;  4HAM A;  1VTN C;  3DEU A;  2ACJ A;  3FMR A;  1B6A A;  1FPQ A;  4OIN F;  2M1B A;  4OIO F;  4EGZ A;  2VC1 A;  4M71 A;  1OMI A;  2NNN A;  4WCG A;  1BI3 A;  1BJA A;  1PP8 F;  1JXS A;  3CJN A;  2F5C A;  5DCF A;  2ETH A;  3AAF A;  2GXB A;  3WGG A;  3GO5 A;  1KYW A;  3WE3 A;  3CTA A;  4HF1 A;  4EV0 A;  1XN7 A;  1BI0 A;  1Y0U A;  3W6K B;  3HIF A;  1CGP A;  4KA4 A;  3GUD A;  5JR3 A;  1SMT A;  3KP5 A;  2B0L A;  4MQV A;  4KYW A;  2R3S A;  3EYI A;  2OAZ A;  3G73 A;  4ZYE A;  1STZ A;  2XKO A;  3FXU A;  3R4K A;  5ICG A;  1PUE E;  2NAZ A;  2VC0 A;  1SD5 A;  3KZZ A;  3MWM A;  3T8R A;  3J7A O;  1XDS A;  2FSW A;  1SD4 A;  1LQ1 A;  3IKT A;  1IRG A;  4IRG A;  4XSZ F;  1I5Z A;  3BPX A;  2QZ8 A;  3GEZ A;  3JSO A;  4ON0 A;  1MJ9 A;  5FO5 A;  2W57 A;  3I0T A;  3ML6 A;  1RIO H;  2L3D A;  2HKO A;  2STW A;  4EM0 B;  3V8L A;  2JPC A;  3KP4 A;  3L9F A;  2KIF A;  1SAX A;  4KDP A;  4R1H A;  2ESH A;  3HYI A;  2EK5 A;  2BGC A;  1RI7 A;  1EV7 A;  4L0Y B;  3IC7 A;  2WV0 A;  2VE9 A;  5D5X B;  1IN7 A;  1FBQ A;  1W5S A;  3V7R A;  2A6E F;  1R5G A;  2AS5 F;  4KMF A;  1F5T A;  3I53 A;  2K27 A;  4HF2 A;  3FZV A;  4A12 A;  4PGH A;  3HTS B;  1HKT A;  4EGY A;  1LNW A;  3FF5 A;  4RAY A;  1FYL A;  1MJB A;  3V7C A;  1XMA A;  4BQA A;  2K4J A;  5E8I A;  3JSP A;  4L9V A;  4IVN A;  4O6J A;  4Q47 A;  4KMU X;  4N9H A;  5HDN A;  1HW2 A;  5TRD A;  3B73 A;  1F4K A;  3R0A A;  1JHH A;  1TW2 A;  5D5W B;  1T0F A;  2V79 A;  5F1R A;  4WXH A;  6PAX A;  1YW8 A;  1LJ9 A;  4KIF A;  2IJL A;  1GHC A;  1S3J A;  1S6L A;  2IVM A;  2WC2 A;  5J8C A;  3SFZ A;  4BAY A;  2QBY A;  2J5P A;  2RNJ A;  2E1N A;  5CVV A;  2H09 A;  1YLF A;  4FT8 A;  2GA1 A;  2P6S A;  1G6N A;  4HW0 A;  2DLL A;  1OKR A;  4O3M A;  4G8X A;  4CXF A;  2Z99 A;  3QU3 A;  3MZH A;  5K5O A;  3KLN A;  5K5Q A;  1J7K A;  2CWE A;  2YR2 A;  2XUB A;  4F7Z A;  3MQ0 A;  3SHF A;  5JHU A;  2DQL A;  2V6C A;  3GVA A;  3U9G A;  5JI6 A;  3M9A A;  1B59 A;  4B8X A;  2C6Y A;  4GCV A;  2Q0O A;  1B9N A;  5E1X A;  1H0M A;  4ETS A;  4ZYD A;  3LQQ A;  2DQR A;  2IRF G;  4U0W A;  1P92 A;  2Q8K A;  5CVJ A;  1IN8 A;  3QRF F;  4HLY A;  3ZMS A;  4QLC U;  1O3Q A;  4M74 A;  4BHC A;  4RB1 A;  4U7D A;  1UHM A;  5LHH A;  1DDN A;  4M9X A;  5ICF A;  4WX9 A;  2QEN A;  4EJO A;  4HDV A;  1YS7 A;  2FE3 A;  1K7A A;  2ZKZ A;  4I98 B;  5LRS A;  3RKW A;  5D6F A;  4EMS A;  1WQ2 A;  2GQQ A;  3F8B A;  1YW9 A;  3RI4 A;  1SMY F;  5E1W A;  4DQ2 A;  2DT5 A;  2DFI A;  3DXJ F;  2A6H F;  1MGT A;  1Z7U A;  5AIQ A;  1USS A;  2EFW A;  3GFJ A;  3GW2 A;  3FWE A;  1OYY A;  2W85 A;  1SFU A;  4U0V A;  2P5V A;  1BN5 A;  3GFI A;  4G7H F;  1KU9 A;  3RIR A;  2XAF A;  4ESJ A;  1G3W A;  1ON2 A;  5LRR A;  1SFE A;  2DU9 A;  2YX4 A;  4FX0 A;  1HW1 A;  2W24 A;  3QP6 A;  1B1B A;  2RQP A;  2WTE A;  3J81 K;  4AIK A;  1KU7 A;  3TO9 A;  5HS8 A;  4UVA A;  2O6G E;  2EFQ A;  2QQA A;  3IRQ A;  3VEP A;  2E7W A;  2ZXJ A;  4MTD A;  2HDC A;  2OZU A;  5ICC A;  5L3E A;  1UFM A;  3MEX A;  5BPD A;  4HX4 A;  4LGW A;  2GAU A;  3H3U A;  1HQC A;  3Q9S A;  1IN4 A;  3FMS A;  3VFZ A;  5HS7 A;  3LST A;  3FHZ A;  1R58 A;  1QNT A;  2O8X A;  2CFX A;  5F6F A;  2BEO A;  2CSO A;  1UB9 A;  2XAH A;  4FHT A;  4G94 A;  1XGM A;  3I59 A;  3L2C A;  2XGX A;  5HS9 A;  2EFP A;  1OPC A;  4AD9 A;  3CUQ B;  3F23 A;  4UHT A;  2CQK A;  4HF0 A;  5AIP A;  4P55 A;  1FX7 A;  2M5W A;  4L5J A;  3HHG A;  3PQK A;  3T8T A;  3DPL C;  5D4S A;  2FBK A;  2QVO A;  4EJW A;  4M9Z A;  4N9I A;  3V7S A;  4ENK A;  3ZP5 A;  1SFX A;  4S05 A;  5E20 A;  3BJ6 A;  1D5V A;  4OIR F;  3HTU A;  2BV6 A;  3WOD F;  3TQN A;  1Z6T A;  4XLN F;  1P4A A;  2DI3 A;  1YW7 A;  2HR3 A;  1XGN A;  3CLO A;  5DCM A;  3NRV A;  2DTR A;  1I27 A;  2YX7 A;  1BC7 C;  3ZN1 A;  1W4M A;  5E8G A;  1XB4 A;  2VBW A;  4I0B A;  4U7B A;  5H6Q A;  5J8F A;  5BQT A;  3E3V A;  3NEU A;  3E6C C;  1TQM A;  1IRF A;  5D4R A;  2IPQ X;  3WGH A;  1B9M A;  2X4H A;  1S8N A;  3RPQ A;  2ZNY A;  3RKY A;  4XRF A;  2PJP A;  1FYM A;  1Z9C A;  4AIJ A;  4BH9 A;  2AXL A;  5LEK A;  3K1N A;  1W7P B;  4U88 A;  4U0Y A;  4WK8 F;  1BOA A;  5A2Q K;  4BYY A;  2W84 A;  1S7A A;  1H9T A;  3KP6 A;  2HKX A;  3HOS A;  1FLI A;  5CVI A;  4ZZL A;  3BJA A;  2W25 A;  3I5U A;  4AVP A;  1D8K A;  3PFI A;  1P4X A;  1MJA A;  2XHK A;  3ZQ7 A;  2HOE A;  1CF7 A;  3DV8 A;  5H20 A;  5DUI A;  3L7W A;  1ZRD A;  2H94 A;  2FNP A;  5HDK A;  3REO A;  4UV8 A;  3LAJ A;  1NHA A;  2JPB A;  3DP7 A;  3M7G A;  3R6S A;  3IL2 A;  3CUO A;  5D8L B;  2FBH A;  1LDK B;  3BWG A;  4CZZ A;  1ON1 A;  3U1D A;  2V1U A;  1SD7 A;  2CG4 A;  4KNY A;  2VT2 A;  2VBY A;  3HRS A;  5BMZ A;  3F6V A;  1KA8 A;  1BM9 A;  2XKP A;  1GXP A;  4A2U A;  2Y0M A;  4L9N A;  3ERE D;  2PMH A;  1TQP A;  4HZF A;  3ZMT A;  1DPR A;  3E5Q A;  2HGC A;  1XSX A;  3QP5 A;  5F64 A;  1A04 A;  2ESN A;  1O3S A;  4CDG A;  2KIM A;  5LEJ A;  5D8K B;  3IWF A;  5DV5 A;  4NQW A;  5CYV A;  3LWF A;  3WTX C;  2IT0 A;  2UWM A;  1Z91 A;  2P5L C;  2EA4 A;  2K02 A;  1R00 A;  2FF4 A;  3WTS C;  4RGR A;  2XAJ A;  3E5X A;  2VN2 A;  4ZYH A;  1HSJ A;  4MHG A;  2D45 A;  4EVI A;  3K69 A;  4D0P A;  5E17 F;  3M8F A;  1HBX G;  3DQV C;  3TGN A;  3E5U A;  4LB5 A;  4Q48 A;  2CGP A;  1E2X A;  1OYW A;  3P9K A;  3EDP A;  1H9G A;  2DW4 A;  4MEX F;  3GZ6 A;  1ZLK A;  1QGP A;  1SD6 A;  4Y15 A;  2L4M A;  4R79 A;  3QU6 A;  1TLH B;  1FSE A;  1BI2 A;  5L3G A;  3OOP A;  2OD5 A;  1ODD A;  3ABT A;  3JW4 A;  3WE2 A;  2P5K A;  4KIB A;  3J80 Z;  1G3Y A;  1J59 A;  4RB2 C;  2R7D A;  1R36 A;  5IT3 A;  5BPI A;  4A6E A;  3OV8 A;  1MD0 A;  5K1Y A;  1ZLJ A;  2QLZ A;  3N4M A;  3FM3 A;  3RDI A;  4ENJ A;  1D8J A;  2OA4 A;  2JTV A;  2KRF A;  1ZAO A;  4P9F A;  1KU2 A;  3CUQ A;  4KUM A;  2NYX A;  4BXU A;  1O7L A;  2V1D A;  5FLX Z;  1U5T B;  1KQ8 A;  2HYG D;  5FFZ A;  2EV0 A;  4LD5 A;  3P9C A;  3R60 A;  5ICE A;  1TBX A;  1ZHF A;  5FD6 A;  2G7U A;  3H92 A;  2RN7 A;  3R0J A;  3KEQ A;  3K1P A;  2EFN A;  2IA2 A;  3KP3 A;  3LAP A;  5L3B A;  4KT5 C;  4M6X A;  4HV6 A;  4JK1 X;  1T2K A;  5LGU A;  2DO7 A;  2ZME A;  3TDU C;  1IAW A;  2O03 A;  2YSR A;  1RUO A;  3GLX A;  1G4D A;  3F72 A;  2DPU A;  4YFX F;  3E6B A;  3F3X A;  2FEZ A;  2ZME B;  3FX3 A;  4DNC A;  3F6O A;  4QWQ A;  2YPR A;  2P7C B;  2IW5 A;  3RJP A;  1DP7 P;  1L3L A;  2DK8 A;  2K7L A;  5EEG A;  2PI0 A;  4IHS A;  3T0Y A;  3GYH X;  4I7H A;  5ILV A;  3V8J A;  1ZRC A;  2FQ3 A;  2E7X A;  4HA8 A;  2H6C A;  1U78 A;  3E6D A;  3TDZ C;  3SQN A;  1QZY A;  1EH6 A;  3BRO A;  4KFC A;  4I2O A;  5A2Q Z;  3LA3 A;  4LG0 B;  2XIG A;  5HLI A;  2OU2 A;  4OIQ F;  4LK0 F;  1T39 A;  2HYF A;  3FXQ A;  3TOB A;  5BS6 A;  5LGT A;  4UNO A;  1P6R A;  5ED4 A;  3SZP A;  2O61 A;  1PDN C;  3HRU A;  2XRN A;  4EM2 A;  3SZT A;  2V9V A;  4A0X A;  5HLH A;  3ECH A;  4EQQ A;  1E17 A;  5HLG A;  2PLY A;  1LEB A;  5KK1 A;  2QQ9 A;  3KLO A;  3O2P E;  2KJB A;  4RB3 C;  2JZY A;  1F9N A;  2PG4 A;  5D5U B;  5LGN A;  3JAM K;  3I64 A;  1GXQ A;  2LDU A;  3I71 A;  3IWZ A;  2DAO A;  1GVJ A;  3ROU A;  2F5D A;  1Z6R A;  5LHI A;  3J81 Z;  4AWX B;  5CVR A;  4BHB A;  2Z3Y A;  2MLK A;  2R7F A;  4I01 A;  2EJR A;  3GFL A;  3BZ6 A;  3TKY A;  4ENN A;  4E70 A;  2EV5 A;  4M73 A;  4PDK A;  2PN6 A;  4EJU A;  4OMZ A;  2EFO A;  4A5M A;  2L02 A;  2GXG A;  2VE8 A;  5ERI A;  1REP C;  3RYR A;  1G3S A;  2RKH A;  1S7O A;  1R23 A;  3F21 A;  2COM A;  3EUH A;  4LB6 B;  2XAQ A;  2CW0 F;  1BC8 C;  3C18 A;  4P5O A;  5FLX K;  2YU3 A;  4IF4 A;  3HUG A;  4G9Y A;  1C0W A;  3MFK A;  3IHU A;  1ZN2 A;  3GZ5 A;  1KQ9 A;  3WU1 B;  2VT3 A;  1MDM A;  4M6Y A;  1J9I A;  3I58 A;  3C7J A;  2FMY A;  3C3W A;  1WKM A;  3MAJ A;  4BNC A;  3LA7 A;  4BHP A;  4IRI A;  2F5F A;  4HOB A;  4RAZ A;  2ZO4 A;  2EV6 A;  4WWC A;  1U6G A;  2QQB A;  3K2Z A;  3LFK A;  3KP2 A;  2UZK A;  4OMY A;  2GIV A;  4A0Z A;  2ELH A;  4RGU A;  4A5N A;  3WG9 A;  5D5V B;  1FYK A;  4OIP F;  1FWZ A;  2Y75 A;  1YYV A;  2ZJ2 A;  5CLS A;  4CO8 A;  3LQR A;  3L00 A;  3V4G A;  2M87 A;  3FXR A;  2VXZ A;  1ZG1 A;  1YTY A;  1ZG3 A;  2DPD A;  3ZPL A;  1J5Y A;  3O6B B;  1O3T A;  2MA3 A;  3HRM A;  2NS0 A;  1IXR C;  3LA2 A;  1T98 A;  4KIC A;  4RS8 A;  4CGZ A;  3IRR A;  2O0Y A;  5BOX A;  2IA1 A;  1FBU A;  4S04 A;  3TO7 A;  1PP7 U;  2LF7 A;  1FY7 A;  3GF2 A;  4UUV A;  5E1Z B;  3VB2 A;  3WTW C;  2FML A;  3WU0 A;  3ABU A;  4I09 A;  4IPA A;  2GA2 A;  1TQI A;  2BBY A;  3MZY A;  3BOQ A;  3F8C A;  3VOE A;  1T6S A;  2K86 A;  4XSX F;  4YFK F;  4IRH A;  1UST A;  3RKX A;  4M72 A;  2OQG A;  3RTR A;  3GXO A;  1ZRF A;  1T38 A;  4JBA A;  3TO6 A;  4LLL A;  1U8R A;  2VBZ A;  2OQR A;  5E18 F;  1I6X A;  3M8E A;  2F2E A;  2MH9 A;  2Z9O A;  1IXC A;  5FGM A;  4HQE A;  5DDG A;  3MCZ A;  2IP2 A;  2FNA A;  5JFR A;  5DCM B;  1W5T A;  1R5H A;  1YQA A;  2VOD A;  5FB2 A;  1IN5 A;  4IHT A;  5AON A;  5LHG A;  2EWN A;  2ZNZ A;  3BP8 A;  1W7P D;  1U5T C;  2HEO A;  4HYE A;  1ZG5 A;  2E1C A;  1F1Z A;  4LG0 A;  4ESB A;  2ZBK A;  1G3T A;  5HVQ C;  2ZFW A;  3COA C;  3W6J B;  4PZJ A;  3HOT A;  5L3D A;  2PMU A;  4HLX A;  2M8E A;  3D0S A;  3B02 A;  3PQJ A;  1R22 A;  2ISY A;  1K78 A;  1J2X A;  2QM3 A;  3L09 A;  1QO0 D;  4H0E A;  1FNN A;  3K0L A;  3I59 B;  3ECO A;  2OZ6 A;  2Z33 A;  3ULQ B;  5JVT A;  1K6O A;  2TDX A;  3N97 A;  4CYD A;  4NB5 A;  2MLG A;  1O57 A;  1MZB A;  3FMQ A;  1TNT A;  1HKS A;  3GFM A;  4Q4Z F;  1O3R A;  1R1V A;  2PEX A;  1XSV A;  5J6X A;  4LK1 F;  4LJZ F;  3E97 A;  2PFB A;  4NHJ A;  2KKO A; 
#chains in the Genus database with same CATH topology
 3K1M A;  3HSF A;  2ISZ A;  3BR3 A;  2M4G A;  2DN0 A;  3GCM A;  4B44 A;  3CME I;  3ERM A;  4DGW B;  4HBL A;  2FOK A;  1RNL A;  3ELK A;  1MBH A;  1F36 A;  2NNY A;  3QQA A;  4H4K C;  5GPA A;  2XAG A;  4HQM A;  1L0O C;  1X58 A;  1ZK8 A;  1Y1W J;  2H1K A;  3VYS B;  1TNS A;  3HOX J;  3F22 A;  1AWC A;  2V7F A;  3CP8 A;  3RZO J;  5J3L A;  4MFD A;  1V4R A;  4XK4 A;  1WJ5 A;  3OL4 A;  3PFY A;  2JRT A;  4XL9 A;  2HPI A;  4M9S A;  2H27 A;  2HQ5 A;  2BXY A;  3D5L A;  2DMT A;  2H6B A;  3GTG J;  3BPV A;  3TMO A;  1P2F A;  1R1T A;  1YX3 A;  5TIS C;  1WI3 A;  2BW3 B;  1MIJ A;  2JT1 A;  2J5O A;  2HQN A;  2KIU A;  4OU0 A;  3OS1 A;  2CUE A;  4LG3 A;  2Y30 A;  2Y31 A;  4CCO A;  3E1S A;  1XD7 A;  1MDM B;  2L54 A;  3BJO A;  3KP7 A;  1A6Q A;  2F48 A;  4ESF A;  2QSG X;  2DA3 A;  4XRS A;  2DT6 A;  4GYG A;  2MH2 A;  1Y56 A;  4UV9 A;  4YG2 F;  4BGD A;  5EF6 A;  2BHZ A;  2EA2 A;  1A5J A;  3ZQI A;  3VPR A;  3P9I A;  5LBQ A;  1U3E M;  3CO6 C;  1ZH5 A;  2KIQ A;  4RB0 A;  4ZTF A;  1XSD A;  5GAH J;  2PQ8 A;  3KET A;  1FBS A;  3F8M A;  4ASN A;  1SVL A;  2QBY B;  3EQL F;  1JUP A;  1X1P A;  1JJ6 C;  1I1S A;  3KZY A;  3DU6 A;  1XS9 A;  1FZP B;  5IT9 Z;  2L4A A;  2GWR A;  3K9T A;  3DF8 A;  1YIO A;  2IA0 A;  4C2U A;  2CO5 A;  3HZJ A;  1MMS A;  4B48 A;  3H3Z A;  2VOP A;  1DUX C;  2HFH A;  5IP9 J;  1I1G A;  1D5Y A;  3CJR B;  3WGI A;  1SAN A;  2V4J C;  4EM1 A;  2ZCW A;  4XN3 A;  5E3L A;  3NQO A;  3SDB A;  4L5I A;  4IZZ A;  4II3 A;  2K9N A;  1EH7 A;  1M1E B;  2ZFU A;  5B66 C;  3F8F A;  1JKQ C;  5KVR A;  3I54 A;  1OR7 A;  2D1V A;  4BS9 A;  2JA8 J;  4R8H A;  4IHX A;  1FP1 D;  4XLA A;  2VB6 A;  1IGN A;  2X1C A;  2MBF A;  2HTJ A;  3O3K A;  4CSW A;  4XLH A;  4ZZD A;  5GP9 A;  3OY9 A;  2FA5 A;  4RM2 A;  2KHM A;  3CQZ J;  1SEU A;  1IF1 A;  1IXS B;  1K83 J;  5L3F A;  1IN6 A;  4P96 A;  5HDG A;  1ZRE A;  1IUY A;  3VOD A;  3S1Q J;  5M5X J;  1HOM A;  1JKO C;  2A68 F;  4A6D A;  5IP6 A;  3HRT A;  1ZAR A;  2A61 A;  2BHY A;  3S2W A;  4WXC A;  3HOZ J;  4F52 A;  2EB7 A;  4I0A A;  4BBR J;  3CCL I;  1ERD A;  2MG4 A;  5J1R A;  2QWW A;  4CH7 A;  3GWZ A;  3WTT C;  3G1M A;  2FRH A;  1WRJ A;  2K4B A;  4MIM A;  4KJZ A;  1TW3 A;  1V55 H;  3HKZ A;  1YHQ I;  1IZ1 A;  4L9T A;  1Z3X A;  5EYR A;  2IBD A;  2KZG A;  4ZC3 A;  1IDZ A;  1QZZ A;  1ZKG A;  1Q1H A;  2DFF A;  3DFG A;  2Z5U A;  4V2G A;  2D1H A;  2HVR A;  1KQ0 A;  2M7B A;  1ULY A;  4FIS A;  1YJ9 I;  1NK3 P;  4N0B A;  4HV5 A;  2F6C A;  3WTV C;  3OR1 C;  4KN7 X;  2BE5 F;  4IL6 C;  3IKV A;  4XBF A;  4J01 A;  2P4W A;  2LKS A;  2W4S A;  3EET A;  1FT9 A;  4CA0 A;  3H9Q A;  1H8A C;  3IAS 2;  1DPU A;  2K40 A;  1R7J A;  2M2E A;  1IV6 A;  1XDU A;  2K9L A;  4AUX A;  2E1M B;  2UXN A;  3ZMU A;  3U21 A;  1JT6 A;  2KJC A;  1WVR A;  3EYY A;  4LIV A;  3RCO A;  1AOY A;  5D6E A;  3ZMZ A;  2FU4 A;  2X0L A;  2F5E A;  4EJV A;  1BI1 A;  3I3L A;  5DUK A;  2ME0 A;  2M0M A;  5H2F C;  3K4K A;  3DWL E;  3S3N A;  5M5Y J;  3HOV J;  2M34 A;  2XAS A;  1HC8 A;  3TL4 X;  4CIC A;  4UUS A;  3BZC A;  4BJ5 C;  3QPT A;  4GDF A;  2DK5 A;  5J1Y A;  4UVB A;  1JI8 A;  2X6W A;  1YO5 C;  4WF2 A;  1LUJ B;  4FCY A;  2HWV A;  1D0Z A;  4CHU A;  1EKE A;  5FD5 A;  4XNF A;  4Z2Y A;  2DBB A;  2RNG A;  2LD5 A;  1YRN B;  3HOY J;  3HM5 A;  3ZN0 A;  1W1W E;  1JE8 A;  2EIN H;  1WI9 A;  2ZME C;  2IEK A;  4CCJ A;  3JAM Z;  4XKW A;  3GX4 X;  5M3F J;  1BIA A;  2KIS A;  1ORK A;  4FX4 A;  2V1X A;  4IO9 F;  3CMY A;  4IHW A;  3QPL A;  4RGS A;  1Z21 A;  2GZW A;  2KRH A;  2GM4 A;  1S29 A;  3M1E A;  2G9W A;  4G7Z F;  3T1B A;  2LP0 A;  1LVA A;  4YFN F;  4BBS J;  2A3S A;  3Q0W A;  3BY6 A;  2FXA A;  1LDD A;  3BG5 A;  1O4X A;  1Z0X A;  4XON A;  1O7F A;  3E6M A;  2LF8 A;  3BTC A;  4MTE A;  4E6K G;  5ILS A;  5FFX A;  4Y52 J;  3WTZ A;  5L3C A;  3CMM A;  1FSH A;  1XGS A;  1IUF A;  1MNE A;  3TW6 A;  2D2W A;  3KFW X;  4D5C A;  5DYM A;  2XAU A;  5JHF A;  4ZH4 F;  1MH3 A;  1PJR A;  2HOA A;  5EG0 B;  1FTT A;  4GXO A;  2Y48 A;  2RC4 A;  5IPA A;  1ZGA A;  2L7Z A;  3FDY A;  4MNU A;  4HPQ A;  2A69 F;  3V8K A;  1YS6 A;  3C1D A;  2OBP A;  2HXO A;  3CDH A;  1X4P A;  4UB6 C;  4UVC A;  2YUS A;  4C2T A;  2P6T A;  3PUB A;  1K78 B;  2E2J J;  3CC2 I;  1OCR H;  1T33 A;  1GT0 C;  1AKH A;  3RPU A;  3A03 A;  2E1M C;  4UUT A;  4E7I A;  2VON A;  4LFU A;  4IJA A;  4LIU A;  4TV7 A;  3DKY A;  1VF9 A;  1N77 A;  3IAM 2;  4MEY F;  1JKP C;  4AIH A;  5EDN A;  1EH8 A;  2W00 A;  4ZYG A;  4B47 A;  1DGW Y;  2XGC A;  2MYS A;  3H35 A;  4LLG F;  3U2R A;  3W2V A;  2PX9 A;  2BXZ A;  2VAS A;  2XVC A;  3SFI A;  4EJT A;  1R9T J;  4Y17 A;  1ETK A;  1XCB A;  4AU7 A;  2O9L A;  5LLQ A;  2ZJP F;  1VQ8 I;  3R61 A;  3HPG A;  4LMY A;  3LSP A;  3OYE A;  3BTJ A;  2QSF X;  4E4H A;  4PCQ A;  3QPH A;  4EEF G;  1OIS A;  2QUF A;  4MLO A;  3J80 K;  1IW7 F;  3AFH A;  4PGG A;  1T95 A;  2O3F A;  3MD2 A;  3QOD A;  3BR6 A;  1X3W B;  3TP3 A;  2QA4 I;  3FM5 A;  3DTI A;  1QQI A;  3S8P A;  3MKY B;  2STT A;  1X2N A;  2MC4 A;  4ENM A;  2ZSI B;  3FXL A;  3FK7 A;  1TWF J;  1IO2 A;  2BZT A;  2UXX A;  2RAE A;  3LSR A;  3UKG A;  4DBQ A;  4K2E A;  1MBE A;  1FOX A;  3TW7 A;  1HST A;  2A5Y B;  1Z05 A;  1XTA A;  2R7R A;  5CVU A;  1WGX A;  3KE2 A;  1B4A A;  4G6Q A;  5DD4 A;  3WTU C;  2DMP A;  2HTS A;  4G12 A;  5CPR B;  1I50 J;  4KIT B;  3TOA A;  1WWX A;  4KN4 X;  3H5R A;  2WWY A;  3JRA A;  1FOK A;  1XGO A;  2HZT A;  4JX5 A;  3OOU A;  4DYC A;  3HJE A;  1FTZ A;  2Q2E A;  2HNH A;  2FUG 2;  1OYI A;  2LC2 A;  3QWL A;  1FMW A;  1VQO I;  1X4O A;  1YIJ I;  3KEO A;  3DKW A;  3D1N I;  1Y0N A;  2NVX J;  4L18 B;  3T5X A;  2MD5 A;  3A01 B;  5F27 A;  4MGR A;  4XOR A;  3W2A A;  2QSH X;  5E79 C;  4GO1 A;  4N4O B;  2E60 A;  4AVZ A;  1WZ2 A;  1RZ4 A;  5BNG A;  2M30 A;  4Z6Y A;  1DU6 A;  1MSF C;  1W36 C;  3Q9V A;  4B43 A;  3VYT B;  4XIC A;  3UR3 C;  2XPV A;  1POG A;  3P5J A;  4PJL A;  1QBJ A;  3CLQ A;  1JGS A;  2A5W A;  2ADU A;  1G8X A;  1ZYR F;  1ETY A;  1KU3 A;  2O8K A;  4L0Z B;  3MKW B;  1K79 A;  1I3A A;  3HSR A;  2X51 A;  2LNB A;  4HDU A;  2RQQ A;  5F1J A;  4GGG A;  2KT0 A;  1MMN A;  3S32 A;  3PO2 J;  1KGS A;  3EUH C;  3K10 A;  3ZOB A;  4A3F J;  1VZ0 A;  1FC3 A;  1QPM A;  3Q5F A;  4GYI A;  2RGV A;  1BIB A;  3QOE A;  1U0J A;  2R4G A;  1YFH A;  2N8G A;  4LLN A;  1TT0 A;  3CCR I;  2R5Z B;  4Q5S F;  1WH7 A;  2VXD A;  2R93 J;  2E5Z A;  5B1B H;  2VQG A;  2A07 F;  3VSL A;  2CYY A;  1XCV A;  3S14 J;  4CCN A;  2M45 A;  5IT9 K;  1WSU A;  1UHW A;  4KIG A;  3JR9 A;  4IXA A;  3SXY A;  2NOJ B;  4OOI A;  3F8N A;  4D7N A;  3JCU C;  1FP2 A;  4A0Y A;  3GTL J;  4E7K A;  4HX8 A;  1J0R A;  3QAH A;  1D0X A;  1W7P A;  1Z1D A;  3QPS A;  3LL7 A;  1HKQ A;  4HX7 A;  3J7Y J;  3B6C A;  1LDJ A;  4WXD A;  1H88 C;  1U2W A;  1XMK A;  3IV5 A;  3HHH A;  2RV8 A;  1VQ5 I;  1U5T A;  2LSO A;  2VJ5 A;  2LKP A;  4U87 A;  2CUF A;  5FKN A;  1UCR A;  5CJ9 A;  1R5I D;  2OPT A;  2RVC A;  5K5R A;  2VOO A;  4RGX A;  2L01 A;  3HSE A;  3DTE A;  3DPT A;  4IHY A;  1OJL A;  5DEQ A;  1KYZ A;  2HQR A;  3OMY A;  3ISP A;  2VPL A;  2P81 A;  2NRA C;  1N78 A;  1TWH J;  1BBY A;  2QCO A;  1HA8 A;  1HXD A;  3ZMV A;  3RZD J;  1F43 A;  4DZP A;  2HDW A;  4G6D A;  2P0W A;  4YII A;  3CO7 C;  3HB9 A;  4Y13 A;  3P7N A;  1X3U A;  1TTY A;  2ECB A;  1P4W A;  4NC8 A;  2K5C A;  2RDP A;  2LTP A;  4OAZ A;  4P9U A;  3CUQ C;  4MQ9 F;  1RUN A;  4IOA F;  4I02 A;  2P8T A;  2OV7 A;  1CF7 B;  4BAC A;  1JT0 A;  1HCR A;  3I4P A;  2P7V B;  3G3Z A;  2WB1 N;  1FMV A;  3JTG A;  1ZTR A;  1ONV A;  5EZG A;  5IYC J;  2FBI A;  1E0E A;  3BG3 A;  4CCK A;  1JHF A;  4HSR A;  2E5N A;  1T08 B;  3LSI A;  5TJJ A;  4G7O F;  1I6H J;  1E3O C;  3W2W A;  3OYC A;  2JSC A;  2QGU A;  4L9J A;  1G59 A;  2CQ7 A;  3KCC A;  3U1K A;  1MKM A;  3SJM A;  1J75 A;  1D3Y A;  2XV4 S;  3F0C A;  5ILU A;  5DD8 A;  4V2F A;  2W1O A;  2XGE A;  2K9M A;  1YG2 A;  5K7Z A;  4N4N B;  1TP4 A;  1ZGJ A;  4O5V A;  2VBX A;  3A0B C;  2DA2 A;  2OF7 A;  5EEH A;  1T0F C;  3JTH A;  3OYI A;  2BYV E;  1QZE A;  2PBI A;  1LEA A;  2MC3 A;  1PUF A;  3I4N J;  2DJI A;  4UXN A;  3RYP A;  3BDD A;  4B1R A;  3QOP A;  4B09 A;  4C2M J;  1HF0 A;  1OCO H;  3DEW A;  2KZV A;  1LB2 A;  1R1U A;  3JRE A;  4IX7 A;  4A3G J;  5DTD A;  3VDX A;  3FKJ A;  2QYO A;  1YRN A;  2ZSH B;  1HW5 A;  1D0Y A;  3GTJ J;  2HS5 A;  4XLP F;  5H6R A;  5KHD A;  4JOM A;  3VWB A;  5GTH C;  3M1C A;  3ZMD A;  2M8G X;  2DA7 A;  5K7H A;  1X1D A;  3PNV A;  1J09 A;  2LYC A;  4I6Z A;  5GAD J;  3A0H C;  4YIF A;  2I10 A;  2XRO A;  3WTY C;  1YI2 I;  4JQF A;  5HOO A;  2G7H A;  1V3F A;  3TP0 A;  2H8W A;  3AL0 C;  4HAM A;  2ZC2 A;  1BJZ A;  2EIM H;  2DJN A;  1VTN C;  3DEU A;  2ACJ A;  4B4C A;  1OFC X;  2ZXI A;  3FMR A;  2WB1 A;  1B6A A;  1FOY A;  1FPQ A;  2Q1Z B;  1ETQ A;  3IH4 A;  2M1B A;  4OIN F;  4OIO F;  4EGZ A;  2VC1 A;  1OCT C;  4M71 A;  5KCM A;  3S1N J;  4XLC A;  1OMI A;  2NNN A;  5JLX A;  4WCG A;  3ESW B;  1BI3 A;  2MD0 A;  3IUO A;  3ZQC A;  1BJA A;  1MW7 A;  1PP8 F;  3S16 J;  1JXS A;  3CJN A;  2F5C A;  3BR0 A;  2ETH A;  5DCF A;  3AAF A;  2GXB A;  1Y1V J;  3WGG A;  3GO5 A;  1KYW A;  3WE3 A;  2WY7 Q;  3QYF A;  3CTA A;  4HF1 A;  4EV0 A;  1XN7 A;  1BI0 A;  1Y0U A;  3W6K B;  1EJ9 A;  1WJF A;  5FKK A;  3HIF A;  1AU7 A;  1CGP A;  5F0F A;  4KA4 A;  3GUD A;  5JR3 A;  1WJA A;  2IS2 A;  2OC6 A;  1SMT A;  3KP5 A;  2B0L A;  4MQV A;  5CQG A;  4KYW A;  3K70 C;  2R3S A;  3EYI A;  2OAZ A;  3G73 A;  2Z2S B;  4ZYE A;  1STZ A;  2XKO A;  3KIO A;  3FXU A;  3R4K A;  5ICG A;  3HOW J;  3A01 A;  2EQR A;  1PUE E;  2NAZ A;  2VC0 A;  1SD5 A;  1E3H A;  3CJQ B;  3KZZ A;  3MWM A;  2IS4 A;  3T8R A;  3J7A O;  4A3I J;  1XDS A;  2FSW A;  4XOT A;  1IRZ A;  3CCS I;  2DOF A;  2JVG A;  3W6V A;  1SD4 A;  4DW6 A;  1LQ1 A;  3IKT A;  2IS1 A;  3OYJ A;  1IRG A;  3EUA A;  4IRG A;  2R92 J;  3MKL A;  4XSZ F;  1SVM A;  1FJL A;  1VQP I;  1I5Z A;  3BPX A;  2QZ8 A;  3GEZ A;  3JSO A;  4RLF A;  4ON0 A;  4M3F A;  5FKO A;  1B8I B;  3B6A A;  1MJ9 A;  4JX4 A;  5FO5 A;  4BXX J;  3NAR A;  2PJR A;  2W57 A;  3I0T A;  3ML6 A;  2LG4 A;  2L5Q A;  1RIO H;  2L3D A;  3HKZ N;  2HKO A;  2M4K A;  2STW A;  4EM0 B;  3V8L A;  2DCE A;  2JPC A;  4I76 A;  3KP4 A;  1YOV B;  3L9F A;  2F4M B;  1UG0 A;  2KIF A;  5HNH A;  1SAX A;  4KDP A;  4R1H A;  2ESH A;  2DOE A;  1RC9 A;  3HYI A;  2EK5 A;  5FJ8 J;  2BGC A;  2AO9 A;  1RI7 A;  1EV7 A;  4BKX A;  4L0Y B;  3IC7 A;  2WV0 A;  2VE9 A;  2IGM A;  1MBG A;  1PVE A;  5D5X B;  2E2I J;  4M3D A;  4YEJ A;  1FBQ A;  1IN7 A;  3S93 A;  1W5S A;  3V7R A;  2A6E F;  1R5G A;  3BTI A;  4NBQ A;  2AS5 F;  4KMF A;  5F0H A;  3GLL A;  1F5T A;  1P9Q C;  1SAU A;  3L2Q A;  3MVP A;  2ID3 A;  3I53 A;  2K27 A;  3PIP F;  4JYK A;  1QA6 A;  4HF2 A;  1QHH D;  3FZV A;  2BOL A;  4A12 A;  3AL0 B;  4PGH A;  3HTS B;  1ACI A;  3MZ8 A;  1R4N B;  1RKT A;  4XLF A;  2ZXW H;  1HKT A;  4EGY A;  1LNW A;  2VKH A;  3FF5 A;  4RAY A;  1FYL A;  1MJB A;  5E3N A;  3V7C A;  1XMA A;  4BQA A;  2K4J A;  1D1A A;  1VQ9 I;  5E8I A;  3JSP A;  2EIL H;  4L9V A;  3CCU I;  4XN0 A;  1R4M B;  1R6R A;  2L2O A;  4IVN A;  4O6J A;  4Q47 A;  4KMU X;  1Z7L A;  3Q3S A;  4N9H A;  5HDN A;  1HW2 A;  5TRD A;  3B73 A;  1F4K A;  3R0A A;  4A3M J;  1JHH A;  1TW2 A;  2CW7 A;  5J4V A;  3L2U A;  4AID A;  5D5W B;  1LFP A;  1T0F A;  3PSF A;  2V79 A;  5F1R A;  4WXH A;  6PAX A;  1YW8 A;  1LJ9 A;  4KIF A;  3CCJ I;  2IJL A;  2HVS A;  1GHC A;  4C9Y A;  1S3J A;  1S6L A;  4ZDO A;  4HNV A;  3LSJ A;  2LR8 A;  4NUB A;  2IVM A;  2WC2 A;  5J8C A;  1W0U A;  5IYB J;  2EIK H;  3SFZ A;  4BAY A;  2QBY A;  3KPH A;  3M8J A;  2J5P A;  2RNJ A;  2CUZ A;  1K4T A;  3ABM H;  2E1N A;  2HOT A;  5CVV A;  2H09 A;  1YLF A;  4BJ6 C;  4FT8 A;  2GA1 A;  2P6S A;  3CC4 I;  1Z77 A;  1HLV A;  1G6N A;  4HW0 A;  2VUM J;  2LBF B;  2NVT J;  1BR4 A;  2DLL A;  2E35 A;  2ZJQ F;  2DXI A;  1MMG A;  1LPQ A;  1OKR A;  1TL8 A;  2O5R A;  4O3M A;  1GV5 A;  3AKZ A;  1RKW A;  4G8X A;  4CXF A;  3S17 J;  2Z99 A;  4NNJ A;  3RQ4 A;  2DFE A;  3ASO H;  3QU3 A;  2NOG A;  4RLQ A;  3MZH A;  5K5O A;  5C44 J;  3KLN A;  2MAB A;  3BZK A;  4BJT A;  2WY8 Q;  5K5Q A;  2QQ8 A;  1J7K A;  2CWE A;  2YR2 A;  4ZDP A;  2XUB A;  1FOW A;  2JMW A;  4F7Z A;  4C3I J;  3MQ0 A;  3SHF A;  2R7X A;  5JHU A;  2DQL A;  2LY2 A;  2V6C A;  5TGT A;  3GVA A;  2E34 A;  2OCE A;  3CCM I;  4HNU A;  1OQY A;  3OR2 C;  1R49 A;  3U9G A;  4PFP A;  5JI6 A;  3M9A A;  1HDD C;  1B59 A;  4B8X A;  3LFU A;  2VKD A;  2C6Y A;  3DCF A;  4GCV A;  2Q0O A;  1LFU P;  1B72 A;  1B9N A;  1XG1 A;  2LMD A;  4MO7 A;  5E1X A;  2AQE A;  1H0M A;  4ETS A;  3BG6 A;  2EBI A;  4RMN A;  3LQQ A;  4ZYD A;  2DQR A;  3RQI A;  2HPM A;  2IRF G;  5J47 A;  4U0W A;  1P92 A;  1NH3 A;  2Q8K A;  5CVJ A;  1IN8 A;  2CW8 A;  3QRF F;  1WFX A;  2CMP A;  2HYJ A;  3ZQQ A;  4HLY A;  1SFO J;  2JA5 J;  2WV1 A;  2X1E A;  3ZMS A;  4QLC U;  1PUF B;  1TC3 C;  1O3Q A;  4M74 A;  4BHC A;  4PJM A;  1WJD A;  4RB1 A;  4U7D A;  2ME6 A;  1UHM A;  5LHH A;  1DDN A;  2LRD A;  4M9X A;  5ICF A;  4WX9 A;  2QEN A;  1FEX A;  4EAT A;  4EJO A;  3ABK H;  4HDV A;  1YS7 A;  2FE3 A;  2R7Z J;  1K7A A;  4A3J J;  2ZKZ A;  4I98 B;  5LRS A;  2JA6 J;  1Z3Y A;  1IRX A;  1TZL A;  2NVU B;  3RKW A;  3GBG A;  5D6F A;  4EMS A;  1MMA A;  1WQ2 A;  2R7V A;  2K3P A;  2GQQ A;  3X2Q H;  2Z16 A;  3PNY A;  3GTK J;  3F8B A;  4W1U A;  1LE8 B;  1OCP A;  5IYD J;  5B5E C;  2KRC A;  3HL2 A;  2NS7 A;  1Y39 A;  1YW9 A;  3RI4 A;  1ITY A;  1SMY F;  2LH9 A;  5E1W A;  4DQ2 A;  2MGQ A;  2EZI A;  4HG2 A;  2JRM A;  2ZB9 A;  2VQH A;  3D5R C;  4FE4 A;  1QHG A;  2DT5 A;  2DFI A;  3DXJ F;  2A6H F;  1MGT A;  2XB5 A;  1Z7U A;  4DBR A;  5AIQ A;  3BQY A;  1USS A;  2EFW A;  3VSK A;  2B7E A;  2DA4 A;  3FBN B;  3GFJ A;  3GW2 A;  3FWE A;  1OYY A;  2X6Y A;  5B3S H;  4CYC A;  2W85 A;  2BY0 A;  2L9S A;  2NS8 A;  4PK4 A;  2M9H A;  1B8I A;  2XB0 X;  2HOS A;  2JVH A;  1SFU A;  1RET A;  2D5V A;  4U0V A;  2KP6 A;  2P5V A;  1BN5 A;  3CDL A;  3GFI A;  4G7H F;  2EZH A;  1KU9 A;  2XSD C;  3RIR A;  2XAF A;  4ESJ A;  3D5S C;  1G3W A;  2FQ4 A;  1ON2 A;  5LRR A;  4JP0 A;  1SFE A;  2DU9 A;  4BUP A;  2QKM B;  5EZH A;  2YX4 A;  3ASN H;  4RAG A;  2WAQ N;  2EZK A;  4FX0 A;  1HW1 A;  2W24 A;  1QVT A;  2VL8 A;  1B1B A;  2RQP A;  3QP6 A;  2DOD A;  3SZG A;  2WTE A;  4ZDL A;  3G2B A;  3K7A J;  4BDZ A;  1A35 A;  3CD6 I;  1ZEL A;  3J81 K;  1U8B A;  4AIK A;  1K4S A;  1KU7 A;  3TO9 A;  3ABL H;  4UVA A;  5HS8 A;  2EFQ A;  2O6G E;  2QQA A;  3IRQ A;  3DBR B;  2Y2Z A;  3VEP A;  3S3M A;  2E7W A;  4PSW A;  2ZXJ A;  4MTD A;  4C3H J;  2HDC A;  2M3A A;  1KON A;  3F9K A;  4Y3O A;  2Y9Z A;  2OTJ I;  1MMD A;  2L9N A;  2OZU A;  5ICC A;  5L3E A;  2XPW A;  1UFM A;  1D1B A;  1G2H A;  2V9K A;  4RDU A;  3MEX A;  2DYS H;  2IAI A;  3WHC A;  2L7M P;  1GV2 A;  5BPD A;  1ETV A;  2VJI A;  4HX4 A;  4LGW A;  3ZCO A;  2GAU A;  2E19 A;  3JRD A;  3H3U A;  2DMU A;  1HQC A;  2PJR B;  3Q9S A;  5EGO A;  1IN4 A;  3FMS A;  2QEX I;  4B3A A;  5GAE J;  3VFZ A;  5HLT A;  2WBM A;  5HS7 A;  3LST A;  3FHZ A;  1R58 A;  3BT9 A;  1APL C;  1QNT A;  2O8X A;  2NVQ J;  2CFX A;  4XOP A;  2H1L A;  5F6F A;  3OYM A;  3JRH A;  2BEO A;  2CSO A;  3HXL A;  2B9S A;  1UB9 A;  3TED A;  2XAH A;  4FHT A;  2FOW A;  4G94 A;  3K4N A;  1XGM A;  2BY2 A;  3I59 A;  2GBY A;  3L2C A;  1B72 B;  4FE7 A;  2XGX A;  5HS9 A;  2QF7 A;  2BW3 A;  2EFP A;  4X1E A;  1OPC A;  3C2B A;  2Y0S A;  3OIO A;  3DU5 A;  5GPC A;  4AD9 A;  3CUQ B;  3F23 A;  1N75 A;  1MBK A;  4J00 A;  3K4J A;  3L1P A;  4UHT A;  2CQK A;  2LFB A;  4ANJ A;  3FXK A;  4HF0 A;  1MND A;  4FQG A;  5AIP A;  4P55 A;  2X48 A;  1MSE C;  1FX7 A;  2M5W A;  4L5J A;  3HHG A;  3PQK A;  3T8T A;  1PYV A;  3DPL C;  4B3X A;  5D4S A;  2FBK A;  2QVO A;  4JX6 A;  2GOX B;  4EJW A;  1X1C A;  4M9Z A;  4N9I A;  3FIW A;  2FJ1 A;  3BCB A;  3V7S A;  1JUM A;  3ZP5 A;  4ENK A;  3QYB A;  3SDG A;  1SFX A;  2VPR A;  4S05 A;  5E20 A;  4BEH B;  2ELJ A;  4A93 J;  3OYH A;  5IOZ A;  2LBF A;  3BJ6 A;  3S1R J;  1D5V A;  2BY1 A;  4OIR F;  3HTU A;  1BR2 A;  4M3G A;  5LD2 C;  3ZGK A;  2BV6 A;  4BQN A;  2LLK A;  3FK6 A;  3PNT A;  1ENH A;  3WOD F;  1BOB A;  3TQN A;  4DOZ A;  4A3D J;  1Z6T A;  4NC6 A;  4XLN F;  2MFZ A;  5KAF C;  1P4A A;  2DI3 A;  1YW7 A;  4BE0 A;  2HR3 A;  3CES A;  1AA7 A;  1XGN A;  3CLO A;  3V42 A;  1DGR M;  5DCM A;  5FLM J;  3NRV A;  4XKB A;  2DTR A;  3CDI A;  4YRV A;  4PFO A;  4XMY A;  5FLV A;  1I27 A;  3H5A A;  2YX7 A;  3Q0V A;  4BE1 A;  2VQL A;  4BXF A;  2LY1 A;  4IOC F;  4F55 A;  2KL4 A;  3K4C A;  1A6I A;  1BC7 C;  3ZN1 A;  1TT5 B;  2XSJ C;  1W4M A;  2MW8 A;  4RBO A;  5E8G A;  1U9O A;  1XB4 A;  2VBW A;  3BG9 A;  4MFE A;  4I0B A;  4U7B A;  5H6Q A;  5J8F A;  2XC7 A;  2XF7 A;  2L9R A;  2F5V A;  5BQT A;  4A3C J;  3VYR B;  3E3V A;  3NEU A;  2R0Q C;  1TQM A;  5D4R A;  1IRF A;  3E6C C;  4GFB A;  3DTK A;  2AXT C;  2IPQ X;  3WGH A;  1B9M A;  1X1B A;  2X4H A;  5JVG F;  4X6A J;  1S8N A;  3RPQ A;  4J19 A;  1N25 A;  1FIP A;  2ZNY A;  2R5Y A;  3RKY A;  4XRF A;  2PJP A;  1FYM A;  1Z9C A;  2Y9Y A;  3MN2 A;  2X1D A;  4BH9 A;  4AIJ A;  2AXL A;  4LOC A;  5LEK A;  3K1N A;  1W7P B;  2ECC A;  5GAG J;  4U88 A;  4U0Y A;  4WK8 F;  1BOA A;  3KYC B;  2Z1D A;  5DM6 F;  2PMZ A;  2FX0 A;  4RA2 A;  4BYY A;  2CQN A;  2K3F A;  5A2Q K;  2W84 A;  1U9N A;  1S7A A;  1UG2 A;  3HBL A;  2X6O A;  5KAI C;  1JJ8 C;  2VKV A;  3ZR8 X;  1Y8Q B;  3K4L A;  1H9T A;  2CJJ A;  3OYG A;  1YIT I;  1BR1 A;  3KP6 A;  1W0T A;  1ZR4 A;  2HKX A;  3BR2 A;  3HOS A;  5IOY A;  1FLI A;  5CVI A;  1IJW C;  4ZZL A;  3BJA A;  3BR5 A;  4Y7N J;  1BW5 A;  1LVK A;  2W25 A;  3I5U A;  3CF2 A;  4AVP A;  1D8K A;  3PFI A;  1AHD P;  2DT7 B;  2A6T A;  4XRS G;  1P4X A;  3CMA I;  3ZQG A;  1MJA A;  2XHK A;  3ZQ7 A;  1UJ8 A;  1V5E A;  1RES A;  2HOE A;  1CF7 A;  3DV8 A;  5H20 A;  5DUI A;  3L7W A;  1ZRD A;  5F04 A;  2H94 A;  2FNP A;  2NVY J;  5HDK A;  1TWC J;  1LKX A;  3REO A;  4UV8 A;  3LAJ A;  2L0K A;  1IC8 A;  1NHA A;  2JPB A;  3DP7 A;  3M7G A;  3O8G A;  3R6S A;  4HNT A;  4XID A;  3IL2 A;  2X85 A;  1GVD A;  3CUO A;  4D7M A;  5D8L B;  1MH4 A;  2OCC H;  2FBH A;  3NWT A;  2XF5 A;  1LDK B;  3BWG A;  5J40 A;  2WAE A;  1UEL B;  4CZZ A;  1ON1 A;  2GLO A;  3DEE A;  3U1D A;  2W82 A;  3A1Y A;  2V1U A;  1Y8R B;  3OS2 A;  1SD7 A;  2VJJ A;  2CU7 A;  2CG4 A;  4DJA A;  4KNY A;  2VT2 A;  2VBY A;  5IY5 H;  3HRS A;  1UZC A;  4F91 B;  1X1A A;  5BMZ A;  2X6X A;  2M7A A;  1OCZ H;  3F6V A;  1KA8 A;  1BM9 A;  1CQT A;  2F4O B;  4PSX A;  2XKP A;  2DA1 A;  1GXP A;  2PMZ N;  4A2U A;  2Y0M A;  4L9N A;  3OIQ A;  3ERE D;  1VQN I;  2PMH A;  3AG1 H;  1TQP A;  4HZF A;  3ZMT A;  3HDD A;  1H89 C;  3JRB A;  1XPX A;  1DPR A;  3E5Q A;  2HGC A;  4XKV A;  1XSX A;  3QP5 A;  5F64 A;  1A04 A;  2ESN A;  5B1A H;  4CZC A;  1O3S A;  4CDG A;  2KIM A;  4V19 K;  5LEJ A;  3W3C A;  2VJ4 A;  2E36 A;  4HRI A;  4A69 C;  3WHB A;  5D8K B;  2IGK A;  1K6Y A;  3IWF A;  2JQ7 A;  1WCM J;  3MMY B;  5DV5 A;  1YE9 A;  3GME A;  3M07 A;  2DFH A;  2L7K A;  3L2R A;  3OYN A;  4BE2 A;  2R5Z A;  5EGO B;  4NQW A;  5CYV A;  2V6E A;  3LWF A;  3WTX C;  2IT0 A;  4IQJ A;  5HNF A;  2LY9 A;  2FD5 A;  5F0C A;  2UWM A;  1DP3 A;  1Z91 A;  3KYD B;  3FXM A;  2JK3 A;  2P5L C;  2E2H J;  2EA4 A;  2K02 A;  1R00 A;  2FF4 A;  3WTS C;  2KQR A;  3FBI B;  4RGR A;  1SFK A;  4QIW N;  5K7F A;  2XAJ A;  2CV2 A;  3E5X A;  2VN2 A;  3DLA A;  4ZYH A;  4CCM A;  1HSJ A;  2KDO A;  1S9H A;  1VND A;  2UV1 A;  3HUG B;  4MHG A;  4C30 A;  4PUS A;  3DLL F;  2D45 A;  4EVI A;  3K69 A;  4G6T B;  2BVL A;  1GLN A;  4D0P A;  3OYL A;  3BG7 A;  3GTO J;  5E17 F;  3M8F A;  1HBX G;  3DQV C;  4AC0 A;  3TGN A;  4D5F A;  3E5U A;  4LB5 A;  4NDL A;  4PJ0 C;  4Q48 A;  3OYA A;  2CGP A;  1E2X A;  1OYW A;  3P9K A;  3EDP A;  1H9G A;  2DW4 A;  3ZQL A;  5GTI C;  4MEX F;  3S3O A;  3GZ6 A;  1ZLK A;  1QGP A;  3ZRG A;  3I55 I;  1SD6 A;  4Y15 A;  2L4M A;  4R79 A;  3O8H A;  3PM1 A;  3QU6 A;  3E7L A;  5C3E J;  3JRI A;  1TLH B;  1FSE A;  4PJJ A;  1BI2 A;  1W5C C;  3PUF A;  5L3G A;  3OOP A;  4A3L J;  2W7N A;  2OD5 A;  1ODD A;  3ABT A;  3JW4 A;  4BQQ A;  2CUJ A;  3WE2 A;  1A36 A;  2P5K A;  3AG4 H;  4KIB A;  3FHN A;  3J80 Z;  1G3Y A;  1J59 A;  4RB2 C;  3JRF A;  1UAA A;  3DKX A;  2R7D A;  1R36 A;  2VQC A;  4AYB A;  5IT3 A;  5BPI A;  3C2G A;  3OV8 A;  3DBH B;  4A6E A;  3H3V K;  1MD0 A;  5K1Y A;  2E1O A;  1ZLJ A;  2QLZ A;  3N4M A;  2JWT A;  2KMU A;  3CP2 A;  3M4O J;  3FM3 A;  3RDI A;  2UUZ A;  2AQF A;  4ENJ A;  1D8J A;  1IDY A;  3OYF A;  3KX2 A;  1S7E A;  1SC7 A;  2DTZ A;  2OA4 A;  3GZN B;  2JTV A;  2LOO A;  2KRF A;  4QPQ A;  4DYR A;  4F92 B;  3PJR A;  1ZAO A;  4P9F A;  3CUQ A;  1KU2 A;  1EF4 A;  2Y69 H;  4KUM A;  1GDT A;  2NYX A;  3BR1 A;  2R7T A;  4BXU A;  1O7L A;  3LOC A;  2GIZ A;  2LVS A;  2V1D A;  4LIT A;  5FLX Z;  1U5T B;  1KQ8 A;  4D1Q A;  3DPU A;  2HYG D;  3OSF A;  2JUC A;  1IG7 A;  5FFZ A;  2EV0 A;  4LD5 A;  2V1N A;  3P9C A;  3R60 A;  3DBL B;  3RPU D;  5ICE A;  1TBX A;  3BCA A;  4IQ4 A;  1ZHF A;  5FD6 A;  2WAF A;  4RM3 A;  4C3J J;  2G7U A;  3PO3 J;  3H0G J;  3H92 A;  2XRL A;  2CS3 A;  4GRI A;  2RN7 A;  3R0J A;  3KEQ A;  3K1P A;  2EFN A;  2IA2 A;  3KP3 A;  3WU2 C;  3LAP A;  5L3B A;  1RRJ A;  3K4B A;  4KT5 C;  4M6X A;  3H36 A;  5JLW A;  1DQU A;  3H9G A;  3HG9 A;  4HV6 A;  4JK1 X;  5EJC A;  2KFD A;  1T2K A;  2CFO A;  4ABZ A;  1X19 A;  4NHJ A;  3SYT A;  5LGU A;  2DO7 A;  2ZME A;  3TDU C;  1IAW A;  2O03 A;  3MKZ A;  4ZTJ A;  1D1C A;  1S5L C;  2YSR A;  3OSG A;  1T8I A;  1RUO A;  1QPI A;  9ANT A;  3GTQ J;  3GLX A;  4IKF A;  2DA6 A;  3KZI C;  2CV1 A;  1G4D A;  3F72 A;  3BLY A;  2DPU A;  2GXA A;  1NG7 A;  4M6V A;  4YFX F;  3E6B A;  1I39 A;  1X2M A;  5HOD A;  2O7O A;  3F3X A;  2CH0 A;  2FEZ A;  3I4M J;  2ZME B;  3OWT A;  1JUS A;  3FX3 A;  4DNC A;  3F6O A;  4QWQ A;  2YPR A;  1VI0 A;  1MBJ A;  2P7C B;  2IW5 A;  2HZD A;  1ZR2 A;  2XPU A;  3RJP A;  1DP7 P;  1L3L A;  2R7S A;  2DK8 A;  2K7L A;  5EEG A;  3J7Z I;  2PI0 A;  4IHS A;  4XM3 A;  3T0Y A;  1VFC A;  1ETO A;  2MSY A;  2CRG A;  4CYC B;  1WH5 A;  3GYH X;  4OWR B;  2Y0S N;  3RKQ A;  3FKI J;  4I7H A;  5ILV A;  3S2D J;  4DZJ A;  3V8J A;  2LK2 A;  1OLT A;  2G0E A;  1RR8 C;  1ZRC A;  3M3Y J;  2FQ3 A;  1NTC A;  4BU2 A;  2E7X A;  3GTM J;  2ELK A;  5M5W J;  4HA8 A;  2H6C A;  1U78 A;  3E6D A;  3HGG A;  3TDZ C;  1X3Z B;  5EG0 A;  1BA5 A;  3SQN A;  1QZY A;  1EH6 A;  3BRO A;  3K70 D;  4KFC A;  4I2O A;  2E71 A;  5A2Q Z;  3LA3 A;  3J7A Y;  4LG0 B;  4PJN A;  4YEL A;  2XIG A;  3AG2 H;  5HLI A;  4AYB N;  2DMQ A;  2OU2 A;  2Q2E B;  4OIQ F;  4LK0 F;  1LE8 A;  1S72 I;  1T39 A;  1MBF A;  2HYF A;  3FXQ A;  3TOB A;  5BS6 A;  1WJC A;  5LGT A;  3G1O A;  3G1L A;  2KLO A;  3H1C A;  1ETW A;  4UNO A;  1P6R A;  5ED4 A;  2OJE D;  3SZP A;  4IHV A;  2CQQ A;  4E7S A;  3CCV I;  2O61 A;  1PDN C;  4NQW B;  3HRU A;  1V54 H;  4RAF A;  2CV0 A;  4E7H A;  2XRN A;  2HVQ A;  4EM2 A;  4ZYA A;  2VIX A;  3L2W A;  2COB A;  3SZT A;  2V9V A;  4A0X A;  5HLH A;  2JA2 A;  2NXN B;  3ECH A;  3LSK A;  3CJT B;  4EQQ A;  1E17 A;  5HLG A;  2PLY A;  2DDA A;  1LEB A;  4FAS D;  2K85 A;  3OS0 A;  3BTL A;  5KK1 A;  3G6E I;  2B63 J;  2QQ9 A;  1P7J A;  3KLO A;  3AG3 H;  3LSG A;  3O2P E;  5C4J J;  2KJB A;  2JSP A;  4CCL A;  4RB3 C;  2R7O A;  2JZY A;  1KZH A;  4KIS A;  1F9N A;  2PG4 A;  1FIA A;  5LGN A;  5D5U B;  4II2 A;  3JAM K;  1TWG J;  3I64 A;  1GXQ A;  3H9J A;  1W36 D;  5CKT A;  2LDU A;  3IP4 B;  3I71 A;  2BVM A;  4QTR A;  2TRT A;  1WJB A;  2IXS A;  3IWZ A;  2DAO A;  1GVJ A;  4XRM A;  3ROU A;  2F5D A;  3EPZ A;  3PL8 A;  1Z6R A;  5LHI A;  3J81 Z;  2R7U A;  2EZL A;  2KPM A;  4I99 C;  1LFB A;  5FRM A;  2X9D A;  3CCQ I;  4Y33 A;  4AWX B;  2W48 A;  2F4I A;  3KEY A;  5CVR A;  4BHB A;  2Z3Y A;  1JKR C;  2MLK A;  2A05 A;  5FRO A;  2R7F A;  4I01 A;  2EJR A;  3GFL A;  3BZ6 A;  4F3Q A;  3TKY A;  4ENN A;  4A3B J;  4E70 A;  3A02 A;  4XKC A;  2HDD A;  5CQE A;  2EV5 A;  3FXO A;  4M73 A;  4P1W A;  1WHU A;  4PDK A;  2R7W A;  2DA5 A;  3ZQF A;  3S2H J;  2PN6 A;  4EJU A;  4OMZ A;  2EFO A;  2XF6 A;  1E3P A;  4UB8 C;  4A5M A;  2L02 A;  3A2K A;  2EIJ H;  2GXG A;  2I8D A;  1JTX A;  2VE8 A;  5ERI A;  5EEA A;  1NK2 P;  3SEQ A;  2L7F P;  1HDP A;  5LFA A;  1REP C;  4AM3 A;  2ICW G;  3TBI A;  3RYR A;  1WPK A;  1G3S A;  2BY3 A;  4M3B A;  2RKH A;  1ZGW A;  1JGG A;  5E3O A;  1YJN I;  1S7O A;  1R23 A;  3F21 A;  5FKL A;  2JA7 J;  2COM A;  3EUH A;  3LSH A;  2V9P A;  2XAQ A;  4LB6 B;  2CW0 F;  4BQO A;  1BC8 C;  1BL0 A;  3C18 A;  4P5O A;  2LKX A;  5FLX K;  3K2A A;  1DU0 A;  2YU3 A;  1I3Q J;  4IF4 A;  3HUG A;  2K9Q A;  4G9Y A;  2EPF A;  1C0W A;  4DYQ A;  3MFK A;  2LRE A;  3IHU A;  1ZN2 A;  4A3K J;  3VYU B;  4A3E J;  3GZ5 A;  1KQ9 A;  3WU1 B;  2VT3 A;  1MDM A;  4M6Y A;  1ZQ3 P;  1J9I A;  3I58 A;  2CQX A;  2HU9 A;  3C7J A;  2FMY A;  3C3W A;  1WKM A;  3MAJ A;  1ETX A;  4F93 B;  1AKH B;  4BNC A;  2JN6 A;  3LA7 A;  4BHP A;  4QSH A;  5FRN A;  3S1M J;  2KDZ A;  2YU9 J;  2JJ7 A;  4IRI A;  1QRY A;  2F5F A;  5FKM A;  4HOB A;  5J4Y A;  4FTH A;  4RAZ A;  1VQL I;  2ZO4 A;  2EV6 A;  2ID6 A;  1T56 A;  4WWC A;  1U6G A;  3K6G A;  2QQB A;  3K2Z A;  1SVO A;  3OYK A;  3LFK A;  3KP2 A;  4QPO A;  2UZK A;  2YS9 A;  4XQF A;  2M0C A;  4OMY A;  2GIV A;  4A0Z A;  2ELH A;  2H8R A;  3A4C A;  4RGU A;  4A5N A;  3WG9 A;  5D5V B;  3LSM A;  1FYK A;  4OIP F;  1FWZ A;  2Y75 A;  1QVU A;  4UY8 I;  4M3E A;  1YYV A;  2ZJ2 A;  5CLS A;  4CO8 A;  3HC7 A;  1GUU A;  3LQR A;  3Q0U A;  3L00 A;  3I56 I;  3V4G A;  2M87 A;  3FXR A;  2VXZ A;  1ZG1 A;  1YTY A;  2QKL B;  2TCT A;  1ZG3 A;  2DPD A;  5M3M J;  3ZPL A;  1J5Y A;  3O6B B;  3PSI A;  1VQM I;  4X0G A;  1O3T A;  2MA3 A;  3HRM A;  2NS0 A;  2K9S A;  4CUG A;  1IXR C;  3LA2 A;  1T98 A;  4KIC A;  4RS8 A;  4CGZ A;  3CCE I;  1JTY A;  2O0Y A;  3IRR A;  5BOX A;  4BY1 J;  2IA1 A;  1FBU A;  4S04 A;  3TO7 A;  1PP7 U;  2LF7 A;  1FY7 A;  2OTL I;  3GF2 A;  4HEA 2;  1RR7 A;  3HGY A;  4UUV A;  1XX5 A;  5E1Z B;  3VB2 A;  5J1U A;  2EH3 A;  5C4X J;  3WTW C;  3IH3 A;  2FML A;  3WU0 A;  5F08 A;  3ABU A;  4I09 A;  4IPA A;  2GA2 A;  1TQI A;  2BBY A;  4NC7 A;  4XLE A;  3MZY A;  3BOQ A;  3I9V 2;  3PIO F;  3F8C A;  4E7Z A;  3VOE A;  1T6S A;  2I5U A;  2K86 A;  2ZJR F;  2L9V A;  4XSX F;  4YFK F;  3GTP J;  4DIQ A;  4IRH A;  1XC5 A;  3C2H A;  1UST A;  2WA0 A;  3RKX A;  4M72 A;  1OR7 C;  2OQG A;  3K4M A;  3GXO A;  3RTR A;  4UUS B;  1T38 A;  1ZRF A;  1VQ6 I;  4JBA A;  3TO6 A;  4LLL A;  5DM7 F;  1V5G A;  1U8R A;  2VBZ A;  3OL3 A;  2OQR A;  4IEJ A;  5E18 F;  1I6X A;  3M8E A;  2F2E A;  2MH9 A;  3G71 I;  2Z9O A;  1IXC A;  5FGM A;  3FIS A;  2IGO A;  5DDG A;  3MCZ A;  5IP7 J;  4HQE A;  2IP2 A;  2FNA A;  5JFR A;  5DCM B;  1Y6I A;  1R5H A;  1W5T A;  1YQA A;  2VOD A;  3OYD A;  5FB2 A;  1IN5 A;  4IHT A;  3ZQH A;  3UNG C;  4ZJZ A;  4ITV A;  5AON A;  5LHG A;  2WAD A;  1YX5 A;  2IGN A;  4OAY A;  1OCC H;  1VQK I;  2EWN A;  1UHS A;  2ZNZ A;  4KT6 A;  3BP8 A;  2V26 A;  1YJW I;  4YIR X;  1UMQ A;  1W7P D;  3BQZ A;  5DS9 A;  3IH2 A;  3LNQ A;  1U5T C;  2HEO A;  2R5Y B;  4HYE A;  1ZG5 A;  2ZXH A;  2E1C A;  3NWS A;  1F1Z A;  2JUG A;  5KNL A;  4LG0 A;  3JRC A;  2IS6 A;  4ESB A;  1P7I A;  3SEZ A;  2ZBK A;  1G3T A;  3H5N A;  2DMN A;  4HST A;  3HOU J;  3NAU A;  3LMM A;  5HVQ C;  2ZFW A;  3COA C;  3RSN A;  3W6J B;  3N05 A;  3H0D A;  2VI6 A;  4PZJ A;  3HOT A;  5L3D A;  4FET A;  1Q1V A;  1TWA J;  2PMU A;  3QYE A;  3JRG A;  2GOM A;  4E7L A;  1VQ4 I;  4HLX A;  2M8E A;  3D0S A;  3B02 A;  3E0J B;  3BC8 A;  1QU3 A;  3CC7 I;  1NG6 A;  2XGD A;  3L2V A;  4D9J A;  2HI3 A;  2WAQ A;  3PQJ A;  1R22 A;  4XR6 A;  3EUK L;  2XDV A;  2ISY A;  1K78 A;  1BW6 A;  1J2X A;  2QM3 A;  1MNM C;  3CCY A;  3L09 A;  1QO0 D;  5E3M A;  4H0E A;  1FNN A;  2HQA A;  3K0L A;  3I59 B;  2HXI A;  3ECO A;  4L5E A;  2OZ6 A;  1R71 A;  2Z33 A;  3ULQ B;  5JVT A;  1K6O A;  1VQ7 I;  2TDX A;  1K61 A;  2VKE A;  3N97 A;  4CYD A;  4BDY A;  4NB5 A;  2AHQ A;  4S0H B;  2MLG A;  1A31 A;  4W97 A;  1IV8 A;  3ZXS A;  3S15 J;  1EA3 A;  3G4S I;  1O57 A;  3OIP A;  1MZB A;  1Z67 A;  3FMQ A;  1TNT A;  3FXJ A;  1HKS A;  3GFM A;  4Q4Z F;  1V5F A;  2DDB A;  1O3R A;  3HPH A;  4Y4R A;  2DOA A;  1R1V A;  2PEX A;  3KYL A;  2DYR H;  4E7J A;  2VLA A;  1RPW A;  1XSV A;  5J6X A;  4LK1 F;  3WG7 H;  4BEH A;  4BY7 J;  3OYB A;  4LJZ F;  2OUM A;  3E97 A;  3ONQ A;  3CZ6 A;  2PFB A;  2RRE A;  1XMX A;  1WJE A;  3CF5 F;  3HEF A;  2R7Q A;  2KKO A;  4BL0 B; 
#chains in the Genus database with same CATH homology
 3K1M A;  3HSF A;  2ISZ A;  4HBL A;  2FOK A;  1RNL A;  3ELK A;  2NNY A;  2XAG A;  4HQM A;  1L0O C;  1TNS A;  3F22 A;  1AWC A;  1V4R A;  2JRT A;  4M9S A;  2H27 A;  3D5L A;  2H6B A;  3BPV A;  1P2F A;  1R1T A;  2JT1 A;  2J5O A;  2HQN A;  2KIU A;  4OU0 A;  1XD7 A;  1MDM B;  2L54 A;  3BJO A;  3KP7 A;  4ESF A;  4GYG A;  2MH2 A;  4UV9 A;  4YG2 F;  2EA2 A;  3P9I A;  5LBQ A;  1U3E M;  3CO6 C;  1ZH5 A;  4RB0 A;  1XSD A;  2PQ8 A;  3KET A;  1FBS A;  3F8M A;  4ASN A;  2QBY B;  3EQL F;  1I1S A;  3KZY A;  1FZP B;  5IT9 Z;  2L4A A;  2GWR A;  3K9T A;  3DF8 A;  1YIO A;  2IA0 A;  2CO5 A;  3H3Z A;  2VOP A;  1DUX C;  2HFH A;  1I1G A;  3WGI A;  4EM1 A;  2ZCW A;  3NQO A;  4L5I A;  1EH7 A;  3F8F A;  5KVR A;  3I54 A;  1OR7 A;  2D1V A;  4R8H A;  1FP1 D;  2MBF A;  2HTJ A;  3O3K A;  4ZZD A;  2FA5 A;  1IF1 A;  1IXS B;  5L3F A;  1IN6 A;  4P96 A;  5HDG A;  1ZRE A;  1IUY A;  3VOD A;  2A68 F;  4A6D A;  3HRT A;  1ZAR A;  2A61 A;  3S2W A;  4WXC A;  2EB7 A;  4I0A A;  2QWW A;  3GWZ A;  3WTT C;  2FRH A;  1WRJ A;  2K4B A;  1TW3 A;  1IZ1 A;  4L9T A;  1QZZ A;  1Q1H A;  3DFG A;  2Z5U A;  2D1H A;  1KQ0 A;  1ULY A;  4N0B A;  4HV5 A;  3WTV C;  4KN7 X;  2BE5 F;  3IKV A;  4XBF A;  2P4W A;  3EET A;  1FT9 A;  1DPU A;  1R7J A;  1XDU A;  2UXN A;  3ZMU A;  2KJC A;  3EYY A;  1AOY A;  5D6E A;  3ZMZ A;  2FU4 A;  2X0L A;  2F5E A;  4EJV A;  1BI1 A;  5DUK A;  2XAS A;  4CIC A;  3QPT A;  2DK5 A;  4UVB A;  1YO5 C;  4WF2 A;  2HWV A;  4CHU A;  5FD5 A;  4Z2Y A;  2DBB A;  3ZN0 A;  1JE8 A;  1WI9 A;  3JAM Z;  3GX4 X;  1BIA A;  4FX4 A;  2V1X A;  4RGS A;  2GZW A;  1S29 A;  3M1E A;  2G9W A;  4G7Z F;  3T1B A;  4YFN F;  1LVA A;  2A3S A;  3BY6 A;  2FXA A;  1LDD A;  1O7F A;  3E6M A;  2LF8 A;  4MTE A;  5ILS A;  5FFX A;  3WTZ A;  5L3C A;  1FSH A;  1XGS A;  2D2W A;  3KFW X;  5DYM A;  4ZH4 F;  4GXO A;  2Y48 A;  2RC4 A;  1ZGA A;  4MNU A;  2A69 F;  3V8K A;  1YS6 A;  3C1D A;  2OBP A;  3CDH A;  4UVC A;  2P6T A;  1K78 B;  3RPU A;  2VON A;  4LFU A;  4IJA A;  4TV7 A;  4MEY F;  4AIH A;  1EH8 A;  4ZYG A;  3U2R A;  4LLG F;  2XVC A;  4EJT A;  4Y17 A;  1XCB A;  5LLQ A;  3R61 A;  4LMY A;  4PCQ A;  3QPH A;  2QUF A;  3J80 K;  1IW7 F;  4PGG A;  2O3F A;  3FM5 A;  1QQI A;  2STT A;  4ENM A;  2UXX A;  4K2E A;  1HST A;  2A5Y B;  1Z05 A;  5CVU A;  3KE2 A;  4G6Q A;  1B4A A;  5DD4 A;  3WTU C;  2HTS A;  3TOA A;  1WWX A;  4KN4 X;  1FOK A;  2WWY A;  1XGO A;  2HZT A;  2Q2E A;  1OYI A;  3KEO A;  3DKW A;  4L18 B;  3T5X A;  2MD5 A;  4MGR A;  4GO1 A;  1RZ4 A;  2M30 A;  3Q9V A;  1QBJ A;  1JGS A;  2ADU A;  1ZYR F;  1KU3 A;  4L0Z B;  1K79 A;  3HSR A;  2LNB A;  4HDU A;  4GGG A;  1KGS A;  1FC3 A;  1QPM A;  3Q5F A;  4GYI A;  2RGV A;  1BIB A;  1YFH A;  4LLN A;  4Q5S F;  2A07 F;  2CYY A;  1XCV A;  2M45 A;  5IT9 K;  1WSU A;  1UHW A;  4KIG A;  4IXA A;  3SXY A;  4OOI A;  3F8N A;  1FP2 A;  4A0Y A;  4HX8 A;  1J0R A;  3QAH A;  1W7P A;  1Z1D A;  1HKQ A;  4HX7 A;  1LDJ A;  4WXD A;  1U2W A;  1XMK A;  3HHH A;  2RV8 A;  1U5T A;  2LSO A;  2LKP A;  1UCR A;  5CJ9 A;  5K5R A;  2VOO A;  2RVC A;  4RGX A;  2L01 A;  3HSE A;  3DPT A;  5DEQ A;  1KYZ A;  2HQR A;  3ISP A;  2NRA C;  1BBY A;  1HXD A;  3ZMV A;  4G6D A;  4YII A;  3CO7 C;  4Y13 A;  3P7N A;  1X3U A;  1TTY A;  1P4W A;  2RDP A;  4P9U A;  3CUQ C;  4MQ9 F;  1RUN A;  4I02 A;  2P8T A;  1CF7 B;  3I4P A;  2P7V B;  3G3Z A;  3JTG A;  1ONV A;  2FBI A;  1JHF A;  4G7O F;  5TJJ A;  2JSC A;  4L9J A;  3KCC A;  1MKM A;  1J75 A;  1D3Y A;  2XV4 S;  5ILU A;  5DD8 A;  1YG2 A;  4O5V A;  1ZGJ A;  2VBX A;  5EEH A;  3JTH A;  2BYV E;  2PBI A;  1LEA A;  2MC3 A;  4UXN A;  3RYP A;  3BDD A;  3QOP A;  4B09 A;  1LB2 A;  1R1U A;  2QYO A;  1HW5 A;  2HS5 A;  4XLP F;  5H6R A;  3ZMD A;  4YIF A;  2XRO A;  3WTY C;  4JQF A;  5HOO A;  2G7H A;  1V3F A;  4HAM A;  1VTN C;  3DEU A;  2ACJ A;  3FMR A;  1B6A A;  1FPQ A;  4OIN F;  2M1B A;  4OIO F;  4EGZ A;  2VC1 A;  4M71 A;  1OMI A;  2NNN A;  4WCG A;  1BI3 A;  1BJA A;  1PP8 F;  1JXS A;  3CJN A;  2F5C A;  5DCF A;  2ETH A;  3AAF A;  2GXB A;  3WGG A;  3GO5 A;  1KYW A;  3WE3 A;  3CTA A;  4HF1 A;  4EV0 A;  1XN7 A;  1BI0 A;  1Y0U A;  3W6K B;  3HIF A;  1CGP A;  4KA4 A;  3GUD A;  5JR3 A;  1SMT A;  3KP5 A;  2B0L A;  4MQV A;  4KYW A;  2R3S A;  3EYI A;  2OAZ A;  3G73 A;  4ZYE A;  1STZ A;  2XKO A;  3FXU A;  3R4K A;  5ICG A;  1PUE E;  2NAZ A;  2VC0 A;  1SD5 A;  3KZZ A;  3MWM A;  3T8R A;  3J7A O;  1XDS A;  2FSW A;  1SD4 A;  1LQ1 A;  3IKT A;  1IRG A;  4IRG A;  4XSZ F;  1I5Z A;  3BPX A;  2QZ8 A;  3GEZ A;  3JSO A;  4ON0 A;  1MJ9 A;  5FO5 A;  2W57 A;  3I0T A;  3ML6 A;  1RIO H;  2L3D A;  2HKO A;  2STW A;  4EM0 B;  3V8L A;  2JPC A;  3KP4 A;  3L9F A;  2KIF A;  1SAX A;  4KDP A;  4R1H A;  2ESH A;  3HYI A;  2EK5 A;  2BGC A;  1RI7 A;  1EV7 A;  4L0Y B;  3IC7 A;  2WV0 A;  2VE9 A;  5D5X B;  1IN7 A;  1FBQ A;  1W5S A;  3V7R A;  2A6E F;  1R5G A;  2AS5 F;  4KMF A;  1F5T A;  3I53 A;  2K27 A;  4HF2 A;  3FZV A;  4A12 A;  4PGH A;  3HTS B;  1HKT A;  4EGY A;  1LNW A;  3FF5 A;  4RAY A;  1FYL A;  1MJB A;  3V7C A;  1XMA A;  4BQA A;  2K4J A;  5E8I A;  3JSP A;  4L9V A;  4IVN A;  4O6J A;  4Q47 A;  4KMU X;  4N9H A;  5HDN A;  1HW2 A;  5TRD A;  3B73 A;  1F4K A;  3R0A A;  1JHH A;  1TW2 A;  5D5W B;  1T0F A;  2V79 A;  5F1R A;  4WXH A;  6PAX A;  1YW8 A;  1LJ9 A;  4KIF A;  2IJL A;  1GHC A;  1S3J A;  1S6L A;  2IVM A;  2WC2 A;  5J8C A;  3SFZ A;  4BAY A;  2QBY A;  2J5P A;  2RNJ A;  2E1N A;  5CVV A;  2H09 A;  1YLF A;  4FT8 A;  2GA1 A;  2P6S A;  1G6N A;  4HW0 A;  2DLL A;  1OKR A;  4O3M A;  4G8X A;  4CXF A;  2Z99 A;  3QU3 A;  3MZH A;  5K5O A;  3KLN A;  5K5Q A;  1J7K A;  2CWE A;  2YR2 A;  2XUB A;  4F7Z A;  3MQ0 A;  3SHF A;  5JHU A;  2DQL A;  2V6C A;  3GVA A;  3U9G A;  5JI6 A;  3M9A A;  1B59 A;  4B8X A;  2C6Y A;  4GCV A;  2Q0O A;  1B9N A;  5E1X A;  1H0M A;  4ETS A;  4ZYD A;  3LQQ A;  2DQR A;  2IRF G;  4U0W A;  1P92 A;  2Q8K A;  5CVJ A;  1IN8 A;  3QRF F;  4HLY A;  3ZMS A;  4QLC U;  1O3Q A;  4M74 A;  4BHC A;  4RB1 A;  4U7D A;  1UHM A;  5LHH A;  1DDN A;  4M9X A;  5ICF A;  4WX9 A;  2QEN A;  4EJO A;  4HDV A;  1YS7 A;  2FE3 A;  1K7A A;  2ZKZ A;  4I98 B;  5LRS A;  3RKW A;  5D6F A;  4EMS A;  1WQ2 A;  2GQQ A;  3F8B A;  1YW9 A;  3RI4 A;  1SMY F;  5E1W A;  4DQ2 A;  2DT5 A;  2DFI A;  3DXJ F;  2A6H F;  1MGT A;  1Z7U A;  5AIQ A;  1USS A;  2EFW A;  3GFJ A;  3GW2 A;  3FWE A;  1OYY A;  2W85 A;  1SFU A;  4U0V A;  2P5V A;  1BN5 A;  3GFI A;  4G7H F;  1KU9 A;  3RIR A;  2XAF A;  4ESJ A;  1G3W A;  1ON2 A;  5LRR A;  1SFE A;  2DU9 A;  2YX4 A;  4FX0 A;  1HW1 A;  2W24 A;  3QP6 A;  1B1B A;  2RQP A;  2WTE A;  3J81 K;  4AIK A;  1KU7 A;  3TO9 A;  5HS8 A;  4UVA A;  2O6G E;  2EFQ A;  2QQA A;  3IRQ A;  3VEP A;  2E7W A;  2ZXJ A;  4MTD A;  2HDC A;  2OZU A;  5ICC A;  5L3E A;  1UFM A;  3MEX A;  5BPD A;  4HX4 A;  4LGW A;  2GAU A;  3H3U A;  1HQC A;  3Q9S A;  1IN4 A;  3FMS A;  3VFZ A;  5HS7 A;  3LST A;  3FHZ A;  1R58 A;  1QNT A;  2O8X A;  2CFX A;  5F6F A;  2BEO A;  2CSO A;  1UB9 A;  2XAH A;  4FHT A;  4G94 A;  1XGM A;  3I59 A;  3L2C A;  2XGX A;  5HS9 A;  2EFP A;  1OPC A;  4AD9 A;  3CUQ B;  3F23 A;  4UHT A;  2CQK A;  4HF0 A;  5AIP A;  4P55 A;  1FX7 A;  2M5W A;  4L5J A;  3HHG A;  3PQK A;  3T8T A;  3DPL C;  5D4S A;  2FBK A;  2QVO A;  4EJW A;  4M9Z A;  4N9I A;  3V7S A;  4ENK A;  3ZP5 A;  1SFX A;  4S05 A;  5E20 A;  3BJ6 A;  1D5V A;  4OIR F;  3HTU A;  2BV6 A;  3WOD F;  3TQN A;  1Z6T A;  4XLN F;  1P4A A;  2DI3 A;  1YW7 A;  2HR3 A;  1XGN A;  3CLO A;  5DCM A;  3NRV A;  2DTR A;  1I27 A;  2YX7 A;  1BC7 C;  3ZN1 A;  1W4M A;  5E8G A;  1XB4 A;  2VBW A;  4I0B A;  4U7B A;  5H6Q A;  5J8F A;  5BQT A;  3E3V A;  3NEU A;  3E6C C;  1TQM A;  1IRF A;  5D4R A;  2IPQ X;  3WGH A;  1B9M A;  2X4H A;  1S8N A;  3RPQ A;  2ZNY A;  3RKY A;  4XRF A;  2PJP A;  1FYM A;  1Z9C A;  4AIJ A;  4BH9 A;  2AXL A;  5LEK A;  3K1N A;  1W7P B;  4U88 A;  4U0Y A;  4WK8 F;  1BOA A;  5A2Q K;  4BYY A;  2W84 A;  1S7A A;  1H9T A;  3KP6 A;  2HKX A;  3HOS A;  1FLI A;  5CVI A;  4ZZL A;  3BJA A;  2W25 A;  3I5U A;  4AVP A;  1D8K A;  3PFI A;  1P4X A;  1MJA A;  2XHK A;  3ZQ7 A;  2HOE A;  1CF7 A;  3DV8 A;  5H20 A;  5DUI A;  3L7W A;  1ZRD A;  2H94 A;  2FNP A;  5HDK A;  3REO A;  4UV8 A;  3LAJ A;  1NHA A;  2JPB A;  3DP7 A;  3M7G A;  3R6S A;  3IL2 A;  3CUO A;  5D8L B;  2FBH A;  1LDK B;  3BWG A;  4CZZ A;  1ON1 A;  3U1D A;  2V1U A;  1SD7 A;  2CG4 A;  4KNY A;  2VT2 A;  2VBY A;  3HRS A;  5BMZ A;  3F6V A;  1KA8 A;  1BM9 A;  2XKP A;  1GXP A;  4A2U A;  2Y0M A;  4L9N A;  3ERE D;  2PMH A;  1TQP A;  4HZF A;  3ZMT A;  1DPR A;  3E5Q A;  2HGC A;  1XSX A;  3QP5 A;  5F64 A;  1A04 A;  2ESN A;  1O3S A;  4CDG A;  2KIM A;  5LEJ A;  5D8K B;  3IWF A;  5DV5 A;  4NQW A;  5CYV A;  3LWF A;  3WTX C;  2IT0 A;  2UWM A;  1Z91 A;  2P5L C;  2EA4 A;  2K02 A;  1R00 A;  2FF4 A;  3WTS C;  4RGR A;  2XAJ A;  3E5X A;  2VN2 A;  4ZYH A;  1HSJ A;  4MHG A;  2D45 A;  4EVI A;  3K69 A;  4D0P A;  5E17 F;  3M8F A;  1HBX G;  3DQV C;  3TGN A;  3E5U A;  4LB5 A;  4Q48 A;  2CGP A;  1E2X A;  1OYW A;  3P9K A;  3EDP A;  1H9G A;  2DW4 A;  4MEX F;  3GZ6 A;  1ZLK A;  1QGP A;  1SD6 A;  4Y15 A;  2L4M A;  4R79 A;  3QU6 A;  1TLH B;  1FSE A;  1BI2 A;  5L3G A;  3OOP A;  2OD5 A;  1ODD A;  3ABT A;  3JW4 A;  3WE2 A;  2P5K A;  4KIB A;  3J80 Z;  1G3Y A;  1J59 A;  4RB2 C;  2R7D A;  1R36 A;  5IT3 A;  5BPI A;  4A6E A;  3OV8 A;  1MD0 A;  5K1Y A;  1ZLJ A;  2QLZ A;  3N4M A;  3FM3 A;  3RDI A;  4ENJ A;  1D8J A;  2OA4 A;  2JTV A;  2KRF A;  1ZAO A;  4P9F A;  1KU2 A;  3CUQ A;  4KUM A;  2NYX A;  4BXU A;  1O7L A;  2V1D A;  5FLX Z;  1U5T B;  1KQ8 A;  2HYG D;  5FFZ A;  2EV0 A;  4LD5 A;  3P9C A;  3R60 A;  5ICE A;  1TBX A;  1ZHF A;  5FD6 A;  2G7U A;  3H92 A;  2RN7 A;  3R0J A;  3KEQ A;  3K1P A;  2EFN A;  2IA2 A;  3KP3 A;  3LAP A;  5L3B A;  4KT5 C;  4M6X A;  4HV6 A;  4JK1 X;  1T2K A;  5LGU A;  2DO7 A;  2ZME A;  3TDU C;  1IAW A;  2O03 A;  2YSR A;  1RUO A;  3GLX A;  1G4D A;  3F72 A;  2DPU A;  4YFX F;  3E6B A;  3F3X A;  2FEZ A;  2ZME B;  3FX3 A;  4DNC A;  3F6O A;  4QWQ A;  2YPR A;  2P7C B;  2IW5 A;  3RJP A;  1DP7 P;  1L3L A;  2DK8 A;  2K7L A;  5EEG A;  2PI0 A;  4IHS A;  3T0Y A;  3GYH X;  4I7H A;  5ILV A;  3V8J A;  1ZRC A;  2FQ3 A;  2E7X A;  4HA8 A;  2H6C A;  1U78 A;  3E6D A;  3TDZ C;  3SQN A;  1QZY A;  1EH6 A;  3BRO A;  4KFC A;  4I2O A;  5A2Q Z;  3LA3 A;  4LG0 B;  2XIG A;  5HLI A;  2OU2 A;  4OIQ F;  4LK0 F;  1T39 A;  2HYF A;  3FXQ A;  3TOB A;  5BS6 A;  5LGT A;  4UNO A;  1P6R A;  5ED4 A;  3SZP A;  2O61 A;  1PDN C;  3HRU A;  2XRN A;  4EM2 A;  3SZT A;  2V9V A;  4A0X A;  5HLH A;  3ECH A;  4EQQ A;  1E17 A;  5HLG A;  2PLY A;  1LEB A;  5KK1 A;  2QQ9 A;  3KLO A;  3O2P E;  2KJB A;  4RB3 C;  2JZY A;  1F9N A;  2PG4 A;  5D5U B;  5LGN A;  3JAM K;  3I64 A;  1GXQ A;  2LDU A;  3I71 A;  3IWZ A;  2DAO A;  1GVJ A;  3ROU A;  2F5D A;  1Z6R A;  5LHI A;  3J81 Z;  4AWX B;  5CVR A;  4BHB A;  2Z3Y A;  2MLK A;  2R7F A;  4I01 A;  2EJR A;  3GFL A;  3BZ6 A;  3TKY A;  4ENN A;  4E70 A;  2EV5 A;  4M73 A;  4PDK A;  2PN6 A;  4EJU A;  4OMZ A;  2EFO A;  4A5M A;  2L02 A;  2GXG A;  2VE8 A;  5ERI A;  1REP C;  3RYR A;  1G3S A;  2RKH A;  1S7O A;  1R23 A;  3F21 A;  2COM A;  3EUH A;  4LB6 B;  2XAQ A;  2CW0 F;  1BC8 C;  3C18 A;  4P5O A;  5FLX K;  2YU3 A;  4IF4 A;  3HUG A;  4G9Y A;  1C0W A;  3MFK A;  3IHU A;  1ZN2 A;  3GZ5 A;  1KQ9 A;  3WU1 B;  2VT3 A;  1MDM A;  4M6Y A;  1J9I A;  3I58 A;  3C7J A;  2FMY A;  3C3W A;  1WKM A;  3MAJ A;  4BNC A;  3LA7 A;  4BHP A;  4IRI A;  2F5F A;  4HOB A;  4RAZ A;  2ZO4 A;  2EV6 A;  4WWC A;  1U6G A;  2QQB A;  3K2Z A;  3LFK A;  3KP2 A;  2UZK A;  4OMY A;  2GIV A;  4A0Z A;  2ELH A;  4RGU A;  4A5N A;  3WG9 A;  5D5V B;  1FYK A;  4OIP F;  1FWZ A;  2Y75 A;  1YYV A;  2ZJ2 A;  5CLS A;  4CO8 A;  3LQR A;  3L00 A;  3V4G A;  2M87 A;  3FXR A;  2VXZ A;  1ZG1 A;  1YTY A;  1ZG3 A;  2DPD A;  3ZPL A;  1J5Y A;  3O6B B;  1O3T A;  2MA3 A;  3HRM A;  2NS0 A;  1IXR C;  3LA2 A;  1T98 A;  4KIC A;  4RS8 A;  4CGZ A;  3IRR A;  2O0Y A;  5BOX A;  2IA1 A;  1FBU A;  4S04 A;  3TO7 A;  1PP7 U;  2LF7 A;  1FY7 A;  3GF2 A;  4UUV A;  5E1Z B;  3VB2 A;  3WTW C;  2FML A;  3WU0 A;  3ABU A;  4I09 A;  4IPA A;  2GA2 A;  1TQI A;  2BBY A;  3MZY A;  3BOQ A;  3F8C A;  3VOE A;  1T6S A;  2K86 A;  4XSX F;  4YFK F;  4IRH A;  1UST A;  3RKX A;  4M72 A;  2OQG A;  3RTR A;  3GXO A;  1ZRF A;  1T38 A;  4JBA A;  3TO6 A;  4LLL A;  1U8R A;  2VBZ A;  2OQR A;  5E18 F;  1I6X A;  3M8E A;  2F2E A;  2MH9 A;  2Z9O A;  1IXC A;  5FGM A;  4HQE A;  5DDG A;  3MCZ A;  2IP2 A;  2FNA A;  5JFR A;  5DCM B;  1W5T A;  1R5H A;  1YQA A;  2VOD A;  5FB2 A;  1IN5 A;  4IHT A;  5AON A;  5LHG A;  2EWN A;  2ZNZ A;  3BP8 A;  1W7P D;  1U5T C;  2HEO A;  4HYE A;  1ZG5 A;  2E1C A;  1F1Z A;  4LG0 A;  4ESB A;  2ZBK A;  1G3T A;  5HVQ C;  2ZFW A;  3COA C;  3W6J B;  4PZJ A;  3HOT A;  5L3D A;  2PMU A;  4HLX A;  2M8E A;  3D0S A;  3B02 A;  3PQJ A;  1R22 A;  2ISY A;  1K78 A;  1J2X A;  2QM3 A;  3L09 A;  1QO0 D;  4H0E A;  1FNN A;  3K0L A;  3I59 B;  3ECO A;  2OZ6 A;  2Z33 A;  3ULQ B;  5JVT A;  1K6O A;  2TDX A;  3N97 A;  4CYD A;  4NB5 A;  2MLG A;  1O57 A;  1MZB A;  3FMQ A;  1TNT A;  1HKS A;  3GFM A;  4Q4Z F;  1O3R A;  1R1V A;  2PEX A;  1XSV A;  5J6X A;  4LK1 F;  4LJZ F;  3E97 A;  2PFB A;  4NHJ A;  2KKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...