4KDPA

Tcar-ssdna complex crystal structure reveals the novel ssdna binding mechanism of the marr family proteins
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TcaR transcription regulator
publication title TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription/dna
total genus 41
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kdpA00
3IWFA 3F6OA 4OIOF 3BWGA 1BN5A 5DV5A 3J81K 3DQVC 5DDGA 3PFIA 4OOIA 1GXQA 2QUFA 1CF7A 3FXQA 4M6YA 1P4AA 1XDUA 2WC2A 1U78A 3WE3A 1FYKA 3J80K 5HDKA 2V6CA 3RDIA 1OYYA 1IXSB 3DF8A 1KU9A 2K86A 3M1EA 4Q5SF 4KYWA 1KYWA 2W57A 3K1NA 3GEZA 3KLOA 6PAXA 2IA0A 4O3MA 3E6DA 3GFJA 1R1TA 4U7BA 2OZUA 2ADUA 4HX4A 4EM1A 4A0ZA 2QWWA 1IN8A 4GO1A 1B4AA 1CGPA 1Z1DA 3KP7A 3ZMUA 3K1PA 1XGOA 1FNNA 2GWRA 5D8LB 3LA3A 1FT9A 2L02A 3F8FA 3GFLA 5IT9Z 4I0AA 4L5IA 1XB4A 1ZLKA 4HV6A 1R00A 2A3SA 1GXPA 1J59A 2DW4A 1GVJA 1D8JA 3F8CA 1YW9A 2DTRA 3ZMDA 2LNBA 3GVAA 4IXAA 4P5OA 3OOPA 3BY6A 4WXHA 4CO8A 3HTUA 1YTYA 2XKOA 4BHCA 1RIOH 1K7AA 4M71A 2FBIA 3KZZA 2BE5F 3Q9SA 3E3VA 1D8KA 2KIFA 3BOQA 4UNOA 4XLNF 2FNAA 4M9SA 2ESHA 5FB2A 1QO0D 1EV7A 2A5YB 1STZA 2Q0OA 4GCVA 2YR2A 1YG2A 2XAFA 5KVRA 3CTAA 3FXUA 1IRFA 3EYYA 1R36A 1F4KA 3T8TA 1W4MA 3K0LA 4UHTA 3SZTA 1OYIA 3KP2A 5JR3A 2OBPA 4HOBA 5E8GA 2XRNA 1OPCA 4DNCA 3IKTA 1HW1A 4R79A 4CGZA 3KCCA 3GZ5A 4A0YA 1R1VA 1L0OC 4WXCA 1D3YA 1MDMB 2DI3A 1J7KA 3BJOA 4RB1A 5BPDA 3ABUA 2FMYA 2DU9A 5E20A 3WTXC 3E5XA 4O5VA 2STWA 3W6JB 1S8NA 4FX0A 5DCMB 4G9YA 5F64A 1W7PA 3MCZA 2MH9A 4HQEA 2DBBA 1IZ1A 1P4WA 2DK5A 2CSOA 1T6SA 2PMUA 3MZHA 5AONA 1MD0A 4WXDA 3WE2A 3C1DA 3IRQA 2ISZA 5HS7A 5A2QZ 3ZN0A 5J8FA 5E18F 4KFCA 2COMA 3EYIA 1YW8A 2GA1A 2P6SA 1ZLJA 2PEXA 2IW5A 1VTNC 1R5GA 4U88A 2O61A 5IT9K 1G6NA 3TO6A 2B0LA 2RGVA 5DUIA 4RGSA 1BM9A 4EMSA 1R7JA 2ZNYA 4A2UA 3FXRA 4OIRF 3MWMA 4CDGA 4BNCA 2UZKA 4U0YA 2M30A 2PG4A 1K79A 5K5QA 1LDJA 4KMUX 1O3RA 3WGGA 4M9XA 2VONA 2WWYA 5BPIA 2FNPA 3K1MA 2VT3A 3PQKA 2MC3A 4LG0B 1FC3A 1L3LA 4HF2A 1TLHB 2XAHA 4U7DA 2E7XA 3I64A 5EEHA 2M8EA 5BOXA 1TNSA 3WGIA 4Y13A 2XASA 1U6GA 1G3SA 3FF5A 2KJCA 5K5OA 2ZMEB 5LLQA 2DPDA 1JHFA 1TQIA 2XUBA 4CHUA 2QQBA 2ZKZA 4I02A 4KIBA 4IHSA 1JXSA 3TGNA 5D6EA 3P9IA 1XSDA 2PI0A 4IPAA 4AIJA 2KRFA 4U0VA 1EH8A 2GA2A 2GQQA 1W5SA 3GX4X 3WTWC 2QZ8A 4BHBA 3ZQ7A 2YX7A 4Z2YA 1RUNA 3ELKA 3S2WA 2QLZA 4L0YB 1SD5A 3QP6A 3FX3A 1O7LA 1HKTA 3DKWA 2OQRA 2QQAA 3QU6A 5BMZA 2OU2A 2W84A 3QRFF 4I0BA 1FP2A 3IL2A 1U3EM 4CXFA 1MDMA 1P2FA 3CUOA 5H6RA 5A2QK 2ISYA 5LEKA 2J5OA 3MZYA 1U5TC 3QU3A 1KA8A 1ZARA 5F1RA 5D4RA 2GIVA 3IWZA 2EWNA 1IN7A 1BOAA 4HQMA 3F8MA 2H6CA 4HLXA 3P9KA 3KLNA 2QENA 2KKOA 5LGNA 4R8HA 2V1DA 2YSRA 3CO7C 4NB5A 2H27A 1YS7A 2VBZA 4ZYGA 5CVUA 4A5NA 3GYHX 3SFZA 4AIHA 1H0MA 4YIFA 4TV7A 2CWEA 1SD6A 1MJ9A 1WWXA 1KYZA 4ZZLA 2Z9OA 4QLCU 5LRRA 3R0AA 4KIGA 4I01A 1QGPA 2HKOA 3WGHA 2JPBA 1Z6TA 4XSXF 1BI0A 3D5LA 1LQ1A 3HSRA 2HTSA 4XSZF 4EJOA 3BP8A 2VT2A 4HAMA 2W85A 1XMAA 4B8XA 3VFZA 2PBIA 2F5CA 1WQ2A 3FWEA 2D45A 2EJRA 3V8KA 2K27A 1TTYA 1B9NA 3W6KB 1C0WA 2Q2EA 3KP6A 2L4MA 4L0ZB 4KN4X 1G3YA 4EGYA 2LKPA 1H9GA 1XGSA 3E5QA 3F8NA 3NRVA 1ZRCA 1BI3A 5ICCA 1PUEE 5ILSA 2FQ3A 1OMIA 3T1BA 2L4AA 1LDKB 2GZWA 2D1VA 3IHUA 2R7DA 2H6BA 5HLGA 4ENJA 4EJTA 3NEUA 3RKYA 2HQRA 3ISPA 2QQ9A 2UWMA 1QZZA 5E8IA 3GFMA 1ONVA 4R1HA 1R5HA 2K02A 3L9FA 1ZN2A 1K78B 1P4XA 4A0XA 1E17A 4M73A 1ZYRF 1XN7A 5F6FA 1BI1A 1JE8A 4LLLA 1Z91A 2EFWA 2IT0A 4LD5A 4G94A 3RIRA 1UFMA 2NNNA 5LHIA 3SQNA 3FMRA 3HUGA 2PLYA 5KK1A 4MEYF 2P5VA 4U0WA 2E1CA 2V1UA 1DDNA 2XAQA 3F72A 1IUYA 2YPRA 1DP7P 2Y48A 2IP2A 1I1SA 3LSTA 3VOEA 1IRGA 2UXXA 1S3JA 2EV5A 2P5KA 2Z5UA 1Z7UA 1LB2A 1BJAA 2EFOA 4NHJA 4LJZF 2G7UA 3C18A 5CVVA 2HEOA 1O3QA 4IJAA 5JHUA 1HSJA 1WI9A 2NS0A 2FMLA 2FOKA 4FHTA 3QPTA 4HX8A 2O3FA 4KMFA 3WTVC 2VN2A 1ZRFA 4MTDA 1QZYA 2PFBA 1IXRC 1HQCA 3JW4A 3IKVA 2MBFA 1USSA 3ZMZA 2FBKA 3DV8A 2A07F 5LRSA 3GW2A 1REPC 5FLXZ 1LDDA 1ZGJA 2OQGA 2TDXA 4Q48A 4UV9A 3VODA 3G73A 2Y0MA 3Q9VA 2FE3A 2CGPA 2AXLA 3GZ6A 4RAYA 2P7VB 2RKHA 2DK8A 3L2CA 2ELHA 4M72A 4ZYHA 4WCGA 3COAC 3G3ZA 3ECHA 5BS6A 1ZG3A 3HHGA 3E6CC 3T5XA 1D5VA 4I7HA 5AIPA 3LFKA 1R1UA 4ZH4F 2VC1A 1H9TA 3IC7A 3LAPA 3FM5A 1UB9A 3TOBA 1LVAA 3HTSB 5CVRA 1RZ4A 4LK1F 2ZJ2A 4OMZA 3LQRA 5E1ZB 3RKXA 5DYMA 3RPQA 1KQ0A 2O6GE 2WTEA 3K9TA 2IA2A 5AIQA 4UVAA 2L01A 3WTYC 5JI6A 2Y75A 3I5UA 1LEBA 1IAWA 1BIBA 2BV6A 1ZH5A 3ABTA 2EV0A 3HOTA 1NHAA 1IN6A 5J8CA 2EFQA 3LQQA 3E6MA 5LGTA 3FMSA 1HSTA 4KA4A 4MHGA 5LHHA 4XBFA 2JTVA 1XGMA 3GLXA 1XCBA 4HZFA 2XGXA 4MQVA 3V4GA 4Y17A 5HS9A 1K78A 4LB6B 2GXBA 4RGUA 2V79A 2MLKA 3I4PA 3EUHA 3GXOA 2QBYB 2H94A 1I1GA 4YFXF 2JT1A 2CO5A 2EFPA 5J6XA 4LLNA 2HYFA 4WX9A 3HRUA 3JAMZ 2LDUA 1I6XA 4KN7X 3ECOA 3BROA 3J7AO 4IRHA 4GGGA 3C7JA 2RDPA 2XIGA 3FHZA 2JPCA 4MEXF 3QPHA 3NQOA 2JRTA 3TKYA 1FYLA 2HR3A 3U1DA 2XHKA 2STTA 2LF8A 4G6QA 4A6EA 5BQTA 5L3FA 1FLIA 1B59A 1G3TA 2EA4A 1FY7A 2BBYA 3U2RA 3MFKA 5HLHA 1XGNA 1MJBA 2O0YA 5TJJA 2K7LA 5E1XA 1USTA 2XKPA 5CLSA 2JZYA 5LGUA 5DCFA 1SFUA 3TQNA 3V8LA 4N9HA 4PGGA 4WK8F 1XMKA 4MNUA 1P6RA 4I2OA 1ZRDA 4YFKF 3M8FA 1HBXG 1YLFA 2ETHA 3KP4A 4HYEA 4KT5C 2RN7A 4EM2A 1I27A 4O6JA 1SMTA 1XDSA 3WTTC 5CYVA 2MD5A 1FOKA 2E7WA 4PGHA 3H92A 4YIIA 1HKQA 4UVCA 1YO5C 5L3CA 2D1HA 3R4KA 1FYMA 2HTJA 2ZBKA 3GF2A 2D2WA 4XRFA 3HRMA 5HDNA 2P5LC 1FSHA 3AAFA 1RUOA 5DEQA 5HOOA 1ON1A 3T0YA 1J5YA 2F5EA 4EGZA 2DQLA 4L9VA 2KIMA 2ESNA 3CJNA 2K4JA 5FFXA 2FXAA 2OD5A 3E5UA 3HYIA 3E97A 2WV0A 4I09A 1FP1D 1B6AA 4EJUA 1CF7B 3DFGA 4AVPA 4Y15A 4RB3C 3V7RA 1T38A 2XV4S 4UV8A 2UXNA 1KU3A 2ZO4A 4LMYA 2XAJA 3DP7A 4I98B 1FBSA 5D4SA 2FRHA 4HDVA 1SD4A 2G7HA 3C3WA 3M8EA 1EH6A 3WTUC 4L9NA 4M9ZA 1WRJA 3GO5A 3TO7A 1RNLA 4N9IA 4GXOA 4LFUA 2V1XA 3BPVA 1YIOA 3B73A 4IVNA 4L9JA 5DCMA 3WTZA 1K6OA 4OIQF 3JAMK 1FSEA 2R3SA 4JK1X 4UUVA 1TNTA 4JBAA 2KIUA 2GAUA 5FD5A 3CUQB 3JSPA 2HYGD 1QPMA 5L3DA 3MEXA 4G6DA 2ZFWA 4E70A 3ULQB 4L18B 4DQ2A 2O8XA 4M6XA 4PZJA 4G8XA 3WU0A 1UHWA 4HW0A 2IVMA 2Z33A 2QBYA 2JSCA 1WSUA 3RKWA 2H09A 4BAYA 1S7AA 4HBLA 4AIKA 3F23A 5H20A 1BC8C 5D5XB 2VBYA 3ZP5A 3BJAA 4G7OF 4CICA 3HRSA 4S05A 2Z3YA 5FO5A 1JGSA 5LEJA 5DD4A 3ML6A 3O2PE 5DUKA 2K4BA 4IHTA 4FT8A 1ODDA 4ZZDA 4S04A 2FEZA 1IW7F 2M87A 2OAZA 3JTGA 2W24A 5D5VB 1J75A 5L3EA 3JSOA 2VXZA 1TBXA 1B1BA 2RC4A 4LG0A 3LAJA 1LEAA 2CQKA 4HA8A 3HHHA 4ESJA 2XAGA 1LNWA 1O7FA 3ERED 3KETA 2RV8A 3H3UA 3ROUA 4LK0F 2LF7A 3M9AA 1F9NA 1HW5A 1JHHA 1MKMA 1IN5A 2ZMEA 1W5TA 1MJAA 2CFXA 2MA3A 4YG2F 2NAZA 3L7WA 4HV5A 4IRIA 2V9VA 3LWFA 2YU3A 2DPUA 1BBYA 2FSWA 2M5WA 1XCVA 3I0TA 4LGWA 2W25A 1G4DA 3EETA 2HQNA 3HIFA 1TQMA 3QOPA 1Z05A 2IPQX 1T2KA 1QNTA 5JFRA 1ZREA 4ESFA 2VBWA 1SAXA 4ETSA 1QBJA 1DUXC 4KDPA 2DAOA 5FD6A 1S29A 4B09A 1LJ9A 5FFZA 1R22A 4OMYA 4P9UA 2BGCA 4EJWA 4IRGA 3I58A 1O57A 2HGCA 2FA5A 3WTSC 4M74A 3RTRA 2R7FA 1EH7A 4KUMA 1MZBA 4PCQA 1UHMA 5LHGA 4AD9A 4RB0A 3IRRA 3DPLC 5HS8A 5ED4A 2IA1A 2P6TA 2QYOA 2AS5F 2A6HF 4D0PA 3F21A 4RAZA 3CUQA 3MAJA 4A12A 1SMYF 1FBUA 3L00A 1T0FA 2RNJA 4Q4ZF 1S7OA 2HKXA 5ILUA 4ZYEA 1QQIA 2HDCA 1ULYA 1FWZA 1PDNC 1ZG1A 2L54A 3SXYA 2ZNZA 3TDZC 3I59B 1FZPB 3DPTA 1BIAA 3HRTA 2IRFG 2E1NA 4A6DA 4JQFA 3R6SA 5E1WA 1E2XA 3O3KA 1O3TA 1FPQA 1ZG5A 1J0RA 1WKMA 1V3FA 1F1ZA 1KQ8A 1YW7A 2FF4A 5E17F 2ACJA 3R61A 3EQLF 1O3SA 1ZHFA 1ZGAA 1AWCA 3DXJF 2VC0A 3TOAA 5D8KB 3RI4A 4MQ9F 1Y0UA 2QM3A 4GYGA 4OU0A 5LBQA 3WODF 3FZVA 4P9FA 5HDGA 1KQ9A 2GXGA 2BYVE 1A04A 4EVIA 5DD8A 1HXDA 1HKSA 3OV8A 3I54A 3GFIA 2IJLA 2RQPA 4FX4A 2DQRA 4HX7A 3VB2A 3I71A 5EEGA 3T8RA 1DPUA 4KNYA 4WWCA 3KEQA 2LSOA 4L9TA 3K2ZA 2X0LA 1YYVA 1PP8F 3QAHA 1TQPA 1AOYA 5L3BA 5K1YA 4XLPF 3V7CA 2VE9A 2DT5A 3F6VA 2DLLA 4WF2A 1TW2A 1Q1HA 2NRAC 2A69F 2A6EF 2DFIA 5FGMA 2G9WA 2L3DA 3CLOA 3FM3A 3HSEA 3M7GA 4HLYA 4CZZA 3F8BA 4HF1A 1GHCA 2EV6A 3KP3A 3L09A 3RYRA 3REOA 5ICEA 3SZPA 4F7ZA 5FLXK 4ON0A 1T39A 1I5ZA 3P7NA 3KEOA 1SFEA 2EFNA 2MH2A 2VBXA 5D5WB 4AWXB 3BDDA 4UVBA 4NQWA 3F3XA 5IT3A 4ZYDA 3R0JA 3ZMTA 1TW3A 2HWVA 3BJ6A 3N97A 3H3ZA 3TDUC 4MTEA 2F5DA 2OA4A 4GYIA 1SFXA 3O6BB 1OKRA 2PQ8A 2MLGA 4MGRA 1UCRA 2O03A 4QWQA 4L5JA 1KGSA 3U9GA 2OZ6A 4G7ZF 3RPUA 1U5TB 1YS6A 3F22A 2X4HA 1IF1A 3I59A 3FMQA 3Q5FA 1J2XA 2M1BA 2CG4A 1T98A 1FBQA 4P55A 3DEUA 1RI7A 4UXNA 3KFWX 4K2EA 2EB7A 3VEPA 2QVOA 2XROA 2A68F 5ERIA 4ENKA 1X3UA 4RGXA 2HOEA 4G7HF 3WG9A 1IXCA 3V7SA 2M45A 2PN6A 1R23A 2CYYA 3MQ0A 2FBHA 3WU1B 3N4MA 3PQJA 2F5FA 1R58A 4BXUA 2NYXA 4ENMA 1W7PD 3B02A 2YX4A 3KP5A 4EV0A 4BYYA 4HDUA 1J9IA 1B9MA 2CW0F 2VODA 5D6FA 1BC7C 5H6QA 3E6BA 3ZPLA 4EQQA 3P9CA 3J81Z 3CDHA 1YFHA 2VOOA 1U8RA 1IN4A 5HLIA 2XVCA 3RYPA 2PMHA 4RGRA 4LLGF 4OINF 3ZMVA 4Q47A 2P7CB 1S6LA 5HVQC 4BQAA 3J80Z 1MGTA 2KJBA 2C6YA 1F5TA 1DPRA 1KU2A 3QP5A 3JTHA 3LA2A 4OIPF 4HF0A 3EDPA 2HS5A 3RJPA 1YQAA 3KZYA 4BH9A 4ESBA 1XSVA 1BI2A 4ENNA 4PDKA 3R60A 3HOSA 3BPXA 4P96A 3GWZA 4EJVA 5TRDA 5ICGA 2F2EA 2PJPA 1U2WA 2J5PA 4N0BA 5L3GA 3V8JA 5ICFA 2NNYA 3GUDA 1OYWA 2ZCWA 2VOPA 5K5RA 3D0SA 5JVTA 1PP7U 2P8TA 5D5UB 3LA7A 2DO7A 3HSFA 2Q8KA 3TO9A 5CVIA 4BHPA 4RB2C 4H0EA 1HW2A 3CUQC 1SD7A 2HFHA 2RVCA 2HZTA 1OR7A 1ZAOA 4A5MA 4ASNA 5CVJA 1KU7A 4KICA 2P4WA 3CO6C 1P92A 1V4RA 4KIFA 2ZXJA 1FX7A 5ILVA 1XSXA 3K69A 2Z99A 3KE2A 3ZMSA 2FU4A 1U5TA 3SHFA 4LB5A 3ZN1A 4EM0B 2BEOA 1Z9CA 3I53A 2EA2A 1Z6RA 5CJ9A 2VE8A 4RS8A 1W7PB 3BZ6A 4CYDA 1G3WA 1ON2A 2EK5A 4YFNF 1XD7A 4IF4A 2A61A
chains in the Genus database with same CATH superfamily
3IWFA 3F6OA 4OIOF 3BWGA 4CH7A 1GT0C 1BN5A 5DV5A 3J81K 3DQVC 3QYEA 4F91B 4FE7A 5DDGA 3PFIA 4Z6YA 5J4YA 1LUJB 4OOIA 1GXQA 1H8AC 1VQLI 2DDAA 2QUFA 3TP3A 1CF7A 3FXQA 2HOTA 2N8GA 4M6YA 4LIVA 1P4AA 4IX7A 1BL0A 1XDUA 2R0QC 1FIAA 2GOMA 3OY9A 2WC2A 1U78A 2OUMA 3WE3A 1FYKA 3OMYA 2QCOA 2QQ8A 3J80K 5DS9A 4BJ6C 3DEWA 5HDKA 2KIQA 2V6CA 2R5ZA 3RDIA 1OYYA 1IXSB 2XDVA 3DF8A 3OS2A 1KU9A 2K86A 1YRNA 3M1EA 4Q5SF 4KYWA 1KYWA 2DYSH 2DMNA 2W57A 3K1NA 3A02A 3GEZA 3KLOA 5FKOA 3W3CA 1YIJI 6PAXA 2IA0A 4O3MA 3E6DA 3GFJA 1R1TA 4U7BA 2WAQN 2OZUA 3SDBA 2ADUA 2XF6A 1D1AA 2XF7A 4HX4A 4EM1A 2KZGA 4PFPA 4IKFA 1JKPC 2DXIA 1A35A 4A0ZA 2KLOA 4RLQA 2QWWA 1IN8A 4GO1A 1B4AA 3A03A 1CGPA 2COBA 4EATA 1Z1DA 3KP7A 3ZMUA 2KPMA 3K1PA 4NBQA 2X6WA 3AL0B 1XGOA 5EGOB 1FNNA 3PO2J 2Y0SA 1PUFA 2GWRA 5D8LB 3LA3A 4FCYA 1FT9A 2R5YB 4A69C 2F4MB 2BOLA 2H8RA 3S2DJ 2L02A 3F8FA 2NVUB 1IJWC 2Z2SB 4PK4A 4KISA 3GFLA 5F08A 2XRLA 5IT9Z 1MMSA 4I0AA 4L5IA 5B66C 3DPUA 3GTOJ 1SVOA 1VQ8I 5F27A 1XB4A 4G6TB 1ZLKA 4HV6A 4XONA 1R00A 2A3SA 1GXPA 4M3DA 2KISA 3LSMA 3LSHA 3VYUB 1J59A 1OCZH 2R93J 3C2BA 2DW4A 3GTPJ 1P7IA 1Y8QB 1GVJA 2IS4A 2HYJA 1D8JA 2LY9A 3OYBA 5J4VA 2A5WA 3F8CA 1ITYA 3JRDA 1YW9A 2DTRA 3ZMDA 4CCKA 1LFBA 1TWGJ 2LNBA 2JA5J 3GVAA 5B1BH 3CDIA 4IXAA 4P5OA 3OOPA 2M7BA 4C2TA 3BY6A 3SEZA 1WFXA 4WXHA 4CO8A 3HTUA 4RAFA 4OWRB 1VQKI 1YITI 3BC8A 1YTYA 2XKOA 1MBJA 1HLVA 3GCMA 4BHCA 3DTKA 1RIOH 1OCRH 4E7ZA 4QIWN 1K7AA 2H1LA 4M71A 2FBIA 3KZZA 2BE5F 1MSFC 3Q9SA 2ZC2A 4YRVA 3E3VA 1D8KA 4BBRJ 1MNDA 2X85A 1RKWA 2BY3A 2KIFA 3BOQA 4UNOA 1VFCA 3A01A 4E6KG 4Y3OA 3B6AA 4XLNF 2FNAA 4M9SA 2ESHA 5FB2A 1QO0D 1EV7A 2A5YB 1STZA 2Q0OA 4GCVA 2GLOA 2YR2A 3I56I 1YG2A 2XAFA 5KVRA 3CTAA 3FXUA 1IRFA 3EYYA 1R36A 1F4KA 3T8TA 3S1MJ 1W4MA 3VYRB 1IDYA 3K0LA 4UHTA 3SZTA 3CCSI 1OYIA 3KP2A 2VJJA 1OCCH 1IGNA 1XMXA 5JR3A 2OBPA 4HOBA 5E8GA 2RREA 4XLEA 2XRNA 1OPCA 4DNCA 3IKTA 2CS3A 3S1NJ 1HW1A 4R79A 4CGZA 3KCCA 4CCJA 5K7FA 2B7EA 5EDNA 1Z21A 2E2HJ 3GLLA 3GZ5A 3K4JA 4A0YA 1HA8A 1R1VA 2R7UA 3OWTA 3O8GA 2L7ZA 1L0OC 4WXCA 5DM7F 2L5QA 3E1SA 2JVHA 3PNTA 1D3YA 1MDMB 5FKNA 2DI3A 1T08B 2ZJPF 1J7KA 1FMWA 3BJOA 2KDOA 4RB1A 5BPDA 2DMQA 4D9JA 3ABUA 1AKHA 2DA6A 3DKYA 1YJWI 2FMYA 4KITB 2DU9A 1WH5A 2QF7A 5E20A 3ONQA 3S93A 2VJ5A 3E5XA 3WTXC 4MLOA 4O5VA 5M5XJ 4BDYA 4DIQA 2STWA 5J1YA 1JJ8C 2BHYA 3ZQHA 3W6JB 3GTKJ 1S8NA 3KYCB 1XS9A 3OL4A 4FX0A 2R7WA 2XSJC 3CC2I 3IAS2 3G1LA 5DCMB 1GV2A 4G9YA 1M1EB 5F64A 1W7PA 1X1AA 3MCZA 2MH9A 3AG4H 4HQEA 2L7KA 4ZTJA 2DBBA 5EG0B 2X1EA 1IZ1A 1P4WA 1B72A 2OTLI 2DK5A 2CSOA 2KP6A 5FLVA 1T6SA 3V42A 2NVTJ 1WI3A 4A3DJ 2PMUA 4C30A 3MZHA 1LFPA 5AONA 3MZ8A 1GDTA 1MD0A 3J7AY 4WXDA 3WE2A 1GV5A 3C1DA 3FKJA 3OYLA 3IRQA 3HC7A 4XIDA 2ISZA 5HS7A 5A2QZ 3ZN0A 5J8FA 1BR4A 1TWAJ 5E18F 4KFCA 1QPIA 3S3NA 2COMA 2MW8A 2O9LA 1YW8A 3EYIA 2GA1A 4DYCA 2P6SA 1ZLJA 2PEXA 3HEFA 3LSIA 3RCOA 2IW5A 3FKIJ 4C2MJ 1VTNC 1JKOC 5B5EC 1R5GA 2HOAA 3J7YJ 4U88A 2O61A 5IT9K 2R7XA 4XMYA 1I6HJ 3TW7A 1YI2I 2KQRA 2LBFB 2OCEA 1G6NA 3BZKA 4KJZA 3TO6A 2B0LA 2RGVA 2K9LA 5DUIA 1FIPA 4RGSA 2CRGA 1BM9A 2LREA 4C3HJ 4EMSA 1O4XA 3PIOF 3H9QA 1N78A 1R7JA 3NAUA 2ZNYA 1MMGA 4A2UA 3F9KA 3FXRA 4OIRF 3AFHA 2W82A 3S17J 3MWMA 4J19A 1MBFA 4CDGA 3D1NI 1B8IA 1X3ZB 2X48A 1IV6A 5LFAA 2HVRA 2IGMA 3AKZA 2ECCA 5GAGJ 4ANJA 4BNCA 3SZGA 2UZKA 2MGQA 4U0YA 3FK6A 2M30A 2PG4A 1K79A 2O5RA 2R5YA 1JKRC 3DU6A 5K5QA 3QPLA 4C9YA 1LDJA 5JVGF 3MMYB 1WHUA 1S72I 4KMUX 4CSWA 4HNTA 1O3RA 3RKQA 3WGGA 4M9XA 4OAZA 2VONA 2WWYA 5BPIA 2FNPA 3K1MA 3H36A 4MO7A 2VT3A 2WBMA 3PQKA 3HPHA 1ETVA 2LVSA 2MC3A 4LG0B 4Y52J 3K4NA 5GP9A 2LH9A 3ASOH 2R7OA 1FC3A 2LKXA 2ZJQF 1L3LA 3LFUA 4NC6A 2K9NA 5FKKA 4HF2A 2IXSA 9ANTA 3VWBA 1TLHB 2ELKA 1XX5A 4XKVA 2XAHA 4RLFA 5TISC 1X2NA 2E7XA 3WU2C 3I64A 4U7DA 1JTXA 2GM4A 5JHFA 5EEHA 2RAEA 1P7JA 5J1UA 2M8EA 3DTEA 1ZTRA 5BOXA 2CV2A 1DU6A 4B44A 1TNSA 3ABLH 3SYTA 1NG7A 1FMVA 5HNFA 3WGIA 4Y13A 2XASA 1U6GA 1G3SA 5LD2C 3FF5A 2KJCA 5K5OA 2ZMEB 5LLQA 2DPDA 1JHFA 2RNGA 1TQIA 1X4OA 2XUBA 4CHUA 2QQBA 2ZKZA 3HOXJ 4I02A 4KIBA 1VNDA 4IHSA 1JXSA 4C2UA 3TGNA 5D6EA 3P9IA 1XSDA 2EZIA 2PI0A 4IPAA 2KRFA 4U0VA 5EF6A 4AIJA 1EH8A 3W2AA 2GA2A 2GQQA 2ME0A 3HG9A 1W5SA 3GX4X 3WTWC 3MVPA 2QZ8A 2VQCA 3ZQQA 4BHBA 2E1MC 4XLAA 4U87A 3ZQ7A 2YX7A 3HXLA 4Z2YA 1K61A 3HDDA 1RUNA 3ELKA 5IPAA 3S2WA 2QLZA 3QODA 4L0YB 1SD5A 3QP6A 3CC7I 4PSXA 3CCMI 2JWTA 2IBDA 2O7OA 3FX3A 4ZDPA 1OR7C 1O7LA 1HKTA 3DKWA 1T56A 4XKBA 4AM3A 2OQRA 2QQAA 3QU6A 5BMZA 2M0CA 2OU2A 2W84A 3QRFF 3PL8A 4XM3A 2V26A 3HOYJ 4I0BA 1FP2A 3IL2A 3H5NA 1U3EM 4CXFA 1MDMA 1PJRA 1P2FA 2E19A 4A3IJ 5CQEA 1V5FA 3CUOA 2XSDC 3B6CA 5H6RA 3TL4X 5A2QK 2ISYA 4I99C 5KHDA 5LEKA 3IV5A 4XKCA 2J5OA 3MZYA 5IP6A 1U5TC 2CFOA 3QU3A 1KA8A 5DTDA 1ZGWA 1HDPA 1ZARA 5F1RA 5D4RA 1U9NA 2GIVA 2Q1ZB 2EWNA 3IWZA 1IN7A 1AA7A 3WG7H 1SFOJ 1BOAA 4HQMA 3F8MA 2H6CA 2HXOA 4HLXA 3P9KA 3KLNA 2QENA 2KKOA 5LGNA 2HPMA 1VI0A 1TWHJ 4AC0A 4R8HA 2R7TA 1I3AA 3DBRB 3CMYA 3FK7A 2V1DA 2YSRA 3CO7C 1MSEC 3TW6A 4IHWA 4HEA2 4NB5A 2H27A 2MFZA 2VBZA 1RESA 1YS7A 4LIUA 4ZYGA 2JSPA 5CVUA 1NH3A 2E35A 2DA3A 3QYBA 4A3KJ 4A5NA 3GYHX 3SFZA 4AIHA 3CF2A 4RA2A 3CD6I 2VIXA 5F0HA 2E34A 4YIFA 1H0MA 4TV7A 2CWEA 1SD6A 3CCQI 1MJ9A 1WWXA 2V4JC 2CQNA 2V6EA 2E60A 2VPRA 2WAQA 1KYZA 4ZZLA 2Z9OA 1T8IA 5KAFC 3KIOA 4QLCU 2E1OA 2AHQA 3VDXA 5DM6F 5LRRA 4DYQA 2HQAA 3IH2A 3R0AA 4FISA 4KIGA 1VQ4I 4I01A 1QGPA 2HKOA 1QRYA 2E36A 4D7MA 3WGHA 4XKWA 1D1BA 2JPBA 1ZR4A 1Z6TA 4BGDA 4XSXF 4BY7J 3L2QA 3SEQA 1BI0A 1W36D 4B47A 3D5LA 1LQ1A 3HSRA 4FE4A 2W48A 2HTSA 1LPQA 4XSZF 1R71A 4EJOA 4ZYAA 3BP8A 2VT2A 4HAMA 4ZDOA 3HGGA 1F43A 2W85A 1XMAA 4B8XA 2AQFA 3VFZA 2PBIA 4Y4RA 2IGKA 2F5CA 3OIQA 1WQ2A 1ERDA 2GIZA 3FWEA 1CQTA 2NXNB 3K4MA 2L7FP 1Y0NA 2MD0A 2D45A 2EJRA 3V8KA 3PJRA 2K27A 2FJ1A 1TTYA 1B9NA 3W6KB 2TCTA 1C0WA 5FKLA 3OOUA 3FHNA 1VQ5I 2Q2EA 3KP6A 2L4MA 4L0ZB 5H2FC 3W2WA 3RSNA 4KN4X 4XLCA 4X6AJ 1G3YA 4JOMA 3CCLI 4B4CA 4EGYA 2LKPA 3OIOA 1H9GA 1XGSA 3E5QA 3F8NA 3NRVA 4IZZA 1ZRCA 1BI3A 5ICCA 1PUEE 4BDZA 1XTAA 1I39A 2EIJH 5ILSA 2FD5A 2FQ3A 3KZIC 1OMIA 3T1BA 4A3GJ 2EQRA 1T33A 4Y7NJ 2L4AA 4BXXJ 1QA6A 2CQ7A 1LDKB 2GZWA 2D1VA 5CKTA 3IHUA 4XLHA 2R7DA 2H6BA 3RZOJ 5HLGA 3BR2A 3M3YJ 4ENJA 2NVYJ 4EJTA 3NEUA 2VKDA 2NVQJ 3RKYA 3JREA 2Z1DA 2HQRA 3BR0A 3ISPA 1FOYA 2QQ9A 3W6VA 4DZJA 4V2GA 2UWMA 3L2UA 1QZZA 3DU5A 2ZXWH 3K2AA 2VL8A 5E8IA 1MBGA 4CA0A 1BR2A 3GFMA 1ONVA 2IS6A 4A3CJ 1RR7A 4R1HA 1R5HA 2K02A 3LSGA 1VQOI 1RKTA 1JUPA 1X2MA 3BG9A 3KEYA 2CV1A 4PJLA 4XR6A 3L9FA 2L2OA 2W1OA 1ZN2A 1K78B 2WY8Q 5C4JJ 1P4XA 4A0XA 1E17A 4M73A 2X51A 3H0DA 1G8XA 1ZYRF 5E3OA 1XN7A 1Y6IA 4C3JJ 5F6FA 1BI1A 4AVZA 1JE8A 4LLLA 1Z91A 5B1AH 2EFWA 4LD5A 2IT0A 3WHCA 4G94A 2GXAA 3RIRA 1UFMA 3TP0A 1JT0A 4Y33A 4NC7A 2NNNA 2DA7A 3HJEA 3ZQFA 5LHIA 3CJTB 3SQNA 3FMRA 3HUGA 2PLYA 2QKMB 3PO3J 5KK1A 4B3XA 3CESA 4MEYF 3DTIA 3Q3SA 2P5VA 4U0WA 1NTCA 2E1CA 2M8GX 2V1UA 3K10A 1DDNA 1MH3A 2XAQA 3F72A 3NARA 5F0CA 3OS0A 1IUYA 2JJ7A 2UV1A 2YPRA 1DP7P 2Y48A 2IP2A 1I1SA 4DBQA 3LSTA 3VOEA 1PVEA 1WJEA 2VI6A 2UXXA 3ABMH 1IRGA 1S3JA 4DYRA 2EV5A 2P5KA 2Z5UA 3OYFA 1Z7UA 3VYTB 1LB2A 1BJAA 2EFOA 4NHJA 5IY5H 4LG3A 2IS2A 1U0JA 4LJZF 2WA0A 2G7UA 3C18A 5CVVA 2HEOA 4IL6C 2HZDA 3FBIB 3LNQA 1O3QA 4IJAA 3OYGA 5JHUA 1HSJA 1WI9A 3QWLA 4NQWB 2NS0A 5J3LA 1LKXA 2FMLA 2E5NA 2FOKA 5J47A 4FHTA 3S1RJ 3OYMA 3S3MA 3QPTA 4HX8A 2O3FA 4CYCA 4KMFA 3WTVC 2BY0A 3EUKL 2X6XA 2WB1N 4ZJZA 2VN2A 3RZDJ 2JVGA 1ZRFA 4MTDA 1QZYA 1LE8A 3LL7A 2BY1A 2PFBA 1IXRC 1HQCA 3JW4A 3H1CA 2KMUA 2LG4A 3IKVA 2MBFA 1USSA 2FQ4A 3ZMZA 2FBKA 3DV8A 4ZC3A 2A07F 3K70D 5LRSA 3GW2A 1REPC 5FLXZ 1LDDA 1JJ6C 3FXLA 5IOZA 1ZGJA 1JI8A 4M3FA 4D1QA 2R4GA 2EIMH 4DGWB 2OQGA 2TDXA 4Q48A 4UV9A 3VODA 3G73A 1V5EA 2B9SA 3HOVJ 2Y0MA 1SVMA 3Q9VA 2FE3A 2CGPA 2AXLA 3CLQA 3GZ6A 1VQ9I 3IH4A 4RAYA 2X6YA 3S16J 3DBLB 2P7VB 5F0FA 5EEAA 2RKHA 2DK8A 4BU2A 3L2CA 2F5VA 4IQJA 2ELHA 4M72A 1I3QJ 4ZYHA 4WCGA 3COAC 1K4SA 3G3ZA 4IHXA 1YJNI 1TT5B 1H88C 4GFBA 2JQ7A 1W0UA 1R9TJ 3ECHA 5BS6A 1Y39A 4I6ZA 1ZG3A 3UNGC 1MH4A 3HHGA 3OYIA 3E6CC 3T5XA 5GADJ 3CMAI 1D5VA 4I7HA 5AIPA 3LFKA 1MIJA 3LSRA 1R1UA 4ZH4F 2E2JJ 1Z3YA 4KT6A 2OC6A 2VC1A 2O8KA 1MBHA 3BCBA 3IC7A 1H9TA 2R7ZJ 3LAPA 3FM5A 1UB9A 3OR1C 3AL0C 2HDWA 2KL4A 4A93J 2VQHA 4FETA 1Q1VA 3TOBA 4B3AA 1LVAA 3HTSB 5CVRA 1D0YA 1RZ4A 5CPRB 3M4OJ 4LK1F 1G59A 2ZJ2A 2I10A 4OMZA 1TL8A 3LQRA 5E1ZB 2L9VA 3RKXA 3HOWJ 3O8HA 2BY2A 5DYMA 4D5CA 3RPQA 2KDZA 1KQ0A 2O6GE 2WTEA 3K9TA 3VYSB 4HPQA 3FBNB 1Z77A 2IA2A 5AIQA 3LOCA 5E3NA 2BW3A 4UVAA 2L01A 1N75A 2K9QA 5HLTA 3WTYC 5JI6A 2YS9A 2Y75A 3I5UA 3QPSA 4IO9F 1ETQA 3ZXSA 1LEBA 1IAWA 1BIBA 2BV6A 1ZH5A 2BHZA 2DFHA 3PFYA 3CCEI 2LY1A 3ABTA 2H8WA 1JT6A 2EV0A 4A3MJ 4NC8A 3HOTA 1NHAA 1IN6A 5J8CA 2EFQA 4AYBN 3LQQA 2XPWA 3QYFA 3HB9A 2R7RA 3CDLA 1IRXA 3E6MA 5LGTA 3FMSA 1HSTA 4KA4A 4MHGA 5LHHA 5E79C 4XN0A 4XBFA 2JTVA 1XGMA 2ME6A 3GLXA 1XCBA 1S5LC 1QHHD 1SEUA 1BA5A 2BVLA 4HZFA 2XGXA 2LKSA 2MG4A 2LRDA 2L9NA 1YX5A 1S9HA 1VQMI 2KRHA 1Z0XA 4MQVA 1XG1A 3V4GA 4Y17A 2HVSA 3L2VA 5HS9A 1K78A 2QSHX 1DGWY 4LB6B 4NNJA 2ZSIB 2GXBA 2CV0A 2DJIA 4RGUA 2HPIA 2V79A 1DQUA 1T95A 1F36A 2MLKA 3I4PA 3EUHA 3GXOA 2QBYB 2H94A 1I1GA 2JMWA 4YFXF 3ZRGA 2JT1A 2CO5A 3BQYA 2EFPA 1EJ9A 3FXJA 4CCLA 5J6XA 4LLNA 2HYFA 4WX9A 2HU9A 3H3VK 3HRUA 3JAMZ 2LDUA 1I6XA 4KN7X 3ECOA 2L9SA 3BROA 3J7AO 4FASD 5C3EJ 1P9QC 4IRHA 4BACA 1SFKA 3C7JA 4GGGA 2FX0A 5E3LA 2RDPA 2XIGA 3FHZA 2JPCA 4MEXF 2JA8J 1N25A 3HM5A 1XC5A 3QPHA 3NQOA 1JKQC 2WADA 2JRTA 3TKYA 1FYLA 2HR3A 5GPAA 3U1DA 2XHKA 2HI3A 2STTA 2LF8A 4G6QA 2QA4I 3BG3A 4A6EA 5BQTA 1IG7A 5L3FA 5EGOA 1FLIA 3PNYA 1RRJA 1B59A 1G3TA 1FY7A 2BBYA 1ORKA 2EA4A 2VXDA 3U2RA 5HLHA 3LMMA 4NDLA 3MFKA 1XGNA 1VQ6I 5IYDJ 1MJBA 2FUG2 4ITVA 2O0YA 2V7FA 4XLFA 3G1OA 1OLTA 3C2GA 5TJJA 4RDUA 2K7LA 1N77A 1POGA 2CUZA 2UUZA 1UJ8A 4QPOA 5E1XA 1AHDP 1USTA 2XKPA 5CLSA 2JZYA 2E1MB 2JN6A 5LGUA 1VF9A 4XRMA 5DCFA 1AU7A 1SFUA 1G2HA 1R4MB 3TQNA 3V8LA 4N9HA 1MMDA 4PGGA 1WZ2A 4JX5A 4BJ5C 3AG2H 4WK8F 1XMKA 2VQLA 4MNUA 1P6RA 2XGEA 4IEJA 4I2OA 1ZRDA 2AXTC 4V19K 2JA7J 4YFKF 3M8FA 1HBXG 2D5VA 1YLFA 2ETHA 3KP4A 4HYEA 3A2KA 4KT5C 1IUFA 2RN7A 4EM2A 4LITA 1I27A 2MSYA 2M4GA 1Z3XA 3G2BA 4O6JA 1SMTA 1XDSA 2VJ4A 3WTTC 5CYVA 2MD5A 2LYCA 4G12A 4H4KC 1MBEA 5HNHA 2DA2A 1WGXA 3C2HA 2E7WA 4PGHA 1FOKA 4HNUA 3H92A 4YIIA 3KX2A 2W7NA 1HKQA 4UVCA 1YO5C 5L3CA 2NOGA 2D1HA 2HDDA 3CCVI 2IGOA 3R4KA 4HSRA 1ETOA 3BTIA 1FYMA 2DMUA 2HTJA 2ZBKA 3GF2A 2D2WA 5IP9J 4XRFA 3HRMA 5HDNA 1D0XA 1EF4A 1HCRA 2P5LC 1FSHA 2ZFUA 3AAFA 1ZKGA 1RUOA 2ZXIA 2F6CA 4M6VA 5DEQA 5HOOA 1ON1A 3M8JA 3T0YA 3K70C 3GZNB 3IH3A 1J5YA 2F5EA 3CCUI 4EGZA 2V9PA 2DQLA 5HODA 4L9VA 2KIMA 2ESNA 3PSFA 3CJNA 2K4JA 5FFXA 5FRNA 2FXAA 3K4BA 2OD5A 3E5UA 3HYIA 2CW7A 1Y8RB 4W97A 2EZKA 3E97A 2WV0A 3CCRI 2MC4A 4I09A 1FP1D 1QVTA 1B6AA 4EJUA 1CF7B 1HOMA 2DA1A 4AUXA 1X4PA 3DFGA 5EZGA 3UKGA 4RM3A 4AVPA 4Y15A 4RB3C 3V7RA 3S8PA 1T38A 2XV4S 4UV8A 2UXNA 1KU3A 4YELA 1TWCJ 2ZO4A 4LMYA 2XAJA 3DP7A 3H5AA 4I98B 4BY1J 1FBSA 1JGGA 1V54H 2R5ZB 1APLC 5D4SA 3DKXA 5EYRA 2G0EA 2FRHA 1SD4A 2G7HA 3C3WA 3M8EA 1EH6A 4HDVA 3WTUC 3CQZJ 2E2IJ 3TBIA 4L9NA 4M9ZA 3BZCA 1WRJA 1X1CA 2EBIA 3GO5A 3TO7A 4XRSG 3CC4I 2R92J 2ID3A 2Y30A 4V2FA 1RNLA 1FJLA 4N9IA 4GXOA 2MYSA 4CCMA 4LFUA 2M4KA 2V1XA 4PUSA 2XPVA 2NS8A 3A1YA 1NG6A 3BPVA 1YIOA 4D7NA 4UY8I 2LTPA 3B73A 4IVNA 4L9JA 5DCMA 3WTZA 3NWTA 1K6OA 4OIQF 3OIPA 4QPQA 3JAMK 1FSEA 5EG0A 2R3SA 2CQXA 3Q0UA 1PUFB 4JK1X 3Q0WA 2WY7Q 4UUVA 1TNTA 2F48A 4JBAA 3GTJJ 2KIUA 2CUEA 2GAUA 5FD5A 3CUQB 3JSPA 2HYGD 1QPMA 5L3DA 3MEXA 2CUJA 4G6DA 3BR1A 2ZFWA 3CJQB 2K40A 2XAUA 4E70A 3ULQB 4L18B 2VQGA 4HG2A 4DQ2A 2O8XA 4M6XA 3A0BC 3BTLA 1MBKA 4PZJA 4G8XA 3WU0A 3IUOA 1UHWA 2YUSA 4HW0A 2IVMA 2LR8A 1ETKA 2Z33A 2QBYA 3HOUJ 4E4HA 3GTGJ 4IHVA 1WJAA 2JSCA 3M1CA 5M5YJ 4RMNA 1WSUA 3RKWA 1QHGA 2H09A 4BAYA 1S7AA 4I76A 2LBFA 4LOCA 1QVUA 4HBLA 4AIKA 3F23A 3GTQJ 1OQYA 2A05A 2LFBA 2P0WA 5H20A 4GDFA 2VB6A 4F3QA 1K4TA 2H1KA 1BC8C 4MFEA 2WB1A 5D5XB 2DDBA 2VBYA 3ZP5A 1A5JA 2QKLB 3BJAA 4G7OF 3QOEA 4RAGA 4DBRA 4BE2A 4CICA 1TC3C 3HRSA 4S05A 2Z3YA 2DTZA 3MN2A 5C44J 3A01B 3BTJA 5FO5A 4DZPA 1JGSA 3S3OA 1S7EA 5LEJA 4XICA 5DD4A 2IS1A 3ML6A 3O2PE 5DUKA 2K4BA 2YU9J 1OFCX 5M5WJ 4IHTA 4FT8A 3RPUD 2I8DA 4DJAA 3L1PA 3S1QJ 1ODDA 2OPTA 2QGUA 4PJJA 4AU7A 4ZZDA 4S04A 3G6EI 2FEZA 1IW7F 2M87A 2OAZA 3JTGA 3OSGA 3H5RA 2W24A 1PYVA 5D5VB 1J75A 2M3AA 5L3EA 3SFIA 3I4NJ 1R5ID 1VQ7I 1ETXA 4FQGA 3JSOA 2VXZA 1DU0A 3Q0VA 1TBXA 3JRHA 1B1BA 1BOBA 2RC4A 3OYEA 1SC7A 4LG0A 3LAJA 1LEAA 1TWFJ 4ZDLA 2CQKA 3HKZN 2KT0A 4HA8A 3VPRA 2PJRB 2EILH 2LC2A 3HHHA 3G4SI 4ESJA 3I4MJ 2XAGA 1LNWA 1O7FA 3ERED 3KETA 1UMQA 2RV8A 3H3UA 3ROUA 5GTHC 4LK0F 2LF7A 1ETWA 3M9AA 1F9NA 1HW5A 1QZEA 1JHHA 1YHQI 1MKMA 2VKHA 1IN5A 5FROA 2ZMEA 1W5TA 3CCJI 3TEDA 1MJAA 2CFXA 2MA3A 3AG1H 4YG2F 2NAZA 3L7WA 1Y56A 4HV5A 4IRIA 3CJRB 2OJED 2V9VA 3LWFA 2YU3A 3ZQGA 2DPUA 1E0EA 1BBYA 2CU7A 2FSWA 2M5WA 3OR2C 4BL0B 1XCVA 3I0TA 3N05A 4M3BA 3FXKA 4LGWA 3K4KA 2W25A 1G4DA 3CMEI 3EETA 2HQNA 3HIFA 1TQMA 3QOPA 1Z05A 4BKXA 1HF0A 2IPQX 1T2KA 1FTTA 5FJ8J 1QNTA 5JFRA 1ZREA 3JRFA 1UHSA 1RC9A 4ESFA 3L2RA 2VBWA 1SAXA 1D0ZA 4ETSA 1QBJA 1DUXC 4KDPA 2DAOA 2W4SA 2EIKH 2W00A 4UUSB 4UB6C 5FD6A 1S29A 4B09A 1LJ9A 4BJTA 4UB8C 1QU3A 1H89C 3BR5A 5FFZA 4AYBA 4XOPA 1R22A 2XF5A 2PMZN 4OMYA 2BZTA 4P9UA 3KYLA 4PJMA 3PNVA 2BGCA 4EJWA 3JRAA 4IRGA 3I58A 1OCTC 1FOWA 1O57A 2HGCA 3OYCA 3JRIA 2FA5A 3WTSC 1TP4A 4M74A 3ESWB 4N4NB 3EUAA 5KAIC 3MKLA 3RTRA 2R7VA 2R7FA 4PJ0C 3S15J 1EH7A 2DYRH 2M7AA 1JUSA 4KUMA 1MZBA 3HZJA 4PCQA 5EJCA 3X2QH 4YEJA 1BR1A 3CCYA 3CZ6A 3OSFA 1UHMA 2Y69H 1FOXA 4DW6A 5LHGA 3AG3H 2VUMJ 4AD9A 1UELB 3PSIA 1J09A 1GLNA 4RB0A 3IRRA 3DPLC 4F93B 1B8IB 5HS8A 5ED4A 2IA1A 3DLLF 1KONA 3K4LA 2OCCH 2P6TA 4XQFA 2XC7A 2QYOA 3E7LA 2AS5F 2A6HF 2KZVA 1Z7LA 4IQ4A 4D0PA 3F21A 1FTZA 1W0TA 3DEEA 3SJMA 4X1EA 3PIPF 2JA6J 1VQNI 1RR8C 3H0GJ 4RAZA 4BQQA 3CUQA 3MAJA 1A36A 4M3GA 4A12A 2XB0X 1SMYF 5K7HA 4AIDA 2OF7A 3ZQCA 2L7MP 3A0HC 2IAIA 2I5UA 2K5CA 1FBUA 2GOXB 3L00A 2L0KA 1T0FA 2RNJA 4Q4ZF 4PSWA 1S7OA 3EUHC 2HKXA 2K3PA 5ILUA 2DJNA 2P81A 4JP0A 4ZYEA 3W2VA 1IDZA 1QQIA 2HDCA 5TGTA 1ULYA 3JCUC 1X1BA 4PFOA 1FWZA 2E71A 1SANA 2Z16A 4XNFA 1I50J 3PUFA 1PDNC 1ZG1A 2L54A 4BS9A 5FLMJ 3SXYA 2ZNZA 2ZXHA 5J1RA 3IP4B 3TDZC 3D5SC 3I59B 1FZPB 3DPTA 5M3MJ 1BIAA 1E3OC 3HRTA 2IRFG 2E1NA 2LOOA 4A6DA 4JQFA 2EPFA 3R6SA 5E1WA 5F1JA 1A31A 3DBHB 4MIMA 3IAM2 1E2XA 3O3KA 1O3TA 1FPQA 1MW7A 1ZG5A 1J0RA 1WKMA 1V3FA 2HVQA 5GAEJ 1F1ZA 2K85A 5EZHA 1KQ8A 2EZHA 1YW7A 1Y1WJ 2FF4A 4II3A 2DFEA 1VQPI 3ZQIA 5E17F 2ACJA 4BQOA 1IV8A 3R61A 2DA4A 3ASNH 4A3EJ 1SAUA 1WJBA 1OCPA 3EQLF 2Y9ZA 1O3SA 1ZHFA 3CMMA 3GBGA 2X1DA 1ZGAA 2V1NA 1AWCA 1NK3P 3DXJF 2VC0A 3TOAA 4E7JA 1Z67A 2FOWA 5D8KB 3LSJA 3RI4A 4MQ9F 1Y0UA 5E3MA 1W36C 2QM3A 4GYGA 5GPCA 4OU0A 4P1WA 5LBQA 3KPHA 2HNHA 3TMOA 3WODF 2KRCA 2CQQA 1WVRA 4XK4A 3FZVA 3G1MA 4E7IA 4P9FA 2X9DA 5HDGA 1KQ9A 5KNLA 2GXGA 2HXIA 3NWSA 4NUBA 2BYVE 1A04A 4EVIA 4E7LA 5DD8A 4L5EA 2PJRA 1HXDA 3GTMJ 1HKSA 3OV8A 3I54A 1JTYA 2DT6A 3GFIA 2IJLA 4JX4A 2RQPA 4FX4A 4B48A 4PJNA 4E7SA 2K9SA 3ZGKA 4JYKA 2DQRA 4HX7A 3VB2A 3I71A 1GVDA 5EEGA 3T8RA 3ZR8X 3OYNA 2AQEA 5IOYA 1DPUA 4KNYA 1D1CA 5FKMA 4WWCA 5B3SH 2BXZA 3KEQA 1W1WE 1YOVB 3K7AJ 2LSOA 4L9TA 1NK2P 4B43A 1ACIA 3K2ZA 2X0LA 1YYVA 1PP8F 3S2HJ 3QAHA 5M3FJ 1TQPA 2ICWG 1AOYA 3HOZJ 5L3BA 5K1YA 2WAFA 4XLPF 2DODA 3P5JA 4CUGA 4E7KA 3V7CA 2VE9A 2DT5A 4J01A 3ZQLA 2LP0A 1GUUA 3F6VA 5F04A 4D5FA 1WJDA 5FRMA 2DLLA 4WF2A 1TW2A 1Q1HA 2HOSA 2NRAC 2A69F 1MNEA 2A6EF 2KHMA 2DA5A 2DFIA 3FDYA 2F4OB 2DT7B 5FGMA 2Y0SN 2X1CA 3ERMA 1V55H 5K7ZA 2G9WA 5KCMA 4UUSA 2L3DA 3OYDA 4XL9A 5C4XJ 4GRIA 3CLOA 3EPZA 3JRBA 3FM3A 3HSEA 3M7GA 4HLYA 4CZZA 3F8BA 4HF1A 1GHCA 1MMNA 2EV6A 1E3HA 3KP3A 3L09A 3RYRA 3REOA 5J40A 5ICEA 3SZPA 2LLKA 4F7ZA 5GAHJ 5FLXK 4ON0A 1T39A 1I5ZA 3P7NA 3FISA 1D5YA 3KEOA 4B1RA 4XRSA 4YIRX 1SFEA 2M0MA 3PUBA 4IOAF 3M07A 1IRZA 2VASA 5GTIC 2EFNA 2JUCA 3H9JA 2MH2A 2VBXA 4MFDA 3GTLJ 1IO2A 1A6QA 5D5WB 4AWXB 3PM1A 3BDDA 2PX9A 2EH3A 4UVBA 1WPKA 3F3XA 4NQWA 3BCAA 5IT3A 3BLYA 4M3EA 2LY2A 2Y9YA 2DCEA 2QEXI 4ZYDA 3ABKH 3R0JA 3ZMTA 2VPLA 3LSPA 4BEHB 1TZLA 1TW3A 1XPXA 2HWVA 2NOJB 3BJ6A 2Y31A 3N97A 3OYJA 2WV1A 3H3ZA 3TDUC 3MKZA 1LVKA 3I3LA 5BNGA 2JRMA 4MTEA 1EKEA 2Q2EB 1LFUP 2R7SA 2CJJA 2F5DA 2OA4A 4GYIA 1UAAA 2OV7A 2DOFA 2IGNA 1SFXA 3O6BB 1OKRA 4F52A 2PQ8A 2ZB9A 3JRCA 2MLGA 4MGRA 1UCRA 2O03A 3GMEA 2VJIA 4QWQA 4L5JA 3BR3A 1KGSA 4S0HB 4BXFA 1W5CC 3RQ4A 2JA2A 3U9GA 2OZ6A 3U21A 4G7ZF 1UZCA 1V5GA 1E3PA 3RPUA 1U5TB 1YS6A 5JLXA 4EEFG 3QQAA 3F22A 1BW5A 2X4HA 1K83J 2A6TA 1IF1A 1UG0A 4CCOA 2QSGX 2JUGA 3I59A 3FMQA 3CP8A 4HNVA 3Q5FA 1J2XA 2M1BA 3F0CA 2DOAA 2B63J 2CG4A 2QSFX 1T98A 1FBQA 3U1KA 4P55A 3DEUA 5IYBJ 2HQ5A 3FXMA 2OTJI 1RI7A 3HPGA 2DOEA 3OS1A 1WJCA 4UXNA 1WJ5A 3KFWX 4K2EA 4II2A 3CP2A 2EB7A 3VEPA 2QVOA 2XROA 3HKZA 2A68F 5ERIA 4ENKA 1X3UA 4RGXA 1HC8A 2HOEA 2CUFA 4G7HF 4ZTFA 2LD5A 3WG9A 1IXCA 1OCOH 3RQIA 2NVXJ 3V7SA 3DCFA 3E0JB 2M45A 2PN6A 1R23A 2CYYA 3MQ0A 1YJ9I 2FBHA 2R7QA 2F4IA 3BG6A 3WU1B 5IYCJ 3G71I 2EZLA 3BG5A 3N4MA 3PQJA 1RETA 2LK2A 2F5FA 1R58A 4BXUA 2NYXA 3HGYA 4ENMA 1ZQ3P 1W7PD 1ZELA 3B02A 1YRNB 1WCMJ 2YX4A 3HUGB 3KP5A 4A3JJ 1U9OA 3H35A 4EV0A 2K3FA 4BYYA 3JRGA 4HRIA 4HDUA 1J9IA 1B9MA 2KFDA 2CW0F 3OYHA 2VODA 3FIWA 4XORA 5D6FA 3MD2A 1BC7C 2V9KA 5H6QA 4XOTA 3BR6A 1R49A 3E6BA 1VZ0A 3UR3C 3ZPLA 2K9MA 4ABZA 2XPUA 2IEKA 3P9CA 4EQQA 3J81Z 2VKEA 3CDHA 1YFHA 3JR9A 1U8RA 1BJZA 1IN4A 5HLIA 2VOOA 3CF5F 2XVCA 3RYPA 3ZCOA 1ENHA 1R4NB 2PMHA 4RGRA 4LLGF 4OINF 3ZMVA 2ZMEC 4Q47A 2WAEA 3L2WA 4FTHA 2AO9A 4J00A 2P7CB 4UUTA 1S6LA 2Y2ZA 5HVQC 4BQAA 3J80Z 2XGCA 2PMZA 1UG2A 4E7HA 5CQGA 1MGTA 2KJBA 2C6YA 3DWLE 1F5TA 4CZCA 2MABA 3OL3A 1DPRA 1JUMA 1EA3A 4C3IJ 1KU2A 3QP5A 4RM2A 3BTCA 3JTHA 4F92B 2LMDA 3VSLA 4CYCB 1DP3A 4QSHA 3LA2A 4OIPF 4HF0A 3VSKA 1LE8B 3EDPA 2HS5A 1KZHA 4OAYA 3RJPA 1YQAA 4BE1A 2XGDA 3KZYA 4BH9A 1X1PA 4ESBA 1XSVA 4QTRA 2ZJRF 2DMTA 3MKWB 2VLAA 3BG7A 1BI2A 2ELJA 4ENNA 4PDKA 3R60A 2NS7A 2RQQA 3HOSA 3BPXA 4RBOA 1X58A 1OJLA 4P96A 3DLAA 3GWZA 4EJVA 5TRDA 5ICGA 2F2EA 2PJPA 2X6OA 1U2WA 2J5PA 1MMAA 4N0BA 4BBSJ 5L3GA 2DFFA 1IC8A 1ZR2A 3V8JA 5ICFA 3J7ZI 1RPWA 2NNYA 3GUDA 1HDDC 3D5RC 1OYWA 2ZCWA 2VOPA 1R6RA 1X3WB 1TT0A 2ID6A 3OYKA 5K5RA 5JLWA 3D0SA 4XN3A 3HL2A 4BQNA 3I55I 3ZOBA 4HSTA 5JVTA 1PP7U 1YX3A 2P8TA 2TRTA 5D5UB 3LA7A 2DO7A 3HSFA 2Q8KA 1WH7A 2M34A 2CW8A 1X1DA 3TO9A 5CVIA 4IHYA 4BEHA 4BHPA 2BVMA 4RB2C 4W1UA 4H0EA 2XB5A 1HW2A 3CUQC 3BT9A 3OYAA 1SD7A 3LSKA 2HFHA 1X19A 2RVCA 2HZTA 4BE0A 1MNMC 1OR7A 1ZAOA 3WHBA 4A5MA 4ASNA 3I9V2 3SDGA 5IP7J 4X0GA 4A3FJ 5CVJA 1T0FC 1KU7A 4A3BJ 4KICA 2DMPA 1SVLA 2L9RA 2P4WA 1P92A 3H9GA 3CO6C 1V4RA 4F55A 2BW3B 2ZSHB 4KIFA 2ZXJA 1FX7A 5ILVA 3A4CA 1XSXA 2VKVA 1ETYA 1AKHB 3K69A 2Z99A 4JX6A 1BW6A 4CCNA 3KE2A 3FXOA 1ZK8A 2M2EA 3ZMSA 2GBYA 1DGRM 2FU4A 3S14J 1U5TA 3SHFA 1WJFA 4N4OB 2ECBA 2BXYA 1U8BA 2E5ZA 4BUPA 4LB5A 3KYDB 3ZN1A 3K6GA 1K6YA 1YE9A 2CMPA 4DOZA 4EM0B 4IOCF 2BEOA 1FEXA 3HBLA 1Z9CA 3I53A 2EA2A 1Z6RA 2DN0A 2EINH 3S32A 5CJ9A 2VE8A 1Y1VJ 3BQZA 4RS8A 4A3LJ 1W7PB 3MKYB 3BZ6A 4CYDA 1G3WA 1OISA 1ON2A 2M9HA 2EK5A 1B72B 2CH0A 4YFNF 2JK3A 1XD7A 4IF4A 2A61A 3K4CA 1A6IA
chains in the Genus database with same CATH topology
3IWFA 3F6OA 4OIOF 3BWGA 1BN5A 5DV5A 3J81K 3DQVC 5DDGA 3PFIA 4OOIA 1GXQA 2QUFA 1CF7A 3FXQA 4M6YA 1P4AA 1XDUA 2WC2A 1U78A 3WE3A 1FYKA 3J80K 5HDKA 2V6CA 3RDIA 1OYYA 1IXSB 3DF8A 1KU9A 2K86A 3M1EA 4Q5SF 4KYWA 1KYWA 2W57A 3K1NA 3GEZA 3KLOA 6PAXA 2IA0A 4O3MA 3E6DA 3GFJA 1R1TA 4U7BA 2OZUA 2ADUA 4HX4A 4EM1A 4A0ZA 2QWWA 1IN8A 4GO1A 1B4AA 1CGPA 1Z1DA 3KP7A 3ZMUA 3K1PA 1XGOA 1FNNA 2GWRA 5D8LB 3LA3A 1FT9A 2L02A 3F8FA 3GFLA 5IT9Z 4I0AA 4L5IA 1XB4A 1ZLKA 4HV6A 1R00A 2A3SA 1GXPA 1J59A 2DW4A 1GVJA 1D8JA 3F8CA 1YW9A 2DTRA 3ZMDA 2LNBA 3GVAA 4IXAA 4P5OA 3OOPA 3BY6A 4WXHA 4CO8A 3HTUA 1YTYA 2XKOA 4BHCA 1RIOH 1K7AA 4M71A 2FBIA 3KZZA 2BE5F 3Q9SA 3E3VA 1D8KA 2KIFA 3BOQA 4UNOA 4XLNF 2FNAA 4M9SA 2ESHA 5FB2A 1QO0D 1EV7A 2A5YB 1STZA 2Q0OA 4GCVA 2YR2A 1YG2A 2XAFA 5KVRA 3CTAA 3FXUA 1IRFA 3EYYA 1R36A 1F4KA 3T8TA 1W4MA 3K0LA 4UHTA 3SZTA 1OYIA 3KP2A 5JR3A 2OBPA 4HOBA 5E8GA 2XRNA 1OPCA 4DNCA 3IKTA 1HW1A 4R79A 4CGZA 3KCCA 3GZ5A 4A0YA 1R1VA 1L0OC 4WXCA 1D3YA 1MDMB 2DI3A 1J7KA 3BJOA 4RB1A 5BPDA 3ABUA 2FMYA 2DU9A 5E20A 3WTXC 3E5XA 4O5VA 2STWA 3W6JB 1S8NA 4FX0A 5DCMB 4G9YA 5F64A 1W7PA 3MCZA 2MH9A 4HQEA 2DBBA 1IZ1A 1P4WA 2DK5A 2CSOA 1T6SA 2PMUA 3MZHA 5AONA 1MD0A 4WXDA 3WE2A 3C1DA 3IRQA 2ISZA 5HS7A 5A2QZ 3ZN0A 5J8FA 5E18F 4KFCA 2COMA 3EYIA 1YW8A 2GA1A 2P6SA 1ZLJA 2PEXA 2IW5A 1VTNC 1R5GA 4U88A 2O61A 5IT9K 1G6NA 3TO6A 2B0LA 2RGVA 5DUIA 4RGSA 1BM9A 4EMSA 1R7JA 2ZNYA 4A2UA 3FXRA 4OIRF 3MWMA 4CDGA 4BNCA 2UZKA 4U0YA 2M30A 2PG4A 1K79A 5K5QA 1LDJA 4KMUX 1O3RA 3WGGA 4M9XA 2VONA 2WWYA 5BPIA 2FNPA 3K1MA 2VT3A 3PQKA 2MC3A 4LG0B 1FC3A 1L3LA 4HF2A 1TLHB 2XAHA 4U7DA 2E7XA 3I64A 5EEHA 2M8EA 5BOXA 1TNSA 3WGIA 4Y13A 2XASA 1U6GA 1G3SA 3FF5A 2KJCA 5K5OA 2ZMEB 5LLQA 2DPDA 1JHFA 1TQIA 2XUBA 4CHUA 2QQBA 2ZKZA 4I02A 4KIBA 4IHSA 1JXSA 3TGNA 5D6EA 3P9IA 1XSDA 2PI0A 4IPAA 4AIJA 2KRFA 4U0VA 1EH8A 2GA2A 2GQQA 1W5SA 3GX4X 3WTWC 2QZ8A 4BHBA 3ZQ7A 2YX7A 4Z2YA 1RUNA 3ELKA 3S2WA 2QLZA 4L0YB 1SD5A 3QP6A 3FX3A 1O7LA 1HKTA 3DKWA 2OQRA 2QQAA 3QU6A 5BMZA 2OU2A 2W84A 3QRFF 4I0BA 1FP2A 3IL2A 1U3EM 4CXFA 1MDMA 1P2FA 3CUOA 5H6RA 5A2QK 2ISYA 5LEKA 2J5OA 3MZYA 1U5TC 3QU3A 1KA8A 1ZARA 5F1RA 5D4RA 2GIVA 3IWZA 2EWNA 1IN7A 1BOAA 4HQMA 3F8MA 2H6CA 4HLXA 3P9KA 3KLNA 2QENA 2KKOA 5LGNA 4R8HA 2V1DA 2YSRA 3CO7C 4NB5A 2H27A 1YS7A 2VBZA 4ZYGA 5CVUA 4A5NA 3GYHX 3SFZA 4AIHA 1H0MA 4YIFA 4TV7A 2CWEA 1SD6A 1MJ9A 1WWXA 1KYZA 4ZZLA 2Z9OA 4QLCU 5LRRA 3R0AA 4KIGA 4I01A 1QGPA 2HKOA 3WGHA 2JPBA 1Z6TA 4XSXF 1BI0A 3D5LA 1LQ1A 3HSRA 2HTSA 4XSZF 4EJOA 3BP8A 2VT2A 4HAMA 2W85A 1XMAA 4B8XA 3VFZA 2PBIA 2F5CA 1WQ2A 3FWEA 2D45A 2EJRA 3V8KA 2K27A 1TTYA 1B9NA 3W6KB 1C0WA 2Q2EA 3KP6A 2L4MA 4L0ZB 4KN4X 1G3YA 4EGYA 2LKPA 1H9GA 1XGSA 3E5QA 3F8NA 3NRVA 1ZRCA 1BI3A 5ICCA 1PUEE 5ILSA 2FQ3A 1OMIA 3T1BA 2L4AA 1LDKB 2GZWA 2D1VA 3IHUA 2R7DA 2H6BA 5HLGA 4ENJA 4EJTA 3NEUA 3RKYA 2HQRA 3ISPA 2QQ9A 2UWMA 1QZZA 5E8IA 3GFMA 1ONVA 4R1HA 1R5HA 2K02A 3L9FA 1ZN2A 1K78B 1P4XA 4A0XA 1E17A 4M73A 1ZYRF 1XN7A 5F6FA 1BI1A 1JE8A 4LLLA 1Z91A 2EFWA 2IT0A 4LD5A 4G94A 3RIRA 1UFMA 2NNNA 5LHIA 3SQNA 3FMRA 3HUGA 2PLYA 5KK1A 4MEYF 2P5VA 4U0WA 2E1CA 2V1UA 1DDNA 2XAQA 3F72A 1IUYA 2YPRA 1DP7P 2Y48A 2IP2A 1I1SA 3LSTA 3VOEA 1IRGA 2UXXA 1S3JA 2EV5A 2P5KA 2Z5UA 1Z7UA 1LB2A 1BJAA 2EFOA 4NHJA 4LJZF 2G7UA 3C18A 5CVVA 2HEOA 1O3QA 4IJAA 5JHUA 1HSJA 1WI9A 2NS0A 2FMLA 2FOKA 4FHTA 3QPTA 4HX8A 2O3FA 4KMFA 3WTVC 2VN2A 1ZRFA 4MTDA 1QZYA 2PFBA 1IXRC 1HQCA 3JW4A 3IKVA 2MBFA 1USSA 3ZMZA 2FBKA 3DV8A 2A07F 5LRSA 3GW2A 1REPC 5FLXZ 1LDDA 1ZGJA 2OQGA 2TDXA 4Q48A 4UV9A 3VODA 3G73A 2Y0MA 3Q9VA 2FE3A 2CGPA 2AXLA 3GZ6A 4RAYA 2P7VB 2RKHA 2DK8A 3L2CA 2ELHA 4M72A 4ZYHA 4WCGA 3COAC 3G3ZA 3ECHA 5BS6A 1ZG3A 3HHGA 3E6CC 3T5XA 1D5VA 4I7HA 5AIPA 3LFKA 1R1UA 4ZH4F 2VC1A 1H9TA 3IC7A 3LAPA 3FM5A 1UB9A 3TOBA 1LVAA 3HTSB 5CVRA 1RZ4A 4LK1F 2ZJ2A 4OMZA 3LQRA 5E1ZB 3RKXA 5DYMA 3RPQA 1KQ0A 2O6GE 2WTEA 3K9TA 2IA2A 5AIQA 4UVAA 2L01A 3WTYC 5JI6A 2Y75A 3I5UA 1LEBA 1IAWA 1BIBA 2BV6A 1ZH5A 3ABTA 2EV0A 3HOTA 1NHAA 1IN6A 5J8CA 2EFQA 3LQQA 3E6MA 5LGTA 3FMSA 1HSTA 4KA4A 4MHGA 5LHHA 4XBFA 2JTVA 1XGMA 3GLXA 1XCBA 4HZFA 2XGXA 4MQVA 3V4GA 4Y17A 5HS9A 1K78A 4LB6B 2GXBA 4RGUA 2V79A 2MLKA 3I4PA 3EUHA 3GXOA 2QBYB 2H94A 1I1GA 4YFXF 2JT1A 2CO5A 2EFPA 5J6XA 4LLNA 2HYFA 4WX9A 3HRUA 3JAMZ 2LDUA 1I6XA 4KN7X 3ECOA 3BROA 3J7AO 4IRHA 4GGGA 3C7JA 2RDPA 2XIGA 3FHZA 2JPCA 4MEXF 3QPHA 3NQOA 2JRTA 3TKYA 1FYLA 2HR3A 3U1DA 2XHKA 2STTA 2LF8A 4G6QA 4A6EA 5BQTA 5L3FA 1FLIA 1B59A 1G3TA 2EA4A 1FY7A 2BBYA 3U2RA 3MFKA 5HLHA 1XGNA 1MJBA 2O0YA 5TJJA 2K7LA 5E1XA 1USTA 2XKPA 5CLSA 2JZYA 5LGUA 5DCFA 1SFUA 3TQNA 3V8LA 4N9HA 4PGGA 4WK8F 1XMKA 4MNUA 1P6RA 4I2OA 1ZRDA 4YFKF 3M8FA 1HBXG 1YLFA 2ETHA 3KP4A 4HYEA 4KT5C 2RN7A 4EM2A 1I27A 4O6JA 1SMTA 1XDSA 3WTTC 5CYVA 2MD5A 1FOKA 2E7WA 4PGHA 3H92A 4YIIA 1HKQA 4UVCA 1YO5C 5L3CA 2D1HA 3R4KA 1FYMA 2HTJA 2ZBKA 3GF2A 2D2WA 4XRFA 3HRMA 5HDNA 2P5LC 1FSHA 3AAFA 1RUOA 5DEQA 5HOOA 1ON1A 3T0YA 1J5YA 2F5EA 4EGZA 2DQLA 4L9VA 2KIMA 2ESNA 3CJNA 2K4JA 5FFXA 2FXAA 2OD5A 3E5UA 3HYIA 3E97A 2WV0A 4I09A 1FP1D 1B6AA 4EJUA 1CF7B 3DFGA 4AVPA 4Y15A 4RB3C 3V7RA 1T38A 2XV4S 4UV8A 2UXNA 1KU3A 2ZO4A 4LMYA 2XAJA 3DP7A 4I98B 1FBSA 5D4SA 2FRHA 4HDVA 1SD4A 2G7HA 3C3WA 3M8EA 1EH6A 3WTUC 4L9NA 4M9ZA 1WRJA 3GO5A 3TO7A 1RNLA 4N9IA 4GXOA 4LFUA 2V1XA 3BPVA 1YIOA 3B73A 4IVNA 4L9JA 5DCMA 3WTZA 1K6OA 4OIQF 3JAMK 1FSEA 2R3SA 4JK1X 4UUVA 1TNTA 4JBAA 2KIUA 2GAUA 5FD5A 3CUQB 3JSPA 2HYGD 1QPMA 5L3DA 3MEXA 4G6DA 2ZFWA 4E70A 3ULQB 4L18B 4DQ2A 2O8XA 4M6XA 4PZJA 4G8XA 3WU0A 1UHWA 4HW0A 2IVMA 2Z33A 2QBYA 2JSCA 1WSUA 3RKWA 2H09A 4BAYA 1S7AA 4HBLA 4AIKA 3F23A 5H20A 1BC8C 5D5XB 2VBYA 3ZP5A 3BJAA 4G7OF 4CICA 3HRSA 4S05A 2Z3YA 5FO5A 1JGSA 5LEJA 5DD4A 3ML6A 3O2PE 5DUKA 2K4BA 4IHTA 4FT8A 1ODDA 4ZZDA 4S04A 2FEZA 1IW7F 2M87A 2OAZA 3JTGA 2W24A 5D5VB 1J75A 5L3EA 3JSOA 2VXZA 1TBXA 1B1BA 2RC4A 4LG0A 3LAJA 1LEAA 2CQKA 4HA8A 3HHHA 4ESJA 2XAGA 1LNWA 1O7FA 3ERED 3KETA 2RV8A 3H3UA 3ROUA 4LK0F 2LF7A 3M9AA 1F9NA 1HW5A 1JHHA 1MKMA 1IN5A 2ZMEA 1W5TA 1MJAA 2CFXA 2MA3A 4YG2F 2NAZA 3L7WA 4HV5A 4IRIA 2V9VA 3LWFA 2YU3A 2DPUA 1BBYA 2FSWA 2M5WA 1XCVA 3I0TA 4LGWA 2W25A 1G4DA 3EETA 2HQNA 3HIFA 1TQMA 3QOPA 1Z05A 2IPQX 1T2KA 1QNTA 5JFRA 1ZREA 4ESFA 2VBWA 1SAXA 4ETSA 1QBJA 1DUXC 4KDPA 2DAOA 5FD6A 1S29A 4B09A 1LJ9A 5FFZA 1R22A 4OMYA 4P9UA 2BGCA 4EJWA 4IRGA 3I58A 1O57A 2HGCA 2FA5A 3WTSC 4M74A 3RTRA 2R7FA 1EH7A 4KUMA 1MZBA 4PCQA 1UHMA 5LHGA 4AD9A 4RB0A 3IRRA 3DPLC 5HS8A 5ED4A 2IA1A 2P6TA 2QYOA 2AS5F 2A6HF 4D0PA 3F21A 4RAZA 3CUQA 3MAJA 4A12A 1SMYF 1FBUA 3L00A 1T0FA 2RNJA 4Q4ZF 1S7OA 2HKXA 5ILUA 4ZYEA 1QQIA 2HDCA 1ULYA 1FWZA 1PDNC 1ZG1A 2L54A 3SXYA 2ZNZA 3TDZC 3I59B 1FZPB 3DPTA 1BIAA 3HRTA 2IRFG 2E1NA 4A6DA 4JQFA 3R6SA 5E1WA 1E2XA 3O3KA 1O3TA 1FPQA 1ZG5A 1J0RA 1WKMA 1V3FA 1F1ZA 1KQ8A 1YW7A 2FF4A 5E17F 2ACJA 3R61A 3EQLF 1O3SA 1ZHFA 1ZGAA 1AWCA 3DXJF 2VC0A 3TOAA 5D8KB 3RI4A 4MQ9F 1Y0UA 2QM3A 4GYGA 4OU0A 5LBQA 3WODF 3FZVA 4P9FA 5HDGA 1KQ9A 2GXGA 2BYVE 1A04A 4EVIA 5DD8A 1HXDA 1HKSA 3OV8A 3I54A 3GFIA 2IJLA 2RQPA 4FX4A 2DQRA 4HX7A 3VB2A 3I71A 5EEGA 3T8RA 1DPUA 4KNYA 4WWCA 3KEQA 2LSOA 4L9TA 3K2ZA 2X0LA 1YYVA 1PP8F 3QAHA 1TQPA 1AOYA 5L3BA 5K1YA 4XLPF 3V7CA 2VE9A 2DT5A 3F6VA 2DLLA 4WF2A 1TW2A 1Q1HA 2NRAC 2A69F 2A6EF 2DFIA 5FGMA 2G9WA 2L3DA 3CLOA 3FM3A 3HSEA 3M7GA 4HLYA 4CZZA 3F8BA 4HF1A 1GHCA 2EV6A 3KP3A 3L09A 3RYRA 3REOA 5ICEA 3SZPA 4F7ZA 5FLXK 4ON0A 1T39A 1I5ZA 3P7NA 3KEOA 1SFEA 2EFNA 2MH2A 2VBXA 5D5WB 4AWXB 3BDDA 4UVBA 4NQWA 3F3XA 5IT3A 4ZYDA 3R0JA 3ZMTA 1TW3A 2HWVA 3BJ6A 3N97A 3H3ZA 3TDUC 4MTEA 2F5DA 2OA4A 4GYIA 1SFXA 3O6BB 1OKRA 2PQ8A 2MLGA 4MGRA 1UCRA 2O03A 4QWQA 4L5JA 1KGSA 3U9GA 2OZ6A 4G7ZF 3RPUA 1U5TB 1YS6A 3F22A 2X4HA 1IF1A 3I59A 3FMQA 3Q5FA 1J2XA 2M1BA 2CG4A 1T98A 1FBQA 4P55A 3DEUA 1RI7A 4UXNA 3KFWX 4K2EA 2EB7A 3VEPA 2QVOA 2XROA 2A68F 5ERIA 4ENKA 1X3UA 4RGXA 2HOEA 4G7HF 3WG9A 1IXCA 3V7SA 2M45A 2PN6A 1R23A 2CYYA 3MQ0A 2FBHA 3WU1B 3N4MA 3PQJA 2F5FA 1R58A 4BXUA 2NYXA 4ENMA 1W7PD 3B02A 2YX4A 3KP5A 4EV0A 4BYYA 4HDUA 1J9IA 1B9MA 2CW0F 2VODA 5D6FA 1BC7C 5H6QA 3E6BA 3ZPLA 4EQQA 3P9CA 3J81Z 3CDHA 1YFHA 2VOOA 1U8RA 1IN4A 5HLIA 2XVCA 3RYPA 2PMHA 4RGRA 4LLGF 4OINF 3ZMVA 4Q47A 2P7CB 1S6LA 5HVQC 4BQAA 3J80Z 1MGTA 2KJBA 2C6YA 1F5TA 1DPRA 1KU2A 3QP5A 3JTHA 3LA2A 4OIPF 4HF0A 3EDPA 2HS5A 3RJPA 1YQAA 3KZYA 4BH9A 4ESBA 1XSVA 1BI2A 4ENNA 4PDKA 3R60A 3HOSA 3BPXA 4P96A 3GWZA 4EJVA 5TRDA 5ICGA 2F2EA 2PJPA 1U2WA 2J5PA 4N0BA 5L3GA 3V8JA 5ICFA 2NNYA 3GUDA 1OYWA 2ZCWA 2VOPA 5K5RA 3D0SA 5JVTA 1PP7U 2P8TA 5D5UB 3LA7A 2DO7A 3HSFA 2Q8KA 3TO9A 5CVIA 4BHPA 4RB2C 4H0EA 1HW2A 3CUQC 1SD7A 2HFHA 2RVCA 2HZTA 1OR7A 1ZAOA 4A5MA 4ASNA 5CVJA 1KU7A 4KICA 2P4WA 3CO6C 1P92A 1V4RA 4KIFA 2ZXJA 1FX7A 5ILVA 1XSXA 3K69A 2Z99A 3KE2A 3ZMSA 2FU4A 1U5TA 3SHFA 4LB5A 3ZN1A 4EM0B 2BEOA 1Z9CA 3I53A 2EA2A 1Z6RA 5CJ9A 2VE8A 4RS8A 1W7PB 3BZ6A 4CYDA 1G3WA 1ON2A 2EK5A 4YFNF 1XD7A 4IF4A 2A61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWF A;  3F6O A;  4OIO F;  3BWG A;  1BN5 A;  5DV5 A;  3J81 K;  3DQV C;  5DDG A;  3PFI A;  4OOI A;  1GXQ A;  2QUF A;  1CF7 A;  3FXQ A;  4M6Y A;  1P4A A;  1XDU A;  2WC2 A;  1U78 A;  3WE3 A;  1FYK A;  3J80 K;  5HDK A;  2V6C A;  3RDI A;  1OYY A;  1IXS B;  3DF8 A;  1KU9 A;  2K86 A;  3M1E A;  4Q5S F;  4KYW A;  1KYW A;  2W57 A;  3K1N A;  3GEZ A;  3KLO A;  6PAX A;  2IA0 A;  4O3M A;  3E6D A;  3GFJ A;  1R1T A;  4U7B A;  2OZU A;  2ADU A;  4HX4 A;  4EM1 A;  4A0Z A;  2QWW A;  1IN8 A;  4GO1 A;  1B4A A;  1CGP A;  1Z1D A;  3KP7 A;  3ZMU A;  3K1P A;  1XGO A;  1FNN A;  2GWR A;  5D8L B;  3LA3 A;  1FT9 A;  2L02 A;  3F8F A;  3GFL A;  5IT9 Z;  4I0A A;  4L5I A;  1XB4 A;  1ZLK A;  4HV6 A;  1R00 A;  2A3S A;  1GXP A;  1J59 A;  2DW4 A;  1GVJ A;  1D8J A;  3F8C A;  1YW9 A;  2DTR A;  3ZMD A;  2LNB A;  3GVA A;  4IXA A;  4P5O A;  3OOP A;  3BY6 A;  4WXH A;  4CO8 A;  3HTU A;  1YTY A;  2XKO A;  4BHC A;  1RIO H;  1K7A A;  4M71 A;  2FBI A;  3KZZ A;  2BE5 F;  3Q9S A;  3E3V A;  1D8K A;  2KIF A;  3BOQ A;  4UNO A;  4XLN F;  2FNA A;  4M9S A;  2ESH A;  5FB2 A;  1QO0 D;  1EV7 A;  2A5Y B;  1STZ A;  2Q0O A;  4GCV A;  2YR2 A;  1YG2 A;  2XAF A;  5KVR A;  3CTA A;  3FXU A;  1IRF A;  3EYY A;  1R36 A;  1F4K A;  3T8T A;  1W4M A;  3K0L A;  4UHT A;  3SZT A;  1OYI A;  3KP2 A;  5JR3 A;  2OBP A;  4HOB A;  5E8G A;  2XRN A;  1OPC A;  4DNC A;  3IKT A;  1HW1 A;  4R79 A;  4CGZ A;  3KCC A;  3GZ5 A;  4A0Y A;  1R1V A;  1L0O C;  4WXC A;  1D3Y A;  1MDM B;  2DI3 A;  1J7K A;  3BJO A;  4RB1 A;  5BPD A;  3ABU A;  2FMY A;  2DU9 A;  5E20 A;  3WTX C;  3E5X A;  4O5V A;  2STW A;  3W6J B;  1S8N A;  4FX0 A;  5DCM B;  4G9Y A;  5F64 A;  1W7P A;  3MCZ A;  2MH9 A;  4HQE A;  2DBB A;  1IZ1 A;  1P4W A;  2DK5 A;  2CSO A;  1T6S A;  2PMU A;  3MZH A;  5AON A;  1MD0 A;  4WXD A;  3WE2 A;  3C1D A;  3IRQ A;  2ISZ A;  5HS7 A;  5A2Q Z;  3ZN0 A;  5J8F A;  5E18 F;  4KFC A;  2COM A;  3EYI A;  1YW8 A;  2GA1 A;  2P6S A;  1ZLJ A;  2PEX A;  2IW5 A;  1VTN C;  1R5G A;  4U88 A;  2O61 A;  5IT9 K;  1G6N A;  3TO6 A;  2B0L A;  2RGV A;  5DUI A;  4RGS A;  1BM9 A;  4EMS A;  1R7J A;  2ZNY A;  4A2U A;  3FXR A;  4OIR F;  3MWM A;  4CDG A;  4BNC A;  2UZK A;  4U0Y A;  2M30 A;  2PG4 A;  1K79 A;  5K5Q A;  1LDJ A;  4KMU X;  1O3R A;  3WGG A;  4M9X A;  2VON A;  2WWY A;  5BPI A;  2FNP A;  3K1M A;  2VT3 A;  3PQK A;  2MC3 A;  4LG0 B;  1FC3 A;  1L3L A;  4HF2 A;  1TLH B;  2XAH A;  4U7D A;  2E7X A;  3I64 A;  5EEH A;  2M8E A;  5BOX A;  1TNS A;  3WGI A;  4Y13 A;  2XAS A;  1U6G A;  1G3S A;  3FF5 A;  2KJC A;  5K5O A;  2ZME B;  5LLQ A;  2DPD A;  1JHF A;  1TQI A;  2XUB A;  4CHU A;  2QQB A;  2ZKZ A;  4I02 A;  4KIB A;  4IHS A;  1JXS A;  3TGN A;  5D6E A;  3P9I A;  1XSD A;  2PI0 A;  4IPA A;  4AIJ A;  2KRF A;  4U0V A;  1EH8 A;  2GA2 A;  2GQQ A;  1W5S A;  3GX4 X;  3WTW C;  2QZ8 A;  4BHB A;  3ZQ7 A;  2YX7 A;  4Z2Y A;  1RUN A;  3ELK A;  3S2W A;  2QLZ A;  4L0Y B;  1SD5 A;  3QP6 A;  3FX3 A;  1O7L A;  1HKT A;  3DKW A;  2OQR A;  2QQA A;  3QU6 A;  5BMZ A;  2OU2 A;  2W84 A;  3QRF F;  4I0B A;  1FP2 A;  3IL2 A;  1U3E M;  4CXF A;  1MDM A;  1P2F A;  3CUO A;  5H6R A;  5A2Q K;  2ISY A;  5LEK A;  2J5O A;  3MZY A;  1U5T C;  3QU3 A;  1KA8 A;  1ZAR A;  5F1R A;  5D4R A;  2GIV A;  3IWZ A;  2EWN A;  1IN7 A;  1BOA A;  4HQM A;  3F8M A;  2H6C A;  4HLX A;  3P9K A;  3KLN A;  2QEN A;  2KKO A;  5LGN A;  4R8H A;  2V1D A;  2YSR A;  3CO7 C;  4NB5 A;  2H27 A;  1YS7 A;  2VBZ A;  4ZYG A;  5CVU A;  4A5N A;  3GYH X;  3SFZ A;  4AIH A;  1H0M A;  4YIF A;  4TV7 A;  2CWE A;  1SD6 A;  1MJ9 A;  1WWX A;  1KYZ A;  4ZZL A;  2Z9O A;  4QLC U;  5LRR A;  3R0A A;  4KIG A;  4I01 A;  1QGP A;  2HKO A;  3WGH A;  2JPB A;  1Z6T A;  4XSX F;  1BI0 A;  3D5L A;  1LQ1 A;  3HSR A;  2HTS A;  4XSZ F;  4EJO A;  3BP8 A;  2VT2 A;  4HAM A;  2W85 A;  1XMA A;  4B8X A;  3VFZ A;  2PBI A;  2F5C A;  1WQ2 A;  3FWE A;  2D45 A;  2EJR A;  3V8K A;  2K27 A;  1TTY A;  1B9N A;  3W6K B;  1C0W A;  2Q2E A;  3KP6 A;  2L4M A;  4L0Z B;  4KN4 X;  1G3Y A;  4EGY A;  2LKP A;  1H9G A;  1XGS A;  3E5Q A;  3F8N A;  3NRV A;  1ZRC A;  1BI3 A;  5ICC A;  1PUE E;  5ILS A;  2FQ3 A;  1OMI A;  3T1B A;  2L4A A;  1LDK B;  2GZW A;  2D1V A;  3IHU A;  2R7D A;  2H6B A;  5HLG A;  4ENJ A;  4EJT A;  3NEU A;  3RKY A;  2HQR A;  3ISP A;  2QQ9 A;  2UWM A;  1QZZ A;  5E8I A;  3GFM A;  1ONV A;  4R1H A;  1R5H A;  2K02 A;  3L9F A;  1ZN2 A;  1K78 B;  1P4X A;  4A0X A;  1E17 A;  4M73 A;  1ZYR F;  1XN7 A;  5F6F A;  1BI1 A;  1JE8 A;  4LLL A;  1Z91 A;  2EFW A;  2IT0 A;  4LD5 A;  4G94 A;  3RIR A;  1UFM A;  2NNN A;  5LHI A;  3SQN A;  3FMR A;  3HUG A;  2PLY A;  5KK1 A;  4MEY F;  2P5V A;  4U0W A;  2E1C A;  2V1U A;  1DDN A;  2XAQ A;  3F72 A;  1IUY A;  2YPR A;  1DP7 P;  2Y48 A;  2IP2 A;  1I1S A;  3LST A;  3VOE A;  1IRG A;  2UXX A;  1S3J A;  2EV5 A;  2P5K A;  2Z5U A;  1Z7U A;  1LB2 A;  1BJA A;  2EFO A;  4NHJ A;  4LJZ F;  2G7U A;  3C18 A;  5CVV A;  2HEO A;  1O3Q A;  4IJA A;  5JHU A;  1HSJ A;  1WI9 A;  2NS0 A;  2FML A;  2FOK A;  4FHT A;  3QPT A;  4HX8 A;  2O3F A;  4KMF A;  3WTV C;  2VN2 A;  1ZRF A;  4MTD A;  1QZY A;  2PFB A;  1IXR C;  1HQC A;  3JW4 A;  3IKV A;  2MBF A;  1USS A;  3ZMZ A;  2FBK A;  3DV8 A;  2A07 F;  5LRS A;  3GW2 A;  1REP C;  5FLX Z;  1LDD A;  1ZGJ A;  2OQG A;  2TDX A;  4Q48 A;  4UV9 A;  3VOD A;  3G73 A;  2Y0M A;  3Q9V A;  2FE3 A;  2CGP A;  2AXL A;  3GZ6 A;  4RAY A;  2P7V B;  2RKH A;  2DK8 A;  3L2C A;  2ELH A;  4M72 A;  4ZYH A;  4WCG A;  3COA C;  3G3Z A;  3ECH A;  5BS6 A;  1ZG3 A;  3HHG A;  3E6C C;  3T5X A;  1D5V A;  4I7H A;  5AIP A;  3LFK A;  1R1U A;  4ZH4 F;  2VC1 A;  1H9T A;  3IC7 A;  3LAP A;  3FM5 A;  1UB9 A;  3TOB A;  1LVA A;  3HTS B;  5CVR A;  1RZ4 A;  4LK1 F;  2ZJ2 A;  4OMZ A;  3LQR A;  5E1Z B;  3RKX A;  5DYM A;  3RPQ A;  1KQ0 A;  2O6G E;  2WTE A;  3K9T A;  2IA2 A;  5AIQ A;  4UVA A;  2L01 A;  3WTY C;  5JI6 A;  2Y75 A;  3I5U A;  1LEB A;  1IAW A;  1BIB A;  2BV6 A;  1ZH5 A;  3ABT A;  2EV0 A;  3HOT A;  1NHA A;  1IN6 A;  5J8C A;  2EFQ A;  3LQQ A;  3E6M A;  5LGT A;  3FMS A;  1HST A;  4KA4 A;  4MHG A;  5LHH A;  4XBF A;  2JTV A;  1XGM A;  3GLX A;  1XCB A;  4HZF A;  2XGX A;  4MQV A;  3V4G A;  4Y17 A;  5HS9 A;  1K78 A;  4LB6 B;  2GXB A;  4RGU A;  2V79 A;  2MLK A;  3I4P A;  3EUH A;  3GXO A;  2QBY B;  2H94 A;  1I1G A;  4YFX F;  2JT1 A;  2CO5 A;  2EFP A;  5J6X A;  4LLN A;  2HYF A;  4WX9 A;  3HRU A;  3JAM Z;  2LDU A;  1I6X A;  4KN7 X;  3ECO A;  3BRO A;  3J7A O;  4IRH A;  4GGG A;  3C7J A;  2RDP A;  2XIG A;  3FHZ A;  2JPC A;  4MEX F;  3QPH A;  3NQO A;  2JRT A;  3TKY A;  1FYL A;  2HR3 A;  3U1D A;  2XHK A;  2STT A;  2LF8 A;  4G6Q A;  4A6E A;  5BQT A;  5L3F A;  1FLI A;  1B59 A;  1G3T A;  2EA4 A;  1FY7 A;  2BBY A;  3U2R A;  3MFK A;  5HLH A;  1XGN A;  1MJB A;  2O0Y A;  5TJJ A;  2K7L A;  5E1X A;  1UST A;  2XKP A;  5CLS A;  2JZY A;  5LGU A;  5DCF A;  1SFU A;  3TQN A;  3V8L A;  4N9H A;  4PGG A;  4WK8 F;  1XMK A;  4MNU A;  1P6R A;  4I2O A;  1ZRD A;  4YFK F;  3M8F A;  1HBX G;  1YLF A;  2ETH A;  3KP4 A;  4HYE A;  4KT5 C;  2RN7 A;  4EM2 A;  1I27 A;  4O6J A;  1SMT A;  1XDS A;  3WTT C;  5CYV A;  2MD5 A;  1FOK A;  2E7W A;  4PGH A;  3H92 A;  4YII A;  1HKQ A;  4UVC A;  1YO5 C;  5L3C A;  2D1H A;  3R4K A;  1FYM A;  2HTJ A;  2ZBK A;  3GF2 A;  2D2W A;  4XRF A;  3HRM A;  5HDN A;  2P5L C;  1FSH A;  3AAF A;  1RUO A;  5DEQ A;  5HOO A;  1ON1 A;  3T0Y A;  1J5Y A;  2F5E A;  4EGZ A;  2DQL A;  4L9V A;  2KIM A;  2ESN A;  3CJN A;  2K4J A;  5FFX A;  2FXA A;  2OD5 A;  3E5U A;  3HYI A;  3E97 A;  2WV0 A;  4I09 A;  1FP1 D;  1B6A A;  4EJU A;  1CF7 B;  3DFG A;  4AVP A;  4Y15 A;  4RB3 C;  3V7R A;  1T38 A;  2XV4 S;  4UV8 A;  2UXN A;  1KU3 A;  2ZO4 A;  4LMY A;  2XAJ A;  3DP7 A;  4I98 B;  1FBS A;  5D4S A;  2FRH A;  4HDV A;  1SD4 A;  2G7H A;  3C3W A;  3M8E A;  1EH6 A;  3WTU C;  4L9N A;  4M9Z A;  1WRJ A;  3GO5 A;  3TO7 A;  1RNL A;  4N9I A;  4GXO A;  4LFU A;  2V1X A;  3BPV A;  1YIO A;  3B73 A;  4IVN A;  4L9J A;  5DCM A;  3WTZ A;  1K6O A;  4OIQ F;  3JAM K;  1FSE A;  2R3S A;  4JK1 X;  4UUV A;  1TNT A;  4JBA A;  2KIU A;  2GAU A;  5FD5 A;  3CUQ B;  3JSP A;  2HYG D;  1QPM A;  5L3D A;  3MEX A;  4G6D A;  2ZFW A;  4E70 A;  3ULQ B;  4L18 B;  4DQ2 A;  2O8X A;  4M6X A;  4PZJ A;  4G8X A;  3WU0 A;  1UHW A;  4HW0 A;  2IVM A;  2Z33 A;  2QBY A;  2JSC A;  1WSU A;  3RKW A;  2H09 A;  4BAY A;  1S7A A;  4HBL A;  4AIK A;  3F23 A;  5H20 A;  1BC8 C;  5D5X B;  2VBY A;  3ZP5 A;  3BJA A;  4G7O F;  4CIC A;  3HRS A;  4S05 A;  2Z3Y A;  5FO5 A;  1JGS A;  5LEJ A;  5DD4 A;  3ML6 A;  3O2P E;  5DUK A;  2K4B A;  4IHT A;  4FT8 A;  1ODD A;  4ZZD A;  4S04 A;  2FEZ A;  1IW7 F;  2M87 A;  2OAZ A;  3JTG A;  2W24 A;  5D5V B;  1J75 A;  5L3E A;  3JSO A;  2VXZ A;  1TBX A;  1B1B A;  2RC4 A;  4LG0 A;  3LAJ A;  1LEA A;  2CQK A;  4HA8 A;  3HHH A;  4ESJ A;  2XAG A;  1LNW A;  1O7F A;  3ERE D;  3KET A;  2RV8 A;  3H3U A;  3ROU A;  4LK0 F;  2LF7 A;  3M9A A;  1F9N A;  1HW5 A;  1JHH A;  1MKM A;  1IN5 A;  2ZME A;  1W5T A;  1MJA A;  2CFX A;  2MA3 A;  4YG2 F;  2NAZ A;  3L7W A;  4HV5 A;  4IRI A;  2V9V A;  3LWF A;  2YU3 A;  2DPU A;  1BBY A;  2FSW A;  2M5W A;  1XCV A;  3I0T A;  4LGW A;  2W25 A;  1G4D A;  3EET A;  2HQN A;  3HIF A;  1TQM A;  3QOP A;  1Z05 A;  2IPQ X;  1T2K A;  1QNT A;  5JFR A;  1ZRE A;  4ESF A;  2VBW A;  1SAX A;  4ETS A;  1QBJ A;  1DUX C;  4KDP A;  2DAO A;  5FD6 A;  1S29 A;  4B09 A;  1LJ9 A;  5FFZ A;  1R22 A;  4OMY A;  4P9U A;  2BGC A;  4EJW A;  4IRG A;  3I58 A;  1O57 A;  2HGC A;  2FA5 A;  3WTS C;  4M74 A;  3RTR A;  2R7F A;  1EH7 A;  4KUM A;  1MZB A;  4PCQ A;  1UHM A;  5LHG A;  4AD9 A;  4RB0 A;  3IRR A;  3DPL C;  5HS8 A;  5ED4 A;  2IA1 A;  2P6T A;  2QYO A;  2AS5 F;  2A6H F;  4D0P A;  3F21 A;  4RAZ A;  3CUQ A;  3MAJ A;  4A12 A;  1SMY F;  1FBU A;  3L00 A;  1T0F A;  2RNJ A;  4Q4Z F;  1S7O A;  2HKX A;  5ILU A;  4ZYE A;  1QQI A;  2HDC A;  1ULY A;  1FWZ A;  1PDN C;  1ZG1 A;  2L54 A;  3SXY A;  2ZNZ A;  3TDZ C;  3I59 B;  1FZP B;  3DPT A;  1BIA A;  3HRT A;  2IRF G;  2E1N A;  4A6D A;  4JQF A;  3R6S A;  5E1W A;  1E2X A;  3O3K A;  1O3T A;  1FPQ A;  1ZG5 A;  1J0R A;  1WKM A;  1V3F A;  1F1Z A;  1KQ8 A;  1YW7 A;  2FF4 A;  5E17 F;  2ACJ A;  3R61 A;  3EQL F;  1O3S A;  1ZHF A;  1ZGA A;  1AWC A;  3DXJ F;  2VC0 A;  3TOA A;  5D8K B;  3RI4 A;  4MQ9 F;  1Y0U A;  2QM3 A;  4GYG A;  4OU0 A;  5LBQ A;  3WOD F;  3FZV A;  4P9F A;  5HDG A;  1KQ9 A;  2GXG A;  2BYV E;  1A04 A;  4EVI A;  5DD8 A;  1HXD A;  1HKS A;  3OV8 A;  3I54 A;  3GFI A;  2IJL A;  2RQP A;  4FX4 A;  2DQR A;  4HX7 A;  3VB2 A;  3I71 A;  5EEG A;  3T8R A;  1DPU A;  4KNY A;  4WWC A;  3KEQ A;  2LSO A;  4L9T A;  3K2Z A;  2X0L A;  1YYV A;  1PP8 F;  3QAH A;  1TQP A;  1AOY A;  5L3B A;  5K1Y A;  4XLP F;  3V7C A;  2VE9 A;  2DT5 A;  3F6V A;  2DLL A;  4WF2 A;  1TW2 A;  1Q1H A;  2NRA C;  2A69 F;  2A6E F;  2DFI A;  5FGM A;  2G9W A;  2L3D A;  3CLO A;  3FM3 A;  3HSE A;  3M7G A;  4HLY A;  4CZZ A;  3F8B A;  4HF1 A;  1GHC A;  2EV6 A;  3KP3 A;  3L09 A;  3RYR A;  3REO A;  5ICE A;  3SZP A;  4F7Z A;  5FLX K;  4ON0 A;  1T39 A;  1I5Z A;  3P7N A;  3KEO A;  1SFE A;  2EFN A;  2MH2 A;  2VBX A;  5D5W B;  4AWX B;  3BDD A;  4UVB A;  4NQW A;  3F3X A;  5IT3 A;  4ZYD A;  3R0J A;  3ZMT A;  1TW3 A;  2HWV A;  3BJ6 A;  3N97 A;  3H3Z A;  3TDU C;  4MTE A;  2F5D A;  2OA4 A;  4GYI A;  1SFX A;  3O6B B;  1OKR A;  2PQ8 A;  2MLG A;  4MGR A;  1UCR A;  2O03 A;  4QWQ A;  4L5J A;  1KGS A;  3U9G A;  2OZ6 A;  4G7Z F;  3RPU A;  1U5T B;  1YS6 A;  3F22 A;  2X4H A;  1IF1 A;  3I59 A;  3FMQ A;  3Q5F A;  1J2X A;  2M1B A;  2CG4 A;  1T98 A;  1FBQ A;  4P55 A;  3DEU A;  1RI7 A;  4UXN A;  3KFW X;  4K2E A;  2EB7 A;  3VEP A;  2QVO A;  2XRO A;  2A68 F;  5ERI A;  4ENK A;  1X3U A;  4RGX A;  2HOE A;  4G7H F;  3WG9 A;  1IXC A;  3V7S A;  2M45 A;  2PN6 A;  1R23 A;  2CYY A;  3MQ0 A;  2FBH A;  3WU1 B;  3N4M A;  3PQJ A;  2F5F A;  1R58 A;  4BXU A;  2NYX A;  4ENM A;  1W7P D;  3B02 A;  2YX4 A;  3KP5 A;  4EV0 A;  4BYY A;  4HDU A;  1J9I A;  1B9M A;  2CW0 F;  2VOD A;  5D6F A;  1BC7 C;  5H6Q A;  3E6B A;  3ZPL A;  4EQQ A;  3P9C A;  3J81 Z;  3CDH A;  1YFH A;  2VOO A;  1U8R A;  1IN4 A;  5HLI A;  2XVC A;  3RYP A;  2PMH A;  4RGR A;  4LLG F;  4OIN F;  3ZMV A;  4Q47 A;  2P7C B;  1S6L A;  5HVQ C;  4BQA A;  3J80 Z;  1MGT A;  2KJB A;  2C6Y A;  1F5T A;  1DPR A;  1KU2 A;  3QP5 A;  3JTH A;  3LA2 A;  4OIP F;  4HF0 A;  3EDP A;  2HS5 A;  3RJP A;  1YQA A;  3KZY A;  4BH9 A;  4ESB A;  1XSV A;  1BI2 A;  4ENN A;  4PDK A;  3R60 A;  3HOS A;  3BPX A;  4P96 A;  3GWZ A;  4EJV A;  5TRD A;  5ICG A;  2F2E A;  2PJP A;  1U2W A;  2J5P A;  4N0B A;  5L3G A;  3V8J A;  5ICF A;  2NNY A;  3GUD A;  1OYW A;  2ZCW A;  2VOP A;  5K5R A;  3D0S A;  5JVT A;  1PP7 U;  2P8T A;  5D5U B;  3LA7 A;  2DO7 A;  3HSF A;  2Q8K A;  3TO9 A;  5CVI A;  4BHP A;  4RB2 C;  4H0E A;  1HW2 A;  3CUQ C;  1SD7 A;  2HFH A;  2RVC A;  2HZT A;  1OR7 A;  1ZAO A;  4A5M A;  4ASN A;  5CVJ A;  1KU7 A;  4KIC A;  2P4W A;  3CO6 C;  1P92 A;  1V4R A;  4KIF A;  2ZXJ A;  1FX7 A;  5ILV A;  1XSX A;  3K69 A;  2Z99 A;  3KE2 A;  3ZMS A;  2FU4 A;  1U5T A;  3SHF A;  4LB5 A;  3ZN1 A;  4EM0 B;  2BEO A;  1Z9C A;  3I53 A;  2EA2 A;  1Z6R A;  5CJ9 A;  2VE8 A;  4RS8 A;  1W7P B;  3BZ6 A;  4CYD A;  1G3W A;  1ON2 A;  2EK5 A;  4YFN F;  1XD7 A;  4IF4 A;  2A61 A; 
#chains in the Genus database with same CATH topology
 3IWF A;  3F6O A;  4OIO F;  3BWG A;  4CH7 A;  1GT0 C;  1BN5 A;  5DV5 A;  3J81 K;  3DQV C;  3QYE A;  4F91 B;  4FE7 A;  5DDG A;  3PFI A;  4Z6Y A;  5J4Y A;  1LUJ B;  4OOI A;  1GXQ A;  1H8A C;  1VQL I;  2DDA A;  2QUF A;  3TP3 A;  1CF7 A;  3FXQ A;  2HOT A;  2N8G A;  4M6Y A;  4LIV A;  1P4A A;  4IX7 A;  1BL0 A;  1XDU A;  2R0Q C;  1FIA A;  2GOM A;  3OY9 A;  2WC2 A;  1U78 A;  2OUM A;  3WE3 A;  1FYK A;  3OMY A;  2QCO A;  2QQ8 A;  3J80 K;  5DS9 A;  4BJ6 C;  3DEW A;  5HDK A;  2KIQ A;  2V6C A;  2R5Z A;  3RDI A;  1OYY A;  1IXS B;  2XDV A;  3DF8 A;  3OS2 A;  1KU9 A;  2K86 A;  1YRN A;  3M1E A;  4Q5S F;  4KYW A;  1KYW A;  2DYS H;  2DMN A;  2W57 A;  3K1N A;  3A02 A;  3GEZ A;  3KLO A;  5FKO A;  3W3C A;  1YIJ I;  6PAX A;  2IA0 A;  4O3M A;  3E6D A;  3GFJ A;  1R1T A;  4U7B A;  2WAQ N;  2OZU A;  3SDB A;  2ADU A;  2XF6 A;  1D1A A;  2XF7 A;  4HX4 A;  4EM1 A;  2KZG A;  4PFP A;  4IKF A;  1JKP C;  2DXI A;  1A35 A;  4A0Z A;  2KLO A;  4RLQ A;  2QWW A;  1IN8 A;  4GO1 A;  1B4A A;  3A03 A;  1CGP A;  2COB A;  4EAT A;  1Z1D A;  3KP7 A;  3ZMU A;  2KPM A;  3K1P A;  4NBQ A;  2X6W A;  3AL0 B;  1XGO A;  5EGO B;  1FNN A;  3PO2 J;  2Y0S A;  1PUF A;  2GWR A;  5D8L B;  3LA3 A;  4FCY A;  1FT9 A;  2R5Y B;  4A69 C;  2F4M B;  2BOL A;  2H8R A;  3S2D J;  2L02 A;  3F8F A;  2NVU B;  1IJW C;  2Z2S B;  4PK4 A;  4KIS A;  3GFL A;  5F08 A;  2XRL A;  5IT9 Z;  1MMS A;  4I0A A;  4L5I A;  5B66 C;  3DPU A;  3GTO J;  1SVO A;  1VQ8 I;  5F27 A;  1XB4 A;  4G6T B;  1ZLK A;  4HV6 A;  4XON A;  1R00 A;  2A3S A;  1GXP A;  4M3D A;  2KIS A;  3LSM A;  3LSH A;  3VYU B;  1J59 A;  1OCZ H;  2R93 J;  3C2B A;  2DW4 A;  3GTP J;  1P7I A;  1Y8Q B;  1GVJ A;  2IS4 A;  2HYJ A;  1D8J A;  2LY9 A;  3OYB A;  5J4V A;  2A5W A;  3F8C A;  1ITY A;  3JRD A;  1YW9 A;  2DTR A;  3ZMD A;  4CCK A;  1LFB A;  1TWG J;  2LNB A;  2JA5 J;  3GVA A;  5B1B H;  3CDI A;  4IXA A;  4P5O A;  3OOP A;  2M7B A;  4C2T A;  3BY6 A;  3SEZ A;  1WFX A;  4WXH A;  4CO8 A;  3HTU A;  4RAF A;  4OWR B;  1VQK I;  1YIT I;  3BC8 A;  1YTY A;  2XKO A;  1MBJ A;  1HLV A;  3GCM A;  4BHC A;  3DTK A;  1RIO H;  1OCR H;  4E7Z A;  4QIW N;  1K7A A;  2H1L A;  4M71 A;  2FBI A;  3KZZ A;  2BE5 F;  1MSF C;  3Q9S A;  2ZC2 A;  4YRV A;  3E3V A;  1D8K A;  4BBR J;  1MND A;  2X85 A;  1RKW A;  2BY3 A;  2KIF A;  3BOQ A;  4UNO A;  1VFC A;  3A01 A;  4E6K G;  4Y3O A;  3B6A A;  4XLN F;  2FNA A;  4M9S A;  2ESH A;  5FB2 A;  1QO0 D;  1EV7 A;  2A5Y B;  1STZ A;  2Q0O A;  4GCV A;  2GLO A;  2YR2 A;  3I56 I;  1YG2 A;  2XAF A;  5KVR A;  3CTA A;  3FXU A;  1IRF A;  3EYY A;  1R36 A;  1F4K A;  3T8T A;  3S1M J;  1W4M A;  3VYR B;  1IDY A;  3K0L A;  4UHT A;  3SZT A;  3CCS I;  1OYI A;  3KP2 A;  2VJJ A;  1OCC H;  1IGN A;  1XMX A;  5JR3 A;  2OBP A;  4HOB A;  5E8G A;  2RRE A;  4XLE A;  2XRN A;  1OPC A;  4DNC A;  3IKT A;  2CS3 A;  3S1N J;  1HW1 A;  4R79 A;  4CGZ A;  3KCC A;  4CCJ A;  5K7F A;  2B7E A;  5EDN A;  1Z21 A;  2E2H J;  3GLL A;  3GZ5 A;  3K4J A;  4A0Y A;  1HA8 A;  1R1V A;  2R7U A;  3OWT A;  3O8G A;  2L7Z A;  1L0O C;  4WXC A;  5DM7 F;  2L5Q A;  3E1S A;  2JVH A;  3PNT A;  1D3Y A;  1MDM B;  5FKN A;  2DI3 A;  1T08 B;  2ZJP F;  1J7K A;  1FMW A;  3BJO A;  2KDO A;  4RB1 A;  5BPD A;  2DMQ A;  4D9J A;  3ABU A;  1AKH A;  2DA6 A;  3DKY A;  1YJW I;  2FMY A;  4KIT B;  2DU9 A;  1WH5 A;  2QF7 A;  5E20 A;  3ONQ A;  3S93 A;  2VJ5 A;  3E5X A;  3WTX C;  4MLO A;  4O5V A;  5M5X J;  4BDY A;  4DIQ A;  2STW A;  5J1Y A;  1JJ8 C;  2BHY A;  3ZQH A;  3W6J B;  3GTK J;  1S8N A;  3KYC B;  1XS9 A;  3OL4 A;  4FX0 A;  2R7W A;  2XSJ C;  3CC2 I;  3IAS 2;  3G1L A;  5DCM B;  1GV2 A;  4G9Y A;  1M1E B;  5F64 A;  1W7P A;  1X1A A;  3MCZ A;  2MH9 A;  3AG4 H;  4HQE A;  2L7K A;  4ZTJ A;  2DBB A;  5EG0 B;  2X1E A;  1IZ1 A;  1P4W A;  1B72 A;  2OTL I;  2DK5 A;  2CSO A;  2KP6 A;  5FLV A;  1T6S A;  3V42 A;  2NVT J;  1WI3 A;  4A3D J;  2PMU A;  4C30 A;  3MZH A;  1LFP A;  5AON A;  3MZ8 A;  1GDT A;  1MD0 A;  3J7A Y;  4WXD A;  3WE2 A;  1GV5 A;  3C1D A;  3FKJ A;  3OYL A;  3IRQ A;  3HC7 A;  4XID A;  2ISZ A;  5HS7 A;  5A2Q Z;  3ZN0 A;  5J8F A;  1BR4 A;  1TWA J;  5E18 F;  4KFC A;  1QPI A;  3S3N A;  2COM A;  2MW8 A;  2O9L A;  1YW8 A;  3EYI A;  2GA1 A;  4DYC A;  2P6S A;  1ZLJ A;  2PEX A;  3HEF A;  3LSI A;  3RCO A;  2IW5 A;  3FKI J;  4C2M J;  1VTN C;  1JKO C;  5B5E C;  1R5G A;  2HOA A;  3J7Y J;  4U88 A;  2O61 A;  5IT9 K;  2R7X A;  4XMY A;  1I6H J;  3TW7 A;  1YI2 I;  2KQR A;  2LBF B;  2OCE A;  1G6N A;  3BZK A;  4KJZ A;  3TO6 A;  2B0L A;  2RGV A;  2K9L A;  5DUI A;  1FIP A;  4RGS A;  2CRG A;  1BM9 A;  2LRE A;  4C3H J;  4EMS A;  1O4X A;  3PIO F;  3H9Q A;  1N78 A;  1R7J A;  3NAU A;  2ZNY A;  1MMG A;  4A2U A;  3F9K A;  3FXR A;  4OIR F;  3AFH A;  2W82 A;  3S17 J;  3MWM A;  4J19 A;  1MBF A;  4CDG A;  3D1N I;  1B8I A;  1X3Z B;  2X48 A;  1IV6 A;  5LFA A;  2HVR A;  2IGM A;  3AKZ A;  2ECC A;  5GAG J;  4ANJ A;  4BNC A;  3SZG A;  2UZK A;  2MGQ A;  4U0Y A;  3FK6 A;  2M30 A;  2PG4 A;  1K79 A;  2O5R A;  2R5Y A;  1JKR C;  3DU6 A;  5K5Q A;  3QPL A;  4C9Y A;  1LDJ A;  5JVG F;  3MMY B;  1WHU A;  1S72 I;  4KMU X;  4CSW A;  4HNT A;  1O3R A;  3RKQ A;  3WGG A;  4M9X A;  4OAZ A;  2VON A;  2WWY A;  5BPI A;  2FNP A;  3K1M A;  3H36 A;  4MO7 A;  2VT3 A;  2WBM A;  3PQK A;  3HPH A;  1ETV A;  2LVS A;  2MC3 A;  4LG0 B;  4Y52 J;  3K4N A;  5GP9 A;  2LH9 A;  3ASO H;  2R7O A;  1FC3 A;  2LKX A;  2ZJQ F;  1L3L A;  3LFU A;  4NC6 A;  2K9N A;  5FKK A;  4HF2 A;  2IXS A;  9ANT A;  3VWB A;  1TLH B;  2ELK A;  1XX5 A;  4XKV A;  2XAH A;  4RLF A;  5TIS C;  1X2N A;  2E7X A;  3WU2 C;  3I64 A;  4U7D A;  1JTX A;  2GM4 A;  5JHF A;  5EEH A;  2RAE A;  1P7J A;  5J1U A;  2M8E A;  3DTE A;  1ZTR A;  5BOX A;  2CV2 A;  1DU6 A;  4B44 A;  1TNS A;  3ABL H;  3SYT A;  1NG7 A;  1FMV A;  5HNF A;  3WGI A;  4Y13 A;  2XAS A;  1U6G A;  1G3S A;  5LD2 C;  3FF5 A;  2KJC A;  5K5O A;  2ZME B;  5LLQ A;  2DPD A;  1JHF A;  2RNG A;  1TQI A;  1X4O A;  2XUB A;  4CHU A;  2QQB A;  2ZKZ A;  3HOX J;  4I02 A;  4KIB A;  1VND A;  4IHS A;  1JXS A;  4C2U A;  3TGN A;  5D6E A;  3P9I A;  1XSD A;  2EZI A;  2PI0 A;  4IPA A;  2KRF A;  4U0V A;  5EF6 A;  4AIJ A;  1EH8 A;  3W2A A;  2GA2 A;  2GQQ A;  2ME0 A;  3HG9 A;  1W5S A;  3GX4 X;  3WTW C;  3MVP A;  2QZ8 A;  2VQC A;  3ZQQ A;  4BHB A;  2E1M C;  4XLA A;  4U87 A;  3ZQ7 A;  2YX7 A;  3HXL A;  4Z2Y A;  1K61 A;  3HDD A;  1RUN A;  3ELK A;  5IPA A;  3S2W A;  2QLZ A;  3QOD A;  4L0Y B;  1SD5 A;  3QP6 A;  3CC7 I;  4PSX A;  3CCM I;  2JWT A;  2IBD A;  2O7O A;  3FX3 A;  4ZDP A;  1OR7 C;  1O7L A;  1HKT A;  3DKW A;  1T56 A;  4XKB A;  4AM3 A;  2OQR A;  2QQA A;  3QU6 A;  5BMZ A;  2M0C A;  2OU2 A;  2W84 A;  3QRF F;  3PL8 A;  4XM3 A;  2V26 A;  3HOY J;  4I0B A;  1FP2 A;  3IL2 A;  3H5N A;  1U3E M;  4CXF A;  1MDM A;  1PJR A;  1P2F A;  2E19 A;  4A3I J;  5CQE A;  1V5F A;  3CUO A;  2XSD C;  3B6C A;  5H6R A;  3TL4 X;  5A2Q K;  2ISY A;  4I99 C;  5KHD A;  5LEK A;  3IV5 A;  4XKC A;  2J5O A;  3MZY A;  5IP6 A;  1U5T C;  2CFO A;  3QU3 A;  1KA8 A;  5DTD A;  1ZGW A;  1HDP A;  1ZAR A;  5F1R A;  5D4R A;  1U9N A;  2GIV A;  2Q1Z B;  2EWN A;  3IWZ A;  1IN7 A;  1AA7 A;  3WG7 H;  1SFO J;  1BOA A;  4HQM A;  3F8M A;  2H6C A;  2HXO A;  4HLX A;  3P9K A;  3KLN A;  2QEN A;  2KKO A;  5LGN A;  2HPM A;  1VI0 A;  1TWH J;  4AC0 A;  4R8H A;  2R7T A;  1I3A A;  3DBR B;  3CMY A;  3FK7 A;  2V1D A;  2YSR A;  3CO7 C;  1MSE C;  3TW6 A;  4IHW A;  4HEA 2;  4NB5 A;  2H27 A;  2MFZ A;  2VBZ A;  1RES A;  1YS7 A;  4LIU A;  4ZYG A;  2JSP A;  5CVU A;  1NH3 A;  2E35 A;  2DA3 A;  3QYB A;  4A3K J;  4A5N A;  3GYH X;  3SFZ A;  4AIH A;  3CF2 A;  4RA2 A;  3CD6 I;  2VIX A;  5F0H A;  2E34 A;  4YIF A;  1H0M A;  4TV7 A;  2CWE A;  1SD6 A;  3CCQ I;  1MJ9 A;  1WWX A;  2V4J C;  2CQN A;  2V6E A;  2E60 A;  2VPR A;  2WAQ A;  1KYZ A;  4ZZL A;  2Z9O A;  1T8I A;  5KAF C;  3KIO A;  4QLC U;  2E1O A;  2AHQ A;  3VDX A;  5DM6 F;  5LRR A;  4DYQ A;  2HQA A;  3IH2 A;  3R0A A;  4FIS A;  4KIG A;  1VQ4 I;  4I01 A;  1QGP A;  2HKO A;  1QRY A;  2E36 A;  4D7M A;  3WGH A;  4XKW A;  1D1B A;  2JPB A;  1ZR4 A;  1Z6T A;  4BGD A;  4XSX F;  4BY7 J;  3L2Q A;  3SEQ A;  1BI0 A;  1W36 D;  4B47 A;  3D5L A;  1LQ1 A;  3HSR A;  4FE4 A;  2W48 A;  2HTS A;  1LPQ A;  4XSZ F;  1R71 A;  4EJO A;  4ZYA A;  3BP8 A;  2VT2 A;  4HAM A;  4ZDO A;  3HGG A;  1F43 A;  2W85 A;  1XMA A;  4B8X A;  2AQF A;  3VFZ A;  2PBI A;  4Y4R A;  2IGK A;  2F5C A;  3OIQ A;  1WQ2 A;  1ERD A;  2GIZ A;  3FWE A;  1CQT A;  2NXN B;  3K4M A;  2L7F P;  1Y0N A;  2MD0 A;  2D45 A;  2EJR A;  3V8K A;  3PJR A;  2K27 A;  2FJ1 A;  1TTY A;  1B9N A;  3W6K B;  2TCT A;  1C0W A;  5FKL A;  3OOU A;  3FHN A;  1VQ5 I;  2Q2E A;  3KP6 A;  2L4M A;  4L0Z B;  5H2F C;  3W2W A;  3RSN A;  4KN4 X;  4XLC A;  4X6A J;  1G3Y A;  4JOM A;  3CCL I;  4B4C A;  4EGY A;  2LKP A;  3OIO A;  1H9G A;  1XGS A;  3E5Q A;  3F8N A;  3NRV A;  4IZZ A;  1ZRC A;  1BI3 A;  5ICC A;  1PUE E;  4BDZ A;  1XTA A;  1I39 A;  2EIJ H;  5ILS A;  2FD5 A;  2FQ3 A;  3KZI C;  1OMI A;  3T1B A;  4A3G J;  2EQR A;  1T33 A;  4Y7N J;  2L4A A;  4BXX J;  1QA6 A;  2CQ7 A;  1LDK B;  2GZW A;  2D1V A;  5CKT A;  3IHU A;  4XLH A;  2R7D A;  2H6B A;  3RZO J;  5HLG A;  3BR2 A;  3M3Y J;  4ENJ A;  2NVY J;  4EJT A;  3NEU A;  2VKD A;  2NVQ J;  3RKY A;  3JRE A;  2Z1D A;  2HQR A;  3BR0 A;  3ISP A;  1FOY A;  2QQ9 A;  3W6V A;  4DZJ A;  4V2G A;  2UWM A;  3L2U A;  1QZZ A;  3DU5 A;  2ZXW H;  3K2A A;  2VL8 A;  5E8I A;  1MBG A;  4CA0 A;  1BR2 A;  3GFM A;  1ONV A;  2IS6 A;  4A3C J;  1RR7 A;  4R1H A;  1R5H A;  2K02 A;  3LSG A;  1VQO I;  1RKT A;  1JUP A;  1X2M A;  3BG9 A;  3KEY A;  2CV1 A;  4PJL A;  4XR6 A;  3L9F A;  2L2O A;  2W1O A;  1ZN2 A;  1K78 B;  2WY8 Q;  5C4J J;  1P4X A;  4A0X A;  1E17 A;  4M73 A;  2X51 A;  3H0D A;  1G8X A;  1ZYR F;  5E3O A;  1XN7 A;  1Y6I A;  4C3J J;  5F6F A;  1BI1 A;  4AVZ A;  1JE8 A;  4LLL A;  1Z91 A;  5B1A H;  2EFW A;  4LD5 A;  2IT0 A;  3WHC A;  4G94 A;  2GXA A;  3RIR A;  1UFM A;  3TP0 A;  1JT0 A;  4Y33 A;  4NC7 A;  2NNN A;  2DA7 A;  3HJE A;  3ZQF A;  5LHI A;  3CJT B;  3SQN A;  3FMR A;  3HUG A;  2PLY A;  2QKM B;  3PO3 J;  5KK1 A;  4B3X A;  3CES A;  4MEY F;  3DTI A;  3Q3S A;  2P5V A;  4U0W A;  1NTC A;  2E1C A;  2M8G X;  2V1U A;  3K10 A;  1DDN A;  1MH3 A;  2XAQ A;  3F72 A;  3NAR A;  5F0C A;  3OS0 A;  1IUY A;  2JJ7 A;  2UV1 A;  2YPR A;  1DP7 P;  2Y48 A;  2IP2 A;  1I1S A;  4DBQ A;  3LST A;  3VOE A;  1PVE A;  1WJE A;  2VI6 A;  2UXX A;  3ABM H;  1IRG A;  1S3J A;  4DYR A;  2EV5 A;  2P5K A;  2Z5U A;  3OYF A;  1Z7U A;  3VYT B;  1LB2 A;  1BJA A;  2EFO A;  4NHJ A;  5IY5 H;  4LG3 A;  2IS2 A;  1U0J A;  4LJZ F;  2WA0 A;  2G7U A;  3C18 A;  5CVV A;  2HEO A;  4IL6 C;  2HZD A;  3FBI B;  3LNQ A;  1O3Q A;  4IJA A;  3OYG A;  5JHU A;  1HSJ A;  1WI9 A;  3QWL A;  4NQW B;  2NS0 A;  5J3L A;  1LKX A;  2FML A;  2E5N A;  2FOK A;  5J47 A;  4FHT A;  3S1R J;  3OYM A;  3S3M A;  3QPT A;  4HX8 A;  2O3F A;  4CYC A;  4KMF A;  3WTV C;  2BY0 A;  3EUK L;  2X6X A;  2WB1 N;  4ZJZ A;  2VN2 A;  3RZD J;  2JVG A;  1ZRF A;  4MTD A;  1QZY A;  1LE8 A;  3LL7 A;  2BY1 A;  2PFB A;  1IXR C;  1HQC A;  3JW4 A;  3H1C A;  2KMU A;  2LG4 A;  3IKV A;  2MBF A;  1USS A;  2FQ4 A;  3ZMZ A;  2FBK A;  3DV8 A;  4ZC3 A;  2A07 F;  3K70 D;  5LRS A;  3GW2 A;  1REP C;  5FLX Z;  1LDD A;  1JJ6 C;  3FXL A;  5IOZ A;  1ZGJ A;  1JI8 A;  4M3F A;  4D1Q A;  2R4G A;  2EIM H;  4DGW B;  2OQG A;  2TDX A;  4Q48 A;  4UV9 A;  3VOD A;  3G73 A;  1V5E A;  2B9S A;  3HOV J;  2Y0M A;  1SVM A;  3Q9V A;  2FE3 A;  2CGP A;  2AXL A;  3CLQ A;  3GZ6 A;  1VQ9 I;  3IH4 A;  4RAY A;  2X6Y A;  3S16 J;  3DBL B;  2P7V B;  5F0F A;  5EEA A;  2RKH A;  2DK8 A;  4BU2 A;  3L2C A;  2F5V A;  4IQJ A;  2ELH A;  4M72 A;  1I3Q J;  4ZYH A;  4WCG A;  3COA C;  1K4S A;  3G3Z A;  4IHX A;  1YJN I;  1TT5 B;  1H88 C;  4GFB A;  2JQ7 A;  1W0U A;  1R9T J;  3ECH A;  5BS6 A;  1Y39 A;  4I6Z A;  1ZG3 A;  3UNG C;  1MH4 A;  3HHG A;  3OYI A;  3E6C C;  3T5X A;  5GAD J;  3CMA I;  1D5V A;  4I7H A;  5AIP A;  3LFK A;  1MIJ A;  3LSR A;  1R1U A;  4ZH4 F;  2E2J J;  1Z3Y A;  4KT6 A;  2OC6 A;  2VC1 A;  2O8K A;  1MBH A;  3BCB A;  3IC7 A;  1H9T A;  2R7Z J;  3LAP A;  3FM5 A;  1UB9 A;  3OR1 C;  3AL0 C;  2HDW A;  2KL4 A;  4A93 J;  2VQH A;  4FET A;  1Q1V A;  3TOB A;  4B3A A;  1LVA A;  3HTS B;  5CVR A;  1D0Y A;  1RZ4 A;  5CPR B;  3M4O J;  4LK1 F;  1G59 A;  2ZJ2 A;  2I10 A;  4OMZ A;  1TL8 A;  3LQR A;  5E1Z B;  2L9V A;  3RKX A;  3HOW J;  3O8H A;  2BY2 A;  5DYM A;  4D5C A;  3RPQ A;  2KDZ A;  1KQ0 A;  2O6G E;  2WTE A;  3K9T A;  3VYS B;  4HPQ A;  3FBN B;  1Z77 A;  2IA2 A;  5AIQ A;  3LOC A;  5E3N A;  2BW3 A;  4UVA A;  2L01 A;  1N75 A;  2K9Q A;  5HLT A;  3WTY C;  5JI6 A;  2YS9 A;  2Y75 A;  3I5U A;  3QPS A;  4IO9 F;  1ETQ A;  3ZXS A;  1LEB A;  1IAW A;  1BIB A;  2BV6 A;  1ZH5 A;  2BHZ A;  2DFH A;  3PFY A;  3CCE I;  2LY1 A;  3ABT A;  2H8W A;  1JT6 A;  2EV0 A;  4A3M J;  4NC8 A;  3HOT A;  1NHA A;  1IN6 A;  5J8C A;  2EFQ A;  4AYB N;  3LQQ A;  2XPW A;  3QYF A;  3HB9 A;  2R7R A;  3CDL A;  1IRX A;  3E6M A;  5LGT A;  3FMS A;  1HST A;  4KA4 A;  4MHG A;  5LHH A;  5E79 C;  4XN0 A;  4XBF A;  2JTV A;  1XGM A;  2ME6 A;  3GLX A;  1XCB A;  1S5L C;  1QHH D;  1SEU A;  1BA5 A;  2BVL A;  4HZF A;  2XGX A;  2LKS A;  2MG4 A;  2LRD A;  2L9N A;  1YX5 A;  1S9H A;  1VQM I;  2KRH A;  1Z0X A;  4MQV A;  1XG1 A;  3V4G A;  4Y17 A;  2HVS A;  3L2V A;  5HS9 A;  1K78 A;  2QSH X;  1DGW Y;  4LB6 B;  4NNJ A;  2ZSI B;  2GXB A;  2CV0 A;  2DJI A;  4RGU A;  2HPI A;  2V79 A;  1DQU A;  1T95 A;  1F36 A;  2MLK A;  3I4P A;  3EUH A;  3GXO A;  2QBY B;  2H94 A;  1I1G A;  2JMW A;  4YFX F;  3ZRG A;  2JT1 A;  2CO5 A;  3BQY A;  2EFP A;  1EJ9 A;  3FXJ A;  4CCL A;  5J6X A;  4LLN A;  2HYF A;  4WX9 A;  2HU9 A;  3H3V K;  3HRU A;  3JAM Z;  2LDU A;  1I6X A;  4KN7 X;  3ECO A;  2L9S A;  3BRO A;  3J7A O;  4FAS D;  5C3E J;  1P9Q C;  4IRH A;  4BAC A;  1SFK A;  3C7J A;  4GGG A;  2FX0 A;  5E3L A;  2RDP A;  2XIG A;  3FHZ A;  2JPC A;  4MEX F;  2JA8 J;  1N25 A;  3HM5 A;  1XC5 A;  3QPH A;  3NQO A;  1JKQ C;  2WAD A;  2JRT A;  3TKY A;  1FYL A;  2HR3 A;  5GPA A;  3U1D A;  2XHK A;  2HI3 A;  2STT A;  2LF8 A;  4G6Q A;  2QA4 I;  3BG3 A;  4A6E A;  5BQT A;  1IG7 A;  5L3F A;  5EGO A;  1FLI A;  3PNY A;  1RRJ A;  1B59 A;  1G3T A;  1FY7 A;  2BBY A;  1ORK A;  2EA4 A;  2VXD A;  3U2R A;  5HLH A;  3LMM A;  4NDL A;  3MFK A;  1XGN A;  1VQ6 I;  5IYD J;  1MJB A;  2FUG 2;  4ITV A;  2O0Y A;  2V7F A;  4XLF A;  3G1O A;  1OLT A;  3C2G A;  5TJJ A;  4RDU A;  2K7L A;  1N77 A;  1POG A;  2CUZ A;  2UUZ A;  1UJ8 A;  4QPO A;  5E1X A;  1AHD P;  1UST A;  2XKP A;  5CLS A;  2JZY A;  2E1M B;  2JN6 A;  5LGU A;  1VF9 A;  4XRM A;  5DCF A;  1AU7 A;  1SFU A;  1G2H A;  1R4M B;  3TQN A;  3V8L A;  4N9H A;  1MMD A;  4PGG A;  1WZ2 A;  4JX5 A;  4BJ5 C;  3AG2 H;  4WK8 F;  1XMK A;  2VQL A;  4MNU A;  1P6R A;  2XGE A;  4IEJ A;  4I2O A;  1ZRD A;  2AXT C;  4V19 K;  2JA7 J;  4YFK F;  3M8F A;  1HBX G;  2D5V A;  1YLF A;  2ETH A;  3KP4 A;  4HYE A;  3A2K A;  4KT5 C;  1IUF A;  2RN7 A;  4EM2 A;  4LIT A;  1I27 A;  2MSY A;  2M4G A;  1Z3X A;  3G2B A;  4O6J A;  1SMT A;  1XDS A;  2VJ4 A;  3WTT C;  5CYV A;  2MD5 A;  2LYC A;  4G12 A;  4H4K C;  1MBE A;  5HNH A;  2DA2 A;  1WGX A;  3C2H A;  2E7W A;  4PGH A;  1FOK A;  4HNU A;  3H92 A;  4YII A;  3KX2 A;  2W7N A;  1HKQ A;  4UVC A;  1YO5 C;  5L3C A;  2NOG A;  2D1H A;  2HDD A;  3CCV I;  2IGO A;  3R4K A;  4HSR A;  1ETO A;  3BTI A;  1FYM A;  2DMU A;  2HTJ A;  2ZBK A;  3GF2 A;  2D2W A;  5IP9 J;  4XRF A;  3HRM A;  5HDN A;  1D0X A;  1EF4 A;  1HCR A;  2P5L C;  1FSH A;  2ZFU A;  3AAF A;  1ZKG A;  1RUO A;  2ZXI A;  2F6C A;  4M6V A;  5DEQ A;  5HOO A;  1ON1 A;  3M8J A;  3T0Y A;  3K70 C;  3GZN B;  3IH3 A;  1J5Y A;  2F5E A;  3CCU I;  4EGZ A;  2V9P A;  2DQL A;  5HOD A;  4L9V A;  2KIM A;  2ESN A;  3PSF A;  3CJN A;  2K4J A;  5FFX A;  5FRN A;  2FXA A;  3K4B A;  2OD5 A;  3E5U A;  3HYI A;  2CW7 A;  1Y8R B;  4W97 A;  2EZK A;  3E97 A;  2WV0 A;  3CCR I;  2MC4 A;  4I09 A;  1FP1 D;  1QVT A;  1B6A A;  4EJU A;  1CF7 B;  1HOM A;  2DA1 A;  4AUX A;  1X4P A;  3DFG A;  5EZG A;  3UKG A;  4RM3 A;  4AVP A;  4Y15 A;  4RB3 C;  3V7R A;  3S8P A;  1T38 A;  2XV4 S;  4UV8 A;  2UXN A;  1KU3 A;  4YEL A;  1TWC J;  2ZO4 A;  4LMY A;  2XAJ A;  3DP7 A;  3H5A A;  4I98 B;  4BY1 J;  1FBS A;  1JGG A;  1V54 H;  2R5Z B;  1APL C;  5D4S A;  3DKX A;  5EYR A;  2G0E A;  2FRH A;  1SD4 A;  2G7H A;  3C3W A;  3M8E A;  1EH6 A;  4HDV A;  3WTU C;  3CQZ J;  2E2I J;  3TBI A;  4L9N A;  4M9Z A;  3BZC A;  1WRJ A;  1X1C A;  2EBI A;  3GO5 A;  3TO7 A;  4XRS G;  3CC4 I;  2R92 J;  2ID3 A;  2Y30 A;  4V2F A;  1RNL A;  1FJL A;  4N9I A;  4GXO A;  2MYS A;  4CCM A;  4LFU A;  2M4K A;  2V1X A;  4PUS A;  2XPV A;  2NS8 A;  3A1Y A;  1NG6 A;  3BPV A;  1YIO A;  4D7N A;  4UY8 I;  2LTP A;  3B73 A;  4IVN A;  4L9J A;  5DCM A;  3WTZ A;  3NWT A;  1K6O A;  4OIQ F;  3OIP A;  4QPQ A;  3JAM K;  1FSE A;  5EG0 A;  2R3S A;  2CQX A;  3Q0U A;  1PUF B;  4JK1 X;  3Q0W A;  2WY7 Q;  4UUV A;  1TNT A;  2F48 A;  4JBA A;  3GTJ J;  2KIU A;  2CUE A;  2GAU A;  5FD5 A;  3CUQ B;  3JSP A;  2HYG D;  1QPM A;  5L3D A;  3MEX A;  2CUJ A;  4G6D A;  3BR1 A;  2ZFW A;  3CJQ B;  2K40 A;  2XAU A;  4E70 A;  3ULQ B;  4L18 B;  2VQG A;  4HG2 A;  4DQ2 A;  2O8X A;  4M6X A;  3A0B C;  3BTL A;  1MBK A;  4PZJ A;  4G8X A;  3WU0 A;  3IUO A;  1UHW A;  2YUS A;  4HW0 A;  2IVM A;  2LR8 A;  1ETK A;  2Z33 A;  2QBY A;  3HOU J;  4E4H A;  3GTG J;  4IHV A;  1WJA A;  2JSC A;  3M1C A;  5M5Y J;  4RMN A;  1WSU A;  3RKW A;  1QHG A;  2H09 A;  4BAY A;  1S7A A;  4I76 A;  2LBF A;  4LOC A;  1QVU A;  4HBL A;  4AIK A;  3F23 A;  3GTQ J;  1OQY A;  2A05 A;  2LFB A;  2P0W A;  5H20 A;  4GDF A;  2VB6 A;  4F3Q A;  1K4T A;  2H1K A;  1BC8 C;  4MFE A;  2WB1 A;  5D5X B;  2DDB A;  2VBY A;  3ZP5 A;  1A5J A;  2QKL B;  3BJA A;  4G7O F;  3QOE A;  4RAG A;  4DBR A;  4BE2 A;  4CIC A;  1TC3 C;  3HRS A;  4S05 A;  2Z3Y A;  2DTZ A;  3MN2 A;  5C44 J;  3A01 B;  3BTJ A;  5FO5 A;  4DZP A;  1JGS A;  3S3O A;  1S7E A;  5LEJ A;  4XIC A;  5DD4 A;  2IS1 A;  3ML6 A;  3O2P E;  5DUK A;  2K4B A;  2YU9 J;  1OFC X;  5M5W J;  4IHT A;  4FT8 A;  3RPU D;  2I8D A;  4DJA A;  3L1P A;  3S1Q J;  1ODD A;  2OPT A;  2QGU A;  4PJJ A;  4AU7 A;  4ZZD A;  4S04 A;  3G6E I;  2FEZ A;  1IW7 F;  2M87 A;  2OAZ A;  3JTG A;  3OSG A;  3H5R A;  2W24 A;  1PYV A;  5D5V B;  1J75 A;  2M3A A;  5L3E A;  3SFI A;  3I4N J;  1R5I D;  1VQ7 I;  1ETX A;  4FQG A;  3JSO A;  2VXZ A;  1DU0 A;  3Q0V A;  1TBX A;  3JRH A;  1B1B A;  1BOB A;  2RC4 A;  3OYE A;  1SC7 A;  4LG0 A;  3LAJ A;  1LEA A;  1TWF J;  4ZDL A;  2CQK A;  3HKZ N;  2KT0 A;  4HA8 A;  3VPR A;  2PJR B;  2EIL H;  2LC2 A;  3HHH A;  3G4S I;  4ESJ A;  3I4M J;  2XAG A;  1LNW A;  1O7F A;  3ERE D;  3KET A;  1UMQ A;  2RV8 A;  3H3U A;  3ROU A;  5GTH C;  4LK0 F;  2LF7 A;  1ETW A;  3M9A A;  1F9N A;  1HW5 A;  1QZE A;  1JHH A;  1YHQ I;  1MKM A;  2VKH A;  1IN5 A;  5FRO A;  2ZME A;  1W5T A;  3CCJ I;  3TED A;  1MJA A;  2CFX A;  2MA3 A;  3AG1 H;  4YG2 F;  2NAZ A;  3L7W A;  1Y56 A;  4HV5 A;  4IRI A;  3CJR B;  2OJE D;  2V9V A;  3LWF A;  2YU3 A;  3ZQG A;  2DPU A;  1E0E A;  1BBY A;  2CU7 A;  2FSW A;  2M5W A;  3OR2 C;  4BL0 B;  1XCV A;  3I0T A;  3N05 A;  4M3B A;  3FXK A;  4LGW A;  3K4K A;  2W25 A;  1G4D A;  3CME I;  3EET A;  2HQN A;  3HIF A;  1TQM A;  3QOP A;  1Z05 A;  4BKX A;  1HF0 A;  2IPQ X;  1T2K A;  1FTT A;  5FJ8 J;  1QNT A;  5JFR A;  1ZRE A;  3JRF A;  1UHS A;  1RC9 A;  4ESF A;  3L2R A;  2VBW A;  1SAX A;  1D0Z A;  4ETS A;  1QBJ A;  1DUX C;  4KDP A;  2DAO A;  2W4S A;  2EIK H;  2W00 A;  4UUS B;  4UB6 C;  5FD6 A;  1S29 A;  4B09 A;  1LJ9 A;  4BJT A;  4UB8 C;  1QU3 A;  1H89 C;  3BR5 A;  5FFZ A;  4AYB A;  4XOP A;  1R22 A;  2XF5 A;  2PMZ N;  4OMY A;  2BZT A;  4P9U A;  3KYL A;  4PJM A;  3PNV A;  2BGC A;  4EJW A;  3JRA A;  4IRG A;  3I58 A;  1OCT C;  1FOW A;  1O57 A;  2HGC A;  3OYC A;  3JRI A;  2FA5 A;  3WTS C;  1TP4 A;  4M74 A;  3ESW B;  4N4N B;  3EUA A;  5KAI C;  3MKL A;  3RTR A;  2R7V A;  2R7F A;  4PJ0 C;  3S15 J;  1EH7 A;  2DYR H;  2M7A A;  1JUS A;  4KUM A;  1MZB A;  3HZJ A;  4PCQ A;  5EJC A;  3X2Q H;  4YEJ A;  1BR1 A;  3CCY A;  3CZ6 A;  3OSF A;  1UHM A;  2Y69 H;  1FOX A;  4DW6 A;  5LHG A;  3AG3 H;  2VUM J;  4AD9 A;  1UEL B;  3PSI A;  1J09 A;  1GLN A;  4RB0 A;  3IRR A;  3DPL C;  4F93 B;  1B8I B;  5HS8 A;  5ED4 A;  2IA1 A;  3DLL F;  1KON A;  3K4L A;  2OCC H;  2P6T A;  4XQF A;  2XC7 A;  2QYO A;  3E7L A;  2AS5 F;  2A6H F;  2KZV A;  1Z7L A;  4IQ4 A;  4D0P A;  3F21 A;  1FTZ A;  1W0T A;  3DEE A;  3SJM A;  4X1E A;  3PIP F;  2JA6 J;  1VQN I;  1RR8 C;  3H0G J;  4RAZ A;  4BQQ A;  3CUQ A;  3MAJ A;  1A36 A;  4M3G A;  4A12 A;  2XB0 X;  1SMY F;  5K7H A;  4AID A;  2OF7 A;  3ZQC A;  2L7M P;  3A0H C;  2IAI A;  2I5U A;  2K5C A;  1FBU A;  2GOX B;  3L00 A;  2L0K A;  1T0F A;  2RNJ A;  4Q4Z F;  4PSW A;  1S7O A;  3EUH C;  2HKX A;  2K3P A;  5ILU A;  2DJN A;  2P81 A;  4JP0 A;  4ZYE A;  3W2V A;  1IDZ A;  1QQI A;  2HDC A;  5TGT A;  1ULY A;  3JCU C;  1X1B A;  4PFO A;  1FWZ A;  2E71 A;  1SAN A;  2Z16 A;  4XNF A;  1I50 J;  3PUF A;  1PDN C;  1ZG1 A;  2L54 A;  4BS9 A;  5FLM J;  3SXY A;  2ZNZ A;  2ZXH A;  5J1R A;  3IP4 B;  3TDZ C;  3D5S C;  3I59 B;  1FZP B;  3DPT A;  5M3M J;  1BIA A;  1E3O C;  3HRT A;  2IRF G;  2E1N A;  2LOO A;  4A6D A;  4JQF A;  2EPF A;  3R6S A;  5E1W A;  5F1J A;  1A31 A;  3DBH B;  4MIM A;  3IAM 2;  1E2X A;  3O3K A;  1O3T A;  1FPQ A;  1MW7 A;  1ZG5 A;  1J0R A;  1WKM A;  1V3F A;  2HVQ A;  5GAE J;  1F1Z A;  2K85 A;  5EZH A;  1KQ8 A;  2EZH A;  1YW7 A;  1Y1W J;  2FF4 A;  4II3 A;  2DFE A;  1VQP I;  3ZQI A;  5E17 F;  2ACJ A;  4BQO A;  1IV8 A;  3R61 A;  2DA4 A;  3ASN H;  4A3E J;  1SAU A;  1WJB A;  1OCP A;  3EQL F;  2Y9Z A;  1O3S A;  1ZHF A;  3CMM A;  3GBG A;  2X1D A;  1ZGA A;  2V1N A;  1AWC A;  1NK3 P;  3DXJ F;  2VC0 A;  3TOA A;  4E7J A;  1Z67 A;  2FOW A;  5D8K B;  3LSJ A;  3RI4 A;  4MQ9 F;  1Y0U A;  5E3M A;  1W36 C;  2QM3 A;  4GYG A;  5GPC A;  4OU0 A;  4P1W A;  5LBQ A;  3KPH A;  2HNH A;  3TMO A;  3WOD F;  2KRC A;  2CQQ A;  1WVR A;  4XK4 A;  3FZV A;  3G1M A;  4E7I A;  4P9F A;  2X9D A;  5HDG A;  1KQ9 A;  5KNL A;  2GXG A;  2HXI A;  3NWS A;  4NUB A;  2BYV E;  1A04 A;  4EVI A;  4E7L A;  5DD8 A;  4L5E A;  2PJR A;  1HXD A;  3GTM J;  1HKS A;  3OV8 A;  3I54 A;  1JTY A;  2DT6 A;  3GFI A;  2IJL A;  4JX4 A;  2RQP A;  4FX4 A;  4B48 A;  4PJN A;  4E7S A;  2K9S A;  3ZGK A;  4JYK A;  2DQR A;  4HX7 A;  3VB2 A;  3I71 A;  1GVD A;  5EEG A;  3T8R A;  3ZR8 X;  3OYN A;  2AQE A;  5IOY A;  1DPU A;  4KNY A;  1D1C A;  5FKM A;  4WWC A;  5B3S H;  2BXZ A;  3KEQ A;  1W1W E;  1YOV B;  3K7A J;  2LSO A;  4L9T A;  1NK2 P;  4B43 A;  1ACI A;  3K2Z A;  2X0L A;  1YYV A;  1PP8 F;  3S2H J;  3QAH A;  5M3F J;  1TQP A;  2ICW G;  1AOY A;  3HOZ J;  5L3B A;  5K1Y A;  2WAF A;  4XLP F;  2DOD A;  3P5J A;  4CUG A;  4E7K A;  3V7C A;  2VE9 A;  2DT5 A;  4J01 A;  3ZQL A;  2LP0 A;  1GUU A;  3F6V A;  5F04 A;  4D5F A;  1WJD A;  5FRM A;  2DLL A;  4WF2 A;  1TW2 A;  1Q1H A;  2HOS A;  2NRA C;  2A69 F;  1MNE A;  2A6E F;  2KHM A;  2DA5 A;  2DFI A;  3FDY A;  2F4O B;  2DT7 B;  5FGM A;  2Y0S N;  2X1C A;  3ERM A;  1V55 H;  5K7Z A;  2G9W A;  5KCM A;  4UUS A;  2L3D A;  3OYD A;  4XL9 A;  5C4X J;  4GRI A;  3CLO A;  3EPZ A;  3JRB A;  3FM3 A;  3HSE A;  3M7G A;  4HLY A;  4CZZ A;  3F8B A;  4HF1 A;  1GHC A;  1MMN A;  2EV6 A;  1E3H A;  3KP3 A;  3L09 A;  3RYR A;  3REO A;  5J40 A;  5ICE A;  3SZP A;  2LLK A;  4F7Z A;  5GAH J;  5FLX K;  4ON0 A;  1T39 A;  1I5Z A;  3P7N A;  3FIS A;  1D5Y A;  3KEO A;  4B1R A;  4XRS A;  4YIR X;  1SFE A;  2M0M A;  3PUB A;  4IOA F;  3M07 A;  1IRZ A;  2VAS A;  5GTI C;  2EFN A;  2JUC A;  3H9J A;  2MH2 A;  2VBX A;  4MFD A;  3GTL J;  1IO2 A;  1A6Q A;  5D5W B;  4AWX B;  3PM1 A;  3BDD A;  2PX9 A;  2EH3 A;  4UVB A;  1WPK A;  3F3X A;  4NQW A;  3BCA A;  5IT3 A;  3BLY A;  4M3E A;  2LY2 A;  2Y9Y A;  2DCE A;  2QEX I;  4ZYD A;  3ABK H;  3R0J A;  3ZMT A;  2VPL A;  3LSP A;  4BEH B;  1TZL A;  1TW3 A;  1XPX A;  2HWV A;  2NOJ B;  3BJ6 A;  2Y31 A;  3N97 A;  3OYJ A;  2WV1 A;  3H3Z A;  3TDU C;  3MKZ A;  1LVK A;  3I3L A;  5BNG A;  2JRM A;  4MTE A;  1EKE A;  2Q2E B;  1LFU P;  2R7S A;  2CJJ A;  2F5D A;  2OA4 A;  4GYI A;  1UAA A;  2OV7 A;  2DOF A;  2IGN A;  1SFX A;  3O6B B;  1OKR A;  4F52 A;  2PQ8 A;  2ZB9 A;  3JRC A;  2MLG A;  4MGR A;  1UCR A;  2O03 A;  3GME A;  2VJI A;  4QWQ A;  4L5J A;  3BR3 A;  1KGS A;  4S0H B;  4BXF A;  1W5C C;  3RQ4 A;  2JA2 A;  3U9G A;  2OZ6 A;  3U21 A;  4G7Z F;  1UZC A;  1V5G A;  1E3P A;  3RPU A;  1U5T B;  1YS6 A;  5JLX A;  4EEF G;  3QQA A;  3F22 A;  1BW5 A;  2X4H A;  1K83 J;  2A6T A;  1IF1 A;  1UG0 A;  4CCO A;  2QSG X;  2JUG A;  3I59 A;  3FMQ A;  3CP8 A;  4HNV A;  3Q5F A;  1J2X A;  2M1B A;  3F0C A;  2DOA A;  2B63 J;  2CG4 A;  2QSF X;  1T98 A;  1FBQ A;  3U1K A;  4P55 A;  3DEU A;  5IYB J;  2HQ5 A;  3FXM A;  2OTJ I;  1RI7 A;  3HPG A;  2DOE A;  3OS1 A;  1WJC A;  4UXN A;  1WJ5 A;  3KFW X;  4K2E A;  4II2 A;  3CP2 A;  2EB7 A;  3VEP A;  2QVO A;  2XRO A;  3HKZ A;  2A68 F;  5ERI A;  4ENK A;  1X3U A;  4RGX A;  1HC8 A;  2HOE A;  2CUF A;  4G7H F;  4ZTF A;  2LD5 A;  3WG9 A;  1IXC A;  1OCO H;  3RQI A;  2NVX J;  3V7S A;  3DCF A;  3E0J B;  2M45 A;  2PN6 A;  1R23 A;  2CYY A;  3MQ0 A;  1YJ9 I;  2FBH A;  2R7Q A;  2F4I A;  3BG6 A;  3WU1 B;  5IYC J;  3G71 I;  2EZL A;  3BG5 A;  3N4M A;  3PQJ A;  1RET A;  2LK2 A;  2F5F A;  1R58 A;  4BXU A;  2NYX A;  3HGY A;  4ENM A;  1ZQ3 P;  1W7P D;  1ZEL A;  3B02 A;  1YRN B;  1WCM J;  2YX4 A;  3HUG B;  3KP5 A;  4A3J J;  1U9O A;  3H35 A;  4EV0 A;  2K3F A;  4BYY A;  3JRG A;  4HRI A;  4HDU A;  1J9I A;  1B9M A;  2KFD A;  2CW0 F;  3OYH A;  2VOD A;  3FIW A;  4XOR A;  5D6F A;  3MD2 A;  1BC7 C;  2V9K A;  5H6Q A;  4XOT A;  3BR6 A;  1R49 A;  3E6B A;  1VZ0 A;  3UR3 C;  3ZPL A;  2K9M A;  4ABZ A;  2XPU A;  2IEK A;  3P9C A;  4EQQ A;  3J81 Z;  2VKE A;  3CDH A;  1YFH A;  3JR9 A;  1U8R A;  1BJZ A;  1IN4 A;  5HLI A;  2VOO A;  3CF5 F;  2XVC A;  3RYP A;  3ZCO A;  1ENH A;  1R4N B;  2PMH A;  4RGR A;  4LLG F;  4OIN F;  3ZMV A;  2ZME C;  4Q47 A;  2WAE A;  3L2W A;  4FTH A;  2AO9 A;  4J00 A;  2P7C B;  4UUT A;  1S6L A;  2Y2Z A;  5HVQ C;  4BQA A;  3J80 Z;  2XGC A;  2PMZ A;  1UG2 A;  4E7H A;  5CQG A;  1MGT A;  2KJB A;  2C6Y A;  3DWL E;  1F5T A;  4CZC A;  2MAB A;  3OL3 A;  1DPR A;  1JUM A;  1EA3 A;  4C3I J;  1KU2 A;  3QP5 A;  4RM2 A;  3BTC A;  3JTH A;  4F92 B;  2LMD A;  3VSL A;  4CYC B;  1DP3 A;  4QSH A;  3LA2 A;  4OIP F;  4HF0 A;  3VSK A;  1LE8 B;  3EDP A;  2HS5 A;  1KZH A;  4OAY A;  3RJP A;  1YQA A;  4BE1 A;  2XGD A;  3KZY A;  4BH9 A;  1X1P A;  4ESB A;  1XSV A;  4QTR A;  2ZJR F;  2DMT A;  3MKW B;  2VLA A;  3BG7 A;  1BI2 A;  2ELJ A;  4ENN A;  4PDK A;  3R60 A;  2NS7 A;  2RQQ A;  3HOS A;  3BPX A;  4RBO A;  1X58 A;  1OJL A;  4P96 A;  3DLA A;  3GWZ A;  4EJV A;  5TRD A;  5ICG A;  2F2E A;  2PJP A;  2X6O A;  1U2W A;  2J5P A;  1MMA A;  4N0B A;  4BBS J;  5L3G A;  2DFF A;  1IC8 A;  1ZR2 A;  3V8J A;  5ICF A;  3J7Z I;  1RPW A;  2NNY A;  3GUD A;  1HDD C;  3D5R C;  1OYW A;  2ZCW A;  2VOP A;  1R6R A;  1X3W B;  1TT0 A;  2ID6 A;  3OYK A;  5K5R A;  5JLW A;  3D0S A;  4XN3 A;  3HL2 A;  4BQN A;  3I55 I;  3ZOB A;  4HST A;  5JVT A;  1PP7 U;  1YX3 A;  2P8T A;  2TRT A;  5D5U B;  3LA7 A;  2DO7 A;  3HSF A;  2Q8K A;  1WH7 A;  2M34 A;  2CW8 A;  1X1D A;  3TO9 A;  5CVI A;  4IHY A;  4BEH A;  4BHP A;  2BVM A;  4RB2 C;  4W1U A;  4H0E A;  2XB5 A;  1HW2 A;  3CUQ C;  3BT9 A;  3OYA A;  1SD7 A;  3LSK A;  2HFH A;  1X19 A;  2RVC A;  2HZT A;  4BE0 A;  1MNM C;  1OR7 A;  1ZAO A;  3WHB A;  4A5M A;  4ASN A;  3I9V 2;  3SDG A;  5IP7 J;  4X0G A;  4A3F J;  5CVJ A;  1T0F C;  1KU7 A;  4A3B J;  4KIC A;  2DMP A;  1SVL A;  2L9R A;  2P4W A;  1P92 A;  3H9G A;  3CO6 C;  1V4R A;  4F55 A;  2BW3 B;  2ZSH B;  4KIF A;  2ZXJ A;  1FX7 A;  5ILV A;  3A4C A;  1XSX A;  2VKV A;  1ETY A;  1AKH B;  3K69 A;  2Z99 A;  4JX6 A;  1BW6 A;  4CCN A;  3KE2 A;  3FXO A;  1ZK8 A;  2M2E A;  3ZMS A;  2GBY A;  1DGR M;  2FU4 A;  3S14 J;  1U5T A;  3SHF A;  1WJF A;  4N4O B;  2ECB A;  2BXY A;  1U8B A;  2E5Z A;  4BUP A;  4LB5 A;  3KYD B;  3ZN1 A;  3K6G A;  1K6Y A;  1YE9 A;  2CMP A;  4DOZ A;  4EM0 B;  4IOC F;  2BEO A;  1FEX A;  3HBL A;  1Z9C A;  3I53 A;  2EA2 A;  1Z6R A;  2DN0 A;  2EIN H;  3S32 A;  5CJ9 A;  2VE8 A;  1Y1V J;  3BQZ A;  4RS8 A;  4A3L J;  1W7P B;  3MKY B;  3BZ6 A;  4CYD A;  1G3W A;  1OIS A;  1ON2 A;  2M9H A;  2EK5 A;  1B72 B;  2CH0 A;  4YFN F;  2JK3 A;  1XD7 A;  4IF4 A;  2A61 A;  3K4C A;  1A6I A; 
#chains in the Genus database with same CATH homology
 3IWF A;  3F6O A;  4OIO F;  3BWG A;  1BN5 A;  5DV5 A;  3J81 K;  3DQV C;  5DDG A;  3PFI A;  4OOI A;  1GXQ A;  2QUF A;  1CF7 A;  3FXQ A;  4M6Y A;  1P4A A;  1XDU A;  2WC2 A;  1U78 A;  3WE3 A;  1FYK A;  3J80 K;  5HDK A;  2V6C A;  3RDI A;  1OYY A;  1IXS B;  3DF8 A;  1KU9 A;  2K86 A;  3M1E A;  4Q5S F;  4KYW A;  1KYW A;  2W57 A;  3K1N A;  3GEZ A;  3KLO A;  6PAX A;  2IA0 A;  4O3M A;  3E6D A;  3GFJ A;  1R1T A;  4U7B A;  2OZU A;  2ADU A;  4HX4 A;  4EM1 A;  4A0Z A;  2QWW A;  1IN8 A;  4GO1 A;  1B4A A;  1CGP A;  1Z1D A;  3KP7 A;  3ZMU A;  3K1P A;  1XGO A;  1FNN A;  2GWR A;  5D8L B;  3LA3 A;  1FT9 A;  2L02 A;  3F8F A;  3GFL A;  5IT9 Z;  4I0A A;  4L5I A;  1XB4 A;  1ZLK A;  4HV6 A;  1R00 A;  2A3S A;  1GXP A;  1J59 A;  2DW4 A;  1GVJ A;  1D8J A;  3F8C A;  1YW9 A;  2DTR A;  3ZMD A;  2LNB A;  3GVA A;  4IXA A;  4P5O A;  3OOP A;  3BY6 A;  4WXH A;  4CO8 A;  3HTU A;  1YTY A;  2XKO A;  4BHC A;  1RIO H;  1K7A A;  4M71 A;  2FBI A;  3KZZ A;  2BE5 F;  3Q9S A;  3E3V A;  1D8K A;  2KIF A;  3BOQ A;  4UNO A;  4XLN F;  2FNA A;  4M9S A;  2ESH A;  5FB2 A;  1QO0 D;  1EV7 A;  2A5Y B;  1STZ A;  2Q0O A;  4GCV A;  2YR2 A;  1YG2 A;  2XAF A;  5KVR A;  3CTA A;  3FXU A;  1IRF A;  3EYY A;  1R36 A;  1F4K A;  3T8T A;  1W4M A;  3K0L A;  4UHT A;  3SZT A;  1OYI A;  3KP2 A;  5JR3 A;  2OBP A;  4HOB A;  5E8G A;  2XRN A;  1OPC A;  4DNC A;  3IKT A;  1HW1 A;  4R79 A;  4CGZ A;  3KCC A;  3GZ5 A;  4A0Y A;  1R1V A;  1L0O C;  4WXC A;  1D3Y A;  1MDM B;  2DI3 A;  1J7K A;  3BJO A;  4RB1 A;  5BPD A;  3ABU A;  2FMY A;  2DU9 A;  5E20 A;  3WTX C;  3E5X A;  4O5V A;  2STW A;  3W6J B;  1S8N A;  4FX0 A;  5DCM B;  4G9Y A;  5F64 A;  1W7P A;  3MCZ A;  2MH9 A;  4HQE A;  2DBB A;  1IZ1 A;  1P4W A;  2DK5 A;  2CSO A;  1T6S A;  2PMU A;  3MZH A;  5AON A;  1MD0 A;  4WXD A;  3WE2 A;  3C1D A;  3IRQ A;  2ISZ A;  5HS7 A;  5A2Q Z;  3ZN0 A;  5J8F A;  5E18 F;  4KFC A;  2COM A;  3EYI A;  1YW8 A;  2GA1 A;  2P6S A;  1ZLJ A;  2PEX A;  2IW5 A;  1VTN C;  1R5G A;  4U88 A;  2O61 A;  5IT9 K;  1G6N A;  3TO6 A;  2B0L A;  2RGV A;  5DUI A;  4RGS A;  1BM9 A;  4EMS A;  1R7J A;  2ZNY A;  4A2U A;  3FXR A;  4OIR F;  3MWM A;  4CDG A;  4BNC A;  2UZK A;  4U0Y A;  2M30 A;  2PG4 A;  1K79 A;  5K5Q A;  1LDJ A;  4KMU X;  1O3R A;  3WGG A;  4M9X A;  2VON A;  2WWY A;  5BPI A;  2FNP A;  3K1M A;  2VT3 A;  3PQK A;  2MC3 A;  4LG0 B;  1FC3 A;  1L3L A;  4HF2 A;  1TLH B;  2XAH A;  4U7D A;  2E7X A;  3I64 A;  5EEH A;  2M8E A;  5BOX A;  1TNS A;  3WGI A;  4Y13 A;  2XAS A;  1U6G A;  1G3S A;  3FF5 A;  2KJC A;  5K5O A;  2ZME B;  5LLQ A;  2DPD A;  1JHF A;  1TQI A;  2XUB A;  4CHU A;  2QQB A;  2ZKZ A;  4I02 A;  4KIB A;  4IHS A;  1JXS A;  3TGN A;  5D6E A;  3P9I A;  1XSD A;  2PI0 A;  4IPA A;  4AIJ A;  2KRF A;  4U0V A;  1EH8 A;  2GA2 A;  2GQQ A;  1W5S A;  3GX4 X;  3WTW C;  2QZ8 A;  4BHB A;  3ZQ7 A;  2YX7 A;  4Z2Y A;  1RUN A;  3ELK A;  3S2W A;  2QLZ A;  4L0Y B;  1SD5 A;  3QP6 A;  3FX3 A;  1O7L A;  1HKT A;  3DKW A;  2OQR A;  2QQA A;  3QU6 A;  5BMZ A;  2OU2 A;  2W84 A;  3QRF F;  4I0B A;  1FP2 A;  3IL2 A;  1U3E M;  4CXF A;  1MDM A;  1P2F A;  3CUO A;  5H6R A;  5A2Q K;  2ISY A;  5LEK A;  2J5O A;  3MZY A;  1U5T C;  3QU3 A;  1KA8 A;  1ZAR A;  5F1R A;  5D4R A;  2GIV A;  3IWZ A;  2EWN A;  1IN7 A;  1BOA A;  4HQM A;  3F8M A;  2H6C A;  4HLX A;  3P9K A;  3KLN A;  2QEN A;  2KKO A;  5LGN A;  4R8H A;  2V1D A;  2YSR A;  3CO7 C;  4NB5 A;  2H27 A;  1YS7 A;  2VBZ A;  4ZYG A;  5CVU A;  4A5N A;  3GYH X;  3SFZ A;  4AIH A;  1H0M A;  4YIF A;  4TV7 A;  2CWE A;  1SD6 A;  1MJ9 A;  1WWX A;  1KYZ A;  4ZZL A;  2Z9O A;  4QLC U;  5LRR A;  3R0A A;  4KIG A;  4I01 A;  1QGP A;  2HKO A;  3WGH A;  2JPB A;  1Z6T A;  4XSX F;  1BI0 A;  3D5L A;  1LQ1 A;  3HSR A;  2HTS A;  4XSZ F;  4EJO A;  3BP8 A;  2VT2 A;  4HAM A;  2W85 A;  1XMA A;  4B8X A;  3VFZ A;  2PBI A;  2F5C A;  1WQ2 A;  3FWE A;  2D45 A;  2EJR A;  3V8K A;  2K27 A;  1TTY A;  1B9N A;  3W6K B;  1C0W A;  2Q2E A;  3KP6 A;  2L4M A;  4L0Z B;  4KN4 X;  1G3Y A;  4EGY A;  2LKP A;  1H9G A;  1XGS A;  3E5Q A;  3F8N A;  3NRV A;  1ZRC A;  1BI3 A;  5ICC A;  1PUE E;  5ILS A;  2FQ3 A;  1OMI A;  3T1B A;  2L4A A;  1LDK B;  2GZW A;  2D1V A;  3IHU A;  2R7D A;  2H6B A;  5HLG A;  4ENJ A;  4EJT A;  3NEU A;  3RKY A;  2HQR A;  3ISP A;  2QQ9 A;  2UWM A;  1QZZ A;  5E8I A;  3GFM A;  1ONV A;  4R1H A;  1R5H A;  2K02 A;  3L9F A;  1ZN2 A;  1K78 B;  1P4X A;  4A0X A;  1E17 A;  4M73 A;  1ZYR F;  1XN7 A;  5F6F A;  1BI1 A;  1JE8 A;  4LLL A;  1Z91 A;  2EFW A;  2IT0 A;  4LD5 A;  4G94 A;  3RIR A;  1UFM A;  2NNN A;  5LHI A;  3SQN A;  3FMR A;  3HUG A;  2PLY A;  5KK1 A;  4MEY F;  2P5V A;  4U0W A;  2E1C A;  2V1U A;  1DDN A;  2XAQ A;  3F72 A;  1IUY A;  2YPR A;  1DP7 P;  2Y48 A;  2IP2 A;  1I1S A;  3LST A;  3VOE A;  1IRG A;  2UXX A;  1S3J A;  2EV5 A;  2P5K A;  2Z5U A;  1Z7U A;  1LB2 A;  1BJA A;  2EFO A;  4NHJ A;  4LJZ F;  2G7U A;  3C18 A;  5CVV A;  2HEO A;  1O3Q A;  4IJA A;  5JHU A;  1HSJ A;  1WI9 A;  2NS0 A;  2FML A;  2FOK A;  4FHT A;  3QPT A;  4HX8 A;  2O3F A;  4KMF A;  3WTV C;  2VN2 A;  1ZRF A;  4MTD A;  1QZY A;  2PFB A;  1IXR C;  1HQC A;  3JW4 A;  3IKV A;  2MBF A;  1USS A;  3ZMZ A;  2FBK A;  3DV8 A;  2A07 F;  5LRS A;  3GW2 A;  1REP C;  5FLX Z;  1LDD A;  1ZGJ A;  2OQG A;  2TDX A;  4Q48 A;  4UV9 A;  3VOD A;  3G73 A;  2Y0M A;  3Q9V A;  2FE3 A;  2CGP A;  2AXL A;  3GZ6 A;  4RAY A;  2P7V B;  2RKH A;  2DK8 A;  3L2C A;  2ELH A;  4M72 A;  4ZYH A;  4WCG A;  3COA C;  3G3Z A;  3ECH A;  5BS6 A;  1ZG3 A;  3HHG A;  3E6C C;  3T5X A;  1D5V A;  4I7H A;  5AIP A;  3LFK A;  1R1U A;  4ZH4 F;  2VC1 A;  1H9T A;  3IC7 A;  3LAP A;  3FM5 A;  1UB9 A;  3TOB A;  1LVA A;  3HTS B;  5CVR A;  1RZ4 A;  4LK1 F;  2ZJ2 A;  4OMZ A;  3LQR A;  5E1Z B;  3RKX A;  5DYM A;  3RPQ A;  1KQ0 A;  2O6G E;  2WTE A;  3K9T A;  2IA2 A;  5AIQ A;  4UVA A;  2L01 A;  3WTY C;  5JI6 A;  2Y75 A;  3I5U A;  1LEB A;  1IAW A;  1BIB A;  2BV6 A;  1ZH5 A;  3ABT A;  2EV0 A;  3HOT A;  1NHA A;  1IN6 A;  5J8C A;  2EFQ A;  3LQQ A;  3E6M A;  5LGT A;  3FMS A;  1HST A;  4KA4 A;  4MHG A;  5LHH A;  4XBF A;  2JTV A;  1XGM A;  3GLX A;  1XCB A;  4HZF A;  2XGX A;  4MQV A;  3V4G A;  4Y17 A;  5HS9 A;  1K78 A;  4LB6 B;  2GXB A;  4RGU A;  2V79 A;  2MLK A;  3I4P A;  3EUH A;  3GXO A;  2QBY B;  2H94 A;  1I1G A;  4YFX F;  2JT1 A;  2CO5 A;  2EFP A;  5J6X A;  4LLN A;  2HYF A;  4WX9 A;  3HRU A;  3JAM Z;  2LDU A;  1I6X A;  4KN7 X;  3ECO A;  3BRO A;  3J7A O;  4IRH A;  4GGG A;  3C7J A;  2RDP A;  2XIG A;  3FHZ A;  2JPC A;  4MEX F;  3QPH A;  3NQO A;  2JRT A;  3TKY A;  1FYL A;  2HR3 A;  3U1D A;  2XHK A;  2STT A;  2LF8 A;  4G6Q A;  4A6E A;  5BQT A;  5L3F A;  1FLI A;  1B59 A;  1G3T A;  2EA4 A;  1FY7 A;  2BBY A;  3U2R A;  3MFK A;  5HLH A;  1XGN A;  1MJB A;  2O0Y A;  5TJJ A;  2K7L A;  5E1X A;  1UST A;  2XKP A;  5CLS A;  2JZY A;  5LGU A;  5DCF A;  1SFU A;  3TQN A;  3V8L A;  4N9H A;  4PGG A;  4WK8 F;  1XMK A;  4MNU A;  1P6R A;  4I2O A;  1ZRD A;  4YFK F;  3M8F A;  1HBX G;  1YLF A;  2ETH A;  3KP4 A;  4HYE A;  4KT5 C;  2RN7 A;  4EM2 A;  1I27 A;  4O6J A;  1SMT A;  1XDS A;  3WTT C;  5CYV A;  2MD5 A;  1FOK A;  2E7W A;  4PGH A;  3H92 A;  4YII A;  1HKQ A;  4UVC A;  1YO5 C;  5L3C A;  2D1H A;  3R4K A;  1FYM A;  2HTJ A;  2ZBK A;  3GF2 A;  2D2W A;  4XRF A;  3HRM A;  5HDN A;  2P5L C;  1FSH A;  3AAF A;  1RUO A;  5DEQ A;  5HOO A;  1ON1 A;  3T0Y A;  1J5Y A;  2F5E A;  4EGZ A;  2DQL A;  4L9V A;  2KIM A;  2ESN A;  3CJN A;  2K4J A;  5FFX A;  2FXA A;  2OD5 A;  3E5U A;  3HYI A;  3E97 A;  2WV0 A;  4I09 A;  1FP1 D;  1B6A A;  4EJU A;  1CF7 B;  3DFG A;  4AVP A;  4Y15 A;  4RB3 C;  3V7R A;  1T38 A;  2XV4 S;  4UV8 A;  2UXN A;  1KU3 A;  2ZO4 A;  4LMY A;  2XAJ A;  3DP7 A;  4I98 B;  1FBS A;  5D4S A;  2FRH A;  4HDV A;  1SD4 A;  2G7H A;  3C3W A;  3M8E A;  1EH6 A;  3WTU C;  4L9N A;  4M9Z A;  1WRJ A;  3GO5 A;  3TO7 A;  1RNL A;  4N9I A;  4GXO A;  4LFU A;  2V1X A;  3BPV A;  1YIO A;  3B73 A;  4IVN A;  4L9J A;  5DCM A;  3WTZ A;  1K6O A;  4OIQ F;  3JAM K;  1FSE A;  2R3S A;  4JK1 X;  4UUV A;  1TNT A;  4JBA A;  2KIU A;  2GAU A;  5FD5 A;  3CUQ B;  3JSP A;  2HYG D;  1QPM A;  5L3D A;  3MEX A;  4G6D A;  2ZFW A;  4E70 A;  3ULQ B;  4L18 B;  4DQ2 A;  2O8X A;  4M6X A;  4PZJ A;  4G8X A;  3WU0 A;  1UHW A;  4HW0 A;  2IVM A;  2Z33 A;  2QBY A;  2JSC A;  1WSU A;  3RKW A;  2H09 A;  4BAY A;  1S7A A;  4HBL A;  4AIK A;  3F23 A;  5H20 A;  1BC8 C;  5D5X B;  2VBY A;  3ZP5 A;  3BJA A;  4G7O F;  4CIC A;  3HRS A;  4S05 A;  2Z3Y A;  5FO5 A;  1JGS A;  5LEJ A;  5DD4 A;  3ML6 A;  3O2P E;  5DUK A;  2K4B A;  4IHT A;  4FT8 A;  1ODD A;  4ZZD A;  4S04 A;  2FEZ A;  1IW7 F;  2M87 A;  2OAZ A;  3JTG A;  2W24 A;  5D5V B;  1J75 A;  5L3E A;  3JSO A;  2VXZ A;  1TBX A;  1B1B A;  2RC4 A;  4LG0 A;  3LAJ A;  1LEA A;  2CQK A;  4HA8 A;  3HHH A;  4ESJ A;  2XAG A;  1LNW A;  1O7F A;  3ERE D;  3KET A;  2RV8 A;  3H3U A;  3ROU A;  4LK0 F;  2LF7 A;  3M9A A;  1F9N A;  1HW5 A;  1JHH A;  1MKM A;  1IN5 A;  2ZME A;  1W5T A;  1MJA A;  2CFX A;  2MA3 A;  4YG2 F;  2NAZ A;  3L7W A;  4HV5 A;  4IRI A;  2V9V A;  3LWF A;  2YU3 A;  2DPU A;  1BBY A;  2FSW A;  2M5W A;  1XCV A;  3I0T A;  4LGW A;  2W25 A;  1G4D A;  3EET A;  2HQN A;  3HIF A;  1TQM A;  3QOP A;  1Z05 A;  2IPQ X;  1T2K A;  1QNT A;  5JFR A;  1ZRE A;  4ESF A;  2VBW A;  1SAX A;  4ETS A;  1QBJ A;  1DUX C;  4KDP A;  2DAO A;  5FD6 A;  1S29 A;  4B09 A;  1LJ9 A;  5FFZ A;  1R22 A;  4OMY A;  4P9U A;  2BGC A;  4EJW A;  4IRG A;  3I58 A;  1O57 A;  2HGC A;  2FA5 A;  3WTS C;  4M74 A;  3RTR A;  2R7F A;  1EH7 A;  4KUM A;  1MZB A;  4PCQ A;  1UHM A;  5LHG A;  4AD9 A;  4RB0 A;  3IRR A;  3DPL C;  5HS8 A;  5ED4 A;  2IA1 A;  2P6T A;  2QYO A;  2AS5 F;  2A6H F;  4D0P A;  3F21 A;  4RAZ A;  3CUQ A;  3MAJ A;  4A12 A;  1SMY F;  1FBU A;  3L00 A;  1T0F A;  2RNJ A;  4Q4Z F;  1S7O A;  2HKX A;  5ILU A;  4ZYE A;  1QQI A;  2HDC A;  1ULY A;  1FWZ A;  1PDN C;  1ZG1 A;  2L54 A;  3SXY A;  2ZNZ A;  3TDZ C;  3I59 B;  1FZP B;  3DPT A;  1BIA A;  3HRT A;  2IRF G;  2E1N A;  4A6D A;  4JQF A;  3R6S A;  5E1W A;  1E2X A;  3O3K A;  1O3T A;  1FPQ A;  1ZG5 A;  1J0R A;  1WKM A;  1V3F A;  1F1Z A;  1KQ8 A;  1YW7 A;  2FF4 A;  5E17 F;  2ACJ A;  3R61 A;  3EQL F;  1O3S A;  1ZHF A;  1ZGA A;  1AWC A;  3DXJ F;  2VC0 A;  3TOA A;  5D8K B;  3RI4 A;  4MQ9 F;  1Y0U A;  2QM3 A;  4GYG A;  4OU0 A;  5LBQ A;  3WOD F;  3FZV A;  4P9F A;  5HDG A;  1KQ9 A;  2GXG A;  2BYV E;  1A04 A;  4EVI A;  5DD8 A;  1HXD A;  1HKS A;  3OV8 A;  3I54 A;  3GFI A;  2IJL A;  2RQP A;  4FX4 A;  2DQR A;  4HX7 A;  3VB2 A;  3I71 A;  5EEG A;  3T8R A;  1DPU A;  4KNY A;  4WWC A;  3KEQ A;  2LSO A;  4L9T A;  3K2Z A;  2X0L A;  1YYV A;  1PP8 F;  3QAH A;  1TQP A;  1AOY A;  5L3B A;  5K1Y A;  4XLP F;  3V7C A;  2VE9 A;  2DT5 A;  3F6V A;  2DLL A;  4WF2 A;  1TW2 A;  1Q1H A;  2NRA C;  2A69 F;  2A6E F;  2DFI A;  5FGM A;  2G9W A;  2L3D A;  3CLO A;  3FM3 A;  3HSE A;  3M7G A;  4HLY A;  4CZZ A;  3F8B A;  4HF1 A;  1GHC A;  2EV6 A;  3KP3 A;  3L09 A;  3RYR A;  3REO A;  5ICE A;  3SZP A;  4F7Z A;  5FLX K;  4ON0 A;  1T39 A;  1I5Z A;  3P7N A;  3KEO A;  1SFE A;  2EFN A;  2MH2 A;  2VBX A;  5D5W B;  4AWX B;  3BDD A;  4UVB A;  4NQW A;  3F3X A;  5IT3 A;  4ZYD A;  3R0J A;  3ZMT A;  1TW3 A;  2HWV A;  3BJ6 A;  3N97 A;  3H3Z A;  3TDU C;  4MTE A;  2F5D A;  2OA4 A;  4GYI A;  1SFX A;  3O6B B;  1OKR A;  2PQ8 A;  2MLG A;  4MGR A;  1UCR A;  2O03 A;  4QWQ A;  4L5J A;  1KGS A;  3U9G A;  2OZ6 A;  4G7Z F;  3RPU A;  1U5T B;  1YS6 A;  3F22 A;  2X4H A;  1IF1 A;  3I59 A;  3FMQ A;  3Q5F A;  1J2X A;  2M1B A;  2CG4 A;  1T98 A;  1FBQ A;  4P55 A;  3DEU A;  1RI7 A;  4UXN A;  3KFW X;  4K2E A;  2EB7 A;  3VEP A;  2QVO A;  2XRO A;  2A68 F;  5ERI A;  4ENK A;  1X3U A;  4RGX A;  2HOE A;  4G7H F;  3WG9 A;  1IXC A;  3V7S A;  2M45 A;  2PN6 A;  1R23 A;  2CYY A;  3MQ0 A;  2FBH A;  3WU1 B;  3N4M A;  3PQJ A;  2F5F A;  1R58 A;  4BXU A;  2NYX A;  4ENM A;  1W7P D;  3B02 A;  2YX4 A;  3KP5 A;  4EV0 A;  4BYY A;  4HDU A;  1J9I A;  1B9M A;  2CW0 F;  2VOD A;  5D6F A;  1BC7 C;  5H6Q A;  3E6B A;  3ZPL A;  4EQQ A;  3P9C A;  3J81 Z;  3CDH A;  1YFH A;  2VOO A;  1U8R A;  1IN4 A;  5HLI A;  2XVC A;  3RYP A;  2PMH A;  4RGR A;  4LLG F;  4OIN F;  3ZMV A;  4Q47 A;  2P7C B;  1S6L A;  5HVQ C;  4BQA A;  3J80 Z;  1MGT A;  2KJB A;  2C6Y A;  1F5T A;  1DPR A;  1KU2 A;  3QP5 A;  3JTH A;  3LA2 A;  4OIP F;  4HF0 A;  3EDP A;  2HS5 A;  3RJP A;  1YQA A;  3KZY A;  4BH9 A;  4ESB A;  1XSV A;  1BI2 A;  4ENN A;  4PDK A;  3R60 A;  3HOS A;  3BPX A;  4P96 A;  3GWZ A;  4EJV A;  5TRD A;  5ICG A;  2F2E A;  2PJP A;  1U2W A;  2J5P A;  4N0B A;  5L3G A;  3V8J A;  5ICF A;  2NNY A;  3GUD A;  1OYW A;  2ZCW A;  2VOP A;  5K5R A;  3D0S A;  5JVT A;  1PP7 U;  2P8T A;  5D5U B;  3LA7 A;  2DO7 A;  3HSF A;  2Q8K A;  3TO9 A;  5CVI A;  4BHP A;  4RB2 C;  4H0E A;  1HW2 A;  3CUQ C;  1SD7 A;  2HFH A;  2RVC A;  2HZT A;  1OR7 A;  1ZAO A;  4A5M A;  4ASN A;  5CVJ A;  1KU7 A;  4KIC A;  2P4W A;  3CO6 C;  1P92 A;  1V4R A;  4KIF A;  2ZXJ A;  1FX7 A;  5ILV A;  1XSX A;  3K69 A;  2Z99 A;  3KE2 A;  3ZMS A;  2FU4 A;  1U5T A;  3SHF A;  4LB5 A;  3ZN1 A;  4EM0 B;  2BEO A;  1Z9C A;  3I53 A;  2EA2 A;  1Z6R A;  5CJ9 A;  2VE8 A;  4RS8 A;  1W7P B;  3BZ6 A;  4CYD A;  1G3W A;  1ON2 A;  2EK5 A;  4YFN F;  1XD7 A;  4IF4 A;  2A61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...