1OKRA

Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
120
structure length
120
Chain Sequence
KTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
publication title Three-Dimensional Structure of Meci: Molecular Basis for Transcriptional Regulation of Staphylococcal Methicillin Resistance
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Bacterial antibiotic resistance
total genus 40
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1okrA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1okrA02
3RI4A 5LRSA 4GYGA 1FOKA 3B02A 1G3WA 1KU3A 1REPC 1MKMA 1MJ9A 1XMAA 4RAZA 1KYZA 5ICEA 2XAJA 4HV5A 4M6XA 1BIBA 5LRRA 5D4RA 4OIQF 4F7ZA 2GQQA 2DT5A 3LAPA 2EA4A 2LKPA 3O2PE 1JHHA 1TW3A 1E17A 1SMTA 4ENMA 5JI6A 4ESJA 4HLYA 1TQPA 5FD5A 3E6MA 3V7SA 1V4RA 2O0YA 3ERED 1MD0A 2V9VA 1OPCA 5IT9K 2DPUA 4U7DA 2RN7A 2VT3A 5TJJA 3E5QA 3T5XA 5ICFA 3C7JA 2XROA 2XAGA 2F5DA 4P9FA 3KLOA 1K78B 2OAZA 3EETA 1HW1A 4Q4ZF 2M87A 3ZMSA 5ILVA 2R7FA 3IWFA 4EJWA 1S8NA 3BOQA 2M45A 4BHCA 4I0AA 3ABUA 1H0MA 2H6BA 2HDCA 2PN6A 1B1BA 2GWRA 4LGWA 2Z3YA 2HEOA 1XMKA 5DEQA 4KT5C 1UHMA 2TDXA 5BQTA 1O3TA 4HDVA 4QWQA 1SAXA 2QUFA 4KYWA 1RUOA 1AOYA 3RYPA 3VEPA 5HVQC 2ESHA 4YFNF 1BI3A 2FA5A 2GXBA 1UFMA 3RKWA 4XLPF 1HKSA 2EFPA 4DNCA 5E1WA 5HLIA 1RIOH 3BWGA 2NS0A 1WWXA 3CJNA 5FGMA 1JE8A 3I59B 1G3SA 4KN7X 5ILUA 3FMSA 3K9TA 4RGRA 4CGZA 1AWCA 1OKRA 2RKHA 4I2OA 1YLFA 3C18A 3I53A 1R23A 1Q1HA 1BIAA 1KGSA 5E17F 1LNWA 2HWVA 1ON1A 3CO7C 3I4PA 1ZRDA 4N9HA 4CHUA 4HX8A 1LDDA 3TGNA 4ZH4F 2OZ6A 2DQRA 3W6KB 2ISZA 3TOAA 4LB5A 3WTZA 2XKPA 5IT3A 5LHIA 1IN5A 2HGCA 4RGXA 2PI0A 3F22A 2ZKZA 5HS8A 1U5TA 4M9ZA 3H92A 2RC4A 4A6EA 4XLNF 4EJOA 1R22A 4I0BA 1FP2A 5H6QA 2XRNA 4EMSA 3E97A 3GVAA 1YQAA 3J7AO 1WI9A 5BS6A 2H09A 2XIGA 3GEZA 2CG4A 1B9MA 1YW7A 3R6SA 3I5UA 3EYIA 1FNNA 2PJPA 2OQGA 1E2XA 1QQIA 2L01A 2JPBA 2MD5A 1S7AA 4ZZLA 1TQMA 5BMZA 4OINF 3GW2A 1TLHB 2IVMA 5J8FA 2ZO4A 2CW0F 2OD5A 1BI0A 2UZKA 4IHSA 3WU0A 3L00A 1ZRCA 1T2KA 1HXDA 3IWZA 2BBYA 1IW7F 4ZYHA 4KMUX 3F8MA 1L3LA 4IPAA 1FY7A 4HQMA 3M9AA 2K4JA 2GIVA 3GWZA 2Y48A 4HX4A 2M8EA 3RIRA 2QQBA 3DF8A 2FMYA 2VT2A 3JAMZ 2XKOA 1G6NA 2EFNA 2FNAA 3HSRA 1FLIA 2STWA 1TNSA 4HF2A 2AXLA 3BY6A 2EK5A 4EVIA 4IRHA 4A12A 1IZ1A 3PQKA 4CICA 1ULYA 1ZYRF 2FSWA 2PQ8A 3FXQA 4G6DA 3ZMZA 3CUOA 3LA3A 5HLGA 1KQ8A 2CYYA 4Q47A 3ZMUA 1D8JA 4WXHA 1IXSB 1I1SA 2V79A 2OU2A 1CF7B 4AIHA 1XGNA 2W84A 2IRFG 4OIRF 1LQ1A 3IRQA 1WKMA 1QNTA 2G7HA 3E5UA 1J5YA 2K02A 4K2EA 4KICA 3F8CA 2HKOA 1FBSA 2NYXA 2D1HA 3FX3A 3K1MA 3DKWA 2XAHA 3E6CC 4L9NA 2OQRA 1YW8A 3IHUA 3MAJA 3IRRA 4LFUA 5LEJA 2HFHA 1O7FA 2DAOA 4WX9A 3W6JB 3ZQ7A 4E70A 3N4MA 3F3XA 3RDIA 3GFMA 5DV5A 2MLGA 3DPTA 1YG2A 3BJ6A 4IXAA 1G3YA 2QLZA 3LWFA 4YFKF 2K4BA 4LD5A 1W7PA 5F64A 1QO0D 1L0OC 3ROUA 2QM3A 1SD5A 2V1XA 2D45A 3HYIA 3CUQB 4IVNA 3WGHA 2IA0A 1MGTA 2CO5A 2OZUA 2ACJA 4MQ9F 5DUKA 1FWZA 3CO6C 3Q9VA 5LEKA 5DD8A 4CO8A 4UV9A 2A07F 1IF1A 1Z05A 4RB0A 4AIJA 3F8BA 5DCMB 3EQLF 3MWMA 4I01A 3I54A 4U0VA 2L4MA 3RPQA 2DPDA 2EA2A 3M8EA 1U8RA 1WQ2A 2YX4A 3FWEA 2WTEA 1XGSA 3RKYA 4XSZF 4L0ZB 4KA4A 2QWWA 4P9UA 2VBXA 4YIIA 2QQ9A 4Y17A 1F5TA 3HRUA 3TQNA 1OYIA 3F8NA 3K2ZA 5HS9A 3ZN1A 4BHPA 3H3UA 1RUNA 2YX7A 2FMLA 2IJLA 1KYWA 1BI1A 4XBFA 4KNYA 1ONVA 4A0ZA 3U9GA 4FHTA 5HOOA 1YIOA 1QZZA 1YS7A 1JGSA 5FO5A 3L7WA 5ICCA 3FZVA 4L0YB 4G7HF 5FFZA 5D5XB 2QBYB 2CSOA 1XSDA 2HTJA 1FSEA 4IJAA 4HYEA 1BC8C 2FRHA 4O5VA 4MGRA 3VFZA 4WK8F 2EFQA 3KP3A 4BQAA 2IT0A 2XAQA 2OBPA 3JSOA 1UB9A 4A2UA 1YW9A 3ZN0A 4OIOF 4NQWA 3T8TA 3D5LA 1MDMA 3JAMK 4G94A 4LG0A 2DLLA 4KIGA 4IRIA 2VOPA 4UV8A 3DEUA 2F2EA 2RGVA 1GVJA 4GCVA 4RB3C 4UXNA 3GF2A 1R5GA 1BI2A 3V8LA 3L2CA 2BGCA 5D8KB 2DTRA 2DBBA 2XV4S 2ETHA 2XUBA 5D8LB 1PP7U 2MLKA 2LF8A 2RQPA 3F6VA 3M7GA 5A2QZ 3CUQC 2IP2A 2A5YB 4HDUA 1YFHA 3G73A 1F1ZA 3TO7A 1T6SA 3KEQA 1PP8F 5D6EA 1G4DA 3ISPA 2MH9A 4EJTA 3LFKA 5L3CA 1ZG3A 2PG4A 1BC7C 1DPUA 1HQCA 2VOOA 2DU9A 2K27A 1R7JA 2BEOA 4WCGA 2MH2A 3GYHX 1W7PD 1O3RA 4P55A 1R1UA 2IA2A 3I0TA 3FM3A 4UNOA 2O03A 1B6AA 4CXFA 3PFIA 4N0BA 2XAFA 3QP6A 3SZTA 2KIUA 1R58A 2EJRA 1ZLJA 3J80Z 3BPXA 4EQQA 2JT1A 1UHWA 3M1EA 4IRGA 4BYYA 3CLOA 2CQKA 3ULQB 4KN4X 2X0LA 5D5VB 2WC2A 2NAZA 3BP8A 1KQ0A 4L9TA 5L3BA 3AAFA 3DP7A 4UVBA 4ASNA 5LBQA 4CYDA 2P8TA 3NEUA 1SFXA 4Y15A 4I09A 3F23A 4D0PA 3R0JA 1TW2A 4CZZA 2G9WA 4KIFA 1Y0UA 3GLXA 3DQVC 1PUEE 4EJVA 4HF1A 3U1DA 2V1UA 3BZ6A 4GYIA 4I02A 1YO5C 2STTA 3RKXA 4KMFA 2ADUA 3GO5A 1XCBA 1O3SA 4G7OF 2BYVE 4ON0A 5CYVA 4HAMA 1QPMA 3WGIA 3HSFA 3Q9SA 5JFRA 3L9FA 1WRJA 1Z6TA 5F6FA 2FE3A 3KZZA 4U0WA 3KE2A 2XASA 3HHHA 4UHTA 3P7NA 2RDPA 4S04A 5FLXZ 3IKVA 1SFUA 4B8XA 4PGGA 2ZMEB 1WSUA 1T98A 3WTTC 1W5SA 4AWXB 1PDNC 1ZREA 2UWMA 1SD4A 5TRDA 2HS5A 2PEXA 3RJPA 2IA1A 2VC0A 3M8FA 1MJBA 4UVCA 4MTDA 4OIPF 3GFJA 3GZ5A 2G7UA 5CVUA 4LLLA 1ZN2A 2A68F 2L02A 4ZYGA 1EH6A 1HW2A 2RV8A 1ZGAA 1HKQA 2OA4A 1LDJA 2F5FA 1S7OA 3E5XA 4GXOA 4PZJA 1BM9A 3KP2A 1MJAA 3DV8A 3NQOA 3GFLA 2E1NA 4KUMA 3ZMTA 2LSOA 3BROA 3HTUA 3CTAA 1XGMA 1QZYA 2PFBA 4P96A 4JBAA 3ZPLA 1J59A 4MTEA 4I98B 1IN4A 3MFKA 4RGSA 4YFXF 3R4KA 3QRFF 3EUHA 3V7RA 4BAYA 5L3GA 5AONA 5D5WB 5F1RA 3R61A 2O6GE 4M9SA 1LEAA 4HF0A 1U78A 1XD7A 5K5OA 3QU3A 2ELHA 5AIQA 2VBYA 4OOIA 1YYVA 2FBIA 1XN7A 2NNYA 5E8IA 2QZ8A 2KKOA 5A2QK 2D2WA 3I71A 4PGHA 3T8RA 3C3WA 4BH9A 5E1ZB 2P6SA 4U88A 4XSXF 4ENNA 2JSCA 4A6DA 5JVTA 3JTGA 4A5NA 1I6XA 2VBWA 5LGUA 4PCQA 1ZG1A 1USSA 4GO1A 5EEHA 3KETA 1BN5A 1C0WA 3F21A 4ZYEA 3TO6A 2F5CA 3VOEA 3RTRA 2CFXA 4UUVA 4CDGA 1USTA 3BJOA 4HOBA 1ZRFA 4Z2YA 2A6EF 2Z5UA 4LMYA 3F8FA 1P4WA 3FXUA 1LVAA 3EYYA 4FT8A 3RYRA 1LEBA 3J80K 3FM5A 2FOKA 3ZMVA 2EV6A 4M9XA 1J9IA 3SFZA 3E6DA 3E3VA 1LB2A 4NB5A 4KIBA 2GXGA 2QENA 3SQNA 4O3MA 3LA2A 2VODA 5DUIA 3COAC 2FEZA 3QP5A 5LHHA 5BPIA 5H20A 1U3EM 4L18B 2MC3A 1EV7A 3HRMA 5D6FA 3FXRA 1R1VA 2HQNA 1FSHA 1FP1D 2E7XA 1B4AA 1SD7A 5K5QA 2L3DA 5H6RA 2ZXJA 3IC7A 2ESNA 4EJUA 3FF5A 2WV0A 3LQRA 1JHFA 4FX4A 2COMA 4MEYF 3R0AA 2KRFA 2KIMA 5KK1A 5CVIA 2W24A 2A69F 5D5UB 1FYMA 1SFEA 1F9NA 1GXPA 2LNBA 1I5ZA 3KP5A 1BOAA 5FB2A 3HIFA 3BPVA 1FZPB 3WE3A 1Z1DA 3ZMDA 2E1CA 3WGGA 1ZG5A 4LJZF 4WXDA 1IXRC 2YU3A 1GXQA 2XHKA 1RI7A 1U5TC 4EGZA 1W7PB 2WWYA 2B0LA 3RPUA 2A61A 1XSXA 2GZWA 3O3KA 4LLNA 1EH8A 3FHZA 2GA1A 4IF4A 3KFWX 1ZGJA 1K78A 1OYYA 1XSVA 2ZNZA 3DFGA 1A04A 2C6YA 1XCVA 4M74A 2DO7A 2O3FA 4G9YA 4FX0A 2LDUA 2W25A 2K7LA 2DI3A 3VODA 5AIPA 2JRTA 4L9VA 2P6TA 2VN2A 3TDZC 1T38A 2FU4A 4ZZDA 2GA2A 2FNPA 2DK8A 1FYKA 1Z7UA 4JK1X 4EGYA 4HZFA 1K7AA 3P9CA 1FT9A 3EDPA 2ZBKA 3TKYA 5DDGA 1P4XA 2PMHA 1S29A 2R7DA 4A5MA 1ZLKA 2ISYA 2F5EA 4HW0A 3Q5FA 3I59A 3ECHA 3JTHA 3DPLC 2GAUA 2VONA 4XRFA 1KU9A 5L3EA 1XB4A 2Z33A 4ZYDA 1FBUA 3U2RA 2RNJA 1KQ9A 1H9TA 3P9IA 2Z9OA 2W85A 5CLSA 4S05A 1LDKB 1R36A 5K5RA 3TDUC 1ZAOA 2ZFWA 3JSPA 2MBFA 1OMIA 1IAWA 1Z91A 1J7KA 2ZNYA 1DPRA 4WF2A 4M72A 1K79A 4PDKA 5E8GA 1ON2A 4A0YA 2P7CB 3HRSA 5ED4A 1W4MA 3NRVA 1RZ4A 1IN6A 3SHFA 1K6OA 5LLQA 4IHTA 4KDPA 1HSTA 3KLNA 4AD9A 3O6BB 1MDMB 4Q48A 1BBYA 3HOSA 2NRAC 1DP7P 4WWCA 2E7WA 4LG0B 1ZHFA 3E6BA 3K0LA 1D5VA 4DQ2A 4UVAA 1P6RA 3KEOA 2ZMEA 4N9IA 2V6CA 3WG9A 5E20A 2L54A 1R00A 3DXJF 3GUDA 4EM2A 4MQVA 2V1DA 1MZBA 3V8KA 4L5IA 2FQ3A 2AS5F 1V3FA 3IKTA 5LHGA 2P5VA 1J2XA 4A0XA 3G3ZA 1HW5A 2VXZA 3FMQA 1X3UA 5JHUA 2YSRA 3SZPA 2KIFA 3GZ6A 1B59A 3QPHA 3KP7A 2M1BA 3HOTA 2VE9A 1SD6A 3WODF 2HOEA 5J8CA 1GHCA 5HLHA 1HSJA 4R1HA 3TOBA 4KFCA 4HX7A 4ETSA 3LAJA 1P4AA 2ZCWA 3LA7A 4EV0A 2P4WA 3V4GA 4LLGF 3WTVC 4ENKA 3V8JA 2KJBA 1Z6RA 4HQEA 2IPQX 4O6JA 4MHGA 2P5LC 2HQRA 1Z9CA 3KCCA 2L4AA 1QBJA 3V7CA 1DDNA 2DFIA 2XGXA 3S2WA 4M6YA 2VC1A 2K86A 3MQ0A 4LB6B 4BXUA 1I1GA 3D0SA 2BE5F 3GXOA 1CF7A 2PLYA 3WTXC 4R79A 1FYLA 4RB1A 3QAHA 3K1NA 1KU7A 1UCRA 5E18F 2IW5A 1J75A 1R5HA 3K1PA 3MEXA 3ML6A 1LJ9A 3HSEA 4G6QA 1HBXG 3J81Z 2EV5A 5K1YA 4AVPA 5DYMA 2HR3A 2J5OA 4L9JA 2YPRA 5FFXA 3OV8A 1P2FA 4LK1F 1XGOA 4G7ZF 4MNUA 2YR2A 3BDDA 1IRGA 2PMUA 4OMYA 1TNTA 2CGPA 4L5JA 2M5WA 5L3DA 4B09A 3GFIA 5LGTA 3T1BA 5DD4A 3F6OA 1QGPA 2EV0A 3QOPA 4NHJA 1U5TB 1HKTA 3CDHA 1OR7A 3QU6A 3P9KA 4R8HA 1OYWA 5CVVA 4TV7A 1T0FA 3GX4X 3PQJA 3LSTA 4YG2F 1XDUA 5ERIA 5LGNA 2HYGD 4M71A 3I64A 5BOXA 1KU2A 3CUQA 2Q2EA 1S6LA 2Y75A 3LQQA 1STZA 2HKXA 2EWNA 2DW4A 1S3JA 3ZP5A 4RGUA 5KVRA 1IRFA 3MZYA 3MZHA 3WTSC 3WTYC 3BJAA 2FBHA 5HDKA 2Q0OA 4BHBA 4ESFA 4I7HA 3T0YA 2CWEA 5IT9Z 3H3ZA 3OOPA 5HS7A 3WU1B 3HRTA 3MCZA 1P92A 5DCMA 2P7VB 3R60A 1T39A 2M30A 5HDGA 1O57A 2LF7A 1ZARA 1YTYA 1U6GA 5E1XA 2UXNA 2QQAA 5CVJA 2ZJ2A 1SMYF 2HTSA 3JW4A 4EM1A 4RAYA 3SXYA 4YIFA 1EH7A 5HDNA 4Q5SF 6PAXA 2H27A 2QVOA 2BV6A 3ELKA 4HV6A 1G3TA 2DK5A 3I58A 1O7LA 4WXCA 2R3SA 3HTSB 3HUGA 3REOA 4H0EA 1FBQA 5DCFA 2EFWA 2W57A 5EEGA 3VB2A 3B73A 2MA3A 3C1DA 2PBIA 1IXCA 3TO9A 3ECOA 2HYFA 3ABTA 1ZH5A 1BJAA 4HLXA 2A3SA 2QBYA 3WTUC 4GGGA 3IL2A 4RS8A 4EM0B 3K69A 5ILSA 2DQLA 4P5OA 2EB7A 2NNNA 5D4SA 3FMRA 4AIKA 2UXXA 1I27A 1JXSA 2Y0MA 2QYOA 1RNLA 1TTYA 4JQFA 3L09A 1H9GA 2FF4A 2J5PA 1DUXC 2P5KA 4OMZA 2O8XA 5CJ9A 3HHGA 1YS6A 3WE2A 2FBKA 4M73A 2H94A 1D3YA 1TBXA 1XDSA 1NHAA 1KA8A 4LK0F 5BPDA 4HBLA 3KZYA 5J6XA 2VBZA 1R1TA 4OU0A 1B9NA 2FXAA 3KP4A 5FD6A 1F4KA 1FC3A 4G8XA 4U0YA 2JPCA 5FLXK 2D1VA 2JZYA 4ESBA 3N97A 2RVCA 2Z99A 1FX7A 2HZTA 3QPTA 2VE8A 1VTNC 3F72A 2A6HF 1TQIA 1CGPA 1W5TA 4BNCA 4QLCU 4RB2C 2EFOA 2Q8KA 1O3QA 1IUYA 4U7BA 5JR3A 4MEXF 2X4HA 2JTVA 3WTWC 5ICGA 1D8KA 3KP6A 2XVCA 4Y13A 2KJCA 2H6CA 3J81K 5L3FA 1FPQA 1U2WA 2O61A 1IN8A 1J0RA 5CVRA 4HA8A 4ENJA 1ODDA 1IN7A
chains in the Genus database with same CATH superfamily
3RI4A 4Z6YA 1VQ7I 2VASA 5LRSA 4GYGA 3BLYA 5J1RA 1FOKA 2PX9A 3B02A 1SANA 2OUMA 1G3WA 3HPGA 1KU3A 1REPC 1MKMA 1MJ9A 3PJRA 1OCRH 1XMAA 4RAZA 1KYZA 5ICEA 1Z0XA 2K9MA 2XAJA 2QA4I 5FKKA 1PYVA 5EEAA 2JWTA 4HV5A 3VSLA 1UAAA 2K9NA 4LOCA 4M6XA 1AKHB 1BIBA 3MZ8A 1I50J 4OWRB 5LRRA 1FMVA 5D4RA 2L7FP 4OIQF 2VL8A 4EEFG 1D0ZA 4F7ZA 4IHXA 2UV1A 1DGRM 2GQQA 2DT5A 2X6OA 5EZGA 3LAPA 1T95A 2DMPA 2EA4A 2LKPA 1H8AC 4XN3A 2KT0A 1YIJI 3O2PE 3V42A 1JHHA 1TW3A 1E17A 3EUHC 1SMTA 3BTCA 4ENMA 3H9QA 4DW6A 5JI6A 2Z16A 4ESJA 2CQXA 4HLYA 1TQPA 2HXIA 5FD5A 3OYBA 3E6MA 1MMSA 3IH3A 3V7SA 1V4RA 1P7IA 2O0YA 1TWAJ 3OY9A 1NH3A 3ERED 1H88C 1MD0A 2V9VA 1OPCA 5IT9K 1BR1A 4D5FA 5IOZA 4U7DA 2DPUA 2RN7A 2VT3A 5TJJA 3E5QA 3T5XA 2QF7A 5ICFA 1RC9A 3C7JA 2XROA 2XAGA 5KCMA 3Q0UA 4CCLA 2F5DA 3KYDB 2VIXA 4KITB 4P9FA 3KLOA 1K78B 2OAZA 1WGXA 2BOLA 1DU0A 3RKQA 4RA2A 4LIUA 1X2NA 1VQPI 2X6XA 3DEWA 3EETA 1HW1A 4Q4ZF 2M87A 3ZMSA 5ILVA 2R7FA 3IWFA 4PSWA 5EYRA 4EJWA 4FQGA 2DDAA 1S8NA 4ANJA 5EDNA 5IP9J 2DA5A 3BOQA 2M45A 4BHCA 4XLHA 4I0AA 4ZYAA 3ABUA 1H0MA 2H6BA 2HDCA 5HNFA 2PN6A 3BTIA 3A01B 1B1BA 2GWRA 3PNVA 1ETKA 4LGWA 2Z3YA 2HVRA 2HEOA 1XMKA 5DEQA 4KT5C 1UHMA 3DBLB 3CMEI 4IZZA 1VNDA 2TDXA 4M3EA 5BQTA 5H2FC 3I3LA 4J01A 3U1KA 1DP3A 1O3TA 4HDVA 4QWQA 1MW7A 3UKGA 1SAXA 3J7AY 2QUFA 1X4OA 4KYWA 1RUOA 1AOYA 4PJLA 3RYPA 3VEPA 5EF6A 4DZJA 2NOGA 2ESHA 4PFPA 4YFNF 5HVQC 1G59A 1BI3A 2FA5A 2GXBA 1UFMA 3RKWA 3ABMH 3HPHA 2KDOA 4XLPF 4NUBA 4V2FA 4XKBA 1HKSA 2EFPA 4HRIA 4DNCA 4BGDA 2DT6A 1ZR2A 2EBIA 5E1WA 5HLIA 1RIOH 3BWGA 2HDDA 1MNEA 1N25A 4DYCA 2NS0A 1WWXA 1RKWA 1I6HJ 1ETWA 4CSWA 4H4KC 4A69C 3CJNA 2VKHA 3H5AA 4CYCB 5FGMA 1JE8A 3I59B 1G3SA 2OJED 3E0JB 4Y3OA 4F3QA 4KN7X 5ILUA 2RQQA 4BDYA 3FMSA 3K9TA 4RGRA 3HOWJ 2BZTA 4CGZA 1AWCA 1OKRA 2RKHA 3HJEA 4MFDA 4I2OA 3S3NA 1YLFA 3C18A 3I53A 1R23A 2JVHA 3L1PA 4FE4A 2LP0A 1Q1HA 5B3SH 1YHQI 1BIAA 2LBFA 4D7NA 1KGSA 2HXOA 3ZGKA 1NK2P 5E17F 3OR2C 1LNWA 2HWVA 1ON1A 1Y8QB 5J1YA 3CO7C 3PO3J 3I4PA 1ZRDA 1ZKGA 4N9HA 1WVRA 1E3PA 4CHUA 5GPAA 3MN2A 1MMDA 4HX8A 1LDDA 3TGNA 3TP0A 4ZH4F 2OZ6A 1QPIA 5J40A 2CU7A 4V19K 3FKIJ 4QPOA 3TL4X 3M3YJ 2DQRA 3TMOA 3W6KB 1B72A 3WHBA 2ISZA 1LFUP 2I5UA 3TOAA 3I4MJ 3BTLA 3PNYA 4LB5A 3WTZA 2XKPA 1R49A 5IT3A 1MNDA 3FISA 5LHIA 1IN5A 3FXLA 2HGCA 1D0YA 4RGXA 2K9SA 2PI0A 3F22A 2ZKZA 3CCRI 5HS8A 1U5TA 4M9ZA 3H92A 4M3BA 3CC7I 3SDGA 1GT0C 2RC4A 4A6EA 4XLNF 4EJOA 1R22A 4I0BA 4HNTA 1FP2A 2R7TA 2MFZA 3AL0B 1R5ID 1ZTRA 2FD5A 3BC8A 3LSIA 5H6QA 4CCKA 2XRNA 4EMSA 1JUMA 3H35A 5B1AH 5HLTA 3E97A 1IJWC 1I3QJ 3GVAA 3GZNB 1YQAA 3J7AO 2QGUA 1WI9A 5BS6A 2H09A 2XIGA 2TRTA 1JKPC 3GEZA 2RNGA 2DMNA 2CG4A 2DA7A 1B9MA 1VQNI 1YW7A 3R6SA 3I5UA 3EYIA 1FNNA 2DTZA 2PJPA 2OQGA 1E2XA 2EZIA 2L7ZA 1QQIA 2L01A 3IAM2 2W4SA 2Y0SN 1PVEA 1KZHA 2JPBA 2VJIA 3FBIB 5BNGA 1VQLI 4XICA 3DCFA 2I8DA 2MD5A 2E35A 1S7AA 3DKYA 4ZZLA 1TQMA 1X2MA 4OINF 4BBRJ 4PK4A 5BMZA 3DKXA 3GW2A 4DBQA 3LL7A 1TLHB 2IVMA 1LKXA 3G4SI 5J8FA 2ZO4A 2CW0F 2OD5A 1Q1VA 2Q1ZB 4E4HA 1BI0A 3OYNA 2UZKA 4UY8I 3BCAA 4IHSA 5KAFC 1HF0A 3HL2A 2M4GA 3WU0A 3L00A 1MH4A 1ZRCA 2LRDA 3CCLI 2EH3A 1D1CA 1T2KA 2BW3A 1HXDA 2H8RA 3IWZA 5M5WJ 2DMUA 2BBYA 1IW7F 4ZYHA 4KT6A 2V9KA 4KMUX 3F8MA 2LTPA 1L3LA 3BR6A 5E3LA 3KYCB 4IPAA 3ZQHA 1FY7A 4HQMA 4XOPA 3M9AA 2R7VA 2WY8Q 5IYCJ 5JHFA 2K4JA 2GIVA 3GWZA 4IL6C 2K3FA 3D5RC 3K70D 2Y48A 3LSJA 4HX4A 1BR2A 2A5WA 1R4NB 2M8EA 3A1YA 3RIRA 2QQBA 4C2MJ 1EJ9A 3DF8A 2FMYA 1IV8A 2BVMA 2X1DA 4E7HA 2VT2A 3JAMZ 5E79C 2XKOA 1G6NA 2EFNA 2FNAA 3HSRA 2E2HJ 1VQOI 1FLIA 3OYKA 2STWA 1TNSA 4HF2A 2HZDA 2AXLA 2F5VA 5GTHC 3BY6A 2EK5A 2L0KA 2CUEA 2DMQA 2M7BA 2MABA 3BR0A 4EVIA 2LKSA 2KMUA 3NWSA 2JUGA 4IRHA 4A12A 3OIPA 1ENHA 2NVUB 4BS9A 3E1SA 1IZ1A 5EGOB 1HLVA 1TZLA 3PQKA 3ZRGA 4CICA 1ULYA 1ZYRF 2IS1A 2FSWA 2PQ8A 4JX5A 2R0QC 3FXQA 4DGWB 2ZFUA 1ACIA 2EPFA 4G6DA 3ZMZA 4DIQA 3CUOA 3LA3A 3VYSB 5HLGA 1KQ8A 3OYCA 1JGGA 2CYYA 3K10A 3O8HA 3N05A 4UUTA 1BJZA 4B3AA 4Q47A 3OYMA 2FJ1A 3DLLF 3ZMUA 2GLOA 1D8JA 4WXHA 1O4XA 1IXSB 1I1SA 2CV2A 2V79A 1JUPA 5J47A 1D1AA 2OU2A 4KJZA 1CF7B 4AIHA 4PSXA 1XGNA 2W84A 3BG9A 2IRFG 4OIRF 1LQ1A 3IRQA 1Y8RB 1WKMA 1T08B 5GTIC 4RDUA 2HPMA 1QNTA 1MSEC 5JLXA 1V5GA 2G7HA 3K70C 3E5UA 3SEZA 1J5YA 2K02A 2MYSA 4K2EA 1Y6IA 2KLOA 3Q0VA 3ZCOA 4XQFA 3TEDA 4BL0B 4KICA 2R92J 1WJ5A 3F8CA 2HKOA 1FBSA 2NYXA 3HEFA 2D1HA 3FX3A 2NOJB 2DOAA 3K1MA 3FKJA 2BVLA 3DKWA 5JLWA 2XAHA 3S3OA 3E6CC 4L9NA 2OQRA 2CQQA 2DODA 1YW8A 3IHUA 3MAJA 3IRRA 1YX3A 4LFUA 2LG4A 5LEJA 2HFHA 2A6TA 1B8IB 1O7FA 4M3GA 1YJ9I 2DAOA 1ORKA 4WX9A 2ECBA 3W6JB 3ZQ7A 3EPZA 3LMMA 3NAUA 4E70A 3N4MA 3F3XA 3RDIA 3GFMA 2WAQN 5DV5A 1IDYA 2KZVA 3F9KA 3FXOA 1DU6A 2ELKA 4AVZA 2MLGA 3DPTA 2P0WA 1YG2A 3BJ6A 2BY1A 4IXAA 1Z7LA 1G3YA 2LK2A 2QLZA 3LWFA 5FKNA 4YFKF 2K4BA 2JA6J 3ZR8X 4LD5A 4M3FA 3HKZN 1W7PA 5F64A 3S1RJ 5FLVA 3CMMA 3AL0C 1QO0D 1L0OC 3ROUA 2QM3A 2OV7A 2R7UA 3IH4A 1SD5A 4A3JJ 2VKVA 3PUFA 3SYTA 2DN0A 3VDXA 5E3MA 2V1XA 4RM2A 2D45A 3JRHA 3HYIA 3CUQB 5EZHA 4BEHA 2DFEA 3K4MA 2KP6A 1ETQA 1RR8C 4IVNA 3WGHA 4IHYA 4PFOA 2E1MB 2IA0A 2DDBA 4B4CA 2CV0A 1UG0A 2BXZA 1MGTA 3AG4H 4XN0A 2AHQA 2ZMEC 2CO5A 1TWGJ 3H3VK 2OZUA 2ACJA 3IAS2 4MQ9F 2XF6A 5DUKA 1FWZA 5F1JA 4BU2A 2DA1A 1ZK8A 2E19A 3Q9VA 3CO6C 5F0HA 2IBDA 5LEKA 4A3DJ 5DD8A 4CO8A 2XC7A 4UV9A 3PO2J 3HOXJ 2A07F 1WCMJ 3K4BA 1IF1A 1Z05A 2CQ7A 5EG0B 3BR5A 2LY1A 4RB0A 4BBSJ 4IEJA 2LLKA 4AIJA 3F8BA 4NDLA 5DCMB 3EQLF 3MWMA 4I01A 3I54A 4U0VA 3CD6I 2L4MA 3BG6A 3RPQA 1LFBA 2DPDA 2R4GA 4J00A 2B9SA 2EA2A 1D0XA 2VQCA 3M8EA 1U8RA 5FROA 2A05A 3AFHA 4ZTJA 1WQ2A 2M7AA 2YX4A 1LE8A 3FWEA 1F36A 2WTEA 1I3AA 4IHVA 1XGSA 5B5EC 3RKYA 4XSZF 4L0ZB 3FXMA 4KA4A 3IUOA 2QWWA 4P9UA 2VBXA 2GBYA 1QHGA 2XAUA 4YIIA 5DS9A 3S1NJ 2QQ9A 4UB6C 5F08A 2W00A 2L7MP 1ITYA 4Y17A 1F5TA 2O5RA 3HRUA 3KYLA 1IRXA 2M4KA 2AXTC 2M8GX 3TQNA 2R5ZB 1OYIA 3F8NA 3K2ZA 5HS9A 3ZN1A 4BHPA 2VLAA 4A93J 3H3UA 1RUNA 1BL0A 2WV1A 2YX7A 2FMLA 2DCEA 4XIDA 2IJLA 2NVTJ 3HUGB 1KYWA 1BI1A 2HYJA 4XBFA 4Y52J 4KNYA 1ONVA 4C3HJ 2Y31A 4A0ZA 3U9GA 3CJQB 4XL9A 2AQEA 4FHTA 4BQNA 5HOOA 1YIOA 1QZZA 1YS7A 1JGSA 1MSFC 3OYGA 2XB5A 2CRGA 5FO5A 3L7WA 5ICCA 2Y9ZA 3MKLA 3FZVA 4L0YB 2WADA 4G7HF 2JA8J 5FFZA 5D5XB 2QBYB 3K4NA 2CSOA 1XSDA 3S15J 3CF2A 2HTJA 1UELB 3DTEA 1XC5A 2OTJI 1FSEA 3QOEA 4IJAA 3L2VA 2VXDA 4HYEA 1BC8C 2KISA 1PUFB 2ZJPF 2FRHA 4O5VA 4MGRA 1UJ8A 3VFZA 4WK8F 2EFQA 1GV5A 3S32A 3C2GA 2DYRH 3KP3A 3GMEA 5C4XJ 4HNVA 3K4LA 4D5CA 1NG6A 2XF5A 2HVSA 4BXFA 3B6CA 1SVLA 4BE2A 4BQAA 2IT0A 2XAQA 2DYSH 3A03A 2EINH 2OBPA 4D7MA 3JSOA 1UB9A 4A2UA 1YW9A 3ZN0A 4OIOF 3OYFA 4NQWA 3T8TA 3D5LA 1MDMA 1JT0A 2M2EA 4BXXJ 2LMDA 3JAMK 4G94A 3FIWA 3SDBA 3ABKH 3BG5A 2MGQA 3RCOA 4LG0A 3G1MA 2VQHA 2DLLA 1RKTA 5FKLA 4KIGA 5IY5H 1T56A 4IRIA 2VOPA 4UV8A 4XRMA 3DEUA 2E5NA 2ME0A 2F2EA 2RGVA 1GVJA 1Z3YA 1A5JA 4GCVA 5CPRB 3S93A 2LY9A 4RB3C 4UXNA 4JOMA 3GF2A 2L7KA 1SC7A 1R5GA 1BI2A 3V8LA 3L2CA 1VQ9I 4XORA 1OR7C 2BGCA 5D8KB 5B66C 1YOVB 1LUJB 2PJRA 3GTGJ 2DTRA 2DBBA 2HQAA 2XV4S 4BQOA 2ETHA 2XUBA 5D8LB 1T0FC 2V1NA 1PP7U 1LPQA 3NWTA 3BTJA 4IOAF 2MLKA 3CCEI 2LF8A 2RQPA 3F6VA 3PIPF 3M7GA 5GADJ 5A2QZ 2VPRA 3CUQC 2IP2A 2A5YB 4HDUA 1YFHA 3G73A 4BJ6C 1F1ZA 2OCEA 3TO7A 3S1QJ 2JA5J 1T6SA 1U0JA 3KEQA 1PP8F 2E1MC 2LH9A 2OCCH 5D6EA 2OF7A 1QHHD 2W1OA 1G4DA 3ISPA 2MH9A 4EJTA 5F0CA 3LFKA 5L3CA 1ZG3A 2PG4A 1BC7C 1DPUA 1ETYA 1OJLA 3GTKJ 4W97A 3HZJA 3TBIA 1HQCA 4C3JJ 2B63J 2AO9A 1VQ4I 1UG2A 2R7SA 1WJCA 1Y39A 2DMTA 5FJ8J 3M4OJ 2VOOA 2DU9A 3PUBA 2K27A 1R7JA 3HBLA 1RRJA 2BEOA 4WCGA 2MH2A 1RETA 3GYHX 1W7PD 2WAQA 2XPUA 3BG3A 4A3EJ 4P55A 4CCMA 4ZTFA 1ZGWA 1O3RA 1RESA 1R1UA 1VQ5I 2IA2A 4CZCA 3RSNA 3I0TA 3I55I 3FM3A 4G12A 4UNOA 2O03A 1B6AA 4CXFA 2WB1N 3PFIA 4N0BA 4XM3A 5TISC 2XAFA 3QP6A 5FKMA 3VYTB 1R9TJ 2LC2A 3SZTA 9ANTA 2KIUA 2K40A 1R58A 1JI8A 2EJRA 4DJAA 1ZLJA 5IP6A 1G2HA 4FCYA 3KZIC 3J80Z 3BPXA 3HKZA 4EQQA 4XLCA 2JT1A 1UHWA 3M1EA 1A36A 1X1BA 2XSDC 1EKEA 4IRGA 4BYYA 3CLOA 2CQKA 1WH7A 3ULQB 3CCJI 3J7ZI 4KN4X 2X0LA 4D9JA 5D5VB 4E7SA 1S72I 2D5VA 2WC2A 1ZELA 2KRCA 2NAZA 3BP8A 2DT7B 3W2WA 1KQ0A 4L9TA 3EUAA 3PIOF 3HC7A 3H9GA 5L3BA 1QVUA 3AAFA 2ZXHA 3DP7A 3G1OA 4UVBA 4ASNA 2YS9A 1FOXA 5LBQA 4CYDA 3OIOA 3GTOJ 3CCSI 2P8TA 3NEUA 2ZSHB 1SFXA 2YU9J 2V9PA 3MKZA 4Y15A 2QCOA 4I09A 1R6RA 3F23A 4D0PA 3PSFA 3R0JA 1A35A 1TW2A 3CCQI 4J19A 4CZZA 2G9WA 4KIFA 1Y0UA 3JRCA 3GLXA 1WJFA 3DQVC 3DTKA 2Y9YA 1PUEE 4EJVA 3RZDJ 4HF1A 1Z67A 3U1DA 2V1UA 3BZ6A 3ZQFA 2ID6A 2IGKA 4GYIA 3BQYA 4I02A 2VUMJ 2X48A 1YO5C 2STTA 3S16J 2UUZA 1OCPA 3RKXA 4KMFA 2ADUA 2ZSIB 2K9QA 3GO5A 3K4CA 1XCBA 3CP2A 1S5LC 1O3SA 4G7OF 2BYVE 4ON0A 3BG7A 5CYVA 4HAMA 1XPXA 1QPMA 2ME6A 3WGIA 2OPTA 3JRAA 1Y1VJ 3HSFA 3Q9SA 5DTDA 4B47A 5JFRA 3L9FA 1WRJA 2IGOA 3PSIA 4ABZA 1TT0A 3F0CA 1X58A 1MBKA 3HOUJ 4F52A 1Z6TA 5F6FA 2FE3A 3KZZA 1P7JA 5HNHA 2R93J 4U0WA 3KE2A 2XASA 3OSFA 3HHHA 4UHTA 3P7NA 2CFOA 2RDPA 4S04A 5FLXZ 4KISA 3IKVA 1SFUA 4DYRA 3I56I 1SVOA 1GDTA 2O7OA 4B8XA 4PGGA 3W6VA 2ZMEB 4IX7A 3CF5F 1WSUA 1T98A 3WTTC 1W5SA 1X4PA 2R7XA 4UB8C 4QIWN 2IS2A 4AWXB 2HOSA 3GBGA 3LSHA 1PDNC 3HOZJ 1ZREA 2CH0A 1JJ6C 2UWMA 1SD4A 5TRDA 2HS5A 2PEXA 1U9OA 4Y4RA 3RJPA 2IA1A 2Z1DA 3OL4A 2VC0A 3M8FA 1MJBA 4GFBA 4UVCA 4MTDA 4OIPF 4A3LJ 3HXLA 3GFJA 3GZ5A 4DYQA 2G7UA 5CVUA 1HDDC 4LLLA 1ZN2A 2A68F 2L02A 4AYBN 3I4NJ 4ZYGA 1WJAA 5M3FJ 2VJJA 1EH6A 4E6KG 2HPIA 1HW2A 1UZCA 4ITVA 2DJNA 5FRMA 2CJJA 1ETXA 2RV8A 2JK3A 3ESWB 1ZGAA 1HKQA 2OA4A 1K4SA 2VPLA 2X51A 1LDJA 2F5FA 2EZLA 1S7OA 3A0BC 1X19A 3E5XA 1VZ0A 2F4OB 3IV5A 2LBFB 4GXOA 2V7FA 4PZJA 1BM9A 3AG2H 2R7WA 3HGYA 3KP2A 1MJAA 1OCTC 2KQRA 3DV8A 2NS8A 3NQOA 4A3IJ 4X6AJ 1BOBA 3GFLA 2E1NA 4KUMA 4BKXA 3ZMTA 2LSOA 1TWHJ 3OWTA 1V54H 1YRNA 5IOYA 3BROA 2NVYJ 3HTUA 3CTAA 1XGMA 1QZYA 2PFBA 4P96A 3JREA 1VF9A 4JBAA 3ZPLA 2EIJH 1J59A 1W0TA 1X1AA 4UUSB 2LOOA 2Z2SB 4MTEA 4I98B 1IN4A 3QPSA 4Y7NJ 3MFKA 1B72B 4RGSA 1VQMI 4YFXF 3R4KA 3QRFF 4IQ4A 3EUHA 3BT9A 5F27A 1IGNA 3V7RA 2KRHA 4DZPA 3ZXSA 3S14J 3VYRB 4G6TB 4BAYA 5L3GA 5AONA 5D5WB 5KNLA 3A0HC 3R61A 5F1RA 2O6GE 2XPWA 1J09A 4M9SA 2CW8A 2DA3A 1LEAA 2X9DA 2NS7A 4HF0A 1U78A 2BY2A 3JRDA 3CDIA 3SEQA 1XD7A 2VQLA 3QU3A 2ELHA 5AIQA 5K5OA 4XONA 3CCMI 4CH7A 3G71I 2GOXB 1MBGA 4CCNA 1ZQ3P 2VBYA 3ZQIA 4OOIA 1YYVA 3CJTB 3RZOJ 2HI3A 2FBIA 1MMAA 1XN7A 1FOWA 2L9VA 2NNYA 3CMAI 5E8IA 3RQ4A 2F48A 2QSHX 1OISA 1XX5A 2QZ8A 3PFYA 3GTJJ 2KKOA 2R7ZJ 5A2QK 2D2WA 3FDYA 3HOYJ 2DOEA 5HODA 3I71A 4PGHA 3T8RA 4B43A 5IP7J 3C3WA 4BH9A 5E1ZB 2P6SA 4U88A 3B6AA 4XSXF 4BJTA 3L2QA 3LFUA 4ENNA 2JSCA 4A6DA 5JVTA 3JTGA 4A5NA 1I6XA 3DTIA 2VBWA 5LGUA 1QA6A 4PCQA 1ZG1A 2F4MB 1IDZA 1USSA 4GO1A 5EEHA 3KETA 1BN5A 5DM6F 1C0WA 2DA2A 1FJLA 2JN6A 3F21A 4ZYEA 3TO6A 2F5CA 3VOEA 4BQQA 3RTRA 2BW3B 2CFXA 2K3PA 2ICWG 4NC6A 4UUVA 3GTQJ 2IAIA 4CDGA 3I9V2 1SEUA 1USTA 3BJOA 1S9HA 2WB1A 1MBJA 4F91B 3GTLJ 3C2BA 4HOBA 4XOTA 3J7YJ 1ZRFA 3S17J 4Z2YA 2A6EF 1Y56A 2V4JC 2Z5UA 4LMYA 1X3WB 3F8FA 1P4WA 3H9JA 3ZQCA 1V5FA 3FXUA 1LVAA 3EYYA 3DU6A 4FT8A 2KIQA 3CC2I 5JVGF 2BY0A 1WJDA 5J3LA 1MBFA 3RYRA 1LEBA 3FM5A 1G8XA 5K7HA 3J80K 5FRNA 2M9HA 2DA6A 2FOKA 2WY7Q 1F43A 3ZMVA 2EV6A 4M9XA 1PJRA 1J9IA 4LG3A 3SFZA 3CCUI 2R7OA 3E6DA 3VPRA 3E3VA 2R5ZA 3CLQA 4C2UA 2LKXA 1LB2A 5IPAA 2IS6A 4NB5A 4KIBA 3CJRB 2GXGA 1V5EA 2QENA 3SQNA 4O3MA 2IS4A 3GCMA 3BZCA 3LA2A 3QWLA 2VODA 1MMGA 5DUIA 5DM7F 3COAC 1YJWI 2MC4A 2R5YA 3DPUA 5M5XJ 2FEZA 3JRGA 3LSRA 2WAFA 1IC8A 2Q2EB 1D1BA 3QP5A 2EILH 5LHHA 3A4CA 4NC7A 5BPIA 5H20A 2QKLB 1U3EM 4L18B 2MC3A 1EV7A 3MKWB 3HRMA 5D6FA 3FXRA 1R1VA 2HQNA 3SJMA 1FSHA 1WFXA 1FP1D 1YE9A 1BW5A 2E7XA 3SFIA 3CCVI 1B4AA 2XDVA 1SD7A 5K5QA 2LR8A 2L3DA 1BR4A 5H6RA 2HDWA 2ZXJA 3IC7A 4E7LA 2ESNA 4EJUA 3FF5A 2WV0A 4OAZA 3LQRA 1JHFA 2KFDA 1MBEA 3QODA 5J1UA 4FX4A 4A3BJ 2COMA 2ELJA 4MEYF 1MIJA 4LITA 3QYFA 4BY1J 3R0AA 2KRFA 1E3OC 2KIMA 3ZQLA 3AG1H 1BA5A 1LFPA 4RBOA 1AKHA 5KK1A 5CVIA 2W24A 3OMYA 2A69F 5D5UB 1FYMA 2O9LA 1SFEA 1F9NA 2O8KA 4ZJZA 1GXPA 2LNBA 3FXKA 3VSKA 1I5ZA 3KP5A 1TL8A 1D5YA 1W36D 1ETVA 3G6EI 4YELA 1BOAA 5FB2A 3HIFA 3BPVA 1FZPB 2M3AA 2W82A 4DBRA 3H36A 3QQAA 2H1LA 3WE3A 2Y2ZA 1Z1DA 2JQ7A 5B1BH 3ZMDA 3VYUB 1P9QC 3OYJA 3AG3H 2E1CA 1X1DA 2JA7J 3H0GJ 3WGGA 2K85A 5GAHJ 1ZG5A 4LJZF 1VQKI 3FHNA 4WXDA 1IXRC 2Y0SA 2HNHA 3WG7H 2YU3A 3ZQGA 1GXQA 2XHKA 1RI7A 1U5TC 4HSTA 4YEJA 1AHDP 4JX6A 2L2OA 4EGZA 2VKEA 1W7PB 3PM1A 2WWYA 4V2GA 2B0LA 4JYKA 3RPUA 4AYBA 2A61A 2GIZA 4X1EA 1XSXA 2CW7A 4M3DA 2GZWA 2K5CA 3O3KA 4LLNA 2JUCA 1EH8A 5FLMJ 3FHZA 2GA1A 4AIDA 1JUSA 4BEHB 2LYCA 5K7FA 1QVTA 2FUG2 4IF4A 3KFWX 4QPQA 2M0CA 2QQ8A 3CDLA 1EA3A 1ZGJA 4II2A 5IYDJ 1K78A 1OYYA 1XSVA 3QPLA 5EJCA 3M1CA 1VI0A 4XR6A 2ZNZA 3DFGA 1WZ2A 1A04A 2C6YA 4C30A 1XCVA 3OYAA 3QYBA 4M74A 3HDDA 4PJNA 2DO7A 5J4YA 2NVQJ 1V55H 1SFOJ 2EZHA 2O3FA 4BY7J 1FEXA 2MD0A 4G9YA 1Z77A 3LSKA 4FX0A 2LDUA 1OQYA 2W25A 1DGWY 2K7LA 2DI3A 3DEEA 3VODA 3L2RA 3GTPJ 5C3EJ 3A01A 3S1MJ 4CCJA 5F04A 3DBRB 5AIPA 2JRTA 4NBQA 4L9VA 3K7AJ 3X2QH 2P6TA 2VN2A 3TDZC 1T38A 2FU4A 4C3IJ 3MD2A 4ZZDA 2GA2A 3UR3C 3CCYA 4RLQA 3JRIA 5KHDA 2E5ZA 2FNPA 2DK8A 1FYKA 1Z7UA 4JK1X 4XRSA 1QRYA 4EGYA 4HZFA 2MSYA 4PJ0C 1LE8B 2RREA 3ERMA 2IGMA 4MLOA 4XKWA 3UNGC 1U8BA 1ZR4A 1K7AA 3K6GA 3ASNH 1IUFA 5LD2C 3P9CA 4A3KJ 1FT9A 1XG1A 3BR3A 3EDPA 3OYDA 3CC4I 3S2DJ 2ZBKA 4L5EA 5M3MJ 3TKYA 5DDGA 1P4XA 3DBHB 1A6QA 3FK7A 2PMHA 3EUKL 4F92B 1S29A 4XRSG 2BY3A 4HG2A 2R7DA 4A5MA 1ZLKA 2H8WA 2ISYA 3ABLH 2KDZA 3DU5A 1QU3A 2F5EA 4AUXA 4HW0A 1Z3XA 4RLFA 4CYCA 2X1CA 3Q5FA 3I59A 3ECHA 3JTHA 1JKRC 1APLC 2E60A 2XPVA 3DPLC 2GAUA 4RMNA 1T8IA 2VONA 1W1WE 1RR7A 3ASOH 4XRFA 1KU9A 5L3EA 1XB4A 3S8PA 1LVKA 1E0EA 2Z33A 4ZYDA 1FBUA 3U2RA 2RNJA 1KQ9A 2COBA 5E3OA 1H9TA 2JVGA 3JR9A 3P9IA 2Z9OA 2DFFA 2W85A 5CLSA 4S05A 1LDKB 1R36A 5K5RA 1OCZH 3TDUC 1WJEA 1ZAOA 2ZFWA 2MBFA 3JSPA 1N77A 1OMIA 3Q0WA 1IAWA 2FX0A 3DLAA 1Z91A 2LD5A 1J7KA 3HG9A 4FE7A 1VQ6I 2ZNYA 1DPRA 4WF2A 5GP9A 4M72A 1K79A 1KONA 4PDKA 5E8GA 5C44J 1ON2A 4A0YA 2QSFX 2XB0X 3L2WA 5J4VA 2QEXI 2RAEA 1JJ8C 2P7CB 1HA8A 3HRSA 1CQTA 5ED4A 1W4MA 3NRVA 1RZ4A 4NC8A 1K61A 1IN6A 1OCCH 3SHFA 1AA7A 1K6OA 5LLQA 4IHTA 3E7LA 2VB6A 3PL8A 4KDPA 1HSTA 2PMZN 3KLNA 3MVPA 4AD9A 4NQWB 4F93B 3O6BB 1WH5A 4PUSA 1MDMB 4Q48A 1OCOH 4YRVA 1BBYA 3HOSA 4DOZA 2NRAC 1HC8A 2XGEA 4AC0A 4W1UA 1DP7P 4WWCA 2E7WA 1QZEA 4LG0B 4S0HB 3IP4B 1ZHFA 2N8GA 3E6BA 2L9SA 1NK3P 4E7KA 3K0LA 3OL3A 2XGDA 4DQ2A 3OS0A 4UVAA 1P6RA 3K4JA 3BQZA 1D5VA 3KEOA 2ZMEA 4N9IA 1R71A 2V6CA 2TCTA 3WG9A 1MBHA 1SVMA 5E20A 1FTZA 2L54A 1I39A 1R00A 3DXJF 3GUDA 4EM2A 4MQVA 2V1DA 3LSMA 1MZBA 3KIOA 3V8KA 4L5IA 2FQ3A 2E71A 2AS5F 2JRMA 3WHCA 4BACA 2ZXWH 1WI3A 2CUFA 3HGGA 5GAEJ 1V3FA 3IKTA 5LHGA 2P5VA 1A6IA 1YITI 1J2XA 4MO7A 4A0XA 3MKYB 2PJRB 3G3ZA 1HW5A 5M5YJ 2VXZA 3FMQA 1X3UA 2EZKA 5JHUA 3ZOBA 2F4IA 2YSRA 3SZPA 2ID3A 5LFAA 3W2AA 2KIFA 2XRLA 2E36A 1OFCX 2AQFA 3GZ6A 1B59A 3QPHA 3DWLE 5CKTA 1YX5A 3KP7A 2M1BA 3HOTA 3FBNB 2VE9A 1SD6A 4RAGA 1SFKA 3WODF 2HOEA 4P1WA 4BUPA 5J8CA 2KL4A 3CMYA 3NARA 1GHCA 5HLHA 4IHWA 1HSJA 1SAUA 3OYHA 1WJBA 2DOFA 4R1HA 3S2HJ 2E2IJ 2KPMA 3K2AA 3TOBA 2Y69H 3WU2C 4IO9F 2CV1A 4KFCA 4HX7A 4ETSA 3LAJA 2VJ5A 4UUSA 1UMQA 3S3MA 1FTTA 1P4AA 4LIVA 2YUSA 2ZCWA 1E3HA 3LA7A 2WAEA 4EV0A 2DXIA 2IEKA 3A2KA 2P4WA 1RPWA 3V4GA 3RPUD 3OYEA 4LLGF 3TW6A 3WTVC 5E3NA 2P81A 4ENKA 3V8JA 2KJBA 3OIQA 4BDZA 1Z6RA 2QKMB 4HQEA 2IPQX 4O6JA 4AU7A 4I99C 4MHGA 2P5LC 5EGOA 2HQRA 3JRBA 1Z9CA 4JX4A 4RM3A 4E7JA 3KCCA 4AM3A 4CCOA 2L4AA 1QBJA 3V7CA 3OYLA 3OYIA 1DDNA 2CQNA 2DFIA 2QSGX 3H5NA 1OLTA 3D1NI 2XGXA 3S2WA 4M6YA 2VC1A 2CMPA 2K9LA 2K86A 3GLLA 3MQ0A 4LB6B 3QYEA 2IGNA 4BXUA 1I1GA 4XMYA 3D0SA 4BE0A 2BE5F 3GXOA 2HVQA 2CUZA 3KX2A 1CF7A 2B7EA 2PLYA 1JTYA 3WTXC 4R79A 1FYLA 4RB1A 3BR1A 3QAHA 2W7NA 3K1NA 1KU7A 1UCRA 3HOVJ 2W48A 5E18F 4I6ZA 2IW5A 1J75A 1R5HA 4N4OB 3K1PA 3MEXA 3HM5A 3ML6A 4MIMA 1LJ9A 3HSEA 4G6QA 2OC6A 1HBXG 3J81Z 3BCBA 2EV5A 5K1YA 1WHUA 4AVPA 2VKDA 5FKOA 3RQIA 2ZJQF 1JKQC 5DYMA 1POGA 2HR3A 2J5OA 4L9JA 2YPRA 2H1KA 2L9RA 3OV8A 5FFXA 1FOYA 1P2FA 4LK1F 1XGOA 4G7ZF 4MNUA 4F55A 2YR2A 1WPKA 3BDDA 1IRGA 4IQJA 1YJNI 1B8IA 1EF4A 2ZXIA 2PMUA 1FIAA 4OMYA 1TNTA 1H89C 2L9NA 2CGPA 4L5JA 2M5WA 5L3DA 4B09A 3GFIA 5LGTA 3CESA 3T1BA 1X1PA 1X1CA 5DD4A 4EATA 3OS1A 1N78A 3F6OA 2XSJC 4HEA2 1QGPA 2EV0A 5KAIC 3QOPA 2R7RA 4BE1A 4NHJA 2BHZA 1U5TB 1FIPA 3JRFA 1HKTA 4X0GA 3CDHA 4ZDOA 1OR7A 1K4TA 3QU6A 3P9KA 2E34A 4R8HA 5GPCA 4FETA 1OYWA 5CVVA 4TV7A 4XNFA 3LNQA 3D5SC 1T0FA 3GX4X 4QTRA 3TW7A 1MNMC 3PQJA 4FISA 2HU9A 2VJ4A 1JT6A 3LSTA 3PNTA 1XDUA 5ERIA 4YG2F 3GTMJ 5LGNA 2HYGD 4M71A 5F0FA 3I64A 5BOXA 4YIRX 4E7ZA 3JCUC 1KU2A 4CUGA 3CUQA 2EQRA 2Q2EA 1S6LA 2Y75A 1Z21A 3LQQA 1STZA 1U9NA 2EWNA 2HKXA 1NTCA 2DW4A 1S3JA 3ZP5A 4RGUA 2EIMH 5KVRA 4B3XA 1IRFA 3MZYA 3MZHA 3WTSC 3SZGA 4N4NB 2Y30A 3WTYC 3LSGA 3BJAA 2FBHA 5HDKA 4D1QA 2Q0OA 3ONQA 4BHBA 2CS3A 4ESFA 1TP4A 3G2BA 4HPQA 4I7HA 3T0YA 2CWEA 1GLNA 5IT9Z 2CUJA 3H3ZA 3O8GA 3OOPA 5HS7A 3FXJA 3WU1B 3HRTA 2WA0A 2MG4A 3H0DA 3MCZA 1TWFJ 4OAYA 5EG0A 1MH3A 2DA4A 1P92A 5DCMA 3OS2A 2P7VB 1W0UA 5GAGJ 2JJ7A 1TWCJ 1VFCA 1K6YA 2F6CA 3CZ6A 4I76A 3R60A 1T39A 2M30A 5C4JJ 5HDGA 1O57A 1GV2A 4XK4A 2LF7A 2V26A 1ZARA 1IV6A 2GXAA 1ERDA 2FQ4A 1YTYA 1U6GA 5E1XA 1X3ZB 5CQEA 2JMWA 2UXNA 3MMYB 2QQAA 1MMNA 4MFEA 5CVJA 1JKOC 2ZJ2A 1Y0NA 3IH2A 1SMYF 2HTSA 3H1CA 3JW4A 4EM1A 4RAYA 2PMZA 3SXYA 2HOAA 1EH7A 4YIFA 4A3MJ 5HDNA 2HOTA 6PAXA 4Q5SF 2WBMA 2H27A 1YRNB 3CP8A 1DQUA 2QVOA 2BV6A 2X6YA 3ELKA 4HV6A 2ZJRF 1G3TA 4XKCA 2I10A 2DK5A 2M0MA 3I58A 1A31A 4FTHA 3ZQQA 2VQGA 1O7LA 2BXYA 4XKVA 5TGTA 4JP0A 4WXCA 1XMXA 2R3SA 2E2JJ 3HTSB 3VWBA 1VQ8I 1IO2A 1XTAA 3HUGA 3LSPA 3REOA 3M8JA 4H0EA 1FBQA 2KHMA 3KEYA 5DCFA 2EFWA 4PJMA 3H5RA 4BJ5C 2W57A 1YI2I 4ZDPA 4GDFA 4B48A 2NXNB 4QSHA 5EEGA 3VB2A 1XS9A 2KZGA 2BHYA 3G1LA 1Y1WJ 3B73A 2MA3A 3C1DA 2PBIA 1IXCA 3TO9A 3ECOA 4HSRA 2HYFA 4XLAA 1FMWA 3ABTA 2L5QA 2LREA 1ZH5A 2VI6A 1NG7A 1BJAA 4HLXA 1ETOA 4IKFA 1N75A 2A3SA 4B1RA 2QBYA 3WTUC 4A3GJ 5CQGA 3U21A 2V6EA 4GGGA 3IL2A 1HCRA 4RS8A 1TT5B 4EM0B 2NVXJ 2ECCA 2XF7A 4IOCF 2LVSA 3K69A 5ILSA 2DQLA 4P5OA 1PUFA 2G0EA 2EB7A 2NNNA 5D4SA 4U87A 3A02A 3FMRA 1M1EB 2LY2A 4AIKA 1IG7A 2UXXA 1AU7A 3K4KA 1I27A 2IXSA 1JXSA 2Y0MA 2QYOA 3CQZJ 1RNLA 1TTYA 1W5CC 4JQFA 3L09A 3M07A 1H9GA 2FF4A 3OOUA 3OSGA 3BR2A 3FK6A 2J5PA 1IRZA 4FASD 1DUXC 3P5JA 2P5KA 3BZKA 4OMZA 2O8XA 5CJ9A 3HHGA 4PJJA 2LFBA 1YS6A 3WE2A 2FBKA 4M73A 2H94A 1D3YA 1TBXA 4ZC3A 1XDSA 1NHAA 1KA8A 3HB9A 4LK0F 1HOMA 1K83J 5BPDA 2JSPA 4HBLA 2R7QA 3KZYA 5J6XA 2ZB9A 4XLEA 2VBZA 4A3CJ 1R1TA 4OU0A 1B9NA 2FXAA 3KP4A 4XLFA 3AKZA 5FD6A 1TC3C 1F4KA 1FC3A 2HQ5A 3OR1C 4ZDLA 2ZC2A 4G8XA 4U0YA 2JPCA 5FLXK 2MW8A 2D1VA 4C2TA 3LOCA 1BW6A 2JZYA 2M34A 5IYBJ 4ESBA 1HDPA 3N97A 2X6WA 2RVCA 2Z99A 1S7EA 1FX7A 2OTLI 2HZTA 3L2UA 3QPTA 2VE8A 1VTNC 2FOWA 3F72A 3W2VA 4HNUA 2A6HF 1TQIA 2X1EA 1CGPA 3KPHA 4M6VA 4Y33A 2E1OA 4A3FJ 1W5TA 3W3CA 4BNCA 4QLCU 4E7IA 4RB2C 1GVDA 2R5YB 1JTXA 2X85A 2EFOA 2EIKH 2Q8KA 3Q3SA 1O3QA 1IUYA 1GUUA 4U7BA 5JR3A 3C2HA 4MEXF 4CA0A 5K7ZA 2X4HA 2JTVA 4RAFA 1UHSA 3WTWC 5ICGA 2XGCA 1D8KA 3KP6A 2JA2A 4B44A 2XVCA 2DJIA 4Y13A 2KJCA 4NNJA 2H6CA 3J81K 1W36C 5L3FA 4C9YA 2GM4A 4GRIA 1FPQA 2GOMA 1U2WA 4II3A 2O61A 1IN8A 1J0RA 2DFHA 5CVRA 3TP3A 1R4MB 4HA8A 4ENJA 1ODDA 1IN7A 1T33A
chains in the Genus database with same CATH topology
3RI4A 5LRSA 4GYGA 1FOKA 3B02A 1G3WA 1KU3A 1REPC 1MKMA 1MJ9A 1XMAA 4RAZA 1KYZA 5ICEA 2XAJA 4HV5A 4M6XA 1BIBA 5LRRA 5D4RA 4OIQF 4F7ZA 2GQQA 2DT5A 3LAPA 2EA4A 2LKPA 3O2PE 1JHHA 1TW3A 1E17A 1SMTA 4ENMA 5JI6A 4ESJA 4HLYA 1TQPA 5FD5A 3E6MA 3V7SA 1V4RA 2O0YA 3ERED 1MD0A 2V9VA 1OPCA 5IT9K 2DPUA 4U7DA 2RN7A 2VT3A 5TJJA 3E5QA 3T5XA 5ICFA 3C7JA 2XROA 2XAGA 2F5DA 4P9FA 3KLOA 1K78B 2OAZA 3EETA 1HW1A 4Q4ZF 2M87A 3ZMSA 5ILVA 2R7FA 3IWFA 4EJWA 1S8NA 3BOQA 2M45A 4BHCA 4I0AA 3ABUA 1H0MA 2H6BA 2HDCA 2PN6A 1B1BA 2GWRA 4LGWA 2Z3YA 2HEOA 1XMKA 5DEQA 4KT5C 1UHMA 2TDXA 5BQTA 1O3TA 4HDVA 4QWQA 1SAXA 2QUFA 4KYWA 1RUOA 1AOYA 3RYPA 3VEPA 5HVQC 2ESHA 4YFNF 1BI3A 2FA5A 2GXBA 1UFMA 3RKWA 4XLPF 1HKSA 2EFPA 4DNCA 5E1WA 5HLIA 1RIOH 3BWGA 2NS0A 1WWXA 3CJNA 5FGMA 1JE8A 3I59B 1G3SA 4KN7X 5ILUA 3FMSA 3K9TA 4RGRA 4CGZA 1AWCA 1OKRA 2RKHA 4I2OA 1YLFA 3C18A 3I53A 1R23A 1Q1HA 1BIAA 1KGSA 5E17F 1LNWA 2HWVA 1ON1A 3CO7C 3I4PA 1ZRDA 4N9HA 4CHUA 4HX8A 1LDDA 3TGNA 4ZH4F 2OZ6A 2DQRA 3W6KB 2ISZA 3TOAA 4LB5A 3WTZA 2XKPA 5IT3A 5LHIA 1IN5A 2HGCA 4RGXA 2PI0A 3F22A 2ZKZA 5HS8A 1U5TA 4M9ZA 3H92A 2RC4A 4A6EA 4XLNF 4EJOA 1R22A 4I0BA 1FP2A 5H6QA 2XRNA 4EMSA 3E97A 3GVAA 1YQAA 3J7AO 1WI9A 5BS6A 2H09A 2XIGA 3GEZA 2CG4A 1B9MA 1YW7A 3R6SA 3I5UA 3EYIA 1FNNA 2PJPA 2OQGA 1E2XA 1QQIA 2L01A 2JPBA 2MD5A 1S7AA 4ZZLA 1TQMA 5BMZA 4OINF 3GW2A 1TLHB 2IVMA 5J8FA 2ZO4A 2CW0F 2OD5A 1BI0A 2UZKA 4IHSA 3WU0A 3L00A 1ZRCA 1T2KA 1HXDA 3IWZA 2BBYA 1IW7F 4ZYHA 4KMUX 3F8MA 1L3LA 4IPAA 1FY7A 4HQMA 3M9AA 2K4JA 2GIVA 3GWZA 2Y48A 4HX4A 2M8EA 3RIRA 2QQBA 3DF8A 2FMYA 2VT2A 3JAMZ 2XKOA 1G6NA 2EFNA 2FNAA 3HSRA 1FLIA 2STWA 1TNSA 4HF2A 2AXLA 3BY6A 2EK5A 4EVIA 4IRHA 4A12A 1IZ1A 3PQKA 4CICA 1ULYA 1ZYRF 2FSWA 2PQ8A 3FXQA 4G6DA 3ZMZA 3CUOA 3LA3A 5HLGA 1KQ8A 2CYYA 4Q47A 3ZMUA 1D8JA 4WXHA 1IXSB 1I1SA 2V79A 2OU2A 1CF7B 4AIHA 1XGNA 2W84A 2IRFG 4OIRF 1LQ1A 3IRQA 1WKMA 1QNTA 2G7HA 3E5UA 1J5YA 2K02A 4K2EA 4KICA 3F8CA 2HKOA 1FBSA 2NYXA 2D1HA 3FX3A 3K1MA 3DKWA 2XAHA 3E6CC 4L9NA 2OQRA 1YW8A 3IHUA 3MAJA 3IRRA 4LFUA 5LEJA 2HFHA 1O7FA 2DAOA 4WX9A 3W6JB 3ZQ7A 4E70A 3N4MA 3F3XA 3RDIA 3GFMA 5DV5A 2MLGA 3DPTA 1YG2A 3BJ6A 4IXAA 1G3YA 2QLZA 3LWFA 4YFKF 2K4BA 4LD5A 1W7PA 5F64A 1QO0D 1L0OC 3ROUA 2QM3A 1SD5A 2V1XA 2D45A 3HYIA 3CUQB 4IVNA 3WGHA 2IA0A 1MGTA 2CO5A 2OZUA 2ACJA 4MQ9F 5DUKA 1FWZA 3CO6C 3Q9VA 5LEKA 5DD8A 4CO8A 4UV9A 2A07F 1IF1A 1Z05A 4RB0A 4AIJA 3F8BA 5DCMB 3EQLF 3MWMA 4I01A 3I54A 4U0VA 2L4MA 3RPQA 2DPDA 2EA2A 3M8EA 1U8RA 1WQ2A 2YX4A 3FWEA 2WTEA 1XGSA 3RKYA 4XSZF 4L0ZB 4KA4A 2QWWA 4P9UA 2VBXA 4YIIA 2QQ9A 4Y17A 1F5TA 3HRUA 3TQNA 1OYIA 3F8NA 3K2ZA 5HS9A 3ZN1A 4BHPA 3H3UA 1RUNA 2YX7A 2FMLA 2IJLA 1KYWA 1BI1A 4XBFA 4KNYA 1ONVA 4A0ZA 3U9GA 4FHTA 5HOOA 1YIOA 1QZZA 1YS7A 1JGSA 5FO5A 3L7WA 5ICCA 3FZVA 4L0YB 4G7HF 5FFZA 5D5XB 2QBYB 2CSOA 1XSDA 2HTJA 1FSEA 4IJAA 4HYEA 1BC8C 2FRHA 4O5VA 4MGRA 3VFZA 4WK8F 2EFQA 3KP3A 4BQAA 2IT0A 2XAQA 2OBPA 3JSOA 1UB9A 4A2UA 1YW9A 3ZN0A 4OIOF 4NQWA 3T8TA 3D5LA 1MDMA 3JAMK 4G94A 4LG0A 2DLLA 4KIGA 4IRIA 2VOPA 4UV8A 3DEUA 2F2EA 2RGVA 1GVJA 4GCVA 4RB3C 4UXNA 3GF2A 1R5GA 1BI2A 3V8LA 3L2CA 2BGCA 5D8KB 2DTRA 2DBBA 2XV4S 2ETHA 2XUBA 5D8LB 1PP7U 2MLKA 2LF8A 2RQPA 3F6VA 3M7GA 5A2QZ 3CUQC 2IP2A 2A5YB 4HDUA 1YFHA 3G73A 1F1ZA 3TO7A 1T6SA 3KEQA 1PP8F 5D6EA 1G4DA 3ISPA 2MH9A 4EJTA 3LFKA 5L3CA 1ZG3A 2PG4A 1BC7C 1DPUA 1HQCA 2VOOA 2DU9A 2K27A 1R7JA 2BEOA 4WCGA 2MH2A 3GYHX 1W7PD 1O3RA 4P55A 1R1UA 2IA2A 3I0TA 3FM3A 4UNOA 2O03A 1B6AA 4CXFA 3PFIA 4N0BA 2XAFA 3QP6A 3SZTA 2KIUA 1R58A 2EJRA 1ZLJA 3J80Z 3BPXA 4EQQA 2JT1A 1UHWA 3M1EA 4IRGA 4BYYA 3CLOA 2CQKA 3ULQB 4KN4X 2X0LA 5D5VB 2WC2A 2NAZA 3BP8A 1KQ0A 4L9TA 5L3BA 3AAFA 3DP7A 4UVBA 4ASNA 5LBQA 4CYDA 2P8TA 3NEUA 1SFXA 4Y15A 4I09A 3F23A 4D0PA 3R0JA 1TW2A 4CZZA 2G9WA 4KIFA 1Y0UA 3GLXA 3DQVC 1PUEE 4EJVA 4HF1A 3U1DA 2V1UA 3BZ6A 4GYIA 4I02A 1YO5C 2STTA 3RKXA 4KMFA 2ADUA 3GO5A 1XCBA 1O3SA 4G7OF 2BYVE 4ON0A 5CYVA 4HAMA 1QPMA 3WGIA 3HSFA 3Q9SA 5JFRA 3L9FA 1WRJA 1Z6TA 5F6FA 2FE3A 3KZZA 4U0WA 3KE2A 2XASA 3HHHA 4UHTA 3P7NA 2RDPA 4S04A 5FLXZ 3IKVA 1SFUA 4B8XA 4PGGA 2ZMEB 1WSUA 1T98A 3WTTC 1W5SA 4AWXB 1PDNC 1ZREA 2UWMA 1SD4A 5TRDA 2HS5A 2PEXA 3RJPA 2IA1A 2VC0A 3M8FA 1MJBA 4UVCA 4MTDA 4OIPF 3GFJA 3GZ5A 2G7UA 5CVUA 4LLLA 1ZN2A 2A68F 2L02A 4ZYGA 1EH6A 1HW2A 2RV8A 1ZGAA 1HKQA 2OA4A 1LDJA 2F5FA 1S7OA 3E5XA 4GXOA 4PZJA 1BM9A 3KP2A 1MJAA 3DV8A 3NQOA 3GFLA 2E1NA 4KUMA 3ZMTA 2LSOA 3BROA 3HTUA 3CTAA 1XGMA 1QZYA 2PFBA 4P96A 4JBAA 3ZPLA 1J59A 4MTEA 4I98B 1IN4A 3MFKA 4RGSA 4YFXF 3R4KA 3QRFF 3EUHA 3V7RA 4BAYA 5L3GA 5AONA 5D5WB 5F1RA 3R61A 2O6GE 4M9SA 1LEAA 4HF0A 1U78A 1XD7A 5K5OA 3QU3A 2ELHA 5AIQA 2VBYA 4OOIA 1YYVA 2FBIA 1XN7A 2NNYA 5E8IA 2QZ8A 2KKOA 5A2QK 2D2WA 3I71A 4PGHA 3T8RA 3C3WA 4BH9A 5E1ZB 2P6SA 4U88A 4XSXF 4ENNA 2JSCA 4A6DA 5JVTA 3JTGA 4A5NA 1I6XA 2VBWA 5LGUA 4PCQA 1ZG1A 1USSA 4GO1A 5EEHA 3KETA 1BN5A 1C0WA 3F21A 4ZYEA 3TO6A 2F5CA 3VOEA 3RTRA 2CFXA 4UUVA 4CDGA 1USTA 3BJOA 4HOBA 1ZRFA 4Z2YA 2A6EF 2Z5UA 4LMYA 3F8FA 1P4WA 3FXUA 1LVAA 3EYYA 4FT8A 3RYRA 1LEBA 3J80K 3FM5A 2FOKA 3ZMVA 2EV6A 4M9XA 1J9IA 3SFZA 3E6DA 3E3VA 1LB2A 4NB5A 4KIBA 2GXGA 2QENA 3SQNA 4O3MA 3LA2A 2VODA 5DUIA 3COAC 2FEZA 3QP5A 5LHHA 5BPIA 5H20A 1U3EM 4L18B 2MC3A 1EV7A 3HRMA 5D6FA 3FXRA 1R1VA 2HQNA 1FSHA 1FP1D 2E7XA 1B4AA 1SD7A 5K5QA 2L3DA 5H6RA 2ZXJA 3IC7A 2ESNA 4EJUA 3FF5A 2WV0A 3LQRA 1JHFA 4FX4A 2COMA 4MEYF 3R0AA 2KRFA 2KIMA 5KK1A 5CVIA 2W24A 2A69F 5D5UB 1FYMA 1SFEA 1F9NA 1GXPA 2LNBA 1I5ZA 3KP5A 1BOAA 5FB2A 3HIFA 3BPVA 1FZPB 3WE3A 1Z1DA 3ZMDA 2E1CA 3WGGA 1ZG5A 4LJZF 4WXDA 1IXRC 2YU3A 1GXQA 2XHKA 1RI7A 1U5TC 4EGZA 1W7PB 2WWYA 2B0LA 3RPUA 2A61A 1XSXA 2GZWA 3O3KA 4LLNA 1EH8A 3FHZA 2GA1A 4IF4A 3KFWX 1ZGJA 1K78A 1OYYA 1XSVA 2ZNZA 3DFGA 1A04A 2C6YA 1XCVA 4M74A 2DO7A 2O3FA 4G9YA 4FX0A 2LDUA 2W25A 2K7LA 2DI3A 3VODA 5AIPA 2JRTA 4L9VA 2P6TA 2VN2A 3TDZC 1T38A 2FU4A 4ZZDA 2GA2A 2FNPA 2DK8A 1FYKA 1Z7UA 4JK1X 4EGYA 4HZFA 1K7AA 3P9CA 1FT9A 3EDPA 2ZBKA 3TKYA 5DDGA 1P4XA 2PMHA 1S29A 2R7DA 4A5MA 1ZLKA 2ISYA 2F5EA 4HW0A 3Q5FA 3I59A 3ECHA 3JTHA 3DPLC 2GAUA 2VONA 4XRFA 1KU9A 5L3EA 1XB4A 2Z33A 4ZYDA 1FBUA 3U2RA 2RNJA 1KQ9A 1H9TA 3P9IA 2Z9OA 2W85A 5CLSA 4S05A 1LDKB 1R36A 5K5RA 3TDUC 1ZAOA 2ZFWA 3JSPA 2MBFA 1OMIA 1IAWA 1Z91A 1J7KA 2ZNYA 1DPRA 4WF2A 4M72A 1K79A 4PDKA 5E8GA 1ON2A 4A0YA 2P7CB 3HRSA 5ED4A 1W4MA 3NRVA 1RZ4A 1IN6A 3SHFA 1K6OA 5LLQA 4IHTA 4KDPA 1HSTA 3KLNA 4AD9A 3O6BB 1MDMB 4Q48A 1BBYA 3HOSA 2NRAC 1DP7P 4WWCA 2E7WA 4LG0B 1ZHFA 3E6BA 3K0LA 1D5VA 4DQ2A 4UVAA 1P6RA 3KEOA 2ZMEA 4N9IA 2V6CA 3WG9A 5E20A 2L54A 1R00A 3DXJF 3GUDA 4EM2A 4MQVA 2V1DA 1MZBA 3V8KA 4L5IA 2FQ3A 2AS5F 1V3FA 3IKTA 5LHGA 2P5VA 1J2XA 4A0XA 3G3ZA 1HW5A 2VXZA 3FMQA 1X3UA 5JHUA 2YSRA 3SZPA 2KIFA 3GZ6A 1B59A 3QPHA 3KP7A 2M1BA 3HOTA 2VE9A 1SD6A 3WODF 2HOEA 5J8CA 1GHCA 5HLHA 1HSJA 4R1HA 3TOBA 4KFCA 4HX7A 4ETSA 3LAJA 1P4AA 2ZCWA 3LA7A 4EV0A 2P4WA 3V4GA 4LLGF 3WTVC 4ENKA 3V8JA 2KJBA 1Z6RA 4HQEA 2IPQX 4O6JA 4MHGA 2P5LC 2HQRA 1Z9CA 3KCCA 2L4AA 1QBJA 3V7CA 1DDNA 2DFIA 2XGXA 3S2WA 4M6YA 2VC1A 2K86A 3MQ0A 4LB6B 4BXUA 1I1GA 3D0SA 2BE5F 3GXOA 1CF7A 2PLYA 3WTXC 4R79A 1FYLA 4RB1A 3QAHA 3K1NA 1KU7A 1UCRA 5E18F 2IW5A 1J75A 1R5HA 3K1PA 3MEXA 3ML6A 1LJ9A 3HSEA 4G6QA 1HBXG 3J81Z 2EV5A 5K1YA 4AVPA 5DYMA 2HR3A 2J5OA 4L9JA 2YPRA 5FFXA 3OV8A 1P2FA 4LK1F 1XGOA 4G7ZF 4MNUA 2YR2A 3BDDA 1IRGA 2PMUA 4OMYA 1TNTA 2CGPA 4L5JA 2M5WA 5L3DA 4B09A 3GFIA 5LGTA 3T1BA 5DD4A 3F6OA 1QGPA 2EV0A 3QOPA 4NHJA 1U5TB 1HKTA 3CDHA 1OR7A 3QU6A 3P9KA 4R8HA 1OYWA 5CVVA 4TV7A 1T0FA 3GX4X 3PQJA 3LSTA 4YG2F 1XDUA 5ERIA 5LGNA 2HYGD 4M71A 3I64A 5BOXA 1KU2A 3CUQA 2Q2EA 1S6LA 2Y75A 3LQQA 1STZA 2HKXA 2EWNA 2DW4A 1S3JA 3ZP5A 4RGUA 5KVRA 1IRFA 3MZYA 3MZHA 3WTSC 3WTYC 3BJAA 2FBHA 5HDKA 2Q0OA 4BHBA 4ESFA 4I7HA 3T0YA 2CWEA 5IT9Z 3H3ZA 3OOPA 5HS7A 3WU1B 3HRTA 3MCZA 1P92A 5DCMA 2P7VB 3R60A 1T39A 2M30A 5HDGA 1O57A 2LF7A 1ZARA 1YTYA 1U6GA 5E1XA 2UXNA 2QQAA 5CVJA 2ZJ2A 1SMYF 2HTSA 3JW4A 4EM1A 4RAYA 3SXYA 4YIFA 1EH7A 5HDNA 4Q5SF 6PAXA 2H27A 2QVOA 2BV6A 3ELKA 4HV6A 1G3TA 2DK5A 3I58A 1O7LA 4WXCA 2R3SA 3HTSB 3HUGA 3REOA 4H0EA 1FBQA 5DCFA 2EFWA 2W57A 5EEGA 3VB2A 3B73A 2MA3A 3C1DA 2PBIA 1IXCA 3TO9A 3ECOA 2HYFA 3ABTA 1ZH5A 1BJAA 4HLXA 2A3SA 2QBYA 3WTUC 4GGGA 3IL2A 4RS8A 4EM0B 3K69A 5ILSA 2DQLA 4P5OA 2EB7A 2NNNA 5D4SA 3FMRA 4AIKA 2UXXA 1I27A 1JXSA 2Y0MA 2QYOA 1RNLA 1TTYA 4JQFA 3L09A 1H9GA 2FF4A 2J5PA 1DUXC 2P5KA 4OMZA 2O8XA 5CJ9A 3HHGA 1YS6A 3WE2A 2FBKA 4M73A 2H94A 1D3YA 1TBXA 1XDSA 1NHAA 1KA8A 4LK0F 5BPDA 4HBLA 3KZYA 5J6XA 2VBZA 1R1TA 4OU0A 1B9NA 2FXAA 3KP4A 5FD6A 1F4KA 1FC3A 4G8XA 4U0YA 2JPCA 5FLXK 2D1VA 2JZYA 4ESBA 3N97A 2RVCA 2Z99A 1FX7A 2HZTA 3QPTA 2VE8A 1VTNC 3F72A 2A6HF 1TQIA 1CGPA 1W5TA 4BNCA 4QLCU 4RB2C 2EFOA 2Q8KA 1O3QA 1IUYA 4U7BA 5JR3A 4MEXF 2X4HA 2JTVA 3WTWC 5ICGA 1D8KA 3KP6A 2XVCA 4Y13A 2KJCA 2H6CA 3J81K 5L3FA 1FPQA 1U2WA 2O61A 1IN8A 1J0RA 5CVRA 4HA8A 4ENJA 1ODDA 1IN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RI4 A;  5LRS A;  4GYG A;  1FOK A;  3B02 A;  1G3W A;  1KU3 A;  1REP C;  1MKM A;  1MJ9 A;  1XMA A;  4RAZ A;  1KYZ A;  5ICE A;  2XAJ A;  4HV5 A;  4M6X A;  1BIB A;  5LRR A;  5D4R A;  4OIQ F;  4F7Z A;  2GQQ A;  2DT5 A;  3LAP A;  2EA4 A;  2LKP A;  3O2P E;  1JHH A;  1TW3 A;  1E17 A;  1SMT A;  4ENM A;  5JI6 A;  4ESJ A;  4HLY A;  1TQP A;  5FD5 A;  3E6M A;  3V7S A;  1V4R A;  2O0Y A;  3ERE D;  1MD0 A;  2V9V A;  1OPC A;  5IT9 K;  2DPU A;  4U7D A;  2RN7 A;  2VT3 A;  5TJJ A;  3E5Q A;  3T5X A;  5ICF A;  3C7J A;  2XRO A;  2XAG A;  2F5D A;  4P9F A;  3KLO A;  1K78 B;  2OAZ A;  3EET A;  1HW1 A;  4Q4Z F;  2M87 A;  3ZMS A;  5ILV A;  2R7F A;  3IWF A;  4EJW A;  1S8N A;  3BOQ A;  2M45 A;  4BHC A;  4I0A A;  3ABU A;  1H0M A;  2H6B A;  2HDC A;  2PN6 A;  1B1B A;  2GWR A;  4LGW A;  2Z3Y A;  2HEO A;  1XMK A;  5DEQ A;  4KT5 C;  1UHM A;  2TDX A;  5BQT A;  1O3T A;  4HDV A;  4QWQ A;  1SAX A;  2QUF A;  4KYW A;  1RUO A;  1AOY A;  3RYP A;  3VEP A;  5HVQ C;  2ESH A;  4YFN F;  1BI3 A;  2FA5 A;  2GXB A;  1UFM A;  3RKW A;  4XLP F;  1HKS A;  2EFP A;  4DNC A;  5E1W A;  5HLI A;  1RIO H;  3BWG A;  2NS0 A;  1WWX A;  3CJN A;  5FGM A;  1JE8 A;  3I59 B;  1G3S A;  4KN7 X;  5ILU A;  3FMS A;  3K9T A;  4RGR A;  4CGZ A;  1AWC A;  1OKR A;  2RKH A;  4I2O A;  1YLF A;  3C18 A;  3I53 A;  1R23 A;  1Q1H A;  1BIA A;  1KGS A;  5E17 F;  1LNW A;  2HWV A;  1ON1 A;  3CO7 C;  3I4P A;  1ZRD A;  4N9H A;  4CHU A;  4HX8 A;  1LDD A;  3TGN A;  4ZH4 F;  2OZ6 A;  2DQR A;  3W6K B;  2ISZ A;  3TOA A;  4LB5 A;  3WTZ A;  2XKP A;  5IT3 A;  5LHI A;  1IN5 A;  2HGC A;  4RGX A;  2PI0 A;  3F22 A;  2ZKZ A;  5HS8 A;  1U5T A;  4M9Z A;  3H92 A;  2RC4 A;  4A6E A;  4XLN F;  4EJO A;  1R22 A;  4I0B A;  1FP2 A;  5H6Q A;  2XRN A;  4EMS A;  3E97 A;  3GVA A;  1YQA A;  3J7A O;  1WI9 A;  5BS6 A;  2H09 A;  2XIG A;  3GEZ A;  2CG4 A;  1B9M A;  1YW7 A;  3R6S A;  3I5U A;  3EYI A;  1FNN A;  2PJP A;  2OQG A;  1E2X A;  1QQI A;  2L01 A;  2JPB A;  2MD5 A;  1S7A A;  4ZZL A;  1TQM A;  5BMZ A;  4OIN F;  3GW2 A;  1TLH B;  2IVM A;  5J8F A;  2ZO4 A;  2CW0 F;  2OD5 A;  1BI0 A;  2UZK A;  4IHS A;  3WU0 A;  3L00 A;  1ZRC A;  1T2K A;  1HXD A;  3IWZ A;  2BBY A;  1IW7 F;  4ZYH A;  4KMU X;  3F8M A;  1L3L A;  4IPA A;  1FY7 A;  4HQM A;  3M9A A;  2K4J A;  2GIV A;  3GWZ A;  2Y48 A;  4HX4 A;  2M8E A;  3RIR A;  2QQB A;  3DF8 A;  2FMY A;  2VT2 A;  3JAM Z;  2XKO A;  1G6N A;  2EFN A;  2FNA A;  3HSR A;  1FLI A;  2STW A;  1TNS A;  4HF2 A;  2AXL A;  3BY6 A;  2EK5 A;  4EVI A;  4IRH A;  4A12 A;  1IZ1 A;  3PQK A;  4CIC A;  1ULY A;  1ZYR F;  2FSW A;  2PQ8 A;  3FXQ A;  4G6D A;  3ZMZ A;  3CUO A;  3LA3 A;  5HLG A;  1KQ8 A;  2CYY A;  4Q47 A;  3ZMU A;  1D8J A;  4WXH A;  1IXS B;  1I1S A;  2V79 A;  2OU2 A;  1CF7 B;  4AIH A;  1XGN A;  2W84 A;  2IRF G;  4OIR F;  1LQ1 A;  3IRQ A;  1WKM A;  1QNT A;  2G7H A;  3E5U A;  1J5Y A;  2K02 A;  4K2E A;  4KIC A;  3F8C A;  2HKO A;  1FBS A;  2NYX A;  2D1H A;  3FX3 A;  3K1M A;  3DKW A;  2XAH A;  3E6C C;  4L9N A;  2OQR A;  1YW8 A;  3IHU A;  3MAJ A;  3IRR A;  4LFU A;  5LEJ A;  2HFH A;  1O7F A;  2DAO A;  4WX9 A;  3W6J B;  3ZQ7 A;  4E70 A;  3N4M A;  3F3X A;  3RDI A;  3GFM A;  5DV5 A;  2MLG A;  3DPT A;  1YG2 A;  3BJ6 A;  4IXA A;  1G3Y A;  2QLZ A;  3LWF A;  4YFK F;  2K4B A;  4LD5 A;  1W7P A;  5F64 A;  1QO0 D;  1L0O C;  3ROU A;  2QM3 A;  1SD5 A;  2V1X A;  2D45 A;  3HYI A;  3CUQ B;  4IVN A;  3WGH A;  2IA0 A;  1MGT A;  2CO5 A;  2OZU A;  2ACJ A;  4MQ9 F;  5DUK A;  1FWZ A;  3CO6 C;  3Q9V A;  5LEK A;  5DD8 A;  4CO8 A;  4UV9 A;  2A07 F;  1IF1 A;  1Z05 A;  4RB0 A;  4AIJ A;  3F8B A;  5DCM B;  3EQL F;  3MWM A;  4I01 A;  3I54 A;  4U0V A;  2L4M A;  3RPQ A;  2DPD A;  2EA2 A;  3M8E A;  1U8R A;  1WQ2 A;  2YX4 A;  3FWE A;  2WTE A;  1XGS A;  3RKY A;  4XSZ F;  4L0Z B;  4KA4 A;  2QWW A;  4P9U A;  2VBX A;  4YII A;  2QQ9 A;  4Y17 A;  1F5T A;  3HRU A;  3TQN A;  1OYI A;  3F8N A;  3K2Z A;  5HS9 A;  3ZN1 A;  4BHP A;  3H3U A;  1RUN A;  2YX7 A;  2FML A;  2IJL A;  1KYW A;  1BI1 A;  4XBF A;  4KNY A;  1ONV A;  4A0Z A;  3U9G A;  4FHT A;  5HOO A;  1YIO A;  1QZZ A;  1YS7 A;  1JGS A;  5FO5 A;  3L7W A;  5ICC A;  3FZV A;  4L0Y B;  4G7H F;  5FFZ A;  5D5X B;  2QBY B;  2CSO A;  1XSD A;  2HTJ A;  1FSE A;  4IJA A;  4HYE A;  1BC8 C;  2FRH A;  4O5V A;  4MGR A;  3VFZ A;  4WK8 F;  2EFQ A;  3KP3 A;  4BQA A;  2IT0 A;  2XAQ A;  2OBP A;  3JSO A;  1UB9 A;  4A2U A;  1YW9 A;  3ZN0 A;  4OIO F;  4NQW A;  3T8T A;  3D5L A;  1MDM A;  3JAM K;  4G94 A;  4LG0 A;  2DLL A;  4KIG A;  4IRI A;  2VOP A;  4UV8 A;  3DEU A;  2F2E A;  2RGV A;  1GVJ A;  4GCV A;  4RB3 C;  4UXN A;  3GF2 A;  1R5G A;  1BI2 A;  3V8L A;  3L2C A;  2BGC A;  5D8K B;  2DTR A;  2DBB A;  2XV4 S;  2ETH A;  2XUB A;  5D8L B;  1PP7 U;  2MLK A;  2LF8 A;  2RQP A;  3F6V A;  3M7G A;  5A2Q Z;  3CUQ C;  2IP2 A;  2A5Y B;  4HDU A;  1YFH A;  3G73 A;  1F1Z A;  3TO7 A;  1T6S A;  3KEQ A;  1PP8 F;  5D6E A;  1G4D A;  3ISP A;  2MH9 A;  4EJT A;  3LFK A;  5L3C A;  1ZG3 A;  2PG4 A;  1BC7 C;  1DPU A;  1HQC A;  2VOO A;  2DU9 A;  2K27 A;  1R7J A;  2BEO A;  4WCG A;  2MH2 A;  3GYH X;  1W7P D;  1O3R A;  4P55 A;  1R1U A;  2IA2 A;  3I0T A;  3FM3 A;  4UNO A;  2O03 A;  1B6A A;  4CXF A;  3PFI A;  4N0B A;  2XAF A;  3QP6 A;  3SZT A;  2KIU A;  1R58 A;  2EJR A;  1ZLJ A;  3J80 Z;  3BPX A;  4EQQ A;  2JT1 A;  1UHW A;  3M1E A;  4IRG A;  4BYY A;  3CLO A;  2CQK A;  3ULQ B;  4KN4 X;  2X0L A;  5D5V B;  2WC2 A;  2NAZ A;  3BP8 A;  1KQ0 A;  4L9T A;  5L3B A;  3AAF A;  3DP7 A;  4UVB A;  4ASN A;  5LBQ A;  4CYD A;  2P8T A;  3NEU A;  1SFX A;  4Y15 A;  4I09 A;  3F23 A;  4D0P A;  3R0J A;  1TW2 A;  4CZZ A;  2G9W A;  4KIF A;  1Y0U A;  3GLX A;  3DQV C;  1PUE E;  4EJV A;  4HF1 A;  3U1D A;  2V1U A;  3BZ6 A;  4GYI A;  4I02 A;  1YO5 C;  2STT A;  3RKX A;  4KMF A;  2ADU A;  3GO5 A;  1XCB A;  1O3S A;  4G7O F;  2BYV E;  4ON0 A;  5CYV A;  4HAM A;  1QPM A;  3WGI A;  3HSF A;  3Q9S A;  5JFR A;  3L9F A;  1WRJ A;  1Z6T A;  5F6F A;  2FE3 A;  3KZZ A;  4U0W A;  3KE2 A;  2XAS A;  3HHH A;  4UHT A;  3P7N A;  2RDP A;  4S04 A;  5FLX Z;  3IKV A;  1SFU A;  4B8X A;  4PGG A;  2ZME B;  1WSU A;  1T98 A;  3WTT C;  1W5S A;  4AWX B;  1PDN C;  1ZRE A;  2UWM A;  1SD4 A;  5TRD A;  2HS5 A;  2PEX A;  3RJP A;  2IA1 A;  2VC0 A;  3M8F A;  1MJB A;  4UVC A;  4MTD A;  4OIP F;  3GFJ A;  3GZ5 A;  2G7U A;  5CVU A;  4LLL A;  1ZN2 A;  2A68 F;  2L02 A;  4ZYG A;  1EH6 A;  1HW2 A;  2RV8 A;  1ZGA A;  1HKQ A;  2OA4 A;  1LDJ A;  2F5F A;  1S7O A;  3E5X A;  4GXO A;  4PZJ A;  1BM9 A;  3KP2 A;  1MJA A;  3DV8 A;  3NQO A;  3GFL A;  2E1N A;  4KUM A;  3ZMT A;  2LSO A;  3BRO A;  3HTU A;  3CTA A;  1XGM A;  1QZY A;  2PFB A;  4P96 A;  4JBA A;  3ZPL A;  1J59 A;  4MTE A;  4I98 B;  1IN4 A;  3MFK A;  4RGS A;  4YFX F;  3R4K A;  3QRF F;  3EUH A;  3V7R A;  4BAY A;  5L3G A;  5AON A;  5D5W B;  5F1R A;  3R61 A;  2O6G E;  4M9S A;  1LEA A;  4HF0 A;  1U78 A;  1XD7 A;  5K5O A;  3QU3 A;  2ELH A;  5AIQ A;  2VBY A;  4OOI A;  1YYV A;  2FBI A;  1XN7 A;  2NNY A;  5E8I A;  2QZ8 A;  2KKO A;  5A2Q K;  2D2W A;  3I71 A;  4PGH A;  3T8R A;  3C3W A;  4BH9 A;  5E1Z B;  2P6S A;  4U88 A;  4XSX F;  4ENN A;  2JSC A;  4A6D A;  5JVT A;  3JTG A;  4A5N A;  1I6X A;  2VBW A;  5LGU A;  4PCQ A;  1ZG1 A;  1USS A;  4GO1 A;  5EEH A;  3KET A;  1BN5 A;  1C0W A;  3F21 A;  4ZYE A;  3TO6 A;  2F5C A;  3VOE A;  3RTR A;  2CFX A;  4UUV A;  4CDG A;  1UST A;  3BJO A;  4HOB A;  1ZRF A;  4Z2Y A;  2A6E F;  2Z5U A;  4LMY A;  3F8F A;  1P4W A;  3FXU A;  1LVA A;  3EYY A;  4FT8 A;  3RYR A;  1LEB A;  3J80 K;  3FM5 A;  2FOK A;  3ZMV A;  2EV6 A;  4M9X A;  1J9I A;  3SFZ A;  3E6D A;  3E3V A;  1LB2 A;  4NB5 A;  4KIB A;  2GXG A;  2QEN A;  3SQN A;  4O3M A;  3LA2 A;  2VOD A;  5DUI A;  3COA C;  2FEZ A;  3QP5 A;  5LHH A;  5BPI A;  5H20 A;  1U3E M;  4L18 B;  2MC3 A;  1EV7 A;  3HRM A;  5D6F A;  3FXR A;  1R1V A;  2HQN A;  1FSH A;  1FP1 D;  2E7X A;  1B4A A;  1SD7 A;  5K5Q A;  2L3D A;  5H6R A;  2ZXJ A;  3IC7 A;  2ESN A;  4EJU A;  3FF5 A;  2WV0 A;  3LQR A;  1JHF A;  4FX4 A;  2COM A;  4MEY F;  3R0A A;  2KRF A;  2KIM A;  5KK1 A;  5CVI A;  2W24 A;  2A69 F;  5D5U B;  1FYM A;  1SFE A;  1F9N A;  1GXP A;  2LNB A;  1I5Z A;  3KP5 A;  1BOA A;  5FB2 A;  3HIF A;  3BPV A;  1FZP B;  3WE3 A;  1Z1D A;  3ZMD A;  2E1C A;  3WGG A;  1ZG5 A;  4LJZ F;  4WXD A;  1IXR C;  2YU3 A;  1GXQ A;  2XHK A;  1RI7 A;  1U5T C;  4EGZ A;  1W7P B;  2WWY A;  2B0L A;  3RPU A;  2A61 A;  1XSX A;  2GZW A;  3O3K A;  4LLN A;  1EH8 A;  3FHZ A;  2GA1 A;  4IF4 A;  3KFW X;  1ZGJ A;  1K78 A;  1OYY A;  1XSV A;  2ZNZ A;  3DFG A;  1A04 A;  2C6Y A;  1XCV A;  4M74 A;  2DO7 A;  2O3F A;  4G9Y A;  4FX0 A;  2LDU A;  2W25 A;  2K7L A;  2DI3 A;  3VOD A;  5AIP A;  2JRT A;  4L9V A;  2P6T A;  2VN2 A;  3TDZ C;  1T38 A;  2FU4 A;  4ZZD A;  2GA2 A;  2FNP A;  2DK8 A;  1FYK A;  1Z7U A;  4JK1 X;  4EGY A;  4HZF A;  1K7A A;  3P9C A;  1FT9 A;  3EDP A;  2ZBK A;  3TKY A;  5DDG A;  1P4X A;  2PMH A;  1S29 A;  2R7D A;  4A5M A;  1ZLK A;  2ISY A;  2F5E A;  4HW0 A;  3Q5F A;  3I59 A;  3ECH A;  3JTH A;  3DPL C;  2GAU A;  2VON A;  4XRF A;  1KU9 A;  5L3E A;  1XB4 A;  2Z33 A;  4ZYD A;  1FBU A;  3U2R A;  2RNJ A;  1KQ9 A;  1H9T A;  3P9I A;  2Z9O A;  2W85 A;  5CLS A;  4S05 A;  1LDK B;  1R36 A;  5K5R A;  3TDU C;  1ZAO A;  2ZFW A;  3JSP A;  2MBF A;  1OMI A;  1IAW A;  1Z91 A;  1J7K A;  2ZNY A;  1DPR A;  4WF2 A;  4M72 A;  1K79 A;  4PDK A;  5E8G A;  1ON2 A;  4A0Y A;  2P7C B;  3HRS A;  5ED4 A;  1W4M A;  3NRV A;  1RZ4 A;  1IN6 A;  3SHF A;  1K6O A;  5LLQ A;  4IHT A;  4KDP A;  1HST A;  3KLN A;  4AD9 A;  3O6B B;  1MDM B;  4Q48 A;  1BBY A;  3HOS A;  2NRA C;  1DP7 P;  4WWC A;  2E7W A;  4LG0 B;  1ZHF A;  3E6B A;  3K0L A;  1D5V A;  4DQ2 A;  4UVA A;  1P6R A;  3KEO A;  2ZME A;  4N9I A;  2V6C A;  3WG9 A;  5E20 A;  2L54 A;  1R00 A;  3DXJ F;  3GUD A;  4EM2 A;  4MQV A;  2V1D A;  1MZB A;  3V8K A;  4L5I A;  2FQ3 A;  2AS5 F;  1V3F A;  3IKT A;  5LHG A;  2P5V A;  1J2X A;  4A0X A;  3G3Z A;  1HW5 A;  2VXZ A;  3FMQ A;  1X3U A;  5JHU A;  2YSR A;  3SZP A;  2KIF A;  3GZ6 A;  1B59 A;  3QPH A;  3KP7 A;  2M1B A;  3HOT A;  2VE9 A;  1SD6 A;  3WOD F;  2HOE A;  5J8C A;  1GHC A;  5HLH A;  1HSJ A;  4R1H A;  3TOB A;  4KFC A;  4HX7 A;  4ETS A;  3LAJ A;  1P4A A;  2ZCW A;  3LA7 A;  4EV0 A;  2P4W A;  3V4G A;  4LLG F;  3WTV C;  4ENK A;  3V8J A;  2KJB A;  1Z6R A;  4HQE A;  2IPQ X;  4O6J A;  4MHG A;  2P5L C;  2HQR A;  1Z9C A;  3KCC A;  2L4A A;  1QBJ A;  3V7C A;  1DDN A;  2DFI A;  2XGX A;  3S2W A;  4M6Y A;  2VC1 A;  2K86 A;  3MQ0 A;  4LB6 B;  4BXU A;  1I1G A;  3D0S A;  2BE5 F;  3GXO A;  1CF7 A;  2PLY A;  3WTX C;  4R79 A;  1FYL A;  4RB1 A;  3QAH A;  3K1N A;  1KU7 A;  1UCR A;  5E18 F;  2IW5 A;  1J75 A;  1R5H A;  3K1P A;  3MEX A;  3ML6 A;  1LJ9 A;  3HSE A;  4G6Q A;  1HBX G;  3J81 Z;  2EV5 A;  5K1Y A;  4AVP A;  5DYM A;  2HR3 A;  2J5O A;  4L9J A;  2YPR A;  5FFX A;  3OV8 A;  1P2F A;  4LK1 F;  1XGO A;  4G7Z F;  4MNU A;  2YR2 A;  3BDD A;  1IRG A;  2PMU A;  4OMY A;  1TNT A;  2CGP A;  4L5J A;  2M5W A;  5L3D A;  4B09 A;  3GFI A;  5LGT A;  3T1B A;  5DD4 A;  3F6O A;  1QGP A;  2EV0 A;  3QOP A;  4NHJ A;  1U5T B;  1HKT A;  3CDH A;  1OR7 A;  3QU6 A;  3P9K A;  4R8H A;  1OYW A;  5CVV A;  4TV7 A;  1T0F A;  3GX4 X;  3PQJ A;  3LST A;  4YG2 F;  1XDU A;  5ERI A;  5LGN A;  2HYG D;  4M71 A;  3I64 A;  5BOX A;  1KU2 A;  3CUQ A;  2Q2E A;  1S6L A;  2Y75 A;  3LQQ A;  1STZ A;  2HKX A;  2EWN A;  2DW4 A;  1S3J A;  3ZP5 A;  4RGU A;  5KVR A;  1IRF A;  3MZY A;  3MZH A;  3WTS C;  3WTY C;  3BJA A;  2FBH A;  5HDK A;  2Q0O A;  4BHB A;  4ESF A;  4I7H A;  3T0Y A;  2CWE A;  5IT9 Z;  3H3Z A;  3OOP A;  5HS7 A;  3WU1 B;  3HRT A;  3MCZ A;  1P92 A;  5DCM A;  2P7V B;  3R60 A;  1T39 A;  2M30 A;  5HDG A;  1O57 A;  2LF7 A;  1ZAR A;  1YTY A;  1U6G A;  5E1X A;  2UXN A;  2QQA A;  5CVJ A;  2ZJ2 A;  1SMY F;  2HTS A;  3JW4 A;  4EM1 A;  4RAY A;  3SXY A;  4YIF A;  1EH7 A;  5HDN A;  4Q5S F;  6PAX A;  2H27 A;  2QVO A;  2BV6 A;  3ELK A;  4HV6 A;  1G3T A;  2DK5 A;  3I58 A;  1O7L A;  4WXC A;  2R3S A;  3HTS B;  3HUG A;  3REO A;  4H0E A;  1FBQ A;  5DCF A;  2EFW A;  2W57 A;  5EEG A;  3VB2 A;  3B73 A;  2MA3 A;  3C1D A;  2PBI A;  1IXC A;  3TO9 A;  3ECO A;  2HYF A;  3ABT A;  1ZH5 A;  1BJA A;  4HLX A;  2A3S A;  2QBY A;  3WTU C;  4GGG A;  3IL2 A;  4RS8 A;  4EM0 B;  3K69 A;  5ILS A;  2DQL A;  4P5O A;  2EB7 A;  2NNN A;  5D4S A;  3FMR A;  4AIK A;  2UXX A;  1I27 A;  1JXS A;  2Y0M A;  2QYO A;  1RNL A;  1TTY A;  4JQF A;  3L09 A;  1H9G A;  2FF4 A;  2J5P A;  1DUX C;  2P5K A;  4OMZ A;  2O8X A;  5CJ9 A;  3HHG A;  1YS6 A;  3WE2 A;  2FBK A;  4M73 A;  2H94 A;  1D3Y A;  1TBX A;  1XDS A;  1NHA A;  1KA8 A;  4LK0 F;  5BPD A;  4HBL A;  3KZY A;  5J6X A;  2VBZ A;  1R1T A;  4OU0 A;  1B9N A;  2FXA A;  3KP4 A;  5FD6 A;  1F4K A;  1FC3 A;  4G8X A;  4U0Y A;  2JPC A;  5FLX K;  2D1V A;  2JZY A;  4ESB A;  3N97 A;  2RVC A;  2Z99 A;  1FX7 A;  2HZT A;  3QPT A;  2VE8 A;  1VTN C;  3F72 A;  2A6H F;  1TQI A;  1CGP A;  1W5T A;  4BNC A;  4QLC U;  4RB2 C;  2EFO A;  2Q8K A;  1O3Q A;  1IUY A;  4U7B A;  5JR3 A;  4MEX F;  2X4H A;  2JTV A;  3WTW C;  5ICG A;  1D8K A;  3KP6 A;  2XVC A;  4Y13 A;  2KJC A;  2H6C A;  3J81 K;  5L3F A;  1FPQ A;  1U2W A;  2O61 A;  1IN8 A;  1J0R A;  5CVR A;  4HA8 A;  4ENJ A;  1ODD A;  1IN7 A; 
#chains in the Genus database with same CATH topology
 3RI4 A;  4Z6Y A;  1VQ7 I;  2VAS A;  5LRS A;  4GYG A;  3BLY A;  5J1R A;  1FOK A;  2PX9 A;  3B02 A;  1SAN A;  2OUM A;  1G3W A;  3HPG A;  1KU3 A;  1REP C;  1MKM A;  1MJ9 A;  3PJR A;  1OCR H;  1XMA A;  4RAZ A;  1KYZ A;  5ICE A;  1Z0X A;  2K9M A;  2XAJ A;  2QA4 I;  5FKK A;  1PYV A;  5EEA A;  2JWT A;  4HV5 A;  3VSL A;  1UAA A;  2K9N A;  4LOC A;  4M6X A;  1AKH B;  1BIB A;  3MZ8 A;  1I50 J;  4OWR B;  5LRR A;  1FMV A;  5D4R A;  2L7F P;  4OIQ F;  2VL8 A;  4EEF G;  1D0Z A;  4F7Z A;  4IHX A;  2UV1 A;  1DGR M;  2GQQ A;  2DT5 A;  2X6O A;  5EZG A;  3LAP A;  1T95 A;  2DMP A;  2EA4 A;  2LKP A;  1H8A C;  4XN3 A;  2KT0 A;  1YIJ I;  3O2P E;  3V42 A;  1JHH A;  1TW3 A;  1E17 A;  3EUH C;  1SMT A;  3BTC A;  4ENM A;  3H9Q A;  4DW6 A;  5JI6 A;  2Z16 A;  4ESJ A;  2CQX A;  4HLY A;  1TQP A;  2HXI A;  5FD5 A;  3OYB A;  3E6M A;  1MMS A;  3IH3 A;  3V7S A;  1V4R A;  1P7I A;  2O0Y A;  1TWA J;  3OY9 A;  1NH3 A;  3ERE D;  1H88 C;  1MD0 A;  2V9V A;  1OPC A;  5IT9 K;  1BR1 A;  4D5F A;  5IOZ A;  4U7D A;  2DPU A;  2RN7 A;  2VT3 A;  5TJJ A;  3E5Q A;  3T5X A;  2QF7 A;  5ICF A;  1RC9 A;  3C7J A;  2XRO A;  2XAG A;  5KCM A;  3Q0U A;  4CCL A;  2F5D A;  3KYD B;  2VIX A;  4KIT B;  4P9F A;  3KLO A;  1K78 B;  2OAZ A;  1WGX A;  2BOL A;  1DU0 A;  3RKQ A;  4RA2 A;  4LIU A;  1X2N A;  1VQP I;  2X6X A;  3DEW A;  3EET A;  1HW1 A;  4Q4Z F;  2M87 A;  3ZMS A;  5ILV A;  2R7F A;  3IWF A;  4PSW A;  5EYR A;  4EJW A;  4FQG A;  2DDA A;  1S8N A;  4ANJ A;  5EDN A;  5IP9 J;  2DA5 A;  3BOQ A;  2M45 A;  4BHC A;  4XLH A;  4I0A A;  4ZYA A;  3ABU A;  1H0M A;  2H6B A;  2HDC A;  5HNF A;  2PN6 A;  3BTI A;  3A01 B;  1B1B A;  2GWR A;  3PNV A;  1ETK A;  4LGW A;  2Z3Y A;  2HVR A;  2HEO A;  1XMK A;  5DEQ A;  4KT5 C;  1UHM A;  3DBL B;  3CME I;  4IZZ A;  1VND A;  2TDX A;  4M3E A;  5BQT A;  5H2F C;  3I3L A;  4J01 A;  3U1K A;  1DP3 A;  1O3T A;  4HDV A;  4QWQ A;  1MW7 A;  3UKG A;  1SAX A;  3J7A Y;  2QUF A;  1X4O A;  4KYW A;  1RUO A;  1AOY A;  4PJL A;  3RYP A;  3VEP A;  5EF6 A;  4DZJ A;  2NOG A;  2ESH A;  4PFP A;  4YFN F;  5HVQ C;  1G59 A;  1BI3 A;  2FA5 A;  2GXB A;  1UFM A;  3RKW A;  3ABM H;  3HPH A;  2KDO A;  4XLP F;  4NUB A;  4V2F A;  4XKB A;  1HKS A;  2EFP A;  4HRI A;  4DNC A;  4BGD A;  2DT6 A;  1ZR2 A;  2EBI A;  5E1W A;  5HLI A;  1RIO H;  3BWG A;  2HDD A;  1MNE A;  1N25 A;  4DYC A;  2NS0 A;  1WWX A;  1RKW A;  1I6H J;  1ETW A;  4CSW A;  4H4K C;  4A69 C;  3CJN A;  2VKH A;  3H5A A;  4CYC B;  5FGM A;  1JE8 A;  3I59 B;  1G3S A;  2OJE D;  3E0J B;  4Y3O A;  4F3Q A;  4KN7 X;  5ILU A;  2RQQ A;  4BDY A;  3FMS A;  3K9T A;  4RGR A;  3HOW J;  2BZT A;  4CGZ A;  1AWC A;  1OKR A;  2RKH A;  3HJE A;  4MFD A;  4I2O A;  3S3N A;  1YLF A;  3C18 A;  3I53 A;  1R23 A;  2JVH A;  3L1P A;  4FE4 A;  2LP0 A;  1Q1H A;  5B3S H;  1YHQ I;  1BIA A;  2LBF A;  4D7N A;  1KGS A;  2HXO A;  3ZGK A;  1NK2 P;  5E17 F;  3OR2 C;  1LNW A;  2HWV A;  1ON1 A;  1Y8Q B;  5J1Y A;  3CO7 C;  3PO3 J;  3I4P A;  1ZRD A;  1ZKG A;  4N9H A;  1WVR A;  1E3P A;  4CHU A;  5GPA A;  3MN2 A;  1MMD A;  4HX8 A;  1LDD A;  3TGN A;  3TP0 A;  4ZH4 F;  2OZ6 A;  1QPI A;  5J40 A;  2CU7 A;  4V19 K;  3FKI J;  4QPO A;  3TL4 X;  3M3Y J;  2DQR A;  3TMO A;  3W6K B;  1B72 A;  3WHB A;  2ISZ A;  1LFU P;  2I5U A;  3TOA A;  3I4M J;  3BTL A;  3PNY A;  4LB5 A;  3WTZ A;  2XKP A;  1R49 A;  5IT3 A;  1MND A;  3FIS A;  5LHI A;  1IN5 A;  3FXL A;  2HGC A;  1D0Y A;  4RGX A;  2K9S A;  2PI0 A;  3F22 A;  2ZKZ A;  3CCR I;  5HS8 A;  1U5T A;  4M9Z A;  3H92 A;  4M3B A;  3CC7 I;  3SDG A;  1GT0 C;  2RC4 A;  4A6E A;  4XLN F;  4EJO A;  1R22 A;  4I0B A;  4HNT A;  1FP2 A;  2R7T A;  2MFZ A;  3AL0 B;  1R5I D;  1ZTR A;  2FD5 A;  3BC8 A;  3LSI A;  5H6Q A;  4CCK A;  2XRN A;  4EMS A;  1JUM A;  3H35 A;  5B1A H;  5HLT A;  3E97 A;  1IJW C;  1I3Q J;  3GVA A;  3GZN B;  1YQA A;  3J7A O;  2QGU A;  1WI9 A;  5BS6 A;  2H09 A;  2XIG A;  2TRT A;  1JKP C;  3GEZ A;  2RNG A;  2DMN A;  2CG4 A;  2DA7 A;  1B9M A;  1VQN I;  1YW7 A;  3R6S A;  3I5U A;  3EYI A;  1FNN A;  2DTZ A;  2PJP A;  2OQG A;  1E2X A;  2EZI A;  2L7Z A;  1QQI A;  2L01 A;  3IAM 2;  2W4S A;  2Y0S N;  1PVE A;  1KZH A;  2JPB A;  2VJI A;  3FBI B;  5BNG A;  1VQL I;  4XIC A;  3DCF A;  2I8D A;  2MD5 A;  2E35 A;  1S7A A;  3DKY A;  4ZZL A;  1TQM A;  1X2M A;  4OIN F;  4BBR J;  4PK4 A;  5BMZ A;  3DKX A;  3GW2 A;  4DBQ A;  3LL7 A;  1TLH B;  2IVM A;  1LKX A;  3G4S I;  5J8F A;  2ZO4 A;  2CW0 F;  2OD5 A;  1Q1V A;  2Q1Z B;  4E4H A;  1BI0 A;  3OYN A;  2UZK A;  4UY8 I;  3BCA A;  4IHS A;  5KAF C;  1HF0 A;  3HL2 A;  2M4G A;  3WU0 A;  3L00 A;  1MH4 A;  1ZRC A;  2LRD A;  3CCL I;  2EH3 A;  1D1C A;  1T2K A;  2BW3 A;  1HXD A;  2H8R A;  3IWZ A;  5M5W J;  2DMU A;  2BBY A;  1IW7 F;  4ZYH A;  4KT6 A;  2V9K A;  4KMU X;  3F8M A;  2LTP A;  1L3L A;  3BR6 A;  5E3L A;  3KYC B;  4IPA A;  3ZQH A;  1FY7 A;  4HQM A;  4XOP A;  3M9A A;  2R7V A;  2WY8 Q;  5IYC J;  5JHF A;  2K4J A;  2GIV A;  3GWZ A;  4IL6 C;  2K3F A;  3D5R C;  3K70 D;  2Y48 A;  3LSJ A;  4HX4 A;  1BR2 A;  2A5W A;  1R4N B;  2M8E A;  3A1Y A;  3RIR A;  2QQB A;  4C2M J;  1EJ9 A;  3DF8 A;  2FMY A;  1IV8 A;  2BVM A;  2X1D A;  4E7H A;  2VT2 A;  3JAM Z;  5E79 C;  2XKO A;  1G6N A;  2EFN A;  2FNA A;  3HSR A;  2E2H J;  1VQO I;  1FLI A;  3OYK A;  2STW A;  1TNS A;  4HF2 A;  2HZD A;  2AXL A;  2F5V A;  5GTH C;  3BY6 A;  2EK5 A;  2L0K A;  2CUE A;  2DMQ A;  2M7B A;  2MAB A;  3BR0 A;  4EVI A;  2LKS A;  2KMU A;  3NWS A;  2JUG A;  4IRH A;  4A12 A;  3OIP A;  1ENH A;  2NVU B;  4BS9 A;  3E1S A;  1IZ1 A;  5EGO B;  1HLV A;  1TZL A;  3PQK A;  3ZRG A;  4CIC A;  1ULY A;  1ZYR F;  2IS1 A;  2FSW A;  2PQ8 A;  4JX5 A;  2R0Q C;  3FXQ A;  4DGW B;  2ZFU A;  1ACI A;  2EPF A;  4G6D A;  3ZMZ A;  4DIQ A;  3CUO A;  3LA3 A;  3VYS B;  5HLG A;  1KQ8 A;  3OYC A;  1JGG A;  2CYY A;  3K10 A;  3O8H A;  3N05 A;  4UUT A;  1BJZ A;  4B3A A;  4Q47 A;  3OYM A;  2FJ1 A;  3DLL F;  3ZMU A;  2GLO A;  1D8J A;  4WXH A;  1O4X A;  1IXS B;  1I1S A;  2CV2 A;  2V79 A;  1JUP A;  5J47 A;  1D1A A;  2OU2 A;  4KJZ A;  1CF7 B;  4AIH A;  4PSX A;  1XGN A;  2W84 A;  3BG9 A;  2IRF G;  4OIR F;  1LQ1 A;  3IRQ A;  1Y8R B;  1WKM A;  1T08 B;  5GTI C;  4RDU A;  2HPM A;  1QNT A;  1MSE C;  5JLX A;  1V5G A;  2G7H A;  3K70 C;  3E5U A;  3SEZ A;  1J5Y A;  2K02 A;  2MYS A;  4K2E A;  1Y6I A;  2KLO A;  3Q0V A;  3ZCO A;  4XQF A;  3TED A;  4BL0 B;  4KIC A;  2R92 J;  1WJ5 A;  3F8C A;  2HKO A;  1FBS A;  2NYX A;  3HEF A;  2D1H A;  3FX3 A;  2NOJ B;  2DOA A;  3K1M A;  3FKJ A;  2BVL A;  3DKW A;  5JLW A;  2XAH A;  3S3O A;  3E6C C;  4L9N A;  2OQR A;  2CQQ A;  2DOD A;  1YW8 A;  3IHU A;  3MAJ A;  3IRR A;  1YX3 A;  4LFU A;  2LG4 A;  5LEJ A;  2HFH A;  2A6T A;  1B8I B;  1O7F A;  4M3G A;  1YJ9 I;  2DAO A;  1ORK A;  4WX9 A;  2ECB A;  3W6J B;  3ZQ7 A;  3EPZ A;  3LMM A;  3NAU A;  4E70 A;  3N4M A;  3F3X A;  3RDI A;  3GFM A;  2WAQ N;  5DV5 A;  1IDY A;  2KZV A;  3F9K A;  3FXO A;  1DU6 A;  2ELK A;  4AVZ A;  2MLG A;  3DPT A;  2P0W A;  1YG2 A;  3BJ6 A;  2BY1 A;  4IXA A;  1Z7L A;  1G3Y A;  2LK2 A;  2QLZ A;  3LWF A;  5FKN A;  4YFK F;  2K4B A;  2JA6 J;  3ZR8 X;  4LD5 A;  4M3F A;  3HKZ N;  1W7P A;  5F64 A;  3S1R J;  5FLV A;  3CMM A;  3AL0 C;  1QO0 D;  1L0O C;  3ROU A;  2QM3 A;  2OV7 A;  2R7U A;  3IH4 A;  1SD5 A;  4A3J J;  2VKV A;  3PUF A;  3SYT A;  2DN0 A;  3VDX A;  5E3M A;  2V1X A;  4RM2 A;  2D45 A;  3JRH A;  3HYI A;  3CUQ B;  5EZH A;  4BEH A;  2DFE A;  3K4M A;  2KP6 A;  1ETQ A;  1RR8 C;  4IVN A;  3WGH A;  4IHY A;  4PFO A;  2E1M B;  2IA0 A;  2DDB A;  4B4C A;  2CV0 A;  1UG0 A;  2BXZ A;  1MGT A;  3AG4 H;  4XN0 A;  2AHQ A;  2ZME C;  2CO5 A;  1TWG J;  3H3V K;  2OZU A;  2ACJ A;  3IAS 2;  4MQ9 F;  2XF6 A;  5DUK A;  1FWZ A;  5F1J A;  4BU2 A;  2DA1 A;  1ZK8 A;  2E19 A;  3Q9V A;  3CO6 C;  5F0H A;  2IBD A;  5LEK A;  4A3D J;  5DD8 A;  4CO8 A;  2XC7 A;  4UV9 A;  3PO2 J;  3HOX J;  2A07 F;  1WCM J;  3K4B A;  1IF1 A;  1Z05 A;  2CQ7 A;  5EG0 B;  3BR5 A;  2LY1 A;  4RB0 A;  4BBS J;  4IEJ A;  2LLK A;  4AIJ A;  3F8B A;  4NDL A;  5DCM B;  3EQL F;  3MWM A;  4I01 A;  3I54 A;  4U0V A;  3CD6 I;  2L4M A;  3BG6 A;  3RPQ A;  1LFB A;  2DPD A;  2R4G A;  4J00 A;  2B9S A;  2EA2 A;  1D0X A;  2VQC A;  3M8E A;  1U8R A;  5FRO A;  2A05 A;  3AFH A;  4ZTJ A;  1WQ2 A;  2M7A A;  2YX4 A;  1LE8 A;  3FWE A;  1F36 A;  2WTE A;  1I3A A;  4IHV A;  1XGS A;  5B5E C;  3RKY A;  4XSZ F;  4L0Z B;  3FXM A;  4KA4 A;  3IUO A;  2QWW A;  4P9U A;  2VBX A;  2GBY A;  1QHG A;  2XAU A;  4YII A;  5DS9 A;  3S1N J;  2QQ9 A;  4UB6 C;  5F08 A;  2W00 A;  2L7M P;  1ITY A;  4Y17 A;  1F5T A;  2O5R A;  3HRU A;  3KYL A;  1IRX A;  2M4K A;  2AXT C;  2M8G X;  3TQN A;  2R5Z B;  1OYI A;  3F8N A;  3K2Z A;  5HS9 A;  3ZN1 A;  4BHP A;  2VLA A;  4A93 J;  3H3U A;  1RUN A;  1BL0 A;  2WV1 A;  2YX7 A;  2FML A;  2DCE A;  4XID A;  2IJL A;  2NVT J;  3HUG B;  1KYW A;  1BI1 A;  2HYJ A;  4XBF A;  4Y52 J;  4KNY A;  1ONV A;  4C3H J;  2Y31 A;  4A0Z A;  3U9G A;  3CJQ B;  4XL9 A;  2AQE A;  4FHT A;  4BQN A;  5HOO A;  1YIO A;  1QZZ A;  1YS7 A;  1JGS A;  1MSF C;  3OYG A;  2XB5 A;  2CRG A;  5FO5 A;  3L7W A;  5ICC A;  2Y9Z A;  3MKL A;  3FZV A;  4L0Y B;  2WAD A;  4G7H F;  2JA8 J;  5FFZ A;  5D5X B;  2QBY B;  3K4N A;  2CSO A;  1XSD A;  3S15 J;  3CF2 A;  2HTJ A;  1UEL B;  3DTE A;  1XC5 A;  2OTJ I;  1FSE A;  3QOE A;  4IJA A;  3L2V A;  2VXD A;  4HYE A;  1BC8 C;  2KIS A;  1PUF B;  2ZJP F;  2FRH A;  4O5V A;  4MGR A;  1UJ8 A;  3VFZ A;  4WK8 F;  2EFQ A;  1GV5 A;  3S32 A;  3C2G A;  2DYR H;  3KP3 A;  3GME A;  5C4X J;  4HNV A;  3K4L A;  4D5C A;  1NG6 A;  2XF5 A;  2HVS A;  4BXF A;  3B6C A;  1SVL A;  4BE2 A;  4BQA A;  2IT0 A;  2XAQ A;  2DYS H;  3A03 A;  2EIN H;  2OBP A;  4D7M A;  3JSO A;  1UB9 A;  4A2U A;  1YW9 A;  3ZN0 A;  4OIO F;  3OYF A;  4NQW A;  3T8T A;  3D5L A;  1MDM A;  1JT0 A;  2M2E A;  4BXX J;  2LMD A;  3JAM K;  4G94 A;  3FIW A;  3SDB A;  3ABK H;  3BG5 A;  2MGQ A;  3RCO A;  4LG0 A;  3G1M A;  2VQH A;  2DLL A;  1RKT A;  5FKL A;  4KIG A;  5IY5 H;  1T56 A;  4IRI A;  2VOP A;  4UV8 A;  4XRM A;  3DEU A;  2E5N A;  2ME0 A;  2F2E A;  2RGV A;  1GVJ A;  1Z3Y A;  1A5J A;  4GCV A;  5CPR B;  3S93 A;  2LY9 A;  4RB3 C;  4UXN A;  4JOM A;  3GF2 A;  2L7K A;  1SC7 A;  1R5G A;  1BI2 A;  3V8L A;  3L2C A;  1VQ9 I;  4XOR A;  1OR7 C;  2BGC A;  5D8K B;  5B66 C;  1YOV B;  1LUJ B;  2PJR A;  3GTG J;  2DTR A;  2DBB A;  2HQA A;  2XV4 S;  4BQO A;  2ETH A;  2XUB A;  5D8L B;  1T0F C;  2V1N A;  1PP7 U;  1LPQ A;  3NWT A;  3BTJ A;  4IOA F;  2MLK A;  3CCE I;  2LF8 A;  2RQP A;  3F6V A;  3PIP F;  3M7G A;  5GAD J;  5A2Q Z;  2VPR A;  3CUQ C;  2IP2 A;  2A5Y B;  4HDU A;  1YFH A;  3G73 A;  4BJ6 C;  1F1Z A;  2OCE A;  3TO7 A;  3S1Q J;  2JA5 J;  1T6S A;  1U0J A;  3KEQ A;  1PP8 F;  2E1M C;  2LH9 A;  2OCC H;  5D6E A;  2OF7 A;  1QHH D;  2W1O A;  1G4D A;  3ISP A;  2MH9 A;  4EJT A;  5F0C A;  3LFK A;  5L3C A;  1ZG3 A;  2PG4 A;  1BC7 C;  1DPU A;  1ETY A;  1OJL A;  3GTK J;  4W97 A;  3HZJ A;  3TBI A;  1HQC A;  4C3J J;  2B63 J;  2AO9 A;  1VQ4 I;  1UG2 A;  2R7S A;  1WJC A;  1Y39 A;  2DMT A;  5FJ8 J;  3M4O J;  2VOO A;  2DU9 A;  3PUB A;  2K27 A;  1R7J A;  3HBL A;  1RRJ A;  2BEO A;  4WCG A;  2MH2 A;  1RET A;  3GYH X;  1W7P D;  2WAQ A;  2XPU A;  3BG3 A;  4A3E J;  4P55 A;  4CCM A;  4ZTF A;  1ZGW A;  1O3R A;  1RES A;  1R1U A;  1VQ5 I;  2IA2 A;  4CZC A;  3RSN A;  3I0T A;  3I55 I;  3FM3 A;  4G12 A;  4UNO A;  2O03 A;  1B6A A;  4CXF A;  2WB1 N;  3PFI A;  4N0B A;  4XM3 A;  5TIS C;  2XAF A;  3QP6 A;  5FKM A;  3VYT B;  1R9T J;  2LC2 A;  3SZT A;  9ANT A;  2KIU A;  2K40 A;  1R58 A;  1JI8 A;  2EJR A;  4DJA A;  1ZLJ A;  5IP6 A;  1G2H A;  4FCY A;  3KZI C;  3J80 Z;  3BPX A;  3HKZ A;  4EQQ A;  4XLC A;  2JT1 A;  1UHW A;  3M1E A;  1A36 A;  1X1B A;  2XSD C;  1EKE A;  4IRG A;  4BYY A;  3CLO A;  2CQK A;  1WH7 A;  3ULQ B;  3CCJ I;  3J7Z I;  4KN4 X;  2X0L A;  4D9J A;  5D5V B;  4E7S A;  1S72 I;  2D5V A;  2WC2 A;  1ZEL A;  2KRC A;  2NAZ A;  3BP8 A;  2DT7 B;  3W2W A;  1KQ0 A;  4L9T A;  3EUA A;  3PIO F;  3HC7 A;  3H9G A;  5L3B A;  1QVU A;  3AAF A;  2ZXH A;  3DP7 A;  3G1O A;  4UVB A;  4ASN A;  2YS9 A;  1FOX A;  5LBQ A;  4CYD A;  3OIO A;  3GTO J;  3CCS I;  2P8T A;  3NEU A;  2ZSH B;  1SFX A;  2YU9 J;  2V9P A;  3MKZ A;  4Y15 A;  2QCO A;  4I09 A;  1R6R A;  3F23 A;  4D0P A;  3PSF A;  3R0J A;  1A35 A;  1TW2 A;  3CCQ I;  4J19 A;  4CZZ A;  2G9W A;  4KIF A;  1Y0U A;  3JRC A;  3GLX A;  1WJF A;  3DQV C;  3DTK A;  2Y9Y A;  1PUE E;  4EJV A;  3RZD J;  4HF1 A;  1Z67 A;  3U1D A;  2V1U A;  3BZ6 A;  3ZQF A;  2ID6 A;  2IGK A;  4GYI A;  3BQY A;  4I02 A;  2VUM J;  2X48 A;  1YO5 C;  2STT A;  3S16 J;  2UUZ A;  1OCP A;  3RKX A;  4KMF A;  2ADU A;  2ZSI B;  2K9Q A;  3GO5 A;  3K4C A;  1XCB A;  3CP2 A;  1S5L C;  1O3S A;  4G7O F;  2BYV E;  4ON0 A;  3BG7 A;  5CYV A;  4HAM A;  1XPX A;  1QPM A;  2ME6 A;  3WGI A;  2OPT A;  3JRA A;  1Y1V J;  3HSF A;  3Q9S A;  5DTD A;  4B47 A;  5JFR A;  3L9F A;  1WRJ A;  2IGO A;  3PSI A;  4ABZ A;  1TT0 A;  3F0C A;  1X58 A;  1MBK A;  3HOU J;  4F52 A;  1Z6T A;  5F6F A;  2FE3 A;  3KZZ A;  1P7J A;  5HNH A;  2R93 J;  4U0W A;  3KE2 A;  2XAS A;  3OSF A;  3HHH A;  4UHT A;  3P7N A;  2CFO A;  2RDP A;  4S04 A;  5FLX Z;  4KIS A;  3IKV A;  1SFU A;  4DYR A;  3I56 I;  1SVO A;  1GDT A;  2O7O A;  4B8X A;  4PGG A;  3W6V A;  2ZME B;  4IX7 A;  3CF5 F;  1WSU A;  1T98 A;  3WTT C;  1W5S A;  1X4P A;  2R7X A;  4UB8 C;  4QIW N;  2IS2 A;  4AWX B;  2HOS A;  3GBG A;  3LSH A;  1PDN C;  3HOZ J;  1ZRE A;  2CH0 A;  1JJ6 C;  2UWM A;  1SD4 A;  5TRD A;  2HS5 A;  2PEX A;  1U9O A;  4Y4R A;  3RJP A;  2IA1 A;  2Z1D A;  3OL4 A;  2VC0 A;  3M8F A;  1MJB A;  4GFB A;  4UVC A;  4MTD A;  4OIP F;  4A3L J;  3HXL A;  3GFJ A;  3GZ5 A;  4DYQ A;  2G7U A;  5CVU A;  1HDD C;  4LLL A;  1ZN2 A;  2A68 F;  2L02 A;  4AYB N;  3I4N J;  4ZYG A;  1WJA A;  5M3F J;  2VJJ A;  1EH6 A;  4E6K G;  2HPI A;  1HW2 A;  1UZC A;  4ITV A;  2DJN A;  5FRM A;  2CJJ A;  1ETX A;  2RV8 A;  2JK3 A;  3ESW B;  1ZGA A;  1HKQ A;  2OA4 A;  1K4S A;  2VPL A;  2X51 A;  1LDJ A;  2F5F A;  2EZL A;  1S7O A;  3A0B C;  1X19 A;  3E5X A;  1VZ0 A;  2F4O B;  3IV5 A;  2LBF B;  4GXO A;  2V7F A;  4PZJ A;  1BM9 A;  3AG2 H;  2R7W A;  3HGY A;  3KP2 A;  1MJA A;  1OCT C;  2KQR A;  3DV8 A;  2NS8 A;  3NQO A;  4A3I J;  4X6A J;  1BOB A;  3GFL A;  2E1N A;  4KUM A;  4BKX A;  3ZMT A;  2LSO A;  1TWH J;  3OWT A;  1V54 H;  1YRN A;  5IOY A;  3BRO A;  2NVY J;  3HTU A;  3CTA A;  1XGM A;  1QZY A;  2PFB A;  4P96 A;  3JRE A;  1VF9 A;  4JBA A;  3ZPL A;  2EIJ H;  1J59 A;  1W0T A;  1X1A A;  4UUS B;  2LOO A;  2Z2S B;  4MTE A;  4I98 B;  1IN4 A;  3QPS A;  4Y7N J;  3MFK A;  1B72 B;  4RGS A;  1VQM I;  4YFX F;  3R4K A;  3QRF F;  4IQ4 A;  3EUH A;  3BT9 A;  5F27 A;  1IGN A;  3V7R A;  2KRH A;  4DZP A;  3ZXS A;  3S14 J;  3VYR B;  4G6T B;  4BAY A;  5L3G A;  5AON A;  5D5W B;  5KNL A;  3A0H C;  3R61 A;  5F1R A;  2O6G E;  2XPW A;  1J09 A;  4M9S A;  2CW8 A;  2DA3 A;  1LEA A;  2X9D A;  2NS7 A;  4HF0 A;  1U78 A;  2BY2 A;  3JRD A;  3CDI A;  3SEQ A;  1XD7 A;  2VQL A;  3QU3 A;  2ELH A;  5AIQ A;  5K5O A;  4XON A;  3CCM I;  4CH7 A;  3G71 I;  2GOX B;  1MBG A;  4CCN A;  1ZQ3 P;  2VBY A;  3ZQI A;  4OOI A;  1YYV A;  3CJT B;  3RZO J;  2HI3 A;  2FBI A;  1MMA A;  1XN7 A;  1FOW A;  2L9V A;  2NNY A;  3CMA I;  5E8I A;  3RQ4 A;  2F48 A;  2QSH X;  1OIS A;  1XX5 A;  2QZ8 A;  3PFY A;  3GTJ J;  2KKO A;  2R7Z J;  5A2Q K;  2D2W A;  3FDY A;  3HOY J;  2DOE A;  5HOD A;  3I71 A;  4PGH A;  3T8R A;  4B43 A;  5IP7 J;  3C3W A;  4BH9 A;  5E1Z B;  2P6S A;  4U88 A;  3B6A A;  4XSX F;  4BJT A;  3L2Q A;  3LFU A;  4ENN A;  2JSC A;  4A6D A;  5JVT A;  3JTG A;  4A5N A;  1I6X A;  3DTI A;  2VBW A;  5LGU A;  1QA6 A;  4PCQ A;  1ZG1 A;  2F4M B;  1IDZ A;  1USS A;  4GO1 A;  5EEH A;  3KET A;  1BN5 A;  5DM6 F;  1C0W A;  2DA2 A;  1FJL A;  2JN6 A;  3F21 A;  4ZYE A;  3TO6 A;  2F5C A;  3VOE A;  4BQQ A;  3RTR A;  2BW3 B;  2CFX A;  2K3P A;  2ICW G;  4NC6 A;  4UUV A;  3GTQ J;  2IAI A;  4CDG A;  3I9V 2;  1SEU A;  1UST A;  3BJO A;  1S9H A;  2WB1 A;  1MBJ A;  4F91 B;  3GTL J;  3C2B A;  4HOB A;  4XOT A;  3J7Y J;  1ZRF A;  3S17 J;  4Z2Y A;  2A6E F;  1Y56 A;  2V4J C;  2Z5U A;  4LMY A;  1X3W B;  3F8F A;  1P4W A;  3H9J A;  3ZQC A;  1V5F A;  3FXU A;  1LVA A;  3EYY A;  3DU6 A;  4FT8 A;  2KIQ A;  3CC2 I;  5JVG F;  2BY0 A;  1WJD A;  5J3L A;  1MBF A;  3RYR A;  1LEB A;  3FM5 A;  1G8X A;  5K7H A;  3J80 K;  5FRN A;  2M9H A;  2DA6 A;  2FOK A;  2WY7 Q;  1F43 A;  3ZMV A;  2EV6 A;  4M9X A;  1PJR A;  1J9I A;  4LG3 A;  3SFZ A;  3CCU I;  2R7O A;  3E6D A;  3VPR A;  3E3V A;  2R5Z A;  3CLQ A;  4C2U A;  2LKX A;  1LB2 A;  5IPA A;  2IS6 A;  4NB5 A;  4KIB A;  3CJR B;  2GXG A;  1V5E A;  2QEN A;  3SQN A;  4O3M A;  2IS4 A;  3GCM A;  3BZC A;  3LA2 A;  3QWL A;  2VOD A;  1MMG A;  5DUI A;  5DM7 F;  3COA C;  1YJW I;  2MC4 A;  2R5Y A;  3DPU A;  5M5X J;  2FEZ A;  3JRG A;  3LSR A;  2WAF A;  1IC8 A;  2Q2E B;  1D1B A;  3QP5 A;  2EIL H;  5LHH A;  3A4C A;  4NC7 A;  5BPI A;  5H20 A;  2QKL B;  1U3E M;  4L18 B;  2MC3 A;  1EV7 A;  3MKW B;  3HRM A;  5D6F A;  3FXR A;  1R1V A;  2HQN A;  3SJM A;  1FSH A;  1WFX A;  1FP1 D;  1YE9 A;  1BW5 A;  2E7X A;  3SFI A;  3CCV I;  1B4A A;  2XDV A;  1SD7 A;  5K5Q A;  2LR8 A;  2L3D A;  1BR4 A;  5H6R A;  2HDW A;  2ZXJ A;  3IC7 A;  4E7L A;  2ESN A;  4EJU A;  3FF5 A;  2WV0 A;  4OAZ A;  3LQR A;  1JHF A;  2KFD A;  1MBE A;  3QOD A;  5J1U A;  4FX4 A;  4A3B J;  2COM A;  2ELJ A;  4MEY F;  1MIJ A;  4LIT A;  3QYF A;  4BY1 J;  3R0A A;  2KRF A;  1E3O C;  2KIM A;  3ZQL A;  3AG1 H;  1BA5 A;  1LFP A;  4RBO A;  1AKH A;  5KK1 A;  5CVI A;  2W24 A;  3OMY A;  2A69 F;  5D5U B;  1FYM A;  2O9L A;  1SFE A;  1F9N A;  2O8K A;  4ZJZ A;  1GXP A;  2LNB A;  3FXK A;  3VSK A;  1I5Z A;  3KP5 A;  1TL8 A;  1D5Y A;  1W36 D;  1ETV A;  3G6E I;  4YEL A;  1BOA A;  5FB2 A;  3HIF A;  3BPV A;  1FZP B;  2M3A A;  2W82 A;  4DBR A;  3H36 A;  3QQA A;  2H1L A;  3WE3 A;  2Y2Z A;  1Z1D A;  2JQ7 A;  5B1B H;  3ZMD A;  3VYU B;  1P9Q C;  3OYJ A;  3AG3 H;  2E1C A;  1X1D A;  2JA7 J;  3H0G J;  3WGG A;  2K85 A;  5GAH J;  1ZG5 A;  4LJZ F;  1VQK I;  3FHN A;  4WXD A;  1IXR C;  2Y0S A;  2HNH A;  3WG7 H;  2YU3 A;  3ZQG A;  1GXQ A;  2XHK A;  1RI7 A;  1U5T C;  4HST A;  4YEJ A;  1AHD P;  4JX6 A;  2L2O A;  4EGZ A;  2VKE A;  1W7P B;  3PM1 A;  2WWY A;  4V2G A;  2B0L A;  4JYK A;  3RPU A;  4AYB A;  2A61 A;  2GIZ A;  4X1E A;  1XSX A;  2CW7 A;  4M3D A;  2GZW A;  2K5C A;  3O3K A;  4LLN A;  2JUC A;  1EH8 A;  5FLM J;  3FHZ A;  2GA1 A;  4AID A;  1JUS A;  4BEH B;  2LYC A;  5K7F A;  1QVT A;  2FUG 2;  4IF4 A;  3KFW X;  4QPQ A;  2M0C A;  2QQ8 A;  3CDL A;  1EA3 A;  1ZGJ A;  4II2 A;  5IYD J;  1K78 A;  1OYY A;  1XSV A;  3QPL A;  5EJC A;  3M1C A;  1VI0 A;  4XR6 A;  2ZNZ A;  3DFG A;  1WZ2 A;  1A04 A;  2C6Y A;  4C30 A;  1XCV A;  3OYA A;  3QYB A;  4M74 A;  3HDD A;  4PJN A;  2DO7 A;  5J4Y A;  2NVQ J;  1V55 H;  1SFO J;  2EZH A;  2O3F A;  4BY7 J;  1FEX A;  2MD0 A;  4G9Y A;  1Z77 A;  3LSK A;  4FX0 A;  2LDU A;  1OQY A;  2W25 A;  1DGW Y;  2K7L A;  2DI3 A;  3DEE A;  3VOD A;  3L2R A;  3GTP J;  5C3E J;  3A01 A;  3S1M J;  4CCJ A;  5F04 A;  3DBR B;  5AIP A;  2JRT A;  4NBQ A;  4L9V A;  3K7A J;  3X2Q H;  2P6T A;  2VN2 A;  3TDZ C;  1T38 A;  2FU4 A;  4C3I J;  3MD2 A;  4ZZD A;  2GA2 A;  3UR3 C;  3CCY A;  4RLQ A;  3JRI A;  5KHD A;  2E5Z A;  2FNP A;  2DK8 A;  1FYK A;  1Z7U A;  4JK1 X;  4XRS A;  1QRY A;  4EGY A;  4HZF A;  2MSY A;  4PJ0 C;  1LE8 B;  2RRE A;  3ERM A;  2IGM A;  4MLO A;  4XKW A;  3UNG C;  1U8B A;  1ZR4 A;  1K7A A;  3K6G A;  3ASN H;  1IUF A;  5LD2 C;  3P9C A;  4A3K J;  1FT9 A;  1XG1 A;  3BR3 A;  3EDP A;  3OYD A;  3CC4 I;  3S2D J;  2ZBK A;  4L5E A;  5M3M J;  3TKY A;  5DDG A;  1P4X A;  3DBH B;  1A6Q A;  3FK7 A;  2PMH A;  3EUK L;  4F92 B;  1S29 A;  4XRS G;  2BY3 A;  4HG2 A;  2R7D A;  4A5M A;  1ZLK A;  2H8W A;  2ISY A;  3ABL H;  2KDZ A;  3DU5 A;  1QU3 A;  2F5E A;  4AUX A;  4HW0 A;  1Z3X A;  4RLF A;  4CYC A;  2X1C A;  3Q5F A;  3I59 A;  3ECH A;  3JTH A;  1JKR C;  1APL C;  2E60 A;  2XPV A;  3DPL C;  2GAU A;  4RMN A;  1T8I A;  2VON A;  1W1W E;  1RR7 A;  3ASO H;  4XRF A;  1KU9 A;  5L3E A;  1XB4 A;  3S8P A;  1LVK A;  1E0E A;  2Z33 A;  4ZYD A;  1FBU A;  3U2R A;  2RNJ A;  1KQ9 A;  2COB A;  5E3O A;  1H9T A;  2JVG A;  3JR9 A;  3P9I A;  2Z9O A;  2DFF A;  2W85 A;  5CLS A;  4S05 A;  1LDK B;  1R36 A;  5K5R A;  1OCZ H;  3TDU C;  1WJE A;  1ZAO A;  2ZFW A;  2MBF A;  3JSP A;  1N77 A;  1OMI A;  3Q0W A;  1IAW A;  2FX0 A;  3DLA A;  1Z91 A;  2LD5 A;  1J7K A;  3HG9 A;  4FE7 A;  1VQ6 I;  2ZNY A;  1DPR A;  4WF2 A;  5GP9 A;  4M72 A;  1K79 A;  1KON A;  4PDK A;  5E8G A;  5C44 J;  1ON2 A;  4A0Y A;  2QSF X;  2XB0 X;  3L2W A;  5J4V A;  2QEX I;  2RAE A;  1JJ8 C;  2P7C B;  1HA8 A;  3HRS A;  1CQT A;  5ED4 A;  1W4M A;  3NRV A;  1RZ4 A;  4NC8 A;  1K61 A;  1IN6 A;  1OCC H;  3SHF A;  1AA7 A;  1K6O A;  5LLQ A;  4IHT A;  3E7L A;  2VB6 A;  3PL8 A;  4KDP A;  1HST A;  2PMZ N;  3KLN A;  3MVP A;  4AD9 A;  4NQW B;  4F93 B;  3O6B B;  1WH5 A;  4PUS A;  1MDM B;  4Q48 A;  1OCO H;  4YRV A;  1BBY A;  3HOS A;  4DOZ A;  2NRA C;  1HC8 A;  2XGE A;  4AC0 A;  4W1U A;  1DP7 P;  4WWC A;  2E7W A;  1QZE A;  4LG0 B;  4S0H B;  3IP4 B;  1ZHF A;  2N8G A;  3E6B A;  2L9S A;  1NK3 P;  4E7K A;  3K0L A;  3OL3 A;  2XGD A;  4DQ2 A;  3OS0 A;  4UVA A;  1P6R A;  3K4J A;  3BQZ A;  1D5V A;  3KEO A;  2ZME A;  4N9I A;  1R71 A;  2V6C A;  2TCT A;  3WG9 A;  1MBH A;  1SVM A;  5E20 A;  1FTZ A;  2L54 A;  1I39 A;  1R00 A;  3DXJ F;  3GUD A;  4EM2 A;  4MQV A;  2V1D A;  3LSM A;  1MZB A;  3KIO A;  3V8K A;  4L5I A;  2FQ3 A;  2E71 A;  2AS5 F;  2JRM A;  3WHC A;  4BAC A;  2ZXW H;  1WI3 A;  2CUF A;  3HGG A;  5GAE J;  1V3F A;  3IKT A;  5LHG A;  2P5V A;  1A6I A;  1YIT I;  1J2X A;  4MO7 A;  4A0X A;  3MKY B;  2PJR B;  3G3Z A;  1HW5 A;  5M5Y J;  2VXZ A;  3FMQ A;  1X3U A;  2EZK A;  5JHU A;  3ZOB A;  2F4I A;  2YSR A;  3SZP A;  2ID3 A;  5LFA A;  3W2A A;  2KIF A;  2XRL A;  2E36 A;  1OFC X;  2AQF A;  3GZ6 A;  1B59 A;  3QPH A;  3DWL E;  5CKT A;  1YX5 A;  3KP7 A;  2M1B A;  3HOT A;  3FBN B;  2VE9 A;  1SD6 A;  4RAG A;  1SFK A;  3WOD F;  2HOE A;  4P1W A;  4BUP A;  5J8C A;  2KL4 A;  3CMY A;  3NAR A;  1GHC A;  5HLH A;  4IHW A;  1HSJ A;  1SAU A;  3OYH A;  1WJB A;  2DOF A;  4R1H A;  3S2H J;  2E2I J;  2KPM A;  3K2A A;  3TOB A;  2Y69 H;  3WU2 C;  4IO9 F;  2CV1 A;  4KFC A;  4HX7 A;  4ETS A;  3LAJ A;  2VJ5 A;  4UUS A;  1UMQ A;  3S3M A;  1FTT A;  1P4A A;  4LIV A;  2YUS A;  2ZCW A;  1E3H A;  3LA7 A;  2WAE A;  4EV0 A;  2DXI A;  2IEK A;  3A2K A;  2P4W A;  1RPW A;  3V4G A;  3RPU D;  3OYE A;  4LLG F;  3TW6 A;  3WTV C;  5E3N A;  2P81 A;  4ENK A;  3V8J A;  2KJB A;  3OIQ A;  4BDZ A;  1Z6R A;  2QKM B;  4HQE A;  2IPQ X;  4O6J A;  4AU7 A;  4I99 C;  4MHG A;  2P5L C;  5EGO A;  2HQR A;  3JRB A;  1Z9C A;  4JX4 A;  4RM3 A;  4E7J A;  3KCC A;  4AM3 A;  4CCO A;  2L4A A;  1QBJ A;  3V7C A;  3OYL A;  3OYI A;  1DDN A;  2CQN A;  2DFI A;  2QSG X;  3H5N A;  1OLT A;  3D1N I;  2XGX A;  3S2W A;  4M6Y A;  2VC1 A;  2CMP A;  2K9L A;  2K86 A;  3GLL A;  3MQ0 A;  4LB6 B;  3QYE A;  2IGN A;  4BXU A;  1I1G A;  4XMY A;  3D0S A;  4BE0 A;  2BE5 F;  3GXO A;  2HVQ A;  2CUZ A;  3KX2 A;  1CF7 A;  2B7E A;  2PLY A;  1JTY A;  3WTX C;  4R79 A;  1FYL A;  4RB1 A;  3BR1 A;  3QAH A;  2W7N A;  3K1N A;  1KU7 A;  1UCR A;  3HOV J;  2W48 A;  5E18 F;  4I6Z A;  2IW5 A;  1J75 A;  1R5H A;  4N4O B;  3K1P A;  3MEX A;  3HM5 A;  3ML6 A;  4MIM A;  1LJ9 A;  3HSE A;  4G6Q A;  2OC6 A;  1HBX G;  3J81 Z;  3BCB A;  2EV5 A;  5K1Y A;  1WHU A;  4AVP A;  2VKD A;  5FKO A;  3RQI A;  2ZJQ F;  1JKQ C;  5DYM A;  1POG A;  2HR3 A;  2J5O A;  4L9J A;  2YPR A;  2H1K A;  2L9R A;  3OV8 A;  5FFX A;  1FOY A;  1P2F A;  4LK1 F;  1XGO A;  4G7Z F;  4MNU A;  4F55 A;  2YR2 A;  1WPK A;  3BDD A;  1IRG A;  4IQJ A;  1YJN I;  1B8I A;  1EF4 A;  2ZXI A;  2PMU A;  1FIA A;  4OMY A;  1TNT A;  1H89 C;  2L9N A;  2CGP A;  4L5J A;  2M5W A;  5L3D A;  4B09 A;  3GFI A;  5LGT A;  3CES A;  3T1B A;  1X1P A;  1X1C A;  5DD4 A;  4EAT A;  3OS1 A;  1N78 A;  3F6O A;  2XSJ C;  4HEA 2;  1QGP A;  2EV0 A;  5KAI C;  3QOP A;  2R7R A;  4BE1 A;  4NHJ A;  2BHZ A;  1U5T B;  1FIP A;  3JRF A;  1HKT A;  4X0G A;  3CDH A;  4ZDO A;  1OR7 A;  1K4T A;  3QU6 A;  3P9K A;  2E34 A;  4R8H A;  5GPC A;  4FET A;  1OYW A;  5CVV A;  4TV7 A;  4XNF A;  3LNQ A;  3D5S C;  1T0F A;  3GX4 X;  4QTR A;  3TW7 A;  1MNM C;  3PQJ A;  4FIS A;  2HU9 A;  2VJ4 A;  1JT6 A;  3LST A;  3PNT A;  1XDU A;  5ERI A;  4YG2 F;  3GTM J;  5LGN A;  2HYG D;  4M71 A;  5F0F A;  3I64 A;  5BOX A;  4YIR X;  4E7Z A;  3JCU C;  1KU2 A;  4CUG A;  3CUQ A;  2EQR A;  2Q2E A;  1S6L A;  2Y75 A;  1Z21 A;  3LQQ A;  1STZ A;  1U9N A;  2EWN A;  2HKX A;  1NTC A;  2DW4 A;  1S3J A;  3ZP5 A;  4RGU A;  2EIM H;  5KVR A;  4B3X A;  1IRF A;  3MZY A;  3MZH A;  3WTS C;  3SZG A;  4N4N B;  2Y30 A;  3WTY C;  3LSG A;  3BJA A;  2FBH A;  5HDK A;  4D1Q A;  2Q0O A;  3ONQ A;  4BHB A;  2CS3 A;  4ESF A;  1TP4 A;  3G2B A;  4HPQ A;  4I7H A;  3T0Y A;  2CWE A;  1GLN A;  5IT9 Z;  2CUJ A;  3H3Z A;  3O8G A;  3OOP A;  5HS7 A;  3FXJ A;  3WU1 B;  3HRT A;  2WA0 A;  2MG4 A;  3H0D A;  3MCZ A;  1TWF J;  4OAY A;  5EG0 A;  1MH3 A;  2DA4 A;  1P92 A;  5DCM A;  3OS2 A;  2P7V B;  1W0U A;  5GAG J;  2JJ7 A;  1TWC J;  1VFC A;  1K6Y A;  2F6C A;  3CZ6 A;  4I76 A;  3R60 A;  1T39 A;  2M30 A;  5C4J J;  5HDG A;  1O57 A;  1GV2 A;  4XK4 A;  2LF7 A;  2V26 A;  1ZAR A;  1IV6 A;  2GXA A;  1ERD A;  2FQ4 A;  1YTY A;  1U6G A;  5E1X A;  1X3Z B;  5CQE A;  2JMW A;  2UXN A;  3MMY B;  2QQA A;  1MMN A;  4MFE A;  5CVJ A;  1JKO C;  2ZJ2 A;  1Y0N A;  3IH2 A;  1SMY F;  2HTS A;  3H1C A;  3JW4 A;  4EM1 A;  4RAY A;  2PMZ A;  3SXY A;  2HOA A;  1EH7 A;  4YIF A;  4A3M J;  5HDN A;  2HOT A;  6PAX A;  4Q5S F;  2WBM A;  2H27 A;  1YRN B;  3CP8 A;  1DQU A;  2QVO A;  2BV6 A;  2X6Y A;  3ELK A;  4HV6 A;  2ZJR F;  1G3T A;  4XKC A;  2I10 A;  2DK5 A;  2M0M A;  3I58 A;  1A31 A;  4FTH A;  3ZQQ A;  2VQG A;  1O7L A;  2BXY A;  4XKV A;  5TGT A;  4JP0 A;  4WXC A;  1XMX A;  2R3S A;  2E2J J;  3HTS B;  3VWB A;  1VQ8 I;  1IO2 A;  1XTA A;  3HUG A;  3LSP A;  3REO A;  3M8J A;  4H0E A;  1FBQ A;  2KHM A;  3KEY A;  5DCF A;  2EFW A;  4PJM A;  3H5R A;  4BJ5 C;  2W57 A;  1YI2 I;  4ZDP A;  4GDF A;  4B48 A;  2NXN B;  4QSH A;  5EEG A;  3VB2 A;  1XS9 A;  2KZG A;  2BHY A;  3G1L A;  1Y1W J;  3B73 A;  2MA3 A;  3C1D A;  2PBI A;  1IXC A;  3TO9 A;  3ECO A;  4HSR A;  2HYF A;  4XLA A;  1FMW A;  3ABT A;  2L5Q A;  2LRE A;  1ZH5 A;  2VI6 A;  1NG7 A;  1BJA A;  4HLX A;  1ETO A;  4IKF A;  1N75 A;  2A3S A;  4B1R A;  2QBY A;  3WTU C;  4A3G J;  5CQG A;  3U21 A;  2V6E A;  4GGG A;  3IL2 A;  1HCR A;  4RS8 A;  1TT5 B;  4EM0 B;  2NVX J;  2ECC A;  2XF7 A;  4IOC F;  2LVS A;  3K69 A;  5ILS A;  2DQL A;  4P5O A;  1PUF A;  2G0E A;  2EB7 A;  2NNN A;  5D4S A;  4U87 A;  3A02 A;  3FMR A;  1M1E B;  2LY2 A;  4AIK A;  1IG7 A;  2UXX A;  1AU7 A;  3K4K A;  1I27 A;  2IXS A;  1JXS A;  2Y0M A;  2QYO A;  3CQZ J;  1RNL A;  1TTY A;  1W5C C;  4JQF A;  3L09 A;  3M07 A;  1H9G A;  2FF4 A;  3OOU A;  3OSG A;  3BR2 A;  3FK6 A;  2J5P A;  1IRZ A;  4FAS D;  1DUX C;  3P5J A;  2P5K A;  3BZK A;  4OMZ A;  2O8X A;  5CJ9 A;  3HHG A;  4PJJ A;  2LFB A;  1YS6 A;  3WE2 A;  2FBK A;  4M73 A;  2H94 A;  1D3Y A;  1TBX A;  4ZC3 A;  1XDS A;  1NHA A;  1KA8 A;  3HB9 A;  4LK0 F;  1HOM A;  1K83 J;  5BPD A;  2JSP A;  4HBL A;  2R7Q A;  3KZY A;  5J6X A;  2ZB9 A;  4XLE A;  2VBZ A;  4A3C J;  1R1T A;  4OU0 A;  1B9N A;  2FXA A;  3KP4 A;  4XLF A;  3AKZ A;  5FD6 A;  1TC3 C;  1F4K A;  1FC3 A;  2HQ5 A;  3OR1 C;  4ZDL A;  2ZC2 A;  4G8X A;  4U0Y A;  2JPC A;  5FLX K;  2MW8 A;  2D1V A;  4C2T A;  3LOC A;  1BW6 A;  2JZY A;  2M34 A;  5IYB J;  4ESB A;  1HDP A;  3N97 A;  2X6W A;  2RVC A;  2Z99 A;  1S7E A;  1FX7 A;  2OTL I;  2HZT A;  3L2U A;  3QPT A;  2VE8 A;  1VTN C;  2FOW A;  3F72 A;  3W2V A;  4HNU A;  2A6H F;  1TQI A;  2X1E A;  1CGP A;  3KPH A;  4M6V A;  4Y33 A;  2E1O A;  4A3F J;  1W5T A;  3W3C A;  4BNC A;  4QLC U;  4E7I A;  4RB2 C;  1GVD A;  2R5Y B;  1JTX A;  2X85 A;  2EFO A;  2EIK H;  2Q8K A;  3Q3S A;  1O3Q A;  1IUY A;  1GUU A;  4U7B A;  5JR3 A;  3C2H A;  4MEX F;  4CA0 A;  5K7Z A;  2X4H A;  2JTV A;  4RAF A;  1UHS A;  3WTW C;  5ICG A;  2XGC A;  1D8K A;  3KP6 A;  2JA2 A;  4B44 A;  2XVC A;  2DJI A;  4Y13 A;  2KJC A;  4NNJ A;  2H6C A;  3J81 K;  1W36 C;  5L3F A;  4C9Y A;  2GM4 A;  4GRI A;  1FPQ A;  2GOM A;  1U2W A;  4II3 A;  2O61 A;  1IN8 A;  1J0R A;  2DFH A;  5CVR A;  3TP3 A;  1R4M B;  4HA8 A;  4ENJ A;  1ODD A;  1IN7 A;  1T33 A; 
#chains in the Genus database with same CATH homology
 3RI4 A;  5LRS A;  4GYG A;  1FOK A;  3B02 A;  1G3W A;  1KU3 A;  1REP C;  1MKM A;  1MJ9 A;  1XMA A;  4RAZ A;  1KYZ A;  5ICE A;  2XAJ A;  4HV5 A;  4M6X A;  1BIB A;  5LRR A;  5D4R A;  4OIQ F;  4F7Z A;  2GQQ A;  2DT5 A;  3LAP A;  2EA4 A;  2LKP A;  3O2P E;  1JHH A;  1TW3 A;  1E17 A;  1SMT A;  4ENM A;  5JI6 A;  4ESJ A;  4HLY A;  1TQP A;  5FD5 A;  3E6M A;  3V7S A;  1V4R A;  2O0Y A;  3ERE D;  1MD0 A;  2V9V A;  1OPC A;  5IT9 K;  2DPU A;  4U7D A;  2RN7 A;  2VT3 A;  5TJJ A;  3E5Q A;  3T5X A;  5ICF A;  3C7J A;  2XRO A;  2XAG A;  2F5D A;  4P9F A;  3KLO A;  1K78 B;  2OAZ A;  3EET A;  1HW1 A;  4Q4Z F;  2M87 A;  3ZMS A;  5ILV A;  2R7F A;  3IWF A;  4EJW A;  1S8N A;  3BOQ A;  2M45 A;  4BHC A;  4I0A A;  3ABU A;  1H0M A;  2H6B A;  2HDC A;  2PN6 A;  1B1B A;  2GWR A;  4LGW A;  2Z3Y A;  2HEO A;  1XMK A;  5DEQ A;  4KT5 C;  1UHM A;  2TDX A;  5BQT A;  1O3T A;  4HDV A;  4QWQ A;  1SAX A;  2QUF A;  4KYW A;  1RUO A;  1AOY A;  3RYP A;  3VEP A;  5HVQ C;  2ESH A;  4YFN F;  1BI3 A;  2FA5 A;  2GXB A;  1UFM A;  3RKW A;  4XLP F;  1HKS A;  2EFP A;  4DNC A;  5E1W A;  5HLI A;  1RIO H;  3BWG A;  2NS0 A;  1WWX A;  3CJN A;  5FGM A;  1JE8 A;  3I59 B;  1G3S A;  4KN7 X;  5ILU A;  3FMS A;  3K9T A;  4RGR A;  4CGZ A;  1AWC A;  1OKR A;  2RKH A;  4I2O A;  1YLF A;  3C18 A;  3I53 A;  1R23 A;  1Q1H A;  1BIA A;  1KGS A;  5E17 F;  1LNW A;  2HWV A;  1ON1 A;  3CO7 C;  3I4P A;  1ZRD A;  4N9H A;  4CHU A;  4HX8 A;  1LDD A;  3TGN A;  4ZH4 F;  2OZ6 A;  2DQR A;  3W6K B;  2ISZ A;  3TOA A;  4LB5 A;  3WTZ A;  2XKP A;  5IT3 A;  5LHI A;  1IN5 A;  2HGC A;  4RGX A;  2PI0 A;  3F22 A;  2ZKZ A;  5HS8 A;  1U5T A;  4M9Z A;  3H92 A;  2RC4 A;  4A6E A;  4XLN F;  4EJO A;  1R22 A;  4I0B A;  1FP2 A;  5H6Q A;  2XRN A;  4EMS A;  3E97 A;  3GVA A;  1YQA A;  3J7A O;  1WI9 A;  5BS6 A;  2H09 A;  2XIG A;  3GEZ A;  2CG4 A;  1B9M A;  1YW7 A;  3R6S A;  3I5U A;  3EYI A;  1FNN A;  2PJP A;  2OQG A;  1E2X A;  1QQI A;  2L01 A;  2JPB A;  2MD5 A;  1S7A A;  4ZZL A;  1TQM A;  5BMZ A;  4OIN F;  3GW2 A;  1TLH B;  2IVM A;  5J8F A;  2ZO4 A;  2CW0 F;  2OD5 A;  1BI0 A;  2UZK A;  4IHS A;  3WU0 A;  3L00 A;  1ZRC A;  1T2K A;  1HXD A;  3IWZ A;  2BBY A;  1IW7 F;  4ZYH A;  4KMU X;  3F8M A;  1L3L A;  4IPA A;  1FY7 A;  4HQM A;  3M9A A;  2K4J A;  2GIV A;  3GWZ A;  2Y48 A;  4HX4 A;  2M8E A;  3RIR A;  2QQB A;  3DF8 A;  2FMY A;  2VT2 A;  3JAM Z;  2XKO A;  1G6N A;  2EFN A;  2FNA A;  3HSR A;  1FLI A;  2STW A;  1TNS A;  4HF2 A;  2AXL A;  3BY6 A;  2EK5 A;  4EVI A;  4IRH A;  4A12 A;  1IZ1 A;  3PQK A;  4CIC A;  1ULY A;  1ZYR F;  2FSW A;  2PQ8 A;  3FXQ A;  4G6D A;  3ZMZ A;  3CUO A;  3LA3 A;  5HLG A;  1KQ8 A;  2CYY A;  4Q47 A;  3ZMU A;  1D8J A;  4WXH A;  1IXS B;  1I1S A;  2V79 A;  2OU2 A;  1CF7 B;  4AIH A;  1XGN A;  2W84 A;  2IRF G;  4OIR F;  1LQ1 A;  3IRQ A;  1WKM A;  1QNT A;  2G7H A;  3E5U A;  1J5Y A;  2K02 A;  4K2E A;  4KIC A;  3F8C A;  2HKO A;  1FBS A;  2NYX A;  2D1H A;  3FX3 A;  3K1M A;  3DKW A;  2XAH A;  3E6C C;  4L9N A;  2OQR A;  1YW8 A;  3IHU A;  3MAJ A;  3IRR A;  4LFU A;  5LEJ A;  2HFH A;  1O7F A;  2DAO A;  4WX9 A;  3W6J B;  3ZQ7 A;  4E70 A;  3N4M A;  3F3X A;  3RDI A;  3GFM A;  5DV5 A;  2MLG A;  3DPT A;  1YG2 A;  3BJ6 A;  4IXA A;  1G3Y A;  2QLZ A;  3LWF A;  4YFK F;  2K4B A;  4LD5 A;  1W7P A;  5F64 A;  1QO0 D;  1L0O C;  3ROU A;  2QM3 A;  1SD5 A;  2V1X A;  2D45 A;  3HYI A;  3CUQ B;  4IVN A;  3WGH A;  2IA0 A;  1MGT A;  2CO5 A;  2OZU A;  2ACJ A;  4MQ9 F;  5DUK A;  1FWZ A;  3CO6 C;  3Q9V A;  5LEK A;  5DD8 A;  4CO8 A;  4UV9 A;  2A07 F;  1IF1 A;  1Z05 A;  4RB0 A;  4AIJ A;  3F8B A;  5DCM B;  3EQL F;  3MWM A;  4I01 A;  3I54 A;  4U0V A;  2L4M A;  3RPQ A;  2DPD A;  2EA2 A;  3M8E A;  1U8R A;  1WQ2 A;  2YX4 A;  3FWE A;  2WTE A;  1XGS A;  3RKY A;  4XSZ F;  4L0Z B;  4KA4 A;  2QWW A;  4P9U A;  2VBX A;  4YII A;  2QQ9 A;  4Y17 A;  1F5T A;  3HRU A;  3TQN A;  1OYI A;  3F8N A;  3K2Z A;  5HS9 A;  3ZN1 A;  4BHP A;  3H3U A;  1RUN A;  2YX7 A;  2FML A;  2IJL A;  1KYW A;  1BI1 A;  4XBF A;  4KNY A;  1ONV A;  4A0Z A;  3U9G A;  4FHT A;  5HOO A;  1YIO A;  1QZZ A;  1YS7 A;  1JGS A;  5FO5 A;  3L7W A;  5ICC A;  3FZV A;  4L0Y B;  4G7H F;  5FFZ A;  5D5X B;  2QBY B;  2CSO A;  1XSD A;  2HTJ A;  1FSE A;  4IJA A;  4HYE A;  1BC8 C;  2FRH A;  4O5V A;  4MGR A;  3VFZ A;  4WK8 F;  2EFQ A;  3KP3 A;  4BQA A;  2IT0 A;  2XAQ A;  2OBP A;  3JSO A;  1UB9 A;  4A2U A;  1YW9 A;  3ZN0 A;  4OIO F;  4NQW A;  3T8T A;  3D5L A;  1MDM A;  3JAM K;  4G94 A;  4LG0 A;  2DLL A;  4KIG A;  4IRI A;  2VOP A;  4UV8 A;  3DEU A;  2F2E A;  2RGV A;  1GVJ A;  4GCV A;  4RB3 C;  4UXN A;  3GF2 A;  1R5G A;  1BI2 A;  3V8L A;  3L2C A;  2BGC A;  5D8K B;  2DTR A;  2DBB A;  2XV4 S;  2ETH A;  2XUB A;  5D8L B;  1PP7 U;  2MLK A;  2LF8 A;  2RQP A;  3F6V A;  3M7G A;  5A2Q Z;  3CUQ C;  2IP2 A;  2A5Y B;  4HDU A;  1YFH A;  3G73 A;  1F1Z A;  3TO7 A;  1T6S A;  3KEQ A;  1PP8 F;  5D6E A;  1G4D A;  3ISP A;  2MH9 A;  4EJT A;  3LFK A;  5L3C A;  1ZG3 A;  2PG4 A;  1BC7 C;  1DPU A;  1HQC A;  2VOO A;  2DU9 A;  2K27 A;  1R7J A;  2BEO A;  4WCG A;  2MH2 A;  3GYH X;  1W7P D;  1O3R A;  4P55 A;  1R1U A;  2IA2 A;  3I0T A;  3FM3 A;  4UNO A;  2O03 A;  1B6A A;  4CXF A;  3PFI A;  4N0B A;  2XAF A;  3QP6 A;  3SZT A;  2KIU A;  1R58 A;  2EJR A;  1ZLJ A;  3J80 Z;  3BPX A;  4EQQ A;  2JT1 A;  1UHW A;  3M1E A;  4IRG A;  4BYY A;  3CLO A;  2CQK A;  3ULQ B;  4KN4 X;  2X0L A;  5D5V B;  2WC2 A;  2NAZ A;  3BP8 A;  1KQ0 A;  4L9T A;  5L3B A;  3AAF A;  3DP7 A;  4UVB A;  4ASN A;  5LBQ A;  4CYD A;  2P8T A;  3NEU A;  1SFX A;  4Y15 A;  4I09 A;  3F23 A;  4D0P A;  3R0J A;  1TW2 A;  4CZZ A;  2G9W A;  4KIF A;  1Y0U A;  3GLX A;  3DQV C;  1PUE E;  4EJV A;  4HF1 A;  3U1D A;  2V1U A;  3BZ6 A;  4GYI A;  4I02 A;  1YO5 C;  2STT A;  3RKX A;  4KMF A;  2ADU A;  3GO5 A;  1XCB A;  1O3S A;  4G7O F;  2BYV E;  4ON0 A;  5CYV A;  4HAM A;  1QPM A;  3WGI A;  3HSF A;  3Q9S A;  5JFR A;  3L9F A;  1WRJ A;  1Z6T A;  5F6F A;  2FE3 A;  3KZZ A;  4U0W A;  3KE2 A;  2XAS A;  3HHH A;  4UHT A;  3P7N A;  2RDP A;  4S04 A;  5FLX Z;  3IKV A;  1SFU A;  4B8X A;  4PGG A;  2ZME B;  1WSU A;  1T98 A;  3WTT C;  1W5S A;  4AWX B;  1PDN C;  1ZRE A;  2UWM A;  1SD4 A;  5TRD A;  2HS5 A;  2PEX A;  3RJP A;  2IA1 A;  2VC0 A;  3M8F A;  1MJB A;  4UVC A;  4MTD A;  4OIP F;  3GFJ A;  3GZ5 A;  2G7U A;  5CVU A;  4LLL A;  1ZN2 A;  2A68 F;  2L02 A;  4ZYG A;  1EH6 A;  1HW2 A;  2RV8 A;  1ZGA A;  1HKQ A;  2OA4 A;  1LDJ A;  2F5F A;  1S7O A;  3E5X A;  4GXO A;  4PZJ A;  1BM9 A;  3KP2 A;  1MJA A;  3DV8 A;  3NQO A;  3GFL A;  2E1N A;  4KUM A;  3ZMT A;  2LSO A;  3BRO A;  3HTU A;  3CTA A;  1XGM A;  1QZY A;  2PFB A;  4P96 A;  4JBA A;  3ZPL A;  1J59 A;  4MTE A;  4I98 B;  1IN4 A;  3MFK A;  4RGS A;  4YFX F;  3R4K A;  3QRF F;  3EUH A;  3V7R A;  4BAY A;  5L3G A;  5AON A;  5D5W B;  5F1R A;  3R61 A;  2O6G E;  4M9S A;  1LEA A;  4HF0 A;  1U78 A;  1XD7 A;  5K5O A;  3QU3 A;  2ELH A;  5AIQ A;  2VBY A;  4OOI A;  1YYV A;  2FBI A;  1XN7 A;  2NNY A;  5E8I A;  2QZ8 A;  2KKO A;  5A2Q K;  2D2W A;  3I71 A;  4PGH A;  3T8R A;  3C3W A;  4BH9 A;  5E1Z B;  2P6S A;  4U88 A;  4XSX F;  4ENN A;  2JSC A;  4A6D A;  5JVT A;  3JTG A;  4A5N A;  1I6X A;  2VBW A;  5LGU A;  4PCQ A;  1ZG1 A;  1USS A;  4GO1 A;  5EEH A;  3KET A;  1BN5 A;  1C0W A;  3F21 A;  4ZYE A;  3TO6 A;  2F5C A;  3VOE A;  3RTR A;  2CFX A;  4UUV A;  4CDG A;  1UST A;  3BJO A;  4HOB A;  1ZRF A;  4Z2Y A;  2A6E F;  2Z5U A;  4LMY A;  3F8F A;  1P4W A;  3FXU A;  1LVA A;  3EYY A;  4FT8 A;  3RYR A;  1LEB A;  3J80 K;  3FM5 A;  2FOK A;  3ZMV A;  2EV6 A;  4M9X A;  1J9I A;  3SFZ A;  3E6D A;  3E3V A;  1LB2 A;  4NB5 A;  4KIB A;  2GXG A;  2QEN A;  3SQN A;  4O3M A;  3LA2 A;  2VOD A;  5DUI A;  3COA C;  2FEZ A;  3QP5 A;  5LHH A;  5BPI A;  5H20 A;  1U3E M;  4L18 B;  2MC3 A;  1EV7 A;  3HRM A;  5D6F A;  3FXR A;  1R1V A;  2HQN A;  1FSH A;  1FP1 D;  2E7X A;  1B4A A;  1SD7 A;  5K5Q A;  2L3D A;  5H6R A;  2ZXJ A;  3IC7 A;  2ESN A;  4EJU A;  3FF5 A;  2WV0 A;  3LQR A;  1JHF A;  4FX4 A;  2COM A;  4MEY F;  3R0A A;  2KRF A;  2KIM A;  5KK1 A;  5CVI A;  2W24 A;  2A69 F;  5D5U B;  1FYM A;  1SFE A;  1F9N A;  1GXP A;  2LNB A;  1I5Z A;  3KP5 A;  1BOA A;  5FB2 A;  3HIF A;  3BPV A;  1FZP B;  3WE3 A;  1Z1D A;  3ZMD A;  2E1C A;  3WGG A;  1ZG5 A;  4LJZ F;  4WXD A;  1IXR C;  2YU3 A;  1GXQ A;  2XHK A;  1RI7 A;  1U5T C;  4EGZ A;  1W7P B;  2WWY A;  2B0L A;  3RPU A;  2A61 A;  1XSX A;  2GZW A;  3O3K A;  4LLN A;  1EH8 A;  3FHZ A;  2GA1 A;  4IF4 A;  3KFW X;  1ZGJ A;  1K78 A;  1OYY A;  1XSV A;  2ZNZ A;  3DFG A;  1A04 A;  2C6Y A;  1XCV A;  4M74 A;  2DO7 A;  2O3F A;  4G9Y A;  4FX0 A;  2LDU A;  2W25 A;  2K7L A;  2DI3 A;  3VOD A;  5AIP A;  2JRT A;  4L9V A;  2P6T A;  2VN2 A;  3TDZ C;  1T38 A;  2FU4 A;  4ZZD A;  2GA2 A;  2FNP A;  2DK8 A;  1FYK A;  1Z7U A;  4JK1 X;  4EGY A;  4HZF A;  1K7A A;  3P9C A;  1FT9 A;  3EDP A;  2ZBK A;  3TKY A;  5DDG A;  1P4X A;  2PMH A;  1S29 A;  2R7D A;  4A5M A;  1ZLK A;  2ISY A;  2F5E A;  4HW0 A;  3Q5F A;  3I59 A;  3ECH A;  3JTH A;  3DPL C;  2GAU A;  2VON A;  4XRF A;  1KU9 A;  5L3E A;  1XB4 A;  2Z33 A;  4ZYD A;  1FBU A;  3U2R A;  2RNJ A;  1KQ9 A;  1H9T A;  3P9I A;  2Z9O A;  2W85 A;  5CLS A;  4S05 A;  1LDK B;  1R36 A;  5K5R A;  3TDU C;  1ZAO A;  2ZFW A;  3JSP A;  2MBF A;  1OMI A;  1IAW A;  1Z91 A;  1J7K A;  2ZNY A;  1DPR A;  4WF2 A;  4M72 A;  1K79 A;  4PDK A;  5E8G A;  1ON2 A;  4A0Y A;  2P7C B;  3HRS A;  5ED4 A;  1W4M A;  3NRV A;  1RZ4 A;  1IN6 A;  3SHF A;  1K6O A;  5LLQ A;  4IHT A;  4KDP A;  1HST A;  3KLN A;  4AD9 A;  3O6B B;  1MDM B;  4Q48 A;  1BBY A;  3HOS A;  2NRA C;  1DP7 P;  4WWC A;  2E7W A;  4LG0 B;  1ZHF A;  3E6B A;  3K0L A;  1D5V A;  4DQ2 A;  4UVA A;  1P6R A;  3KEO A;  2ZME A;  4N9I A;  2V6C A;  3WG9 A;  5E20 A;  2L54 A;  1R00 A;  3DXJ F;  3GUD A;  4EM2 A;  4MQV A;  2V1D A;  1MZB A;  3V8K A;  4L5I A;  2FQ3 A;  2AS5 F;  1V3F A;  3IKT A;  5LHG A;  2P5V A;  1J2X A;  4A0X A;  3G3Z A;  1HW5 A;  2VXZ A;  3FMQ A;  1X3U A;  5JHU A;  2YSR A;  3SZP A;  2KIF A;  3GZ6 A;  1B59 A;  3QPH A;  3KP7 A;  2M1B A;  3HOT A;  2VE9 A;  1SD6 A;  3WOD F;  2HOE A;  5J8C A;  1GHC A;  5HLH A;  1HSJ A;  4R1H A;  3TOB A;  4KFC A;  4HX7 A;  4ETS A;  3LAJ A;  1P4A A;  2ZCW A;  3LA7 A;  4EV0 A;  2P4W A;  3V4G A;  4LLG F;  3WTV C;  4ENK A;  3V8J A;  2KJB A;  1Z6R A;  4HQE A;  2IPQ X;  4O6J A;  4MHG A;  2P5L C;  2HQR A;  1Z9C A;  3KCC A;  2L4A A;  1QBJ A;  3V7C A;  1DDN A;  2DFI A;  2XGX A;  3S2W A;  4M6Y A;  2VC1 A;  2K86 A;  3MQ0 A;  4LB6 B;  4BXU A;  1I1G A;  3D0S A;  2BE5 F;  3GXO A;  1CF7 A;  2PLY A;  3WTX C;  4R79 A;  1FYL A;  4RB1 A;  3QAH A;  3K1N A;  1KU7 A;  1UCR A;  5E18 F;  2IW5 A;  1J75 A;  1R5H A;  3K1P A;  3MEX A;  3ML6 A;  1LJ9 A;  3HSE A;  4G6Q A;  1HBX G;  3J81 Z;  2EV5 A;  5K1Y A;  4AVP A;  5DYM A;  2HR3 A;  2J5O A;  4L9J A;  2YPR A;  5FFX A;  3OV8 A;  1P2F A;  4LK1 F;  1XGO A;  4G7Z F;  4MNU A;  2YR2 A;  3BDD A;  1IRG A;  2PMU A;  4OMY A;  1TNT A;  2CGP A;  4L5J A;  2M5W A;  5L3D A;  4B09 A;  3GFI A;  5LGT A;  3T1B A;  5DD4 A;  3F6O A;  1QGP A;  2EV0 A;  3QOP A;  4NHJ A;  1U5T B;  1HKT A;  3CDH A;  1OR7 A;  3QU6 A;  3P9K A;  4R8H A;  1OYW A;  5CVV A;  4TV7 A;  1T0F A;  3GX4 X;  3PQJ A;  3LST A;  4YG2 F;  1XDU A;  5ERI A;  5LGN A;  2HYG D;  4M71 A;  3I64 A;  5BOX A;  1KU2 A;  3CUQ A;  2Q2E A;  1S6L A;  2Y75 A;  3LQQ A;  1STZ A;  2HKX A;  2EWN A;  2DW4 A;  1S3J A;  3ZP5 A;  4RGU A;  5KVR A;  1IRF A;  3MZY A;  3MZH A;  3WTS C;  3WTY C;  3BJA A;  2FBH A;  5HDK A;  2Q0O A;  4BHB A;  4ESF A;  4I7H A;  3T0Y A;  2CWE A;  5IT9 Z;  3H3Z A;  3OOP A;  5HS7 A;  3WU1 B;  3HRT A;  3MCZ A;  1P92 A;  5DCM A;  2P7V B;  3R60 A;  1T39 A;  2M30 A;  5HDG A;  1O57 A;  2LF7 A;  1ZAR A;  1YTY A;  1U6G A;  5E1X A;  2UXN A;  2QQA A;  5CVJ A;  2ZJ2 A;  1SMY F;  2HTS A;  3JW4 A;  4EM1 A;  4RAY A;  3SXY A;  4YIF A;  1EH7 A;  5HDN A;  4Q5S F;  6PAX A;  2H27 A;  2QVO A;  2BV6 A;  3ELK A;  4HV6 A;  1G3T A;  2DK5 A;  3I58 A;  1O7L A;  4WXC A;  2R3S A;  3HTS B;  3HUG A;  3REO A;  4H0E A;  1FBQ A;  5DCF A;  2EFW A;  2W57 A;  5EEG A;  3VB2 A;  3B73 A;  2MA3 A;  3C1D A;  2PBI A;  1IXC A;  3TO9 A;  3ECO A;  2HYF A;  3ABT A;  1ZH5 A;  1BJA A;  4HLX A;  2A3S A;  2QBY A;  3WTU C;  4GGG A;  3IL2 A;  4RS8 A;  4EM0 B;  3K69 A;  5ILS A;  2DQL A;  4P5O A;  2EB7 A;  2NNN A;  5D4S A;  3FMR A;  4AIK A;  2UXX A;  1I27 A;  1JXS A;  2Y0M A;  2QYO A;  1RNL A;  1TTY A;  4JQF A;  3L09 A;  1H9G A;  2FF4 A;  2J5P A;  1DUX C;  2P5K A;  4OMZ A;  2O8X A;  5CJ9 A;  3HHG A;  1YS6 A;  3WE2 A;  2FBK A;  4M73 A;  2H94 A;  1D3Y A;  1TBX A;  1XDS A;  1NHA A;  1KA8 A;  4LK0 F;  5BPD A;  4HBL A;  3KZY A;  5J6X A;  2VBZ A;  1R1T A;  4OU0 A;  1B9N A;  2FXA A;  3KP4 A;  5FD6 A;  1F4K A;  1FC3 A;  4G8X A;  4U0Y A;  2JPC A;  5FLX K;  2D1V A;  2JZY A;  4ESB A;  3N97 A;  2RVC A;  2Z99 A;  1FX7 A;  2HZT A;  3QPT A;  2VE8 A;  1VTN C;  3F72 A;  2A6H F;  1TQI A;  1CGP A;  1W5T A;  4BNC A;  4QLC U;  4RB2 C;  2EFO A;  2Q8K A;  1O3Q A;  1IUY A;  4U7B A;  5JR3 A;  4MEX F;  2X4H A;  2JTV A;  3WTW C;  5ICG A;  1D8K A;  3KP6 A;  2XVC A;  4Y13 A;  2KJC A;  2H6C A;  3J81 K;  5L3F A;  1FPQ A;  1U2W A;  2O61 A;  1IN8 A;  1J0R A;  5CVR A;  4HA8 A;  4ENJ A;  1ODD A;  1IN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...