4KDPA

Tcar-ssdna complex crystal structure reveals the novel ssdna binding mechanism of the marr family proteins
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords TcaR transcription regulator
publication title TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins.
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 41
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kdpA00
3NRVA 2FBIA 1F1ZA 4NHJA 1FSHA 4UUVA 4P9UA 1H9GA 5CVIA 1EH7A 1YS7A 2VXZA 4UV8A 3GF2A 1S7AA 1LJ9A 1ZARA 3W6JB 2CYYA 5D8KB 1T98A 1OMIA 4AD9A 4HF2A 1AOYA 2EFWA 5LHIA 2MH9A 1W7PA 3TOAA 4EJVA 5TRDA 2WV0A 4O5VA 3E6BA 1ON2A 2CG4A 1ZG5A 5AONA 2EFPA 2DK8A 2NAZA 3H3ZA 1XCVA 3F72A 4PZJA 2Q8KA 4MTDA 3JTGA 2NNNA 4CXFA 3HSEA 4WXHA 4E70A 1O7FA 4KNYA 2OZ6A 4HDUA 4JQFA 1R36A 5HDGA 2DI3A 2XROA 1KU7A 5JVTA 4KT5C 3J81K 3F3XA 1KQ9A 4L9NA 2JRTA 1KU3A 2MA3A 2DAOA 2P8TA 1G4DA 1YYVA 2V6CA 4EMSA 2YR2A 4LLNA 2Z9OA 3E5QA 2EWNA 2K02A 2UXNA 5HDKA 3PFIA 3F8BA 3KLNA 3HYIA 1S29A 2OQGA 2VODA 1RUOA 5LEJA 4KN7X 1OR7A 3SQNA 4ZYGA 5LRSA 5HS7A 3ZN0A 4L9JA 5HVQC 2EA4A 5E18F 1O3RA 2NRAC 4IRGA 2MBFA 3G3ZA 3TDUC 4MQVA 3E6CC 3VB2A 3QU6A 2JSCA 2OD5A 5LHGA 5L3EA 4UVBA 5CVJA 4A5NA 2CSOA 3J7AO 3NQOA 4GCVA 3WTWC 4L0YB 3HIFA 2XKOA 2DLLA 4D0PA 2A07F 3J80K 2HTJA 3HSRA 3VOEA 1TW3A 4KICA 2FBKA 4EVIA 1J59A 3GFLA 2DTRA 1H9TA 4ESJA 4CHUA 2FXAA 4N0BA 1FBUA 5DD8A 3IRQA 4ESBA 5LLQA 1EV7A 1Z1DA 4EJUA 4P55A 1K6OA 2ZO4A 3ISPA 3JTHA 3WE2A 1IF1A 1SD7A 5H20A 5D5UB 2ETHA 4YIIA 1UHMA 5LGNA 4PCQA 3L9FA 1REPC 4LMYA 4XSXF 1SMTA 4BYYA 2B0LA 2H09A 5IT9K 3HOTA 1XMKA 1LDKB 5D4RA 4ASNA 1AWCA 1IXRC 3FWEA 4AIHA 3K0LA 2PN6A 2QUFA 2ZMEB 1IZ1A 4QLCU 4FHTA 1ZRFA 1SFEA 4I0BA 3KZZA 5F64A 3MFKA 5FGMA 1JE8A 3F8CA 4HBLA 3OV8A 1B59A 4U0YA 1FZPB 3TO6A 5FLXZ 3WTYC 3EDPA 3MWMA 2E1CA 2FU4A 3R4KA 5DYMA 1I27A 4OIRF 1F4KA 2L3DA 3FM3A 4WCGA 2F5CA 1K79A 2VBWA 3GZ5A 2FA5A 1MDMB 4OIQF 2G9WA 2EA2A 4IRIA 1TNSA 2FOKA 5FFZA 4EV0A 3O3KA 2W84A 2PFBA 3HHGA 2H6CA 2VN2A 1IXSB 3R0JA 5K5QA 1XSVA 1KQ0A 4RB1A 2BEOA 2JTVA 1RIOH 2Y48A 3GXOA 2DFIA 4EM2A 3WTZA 2MD5A 3EYIA 1YIOA 4G94A 3F23A 1SD5A 4LB5A 1T38A 3PQJA 3RPQA 2FE3A 3WTSC 2HQNA 2JPCA 4RAYA 1ZLJA 3QPTA 2Z5UA 3TOBA 1FP2A 2DT5A 3Q9VA 5HLGA 4I0AA 1YFHA 3IKTA 2RKHA 1RUNA 4U0VA 1ZGAA 2PG4A 4MQ9F 5CLSA 3DQVC 2XAFA 2LNBA 2XUBA 4U7DA 1HW2A 2V1XA 4RB3C 4Q5SF 5KVRA 1QBJA 4KIBA 2FQ3A 1ZGJA 4M6XA 3ECHA 1OPCA 2QQBA 3ZPLA 3KP7A 1ZRCA 3E97A 1LVAA 1XGNA 2GXBA 2L4AA 2J5OA 5JFRA 3F8MA 3KFWX 3LFKA 4L18B 2ZKZA 3KP4A 1WI9A 2HFHA 4A2UA 1FC3A 2QVOA 2AXLA 5D5VB 3R60A 2Y0MA 2KKOA 2DK5A 4UVCA 1BM9A 5L3GA 2BE5F 2K7LA 3DF8A 1FPQA 2CQKA 4HW0A 1R23A 4A0ZA 2V79A 2NNYA 3BWGA 1G3TA 2DW4A 1ULYA 1FYLA 4LLGF 3GX4X 3ERED 4HLYA 3ZMSA 4I01A 1QO0D 4Q47A 4WXDA 5AIPA 1JHHA 2STTA 4EGYA 5E8GA 4L5IA 4M71A 5IT3A 2E7XA 4WX9A 4KA4A 4G7OF 4Q4ZF 3ZMTA 2OU2A 3JAMK 1J0RA 3QOPA 4HDVA 1ZRDA 4M9SA 1KU2A 4UXNA 3BY6A 2PJPA 1SFXA 3DPTA 5TJJA 3O2PE 2H6BA 4AWXB 3N4MA 1P4XA 2EFOA 4HAMA 3RDIA 5LGUA 3N97A 4HV5A 3WODF 3GYHX 4EM1A 4U0WA 1FBQA 3R0AA 1WWXA 2D1VA 2ZMEA 2QYOA 3T5XA 4M9ZA 1O57A 3E6MA 3F6VA 1LDDA 1YO5C 4Y13A 1IUYA 1S3JA 5L3BA 2HGCA 4OU0A 2IP2A 3KP6A 2FBHA 4Y17A 2O0YA 1QZYA 2EV0A 1W7PD 2O8XA 1BI2A 2OAZA 1DP7P 2X4HA 5DDGA 2ELHA 3CUQC 2EV6A 3I53A 3R6SA 1GVJA 3OOPA 4IRHA 2A6EF 1I1SA 1HXDA 1HKTA 4TV7A 2D45A 3AAFA 1JHFA 2O6GE 4KIFA 2HS5A 5E8IA 5A2QK 2IPQX 3DP7A 5JR3A 3CJNA 2VOPA 1WRJA 1DUXC 2J5PA 1HQCA 4M74A 3RKYA 2EV5A 5BPIA 2M5WA 3CUQB 2RQPA 3C7JA 3FX3A 1XN7A 1FSEA 1U78A 3FM5A 4JK1X 2K86A 3CO6C 1MKMA 2Z3YA 2ESNA 2R7FA 3QU3A 1GHCA 3HRTA 2W25A 3ZMUA 4UHTA 4RB2C 4GYIA 3L00A 2BV6A 2GQQA 3J81Z 3ZQ7A 2YPRA 3JSPA 5HS9A 2P7CB 2IW5A 3FXQA 3RKXA 4I7HA 1U3EM 1C0WA 1FNNA 4GXOA 1UFMA 4HX4A 3CDHA 4XSZF 2YX4A 2LDUA 3BPVA 1FX7A 3TKYA 4XRFA 1T39A 3WTVC 1ON1A 2JZYA 3I64A 2MLGA 1R7JA 6PAXA 3WTXC 1FBSA 1O3QA 2LKPA 1XDSA 5DUIA 4LB6B 4DNCA 4A0XA 4JBAA 3GLXA 1J5YA 4BQAA 2DBBA 3B73A 1BC8C 1PDNC 1RZ4A 4OIOF 4FT8A 3K69A 2QQ9A 3WU1B 1ZREA 1P4WA 4U88A 2QBYB 3ABUA 4LD5A 1ZH5A 4G9YA 3LQQA 1P2FA 2DQLA 1OYWA 2GAUA 2CGPA 3COAC 4LLLA 1BIBA 4K2EA 5E1WA 3J80Z 4B8XA 2VE9A 2Z33A 5E1ZB 1QZZA 2X0LA 5H6QA 4H0EA 2COMA 3BP8A 4ZYEA 2EB7A 1P4AA 3EETA 4BHCA 4MHGA 2E7WA 1S7OA 1K7AA 1W5SA 4UVAA 5ILVA 2NYXA 2ZXJA 1O7LA 2ISYA 2XAQA 3D5LA 3ELKA 1W5TA 2M8EA 4ESFA 1HKQA 5CVVA 3ZMZA 5L3DA 3WGHA 2D2WA 1ODDA 1TNTA 2TDXA 2G7HA 3ZN1A 1FY7A 1B9NA 2HR3A 1LB2A 5FO5A 1I1GA 2JPBA 3I5UA 1D5VA 4XLPF 5ICFA 4HQEA 3GFMA 5CVUA 3E6DA 5IT9Z 1D3YA 4UV9A 3TDZC 2P4WA 1BI3A 1P92A 4G6QA 3W6KB 3FMRA 3SZPA 4LGWA 1S6LA 1F5TA 3F6OA 2BYVE 2GZWA 5D5WB 3IWZA 4RS8A 2OBPA 2UXXA 5DCMB 3IL2A 1LEBA 1J2XA 1YTYA 3WGGA 1A04A 4OMZA 4ON0A 5JHUA 1IN5A 4FX4A 3Q5FA 3V8KA 1IN8A 1XGMA 2F5FA 2RNJA 2PMHA 2W57A 3FZVA 2H94A 1QQIA 2CWEA 3MEXA 2IJLA 2FMYA 2W24A 1WKMA 4PGGA 1MZBA 1QPMA 2ZNZA 4MEYF 1G3WA 3CUQA 5FD5A 3HRMA 2ZJ2A 2L54A 3LA3A 4BXUA 3FXUA 3BDDA 1U5TC 4IXAA 4BAYA 5BOXA 2BBYA 4ZZLA 2YSRA 1ZN2A 4ZZDA 1EH6A 2QWWA 1TLHB 3RYRA 3FXRA 3Q9SA 2HTSA 2XASA 2XAHA 5E1XA 1KA8A 1OYIA 1IRGA 4G7ZF 1K78B 1FWZA 5ILUA 4FX0A 2ACJA 2KJBA 5D6FA 1E17A 2P5VA 5KK1A 2GA2A 1W7PB 4R79A 2FMLA 1U5TB 5L3FA 4IJAA 2A61A 1O3SA 2XGXA 4UNOA 4LFUA 3G73A 4ENKA 5LBQA 1YS6A 3K1NA 1T0FA 1XB4A 5F1RA 4LG0B 4DQ2A 3DFGA 2PBIA 4NQWA 1BC7C 4P96A 2HWVA 3U2RA 2EK5A 5D5XB 3DV8A 1R58A 1R1TA 4G6DA 4M9XA 4RGRA 1VTNC 2QBYA 5LHHA 4L9TA 2KJCA 2DQRA 1V4RA 3LA7A 4N9HA 3CO7C 2Z99A 5CYVA 3K1MA 3BOQA 4OOIA 4RB0A 2C6YA 3WU0A 2STWA 1YG2A 2K4JA 4HF1A 4HV6A 4Q48A 4EJTA 1Z6RA 2HYFA 3SZTA 3KP5A 3RIRA 3I71A 2VT3A 3EUHA 3GFIA 3DKWA 1QNTA 4GYGA 1SAXA 2PI0A 3QP5A 3BJAA 1XGSA 2AS5F 2HOEA 5BPDA 1FLIA 5EEGA 2GIVA 4EM0B 5LRRA 5D6EA 3GVAA 3GZ6A 2XAGA 3P9CA 2PQ8A 3T8RA 3JAMZ 3DEUA 4G7HF 3VEPA 3RPUA 2KIUA 2LF8A 1W4MA 2RV8A 3FMSA 2WTEA 2M30A 4OINF 5DCFA 1UB9A 1YQAA 5D8LB 3V4GA 1XCBA 3M1EA 3GUDA 4ETSA 4LK1F 1USTA 2IT0A 4AIJA 4MNUA 3BJ6A 2ZFWA 5D4SA 3MAJA 1FYKA 2VONA 2MC3A 4PGHA 4ENJA 1J7KA 1ZLKA 1DDNA 1XSXA 3TGNA 2E1NA 3SHFA 2XAJA 2NS0A 4A6EA 1R5HA 1LNWA 5BS6A 2Y75A 1B1BA 1LEAA 1MJAA 4HOBA 3JSOA 2QM3A 1BI0A 3GEZA 2P6TA 2VBYA 1V3FA 3QP6A 4L5JA 1FP1D 4LJZF 4LK0F 3M9AA 5HDNA 1MDMA 2WWYA 1TBXA 4R1HA 4WXCA 1FOKA 1MJ9A 1YW9A 3GFJA 2CO5A 1WSUA 2M87A 4GGGA 1OYYA 3L7WA 4HA8A 1YW8A 2IA1A 4YFXF 5L3CA 2F5EA 2HZTA 5A2QZ 2GA1A 3P7NA 5HOOA 1P6RA 5ICGA 2A6HF 4WK8F 3U1DA 2QQAA 3KE2A 3RTRA 2VBZA 2FEZA 4ZH4F 4IVNA 2DPUA 4HZFA 1K78A 3SXYA 4U7BA 1XGOA 3B02A 4A12A 1IN4A 3E3VA 3F22A 3ML6A 4HX7A 3H3UA 4KMFA 1TQPA 4KFCA 1G3SA 1ONVA 1HSTA 3MZYA 2XRNA 3S2WA 4S04A 1U5TA 4BHBA 3F8FA 5F6FA 1U2WA 1XMAA 2VOOA 4Z2YA 1R00A 1ZG1A 2P5KA 2W85A 1H0MA 4WF2A 2PEXA 4L9VA 4KYWA 4LG0A 3T0YA 1EH8A 2M45A 2V1UA 2A3SA 1R1UA 3CUOA 4HYEA 4NB5A 3WTUC 1NHAA 4O3MA 2RN7A 3P9IA 2LF7A 1GXQA 2QZ8A 1IRFA 2XKPA 3MZHA 1T2KA 2RC4A 2QENA 4AVPA 3KCCA 2O61A 4KMUX 3F8NA 3REOA 4CDGA 2K27A 1KGSA 4A5MA 1Z91A 3DPLC 2GWRA 1FT9A 3IRRA 3KEQA 1BOAA 4YG2F 3WG9A 1F9NA 4RGUA 3KEOA 4YFNF 5CJ9A 1Y0UA 2GXGA 4IHTA 3HRSA 4CYDA 5HS8A 1KU9A 4YFKF 2P5LC 3WGIA 2MH2A 4BHPA 4MEXF 1X3UA 2HQRA 1I6XA 2V1DA 4I02A 2XVCA 5ICEA 2XHKA 4ENMA 1Q1HA 4EJWA 2JT1A 3LA2A 2HKXA 3V8LA 3IC7A 5FFXA 2L4MA 1B6AA 4AIKA 3GW2A 4MGRA 1QGPA 3C3WA 3QAHA 3R61A 3LAPA 1FYMA 3HOSA 2EFQA 3E5XA 4B09A 3I59B 2IA0A 4I2OA 3NEUA 3U9GA 3EYYA 2LSOA 4CZZA 1J9IA 1IAWA 1ZG3A 3I58A 1LQ1A 3HSFA 1TQIA 4BH9A 2V9VA 2A5YB 2XIGA 3PQKA 1CF7B 2BGCA 2FRHA 3KETA 5K5RA 3TO9A 3L2CA 3LQRA 3BROA 3M7GA 5J8FA 4ENNA 4EQQA 3HHHA 4WWCA 4L0ZB 5ILSA 5DD4A 1CGPA 3IWFA 1B9MA 2P7VB 3MCZA 3RYPA 5E20A 5HLIA 2F5DA 4PDKA 1DPRA 2FSWA 2M1BA 2ZBKA 3P9KA 1XSDA 4IF4A 1GXPA 3FMQA 4KIGA 3E5UA 3C1DA 1MGTA 2ZNYA 3HUGA 4OIPF 3TO7A 1XD7A 4P9FA 2G7UA 3V7CA 3GO5A 1DPUA 2DU9A 2FNAA 1D8JA 1O3TA 1T6SA 5LGTA 1Z7UA 5HLHA 2HEOA 4XBFA 4IHSA 3FHZA 3MQ0A 3M8FA 2UZKA 4N9IA 1E2XA 1L0OC 1PP8F 1HSJA 5DUKA 3V7SA 1SFUA 4BNCA 2CFXA 2Q0OA 2XV4S 5FLXK 2PLYA 5ED4A 1UHWA 3M8EA 5FD6A 4S05A 1ZAOA 3T8TA 2ZCWA 2RVCA 1J75A 1R22A 4Y15A 4M72A 2HKOA 5H6RA 4I98B 4ZYDA 1JXSA 1R5GA 2HYGD 3ECOA 3ZMVA 3ROUA 5EEHA 1TTYA 2ESHA 3T1BA 1Z05A 3SFZA 1BBYA 1OKRA 4M73A 2KRFA 1ZYRF 3ABTA 5CVRA 5LEKA 1Z6TA 2OQRA 4YIFA 4HX8A 3K1PA 3LWFA 3VFZA 3L09A 2Q2EA 1TW2A 4GO1A 2K4BA 1KQ8A 3DXJF 3ULQB 4R8HA 3LAJA 2VC0A 2PMUA 1SD4A 3KZYA 2YU3A 4QWQA 4EGZA 2R7DA 4XLNF 3HRUA 1HBXG 3CTAA 3KLOA 1HKSA 4HLXA 4EJOA 5E17F 2DPDA 4I09A 4O6JA 4KUMA 4A0YA 1I5ZA 4IPAA 3KP2A 1YLFA 5K5OA 5DEQA 2A68F 1BJAA 1IN7A 2FF4A 3VODA 2VBXA 3IKVA 3WE3A 1RI7A 5AIQA 1ZHFA 4F7ZA 4RAZA 3RJPA 1XDUA 1PP7U 4RGXA 3BJOA 1G6NA 5BMZA 2O03A 2R3SA 1KYZA 3K2ZA 1UCRA 3RI4A 2QLZA 4HQMA 5DV5A 3BZ6A 2IVMA 5K1YA 5J8CA 1IW7F 2OZUA 2HDCA 3I59A 2VT2A 3D0SA 1LDJA 5ERIA 2KIFA 1MD0A 3ZP5A 3I4PA 1BIAA 3TQNA 2ADUA 1YW7A 2O3FA 5FB2A 3I0TA 4M6YA 1HW5A 2YX7A 1CF7A 1MJBA 5BQTA 3HTSB 1S8NA 3CLOA 3K9TA 4CICA 3BPXA 5J6XA 3O6BB 4HF0A 1IXCA 2FNPA 3I54A 1STZA 1L3LA 2UWMA 2ISZA 3GWZA 4KN4X 1WQ2A 3V7RA 1PUEE 3H92A 1R1VA 4ZYHA 2WC2A 3LSTA 2D1HA 1JGSA 2A69F 1IN6A 2L01A 3ZMDA 3HTUA 3JW4A 3FF5A 1D8KA 5DCMA 1G3YA 1Z9CA 1HW1A 3EQLF 2IRFG 4CGZA 2CW0F 3QRFF 1TQMA 4A6DA 4MTEA 1B4AA 1SMYF 2P6SA 2RDPA 5JI6A 4OMYA 2L02A 1U8RA 1SD6A 2VC1A 2DO7A 2F2EA 1BI1A 3V8JA 1KYWA 2OA4A 5ICCA 2MLKA 3QPHA 2RGVA 3RKWA 4CO8A 3C18A 4P5OA 4G8XA 3F21A 1BN5A 1U6GA 4RGSA 3KP3A 2VE8A 1USSA 3WTTC 2H27A 4KDPA 2EFNA 2EJRA 1RNLA 2IA2A 3IHUA 2KIMA
chains in the Genus database with same CATH superfamily
1XTAA 1DGWY 4ABZA 2R7WA 3NRVA 2FBIA 1F1ZA 5IY5H 1VNDA 4NHJA 1FSHA 4UUVA 1B8IB 2E19A 1PJRA 4P9UA 1H9GA 2VUMJ 1Z7LA 5CVIA 5M3MJ 1EH7A 1YS7A 2VXZA 4UV8A 1X58A 2R4GA 2JQ7A 3GF2A 1S7AA 1LJ9A 1ZARA 3W6JB 2CYYA 5D8KB 1T98A 5J47A 1OMIA 3ASNH 4AD9A 4A3KJ 2BY0A 4HF2A 4ZJZA 1AOYA 2EFWA 2CW7A 5LHIA 4YEJA 1QA6A 3OYCA 2MH9A 2ELKA 1W7PA 3TOAA 4EJVA 4RAGA 3MKZA 5TRDA 2WV0A 4O5VA 3E6BA 1D1AA 1ON2A 2CG4A 2WADA 3CESA 1ZG5A 5AONA 2DN0A 2EFPA 1YRNA 2DK8A 3S1MJ 2QSFX 2UUZA 2Y30A 2NAZA 3G4SI 3H3ZA 1XCVA 4C9YA 1OQYA 3F72A 5HNFA 4PZJA 2Q8KA 4C2TA 4MTDA 4NC6A 3JTGA 2NNNA 4PSXA 4CXFA 1VQKI 3HSEA 4WXHA 4E70A 3S93A 1O7FA 2FJ1A 5FKNA 4DGWB 3HOXJ 4KNYA 2OZ6A 4HDUA 4JQFA 9ANTA 1R36A 5HDGA 4FETA 3FXJA 1FMVA 2DI3A 1MW7A 1I39A 2XROA 1BR1A 3BCAA 1KU7A 5JVTA 2H8WA 3BG6A 4KT5C 4Z6YA 5FJ8J 2CW8A 3J81K 3LOCA 3F3XA 1KQ9A 2OV7A 3K2AA 4L9NA 1OISA 3GTLJ 2JRTA 1SVLA 4IOAF 1KU3A 2MA3A 2DAOA 1QHGA 3VSLA 2P8TA 2F4IA 1G4DA 3Q3SA 1YYVA 2HXIA 2LTPA 2Y69H 3H35A 3I4NJ 2V6CA 4EMSA 2YR2A 4LLNA 1JTYA 2EZHA 2VPLA 3VYRB 2Z9OA 3E5QA 2EWNA 3HOYJ 1Y39A 1XS9A 2NVUB 2DOAA 2K02A 2UXNA 5HDKA 3PFIA 5FKLA 2WY7Q 3HDDA 2NOGA 4CCNA 3F8BA 3KLNA 1DU6A 3LSMA 1IGNA 4JP0A 2DDBA 1V54H 3HC7A 2DFHA 3HYIA 3LMMA 1S29A 4QIWN 2OQGA 4RMNA 2VODA 1RUOA 5LEJA 1N77A 4KN7X 4NQWB 4BBRJ 1OFCX 1OR7A 2BY2A 3SQNA 3HM5A 4ZDPA 1X2NA 4ZYGA 4IKFA 1DGRM 2JWTA 2G0EA 5LRSA 5HS7A 3ZN0A 3GTGJ 2E2JJ 4L9JA 5HVQC 2EA4A 5E18F 3QPSA 1O3RA 4B3XA 3P5JA 2NRAC 1ZGWA 4BJ5C 4IRGA 1OCTC 3PIPF 2MBFA 3G3ZA 4ITVA 3TDUC 3D1NI 4MQVA 2TRTA 2LK2A 3E6CC 3VB2A 3A02A 1W36D 2QKLB 1G59A 3QU6A 2JSCA 4UUTA 3RCOA 5CKTA 2MSYA 2OD5A 5B66C 1QPIA 1JI8A 5LHGA 5L3EA 3QQAA 3FXMA 4UVBA 5CVJA 2K9LA 4A5NA 3BR0A 4MFDA 2CSOA 3J7AO 1YX3A 1P7IA 3NQOA 4GCVA 3WTWC 2BXYA 2HI3A 1U8BA 4L0YB 3SEQA 3ZRGA 3HIFA 2XKOA 2DLLA 5FKKA 4D0PA 2A07F 3J80K 2HTJA 3HSRA 5HNHA 2CRGA 4KISA 3VOEA 2EQRA 2E2HJ 4A3BJ 2M0CA 1TW3A 2AXTC 4KICA 2FBKA 1WGXA 3K70C 3TMOA 4EVIA 3TBIA 1YJ9I 1J59A 3GFLA 3HOZJ 5HODA 2IS6A 3KIOA 1LVKA 2DTRA 2HXOA 1H9TA 2X6OA 3C2GA 2KRHA 3HPHA 4ESJA 3LSPA 4CHUA 2FXAA 4N0BA 4DIQA 1FBUA 3K6GA 3ABKH 5DD8A 4B4CA 5F0HA 3IRQA 2JA6J 1TWGJ 4ESBA 2IAIA 5LLQA 4HNTA 1EV7A 1Z1DA 3S15J 4P55A 4EJUA 1K6OA 2ZO4A 3ISPA 2CH0A 3S3MA 2CFOA 3JTHA 3WE2A 1IF1A 1SD7A 1E0EA 1Y0NA 2LVSA 1APLC 5H20A 3VDXA 5D5UB 1MBFA 2ETHA 2E5NA 2ZMEC 2KLOA 3BTIA 1LE8B 2XF5A 4RA2A 4YIIA 3CMEI 3G1OA 1UHMA 3DEEA 5LGNA 4PCQA 4HNUA 2M9HA 3L9FA 1REPC 4LMYA 4XSXF 3OYFA 3DTKA 3S14J 1SMTA 5F08A 2E35A 2IXSA 3LNQA 1I3QJ 2O5RA 4MLOA 4BYYA 1FOYA 2DFEA 2B0LA 2H09A 3VYUB 2WY8Q 5IT9K 3HOTA 3CC2I 1XMKA 1LDKB 2M34A 3DLAA 5D4RA 2JVHA 4ASNA 3JRHA 4E7LA 2F48A 3HKZN 1IXRC 3FWEA 4AIHA 3C2HA 1AWCA 1TL8A 1V55H 2QA4I 3K0LA 5FRMA 2PN6A 2QUFA 3RSNA 2ZMEB 2HVQA 1SEUA 1IZ1A 4QLCU 1VQLI 4FHTA 2XGCA 5IYDJ 1ZRFA 1SFEA 4I0BA 1N78A 2NOJB 3KZZA 1FIAA 5F64A 2LREA 3MFKA 5FGMA 3HKZA 4CCOA 3A0BC 1JE8A 3F8CA 1MNMC 4HBLA 5TISC 3OV8A 4E7KA 4AVZA 1B59A 4U0YA 1FZPB 4PFOA 3TO6A 5FLXZ 4RLQA 2V9KA 3EDPA 3WTYC 1K4SA 4XNFA 3MWMA 1SFOJ 2E1CA 1S5LC 2FU4A 3DCFA 3R4KA 5DYMA 1I27A 4JOMA 4OIRF 1F4KA 2L3DA 2HOAA 3FM3A 4WCGA 2F5CA 1K79A 2VBWA 1T08B 3GZ5A 2FA5A 4C2MJ 1MDMB 4OIQF 3CZ6A 2G9WA 1QZEA 2EA2A 3HXLA 1LUJB 2X51A 4IRIA 1TNSA 2FOKA 5FROA 3OYEA 5FFZA 3QYBA 1ETQA 1T8IA 5FLVA 5C4XJ 1POGA 4EV0A 3ZQFA 3O3KA 2DT7B 2W84A 4IHXA 1U9OA 2PFBA 3HHGA 2VQHA 4NC8A 2H6CA 2NVQJ 1NK3P 2VN2A 1BJZA 1IXSB 3R0JA 1P7JA 5EYRA 2BVMA 5K5QA 2LBFA 1XSVA 1KQ0A 2X1DA 4XRMA 3OY9A 4RB1A 4EEFG 5EG0B 2BEOA 3F0CA 1VZ0A 3OWTA 2W00A 2JTVA 1RIOH 2LFBA 2Y48A 3GXOA 4HG2A 2DFIA 1W1WE 4X6AJ 4XRSG 3ZOBA 4EM2A 1NG6A 3WTZA 2MD5A 5CPRB 3EYIA 1I3AA 1YIOA 4G94A 2VJJA 4E4HA 3F23A 1SD5A 4DZJA 4LB5A 1T38A 1IUFA 2FX0A 3PQJA 2K85A 3QODA 1ITYA 3RPQA 2FE3A 2M4KA 2CV0A 4C30A 2DMPA 3UNGC 3WTSC 2E71A 2HQNA 2JPCA 4RAYA 4V2GA 1ZLJA 3OS2A 3G71I 3WG7H 3QPTA 2Z5UA 1TWHJ 3TOBA 1FP2A 2DT5A 3Q9VA 1MMGA 3I9V2 5HLGA 4I0AA 3U21A 1YFHA 3IKTA 1ERDA 2RKHA 1RUNA 1A6QA 2ZFUA 4PK4A 4U0VA 1ZGAA 1S72I 2PG4A 4MQ9F 3CF5F 5CLSA 1X3ZB 2F5VA 2KDOA 2UV1A 5FRNA 3DQVC 1I50J 2XAFA 2R7RA 3PJRA 2LNBA 2XUBA 4U7DA 1HW2A 3MD2A 4B47A 2ZXWH 5HLTA 3LL7A 5H2FC 3W2WA 2V1XA 1WH5A 4RB3C 4Q5SF 1M1EB 2CQNA 4D9JA 4V2FA 2NS8A 5KVRA 2XRLA 1QBJA 2XGEA 4BXFA 4KIBA 2FQ3A 3TEDA 1OCPA 1Z0XA 1ZGJA 2X6YA 4M6XA 3ECHA 3RZOJ 5IOYA 1OPCA 2QQBA 3ZPLA 4X1EA 3KP7A 1GLNA 3JCUC 2HYJA 1LVAA 2JJ7A 3E97A 1ZRCA 1XGNA 2GXBA 2L4AA 4J00A 2J5OA 2VJ4A 2HOTA 5JFRA 3F8MA 1WJFA 3KFWX 4D1QA 1S7EA 2L7MP 2E2IJ 3LFKA 4RBOA 1G8XA 5CQEA 4HEA2 2A05A 1QVTA 2ZKZA 4L18B 2ME0A 3KP4A 1WI9A 2HFHA 3LSRA 4A2UA 1FC3A 2MD0A 2QVOA 2GLOA 4AM3A 4AYBN 2AXLA 5D5VB 2XAUA 3R60A 2XB0X 2Y0MA 4D5CA 3RZDJ 2KKOA 2DK5A 1PUFB 1RC9A 1N25A 4UVCA 3K10A 1BM9A 5L3GA 1JUPA 2BE5F 2K7LA 3QPLA 4D7NA 3DF8A 1FPQA 4B43A 2CQKA 4HW0A 1R23A 4A0ZA 2VXDA 2V79A 4U87A 2NNYA 1DP3A 5B5EC 2BHZA 3BWGA 1QHHD 3ZCOA 4AYBA 1RESA 1G3TA 3HG9A 1Z3XA 2DW4A 1ULYA 3HPGA 1FYLA 4LG3A 4LLGF 1WCMJ 4BE0A 2K9SA 3GX4X 2W7NA 3BZCA 3ERED 2JA8J 4HLYA 3CDLA 3ZMSA 1S9HA 4I01A 5IYCJ 1QO0D 4Q47A 4WXDA 3I56I 2DDAA 2WA0A 1JHHA 5AIPA 2STTA 4EGYA 5E8GA 4BDZA 4IO9F 2DA1A 4II3A 4L5IA 4M71A 5IT3A 2E7XA 1VQ5I 1YIJI 4WX9A 4A3FJ 5IP9J 4KA4A 3DPUA 3ZR8X 4G7OF 4Q4ZF 2ELJA 3ZMTA 2OU2A 1TT0A 3JAMK 1J0RA 3NAUA 3CCYA 3K4JA 3FKJA 1ETWA 3H9QA 3QOPA 2QCOA 4HDVA 1HCRA 1ZRDA 4XLEA 4M9SA 3PSIA 1KU2A 4UXNA 3BY6A 2PJPA 1JT6A 1SFXA 2EIJH 3K4MA 2XPVA 3DPTA 3H5AA 3A1YA 5TJJA 5E3LA 3O2PE 2H6BA 5M5XJ 4AWXB 5BNGA 3N4MA 1P4XA 2BW3B 3K4KA 2DOFA 2EFOA 4HSTA 2EIMH 4A3EJ 1WJEA 4HAMA 3RDIA 3MKYB 4M6VA 2YUSA 5LGUA 3N97A 4HV5A 1OJLA 2KHMA 1IDZA 5EGOA 3WODF 1K83J 1RR8C 1TT5B 3GYHX 4EM1A 3BT9A 2XF6A 3Q0UA 4U0WA 5GPCA 4RDUA 2ZB9A 1FBQA 3BR3A 1WWXA 3BZKA 3R0AA 4PUSA 2D1VA 2ZMEA 2QYOA 2KQRA 3T5XA 3H9JA 3LSKA 4M9ZA 3JRDA 1T33A 1O57A 2ZXIA 2M0MA 3FBIB 3E6MA 3F6VA 1LDDA 2JN6A 4CCLA 1YO5C 2X9DA 1W0UA 3BR6A 2IGMA 4Y13A 1IUYA 1S3JA 5L3BA 4XOPA 2HGCA 4OU0A 1VQ6I 2VB6A 3DBLB 3K4BA 4XK4A 4MIMA 2IP2A 1D5YA 1Y6IA 3KP6A 3S17J 2FBHA 1I6HJ 3A4CA 4Y17A 5KAIC 4BQQA 2O0YA 5IOZA 2RQQA 1QZYA 4B48A 2EV0A 1W7PD 2R92J 2KISA 2O8XA 2V6EA 1BI2A 4LIUA 4ZDLA 3TL4X 4F55A 2JSPA 2OJED 2XDVA 4QTRA 2XSDC 2OAZA 1DP7P 2X4HA 3OYKA 5DDGA 2ELHA 3KYDB 4PJMA 4IEJA 2QGUA 3CUQC 2EV6A 3I53A 3R6SA 3IH2A 1GVJA 3CF2A 2L7KA 3OOPA 3BTJA 4IRHA 3W2VA 3GTQJ 2A6EF 1I1SA 1OCZH 5B1AH 1HXDA 2XPWA 2QSHX 1HKTA 4TV7A 2LY1A 2D45A 3AAFA 1Y8RB 1JHFA 1V5FA 2O6GE 4KIFA 2B7EA 5JHFA 2HS5A 5E8IA 4B3AA 4UUSB 5A2QK 3G1MA 5EG0A 3M4OJ 2IPQX 3DP7A 5JR3A 3CJNA 2VOPA 1WRJA 3GTOJ 1Z3YA 2CQ7A 4IQJA 2L7FP 1ZR4A 1DUXC 2PX9A 3BQYA 2J5PA 3AG3H 1HQCA 1YJWI 4M74A 3S1RJ 3DKXA 3RKYA 2EV5A 2AHQA 5BPIA 2K9MA 2M5WA 4YIRX 3L2WA 3CUQB 2RQPA 3C7JA 3L2QA 3FX3A 1XN7A 3S1NJ 1FSEA 2VLAA 1U78A 4B44A 3CP2A 3FM5A 2X1EA 4JK1X 2K86A 2MGQA 3CO6C 1MKMA 2XF7A 3VYTB 2K9QA 1OLTA 2LC2A 1YX5A 2Z3YA 2ESNA 4XKCA 2CQQA 4ZDOA 2R7FA 3GTPJ 3QU3A 1GHCA 3HRTA 2HOSA 2W25A 1NK2P 2R7VA 2CS3A 2XB5A 1MSEC 3ZMUA 4UHTA 1XMXA 4C3JJ 5GAGJ 4RB2C 2L0KA 4GYIA 2VQLA 5GP9A 3L00A 3LSIA 1VQ9I 1X1BA 4HSRA 2BV6A 2R7QA 3H5NA 4ZTJA 1T0FC 2GQQA 3J81Z 1MBKA 3FISA 3ZQ7A 1G2HA 1R4NB 2YPRA 3JSPA 2R7UA 5HS9A 4CZCA 2P7CB 2IW5A 2VJIA 2KP6A 3FHNA 1ENHA 2LYCA 3FXQA 3GCMA 4M3DA 3PM1A 4ANJA 3RKXA 1EKEA 3Q0WA 1D0ZA 4I7HA 3I4MJ 2DA6A 1U3EM 1C0WA 1FNNA 4GXOA 1UFMA 3OL4A 4HX4A 2W1OA 1U0JA 4XMYA 2KFDA 3CDHA 5KNLA 2EBIA 2M8GX 5J4YA 4XSZF 2YX4A 2LDUA 4G12A 3JRAA 3BPVA 1FX7A 3TKYA 4XRFA 1WI3A 1AKHA 1XG1A 1T39A 3WTVC 2ZJQF 1ON1A 2Q2EB 4BU2A 2JZYA 2V7FA 3I64A 2MLGA 4J01A 1R7JA 6PAXA 3WTXC 1FBSA 2BVLA 3OR2C 1O3QA 2DYRH 2OCCH 2LKPA 1XDSA 4BUPA 5DUIA 4LB6B 4DNCA 4A0XA 4JBAA 1MH3A 3GLXA 1J5YA 4BQAA 1PUFA 2DBBA 2EIKH 1XC5A 3B73A 4M3GA 1BC8C 1PDNC 1RZ4A 4OIOF 3EUHC 4AU7A 2JUGA 4FT8A 3PNVA 3K69A 3UR3C 2QQ9A 3J7YJ 3WU1B 4A3GJ 2LLKA 1ZREA 3OR1C 1P4WA 3CMYA 3DTIA 4U88A 2DYSH 2QBYB 1HC8A 4GFBA 1RR7A 3ABUA 4LD5A 1ZH5A 3ZQCA 4G9YA 1MMAA 3LQQA 1P2FA 2F4MB 2DQLA 1DU0A 4A69C 1MNDA 1OYWA 1GVDA 2GAUA 2CGPA 3COAC 2DJIA 5E79C 2VQGA 2JA2A 4LLLA 1EF4A 1BIBA 4K2EA 5E1WA 3J80Z 2LRDA 4B8XA 1SVMA 2VE9A 2Z33A 5E1ZB 1QZZA 2X0LA 5H6QA 4H0EA 4NNJA 2COMA 2PMZN 3BP8A 4ZYEA 2Y2ZA 2YS9A 2EB7A 1P4AA 3EETA 4BHCA 4MHGA 2E7WA 1S7OA 1XX5A 1K7AA 4OAZA 1FMWA 1WJBA 1U9NA 1W5SA 1GUUA 4UVAA 5ILVA 3OYIA 4BBSJ 1TWCJ 1P9QC 2NYXA 2ZXJA 4DYCA 3DBRB 1VQPI 3FKIJ 1O7LA 2ISYA 2XAQA 4PFPA 3D5LA 1IDYA 2PMZA 2OF7A 2QF7A 3ELKA 1W5TA 2M8EA 2X1CA 4BEHB 4ESFA 1HKQA 4LIVA 4W1UA 2ECCA 5CVVA 4XIDA 1F36A 3J7AY 3IAM2 2BW3A 3KPHA 3ZMZA 4IHWA 5L3DA 1IRXA 5GAEJ 2RAEA 3WGHA 2D2WA 1ODDA 2IGNA 1TNTA 2R93J 2TDXA 1FTTA 2G7HA 3EPZA 3ZN1A 4N4NB 5DS9A 1FY7A 1B9NA 2HR3A 1LB2A 5FO5A 2WV1A 1I1GA 1IRZA 3HZJA 2JPBA 1WFXA 1VFCA 3JREA 2IS4A 3KYCB 2IS2A 1TWFJ 3AG2H 3I5UA 2KRCA 1D5VA 4XLPF 1B72B 4M3FA 5ICFA 4HQEA 3OYMA 3C2BA 1ACIA 2E1MC 4IHYA 2WAFA 5GAHJ 3GFMA 3IH4A 3PUFA 5CVUA 3E6DA 3RKQA 5E3NA 3IAS2 3FK7A 5IT9Z 1D3YA 1HDDC 4UV9A 3TDZC 2P4WA 3FXKA 4DW6A 1BI3A 1P92A 4P1WA 3TW6A 4G6QA 3LFUA 3W6KB 2NVYJ 3FMRA 1FJLA 3SZPA 4LGWA 1S6LA 2VQCA 1F5TA 3F6OA 4AUXA 3CLQA 2R7TA 3OYJA 2R5ZB 2BYVE 2GZWA 5D5WB 3IWZA 4RS8A 2OBPA 2UXXA 5DCMB 3H9GA 3IL2A 2X6XA 2HDWA 1LEBA 2EINH 1J2XA 2V26A 1YTYA 1B8IA 3E0JB 3WGGA 1A04A 4OMZA 4ON0A 3OYGA 2E1MB 5JHUA 1IN5A 1HA8A 4FX4A 4CCMA 3V8KA 3Q5FA 3ABLH 4I6ZA 2MC4A 2XPUA 1YOVB 2VPRA 4UUSA 1IN8A 1XGMA 3BG9A 2F5FA 4I76A 2RNJA 2PMHA 2W57A 1FOWA 3GTMJ 3FZVA 2H94A 5F0FA 1QQIA 2CWEA 1GT0C 2MG4A 3MEXA 3H0GJ 1MBEA 2IJLA 2VI6A 2FMYA 5DTDA 1ZK8A 4XKBA 3OMYA 3CMMA 2W24A 1WKMA 4PGGA 3LSJA 3GTKJ 1MZBA 3BG3A 1QPMA 2LG4A 4KT6A 2FOWA 5C4JJ 4BQOA 2ZNZA 1BW6A 2Q1ZB 2GBYA 4MEYF 3U1KA 3ERMA 1G3WA 3CUQA 2Y9ZA 3AL0C 3DBHB 5FD5A 3HRMA 2ZJ2A 3K4NA 2L54A 3LA3A 4F91B 2X85A 4BXUA 4DJAA 4XLFA 3FXUA 2EZLA 1U5TC 3BDDA 4IXAA 3ZQGA 4BAYA 5BOXA 3MN2A 2BBYA 4ZZLA 4UB6C 4BQNA 2YSRA 1ZN2A 3WHBA 4ZZDA 1EH6A 2QWWA 1TLHB 3RYRA 2M2EA 3FXRA 3Q9SA 2HTSA 4ZYAA 2XASA 2XAHA 1A31A 5J4VA 3F9KA 5E1XA 1KA8A 1GV5A 1OYIA 4HNVA 3LSHA 1TC3C 2KL4A 4NBQA 4XLHA 1IRGA 4G7ZF 2DT6A 3ZQIA 1RKWA 3A0HC 2CU7A 1K78B 1FWZA 5ILUA 4FX0A 3LSGA 2GOMA 5DM6F 2ACJA 2K3FA 2DTZA 4HPQA 1PYVA 4I99C 2KJBA 5D6FA 3AL0B 4Y7NJ 1E17A 3SFIA 1V5EA 1XPXA 2P5VA 1CQTA 1T95A 3MMYB 3BR1A 3H36A 1X4PA 5IYBJ 5KK1A 2GA2A 1W7PB 1BA5A 4R79A 1E3HA 2FMLA 1U5TB 5L3FA 1H88C 3OYBA 1KZHA 5K7ZA 2K3PA 2CUJA 4IJAA 3IP4B 1YRNB 1SAUA 2A61A 1O3SA 2XGXA 4GDFA 4UNOA 2E1OA 2DMTA 4LFUA 5J1UA 3G73A 2BY1A 4ENKA 1WHUA 3A03A 3CJQB 5LBQA 1YS6A 3H3VK 3K1NA 4XORA 2F4OB 2AQFA 3CCQI 1T0FA 1W5CC 4PSWA 4IOCF 1XB4A 2N8GA 5F1RA 4E7HA 4LG0B 1ZELA 4DQ2A 1JKOC 3DFGA 2PBIA 4NQWA 3CC7I 1JUMA 2O9LA 4UB8C 2M7BA 3GZNB 1BC7C 3E1SA 4P96A 2HWVA 2NVTJ 3U2RA 2EK5A 3QOEA 5M5YJ 5D5XB 3OYNA 1RPWA 3DV8A 1R58A 1R1TA 4G6DA 1VQOI 4M9XA 1IG7A 4XOTA 1R6RA 5F04A 4RGRA 1ETOA 4C3HJ 1VTNC 3L2VA 2R7OA 2QBYA 4QPQA 5LHHA 2L9SA 3HEFA 1WJ5A 4L9TA 3WHCA 2KJCA 3OIQA 2E60A 2KMUA 4DYQA 2DQRA 1V4RA 3LA7A 4N9HA 3CO7C 2Z99A 3PO2J 4RM2A 3TP0A 5CYVA 3K1MA 3BOQA 3W6VA 4OOIA 3VWBA 2WAQN 1QU3A 1WJAA 4RB0A 2C6YA 3WU0A 3KZIC 2STWA 1YG2A 2HQ5A 2K4JA 3SZGA 4HF1A 2DA7A 4IHVA 3OIPA 4HV6A 4Q48A 4FASD 4EJTA 1Z6RA 2DMNA 1FEXA 5EZHA 2HYFA 2WAQA 3L1PA 3SZTA 2HPMA 3CCSI 3KP5A 3RIRA 3I71A 2VT3A 3EUHA 3JRCA 3GFIA 2BY3A 3DKWA 2HVRA 1QNTA 4GYGA 4W97A 1IV6A 1SAXA 2L5QA 3HL2A 1MMNA 3G1LA 3G6EI 2L9NA 2PI0A 2COBA 2CUZA 3QP5A 1ZR2A 3BJAA 1R9TJ 1XGSA 2AS5F 4BKXA 4BEHA 2Z1DA 3S16J 2VKEA 2HOEA 5BPDA 1FLIA 5EEGA 2GIVA 2ME6A 4EM0B 5LRRA 5D6EA 3GVAA 1R4MB 2DA5A 5J1YA 3KYLA 1VQ4I 3GZ6A 1BR2A 5F27A 5IPAA 3NARA 2QEXI 1W36C 1YE9A 2P81A 2XAGA 4JYKA 1BW5A 3P9CA 2PQ8A 1E3PA 3T8RA 5J3LA 2JVGA 3JAMZ 1SC7A 3DEUA 4G7HF 3RPUA 3VEPA 1LE8A 2KIUA 2LF8A 1W4MA 2RV8A 3FMSA 2WTEA 4XR6A 2M30A 2Z16A 4OINF 4H4KC 5DCFA 3S1QJ 1UB9A 1YQAA 5D8LB 2HPIA 1HOMA 2LMDA 2LR8A 3V4GA 4A3LJ 2CJJA 1WJDA 1XCBA 3M1EA 3GUDA 4QSHA 1ZQ3P 4ETSA 2GIZA 1Y1VJ 3JR9A 1OCOH 3JRBA 1Y1WJ 1Z21A 4LK1F 1USTA 1UHSA 2IT0A 3PNYA 4AIJA 5JVGF 3H5RA 5M3FJ 4MNUA 4N4OB 3BJ6A 2ZFWA 2HVSA 5D4SA 1UJ8A 1ZKGA 4KITB 3MAJA 1FYKA 2VONA 2MC3A 4PGHA 4ENJA 1J7KA 2GM4A 4XONA 3O8GA 1ZLKA 1DDNA 4XLCA 1A5JA 1XSXA 2ZSHB 3A01B 3TGNA 2R5ZA 2E1NA 3SHFA 2XAJA 2P0WA 2NS0A 4RLFA 1R5HA 2E34A 3ONQA 4A6EA 1LNWA 5GADJ 4L5EA 5BS6A 2Y75A 4MFEA 5E3OA 3CCJI 1B1BA 1LEAA 1MJAA 4HOBA 3JSOA 2QM3A 1BI0A 2LKSA 2ECBA 3GEZA 2P6TA 2VBYA 1HF0A 1V3FA 3BCBA 4S0HB 3QP6A 2M4GA 4L5JA 3A2KA 3TP3A 1H89C 1FP1D 3GTJJ 4LJZF 4LK0F 3M9AA 5HDNA 5F1JA 1MDMA 1NTCA 1UMQA 5GTIC 4LITA 2WWYA 3D5SC 3AG4H 1TBXA 4R1HA 4WXCA 1FOKA 1EJ9A 4IQ4A 4CUGA 1MJ9A 1YW9A 3HB9A 3GFJA 2CO5A 1WSUA 2M87A 2R7XA 3EUKL 4GGGA 3W3CA 1OYYA 3L7WA 4HA8A 3HUGB 3VYSB 1FIPA 3H0DA 1YW8A 1MMSA 2IA1A 3DU6A 3S2HJ 4YFXF 5L3CA 1Z67A 2ID3A 3QYFA 2F5EA 1JJ8C 2HZTA 2OCEA 2GA1A 5A2QZ 3P7NA 2A5WA 5HOOA 3X2QH 1P6RA 5ICGA 1Q1VA 2R5YB 2DJNA 2K40A 3CMAI 2A6HF 4WK8F 2A6TA 4BE1A 1HLVA 3U1DA 1IJWC 1TP4A 1LFPA 2QQAA 3KE2A 3RTRA 4A3JJ 3BLYA 1JKPC 3ASOH 1UZCA 2VBZA 2FEZA 4ZH4F 4IVNA 3OIOA 3CCLI 4A3IJ 4FE4A 2DPUA 4HZFA 3HOWJ 1K78A 1X1AA 3SXYA 4U7BA 1XGOA 2B9SA 3B02A 4A12A 1IN4A 3E3VA 1A6IA 3F22A 3ML6A 4HX7A 3H3UA 4E6KG 4KMFA 3M3YJ 1TQPA 4KFCA 1G3SA 1MH4A 4BS9A 1ONVA 1BL0A 1HSTA 3MZYA 1D0YA 2XRNA 3S2WA 4S04A 1TWAJ 1U5TA 5EJCA 3O8HA 1T56A 3OS0A 1GV2A 4BHBA 3F8FA 5F6FA 5LD2C 2WAEA 3BC8A 1U2WA 1XMAA 1X1CA 4BE2A 2VOOA 5KCMA 3MZ8A 1R00A 4Z2YA 1ZG1A 2EZIA 1JUSA 1R5ID 2P5KA 4LOCA 2W85A 2R0QC 1H0MA 4WF2A 2PEXA 2NVXJ 4L9VA 2LBFB 3J7ZI 4KYWA 3GMEA 3QWLA 4DOZA 4LG0A 1X4OA 5JLWA 3T0YA 1VI0A 1EH8A 1VQMI 1BR4A 2M45A 2V1UA 4F92B 3M07A 3ZQQA 3QYEA 2M3AA 2A3SA 4PJ0C 3HJEA 2EZKA 4EATA 1SFKA 1R1UA 3CUOA 4HYEA 3FXLA 3K7AJ 3KEYA 1Y8QB 4MO7A 4M3EA 4NB5A 2XGDA 3WTUC 1NHAA 4O3MA 2RN7A 3P9IA 4BL0B 2LF7A 1GXQA 2QZ8A 3OSFA 1IRFA 4E7SA 4Y4RA 4ZTFA 2I8DA 2XKPA 3MZHA 4PJNA 1T2KA 2RC4A 2QENA 4AVPA 4AIDA 3KCCA 2O61A 3S2DJ 4KMUX 3F8NA 4BGDA 3REOA 4RAFA 2K27A 3VPRA 2W82A 4CDGA 2HNHA 2LKXA 1KGSA 3BG7A 2DFFA 4A5MA 2O7OA 3PIOF 1Z91A 3DPLC 4JX5A 2GWRA 1FT9A 2MABA 2TCTA 2BHYA 5GTHC 3K4CA 3PUBA 3IRRA 1N75A 3KEQA 1BOAA 4YG2F 1RETA 3PNTA 3WG9A 3HGYA 1F9NA 4RGUA 3KEOA 1YHQI 1WH7A 4E7IA 4YFNF 5CJ9A 1R49A 1Y0UA 2Y0SN 2GXGA 4IHTA 3HRSA 4CYDA 5HS8A 1KU9A 4YFKF 2P5LC 4A3DJ 3WGIA 2MH2A 3PFYA 2CMPA 4CCJA 2PJRB 4BHPA 5LFAA 2Y0SA 4MEXF 1X3UA 2HQRA 1I6XA 2V1DA 4I02A 2HU9A 2XVCA 2XHKA 5ICEA 5DM7F 4ENMA 1Q1HA 1JKRC 4YELA 5FKOA 4EJWA 4AC0A 2JT1A 2ID6A 3LA2A 2HKXA 4E7JA 2EH3A 3CQZJ 3V8LA 3IC7A 1BOBA 5FFXA 2L4MA 1B6AA 4AIKA 3PO3J 3E7LA 2VJ5A 3GW2A 4MGRA 1QGPA 2DA4A 3C3WA 3H1CA 4IL6C 2H1KA 3QAHA 4QPOA 3ZQHA 3R61A 3LAPA 1O4XA 1FTZA 1FYMA 1IV8A 3HOSA 4CYCB 2RREA 2EFQA 3CCMI 3E5XA 1HDPA 4B09A 2V1NA 3I59B 4D5FA 1X1DA 2IA0A 4I2OA 3CJTB 3NEUA 5K7FA 3DTEA 2VKHA 5IP6A 3L2RA 4FQGA 3U9GA 3EYYA 1D0XA 2LSOA 2L9RA 4CZZA 4XKVA 1J9IA 4PJLA 2DMUA 1IAWA 1ZG3A 3I58A 1LQ1A 3HSFA 1TQIA 4BH9A 2V9VA 2A5YB 1FOXA 3IV5A 2XIGA 3CCUI 1X3WB 3PQKA 1CF7B 2BGCA 2E36A 3DU5A 3A01A 2FRHA 3KETA 5K5RA 3TO9A 2KIQA 3PL8A 2LP0A 4XN0A 1YJNI 3UKGA 2AQEA 3L2CA 3LQRA 3PSFA 1VQ7I 2GOXB 3BROA 3KX2A 3M7GA 5J8FA 3V42A 4ENNA 3GLLA 4EQQA 3HHHA 4WWCA 2GXAA 4L0ZB 1YI2I 2ZXHA 3BG5A 5FLMJ 5ILSA 5DD4A 1OCRH 3DLLF 1CGPA 3IWFA 1B9MA 3CC4I 2P7VB 3MCZA 3RYPA 3AFHA 2YU9J 5E20A 3OOUA 5HLIA 2F5DA 3ZXSA 2LH9A 3BQZA 4PDKA 3WU2C 1DPRA 2FSWA 3BTLA 2M1BA 2ZBKA 1K4TA 3P9KA 1XSDA 2FQ4A 4CSWA 4IF4A 1GDTA 2DXIA 1GXPA 3FMQA 4Y33A 1VQNI 4KIGA 3E5UA 3C1DA 1MGTA 2ZNYA 5C44J 2CV1A 3HUGA 3MKLA 4OIPF 3D5RC 2MFZA 1XD7A 3TO7A 4P9FA 2G7UA 5M5WJ 3V7CA 5EGOB 3GO5A 1DPUA 3FBNB 2DU9A 2FNAA 2HZDA 1D8JA 1O3TA 1T6SA 5LGTA 1Z7UA 5HLHA 2X6WA 2K5CA 2HEOA 4CA0A 4XBFA 4IHSA 5JLXA 1MNEA 2H8RA 1UG0A 3FHZA 3MQ0A 1W0TA 2R5YA 3M8FA 2UZKA 3OYLA 4N9IA 1NG7A 1WJCA 2WBMA 1E2XA 4A93J 3BR5A 3NWTA 2DMQA 1L0OC 2DCEA 5EF6A 1PP8F 1HSJA 5DUKA 5FKMA 3V7SA 4J19A 3JRFA 1UAAA 2IGKA 3SDBA 3HOUJ 2XC7A 1SFUA 4BNCA 2CFXA 2Q0OA 2XV4S 5FLXK 1WVRA 2PLYA 2CQXA 1ZTRA 2ZJPF 5ED4A 4C2UA 2W4SA 1UHWA 3M8EA 5FD6A 2MW8A 1ORKA 1YITI 1MBGA 4S05A 1ZAOA 3T8TA 4DZPA 2ZCWA 3W2AA 2DA3A 1QRYA 3CP8A 4XICA 2LY9A 1KONA 2RVCA 3ESWB 1J75A 2DOEA 3L2UA 1R22A 4Y15A 3M8JA 4B1RA 2H1LA 4M72A 3RQ4A 2HKOA 5H6RA 3OYHA 1DQUA 4GRIA 4I98B 4ZYDA 1JXSA 1R5GA 2HYGD 3ECOA 4YRVA 3OL3A 1SANA 3ZMVA 2LY2A 1ETVA 1J09A 2D5VA 5EZGA 1JJ6C 2OTJI 3SDGA 2KDZA 2ICWG 3CDIA 2MYSA 3ROUA 3B6AA 5EEHA 2ZJRF 4CH7A 1TTYA 4E7ZA 2JA5J 2ESHA 4A3MJ 1SVOA 3T1BA 1ETXA 3DEWA 5EDNA 4BJTA 4BJ6C 4DBRA 2VKDA 1Z05A 2BOLA 3SFZA 1BBYA 1OKRA 4M73A 3OYAA 2KRFA 1AA7A 1ZYRF 1UG2A 3ABTA 5CVRA 2W48A 1TZLA 3BR2A 1Z6TA 4ZC3A 2OQRA 4YIFA 5LEKA 1MSFC 2QSGX 4HX8A 2F6CA 3K1PA 4F3QA 2WB1N 2Y9YA 3LWFA 3VFZA 3L09A 2B63J 2Q2EA 3B6CA 1V5GA 3AKZA 2IS1A 1QVUA 1TW2A 3IH3A 4GO1A 4F93B 2K4BA 3G2BA 1KQ8A 2EILH 1Z77A 1VF9A 4DBQA 4HRIA 3EUAA 3FK6A 3DXJF 2WB1A 3ULQB 3JRIA 4R8HA 2V9PA 3LAJA 2JMWA 3K4LA 2VC0A 2PMUA 1SD4A 3KZYA 2YU3A 4QWQA 3CCRI 4XL9A 4EGZA 2R7DA 4JX6A 4XLNF 2JK3A 3HRUA 1HBXG 1X19A 3CTAA 5C3EJ 4BY1J 1OR7C 3KLOA 1K61A 1HKSA 2L2OA 1A36A 1JT0A 3I3LA 4HLXA 4EJOA 5E17F 1WPKA 2DPDA 2Y31A 4I09A 3CCEI 2JRMA 4O6JA 2FUG2 4KUMA 4A0YA 1I5ZA 1AU7A 4IPAA 3I55I 2NXNB 3MKWB 3DWLE 3KP2A 3Q0VA 4KJZA 1YLFA 5K5OA 5DEQA 1K6YA 3CJRB 4RM3A 2A68F 1BJAA 1IN7A 2FF4A 2VBXA 3IKVA 3VODA 3WE3A 2PJRA 1RI7A 5AIQA 1ZHFA 2CV2A 4F7ZA 2I10A 2M7AA 4RAZA 3RJPA 5J1RA 2BZTA 3MVPA 1XDUA 1AKHB 2JA7J 1PP7U 4RGXA 4BXXJ 3BJOA 1G6NA 5BMZA 1X2MA 4OAYA 2O03A 3AG1H 5CQGA 2R3SA 3RPUD 2HQAA 5B1BH 1KYZA 3K2ZA 1UCRA 3RI4A 3K70D 1EA3A 2QLZA 5EEAA 4XQFA 4HQMA 5K7HA 4JX4A 5DV5A 3BZ6A 4D7MA 2XSJC 4CCKA 2IVMA 1JKQC 4XLAA 2NS7A 5K1YA 3ABMH 5J8CA 4CYCA 3FXOA 1IW7F 3SJMA 4XN3A 2IEKA 2OZUA 2HDCA 3HBLA 2VKVA 1IO2A 2VT2A 3I59A 3D0SA 1D1BA 4FTHA 3HGGA 1LDJA 5ERIA 4BY7J 2KIFA 1MD0A 5IP7J 3NWSA 3S8PA 1OCCH 3I4PA 3ZP5A 1R71A 4XRSA 4UY8I 1BIAA 3TQNA 4DYRA 2ADUA 1YW7A 4XKWA 2Z2SB 4C3IJ 5TGTA 1LFUP 2IGOA 2O3FA 1ETYA 5FB2A 3I0TA 4M6YA 3VSKA 4BDYA 3S3OA 1HW5A 2YX7A 5B3SH 2L9VA 1VQ8I 1CF7A 1MJBA 3GBGA 3OYDA 5BQTA 4NC7A 2LD5A 3OS1A 3N05A 3HTSB 2LOOA 4X0GA 1S8NA 3CLOA 1B72A 2OUMA 2IBDA 3K9TA 3S3NA 4CICA 3BPXA 5J6XA 1Y56A 4FISA 3O6BB 3ZGKA 2EPFA 2O8KA 3CD6I 4HF0A 1IXCA 1LKXA 2FNPA 3I54A 1RKTA 1STZA 1A35A 1L3LA 2UWMA 2ISZA 2VL8A 3IUOA 5GPAA 3GWZA 4KN4X 1WQ2A 1NH3A 3V7RA 2HDDA 1PUEE 3H92A 2K9NA 2BXZA 1X1PA 1R1VA 4ZYHA 2WC2A 5F0CA 1UELB 5KHDA 3LSTA 4IX7A 2D1HA 1JGSA 2A69F 2KPMA 3TW7A 5E3MA 1IN6A 2L01A 3ZMDA 3HTUA 3FIWA 4BACA 2X48A 3FF5A 3JW4A 4NUBA 2L7ZA 4IZZA 1D8KA 4M3BA 1H8AC 5DCMA 1ETKA 1MIJA 1G3YA 2R7SA 1Z9CA 1HW1A 3SEZA 3EQLF 2IRFG 3JRGA 4CGZA 2CW0F 3QRFF 2CUEA 1TQMA 4A6DA 3M1CA 1JTXA 2E5ZA 2V4JC 1B4AA 4MTEA 3ZQLA 1E3OC 1MBJA 1SMYF 2P6SA 2RDPA 5JI6A 4NDLA 2R7ZJ 4OMYA 2DODA 2QQ8A 2L02A 1U8RA 1SD6A 2VC1A 2QKMB 4FE7A 1PVEA 2DO7A 3SYTA 2CUFA 4FCYA 1RRJA 2AO9A 1JGGA 4G6TB 5KAFC 2F2EA 2ZSIB 2OTLI 1D1CA 1BI1A 3BTCA 3FDYA 3CCVI 3OSGA 3V8JA 2FD5A 1AHDP 3DKYA 1KYWA 2ZC2A 2KT0A 1IC8A 2OA4A 5ICCA 4II2A 2MLKA 4OWRB 2VIXA 3QPHA 5J40A 2RGVA 3RKWA 4CO8A 3C18A 4P5OA 3S32A 4G8XA 3HOVJ 4Y3OA 3F21A 1MMDA 4A3CJ 1BN5A 4XM3A 1U6GA 4RGSA 1F43A 4Y52J 3KP3A 2VASA 2I5UA 2KZVA 2OPTA 3RQIA 2VE8A 1USSA 2OC6A 1MBHA 3WTTC 1LFBA 2H27A 1LPQA 4KDPA 4V19K 2KZGA 4PJJA 1WZ2A 2EFNA 2EJRA 2DA2A 1RNLA 2IA2A 4F52A 3IHUA 2RNGA 2KIMA 2JUCA
chains in the Genus database with same CATH topology
3NRVA 2FBIA 1F1ZA 4NHJA 1FSHA 4UUVA 4P9UA 1H9GA 5CVIA 1EH7A 1YS7A 2VXZA 4UV8A 3GF2A 1S7AA 1LJ9A 1ZARA 3W6JB 2CYYA 5D8KB 1T98A 1OMIA 4AD9A 4HF2A 1AOYA 2EFWA 5LHIA 2MH9A 1W7PA 3TOAA 4EJVA 5TRDA 2WV0A 4O5VA 3E6BA 1ON2A 2CG4A 1ZG5A 5AONA 2EFPA 2DK8A 2NAZA 3H3ZA 1XCVA 3F72A 4PZJA 2Q8KA 4MTDA 3JTGA 2NNNA 4CXFA 3HSEA 4WXHA 4E70A 1O7FA 4KNYA 2OZ6A 4HDUA 4JQFA 1R36A 5HDGA 2DI3A 2XROA 1KU7A 5JVTA 4KT5C 3J81K 3F3XA 1KQ9A 4L9NA 2JRTA 1KU3A 2MA3A 2DAOA 2P8TA 1G4DA 1YYVA 2V6CA 4EMSA 2YR2A 4LLNA 2Z9OA 3E5QA 2EWNA 2K02A 2UXNA 5HDKA 3PFIA 3F8BA 3KLNA 3HYIA 1S29A 2OQGA 2VODA 1RUOA 5LEJA 4KN7X 1OR7A 3SQNA 4ZYGA 5LRSA 5HS7A 3ZN0A 4L9JA 5HVQC 2EA4A 5E18F 1O3RA 2NRAC 4IRGA 2MBFA 3G3ZA 3TDUC 4MQVA 3E6CC 3VB2A 3QU6A 2JSCA 2OD5A 5LHGA 5L3EA 4UVBA 5CVJA 4A5NA 2CSOA 3J7AO 3NQOA 4GCVA 3WTWC 4L0YB 3HIFA 2XKOA 2DLLA 4D0PA 2A07F 3J80K 2HTJA 3HSRA 3VOEA 1TW3A 4KICA 2FBKA 4EVIA 1J59A 3GFLA 2DTRA 1H9TA 4ESJA 4CHUA 2FXAA 4N0BA 1FBUA 5DD8A 3IRQA 4ESBA 5LLQA 1EV7A 1Z1DA 4EJUA 4P55A 1K6OA 2ZO4A 3ISPA 3JTHA 3WE2A 1IF1A 1SD7A 5H20A 5D5UB 2ETHA 4YIIA 1UHMA 5LGNA 4PCQA 3L9FA 1REPC 4LMYA 4XSXF 1SMTA 4BYYA 2B0LA 2H09A 5IT9K 3HOTA 1XMKA 1LDKB 5D4RA 4ASNA 1AWCA 1IXRC 3FWEA 4AIHA 3K0LA 2PN6A 2QUFA 2ZMEB 1IZ1A 4QLCU 4FHTA 1ZRFA 1SFEA 4I0BA 3KZZA 5F64A 3MFKA 5FGMA 1JE8A 3F8CA 4HBLA 3OV8A 1B59A 4U0YA 1FZPB 3TO6A 5FLXZ 3WTYC 3EDPA 3MWMA 2E1CA 2FU4A 3R4KA 5DYMA 1I27A 4OIRF 1F4KA 2L3DA 3FM3A 4WCGA 2F5CA 1K79A 2VBWA 3GZ5A 2FA5A 1MDMB 4OIQF 2G9WA 2EA2A 4IRIA 1TNSA 2FOKA 5FFZA 4EV0A 3O3KA 2W84A 2PFBA 3HHGA 2H6CA 2VN2A 1IXSB 3R0JA 5K5QA 1XSVA 1KQ0A 4RB1A 2BEOA 2JTVA 1RIOH 2Y48A 3GXOA 2DFIA 4EM2A 3WTZA 2MD5A 3EYIA 1YIOA 4G94A 3F23A 1SD5A 4LB5A 1T38A 3PQJA 3RPQA 2FE3A 3WTSC 2HQNA 2JPCA 4RAYA 1ZLJA 3QPTA 2Z5UA 3TOBA 1FP2A 2DT5A 3Q9VA 5HLGA 4I0AA 1YFHA 3IKTA 2RKHA 1RUNA 4U0VA 1ZGAA 2PG4A 4MQ9F 5CLSA 3DQVC 2XAFA 2LNBA 2XUBA 4U7DA 1HW2A 2V1XA 4RB3C 4Q5SF 5KVRA 1QBJA 4KIBA 2FQ3A 1ZGJA 4M6XA 3ECHA 1OPCA 2QQBA 3ZPLA 3KP7A 1ZRCA 3E97A 1LVAA 1XGNA 2GXBA 2L4AA 2J5OA 5JFRA 3F8MA 3KFWX 3LFKA 4L18B 2ZKZA 3KP4A 1WI9A 2HFHA 4A2UA 1FC3A 2QVOA 2AXLA 5D5VB 3R60A 2Y0MA 2KKOA 2DK5A 4UVCA 1BM9A 5L3GA 2BE5F 2K7LA 3DF8A 1FPQA 2CQKA 4HW0A 1R23A 4A0ZA 2V79A 2NNYA 3BWGA 1G3TA 2DW4A 1ULYA 1FYLA 4LLGF 3GX4X 3ERED 4HLYA 3ZMSA 4I01A 1QO0D 4Q47A 4WXDA 5AIPA 1JHHA 2STTA 4EGYA 5E8GA 4L5IA 4M71A 5IT3A 2E7XA 4WX9A 4KA4A 4G7OF 4Q4ZF 3ZMTA 2OU2A 3JAMK 1J0RA 3QOPA 4HDVA 1ZRDA 4M9SA 1KU2A 4UXNA 3BY6A 2PJPA 1SFXA 3DPTA 5TJJA 3O2PE 2H6BA 4AWXB 3N4MA 1P4XA 2EFOA 4HAMA 3RDIA 5LGUA 3N97A 4HV5A 3WODF 3GYHX 4EM1A 4U0WA 1FBQA 3R0AA 1WWXA 2D1VA 2ZMEA 2QYOA 3T5XA 4M9ZA 1O57A 3E6MA 3F6VA 1LDDA 1YO5C 4Y13A 1IUYA 1S3JA 5L3BA 2HGCA 4OU0A 2IP2A 3KP6A 2FBHA 4Y17A 2O0YA 1QZYA 2EV0A 1W7PD 2O8XA 1BI2A 2OAZA 1DP7P 2X4HA 5DDGA 2ELHA 3CUQC 2EV6A 3I53A 3R6SA 1GVJA 3OOPA 4IRHA 2A6EF 1I1SA 1HXDA 1HKTA 4TV7A 2D45A 3AAFA 1JHFA 2O6GE 4KIFA 2HS5A 5E8IA 5A2QK 2IPQX 3DP7A 5JR3A 3CJNA 2VOPA 1WRJA 1DUXC 2J5PA 1HQCA 4M74A 3RKYA 2EV5A 5BPIA 2M5WA 3CUQB 2RQPA 3C7JA 3FX3A 1XN7A 1FSEA 1U78A 3FM5A 4JK1X 2K86A 3CO6C 1MKMA 2Z3YA 2ESNA 2R7FA 3QU3A 1GHCA 3HRTA 2W25A 3ZMUA 4UHTA 4RB2C 4GYIA 3L00A 2BV6A 2GQQA 3J81Z 3ZQ7A 2YPRA 3JSPA 5HS9A 2P7CB 2IW5A 3FXQA 3RKXA 4I7HA 1U3EM 1C0WA 1FNNA 4GXOA 1UFMA 4HX4A 3CDHA 4XSZF 2YX4A 2LDUA 3BPVA 1FX7A 3TKYA 4XRFA 1T39A 3WTVC 1ON1A 2JZYA 3I64A 2MLGA 1R7JA 6PAXA 3WTXC 1FBSA 1O3QA 2LKPA 1XDSA 5DUIA 4LB6B 4DNCA 4A0XA 4JBAA 3GLXA 1J5YA 4BQAA 2DBBA 3B73A 1BC8C 1PDNC 1RZ4A 4OIOF 4FT8A 3K69A 2QQ9A 3WU1B 1ZREA 1P4WA 4U88A 2QBYB 3ABUA 4LD5A 1ZH5A 4G9YA 3LQQA 1P2FA 2DQLA 1OYWA 2GAUA 2CGPA 3COAC 4LLLA 1BIBA 4K2EA 5E1WA 3J80Z 4B8XA 2VE9A 2Z33A 5E1ZB 1QZZA 2X0LA 5H6QA 4H0EA 2COMA 3BP8A 4ZYEA 2EB7A 1P4AA 3EETA 4BHCA 4MHGA 2E7WA 1S7OA 1K7AA 1W5SA 4UVAA 5ILVA 2NYXA 2ZXJA 1O7LA 2ISYA 2XAQA 3D5LA 3ELKA 1W5TA 2M8EA 4ESFA 1HKQA 5CVVA 3ZMZA 5L3DA 3WGHA 2D2WA 1ODDA 1TNTA 2TDXA 2G7HA 3ZN1A 1FY7A 1B9NA 2HR3A 1LB2A 5FO5A 1I1GA 2JPBA 3I5UA 1D5VA 4XLPF 5ICFA 4HQEA 3GFMA 5CVUA 3E6DA 5IT9Z 1D3YA 4UV9A 3TDZC 2P4WA 1BI3A 1P92A 4G6QA 3W6KB 3FMRA 3SZPA 4LGWA 1S6LA 1F5TA 3F6OA 2BYVE 2GZWA 5D5WB 3IWZA 4RS8A 2OBPA 2UXXA 5DCMB 3IL2A 1LEBA 1J2XA 1YTYA 3WGGA 1A04A 4OMZA 4ON0A 5JHUA 1IN5A 4FX4A 3Q5FA 3V8KA 1IN8A 1XGMA 2F5FA 2RNJA 2PMHA 2W57A 3FZVA 2H94A 1QQIA 2CWEA 3MEXA 2IJLA 2FMYA 2W24A 1WKMA 4PGGA 1MZBA 1QPMA 2ZNZA 4MEYF 1G3WA 3CUQA 5FD5A 3HRMA 2ZJ2A 2L54A 3LA3A 4BXUA 3FXUA 3BDDA 1U5TC 4IXAA 4BAYA 5BOXA 2BBYA 4ZZLA 2YSRA 1ZN2A 4ZZDA 1EH6A 2QWWA 1TLHB 3RYRA 3FXRA 3Q9SA 2HTSA 2XASA 2XAHA 5E1XA 1KA8A 1OYIA 1IRGA 4G7ZF 1K78B 1FWZA 5ILUA 4FX0A 2ACJA 2KJBA 5D6FA 1E17A 2P5VA 5KK1A 2GA2A 1W7PB 4R79A 2FMLA 1U5TB 5L3FA 4IJAA 2A61A 1O3SA 2XGXA 4UNOA 4LFUA 3G73A 4ENKA 5LBQA 1YS6A 3K1NA 1T0FA 1XB4A 5F1RA 4LG0B 4DQ2A 3DFGA 2PBIA 4NQWA 1BC7C 4P96A 2HWVA 3U2RA 2EK5A 5D5XB 3DV8A 1R58A 1R1TA 4G6DA 4M9XA 4RGRA 1VTNC 2QBYA 5LHHA 4L9TA 2KJCA 2DQRA 1V4RA 3LA7A 4N9HA 3CO7C 2Z99A 5CYVA 3K1MA 3BOQA 4OOIA 4RB0A 2C6YA 3WU0A 2STWA 1YG2A 2K4JA 4HF1A 4HV6A 4Q48A 4EJTA 1Z6RA 2HYFA 3SZTA 3KP5A 3RIRA 3I71A 2VT3A 3EUHA 3GFIA 3DKWA 1QNTA 4GYGA 1SAXA 2PI0A 3QP5A 3BJAA 1XGSA 2AS5F 2HOEA 5BPDA 1FLIA 5EEGA 2GIVA 4EM0B 5LRRA 5D6EA 3GVAA 3GZ6A 2XAGA 3P9CA 2PQ8A 3T8RA 3JAMZ 3DEUA 4G7HF 3VEPA 3RPUA 2KIUA 2LF8A 1W4MA 2RV8A 3FMSA 2WTEA 2M30A 4OINF 5DCFA 1UB9A 1YQAA 5D8LB 3V4GA 1XCBA 3M1EA 3GUDA 4ETSA 4LK1F 1USTA 2IT0A 4AIJA 4MNUA 3BJ6A 2ZFWA 5D4SA 3MAJA 1FYKA 2VONA 2MC3A 4PGHA 4ENJA 1J7KA 1ZLKA 1DDNA 1XSXA 3TGNA 2E1NA 3SHFA 2XAJA 2NS0A 4A6EA 1R5HA 1LNWA 5BS6A 2Y75A 1B1BA 1LEAA 1MJAA 4HOBA 3JSOA 2QM3A 1BI0A 3GEZA 2P6TA 2VBYA 1V3FA 3QP6A 4L5JA 1FP1D 4LJZF 4LK0F 3M9AA 5HDNA 1MDMA 2WWYA 1TBXA 4R1HA 4WXCA 1FOKA 1MJ9A 1YW9A 3GFJA 2CO5A 1WSUA 2M87A 4GGGA 1OYYA 3L7WA 4HA8A 1YW8A 2IA1A 4YFXF 5L3CA 2F5EA 2HZTA 5A2QZ 2GA1A 3P7NA 5HOOA 1P6RA 5ICGA 2A6HF 4WK8F 3U1DA 2QQAA 3KE2A 3RTRA 2VBZA 2FEZA 4ZH4F 4IVNA 2DPUA 4HZFA 1K78A 3SXYA 4U7BA 1XGOA 3B02A 4A12A 1IN4A 3E3VA 3F22A 3ML6A 4HX7A 3H3UA 4KMFA 1TQPA 4KFCA 1G3SA 1ONVA 1HSTA 3MZYA 2XRNA 3S2WA 4S04A 1U5TA 4BHBA 3F8FA 5F6FA 1U2WA 1XMAA 2VOOA 4Z2YA 1R00A 1ZG1A 2P5KA 2W85A 1H0MA 4WF2A 2PEXA 4L9VA 4KYWA 4LG0A 3T0YA 1EH8A 2M45A 2V1UA 2A3SA 1R1UA 3CUOA 4HYEA 4NB5A 3WTUC 1NHAA 4O3MA 2RN7A 3P9IA 2LF7A 1GXQA 2QZ8A 1IRFA 2XKPA 3MZHA 1T2KA 2RC4A 2QENA 4AVPA 3KCCA 2O61A 4KMUX 3F8NA 3REOA 4CDGA 2K27A 1KGSA 4A5MA 1Z91A 3DPLC 2GWRA 1FT9A 3IRRA 3KEQA 1BOAA 4YG2F 3WG9A 1F9NA 4RGUA 3KEOA 4YFNF 5CJ9A 1Y0UA 2GXGA 4IHTA 3HRSA 4CYDA 5HS8A 1KU9A 4YFKF 2P5LC 3WGIA 2MH2A 4BHPA 4MEXF 1X3UA 2HQRA 1I6XA 2V1DA 4I02A 2XVCA 5ICEA 2XHKA 4ENMA 1Q1HA 4EJWA 2JT1A 3LA2A 2HKXA 3V8LA 3IC7A 5FFXA 2L4MA 1B6AA 4AIKA 3GW2A 4MGRA 1QGPA 3C3WA 3QAHA 3R61A 3LAPA 1FYMA 3HOSA 2EFQA 3E5XA 4B09A 3I59B 2IA0A 4I2OA 3NEUA 3U9GA 3EYYA 2LSOA 4CZZA 1J9IA 1IAWA 1ZG3A 3I58A 1LQ1A 3HSFA 1TQIA 4BH9A 2V9VA 2A5YB 2XIGA 3PQKA 1CF7B 2BGCA 2FRHA 3KETA 5K5RA 3TO9A 3L2CA 3LQRA 3BROA 3M7GA 5J8FA 4ENNA 4EQQA 3HHHA 4WWCA 4L0ZB 5ILSA 5DD4A 1CGPA 3IWFA 1B9MA 2P7VB 3MCZA 3RYPA 5E20A 5HLIA 2F5DA 4PDKA 1DPRA 2FSWA 2M1BA 2ZBKA 3P9KA 1XSDA 4IF4A 1GXPA 3FMQA 4KIGA 3E5UA 3C1DA 1MGTA 2ZNYA 3HUGA 4OIPF 3TO7A 1XD7A 4P9FA 2G7UA 3V7CA 3GO5A 1DPUA 2DU9A 2FNAA 1D8JA 1O3TA 1T6SA 5LGTA 1Z7UA 5HLHA 2HEOA 4XBFA 4IHSA 3FHZA 3MQ0A 3M8FA 2UZKA 4N9IA 1E2XA 1L0OC 1PP8F 1HSJA 5DUKA 3V7SA 1SFUA 4BNCA 2CFXA 2Q0OA 2XV4S 5FLXK 2PLYA 5ED4A 1UHWA 3M8EA 5FD6A 4S05A 1ZAOA 3T8TA 2ZCWA 2RVCA 1J75A 1R22A 4Y15A 4M72A 2HKOA 5H6RA 4I98B 4ZYDA 1JXSA 1R5GA 2HYGD 3ECOA 3ZMVA 3ROUA 5EEHA 1TTYA 2ESHA 3T1BA 1Z05A 3SFZA 1BBYA 1OKRA 4M73A 2KRFA 1ZYRF 3ABTA 5CVRA 5LEKA 1Z6TA 2OQRA 4YIFA 4HX8A 3K1PA 3LWFA 3VFZA 3L09A 2Q2EA 1TW2A 4GO1A 2K4BA 1KQ8A 3DXJF 3ULQB 4R8HA 3LAJA 2VC0A 2PMUA 1SD4A 3KZYA 2YU3A 4QWQA 4EGZA 2R7DA 4XLNF 3HRUA 1HBXG 3CTAA 3KLOA 1HKSA 4HLXA 4EJOA 5E17F 2DPDA 4I09A 4O6JA 4KUMA 4A0YA 1I5ZA 4IPAA 3KP2A 1YLFA 5K5OA 5DEQA 2A68F 1BJAA 1IN7A 2FF4A 3VODA 2VBXA 3IKVA 3WE3A 1RI7A 5AIQA 1ZHFA 4F7ZA 4RAZA 3RJPA 1XDUA 1PP7U 4RGXA 3BJOA 1G6NA 5BMZA 2O03A 2R3SA 1KYZA 3K2ZA 1UCRA 3RI4A 2QLZA 4HQMA 5DV5A 3BZ6A 2IVMA 5K1YA 5J8CA 1IW7F 2OZUA 2HDCA 3I59A 2VT2A 3D0SA 1LDJA 5ERIA 2KIFA 1MD0A 3ZP5A 3I4PA 1BIAA 3TQNA 2ADUA 1YW7A 2O3FA 5FB2A 3I0TA 4M6YA 1HW5A 2YX7A 1CF7A 1MJBA 5BQTA 3HTSB 1S8NA 3CLOA 3K9TA 4CICA 3BPXA 5J6XA 3O6BB 4HF0A 1IXCA 2FNPA 3I54A 1STZA 1L3LA 2UWMA 2ISZA 3GWZA 4KN4X 1WQ2A 3V7RA 1PUEE 3H92A 1R1VA 4ZYHA 2WC2A 3LSTA 2D1HA 1JGSA 2A69F 1IN6A 2L01A 3ZMDA 3HTUA 3JW4A 3FF5A 1D8KA 5DCMA 1G3YA 1Z9CA 1HW1A 3EQLF 2IRFG 4CGZA 2CW0F 3QRFF 1TQMA 4A6DA 4MTEA 1B4AA 1SMYF 2P6SA 2RDPA 5JI6A 4OMYA 2L02A 1U8RA 1SD6A 2VC1A 2DO7A 2F2EA 1BI1A 3V8JA 1KYWA 2OA4A 5ICCA 2MLKA 3QPHA 2RGVA 3RKWA 4CO8A 3C18A 4P5OA 4G8XA 3F21A 1BN5A 1U6GA 4RGSA 3KP3A 2VE8A 1USSA 3WTTC 2H27A 4KDPA 2EFNA 2EJRA 1RNLA 2IA2A 3IHUA 2KIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRV A;  2FBI A;  1F1Z A;  4NHJ A;  1FSH A;  4UUV A;  4P9U A;  1H9G A;  5CVI A;  1EH7 A;  1YS7 A;  2VXZ A;  4UV8 A;  3GF2 A;  1S7A A;  1LJ9 A;  1ZAR A;  3W6J B;  2CYY A;  5D8K B;  1T98 A;  1OMI A;  4AD9 A;  4HF2 A;  1AOY A;  2EFW A;  5LHI A;  2MH9 A;  1W7P A;  3TOA A;  4EJV A;  5TRD A;  2WV0 A;  4O5V A;  3E6B A;  1ON2 A;  2CG4 A;  1ZG5 A;  5AON A;  2EFP A;  2DK8 A;  2NAZ A;  3H3Z A;  1XCV A;  3F72 A;  4PZJ A;  2Q8K A;  4MTD A;  3JTG A;  2NNN A;  4CXF A;  3HSE A;  4WXH A;  4E70 A;  1O7F A;  4KNY A;  2OZ6 A;  4HDU A;  4JQF A;  1R36 A;  5HDG A;  2DI3 A;  2XRO A;  1KU7 A;  5JVT A;  4KT5 C;  3J81 K;  3F3X A;  1KQ9 A;  4L9N A;  2JRT A;  1KU3 A;  2MA3 A;  2DAO A;  2P8T A;  1G4D A;  1YYV A;  2V6C A;  4EMS A;  2YR2 A;  4LLN A;  2Z9O A;  3E5Q A;  2EWN A;  2K02 A;  2UXN A;  5HDK A;  3PFI A;  3F8B A;  3KLN A;  3HYI A;  1S29 A;  2OQG A;  2VOD A;  1RUO A;  5LEJ A;  4KN7 X;  1OR7 A;  3SQN A;  4ZYG A;  5LRS A;  5HS7 A;  3ZN0 A;  4L9J A;  5HVQ C;  2EA4 A;  5E18 F;  1O3R A;  2NRA C;  4IRG A;  2MBF A;  3G3Z A;  3TDU C;  4MQV A;  3E6C C;  3VB2 A;  3QU6 A;  2JSC A;  2OD5 A;  5LHG A;  5L3E A;  4UVB A;  5CVJ A;  4A5N A;  2CSO A;  3J7A O;  3NQO A;  4GCV A;  3WTW C;  4L0Y B;  3HIF A;  2XKO A;  2DLL A;  4D0P A;  2A07 F;  3J80 K;  2HTJ A;  3HSR A;  3VOE A;  1TW3 A;  4KIC A;  2FBK A;  4EVI A;  1J59 A;  3GFL A;  2DTR A;  1H9T A;  4ESJ A;  4CHU A;  2FXA A;  4N0B A;  1FBU A;  5DD8 A;  3IRQ A;  4ESB A;  5LLQ A;  1EV7 A;  1Z1D A;  4EJU A;  4P55 A;  1K6O A;  2ZO4 A;  3ISP A;  3JTH A;  3WE2 A;  1IF1 A;  1SD7 A;  5H20 A;  5D5U B;  2ETH A;  4YII A;  1UHM A;  5LGN A;  4PCQ A;  3L9F A;  1REP C;  4LMY A;  4XSX F;  1SMT A;  4BYY A;  2B0L A;  2H09 A;  5IT9 K;  3HOT A;  1XMK A;  1LDK B;  5D4R A;  4ASN A;  1AWC A;  1IXR C;  3FWE A;  4AIH A;  3K0L A;  2PN6 A;  2QUF A;  2ZME B;  1IZ1 A;  4QLC U;  4FHT A;  1ZRF A;  1SFE A;  4I0B A;  3KZZ A;  5F64 A;  3MFK A;  5FGM A;  1JE8 A;  3F8C A;  4HBL A;  3OV8 A;  1B59 A;  4U0Y A;  1FZP B;  3TO6 A;  5FLX Z;  3WTY C;  3EDP A;  3MWM A;  2E1C A;  2FU4 A;  3R4K A;  5DYM A;  1I27 A;  4OIR F;  1F4K A;  2L3D A;  3FM3 A;  4WCG A;  2F5C A;  1K79 A;  2VBW A;  3GZ5 A;  2FA5 A;  1MDM B;  4OIQ F;  2G9W A;  2EA2 A;  4IRI A;  1TNS A;  2FOK A;  5FFZ A;  4EV0 A;  3O3K A;  2W84 A;  2PFB A;  3HHG A;  2H6C A;  2VN2 A;  1IXS B;  3R0J A;  5K5Q A;  1XSV A;  1KQ0 A;  4RB1 A;  2BEO A;  2JTV A;  1RIO H;  2Y48 A;  3GXO A;  2DFI A;  4EM2 A;  3WTZ A;  2MD5 A;  3EYI A;  1YIO A;  4G94 A;  3F23 A;  1SD5 A;  4LB5 A;  1T38 A;  3PQJ A;  3RPQ A;  2FE3 A;  3WTS C;  2HQN A;  2JPC A;  4RAY A;  1ZLJ A;  3QPT A;  2Z5U A;  3TOB A;  1FP2 A;  2DT5 A;  3Q9V A;  5HLG A;  4I0A A;  1YFH A;  3IKT A;  2RKH A;  1RUN A;  4U0V A;  1ZGA A;  2PG4 A;  4MQ9 F;  5CLS A;  3DQV C;  2XAF A;  2LNB A;  2XUB A;  4U7D A;  1HW2 A;  2V1X A;  4RB3 C;  4Q5S F;  5KVR A;  1QBJ A;  4KIB A;  2FQ3 A;  1ZGJ A;  4M6X A;  3ECH A;  1OPC A;  2QQB A;  3ZPL A;  3KP7 A;  1ZRC A;  3E97 A;  1LVA A;  1XGN A;  2GXB A;  2L4A A;  2J5O A;  5JFR A;  3F8M A;  3KFW X;  3LFK A;  4L18 B;  2ZKZ A;  3KP4 A;  1WI9 A;  2HFH A;  4A2U A;  1FC3 A;  2QVO A;  2AXL A;  5D5V B;  3R60 A;  2Y0M A;  2KKO A;  2DK5 A;  4UVC A;  1BM9 A;  5L3G A;  2BE5 F;  2K7L A;  3DF8 A;  1FPQ A;  2CQK A;  4HW0 A;  1R23 A;  4A0Z A;  2V79 A;  2NNY A;  3BWG A;  1G3T A;  2DW4 A;  1ULY A;  1FYL A;  4LLG F;  3GX4 X;  3ERE D;  4HLY A;  3ZMS A;  4I01 A;  1QO0 D;  4Q47 A;  4WXD A;  5AIP A;  1JHH A;  2STT A;  4EGY A;  5E8G A;  4L5I A;  4M71 A;  5IT3 A;  2E7X A;  4WX9 A;  4KA4 A;  4G7O F;  4Q4Z F;  3ZMT A;  2OU2 A;  3JAM K;  1J0R A;  3QOP A;  4HDV A;  1ZRD A;  4M9S A;  1KU2 A;  4UXN A;  3BY6 A;  2PJP A;  1SFX A;  3DPT A;  5TJJ A;  3O2P E;  2H6B A;  4AWX B;  3N4M A;  1P4X A;  2EFO A;  4HAM A;  3RDI A;  5LGU A;  3N97 A;  4HV5 A;  3WOD F;  3GYH X;  4EM1 A;  4U0W A;  1FBQ A;  3R0A A;  1WWX A;  2D1V A;  2ZME A;  2QYO A;  3T5X A;  4M9Z A;  1O57 A;  3E6M A;  3F6V A;  1LDD A;  1YO5 C;  4Y13 A;  1IUY A;  1S3J A;  5L3B A;  2HGC A;  4OU0 A;  2IP2 A;  3KP6 A;  2FBH A;  4Y17 A;  2O0Y A;  1QZY A;  2EV0 A;  1W7P D;  2O8X A;  1BI2 A;  2OAZ A;  1DP7 P;  2X4H A;  5DDG A;  2ELH A;  3CUQ C;  2EV6 A;  3I53 A;  3R6S A;  1GVJ A;  3OOP A;  4IRH A;  2A6E F;  1I1S A;  1HXD A;  1HKT A;  4TV7 A;  2D45 A;  3AAF A;  1JHF A;  2O6G E;  4KIF A;  2HS5 A;  5E8I A;  5A2Q K;  2IPQ X;  3DP7 A;  5JR3 A;  3CJN A;  2VOP A;  1WRJ A;  1DUX C;  2J5P A;  1HQC A;  4M74 A;  3RKY A;  2EV5 A;  5BPI A;  2M5W A;  3CUQ B;  2RQP A;  3C7J A;  3FX3 A;  1XN7 A;  1FSE A;  1U78 A;  3FM5 A;  4JK1 X;  2K86 A;  3CO6 C;  1MKM A;  2Z3Y A;  2ESN A;  2R7F A;  3QU3 A;  1GHC A;  3HRT A;  2W25 A;  3ZMU A;  4UHT A;  4RB2 C;  4GYI A;  3L00 A;  2BV6 A;  2GQQ A;  3J81 Z;  3ZQ7 A;  2YPR A;  3JSP A;  5HS9 A;  2P7C B;  2IW5 A;  3FXQ A;  3RKX A;  4I7H A;  1U3E M;  1C0W A;  1FNN A;  4GXO A;  1UFM A;  4HX4 A;  3CDH A;  4XSZ F;  2YX4 A;  2LDU A;  3BPV A;  1FX7 A;  3TKY A;  4XRF A;  1T39 A;  3WTV C;  1ON1 A;  2JZY A;  3I64 A;  2MLG A;  1R7J A;  6PAX A;  3WTX C;  1FBS A;  1O3Q A;  2LKP A;  1XDS A;  5DUI A;  4LB6 B;  4DNC A;  4A0X A;  4JBA A;  3GLX A;  1J5Y A;  4BQA A;  2DBB A;  3B73 A;  1BC8 C;  1PDN C;  1RZ4 A;  4OIO F;  4FT8 A;  3K69 A;  2QQ9 A;  3WU1 B;  1ZRE A;  1P4W A;  4U88 A;  2QBY B;  3ABU A;  4LD5 A;  1ZH5 A;  4G9Y A;  3LQQ A;  1P2F A;  2DQL A;  1OYW A;  2GAU A;  2CGP A;  3COA C;  4LLL A;  1BIB A;  4K2E A;  5E1W A;  3J80 Z;  4B8X A;  2VE9 A;  2Z33 A;  5E1Z B;  1QZZ A;  2X0L A;  5H6Q A;  4H0E A;  2COM A;  3BP8 A;  4ZYE A;  2EB7 A;  1P4A A;  3EET A;  4BHC A;  4MHG A;  2E7W A;  1S7O A;  1K7A A;  1W5S A;  4UVA A;  5ILV A;  2NYX A;  2ZXJ A;  1O7L A;  2ISY A;  2XAQ A;  3D5L A;  3ELK A;  1W5T A;  2M8E A;  4ESF A;  1HKQ A;  5CVV A;  3ZMZ A;  5L3D A;  3WGH A;  2D2W A;  1ODD A;  1TNT A;  2TDX A;  2G7H A;  3ZN1 A;  1FY7 A;  1B9N A;  2HR3 A;  1LB2 A;  5FO5 A;  1I1G A;  2JPB A;  3I5U A;  1D5V A;  4XLP F;  5ICF A;  4HQE A;  3GFM A;  5CVU A;  3E6D A;  5IT9 Z;  1D3Y A;  4UV9 A;  3TDZ C;  2P4W A;  1BI3 A;  1P92 A;  4G6Q A;  3W6K B;  3FMR A;  3SZP A;  4LGW A;  1S6L A;  1F5T A;  3F6O A;  2BYV E;  2GZW A;  5D5W B;  3IWZ A;  4RS8 A;  2OBP A;  2UXX A;  5DCM B;  3IL2 A;  1LEB A;  1J2X A;  1YTY A;  3WGG A;  1A04 A;  4OMZ A;  4ON0 A;  5JHU A;  1IN5 A;  4FX4 A;  3Q5F A;  3V8K A;  1IN8 A;  1XGM A;  2F5F A;  2RNJ A;  2PMH A;  2W57 A;  3FZV A;  2H94 A;  1QQI A;  2CWE A;  3MEX A;  2IJL A;  2FMY A;  2W24 A;  1WKM A;  4PGG A;  1MZB A;  1QPM A;  2ZNZ A;  4MEY F;  1G3W A;  3CUQ A;  5FD5 A;  3HRM A;  2ZJ2 A;  2L54 A;  3LA3 A;  4BXU A;  3FXU A;  3BDD A;  1U5T C;  4IXA A;  4BAY A;  5BOX A;  2BBY A;  4ZZL A;  2YSR A;  1ZN2 A;  4ZZD A;  1EH6 A;  2QWW A;  1TLH B;  3RYR A;  3FXR A;  3Q9S A;  2HTS A;  2XAS A;  2XAH A;  5E1X A;  1KA8 A;  1OYI A;  1IRG A;  4G7Z F;  1K78 B;  1FWZ A;  5ILU A;  4FX0 A;  2ACJ A;  2KJB A;  5D6F A;  1E17 A;  2P5V A;  5KK1 A;  2GA2 A;  1W7P B;  4R79 A;  2FML A;  1U5T B;  5L3F A;  4IJA A;  2A61 A;  1O3S A;  2XGX A;  4UNO A;  4LFU A;  3G73 A;  4ENK A;  5LBQ A;  1YS6 A;  3K1N A;  1T0F A;  1XB4 A;  5F1R A;  4LG0 B;  4DQ2 A;  3DFG A;  2PBI A;  4NQW A;  1BC7 C;  4P96 A;  2HWV A;  3U2R A;  2EK5 A;  5D5X B;  3DV8 A;  1R58 A;  1R1T A;  4G6D A;  4M9X A;  4RGR A;  1VTN C;  2QBY A;  5LHH A;  4L9T A;  2KJC A;  2DQR A;  1V4R A;  3LA7 A;  4N9H A;  3CO7 C;  2Z99 A;  5CYV A;  3K1M A;  3BOQ A;  4OOI A;  4RB0 A;  2C6Y A;  3WU0 A;  2STW A;  1YG2 A;  2K4J A;  4HF1 A;  4HV6 A;  4Q48 A;  4EJT A;  1Z6R A;  2HYF A;  3SZT A;  3KP5 A;  3RIR A;  3I71 A;  2VT3 A;  3EUH A;  3GFI A;  3DKW A;  1QNT A;  4GYG A;  1SAX A;  2PI0 A;  3QP5 A;  3BJA A;  1XGS A;  2AS5 F;  2HOE A;  5BPD A;  1FLI A;  5EEG A;  2GIV A;  4EM0 B;  5LRR A;  5D6E A;  3GVA A;  3GZ6 A;  2XAG A;  3P9C A;  2PQ8 A;  3T8R A;  3JAM Z;  3DEU A;  4G7H F;  3VEP A;  3RPU A;  2KIU A;  2LF8 A;  1W4M A;  2RV8 A;  3FMS A;  2WTE A;  2M30 A;  4OIN F;  5DCF A;  1UB9 A;  1YQA A;  5D8L B;  3V4G A;  1XCB A;  3M1E A;  3GUD A;  4ETS A;  4LK1 F;  1UST A;  2IT0 A;  4AIJ A;  4MNU A;  3BJ6 A;  2ZFW A;  5D4S A;  3MAJ A;  1FYK A;  2VON A;  2MC3 A;  4PGH A;  4ENJ A;  1J7K A;  1ZLK A;  1DDN A;  1XSX A;  3TGN A;  2E1N A;  3SHF A;  2XAJ A;  2NS0 A;  4A6E A;  1R5H A;  1LNW A;  5BS6 A;  2Y75 A;  1B1B A;  1LEA A;  1MJA A;  4HOB A;  3JSO A;  2QM3 A;  1BI0 A;  3GEZ A;  2P6T A;  2VBY A;  1V3F A;  3QP6 A;  4L5J A;  1FP1 D;  4LJZ F;  4LK0 F;  3M9A A;  5HDN A;  1MDM A;  2WWY A;  1TBX A;  4R1H A;  4WXC A;  1FOK A;  1MJ9 A;  1YW9 A;  3GFJ A;  2CO5 A;  1WSU A;  2M87 A;  4GGG A;  1OYY A;  3L7W A;  4HA8 A;  1YW8 A;  2IA1 A;  4YFX F;  5L3C A;  2F5E A;  2HZT A;  5A2Q Z;  2GA1 A;  3P7N A;  5HOO A;  1P6R A;  5ICG A;  2A6H F;  4WK8 F;  3U1D A;  2QQA A;  3KE2 A;  3RTR A;  2VBZ A;  2FEZ A;  4ZH4 F;  4IVN A;  2DPU A;  4HZF A;  1K78 A;  3SXY A;  4U7B A;  1XGO A;  3B02 A;  4A12 A;  1IN4 A;  3E3V A;  3F22 A;  3ML6 A;  4HX7 A;  3H3U A;  4KMF A;  1TQP A;  4KFC A;  1G3S A;  1ONV A;  1HST A;  3MZY A;  2XRN A;  3S2W A;  4S04 A;  1U5T A;  4BHB A;  3F8F A;  5F6F A;  1U2W A;  1XMA A;  2VOO A;  4Z2Y A;  1R00 A;  1ZG1 A;  2P5K A;  2W85 A;  1H0M A;  4WF2 A;  2PEX A;  4L9V A;  4KYW A;  4LG0 A;  3T0Y A;  1EH8 A;  2M45 A;  2V1U A;  2A3S A;  1R1U A;  3CUO A;  4HYE A;  4NB5 A;  3WTU C;  1NHA A;  4O3M A;  2RN7 A;  3P9I A;  2LF7 A;  1GXQ A;  2QZ8 A;  1IRF A;  2XKP A;  3MZH A;  1T2K A;  2RC4 A;  2QEN A;  4AVP A;  3KCC A;  2O61 A;  4KMU X;  3F8N A;  3REO A;  4CDG A;  2K27 A;  1KGS A;  4A5M A;  1Z91 A;  3DPL C;  2GWR A;  1FT9 A;  3IRR A;  3KEQ A;  1BOA A;  4YG2 F;  3WG9 A;  1F9N A;  4RGU A;  3KEO A;  4YFN F;  5CJ9 A;  1Y0U A;  2GXG A;  4IHT A;  3HRS A;  4CYD A;  5HS8 A;  1KU9 A;  4YFK F;  2P5L C;  3WGI A;  2MH2 A;  4BHP A;  4MEX F;  1X3U A;  2HQR A;  1I6X A;  2V1D A;  4I02 A;  2XVC A;  5ICE A;  2XHK A;  4ENM A;  1Q1H A;  4EJW A;  2JT1 A;  3LA2 A;  2HKX A;  3V8L A;  3IC7 A;  5FFX A;  2L4M A;  1B6A A;  4AIK A;  3GW2 A;  4MGR A;  1QGP A;  3C3W A;  3QAH A;  3R61 A;  3LAP A;  1FYM A;  3HOS A;  2EFQ A;  3E5X A;  4B09 A;  3I59 B;  2IA0 A;  4I2O A;  3NEU A;  3U9G A;  3EYY A;  2LSO A;  4CZZ A;  1J9I A;  1IAW A;  1ZG3 A;  3I58 A;  1LQ1 A;  3HSF A;  1TQI A;  4BH9 A;  2V9V A;  2A5Y B;  2XIG A;  3PQK A;  1CF7 B;  2BGC A;  2FRH A;  3KET A;  5K5R A;  3TO9 A;  3L2C A;  3LQR A;  3BRO A;  3M7G A;  5J8F A;  4ENN A;  4EQQ A;  3HHH A;  4WWC A;  4L0Z B;  5ILS A;  5DD4 A;  1CGP A;  3IWF A;  1B9M A;  2P7V B;  3MCZ A;  3RYP A;  5E20 A;  5HLI A;  2F5D A;  4PDK A;  1DPR A;  2FSW A;  2M1B A;  2ZBK A;  3P9K A;  1XSD A;  4IF4 A;  1GXP A;  3FMQ A;  4KIG A;  3E5U A;  3C1D A;  1MGT A;  2ZNY A;  3HUG A;  4OIP F;  3TO7 A;  1XD7 A;  4P9F A;  2G7U A;  3V7C A;  3GO5 A;  1DPU A;  2DU9 A;  2FNA A;  1D8J A;  1O3T A;  1T6S A;  5LGT A;  1Z7U A;  5HLH A;  2HEO A;  4XBF A;  4IHS A;  3FHZ A;  3MQ0 A;  3M8F A;  2UZK A;  4N9I A;  1E2X A;  1L0O C;  1PP8 F;  1HSJ A;  5DUK A;  3V7S A;  1SFU A;  4BNC A;  2CFX A;  2Q0O A;  2XV4 S;  5FLX K;  2PLY A;  5ED4 A;  1UHW A;  3M8E A;  5FD6 A;  4S05 A;  1ZAO A;  3T8T A;  2ZCW A;  2RVC A;  1J75 A;  1R22 A;  4Y15 A;  4M72 A;  2HKO A;  5H6R A;  4I98 B;  4ZYD A;  1JXS A;  1R5G A;  2HYG D;  3ECO A;  3ZMV A;  3ROU A;  5EEH A;  1TTY A;  2ESH A;  3T1B A;  1Z05 A;  3SFZ A;  1BBY A;  1OKR A;  4M73 A;  2KRF A;  1ZYR F;  3ABT A;  5CVR A;  5LEK A;  1Z6T A;  2OQR A;  4YIF A;  4HX8 A;  3K1P A;  3LWF A;  3VFZ A;  3L09 A;  2Q2E A;  1TW2 A;  4GO1 A;  2K4B A;  1KQ8 A;  3DXJ F;  3ULQ B;  4R8H A;  3LAJ A;  2VC0 A;  2PMU A;  1SD4 A;  3KZY A;  2YU3 A;  4QWQ A;  4EGZ A;  2R7D A;  4XLN F;  3HRU A;  1HBX G;  3CTA A;  3KLO A;  1HKS A;  4HLX A;  4EJO A;  5E17 F;  2DPD A;  4I09 A;  4O6J A;  4KUM A;  4A0Y A;  1I5Z A;  4IPA A;  3KP2 A;  1YLF A;  5K5O A;  5DEQ A;  2A68 F;  1BJA A;  1IN7 A;  2FF4 A;  3VOD A;  2VBX A;  3IKV A;  3WE3 A;  1RI7 A;  5AIQ A;  1ZHF A;  4F7Z A;  4RAZ A;  3RJP A;  1XDU A;  1PP7 U;  4RGX A;  3BJO A;  1G6N A;  5BMZ A;  2O03 A;  2R3S A;  1KYZ A;  3K2Z A;  1UCR A;  3RI4 A;  2QLZ A;  4HQM A;  5DV5 A;  3BZ6 A;  2IVM A;  5K1Y A;  5J8C A;  1IW7 F;  2OZU A;  2HDC A;  3I59 A;  2VT2 A;  3D0S A;  1LDJ A;  5ERI A;  2KIF A;  1MD0 A;  3ZP5 A;  3I4P A;  1BIA A;  3TQN A;  2ADU A;  1YW7 A;  2O3F A;  5FB2 A;  3I0T A;  4M6Y A;  1HW5 A;  2YX7 A;  1CF7 A;  1MJB A;  5BQT A;  3HTS B;  1S8N A;  3CLO A;  3K9T A;  4CIC A;  3BPX A;  5J6X A;  3O6B B;  4HF0 A;  1IXC A;  2FNP A;  3I54 A;  1STZ A;  1L3L A;  2UWM A;  2ISZ A;  3GWZ A;  4KN4 X;  1WQ2 A;  3V7R A;  1PUE E;  3H92 A;  1R1V A;  4ZYH A;  2WC2 A;  3LST A;  2D1H A;  1JGS A;  2A69 F;  1IN6 A;  2L01 A;  3ZMD A;  3HTU A;  3JW4 A;  3FF5 A;  1D8K A;  5DCM A;  1G3Y A;  1Z9C A;  1HW1 A;  3EQL F;  2IRF G;  4CGZ A;  2CW0 F;  3QRF F;  1TQM A;  4A6D A;  4MTE A;  1B4A A;  1SMY F;  2P6S A;  2RDP A;  5JI6 A;  4OMY A;  2L02 A;  1U8R A;  1SD6 A;  2VC1 A;  2DO7 A;  2F2E A;  1BI1 A;  3V8J A;  1KYW A;  2OA4 A;  5ICC A;  2MLK A;  3QPH A;  2RGV A;  3RKW A;  4CO8 A;  3C18 A;  4P5O A;  4G8X A;  3F21 A;  1BN5 A;  1U6G A;  4RGS A;  3KP3 A;  2VE8 A;  1USS A;  3WTT C;  2H27 A;  4KDP A;  2EFN A;  2EJR A;  1RNL A;  2IA2 A;  3IHU A;  2KIM A; 
#chains in the Genus database with same CATH topology
 1XTA A;  1DGW Y;  4ABZ A;  2R7W A;  3NRV A;  2FBI A;  1F1Z A;  5IY5 H;  1VND A;  4NHJ A;  1FSH A;  4UUV A;  1B8I B;  2E19 A;  1PJR A;  4P9U A;  1H9G A;  2VUM J;  1Z7L A;  5CVI A;  5M3M J;  1EH7 A;  1YS7 A;  2VXZ A;  4UV8 A;  1X58 A;  2R4G A;  2JQ7 A;  3GF2 A;  1S7A A;  1LJ9 A;  1ZAR A;  3W6J B;  2CYY A;  5D8K B;  1T98 A;  5J47 A;  1OMI A;  3ASN H;  4AD9 A;  4A3K J;  2BY0 A;  4HF2 A;  4ZJZ A;  1AOY A;  2EFW A;  2CW7 A;  5LHI A;  4YEJ A;  1QA6 A;  3OYC A;  2MH9 A;  2ELK A;  1W7P A;  3TOA A;  4EJV A;  4RAG A;  3MKZ A;  5TRD A;  2WV0 A;  4O5V A;  3E6B A;  1D1A A;  1ON2 A;  2CG4 A;  2WAD A;  3CES A;  1ZG5 A;  5AON A;  2DN0 A;  2EFP A;  1YRN A;  2DK8 A;  3S1M J;  2QSF X;  2UUZ A;  2Y30 A;  2NAZ A;  3G4S I;  3H3Z A;  1XCV A;  4C9Y A;  1OQY A;  3F72 A;  5HNF A;  4PZJ A;  2Q8K A;  4C2T A;  4MTD A;  4NC6 A;  3JTG A;  2NNN A;  4PSX A;  4CXF A;  1VQK I;  3HSE A;  4WXH A;  4E70 A;  3S93 A;  1O7F A;  2FJ1 A;  5FKN A;  4DGW B;  3HOX J;  4KNY A;  2OZ6 A;  4HDU A;  4JQF A;  9ANT A;  1R36 A;  5HDG A;  4FET A;  3FXJ A;  1FMV A;  2DI3 A;  1MW7 A;  1I39 A;  2XRO A;  1BR1 A;  3BCA A;  1KU7 A;  5JVT A;  2H8W A;  3BG6 A;  4KT5 C;  4Z6Y A;  5FJ8 J;  2CW8 A;  3J81 K;  3LOC A;  3F3X A;  1KQ9 A;  2OV7 A;  3K2A A;  4L9N A;  1OIS A;  3GTL J;  2JRT A;  1SVL A;  4IOA F;  1KU3 A;  2MA3 A;  2DAO A;  1QHG A;  3VSL A;  2P8T A;  2F4I A;  1G4D A;  3Q3S A;  1YYV A;  2HXI A;  2LTP A;  2Y69 H;  3H35 A;  3I4N J;  2V6C A;  4EMS A;  2YR2 A;  4LLN A;  1JTY A;  2EZH A;  2VPL A;  3VYR B;  2Z9O A;  3E5Q A;  2EWN A;  3HOY J;  1Y39 A;  1XS9 A;  2NVU B;  2DOA A;  2K02 A;  2UXN A;  5HDK A;  3PFI A;  5FKL A;  2WY7 Q;  3HDD A;  2NOG A;  4CCN A;  3F8B A;  3KLN A;  1DU6 A;  3LSM A;  1IGN A;  4JP0 A;  2DDB A;  1V54 H;  3HC7 A;  2DFH A;  3HYI A;  3LMM A;  1S29 A;  4QIW N;  2OQG A;  4RMN A;  2VOD A;  1RUO A;  5LEJ A;  1N77 A;  4KN7 X;  4NQW B;  4BBR J;  1OFC X;  1OR7 A;  2BY2 A;  3SQN A;  3HM5 A;  4ZDP A;  1X2N A;  4ZYG A;  4IKF A;  1DGR M;  2JWT A;  2G0E A;  5LRS A;  5HS7 A;  3ZN0 A;  3GTG J;  2E2J J;  4L9J A;  5HVQ C;  2EA4 A;  5E18 F;  3QPS A;  1O3R A;  4B3X A;  3P5J A;  2NRA C;  1ZGW A;  4BJ5 C;  4IRG A;  1OCT C;  3PIP F;  2MBF A;  3G3Z A;  4ITV A;  3TDU C;  3D1N I;  4MQV A;  2TRT A;  2LK2 A;  3E6C C;  3VB2 A;  3A02 A;  1W36 D;  2QKL B;  1G59 A;  3QU6 A;  2JSC A;  4UUT A;  3RCO A;  5CKT A;  2MSY A;  2OD5 A;  5B66 C;  1QPI A;  1JI8 A;  5LHG A;  5L3E A;  3QQA A;  3FXM A;  4UVB A;  5CVJ A;  2K9L A;  4A5N A;  3BR0 A;  4MFD A;  2CSO A;  3J7A O;  1YX3 A;  1P7I A;  3NQO A;  4GCV A;  3WTW C;  2BXY A;  2HI3 A;  1U8B A;  4L0Y B;  3SEQ A;  3ZRG A;  3HIF A;  2XKO A;  2DLL A;  5FKK A;  4D0P A;  2A07 F;  3J80 K;  2HTJ A;  3HSR A;  5HNH A;  2CRG A;  4KIS A;  3VOE A;  2EQR A;  2E2H J;  4A3B J;  2M0C A;  1TW3 A;  2AXT C;  4KIC A;  2FBK A;  1WGX A;  3K70 C;  3TMO A;  4EVI A;  3TBI A;  1YJ9 I;  1J59 A;  3GFL A;  3HOZ J;  5HOD A;  2IS6 A;  3KIO A;  1LVK A;  2DTR A;  2HXO A;  1H9T A;  2X6O A;  3C2G A;  2KRH A;  3HPH A;  4ESJ A;  3LSP A;  4CHU A;  2FXA A;  4N0B A;  4DIQ A;  1FBU A;  3K6G A;  3ABK H;  5DD8 A;  4B4C A;  5F0H A;  3IRQ A;  2JA6 J;  1TWG J;  4ESB A;  2IAI A;  5LLQ A;  4HNT A;  1EV7 A;  1Z1D A;  3S15 J;  4P55 A;  4EJU A;  1K6O A;  2ZO4 A;  3ISP A;  2CH0 A;  3S3M A;  2CFO A;  3JTH A;  3WE2 A;  1IF1 A;  1SD7 A;  1E0E A;  1Y0N A;  2LVS A;  1APL C;  5H20 A;  3VDX A;  5D5U B;  1MBF A;  2ETH A;  2E5N A;  2ZME C;  2KLO A;  3BTI A;  1LE8 B;  2XF5 A;  4RA2 A;  4YII A;  3CME I;  3G1O A;  1UHM A;  3DEE A;  5LGN A;  4PCQ A;  4HNU A;  2M9H A;  3L9F A;  1REP C;  4LMY A;  4XSX F;  3OYF A;  3DTK A;  3S14 J;  1SMT A;  5F08 A;  2E35 A;  2IXS A;  3LNQ A;  1I3Q J;  2O5R A;  4MLO A;  4BYY A;  1FOY A;  2DFE A;  2B0L A;  2H09 A;  3VYU B;  2WY8 Q;  5IT9 K;  3HOT A;  3CC2 I;  1XMK A;  1LDK B;  2M34 A;  3DLA A;  5D4R A;  2JVH A;  4ASN A;  3JRH A;  4E7L A;  2F48 A;  3HKZ N;  1IXR C;  3FWE A;  4AIH A;  3C2H A;  1AWC A;  1TL8 A;  1V55 H;  2QA4 I;  3K0L A;  5FRM A;  2PN6 A;  2QUF A;  3RSN A;  2ZME B;  2HVQ A;  1SEU A;  1IZ1 A;  4QLC U;  1VQL I;  4FHT A;  2XGC A;  5IYD J;  1ZRF A;  1SFE A;  4I0B A;  1N78 A;  2NOJ B;  3KZZ A;  1FIA A;  5F64 A;  2LRE A;  3MFK A;  5FGM A;  3HKZ A;  4CCO A;  3A0B C;  1JE8 A;  3F8C A;  1MNM C;  4HBL A;  5TIS C;  3OV8 A;  4E7K A;  4AVZ A;  1B59 A;  4U0Y A;  1FZP B;  4PFO A;  3TO6 A;  5FLX Z;  4RLQ A;  2V9K A;  3EDP A;  3WTY C;  1K4S A;  4XNF A;  3MWM A;  1SFO J;  2E1C A;  1S5L C;  2FU4 A;  3DCF A;  3R4K A;  5DYM A;  1I27 A;  4JOM A;  4OIR F;  1F4K A;  2L3D A;  2HOA A;  3FM3 A;  4WCG A;  2F5C A;  1K79 A;  2VBW A;  1T08 B;  3GZ5 A;  2FA5 A;  4C2M J;  1MDM B;  4OIQ F;  3CZ6 A;  2G9W A;  1QZE A;  2EA2 A;  3HXL A;  1LUJ B;  2X51 A;  4IRI A;  1TNS A;  2FOK A;  5FRO A;  3OYE A;  5FFZ A;  3QYB A;  1ETQ A;  1T8I A;  5FLV A;  5C4X J;  1POG A;  4EV0 A;  3ZQF A;  3O3K A;  2DT7 B;  2W84 A;  4IHX A;  1U9O A;  2PFB A;  3HHG A;  2VQH A;  4NC8 A;  2H6C A;  2NVQ J;  1NK3 P;  2VN2 A;  1BJZ A;  1IXS B;  3R0J A;  1P7J A;  5EYR A;  2BVM A;  5K5Q A;  2LBF A;  1XSV A;  1KQ0 A;  2X1D A;  4XRM A;  3OY9 A;  4RB1 A;  4EEF G;  5EG0 B;  2BEO A;  3F0C A;  1VZ0 A;  3OWT A;  2W00 A;  2JTV A;  1RIO H;  2LFB A;  2Y48 A;  3GXO A;  4HG2 A;  2DFI A;  1W1W E;  4X6A J;  4XRS G;  3ZOB A;  4EM2 A;  1NG6 A;  3WTZ A;  2MD5 A;  5CPR B;  3EYI A;  1I3A A;  1YIO A;  4G94 A;  2VJJ A;  4E4H A;  3F23 A;  1SD5 A;  4DZJ A;  4LB5 A;  1T38 A;  1IUF A;  2FX0 A;  3PQJ A;  2K85 A;  3QOD A;  1ITY A;  3RPQ A;  2FE3 A;  2M4K A;  2CV0 A;  4C30 A;  2DMP A;  3UNG C;  3WTS C;  2E71 A;  2HQN A;  2JPC A;  4RAY A;  4V2G A;  1ZLJ A;  3OS2 A;  3G71 I;  3WG7 H;  3QPT A;  2Z5U A;  1TWH J;  3TOB A;  1FP2 A;  2DT5 A;  3Q9V A;  1MMG A;  3I9V 2;  5HLG A;  4I0A A;  3U21 A;  1YFH A;  3IKT A;  1ERD A;  2RKH A;  1RUN A;  1A6Q A;  2ZFU A;  4PK4 A;  4U0V A;  1ZGA A;  1S72 I;  2PG4 A;  4MQ9 F;  3CF5 F;  5CLS A;  1X3Z B;  2F5V A;  2KDO A;  2UV1 A;  5FRN A;  3DQV C;  1I50 J;  2XAF A;  2R7R A;  3PJR A;  2LNB A;  2XUB A;  4U7D A;  1HW2 A;  3MD2 A;  4B47 A;  2ZXW H;  5HLT A;  3LL7 A;  5H2F C;  3W2W A;  2V1X A;  1WH5 A;  4RB3 C;  4Q5S F;  1M1E B;  2CQN A;  4D9J A;  4V2F A;  2NS8 A;  5KVR A;  2XRL A;  1QBJ A;  2XGE A;  4BXF A;  4KIB A;  2FQ3 A;  3TED A;  1OCP A;  1Z0X A;  1ZGJ A;  2X6Y A;  4M6X A;  3ECH A;  3RZO J;  5IOY A;  1OPC A;  2QQB A;  3ZPL A;  4X1E A;  3KP7 A;  1GLN A;  3JCU C;  2HYJ A;  1LVA A;  2JJ7 A;  3E97 A;  1ZRC A;  1XGN A;  2GXB A;  2L4A A;  4J00 A;  2J5O A;  2VJ4 A;  2HOT A;  5JFR A;  3F8M A;  1WJF A;  3KFW X;  4D1Q A;  1S7E A;  2L7M P;  2E2I J;  3LFK A;  4RBO A;  1G8X A;  5CQE A;  4HEA 2;  2A05 A;  1QVT A;  2ZKZ A;  4L18 B;  2ME0 A;  3KP4 A;  1WI9 A;  2HFH A;  3LSR A;  4A2U A;  1FC3 A;  2MD0 A;  2QVO A;  2GLO A;  4AM3 A;  4AYB N;  2AXL A;  5D5V B;  2XAU A;  3R60 A;  2XB0 X;  2Y0M A;  4D5C A;  3RZD J;  2KKO A;  2DK5 A;  1PUF B;  1RC9 A;  1N25 A;  4UVC A;  3K10 A;  1BM9 A;  5L3G A;  1JUP A;  2BE5 F;  2K7L A;  3QPL A;  4D7N A;  3DF8 A;  1FPQ A;  4B43 A;  2CQK A;  4HW0 A;  1R23 A;  4A0Z A;  2VXD A;  2V79 A;  4U87 A;  2NNY A;  1DP3 A;  5B5E C;  2BHZ A;  3BWG A;  1QHH D;  3ZCO A;  4AYB A;  1RES A;  1G3T A;  3HG9 A;  1Z3X A;  2DW4 A;  1ULY A;  3HPG A;  1FYL A;  4LG3 A;  4LLG F;  1WCM J;  4BE0 A;  2K9S A;  3GX4 X;  2W7N A;  3BZC A;  3ERE D;  2JA8 J;  4HLY A;  3CDL A;  3ZMS A;  1S9H A;  4I01 A;  5IYC J;  1QO0 D;  4Q47 A;  4WXD A;  3I56 I;  2DDA A;  2WA0 A;  1JHH A;  5AIP A;  2STT A;  4EGY A;  5E8G A;  4BDZ A;  4IO9 F;  2DA1 A;  4II3 A;  4L5I A;  4M71 A;  5IT3 A;  2E7X A;  1VQ5 I;  1YIJ I;  4WX9 A;  4A3F J;  5IP9 J;  4KA4 A;  3DPU A;  3ZR8 X;  4G7O F;  4Q4Z F;  2ELJ A;  3ZMT A;  2OU2 A;  1TT0 A;  3JAM K;  1J0R A;  3NAU A;  3CCY A;  3K4J A;  3FKJ A;  1ETW A;  3H9Q A;  3QOP A;  2QCO A;  4HDV A;  1HCR A;  1ZRD A;  4XLE A;  4M9S A;  3PSI A;  1KU2 A;  4UXN A;  3BY6 A;  2PJP A;  1JT6 A;  1SFX A;  2EIJ H;  3K4M A;  2XPV A;  3DPT A;  3H5A A;  3A1Y A;  5TJJ A;  5E3L A;  3O2P E;  2H6B A;  5M5X J;  4AWX B;  5BNG A;  3N4M A;  1P4X A;  2BW3 B;  3K4K A;  2DOF A;  2EFO A;  4HST A;  2EIM H;  4A3E J;  1WJE A;  4HAM A;  3RDI A;  3MKY B;  4M6V A;  2YUS A;  5LGU A;  3N97 A;  4HV5 A;  1OJL A;  2KHM A;  1IDZ A;  5EGO A;  3WOD F;  1K83 J;  1RR8 C;  1TT5 B;  3GYH X;  4EM1 A;  3BT9 A;  2XF6 A;  3Q0U A;  4U0W A;  5GPC A;  4RDU A;  2ZB9 A;  1FBQ A;  3BR3 A;  1WWX A;  3BZK A;  3R0A A;  4PUS A;  2D1V A;  2ZME A;  2QYO A;  2KQR A;  3T5X A;  3H9J A;  3LSK A;  4M9Z A;  3JRD A;  1T33 A;  1O57 A;  2ZXI A;  2M0M A;  3FBI B;  3E6M A;  3F6V A;  1LDD A;  2JN6 A;  4CCL A;  1YO5 C;  2X9D A;  1W0U A;  3BR6 A;  2IGM A;  4Y13 A;  1IUY A;  1S3J A;  5L3B A;  4XOP A;  2HGC A;  4OU0 A;  1VQ6 I;  2VB6 A;  3DBL B;  3K4B A;  4XK4 A;  4MIM A;  2IP2 A;  1D5Y A;  1Y6I A;  3KP6 A;  3S17 J;  2FBH A;  1I6H J;  3A4C A;  4Y17 A;  5KAI C;  4BQQ A;  2O0Y A;  5IOZ A;  2RQQ A;  1QZY A;  4B48 A;  2EV0 A;  1W7P D;  2R92 J;  2KIS A;  2O8X A;  2V6E A;  1BI2 A;  4LIU A;  4ZDL A;  3TL4 X;  4F55 A;  2JSP A;  2OJE D;  2XDV A;  4QTR A;  2XSD C;  2OAZ A;  1DP7 P;  2X4H A;  3OYK A;  5DDG A;  2ELH A;  3KYD B;  4PJM A;  4IEJ A;  2QGU A;  3CUQ C;  2EV6 A;  3I53 A;  3R6S A;  3IH2 A;  1GVJ A;  3CF2 A;  2L7K A;  3OOP A;  3BTJ A;  4IRH A;  3W2V A;  3GTQ J;  2A6E F;  1I1S A;  1OCZ H;  5B1A H;  1HXD A;  2XPW A;  2QSH X;  1HKT A;  4TV7 A;  2LY1 A;  2D45 A;  3AAF A;  1Y8R B;  1JHF A;  1V5F A;  2O6G E;  4KIF A;  2B7E A;  5JHF A;  2HS5 A;  5E8I A;  4B3A A;  4UUS B;  5A2Q K;  3G1M A;  5EG0 A;  3M4O J;  2IPQ X;  3DP7 A;  5JR3 A;  3CJN A;  2VOP A;  1WRJ A;  3GTO J;  1Z3Y A;  2CQ7 A;  4IQJ A;  2L7F P;  1ZR4 A;  1DUX C;  2PX9 A;  3BQY A;  2J5P A;  3AG3 H;  1HQC A;  1YJW I;  4M74 A;  3S1R J;  3DKX A;  3RKY A;  2EV5 A;  2AHQ A;  5BPI A;  2K9M A;  2M5W A;  4YIR X;  3L2W A;  3CUQ B;  2RQP A;  3C7J A;  3L2Q A;  3FX3 A;  1XN7 A;  3S1N J;  1FSE A;  2VLA A;  1U78 A;  4B44 A;  3CP2 A;  3FM5 A;  2X1E A;  4JK1 X;  2K86 A;  2MGQ A;  3CO6 C;  1MKM A;  2XF7 A;  3VYT B;  2K9Q A;  1OLT A;  2LC2 A;  1YX5 A;  2Z3Y A;  2ESN A;  4XKC A;  2CQQ A;  4ZDO A;  2R7F A;  3GTP J;  3QU3 A;  1GHC A;  3HRT A;  2HOS A;  2W25 A;  1NK2 P;  2R7V A;  2CS3 A;  2XB5 A;  1MSE C;  3ZMU A;  4UHT A;  1XMX A;  4C3J J;  5GAG J;  4RB2 C;  2L0K A;  4GYI A;  2VQL A;  5GP9 A;  3L00 A;  3LSI A;  1VQ9 I;  1X1B A;  4HSR A;  2BV6 A;  2R7Q A;  3H5N A;  4ZTJ A;  1T0F C;  2GQQ A;  3J81 Z;  1MBK A;  3FIS A;  3ZQ7 A;  1G2H A;  1R4N B;  2YPR A;  3JSP A;  2R7U A;  5HS9 A;  4CZC A;  2P7C B;  2IW5 A;  2VJI A;  2KP6 A;  3FHN A;  1ENH A;  2LYC A;  3FXQ A;  3GCM A;  4M3D A;  3PM1 A;  4ANJ A;  3RKX A;  1EKE A;  3Q0W A;  1D0Z A;  4I7H A;  3I4M J;  2DA6 A;  1U3E M;  1C0W A;  1FNN A;  4GXO A;  1UFM A;  3OL4 A;  4HX4 A;  2W1O A;  1U0J A;  4XMY A;  2KFD A;  3CDH A;  5KNL A;  2EBI A;  2M8G X;  5J4Y A;  4XSZ F;  2YX4 A;  2LDU A;  4G12 A;  3JRA A;  3BPV A;  1FX7 A;  3TKY A;  4XRF A;  1WI3 A;  1AKH A;  1XG1 A;  1T39 A;  3WTV C;  2ZJQ F;  1ON1 A;  2Q2E B;  4BU2 A;  2JZY A;  2V7F A;  3I64 A;  2MLG A;  4J01 A;  1R7J A;  6PAX A;  3WTX C;  1FBS A;  2BVL A;  3OR2 C;  1O3Q A;  2DYR H;  2OCC H;  2LKP A;  1XDS A;  4BUP A;  5DUI A;  4LB6 B;  4DNC A;  4A0X A;  4JBA A;  1MH3 A;  3GLX A;  1J5Y A;  4BQA A;  1PUF A;  2DBB A;  2EIK H;  1XC5 A;  3B73 A;  4M3G A;  1BC8 C;  1PDN C;  1RZ4 A;  4OIO F;  3EUH C;  4AU7 A;  2JUG A;  4FT8 A;  3PNV A;  3K69 A;  3UR3 C;  2QQ9 A;  3J7Y J;  3WU1 B;  4A3G J;  2LLK A;  1ZRE A;  3OR1 C;  1P4W A;  3CMY A;  3DTI A;  4U88 A;  2DYS H;  2QBY B;  1HC8 A;  4GFB A;  1RR7 A;  3ABU A;  4LD5 A;  1ZH5 A;  3ZQC A;  4G9Y A;  1MMA A;  3LQQ A;  1P2F A;  2F4M B;  2DQL A;  1DU0 A;  4A69 C;  1MND A;  1OYW A;  1GVD A;  2GAU A;  2CGP A;  3COA C;  2DJI A;  5E79 C;  2VQG A;  2JA2 A;  4LLL A;  1EF4 A;  1BIB A;  4K2E A;  5E1W A;  3J80 Z;  2LRD A;  4B8X A;  1SVM A;  2VE9 A;  2Z33 A;  5E1Z B;  1QZZ A;  2X0L A;  5H6Q A;  4H0E A;  4NNJ A;  2COM A;  2PMZ N;  3BP8 A;  4ZYE A;  2Y2Z A;  2YS9 A;  2EB7 A;  1P4A A;  3EET A;  4BHC A;  4MHG A;  2E7W A;  1S7O A;  1XX5 A;  1K7A A;  4OAZ A;  1FMW A;  1WJB A;  1U9N A;  1W5S A;  1GUU A;  4UVA A;  5ILV A;  3OYI A;  4BBS J;  1TWC J;  1P9Q C;  2NYX A;  2ZXJ A;  4DYC A;  3DBR B;  1VQP I;  3FKI J;  1O7L A;  2ISY A;  2XAQ A;  4PFP A;  3D5L A;  1IDY A;  2PMZ A;  2OF7 A;  2QF7 A;  3ELK A;  1W5T A;  2M8E A;  2X1C A;  4BEH B;  4ESF A;  1HKQ A;  4LIV A;  4W1U A;  2ECC A;  5CVV A;  4XID A;  1F36 A;  3J7A Y;  3IAM 2;  2BW3 A;  3KPH A;  3ZMZ A;  4IHW A;  5L3D A;  1IRX A;  5GAE J;  2RAE A;  3WGH A;  2D2W A;  1ODD A;  2IGN A;  1TNT A;  2R93 J;  2TDX A;  1FTT A;  2G7H A;  3EPZ A;  3ZN1 A;  4N4N B;  5DS9 A;  1FY7 A;  1B9N A;  2HR3 A;  1LB2 A;  5FO5 A;  2WV1 A;  1I1G A;  1IRZ A;  3HZJ A;  2JPB A;  1WFX A;  1VFC A;  3JRE A;  2IS4 A;  3KYC B;  2IS2 A;  1TWF J;  3AG2 H;  3I5U A;  2KRC A;  1D5V A;  4XLP F;  1B72 B;  4M3F A;  5ICF A;  4HQE A;  3OYM A;  3C2B A;  1ACI A;  2E1M C;  4IHY A;  2WAF A;  5GAH J;  3GFM A;  3IH4 A;  3PUF A;  5CVU A;  3E6D A;  3RKQ A;  5E3N A;  3IAS 2;  3FK7 A;  5IT9 Z;  1D3Y A;  1HDD C;  4UV9 A;  3TDZ C;  2P4W A;  3FXK A;  4DW6 A;  1BI3 A;  1P92 A;  4P1W A;  3TW6 A;  4G6Q A;  3LFU A;  3W6K B;  2NVY J;  3FMR A;  1FJL A;  3SZP A;  4LGW A;  1S6L A;  2VQC A;  1F5T A;  3F6O A;  4AUX A;  3CLQ A;  2R7T A;  3OYJ A;  2R5Z B;  2BYV E;  2GZW A;  5D5W B;  3IWZ A;  4RS8 A;  2OBP A;  2UXX A;  5DCM B;  3H9G A;  3IL2 A;  2X6X A;  2HDW A;  1LEB A;  2EIN H;  1J2X A;  2V26 A;  1YTY A;  1B8I A;  3E0J B;  3WGG A;  1A04 A;  4OMZ A;  4ON0 A;  3OYG A;  2E1M B;  5JHU A;  1IN5 A;  1HA8 A;  4FX4 A;  4CCM A;  3V8K A;  3Q5F A;  3ABL H;  4I6Z A;  2MC4 A;  2XPU A;  1YOV B;  2VPR A;  4UUS A;  1IN8 A;  1XGM A;  3BG9 A;  2F5F A;  4I76 A;  2RNJ A;  2PMH A;  2W57 A;  1FOW A;  3GTM J;  3FZV A;  2H94 A;  5F0F A;  1QQI A;  2CWE A;  1GT0 C;  2MG4 A;  3MEX A;  3H0G J;  1MBE A;  2IJL A;  2VI6 A;  2FMY A;  5DTD A;  1ZK8 A;  4XKB A;  3OMY A;  3CMM A;  2W24 A;  1WKM A;  4PGG A;  3LSJ A;  3GTK J;  1MZB A;  3BG3 A;  1QPM A;  2LG4 A;  4KT6 A;  2FOW A;  5C4J J;  4BQO A;  2ZNZ A;  1BW6 A;  2Q1Z B;  2GBY A;  4MEY F;  3U1K A;  3ERM A;  1G3W A;  3CUQ A;  2Y9Z A;  3AL0 C;  3DBH B;  5FD5 A;  3HRM A;  2ZJ2 A;  3K4N A;  2L54 A;  3LA3 A;  4F91 B;  2X85 A;  4BXU A;  4DJA A;  4XLF A;  3FXU A;  2EZL A;  1U5T C;  3BDD A;  4IXA A;  3ZQG A;  4BAY A;  5BOX A;  3MN2 A;  2BBY A;  4ZZL A;  4UB6 C;  4BQN A;  2YSR A;  1ZN2 A;  3WHB A;  4ZZD A;  1EH6 A;  2QWW A;  1TLH B;  3RYR A;  2M2E A;  3FXR A;  3Q9S A;  2HTS A;  4ZYA A;  2XAS A;  2XAH A;  1A31 A;  5J4V A;  3F9K A;  5E1X A;  1KA8 A;  1GV5 A;  1OYI A;  4HNV A;  3LSH A;  1TC3 C;  2KL4 A;  4NBQ A;  4XLH A;  1IRG A;  4G7Z F;  2DT6 A;  3ZQI A;  1RKW A;  3A0H C;  2CU7 A;  1K78 B;  1FWZ A;  5ILU A;  4FX0 A;  3LSG A;  2GOM A;  5DM6 F;  2ACJ A;  2K3F A;  2DTZ A;  4HPQ A;  1PYV A;  4I99 C;  2KJB A;  5D6F A;  3AL0 B;  4Y7N J;  1E17 A;  3SFI A;  1V5E A;  1XPX A;  2P5V A;  1CQT A;  1T95 A;  3MMY B;  3BR1 A;  3H36 A;  1X4P A;  5IYB J;  5KK1 A;  2GA2 A;  1W7P B;  1BA5 A;  4R79 A;  1E3H A;  2FML A;  1U5T B;  5L3F A;  1H88 C;  3OYB A;  1KZH A;  5K7Z A;  2K3P A;  2CUJ A;  4IJA A;  3IP4 B;  1YRN B;  1SAU A;  2A61 A;  1O3S A;  2XGX A;  4GDF A;  4UNO A;  2E1O A;  2DMT A;  4LFU A;  5J1U A;  3G73 A;  2BY1 A;  4ENK A;  1WHU A;  3A03 A;  3CJQ B;  5LBQ A;  1YS6 A;  3H3V K;  3K1N A;  4XOR A;  2F4O B;  2AQF A;  3CCQ I;  1T0F A;  1W5C C;  4PSW A;  4IOC F;  1XB4 A;  2N8G A;  5F1R A;  4E7H A;  4LG0 B;  1ZEL A;  4DQ2 A;  1JKO C;  3DFG A;  2PBI A;  4NQW A;  3CC7 I;  1JUM A;  2O9L A;  4UB8 C;  2M7B A;  3GZN B;  1BC7 C;  3E1S A;  4P96 A;  2HWV A;  2NVT J;  3U2R A;  2EK5 A;  3QOE A;  5M5Y J;  5D5X B;  3OYN A;  1RPW A;  3DV8 A;  1R58 A;  1R1T A;  4G6D A;  1VQO I;  4M9X A;  1IG7 A;  4XOT A;  1R6R A;  5F04 A;  4RGR A;  1ETO A;  4C3H J;  1VTN C;  3L2V A;  2R7O A;  2QBY A;  4QPQ A;  5LHH A;  2L9S A;  3HEF A;  1WJ5 A;  4L9T A;  3WHC A;  2KJC A;  3OIQ A;  2E60 A;  2KMU A;  4DYQ A;  2DQR A;  1V4R A;  3LA7 A;  4N9H A;  3CO7 C;  2Z99 A;  3PO2 J;  4RM2 A;  3TP0 A;  5CYV A;  3K1M A;  3BOQ A;  3W6V A;  4OOI A;  3VWB A;  2WAQ N;  1QU3 A;  1WJA A;  4RB0 A;  2C6Y A;  3WU0 A;  3KZI C;  2STW A;  1YG2 A;  2HQ5 A;  2K4J A;  3SZG A;  4HF1 A;  2DA7 A;  4IHV A;  3OIP A;  4HV6 A;  4Q48 A;  4FAS D;  4EJT A;  1Z6R A;  2DMN A;  1FEX A;  5EZH A;  2HYF A;  2WAQ A;  3L1P A;  3SZT A;  2HPM A;  3CCS I;  3KP5 A;  3RIR A;  3I71 A;  2VT3 A;  3EUH A;  3JRC A;  3GFI A;  2BY3 A;  3DKW A;  2HVR A;  1QNT A;  4GYG A;  4W97 A;  1IV6 A;  1SAX A;  2L5Q A;  3HL2 A;  1MMN A;  3G1L A;  3G6E I;  2L9N A;  2PI0 A;  2COB A;  2CUZ A;  3QP5 A;  1ZR2 A;  3BJA A;  1R9T J;  1XGS A;  2AS5 F;  4BKX A;  4BEH A;  2Z1D A;  3S16 J;  2VKE A;  2HOE A;  5BPD A;  1FLI A;  5EEG A;  2GIV A;  2ME6 A;  4EM0 B;  5LRR A;  5D6E A;  3GVA A;  1R4M B;  2DA5 A;  5J1Y A;  3KYL A;  1VQ4 I;  3GZ6 A;  1BR2 A;  5F27 A;  5IPA A;  3NAR A;  2QEX I;  1W36 C;  1YE9 A;  2P81 A;  2XAG A;  4JYK A;  1BW5 A;  3P9C A;  2PQ8 A;  1E3P A;  3T8R A;  5J3L A;  2JVG A;  3JAM Z;  1SC7 A;  3DEU A;  4G7H F;  3RPU A;  3VEP A;  1LE8 A;  2KIU A;  2LF8 A;  1W4M A;  2RV8 A;  3FMS A;  2WTE A;  4XR6 A;  2M30 A;  2Z16 A;  4OIN F;  4H4K C;  5DCF A;  3S1Q J;  1UB9 A;  1YQA A;  5D8L B;  2HPI A;  1HOM A;  2LMD A;  2LR8 A;  3V4G A;  4A3L J;  2CJJ A;  1WJD A;  1XCB A;  3M1E A;  3GUD A;  4QSH A;  1ZQ3 P;  4ETS A;  2GIZ A;  1Y1V J;  3JR9 A;  1OCO H;  3JRB A;  1Y1W J;  1Z21 A;  4LK1 F;  1UST A;  1UHS A;  2IT0 A;  3PNY A;  4AIJ A;  5JVG F;  3H5R A;  5M3F J;  4MNU A;  4N4O B;  3BJ6 A;  2ZFW A;  2HVS A;  5D4S A;  1UJ8 A;  1ZKG A;  4KIT B;  3MAJ A;  1FYK A;  2VON A;  2MC3 A;  4PGH A;  4ENJ A;  1J7K A;  2GM4 A;  4XON A;  3O8G A;  1ZLK A;  1DDN A;  4XLC A;  1A5J A;  1XSX A;  2ZSH B;  3A01 B;  3TGN A;  2R5Z A;  2E1N A;  3SHF A;  2XAJ A;  2P0W A;  2NS0 A;  4RLF A;  1R5H A;  2E34 A;  3ONQ A;  4A6E A;  1LNW A;  5GAD J;  4L5E A;  5BS6 A;  2Y75 A;  4MFE A;  5E3O A;  3CCJ I;  1B1B A;  1LEA A;  1MJA A;  4HOB A;  3JSO A;  2QM3 A;  1BI0 A;  2LKS A;  2ECB A;  3GEZ A;  2P6T A;  2VBY A;  1HF0 A;  1V3F A;  3BCB A;  4S0H B;  3QP6 A;  2M4G A;  4L5J A;  3A2K A;  3TP3 A;  1H89 C;  1FP1 D;  3GTJ J;  4LJZ F;  4LK0 F;  3M9A A;  5HDN A;  5F1J A;  1MDM A;  1NTC A;  1UMQ A;  5GTI C;  4LIT A;  2WWY A;  3D5S C;  3AG4 H;  1TBX A;  4R1H A;  4WXC A;  1FOK A;  1EJ9 A;  4IQ4 A;  4CUG A;  1MJ9 A;  1YW9 A;  3HB9 A;  3GFJ A;  2CO5 A;  1WSU A;  2M87 A;  2R7X A;  3EUK L;  4GGG A;  3W3C A;  1OYY A;  3L7W A;  4HA8 A;  3HUG B;  3VYS B;  1FIP A;  3H0D A;  1YW8 A;  1MMS A;  2IA1 A;  3DU6 A;  3S2H J;  4YFX F;  5L3C A;  1Z67 A;  2ID3 A;  3QYF A;  2F5E A;  1JJ8 C;  2HZT A;  2OCE A;  2GA1 A;  5A2Q Z;  3P7N A;  2A5W A;  5HOO A;  3X2Q H;  1P6R A;  5ICG A;  1Q1V A;  2R5Y B;  2DJN A;  2K40 A;  3CMA I;  2A6H F;  4WK8 F;  2A6T A;  4BE1 A;  1HLV A;  3U1D A;  1IJW C;  1TP4 A;  1LFP A;  2QQA A;  3KE2 A;  3RTR A;  4A3J J;  3BLY A;  1JKP C;  3ASO H;  1UZC A;  2VBZ A;  2FEZ A;  4ZH4 F;  4IVN A;  3OIO A;  3CCL I;  4A3I J;  4FE4 A;  2DPU A;  4HZF A;  3HOW J;  1K78 A;  1X1A A;  3SXY A;  4U7B A;  1XGO A;  2B9S A;  3B02 A;  4A12 A;  1IN4 A;  3E3V A;  1A6I A;  3F22 A;  3ML6 A;  4HX7 A;  3H3U A;  4E6K G;  4KMF A;  3M3Y J;  1TQP A;  4KFC A;  1G3S A;  1MH4 A;  4BS9 A;  1ONV A;  1BL0 A;  1HST A;  3MZY A;  1D0Y A;  2XRN A;  3S2W A;  4S04 A;  1TWA J;  1U5T A;  5EJC A;  3O8H A;  1T56 A;  3OS0 A;  1GV2 A;  4BHB A;  3F8F A;  5F6F A;  5LD2 C;  2WAE A;  3BC8 A;  1U2W A;  1XMA A;  1X1C A;  4BE2 A;  2VOO A;  5KCM A;  3MZ8 A;  1R00 A;  4Z2Y A;  1ZG1 A;  2EZI A;  1JUS A;  1R5I D;  2P5K A;  4LOC A;  2W85 A;  2R0Q C;  1H0M A;  4WF2 A;  2PEX A;  2NVX J;  4L9V A;  2LBF B;  3J7Z I;  4KYW A;  3GME A;  3QWL A;  4DOZ A;  4LG0 A;  1X4O A;  5JLW A;  3T0Y A;  1VI0 A;  1EH8 A;  1VQM I;  1BR4 A;  2M45 A;  2V1U A;  4F92 B;  3M07 A;  3ZQQ A;  3QYE A;  2M3A A;  2A3S A;  4PJ0 C;  3HJE A;  2EZK A;  4EAT A;  1SFK A;  1R1U A;  3CUO A;  4HYE A;  3FXL A;  3K7A J;  3KEY A;  1Y8Q B;  4MO7 A;  4M3E A;  4NB5 A;  2XGD A;  3WTU C;  1NHA A;  4O3M A;  2RN7 A;  3P9I A;  4BL0 B;  2LF7 A;  1GXQ A;  2QZ8 A;  3OSF A;  1IRF A;  4E7S A;  4Y4R A;  4ZTF A;  2I8D A;  2XKP A;  3MZH A;  4PJN A;  1T2K A;  2RC4 A;  2QEN A;  4AVP A;  4AID A;  3KCC A;  2O61 A;  3S2D J;  4KMU X;  3F8N A;  4BGD A;  3REO A;  4RAF A;  2K27 A;  3VPR A;  2W82 A;  4CDG A;  2HNH A;  2LKX A;  1KGS A;  3BG7 A;  2DFF A;  4A5M A;  2O7O A;  3PIO F;  1Z91 A;  3DPL C;  4JX5 A;  2GWR A;  1FT9 A;  2MAB A;  2TCT A;  2BHY A;  5GTH C;  3K4C A;  3PUB A;  3IRR A;  1N75 A;  3KEQ A;  1BOA A;  4YG2 F;  1RET A;  3PNT A;  3WG9 A;  3HGY A;  1F9N A;  4RGU A;  3KEO A;  1YHQ I;  1WH7 A;  4E7I A;  4YFN F;  5CJ9 A;  1R49 A;  1Y0U A;  2Y0S N;  2GXG A;  4IHT A;  3HRS A;  4CYD A;  5HS8 A;  1KU9 A;  4YFK F;  2P5L C;  4A3D J;  3WGI A;  2MH2 A;  3PFY A;  2CMP A;  4CCJ A;  2PJR B;  4BHP A;  5LFA A;  2Y0S A;  4MEX F;  1X3U A;  2HQR A;  1I6X A;  2V1D A;  4I02 A;  2HU9 A;  2XVC A;  2XHK A;  5ICE A;  5DM7 F;  4ENM A;  1Q1H A;  1JKR C;  4YEL A;  5FKO A;  4EJW A;  4AC0 A;  2JT1 A;  2ID6 A;  3LA2 A;  2HKX A;  4E7J A;  2EH3 A;  3CQZ J;  3V8L A;  3IC7 A;  1BOB A;  5FFX A;  2L4M A;  1B6A A;  4AIK A;  3PO3 J;  3E7L A;  2VJ5 A;  3GW2 A;  4MGR A;  1QGP A;  2DA4 A;  3C3W A;  3H1C A;  4IL6 C;  2H1K A;  3QAH A;  4QPO A;  3ZQH A;  3R61 A;  3LAP A;  1O4X A;  1FTZ A;  1FYM A;  1IV8 A;  3HOS A;  4CYC B;  2RRE A;  2EFQ A;  3CCM I;  3E5X A;  1HDP A;  4B09 A;  2V1N A;  3I59 B;  4D5F A;  1X1D A;  2IA0 A;  4I2O A;  3CJT B;  3NEU A;  5K7F A;  3DTE A;  2VKH A;  5IP6 A;  3L2R A;  4FQG A;  3U9G A;  3EYY A;  1D0X A;  2LSO A;  2L9R A;  4CZZ A;  4XKV A;  1J9I A;  4PJL A;  2DMU A;  1IAW A;  1ZG3 A;  3I58 A;  1LQ1 A;  3HSF A;  1TQI A;  4BH9 A;  2V9V A;  2A5Y B;  1FOX A;  3IV5 A;  2XIG A;  3CCU I;  1X3W B;  3PQK A;  1CF7 B;  2BGC A;  2E36 A;  3DU5 A;  3A01 A;  2FRH A;  3KET A;  5K5R A;  3TO9 A;  2KIQ A;  3PL8 A;  2LP0 A;  4XN0 A;  1YJN I;  3UKG A;  2AQE A;  3L2C A;  3LQR A;  3PSF A;  1VQ7 I;  2GOX B;  3BRO A;  3KX2 A;  3M7G A;  5J8F A;  3V42 A;  4ENN A;  3GLL A;  4EQQ A;  3HHH A;  4WWC A;  2GXA A;  4L0Z B;  1YI2 I;  2ZXH A;  3BG5 A;  5FLM J;  5ILS A;  5DD4 A;  1OCR H;  3DLL F;  1CGP A;  3IWF A;  1B9M A;  3CC4 I;  2P7V B;  3MCZ A;  3RYP A;  3AFH A;  2YU9 J;  5E20 A;  3OOU A;  5HLI A;  2F5D A;  3ZXS A;  2LH9 A;  3BQZ A;  4PDK A;  3WU2 C;  1DPR A;  2FSW A;  3BTL A;  2M1B A;  2ZBK A;  1K4T A;  3P9K A;  1XSD A;  2FQ4 A;  4CSW A;  4IF4 A;  1GDT A;  2DXI A;  1GXP A;  3FMQ A;  4Y33 A;  1VQN I;  4KIG A;  3E5U A;  3C1D A;  1MGT A;  2ZNY A;  5C44 J;  2CV1 A;  3HUG A;  3MKL A;  4OIP F;  3D5R C;  2MFZ A;  1XD7 A;  3TO7 A;  4P9F A;  2G7U A;  5M5W J;  3V7C A;  5EGO B;  3GO5 A;  1DPU A;  3FBN B;  2DU9 A;  2FNA A;  2HZD A;  1D8J A;  1O3T A;  1T6S A;  5LGT A;  1Z7U A;  5HLH A;  2X6W A;  2K5C A;  2HEO A;  4CA0 A;  4XBF A;  4IHS A;  5JLX A;  1MNE A;  2H8R A;  1UG0 A;  3FHZ A;  3MQ0 A;  1W0T A;  2R5Y A;  3M8F A;  2UZK A;  3OYL A;  4N9I A;  1NG7 A;  1WJC A;  2WBM A;  1E2X A;  4A93 J;  3BR5 A;  3NWT A;  2DMQ A;  1L0O C;  2DCE A;  5EF6 A;  1PP8 F;  1HSJ A;  5DUK A;  5FKM A;  3V7S A;  4J19 A;  3JRF A;  1UAA A;  2IGK A;  3SDB A;  3HOU J;  2XC7 A;  1SFU A;  4BNC A;  2CFX A;  2Q0O A;  2XV4 S;  5FLX K;  1WVR A;  2PLY A;  2CQX A;  1ZTR A;  2ZJP F;  5ED4 A;  4C2U A;  2W4S A;  1UHW A;  3M8E A;  5FD6 A;  2MW8 A;  1ORK A;  1YIT I;  1MBG A;  4S05 A;  1ZAO A;  3T8T A;  4DZP A;  2ZCW A;  3W2A A;  2DA3 A;  1QRY A;  3CP8 A;  4XIC A;  2LY9 A;  1KON A;  2RVC A;  3ESW B;  1J75 A;  2DOE A;  3L2U A;  1R22 A;  4Y15 A;  3M8J A;  4B1R A;  2H1L A;  4M72 A;  3RQ4 A;  2HKO A;  5H6R A;  3OYH A;  1DQU A;  4GRI A;  4I98 B;  4ZYD A;  1JXS A;  1R5G A;  2HYG D;  3ECO A;  4YRV A;  3OL3 A;  1SAN A;  3ZMV A;  2LY2 A;  1ETV A;  1J09 A;  2D5V A;  5EZG A;  1JJ6 C;  2OTJ I;  3SDG A;  2KDZ A;  2ICW G;  3CDI A;  2MYS A;  3ROU A;  3B6A A;  5EEH A;  2ZJR F;  4CH7 A;  1TTY A;  4E7Z A;  2JA5 J;  2ESH A;  4A3M J;  1SVO A;  3T1B A;  1ETX A;  3DEW A;  5EDN A;  4BJT A;  4BJ6 C;  4DBR A;  2VKD A;  1Z05 A;  2BOL A;  3SFZ A;  1BBY A;  1OKR A;  4M73 A;  3OYA A;  2KRF A;  1AA7 A;  1ZYR F;  1UG2 A;  3ABT A;  5CVR A;  2W48 A;  1TZL A;  3BR2 A;  1Z6T A;  4ZC3 A;  2OQR A;  4YIF A;  5LEK A;  1MSF C;  2QSG X;  4HX8 A;  2F6C A;  3K1P A;  4F3Q A;  2WB1 N;  2Y9Y A;  3LWF A;  3VFZ A;  3L09 A;  2B63 J;  2Q2E A;  3B6C A;  1V5G A;  3AKZ A;  2IS1 A;  1QVU A;  1TW2 A;  3IH3 A;  4GO1 A;  4F93 B;  2K4B A;  3G2B A;  1KQ8 A;  2EIL H;  1Z77 A;  1VF9 A;  4DBQ A;  4HRI A;  3EUA A;  3FK6 A;  3DXJ F;  2WB1 A;  3ULQ B;  3JRI A;  4R8H A;  2V9P A;  3LAJ A;  2JMW A;  3K4L A;  2VC0 A;  2PMU A;  1SD4 A;  3KZY A;  2YU3 A;  4QWQ A;  3CCR I;  4XL9 A;  4EGZ A;  2R7D A;  4JX6 A;  4XLN F;  2JK3 A;  3HRU A;  1HBX G;  1X19 A;  3CTA A;  5C3E J;  4BY1 J;  1OR7 C;  3KLO A;  1K61 A;  1HKS A;  2L2O A;  1A36 A;  1JT0 A;  3I3L A;  4HLX A;  4EJO A;  5E17 F;  1WPK A;  2DPD A;  2Y31 A;  4I09 A;  3CCE I;  2JRM A;  4O6J A;  2FUG 2;  4KUM A;  4A0Y A;  1I5Z A;  1AU7 A;  4IPA A;  3I55 I;  2NXN B;  3MKW B;  3DWL E;  3KP2 A;  3Q0V A;  4KJZ A;  1YLF A;  5K5O A;  5DEQ A;  1K6Y A;  3CJR B;  4RM3 A;  2A68 F;  1BJA A;  1IN7 A;  2FF4 A;  2VBX A;  3IKV A;  3VOD A;  3WE3 A;  2PJR A;  1RI7 A;  5AIQ A;  1ZHF A;  2CV2 A;  4F7Z A;  2I10 A;  2M7A A;  4RAZ A;  3RJP A;  5J1R A;  2BZT A;  3MVP A;  1XDU A;  1AKH B;  2JA7 J;  1PP7 U;  4RGX A;  4BXX J;  3BJO A;  1G6N A;  5BMZ A;  1X2M A;  4OAY A;  2O03 A;  3AG1 H;  5CQG A;  2R3S A;  3RPU D;  2HQA A;  5B1B H;  1KYZ A;  3K2Z A;  1UCR A;  3RI4 A;  3K70 D;  1EA3 A;  2QLZ A;  5EEA A;  4XQF A;  4HQM A;  5K7H A;  4JX4 A;  5DV5 A;  3BZ6 A;  4D7M A;  2XSJ C;  4CCK A;  2IVM A;  1JKQ C;  4XLA A;  2NS7 A;  5K1Y A;  3ABM H;  5J8C A;  4CYC A;  3FXO A;  1IW7 F;  3SJM A;  4XN3 A;  2IEK A;  2OZU A;  2HDC A;  3HBL A;  2VKV A;  1IO2 A;  2VT2 A;  3I59 A;  3D0S A;  1D1B A;  4FTH A;  3HGG A;  1LDJ A;  5ERI A;  4BY7 J;  2KIF A;  1MD0 A;  5IP7 J;  3NWS A;  3S8P A;  1OCC H;  3I4P A;  3ZP5 A;  1R71 A;  4XRS A;  4UY8 I;  1BIA A;  3TQN A;  4DYR A;  2ADU A;  1YW7 A;  4XKW A;  2Z2S B;  4C3I J;  5TGT A;  1LFU P;  2IGO A;  2O3F A;  1ETY A;  5FB2 A;  3I0T A;  4M6Y A;  3VSK A;  4BDY A;  3S3O A;  1HW5 A;  2YX7 A;  5B3S H;  2L9V A;  1VQ8 I;  1CF7 A;  1MJB A;  3GBG A;  3OYD A;  5BQT A;  4NC7 A;  2LD5 A;  3OS1 A;  3N05 A;  3HTS B;  2LOO A;  4X0G A;  1S8N A;  3CLO A;  1B72 A;  2OUM A;  2IBD A;  3K9T A;  3S3N A;  4CIC A;  3BPX A;  5J6X A;  1Y56 A;  4FIS A;  3O6B B;  3ZGK A;  2EPF A;  2O8K A;  3CD6 I;  4HF0 A;  1IXC A;  1LKX A;  2FNP A;  3I54 A;  1RKT A;  1STZ A;  1A35 A;  1L3L A;  2UWM A;  2ISZ A;  2VL8 A;  3IUO A;  5GPA A;  3GWZ A;  4KN4 X;  1WQ2 A;  1NH3 A;  3V7R A;  2HDD A;  1PUE E;  3H92 A;  2K9N A;  2BXZ A;  1X1P A;  1R1V A;  4ZYH A;  2WC2 A;  5F0C A;  1UEL B;  5KHD A;  3LST A;  4IX7 A;  2D1H A;  1JGS A;  2A69 F;  2KPM A;  3TW7 A;  5E3M A;  1IN6 A;  2L01 A;  3ZMD A;  3HTU A;  3FIW A;  4BAC A;  2X48 A;  3FF5 A;  3JW4 A;  4NUB A;  2L7Z A;  4IZZ A;  1D8K A;  4M3B A;  1H8A C;  5DCM A;  1ETK A;  1MIJ A;  1G3Y A;  2R7S A;  1Z9C A;  1HW1 A;  3SEZ A;  3EQL F;  2IRF G;  3JRG A;  4CGZ A;  2CW0 F;  3QRF F;  2CUE A;  1TQM A;  4A6D A;  3M1C A;  1JTX A;  2E5Z A;  2V4J C;  1B4A A;  4MTE A;  3ZQL A;  1E3O C;  1MBJ A;  1SMY F;  2P6S A;  2RDP A;  5JI6 A;  4NDL A;  2R7Z J;  4OMY A;  2DOD A;  2QQ8 A;  2L02 A;  1U8R A;  1SD6 A;  2VC1 A;  2QKM B;  4FE7 A;  1PVE A;  2DO7 A;  3SYT A;  2CUF A;  4FCY A;  1RRJ A;  2AO9 A;  1JGG A;  4G6T B;  5KAF C;  2F2E A;  2ZSI B;  2OTL I;  1D1C A;  1BI1 A;  3BTC A;  3FDY A;  3CCV I;  3OSG A;  3V8J A;  2FD5 A;  1AHD P;  3DKY A;  1KYW A;  2ZC2 A;  2KT0 A;  1IC8 A;  2OA4 A;  5ICC A;  4II2 A;  2MLK A;  4OWR B;  2VIX A;  3QPH A;  5J40 A;  2RGV A;  3RKW A;  4CO8 A;  3C18 A;  4P5O A;  3S32 A;  4G8X A;  3HOV J;  4Y3O A;  3F21 A;  1MMD A;  4A3C J;  1BN5 A;  4XM3 A;  1U6G A;  4RGS A;  1F43 A;  4Y52 J;  3KP3 A;  2VAS A;  2I5U A;  2KZV A;  2OPT A;  3RQI A;  2VE8 A;  1USS A;  2OC6 A;  1MBH A;  3WTT C;  1LFB A;  2H27 A;  1LPQ A;  4KDP A;  4V19 K;  2KZG A;  4PJJ A;  1WZ2 A;  2EFN A;  2EJR A;  2DA2 A;  1RNL A;  2IA2 A;  4F52 A;  3IHU A;  2RNG A;  2KIM A;  2JUC A; 
#chains in the Genus database with same CATH homology
 3NRV A;  2FBI A;  1F1Z A;  4NHJ A;  1FSH A;  4UUV A;  4P9U A;  1H9G A;  5CVI A;  1EH7 A;  1YS7 A;  2VXZ A;  4UV8 A;  3GF2 A;  1S7A A;  1LJ9 A;  1ZAR A;  3W6J B;  2CYY A;  5D8K B;  1T98 A;  1OMI A;  4AD9 A;  4HF2 A;  1AOY A;  2EFW A;  5LHI A;  2MH9 A;  1W7P A;  3TOA A;  4EJV A;  5TRD A;  2WV0 A;  4O5V A;  3E6B A;  1ON2 A;  2CG4 A;  1ZG5 A;  5AON A;  2EFP A;  2DK8 A;  2NAZ A;  3H3Z A;  1XCV A;  3F72 A;  4PZJ A;  2Q8K A;  4MTD A;  3JTG A;  2NNN A;  4CXF A;  3HSE A;  4WXH A;  4E70 A;  1O7F A;  4KNY A;  2OZ6 A;  4HDU A;  4JQF A;  1R36 A;  5HDG A;  2DI3 A;  2XRO A;  1KU7 A;  5JVT A;  4KT5 C;  3J81 K;  3F3X A;  1KQ9 A;  4L9N A;  2JRT A;  1KU3 A;  2MA3 A;  2DAO A;  2P8T A;  1G4D A;  1YYV A;  2V6C A;  4EMS A;  2YR2 A;  4LLN A;  2Z9O A;  3E5Q A;  2EWN A;  2K02 A;  2UXN A;  5HDK A;  3PFI A;  3F8B A;  3KLN A;  3HYI A;  1S29 A;  2OQG A;  2VOD A;  1RUO A;  5LEJ A;  4KN7 X;  1OR7 A;  3SQN A;  4ZYG A;  5LRS A;  5HS7 A;  3ZN0 A;  4L9J A;  5HVQ C;  2EA4 A;  5E18 F;  1O3R A;  2NRA C;  4IRG A;  2MBF A;  3G3Z A;  3TDU C;  4MQV A;  3E6C C;  3VB2 A;  3QU6 A;  2JSC A;  2OD5 A;  5LHG A;  5L3E A;  4UVB A;  5CVJ A;  4A5N A;  2CSO A;  3J7A O;  3NQO A;  4GCV A;  3WTW C;  4L0Y B;  3HIF A;  2XKO A;  2DLL A;  4D0P A;  2A07 F;  3J80 K;  2HTJ A;  3HSR A;  3VOE A;  1TW3 A;  4KIC A;  2FBK A;  4EVI A;  1J59 A;  3GFL A;  2DTR A;  1H9T A;  4ESJ A;  4CHU A;  2FXA A;  4N0B A;  1FBU A;  5DD8 A;  3IRQ A;  4ESB A;  5LLQ A;  1EV7 A;  1Z1D A;  4EJU A;  4P55 A;  1K6O A;  2ZO4 A;  3ISP A;  3JTH A;  3WE2 A;  1IF1 A;  1SD7 A;  5H20 A;  5D5U B;  2ETH A;  4YII A;  1UHM A;  5LGN A;  4PCQ A;  3L9F A;  1REP C;  4LMY A;  4XSX F;  1SMT A;  4BYY A;  2B0L A;  2H09 A;  5IT9 K;  3HOT A;  1XMK A;  1LDK B;  5D4R A;  4ASN A;  1AWC A;  1IXR C;  3FWE A;  4AIH A;  3K0L A;  2PN6 A;  2QUF A;  2ZME B;  1IZ1 A;  4QLC U;  4FHT A;  1ZRF A;  1SFE A;  4I0B A;  3KZZ A;  5F64 A;  3MFK A;  5FGM A;  1JE8 A;  3F8C A;  4HBL A;  3OV8 A;  1B59 A;  4U0Y A;  1FZP B;  3TO6 A;  5FLX Z;  3WTY C;  3EDP A;  3MWM A;  2E1C A;  2FU4 A;  3R4K A;  5DYM A;  1I27 A;  4OIR F;  1F4K A;  2L3D A;  3FM3 A;  4WCG A;  2F5C A;  1K79 A;  2VBW A;  3GZ5 A;  2FA5 A;  1MDM B;  4OIQ F;  2G9W A;  2EA2 A;  4IRI A;  1TNS A;  2FOK A;  5FFZ A;  4EV0 A;  3O3K A;  2W84 A;  2PFB A;  3HHG A;  2H6C A;  2VN2 A;  1IXS B;  3R0J A;  5K5Q A;  1XSV A;  1KQ0 A;  4RB1 A;  2BEO A;  2JTV A;  1RIO H;  2Y48 A;  3GXO A;  2DFI A;  4EM2 A;  3WTZ A;  2MD5 A;  3EYI A;  1YIO A;  4G94 A;  3F23 A;  1SD5 A;  4LB5 A;  1T38 A;  3PQJ A;  3RPQ A;  2FE3 A;  3WTS C;  2HQN A;  2JPC A;  4RAY A;  1ZLJ A;  3QPT A;  2Z5U A;  3TOB A;  1FP2 A;  2DT5 A;  3Q9V A;  5HLG A;  4I0A A;  1YFH A;  3IKT A;  2RKH A;  1RUN A;  4U0V A;  1ZGA A;  2PG4 A;  4MQ9 F;  5CLS A;  3DQV C;  2XAF A;  2LNB A;  2XUB A;  4U7D A;  1HW2 A;  2V1X A;  4RB3 C;  4Q5S F;  5KVR A;  1QBJ A;  4KIB A;  2FQ3 A;  1ZGJ A;  4M6X A;  3ECH A;  1OPC A;  2QQB A;  3ZPL A;  3KP7 A;  1ZRC A;  3E97 A;  1LVA A;  1XGN A;  2GXB A;  2L4A A;  2J5O A;  5JFR A;  3F8M A;  3KFW X;  3LFK A;  4L18 B;  2ZKZ A;  3KP4 A;  1WI9 A;  2HFH A;  4A2U A;  1FC3 A;  2QVO A;  2AXL A;  5D5V B;  3R60 A;  2Y0M A;  2KKO A;  2DK5 A;  4UVC A;  1BM9 A;  5L3G A;  2BE5 F;  2K7L A;  3DF8 A;  1FPQ A;  2CQK A;  4HW0 A;  1R23 A;  4A0Z A;  2V79 A;  2NNY A;  3BWG A;  1G3T A;  2DW4 A;  1ULY A;  1FYL A;  4LLG F;  3GX4 X;  3ERE D;  4HLY A;  3ZMS A;  4I01 A;  1QO0 D;  4Q47 A;  4WXD A;  5AIP A;  1JHH A;  2STT A;  4EGY A;  5E8G A;  4L5I A;  4M71 A;  5IT3 A;  2E7X A;  4WX9 A;  4KA4 A;  4G7O F;  4Q4Z F;  3ZMT A;  2OU2 A;  3JAM K;  1J0R A;  3QOP A;  4HDV A;  1ZRD A;  4M9S A;  1KU2 A;  4UXN A;  3BY6 A;  2PJP A;  1SFX A;  3DPT A;  5TJJ A;  3O2P E;  2H6B A;  4AWX B;  3N4M A;  1P4X A;  2EFO A;  4HAM A;  3RDI A;  5LGU A;  3N97 A;  4HV5 A;  3WOD F;  3GYH X;  4EM1 A;  4U0W A;  1FBQ A;  3R0A A;  1WWX A;  2D1V A;  2ZME A;  2QYO A;  3T5X A;  4M9Z A;  1O57 A;  3E6M A;  3F6V A;  1LDD A;  1YO5 C;  4Y13 A;  1IUY A;  1S3J A;  5L3B A;  2HGC A;  4OU0 A;  2IP2 A;  3KP6 A;  2FBH A;  4Y17 A;  2O0Y A;  1QZY A;  2EV0 A;  1W7P D;  2O8X A;  1BI2 A;  2OAZ A;  1DP7 P;  2X4H A;  5DDG A;  2ELH A;  3CUQ C;  2EV6 A;  3I53 A;  3R6S A;  1GVJ A;  3OOP A;  4IRH A;  2A6E F;  1I1S A;  1HXD A;  1HKT A;  4TV7 A;  2D45 A;  3AAF A;  1JHF A;  2O6G E;  4KIF A;  2HS5 A;  5E8I A;  5A2Q K;  2IPQ X;  3DP7 A;  5JR3 A;  3CJN A;  2VOP A;  1WRJ A;  1DUX C;  2J5P A;  1HQC A;  4M74 A;  3RKY A;  2EV5 A;  5BPI A;  2M5W A;  3CUQ B;  2RQP A;  3C7J A;  3FX3 A;  1XN7 A;  1FSE A;  1U78 A;  3FM5 A;  4JK1 X;  2K86 A;  3CO6 C;  1MKM A;  2Z3Y A;  2ESN A;  2R7F A;  3QU3 A;  1GHC A;  3HRT A;  2W25 A;  3ZMU A;  4UHT A;  4RB2 C;  4GYI A;  3L00 A;  2BV6 A;  2GQQ A;  3J81 Z;  3ZQ7 A;  2YPR A;  3JSP A;  5HS9 A;  2P7C B;  2IW5 A;  3FXQ A;  3RKX A;  4I7H A;  1U3E M;  1C0W A;  1FNN A;  4GXO A;  1UFM A;  4HX4 A;  3CDH A;  4XSZ F;  2YX4 A;  2LDU A;  3BPV A;  1FX7 A;  3TKY A;  4XRF A;  1T39 A;  3WTV C;  1ON1 A;  2JZY A;  3I64 A;  2MLG A;  1R7J A;  6PAX A;  3WTX C;  1FBS A;  1O3Q A;  2LKP A;  1XDS A;  5DUI A;  4LB6 B;  4DNC A;  4A0X A;  4JBA A;  3GLX A;  1J5Y A;  4BQA A;  2DBB A;  3B73 A;  1BC8 C;  1PDN C;  1RZ4 A;  4OIO F;  4FT8 A;  3K69 A;  2QQ9 A;  3WU1 B;  1ZRE A;  1P4W A;  4U88 A;  2QBY B;  3ABU A;  4LD5 A;  1ZH5 A;  4G9Y A;  3LQQ A;  1P2F A;  2DQL A;  1OYW A;  2GAU A;  2CGP A;  3COA C;  4LLL A;  1BIB A;  4K2E A;  5E1W A;  3J80 Z;  4B8X A;  2VE9 A;  2Z33 A;  5E1Z B;  1QZZ A;  2X0L A;  5H6Q A;  4H0E A;  2COM A;  3BP8 A;  4ZYE A;  2EB7 A;  1P4A A;  3EET A;  4BHC A;  4MHG A;  2E7W A;  1S7O A;  1K7A A;  1W5S A;  4UVA A;  5ILV A;  2NYX A;  2ZXJ A;  1O7L A;  2ISY A;  2XAQ A;  3D5L A;  3ELK A;  1W5T A;  2M8E A;  4ESF A;  1HKQ A;  5CVV A;  3ZMZ A;  5L3D A;  3WGH A;  2D2W A;  1ODD A;  1TNT A;  2TDX A;  2G7H A;  3ZN1 A;  1FY7 A;  1B9N A;  2HR3 A;  1LB2 A;  5FO5 A;  1I1G A;  2JPB A;  3I5U A;  1D5V A;  4XLP F;  5ICF A;  4HQE A;  3GFM A;  5CVU A;  3E6D A;  5IT9 Z;  1D3Y A;  4UV9 A;  3TDZ C;  2P4W A;  1BI3 A;  1P92 A;  4G6Q A;  3W6K B;  3FMR A;  3SZP A;  4LGW A;  1S6L A;  1F5T A;  3F6O A;  2BYV E;  2GZW A;  5D5W B;  3IWZ A;  4RS8 A;  2OBP A;  2UXX A;  5DCM B;  3IL2 A;  1LEB A;  1J2X A;  1YTY A;  3WGG A;  1A04 A;  4OMZ A;  4ON0 A;  5JHU A;  1IN5 A;  4FX4 A;  3Q5F A;  3V8K A;  1IN8 A;  1XGM A;  2F5F A;  2RNJ A;  2PMH A;  2W57 A;  3FZV A;  2H94 A;  1QQI A;  2CWE A;  3MEX A;  2IJL A;  2FMY A;  2W24 A;  1WKM A;  4PGG A;  1MZB A;  1QPM A;  2ZNZ A;  4MEY F;  1G3W A;  3CUQ A;  5FD5 A;  3HRM A;  2ZJ2 A;  2L54 A;  3LA3 A;  4BXU A;  3FXU A;  3BDD A;  1U5T C;  4IXA A;  4BAY A;  5BOX A;  2BBY A;  4ZZL A;  2YSR A;  1ZN2 A;  4ZZD A;  1EH6 A;  2QWW A;  1TLH B;  3RYR A;  3FXR A;  3Q9S A;  2HTS A;  2XAS A;  2XAH A;  5E1X A;  1KA8 A;  1OYI A;  1IRG A;  4G7Z F;  1K78 B;  1FWZ A;  5ILU A;  4FX0 A;  2ACJ A;  2KJB A;  5D6F A;  1E17 A;  2P5V A;  5KK1 A;  2GA2 A;  1W7P B;  4R79 A;  2FML A;  1U5T B;  5L3F A;  4IJA A;  2A61 A;  1O3S A;  2XGX A;  4UNO A;  4LFU A;  3G73 A;  4ENK A;  5LBQ A;  1YS6 A;  3K1N A;  1T0F A;  1XB4 A;  5F1R A;  4LG0 B;  4DQ2 A;  3DFG A;  2PBI A;  4NQW A;  1BC7 C;  4P96 A;  2HWV A;  3U2R A;  2EK5 A;  5D5X B;  3DV8 A;  1R58 A;  1R1T A;  4G6D A;  4M9X A;  4RGR A;  1VTN C;  2QBY A;  5LHH A;  4L9T A;  2KJC A;  2DQR A;  1V4R A;  3LA7 A;  4N9H A;  3CO7 C;  2Z99 A;  5CYV A;  3K1M A;  3BOQ A;  4OOI A;  4RB0 A;  2C6Y A;  3WU0 A;  2STW A;  1YG2 A;  2K4J A;  4HF1 A;  4HV6 A;  4Q48 A;  4EJT A;  1Z6R A;  2HYF A;  3SZT A;  3KP5 A;  3RIR A;  3I71 A;  2VT3 A;  3EUH A;  3GFI A;  3DKW A;  1QNT A;  4GYG A;  1SAX A;  2PI0 A;  3QP5 A;  3BJA A;  1XGS A;  2AS5 F;  2HOE A;  5BPD A;  1FLI A;  5EEG A;  2GIV A;  4EM0 B;  5LRR A;  5D6E A;  3GVA A;  3GZ6 A;  2XAG A;  3P9C A;  2PQ8 A;  3T8R A;  3JAM Z;  3DEU A;  4G7H F;  3VEP A;  3RPU A;  2KIU A;  2LF8 A;  1W4M A;  2RV8 A;  3FMS A;  2WTE A;  2M30 A;  4OIN F;  5DCF A;  1UB9 A;  1YQA A;  5D8L B;  3V4G A;  1XCB A;  3M1E A;  3GUD A;  4ETS A;  4LK1 F;  1UST A;  2IT0 A;  4AIJ A;  4MNU A;  3BJ6 A;  2ZFW A;  5D4S A;  3MAJ A;  1FYK A;  2VON A;  2MC3 A;  4PGH A;  4ENJ A;  1J7K A;  1ZLK A;  1DDN A;  1XSX A;  3TGN A;  2E1N A;  3SHF A;  2XAJ A;  2NS0 A;  4A6E A;  1R5H A;  1LNW A;  5BS6 A;  2Y75 A;  1B1B A;  1LEA A;  1MJA A;  4HOB A;  3JSO A;  2QM3 A;  1BI0 A;  3GEZ A;  2P6T A;  2VBY A;  1V3F A;  3QP6 A;  4L5J A;  1FP1 D;  4LJZ F;  4LK0 F;  3M9A A;  5HDN A;  1MDM A;  2WWY A;  1TBX A;  4R1H A;  4WXC A;  1FOK A;  1MJ9 A;  1YW9 A;  3GFJ A;  2CO5 A;  1WSU A;  2M87 A;  4GGG A;  1OYY A;  3L7W A;  4HA8 A;  1YW8 A;  2IA1 A;  4YFX F;  5L3C A;  2F5E A;  2HZT A;  5A2Q Z;  2GA1 A;  3P7N A;  5HOO A;  1P6R A;  5ICG A;  2A6H F;  4WK8 F;  3U1D A;  2QQA A;  3KE2 A;  3RTR A;  2VBZ A;  2FEZ A;  4ZH4 F;  4IVN A;  2DPU A;  4HZF A;  1K78 A;  3SXY A;  4U7B A;  1XGO A;  3B02 A;  4A12 A;  1IN4 A;  3E3V A;  3F22 A;  3ML6 A;  4HX7 A;  3H3U A;  4KMF A;  1TQP A;  4KFC A;  1G3S A;  1ONV A;  1HST A;  3MZY A;  2XRN A;  3S2W A;  4S04 A;  1U5T A;  4BHB A;  3F8F A;  5F6F A;  1U2W A;  1XMA A;  2VOO A;  4Z2Y A;  1R00 A;  1ZG1 A;  2P5K A;  2W85 A;  1H0M A;  4WF2 A;  2PEX A;  4L9V A;  4KYW A;  4LG0 A;  3T0Y A;  1EH8 A;  2M45 A;  2V1U A;  2A3S A;  1R1U A;  3CUO A;  4HYE A;  4NB5 A;  3WTU C;  1NHA A;  4O3M A;  2RN7 A;  3P9I A;  2LF7 A;  1GXQ A;  2QZ8 A;  1IRF A;  2XKP A;  3MZH A;  1T2K A;  2RC4 A;  2QEN A;  4AVP A;  3KCC A;  2O61 A;  4KMU X;  3F8N A;  3REO A;  4CDG A;  2K27 A;  1KGS A;  4A5M A;  1Z91 A;  3DPL C;  2GWR A;  1FT9 A;  3IRR A;  3KEQ A;  1BOA A;  4YG2 F;  3WG9 A;  1F9N A;  4RGU A;  3KEO A;  4YFN F;  5CJ9 A;  1Y0U A;  2GXG A;  4IHT A;  3HRS A;  4CYD A;  5HS8 A;  1KU9 A;  4YFK F;  2P5L C;  3WGI A;  2MH2 A;  4BHP A;  4MEX F;  1X3U A;  2HQR A;  1I6X A;  2V1D A;  4I02 A;  2XVC A;  5ICE A;  2XHK A;  4ENM A;  1Q1H A;  4EJW A;  2JT1 A;  3LA2 A;  2HKX A;  3V8L A;  3IC7 A;  5FFX A;  2L4M A;  1B6A A;  4AIK A;  3GW2 A;  4MGR A;  1QGP A;  3C3W A;  3QAH A;  3R61 A;  3LAP A;  1FYM A;  3HOS A;  2EFQ A;  3E5X A;  4B09 A;  3I59 B;  2IA0 A;  4I2O A;  3NEU A;  3U9G A;  3EYY A;  2LSO A;  4CZZ A;  1J9I A;  1IAW A;  1ZG3 A;  3I58 A;  1LQ1 A;  3HSF A;  1TQI A;  4BH9 A;  2V9V A;  2A5Y B;  2XIG A;  3PQK A;  1CF7 B;  2BGC A;  2FRH A;  3KET A;  5K5R A;  3TO9 A;  3L2C A;  3LQR A;  3BRO A;  3M7G A;  5J8F A;  4ENN A;  4EQQ A;  3HHH A;  4WWC A;  4L0Z B;  5ILS A;  5DD4 A;  1CGP A;  3IWF A;  1B9M A;  2P7V B;  3MCZ A;  3RYP A;  5E20 A;  5HLI A;  2F5D A;  4PDK A;  1DPR A;  2FSW A;  2M1B A;  2ZBK A;  3P9K A;  1XSD A;  4IF4 A;  1GXP A;  3FMQ A;  4KIG A;  3E5U A;  3C1D A;  1MGT A;  2ZNY A;  3HUG A;  4OIP F;  3TO7 A;  1XD7 A;  4P9F A;  2G7U A;  3V7C A;  3GO5 A;  1DPU A;  2DU9 A;  2FNA A;  1D8J A;  1O3T A;  1T6S A;  5LGT A;  1Z7U A;  5HLH A;  2HEO A;  4XBF A;  4IHS A;  3FHZ A;  3MQ0 A;  3M8F A;  2UZK A;  4N9I A;  1E2X A;  1L0O C;  1PP8 F;  1HSJ A;  5DUK A;  3V7S A;  1SFU A;  4BNC A;  2CFX A;  2Q0O A;  2XV4 S;  5FLX K;  2PLY A;  5ED4 A;  1UHW A;  3M8E A;  5FD6 A;  4S05 A;  1ZAO A;  3T8T A;  2ZCW A;  2RVC A;  1J75 A;  1R22 A;  4Y15 A;  4M72 A;  2HKO A;  5H6R A;  4I98 B;  4ZYD A;  1JXS A;  1R5G A;  2HYG D;  3ECO A;  3ZMV A;  3ROU A;  5EEH A;  1TTY A;  2ESH A;  3T1B A;  1Z05 A;  3SFZ A;  1BBY A;  1OKR A;  4M73 A;  2KRF A;  1ZYR F;  3ABT A;  5CVR A;  5LEK A;  1Z6T A;  2OQR A;  4YIF A;  4HX8 A;  3K1P A;  3LWF A;  3VFZ A;  3L09 A;  2Q2E A;  1TW2 A;  4GO1 A;  2K4B A;  1KQ8 A;  3DXJ F;  3ULQ B;  4R8H A;  3LAJ A;  2VC0 A;  2PMU A;  1SD4 A;  3KZY A;  2YU3 A;  4QWQ A;  4EGZ A;  2R7D A;  4XLN F;  3HRU A;  1HBX G;  3CTA A;  3KLO A;  1HKS A;  4HLX A;  4EJO A;  5E17 F;  2DPD A;  4I09 A;  4O6J A;  4KUM A;  4A0Y A;  1I5Z A;  4IPA A;  3KP2 A;  1YLF A;  5K5O A;  5DEQ A;  2A68 F;  1BJA A;  1IN7 A;  2FF4 A;  3VOD A;  2VBX A;  3IKV A;  3WE3 A;  1RI7 A;  5AIQ A;  1ZHF A;  4F7Z A;  4RAZ A;  3RJP A;  1XDU A;  1PP7 U;  4RGX A;  3BJO A;  1G6N A;  5BMZ A;  2O03 A;  2R3S A;  1KYZ A;  3K2Z A;  1UCR A;  3RI4 A;  2QLZ A;  4HQM A;  5DV5 A;  3BZ6 A;  2IVM A;  5K1Y A;  5J8C A;  1IW7 F;  2OZU A;  2HDC A;  3I59 A;  2VT2 A;  3D0S A;  1LDJ A;  5ERI A;  2KIF A;  1MD0 A;  3ZP5 A;  3I4P A;  1BIA A;  3TQN A;  2ADU A;  1YW7 A;  2O3F A;  5FB2 A;  3I0T A;  4M6Y A;  1HW5 A;  2YX7 A;  1CF7 A;  1MJB A;  5BQT A;  3HTS B;  1S8N A;  3CLO A;  3K9T A;  4CIC A;  3BPX A;  5J6X A;  3O6B B;  4HF0 A;  1IXC A;  2FNP A;  3I54 A;  1STZ A;  1L3L A;  2UWM A;  2ISZ A;  3GWZ A;  4KN4 X;  1WQ2 A;  3V7R A;  1PUE E;  3H92 A;  1R1V A;  4ZYH A;  2WC2 A;  3LST A;  2D1H A;  1JGS A;  2A69 F;  1IN6 A;  2L01 A;  3ZMD A;  3HTU A;  3JW4 A;  3FF5 A;  1D8K A;  5DCM A;  1G3Y A;  1Z9C A;  1HW1 A;  3EQL F;  2IRF G;  4CGZ A;  2CW0 F;  3QRF F;  1TQM A;  4A6D A;  4MTE A;  1B4A A;  1SMY F;  2P6S A;  2RDP A;  5JI6 A;  4OMY A;  2L02 A;  1U8R A;  1SD6 A;  2VC1 A;  2DO7 A;  2F2E A;  1BI1 A;  3V8J A;  1KYW A;  2OA4 A;  5ICC A;  2MLK A;  3QPH A;  2RGV A;  3RKW A;  4CO8 A;  3C18 A;  4P5O A;  4G8X A;  3F21 A;  1BN5 A;  1U6G A;  4RGS A;  3KP3 A;  2VE8 A;  1USS A;  3WTT C;  2H27 A;  4KDP A;  2EFN A;  2EJR A;  1RNL A;  2IA2 A;  3IHU A;  2KIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...