1OKRA

Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
120
structure length
120
Chain Sequence
KTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
publication title Three-Dimensional Structure of Meci: Molecular Basis for Transcriptional Regulation of Staphylococcal Methicillin Resistance
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Bacterial antibiotic resistance
total genus 40
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1okrA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1okrA02
2EFNA 4BHCA 1L3LA 2ACJA 2JPBA 5JVTA 4A5NA 1UB9A 4ETSA 1TNSA 2GQQA 2F5DA 1PDNC 1B9MA 1YYVA 1QQIA 3FXRA 1GHCA 1USSA 1YFHA 1ULYA 5AONA 4IF4A 5L3BA 2EFWA 3MWMA 3CUQB 5ED4A 2E7XA 2VC0A 2MH9A 5E8GA 1EH7A 1FYLA 3BJOA 4ZYGA 2XHKA 2R7DA 1FY7A 2A07F 5BQTA 2OZ6A 3SHFA 5LGUA 5CVIA 3TOAA 2HDCA 3MEXA 3ERED 1ZGAA 5E1ZB 3WTVC 5IT9Z 2Q8KA 4RB0A 3GVAA 2OU2A 1P4XA 5LRRA 4EM1A 4U7BA 4Y13A 1RNLA 4G7OF 3LA3A 2VBYA 1BI3A 3KLOA 2OQRA 2CG4A 2PEXA 5LHIA 2FNPA 1ZHFA 3ULQB 4N0BA 4A0XA 2QZ8A 5D6FA 4UHTA 1MJAA 4ZYHA 1FP2A 3TKYA 1U5TC 3CLOA 1C0WA 4LG0B 5L3CA 1O3RA 2MH2A 1DP7P 1TW3A 1E17A 3WTUC 5DCMA 3WGGA 4LB6B 4ESFA 4UV9A 2EV6A 3ELKA 4HLYA 4UVAA 3WGIA 3DPLC 2DT5A 3TGNA 4IXAA 4CDGA 1PP7U 3DV8A 3GXOA 2VT3A 3BPXA 2R3SA 2NNYA 3FXQA 3BWGA 4H0EA 1JGSA 1U6GA 2PLYA 2W84A 2K4JA 5JHUA 1I6XA 1ON2A 5D6EA 3WTYC 4OIPF 5HLHA 3GFIA 1XSVA 2XAQA 1RUNA 1GXQA 3M9AA 2OA4A 3U2RA 3KEQA 1XN7A 2VBXA 3QU3A 2G7UA 3FM3A 4I0BA 1I1GA 3VFZA 2WTEA 4A0YA 2P5KA 4EGYA 5L3GA 4LK1F 1UCRA 5IT9K 2P8TA 4CZZA 3FZVA 3ZPLA 4IRHA 1AOYA 2PJPA 1KU7A 4EGZA 4G94A 3FMQA 3VEPA 2FMYA 3OV8A 4RAYA 3NQOA 5E18F 3HSEA 3F8CA 1P4AA 1T0FA 4P96A 1J9IA 1KGSA 1R5HA 2DO7A 5JI6A 3LA2A 5EEHA 1BOAA 5D8KB 2EA4A 3C7JA 3QOPA 4HF0A 2YX7A 2A5YB 4Q5SF 1XDSA 4KIBA 4KNYA 1DDNA 2MLGA 4KIFA 1ZG1A 2M30A 4M73A 3FX3A 2RQPA 5FFXA 2CFXA 3KP2A 1ZH5A 4OIOF 3B02A 5CVJA 3BZ6A 4O5VA 2HKXA 3ABTA 2F5FA 5F6FA 1B6AA 3FWEA 2XAHA 3LQRA 3KLNA 4ZH4F 4B09A 2P4WA 4I02A 1HKSA 2VOPA 1XSXA 4CO8A 1USTA 3NEUA 2FBIA 2EFOA 2BBYA 2D1HA 2KIMA 3E5XA 2FSWA 4EMSA 3ZQ7A 4G8XA 1TW2A 3GWZA 5D5UB 1G6NA 2PMUA 3F72A 1LDJA 5ICEA 4JQFA 2GIVA 4MTDA 3F22A 3V8LA 2A6HF 2P6SA 4EJWA 3N4MA 3KE2A 2VE8A 4U0YA 1ZLKA 5E1XA 4M6YA 5HVQC 4TV7A 3I59B 3O6BB 1ON1A 3L7WA 4UV8A 2V1UA 2GXBA 1P2FA 2V6CA 3RKYA 4RB2C 3V7SA 2QBYA 3PQKA 2XIGA 3H92A 3MCZA 1IN5A 3C1DA 3LFKA 2HTSA 4ENJA 5HLGA 3OOPA 2L01A 3V8JA 2O8XA 4FX0A 4NB5A 2HS5A 4R79A 3J80Z 3MQ0A 1LVAA 3VOEA 3HUGA 3LQQA 3V4GA 3ECOA 1OYIA 3COAC 2Y75A 5ICGA 1MDMA 1KQ9A 1J7KA 1KA8A 5A2QZ 3JSPA 2HZTA 1OKRA 4EJVA 2RV8A 3F6OA 4IRIA 3WG9A 3K0LA 3LAJA 2HWVA 2DBBA 3HOTA 3QAHA 2ZBKA 4MEXF 4KYWA 5LGNA 4YFXF 1IZ1A 3W6JB 4YFKF 3ZMUA 3ZP5A 3R61A 4A2UA 2HTJA 2JRTA 5J8FA 2XAJA 3FF5A 2W25A 2L02A 4RGXA 1IF1A 1ZREA 1TQPA 1LDDA 2KRFA 4PGGA 1I27A 1Z91A 2XVCA 1G4DA 5H20A 3TO7A 2XRNA 1PP8F 4CYDA 3QRFF 2GA1A 3I54A 1RZ4A 2QQBA 1KYZA 1FT9A 3I64A 5DCMB 2ZJ2A 1LB2A 5DCFA 2RNJA 4BQAA 2PN6A 2O6GE 4LK0F 4BHPA 1YS7A 3HSFA 4PCQA 2RN7A 1TQIA 2ZXJA 2ZMEA 1NHAA 2QVOA 3F21A 4ESBA 5BMZA 3GLXA 4CICA 3I5UA 4ESJA 3WTSC 5HS8A 2O3FA 1KU9A 3KP6A 4BHBA 1E2XA 4L5IA 3HTSB 5H6QA 4RGUA 3D5LA 1REPC 1ZG3A 2Z5UA 3EDPA 3J80K 1UFMA 3HTUA 1JHFA 1SMYF 3K1MA 1LJ9A 3M1EA 2M8EA 3MAJA 2JTVA 5ICFA 4U0VA 5E20A 2QENA 4U7DA 1FBSA 4XLPF 1Z9CA 1D8JA 3FM5A 1ZRCA 4KMFA 4AWXB 3F23A 2WWYA 1PUEE 3RYRA 4HA8A 3SZPA 3BY6A 2QM3A 1MJBA 2R7FA 2GZWA 1BI0A 3E5QA 2P7VB 2PMHA 2LF7A 5K1YA 3LAPA 4A12A 1S7AA 4M6XA 4OINF 2YX4A 1LQ1A 3E6BA 3TQNA 1ONVA 1SD4A 2HR3A 1W5SA 1FX7A 2ZFWA 3C18A 3IWFA 1T38A 1XGSA 5DYMA 2J5OA 1W7PD 2IP2A 2IJLA 3WU1B 2O0YA 4B8XA 1K6OA 2QYOA 1O57A 2KJCA 2M45A 1SD6A 2Z33A 1FWZA 1K78A 3P9CA 2LNBA 1FSEA 1G3TA 2TDXA 4FX4A 2CW0F 5BPIA 1B1BA 2GAUA 3RI4A 3RKXA 2FEZA 3RTRA 2STTA 4BH9A 2JSCA 2NYXA 4I09A 3U9GA 2MLKA 4R1HA 4M74A 4Z2YA 1JHHA 2ISYA 2BYVE 4NQWA 4MQ9F 2CO5A 3RKWA 5LHGA 4LLGF 3T8RA 2K7LA 5FLXZ 2QLZA 3BJ6A 5HOOA 1I1SA 1XD7A 4G7ZF 3W6KB 1UHWA 1BI2A 1EV7A 4WF2A 4AIKA 2UXNA 4NHJA 1LNWA 4ZZLA 3KCCA 3DP7A 1YW7A 4IHSA 1R36A 4AIHA 4L9NA 3GUDA 4L0YB 3K1NA 1SAXA 2DW4A 1BN5A 1YS6A 2YPRA 2WV0A 2G9WA 4HLXA 4QWQA 4LB5A 2EA2A 2XASA 2FU4A 4FT8A 4F7ZA 4HX8A 1ZRFA 3HHGA 4PZJA 2W85A 2M87A 1IXCA 5JR3A 5DD4A 4A0ZA 4XRFA 4ZZDA 2MA3A 1YW9A 3HRMA 2QBYB 3GZ5A 5K5OA 1T98A 2RC4A 3SZTA 4RAZA 3WTWC 2ZNZA 5E17F 1D3YA 4AD9A 2A6EF 3L00A 5L3FA 1U5TA 4WX9A 1ZAOA 4L18B 4E70A 3J7AO 5DEQA 1W7PB 5HDNA 1MDMB 3CUQC 3GFLA 2P6TA 2F5CA 5HLIA 2IRFG 2E1CA 2L3DA 2X0LA 3T8TA 3QP6A 1IUYA 4M9XA 3R4KA 3MZYA 4MGRA 2CYYA 2DU9A 4GCVA 1GVJA 1BC8C 4HDUA 2AXLA 1R1VA 1JE8A 2GXGA 3G73A 3N97A 1STZA 5HS7A 2VC1A 5FLXK 1MZBA 1D5VA 1IRFA 1SFXA 1MKMA 3FXUA 4S04A 1RIOH 1TLHB 2ADUA 2DFIA 4OMYA 3CUQA 2YU3A 4EM2A 2NS0A 3AAFA 2M1BA 2V79A 1H9TA 1WRJA 1ZLJA 5DV5A 5EEGA 3RJPA 3WTZA 2FF4A 1FC3A 4KA4A 2CWEA 2RKHA 2IPQX 4Y17A 1FLIA 2EV0A 3TO6A 2ZMEB 3I4PA 4IHTA 4LD5A 3HOSA 2OQGA 4P9FA 4ENMA 2XKOA 3IWZA 3NRVA 3ZN0A 5CVVA 1GXPA 4HAMA 2LSOA 1U3EM 1IN4A 2GWRA 5CYVA 3LWFA 2JZYA 1D8KA 2CSOA 3HHHA 2FMLA 1Z6RA 1KQ8A 4IJAA 1XDUA 5D5VB 4RS8A 1IN6A 1R22A 2VBZA 3IRRA 5FB2A 1R00A 2F5EA 3ROUA 1T39A 3GEZA 2D45A 3TDUC 4K2EA 1T2KA 3WTTC 4OU0A 2GA2A 5HDGA 5ICCA 4HYEA 4HDVA 4LLNA 3KP5A 1XMAA 4UXNA 3RPUA 3MZHA 2DPUA 2UXXA 3BOQA 1SD5A 1W5TA 1YG2A 4P9UA 2P5LC 4XSZF 3GO5A 1XGMA 2HKOA 2XUBA 4HX4A 3SFZA 2PI0A 4WK8F 5HS9A 4RGSA 3P9IA 1R23A 3GYHX 5KK1A 1S29A 1K7AA 2D1VA 4P5OA 3T5XA 3IHUA 4R8HA 5E1WA 1K79A 2M5WA 1S8NA 1B9NA 1TBXA 4M9ZA 3FMRA 3I53A 4OOIA 3EYYA 4N9IA 3TOBA 2FNAA 3I0TA 5DD8A 2MBFA 1DUXC 3T1BA 1RUOA 4L9TA 2V1XA 3F8NA 4I7HA 1G3SA 3QPTA 1FZPB 4I0AA 1LEBA 1F5TA 2W24A 3GW2A 1DPUA 3JW4A 2KIUA 1BI1A 4G7HF 1IN7A 1O7FA 3M8FA 5ERIA 5AIPA 2XGXA 5TRDA 2DAOA 5ILSA 3E5UA 3ZN1A 4AIJA 4A5MA 5DUIA 1JXSA 3K69A 2QQ9A 4OIRF 2K27A 2QWWA 3ABUA 3DKWA 3PFIA 4EV0A 3V7CA 1ZYRF 4BYYA 2ZKZA 4HV5A 1KU3A 3Q5FA 2P7CB 5HDKA 2FBHA 2MD5A 3P7NA 1QO0D 3L2CA 2IA1A 3KP7A 1EH8A 1KU2A 1FYKA 3F8FA 1HW2A 3QU6A 3FMSA 2G7HA 1SFEA 1R5GA 2B0LA 3CJNA 2IT0A 2XKPA 2W57A 1U2WA 1YQAA 3R0JA 2PFBA 4HW0A 2Y48A 3TO9A 4YFNF 4YIIA 1T6SA 4KICA 4M71A 2H09A 3KEOA 4HQMA 5H6RA 2IA0A 1U5TB 1FYMA 2CQKA 3Q9VA 5CVUA 4OIQF 3HRSA 1Z05A 2KIFA 4JBAA 4DQ2A 2HFHA 3S2WA 4XBFA 4EQQA 1KQ0A 3DF8A 1F4KA 3P9KA 1R1UA 1KYWA 3KFWX 2OBPA 4DNCA 1BIBA 4KIGA 2BV6A 3FHZA 1FBUA 1W4MA 2FE3A 3HYIA 2VN2A 2VE9A 3B73A 2ELHA 2RDPA 1U78A 1J5YA 3HRTA 4QLCU 3VODA 5LEJA 1QBJA 4FHTA 2HOEA 3REOA 4XSXF 3F3XA 4U88A 2H6CA 2EWNA 1XCVA 3R0AA 2PBIA 4MTEA 5F64A 3BPVA 1MD0A 3RYPA 5LRSA 1OR7A 1V3FA 4U0WA 1H0MA 1CGPA 5E8IA 4EJTA 2ESNA 2FA5A 3U1DA 1BM9A 5FGMA 4BAYA 1ZG5A 3MFKA 1LDKB 5J6XA 2O03A 3DPTA 3ECHA 3ZMZA 1HSJA 1X3UA 2ZNYA 4RB1A 1QZZA 4ZYEA 3KZZA 4YIFA 1HXDA 3F6VA 3J81Z 4CHUA 1XGOA 2A61A 3LA7A 1ZN2A 4N9HA 1FOKA 1Y0UA 2OAZA 1MGTA 4G9YA 3HIFA 2V9VA 2LDUA 4GO1A 3H3UA 2DQRA 4EM0B 1OPCA 1HW5A 3IL2A 4UUVA 4LLLA 3Q9SA 5IT3A 4HF1A 2DK5A 1V4RA 1Q1HA 4HBLA 1YW8A 1CF7A 4WXCA 2HYGD 2FXAA 1ZRDA 1RI7A 4EVIA 5CLSA 4ON0A 2AS5F 1IN8A 1BC7C 2Z9OA 3KP4A 4BNCA 3QPHA 5DUKA 2Z3YA 2OZUA 3V7RA 1EH6A 3I58A 2K86A 1IXSB 2EJRA 2EB7A 2EFPA 1IW7F 1AWCA 6PAXA 2V1DA 2DQLA 1YIOA 2KJBA 2EV5A 4EJOA 4IVNA 2E1NA 1BBYA 4LFUA 1OYYA 1YLFA 1TTYA 3WGHA 5LBQA 2VXZA 1QZYA 1WKMA 2NNNA 4LGWA 3E3VA 3WU0A 2ETHA 2DPDA 5JFRA 4RGRA 5L3DA 1FP1D 3IRQA 4WXHA 5LHHA 2L54A 2UZKA 3LSTA 5ILVA 2O61A 3E6CC 1R58A 4A6EA 1HSTA 5FD5A 4M9SA 2H94A 4HOBA 4GYIA 2DK8A 1SMTA 1O3QA 3V8KA 2QUFA 1S3JA 2WC2A 4MNUA 5KVRA 3JTGA 1HKTA 4HZFA 1FSHA 5AIQA 2KKOA 1OMIA 2CGPA 4MQVA 3GFMA 1H9GA 1J75A 3SXYA 2FQ3A 2RGVA 3DEUA 3J81K 2COMA 3GFJA 3HSRA 1FNNA 4CGZA 2K02A 3L9FA 4L9VA 3RDIA 4MHGA 1P92A 3ISPA 5FFZA 3M8EA 4ENNA 3CUOA 3KP3A 1S7OA 4WXDA 4LMYA 2BE5F 5D4SA 5FD6A 4KMUX 4I2OA 5J8CA 1F9NA 3I71A 1VTNC 2IW5A 2HQNA 1R1TA 3EQLF 3ZMTA 1UHMA 5K5RA 1IRGA 3CO6C 4PGHA 1XB4A 2YSRA 3ZMDA 3D0SA 2H27A 3R60A 1QPMA 3BROA 2STWA 4UNOA 4G6QA 2IA2A 2DTRA 4BXUA 3IKVA 1YTYA 4XLNF 3IC7A 2MC3A 3G3ZA 1OYWA 2HEOA 5CVRA 2PG4A 2HGCA 2HQRA 3T0YA 3F8MA 2C6YA 5LLQA 3R6SA 4EJUA 3ZMVA 3JAMZ 2EK5A 3H3ZA 1L0OC 2ZO4A 3K2ZA 2VODA 1HQCA 3PQJA 2A68F 4KN7X 1XGNA 1TNTA 1BJAA 1ZGJA 3K9TA 2OD5A 3CTAA 4Q47A 3JTHA 4HQEA 1P6RA 1P4WA 2H6BA 1J2XA 1SFUA 4UVBA 4LG0A 3WE3A 4IRGA 5TJJA 3F8BA 3ML6A 1B59A 4JK1X 4S05A 4GGGA 5D4RA 3ZMSA 3BDDA 1XSDA 1HBXG 2FBKA 1WWXA 2IVMA 2YR2A 1SD7A 2Y0MA 4P55A 2P5VA 2EFQA 1J59A 4MEYF 3KZYA 5ILUA 3WTXC 1ZARA 1HW1A 4ENKA 2Q0OA 1Z6TA 1XCBA 3E97A 3CO7C 4ASNA 1R7JA 2VONA 5D8LB 3EYIA 5LEKA 4KFCA 3KETA 5F1RA 3TDZC 3SQNA 2LKPA 4Q48A 3GX4X 4HX7A 2L4MA 3M7GA 2ZCWA 1ODDA 2LF8A 1K78B 2X4HA 1TQMA 1W7PA 1HKQA 2BEOA 4O3MA 3E6MA 5BOXA 2NAZA 3C3WA 4A6DA 3K1PA 1LEAA 2PQ8A 4I01A 4O6JA 1WI9A 4LJZF 4KT5C 2BGCA 2VT2A 3JAMK 2F2EA 1I5ZA 4HV6A 3L09A 3GZ6A 4UVCA 4OMZA 1O3TA 5K5QA 2UWMA 4HF2A 5D5XB 2VBWA 1DPRA 4IPAA 4PDKA 2L4AA 2D2WA 4G6DA 1CF7B 4Q4ZF 1QGPA 1S6LA 3VB2A 1WQ2A 1A04A 1F1ZA 2XROA 2A69F 4L5JA 2QQAA 4GXOA 2DLLA 2Z99A 1Z1DA 5D5WB 2RVCA 4L9JA 3DXJF 2FOKA 3BP8A 5LGTA 4L0ZB 4I98B 2FRHA 2A3SA 5DDGA 4KUMA 5BS6A 1FBQA 2ISZA 3DFGA 4KDPA 5L3EA 4GYGA 3O2PE 1Z7UA 3HRUA 3CDHA 5BPDA 4D0PA 2XV4S 1XMKA 3EUHA 1IAWA 1U8RA 4KN4X 4WWCA 3O3KA 4Y15A 1O3SA 1FPQA 5CJ9A 3GF2A 3WE2A 2J5PA 3DQVC 1BIAA 3WODF 3BJAA 2HYFA 4CXFA 2E7WA 4ZYDA 1G3WA 4YG2F 2XAFA 1QNTA 2K4BA 5FO5A 4RB3C 2JT1A 1B4AA 1MJ9A 2ESHA 3IKTA 3E6DA 2DI3A 4AVPA 3QP5A 5A2QK 1YO5C 2JPCA 4WCGA 1WSUA 3JSOA 2VOOA 1O7LA 3RIRA 3I59A 2NRAC 1G3YA 3RPQA 3EETA 4M72A 1J0RA 2XAGA 2Q2EA 1IXRC
chains in the Genus database with same CATH superfamily
2EFNA 5J40A 4DJAA 4BHCA 2OJED 1L3LA 1TWCJ 2XGDA 1A36A 2ACJA 3BR3A 2A5WA 2JPBA 5IOYA 1JT6A 5JVTA 3A4CA 3OYGA 4A5NA 1VQ4I 1UB9A 4ETSA 3A02A 3SYTA 4U87A 3L2UA 2ZJQF 1TNSA 2GQQA 4JOMA 3GTGJ 2R5YB 2F5DA 5FKLA 3DLLF 3OIPA 3S1QJ 1FEXA 1PDNC 1B9MA 1YYVA 2FJ1A 1QQIA 4A3EJ 3FXRA 1HC8A 3BR1A 1MW7A 3IUOA 1GHCA 1USSA 2NOGA 1YFHA 1ULYA 5AONA 2E19A 4IF4A 5L3BA 2EFWA 3MWMA 2HZDA 3CUQB 4PFPA 3OYFA 3GBGA 5ED4A 2E7XA 5EG0A 2VC0A 2MH9A 4BQQA 2KPMA 2M3AA 3QQAA 4A3FJ 3HKZN 1VQOI 2PMZN 5E8GA 1EH7A 1FYLA 3BJOA 4HEA2 1XMXA 4PSWA 3TP0A 4ZYGA 2XHKA 2X6OA 2DA2A 2E5NA 2R7DA 1FY7A 4X6AJ 2VB6A 3L2QA 4A3DJ 1PJRA 3RZDJ 2A07F 1Y0NA 5BQTA 2CJJA 2OZ6A 3SHFA 5LGUA 5CVIA 2XPUA 3TOAA 2HDCA 3MEXA 3ERED 1ZGAA 5E1ZB 3WTVC 1S72I 4BBRJ 5IT9Z 1WH5A 4N4OB 1HDPA 2VJJA 2Q8KA 3A1YA 3GTJJ 3FKJA 1D5YA 4RB0A 3GVAA 1WFXA 2OU2A 4XN3A 1P4XA 5LRRA 1WI3A 4EM1A 4Y13A 4U7BA 1RNLA 4G7OF 2VI6A 3PNVA 3LA3A 1N25A 2VBYA 1BI3A 2R5ZB 3PIPF 3KLOA 2KZGA 2OQRA 2DMUA 2CG4A 2PEXA 5LHIA 2AXTC 3S3NA 2FNPA 1ZHFA 3ULQB 4BJ6C 3PNTA 1WH7A 1R5ID 3BG7A 1XTAA 4XLHA 3GTMJ 4N0BA 2CW8A 4A0XA 2QZ8A 3QYBA 4XM3A 4IOCF 1ZQ3P 5D6FA 4PJJA 2NS8A 5CQEA 4UHTA 1MJAA 4ZYHA 1FP2A 3TKYA 1U5TC 3CLOA 1C0WA 2IS6A 4LG0B 1Z0XA 4IEJA 5L3CA 1O3RA 2MH2A 1DP7P 3ZR8X 1TW3A 1E17A 4A3CJ 2E5ZA 3WTUC 2PJRB 5DCMA 2DFEA 3WGGA 3I3LA 2O8KA 1N78A 2P81A 4LB6B 5HNHA 4YIRX 4ESFA 3OYMA 4UV9A 1TL8A 1YX3A 2DA3A 2EV6A 3ELKA 4HLYA 4UVAA 3WGIA 3DPLC 2B9SA 5BNGA 2DT5A 1LE8B 4XN0A 3TGNA 4E7JA 3H0GJ 4NNJA 4KT6A 4G12A 4IXAA 2ZXIA 4CDGA 1PP7U 3DV8A 5FLVA 2M8GX 2VT3A 3BPXA 1D0ZA 2MW8A 2R3SA 3GXOA 1UZCA 2NNYA 3FXQA 2ELJA 3BWGA 4H0EA 1QVTA 2HVQA 1JGSA 1U6GA 4DYRA 2PLYA 2W84A 3I9V2 4I6ZA 2NVXJ 2PX9A 5KCMA 4ZYAA 1Z67A 2HXIA 2K4JA 5EEAA 5JHUA 5EGOA 4CYCA 3D1NI 5IPAA 2Z2SB 1VQ6I 4IOAF 1I6XA 1ON2A 5D6EA 2KT0A 3DTIA 3QYEA 3WTYC 4BE2A 1MNDA 3LSHA 4OIPF 4HNUA 5HLHA 3GFIA 1XSVA 2E34A 2XAQA 1BR2A 2LFBA 1RUNA 1GXQA 3M9AA 2DMQA 2OA4A 1MSFC 3CC7I 5KNLA 3U2RA 3FDYA 5JVGF 2ZSIB 3KEQA 2CMPA 3BC8A 1XN7A 2VBXA 4XQFA 1SFKA 2ICWG 3KEYA 1IJWC 2GOXB 4XK4A 3QU3A 2EPFA 4LITA 3JREA 1CQTA 2G7UA 5FKMA 3CP2A 3FM3A 4I0BA 2JVHA 1NK2P 1I1GA 3VFZA 2WTEA 4ZTFA 4A0YA 1X4PA 3O8GA 2P5KA 4EGYA 5L3GA 3A2KA 4LK1F 1UCRA 2L2OA 5IT9K 5J4VA 2P8TA 4CZZA 5E79C 1W36C 3K4JA 2MD0A 3FZVA 2OTLI 4AYBN 1R4MB 4CA0A 2E36A 3ZPLA 1RRJA 4IRHA 2GBYA 2R7ZJ 2K9NA 1AOYA 2PJPA 1APLC 3CMEI 1Z3YA 1KU7A 5FRNA 2OV7A 4EGZA 1V5GA 4G94A 3FMQA 3VEPA 2KLOA 1YRNB 2HVSA 2FMYA 3OV8A 4RAYA 5IY5H 3NQOA 5GPCA 2DA7A 2ID3A 5E18F 3OS1A 3HSEA 3F8CA 1GLNA 1P4AA 1T0FA 4P96A 1J9IA 3VWBA 2JK3A 3S3OA 1BR1A 3CLQA 3BLYA 1KGSA 5H2FC 5HLTA 1R5HA 1W5CC 2DO7A 5JI6A 3LA2A 5EEHA 1BOAA 2VQLA 2EIJH 1JGGA 1V55H 5D8KB 2EA4A 3PM1A 2ECBA 3C7JA 2AQFA 2LVSA 4E7KA 3QOPA 4RLQA 1Q1VA 1VZ0A 1U9NA 4RMNA 4L5EA 1ETYA 2KIQA 4HF0A 2YX7A 2A5YB 4Q5SF 1XDSA 2L9SA 4KIBA 4KNYA 1DDNA 2MLGA 4KIFA 1ZG1A 2M30A 4M73A 4A3MJ 3H9JA 3FX3A 5FKOA 1T95A 3PIOF 2RQPA 5FFXA 3J7AY 2CFXA 3KP2A 5F27A 2XPVA 1ZH5A 1HOMA 2H8WA 4FETA 2X1EA 4OIOF 2IGKA 3CCEI 3B02A 5EYRA 2K9LA 5CVJA 5GAEJ 1VQLI 3BZ6A 4UUSB 4O5VA 4IO9F 2HKXA 3CMYA 4W1UA 3ABTA 2R7QA 2FUG2 2CUEA 2BXZA 2F5FA 5F6FA 3BG9A 1Y1VJ 5B5EC 1B6AA 3FWEA 1YJNI 2XAHA 3LQRA 4II2A 2IBDA 3KLNA 2LG4A 4ZH4F 4D1QA 2W48A 4B09A 4E4HA 2P4WA 3ASOH 2BY2A 3FXKA 4I02A 3M1CA 1HKSA 3OYCA 2VOPA 1XSXA 4CO8A 1LFBA 3HG9A 3Q0WA 2L9NA 1USTA 3NEUA 4LIUA 2FBIA 2EFOA 2BBYA 5M5WJ 1OCOH 1IRZA 3VYRB 2D1HA 2KIMA 1MMNA 1JUMA 2FSWA 3E5XA 4XLAA 1TWGJ 2KRCA 3ZQ7A 4EMSA 3JR9A 3E7LA 4G8XA 1VFCA 1TW2A 2KDOA 4PJLA 3GWZA 5D5UB 2AQEA 2MGQA 1Y8RB 1G6NA 2WAEA 3WHCA 3HXLA 3BR6A 2GIZA 5IYCJ 2DDAA 2PMUA 3LSIA 3F72A 1LDJA 5ICEA 2O9LA 4MFEA 4JQFA 2GIVA 1YITI 4MTDA 1OLTA 2LRDA 2VJ4A 1MBGA 5M5XJ 3F22A 2M7BA 4C3HJ 4F3QA 2Y0SN 3V8LA 1HLVA 2A6HF 2P6SA 2K3FA 1TWFJ 1JT0A 3Q0UA 4EJWA 5LFAA 1LUJB 3N4MA 3KE2A 3N05A 2KISA 2VE8A 2WAQN 4U0YA 1ZLKA 5E1XA 4IL6C 4M6YA 5HVQC 3HOZJ 4TV7A 3I59B 3O6BB 1ENHA 1ON1A 2YUSA 3L7WA 4UV8A 3AG2H 2V1UA 2CS3A 3KX2A 1P2FA 2GXBA 4UUTA 1SVOA 2V6CA 3J7YJ 3RKYA 1MIJA 2LKXA 4Z6YA 4RB2C 3QPLA 2Q2EB 1R4NB 3V7SA 1B72A 2NVYJ 2QBYA 3PQKA 2X48A 2QKLB 3CF2A 2KQRA 3FIWA 2XIGA 3H92A 3MCZA 1A35A 1NG6A 2Y2ZA 1IN5A 3C1DA 3CMMA 4QPQA 3LFKA 2HTSA 4ENJA 1YJ9I 4DBRA 3FXOA 5HLGA 3OOPA 2ME0A 2KDZA 3SEQA 2L01A 3V8JA 2O8XA 4FX0A 4NB5A 2HS5A 4R79A 2LYCA 3J80Z 1O4XA 2LR8A 3MQ0A 1LVAA 2EILH 3HUGA 3LQQA 3VOEA 1IDZA 3V4GA 1RC9A 1H89C 3ECOA 1OYIA 5DM6F 3COAC 2Y75A 5ICGA 1MDMA 1KQ9A 1D0YA 2XPWA 5GTIC 1D0XA 1J7KA 1KA8A 5EG0B 3L2VA 3KYDB 5A2QZ 3JSPA 3S3MA 1H8AC 3OL3A 4II3A 2HZTA 1W0UA 1OKRA 3CDLA 5IP7J 4EJVA 2RV8A 2W4SA 3F6OA 2BHYA 3FBNB 4YRVA 2DT6A 4IRIA 1JJ6C 1G59A 3WG9A 4ABZA 3HOXJ 3K0LA 3LAJA 2HWVA 2DBBA 3HOTA 3QAHA 1ZR2A 2ZBKA 4MEXF 4KYWA 2EBIA 5LGNA 1OCTC 4YFXF 4OAYA 1RKWA 5M3FJ 3BG3A 2L7MP 5IP6A 1MBFA 1IZ1A 2DTZA 3W6JB 2XGCA 4YFKF 3ZMUA 3ZP5A 3R61A 4IZZA 3DWLE 4A2UA 2HTJA 2JRTA 4RM2A 3F9KA 3ABMH 3SJMA 1QHGA 3AL0C 2WY8Q 5J8FA 1G8XA 1S7EA 3QPSA 2XAJA 5J1UA 4UB6C 3FF5A 3ZRGA 2XF6A 2W25A 2Z1DA 2L02A 4RGXA 3RCOA 1IF1A 1ZREA 3DTEA 1TQPA 4C9YA 1LDDA 4XORA 2KRFA 3CCJI 3KPHA 4PGGA 1I27A 1Z91A 2XVCA 1K83J 1VQ5I 1G4DA 5H20A 2B63J 3TO7A 4A3IJ 2XRNA 3HOUJ 5GTHC 5KAFC 4DGWB 1PP8F 4CYDA 3QRFF 3ZQFA 1HCRA 2ZSHB 2OF7A 4X1EA 2GA1A 4NC8A 3I54A 1RZ4A 4CCOA 2LMDA 4KJZA 2QQBA 4Y33A 4C3IJ 4RM3A 3HEFA 1KYZA 1FT9A 3I64A 5IYDJ 2VKEA 2BZTA 2QSGX 5DCMB 2BVMA 2E35A 2ZJ2A 5DCFA 4J01A 2RNJA 5C3EJ 1LB2A 1B8IA 4BQAA 2K9QA 1SEUA 2PN6A 2O6GE 4LK0F 4BHPA 1YS7A 2DFFA 2M34A 3HSFA 1MMDA 1A6IA 4JP0A 4PCQA 2QA4I 2RN7A 1YX5A 1TQIA 3ZOBA 4B4CA 2ZXJA 2ZMEA 3UKGA 1NHAA 3PO3J 1ETQA 4Y3OA 2QVOA 3F21A 2CV1A 4ESBA 5BMZA 2RAEA 3GLXA 3W3CA 4CICA 3I5UA 4ESJA 4JX4A 3WTSC 5HS8A 2O3FA 3OYAA 1NH3A 1KU9A 3KP6A 4BHBA 3S16J 2MABA 2X9DA 1E2XA 4L5IA 4XLFA 4CYCB 2AO9A 5EGOB 2VPRA 3HTSB 2DA5A 5H6QA 4RGUA 3MKYB 3U1KA 3GLLA 3D5LA 1REPC 1ZG3A 2Z5UA 3EDPA 2Y31A 2RNGA 3J80K 3FBIB 4BL0B 5B1BH 1EJ9A 1UFMA 3HTUA 1JHFA 3K2AA 5CPRB 1SMYF 3K1MA 1LJ9A 3M1EA 2B7EA 2M8EA 4PJ0C 4XKWA 3MAJA 2JJ7A 2JTVA 2GM4A 5ICFA 1FMVA 1MBKA 1OR7C 1DGWY 4U0VA 1VQ9I 1YIJI 3WHBA 5E20A 2JA8J 2JVGA 4BU2A 2QENA 4U7DA 1FBSA 4B3AA 4AU7A 4XLPF 4D5FA 4BEHB 3TW7A 3H5NA 2VIXA 1Z9CA 1D8JA 4BY7J 4LG3A 4UY8I 2CRGA 3FM5A 1ZRCA 4KMFA 4AWXB 2LREA 3NWSA 3S17J 2LY1A 1ERDA 3F23A 2WWYA 3OYLA 3WG7H 1PUEE 3RYRA 4HA8A 3SZPA 2ZC2A 3BY6A 3S32A 2QM3A 1MJBA 4V19K 1F43A 2R7FA 1WZ2A 2GZWA 2EZLA 2F48A 1BI0A 3E5QA 2P7VB 3HGYA 2WV1A 2PMHA 3OYKA 3OOUA 3HOVJ 2LF7A 5K1YA 3LAPA 2ID6A 4A12A 1S7AA 1ZK8A 4M6XA 2OTJI 4GDFA 4OINF 3IH2A 5B1AH 1I6HJ 2YX4A 1LQ1A 3E6BA 3TQNA 1ONVA 1JKQC 3F0CA 4BXXJ 1SD4A 2HR3A 1W5SA 1FX7A 2ZFWA 3C18A 3IWFA 4XRSA 1T38A 1XGSA 1TZLA 1R49A 4NC6A 1P7IA 2G0EA 5DYMA 2J5OA 3CZ6A 4I76A 1W7PD 2IGNA 1RR7A 2IP2A 2JWTA 3LSGA 2IJLA 3WU1B 2O0YA 1KZHA 4B8XA 4DZPA 2IAIA 2DODA 3S2HJ 1IRXA 1K6OA 2QYOA 1T08B 1O57A 1K61A 2KJCA 4CSWA 2R0QC 2M45A 1SD6A 2Z33A 1FWZA 1K78A 3E0JB 2DFHA 2VL8A 2LNBA 1OISA 3P9CA 4F55A 1FSEA 1G3TA 1TT0A 2TDXA 4HRIA 4FX4A 2CW0F 5BPIA 2OUMA 1B1BA 2DJNA 3JRIA 3GCMA 3ZQIA 2GAUA 3DEEA 3RI4A 2V4JC 3JRAA 4E7SA 3RKXA 3CF5F 4IHXA 1I3QJ 2FEZA 1WJCA 3RTRA 1ACIA 3M8JA 2DYRH 2STTA 2KZVA 2E1MB 4BH9A 2JSCA 2NYXA 4I09A 3U9GA 2MLKA 4R1HA 3G1MA 4M74A 3HC7A 4Z2YA 3U21A 1JHHA 4QTRA 2ISYA 2BYVE 4NQWA 4MQ9F 1MMAA 2CO5A 3RKWA 3LNQA 5LHGA 1Z3XA 2AHQA 4LLGF 3T8RA 4F93B 2K7LA 2FD5A 5FLXZ 2QLZA 2WADA 5C44J 2DMNA 3BJ6A 5HOOA 1I1SA 1XD7A 4G7ZF 3G1LA 4M3EA 5E3OA 3W6KB 1UHWA 1BI2A 4IHVA 1WHUA 4B1RA 2LBFA 1EV7A 2M4GA 4WF2A 4AIKA 2JUGA 2UXNA 2WA0A 1WCMJ 4NHJA 3K4MA 1LNWA 4ZZLA 3KCCA 3DP7A 1YW7A 4IHSA 5F08A 1R36A 4QPOA 4AIHA 4L9NA 3GUDA 4B47A 4L0YB 3K1NA 1SAXA 2DW4A 1BN5A 1XG1A 1YS6A 2CH0A 2YPRA 2WV0A 2G9WA 1JKOC 4HLXA 3MMYB 1WJFA 4QWQA 4LB5A 2EA2A 3CP8A 2XASA 2FU4A 4BY1J 4FT8A 4F7ZA 4HX8A 1ZRFA 3HHGA 4PZJA 2W85A 2K9SA 2M87A 3RKQA 4NBQA 3A01A 1IXCA 2R7SA 3KYLA 5JR3A 5DD4A 4A0ZA 1RPWA 1TC3C 1RKTA 1TP4A 2F6CA 4XRFA 2EH3A 4ZZDA 4PK4A 1FTZA 1UG0A 2MA3A 3HZJA 1YHQI 1YW9A 2O7OA 3HRMA 1B72B 2QBYB 3GZ5A 2HDDA 5K5OA 2XRLA 1LPQA 1T98A 2RC4A 3SZTA 1I50J 4RAZA 3C2BA 2QKMB 3CMAI 3WTWC 2ZNZA 3CC4I 5E17F 2XB5A 3EUAA 4OWRB 1D3YA 2HQAA 2JA2A 4AD9A 5IOZA 3AG3H 1A6QA 2A6EF 4JYKA 3L00A 1GV5A 2MYSA 3OYHA 5L3FA 2YU9J 1VQ7I 1U5TA 2XB0X 4WX9A 2R7VA 4M6VA 4N4NB 1ZAOA 3OYEA 4L18B 3OMYA 2HXOA 4E70A 3J7AO 4RAFA 5DEQA 1W7PB 5HDNA 2EZHA 3C2HA 4BJTA 1MDMB 3GMEA 3CUQC 2RQQA 3K4CA 2XC7A 3GFLA 4IQ4A 1MMSA 2P6TA 1QPIA 1V5FA 2QGUA 2CQNA 2FOWA 2F5CA 3MVPA 5HLIA 2IRFG 4XLEA 4PJNA 3OYDA 2E1CA 2L3DA 2X0LA 1JTYA 2CU7A 3T8TA 3QP6A 3UR3C 1IUYA 3QYFA 4BBSJ 3B6CA 4M9XA 3R4KA 1JJ8C 1UMQA 3MZYA 4MGRA 2CYYA 5EZHA 3ZQQA 2DU9A 4GCVA 3HL2A 1GVJA 1BC8C 5F1JA 4HDUA 2DOAA 4DYCA 2AXLA 1R1VA 3HJEA 3RQ4A 3HGGA 4HNTA 1JE8A 2GXGA 2TCTA 3G73A 3N97A 5EJCA 3FXJA 1STZA 5HS7A 4BQOA 1V5EA 2VC1A 5FLXK 1X58A 1MZBA 3IAS2 3IAM2 1D5VA 5K7FA 3JCUC 1IRFA 1SFXA 3CCYA 3SZGA 1MKMA 3FXUA 4YELA 4S04A 5JLWA 2XF5A 4A93J 3W2WA 3MKWB 3C2GA 2CQQA 3K70C 1RIOH 1X4OA 1TLHB 2ADUA 1YE9A 3PNYA 2E2HJ 4XKCA 2ECCA 1XX5A 2E71A 2DFIA 2W00A 4OMYA 3CUQA 2YU3A 3MKZA 4EM2A 1S9HA 1V54H 2A05A 2NS0A 2E60A 1LKXA 1A5JA 3AAFA 2M1BA 2V79A 1VQMI 2NVUB 1H9TA 1WRJA 1ZLJA 2EZKA 5DV5A 5EEGA 1WJEA 3RJPA 3WTZA 2FF4A 1FC3A 2M4KA 1B8IB 4KA4A 3IP4B 3ZQLA 2CWEA 3AG4H 2RKHA 2WB1N 3D5RC 1X3ZB 2IPQX 4Y17A 3OIQA 5EZGA 1T33A 4A3BJ 2EV0A 1FLIA 3TO6A 2H1LA 3JRHA 4MIMA 2ZMEB 3I4PA 4IHTA 5B3SH 4LD5A 4XNFA 3O8HA 4JX5A 3HOSA 3A03A 4NDLA 2OQGA 1FIPA 1ZGWA 5JHFA 4P9FA 4ENMA 2XKOA 1Y6IA 3IWZA 1IUFA 1T8IA 3NRVA 2X6XA 3ZN0A 1QU3A 5CVVA 4XIDA 2Z16A 1GXPA 3LMMA 4HAMA 2BY0A 2LSOA 1XS9A 3FK7A 1U3EM 3VPRA 2L7KA 1IN4A 2GWRA 5CYVA 3LWFA 2JZYA 1D8KA 1P9QC 2CSOA 3HHHA 2FMLA 3HPHA 2Y69H 2NOJB 3VSLA 2NVQJ 1Z6RA 1KQ8A 4IJAA 1XDUA 2MC4A 4BXFA 5GADJ 5D5VB 4RS8A 1IN6A 1R22A 2VBZA 2MSYA 4AC0A 3IRRA 1QHHD 3A0HC 2DA4A 4A3KJ 5FB2A 3H3VK 4W97A 3ZGKA 1R00A 2R7OA 2F5EA 3BCAA 3BCBA 3M07A 3ROUA 2EZIA 2NVTJ 1T39A 3LSRA 3GEZA 5K7ZA 1MSEC 1K6YA 2XGEA 3DU5A 2D45A 2IS4A 4X0GA 1X2NA 3BG5A 3TDUC 2CQXA 4K2EA 1AKHA 1T2KA 1LVKA 3WTTC 4OU0A 2GA2A 1OCPA 4BDYA 5HDGA 2FQ4A 2CV0A 5ICCA 4HYEA 2Y0SA 4HDVA 4LLNA 3KP5A 1XMAA 1HF0A 4UXNA 3RPUA 3MZHA 3ESWB 3JRDA 1MNEA 4Y4RA 2VPLA 2DPUA 2UXXA 3K4KA 3I4MJ 3BOQA 1DU0A 3L2WA 2TRTA 3CQZJ 1P7JA 1SD5A 1W5TA 1YG2A 4P9UA 2P5LC 4XSZF 3ERMA 1U9OA 3GO5A 1XGMA 2HKOA 2XUBA 1ETXA 4HX4A 2DXIA 2I8DA 3G71I 3SFZA 2PI0A 4WK8F 5HS9A 4RA2A 2OCCH 4RGSA 2HDWA 4MFDA 3CCQI 1ETOA 2DOFA 4E7IA 1XC5A 3P9IA 3H5RA 3K4NA 1X3WB 1R23A 2MFZA 3VSKA 3GYHX 1ZKGA 5KK1A 2X1DA 1S29A 4QSHA 2LLKA 3H1CA 4F92B 1K7AA 2D1VA 4P5OA 5FKNA 2HOAA 3T5XA 3IHUA 4R8HA 5E1WA 3W6VA 1DU6A 4XMYA 1K79A 2M5WA 3OS2A 3FXLA 1S8NA 1B9NA 1SVLA 1TBXA 3FMRA 3I53A 4M9ZA 4OOIA 5J47A 3EYYA 5GAGJ 3PSFA 4N9IA 3TOBA 2FNAA 3I0TA 1Y39A 3VYUB 5DD8A 2MBFA 3TL4X 3HDDA 1DUXC 3T1BA 1RUOA 5HODA 4L9TA 2BXYA 4A69C 2V1XA 3F8NA 4I7HA 1G3SA 2VQGA 3CCRI 2CUZA 3FHNA 3FISA 3QPTA 2HVRA 3L2RA 3DBLB 3ZQHA 4ITVA 1U8BA 3ABKH 1BA5A 1FZPB 4I0AA 1LEBA 1F5TA 2W24A 3GW2A 4B3XA 1DPUA 3EUHC 3JW4A 2KIUA 3TW6A 1BI1A 2X51A 1IN7A 1O7FA 3PUBA 3M8FA 4G7HF 1FOYA 5ERIA 2KHMA 2HQ5A 4EEFG 5AIPA 2JA5J 2XGXA 2DAOA 5ILSA 5TRDA 3E5UA 3EPZA 3BR5A 3ZN1A 5J3LA 4AIJA 4A5MA 3ZQCA 3QWLA 5DUIA 3IV5A 2X1CA 1JXSA 3K69A 2QQ9A 4OIRF 4LIVA 4E7LA 2K27A 2QWWA 1KONA 3ABUA 3DKWA 3PFIA 4EV0A 4NUBA 3V7CA 1A31A 3CC2I 5IP9J 2V7FA 1ZYRF 2CQ7A 2I5UA 1UJ8A 3G4SI 4BYYA 1IV6A 1Z7LA 2ZKZA 1VQ8I 4HV5A 1KU3A 3Q5FA 1W36D 2P7CB 5HDKA 2FBHA 2MD5A 1JKRC 2VLAA 2QCOA 3P7NA 4B44A 4DOZA 1E3PA 1QO0D 3OR1C 3L2CA 1PUFA 4AUXA 2IA1A 2LC2A 3KP7A 1EH8A 3OWTA 5DS9A 3A01B 4RBOA 1KU2A 4DW6A 1FYKA 1MNMC 4Y52J 2EQRA 5B66C 2VJ5A 4DZJA 3F8FA 5E3MA 2R92J 1HW2A 3QU6A 3FMSA 2G7HA 1SFEA 1R5GA 1GDTA 3JRBA 2B0LA 3CJNA 2IT0A 2XKPA 2MG4A 2W57A 1OCZH 4IHYA 1U2WA 1YQAA 3BTIA 3R0JA 3HB9A 2PFBA 4HW0A 2Y48A 1MBJA 1BJZA 3TO9A 1SC7A 1IDYA 1W1WE 4YFNF 4YIIA 2N8GA 1T6SA 4XOPA 4KICA 3BZCA 2V9PA 4M71A 2V6EA 4YEJA 2H09A 4KITB 3KEOA 4HQMA 5H6RA 2VUMJ 1VF9A 2KP6A 2IA0A 1U5TB 1FYMA 2CQKA 2DOEA 3Q9VA 5CVUA 4OIQF 2DA6A 3HRSA 1MBHA 4IX7A 1Z05A 4C2MJ 2LY2A 2X85A 2X6YA 2KIFA 4JBAA 4DQ2A 1VI0A 5J1YA 4AM3A 1JI8A 2HFHA 3S2WA 4FCYA 4NC7A 3DTKA 1F36A 2EIKH 3KIOA 3FK6A 5E3LA 4XBFA 4EQQA 1KQ0A 3DF8A 1E3OC 1QRYA 1F4KA 3P9KA 1YOVB 2DDBA 2L5QA 1R1UA 3OSFA 2JQ7A 1UG2A 1KYWA 3HOYJ 3KFWX 2OBPA 3LL7A 4MO7A 3S1MJ 4DNCA 3SEZA 1BIBA 3LSMA 2BV6A 4KIGA 2FX0A 2WBMA 2XF7A 5GPAA 1ZELA 4E6KG 3JRCA 3OYNA 1FBUA 1W4MA 2FE3A 1NG7A 3HYIA 3RPUD 2VN2A 2VE9A 3B73A 2ELHA 4ZTJA 2HOSA 2Y9ZA 2JA7J 2RDPA 2VXDA 1U78A 3W2VA 1J5YA 3HRTA 4CH7A 4QLCU 1WJBA 2K85A 3VODA 5LEJA 2K9MA 1QBJA 4FHTA 3GTQJ 2HOEA 4UB8C 3REOA 2F4MB 4B43A 3E1SA 4XSXF 3F3XA 2EINH 4U88A 2R7TA 2E2JJ 2H6CA 1HA8A 1IG7A 2EWNA 1XCVA 3BTLA 3R0AA 2PBIA 4MTEA 5F64A 2H1KA 3BPVA 4A3JJ 4J19A 1MD0A 3RYPA 5GAHJ 5LRSA 1OR7A 1V3FA 3IH4A 2K3PA 4U0WA 1M1EB 1H0MA 3OYBA 1GT0C 1CGPA 2HU9A 5E8IA 3HOWJ 4CUGA 2JRMA 4EJTA 2YS9A 2ESNA 2FA5A 3U1DA 1BM9A 4C30A 1I3AA 1IC8A 1WJ5A 3M4OJ 5FGMA 1RR8C 4BAYA 1ZG5A 3MFKA 1W0TA 3BG6A 1LDKB 2WY7Q 2VKVA 5J6XA 3ONQA 1AA7A 2O03A 1QVUA 3DPTA 3ECHA 3NARA 4A3LJ 3WU2C 1FIAA 3ZMZA 1HSJA 1X3UA 2ZNYA 3DCFA 4CCNA 4RB1A 3GTOJ 1QZZA 2DJIA 4ZYEA 3KZZA 4YIFA 3HKZA 1WGXA 2PMZA 1HXDA 3F6VA 5DTDA 3J81Z 1Y1WJ 1FOXA 4CHUA 2Q1ZB 3BZKA 1XGOA 1N75A 2A61A 4HG2A 3LA7A 1ZN2A 4N9HA 1FOKA 4AIDA 1UHSA 1Y0UA 2OAZA 1D1AA 1MGTA 4G9YA 3HIFA 3W2AA 1VQKI 1JTXA 2V1NA 2V9VA 5C4JJ 2LDUA 4GO1A 2VJIA 3H3UA 2DQRA 4EM0B 2DT7B 2BY1A 1OPCA 1HW5A 4IHWA 1ETKA 4XICA 3IL2A 3DEWA 3BTCA 3I55I 4UUVA 4LLLA 3Q9SA 5IT3A 4HF1A 3GTLJ 2DK5A 2CFOA 2JMWA 1V4RA 5CKTA 1Q1HA 3HM5A 3GTKJ 4HBLA 1JUPA 1YW8A 2W1OA 1CF7A 3B6AA 4HPQA 5KHDA 4WXCA 5FRMA 3PO2J 2K5CA 2HYGD 2FXAA 1ZRDA 1RI7A 2W82A 4EVIA 5CLSA 4ON0A 3S1RJ 2AS5F 2R7UA 1IN8A 1BC7C 2Z9OA 3KP4A 3GTPJ 3OYIA 4BNCA 3QPHA 5DUKA 4E7HA 5F0CA 2Z3YA 2OZUA 2QF7A 5FROA 2ZB9A 3V7RA 3G6EI 1EH6A 1OCCH 3G2BA 3I58A 2BHZA 5FKKA 2L9VA 2K86A 4BQNA 2COBA 1IXSB 3LSJA 2EJRA 1IGNA 2EB7A 1BR4A 3D5SC 4XRSG 2EFPA 1IW7F 2W7NA 1AWCA 6PAXA 3H9QA 4LOCA 4V2FA 4FE4A 1EA3A 1R6RA 3OSGA 3JRGA 2V1DA 2DQLA 1YIOA 3NWTA 2KJBA 2BW3A 3NAUA 5J1RA 2EV5A 1AKHB 1G2HA 1RETA 1N77A 4ZDOA 2Y9YA 4EJOA 4IVNA 2E1NA 4RAGA 1BBYA 4LFUA 1OYYA 1YLFA 1VQPI 3SDGA 1TTYA 3WGHA 5LBQA 1ITYA 2VXZA 1FMWA 1WKMA 1QZYA 2HPMA 2NNNA 4LGWA 4ZC3A 2HI3A 3Q3SA 4XKVA 3E3VA 5F0HA 3WU0A 1EF4A 4PJMA 2ETHA 4EATA 1SANA 2DPDA 4P1WA 1IO2A 4RGRA 5JFRA 4GRIA 5L3DA 1FP1D 1SFOJ 3IRQA 4WXHA 5LHHA 4BGDA 4M3FA 2M0MA 2L54A 2UZKA 3LSTA 5ILVA 2IGMA 3PL8A 2O61A 3E6CC 1I39A 1T0FC 4FISA 1R58A 4XLCA 4A6EA 3HUGB 1HSTA 3K4BA 1MBEA 2E1OA 5FD5A 5EDNA 4M9SA 2H94A 4HOBA 3MN2A 1BW6A 4GYIA 2DK8A 1SMTA 1JKPC 2WAFA 2OPTA 2IS2A 1O3QA 1LFPA 2HPIA 2KFDA 3V8KA 2QUFA 1S3JA 2WC2A 4ZDPA 1LFUP 4MNUA 1UAAA 4C2UA 5KVRA 3SDBA 3JTGA 3K6GA 5EF6A 1HKTA 4BDZA 2M9HA 4HZFA 1ZR4A 5C4XJ 1FSHA 5AIQA 2KKOA 1OMIA 1UELB 2CGPA 3HPGA 4BEHA 2M0CA 3GFMA 4MQVA 1H9GA 3OR2C 1GUUA 1J75A 3SXYA 2FQ3A 5TGTA 4QIWN 2RGVA 3DEUA 3J81K 3ZCOA 2COMA 2F5VA 3GFJA 3HSRA 4H4KC 1FNNA 3PJRA 1AU7A 4I99C 4CGZA 2K02A 1SAUA 2ZFUA 3L9FA 4FTHA 3CESA 4L9VA 2CUFA 3HBLA 3RDIA 3S2DJ 4MHGA 1P92A 3ISPA 5FFZA 3M8EA 4ENNA 3CUOA 1SVMA 3KP3A 3H0DA 2NXNB 1S7OA 2IXSA 4WXDA 2IS1A 2E1MC 3BQZA 2DYSH 2HYJA 4LMYA 2BE5F 4AYBA 5D4SA 5FD6A 3S93A 1PYVA 4KMUX 4I2OA 2LKSA 2VKDA 2R5YA 4HSRA 5J8CA 1F9NA 4IKFA 3I71A 4HNVA 2IW5A 1VTNC 5HNFA 2HQNA 3CJQB 1R1TA 3EQLF 3ZMTA 1ETVA 1UHMA 5K5RA 2L7FP 1X19A 1YI2I 2M7AA 1IRGA 1JUSA 3CO6C 3ASNH 4PGHA 1XB4A 2YSRA 5JLXA 3D0SA 3ZMDA 4BS9A 1FJLA 2H27A 1J09A 3CJTB 3R60A 2GLOA 1QPMA 3BROA 2STWA 4UNOA 2R7RA 4G6QA 1XPXA 1TT5B 2IA2A 2DTRA 4BXUA 1T56A 1QA6A 2QSHX 4XOTA 5KAIC 1E3HA 4D5CA 3TBIA 3IKVA 2VQCA 2D5VA 3S1NJ 1YTYA 3VYTB 4XLNF 3IC7A 2MC3A 3G3ZA 1OYWA 2HOTA 4A3GJ 5J4YA 2XDVA 5F04A 3MKLA 1K4SA 2HEOA 5CVRA 2PG4A 2GXAA 2R4GA 2HGCA 1PUFB 2JA6J 2HQRA 3T0YA 2OCEA 3F8MA 3OYJA 4CCKA 4CCJA 3CCVI 2C6YA 1R9TJ 5LLQA 3R6SA 4EJUA 2DCEA 2VKHA 3S8PA 3ZMVA 3DBRB 4AVZA 1ZTRA 2DA1A 3JAMZ 2EK5A 3H3ZA 1L0OC 3KYCB 3LFUA 2ZO4A 3K2ZA 2VODA 3I4NJ 1HQCA 3AL0B 3PQJA 4FQGA 3QOEA 2A68F 2R5ZA 4KISA 2WB1A 4KN7X 2ELKA 1XGNA 1TNTA 1BJAA 5FLMJ 3RZOJ 3X2QH 4RLFA 2EIMH 1ZGJA 2X6WA 3K9TA 2OD5A 4GFBA 3BTJA 3CTAA 1TWHJ 2HNHA 3KZIC 3DKXA 1X1AA 4Q47A 3JTHA 3ZXSA 1K4TA 4HQEA 1ORKA 2ME6A 1X1CA 1VQNI 2V9KA 1P6RA 2UV1A 1R71A 1P4WA 4RDUA 2H6BA 1J2XA 1SFUA 4UVBA 4LG0A 3WE3A 2R93J 4IRGA 5TJJA 3F8BA 2BVLA 3ML6A 3A0BC 3AG1H 5LD2C 4MLOA 1B59A 3PFYA 3BR2A 4JK1X 4S05A 4GGGA 2KRHA 5D4RA 3ZMSA 3BDDA 1XSDA 3K4LA 2PJRA 1HBXG 1D1BA 2DN0A 3DLAA 1NK3P 2K40A 2FBKA 1MMGA 1WWXA 2IVMA 2YR2A 1SD7A 1FOWA 2Y0MA 4P55A 4JX6A 2P5VA 2EFQA 1J59A 4MEYF 1Z77A 3AKZA 1LE8A 3AFHA 2CW7A 2P0WA 4M3GA 3KZYA 5ILUA 3WTXC 2R7WA 1ZARA 1HW1A 4ENKA 4F52A 2KL4A 1POGA 2JSPA 2E2IJ 2Q0OA 1Z6TA 1XCBA 3E97A 3CO7C 2WAQA 3LSKA 4PFOA 3G1OA 4DIQA 4BE0A 4ASNA 1R7JA 2VONA 1WJAA 1X1BA 5K7HA 5D8LB 5M3MJ 3EYIA 5LEKA 4KFCA 3KETA 1HDDC 2NS7A 3VYSB 1NTCA 5F1RA 3TDZC 3SQNA 4ZJZA 2LKPA 1OJLA 1E0EA 1QZEA 3BT9A 1OQYA 4Q48A 3MD2A 3GX4X 3EUKL 1VNDA 4HX7A 3OL4A 4PSXA 2L4MA 4C3JJ 4V2GA 3M7GA 3K7AJ 2ZCWA 4CCLA 1ODDA 3CCSI 1GVDA 3H9GA 2LF8A 1K78B 2X4HA 3I56I 1TQMA 4XRMA 1W7PA 1FTTA 2XSJC 1HKQA 3LOCA 3Q0VA 4DYQA 3V42A 2BEOA 1DQUA 2ZXHA 3ABLH 4O3MA 3E6MA 4Y7NJ 5BOXA 1H88C 1GV2A 5DM7F 2NAZA 2Y30A 2LH9A 1X1PA 3C3WA 4A6DA 2OC6A 5TISC 2QQ8A 3K10A 3K1PA 1LEAA 2PQ8A 4I01A 2ZXWH 4O6JA 1WI9A 4LJZF 1Y56A 5CQGA 2ZJPF 3OIOA 2LTPA 4KT5C 1WVRA 2BGCA 3P5JA 2VT2A 3CCLI 1Y8QB 5IYBJ 3JAMK 4C2TA 2F2EA 1OCRH 1I5ZA 4HV6A 3JRFA 4J00A 2ZMEC 3L09A 4NQWB 2CUJA 2F4IA 1TWAJ 4XL9A 4XKBA 2JUCA 3LSPA 3GZ6A 1YRNA 4UVCA 4OMZA 3OS0A 3S15J 1O3TA 1BL0A 5K5QA 2A6TA 2UWMA 4HF2A 3DPUA 5D5XB 2KMUA 2VBWA 3CCMI 1DPRA 4IPAA 4PDKA 2CV2A 5E3NA 4BJ5C 1ETWA 2L4AA 2D2WA 1X2MA 4G6DA 5F0FA 1CF7B 4Q4ZF 1QGPA 3L1PA 9ANTA 2L0KA 1S6LA 2LBFB 3VB2A 3J7ZI 1WQ2A 3DKYA 2LP0A 4DBQA 1A04A 1RESA 1F1ZA 2XROA 2A69F 4L5JA 2O5RA 5GP9A 2QQAA 2XAUA 4GXOA 2ZJRF 2DLLA 2GOMA 1U0JA 1OFCX 2Z99A 1Z1DA 3BR0A 5D5WB 2RVCA 4L9JA 3DBHB 3DXJF 2FOKA 2JN6A 4E7ZA 3BP8A 5LGTA 4L0ZB 4I98B 2V26A 3S14J 2L7ZA 2FRHA 4D9JA 2VASA 2A3SA 5DDGA 4KUMA 1PVEA 5BS6A 1FBQA 2RREA 3CCUI 2ISZA 2UUZA 3DFGA 4D7MA 2F4OB 2DMTA 4KDPA 4BUPA 5L3EA 4GYGA 3O2PE 1Z7UA 3HRUA 4BKXA 4ANJA 4IQJA 3CDHA 2BW3B 5M5YJ 4G6TB 4UUSA 3GZNB 4OAZA 2BY3A 5BPDA 3CD6I 4D0PA 4BE1A 4S0HB 1YJWI 3CDIA 2XV4S 1XMKA 3EUHA 2QSFX 1IAWA 3FXMA 1U8RA 2R7XA 4M3BA 4KN4X 4WWCA 1BOBA 3O3KA 1WJDA 4Y15A 1O3SA 1FPQA 5CJ9A 1S5LC 4PUSA 2QEXI 3ZQGA 2IEKA 3GF2A 3WE2A 2J5PA 2LD5A 3MZ8A 3DQVC 4ZDLA 5FJ8J 1BIAA 3RSNA 3H36A 3WODF 3K70D 3BJAA 1WPKA 1EKEA 4CCMA 1AHDP 2HYFA 2I10A 4CXFA 2E7WA 4ZYDA 1G3WA 4FASD 4M3DA 3CJRB 4YG2F 2XAFA 1QNTA 2H8RA 2K4BA 3BQYA 5FO5A 4B48A 3PUFA 1Z21A 2VQHA 1IV8A 4RB3C 4BACA 4HSTA 2JT1A 1BW5A 3SFIA 3M3YJ 2L9RA 1B4AA 1MJ9A 2XSDC 1DGRM 2DMPA 2ESHA 3IKTA 3VDXA 3E6DA 2DI3A 4AVPA 3QP5A 5A2QK 1YO5C 2JPCA 2LY9A 3OY9A 4WCGA 1WSUA 4FE7A 3TMOA 4D7NA 3JSOA 3RQIA 2VOOA 1O7LA 1MH4A 3RIRA 1MH3A 3FKIJ 3TP3A 3I59A 3UNGC 2M2EA 2NRAC 1G3YA 3H35A 3RPQA 3EETA 3DU6A 3H5AA 3PSIA 4XONA 1X1DA 1DP3A 4M72A 4XR6A 2IGOA 2LOOA 2LK2A 4F91B 1J0RA 3TEDA 3IH3A 3FHZA 2BOLA 1D1CA 2XAGA 2Q2EA 4CZCA 3QODA 1IXRC
chains in the Genus database with same CATH topology
2EFNA 4BHCA 1L3LA 2ACJA 2JPBA 5JVTA 4A5NA 1UB9A 4ETSA 1TNSA 2GQQA 2F5DA 1PDNC 1B9MA 1YYVA 1QQIA 3FXRA 1GHCA 1USSA 1YFHA 1ULYA 5AONA 4IF4A 5L3BA 2EFWA 3MWMA 3CUQB 5ED4A 2E7XA 2VC0A 2MH9A 5E8GA 1EH7A 1FYLA 3BJOA 4ZYGA 2XHKA 2R7DA 1FY7A 2A07F 5BQTA 2OZ6A 3SHFA 5LGUA 5CVIA 3TOAA 2HDCA 3MEXA 3ERED 1ZGAA 5E1ZB 3WTVC 5IT9Z 2Q8KA 4RB0A 3GVAA 2OU2A 1P4XA 5LRRA 4EM1A 4U7BA 4Y13A 1RNLA 4G7OF 3LA3A 2VBYA 1BI3A 3KLOA 2OQRA 2CG4A 2PEXA 5LHIA 2FNPA 1ZHFA 3ULQB 4N0BA 4A0XA 2QZ8A 5D6FA 4UHTA 1MJAA 4ZYHA 1FP2A 3TKYA 1U5TC 3CLOA 1C0WA 4LG0B 5L3CA 1O3RA 2MH2A 1DP7P 1TW3A 1E17A 3WTUC 5DCMA 3WGGA 4LB6B 4ESFA 4UV9A 2EV6A 3ELKA 4HLYA 4UVAA 3WGIA 3DPLC 2DT5A 3TGNA 4IXAA 4CDGA 1PP7U 3DV8A 3GXOA 2VT3A 3BPXA 2R3SA 2NNYA 3FXQA 3BWGA 4H0EA 1JGSA 1U6GA 2PLYA 2W84A 2K4JA 5JHUA 1I6XA 1ON2A 5D6EA 3WTYC 4OIPF 5HLHA 3GFIA 1XSVA 2XAQA 1RUNA 1GXQA 3M9AA 2OA4A 3U2RA 3KEQA 1XN7A 2VBXA 3QU3A 2G7UA 3FM3A 4I0BA 1I1GA 3VFZA 2WTEA 4A0YA 2P5KA 4EGYA 5L3GA 4LK1F 1UCRA 5IT9K 2P8TA 4CZZA 3FZVA 3ZPLA 4IRHA 1AOYA 2PJPA 1KU7A 4EGZA 4G94A 3FMQA 3VEPA 2FMYA 3OV8A 4RAYA 3NQOA 5E18F 3HSEA 3F8CA 1P4AA 1T0FA 4P96A 1J9IA 1KGSA 1R5HA 2DO7A 5JI6A 3LA2A 5EEHA 1BOAA 5D8KB 2EA4A 3C7JA 3QOPA 4HF0A 2YX7A 2A5YB 4Q5SF 1XDSA 4KIBA 4KNYA 1DDNA 2MLGA 4KIFA 1ZG1A 2M30A 4M73A 3FX3A 2RQPA 5FFXA 2CFXA 3KP2A 1ZH5A 4OIOF 3B02A 5CVJA 3BZ6A 4O5VA 2HKXA 3ABTA 2F5FA 5F6FA 1B6AA 3FWEA 2XAHA 3LQRA 3KLNA 4ZH4F 4B09A 2P4WA 4I02A 1HKSA 2VOPA 1XSXA 4CO8A 1USTA 3NEUA 2FBIA 2EFOA 2BBYA 2D1HA 2KIMA 3E5XA 2FSWA 4EMSA 3ZQ7A 4G8XA 1TW2A 3GWZA 5D5UB 1G6NA 2PMUA 3F72A 1LDJA 5ICEA 4JQFA 2GIVA 4MTDA 3F22A 3V8LA 2A6HF 2P6SA 4EJWA 3N4MA 3KE2A 2VE8A 4U0YA 1ZLKA 5E1XA 4M6YA 5HVQC 4TV7A 3I59B 3O6BB 1ON1A 3L7WA 4UV8A 2V1UA 2GXBA 1P2FA 2V6CA 3RKYA 4RB2C 3V7SA 2QBYA 3PQKA 2XIGA 3H92A 3MCZA 1IN5A 3C1DA 3LFKA 2HTSA 4ENJA 5HLGA 3OOPA 2L01A 3V8JA 2O8XA 4FX0A 4NB5A 2HS5A 4R79A 3J80Z 3MQ0A 1LVAA 3VOEA 3HUGA 3LQQA 3V4GA 3ECOA 1OYIA 3COAC 2Y75A 5ICGA 1MDMA 1KQ9A 1J7KA 1KA8A 5A2QZ 3JSPA 2HZTA 1OKRA 4EJVA 2RV8A 3F6OA 4IRIA 3WG9A 3K0LA 3LAJA 2HWVA 2DBBA 3HOTA 3QAHA 2ZBKA 4MEXF 4KYWA 5LGNA 4YFXF 1IZ1A 3W6JB 4YFKF 3ZMUA 3ZP5A 3R61A 4A2UA 2HTJA 2JRTA 5J8FA 2XAJA 3FF5A 2W25A 2L02A 4RGXA 1IF1A 1ZREA 1TQPA 1LDDA 2KRFA 4PGGA 1I27A 1Z91A 2XVCA 1G4DA 5H20A 3TO7A 2XRNA 1PP8F 4CYDA 3QRFF 2GA1A 3I54A 1RZ4A 2QQBA 1KYZA 1FT9A 3I64A 5DCMB 2ZJ2A 1LB2A 5DCFA 2RNJA 4BQAA 2PN6A 2O6GE 4LK0F 4BHPA 1YS7A 3HSFA 4PCQA 2RN7A 1TQIA 2ZXJA 2ZMEA 1NHAA 2QVOA 3F21A 4ESBA 5BMZA 3GLXA 4CICA 3I5UA 4ESJA 3WTSC 5HS8A 2O3FA 1KU9A 3KP6A 4BHBA 1E2XA 4L5IA 3HTSB 5H6QA 4RGUA 3D5LA 1REPC 1ZG3A 2Z5UA 3EDPA 3J80K 1UFMA 3HTUA 1JHFA 1SMYF 3K1MA 1LJ9A 3M1EA 2M8EA 3MAJA 2JTVA 5ICFA 4U0VA 5E20A 2QENA 4U7DA 1FBSA 4XLPF 1Z9CA 1D8JA 3FM5A 1ZRCA 4KMFA 4AWXB 3F23A 2WWYA 1PUEE 3RYRA 4HA8A 3SZPA 3BY6A 2QM3A 1MJBA 2R7FA 2GZWA 1BI0A 3E5QA 2P7VB 2PMHA 2LF7A 5K1YA 3LAPA 4A12A 1S7AA 4M6XA 4OINF 2YX4A 1LQ1A 3E6BA 3TQNA 1ONVA 1SD4A 2HR3A 1W5SA 1FX7A 2ZFWA 3C18A 3IWFA 1T38A 1XGSA 5DYMA 2J5OA 1W7PD 2IP2A 2IJLA 3WU1B 2O0YA 4B8XA 1K6OA 2QYOA 1O57A 2KJCA 2M45A 1SD6A 2Z33A 1FWZA 1K78A 3P9CA 2LNBA 1FSEA 1G3TA 2TDXA 4FX4A 2CW0F 5BPIA 1B1BA 2GAUA 3RI4A 3RKXA 2FEZA 3RTRA 2STTA 4BH9A 2JSCA 2NYXA 4I09A 3U9GA 2MLKA 4R1HA 4M74A 4Z2YA 1JHHA 2ISYA 2BYVE 4NQWA 4MQ9F 2CO5A 3RKWA 5LHGA 4LLGF 3T8RA 2K7LA 5FLXZ 2QLZA 3BJ6A 5HOOA 1I1SA 1XD7A 4G7ZF 3W6KB 1UHWA 1BI2A 1EV7A 4WF2A 4AIKA 2UXNA 4NHJA 1LNWA 4ZZLA 3KCCA 3DP7A 1YW7A 4IHSA 1R36A 4AIHA 4L9NA 3GUDA 4L0YB 3K1NA 1SAXA 2DW4A 1BN5A 1YS6A 2YPRA 2WV0A 2G9WA 4HLXA 4QWQA 4LB5A 2EA2A 2XASA 2FU4A 4FT8A 4F7ZA 4HX8A 1ZRFA 3HHGA 4PZJA 2W85A 2M87A 1IXCA 5JR3A 5DD4A 4A0ZA 4XRFA 4ZZDA 2MA3A 1YW9A 3HRMA 2QBYB 3GZ5A 5K5OA 1T98A 2RC4A 3SZTA 4RAZA 3WTWC 2ZNZA 5E17F 1D3YA 4AD9A 2A6EF 3L00A 5L3FA 1U5TA 4WX9A 1ZAOA 4L18B 4E70A 3J7AO 5DEQA 1W7PB 5HDNA 1MDMB 3CUQC 3GFLA 2P6TA 2F5CA 5HLIA 2IRFG 2E1CA 2L3DA 2X0LA 3T8TA 3QP6A 1IUYA 4M9XA 3R4KA 3MZYA 4MGRA 2CYYA 2DU9A 4GCVA 1GVJA 1BC8C 4HDUA 2AXLA 1R1VA 1JE8A 2GXGA 3G73A 3N97A 1STZA 5HS7A 2VC1A 5FLXK 1MZBA 1D5VA 1IRFA 1SFXA 1MKMA 3FXUA 4S04A 1RIOH 1TLHB 2ADUA 2DFIA 4OMYA 3CUQA 2YU3A 4EM2A 2NS0A 3AAFA 2M1BA 2V79A 1H9TA 1WRJA 1ZLJA 5DV5A 5EEGA 3RJPA 3WTZA 2FF4A 1FC3A 4KA4A 2CWEA 2RKHA 2IPQX 4Y17A 1FLIA 2EV0A 3TO6A 2ZMEB 3I4PA 4IHTA 4LD5A 3HOSA 2OQGA 4P9FA 4ENMA 2XKOA 3IWZA 3NRVA 3ZN0A 5CVVA 1GXPA 4HAMA 2LSOA 1U3EM 1IN4A 2GWRA 5CYVA 3LWFA 2JZYA 1D8KA 2CSOA 3HHHA 2FMLA 1Z6RA 1KQ8A 4IJAA 1XDUA 5D5VB 4RS8A 1IN6A 1R22A 2VBZA 3IRRA 5FB2A 1R00A 2F5EA 3ROUA 1T39A 3GEZA 2D45A 3TDUC 4K2EA 1T2KA 3WTTC 4OU0A 2GA2A 5HDGA 5ICCA 4HYEA 4HDVA 4LLNA 3KP5A 1XMAA 4UXNA 3RPUA 3MZHA 2DPUA 2UXXA 3BOQA 1SD5A 1W5TA 1YG2A 4P9UA 2P5LC 4XSZF 3GO5A 1XGMA 2HKOA 2XUBA 4HX4A 3SFZA 2PI0A 4WK8F 5HS9A 4RGSA 3P9IA 1R23A 3GYHX 5KK1A 1S29A 1K7AA 2D1VA 4P5OA 3T5XA 3IHUA 4R8HA 5E1WA 1K79A 2M5WA 1S8NA 1B9NA 1TBXA 4M9ZA 3FMRA 3I53A 4OOIA 3EYYA 4N9IA 3TOBA 2FNAA 3I0TA 5DD8A 2MBFA 1DUXC 3T1BA 1RUOA 4L9TA 2V1XA 3F8NA 4I7HA 1G3SA 3QPTA 1FZPB 4I0AA 1LEBA 1F5TA 2W24A 3GW2A 1DPUA 3JW4A 2KIUA 1BI1A 4G7HF 1IN7A 1O7FA 3M8FA 5ERIA 5AIPA 2XGXA 5TRDA 2DAOA 5ILSA 3E5UA 3ZN1A 4AIJA 4A5MA 5DUIA 1JXSA 3K69A 2QQ9A 4OIRF 2K27A 2QWWA 3ABUA 3DKWA 3PFIA 4EV0A 3V7CA 1ZYRF 4BYYA 2ZKZA 4HV5A 1KU3A 3Q5FA 2P7CB 5HDKA 2FBHA 2MD5A 3P7NA 1QO0D 3L2CA 2IA1A 3KP7A 1EH8A 1KU2A 1FYKA 3F8FA 1HW2A 3QU6A 3FMSA 2G7HA 1SFEA 1R5GA 2B0LA 3CJNA 2IT0A 2XKPA 2W57A 1U2WA 1YQAA 3R0JA 2PFBA 4HW0A 2Y48A 3TO9A 4YFNF 4YIIA 1T6SA 4KICA 4M71A 2H09A 3KEOA 4HQMA 5H6RA 2IA0A 1U5TB 1FYMA 2CQKA 3Q9VA 5CVUA 4OIQF 3HRSA 1Z05A 2KIFA 4JBAA 4DQ2A 2HFHA 3S2WA 4XBFA 4EQQA 1KQ0A 3DF8A 1F4KA 3P9KA 1R1UA 1KYWA 3KFWX 2OBPA 4DNCA 1BIBA 4KIGA 2BV6A 3FHZA 1FBUA 1W4MA 2FE3A 3HYIA 2VN2A 2VE9A 3B73A 2ELHA 2RDPA 1U78A 1J5YA 3HRTA 4QLCU 3VODA 5LEJA 1QBJA 4FHTA 2HOEA 3REOA 4XSXF 3F3XA 4U88A 2H6CA 2EWNA 1XCVA 3R0AA 2PBIA 4MTEA 5F64A 3BPVA 1MD0A 3RYPA 5LRSA 1OR7A 1V3FA 4U0WA 1H0MA 1CGPA 5E8IA 4EJTA 2ESNA 2FA5A 3U1DA 1BM9A 5FGMA 4BAYA 1ZG5A 3MFKA 1LDKB 5J6XA 2O03A 3DPTA 3ECHA 3ZMZA 1HSJA 1X3UA 2ZNYA 4RB1A 1QZZA 4ZYEA 3KZZA 4YIFA 1HXDA 3F6VA 3J81Z 4CHUA 1XGOA 2A61A 3LA7A 1ZN2A 4N9HA 1FOKA 1Y0UA 2OAZA 1MGTA 4G9YA 3HIFA 2V9VA 2LDUA 4GO1A 3H3UA 2DQRA 4EM0B 1OPCA 1HW5A 3IL2A 4UUVA 4LLLA 3Q9SA 5IT3A 4HF1A 2DK5A 1V4RA 1Q1HA 4HBLA 1YW8A 1CF7A 4WXCA 2HYGD 2FXAA 1ZRDA 1RI7A 4EVIA 5CLSA 4ON0A 2AS5F 1IN8A 1BC7C 2Z9OA 3KP4A 4BNCA 3QPHA 5DUKA 2Z3YA 2OZUA 3V7RA 1EH6A 3I58A 2K86A 1IXSB 2EJRA 2EB7A 2EFPA 1IW7F 1AWCA 6PAXA 2V1DA 2DQLA 1YIOA 2KJBA 2EV5A 4EJOA 4IVNA 2E1NA 1BBYA 4LFUA 1OYYA 1YLFA 1TTYA 3WGHA 5LBQA 2VXZA 1QZYA 1WKMA 2NNNA 4LGWA 3E3VA 3WU0A 2ETHA 2DPDA 5JFRA 4RGRA 5L3DA 1FP1D 3IRQA 4WXHA 5LHHA 2L54A 2UZKA 3LSTA 5ILVA 2O61A 3E6CC 1R58A 4A6EA 1HSTA 5FD5A 4M9SA 2H94A 4HOBA 4GYIA 2DK8A 1SMTA 1O3QA 3V8KA 2QUFA 1S3JA 2WC2A 4MNUA 5KVRA 3JTGA 1HKTA 4HZFA 1FSHA 5AIQA 2KKOA 1OMIA 2CGPA 4MQVA 3GFMA 1H9GA 1J75A 3SXYA 2FQ3A 2RGVA 3DEUA 3J81K 2COMA 3GFJA 3HSRA 1FNNA 4CGZA 2K02A 3L9FA 4L9VA 3RDIA 4MHGA 1P92A 3ISPA 5FFZA 3M8EA 4ENNA 3CUOA 3KP3A 1S7OA 4WXDA 4LMYA 2BE5F 5D4SA 5FD6A 4KMUX 4I2OA 5J8CA 1F9NA 3I71A 1VTNC 2IW5A 2HQNA 1R1TA 3EQLF 3ZMTA 1UHMA 5K5RA 1IRGA 3CO6C 4PGHA 1XB4A 2YSRA 3ZMDA 3D0SA 2H27A 3R60A 1QPMA 3BROA 2STWA 4UNOA 4G6QA 2IA2A 2DTRA 4BXUA 3IKVA 1YTYA 4XLNF 3IC7A 2MC3A 3G3ZA 1OYWA 2HEOA 5CVRA 2PG4A 2HGCA 2HQRA 3T0YA 3F8MA 2C6YA 5LLQA 3R6SA 4EJUA 3ZMVA 3JAMZ 2EK5A 3H3ZA 1L0OC 2ZO4A 3K2ZA 2VODA 1HQCA 3PQJA 2A68F 4KN7X 1XGNA 1TNTA 1BJAA 1ZGJA 3K9TA 2OD5A 3CTAA 4Q47A 3JTHA 4HQEA 1P6RA 1P4WA 2H6BA 1J2XA 1SFUA 4UVBA 4LG0A 3WE3A 4IRGA 5TJJA 3F8BA 3ML6A 1B59A 4JK1X 4S05A 4GGGA 5D4RA 3ZMSA 3BDDA 1XSDA 1HBXG 2FBKA 1WWXA 2IVMA 2YR2A 1SD7A 2Y0MA 4P55A 2P5VA 2EFQA 1J59A 4MEYF 3KZYA 5ILUA 3WTXC 1ZARA 1HW1A 4ENKA 2Q0OA 1Z6TA 1XCBA 3E97A 3CO7C 4ASNA 1R7JA 2VONA 5D8LB 3EYIA 5LEKA 4KFCA 3KETA 5F1RA 3TDZC 3SQNA 2LKPA 4Q48A 3GX4X 4HX7A 2L4MA 3M7GA 2ZCWA 1ODDA 2LF8A 1K78B 2X4HA 1TQMA 1W7PA 1HKQA 2BEOA 4O3MA 3E6MA 5BOXA 2NAZA 3C3WA 4A6DA 3K1PA 1LEAA 2PQ8A 4I01A 4O6JA 1WI9A 4LJZF 4KT5C 2BGCA 2VT2A 3JAMK 2F2EA 1I5ZA 4HV6A 3L09A 3GZ6A 4UVCA 4OMZA 1O3TA 5K5QA 2UWMA 4HF2A 5D5XB 2VBWA 1DPRA 4IPAA 4PDKA 2L4AA 2D2WA 4G6DA 1CF7B 4Q4ZF 1QGPA 1S6LA 3VB2A 1WQ2A 1A04A 1F1ZA 2XROA 2A69F 4L5JA 2QQAA 4GXOA 2DLLA 2Z99A 1Z1DA 5D5WB 2RVCA 4L9JA 3DXJF 2FOKA 3BP8A 5LGTA 4L0ZB 4I98B 2FRHA 2A3SA 5DDGA 4KUMA 5BS6A 1FBQA 2ISZA 3DFGA 4KDPA 5L3EA 4GYGA 3O2PE 1Z7UA 3HRUA 3CDHA 5BPDA 4D0PA 2XV4S 1XMKA 3EUHA 1IAWA 1U8RA 4KN4X 4WWCA 3O3KA 4Y15A 1O3SA 1FPQA 5CJ9A 3GF2A 3WE2A 2J5PA 3DQVC 1BIAA 3WODF 3BJAA 2HYFA 4CXFA 2E7WA 4ZYDA 1G3WA 4YG2F 2XAFA 1QNTA 2K4BA 5FO5A 4RB3C 2JT1A 1B4AA 1MJ9A 2ESHA 3IKTA 3E6DA 2DI3A 4AVPA 3QP5A 5A2QK 1YO5C 2JPCA 4WCGA 1WSUA 3JSOA 2VOOA 1O7LA 3RIRA 3I59A 2NRAC 1G3YA 3RPQA 3EETA 4M72A 1J0RA 2XAGA 2Q2EA 1IXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFN A;  4BHC A;  1L3L A;  2ACJ A;  2JPB A;  5JVT A;  4A5N A;  1UB9 A;  4ETS A;  1TNS A;  2GQQ A;  2F5D A;  1PDN C;  1B9M A;  1YYV A;  1QQI A;  3FXR A;  1GHC A;  1USS A;  1YFH A;  1ULY A;  5AON A;  4IF4 A;  5L3B A;  2EFW A;  3MWM A;  3CUQ B;  5ED4 A;  2E7X A;  2VC0 A;  2MH9 A;  5E8G A;  1EH7 A;  1FYL A;  3BJO A;  4ZYG A;  2XHK A;  2R7D A;  1FY7 A;  2A07 F;  5BQT A;  2OZ6 A;  3SHF A;  5LGU A;  5CVI A;  3TOA A;  2HDC A;  3MEX A;  3ERE D;  1ZGA A;  5E1Z B;  3WTV C;  5IT9 Z;  2Q8K A;  4RB0 A;  3GVA A;  2OU2 A;  1P4X A;  5LRR A;  4EM1 A;  4U7B A;  4Y13 A;  1RNL A;  4G7O F;  3LA3 A;  2VBY A;  1BI3 A;  3KLO A;  2OQR A;  2CG4 A;  2PEX A;  5LHI A;  2FNP A;  1ZHF A;  3ULQ B;  4N0B A;  4A0X A;  2QZ8 A;  5D6F A;  4UHT A;  1MJA A;  4ZYH A;  1FP2 A;  3TKY A;  1U5T C;  3CLO A;  1C0W A;  4LG0 B;  5L3C A;  1O3R A;  2MH2 A;  1DP7 P;  1TW3 A;  1E17 A;  3WTU C;  5DCM A;  3WGG A;  4LB6 B;  4ESF A;  4UV9 A;  2EV6 A;  3ELK A;  4HLY A;  4UVA A;  3WGI A;  3DPL C;  2DT5 A;  3TGN A;  4IXA A;  4CDG A;  1PP7 U;  3DV8 A;  3GXO A;  2VT3 A;  3BPX A;  2R3S A;  2NNY A;  3FXQ A;  3BWG A;  4H0E A;  1JGS A;  1U6G A;  2PLY A;  2W84 A;  2K4J A;  5JHU A;  1I6X A;  1ON2 A;  5D6E A;  3WTY C;  4OIP F;  5HLH A;  3GFI A;  1XSV A;  2XAQ A;  1RUN A;  1GXQ A;  3M9A A;  2OA4 A;  3U2R A;  3KEQ A;  1XN7 A;  2VBX A;  3QU3 A;  2G7U A;  3FM3 A;  4I0B A;  1I1G A;  3VFZ A;  2WTE A;  4A0Y A;  2P5K A;  4EGY A;  5L3G A;  4LK1 F;  1UCR A;  5IT9 K;  2P8T A;  4CZZ A;  3FZV A;  3ZPL A;  4IRH A;  1AOY A;  2PJP A;  1KU7 A;  4EGZ A;  4G94 A;  3FMQ A;  3VEP A;  2FMY A;  3OV8 A;  4RAY A;  3NQO A;  5E18 F;  3HSE A;  3F8C A;  1P4A A;  1T0F A;  4P96 A;  1J9I A;  1KGS A;  1R5H A;  2DO7 A;  5JI6 A;  3LA2 A;  5EEH A;  1BOA A;  5D8K B;  2EA4 A;  3C7J A;  3QOP A;  4HF0 A;  2YX7 A;  2A5Y B;  4Q5S F;  1XDS A;  4KIB A;  4KNY A;  1DDN A;  2MLG A;  4KIF A;  1ZG1 A;  2M30 A;  4M73 A;  3FX3 A;  2RQP A;  5FFX A;  2CFX A;  3KP2 A;  1ZH5 A;  4OIO F;  3B02 A;  5CVJ A;  3BZ6 A;  4O5V A;  2HKX A;  3ABT A;  2F5F A;  5F6F A;  1B6A A;  3FWE A;  2XAH A;  3LQR A;  3KLN A;  4ZH4 F;  4B09 A;  2P4W A;  4I02 A;  1HKS A;  2VOP A;  1XSX A;  4CO8 A;  1UST A;  3NEU A;  2FBI A;  2EFO A;  2BBY A;  2D1H A;  2KIM A;  3E5X A;  2FSW A;  4EMS A;  3ZQ7 A;  4G8X A;  1TW2 A;  3GWZ A;  5D5U B;  1G6N A;  2PMU A;  3F72 A;  1LDJ A;  5ICE A;  4JQF A;  2GIV A;  4MTD A;  3F22 A;  3V8L A;  2A6H F;  2P6S A;  4EJW A;  3N4M A;  3KE2 A;  2VE8 A;  4U0Y A;  1ZLK A;  5E1X A;  4M6Y A;  5HVQ C;  4TV7 A;  3I59 B;  3O6B B;  1ON1 A;  3L7W A;  4UV8 A;  2V1U A;  2GXB A;  1P2F A;  2V6C A;  3RKY A;  4RB2 C;  3V7S A;  2QBY A;  3PQK A;  2XIG A;  3H92 A;  3MCZ A;  1IN5 A;  3C1D A;  3LFK A;  2HTS A;  4ENJ A;  5HLG A;  3OOP A;  2L01 A;  3V8J A;  2O8X A;  4FX0 A;  4NB5 A;  2HS5 A;  4R79 A;  3J80 Z;  3MQ0 A;  1LVA A;  3VOE A;  3HUG A;  3LQQ A;  3V4G A;  3ECO A;  1OYI A;  3COA C;  2Y75 A;  5ICG A;  1MDM A;  1KQ9 A;  1J7K A;  1KA8 A;  5A2Q Z;  3JSP A;  2HZT A;  1OKR A;  4EJV A;  2RV8 A;  3F6O A;  4IRI A;  3WG9 A;  3K0L A;  3LAJ A;  2HWV A;  2DBB A;  3HOT A;  3QAH A;  2ZBK A;  4MEX F;  4KYW A;  5LGN A;  4YFX F;  1IZ1 A;  3W6J B;  4YFK F;  3ZMU A;  3ZP5 A;  3R61 A;  4A2U A;  2HTJ A;  2JRT A;  5J8F A;  2XAJ A;  3FF5 A;  2W25 A;  2L02 A;  4RGX A;  1IF1 A;  1ZRE A;  1TQP A;  1LDD A;  2KRF A;  4PGG A;  1I27 A;  1Z91 A;  2XVC A;  1G4D A;  5H20 A;  3TO7 A;  2XRN A;  1PP8 F;  4CYD A;  3QRF F;  2GA1 A;  3I54 A;  1RZ4 A;  2QQB A;  1KYZ A;  1FT9 A;  3I64 A;  5DCM B;  2ZJ2 A;  1LB2 A;  5DCF A;  2RNJ A;  4BQA A;  2PN6 A;  2O6G E;  4LK0 F;  4BHP A;  1YS7 A;  3HSF A;  4PCQ A;  2RN7 A;  1TQI A;  2ZXJ A;  2ZME A;  1NHA A;  2QVO A;  3F21 A;  4ESB A;  5BMZ A;  3GLX A;  4CIC A;  3I5U A;  4ESJ A;  3WTS C;  5HS8 A;  2O3F A;  1KU9 A;  3KP6 A;  4BHB A;  1E2X A;  4L5I A;  3HTS B;  5H6Q A;  4RGU A;  3D5L A;  1REP C;  1ZG3 A;  2Z5U A;  3EDP A;  3J80 K;  1UFM A;  3HTU A;  1JHF A;  1SMY F;  3K1M A;  1LJ9 A;  3M1E A;  2M8E A;  3MAJ A;  2JTV A;  5ICF A;  4U0V A;  5E20 A;  2QEN A;  4U7D A;  1FBS A;  4XLP F;  1Z9C A;  1D8J A;  3FM5 A;  1ZRC A;  4KMF A;  4AWX B;  3F23 A;  2WWY A;  1PUE E;  3RYR A;  4HA8 A;  3SZP A;  3BY6 A;  2QM3 A;  1MJB A;  2R7F A;  2GZW A;  1BI0 A;  3E5Q A;  2P7V B;  2PMH A;  2LF7 A;  5K1Y A;  3LAP A;  4A12 A;  1S7A A;  4M6X A;  4OIN F;  2YX4 A;  1LQ1 A;  3E6B A;  3TQN A;  1ONV A;  1SD4 A;  2HR3 A;  1W5S A;  1FX7 A;  2ZFW A;  3C18 A;  3IWF A;  1T38 A;  1XGS A;  5DYM A;  2J5O A;  1W7P D;  2IP2 A;  2IJL A;  3WU1 B;  2O0Y A;  4B8X A;  1K6O A;  2QYO A;  1O57 A;  2KJC A;  2M45 A;  1SD6 A;  2Z33 A;  1FWZ A;  1K78 A;  3P9C A;  2LNB A;  1FSE A;  1G3T A;  2TDX A;  4FX4 A;  2CW0 F;  5BPI A;  1B1B A;  2GAU A;  3RI4 A;  3RKX A;  2FEZ A;  3RTR A;  2STT A;  4BH9 A;  2JSC A;  2NYX A;  4I09 A;  3U9G A;  2MLK A;  4R1H A;  4M74 A;  4Z2Y A;  1JHH A;  2ISY A;  2BYV E;  4NQW A;  4MQ9 F;  2CO5 A;  3RKW A;  5LHG A;  4LLG F;  3T8R A;  2K7L A;  5FLX Z;  2QLZ A;  3BJ6 A;  5HOO A;  1I1S A;  1XD7 A;  4G7Z F;  3W6K B;  1UHW A;  1BI2 A;  1EV7 A;  4WF2 A;  4AIK A;  2UXN A;  4NHJ A;  1LNW A;  4ZZL A;  3KCC A;  3DP7 A;  1YW7 A;  4IHS A;  1R36 A;  4AIH A;  4L9N A;  3GUD A;  4L0Y B;  3K1N A;  1SAX A;  2DW4 A;  1BN5 A;  1YS6 A;  2YPR A;  2WV0 A;  2G9W A;  4HLX A;  4QWQ A;  4LB5 A;  2EA2 A;  2XAS A;  2FU4 A;  4FT8 A;  4F7Z A;  4HX8 A;  1ZRF A;  3HHG A;  4PZJ A;  2W85 A;  2M87 A;  1IXC A;  5JR3 A;  5DD4 A;  4A0Z A;  4XRF A;  4ZZD A;  2MA3 A;  1YW9 A;  3HRM A;  2QBY B;  3GZ5 A;  5K5O A;  1T98 A;  2RC4 A;  3SZT A;  4RAZ A;  3WTW C;  2ZNZ A;  5E17 F;  1D3Y A;  4AD9 A;  2A6E F;  3L00 A;  5L3F A;  1U5T A;  4WX9 A;  1ZAO A;  4L18 B;  4E70 A;  3J7A O;  5DEQ A;  1W7P B;  5HDN A;  1MDM B;  3CUQ C;  3GFL A;  2P6T A;  2F5C A;  5HLI A;  2IRF G;  2E1C A;  2L3D A;  2X0L A;  3T8T A;  3QP6 A;  1IUY A;  4M9X A;  3R4K A;  3MZY A;  4MGR A;  2CYY A;  2DU9 A;  4GCV A;  1GVJ A;  1BC8 C;  4HDU A;  2AXL A;  1R1V A;  1JE8 A;  2GXG A;  3G73 A;  3N97 A;  1STZ A;  5HS7 A;  2VC1 A;  5FLX K;  1MZB A;  1D5V A;  1IRF A;  1SFX A;  1MKM A;  3FXU A;  4S04 A;  1RIO H;  1TLH B;  2ADU A;  2DFI A;  4OMY A;  3CUQ A;  2YU3 A;  4EM2 A;  2NS0 A;  3AAF A;  2M1B A;  2V79 A;  1H9T A;  1WRJ A;  1ZLJ A;  5DV5 A;  5EEG A;  3RJP A;  3WTZ A;  2FF4 A;  1FC3 A;  4KA4 A;  2CWE A;  2RKH A;  2IPQ X;  4Y17 A;  1FLI A;  2EV0 A;  3TO6 A;  2ZME B;  3I4P A;  4IHT A;  4LD5 A;  3HOS A;  2OQG A;  4P9F A;  4ENM A;  2XKO A;  3IWZ A;  3NRV A;  3ZN0 A;  5CVV A;  1GXP A;  4HAM A;  2LSO A;  1U3E M;  1IN4 A;  2GWR A;  5CYV A;  3LWF A;  2JZY A;  1D8K A;  2CSO A;  3HHH A;  2FML A;  1Z6R A;  1KQ8 A;  4IJA A;  1XDU A;  5D5V B;  4RS8 A;  1IN6 A;  1R22 A;  2VBZ A;  3IRR A;  5FB2 A;  1R00 A;  2F5E A;  3ROU A;  1T39 A;  3GEZ A;  2D45 A;  3TDU C;  4K2E A;  1T2K A;  3WTT C;  4OU0 A;  2GA2 A;  5HDG A;  5ICC A;  4HYE A;  4HDV A;  4LLN A;  3KP5 A;  1XMA A;  4UXN A;  3RPU A;  3MZH A;  2DPU A;  2UXX A;  3BOQ A;  1SD5 A;  1W5T A;  1YG2 A;  4P9U A;  2P5L C;  4XSZ F;  3GO5 A;  1XGM A;  2HKO A;  2XUB A;  4HX4 A;  3SFZ A;  2PI0 A;  4WK8 F;  5HS9 A;  4RGS A;  3P9I A;  1R23 A;  3GYH X;  5KK1 A;  1S29 A;  1K7A A;  2D1V A;  4P5O A;  3T5X A;  3IHU A;  4R8H A;  5E1W A;  1K79 A;  2M5W A;  1S8N A;  1B9N A;  1TBX A;  4M9Z A;  3FMR A;  3I53 A;  4OOI A;  3EYY A;  4N9I A;  3TOB A;  2FNA A;  3I0T A;  5DD8 A;  2MBF A;  1DUX C;  3T1B A;  1RUO A;  4L9T A;  2V1X A;  3F8N A;  4I7H A;  1G3S A;  3QPT A;  1FZP B;  4I0A A;  1LEB A;  1F5T A;  2W24 A;  3GW2 A;  1DPU A;  3JW4 A;  2KIU A;  1BI1 A;  4G7H F;  1IN7 A;  1O7F A;  3M8F A;  5ERI A;  5AIP A;  2XGX A;  5TRD A;  2DAO A;  5ILS A;  3E5U A;  3ZN1 A;  4AIJ A;  4A5M A;  5DUI A;  1JXS A;  3K69 A;  2QQ9 A;  4OIR F;  2K27 A;  2QWW A;  3ABU A;  3DKW A;  3PFI A;  4EV0 A;  3V7C A;  1ZYR F;  4BYY A;  2ZKZ A;  4HV5 A;  1KU3 A;  3Q5F A;  2P7C B;  5HDK A;  2FBH A;  2MD5 A;  3P7N A;  1QO0 D;  3L2C A;  2IA1 A;  3KP7 A;  1EH8 A;  1KU2 A;  1FYK A;  3F8F A;  1HW2 A;  3QU6 A;  3FMS A;  2G7H A;  1SFE A;  1R5G A;  2B0L A;  3CJN A;  2IT0 A;  2XKP A;  2W57 A;  1U2W A;  1YQA A;  3R0J A;  2PFB A;  4HW0 A;  2Y48 A;  3TO9 A;  4YFN F;  4YII A;  1T6S A;  4KIC A;  4M71 A;  2H09 A;  3KEO A;  4HQM A;  5H6R A;  2IA0 A;  1U5T B;  1FYM A;  2CQK A;  3Q9V A;  5CVU A;  4OIQ F;  3HRS A;  1Z05 A;  2KIF A;  4JBA A;  4DQ2 A;  2HFH A;  3S2W A;  4XBF A;  4EQQ A;  1KQ0 A;  3DF8 A;  1F4K A;  3P9K A;  1R1U A;  1KYW A;  3KFW X;  2OBP A;  4DNC A;  1BIB A;  4KIG A;  2BV6 A;  3FHZ A;  1FBU A;  1W4M A;  2FE3 A;  3HYI A;  2VN2 A;  2VE9 A;  3B73 A;  2ELH A;  2RDP A;  1U78 A;  1J5Y A;  3HRT A;  4QLC U;  3VOD A;  5LEJ A;  1QBJ A;  4FHT A;  2HOE A;  3REO A;  4XSX F;  3F3X A;  4U88 A;  2H6C A;  2EWN A;  1XCV A;  3R0A A;  2PBI A;  4MTE A;  5F64 A;  3BPV A;  1MD0 A;  3RYP A;  5LRS A;  1OR7 A;  1V3F A;  4U0W A;  1H0M A;  1CGP A;  5E8I A;  4EJT A;  2ESN A;  2FA5 A;  3U1D A;  1BM9 A;  5FGM A;  4BAY A;  1ZG5 A;  3MFK A;  1LDK B;  5J6X A;  2O03 A;  3DPT A;  3ECH A;  3ZMZ A;  1HSJ A;  1X3U A;  2ZNY A;  4RB1 A;  1QZZ A;  4ZYE A;  3KZZ A;  4YIF A;  1HXD A;  3F6V A;  3J81 Z;  4CHU A;  1XGO A;  2A61 A;  3LA7 A;  1ZN2 A;  4N9H A;  1FOK A;  1Y0U A;  2OAZ A;  1MGT A;  4G9Y A;  3HIF A;  2V9V A;  2LDU A;  4GO1 A;  3H3U A;  2DQR A;  4EM0 B;  1OPC A;  1HW5 A;  3IL2 A;  4UUV A;  4LLL A;  3Q9S A;  5IT3 A;  4HF1 A;  2DK5 A;  1V4R A;  1Q1H A;  4HBL A;  1YW8 A;  1CF7 A;  4WXC A;  2HYG D;  2FXA A;  1ZRD A;  1RI7 A;  4EVI A;  5CLS A;  4ON0 A;  2AS5 F;  1IN8 A;  1BC7 C;  2Z9O A;  3KP4 A;  4BNC A;  3QPH A;  5DUK A;  2Z3Y A;  2OZU A;  3V7R A;  1EH6 A;  3I58 A;  2K86 A;  1IXS B;  2EJR A;  2EB7 A;  2EFP A;  1IW7 F;  1AWC A;  6PAX A;  2V1D A;  2DQL A;  1YIO A;  2KJB A;  2EV5 A;  4EJO A;  4IVN A;  2E1N A;  1BBY A;  4LFU A;  1OYY A;  1YLF A;  1TTY A;  3WGH A;  5LBQ A;  2VXZ A;  1QZY A;  1WKM A;  2NNN A;  4LGW A;  3E3V A;  3WU0 A;  2ETH A;  2DPD A;  5JFR A;  4RGR A;  5L3D A;  1FP1 D;  3IRQ A;  4WXH A;  5LHH A;  2L54 A;  2UZK A;  3LST A;  5ILV A;  2O61 A;  3E6C C;  1R58 A;  4A6E A;  1HST A;  5FD5 A;  4M9S A;  2H94 A;  4HOB A;  4GYI A;  2DK8 A;  1SMT A;  1O3Q A;  3V8K A;  2QUF A;  1S3J A;  2WC2 A;  4MNU A;  5KVR A;  3JTG A;  1HKT A;  4HZF A;  1FSH A;  5AIQ A;  2KKO A;  1OMI A;  2CGP A;  4MQV A;  3GFM A;  1H9G A;  1J75 A;  3SXY A;  2FQ3 A;  2RGV A;  3DEU A;  3J81 K;  2COM A;  3GFJ A;  3HSR A;  1FNN A;  4CGZ A;  2K02 A;  3L9F A;  4L9V A;  3RDI A;  4MHG A;  1P92 A;  3ISP A;  5FFZ A;  3M8E A;  4ENN A;  3CUO A;  3KP3 A;  1S7O A;  4WXD A;  4LMY A;  2BE5 F;  5D4S A;  5FD6 A;  4KMU X;  4I2O A;  5J8C A;  1F9N A;  3I71 A;  1VTN C;  2IW5 A;  2HQN A;  1R1T A;  3EQL F;  3ZMT A;  1UHM A;  5K5R A;  1IRG A;  3CO6 C;  4PGH A;  1XB4 A;  2YSR A;  3ZMD A;  3D0S A;  2H27 A;  3R60 A;  1QPM A;  3BRO A;  2STW A;  4UNO A;  4G6Q A;  2IA2 A;  2DTR A;  4BXU A;  3IKV A;  1YTY A;  4XLN F;  3IC7 A;  2MC3 A;  3G3Z A;  1OYW A;  2HEO A;  5CVR A;  2PG4 A;  2HGC A;  2HQR A;  3T0Y A;  3F8M A;  2C6Y A;  5LLQ A;  3R6S A;  4EJU A;  3ZMV A;  3JAM Z;  2EK5 A;  3H3Z A;  1L0O C;  2ZO4 A;  3K2Z A;  2VOD A;  1HQC A;  3PQJ A;  2A68 F;  4KN7 X;  1XGN A;  1TNT A;  1BJA A;  1ZGJ A;  3K9T A;  2OD5 A;  3CTA A;  4Q47 A;  3JTH A;  4HQE A;  1P6R A;  1P4W A;  2H6B A;  1J2X A;  1SFU A;  4UVB A;  4LG0 A;  3WE3 A;  4IRG A;  5TJJ A;  3F8B A;  3ML6 A;  1B59 A;  4JK1 X;  4S05 A;  4GGG A;  5D4R A;  3ZMS A;  3BDD A;  1XSD A;  1HBX G;  2FBK A;  1WWX A;  2IVM A;  2YR2 A;  1SD7 A;  2Y0M A;  4P55 A;  2P5V A;  2EFQ A;  1J59 A;  4MEY F;  3KZY A;  5ILU A;  3WTX C;  1ZAR A;  1HW1 A;  4ENK A;  2Q0O A;  1Z6T A;  1XCB A;  3E97 A;  3CO7 C;  4ASN A;  1R7J A;  2VON A;  5D8L B;  3EYI A;  5LEK A;  4KFC A;  3KET A;  5F1R A;  3TDZ C;  3SQN A;  2LKP A;  4Q48 A;  3GX4 X;  4HX7 A;  2L4M A;  3M7G A;  2ZCW A;  1ODD A;  2LF8 A;  1K78 B;  2X4H A;  1TQM A;  1W7P A;  1HKQ A;  2BEO A;  4O3M A;  3E6M A;  5BOX A;  2NAZ A;  3C3W A;  4A6D A;  3K1P A;  1LEA A;  2PQ8 A;  4I01 A;  4O6J A;  1WI9 A;  4LJZ F;  4KT5 C;  2BGC A;  2VT2 A;  3JAM K;  2F2E A;  1I5Z A;  4HV6 A;  3L09 A;  3GZ6 A;  4UVC A;  4OMZ A;  1O3T A;  5K5Q A;  2UWM A;  4HF2 A;  5D5X B;  2VBW A;  1DPR A;  4IPA A;  4PDK A;  2L4A A;  2D2W A;  4G6D A;  1CF7 B;  4Q4Z F;  1QGP A;  1S6L A;  3VB2 A;  1WQ2 A;  1A04 A;  1F1Z A;  2XRO A;  2A69 F;  4L5J A;  2QQA A;  4GXO A;  2DLL A;  2Z99 A;  1Z1D A;  5D5W B;  2RVC A;  4L9J A;  3DXJ F;  2FOK A;  3BP8 A;  5LGT A;  4L0Z B;  4I98 B;  2FRH A;  2A3S A;  5DDG A;  4KUM A;  5BS6 A;  1FBQ A;  2ISZ A;  3DFG A;  4KDP A;  5L3E A;  4GYG A;  3O2P E;  1Z7U A;  3HRU A;  3CDH A;  5BPD A;  4D0P A;  2XV4 S;  1XMK A;  3EUH A;  1IAW A;  1U8R A;  4KN4 X;  4WWC A;  3O3K A;  4Y15 A;  1O3S A;  1FPQ A;  5CJ9 A;  3GF2 A;  3WE2 A;  2J5P A;  3DQV C;  1BIA A;  3WOD F;  3BJA A;  2HYF A;  4CXF A;  2E7W A;  4ZYD A;  1G3W A;  4YG2 F;  2XAF A;  1QNT A;  2K4B A;  5FO5 A;  4RB3 C;  2JT1 A;  1B4A A;  1MJ9 A;  2ESH A;  3IKT A;  3E6D A;  2DI3 A;  4AVP A;  3QP5 A;  5A2Q K;  1YO5 C;  2JPC A;  4WCG A;  1WSU A;  3JSO A;  2VOO A;  1O7L A;  3RIR A;  3I59 A;  2NRA C;  1G3Y A;  3RPQ A;  3EET A;  4M72 A;  1J0R A;  2XAG A;  2Q2E A;  1IXR C; 
#chains in the Genus database with same CATH topology
 2EFN A;  5J40 A;  4DJA A;  4BHC A;  2OJE D;  1L3L A;  1TWC J;  2XGD A;  1A36 A;  2ACJ A;  3BR3 A;  2A5W A;  2JPB A;  5IOY A;  1JT6 A;  5JVT A;  3A4C A;  3OYG A;  4A5N A;  1VQ4 I;  1UB9 A;  4ETS A;  3A02 A;  3SYT A;  4U87 A;  3L2U A;  2ZJQ F;  1TNS A;  2GQQ A;  4JOM A;  3GTG J;  2R5Y B;  2F5D A;  5FKL A;  3DLL F;  3OIP A;  3S1Q J;  1FEX A;  1PDN C;  1B9M A;  1YYV A;  2FJ1 A;  1QQI A;  4A3E J;  3FXR A;  1HC8 A;  3BR1 A;  1MW7 A;  3IUO A;  1GHC A;  1USS A;  2NOG A;  1YFH A;  1ULY A;  5AON A;  2E19 A;  4IF4 A;  5L3B A;  2EFW A;  3MWM A;  2HZD A;  3CUQ B;  4PFP A;  3OYF A;  3GBG A;  5ED4 A;  2E7X A;  5EG0 A;  2VC0 A;  2MH9 A;  4BQQ A;  2KPM A;  2M3A A;  3QQA A;  4A3F J;  3HKZ N;  1VQO I;  2PMZ N;  5E8G A;  1EH7 A;  1FYL A;  3BJO A;  4HEA 2;  1XMX A;  4PSW A;  3TP0 A;  4ZYG A;  2XHK A;  2X6O A;  2DA2 A;  2E5N A;  2R7D A;  1FY7 A;  4X6A J;  2VB6 A;  3L2Q A;  4A3D J;  1PJR A;  3RZD J;  2A07 F;  1Y0N A;  5BQT A;  2CJJ A;  2OZ6 A;  3SHF A;  5LGU A;  5CVI A;  2XPU A;  3TOA A;  2HDC A;  3MEX A;  3ERE D;  1ZGA A;  5E1Z B;  3WTV C;  1S72 I;  4BBR J;  5IT9 Z;  1WH5 A;  4N4O B;  1HDP A;  2VJJ A;  2Q8K A;  3A1Y A;  3GTJ J;  3FKJ A;  1D5Y A;  4RB0 A;  3GVA A;  1WFX A;  2OU2 A;  4XN3 A;  1P4X A;  5LRR A;  1WI3 A;  4EM1 A;  4Y13 A;  4U7B A;  1RNL A;  4G7O F;  2VI6 A;  3PNV A;  3LA3 A;  1N25 A;  2VBY A;  1BI3 A;  2R5Z B;  3PIP F;  3KLO A;  2KZG A;  2OQR A;  2DMU A;  2CG4 A;  2PEX A;  5LHI A;  2AXT C;  3S3N A;  2FNP A;  1ZHF A;  3ULQ B;  4BJ6 C;  3PNT A;  1WH7 A;  1R5I D;  3BG7 A;  1XTA A;  4XLH A;  3GTM J;  4N0B A;  2CW8 A;  4A0X A;  2QZ8 A;  3QYB A;  4XM3 A;  4IOC F;  1ZQ3 P;  5D6F A;  4PJJ A;  2NS8 A;  5CQE A;  4UHT A;  1MJA A;  4ZYH A;  1FP2 A;  3TKY A;  1U5T C;  3CLO A;  1C0W A;  2IS6 A;  4LG0 B;  1Z0X A;  4IEJ A;  5L3C A;  1O3R A;  2MH2 A;  1DP7 P;  3ZR8 X;  1TW3 A;  1E17 A;  4A3C J;  2E5Z A;  3WTU C;  2PJR B;  5DCM A;  2DFE A;  3WGG A;  3I3L A;  2O8K A;  1N78 A;  2P81 A;  4LB6 B;  5HNH A;  4YIR X;  4ESF A;  3OYM A;  4UV9 A;  1TL8 A;  1YX3 A;  2DA3 A;  2EV6 A;  3ELK A;  4HLY A;  4UVA A;  3WGI A;  3DPL C;  2B9S A;  5BNG A;  2DT5 A;  1LE8 B;  4XN0 A;  3TGN A;  4E7J A;  3H0G J;  4NNJ A;  4KT6 A;  4G12 A;  4IXA A;  2ZXI A;  4CDG A;  1PP7 U;  3DV8 A;  5FLV A;  2M8G X;  2VT3 A;  3BPX A;  1D0Z A;  2MW8 A;  2R3S A;  3GXO A;  1UZC A;  2NNY A;  3FXQ A;  2ELJ A;  3BWG A;  4H0E A;  1QVT A;  2HVQ A;  1JGS A;  1U6G A;  4DYR A;  2PLY A;  2W84 A;  3I9V 2;  4I6Z A;  2NVX J;  2PX9 A;  5KCM A;  4ZYA A;  1Z67 A;  2HXI A;  2K4J A;  5EEA A;  5JHU A;  5EGO A;  4CYC A;  3D1N I;  5IPA A;  2Z2S B;  1VQ6 I;  4IOA F;  1I6X A;  1ON2 A;  5D6E A;  2KT0 A;  3DTI A;  3QYE A;  3WTY C;  4BE2 A;  1MND A;  3LSH A;  4OIP F;  4HNU A;  5HLH A;  3GFI A;  1XSV A;  2E34 A;  2XAQ A;  1BR2 A;  2LFB A;  1RUN A;  1GXQ A;  3M9A A;  2DMQ A;  2OA4 A;  1MSF C;  3CC7 I;  5KNL A;  3U2R A;  3FDY A;  5JVG F;  2ZSI B;  3KEQ A;  2CMP A;  3BC8 A;  1XN7 A;  2VBX A;  4XQF A;  1SFK A;  2ICW G;  3KEY A;  1IJW C;  2GOX B;  4XK4 A;  3QU3 A;  2EPF A;  4LIT A;  3JRE A;  1CQT A;  2G7U A;  5FKM A;  3CP2 A;  3FM3 A;  4I0B A;  2JVH A;  1NK2 P;  1I1G A;  3VFZ A;  2WTE A;  4ZTF A;  4A0Y A;  1X4P A;  3O8G A;  2P5K A;  4EGY A;  5L3G A;  3A2K A;  4LK1 F;  1UCR A;  2L2O A;  5IT9 K;  5J4V A;  2P8T A;  4CZZ A;  5E79 C;  1W36 C;  3K4J A;  2MD0 A;  3FZV A;  2OTL I;  4AYB N;  1R4M B;  4CA0 A;  2E36 A;  3ZPL A;  1RRJ A;  4IRH A;  2GBY A;  2R7Z J;  2K9N A;  1AOY A;  2PJP A;  1APL C;  3CME I;  1Z3Y A;  1KU7 A;  5FRN A;  2OV7 A;  4EGZ A;  1V5G A;  4G94 A;  3FMQ A;  3VEP A;  2KLO A;  1YRN B;  2HVS A;  2FMY A;  3OV8 A;  4RAY A;  5IY5 H;  3NQO A;  5GPC A;  2DA7 A;  2ID3 A;  5E18 F;  3OS1 A;  3HSE A;  3F8C A;  1GLN A;  1P4A A;  1T0F A;  4P96 A;  1J9I A;  3VWB A;  2JK3 A;  3S3O A;  1BR1 A;  3CLQ A;  3BLY A;  1KGS A;  5H2F C;  5HLT A;  1R5H A;  1W5C C;  2DO7 A;  5JI6 A;  3LA2 A;  5EEH A;  1BOA A;  2VQL A;  2EIJ H;  1JGG A;  1V55 H;  5D8K B;  2EA4 A;  3PM1 A;  2ECB A;  3C7J A;  2AQF A;  2LVS A;  4E7K A;  3QOP A;  4RLQ A;  1Q1V A;  1VZ0 A;  1U9N A;  4RMN A;  4L5E A;  1ETY A;  2KIQ A;  4HF0 A;  2YX7 A;  2A5Y B;  4Q5S F;  1XDS A;  2L9S A;  4KIB A;  4KNY A;  1DDN A;  2MLG A;  4KIF A;  1ZG1 A;  2M30 A;  4M73 A;  4A3M J;  3H9J A;  3FX3 A;  5FKO A;  1T95 A;  3PIO F;  2RQP A;  5FFX A;  3J7A Y;  2CFX A;  3KP2 A;  5F27 A;  2XPV A;  1ZH5 A;  1HOM A;  2H8W A;  4FET A;  2X1E A;  4OIO F;  2IGK A;  3CCE I;  3B02 A;  5EYR A;  2K9L A;  5CVJ A;  5GAE J;  1VQL I;  3BZ6 A;  4UUS B;  4O5V A;  4IO9 F;  2HKX A;  3CMY A;  4W1U A;  3ABT A;  2R7Q A;  2FUG 2;  2CUE A;  2BXZ A;  2F5F A;  5F6F A;  3BG9 A;  1Y1V J;  5B5E C;  1B6A A;  3FWE A;  1YJN I;  2XAH A;  3LQR A;  4II2 A;  2IBD A;  3KLN A;  2LG4 A;  4ZH4 F;  4D1Q A;  2W48 A;  4B09 A;  4E4H A;  2P4W A;  3ASO H;  2BY2 A;  3FXK A;  4I02 A;  3M1C A;  1HKS A;  3OYC A;  2VOP A;  1XSX A;  4CO8 A;  1LFB A;  3HG9 A;  3Q0W A;  2L9N A;  1UST A;  3NEU A;  4LIU A;  2FBI A;  2EFO A;  2BBY A;  5M5W J;  1OCO H;  1IRZ A;  3VYR B;  2D1H A;  2KIM A;  1MMN A;  1JUM A;  2FSW A;  3E5X A;  4XLA A;  1TWG J;  2KRC A;  3ZQ7 A;  4EMS A;  3JR9 A;  3E7L A;  4G8X A;  1VFC A;  1TW2 A;  2KDO A;  4PJL A;  3GWZ A;  5D5U B;  2AQE A;  2MGQ A;  1Y8R B;  1G6N A;  2WAE A;  3WHC A;  3HXL A;  3BR6 A;  2GIZ A;  5IYC J;  2DDA A;  2PMU A;  3LSI A;  3F72 A;  1LDJ A;  5ICE A;  2O9L A;  4MFE A;  4JQF A;  2GIV A;  1YIT I;  4MTD A;  1OLT A;  2LRD A;  2VJ4 A;  1MBG A;  5M5X J;  3F22 A;  2M7B A;  4C3H J;  4F3Q A;  2Y0S N;  3V8L A;  1HLV A;  2A6H F;  2P6S A;  2K3F A;  1TWF J;  1JT0 A;  3Q0U A;  4EJW A;  5LFA A;  1LUJ B;  3N4M A;  3KE2 A;  3N05 A;  2KIS A;  2VE8 A;  2WAQ N;  4U0Y A;  1ZLK A;  5E1X A;  4IL6 C;  4M6Y A;  5HVQ C;  3HOZ J;  4TV7 A;  3I59 B;  3O6B B;  1ENH A;  1ON1 A;  2YUS A;  3L7W A;  4UV8 A;  3AG2 H;  2V1U A;  2CS3 A;  3KX2 A;  1P2F A;  2GXB A;  4UUT A;  1SVO A;  2V6C A;  3J7Y J;  3RKY A;  1MIJ A;  2LKX A;  4Z6Y A;  4RB2 C;  3QPL A;  2Q2E B;  1R4N B;  3V7S A;  1B72 A;  2NVY J;  2QBY A;  3PQK A;  2X48 A;  2QKL B;  3CF2 A;  2KQR A;  3FIW A;  2XIG A;  3H92 A;  3MCZ A;  1A35 A;  1NG6 A;  2Y2Z A;  1IN5 A;  3C1D A;  3CMM A;  4QPQ A;  3LFK A;  2HTS A;  4ENJ A;  1YJ9 I;  4DBR A;  3FXO A;  5HLG A;  3OOP A;  2ME0 A;  2KDZ A;  3SEQ A;  2L01 A;  3V8J A;  2O8X A;  4FX0 A;  4NB5 A;  2HS5 A;  4R79 A;  2LYC A;  3J80 Z;  1O4X A;  2LR8 A;  3MQ0 A;  1LVA A;  2EIL H;  3HUG A;  3LQQ A;  3VOE A;  1IDZ A;  3V4G A;  1RC9 A;  1H89 C;  3ECO A;  1OYI A;  5DM6 F;  3COA C;  2Y75 A;  5ICG A;  1MDM A;  1KQ9 A;  1D0Y A;  2XPW A;  5GTI C;  1D0X A;  1J7K A;  1KA8 A;  5EG0 B;  3L2V A;  3KYD B;  5A2Q Z;  3JSP A;  3S3M A;  1H8A C;  3OL3 A;  4II3 A;  2HZT A;  1W0U A;  1OKR A;  3CDL A;  5IP7 J;  4EJV A;  2RV8 A;  2W4S A;  3F6O A;  2BHY A;  3FBN B;  4YRV A;  2DT6 A;  4IRI A;  1JJ6 C;  1G59 A;  3WG9 A;  4ABZ A;  3HOX J;  3K0L A;  3LAJ A;  2HWV A;  2DBB A;  3HOT A;  3QAH A;  1ZR2 A;  2ZBK A;  4MEX F;  4KYW A;  2EBI A;  5LGN A;  1OCT C;  4YFX F;  4OAY A;  1RKW A;  5M3F J;  3BG3 A;  2L7M P;  5IP6 A;  1MBF A;  1IZ1 A;  2DTZ A;  3W6J B;  2XGC A;  4YFK F;  3ZMU A;  3ZP5 A;  3R61 A;  4IZZ A;  3DWL E;  4A2U A;  2HTJ A;  2JRT A;  4RM2 A;  3F9K A;  3ABM H;  3SJM A;  1QHG A;  3AL0 C;  2WY8 Q;  5J8F A;  1G8X A;  1S7E A;  3QPS A;  2XAJ A;  5J1U A;  4UB6 C;  3FF5 A;  3ZRG A;  2XF6 A;  2W25 A;  2Z1D A;  2L02 A;  4RGX A;  3RCO A;  1IF1 A;  1ZRE A;  3DTE A;  1TQP A;  4C9Y A;  1LDD A;  4XOR A;  2KRF A;  3CCJ I;  3KPH A;  4PGG A;  1I27 A;  1Z91 A;  2XVC A;  1K83 J;  1VQ5 I;  1G4D A;  5H20 A;  2B63 J;  3TO7 A;  4A3I J;  2XRN A;  3HOU J;  5GTH C;  5KAF C;  4DGW B;  1PP8 F;  4CYD A;  3QRF F;  3ZQF A;  1HCR A;  2ZSH B;  2OF7 A;  4X1E A;  2GA1 A;  4NC8 A;  3I54 A;  1RZ4 A;  4CCO A;  2LMD A;  4KJZ A;  2QQB A;  4Y33 A;  4C3I J;  4RM3 A;  3HEF A;  1KYZ A;  1FT9 A;  3I64 A;  5IYD J;  2VKE A;  2BZT A;  2QSG X;  5DCM B;  2BVM A;  2E35 A;  2ZJ2 A;  5DCF A;  4J01 A;  2RNJ A;  5C3E J;  1LB2 A;  1B8I A;  4BQA A;  2K9Q A;  1SEU A;  2PN6 A;  2O6G E;  4LK0 F;  4BHP A;  1YS7 A;  2DFF A;  2M34 A;  3HSF A;  1MMD A;  1A6I A;  4JP0 A;  4PCQ A;  2QA4 I;  2RN7 A;  1YX5 A;  1TQI A;  3ZOB A;  4B4C A;  2ZXJ A;  2ZME A;  3UKG A;  1NHA A;  3PO3 J;  1ETQ A;  4Y3O A;  2QVO A;  3F21 A;  2CV1 A;  4ESB A;  5BMZ A;  2RAE A;  3GLX A;  3W3C A;  4CIC A;  3I5U A;  4ESJ A;  4JX4 A;  3WTS C;  5HS8 A;  2O3F A;  3OYA A;  1NH3 A;  1KU9 A;  3KP6 A;  4BHB A;  3S16 J;  2MAB A;  2X9D A;  1E2X A;  4L5I A;  4XLF A;  4CYC B;  2AO9 A;  5EGO B;  2VPR A;  3HTS B;  2DA5 A;  5H6Q A;  4RGU A;  3MKY B;  3U1K A;  3GLL A;  3D5L A;  1REP C;  1ZG3 A;  2Z5U A;  3EDP A;  2Y31 A;  2RNG A;  3J80 K;  3FBI B;  4BL0 B;  5B1B H;  1EJ9 A;  1UFM A;  3HTU A;  1JHF A;  3K2A A;  5CPR B;  1SMY F;  3K1M A;  1LJ9 A;  3M1E A;  2B7E A;  2M8E A;  4PJ0 C;  4XKW A;  3MAJ A;  2JJ7 A;  2JTV A;  2GM4 A;  5ICF A;  1FMV A;  1MBK A;  1OR7 C;  1DGW Y;  4U0V A;  1VQ9 I;  1YIJ I;  3WHB A;  5E20 A;  2JA8 J;  2JVG A;  4BU2 A;  2QEN A;  4U7D A;  1FBS A;  4B3A A;  4AU7 A;  4XLP F;  4D5F A;  4BEH B;  3TW7 A;  3H5N A;  2VIX A;  1Z9C A;  1D8J A;  4BY7 J;  4LG3 A;  4UY8 I;  2CRG A;  3FM5 A;  1ZRC A;  4KMF A;  4AWX B;  2LRE A;  3NWS A;  3S17 J;  2LY1 A;  1ERD A;  3F23 A;  2WWY A;  3OYL A;  3WG7 H;  1PUE E;  3RYR A;  4HA8 A;  3SZP A;  2ZC2 A;  3BY6 A;  3S32 A;  2QM3 A;  1MJB A;  4V19 K;  1F43 A;  2R7F A;  1WZ2 A;  2GZW A;  2EZL A;  2F48 A;  1BI0 A;  3E5Q A;  2P7V B;  3HGY A;  2WV1 A;  2PMH A;  3OYK A;  3OOU A;  3HOV J;  2LF7 A;  5K1Y A;  3LAP A;  2ID6 A;  4A12 A;  1S7A A;  1ZK8 A;  4M6X A;  2OTJ I;  4GDF A;  4OIN F;  3IH2 A;  5B1A H;  1I6H J;  2YX4 A;  1LQ1 A;  3E6B A;  3TQN A;  1ONV A;  1JKQ C;  3F0C A;  4BXX J;  1SD4 A;  2HR3 A;  1W5S A;  1FX7 A;  2ZFW A;  3C18 A;  3IWF A;  4XRS A;  1T38 A;  1XGS A;  1TZL A;  1R49 A;  4NC6 A;  1P7I A;  2G0E A;  5DYM A;  2J5O A;  3CZ6 A;  4I76 A;  1W7P D;  2IGN A;  1RR7 A;  2IP2 A;  2JWT A;  3LSG A;  2IJL A;  3WU1 B;  2O0Y A;  1KZH A;  4B8X A;  4DZP A;  2IAI A;  2DOD A;  3S2H J;  1IRX A;  1K6O A;  2QYO A;  1T08 B;  1O57 A;  1K61 A;  2KJC A;  4CSW A;  2R0Q C;  2M45 A;  1SD6 A;  2Z33 A;  1FWZ A;  1K78 A;  3E0J B;  2DFH A;  2VL8 A;  2LNB A;  1OIS A;  3P9C A;  4F55 A;  1FSE A;  1G3T A;  1TT0 A;  2TDX A;  4HRI A;  4FX4 A;  2CW0 F;  5BPI A;  2OUM A;  1B1B A;  2DJN A;  3JRI A;  3GCM A;  3ZQI A;  2GAU A;  3DEE A;  3RI4 A;  2V4J C;  3JRA A;  4E7S A;  3RKX A;  3CF5 F;  4IHX A;  1I3Q J;  2FEZ A;  1WJC A;  3RTR A;  1ACI A;  3M8J A;  2DYR H;  2STT A;  2KZV A;  2E1M B;  4BH9 A;  2JSC A;  2NYX A;  4I09 A;  3U9G A;  2MLK A;  4R1H A;  3G1M A;  4M74 A;  3HC7 A;  4Z2Y A;  3U21 A;  1JHH A;  4QTR A;  2ISY A;  2BYV E;  4NQW A;  4MQ9 F;  1MMA A;  2CO5 A;  3RKW A;  3LNQ A;  5LHG A;  1Z3X A;  2AHQ A;  4LLG F;  3T8R A;  4F93 B;  2K7L A;  2FD5 A;  5FLX Z;  2QLZ A;  2WAD A;  5C44 J;  2DMN A;  3BJ6 A;  5HOO A;  1I1S A;  1XD7 A;  4G7Z F;  3G1L A;  4M3E A;  5E3O A;  3W6K B;  1UHW A;  1BI2 A;  4IHV A;  1WHU A;  4B1R A;  2LBF A;  1EV7 A;  2M4G A;  4WF2 A;  4AIK A;  2JUG A;  2UXN A;  2WA0 A;  1WCM J;  4NHJ A;  3K4M A;  1LNW A;  4ZZL A;  3KCC A;  3DP7 A;  1YW7 A;  4IHS A;  5F08 A;  1R36 A;  4QPO A;  4AIH A;  4L9N A;  3GUD A;  4B47 A;  4L0Y B;  3K1N A;  1SAX A;  2DW4 A;  1BN5 A;  1XG1 A;  1YS6 A;  2CH0 A;  2YPR A;  2WV0 A;  2G9W A;  1JKO C;  4HLX A;  3MMY B;  1WJF A;  4QWQ A;  4LB5 A;  2EA2 A;  3CP8 A;  2XAS A;  2FU4 A;  4BY1 J;  4FT8 A;  4F7Z A;  4HX8 A;  1ZRF A;  3HHG A;  4PZJ A;  2W85 A;  2K9S A;  2M87 A;  3RKQ A;  4NBQ A;  3A01 A;  1IXC A;  2R7S A;  3KYL A;  5JR3 A;  5DD4 A;  4A0Z A;  1RPW A;  1TC3 C;  1RKT A;  1TP4 A;  2F6C A;  4XRF A;  2EH3 A;  4ZZD A;  4PK4 A;  1FTZ A;  1UG0 A;  2MA3 A;  3HZJ A;  1YHQ I;  1YW9 A;  2O7O A;  3HRM A;  1B72 B;  2QBY B;  3GZ5 A;  2HDD A;  5K5O A;  2XRL A;  1LPQ A;  1T98 A;  2RC4 A;  3SZT A;  1I50 J;  4RAZ A;  3C2B A;  2QKM B;  3CMA I;  3WTW C;  2ZNZ A;  3CC4 I;  5E17 F;  2XB5 A;  3EUA A;  4OWR B;  1D3Y A;  2HQA A;  2JA2 A;  4AD9 A;  5IOZ A;  3AG3 H;  1A6Q A;  2A6E F;  4JYK A;  3L00 A;  1GV5 A;  2MYS A;  3OYH A;  5L3F A;  2YU9 J;  1VQ7 I;  1U5T A;  2XB0 X;  4WX9 A;  2R7V A;  4M6V A;  4N4N B;  1ZAO A;  3OYE A;  4L18 B;  3OMY A;  2HXO A;  4E70 A;  3J7A O;  4RAF A;  5DEQ A;  1W7P B;  5HDN A;  2EZH A;  3C2H A;  4BJT A;  1MDM B;  3GME A;  3CUQ C;  2RQQ A;  3K4C A;  2XC7 A;  3GFL A;  4IQ4 A;  1MMS A;  2P6T A;  1QPI A;  1V5F A;  2QGU A;  2CQN A;  2FOW A;  2F5C A;  3MVP A;  5HLI A;  2IRF G;  4XLE A;  4PJN A;  3OYD A;  2E1C A;  2L3D A;  2X0L A;  1JTY A;  2CU7 A;  3T8T A;  3QP6 A;  3UR3 C;  1IUY A;  3QYF A;  4BBS J;  3B6C A;  4M9X A;  3R4K A;  1JJ8 C;  1UMQ A;  3MZY A;  4MGR A;  2CYY A;  5EZH A;  3ZQQ A;  2DU9 A;  4GCV A;  3HL2 A;  1GVJ A;  1BC8 C;  5F1J A;  4HDU A;  2DOA A;  4DYC A;  2AXL A;  1R1V A;  3HJE A;  3RQ4 A;  3HGG A;  4HNT A;  1JE8 A;  2GXG A;  2TCT A;  3G73 A;  3N97 A;  5EJC A;  3FXJ A;  1STZ A;  5HS7 A;  4BQO A;  1V5E A;  2VC1 A;  5FLX K;  1X58 A;  1MZB A;  3IAS 2;  3IAM 2;  1D5V A;  5K7F A;  3JCU C;  1IRF A;  1SFX A;  3CCY A;  3SZG A;  1MKM A;  3FXU A;  4YEL A;  4S04 A;  5JLW A;  2XF5 A;  4A93 J;  3W2W A;  3MKW B;  3C2G A;  2CQQ A;  3K70 C;  1RIO H;  1X4O A;  1TLH B;  2ADU A;  1YE9 A;  3PNY A;  2E2H J;  4XKC A;  2ECC A;  1XX5 A;  2E71 A;  2DFI A;  2W00 A;  4OMY A;  3CUQ A;  2YU3 A;  3MKZ A;  4EM2 A;  1S9H A;  1V54 H;  2A05 A;  2NS0 A;  2E60 A;  1LKX A;  1A5J A;  3AAF A;  2M1B A;  2V79 A;  1VQM I;  2NVU B;  1H9T A;  1WRJ A;  1ZLJ A;  2EZK A;  5DV5 A;  5EEG A;  1WJE A;  3RJP A;  3WTZ A;  2FF4 A;  1FC3 A;  2M4K A;  1B8I B;  4KA4 A;  3IP4 B;  3ZQL A;  2CWE A;  3AG4 H;  2RKH A;  2WB1 N;  3D5R C;  1X3Z B;  2IPQ X;  4Y17 A;  3OIQ A;  5EZG A;  1T33 A;  4A3B J;  2EV0 A;  1FLI A;  3TO6 A;  2H1L A;  3JRH A;  4MIM A;  2ZME B;  3I4P A;  4IHT A;  5B3S H;  4LD5 A;  4XNF A;  3O8H A;  4JX5 A;  3HOS A;  3A03 A;  4NDL A;  2OQG A;  1FIP A;  1ZGW A;  5JHF A;  4P9F A;  4ENM A;  2XKO A;  1Y6I A;  3IWZ A;  1IUF A;  1T8I A;  3NRV A;  2X6X A;  3ZN0 A;  1QU3 A;  5CVV A;  4XID A;  2Z16 A;  1GXP A;  3LMM A;  4HAM A;  2BY0 A;  2LSO A;  1XS9 A;  3FK7 A;  1U3E M;  3VPR A;  2L7K A;  1IN4 A;  2GWR A;  5CYV A;  3LWF A;  2JZY A;  1D8K A;  1P9Q C;  2CSO A;  3HHH A;  2FML A;  3HPH A;  2Y69 H;  2NOJ B;  3VSL A;  2NVQ J;  1Z6R A;  1KQ8 A;  4IJA A;  1XDU A;  2MC4 A;  4BXF A;  5GAD J;  5D5V B;  4RS8 A;  1IN6 A;  1R22 A;  2VBZ A;  2MSY A;  4AC0 A;  3IRR A;  1QHH D;  3A0H C;  2DA4 A;  4A3K J;  5FB2 A;  3H3V K;  4W97 A;  3ZGK A;  1R00 A;  2R7O A;  2F5E A;  3BCA A;  3BCB A;  3M07 A;  3ROU A;  2EZI A;  2NVT J;  1T39 A;  3LSR A;  3GEZ A;  5K7Z A;  1MSE C;  1K6Y A;  2XGE A;  3DU5 A;  2D45 A;  2IS4 A;  4X0G A;  1X2N A;  3BG5 A;  3TDU C;  2CQX A;  4K2E A;  1AKH A;  1T2K A;  1LVK A;  3WTT C;  4OU0 A;  2GA2 A;  1OCP A;  4BDY A;  5HDG A;  2FQ4 A;  2CV0 A;  5ICC A;  4HYE A;  2Y0S A;  4HDV A;  4LLN A;  3KP5 A;  1XMA A;  1HF0 A;  4UXN A;  3RPU A;  3MZH A;  3ESW B;  3JRD A;  1MNE A;  4Y4R A;  2VPL A;  2DPU A;  2UXX A;  3K4K A;  3I4M J;  3BOQ A;  1DU0 A;  3L2W A;  2TRT A;  3CQZ J;  1P7J A;  1SD5 A;  1W5T A;  1YG2 A;  4P9U A;  2P5L C;  4XSZ F;  3ERM A;  1U9O A;  3GO5 A;  1XGM A;  2HKO A;  2XUB A;  1ETX A;  4HX4 A;  2DXI A;  2I8D A;  3G71 I;  3SFZ A;  2PI0 A;  4WK8 F;  5HS9 A;  4RA2 A;  2OCC H;  4RGS A;  2HDW A;  4MFD A;  3CCQ I;  1ETO A;  2DOF A;  4E7I A;  1XC5 A;  3P9I A;  3H5R A;  3K4N A;  1X3W B;  1R23 A;  2MFZ A;  3VSK A;  3GYH X;  1ZKG A;  5KK1 A;  2X1D A;  1S29 A;  4QSH A;  2LLK A;  3H1C A;  4F92 B;  1K7A A;  2D1V A;  4P5O A;  5FKN A;  2HOA A;  3T5X A;  3IHU A;  4R8H A;  5E1W A;  3W6V A;  1DU6 A;  4XMY A;  1K79 A;  2M5W A;  3OS2 A;  3FXL A;  1S8N A;  1B9N A;  1SVL A;  1TBX A;  3FMR A;  3I53 A;  4M9Z A;  4OOI A;  5J47 A;  3EYY A;  5GAG J;  3PSF A;  4N9I A;  3TOB A;  2FNA A;  3I0T A;  1Y39 A;  3VYU B;  5DD8 A;  2MBF A;  3TL4 X;  3HDD A;  1DUX C;  3T1B A;  1RUO A;  5HOD A;  4L9T A;  2BXY A;  4A69 C;  2V1X A;  3F8N A;  4I7H A;  1G3S A;  2VQG A;  3CCR I;  2CUZ A;  3FHN A;  3FIS A;  3QPT A;  2HVR A;  3L2R A;  3DBL B;  3ZQH A;  4ITV A;  1U8B A;  3ABK H;  1BA5 A;  1FZP B;  4I0A A;  1LEB A;  1F5T A;  2W24 A;  3GW2 A;  4B3X A;  1DPU A;  3EUH C;  3JW4 A;  2KIU A;  3TW6 A;  1BI1 A;  2X51 A;  1IN7 A;  1O7F A;  3PUB A;  3M8F A;  4G7H F;  1FOY A;  5ERI A;  2KHM A;  2HQ5 A;  4EEF G;  5AIP A;  2JA5 J;  2XGX A;  2DAO A;  5ILS A;  5TRD A;  3E5U A;  3EPZ A;  3BR5 A;  3ZN1 A;  5J3L A;  4AIJ A;  4A5M A;  3ZQC A;  3QWL A;  5DUI A;  3IV5 A;  2X1C A;  1JXS A;  3K69 A;  2QQ9 A;  4OIR F;  4LIV A;  4E7L A;  2K27 A;  2QWW A;  1KON A;  3ABU A;  3DKW A;  3PFI A;  4EV0 A;  4NUB A;  3V7C A;  1A31 A;  3CC2 I;  5IP9 J;  2V7F A;  1ZYR F;  2CQ7 A;  2I5U A;  1UJ8 A;  3G4S I;  4BYY A;  1IV6 A;  1Z7L A;  2ZKZ A;  1VQ8 I;  4HV5 A;  1KU3 A;  3Q5F A;  1W36 D;  2P7C B;  5HDK A;  2FBH A;  2MD5 A;  1JKR C;  2VLA A;  2QCO A;  3P7N A;  4B44 A;  4DOZ A;  1E3P A;  1QO0 D;  3OR1 C;  3L2C A;  1PUF A;  4AUX A;  2IA1 A;  2LC2 A;  3KP7 A;  1EH8 A;  3OWT A;  5DS9 A;  3A01 B;  4RBO A;  1KU2 A;  4DW6 A;  1FYK A;  1MNM C;  4Y52 J;  2EQR A;  5B66 C;  2VJ5 A;  4DZJ A;  3F8F A;  5E3M A;  2R92 J;  1HW2 A;  3QU6 A;  3FMS A;  2G7H A;  1SFE A;  1R5G A;  1GDT A;  3JRB A;  2B0L A;  3CJN A;  2IT0 A;  2XKP A;  2MG4 A;  2W57 A;  1OCZ H;  4IHY A;  1U2W A;  1YQA A;  3BTI A;  3R0J A;  3HB9 A;  2PFB A;  4HW0 A;  2Y48 A;  1MBJ A;  1BJZ A;  3TO9 A;  1SC7 A;  1IDY A;  1W1W E;  4YFN F;  4YII A;  2N8G A;  1T6S A;  4XOP A;  4KIC A;  3BZC A;  2V9P A;  4M71 A;  2V6E A;  4YEJ A;  2H09 A;  4KIT B;  3KEO A;  4HQM A;  5H6R A;  2VUM J;  1VF9 A;  2KP6 A;  2IA0 A;  1U5T B;  1FYM A;  2CQK A;  2DOE A;  3Q9V A;  5CVU A;  4OIQ F;  2DA6 A;  3HRS A;  1MBH A;  4IX7 A;  1Z05 A;  4C2M J;  2LY2 A;  2X85 A;  2X6Y A;  2KIF A;  4JBA A;  4DQ2 A;  1VI0 A;  5J1Y A;  4AM3 A;  1JI8 A;  2HFH A;  3S2W A;  4FCY A;  4NC7 A;  3DTK A;  1F36 A;  2EIK H;  3KIO A;  3FK6 A;  5E3L A;  4XBF A;  4EQQ A;  1KQ0 A;  3DF8 A;  1E3O C;  1QRY A;  1F4K A;  3P9K A;  1YOV B;  2DDB A;  2L5Q A;  1R1U A;  3OSF A;  2JQ7 A;  1UG2 A;  1KYW A;  3HOY J;  3KFW X;  2OBP A;  3LL7 A;  4MO7 A;  3S1M J;  4DNC A;  3SEZ A;  1BIB A;  3LSM A;  2BV6 A;  4KIG A;  2FX0 A;  2WBM A;  2XF7 A;  5GPA A;  1ZEL A;  4E6K G;  3JRC A;  3OYN A;  1FBU A;  1W4M A;  2FE3 A;  1NG7 A;  3HYI A;  3RPU D;  2VN2 A;  2VE9 A;  3B73 A;  2ELH A;  4ZTJ A;  2HOS A;  2Y9Z A;  2JA7 J;  2RDP A;  2VXD A;  1U78 A;  3W2V A;  1J5Y A;  3HRT A;  4CH7 A;  4QLC U;  1WJB A;  2K85 A;  3VOD A;  5LEJ A;  2K9M A;  1QBJ A;  4FHT A;  3GTQ J;  2HOE A;  4UB8 C;  3REO A;  2F4M B;  4B43 A;  3E1S A;  4XSX F;  3F3X A;  2EIN H;  4U88 A;  2R7T A;  2E2J J;  2H6C A;  1HA8 A;  1IG7 A;  2EWN A;  1XCV A;  3BTL A;  3R0A A;  2PBI A;  4MTE A;  5F64 A;  2H1K A;  3BPV A;  4A3J J;  4J19 A;  1MD0 A;  3RYP A;  5GAH J;  5LRS A;  1OR7 A;  1V3F A;  3IH4 A;  2K3P A;  4U0W A;  1M1E B;  1H0M A;  3OYB A;  1GT0 C;  1CGP A;  2HU9 A;  5E8I A;  3HOW J;  4CUG A;  2JRM A;  4EJT A;  2YS9 A;  2ESN A;  2FA5 A;  3U1D A;  1BM9 A;  4C30 A;  1I3A A;  1IC8 A;  1WJ5 A;  3M4O J;  5FGM A;  1RR8 C;  4BAY A;  1ZG5 A;  3MFK A;  1W0T A;  3BG6 A;  1LDK B;  2WY7 Q;  2VKV A;  5J6X A;  3ONQ A;  1AA7 A;  2O03 A;  1QVU A;  3DPT A;  3ECH A;  3NAR A;  4A3L J;  3WU2 C;  1FIA A;  3ZMZ A;  1HSJ A;  1X3U A;  2ZNY A;  3DCF A;  4CCN A;  4RB1 A;  3GTO J;  1QZZ A;  2DJI A;  4ZYE A;  3KZZ A;  4YIF A;  3HKZ A;  1WGX A;  2PMZ A;  1HXD A;  3F6V A;  5DTD A;  3J81 Z;  1Y1W J;  1FOX A;  4CHU A;  2Q1Z B;  3BZK A;  1XGO A;  1N75 A;  2A61 A;  4HG2 A;  3LA7 A;  1ZN2 A;  4N9H A;  1FOK A;  4AID A;  1UHS A;  1Y0U A;  2OAZ A;  1D1A A;  1MGT A;  4G9Y A;  3HIF A;  3W2A A;  1VQK I;  1JTX A;  2V1N A;  2V9V A;  5C4J J;  2LDU A;  4GO1 A;  2VJI A;  3H3U A;  2DQR A;  4EM0 B;  2DT7 B;  2BY1 A;  1OPC A;  1HW5 A;  4IHW A;  1ETK A;  4XIC A;  3IL2 A;  3DEW A;  3BTC A;  3I55 I;  4UUV A;  4LLL A;  3Q9S A;  5IT3 A;  4HF1 A;  3GTL J;  2DK5 A;  2CFO A;  2JMW A;  1V4R A;  5CKT A;  1Q1H A;  3HM5 A;  3GTK J;  4HBL A;  1JUP A;  1YW8 A;  2W1O A;  1CF7 A;  3B6A A;  4HPQ A;  5KHD A;  4WXC A;  5FRM A;  3PO2 J;  2K5C A;  2HYG D;  2FXA A;  1ZRD A;  1RI7 A;  2W82 A;  4EVI A;  5CLS A;  4ON0 A;  3S1R J;  2AS5 F;  2R7U A;  1IN8 A;  1BC7 C;  2Z9O A;  3KP4 A;  3GTP J;  3OYI A;  4BNC A;  3QPH A;  5DUK A;  4E7H A;  5F0C A;  2Z3Y A;  2OZU A;  2QF7 A;  5FRO A;  2ZB9 A;  3V7R A;  3G6E I;  1EH6 A;  1OCC H;  3G2B A;  3I58 A;  2BHZ A;  5FKK A;  2L9V A;  2K86 A;  4BQN A;  2COB A;  1IXS B;  3LSJ A;  2EJR A;  1IGN A;  2EB7 A;  1BR4 A;  3D5S C;  4XRS G;  2EFP A;  1IW7 F;  2W7N A;  1AWC A;  6PAX A;  3H9Q A;  4LOC A;  4V2F A;  4FE4 A;  1EA3 A;  1R6R A;  3OSG A;  3JRG A;  2V1D A;  2DQL A;  1YIO A;  3NWT A;  2KJB A;  2BW3 A;  3NAU A;  5J1R A;  2EV5 A;  1AKH B;  1G2H A;  1RET A;  1N77 A;  4ZDO A;  2Y9Y A;  4EJO A;  4IVN A;  2E1N A;  4RAG A;  1BBY A;  4LFU A;  1OYY A;  1YLF A;  1VQP I;  3SDG A;  1TTY A;  3WGH A;  5LBQ A;  1ITY A;  2VXZ A;  1FMW A;  1WKM A;  1QZY A;  2HPM A;  2NNN A;  4LGW A;  4ZC3 A;  2HI3 A;  3Q3S A;  4XKV A;  3E3V A;  5F0H A;  3WU0 A;  1EF4 A;  4PJM A;  2ETH A;  4EAT A;  1SAN A;  2DPD A;  4P1W A;  1IO2 A;  4RGR A;  5JFR A;  4GRI A;  5L3D A;  1FP1 D;  1SFO J;  3IRQ A;  4WXH A;  5LHH A;  4BGD A;  4M3F A;  2M0M A;  2L54 A;  2UZK A;  3LST A;  5ILV A;  2IGM A;  3PL8 A;  2O61 A;  3E6C C;  1I39 A;  1T0F C;  4FIS A;  1R58 A;  4XLC A;  4A6E A;  3HUG B;  1HST A;  3K4B A;  1MBE A;  2E1O A;  5FD5 A;  5EDN A;  4M9S A;  2H94 A;  4HOB A;  3MN2 A;  1BW6 A;  4GYI A;  2DK8 A;  1SMT A;  1JKP C;  2WAF A;  2OPT A;  2IS2 A;  1O3Q A;  1LFP A;  2HPI A;  2KFD A;  3V8K A;  2QUF A;  1S3J A;  2WC2 A;  4ZDP A;  1LFU P;  4MNU A;  1UAA A;  4C2U A;  5KVR A;  3SDB A;  3JTG A;  3K6G A;  5EF6 A;  1HKT A;  4BDZ A;  2M9H A;  4HZF A;  1ZR4 A;  5C4X J;  1FSH A;  5AIQ A;  2KKO A;  1OMI A;  1UEL B;  2CGP A;  3HPG A;  4BEH A;  2M0C A;  3GFM A;  4MQV A;  1H9G A;  3OR2 C;  1GUU A;  1J75 A;  3SXY A;  2FQ3 A;  5TGT A;  4QIW N;  2RGV A;  3DEU A;  3J81 K;  3ZCO A;  2COM A;  2F5V A;  3GFJ A;  3HSR A;  4H4K C;  1FNN A;  3PJR A;  1AU7 A;  4I99 C;  4CGZ A;  2K02 A;  1SAU A;  2ZFU A;  3L9F A;  4FTH A;  3CES A;  4L9V A;  2CUF A;  3HBL A;  3RDI A;  3S2D J;  4MHG A;  1P92 A;  3ISP A;  5FFZ A;  3M8E A;  4ENN A;  3CUO A;  1SVM A;  3KP3 A;  3H0D A;  2NXN B;  1S7O A;  2IXS A;  4WXD A;  2IS1 A;  2E1M C;  3BQZ A;  2DYS H;  2HYJ A;  4LMY A;  2BE5 F;  4AYB A;  5D4S A;  5FD6 A;  3S93 A;  1PYV A;  4KMU X;  4I2O A;  2LKS A;  2VKD A;  2R5Y A;  4HSR A;  5J8C A;  1F9N A;  4IKF A;  3I71 A;  4HNV A;  2IW5 A;  1VTN C;  5HNF A;  2HQN A;  3CJQ B;  1R1T A;  3EQL F;  3ZMT A;  1ETV A;  1UHM A;  5K5R A;  2L7F P;  1X19 A;  1YI2 I;  2M7A A;  1IRG A;  1JUS A;  3CO6 C;  3ASN H;  4PGH A;  1XB4 A;  2YSR A;  5JLX A;  3D0S A;  3ZMD A;  4BS9 A;  1FJL A;  2H27 A;  1J09 A;  3CJT B;  3R60 A;  2GLO A;  1QPM A;  3BRO A;  2STW A;  4UNO A;  2R7R A;  4G6Q A;  1XPX A;  1TT5 B;  2IA2 A;  2DTR A;  4BXU A;  1T56 A;  1QA6 A;  2QSH X;  4XOT A;  5KAI C;  1E3H A;  4D5C A;  3TBI A;  3IKV A;  2VQC A;  2D5V A;  3S1N J;  1YTY A;  3VYT B;  4XLN F;  3IC7 A;  2MC3 A;  3G3Z A;  1OYW A;  2HOT A;  4A3G J;  5J4Y A;  2XDV A;  5F04 A;  3MKL A;  1K4S A;  2HEO A;  5CVR A;  2PG4 A;  2GXA A;  2R4G A;  2HGC A;  1PUF B;  2JA6 J;  2HQR A;  3T0Y A;  2OCE A;  3F8M A;  3OYJ A;  4CCK A;  4CCJ A;  3CCV I;  2C6Y A;  1R9T J;  5LLQ A;  3R6S A;  4EJU A;  2DCE A;  2VKH A;  3S8P A;  3ZMV A;  3DBR B;  4AVZ A;  1ZTR A;  2DA1 A;  3JAM Z;  2EK5 A;  3H3Z A;  1L0O C;  3KYC B;  3LFU A;  2ZO4 A;  3K2Z A;  2VOD A;  3I4N J;  1HQC A;  3AL0 B;  3PQJ A;  4FQG A;  3QOE A;  2A68 F;  2R5Z A;  4KIS A;  2WB1 A;  4KN7 X;  2ELK A;  1XGN A;  1TNT A;  1BJA A;  5FLM J;  3RZO J;  3X2Q H;  4RLF A;  2EIM H;  1ZGJ A;  2X6W A;  3K9T A;  2OD5 A;  4GFB A;  3BTJ A;  3CTA A;  1TWH J;  2HNH A;  3KZI C;  3DKX A;  1X1A A;  4Q47 A;  3JTH A;  3ZXS A;  1K4T A;  4HQE A;  1ORK A;  2ME6 A;  1X1C A;  1VQN I;  2V9K A;  1P6R A;  2UV1 A;  1R71 A;  1P4W A;  4RDU A;  2H6B A;  1J2X A;  1SFU A;  4UVB A;  4LG0 A;  3WE3 A;  2R93 J;  4IRG A;  5TJJ A;  3F8B A;  2BVL A;  3ML6 A;  3A0B C;  3AG1 H;  5LD2 C;  4MLO A;  1B59 A;  3PFY A;  3BR2 A;  4JK1 X;  4S05 A;  4GGG A;  2KRH A;  5D4R A;  3ZMS A;  3BDD A;  1XSD A;  3K4L A;  2PJR A;  1HBX G;  1D1B A;  2DN0 A;  3DLA A;  1NK3 P;  2K40 A;  2FBK A;  1MMG A;  1WWX A;  2IVM A;  2YR2 A;  1SD7 A;  1FOW A;  2Y0M A;  4P55 A;  4JX6 A;  2P5V A;  2EFQ A;  1J59 A;  4MEY F;  1Z77 A;  3AKZ A;  1LE8 A;  3AFH A;  2CW7 A;  2P0W A;  4M3G A;  3KZY A;  5ILU A;  3WTX C;  2R7W A;  1ZAR A;  1HW1 A;  4ENK A;  4F52 A;  2KL4 A;  1POG A;  2JSP A;  2E2I J;  2Q0O A;  1Z6T A;  1XCB A;  3E97 A;  3CO7 C;  2WAQ A;  3LSK A;  4PFO A;  3G1O A;  4DIQ A;  4BE0 A;  4ASN A;  1R7J A;  2VON A;  1WJA A;  1X1B A;  5K7H A;  5D8L B;  5M3M J;  3EYI A;  5LEK A;  4KFC A;  3KET A;  1HDD C;  2NS7 A;  3VYS B;  1NTC A;  5F1R A;  3TDZ C;  3SQN A;  4ZJZ A;  2LKP A;  1OJL A;  1E0E A;  1QZE A;  3BT9 A;  1OQY A;  4Q48 A;  3MD2 A;  3GX4 X;  3EUK L;  1VND A;  4HX7 A;  3OL4 A;  4PSX A;  2L4M A;  4C3J J;  4V2G A;  3M7G A;  3K7A J;  2ZCW A;  4CCL A;  1ODD A;  3CCS I;  1GVD A;  3H9G A;  2LF8 A;  1K78 B;  2X4H A;  3I56 I;  1TQM A;  4XRM A;  1W7P A;  1FTT A;  2XSJ C;  1HKQ A;  3LOC A;  3Q0V A;  4DYQ A;  3V42 A;  2BEO A;  1DQU A;  2ZXH A;  3ABL H;  4O3M A;  3E6M A;  4Y7N J;  5BOX A;  1H88 C;  1GV2 A;  5DM7 F;  2NAZ A;  2Y30 A;  2LH9 A;  1X1P A;  3C3W A;  4A6D A;  2OC6 A;  5TIS C;  2QQ8 A;  3K10 A;  3K1P A;  1LEA A;  2PQ8 A;  4I01 A;  2ZXW H;  4O6J A;  1WI9 A;  4LJZ F;  1Y56 A;  5CQG A;  2ZJP F;  3OIO A;  2LTP A;  4KT5 C;  1WVR A;  2BGC A;  3P5J A;  2VT2 A;  3CCL I;  1Y8Q B;  5IYB J;  3JAM K;  4C2T A;  2F2E A;  1OCR H;  1I5Z A;  4HV6 A;  3JRF A;  4J00 A;  2ZME C;  3L09 A;  4NQW B;  2CUJ A;  2F4I A;  1TWA J;  4XL9 A;  4XKB A;  2JUC A;  3LSP A;  3GZ6 A;  1YRN A;  4UVC A;  4OMZ A;  3OS0 A;  3S15 J;  1O3T A;  1BL0 A;  5K5Q A;  2A6T A;  2UWM A;  4HF2 A;  3DPU A;  5D5X B;  2KMU A;  2VBW A;  3CCM I;  1DPR A;  4IPA A;  4PDK A;  2CV2 A;  5E3N A;  4BJ5 C;  1ETW A;  2L4A A;  2D2W A;  1X2M A;  4G6D A;  5F0F A;  1CF7 B;  4Q4Z F;  1QGP A;  3L1P A;  9ANT A;  2L0K A;  1S6L A;  2LBF B;  3VB2 A;  3J7Z I;  1WQ2 A;  3DKY A;  2LP0 A;  4DBQ A;  1A04 A;  1RES A;  1F1Z A;  2XRO A;  2A69 F;  4L5J A;  2O5R A;  5GP9 A;  2QQA A;  2XAU A;  4GXO A;  2ZJR F;  2DLL A;  2GOM A;  1U0J A;  1OFC X;  2Z99 A;  1Z1D A;  3BR0 A;  5D5W B;  2RVC A;  4L9J A;  3DBH B;  3DXJ F;  2FOK A;  2JN6 A;  4E7Z A;  3BP8 A;  5LGT A;  4L0Z B;  4I98 B;  2V26 A;  3S14 J;  2L7Z A;  2FRH A;  4D9J A;  2VAS A;  2A3S A;  5DDG A;  4KUM A;  1PVE A;  5BS6 A;  1FBQ A;  2RRE A;  3CCU I;  2ISZ A;  2UUZ A;  3DFG A;  4D7M A;  2F4O B;  2DMT A;  4KDP A;  4BUP A;  5L3E A;  4GYG A;  3O2P E;  1Z7U A;  3HRU A;  4BKX A;  4ANJ A;  4IQJ A;  3CDH A;  2BW3 B;  5M5Y J;  4G6T B;  4UUS A;  3GZN B;  4OAZ A;  2BY3 A;  5BPD A;  3CD6 I;  4D0P A;  4BE1 A;  4S0H B;  1YJW I;  3CDI A;  2XV4 S;  1XMK A;  3EUH A;  2QSF X;  1IAW A;  3FXM A;  1U8R A;  2R7X A;  4M3B A;  4KN4 X;  4WWC A;  1BOB A;  3O3K A;  1WJD A;  4Y15 A;  1O3S A;  1FPQ A;  5CJ9 A;  1S5L C;  4PUS A;  2QEX I;  3ZQG A;  2IEK A;  3GF2 A;  3WE2 A;  2J5P A;  2LD5 A;  3MZ8 A;  3DQV C;  4ZDL A;  5FJ8 J;  1BIA A;  3RSN A;  3H36 A;  3WOD F;  3K70 D;  3BJA A;  1WPK A;  1EKE A;  4CCM A;  1AHD P;  2HYF A;  2I10 A;  4CXF A;  2E7W A;  4ZYD A;  1G3W A;  4FAS D;  4M3D A;  3CJR B;  4YG2 F;  2XAF A;  1QNT A;  2H8R A;  2K4B A;  3BQY A;  5FO5 A;  4B48 A;  3PUF A;  1Z21 A;  2VQH A;  1IV8 A;  4RB3 C;  4BAC A;  4HST A;  2JT1 A;  1BW5 A;  3SFI A;  3M3Y J;  2L9R A;  1B4A A;  1MJ9 A;  2XSD C;  1DGR M;  2DMP A;  2ESH A;  3IKT A;  3VDX A;  3E6D A;  2DI3 A;  4AVP A;  3QP5 A;  5A2Q K;  1YO5 C;  2JPC A;  2LY9 A;  3OY9 A;  4WCG A;  1WSU A;  4FE7 A;  3TMO A;  4D7N A;  3JSO A;  3RQI A;  2VOO A;  1O7L A;  1MH4 A;  3RIR A;  1MH3 A;  3FKI J;  3TP3 A;  3I59 A;  3UNG C;  2M2E A;  2NRA C;  1G3Y A;  3H35 A;  3RPQ A;  3EET A;  3DU6 A;  3H5A A;  3PSI A;  4XON A;  1X1D A;  1DP3 A;  4M72 A;  4XR6 A;  2IGO A;  2LOO A;  2LK2 A;  4F91 B;  1J0R A;  3TED A;  3IH3 A;  3FHZ A;  2BOL A;  1D1C A;  2XAG A;  2Q2E A;  4CZC A;  3QOD A;  1IXR C; 
#chains in the Genus database with same CATH homology
 2EFN A;  4BHC A;  1L3L A;  2ACJ A;  2JPB A;  5JVT A;  4A5N A;  1UB9 A;  4ETS A;  1TNS A;  2GQQ A;  2F5D A;  1PDN C;  1B9M A;  1YYV A;  1QQI A;  3FXR A;  1GHC A;  1USS A;  1YFH A;  1ULY A;  5AON A;  4IF4 A;  5L3B A;  2EFW A;  3MWM A;  3CUQ B;  5ED4 A;  2E7X A;  2VC0 A;  2MH9 A;  5E8G A;  1EH7 A;  1FYL A;  3BJO A;  4ZYG A;  2XHK A;  2R7D A;  1FY7 A;  2A07 F;  5BQT A;  2OZ6 A;  3SHF A;  5LGU A;  5CVI A;  3TOA A;  2HDC A;  3MEX A;  3ERE D;  1ZGA A;  5E1Z B;  3WTV C;  5IT9 Z;  2Q8K A;  4RB0 A;  3GVA A;  2OU2 A;  1P4X A;  5LRR A;  4EM1 A;  4U7B A;  4Y13 A;  1RNL A;  4G7O F;  3LA3 A;  2VBY A;  1BI3 A;  3KLO A;  2OQR A;  2CG4 A;  2PEX A;  5LHI A;  2FNP A;  1ZHF A;  3ULQ B;  4N0B A;  4A0X A;  2QZ8 A;  5D6F A;  4UHT A;  1MJA A;  4ZYH A;  1FP2 A;  3TKY A;  1U5T C;  3CLO A;  1C0W A;  4LG0 B;  5L3C A;  1O3R A;  2MH2 A;  1DP7 P;  1TW3 A;  1E17 A;  3WTU C;  5DCM A;  3WGG A;  4LB6 B;  4ESF A;  4UV9 A;  2EV6 A;  3ELK A;  4HLY A;  4UVA A;  3WGI A;  3DPL C;  2DT5 A;  3TGN A;  4IXA A;  4CDG A;  1PP7 U;  3DV8 A;  3GXO A;  2VT3 A;  3BPX A;  2R3S A;  2NNY A;  3FXQ A;  3BWG A;  4H0E A;  1JGS A;  1U6G A;  2PLY A;  2W84 A;  2K4J A;  5JHU A;  1I6X A;  1ON2 A;  5D6E A;  3WTY C;  4OIP F;  5HLH A;  3GFI A;  1XSV A;  2XAQ A;  1RUN A;  1GXQ A;  3M9A A;  2OA4 A;  3U2R A;  3KEQ A;  1XN7 A;  2VBX A;  3QU3 A;  2G7U A;  3FM3 A;  4I0B A;  1I1G A;  3VFZ A;  2WTE A;  4A0Y A;  2P5K A;  4EGY A;  5L3G A;  4LK1 F;  1UCR A;  5IT9 K;  2P8T A;  4CZZ A;  3FZV A;  3ZPL A;  4IRH A;  1AOY A;  2PJP A;  1KU7 A;  4EGZ A;  4G94 A;  3FMQ A;  3VEP A;  2FMY A;  3OV8 A;  4RAY A;  3NQO A;  5E18 F;  3HSE A;  3F8C A;  1P4A A;  1T0F A;  4P96 A;  1J9I A;  1KGS A;  1R5H A;  2DO7 A;  5JI6 A;  3LA2 A;  5EEH A;  1BOA A;  5D8K B;  2EA4 A;  3C7J A;  3QOP A;  4HF0 A;  2YX7 A;  2A5Y B;  4Q5S F;  1XDS A;  4KIB A;  4KNY A;  1DDN A;  2MLG A;  4KIF A;  1ZG1 A;  2M30 A;  4M73 A;  3FX3 A;  2RQP A;  5FFX A;  2CFX A;  3KP2 A;  1ZH5 A;  4OIO F;  3B02 A;  5CVJ A;  3BZ6 A;  4O5V A;  2HKX A;  3ABT A;  2F5F A;  5F6F A;  1B6A A;  3FWE A;  2XAH A;  3LQR A;  3KLN A;  4ZH4 F;  4B09 A;  2P4W A;  4I02 A;  1HKS A;  2VOP A;  1XSX A;  4CO8 A;  1UST A;  3NEU A;  2FBI A;  2EFO A;  2BBY A;  2D1H A;  2KIM A;  3E5X A;  2FSW A;  4EMS A;  3ZQ7 A;  4G8X A;  1TW2 A;  3GWZ A;  5D5U B;  1G6N A;  2PMU A;  3F72 A;  1LDJ A;  5ICE A;  4JQF A;  2GIV A;  4MTD A;  3F22 A;  3V8L A;  2A6H F;  2P6S A;  4EJW A;  3N4M A;  3KE2 A;  2VE8 A;  4U0Y A;  1ZLK A;  5E1X A;  4M6Y A;  5HVQ C;  4TV7 A;  3I59 B;  3O6B B;  1ON1 A;  3L7W A;  4UV8 A;  2V1U A;  2GXB A;  1P2F A;  2V6C A;  3RKY A;  4RB2 C;  3V7S A;  2QBY A;  3PQK A;  2XIG A;  3H92 A;  3MCZ A;  1IN5 A;  3C1D A;  3LFK A;  2HTS A;  4ENJ A;  5HLG A;  3OOP A;  2L01 A;  3V8J A;  2O8X A;  4FX0 A;  4NB5 A;  2HS5 A;  4R79 A;  3J80 Z;  3MQ0 A;  1LVA A;  3VOE A;  3HUG A;  3LQQ A;  3V4G A;  3ECO A;  1OYI A;  3COA C;  2Y75 A;  5ICG A;  1MDM A;  1KQ9 A;  1J7K A;  1KA8 A;  5A2Q Z;  3JSP A;  2HZT A;  1OKR A;  4EJV A;  2RV8 A;  3F6O A;  4IRI A;  3WG9 A;  3K0L A;  3LAJ A;  2HWV A;  2DBB A;  3HOT A;  3QAH A;  2ZBK A;  4MEX F;  4KYW A;  5LGN A;  4YFX F;  1IZ1 A;  3W6J B;  4YFK F;  3ZMU A;  3ZP5 A;  3R61 A;  4A2U A;  2HTJ A;  2JRT A;  5J8F A;  2XAJ A;  3FF5 A;  2W25 A;  2L02 A;  4RGX A;  1IF1 A;  1ZRE A;  1TQP A;  1LDD A;  2KRF A;  4PGG A;  1I27 A;  1Z91 A;  2XVC A;  1G4D A;  5H20 A;  3TO7 A;  2XRN A;  1PP8 F;  4CYD A;  3QRF F;  2GA1 A;  3I54 A;  1RZ4 A;  2QQB A;  1KYZ A;  1FT9 A;  3I64 A;  5DCM B;  2ZJ2 A;  1LB2 A;  5DCF A;  2RNJ A;  4BQA A;  2PN6 A;  2O6G E;  4LK0 F;  4BHP A;  1YS7 A;  3HSF A;  4PCQ A;  2RN7 A;  1TQI A;  2ZXJ A;  2ZME A;  1NHA A;  2QVO A;  3F21 A;  4ESB A;  5BMZ A;  3GLX A;  4CIC A;  3I5U A;  4ESJ A;  3WTS C;  5HS8 A;  2O3F A;  1KU9 A;  3KP6 A;  4BHB A;  1E2X A;  4L5I A;  3HTS B;  5H6Q A;  4RGU A;  3D5L A;  1REP C;  1ZG3 A;  2Z5U A;  3EDP A;  3J80 K;  1UFM A;  3HTU A;  1JHF A;  1SMY F;  3K1M A;  1LJ9 A;  3M1E A;  2M8E A;  3MAJ A;  2JTV A;  5ICF A;  4U0V A;  5E20 A;  2QEN A;  4U7D A;  1FBS A;  4XLP F;  1Z9C A;  1D8J A;  3FM5 A;  1ZRC A;  4KMF A;  4AWX B;  3F23 A;  2WWY A;  1PUE E;  3RYR A;  4HA8 A;  3SZP A;  3BY6 A;  2QM3 A;  1MJB A;  2R7F A;  2GZW A;  1BI0 A;  3E5Q A;  2P7V B;  2PMH A;  2LF7 A;  5K1Y A;  3LAP A;  4A12 A;  1S7A A;  4M6X A;  4OIN F;  2YX4 A;  1LQ1 A;  3E6B A;  3TQN A;  1ONV A;  1SD4 A;  2HR3 A;  1W5S A;  1FX7 A;  2ZFW A;  3C18 A;  3IWF A;  1T38 A;  1XGS A;  5DYM A;  2J5O A;  1W7P D;  2IP2 A;  2IJL A;  3WU1 B;  2O0Y A;  4B8X A;  1K6O A;  2QYO A;  1O57 A;  2KJC A;  2M45 A;  1SD6 A;  2Z33 A;  1FWZ A;  1K78 A;  3P9C A;  2LNB A;  1FSE A;  1G3T A;  2TDX A;  4FX4 A;  2CW0 F;  5BPI A;  1B1B A;  2GAU A;  3RI4 A;  3RKX A;  2FEZ A;  3RTR A;  2STT A;  4BH9 A;  2JSC A;  2NYX A;  4I09 A;  3U9G A;  2MLK A;  4R1H A;  4M74 A;  4Z2Y A;  1JHH A;  2ISY A;  2BYV E;  4NQW A;  4MQ9 F;  2CO5 A;  3RKW A;  5LHG A;  4LLG F;  3T8R A;  2K7L A;  5FLX Z;  2QLZ A;  3BJ6 A;  5HOO A;  1I1S A;  1XD7 A;  4G7Z F;  3W6K B;  1UHW A;  1BI2 A;  1EV7 A;  4WF2 A;  4AIK A;  2UXN A;  4NHJ A;  1LNW A;  4ZZL A;  3KCC A;  3DP7 A;  1YW7 A;  4IHS A;  1R36 A;  4AIH A;  4L9N A;  3GUD A;  4L0Y B;  3K1N A;  1SAX A;  2DW4 A;  1BN5 A;  1YS6 A;  2YPR A;  2WV0 A;  2G9W A;  4HLX A;  4QWQ A;  4LB5 A;  2EA2 A;  2XAS A;  2FU4 A;  4FT8 A;  4F7Z A;  4HX8 A;  1ZRF A;  3HHG A;  4PZJ A;  2W85 A;  2M87 A;  1IXC A;  5JR3 A;  5DD4 A;  4A0Z A;  4XRF A;  4ZZD A;  2MA3 A;  1YW9 A;  3HRM A;  2QBY B;  3GZ5 A;  5K5O A;  1T98 A;  2RC4 A;  3SZT A;  4RAZ A;  3WTW C;  2ZNZ A;  5E17 F;  1D3Y A;  4AD9 A;  2A6E F;  3L00 A;  5L3F A;  1U5T A;  4WX9 A;  1ZAO A;  4L18 B;  4E70 A;  3J7A O;  5DEQ A;  1W7P B;  5HDN A;  1MDM B;  3CUQ C;  3GFL A;  2P6T A;  2F5C A;  5HLI A;  2IRF G;  2E1C A;  2L3D A;  2X0L A;  3T8T A;  3QP6 A;  1IUY A;  4M9X A;  3R4K A;  3MZY A;  4MGR A;  2CYY A;  2DU9 A;  4GCV A;  1GVJ A;  1BC8 C;  4HDU A;  2AXL A;  1R1V A;  1JE8 A;  2GXG A;  3G73 A;  3N97 A;  1STZ A;  5HS7 A;  2VC1 A;  5FLX K;  1MZB A;  1D5V A;  1IRF A;  1SFX A;  1MKM A;  3FXU A;  4S04 A;  1RIO H;  1TLH B;  2ADU A;  2DFI A;  4OMY A;  3CUQ A;  2YU3 A;  4EM2 A;  2NS0 A;  3AAF A;  2M1B A;  2V79 A;  1H9T A;  1WRJ A;  1ZLJ A;  5DV5 A;  5EEG A;  3RJP A;  3WTZ A;  2FF4 A;  1FC3 A;  4KA4 A;  2CWE A;  2RKH A;  2IPQ X;  4Y17 A;  1FLI A;  2EV0 A;  3TO6 A;  2ZME B;  3I4P A;  4IHT A;  4LD5 A;  3HOS A;  2OQG A;  4P9F A;  4ENM A;  2XKO A;  3IWZ A;  3NRV A;  3ZN0 A;  5CVV A;  1GXP A;  4HAM A;  2LSO A;  1U3E M;  1IN4 A;  2GWR A;  5CYV A;  3LWF A;  2JZY A;  1D8K A;  2CSO A;  3HHH A;  2FML A;  1Z6R A;  1KQ8 A;  4IJA A;  1XDU A;  5D5V B;  4RS8 A;  1IN6 A;  1R22 A;  2VBZ A;  3IRR A;  5FB2 A;  1R00 A;  2F5E A;  3ROU A;  1T39 A;  3GEZ A;  2D45 A;  3TDU C;  4K2E A;  1T2K A;  3WTT C;  4OU0 A;  2GA2 A;  5HDG A;  5ICC A;  4HYE A;  4HDV A;  4LLN A;  3KP5 A;  1XMA A;  4UXN A;  3RPU A;  3MZH A;  2DPU A;  2UXX A;  3BOQ A;  1SD5 A;  1W5T A;  1YG2 A;  4P9U A;  2P5L C;  4XSZ F;  3GO5 A;  1XGM A;  2HKO A;  2XUB A;  4HX4 A;  3SFZ A;  2PI0 A;  4WK8 F;  5HS9 A;  4RGS A;  3P9I A;  1R23 A;  3GYH X;  5KK1 A;  1S29 A;  1K7A A;  2D1V A;  4P5O A;  3T5X A;  3IHU A;  4R8H A;  5E1W A;  1K79 A;  2M5W A;  1S8N A;  1B9N A;  1TBX A;  4M9Z A;  3FMR A;  3I53 A;  4OOI A;  3EYY A;  4N9I A;  3TOB A;  2FNA A;  3I0T A;  5DD8 A;  2MBF A;  1DUX C;  3T1B A;  1RUO A;  4L9T A;  2V1X A;  3F8N A;  4I7H A;  1G3S A;  3QPT A;  1FZP B;  4I0A A;  1LEB A;  1F5T A;  2W24 A;  3GW2 A;  1DPU A;  3JW4 A;  2KIU A;  1BI1 A;  4G7H F;  1IN7 A;  1O7F A;  3M8F A;  5ERI A;  5AIP A;  2XGX A;  5TRD A;  2DAO A;  5ILS A;  3E5U A;  3ZN1 A;  4AIJ A;  4A5M A;  5DUI A;  1JXS A;  3K69 A;  2QQ9 A;  4OIR F;  2K27 A;  2QWW A;  3ABU A;  3DKW A;  3PFI A;  4EV0 A;  3V7C A;  1ZYR F;  4BYY A;  2ZKZ A;  4HV5 A;  1KU3 A;  3Q5F A;  2P7C B;  5HDK A;  2FBH A;  2MD5 A;  3P7N A;  1QO0 D;  3L2C A;  2IA1 A;  3KP7 A;  1EH8 A;  1KU2 A;  1FYK A;  3F8F A;  1HW2 A;  3QU6 A;  3FMS A;  2G7H A;  1SFE A;  1R5G A;  2B0L A;  3CJN A;  2IT0 A;  2XKP A;  2W57 A;  1U2W A;  1YQA A;  3R0J A;  2PFB A;  4HW0 A;  2Y48 A;  3TO9 A;  4YFN F;  4YII A;  1T6S A;  4KIC A;  4M71 A;  2H09 A;  3KEO A;  4HQM A;  5H6R A;  2IA0 A;  1U5T B;  1FYM A;  2CQK A;  3Q9V A;  5CVU A;  4OIQ F;  3HRS A;  1Z05 A;  2KIF A;  4JBA A;  4DQ2 A;  2HFH A;  3S2W A;  4XBF A;  4EQQ A;  1KQ0 A;  3DF8 A;  1F4K A;  3P9K A;  1R1U A;  1KYW A;  3KFW X;  2OBP A;  4DNC A;  1BIB A;  4KIG A;  2BV6 A;  3FHZ A;  1FBU A;  1W4M A;  2FE3 A;  3HYI A;  2VN2 A;  2VE9 A;  3B73 A;  2ELH A;  2RDP A;  1U78 A;  1J5Y A;  3HRT A;  4QLC U;  3VOD A;  5LEJ A;  1QBJ A;  4FHT A;  2HOE A;  3REO A;  4XSX F;  3F3X A;  4U88 A;  2H6C A;  2EWN A;  1XCV A;  3R0A A;  2PBI A;  4MTE A;  5F64 A;  3BPV A;  1MD0 A;  3RYP A;  5LRS A;  1OR7 A;  1V3F A;  4U0W A;  1H0M A;  1CGP A;  5E8I A;  4EJT A;  2ESN A;  2FA5 A;  3U1D A;  1BM9 A;  5FGM A;  4BAY A;  1ZG5 A;  3MFK A;  1LDK B;  5J6X A;  2O03 A;  3DPT A;  3ECH A;  3ZMZ A;  1HSJ A;  1X3U A;  2ZNY A;  4RB1 A;  1QZZ A;  4ZYE A;  3KZZ A;  4YIF A;  1HXD A;  3F6V A;  3J81 Z;  4CHU A;  1XGO A;  2A61 A;  3LA7 A;  1ZN2 A;  4N9H A;  1FOK A;  1Y0U A;  2OAZ A;  1MGT A;  4G9Y A;  3HIF A;  2V9V A;  2LDU A;  4GO1 A;  3H3U A;  2DQR A;  4EM0 B;  1OPC A;  1HW5 A;  3IL2 A;  4UUV A;  4LLL A;  3Q9S A;  5IT3 A;  4HF1 A;  2DK5 A;  1V4R A;  1Q1H A;  4HBL A;  1YW8 A;  1CF7 A;  4WXC A;  2HYG D;  2FXA A;  1ZRD A;  1RI7 A;  4EVI A;  5CLS A;  4ON0 A;  2AS5 F;  1IN8 A;  1BC7 C;  2Z9O A;  3KP4 A;  4BNC A;  3QPH A;  5DUK A;  2Z3Y A;  2OZU A;  3V7R A;  1EH6 A;  3I58 A;  2K86 A;  1IXS B;  2EJR A;  2EB7 A;  2EFP A;  1IW7 F;  1AWC A;  6PAX A;  2V1D A;  2DQL A;  1YIO A;  2KJB A;  2EV5 A;  4EJO A;  4IVN A;  2E1N A;  1BBY A;  4LFU A;  1OYY A;  1YLF A;  1TTY A;  3WGH A;  5LBQ A;  2VXZ A;  1QZY A;  1WKM A;  2NNN A;  4LGW A;  3E3V A;  3WU0 A;  2ETH A;  2DPD A;  5JFR A;  4RGR A;  5L3D A;  1FP1 D;  3IRQ A;  4WXH A;  5LHH A;  2L54 A;  2UZK A;  3LST A;  5ILV A;  2O61 A;  3E6C C;  1R58 A;  4A6E A;  1HST A;  5FD5 A;  4M9S A;  2H94 A;  4HOB A;  4GYI A;  2DK8 A;  1SMT A;  1O3Q A;  3V8K A;  2QUF A;  1S3J A;  2WC2 A;  4MNU A;  5KVR A;  3JTG A;  1HKT A;  4HZF A;  1FSH A;  5AIQ A;  2KKO A;  1OMI A;  2CGP A;  4MQV A;  3GFM A;  1H9G A;  1J75 A;  3SXY A;  2FQ3 A;  2RGV A;  3DEU A;  3J81 K;  2COM A;  3GFJ A;  3HSR A;  1FNN A;  4CGZ A;  2K02 A;  3L9F A;  4L9V A;  3RDI A;  4MHG A;  1P92 A;  3ISP A;  5FFZ A;  3M8E A;  4ENN A;  3CUO A;  3KP3 A;  1S7O A;  4WXD A;  4LMY A;  2BE5 F;  5D4S A;  5FD6 A;  4KMU X;  4I2O A;  5J8C A;  1F9N A;  3I71 A;  1VTN C;  2IW5 A;  2HQN A;  1R1T A;  3EQL F;  3ZMT A;  1UHM A;  5K5R A;  1IRG A;  3CO6 C;  4PGH A;  1XB4 A;  2YSR A;  3ZMD A;  3D0S A;  2H27 A;  3R60 A;  1QPM A;  3BRO A;  2STW A;  4UNO A;  4G6Q A;  2IA2 A;  2DTR A;  4BXU A;  3IKV A;  1YTY A;  4XLN F;  3IC7 A;  2MC3 A;  3G3Z A;  1OYW A;  2HEO A;  5CVR A;  2PG4 A;  2HGC A;  2HQR A;  3T0Y A;  3F8M A;  2C6Y A;  5LLQ A;  3R6S A;  4EJU A;  3ZMV A;  3JAM Z;  2EK5 A;  3H3Z A;  1L0O C;  2ZO4 A;  3K2Z A;  2VOD A;  1HQC A;  3PQJ A;  2A68 F;  4KN7 X;  1XGN A;  1TNT A;  1BJA A;  1ZGJ A;  3K9T A;  2OD5 A;  3CTA A;  4Q47 A;  3JTH A;  4HQE A;  1P6R A;  1P4W A;  2H6B A;  1J2X A;  1SFU A;  4UVB A;  4LG0 A;  3WE3 A;  4IRG A;  5TJJ A;  3F8B A;  3ML6 A;  1B59 A;  4JK1 X;  4S05 A;  4GGG A;  5D4R A;  3ZMS A;  3BDD A;  1XSD A;  1HBX G;  2FBK A;  1WWX A;  2IVM A;  2YR2 A;  1SD7 A;  2Y0M A;  4P55 A;  2P5V A;  2EFQ A;  1J59 A;  4MEY F;  3KZY A;  5ILU A;  3WTX C;  1ZAR A;  1HW1 A;  4ENK A;  2Q0O A;  1Z6T A;  1XCB A;  3E97 A;  3CO7 C;  4ASN A;  1R7J A;  2VON A;  5D8L B;  3EYI A;  5LEK A;  4KFC A;  3KET A;  5F1R A;  3TDZ C;  3SQN A;  2LKP A;  4Q48 A;  3GX4 X;  4HX7 A;  2L4M A;  3M7G A;  2ZCW A;  1ODD A;  2LF8 A;  1K78 B;  2X4H A;  1TQM A;  1W7P A;  1HKQ A;  2BEO A;  4O3M A;  3E6M A;  5BOX A;  2NAZ A;  3C3W A;  4A6D A;  3K1P A;  1LEA A;  2PQ8 A;  4I01 A;  4O6J A;  1WI9 A;  4LJZ F;  4KT5 C;  2BGC A;  2VT2 A;  3JAM K;  2F2E A;  1I5Z A;  4HV6 A;  3L09 A;  3GZ6 A;  4UVC A;  4OMZ A;  1O3T A;  5K5Q A;  2UWM A;  4HF2 A;  5D5X B;  2VBW A;  1DPR A;  4IPA A;  4PDK A;  2L4A A;  2D2W A;  4G6D A;  1CF7 B;  4Q4Z F;  1QGP A;  1S6L A;  3VB2 A;  1WQ2 A;  1A04 A;  1F1Z A;  2XRO A;  2A69 F;  4L5J A;  2QQA A;  4GXO A;  2DLL A;  2Z99 A;  1Z1D A;  5D5W B;  2RVC A;  4L9J A;  3DXJ F;  2FOK A;  3BP8 A;  5LGT A;  4L0Z B;  4I98 B;  2FRH A;  2A3S A;  5DDG A;  4KUM A;  5BS6 A;  1FBQ A;  2ISZ A;  3DFG A;  4KDP A;  5L3E A;  4GYG A;  3O2P E;  1Z7U A;  3HRU A;  3CDH A;  5BPD A;  4D0P A;  2XV4 S;  1XMK A;  3EUH A;  1IAW A;  1U8R A;  4KN4 X;  4WWC A;  3O3K A;  4Y15 A;  1O3S A;  1FPQ A;  5CJ9 A;  3GF2 A;  3WE2 A;  2J5P A;  3DQV C;  1BIA A;  3WOD F;  3BJA A;  2HYF A;  4CXF A;  2E7W A;  4ZYD A;  1G3W A;  4YG2 F;  2XAF A;  1QNT A;  2K4B A;  5FO5 A;  4RB3 C;  2JT1 A;  1B4A A;  1MJ9 A;  2ESH A;  3IKT A;  3E6D A;  2DI3 A;  4AVP A;  3QP5 A;  5A2Q K;  1YO5 C;  2JPC A;  4WCG A;  1WSU A;  3JSO A;  2VOO A;  1O7L A;  3RIR A;  3I59 A;  2NRA C;  1G3Y A;  3RPQ A;  3EET A;  4M72 A;  1J0R A;  2XAG A;  2Q2E A;  1IXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...