2LC2A

Solution structure of the rxlr effector p. capsici avr3a4
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GSSGSSGNVDSNQNKASMLQARLNDEAGGTRLLRVHHESDTEERGFLEKAAVKKMAKAIMADPNKADEVYKKWADKGYTLTQMSNFLKSKTAGKYDRVYNGYVIHLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVR3a4
publication title A PIP-binding interface in the oomycete RXLR effector AVR3A is required for its accumulation in host cells to modulate plant immunity
rcsb
source organism Phytophthora capsici
molecule tags Protein binding
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16810 RXLR RXLR phytopathogen effector protein, Avirulence activity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lc2A01
3ZGKA 3ZR8X 2LC2A
chains in the Genus database with same CATH superfamily
1XGSA 2KIFA 3BQYA 4D7NA 2O0YA 1EJ9A 5F04A 4IHXA 3O3KA 2VONA 3F0CA 2A5WA 5LHIA 2P6TA 2ZXWH 2OJED 3F9KA 1Z77A 1SD7A 2DYRH 5KAIC 3L1PA 2LYCA 3BJAA 2LBFA 3EETA 4IOAF 2V4JC 2ZSIB 2QQ9A 4OIRF 1CF7A 3FXJA 3MZYA 3OS2A 4G94A 3PJRA 2DN0A 3HZJA 5C44J 3WGGA 4EMSA 3WTSC 3K1MA 4HOBA 4NQWB 5JVGF 2NYXA 2DXIA 3AAFA 4RM3A 1TLHB 2CQ7A 2MD5A 2JA2A 5IPAA 2A07F 4YRVA 3UKGA 3CJNA 3BJ6A 2RDPA 4ESFA 2BYVE 2VT3A 3GXOA 3K70C 3F6VA 2E1MB 3ABLH 1V5EA 2K85A 2PMHA 2IEKA 2XUBA 4WXHA 3GWZA 1I39A 2ZB9A 4AIKA 2ELKA 1MZBA 2F4IA 3R0AA 2JUCA 2K7LA 4G6QA 3ZQIA 4D5FA 1OCTC 4I01A 2IS4A 4Y33A 3O6BB 3H5AA 4CCOA 3FX3A 3KPHA 3WTZA 4ASNA 4A6EA 2E2HJ 1FYLA 4MTEA 2UXNA 1NTCA 3KE2A 2Y9ZA 3GTMJ 1T8IA 5FFXA 1H89C 4M3FA 4NC7A 1DQUA 3ELKA 4O3MA 4LG3A 5CVIA 3W6VA 1E3HA 1HF0A 2EIMH 3GVAA 1TT5B 1PUFA 3QRFF 2V6EA 4G7HF 3FM3A 3KP5A 3K4NA 4U0VA 4RBOA 1QA6A 3S3NA 4EJTA 3K7AJ 4UV9A 2YSRA 1BBYA 1GXQA 2FX0A 2VQHA 2HS5A 4HYEA 4AM3A 2BVMA 4BBSJ 1ZGAA 1XS9A 2HI3A 3VYSB 1R71A 3KEOA 5FROA 3IC7A 3W2WA 3K2AA 3GTOJ 1X3UA 2RQPA 2VBYA 3S93A 5LEJA 1TL8A 3CUQB 4EJUA 3RTRA 4X1EA 3RCOA 4XRMA 1D3YA 2HPIA 2JWTA 3RIRA 3P9KA 2M4KA 1GVJA 2DJNA 3ASNH 3I4PA 1EV7A 1M1EB 4LIVA 2ETHA 1HCRA 4L9NA 3FXQA 5KNLA 1Z05A 3HB9A 3CMAI 3D0SA 1QZEA 1WH7A 4MQ9F 2YX7A 2DA1A 3ECHA 3H5NA 4IRGA 2ZNYA 1YITI 3U1DA 3CF5F 2A05A 3JSPA 5BNGA 1NG7A 3ZGKA 4XKBA 1YIJI 1ZGJA 1R9TJ 5JFRA 3ZQHA 4KISA 1QU3A 4IPAA 2Y75A 3QP5A 3S2HJ 4C2UA 4K2EA 3K1PA 3M07A 3TP0A 1F4KA 1BOBA 2LP0A 2R7OA 2NS7A 5B1BH 2MYSA 3KP6A 5FB2A 1F36A 1WHUA 1SFUA 5A2QZ 4DYCA 4IKFA 1RKWA 1MJBA 2NNYA 4PJLA 4Z6YA 4UVAA 4S05A 1W5CC 1ZK8A 2CH0A 1BI1A 2BY0A 2RAEA 4O5VA 4Y3OA 5E1XA 3ZRGA 3JR9A 1B59A 2HOEA 2J5OA 1O3RA 1MW7A 2HDWA 1K6OA 1H9TA 3H3ZA 4RGSA 5HNFA 2E71A 3FHNA 2L3DA 2JVGA 3WE3A 4W97A 3H92A 3HOUJ 1WKMA 1B72A 2QBYB 2ZJRF 5J40A 3CO6C 1WFXA 3FMRA 3FK6A 1ZTRA 3P5JA 5GAEJ 2JSCA 5K1YA 3HIFA 2ZKZA 3P9IA 2XAHA 4U0YA 2QWWA 2EV5A 3WG9A 1TWCJ 2WAEA 4RAGA 1FLIA 3W3CA 4PFOA 2WV1A 3RYRA 2BBYA 3M4OJ 4V2GA 3GFIA 2ZJ2A 1V3FA 2L0KA 3LA2A 2X6YA 5D5UB 5EG0A 1N75A 3PFIA 1GVDA 4ZYAA 3ERMA 2R3SA 1P6RA 2ISYA 3S16J 3B02A 4Y13A 3QAHA 1I1GA 1I27A 1ZHFA 3CP2A 4M6YA 2R7SA 3K1NA 5FKLA 3T8RA 1G8XA 3ZQLA 1ETOA 2KP6A 3FKJA 2P5KA 1R1UA 3K10A 1HA8A 4V2FA 2BOLA 4II2A 4XRSG 5KCMA 4L0YB 3CMEI 1W4MA 1QBJA 2NRAC 3EPZA 5B5EC 2ELHA 2HDCA 1MBGA 3IH3A 3K4LA 4KN7X 4AC0A 2LSOA 3U1KA 3HRSA 1ZQ3P 4KYWA 5J1RA 3M1CA 2MA3A 2R4GA 1DP7P 1FBQA 3IKTA 4HDVA 1T08B 1U9OA 1I6XA 2NS8A 5DCMA 2NNNA 4P55A 1IUFA 1XDUA 1Y1WJ 4KNYA 1QRYA 2LY2A 1RKTA 1P92A 2X6XA 3WU0A 3SQNA 4B1RA 4OOIA 3SZTA 4ESBA 1WPKA 3GTPJ 3CCMI 3BR0A 4XNFA 4LFUA 3K69A 2DJIA 2UUZA 4D9JA 2MLKA 4PJ0C 3L09A 3A0BC 4BHCA 4HSRA 2VLAA 2AS5F 3KYDB 4XLEA 2KRFA 2EFQA 2STWA 3CCQI 1XGMA 1ZR4A 5JLWA 3I3LA 2P4WA 4L0ZB 5J47A 1ENHA 5IOZA 2HQNA 3EUHC 1SEUA 2EV6A 2VOOA 1P7JA 1X2MA 1XMAA 3CO7C 1SC7A 3K4BA 3KP4A 3TW7A 1T95A 1JTXA 1UFMA 2HOTA 3IWZA 4XR6A 2PEXA 3FWEA 3T0YA 4KT6A 5F0FA 3A0HC 2VC0A 3VODA 3BTIA 1IDYA 3IP4B 1ON1A 1R4NB 4YEJA 3J7YJ 2K9SA 2W85A 2ADUA 3E0JB 1G3WA 3LSJA 1TW3A 1RIOH 3I53A 3ZMDA 4BY1J 2XASA 1QO0D 3HSRA 3BG5A 5GAGJ 2FOKA 3FHZA 3AG1H 4BEHA 2ZMEC 1SVOA 5HLHA 3OL3A 3OL4A 3G2BA 5EGOA 2IPQX 3DPTA 5FLVA 5FKKA 2DTZA 3GX4X 3PNTA 3TP3A 1J75A 1S3JA 2H8RA 3ISPA 1YW9A 3BZCA 1S7OA 3J7AO 3AL0C 2XGEA 3GEZA 1U6GA 2EZKA 3JTGA 2GXBA 2XAUA 1Z21A 3KYLA 2IS1A 4IHTA 4A5MA 3T8TA 3FM5A 2X48A 1Z1DA 2PN6A 3QQAA 3WE2A 2MSYA 5F27A 4I7HA 3H0DA 2JA6J 1X3WB 4YFKF 5ILSA 5IYCJ 1U2WA 2Y0MA 3JRDA 1JXSA 1O3TA 2V9PA 1J2XA 2LH9A 5DS9A 2AQFA 1OPCA 4R79A 3CC4I 1BW6A 2DOEA 3A01B 4I0BA 2V1UA 2VIXA 3GMEA 3AG3H 2Y48A 3WTTC 1DPRA 4LLGF 2KQRA 1SFKA 1YJWI 5LRSA 4HV5A 4BHPA 2MW8A 2Z99A 1XG1A 1Z9CA 2JPBA 3EYYA 1KYWA 2FMYA 2A6EF 2CGPA 2DA3A 2G7HA 1BI3A 1XSXA 5K5QA 2H1LA 3F8CA 1T98A 1X1BA 2BW3B 2O8KA 3PM1A 2ESHA 4IRHA 5CVVA 4BQNA 3CCLI 3I0TA 2QSFX 2FBIA 3TO7A 1TWGJ 1LVKA 3FZVA 5DD4A 5DYMA 2XSDC 1H8AC 4U7DA 2F5FA 4U88A 2M1BA 1YTYA 2GBYA 2EZHA 2Y31A 5EEAA 2OBPA 5FLXK 5C3EJ 4F55A 4DOZA 1U8RA 4MLOA 4BDZA 2EZLA 4XLAA 1W7PD 2VC1A 4C3HJ 3I5UA 4XL9A 1K4SA 2F4OB 2L02A 2H94A 2E19A 3RDIA 2I8DA 4BDYA 4NB5A 2Y9YA 5HS9A 3EDPA 5GTHC 1BI0A 2O61A 4A0ZA 3IHUA 4CYCB 3I4NJ 4DJAA 4RLQA 1ZG3A 4IF4A 3OYJA 1UHWA 3FXRA 4XLPF 1B8IA 4I6ZA 1R1VA 4HF1A 4E7ZA 3DTKA 2E35A 2BY3A 2LKSA 2XGXA 1D1CA 4WCGA 5FRMA 3PL8A 2KJCA 1YRNA 3OYMA 2JZYA 3GLXA 4I09A 3CDIA 1IN8A 4XMYA 2DFHA 4ZH4F 4BJ5C 3OYFA 2GWRA 3BJOA 2YR2A 5CKTA 1WJDA 4B3AA 1IJWC 5ICGA 2XIGA 5DUIA 2BZTA 5ICEA 4KA4A 1VQNI 3S1QJ 3HYIA 2COMA 1ZELA 3D5SC 1A36A 2HQAA 1ZH5A 3FXKA 4AWXB 1ITYA 4BQAA 1ZYRF 2DMTA 4KDPA 3CCEI 1K7AA 2HTJA 3CUQA 3ECOA 4E4HA 1IXRC 2K9QA 1SANA 3L7WA 4Y17A 3ULQB 4AUXA 4QWQA 2CV0A 2AO9A 3HBLA 4HX7A 1VQ6I 3T1BA 1RESA 2W1OA 1KGSA 3H3UA 3CCYA 4IEJA 4A3GJ 1ERDA 5H20A 4IQ4A 2Z3YA 1X4PA 4M3GA 1EF4A 4HLYA 2STTA 2R92J 2BHYA 3CMMA 4M74A 2M5WA 3BR6A 1OYIA 1T0FC 3SJMA 4B3XA 2X85A 2DOAA 2KRCA 2CW0F 1SD6A 4KIGA 5IOYA 3ABKH 4ENNA 1ZGWA 4L5JA 1Y0UA 5F64A 1YHQI 1K79A 1YYVA 3ERED 1JUSA 1E0EA 4EGZA 2F5DA 1S8NA 4BS9A 3HHHA 4A3MJ 1HXDA 3DTIA 3OYDA 2H09A 2OU2A 1P2FA 3HRUA 3WHCA 1BR2A 2LY9A 2X51A 2QQ8A 1QGPA 3EYIA 2CV1A 2LK2A 2Q2EB 3LA3A 2VXZA 1A31A 2EB7A 2ZXJA 1BC7C 3BCBA 5FLMJ 4FE4A 2PMZA 3C2BA 1J5YA 1OCRH 2KISA 3Q0VA 4PJJA 1Z7LA 1DDNA 2OTJI 2R7RA 2ZNZA 3SZGA 1BA5A 5FRNA 3W2VA 1DGRM 2JQ7A 4XONA 2TRTA 3BR1A 3DU5A 3OYIA 1SD5A 2HXIA 4ON0A 1KU7A 3GFMA 5E8GA 2E1NA 2E2IJ 2HOAA 4F91B 1VQ5I 1IN7A 2XPUA 2R5YB 2R7FA 3CESA 4AYBA 1QVTA 4PGGA 5BOXA 3M7GA 3ZN1A 3BTCA 2IGNA 2ECCA 2HYJA 3FXLA 2CUZA 2JN6A 1VQPI 2F4MB 3GW2A 2VASA 5KVRA 4AIJA 1MGTA 3GTGJ 5LGTA 2V9KA 2HVQA 4ZTJA 1MBFA 4L5EA 2VJIA 1R6RA 1T38A 3BLYA 4EATA 3OYBA 1VQLI 2R7TA 3TO9A 2NXNB 1ZN2A 2ZFUA 3U9GA 2CW7A 2K5CA 2PMZN 2CQQA 2VQCA 4U0WA 2KDZA 2R0QC 1MMNA 3O2PE 4G8XA 3LSGA 4G7OF 2Z16A 5E79C 5K5RA 2Y0SA 1FT9A 4FE7A 3GTKJ 4MO7A 4KMUX 2FJ1A 2G7UA 4Q4ZF 4TV7A 2Q1ZB 1V4RA 3QP6A 3J7ZI 3QYEA 2IP2A 4WX9A 2MH9A 2VQGA 4HW0A 4A3FJ 3WTVC 3H9JA 2OQGA 1MSFC 4E7IA 3JRFA 5H2FC 4HNTA 1A5JA 3CCSI 5DUKA 1YX3A 3DU6A 3NARA 4ENJA 3H36A 3J80Z 2DCEA 2HWVA 1OJLA 2HFHA 1U5TA 4MGRA 3BZKA 2VJ5A 3V42A 2MFZA 4KFCA 3NWSA 2FNAA 1MBHA 3KEYA 1JGSA 1N25A 2CFXA 3HPGA 3QPTA 3CMYA 4EM0B 2CG4A 5IY5H 2W7NA 5J3LA 1R49A 2M7BA 1JI8A 1KA8A 4AIHA 3R0JA 3J81Z 1S6LA 4JX4A 5E8IA 2BHZA 2OQRA 1OCZH 1R5HA 5GAHJ 2GXAA 3GFLA 1XB4A 1N77A 3KP2A 1S72I 1BR1A 2LF7A 4UY8I 5EZGA 2EILH 2FEZA 2VT2A 3FKIJ 2Y0SN 3QYBA 4LMYA 4UXNA 3GTJJ 1A35A 4HLXA 4Q5SF 3OYHA 3E3VA 3LAJA 5KAFC 1UELB 1BJZA 5JVTA 4PUSA 2DPDA 1R23A 5IT9Z 1XGOA 2FU4A 5KK1A 5JR3A 4XN0A 1YI2I 3TDZC 3KLNA 1HDDC 3H9QA 4ZJZA 4OMZA 2VJ4A 2EIKH 1J09A 2RQQA 2CJJA 3LQQA 1A6IA 5E3LA 3GZ6A 2HQRA 1IN5A 2OF7A 3L2UA 1VQ4I 2CRGA 3IV5A 1ZG1A 1R1TA 1S7AA 1BM9A 5L3CA 3MN2A 2XAGA 2AXTC 3HJEA 2XB0X 3LNQA 4HAMA 5FJ8J 2NVTJ 2X6OA 4UUTA 4ZZDA 2A6HF 2JRMA 4DYRA 1FYMA 4GFBA 3WGHA 1JUMA 1X1DA 4BU2A 1LE8B 5LEKA 3BROA 3QU6A 5JHFA 4BH9A 4A3BJ 1MH3A 3A03A 2W82A 3DV8A 1PJRA 3QWLA 3Q0UA 1G3TA 4ZDPA 5HDKA 1OCCH 3CJTB 3FXOA 1TC3C 1XTAA 2L9NA 2EFNA 3HTSB 2EIJH 4F3QA 1IUYA 4MFEA 1HC8A 5J4VA 1IC8A 3V7RA 5CQEA 3C7JA 1VQ8I 5IP7J 2X1DA 2IS2A 1TWHJ 4BXXJ 4UUSB 2DYSH 5ED4A 2R5ZA 5CJ9A 4DBRA 3E1SA 3VWBA 3QPHA 4A12A 1TBXA 4EGYA 1J0RA 1YX5A 1I3AA 1EH6A 2AHQA 4C2TA 2HOSA 3KLOA 4F7ZA 3CCUI 4FHTA 2WC2A 1R58A 1WI9A 3H3VK 5J1UA 1VQ9I 3I64A 3CJQB 1D8KA 2E1OA 4ITVA 1FJLA 2Y2ZA 1W36D 3Q9SA 4YIFA 5B3SH 1WJAA 3VYTB 1FBSA 2RC4A 4PJNA 1BC8C 2MABA 2H6BA 2K9LA 4HF2A 3MZHA 4KIFA 4UHTA 4XN3A 2VODA 5K7ZA 2B63J 2L5QA 4LLLA 2LD5A 2K3PA 3RZDJ 1JHHA 1IRZA 3DF8A 2L01A 3HC7A 4XOPA 2KPMA 3C3WA 1S5LC 2QLZA 5FO5A 3VB2A 1R00A 2JT1A 4P5OA 1Q1HA 2FSWA 5DTDA 1X4OA 4ZDLA 1GXPA 4FETA 1RRJA 1UCRA 1O3QA 2DQLA 3LSIA 3HKZA 3TBIA 1W1WE 5BMZA 2XKPA 1VQMI 2L7MP 3I58A 1AA7A 3GFJA 5TISC 4B43A 3ZQCA 1DP3A 1ON2A 2RKHA 4H4KC 1ZRCA 2DTRA 2Q0OA 2DMNA 2CS3A 3EUKL 4BL0B 2L4MA 2VXDA 3KP7A 2W57A 2V1DA 3GZNB 3REOA 1FYKA 4ZYEA 3UNGC 3I59B 1T56A 2V26A 2Y30A 1BIAA 4CZZA 5D4RA 1KU3A 4G6TB 5HDNA 1DU6A 4RGXA 3MD2A 3OYAA 2CQNA 2F6CA 3R4KA 2X1EA 2GA2A 5IP6A 4DBQA 1MDMA 1QPIA 5TRDA 2HTSA 3SFIA 1MBJA 2KMUA 4GYIA 1HDPA 1LJ9A 1XMXA 2MD0A 1V5FA 2BV6A 2RVCA 4CCMA 2GZWA 3HKZN 4KIBA 1MMDA 3ESWB 3BWGA 1QVUA 3BPXA 3S8PA 2M4GA 2P5LC 3OIQA 1HKTA 4YFXF 2YU9J 5DDGA 4N4OB 3MEXA 3Q3SA 1ONVA 3H9GA 4FASD 1JKPC 4I2OA 1T6SA 4M6VA 4A3JJ 1XC5A 2RNJA 1MMSA 5HODA 2DFEA 4HEA2 3HOTA 3L2CA 4U7BA 1O57A 1FNNA 1APLC 4J19A 3CF2A 2DK5A 3OOUA 1QZYA 1HLVA 2Z2SB 2HVRA 1S29A 2L54A 2DODA 2E5NA 5EF6A 1JE8A 2VKVA 5FKOA 1RI7A 4BUPA 1MBKA 1YJ9I 3I55I 5LFAA 4XRSA 2KLOA 4NNJA 3ZXSA 2M0CA 3OSGA 1BR4A 4AVZA 4F52A 4GYGA 4N4NB 2JK3A 3AKZA 1D5VA 4CCLA 4XSZF 5BPDA 2O6GE 1EKEA 5AIQA 3BG3A 4B09A 3VDXA 1N78A 1KU9A 2DA6A 2VI6A 2F5CA 4R1HA 1POGA 2DAOA 2VKDA 2MBFA 4IHYA 1WJFA 4V19K 4M73A 1Z3XA 1F5TA 4RS8A 2NOGA 1SAXA 2VBZA 3KEQA 3AFHA 1SFXA 3ZMVA 3D5LA 1D0XA 3LSTA 2WB1N 1OCOH 2HEOA 2EFOA 2WTEA 3JRCA 3G6EI 2JA8J 3DPLC 2BXYA 4E7SA 2PLYA 4B4CA 4BKXA 1XN7A 3IH2A 2W4SA 4GDFA 1Y8QB 4ZDOA 3H5RA 2Q2EA 2NVYJ 3DP7A 2L7FP 3M1EA 4IZZA 3RKYA 3RPUA 2HDDA 3HGGA 1S7EA 2A69F 5E3NA 5AIPA 2ZJPF 3BTJA 4HQMA 2W24A 1WGXA 1Y56A 4FT8A 1AOYA 1IZ1A 2OV7A 3P7NA 3G1OA 4HA8A 3HGYA 3O8HA 1Y6IA 2OC6A 1LFUP 3JAMK 3S2DJ 1XCVA 3B6AA 1SFOJ 3RKXA 4I0AA 5CVRA 2J5PA 2VBXA 1HKSA 3KFWX 3PIPF 3OYLA 2LF8A 2OTLI 4IL6C 3S3OA 4E7JA 1I1SA 2QSHX 1R5ID 5HVQC 2R7VA 4II3A 4IVNA 4X6AJ 3PUBA 4RAFA 3OSFA 1SD4A 5GPCA 3BR2A 3QPSA 3J7AY 3S15J 4QPOA 2FNPA 4WWCA 4S04A 1VFCA 4LG0B 2VUMJ 1VQ7I 3OIPA 4YFNF 2EFPA 2K9NA 2X9DA 5D5WB 3WGIA 4HPQA 1VI0A 4NC8A 3ZR8X 1OMIA 2Z33A 2OUMA 3SEZA 3OS1A 4LGWA 3MVPA 2NVUB 3TEDA 1K78A 1MNDA 4A3KJ 2JA5J 5M5XJ 1IXCA 2FD5A 2IBDA 2XRNA 4RDUA 1G3SA 5J6XA 2X4HA 4XLNF 4E7HA 5D5VB 2CYYA 2E60A 5ILVA 1R5GA 4PDKA 2M8EA 2RN7A 2L7KA 2XKOA 2B9SA 2XF6A 3PIOF 2QENA 3O8GA 1FP1D 1MKMA 1BL0A 4CH7A 3EQLF 2KIUA 5BS6A 3GTLJ 2VB6A 2WA0A 3NRVA 3CQZJ 2DDBA 5AONA 2WY7Q 3F8NA 4ETSA 4J01A 2V9VA 2M3AA 1LDKB 2O5RA 4EV0A 2E5ZA 3BP8A 3HOVJ 5M3MJ 2JVHA 4MIMA 2G9WA 2V79A 5CLSA 2CWEA 3C2HA 4F93B 4IQJA 3QOEA 3SDBA 4BACA 2K4JA 3L00A 3JRAA 1V55H 2PBIA 4DYQA 5L3DA 1MH4A 2HZDA 2M7AA 1QZZA 3CUQC 3OIOA 2ECBA 2QQAA 4OU0A 5LGNA 1JT6A 1IRGA 3RPQA 3S1MJ 3V7SA 1FIAA 4UVBA 1YS7A 4JQFA 3HRMA 1PUEE 3FIWA 1HW5A 1U0JA 2VPRA 1XPXA 1OR7A 1YS6A 1LEBA 4CSWA 5BPIA 1P7IA 2WAQN 1W0UA 3CD6I 3NAUA 1L0OC 1BN5A 1HSJA 2HU9A 5F0CA 2ME0A 5F1JA 4NQWA 3TOAA 3I54A 4ZYDA 1GV2A 4XLHA 2O9LA 3WODF 2YX4A 1IV6A 3HG9A 3S2WA 4AD9A 3MMYB 2M9HA 1Z67A 1IF1A 2VL8A 3PUFA 2CSOA 4JK1X 3I71A 1MNMC 1UHSA 4D0PA 3F22A 5FKNA 1FOWA 2IW5A 3FF5A 4PZJA 3MKYB 2GOMA 4ANJA 2EZIA 3L9FA 4I02A 2UZKA 1YJNI 4W1UA 1MSEC 3M3YJ 4GCVA 3VYRB 4MFDA 3E5QA 5EJCA 4IHWA 4U87A 5HDGA 2KL4A 1W36C 4OAZA 1YLFA 5FD5A 1LE8A 1JTYA 4RA2A 1P9QC 3F21A 2K9MA 1O4XA 3GF2A 4HQEA 4JX5A 2Q8KA 4CO8A 1RUNA 3M8FA 3CC2I 3LA7A 3FBNB 5D8KB 4YELA 2XRLA 2LREA 4AU7A 3MCZA 1YW8A 1AKHB 2JA7J 2CFOA 2KKOA 1B72B 2DK8A 2HQ5A 1D8JA 3BPVA 4I99C 4HNVA 2PJRB 3F8BA 5CVJA 2HZTA 1LVAA 1ULYA 2CUJA 1FMVA 4N0BA 1KU2A 3ZQQA 2WAFA 3VSLA 3OR1C 1VF9A 5ICCA 4M71A 3RPUD 5EZHA 1WJEA 3VSKA 3TO6A 3ABUA 3RQIA 2NVQJ 2JRTA 4LB6B 2IA2A 5FFZA 2M2EA 2D1VA 1WSUA 5GP9A 1XX5A 2DFIA 3K9TA 2R7ZJ 2KJBA 4FTHA 2XSJC 2A3SA 2JSPA 4LIUA 2R7UA 2P7VB 2IXSA 1QHGA 4PJMA 5FLXZ 2PI0A 1NHAA 3IH4A 1QNTA 2D5VA 5EG0B 2HVSA 2B0LA 3ZPLA 1RPWA 3Q9VA 2I5UA 4RM2A 4BE1A 2KHMA 2VE8A 1ACIA 4CCKA 1W7PB 3R61A 3E6CC 3PO2J 2K86A 1YE9A 5E3OA 2IGMA 4CDGA 4DQ2A 2ZFWA 4B44A 1Y1VJ 1UB9A 3OR2C 4C30A 2FQ4A 1U5TC 2GA1A 3W6JB 2QEXI 2UXXA 3NEUA 4CA0A 2GOXB 3F6OA 1WZ2A 1X3ZB 2CU7A 5LLQA 2EJRA 1U78A 3JRGA 3ZQFA 1SMTA 2XGCA 3CP8A 4KT5C 4KITB 2VE9A 3RYPA 4UUVA 4M6XA 2FBHA 2XAQA 2MH2A 3N4MA 2NOJB 1ODDA 3SZPA 3KZIC 4A3CJ 1TTYA 4LITA 1TNTA 4BQOA 2KIMA 2HYGD 4NUBA 3V8LA 3PNVA 1D0ZA 4OWRB 4XOTA 4IO9F 3MKLA 4A3IJ 3Q0WA 1TT0A 4M72A 4L9VA 1P4WA 2ID6A 2HR3A 2M8GX 4G12A 5LRRA 1MBEA 2QM3A 3CCJI 4YIIA 1FP2A 3K0LA 3K4KA 3V8KA 2R93J 4G6DA 1E17A 2FQ3A 3HUGB 2R7WA 3LQRA 3HPHA 5ILUA 5F08A 4RB0A 2L9SA 1NK2P 3CC7I 1ZAOA 3IAM2 1Y0NA 2CUEA 1MNEA 3K4JA 2K02A 2QBYA 2ISZA 2ELJA 1BOAA 4PSWA 2VPLA 1UMQA 3PNYA 2L9VA 3I4MJ 2CUFA 4DZPA 4NDLA 3M8JA 3HL2A 2PMUA 4IRIA 2MGQA 3SXYA 1K6YA 2OA4A 2A6TA 4DGWB 3ZCOA 1KONA 5JLXA 3TMOA 4C3JJ 3ZMZA 4HBLA 2HKOA 2QKMB 2K27A 3ROUA 1P4AA 1TW2A 1IRXA 3A02A 2BY1A 3BQZA 2QUFA 4PFPA 1WI3A 2VBWA 3GZ5A 3BG9A 5D6EA 2XDVA 5D8LB 2YS9A 1NH3A 2OZ6A 4CCJA 1VQKI 4MHGA 3QOPA 1YFHA 3B6CA 3H1CA 4QPQA 1X1CA 5D6FA 1B4AA 5LD2C 2KRHA 1LDJA 3GLLA 3CCRI 2NS0A 5J8FA 2QQBA 4M3DA 1ZREA 1KQ0A 4BY7J 1IXSB 2RREA 2QF7A 4L5IA 2HGCA 2BEOA 3HSEA 1MJAA 3R60A 3BG6A 4UB6C 3AG2H 3CLQA 3W6KB 4JP0A 1R22A 2XF7A 4B8XA 1LNWA 1V5GA 2ZXIA 3ASOH 1IRFA 1E3OC 5E1WA 1HOMA 3DTEA 4BXFA 3LSMA 1ETXA 1FOYA 4RMNA 2EINH 3L2RA 2ID3A 1KQ9A 4H0EA 4R8HA 4E7LA 2DLLA 1HQCA 3CLOA 4UV8A 1MMGA 5L3FA 3OOPA 3KCCA 3OYCA 4MEXF 3G71I 4OMYA 3CDHA 4OAYA 2DA4A 4M3BA 3H0GJ 1IN4A 1L3LA 4KICA 3CJRB 1H0MA 3PSFA 1KYZA 2O8XA 2IA0A 1REPC 1FSHA 3QODA 3LL7A 1KQ8A 1WVRA 1FZPB 4XBFA 3A2KA 3K6GA 2DA5A 2O03A 2OZUA 3F8MA 5F1RA 2CW8A 1T2KA 2EV0A 2O3FA 3TW6A 2EQRA 3N97A 1Z0XA 5FGMA 2H6CA 5J4YA 2LTPA 1E3PA 2W00A 1P4XA 4FISA 4BAYA 5DM6F 3G4SI 3KZYA 3GO5A 1D1AA 1JKRC 3HDDA 3MWMA 3MKZA 2E7XA 5M5WJ 3PO3J 1MJ9A 1OISA 5KHDA 1IV8A 1SVLA 4M9ZA 3E6MA 1FC3A 2YPRA 1HW1A 5TJJA 3RKQA 5F6FA 1FSEA 3BZ6A 4Q48A 2ZSHB 5HLGA 4LG0A 1IG7A 3GYHX 4B47A 3G73A 2P6SA 3FXUA 3NQOA 3RZOJ 5K5OA 4NBQA 4GRIA 1EH7A 3E6BA 1HKQA 2XGDA 3KZZA 3TGNA 2C6YA 4OIQF 2L2OA 2ZMEB 3QPLA 5HOOA 4A3DJ 1B8IB 3QYFA 4BGDA 1PDNC 2KFDA 4EJOA 3JCUC 2XAFA 1A04A 1DGWY 2ZBKA 3BT9A 2DMUA 3BY6A 1JKQC 1YRNB 2MC4A 3LOCA 3DKWA 1GLNA 1UG2A 5E18F 3S14J 5K7FA 2HPMA 3M9AA 3AL0B 5HLTA 1U3EM 4JYKA 2P0WA 3C2GA 3LMMA 1IN6A 3FBIB 2LR8A 3WTYC 1YOVB 4EJWA 1I3QJ 1LPQA 4IHVA 5A2QK 2LFBA 4HSTA 2FBKA 2PJPA 5J8CA 1G4DA 2DW4A 2GQQA 1K4TA 2QA4I 3OY9A 4HX8A 2DBBA 3LAPA 2LNBA 4BE0A 3A01A 4P9FA 3IAS2 3JREA 3GTQJ 1H9GA 3DKXA 3COAC 1XD7A 5GADJ 3PFYA 2UV1A 2NAZA 3RKWA 3HM5A 2CO5A 4XKVA 2LG4A 3RSNA 1JT0A 4IXAA 4KUMA 2Z1DA 2DU9A 4MEYF 4Y7NJ 3BTLA 4OIOF 3HOWJ 2H8WA 5B1AH 1JHFA 1EA3A 2FUG2 2F2EA 1LKXA 2F5VA 4CUGA 1X1PA 3ZMTA 4CZCA 4J00A 2BW3A 1Z6TA 4Z2YA 2DI3A 4BYYA 4MQVA 4XORA 5L3EA 4RGUA 1LEAA 4D1QA 2M30A 4N9HA 2LKXA 1ZLKA 1J9IA 4FQGA 3ZQGA 2P81A 4EEFG 2BVLA 2QZ8A 2V6CA 1H88C 1B1BA 3VYUB 1FBUA 2N8GA 3FDYA 2XPVA 2XC7A 2JPCA 3C18A 4BHBA 5FD6A 4XICA 3OYNA 1X2NA 1IO2A 2W25A 4BE2A 2V1XA 1IW7F 1CGPA 2XROA 2KDOA 1HBXG 1OCPA 2KIQA 5E1ZB 3DEEA 1F1ZA 3ML6A 4E7KA 1YO5C 2OPTA 2QVOA 3MAJA 1GHCA 3SYTA 1LFPA 1R36A 3HEFA 1I6HJ 4CYCA 2HNHA 1LFBA 4HRIA 3OYEA 2DQRA 1VNDA 3U2RA 4XKWA 3FMQA 2E34A 4HV6A 4DNCA 5M5YJ 3DLAA 4NHJA 2E36A 4DZJA 2FE3A 3G1MA 1AKHA 5L3GA 3ABTA 3V7CA 3DBLB 1YIOA 2LY1A 1J59A 1LQ1A 3ZP5A 3DBRB 2PJRA 4RAZA 3OYGA 2WB1A 4OIPF 3JRBA 1B9MA 4A3LJ 3FXMA 4EJVA 3LFUA 3WTXC 5CQGA 1W5SA 1TP4A 5JI6A 1VQOI 2FA5A 4O6JA 2GIZA 1PYVA 3BR3A 1ZLJA 2NVXJ 2D45A 2WBMA 3VPRA 3F72A 1CQTA 1LB2A 3CUOA 2EFWA 3HOSA 4EM1A 3BCAA 2DDAA 2L7ZA 5GPAA 2JUGA 3OS0A 3I56I 4A0XA 1RZ4A 1JJ6C 3BDDA 2YUSA 2R7XA 2WWYA 2FXAA 1W7PA 1WCMJ 3E6DA 5CPRB 1T33A 2I10A 5ERIA 4I98B 1XCBA 3TL4X 3S3MA 1QQIA 4P1WA 1K83J 1USSA 1YW7A 2Z5UA 1YQAA 2X1CA 3TQNA 1U5TB 1RR8C 2ACJA 2AXLA 3V8JA 3DEUA 1R7JA 2GAUA 2XF5A 1BI2A 3CCVI 3G1LA 3G3ZA 2QGUA 2D1HA 1S9HA 2OCEA 2P5VA 3GBGA 4QIWN 1IGNA 1KZHA 1SVMA 2L4AA 5C4XJ 1TQMA 4UNOA 2GLOA 1U9NA 2JTVA 4FCYA 2DMPA 3I9V2 1PP8F 4GGGA 1FPQA 3K4MA 4KMFA 1FEXA 4G7ZF 3HOZJ 1I50J 2GXGA 2LBFB 5LGUA 1BIBA 1USTA 1OR7C 3MZ8A 1CF7B 1RNLA 3ZN0A 4LB5A 1OLTA 3DWLE 1U8BA 1W0TA 3W2AA 5H6QA 3DCFA 5EEGA 3S1NJ 4MNUA 3PSIA 6PAXA 4PSXA 5HNHA 3Q5FA 3HUGA 4N9IA 4RAYA 2R5YA 1IDZA 2P8TA 4PGHA 4FX0A 4M9XA 3VOEA 2M87A 3F8FA 4XQFA 5D5XB 3D1NI 4P96A 2QKLB 3SFZA 1WJCA 4A5NA 2E1MC 1LUJB 4LLNA 2EA4A 1TNSA 2QYOA 5LHHA 3HXLA 1XMKA 2DT5A 2O7OA 4IJAA 1TQIA 4CGZA 5DV5A 1YG2A 3F23A 2H27A 1G6NA 1X58A 1TWFJ 1Z3YA 4Y15A 3AG4H 2XAJA 4ZC3A 1JGGA 5DEQA 2IT0A 2LDUA 1WJBA 1VZ0A 5DM7F 4GXOA 4RLFA 1K61A 2MC3A 3BOQA 2RGVA 3V4GA 4D7MA 3ZOBA 2ZC2A 4XKCA 3OYKA 3DXJF 4L9TA 4E70A 4AVPA 4EVIA 3N05A 2HKXA 3E7LA 1PUFB 3FK7A 3HHGA 2WAQA 3WU2C 4XLFA 3LSRA 4WXDA 1IAWA 2E1CA 4I76A 2B7EA 1Y39A 3KYCB 1GDTA 4D5CA 3JSOA 2JJ7A 2W84A 3B73A 5B66C 2ZCWA 4XSXF 2LVSA 3OV8A 3VEPA 3K4CA 2HYFA 2A68F 3KETA 3K70D 2R5ZB 1FOKA 1C0WA 3NWTA 1JKOC 2E2JJ 3RJPA 3A4CA 4LOCA 3DPUA 1QHHD 2DT7B 1F9NA 2XHKA 3JAMZ 3HOXJ 3DEWA 2VQLA 5EDNA 1G59A 4XRFA 3TOBA 3S1RJ 2LRDA 4A69C 2GM4A 1EH8A 1JUPA 1WQ2A 2VOPA 2R7QA 1ZKGA 3FMSA 1B9NA 3H35A 5H6RA 1UG0A 4XLCA 3VFZA 4BJTA 4L18B 5CVUA 2JMWA 5HS7A 1D1BA 3ZMSA 1PVEA 2VKEA 2TDXA 1FTZA 2AQEA 1TZLA 3K2ZA 3ZQ7A 2PFBA 4A6DA 5EEHA 2RV8A 2IS6A 1F43A 3SHFA 2EK5A 4JX6A 1SMYF 2ZO4A 2BY2A 4BQQA 4CICA 4Y52J 3MFKA 3HTUA 2DPUA 1ETQA 4CCNA 1D0YA 2HXOA 2IAIA 4CHUA 3HRTA 3ABMH 4KN4X 3LWFA 2EH3A 3RQ4A 3DFGA 1UZCA 5EYRA 4ENKA 2VJJA 2K4BA 1T39A 2MG4A 1ZARA 4QLCU 5TGTA 3FISA 4BJ6C 1BJAA 5BQTA 3IUOA 1RUOA 4NC6A 4PK4A 1UHMA 5IP9J 4MTDA 2EA2A 3PQJA 4ZZLA 3E97A 3QU3A 1J7KA 2F48A 1OFCX 3TKYA 2FF4A 3EUHA 1FMWA 2CQKA 3GUDA 2QSGX 1RC9A 4HZFA 4RB1A 4DW6A 4ENMA 2BXZA 3CTAA 2DA7A 1ZG5A 1Q1VA 2FRHA 4M3EA 2PQ8A 3ONQA 1AU7A 2A61A 3OWTA 4HG2A 3UR3C 1AWCA 5JHUA 5IYDJ 2BGCA 4IHSA 1TWAJ 3MKWB 2XV4S 3JTHA 2MLGA 4OINF 2DO7A 2V1NA 2QCOA 4AIDA 3TDUC 4C3IJ 4UVCA 5HLIA 3LSKA 1QPMA 4RGRA 5C4JJ 1O7LA 1MDMB 4UUSA 2ZMEA 2WADA 4GO1A 2LC2A 1Z6RA 1X1AA 1R4MB 2CMPA 3IKVA 5FKMA 2DOFA 4EM2A 1FTTA 5E20A 3IRRA 2FMLA 2ZXHA 4Q47A 4XM3A 4XIDA 3WU1B 2XB5A 1GUUA 2LLKA 1WRJA 4ZYHA 4DIQA 2ZJQF 3X2QH 2L9RA 4JOMA 1HW2A 2LOOA 2KZVA 4HX4A 5CYVA 1ETYA 2GIVA 2WV0A 4PCQA 3LSPA 3L2VA 1XDSA 2OAZA 3SEQA 4ZYGA 1UAAA 2EPFA 2DT6A 4L9JA 4Y4RA 2VKHA 3IWFA 2EBIA 2WY8Q 3SDGA 1JJ8C 1FWZA 2XVCA 3L2QA 1XSDA 1MD0A 1ORKA 1OYWA 2XPWA 3JW4A 5LBQA 1MMAA 3WHBA 3S17J 2X6WA 3S32A 2RNGA 1I5ZA 3JRIA 2EWNA 3KIOA 4LD5A 3M8EA 2IA1A 3KP3A 2KZGA 2OCCH 4F92B 4HDUA 5LHGA 2K40A 2IRFG 1OQYA 4RB2C 4BBRJ 2COBA 3MQ0A 1ZR2A 2ME6A 4BNCA 3D5RC 4YG2F 2M0MA 1OKRA 1FIPA 1DUXC 1Z7UA 3BG7A 2D2WA 4P9UA 1BW5A 2IVMA 5DCMB 1G2HA 5J1YA 2KT0A 3WG7H 2W48A 4ABZA 2H1KA 2LKPA 1W5TA 2A5YB 2V7FA 4ESJA 1WJ5A 2F5EA 2X0LA 3CZ6A 3L2WA 2DMQA 4A3EJ 4WF2A 1PP7U 4HF0A 1LDDA 4ZTFA 4QSHA 4EQQA 4YIRX 1ZRDA 1TQPA 2PG4A 3I59A 1XGNA 5GTIC 3JRHA 2PX9A 3BR5A 3ZMUA 3C1DA 4X0GA 1HSTA 4QTRA 1AHDP 2IGOA 4WXCA 1ETKA 5D4SA 1X19A 3J80K 3WTUC 2VN2A 1OYYA 2IGKA 1Z91A 1RR7A 5HS8A 4WK8F 4XK4A 1D5YA 1NK3P 2G0EA 2K3FA 3R6SA 1O7FA 4E6KG 3E5UA 1MIJA 2P7CB 3BC8A 1XSVA 1ZRFA 3LSHA 3J81K 3F3XA 2FOWA 4A0YA 2R7DA 4KJZA 4LK1F 4RB3C 1SFEA 2CQXA 3DKYA 1A6QA 4B48A 2CV2A 2ESNA 5L3BA 3OMYA 2Z9OA 1SAUA 1FX7A 1WWXA 3DBHB 4A93J 2Y69H 3HOYJ 2ICWG 3PQKA 4LK0F 1FOXA 5IT9K 4FX4A 3A1YA 1STZA 4HNUA 4C2MJ 2M45A 3EUAA 5DD8A 1FY7A 3IL2A 1K78B 2TCTA 3T5XA 5E3MA 4BEHB 5ICFA 5E17F 5F0HA 4M9SA 3U21A 1DPUA 4CXFA 5EGOB 3DLLF 4C9YA 2UWMA 2M34A 4S0HB 2IJLA 1E2XA 2YU3A 4JBAA 4CYDA 1NG6A 4UB8C 1WH5A 2E7WA 4BXUA 3DQVC 1GT0C 1RETA 2OD5A 3E5XA 4A2UA 4IOCF 1VTNC 5IT3A 2LMDA 1Y8RB 5IYBJ 2BE5F 3CDLA 4AYBN 1DU0A 1T0FA 5K7HA 3P9CA 4G9YA 3KX2A 9ANTA 3HSFA 1ETVA 1ETWA 5DCFA 3WTWC 4IX7A 2DA2A 1GV5A 4LJZF 2DFFA 3IRQA 5M3FJ 1UJ8A 1O3SA 3RI4A 3LFKA 3GCMA 1B6AA 1V54H 1G3YA
chains in the Genus database with same CATH topology
3OYNA 3OIPA 4BE2A 4HPQA 2KDOA 3DEEA 4E4HA 4NC8A 3ZR8X 2A5WA 4E7KA 2OUMA 3SEZA 3OS1A 3SYTA 1LFPA 2CV0A 1MNDA 2HNHA 3F9KA 2W1OA 4HRIA 2LYCA 3OYEA 2LBFA 1ERDA 2V4JC 2ZSIB 4E7HA 4IQ4A 4XKWA 1X4PA 3OS2A 2E60A 3PJRA 3CMMA 3DLAA 2L7KA 2XF6A 1T0FC 4NQWB 4B3XA 2DXIA 2X85A 2DOAA 2KRCA 4RM3A 4CH7A 2JA2A 2VB6A 2WA0A 4YRVA 2LY1A 2WY7Q 4J01A 1E0EA 2M3AA 3K70C 1LDKB 2E1MB 2O5RA 4BS9A 1V5EA 2PJRA 2E5ZA 2JVHA 3OYGA 2WB1A 3DTIA 3OYDA 2F4IA 3C2HA 4F93B 1BR2A 3QOEA 3SDBA 2X51A 3LFUA 4BACA 4IQJA 5CQGA 2CV1A 2Q2EB 2HZDA 2M7AA 2VXZA 2IS4A 4Y33A 3H5AA 3BCBA 1PYVA 2PMZA 4CCOA 4JQFA 2WBMA 1Z7LA 4PJJA 2R7RA 3SZGA 5FRNA 3W2VA 3HOSA 1U0JA 1DGRM 3BCAA 4XONA 4NC7A 1DQUA 2JUGA 3DU5A 3OS0A 3OYIA 4LG3A 4CSWA 2V6EA 2R7XA 2HU9A 4F91B 3CESA 5CPRB 3K4NA 4AYBA 3TL4X 3S3NA 2IGNA 4XLHA 3S3MA 4P1WA 3HG9A 2CUZA 2X1CA 3MMYB 2VL8A 2VASA 2VQHA 2XF5A 2BVMA 2V9KA 2HVQA 4ZTJA 3VYSB 2VJIA 1R6RA 1S9HA 5FROA 3BLYA 3GBGA 3W2WA 4EATA 3OYBA 3MKYB 2R7TA 2GOMA 4ANJA 3S93A 3VYRB 2ZFUA 2CW7A 2K5CA 2VQCA 3RCOA 3RTRA 1MMNA 3I9V2 4U87A 2HPIA 3LSGA 2KL4A 3K4MA 2M4KA 1W36C 4OAZA 2LBFB 2Z16A 1P9QC 1OR7C 2Y0SA 2K9MA 1OLTA 3DWLE 4LIVA 2Q1ZB 3W2AA 3FBNB 3PSIA 5KNLA 4PSXA 5HNHA 3QYEA 3H5NA 2VQGA 3H9JA 4YELA 2LREA 4AU7A 4E7IA 4HNTA 2CFOA 1YX3A 3DU6A 1NG7A 4XQFA 2DCEA 2QKLB 2VJ5A 3V42A 3ZGKA 4XKBA 2PJRB 1WJCA 2E1MC 2MFZA 3NWSA 4KISA 1QU3A 3HXLA 3KEYA 3HPGA 2CUJA 1FMVA 2W7NA 4C2UA 3ZQQA 2WAFA 3VSLA 3OR1C 2M7BA 3RPUD 1WJEA 3VSKA 1JI8A 1BOBA 1Z3YA 2R7OA 2MYSA 4ZC3A 1WJBA 1VZ0A 4RLFA 1N77A 4IKFA 2R7UA 2XSJC 2JSPA 4LIUA 1BR1A 2IXSA 1QHGA 4PJLA 4PJMA 3QYBA 4XKCA 3OYKA 2CH0A 2HVSA 3N05A 4BE1A 4RM2A 3OYHA 2KHMA 1UELB 4Y3OA 2WAQA 3ZRGA 4XLFA 4PUSA 4CCKA 1MW7A 2HDWA 1YE9A 2IGMA 4XN0A 5HNFA 3FHNA 2JVGA 3H9QA 4B44A 4ZJZA 3K70D 3OR2C 2VJ4A 3K4CA 4C30A 2RQQA 1J09A 1WFXA 3NWTA 4CA0A 2GOXB 3A4CA 3DPUA 1QHHD 3L2UA 2DT7B 3CP8A 4KITB 2VQLA 1G59A 2LRDA 2NOJB 2WAEA 2R7QA 4PFOA 3W3CA 3H35A 4LITA 1UG0A 4XLCA 4BJTA 4BQOA 4NUBA 1D1BA 3PNVA 1X1DA 1D0ZA 4OWRB 4XOTA 4BU2A 2AQEA 5JHFA 1TZLA 1TT0A 2W82A 1PJRA 2X6YA 2IS6A 4ZDPA 1N75A 4ZYAA 2L9NA 3K4KA 3HUGB 2R7WA 4F3QA 4BQQA 3HPHA 4CCNA 1D0YA 5CQEA 2L9SA 3CP2A 2R7SA 2X1DA 2IS2A 3IAM2 3RQ4A 1G8XA 2VJJA 2KP6A 1MNEA 3FKJA 3K4JA 3K10A 4DBRA 3E1SA 1HA8A 3VWBA 2BOLA 5TGTA 4BJ6C 1YX5A 4II2A 2ELJA 3IUOA 4PSWA 4PK4A 2VPLA 3PNYA 5KCMA 4C2TA 3M8JA 3HL2A 3EPZA 4DGWB 1K6YA 2A6TA 3CJQB 3ZCOA 1KONA 3K4LA 4ITVA 3TMOA 1FMWA 1W36D 3M1CA 2R4GA 1WJAA 3VYTB 4PJNA 2QKMB 2MABA 1IRXA 2K9LA 4PFPA 3ONQA 2LY2A 3OWTA 2XDVA 4HG2A 3UR3C 4CCJA 2X6XA 4XN3A 4QPQA 3MKWB 2L5QA 1X1CA 2K3PA 5LD2C 2KRHA 4XNFA 2V1NA 2DJIA 2UUZA 4D9JA 3HC7A 3LSKA 4XOPA 2KPMA 4HSRA 2VLAA 4XLEA 2WADA 2LC2A 2RREA 1X1AA 2CMPA 4P5OA 3I3LA 1X4OA 4ZDLA 2ZXHA 4XM3A 3BG6A 4FETA 4DIQA 3EUHC 3LSIA 3HKZA 3TBIA 4JOMA 2LOOA 2KZVA 2XF7A 3K4BA 3L2VA 1T95A 1V5GA 2ZXIA 3SEQA 1AA7A 1UAAA 2DT6A 4XR6A 4Y4RA 3DTEA 4B43A 2VKHA 3LSMA 4BXFA 1DP3A 4H4KC 2WY8Q 4RMNA 4KT6A 3L2RA 4BL0B 2CS3A 3EUKL 3L2QA 2VXDA 3IP4B 4E7LA 4YEJA 1MMGA 3OYCA 3UNGC 1MMAA 3E0JB 4OAYA 2V26A 2X6WA 4G6TB 3S32A 2RNGA 3CJRB 3MD2A 3OYAA 2F6CA 3PSFA 2X1EA 4BEHA 3OL3A 3LL7A 3G2BA 3OL4A 3QODA 4DBQA 4F92B 3DPTA 3A2KA 3K6GA 3PNTA 2KMUA 2CW8A 2MD0A 1V5FA 4CCMA 2W00A 1MMDA 3S8PA 3D5RC 1D1AA 3AL0C 2M4GA 2M0MA 3OIQA 2XAUA 1Z21A 3BG7A 3MKZA 3KYLA 2IS1A 4N4OB 5KHDA 3H9GA 4FASD 3H0DA 2V7FA 1WJ5A 3L2WA 3CZ6A 2ZSHB 4ZTFA 2LH9A 2AQFA 4B47A 4R79A 4HEA2 3HOTA 2VIXA 4U7BA 4GRIA 2KQRA 1SFKA 3CF2A 3OOUA 4X0GA 2Z2SB 2HVRA 2L2OA 2IGOA 1X19A 5HOOA 2E5NA 3QYFA 4BGDA 2IGKA 4BUPA 5LFAA 2KLOA 4NNJA 1DGWY 3ZXSA 1BR4A 4AVZA 4E6KG 4F52A 1X1BA 2BW3B 4N4NB 3BC8A 3AKZA 2MC4A 4CCLA 1GLNA 4BQNA 3LSHA 2HPMA 3AL0B 5HLTA 1LVKA 3VDXA 1N78A 2P0WA 3C2GA 3LMMA 4KJZA 3FBIB 2VKDA 1WJFA 3DKYA 1Z3XA 4HSTA 4B48A 2CV2A 3AFHA 3OMYA 3D5LA 1D0XA 1SAUA 4DOZA 4F55A 4MLOA 4BDZA 4XLAA 3DPLC 3OY9A 4E7SA 4XL9A 4BE0A 2W4SA 2I8DA 4BDYA 4ZDOA 3H5RA 3A1YA 3IAS2 4HNUA 3DKXA 3EUAA 4IZZA 3PFYA 2UV1A 4BEHB 4XKVA 3RSNA 2LG4A 3U21A 4RLQA 4DJAA 3OYJA 2UWMA 4C9YA 2Z1DA 1Y56A 2OV7A 1NG6A 4E7ZA 3DTKA 3DQVC 1Y6IA 5FRMA 2OC6A 1D1CA 3PL8A 1EA3A 2FUG2 2F5VA 1LKXA 4CUGA 4CZCA 4J00A 2BW3A 3OYMA 4XMYA 3OYLA 4XORA 4BJ5C 3OYFA 3KX2A 5CKTA 1WJDA 4D1QA 3S3OA 4E7JA 4IX7A 5HVQC 2BVLA 4II3A 2R7VA 3PUBA 3VYUB 1ZELA 3J7AY 3FDYA 3D5SC 4QPOA 2HQAA 2XC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZGK A;  3ZR8 X;  2LC2 A; 
#chains in the Genus database with same CATH topology
 1XGS A;  2KIF A;  3BQY A;  4D7N A;  2O0Y A;  1EJ9 A;  5F04 A;  4IHX A;  3O3K A;  2VON A;  3F0C A;  2A5W A;  5LHI A;  2P6T A;  2ZXW H;  2OJE D;  3F9K A;  1Z77 A;  1SD7 A;  2DYR H;  5KAI C;  3L1P A;  2LYC A;  3BJA A;  2LBF A;  3EET A;  4IOA F;  2V4J C;  2ZSI B;  2QQ9 A;  4OIR F;  1CF7 A;  3FXJ A;  3MZY A;  3OS2 A;  4G94 A;  3PJR A;  2DN0 A;  3HZJ A;  5C44 J;  3WGG A;  4EMS A;  3WTS C;  3K1M A;  4HOB A;  4NQW B;  5JVG F;  2NYX A;  2DXI A;  3AAF A;  4RM3 A;  1TLH B;  2CQ7 A;  2MD5 A;  2JA2 A;  5IPA A;  2A07 F;  4YRV A;  3UKG A;  3CJN A;  3BJ6 A;  2RDP A;  4ESF A;  2BYV E;  2VT3 A;  3GXO A;  3K70 C;  3F6V A;  2E1M B;  3ABL H;  1V5E A;  2K85 A;  2PMH A;  2IEK A;  2XUB A;  4WXH A;  3GWZ A;  1I39 A;  2ZB9 A;  4AIK A;  2ELK A;  1MZB A;  2F4I A;  3R0A A;  2JUC A;  2K7L A;  4G6Q A;  3ZQI A;  4D5F A;  1OCT C;  4I01 A;  2IS4 A;  4Y33 A;  3O6B B;  3H5A A;  4CCO A;  3FX3 A;  3KPH A;  3WTZ A;  4ASN A;  4A6E A;  2E2H J;  1FYL A;  4MTE A;  2UXN A;  1NTC A;  3KE2 A;  2Y9Z A;  3GTM J;  1T8I A;  5FFX A;  1H89 C;  4M3F A;  4NC7 A;  1DQU A;  3ELK A;  4O3M A;  4LG3 A;  5CVI A;  3W6V A;  1E3H A;  1HF0 A;  2EIM H;  3GVA A;  1TT5 B;  1PUF A;  3QRF F;  2V6E A;  4G7H F;  3FM3 A;  3KP5 A;  3K4N A;  4U0V A;  4RBO A;  1QA6 A;  3S3N A;  4EJT A;  3K7A J;  4UV9 A;  2YSR A;  1BBY A;  1GXQ A;  2FX0 A;  2VQH A;  2HS5 A;  4HYE A;  4AM3 A;  2BVM A;  4BBS J;  1ZGA A;  1XS9 A;  2HI3 A;  3VYS B;  1R71 A;  3KEO A;  5FRO A;  3IC7 A;  3W2W A;  3K2A A;  3GTO J;  1X3U A;  2RQP A;  2VBY A;  3S93 A;  5LEJ A;  1TL8 A;  3CUQ B;  4EJU A;  3RTR A;  4X1E A;  3RCO A;  4XRM A;  1D3Y A;  2HPI A;  2JWT A;  3RIR A;  3P9K A;  2M4K A;  1GVJ A;  2DJN A;  3ASN H;  3I4P A;  1EV7 A;  1M1E B;  4LIV A;  2ETH A;  1HCR A;  4L9N A;  3FXQ A;  5KNL A;  1Z05 A;  3HB9 A;  3CMA I;  3D0S A;  1QZE A;  1WH7 A;  4MQ9 F;  2YX7 A;  2DA1 A;  3ECH A;  3H5N A;  4IRG A;  2ZNY A;  1YIT I;  3U1D A;  3CF5 F;  2A05 A;  3JSP A;  5BNG A;  1NG7 A;  3ZGK A;  4XKB A;  1YIJ I;  1ZGJ A;  1R9T J;  5JFR A;  3ZQH A;  4KIS A;  1QU3 A;  4IPA A;  2Y75 A;  3QP5 A;  3S2H J;  4C2U A;  4K2E A;  3K1P A;  3M07 A;  3TP0 A;  1F4K A;  1BOB A;  2LP0 A;  2R7O A;  2NS7 A;  5B1B H;  2MYS A;  3KP6 A;  5FB2 A;  1F36 A;  1WHU A;  1SFU A;  5A2Q Z;  4DYC A;  4IKF A;  1RKW A;  1MJB A;  2NNY A;  4PJL A;  4Z6Y A;  4UVA A;  4S05 A;  1W5C C;  1ZK8 A;  2CH0 A;  1BI1 A;  2BY0 A;  2RAE A;  4O5V A;  4Y3O A;  5E1X A;  3ZRG A;  3JR9 A;  1B59 A;  2HOE A;  2J5O A;  1O3R A;  1MW7 A;  2HDW A;  1K6O A;  1H9T A;  3H3Z A;  4RGS A;  5HNF A;  2E71 A;  3FHN A;  2L3D A;  2JVG A;  3WE3 A;  4W97 A;  3H92 A;  3HOU J;  1WKM A;  1B72 A;  2QBY B;  2ZJR F;  5J40 A;  3CO6 C;  1WFX A;  3FMR A;  3FK6 A;  1ZTR A;  3P5J A;  5GAE J;  2JSC A;  5K1Y A;  3HIF A;  2ZKZ A;  3P9I A;  2XAH A;  4U0Y A;  2QWW A;  2EV5 A;  3WG9 A;  1TWC J;  2WAE A;  4RAG A;  1FLI A;  3W3C A;  4PFO A;  2WV1 A;  3RYR A;  2BBY A;  3M4O J;  4V2G A;  3GFI A;  2ZJ2 A;  1V3F A;  2L0K A;  3LA2 A;  2X6Y A;  5D5U B;  5EG0 A;  1N75 A;  3PFI A;  1GVD A;  4ZYA A;  3ERM A;  2R3S A;  1P6R A;  2ISY A;  3S16 J;  3B02 A;  4Y13 A;  3QAH A;  1I1G A;  1I27 A;  1ZHF A;  3CP2 A;  4M6Y A;  2R7S A;  3K1N A;  5FKL A;  3T8R A;  1G8X A;  3ZQL A;  1ETO A;  2KP6 A;  3FKJ A;  2P5K A;  1R1U A;  3K10 A;  1HA8 A;  4V2F A;  2BOL A;  4II2 A;  4XRS G;  5KCM A;  4L0Y B;  3CME I;  1W4M A;  1QBJ A;  2NRA C;  3EPZ A;  5B5E C;  2ELH A;  2HDC A;  1MBG A;  3IH3 A;  3K4L A;  4KN7 X;  4AC0 A;  2LSO A;  3U1K A;  3HRS A;  1ZQ3 P;  4KYW A;  5J1R A;  3M1C A;  2MA3 A;  2R4G A;  1DP7 P;  1FBQ A;  3IKT A;  4HDV A;  1T08 B;  1U9O A;  1I6X A;  2NS8 A;  5DCM A;  2NNN A;  4P55 A;  1IUF A;  1XDU A;  1Y1W J;  4KNY A;  1QRY A;  2LY2 A;  1RKT A;  1P92 A;  2X6X A;  3WU0 A;  3SQN A;  4B1R A;  4OOI A;  3SZT A;  4ESB A;  1WPK A;  3GTP J;  3CCM I;  3BR0 A;  4XNF A;  4LFU A;  3K69 A;  2DJI A;  2UUZ A;  4D9J A;  2MLK A;  4PJ0 C;  3L09 A;  3A0B C;  4BHC A;  4HSR A;  2VLA A;  2AS5 F;  3KYD B;  4XLE A;  2KRF A;  2EFQ A;  2STW A;  3CCQ I;  1XGM A;  1ZR4 A;  5JLW A;  3I3L A;  2P4W A;  4L0Z B;  5J47 A;  1ENH A;  5IOZ A;  2HQN A;  3EUH C;  1SEU A;  2EV6 A;  2VOO A;  1P7J A;  1X2M A;  1XMA A;  3CO7 C;  1SC7 A;  3K4B A;  3KP4 A;  3TW7 A;  1T95 A;  1JTX A;  1UFM A;  2HOT A;  3IWZ A;  4XR6 A;  2PEX A;  3FWE A;  3T0Y A;  4KT6 A;  5F0F A;  3A0H C;  2VC0 A;  3VOD A;  3BTI A;  1IDY A;  3IP4 B;  1ON1 A;  1R4N B;  4YEJ A;  3J7Y J;  2K9S A;  2W85 A;  2ADU A;  3E0J B;  1G3W A;  3LSJ A;  1TW3 A;  1RIO H;  3I53 A;  3ZMD A;  4BY1 J;  2XAS A;  1QO0 D;  3HSR A;  3BG5 A;  5GAG J;  2FOK A;  3FHZ A;  3AG1 H;  4BEH A;  2ZME C;  1SVO A;  5HLH A;  3OL3 A;  3OL4 A;  3G2B A;  5EGO A;  2IPQ X;  3DPT A;  5FLV A;  5FKK A;  2DTZ A;  3GX4 X;  3PNT A;  3TP3 A;  1J75 A;  1S3J A;  2H8R A;  3ISP A;  1YW9 A;  3BZC A;  1S7O A;  3J7A O;  3AL0 C;  2XGE A;  3GEZ A;  1U6G A;  2EZK A;  3JTG A;  2GXB A;  2XAU A;  1Z21 A;  3KYL A;  2IS1 A;  4IHT A;  4A5M A;  3T8T A;  3FM5 A;  2X48 A;  1Z1D A;  2PN6 A;  3QQA A;  3WE2 A;  2MSY A;  5F27 A;  4I7H A;  3H0D A;  2JA6 J;  1X3W B;  4YFK F;  5ILS A;  5IYC J;  1U2W A;  2Y0M A;  3JRD A;  1JXS A;  1O3T A;  2V9P A;  1J2X A;  2LH9 A;  5DS9 A;  2AQF A;  1OPC A;  4R79 A;  3CC4 I;  1BW6 A;  2DOE A;  3A01 B;  4I0B A;  2V1U A;  2VIX A;  3GME A;  3AG3 H;  2Y48 A;  3WTT C;  1DPR A;  4LLG F;  2KQR A;  1SFK A;  1YJW I;  5LRS A;  4HV5 A;  4BHP A;  2MW8 A;  2Z99 A;  1XG1 A;  1Z9C A;  2JPB A;  3EYY A;  1KYW A;  2FMY A;  2A6E F;  2CGP A;  2DA3 A;  2G7H A;  1BI3 A;  1XSX A;  5K5Q A;  2H1L A;  3F8C A;  1T98 A;  1X1B A;  2BW3 B;  2O8K A;  3PM1 A;  2ESH A;  4IRH A;  5CVV A;  4BQN A;  3CCL I;  3I0T A;  2QSF X;  2FBI A;  3TO7 A;  1TWG J;  1LVK A;  3FZV A;  5DD4 A;  5DYM A;  2XSD C;  1H8A C;  4U7D A;  2F5F A;  4U88 A;  2M1B A;  1YTY A;  2GBY A;  2EZH A;  2Y31 A;  5EEA A;  2OBP A;  5FLX K;  5C3E J;  4F55 A;  4DOZ A;  1U8R A;  4MLO A;  4BDZ A;  2EZL A;  4XLA A;  1W7P D;  2VC1 A;  4C3H J;  3I5U A;  4XL9 A;  1K4S A;  2F4O B;  2L02 A;  2H94 A;  2E19 A;  3RDI A;  2I8D A;  4BDY A;  4NB5 A;  2Y9Y A;  5HS9 A;  3EDP A;  5GTH C;  1BI0 A;  2O61 A;  4A0Z A;  3IHU A;  4CYC B;  3I4N J;  4DJA A;  4RLQ A;  1ZG3 A;  4IF4 A;  3OYJ A;  1UHW A;  3FXR A;  4XLP F;  1B8I A;  4I6Z A;  1R1V A;  4HF1 A;  4E7Z A;  3DTK A;  2E35 A;  2BY3 A;  2LKS A;  2XGX A;  1D1C A;  4WCG A;  5FRM A;  3PL8 A;  2KJC A;  1YRN A;  3OYM A;  2JZY A;  3GLX A;  4I09 A;  3CDI A;  1IN8 A;  4XMY A;  2DFH A;  4ZH4 F;  4BJ5 C;  3OYF A;  2GWR A;  3BJO A;  2YR2 A;  5CKT A;  1WJD A;  4B3A A;  1IJW C;  5ICG A;  2XIG A;  5DUI A;  2BZT A;  5ICE A;  4KA4 A;  1VQN I;  3S1Q J;  3HYI A;  2COM A;  1ZEL A;  3D5S C;  1A36 A;  2HQA A;  1ZH5 A;  3FXK A;  4AWX B;  1ITY A;  4BQA A;  1ZYR F;  2DMT A;  4KDP A;  3CCE I;  1K7A A;  2HTJ A;  3CUQ A;  3ECO A;  4E4H A;  1IXR C;  2K9Q A;  1SAN A;  3L7W A;  4Y17 A;  3ULQ B;  4AUX A;  4QWQ A;  2CV0 A;  2AO9 A;  3HBL A;  4HX7 A;  1VQ6 I;  3T1B A;  1RES A;  2W1O A;  1KGS A;  3H3U A;  3CCY A;  4IEJ A;  4A3G J;  1ERD A;  5H20 A;  4IQ4 A;  2Z3Y A;  1X4P A;  4M3G A;  1EF4 A;  4HLY A;  2STT A;  2R92 J;  2BHY A;  3CMM A;  4M74 A;  2M5W A;  3BR6 A;  1OYI A;  1T0F C;  3SJM A;  4B3X A;  2X85 A;  2DOA A;  2KRC A;  2CW0 F;  1SD6 A;  4KIG A;  5IOY A;  3ABK H;  4ENN A;  1ZGW A;  4L5J A;  1Y0U A;  5F64 A;  1YHQ I;  1K79 A;  1YYV A;  3ERE D;  1JUS A;  1E0E A;  4EGZ A;  2F5D A;  1S8N A;  4BS9 A;  3HHH A;  4A3M J;  1HXD A;  3DTI A;  3OYD A;  2H09 A;  2OU2 A;  1P2F A;  3HRU A;  3WHC A;  1BR2 A;  2LY9 A;  2X51 A;  2QQ8 A;  1QGP A;  3EYI A;  2CV1 A;  2LK2 A;  2Q2E B;  3LA3 A;  2VXZ A;  1A31 A;  2EB7 A;  2ZXJ A;  1BC7 C;  3BCB A;  5FLM J;  4FE4 A;  2PMZ A;  3C2B A;  1J5Y A;  1OCR H;  2KIS A;  3Q0V A;  4PJJ A;  1Z7L A;  1DDN A;  2OTJ I;  2R7R A;  2ZNZ A;  3SZG A;  1BA5 A;  5FRN A;  3W2V A;  1DGR M;  2JQ7 A;  4XON A;  2TRT A;  3BR1 A;  3DU5 A;  3OYI A;  1SD5 A;  2HXI A;  4ON0 A;  1KU7 A;  3GFM A;  5E8G A;  2E1N A;  2E2I J;  2HOA A;  4F91 B;  1VQ5 I;  1IN7 A;  2XPU A;  2R5Y B;  2R7F A;  3CES A;  4AYB A;  1QVT A;  4PGG A;  5BOX A;  3M7G A;  3ZN1 A;  3BTC A;  2IGN A;  2ECC A;  2HYJ A;  3FXL A;  2CUZ A;  2JN6 A;  1VQP I;  2F4M B;  3GW2 A;  2VAS A;  5KVR A;  4AIJ A;  1MGT A;  3GTG J;  5LGT A;  2V9K A;  2HVQ A;  4ZTJ A;  1MBF A;  4L5E A;  2VJI A;  1R6R A;  1T38 A;  3BLY A;  4EAT A;  3OYB A;  1VQL I;  2R7T A;  3TO9 A;  2NXN B;  1ZN2 A;  2ZFU A;  3U9G A;  2CW7 A;  2K5C A;  2PMZ N;  2CQQ A;  2VQC A;  4U0W A;  2KDZ A;  2R0Q C;  1MMN A;  3O2P E;  4G8X A;  3LSG A;  4G7O F;  2Z16 A;  5E79 C;  5K5R A;  2Y0S A;  1FT9 A;  4FE7 A;  3GTK J;  4MO7 A;  4KMU X;  2FJ1 A;  2G7U A;  4Q4Z F;  4TV7 A;  2Q1Z B;  1V4R A;  3QP6 A;  3J7Z I;  3QYE A;  2IP2 A;  4WX9 A;  2MH9 A;  2VQG A;  4HW0 A;  4A3F J;  3WTV C;  3H9J A;  2OQG A;  1MSF C;  4E7I A;  3JRF A;  5H2F C;  4HNT A;  1A5J A;  3CCS I;  5DUK A;  1YX3 A;  3DU6 A;  3NAR A;  4ENJ A;  3H36 A;  3J80 Z;  2DCE A;  2HWV A;  1OJL A;  2HFH A;  1U5T A;  4MGR A;  3BZK A;  2VJ5 A;  3V42 A;  2MFZ A;  4KFC A;  3NWS A;  2FNA A;  1MBH A;  3KEY A;  1JGS A;  1N25 A;  2CFX A;  3HPG A;  3QPT A;  3CMY A;  4EM0 B;  2CG4 A;  5IY5 H;  2W7N A;  5J3L A;  1R49 A;  2M7B A;  1JI8 A;  1KA8 A;  4AIH A;  3R0J A;  3J81 Z;  1S6L A;  4JX4 A;  5E8I A;  2BHZ A;  2OQR A;  1OCZ H;  1R5H A;  5GAH J;  2GXA A;  3GFL A;  1XB4 A;  1N77 A;  3KP2 A;  1S72 I;  1BR1 A;  2LF7 A;  4UY8 I;  5EZG A;  2EIL H;  2FEZ A;  2VT2 A;  3FKI J;  2Y0S N;  3QYB A;  4LMY A;  4UXN A;  3GTJ J;  1A35 A;  4HLX A;  4Q5S F;  3OYH A;  3E3V A;  3LAJ A;  5KAF C;  1UEL B;  1BJZ A;  5JVT A;  4PUS A;  2DPD A;  1R23 A;  5IT9 Z;  1XGO A;  2FU4 A;  5KK1 A;  5JR3 A;  4XN0 A;  1YI2 I;  3TDZ C;  3KLN A;  1HDD C;  3H9Q A;  4ZJZ A;  4OMZ A;  2VJ4 A;  2EIK H;  1J09 A;  2RQQ A;  2CJJ A;  3LQQ A;  1A6I A;  5E3L A;  3GZ6 A;  2HQR A;  1IN5 A;  2OF7 A;  3L2U A;  1VQ4 I;  2CRG A;  3IV5 A;  1ZG1 A;  1R1T A;  1S7A A;  1BM9 A;  5L3C A;  3MN2 A;  2XAG A;  2AXT C;  3HJE A;  2XB0 X;  3LNQ A;  4HAM A;  5FJ8 J;  2NVT J;  2X6O A;  4UUT A;  4ZZD A;  2A6H F;  2JRM A;  4DYR A;  1FYM A;  4GFB A;  3WGH A;  1JUM A;  1X1D A;  4BU2 A;  1LE8 B;  5LEK A;  3BRO A;  3QU6 A;  5JHF A;  4BH9 A;  4A3B J;  1MH3 A;  3A03 A;  2W82 A;  3DV8 A;  1PJR A;  3QWL A;  3Q0U A;  1G3T A;  4ZDP A;  5HDK A;  1OCC H;  3CJT B;  3FXO A;  1TC3 C;  1XTA A;  2L9N A;  2EFN A;  3HTS B;  2EIJ H;  4F3Q A;  1IUY A;  4MFE A;  1HC8 A;  5J4V A;  1IC8 A;  3V7R A;  5CQE A;  3C7J A;  1VQ8 I;  5IP7 J;  2X1D A;  2IS2 A;  1TWH J;  4BXX J;  4UUS B;  2DYS H;  5ED4 A;  2R5Z A;  5CJ9 A;  4DBR A;  3E1S A;  3VWB A;  3QPH A;  4A12 A;  1TBX A;  4EGY A;  1J0R A;  1YX5 A;  1I3A A;  1EH6 A;  2AHQ A;  4C2T A;  2HOS A;  3KLO A;  4F7Z A;  3CCU I;  4FHT A;  2WC2 A;  1R58 A;  1WI9 A;  3H3V K;  5J1U A;  1VQ9 I;  3I64 A;  3CJQ B;  1D8K A;  2E1O A;  4ITV A;  1FJL A;  2Y2Z A;  1W36 D;  3Q9S A;  4YIF A;  5B3S H;  1WJA A;  3VYT B;  1FBS A;  2RC4 A;  4PJN A;  1BC8 C;  2MAB A;  2H6B A;  2K9L A;  4HF2 A;  3MZH A;  4KIF A;  4UHT A;  4XN3 A;  2VOD A;  5K7Z A;  2B63 J;  2L5Q A;  4LLL A;  2LD5 A;  2K3P A;  3RZD J;  1JHH A;  1IRZ A;  3DF8 A;  2L01 A;  3HC7 A;  4XOP A;  2KPM A;  3C3W A;  1S5L C;  2QLZ A;  5FO5 A;  3VB2 A;  1R00 A;  2JT1 A;  4P5O A;  1Q1H A;  2FSW A;  5DTD A;  1X4O A;  4ZDL A;  1GXP A;  4FET A;  1RRJ A;  1UCR A;  1O3Q A;  2DQL A;  3LSI A;  3HKZ A;  3TBI A;  1W1W E;  5BMZ A;  2XKP A;  1VQM I;  2L7M P;  3I58 A;  1AA7 A;  3GFJ A;  5TIS C;  4B43 A;  3ZQC A;  1DP3 A;  1ON2 A;  2RKH A;  4H4K C;  1ZRC A;  2DTR A;  2Q0O A;  2DMN A;  2CS3 A;  3EUK L;  4BL0 B;  2L4M A;  2VXD A;  3KP7 A;  2W57 A;  2V1D A;  3GZN B;  3REO A;  1FYK A;  4ZYE A;  3UNG C;  3I59 B;  1T56 A;  2V26 A;  2Y30 A;  1BIA A;  4CZZ A;  5D4R A;  1KU3 A;  4G6T B;  5HDN A;  1DU6 A;  4RGX A;  3MD2 A;  3OYA A;  2CQN A;  2F6C A;  3R4K A;  2X1E A;  2GA2 A;  5IP6 A;  4DBQ A;  1MDM A;  1QPI A;  5TRD A;  2HTS A;  3SFI A;  1MBJ A;  2KMU A;  4GYI A;  1HDP A;  1LJ9 A;  1XMX A;  2MD0 A;  1V5F A;  2BV6 A;  2RVC A;  4CCM A;  2GZW A;  3HKZ N;  4KIB A;  1MMD A;  3ESW B;  3BWG A;  1QVU A;  3BPX A;  3S8P A;  2M4G A;  2P5L C;  3OIQ A;  1HKT A;  4YFX F;  2YU9 J;  5DDG A;  4N4O B;  3MEX A;  3Q3S A;  1ONV A;  3H9G A;  4FAS D;  1JKP C;  4I2O A;  1T6S A;  4M6V A;  4A3J J;  1XC5 A;  2RNJ A;  1MMS A;  5HOD A;  2DFE A;  4HEA 2;  3HOT A;  3L2C A;  4U7B A;  1O57 A;  1FNN A;  1APL C;  4J19 A;  3CF2 A;  2DK5 A;  3OOU A;  1QZY A;  1HLV A;  2Z2S B;  2HVR A;  1S29 A;  2L54 A;  2DOD A;  2E5N A;  5EF6 A;  1JE8 A;  2VKV A;  5FKO A;  1RI7 A;  4BUP A;  1MBK A;  1YJ9 I;  3I55 I;  5LFA A;  4XRS A;  2KLO A;  4NNJ A;  3ZXS A;  2M0C A;  3OSG A;  1BR4 A;  4AVZ A;  4F52 A;  4GYG A;  4N4N B;  2JK3 A;  3AKZ A;  1D5V A;  4CCL A;  4XSZ F;  5BPD A;  2O6G E;  1EKE A;  5AIQ A;  3BG3 A;  4B09 A;  3VDX A;  1N78 A;  1KU9 A;  2DA6 A;  2VI6 A;  2F5C A;  4R1H A;  1POG A;  2DAO A;  2VKD A;  2MBF A;  4IHY A;  1WJF A;  4V19 K;  4M73 A;  1Z3X A;  1F5T A;  4RS8 A;  2NOG A;  1SAX A;  2VBZ A;  3KEQ A;  3AFH A;  1SFX A;  3ZMV A;  3D5L A;  1D0X A;  3LST A;  2WB1 N;  1OCO H;  2HEO A;  2EFO A;  2WTE A;  3JRC A;  3G6E I;  2JA8 J;  3DPL C;  2BXY A;  4E7S A;  2PLY A;  4B4C A;  4BKX A;  1XN7 A;  3IH2 A;  2W4S A;  4GDF A;  1Y8Q B;  4ZDO A;  3H5R A;  2Q2E A;  2NVY J;  3DP7 A;  2L7F P;  3M1E A;  4IZZ A;  3RKY A;  3RPU A;  2HDD A;  3HGG A;  1S7E A;  2A69 F;  5E3N A;  5AIP A;  2ZJP F;  3BTJ A;  4HQM A;  2W24 A;  1WGX A;  1Y56 A;  4FT8 A;  1AOY A;  1IZ1 A;  2OV7 A;  3P7N A;  3G1O A;  4HA8 A;  3HGY A;  3O8H A;  1Y6I A;  2OC6 A;  1LFU P;  3JAM K;  3S2D J;  1XCV A;  3B6A A;  1SFO J;  3RKX A;  4I0A A;  5CVR A;  2J5P A;  2VBX A;  1HKS A;  3KFW X;  3PIP F;  3OYL A;  2LF8 A;  2OTL I;  4IL6 C;  3S3O A;  4E7J A;  1I1S A;  2QSH X;  1R5I D;  5HVQ C;  2R7V A;  4II3 A;  4IVN A;  4X6A J;  3PUB A;  4RAF A;  3OSF A;  1SD4 A;  5GPC A;  3BR2 A;  3QPS A;  3J7A Y;  3S15 J;  4QPO A;  2FNP A;  4WWC A;  4S04 A;  1VFC A;  4LG0 B;  2VUM J;  1VQ7 I;  3OIP A;  4YFN F;  2EFP A;  2K9N A;  2X9D A;  5D5W B;  3WGI A;  4HPQ A;  1VI0 A;  4NC8 A;  3ZR8 X;  1OMI A;  2Z33 A;  2OUM A;  3SEZ A;  3OS1 A;  4LGW A;  3MVP A;  2NVU B;  3TED A;  1K78 A;  1MND A;  4A3K J;  2JA5 J;  5M5X J;  1IXC A;  2FD5 A;  2IBD A;  2XRN A;  4RDU A;  1G3S A;  5J6X A;  2X4H A;  4XLN F;  4E7H A;  5D5V B;  2CYY A;  2E60 A;  5ILV A;  1R5G A;  4PDK A;  2M8E A;  2RN7 A;  2L7K A;  2XKO A;  2B9S A;  2XF6 A;  3PIO F;  2QEN A;  3O8G A;  1FP1 D;  1MKM A;  1BL0 A;  4CH7 A;  3EQL F;  2KIU A;  5BS6 A;  3GTL J;  2VB6 A;  2WA0 A;  3NRV A;  3CQZ J;  2DDB A;  5AON A;  2WY7 Q;  3F8N A;  4ETS A;  4J01 A;  2V9V A;  2M3A A;  1LDK B;  2O5R A;  4EV0 A;  2E5Z A;  3BP8 A;  3HOV J;  5M3M J;  2JVH A;  4MIM A;  2G9W A;  2V79 A;  5CLS A;  2CWE A;  3C2H A;  4F93 B;  4IQJ A;  3QOE A;  3SDB A;  4BAC A;  2K4J A;  3L00 A;  3JRA A;  1V55 H;  2PBI A;  4DYQ A;  5L3D A;  1MH4 A;  2HZD A;  2M7A A;  1QZZ A;  3CUQ C;  3OIO A;  2ECB A;  2QQA A;  4OU0 A;  5LGN A;  1JT6 A;  1IRG A;  3RPQ A;  3S1M J;  3V7S A;  1FIA A;  4UVB A;  1YS7 A;  4JQF A;  3HRM A;  1PUE E;  3FIW A;  1HW5 A;  1U0J A;  2VPR A;  1XPX A;  1OR7 A;  1YS6 A;  1LEB A;  4CSW A;  5BPI A;  1P7I A;  2WAQ N;  1W0U A;  3CD6 I;  3NAU A;  1L0O C;  1BN5 A;  1HSJ A;  2HU9 A;  5F0C A;  2ME0 A;  5F1J A;  4NQW A;  3TOA A;  3I54 A;  4ZYD A;  1GV2 A;  4XLH A;  2O9L A;  3WOD F;  2YX4 A;  1IV6 A;  3HG9 A;  3S2W A;  4AD9 A;  3MMY B;  2M9H A;  1Z67 A;  1IF1 A;  2VL8 A;  3PUF A;  2CSO A;  4JK1 X;  3I71 A;  1MNM C;  1UHS A;  4D0P A;  3F22 A;  5FKN A;  1FOW A;  2IW5 A;  3FF5 A;  4PZJ A;  3MKY B;  2GOM A;  4ANJ A;  2EZI A;  3L9F A;  4I02 A;  2UZK A;  1YJN I;  4W1U A;  1MSE C;  3M3Y J;  4GCV A;  3VYR B;  4MFD A;  3E5Q A;  5EJC A;  4IHW A;  4U87 A;  5HDG A;  2KL4 A;  1W36 C;  4OAZ A;  1YLF A;  5FD5 A;  1LE8 A;  1JTY A;  4RA2 A;  1P9Q C;  3F21 A;  2K9M A;  1O4X A;  3GF2 A;  4HQE A;  4JX5 A;  2Q8K A;  4CO8 A;  1RUN A;  3M8F A;  3CC2 I;  3LA7 A;  3FBN B;  5D8K B;  4YEL A;  2XRL A;  2LRE A;  4AU7 A;  3MCZ A;  1YW8 A;  1AKH B;  2JA7 J;  2CFO A;  2KKO A;  1B72 B;  2DK8 A;  2HQ5 A;  1D8J A;  3BPV A;  4I99 C;  4HNV A;  2PJR B;  3F8B A;  5CVJ A;  2HZT A;  1LVA A;  1ULY A;  2CUJ A;  1FMV A;  4N0B A;  1KU2 A;  3ZQQ A;  2WAF A;  3VSL A;  3OR1 C;  1VF9 A;  5ICC A;  4M71 A;  3RPU D;  5EZH A;  1WJE A;  3VSK A;  3TO6 A;  3ABU A;  3RQI A;  2NVQ J;  2JRT A;  4LB6 B;  2IA2 A;  5FFZ A;  2M2E A;  2D1V A;  1WSU A;  5GP9 A;  1XX5 A;  2DFI A;  3K9T A;  2R7Z J;  2KJB A;  4FTH A;  2XSJ C;  2A3S A;  2JSP A;  4LIU A;  2R7U A;  2P7V B;  2IXS A;  1QHG A;  4PJM A;  5FLX Z;  2PI0 A;  1NHA A;  3IH4 A;  1QNT A;  2D5V A;  5EG0 B;  2HVS A;  2B0L A;  3ZPL A;  1RPW A;  3Q9V A;  2I5U A;  4RM2 A;  4BE1 A;  2KHM A;  2VE8 A;  1ACI A;  4CCK A;  1W7P B;  3R61 A;  3E6C C;  3PO2 J;  2K86 A;  1YE9 A;  5E3O A;  2IGM A;  4CDG A;  4DQ2 A;  2ZFW A;  4B44 A;  1Y1V J;  1UB9 A;  3OR2 C;  4C30 A;  2FQ4 A;  1U5T C;  2GA1 A;  3W6J B;  2QEX I;  2UXX A;  3NEU A;  4CA0 A;  2GOX B;  3F6O A;  1WZ2 A;  1X3Z B;  2CU7 A;  5LLQ A;  2EJR A;  1U78 A;  3JRG A;  3ZQF A;  1SMT A;  2XGC A;  3CP8 A;  4KT5 C;  4KIT B;  2VE9 A;  3RYP A;  4UUV A;  4M6X A;  2FBH A;  2XAQ A;  2MH2 A;  3N4M A;  2NOJ B;  1ODD A;  3SZP A;  3KZI C;  4A3C J;  1TTY A;  4LIT A;  1TNT A;  4BQO A;  2KIM A;  2HYG D;  4NUB A;  3V8L A;  3PNV A;  1D0Z A;  4OWR B;  4XOT A;  4IO9 F;  3MKL A;  4A3I J;  3Q0W A;  1TT0 A;  4M72 A;  4L9V A;  1P4W A;  2ID6 A;  2HR3 A;  2M8G X;  4G12 A;  5LRR A;  1MBE A;  2QM3 A;  3CCJ I;  4YII A;  1FP2 A;  3K0L A;  3K4K A;  3V8K A;  2R93 J;  4G6D A;  1E17 A;  2FQ3 A;  3HUG B;  2R7W A;  3LQR A;  3HPH A;  5ILU A;  5F08 A;  4RB0 A;  2L9S A;  1NK2 P;  3CC7 I;  1ZAO A;  3IAM 2;  1Y0N A;  2CUE A;  1MNE A;  3K4J A;  2K02 A;  2QBY A;  2ISZ A;  2ELJ A;  1BOA A;  4PSW A;  2VPL A;  1UMQ A;  3PNY A;  2L9V A;  3I4M J;  2CUF A;  4DZP A;  4NDL A;  3M8J A;  3HL2 A;  2PMU A;  4IRI A;  2MGQ A;  3SXY A;  1K6Y A;  2OA4 A;  2A6T A;  4DGW B;  3ZCO A;  1KON A;  5JLX A;  3TMO A;  4C3J J;  3ZMZ A;  4HBL A;  2HKO A;  2QKM B;  2K27 A;  3ROU A;  1P4A A;  1TW2 A;  1IRX A;  3A02 A;  2BY1 A;  3BQZ A;  2QUF A;  4PFP A;  1WI3 A;  2VBW A;  3GZ5 A;  3BG9 A;  5D6E A;  2XDV A;  5D8L B;  2YS9 A;  1NH3 A;  2OZ6 A;  4CCJ A;  1VQK I;  4MHG A;  3QOP A;  1YFH A;  3B6C A;  3H1C A;  4QPQ A;  1X1C A;  5D6F A;  1B4A A;  5LD2 C;  2KRH A;  1LDJ A;  3GLL A;  3CCR I;  2NS0 A;  5J8F A;  2QQB A;  4M3D A;  1ZRE A;  1KQ0 A;  4BY7 J;  1IXS B;  2RRE A;  2QF7 A;  4L5I A;  2HGC A;  2BEO A;  3HSE A;  1MJA A;  3R60 A;  3BG6 A;  4UB6 C;  3AG2 H;  3CLQ A;  3W6K B;  4JP0 A;  1R22 A;  2XF7 A;  4B8X A;  1LNW A;  1V5G A;  2ZXI A;  3ASO H;  1IRF A;  1E3O C;  5E1W A;  1HOM A;  3DTE A;  4BXF A;  3LSM A;  1ETX A;  1FOY A;  4RMN A;  2EIN H;  3L2R A;  2ID3 A;  1KQ9 A;  4H0E A;  4R8H A;  4E7L A;  2DLL A;  1HQC A;  3CLO A;  4UV8 A;  1MMG A;  5L3F A;  3OOP A;  3KCC A;  3OYC A;  4MEX F;  3G71 I;  4OMY A;  3CDH A;  4OAY A;  2DA4 A;  4M3B A;  3H0G J;  1IN4 A;  1L3L A;  4KIC A;  3CJR B;  1H0M A;  3PSF A;  1KYZ A;  2O8X A;  2IA0 A;  1REP C;  1FSH A;  3QOD A;  3LL7 A;  1KQ8 A;  1WVR A;  1FZP B;  4XBF A;  3A2K A;  3K6G A;  2DA5 A;  2O03 A;  2OZU A;  3F8M A;  5F1R A;  2CW8 A;  1T2K A;  2EV0 A;  2O3F A;  3TW6 A;  2EQR A;  3N97 A;  1Z0X A;  5FGM A;  2H6C A;  5J4Y A;  2LTP A;  1E3P A;  2W00 A;  1P4X A;  4FIS A;  4BAY A;  5DM6 F;  3G4S I;  3KZY A;  3GO5 A;  1D1A A;  1JKR C;  3HDD A;  3MWM A;  3MKZ A;  2E7X A;  5M5W J;  3PO3 J;  1MJ9 A;  1OIS A;  5KHD A;  1IV8 A;  1SVL A;  4M9Z A;  3E6M A;  1FC3 A;  2YPR A;  1HW1 A;  5TJJ A;  3RKQ A;  5F6F A;  1FSE A;  3BZ6 A;  4Q48 A;  2ZSH B;  5HLG A;  4LG0 A;  1IG7 A;  3GYH X;  4B47 A;  3G73 A;  2P6S A;  3FXU A;  3NQO A;  3RZO J;  5K5O A;  4NBQ A;  4GRI A;  1EH7 A;  3E6B A;  1HKQ A;  2XGD A;  3KZZ A;  3TGN A;  2C6Y A;  4OIQ F;  2L2O A;  2ZME B;  3QPL A;  5HOO A;  4A3D J;  1B8I B;  3QYF A;  4BGD A;  1PDN C;  2KFD A;  4EJO A;  3JCU C;  2XAF A;  1A04 A;  1DGW Y;  2ZBK A;  3BT9 A;  2DMU A;  3BY6 A;  1JKQ C;  1YRN B;  2MC4 A;  3LOC A;  3DKW A;  1GLN A;  1UG2 A;  5E18 F;  3S14 J;  5K7F A;  2HPM A;  3M9A A;  3AL0 B;  5HLT A;  1U3E M;  4JYK A;  2P0W A;  3C2G A;  3LMM A;  1IN6 A;  3FBI B;  2LR8 A;  3WTY C;  1YOV B;  4EJW A;  1I3Q J;  1LPQ A;  4IHV A;  5A2Q K;  2LFB A;  4HST A;  2FBK A;  2PJP A;  5J8C A;  1G4D A;  2DW4 A;  2GQQ A;  1K4T A;  2QA4 I;  3OY9 A;  4HX8 A;  2DBB A;  3LAP A;  2LNB A;  4BE0 A;  3A01 A;  4P9F A;  3IAS 2;  3JRE A;  3GTQ J;  1H9G A;  3DKX A;  3COA C;  1XD7 A;  5GAD J;  3PFY A;  2UV1 A;  2NAZ A;  3RKW A;  3HM5 A;  2CO5 A;  4XKV A;  2LG4 A;  3RSN A;  1JT0 A;  4IXA A;  4KUM A;  2Z1D A;  2DU9 A;  4MEY F;  4Y7N J;  3BTL A;  4OIO F;  3HOW J;  2H8W A;  5B1A H;  1JHF A;  1EA3 A;  2FUG 2;  2F2E A;  1LKX A;  2F5V A;  4CUG A;  1X1P A;  3ZMT A;  4CZC A;  4J00 A;  2BW3 A;  1Z6T A;  4Z2Y A;  2DI3 A;  4BYY A;  4MQV A;  4XOR A;  5L3E A;  4RGU A;  1LEA A;  4D1Q A;  2M30 A;  4N9H A;  2LKX A;  1ZLK A;  1J9I A;  4FQG A;  3ZQG A;  2P81 A;  4EEF G;  2BVL A;  2QZ8 A;  2V6C A;  1H88 C;  1B1B A;  3VYU B;  1FBU A;  2N8G A;  3FDY A;  2XPV A;  2XC7 A;  2JPC A;  3C18 A;  4BHB A;  5FD6 A;  4XIC A;  3OYN A;  1X2N A;  1IO2 A;  2W25 A;  4BE2 A;  2V1X A;  1IW7 F;  1CGP A;  2XRO A;  2KDO A;  1HBX G;  1OCP A;  2KIQ A;  5E1Z B;  3DEE A;  1F1Z A;  3ML6 A;  4E7K A;  1YO5 C;  2OPT A;  2QVO A;  3MAJ A;  1GHC A;  3SYT A;  1LFP A;  1R36 A;  3HEF A;  1I6H J;  4CYC A;  2HNH A;  1LFB A;  4HRI A;  3OYE A;  2DQR A;  1VND A;  3U2R A;  4XKW A;  3FMQ A;  2E34 A;  4HV6 A;  4DNC A;  5M5Y J;  3DLA A;  4NHJ A;  2E36 A;  4DZJ A;  2FE3 A;  3G1M A;  1AKH A;  5L3G A;  3ABT A;  3V7C A;  3DBL B;  1YIO A;  2LY1 A;  1J59 A;  1LQ1 A;  3ZP5 A;  3DBR B;  2PJR A;  4RAZ A;  3OYG A;  2WB1 A;  4OIP F;  3JRB A;  1B9M A;  4A3L J;  3FXM A;  4EJV A;  3LFU A;  3WTX C;  5CQG A;  1W5S A;  1TP4 A;  5JI6 A;  1VQO I;  2FA5 A;  4O6J A;  2GIZ A;  1PYV A;  3BR3 A;  1ZLJ A;  2NVX J;  2D45 A;  2WBM A;  3VPR A;  3F72 A;  1CQT A;  1LB2 A;  3CUO A;  2EFW A;  3HOS A;  4EM1 A;  3BCA A;  2DDA A;  2L7Z A;  5GPA A;  2JUG A;  3OS0 A;  3I56 I;  4A0X A;  1RZ4 A;  1JJ6 C;  3BDD A;  2YUS A;  2R7X A;  2WWY A;  2FXA A;  1W7P A;  1WCM J;  3E6D A;  5CPR B;  1T33 A;  2I10 A;  5ERI A;  4I98 B;  1XCB A;  3TL4 X;  3S3M A;  1QQI A;  4P1W A;  1K83 J;  1USS A;  1YW7 A;  2Z5U A;  1YQA A;  2X1C A;  3TQN A;  1U5T B;  1RR8 C;  2ACJ A;  2AXL A;  3V8J A;  3DEU A;  1R7J A;  2GAU A;  2XF5 A;  1BI2 A;  3CCV I;  3G1L A;  3G3Z A;  2QGU A;  2D1H A;  1S9H A;  2OCE A;  2P5V A;  3GBG A;  4QIW N;  1IGN A;  1KZH A;  1SVM A;  2L4A A;  5C4X J;  1TQM A;  4UNO A;  2GLO A;  1U9N A;  2JTV A;  4FCY A;  2DMP A;  3I9V 2;  1PP8 F;  4GGG A;  1FPQ A;  3K4M A;  4KMF A;  1FEX A;  4G7Z F;  3HOZ J;  1I50 J;  2GXG A;  2LBF B;  5LGU A;  1BIB A;  1UST A;  1OR7 C;  3MZ8 A;  1CF7 B;  1RNL A;  3ZN0 A;  4LB5 A;  1OLT A;  3DWL E;  1U8B A;  1W0T A;  3W2A A;  5H6Q A;  3DCF A;  5EEG A;  3S1N J;  4MNU A;  3PSI A;  6PAX A;  4PSX A;  5HNH A;  3Q5F A;  3HUG A;  4N9I A;  4RAY A;  2R5Y A;  1IDZ A;  2P8T A;  4PGH A;  4FX0 A;  4M9X A;  3VOE A;  2M87 A;  3F8F A;  4XQF A;  5D5X B;  3D1N I;  4P96 A;  2QKL B;  3SFZ A;  1WJC A;  4A5N A;  2E1M C;  1LUJ B;  4LLN A;  2EA4 A;  1TNS A;  2QYO A;  5LHH A;  3HXL A;  1XMK A;  2DT5 A;  2O7O A;  4IJA A;  1TQI A;  4CGZ A;  5DV5 A;  1YG2 A;  3F23 A;  2H27 A;  1G6N A;  1X58 A;  1TWF J;  1Z3Y A;  4Y15 A;  3AG4 H;  2XAJ A;  4ZC3 A;  1JGG A;  5DEQ A;  2IT0 A;  2LDU A;  1WJB A;  1VZ0 A;  5DM7 F;  4GXO A;  4RLF A;  1K61 A;  2MC3 A;  3BOQ A;  2RGV A;  3V4G A;  4D7M A;  3ZOB A;  2ZC2 A;  4XKC A;  3OYK A;  3DXJ F;  4L9T A;  4E70 A;  4AVP A;  4EVI A;  3N05 A;  2HKX A;  3E7L A;  1PUF B;  3FK7 A;  3HHG A;  2WAQ A;  3WU2 C;  4XLF A;  3LSR A;  4WXD A;  1IAW A;  2E1C A;  4I76 A;  2B7E A;  1Y39 A;  3KYC B;  1GDT A;  4D5C A;  3JSO A;  2JJ7 A;  2W84 A;  3B73 A;  5B66 C;  2ZCW A;  4XSX F;  2LVS A;  3OV8 A;  3VEP A;  3K4C A;  2HYF A;  2A68 F;  3KET A;  3K70 D;  2R5Z B;  1FOK A;  1C0W A;  3NWT A;  1JKO C;  2E2J J;  3RJP A;  3A4C A;  4LOC A;  3DPU A;  1QHH D;  2DT7 B;  1F9N A;  2XHK A;  3JAM Z;  3HOX J;  3DEW A;  2VQL A;  5EDN A;  1G59 A;  4XRF A;  3TOB A;  3S1R J;  2LRD A;  4A69 C;  2GM4 A;  1EH8 A;  1JUP A;  1WQ2 A;  2VOP A;  2R7Q A;  1ZKG A;  3FMS A;  1B9N A;  3H35 A;  5H6R A;  1UG0 A;  4XLC A;  3VFZ A;  4BJT A;  4L18 B;  5CVU A;  2JMW A;  5HS7 A;  1D1B A;  3ZMS A;  1PVE A;  2VKE A;  2TDX A;  1FTZ A;  2AQE A;  1TZL A;  3K2Z A;  3ZQ7 A;  2PFB A;  4A6D A;  5EEH A;  2RV8 A;  2IS6 A;  1F43 A;  3SHF A;  2EK5 A;  4JX6 A;  1SMY F;  2ZO4 A;  2BY2 A;  4BQQ A;  4CIC A;  4Y52 J;  3MFK A;  3HTU A;  2DPU A;  1ETQ A;  4CCN A;  1D0Y A;  2HXO A;  2IAI A;  4CHU A;  3HRT A;  3ABM H;  4KN4 X;  3LWF A;  2EH3 A;  3RQ4 A;  3DFG A;  1UZC A;  5EYR A;  4ENK A;  2VJJ A;  2K4B A;  1T39 A;  2MG4 A;  1ZAR A;  4QLC U;  5TGT A;  3FIS A;  4BJ6 C;  1BJA A;  5BQT A;  3IUO A;  1RUO A;  4NC6 A;  4PK4 A;  1UHM A;  5IP9 J;  4MTD A;  2EA2 A;  3PQJ A;  4ZZL A;  3E97 A;  3QU3 A;  1J7K A;  2F48 A;  1OFC X;  3TKY A;  2FF4 A;  3EUH A;  1FMW A;  2CQK A;  3GUD A;  2QSG X;  1RC9 A;  4HZF A;  4RB1 A;  4DW6 A;  4ENM A;  2BXZ A;  3CTA A;  2DA7 A;  1ZG5 A;  1Q1V A;  2FRH A;  4M3E A;  2PQ8 A;  3ONQ A;  1AU7 A;  2A61 A;  3OWT A;  4HG2 A;  3UR3 C;  1AWC A;  5JHU A;  5IYD J;  2BGC A;  4IHS A;  1TWA J;  3MKW B;  2XV4 S;  3JTH A;  2MLG A;  4OIN F;  2DO7 A;  2V1N A;  2QCO A;  4AID A;  3TDU C;  4C3I J;  4UVC A;  5HLI A;  3LSK A;  1QPM A;  4RGR A;  5C4J J;  1O7L A;  1MDM B;  4UUS A;  2ZME A;  2WAD A;  4GO1 A;  2LC2 A;  1Z6R A;  1X1A A;  1R4M B;  2CMP A;  3IKV A;  5FKM A;  2DOF A;  4EM2 A;  1FTT A;  5E20 A;  3IRR A;  2FML A;  2ZXH A;  4Q47 A;  4XM3 A;  4XID A;  3WU1 B;  2XB5 A;  1GUU A;  2LLK A;  1WRJ A;  4ZYH A;  4DIQ A;  2ZJQ F;  3X2Q H;  2L9R A;  4JOM A;  1HW2 A;  2LOO A;  2KZV A;  4HX4 A;  5CYV A;  1ETY A;  2GIV A;  2WV0 A;  4PCQ A;  3LSP A;  3L2V A;  1XDS A;  2OAZ A;  3SEQ A;  4ZYG A;  1UAA A;  2EPF A;  2DT6 A;  4L9J A;  4Y4R A;  2VKH A;  3IWF A;  2EBI A;  2WY8 Q;  3SDG A;  1JJ8 C;  1FWZ A;  2XVC A;  3L2Q A;  1XSD A;  1MD0 A;  1ORK A;  1OYW A;  2XPW A;  3JW4 A;  5LBQ A;  1MMA A;  3WHB A;  3S17 J;  2X6W A;  3S32 A;  2RNG A;  1I5Z A;  3JRI A;  2EWN A;  3KIO A;  4LD5 A;  3M8E A;  2IA1 A;  3KP3 A;  2KZG A;  2OCC H;  4F92 B;  4HDU A;  5LHG A;  2K40 A;  2IRF G;  1OQY A;  4RB2 C;  4BBR J;  2COB A;  3MQ0 A;  1ZR2 A;  2ME6 A;  4BNC A;  3D5R C;  4YG2 F;  2M0M A;  1OKR A;  1FIP A;  1DUX C;  1Z7U A;  3BG7 A;  2D2W A;  4P9U A;  1BW5 A;  2IVM A;  5DCM B;  1G2H A;  5J1Y A;  2KT0 A;  3WG7 H;  2W48 A;  4ABZ A;  2H1K A;  2LKP A;  1W5T A;  2A5Y B;  2V7F A;  4ESJ A;  1WJ5 A;  2F5E A;  2X0L A;  3CZ6 A;  3L2W A;  2DMQ A;  4A3E J;  4WF2 A;  1PP7 U;  4HF0 A;  1LDD A;  4ZTF A;  4QSH A;  4EQQ A;  4YIR X;  1ZRD A;  1TQP A;  2PG4 A;  3I59 A;  1XGN A;  5GTI C;  3JRH A;  2PX9 A;  3BR5 A;  3ZMU A;  3C1D A;  4X0G A;  1HST A;  4QTR A;  1AHD P;  2IGO A;  4WXC A;  1ETK A;  5D4S A;  1X19 A;  3J80 K;  3WTU C;  2VN2 A;  1OYY A;  2IGK A;  1Z91 A;  1RR7 A;  5HS8 A;  4WK8 F;  4XK4 A;  1D5Y A;  1NK3 P;  2G0E A;  2K3F A;  3R6S A;  1O7F A;  4E6K G;  3E5U A;  1MIJ A;  2P7C B;  3BC8 A;  1XSV A;  1ZRF A;  3LSH A;  3J81 K;  3F3X A;  2FOW A;  4A0Y A;  2R7D A;  4KJZ A;  4LK1 F;  4RB3 C;  1SFE A;  2CQX A;  3DKY A;  1A6Q A;  4B48 A;  2CV2 A;  2ESN A;  5L3B A;  3OMY A;  2Z9O A;  1SAU A;  1FX7 A;  1WWX A;  3DBH B;  4A93 J;  2Y69 H;  3HOY J;  2ICW G;  3PQK A;  4LK0 F;  1FOX A;  5IT9 K;  4FX4 A;  3A1Y A;  1STZ A;  4HNU A;  4C2M J;  2M45 A;  3EUA A;  5DD8 A;  1FY7 A;  3IL2 A;  1K78 B;  2TCT A;  3T5X A;  5E3M A;  4BEH B;  5ICF A;  5E17 F;  5F0H A;  4M9S A;  3U21 A;  1DPU A;  4CXF A;  5EGO B;  3DLL F;  4C9Y A;  2UWM A;  2M34 A;  4S0H B;  2IJL A;  1E2X A;  2YU3 A;  4JBA A;  4CYD A;  1NG6 A;  4UB8 C;  1WH5 A;  2E7W A;  4BXU A;  3DQV C;  1GT0 C;  1RET A;  2OD5 A;  3E5X A;  4A2U A;  4IOC F;  1VTN C;  5IT3 A;  2LMD A;  1Y8R B;  5IYB J;  2BE5 F;  3CDL A;  4AYB N;  1DU0 A;  1T0F A;  5K7H A;  3P9C A;  4G9Y A;  3KX2 A;  9ANT A;  3HSF A;  1ETV A;  1ETW A;  5DCF A;  3WTW C;  4IX7 A;  2DA2 A;  1GV5 A;  4LJZ F;  2DFF A;  3IRQ A;  5M3F J;  1UJ8 A;  1O3S A;  3RI4 A;  3LFK A;  3GCM A;  1B6A A;  1V54 H;  1G3Y A; 
#chains in the Genus database with same CATH homology
 3OYN A;  3OIP A;  4BE2 A;  4HPQ A;  2KDO A;  3DEE A;  4E4H A;  4NC8 A;  3ZR8 X;  2A5W A;  4E7K A;  2OUM A;  3SEZ A;  3OS1 A;  3SYT A;  1LFP A;  2CV0 A;  1MND A;  2HNH A;  3F9K A;  2W1O A;  4HRI A;  2LYC A;  3OYE A;  2LBF A;  1ERD A;  2V4J C;  2ZSI B;  4E7H A;  4IQ4 A;  4XKW A;  1X4P A;  3OS2 A;  2E60 A;  3PJR A;  3CMM A;  3DLA A;  2L7K A;  2XF6 A;  1T0F C;  4NQW B;  4B3X A;  2DXI A;  2X85 A;  2DOA A;  2KRC A;  4RM3 A;  4CH7 A;  2JA2 A;  2VB6 A;  2WA0 A;  4YRV A;  2LY1 A;  2WY7 Q;  4J01 A;  1E0E A;  2M3A A;  3K70 C;  1LDK B;  2E1M B;  2O5R A;  4BS9 A;  1V5E A;  2PJR A;  2E5Z A;  2JVH A;  3OYG A;  2WB1 A;  3DTI A;  3OYD A;  2F4I A;  3C2H A;  4F93 B;  1BR2 A;  3QOE A;  3SDB A;  2X51 A;  3LFU A;  4BAC A;  4IQJ A;  5CQG A;  2CV1 A;  2Q2E B;  2HZD A;  2M7A A;  2VXZ A;  2IS4 A;  4Y33 A;  3H5A A;  3BCB A;  1PYV A;  2PMZ A;  4CCO A;  4JQF A;  2WBM A;  1Z7L A;  4PJJ A;  2R7R A;  3SZG A;  5FRN A;  3W2V A;  3HOS A;  1U0J A;  1DGR M;  3BCA A;  4XON A;  4NC7 A;  1DQU A;  2JUG A;  3DU5 A;  3OS0 A;  3OYI A;  4LG3 A;  4CSW A;  2V6E A;  2R7X A;  2HU9 A;  4F91 B;  3CES A;  5CPR B;  3K4N A;  4AYB A;  3TL4 X;  3S3N A;  2IGN A;  4XLH A;  3S3M A;  4P1W A;  3HG9 A;  2CUZ A;  2X1C A;  3MMY B;  2VL8 A;  2VAS A;  2VQH A;  2XF5 A;  2BVM A;  2V9K A;  2HVQ A;  4ZTJ A;  3VYS B;  2VJI A;  1R6R A;  1S9H A;  5FRO A;  3BLY A;  3GBG A;  3W2W A;  4EAT A;  3OYB A;  3MKY B;  2R7T A;  2GOM A;  4ANJ A;  3S93 A;  3VYR B;  2ZFU A;  2CW7 A;  2K5C A;  2VQC A;  3RCO A;  3RTR A;  1MMN A;  3I9V 2;  4U87 A;  2HPI A;  3LSG A;  2KL4 A;  3K4M A;  2M4K A;  1W36 C;  4OAZ A;  2LBF B;  2Z16 A;  1P9Q C;  1OR7 C;  2Y0S A;  2K9M A;  1OLT A;  3DWL E;  4LIV A;  2Q1Z B;  3W2A A;  3FBN B;  3PSI A;  5KNL A;  4PSX A;  5HNH A;  3QYE A;  3H5N A;  2VQG A;  3H9J A;  4YEL A;  2LRE A;  4AU7 A;  4E7I A;  4HNT A;  2CFO A;  1YX3 A;  3DU6 A;  1NG7 A;  4XQF A;  2DCE A;  2QKL B;  2VJ5 A;  3V42 A;  3ZGK A;  4XKB A;  2PJR B;  1WJC A;  2E1M C;  2MFZ A;  3NWS A;  4KIS A;  1QU3 A;  3HXL A;  3KEY A;  3HPG A;  2CUJ A;  1FMV A;  2W7N A;  4C2U A;  3ZQQ A;  2WAF A;  3VSL A;  3OR1 C;  2M7B A;  3RPU D;  1WJE A;  3VSK A;  1JI8 A;  1BOB A;  1Z3Y A;  2R7O A;  2MYS A;  4ZC3 A;  1WJB A;  1VZ0 A;  4RLF A;  1N77 A;  4IKF A;  2R7U A;  2XSJ C;  2JSP A;  4LIU A;  1BR1 A;  2IXS A;  1QHG A;  4PJL A;  4PJM A;  3QYB A;  4XKC A;  3OYK A;  2CH0 A;  2HVS A;  3N05 A;  4BE1 A;  4RM2 A;  3OYH A;  2KHM A;  1UEL B;  4Y3O A;  2WAQ A;  3ZRG A;  4XLF A;  4PUS A;  4CCK A;  1MW7 A;  2HDW A;  1YE9 A;  2IGM A;  4XN0 A;  5HNF A;  3FHN A;  2JVG A;  3H9Q A;  4B44 A;  4ZJZ A;  3K70 D;  3OR2 C;  2VJ4 A;  3K4C A;  4C30 A;  2RQQ A;  1J09 A;  1WFX A;  3NWT A;  4CA0 A;  2GOX B;  3A4C A;  3DPU A;  1QHH D;  3L2U A;  2DT7 B;  3CP8 A;  4KIT B;  2VQL A;  1G59 A;  2LRD A;  2NOJ B;  2WAE A;  2R7Q A;  4PFO A;  3W3C A;  3H35 A;  4LIT A;  1UG0 A;  4XLC A;  4BJT A;  4BQO A;  4NUB A;  1D1B A;  3PNV A;  1X1D A;  1D0Z A;  4OWR B;  4XOT A;  4BU2 A;  2AQE A;  5JHF A;  1TZL A;  1TT0 A;  2W82 A;  1PJR A;  2X6Y A;  2IS6 A;  4ZDP A;  1N75 A;  4ZYA A;  2L9N A;  3K4K A;  3HUG B;  2R7W A;  4F3Q A;  4BQQ A;  3HPH A;  4CCN A;  1D0Y A;  5CQE A;  2L9S A;  3CP2 A;  2R7S A;  2X1D A;  2IS2 A;  3IAM 2;  3RQ4 A;  1G8X A;  2VJJ A;  2KP6 A;  1MNE A;  3FKJ A;  3K4J A;  3K10 A;  4DBR A;  3E1S A;  1HA8 A;  3VWB A;  2BOL A;  5TGT A;  4BJ6 C;  1YX5 A;  4II2 A;  2ELJ A;  3IUO A;  4PSW A;  4PK4 A;  2VPL A;  3PNY A;  5KCM A;  4C2T A;  3M8J A;  3HL2 A;  3EPZ A;  4DGW B;  1K6Y A;  2A6T A;  3CJQ B;  3ZCO A;  1KON A;  3K4L A;  4ITV A;  3TMO A;  1FMW A;  1W36 D;  3M1C A;  2R4G A;  1WJA A;  3VYT B;  4PJN A;  2QKM B;  2MAB A;  1IRX A;  2K9L A;  4PFP A;  3ONQ A;  2LY2 A;  3OWT A;  2XDV A;  4HG2 A;  3UR3 C;  4CCJ A;  2X6X A;  4XN3 A;  4QPQ A;  3MKW B;  2L5Q A;  1X1C A;  2K3P A;  5LD2 C;  2KRH A;  4XNF A;  2V1N A;  2DJI A;  2UUZ A;  4D9J A;  3HC7 A;  3LSK A;  4XOP A;  2KPM A;  4HSR A;  2VLA A;  4XLE A;  2WAD A;  2LC2 A;  2RRE A;  1X1A A;  2CMP A;  4P5O A;  3I3L A;  1X4O A;  4ZDL A;  2ZXH A;  4XM3 A;  3BG6 A;  4FET A;  4DIQ A;  3EUH C;  3LSI A;  3HKZ A;  3TBI A;  4JOM A;  2LOO A;  2KZV A;  2XF7 A;  3K4B A;  3L2V A;  1T95 A;  1V5G A;  2ZXI A;  3SEQ A;  1AA7 A;  1UAA A;  2DT6 A;  4XR6 A;  4Y4R A;  3DTE A;  4B43 A;  2VKH A;  3LSM A;  4BXF A;  1DP3 A;  4H4K C;  2WY8 Q;  4RMN A;  4KT6 A;  3L2R A;  4BL0 B;  2CS3 A;  3EUK L;  3L2Q A;  2VXD A;  3IP4 B;  4E7L A;  4YEJ A;  1MMG A;  3OYC A;  3UNG C;  1MMA A;  3E0J B;  4OAY A;  2V26 A;  2X6W A;  4G6T B;  3S32 A;  2RNG A;  3CJR B;  3MD2 A;  3OYA A;  2F6C A;  3PSF A;  2X1E A;  4BEH A;  3OL3 A;  3LL7 A;  3G2B A;  3OL4 A;  3QOD A;  4DBQ A;  4F92 B;  3DPT A;  3A2K A;  3K6G A;  3PNT A;  2KMU A;  2CW8 A;  2MD0 A;  1V5F A;  4CCM A;  2W00 A;  1MMD A;  3S8P A;  3D5R C;  1D1A A;  3AL0 C;  2M4G A;  2M0M A;  3OIQ A;  2XAU A;  1Z21 A;  3BG7 A;  3MKZ A;  3KYL A;  2IS1 A;  4N4O B;  5KHD A;  3H9G A;  4FAS D;  3H0D A;  2V7F A;  1WJ5 A;  3L2W A;  3CZ6 A;  2ZSH B;  4ZTF A;  2LH9 A;  2AQF A;  4B47 A;  4R79 A;  4HEA 2;  3HOT A;  2VIX A;  4U7B A;  4GRI A;  2KQR A;  1SFK A;  3CF2 A;  3OOU A;  4X0G A;  2Z2S B;  2HVR A;  2L2O A;  2IGO A;  1X19 A;  5HOO A;  2E5N A;  3QYF A;  4BGD A;  2IGK A;  4BUP A;  5LFA A;  2KLO A;  4NNJ A;  1DGW Y;  3ZXS A;  1BR4 A;  4AVZ A;  4E6K G;  4F52 A;  1X1B A;  2BW3 B;  4N4N B;  3BC8 A;  3AKZ A;  2MC4 A;  4CCL A;  1GLN A;  4BQN A;  3LSH A;  2HPM A;  3AL0 B;  5HLT A;  1LVK A;  3VDX A;  1N78 A;  2P0W A;  3C2G A;  3LMM A;  4KJZ A;  3FBI B;  2VKD A;  1WJF A;  3DKY A;  1Z3X A;  4HST A;  4B48 A;  2CV2 A;  3AFH A;  3OMY A;  3D5L A;  1D0X A;  1SAU A;  4DOZ A;  4F55 A;  4MLO A;  4BDZ A;  4XLA A;  3DPL C;  3OY9 A;  4E7S A;  4XL9 A;  4BE0 A;  2W4S A;  2I8D A;  4BDY A;  4ZDO A;  3H5R A;  3A1Y A;  3IAS 2;  4HNU A;  3DKX A;  3EUA A;  4IZZ A;  3PFY A;  2UV1 A;  4BEH B;  4XKV A;  3RSN A;  2LG4 A;  3U21 A;  4RLQ A;  4DJA A;  3OYJ A;  2UWM A;  4C9Y A;  2Z1D A;  1Y56 A;  2OV7 A;  1NG6 A;  4E7Z A;  3DTK A;  3DQV C;  1Y6I A;  5FRM A;  2OC6 A;  1D1C A;  3PL8 A;  1EA3 A;  2FUG 2;  2F5V A;  1LKX A;  4CUG A;  4CZC A;  4J00 A;  2BW3 A;  3OYM A;  4XMY A;  3OYL A;  4XOR A;  4BJ5 C;  3OYF A;  3KX2 A;  5CKT A;  1WJD A;  4D1Q A;  3S3O A;  4E7J A;  4IX7 A;  5HVQ C;  2BVL A;  4II3 A;  2R7V A;  3PUB A;  3VYU B;  1ZEL A;  3J7A Y;  3FDY A;  3D5S C;  4QPO A;  2HQA A;  2XC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...