4U0YA

Crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
b'MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor YvoA
publication title Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transcription
total genus 24
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4u0yA00
3OOPA 1Z6TA 2ZMEB 3ZN0A 3I5UA 4WCGA 1LDKB 4B09A 3WTZA 3TOBA 1P4XA 3C7JA 2JPBA 3KLOA 1E17A 4RGSA 2IW5A 3GWZA 4ETSA 3R61A 5ICGA 1SAXA 3V4GA 1VTNC 5L3EA 2W84A 1WRJA 3V7RA 1XGOA 3DXJF 1G3WA 1EH7A 4A5MA 4KIFA 3IKTA 3BJOA 3B02A 3F8MA 3R4KA 1DDNA 2JZYA 3OV8A 1IN7A 1P2FA 2FRHA 1ZREA 3GFMA 4FHTA 3L2CA 3E6CC 4GGGA 1U6GA 4TV7A 2RNJA 4L5JA 1ON1A 3ECHA 2O03A 3JTHA 3TGNA 1OR7A 1BC7C 3HTSB 5L3DA 4LK1F 1IN5A 1O3RA 2CFXA 4P5OA 1O57A 2JSCA 3BDDA 1HSJA 5BS6A 4IRGA 1R22A 3KEOA 1D5VA 3JSOA 3BP8A 1K6OA 2NNYA 4BNCA 3E5XA 3GLXA 4IRHA 3HUGA 4IF4A 4QWQA 2XROA 3NEUA 4HDUA 1FT9A 1S7AA 2L02A 4HQEA 4F7ZA 3FMSA 2A61A 1Z1DA 3CTAA 3NRVA 3QPHA 4O6JA 5D5VB 4U0YA 3K1NA 2IA1A 1IW7F 2OU2A 1EH6A 5DD4A 3F22A 4M9XA 1ZGJA 1ZYRF 3V8LA 2ZBKA 2RKHA 4LJZF 1J9IA 1C0WA 1ZH5A 4UXNA 2Z99A 1U3EM 4M74A 2KIUA 3IRRA 2BGCA 4HAMA 2DU9A 1A04A 2H09A 5BMZA 3NQOA 2F5CA 2HEOA 3I54A 1MGTA 1QQIA 4N0BA 4G7OF 3KZYA 3CDHA 5JR3A 4CO8A 4D0PA 3WU0A 4EV0A 1KU2A 2HYGD 1J59A 2RQPA 5K5RA 4L18B 3GXOA 2VC0A 1FZPB 4ZH4F 1J0RA 1B6AA 3F72A 1MDMA 3F21A 3LA2A 2DI3A 2H6BA 2CO5A 4YIFA 1KQ0A 2ESNA 4MEXF 3EYYA 4UV9A 1MDMB 3LFKA 2XASA 3T5XA 3F3XA 1E2XA 1D8KA 4OIPF 1ZRFA 4NHJA 5JHUA 2NNNA 1B9MA 4EJWA 2A6HF 3R0JA 4ESJA 2H27A 1U5TA 4ENMA 3TO9A 2GQQA 1SD6A 4YG2F 1GXQA 2K27A 5K5OA 1JXSA 4IRIA 4LMYA 1FP1D 3TQNA 1XGNA 2BBYA 2IP2A 4KMFA 3L7WA 1U5TB 1D3YA 2E1CA 5LGUA 4PCQA 3HIFA 4UVAA 1T0FA 4RAYA 3LQQA 3D5LA 2GZWA 2WV0A 1SFUA 2CW0F 3GYHX 1XCBA 3WGGA 1FBSA 2PMUA 3ZMUA 5JFRA 2M45A 2E1NA 2STTA 1IRFA 4MNUA 2QM3A 5ILSA 5DCFA 3CUQA 3QRFF 1S7OA 1H0MA 5L3CA 1QO0D 2VXZA 1RI7A 2K4JA 2K02A 2ISYA 4LLLA 1HKSA 2K4BA 1QGPA 2FF4A 3KP6A 4EMSA 1W7PB 1P4AA 2EA4A 4M9ZA 5FFXA 2M87A 4ZYDA 1Z7UA 4O3MA 5DEQA 2Q8KA 1YYVA 4KDPA 2DT5A 1DPUA 3WG9A 1I5ZA 4PGGA 5IT3A 1SD4A 5KK1A 2XRNA 4UVCA 3KP4A 3RIRA 4IHSA 3WTSC 4ZYGA 3KFWX 3BZ6A 3C18A 3FZVA 4A6EA 3T1BA 1FBQA 3KE2A 3QU6A 1GXPA 2EFPA 1KA8A 3CO7C 2FSWA 5AIQA 4I0BA 5D6FA 2G9WA 5AONA 4HX8A 1F5TA 4KA4A 3HRMA 3JTGA 5HLIA 5CVRA 2LSOA 3JW4A 3V7SA 3ZMVA 2FBHA 2EV5A 4RS8A 3H92A 1H9TA 1CF7A 4OINF 3KLNA 4HV5A 5HDGA 1FPQA 1V3FA 2H94A 5E1WA 2XAFA 2DW4A 1OYYA 4LG0B 1J7KA 1O3TA 1CF7B 2FU4A 2VOPA 1HKTA 3ULQB 4I2OA 1XSXA 5IT9Z 4R8HA 4A2UA 4L0ZB 1IXRC 4HZFA 1LEBA 3EUHA 2P7CB 3E3VA 2ZFWA 3L9FA 2Q0OA 2G7HA 4P9FA 4LGWA 4KN7X 3QP6A 3HTUA 3SHFA 2BE5F 3I64A 5F64A 3K2ZA 1R5HA 1Z9CA 2TDXA 2MH9A 3PQJA 2PLYA 3DF8A 4G9YA 1SMTA 5CVIA 3PQKA 3W6JB 2XAJA 1P4WA 3KZZA 4L9VA 2VBXA 3ZP5A 1QZZA 2VBYA 3J80Z 2A3SA 3I53A 4YFKF 3N4MA 3CO6C 2PEXA 3BY6A 2A69F 3BJAA 3GO5A 2HQNA 1EV7A 1XDSA 4P9UA 3S2WA 4CZZA 4HOBA 4S04A 2YU3A 2D1HA 2HOEA 3BPVA 2GWRA 2EFOA 2HDCA 2Y75A 3ZMZA 3P9IA 1J2XA 2OAZA 1GVJA 5ERIA 3F8BA 4FX4A 1SFEA 2P5KA 1UB9A 2QYOA 4ESFA 4HX7A 5LBQA 1YW8A 4JK1X 4BXUA 1ZGAA 4ZYEA 5DUIA 3M8FA 2P8TA 1S3JA 2QVOA 5L3BA 2VODA 2HR3A 5F6FA 4G94A 4CHUA 4UV8A 1YTYA 2HKXA 1IN8A 2PQ8A 3RKWA 1F1ZA 3WGIA 1HW5A 3HOSA 5LEJA 1JHFA 3DP7A 2W85A 1LEAA 2OQRA 1BI1A 4EM0B 1R58A 3DV8A 5HLHA 4G7HF 1O7LA 1TW2A 3ELKA 1FSHA 3MFKA 1K79A 4RB1A 3FX3A 3GFJA 2MLGA 5JI6A 3ECOA 4MGRA 2M8EA 2F5FA 2DBBA 5HS8A 2ETHA 3P7NA 4KT5C 1IRGA 1G3YA 1FBUA 4EQQA 4MTDA 1LJ9A 3WODF 4GYGA 3ML6A 2D2WA 4WXDA 3E97A 5F1RA 2W24A 2X0LA 3M9AA 4AIKA 5HDKA 2MBFA 1RNLA 1G6NA 4G7ZF 1G4DA 5D8KB 3J81Z 1RUOA 1B1BA 4AIJA 2E7WA 2JT1A 2GA2A 2EB7A 1SD7A 2VC1A 1IN6A 1MKMA 5HVQC 2KIFA 3TDZC 5LHHA 1I1GA 2QQ9A 1KYZA 2QWWA 3I4PA 1OYWA 3R0AA 4ZZLA 2X4HA 3SZTA 3WTWC 3F6VA 2K86A 3K9TA 2R7DA 2YSRA 4A5NA 1AOYA 1FSEA 3IL2A 2P5LC 1O3QA 2CSOA 1JGSA 2F2EA 4KMUX 1YLFA 3U2RA 1U78A 4YFXF 3FWEA 4XRFA 4N9IA 3MZHA 1SD5A 2IPQX 3DEUA 3P9CA 4GCVA 4Z2YA 2LKPA 2Y48A 4AWXB 3GF2A 2EV0A 3BPXA 3RYRA 3ZPLA 1KGSA 4A6DA 1LDJA 1BIBA 2P7VB 4IVNA 1W7PD 2F5EA 1I1SA 4DQ2A 2FBKA 4ON0A 3RPUA 4FT8A 3FM3A 3W6KB 3I71A 3E6BA 5D4SA 3BROA 2IA0A 2J5OA 2PMHA 1PP8F 2GXGA 3M1EA 5AIPA 3C1DA 2ZNZA 4EM1A 1YO5C 2XV4S 4BQAA 5TRDA 5BOXA 2FEZA 4O5VA 2HQRA 1FYKA 5J8FA 2VE8A 3HRSA 4EM2A 1XMKA 1STZA 3TDUC 4U7DA 1HBXG 4Q5SF 2HS5A 1LVAA 5FB2A 1WI9A 3WE2A 4ENNA 3LQRA 2R3SA 4OIRF 3TOAA 2QQAA 1DUXC 5HOOA 2JPCA 2H6CA 2Q2EA 1FOKA 5LHGA 1ODDA 4P96A 5IT9K 3JAMZ 4RAZA 1G3SA 3MQ0A 1KU3A 4I01A 5E8GA 3HSFA 3U1DA 2V1UA 3KP2A 2NAZA 4P55A 2V1DA 3RYPA 1IAWA 1D8JA 3Q9SA 2QZ8A 3O6BB 2W57A 4KICA 3LWFA 2L4MA 1RIOH 2FQ3A 2QQBA 3EQLF 1MJAA 3RKXA 4HYEA 2LNBA 4I98B 5D8LB 2UZKA 3HOTA 1U2WA 4LB6B 4EJTA 2A6EF 1ZHFA 2QBYA 5D4RA 1H9GA 3GZ5A 1MD0A 2EFWA 3FMRA 1R36A 1W7PA 5LLQA 2ZXJA 4EGYA 2E7XA 3QU3A 2OD5A 2YPRA 3J80K 3H3UA 4XLNF 2QBYB 1T98A 2HGCA 2RVCA 4EJVA 3L09A 2EWNA 2VT3A 4RB0A 1K7AA 3J7AO 1F4KA 2KJBA 5LHIA 5K1YA 4LK0F 1XCVA 2CYYA 4RB2C 1OYIA 4CYDA 5BQTA 1TNSA 4KUMA 4XSXF 4MEYF 4R1HA 4EJUA 5L3GA 1S6LA 3ZMDA 5CLSA 5E18F 3SXYA 3M7GA 5TJJA 3HRUA 3DPTA 5J8CA 3MAJA 4LD5A 4GO1A 1LNWA 1J75A 3VB2A 3SQNA 4I7HA 1OKRA 2GIVA 1BJAA 3K1MA 5D5XB 4L9TA 3DFGA 4OMYA 2FE3A 4RGXA 4WK8F 1DPRA 3AAFA 1Y0UA 2A07F 3FXUA 1WSUA 4LG0A 3B73A 3JSPA 5H6QA 4I0AA 5CVUA 4UUVA 4M71A 2ACJA 1XSDA 2LF8A 5CJ9A 4KN4X 3M8EA 2K7LA 2DPUA 5HDNA 5EEGA 1BI3A 2UXXA 5E20A 1PUEE 2AXLA 4UNOA 5E17F 5FFZA 4HF2A 1RUNA 2NYXA 4AIHA 2O6GE 2NRAC 4MHGA 2GXBA 1TQMA 4R79A 1FC3A 4HF1A 2DFIA 3RPQA 2HZTA 4L0YB 5HS9A 2ELHA 1HXDA 3KP7A 1ZN2A 3O2PE 2OA4A 4OU0A 4A0XA 1KQ9A 4CICA 3T0YA 3GX4X 5DUKA 3WTXC 5H6RA 4BHPA 2UWMA 2VN2A 4MTEA 4H0EA 1QBJA 2KIMA 3E6MA 3RDIA 4RGRA 2EA2A 4CGZA 1TTYA 2HKOA 4MQVA 3REOA 1MJBA 1Z05A 4HF0A 2RN7A 1R1UA 1TBXA 1NHAA 4BH9A 2ADUA 1YS6A 1LQ1A 2L4AA 2XUBA 3I58A 1UFMA 4CXFA 2EFQA 5ED4A 5DDGA 2EK5A 4JQFA 2ZJ2A 4K2EA 1X3UA 1UHMA 3ZMTA 3U9GA 3ZN1A 2FOKA 1ZRCA 3FXRA 2OQGA 3LAJA 4G6DA 1ON2A 1XGMA 2CWEA 1UCRA 4Q4ZF 3O3KA 1ZAOA 2R7FA 2RV8A 5LGTA 1PDNC 2AS5F 4S05A 3H3ZA 1W5SA 1XGSA 3N97A 3FM5A 2KKOA 3V7CA 4HA8A 3WU1B 1I6XA 3VEPA 3ZMSA 4WWCA 1K78A 5ICFA 3G3ZA 4YFNF 2L01A 4M6YA 3DPLC 4UHTA 1ZG1A 4GYIA 4I09A 2YR2A 5DYMA 1K78B 1R00A 1OPCA 3ISPA 1R5GA 2ZNYA 3COAC 3HSRA 5E8IA 4PZJA 4Y15A 3WTYC 2XKPA 1ZG3A 1OMIA 5CYVA 2PN6A 3QOPA 4WX9A 4LLNA 5ILVA 1LB2A 2DPDA 1T6SA 4PGHA 1FP2A 3GZ6A 3MCZA 3E5QA 2VBWA 4JBAA 2J5PA 1FYMA 5HLGA 4M73A 3HHHA 4KYWA 5LEKA 2XVCA 4DNCA 4HLXA 2OBPA 2OZUA 2Z3YA 4QLCU 5DCMA 5A2QZ 1YW7A 3JAMK 2YX4A 1TQIA 3KETA 2M30A 4Y17A 5LRSA 1USTA 4MQ9F 3FHZA 2DAOA 1LDDA 3KCCA 5DCMB 1IF1A 1CGPA 3T8RA 5FLXZ 3Q5FA 2FMYA 4WXCA 2OZ6A 4IPAA 3LA3A 3P9KA 1DP7P 2DQRA 3EETA 2PI0A 3C3WA 3QAHA 3HHGA 4IHTA 2DK8A 2VOOA 1S8NA 4AVPA 3CLOA 3LAPA 3F8FA 1WKMA 2DK5A 1HKQA 2VBZA 3ROUA 1BOAA 1B4AA 4ENKA 3TKYA 1FYLA 3LSTA 4ESBA 2WC2A 4RGUA 3MWMA 3WTUC 3FF5A 1BC8C 3R60A 4U0WA 2LDUA 4XLPF 2A5YB 1B9NA 2V6CA 2RGVA 2IJLA 1JHHA 1XN7A 3Q9VA 4U88A 1ZLKA 1ONVA 2GAUA 1YIOA 3IRQA 4U7BA 2MH2A 1YQAA 3VODA 2QLZA 4Q48A 3WE3A 3DKWA 1JE8A 3GUDA 4EJOA 4M72A 1L0OC 1V4RA 2EV6A 3GFIA 2FNAA 1MZBA 4M6XA 1F9NA 3BJ6A 2VE9A 1ZRDA 1TNTA 5FGMA 5ICCA 3D0SA 4UVBA 4LFUA 5H20A 5KVRA 1XB4A 4G6QA 3ZQ7A 3K0LA 1IZ1A 2PBIA 1Q1HA 5HS7A 1IXSB 3WGHA 2ZCWA 1KU9A 1T2KA 1IN4A 2F5DA 2FBIA 1SFXA 4KIBA 1G3TA 3ERED 2NS0A 2ESHA 4N9HA 4BHCA 1ZG5A 2XIGA 4PDKA 2A68F 3R6SA 4WXHA 2IT0A 1J5YA 4BHBA 4HQMA 2YX7A 4NQWA 1ZLJA 2KJCA 1WWXA 3F23A 3SFZA 3IC7A 4KNYA 2O8XA 4BYYA 2D45A 3QP5A 2KRFA 5CVJA 4ASNA 1KQ8A 1W4MA 1XD7A 4A12A 4U0VA 5JVTA 3HSEA 1YS7A 4XBFA 2BEOA 5FD6A 5LGNA 3GEZA 2XAQA 3GW2A 3G73A 4A0YA 2L3DA 2STWA 2HWVA 2CG4A 3BWGA 3RJPA 4IJAA 5EEHA 1HW2A 1TLHB 2G7UA 2FA5A 1TQPA 3E6DA 6PAXA 3EDPA 4A0ZA 2RDPA 2WTEA 1P92A 3F8NA 3FMQA 1YW9A 1IUYA 4XSZF 4E70A 3BOQA 1B59A 2EJRA 4Y13A 3ABUA 1W5TA 3I0TA 1HQCA 4ENJA 2XHKA 2RC4A 1BM9A 2Y0MA 2IVMA 5FO5A 3CUOA 3VOEA 3K69A 4HDVA 2HTSA 1SMYF 2MA3A 3IWFA 1YG2A 4HV6A 5ILUA 5K5QA 3DQVC 2FXAA 3FXQA 4G8XA 5DV5A 4LLGF 2Z9OA 3EYIA 3CJNA 3KP3A 3E5UA 2O3FA 2PG4A 3CUQB 3MZYA 1GHCA 2JRTA 2DQLA 4IXAA 2HYFA 1U5TC 3IHUA 5L3FA 2D1VA 4CDGA 1I27A 1WQ2A 4OIQF 2MC3A 5D5WB 5ICEA 1O7FA 1XSVA 2HFHA 2JTVA 3TO7A 4EGZA 2ZO4A 2GA1A 5BPIA 2ISZA 1FWZA 1T39A 4NB5A 1XDUA 2M1BA 1ULYA 2ZKZA 4KFCA 1R23A 2C6YA 1HW1A 1FNNA 1R1VA 3V8JA 2QUFA 1QZYA 4M9SA 2UXNA 1P6RA 2FMLA 4YIIA 2EFNA 3LA7A 2O0YA 2M5WA 3CUQC 3IKVA 2DTRA 3WTVC 2WWYA 1USSA 1FLIA 4I02A 1BN5A 1MJ9A 2XGXA 3VFZA 1KYWA 4OOIA 2P6TA 2O61A 2XAHA 4L9JA 2V1XA 3T8TA 3TO6A 2VONA 2XKOA 1UHWA 4B8XA 4RB3C 2LF7A 5J6XA 1KU7A 2BYVE 1BIAA 1EH8A 3F8CA 2BV6A 5FD5A 1TW3A 3MEXA 2QENA 1XMAA 5A2QK 3PFIA 2HTJA 1HSTA 1REPC 3IWZA 4GXOA 2P4WA 3J81K 3L00A 2CGPA 5DD8A 1AWCA 1YFHA 4BAYA 5D5UB 4WF2A 1T38A 5FLXK 3F6OA 3SZPA 2MLKA 4ZZDA 4OMZA 1Z91A 1ZARA 1QNTA 5LRRA 4OIOF 2Z5UA 1RZ4A 2PJPA 1Z6RA 1S29A 2Z33A 3RKYA 1BI2A 2B0LA 3HYIA 4Q47A 1R7JA 5E1XA 1BI0A 3KP5A 1BBYA 2FNPA 4FX0A 3KEQA 2V9VA 2W25A 2DLLA 4KIGA 4L5IA 1FY7A 2COMA 3QPTA 3GFLA 2P6SA 3I59A 1PP7U 2PFBA 3RTRA 2IA2A 3RI4A 4HBLA 2IRFG 3WTTC 3ABTA 3GVAA 1U8RA 3V8KA 1FX7A 5CVVA 3I59B 5BPDA 1IXCA 5E1ZB 2XAGA 2CQKA 4HX4A 4AD9A 1QPMA 2DO7A 2P5VA 2VT2A 3K1PA 4ZYHA 2MD5A 4HLYA 2ZMEA 2V79A 5D6EA 4L9NA 2L54A 4EVIA 1L3LA 1R1TA 4HW0A 1O3SA 3HRTA 4LB5A
chains in the Genus database with same CATH superfamily
2L0KA 3OOPA 1Z6TA 2W82A 2ZMEB 3OR2C 3ZN0A 2XDVA 3I5UA 1IV6A 2AQFA 4WCGA 1LDKB 2ZC2A 1T8IA 4B09A 3WTZA 3TOBA 4J19A 1P4XA 3C7JA 3OMYA 2JPBA 2JA2A 4C9YA 2X1EA 3KLOA 2NVQJ 1E17A 4RGSA 2IW5A 5B5EC 1WH7A 2JSPA 1LKXA 1FMWA 3GWZA 3TW7A 4ETSA 3R61A 1ACIA 5ICGA 1SAXA 3V4GA 1SAUA 1WJFA 1VTNC 4RAGA 5J4VA 5L3EA 2W84A 4Z6YA 2IAIA 3CJTB 1WRJA 2CQXA 3V7RA 1XGOA 2VKEA 3DXJF 4E7KA 1ZELA 2NVUB 4F92B 2HI3A 2VIXA 1JGGA 4A3KJ 1G3WA 3CMYA 4BJTA 1MW7A 1EH7A 4A5MA 4KIFA 3IUOA 4XLFA 2KZGA 3RSNA 3G4SI 1H89C 3VYTB 3RQ4A 3OIOA 5FKMA 4OAYA 2DA6A 3IKTA 3BJOA 3S32A 3B02A 3Q0WA 1MIJA 4IKFA 3F8MA 3U1KA 3R4KA 1DDNA 2JZYA 4A3EJ 3OV8A 3I4MJ 4KT6A 1IN7A 1P2FA 2FRHA 3WG7H 1ZREA 2V9KA 3BZCA 3GFMA 4FHTA 3A01A 3OYBA 3L2CA 1TWCJ 3E6CC 4GGGA 1U6GA 4TV7A 1U8BA 2RNJA 2BW3A 4L5JA 3CMAI 1X1CA 1ON1A 3ECHA 2O03A 2ZMEC 3JTHA 3TGNA 1OR7A 1BC7C 3DTIA 3HTSB 3LSGA 5L3DA 2LKSA 2Y0SN 4LK1F 1IN5A 5JHFA 1V5EA 1O3RA 2HQ5A 3M4OJ 1Y1WJ 2CFXA 1QVUA 4P5OA 3IAS2 3A01B 1A36A 2VJJA 1O57A 4RM2A 2K9QA 2JSCA 2BW3B 2EH3A 3BDDA 1HSJA 5BS6A 4IRGA 1R22A 2F4MB 2X1CA 3KEOA 4J01A 3RQIA 1D5VA 3CCEI 3UR3C 3JSOA 5EEAA 1FIPA 5C3EJ 2DFEA 2M4KA 3BP8A 4BJ5C 1O4XA 1MBJA 2JA5J 1K6OA 3K10A 1JTXA 2HU9A 4IHYA 1MBKA 2NNYA 3E5XA 4BNCA 2GOMA 2XGCA 3GLXA 4YIRX 3GTQJ 2IXSA 5M5WJ 3I56I 4JX4A 4XN0A 3CMMA 4IRHA 3CMEI 4EATA 3HUGA 4BKXA 2M8GX 4IF4A 2LY2A 3GZNB 3M8JA 4RLQA 2OCCH 4QWQA 4D7MA 4CCJA 2XROA 3GTMJ 3NEUA 2LH9A 4X1EA 5J3LA 3VWBA 4HDUA 1FT9A 1S7AA 2L02A 4HQEA 4F7ZA 3FMSA 3KYCB 2A61A 1Z1DA 3CTAA 3NRVA 3QPHA 4O6JA 5D5VB 4W1UA 4U0YA 3K1NA 2CW8A 2YU9J 1VFCA 2IA1A 1IW7F 2OU2A 1EH6A 5DD4A 4A3LJ 3F22A 2HVQA 4LITA 1HC8A 2GOXB 4M9XA 4B3AA 4IO9F 1ZGJA 2V6EA 3HOUJ 3M3YJ 2VKDA 3AG3H 2Y31A 1ZYRF 3V8LA 2Z2SB 2ZBKA 2RKHA 4BACA 4LJZF 3SJMA 1J9IA 1C0WA 2VLAA 4Y7NJ 1ZH5A 4UXNA 2Z99A 4XRSG 1U3EM 4M74A 1E3HA 1DGWY 2KIUA 2BGCA 2LBFA 4FE4A 3SEQA 3IRRA 3CCUI 1VQOI 2ID3A 4HAMA 1R9TJ 2DU9A 1YX5A 1A04A 2H09A 5BMZA 3NQOA 2QEXI 4JX5A 1HDPA 2F5CA 2HEOA 2DMQA 1ZTRA 2RQQA 3I54A 2WY7Q 1MGTA 3GCMA 1QQIA 4N0BA 4BDYA 4G7OF 3KZYA 3CDHA 5F04A 5JR3A 2VQHA 2LBFB 4CO8A 1POGA 4D0PA 1IC8A 3WU0A 4EV0A 1FEXA 1KU2A 2HYGD 5IOZA 2KRCA 3CZ6A 3RZDJ 4D1QA 1J59A 2RQPA 2CQQA 5K5RA 5B66C 4L18B 1GLNA 2OC6A 2XPVA 3GXOA 2VC0A 1FZPB 1VQ4I 4ZH4F 1J0RA 2QKLB 5EYRA 1B6AA 3F72A 1MDMA 3F21A 3LA2A 1OCOH 4M3DA 2DI3A 2H6BA 2CO5A 1ETYA 5E3NA 3QYFA 3E0JB 4YIFA 2CQNA 1UMQA 2ZXIA 1KQ0A 1RRJA 2E1MC 2ESNA 4MEXF 1YX3A 2LG4A 3EYYA 2LD5A 1LFPA 4UV9A 1MDMB 3LFKA 2XASA 3T5XA 3F3XA 1E2XA 3E1SA 4X6AJ 1D8KA 2DT7B 2KT0A 1ZRFA 4OIPF 4NHJA 2EILH 4ANJA 5JHUA 3CCSI 3MKZA 1IJWC 2NNNA 3LSJA 1B9MA 2X6WA 4EJWA 2A6HF 4BJ6C 1A35A 3EPZA 3R0JA 3CJRB 2KDOA 1OCPA 1VZ0A 3IAM2 4ESJA 1Z21A 2NOGA 3PO3J 1R4MB 1WFXA 2H1LA 2H27A 1U5TA 4ENMA 3TO9A 2GQQA 4BEHA 1SD6A 4YG2F 3FXKA 3PUBA 1GXQA 2V4JC 2K27A 2FJ1A 3CF2A 5K5OA 3PNYA 1JXSA 4IRIA 4LMYA 2KIQA 1FP1D 3TQNA 1Y39A 1XGNA 2BBYA 2IP2A 4KMFA 3S15J 2YUSA 4XMYA 4CUGA 4A3BJ 3L7WA 1U5TB 1D3YA 2DMUA 2F4IA 2E1CA 3V42A 1S7EA 2QSHX 2VASA 1WHUA 5LGUA 4PCQA 2ZJQF 4A3IJ 3HIFA 4UVAA 1T0FA 4RAYA 4XORA 3LQQA 1VQNI 3ZRGA 3D5LA 3HZJA 3NAUA 2GZWA 2WV0A 1SFUA 3L2WA 2CW0F 3GYHX 4YELA 1XCBA 1ZK8A 3WGGA 2LVSA 3M1CA 3GTLJ 3PSFA 3BG5A 2V9PA 2KDZA 1FBSA 4BQQA 2PMUA 1MSEC 3S1NJ 2KPMA 2Y0SA 4IZZA 1W0TA 3ZMUA 5JFRA 1Y8RB 2M45A 2E1NA 2STTA 2OV7A 1IRFA 2JVHA 4MNUA 2QM3A 3FXJA 2R4GA 5ILSA 3H5RA 5DCFA 2XGEA 3CUQA 3AG2H 4XRMA 2M3AA 3QRFF 1S7OA 1H0MA 5L3CA 1QO0D 2VXZA 1RI7A 3LFUA 4DYRA 2K4JA 3DLAA 2K02A 2ISYA 4M6VA 2VPRA 4LLLA 4A3DJ 1HKSA 1UJ8A 3EUAA 4X0GA 2K4BA 1QGPA 1GV5A 3SZGA 3LSMA 3CF5F 2FF4A 2JJ7A 2Q1ZB 3KP6A 3OL4A 4PJMA 1W7PB 4DZPA 1P4AA 4EMSA 4BE1A 2EA4A 3L1PA 3BQZA 3A02A 2XB5A 4M9ZA 5FFXA 3IH4A 2M87A 4AYBA 4ZYDA 1Z7UA 3JRAA 4O3MA 2E5ZA 4FETA 5DEQA 2VXDA 1K4SA 2Q8KA 3PO2J 1YYVA 4XKCA 1N25A 4KDPA 1S5LC 2DT5A 1DPUA 3FXMA 2LY1A 5K7ZA 3WG9A 1I5ZA 4PGGA 3HKZA 3IH3A 2IS6A 5IT3A 3BCAA 3SFIA 1SD4A 3HOZJ 5KK1A 2XRNA 4UVCA 3KP4A 1V55H 3RIRA 2XPUA 2CW7A 1HA8A 4UUSA 1T0FC 2COBA 4IHSA 1N78A 3WTSC 4AU7A 4ZYGA 2DJNA 1Y0NA 3KFWX 3ZQLA 3CJQB 1RESA 3BZ6A 3C18A 1Y6IA 3FZVA 3CC2I 4A6EA 3AG4H 3T1BA 1FBQA 3KE2A 2Z1DA 3QU6A 1GXPA 2EFPA 2X6OA 1KA8A 3CO7C 5IYCJ 1G2HA 2AQEA 3ERMA 2FSWA 5AIQA 2N8GA 1FTZA 4I0BA 5D6FA 2G9WA 1IO2A 5AONA 1YJ9I 4HX8A 1F5TA 4KA4A 4CH7A 3HRMA 3A0BC 3L2RA 3VPRA 3JTGA 5HLIA 3K6GA 2BXYA 1Z7LA 5CVRA 3S8PA 5CKTA 2LSOA 3JW4A 3V7SA 3BG6A 4A3GJ 3ZMVA 3VYUB 2FBHA 3G2BA 3HJEA 2EV5A 4RS8A 3JRIA 3H92A 1H9TA 1CF7A 4OINF 3CQZJ 2AHQA 2CH0A 3GTPJ 3KLNA 4HV5A 5HLTA 4MLOA 2FD5A 5HDGA 1FPQA 1V3FA 2H94A 4QTRA 5E1WA 4I76A 2XAFA 2DW4A 4A3FJ 4CCNA 3CDIA 1OYYA 4LG0B 1I3AA 1T95A 1J7KA 5IPAA 1O3TA 4E7HA 1CF7B 2FU4A 1X2NA 2K40A 2R7QA 2VOPA 1HKTA 1PJRA 2VKHA 2DFFA 4C2UA 3J7ZI 3ULQB 4I2OA 1XSXA 5IT9Z 4R8HA 4A2UA 4L0ZB 1IXRC 2IGMA 4HZFA 1LEBA 3EUHA 2W7NA 2AXTC 2EZLA 4KISA 3ESWB 3OYAA 3QQAA 3J7YJ 2P7CB 3E3VA 2ZFWA 2CUZA 3KIOA 3L9FA 2Q0OA 1SANA 2G7HA 4UUTA 4P9FA 2DMNA 3H9GA 4LGWA 4KN7X 3QP6A 3HTUA 1I6HJ 2DA1A 3GTOJ 2JUCA 4BQNA 3SHFA 4RMNA 2BE5F 3I64A 1Z3XA 2HPMA 1UG0A 4MIMA 1GVDA 1YOVB 5F64A 3DBLB 4LIVA 3BZKA 2LTPA 3K2ZA 2E19A 1IV8A 4UY8I 1R5HA 4B43A 3I4NJ 4C2TA 1Z9CA 1MBGA 2TDXA 5IYBJ 4P1WA 3OOUA 1SVOA 2MH9A 2IBDA 3PQJA 2PLYA 3DF8A 2ZXWH 4G9YA 1SMTA 5CVIA 3PQKA 3W6JB 2XAJA 4XK4A 1P4WA 2CV2A 2K9MA 3KZZA 4IQ4A 4L9VA 1YJNI 2VBXA 4PJJA 3H9JA 3ZP5A 1QZZA 2VBYA 1H8AC 3G1MA 4FTHA 2ZSHB 2A3SA 2E60A 3I53A 4YFKF 5KAFC 3J80Z 3CO6C 3N4MA 1JJ6C 2PEXA 3BY6A 4J00A 2R7UA 2QGUA 4F55A 2A69F 1WGXA 2WV1A 3BJAA 3GO5A 1XMXA 1FOXA 2HQNA 1EV7A 1XDSA 4P9UA 3S2WA 4CZZA 4HOBA 2DMPA 4S04A 2YU3A 2D1HA 2BY3A 2HOEA 2XF6A 4BE2A 1RPWA 1UZCA 3BPVA 4BGDA 2UUZA 2GWRA 2R5YA 2EFOA 1X4PA 4CCKA 2DXIA 2L7KA 2HDCA 2R7ZJ 2KHMA 2Y75A 3EUHC 4KJZA 2V1NA 3ZMZA 1VQ6I 3P9IA 1J2XA 1P7IA 1GVJA 2BOLA 2OAZA 2LLKA 5ERIA 3F8BA 4IL6C 4NUBA 5K7FA 3HL2A 4FX4A 1SFEA 5C4XJ 2L7FP 2P5KA 2JQ7A 2R5YB 3RZOJ 1UB9A 5M3FJ 1JKRC 2WB1A 2R92J 4W97A 2MD0A 2QYOA 4ESFA 4HX7A 2EQRA 2JN6A 5LBQA 1YW8A 4JK1X 5IY5H 3OWTA 1BL0A 5GPCA 4BXUA 1ZGAA 3BG3A 4ZYEA 3UNGC 5DUIA 2LMDA 3M8FA 1AU7A 2P8TA 1S3JA 2DCEA 2XF5A 1JTYA 2JVGA 2QVOA 5L3BA 4OWRB 2VODA 3LSHA 3A03A 2VPLA 2HR3A 5F6FA 3FDYA 4BDZA 4G94A 4CHUA 4UV8A 1OISA 1YTYA 3DEEA 2HKXA 4NNJA 1IN8A 2P0WA 2PQ8A 3RKWA 5LFAA 1F1ZA 2NVXJ 4BY1J 2B7EA 3WGIA 2CV0A 4PJNA 2DT6A 1HW5A 3HOSA 5LEJA 1JHFA 3DP7A 4II3A 2W85A 5CQGA 1LEAA 2OQRA 1W36D 1X1PA 1BI1A 4EM0B 1R58A 3DV8A 3CC7I 4D7NA 5HLHA 4G7HF 1O7LA 3H36A 4N4OB 1OCTC 1TW2A 3ELKA 3A0HC 1FSHA 3MFKA 1K79A 2IEKA 3FX3A 4RB1A 3FXOA 4IHVA 2R0QC 3GFJA 2MLGA 2BZTA 2M34A 5JI6A 4XNFA 2KP6A 4GRIA 3LSIA 3IV5A 3ECOA 2DYRH 4MGRA 1VQMI 2LR8A 1Y8QB 3FISA 4DZJA 1N75A 1X4OA 3W2WA 2M8EA 3O8HA 4DW6A 2F5FA 4IQJA 3BG7A 1UG2A 2DBBA 3SDBA 2XGDA 2R93J 5HS8A 2ETHA 3P7NA 5GTHC 2HOAA 3MZ8A 3GTGJ 4Y52J 1OJLA 4KT5C 2OCEA 1IRGA 4DOZA 1I39A 1G3YA 3RPUD 1QHGA 1IGNA 1FBUA 1T33A 1Z67A 1IRXA 4EQQA 3J7AY 2W4SA 1ORKA 4MTDA 5DM7F 2EINH 4XKVA 1LJ9A 5EZHA 3WODF 4PJ0C 2H1KA 4GYGA 3ML6A 2D2WA 3BR1A 4WXDA 3E97A 5F1RA 1MMNA 5CPRB 2BXZA 2W24A 3H0GJ 2X0LA 4PSXA 3M9AA 4AIKA 3A1YA 3UKGA 5HDKA 2OJED 3OSFA 2MBFA 1MNDA 1RNLA 3K4NA 1G6NA 3FK7A 4G7ZF 1G4DA 4GFBA 3K7AJ 5D8KB 4KITB 3J81Z 1RUOA 4QPOA 4XL9A 3AKZA 1B1BA 2WADA 4DGWB 2E7WA 4AIJA 3AL0B 2JT1A 3I9V2 1U9NA 2GA2A 1E3OC 2EB7A 1SD7A 3OYDA 2VC1A 1IN6A 1MKMA 1UHSA 5IP6A 2L7ZA 5HVQC 2KIFA 4CSWA 3TDZC 2VKVA 4I6ZA 3W2AA 5LHHA 2XF7A 2QQ8A 1I1GA 2QQ9A 1KYZA 1V54H 2BHYA 2QWWA 3I4PA 5M5XJ 2VB6A 1JJ8C 2L5QA 1OYWA 3R0AA 4ITVA 4ZZLA 3VYRB 2OTLI 1HDDC 2X4HA 1VQKI 2IS1A 3VSLA 2XB0X 2KQRA 3SZTA 3WTWC 3PUFA 5F27A 3F6VA 1K4TA 4AYBN 2K86A 3K9TA 2R7DA 4PFPA 2YSRA 3OYGA 2CJJA 4A5NA 4NC7A 3K4BA 4YEJA 5FJ8J 1AOYA 1FSEA 1R49A 3IL2A 2P5LC 4CCMA 3HB9A 2CSOA 1O3QA 4B4CA 1JGSA 2F2EA 3OR1C 4E7ZA 3HKZN 5TISC 3HDDA 3D1NI 4LOCA 3G71I 4KMUX 1YLFA 3U2RA 1U78A 2E1MB 4YFXF 3FWEA 1EJ9A 2GIZA 2WAFA 4OAZA 3BTCA 3AL0C 4AVZA 2HNHA 1G8XA 2FUG2 4XRFA 4N9IA 1VF9A 1E0EA 3MZHA 1V5FA 1SD5A 2IPQX 3DEUA 3P9CA 3C2HA 4AC0A 4GCVA 4Z2YA 3BR6A 2LKPA 2NS7A 2Y48A 4RAFA 4AWXB 3GF2A 1SVMA 2EV0A 4XOTA 3BPXA 1F36A 3RYRA 1KGSA 3ZPLA 5F0CA 4A6DA 2WA0A 1LDJA 1I3QJ 1BIBA 2MFZA 1LPQA 4D5CA 1JI8A 1Z3YA 3H0DA 2P7VB 4IVNA 1W7PD 2F5EA 1I1SA 4DQ2A 3ONQA 1TWFJ 2FBKA 4ON0A 3RPUA 4FT8A 4HNTA 3FM3A 4BBRJ 2CQ7A 1BOBA 2OF7A 3DCFA 3W6KB 5FRNA 3I71A 3E6BA 5TGTA 3BROA 5D4SA 3BLYA 4ZDPA 2P81A 2IA0A 2J5OA 3QOEA 2PMHA 1PP8F 1XPXA 2GXGA 3M1EA 5AIPA 3C1DA 2GLOA 3NARA 4BXFA 1VQLI 2ZNZA 4EM1A 1AKHA 2IGKA 2FX0A 2EBIA 1Y1VJ 2XV4S 1YO5C 4BQAA 1D0XA 5TRDA 5BOXA 1ZR2A 5EGOB 2FEZA 3VSKA 4O5VA 1BJZA 2HQRA 1FYKA 5J8FA 3FK6A 2VE8A 3HRSA 1VQ8I 4HRIA 4BUPA 4EM2A 4NC8A 1XMKA 4E7IA 2UV1A 1STZA 1AKHB 3TDUC 4U7DA 3CD6I 1U0JA 5GAEJ 1HBXG 3FBNB 1W36C 4Q5SF 2HS5A 5GAGJ 1LVAA 5FB2A 5DTDA 1T56A 1WI9A 1DU0A 3WE2A 4ENNA 3LQRA 1FTTA 1NTCA 2R3SA 4OIRF 3TOAA 2QQAA 1DUXC 5HOOA 3BR0A 2JPCA 3BTJA 2H6CA 2Q2EA 3TW6A 2TCTA 3B6AA 2IS2A 1FOKA 5LHGA 1QRYA 1ODDA 4P96A 2XAUA 4U87A 1VQ5I 3D5RC 2R7SA 5IT9K 2VL8A 4IEJA 1S72I 3JAMZ 3HGGA 2K3PA 1G3SA 4RAZA 4BXXJ 1XS9A 1ETOA 3MN2A 1NG7A 3MQ0A 3W2VA 1KU3A 4I01A 5E8GA 3HSFA 3U1DA 1A6QA 2V1UA 2Q2EB 2NAZA 3KP2A 4P55A 2NXNB 2V1DA 5FLVA 1H88C 3RYPA 1A6IA 1IAWA 1D8JA 2JWTA 2RAEA 3ZOBA 4XLCA 3Q9SA 4A3MJ 2QZ8A 3O6BB 3KX2A 2W57A 1B72A 4KICA 3LWFA 2L4MA 1RIOH 2FQ3A 2VQLA 3ZQGA 2BVMA 4A93J 2K9SA 3BTLA 4B48A 5GAHJ 2QQBA 3ZCOA 3EQLF 2F6CA 1MJAA 3RKXA 3LSRA 5B3SH 3JRGA 4HYEA 2LNBA 4I98B 5D8LB 2UZKA 3HOTA 1U2WA 4LB6B 1B72B 4EJTA 4NBQA 1LE8B 2A6EF 1ZHFA 1YE9A 3ASOH 2QBYA 2DA2A 5D4RA 2LP0A 1H9GA 3GZ5A 1MD0A 2LK2A 4QSHA 2EFWA 3FMRA 2BHZA 1R36A 1W7PA 5LLQA 2ZXJA 1G59A 4EGYA 2XC7A 2D5VA 2E7XA 3QU3A 2OD5A 2YPRA 3J80K 1Z77A 3H3UA 4XLNF 4UB8C 3DKXA 3W6VA 2QBYB 1T98A 4M3EA 1NH3A 2HGCA 3HOXJ 2RVCA 2X48A 2WB1N 4EJVA 3DLLF 3L09A 9ANTA 2EWNA 2VT3A 4RB0A 1K7AA 1HCRA 3CCVI 3J7AO 1TWHJ 1XX5A 2KJBA 1F4KA 5LHIA 3B6CA 5K1YA 4LK0F 1XCVA 2CYYA 1PVEA 3TP3A 1X3ZB 1DP3A 2KZVA 3TL4X 4RB2C 1OYIA 2O9LA 4CYDA 5BQTA 1QVTA 1TNSA 4KUMA 1JUMA 4XSXF 2W48A 4MEYF 2NOJB 4R1HA 4EJUA 5L3GA 1W5CC 1S6LA 3ZMDA 1RETA 3HPGA 3HPHA 5CLSA 5E18F 3SXYA 4FQGA 2QKMB 5IP7J 1Z0XA 3M7GA 2HZDA 4F91B 5TJJA 1X1AA 1S9HA 3HRUA 3DPTA 4F3QA 5J8CA 3BG9A 1K61A 3MAJA 2A6TA 4XIDA 4LD5A 2EZIA 2YS9A 1LNWA 4GO1A 1J75A 4F52A 3L2QA 2DOEA 3VB2A 2B63J 3SQNA 1APLC 4I7HA 1OKRA 4CCOA 2GIVA 1BJAA 2MG4A 3K1MA 5D5XB 4L9TA 1EA3A 1BR4A 3DFGA 4OMYA 4JYKA 2FE3A 4B1RA 1GDTA 4RGXA 4WK8F 2E2IJ 3N05A 1DPRA 3AAFA 1Y0UA 4ZDLA 2A07F 2X1DA 3FXUA 1WSUA 2IGOA 3ZGKA 3OIQA 2W1OA 1TP4A 4HSRA 4GDFA 4LG0A 3B73A 5HODA 3JSPA 5H6QA 1D1AA 4I0AA 5CVUA 2PJRB 4ZC3A 3CCJI 4M71A 4UUVA 2JMWA 2ACJA 2ZB9A 1XSDA 2ZXHA 5E3LA 2LF8A 5CJ9A 4XOPA 4KN4X 3M8EA 3JRBA 2K7LA 1FIAA 2DPUA 4B44A 5HDNA 5EEGA 2M4GA 1BI3A 2UXXA 3CESA 5E20A 4BU2A 1PUEE 2AXLA 3HC7A 4UNOA 2MYSA 4AM3A 5E17F 5FFZA 2X9DA 1MNMC 2FQ4A 1ETQA 4HF2A 1D0ZA 1RUNA 2NYXA 4AIHA 2QCOA 2BY0A 2VI6A 4XLEA 3BR2A 2O6GE 2NRAC 5IYDJ 1LVKA 4E7SA 3BR5A 1BR2A 4MHGA 2GXBA 1QA6A 1TQMA 1ZR4A 4R79A 1FC3A 1JUPA 4HF1A 3H3VK 2DFIA 3H5NA 5GADJ 4CYCA 3RPQA 2HZTA 4ZJZA 4L0YB 1JUSA 3GBGA 2DOFA 3G1LA 5HS9A 2A5WA 3CCLI 2ELHA 1QHHD 1HXDA 3KP7A 1RC9A 4HEA2 1ZN2A 3ZQFA 1TL8A 3O2PE 2OA4A 4OU0A 4A0XA 1KQ9A 2R7OA 4CICA 3T0YA 3GX4X 2R7RA 5DUKA 3OYHA 3WTXC 1JT0A 5H6RA 4BHPA 4CYCB 3BC8A 2UWMA 2VN2A 3MD2A 5F0FA 4MTEA 4HNUA 2MABA 2XRLA 4H0EA 3H5AA 1QBJA 1NG6A 2KIMA 1IRZA 5EJCA 1SVLA 1WZ2A 1SEUA 3E6MA 5EG0A 2DYSH 4PSWA 4RGRA 3RDIA 4C3JJ 2EA2A 4CGZA 1ETKA 2XSJC 1TTYA 2HKOA 4MQVA 3REOA 1U9OA 1MJBA 1Z05A 4ZTJA 3CLQA 3MVPA 4HF0A 1FJLA 2RN7A 1I50J 1R1UA 1TBXA 1NHAA 1WI3A 3BR3A 2ADUA 4JX6A 4BH9A 4F93B 5GTIC 2HDDA 2F4OB 4CA0A 1WCMJ 1YS6A 2MSYA 3DPUA 3MKWB 1LQ1A 1MSFC 2L9RA 2L4AA 2XUBA 3I58A 1UFMA 4CXFA 2DA3A 4E7JA 2EFQA 5ED4A 5EG0B 3CP2A 5DDGA 2EK5A 4JQFA 4BS9A 2ZJ2A 4YRVA 4K2EA 3HM5A 1X3UA 1UHMA 3ZR8X 3ZMTA 1QPIA 3U9GA 3ZN1A 2FOKA 3CCQI 3QPLA 1ZRCA 2NS8A 3FXRA 2AO9A 2R7TA 2OQGA 3TEDA 4N4NB 3PFYA 3LAJA 4G6DA 5CQEA 1ON2A 4FE7A 1NK3P 3LSKA 2DJIA 3OS2A 1GT0C 1XGMA 2CWEA 1UCRA 1MBFA 1TC3C 4L5EA 4Q4ZF 3O3KA 2X6XA 1ZAOA 5DS9A 2R7FA 4HPQA 2RV8A 5LGTA 1PDNC 2AS5F 4S05A 3A2KA 1HLVA 1WVRA 3ABLH 1W5SA 1XGSA 1BR1A 3H3ZA 3N97A 4C2MJ 2HVSA 3W3CA 3FM5A 4CCLA 3I3LA 1PUFA 2KKOA 3V7CA 5J47A 5LD2C 3OYCA 1JKOC 4HA8A 2CUEA 3WU1B 1I6XA 3KYDB 3VEPA 3ZMSA 2CUFA 1MNEA 4WWCA 1K78A 3FKJA 1TWAJ 3DBRB 3DU6A 1PYVA 3G3ZA 3H35A 5ICFA 4BE0A 2Y9ZA 2LFBA 4YFNF 1X3WB 2KFDA 2L01A 4M6YA 5J1YA 3DPLC 3OYEA 4UHTA 2RNGA 1ZG1A 5EF6A 1PUFB 4GYIA 1R4NB 4I09A 2YR2A 2XPWA 5DYMA 3ZQCA 1K78B 2VJIA 1R00A 1OPCA 3ISPA 4XRSA 1R5GA 2KLOA 1JKPC 2ZNYA 3COAC 3E7LA 1ZGWA 3HSRA 5E8IA 3S14J 4C30A 4PZJA 4Y15A 3WTYC 2XKPA 4FISA 5J4YA 1X2MA 4PJLA 1ZG3A 4RM3A 2Y69H 4ZTFA 1JKQC 2E2JJ 3HOWJ 1D1CA 1OMIA 2H8WA 2JRMA 5CYVA 4XONA 2PN6A 3ZQQA 3QOPA 4WX9A 4LLNA 5ILVA 1LB2A 3WU2C 1BW5A 2DPDA 1T6SA 4PGHA 1FP2A 3JRFA 3GZ6A 3MCZA 5JLWA 3F0CA 3FHNA 3E5QA 1KONA 2GXAA 2VBWA 4JBAA 3ASNH 2J5PA 3EUKL 5EDNA 3C2BA 1FYMA 5HLGA 2XSDC 5E79C 5B1BH 1V5GA 4M73A 3HHHA 4KYWA 5H2FC 5IOYA 1LUJB 3A4CA 1OCCH 5LEKA 3OYFA 2G0EA 2FOWA 2XVCA 3VYSB 2EPFA 3QYEA 4DNCA 1LFUP 3DU5A 1UAAA 3PIPF 5KNLA 3DBHB 4HLXA 3OYKA 3DWLE 2OBPA 2OZUA 3OL3A 2Z3YA 4QLCU 5DCMA 5A2QZ 3JRHA 3HOVJ 1YW7A 3JAMK 2YX4A 4MFEA 4NC6A 1TQIA 2F5VA 3KETA 2M30A 3OY9A 4B3XA 4Y17A 1JT6A 2CU7A 3OYJA 3BQYA 5LRSA 1USTA 4MQ9F 5FKKA 3FHZA 2DAOA 1UELB 3S1QJ 1QU3A 1LDDA 2CRGA 2K85A 3KCCA 5DCMB 1IF1A 1CGPA 3OS1A 3T8RA 5FLXZ 3JR9A 2OPTA 3CCMI 3Q5FA 1WH5A 2FMYA 2WAQA 4WXCA 2OZ6A 2E2HJ 1MMGA 1ZKGA 4IPAA 2O8KA 3LA3A 3P9KA 4G12A 4QPQA 2VJ5A 1DP7P 2DQRA 3EETA 2L9SA 3P5JA 3C3WA 2PI0A 2VUMJ 1A31A 3QAHA 1RR7A 3HHGA 4IHTA 2DK8A 2NVYJ 2X85A 2VOOA 1S8NA 1MH3A 1MH4A 4AVPA 1P9QC 2DFHA 1K83J 5M3MJ 3CLOA 3LAPA 3F8FA 1WKMA 2DDAA 2DK5A 1HKQA 2PMZA 2X51A 3MKLA 4PK4A 3ABMH 2VBZA 3ROUA 1VQ7I 1BOAA 1B4AA 4ENKA 3HOYJ 3S1MJ 1R5ID 4Y4RA 3TKYA 1FYLA 3LSTA 1YITI 4ESBA 1GV2A 2WC2A 5FKLA 1YIJI 4FASD 1FOWA 4RGUA 3MWMA 4B47A 3WTUC 3WHCA 4D9JA 3FF5A 1BC8C 1ETWA 2X6YA 3ZXSA 3K70C 1VQPI 4BL0B 1ERDA 3R60A 4U0WA 3DTEA 1SFKA 2LDUA 3HEFA 4XLPF 2A5YB 3SEZA 4RDUA 2V6CA 1B9NA 2RGVA 1VI0A 2ECBA 2IJLA 2E35A 1JHHA 4XQFA 1XN7A 1TZLA 3Q9VA 4U88A 3QODA 3FIWA 2DMTA 1ZLKA 4PFOA 1ONVA 2GAUA 4LIUA 4MFDA 2LC2A 1YIOA 4IHXA 2K5CA 3IRQA 3JCUC 4U7BA 3PJRA 1RKWA 3HUGB 4A3JJ 2MH2A 1HF0A 4JOMA 1YQAA 3VODA 2F48A 2JK3A 4QIWN 3HG9A 2KISA 2QLZA 4Q48A 3WE3A 3DKWA 4E4HA 1JE8A 2MC4A 3GUDA 4EJOA 3LL7A 2O5RA 4M72A 4G6TB 4ABZA 1L0OC 1V4RA 1N77A 2EV6A 3NWTA 4DBQA 3S2HJ 3GFIA 2FNAA 1MZBA 3RCOA 3FKIJ 3PIOF 4M6XA 3S3OA 2I10A 1F9NA 2DODA 3BJ6A 2ECCA 2VE9A 3DTKA 1OR7C 5EGOA 2ZSIB 3KZIC 4BBSJ 1ZRDA 1EKEA 2PX9A 1TNTA 5FGMA 5ICCA 3D0SA 4UVBA 1X58A 1T08B 4LFUA 5H20A 5KVRA 1XB4A 4G6QA 5FRMA 4IOAF 3ZQ7A 3K0LA 1D5YA 1IZ1A 4UB6C 1IDZA 1EF4A 3K4MA 2E5NA 4XM3A 2PBIA 2EZHA 1W0UA 1Q1HA 5HS7A 1IXSB 3WGHA 2ZCWA 1SFOJ 5E3OA 2ID6A 3KPHA 4S0HB 1KU9A 2LRDA 2LREA 1T2KA 1IN4A 2F5DA 5GP9A 2V26A 3OYNA 1RR8C 3QWLA 2FBIA 1SFXA 4KIBA 3ZQIA 3PSIA 2L7MP 5F1JA 1G3TA 3ERED 2NS0A 2ESHA 4N9HA 2E34A 4BHCA 1ZG5A 1FOYA 4A3CJ 2XIGA 4PDKA 2A68F 3R6SA 4WXHA 2IT0A 1J5YA 1XG1A 4BHBA 4HQMA 3HGYA 2YX7A 4H4KC 4NQWA 1ZLJA 2KJCA 1WWXA 2DA7A 4M3FA 3F23A 3SFZA 3IC7A 3L2VA 4KNYA 2O8XA 4RBOA 2ELJA 4BYYA 3QP5A 3TP0A 2ZJRF 2D45A 3BTIA 1WPKA 2KRFA 2DTZA 2W00A 5CVJA 4ASNA 1IDYA 1TT0A 1W4MA 1KQ8A 2DN0A 1XD7A 2K3FA 4A12A 4U0VA 5JVTA 3HSEA 1DQUA 2E36A 4NDLA 1YS7A 4NQWB 4XBFA 5K7HA 5C4JJ 1WJEA 2BEOA 5FD6A 2OUMA 1A5JA 5LGNA 3Q3SA 2QF7A 2I5UA 3GEZA 2XAQA 3GW2A 2KRHA 1F43A 3VDXA 3G73A 1M1EB 2QSFX 4A0YA 2L3DA 2STWA 1ITYA 4I99C 3BT9A 2HWVA 3HBLA 2CG4A 3BWGA 3SDGA 3RJPA 1LE8A 3IH2A 4IJAA 2M2EA 4AUXA 5EEHA 2L2OA 1HW2A 2M0MA 1TLHB 4IOCF 2G7UA 2FA5A 1W1WE 1TQPA 3E6DA 3CDLA 2LKXA 6PAXA 3EDPA 3CCRI 2ELKA 5J1UA 4IHWA 5E3MA 4PUSA 4A0ZA 2RDPA 2WTEA 3S3MA 4E7LA 4BEHB 1P92A 4JP0A 2CV1A 3F8NA 3FMQA 3D5SC 1YW9A 1IUYA 4XSZF 2JUGA 2M7AA 2HXOA 4E70A 3FBIB 3AG1H 3BOQA 4ZDOA 3Q0UA 1B59A 2EJRA 4Y13A 3JRCA 3ABUA 2O7OA 1W5TA 3I0TA 1QZEA 1HQCA 1ENHA 4ENJA 2XHKA 5DM6F 2RC4A 1BM9A 2Y0MA 2IVMA 2R5ZA 1D0YA 5HNHA 5FO5A 2EIJH 3ABKH 3CUOA 3K69A 3VOEA 3OS0A 1YRNA 4HDVA 2HTSA 5FROA 1SMYF 2ICWG 2HVRA 3BCBA 2JA7J 5FKNA 2MA3A 3CC4I 3IWFA 1YG2A 4HV6A 3CCYA 1OCZH 3LSPA 1ZQ3P 5ILUA 5K5QA 3AFHA 4A69C 3DQVC 2FXAA 3FXQA 4G8XA 4LG3A 5DV5A 2HQAA 4LLGF 2K9LA 2R5ZB 2Y2ZA 3C2GA 4M3GA 4V2GA 3OSGA 1YRNB 5F0HA 2Z9OA 3K4JA 2QSGX 1MMSA 2DA5A 1X1BA 3EYIA 3CJNA 2EIMH 4FCYA 1WJ5A 3QYBA 3KP3A 3E5UA 2IS4A 3OYLA 2O3FA 2PG4A 3CUQB 3MZYA 3G6EI 1GHCA 1X1DA 5B1AH 2JRTA 2DQLA 2LY9A 4IXAA 1MBHA 2HYFA 3S1RJ 2LYCA 3JREA 1U5TC 3IHUA 5L3FA 2D1VA 1LFBA 3IP4B 4CDGA 1I27A 1OFCX 1WQ2A 2V7FA 4C3IJ 4OIQF 2MC3A 4AIDA 1MMDA 3CP8A 2WBMA 4C3HJ 5D5WB 5ICEA 3MKYB 1R71A 2H8RA 1O7FA 4DJAA 3S2DJ 3K4KA 1XSVA 2HFHA 2JTVA 3TBIA 3TO7A 2ZO4A 4EGZA 2JA8J 4MO7A 3S17J 1J09A 3S93A 3DKYA 5EZGA 2GA1A 5BPIA 3S3NA 1FWZA 2ISZA 3H1CA 2HOSA 2PJRA 3Q0VA 1T39A 2HPIA 4NB5A 3LOCA 1XDUA 2M1BA 3LNQA 1YJWI 1ULYA 2ZKZA 4KFCA 4ZYAA 1WJDA 1R23A 3GTKJ 2C6YA 1HW1A 1YHQI 1FNNA 1OLTA 1R1VA 3RKQA 3V8JA 2QUFA 1QZYA 1DGRM 4M9SA 3S16J 2UXNA 4UUSB 2IGNA 3O8GA 1ETVA 1P6RA 1BA5A 2BY2A 2FMLA 3X2QH 4YIIA 2EFNA 3LA7A 2R7WA 1IG7A 3G1OA 4Y3OA 1MBEA 2O0YA 2M5WA 1OQYA 3CUQC 1CQTA 3IKVA 2DTRA 4D5FA 3WTVC 2MW8A 2WWYA 1SC7A 1USSA 2CFOA 1FLIA 1TWGJ 1RKTA 4I02A 1BN5A 1MJ9A 1WJAA 2XGXA 2M0CA 3PNVA 1KYWA 3VFZA 1Y56A 4OOIA 2E71A 4DBRA 1VNDA 2P6TA 1XTAA 2KL4A 2O61A 2XAHA 4L9JA 3GLLA 3K2AA 2V1XA 3T8TA 3TO6A 2B9SA 2JA6J 2VONA 2XKOA 1UHWA 4B8XA 4RB3C 3I55I 2HOTA 1NK2P 2LF7A 1DU6A 5J6XA 1KU7A 2BYVE 1BIAA 1EH8A 2WAEA 3F8CA 2BV6A 3PM1A 4M3BA 5FD5A 1TW3A 2WAQN 4HNVA 3MEXA 4CZCA 2ZFUA 2GBYA 4HSTA 2QENA 1KZHA 1XMAA 5JLXA 5A2QK 3FXLA 2K9NA 4Y33A 3PFIA 2HTJA 2GM4A 2E1OA 1HSTA 1TT5B 1REPC 3IWZA 4GXOA 2Y30A 2P4WA 4BQOA 3J81K 4DYQA 3L00A 2CGPA 5DD8A 1AWCA 2OTJI 1YFHA 4BAYA 1B8IA 3K4CA 2PMZN 2EZKA 5J1RA 5D5UB 2KMUA 4WF2A 3PNTA 4XLAA 1T38A 5FLXK 2CMPA 3F6OA 3NWSA 3K4LA 3PL8A 2I8DA 3SZPA 2ME6A 4XR6A 3SYTA 5BNGA 5FLMJ 5KHDA 2A05A 3K70D 5C44J 2MLKA 1P7JA 4XN3A 4ZZDA 1R6RA 2Y9YA 3F9KA 4OMZA 1Z91A 1FMVA 4BY7J 1B8IB 1ZARA 1QNTA 4RLFA 5LRRA 5M5YJ 2L9NA 4OIOF 3WHBA 2Z5UA 3M07A 2CUJA 3LMMA 1RZ4A 2PJPA 2HXIA 2TRTA 5J40A 2DA4A 2NVTJ 1Z6RA 1IUFA 1S29A 2Z33A 5JVGF 3RKYA 1BI2A 3TMOA 4XLHA 2LOOA 3QPSA 2B0LA 3HYIA 2VQGA 4II2A 2DOAA 3KYLA 2R7VA 4Q47A 3JRDA 1R7JA 5E1XA 1BI0A 3KP5A 4XICA 1GUUA 4XKWA 1BBYA 3OYMA 3OYIA 2FNPA 4FX0A 4XKBA 3KEQA 3L2UA 5F08A 2V9VA 2R7XA 2W25A 2M9HA 4V2FA 2DLLA 2HDWA 2MGQA 1YI2I 4KIGA 4L5IA 1OCRH 1FY7A 2HYJA 4DYCA 1AA7A 1WJCA 1XC5A 2COMA 2M7BA 1HOMA 3QPTA 3GFLA 3GTJJ 2P6SA 1E3PA 3HXLA 3I59A 3OIPA 2PFBA 5HNFA 1PP7U 3RTRA 2IA2A 3RI4A 4HG2A 4HBLA 3MMYB 4RA2A 2IRFG 5GPAA 2DDBA 3WTTC 3ABTA 5KAIC 4EEFG 2QA4I 1X19A 3GVAA 1U8RA 2EIKH 1D1BA 3V8KA 5IP9J 1FX7A 5CVVA 2BVLA 3KEYA 3I59B 5BPDA 1IXCA 1MMAA 5E1ZB 2XAGA 2Z16A 2CQKA 4IX7A 4HX4A 4AD9A 2VJ4A 1QPMA 2DO7A 2P5VA 2VT2A 5KCMA 2L9VA 3K1PA 3DEWA 2CS3A 4ZYHA 2MD5A 3GMEA 5FKOA 4V19K 3H9QA 4HLYA 2VQCA 2ZMEA 2ZJPF 2V79A 3ZQHA 1AHDP 5D6EA 1Q1VA 4L9NA 4DIQA 2L54A 4EVIA 1L3LA 1R1TA 1BW6A 1WJBA 4E6KG 3U21A 1VQ9I 2WY8Q 2RREA 1ETXA 2BY1A 4HW0A 1K6YA 1O3SA 2ME0A 3HRTA 4LB5A
chains in the Genus database with same CATH topology
3OOPA 1Z6TA 2ZMEB 3ZN0A 3I5UA 4WCGA 1LDKB 4B09A 3WTZA 3TOBA 1P4XA 3C7JA 2JPBA 3KLOA 1E17A 4RGSA 2IW5A 3GWZA 4ETSA 3R61A 5ICGA 1SAXA 3V4GA 1VTNC 5L3EA 2W84A 1WRJA 3V7RA 1XGOA 3DXJF 1G3WA 1EH7A 4A5MA 4KIFA 3IKTA 3BJOA 3B02A 3F8MA 3R4KA 1DDNA 2JZYA 3OV8A 1IN7A 1P2FA 2FRHA 1ZREA 3GFMA 4FHTA 3L2CA 3E6CC 4GGGA 1U6GA 4TV7A 2RNJA 4L5JA 1ON1A 3ECHA 2O03A 3JTHA 3TGNA 1OR7A 1BC7C 3HTSB 5L3DA 4LK1F 1IN5A 1O3RA 2CFXA 4P5OA 1O57A 2JSCA 3BDDA 1HSJA 5BS6A 4IRGA 1R22A 3KEOA 1D5VA 3JSOA 3BP8A 1K6OA 2NNYA 4BNCA 3E5XA 3GLXA 4IRHA 3HUGA 4IF4A 4QWQA 2XROA 3NEUA 4HDUA 1FT9A 1S7AA 2L02A 4HQEA 4F7ZA 3FMSA 2A61A 1Z1DA 3CTAA 3NRVA 3QPHA 4O6JA 5D5VB 4U0YA 3K1NA 2IA1A 1IW7F 2OU2A 1EH6A 5DD4A 3F22A 4M9XA 1ZGJA 1ZYRF 3V8LA 2ZBKA 2RKHA 4LJZF 1J9IA 1C0WA 1ZH5A 4UXNA 2Z99A 1U3EM 4M74A 2KIUA 3IRRA 2BGCA 4HAMA 2DU9A 1A04A 2H09A 5BMZA 3NQOA 2F5CA 2HEOA 3I54A 1MGTA 1QQIA 4N0BA 4G7OF 3KZYA 3CDHA 5JR3A 4CO8A 4D0PA 3WU0A 4EV0A 1KU2A 2HYGD 1J59A 2RQPA 5K5RA 4L18B 3GXOA 2VC0A 1FZPB 4ZH4F 1J0RA 1B6AA 3F72A 1MDMA 3F21A 3LA2A 2DI3A 2H6BA 2CO5A 4YIFA 1KQ0A 2ESNA 4MEXF 3EYYA 4UV9A 1MDMB 3LFKA 2XASA 3T5XA 3F3XA 1E2XA 1D8KA 4OIPF 1ZRFA 4NHJA 5JHUA 2NNNA 1B9MA 4EJWA 2A6HF 3R0JA 4ESJA 2H27A 1U5TA 4ENMA 3TO9A 2GQQA 1SD6A 4YG2F 1GXQA 2K27A 5K5OA 1JXSA 4IRIA 4LMYA 1FP1D 3TQNA 1XGNA 2BBYA 2IP2A 4KMFA 3L7WA 1U5TB 1D3YA 2E1CA 5LGUA 4PCQA 3HIFA 4UVAA 1T0FA 4RAYA 3LQQA 3D5LA 2GZWA 2WV0A 1SFUA 2CW0F 3GYHX 1XCBA 3WGGA 1FBSA 2PMUA 3ZMUA 5JFRA 2M45A 2E1NA 2STTA 1IRFA 4MNUA 2QM3A 5ILSA 5DCFA 3CUQA 3QRFF 1S7OA 1H0MA 5L3CA 1QO0D 2VXZA 1RI7A 2K4JA 2K02A 2ISYA 4LLLA 1HKSA 2K4BA 1QGPA 2FF4A 3KP6A 4EMSA 1W7PB 1P4AA 2EA4A 4M9ZA 5FFXA 2M87A 4ZYDA 1Z7UA 4O3MA 5DEQA 2Q8KA 1YYVA 4KDPA 2DT5A 1DPUA 3WG9A 1I5ZA 4PGGA 5IT3A 1SD4A 5KK1A 2XRNA 4UVCA 3KP4A 3RIRA 4IHSA 3WTSC 4ZYGA 3KFWX 3BZ6A 3C18A 3FZVA 4A6EA 3T1BA 1FBQA 3KE2A 3QU6A 1GXPA 2EFPA 1KA8A 3CO7C 2FSWA 5AIQA 4I0BA 5D6FA 2G9WA 5AONA 4HX8A 1F5TA 4KA4A 3HRMA 3JTGA 5HLIA 5CVRA 2LSOA 3JW4A 3V7SA 3ZMVA 2FBHA 2EV5A 4RS8A 3H92A 1H9TA 1CF7A 4OINF 3KLNA 4HV5A 5HDGA 1FPQA 1V3FA 2H94A 5E1WA 2XAFA 2DW4A 1OYYA 4LG0B 1J7KA 1O3TA 1CF7B 2FU4A 2VOPA 1HKTA 3ULQB 4I2OA 1XSXA 5IT9Z 4R8HA 4A2UA 4L0ZB 1IXRC 4HZFA 1LEBA 3EUHA 2P7CB 3E3VA 2ZFWA 3L9FA 2Q0OA 2G7HA 4P9FA 4LGWA 4KN7X 3QP6A 3HTUA 3SHFA 2BE5F 3I64A 5F64A 3K2ZA 1R5HA 1Z9CA 2TDXA 2MH9A 3PQJA 2PLYA 3DF8A 4G9YA 1SMTA 5CVIA 3PQKA 3W6JB 2XAJA 1P4WA 3KZZA 4L9VA 2VBXA 3ZP5A 1QZZA 2VBYA 3J80Z 2A3SA 3I53A 4YFKF 3N4MA 3CO6C 2PEXA 3BY6A 2A69F 3BJAA 3GO5A 2HQNA 1EV7A 1XDSA 4P9UA 3S2WA 4CZZA 4HOBA 4S04A 2YU3A 2D1HA 2HOEA 3BPVA 2GWRA 2EFOA 2HDCA 2Y75A 3ZMZA 3P9IA 1J2XA 2OAZA 1GVJA 5ERIA 3F8BA 4FX4A 1SFEA 2P5KA 1UB9A 2QYOA 4ESFA 4HX7A 5LBQA 1YW8A 4JK1X 4BXUA 1ZGAA 4ZYEA 5DUIA 3M8FA 2P8TA 1S3JA 2QVOA 5L3BA 2VODA 2HR3A 5F6FA 4G94A 4CHUA 4UV8A 1YTYA 2HKXA 1IN8A 2PQ8A 3RKWA 1F1ZA 3WGIA 1HW5A 3HOSA 5LEJA 1JHFA 3DP7A 2W85A 1LEAA 2OQRA 1BI1A 4EM0B 1R58A 3DV8A 5HLHA 4G7HF 1O7LA 1TW2A 3ELKA 1FSHA 3MFKA 1K79A 4RB1A 3FX3A 3GFJA 2MLGA 5JI6A 3ECOA 4MGRA 2M8EA 2F5FA 2DBBA 5HS8A 2ETHA 3P7NA 4KT5C 1IRGA 1G3YA 1FBUA 4EQQA 4MTDA 1LJ9A 3WODF 4GYGA 3ML6A 2D2WA 4WXDA 3E97A 5F1RA 2W24A 2X0LA 3M9AA 4AIKA 5HDKA 2MBFA 1RNLA 1G6NA 4G7ZF 1G4DA 5D8KB 3J81Z 1RUOA 1B1BA 4AIJA 2E7WA 2JT1A 2GA2A 2EB7A 1SD7A 2VC1A 1IN6A 1MKMA 5HVQC 2KIFA 3TDZC 5LHHA 1I1GA 2QQ9A 1KYZA 2QWWA 3I4PA 1OYWA 3R0AA 4ZZLA 2X4HA 3SZTA 3WTWC 3F6VA 2K86A 3K9TA 2R7DA 2YSRA 4A5NA 1AOYA 1FSEA 3IL2A 2P5LC 1O3QA 2CSOA 1JGSA 2F2EA 4KMUX 1YLFA 3U2RA 1U78A 4YFXF 3FWEA 4XRFA 4N9IA 3MZHA 1SD5A 2IPQX 3DEUA 3P9CA 4GCVA 4Z2YA 2LKPA 2Y48A 4AWXB 3GF2A 2EV0A 3BPXA 3RYRA 3ZPLA 1KGSA 4A6DA 1LDJA 1BIBA 2P7VB 4IVNA 1W7PD 2F5EA 1I1SA 4DQ2A 2FBKA 4ON0A 3RPUA 4FT8A 3FM3A 3W6KB 3I71A 3E6BA 5D4SA 3BROA 2IA0A 2J5OA 2PMHA 1PP8F 2GXGA 3M1EA 5AIPA 3C1DA 2ZNZA 4EM1A 1YO5C 2XV4S 4BQAA 5TRDA 5BOXA 2FEZA 4O5VA 2HQRA 1FYKA 5J8FA 2VE8A 3HRSA 4EM2A 1XMKA 1STZA 3TDUC 4U7DA 1HBXG 4Q5SF 2HS5A 1LVAA 5FB2A 1WI9A 3WE2A 4ENNA 3LQRA 2R3SA 4OIRF 3TOAA 2QQAA 1DUXC 5HOOA 2JPCA 2H6CA 2Q2EA 1FOKA 5LHGA 1ODDA 4P96A 5IT9K 3JAMZ 4RAZA 1G3SA 3MQ0A 1KU3A 4I01A 5E8GA 3HSFA 3U1DA 2V1UA 3KP2A 2NAZA 4P55A 2V1DA 3RYPA 1IAWA 1D8JA 3Q9SA 2QZ8A 3O6BB 2W57A 4KICA 3LWFA 2L4MA 1RIOH 2FQ3A 2QQBA 3EQLF 1MJAA 3RKXA 4HYEA 2LNBA 4I98B 5D8LB 2UZKA 3HOTA 1U2WA 4LB6B 4EJTA 2A6EF 1ZHFA 2QBYA 5D4RA 1H9GA 3GZ5A 1MD0A 2EFWA 3FMRA 1R36A 1W7PA 5LLQA 2ZXJA 4EGYA 2E7XA 3QU3A 2OD5A 2YPRA 3J80K 3H3UA 4XLNF 2QBYB 1T98A 2HGCA 2RVCA 4EJVA 3L09A 2EWNA 2VT3A 4RB0A 1K7AA 3J7AO 1F4KA 2KJBA 5LHIA 5K1YA 4LK0F 1XCVA 2CYYA 4RB2C 1OYIA 4CYDA 5BQTA 1TNSA 4KUMA 4XSXF 4MEYF 4R1HA 4EJUA 5L3GA 1S6LA 3ZMDA 5CLSA 5E18F 3SXYA 3M7GA 5TJJA 3HRUA 3DPTA 5J8CA 3MAJA 4LD5A 4GO1A 1LNWA 1J75A 3VB2A 3SQNA 4I7HA 1OKRA 2GIVA 1BJAA 3K1MA 5D5XB 4L9TA 3DFGA 4OMYA 2FE3A 4RGXA 4WK8F 1DPRA 3AAFA 1Y0UA 2A07F 3FXUA 1WSUA 4LG0A 3B73A 3JSPA 5H6QA 4I0AA 5CVUA 4UUVA 4M71A 2ACJA 1XSDA 2LF8A 5CJ9A 4KN4X 3M8EA 2K7LA 2DPUA 5HDNA 5EEGA 1BI3A 2UXXA 5E20A 1PUEE 2AXLA 4UNOA 5E17F 5FFZA 4HF2A 1RUNA 2NYXA 4AIHA 2O6GE 2NRAC 4MHGA 2GXBA 1TQMA 4R79A 1FC3A 4HF1A 2DFIA 3RPQA 2HZTA 4L0YB 5HS9A 2ELHA 1HXDA 3KP7A 1ZN2A 3O2PE 2OA4A 4OU0A 4A0XA 1KQ9A 4CICA 3T0YA 3GX4X 5DUKA 3WTXC 5H6RA 4BHPA 2UWMA 2VN2A 4MTEA 4H0EA 1QBJA 2KIMA 3E6MA 3RDIA 4RGRA 2EA2A 4CGZA 1TTYA 2HKOA 4MQVA 3REOA 1MJBA 1Z05A 4HF0A 2RN7A 1R1UA 1TBXA 1NHAA 4BH9A 2ADUA 1YS6A 1LQ1A 2L4AA 2XUBA 3I58A 1UFMA 4CXFA 2EFQA 5ED4A 5DDGA 2EK5A 4JQFA 2ZJ2A 4K2EA 1X3UA 1UHMA 3ZMTA 3U9GA 3ZN1A 2FOKA 1ZRCA 3FXRA 2OQGA 3LAJA 4G6DA 1ON2A 1XGMA 2CWEA 1UCRA 4Q4ZF 3O3KA 1ZAOA 2R7FA 2RV8A 5LGTA 1PDNC 2AS5F 4S05A 3H3ZA 1W5SA 1XGSA 3N97A 3FM5A 2KKOA 3V7CA 4HA8A 3WU1B 1I6XA 3VEPA 3ZMSA 4WWCA 1K78A 5ICFA 3G3ZA 4YFNF 2L01A 4M6YA 3DPLC 4UHTA 1ZG1A 4GYIA 4I09A 2YR2A 5DYMA 1K78B 1R00A 1OPCA 3ISPA 1R5GA 2ZNYA 3COAC 3HSRA 5E8IA 4PZJA 4Y15A 3WTYC 2XKPA 1ZG3A 1OMIA 5CYVA 2PN6A 3QOPA 4WX9A 4LLNA 5ILVA 1LB2A 2DPDA 1T6SA 4PGHA 1FP2A 3GZ6A 3MCZA 3E5QA 2VBWA 4JBAA 2J5PA 1FYMA 5HLGA 4M73A 3HHHA 4KYWA 5LEKA 2XVCA 4DNCA 4HLXA 2OBPA 2OZUA 2Z3YA 4QLCU 5DCMA 5A2QZ 1YW7A 3JAMK 2YX4A 1TQIA 3KETA 2M30A 4Y17A 5LRSA 1USTA 4MQ9F 3FHZA 2DAOA 1LDDA 3KCCA 5DCMB 1IF1A 1CGPA 3T8RA 5FLXZ 3Q5FA 2FMYA 4WXCA 2OZ6A 4IPAA 3LA3A 3P9KA 1DP7P 2DQRA 3EETA 2PI0A 3C3WA 3QAHA 3HHGA 4IHTA 2DK8A 2VOOA 1S8NA 4AVPA 3CLOA 3LAPA 3F8FA 1WKMA 2DK5A 1HKQA 2VBZA 3ROUA 1BOAA 1B4AA 4ENKA 3TKYA 1FYLA 3LSTA 4ESBA 2WC2A 4RGUA 3MWMA 3WTUC 3FF5A 1BC8C 3R60A 4U0WA 2LDUA 4XLPF 2A5YB 1B9NA 2V6CA 2RGVA 2IJLA 1JHHA 1XN7A 3Q9VA 4U88A 1ZLKA 1ONVA 2GAUA 1YIOA 3IRQA 4U7BA 2MH2A 1YQAA 3VODA 2QLZA 4Q48A 3WE3A 3DKWA 1JE8A 3GUDA 4EJOA 4M72A 1L0OC 1V4RA 2EV6A 3GFIA 2FNAA 1MZBA 4M6XA 1F9NA 3BJ6A 2VE9A 1ZRDA 1TNTA 5FGMA 5ICCA 3D0SA 4UVBA 4LFUA 5H20A 5KVRA 1XB4A 4G6QA 3ZQ7A 3K0LA 1IZ1A 2PBIA 1Q1HA 5HS7A 1IXSB 3WGHA 2ZCWA 1KU9A 1T2KA 1IN4A 2F5DA 2FBIA 1SFXA 4KIBA 1G3TA 3ERED 2NS0A 2ESHA 4N9HA 4BHCA 1ZG5A 2XIGA 4PDKA 2A68F 3R6SA 4WXHA 2IT0A 1J5YA 4BHBA 4HQMA 2YX7A 4NQWA 1ZLJA 2KJCA 1WWXA 3F23A 3SFZA 3IC7A 4KNYA 2O8XA 4BYYA 2D45A 3QP5A 2KRFA 5CVJA 4ASNA 1KQ8A 1W4MA 1XD7A 4A12A 4U0VA 5JVTA 3HSEA 1YS7A 4XBFA 2BEOA 5FD6A 5LGNA 3GEZA 2XAQA 3GW2A 3G73A 4A0YA 2L3DA 2STWA 2HWVA 2CG4A 3BWGA 3RJPA 4IJAA 5EEHA 1HW2A 1TLHB 2G7UA 2FA5A 1TQPA 3E6DA 6PAXA 3EDPA 4A0ZA 2RDPA 2WTEA 1P92A 3F8NA 3FMQA 1YW9A 1IUYA 4XSZF 4E70A 3BOQA 1B59A 2EJRA 4Y13A 3ABUA 1W5TA 3I0TA 1HQCA 4ENJA 2XHKA 2RC4A 1BM9A 2Y0MA 2IVMA 5FO5A 3CUOA 3VOEA 3K69A 4HDVA 2HTSA 1SMYF 2MA3A 3IWFA 1YG2A 4HV6A 5ILUA 5K5QA 3DQVC 2FXAA 3FXQA 4G8XA 5DV5A 4LLGF 2Z9OA 3EYIA 3CJNA 3KP3A 3E5UA 2O3FA 2PG4A 3CUQB 3MZYA 1GHCA 2JRTA 2DQLA 4IXAA 2HYFA 1U5TC 3IHUA 5L3FA 2D1VA 4CDGA 1I27A 1WQ2A 4OIQF 2MC3A 5D5WB 5ICEA 1O7FA 1XSVA 2HFHA 2JTVA 3TO7A 4EGZA 2ZO4A 2GA1A 5BPIA 2ISZA 1FWZA 1T39A 4NB5A 1XDUA 2M1BA 1ULYA 2ZKZA 4KFCA 1R23A 2C6YA 1HW1A 1FNNA 1R1VA 3V8JA 2QUFA 1QZYA 4M9SA 2UXNA 1P6RA 2FMLA 4YIIA 2EFNA 3LA7A 2O0YA 2M5WA 3CUQC 3IKVA 2DTRA 3WTVC 2WWYA 1USSA 1FLIA 4I02A 1BN5A 1MJ9A 2XGXA 3VFZA 1KYWA 4OOIA 2P6TA 2O61A 2XAHA 4L9JA 2V1XA 3T8TA 3TO6A 2VONA 2XKOA 1UHWA 4B8XA 4RB3C 2LF7A 5J6XA 1KU7A 2BYVE 1BIAA 1EH8A 3F8CA 2BV6A 5FD5A 1TW3A 3MEXA 2QENA 1XMAA 5A2QK 3PFIA 2HTJA 1HSTA 1REPC 3IWZA 4GXOA 2P4WA 3J81K 3L00A 2CGPA 5DD8A 1AWCA 1YFHA 4BAYA 5D5UB 4WF2A 1T38A 5FLXK 3F6OA 3SZPA 2MLKA 4ZZDA 4OMZA 1Z91A 1ZARA 1QNTA 5LRRA 4OIOF 2Z5UA 1RZ4A 2PJPA 1Z6RA 1S29A 2Z33A 3RKYA 1BI2A 2B0LA 3HYIA 4Q47A 1R7JA 5E1XA 1BI0A 3KP5A 1BBYA 2FNPA 4FX0A 3KEQA 2V9VA 2W25A 2DLLA 4KIGA 4L5IA 1FY7A 2COMA 3QPTA 3GFLA 2P6SA 3I59A 1PP7U 2PFBA 3RTRA 2IA2A 3RI4A 4HBLA 2IRFG 3WTTC 3ABTA 3GVAA 1U8RA 3V8KA 1FX7A 5CVVA 3I59B 5BPDA 1IXCA 5E1ZB 2XAGA 2CQKA 4HX4A 4AD9A 1QPMA 2DO7A 2P5VA 2VT2A 3K1PA 4ZYHA 2MD5A 4HLYA 2ZMEA 2V79A 5D6EA 4L9NA 2L54A 4EVIA 1L3LA 1R1TA 4HW0A 1O3SA 3HRTA 4LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOP A;  1Z6T A;  2ZME B;  3ZN0 A;  3I5U A;  4WCG A;  1LDK B;  4B09 A;  3WTZ A;  3TOB A;  1P4X A;  3C7J A;  2JPB A;  3KLO A;  1E17 A;  4RGS A;  2IW5 A;  3GWZ A;  4ETS A;  3R61 A;  5ICG A;  1SAX A;  3V4G A;  1VTN C;  5L3E A;  2W84 A;  1WRJ A;  3V7R A;  1XGO A;  3DXJ F;  1G3W A;  1EH7 A;  4A5M A;  4KIF A;  3IKT A;  3BJO A;  3B02 A;  3F8M A;  3R4K A;  1DDN A;  2JZY A;  3OV8 A;  1IN7 A;  1P2F A;  2FRH A;  1ZRE A;  3GFM A;  4FHT A;  3L2C A;  3E6C C;  4GGG A;  1U6G A;  4TV7 A;  2RNJ A;  4L5J A;  1ON1 A;  3ECH A;  2O03 A;  3JTH A;  3TGN A;  1OR7 A;  1BC7 C;  3HTS B;  5L3D A;  4LK1 F;  1IN5 A;  1O3R A;  2CFX A;  4P5O A;  1O57 A;  2JSC A;  3BDD A;  1HSJ A;  5BS6 A;  4IRG A;  1R22 A;  3KEO A;  1D5V A;  3JSO A;  3BP8 A;  1K6O A;  2NNY A;  4BNC A;  3E5X A;  3GLX A;  4IRH A;  3HUG A;  4IF4 A;  4QWQ A;  2XRO A;  3NEU A;  4HDU A;  1FT9 A;  1S7A A;  2L02 A;  4HQE A;  4F7Z A;  3FMS A;  2A61 A;  1Z1D A;  3CTA A;  3NRV A;  3QPH A;  4O6J A;  5D5V B;  4U0Y A;  3K1N A;  2IA1 A;  1IW7 F;  2OU2 A;  1EH6 A;  5DD4 A;  3F22 A;  4M9X A;  1ZGJ A;  1ZYR F;  3V8L A;  2ZBK A;  2RKH A;  4LJZ F;  1J9I A;  1C0W A;  1ZH5 A;  4UXN A;  2Z99 A;  1U3E M;  4M74 A;  2KIU A;  3IRR A;  2BGC A;  4HAM A;  2DU9 A;  1A04 A;  2H09 A;  5BMZ A;  3NQO A;  2F5C A;  2HEO A;  3I54 A;  1MGT A;  1QQI A;  4N0B A;  4G7O F;  3KZY A;  3CDH A;  5JR3 A;  4CO8 A;  4D0P A;  3WU0 A;  4EV0 A;  1KU2 A;  2HYG D;  1J59 A;  2RQP A;  5K5R A;  4L18 B;  3GXO A;  2VC0 A;  1FZP B;  4ZH4 F;  1J0R A;  1B6A A;  3F72 A;  1MDM A;  3F21 A;  3LA2 A;  2DI3 A;  2H6B A;  2CO5 A;  4YIF A;  1KQ0 A;  2ESN A;  4MEX F;  3EYY A;  4UV9 A;  1MDM B;  3LFK A;  2XAS A;  3T5X A;  3F3X A;  1E2X A;  1D8K A;  4OIP F;  1ZRF A;  4NHJ A;  5JHU A;  2NNN A;  1B9M A;  4EJW A;  2A6H F;  3R0J A;  4ESJ A;  2H27 A;  1U5T A;  4ENM A;  3TO9 A;  2GQQ A;  1SD6 A;  4YG2 F;  1GXQ A;  2K27 A;  5K5O A;  1JXS A;  4IRI A;  4LMY A;  1FP1 D;  3TQN A;  1XGN A;  2BBY A;  2IP2 A;  4KMF A;  3L7W A;  1U5T B;  1D3Y A;  2E1C A;  5LGU A;  4PCQ A;  3HIF A;  4UVA A;  1T0F A;  4RAY A;  3LQQ A;  3D5L A;  2GZW A;  2WV0 A;  1SFU A;  2CW0 F;  3GYH X;  1XCB A;  3WGG A;  1FBS A;  2PMU A;  3ZMU A;  5JFR A;  2M45 A;  2E1N A;  2STT A;  1IRF A;  4MNU A;  2QM3 A;  5ILS A;  5DCF A;  3CUQ A;  3QRF F;  1S7O A;  1H0M A;  5L3C A;  1QO0 D;  2VXZ A;  1RI7 A;  2K4J A;  2K02 A;  2ISY A;  4LLL A;  1HKS A;  2K4B A;  1QGP A;  2FF4 A;  3KP6 A;  4EMS A;  1W7P B;  1P4A A;  2EA4 A;  4M9Z A;  5FFX A;  2M87 A;  4ZYD A;  1Z7U A;  4O3M A;  5DEQ A;  2Q8K A;  1YYV A;  4KDP A;  2DT5 A;  1DPU A;  3WG9 A;  1I5Z A;  4PGG A;  5IT3 A;  1SD4 A;  5KK1 A;  2XRN A;  4UVC A;  3KP4 A;  3RIR A;  4IHS A;  3WTS C;  4ZYG A;  3KFW X;  3BZ6 A;  3C18 A;  3FZV A;  4A6E A;  3T1B A;  1FBQ A;  3KE2 A;  3QU6 A;  1GXP A;  2EFP A;  1KA8 A;  3CO7 C;  2FSW A;  5AIQ A;  4I0B A;  5D6F A;  2G9W A;  5AON A;  4HX8 A;  1F5T A;  4KA4 A;  3HRM A;  3JTG A;  5HLI A;  5CVR A;  2LSO A;  3JW4 A;  3V7S A;  3ZMV A;  2FBH A;  2EV5 A;  4RS8 A;  3H92 A;  1H9T A;  1CF7 A;  4OIN F;  3KLN A;  4HV5 A;  5HDG A;  1FPQ A;  1V3F A;  2H94 A;  5E1W A;  2XAF A;  2DW4 A;  1OYY A;  4LG0 B;  1J7K A;  1O3T A;  1CF7 B;  2FU4 A;  2VOP A;  1HKT A;  3ULQ B;  4I2O A;  1XSX A;  5IT9 Z;  4R8H A;  4A2U A;  4L0Z B;  1IXR C;  4HZF A;  1LEB A;  3EUH A;  2P7C B;  3E3V A;  2ZFW A;  3L9F A;  2Q0O A;  2G7H A;  4P9F A;  4LGW A;  4KN7 X;  3QP6 A;  3HTU A;  3SHF A;  2BE5 F;  3I64 A;  5F64 A;  3K2Z A;  1R5H A;  1Z9C A;  2TDX A;  2MH9 A;  3PQJ A;  2PLY A;  3DF8 A;  4G9Y A;  1SMT A;  5CVI A;  3PQK A;  3W6J B;  2XAJ A;  1P4W A;  3KZZ A;  4L9V A;  2VBX A;  3ZP5 A;  1QZZ A;  2VBY A;  3J80 Z;  2A3S A;  3I53 A;  4YFK F;  3N4M A;  3CO6 C;  2PEX A;  3BY6 A;  2A69 F;  3BJA A;  3GO5 A;  2HQN A;  1EV7 A;  1XDS A;  4P9U A;  3S2W A;  4CZZ A;  4HOB A;  4S04 A;  2YU3 A;  2D1H A;  2HOE A;  3BPV A;  2GWR A;  2EFO A;  2HDC A;  2Y75 A;  3ZMZ A;  3P9I A;  1J2X A;  2OAZ A;  1GVJ A;  5ERI A;  3F8B A;  4FX4 A;  1SFE A;  2P5K A;  1UB9 A;  2QYO A;  4ESF A;  4HX7 A;  5LBQ A;  1YW8 A;  4JK1 X;  4BXU A;  1ZGA A;  4ZYE A;  5DUI A;  3M8F A;  2P8T A;  1S3J A;  2QVO A;  5L3B A;  2VOD A;  2HR3 A;  5F6F A;  4G94 A;  4CHU A;  4UV8 A;  1YTY A;  2HKX A;  1IN8 A;  2PQ8 A;  3RKW A;  1F1Z A;  3WGI A;  1HW5 A;  3HOS A;  5LEJ A;  1JHF A;  3DP7 A;  2W85 A;  1LEA A;  2OQR A;  1BI1 A;  4EM0 B;  1R58 A;  3DV8 A;  5HLH A;  4G7H F;  1O7L A;  1TW2 A;  3ELK A;  1FSH A;  3MFK A;  1K79 A;  4RB1 A;  3FX3 A;  3GFJ A;  2MLG A;  5JI6 A;  3ECO A;  4MGR A;  2M8E A;  2F5F A;  2DBB A;  5HS8 A;  2ETH A;  3P7N A;  4KT5 C;  1IRG A;  1G3Y A;  1FBU A;  4EQQ A;  4MTD A;  1LJ9 A;  3WOD F;  4GYG A;  3ML6 A;  2D2W A;  4WXD A;  3E97 A;  5F1R A;  2W24 A;  2X0L A;  3M9A A;  4AIK A;  5HDK A;  2MBF A;  1RNL A;  1G6N A;  4G7Z F;  1G4D A;  5D8K B;  3J81 Z;  1RUO A;  1B1B A;  4AIJ A;  2E7W A;  2JT1 A;  2GA2 A;  2EB7 A;  1SD7 A;  2VC1 A;  1IN6 A;  1MKM A;  5HVQ C;  2KIF A;  3TDZ C;  5LHH A;  1I1G A;  2QQ9 A;  1KYZ A;  2QWW A;  3I4P A;  1OYW A;  3R0A A;  4ZZL A;  2X4H A;  3SZT A;  3WTW C;  3F6V A;  2K86 A;  3K9T A;  2R7D A;  2YSR A;  4A5N A;  1AOY A;  1FSE A;  3IL2 A;  2P5L C;  1O3Q A;  2CSO A;  1JGS A;  2F2E A;  4KMU X;  1YLF A;  3U2R A;  1U78 A;  4YFX F;  3FWE A;  4XRF A;  4N9I A;  3MZH A;  1SD5 A;  2IPQ X;  3DEU A;  3P9C A;  4GCV A;  4Z2Y A;  2LKP A;  2Y48 A;  4AWX B;  3GF2 A;  2EV0 A;  3BPX A;  3RYR A;  3ZPL A;  1KGS A;  4A6D A;  1LDJ A;  1BIB A;  2P7V B;  4IVN A;  1W7P D;  2F5E A;  1I1S A;  4DQ2 A;  2FBK A;  4ON0 A;  3RPU A;  4FT8 A;  3FM3 A;  3W6K B;  3I71 A;  3E6B A;  5D4S A;  3BRO A;  2IA0 A;  2J5O A;  2PMH A;  1PP8 F;  2GXG A;  3M1E A;  5AIP A;  3C1D A;  2ZNZ A;  4EM1 A;  1YO5 C;  2XV4 S;  4BQA A;  5TRD A;  5BOX A;  2FEZ A;  4O5V A;  2HQR A;  1FYK A;  5J8F A;  2VE8 A;  3HRS A;  4EM2 A;  1XMK A;  1STZ A;  3TDU C;  4U7D A;  1HBX G;  4Q5S F;  2HS5 A;  1LVA A;  5FB2 A;  1WI9 A;  3WE2 A;  4ENN A;  3LQR A;  2R3S A;  4OIR F;  3TOA A;  2QQA A;  1DUX C;  5HOO A;  2JPC A;  2H6C A;  2Q2E A;  1FOK A;  5LHG A;  1ODD A;  4P96 A;  5IT9 K;  3JAM Z;  4RAZ A;  1G3S A;  3MQ0 A;  1KU3 A;  4I01 A;  5E8G A;  3HSF A;  3U1D A;  2V1U A;  3KP2 A;  2NAZ A;  4P55 A;  2V1D A;  3RYP A;  1IAW A;  1D8J A;  3Q9S A;  2QZ8 A;  3O6B B;  2W57 A;  4KIC A;  3LWF A;  2L4M A;  1RIO H;  2FQ3 A;  2QQB A;  3EQL F;  1MJA A;  3RKX A;  4HYE A;  2LNB A;  4I98 B;  5D8L B;  2UZK A;  3HOT A;  1U2W A;  4LB6 B;  4EJT A;  2A6E F;  1ZHF A;  2QBY A;  5D4R A;  1H9G A;  3GZ5 A;  1MD0 A;  2EFW A;  3FMR A;  1R36 A;  1W7P A;  5LLQ A;  2ZXJ A;  4EGY A;  2E7X A;  3QU3 A;  2OD5 A;  2YPR A;  3J80 K;  3H3U A;  4XLN F;  2QBY B;  1T98 A;  2HGC A;  2RVC A;  4EJV A;  3L09 A;  2EWN A;  2VT3 A;  4RB0 A;  1K7A A;  3J7A O;  1F4K A;  2KJB A;  5LHI A;  5K1Y A;  4LK0 F;  1XCV A;  2CYY A;  4RB2 C;  1OYI A;  4CYD A;  5BQT A;  1TNS A;  4KUM A;  4XSX F;  4MEY F;  4R1H A;  4EJU A;  5L3G A;  1S6L A;  3ZMD A;  5CLS A;  5E18 F;  3SXY A;  3M7G A;  5TJJ A;  3HRU A;  3DPT A;  5J8C A;  3MAJ A;  4LD5 A;  4GO1 A;  1LNW A;  1J75 A;  3VB2 A;  3SQN A;  4I7H A;  1OKR A;  2GIV A;  1BJA A;  3K1M A;  5D5X B;  4L9T A;  3DFG A;  4OMY A;  2FE3 A;  4RGX A;  4WK8 F;  1DPR A;  3AAF A;  1Y0U A;  2A07 F;  3FXU A;  1WSU A;  4LG0 A;  3B73 A;  3JSP A;  5H6Q A;  4I0A A;  5CVU A;  4UUV A;  4M71 A;  2ACJ A;  1XSD A;  2LF8 A;  5CJ9 A;  4KN4 X;  3M8E A;  2K7L A;  2DPU A;  5HDN A;  5EEG A;  1BI3 A;  2UXX A;  5E20 A;  1PUE E;  2AXL A;  4UNO A;  5E17 F;  5FFZ A;  4HF2 A;  1RUN A;  2NYX A;  4AIH A;  2O6G E;  2NRA C;  4MHG A;  2GXB A;  1TQM A;  4R79 A;  1FC3 A;  4HF1 A;  2DFI A;  3RPQ A;  2HZT A;  4L0Y B;  5HS9 A;  2ELH A;  1HXD A;  3KP7 A;  1ZN2 A;  3O2P E;  2OA4 A;  4OU0 A;  4A0X A;  1KQ9 A;  4CIC A;  3T0Y A;  3GX4 X;  5DUK A;  3WTX C;  5H6R A;  4BHP A;  2UWM A;  2VN2 A;  4MTE A;  4H0E A;  1QBJ A;  2KIM A;  3E6M A;  3RDI A;  4RGR A;  2EA2 A;  4CGZ A;  1TTY A;  2HKO A;  4MQV A;  3REO A;  1MJB A;  1Z05 A;  4HF0 A;  2RN7 A;  1R1U A;  1TBX A;  1NHA A;  4BH9 A;  2ADU A;  1YS6 A;  1LQ1 A;  2L4A A;  2XUB A;  3I58 A;  1UFM A;  4CXF A;  2EFQ A;  5ED4 A;  5DDG A;  2EK5 A;  4JQF A;  2ZJ2 A;  4K2E A;  1X3U A;  1UHM A;  3ZMT A;  3U9G A;  3ZN1 A;  2FOK A;  1ZRC A;  3FXR A;  2OQG A;  3LAJ A;  4G6D A;  1ON2 A;  1XGM A;  2CWE A;  1UCR A;  4Q4Z F;  3O3K A;  1ZAO A;  2R7F A;  2RV8 A;  5LGT A;  1PDN C;  2AS5 F;  4S05 A;  3H3Z A;  1W5S A;  1XGS A;  3N97 A;  3FM5 A;  2KKO A;  3V7C A;  4HA8 A;  3WU1 B;  1I6X A;  3VEP A;  3ZMS A;  4WWC A;  1K78 A;  5ICF A;  3G3Z A;  4YFN F;  2L01 A;  4M6Y A;  3DPL C;  4UHT A;  1ZG1 A;  4GYI A;  4I09 A;  2YR2 A;  5DYM A;  1K78 B;  1R00 A;  1OPC A;  3ISP A;  1R5G A;  2ZNY A;  3COA C;  3HSR A;  5E8I A;  4PZJ A;  4Y15 A;  3WTY C;  2XKP A;  1ZG3 A;  1OMI A;  5CYV A;  2PN6 A;  3QOP A;  4WX9 A;  4LLN A;  5ILV A;  1LB2 A;  2DPD A;  1T6S A;  4PGH A;  1FP2 A;  3GZ6 A;  3MCZ A;  3E5Q A;  2VBW A;  4JBA A;  2J5P A;  1FYM A;  5HLG A;  4M73 A;  3HHH A;  4KYW A;  5LEK A;  2XVC A;  4DNC A;  4HLX A;  2OBP A;  2OZU A;  2Z3Y A;  4QLC U;  5DCM A;  5A2Q Z;  1YW7 A;  3JAM K;  2YX4 A;  1TQI A;  3KET A;  2M30 A;  4Y17 A;  5LRS A;  1UST A;  4MQ9 F;  3FHZ A;  2DAO A;  1LDD A;  3KCC A;  5DCM B;  1IF1 A;  1CGP A;  3T8R A;  5FLX Z;  3Q5F A;  2FMY A;  4WXC A;  2OZ6 A;  4IPA A;  3LA3 A;  3P9K A;  1DP7 P;  2DQR A;  3EET A;  2PI0 A;  3C3W A;  3QAH A;  3HHG A;  4IHT A;  2DK8 A;  2VOO A;  1S8N A;  4AVP A;  3CLO A;  3LAP A;  3F8F A;  1WKM A;  2DK5 A;  1HKQ A;  2VBZ A;  3ROU A;  1BOA A;  1B4A A;  4ENK A;  3TKY A;  1FYL A;  3LST A;  4ESB A;  2WC2 A;  4RGU A;  3MWM A;  3WTU C;  3FF5 A;  1BC8 C;  3R60 A;  4U0W A;  2LDU A;  4XLP F;  2A5Y B;  1B9N A;  2V6C A;  2RGV A;  2IJL A;  1JHH A;  1XN7 A;  3Q9V A;  4U88 A;  1ZLK A;  1ONV A;  2GAU A;  1YIO A;  3IRQ A;  4U7B A;  2MH2 A;  1YQA A;  3VOD A;  2QLZ A;  4Q48 A;  3WE3 A;  3DKW A;  1JE8 A;  3GUD A;  4EJO A;  4M72 A;  1L0O C;  1V4R A;  2EV6 A;  3GFI A;  2FNA A;  1MZB A;  4M6X A;  1F9N A;  3BJ6 A;  2VE9 A;  1ZRD A;  1TNT A;  5FGM A;  5ICC A;  3D0S A;  4UVB A;  4LFU A;  5H20 A;  5KVR A;  1XB4 A;  4G6Q A;  3ZQ7 A;  3K0L A;  1IZ1 A;  2PBI A;  1Q1H A;  5HS7 A;  1IXS B;  3WGH A;  2ZCW A;  1KU9 A;  1T2K A;  1IN4 A;  2F5D A;  2FBI A;  1SFX A;  4KIB A;  1G3T A;  3ERE D;  2NS0 A;  2ESH A;  4N9H A;  4BHC A;  1ZG5 A;  2XIG A;  4PDK A;  2A68 F;  3R6S A;  4WXH A;  2IT0 A;  1J5Y A;  4BHB A;  4HQM A;  2YX7 A;  4NQW A;  1ZLJ A;  2KJC A;  1WWX A;  3F23 A;  3SFZ A;  3IC7 A;  4KNY A;  2O8X A;  4BYY A;  2D45 A;  3QP5 A;  2KRF A;  5CVJ A;  4ASN A;  1KQ8 A;  1W4M A;  1XD7 A;  4A12 A;  4U0V A;  5JVT A;  3HSE A;  1YS7 A;  4XBF A;  2BEO A;  5FD6 A;  5LGN A;  3GEZ A;  2XAQ A;  3GW2 A;  3G73 A;  4A0Y A;  2L3D A;  2STW A;  2HWV A;  2CG4 A;  3BWG A;  3RJP A;  4IJA A;  5EEH A;  1HW2 A;  1TLH B;  2G7U A;  2FA5 A;  1TQP A;  3E6D A;  6PAX A;  3EDP A;  4A0Z A;  2RDP A;  2WTE A;  1P92 A;  3F8N A;  3FMQ A;  1YW9 A;  1IUY A;  4XSZ F;  4E70 A;  3BOQ A;  1B59 A;  2EJR A;  4Y13 A;  3ABU A;  1W5T A;  3I0T A;  1HQC A;  4ENJ A;  2XHK A;  2RC4 A;  1BM9 A;  2Y0M A;  2IVM A;  5FO5 A;  3CUO A;  3VOE A;  3K69 A;  4HDV A;  2HTS A;  1SMY F;  2MA3 A;  3IWF A;  1YG2 A;  4HV6 A;  5ILU A;  5K5Q A;  3DQV C;  2FXA A;  3FXQ A;  4G8X A;  5DV5 A;  4LLG F;  2Z9O A;  3EYI A;  3CJN A;  3KP3 A;  3E5U A;  2O3F A;  2PG4 A;  3CUQ B;  3MZY A;  1GHC A;  2JRT A;  2DQL A;  4IXA A;  2HYF A;  1U5T C;  3IHU A;  5L3F A;  2D1V A;  4CDG A;  1I27 A;  1WQ2 A;  4OIQ F;  2MC3 A;  5D5W B;  5ICE A;  1O7F A;  1XSV A;  2HFH A;  2JTV A;  3TO7 A;  4EGZ A;  2ZO4 A;  2GA1 A;  5BPI A;  2ISZ A;  1FWZ A;  1T39 A;  4NB5 A;  1XDU A;  2M1B A;  1ULY A;  2ZKZ A;  4KFC A;  1R23 A;  2C6Y A;  1HW1 A;  1FNN A;  1R1V A;  3V8J A;  2QUF A;  1QZY A;  4M9S A;  2UXN A;  1P6R A;  2FML A;  4YII A;  2EFN A;  3LA7 A;  2O0Y A;  2M5W A;  3CUQ C;  3IKV A;  2DTR A;  3WTV C;  2WWY A;  1USS A;  1FLI A;  4I02 A;  1BN5 A;  1MJ9 A;  2XGX A;  3VFZ A;  1KYW A;  4OOI A;  2P6T A;  2O61 A;  2XAH A;  4L9J A;  2V1X A;  3T8T A;  3TO6 A;  2VON A;  2XKO A;  1UHW A;  4B8X A;  4RB3 C;  2LF7 A;  5J6X A;  1KU7 A;  2BYV E;  1BIA A;  1EH8 A;  3F8C A;  2BV6 A;  5FD5 A;  1TW3 A;  3MEX A;  2QEN A;  1XMA A;  5A2Q K;  3PFI A;  2HTJ A;  1HST A;  1REP C;  3IWZ A;  4GXO A;  2P4W A;  3J81 K;  3L00 A;  2CGP A;  5DD8 A;  1AWC A;  1YFH A;  4BAY A;  5D5U B;  4WF2 A;  1T38 A;  5FLX K;  3F6O A;  3SZP A;  2MLK A;  4ZZD A;  4OMZ A;  1Z91 A;  1ZAR A;  1QNT A;  5LRR A;  4OIO F;  2Z5U A;  1RZ4 A;  2PJP A;  1Z6R A;  1S29 A;  2Z33 A;  3RKY A;  1BI2 A;  2B0L A;  3HYI A;  4Q47 A;  1R7J A;  5E1X A;  1BI0 A;  3KP5 A;  1BBY A;  2FNP A;  4FX0 A;  3KEQ A;  2V9V A;  2W25 A;  2DLL A;  4KIG A;  4L5I A;  1FY7 A;  2COM A;  3QPT A;  3GFL A;  2P6S A;  3I59 A;  1PP7 U;  2PFB A;  3RTR A;  2IA2 A;  3RI4 A;  4HBL A;  2IRF G;  3WTT C;  3ABT A;  3GVA A;  1U8R A;  3V8K A;  1FX7 A;  5CVV A;  3I59 B;  5BPD A;  1IXC A;  5E1Z B;  2XAG A;  2CQK A;  4HX4 A;  4AD9 A;  1QPM A;  2DO7 A;  2P5V A;  2VT2 A;  3K1P A;  4ZYH A;  2MD5 A;  4HLY A;  2ZME A;  2V79 A;  5D6E A;  4L9N A;  2L54 A;  4EVI A;  1L3L A;  1R1T A;  4HW0 A;  1O3S A;  3HRT A;  4LB5 A; 
#chains in the Genus database with same CATH topology
 2L0K A;  3OOP A;  1Z6T A;  2W82 A;  2ZME B;  3OR2 C;  3ZN0 A;  2XDV A;  3I5U A;  1IV6 A;  2AQF A;  4WCG A;  1LDK B;  2ZC2 A;  1T8I A;  4B09 A;  3WTZ A;  3TOB A;  4J19 A;  1P4X A;  3C7J A;  3OMY A;  2JPB A;  2JA2 A;  4C9Y A;  2X1E A;  3KLO A;  2NVQ J;  1E17 A;  4RGS A;  2IW5 A;  5B5E C;  1WH7 A;  2JSP A;  1LKX A;  1FMW A;  3GWZ A;  3TW7 A;  4ETS A;  3R61 A;  1ACI A;  5ICG A;  1SAX A;  3V4G A;  1SAU A;  1WJF A;  1VTN C;  4RAG A;  5J4V A;  5L3E A;  2W84 A;  4Z6Y A;  2IAI A;  3CJT B;  1WRJ A;  2CQX A;  3V7R A;  1XGO A;  2VKE A;  3DXJ F;  4E7K A;  1ZEL A;  2NVU B;  4F92 B;  2HI3 A;  2VIX A;  1JGG A;  4A3K J;  1G3W A;  3CMY A;  4BJT A;  1MW7 A;  1EH7 A;  4A5M A;  4KIF A;  3IUO A;  4XLF A;  2KZG A;  3RSN A;  3G4S I;  1H89 C;  3VYT B;  3RQ4 A;  3OIO A;  5FKM A;  4OAY A;  2DA6 A;  3IKT A;  3BJO A;  3S32 A;  3B02 A;  3Q0W A;  1MIJ A;  4IKF A;  3F8M A;  3U1K A;  3R4K A;  1DDN A;  2JZY A;  4A3E J;  3OV8 A;  3I4M J;  4KT6 A;  1IN7 A;  1P2F A;  2FRH A;  3WG7 H;  1ZRE A;  2V9K A;  3BZC A;  3GFM A;  4FHT A;  3A01 A;  3OYB A;  3L2C A;  1TWC J;  3E6C C;  4GGG A;  1U6G A;  4TV7 A;  1U8B A;  2RNJ A;  2BW3 A;  4L5J A;  3CMA I;  1X1C A;  1ON1 A;  3ECH A;  2O03 A;  2ZME C;  3JTH A;  3TGN A;  1OR7 A;  1BC7 C;  3DTI A;  3HTS B;  3LSG A;  5L3D A;  2LKS A;  2Y0S N;  4LK1 F;  1IN5 A;  5JHF A;  1V5E A;  1O3R A;  2HQ5 A;  3M4O J;  1Y1W J;  2CFX A;  1QVU A;  4P5O A;  3IAS 2;  3A01 B;  1A36 A;  2VJJ A;  1O57 A;  4RM2 A;  2K9Q A;  2JSC A;  2BW3 B;  2EH3 A;  3BDD A;  1HSJ A;  5BS6 A;  4IRG A;  1R22 A;  2F4M B;  2X1C A;  3KEO A;  4J01 A;  3RQI A;  1D5V A;  3CCE I;  3UR3 C;  3JSO A;  5EEA A;  1FIP A;  5C3E J;  2DFE A;  2M4K A;  3BP8 A;  4BJ5 C;  1O4X A;  1MBJ A;  2JA5 J;  1K6O A;  3K10 A;  1JTX A;  2HU9 A;  4IHY A;  1MBK A;  2NNY A;  3E5X A;  4BNC A;  2GOM A;  2XGC A;  3GLX A;  4YIR X;  3GTQ J;  2IXS A;  5M5W J;  3I56 I;  4JX4 A;  4XN0 A;  3CMM A;  4IRH A;  3CME I;  4EAT A;  3HUG A;  4BKX A;  2M8G X;  4IF4 A;  2LY2 A;  3GZN B;  3M8J A;  4RLQ A;  2OCC H;  4QWQ A;  4D7M A;  4CCJ A;  2XRO A;  3GTM J;  3NEU A;  2LH9 A;  4X1E A;  5J3L A;  3VWB A;  4HDU A;  1FT9 A;  1S7A A;  2L02 A;  4HQE A;  4F7Z A;  3FMS A;  3KYC B;  2A61 A;  1Z1D A;  3CTA A;  3NRV A;  3QPH A;  4O6J A;  5D5V B;  4W1U A;  4U0Y A;  3K1N A;  2CW8 A;  2YU9 J;  1VFC A;  2IA1 A;  1IW7 F;  2OU2 A;  1EH6 A;  5DD4 A;  4A3L J;  3F22 A;  2HVQ A;  4LIT A;  1HC8 A;  2GOX B;  4M9X A;  4B3A A;  4IO9 F;  1ZGJ A;  2V6E A;  3HOU J;  3M3Y J;  2VKD A;  3AG3 H;  2Y31 A;  1ZYR F;  3V8L A;  2Z2S B;  2ZBK A;  2RKH A;  4BAC A;  4LJZ F;  3SJM A;  1J9I A;  1C0W A;  2VLA A;  4Y7N J;  1ZH5 A;  4UXN A;  2Z99 A;  4XRS G;  1U3E M;  4M74 A;  1E3H A;  1DGW Y;  2KIU A;  2BGC A;  2LBF A;  4FE4 A;  3SEQ A;  3IRR A;  3CCU I;  1VQO I;  2ID3 A;  4HAM A;  1R9T J;  2DU9 A;  1YX5 A;  1A04 A;  2H09 A;  5BMZ A;  3NQO A;  2QEX I;  4JX5 A;  1HDP A;  2F5C A;  2HEO A;  2DMQ A;  1ZTR A;  2RQQ A;  3I54 A;  2WY7 Q;  1MGT A;  3GCM A;  1QQI A;  4N0B A;  4BDY A;  4G7O F;  3KZY A;  3CDH A;  5F04 A;  5JR3 A;  2VQH A;  2LBF B;  4CO8 A;  1POG A;  4D0P A;  1IC8 A;  3WU0 A;  4EV0 A;  1FEX A;  1KU2 A;  2HYG D;  5IOZ A;  2KRC A;  3CZ6 A;  3RZD J;  4D1Q A;  1J59 A;  2RQP A;  2CQQ A;  5K5R A;  5B66 C;  4L18 B;  1GLN A;  2OC6 A;  2XPV A;  3GXO A;  2VC0 A;  1FZP B;  1VQ4 I;  4ZH4 F;  1J0R A;  2QKL B;  5EYR A;  1B6A A;  3F72 A;  1MDM A;  3F21 A;  3LA2 A;  1OCO H;  4M3D A;  2DI3 A;  2H6B A;  2CO5 A;  1ETY A;  5E3N A;  3QYF A;  3E0J B;  4YIF A;  2CQN A;  1UMQ A;  2ZXI A;  1KQ0 A;  1RRJ A;  2E1M C;  2ESN A;  4MEX F;  1YX3 A;  2LG4 A;  3EYY A;  2LD5 A;  1LFP A;  4UV9 A;  1MDM B;  3LFK A;  2XAS A;  3T5X A;  3F3X A;  1E2X A;  3E1S A;  4X6A J;  1D8K A;  2DT7 B;  2KT0 A;  1ZRF A;  4OIP F;  4NHJ A;  2EIL H;  4ANJ A;  5JHU A;  3CCS I;  3MKZ A;  1IJW C;  2NNN A;  3LSJ A;  1B9M A;  2X6W A;  4EJW A;  2A6H F;  4BJ6 C;  1A35 A;  3EPZ A;  3R0J A;  3CJR B;  2KDO A;  1OCP A;  1VZ0 A;  3IAM 2;  4ESJ A;  1Z21 A;  2NOG A;  3PO3 J;  1R4M B;  1WFX A;  2H1L A;  2H27 A;  1U5T A;  4ENM A;  3TO9 A;  2GQQ A;  4BEH A;  1SD6 A;  4YG2 F;  3FXK A;  3PUB A;  1GXQ A;  2V4J C;  2K27 A;  2FJ1 A;  3CF2 A;  5K5O A;  3PNY A;  1JXS A;  4IRI A;  4LMY A;  2KIQ A;  1FP1 D;  3TQN A;  1Y39 A;  1XGN A;  2BBY A;  2IP2 A;  4KMF A;  3S15 J;  2YUS A;  4XMY A;  4CUG A;  4A3B J;  3L7W A;  1U5T B;  1D3Y A;  2DMU A;  2F4I A;  2E1C A;  3V42 A;  1S7E A;  2QSH X;  2VAS A;  1WHU A;  5LGU A;  4PCQ A;  2ZJQ F;  4A3I J;  3HIF A;  4UVA A;  1T0F A;  4RAY A;  4XOR A;  3LQQ A;  1VQN I;  3ZRG A;  3D5L A;  3HZJ A;  3NAU A;  2GZW A;  2WV0 A;  1SFU A;  3L2W A;  2CW0 F;  3GYH X;  4YEL A;  1XCB A;  1ZK8 A;  3WGG A;  2LVS A;  3M1C A;  3GTL J;  3PSF A;  3BG5 A;  2V9P A;  2KDZ A;  1FBS A;  4BQQ A;  2PMU A;  1MSE C;  3S1N J;  2KPM A;  2Y0S A;  4IZZ A;  1W0T A;  3ZMU A;  5JFR A;  1Y8R B;  2M45 A;  2E1N A;  2STT A;  2OV7 A;  1IRF A;  2JVH A;  4MNU A;  2QM3 A;  3FXJ A;  2R4G A;  5ILS A;  3H5R A;  5DCF A;  2XGE A;  3CUQ A;  3AG2 H;  4XRM A;  2M3A A;  3QRF F;  1S7O A;  1H0M A;  5L3C A;  1QO0 D;  2VXZ A;  1RI7 A;  3LFU A;  4DYR A;  2K4J A;  3DLA A;  2K02 A;  2ISY A;  4M6V A;  2VPR A;  4LLL A;  4A3D J;  1HKS A;  1UJ8 A;  3EUA A;  4X0G A;  2K4B A;  1QGP A;  1GV5 A;  3SZG A;  3LSM A;  3CF5 F;  2FF4 A;  2JJ7 A;  2Q1Z B;  3KP6 A;  3OL4 A;  4PJM A;  1W7P B;  4DZP A;  1P4A A;  4EMS A;  4BE1 A;  2EA4 A;  3L1P A;  3BQZ A;  3A02 A;  2XB5 A;  4M9Z A;  5FFX A;  3IH4 A;  2M87 A;  4AYB A;  4ZYD A;  1Z7U A;  3JRA A;  4O3M A;  2E5Z A;  4FET A;  5DEQ A;  2VXD A;  1K4S A;  2Q8K A;  3PO2 J;  1YYV A;  4XKC A;  1N25 A;  4KDP A;  1S5L C;  2DT5 A;  1DPU A;  3FXM A;  2LY1 A;  5K7Z A;  3WG9 A;  1I5Z A;  4PGG A;  3HKZ A;  3IH3 A;  2IS6 A;  5IT3 A;  3BCA A;  3SFI A;  1SD4 A;  3HOZ J;  5KK1 A;  2XRN A;  4UVC A;  3KP4 A;  1V55 H;  3RIR A;  2XPU A;  2CW7 A;  1HA8 A;  4UUS A;  1T0F C;  2COB A;  4IHS A;  1N78 A;  3WTS C;  4AU7 A;  4ZYG A;  2DJN A;  1Y0N A;  3KFW X;  3ZQL A;  3CJQ B;  1RES A;  3BZ6 A;  3C18 A;  1Y6I A;  3FZV A;  3CC2 I;  4A6E A;  3AG4 H;  3T1B A;  1FBQ A;  3KE2 A;  2Z1D A;  3QU6 A;  1GXP A;  2EFP A;  2X6O A;  1KA8 A;  3CO7 C;  5IYC J;  1G2H A;  2AQE A;  3ERM A;  2FSW A;  5AIQ A;  2N8G A;  1FTZ A;  4I0B A;  5D6F A;  2G9W A;  1IO2 A;  5AON A;  1YJ9 I;  4HX8 A;  1F5T A;  4KA4 A;  4CH7 A;  3HRM A;  3A0B C;  3L2R A;  3VPR A;  3JTG A;  5HLI A;  3K6G A;  2BXY A;  1Z7L A;  5CVR A;  3S8P A;  5CKT A;  2LSO A;  3JW4 A;  3V7S A;  3BG6 A;  4A3G J;  3ZMV A;  3VYU B;  2FBH A;  3G2B A;  3HJE A;  2EV5 A;  4RS8 A;  3JRI A;  3H92 A;  1H9T A;  1CF7 A;  4OIN F;  3CQZ J;  2AHQ A;  2CH0 A;  3GTP J;  3KLN A;  4HV5 A;  5HLT A;  4MLO A;  2FD5 A;  5HDG A;  1FPQ A;  1V3F A;  2H94 A;  4QTR A;  5E1W A;  4I76 A;  2XAF A;  2DW4 A;  4A3F J;  4CCN A;  3CDI A;  1OYY A;  4LG0 B;  1I3A A;  1T95 A;  1J7K A;  5IPA A;  1O3T A;  4E7H A;  1CF7 B;  2FU4 A;  1X2N A;  2K40 A;  2R7Q A;  2VOP A;  1HKT A;  1PJR A;  2VKH A;  2DFF A;  4C2U A;  3J7Z I;  3ULQ B;  4I2O A;  1XSX A;  5IT9 Z;  4R8H A;  4A2U A;  4L0Z B;  1IXR C;  2IGM A;  4HZF A;  1LEB A;  3EUH A;  2W7N A;  2AXT C;  2EZL A;  4KIS A;  3ESW B;  3OYA A;  3QQA A;  3J7Y J;  2P7C B;  3E3V A;  2ZFW A;  2CUZ A;  3KIO A;  3L9F A;  2Q0O A;  1SAN A;  2G7H A;  4UUT A;  4P9F A;  2DMN A;  3H9G A;  4LGW A;  4KN7 X;  3QP6 A;  3HTU A;  1I6H J;  2DA1 A;  3GTO J;  2JUC A;  4BQN A;  3SHF A;  4RMN A;  2BE5 F;  3I64 A;  1Z3X A;  2HPM A;  1UG0 A;  4MIM A;  1GVD A;  1YOV B;  5F64 A;  3DBL B;  4LIV A;  3BZK A;  2LTP A;  3K2Z A;  2E19 A;  1IV8 A;  4UY8 I;  1R5H A;  4B43 A;  3I4N J;  4C2T A;  1Z9C A;  1MBG A;  2TDX A;  5IYB J;  4P1W A;  3OOU A;  1SVO A;  2MH9 A;  2IBD A;  3PQJ A;  2PLY A;  3DF8 A;  2ZXW H;  4G9Y A;  1SMT A;  5CVI A;  3PQK A;  3W6J B;  2XAJ A;  4XK4 A;  1P4W A;  2CV2 A;  2K9M A;  3KZZ A;  4IQ4 A;  4L9V A;  1YJN I;  2VBX A;  4PJJ A;  3H9J A;  3ZP5 A;  1QZZ A;  2VBY A;  1H8A C;  3G1M A;  4FTH A;  2ZSH B;  2A3S A;  2E60 A;  3I53 A;  4YFK F;  5KAF C;  3J80 Z;  3CO6 C;  3N4M A;  1JJ6 C;  2PEX A;  3BY6 A;  4J00 A;  2R7U A;  2QGU A;  4F55 A;  2A69 F;  1WGX A;  2WV1 A;  3BJA A;  3GO5 A;  1XMX A;  1FOX A;  2HQN A;  1EV7 A;  1XDS A;  4P9U A;  3S2W A;  4CZZ A;  4HOB A;  2DMP A;  4S04 A;  2YU3 A;  2D1H A;  2BY3 A;  2HOE A;  2XF6 A;  4BE2 A;  1RPW A;  1UZC A;  3BPV A;  4BGD A;  2UUZ A;  2GWR A;  2R5Y A;  2EFO A;  1X4P A;  4CCK A;  2DXI A;  2L7K A;  2HDC A;  2R7Z J;  2KHM A;  2Y75 A;  3EUH C;  4KJZ A;  2V1N A;  3ZMZ A;  1VQ6 I;  3P9I A;  1J2X A;  1P7I A;  1GVJ A;  2BOL A;  2OAZ A;  2LLK A;  5ERI A;  3F8B A;  4IL6 C;  4NUB A;  5K7F A;  3HL2 A;  4FX4 A;  1SFE A;  5C4X J;  2L7F P;  2P5K A;  2JQ7 A;  2R5Y B;  3RZO J;  1UB9 A;  5M3F J;  1JKR C;  2WB1 A;  2R92 J;  4W97 A;  2MD0 A;  2QYO A;  4ESF A;  4HX7 A;  2EQR A;  2JN6 A;  5LBQ A;  1YW8 A;  4JK1 X;  5IY5 H;  3OWT A;  1BL0 A;  5GPC A;  4BXU A;  1ZGA A;  3BG3 A;  4ZYE A;  3UNG C;  5DUI A;  2LMD A;  3M8F A;  1AU7 A;  2P8T A;  1S3J A;  2DCE A;  2XF5 A;  1JTY A;  2JVG A;  2QVO A;  5L3B A;  4OWR B;  2VOD A;  3LSH A;  3A03 A;  2VPL A;  2HR3 A;  5F6F A;  3FDY A;  4BDZ A;  4G94 A;  4CHU A;  4UV8 A;  1OIS A;  1YTY A;  3DEE A;  2HKX A;  4NNJ A;  1IN8 A;  2P0W A;  2PQ8 A;  3RKW A;  5LFA A;  1F1Z A;  2NVX J;  4BY1 J;  2B7E A;  3WGI A;  2CV0 A;  4PJN A;  2DT6 A;  1HW5 A;  3HOS A;  5LEJ A;  1JHF A;  3DP7 A;  4II3 A;  2W85 A;  5CQG A;  1LEA A;  2OQR A;  1W36 D;  1X1P A;  1BI1 A;  4EM0 B;  1R58 A;  3DV8 A;  3CC7 I;  4D7N A;  5HLH A;  4G7H F;  1O7L A;  3H36 A;  4N4O B;  1OCT C;  1TW2 A;  3ELK A;  3A0H C;  1FSH A;  3MFK A;  1K79 A;  2IEK A;  3FX3 A;  4RB1 A;  3FXO A;  4IHV A;  2R0Q C;  3GFJ A;  2MLG A;  2BZT A;  2M34 A;  5JI6 A;  4XNF A;  2KP6 A;  4GRI A;  3LSI A;  3IV5 A;  3ECO A;  2DYR H;  4MGR A;  1VQM I;  2LR8 A;  1Y8Q B;  3FIS A;  4DZJ A;  1N75 A;  1X4O A;  3W2W A;  2M8E A;  3O8H A;  4DW6 A;  2F5F A;  4IQJ A;  3BG7 A;  1UG2 A;  2DBB A;  3SDB A;  2XGD A;  2R93 J;  5HS8 A;  2ETH A;  3P7N A;  5GTH C;  2HOA A;  3MZ8 A;  3GTG J;  4Y52 J;  1OJL A;  4KT5 C;  2OCE A;  1IRG A;  4DOZ A;  1I39 A;  1G3Y A;  3RPU D;  1QHG A;  1IGN A;  1FBU A;  1T33 A;  1Z67 A;  1IRX A;  4EQQ A;  3J7A Y;  2W4S A;  1ORK A;  4MTD A;  5DM7 F;  2EIN H;  4XKV A;  1LJ9 A;  5EZH A;  3WOD F;  4PJ0 C;  2H1K A;  4GYG A;  3ML6 A;  2D2W A;  3BR1 A;  4WXD A;  3E97 A;  5F1R A;  1MMN A;  5CPR B;  2BXZ A;  2W24 A;  3H0G J;  2X0L A;  4PSX A;  3M9A A;  4AIK A;  3A1Y A;  3UKG A;  5HDK A;  2OJE D;  3OSF A;  2MBF A;  1MND A;  1RNL A;  3K4N A;  1G6N A;  3FK7 A;  4G7Z F;  1G4D A;  4GFB A;  3K7A J;  5D8K B;  4KIT B;  3J81 Z;  1RUO A;  4QPO A;  4XL9 A;  3AKZ A;  1B1B A;  2WAD A;  4DGW B;  2E7W A;  4AIJ A;  3AL0 B;  2JT1 A;  3I9V 2;  1U9N A;  2GA2 A;  1E3O C;  2EB7 A;  1SD7 A;  3OYD A;  2VC1 A;  1IN6 A;  1MKM A;  1UHS A;  5IP6 A;  2L7Z A;  5HVQ C;  2KIF A;  4CSW A;  3TDZ C;  2VKV A;  4I6Z A;  3W2A A;  5LHH A;  2XF7 A;  2QQ8 A;  1I1G A;  2QQ9 A;  1KYZ A;  1V54 H;  2BHY A;  2QWW A;  3I4P A;  5M5X J;  2VB6 A;  1JJ8 C;  2L5Q A;  1OYW A;  3R0A A;  4ITV A;  4ZZL A;  3VYR B;  2OTL I;  1HDD C;  2X4H A;  1VQK I;  2IS1 A;  3VSL A;  2XB0 X;  2KQR A;  3SZT A;  3WTW C;  3PUF A;  5F27 A;  3F6V A;  1K4T A;  4AYB N;  2K86 A;  3K9T A;  2R7D A;  4PFP A;  2YSR A;  3OYG A;  2CJJ A;  4A5N A;  4NC7 A;  3K4B A;  4YEJ A;  5FJ8 J;  1AOY A;  1FSE A;  1R49 A;  3IL2 A;  2P5L C;  4CCM A;  3HB9 A;  2CSO A;  1O3Q A;  4B4C A;  1JGS A;  2F2E A;  3OR1 C;  4E7Z A;  3HKZ N;  5TIS C;  3HDD A;  3D1N I;  4LOC A;  3G71 I;  4KMU X;  1YLF A;  3U2R A;  1U78 A;  2E1M B;  4YFX F;  3FWE A;  1EJ9 A;  2GIZ A;  2WAF A;  4OAZ A;  3BTC A;  3AL0 C;  4AVZ A;  2HNH A;  1G8X A;  2FUG 2;  4XRF A;  4N9I A;  1VF9 A;  1E0E A;  3MZH A;  1V5F A;  1SD5 A;  2IPQ X;  3DEU A;  3P9C A;  3C2H A;  4AC0 A;  4GCV A;  4Z2Y A;  3BR6 A;  2LKP A;  2NS7 A;  2Y48 A;  4RAF A;  4AWX B;  3GF2 A;  1SVM A;  2EV0 A;  4XOT A;  3BPX A;  1F36 A;  3RYR A;  1KGS A;  3ZPL A;  5F0C A;  4A6D A;  2WA0 A;  1LDJ A;  1I3Q J;  1BIB A;  2MFZ A;  1LPQ A;  4D5C A;  1JI8 A;  1Z3Y A;  3H0D A;  2P7V B;  4IVN A;  1W7P D;  2F5E A;  1I1S A;  4DQ2 A;  3ONQ A;  1TWF J;  2FBK A;  4ON0 A;  3RPU A;  4FT8 A;  4HNT A;  3FM3 A;  4BBR J;  2CQ7 A;  1BOB A;  2OF7 A;  3DCF A;  3W6K B;  5FRN A;  3I71 A;  3E6B A;  5TGT A;  3BRO A;  5D4S A;  3BLY A;  4ZDP A;  2P81 A;  2IA0 A;  2J5O A;  3QOE A;  2PMH A;  1PP8 F;  1XPX A;  2GXG A;  3M1E A;  5AIP A;  3C1D A;  2GLO A;  3NAR A;  4BXF A;  1VQL I;  2ZNZ A;  4EM1 A;  1AKH A;  2IGK A;  2FX0 A;  2EBI A;  1Y1V J;  2XV4 S;  1YO5 C;  4BQA A;  1D0X A;  5TRD A;  5BOX A;  1ZR2 A;  5EGO B;  2FEZ A;  3VSK A;  4O5V A;  1BJZ A;  2HQR A;  1FYK A;  5J8F A;  3FK6 A;  2VE8 A;  3HRS A;  1VQ8 I;  4HRI A;  4BUP A;  4EM2 A;  4NC8 A;  1XMK A;  4E7I A;  2UV1 A;  1STZ A;  1AKH B;  3TDU C;  4U7D A;  3CD6 I;  1U0J A;  5GAE J;  1HBX G;  3FBN B;  1W36 C;  4Q5S F;  2HS5 A;  5GAG J;  1LVA A;  5FB2 A;  5DTD A;  1T56 A;  1WI9 A;  1DU0 A;  3WE2 A;  4ENN A;  3LQR A;  1FTT A;  1NTC A;  2R3S A;  4OIR F;  3TOA A;  2QQA A;  1DUX C;  5HOO A;  3BR0 A;  2JPC A;  3BTJ A;  2H6C A;  2Q2E A;  3TW6 A;  2TCT A;  3B6A A;  2IS2 A;  1FOK A;  5LHG A;  1QRY A;  1ODD A;  4P96 A;  2XAU A;  4U87 A;  1VQ5 I;  3D5R C;  2R7S A;  5IT9 K;  2VL8 A;  4IEJ A;  1S72 I;  3JAM Z;  3HGG A;  2K3P A;  1G3S A;  4RAZ A;  4BXX J;  1XS9 A;  1ETO A;  3MN2 A;  1NG7 A;  3MQ0 A;  3W2V A;  1KU3 A;  4I01 A;  5E8G A;  3HSF A;  3U1D A;  1A6Q A;  2V1U A;  2Q2E B;  2NAZ A;  3KP2 A;  4P55 A;  2NXN B;  2V1D A;  5FLV A;  1H88 C;  3RYP A;  1A6I A;  1IAW A;  1D8J A;  2JWT A;  2RAE A;  3ZOB A;  4XLC A;  3Q9S A;  4A3M J;  2QZ8 A;  3O6B B;  3KX2 A;  2W57 A;  1B72 A;  4KIC A;  3LWF A;  2L4M A;  1RIO H;  2FQ3 A;  2VQL A;  3ZQG A;  2BVM A;  4A93 J;  2K9S A;  3BTL A;  4B48 A;  5GAH J;  2QQB A;  3ZCO A;  3EQL F;  2F6C A;  1MJA A;  3RKX A;  3LSR A;  5B3S H;  3JRG A;  4HYE A;  2LNB A;  4I98 B;  5D8L B;  2UZK A;  3HOT A;  1U2W A;  4LB6 B;  1B72 B;  4EJT A;  4NBQ A;  1LE8 B;  2A6E F;  1ZHF A;  1YE9 A;  3ASO H;  2QBY A;  2DA2 A;  5D4R A;  2LP0 A;  1H9G A;  3GZ5 A;  1MD0 A;  2LK2 A;  4QSH A;  2EFW A;  3FMR A;  2BHZ A;  1R36 A;  1W7P A;  5LLQ A;  2ZXJ A;  1G59 A;  4EGY A;  2XC7 A;  2D5V A;  2E7X A;  3QU3 A;  2OD5 A;  2YPR A;  3J80 K;  1Z77 A;  3H3U A;  4XLN F;  4UB8 C;  3DKX A;  3W6V A;  2QBY B;  1T98 A;  4M3E A;  1NH3 A;  2HGC A;  3HOX J;  2RVC A;  2X48 A;  2WB1 N;  4EJV A;  3DLL F;  3L09 A;  9ANT A;  2EWN A;  2VT3 A;  4RB0 A;  1K7A A;  1HCR A;  3CCV I;  3J7A O;  1TWH J;  1XX5 A;  2KJB A;  1F4K A;  5LHI A;  3B6C A;  5K1Y A;  4LK0 F;  1XCV A;  2CYY A;  1PVE A;  3TP3 A;  1X3Z B;  1DP3 A;  2KZV A;  3TL4 X;  4RB2 C;  1OYI A;  2O9L A;  4CYD A;  5BQT A;  1QVT A;  1TNS A;  4KUM A;  1JUM A;  4XSX F;  2W48 A;  4MEY F;  2NOJ B;  4R1H A;  4EJU A;  5L3G A;  1W5C C;  1S6L A;  3ZMD A;  1RET A;  3HPG A;  3HPH A;  5CLS A;  5E18 F;  3SXY A;  4FQG A;  2QKM B;  5IP7 J;  1Z0X A;  3M7G A;  2HZD A;  4F91 B;  5TJJ A;  1X1A A;  1S9H A;  3HRU A;  3DPT A;  4F3Q A;  5J8C A;  3BG9 A;  1K61 A;  3MAJ A;  2A6T A;  4XID A;  4LD5 A;  2EZI A;  2YS9 A;  1LNW A;  4GO1 A;  1J75 A;  4F52 A;  3L2Q A;  2DOE A;  3VB2 A;  2B63 J;  3SQN A;  1APL C;  4I7H A;  1OKR A;  4CCO A;  2GIV A;  1BJA A;  2MG4 A;  3K1M A;  5D5X B;  4L9T A;  1EA3 A;  1BR4 A;  3DFG A;  4OMY A;  4JYK A;  2FE3 A;  4B1R A;  1GDT A;  4RGX A;  4WK8 F;  2E2I J;  3N05 A;  1DPR A;  3AAF A;  1Y0U A;  4ZDL A;  2A07 F;  2X1D A;  3FXU A;  1WSU A;  2IGO A;  3ZGK A;  3OIQ A;  2W1O A;  1TP4 A;  4HSR A;  4GDF A;  4LG0 A;  3B73 A;  5HOD A;  3JSP A;  5H6Q A;  1D1A A;  4I0A A;  5CVU A;  2PJR B;  4ZC3 A;  3CCJ I;  4M71 A;  4UUV A;  2JMW A;  2ACJ A;  2ZB9 A;  1XSD A;  2ZXH A;  5E3L A;  2LF8 A;  5CJ9 A;  4XOP A;  4KN4 X;  3M8E A;  3JRB A;  2K7L A;  1FIA A;  2DPU A;  4B44 A;  5HDN A;  5EEG A;  2M4G A;  1BI3 A;  2UXX A;  3CES A;  5E20 A;  4BU2 A;  1PUE E;  2AXL A;  3HC7 A;  4UNO A;  2MYS A;  4AM3 A;  5E17 F;  5FFZ A;  2X9D A;  1MNM C;  2FQ4 A;  1ETQ A;  4HF2 A;  1D0Z A;  1RUN A;  2NYX A;  4AIH A;  2QCO A;  2BY0 A;  2VI6 A;  4XLE A;  3BR2 A;  2O6G E;  2NRA C;  5IYD J;  1LVK A;  4E7S A;  3BR5 A;  1BR2 A;  4MHG A;  2GXB A;  1QA6 A;  1TQM A;  1ZR4 A;  4R79 A;  1FC3 A;  1JUP A;  4HF1 A;  3H3V K;  2DFI A;  3H5N A;  5GAD J;  4CYC A;  3RPQ A;  2HZT A;  4ZJZ A;  4L0Y B;  1JUS A;  3GBG A;  2DOF A;  3G1L A;  5HS9 A;  2A5W A;  3CCL I;  2ELH A;  1QHH D;  1HXD A;  3KP7 A;  1RC9 A;  4HEA 2;  1ZN2 A;  3ZQF A;  1TL8 A;  3O2P E;  2OA4 A;  4OU0 A;  4A0X A;  1KQ9 A;  2R7O A;  4CIC A;  3T0Y A;  3GX4 X;  2R7R A;  5DUK A;  3OYH A;  3WTX C;  1JT0 A;  5H6R A;  4BHP A;  4CYC B;  3BC8 A;  2UWM A;  2VN2 A;  3MD2 A;  5F0F A;  4MTE A;  4HNU A;  2MAB A;  2XRL A;  4H0E A;  3H5A A;  1QBJ A;  1NG6 A;  2KIM A;  1IRZ A;  5EJC A;  1SVL A;  1WZ2 A;  1SEU A;  3E6M A;  5EG0 A;  2DYS H;  4PSW A;  4RGR A;  3RDI A;  4C3J J;  2EA2 A;  4CGZ A;  1ETK A;  2XSJ C;  1TTY A;  2HKO A;  4MQV A;  3REO A;  1U9O A;  1MJB A;  1Z05 A;  4ZTJ A;  3CLQ A;  3MVP A;  4HF0 A;  1FJL A;  2RN7 A;  1I50 J;  1R1U A;  1TBX A;  1NHA A;  1WI3 A;  3BR3 A;  2ADU A;  4JX6 A;  4BH9 A;  4F93 B;  5GTI C;  2HDD A;  2F4O B;  4CA0 A;  1WCM J;  1YS6 A;  2MSY A;  3DPU A;  3MKW B;  1LQ1 A;  1MSF C;  2L9R A;  2L4A A;  2XUB A;  3I58 A;  1UFM A;  4CXF A;  2DA3 A;  4E7J A;  2EFQ A;  5ED4 A;  5EG0 B;  3CP2 A;  5DDG A;  2EK5 A;  4JQF A;  4BS9 A;  2ZJ2 A;  4YRV A;  4K2E A;  3HM5 A;  1X3U A;  1UHM A;  3ZR8 X;  3ZMT A;  1QPI A;  3U9G A;  3ZN1 A;  2FOK A;  3CCQ I;  3QPL A;  1ZRC A;  2NS8 A;  3FXR A;  2AO9 A;  2R7T A;  2OQG A;  3TED A;  4N4N B;  3PFY A;  3LAJ A;  4G6D A;  5CQE A;  1ON2 A;  4FE7 A;  1NK3 P;  3LSK A;  2DJI A;  3OS2 A;  1GT0 C;  1XGM A;  2CWE A;  1UCR A;  1MBF A;  1TC3 C;  4L5E A;  4Q4Z F;  3O3K A;  2X6X A;  1ZAO A;  5DS9 A;  2R7F A;  4HPQ A;  2RV8 A;  5LGT A;  1PDN C;  2AS5 F;  4S05 A;  3A2K A;  1HLV A;  1WVR A;  3ABL H;  1W5S A;  1XGS A;  1BR1 A;  3H3Z A;  3N97 A;  4C2M J;  2HVS A;  3W3C A;  3FM5 A;  4CCL A;  3I3L A;  1PUF A;  2KKO A;  3V7C A;  5J47 A;  5LD2 C;  3OYC A;  1JKO C;  4HA8 A;  2CUE A;  3WU1 B;  1I6X A;  3KYD B;  3VEP A;  3ZMS A;  2CUF A;  1MNE A;  4WWC A;  1K78 A;  3FKJ A;  1TWA J;  3DBR B;  3DU6 A;  1PYV A;  3G3Z A;  3H35 A;  5ICF A;  4BE0 A;  2Y9Z A;  2LFB A;  4YFN F;  1X3W B;  2KFD A;  2L01 A;  4M6Y A;  5J1Y A;  3DPL C;  3OYE A;  4UHT A;  2RNG A;  1ZG1 A;  5EF6 A;  1PUF B;  4GYI A;  1R4N B;  4I09 A;  2YR2 A;  2XPW A;  5DYM A;  3ZQC A;  1K78 B;  2VJI A;  1R00 A;  1OPC A;  3ISP A;  4XRS A;  1R5G A;  2KLO A;  1JKP C;  2ZNY A;  3COA C;  3E7L A;  1ZGW A;  3HSR A;  5E8I A;  3S14 J;  4C30 A;  4PZJ A;  4Y15 A;  3WTY C;  2XKP A;  4FIS A;  5J4Y A;  1X2M A;  4PJL A;  1ZG3 A;  4RM3 A;  2Y69 H;  4ZTF A;  1JKQ C;  2E2J J;  3HOW J;  1D1C A;  1OMI A;  2H8W A;  2JRM A;  5CYV A;  4XON A;  2PN6 A;  3ZQQ A;  3QOP A;  4WX9 A;  4LLN A;  5ILV A;  1LB2 A;  3WU2 C;  1BW5 A;  2DPD A;  1T6S A;  4PGH A;  1FP2 A;  3JRF A;  3GZ6 A;  3MCZ A;  5JLW A;  3F0C A;  3FHN A;  3E5Q A;  1KON A;  2GXA A;  2VBW A;  4JBA A;  3ASN H;  2J5P A;  3EUK L;  5EDN A;  3C2B A;  1FYM A;  5HLG A;  2XSD C;  5E79 C;  5B1B H;  1V5G A;  4M73 A;  3HHH A;  4KYW A;  5H2F C;  5IOY A;  1LUJ B;  3A4C A;  1OCC H;  5LEK A;  3OYF A;  2G0E A;  2FOW A;  2XVC A;  3VYS B;  2EPF A;  3QYE A;  4DNC A;  1LFU P;  3DU5 A;  1UAA A;  3PIP F;  5KNL A;  3DBH B;  4HLX A;  3OYK A;  3DWL E;  2OBP A;  2OZU A;  3OL3 A;  2Z3Y A;  4QLC U;  5DCM A;  5A2Q Z;  3JRH A;  3HOV J;  1YW7 A;  3JAM K;  2YX4 A;  4MFE A;  4NC6 A;  1TQI A;  2F5V A;  3KET A;  2M30 A;  3OY9 A;  4B3X A;  4Y17 A;  1JT6 A;  2CU7 A;  3OYJ A;  3BQY A;  5LRS A;  1UST A;  4MQ9 F;  5FKK A;  3FHZ A;  2DAO A;  1UEL B;  3S1Q J;  1QU3 A;  1LDD A;  2CRG A;  2K85 A;  3KCC A;  5DCM B;  1IF1 A;  1CGP A;  3OS1 A;  3T8R A;  5FLX Z;  3JR9 A;  2OPT A;  3CCM I;  3Q5F A;  1WH5 A;  2FMY A;  2WAQ A;  4WXC A;  2OZ6 A;  2E2H J;  1MMG A;  1ZKG A;  4IPA A;  2O8K A;  3LA3 A;  3P9K A;  4G12 A;  4QPQ A;  2VJ5 A;  1DP7 P;  2DQR A;  3EET A;  2L9S A;  3P5J A;  3C3W A;  2PI0 A;  2VUM J;  1A31 A;  3QAH A;  1RR7 A;  3HHG A;  4IHT A;  2DK8 A;  2NVY J;  2X85 A;  2VOO A;  1S8N A;  1MH3 A;  1MH4 A;  4AVP A;  1P9Q C;  2DFH A;  1K83 J;  5M3M J;  3CLO A;  3LAP A;  3F8F A;  1WKM A;  2DDA A;  2DK5 A;  1HKQ A;  2PMZ A;  2X51 A;  3MKL A;  4PK4 A;  3ABM H;  2VBZ A;  3ROU A;  1VQ7 I;  1BOA A;  1B4A A;  4ENK A;  3HOY J;  3S1M J;  1R5I D;  4Y4R A;  3TKY A;  1FYL A;  3LST A;  1YIT I;  4ESB A;  1GV2 A;  2WC2 A;  5FKL A;  1YIJ I;  4FAS D;  1FOW A;  4RGU A;  3MWM A;  4B47 A;  3WTU C;  3WHC A;  4D9J A;  3FF5 A;  1BC8 C;  1ETW A;  2X6Y A;  3ZXS A;  3K70 C;  1VQP I;  4BL0 B;  1ERD A;  3R60 A;  4U0W A;  3DTE A;  1SFK A;  2LDU A;  3HEF A;  4XLP F;  2A5Y B;  3SEZ A;  4RDU A;  2V6C A;  1B9N A;  2RGV A;  1VI0 A;  2ECB A;  2IJL A;  2E35 A;  1JHH A;  4XQF A;  1XN7 A;  1TZL A;  3Q9V A;  4U88 A;  3QOD A;  3FIW A;  2DMT A;  1ZLK A;  4PFO A;  1ONV A;  2GAU A;  4LIU A;  4MFD A;  2LC2 A;  1YIO A;  4IHX A;  2K5C A;  3IRQ A;  3JCU C;  4U7B A;  3PJR A;  1RKW A;  3HUG B;  4A3J J;  2MH2 A;  1HF0 A;  4JOM A;  1YQA A;  3VOD A;  2F48 A;  2JK3 A;  4QIW N;  3HG9 A;  2KIS A;  2QLZ A;  4Q48 A;  3WE3 A;  3DKW A;  4E4H A;  1JE8 A;  2MC4 A;  3GUD A;  4EJO A;  3LL7 A;  2O5R A;  4M72 A;  4G6T B;  4ABZ A;  1L0O C;  1V4R A;  1N77 A;  2EV6 A;  3NWT A;  4DBQ A;  3S2H J;  3GFI A;  2FNA A;  1MZB A;  3RCO A;  3FKI J;  3PIO F;  4M6X A;  3S3O A;  2I10 A;  1F9N A;  2DOD A;  3BJ6 A;  2ECC A;  2VE9 A;  3DTK A;  1OR7 C;  5EGO A;  2ZSI B;  3KZI C;  4BBS J;  1ZRD A;  1EKE A;  2PX9 A;  1TNT A;  5FGM A;  5ICC A;  3D0S A;  4UVB A;  1X58 A;  1T08 B;  4LFU A;  5H20 A;  5KVR A;  1XB4 A;  4G6Q A;  5FRM A;  4IOA F;  3ZQ7 A;  3K0L A;  1D5Y A;  1IZ1 A;  4UB6 C;  1IDZ A;  1EF4 A;  3K4M A;  2E5N A;  4XM3 A;  2PBI A;  2EZH A;  1W0U A;  1Q1H A;  5HS7 A;  1IXS B;  3WGH A;  2ZCW A;  1SFO J;  5E3O A;  2ID6 A;  3KPH A;  4S0H B;  1KU9 A;  2LRD A;  2LRE A;  1T2K A;  1IN4 A;  2F5D A;  5GP9 A;  2V26 A;  3OYN A;  1RR8 C;  3QWL A;  2FBI A;  1SFX A;  4KIB A;  3ZQI A;  3PSI A;  2L7M P;  5F1J A;  1G3T A;  3ERE D;  2NS0 A;  2ESH A;  4N9H A;  2E34 A;  4BHC A;  1ZG5 A;  1FOY A;  4A3C J;  2XIG A;  4PDK A;  2A68 F;  3R6S A;  4WXH A;  2IT0 A;  1J5Y A;  1XG1 A;  4BHB A;  4HQM A;  3HGY A;  2YX7 A;  4H4K C;  4NQW A;  1ZLJ A;  2KJC A;  1WWX A;  2DA7 A;  4M3F A;  3F23 A;  3SFZ A;  3IC7 A;  3L2V A;  4KNY A;  2O8X A;  4RBO A;  2ELJ A;  4BYY A;  3QP5 A;  3TP0 A;  2ZJR F;  2D45 A;  3BTI A;  1WPK A;  2KRF A;  2DTZ A;  2W00 A;  5CVJ A;  4ASN A;  1IDY A;  1TT0 A;  1W4M A;  1KQ8 A;  2DN0 A;  1XD7 A;  2K3F A;  4A12 A;  4U0V A;  5JVT A;  3HSE A;  1DQU A;  2E36 A;  4NDL A;  1YS7 A;  4NQW B;  4XBF A;  5K7H A;  5C4J J;  1WJE A;  2BEO A;  5FD6 A;  2OUM A;  1A5J A;  5LGN A;  3Q3S A;  2QF7 A;  2I5U A;  3GEZ A;  2XAQ A;  3GW2 A;  2KRH A;  1F43 A;  3VDX A;  3G73 A;  1M1E B;  2QSF X;  4A0Y A;  2L3D A;  2STW A;  1ITY A;  4I99 C;  3BT9 A;  2HWV A;  3HBL A;  2CG4 A;  3BWG A;  3SDG A;  3RJP A;  1LE8 A;  3IH2 A;  4IJA A;  2M2E A;  4AUX A;  5EEH A;  2L2O A;  1HW2 A;  2M0M A;  1TLH B;  4IOC F;  2G7U A;  2FA5 A;  1W1W E;  1TQP A;  3E6D A;  3CDL A;  2LKX A;  6PAX A;  3EDP A;  3CCR I;  2ELK A;  5J1U A;  4IHW A;  5E3M A;  4PUS A;  4A0Z A;  2RDP A;  2WTE A;  3S3M A;  4E7L A;  4BEH B;  1P92 A;  4JP0 A;  2CV1 A;  3F8N A;  3FMQ A;  3D5S C;  1YW9 A;  1IUY A;  4XSZ F;  2JUG A;  2M7A A;  2HXO A;  4E70 A;  3FBI B;  3AG1 H;  3BOQ A;  4ZDO A;  3Q0U A;  1B59 A;  2EJR A;  4Y13 A;  3JRC A;  3ABU A;  2O7O A;  1W5T A;  3I0T A;  1QZE A;  1HQC A;  1ENH A;  4ENJ A;  2XHK A;  5DM6 F;  2RC4 A;  1BM9 A;  2Y0M A;  2IVM A;  2R5Z A;  1D0Y A;  5HNH A;  5FO5 A;  2EIJ H;  3ABK H;  3CUO A;  3K69 A;  3VOE A;  3OS0 A;  1YRN A;  4HDV A;  2HTS A;  5FRO A;  1SMY F;  2ICW G;  2HVR A;  3BCB A;  2JA7 J;  5FKN A;  2MA3 A;  3CC4 I;  3IWF A;  1YG2 A;  4HV6 A;  3CCY A;  1OCZ H;  3LSP A;  1ZQ3 P;  5ILU A;  5K5Q A;  3AFH A;  4A69 C;  3DQV C;  2FXA A;  3FXQ A;  4G8X A;  4LG3 A;  5DV5 A;  2HQA A;  4LLG F;  2K9L A;  2R5Z B;  2Y2Z A;  3C2G A;  4M3G A;  4V2G A;  3OSG A;  1YRN B;  5F0H A;  2Z9O A;  3K4J A;  2QSG X;  1MMS A;  2DA5 A;  1X1B A;  3EYI A;  3CJN A;  2EIM H;  4FCY A;  1WJ5 A;  3QYB A;  3KP3 A;  3E5U A;  2IS4 A;  3OYL A;  2O3F A;  2PG4 A;  3CUQ B;  3MZY A;  3G6E I;  1GHC A;  1X1D A;  5B1A H;  2JRT A;  2DQL A;  2LY9 A;  4IXA A;  1MBH A;  2HYF A;  3S1R J;  2LYC A;  3JRE A;  1U5T C;  3IHU A;  5L3F A;  2D1V A;  1LFB A;  3IP4 B;  4CDG A;  1I27 A;  1OFC X;  1WQ2 A;  2V7F A;  4C3I J;  4OIQ F;  2MC3 A;  4AID A;  1MMD A;  3CP8 A;  2WBM A;  4C3H J;  5D5W B;  5ICE A;  3MKY B;  1R71 A;  2H8R A;  1O7F A;  4DJA A;  3S2D J;  3K4K A;  1XSV A;  2HFH A;  2JTV A;  3TBI A;  3TO7 A;  2ZO4 A;  4EGZ A;  2JA8 J;  4MO7 A;  3S17 J;  1J09 A;  3S93 A;  3DKY A;  5EZG A;  2GA1 A;  5BPI A;  3S3N A;  1FWZ A;  2ISZ A;  3H1C A;  2HOS A;  2PJR A;  3Q0V A;  1T39 A;  2HPI A;  4NB5 A;  3LOC A;  1XDU A;  2M1B A;  3LNQ A;  1YJW I;  1ULY A;  2ZKZ A;  4KFC A;  4ZYA A;  1WJD A;  1R23 A;  3GTK J;  2C6Y A;  1HW1 A;  1YHQ I;  1FNN A;  1OLT A;  1R1V A;  3RKQ A;  3V8J A;  2QUF A;  1QZY A;  1DGR M;  4M9S A;  3S16 J;  2UXN A;  4UUS B;  2IGN A;  3O8G A;  1ETV A;  1P6R A;  1BA5 A;  2BY2 A;  2FML A;  3X2Q H;  4YII A;  2EFN A;  3LA7 A;  2R7W A;  1IG7 A;  3G1O A;  4Y3O A;  1MBE A;  2O0Y A;  2M5W A;  1OQY A;  3CUQ C;  1CQT A;  3IKV A;  2DTR A;  4D5F A;  3WTV C;  2MW8 A;  2WWY A;  1SC7 A;  1USS A;  2CFO A;  1FLI A;  1TWG J;  1RKT A;  4I02 A;  1BN5 A;  1MJ9 A;  1WJA A;  2XGX A;  2M0C A;  3PNV A;  1KYW A;  3VFZ A;  1Y56 A;  4OOI A;  2E71 A;  4DBR A;  1VND A;  2P6T A;  1XTA A;  2KL4 A;  2O61 A;  2XAH A;  4L9J A;  3GLL A;  3K2A A;  2V1X A;  3T8T A;  3TO6 A;  2B9S A;  2JA6 J;  2VON A;  2XKO A;  1UHW A;  4B8X A;  4RB3 C;  3I55 I;  2HOT A;  1NK2 P;  2LF7 A;  1DU6 A;  5J6X A;  1KU7 A;  2BYV E;  1BIA A;  1EH8 A;  2WAE A;  3F8C A;  2BV6 A;  3PM1 A;  4M3B A;  5FD5 A;  1TW3 A;  2WAQ N;  4HNV A;  3MEX A;  4CZC A;  2ZFU A;  2GBY A;  4HST A;  2QEN A;  1KZH A;  1XMA A;  5JLX A;  5A2Q K;  3FXL A;  2K9N A;  4Y33 A;  3PFI A;  2HTJ A;  2GM4 A;  2E1O A;  1HST A;  1TT5 B;  1REP C;  3IWZ A;  4GXO A;  2Y30 A;  2P4W A;  4BQO A;  3J81 K;  4DYQ A;  3L00 A;  2CGP A;  5DD8 A;  1AWC A;  2OTJ I;  1YFH A;  4BAY A;  1B8I A;  3K4C A;  2PMZ N;  2EZK A;  5J1R A;  5D5U B;  2KMU A;  4WF2 A;  3PNT A;  4XLA A;  1T38 A;  5FLX K;  2CMP A;  3F6O A;  3NWS A;  3K4L A;  3PL8 A;  2I8D A;  3SZP A;  2ME6 A;  4XR6 A;  3SYT A;  5BNG A;  5FLM J;  5KHD A;  2A05 A;  3K70 D;  5C44 J;  2MLK A;  1P7J A;  4XN3 A;  4ZZD A;  1R6R A;  2Y9Y A;  3F9K A;  4OMZ A;  1Z91 A;  1FMV A;  4BY7 J;  1B8I B;  1ZAR A;  1QNT A;  4RLF A;  5LRR A;  5M5Y J;  2L9N A;  4OIO F;  3WHB A;  2Z5U A;  3M07 A;  2CUJ A;  3LMM A;  1RZ4 A;  2PJP A;  2HXI A;  2TRT A;  5J40 A;  2DA4 A;  2NVT J;  1Z6R A;  1IUF A;  1S29 A;  2Z33 A;  5JVG F;  3RKY A;  1BI2 A;  3TMO A;  4XLH A;  2LOO A;  3QPS A;  2B0L A;  3HYI A;  2VQG A;  4II2 A;  2DOA A;  3KYL A;  2R7V A;  4Q47 A;  3JRD A;  1R7J A;  5E1X A;  1BI0 A;  3KP5 A;  4XIC A;  1GUU A;  4XKW A;  1BBY A;  3OYM A;  3OYI A;  2FNP A;  4FX0 A;  4XKB A;  3KEQ A;  3L2U A;  5F08 A;  2V9V A;  2R7X A;  2W25 A;  2M9H A;  4V2F A;  2DLL A;  2HDW A;  2MGQ A;  1YI2 I;  4KIG A;  4L5I A;  1OCR H;  1FY7 A;  2HYJ A;  4DYC A;  1AA7 A;  1WJC A;  1XC5 A;  2COM A;  2M7B A;  1HOM A;  3QPT A;  3GFL A;  3GTJ J;  2P6S A;  1E3P A;  3HXL A;  3I59 A;  3OIP A;  2PFB A;  5HNF A;  1PP7 U;  3RTR A;  2IA2 A;  3RI4 A;  4HG2 A;  4HBL A;  3MMY B;  4RA2 A;  2IRF G;  5GPA A;  2DDB A;  3WTT C;  3ABT A;  5KAI C;  4EEF G;  2QA4 I;  1X19 A;  3GVA A;  1U8R A;  2EIK H;  1D1B A;  3V8K A;  5IP9 J;  1FX7 A;  5CVV A;  2BVL A;  3KEY A;  3I59 B;  5BPD A;  1IXC A;  1MMA A;  5E1Z B;  2XAG A;  2Z16 A;  2CQK A;  4IX7 A;  4HX4 A;  4AD9 A;  2VJ4 A;  1QPM A;  2DO7 A;  2P5V A;  2VT2 A;  5KCM A;  2L9V A;  3K1P A;  3DEW A;  2CS3 A;  4ZYH A;  2MD5 A;  3GME A;  5FKO A;  4V19 K;  3H9Q A;  4HLY A;  2VQC A;  2ZME A;  2ZJP F;  2V79 A;  3ZQH A;  1AHD P;  5D6E A;  1Q1V A;  4L9N A;  4DIQ A;  2L54 A;  4EVI A;  1L3L A;  1R1T A;  1BW6 A;  1WJB A;  4E6K G;  3U21 A;  1VQ9 I;  2WY8 Q;  2RRE A;  1ETX A;  2BY1 A;  4HW0 A;  1K6Y A;  1O3S A;  2ME0 A;  3HRT A;  4LB5 A; 
#chains in the Genus database with same CATH homology
 3OOP A;  1Z6T A;  2ZME B;  3ZN0 A;  3I5U A;  4WCG A;  1LDK B;  4B09 A;  3WTZ A;  3TOB A;  1P4X A;  3C7J A;  2JPB A;  3KLO A;  1E17 A;  4RGS A;  2IW5 A;  3GWZ A;  4ETS A;  3R61 A;  5ICG A;  1SAX A;  3V4G A;  1VTN C;  5L3E A;  2W84 A;  1WRJ A;  3V7R A;  1XGO A;  3DXJ F;  1G3W A;  1EH7 A;  4A5M A;  4KIF A;  3IKT A;  3BJO A;  3B02 A;  3F8M A;  3R4K A;  1DDN A;  2JZY A;  3OV8 A;  1IN7 A;  1P2F A;  2FRH A;  1ZRE A;  3GFM A;  4FHT A;  3L2C A;  3E6C C;  4GGG A;  1U6G A;  4TV7 A;  2RNJ A;  4L5J A;  1ON1 A;  3ECH A;  2O03 A;  3JTH A;  3TGN A;  1OR7 A;  1BC7 C;  3HTS B;  5L3D A;  4LK1 F;  1IN5 A;  1O3R A;  2CFX A;  4P5O A;  1O57 A;  2JSC A;  3BDD A;  1HSJ A;  5BS6 A;  4IRG A;  1R22 A;  3KEO A;  1D5V A;  3JSO A;  3BP8 A;  1K6O A;  2NNY A;  4BNC A;  3E5X A;  3GLX A;  4IRH A;  3HUG A;  4IF4 A;  4QWQ A;  2XRO A;  3NEU A;  4HDU A;  1FT9 A;  1S7A A;  2L02 A;  4HQE A;  4F7Z A;  3FMS A;  2A61 A;  1Z1D A;  3CTA A;  3NRV A;  3QPH A;  4O6J A;  5D5V B;  4U0Y A;  3K1N A;  2IA1 A;  1IW7 F;  2OU2 A;  1EH6 A;  5DD4 A;  3F22 A;  4M9X A;  1ZGJ A;  1ZYR F;  3V8L A;  2ZBK A;  2RKH A;  4LJZ F;  1J9I A;  1C0W A;  1ZH5 A;  4UXN A;  2Z99 A;  1U3E M;  4M74 A;  2KIU A;  3IRR A;  2BGC A;  4HAM A;  2DU9 A;  1A04 A;  2H09 A;  5BMZ A;  3NQO A;  2F5C A;  2HEO A;  3I54 A;  1MGT A;  1QQI A;  4N0B A;  4G7O F;  3KZY A;  3CDH A;  5JR3 A;  4CO8 A;  4D0P A;  3WU0 A;  4EV0 A;  1KU2 A;  2HYG D;  1J59 A;  2RQP A;  5K5R A;  4L18 B;  3GXO A;  2VC0 A;  1FZP B;  4ZH4 F;  1J0R A;  1B6A A;  3F72 A;  1MDM A;  3F21 A;  3LA2 A;  2DI3 A;  2H6B A;  2CO5 A;  4YIF A;  1KQ0 A;  2ESN A;  4MEX F;  3EYY A;  4UV9 A;  1MDM B;  3LFK A;  2XAS A;  3T5X A;  3F3X A;  1E2X A;  1D8K A;  4OIP F;  1ZRF A;  4NHJ A;  5JHU A;  2NNN A;  1B9M A;  4EJW A;  2A6H F;  3R0J A;  4ESJ A;  2H27 A;  1U5T A;  4ENM A;  3TO9 A;  2GQQ A;  1SD6 A;  4YG2 F;  1GXQ A;  2K27 A;  5K5O A;  1JXS A;  4IRI A;  4LMY A;  1FP1 D;  3TQN A;  1XGN A;  2BBY A;  2IP2 A;  4KMF A;  3L7W A;  1U5T B;  1D3Y A;  2E1C A;  5LGU A;  4PCQ A;  3HIF A;  4UVA A;  1T0F A;  4RAY A;  3LQQ A;  3D5L A;  2GZW A;  2WV0 A;  1SFU A;  2CW0 F;  3GYH X;  1XCB A;  3WGG A;  1FBS A;  2PMU A;  3ZMU A;  5JFR A;  2M45 A;  2E1N A;  2STT A;  1IRF A;  4MNU A;  2QM3 A;  5ILS A;  5DCF A;  3CUQ A;  3QRF F;  1S7O A;  1H0M A;  5L3C A;  1QO0 D;  2VXZ A;  1RI7 A;  2K4J A;  2K02 A;  2ISY A;  4LLL A;  1HKS A;  2K4B A;  1QGP A;  2FF4 A;  3KP6 A;  4EMS A;  1W7P B;  1P4A A;  2EA4 A;  4M9Z A;  5FFX A;  2M87 A;  4ZYD A;  1Z7U A;  4O3M A;  5DEQ A;  2Q8K A;  1YYV A;  4KDP A;  2DT5 A;  1DPU A;  3WG9 A;  1I5Z A;  4PGG A;  5IT3 A;  1SD4 A;  5KK1 A;  2XRN A;  4UVC A;  3KP4 A;  3RIR A;  4IHS A;  3WTS C;  4ZYG A;  3KFW X;  3BZ6 A;  3C18 A;  3FZV A;  4A6E A;  3T1B A;  1FBQ A;  3KE2 A;  3QU6 A;  1GXP A;  2EFP A;  1KA8 A;  3CO7 C;  2FSW A;  5AIQ A;  4I0B A;  5D6F A;  2G9W A;  5AON A;  4HX8 A;  1F5T A;  4KA4 A;  3HRM A;  3JTG A;  5HLI A;  5CVR A;  2LSO A;  3JW4 A;  3V7S A;  3ZMV A;  2FBH A;  2EV5 A;  4RS8 A;  3H92 A;  1H9T A;  1CF7 A;  4OIN F;  3KLN A;  4HV5 A;  5HDG A;  1FPQ A;  1V3F A;  2H94 A;  5E1W A;  2XAF A;  2DW4 A;  1OYY A;  4LG0 B;  1J7K A;  1O3T A;  1CF7 B;  2FU4 A;  2VOP A;  1HKT A;  3ULQ B;  4I2O A;  1XSX A;  5IT9 Z;  4R8H A;  4A2U A;  4L0Z B;  1IXR C;  4HZF A;  1LEB A;  3EUH A;  2P7C B;  3E3V A;  2ZFW A;  3L9F A;  2Q0O A;  2G7H A;  4P9F A;  4LGW A;  4KN7 X;  3QP6 A;  3HTU A;  3SHF A;  2BE5 F;  3I64 A;  5F64 A;  3K2Z A;  1R5H A;  1Z9C A;  2TDX A;  2MH9 A;  3PQJ A;  2PLY A;  3DF8 A;  4G9Y A;  1SMT A;  5CVI A;  3PQK A;  3W6J B;  2XAJ A;  1P4W A;  3KZZ A;  4L9V A;  2VBX A;  3ZP5 A;  1QZZ A;  2VBY A;  3J80 Z;  2A3S A;  3I53 A;  4YFK F;  3N4M A;  3CO6 C;  2PEX A;  3BY6 A;  2A69 F;  3BJA A;  3GO5 A;  2HQN A;  1EV7 A;  1XDS A;  4P9U A;  3S2W A;  4CZZ A;  4HOB A;  4S04 A;  2YU3 A;  2D1H A;  2HOE A;  3BPV A;  2GWR A;  2EFO A;  2HDC A;  2Y75 A;  3ZMZ A;  3P9I A;  1J2X A;  2OAZ A;  1GVJ A;  5ERI A;  3F8B A;  4FX4 A;  1SFE A;  2P5K A;  1UB9 A;  2QYO A;  4ESF A;  4HX7 A;  5LBQ A;  1YW8 A;  4JK1 X;  4BXU A;  1ZGA A;  4ZYE A;  5DUI A;  3M8F A;  2P8T A;  1S3J A;  2QVO A;  5L3B A;  2VOD A;  2HR3 A;  5F6F A;  4G94 A;  4CHU A;  4UV8 A;  1YTY A;  2HKX A;  1IN8 A;  2PQ8 A;  3RKW A;  1F1Z A;  3WGI A;  1HW5 A;  3HOS A;  5LEJ A;  1JHF A;  3DP7 A;  2W85 A;  1LEA A;  2OQR A;  1BI1 A;  4EM0 B;  1R58 A;  3DV8 A;  5HLH A;  4G7H F;  1O7L A;  1TW2 A;  3ELK A;  1FSH A;  3MFK A;  1K79 A;  4RB1 A;  3FX3 A;  3GFJ A;  2MLG A;  5JI6 A;  3ECO A;  4MGR A;  2M8E A;  2F5F A;  2DBB A;  5HS8 A;  2ETH A;  3P7N A;  4KT5 C;  1IRG A;  1G3Y A;  1FBU A;  4EQQ A;  4MTD A;  1LJ9 A;  3WOD F;  4GYG A;  3ML6 A;  2D2W A;  4WXD A;  3E97 A;  5F1R A;  2W24 A;  2X0L A;  3M9A A;  4AIK A;  5HDK A;  2MBF A;  1RNL A;  1G6N A;  4G7Z F;  1G4D A;  5D8K B;  3J81 Z;  1RUO A;  1B1B A;  4AIJ A;  2E7W A;  2JT1 A;  2GA2 A;  2EB7 A;  1SD7 A;  2VC1 A;  1IN6 A;  1MKM A;  5HVQ C;  2KIF A;  3TDZ C;  5LHH A;  1I1G A;  2QQ9 A;  1KYZ A;  2QWW A;  3I4P A;  1OYW A;  3R0A A;  4ZZL A;  2X4H A;  3SZT A;  3WTW C;  3F6V A;  2K86 A;  3K9T A;  2R7D A;  2YSR A;  4A5N A;  1AOY A;  1FSE A;  3IL2 A;  2P5L C;  1O3Q A;  2CSO A;  1JGS A;  2F2E A;  4KMU X;  1YLF A;  3U2R A;  1U78 A;  4YFX F;  3FWE A;  4XRF A;  4N9I A;  3MZH A;  1SD5 A;  2IPQ X;  3DEU A;  3P9C A;  4GCV A;  4Z2Y A;  2LKP A;  2Y48 A;  4AWX B;  3GF2 A;  2EV0 A;  3BPX A;  3RYR A;  3ZPL A;  1KGS A;  4A6D A;  1LDJ A;  1BIB A;  2P7V B;  4IVN A;  1W7P D;  2F5E A;  1I1S A;  4DQ2 A;  2FBK A;  4ON0 A;  3RPU A;  4FT8 A;  3FM3 A;  3W6K B;  3I71 A;  3E6B A;  5D4S A;  3BRO A;  2IA0 A;  2J5O A;  2PMH A;  1PP8 F;  2GXG A;  3M1E A;  5AIP A;  3C1D A;  2ZNZ A;  4EM1 A;  1YO5 C;  2XV4 S;  4BQA A;  5TRD A;  5BOX A;  2FEZ A;  4O5V A;  2HQR A;  1FYK A;  5J8F A;  2VE8 A;  3HRS A;  4EM2 A;  1XMK A;  1STZ A;  3TDU C;  4U7D A;  1HBX G;  4Q5S F;  2HS5 A;  1LVA A;  5FB2 A;  1WI9 A;  3WE2 A;  4ENN A;  3LQR A;  2R3S A;  4OIR F;  3TOA A;  2QQA A;  1DUX C;  5HOO A;  2JPC A;  2H6C A;  2Q2E A;  1FOK A;  5LHG A;  1ODD A;  4P96 A;  5IT9 K;  3JAM Z;  4RAZ A;  1G3S A;  3MQ0 A;  1KU3 A;  4I01 A;  5E8G A;  3HSF A;  3U1D A;  2V1U A;  3KP2 A;  2NAZ A;  4P55 A;  2V1D A;  3RYP A;  1IAW A;  1D8J A;  3Q9S A;  2QZ8 A;  3O6B B;  2W57 A;  4KIC A;  3LWF A;  2L4M A;  1RIO H;  2FQ3 A;  2QQB A;  3EQL F;  1MJA A;  3RKX A;  4HYE A;  2LNB A;  4I98 B;  5D8L B;  2UZK A;  3HOT A;  1U2W A;  4LB6 B;  4EJT A;  2A6E F;  1ZHF A;  2QBY A;  5D4R A;  1H9G A;  3GZ5 A;  1MD0 A;  2EFW A;  3FMR A;  1R36 A;  1W7P A;  5LLQ A;  2ZXJ A;  4EGY A;  2E7X A;  3QU3 A;  2OD5 A;  2YPR A;  3J80 K;  3H3U A;  4XLN F;  2QBY B;  1T98 A;  2HGC A;  2RVC A;  4EJV A;  3L09 A;  2EWN A;  2VT3 A;  4RB0 A;  1K7A A;  3J7A O;  1F4K A;  2KJB A;  5LHI A;  5K1Y A;  4LK0 F;  1XCV A;  2CYY A;  4RB2 C;  1OYI A;  4CYD A;  5BQT A;  1TNS A;  4KUM A;  4XSX F;  4MEY F;  4R1H A;  4EJU A;  5L3G A;  1S6L A;  3ZMD A;  5CLS A;  5E18 F;  3SXY A;  3M7G A;  5TJJ A;  3HRU A;  3DPT A;  5J8C A;  3MAJ A;  4LD5 A;  4GO1 A;  1LNW A;  1J75 A;  3VB2 A;  3SQN A;  4I7H A;  1OKR A;  2GIV A;  1BJA A;  3K1M A;  5D5X B;  4L9T A;  3DFG A;  4OMY A;  2FE3 A;  4RGX A;  4WK8 F;  1DPR A;  3AAF A;  1Y0U A;  2A07 F;  3FXU A;  1WSU A;  4LG0 A;  3B73 A;  3JSP A;  5H6Q A;  4I0A A;  5CVU A;  4UUV A;  4M71 A;  2ACJ A;  1XSD A;  2LF8 A;  5CJ9 A;  4KN4 X;  3M8E A;  2K7L A;  2DPU A;  5HDN A;  5EEG A;  1BI3 A;  2UXX A;  5E20 A;  1PUE E;  2AXL A;  4UNO A;  5E17 F;  5FFZ A;  4HF2 A;  1RUN A;  2NYX A;  4AIH A;  2O6G E;  2NRA C;  4MHG A;  2GXB A;  1TQM A;  4R79 A;  1FC3 A;  4HF1 A;  2DFI A;  3RPQ A;  2HZT A;  4L0Y B;  5HS9 A;  2ELH A;  1HXD A;  3KP7 A;  1ZN2 A;  3O2P E;  2OA4 A;  4OU0 A;  4A0X A;  1KQ9 A;  4CIC A;  3T0Y A;  3GX4 X;  5DUK A;  3WTX C;  5H6R A;  4BHP A;  2UWM A;  2VN2 A;  4MTE A;  4H0E A;  1QBJ A;  2KIM A;  3E6M A;  3RDI A;  4RGR A;  2EA2 A;  4CGZ A;  1TTY A;  2HKO A;  4MQV A;  3REO A;  1MJB A;  1Z05 A;  4HF0 A;  2RN7 A;  1R1U A;  1TBX A;  1NHA A;  4BH9 A;  2ADU A;  1YS6 A;  1LQ1 A;  2L4A A;  2XUB A;  3I58 A;  1UFM A;  4CXF A;  2EFQ A;  5ED4 A;  5DDG A;  2EK5 A;  4JQF A;  2ZJ2 A;  4K2E A;  1X3U A;  1UHM A;  3ZMT A;  3U9G A;  3ZN1 A;  2FOK A;  1ZRC A;  3FXR A;  2OQG A;  3LAJ A;  4G6D A;  1ON2 A;  1XGM A;  2CWE A;  1UCR A;  4Q4Z F;  3O3K A;  1ZAO A;  2R7F A;  2RV8 A;  5LGT A;  1PDN C;  2AS5 F;  4S05 A;  3H3Z A;  1W5S A;  1XGS A;  3N97 A;  3FM5 A;  2KKO A;  3V7C A;  4HA8 A;  3WU1 B;  1I6X A;  3VEP A;  3ZMS A;  4WWC A;  1K78 A;  5ICF A;  3G3Z A;  4YFN F;  2L01 A;  4M6Y A;  3DPL C;  4UHT A;  1ZG1 A;  4GYI A;  4I09 A;  2YR2 A;  5DYM A;  1K78 B;  1R00 A;  1OPC A;  3ISP A;  1R5G A;  2ZNY A;  3COA C;  3HSR A;  5E8I A;  4PZJ A;  4Y15 A;  3WTY C;  2XKP A;  1ZG3 A;  1OMI A;  5CYV A;  2PN6 A;  3QOP A;  4WX9 A;  4LLN A;  5ILV A;  1LB2 A;  2DPD A;  1T6S A;  4PGH A;  1FP2 A;  3GZ6 A;  3MCZ A;  3E5Q A;  2VBW A;  4JBA A;  2J5P A;  1FYM A;  5HLG A;  4M73 A;  3HHH A;  4KYW A;  5LEK A;  2XVC A;  4DNC A;  4HLX A;  2OBP A;  2OZU A;  2Z3Y A;  4QLC U;  5DCM A;  5A2Q Z;  1YW7 A;  3JAM K;  2YX4 A;  1TQI A;  3KET A;  2M30 A;  4Y17 A;  5LRS A;  1UST A;  4MQ9 F;  3FHZ A;  2DAO A;  1LDD A;  3KCC A;  5DCM B;  1IF1 A;  1CGP A;  3T8R A;  5FLX Z;  3Q5F A;  2FMY A;  4WXC A;  2OZ6 A;  4IPA A;  3LA3 A;  3P9K A;  1DP7 P;  2DQR A;  3EET A;  2PI0 A;  3C3W A;  3QAH A;  3HHG A;  4IHT A;  2DK8 A;  2VOO A;  1S8N A;  4AVP A;  3CLO A;  3LAP A;  3F8F A;  1WKM A;  2DK5 A;  1HKQ A;  2VBZ A;  3ROU A;  1BOA A;  1B4A A;  4ENK A;  3TKY A;  1FYL A;  3LST A;  4ESB A;  2WC2 A;  4RGU A;  3MWM A;  3WTU C;  3FF5 A;  1BC8 C;  3R60 A;  4U0W A;  2LDU A;  4XLP F;  2A5Y B;  1B9N A;  2V6C A;  2RGV A;  2IJL A;  1JHH A;  1XN7 A;  3Q9V A;  4U88 A;  1ZLK A;  1ONV A;  2GAU A;  1YIO A;  3IRQ A;  4U7B A;  2MH2 A;  1YQA A;  3VOD A;  2QLZ A;  4Q48 A;  3WE3 A;  3DKW A;  1JE8 A;  3GUD A;  4EJO A;  4M72 A;  1L0O C;  1V4R A;  2EV6 A;  3GFI A;  2FNA A;  1MZB A;  4M6X A;  1F9N A;  3BJ6 A;  2VE9 A;  1ZRD A;  1TNT A;  5FGM A;  5ICC A;  3D0S A;  4UVB A;  4LFU A;  5H20 A;  5KVR A;  1XB4 A;  4G6Q A;  3ZQ7 A;  3K0L A;  1IZ1 A;  2PBI A;  1Q1H A;  5HS7 A;  1IXS B;  3WGH A;  2ZCW A;  1KU9 A;  1T2K A;  1IN4 A;  2F5D A;  2FBI A;  1SFX A;  4KIB A;  1G3T A;  3ERE D;  2NS0 A;  2ESH A;  4N9H A;  4BHC A;  1ZG5 A;  2XIG A;  4PDK A;  2A68 F;  3R6S A;  4WXH A;  2IT0 A;  1J5Y A;  4BHB A;  4HQM A;  2YX7 A;  4NQW A;  1ZLJ A;  2KJC A;  1WWX A;  3F23 A;  3SFZ A;  3IC7 A;  4KNY A;  2O8X A;  4BYY A;  2D45 A;  3QP5 A;  2KRF A;  5CVJ A;  4ASN A;  1KQ8 A;  1W4M A;  1XD7 A;  4A12 A;  4U0V A;  5JVT A;  3HSE A;  1YS7 A;  4XBF A;  2BEO A;  5FD6 A;  5LGN A;  3GEZ A;  2XAQ A;  3GW2 A;  3G73 A;  4A0Y A;  2L3D A;  2STW A;  2HWV A;  2CG4 A;  3BWG A;  3RJP A;  4IJA A;  5EEH A;  1HW2 A;  1TLH B;  2G7U A;  2FA5 A;  1TQP A;  3E6D A;  6PAX A;  3EDP A;  4A0Z A;  2RDP A;  2WTE A;  1P92 A;  3F8N A;  3FMQ A;  1YW9 A;  1IUY A;  4XSZ F;  4E70 A;  3BOQ A;  1B59 A;  2EJR A;  4Y13 A;  3ABU A;  1W5T A;  3I0T A;  1HQC A;  4ENJ A;  2XHK A;  2RC4 A;  1BM9 A;  2Y0M A;  2IVM A;  5FO5 A;  3CUO A;  3VOE A;  3K69 A;  4HDV A;  2HTS A;  1SMY F;  2MA3 A;  3IWF A;  1YG2 A;  4HV6 A;  5ILU A;  5K5Q A;  3DQV C;  2FXA A;  3FXQ A;  4G8X A;  5DV5 A;  4LLG F;  2Z9O A;  3EYI A;  3CJN A;  3KP3 A;  3E5U A;  2O3F A;  2PG4 A;  3CUQ B;  3MZY A;  1GHC A;  2JRT A;  2DQL A;  4IXA A;  2HYF A;  1U5T C;  3IHU A;  5L3F A;  2D1V A;  4CDG A;  1I27 A;  1WQ2 A;  4OIQ F;  2MC3 A;  5D5W B;  5ICE A;  1O7F A;  1XSV A;  2HFH A;  2JTV A;  3TO7 A;  4EGZ A;  2ZO4 A;  2GA1 A;  5BPI A;  2ISZ A;  1FWZ A;  1T39 A;  4NB5 A;  1XDU A;  2M1B A;  1ULY A;  2ZKZ A;  4KFC A;  1R23 A;  2C6Y A;  1HW1 A;  1FNN A;  1R1V A;  3V8J A;  2QUF A;  1QZY A;  4M9S A;  2UXN A;  1P6R A;  2FML A;  4YII A;  2EFN A;  3LA7 A;  2O0Y A;  2M5W A;  3CUQ C;  3IKV A;  2DTR A;  3WTV C;  2WWY A;  1USS A;  1FLI A;  4I02 A;  1BN5 A;  1MJ9 A;  2XGX A;  3VFZ A;  1KYW A;  4OOI A;  2P6T A;  2O61 A;  2XAH A;  4L9J A;  2V1X A;  3T8T A;  3TO6 A;  2VON A;  2XKO A;  1UHW A;  4B8X A;  4RB3 C;  2LF7 A;  5J6X A;  1KU7 A;  2BYV E;  1BIA A;  1EH8 A;  3F8C A;  2BV6 A;  5FD5 A;  1TW3 A;  3MEX A;  2QEN A;  1XMA A;  5A2Q K;  3PFI A;  2HTJ A;  1HST A;  1REP C;  3IWZ A;  4GXO A;  2P4W A;  3J81 K;  3L00 A;  2CGP A;  5DD8 A;  1AWC A;  1YFH A;  4BAY A;  5D5U B;  4WF2 A;  1T38 A;  5FLX K;  3F6O A;  3SZP A;  2MLK A;  4ZZD A;  4OMZ A;  1Z91 A;  1ZAR A;  1QNT A;  5LRR A;  4OIO F;  2Z5U A;  1RZ4 A;  2PJP A;  1Z6R A;  1S29 A;  2Z33 A;  3RKY A;  1BI2 A;  2B0L A;  3HYI A;  4Q47 A;  1R7J A;  5E1X A;  1BI0 A;  3KP5 A;  1BBY A;  2FNP A;  4FX0 A;  3KEQ A;  2V9V A;  2W25 A;  2DLL A;  4KIG A;  4L5I A;  1FY7 A;  2COM A;  3QPT A;  3GFL A;  2P6S A;  3I59 A;  1PP7 U;  2PFB A;  3RTR A;  2IA2 A;  3RI4 A;  4HBL A;  2IRF G;  3WTT C;  3ABT A;  3GVA A;  1U8R A;  3V8K A;  1FX7 A;  5CVV A;  3I59 B;  5BPD A;  1IXC A;  5E1Z B;  2XAG A;  2CQK A;  4HX4 A;  4AD9 A;  1QPM A;  2DO7 A;  2P5V A;  2VT2 A;  3K1P A;  4ZYH A;  2MD5 A;  4HLY A;  2ZME A;  2V79 A;  5D6E A;  4L9N A;  2L54 A;  4EVI A;  1L3L A;  1R1T A;  4HW0 A;  1O3S A;  3HRT A;  4LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...