4U0YA

Crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor YvoA
publication title Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transcription
total genus 24
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4u0yA00
3P9KA 1ZG1A 2MH9A 1FWZA 4UNOA 5BS6A 1G3SA 1HXDA 2VT2A 2HQNA 4LLNA 2IW5A 1ZG3A 4I98B 2OU2A 3TDZC 2DK5A 1TLHB 2XAGA 2XAHA 3WTSC 3FF5A 3CTAA 4U88A 4CDGA 2HR3A 3BPXA 3JTHA 3HHGA 1J9IA 3ZMZA 2CSOA 4WF2A 4P96A 5D5XB 2K7LA 4EJUA 1I1SA 2OZUA 3WG9A 1X3UA 4G6DA 3W6JB 2EWNA 2HQRA 2YPRA 4HX4A 2KIFA 1YO5C 2Y0MA 1VTNC 4KIGA 1G3TA 3E6CC 3DQVC 2ESHA 2O0YA 2V79A 3RTRA 2RV8A 3R6SA 5FB2A 5D6EA 2VBYA 4IXAA 4Y15A 3OV8A 2G7UA 1SD4A 4R8HA 2Z3YA 4MHGA 3LFKA 3ZPLA 3MZYA 2FNPA 2H6BA 5E1XA 3T8RA 2NRAC 2P5LC 1B9NA 4AD9A 4DNCA 4Q4ZF 2MC3A 2DW4A 1HQCA 1MGTA 2STWA 4M72A 5DCFA 1K79A 5HS9A 4OIRF 1SMYF 2L01A 3WTYC 5IT9Z 1I1GA 5K1YA 1YS7A 3LAPA 3JTGA 3F23A 1ONVA 3QAHA 5LEJA 3EQLF 1J0RA 1TBXA 4PGHA 3Q9SA 3FM5A 1OR7A 3RYPA 1W7PB 3ROUA 3GZ5A 1J2XA 5CVUA 3RPQA 2MBFA 1MD0A 1FYMA 1IXSB 3G3ZA 3PFIA 2FE3A 3I59B 4KIBA 2NS0A 1U2WA 5CVJA 1W5TA 5BMZA 2FMLA 2VC0A 2KKOA 2VT3A 4PZJA 4CZZA 3D0SA 2XASA 1OYIA 5D6FA 2C6YA 3RI4A 1IF1A 3TO6A 1V3FA 2QYOA 2LKPA 1KU3A 4HAMA 5HDGA 4HQEA 2Z9OA 4HX8A 5ICEA 2ZMEA 3Q9VA 1ZYRF 4HYEA 1BC8C 2DI3A 5H6QA 4WK8F 1HKTA 4U0YA 2IJLA 3T5XA 5L3GA 1R36A 1ZH5A 2RNJA 2FSWA 3R60A 2XAFA 4FHTA 1QGPA 4LB5A 2BGCA 1FLIA 5BQTA 4WXHA 2OBPA 4LGWA 4Y17A 2HZTA 4R1HA 1Z1DA 1BN5A 4D0PA 3Q5FA 3QU6A 5DYMA 4ZH4F 3KP2A 4IHSA 2M1BA 3LAJA 2DTRA 2MA3A 3KP5A 5L3FA 4AIHA 3TO7A 2PJPA 2IT0A 3S2WA 3WE3A 3VOEA 2D2WA 1EV7A 3SHFA 3MCZA 2Y75A 4UVBA 3KP3A 1BIAA 1YYVA 4UUVA 4IHTA 2HEOA 4LFUA 4I0BA 3RYRA 3F6OA 1ULYA 1BI0A 3ZN0A 4HLYA 3GFLA 3FX3A 4IRHA 1R7JA 3VODA 4ZZLA 3GUDA 5DEQA 1TNTA 4GO1A 4G94A 4ESBA 1QZZA 1XD7A 1D3YA 2EA2A 1QNTA 3F3XA 3FM3A 3PQJA 4EM2A 4M6YA 3FXRA 3HSFA 2XVCA 1J7KA 2CO5A 4RAZA 3ISPA 3QU3A 1EH7A 2QVOA 5CVRA 3FXUA 4ZYHA 5D8KB 3WGIA 3VB2A 1LQ1A 2OQGA 5DV5A 3K1PA 1R58A 4RB3C 3GXOA 1FSHA 3O6BB 2O3FA 3MFKA 5ICGA 1I27A 1F1ZA 4QWQA 4OIOF 1ZN2A 4A0YA 4ENNA 1DUXC 4Q48A 1PDNC 5TRDA 3RKXA 1QPMA 2ESNA 2FA5A 1G3YA 1R22A 4A6EA 1R1VA 2JT1A 2PN6A 2HKXA 4GYGA 3KEOA 3H3UA 2RKHA 2OZ6A 1T2KA 2UWMA 4U0WA 5DDGA 1XCVA 3TQNA 5FLXZ 3I0TA 5DCMA 3TOAA 3NQOA 4CHUA 1FOKA 4N0BA 5FO5A 1B9MA 3L9FA 4LK0F 1LEBA 4P55A 1J59A 2H94A 2GIVA 3C3WA 3K1MA 1ON2A 1RNLA 3WTXC 1K78B 1B6AA 2P8TA 2P6SA 2V1DA 5ICCA 1OKRA 1YG2A 1W7PD 2L4MA 1EH6A 4GGGA 1CF7B 2PG4A 3WTUC 2GQQA 2FNAA 2XAJA 1J75A 2HYGD 4M9SA 1Z9CA 2DPUA 1P6RA 3SQNA 1XGMA 2P7CB 2P5KA 3KLOA 1T38A 4HDUA 5J6XA 1Y0UA 1IXCA 3IRRA 1C0WA 5LRRA 1ZARA 4M73A 4BH9A 1U3EM 2X4HA 2F5DA 5D5WB 4MEYF 1D8KA 3FWEA 2EA4A 4MEXF 4ENMA 3GX4X 4IJAA 4EVIA 2CWEA 4A12A 3TOBA 4WX9A 2V1UA 4U7BA 4H0EA 5DUIA 5A2QK 4IF4A 2DLLA 4EGYA 4JK1X 1WQ2A 5DD4A 3HUGA 4ENKA 3U1DA 4Q5SF 3O3KA 2VBWA 1YIOA 5L3EA 1RI7A 3V7SA 5BOXA 4EJTA 4OMZA 3HTUA 3V7CA 5J8FA 3L7WA 3EYIA 4HF1A 1UCRA 1J5YA 3ZN1A 2QBYB 2O61A 1HW1A 4GXOA 2FBIA 3HTSB 2FF4A 3ZMTA 3DFGA 3V4GA 4BNCA 2A07F 4LD5A 1R1UA 3K0LA 3REOA 3KP6A 3RKYA 2QLZA 2XV4S 1GXQA 1R00A 5LGTA 5TJJA 4KDPA 5E1ZB 3QOPA 3J80K 3DP7A 4Y13A 4LG0A 1FYKA 3JAMK 1S29A 1ZRDA 1MJAA 3IWFA 2HDCA 3IKTA 4L9VA 4BXUA 1U6GA 2XIGA 1ZAOA 2GA2A 2MLKA 2M8EA 2JPCA 5HLIA 2FXAA 4ASNA 1T98A 4ENJA 4P9FA 1WWXA 3DEUA 2JSCA 3EYYA 1YFHA 4FX0A 1XGNA 1HW2A 1HBXG 3HRMA 3BROA 2GA1A 4KICA 2FRHA 1GHCA 1UHWA 1TQPA 1SFUA 4ESJA 1USSA 3J81K 4GCVA 5E17F 4S04A 1HW5A 4MQVA 1YQAA 1BI2A 3U9GA 2OA4A 1JXSA 1PP8F 3TO9A 1JHFA 2B0LA 3U2RA 2YU3A 5KVRA 1LJ9A 1TW2A 3CUOA 2F5FA 3F8BA 4RS8A 2P4WA 2DFIA 2JPBA 2JTVA 4L9NA 1TW3A 3CUQB 4IRGA 3C1DA 5LGUA 2V9VA 5IT3A 3HRSA 2O03A 4I02A 2EFWA 4CGZA 4I2OA 2NAZA 1ZHFA 3GWZA 3AAFA 3R61A 1XSXA 3F8MA 2Q0OA 3WTZA 1MJ9A 1LDKB 3E6MA 4HZFA 1W4MA 3FMSA 4L9TA 2FOKA 4KN7X 5E8IA 2V6CA 3LA3A 4EMSA 1BC7C 2KJCA 4EM0B 5J8CA 4B8XA 3W6KB 1MZBA 5LRSA 2KIUA 2EV5A 2LDUA 3WU0A 1O3SA 1TTYA 3I53A 5ILSA 4A6DA 1QQIA 1Z91A 4RAYA 4OIQF 3EUHA 1W5SA 2HGCA 3M1EA 2Q2EA 1O57A 1NHAA 4HOBA 3GZ6A 1KQ0A 3BJAA 4Z2YA 3F8FA 2Q8KA 5DD8A 1UB9A 4KT5C 4AIJA 1IW7F 4HLXA 1LNWA 1CGPA 3F21A 3KP7A 2L54A 4KUMA 3KZYA 2VC1A 1FBUA 3ECOA 4P5OA 1UFMA 2EK5A 2J5PA 1JHHA 3E3VA 1RIOH 2NYXA 4EM1A 4EV0A 1S7AA 4XLNF 4XRFA 4ZYEA 1R5GA 4A0XA 3H92A 2ZNYA 1W7PA 1ZREA 1YW8A 4WXDA 4TV7A 2M87A 2ZJ2A 2QUFA 4NHJA 2NNNA 3ABTA 3HSRA 1O7FA 2JRTA 1O3TA 1XN7A 2W57A 3IL2A 3I59A 1EH8A 2AXLA 2VE9A 1FBQA 2BE5F 4PGGA 1F5TA 5HS8A 1P4XA 3TDUC 2MLGA 2CG4A 1E17A 2DK8A 3RKWA 1O7LA 1SD6A 2PEXA 4GYIA 1QBJA 3P9CA 1SFEA 2STTA 5HLGA 2QWWA 1OYYA 4HF0A 4P9UA 1RUOA 2A6EF 4LLLA 2A3SA 5D5VB 1K6OA 4OU0A 2F5EA 4PDKA 3V8JA 4RB0A 3MZHA 3LA2A 3ABUA 1IXRC 5ILUA 3KE2A 3H3ZA 2Z5UA 1SAXA 5F64A 2ISZA 4UV9A 1KA8A 2E7XA 2YX7A 2XGXA 4OOIA 1I5ZA 2HOEA 2TDXA 3BJ6A 3T1BA 2YSRA 5E20A 1AOYA 4U7DA 2PLYA 1FPQA 3FZVA 3KEQA 4L18B 5D4SA 3GEZA 2XHKA 1YS6A 3M9AA 4G7ZF 2XUBA 2O6GE 2YX4A 3KFWX 2RN7A 2D1VA 1R5HA 4FX4A 2W84A 2P7VB 3GVAA 1XB4A 4XBFA 1FBSA 1P4AA 2HTSA 4UXNA 2WWYA 1HSJA 3ML6A 3B02A 1BOAA 1ZLKA 3I54A 2IPQX 2D45A 5HDNA 3MQ0A 4N9IA 4ETSA 2L4AA 4RB2C 1ODDA 3QPHA 1F4KA 1REPC 5D5UB 3WGHA 2G9WA 5AIQA 2A6HF 2WTEA 1GVJA 2QQBA 1HSTA 4ZYDA 1MDMB 2YR2A 4YIIA 3E5XA 4I7HA 1KQ8A 4BHCA 2EB7A 4A5NA 5IT9K 4HW0A 2JZYA 5DUKA 1FP2A 4I01A 2MH2A 3KP4A 3RJPA 1B4AA 3GO5A 2ETHA 2CFXA 3QP6A 4LK1F 3KETA 4XSZF 3V7RA 1ZGJA 1H0MA 2KRFA 2FEZA 2RDPA 1FX7A 1R23A 4M6XA 1FNNA 2WC2A 1XGSA 2R7FA 3K9TA 3E5UA 3SFZA 2VODA 3R0AA 1RZ4A 3O2PE 3N97A 4G7HF 5JFRA 3NRVA 2P5VA 1P4WA 2ZFWA 4YFKF 1WSUA 1BM9A 4YIFA 2IA0A 3CO7C 2IP2A 2COMA 5JR3A 2ZCWA 3V8LA 2MD5A 4G8XA 4G6QA 1IN5A 3ZQ7A 4RGRA 1FY7A 3GYHX 2L02A 3RDIA 3GFMA 4A0ZA 1TQIA 3BWGA 3FMRA 3N4MA 1JGSA 1H9TA 1MDMA 5L3CA 4MTDA 3VEPA 1IN6A 1BI1A 2GAUA 1T39A 2DT5A 2M5WA 1OYWA 3DPLC 3T0YA 3F72A 1KU7A 2Y48A 5JI6A 1L3LA 4YFNF 5EEGA 1LVAA 4L0ZB 1D5VA 1XSDA 3CJNA 3F8CA 2RC4A 1LB2A 3I4PA 1QZYA 1K78A 1KU9A 3SXYA 1XSVA 2A69F 5BPIA 2A68F 5AIPA 2M45A 4JQFA 4N9HA 4UHTA 4CXFA 4I0AA 4BYYA 1CF7A 2XKOA 3LA7A 1V4RA 2HWVA 2OAZA 4OIPF 1BJAA 2W24A 2FMYA 1QO0D 4O3MA 3QP5A 2H6CA 3FMQA 3HIFA 5K5OA 3SZPA 3C7JA 1Z7UA 1KU2A 1FYLA 2LF8A 2VBXA 5D8LB 2J5OA 3M8EA 3M8FA 3L2CA 5H20A 2UZKA 4HV6A 2K02A 2D1HA 1BIBA 3HYIA 1F9NA 3I71A 2K86A 3BDDA 2OD5A 4ZYGA 2E7WA 4CO8A 4UV8A 1U78A 1D8JA 2F2EA 1H9GA 3GW2A 1HKQA 1LDDA 3FXQA 3E6DA 3ZMDA 4BHPA 5K5RA 3GLXA 5K5QA 4IRIA 1IZ1A 3P9IA 3EDPA 2QZ8A 4ESFA 5L3BA 2FBKA 3IHUA 2H09A 5FD6A 2ADUA 3QRFF 1BBYA 2QBYA 3LSTA 4MNUA 5CJ9A 4NQWA 4HV5A 2GXBA 2ZNZA 2LF7A 3HRUA 1O3QA 2LNBA 1IN8A 1KYZA 4F7ZA 4OMYA 4LJZF 5CYVA 2HTJA 4QLCU 3CUQC 1YLFA 5ERIA 4M74A 5EEHA 5BPDA 3HOTA 3WTTC 2ZMEB 2VONA 3RIRA 3WTWC 1T0FA 3FHZA 5ICFA 2H27A 5HS7A 5ILVA 1K7AA 1XMAA 4M9ZA 4LLGF 4L0YB 5JHUA 3ZP5A 2ZKZA 1U5TB 2FU4A 1U5TC 2EFOA 3T8TA 2M30A 2IRFG 4BAYA 5FLXK 5FFXA 3ZMUA 3I5UA 4AIKA 1XMKA 2FQ3A 1AWCA 2F5CA 3R0JA 3ZMSA 3D5LA 2R3SA 4O6JA 1IN4A 5LLQA 2GWRA 5CVIA 4AVPA 2UXXA 3CLOA 2KIMA 1XGOA 1WI9A 3K1NA 2RGVA 4M71A 1I6XA 1JE8A 3DKWA 5LHGA 4KN4X 1BI3A 3V8KA 1MJBA 4KMUX 1SD5A 3E5QA 1IRGA 2O8XA 4RGSA 4R79A 3I58A 2NNYA 1L0OC 2XROA 5H6RA 3I64A 3K69A 3CO6C 2EV0A 3G73A 4HX7A 1S7OA 4EQQA 1ZRCA 3DXJF 5LGNA 4UVAA 3CUQA 4U0VA 2W85A 4MGRA 4EGZA 3IKVA 1G4DA 2BBYA 5E1WA 2CQKA 2HFHA 1XCBA 2DPDA 4HQMA 2EFQA 2R7DA 1DPUA 3OOPA 5LHHA 2FBHA 1U5TA 2V1XA 1DPRA 1E2XA 5E8GA 2VOOA 4MQ9F 2DO7A 4RGUA 4JBAA 5FGMA 1DP7P 4BHBA 2DBBA 4HA8A 2EV6A 2X0LA 5L3DA 2CGPA 3MWMA 1KGSA 3HHHA 3IWZA 2RVCA 5A2QZ 5ED4A 1ZLJA 1A04A 4RGXA 1R1TA 2OQRA 3WU1B 1RUNA 4S05A 1SFXA 3VFZA 4G9YA 4O5VA 3KCCA 3BOQA 1IAWA 5LBQA 3ECHA 1XDUA 1IUYA 3JSOA 4B09A 3NEUA 3MEXA 1ZG5A 2Z33A 3RPUA 4WWCA 2ISYA 5FD5A 5HDKA 1SMTA 2CW0F 3JSPA 5F6FA 1KYWA 2IVMA 1S6LA 5HLHA 3L00A 4YG2F 1PP7U 3DF8A 2VXZA 5E18F 3GF2A 1MKMA 4XLPF 2W25A 3J80Z 2HKOA 2L3DA 1FP1D 3MAJA 3JAMZ 4KMFA 1KQ9A 2PMHA 4WCGA 3F6VA 3HRTA 2WV0A 1WKMA 4CYDA 1Z6TA 2RQPA 2VN2A 3BY6A 2PBIA 1IRFA 3TGNA 2CYYA 5DCMB 5FFZA 2PQ8A 1G3WA 3IRQA 3EETA 3JW4A 3LQQA 2QM3A 4ZZDA 4ON0A 2DQRA 1DDNA 1ZRFA 1P2FA 2PMUA 4M9XA 1LDJA 2ZBKA 2VBZA 4CICA 2K27A 1Z6RA 3E6BA 2VOPA 3J81Z 1S8NA 4RB1A 1WRJA 3ULQB 2Z99A 2QQAA 3BJOA 1B59A 4EJWA 3DV8A 2DU9A 3BPVA 1ON1A 3C18A 5CVVA 3WTVC 3WGGA 5LEKA 3DPTA 1OPCA 4AWXB 1FSEA 1OMIA 3CDHA 1B1BA 5LHIA 2UXNA 3F22A 2HS5A 4L5IA 3ERED 4IVNA 2GZWA 4DQ2A 4L5JA 2G7HA 3LWFA 1Q1HA 2P6TA 2DAOA 3SZTA 4PCQA 1G6NA 4KA4A 2E1CA 2ELHA 3KLNA 3GFIA 2QQ9A 2ZXJA 3BZ6A 1YTYA 1S3JA 2IA1A 5KK1A 1FC3A 1ZGAA 2E1NA 3GFJA 3R4KA 1IN7A 4L9JA 4IPAA 3E97A 1STZA 4LMYA 2AS5F 3P7NA 4Q47A 4OINF 4KYWA 1PUEE 1SD7A 2EFPA 4BQAA 5F1RA 1YW7A 6PAXA 2XRNA 5CLSA 2IA2A 4HF2A 2HYFA 4E70A 1FT9A 2K4BA 1U8RA 4G7OF 4HDVA 1GXPA 2A5YB 2PI0A 1Z05A 3J7AO 2ACJA 2GXGA 4EJOA 5AONA 4EJVA 2K4JA 1HKSA 4HBLA 2BEOA 3WODF 3IC7A 1LEAA 2ZO4A 3TKYA 1UHMA 5JVTA 2LSOA 1USTA 2KJBA 1TQMA 2BYVE 2DQLA 4A5MA 2BV6A 5HVQC 5HOOA 4KFCA 2A61A 4A2UA 4K2EA 3F8NA 4MTEA 4UVCA 4LG0B 3PQKA 1T6SA 2EFNA 4KNYA 4NB5A 1XDSA 4I09A 3WE2A 3HSEA 3ZMVA 3HOSA 4YFXF 3BP8A 4LB6B 2QENA 3L09A 1O3RA 3QPTA 2XAQA 4XSXF 1FZPB 3ELKA 3K2ZA 1YW9A 1TNSA 4KIFA 3KZZA 2EJRA 2PFBA 3COAC 4WXCA 2XKPA 2VE8A 3M7GA 4FT8A 1P92A 5D4RA 3B73A 3LQRA
chains in the Genus database with same CATH superfamily
3P9KA 1ZG1A 5FKKA 2MH9A 4GFBA 4BDYA 1FWZA 4UNOA 4RMNA 4BQQA 5BS6A 1G3SA 1HXDA 2VT2A 2HQNA 1YITI 4LLNA 3HB9A 4XL9A 2IW5A 4X0GA 1ZG3A 4I98B 2OU2A 3MKLA 3F0CA 3CMAI 1IO2A 4FE4A 3TDZC 3GTGJ 3KIOA 1ZELA 1I3AA 2DK5A 1TLHB 2XAGA 2XAHA 4QPQA 3WTSC 1YJWI 3FF5A 3CTAA 2HNHA 4U88A 3FBIB 4BE2A 3QWLA 3CCUI 3EUAA 4CDGA 3GTMJ 1LPQA 2HR3A 2JA6J 2H8RA 5EGOA 4PSXA 3GMEA 1VNDA 3BPXA 1I50J 3CMMA 3JTHA 3RKQA 1OR7C 3HHGA 1J9IA 1SC7A 4QIWN 1GV5A 3ZMZA 1A35A 2CSOA 1YX3A 1ITYA 1ERDA 4WF2A 3DU5A 4P96A 4AC0A 5D5XB 3MKYB 3G2BA 2K7LA 4EJUA 1VQ6I 1I1SA 2OZUA 5E79C 3WG9A 1X3UA 4G6DA 1V5FA 3W6JB 1ZTRA 2EWNA 2HQRA 2YPRA 4HX4A 2KIFA 3SFIA 1YO5C 2Y0MA 1VTNC 4Y3OA 4I6ZA 5FROA 4KIGA 3BTIA 2JMWA 1G3TA 3E6CC 4HNVA 3DQVC 1UJ8A 2ESHA 3K70D 2O0YA 3QPSA 2V79A 2XC7A 3RTRA 5F27A 2RV8A 3R6SA 5FB2A 1M1EB 2YU9J 5D6EA 2VBYA 1D5YA 4IXAA 4CYCB 4Y15A 4BXXJ 4EATA 1RESA 3OV8A 2H8WA 4GDFA 2G7UA 4II2A 3GLLA 2Q2EB 1SD4A 4R8HA 2Z3YA 4MHGA 3LFKA 2R7SA 3ZPLA 2K9LA 1OCCH 2FNPA 2H6BA 3MZYA 1YRNA 2O7OA 5E1XA 2HDDA 1TZLA 3T8RA 5FKOA 2NRAC 2P5LC 1B9NA 4AD9A 2PX9A 2VKVA 4IQJA 4DNCA 2NVUB 4Q4ZF 1MBFA 1WJFA 2MC3A 3OYEA 2DW4A 4XIDA 1HQCA 4HSTA 4DYRA 1MGTA 2STWA 4M72A 9ANTA 5DCFA 3LSPA 1K79A 5HS9A 5B66C 4OIRF 3FXKA 4DJAA 1FMWA 3ZCOA 1SMYF 3CCEI 2L01A 4CCMA 1HDDC 3E7LA 1BOBA 3WTYC 2G0EA 5IT9Z 1I1GA 5K1YA 1YS7A 3FIWA 4NUBA 4IO9F 3H9GA 3LAPA 3ZQCA 3JTGA 3F23A 3OL3A 1ONVA 2HVQA 3QAHA 2ID6A 5LEJA 3EQLF 4W1UA 1J0RA 1TBXA 4PGHA 2O8KA 3Q9SA 3BG6A 3PNVA 3FM5A 1OR7A 3RYPA 1W7PB 3ERMA 2F6CA 3ROUA 2ZB9A 3W2WA 5EEAA 3GTKJ 2LRDA 5IPAA 3GZ5A 2KT0A 1J2XA 5CVUA 2V7FA 3RPQA 2MBFA 2M34A 4XLEA 1MD0A 1FYMA 1IXSB 4XQFA 5C4XJ 3G3ZA 2DDAA 2KDZA 3PFIA 2FE3A 3ZOBA 5C4JJ 3I59B 4KIBA 4D5CA 4PFOA 1GV2A 1HCRA 2IAIA 2NS0A 3C2HA 4BY7J 2ZJRF 1U2WA 3QOEA 3M4OJ 5CVJA 3ZQHA 1W5CC 2VL8A 4QPOA 1W5TA 5BMZA 2FMLA 2VC0A 4KISA 2KKOA 3QPLA 2VT3A 4PZJA 4CYCA 2BOLA 2KHMA 4CZZA 3D0SA 3A0HC 2VJ4A 2XASA 3H3VK 2Y69H 1OYIA 4II3A 5D6FA 2C6YA 2X6WA 1H88C 2CQ7A 4JX6A 4F91B 2DT6A 3DKXA 3RI4A 4ZTJA 4G6TB 5M3MJ 2L0KA 3TO6A 2CQXA 1IF1A 1V3FA 2QYOA 2LKPA 3K4KA 1YJNI 4CCNA 1KU3A 4B47A 3BCAA 3CCYA 1VQ4I 4HAMA 1NG7A 5HDGA 4HQEA 2Z9OA 4HX8A 5ICEA 2ZMEA 2K3PA 1FEXA 3K4MA 3HGYA 3Q9VA 1ZYRF 2HXIA 2VIXA 3W3CA 4XN3A 2IGKA 3VSLA 2UV1A 4G12A 1YOVB 3CESA 3IH3A 1BW5A 4HYEA 3RSNA 5M5WJ 1BC8C 2K9MA 1YI2I 2X1EA 1TT5B 2DI3A 5H6QA 1R6RA 1BR2A 1JGGA 4WK8F 2CUZA 1HKTA 2L9RA 4XLHA 4U0YA 3SDBA 2IJLA 3G4SI 2Y2ZA 3T5XA 2K9SA 5L3GA 1R36A 1ZH5A 2LYCA 2RNJA 2FSWA 3R60A 3PSFA 2XAFA 1SEUA 4FQGA 2LBFB 2E71A 4FHTA 1QGPA 4LB5A 2BGCA 1FLIA 5BQTA 4JX4A 2M7BA 3EUKL 1K61A 3QODA 4WXHA 2XGEA 3OL4A 4C2TA 2OBPA 4FETA 1X3WB 1RR7A 4LGWA 4Y17A 3HOWJ 2HZTA 2AHQA 4C3IJ 4R1HA 1Z1DA 3E0JB 3KZIC 2FD5A 1BN5A 4D0PA 2YUSA 3Q5FA 3FDYA 4P1WA 3QU6A 1VQMI 1WJBA 2XF5A 5DYMA 4CA0A 4ZH4F 1XMXA 3KP2A 4CH7A 1SAUA 3CDIA 2M1BA 4IHSA 3L2VA 3LAJA 2DTRA 2JVGA 2L9VA 3S16J 2HOAA 2MA3A 3KP5A 2NOGA 5FJ8J 5M3FJ 2AO9A 5L3FA 4AIHA 3TO7A 3C2GA 2PJPA 2IT0A 5KCMA 3S2WA 5C3EJ 3WE3A 2LY1A 3VOEA 1R4MB 1FIPA 4ZDPA 4PK4A 2D2WA 1EV7A 3SHFA 4E7ZA 3MCZA 2LOOA 2Y75A 3CF2A 4UVBA 3KP3A 4XRMA 1BIAA 2E1MB 2E1MC 1YYVA 4UUVA 2R4GA 1MBKA 4IHTA 2M3AA 3VWBA 1N25A 4LFUA 2HEOA 5FRMA 4I0BA 3RYRA 2ZC2A 3F6OA 1HOMA 2Y31A 1IC8A 3Q0UA 1ULYA 1BI0A 2MYSA 2B63J 3ZN0A 4HLYA 3DTKA 3S1MJ 3GFLA 3FX3A 1VQ8I 1Y0NA 2L9NA 1NH3A 4IRHA 1R7JA 3VODA 1VQ9I 2LY2A 5K7HA 4ZZLA 1JUMA 3GUDA 5DEQA 2QF7A 3MMYB 1TNTA 2DFFA 4GO1A 4G94A 4ESBA 1QZZA 4E7SA 3K70C 1XD7A 1D3YA 2EA2A 3LFUA 4MIMA 2DA3A 1QNTA 3F3XA 3FM3A 3PQJA 4EEFG 4EM2A 4XRSA 4M6YA 1H8AC 3FXRA 3QYBA 3HSFA 2XVCA 4IOCF 1J7KA 2CO5A 4BEHA 4RAZA 3S15J 3ISPA 3QU3A 4UUTA 5F08A 4Y7NJ 1EH7A 2QVOA 5CVRA 3W2AA 2QCOA 1RKTA 3FXUA 4ZYHA 5D8KB 4DBRA 3WGIA 3VB2A 1LQ1A 2TCTA 4FASD 2CUJA 2PMZA 2OQGA 1X2MA 3S1QJ 3NARA 5DV5A 3K1PA 3RQ4A 3SEZA 1R58A 4Z6YA 4RB3C 3GXOA 2CUEA 1FSHA 5IYCJ 5E3MA 1WJCA 1E3PA 3OSGA 4UUSB 1TL8A 1TWCJ 5CQEA 3L2RA 3O6BB 1UELB 3M07A 2W48A 2O3FA 3MFKA 2KZVA 5ICGA 1I27A 1F1ZA 5JHFA 3G6EI 2ZXIA 4QWQA 4OIOF 1GT0C 3HM5A 3OIPA 1ZN2A 1OFCX 4A0YA 4ENNA 1DUXC 2ZSIB 2E34A 1Y39A 4Q48A 2DOAA 1PDNC 5TRDA 3JR9A 3LNQA 3RKXA 5FKNA 3JRIA 1YJ9I 3HGGA 1QPMA 2M9HA 2ESNA 1D1BA 4ZJZA 2FA5A 1G3YA 1R22A 1QVUA 4A6EA 1R1VA 2JT1A 3H9QA 2PN6A 2FX0A 2Y0SA 4HSRA 2MGQA 2HKXA 5B1AH 4GYGA 3KEOA 1RRJA 2BW3A 1Y6IA 3P5JA 2B7EA 3H3UA 2R7WA 4AVZA 1WJEA 2BVLA 2RKHA 3S2DJ 2HQ5A 3A02A 2OZ6A 4PJ0C 1T2KA 2UWMA 2XF6A 3BR1A 4HNTA 4U0WA 5J1YA 3MD2A 4NC8A 1OCZH 1UHSA 5DDGA 1VQ5I 3OYGA 1NK2P 1XCVA 2L9SA 4IHVA 3TQNA 2R5YA 3S17J 2F5VA 5FLXZ 3I3LA 2E19A 3FXJA 3I0TA 5DCMA 1S9HA 5EJCA 3NQOA 3TOAA 2RNGA 2V9PA 1GDTA 1FOKA 4CHUA 4N0BA 2IGNA 1SVOA 1B9MA 5FO5A 3IH2A 2GIZA 3L9FA 4LK0F 3ESWB 1LEBA 4P55A 3OYFA 1J59A 2H94A 4A3EJ 2GIVA 3C3WA 3K1MA 3OIQA 1ON2A 1SFOJ 1BW6A 1RNLA 3WTXC 3X2QH 1K78B 1HLVA 2EIJH 1B6AA 4BDZA 2P8TA 2P6SA 2V1DA 5ICCA 1OKRA 2NVYJ 1YG2A 1W7PD 1ZK8A 4M3EA 4RAFA 3RQIA 1ORKA 5J40A 3CMEI 3HPHA 3ABLH 3HC7A 2ZJQF 2L4MA 2M2EA 4IZZA 1EH6A 4GGGA 1R49A 3J7ZI 2JUCA 5M5YJ 2PG4A 1CF7B 3DTIA 3WTUC 2GQQA 2FNAA 3SYTA 2XAJA 1J75A 2DOFA 2E5ZA 2HYGD 4M9SA 4J01A 1Z9CA 2KQRA 2DPUA 2NVXJ 1NTCA 1P6RA 2GXAA 3SQNA 1XGMA 3CCQI 3B6AA 2VPRA 2P7CB 2P5KA 5K7FA 3BR3A 3KLOA 1V5EA 3A03A 2VQGA 1W0TA 2QGUA 1POGA 1T38A 4HDUA 2VXDA 1V54H 2DA1A 5GAEJ 5JLXA 3M3YJ 5J6XA 2EILH 1Y0UA 2DMNA 4XONA 1IXCA 4BS9A 3IRRA 2LD5A 4LOCA 1C0WA 2DMQA 3CF5F 4CZCA 4XORA 5LRRA 1ZARA 4M73A 2X1CA 1HC8A 4BH9A 5F0FA 5EYRA 1U3EM 2X4HA 1Z7LA 2F5DA 5D5WB 3CC4I 4MEYF 2VQCA 1X58A 3CZ6A 2HI3A 4M3DA 2Z2SB 5F1JA 4C2MJ 1D8KA 4RBOA 4Y52J 1E0EA 1AA7A 1W1WE 2GBYA 3FWEA 1QZEA 2EA4A 3AL0B 4MEXF 4ENMA 3GX4X 3DPUA 4IJAA 3W2VA 2LKSA 4EVIA 2IGMA 2CWEA 2P81A 1QHHD 4AYBA 4PUSA 4A12A 3TOBA 4WX9A 2V1UA 3LSMA 1OISA 4U7BA 4H0EA 1DGWY 2BY3A 2VQLA 5LFAA 5DUIA 3A1YA 2R7VA 3WU2C 4C9YA 5A2QK 3RZDJ 4IF4A 3BR6A 2DLLA 4EGYA 3IAS2 4JK1X 1WQ2A 5M5XJ 5DD4A 3HUGA 4ENKA 3U1DA 4Q5SF 3H35A 3O3KA 2WA0A 2VBWA 2HXOA 1OCTC 1YIOA 5L3EA 1RI7A 3V7SA 5BOXA 2NS8A 1X4PA 2W7NA 1N77A 4EJTA 4OMZA 3OOUA 3HTUA 3V7CA 2R0QC 2KIQA 2X51A 5J8FA 3L7WA 3EYIA 4HF1A 1JKRC 2KPMA 3ONQA 4B3AA 2XGDA 1FMVA 5LD2C 2OPTA 2Q1ZB 2CJJA 1UCRA 4ZC3A 1J5YA 3FXOA 2L5QA 3ZN1A 2QBYB 2O61A 1HW1A 4GXOA 2QSFX 2FBIA 2WY7Q 5IYBJ 2IXSA 3HTSB 2WV1A 2FF4A 2WADA 3OYJA 2BVMA 3ZMTA 2VUMJ 3OSFA 3DFGA 3V4GA 3CCLI 4BNCA 2A07F 1MMGA 2IS6A 2F48A 4LD5A 3M8JA 2R7TA 1JKQC 4X1EA 4JOMA 1R1UA 1OCOH 3K0LA 3REOA 3KP6A 1JKOC 1I3QJ 3RKYA 2QLZA 2XV4S 1GXQA 1R00A 1OQYA 1MIJA 5LGTA 5TJJA 2DJNA 4KDPA 1IGNA 5E1ZB 3QOPA 3J80K 1WCMJ 3DP7A 4Y13A 4LG0A 1NG6A 1FYKA 3JAMK 1S29A 3OYHA 1ZRDA 5B1BH 3HDDA 3J7AY 1K4TA 1MJAA 3WG7H 3IWFA 2HDCA 3IKTA 4L9VA 4BXUA 1U6GA 2XIGA 2CRGA 2QQ8A 1ZAOA 2GA2A 5FRNA 2MLKA 4D5FA 2M8EA 2JPCA 1E3HA 2DYRH 3GBGA 4RM2A 5HLIA 2JA5J 2FXAA 3H0GJ 3K4NA 4ASNA 1T98A 4ENJA 2YS9A 3LSKA 2LVSA 4P9FA 1ZR4A 5GTIC 1WWXA 2GLOA 3DEUA 4LITA 2JSCA 3BTCA 3EYYA 5DM6F 1YFHA 1T8IA 3HKZN 1JTXA 4FX0A 1JUPA 1Y8RB 3DTEA 3KEYA 1XGNA 4AM3A 1HW2A 1HBXG 3H9JA 3HRMA 3HPGA 2ME0A 3BROA 3CCVI 2GA1A 1MSEC 2E2JJ 2HU9A 4KICA 2FRHA 1GHCA 1IDZA 1UHWA 1TQPA 2B9SA 1SFUA 3ABMH 3VPRA 2V1NA 4ESJA 3G1LA 1TWHJ 1USSA 3J81K 4GCVA 3WHCA 1B72B 1R5ID 5E17F 4S04A 1LE8B 1HW5A 3TBIA 4MQVA 4U87A 1YQAA 3EUHC 1BI2A 2V6EA 4AYBN 4JP0A 3U9GA 5CQGA 2JK3A 2K3FA 2OA4A 1JXSA 1PP8F 3TL4X 3ABKH 1AKHB 3TO9A 1JHFA 1XTAA 2B0LA 4BUPA 3U2RA 2YU3A 5KVRA 3NAUA 1G2HA 3TW7A 1LJ9A 1TW2A 3CUOA 2JQ7A 2DMPA 5HNHA 2F5FA 3F8BA 4RS8A 2P4WA 1WZ2A 1QU3A 2DFIA 3S3OA 1D1CA 2JPBA 2JTVA 2K9QA 2EBIA 4IHXA 4L9NA 4W97A 2NS7A 1TW3A 3CUQB 4IRGA 3C1DA 2A6TA 1LFUP 2WB1A 4JX5A 5LGUA 3GCMA 2E2IJ 1TP4A 2V9VA 5IT3A 3HRSA 2X1DA 2O03A 4I02A 2EFWA 2D5VA 3DLAA 4CGZA 4I2OA 2E5NA 4IX7A 3ZRGA 2NAZA 1ZHFA 3GWZA 3PIOF 3AAFA 3M1CA 3R61A 1VQ7I 5E3OA 2CMPA 3PO2J 1XSXA 3F8MA 2CQQA 3C2BA 3SEQA 2Q0OA 2XSDC 3WTZA 1MJ9A 2EIKH 1LDKB 3IV5A 3E6MA 4HZFA 4RLQA 1W4MA 5IYDJ 1VQKI 3FMSA 4L9TA 2FOKA 2VKHA 4KN7X 5E8IA 1XPXA 2V6CA 3LA3A 5K7ZA 3L2UA 4EMSA 1J09A 1BC7C 2KJCA 4EM0B 1WI3A 2XB5A 2JJ7A 5HLTA 2R7RA 5J8CA 1TT0A 4GRIA 4B8XA 5EG0B 2OCEA 4A3KJ 2EPFA 4I76A 3W6KB 1IG7A 2FUG2 1MZBA 5LRSA 3LL7A 2KIUA 2EV5A 2JA2A 2LDUA 3WU0A 1O3SA 1TTYA 3I53A 2L2OA 2A5WA 5ILSA 5B3SH 4A6DA 1QQIA 1BA5A 1Z91A 1HA8A 1O4XA 4RAYA 4D9JA 4OIQF 3EUHA 2HZDA 1W5SA 2HGCA 3M1EA 2Q2EA 3HOVJ 1O57A 1NHAA 1N75A 4HOBA 3GZ6A 4A3IJ 1KQ0A 4E7HA 2XAUA 4FISA 1DU6A 3BJAA 4Z2YA 4BU2A 3F8FA 2Q8KA 1Y1WJ 4ANJA 5DD8A 1GVDA 2EIMH 5IP9J 2JSPA 4PFPA 4RA2A 3VDXA 1DP3A 2CS3A 1UB9A 1D1AA 4KT5C 4AIJA 1IW7F 1YE9A 4KITB 4CCOA 3BR2A 4HLXA 1T95A 2L7KA 1HF0A 1LNWA 1CGPA 4HG2A 3F21A 3KP7A 2RAEA 4BJ6C 3CCMI 2L54A 3FISA 3PJRA 4KUMA 4MFEA 1UMQA 2IS4A 3DBRB 4IHWA 3KZYA 3GTPJ 1MSFC 1F43A 2VC1A 1FBUA 3ECOA 4P5OA 1UFMA 2EK5A 2R5ZB 1MMDA 2J5PA 2WAEA 3TMOA 1JHHA 4PJNA 1WVRA 3E3VA 2NYXA 4DOZA 2WAFA 1RIOH 2DMUA 4EM1A 4EV0A 1S7AA 4XLNF 1DGRM 4XRFA 2LY9A 2DTZA 3H1CA 3ZR8X 4ZYEA 1R5GA 1SFKA 2NVQJ 2ZXHA 4UB6C 4A0XA 5IY5H 5GPCA 3HL2A 3H92A 2ZNYA 3AG1H 1NK3P 3H5NA 1W7PA 3OWTA 2WB1N 3CCRI 1ZREA 4B48A 2R7XA 1ETKA 1YW8A 4CSWA 4WXDA 4TV7A 2M87A 2ZJ2A 4XMYA 4E6KG 1MNEA 4LIVA 3HZJA 2QUFA 4NHJA 2NNNA 3BZCA 3ABTA 3IUOA 3HSRA 3ZXSA 1O7FA 2JRTA 1O3TA 1XN7A 4JYKA 3LSIA 2W57A 4BXFA 1I39A 3IL2A 4M6VA 3I59A 1EH8A 2AXLA 3IP4B 2VE9A 3LSHA 1FBQA 2BE5F 5GPAA 3DU6A 4PGGA 2CW7A 1F5TA 5HS8A 1P4XA 3JCUC 3A4CA 2MW8A 2JRMA 3TDUC 3S14J 2MC4A 2ZFUA 4XKCA 1MBHA 4XLAA 1VZ0A 2MLGA 2CG4A 1E17A 1VF9A 2DK8A 3RKWA 1O7LA 1SD6A 2E60A 2PEXA 5IOYA 4GYIA 2DCEA 2ME6A 2OF7A 1QBJA 3P9CA 1SFEA 4B44A 2STTA 5HLGA 2QWWA 1OYYA 4HF0A 1MH3A 1TWFJ 2W4SA 3JRAA 4BKXA 4P9UA 1YX5A 1RUOA 2A6EF 4LLLA 2OV7A 2A3SA 1KONA 2E35A 5D5VB 1K6OA 4OU0A 4ZDLA 2F5EA 4PDKA 3V8JA 4RB0A 4B1RA 3KPHA 3OY9A 3MZHA 1WH5A 2MSYA 3Q3SA 3ZQIA 3LA2A 5FLVA 3ABUA 1IXRC 5ILUA 1FOXA 3KE2A 3H3ZA 2Z5UA 5F0CA 4KT6A 4LIUA 2X9DA 1SAXA 5F64A 3JRBA 1EA3A 5BNGA 1AU7A 2NOJB 3K4JA 2ISZA 4UV9A 1KA8A 2E7XA 4HPQA 2YX7A 4CCKA 2XGXA 3A0BC 4OOIA 1I5ZA 1X2NA 2HOEA 2TDXA 3BJ6A 4S0HB 3GTJJ 3S3MA 3T1BA 2YSRA 2ZSHB 5E20A 1AOYA 4U7DA 2PLYA 3H0DA 3OS2A 1VFCA 1EF4A 2HYJA 1Y1VJ 2LBFA 1FPQA 4QSHA 3FZVA 2UUZA 3KEQA 1HDPA 1OLTA 3HOUJ 3OYIA 2JN6A 4L18B 3TP3A 5D4SA 2DA7A 1WFXA 4J00A 3GEZA 2HPIA 1BR1A 1LVKA 2XHKA 2NXNB 1UZCA 2L7MP 1IRZA 1YS6A 3M9AA 4DW6A 2XUBA 2DA5A 4G7ZF 2O6GE 2YX4A 2JA8J 1YHQI 3KFWX 1S7EA 2H1LA 2RN7A 4B43A 2D1VA 1R5HA 4FX4A 3CJQB 2LFBA 1OCRH 2W84A 2P7VB 3GVAA 1XB4A 3W6VA 1W0UA 2PJRB 2EZIA 1FBSA 1P4AA 2HTSA 4UXNA 4XBFA 5IOZA 2VI6A 2WWYA 3BQYA 1QA6A 4XICA 1HSJA 1UG2A 3MVPA 2K40A 2K85A 2CV0A 2WAQA 3K2AA 3JREA 2WBMA 3ML6A 2KFDA 3B02A 1BOAA 3LSGA 1ZLKA 3I54A 2XRLA 3ASOH 3DLLF 3J7YJ 2IPQX 2Z16A 2D45A 4DGWB 1FTZA 4OAYA 5HDNA 3MQ0A 4N9IA 4ETSA 4BQNA 2L4AA 4RB2C 1H89C 2OCCH 1ODDA 2EH3A 3QPHA 1F4KA 1REPC 5D5UB 2KRHA 3WGHA 2G9WA 3HJEA 2DDBA 3OYBA 5AIQA 2A6HF 2WTEA 3CQZJ 5GAGJ 4A3MJ 3WHBA 5E3NA 1GVJA 2QQBA 1HSTA 2TRTA 2LKXA 4ZYDA 2FJ1A 1MDMB 1U9NA 1FOWA 3LOCA 1AHDP 2YR2A 4YIIA 5GP9A 3E5XA 4I7HA 1KQ8A 4BHCA 3NWTA 4A3LJ 2EB7A 4A5NA 5IT9K 4FTHA 3K7AJ 2XGCA 4HW0A 2JZYA 5DUKA 5JVGF 2E2HJ 2F4IA 1FP2A 4I01A 4DZPA 1W36C 2MH2A 3KP4A 3RJPA 2VASA 4IKFA 1B4AA 3GO5A 3S93A 2KDOA 3MKWB 2R7OA 2XPUA 2M7AA 2ETHA 3OYDA 2CFXA 2CQNA 3QP6A 4LK1F 4IHYA 3KETA 4B4CA 1MH4A 3PNTA 4XSZF 3V7RA 1G59A 2VJ5A 1ZGJA 3VYUB 1H0MA 2KRFA 2FEZA 1U8BA 2QKLB 2HDWA 3A01B 2RDPA 1FX7A 2DA6A 1R23A 2CFOA 4M6XA 2F4OB 1BL0A 1FNNA 3PL8A 2HOTA 2VKDA 2WC2A 4AU7A 3CJRB 2I10A 1XGSA 3GTLJ 2R7FA 2DFEA 3K9TA 4IOAF 3E5UA 2ICWG 3SFZA 2VODA 3HOZJ 3GTOJ 3R0AA 4RAGA 1RZ4A 3O2PE 3N97A 4G7HF 5JFRA 3NRVA 4A3DJ 2EZHA 2P5VA 1R4NB 2W82A 3QYFA 1P4WA 2ZFWA 4YFKF 1WSUA 1BM9A 4E7JA 4UUSA 4YIFA 2IA0A 3CO7C 3H5RA 2IP2A 5KNLA 3S1NJ 2EQRA 3HOYJ 2COMA 1A36A 4C3HJ 1OCPA 3JRFA 1X1DA 5JR3A 2ZCWA 3V8LA 2MD5A 3SDGA 2V26A 3CC7I 3GZNB 4G8XA 3FXLA 4G6QA 4E7LA 3BT9A 1IN5A 3ZQ7A 4RGRA 1FY7A 3AG4H 3O8HA 3GYHX 2IBDA 2L02A 2NVTJ 4LG3A 2WAQN 3RDIA 3GFMA 1PJRA 4A0ZA 2KZGA 3HKZA 1TQIA 3BWGA 3FMRA 3JRDA 3N4MA 3RPUD 1JGSA 1H9TA 1MDMA 4E7KA 2CW8A 5L3CA 4MTDA 3VEPA 4AIDA 1IN6A 1DQUA 1ETYA 1BI1A 2V4JC 2GAUA 1T39A 2DT5A 4DBQA 4HRIA 2M5WA 1IRXA 3ZQGA 1T08B 3AL0C 1OYWA 3DPLC 1MMAA 2HPMA 5EGOB 1QRYA 3T0YA 4F93B 3L1PA 4UB8C 3F72A 1KU7A 2MD0A 3I9V2 2Y48A 5JI6A 4ZDOA 1L3LA 4YFNF 4A3BJ 5IP7J 2BXYA 2JUGA 2FQ4A 2MG4A 5EEGA 1LVAA 4L0ZB 3CP8A 1D5VA 1XSDA 2BY1A 3CJNA 3F8CA 3CCSI 2RC4A 1LB2A 3A01A 2M0MA 3I4PA 1XS9A 1QZYA 1K78A 3UNGC 5HODA 2CUFA 3QQAA 4QTRA 2Y9YA 5DM7F 1KU9A 3SXYA 5J1UA 1XSVA 2A69F 2R92J 5BPIA 2A68F 3OYKA 5J4VA 4XN0A 3Q0WA 5AIPA 2DOEA 2M45A 4JQFA 2CU7A 2DA2A 2E1OA 4N9HA 4UHTA 3OIOA 4CXFA 4OWRB 4I0AA 4D7MA 1V5GA 4RLFA 4BYYA 3E1SA 1CF7A 3CLQA 4NQWB 2XKOA 3S32A 3LA7A 1V4RA 2HWVA 4A3CJ 2OAZA 4YEJA 4OIPF 1YRNB 1MBGA 1BJAA 2W24A 2FMYA 1QO0D 4O3MA 3DWLE 3QP5A 2XPVA 4MLOA 2M0CA 1SVLA 2H6CA 2DA4A 1WPKA 3FMQA 4ITVA 1WJ5A 3IH4A 2XDVA 1LKXA 3HIFA 5K5OA 2AQEA 2H1KA 2GOXB 3RZOJ 1PVEA 1T0FC 3SZPA 3C7JA 2VJJA 2WY8Q 4DIQA 1MNDA 1Z7UA 1KU2A 1VQOI 1F36A 1FYLA 2LF8A 2VBXA 1VI0A 2VB6A 5D8LB 4A3FJ 2J5OA 3M8EA 3M8FA 3L2CA 1TWGJ 3BR0A 5H20A 2OTJI 2UZKA 1GLNA 4HV6A 2K02A 3L2QA 2D1HA 1BIBA 3HYIA 4XOTA 1RKWA 1F9NA 3I71A 5EZHA 2K86A 2N8GA 2IEKA 2QSHX 2LC2A 3BDDA 2OD5A 4FCYA 2BY2A 4ABZA 3MN2A 2K9NA 4ZYGA 2E7WA 2JVHA 4M3GA 3VSKA 2ZJPF 3S1RJ 4CO8A 2Y9ZA 2LR8A 1N78A 3PUBA 4BE1A 3UR3C 4UV8A 1U78A 1D8JA 1ETXA 3AFHA 3H36A 2F2EA 4BACA 2Z1DA 3CDLA 2CV1A 3BTLA 2DXIA 1H9GA 3GW2A 1HKQA 1PYVA 4XK4A 2BHZA 1LDDA 3FXQA 1K83J 2E36A 3E6DA 2CH0A 3ZMDA 4BHPA 4XM3A 5K5RA 1VQPI 4FE7A 3TEDA 3GLXA 5K5QA 4IRIA 2ID3A 1IZ1A 1X1BA 3P9IA 3EDPA 4YELA 4F3QA 2QZ8A 1LFBA 4ESFA 5L3BA 2FBKA 3BG5A 4XR6A 3IHUA 2H09A 5FD6A 2ADUA 2VLAA 4BJ5C 3QRFF 3CP2A 3V42A 4BY1J 3JRGA 1BBYA 2QBYA 3LSTA 4MNUA 5CJ9A 5F0HA 4NQWA 4HV5A 2GXBA 3K4BA 2ZNZA 2LF7A 3HRUA 1R71A 3FXMA 1IDYA 1Y56A 4CUGA 2LNBA 1O3QA 1MNMC 1IN8A 1KYZA 4ZYAA 1SVMA 2LTPA 4BBSJ 3KYDB 2R7ZJ 1MMSA 3BLYA 4F7ZA 4OMYA 4LJZF 5CYVA 2HTJA 4QLCU 1Z67A 3CUQC 1YLFA 1YIJI 5ERIA 3KYLA 4X6AJ 2L7FP 4M74A 5EEHA 1OJLA 5BPDA 3HOTA 3WTTC 2ZMEB 2K5CA 2IS1A 2ZMEC 2VONA 3I55I 3RIRA 3WTWC 1T0FA 3FHZA 2DJIA 5ICFA 2H27A 3BG3A 5HS7A 5ILVA 4I99C 1K7AA 2EZLA 4PSWA 1XMAA 4M9ZA 4LLGF 4BL0B 3OYCA 5JHUA 3ZP5A 4L0YB 2ZKZA 1U5TB 2FU4A 1EJ9A 1U5TC 3AG3H 2ZXWH 4IL6C 2EFOA 3T8TA 4M3BA 3SJMA 1RPWA 2M30A 3HG9A 5TGTA 3K10A 4C30A 5EDNA 4CCLA 2IRFG 1A6IA 4BAYA 5FLXK 5FFXA 2RREA 5J4YA 3BZKA 3ZMUA 3I5UA 4AIKA 1JT0A 2EINH 1XMKA 4N4OB 5DS9A 4N4NB 1FOYA 2FQ3A 4DYCA 1AWCA 2HVRA 4RDUA 4XLFA 2F5CA 3R0JA 1G8XA 3ZMSA 1IUFA 1W36D 3D5LA 2R3SA 4O6JA 1IN4A 5LLQA 2GWRA 5CVIA 5EF6A 4AVPA 2A05A 3PIPF 2UXXA 1ETWA 3CLOA 2AQFA 2KIMA 1XGOA 2OUMA 1Z3YA 1WI9A 3Q0VA 2KL4A 3K1NA 1B72A 1U0JA 2RGVA 1A6QA 4XOPA 1LE8A 4M71A 1I6XA 3CCJI 1JE8A 3DKWA 3FK7A 3JRHA 4V19K 2DODA 5LHGA 4YRVA 4KN4X 1BI3A 3V8KA 1A31A 1MJBA 2FOWA 1ZGWA 1Q1VA 3TP0A 4KMUX 1SD5A 4KJZA 2HOSA 3E5QA 1IRGA 1AKHA 2O8XA 4RGSA 4R79A 3I58A 2ELKA 2NNYA 1PUFB 2I8DA 1X4OA 1L0OC 3O8GA 1D0XA 2XROA 5H6RA 3I64A 3K69A 3CO6C 3IAM2 2EV0A 3G73A 4HX7A 1S7OA 5IP6A 4EQQA 5J47A 1ZRCA 3DXJF 5DTDA 4E4HA 5LGNA 4UVAA 5JLWA 2M8GX 2DFHA 4E7IA 3CUQA 4U0VA 2W85A 4MGRA 1FTTA 4EGZA 2Y30A 4J19A 3IKVA 1G4DA 2BBYA 5E1WA 2W00A 2X48A 3BQZA 2CQKA 2HFHA 1XCBA 5GTHC 2DPDA 4HQMA 2BZTA 2EFQA 2R7DA 1DPUA 1ETOA 4NDLA 1K6YA 2LH9A 3OOPA 1K4SA 3DBLB 5LHHA 2FBHA 1U5TA 2V1XA 1DPRA 4XKWA 1E2XA 3OS0A 1S5LC 3K4CA 5E8GA 2VOOA 4MQ9F 2DO7A 4RGUA 3FK6A 3FKJA 4V2GA 4JBAA 5FGMA 1DP7P 3VYTB 5GAHJ 1Y8QB 5KAIC 1APLC 2AXTC 4BHBA 1T56A 2X85A 2DBBA 4HA8A 2DYSH 2X6YA 2EV6A 2X0LA 5L3DA 4BEHB 2CGPA 2XB0X 1KGSA 3MWMA 3A2KA 4XRSG 3HHHA 3IWZA 2XPWA 4F52A 1D0ZA 5FKLA 5EG0A 1DU0A 1WJAA 1UG0A 2RVCA 5A2QZ 5ED4A 1E3OC 1ZLJA 1XC5A 4NNJA 1A04A 4RGXA 1R1TA 2OQRA 3G71I 2KMUA 3WU1B 1RUNA 4S05A 1SFXA 3QYEA 5CKTA 3VFZA 3OMYA 3BTJA 4G9YA 4A3GJ 4O5VA 3KCCA 3BOQA 1IAWA 5LBQA 2F4MB 2LK2A 3ECHA 1LFPA 1XDUA 1IUYA 3JSOA 1ENHA 5FLMJ 4B09A 4BQOA 3NEUA 1S72I 3MEXA 1MW7A 3NWSA 3OYNA 2VPLA 1WJDA 1ZG5A 2Z33A 3PFYA 3RPUA 1PUFA 4WWCA 2ISYA 5FD5A 3BG9A 4NC6A 5HDKA 1SMTA 2CW0F 1FIAA 3OS1A 1ZQ3P 3JSPA 1QPIA 2QSGX 3I56I 1IV8A 5F6FA 1KYWA 2IVMA 1S6LA 5F04A 4DYQA 5HLHA 3UKGA 2KP6A 3HEFA 3L00A 1BR4A 4HNUA 4YG2F 1QHGA 1PP7U 2BW3B 3DF8A 2MFZA 2COBA 2VXZA 5E18F 3FKIJ 3HXLA 2R5ZA 3VYSB 3GF2A 3HOXJ 1MKMA 2ECBA 1U9OA 3PM1A 4XLPF 3CMYA 2W25A 3D1NI 3J80Z 2ELJA 2HKOA 2L3DA 4XKVA 1FP1D 3MAJA 3JAMZ 4KMFA 2L7ZA 1KQ9A 1A5JA 2PMHA 4WCGA 3F6VA 3HRTA 2M4GA 2WV0A 1WKMA 4CYDA 1Z6TA 2RQPA 2VN2A 2R5YB 1QVTA 2I5UA 3BY6A 2PBIA 2LLKA 1IRFA 3TGNA 1CQTA 1I6HJ 4M3FA 2CYYA 5DCMB 5FFZA 2OC6A 2PQ8A 1G3WA 4F92B 3IRQA 3EETA 3JW4A 3I4MJ 2W1OA 2VKEA 3I4NJ 1ZKGA 1VQNI 5HNFA 3LSRA 3LQQA 2QM3A 4ZZDA 2KLOA 3TW6A 4ON0A 4BBRJ 2DQRA 1RR8C 1DDNA 2IS2A 3F9KA 2QA4I 3ZQQA 2BY0A 1ZRFA 1P2FA 1RETA 1X1PA 1V55H 1XX5A 2PMUA 4M9XA 2DN0A 2QKMB 4PJJA 1LDJA 4NBQA 2ZBKA 2VBZA 3G1MA 4CICA 2K27A 1Z6RA 3E6BA 2VOPA 4V2FA 3ASNH 3J81Z 2CV2A 1TC3C 3ZQFA 5FKMA 1S8NA 3MZ8A 1MBJA 3SZGA 4RB1A 1WH7A 1WRJA 3BR5A 2RQQA 4D7NA 3ULQB 2LMDA 3EPZA 2DMTA 1VQLI 2Z99A 4H4KC 2QQAA 3BJOA 3U21A 3CJTB 2V9KA 3FHNA 1B59A 4EJWA 3DV8A 2DU9A 3BPVA 1ON1A 3C18A 5CVVA 2JA7J 3PUFA 1P7JA 5CPRB 3WTVC 3WGGA 4MO7A 3DPTA 1OPCA 4AWXB 1FSEA 5LEKA 3PO3J 1OMIA 1EKEA 3CDHA 1B1BA 1JTYA 5J3LA 5LHIA 3S3NA 2UXNA 3F22A 2LP0A 4XKBA 1LUJB 2R7UA 5E3LA 3VYRB 1Z21A 3JRCA 2QEXI 2HS5A 4L5IA 3DKYA 4XLCA 1IV6A 1Z77A 4L5EA 3ERED 3ZQLA 1IJWC 4IVNA 2GOMA 2IGOA 2GZWA 1TWAJ 4DQ2A 4L5JA 2G7HA 3LWFA 3OR2C 3FBNB 1Q1HA 2P6TA 2DAOA 3CD6I 3SZTA 4IQ4A 4PCQA 4RM3A 4OAZA 2ECCA 3K4LA 1G6NA 4KA4A 3OYLA 4A69C 2LREA 2E1CA 3OYMA 2ELHA 2VJIA 3KLNA 3GFIA 3BZ6A 2QQ9A 2HQAA 2ZXJA 4BJTA 1YTYA 1S3JA 2IA1A 4AUXA 5KK1A 1FC3A 1B8IB 1X3ZB 1ZGAA 2E1NA 3D5RC 3GFJA 3R4KA 1IN7A 1ETQA 3BC8A 4L9JA 4IPAA 3E97A 4ZTFA 3GTQJ 1STZA 4LMYA 4C3JJ 2AS5F 3P7NA 4MFDA 2HVSA 2XF7A 3N05A 2O9LA 4Q47A 1R9TJ 4NC7A 2PJRA 4OINF 1T33A 2GM4A 4KYWA 3S2HJ 3HUGB 1PUEE 1SD7A 1Z0XA 2EFPA 1ZR2A 1P9QC 4BQAA 5F1RA 3D5SC 1YW7A 6PAXA 1RC9A 2XRNA 4DZJA 4C2UA 5CLSA 2IA2A 2OJED 2KRCA 3H5AA 3HBLA 4YIRX 3B6CA 2HYFA 4E70A 4HF2A 3BG7A 1FT9A 2K4BA 4PJMA 1U8RA 3MKZA 2BXZA 4G7OF 1UAAA 1MMNA 3PNYA 4HDVA 2OTLI 3KYCB 1GXPA 3OYAA 2A5YB 3DEEA 5TISC 1Z05A 2PI0A 4A93J 2KISA 4XNFA 3J7AO 3ZGKA 2GXGA 3AG2H 2ACJA 4F55A 3S8PA 5B5EC 4EJOA 5AONA 2VQHA 4EJVA 2K4JA 3DCFA 1ACIA 1HKSA 4HBLA 2BEOA 3WODF 4UY8I 2PMZN 3DBHB 3IC7A 2BHYA 5J1RA 1LEAA 1ETVA 2X6OA 2ZO4A 3TKYA 1UHMA 5JVTA 2LSOA 1USTA 2KJBA 4IEJA 1TQMA 2BYVE 4CCJA 2DQLA 1XG1A 4A5MA 2BV6A 5HVQC 5HOOA 4KFCA 2A61A 3BCBA 2DT7B 1MBEA 4BE0A 4A2UA 4K2EA 5EZGA 5H2FC 3F8NA 4MTEA 1JUSA 4UVCA 3U1KA 4LG0B 4Y4RA 3PQKA 1T6SA 2EFNA 4KNYA 4NB5A 1P7IA 1BJZA 1XDSA 4I09A 3WE2A 5C44J 3HSEA 4Y33A 3ZMVA 4BGDA 5KHDA 3HOSA 4YFXF 1X1CA 1Z3XA 3G1OA 3BP8A 4LB6B 1D0YA 2QENA 2Y0SN 2M4KA 3L09A 4HEA2 1WHUA 1B8IA 3AKZA 1O3RA 3QPTA 2XAQA 3K6GA 2P0WA 4XSXF 1FZPB 3L2WA 3KX2A 2JWTA 5GADJ 3ELKA 2EZKA 3K2ZA 1YW9A 3LMMA 1JJ8C 5KAFC 1GUUA 1KZHA 1TNSA 1JI8A 2O5RA 1X1AA 2MABA 3CC2I 4KIFA 1WGXA 4D1QA 1JKPC 3KZZA 2EJRA 1FJLA 2PFBA 3COAC 1SANA 4WXCA 2XKPA 2VE8A 2XSJC 3LSJA 3OR1C 1JJ6C 2R7QA 3RCOA 4A3JJ 2R93J 1X19A 3M7GA 4FT8A 2LG4A 4B3XA 3PSIA 2X6XA 1P92A 5D4RA 3DEWA 4PJLA 3B73A 1JT6A 3LQRA
chains in the Genus database with same CATH topology
3P9KA 1ZG1A 2MH9A 1FWZA 4UNOA 5BS6A 1G3SA 1HXDA 2VT2A 2HQNA 4LLNA 2IW5A 1ZG3A 4I98B 2OU2A 3TDZC 2DK5A 1TLHB 2XAGA 2XAHA 3WTSC 3FF5A 3CTAA 4U88A 4CDGA 2HR3A 3BPXA 3JTHA 3HHGA 1J9IA 3ZMZA 2CSOA 4WF2A 4P96A 5D5XB 2K7LA 4EJUA 1I1SA 2OZUA 3WG9A 1X3UA 4G6DA 3W6JB 2EWNA 2HQRA 2YPRA 4HX4A 2KIFA 1YO5C 2Y0MA 1VTNC 4KIGA 1G3TA 3E6CC 3DQVC 2ESHA 2O0YA 2V79A 3RTRA 2RV8A 3R6SA 5FB2A 5D6EA 2VBYA 4IXAA 4Y15A 3OV8A 2G7UA 1SD4A 4R8HA 2Z3YA 4MHGA 3LFKA 3ZPLA 3MZYA 2FNPA 2H6BA 5E1XA 3T8RA 2NRAC 2P5LC 1B9NA 4AD9A 4DNCA 4Q4ZF 2MC3A 2DW4A 1HQCA 1MGTA 2STWA 4M72A 5DCFA 1K79A 5HS9A 4OIRF 1SMYF 2L01A 3WTYC 5IT9Z 1I1GA 5K1YA 1YS7A 3LAPA 3JTGA 3F23A 1ONVA 3QAHA 5LEJA 3EQLF 1J0RA 1TBXA 4PGHA 3Q9SA 3FM5A 1OR7A 3RYPA 1W7PB 3ROUA 3GZ5A 1J2XA 5CVUA 3RPQA 2MBFA 1MD0A 1FYMA 1IXSB 3G3ZA 3PFIA 2FE3A 3I59B 4KIBA 2NS0A 1U2WA 5CVJA 1W5TA 5BMZA 2FMLA 2VC0A 2KKOA 2VT3A 4PZJA 4CZZA 3D0SA 2XASA 1OYIA 5D6FA 2C6YA 3RI4A 1IF1A 3TO6A 1V3FA 2QYOA 2LKPA 1KU3A 4HAMA 5HDGA 4HQEA 2Z9OA 4HX8A 5ICEA 2ZMEA 3Q9VA 1ZYRF 4HYEA 1BC8C 2DI3A 5H6QA 4WK8F 1HKTA 4U0YA 2IJLA 3T5XA 5L3GA 1R36A 1ZH5A 2RNJA 2FSWA 3R60A 2XAFA 4FHTA 1QGPA 4LB5A 2BGCA 1FLIA 5BQTA 4WXHA 2OBPA 4LGWA 4Y17A 2HZTA 4R1HA 1Z1DA 1BN5A 4D0PA 3Q5FA 3QU6A 5DYMA 4ZH4F 3KP2A 4IHSA 2M1BA 3LAJA 2DTRA 2MA3A 3KP5A 5L3FA 4AIHA 3TO7A 2PJPA 2IT0A 3S2WA 3WE3A 3VOEA 2D2WA 1EV7A 3SHFA 3MCZA 2Y75A 4UVBA 3KP3A 1BIAA 1YYVA 4UUVA 4IHTA 2HEOA 4LFUA 4I0BA 3RYRA 3F6OA 1ULYA 1BI0A 3ZN0A 4HLYA 3GFLA 3FX3A 4IRHA 1R7JA 3VODA 4ZZLA 3GUDA 5DEQA 1TNTA 4GO1A 4G94A 4ESBA 1QZZA 1XD7A 1D3YA 2EA2A 1QNTA 3F3XA 3FM3A 3PQJA 4EM2A 4M6YA 3FXRA 3HSFA 2XVCA 1J7KA 2CO5A 4RAZA 3ISPA 3QU3A 1EH7A 2QVOA 5CVRA 3FXUA 4ZYHA 5D8KB 3WGIA 3VB2A 1LQ1A 2OQGA 5DV5A 3K1PA 1R58A 4RB3C 3GXOA 1FSHA 3O6BB 2O3FA 3MFKA 5ICGA 1I27A 1F1ZA 4QWQA 4OIOF 1ZN2A 4A0YA 4ENNA 1DUXC 4Q48A 1PDNC 5TRDA 3RKXA 1QPMA 2ESNA 2FA5A 1G3YA 1R22A 4A6EA 1R1VA 2JT1A 2PN6A 2HKXA 4GYGA 3KEOA 3H3UA 2RKHA 2OZ6A 1T2KA 2UWMA 4U0WA 5DDGA 1XCVA 3TQNA 5FLXZ 3I0TA 5DCMA 3TOAA 3NQOA 4CHUA 1FOKA 4N0BA 5FO5A 1B9MA 3L9FA 4LK0F 1LEBA 4P55A 1J59A 2H94A 2GIVA 3C3WA 3K1MA 1ON2A 1RNLA 3WTXC 1K78B 1B6AA 2P8TA 2P6SA 2V1DA 5ICCA 1OKRA 1YG2A 1W7PD 2L4MA 1EH6A 4GGGA 1CF7B 2PG4A 3WTUC 2GQQA 2FNAA 2XAJA 1J75A 2HYGD 4M9SA 1Z9CA 2DPUA 1P6RA 3SQNA 1XGMA 2P7CB 2P5KA 3KLOA 1T38A 4HDUA 5J6XA 1Y0UA 1IXCA 3IRRA 1C0WA 5LRRA 1ZARA 4M73A 4BH9A 1U3EM 2X4HA 2F5DA 5D5WB 4MEYF 1D8KA 3FWEA 2EA4A 4MEXF 4ENMA 3GX4X 4IJAA 4EVIA 2CWEA 4A12A 3TOBA 4WX9A 2V1UA 4U7BA 4H0EA 5DUIA 5A2QK 4IF4A 2DLLA 4EGYA 4JK1X 1WQ2A 5DD4A 3HUGA 4ENKA 3U1DA 4Q5SF 3O3KA 2VBWA 1YIOA 5L3EA 1RI7A 3V7SA 5BOXA 4EJTA 4OMZA 3HTUA 3V7CA 5J8FA 3L7WA 3EYIA 4HF1A 1UCRA 1J5YA 3ZN1A 2QBYB 2O61A 1HW1A 4GXOA 2FBIA 3HTSB 2FF4A 3ZMTA 3DFGA 3V4GA 4BNCA 2A07F 4LD5A 1R1UA 3K0LA 3REOA 3KP6A 3RKYA 2QLZA 2XV4S 1GXQA 1R00A 5LGTA 5TJJA 4KDPA 5E1ZB 3QOPA 3J80K 3DP7A 4Y13A 4LG0A 1FYKA 3JAMK 1S29A 1ZRDA 1MJAA 3IWFA 2HDCA 3IKTA 4L9VA 4BXUA 1U6GA 2XIGA 1ZAOA 2GA2A 2MLKA 2M8EA 2JPCA 5HLIA 2FXAA 4ASNA 1T98A 4ENJA 4P9FA 1WWXA 3DEUA 2JSCA 3EYYA 1YFHA 4FX0A 1XGNA 1HW2A 1HBXG 3HRMA 3BROA 2GA1A 4KICA 2FRHA 1GHCA 1UHWA 1TQPA 1SFUA 4ESJA 1USSA 3J81K 4GCVA 5E17F 4S04A 1HW5A 4MQVA 1YQAA 1BI2A 3U9GA 2OA4A 1JXSA 1PP8F 3TO9A 1JHFA 2B0LA 3U2RA 2YU3A 5KVRA 1LJ9A 1TW2A 3CUOA 2F5FA 3F8BA 4RS8A 2P4WA 2DFIA 2JPBA 2JTVA 4L9NA 1TW3A 3CUQB 4IRGA 3C1DA 5LGUA 2V9VA 5IT3A 3HRSA 2O03A 4I02A 2EFWA 4CGZA 4I2OA 2NAZA 1ZHFA 3GWZA 3AAFA 3R61A 1XSXA 3F8MA 2Q0OA 3WTZA 1MJ9A 1LDKB 3E6MA 4HZFA 1W4MA 3FMSA 4L9TA 2FOKA 4KN7X 5E8IA 2V6CA 3LA3A 4EMSA 1BC7C 2KJCA 4EM0B 5J8CA 4B8XA 3W6KB 1MZBA 5LRSA 2KIUA 2EV5A 2LDUA 3WU0A 1O3SA 1TTYA 3I53A 5ILSA 4A6DA 1QQIA 1Z91A 4RAYA 4OIQF 3EUHA 1W5SA 2HGCA 3M1EA 2Q2EA 1O57A 1NHAA 4HOBA 3GZ6A 1KQ0A 3BJAA 4Z2YA 3F8FA 2Q8KA 5DD8A 1UB9A 4KT5C 4AIJA 1IW7F 4HLXA 1LNWA 1CGPA 3F21A 3KP7A 2L54A 4KUMA 3KZYA 2VC1A 1FBUA 3ECOA 4P5OA 1UFMA 2EK5A 2J5PA 1JHHA 3E3VA 1RIOH 2NYXA 4EM1A 4EV0A 1S7AA 4XLNF 4XRFA 4ZYEA 1R5GA 4A0XA 3H92A 2ZNYA 1W7PA 1ZREA 1YW8A 4WXDA 4TV7A 2M87A 2ZJ2A 2QUFA 4NHJA 2NNNA 3ABTA 3HSRA 1O7FA 2JRTA 1O3TA 1XN7A 2W57A 3IL2A 3I59A 1EH8A 2AXLA 2VE9A 1FBQA 2BE5F 4PGGA 1F5TA 5HS8A 1P4XA 3TDUC 2MLGA 2CG4A 1E17A 2DK8A 3RKWA 1O7LA 1SD6A 2PEXA 4GYIA 1QBJA 3P9CA 1SFEA 2STTA 5HLGA 2QWWA 1OYYA 4HF0A 4P9UA 1RUOA 2A6EF 4LLLA 2A3SA 5D5VB 1K6OA 4OU0A 2F5EA 4PDKA 3V8JA 4RB0A 3MZHA 3LA2A 3ABUA 1IXRC 5ILUA 3KE2A 3H3ZA 2Z5UA 1SAXA 5F64A 2ISZA 4UV9A 1KA8A 2E7XA 2YX7A 2XGXA 4OOIA 1I5ZA 2HOEA 2TDXA 3BJ6A 3T1BA 2YSRA 5E20A 1AOYA 4U7DA 2PLYA 1FPQA 3FZVA 3KEQA 4L18B 5D4SA 3GEZA 2XHKA 1YS6A 3M9AA 4G7ZF 2XUBA 2O6GE 2YX4A 3KFWX 2RN7A 2D1VA 1R5HA 4FX4A 2W84A 2P7VB 3GVAA 1XB4A 4XBFA 1FBSA 1P4AA 2HTSA 4UXNA 2WWYA 1HSJA 3ML6A 3B02A 1BOAA 1ZLKA 3I54A 2IPQX 2D45A 5HDNA 3MQ0A 4N9IA 4ETSA 2L4AA 4RB2C 1ODDA 3QPHA 1F4KA 1REPC 5D5UB 3WGHA 2G9WA 5AIQA 2A6HF 2WTEA 1GVJA 2QQBA 1HSTA 4ZYDA 1MDMB 2YR2A 4YIIA 3E5XA 4I7HA 1KQ8A 4BHCA 2EB7A 4A5NA 5IT9K 4HW0A 2JZYA 5DUKA 1FP2A 4I01A 2MH2A 3KP4A 3RJPA 1B4AA 3GO5A 2ETHA 2CFXA 3QP6A 4LK1F 3KETA 4XSZF 3V7RA 1ZGJA 1H0MA 2KRFA 2FEZA 2RDPA 1FX7A 1R23A 4M6XA 1FNNA 2WC2A 1XGSA 2R7FA 3K9TA 3E5UA 3SFZA 2VODA 3R0AA 1RZ4A 3O2PE 3N97A 4G7HF 5JFRA 3NRVA 2P5VA 1P4WA 2ZFWA 4YFKF 1WSUA 1BM9A 4YIFA 2IA0A 3CO7C 2IP2A 2COMA 5JR3A 2ZCWA 3V8LA 2MD5A 4G8XA 4G6QA 1IN5A 3ZQ7A 4RGRA 1FY7A 3GYHX 2L02A 3RDIA 3GFMA 4A0ZA 1TQIA 3BWGA 3FMRA 3N4MA 1JGSA 1H9TA 1MDMA 5L3CA 4MTDA 3VEPA 1IN6A 1BI1A 2GAUA 1T39A 2DT5A 2M5WA 1OYWA 3DPLC 3T0YA 3F72A 1KU7A 2Y48A 5JI6A 1L3LA 4YFNF 5EEGA 1LVAA 4L0ZB 1D5VA 1XSDA 3CJNA 3F8CA 2RC4A 1LB2A 3I4PA 1QZYA 1K78A 1KU9A 3SXYA 1XSVA 2A69F 5BPIA 2A68F 5AIPA 2M45A 4JQFA 4N9HA 4UHTA 4CXFA 4I0AA 4BYYA 1CF7A 2XKOA 3LA7A 1V4RA 2HWVA 2OAZA 4OIPF 1BJAA 2W24A 2FMYA 1QO0D 4O3MA 3QP5A 2H6CA 3FMQA 3HIFA 5K5OA 3SZPA 3C7JA 1Z7UA 1KU2A 1FYLA 2LF8A 2VBXA 5D8LB 2J5OA 3M8EA 3M8FA 3L2CA 5H20A 2UZKA 4HV6A 2K02A 2D1HA 1BIBA 3HYIA 1F9NA 3I71A 2K86A 3BDDA 2OD5A 4ZYGA 2E7WA 4CO8A 4UV8A 1U78A 1D8JA 2F2EA 1H9GA 3GW2A 1HKQA 1LDDA 3FXQA 3E6DA 3ZMDA 4BHPA 5K5RA 3GLXA 5K5QA 4IRIA 1IZ1A 3P9IA 3EDPA 2QZ8A 4ESFA 5L3BA 2FBKA 3IHUA 2H09A 5FD6A 2ADUA 3QRFF 1BBYA 2QBYA 3LSTA 4MNUA 5CJ9A 4NQWA 4HV5A 2GXBA 2ZNZA 2LF7A 3HRUA 1O3QA 2LNBA 1IN8A 1KYZA 4F7ZA 4OMYA 4LJZF 5CYVA 2HTJA 4QLCU 3CUQC 1YLFA 5ERIA 4M74A 5EEHA 5BPDA 3HOTA 3WTTC 2ZMEB 2VONA 3RIRA 3WTWC 1T0FA 3FHZA 5ICFA 2H27A 5HS7A 5ILVA 1K7AA 1XMAA 4M9ZA 4LLGF 4L0YB 5JHUA 3ZP5A 2ZKZA 1U5TB 2FU4A 1U5TC 2EFOA 3T8TA 2M30A 2IRFG 4BAYA 5FLXK 5FFXA 3ZMUA 3I5UA 4AIKA 1XMKA 2FQ3A 1AWCA 2F5CA 3R0JA 3ZMSA 3D5LA 2R3SA 4O6JA 1IN4A 5LLQA 2GWRA 5CVIA 4AVPA 2UXXA 3CLOA 2KIMA 1XGOA 1WI9A 3K1NA 2RGVA 4M71A 1I6XA 1JE8A 3DKWA 5LHGA 4KN4X 1BI3A 3V8KA 1MJBA 4KMUX 1SD5A 3E5QA 1IRGA 2O8XA 4RGSA 4R79A 3I58A 2NNYA 1L0OC 2XROA 5H6RA 3I64A 3K69A 3CO6C 2EV0A 3G73A 4HX7A 1S7OA 4EQQA 1ZRCA 3DXJF 5LGNA 4UVAA 3CUQA 4U0VA 2W85A 4MGRA 4EGZA 3IKVA 1G4DA 2BBYA 5E1WA 2CQKA 2HFHA 1XCBA 2DPDA 4HQMA 2EFQA 2R7DA 1DPUA 3OOPA 5LHHA 2FBHA 1U5TA 2V1XA 1DPRA 1E2XA 5E8GA 2VOOA 4MQ9F 2DO7A 4RGUA 4JBAA 5FGMA 1DP7P 4BHBA 2DBBA 4HA8A 2EV6A 2X0LA 5L3DA 2CGPA 3MWMA 1KGSA 3HHHA 3IWZA 2RVCA 5A2QZ 5ED4A 1ZLJA 1A04A 4RGXA 1R1TA 2OQRA 3WU1B 1RUNA 4S05A 1SFXA 3VFZA 4G9YA 4O5VA 3KCCA 3BOQA 1IAWA 5LBQA 3ECHA 1XDUA 1IUYA 3JSOA 4B09A 3NEUA 3MEXA 1ZG5A 2Z33A 3RPUA 4WWCA 2ISYA 5FD5A 5HDKA 1SMTA 2CW0F 3JSPA 5F6FA 1KYWA 2IVMA 1S6LA 5HLHA 3L00A 4YG2F 1PP7U 3DF8A 2VXZA 5E18F 3GF2A 1MKMA 4XLPF 2W25A 3J80Z 2HKOA 2L3DA 1FP1D 3MAJA 3JAMZ 4KMFA 1KQ9A 2PMHA 4WCGA 3F6VA 3HRTA 2WV0A 1WKMA 4CYDA 1Z6TA 2RQPA 2VN2A 3BY6A 2PBIA 1IRFA 3TGNA 2CYYA 5DCMB 5FFZA 2PQ8A 1G3WA 3IRQA 3EETA 3JW4A 3LQQA 2QM3A 4ZZDA 4ON0A 2DQRA 1DDNA 1ZRFA 1P2FA 2PMUA 4M9XA 1LDJA 2ZBKA 2VBZA 4CICA 2K27A 1Z6RA 3E6BA 2VOPA 3J81Z 1S8NA 4RB1A 1WRJA 3ULQB 2Z99A 2QQAA 3BJOA 1B59A 4EJWA 3DV8A 2DU9A 3BPVA 1ON1A 3C18A 5CVVA 3WTVC 3WGGA 5LEKA 3DPTA 1OPCA 4AWXB 1FSEA 1OMIA 3CDHA 1B1BA 5LHIA 2UXNA 3F22A 2HS5A 4L5IA 3ERED 4IVNA 2GZWA 4DQ2A 4L5JA 2G7HA 3LWFA 1Q1HA 2P6TA 2DAOA 3SZTA 4PCQA 1G6NA 4KA4A 2E1CA 2ELHA 3KLNA 3GFIA 2QQ9A 2ZXJA 3BZ6A 1YTYA 1S3JA 2IA1A 5KK1A 1FC3A 1ZGAA 2E1NA 3GFJA 3R4KA 1IN7A 4L9JA 4IPAA 3E97A 1STZA 4LMYA 2AS5F 3P7NA 4Q47A 4OINF 4KYWA 1PUEE 1SD7A 2EFPA 4BQAA 5F1RA 1YW7A 6PAXA 2XRNA 5CLSA 2IA2A 4HF2A 2HYFA 4E70A 1FT9A 2K4BA 1U8RA 4G7OF 4HDVA 1GXPA 2A5YB 2PI0A 1Z05A 3J7AO 2ACJA 2GXGA 4EJOA 5AONA 4EJVA 2K4JA 1HKSA 4HBLA 2BEOA 3WODF 3IC7A 1LEAA 2ZO4A 3TKYA 1UHMA 5JVTA 2LSOA 1USTA 2KJBA 1TQMA 2BYVE 2DQLA 4A5MA 2BV6A 5HVQC 5HOOA 4KFCA 2A61A 4A2UA 4K2EA 3F8NA 4MTEA 4UVCA 4LG0B 3PQKA 1T6SA 2EFNA 4KNYA 4NB5A 1XDSA 4I09A 3WE2A 3HSEA 3ZMVA 3HOSA 4YFXF 3BP8A 4LB6B 2QENA 3L09A 1O3RA 3QPTA 2XAQA 4XSXF 1FZPB 3ELKA 3K2ZA 1YW9A 1TNSA 4KIFA 3KZZA 2EJRA 2PFBA 3COAC 4WXCA 2XKPA 2VE8A 3M7GA 4FT8A 1P92A 5D4RA 3B73A 3LQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9K A;  1ZG1 A;  2MH9 A;  1FWZ A;  4UNO A;  5BS6 A;  1G3S A;  1HXD A;  2VT2 A;  2HQN A;  4LLN A;  2IW5 A;  1ZG3 A;  4I98 B;  2OU2 A;  3TDZ C;  2DK5 A;  1TLH B;  2XAG A;  2XAH A;  3WTS C;  3FF5 A;  3CTA A;  4U88 A;  4CDG A;  2HR3 A;  3BPX A;  3JTH A;  3HHG A;  1J9I A;  3ZMZ A;  2CSO A;  4WF2 A;  4P96 A;  5D5X B;  2K7L A;  4EJU A;  1I1S A;  2OZU A;  3WG9 A;  1X3U A;  4G6D A;  3W6J B;  2EWN A;  2HQR A;  2YPR A;  4HX4 A;  2KIF A;  1YO5 C;  2Y0M A;  1VTN C;  4KIG A;  1G3T A;  3E6C C;  3DQV C;  2ESH A;  2O0Y A;  2V79 A;  3RTR A;  2RV8 A;  3R6S A;  5FB2 A;  5D6E A;  2VBY A;  4IXA A;  4Y15 A;  3OV8 A;  2G7U A;  1SD4 A;  4R8H A;  2Z3Y A;  4MHG A;  3LFK A;  3ZPL A;  3MZY A;  2FNP A;  2H6B A;  5E1X A;  3T8R A;  2NRA C;  2P5L C;  1B9N A;  4AD9 A;  4DNC A;  4Q4Z F;  2MC3 A;  2DW4 A;  1HQC A;  1MGT A;  2STW A;  4M72 A;  5DCF A;  1K79 A;  5HS9 A;  4OIR F;  1SMY F;  2L01 A;  3WTY C;  5IT9 Z;  1I1G A;  5K1Y A;  1YS7 A;  3LAP A;  3JTG A;  3F23 A;  1ONV A;  3QAH A;  5LEJ A;  3EQL F;  1J0R A;  1TBX A;  4PGH A;  3Q9S A;  3FM5 A;  1OR7 A;  3RYP A;  1W7P B;  3ROU A;  3GZ5 A;  1J2X A;  5CVU A;  3RPQ A;  2MBF A;  1MD0 A;  1FYM A;  1IXS B;  3G3Z A;  3PFI A;  2FE3 A;  3I59 B;  4KIB A;  2NS0 A;  1U2W A;  5CVJ A;  1W5T A;  5BMZ A;  2FML A;  2VC0 A;  2KKO A;  2VT3 A;  4PZJ A;  4CZZ A;  3D0S A;  2XAS A;  1OYI A;  5D6F A;  2C6Y A;  3RI4 A;  1IF1 A;  3TO6 A;  1V3F A;  2QYO A;  2LKP A;  1KU3 A;  4HAM A;  5HDG A;  4HQE A;  2Z9O A;  4HX8 A;  5ICE A;  2ZME A;  3Q9V A;  1ZYR F;  4HYE A;  1BC8 C;  2DI3 A;  5H6Q A;  4WK8 F;  1HKT A;  4U0Y A;  2IJL A;  3T5X A;  5L3G A;  1R36 A;  1ZH5 A;  2RNJ A;  2FSW A;  3R60 A;  2XAF A;  4FHT A;  1QGP A;  4LB5 A;  2BGC A;  1FLI A;  5BQT A;  4WXH A;  2OBP A;  4LGW A;  4Y17 A;  2HZT A;  4R1H A;  1Z1D A;  1BN5 A;  4D0P A;  3Q5F A;  3QU6 A;  5DYM A;  4ZH4 F;  3KP2 A;  4IHS A;  2M1B A;  3LAJ A;  2DTR A;  2MA3 A;  3KP5 A;  5L3F A;  4AIH A;  3TO7 A;  2PJP A;  2IT0 A;  3S2W A;  3WE3 A;  3VOE A;  2D2W A;  1EV7 A;  3SHF A;  3MCZ A;  2Y75 A;  4UVB A;  3KP3 A;  1BIA A;  1YYV A;  4UUV A;  4IHT A;  2HEO A;  4LFU A;  4I0B A;  3RYR A;  3F6O A;  1ULY A;  1BI0 A;  3ZN0 A;  4HLY A;  3GFL A;  3FX3 A;  4IRH A;  1R7J A;  3VOD A;  4ZZL A;  3GUD A;  5DEQ A;  1TNT A;  4GO1 A;  4G94 A;  4ESB A;  1QZZ A;  1XD7 A;  1D3Y A;  2EA2 A;  1QNT A;  3F3X A;  3FM3 A;  3PQJ A;  4EM2 A;  4M6Y A;  3FXR A;  3HSF A;  2XVC A;  1J7K A;  2CO5 A;  4RAZ A;  3ISP A;  3QU3 A;  1EH7 A;  2QVO A;  5CVR A;  3FXU A;  4ZYH A;  5D8K B;  3WGI A;  3VB2 A;  1LQ1 A;  2OQG A;  5DV5 A;  3K1P A;  1R58 A;  4RB3 C;  3GXO A;  1FSH A;  3O6B B;  2O3F A;  3MFK A;  5ICG A;  1I27 A;  1F1Z A;  4QWQ A;  4OIO F;  1ZN2 A;  4A0Y A;  4ENN A;  1DUX C;  4Q48 A;  1PDN C;  5TRD A;  3RKX A;  1QPM A;  2ESN A;  2FA5 A;  1G3Y A;  1R22 A;  4A6E A;  1R1V A;  2JT1 A;  2PN6 A;  2HKX A;  4GYG A;  3KEO A;  3H3U A;  2RKH A;  2OZ6 A;  1T2K A;  2UWM A;  4U0W A;  5DDG A;  1XCV A;  3TQN A;  5FLX Z;  3I0T A;  5DCM A;  3TOA A;  3NQO A;  4CHU A;  1FOK A;  4N0B A;  5FO5 A;  1B9M A;  3L9F A;  4LK0 F;  1LEB A;  4P55 A;  1J59 A;  2H94 A;  2GIV A;  3C3W A;  3K1M A;  1ON2 A;  1RNL A;  3WTX C;  1K78 B;  1B6A A;  2P8T A;  2P6S A;  2V1D A;  5ICC A;  1OKR A;  1YG2 A;  1W7P D;  2L4M A;  1EH6 A;  4GGG A;  1CF7 B;  2PG4 A;  3WTU C;  2GQQ A;  2FNA A;  2XAJ A;  1J75 A;  2HYG D;  4M9S A;  1Z9C A;  2DPU A;  1P6R A;  3SQN A;  1XGM A;  2P7C B;  2P5K A;  3KLO A;  1T38 A;  4HDU A;  5J6X A;  1Y0U A;  1IXC A;  3IRR A;  1C0W A;  5LRR A;  1ZAR A;  4M73 A;  4BH9 A;  1U3E M;  2X4H A;  2F5D A;  5D5W B;  4MEY F;  1D8K A;  3FWE A;  2EA4 A;  4MEX F;  4ENM A;  3GX4 X;  4IJA A;  4EVI A;  2CWE A;  4A12 A;  3TOB A;  4WX9 A;  2V1U A;  4U7B A;  4H0E A;  5DUI A;  5A2Q K;  4IF4 A;  2DLL A;  4EGY A;  4JK1 X;  1WQ2 A;  5DD4 A;  3HUG A;  4ENK A;  3U1D A;  4Q5S F;  3O3K A;  2VBW A;  1YIO A;  5L3E A;  1RI7 A;  3V7S A;  5BOX A;  4EJT A;  4OMZ A;  3HTU A;  3V7C A;  5J8F A;  3L7W A;  3EYI A;  4HF1 A;  1UCR A;  1J5Y A;  3ZN1 A;  2QBY B;  2O61 A;  1HW1 A;  4GXO A;  2FBI A;  3HTS B;  2FF4 A;  3ZMT A;  3DFG A;  3V4G A;  4BNC A;  2A07 F;  4LD5 A;  1R1U A;  3K0L A;  3REO A;  3KP6 A;  3RKY A;  2QLZ A;  2XV4 S;  1GXQ A;  1R00 A;  5LGT A;  5TJJ A;  4KDP A;  5E1Z B;  3QOP A;  3J80 K;  3DP7 A;  4Y13 A;  4LG0 A;  1FYK A;  3JAM K;  1S29 A;  1ZRD A;  1MJA A;  3IWF A;  2HDC A;  3IKT A;  4L9V A;  4BXU A;  1U6G A;  2XIG A;  1ZAO A;  2GA2 A;  2MLK A;  2M8E A;  2JPC A;  5HLI A;  2FXA A;  4ASN A;  1T98 A;  4ENJ A;  4P9F A;  1WWX A;  3DEU A;  2JSC A;  3EYY A;  1YFH A;  4FX0 A;  1XGN A;  1HW2 A;  1HBX G;  3HRM A;  3BRO A;  2GA1 A;  4KIC A;  2FRH A;  1GHC A;  1UHW A;  1TQP A;  1SFU A;  4ESJ A;  1USS A;  3J81 K;  4GCV A;  5E17 F;  4S04 A;  1HW5 A;  4MQV A;  1YQA A;  1BI2 A;  3U9G A;  2OA4 A;  1JXS A;  1PP8 F;  3TO9 A;  1JHF A;  2B0L A;  3U2R A;  2YU3 A;  5KVR A;  1LJ9 A;  1TW2 A;  3CUO A;  2F5F A;  3F8B A;  4RS8 A;  2P4W A;  2DFI A;  2JPB A;  2JTV A;  4L9N A;  1TW3 A;  3CUQ B;  4IRG A;  3C1D A;  5LGU A;  2V9V A;  5IT3 A;  3HRS A;  2O03 A;  4I02 A;  2EFW A;  4CGZ A;  4I2O A;  2NAZ A;  1ZHF A;  3GWZ A;  3AAF A;  3R61 A;  1XSX A;  3F8M A;  2Q0O A;  3WTZ A;  1MJ9 A;  1LDK B;  3E6M A;  4HZF A;  1W4M A;  3FMS A;  4L9T A;  2FOK A;  4KN7 X;  5E8I A;  2V6C A;  3LA3 A;  4EMS A;  1BC7 C;  2KJC A;  4EM0 B;  5J8C A;  4B8X A;  3W6K B;  1MZB A;  5LRS A;  2KIU A;  2EV5 A;  2LDU A;  3WU0 A;  1O3S A;  1TTY A;  3I53 A;  5ILS A;  4A6D A;  1QQI A;  1Z91 A;  4RAY A;  4OIQ F;  3EUH A;  1W5S A;  2HGC A;  3M1E A;  2Q2E A;  1O57 A;  1NHA A;  4HOB A;  3GZ6 A;  1KQ0 A;  3BJA A;  4Z2Y A;  3F8F A;  2Q8K A;  5DD8 A;  1UB9 A;  4KT5 C;  4AIJ A;  1IW7 F;  4HLX A;  1LNW A;  1CGP A;  3F21 A;  3KP7 A;  2L54 A;  4KUM A;  3KZY A;  2VC1 A;  1FBU A;  3ECO A;  4P5O A;  1UFM A;  2EK5 A;  2J5P A;  1JHH A;  3E3V A;  1RIO H;  2NYX A;  4EM1 A;  4EV0 A;  1S7A A;  4XLN F;  4XRF A;  4ZYE A;  1R5G A;  4A0X A;  3H92 A;  2ZNY A;  1W7P A;  1ZRE A;  1YW8 A;  4WXD A;  4TV7 A;  2M87 A;  2ZJ2 A;  2QUF A;  4NHJ A;  2NNN A;  3ABT A;  3HSR A;  1O7F A;  2JRT A;  1O3T A;  1XN7 A;  2W57 A;  3IL2 A;  3I59 A;  1EH8 A;  2AXL A;  2VE9 A;  1FBQ A;  2BE5 F;  4PGG A;  1F5T A;  5HS8 A;  1P4X A;  3TDU C;  2MLG A;  2CG4 A;  1E17 A;  2DK8 A;  3RKW A;  1O7L A;  1SD6 A;  2PEX A;  4GYI A;  1QBJ A;  3P9C A;  1SFE A;  2STT A;  5HLG A;  2QWW A;  1OYY A;  4HF0 A;  4P9U A;  1RUO A;  2A6E F;  4LLL A;  2A3S A;  5D5V B;  1K6O A;  4OU0 A;  2F5E A;  4PDK A;  3V8J A;  4RB0 A;  3MZH A;  3LA2 A;  3ABU A;  1IXR C;  5ILU A;  3KE2 A;  3H3Z A;  2Z5U A;  1SAX A;  5F64 A;  2ISZ A;  4UV9 A;  1KA8 A;  2E7X A;  2YX7 A;  2XGX A;  4OOI A;  1I5Z A;  2HOE A;  2TDX A;  3BJ6 A;  3T1B A;  2YSR A;  5E20 A;  1AOY A;  4U7D A;  2PLY A;  1FPQ A;  3FZV A;  3KEQ A;  4L18 B;  5D4S A;  3GEZ A;  2XHK A;  1YS6 A;  3M9A A;  4G7Z F;  2XUB A;  2O6G E;  2YX4 A;  3KFW X;  2RN7 A;  2D1V A;  1R5H A;  4FX4 A;  2W84 A;  2P7V B;  3GVA A;  1XB4 A;  4XBF A;  1FBS A;  1P4A A;  2HTS A;  4UXN A;  2WWY A;  1HSJ A;  3ML6 A;  3B02 A;  1BOA A;  1ZLK A;  3I54 A;  2IPQ X;  2D45 A;  5HDN A;  3MQ0 A;  4N9I A;  4ETS A;  2L4A A;  4RB2 C;  1ODD A;  3QPH A;  1F4K A;  1REP C;  5D5U B;  3WGH A;  2G9W A;  5AIQ A;  2A6H F;  2WTE A;  1GVJ A;  2QQB A;  1HST A;  4ZYD A;  1MDM B;  2YR2 A;  4YII A;  3E5X A;  4I7H A;  1KQ8 A;  4BHC A;  2EB7 A;  4A5N A;  5IT9 K;  4HW0 A;  2JZY A;  5DUK A;  1FP2 A;  4I01 A;  2MH2 A;  3KP4 A;  3RJP A;  1B4A A;  3GO5 A;  2ETH A;  2CFX A;  3QP6 A;  4LK1 F;  3KET A;  4XSZ F;  3V7R A;  1ZGJ A;  1H0M A;  2KRF A;  2FEZ A;  2RDP A;  1FX7 A;  1R23 A;  4M6X A;  1FNN A;  2WC2 A;  1XGS A;  2R7F A;  3K9T A;  3E5U A;  3SFZ A;  2VOD A;  3R0A A;  1RZ4 A;  3O2P E;  3N97 A;  4G7H F;  5JFR A;  3NRV A;  2P5V A;  1P4W A;  2ZFW A;  4YFK F;  1WSU A;  1BM9 A;  4YIF A;  2IA0 A;  3CO7 C;  2IP2 A;  2COM A;  5JR3 A;  2ZCW A;  3V8L A;  2MD5 A;  4G8X A;  4G6Q A;  1IN5 A;  3ZQ7 A;  4RGR A;  1FY7 A;  3GYH X;  2L02 A;  3RDI A;  3GFM A;  4A0Z A;  1TQI A;  3BWG A;  3FMR A;  3N4M A;  1JGS A;  1H9T A;  1MDM A;  5L3C A;  4MTD A;  3VEP A;  1IN6 A;  1BI1 A;  2GAU A;  1T39 A;  2DT5 A;  2M5W A;  1OYW A;  3DPL C;  3T0Y A;  3F72 A;  1KU7 A;  2Y48 A;  5JI6 A;  1L3L A;  4YFN F;  5EEG A;  1LVA A;  4L0Z B;  1D5V A;  1XSD A;  3CJN A;  3F8C A;  2RC4 A;  1LB2 A;  3I4P A;  1QZY A;  1K78 A;  1KU9 A;  3SXY A;  1XSV A;  2A69 F;  5BPI A;  2A68 F;  5AIP A;  2M45 A;  4JQF A;  4N9H A;  4UHT A;  4CXF A;  4I0A A;  4BYY A;  1CF7 A;  2XKO A;  3LA7 A;  1V4R A;  2HWV A;  2OAZ A;  4OIP F;  1BJA A;  2W24 A;  2FMY A;  1QO0 D;  4O3M A;  3QP5 A;  2H6C A;  3FMQ A;  3HIF A;  5K5O A;  3SZP A;  3C7J A;  1Z7U A;  1KU2 A;  1FYL A;  2LF8 A;  2VBX A;  5D8L B;  2J5O A;  3M8E A;  3M8F A;  3L2C A;  5H20 A;  2UZK A;  4HV6 A;  2K02 A;  2D1H A;  1BIB A;  3HYI A;  1F9N A;  3I71 A;  2K86 A;  3BDD A;  2OD5 A;  4ZYG A;  2E7W A;  4CO8 A;  4UV8 A;  1U78 A;  1D8J A;  2F2E A;  1H9G A;  3GW2 A;  1HKQ A;  1LDD A;  3FXQ A;  3E6D A;  3ZMD A;  4BHP A;  5K5R A;  3GLX A;  5K5Q A;  4IRI A;  1IZ1 A;  3P9I A;  3EDP A;  2QZ8 A;  4ESF A;  5L3B A;  2FBK A;  3IHU A;  2H09 A;  5FD6 A;  2ADU A;  3QRF F;  1BBY A;  2QBY A;  3LST A;  4MNU A;  5CJ9 A;  4NQW A;  4HV5 A;  2GXB A;  2ZNZ A;  2LF7 A;  3HRU A;  1O3Q A;  2LNB A;  1IN8 A;  1KYZ A;  4F7Z A;  4OMY A;  4LJZ F;  5CYV A;  2HTJ A;  4QLC U;  3CUQ C;  1YLF A;  5ERI A;  4M74 A;  5EEH A;  5BPD A;  3HOT A;  3WTT C;  2ZME B;  2VON A;  3RIR A;  3WTW C;  1T0F A;  3FHZ A;  5ICF A;  2H27 A;  5HS7 A;  5ILV A;  1K7A A;  1XMA A;  4M9Z A;  4LLG F;  4L0Y B;  5JHU A;  3ZP5 A;  2ZKZ A;  1U5T B;  2FU4 A;  1U5T C;  2EFO A;  3T8T A;  2M30 A;  2IRF G;  4BAY A;  5FLX K;  5FFX A;  3ZMU A;  3I5U A;  4AIK A;  1XMK A;  2FQ3 A;  1AWC A;  2F5C A;  3R0J A;  3ZMS A;  3D5L A;  2R3S A;  4O6J A;  1IN4 A;  5LLQ A;  2GWR A;  5CVI A;  4AVP A;  2UXX A;  3CLO A;  2KIM A;  1XGO A;  1WI9 A;  3K1N A;  2RGV A;  4M71 A;  1I6X A;  1JE8 A;  3DKW A;  5LHG A;  4KN4 X;  1BI3 A;  3V8K A;  1MJB A;  4KMU X;  1SD5 A;  3E5Q A;  1IRG A;  2O8X A;  4RGS A;  4R79 A;  3I58 A;  2NNY A;  1L0O C;  2XRO A;  5H6R A;  3I64 A;  3K69 A;  3CO6 C;  2EV0 A;  3G73 A;  4HX7 A;  1S7O A;  4EQQ A;  1ZRC A;  3DXJ F;  5LGN A;  4UVA A;  3CUQ A;  4U0V A;  2W85 A;  4MGR A;  4EGZ A;  3IKV A;  1G4D A;  2BBY A;  5E1W A;  2CQK A;  2HFH A;  1XCB A;  2DPD A;  4HQM A;  2EFQ A;  2R7D A;  1DPU A;  3OOP A;  5LHH A;  2FBH A;  1U5T A;  2V1X A;  1DPR A;  1E2X A;  5E8G A;  2VOO A;  4MQ9 F;  2DO7 A;  4RGU A;  4JBA A;  5FGM A;  1DP7 P;  4BHB A;  2DBB A;  4HA8 A;  2EV6 A;  2X0L A;  5L3D A;  2CGP A;  3MWM A;  1KGS A;  3HHH A;  3IWZ A;  2RVC A;  5A2Q Z;  5ED4 A;  1ZLJ A;  1A04 A;  4RGX A;  1R1T A;  2OQR A;  3WU1 B;  1RUN A;  4S05 A;  1SFX A;  3VFZ A;  4G9Y A;  4O5V A;  3KCC A;  3BOQ A;  1IAW A;  5LBQ A;  3ECH A;  1XDU A;  1IUY A;  3JSO A;  4B09 A;  3NEU A;  3MEX A;  1ZG5 A;  2Z33 A;  3RPU A;  4WWC A;  2ISY A;  5FD5 A;  5HDK A;  1SMT A;  2CW0 F;  3JSP A;  5F6F A;  1KYW A;  2IVM A;  1S6L A;  5HLH A;  3L00 A;  4YG2 F;  1PP7 U;  3DF8 A;  2VXZ A;  5E18 F;  3GF2 A;  1MKM A;  4XLP F;  2W25 A;  3J80 Z;  2HKO A;  2L3D A;  1FP1 D;  3MAJ A;  3JAM Z;  4KMF A;  1KQ9 A;  2PMH A;  4WCG A;  3F6V A;  3HRT A;  2WV0 A;  1WKM A;  4CYD A;  1Z6T A;  2RQP A;  2VN2 A;  3BY6 A;  2PBI A;  1IRF A;  3TGN A;  2CYY A;  5DCM B;  5FFZ A;  2PQ8 A;  1G3W A;  3IRQ A;  3EET A;  3JW4 A;  3LQQ A;  2QM3 A;  4ZZD A;  4ON0 A;  2DQR A;  1DDN A;  1ZRF A;  1P2F A;  2PMU A;  4M9X A;  1LDJ A;  2ZBK A;  2VBZ A;  4CIC A;  2K27 A;  1Z6R A;  3E6B A;  2VOP A;  3J81 Z;  1S8N A;  4RB1 A;  1WRJ A;  3ULQ B;  2Z99 A;  2QQA A;  3BJO A;  1B59 A;  4EJW A;  3DV8 A;  2DU9 A;  3BPV A;  1ON1 A;  3C18 A;  5CVV A;  3WTV C;  3WGG A;  5LEK A;  3DPT A;  1OPC A;  4AWX B;  1FSE A;  1OMI A;  3CDH A;  1B1B A;  5LHI A;  2UXN A;  3F22 A;  2HS5 A;  4L5I A;  3ERE D;  4IVN A;  2GZW A;  4DQ2 A;  4L5J A;  2G7H A;  3LWF A;  1Q1H A;  2P6T A;  2DAO A;  3SZT A;  4PCQ A;  1G6N A;  4KA4 A;  2E1C A;  2ELH A;  3KLN A;  3GFI A;  2QQ9 A;  2ZXJ A;  3BZ6 A;  1YTY A;  1S3J A;  2IA1 A;  5KK1 A;  1FC3 A;  1ZGA A;  2E1N A;  3GFJ A;  3R4K A;  1IN7 A;  4L9J A;  4IPA A;  3E97 A;  1STZ A;  4LMY A;  2AS5 F;  3P7N A;  4Q47 A;  4OIN F;  4KYW A;  1PUE E;  1SD7 A;  2EFP A;  4BQA A;  5F1R A;  1YW7 A;  6PAX A;  2XRN A;  5CLS A;  2IA2 A;  4HF2 A;  2HYF A;  4E70 A;  1FT9 A;  2K4B A;  1U8R A;  4G7O F;  4HDV A;  1GXP A;  2A5Y B;  2PI0 A;  1Z05 A;  3J7A O;  2ACJ A;  2GXG A;  4EJO A;  5AON A;  4EJV A;  2K4J A;  1HKS A;  4HBL A;  2BEO A;  3WOD F;  3IC7 A;  1LEA A;  2ZO4 A;  3TKY A;  1UHM A;  5JVT A;  2LSO A;  1UST A;  2KJB A;  1TQM A;  2BYV E;  2DQL A;  4A5M A;  2BV6 A;  5HVQ C;  5HOO A;  4KFC A;  2A61 A;  4A2U A;  4K2E A;  3F8N A;  4MTE A;  4UVC A;  4LG0 B;  3PQK A;  1T6S A;  2EFN A;  4KNY A;  4NB5 A;  1XDS A;  4I09 A;  3WE2 A;  3HSE A;  3ZMV A;  3HOS A;  4YFX F;  3BP8 A;  4LB6 B;  2QEN A;  3L09 A;  1O3R A;  3QPT A;  2XAQ A;  4XSX F;  1FZP B;  3ELK A;  3K2Z A;  1YW9 A;  1TNS A;  4KIF A;  3KZZ A;  2EJR A;  2PFB A;  3COA C;  4WXC A;  2XKP A;  2VE8 A;  3M7G A;  4FT8 A;  1P92 A;  5D4R A;  3B73 A;  3LQR A; 
#chains in the Genus database with same CATH topology
 3P9K A;  1ZG1 A;  5FKK A;  2MH9 A;  4GFB A;  4BDY A;  1FWZ A;  4UNO A;  4RMN A;  4BQQ A;  5BS6 A;  1G3S A;  1HXD A;  2VT2 A;  2HQN A;  1YIT I;  4LLN A;  3HB9 A;  4XL9 A;  2IW5 A;  4X0G A;  1ZG3 A;  4I98 B;  2OU2 A;  3MKL A;  3F0C A;  3CMA I;  1IO2 A;  4FE4 A;  3TDZ C;  3GTG J;  3KIO A;  1ZEL A;  1I3A A;  2DK5 A;  1TLH B;  2XAG A;  2XAH A;  4QPQ A;  3WTS C;  1YJW I;  3FF5 A;  3CTA A;  2HNH A;  4U88 A;  3FBI B;  4BE2 A;  3QWL A;  3CCU I;  3EUA A;  4CDG A;  3GTM J;  1LPQ A;  2HR3 A;  2JA6 J;  2H8R A;  5EGO A;  4PSX A;  3GME A;  1VND A;  3BPX A;  1I50 J;  3CMM A;  3JTH A;  3RKQ A;  1OR7 C;  3HHG A;  1J9I A;  1SC7 A;  4QIW N;  1GV5 A;  3ZMZ A;  1A35 A;  2CSO A;  1YX3 A;  1ITY A;  1ERD A;  4WF2 A;  3DU5 A;  4P96 A;  4AC0 A;  5D5X B;  3MKY B;  3G2B A;  2K7L A;  4EJU A;  1VQ6 I;  1I1S A;  2OZU A;  5E79 C;  3WG9 A;  1X3U A;  4G6D A;  1V5F A;  3W6J B;  1ZTR A;  2EWN A;  2HQR A;  2YPR A;  4HX4 A;  2KIF A;  3SFI A;  1YO5 C;  2Y0M A;  1VTN C;  4Y3O A;  4I6Z A;  5FRO A;  4KIG A;  3BTI A;  2JMW A;  1G3T A;  3E6C C;  4HNV A;  3DQV C;  1UJ8 A;  2ESH A;  3K70 D;  2O0Y A;  3QPS A;  2V79 A;  2XC7 A;  3RTR A;  5F27 A;  2RV8 A;  3R6S A;  5FB2 A;  1M1E B;  2YU9 J;  5D6E A;  2VBY A;  1D5Y A;  4IXA A;  4CYC B;  4Y15 A;  4BXX J;  4EAT A;  1RES A;  3OV8 A;  2H8W A;  4GDF A;  2G7U A;  4II2 A;  3GLL A;  2Q2E B;  1SD4 A;  4R8H A;  2Z3Y A;  4MHG A;  3LFK A;  2R7S A;  3ZPL A;  2K9L A;  1OCC H;  2FNP A;  2H6B A;  3MZY A;  1YRN A;  2O7O A;  5E1X A;  2HDD A;  1TZL A;  3T8R A;  5FKO A;  2NRA C;  2P5L C;  1B9N A;  4AD9 A;  2PX9 A;  2VKV A;  4IQJ A;  4DNC A;  2NVU B;  4Q4Z F;  1MBF A;  1WJF A;  2MC3 A;  3OYE A;  2DW4 A;  4XID A;  1HQC A;  4HST A;  4DYR A;  1MGT A;  2STW A;  4M72 A;  9ANT A;  5DCF A;  3LSP A;  1K79 A;  5HS9 A;  5B66 C;  4OIR F;  3FXK A;  4DJA A;  1FMW A;  3ZCO A;  1SMY F;  3CCE I;  2L01 A;  4CCM A;  1HDD C;  3E7L A;  1BOB A;  3WTY C;  2G0E A;  5IT9 Z;  1I1G A;  5K1Y A;  1YS7 A;  3FIW A;  4NUB A;  4IO9 F;  3H9G A;  3LAP A;  3ZQC A;  3JTG A;  3F23 A;  3OL3 A;  1ONV A;  2HVQ A;  3QAH A;  2ID6 A;  5LEJ A;  3EQL F;  4W1U A;  1J0R A;  1TBX A;  4PGH A;  2O8K A;  3Q9S A;  3BG6 A;  3PNV A;  3FM5 A;  1OR7 A;  3RYP A;  1W7P B;  3ERM A;  2F6C A;  3ROU A;  2ZB9 A;  3W2W A;  5EEA A;  3GTK J;  2LRD A;  5IPA A;  3GZ5 A;  2KT0 A;  1J2X A;  5CVU A;  2V7F A;  3RPQ A;  2MBF A;  2M34 A;  4XLE A;  1MD0 A;  1FYM A;  1IXS B;  4XQF A;  5C4X J;  3G3Z A;  2DDA A;  2KDZ A;  3PFI A;  2FE3 A;  3ZOB A;  5C4J J;  3I59 B;  4KIB A;  4D5C A;  4PFO A;  1GV2 A;  1HCR A;  2IAI A;  2NS0 A;  3C2H A;  4BY7 J;  2ZJR F;  1U2W A;  3QOE A;  3M4O J;  5CVJ A;  3ZQH A;  1W5C C;  2VL8 A;  4QPO A;  1W5T A;  5BMZ A;  2FML A;  2VC0 A;  4KIS A;  2KKO A;  3QPL A;  2VT3 A;  4PZJ A;  4CYC A;  2BOL A;  2KHM A;  4CZZ A;  3D0S A;  3A0H C;  2VJ4 A;  2XAS A;  3H3V K;  2Y69 H;  1OYI A;  4II3 A;  5D6F A;  2C6Y A;  2X6W A;  1H88 C;  2CQ7 A;  4JX6 A;  4F91 B;  2DT6 A;  3DKX A;  3RI4 A;  4ZTJ A;  4G6T B;  5M3M J;  2L0K A;  3TO6 A;  2CQX A;  1IF1 A;  1V3F A;  2QYO A;  2LKP A;  3K4K A;  1YJN I;  4CCN A;  1KU3 A;  4B47 A;  3BCA A;  3CCY A;  1VQ4 I;  4HAM A;  1NG7 A;  5HDG A;  4HQE A;  2Z9O A;  4HX8 A;  5ICE A;  2ZME A;  2K3P A;  1FEX A;  3K4M A;  3HGY A;  3Q9V A;  1ZYR F;  2HXI A;  2VIX A;  3W3C A;  4XN3 A;  2IGK A;  3VSL A;  2UV1 A;  4G12 A;  1YOV B;  3CES A;  3IH3 A;  1BW5 A;  4HYE A;  3RSN A;  5M5W J;  1BC8 C;  2K9M A;  1YI2 I;  2X1E A;  1TT5 B;  2DI3 A;  5H6Q A;  1R6R A;  1BR2 A;  1JGG A;  4WK8 F;  2CUZ A;  1HKT A;  2L9R A;  4XLH A;  4U0Y A;  3SDB A;  2IJL A;  3G4S I;  2Y2Z A;  3T5X A;  2K9S A;  5L3G A;  1R36 A;  1ZH5 A;  2LYC A;  2RNJ A;  2FSW A;  3R60 A;  3PSF A;  2XAF A;  1SEU A;  4FQG A;  2LBF B;  2E71 A;  4FHT A;  1QGP A;  4LB5 A;  2BGC A;  1FLI A;  5BQT A;  4JX4 A;  2M7B A;  3EUK L;  1K61 A;  3QOD A;  4WXH A;  2XGE A;  3OL4 A;  4C2T A;  2OBP A;  4FET A;  1X3W B;  1RR7 A;  4LGW A;  4Y17 A;  3HOW J;  2HZT A;  2AHQ A;  4C3I J;  4R1H A;  1Z1D A;  3E0J B;  3KZI C;  2FD5 A;  1BN5 A;  4D0P A;  2YUS A;  3Q5F A;  3FDY A;  4P1W A;  3QU6 A;  1VQM I;  1WJB A;  2XF5 A;  5DYM A;  4CA0 A;  4ZH4 F;  1XMX A;  3KP2 A;  4CH7 A;  1SAU A;  3CDI A;  2M1B A;  4IHS A;  3L2V A;  3LAJ A;  2DTR A;  2JVG A;  2L9V A;  3S16 J;  2HOA A;  2MA3 A;  3KP5 A;  2NOG A;  5FJ8 J;  5M3F J;  2AO9 A;  5L3F A;  4AIH A;  3TO7 A;  3C2G A;  2PJP A;  2IT0 A;  5KCM A;  3S2W A;  5C3E J;  3WE3 A;  2LY1 A;  3VOE A;  1R4M B;  1FIP A;  4ZDP A;  4PK4 A;  2D2W A;  1EV7 A;  3SHF A;  4E7Z A;  3MCZ A;  2LOO A;  2Y75 A;  3CF2 A;  4UVB A;  3KP3 A;  4XRM A;  1BIA A;  2E1M B;  2E1M C;  1YYV A;  4UUV A;  2R4G A;  1MBK A;  4IHT A;  2M3A A;  3VWB A;  1N25 A;  4LFU A;  2HEO A;  5FRM A;  4I0B A;  3RYR A;  2ZC2 A;  3F6O A;  1HOM A;  2Y31 A;  1IC8 A;  3Q0U A;  1ULY A;  1BI0 A;  2MYS A;  2B63 J;  3ZN0 A;  4HLY A;  3DTK A;  3S1M J;  3GFL A;  3FX3 A;  1VQ8 I;  1Y0N A;  2L9N A;  1NH3 A;  4IRH A;  1R7J A;  3VOD A;  1VQ9 I;  2LY2 A;  5K7H A;  4ZZL A;  1JUM A;  3GUD A;  5DEQ A;  2QF7 A;  3MMY B;  1TNT A;  2DFF A;  4GO1 A;  4G94 A;  4ESB A;  1QZZ A;  4E7S A;  3K70 C;  1XD7 A;  1D3Y A;  2EA2 A;  3LFU A;  4MIM A;  2DA3 A;  1QNT A;  3F3X A;  3FM3 A;  3PQJ A;  4EEF G;  4EM2 A;  4XRS A;  4M6Y A;  1H8A C;  3FXR A;  3QYB A;  3HSF A;  2XVC A;  4IOC F;  1J7K A;  2CO5 A;  4BEH A;  4RAZ A;  3S15 J;  3ISP A;  3QU3 A;  4UUT A;  5F08 A;  4Y7N J;  1EH7 A;  2QVO A;  5CVR A;  3W2A A;  2QCO A;  1RKT A;  3FXU A;  4ZYH A;  5D8K B;  4DBR A;  3WGI A;  3VB2 A;  1LQ1 A;  2TCT A;  4FAS D;  2CUJ A;  2PMZ A;  2OQG A;  1X2M A;  3S1Q J;  3NAR A;  5DV5 A;  3K1P A;  3RQ4 A;  3SEZ A;  1R58 A;  4Z6Y A;  4RB3 C;  3GXO A;  2CUE A;  1FSH A;  5IYC J;  5E3M A;  1WJC A;  1E3P A;  3OSG A;  4UUS B;  1TL8 A;  1TWC J;  5CQE A;  3L2R A;  3O6B B;  1UEL B;  3M07 A;  2W48 A;  2O3F A;  3MFK A;  2KZV A;  5ICG A;  1I27 A;  1F1Z A;  5JHF A;  3G6E I;  2ZXI A;  4QWQ A;  4OIO F;  1GT0 C;  3HM5 A;  3OIP A;  1ZN2 A;  1OFC X;  4A0Y A;  4ENN A;  1DUX C;  2ZSI B;  2E34 A;  1Y39 A;  4Q48 A;  2DOA A;  1PDN C;  5TRD A;  3JR9 A;  3LNQ A;  3RKX A;  5FKN A;  3JRI A;  1YJ9 I;  3HGG A;  1QPM A;  2M9H A;  2ESN A;  1D1B A;  4ZJZ A;  2FA5 A;  1G3Y A;  1R22 A;  1QVU A;  4A6E A;  1R1V A;  2JT1 A;  3H9Q A;  2PN6 A;  2FX0 A;  2Y0S A;  4HSR A;  2MGQ A;  2HKX A;  5B1A H;  4GYG A;  3KEO A;  1RRJ A;  2BW3 A;  1Y6I A;  3P5J A;  2B7E A;  3H3U A;  2R7W A;  4AVZ A;  1WJE A;  2BVL A;  2RKH A;  3S2D J;  2HQ5 A;  3A02 A;  2OZ6 A;  4PJ0 C;  1T2K A;  2UWM A;  2XF6 A;  3BR1 A;  4HNT A;  4U0W A;  5J1Y A;  3MD2 A;  4NC8 A;  1OCZ H;  1UHS A;  5DDG A;  1VQ5 I;  3OYG A;  1NK2 P;  1XCV A;  2L9S A;  4IHV A;  3TQN A;  2R5Y A;  3S17 J;  2F5V A;  5FLX Z;  3I3L A;  2E19 A;  3FXJ A;  3I0T A;  5DCM A;  1S9H A;  5EJC A;  3NQO A;  3TOA A;  2RNG A;  2V9P A;  1GDT A;  1FOK A;  4CHU A;  4N0B A;  2IGN A;  1SVO A;  1B9M A;  5FO5 A;  3IH2 A;  2GIZ A;  3L9F A;  4LK0 F;  3ESW B;  1LEB A;  4P55 A;  3OYF A;  1J59 A;  2H94 A;  4A3E J;  2GIV A;  3C3W A;  3K1M A;  3OIQ A;  1ON2 A;  1SFO J;  1BW6 A;  1RNL A;  3WTX C;  3X2Q H;  1K78 B;  1HLV A;  2EIJ H;  1B6A A;  4BDZ A;  2P8T A;  2P6S A;  2V1D A;  5ICC A;  1OKR A;  2NVY J;  1YG2 A;  1W7P D;  1ZK8 A;  4M3E A;  4RAF A;  3RQI A;  1ORK A;  5J40 A;  3CME I;  3HPH A;  3ABL H;  3HC7 A;  2ZJQ F;  2L4M A;  2M2E A;  4IZZ A;  1EH6 A;  4GGG A;  1R49 A;  3J7Z I;  2JUC A;  5M5Y J;  2PG4 A;  1CF7 B;  3DTI A;  3WTU C;  2GQQ A;  2FNA A;  3SYT A;  2XAJ A;  1J75 A;  2DOF A;  2E5Z A;  2HYG D;  4M9S A;  4J01 A;  1Z9C A;  2KQR A;  2DPU A;  2NVX J;  1NTC A;  1P6R A;  2GXA A;  3SQN A;  1XGM A;  3CCQ I;  3B6A A;  2VPR A;  2P7C B;  2P5K A;  5K7F A;  3BR3 A;  3KLO A;  1V5E A;  3A03 A;  2VQG A;  1W0T A;  2QGU A;  1POG A;  1T38 A;  4HDU A;  2VXD A;  1V54 H;  2DA1 A;  5GAE J;  5JLX A;  3M3Y J;  5J6X A;  2EIL H;  1Y0U A;  2DMN A;  4XON A;  1IXC A;  4BS9 A;  3IRR A;  2LD5 A;  4LOC A;  1C0W A;  2DMQ A;  3CF5 F;  4CZC A;  4XOR A;  5LRR A;  1ZAR A;  4M73 A;  2X1C A;  1HC8 A;  4BH9 A;  5F0F A;  5EYR A;  1U3E M;  2X4H A;  1Z7L A;  2F5D A;  5D5W B;  3CC4 I;  4MEY F;  2VQC A;  1X58 A;  3CZ6 A;  2HI3 A;  4M3D A;  2Z2S B;  5F1J A;  4C2M J;  1D8K A;  4RBO A;  4Y52 J;  1E0E A;  1AA7 A;  1W1W E;  2GBY A;  3FWE A;  1QZE A;  2EA4 A;  3AL0 B;  4MEX F;  4ENM A;  3GX4 X;  3DPU A;  4IJA A;  3W2V A;  2LKS A;  4EVI A;  2IGM A;  2CWE A;  2P81 A;  1QHH D;  4AYB A;  4PUS A;  4A12 A;  3TOB A;  4WX9 A;  2V1U A;  3LSM A;  1OIS A;  4U7B A;  4H0E A;  1DGW Y;  2BY3 A;  2VQL A;  5LFA A;  5DUI A;  3A1Y A;  2R7V A;  3WU2 C;  4C9Y A;  5A2Q K;  3RZD J;  4IF4 A;  3BR6 A;  2DLL A;  4EGY A;  3IAS 2;  4JK1 X;  1WQ2 A;  5M5X J;  5DD4 A;  3HUG A;  4ENK A;  3U1D A;  4Q5S F;  3H35 A;  3O3K A;  2WA0 A;  2VBW A;  2HXO A;  1OCT C;  1YIO A;  5L3E A;  1RI7 A;  3V7S A;  5BOX A;  2NS8 A;  1X4P A;  2W7N A;  1N77 A;  4EJT A;  4OMZ A;  3OOU A;  3HTU A;  3V7C A;  2R0Q C;  2KIQ A;  2X51 A;  5J8F A;  3L7W A;  3EYI A;  4HF1 A;  1JKR C;  2KPM A;  3ONQ A;  4B3A A;  2XGD A;  1FMV A;  5LD2 C;  2OPT A;  2Q1Z B;  2CJJ A;  1UCR A;  4ZC3 A;  1J5Y A;  3FXO A;  2L5Q A;  3ZN1 A;  2QBY B;  2O61 A;  1HW1 A;  4GXO A;  2QSF X;  2FBI A;  2WY7 Q;  5IYB J;  2IXS A;  3HTS B;  2WV1 A;  2FF4 A;  2WAD A;  3OYJ A;  2BVM A;  3ZMT A;  2VUM J;  3OSF A;  3DFG A;  3V4G A;  3CCL I;  4BNC A;  2A07 F;  1MMG A;  2IS6 A;  2F48 A;  4LD5 A;  3M8J A;  2R7T A;  1JKQ C;  4X1E A;  4JOM A;  1R1U A;  1OCO H;  3K0L A;  3REO A;  3KP6 A;  1JKO C;  1I3Q J;  3RKY A;  2QLZ A;  2XV4 S;  1GXQ A;  1R00 A;  1OQY A;  1MIJ A;  5LGT A;  5TJJ A;  2DJN A;  4KDP A;  1IGN A;  5E1Z B;  3QOP A;  3J80 K;  1WCM J;  3DP7 A;  4Y13 A;  4LG0 A;  1NG6 A;  1FYK A;  3JAM K;  1S29 A;  3OYH A;  1ZRD A;  5B1B H;  3HDD A;  3J7A Y;  1K4T A;  1MJA A;  3WG7 H;  3IWF A;  2HDC A;  3IKT A;  4L9V A;  4BXU A;  1U6G A;  2XIG A;  2CRG A;  2QQ8 A;  1ZAO A;  2GA2 A;  5FRN A;  2MLK A;  4D5F A;  2M8E A;  2JPC A;  1E3H A;  2DYR H;  3GBG A;  4RM2 A;  5HLI A;  2JA5 J;  2FXA A;  3H0G J;  3K4N A;  4ASN A;  1T98 A;  4ENJ A;  2YS9 A;  3LSK A;  2LVS A;  4P9F A;  1ZR4 A;  5GTI C;  1WWX A;  2GLO A;  3DEU A;  4LIT A;  2JSC A;  3BTC A;  3EYY A;  5DM6 F;  1YFH A;  1T8I A;  3HKZ N;  1JTX A;  4FX0 A;  1JUP A;  1Y8R B;  3DTE A;  3KEY A;  1XGN A;  4AM3 A;  1HW2 A;  1HBX G;  3H9J A;  3HRM A;  3HPG A;  2ME0 A;  3BRO A;  3CCV I;  2GA1 A;  1MSE C;  2E2J J;  2HU9 A;  4KIC A;  2FRH A;  1GHC A;  1IDZ A;  1UHW A;  1TQP A;  2B9S A;  1SFU A;  3ABM H;  3VPR A;  2V1N A;  4ESJ A;  3G1L A;  1TWH J;  1USS A;  3J81 K;  4GCV A;  3WHC A;  1B72 B;  1R5I D;  5E17 F;  4S04 A;  1LE8 B;  1HW5 A;  3TBI A;  4MQV A;  4U87 A;  1YQA A;  3EUH C;  1BI2 A;  2V6E A;  4AYB N;  4JP0 A;  3U9G A;  5CQG A;  2JK3 A;  2K3F A;  2OA4 A;  1JXS A;  1PP8 F;  3TL4 X;  3ABK H;  1AKH B;  3TO9 A;  1JHF A;  1XTA A;  2B0L A;  4BUP A;  3U2R A;  2YU3 A;  5KVR A;  3NAU A;  1G2H A;  3TW7 A;  1LJ9 A;  1TW2 A;  3CUO A;  2JQ7 A;  2DMP A;  5HNH A;  2F5F A;  3F8B A;  4RS8 A;  2P4W A;  1WZ2 A;  1QU3 A;  2DFI A;  3S3O A;  1D1C A;  2JPB A;  2JTV A;  2K9Q A;  2EBI A;  4IHX A;  4L9N A;  4W97 A;  2NS7 A;  1TW3 A;  3CUQ B;  4IRG A;  3C1D A;  2A6T A;  1LFU P;  2WB1 A;  4JX5 A;  5LGU A;  3GCM A;  2E2I J;  1TP4 A;  2V9V A;  5IT3 A;  3HRS A;  2X1D A;  2O03 A;  4I02 A;  2EFW A;  2D5V A;  3DLA A;  4CGZ A;  4I2O A;  2E5N A;  4IX7 A;  3ZRG A;  2NAZ A;  1ZHF A;  3GWZ A;  3PIO F;  3AAF A;  3M1C A;  3R61 A;  1VQ7 I;  5E3O A;  2CMP A;  3PO2 J;  1XSX A;  3F8M A;  2CQQ A;  3C2B A;  3SEQ A;  2Q0O A;  2XSD C;  3WTZ A;  1MJ9 A;  2EIK H;  1LDK B;  3IV5 A;  3E6M A;  4HZF A;  4RLQ A;  1W4M A;  5IYD J;  1VQK I;  3FMS A;  4L9T A;  2FOK A;  2VKH A;  4KN7 X;  5E8I A;  1XPX A;  2V6C A;  3LA3 A;  5K7Z A;  3L2U A;  4EMS A;  1J09 A;  1BC7 C;  2KJC A;  4EM0 B;  1WI3 A;  2XB5 A;  2JJ7 A;  5HLT A;  2R7R A;  5J8C A;  1TT0 A;  4GRI A;  4B8X A;  5EG0 B;  2OCE A;  4A3K J;  2EPF A;  4I76 A;  3W6K B;  1IG7 A;  2FUG 2;  1MZB A;  5LRS A;  3LL7 A;  2KIU A;  2EV5 A;  2JA2 A;  2LDU A;  3WU0 A;  1O3S A;  1TTY A;  3I53 A;  2L2O A;  2A5W A;  5ILS A;  5B3S H;  4A6D A;  1QQI A;  1BA5 A;  1Z91 A;  1HA8 A;  1O4X A;  4RAY A;  4D9J A;  4OIQ F;  3EUH A;  2HZD A;  1W5S A;  2HGC A;  3M1E A;  2Q2E A;  3HOV J;  1O57 A;  1NHA A;  1N75 A;  4HOB A;  3GZ6 A;  4A3I J;  1KQ0 A;  4E7H A;  2XAU A;  4FIS A;  1DU6 A;  3BJA A;  4Z2Y A;  4BU2 A;  3F8F A;  2Q8K A;  1Y1W J;  4ANJ A;  5DD8 A;  1GVD A;  2EIM H;  5IP9 J;  2JSP A;  4PFP A;  4RA2 A;  3VDX A;  1DP3 A;  2CS3 A;  1UB9 A;  1D1A A;  4KT5 C;  4AIJ A;  1IW7 F;  1YE9 A;  4KIT B;  4CCO A;  3BR2 A;  4HLX A;  1T95 A;  2L7K A;  1HF0 A;  1LNW A;  1CGP A;  4HG2 A;  3F21 A;  3KP7 A;  2RAE A;  4BJ6 C;  3CCM I;  2L54 A;  3FIS A;  3PJR A;  4KUM A;  4MFE A;  1UMQ A;  2IS4 A;  3DBR B;  4IHW A;  3KZY A;  3GTP J;  1MSF C;  1F43 A;  2VC1 A;  1FBU A;  3ECO A;  4P5O A;  1UFM A;  2EK5 A;  2R5Z B;  1MMD A;  2J5P A;  2WAE A;  3TMO A;  1JHH A;  4PJN A;  1WVR A;  3E3V A;  2NYX A;  4DOZ A;  2WAF A;  1RIO H;  2DMU A;  4EM1 A;  4EV0 A;  1S7A A;  4XLN F;  1DGR M;  4XRF A;  2LY9 A;  2DTZ A;  3H1C A;  3ZR8 X;  4ZYE A;  1R5G A;  1SFK A;  2NVQ J;  2ZXH A;  4UB6 C;  4A0X A;  5IY5 H;  5GPC A;  3HL2 A;  3H92 A;  2ZNY A;  3AG1 H;  1NK3 P;  3H5N A;  1W7P A;  3OWT A;  2WB1 N;  3CCR I;  1ZRE A;  4B48 A;  2R7X A;  1ETK A;  1YW8 A;  4CSW A;  4WXD A;  4TV7 A;  2M87 A;  2ZJ2 A;  4XMY A;  4E6K G;  1MNE A;  4LIV A;  3HZJ A;  2QUF A;  4NHJ A;  2NNN A;  3BZC A;  3ABT A;  3IUO A;  3HSR A;  3ZXS A;  1O7F A;  2JRT A;  1O3T A;  1XN7 A;  4JYK A;  3LSI A;  2W57 A;  4BXF A;  1I39 A;  3IL2 A;  4M6V A;  3I59 A;  1EH8 A;  2AXL A;  3IP4 B;  2VE9 A;  3LSH A;  1FBQ A;  2BE5 F;  5GPA A;  3DU6 A;  4PGG A;  2CW7 A;  1F5T A;  5HS8 A;  1P4X A;  3JCU C;  3A4C A;  2MW8 A;  2JRM A;  3TDU C;  3S14 J;  2MC4 A;  2ZFU A;  4XKC A;  1MBH A;  4XLA A;  1VZ0 A;  2MLG A;  2CG4 A;  1E17 A;  1VF9 A;  2DK8 A;  3RKW A;  1O7L A;  1SD6 A;  2E60 A;  2PEX A;  5IOY A;  4GYI A;  2DCE A;  2ME6 A;  2OF7 A;  1QBJ A;  3P9C A;  1SFE A;  4B44 A;  2STT A;  5HLG A;  2QWW A;  1OYY A;  4HF0 A;  1MH3 A;  1TWF J;  2W4S A;  3JRA A;  4BKX A;  4P9U A;  1YX5 A;  1RUO A;  2A6E F;  4LLL A;  2OV7 A;  2A3S A;  1KON A;  2E35 A;  5D5V B;  1K6O A;  4OU0 A;  4ZDL A;  2F5E A;  4PDK A;  3V8J A;  4RB0 A;  4B1R A;  3KPH A;  3OY9 A;  3MZH A;  1WH5 A;  2MSY A;  3Q3S A;  3ZQI A;  3LA2 A;  5FLV A;  3ABU A;  1IXR C;  5ILU A;  1FOX A;  3KE2 A;  3H3Z A;  2Z5U A;  5F0C A;  4KT6 A;  4LIU A;  2X9D A;  1SAX A;  5F64 A;  3JRB A;  1EA3 A;  5BNG A;  1AU7 A;  2NOJ B;  3K4J A;  2ISZ A;  4UV9 A;  1KA8 A;  2E7X A;  4HPQ A;  2YX7 A;  4CCK A;  2XGX A;  3A0B C;  4OOI A;  1I5Z A;  1X2N A;  2HOE A;  2TDX A;  3BJ6 A;  4S0H B;  3GTJ J;  3S3M A;  3T1B A;  2YSR A;  2ZSH B;  5E20 A;  1AOY A;  4U7D A;  2PLY A;  3H0D A;  3OS2 A;  1VFC A;  1EF4 A;  2HYJ A;  1Y1V J;  2LBF A;  1FPQ A;  4QSH A;  3FZV A;  2UUZ A;  3KEQ A;  1HDP A;  1OLT A;  3HOU J;  3OYI A;  2JN6 A;  4L18 B;  3TP3 A;  5D4S A;  2DA7 A;  1WFX A;  4J00 A;  3GEZ A;  2HPI A;  1BR1 A;  1LVK A;  2XHK A;  2NXN B;  1UZC A;  2L7M P;  1IRZ A;  1YS6 A;  3M9A A;  4DW6 A;  2XUB A;  2DA5 A;  4G7Z F;  2O6G E;  2YX4 A;  2JA8 J;  1YHQ I;  3KFW X;  1S7E A;  2H1L A;  2RN7 A;  4B43 A;  2D1V A;  1R5H A;  4FX4 A;  3CJQ B;  2LFB A;  1OCR H;  2W84 A;  2P7V B;  3GVA A;  1XB4 A;  3W6V A;  1W0U A;  2PJR B;  2EZI A;  1FBS A;  1P4A A;  2HTS A;  4UXN A;  4XBF A;  5IOZ A;  2VI6 A;  2WWY A;  3BQY A;  1QA6 A;  4XIC A;  1HSJ A;  1UG2 A;  3MVP A;  2K40 A;  2K85 A;  2CV0 A;  2WAQ A;  3K2A A;  3JRE A;  2WBM A;  3ML6 A;  2KFD A;  3B02 A;  1BOA A;  3LSG A;  1ZLK A;  3I54 A;  2XRL A;  3ASO H;  3DLL F;  3J7Y J;  2IPQ X;  2Z16 A;  2D45 A;  4DGW B;  1FTZ A;  4OAY A;  5HDN A;  3MQ0 A;  4N9I A;  4ETS A;  4BQN A;  2L4A A;  4RB2 C;  1H89 C;  2OCC H;  1ODD A;  2EH3 A;  3QPH A;  1F4K A;  1REP C;  5D5U B;  2KRH A;  3WGH A;  2G9W A;  3HJE A;  2DDB A;  3OYB A;  5AIQ A;  2A6H F;  2WTE A;  3CQZ J;  5GAG J;  4A3M J;  3WHB A;  5E3N A;  1GVJ A;  2QQB A;  1HST A;  2TRT A;  2LKX A;  4ZYD A;  2FJ1 A;  1MDM B;  1U9N A;  1FOW A;  3LOC A;  1AHD P;  2YR2 A;  4YII A;  5GP9 A;  3E5X A;  4I7H A;  1KQ8 A;  4BHC A;  3NWT A;  4A3L J;  2EB7 A;  4A5N A;  5IT9 K;  4FTH A;  3K7A J;  2XGC A;  4HW0 A;  2JZY A;  5DUK A;  5JVG F;  2E2H J;  2F4I A;  1FP2 A;  4I01 A;  4DZP A;  1W36 C;  2MH2 A;  3KP4 A;  3RJP A;  2VAS A;  4IKF A;  1B4A A;  3GO5 A;  3S93 A;  2KDO A;  3MKW B;  2R7O A;  2XPU A;  2M7A A;  2ETH A;  3OYD A;  2CFX A;  2CQN A;  3QP6 A;  4LK1 F;  4IHY A;  3KET A;  4B4C A;  1MH4 A;  3PNT A;  4XSZ F;  3V7R A;  1G59 A;  2VJ5 A;  1ZGJ A;  3VYU B;  1H0M A;  2KRF A;  2FEZ A;  1U8B A;  2QKL B;  2HDW A;  3A01 B;  2RDP A;  1FX7 A;  2DA6 A;  1R23 A;  2CFO A;  4M6X A;  2F4O B;  1BL0 A;  1FNN A;  3PL8 A;  2HOT A;  2VKD A;  2WC2 A;  4AU7 A;  3CJR B;  2I10 A;  1XGS A;  3GTL J;  2R7F A;  2DFE A;  3K9T A;  4IOA F;  3E5U A;  2ICW G;  3SFZ A;  2VOD A;  3HOZ J;  3GTO J;  3R0A A;  4RAG A;  1RZ4 A;  3O2P E;  3N97 A;  4G7H F;  5JFR A;  3NRV A;  4A3D J;  2EZH A;  2P5V A;  1R4N B;  2W82 A;  3QYF A;  1P4W A;  2ZFW A;  4YFK F;  1WSU A;  1BM9 A;  4E7J A;  4UUS A;  4YIF A;  2IA0 A;  3CO7 C;  3H5R A;  2IP2 A;  5KNL A;  3S1N J;  2EQR A;  3HOY J;  2COM A;  1A36 A;  4C3H J;  1OCP A;  3JRF A;  1X1D A;  5JR3 A;  2ZCW A;  3V8L A;  2MD5 A;  3SDG A;  2V26 A;  3CC7 I;  3GZN B;  4G8X A;  3FXL A;  4G6Q A;  4E7L A;  3BT9 A;  1IN5 A;  3ZQ7 A;  4RGR A;  1FY7 A;  3AG4 H;  3O8H A;  3GYH X;  2IBD A;  2L02 A;  2NVT J;  4LG3 A;  2WAQ N;  3RDI A;  3GFM A;  1PJR A;  4A0Z A;  2KZG A;  3HKZ A;  1TQI A;  3BWG A;  3FMR A;  3JRD A;  3N4M A;  3RPU D;  1JGS A;  1H9T A;  1MDM A;  4E7K A;  2CW8 A;  5L3C A;  4MTD A;  3VEP A;  4AID A;  1IN6 A;  1DQU A;  1ETY A;  1BI1 A;  2V4J C;  2GAU A;  1T39 A;  2DT5 A;  4DBQ A;  4HRI A;  2M5W A;  1IRX A;  3ZQG A;  1T08 B;  3AL0 C;  1OYW A;  3DPL C;  1MMA A;  2HPM A;  5EGO B;  1QRY A;  3T0Y A;  4F93 B;  3L1P A;  4UB8 C;  3F72 A;  1KU7 A;  2MD0 A;  3I9V 2;  2Y48 A;  5JI6 A;  4ZDO A;  1L3L A;  4YFN F;  4A3B J;  5IP7 J;  2BXY A;  2JUG A;  2FQ4 A;  2MG4 A;  5EEG A;  1LVA A;  4L0Z B;  3CP8 A;  1D5V A;  1XSD A;  2BY1 A;  3CJN A;  3F8C A;  3CCS I;  2RC4 A;  1LB2 A;  3A01 A;  2M0M A;  3I4P A;  1XS9 A;  1QZY A;  1K78 A;  3UNG C;  5HOD A;  2CUF A;  3QQA A;  4QTR A;  2Y9Y A;  5DM7 F;  1KU9 A;  3SXY A;  5J1U A;  1XSV A;  2A69 F;  2R92 J;  5BPI A;  2A68 F;  3OYK A;  5J4V A;  4XN0 A;  3Q0W A;  5AIP A;  2DOE A;  2M45 A;  4JQF A;  2CU7 A;  2DA2 A;  2E1O A;  4N9H A;  4UHT A;  3OIO A;  4CXF A;  4OWR B;  4I0A A;  4D7M A;  1V5G A;  4RLF A;  4BYY A;  3E1S A;  1CF7 A;  3CLQ A;  4NQW B;  2XKO A;  3S32 A;  3LA7 A;  1V4R A;  2HWV A;  4A3C J;  2OAZ A;  4YEJ A;  4OIP F;  1YRN B;  1MBG A;  1BJA A;  2W24 A;  2FMY A;  1QO0 D;  4O3M A;  3DWL E;  3QP5 A;  2XPV A;  4MLO A;  2M0C A;  1SVL A;  2H6C A;  2DA4 A;  1WPK A;  3FMQ A;  4ITV A;  1WJ5 A;  3IH4 A;  2XDV A;  1LKX A;  3HIF A;  5K5O A;  2AQE A;  2H1K A;  2GOX B;  3RZO J;  1PVE A;  1T0F C;  3SZP A;  3C7J A;  2VJJ A;  2WY8 Q;  4DIQ A;  1MND A;  1Z7U A;  1KU2 A;  1VQO I;  1F36 A;  1FYL A;  2LF8 A;  2VBX A;  1VI0 A;  2VB6 A;  5D8L B;  4A3F J;  2J5O A;  3M8E A;  3M8F A;  3L2C A;  1TWG J;  3BR0 A;  5H20 A;  2OTJ I;  2UZK A;  1GLN A;  4HV6 A;  2K02 A;  3L2Q A;  2D1H A;  1BIB A;  3HYI A;  4XOT A;  1RKW A;  1F9N A;  3I71 A;  5EZH A;  2K86 A;  2N8G A;  2IEK A;  2QSH X;  2LC2 A;  3BDD A;  2OD5 A;  4FCY A;  2BY2 A;  4ABZ A;  3MN2 A;  2K9N A;  4ZYG A;  2E7W A;  2JVH A;  4M3G A;  3VSK A;  2ZJP F;  3S1R J;  4CO8 A;  2Y9Z A;  2LR8 A;  1N78 A;  3PUB A;  4BE1 A;  3UR3 C;  4UV8 A;  1U78 A;  1D8J A;  1ETX A;  3AFH A;  3H36 A;  2F2E A;  4BAC A;  2Z1D A;  3CDL A;  2CV1 A;  3BTL A;  2DXI A;  1H9G A;  3GW2 A;  1HKQ A;  1PYV A;  4XK4 A;  2BHZ A;  1LDD A;  3FXQ A;  1K83 J;  2E36 A;  3E6D A;  2CH0 A;  3ZMD A;  4BHP A;  4XM3 A;  5K5R A;  1VQP I;  4FE7 A;  3TED A;  3GLX A;  5K5Q A;  4IRI A;  2ID3 A;  1IZ1 A;  1X1B A;  3P9I A;  3EDP A;  4YEL A;  4F3Q A;  2QZ8 A;  1LFB A;  4ESF A;  5L3B A;  2FBK A;  3BG5 A;  4XR6 A;  3IHU A;  2H09 A;  5FD6 A;  2ADU A;  2VLA A;  4BJ5 C;  3QRF F;  3CP2 A;  3V42 A;  4BY1 J;  3JRG A;  1BBY A;  2QBY A;  3LST A;  4MNU A;  5CJ9 A;  5F0H A;  4NQW A;  4HV5 A;  2GXB A;  3K4B A;  2ZNZ A;  2LF7 A;  3HRU A;  1R71 A;  3FXM A;  1IDY A;  1Y56 A;  4CUG A;  2LNB A;  1O3Q A;  1MNM C;  1IN8 A;  1KYZ A;  4ZYA A;  1SVM A;  2LTP A;  4BBS J;  3KYD B;  2R7Z J;  1MMS A;  3BLY A;  4F7Z A;  4OMY A;  4LJZ F;  5CYV A;  2HTJ A;  4QLC U;  1Z67 A;  3CUQ C;  1YLF A;  1YIJ I;  5ERI A;  3KYL A;  4X6A J;  2L7F P;  4M74 A;  5EEH A;  1OJL A;  5BPD A;  3HOT A;  3WTT C;  2ZME B;  2K5C A;  2IS1 A;  2ZME C;  2VON A;  3I55 I;  3RIR A;  3WTW C;  1T0F A;  3FHZ A;  2DJI A;  5ICF A;  2H27 A;  3BG3 A;  5HS7 A;  5ILV A;  4I99 C;  1K7A A;  2EZL A;  4PSW A;  1XMA A;  4M9Z A;  4LLG F;  4BL0 B;  3OYC A;  5JHU A;  3ZP5 A;  4L0Y B;  2ZKZ A;  1U5T B;  2FU4 A;  1EJ9 A;  1U5T C;  3AG3 H;  2ZXW H;  4IL6 C;  2EFO A;  3T8T A;  4M3B A;  3SJM A;  1RPW A;  2M30 A;  3HG9 A;  5TGT A;  3K10 A;  4C30 A;  5EDN A;  4CCL A;  2IRF G;  1A6I A;  4BAY A;  5FLX K;  5FFX A;  2RRE A;  5J4Y A;  3BZK A;  3ZMU A;  3I5U A;  4AIK A;  1JT0 A;  2EIN H;  1XMK A;  4N4O B;  5DS9 A;  4N4N B;  1FOY A;  2FQ3 A;  4DYC A;  1AWC A;  2HVR A;  4RDU A;  4XLF A;  2F5C A;  3R0J A;  1G8X A;  3ZMS A;  1IUF A;  1W36 D;  3D5L A;  2R3S A;  4O6J A;  1IN4 A;  5LLQ A;  2GWR A;  5CVI A;  5EF6 A;  4AVP A;  2A05 A;  3PIP F;  2UXX A;  1ETW A;  3CLO A;  2AQF A;  2KIM A;  1XGO A;  2OUM A;  1Z3Y A;  1WI9 A;  3Q0V A;  2KL4 A;  3K1N A;  1B72 A;  1U0J A;  2RGV A;  1A6Q A;  4XOP A;  1LE8 A;  4M71 A;  1I6X A;  3CCJ I;  1JE8 A;  3DKW A;  3FK7 A;  3JRH A;  4V19 K;  2DOD A;  5LHG A;  4YRV A;  4KN4 X;  1BI3 A;  3V8K A;  1A31 A;  1MJB A;  2FOW A;  1ZGW A;  1Q1V A;  3TP0 A;  4KMU X;  1SD5 A;  4KJZ A;  2HOS A;  3E5Q A;  1IRG A;  1AKH A;  2O8X A;  4RGS A;  4R79 A;  3I58 A;  2ELK A;  2NNY A;  1PUF B;  2I8D A;  1X4O A;  1L0O C;  3O8G A;  1D0X A;  2XRO A;  5H6R A;  3I64 A;  3K69 A;  3CO6 C;  3IAM 2;  2EV0 A;  3G73 A;  4HX7 A;  1S7O A;  5IP6 A;  4EQQ A;  5J47 A;  1ZRC A;  3DXJ F;  5DTD A;  4E4H A;  5LGN A;  4UVA A;  5JLW A;  2M8G X;  2DFH A;  4E7I A;  3CUQ A;  4U0V A;  2W85 A;  4MGR A;  1FTT A;  4EGZ A;  2Y30 A;  4J19 A;  3IKV A;  1G4D A;  2BBY A;  5E1W A;  2W00 A;  2X48 A;  3BQZ A;  2CQK A;  2HFH A;  1XCB A;  5GTH C;  2DPD A;  4HQM A;  2BZT A;  2EFQ A;  2R7D A;  1DPU A;  1ETO A;  4NDL A;  1K6Y A;  2LH9 A;  3OOP A;  1K4S A;  3DBL B;  5LHH A;  2FBH A;  1U5T A;  2V1X A;  1DPR A;  4XKW A;  1E2X A;  3OS0 A;  1S5L C;  3K4C A;  5E8G A;  2VOO A;  4MQ9 F;  2DO7 A;  4RGU A;  3FK6 A;  3FKJ A;  4V2G A;  4JBA A;  5FGM A;  1DP7 P;  3VYT B;  5GAH J;  1Y8Q B;  5KAI C;  1APL C;  2AXT C;  4BHB A;  1T56 A;  2X85 A;  2DBB A;  4HA8 A;  2DYS H;  2X6Y A;  2EV6 A;  2X0L A;  5L3D A;  4BEH B;  2CGP A;  2XB0 X;  1KGS A;  3MWM A;  3A2K A;  4XRS G;  3HHH A;  3IWZ A;  2XPW A;  4F52 A;  1D0Z A;  5FKL A;  5EG0 A;  1DU0 A;  1WJA A;  1UG0 A;  2RVC A;  5A2Q Z;  5ED4 A;  1E3O C;  1ZLJ A;  1XC5 A;  4NNJ A;  1A04 A;  4RGX A;  1R1T A;  2OQR A;  3G71 I;  2KMU A;  3WU1 B;  1RUN A;  4S05 A;  1SFX A;  3QYE A;  5CKT A;  3VFZ A;  3OMY A;  3BTJ A;  4G9Y A;  4A3G J;  4O5V A;  3KCC A;  3BOQ A;  1IAW A;  5LBQ A;  2F4M B;  2LK2 A;  3ECH A;  1LFP A;  1XDU A;  1IUY A;  3JSO A;  1ENH A;  5FLM J;  4B09 A;  4BQO A;  3NEU A;  1S72 I;  3MEX A;  1MW7 A;  3NWS A;  3OYN A;  2VPL A;  1WJD A;  1ZG5 A;  2Z33 A;  3PFY A;  3RPU A;  1PUF A;  4WWC A;  2ISY A;  5FD5 A;  3BG9 A;  4NC6 A;  5HDK A;  1SMT A;  2CW0 F;  1FIA A;  3OS1 A;  1ZQ3 P;  3JSP A;  1QPI A;  2QSG X;  3I56 I;  1IV8 A;  5F6F A;  1KYW A;  2IVM A;  1S6L A;  5F04 A;  4DYQ A;  5HLH A;  3UKG A;  2KP6 A;  3HEF A;  3L00 A;  1BR4 A;  4HNU A;  4YG2 F;  1QHG A;  1PP7 U;  2BW3 B;  3DF8 A;  2MFZ A;  2COB A;  2VXZ A;  5E18 F;  3FKI J;  3HXL A;  2R5Z A;  3VYS B;  3GF2 A;  3HOX J;  1MKM A;  2ECB A;  1U9O A;  3PM1 A;  4XLP F;  3CMY A;  2W25 A;  3D1N I;  3J80 Z;  2ELJ A;  2HKO A;  2L3D A;  4XKV A;  1FP1 D;  3MAJ A;  3JAM Z;  4KMF A;  2L7Z A;  1KQ9 A;  1A5J A;  2PMH A;  4WCG A;  3F6V A;  3HRT A;  2M4G A;  2WV0 A;  1WKM A;  4CYD A;  1Z6T A;  2RQP A;  2VN2 A;  2R5Y B;  1QVT A;  2I5U A;  3BY6 A;  2PBI A;  2LLK A;  1IRF A;  3TGN A;  1CQT A;  1I6H J;  4M3F A;  2CYY A;  5DCM B;  5FFZ A;  2OC6 A;  2PQ8 A;  1G3W A;  4F92 B;  3IRQ A;  3EET A;  3JW4 A;  3I4M J;  2W1O A;  2VKE A;  3I4N J;  1ZKG A;  1VQN I;  5HNF A;  3LSR A;  3LQQ A;  2QM3 A;  4ZZD A;  2KLO A;  3TW6 A;  4ON0 A;  4BBR J;  2DQR A;  1RR8 C;  1DDN A;  2IS2 A;  3F9K A;  2QA4 I;  3ZQQ A;  2BY0 A;  1ZRF A;  1P2F A;  1RET A;  1X1P A;  1V55 H;  1XX5 A;  2PMU A;  4M9X A;  2DN0 A;  2QKM B;  4PJJ A;  1LDJ A;  4NBQ A;  2ZBK A;  2VBZ A;  3G1M A;  4CIC A;  2K27 A;  1Z6R A;  3E6B A;  2VOP A;  4V2F A;  3ASN H;  3J81 Z;  2CV2 A;  1TC3 C;  3ZQF A;  5FKM A;  1S8N A;  3MZ8 A;  1MBJ A;  3SZG A;  4RB1 A;  1WH7 A;  1WRJ A;  3BR5 A;  2RQQ A;  4D7N A;  3ULQ B;  2LMD A;  3EPZ A;  2DMT A;  1VQL I;  2Z99 A;  4H4K C;  2QQA A;  3BJO A;  3U21 A;  3CJT B;  2V9K A;  3FHN A;  1B59 A;  4EJW A;  3DV8 A;  2DU9 A;  3BPV A;  1ON1 A;  3C18 A;  5CVV A;  2JA7 J;  3PUF A;  1P7J A;  5CPR B;  3WTV C;  3WGG A;  4MO7 A;  3DPT A;  1OPC A;  4AWX B;  1FSE A;  5LEK A;  3PO3 J;  1OMI A;  1EKE A;  3CDH A;  1B1B A;  1JTY A;  5J3L A;  5LHI A;  3S3N A;  2UXN A;  3F22 A;  2LP0 A;  4XKB A;  1LUJ B;  2R7U A;  5E3L A;  3VYR B;  1Z21 A;  3JRC A;  2QEX I;  2HS5 A;  4L5I A;  3DKY A;  4XLC A;  1IV6 A;  1Z77 A;  4L5E A;  3ERE D;  3ZQL A;  1IJW C;  4IVN A;  2GOM A;  2IGO A;  2GZW A;  1TWA J;  4DQ2 A;  4L5J A;  2G7H A;  3LWF A;  3OR2 C;  3FBN B;  1Q1H A;  2P6T A;  2DAO A;  3CD6 I;  3SZT A;  4IQ4 A;  4PCQ A;  4RM3 A;  4OAZ A;  2ECC A;  3K4L A;  1G6N A;  4KA4 A;  3OYL A;  4A69 C;  2LRE A;  2E1C A;  3OYM A;  2ELH A;  2VJI A;  3KLN A;  3GFI A;  3BZ6 A;  2QQ9 A;  2HQA A;  2ZXJ A;  4BJT A;  1YTY A;  1S3J A;  2IA1 A;  4AUX A;  5KK1 A;  1FC3 A;  1B8I B;  1X3Z B;  1ZGA A;  2E1N A;  3D5R C;  3GFJ A;  3R4K A;  1IN7 A;  1ETQ A;  3BC8 A;  4L9J A;  4IPA A;  3E97 A;  4ZTF A;  3GTQ J;  1STZ A;  4LMY A;  4C3J J;  2AS5 F;  3P7N A;  4MFD A;  2HVS A;  2XF7 A;  3N05 A;  2O9L A;  4Q47 A;  1R9T J;  4NC7 A;  2PJR A;  4OIN F;  1T33 A;  2GM4 A;  4KYW A;  3S2H J;  3HUG B;  1PUE E;  1SD7 A;  1Z0X A;  2EFP A;  1ZR2 A;  1P9Q C;  4BQA A;  5F1R A;  3D5S C;  1YW7 A;  6PAX A;  1RC9 A;  2XRN A;  4DZJ A;  4C2U A;  5CLS A;  2IA2 A;  2OJE D;  2KRC A;  3H5A A;  3HBL A;  4YIR X;  3B6C A;  2HYF A;  4E70 A;  4HF2 A;  3BG7 A;  1FT9 A;  2K4B A;  4PJM A;  1U8R A;  3MKZ A;  2BXZ A;  4G7O F;  1UAA A;  1MMN A;  3PNY A;  4HDV A;  2OTL I;  3KYC B;  1GXP A;  3OYA A;  2A5Y B;  3DEE A;  5TIS C;  1Z05 A;  2PI0 A;  4A93 J;  2KIS A;  4XNF A;  3J7A O;  3ZGK A;  2GXG A;  3AG2 H;  2ACJ A;  4F55 A;  3S8P A;  5B5E C;  4EJO A;  5AON A;  2VQH A;  4EJV A;  2K4J A;  3DCF A;  1ACI A;  1HKS A;  4HBL A;  2BEO A;  3WOD F;  4UY8 I;  2PMZ N;  3DBH B;  3IC7 A;  2BHY A;  5J1R A;  1LEA A;  1ETV A;  2X6O A;  2ZO4 A;  3TKY A;  1UHM A;  5JVT A;  2LSO A;  1UST A;  2KJB A;  4IEJ A;  1TQM A;  2BYV E;  4CCJ A;  2DQL A;  1XG1 A;  4A5M A;  2BV6 A;  5HVQ C;  5HOO A;  4KFC A;  2A61 A;  3BCB A;  2DT7 B;  1MBE A;  4BE0 A;  4A2U A;  4K2E A;  5EZG A;  5H2F C;  3F8N A;  4MTE A;  1JUS A;  4UVC A;  3U1K A;  4LG0 B;  4Y4R A;  3PQK A;  1T6S A;  2EFN A;  4KNY A;  4NB5 A;  1P7I A;  1BJZ A;  1XDS A;  4I09 A;  3WE2 A;  5C44 J;  3HSE A;  4Y33 A;  3ZMV A;  4BGD A;  5KHD A;  3HOS A;  4YFX F;  1X1C A;  1Z3X A;  3G1O A;  3BP8 A;  4LB6 B;  1D0Y A;  2QEN A;  2Y0S N;  2M4K A;  3L09 A;  4HEA 2;  1WHU A;  1B8I A;  3AKZ A;  1O3R A;  3QPT A;  2XAQ A;  3K6G A;  2P0W A;  4XSX F;  1FZP B;  3L2W A;  3KX2 A;  2JWT A;  5GAD J;  3ELK A;  2EZK A;  3K2Z A;  1YW9 A;  3LMM A;  1JJ8 C;  5KAF C;  1GUU A;  1KZH A;  1TNS A;  1JI8 A;  2O5R A;  1X1A A;  2MAB A;  3CC2 I;  4KIF A;  1WGX A;  4D1Q A;  1JKP C;  3KZZ A;  2EJR A;  1FJL A;  2PFB A;  3COA C;  1SAN A;  4WXC A;  2XKP A;  2VE8 A;  2XSJ C;  3LSJ A;  3OR1 C;  1JJ6 C;  2R7Q A;  3RCO A;  4A3J J;  2R93 J;  1X19 A;  3M7G A;  4FT8 A;  2LG4 A;  4B3X A;  3PSI A;  2X6X A;  1P92 A;  5D4R A;  3DEW A;  4PJL A;  3B73 A;  1JT6 A;  3LQR A; 
#chains in the Genus database with same CATH homology
 3P9K A;  1ZG1 A;  2MH9 A;  1FWZ A;  4UNO A;  5BS6 A;  1G3S A;  1HXD A;  2VT2 A;  2HQN A;  4LLN A;  2IW5 A;  1ZG3 A;  4I98 B;  2OU2 A;  3TDZ C;  2DK5 A;  1TLH B;  2XAG A;  2XAH A;  3WTS C;  3FF5 A;  3CTA A;  4U88 A;  4CDG A;  2HR3 A;  3BPX A;  3JTH A;  3HHG A;  1J9I A;  3ZMZ A;  2CSO A;  4WF2 A;  4P96 A;  5D5X B;  2K7L A;  4EJU A;  1I1S A;  2OZU A;  3WG9 A;  1X3U A;  4G6D A;  3W6J B;  2EWN A;  2HQR A;  2YPR A;  4HX4 A;  2KIF A;  1YO5 C;  2Y0M A;  1VTN C;  4KIG A;  1G3T A;  3E6C C;  3DQV C;  2ESH A;  2O0Y A;  2V79 A;  3RTR A;  2RV8 A;  3R6S A;  5FB2 A;  5D6E A;  2VBY A;  4IXA A;  4Y15 A;  3OV8 A;  2G7U A;  1SD4 A;  4R8H A;  2Z3Y A;  4MHG A;  3LFK A;  3ZPL A;  3MZY A;  2FNP A;  2H6B A;  5E1X A;  3T8R A;  2NRA C;  2P5L C;  1B9N A;  4AD9 A;  4DNC A;  4Q4Z F;  2MC3 A;  2DW4 A;  1HQC A;  1MGT A;  2STW A;  4M72 A;  5DCF A;  1K79 A;  5HS9 A;  4OIR F;  1SMY F;  2L01 A;  3WTY C;  5IT9 Z;  1I1G A;  5K1Y A;  1YS7 A;  3LAP A;  3JTG A;  3F23 A;  1ONV A;  3QAH A;  5LEJ A;  3EQL F;  1J0R A;  1TBX A;  4PGH A;  3Q9S A;  3FM5 A;  1OR7 A;  3RYP A;  1W7P B;  3ROU A;  3GZ5 A;  1J2X A;  5CVU A;  3RPQ A;  2MBF A;  1MD0 A;  1FYM A;  1IXS B;  3G3Z A;  3PFI A;  2FE3 A;  3I59 B;  4KIB A;  2NS0 A;  1U2W A;  5CVJ A;  1W5T A;  5BMZ A;  2FML A;  2VC0 A;  2KKO A;  2VT3 A;  4PZJ A;  4CZZ A;  3D0S A;  2XAS A;  1OYI A;  5D6F A;  2C6Y A;  3RI4 A;  1IF1 A;  3TO6 A;  1V3F A;  2QYO A;  2LKP A;  1KU3 A;  4HAM A;  5HDG A;  4HQE A;  2Z9O A;  4HX8 A;  5ICE A;  2ZME A;  3Q9V A;  1ZYR F;  4HYE A;  1BC8 C;  2DI3 A;  5H6Q A;  4WK8 F;  1HKT A;  4U0Y A;  2IJL A;  3T5X A;  5L3G A;  1R36 A;  1ZH5 A;  2RNJ A;  2FSW A;  3R60 A;  2XAF A;  4FHT A;  1QGP A;  4LB5 A;  2BGC A;  1FLI A;  5BQT A;  4WXH A;  2OBP A;  4LGW A;  4Y17 A;  2HZT A;  4R1H A;  1Z1D A;  1BN5 A;  4D0P A;  3Q5F A;  3QU6 A;  5DYM A;  4ZH4 F;  3KP2 A;  4IHS A;  2M1B A;  3LAJ A;  2DTR A;  2MA3 A;  3KP5 A;  5L3F A;  4AIH A;  3TO7 A;  2PJP A;  2IT0 A;  3S2W A;  3WE3 A;  3VOE A;  2D2W A;  1EV7 A;  3SHF A;  3MCZ A;  2Y75 A;  4UVB A;  3KP3 A;  1BIA A;  1YYV A;  4UUV A;  4IHT A;  2HEO A;  4LFU A;  4I0B A;  3RYR A;  3F6O A;  1ULY A;  1BI0 A;  3ZN0 A;  4HLY A;  3GFL A;  3FX3 A;  4IRH A;  1R7J A;  3VOD A;  4ZZL A;  3GUD A;  5DEQ A;  1TNT A;  4GO1 A;  4G94 A;  4ESB A;  1QZZ A;  1XD7 A;  1D3Y A;  2EA2 A;  1QNT A;  3F3X A;  3FM3 A;  3PQJ A;  4EM2 A;  4M6Y A;  3FXR A;  3HSF A;  2XVC A;  1J7K A;  2CO5 A;  4RAZ A;  3ISP A;  3QU3 A;  1EH7 A;  2QVO A;  5CVR A;  3FXU A;  4ZYH A;  5D8K B;  3WGI A;  3VB2 A;  1LQ1 A;  2OQG A;  5DV5 A;  3K1P A;  1R58 A;  4RB3 C;  3GXO A;  1FSH A;  3O6B B;  2O3F A;  3MFK A;  5ICG A;  1I27 A;  1F1Z A;  4QWQ A;  4OIO F;  1ZN2 A;  4A0Y A;  4ENN A;  1DUX C;  4Q48 A;  1PDN C;  5TRD A;  3RKX A;  1QPM A;  2ESN A;  2FA5 A;  1G3Y A;  1R22 A;  4A6E A;  1R1V A;  2JT1 A;  2PN6 A;  2HKX A;  4GYG A;  3KEO A;  3H3U A;  2RKH A;  2OZ6 A;  1T2K A;  2UWM A;  4U0W A;  5DDG A;  1XCV A;  3TQN A;  5FLX Z;  3I0T A;  5DCM A;  3TOA A;  3NQO A;  4CHU A;  1FOK A;  4N0B A;  5FO5 A;  1B9M A;  3L9F A;  4LK0 F;  1LEB A;  4P55 A;  1J59 A;  2H94 A;  2GIV A;  3C3W A;  3K1M A;  1ON2 A;  1RNL A;  3WTX C;  1K78 B;  1B6A A;  2P8T A;  2P6S A;  2V1D A;  5ICC A;  1OKR A;  1YG2 A;  1W7P D;  2L4M A;  1EH6 A;  4GGG A;  1CF7 B;  2PG4 A;  3WTU C;  2GQQ A;  2FNA A;  2XAJ A;  1J75 A;  2HYG D;  4M9S A;  1Z9C A;  2DPU A;  1P6R A;  3SQN A;  1XGM A;  2P7C B;  2P5K A;  3KLO A;  1T38 A;  4HDU A;  5J6X A;  1Y0U A;  1IXC A;  3IRR A;  1C0W A;  5LRR A;  1ZAR A;  4M73 A;  4BH9 A;  1U3E M;  2X4H A;  2F5D A;  5D5W B;  4MEY F;  1D8K A;  3FWE A;  2EA4 A;  4MEX F;  4ENM A;  3GX4 X;  4IJA A;  4EVI A;  2CWE A;  4A12 A;  3TOB A;  4WX9 A;  2V1U A;  4U7B A;  4H0E A;  5DUI A;  5A2Q K;  4IF4 A;  2DLL A;  4EGY A;  4JK1 X;  1WQ2 A;  5DD4 A;  3HUG A;  4ENK A;  3U1D A;  4Q5S F;  3O3K A;  2VBW A;  1YIO A;  5L3E A;  1RI7 A;  3V7S A;  5BOX A;  4EJT A;  4OMZ A;  3HTU A;  3V7C A;  5J8F A;  3L7W A;  3EYI A;  4HF1 A;  1UCR A;  1J5Y A;  3ZN1 A;  2QBY B;  2O61 A;  1HW1 A;  4GXO A;  2FBI A;  3HTS B;  2FF4 A;  3ZMT A;  3DFG A;  3V4G A;  4BNC A;  2A07 F;  4LD5 A;  1R1U A;  3K0L A;  3REO A;  3KP6 A;  3RKY A;  2QLZ A;  2XV4 S;  1GXQ A;  1R00 A;  5LGT A;  5TJJ A;  4KDP A;  5E1Z B;  3QOP A;  3J80 K;  3DP7 A;  4Y13 A;  4LG0 A;  1FYK A;  3JAM K;  1S29 A;  1ZRD A;  1MJA A;  3IWF A;  2HDC A;  3IKT A;  4L9V A;  4BXU A;  1U6G A;  2XIG A;  1ZAO A;  2GA2 A;  2MLK A;  2M8E A;  2JPC A;  5HLI A;  2FXA A;  4ASN A;  1T98 A;  4ENJ A;  4P9F A;  1WWX A;  3DEU A;  2JSC A;  3EYY A;  1YFH A;  4FX0 A;  1XGN A;  1HW2 A;  1HBX G;  3HRM A;  3BRO A;  2GA1 A;  4KIC A;  2FRH A;  1GHC A;  1UHW A;  1TQP A;  1SFU A;  4ESJ A;  1USS A;  3J81 K;  4GCV A;  5E17 F;  4S04 A;  1HW5 A;  4MQV A;  1YQA A;  1BI2 A;  3U9G A;  2OA4 A;  1JXS A;  1PP8 F;  3TO9 A;  1JHF A;  2B0L A;  3U2R A;  2YU3 A;  5KVR A;  1LJ9 A;  1TW2 A;  3CUO A;  2F5F A;  3F8B A;  4RS8 A;  2P4W A;  2DFI A;  2JPB A;  2JTV A;  4L9N A;  1TW3 A;  3CUQ B;  4IRG A;  3C1D A;  5LGU A;  2V9V A;  5IT3 A;  3HRS A;  2O03 A;  4I02 A;  2EFW A;  4CGZ A;  4I2O A;  2NAZ A;  1ZHF A;  3GWZ A;  3AAF A;  3R61 A;  1XSX A;  3F8M A;  2Q0O A;  3WTZ A;  1MJ9 A;  1LDK B;  3E6M A;  4HZF A;  1W4M A;  3FMS A;  4L9T A;  2FOK A;  4KN7 X;  5E8I A;  2V6C A;  3LA3 A;  4EMS A;  1BC7 C;  2KJC A;  4EM0 B;  5J8C A;  4B8X A;  3W6K B;  1MZB A;  5LRS A;  2KIU A;  2EV5 A;  2LDU A;  3WU0 A;  1O3S A;  1TTY A;  3I53 A;  5ILS A;  4A6D A;  1QQI A;  1Z91 A;  4RAY A;  4OIQ F;  3EUH A;  1W5S A;  2HGC A;  3M1E A;  2Q2E A;  1O57 A;  1NHA A;  4HOB A;  3GZ6 A;  1KQ0 A;  3BJA A;  4Z2Y A;  3F8F A;  2Q8K A;  5DD8 A;  1UB9 A;  4KT5 C;  4AIJ A;  1IW7 F;  4HLX A;  1LNW A;  1CGP A;  3F21 A;  3KP7 A;  2L54 A;  4KUM A;  3KZY A;  2VC1 A;  1FBU A;  3ECO A;  4P5O A;  1UFM A;  2EK5 A;  2J5P A;  1JHH A;  3E3V A;  1RIO H;  2NYX A;  4EM1 A;  4EV0 A;  1S7A A;  4XLN F;  4XRF A;  4ZYE A;  1R5G A;  4A0X A;  3H92 A;  2ZNY A;  1W7P A;  1ZRE A;  1YW8 A;  4WXD A;  4TV7 A;  2M87 A;  2ZJ2 A;  2QUF A;  4NHJ A;  2NNN A;  3ABT A;  3HSR A;  1O7F A;  2JRT A;  1O3T A;  1XN7 A;  2W57 A;  3IL2 A;  3I59 A;  1EH8 A;  2AXL A;  2VE9 A;  1FBQ A;  2BE5 F;  4PGG A;  1F5T A;  5HS8 A;  1P4X A;  3TDU C;  2MLG A;  2CG4 A;  1E17 A;  2DK8 A;  3RKW A;  1O7L A;  1SD6 A;  2PEX A;  4GYI A;  1QBJ A;  3P9C A;  1SFE A;  2STT A;  5HLG A;  2QWW A;  1OYY A;  4HF0 A;  4P9U A;  1RUO A;  2A6E F;  4LLL A;  2A3S A;  5D5V B;  1K6O A;  4OU0 A;  2F5E A;  4PDK A;  3V8J A;  4RB0 A;  3MZH A;  3LA2 A;  3ABU A;  1IXR C;  5ILU A;  3KE2 A;  3H3Z A;  2Z5U A;  1SAX A;  5F64 A;  2ISZ A;  4UV9 A;  1KA8 A;  2E7X A;  2YX7 A;  2XGX A;  4OOI A;  1I5Z A;  2HOE A;  2TDX A;  3BJ6 A;  3T1B A;  2YSR A;  5E20 A;  1AOY A;  4U7D A;  2PLY A;  1FPQ A;  3FZV A;  3KEQ A;  4L18 B;  5D4S A;  3GEZ A;  2XHK A;  1YS6 A;  3M9A A;  4G7Z F;  2XUB A;  2O6G E;  2YX4 A;  3KFW X;  2RN7 A;  2D1V A;  1R5H A;  4FX4 A;  2W84 A;  2P7V B;  3GVA A;  1XB4 A;  4XBF A;  1FBS A;  1P4A A;  2HTS A;  4UXN A;  2WWY A;  1HSJ A;  3ML6 A;  3B02 A;  1BOA A;  1ZLK A;  3I54 A;  2IPQ X;  2D45 A;  5HDN A;  3MQ0 A;  4N9I A;  4ETS A;  2L4A A;  4RB2 C;  1ODD A;  3QPH A;  1F4K A;  1REP C;  5D5U B;  3WGH A;  2G9W A;  5AIQ A;  2A6H F;  2WTE A;  1GVJ A;  2QQB A;  1HST A;  4ZYD A;  1MDM B;  2YR2 A;  4YII A;  3E5X A;  4I7H A;  1KQ8 A;  4BHC A;  2EB7 A;  4A5N A;  5IT9 K;  4HW0 A;  2JZY A;  5DUK A;  1FP2 A;  4I01 A;  2MH2 A;  3KP4 A;  3RJP A;  1B4A A;  3GO5 A;  2ETH A;  2CFX A;  3QP6 A;  4LK1 F;  3KET A;  4XSZ F;  3V7R A;  1ZGJ A;  1H0M A;  2KRF A;  2FEZ A;  2RDP A;  1FX7 A;  1R23 A;  4M6X A;  1FNN A;  2WC2 A;  1XGS A;  2R7F A;  3K9T A;  3E5U A;  3SFZ A;  2VOD A;  3R0A A;  1RZ4 A;  3O2P E;  3N97 A;  4G7H F;  5JFR A;  3NRV A;  2P5V A;  1P4W A;  2ZFW A;  4YFK F;  1WSU A;  1BM9 A;  4YIF A;  2IA0 A;  3CO7 C;  2IP2 A;  2COM A;  5JR3 A;  2ZCW A;  3V8L A;  2MD5 A;  4G8X A;  4G6Q A;  1IN5 A;  3ZQ7 A;  4RGR A;  1FY7 A;  3GYH X;  2L02 A;  3RDI A;  3GFM A;  4A0Z A;  1TQI A;  3BWG A;  3FMR A;  3N4M A;  1JGS A;  1H9T A;  1MDM A;  5L3C A;  4MTD A;  3VEP A;  1IN6 A;  1BI1 A;  2GAU A;  1T39 A;  2DT5 A;  2M5W A;  1OYW A;  3DPL C;  3T0Y A;  3F72 A;  1KU7 A;  2Y48 A;  5JI6 A;  1L3L A;  4YFN F;  5EEG A;  1LVA A;  4L0Z B;  1D5V A;  1XSD A;  3CJN A;  3F8C A;  2RC4 A;  1LB2 A;  3I4P A;  1QZY A;  1K78 A;  1KU9 A;  3SXY A;  1XSV A;  2A69 F;  5BPI A;  2A68 F;  5AIP A;  2M45 A;  4JQF A;  4N9H A;  4UHT A;  4CXF A;  4I0A A;  4BYY A;  1CF7 A;  2XKO A;  3LA7 A;  1V4R A;  2HWV A;  2OAZ A;  4OIP F;  1BJA A;  2W24 A;  2FMY A;  1QO0 D;  4O3M A;  3QP5 A;  2H6C A;  3FMQ A;  3HIF A;  5K5O A;  3SZP A;  3C7J A;  1Z7U A;  1KU2 A;  1FYL A;  2LF8 A;  2VBX A;  5D8L B;  2J5O A;  3M8E A;  3M8F A;  3L2C A;  5H20 A;  2UZK A;  4HV6 A;  2K02 A;  2D1H A;  1BIB A;  3HYI A;  1F9N A;  3I71 A;  2K86 A;  3BDD A;  2OD5 A;  4ZYG A;  2E7W A;  4CO8 A;  4UV8 A;  1U78 A;  1D8J A;  2F2E A;  1H9G A;  3GW2 A;  1HKQ A;  1LDD A;  3FXQ A;  3E6D A;  3ZMD A;  4BHP A;  5K5R A;  3GLX A;  5K5Q A;  4IRI A;  1IZ1 A;  3P9I A;  3EDP A;  2QZ8 A;  4ESF A;  5L3B A;  2FBK A;  3IHU A;  2H09 A;  5FD6 A;  2ADU A;  3QRF F;  1BBY A;  2QBY A;  3LST A;  4MNU A;  5CJ9 A;  4NQW A;  4HV5 A;  2GXB A;  2ZNZ A;  2LF7 A;  3HRU A;  1O3Q A;  2LNB A;  1IN8 A;  1KYZ A;  4F7Z A;  4OMY A;  4LJZ F;  5CYV A;  2HTJ A;  4QLC U;  3CUQ C;  1YLF A;  5ERI A;  4M74 A;  5EEH A;  5BPD A;  3HOT A;  3WTT C;  2ZME B;  2VON A;  3RIR A;  3WTW C;  1T0F A;  3FHZ A;  5ICF A;  2H27 A;  5HS7 A;  5ILV A;  1K7A A;  1XMA A;  4M9Z A;  4LLG F;  4L0Y B;  5JHU A;  3ZP5 A;  2ZKZ A;  1U5T B;  2FU4 A;  1U5T C;  2EFO A;  3T8T A;  2M30 A;  2IRF G;  4BAY A;  5FLX K;  5FFX A;  3ZMU A;  3I5U A;  4AIK A;  1XMK A;  2FQ3 A;  1AWC A;  2F5C A;  3R0J A;  3ZMS A;  3D5L A;  2R3S A;  4O6J A;  1IN4 A;  5LLQ A;  2GWR A;  5CVI A;  4AVP A;  2UXX A;  3CLO A;  2KIM A;  1XGO A;  1WI9 A;  3K1N A;  2RGV A;  4M71 A;  1I6X A;  1JE8 A;  3DKW A;  5LHG A;  4KN4 X;  1BI3 A;  3V8K A;  1MJB A;  4KMU X;  1SD5 A;  3E5Q A;  1IRG A;  2O8X A;  4RGS A;  4R79 A;  3I58 A;  2NNY A;  1L0O C;  2XRO A;  5H6R A;  3I64 A;  3K69 A;  3CO6 C;  2EV0 A;  3G73 A;  4HX7 A;  1S7O A;  4EQQ A;  1ZRC A;  3DXJ F;  5LGN A;  4UVA A;  3CUQ A;  4U0V A;  2W85 A;  4MGR A;  4EGZ A;  3IKV A;  1G4D A;  2BBY A;  5E1W A;  2CQK A;  2HFH A;  1XCB A;  2DPD A;  4HQM A;  2EFQ A;  2R7D A;  1DPU A;  3OOP A;  5LHH A;  2FBH A;  1U5T A;  2V1X A;  1DPR A;  1E2X A;  5E8G A;  2VOO A;  4MQ9 F;  2DO7 A;  4RGU A;  4JBA A;  5FGM A;  1DP7 P;  4BHB A;  2DBB A;  4HA8 A;  2EV6 A;  2X0L A;  5L3D A;  2CGP A;  3MWM A;  1KGS A;  3HHH A;  3IWZ A;  2RVC A;  5A2Q Z;  5ED4 A;  1ZLJ A;  1A04 A;  4RGX A;  1R1T A;  2OQR A;  3WU1 B;  1RUN A;  4S05 A;  1SFX A;  3VFZ A;  4G9Y A;  4O5V A;  3KCC A;  3BOQ A;  1IAW A;  5LBQ A;  3ECH A;  1XDU A;  1IUY A;  3JSO A;  4B09 A;  3NEU A;  3MEX A;  1ZG5 A;  2Z33 A;  3RPU A;  4WWC A;  2ISY A;  5FD5 A;  5HDK A;  1SMT A;  2CW0 F;  3JSP A;  5F6F A;  1KYW A;  2IVM A;  1S6L A;  5HLH A;  3L00 A;  4YG2 F;  1PP7 U;  3DF8 A;  2VXZ A;  5E18 F;  3GF2 A;  1MKM A;  4XLP F;  2W25 A;  3J80 Z;  2HKO A;  2L3D A;  1FP1 D;  3MAJ A;  3JAM Z;  4KMF A;  1KQ9 A;  2PMH A;  4WCG A;  3F6V A;  3HRT A;  2WV0 A;  1WKM A;  4CYD A;  1Z6T A;  2RQP A;  2VN2 A;  3BY6 A;  2PBI A;  1IRF A;  3TGN A;  2CYY A;  5DCM B;  5FFZ A;  2PQ8 A;  1G3W A;  3IRQ A;  3EET A;  3JW4 A;  3LQQ A;  2QM3 A;  4ZZD A;  4ON0 A;  2DQR A;  1DDN A;  1ZRF A;  1P2F A;  2PMU A;  4M9X A;  1LDJ A;  2ZBK A;  2VBZ A;  4CIC A;  2K27 A;  1Z6R A;  3E6B A;  2VOP A;  3J81 Z;  1S8N A;  4RB1 A;  1WRJ A;  3ULQ B;  2Z99 A;  2QQA A;  3BJO A;  1B59 A;  4EJW A;  3DV8 A;  2DU9 A;  3BPV A;  1ON1 A;  3C18 A;  5CVV A;  3WTV C;  3WGG A;  5LEK A;  3DPT A;  1OPC A;  4AWX B;  1FSE A;  1OMI A;  3CDH A;  1B1B A;  5LHI A;  2UXN A;  3F22 A;  2HS5 A;  4L5I A;  3ERE D;  4IVN A;  2GZW A;  4DQ2 A;  4L5J A;  2G7H A;  3LWF A;  1Q1H A;  2P6T A;  2DAO A;  3SZT A;  4PCQ A;  1G6N A;  4KA4 A;  2E1C A;  2ELH A;  3KLN A;  3GFI A;  2QQ9 A;  2ZXJ A;  3BZ6 A;  1YTY A;  1S3J A;  2IA1 A;  5KK1 A;  1FC3 A;  1ZGA A;  2E1N A;  3GFJ A;  3R4K A;  1IN7 A;  4L9J A;  4IPA A;  3E97 A;  1STZ A;  4LMY A;  2AS5 F;  3P7N A;  4Q47 A;  4OIN F;  4KYW A;  1PUE E;  1SD7 A;  2EFP A;  4BQA A;  5F1R A;  1YW7 A;  6PAX A;  2XRN A;  5CLS A;  2IA2 A;  4HF2 A;  2HYF A;  4E70 A;  1FT9 A;  2K4B A;  1U8R A;  4G7O F;  4HDV A;  1GXP A;  2A5Y B;  2PI0 A;  1Z05 A;  3J7A O;  2ACJ A;  2GXG A;  4EJO A;  5AON A;  4EJV A;  2K4J A;  1HKS A;  4HBL A;  2BEO A;  3WOD F;  3IC7 A;  1LEA A;  2ZO4 A;  3TKY A;  1UHM A;  5JVT A;  2LSO A;  1UST A;  2KJB A;  1TQM A;  2BYV E;  2DQL A;  4A5M A;  2BV6 A;  5HVQ C;  5HOO A;  4KFC A;  2A61 A;  4A2U A;  4K2E A;  3F8N A;  4MTE A;  4UVC A;  4LG0 B;  3PQK A;  1T6S A;  2EFN A;  4KNY A;  4NB5 A;  1XDS A;  4I09 A;  3WE2 A;  3HSE A;  3ZMV A;  3HOS A;  4YFX F;  3BP8 A;  4LB6 B;  2QEN A;  3L09 A;  1O3R A;  3QPT A;  2XAQ A;  4XSX F;  1FZP B;  3ELK A;  3K2Z A;  1YW9 A;  1TNS A;  4KIF A;  3KZZ A;  2EJR A;  2PFB A;  3COA C;  4WXC A;  2XKP A;  2VE8 A;  3M7G A;  4FT8 A;  1P92 A;  5D4R A;  3B73 A;  3LQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...