2LC2A

Solution structure of the rxlr effector p. capsici avr3a4
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GSSGSSGNVDSNQNKASMLQARLNDEAGGTRLLRVHHESDTEERGFLEKAAVKKMAKAIMADPNKADEVYKKWADKGYTLTQMSNFLKSKTAGKYDRVYNGYVIHLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords AVR3a4
publication title A PIP-binding interface in the oomycete RXLR effector AVR3A is required for its accumulation in host cells to modulate plant immunity
rcsb
source organism Phytophthora capsici
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16810 RXLR RXLR phytopathogen effector protein, Avirulence activity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lc2A01
3ZR8X 2LC2A 3ZGKA
chains in the Genus database with same CATH superfamily
1OMIA 1KU7A 3L9FA 2VN2A 3ZPLA 2LLKA 3DTKA 2KLOA 3E5QA 4L9VA 3Q9VA 3LSHA 1UHWA 3V8JA 4DIQA 4G7HF 3G1MA 4IKFA 2WTEA 3SFIA 4F91B 1S72I 2DQLA 2EA4A 4CGZA 4QWQA 4Z6YA 2DMNA 4M3BA 3HRSA 3KP7A 1MMDA 1T0FA 1D5YA 4G7ZF 1SD6A 2JUGA 2K7LA 2CRGA 1N78A 1AHDP 1SVLA 4LLNA 1WZ2A 2GZWA 5LRSA 2OBPA 4Y15A 2HNHA 1SMYF 3ABKH 1POGA 1ONVA 2F5FA 3HBLA 4IQJA 1FZPB 1AKHA 2AO9A 3VSLA 2Y31A 3K4JA 5CVUA 1A5JA 5K7FA 5LHHA 5D4SA 2LFBA 2BW3A 2VQHA 2Q8KA 4BKXA 2RGVA 3WGHA 2P5VA 3LA3A 4FT8A 4I2OA 3BOQA 1T0FC 3D5SC 4QSHA 3F8CA 1FMWA 1O7FA 2HDWA 3WU0A 3ZQQA 1FSHA 5M5YJ 2XPWA 1XMKA 4HNUA 5CPRB 3FXKA 1XPXA 2G0EA 2QBYA 2GBYA 2PFBA 2GXBA 3VEPA 2XGEA 3OYCA 4E7IA 2H8RA 3JAMZ 1Z3YA 4U7BA 1ETWA 3K4LA 3WTXC 1Z91A 4OIPF 2XAFA 4P9FA 4XLAA 4ABZA 2HPMA 2FF4A 3CUOA 3I58A 4J19A 2BBYA 1VQ9I 2B9SA 2DYRH 2MH2A 2IJLA 2Z33A 2P7CB 4G94A 2W24A 3PO3J 4EEFG 1ZKGA 4HF0A 1QHGA 1MSEC 1S7OA 2ZSHB 2KMUA 2VPRA 2NVYJ 2RAEA 4KYWA 1FIPA 2CUZA 1LB2A 2FA5A 3H9QA 1F43A 3BJ6A 2P7VB 1KQ8A 2DOEA 4PJ0C 3BZKA 3VOEA 1YLFA 1X3WB 4MIMA 5L3CA 4HQEA 3TMOA 3R6SA 1IDYA 2JZYA 3PO2J 1HW2A 2BVMA 1V5FA 4JYKA 3I71A 5D5XB 3HHGA 5F04A 2NS8A 3ZCOA 2JVHA 4KMUX 2ME0A 2P6SA 3H9JA 2OUMA 4OAZA 3HGGA 1OCRH 1SFUA 1JTYA 2BOLA 3FX3A 3S32A 2E5ZA 1R71A 3E5UA 3WTUC 3KCCA 3KFWX 4UVCA 1SD5A 4MFDA 5BPDA 3HTUA 2V1UA 3IC7A 1MBKA 5ICEA 1LKXA 5K7HA 2YU3A 1IO2A 4EM0B 3E6DA 1WJDA 4UUTA 3T8RA 2M2EA 2Y30A 2DK5A 3G2BA 2QGUA 5CJ9A 3M9AA 4GGGA 1HXDA 5GP9A 3OYJA 5HVQC 4N9IA 4CCOA 2I5UA 3S17J 3DPTA 3FXRA 3VYSB 1I6HJ 4DYRA 1ETQA 5KNLA 5M3MJ 2R3SA 5JLXA 1EJ9A 3I55I 2R7WA 2WA0A 4L9TA 3DQVC 5DCMA 1LJ9A 4JX4A 3KEYA 3FHZA 4M74A 2R7OA 2Y9YA 4KDPA 1LDDA 3DCFA 4OU0A 4KMFA 1KYZA 1SFOJ 2EIJH 1T98A 1OYYA 1K4SA 2NRAC 1ZGAA 3EYYA 1IV8A 4F3QA 1WSUA 4IHXA 3WG9A 3HTSB 2EBIA 1D8JA 4A5MA 2XGXA 5J1RA 2LG4A 2EWNA 2K85A 1KU3A 3ERED 3M4OJ 1ETVA 2VKHA 4YIFA 3H9GA 4CSWA 3DBLB 3KLNA 4U88A 2DO7A 2FBIA 2CW7A 4A6DA 4IZZA 1HC8A 4ZDOA 3P9IA 1VQ7I 1OCPA 2DTRA 3P7NA 4KIFA 1IN4A 2LBFA 3ZQIA 4XNFA 1HDDC 2O8KA 1X3UA 4ENMA 2QF7A 1W7PB 2EFNA 2AQEA 1I5ZA 1JUMA 5DUIA 1J2XA 5DS9A 2PX9A 3J7ZI 2LTPA 2STWA 2HU9A 2VLAA 1P7IA 4PJLA 1HOMA 1WFXA 5FROA 1IAWA 3V7RA 1TLHB 2Y75A 4EJTA 1LDJA 2VE9A 2NOGA 4R8HA 4P1WA 4A5NA 4A3CJ 2L9VA 2A3SA 2EB7A 1BR4A 5BQTA 3SEZA 1VQ4I 1PUFA 1EV7A 5E8GA 1SANA 1MNEA 2XSJC 3TQNA 1UG0A 2AQFA 1FSEA 3AL0B 4W1UA 2MD0A 4ESBA 2L4MA 3U1KA 3DEWA 1JGGA 1RUOA 1WGXA 3RQ4A 1RPWA 4F7ZA 4IEJA 2O61A 4YFXF 1BN5A 1P4AA 2HZDA 5CQGA 3KPHA 1QO0D 2HEOA 1F36A 2CSOA 2OU2A 4YFNF 4BGDA 2OPTA 2HI3A 2FOWA 2W84A 5E20A 5J8FA 4ZYHA 2L7ZA 3GTGJ 2ZXIA 2FXAA 3HM5A 3ZGKA 2GA2A 5HNHA 3K4MA 4RAFA 3WHBA 2XAQA 2L02A 5CYVA 3HOZJ 1TWCJ 2E2IJ 2OTJI 1Y8RB 5ICCA 1HCRA 1HKSA 4A3DJ 2KDZA 3TP0A 2O6GE 3HIFA 2K9LA 3HUGB 3Q9SA 4I76A 3FXUA 1Y56A 3U9GA 5H20A 3FF5A 3FIWA 3M1CA 4XRMA 2PJRB 1WCMJ 4YEJA 3OS2A 5D5VB 1OYIA 3LSTA 5E3OA 2LD5A 3OIPA 1G3YA 4BU2A 4BQQA 1OKRA 2CQQA 2MC3A 4RB0A 2DFHA 3TOAA 3IL2A 3I59B 3N05A 1D5VA 3K1PA 3SZTA 1ZYRF 1FIAA 1O4XA 4E7KA 1WJAA 3FM3A 2PI0A 2R7XA 2QENA 2QQ9A 4NC8A 1CF7A 3HOWJ 3TBIA 4CCJA 2BY2A 4CHUA 1U5TB 2MFZA 3K69A 1Z21A 4BE2A 1U8BA 4RAZA 2VJIA 4IOAF 5DCFA 1ZR2A 4A3JJ 1UAAA 2DMUA 2CUFA 1UCRA 1V55H 5H6RA 2VJ5A 3OV8A 3L2CA 3S1QJ 2HVQA 3RCOA 5FKMA 3KZIC 3P9CA 2W7NA 2EZHA 3A0HC 1H0MA 1LDKB 1MW7A 5GAHJ 3GTLJ 5KHDA 4O6JA 3OYAA 4P9UA 1GUUA 5K7ZA 5B66C 2KIQA 1XN7A 2AXLA 3QQAA 3FXOA 3H3ZA 3WTSC 3ZMVA 1IC8A 2JUCA 2W57A 4XMYA 1E3PA 2PLYA 3VYRB 4A0ZA 1Z9CA 4WF2A 1VQNI 2R92J 5IT3A 2Z99A 1BJZA 1JT0A 5CVIA 3ZOBA 4HZFA 2NVTJ 3IP4B 2DK8A 2F2EA 2GIVA 1IUFA 5LEJA 4B4CA 2OTLI 1XDSA 3TO6A 1L3LA 1J5YA 4EQQA 3CC4I 4G6TB 3JRIA 3E6MA 3OYKA 1YX3A 2IS2A 4HV6A 3V42A 3IRQA 3D5LA 3H1CA 2WAEA 4D9JA 4F52A 4A3FJ 2DFIA 2KHMA 4M9XA 1BIAA 2MYSA 2WY7Q 5HLGA 2PN6A 4U7DA 5M3FJ 2ID3A 3LMMA 2HKXA 1KU2A 4HX4A 4QPQA 3OYMA 1BW6A 5LRRA 2ZMEB 4GCVA 2LY9A 2JRMA 1BI0A 3IWZA 5L3EA 2KRFA 2L7FP 5KVRA 5E8IA 3DBRB 4LGWA 3RPUA 3OYNA 1A31A 1S8NA 2LKSA 2LNBA 3I4PA 2FUG2 1J0RA 2RNJA 2XROA 4IHTA 2VXZA 3IH2A 3ZMZA 2XF5A 2PBIA 2VASA 3A1YA 5J1UA 2P5LC 4WK8F 1F9NA 3FMSA 4M72A 4S05A 2E1CA 1FEXA 2O9LA 3SJMA 2HVSA 1QZYA 1U6GA 5B3SH 1SFXA 2JTVA 1SD7A 5DM7F 3HKZA 5EDNA 2KRHA 3WG7H 2OJED 1YYVA 4PFPA 3REOA 1C0WA 1R7JA 5CVJA 3WTZA 5HLHA 5EZHA 3COAC 4FASD 1BI2A 3DKYA 1S7EA 2QLZA 3QPTA 4NUBA 2Q2EA 2K40A 3ASOH 3BROA 1P2FA 3OIOA 3FMRA 4EJWA 3LSPA 1JJ8C 2K3FA 3BCBA 1FYLA 4CCKA 4KT5C 2PMUA 2PJPA 1RRJA 2E1OA 4PUSA 1B72A 2IS1A 1FBQA 3K10A 2E1MC 4RM2A 3C7JA 3WE2A 3M8FA 3OYEA 2O03A 2EV6A 2K9SA 5HOOA 4PJMA 1FYKA 5IT9Z 5EEGA 1R5ID 2ZNYA 2VQGA 1XS9A 3S3MA 4DZPA 1MBGA 2X1DA 2HQAA 3WU2C 5FFXA 3CCMI 3JTHA 3CDLA 2STTA 5D8KB 4UY8I 2IEKA 2DFFA 2XAUA 3F21A 4D7NA 2FNPA 1S7AA 3MKWB 3CC7I 1B8IB 3S16J 2JT1A 3CMYA 4CYCA 2F4MB 2VBXA 2F5EA 3OOUA 4YIRX 3OYBA 2XAGA 2IGKA 4CCMA 2W25A 3QODA 2V6CA 4LOCA 4F93B 3CC2I 1JGSA 2JSPA 3HG9A 3KX2A 2EPFA 1F4KA 1FP2A 4KITB 1MDMB 3AAFA 5F6FA 2V9VA 3FBIB 4P96A 4OMYA 2NNNA 5K5RA 1PJRA 5TJJA 5LD2C 4M71A 1NG6A 1MH3A 2LF8A 4KT6A 2R7ZJ 2BXZA 2FEZA 4HX8A 5EGOA 4E7LA 5JFRA 3F8MA 3C2HA 3RYPA 2MLKA 3CCUI 2E34A 5HDGA 4ITVA 1VNDA 2EQRA 2KIUA 4Y3OA 2JMWA 3CZ6A 4C2MJ 2UXNA 1RNLA 2GWRA 4U0WA 1X58A 3IKTA 3ZN0A 2VT2A 4IVNA 1PDNC 1UMQA 2HQNA 5GPCA 2KDOA 2OCCH 1Z7LA 2UV1A 5ICFA 4N4OB 4BYYA 2XPUA 3KZZA 3CF5F 1PUEE 2K9MA 3BR2A 2E7WA 4BL0B 1H9GA 1MMGA 4M6YA 4PDKA 5C44J 1JKQC 4A3LJ 2QSHX 3MZYA 4Z2YA 4EGYA 2VONA 1L0OC 3RKYA 4EJUA 4BXXJ 4II2A 3GFJA 4XKBA 3G6EI 2ESHA 3GTJJ 2V9KA 1R1UA 2MH9A 3IRRA 2VOOA 2FQ4A 4I02A 3IAS2 4HV5A 1WJCA 4BEHA 1BBYA 3KP3A 4DW6A 5BNGA 4LK0F 1YITI 3G71I 1AA7A 4MQVA 1SAXA 4BY7J 2ZBKA 2F5DA 2ZXHA 3QP5A 2CJJA 3CJRB 2Y0SA 2YUSA 2HWVA 1HF0A 1HQCA 4KUMA 3F6VA 3HRMA 2LP0A 2DODA 1QNTA 4RB2C 1G3WA 4PGGA 3D1NI 3CP8A 4IRHA 3GW2A 4L5JA 4XLCA 5B5EC 4I6ZA 3J81K 3OIQA 5CLSA 4A3KJ 5F0CA 2A6EF 5L3GA 1FOKA 1ERDA 1TNTA 3QAHA 4B8XA 3F8NA 1APLC 4UVAA 1BC8C 3DKWA 4A2UA 1FC3A 2CYYA 2JSCA 4PFOA 3ZR8X 2DI3A 3FKIJ 5LBQA 3DFGA 2XSDC 1QU3A 3EPZA 3FWEA 4BJTA 3SHFA 1R6RA 1RESA 2BV6A 3GTOJ 2M87A 2EZLA 5GPAA 1LE8B 2A6TA 4RS8A 2DAOA 3KYLA 2VBWA 4ZTJA 2FOKA 2H6CA 2CMPA 1STZA 4C2UA 3VDXA 1RC9A 1YHQI 3J80K 1U9NA 4HSRA 1KONA 4WXCA 5JHUA 2XF6A 4BY1J 2V6EA 4I98B 4NBQA 5K5OA 2AS5F 3PJRA 2XDVA 4M3DA 2GLOA 3F3XA 3PIOF 2R7VA 1R23A 2X4HA 3EETA 2R7QA 2JPCA 2O3FA 1ZLKA 3GTPJ 2KT0A 3PSIA 4DOZA 4A3MJ 3M7GA 3MAJA 5CKTA 2P8TA 2QUFA 5JI6A 1K83J 4RAYA 5D6FA 3K2ZA 3MN2A 4CYDA 4YFKF 3M3YJ 1WH5A 5E3LA 3BR0A 1CGPA 2DT5A 4ZZLA 1WQ2A 4IXAA 4M9ZA 4MEXF 1OISA 2FSWA 3B02A 4IRGA 2F4OB 3HZJA 4HQMA 3OR2C 1J7KA 4WWCA 3ZP5A 3HXLA 2DA3A 2IW5A 1IN6A 1I3AA 5IT9K 1JHHA 5ILSA 3SDGA 1TC3C 4E6KG 2ME6A 2YX7A 2L01A 2PEXA 3KE2A 3TW6A 4D1QA 3E6CC 1B6AA 2DJIA 1RKTA 3TL4X 2VBZA 6PAXA 4XQFA 2HKOA 3Q0WA 3F9KA 5F64A 2DFEA 2FD5A 2DYSH 2BY0A 3LFUA 1I1GA 4U0VA 4A0YA 3RQIA 4GFBA 5FRMA 3DTEA 3S14J 3M8EA 1Y0NA 2I8DA 2NYXA 5EZGA 2NNYA 2A6HF 2CW0F 1B4AA 3JRCA 4I0BA 1LFPA 1T08B 4IQ4A 3LSMA 4PZJA 3JRFA 4CCNA 1PP7U 4CDGA 2VUMJ 4RGXA 3CCYA 1OCTC 1T39A 5K5QA 5AONA 3RJPA 1VF9A 3I53A 3S8PA 2BW3B 3SZGA 5HLTA 1MKMA 3FK6A 2VB6A 3Q0UA 5M5WJ 2GXGA 5DUKA 2K5CA 3O2PE 1WI3A 2QBYB 4IF4A 2V4JC 2ECBA 1QHHD 3IKVA 1BR1A 3E0JB 2LY2A 2X1CA 5F0FA 4C3JJ 1XC5A 3DPLC 4RLFA 4XLEA 3CO6C 4J01A 1ETYA 1K79A 3S3OA 4BDZA 3AG2H 3HOSA 2IS4A 4RGUA 4J00A 2A68F 1FBUA 4NQWA 4C9YA 2I10A 1TBXA 2RDPA 3GEZA 2ELKA 1FYMA 3U2RA 1USTA 2PQ8A 2DA6A 1ZN2A 2XF7A 4AU7A 3J7AY 3A03A 3I4NJ 3GXOA 4A69C 2R7RA 1W5TA 3S2DJ 2L9SA 3TO7A 3BC8A 1UG2A 5DYMA 2IAIA 1IF1A 2IRFG 5IPAA 3JREA 2K27A 2DQRA 4JOMA 1UJ8A 3KYDB 3DEEA 1YIJI 1G4DA 2HTJA 2EINH 3HKZN 1OPCA 3MCZA 3ERMA 1PP8F 2O0YA 5GTIC 4K2EA 3PSFA 5EJCA 3UNGC 3BLYA 3WE3A 3CCRI 2NOJB 4UV8A 1ETKA 1YJNI 3BZ6A 1FY7A 2E60A 2LC2A 3TO9A 4L0YB 3I9V2 5E3MA 5AIPA 5ICGA 4LJZF 1VQPI 2CV1A 4BE0A 1Z1DA 4WXDA 1Z77A 2D1VA 1FNNA 1R49A 1JKRC 3JRDA 1HSTA 1YE9A 2CU7A 3PUFA 1DU0A 3GTKJ 3I4MJ 2ZJRF 2LF7A 3VB2A 1YRNB 3JTGA 5DV5A 1YW8A 2L9RA 3DP7A 5GADJ 2XKPA 4XRSA 3OS0A 1XMAA 2CH0A 5LGUA 2ZNZA 2CQNA 1NG7A 1LFUP 2KPMA 2N8GA 2R7UA 2E19A 4I09A 2CFOA 2MBFA 4XIDA 2VOPA 3BTIA 3W6KB 3S15J 4P5OA 1ZK8A 2G7HA 2MG4A 2DA5A 2V26A 2EJRA 5BS6A 5JR3A 5J1YA 3H0DA 3M07A 1X1AA 2ZJPF 1Q1HA 1D3YA 1I6XA 5EG0B 2M0MA 4ZDLA 3CMMA 3W2AA 4TV7A 2DXIA 4HG2A 1XSDA 1WJEA 5IP9J 2E2JJ 3BR1A 2F4IA 4ESFA 5K1YA 3D5RC 1W7PA 1RI7A 4PJNA 3RZDJ 1IJWC 4QLCU 3G73A 1NK2P 1WRJA 2KJCA 2JA7J 3LA7A 1KGSA 1MMAA 1E0EA 4XRSG 5L3DA 1YW7A 2VE8A 1X1BA 1X1CA 2WV1A 1KZHA 2AXTC 2XV4S 2CV0A 1Q1VA 3OL4A 1FMVA 3L2UA 2WB1A 5GAEJ 3J7YJ 4Y17A 2QZ8A 3FXQA 4D5CA 4PSWA 3IAM2 2NVQJ 1IXSB 4LG0A 1RR8C 1MIJA 2Q0OA 1BOAA 2Y48A 2M45A 1JI8A 2BVLA 3B6CA 3BZCA 2HDCA 4PGHA 4BQOA 1E3HA 1A04A 1XCBA 3MEXA 1YO5C 2K4JA 2KIMA 1G2HA 1ZGJA 3BDDA 2DA4A 4FCYA 1ZRFA 3L2RA 1Y39A 1R36A 1F1ZA 4GXOA 3HYIA 1FP1D 2VODA 2D1HA 2X6WA 1JKPC 1V54H 1R00A 2M8GX 4DYQA 2ELHA 2QSGX 5M5XJ 2BY1A 2ZXWH 1GLNA 1UZCA 3BTJA 4BXFA 4ZYGA 2IBDA 2CV2A 3FISA 3CUQB 3NRVA 1MJ9A 2W85A 2M7BA 1UB9A 2CQKA 3BJOA 3IWFA 3OS1A 2ACJA 1ITYA 1XGNA 2X51A 4H4KC 2ETHA 4ESJA 5FLXK 2H8WA 3QU6A 3W6JB 2HTSA 2Z16A 4HEA2 2JA6J 1VI0A 5FGMA 1ZLJA 2L7MP 4XN0A 2XPVA 4ZYAA 2WADA 2PJRA 3NAUA 2ZFUA 3ABTA 3GO5A 1BL0A 4B09A 2Y0SN 1FOWA 3HEFA 3CLOA 1GXPA 2HZTA 5C4XJ 1QZEA 3I59A 5CQEA 2H09A 2EILH 5KK1A 4DZJA 4OIRF 2QQAA 3DKXA 3E5XA 4X1EA 2H1LA 3B73A 4OINF 3QYEA 4KISA 5FRNA 4XOPA 5FD6A 4S0HB 2CS3A 3Q5FA 3ECHA 1YIOA 3PUBA 1GT0C 1SAUA 5DTDA 3KEOA 3GFLA 3F72A 3I64A 2COMA 3LAPA 4MEYF 1JHFA 3C3WA 1S6LA 5LGNA 3FHNA 1G8XA 1N75A 3M1EA 2M8EA 2ICWG 4EJOA 4IO9F 1K78B 3DXJF 2L2OA 3PM1A 3GZ5A 4C3HJ 3CCVI 5EEHA 2R7DA 2WAQA 3DF8A 4XM3A 3JSPA 2EH3A 4LB6B 4RAGA 1MBJA 3GX4X 1YJWI 2P0WA 4HRIA 1U0JA 3CCJI 3S1RJ 1RKWA 3MD2A 3ABLH 3I5UA 3R0AA 2W4SA 2HOSA 4XK4A 2XGDA 5E1XA 2BHZA 1QQIA 2IPQX 3FMQA 2EZIA 3RPQA 1UHMA 1TWAJ 5E1WA 1U78A 4II3A 1O3QA 3K1MA 4YIIA 1GHCA 4XICA 3F23A 4I0AA 3V4GA 4GYGA 1WH7A 4WX9A 3JRHA 4BUPA 4DYCA 3VYTB 3DTIA 4FISA 2W82A 4E4HA 4ZYDA 4HOBA 4ZC3A 4U0YA 3KEQA 4AIKA 2LSOA 4G6QA 2GXAA 4IRIA 1ZG3A 2IA0A 1NHAA 3ZMTA 3NQOA 3CMEI 1P6RA 2X6XA 5HLIA 1CF7B 1LVAA 1FTZA 2IVMA 3EDPA 5HNFA 2LMDA 4RBOA 4L5EA 2ESNA 5ILUA 3TKYA 1ZR4A 4A0XA 1ORKA 2ZB9A 1I3QJ 1W1WE 2X85A 3QYBA 4A3GJ 2XB0X 1JXSA 2D5VA 2GOMA 2R5ZA 5E1ZB 4ZDPA 5LEKA 1XB4A 2ZMEA 2F5VA 3TW7A 3J81Z 2O7OA 5FLVA 1IDZA 2MC4A 2R7SA 4Y7NJ 3LA2A 1V4RA 1TL8A 3ZQLA 2M4GA 1B1BA 2L5QA 4Y33A 4BAYA 4A93J 2GQQA 4M6XA 3FXJA 4ANJA 3H35A 4E7HA 2DLLA 3MKLA 4B43A 1TQMA 4EV0A 1DDNA 4RLQA 3FDYA 3OWTA 1H9TA 1ULYA 2CO5A 3PFIA 2ZMEC 3KLOA 5HS7A 2C6YA 1P4WA 2UWMA 2EFWA 3TDZC 3RIRA 2XASA 2TRTA 1KYWA 1ZG5A 3BG6A 4NC6A 5LGTA 3J80Z 4OIOF 1AOYA 3MZ8A 3V8KA 4BH9A 4NC7A 3K4BA 4KIGA 5GTHC 1IUYA 2CW8A 2DCEA 1YG2A 3O6BB 2QWWA 3MQ0A 4JQFA 4UB8C 4OOIA 1VQ8I 3I3LA 4KICA 1MBFA 4JP0A 5DD4A 4AUXA 3ZRGA 5TRDA 2ZKZA 4S04A 4G9YA 1R4NB 1A6QA 1W36C 4ZZDA 4BDYA 1RIOH 1YS6A 5J47A 2Z1DA 5A2QK 2L54A 3BPXA 1RUNA 3ZQCA 2FNAA 3WODF 3UKGA 4XLPF 1LVKA 3RPUD 5D5UB 5IOZA 4V2FA 4YG2F 2IA1A 5HS9A 1PYVA 3GFMA 1B8IA 1R1VA 2X6YA 1U9OA 3H3UA 1MZBA 1OCZH 2LVSA 2OC6A 2G7UA 4H0EA 5CVVA 3EQLF 1KQ0A 2UZKA 1Y0UA 2ISZA 1DPRA 2DTZA 1USSA 1W4MA 2CUEA 1NTCA 1UELB 2LK2A 2M30A 2R7FA 4OMZA 5BPIA 1A35A 2ZJ2A 3EUHA 1MDMA 3EUAA 1BM9A 2H94A 2KIFA 4IL6C 3SQNA 3GLXA 3QRFF 1WHUA 2JQ7A 4QIWN 4QPOA 4M6VA 5E17F 3G3ZA 2R5YA 5C4JJ 3GF2A 4X0GA 4EM2A 4PSXA 3KP4A 2QQ8A 2H27A 1QVUA 1ENHA 5H2FC 3IH4A 2EV0A 4CZCA 5JLWA 4AYBA 3AG4H 2E2HJ 2Y0MA 4BQAA 1ACIA 1RZ4A 1TQIA 4BQNA 1B72B 1Z67A 2JJ7A 4E7JA 2O5RA 3FXMA 2GA1A 2ELJA 3HPGA 1EH7A 3HC7A 2W00A 1JE8A 3EUHC 3IHUA 2B63J 3DBHB 1ETOA 2NVXJ 1W0UA 3VODA 2RQPA 1OJLA 3O8GA 4IHWA 3K70C 1MD0A 2DMQA 2NS0A 1Y1VJ 1J09A 4YRVA 5IYBJ 2VIXA 1SFKA 3BR5A 4BJ6C 4GDFA 3HB9A 5BOXA 3BG7A 4CXFA 1TW3A 4M3GA 3HJEA 1T2KA 3F8BA 1O3SA 4BS9A 2YPRA 1XD7A 2IGNA 1MH4A 2OCEA 1OCOH 2RREA 3A01A 4HDUA 2V1NA 4RA2A 5TGTA 4XN3A 5EYRA 3LSRA 3K1NA 1EH6A 3C18A 3CTAA 2BHYA 4AWXB 5HODA 3F22A 3OY9A 4PCQA 4XSZF 2HVRA 2V1DA 2CUJA 3CCSI 2D45A 1R1TA 2FQ3A 3IV5A 2L0KA 2F6CA 4DNCA 4ZTFA 1S3JA 1Z7UA 2FRHA 4MGRA 4XKWA 2L7KA 2WB1N 3OMYA 2IA2A 4JX5A 3ONQA 5FKLA 2XVCA 1MJAA 4ZJZA 1WJ5A 5FB2A 4MFEA 1Z0XA 1IZ1A 5J40A 1XGMA 1XG1A 1GXQA 2M9HA 2JRTA 5FKNA 1BI3A 1B9MA 3BR6A 4XBFA 1WPKA 3OYIA 1REPC 1VZ0A 3AKZA 3QU3A 4A3EJ 1J9IA 3BR3A 1RR7A 3N4MA 1WJFA 4ENJA 4O5VA 5LFAA 4FQGA 1Z6TA 4BBRJ 4RDUA 3FZVA 2UXXA 1SD4A 1DGWY 2MW8A 2OQRA 3WHCA 1R5GA 4BBSJ 1XGOA 3SYTA 2FMYA 4UUSA 2M4KA 3MVPA 2E35A 1FX7A 2F48A 1XX5A 2QYOA 4ENNA 1TW2A 3BG3A 2HS5A 2Z5UA 4EVIA 3SDBA 2WY8Q 2HDDA 2Z3YA 1X4PA 2NXNB 4XKCA 3E97A 2XUBA 4E7SA 1ZRCA 3H0GJ 2K9QA 1V5EA 2R4GA 3E1SA 2XRNA 2QEXI 1T33A 1QBJA 4XOTA 2IGOA 4FTHA 2YX4A 3OSGA 1SMTA 4C30A 3A4CA 3H92A 3I56I 3M8JA 4JBAA 1K61A 3T0YA 3WTYC 5KCMA 1TWFJ 3OSFA 3KIOA 1VTNC 3O3KA 4Q4ZF 2FMLA 3GZ6A 3PNVA 1D0XA 1X1DA 2E71A 2DA2A 3KP2A 4HF1A 2OA4A 1IN5A 2LOOA 3HL2A 3WTWC 4Q5SF 3R4KA 2K86A 2NVUB 3CCEI 2A5YB 1DP7P 3IUOA 5GAGJ 4M3FA 3OYHA 3LAJA 1J75A 3DWLE 2B0LA 3DLLF 5FD5A 3F8FA 3H36A 3W2VA 2WAQN 5KAFC 4IHYA 2MD5A 3UR3C 3K7AJ 1N77A 3CP2A 2Z9OA 3R61A 2JK3A 3S93A 1LEBA 1JT6A 2VKVA 4XORA 4FE4A 1F5TA 4IX7A 4XLFA 2RV8A 2RVCA 1VQ5I 4AVPA 4AD9A 3SEQA 3NWTA 3ZMUA 3HSEA 3CLQA 3L09A 4HW0A 2BY3A 4MHGA 4Y4RA 5BMZA 4O3MA 2DA1A 4L9JA 2PMHA 2H6BA 4I01A 3AFHA 4ON0A 2HGCA 3MKYB 3GLLA 4GO1A 4HPQA 4N9HA 4CCLA 2GM4A 3LNQA 2BEOA 3ZQ7A 3LSIA 5FLXZ 3BPVA 1K6OA 1I50J 1S29A 1IG7A 3RTRA 3H3VK 5J4YA 2DT6A 4DBRA 2VPLA 3MFKA 4R79A 1AKHB 2CGPA 1UHSA 1WI9A 3LWFA 4XONA 3OYGA 1ZQ3P 2J5PA 4AM3A 3SZPA 1ON1A 2Y69H 2YSRA 1YI2I 4UVBA 2CG4A 1FJLA 1P92A 1QGPA 1WWXA 2HYFA 3L1PA 4FHTA 2HFHA 3BQYA 2TCTA 2W48A 4HX7A 2M34A 1T6SA 2TDXA 3EUKL 3TOBA 2ECCA 4HLYA 5F08A 1U8RA 1E2XA 1K4TA 3VPRA 4XLHA 5J3LA 1GVDA 3L2WA 4KN4X 4KJZA 2X1EA 3GZNB 2MLGA 2JA2A 3PIPF 2EA2A 4AC0A 1M1EB 1CQTA 4C3IJ 4MO7A 5B1AH 5CVRA 1HKQA 3RKXA 4G8XA 1GVJA 1A6IA 1LUJB 3O8HA 1V5GA 3OOPA 3HOUJ 4EATA 3L00A 4N4NB 2Y9ZA 1BW5A 4UUVA 2X6OA 2WC2A 3OYLA 1EF4A 3HRTA 5J8CA 4EMSA 4RB3C 1DP3A 1FT9A 1HW1A 3IH3A 2UUZA 4BE1A 1JUSA 1MNMC 4M73A 1TT0A 4FETA 3T5XA 2DDAA 3V7CA 4NDLA 4ENKA 2A61A 4W97A 5D8LB 3G4SI 4LIUA 4IHVA 3RI4A 3ROUA 1YRNA 4C2TA 1MMNA 3AG3H 3R0JA 1H8AC 2VJJA 3HDDA 4NQWB 2HYJA 1E3OC 3ELKA 3FM5A 1XDUA 3D0SA 1R9TJ 3GTQJ 1LPQA 3CJNA 1EH8A 2B7EA 2RKHA 2OZ6A 4JX6A 3ZMSA 2QCOA 4F92B 3B6AA 2KP6A 3S3NA 2CQ7A 4UB6C 3ECOA 1SC7A 5C3EJ 1IRGA 5EF6A 1N25A 5EG0A 5F27A 4RGRA 2P4WA 5L3BA 1YTYA 2HOAA 4OIQF 4Q48A 2R7TA 2E7XA 1H89C 3H5AA 2HPIA 3LSJA 3PL8A 3PFYA 1ON2A 1J59A 4HNTA 2RQQA 3X2QH 1HKTA 1W5CC 3QYFA 1BC7C 4BHCA 9ANTA 4LIVA 1K7AA 4I7HA 3JSOA 2V7FA 2HXIA 4RB1A 3CO7C 3HOYJ 1FTTA 4AYBN 1B59A 1T95A 3W3CA 2HR3A 3VFZA 3OL3A 3MZHA 1W0TA 3KP5A 2LDUA 1I39A 4X6AJ 1IXCA 5DCMB 1Z6RA 2J5OA 1HLVA 2LRDA 2P5KA 3ZMDA 2KZVA 3BG5A 1P9QC 4HBLA 1VQLI 3P5JA 3S1MJ 3FKJA 1LQ1A 2FJ1A 1EA3A 4HLXA 4Y52J 5IP6A 3SFZA 3BTLA 1X19A 4I99C 4OWRB 1ODDA 3JRAA 2QSFX 3ASNH 3W6VA 3G1LA 5IYCJ 3TEDA 2A07F 2YS9A 1IXRC 2ZCWA 2DN0A 1P7JA 5A2QZ 2ID6A 2IXSA 2EK5A 5LHIA 2Z2SB 3U21A 1VQ6I 3Q0VA 2LH9A 4QTRA 1JJ6C 3WGGA 4L0ZB 3J7AO 1NK3P 4BACA 3KP6A 3CUQA 3I54A 3DU6A 1W7PD 1QA6A 1H88C 2O8XA 3GYHX 1FOYA 3ESWB 5FFZA 3PNTA 3LOCA 4DBQA 4BNCA 3AL0C 3QPSA 2BXYA 1U2WA 2DOFA 1X1PA 2EZKA 3QPLA 5D6EA 3PQJA 2LBFB 2WBMA 2ZC2A 2JVGA 2RC4A 4L5IA 3JW4A 4XSXF 4E70A 1YX5A 5E79C 2L9NA 3T8TA 1ZHFA 1SVMA 1D8KA 2EV5A 2MA3A 4LG0B 3CUQC 2M5WA 3HUGA 4KNYA 3JRGA 1QPIA 3HOVJ 4EM1A 5E18F 2PMZA 1P4XA 3NWSA 1O7LA 1Y6IA 1ZTRA 3CCQI 3BCAA 2DU9A 2KQRA 1XCVA 1S5LC 3OR1C 1T56A 1OFCX 4ETSA 2GOXB 1PUFB 3KZYA 2HQRA 4GYIA 3JAMK 1FBSA 4PK4A 1VQMI 3JCUC 1T38A 4LB5A 5HDNA 2HYGD 2KL4A 1TZLA 2P81A 5JHFA 3C1DA 3K4NA 2XAHA 2K9NA 2VJ4A 3HPHA 1DQUA 1BR2A 4AVZA 4Y13A 1K78A 1W5SA 1R5HA 3S2HJ 2VQLA 4CUGA 1U5TA 3PQKA 2QA4I 3ZQGA 2K4BA 2L4AA 4UNOA 1G3SA 4IJAA 1GV5A 3S1NJ 2EFQA 1LEAA 5EEAA 4Q47A 1O3TA 4BHPA 4LITA 4PJJA 3QOEA 3QWLA 1ZARA 4IHSA 2OF7A 3WTTC 4E7ZA 2XAJA 3QOPA 3CCLI 3BG9A 1HSJA 3DV8A 3VYUB 2EIMH 1BOBA 1ZH5A 1DPUA 4B1RA 1JUPA 1U5TC 3NARA 1Z05A 4RGSA 1WVRA 2LR8A 1HDPA 2OQGA 5F0HA 1D0ZA 3C2GA 3BJAA 2ZJQF 1JKOC 2A5WA 2WWYA 2Y2ZA 2PG4A 2FBHA 3ZQHA 5DEQA 3AG1H 5J6XA 4UV9A 1BIBA 2E1NA 3H5RA 3HGYA 4B47A 2XB5A 4NB5A 4RM3A 4XLNF 1TWGJ 1X4OA 5F1JA 3MWMA 3HOXJ 2WAFA 4RMNA 1R22A 3OYFA 1K6YA 1YOVB 2VL8A 1MNDA 3LSKA 2V9PA 2LY1A 4LK1F 1YW9A 4HSTA 1YQAA 4CH7A 4F55A 2GIZA 2G9WA 1MGTA 3L2VA 2DA7A 1OYWA 4FX0A 5LHGA 5E3NA 1NH3A 3ZN1A 3RDIA 3GMEA 2MGQA 5IY5H 3LQQA 2JN6A 2DJNA 3DPUA 2CWEA 3WU1B 5JVTA 4NNJA 1MBEA 2VBYA 4KN7X 3WTVC 1SFEA 4B3XA 3N97A 1R4MB 4LD5A 2BGCA 2DDBA 3RKWA 4CICA 4FE7A 2M0CA 4LMYA 3TP3A 4MQ9F 2VC1A 3ABMH 5LLQA 3CESA 1ZRDA 2VXDA 4CA0A 3KYCB 4B3AA 3VWBA 3A2KA 2OV7A 3K2AA 1ETXA 1Y8QB 1PVEA 3JRBA 2E5NA 5KAIC 4DJAA 4A6EA 2XHKA 3Q3SA 1LFBA 1YFHA 1I1SA 2A69F 1XMXA 3CD6I 2P6TA 3V8LA 4CO8A 4DQ2A 3I0TA 1EKEA 1VFCA 1DU6A 3U1DA 5IOYA 2FX0A 4AIJA 1GV2A 3H5NA 2R5ZB 4XR6A 5FO5A 1YJ9I 4A3IJ 2NS7A 2FU4A 1TT5B 3ML6A 3R60A 5TISC 4KFCA 1FWZA 1Y1WJ 2DPUA 1A36A 2GAUA 5FKKA 5FLMJ 2DBBA 2OD5A 1HW5A 3FXLA 3E3VA 2L3DA 1WKMA 1OLTA 2ISYA 3GBGA 3K0LA 4L18B 3L2QA 1IN7A 2M7AA 3WGIA 4OAYA 4M9SA 1IRFA 3ISPA 4XRFA 1IV6A 4HA8A 2YU9J 3CF2A 1FLIA 1MJBA 2JPBA 4LFUA 4WXHA 4D5FA 2R93J 2VT3A 1D1AA 1JTXA 3BT9A 2M3AA 1D1CA 4HF2A 4LLGF 1RETA 3CMAI 1W36D 5HDKA 1BI1A 2BE5F 2V79A 1G6NA 3ABUA 2KISA 4HAMA 1TNSA 2JA5J 3PNYA 3SXYA 2ADUA 4CZZA 3DEUA 1Z3XA 2BZTA 2KFDA 3KETA 4DGWB 3RYRA 1AWCA 1B9NA 2X0LA 3QP6A 1DGRM 2VI6A 2E1MB 3FBNB 1TQPA 1IRXA 2NAZA 2XIGA 4BHBA 4UHTA 4IOCF 1XTAA 4KIBA 1MMSA 2VQCA 1E17A 3EYIA 1HBXG 5ILVA 1KQ9A 1X2MA 4MNUA 2E36A 3V7SA 1ZREA 2F5CA 2COBA 2OAZA 4YELA 2Q2EB 4ASNA 2EIKH 3RKQA 3L7WA 4AIHA 1IRZA 3GVAA 1X2NA 3RZOJ 1T8IA 3W2WA 3HSRA 3K4CA 1MSFC 1WJBA 3HHHA 2VKDA 4ZH4F 2DW4A 2ZXJA 1DUXC 2MABA 1KU9A 2HOTA 5ERIA 3HSFA 2FBKA 1XSXA 2V1XA 2XGCA 1GDTA 2IP2A 4HNVA 4B48A 3K6GA 3TDUC 4L9NA 4P55A 4JK1X 3BWGA 2CQXA 1OR7A 2KRCA 4BXUA 5DM6F 3MKZA 2JWTA 1R58A 2QM3A 2LKPA 4CYCB 1QPMA 3ULQB 2QVOA 5JVGF 2KKOA 4BJ5C 4LG3A 4HYEA 5F1RA 1HA8A 2A05A 2R5YB 1IGNA 3FK7A 3K70D 2XRLA 2RNGA 4EJVA 2Q1ZB 4U87A 2X48A 2DOAA 1QVTA 1YS7A 1G3TA 2FE3A 5H6QA 2ZO4A 1OQYA 3LSGA 1ZAOA 5IYDJ 3A02A 4G7OF 3CJTB 4G12A 1G59A 2H1KA 4V19K 3VSKA 3TGNA 2OZUA 3K9TA 1OR7C 2QKLB 4UXNA 1QRYA 1ZELA 2EFPA 4XL9A 1VQOI 4NHJA 1S9HA 2VKEA 1VQKI 1KA8A 2HOEA 2AHQA 2M1BA 3GWZA 5EGOB 4GRIA 1I27A 2EFOA 3DU5A 4ZYEA 5DDGA 4KA4A 5FJ8J 4A3BJ 4N0BA 2YR2A 2QKMB 3ZXSA 1SVOA 3GUDA 4LLLA 4V2GA 3BP8A 2DMTA 3MMYB 2ZSIB 5J4VA 3G1OA 3LFKA 3DLAA 3LQRA 3F0CA 2D2WA 3CQZJ 1XSVA 5B1BH 4D0PA 3GTMJ 3K4KA 4XKVA 1D1BA 2VC0A 2K02A 3A01B 1BA5A 5AIQA 3BY6A 4A12A 2DPDA 4D7MA 5D5WB 1O57A 1TTYA 3E6BA 4R1HA 3QPHA 4MTEA 3NEUA 2IT0A 2QQBA 3CDIA 3A0BC 1MBHA 2IGMA 4MLOA 1UFMA 3RSNA 3S2WA 3JR9A 3HOTA 2LYCA 4AIDA 4FX4A 1SEUA 1X3ZB 1LE8A 2XC7A 4M3EA 2HXOA 3CJQB 3BTCA 2JA8J 3T1BA 1O3RA 2ZFWA 4HDVA 4IPAA 4BEHB 1AU7A 3E7LA 1OCCH 3P9KA 4B44A 5D4RA 2LREA 5DD8A 5L3FA 2BYVE 5HS8A 2PMZN 3HRUA 5ED4A 2K3PA 2KZGA 1XGSA 1TWHJ 3ZQFA 2XKOA 4G6DA 1ZGWA 4WCGA 4EGZA 1V3FA 1BJAA 1D0YA 1LNWA 3OYDA 2DMPA 1U3EM 1ZG1A 2HQ5A 2R0QC 2RN7A 3LL7A 1QZZA 2IS6A 2DT7B 3F6OA 1IN8A 1FPQA 3BQZA 2KJBA 3CDHA 3GCMA 3C2BA 1FOXA 2X9DA 2MSYA 2LKXA 5FKOA 5IP7J 1TP4A 2CFXA 4UUSB 2W1OA 1IW7F 4MTDA 3GFIA 2WV0A
chains in the Genus database with same CATH topology
2L2OA 2XAUA 3DTKA 2KLOA 2WAQA 4XM3A 3MKWB 2R7TA 4DIQA 3LSHA 4IKFA 3H5AA 2HPIA 2P0WA 3PL8A 4F91B 1U0JA 3PFYA 4HRIA 3OOUA 3OYBA 3MD2A 2IGKA 4HNTA 4CCMA 2RQQA 2W4SA 3QODA 4F93B 3QYFA 1MMDA 2JSPA 3HG9A 4LIVA 3KX2A 2JUGA 4II3A 1N78A 2V7FA 4KITB 3FBIB 2HNHA 4BUPA 1PJRA 3VYTB 5LD2C 3DTIA 1T95A 4E4HA 2W82A 4IQJA 1NG6A 4ZC3A 4KT6A 3W3CA 3VSLA 3OL3A 3K4JA 4E7LA 2X6XA 2BW3A 2VQHA 3C2HA 1T0FC 3D5SC 1FMWA 2HDWA 2LRDA 4ITVA 4Y3OA 3ZQQA 5HNFA 4HNUA 5CPRB 2KZVA 1P9QC 3CZ6A 2X85A 3QYBA 3FKJA 1EA3A 2GOMA 4ZDPA 3OYCA 1X19A 4E7IA 4OWRB 4U7BA 1Z3YA 2KDOA 1Z7LA 2UV1A 2F5VA 4N4OB 3K4LA 2MC4A 2R7SA 2K9MA 4XLAA 2HPMA 2IXSA 4BL0B 1MMGA 2M4GA 2Z2SB 3U21A 2LH9A 2L5QA 4Y33A 4BACA 3DU6A 4II2A 4XKBA 4ANJA 3H35A 4E7HA 4B43A 4RLQA 3FDYA 2V9KA 3OWTA 3IAS2 3PNTA 1WJCA 4DBQA 3AL0C 4BEHA 1QHGA 2LBFB 2WBMA 2ZSHB 2JVGA 2UWMA 2KMUA 1AA7A 1YX5A 3BG6A 2L9NA 2CUZA 3H9QA 2ZXHA 3CJRB 2Y0SA 4NC7A 2PMZA 3K4BA 3NWSA 1Y6IA 2CW8A 2DCEA 3BCAA 2KQRA 4JQFA 3OR1C 3TMOA 2GOXB 3I3LA 3CP8A 2BVMA 3ZRGA 1V5FA 4PK4A 4XLCA 1W36C 2KL4A 1TZLA 3OIQA 5JHFA 3ZCOA 3K4NA 4BDYA 2Z1DA 2JVHA 2VJ4A 3HPHA 1ERDA 1DQUA 3H9JA 1BR2A 2OUMA 4OAZA 1LVKA 4AVZA 3ZR8X 4PFOA 3RPUD 2VQLA 4CUGA 1QU3A 3EPZA 2BOLA 3S32A 4BJTA 2E5ZA 1R6RA 1PYVA 2A6TA 3KYLA 2X6YA 4ZTJA 4LITA 4PJJA 3QOEA 1LKXA 2CMPA 2OC6A 4C2UA 1WJDA 4E7ZA 3VDXA 3G2BA 1UELB 4HSRA 1KONA 2XF6A 3VYUB 1BOBA 2V6EA 3OYJA 5HVQC 3EUAA 4CCOA 3PJRA 2XDVA 3DPTA 2R7VA 4QPOA 3VYSB 1D0ZA 3C2GA 2R7QA 5KNLA 2A5WA 4X0GA 4PSXA 2R7WA 3PSIA 2WA0A 4DOZA 3DQVC 4CZCA 4AYBA 3KEYA 5CKTA 4BQNA 2R7OA 4E7JA 2O5RA 2ELJA 4B47A 3H5RA 3HPGA 3HC7A 4RM3A 2W00A 3EUHC 1X4OA 2WAFA 4RMNA 3OYFA 1K6YA 2VL8A 4F3QA 3OR2C 3K70C 1MNDA 3LSKA 3HXLA 1J09A 2LY1A 4YRVA 4HSTA 2VIXA 1SFKA 4CH7A 2LG4A 4BJ6C 4E6KG 4F55A 3L2VA 3BG7A 2VKHA 4D1QA 2DJIA 3DPUA 3H9GA 3TL4X 4BS9A 4CSWA 4XQFA 4NNJA 2IGNA 3F9KA 4B3XA 3LFUA 2RREA 2CW7A 2V1NA 4IZZA 4ZDOA 5TGTA 5FRMA 3DTEA 4XN3A 2I8DA 2LBFA 3CESA 2VXDA 4CA0A 3OY9A 3VWBA 4XNFA 2HVRA 3A2KA 2OV7A 2CUJA 1LFPA 2AQEA 4IQ4A 3LSMA 4ZTFA 2F6CA 4CCNA 2E5NA 4DJAA 2HU9A 2L7KA 4XKWA 2VLAA 4PJLA 3OMYA 3S8PA 3SZGA 2BW3B 1WFXA 3ONQA 5FROA 5HLTA 4ZJZA 2VB6A 4P1WA 1WJ5A 2K5CA 1BR4A 3SEZA 1MNEA 2XSJC 1UG0A 2AQFA 2V4JC 3H5NA 1QHHD 4XR6A 1BR1A 3OYIA 3AL0B 2MD0A 3E0JB 1VZ0A 2LY2A 2X1CA 3AKZA 3DPLC 4RLFA 4XLEA 1WJFA 4J01A 3S3OA 3RQ4A 4BDZA 3HOSA 2IS4A 5LFAA 4J00A 2HZDA 5CQGA 4C9YA 1OLTA 1DGWY 3GBGA 3L2QA 2M7AA 4BGDA 4OAYA 2XF7A 3SYTA 4AU7A 3J7AY 2R7RA 2ZXIA 2L9SA 2M4KA 3CF2A 3ZGKA 5HNHA 3BC8A 3K4MA 1D1AA 3SDBA 2WY8Q 2M3AA 1D1CA 4JOMA 1W36D 3DEEA 1X4PA 4XKCA 4E7SA 2K9LA 3PNYA 3HUGB 1V5EA 2R4GA 1Z3XA 1Y56A 3E1SA 4DGWB 3M1CA 3PSFA 4XOTA 3UNGC 3BLYA 2PJRB 2IGOA 1DGRM 2NOJB 4YEJA 3OS2A 2E1MB 3FBNB 4C30A 1IRXA 2E60A 3A4CA 2LC2A 3OIPA 4BU2A 3M8JA 4BQQA 3I9V2 5KCMA 2VQCA 3N05A 2CV1A 4BE0A 3PNVA 1D0XA 1YE9A 1X1DA 4YELA 2Q2EB 4E7KA 1WJAA 2R7XA 2LOOA 3HL2A 4NC8A 3W2WA 3TBIA 3K4CA 4CCJA 2MFZA 1Z21A 4BE2A 1WJBA 2VJIA 3OS0A 2CH0A 2VKDA 3IUOA 1NG7A 1UAAA 3OYHA 2KPMA 3DWLE 2R7UA 2VJ5A 2MABA 2CFOA 3W2VA 4P5OA 2HVQA 3UR3C 2V26A 1N77A 4B48A 3CP2A 3K6GA 3RCOA 3H0DA 1X1AA 3S93A 2W7NA 4XORA 4IX7A 4XLFA 2M0MA 2KRCA 4ZDLA 1LDKB 1MW7A 3CMMA 3MKZA 3W2AA 2DXIA 3SEQA 3NWTA 5KHDA 4HG2A 3OYAA 1WJEA 4Y4RA 2F4IA 3D5RC 4BJ5C 4LG3A 4PJNA 1HA8A 3MKYB 3AFHA 4XMYA 3K70D 3VYRB 2RNGA 4HPQA 2Q1ZB 1MMAA 1E0EA 4U87A 2DOAA 4CCLA 1X1BA 3LSIA 1X1CA 3LSGA 2CV0A 1G59A 3OL4A 1FMVA 3RTRA 3VSKA 2WB1A 3L2UA 1OR7C 2DT6A 2QKLB 4DBRA 2VPLA 3IP4B 4R79A 1ZELA 3IAM2 4PSWA 4XL9A 1S9HA 4XONA 4GRIA 3DU5A 3OYGA 1JI8A 2BVLA 2QKMB 3ZXSA 4G6TB 4BQOA 1YX3A 3OYKA 2IS2A 3V42A 3D5LA 2WAEA 3MMYB 4D9JA 4F52A 2ZSIB 2KHMA 2MYSA 2WY7Q 3DLAA 3LMMA 3L2RA 4QPQA 3OYMA 3EUKL 3K4KA 4XKVA 4XLHA 1D1BA 2X6WA 3L2WA 4KJZA 3OYNA 2X1EA 1GLNA 2JA2A 2FUG2 4BXFA 2CV2A 2IGMA 4MLOA 3RSNA 3HOTA 2VXZA 2LYCA 2M7BA 3OS1A 2XF5A 2XC7A 2X51A 2VASA 3A1YA 3CJQB 4H4KC 1V5GA 2Z16A 4EATA 4HEA2 4N4NB 4BEHB 4XN0A 2HVSA 3OYLA 4ZYAA 2WADA 4B44A 2PJRA 2ZFUA 1DP3A 3HKZA 2LREA 2KRHA 4PFPA 2UUZA 4BE1A 2K3PA 1TT0A 4FETA 5CQEA 4FASD 3DKXA 3DKYA 4KISA 3QYEA 5FRNA 4XOPA 4NUBA 4LIUA 2CS3A 1D0YA 3BCBA 4CCKA 3OYDA 1MMNA 4C2TA 3PUBA 1SAUA 2VJJA 4PUSA 2IS1A 3K10A 3LL7A 4NQWB 2E1MC 2DT7B 2IS6A 4RM2A 3OYEA 5HOOA 3FHNA 4PJMA 4F92B 1G8XA 2VQGA 1N75A 2W1OA 3S3MA 2KP6A 2X1DA 2HQAA 3S3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR8 X;  2LC2 A;  3ZGK A; 
#chains in the Genus database with same CATH topology
 1OMI A;  1KU7 A;  3L9F A;  2VN2 A;  3ZPL A;  2LLK A;  3DTK A;  2KLO A;  3E5Q A;  4L9V A;  3Q9V A;  3LSH A;  1UHW A;  3V8J A;  4DIQ A;  4G7H F;  3G1M A;  4IKF A;  2WTE A;  3SFI A;  4F91 B;  1S72 I;  2DQL A;  2EA4 A;  4CGZ A;  4QWQ A;  4Z6Y A;  2DMN A;  4M3B A;  3HRS A;  3KP7 A;  1MMD A;  1T0F A;  1D5Y A;  4G7Z F;  1SD6 A;  2JUG A;  2K7L A;  2CRG A;  1N78 A;  1AHD P;  1SVL A;  4LLN A;  1WZ2 A;  2GZW A;  5LRS A;  2OBP A;  4Y15 A;  2HNH A;  1SMY F;  3ABK H;  1POG A;  1ONV A;  2F5F A;  3HBL A;  4IQJ A;  1FZP B;  1AKH A;  2AO9 A;  3VSL A;  2Y31 A;  3K4J A;  5CVU A;  1A5J A;  5K7F A;  5LHH A;  5D4S A;  2LFB A;  2BW3 A;  2VQH A;  2Q8K A;  4BKX A;  2RGV A;  3WGH A;  2P5V A;  3LA3 A;  4FT8 A;  4I2O A;  3BOQ A;  1T0F C;  3D5S C;  4QSH A;  3F8C A;  1FMW A;  1O7F A;  2HDW A;  3WU0 A;  3ZQQ A;  1FSH A;  5M5Y J;  2XPW A;  1XMK A;  4HNU A;  5CPR B;  3FXK A;  1XPX A;  2G0E A;  2QBY A;  2GBY A;  2PFB A;  2GXB A;  3VEP A;  2XGE A;  3OYC A;  4E7I A;  2H8R A;  3JAM Z;  1Z3Y A;  4U7B A;  1ETW A;  3K4L A;  3WTX C;  1Z91 A;  4OIP F;  2XAF A;  4P9F A;  4XLA A;  4ABZ A;  2HPM A;  2FF4 A;  3CUO A;  3I58 A;  4J19 A;  2BBY A;  1VQ9 I;  2B9S A;  2DYR H;  2MH2 A;  2IJL A;  2Z33 A;  2P7C B;  4G94 A;  2W24 A;  3PO3 J;  4EEF G;  1ZKG A;  4HF0 A;  1QHG A;  1MSE C;  1S7O A;  2ZSH B;  2KMU A;  2VPR A;  2NVY J;  2RAE A;  4KYW A;  1FIP A;  2CUZ A;  1LB2 A;  2FA5 A;  3H9Q A;  1F43 A;  3BJ6 A;  2P7V B;  1KQ8 A;  2DOE A;  4PJ0 C;  3BZK A;  3VOE A;  1YLF A;  1X3W B;  4MIM A;  5L3C A;  4HQE A;  3TMO A;  3R6S A;  1IDY A;  2JZY A;  3PO2 J;  1HW2 A;  2BVM A;  1V5F A;  4JYK A;  3I71 A;  5D5X B;  3HHG A;  5F04 A;  2NS8 A;  3ZCO A;  2JVH A;  4KMU X;  2ME0 A;  2P6S A;  3H9J A;  2OUM A;  4OAZ A;  3HGG A;  1OCR H;  1SFU A;  1JTY A;  2BOL A;  3FX3 A;  3S32 A;  2E5Z A;  1R71 A;  3E5U A;  3WTU C;  3KCC A;  3KFW X;  4UVC A;  1SD5 A;  4MFD A;  5BPD A;  3HTU A;  2V1U A;  3IC7 A;  1MBK A;  5ICE A;  1LKX A;  5K7H A;  2YU3 A;  1IO2 A;  4EM0 B;  3E6D A;  1WJD A;  4UUT A;  3T8R A;  2M2E A;  2Y30 A;  2DK5 A;  3G2B A;  2QGU A;  5CJ9 A;  3M9A A;  4GGG A;  1HXD A;  5GP9 A;  3OYJ A;  5HVQ C;  4N9I A;  4CCO A;  2I5U A;  3S17 J;  3DPT A;  3FXR A;  3VYS B;  1I6H J;  4DYR A;  1ETQ A;  5KNL A;  5M3M J;  2R3S A;  5JLX A;  1EJ9 A;  3I55 I;  2R7W A;  2WA0 A;  4L9T A;  3DQV C;  5DCM A;  1LJ9 A;  4JX4 A;  3KEY A;  3FHZ A;  4M74 A;  2R7O A;  2Y9Y A;  4KDP A;  1LDD A;  3DCF A;  4OU0 A;  4KMF A;  1KYZ A;  1SFO J;  2EIJ H;  1T98 A;  1OYY A;  1K4S A;  2NRA C;  1ZGA A;  3EYY A;  1IV8 A;  4F3Q A;  1WSU A;  4IHX A;  3WG9 A;  3HTS B;  2EBI A;  1D8J A;  4A5M A;  2XGX A;  5J1R A;  2LG4 A;  2EWN A;  2K85 A;  1KU3 A;  3ERE D;  3M4O J;  1ETV A;  2VKH A;  4YIF A;  3H9G A;  4CSW A;  3DBL B;  3KLN A;  4U88 A;  2DO7 A;  2FBI A;  2CW7 A;  4A6D A;  4IZZ A;  1HC8 A;  4ZDO A;  3P9I A;  1VQ7 I;  1OCP A;  2DTR A;  3P7N A;  4KIF A;  1IN4 A;  2LBF A;  3ZQI A;  4XNF A;  1HDD C;  2O8K A;  1X3U A;  4ENM A;  2QF7 A;  1W7P B;  2EFN A;  2AQE A;  1I5Z A;  1JUM A;  5DUI A;  1J2X A;  5DS9 A;  2PX9 A;  3J7Z I;  2LTP A;  2STW A;  2HU9 A;  2VLA A;  1P7I A;  4PJL A;  1HOM A;  1WFX A;  5FRO A;  1IAW A;  3V7R A;  1TLH B;  2Y75 A;  4EJT A;  1LDJ A;  2VE9 A;  2NOG A;  4R8H A;  4P1W A;  4A5N A;  4A3C J;  2L9V A;  2A3S A;  2EB7 A;  1BR4 A;  5BQT A;  3SEZ A;  1VQ4 I;  1PUF A;  1EV7 A;  5E8G A;  1SAN A;  1MNE A;  2XSJ C;  3TQN A;  1UG0 A;  2AQF A;  1FSE A;  3AL0 B;  4W1U A;  2MD0 A;  4ESB A;  2L4M A;  3U1K A;  3DEW A;  1JGG A;  1RUO A;  1WGX A;  3RQ4 A;  1RPW A;  4F7Z A;  4IEJ A;  2O61 A;  4YFX F;  1BN5 A;  1P4A A;  2HZD A;  5CQG A;  3KPH A;  1QO0 D;  2HEO A;  1F36 A;  2CSO A;  2OU2 A;  4YFN F;  4BGD A;  2OPT A;  2HI3 A;  2FOW A;  2W84 A;  5E20 A;  5J8F A;  4ZYH A;  2L7Z A;  3GTG J;  2ZXI A;  2FXA A;  3HM5 A;  3ZGK A;  2GA2 A;  5HNH A;  3K4M A;  4RAF A;  3WHB A;  2XAQ A;  2L02 A;  5CYV A;  3HOZ J;  1TWC J;  2E2I J;  2OTJ I;  1Y8R B;  5ICC A;  1HCR A;  1HKS A;  4A3D J;  2KDZ A;  3TP0 A;  2O6G E;  3HIF A;  2K9L A;  3HUG B;  3Q9S A;  4I76 A;  3FXU A;  1Y56 A;  3U9G A;  5H20 A;  3FF5 A;  3FIW A;  3M1C A;  4XRM A;  2PJR B;  1WCM J;  4YEJ A;  3OS2 A;  5D5V B;  1OYI A;  3LST A;  5E3O A;  2LD5 A;  3OIP A;  1G3Y A;  4BU2 A;  4BQQ A;  1OKR A;  2CQQ A;  2MC3 A;  4RB0 A;  2DFH A;  3TOA A;  3IL2 A;  3I59 B;  3N05 A;  1D5V A;  3K1P A;  3SZT A;  1ZYR F;  1FIA A;  1O4X A;  4E7K A;  1WJA A;  3FM3 A;  2PI0 A;  2R7X A;  2QEN A;  2QQ9 A;  4NC8 A;  1CF7 A;  3HOW J;  3TBI A;  4CCJ A;  2BY2 A;  4CHU A;  1U5T B;  2MFZ A;  3K69 A;  1Z21 A;  4BE2 A;  1U8B A;  4RAZ A;  2VJI A;  4IOA F;  5DCF A;  1ZR2 A;  4A3J J;  1UAA A;  2DMU A;  2CUF A;  1UCR A;  1V55 H;  5H6R A;  2VJ5 A;  3OV8 A;  3L2C A;  3S1Q J;  2HVQ A;  3RCO A;  5FKM A;  3KZI C;  3P9C A;  2W7N A;  2EZH A;  3A0H C;  1H0M A;  1LDK B;  1MW7 A;  5GAH J;  3GTL J;  5KHD A;  4O6J A;  3OYA A;  4P9U A;  1GUU A;  5K7Z A;  5B66 C;  2KIQ A;  1XN7 A;  2AXL A;  3QQA A;  3FXO A;  3H3Z A;  3WTS C;  3ZMV A;  1IC8 A;  2JUC A;  2W57 A;  4XMY A;  1E3P A;  2PLY A;  3VYR B;  4A0Z A;  1Z9C A;  4WF2 A;  1VQN I;  2R92 J;  5IT3 A;  2Z99 A;  1BJZ A;  1JT0 A;  5CVI A;  3ZOB A;  4HZF A;  2NVT J;  3IP4 B;  2DK8 A;  2F2E A;  2GIV A;  1IUF A;  5LEJ A;  4B4C A;  2OTL I;  1XDS A;  3TO6 A;  1L3L A;  1J5Y A;  4EQQ A;  3CC4 I;  4G6T B;  3JRI A;  3E6M A;  3OYK A;  1YX3 A;  2IS2 A;  4HV6 A;  3V42 A;  3IRQ A;  3D5L A;  3H1C A;  2WAE A;  4D9J A;  4F52 A;  4A3F J;  2DFI A;  2KHM A;  4M9X A;  1BIA A;  2MYS A;  2WY7 Q;  5HLG A;  2PN6 A;  4U7D A;  5M3F J;  2ID3 A;  3LMM A;  2HKX A;  1KU2 A;  4HX4 A;  4QPQ A;  3OYM A;  1BW6 A;  5LRR A;  2ZME B;  4GCV A;  2LY9 A;  2JRM A;  1BI0 A;  3IWZ A;  5L3E A;  2KRF A;  2L7F P;  5KVR A;  5E8I A;  3DBR B;  4LGW A;  3RPU A;  3OYN A;  1A31 A;  1S8N A;  2LKS A;  2LNB A;  3I4P A;  2FUG 2;  1J0R A;  2RNJ A;  2XRO A;  4IHT A;  2VXZ A;  3IH2 A;  3ZMZ A;  2XF5 A;  2PBI A;  2VAS A;  3A1Y A;  5J1U A;  2P5L C;  4WK8 F;  1F9N A;  3FMS A;  4M72 A;  4S05 A;  2E1C A;  1FEX A;  2O9L A;  3SJM A;  2HVS A;  1QZY A;  1U6G A;  5B3S H;  1SFX A;  2JTV A;  1SD7 A;  5DM7 F;  3HKZ A;  5EDN A;  2KRH A;  3WG7 H;  2OJE D;  1YYV A;  4PFP A;  3REO A;  1C0W A;  1R7J A;  5CVJ A;  3WTZ A;  5HLH A;  5EZH A;  3COA C;  4FAS D;  1BI2 A;  3DKY A;  1S7E A;  2QLZ A;  3QPT A;  4NUB A;  2Q2E A;  2K40 A;  3ASO H;  3BRO A;  1P2F A;  3OIO A;  3FMR A;  4EJW A;  3LSP A;  1JJ8 C;  2K3F A;  3BCB A;  1FYL A;  4CCK A;  4KT5 C;  2PMU A;  2PJP A;  1RRJ A;  2E1O A;  4PUS A;  1B72 A;  2IS1 A;  1FBQ A;  3K10 A;  2E1M C;  4RM2 A;  3C7J A;  3WE2 A;  3M8F A;  3OYE A;  2O03 A;  2EV6 A;  2K9S A;  5HOO A;  4PJM A;  1FYK A;  5IT9 Z;  5EEG A;  1R5I D;  2ZNY A;  2VQG A;  1XS9 A;  3S3M A;  4DZP A;  1MBG A;  2X1D A;  2HQA A;  3WU2 C;  5FFX A;  3CCM I;  3JTH A;  3CDL A;  2STT A;  5D8K B;  4UY8 I;  2IEK A;  2DFF A;  2XAU A;  3F21 A;  4D7N A;  2FNP A;  1S7A A;  3MKW B;  3CC7 I;  1B8I B;  3S16 J;  2JT1 A;  3CMY A;  4CYC A;  2F4M B;  2VBX A;  2F5E A;  3OOU A;  4YIR X;  3OYB A;  2XAG A;  2IGK A;  4CCM A;  2W25 A;  3QOD A;  2V6C A;  4LOC A;  4F93 B;  3CC2 I;  1JGS A;  2JSP A;  3HG9 A;  3KX2 A;  2EPF A;  1F4K A;  1FP2 A;  4KIT B;  1MDM B;  3AAF A;  5F6F A;  2V9V A;  3FBI B;  4P96 A;  4OMY A;  2NNN A;  5K5R A;  1PJR A;  5TJJ A;  5LD2 C;  4M71 A;  1NG6 A;  1MH3 A;  2LF8 A;  4KT6 A;  2R7Z J;  2BXZ A;  2FEZ A;  4HX8 A;  5EGO A;  4E7L A;  5JFR A;  3F8M A;  3C2H A;  3RYP A;  2MLK A;  3CCU I;  2E34 A;  5HDG A;  4ITV A;  1VND A;  2EQR A;  2KIU A;  4Y3O A;  2JMW A;  3CZ6 A;  4C2M J;  2UXN A;  1RNL A;  2GWR A;  4U0W A;  1X58 A;  3IKT A;  3ZN0 A;  2VT2 A;  4IVN A;  1PDN C;  1UMQ A;  2HQN A;  5GPC A;  2KDO A;  2OCC H;  1Z7L A;  2UV1 A;  5ICF A;  4N4O B;  4BYY A;  2XPU A;  3KZZ A;  3CF5 F;  1PUE E;  2K9M A;  3BR2 A;  2E7W A;  4BL0 B;  1H9G A;  1MMG A;  4M6Y A;  4PDK A;  5C44 J;  1JKQ C;  4A3L J;  2QSH X;  3MZY A;  4Z2Y A;  4EGY A;  2VON A;  1L0O C;  3RKY A;  4EJU A;  4BXX J;  4II2 A;  3GFJ A;  4XKB A;  3G6E I;  2ESH A;  3GTJ J;  2V9K A;  1R1U A;  2MH9 A;  3IRR A;  2VOO A;  2FQ4 A;  4I02 A;  3IAS 2;  4HV5 A;  1WJC A;  4BEH A;  1BBY A;  3KP3 A;  4DW6 A;  5BNG A;  4LK0 F;  1YIT I;  3G71 I;  1AA7 A;  4MQV A;  1SAX A;  4BY7 J;  2ZBK A;  2F5D A;  2ZXH A;  3QP5 A;  2CJJ A;  3CJR B;  2Y0S A;  2YUS A;  2HWV A;  1HF0 A;  1HQC A;  4KUM A;  3F6V A;  3HRM A;  2LP0 A;  2DOD A;  1QNT A;  4RB2 C;  1G3W A;  4PGG A;  3D1N I;  3CP8 A;  4IRH A;  3GW2 A;  4L5J A;  4XLC A;  5B5E C;  4I6Z A;  3J81 K;  3OIQ A;  5CLS A;  4A3K J;  5F0C A;  2A6E F;  5L3G A;  1FOK A;  1ERD A;  1TNT A;  3QAH A;  4B8X A;  3F8N A;  1APL C;  4UVA A;  1BC8 C;  3DKW A;  4A2U A;  1FC3 A;  2CYY A;  2JSC A;  4PFO A;  3ZR8 X;  2DI3 A;  3FKI J;  5LBQ A;  3DFG A;  2XSD C;  1QU3 A;  3EPZ A;  3FWE A;  4BJT A;  3SHF A;  1R6R A;  1RES A;  2BV6 A;  3GTO J;  2M87 A;  2EZL A;  5GPA A;  1LE8 B;  2A6T A;  4RS8 A;  2DAO A;  3KYL A;  2VBW A;  4ZTJ A;  2FOK A;  2H6C A;  2CMP A;  1STZ A;  4C2U A;  3VDX A;  1RC9 A;  1YHQ I;  3J80 K;  1U9N A;  4HSR A;  1KON A;  4WXC A;  5JHU A;  2XF6 A;  4BY1 J;  2V6E A;  4I98 B;  4NBQ A;  5K5O A;  2AS5 F;  3PJR A;  2XDV A;  4M3D A;  2GLO A;  3F3X A;  3PIO F;  2R7V A;  1R23 A;  2X4H A;  3EET A;  2R7Q A;  2JPC A;  2O3F A;  1ZLK A;  3GTP J;  2KT0 A;  3PSI A;  4DOZ A;  4A3M J;  3M7G A;  3MAJ A;  5CKT A;  2P8T A;  2QUF A;  5JI6 A;  1K83 J;  4RAY A;  5D6F A;  3K2Z A;  3MN2 A;  4CYD A;  4YFK F;  3M3Y J;  1WH5 A;  5E3L A;  3BR0 A;  1CGP A;  2DT5 A;  4ZZL A;  1WQ2 A;  4IXA A;  4M9Z A;  4MEX F;  1OIS A;  2FSW A;  3B02 A;  4IRG A;  2F4O B;  3HZJ A;  4HQM A;  3OR2 C;  1J7K A;  4WWC A;  3ZP5 A;  3HXL A;  2DA3 A;  2IW5 A;  1IN6 A;  1I3A A;  5IT9 K;  1JHH A;  5ILS A;  3SDG A;  1TC3 C;  4E6K G;  2ME6 A;  2YX7 A;  2L01 A;  2PEX A;  3KE2 A;  3TW6 A;  4D1Q A;  3E6C C;  1B6A A;  2DJI A;  1RKT A;  3TL4 X;  2VBZ A;  6PAX A;  4XQF A;  2HKO A;  3Q0W A;  3F9K A;  5F64 A;  2DFE A;  2FD5 A;  2DYS H;  2BY0 A;  3LFU A;  1I1G A;  4U0V A;  4A0Y A;  3RQI A;  4GFB A;  5FRM A;  3DTE A;  3S14 J;  3M8E A;  1Y0N A;  2I8D A;  2NYX A;  5EZG A;  2NNY A;  2A6H F;  2CW0 F;  1B4A A;  3JRC A;  4I0B A;  1LFP A;  1T08 B;  4IQ4 A;  3LSM A;  4PZJ A;  3JRF A;  4CCN A;  1PP7 U;  4CDG A;  2VUM J;  4RGX A;  3CCY A;  1OCT C;  1T39 A;  5K5Q A;  5AON A;  3RJP A;  1VF9 A;  3I53 A;  3S8P A;  2BW3 B;  3SZG A;  5HLT A;  1MKM A;  3FK6 A;  2VB6 A;  3Q0U A;  5M5W J;  2GXG A;  5DUK A;  2K5C A;  3O2P E;  1WI3 A;  2QBY B;  4IF4 A;  2V4J C;  2ECB A;  1QHH D;  3IKV A;  1BR1 A;  3E0J B;  2LY2 A;  2X1C A;  5F0F A;  4C3J J;  1XC5 A;  3DPL C;  4RLF A;  4XLE A;  3CO6 C;  4J01 A;  1ETY A;  1K79 A;  3S3O A;  4BDZ A;  3AG2 H;  3HOS A;  2IS4 A;  4RGU A;  4J00 A;  2A68 F;  1FBU A;  4NQW A;  4C9Y A;  2I10 A;  1TBX A;  2RDP A;  3GEZ A;  2ELK A;  1FYM A;  3U2R A;  1UST A;  2PQ8 A;  2DA6 A;  1ZN2 A;  2XF7 A;  4AU7 A;  3J7A Y;  3A03 A;  3I4N J;  3GXO A;  4A69 C;  2R7R A;  1W5T A;  3S2D J;  2L9S A;  3TO7 A;  3BC8 A;  1UG2 A;  5DYM A;  2IAI A;  1IF1 A;  2IRF G;  5IPA A;  3JRE A;  2K27 A;  2DQR A;  4JOM A;  1UJ8 A;  3KYD B;  3DEE A;  1YIJ I;  1G4D A;  2HTJ A;  2EIN H;  3HKZ N;  1OPC A;  3MCZ A;  3ERM A;  1PP8 F;  2O0Y A;  5GTI C;  4K2E A;  3PSF A;  5EJC A;  3UNG C;  3BLY A;  3WE3 A;  3CCR I;  2NOJ B;  4UV8 A;  1ETK A;  1YJN I;  3BZ6 A;  1FY7 A;  2E60 A;  2LC2 A;  3TO9 A;  4L0Y B;  3I9V 2;  5E3M A;  5AIP A;  5ICG A;  4LJZ F;  1VQP I;  2CV1 A;  4BE0 A;  1Z1D A;  4WXD A;  1Z77 A;  2D1V A;  1FNN A;  1R49 A;  1JKR C;  3JRD A;  1HST A;  1YE9 A;  2CU7 A;  3PUF A;  1DU0 A;  3GTK J;  3I4M J;  2ZJR F;  2LF7 A;  3VB2 A;  1YRN B;  3JTG A;  5DV5 A;  1YW8 A;  2L9R A;  3DP7 A;  5GAD J;  2XKP A;  4XRS A;  3OS0 A;  1XMA A;  2CH0 A;  5LGU A;  2ZNZ A;  2CQN A;  1NG7 A;  1LFU P;  2KPM A;  2N8G A;  2R7U A;  2E19 A;  4I09 A;  2CFO A;  2MBF A;  4XID A;  2VOP A;  3BTI A;  3W6K B;  3S15 J;  4P5O A;  1ZK8 A;  2G7H A;  2MG4 A;  2DA5 A;  2V26 A;  2EJR A;  5BS6 A;  5JR3 A;  5J1Y A;  3H0D A;  3M07 A;  1X1A A;  2ZJP F;  1Q1H A;  1D3Y A;  1I6X A;  5EG0 B;  2M0M A;  4ZDL A;  3CMM A;  3W2A A;  4TV7 A;  2DXI A;  4HG2 A;  1XSD A;  1WJE A;  5IP9 J;  2E2J J;  3BR1 A;  2F4I A;  4ESF A;  5K1Y A;  3D5R C;  1W7P A;  1RI7 A;  4PJN A;  3RZD J;  1IJW C;  4QLC U;  3G73 A;  1NK2 P;  1WRJ A;  2KJC A;  2JA7 J;  3LA7 A;  1KGS A;  1MMA A;  1E0E A;  4XRS G;  5L3D A;  1YW7 A;  2VE8 A;  1X1B A;  1X1C A;  2WV1 A;  1KZH A;  2AXT C;  2XV4 S;  2CV0 A;  1Q1V A;  3OL4 A;  1FMV A;  3L2U A;  2WB1 A;  5GAE J;  3J7Y J;  4Y17 A;  2QZ8 A;  3FXQ A;  4D5C A;  4PSW A;  3IAM 2;  2NVQ J;  1IXS B;  4LG0 A;  1RR8 C;  1MIJ A;  2Q0O A;  1BOA A;  2Y48 A;  2M45 A;  1JI8 A;  2BVL A;  3B6C A;  3BZC A;  2HDC A;  4PGH A;  4BQO A;  1E3H A;  1A04 A;  1XCB A;  3MEX A;  1YO5 C;  2K4J A;  2KIM A;  1G2H A;  1ZGJ A;  3BDD A;  2DA4 A;  4FCY A;  1ZRF A;  3L2R A;  1Y39 A;  1R36 A;  1F1Z A;  4GXO A;  3HYI A;  1FP1 D;  2VOD A;  2D1H A;  2X6W A;  1JKP C;  1V54 H;  1R00 A;  2M8G X;  4DYQ A;  2ELH A;  2QSG X;  5M5X J;  2BY1 A;  2ZXW H;  1GLN A;  1UZC A;  3BTJ A;  4BXF A;  4ZYG A;  2IBD A;  2CV2 A;  3FIS A;  3CUQ B;  3NRV A;  1MJ9 A;  2W85 A;  2M7B A;  1UB9 A;  2CQK A;  3BJO A;  3IWF A;  3OS1 A;  2ACJ A;  1ITY A;  1XGN A;  2X51 A;  4H4K C;  2ETH A;  4ESJ A;  5FLX K;  2H8W A;  3QU6 A;  3W6J B;  2HTS A;  2Z16 A;  4HEA 2;  2JA6 J;  1VI0 A;  5FGM A;  1ZLJ A;  2L7M P;  4XN0 A;  2XPV A;  4ZYA A;  2WAD A;  2PJR A;  3NAU A;  2ZFU A;  3ABT A;  3GO5 A;  1BL0 A;  4B09 A;  2Y0S N;  1FOW A;  3HEF A;  3CLO A;  1GXP A;  2HZT A;  5C4X J;  1QZE A;  3I59 A;  5CQE A;  2H09 A;  2EIL H;  5KK1 A;  4DZJ A;  4OIR F;  2QQA A;  3DKX A;  3E5X A;  4X1E A;  2H1L A;  3B73 A;  4OIN F;  3QYE A;  4KIS A;  5FRN A;  4XOP A;  5FD6 A;  4S0H B;  2CS3 A;  3Q5F A;  3ECH A;  1YIO A;  3PUB A;  1GT0 C;  1SAU A;  5DTD A;  3KEO A;  3GFL A;  3F72 A;  3I64 A;  2COM A;  3LAP A;  4MEY F;  1JHF A;  3C3W A;  1S6L A;  5LGN A;  3FHN A;  1G8X A;  1N75 A;  3M1E A;  2M8E A;  2ICW G;  4EJO A;  4IO9 F;  1K78 B;  3DXJ F;  2L2O A;  3PM1 A;  3GZ5 A;  4C3H J;  3CCV I;  5EEH A;  2R7D A;  2WAQ A;  3DF8 A;  4XM3 A;  3JSP A;  2EH3 A;  4LB6 B;  4RAG A;  1MBJ A;  3GX4 X;  1YJW I;  2P0W A;  4HRI A;  1U0J A;  3CCJ I;  3S1R J;  1RKW A;  3MD2 A;  3ABL H;  3I5U A;  3R0A A;  2W4S A;  2HOS A;  4XK4 A;  2XGD A;  5E1X A;  2BHZ A;  1QQI A;  2IPQ X;  3FMQ A;  2EZI A;  3RPQ A;  1UHM A;  1TWA J;  5E1W A;  1U78 A;  4II3 A;  1O3Q A;  3K1M A;  4YII A;  1GHC A;  4XIC A;  3F23 A;  4I0A A;  3V4G A;  4GYG A;  1WH7 A;  4WX9 A;  3JRH A;  4BUP A;  4DYC A;  3VYT B;  3DTI A;  4FIS A;  2W82 A;  4E4H A;  4ZYD A;  4HOB A;  4ZC3 A;  4U0Y A;  3KEQ A;  4AIK A;  2LSO A;  4G6Q A;  2GXA A;  4IRI A;  1ZG3 A;  2IA0 A;  1NHA A;  3ZMT A;  3NQO A;  3CME I;  1P6R A;  2X6X A;  5HLI A;  1CF7 B;  1LVA A;  1FTZ A;  2IVM A;  3EDP A;  5HNF A;  2LMD A;  4RBO A;  4L5E A;  2ESN A;  5ILU A;  3TKY A;  1ZR4 A;  4A0X A;  1ORK A;  2ZB9 A;  1I3Q J;  1W1W E;  2X85 A;  3QYB A;  4A3G J;  2XB0 X;  1JXS A;  2D5V A;  2GOM A;  2R5Z A;  5E1Z B;  4ZDP A;  5LEK A;  1XB4 A;  2ZME A;  2F5V A;  3TW7 A;  3J81 Z;  2O7O A;  5FLV A;  1IDZ A;  2MC4 A;  2R7S A;  4Y7N J;  3LA2 A;  1V4R A;  1TL8 A;  3ZQL A;  2M4G A;  1B1B A;  2L5Q A;  4Y33 A;  4BAY A;  4A93 J;  2GQQ A;  4M6X A;  3FXJ A;  4ANJ A;  3H35 A;  4E7H A;  2DLL A;  3MKL A;  4B43 A;  1TQM A;  4EV0 A;  1DDN A;  4RLQ A;  3FDY A;  3OWT A;  1H9T A;  1ULY A;  2CO5 A;  3PFI A;  2ZME C;  3KLO A;  5HS7 A;  2C6Y A;  1P4W A;  2UWM A;  2EFW A;  3TDZ C;  3RIR A;  2XAS A;  2TRT A;  1KYW A;  1ZG5 A;  3BG6 A;  4NC6 A;  5LGT A;  3J80 Z;  4OIO F;  1AOY A;  3MZ8 A;  3V8K A;  4BH9 A;  4NC7 A;  3K4B A;  4KIG A;  5GTH C;  1IUY A;  2CW8 A;  2DCE A;  1YG2 A;  3O6B B;  2QWW A;  3MQ0 A;  4JQF A;  4UB8 C;  4OOI A;  1VQ8 I;  3I3L A;  4KIC A;  1MBF A;  4JP0 A;  5DD4 A;  4AUX A;  3ZRG A;  5TRD A;  2ZKZ A;  4S04 A;  4G9Y A;  1R4N B;  1A6Q A;  1W36 C;  4ZZD A;  4BDY A;  1RIO H;  1YS6 A;  5J47 A;  2Z1D A;  5A2Q K;  2L54 A;  3BPX A;  1RUN A;  3ZQC A;  2FNA A;  3WOD F;  3UKG A;  4XLP F;  1LVK A;  3RPU D;  5D5U B;  5IOZ A;  4V2F A;  4YG2 F;  2IA1 A;  5HS9 A;  1PYV A;  3GFM A;  1B8I A;  1R1V A;  2X6Y A;  1U9O A;  3H3U A;  1MZB A;  1OCZ H;  2LVS A;  2OC6 A;  2G7U A;  4H0E A;  5CVV A;  3EQL F;  1KQ0 A;  2UZK A;  1Y0U A;  2ISZ A;  1DPR A;  2DTZ A;  1USS A;  1W4M A;  2CUE A;  1NTC A;  1UEL B;  2LK2 A;  2M30 A;  2R7F A;  4OMZ A;  5BPI A;  1A35 A;  2ZJ2 A;  3EUH A;  1MDM A;  3EUA A;  1BM9 A;  2H94 A;  2KIF A;  4IL6 C;  3SQN A;  3GLX A;  3QRF F;  1WHU A;  2JQ7 A;  4QIW N;  4QPO A;  4M6V A;  5E17 F;  3G3Z A;  2R5Y A;  5C4J J;  3GF2 A;  4X0G A;  4EM2 A;  4PSX A;  3KP4 A;  2QQ8 A;  2H27 A;  1QVU A;  1ENH A;  5H2F C;  3IH4 A;  2EV0 A;  4CZC A;  5JLW A;  4AYB A;  3AG4 H;  2E2H J;  2Y0M A;  4BQA A;  1ACI A;  1RZ4 A;  1TQI A;  4BQN A;  1B72 B;  1Z67 A;  2JJ7 A;  4E7J A;  2O5R A;  3FXM A;  2GA1 A;  2ELJ A;  3HPG A;  1EH7 A;  3HC7 A;  2W00 A;  1JE8 A;  3EUH C;  3IHU A;  2B63 J;  3DBH B;  1ETO A;  2NVX J;  1W0U A;  3VOD A;  2RQP A;  1OJL A;  3O8G A;  4IHW A;  3K70 C;  1MD0 A;  2DMQ A;  2NS0 A;  1Y1V J;  1J09 A;  4YRV A;  5IYB J;  2VIX A;  1SFK A;  3BR5 A;  4BJ6 C;  4GDF A;  3HB9 A;  5BOX A;  3BG7 A;  4CXF A;  1TW3 A;  4M3G A;  3HJE A;  1T2K A;  3F8B A;  1O3S A;  4BS9 A;  2YPR A;  1XD7 A;  2IGN A;  1MH4 A;  2OCE A;  1OCO H;  2RRE A;  3A01 A;  4HDU A;  2V1N A;  4RA2 A;  5TGT A;  4XN3 A;  5EYR A;  3LSR A;  3K1N A;  1EH6 A;  3C18 A;  3CTA A;  2BHY A;  4AWX B;  5HOD A;  3F22 A;  3OY9 A;  4PCQ A;  4XSZ F;  2HVR A;  2V1D A;  2CUJ A;  3CCS I;  2D45 A;  1R1T A;  2FQ3 A;  3IV5 A;  2L0K A;  2F6C A;  4DNC A;  4ZTF A;  1S3J A;  1Z7U A;  2FRH A;  4MGR A;  4XKW A;  2L7K A;  2WB1 N;  3OMY A;  2IA2 A;  4JX5 A;  3ONQ A;  5FKL A;  2XVC A;  1MJA A;  4ZJZ A;  1WJ5 A;  5FB2 A;  4MFE A;  1Z0X A;  1IZ1 A;  5J40 A;  1XGM A;  1XG1 A;  1GXQ A;  2M9H A;  2JRT A;  5FKN A;  1BI3 A;  1B9M A;  3BR6 A;  4XBF A;  1WPK A;  3OYI A;  1REP C;  1VZ0 A;  3AKZ A;  3QU3 A;  4A3E J;  1J9I A;  3BR3 A;  1RR7 A;  3N4M A;  1WJF A;  4ENJ A;  4O5V A;  5LFA A;  4FQG A;  1Z6T A;  4BBR J;  4RDU A;  3FZV A;  2UXX A;  1SD4 A;  1DGW Y;  2MW8 A;  2OQR A;  3WHC A;  1R5G A;  4BBS J;  1XGO A;  3SYT A;  2FMY A;  4UUS A;  2M4K A;  3MVP A;  2E35 A;  1FX7 A;  2F48 A;  1XX5 A;  2QYO A;  4ENN A;  1TW2 A;  3BG3 A;  2HS5 A;  2Z5U A;  4EVI A;  3SDB A;  2WY8 Q;  2HDD A;  2Z3Y A;  1X4P A;  2NXN B;  4XKC A;  3E97 A;  2XUB A;  4E7S A;  1ZRC A;  3H0G J;  2K9Q A;  1V5E A;  2R4G A;  3E1S A;  2XRN A;  2QEX I;  1T33 A;  1QBJ A;  4XOT A;  2IGO A;  4FTH A;  2YX4 A;  3OSG A;  1SMT A;  4C30 A;  3A4C A;  3H92 A;  3I56 I;  3M8J A;  4JBA A;  1K61 A;  3T0Y A;  3WTY C;  5KCM A;  1TWF J;  3OSF A;  3KIO A;  1VTN C;  3O3K A;  4Q4Z F;  2FML A;  3GZ6 A;  3PNV A;  1D0X A;  1X1D A;  2E71 A;  2DA2 A;  3KP2 A;  4HF1 A;  2OA4 A;  1IN5 A;  2LOO A;  3HL2 A;  3WTW C;  4Q5S F;  3R4K A;  2K86 A;  2NVU B;  3CCE I;  2A5Y B;  1DP7 P;  3IUO A;  5GAG J;  4M3F A;  3OYH A;  3LAJ A;  1J75 A;  3DWL E;  2B0L A;  3DLL F;  5FD5 A;  3F8F A;  3H36 A;  3W2V A;  2WAQ N;  5KAF C;  4IHY A;  2MD5 A;  3UR3 C;  3K7A J;  1N77 A;  3CP2 A;  2Z9O A;  3R61 A;  2JK3 A;  3S93 A;  1LEB A;  1JT6 A;  2VKV A;  4XOR A;  4FE4 A;  1F5T A;  4IX7 A;  4XLF A;  2RV8 A;  2RVC A;  1VQ5 I;  4AVP A;  4AD9 A;  3SEQ A;  3NWT A;  3ZMU A;  3HSE A;  3CLQ A;  3L09 A;  4HW0 A;  2BY3 A;  4MHG A;  4Y4R A;  5BMZ A;  4O3M A;  2DA1 A;  4L9J A;  2PMH A;  2H6B A;  4I01 A;  3AFH A;  4ON0 A;  2HGC A;  3MKY B;  3GLL A;  4GO1 A;  4HPQ A;  4N9H A;  4CCL A;  2GM4 A;  3LNQ A;  2BEO A;  3ZQ7 A;  3LSI A;  5FLX Z;  3BPV A;  1K6O A;  1I50 J;  1S29 A;  1IG7 A;  3RTR A;  3H3V K;  5J4Y A;  2DT6 A;  4DBR A;  2VPL A;  3MFK A;  4R79 A;  1AKH B;  2CGP A;  1UHS A;  1WI9 A;  3LWF A;  4XON A;  3OYG A;  1ZQ3 P;  2J5P A;  4AM3 A;  3SZP A;  1ON1 A;  2Y69 H;  2YSR A;  1YI2 I;  4UVB A;  2CG4 A;  1FJL A;  1P92 A;  1QGP A;  1WWX A;  2HYF A;  3L1P A;  4FHT A;  2HFH A;  3BQY A;  2TCT A;  2W48 A;  4HX7 A;  2M34 A;  1T6S A;  2TDX A;  3EUK L;  3TOB A;  2ECC A;  4HLY A;  5F08 A;  1U8R A;  1E2X A;  1K4T A;  3VPR A;  4XLH A;  5J3L A;  1GVD A;  3L2W A;  4KN4 X;  4KJZ A;  2X1E A;  3GZN B;  2MLG A;  2JA2 A;  3PIP F;  2EA2 A;  4AC0 A;  1M1E B;  1CQT A;  4C3I J;  4MO7 A;  5B1A H;  5CVR A;  1HKQ A;  3RKX A;  4G8X A;  1GVJ A;  1A6I A;  1LUJ B;  3O8H A;  1V5G A;  3OOP A;  3HOU J;  4EAT A;  3L00 A;  4N4N B;  2Y9Z A;  1BW5 A;  4UUV A;  2X6O A;  2WC2 A;  3OYL A;  1EF4 A;  3HRT A;  5J8C A;  4EMS A;  4RB3 C;  1DP3 A;  1FT9 A;  1HW1 A;  3IH3 A;  2UUZ A;  4BE1 A;  1JUS A;  1MNM C;  4M73 A;  1TT0 A;  4FET A;  3T5X A;  2DDA A;  3V7C A;  4NDL A;  4ENK A;  2A61 A;  4W97 A;  5D8L B;  3G4S I;  4LIU A;  4IHV A;  3RI4 A;  3ROU A;  1YRN A;  4C2T A;  1MMN A;  3AG3 H;  3R0J A;  1H8A C;  2VJJ A;  3HDD A;  4NQW B;  2HYJ A;  1E3O C;  3ELK A;  3FM5 A;  1XDU A;  3D0S A;  1R9T J;  3GTQ J;  1LPQ A;  3CJN A;  1EH8 A;  2B7E A;  2RKH A;  2OZ6 A;  4JX6 A;  3ZMS A;  2QCO A;  4F92 B;  3B6A A;  2KP6 A;  3S3N A;  2CQ7 A;  4UB6 C;  3ECO A;  1SC7 A;  5C3E J;  1IRG A;  5EF6 A;  1N25 A;  5EG0 A;  5F27 A;  4RGR A;  2P4W A;  5L3B A;  1YTY A;  2HOA A;  4OIQ F;  4Q48 A;  2R7T A;  2E7X A;  1H89 C;  3H5A A;  2HPI A;  3LSJ A;  3PL8 A;  3PFY A;  1ON2 A;  1J59 A;  4HNT A;  2RQQ A;  3X2Q H;  1HKT A;  1W5C C;  3QYF A;  1BC7 C;  4BHC A;  9ANT A;  4LIV A;  1K7A A;  4I7H A;  3JSO A;  2V7F A;  2HXI A;  4RB1 A;  3CO7 C;  3HOY J;  1FTT A;  4AYB N;  1B59 A;  1T95 A;  3W3C A;  2HR3 A;  3VFZ A;  3OL3 A;  3MZH A;  1W0T A;  3KP5 A;  2LDU A;  1I39 A;  4X6A J;  1IXC A;  5DCM B;  1Z6R A;  2J5O A;  1HLV A;  2LRD A;  2P5K A;  3ZMD A;  2KZV A;  3BG5 A;  1P9Q C;  4HBL A;  1VQL I;  3P5J A;  3S1M J;  3FKJ A;  1LQ1 A;  2FJ1 A;  1EA3 A;  4HLX A;  4Y52 J;  5IP6 A;  3SFZ A;  3BTL A;  1X19 A;  4I99 C;  4OWR B;  1ODD A;  3JRA A;  2QSF X;  3ASN H;  3W6V A;  3G1L A;  5IYC J;  3TED A;  2A07 F;  2YS9 A;  1IXR C;  2ZCW A;  2DN0 A;  1P7J A;  5A2Q Z;  2ID6 A;  2IXS A;  2EK5 A;  5LHI A;  2Z2S B;  3U21 A;  1VQ6 I;  3Q0V A;  2LH9 A;  4QTR A;  1JJ6 C;  3WGG A;  4L0Z B;  3J7A O;  1NK3 P;  4BAC A;  3KP6 A;  3CUQ A;  3I54 A;  3DU6 A;  1W7P D;  1QA6 A;  1H88 C;  2O8X A;  3GYH X;  1FOY A;  3ESW B;  5FFZ A;  3PNT A;  3LOC A;  4DBQ A;  4BNC A;  3AL0 C;  3QPS A;  2BXY A;  1U2W A;  2DOF A;  1X1P A;  2EZK A;  3QPL A;  5D6E A;  3PQJ A;  2LBF B;  2WBM A;  2ZC2 A;  2JVG A;  2RC4 A;  4L5I A;  3JW4 A;  4XSX F;  4E70 A;  1YX5 A;  5E79 C;  2L9N A;  3T8T A;  1ZHF A;  1SVM A;  1D8K A;  2EV5 A;  2MA3 A;  4LG0 B;  3CUQ C;  2M5W A;  3HUG A;  4KNY A;  3JRG A;  1QPI A;  3HOV J;  4EM1 A;  5E18 F;  2PMZ A;  1P4X A;  3NWS A;  1O7L A;  1Y6I A;  1ZTR A;  3CCQ I;  3BCA A;  2DU9 A;  2KQR A;  1XCV A;  1S5L C;  3OR1 C;  1T56 A;  1OFC X;  4ETS A;  2GOX B;  1PUF B;  3KZY A;  2HQR A;  4GYI A;  3JAM K;  1FBS A;  4PK4 A;  1VQM I;  3JCU C;  1T38 A;  4LB5 A;  5HDN A;  2HYG D;  2KL4 A;  1TZL A;  2P81 A;  5JHF A;  3C1D A;  3K4N A;  2XAH A;  2K9N A;  2VJ4 A;  3HPH A;  1DQU A;  1BR2 A;  4AVZ A;  4Y13 A;  1K78 A;  1W5S A;  1R5H A;  3S2H J;  2VQL A;  4CUG A;  1U5T A;  3PQK A;  2QA4 I;  3ZQG A;  2K4B A;  2L4A A;  4UNO A;  1G3S A;  4IJA A;  1GV5 A;  3S1N J;  2EFQ A;  1LEA A;  5EEA A;  4Q47 A;  1O3T A;  4BHP A;  4LIT A;  4PJJ A;  3QOE A;  3QWL A;  1ZAR A;  4IHS A;  2OF7 A;  3WTT C;  4E7Z A;  2XAJ A;  3QOP A;  3CCL I;  3BG9 A;  1HSJ A;  3DV8 A;  3VYU B;  2EIM H;  1BOB A;  1ZH5 A;  1DPU A;  4B1R A;  1JUP A;  1U5T C;  3NAR A;  1Z05 A;  4RGS A;  1WVR A;  2LR8 A;  1HDP A;  2OQG A;  5F0H A;  1D0Z A;  3C2G A;  3BJA A;  2ZJQ F;  1JKO C;  2A5W A;  2WWY A;  2Y2Z A;  2PG4 A;  2FBH A;  3ZQH A;  5DEQ A;  3AG1 H;  5J6X A;  4UV9 A;  1BIB A;  2E1N A;  3H5R A;  3HGY A;  4B47 A;  2XB5 A;  4NB5 A;  4RM3 A;  4XLN F;  1TWG J;  1X4O A;  5F1J A;  3MWM A;  3HOX J;  2WAF A;  4RMN A;  1R22 A;  3OYF A;  1K6Y A;  1YOV B;  2VL8 A;  1MND A;  3LSK A;  2V9P A;  2LY1 A;  4LK1 F;  1YW9 A;  4HST A;  1YQA A;  4CH7 A;  4F55 A;  2GIZ A;  2G9W A;  1MGT A;  3L2V A;  2DA7 A;  1OYW A;  4FX0 A;  5LHG A;  5E3N A;  1NH3 A;  3ZN1 A;  3RDI A;  3GME A;  2MGQ A;  5IY5 H;  3LQQ A;  2JN6 A;  2DJN A;  3DPU A;  2CWE A;  3WU1 B;  5JVT A;  4NNJ A;  1MBE A;  2VBY A;  4KN7 X;  3WTV C;  1SFE A;  4B3X A;  3N97 A;  1R4M B;  4LD5 A;  2BGC A;  2DDB A;  3RKW A;  4CIC A;  4FE7 A;  2M0C A;  4LMY A;  3TP3 A;  4MQ9 F;  2VC1 A;  3ABM H;  5LLQ A;  3CES A;  1ZRD A;  2VXD A;  4CA0 A;  3KYC B;  4B3A A;  3VWB A;  3A2K A;  2OV7 A;  3K2A A;  1ETX A;  1Y8Q B;  1PVE A;  3JRB A;  2E5N A;  5KAI C;  4DJA A;  4A6E A;  2XHK A;  3Q3S A;  1LFB A;  1YFH A;  1I1S A;  2A69 F;  1XMX A;  3CD6 I;  2P6T A;  3V8L A;  4CO8 A;  4DQ2 A;  3I0T A;  1EKE A;  1VFC A;  1DU6 A;  3U1D A;  5IOY A;  2FX0 A;  4AIJ A;  1GV2 A;  3H5N A;  2R5Z B;  4XR6 A;  5FO5 A;  1YJ9 I;  4A3I J;  2NS7 A;  2FU4 A;  1TT5 B;  3ML6 A;  3R60 A;  5TIS C;  4KFC A;  1FWZ A;  1Y1W J;  2DPU A;  1A36 A;  2GAU A;  5FKK A;  5FLM J;  2DBB A;  2OD5 A;  1HW5 A;  3FXL A;  3E3V A;  2L3D A;  1WKM A;  1OLT A;  2ISY A;  3GBG A;  3K0L A;  4L18 B;  3L2Q A;  1IN7 A;  2M7A A;  3WGI A;  4OAY A;  4M9S A;  1IRF A;  3ISP A;  4XRF A;  1IV6 A;  4HA8 A;  2YU9 J;  3CF2 A;  1FLI A;  1MJB A;  2JPB A;  4LFU A;  4WXH A;  4D5F A;  2R93 J;  2VT3 A;  1D1A A;  1JTX A;  3BT9 A;  2M3A A;  1D1C A;  4HF2 A;  4LLG F;  1RET A;  3CMA I;  1W36 D;  5HDK A;  1BI1 A;  2BE5 F;  2V79 A;  1G6N A;  3ABU A;  2KIS A;  4HAM A;  1TNS A;  2JA5 J;  3PNY A;  3SXY A;  2ADU A;  4CZZ A;  3DEU A;  1Z3X A;  2BZT A;  2KFD A;  3KET A;  4DGW B;  3RYR A;  1AWC A;  1B9N A;  2X0L A;  3QP6 A;  1DGR M;  2VI6 A;  2E1M B;  3FBN B;  1TQP A;  1IRX A;  2NAZ A;  2XIG A;  4BHB A;  4UHT A;  4IOC F;  1XTA A;  4KIB A;  1MMS A;  2VQC A;  1E17 A;  3EYI A;  1HBX G;  5ILV A;  1KQ9 A;  1X2M A;  4MNU A;  2E36 A;  3V7S A;  1ZRE A;  2F5C A;  2COB A;  2OAZ A;  4YEL A;  2Q2E B;  4ASN A;  2EIK H;  3RKQ A;  3L7W A;  4AIH A;  1IRZ A;  3GVA A;  1X2N A;  3RZO J;  1T8I A;  3W2W A;  3HSR A;  3K4C A;  1MSF C;  1WJB A;  3HHH A;  2VKD A;  4ZH4 F;  2DW4 A;  2ZXJ A;  1DUX C;  2MAB A;  1KU9 A;  2HOT A;  5ERI A;  3HSF A;  2FBK A;  1XSX A;  2V1X A;  2XGC A;  1GDT A;  2IP2 A;  4HNV A;  4B48 A;  3K6G A;  3TDU C;  4L9N A;  4P55 A;  4JK1 X;  3BWG A;  2CQX A;  1OR7 A;  2KRC A;  4BXU A;  5DM6 F;  3MKZ A;  2JWT A;  1R58 A;  2QM3 A;  2LKP A;  4CYC B;  1QPM A;  3ULQ B;  2QVO A;  5JVG F;  2KKO A;  4BJ5 C;  4LG3 A;  4HYE A;  5F1R A;  1HA8 A;  2A05 A;  2R5Y B;  1IGN A;  3FK7 A;  3K70 D;  2XRL A;  2RNG A;  4EJV A;  2Q1Z B;  4U87 A;  2X48 A;  2DOA A;  1QVT A;  1YS7 A;  1G3T A;  2FE3 A;  5H6Q A;  2ZO4 A;  1OQY A;  3LSG A;  1ZAO A;  5IYD J;  3A02 A;  4G7O F;  3CJT B;  4G12 A;  1G59 A;  2H1K A;  4V19 K;  3VSK A;  3TGN A;  2OZU A;  3K9T A;  1OR7 C;  2QKL B;  4UXN A;  1QRY A;  1ZEL A;  2EFP A;  4XL9 A;  1VQO I;  4NHJ A;  1S9H A;  2VKE A;  1VQK I;  1KA8 A;  2HOE A;  2AHQ A;  2M1B A;  3GWZ A;  5EGO B;  4GRI A;  1I27 A;  2EFO A;  3DU5 A;  4ZYE A;  5DDG A;  4KA4 A;  5FJ8 J;  4A3B J;  4N0B A;  2YR2 A;  2QKM B;  3ZXS A;  1SVO A;  3GUD A;  4LLL A;  4V2G A;  3BP8 A;  2DMT A;  3MMY B;  2ZSI B;  5J4V A;  3G1O A;  3LFK A;  3DLA A;  3LQR A;  3F0C A;  2D2W A;  3CQZ J;  1XSV A;  5B1B H;  4D0P A;  3GTM J;  3K4K A;  4XKV A;  1D1B A;  2VC0 A;  2K02 A;  3A01 B;  1BA5 A;  5AIQ A;  3BY6 A;  4A12 A;  2DPD A;  4D7M A;  5D5W B;  1O57 A;  1TTY A;  3E6B A;  4R1H A;  3QPH A;  4MTE A;  3NEU A;  2IT0 A;  2QQB A;  3CDI A;  3A0B C;  1MBH A;  2IGM A;  4MLO A;  1UFM A;  3RSN A;  3S2W A;  3JR9 A;  3HOT A;  2LYC A;  4AID A;  4FX4 A;  1SEU A;  1X3Z B;  1LE8 A;  2XC7 A;  4M3E A;  2HXO A;  3CJQ B;  3BTC A;  2JA8 J;  3T1B A;  1O3R A;  2ZFW A;  4HDV A;  4IPA A;  4BEH B;  1AU7 A;  3E7L A;  1OCC H;  3P9K A;  4B44 A;  5D4R A;  2LRE A;  5DD8 A;  5L3F A;  2BYV E;  5HS8 A;  2PMZ N;  3HRU A;  5ED4 A;  2K3P A;  2KZG A;  1XGS A;  1TWH J;  3ZQF A;  2XKO A;  4G6D A;  1ZGW A;  4WCG A;  4EGZ A;  1V3F A;  1BJA A;  1D0Y A;  1LNW A;  3OYD A;  2DMP A;  1U3E M;  1ZG1 A;  2HQ5 A;  2R0Q C;  2RN7 A;  3LL7 A;  1QZZ A;  2IS6 A;  2DT7 B;  3F6O A;  1IN8 A;  1FPQ A;  3BQZ A;  2KJB A;  3CDH A;  3GCM A;  3C2B A;  1FOX A;  2X9D A;  2MSY A;  2LKX A;  5FKO A;  5IP7 J;  1TP4 A;  2CFX A;  4UUS B;  2W1O A;  1IW7 F;  4MTD A;  3GFI A;  2WV0 A; 
#chains in the Genus database with same CATH homology
 2L2O A;  2XAU A;  3DTK A;  2KLO A;  2WAQ A;  4XM3 A;  3MKW B;  2R7T A;  4DIQ A;  3LSH A;  4IKF A;  3H5A A;  2HPI A;  2P0W A;  3PL8 A;  4F91 B;  1U0J A;  3PFY A;  4HRI A;  3OOU A;  3OYB A;  3MD2 A;  2IGK A;  4HNT A;  4CCM A;  2RQQ A;  2W4S A;  3QOD A;  4F93 B;  3QYF A;  1MMD A;  2JSP A;  3HG9 A;  4LIV A;  3KX2 A;  2JUG A;  4II3 A;  1N78 A;  2V7F A;  4KIT B;  3FBI B;  2HNH A;  4BUP A;  1PJR A;  3VYT B;  5LD2 C;  3DTI A;  1T95 A;  4E4H A;  2W82 A;  4IQJ A;  1NG6 A;  4ZC3 A;  4KT6 A;  3W3C A;  3VSL A;  3OL3 A;  3K4J A;  4E7L A;  2X6X A;  2BW3 A;  2VQH A;  3C2H A;  1T0F C;  3D5S C;  1FMW A;  2HDW A;  2LRD A;  4ITV A;  4Y3O A;  3ZQQ A;  5HNF A;  4HNU A;  5CPR B;  2KZV A;  1P9Q C;  3CZ6 A;  2X85 A;  3QYB A;  3FKJ A;  1EA3 A;  2GOM A;  4ZDP A;  3OYC A;  1X19 A;  4E7I A;  4OWR B;  4U7B A;  1Z3Y A;  2KDO A;  1Z7L A;  2UV1 A;  2F5V A;  4N4O B;  3K4L A;  2MC4 A;  2R7S A;  2K9M A;  4XLA A;  2HPM A;  2IXS A;  4BL0 B;  1MMG A;  2M4G A;  2Z2S B;  3U21 A;  2LH9 A;  2L5Q A;  4Y33 A;  4BAC A;  3DU6 A;  4II2 A;  4XKB A;  4ANJ A;  3H35 A;  4E7H A;  4B43 A;  4RLQ A;  3FDY A;  2V9K A;  3OWT A;  3IAS 2;  3PNT A;  1WJC A;  4DBQ A;  3AL0 C;  4BEH A;  1QHG A;  2LBF B;  2WBM A;  2ZSH B;  2JVG A;  2UWM A;  2KMU A;  1AA7 A;  1YX5 A;  3BG6 A;  2L9N A;  2CUZ A;  3H9Q A;  2ZXH A;  3CJR B;  2Y0S A;  4NC7 A;  2PMZ A;  3K4B A;  3NWS A;  1Y6I A;  2CW8 A;  2DCE A;  3BCA A;  2KQR A;  4JQF A;  3OR1 C;  3TMO A;  2GOX B;  3I3L A;  3CP8 A;  2BVM A;  3ZRG A;  1V5F A;  4PK4 A;  4XLC A;  1W36 C;  2KL4 A;  1TZL A;  3OIQ A;  5JHF A;  3ZCO A;  3K4N A;  4BDY A;  2Z1D A;  2JVH A;  2VJ4 A;  3HPH A;  1ERD A;  1DQU A;  3H9J A;  1BR2 A;  2OUM A;  4OAZ A;  1LVK A;  4AVZ A;  3ZR8 X;  4PFO A;  3RPU D;  2VQL A;  4CUG A;  1QU3 A;  3EPZ A;  2BOL A;  3S32 A;  4BJT A;  2E5Z A;  1R6R A;  1PYV A;  2A6T A;  3KYL A;  2X6Y A;  4ZTJ A;  4LIT A;  4PJJ A;  3QOE A;  1LKX A;  2CMP A;  2OC6 A;  4C2U A;  1WJD A;  4E7Z A;  3VDX A;  3G2B A;  1UEL B;  4HSR A;  1KON A;  2XF6 A;  3VYU B;  1BOB A;  2V6E A;  3OYJ A;  5HVQ C;  3EUA A;  4CCO A;  3PJR A;  2XDV A;  3DPT A;  2R7V A;  4QPO A;  3VYS B;  1D0Z A;  3C2G A;  2R7Q A;  5KNL A;  2A5W A;  4X0G A;  4PSX A;  2R7W A;  3PSI A;  2WA0 A;  4DOZ A;  3DQV C;  4CZC A;  4AYB A;  3KEY A;  5CKT A;  4BQN A;  2R7O A;  4E7J A;  2O5R A;  2ELJ A;  4B47 A;  3H5R A;  3HPG A;  3HC7 A;  4RM3 A;  2W00 A;  3EUH C;  1X4O A;  2WAF A;  4RMN A;  3OYF A;  1K6Y A;  2VL8 A;  4F3Q A;  3OR2 C;  3K70 C;  1MND A;  3LSK A;  3HXL A;  1J09 A;  2LY1 A;  4YRV A;  4HST A;  2VIX A;  1SFK A;  4CH7 A;  2LG4 A;  4BJ6 C;  4E6K G;  4F55 A;  3L2V A;  3BG7 A;  2VKH A;  4D1Q A;  2DJI A;  3DPU A;  3H9G A;  3TL4 X;  4BS9 A;  4CSW A;  4XQF A;  4NNJ A;  2IGN A;  3F9K A;  4B3X A;  3LFU A;  2RRE A;  2CW7 A;  2V1N A;  4IZZ A;  4ZDO A;  5TGT A;  5FRM A;  3DTE A;  4XN3 A;  2I8D A;  2LBF A;  3CES A;  2VXD A;  4CA0 A;  3OY9 A;  3VWB A;  4XNF A;  2HVR A;  3A2K A;  2OV7 A;  2CUJ A;  1LFP A;  2AQE A;  4IQ4 A;  3LSM A;  4ZTF A;  2F6C A;  4CCN A;  2E5N A;  4DJA A;  2HU9 A;  2L7K A;  4XKW A;  2VLA A;  4PJL A;  3OMY A;  3S8P A;  3SZG A;  2BW3 B;  1WFX A;  3ONQ A;  5FRO A;  5HLT A;  4ZJZ A;  2VB6 A;  4P1W A;  1WJ5 A;  2K5C A;  1BR4 A;  3SEZ A;  1MNE A;  2XSJ C;  1UG0 A;  2AQF A;  2V4J C;  3H5N A;  1QHH D;  4XR6 A;  1BR1 A;  3OYI A;  3AL0 B;  2MD0 A;  3E0J B;  1VZ0 A;  2LY2 A;  2X1C A;  3AKZ A;  3DPL C;  4RLF A;  4XLE A;  1WJF A;  4J01 A;  3S3O A;  3RQ4 A;  4BDZ A;  3HOS A;  2IS4 A;  5LFA A;  4J00 A;  2HZD A;  5CQG A;  4C9Y A;  1OLT A;  1DGW Y;  3GBG A;  3L2Q A;  2M7A A;  4BGD A;  4OAY A;  2XF7 A;  3SYT A;  4AU7 A;  3J7A Y;  2R7R A;  2ZXI A;  2L9S A;  2M4K A;  3CF2 A;  3ZGK A;  5HNH A;  3BC8 A;  3K4M A;  1D1A A;  3SDB A;  2WY8 Q;  2M3A A;  1D1C A;  4JOM A;  1W36 D;  3DEE A;  1X4P A;  4XKC A;  4E7S A;  2K9L A;  3PNY A;  3HUG B;  1V5E A;  2R4G A;  1Z3X A;  1Y56 A;  3E1S A;  4DGW B;  3M1C A;  3PSF A;  4XOT A;  3UNG C;  3BLY A;  2PJR B;  2IGO A;  1DGR M;  2NOJ B;  4YEJ A;  3OS2 A;  2E1M B;  3FBN B;  4C30 A;  1IRX A;  2E60 A;  3A4C A;  2LC2 A;  3OIP A;  4BU2 A;  3M8J A;  4BQQ A;  3I9V 2;  5KCM A;  2VQC A;  3N05 A;  2CV1 A;  4BE0 A;  3PNV A;  1D0X A;  1YE9 A;  1X1D A;  4YEL A;  2Q2E B;  4E7K A;  1WJA A;  2R7X A;  2LOO A;  3HL2 A;  4NC8 A;  3W2W A;  3TBI A;  3K4C A;  4CCJ A;  2MFZ A;  1Z21 A;  4BE2 A;  1WJB A;  2VJI A;  3OS0 A;  2CH0 A;  2VKD A;  3IUO A;  1NG7 A;  1UAA A;  3OYH A;  2KPM A;  3DWL E;  2R7U A;  2VJ5 A;  2MAB A;  2CFO A;  3W2V A;  4P5O A;  2HVQ A;  3UR3 C;  2V26 A;  1N77 A;  4B48 A;  3CP2 A;  3K6G A;  3RCO A;  3H0D A;  1X1A A;  3S93 A;  2W7N A;  4XOR A;  4IX7 A;  4XLF A;  2M0M A;  2KRC A;  4ZDL A;  1LDK B;  1MW7 A;  3CMM A;  3MKZ A;  3W2A A;  2DXI A;  3SEQ A;  3NWT A;  5KHD A;  4HG2 A;  3OYA A;  1WJE A;  4Y4R A;  2F4I A;  3D5R C;  4BJ5 C;  4LG3 A;  4PJN A;  1HA8 A;  3MKY B;  3AFH A;  4XMY A;  3K70 D;  3VYR B;  2RNG A;  4HPQ A;  2Q1Z B;  1MMA A;  1E0E A;  4U87 A;  2DOA A;  4CCL A;  1X1B A;  3LSI A;  1X1C A;  3LSG A;  2CV0 A;  1G59 A;  3OL4 A;  1FMV A;  3RTR A;  3VSK A;  2WB1 A;  3L2U A;  1OR7 C;  2DT6 A;  2QKL B;  4DBR A;  2VPL A;  3IP4 B;  4R79 A;  1ZEL A;  3IAM 2;  4PSW A;  4XL9 A;  1S9H A;  4XON A;  4GRI A;  3DU5 A;  3OYG A;  1JI8 A;  2BVL A;  2QKM B;  3ZXS A;  4G6T B;  4BQO A;  1YX3 A;  3OYK A;  2IS2 A;  3V42 A;  3D5L A;  2WAE A;  3MMY B;  4D9J A;  4F52 A;  2ZSI B;  2KHM A;  2MYS A;  2WY7 Q;  3DLA A;  3LMM A;  3L2R A;  4QPQ A;  3OYM A;  3EUK L;  3K4K A;  4XKV A;  4XLH A;  1D1B A;  2X6W A;  3L2W A;  4KJZ A;  3OYN A;  2X1E A;  1GLN A;  2JA2 A;  2FUG 2;  4BXF A;  2CV2 A;  2IGM A;  4MLO A;  3RSN A;  3HOT A;  2VXZ A;  2LYC A;  2M7B A;  3OS1 A;  2XF5 A;  2XC7 A;  2X51 A;  2VAS A;  3A1Y A;  3CJQ B;  4H4K C;  1V5G A;  2Z16 A;  4EAT A;  4HEA 2;  4N4N B;  4BEH B;  4XN0 A;  2HVS A;  3OYL A;  4ZYA A;  2WAD A;  4B44 A;  2PJR A;  2ZFU A;  1DP3 A;  3HKZ A;  2LRE A;  2KRH A;  4PFP A;  2UUZ A;  4BE1 A;  2K3P A;  1TT0 A;  4FET A;  5CQE A;  4FAS D;  3DKX A;  3DKY A;  4KIS A;  3QYE A;  5FRN A;  4XOP A;  4NUB A;  4LIU A;  2CS3 A;  1D0Y A;  3BCB A;  4CCK A;  3OYD A;  1MMN A;  4C2T A;  3PUB A;  1SAU A;  2VJJ A;  4PUS A;  2IS1 A;  3K10 A;  3LL7 A;  4NQW B;  2E1M C;  2DT7 B;  2IS6 A;  4RM2 A;  3OYE A;  5HOO A;  3FHN A;  4PJM A;  4F92 B;  1G8X A;  2VQG A;  1N75 A;  2W1O A;  3S3M A;  2KP6 A;  2X1D A;  2HQA A;  3S3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...