1OKRA

Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
120
structure length
120
Chain Sequence
KTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Bacterial antibiotic resistance
molecule keywords METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
publication title Three-Dimensional Structure of Meci: Molecular Basis for Transcriptional Regulation of Staphylococcal Methicillin Resistance
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 40
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1okrA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1okrA02
2HKXA 4HF1A 4IPAA 1SD4A 1DPUA 1LDJA 1R1VA 3GWZA 2COMA 1TLHB 1F4KA 3KETA 4M9SA 2FNPA 2DBBA 1B9MA 2R3SA 2Y0MA 2CYYA 3F8FA 3WGHA 1IRGA 3QP6A 3K9TA 4PGHA 3IL2A 2PBIA 1FY7A 1T6SA 3E5XA 2RVCA 1ZG5A 1B59A 1LVAA 2EA2A 2P5KA 4IHSA 4KDPA 2GQQA 2EWNA 4CYDA 1ZRDA 1YW8A 2WWYA 3BZ6A 1LQ1A 1BC7C 5ILSA 3IHUA 2M87A 3CO7C 2YPRA 2M1BA 5DD4A 5K5OA 3KP5A 3S2WA 4MNUA 1DUXC 4EJVA 4L5JA 3DEUA 3E6MA 2X0LA 4R8HA 3JSOA 4ETSA 1IAWA 2TDXA 4I02A 1A04A 3ZN0A 2D1VA 2ESNA 2Y75A 4XBFA 2UXNA 3FXUA 1C0WA 3FMQA 3JTGA 2BYVE 5HS7A 1IN8A 5ICFA 1W7PB 4ENNA 3CLOA 1QNTA 4O5VA 5LBQA 4XLPF 1ZARA 2XASA 1HKSA 2P7VB 4RB0A 3P7NA 1FYMA 2DQLA 1OYIA 3ZMDA 4CDGA 4EGYA 1T39A 5LHHA 1J2XA 4NHJA 3LQQA 2ZNZA 1GXQA 3SQNA 3F6OA 2KKOA 1QBJA 3L09A 2YU3A 3F8MA 1B9NA 1ODDA 2UXXA 3JAMZ 1YIOA 5BPDA 5ICGA 1HBXG 2BGCA 1P4XA 4YIFA 1T2KA 1RIOH 2NNYA 2EK5A 2V1XA 4GO1A 1SMYF 4ZH4F 4DNCA 1GXPA 2E7XA 2Z5UA 4LMYA 1FZPB 4FX0A 2LF7A 1O3SA 3ZMSA 4G7OF 4OINF 1SAXA 2FQ3A 2MLGA 3ABUA 2VBXA 2GIVA 3FXQA 3FMRA 3HSFA 2MH9A 2W85A 1AOYA 4XSZF 2DK8A 3DFGA 3GZ6A 3I59B 5E8GA 4A0ZA 3F8NA 1LNWA 5HS8A 2MC3A 4R79A 5K5RA 1Z05A 2KJBA 3D5LA 1YYVA 2HTJA 5DEQA 2V6CA 2PMUA 1FX7A 2MA3A 2MH2A 4U7DA 3MQ0A 5J8CA 3VFZA 1O3TA 1XMAA 2F5DA 4GYIA 1BI3A 4CXFA 2WTEA 2LF8A 4KIFA 1ZN2A 1W7PD 1XGMA 5JI6A 4FX4A 1XSXA 4F7ZA 2PG4A 3ZQ7A 2P6SA 5HDGA 3DP7A 5HOOA 4UNOA 3IWFA 1E17A 1YO5C 2DFIA 4GXOA 5E20A 2IA0A 3KLNA 2FBHA 1PP8F 2JPCA 3RPQA 4BQAA 4Z2YA 3KLOA 2E7WA 2OZUA 1K78B 3G73A 2DK5A 4EM2A 2MBFA 3F22A 3O3KA 2XAFA 5LHGA 1SD7A 1EV7A 5FD6A 4WCGA 1U3EM 1YS7A 5F6FA 4LGWA 3TGNA 1IN5A 2XROA 4KMUX 4EVIA 2A07F 3W6JB 1BN5A 3ECHA 1G6NA 4IRHA 3CDHA 2IA1A 1XD7A 2BE5F 1YTYA 2A3SA 4TV7A 2VODA 4IHTA 3WGIA 1CGPA 2M45A 3CUQC 3J7AO 2P6TA 4A5MA 2D2WA 4G94A 2D45A 4P5OA 4I98B 4ENJA 2EFQA 2QWWA 2FRHA 4A12A 3WU1B 4HA8A 4L9NA 1FSHA 3BJ6A 1TQPA 2JT1A 4WK8F 3WTUC 1BIAA 1EH7A 5DD8A 4Q48A 4A2UA 1MJ9A 2O61A 1ZHFA 3GEZA 1XGNA 1ZYRF 4AVPA 4M9XA 4MGRA 3F8CA 4ZYGA 2RC4A 4M6XA 3RPUA 3RI4A 3TQNA 1Z9CA 1MDMA 4I09A 2CSOA 4EJOA 4G8XA 1U5TC 3PQJA 1KYZA 3U1DA 4ZYDA 5D5UB 3MFKA 1XB4A 3RIRA 1SFUA 5FLXZ 1WI9A 3FX3A 3LWFA 3CO6C 1K79A 3GXOA 2UWMA 3RYPA 3SZTA 1RI7A 2M5WA 3F3XA 1XSVA 1UHWA 3QAHA 1USSA 4CGZA 4Y13A 2HDCA 5CVUA 4HQMA 1G3TA 5FO5A 4LG0B 5CVIA 1XGSA 1H9TA 2VN2A 3JTHA 2HWVA 5D4SA 2Y48A 2XKOA 1BI1A 5JR3A 2ZJ2A 4BXUA 2CW0F 3E6DA 5TJJA 2K4JA 3H3ZA 2L02A 4L0ZB 4BH9A 3RTRA 3GFMA 3JW4A 4QWQA 2O6GE 4BHBA 4MEXF 2OQRA 5BQTA 1USTA 3M8EA 4LK0F 1KU7A 3RKWA 4IRGA 4AWXB 2KRFA 1ZAOA 2FMYA 2A68F 4KIBA 4KUMA 4ASNA 1JE8A 2NNNA 2L54A 1OMIA 5D8LB 5D6EA 1I27A 1YFHA 4LLNA 3F23A 3LQRA 2A6HF 2OBPA 3C3WA 1F9NA 2VE8A 3GYHX 1MZBA 4RAZA 2GAUA 3I4PA 2EJRA 4UVAA 2W25A 3KEOA 4LD5A 4M71A 2ESHA 3TOAA 3QU6A 1H9GA 1YW9A 1D8KA 4RB3C 5DCFA 3L2CA 3WE2A 3HRSA 3LA3A 5LEJA 2CWEA 3HTUA 2F5FA 2XRNA 1QZYA 3Q5FA 1IN4A 1FLIA 3V8JA 5E1WA 3T8TA 5ILUA 2QYOA 5CJ9A 3KZZA 4L9JA 2FBIA 3HRMA 4EM1A 4XLNF 3LSTA 5HLIA 4MQVA 2BEOA 3ZPLA 5L3CA 4PGGA 2K02A 1R1UA 4BYYA 2IJLA 3CUQA 1NHAA 4HQEA 4I01A 1BM9A 1FBQA 1XMKA 3WTZA 1H0MA 5K5QA 1OKRA 4UUVA 2STWA 1YLFA 3JSPA 4HDUA 2DAOA 2H09A 3IRRA 1OPCA 1O7FA 3HOTA 4U0WA 1F1ZA 5DCMB 4HLXA 3TKYA 3N4MA 4WXHA 4I0AA 3M9AA 4HF0A 4DQ2A 1K6OA 3VODA 4HOBA 1JHHA 1XCVA 5HDKA 5LLQA 2R7DA 3WE3A 4UHTA 1LEAA 3QPTA 5HLGA 2ZMEA 1U5TA 2ADUA 3J80Z 2PFBA 1DPRA 1IRFA 1FBSA 3CUOA 2ACJA 2V1UA 2DPUA 1HSTA 4N0BA 2EFNA 3BROA 1O7LA 5HVQC 2AXLA 1HW5A 3MZHA 4CICA 2EV5A 2ZXJA 3BP8A 4Y17A 2HR3A 4A6DA 4OIQF 4UV9A 3SFZA 2FE3A 3T5XA 3JAMK 2QQAA 3KP4A 2ELHA 3D0SA 5BS6A 2ZCWA 2IW5A 3ULQB 5ILVA 2Q2EA 2F2EA 4BHPA 1MGTA 3MWMA 1B6AA 4LB5A 4MTEA 4LLLA 2XIGA 1YQAA 1U8RA 2HEOA 2OU2A 1R7JA 4IJAA 2LNBA 2PI0A 2HYFA 4ZZDA 1T38A 5TRDA 1TW3A 5L3EA 5DUIA 3LA2A 3ECOA 3OOPA 3MAJA 4M73A 4CZZA 5AONA 2F5EA 2CO5A 2XAGA 2KJCA 2IPQX 4UVBA 1F5TA 2HGCA 3KP3A 3ERED 4K2EA 1AWCA 2L4MA 1ZRCA 3HYIA 1FSEA 1QQIA 3W6KB 2IVMA 4Q47A 5DDGA 3DXJF 4A0XA 5ED4A 2CG4A 5ICEA 4LK1F 3VB2A 4ENKA 4KA4A 2Q0OA 3R0JA 2O8XA 3WODF 4HYEA 3NQOA 3U9GA 4EV0A 4BHCA 2FBKA 3I53A 4BNCA 3Q9VA 3EUHA 1OYYA 1RUOA 1KU9A 3P9IA 1BC8C 4AIKA 1RZ4A 1VTNC 4R1HA 1IW7F 4M72A 1LB2A 2EFWA 3F72A 3RKXA 3GUDA 2VBZA 3CTAA 4KYWA 3ISPA 4RGSA 2FMLA 4U0VA 5CYVA 4IXAA 3ZN1A 2EFPA 4GGGA 2PQ8A 5HDNA 2P5VA 3OV8A 3CJNA 1E2XA 5ERIA 4YFKF 3WTYC 2NYXA 4ENMA 1J59A 2RQPA 1MD0A 3IKTA 4UV8A 1ULYA 1CF7A 1IN6A 3VOEA 2ETHA 3I5UA 4L5IA 4A5NA 1IXRC 5JHUA 2H6BA 1L3LA 3GF2A 4YIIA 3BJOA 3KP2A 5CVJA 4KMFA 4HV5A 2BBYA 3KFWX 4IRIA 4IVNA 3EYYA 3SZPA 5HS9A 2EV6A 1ZH5A 1DP7P 3H3UA 2QVOA 1TQMA 2G7UA 2HZTA 3I58A 4LB6B 3HRTA 4GCVA 1ZG1A 1P4AA 1TBXA 2VT2A 3N97A 1W5TA 1HKTA 5L3DA 3V7CA 2DT5A 2K86A 4HX8A 1W5SA 4MEYF 2O03A 4KICA 2A69F 4RAYA 3QRFF 3U2RA 2JPBA 4G6DA 2HS5A 1R5HA 3QPHA 3EETA 4EQQA 5FLXK 3ML6A 2QBYA 2BV6A 2X4HA 3E6CC 4O3MA 2DPDA 2PLYA 2QUFA 3K2ZA 1FP1D 4QLCU 3V8LA 1ZGJA 4G6QA 2HQNA 4XSXF 1BJAA 5FB2A 3L9FA 4HLYA 3R4KA 3RJPA 2XGXA 3WGGA 2YSRA 6PAXA 1W7PA 3DPLC 5FD5A 1G3WA 5F1RA 5AIQA 2H6CA 3ZMVA 2M30A 4L18B 1XSDA 1FT9A 3M7GA 3BWGA 1KU2A 4P9UA 1EH6A 4U88A 4P9FA 2FOKA 3R0AA 3LA7A 3ZMZA 3BY6A 1TNTA 5H6RA 4WXDA 1FYLA 3GLXA 2ZKZA 2G7HA 2L4AA 4OU0A 4MQ9F 3TOBA 1U6GA 1XN7A 3AAFA 2VOOA 1JHFA 1SD6A 1G3YA 1D5VA 3NRVA 3KEQA 4EMSA 1Z6RA 3NEUA 3WTVC 4FHTA 3GFIA 1FC3A 3PFIA 2FF4A 5EEHA 4OMYA 1FP2A 2Z33A 3F21A 2FEZA 2H27A 4ZYEA 2JRTA 4Y15A 2KIUA 1KYWA 1V4RA 4P96A 3EQLF 1YS6A 3L7WA 4EJWA 4OIPF 1QO0D 2GA2A 1GHCA 3WU0A 2GXBA 4I2OA 3WTTC 2D1HA 3SHFA 1B4AA 2EFOA 5F64A 4ON0A 2KIFA 2XAHA 2FU4A 1MKMA 1S7OA 2DLLA 3I59A 1BIBA 5E18F 1WQ2A 2RN7A 3MZYA 1S7AA 2XUBA 1FPQA 1IXSB 4HX7A 3RYRA 2IA2A 4MTDA 5LGTA 4HDVA 1ON1A 4S04A 3O6BB 2GZWA 1ZLKA 3HTSB 3FXRA 1I1SA 4G9YA 1PP7U 2P5LC 1U2WA 5IT9Z 1MJBA 5LEKA 1LEBA 2MLKA 3FHZA 2P8TA 3B02A 3KP6A 1B1BA 5A2QZ 3E5QA 4B09A 2PN6A 5JVTA 2P7CB 4KNYA 4KFCA 1K7AA 4HX4A 2PJPA 3V4GA 5DUKA 1QZZA 3ZMTA 1K78A 3SXYA 4HF2A 3VEPA 4OIRF 2Z99A 2J5OA 2E1CA 3BPXA 3DPTA 3C1DA 5E1XA 1R00A 2R7FA 2XAQA 2VT3A 4LJZF 3DKWA 3MCZA 4AIHA 4HV6A 3LFKA 3V8KA 2HTSA 1UFMA 3J81Z 4EJTA 3HRUA 3GVAA 4RS8A 3TO7A 5KK1A 1FNNA 3J80K 2FNAA 1Z7UA 1J75A 5ICCA 1KGSA 3KP7A 4RGUA 1O3RA 4Q4ZF 2VBWA 2OQGA 1RUNA 3LAPA 2M8EA 2IP2A 3DQVC 5H6QA 1W4MA 2VC1A 3R6SA 3FZVA 2QBYB 1TQIA 5L3GA 2OD5A 1R36A 1TTYA 1MDMB 2K4BA 1YG2A 3L00A 2RV8A 2YX7A 3REOA 5FFXA 4M74A 4D0PA 3I54A 1BI0A 1G3SA 1ZREA 3K0LA 4ESJA 1IXCA 2W57A 2GA1A 2ISYA 1I5ZA 3KCCA 2K7LA 3BOQA 5KVRA 3F8BA 4XRFA 3M1EA 1P6RA 2DU9A 1S3JA 2PMHA 2W24A 1LDKB 3V7SA 2Q8KA 4M6YA 2K27A 4N9HA 2LSOA 4MHGA 2QQBA 3E5UA 4HW0A 3K1NA 2HFHA 2HYGD 1MJAA 3ZMUA 1O3QA 1G4DA 2XKPA 2V79A 2EV0A 2XVCA 1HQCA 2VC0A 4Q5SF 1UCRA 1XGOA 1PUEE 5JFRA 4P55A 3TO9A 3GFJA 2DO7A 1L0OC 2Z9OA 3I64A 2ZFWA 2ZO4A 3E6BA 4U7BA 4LG0A 5BMZA 2DTRA 2YR2A 2VONA 1XDUA 3K69A 4L0YB 4UXNA 1LJ9A 5AIPA 1XDSA 3WTSC 1I1GA 1Z6TA 4O6JA 1J7KA 3C7JA 3ELKA 2XHKA 2JSCA 2DQRA 2IRFG 2P4WA 3T8RA 4L9TA 2FSWA 4U0YA 2HQRA 1ON2A 1SFXA 4CHUA 2NAZA 4WX9A 5CVVA 4I7HA 4EJUA 4PCQA 1UB9A 3MEXA 2A6EF 4AIJA 3WTXC 2W84A 4PZJA 3FM5A 5LGNA 2LDUA 1HSJA 3HUGA 5LRSA 3IC7A 1D8JA 2VOPA 3KZYA 1KA8A 1ZG3A 1X3UA 2CGPA 2RDPA 4S05A 1YW7A 5CLSA 1J5YA 2CFXA 1ZRFA 2OAZA 3ABTA 3I71A 2RKHA 3ZP5A 3FMSA 2NRAC 5D5WB 1IZ1A 5FFZA 3GO5A 3KE2A 1R22A 2O0YA 2MD5A 3O2PE 4HZFA 3GX4X 3E97A 3EYIA 1FBUA 2LKPA 4RGRA 4G7ZF 3QOPA 2OZ6A 1HW2A 4HBLA 3LAJA 2L01A 1O57A 2A5YB 2QENA 1TNSA 4A6EA 2L3DA 1FYKA 2QQ9A 1Z91A 3CUQB 5DYMA 1P92A 1U78A 1SFEA 3EDPA 3E3VA 4E70A 5LRRA 1LDDA 3BJAA 4H0EA 1RNLA 1FOKA 2H94A 3F6VA 4UVCA 4OMZA 3GFLA 1J0RA 3M8FA 2UZKA 3FM3A 4YFNF 1WRJA 5J8FA 3K1PA 3H92A 2ISZA 3ROUA 1DDNA 4RB2C 5HLHA 3HSEA 5DCMA 2Z3YA 2YX4A 5FGMA 3WTWC 2ZMEB 4ESBA 2E1NA 3PQKA 4WXCA 1U5TB 3COAC 2J5PA 3G3ZA 4G7HF 2XAJA 1BBYA 3BPVA 4HAMA 1S6LA 1WKMA 1REPC 1TW2A 3HHGA 2CQKA 4OOIA 3HHHA 1T0FA 4WWCA 1STZA 4ZYHA 2O3FA 1T98A 4M9ZA 1QGPA 2EA4A 5L3BA 2A61A 3HSRA 4JBAA 1Z1DA 4PDKA 4OIOF 4YG2F 3R60A 3QU3A 2GWRA 2V9VA 5DV5A 1V3FA 2DI3A 1EH8A 5BPIA 3IWZA 1HXDA 2RGVA 3WG9A 2G9WA 5EEGA 1R5GA 1R1TA 2GXGA 3Q9SA 1R58A 2PEXA 5CVRA 3B73A 4YFXF 3P9CA 3FWEA 5J6XA 1FWZA 1P2FA 3TO6A 3IRQA 5H20A 1GVJA 1OYWA 1R23A 1UHMA 4IF4A 4EGZA 1J9IA 5L3FA 3K1MA 2ZBKA 5LGUA 1KQ9A 1P4WA 2JTVA 4EM0B 3P9KA 1HW1A 4KIGA 1I6XA 2IT0A 2JZYA 1PDNC 4KN7X 3IKVA 5D6FA 2FA5A 1KU3A 1OR7A 3TDUC 2HKOA 1WWXA 4L9VA 4FT8A 4KN4X 5E1ZB 1BOAA 1QPMA 5E8IA 3RKYA 3HIFA 4LFUA 2QM3A 1ZLJA 4JQFA 4ESFA 5K1YA 5D4RA 3FF5A 3TDZC 4RGXA 2WC2A 1SD5A 2QLZA 3T1BA 2EB7A 5D8KB 5D5XB 2STTA 1WSUA 2ZNYA 4LLGF 4BAYA 1D3YA 3HOSA 1ZGAA 2VBYA 4GYGA 2VXZA 5IT3A 2XV4S 3I0TA 2QZ8A 5IT9K 4NB5A 1JXSA 3GW2A 2VE9A 1SMTA 1ONVA 4N9IA 3V7RA 3R61A 3DV8A 2KIMA 2V1DA 2NS0A 3QP5A 5A2QK 2F5CA 3DF8A 4AD9A 1S29A 1HKQA 2RNJA 3RDIA 4CO8A 4RB1A 5D5VB 1BI2A 3T0YA 4WF2A 2B0LA 3BDDA 1JGSA 4I0BA 5BOXA 1IN7A 1KQ0A 1CF7B 1S8NA 3GZ5A 3C18A 2AS5F 1KQ8A 1Y0UA 2HOEA 5LHIA 2DW4A 1XCBA 4ZZLA 2WV0A 4B8XA 1IUYA 4KT5C 4NQWA 2FXAA 1Q1HA 2C6YA 1IF1A 3J81K 2OA4A 5E17F 4JK1X 4A0YA
chains in the Genus database with same CATH superfamily
2HKXA 2CW7A 3FKJA 3SEQA 4HF1A 2VLAA 5FROA 4IPAA 1SD4A 1DPUA 1ZELA 1LDJA 1R1VA 4HNTA 3GWZA 2COMA 1TLHB 1F4KA 3JRDA 3KETA 2DOEA 4M9SA 2FNPA 2DBBA 1NK3P 2CQXA 1B9MA 2R3SA 2Y0MA 2CYYA 3F8FA 3OR2C 3WGHA 4AU7A 1XX5A 2I5UA 1U0JA 4BJTA 3QP6A 5J1YA 3K9TA 1IRGA 4PGHA 3IL2A 2PBIA 4UY8I 1FY7A 1T6SA 5E3MA 1V5EA 5GAGJ 1YJ9I 3E5XA 4BBSJ 2JA7J 4QIWN 2RVCA 1ZG5A 1RESA 1B59A 1D0ZA 1LVAA 2ICWG 1LE8B 2EA2A 2P5KA 3AG1H 2GOMA 2XGCA 4IHSA 4KDPA 4B43A 1OCRH 2GQQA 3BR3A 2EWNA 1PYVA 4CYDA 4XONA 1ZRDA 2L9VA 1YW8A 3Q3SA 2WWYA 3BZ6A 2HQAA 4XM3A 4ZDLA 1LQ1A 1BC7C 5ILSA 3IHUA 2M87A 3CO7C 2YPRA 2M1BA 5DD4A 4UUSB 5K5OA 1BL0A 3KP5A 3S2WA 3W3CA 4MNUA 1DUXC 2XB0X 3UKGA 2VL8A 4EJVA 3ASNH 3NWSA 4L5JA 2V26A 3TMOA 2GLOA 3DEUA 1F43A 3E6MA 2E19A 4NC6A 2X0LA 4R8HA 2R93J 3OYNA 2W82A 3JSOA 4ETSA 1IAWA 2TDXA 4I02A 1A04A 3ZN0A 4C3JJ 2D1VA 2ESNA 4FASD 1R4MB 2Y75A 4RDUA 5HNFA 4XBFA 2UXNA 1TL8A 3FXUA 2JK3A 1C0WA 4Y3OA 3PUBA 2WV1A 1SVMA 3FMQA 3U21A 4BQOA 3JTGA 1Z21A 4PJLA 1IDYA 2AO9A 1OCZH 3OYFA 1TWCJ 1XC5A 2Z2SB 2BYVE 5HS7A 1IN8A 5ICFA 3D1NI 1W7PB 4ENNA 2DMUA 3CLOA 1QNTA 4O5VA 4AUXA 5LBQA 4XLPF 1ZARA 3CESA 2XASA 1HKSA 2KFDA 2P7VB 1OQYA 2L5QA 1S72I 4RB0A 3P7NA 1FYMA 2R7QA 2LKXA 3DKXA 4XK4A 3J7ZI 2DQLA 1OYIA 3M4OJ 3EUKL 3ZMDA 4XKBA 4CDGA 2CFOA 3BLYA 4FE4A 4EGYA 1Z67A 2QGUA 3S32A 3CJRB 1TP4A 4XORA 2ZJPF 1T39A 2N8GA 3ZCOA 5LHHA 1J2XA 4NHJA 2VPLA 3LQQA 3BR0A 3HGYA 2ZNZA 1VQNI 1GXQA 3SQNA 4RLFA 2M4GA 3AG2H 1FTZA 3F6OA 1W5CC 2KKOA 1VFCA 1QBJA 4B48A 3L09A 4LIVA 3RCOA 2OTLI 3A4CA 1I50J 4CCNA 2YU3A 3F8MA 2RQQA 4F92B 1ZKGA 1B9NA 4BUPA 2Y2ZA 4ITVA 1ODDA 2R92J 2HPMA 2UXXA 1WZ2A 3JAMZ 1YIOA 2H1LA 5BPDA 5ICGA 1HBXG 2BGCA 2W00A 1P4XA 4YIFA 1QA6A 5FLMJ 2R5YB 3E1SA 1OJLA 1T2KA 1RIOH 1SFOJ 2BHZA 2NNYA 2EK5A 2ZJQF 2V1XA 4GO1A 1Z77A 1SMYF 4ZH4F 4DNCA 1X1PA 1GXPA 4IQJA 2CUFA 1EJ9A 2E7XA 2Z5UA 4DBQA 4LMYA 1FZPB 2GBYA 4FX0A 2LF7A 3Q0WA 1O3SA 3ZMSA 4G7OF 4OINF 3FHNA 1SAXA 1Z0XA 2CS3A 2FQ3A 2MLGA 5M5YJ 3A0BC 4IHXA 3ABUA 2VBXA 2GIVA 3FXQA 1HDDC 1MBKA 3FMRA 3HSFA 1T08B 3A02A 2MH9A 4XMYA 2IGMA 2W85A 1FIPA 3C2GA 1AOYA 4XSZF 3D5RC 4CCOA 2DK8A 2F4MB 3G1MA 3IH3A 3DFGA 4F91B 3GZ6A 1IO2A 1RKWA 3I59B 1ITYA 5E8GA 4A0ZA 1OISA 1N75A 3F8NA 1LNWA 5HS8A 4PUSA 1PUFB 2VQGA 2MC3A 4R79A 5K5RA 1Z05A 2KJBA 3D5LA 2D5VA 4LOCA 1YYVA 2HTJA 3CCEI 1T95A 4GRIA 4HEA2 5DEQA 2V6CA 5FKNA 2IXSA 2PMUA 1FX7A 1VNDA 2MA3A 2ECBA 2MH2A 4U7DA 1W36D 3MQ0A 5J8CA 3VFZA 1O3TA 2HDDA 3FISA 1XMAA 2F5DA 4GYIA 3JRHA 5F27A 3G71I 1BI3A 5GTIC 4CXFA 2WTEA 1RR7A 2LF8A 2ZSIB 4KIFA 3HC7A 4PSWA 1ZN2A 2NS8A 1Y1WJ 1W7PD 3B6AA 1XGMA 5JI6A 4BXXJ 1WJBA 1X1BA 5EGOB 3IP4B 4B3XA 4HSTA 4FX4A 3PUFA 1XSXA 4F7ZA 2PG4A 1ZGWA 3ZQ7A 2DA4A 2P6SA 5HDGA 3DP7A 5HOOA 1WPKA 4UNOA 3IWFA 1E17A 2VQLA 4JX6A 1YO5C 1LFUP 2DFIA 4GXOA 5E20A 2IA0A 1TWGJ 1MBJA 2MC4A 3KLNA 2FBHA 1PP8F 2JPCA 3RPQA 4BQAA 5CPRB 3LMMA 4Z2YA 3VSLA 3KLOA 2IGKA 2E7WA 2OZUA 4F3QA 1K78B 2CW8A 3G73A 2MGQA 2DK5A 3JREA 3JRFA 2BHYA 2B7EA 4EM2A 3CC2I 4I76A 2MBFA 3F22A 4CCKA 3GTGJ 4UUTA 3O3KA 2XAFA 2DA1A 2QKMB 5LHGA 3PM1A 2X6YA 5CQGA 1SD7A 4D7MA 3OYKA 3X2QH 1X19A 3CLQA 1EV7A 5FD6A 1NG6A 3ZQHA 4WCGA 1U3EM 1YS7A 5F6FA 4LGWA 5F1JA 3GMEA 4XOTA 1IN5A 3I9V2 3TGNA 2XROA 4LIUA 3S93A 4KMUX 4EVIA 2A07F 3W6JB 1BN5A 5F0HA 2JUGA 2DT7B 3CDLA 3ECHA 1G6NA 3CP2A 4IRHA 3CDHA 5IYDJ 4Y52J 4XR6A 4A3IJ 2IA1A 3SJMA 1XD7A 2BE5F 1YTYA 2A3SA 4TV7A 2VODA 3KYCB 2K9LA 2VQCA 4IQ4A 4IHTA 2NVUB 4CCLA 3WGIA 1CGPA 3NARA 2M45A 3CUQC 3J7AO 2P6TA 4A5MA 3CCLI 2R5ZA 2D2WA 1CQTA 4G94A 2D45A 4P5OA 4I98B 4ENJA 3B6CA 4DOZA 2EFQA 2QWWA 3S1QJ 2FRHA 4A12A 2BXYA 3W2AA 5K7ZA 3WU1B 5JLWA 1A35A 3A2KA 2EIKH 4HA8A 2P0WA 4BKXA 1A31A 4L9NA 5IP9J 3CCSI 1FSHA 4EEFG 4M3GA 2NOGA 3BJ6A 3ZRGA 1TQPA 2JT1A 4WK8F 3I56I 3WTUC 2E36A 1BIAA 1EH7A 5DD8A 4Q48A 4A2UA 1MJ9A 4ZDPA 2O61A 2KHMA 1ZHFA 3GEZA 1XGNA 1ZYRF 4AVPA 4CH7A 4BACA 4M9XA 2LRDA 2WAQA 1R6RA 4MGRA 1W0TA 3F8CA 4ZYGA 3L2WA 2RC4A 4M6XA 3RPUA 3RI4A 4C2UA 2R7VA 2QSGX 2OJED 4X1EA 3TQNA 1Z9CA 1MDMA 4I09A 2CSOA 2WAEA 4EJOA 4G8XA 2DJIA 2VKDA 1U5TC 1MBGA 3PQJA 1KYZA 3HB9A 3U1DA 4ZYDA 1DU0A 3CF2A 1DGRM 2XPWA 2OTJI 5D5UB 3MFKA 2R7OA 3H9GA 1XB4A 2Y9YA 3RIRA 1SFUA 3GTKJ 4F55A 5FLXZ 3A0HC 1BR2A 1WI9A 4J01A 3FX3A 2DOAA 3CF5F 3LWFA 3CO6C 1K79A 2JVGA 3GXOA 1XS9A 2UWMA 1KONA 1G8XA 2KQRA 3RYPA 1GLNA 2BW3A 3SZTA 1RI7A 2BVLA 2M5WA 4IEJA 4D5FA 5K7FA 1JKQC 2DMQA 3F3XA 3CCRI 4D1QA 1WJAA 3RKQA 5BNGA 1XSVA 1UHWA 1AKHA 4DYRA 3QAHA 2L9NA 3DU6A 4DYCA 1USSA 1IGNA 4CGZA 2DFHA 4Y13A 1P7IA 5CVUA 2HDCA 4HQMA 5JHFA 3ZQFA 3ABKH 3WU2C 1G3TA 1R5ID 5FO5A 1HC8A 2HVRA 1Z3YA 2GXAA 4LG0B 2O9LA 1VQOI 1I3AA 3K4MA 2F4IA 5CVIA 3DTKA 3HXLA 4BJ5C 2W4SA 1QVTA 1XGSA 2VN2A 1H9TA 3JTHA 2HWVA 5FKKA 5D4SA 1VQLI 3BCAA 2Y48A 2KLOA 3ZQIA 2XKOA 1BI1A 1OCOH 4DZJA 1BW6A 5JR3A 5J40A 1RR8C 2ZJ2A 3JRIA 3CCUI 4BXUA 2CW0F 3E6DA 5TJJA 5E3OA 5CKTA 1BR1A 4LITA 2DFEA 2K4JA 1ETXA 1QU3A 3H3ZA 2L02A 3DBRB 4IO9F 4L0ZB 3HDDA 3OMYA 4BH9A 1IRZA 3RTRA 1IG7A 3GFMA 3JW4A 3PL8A 2E1MC 1IV6A 1Y56A 2JVHA 4QWQA 2O6GE 3UR3C 4BHBA 2JA5J 2DA7A 1MNEA 3BT9A 2OQRA 3HKZA 4DJAA 5BQTA 2L9RA 1O4XA 4MEXF 4A3LJ 1USTA 5F04A 3M8EA 4LK0F 2HOTA 5M5XJ 1PJRA 3PSFA 3RKWA 1KU7A 4IRGA 3TEDA 4XL9A 4AWXB 5J1RA 2KRFA 2KIQA 5J47A 1ZAOA 2FMYA 2V4JC 2A68F 5J4VA 3NAUA 3W2VA 4KIBA 4KUMA 2E2IJ 4ASNA 1JE8A 4RMNA 2NVXJ 4JYKA 4M3FA 1FOYA 4IHYA 4E7LA 2NNNA 4A3MJ 2CH0A 1MMSA 2L54A 1OMIA 1YJWI 2Y31A 5D8LB 3BZKA 5D6EA 1I27A 1FOXA 5M3MJ 1YFHA 1WI3A 4LLNA 1YIJI 1TC3C 4DBRA 1NK2P 3F23A 1VQKI 2W48A 3LQRA 3MZ8A 2MW8A 3OIQA 2EINH 3DPUA 1JJ6C 3FXOA 2A6HF 2OBPA 5B1BH 3C3WA 1F9NA 2VE8A 3GYHX 3C2BA 2WAQN 1MZBA 4RAZA 2GAUA 4M3BA 3I4PA 3HPHA 2DJNA 2EJRA 4UVAA 2W25A 3KEOA 4LD5A 4A3EJ 4M71A 1MH4A 2ESHA 3EUHC 1QPIA 4GDFA 3TOAA 3QU6A 4E7KA 1K6YA 2X1CA 2A5WA 1H9GA 1YX3A 1YW9A 3K4NA 4CSWA 2XRLA 3MMYB 1D8KA 4RB3C 1JI8A 5H2FC 4XIDA 4XNFA 5DCFA 3L2CA 3WE2A 2DDBA 2JQ7A 3HRSA 3LA3A 5LEJA 2WY8Q 1LFBA 2CWEA 1DP3A 4IL6C 3HTUA 1JKPC 2ZSHB 2JSPA 2F5FA 2XRNA 1MSEC 3TP3A 1QZYA 3Q5FA 1IN4A 2DTZA 1FLIA 1VQPI 4XLFA 3E0JB 3V8JA 5E1WA 3T8TA 5ILUA 2QYOA 3W6VA 5CJ9A 3HOWJ 3ZQGA 3KZZA 4L9JA 4E7JA 2V6EA 2FBIA 5FJ8J 1MMAA 3JRGA 2L7MP 3HRMA 4BDYA 4EM1A 4XLNF 2K85A 1YE9A 3GTQJ 2HOSA 3LSTA 5HLIA 4MQVA 1V55H 2BEOA 2MFZA 1R9TJ 3ZPLA 1IC8A 1ENHA 3F0CA 3LSMA 3TW7A 5L3CA 3S15J 4PGGA 1E3PA 1G59A 4MFDA 2K02A 1R1UA 1XMXA 3W2WA 1R49A 3S8PA 4BYYA 4KISA 2IJLA 2OUMA 1ETWA 3CUQA 1NHAA 1U8BA 1ORKA 4HQEA 4I01A 1X58A 1BM9A 3KIOA 1B8IB 1FBQA 1XMKA 2JA8J 5EG0A 3WTZA 4XRSG 1H0MA 2K9SA 2B63J 5K5QA 3MVPA 1OKRA 4UUVA 4KITB 2STWA 4Z6YA 1YLFA 3ABMH 1H88C 1BA5A 2AHQA 3JSPA 2R5ZB 2LD5A 4HDUA 4CYCA 3K70C 2DAOA 2H09A 3IRRA 1OPCA 1O7FA 3HOTA 3AL0C 4U0WA 4JX5A 1F1ZA 5DCMB 1GDTA 4HLXA 3TKYA 1SVLA 3N4MA 1NH3A 4WXHA 1P9QC 4W1UA 4Y4RA 3Q0UA 4I0AA 5HLTA 5DM6F 3M9AA 4HF0A 2COBA 1B72A 1FIAA 3GTJJ 4DQ2A 1K6OA 3VODA 2VPRA 2LLKA 4HOBA 1JHHA 1XCVA 5HDKA 2L7KA 5LLQA 2R7DA 3HKZN 3WE3A 4UHTA 4NUBA 2WADA 1LEAA 3QPTA 5HLGA 3AG4H 2ZMEA 1UHSA 4RAGA 3G2BA 1U5TA 2ADUA 3SZGA 3QYBA 2YUSA 2Y0SA 3J80Z 1G2HA 3LSKA 2PFBA 1DPRA 1D1BA 4CCJA 1IRFA 1FBSA 1AHDP 1UMQA 4C2MJ 3CUOA 2ACJA 2GOXB 3DCFA 5M3FJ 2V1UA 4FCYA 4ZTJA 2DPUA 2XF6A 1HSTA 3M07A 4N0BA 3CDIA 2EFNA 3BROA 4M3DA 2HXOA 1O7LA 5HVQC 5EF6A 2AXLA 4BE2A 1HW5A 1NG7A 2VKHA 3MZHA 2RAEA 4CICA 2V9KA 4JX4A 3FKIJ 2EV5A 2ZXJA 4XKVA 2CUEA 3G6EI 1D0YA 2DA5A 2L9SA 3BP8A 4UB6C 1YRNB 4CZCA 3QPSA 2HR3A 4Y17A 2M8GX 2XF5A 1W0UA 4P1WA 1I39A 4A6DA 4OIQF 2R4GA 3OYCA 2AQFA 4UV9A 3SFZA 2FE3A 3T5XA 1U9OA 2BW3B 3JAMK 2QQAA 5DM7F 3PJRA 1XTAA 2VASA 3KP4A 2MD0A 4XLEA 2ELHA 3D0SA 5IP6A 1W36C 5BS6A 2ZCWA 2IW5A 3OYJA 4AIDA 1FMWA 3ULQB 5GAHJ 2HI3A 5ILVA 2Q2EA 4LG3A 4IOAF 2F2EA 1SC7A 5HNHA 4BHPA 4YIRX 1MGTA 2XSDC 3MWMA 3CZ6A 1B6AA 2M7AA 3K70D 4LB5A 1LPQA 3OL3A 1APLC 4MTEA 1BOBA 3S14J 1HF0A 4LLLA 2XIGA 4IZZA 1X3WB 3LSJA 4KJZA 2H1KA 1HLVA 2MSYA 1YQAA 1U9NA 2XPUA 3OIPA 1U8RA 2DXIA 2HEOA 3DLAA 1VZ0A 2OU2A 2EIJH 2QF7A 1XG1A 1R7JA 3OYLA 3H5RA 4IJAA 4II2A 2LNBA 1TWFJ 4BU2A 2HYFA 1WHUA 3AFHA 2PI0A 4BBRJ 3BR1A 1TWAJ 4ZZDA 1T38A 5TRDA 1TW3A 2VQHA 4XN0A 5L3EA 5DUIA 3LA2A 3ECOA 3OOPA 1FEXA 2VJ4A 3MAJA 4M73A 4CZZA 5AONA 2F5EA 2CO5A 4PJ0C 2XAGA 2KJCA 1WJEA 3H0DA 3JRCA 2IPQX 4UVBA 1F5TA 2NVTJ 3KPHA 2HGCA 3KP3A 2XC7A 3ERED 2DA6A 4K2EA 4W97A 1UG2A 1K61A 1AWCA 2L4MA 1ZRCA 3HYIA 1FSEA 1QQIA 3W6KB 1BJZA 3VYUB 2IVMA 4Q47A 4MO7A 5EZHA 5DDGA 5FRNA 3DXJF 3ZOBA 4A0XA 5ED4A 2CG4A 5ICEA 2ZB9A 1MMDA 4LK1F 3VB2A 1F36A 4BJ6C 4ENKA 4KA4A 2HOAA 2LOOA 2Q0OA 2XGEA 3EPZA 3R0JA 4J00A 2O8XA 3H5AA 3WODF 4HYEA 1ETOA 4HNUA 2VKVA 2VJJA 1H8AC 3NQOA 3U9GA 4HSRA 4EV0A 1JT6A 3BG5A 1IV8A 2UV1A 4BEHA 4BHCA 2FBKA 3I53A 2RREA 1JUSA 4ANJA 4XKCA 4BNCA 2DDAA 1K4SA 4H4KC 3Q9VA 3EUHA 3HJEA 1D5YA 4B4CA 1OYYA 1RUOA 1KU9A 3CP8A 1JKOC 1DQUA 2JA6J 3P9IA 3RQIA 1HOMA 1BC8C 4AIKA 3BTCA 1RZ4A 1VTNC 4R1HA 5DTDA 1IW7F 4M72A 1LB2A 2Y0SN 2EFWA 2NVYJ 3M8JA 1GV2A 2BXZA 5LD2C 3F72A 3RKXA 3BR6A 3GUDA 1MW7A 2Q1ZB 3CTAA 2I10A 2VBZA 3I3LA 4KYWA 3ISPA 2LG4A 4RGSA 2R7SA 5C44J 5KAFC 4I6ZA 3H9QA 4A3CJ 1FOWA 4BL0B 2E35A 2FMLA 4U0VA 5CYVA 4IKFA 4IXAA 3ZN1A 4BE1A 3FDYA 2EFPA 4GGGA 3GZNB 2ECCA 2X48A 2PQ8A 5HDNA 2M34A 2P5VA 2BY3A 1R4NB 4NQWB 4Y7NJ 3DBHB 3OV8A 3CJNA 1E2XA 1K83J 5ERIA 4YFKF 3WTYC 2NYXA 4ENMA 1J59A 2RQPA 2FD5A 2R7UA 1MD0A 3IKTA 4UV8A 1ULYA 1CF7A 3ERMA 1IN6A 2JWTA 4QSHA 4ZYAA 1WJFA 3GTOJ 3VOEA 4YELA 2ETHA 3I5UA 4L5IA 1Y39A 5IOZA 4A5NA 1IXRC 2NXNB 3BG6A 2H6BA 5JHUA 1L3LA 3BG3A 3GF2A 4YIIA 3BJOA 5HODA 3KP2A 3CMYA 5CVJA 1ETKA 1JUPA 2M4KA 1A6QA 4KMFA 4HV5A 2WB1A 4BDZA 2X1DA 2BBYA 3BC8A 3KFWX 3QQAA 4IRIA 2DYRH 4IVNA 3PNVA 1JTXA 3EYYA 3G1LA 3SZPA 5HS9A 3CCQI 2EPFA 2DMPA 3BQZA 2EV6A 1ZH5A 3BTJA 1DP7P 3H3UA 2B9SA 2ZC2A 3OOUA 3RSNA 2QVOA 3SDBA 1TQMA 2G7UA 2HZTA 3HOVJ 3I58A 4E6KG 4CYCB 4LB6B 5KCMA 3HRTA 4GCVA 1ZG1A 1P4AA 4ZTFA 1TBXA 2XAUA 4I99C 1QRYA 2CUZA 3TW6A 2VT2A 3N97A 1W5TA 3BR5A 3KX2A 1IJWC 4G12A 1HKTA 5L3DA 3TP0A 1LE8A 3V7CA 1LKXA 2DT5A 2K86A 4HX8A 1W5SA 2H8WA 1GVDA 3LFUA 3PIPF 4MEYF 2O03A 4KICA 2A69F 3HZJA 4RAYA 2EBIA 2Y9ZA 3QRFF 4PK4A 3U2RA 2JPBA 3K7AJ 4G6DA 1ZR2A 2HS5A 1TT0A 1R5HA 1R71A 1ZQ3P 1SVOA 3QPHA 2Y30A 3EETA 4EQQA 5FLXK 3ML6A 2ZJRF 2QBYA 2BV6A 3DTEA 2X4HA 2XGDA 1ACIA 1MMNA 1I6HJ 3E6CC 2ZFUA 3S1RJ 4O3MA 5KAIC 1AA7A 2ZMEC 2DPDA 2QUFA 1YHQI 2PLYA 3VWBA 3K2ZA 1FP1D 4QLCU 2CUJA 3V8LA 2VUMJ 1ZGJA 4C9YA 1V5FA 4A3GJ 4G6QA 2HQNA 1JJ8C 4XSXF 1BJAA 3H36A 2LK2A 2WBMA 2CQNA 3L9FA 5FB2A 1JKRC 3FXKA 3IUOA 4BE0A 2AQEA 4DIQA 1OCCH 2LTPA 1Y8RB 4HLYA 2TRTA 3R4KA 4IHWA 5LFAA 3ZR8X 3RJPA 2E2HJ 4B1RA 4HPQA 1OCPA 2ZXWH 3OWTA 2XGXA 3G4SI 1T33A 1VI0A 3F9KA 4CA0A 4HRIA 3WGGA 2YSRA 6PAXA 1JT0A 4IX7A 1W7PA 3E7LA 3FXMA 3DPLC 5FD5A 2XPVA 1X4PA 1G3WA 5F1RA 5AIQA 2H6CA 3ZMVA 2M30A 4L18B 1XSDA 1VQ4I 4KT6A 2IEKA 3WG7H 1FT9A 3M7GA 1A5JA 3BWGA 2K3PA 1XPXA 1KU2A 4P9UA 1EH6A 4FQGA 3PO2J 4U88A 4P9FA 2BOLA 2FOKA 3R0AA 3IAS2 2QEXI 2V9PA 3LA7A 4YRVA 3OIOA 1T56A 3ZMZA 1WFXA 2KRCA 2R7ZJ 2O5RA 5IP7J 3BY6A 1TNTA 2KP6A 3G1OA 3AG3H 5H6RA 4WXDA 4B44A 4CUGA 1FYLA 1EF4A 3BTIA 3GLXA 2ZKZA 3HPGA 2G7HA 2L4AA 4OU0A 4MQ9F 3TOBA 1U6GA 5K7HA 1XN7A 2CQQA 3AAFA 2VOOA 2IAIA 1JHFA 3OYMA 5IOYA 2IBDA 1SD6A 1G3YA 4C2TA 3HOYJ 3OL4A 1D5VA 2R5YA 4A93J 2KT0A 2WB1N 5GP9A 1GV5A 3FK7A 3NRVA 1GT0C 1X1AA 3KEQA 4EMSA 1Z6RA 3DTIA 4IHVA 3H35A 3NEUA 2MABA 3WTVC 4FHTA 3GFIA 1FC3A 3PFIA 3ABLH 2FF4A 1BW5A 5IYCJ 5EEHA 4OMYA 4ABZA 1FP2A 2KZGA 3F21A 2FEZA 5FKOA 2K9QA 4ZYEA 2Z33A 2H27A 2JRTA 4Y15A 2LKSA 4DYQA 2KIUA 1KYWA 1V4RA 1FMVA 4P96A 3BG9A 4DGWB 3EQLF 1YS6A 3L7WA 4EJWA 4OIPF 1QO0D 2GA2A 1GHCA 3MN2A 3A03A 3WU0A 2GXBA 5J1UA 4I2OA 3WTTC 2L7FP 2D1HA 3SHFA 3CJQB 1B4AA 2EFOA 5F64A 3SYTA 2DA3A 1FTTA 3S3MA 3OY9A 1UELB 4ON0A 5EZGA 2KIFA 2XAHA 3AKZA 2FU4A 3DKYA 1MKMA 2QQ8A 1S7OA 5F08A 2DLLA 1VF9A 3I59A 1BIBA 1WQ2A 2RN7A 2E1OA 3MZYA 1S7AA 3QWLA 2XUBA 5E18F 1FPQA 1IXSB 3OYHA 3LSRA 4HX7A 1PUFA 2YU9J 3RYRA 2Z16A 4RAFA 2XF7A 5IYBJ 2X9DA 2E34A 2IA2A 4MTDA 5LGTA 4QTRA 4PJMA 3S2DJ 1WVRA 4HDVA 1P7JA 1ON1A 4S04A 3O6BB 2HQ5A 2GZWA 3S1NJ 4FISA 3ZQQA 1ZLKA 3HTSB 3FXRA 3LSIA 5J4YA 1I1SA 4G9YA 1PP7U 2X6WA 3M3YJ 2P5LC 2FUG2 1U2WA 5IT9Z 1OCTC 2VJIA 1MJBA 5LEKA 2BY0A 2CJJA 1LEBA 2MLKA 1EKEA 3IH2A 2V1NA 3HGGA 2X1EA 3FHZA 2LFBA 5EGOA 2G0EA 4XLHA 2P8TA 5KHDA 3B02A 3KP6A 1VQMI 3K4LA 1B1BA 4UB8C 2DMTA 5A2QZ 3E5QA 1ETQA 1X1DA 4RA2A 4B09A 2PN6A 3IAM2 5JVTA 2P7CB 4KNYA 4KFCA 1K7AA 2F4OB 3FBIB 4HX4A 1LFPA 4J19A 1YOVB 4XLAA 3OYDA 4C30A 3LL7A 4BY1J 2FQ4A 5E3NA 2PJPA 2JRMA 2X6XA 3V4GA 1UAAA 1UG0A 5DUKA 1QZZA 3ZMTA 2R7WA 1K78A 3CQZJ 1X2MA 3SXYA 5EEAA 3FBNB 4F52A 4HF2A 1X2NA 3VEPA 4OIRF 2Z99A 3WHBA 2J5OA 2JUCA 4BY7J 2E1CA 3BPXA 3DPTA 3WHCA 2K5CA 3C1DA 2UUZA 2KMUA 5E1XA 1R00A 2R7FA 2WY7Q 2E71A 3ZQLA 2XAQA 2MG4A 1E3HA 2VT3A 2M0CA 4FETA 4LJZF 3DKWA 3MCZA 4D5CA 4AIHA 3IH4A 4HV6A 4N4OB 3LFKA 3V8KA 2HTSA 1UFMA 3J81Z 5FKLA 4EJTA 3HRUA 3H3VK 3S16J 3JRAA 5EJCA 1N77A 2DOFA 3GVAA 4DZPA 4RS8A 3TO7A 2K9MA 5KK1A 1EA3A 3TL4X 1FNNA 3J80K 1A36A 3A01A 2FNAA 1N78A 1Z7UA 1J75A 4ZC3A 5ICCA 4FTHA 1KGSA 3KP7A 2ELKA 4RGUA 3VSKA 1O3RA 4Q4ZF 1W1WE 2VBWA 1IRXA 1ETYA 2R0QC 1ZR4A 3IV5A 2HVQA 4BGDA 3MKWB 2OQGA 2IS6A 1RUNA 2M8EA 3LAPA 2IP2A 3DQVC 1AU7A 5H6QA 5B66C 1W4MA 2VC1A 3K4BA 3R6SA 3DU5A 1Y8QB 3FZVA 3UNGC 2QBYB 3HG9A 1TQIA 3H0GJ 3DEEA 2LVSA 5L3GA 2OD5A 3J7AY 1R36A 1TTYA 2V7FA 1MDMB 2IGOA 2K4BA 1YG2A 1ZTRA 3HBLA 3L00A 4BQNA 2RNGA 2RV8A 2YX7A 3CC7I 2JA2A 3REOA 1MH3A 5FFXA 2M2EA 3OYBA 3ZGKA 4M74A 4D0PA 3I54A 3OS1A 1JGGA 5GADJ 1BI0A 1G3SA 4X0GA 3K0LA 1ZREA 4BQQA 4ESJA 1IXCA 1QHGA 2W57A 2GA1A 3LSGA 2ISYA 2PMZA 3KEYA 1I5ZA 3KCCA 2DYSH 2X85A 2HU9A 2K7LA 2EZLA 2GM4A 3BOQA 1TWHJ 3CMMA 5KVRA 1T0FC 3BZCA 3F8BA 1HA8A 3FIWA 1YITI 4XRFA 3M1EA 1P6RA 2DU9A 3VPRA 3CC4I 1S3JA 4F93B 1SEUA 5EDNA 1JTYA 2PMHA 2W24A 1LDKB 3V7SA 3NWTA 3SEZA 4D9JA 3RZOJ 3RQ4A 4XRMA 2LY2A 2Q8KA 4M6YA 1AKHB 2DN0A 3C2HA 3GTPJ 2K27A 4N9HA 5B5EC 2LSOA 1MBEA 4MHGA 2R7TA 2JMWA 5B1AH 2QQBA 2VIXA 3E5UA 3J7YJ 3CCYA 4HW0A 3K1NA 4PJNA 1KZHA 1N25A 1ERDA 2HFHA 2HYGD 4RM2A 3OYIA 1MJAA 4G6TB 4AYBA 2HPIA 3ZMUA 1O3QA 1RC9A 1G4DA 2QSHX 2XKPA 2V79A 2EV0A 3VYRB 2XVCA 3JRBA 4PFOA 3GCMA 1HQCA 2OV7A 2VC0A 4Q5SF 1MBFA 1UCRA 1XGOA 1Q1VA 1PUEE 5JFRA 2ME6A 4P55A 1WJ5A 1RETA 3TO9A 3CCMI 5JVGF 3GFJA 2HYJA 3CCJI 2DO7A 3CMEI 1L0OC 5GAEJ 2Z9OA 1DGWY 2KL4A 3I64A 1X3ZB 4V2GA 2ZFWA 1IDZA 3HL2A 5GPCA 2ZO4A 3E6BA 4U7BA 1YI2I 2M7BA 4LG0A 1X1CA 3K10A 5BMZA 2DTRA 2LBFA 1JUMA 2KZVA 2YR2A 1XDUA 2VONA 4XKWA 3K69A 4L0YB 4UXNA 1LJ9A 4CCMA 5AIPA 2OC6A 1XDSA 5FLVA 3WTSC 1I1GA 1Z6TA 3FXLA 3S3NA 4O6JA 1VQ5I 1J7KA 2CMPA 3C7JA 3ELKA 2XHKA 3EUAA 2JSCA 2DQRA 3PNTA 1WH7A 2IRFG 2P4WA 4B47A 1UJ8A 3T8RA 4L9TA 2FSWA 2IS1A 3LSHA 3GBGA 4U0YA 2HQRA 2ZXHA 3K4CA 1ON2A 1SFXA 2DT6A 4NDLA 4CHUA 1OR7C 2NAZA 4WX9A 2E2JJ 2NOJB 1NTCA 2EZKA 4ZJZA 5CVVA 3BCBA 4I7HA 4EJUA 3HEFA 5GPAA 3L2VA 4II3A 1MSFC 1VQ9I 1OLTA 4PCQA 2QA4I 1UB9A 2OF7A 4X6AJ 3MEXA 2A6EF 4NC8A 4AIJA 2VJ5A 3WTXC 4PFPA 2W84A 4PZJA 2TCTA 3FM5A 1H89C 5LGNA 3RPUD 4MLOA 1V5GA 1WJDA 2LDUA 2ELJA 4BS9A 1HSJA 2LYCA 1RKTA 2JN6A 2KRHA 1RRJA 3HUGA 5LRSA 5F0CA 1VQ7I 1LVKA 3IC7A 3HOXJ 1D8JA 2JJ7A 4BXFA 2K40A 1SAUA 3OSFA 2VOPA 3KZYA 3O8GA 1KA8A 1ZG3A 2O7OA 1X3UA 2XDVA 2CGPA 2NS7A 2RDPA 3M1CA 2XB5A 3JR9A 2LY1A 2LH9A 4S05A 1YW7A 5CLSA 1J5YA 4JOMA 3PIOF 3L2UA 4A3BJ 1J09A 5DS9A 2CFXA 1ZRFA 2OAZA 3ABTA 3I71A 2I8DA 2RKHA 3QODA 3L2QA 1MBHA 3ZP5A 3FMSA 1TZLA 2NRAC 5D5WB 3ESWB 1IZ1A 2PMZN 1X4OA 1RPWA 3CJTB 5FFZA 3GO5A 3KE2A 4XOPA 1R22A 3GTLJ 4YEJA 1Z3XA 3TBIA 3MKZA 1YJNI 5EYRA 2O0YA 4HG2A 2MD5A 3O2PE 4HZFA 3I55I 3GX4X 3E97A 3EYIA 2DODA 1FBUA 2LKPA 4RGRA 3OYAA 3QOPA 2OZ6A 4G7ZF 1HW2A 4HBLA 2PJRA 3LAJA 4JP0A 2L01A 1O57A 2A5YB 1S5LC 2BVMA 2KDOA 5C3EJ 2XSJC 2QENA 4OWRB 3ZXSA 2YS9A 1TNSA 4A6EA 2L3DA 2ME0A 2F5VA 1FYKA 2QQ9A 5C4XJ 2F6CA 1Z91A 3CUQB 2K3FA 3LNQA 4XN3A 5DYMA 2H8RA 1P92A 1QVUA 1U78A 2P81A 2VKEA 4AYBN 5EG0B 1SFEA 4E7IA 2AXTC 3EDPA 3E3VA 2CU7A 4E70A 4AM3A 5LRRA 1LDDA 1Z7LA 3BJAA 4H0EA 3H5NA 2K9NA 1RNLA 2HZDA 2H94A 1FOKA 1Y6IA 3F6VA 1LUJB 5JLXA 2E5NA 4UVCA 1E0EA 3ASOH 5TISC 4OMZA 1B8IA 1I3QJ 2ID3A 4ZDOA 3GFLA 3DWLE 2EIMH 1J0RA 3M8FA 4Y33A 1ETVA 2HDWA 2UZKA 2WAFA 3FM3A 4YFNF 1WRJA 1FJLA 5J8FA 4C3IJ 1B72B 3A01B 3K1PA 4QPQA 3OYEA 1T8IA 2F48A 3H92A 2ISZA 3ROUA 3KYLA 1DDNA 3H1CA 1WGXA 3BQYA 4RB2C 2LREA 5HLHA 2HXIA 3HSEA 2QSFX 5DCMA 2M9HA 3VYTB 2Z3YA 4AVZA 3S1MJ 4A3JJ 4U87A 2YX4A 5FGMA 1K4TA 3WTWC 2ZMEB 2CQ7A 4ESBA 2E1NA 3PQKA 4WXCA 1U5TB 3L1PA 2J5PA 2KPMA 4E4HA 3COAC 3G3ZA 2VB6A 4G7HF 5E79C 4UUSA 2ID6A 4NNJA 3CD6I 4IOCF 2CRGA 4RLQA 2XAJA 3LSPA 1BBYA 2W7NA 4RBOA 2BY2A 3BPVA 2WA0A 4HAMA 1S6LA 1WKMA 1Y1VJ 3GLLA 2LR8A 3K6GA 1REPC 5J3LA 2CV2A 1TW2A 3L2RA 2EZHA 2CQKA 3HHGA 2NVQJ 4OOIA 5CQEA 2M3AA 3HHHA 1T0FA 4WWCA 1STZA 3LOCA 4ZYHA 3OS0A 2CV0A 2O3FA 1MIJA 1OFCX 1WCMJ 2GIZA 3FK6A 2A05A 1T98A 2X51A 4M9ZA 1QGPA 1MNMC 2EA4A 5L3BA 2A61A 2E60A 3HSRA 4PJJA 2IS2A 4NC7A 3D5SC 2Y69H 4JBAA 1Z1DA 1DU6A 4PDKA 4OIOF 4YG2F 2IS4A 3R60A 2ZXIA 3QYEA 2FOWA 3QU3A 3ZQCA 3H9JA 4FE7A 2GWRA 2V9VA 5DV5A 1V3FA 2DI3A 3U1KA 2DMNA 1EH8A 5BPIA 2FJ1A 1HXDA 3IWZA 2RGVA 3WG9A 1MMGA 1BR4A 2G9WA 2Q2EB 2VXDA 2QKLB 5EEGA 1R5GA 3QYFA 1Y0NA 1YRNA 1R1TA 4GFBA 2GXGA 3OS2A 2R7RA 3GTMJ 3S2HJ 4A3FJ 3Q9SA 1R58A 2PEXA 5CVRA 3B73A 4YFXF 3P9CA 3FWEA 5GTHC 4V19K 3A1YA 5J6XA 2KDZA 1FWZA 2EZIA 1P2FA 4RM3A 3TO6A 3IRQA 4M3EA 2HVSA 5H20A 1GVJA 1OYWA 4A3DJ 3DLLF 1R23A 1S7EA 1A6IA 5B3SH 1UHMA 4IF4A 5IPAA 4EGZA 4N4NB 9ANTA 1POGA 1J9IA 4M6VA 5L3FA 3K1MA 2ZBKA 5LGUA 4E7SA 1KQ9A 4XQFA 1P4WA 2JTVA 3PNYA 2KISA 1GUUA 3I4NJ 2E1MB 3O8HA 3DEWA 4EM0B 2Z1DA 3PFYA 2A6TA 3HM5A 3P9KA 3QOEA 1HW1A 4KIGA 3P5JA 1HDPA 5E3LA 1I6XA 4NBQA 2IT0A 2JZYA 1PDNC 1IUFA 2LBFB 4KN7X 2EQRA 3OSGA 2LP0A 3IKVA 3VYSB 3CMAI 5D6FA 3KYDB 2FA5A 2CV1A 1KU3A 2L7ZA 2X6OA 1E3OC 1OR7A 4V2FA 3TDUC 2HKOA 1WWXA 4L9VA 4FT8A 3RZDJ 2LMDA 4KN4X 3HOUJ 5E1ZB 1SFKA 2L0KA 2E5ZA 1QZEA 3V42A 1BOAA 1QPMA 3DBLB 5E8IA 3CCVI 4XRSA 1HCRA 1QHHD 4L5EA 3BG7A 3RKYA 4OAZA 3HIFA 4LFUA 4AC0A 2L2OA 2QM3A 1ZLJA 4JQFA 5TGTA 4ESFA 2DA2A 5K1YA 5D4RA 3FF5A 2PX9A 3MD2A 3TDZC 2OPTA 4RGXA 2WC2A 1SD5A 2QLZA 3T1BA 2EB7A 3KZIC 5D8KB 1TT5B 5D5XB 5C4JJ 3Q0VA 5FRMA 4BEHB 2STTA 4S0HB 1WSUA 4E7HA 2ZNYA 4LLGF 1YX5A 3N05A 4BAYA 1D3YA 1ZGAA 2VBYA 4GYGA 3HOSA 2VXZA 5IT3A 2XV4S 2VI6A 4EATA 4PSXA 4MIMA 3BTLA 2LC2A 4D7NA 3I0TA 2QZ8A 5IT9K 3JCUC 3HUGB 2W1OA 1VQ8I 4NB5A 2R7XA 1JXSA 3GW2A 2HNHA 2VE9A 4XICA 1V54H 1SMTA 1S9HA 1ONVA 3FXJA 4N9IA 3SFIA 3V7RA 3R61A 1MNDA 1ZK8A 3DV8A 2KIMA 2V1DA 2EH3A 2NS0A 3QP5A 5A2QK 1PVEA 2F5CA 3ONQA 2EILH 3DF8A 5M5WJ 3MKLA 3SDGA 3I4MJ 5KNLA 4AD9A 1WH5A 1S29A 4A69C 1HKQA 1WJCA 2DFFA 2OCCH 4B3AA 2RNJA 3RDIA 3K2AA 4CO8A 5F0FA 4RB1A 2OCEA 1D1AA 1VQ6I 5D5VB 1BI2A 2IGNA 3T0YA 4WF2A 4DW6A 2B0LA 5IY5H 3BDDA 1JGSA 4E7ZA 3S3OA 4I0BA 1D0XA 3HOZJ 5BOXA 1IN7A 1KQ0A 4XLCA 3PO3J 1CF7B 1D1CA 1S8NA 2LY9A 3PSIA 4C3HJ 4OAYA 3GZ5A 2PJRB 1UZCA 2BZTA 2MYSA 3C18A 2AS5F 1KQ8A 1Y0UA 2HOEA 5LHIA 1SANA 3MKYB 2DW4A 1XCBA 2O8KA 3OR1C 3OYGA 2FX0A 2WV0A 4ZZLA 4B8XA 1IUYA 4KT5C 4A3KJ 2M0MA 4NQWA 2FXAA 1Q1HA 4HNVA 2C6YA 1IF1A 3S17J 3K4KA 3J81K 2OA4A 5FKMA 2BY1A 3K4JA 3VDXA 5E17F 4MFEA 2QCOA 1M1EB 4JK1X 4QPOA 3AL0B 2DCEA 3BR2A 4A0YA 3QPLA
chains in the Genus database with same CATH topology
2HKXA 4HF1A 4IPAA 1SD4A 1DPUA 1LDJA 1R1VA 3GWZA 2COMA 1TLHB 1F4KA 3KETA 4M9SA 2FNPA 2DBBA 1B9MA 2R3SA 2Y0MA 2CYYA 3F8FA 3WGHA 1IRGA 3QP6A 3K9TA 4PGHA 3IL2A 2PBIA 1FY7A 1T6SA 3E5XA 2RVCA 1ZG5A 1B59A 1LVAA 2EA2A 2P5KA 4IHSA 4KDPA 2GQQA 2EWNA 4CYDA 1ZRDA 1YW8A 2WWYA 3BZ6A 1LQ1A 1BC7C 5ILSA 3IHUA 2M87A 3CO7C 2YPRA 2M1BA 5DD4A 5K5OA 3KP5A 3S2WA 4MNUA 1DUXC 4EJVA 4L5JA 3DEUA 3E6MA 2X0LA 4R8HA 3JSOA 4ETSA 1IAWA 2TDXA 4I02A 1A04A 3ZN0A 2D1VA 2ESNA 2Y75A 4XBFA 2UXNA 3FXUA 1C0WA 3FMQA 3JTGA 2BYVE 5HS7A 1IN8A 5ICFA 1W7PB 4ENNA 3CLOA 1QNTA 4O5VA 5LBQA 4XLPF 1ZARA 2XASA 1HKSA 2P7VB 4RB0A 3P7NA 1FYMA 2DQLA 1OYIA 3ZMDA 4CDGA 4EGYA 1T39A 5LHHA 1J2XA 4NHJA 3LQQA 2ZNZA 1GXQA 3SQNA 3F6OA 2KKOA 1QBJA 3L09A 2YU3A 3F8MA 1B9NA 1ODDA 2UXXA 3JAMZ 1YIOA 5BPDA 5ICGA 1HBXG 2BGCA 1P4XA 4YIFA 1T2KA 1RIOH 2NNYA 2EK5A 2V1XA 4GO1A 1SMYF 4ZH4F 4DNCA 1GXPA 2E7XA 2Z5UA 4LMYA 1FZPB 4FX0A 2LF7A 1O3SA 3ZMSA 4G7OF 4OINF 1SAXA 2FQ3A 2MLGA 3ABUA 2VBXA 2GIVA 3FXQA 3FMRA 3HSFA 2MH9A 2W85A 1AOYA 4XSZF 2DK8A 3DFGA 3GZ6A 3I59B 5E8GA 4A0ZA 3F8NA 1LNWA 5HS8A 2MC3A 4R79A 5K5RA 1Z05A 2KJBA 3D5LA 1YYVA 2HTJA 5DEQA 2V6CA 2PMUA 1FX7A 2MA3A 2MH2A 4U7DA 3MQ0A 5J8CA 3VFZA 1O3TA 1XMAA 2F5DA 4GYIA 1BI3A 4CXFA 2WTEA 2LF8A 4KIFA 1ZN2A 1W7PD 1XGMA 5JI6A 4FX4A 1XSXA 4F7ZA 2PG4A 3ZQ7A 2P6SA 5HDGA 3DP7A 5HOOA 4UNOA 3IWFA 1E17A 1YO5C 2DFIA 4GXOA 5E20A 2IA0A 3KLNA 2FBHA 1PP8F 2JPCA 3RPQA 4BQAA 4Z2YA 3KLOA 2E7WA 2OZUA 1K78B 3G73A 2DK5A 4EM2A 2MBFA 3F22A 3O3KA 2XAFA 5LHGA 1SD7A 1EV7A 5FD6A 4WCGA 1U3EM 1YS7A 5F6FA 4LGWA 3TGNA 1IN5A 2XROA 4KMUX 4EVIA 2A07F 3W6JB 1BN5A 3ECHA 1G6NA 4IRHA 3CDHA 2IA1A 1XD7A 2BE5F 1YTYA 2A3SA 4TV7A 2VODA 4IHTA 3WGIA 1CGPA 2M45A 3CUQC 3J7AO 2P6TA 4A5MA 2D2WA 4G94A 2D45A 4P5OA 4I98B 4ENJA 2EFQA 2QWWA 2FRHA 4A12A 3WU1B 4HA8A 4L9NA 1FSHA 3BJ6A 1TQPA 2JT1A 4WK8F 3WTUC 1BIAA 1EH7A 5DD8A 4Q48A 4A2UA 1MJ9A 2O61A 1ZHFA 3GEZA 1XGNA 1ZYRF 4AVPA 4M9XA 4MGRA 3F8CA 4ZYGA 2RC4A 4M6XA 3RPUA 3RI4A 3TQNA 1Z9CA 1MDMA 4I09A 2CSOA 4EJOA 4G8XA 1U5TC 3PQJA 1KYZA 3U1DA 4ZYDA 5D5UB 3MFKA 1XB4A 3RIRA 1SFUA 5FLXZ 1WI9A 3FX3A 3LWFA 3CO6C 1K79A 3GXOA 2UWMA 3RYPA 3SZTA 1RI7A 2M5WA 3F3XA 1XSVA 1UHWA 3QAHA 1USSA 4CGZA 4Y13A 2HDCA 5CVUA 4HQMA 1G3TA 5FO5A 4LG0B 5CVIA 1XGSA 1H9TA 2VN2A 3JTHA 2HWVA 5D4SA 2Y48A 2XKOA 1BI1A 5JR3A 2ZJ2A 4BXUA 2CW0F 3E6DA 5TJJA 2K4JA 3H3ZA 2L02A 4L0ZB 4BH9A 3RTRA 3GFMA 3JW4A 4QWQA 2O6GE 4BHBA 4MEXF 2OQRA 5BQTA 1USTA 3M8EA 4LK0F 1KU7A 3RKWA 4IRGA 4AWXB 2KRFA 1ZAOA 2FMYA 2A68F 4KIBA 4KUMA 4ASNA 1JE8A 2NNNA 2L54A 1OMIA 5D8LB 5D6EA 1I27A 1YFHA 4LLNA 3F23A 3LQRA 2A6HF 2OBPA 3C3WA 1F9NA 2VE8A 3GYHX 1MZBA 4RAZA 2GAUA 3I4PA 2EJRA 4UVAA 2W25A 3KEOA 4LD5A 4M71A 2ESHA 3TOAA 3QU6A 1H9GA 1YW9A 1D8KA 4RB3C 5DCFA 3L2CA 3WE2A 3HRSA 3LA3A 5LEJA 2CWEA 3HTUA 2F5FA 2XRNA 1QZYA 3Q5FA 1IN4A 1FLIA 3V8JA 5E1WA 3T8TA 5ILUA 2QYOA 5CJ9A 3KZZA 4L9JA 2FBIA 3HRMA 4EM1A 4XLNF 3LSTA 5HLIA 4MQVA 2BEOA 3ZPLA 5L3CA 4PGGA 2K02A 1R1UA 4BYYA 2IJLA 3CUQA 1NHAA 4HQEA 4I01A 1BM9A 1FBQA 1XMKA 3WTZA 1H0MA 5K5QA 1OKRA 4UUVA 2STWA 1YLFA 3JSPA 4HDUA 2DAOA 2H09A 3IRRA 1OPCA 1O7FA 3HOTA 4U0WA 1F1ZA 5DCMB 4HLXA 3TKYA 3N4MA 4WXHA 4I0AA 3M9AA 4HF0A 4DQ2A 1K6OA 3VODA 4HOBA 1JHHA 1XCVA 5HDKA 5LLQA 2R7DA 3WE3A 4UHTA 1LEAA 3QPTA 5HLGA 2ZMEA 1U5TA 2ADUA 3J80Z 2PFBA 1DPRA 1IRFA 1FBSA 3CUOA 2ACJA 2V1UA 2DPUA 1HSTA 4N0BA 2EFNA 3BROA 1O7LA 5HVQC 2AXLA 1HW5A 3MZHA 4CICA 2EV5A 2ZXJA 3BP8A 4Y17A 2HR3A 4A6DA 4OIQF 4UV9A 3SFZA 2FE3A 3T5XA 3JAMK 2QQAA 3KP4A 2ELHA 3D0SA 5BS6A 2ZCWA 2IW5A 3ULQB 5ILVA 2Q2EA 2F2EA 4BHPA 1MGTA 3MWMA 1B6AA 4LB5A 4MTEA 4LLLA 2XIGA 1YQAA 1U8RA 2HEOA 2OU2A 1R7JA 4IJAA 2LNBA 2PI0A 2HYFA 4ZZDA 1T38A 5TRDA 1TW3A 5L3EA 5DUIA 3LA2A 3ECOA 3OOPA 3MAJA 4M73A 4CZZA 5AONA 2F5EA 2CO5A 2XAGA 2KJCA 2IPQX 4UVBA 1F5TA 2HGCA 3KP3A 3ERED 4K2EA 1AWCA 2L4MA 1ZRCA 3HYIA 1FSEA 1QQIA 3W6KB 2IVMA 4Q47A 5DDGA 3DXJF 4A0XA 5ED4A 2CG4A 5ICEA 4LK1F 3VB2A 4ENKA 4KA4A 2Q0OA 3R0JA 2O8XA 3WODF 4HYEA 3NQOA 3U9GA 4EV0A 4BHCA 2FBKA 3I53A 4BNCA 3Q9VA 3EUHA 1OYYA 1RUOA 1KU9A 3P9IA 1BC8C 4AIKA 1RZ4A 1VTNC 4R1HA 1IW7F 4M72A 1LB2A 2EFWA 3F72A 3RKXA 3GUDA 2VBZA 3CTAA 4KYWA 3ISPA 4RGSA 2FMLA 4U0VA 5CYVA 4IXAA 3ZN1A 2EFPA 4GGGA 2PQ8A 5HDNA 2P5VA 3OV8A 3CJNA 1E2XA 5ERIA 4YFKF 3WTYC 2NYXA 4ENMA 1J59A 2RQPA 1MD0A 3IKTA 4UV8A 1ULYA 1CF7A 1IN6A 3VOEA 2ETHA 3I5UA 4L5IA 4A5NA 1IXRC 5JHUA 2H6BA 1L3LA 3GF2A 4YIIA 3BJOA 3KP2A 5CVJA 4KMFA 4HV5A 2BBYA 3KFWX 4IRIA 4IVNA 3EYYA 3SZPA 5HS9A 2EV6A 1ZH5A 1DP7P 3H3UA 2QVOA 1TQMA 2G7UA 2HZTA 3I58A 4LB6B 3HRTA 4GCVA 1ZG1A 1P4AA 1TBXA 2VT2A 3N97A 1W5TA 1HKTA 5L3DA 3V7CA 2DT5A 2K86A 4HX8A 1W5SA 4MEYF 2O03A 4KICA 2A69F 4RAYA 3QRFF 3U2RA 2JPBA 4G6DA 2HS5A 1R5HA 3QPHA 3EETA 4EQQA 5FLXK 3ML6A 2QBYA 2BV6A 2X4HA 3E6CC 4O3MA 2DPDA 2PLYA 2QUFA 3K2ZA 1FP1D 4QLCU 3V8LA 1ZGJA 4G6QA 2HQNA 4XSXF 1BJAA 5FB2A 3L9FA 4HLYA 3R4KA 3RJPA 2XGXA 3WGGA 2YSRA 6PAXA 1W7PA 3DPLC 5FD5A 1G3WA 5F1RA 5AIQA 2H6CA 3ZMVA 2M30A 4L18B 1XSDA 1FT9A 3M7GA 3BWGA 1KU2A 4P9UA 1EH6A 4U88A 4P9FA 2FOKA 3R0AA 3LA7A 3ZMZA 3BY6A 1TNTA 5H6RA 4WXDA 1FYLA 3GLXA 2ZKZA 2G7HA 2L4AA 4OU0A 4MQ9F 3TOBA 1U6GA 1XN7A 3AAFA 2VOOA 1JHFA 1SD6A 1G3YA 1D5VA 3NRVA 3KEQA 4EMSA 1Z6RA 3NEUA 3WTVC 4FHTA 3GFIA 1FC3A 3PFIA 2FF4A 5EEHA 4OMYA 1FP2A 2Z33A 3F21A 2FEZA 2H27A 4ZYEA 2JRTA 4Y15A 2KIUA 1KYWA 1V4RA 4P96A 3EQLF 1YS6A 3L7WA 4EJWA 4OIPF 1QO0D 2GA2A 1GHCA 3WU0A 2GXBA 4I2OA 3WTTC 2D1HA 3SHFA 1B4AA 2EFOA 5F64A 4ON0A 2KIFA 2XAHA 2FU4A 1MKMA 1S7OA 2DLLA 3I59A 1BIBA 5E18F 1WQ2A 2RN7A 3MZYA 1S7AA 2XUBA 1FPQA 1IXSB 4HX7A 3RYRA 2IA2A 4MTDA 5LGTA 4HDVA 1ON1A 4S04A 3O6BB 2GZWA 1ZLKA 3HTSB 3FXRA 1I1SA 4G9YA 1PP7U 2P5LC 1U2WA 5IT9Z 1MJBA 5LEKA 1LEBA 2MLKA 3FHZA 2P8TA 3B02A 3KP6A 1B1BA 5A2QZ 3E5QA 4B09A 2PN6A 5JVTA 2P7CB 4KNYA 4KFCA 1K7AA 4HX4A 2PJPA 3V4GA 5DUKA 1QZZA 3ZMTA 1K78A 3SXYA 4HF2A 3VEPA 4OIRF 2Z99A 2J5OA 2E1CA 3BPXA 3DPTA 3C1DA 5E1XA 1R00A 2R7FA 2XAQA 2VT3A 4LJZF 3DKWA 3MCZA 4AIHA 4HV6A 3LFKA 3V8KA 2HTSA 1UFMA 3J81Z 4EJTA 3HRUA 3GVAA 4RS8A 3TO7A 5KK1A 1FNNA 3J80K 2FNAA 1Z7UA 1J75A 5ICCA 1KGSA 3KP7A 4RGUA 1O3RA 4Q4ZF 2VBWA 2OQGA 1RUNA 3LAPA 2M8EA 2IP2A 3DQVC 5H6QA 1W4MA 2VC1A 3R6SA 3FZVA 2QBYB 1TQIA 5L3GA 2OD5A 1R36A 1TTYA 1MDMB 2K4BA 1YG2A 3L00A 2RV8A 2YX7A 3REOA 5FFXA 4M74A 4D0PA 3I54A 1BI0A 1G3SA 1ZREA 3K0LA 4ESJA 1IXCA 2W57A 2GA1A 2ISYA 1I5ZA 3KCCA 2K7LA 3BOQA 5KVRA 3F8BA 4XRFA 3M1EA 1P6RA 2DU9A 1S3JA 2PMHA 2W24A 1LDKB 3V7SA 2Q8KA 4M6YA 2K27A 4N9HA 2LSOA 4MHGA 2QQBA 3E5UA 4HW0A 3K1NA 2HFHA 2HYGD 1MJAA 3ZMUA 1O3QA 1G4DA 2XKPA 2V79A 2EV0A 2XVCA 1HQCA 2VC0A 4Q5SF 1UCRA 1XGOA 1PUEE 5JFRA 4P55A 3TO9A 3GFJA 2DO7A 1L0OC 2Z9OA 3I64A 2ZFWA 2ZO4A 3E6BA 4U7BA 4LG0A 5BMZA 2DTRA 2YR2A 2VONA 1XDUA 3K69A 4L0YB 4UXNA 1LJ9A 5AIPA 1XDSA 3WTSC 1I1GA 1Z6TA 4O6JA 1J7KA 3C7JA 3ELKA 2XHKA 2JSCA 2DQRA 2IRFG 2P4WA 3T8RA 4L9TA 2FSWA 4U0YA 2HQRA 1ON2A 1SFXA 4CHUA 2NAZA 4WX9A 5CVVA 4I7HA 4EJUA 4PCQA 1UB9A 3MEXA 2A6EF 4AIJA 3WTXC 2W84A 4PZJA 3FM5A 5LGNA 2LDUA 1HSJA 3HUGA 5LRSA 3IC7A 1D8JA 2VOPA 3KZYA 1KA8A 1ZG3A 1X3UA 2CGPA 2RDPA 4S05A 1YW7A 5CLSA 1J5YA 2CFXA 1ZRFA 2OAZA 3ABTA 3I71A 2RKHA 3ZP5A 3FMSA 2NRAC 5D5WB 1IZ1A 5FFZA 3GO5A 3KE2A 1R22A 2O0YA 2MD5A 3O2PE 4HZFA 3GX4X 3E97A 3EYIA 1FBUA 2LKPA 4RGRA 4G7ZF 3QOPA 2OZ6A 1HW2A 4HBLA 3LAJA 2L01A 1O57A 2A5YB 2QENA 1TNSA 4A6EA 2L3DA 1FYKA 2QQ9A 1Z91A 3CUQB 5DYMA 1P92A 1U78A 1SFEA 3EDPA 3E3VA 4E70A 5LRRA 1LDDA 3BJAA 4H0EA 1RNLA 1FOKA 2H94A 3F6VA 4UVCA 4OMZA 3GFLA 1J0RA 3M8FA 2UZKA 3FM3A 4YFNF 1WRJA 5J8FA 3K1PA 3H92A 2ISZA 3ROUA 1DDNA 4RB2C 5HLHA 3HSEA 5DCMA 2Z3YA 2YX4A 5FGMA 3WTWC 2ZMEB 4ESBA 2E1NA 3PQKA 4WXCA 1U5TB 3COAC 2J5PA 3G3ZA 4G7HF 2XAJA 1BBYA 3BPVA 4HAMA 1S6LA 1WKMA 1REPC 1TW2A 3HHGA 2CQKA 4OOIA 3HHHA 1T0FA 4WWCA 1STZA 4ZYHA 2O3FA 1T98A 4M9ZA 1QGPA 2EA4A 5L3BA 2A61A 3HSRA 4JBAA 1Z1DA 4PDKA 4OIOF 4YG2F 3R60A 3QU3A 2GWRA 2V9VA 5DV5A 1V3FA 2DI3A 1EH8A 5BPIA 3IWZA 1HXDA 2RGVA 3WG9A 2G9WA 5EEGA 1R5GA 1R1TA 2GXGA 3Q9SA 1R58A 2PEXA 5CVRA 3B73A 4YFXF 3P9CA 3FWEA 5J6XA 1FWZA 1P2FA 3TO6A 3IRQA 5H20A 1GVJA 1OYWA 1R23A 1UHMA 4IF4A 4EGZA 1J9IA 5L3FA 3K1MA 2ZBKA 5LGUA 1KQ9A 1P4WA 2JTVA 4EM0B 3P9KA 1HW1A 4KIGA 1I6XA 2IT0A 2JZYA 1PDNC 4KN7X 3IKVA 5D6FA 2FA5A 1KU3A 1OR7A 3TDUC 2HKOA 1WWXA 4L9VA 4FT8A 4KN4X 5E1ZB 1BOAA 1QPMA 5E8IA 3RKYA 3HIFA 4LFUA 2QM3A 1ZLJA 4JQFA 4ESFA 5K1YA 5D4RA 3FF5A 3TDZC 4RGXA 2WC2A 1SD5A 2QLZA 3T1BA 2EB7A 5D8KB 5D5XB 2STTA 1WSUA 2ZNYA 4LLGF 4BAYA 1D3YA 3HOSA 1ZGAA 2VBYA 4GYGA 2VXZA 5IT3A 2XV4S 3I0TA 2QZ8A 5IT9K 4NB5A 1JXSA 3GW2A 2VE9A 1SMTA 1ONVA 4N9IA 3V7RA 3R61A 3DV8A 2KIMA 2V1DA 2NS0A 3QP5A 5A2QK 2F5CA 3DF8A 4AD9A 1S29A 1HKQA 2RNJA 3RDIA 4CO8A 4RB1A 5D5VB 1BI2A 3T0YA 4WF2A 2B0LA 3BDDA 1JGSA 4I0BA 5BOXA 1IN7A 1KQ0A 1CF7B 1S8NA 3GZ5A 3C18A 2AS5F 1KQ8A 1Y0UA 2HOEA 5LHIA 2DW4A 1XCBA 4ZZLA 2WV0A 4B8XA 1IUYA 4KT5C 4NQWA 2FXAA 1Q1HA 2C6YA 1IF1A 3J81K 2OA4A 5E17F 4JK1X 4A0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKX A;  4HF1 A;  4IPA A;  1SD4 A;  1DPU A;  1LDJ A;  1R1V A;  3GWZ A;  2COM A;  1TLH B;  1F4K A;  3KET A;  4M9S A;  2FNP A;  2DBB A;  1B9M A;  2R3S A;  2Y0M A;  2CYY A;  3F8F A;  3WGH A;  1IRG A;  3QP6 A;  3K9T A;  4PGH A;  3IL2 A;  2PBI A;  1FY7 A;  1T6S A;  3E5X A;  2RVC A;  1ZG5 A;  1B59 A;  1LVA A;  2EA2 A;  2P5K A;  4IHS A;  4KDP A;  2GQQ A;  2EWN A;  4CYD A;  1ZRD A;  1YW8 A;  2WWY A;  3BZ6 A;  1LQ1 A;  1BC7 C;  5ILS A;  3IHU A;  2M87 A;  3CO7 C;  2YPR A;  2M1B A;  5DD4 A;  5K5O A;  3KP5 A;  3S2W A;  4MNU A;  1DUX C;  4EJV A;  4L5J A;  3DEU A;  3E6M A;  2X0L A;  4R8H A;  3JSO A;  4ETS A;  1IAW A;  2TDX A;  4I02 A;  1A04 A;  3ZN0 A;  2D1V A;  2ESN A;  2Y75 A;  4XBF A;  2UXN A;  3FXU A;  1C0W A;  3FMQ A;  3JTG A;  2BYV E;  5HS7 A;  1IN8 A;  5ICF A;  1W7P B;  4ENN A;  3CLO A;  1QNT A;  4O5V A;  5LBQ A;  4XLP F;  1ZAR A;  2XAS A;  1HKS A;  2P7V B;  4RB0 A;  3P7N A;  1FYM A;  2DQL A;  1OYI A;  3ZMD A;  4CDG A;  4EGY A;  1T39 A;  5LHH A;  1J2X A;  4NHJ A;  3LQQ A;  2ZNZ A;  1GXQ A;  3SQN A;  3F6O A;  2KKO A;  1QBJ A;  3L09 A;  2YU3 A;  3F8M A;  1B9N A;  1ODD A;  2UXX A;  3JAM Z;  1YIO A;  5BPD A;  5ICG A;  1HBX G;  2BGC A;  1P4X A;  4YIF A;  1T2K A;  1RIO H;  2NNY A;  2EK5 A;  2V1X A;  4GO1 A;  1SMY F;  4ZH4 F;  4DNC A;  1GXP A;  2E7X A;  2Z5U A;  4LMY A;  1FZP B;  4FX0 A;  2LF7 A;  1O3S A;  3ZMS A;  4G7O F;  4OIN F;  1SAX A;  2FQ3 A;  2MLG A;  3ABU A;  2VBX A;  2GIV A;  3FXQ A;  3FMR A;  3HSF A;  2MH9 A;  2W85 A;  1AOY A;  4XSZ F;  2DK8 A;  3DFG A;  3GZ6 A;  3I59 B;  5E8G A;  4A0Z A;  3F8N A;  1LNW A;  5HS8 A;  2MC3 A;  4R79 A;  5K5R A;  1Z05 A;  2KJB A;  3D5L A;  1YYV A;  2HTJ A;  5DEQ A;  2V6C A;  2PMU A;  1FX7 A;  2MA3 A;  2MH2 A;  4U7D A;  3MQ0 A;  5J8C A;  3VFZ A;  1O3T A;  1XMA A;  2F5D A;  4GYI A;  1BI3 A;  4CXF A;  2WTE A;  2LF8 A;  4KIF A;  1ZN2 A;  1W7P D;  1XGM A;  5JI6 A;  4FX4 A;  1XSX A;  4F7Z A;  2PG4 A;  3ZQ7 A;  2P6S A;  5HDG A;  3DP7 A;  5HOO A;  4UNO A;  3IWF A;  1E17 A;  1YO5 C;  2DFI A;  4GXO A;  5E20 A;  2IA0 A;  3KLN A;  2FBH A;  1PP8 F;  2JPC A;  3RPQ A;  4BQA A;  4Z2Y A;  3KLO A;  2E7W A;  2OZU A;  1K78 B;  3G73 A;  2DK5 A;  4EM2 A;  2MBF A;  3F22 A;  3O3K A;  2XAF A;  5LHG A;  1SD7 A;  1EV7 A;  5FD6 A;  4WCG A;  1U3E M;  1YS7 A;  5F6F A;  4LGW A;  3TGN A;  1IN5 A;  2XRO A;  4KMU X;  4EVI A;  2A07 F;  3W6J B;  1BN5 A;  3ECH A;  1G6N A;  4IRH A;  3CDH A;  2IA1 A;  1XD7 A;  2BE5 F;  1YTY A;  2A3S A;  4TV7 A;  2VOD A;  4IHT A;  3WGI A;  1CGP A;  2M45 A;  3CUQ C;  3J7A O;  2P6T A;  4A5M A;  2D2W A;  4G94 A;  2D45 A;  4P5O A;  4I98 B;  4ENJ A;  2EFQ A;  2QWW A;  2FRH A;  4A12 A;  3WU1 B;  4HA8 A;  4L9N A;  1FSH A;  3BJ6 A;  1TQP A;  2JT1 A;  4WK8 F;  3WTU C;  1BIA A;  1EH7 A;  5DD8 A;  4Q48 A;  4A2U A;  1MJ9 A;  2O61 A;  1ZHF A;  3GEZ A;  1XGN A;  1ZYR F;  4AVP A;  4M9X A;  4MGR A;  3F8C A;  4ZYG A;  2RC4 A;  4M6X A;  3RPU A;  3RI4 A;  3TQN A;  1Z9C A;  1MDM A;  4I09 A;  2CSO A;  4EJO A;  4G8X A;  1U5T C;  3PQJ A;  1KYZ A;  3U1D A;  4ZYD A;  5D5U B;  3MFK A;  1XB4 A;  3RIR A;  1SFU A;  5FLX Z;  1WI9 A;  3FX3 A;  3LWF A;  3CO6 C;  1K79 A;  3GXO A;  2UWM A;  3RYP A;  3SZT A;  1RI7 A;  2M5W A;  3F3X A;  1XSV A;  1UHW A;  3QAH A;  1USS A;  4CGZ A;  4Y13 A;  2HDC A;  5CVU A;  4HQM A;  1G3T A;  5FO5 A;  4LG0 B;  5CVI A;  1XGS A;  1H9T A;  2VN2 A;  3JTH A;  2HWV A;  5D4S A;  2Y48 A;  2XKO A;  1BI1 A;  5JR3 A;  2ZJ2 A;  4BXU A;  2CW0 F;  3E6D A;  5TJJ A;  2K4J A;  3H3Z A;  2L02 A;  4L0Z B;  4BH9 A;  3RTR A;  3GFM A;  3JW4 A;  4QWQ A;  2O6G E;  4BHB A;  4MEX F;  2OQR A;  5BQT A;  1UST A;  3M8E A;  4LK0 F;  1KU7 A;  3RKW A;  4IRG A;  4AWX B;  2KRF A;  1ZAO A;  2FMY A;  2A68 F;  4KIB A;  4KUM A;  4ASN A;  1JE8 A;  2NNN A;  2L54 A;  1OMI A;  5D8L B;  5D6E A;  1I27 A;  1YFH A;  4LLN A;  3F23 A;  3LQR A;  2A6H F;  2OBP A;  3C3W A;  1F9N A;  2VE8 A;  3GYH X;  1MZB A;  4RAZ A;  2GAU A;  3I4P A;  2EJR A;  4UVA A;  2W25 A;  3KEO A;  4LD5 A;  4M71 A;  2ESH A;  3TOA A;  3QU6 A;  1H9G A;  1YW9 A;  1D8K A;  4RB3 C;  5DCF A;  3L2C A;  3WE2 A;  3HRS A;  3LA3 A;  5LEJ A;  2CWE A;  3HTU A;  2F5F A;  2XRN A;  1QZY A;  3Q5F A;  1IN4 A;  1FLI A;  3V8J A;  5E1W A;  3T8T A;  5ILU A;  2QYO A;  5CJ9 A;  3KZZ A;  4L9J A;  2FBI A;  3HRM A;  4EM1 A;  4XLN F;  3LST A;  5HLI A;  4MQV A;  2BEO A;  3ZPL A;  5L3C A;  4PGG A;  2K02 A;  1R1U A;  4BYY A;  2IJL A;  3CUQ A;  1NHA A;  4HQE A;  4I01 A;  1BM9 A;  1FBQ A;  1XMK A;  3WTZ A;  1H0M A;  5K5Q A;  1OKR A;  4UUV A;  2STW A;  1YLF A;  3JSP A;  4HDU A;  2DAO A;  2H09 A;  3IRR A;  1OPC A;  1O7F A;  3HOT A;  4U0W A;  1F1Z A;  5DCM B;  4HLX A;  3TKY A;  3N4M A;  4WXH A;  4I0A A;  3M9A A;  4HF0 A;  4DQ2 A;  1K6O A;  3VOD A;  4HOB A;  1JHH A;  1XCV A;  5HDK A;  5LLQ A;  2R7D A;  3WE3 A;  4UHT A;  1LEA A;  3QPT A;  5HLG A;  2ZME A;  1U5T A;  2ADU A;  3J80 Z;  2PFB A;  1DPR A;  1IRF A;  1FBS A;  3CUO A;  2ACJ A;  2V1U A;  2DPU A;  1HST A;  4N0B A;  2EFN A;  3BRO A;  1O7L A;  5HVQ C;  2AXL A;  1HW5 A;  3MZH A;  4CIC A;  2EV5 A;  2ZXJ A;  3BP8 A;  4Y17 A;  2HR3 A;  4A6D A;  4OIQ F;  4UV9 A;  3SFZ A;  2FE3 A;  3T5X A;  3JAM K;  2QQA A;  3KP4 A;  2ELH A;  3D0S A;  5BS6 A;  2ZCW A;  2IW5 A;  3ULQ B;  5ILV A;  2Q2E A;  2F2E A;  4BHP A;  1MGT A;  3MWM A;  1B6A A;  4LB5 A;  4MTE A;  4LLL A;  2XIG A;  1YQA A;  1U8R A;  2HEO A;  2OU2 A;  1R7J A;  4IJA A;  2LNB A;  2PI0 A;  2HYF A;  4ZZD A;  1T38 A;  5TRD A;  1TW3 A;  5L3E A;  5DUI A;  3LA2 A;  3ECO A;  3OOP A;  3MAJ A;  4M73 A;  4CZZ A;  5AON A;  2F5E A;  2CO5 A;  2XAG A;  2KJC A;  2IPQ X;  4UVB A;  1F5T A;  2HGC A;  3KP3 A;  3ERE D;  4K2E A;  1AWC A;  2L4M A;  1ZRC A;  3HYI A;  1FSE A;  1QQI A;  3W6K B;  2IVM A;  4Q47 A;  5DDG A;  3DXJ F;  4A0X A;  5ED4 A;  2CG4 A;  5ICE A;  4LK1 F;  3VB2 A;  4ENK A;  4KA4 A;  2Q0O A;  3R0J A;  2O8X A;  3WOD F;  4HYE A;  3NQO A;  3U9G A;  4EV0 A;  4BHC A;  2FBK A;  3I53 A;  4BNC A;  3Q9V A;  3EUH A;  1OYY A;  1RUO A;  1KU9 A;  3P9I A;  1BC8 C;  4AIK A;  1RZ4 A;  1VTN C;  4R1H A;  1IW7 F;  4M72 A;  1LB2 A;  2EFW A;  3F72 A;  3RKX A;  3GUD A;  2VBZ A;  3CTA A;  4KYW A;  3ISP A;  4RGS A;  2FML A;  4U0V A;  5CYV A;  4IXA A;  3ZN1 A;  2EFP A;  4GGG A;  2PQ8 A;  5HDN A;  2P5V A;  3OV8 A;  3CJN A;  1E2X A;  5ERI A;  4YFK F;  3WTY C;  2NYX A;  4ENM A;  1J59 A;  2RQP A;  1MD0 A;  3IKT A;  4UV8 A;  1ULY A;  1CF7 A;  1IN6 A;  3VOE A;  2ETH A;  3I5U A;  4L5I A;  4A5N A;  1IXR C;  5JHU A;  2H6B A;  1L3L A;  3GF2 A;  4YII A;  3BJO A;  3KP2 A;  5CVJ A;  4KMF A;  4HV5 A;  2BBY A;  3KFW X;  4IRI A;  4IVN A;  3EYY A;  3SZP A;  5HS9 A;  2EV6 A;  1ZH5 A;  1DP7 P;  3H3U A;  2QVO A;  1TQM A;  2G7U A;  2HZT A;  3I58 A;  4LB6 B;  3HRT A;  4GCV A;  1ZG1 A;  1P4A A;  1TBX A;  2VT2 A;  3N97 A;  1W5T A;  1HKT A;  5L3D A;  3V7C A;  2DT5 A;  2K86 A;  4HX8 A;  1W5S A;  4MEY F;  2O03 A;  4KIC A;  2A69 F;  4RAY A;  3QRF F;  3U2R A;  2JPB A;  4G6D A;  2HS5 A;  1R5H A;  3QPH A;  3EET A;  4EQQ A;  5FLX K;  3ML6 A;  2QBY A;  2BV6 A;  2X4H A;  3E6C C;  4O3M A;  2DPD A;  2PLY A;  2QUF A;  3K2Z A;  1FP1 D;  4QLC U;  3V8L A;  1ZGJ A;  4G6Q A;  2HQN A;  4XSX F;  1BJA A;  5FB2 A;  3L9F A;  4HLY A;  3R4K A;  3RJP A;  2XGX A;  3WGG A;  2YSR A;  6PAX A;  1W7P A;  3DPL C;  5FD5 A;  1G3W A;  5F1R A;  5AIQ A;  2H6C A;  3ZMV A;  2M30 A;  4L18 B;  1XSD A;  1FT9 A;  3M7G A;  3BWG A;  1KU2 A;  4P9U A;  1EH6 A;  4U88 A;  4P9F A;  2FOK A;  3R0A A;  3LA7 A;  3ZMZ A;  3BY6 A;  1TNT A;  5H6R A;  4WXD A;  1FYL A;  3GLX A;  2ZKZ A;  2G7H A;  2L4A A;  4OU0 A;  4MQ9 F;  3TOB A;  1U6G A;  1XN7 A;  3AAF A;  2VOO A;  1JHF A;  1SD6 A;  1G3Y A;  1D5V A;  3NRV A;  3KEQ A;  4EMS A;  1Z6R A;  3NEU A;  3WTV C;  4FHT A;  3GFI A;  1FC3 A;  3PFI A;  2FF4 A;  5EEH A;  4OMY A;  1FP2 A;  2Z33 A;  3F21 A;  2FEZ A;  2H27 A;  4ZYE A;  2JRT A;  4Y15 A;  2KIU A;  1KYW A;  1V4R A;  4P96 A;  3EQL F;  1YS6 A;  3L7W A;  4EJW A;  4OIP F;  1QO0 D;  2GA2 A;  1GHC A;  3WU0 A;  2GXB A;  4I2O A;  3WTT C;  2D1H A;  3SHF A;  1B4A A;  2EFO A;  5F64 A;  4ON0 A;  2KIF A;  2XAH A;  2FU4 A;  1MKM A;  1S7O A;  2DLL A;  3I59 A;  1BIB A;  5E18 F;  1WQ2 A;  2RN7 A;  3MZY A;  1S7A A;  2XUB A;  1FPQ A;  1IXS B;  4HX7 A;  3RYR A;  2IA2 A;  4MTD A;  5LGT A;  4HDV A;  1ON1 A;  4S04 A;  3O6B B;  2GZW A;  1ZLK A;  3HTS B;  3FXR A;  1I1S A;  4G9Y A;  1PP7 U;  2P5L C;  1U2W A;  5IT9 Z;  1MJB A;  5LEK A;  1LEB A;  2MLK A;  3FHZ A;  2P8T A;  3B02 A;  3KP6 A;  1B1B A;  5A2Q Z;  3E5Q A;  4B09 A;  2PN6 A;  5JVT A;  2P7C B;  4KNY A;  4KFC A;  1K7A A;  4HX4 A;  2PJP A;  3V4G A;  5DUK A;  1QZZ A;  3ZMT A;  1K78 A;  3SXY A;  4HF2 A;  3VEP A;  4OIR F;  2Z99 A;  2J5O A;  2E1C A;  3BPX A;  3DPT A;  3C1D A;  5E1X A;  1R00 A;  2R7F A;  2XAQ A;  2VT3 A;  4LJZ F;  3DKW A;  3MCZ A;  4AIH A;  4HV6 A;  3LFK A;  3V8K A;  2HTS A;  1UFM A;  3J81 Z;  4EJT A;  3HRU A;  3GVA A;  4RS8 A;  3TO7 A;  5KK1 A;  1FNN A;  3J80 K;  2FNA A;  1Z7U A;  1J75 A;  5ICC A;  1KGS A;  3KP7 A;  4RGU A;  1O3R A;  4Q4Z F;  2VBW A;  2OQG A;  1RUN A;  3LAP A;  2M8E A;  2IP2 A;  3DQV C;  5H6Q A;  1W4M A;  2VC1 A;  3R6S A;  3FZV A;  2QBY B;  1TQI A;  5L3G A;  2OD5 A;  1R36 A;  1TTY A;  1MDM B;  2K4B A;  1YG2 A;  3L00 A;  2RV8 A;  2YX7 A;  3REO A;  5FFX A;  4M74 A;  4D0P A;  3I54 A;  1BI0 A;  1G3S A;  1ZRE A;  3K0L A;  4ESJ A;  1IXC A;  2W57 A;  2GA1 A;  2ISY A;  1I5Z A;  3KCC A;  2K7L A;  3BOQ A;  5KVR A;  3F8B A;  4XRF A;  3M1E A;  1P6R A;  2DU9 A;  1S3J A;  2PMH A;  2W24 A;  1LDK B;  3V7S A;  2Q8K A;  4M6Y A;  2K27 A;  4N9H A;  2LSO A;  4MHG A;  2QQB A;  3E5U A;  4HW0 A;  3K1N A;  2HFH A;  2HYG D;  1MJA A;  3ZMU A;  1O3Q A;  1G4D A;  2XKP A;  2V79 A;  2EV0 A;  2XVC A;  1HQC A;  2VC0 A;  4Q5S F;  1UCR A;  1XGO A;  1PUE E;  5JFR A;  4P55 A;  3TO9 A;  3GFJ A;  2DO7 A;  1L0O C;  2Z9O A;  3I64 A;  2ZFW A;  2ZO4 A;  3E6B A;  4U7B A;  4LG0 A;  5BMZ A;  2DTR A;  2YR2 A;  2VON A;  1XDU A;  3K69 A;  4L0Y B;  4UXN A;  1LJ9 A;  5AIP A;  1XDS A;  3WTS C;  1I1G A;  1Z6T A;  4O6J A;  1J7K A;  3C7J A;  3ELK A;  2XHK A;  2JSC A;  2DQR A;  2IRF G;  2P4W A;  3T8R A;  4L9T A;  2FSW A;  4U0Y A;  2HQR A;  1ON2 A;  1SFX A;  4CHU A;  2NAZ A;  4WX9 A;  5CVV A;  4I7H A;  4EJU A;  4PCQ A;  1UB9 A;  3MEX A;  2A6E F;  4AIJ A;  3WTX C;  2W84 A;  4PZJ A;  3FM5 A;  5LGN A;  2LDU A;  1HSJ A;  3HUG A;  5LRS A;  3IC7 A;  1D8J A;  2VOP A;  3KZY A;  1KA8 A;  1ZG3 A;  1X3U A;  2CGP A;  2RDP A;  4S05 A;  1YW7 A;  5CLS A;  1J5Y A;  2CFX A;  1ZRF A;  2OAZ A;  3ABT A;  3I71 A;  2RKH A;  3ZP5 A;  3FMS A;  2NRA C;  5D5W B;  1IZ1 A;  5FFZ A;  3GO5 A;  3KE2 A;  1R22 A;  2O0Y A;  2MD5 A;  3O2P E;  4HZF A;  3GX4 X;  3E97 A;  3EYI A;  1FBU A;  2LKP A;  4RGR A;  4G7Z F;  3QOP A;  2OZ6 A;  1HW2 A;  4HBL A;  3LAJ A;  2L01 A;  1O57 A;  2A5Y B;  2QEN A;  1TNS A;  4A6E A;  2L3D A;  1FYK A;  2QQ9 A;  1Z91 A;  3CUQ B;  5DYM A;  1P92 A;  1U78 A;  1SFE A;  3EDP A;  3E3V A;  4E70 A;  5LRR A;  1LDD A;  3BJA A;  4H0E A;  1RNL A;  1FOK A;  2H94 A;  3F6V A;  4UVC A;  4OMZ A;  3GFL A;  1J0R A;  3M8F A;  2UZK A;  3FM3 A;  4YFN F;  1WRJ A;  5J8F A;  3K1P A;  3H92 A;  2ISZ A;  3ROU A;  1DDN A;  4RB2 C;  5HLH A;  3HSE A;  5DCM A;  2Z3Y A;  2YX4 A;  5FGM A;  3WTW C;  2ZME B;  4ESB A;  2E1N A;  3PQK A;  4WXC A;  1U5T B;  3COA C;  2J5P A;  3G3Z A;  4G7H F;  2XAJ A;  1BBY A;  3BPV A;  4HAM A;  1S6L A;  1WKM A;  1REP C;  1TW2 A;  3HHG A;  2CQK A;  4OOI A;  3HHH A;  1T0F A;  4WWC A;  1STZ A;  4ZYH A;  2O3F A;  1T98 A;  4M9Z A;  1QGP A;  2EA4 A;  5L3B A;  2A61 A;  3HSR A;  4JBA A;  1Z1D A;  4PDK A;  4OIO F;  4YG2 F;  3R60 A;  3QU3 A;  2GWR A;  2V9V A;  5DV5 A;  1V3F A;  2DI3 A;  1EH8 A;  5BPI A;  3IWZ A;  1HXD A;  2RGV A;  3WG9 A;  2G9W A;  5EEG A;  1R5G A;  1R1T A;  2GXG A;  3Q9S A;  1R58 A;  2PEX A;  5CVR A;  3B73 A;  4YFX F;  3P9C A;  3FWE A;  5J6X A;  1FWZ A;  1P2F A;  3TO6 A;  3IRQ A;  5H20 A;  1GVJ A;  1OYW A;  1R23 A;  1UHM A;  4IF4 A;  4EGZ A;  1J9I A;  5L3F A;  3K1M A;  2ZBK A;  5LGU A;  1KQ9 A;  1P4W A;  2JTV A;  4EM0 B;  3P9K A;  1HW1 A;  4KIG A;  1I6X A;  2IT0 A;  2JZY A;  1PDN C;  4KN7 X;  3IKV A;  5D6F A;  2FA5 A;  1KU3 A;  1OR7 A;  3TDU C;  2HKO A;  1WWX A;  4L9V A;  4FT8 A;  4KN4 X;  5E1Z B;  1BOA A;  1QPM A;  5E8I A;  3RKY A;  3HIF A;  4LFU A;  2QM3 A;  1ZLJ A;  4JQF A;  4ESF A;  5K1Y A;  5D4R A;  3FF5 A;  3TDZ C;  4RGX A;  2WC2 A;  1SD5 A;  2QLZ A;  3T1B A;  2EB7 A;  5D8K B;  5D5X B;  2STT A;  1WSU A;  2ZNY A;  4LLG F;  4BAY A;  1D3Y A;  3HOS A;  1ZGA A;  2VBY A;  4GYG A;  2VXZ A;  5IT3 A;  2XV4 S;  3I0T A;  2QZ8 A;  5IT9 K;  4NB5 A;  1JXS A;  3GW2 A;  2VE9 A;  1SMT A;  1ONV A;  4N9I A;  3V7R A;  3R61 A;  3DV8 A;  2KIM A;  2V1D A;  2NS0 A;  3QP5 A;  5A2Q K;  2F5C A;  3DF8 A;  4AD9 A;  1S29 A;  1HKQ A;  2RNJ A;  3RDI A;  4CO8 A;  4RB1 A;  5D5V B;  1BI2 A;  3T0Y A;  4WF2 A;  2B0L A;  3BDD A;  1JGS A;  4I0B A;  5BOX A;  1IN7 A;  1KQ0 A;  1CF7 B;  1S8N A;  3GZ5 A;  3C18 A;  2AS5 F;  1KQ8 A;  1Y0U A;  2HOE A;  5LHI A;  2DW4 A;  1XCB A;  4ZZL A;  2WV0 A;  4B8X A;  1IUY A;  4KT5 C;  4NQW A;  2FXA A;  1Q1H A;  2C6Y A;  1IF1 A;  3J81 K;  2OA4 A;  5E17 F;  4JK1 X;  4A0Y A; 
#chains in the Genus database with same CATH topology
 2HKX A;  2CW7 A;  3FKJ A;  3SEQ A;  4HF1 A;  2VLA A;  5FRO A;  4IPA A;  1SD4 A;  1DPU A;  1ZEL A;  1LDJ A;  1R1V A;  4HNT A;  3GWZ A;  2COM A;  1TLH B;  1F4K A;  3JRD A;  3KET A;  2DOE A;  4M9S A;  2FNP A;  2DBB A;  1NK3 P;  2CQX A;  1B9M A;  2R3S A;  2Y0M A;  2CYY A;  3F8F A;  3OR2 C;  3WGH A;  4AU7 A;  1XX5 A;  2I5U A;  1U0J A;  4BJT A;  3QP6 A;  5J1Y A;  3K9T A;  1IRG A;  4PGH A;  3IL2 A;  2PBI A;  4UY8 I;  1FY7 A;  1T6S A;  5E3M A;  1V5E A;  5GAG J;  1YJ9 I;  3E5X A;  4BBS J;  2JA7 J;  4QIW N;  2RVC A;  1ZG5 A;  1RES A;  1B59 A;  1D0Z A;  1LVA A;  2ICW G;  1LE8 B;  2EA2 A;  2P5K A;  3AG1 H;  2GOM A;  2XGC A;  4IHS A;  4KDP A;  4B43 A;  1OCR H;  2GQQ A;  3BR3 A;  2EWN A;  1PYV A;  4CYD A;  4XON A;  1ZRD A;  2L9V A;  1YW8 A;  3Q3S A;  2WWY A;  3BZ6 A;  2HQA A;  4XM3 A;  4ZDL A;  1LQ1 A;  1BC7 C;  5ILS A;  3IHU A;  2M87 A;  3CO7 C;  2YPR A;  2M1B A;  5DD4 A;  4UUS B;  5K5O A;  1BL0 A;  3KP5 A;  3S2W A;  3W3C A;  4MNU A;  1DUX C;  2XB0 X;  3UKG A;  2VL8 A;  4EJV A;  3ASN H;  3NWS A;  4L5J A;  2V26 A;  3TMO A;  2GLO A;  3DEU A;  1F43 A;  3E6M A;  2E19 A;  4NC6 A;  2X0L A;  4R8H A;  2R93 J;  3OYN A;  2W82 A;  3JSO A;  4ETS A;  1IAW A;  2TDX A;  4I02 A;  1A04 A;  3ZN0 A;  4C3J J;  2D1V A;  2ESN A;  4FAS D;  1R4M B;  2Y75 A;  4RDU A;  5HNF A;  4XBF A;  2UXN A;  1TL8 A;  3FXU A;  2JK3 A;  1C0W A;  4Y3O A;  3PUB A;  2WV1 A;  1SVM A;  3FMQ A;  3U21 A;  4BQO A;  3JTG A;  1Z21 A;  4PJL A;  1IDY A;  2AO9 A;  1OCZ H;  3OYF A;  1TWC J;  1XC5 A;  2Z2S B;  2BYV E;  5HS7 A;  1IN8 A;  5ICF A;  3D1N I;  1W7P B;  4ENN A;  2DMU A;  3CLO A;  1QNT A;  4O5V A;  4AUX A;  5LBQ A;  4XLP F;  1ZAR A;  3CES A;  2XAS A;  1HKS A;  2KFD A;  2P7V B;  1OQY A;  2L5Q A;  1S72 I;  4RB0 A;  3P7N A;  1FYM A;  2R7Q A;  2LKX A;  3DKX A;  4XK4 A;  3J7Z I;  2DQL A;  1OYI A;  3M4O J;  3EUK L;  3ZMD A;  4XKB A;  4CDG A;  2CFO A;  3BLY A;  4FE4 A;  4EGY A;  1Z67 A;  2QGU A;  3S32 A;  3CJR B;  1TP4 A;  4XOR A;  2ZJP F;  1T39 A;  2N8G A;  3ZCO A;  5LHH A;  1J2X A;  4NHJ A;  2VPL A;  3LQQ A;  3BR0 A;  3HGY A;  2ZNZ A;  1VQN I;  1GXQ A;  3SQN A;  4RLF A;  2M4G A;  3AG2 H;  1FTZ A;  3F6O A;  1W5C C;  2KKO A;  1VFC A;  1QBJ A;  4B48 A;  3L09 A;  4LIV A;  3RCO A;  2OTL I;  3A4C A;  1I50 J;  4CCN A;  2YU3 A;  3F8M A;  2RQQ A;  4F92 B;  1ZKG A;  1B9N A;  4BUP A;  2Y2Z A;  4ITV A;  1ODD A;  2R92 J;  2HPM A;  2UXX A;  1WZ2 A;  3JAM Z;  1YIO A;  2H1L A;  5BPD A;  5ICG A;  1HBX G;  2BGC A;  2W00 A;  1P4X A;  4YIF A;  1QA6 A;  5FLM J;  2R5Y B;  3E1S A;  1OJL A;  1T2K A;  1RIO H;  1SFO J;  2BHZ A;  2NNY A;  2EK5 A;  2ZJQ F;  2V1X A;  4GO1 A;  1Z77 A;  1SMY F;  4ZH4 F;  4DNC A;  1X1P A;  1GXP A;  4IQJ A;  2CUF A;  1EJ9 A;  2E7X A;  2Z5U A;  4DBQ A;  4LMY A;  1FZP B;  2GBY A;  4FX0 A;  2LF7 A;  3Q0W A;  1O3S A;  3ZMS A;  4G7O F;  4OIN F;  3FHN A;  1SAX A;  1Z0X A;  2CS3 A;  2FQ3 A;  2MLG A;  5M5Y J;  3A0B C;  4IHX A;  3ABU A;  2VBX A;  2GIV A;  3FXQ A;  1HDD C;  1MBK A;  3FMR A;  3HSF A;  1T08 B;  3A02 A;  2MH9 A;  4XMY A;  2IGM A;  2W85 A;  1FIP A;  3C2G A;  1AOY A;  4XSZ F;  3D5R C;  4CCO A;  2DK8 A;  2F4M B;  3G1M A;  3IH3 A;  3DFG A;  4F91 B;  3GZ6 A;  1IO2 A;  1RKW A;  3I59 B;  1ITY A;  5E8G A;  4A0Z A;  1OIS A;  1N75 A;  3F8N A;  1LNW A;  5HS8 A;  4PUS A;  1PUF B;  2VQG A;  2MC3 A;  4R79 A;  5K5R A;  1Z05 A;  2KJB A;  3D5L A;  2D5V A;  4LOC A;  1YYV A;  2HTJ A;  3CCE I;  1T95 A;  4GRI A;  4HEA 2;  5DEQ A;  2V6C A;  5FKN A;  2IXS A;  2PMU A;  1FX7 A;  1VND A;  2MA3 A;  2ECB A;  2MH2 A;  4U7D A;  1W36 D;  3MQ0 A;  5J8C A;  3VFZ A;  1O3T A;  2HDD A;  3FIS A;  1XMA A;  2F5D A;  4GYI A;  3JRH A;  5F27 A;  3G71 I;  1BI3 A;  5GTI C;  4CXF A;  2WTE A;  1RR7 A;  2LF8 A;  2ZSI B;  4KIF A;  3HC7 A;  4PSW A;  1ZN2 A;  2NS8 A;  1Y1W J;  1W7P D;  3B6A A;  1XGM A;  5JI6 A;  4BXX J;  1WJB A;  1X1B A;  5EGO B;  3IP4 B;  4B3X A;  4HST A;  4FX4 A;  3PUF A;  1XSX A;  4F7Z A;  2PG4 A;  1ZGW A;  3ZQ7 A;  2DA4 A;  2P6S A;  5HDG A;  3DP7 A;  5HOO A;  1WPK A;  4UNO A;  3IWF A;  1E17 A;  2VQL A;  4JX6 A;  1YO5 C;  1LFU P;  2DFI A;  4GXO A;  5E20 A;  2IA0 A;  1TWG J;  1MBJ A;  2MC4 A;  3KLN A;  2FBH A;  1PP8 F;  2JPC A;  3RPQ A;  4BQA A;  5CPR B;  3LMM A;  4Z2Y A;  3VSL A;  3KLO A;  2IGK A;  2E7W A;  2OZU A;  4F3Q A;  1K78 B;  2CW8 A;  3G73 A;  2MGQ A;  2DK5 A;  3JRE A;  3JRF A;  2BHY A;  2B7E A;  4EM2 A;  3CC2 I;  4I76 A;  2MBF A;  3F22 A;  4CCK A;  3GTG J;  4UUT A;  3O3K A;  2XAF A;  2DA1 A;  2QKM B;  5LHG A;  3PM1 A;  2X6Y A;  5CQG A;  1SD7 A;  4D7M A;  3OYK A;  3X2Q H;  1X19 A;  3CLQ A;  1EV7 A;  5FD6 A;  1NG6 A;  3ZQH A;  4WCG A;  1U3E M;  1YS7 A;  5F6F A;  4LGW A;  5F1J A;  3GME A;  4XOT A;  1IN5 A;  3I9V 2;  3TGN A;  2XRO A;  4LIU A;  3S93 A;  4KMU X;  4EVI A;  2A07 F;  3W6J B;  1BN5 A;  5F0H A;  2JUG A;  2DT7 B;  3CDL A;  3ECH A;  1G6N A;  3CP2 A;  4IRH A;  3CDH A;  5IYD J;  4Y52 J;  4XR6 A;  4A3I J;  2IA1 A;  3SJM A;  1XD7 A;  2BE5 F;  1YTY A;  2A3S A;  4TV7 A;  2VOD A;  3KYC B;  2K9L A;  2VQC A;  4IQ4 A;  4IHT A;  2NVU B;  4CCL A;  3WGI A;  1CGP A;  3NAR A;  2M45 A;  3CUQ C;  3J7A O;  2P6T A;  4A5M A;  3CCL I;  2R5Z A;  2D2W A;  1CQT A;  4G94 A;  2D45 A;  4P5O A;  4I98 B;  4ENJ A;  3B6C A;  4DOZ A;  2EFQ A;  2QWW A;  3S1Q J;  2FRH A;  4A12 A;  2BXY A;  3W2A A;  5K7Z A;  3WU1 B;  5JLW A;  1A35 A;  3A2K A;  2EIK H;  4HA8 A;  2P0W A;  4BKX A;  1A31 A;  4L9N A;  5IP9 J;  3CCS I;  1FSH A;  4EEF G;  4M3G A;  2NOG A;  3BJ6 A;  3ZRG A;  1TQP A;  2JT1 A;  4WK8 F;  3I56 I;  3WTU C;  2E36 A;  1BIA A;  1EH7 A;  5DD8 A;  4Q48 A;  4A2U A;  1MJ9 A;  4ZDP A;  2O61 A;  2KHM A;  1ZHF A;  3GEZ A;  1XGN A;  1ZYR F;  4AVP A;  4CH7 A;  4BAC A;  4M9X A;  2LRD A;  2WAQ A;  1R6R A;  4MGR A;  1W0T A;  3F8C A;  4ZYG A;  3L2W A;  2RC4 A;  4M6X A;  3RPU A;  3RI4 A;  4C2U A;  2R7V A;  2QSG X;  2OJE D;  4X1E A;  3TQN A;  1Z9C A;  1MDM A;  4I09 A;  2CSO A;  2WAE A;  4EJO A;  4G8X A;  2DJI A;  2VKD A;  1U5T C;  1MBG A;  3PQJ A;  1KYZ A;  3HB9 A;  3U1D A;  4ZYD A;  1DU0 A;  3CF2 A;  1DGR M;  2XPW A;  2OTJ I;  5D5U B;  3MFK A;  2R7O A;  3H9G A;  1XB4 A;  2Y9Y A;  3RIR A;  1SFU A;  3GTK J;  4F55 A;  5FLX Z;  3A0H C;  1BR2 A;  1WI9 A;  4J01 A;  3FX3 A;  2DOA A;  3CF5 F;  3LWF A;  3CO6 C;  1K79 A;  2JVG A;  3GXO A;  1XS9 A;  2UWM A;  1KON A;  1G8X A;  2KQR A;  3RYP A;  1GLN A;  2BW3 A;  3SZT A;  1RI7 A;  2BVL A;  2M5W A;  4IEJ A;  4D5F A;  5K7F A;  1JKQ C;  2DMQ A;  3F3X A;  3CCR I;  4D1Q A;  1WJA A;  3RKQ A;  5BNG A;  1XSV A;  1UHW A;  1AKH A;  4DYR A;  3QAH A;  2L9N A;  3DU6 A;  4DYC A;  1USS A;  1IGN A;  4CGZ A;  2DFH A;  4Y13 A;  1P7I A;  5CVU A;  2HDC A;  4HQM A;  5JHF A;  3ZQF A;  3ABK H;  3WU2 C;  1G3T A;  1R5I D;  5FO5 A;  1HC8 A;  2HVR A;  1Z3Y A;  2GXA A;  4LG0 B;  2O9L A;  1VQO I;  1I3A A;  3K4M A;  2F4I A;  5CVI A;  3DTK A;  3HXL A;  4BJ5 C;  2W4S A;  1QVT A;  1XGS A;  2VN2 A;  1H9T A;  3JTH A;  2HWV A;  5FKK A;  5D4S A;  1VQL I;  3BCA A;  2Y48 A;  2KLO A;  3ZQI A;  2XKO A;  1BI1 A;  1OCO H;  4DZJ A;  1BW6 A;  5JR3 A;  5J40 A;  1RR8 C;  2ZJ2 A;  3JRI A;  3CCU I;  4BXU A;  2CW0 F;  3E6D A;  5TJJ A;  5E3O A;  5CKT A;  1BR1 A;  4LIT A;  2DFE A;  2K4J A;  1ETX A;  1QU3 A;  3H3Z A;  2L02 A;  3DBR B;  4IO9 F;  4L0Z B;  3HDD A;  3OMY A;  4BH9 A;  1IRZ A;  3RTR A;  1IG7 A;  3GFM A;  3JW4 A;  3PL8 A;  2E1M C;  1IV6 A;  1Y56 A;  2JVH A;  4QWQ A;  2O6G E;  3UR3 C;  4BHB A;  2JA5 J;  2DA7 A;  1MNE A;  3BT9 A;  2OQR A;  3HKZ A;  4DJA A;  5BQT A;  2L9R A;  1O4X A;  4MEX F;  4A3L J;  1UST A;  5F04 A;  3M8E A;  4LK0 F;  2HOT A;  5M5X J;  1PJR A;  3PSF A;  3RKW A;  1KU7 A;  4IRG A;  3TED A;  4XL9 A;  4AWX B;  5J1R A;  2KRF A;  2KIQ A;  5J47 A;  1ZAO A;  2FMY A;  2V4J C;  2A68 F;  5J4V A;  3NAU A;  3W2V A;  4KIB A;  4KUM A;  2E2I J;  4ASN A;  1JE8 A;  4RMN A;  2NVX J;  4JYK A;  4M3F A;  1FOY A;  4IHY A;  4E7L A;  2NNN A;  4A3M J;  2CH0 A;  1MMS A;  2L54 A;  1OMI A;  1YJW I;  2Y31 A;  5D8L B;  3BZK A;  5D6E A;  1I27 A;  1FOX A;  5M3M J;  1YFH A;  1WI3 A;  4LLN A;  1YIJ I;  1TC3 C;  4DBR A;  1NK2 P;  3F23 A;  1VQK I;  2W48 A;  3LQR A;  3MZ8 A;  2MW8 A;  3OIQ A;  2EIN H;  3DPU A;  1JJ6 C;  3FXO A;  2A6H F;  2OBP A;  5B1B H;  3C3W A;  1F9N A;  2VE8 A;  3GYH X;  3C2B A;  2WAQ N;  1MZB A;  4RAZ A;  2GAU A;  4M3B A;  3I4P A;  3HPH A;  2DJN A;  2EJR A;  4UVA A;  2W25 A;  3KEO A;  4LD5 A;  4A3E J;  4M71 A;  1MH4 A;  2ESH A;  3EUH C;  1QPI A;  4GDF A;  3TOA A;  3QU6 A;  4E7K A;  1K6Y A;  2X1C A;  2A5W A;  1H9G A;  1YX3 A;  1YW9 A;  3K4N A;  4CSW A;  2XRL A;  3MMY B;  1D8K A;  4RB3 C;  1JI8 A;  5H2F C;  4XID A;  4XNF A;  5DCF A;  3L2C A;  3WE2 A;  2DDB A;  2JQ7 A;  3HRS A;  3LA3 A;  5LEJ A;  2WY8 Q;  1LFB A;  2CWE A;  1DP3 A;  4IL6 C;  3HTU A;  1JKP C;  2ZSH B;  2JSP A;  2F5F A;  2XRN A;  1MSE C;  3TP3 A;  1QZY A;  3Q5F A;  1IN4 A;  2DTZ A;  1FLI A;  1VQP I;  4XLF A;  3E0J B;  3V8J A;  5E1W A;  3T8T A;  5ILU A;  2QYO A;  3W6V A;  5CJ9 A;  3HOW J;  3ZQG A;  3KZZ A;  4L9J A;  4E7J A;  2V6E A;  2FBI A;  5FJ8 J;  1MMA A;  3JRG A;  2L7M P;  3HRM A;  4BDY A;  4EM1 A;  4XLN F;  2K85 A;  1YE9 A;  3GTQ J;  2HOS A;  3LST A;  5HLI A;  4MQV A;  1V55 H;  2BEO A;  2MFZ A;  1R9T J;  3ZPL A;  1IC8 A;  1ENH A;  3F0C A;  3LSM A;  3TW7 A;  5L3C A;  3S15 J;  4PGG A;  1E3P A;  1G59 A;  4MFD A;  2K02 A;  1R1U A;  1XMX A;  3W2W A;  1R49 A;  3S8P A;  4BYY A;  4KIS A;  2IJL A;  2OUM A;  1ETW A;  3CUQ A;  1NHA A;  1U8B A;  1ORK A;  4HQE A;  4I01 A;  1X58 A;  1BM9 A;  3KIO A;  1B8I B;  1FBQ A;  1XMK A;  2JA8 J;  5EG0 A;  3WTZ A;  4XRS G;  1H0M A;  2K9S A;  2B63 J;  5K5Q A;  3MVP A;  1OKR A;  4UUV A;  4KIT B;  2STW A;  4Z6Y A;  1YLF A;  3ABM H;  1H88 C;  1BA5 A;  2AHQ A;  3JSP A;  2R5Z B;  2LD5 A;  4HDU A;  4CYC A;  3K70 C;  2DAO A;  2H09 A;  3IRR A;  1OPC A;  1O7F A;  3HOT A;  3AL0 C;  4U0W A;  4JX5 A;  1F1Z A;  5DCM B;  1GDT A;  4HLX A;  3TKY A;  1SVL A;  3N4M A;  1NH3 A;  4WXH A;  1P9Q C;  4W1U A;  4Y4R A;  3Q0U A;  4I0A A;  5HLT A;  5DM6 F;  3M9A A;  4HF0 A;  2COB A;  1B72 A;  1FIA A;  3GTJ J;  4DQ2 A;  1K6O A;  3VOD A;  2VPR A;  2LLK A;  4HOB A;  1JHH A;  1XCV A;  5HDK A;  2L7K A;  5LLQ A;  2R7D A;  3HKZ N;  3WE3 A;  4UHT A;  4NUB A;  2WAD A;  1LEA A;  3QPT A;  5HLG A;  3AG4 H;  2ZME A;  1UHS A;  4RAG A;  3G2B A;  1U5T A;  2ADU A;  3SZG A;  3QYB A;  2YUS A;  2Y0S A;  3J80 Z;  1G2H A;  3LSK A;  2PFB A;  1DPR A;  1D1B A;  4CCJ A;  1IRF A;  1FBS A;  1AHD P;  1UMQ A;  4C2M J;  3CUO A;  2ACJ A;  2GOX B;  3DCF A;  5M3F J;  2V1U A;  4FCY A;  4ZTJ A;  2DPU A;  2XF6 A;  1HST A;  3M07 A;  4N0B A;  3CDI A;  2EFN A;  3BRO A;  4M3D A;  2HXO A;  1O7L A;  5HVQ C;  5EF6 A;  2AXL A;  4BE2 A;  1HW5 A;  1NG7 A;  2VKH A;  3MZH A;  2RAE A;  4CIC A;  2V9K A;  4JX4 A;  3FKI J;  2EV5 A;  2ZXJ A;  4XKV A;  2CUE A;  3G6E I;  1D0Y A;  2DA5 A;  2L9S A;  3BP8 A;  4UB6 C;  1YRN B;  4CZC A;  3QPS A;  2HR3 A;  4Y17 A;  2M8G X;  2XF5 A;  1W0U A;  4P1W A;  1I39 A;  4A6D A;  4OIQ F;  2R4G A;  3OYC A;  2AQF A;  4UV9 A;  3SFZ A;  2FE3 A;  3T5X A;  1U9O A;  2BW3 B;  3JAM K;  2QQA A;  5DM7 F;  3PJR A;  1XTA A;  2VAS A;  3KP4 A;  2MD0 A;  4XLE A;  2ELH A;  3D0S A;  5IP6 A;  1W36 C;  5BS6 A;  2ZCW A;  2IW5 A;  3OYJ A;  4AID A;  1FMW A;  3ULQ B;  5GAH J;  2HI3 A;  5ILV A;  2Q2E A;  4LG3 A;  4IOA F;  2F2E A;  1SC7 A;  5HNH A;  4BHP A;  4YIR X;  1MGT A;  2XSD C;  3MWM A;  3CZ6 A;  1B6A A;  2M7A A;  3K70 D;  4LB5 A;  1LPQ A;  3OL3 A;  1APL C;  4MTE A;  1BOB A;  3S14 J;  1HF0 A;  4LLL A;  2XIG A;  4IZZ A;  1X3W B;  3LSJ A;  4KJZ A;  2H1K A;  1HLV A;  2MSY A;  1YQA A;  1U9N A;  2XPU A;  3OIP A;  1U8R A;  2DXI A;  2HEO A;  3DLA A;  1VZ0 A;  2OU2 A;  2EIJ H;  2QF7 A;  1XG1 A;  1R7J A;  3OYL A;  3H5R A;  4IJA A;  4II2 A;  2LNB A;  1TWF J;  4BU2 A;  2HYF A;  1WHU A;  3AFH A;  2PI0 A;  4BBR J;  3BR1 A;  1TWA J;  4ZZD A;  1T38 A;  5TRD A;  1TW3 A;  2VQH A;  4XN0 A;  5L3E A;  5DUI A;  3LA2 A;  3ECO A;  3OOP A;  1FEX A;  2VJ4 A;  3MAJ A;  4M73 A;  4CZZ A;  5AON A;  2F5E A;  2CO5 A;  4PJ0 C;  2XAG A;  2KJC A;  1WJE A;  3H0D A;  3JRC A;  2IPQ X;  4UVB A;  1F5T A;  2NVT J;  3KPH A;  2HGC A;  3KP3 A;  2XC7 A;  3ERE D;  2DA6 A;  4K2E A;  4W97 A;  1UG2 A;  1K61 A;  1AWC A;  2L4M A;  1ZRC A;  3HYI A;  1FSE A;  1QQI A;  3W6K B;  1BJZ A;  3VYU B;  2IVM A;  4Q47 A;  4MO7 A;  5EZH A;  5DDG A;  5FRN A;  3DXJ F;  3ZOB A;  4A0X A;  5ED4 A;  2CG4 A;  5ICE A;  2ZB9 A;  1MMD A;  4LK1 F;  3VB2 A;  1F36 A;  4BJ6 C;  4ENK A;  4KA4 A;  2HOA A;  2LOO A;  2Q0O A;  2XGE A;  3EPZ A;  3R0J A;  4J00 A;  2O8X A;  3H5A A;  3WOD F;  4HYE A;  1ETO A;  4HNU A;  2VKV A;  2VJJ A;  1H8A C;  3NQO A;  3U9G A;  4HSR A;  4EV0 A;  1JT6 A;  3BG5 A;  1IV8 A;  2UV1 A;  4BEH A;  4BHC A;  2FBK A;  3I53 A;  2RRE A;  1JUS A;  4ANJ A;  4XKC A;  4BNC A;  2DDA A;  1K4S A;  4H4K C;  3Q9V A;  3EUH A;  3HJE A;  1D5Y A;  4B4C A;  1OYY A;  1RUO A;  1KU9 A;  3CP8 A;  1JKO C;  1DQU A;  2JA6 J;  3P9I A;  3RQI A;  1HOM A;  1BC8 C;  4AIK A;  3BTC A;  1RZ4 A;  1VTN C;  4R1H A;  5DTD A;  1IW7 F;  4M72 A;  1LB2 A;  2Y0S N;  2EFW A;  2NVY J;  3M8J A;  1GV2 A;  2BXZ A;  5LD2 C;  3F72 A;  3RKX A;  3BR6 A;  3GUD A;  1MW7 A;  2Q1Z B;  3CTA A;  2I10 A;  2VBZ A;  3I3L A;  4KYW A;  3ISP A;  2LG4 A;  4RGS A;  2R7S A;  5C44 J;  5KAF C;  4I6Z A;  3H9Q A;  4A3C J;  1FOW A;  4BL0 B;  2E35 A;  2FML A;  4U0V A;  5CYV A;  4IKF A;  4IXA A;  3ZN1 A;  4BE1 A;  3FDY A;  2EFP A;  4GGG A;  3GZN B;  2ECC A;  2X48 A;  2PQ8 A;  5HDN A;  2M34 A;  2P5V A;  2BY3 A;  1R4N B;  4NQW B;  4Y7N J;  3DBH B;  3OV8 A;  3CJN A;  1E2X A;  1K83 J;  5ERI A;  4YFK F;  3WTY C;  2NYX A;  4ENM A;  1J59 A;  2RQP A;  2FD5 A;  2R7U A;  1MD0 A;  3IKT A;  4UV8 A;  1ULY A;  1CF7 A;  3ERM A;  1IN6 A;  2JWT A;  4QSH A;  4ZYA A;  1WJF A;  3GTO J;  3VOE A;  4YEL A;  2ETH A;  3I5U A;  4L5I A;  1Y39 A;  5IOZ A;  4A5N A;  1IXR C;  2NXN B;  3BG6 A;  2H6B A;  5JHU A;  1L3L A;  3BG3 A;  3GF2 A;  4YII A;  3BJO A;  5HOD A;  3KP2 A;  3CMY A;  5CVJ A;  1ETK A;  1JUP A;  2M4K A;  1A6Q A;  4KMF A;  4HV5 A;  2WB1 A;  4BDZ A;  2X1D A;  2BBY A;  3BC8 A;  3KFW X;  3QQA A;  4IRI A;  2DYR H;  4IVN A;  3PNV A;  1JTX A;  3EYY A;  3G1L A;  3SZP A;  5HS9 A;  3CCQ I;  2EPF A;  2DMP A;  3BQZ A;  2EV6 A;  1ZH5 A;  3BTJ A;  1DP7 P;  3H3U A;  2B9S A;  2ZC2 A;  3OOU A;  3RSN A;  2QVO A;  3SDB A;  1TQM A;  2G7U A;  2HZT A;  3HOV J;  3I58 A;  4E6K G;  4CYC B;  4LB6 B;  5KCM A;  3HRT A;  4GCV A;  1ZG1 A;  1P4A A;  4ZTF A;  1TBX A;  2XAU A;  4I99 C;  1QRY A;  2CUZ A;  3TW6 A;  2VT2 A;  3N97 A;  1W5T A;  3BR5 A;  3KX2 A;  1IJW C;  4G12 A;  1HKT A;  5L3D A;  3TP0 A;  1LE8 A;  3V7C A;  1LKX A;  2DT5 A;  2K86 A;  4HX8 A;  1W5S A;  2H8W A;  1GVD A;  3LFU A;  3PIP F;  4MEY F;  2O03 A;  4KIC A;  2A69 F;  3HZJ A;  4RAY A;  2EBI A;  2Y9Z A;  3QRF F;  4PK4 A;  3U2R A;  2JPB A;  3K7A J;  4G6D A;  1ZR2 A;  2HS5 A;  1TT0 A;  1R5H A;  1R71 A;  1ZQ3 P;  1SVO A;  3QPH A;  2Y30 A;  3EET A;  4EQQ A;  5FLX K;  3ML6 A;  2ZJR F;  2QBY A;  2BV6 A;  3DTE A;  2X4H A;  2XGD A;  1ACI A;  1MMN A;  1I6H J;  3E6C C;  2ZFU A;  3S1R J;  4O3M A;  5KAI C;  1AA7 A;  2ZME C;  2DPD A;  2QUF A;  1YHQ I;  2PLY A;  3VWB A;  3K2Z A;  1FP1 D;  4QLC U;  2CUJ A;  3V8L A;  2VUM J;  1ZGJ A;  4C9Y A;  1V5F A;  4A3G J;  4G6Q A;  2HQN A;  1JJ8 C;  4XSX F;  1BJA A;  3H36 A;  2LK2 A;  2WBM A;  2CQN A;  3L9F A;  5FB2 A;  1JKR C;  3FXK A;  3IUO A;  4BE0 A;  2AQE A;  4DIQ A;  1OCC H;  2LTP A;  1Y8R B;  4HLY A;  2TRT A;  3R4K A;  4IHW A;  5LFA A;  3ZR8 X;  3RJP A;  2E2H J;  4B1R A;  4HPQ A;  1OCP A;  2ZXW H;  3OWT A;  2XGX A;  3G4S I;  1T33 A;  1VI0 A;  3F9K A;  4CA0 A;  4HRI A;  3WGG A;  2YSR A;  6PAX A;  1JT0 A;  4IX7 A;  1W7P A;  3E7L A;  3FXM A;  3DPL C;  5FD5 A;  2XPV A;  1X4P A;  1G3W A;  5F1R A;  5AIQ A;  2H6C A;  3ZMV A;  2M30 A;  4L18 B;  1XSD A;  1VQ4 I;  4KT6 A;  2IEK A;  3WG7 H;  1FT9 A;  3M7G A;  1A5J A;  3BWG A;  2K3P A;  1XPX A;  1KU2 A;  4P9U A;  1EH6 A;  4FQG A;  3PO2 J;  4U88 A;  4P9F A;  2BOL A;  2FOK A;  3R0A A;  3IAS 2;  2QEX I;  2V9P A;  3LA7 A;  4YRV A;  3OIO A;  1T56 A;  3ZMZ A;  1WFX A;  2KRC A;  2R7Z J;  2O5R A;  5IP7 J;  3BY6 A;  1TNT A;  2KP6 A;  3G1O A;  3AG3 H;  5H6R A;  4WXD A;  4B44 A;  4CUG A;  1FYL A;  1EF4 A;  3BTI A;  3GLX A;  2ZKZ A;  3HPG A;  2G7H A;  2L4A A;  4OU0 A;  4MQ9 F;  3TOB A;  1U6G A;  5K7H A;  1XN7 A;  2CQQ A;  3AAF A;  2VOO A;  2IAI A;  1JHF A;  3OYM A;  5IOY A;  2IBD A;  1SD6 A;  1G3Y A;  4C2T A;  3HOY J;  3OL4 A;  1D5V A;  2R5Y A;  4A93 J;  2KT0 A;  2WB1 N;  5GP9 A;  1GV5 A;  3FK7 A;  3NRV A;  1GT0 C;  1X1A A;  3KEQ A;  4EMS A;  1Z6R A;  3DTI A;  4IHV A;  3H35 A;  3NEU A;  2MAB A;  3WTV C;  4FHT A;  3GFI A;  1FC3 A;  3PFI A;  3ABL H;  2FF4 A;  1BW5 A;  5IYC J;  5EEH A;  4OMY A;  4ABZ A;  1FP2 A;  2KZG A;  3F21 A;  2FEZ A;  5FKO A;  2K9Q A;  4ZYE A;  2Z33 A;  2H27 A;  2JRT A;  4Y15 A;  2LKS A;  4DYQ A;  2KIU A;  1KYW A;  1V4R A;  1FMV A;  4P96 A;  3BG9 A;  4DGW B;  3EQL F;  1YS6 A;  3L7W A;  4EJW A;  4OIP F;  1QO0 D;  2GA2 A;  1GHC A;  3MN2 A;  3A03 A;  3WU0 A;  2GXB A;  5J1U A;  4I2O A;  3WTT C;  2L7F P;  2D1H A;  3SHF A;  3CJQ B;  1B4A A;  2EFO A;  5F64 A;  3SYT A;  2DA3 A;  1FTT A;  3S3M A;  3OY9 A;  1UEL B;  4ON0 A;  5EZG A;  2KIF A;  2XAH A;  3AKZ A;  2FU4 A;  3DKY A;  1MKM A;  2QQ8 A;  1S7O A;  5F08 A;  2DLL A;  1VF9 A;  3I59 A;  1BIB A;  1WQ2 A;  2RN7 A;  2E1O A;  3MZY A;  1S7A A;  3QWL A;  2XUB A;  5E18 F;  1FPQ A;  1IXS B;  3OYH A;  3LSR A;  4HX7 A;  1PUF A;  2YU9 J;  3RYR A;  2Z16 A;  4RAF A;  2XF7 A;  5IYB J;  2X9D A;  2E34 A;  2IA2 A;  4MTD A;  5LGT A;  4QTR A;  4PJM A;  3S2D J;  1WVR A;  4HDV A;  1P7J A;  1ON1 A;  4S04 A;  3O6B B;  2HQ5 A;  2GZW A;  3S1N J;  4FIS A;  3ZQQ A;  1ZLK A;  3HTS B;  3FXR A;  3LSI A;  5J4Y A;  1I1S A;  4G9Y A;  1PP7 U;  2X6W A;  3M3Y J;  2P5L C;  2FUG 2;  1U2W A;  5IT9 Z;  1OCT C;  2VJI A;  1MJB A;  5LEK A;  2BY0 A;  2CJJ A;  1LEB A;  2MLK A;  1EKE A;  3IH2 A;  2V1N A;  3HGG A;  2X1E A;  3FHZ A;  2LFB A;  5EGO A;  2G0E A;  4XLH A;  2P8T A;  5KHD A;  3B02 A;  3KP6 A;  1VQM I;  3K4L A;  1B1B A;  4UB8 C;  2DMT A;  5A2Q Z;  3E5Q A;  1ETQ A;  1X1D A;  4RA2 A;  4B09 A;  2PN6 A;  3IAM 2;  5JVT A;  2P7C B;  4KNY A;  4KFC A;  1K7A A;  2F4O B;  3FBI B;  4HX4 A;  1LFP A;  4J19 A;  1YOV B;  4XLA A;  3OYD A;  4C30 A;  3LL7 A;  4BY1 J;  2FQ4 A;  5E3N A;  2PJP A;  2JRM A;  2X6X A;  3V4G A;  1UAA A;  1UG0 A;  5DUK A;  1QZZ A;  3ZMT A;  2R7W A;  1K78 A;  3CQZ J;  1X2M A;  3SXY A;  5EEA A;  3FBN B;  4F52 A;  4HF2 A;  1X2N A;  3VEP A;  4OIR F;  2Z99 A;  3WHB A;  2J5O A;  2JUC A;  4BY7 J;  2E1C A;  3BPX A;  3DPT A;  3WHC A;  2K5C A;  3C1D A;  2UUZ A;  2KMU A;  5E1X A;  1R00 A;  2R7F A;  2WY7 Q;  2E71 A;  3ZQL A;  2XAQ A;  2MG4 A;  1E3H A;  2VT3 A;  2M0C A;  4FET A;  4LJZ F;  3DKW A;  3MCZ A;  4D5C A;  4AIH A;  3IH4 A;  4HV6 A;  4N4O B;  3LFK A;  3V8K A;  2HTS A;  1UFM A;  3J81 Z;  5FKL A;  4EJT A;  3HRU A;  3H3V K;  3S16 J;  3JRA A;  5EJC A;  1N77 A;  2DOF A;  3GVA A;  4DZP A;  4RS8 A;  3TO7 A;  2K9M A;  5KK1 A;  1EA3 A;  3TL4 X;  1FNN A;  3J80 K;  1A36 A;  3A01 A;  2FNA A;  1N78 A;  1Z7U A;  1J75 A;  4ZC3 A;  5ICC A;  4FTH A;  1KGS A;  3KP7 A;  2ELK A;  4RGU A;  3VSK A;  1O3R A;  4Q4Z F;  1W1W E;  2VBW A;  1IRX A;  1ETY A;  2R0Q C;  1ZR4 A;  3IV5 A;  2HVQ A;  4BGD A;  3MKW B;  2OQG A;  2IS6 A;  1RUN A;  2M8E A;  3LAP A;  2IP2 A;  3DQV C;  1AU7 A;  5H6Q A;  5B66 C;  1W4M A;  2VC1 A;  3K4B A;  3R6S A;  3DU5 A;  1Y8Q B;  3FZV A;  3UNG C;  2QBY B;  3HG9 A;  1TQI A;  3H0G J;  3DEE A;  2LVS A;  5L3G A;  2OD5 A;  3J7A Y;  1R36 A;  1TTY A;  2V7F A;  1MDM B;  2IGO A;  2K4B A;  1YG2 A;  1ZTR A;  3HBL A;  3L00 A;  4BQN A;  2RNG A;  2RV8 A;  2YX7 A;  3CC7 I;  2JA2 A;  3REO A;  1MH3 A;  5FFX A;  2M2E A;  3OYB A;  3ZGK A;  4M74 A;  4D0P A;  3I54 A;  3OS1 A;  1JGG A;  5GAD J;  1BI0 A;  1G3S A;  4X0G A;  3K0L A;  1ZRE A;  4BQQ A;  4ESJ A;  1IXC A;  1QHG A;  2W57 A;  2GA1 A;  3LSG A;  2ISY A;  2PMZ A;  3KEY A;  1I5Z A;  3KCC A;  2DYS H;  2X85 A;  2HU9 A;  2K7L A;  2EZL A;  2GM4 A;  3BOQ A;  1TWH J;  3CMM A;  5KVR A;  1T0F C;  3BZC A;  3F8B A;  1HA8 A;  3FIW A;  1YIT I;  4XRF A;  3M1E A;  1P6R A;  2DU9 A;  3VPR A;  3CC4 I;  1S3J A;  4F93 B;  1SEU A;  5EDN A;  1JTY A;  2PMH A;  2W24 A;  1LDK B;  3V7S A;  3NWT A;  3SEZ A;  4D9J A;  3RZO J;  3RQ4 A;  4XRM A;  2LY2 A;  2Q8K A;  4M6Y A;  1AKH B;  2DN0 A;  3C2H A;  3GTP J;  2K27 A;  4N9H A;  5B5E C;  2LSO A;  1MBE A;  4MHG A;  2R7T A;  2JMW A;  5B1A H;  2QQB A;  2VIX A;  3E5U A;  3J7Y J;  3CCY A;  4HW0 A;  3K1N A;  4PJN A;  1KZH A;  1N25 A;  1ERD A;  2HFH A;  2HYG D;  4RM2 A;  3OYI A;  1MJA A;  4G6T B;  4AYB A;  2HPI A;  3ZMU A;  1O3Q A;  1RC9 A;  1G4D A;  2QSH X;  2XKP A;  2V79 A;  2EV0 A;  3VYR B;  2XVC A;  3JRB A;  4PFO A;  3GCM A;  1HQC A;  2OV7 A;  2VC0 A;  4Q5S F;  1MBF A;  1UCR A;  1XGO A;  1Q1V A;  1PUE E;  5JFR A;  2ME6 A;  4P55 A;  1WJ5 A;  1RET A;  3TO9 A;  3CCM I;  5JVG F;  3GFJ A;  2HYJ A;  3CCJ I;  2DO7 A;  3CME I;  1L0O C;  5GAE J;  2Z9O A;  1DGW Y;  2KL4 A;  3I64 A;  1X3Z B;  4V2G A;  2ZFW A;  1IDZ A;  3HL2 A;  5GPC A;  2ZO4 A;  3E6B A;  4U7B A;  1YI2 I;  2M7B A;  4LG0 A;  1X1C A;  3K10 A;  5BMZ A;  2DTR A;  2LBF A;  1JUM A;  2KZV A;  2YR2 A;  1XDU A;  2VON A;  4XKW A;  3K69 A;  4L0Y B;  4UXN A;  1LJ9 A;  4CCM A;  5AIP A;  2OC6 A;  1XDS A;  5FLV A;  3WTS C;  1I1G A;  1Z6T A;  3FXL A;  3S3N A;  4O6J A;  1VQ5 I;  1J7K A;  2CMP A;  3C7J A;  3ELK A;  2XHK A;  3EUA A;  2JSC A;  2DQR A;  3PNT A;  1WH7 A;  2IRF G;  2P4W A;  4B47 A;  1UJ8 A;  3T8R A;  4L9T A;  2FSW A;  2IS1 A;  3LSH A;  3GBG A;  4U0Y A;  2HQR A;  2ZXH A;  3K4C A;  1ON2 A;  1SFX A;  2DT6 A;  4NDL A;  4CHU A;  1OR7 C;  2NAZ A;  4WX9 A;  2E2J J;  2NOJ B;  1NTC A;  2EZK A;  4ZJZ A;  5CVV A;  3BCB A;  4I7H A;  4EJU A;  3HEF A;  5GPA A;  3L2V A;  4II3 A;  1MSF C;  1VQ9 I;  1OLT A;  4PCQ A;  2QA4 I;  1UB9 A;  2OF7 A;  4X6A J;  3MEX A;  2A6E F;  4NC8 A;  4AIJ A;  2VJ5 A;  3WTX C;  4PFP A;  2W84 A;  4PZJ A;  2TCT A;  3FM5 A;  1H89 C;  5LGN A;  3RPU D;  4MLO A;  1V5G A;  1WJD A;  2LDU A;  2ELJ A;  4BS9 A;  1HSJ A;  2LYC A;  1RKT A;  2JN6 A;  2KRH A;  1RRJ A;  3HUG A;  5LRS A;  5F0C A;  1VQ7 I;  1LVK A;  3IC7 A;  3HOX J;  1D8J A;  2JJ7 A;  4BXF A;  2K40 A;  1SAU A;  3OSF A;  2VOP A;  3KZY A;  3O8G A;  1KA8 A;  1ZG3 A;  2O7O A;  1X3U A;  2XDV A;  2CGP A;  2NS7 A;  2RDP A;  3M1C A;  2XB5 A;  3JR9 A;  2LY1 A;  2LH9 A;  4S05 A;  1YW7 A;  5CLS A;  1J5Y A;  4JOM A;  3PIO F;  3L2U A;  4A3B J;  1J09 A;  5DS9 A;  2CFX A;  1ZRF A;  2OAZ A;  3ABT A;  3I71 A;  2I8D A;  2RKH A;  3QOD A;  3L2Q A;  1MBH A;  3ZP5 A;  3FMS A;  1TZL A;  2NRA C;  5D5W B;  3ESW B;  1IZ1 A;  2PMZ N;  1X4O A;  1RPW A;  3CJT B;  5FFZ A;  3GO5 A;  3KE2 A;  4XOP A;  1R22 A;  3GTL J;  4YEJ A;  1Z3X A;  3TBI A;  3MKZ A;  1YJN I;  5EYR A;  2O0Y A;  4HG2 A;  2MD5 A;  3O2P E;  4HZF A;  3I55 I;  3GX4 X;  3E97 A;  3EYI A;  2DOD A;  1FBU A;  2LKP A;  4RGR A;  3OYA A;  3QOP A;  2OZ6 A;  4G7Z F;  1HW2 A;  4HBL A;  2PJR A;  3LAJ A;  4JP0 A;  2L01 A;  1O57 A;  2A5Y B;  1S5L C;  2BVM A;  2KDO A;  5C3E J;  2XSJ C;  2QEN A;  4OWR B;  3ZXS A;  2YS9 A;  1TNS A;  4A6E A;  2L3D A;  2ME0 A;  2F5V A;  1FYK A;  2QQ9 A;  5C4X J;  2F6C A;  1Z91 A;  3CUQ B;  2K3F A;  3LNQ A;  4XN3 A;  5DYM A;  2H8R A;  1P92 A;  1QVU A;  1U78 A;  2P81 A;  2VKE A;  4AYB N;  5EG0 B;  1SFE A;  4E7I A;  2AXT C;  3EDP A;  3E3V A;  2CU7 A;  4E70 A;  4AM3 A;  5LRR A;  1LDD A;  1Z7L A;  3BJA A;  4H0E A;  3H5N A;  2K9N A;  1RNL A;  2HZD A;  2H94 A;  1FOK A;  1Y6I A;  3F6V A;  1LUJ B;  5JLX A;  2E5N A;  4UVC A;  1E0E A;  3ASO H;  5TIS C;  4OMZ A;  1B8I A;  1I3Q J;  2ID3 A;  4ZDO A;  3GFL A;  3DWL E;  2EIM H;  1J0R A;  3M8F A;  4Y33 A;  1ETV A;  2HDW A;  2UZK A;  2WAF A;  3FM3 A;  4YFN F;  1WRJ A;  1FJL A;  5J8F A;  4C3I J;  1B72 B;  3A01 B;  3K1P A;  4QPQ A;  3OYE A;  1T8I A;  2F48 A;  3H92 A;  2ISZ A;  3ROU A;  3KYL A;  1DDN A;  3H1C A;  1WGX A;  3BQY A;  4RB2 C;  2LRE A;  5HLH A;  2HXI A;  3HSE A;  2QSF X;  5DCM A;  2M9H A;  3VYT B;  2Z3Y A;  4AVZ A;  3S1M J;  4A3J J;  4U87 A;  2YX4 A;  5FGM A;  1K4T A;  3WTW C;  2ZME B;  2CQ7 A;  4ESB A;  2E1N A;  3PQK A;  4WXC A;  1U5T B;  3L1P A;  2J5P A;  2KPM A;  4E4H A;  3COA C;  3G3Z A;  2VB6 A;  4G7H F;  5E79 C;  4UUS A;  2ID6 A;  4NNJ A;  3CD6 I;  4IOC F;  2CRG A;  4RLQ A;  2XAJ A;  3LSP A;  1BBY A;  2W7N A;  4RBO A;  2BY2 A;  3BPV A;  2WA0 A;  4HAM A;  1S6L A;  1WKM A;  1Y1V J;  3GLL A;  2LR8 A;  3K6G A;  1REP C;  5J3L A;  2CV2 A;  1TW2 A;  3L2R A;  2EZH A;  2CQK A;  3HHG A;  2NVQ J;  4OOI A;  5CQE A;  2M3A A;  3HHH A;  1T0F A;  4WWC A;  1STZ A;  3LOC A;  4ZYH A;  3OS0 A;  2CV0 A;  2O3F A;  1MIJ A;  1OFC X;  1WCM J;  2GIZ A;  3FK6 A;  2A05 A;  1T98 A;  2X51 A;  4M9Z A;  1QGP A;  1MNM C;  2EA4 A;  5L3B A;  2A61 A;  2E60 A;  3HSR A;  4PJJ A;  2IS2 A;  4NC7 A;  3D5S C;  2Y69 H;  4JBA A;  1Z1D A;  1DU6 A;  4PDK A;  4OIO F;  4YG2 F;  2IS4 A;  3R60 A;  2ZXI A;  3QYE A;  2FOW A;  3QU3 A;  3ZQC A;  3H9J A;  4FE7 A;  2GWR A;  2V9V A;  5DV5 A;  1V3F A;  2DI3 A;  3U1K A;  2DMN A;  1EH8 A;  5BPI A;  2FJ1 A;  1HXD A;  3IWZ A;  2RGV A;  3WG9 A;  1MMG A;  1BR4 A;  2G9W A;  2Q2E B;  2VXD A;  2QKL B;  5EEG A;  1R5G A;  3QYF A;  1Y0N A;  1YRN A;  1R1T A;  4GFB A;  2GXG A;  3OS2 A;  2R7R A;  3GTM J;  3S2H J;  4A3F J;  3Q9S A;  1R58 A;  2PEX A;  5CVR A;  3B73 A;  4YFX F;  3P9C A;  3FWE A;  5GTH C;  4V19 K;  3A1Y A;  5J6X A;  2KDZ A;  1FWZ A;  2EZI A;  1P2F A;  4RM3 A;  3TO6 A;  3IRQ A;  4M3E A;  2HVS A;  5H20 A;  1GVJ A;  1OYW A;  4A3D J;  3DLL F;  1R23 A;  1S7E A;  1A6I A;  5B3S H;  1UHM A;  4IF4 A;  5IPA A;  4EGZ A;  4N4N B;  9ANT A;  1POG A;  1J9I A;  4M6V A;  5L3F A;  3K1M A;  2ZBK A;  5LGU A;  4E7S A;  1KQ9 A;  4XQF A;  1P4W A;  2JTV A;  3PNY A;  2KIS A;  1GUU A;  3I4N J;  2E1M B;  3O8H A;  3DEW A;  4EM0 B;  2Z1D A;  3PFY A;  2A6T A;  3HM5 A;  3P9K A;  3QOE A;  1HW1 A;  4KIG A;  3P5J A;  1HDP A;  5E3L A;  1I6X A;  4NBQ A;  2IT0 A;  2JZY A;  1PDN C;  1IUF A;  2LBF B;  4KN7 X;  2EQR A;  3OSG A;  2LP0 A;  3IKV A;  3VYS B;  3CMA I;  5D6F A;  3KYD B;  2FA5 A;  2CV1 A;  1KU3 A;  2L7Z A;  2X6O A;  1E3O C;  1OR7 A;  4V2F A;  3TDU C;  2HKO A;  1WWX A;  4L9V A;  4FT8 A;  3RZD J;  2LMD A;  4KN4 X;  3HOU J;  5E1Z B;  1SFK A;  2L0K A;  2E5Z A;  1QZE A;  3V42 A;  1BOA A;  1QPM A;  3DBL B;  5E8I A;  3CCV I;  4XRS A;  1HCR A;  1QHH D;  4L5E A;  3BG7 A;  3RKY A;  4OAZ A;  3HIF A;  4LFU A;  4AC0 A;  2L2O A;  2QM3 A;  1ZLJ A;  4JQF A;  5TGT A;  4ESF A;  2DA2 A;  5K1Y A;  5D4R A;  3FF5 A;  2PX9 A;  3MD2 A;  3TDZ C;  2OPT A;  4RGX A;  2WC2 A;  1SD5 A;  2QLZ A;  3T1B A;  2EB7 A;  3KZI C;  5D8K B;  1TT5 B;  5D5X B;  5C4J J;  3Q0V A;  5FRM A;  4BEH B;  2STT A;  4S0H B;  1WSU A;  4E7H A;  2ZNY A;  4LLG F;  1YX5 A;  3N05 A;  4BAY A;  1D3Y A;  1ZGA A;  2VBY A;  4GYG A;  3HOS A;  2VXZ A;  5IT3 A;  2XV4 S;  2VI6 A;  4EAT A;  4PSX A;  4MIM A;  3BTL A;  2LC2 A;  4D7N A;  3I0T A;  2QZ8 A;  5IT9 K;  3JCU C;  3HUG B;  2W1O A;  1VQ8 I;  4NB5 A;  2R7X A;  1JXS A;  3GW2 A;  2HNH A;  2VE9 A;  4XIC A;  1V54 H;  1SMT A;  1S9H A;  1ONV A;  3FXJ A;  4N9I A;  3SFI A;  3V7R A;  3R61 A;  1MND A;  1ZK8 A;  3DV8 A;  2KIM A;  2V1D A;  2EH3 A;  2NS0 A;  3QP5 A;  5A2Q K;  1PVE A;  2F5C A;  3ONQ A;  2EIL H;  3DF8 A;  5M5W J;  3MKL A;  3SDG A;  3I4M J;  5KNL A;  4AD9 A;  1WH5 A;  1S29 A;  4A69 C;  1HKQ A;  1WJC A;  2DFF A;  2OCC H;  4B3A A;  2RNJ A;  3RDI A;  3K2A A;  4CO8 A;  5F0F A;  4RB1 A;  2OCE A;  1D1A A;  1VQ6 I;  5D5V B;  1BI2 A;  2IGN A;  3T0Y A;  4WF2 A;  4DW6 A;  2B0L A;  5IY5 H;  3BDD A;  1JGS A;  4E7Z A;  3S3O A;  4I0B A;  1D0X A;  3HOZ J;  5BOX A;  1IN7 A;  1KQ0 A;  4XLC A;  3PO3 J;  1CF7 B;  1D1C A;  1S8N A;  2LY9 A;  3PSI A;  4C3H J;  4OAY A;  3GZ5 A;  2PJR B;  1UZC A;  2BZT A;  2MYS A;  3C18 A;  2AS5 F;  1KQ8 A;  1Y0U A;  2HOE A;  5LHI A;  1SAN A;  3MKY B;  2DW4 A;  1XCB A;  2O8K A;  3OR1 C;  3OYG A;  2FX0 A;  2WV0 A;  4ZZL A;  4B8X A;  1IUY A;  4KT5 C;  4A3K J;  2M0M A;  4NQW A;  2FXA A;  1Q1H A;  4HNV A;  2C6Y A;  1IF1 A;  3S17 J;  3K4K A;  3J81 K;  2OA4 A;  5FKM A;  2BY1 A;  3K4J A;  3VDX A;  5E17 F;  4MFE A;  2QCO A;  1M1E B;  4JK1 X;  4QPO A;  3AL0 B;  2DCE A;  3BR2 A;  4A0Y A;  3QPL A; 
#chains in the Genus database with same CATH homology
 2HKX A;  4HF1 A;  4IPA A;  1SD4 A;  1DPU A;  1LDJ A;  1R1V A;  3GWZ A;  2COM A;  1TLH B;  1F4K A;  3KET A;  4M9S A;  2FNP A;  2DBB A;  1B9M A;  2R3S A;  2Y0M A;  2CYY A;  3F8F A;  3WGH A;  1IRG A;  3QP6 A;  3K9T A;  4PGH A;  3IL2 A;  2PBI A;  1FY7 A;  1T6S A;  3E5X A;  2RVC A;  1ZG5 A;  1B59 A;  1LVA A;  2EA2 A;  2P5K A;  4IHS A;  4KDP A;  2GQQ A;  2EWN A;  4CYD A;  1ZRD A;  1YW8 A;  2WWY A;  3BZ6 A;  1LQ1 A;  1BC7 C;  5ILS A;  3IHU A;  2M87 A;  3CO7 C;  2YPR A;  2M1B A;  5DD4 A;  5K5O A;  3KP5 A;  3S2W A;  4MNU A;  1DUX C;  4EJV A;  4L5J A;  3DEU A;  3E6M A;  2X0L A;  4R8H A;  3JSO A;  4ETS A;  1IAW A;  2TDX A;  4I02 A;  1A04 A;  3ZN0 A;  2D1V A;  2ESN A;  2Y75 A;  4XBF A;  2UXN A;  3FXU A;  1C0W A;  3FMQ A;  3JTG A;  2BYV E;  5HS7 A;  1IN8 A;  5ICF A;  1W7P B;  4ENN A;  3CLO A;  1QNT A;  4O5V A;  5LBQ A;  4XLP F;  1ZAR A;  2XAS A;  1HKS A;  2P7V B;  4RB0 A;  3P7N A;  1FYM A;  2DQL A;  1OYI A;  3ZMD A;  4CDG A;  4EGY A;  1T39 A;  5LHH A;  1J2X A;  4NHJ A;  3LQQ A;  2ZNZ A;  1GXQ A;  3SQN A;  3F6O A;  2KKO A;  1QBJ A;  3L09 A;  2YU3 A;  3F8M A;  1B9N A;  1ODD A;  2UXX A;  3JAM Z;  1YIO A;  5BPD A;  5ICG A;  1HBX G;  2BGC A;  1P4X A;  4YIF A;  1T2K A;  1RIO H;  2NNY A;  2EK5 A;  2V1X A;  4GO1 A;  1SMY F;  4ZH4 F;  4DNC A;  1GXP A;  2E7X A;  2Z5U A;  4LMY A;  1FZP B;  4FX0 A;  2LF7 A;  1O3S A;  3ZMS A;  4G7O F;  4OIN F;  1SAX A;  2FQ3 A;  2MLG A;  3ABU A;  2VBX A;  2GIV A;  3FXQ A;  3FMR A;  3HSF A;  2MH9 A;  2W85 A;  1AOY A;  4XSZ F;  2DK8 A;  3DFG A;  3GZ6 A;  3I59 B;  5E8G A;  4A0Z A;  3F8N A;  1LNW A;  5HS8 A;  2MC3 A;  4R79 A;  5K5R A;  1Z05 A;  2KJB A;  3D5L A;  1YYV A;  2HTJ A;  5DEQ A;  2V6C A;  2PMU A;  1FX7 A;  2MA3 A;  2MH2 A;  4U7D A;  3MQ0 A;  5J8C A;  3VFZ A;  1O3T A;  1XMA A;  2F5D A;  4GYI A;  1BI3 A;  4CXF A;  2WTE A;  2LF8 A;  4KIF A;  1ZN2 A;  1W7P D;  1XGM A;  5JI6 A;  4FX4 A;  1XSX A;  4F7Z A;  2PG4 A;  3ZQ7 A;  2P6S A;  5HDG A;  3DP7 A;  5HOO A;  4UNO A;  3IWF A;  1E17 A;  1YO5 C;  2DFI A;  4GXO A;  5E20 A;  2IA0 A;  3KLN A;  2FBH A;  1PP8 F;  2JPC A;  3RPQ A;  4BQA A;  4Z2Y A;  3KLO A;  2E7W A;  2OZU A;  1K78 B;  3G73 A;  2DK5 A;  4EM2 A;  2MBF A;  3F22 A;  3O3K A;  2XAF A;  5LHG A;  1SD7 A;  1EV7 A;  5FD6 A;  4WCG A;  1U3E M;  1YS7 A;  5F6F A;  4LGW A;  3TGN A;  1IN5 A;  2XRO A;  4KMU X;  4EVI A;  2A07 F;  3W6J B;  1BN5 A;  3ECH A;  1G6N A;  4IRH A;  3CDH A;  2IA1 A;  1XD7 A;  2BE5 F;  1YTY A;  2A3S A;  4TV7 A;  2VOD A;  4IHT A;  3WGI A;  1CGP A;  2M45 A;  3CUQ C;  3J7A O;  2P6T A;  4A5M A;  2D2W A;  4G94 A;  2D45 A;  4P5O A;  4I98 B;  4ENJ A;  2EFQ A;  2QWW A;  2FRH A;  4A12 A;  3WU1 B;  4HA8 A;  4L9N A;  1FSH A;  3BJ6 A;  1TQP A;  2JT1 A;  4WK8 F;  3WTU C;  1BIA A;  1EH7 A;  5DD8 A;  4Q48 A;  4A2U A;  1MJ9 A;  2O61 A;  1ZHF A;  3GEZ A;  1XGN A;  1ZYR F;  4AVP A;  4M9X A;  4MGR A;  3F8C A;  4ZYG A;  2RC4 A;  4M6X A;  3RPU A;  3RI4 A;  3TQN A;  1Z9C A;  1MDM A;  4I09 A;  2CSO A;  4EJO A;  4G8X A;  1U5T C;  3PQJ A;  1KYZ A;  3U1D A;  4ZYD A;  5D5U B;  3MFK A;  1XB4 A;  3RIR A;  1SFU A;  5FLX Z;  1WI9 A;  3FX3 A;  3LWF A;  3CO6 C;  1K79 A;  3GXO A;  2UWM A;  3RYP A;  3SZT A;  1RI7 A;  2M5W A;  3F3X A;  1XSV A;  1UHW A;  3QAH A;  1USS A;  4CGZ A;  4Y13 A;  2HDC A;  5CVU A;  4HQM A;  1G3T A;  5FO5 A;  4LG0 B;  5CVI A;  1XGS A;  1H9T A;  2VN2 A;  3JTH A;  2HWV A;  5D4S A;  2Y48 A;  2XKO A;  1BI1 A;  5JR3 A;  2ZJ2 A;  4BXU A;  2CW0 F;  3E6D A;  5TJJ A;  2K4J A;  3H3Z A;  2L02 A;  4L0Z B;  4BH9 A;  3RTR A;  3GFM A;  3JW4 A;  4QWQ A;  2O6G E;  4BHB A;  4MEX F;  2OQR A;  5BQT A;  1UST A;  3M8E A;  4LK0 F;  1KU7 A;  3RKW A;  4IRG A;  4AWX B;  2KRF A;  1ZAO A;  2FMY A;  2A68 F;  4KIB A;  4KUM A;  4ASN A;  1JE8 A;  2NNN A;  2L54 A;  1OMI A;  5D8L B;  5D6E A;  1I27 A;  1YFH A;  4LLN A;  3F23 A;  3LQR A;  2A6H F;  2OBP A;  3C3W A;  1F9N A;  2VE8 A;  3GYH X;  1MZB A;  4RAZ A;  2GAU A;  3I4P A;  2EJR A;  4UVA A;  2W25 A;  3KEO A;  4LD5 A;  4M71 A;  2ESH A;  3TOA A;  3QU6 A;  1H9G A;  1YW9 A;  1D8K A;  4RB3 C;  5DCF A;  3L2C A;  3WE2 A;  3HRS A;  3LA3 A;  5LEJ A;  2CWE A;  3HTU A;  2F5F A;  2XRN A;  1QZY A;  3Q5F A;  1IN4 A;  1FLI A;  3V8J A;  5E1W A;  3T8T A;  5ILU A;  2QYO A;  5CJ9 A;  3KZZ A;  4L9J A;  2FBI A;  3HRM A;  4EM1 A;  4XLN F;  3LST A;  5HLI A;  4MQV A;  2BEO A;  3ZPL A;  5L3C A;  4PGG A;  2K02 A;  1R1U A;  4BYY A;  2IJL A;  3CUQ A;  1NHA A;  4HQE A;  4I01 A;  1BM9 A;  1FBQ A;  1XMK A;  3WTZ A;  1H0M A;  5K5Q A;  1OKR A;  4UUV A;  2STW A;  1YLF A;  3JSP A;  4HDU A;  2DAO A;  2H09 A;  3IRR A;  1OPC A;  1O7F A;  3HOT A;  4U0W A;  1F1Z A;  5DCM B;  4HLX A;  3TKY A;  3N4M A;  4WXH A;  4I0A A;  3M9A A;  4HF0 A;  4DQ2 A;  1K6O A;  3VOD A;  4HOB A;  1JHH A;  1XCV A;  5HDK A;  5LLQ A;  2R7D A;  3WE3 A;  4UHT A;  1LEA A;  3QPT A;  5HLG A;  2ZME A;  1U5T A;  2ADU A;  3J80 Z;  2PFB A;  1DPR A;  1IRF A;  1FBS A;  3CUO A;  2ACJ A;  2V1U A;  2DPU A;  1HST A;  4N0B A;  2EFN A;  3BRO A;  1O7L A;  5HVQ C;  2AXL A;  1HW5 A;  3MZH A;  4CIC A;  2EV5 A;  2ZXJ A;  3BP8 A;  4Y17 A;  2HR3 A;  4A6D A;  4OIQ F;  4UV9 A;  3SFZ A;  2FE3 A;  3T5X A;  3JAM K;  2QQA A;  3KP4 A;  2ELH A;  3D0S A;  5BS6 A;  2ZCW A;  2IW5 A;  3ULQ B;  5ILV A;  2Q2E A;  2F2E A;  4BHP A;  1MGT A;  3MWM A;  1B6A A;  4LB5 A;  4MTE A;  4LLL A;  2XIG A;  1YQA A;  1U8R A;  2HEO A;  2OU2 A;  1R7J A;  4IJA A;  2LNB A;  2PI0 A;  2HYF A;  4ZZD A;  1T38 A;  5TRD A;  1TW3 A;  5L3E A;  5DUI A;  3LA2 A;  3ECO A;  3OOP A;  3MAJ A;  4M73 A;  4CZZ A;  5AON A;  2F5E A;  2CO5 A;  2XAG A;  2KJC A;  2IPQ X;  4UVB A;  1F5T A;  2HGC A;  3KP3 A;  3ERE D;  4K2E A;  1AWC A;  2L4M A;  1ZRC A;  3HYI A;  1FSE A;  1QQI A;  3W6K B;  2IVM A;  4Q47 A;  5DDG A;  3DXJ F;  4A0X A;  5ED4 A;  2CG4 A;  5ICE A;  4LK1 F;  3VB2 A;  4ENK A;  4KA4 A;  2Q0O A;  3R0J A;  2O8X A;  3WOD F;  4HYE A;  3NQO A;  3U9G A;  4EV0 A;  4BHC A;  2FBK A;  3I53 A;  4BNC A;  3Q9V A;  3EUH A;  1OYY A;  1RUO A;  1KU9 A;  3P9I A;  1BC8 C;  4AIK A;  1RZ4 A;  1VTN C;  4R1H A;  1IW7 F;  4M72 A;  1LB2 A;  2EFW A;  3F72 A;  3RKX A;  3GUD A;  2VBZ A;  3CTA A;  4KYW A;  3ISP A;  4RGS A;  2FML A;  4U0V A;  5CYV A;  4IXA A;  3ZN1 A;  2EFP A;  4GGG A;  2PQ8 A;  5HDN A;  2P5V A;  3OV8 A;  3CJN A;  1E2X A;  5ERI A;  4YFK F;  3WTY C;  2NYX A;  4ENM A;  1J59 A;  2RQP A;  1MD0 A;  3IKT A;  4UV8 A;  1ULY A;  1CF7 A;  1IN6 A;  3VOE A;  2ETH A;  3I5U A;  4L5I A;  4A5N A;  1IXR C;  5JHU A;  2H6B A;  1L3L A;  3GF2 A;  4YII A;  3BJO A;  3KP2 A;  5CVJ A;  4KMF A;  4HV5 A;  2BBY A;  3KFW X;  4IRI A;  4IVN A;  3EYY A;  3SZP A;  5HS9 A;  2EV6 A;  1ZH5 A;  1DP7 P;  3H3U A;  2QVO A;  1TQM A;  2G7U A;  2HZT A;  3I58 A;  4LB6 B;  3HRT A;  4GCV A;  1ZG1 A;  1P4A A;  1TBX A;  2VT2 A;  3N97 A;  1W5T A;  1HKT A;  5L3D A;  3V7C A;  2DT5 A;  2K86 A;  4HX8 A;  1W5S A;  4MEY F;  2O03 A;  4KIC A;  2A69 F;  4RAY A;  3QRF F;  3U2R A;  2JPB A;  4G6D A;  2HS5 A;  1R5H A;  3QPH A;  3EET A;  4EQQ A;  5FLX K;  3ML6 A;  2QBY A;  2BV6 A;  2X4H A;  3E6C C;  4O3M A;  2DPD A;  2PLY A;  2QUF A;  3K2Z A;  1FP1 D;  4QLC U;  3V8L A;  1ZGJ A;  4G6Q A;  2HQN A;  4XSX F;  1BJA A;  5FB2 A;  3L9F A;  4HLY A;  3R4K A;  3RJP A;  2XGX A;  3WGG A;  2YSR A;  6PAX A;  1W7P A;  3DPL C;  5FD5 A;  1G3W A;  5F1R A;  5AIQ A;  2H6C A;  3ZMV A;  2M30 A;  4L18 B;  1XSD A;  1FT9 A;  3M7G A;  3BWG A;  1KU2 A;  4P9U A;  1EH6 A;  4U88 A;  4P9F A;  2FOK A;  3R0A A;  3LA7 A;  3ZMZ A;  3BY6 A;  1TNT A;  5H6R A;  4WXD A;  1FYL A;  3GLX A;  2ZKZ A;  2G7H A;  2L4A A;  4OU0 A;  4MQ9 F;  3TOB A;  1U6G A;  1XN7 A;  3AAF A;  2VOO A;  1JHF A;  1SD6 A;  1G3Y A;  1D5V A;  3NRV A;  3KEQ A;  4EMS A;  1Z6R A;  3NEU A;  3WTV C;  4FHT A;  3GFI A;  1FC3 A;  3PFI A;  2FF4 A;  5EEH A;  4OMY A;  1FP2 A;  2Z33 A;  3F21 A;  2FEZ A;  2H27 A;  4ZYE A;  2JRT A;  4Y15 A;  2KIU A;  1KYW A;  1V4R A;  4P96 A;  3EQL F;  1YS6 A;  3L7W A;  4EJW A;  4OIP F;  1QO0 D;  2GA2 A;  1GHC A;  3WU0 A;  2GXB A;  4I2O A;  3WTT C;  2D1H A;  3SHF A;  1B4A A;  2EFO A;  5F64 A;  4ON0 A;  2KIF A;  2XAH A;  2FU4 A;  1MKM A;  1S7O A;  2DLL A;  3I59 A;  1BIB A;  5E18 F;  1WQ2 A;  2RN7 A;  3MZY A;  1S7A A;  2XUB A;  1FPQ A;  1IXS B;  4HX7 A;  3RYR A;  2IA2 A;  4MTD A;  5LGT A;  4HDV A;  1ON1 A;  4S04 A;  3O6B B;  2GZW A;  1ZLK A;  3HTS B;  3FXR A;  1I1S A;  4G9Y A;  1PP7 U;  2P5L C;  1U2W A;  5IT9 Z;  1MJB A;  5LEK A;  1LEB A;  2MLK A;  3FHZ A;  2P8T A;  3B02 A;  3KP6 A;  1B1B A;  5A2Q Z;  3E5Q A;  4B09 A;  2PN6 A;  5JVT A;  2P7C B;  4KNY A;  4KFC A;  1K7A A;  4HX4 A;  2PJP A;  3V4G A;  5DUK A;  1QZZ A;  3ZMT A;  1K78 A;  3SXY A;  4HF2 A;  3VEP A;  4OIR F;  2Z99 A;  2J5O A;  2E1C A;  3BPX A;  3DPT A;  3C1D A;  5E1X A;  1R00 A;  2R7F A;  2XAQ A;  2VT3 A;  4LJZ F;  3DKW A;  3MCZ A;  4AIH A;  4HV6 A;  3LFK A;  3V8K A;  2HTS A;  1UFM A;  3J81 Z;  4EJT A;  3HRU A;  3GVA A;  4RS8 A;  3TO7 A;  5KK1 A;  1FNN A;  3J80 K;  2FNA A;  1Z7U A;  1J75 A;  5ICC A;  1KGS A;  3KP7 A;  4RGU A;  1O3R A;  4Q4Z F;  2VBW A;  2OQG A;  1RUN A;  3LAP A;  2M8E A;  2IP2 A;  3DQV C;  5H6Q A;  1W4M A;  2VC1 A;  3R6S A;  3FZV A;  2QBY B;  1TQI A;  5L3G A;  2OD5 A;  1R36 A;  1TTY A;  1MDM B;  2K4B A;  1YG2 A;  3L00 A;  2RV8 A;  2YX7 A;  3REO A;  5FFX A;  4M74 A;  4D0P A;  3I54 A;  1BI0 A;  1G3S A;  1ZRE A;  3K0L A;  4ESJ A;  1IXC A;  2W57 A;  2GA1 A;  2ISY A;  1I5Z A;  3KCC A;  2K7L A;  3BOQ A;  5KVR A;  3F8B A;  4XRF A;  3M1E A;  1P6R A;  2DU9 A;  1S3J A;  2PMH A;  2W24 A;  1LDK B;  3V7S A;  2Q8K A;  4M6Y A;  2K27 A;  4N9H A;  2LSO A;  4MHG A;  2QQB A;  3E5U A;  4HW0 A;  3K1N A;  2HFH A;  2HYG D;  1MJA A;  3ZMU A;  1O3Q A;  1G4D A;  2XKP A;  2V79 A;  2EV0 A;  2XVC A;  1HQC A;  2VC0 A;  4Q5S F;  1UCR A;  1XGO A;  1PUE E;  5JFR A;  4P55 A;  3TO9 A;  3GFJ A;  2DO7 A;  1L0O C;  2Z9O A;  3I64 A;  2ZFW A;  2ZO4 A;  3E6B A;  4U7B A;  4LG0 A;  5BMZ A;  2DTR A;  2YR2 A;  2VON A;  1XDU A;  3K69 A;  4L0Y B;  4UXN A;  1LJ9 A;  5AIP A;  1XDS A;  3WTS C;  1I1G A;  1Z6T A;  4O6J A;  1J7K A;  3C7J A;  3ELK A;  2XHK A;  2JSC A;  2DQR A;  2IRF G;  2P4W A;  3T8R A;  4L9T A;  2FSW A;  4U0Y A;  2HQR A;  1ON2 A;  1SFX A;  4CHU A;  2NAZ A;  4WX9 A;  5CVV A;  4I7H A;  4EJU A;  4PCQ A;  1UB9 A;  3MEX A;  2A6E F;  4AIJ A;  3WTX C;  2W84 A;  4PZJ A;  3FM5 A;  5LGN A;  2LDU A;  1HSJ A;  3HUG A;  5LRS A;  3IC7 A;  1D8J A;  2VOP A;  3KZY A;  1KA8 A;  1ZG3 A;  1X3U A;  2CGP A;  2RDP A;  4S05 A;  1YW7 A;  5CLS A;  1J5Y A;  2CFX A;  1ZRF A;  2OAZ A;  3ABT A;  3I71 A;  2RKH A;  3ZP5 A;  3FMS A;  2NRA C;  5D5W B;  1IZ1 A;  5FFZ A;  3GO5 A;  3KE2 A;  1R22 A;  2O0Y A;  2MD5 A;  3O2P E;  4HZF A;  3GX4 X;  3E97 A;  3EYI A;  1FBU A;  2LKP A;  4RGR A;  4G7Z F;  3QOP A;  2OZ6 A;  1HW2 A;  4HBL A;  3LAJ A;  2L01 A;  1O57 A;  2A5Y B;  2QEN A;  1TNS A;  4A6E A;  2L3D A;  1FYK A;  2QQ9 A;  1Z91 A;  3CUQ B;  5DYM A;  1P92 A;  1U78 A;  1SFE A;  3EDP A;  3E3V A;  4E70 A;  5LRR A;  1LDD A;  3BJA A;  4H0E A;  1RNL A;  1FOK A;  2H94 A;  3F6V A;  4UVC A;  4OMZ A;  3GFL A;  1J0R A;  3M8F A;  2UZK A;  3FM3 A;  4YFN F;  1WRJ A;  5J8F A;  3K1P A;  3H92 A;  2ISZ A;  3ROU A;  1DDN A;  4RB2 C;  5HLH A;  3HSE A;  5DCM A;  2Z3Y A;  2YX4 A;  5FGM A;  3WTW C;  2ZME B;  4ESB A;  2E1N A;  3PQK A;  4WXC A;  1U5T B;  3COA C;  2J5P A;  3G3Z A;  4G7H F;  2XAJ A;  1BBY A;  3BPV A;  4HAM A;  1S6L A;  1WKM A;  1REP C;  1TW2 A;  3HHG A;  2CQK A;  4OOI A;  3HHH A;  1T0F A;  4WWC A;  1STZ A;  4ZYH A;  2O3F A;  1T98 A;  4M9Z A;  1QGP A;  2EA4 A;  5L3B A;  2A61 A;  3HSR A;  4JBA A;  1Z1D A;  4PDK A;  4OIO F;  4YG2 F;  3R60 A;  3QU3 A;  2GWR A;  2V9V A;  5DV5 A;  1V3F A;  2DI3 A;  1EH8 A;  5BPI A;  3IWZ A;  1HXD A;  2RGV A;  3WG9 A;  2G9W A;  5EEG A;  1R5G A;  1R1T A;  2GXG A;  3Q9S A;  1R58 A;  2PEX A;  5CVR A;  3B73 A;  4YFX F;  3P9C A;  3FWE A;  5J6X A;  1FWZ A;  1P2F A;  3TO6 A;  3IRQ A;  5H20 A;  1GVJ A;  1OYW A;  1R23 A;  1UHM A;  4IF4 A;  4EGZ A;  1J9I A;  5L3F A;  3K1M A;  2ZBK A;  5LGU A;  1KQ9 A;  1P4W A;  2JTV A;  4EM0 B;  3P9K A;  1HW1 A;  4KIG A;  1I6X A;  2IT0 A;  2JZY A;  1PDN C;  4KN7 X;  3IKV A;  5D6F A;  2FA5 A;  1KU3 A;  1OR7 A;  3TDU C;  2HKO A;  1WWX A;  4L9V A;  4FT8 A;  4KN4 X;  5E1Z B;  1BOA A;  1QPM A;  5E8I A;  3RKY A;  3HIF A;  4LFU A;  2QM3 A;  1ZLJ A;  4JQF A;  4ESF A;  5K1Y A;  5D4R A;  3FF5 A;  3TDZ C;  4RGX A;  2WC2 A;  1SD5 A;  2QLZ A;  3T1B A;  2EB7 A;  5D8K B;  5D5X B;  2STT A;  1WSU A;  2ZNY A;  4LLG F;  4BAY A;  1D3Y A;  3HOS A;  1ZGA A;  2VBY A;  4GYG A;  2VXZ A;  5IT3 A;  2XV4 S;  3I0T A;  2QZ8 A;  5IT9 K;  4NB5 A;  1JXS A;  3GW2 A;  2VE9 A;  1SMT A;  1ONV A;  4N9I A;  3V7R A;  3R61 A;  3DV8 A;  2KIM A;  2V1D A;  2NS0 A;  3QP5 A;  5A2Q K;  2F5C A;  3DF8 A;  4AD9 A;  1S29 A;  1HKQ A;  2RNJ A;  3RDI A;  4CO8 A;  4RB1 A;  5D5V B;  1BI2 A;  3T0Y A;  4WF2 A;  2B0L A;  3BDD A;  1JGS A;  4I0B A;  5BOX A;  1IN7 A;  1KQ0 A;  1CF7 B;  1S8N A;  3GZ5 A;  3C18 A;  2AS5 F;  1KQ8 A;  1Y0U A;  2HOE A;  5LHI A;  2DW4 A;  1XCB A;  4ZZL A;  2WV0 A;  4B8X A;  1IUY A;  4KT5 C;  4NQW A;  2FXA A;  1Q1H A;  2C6Y A;  1IF1 A;  3J81 K;  2OA4 A;  5E17 F;  4JK1 X;  4A0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...