2DO7A

Solution structure of the winged helix-turn-helix motif of human cul-4b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GSSGSSGIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cullin-4B
publication title Solution structure of the winged helix-turn-helix motif of human CUL-4B
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2do7A01
3HIFA 5LBQA 1FNNA 2XVCA 3DQVC 1PDNC 1STZA 1IXRC 2IT0A 2QENA 5E1XA 4ZZLA 2HEOA 1F9NA 3C7JA 4IPAA 3O2PE 3N97A 1IN5A 1FX7A 1FLIA 2MBFA 4LK0F 3VOEA 4R79A 4WXCA 5BPDA 2UXXA 3CUOA 3GX4X 1W7PB 3BWGA 2STTA 3I4PA 4YIIA 2H09A 2JSCA 1G3TA 5LLQA 2LNBA 2ZCWA 5D5XB 4RGXA 2M1BA 1SAXA 2KJBA 2GQQA 4M6XA 2F5EA 3M1EA 3WTWC 2RKHA 2FF4A 1P2FA 3ZMVA 3U9GA 2HTSA 3GZ5A 4EJWA 3WGIA 4BYYA 4GO1A 4R1HA 4UNOA 3FM5A 1IN8A 1CGPA 4L9NA 2M8EA 1FPQA 1BJAA 1OMIA 2RNJA 2FRHA 2QWWA 3KP6A 5H20A 1Z91A 1ZGJA 3WODF 3GO5A 3IHUA 2ACJA 4U88A 1QGPA 5ERIA 3T5XA 1VTNC 1I1SA 5TRDA 3DP7A 4L5IA 1UHWA 3OV8A 4KA4A 1U5TA 4NQWA 1ZLKA 1YQAA 3Q9VA 2HKXA 2DT5A 2YX4A 3IWZA 2EB7A 1QNTA 4ESJA 1WQ2A 3I71A 3MFKA 1L0OC 1LDKB 4FX4A 1MJBA 2HGCA 4ZYEA 2P6SA 3GLXA 2QYOA 1HKQA 1KA8A 2DAOA 2KIFA 2Z99A 3TO6A 1BN5A 2O0YA 2XAFA 2FNPA 2W84A 3W6JB 3E6MA 1Z6RA 3HOTA 3K0LA 4HDVA 1YW9A 1G6NA 5LGUA 4JBAA 2QM3A 3CDHA 2DBBA 4YFXF 5E8IA 3SZTA 2FQ3A 1OKRA 5CVUA 1R1TA 3QU3A 4I09A 3SFZA 3I0TA 1TLHB 1MDMA 1TQMA 3RDIA 4HQEA 5CJ9A 1B59A 3FZVA 3PFIA 3QPTA 1KU3A 2DFIA 3BROA 4JK1X 5CVRA 2HDCA 5L3EA 3GUDA 2DPDA 3SHFA 2QZ8A 1ZRCA 4P9FA 1IXSB 2HYFA 4AVPA 2MD5A 4GCVA 1IN4A 3QPHA 5LRSA 3GYHX 1CF7A 3VEPA 2F5FA 4KNYA 2K86A 2RGVA 4BAYA 4HW0A 4R8HA 3E3VA 5LHHA 3RKYA 4EV0A 2DW4A 3KFWX 2QVOA 1O3SA 2TDXA 4BHPA 3MZHA 2D1VA 5L3BA 4UVBA 3F8FA 2CGPA 1XSVA 4M9XA 5H6QA 2PJPA 4MGRA 1IAWA 3IWFA 4U0YA 5E1WA 1DP7P 5D4SA 3H92A 2FBIA 2CG4A 4K2EA 1XGMA 3WE2A 4PGGA 3FXQA 4A5NA 5ICFA 4CDGA 2Z33A 3K2ZA 5DUKA 2M87A 3CLOA 4GYIA 3Q5FA 3EQLF 3IL2A 4MQVA 1S29A 1ZRDA 1XMAA 3L00A 4CGZA 3BPVA 4RAZA 4MHGA 2STWA 3K9TA 1TBXA 3QP6A 2PG4A 3WGHA 3DXJF 3E6CC 3FXRA 1S3JA 1S6LA 1ZN2A 1R22A 2NYXA 2VN2A 4G6QA 4A6DA 2A6HF 2NRAC 2PEXA 4CO8A 3HHHA 3WTSC 2QBYB 3F21A 1KU9A 1MGTA 4F7ZA 2IJLA 3LA3A 3GXOA 5DEQA 3BP8A 4LG0B 3IKVA 2X4HA 4UV9A 1KQ8A 1R7JA 1MD0A 1R5HA 4KUMA 2CW0F 1R23A 5F1RA 2HQRA 5DD4A 1J0RA 2XAGA 1SMYF 5DCMB 4ETSA 5FFXA 1UFMA 3RPQA 4DNCA 2GXBA 4U0WA 5LGNA 4HAMA 2VONA 1JGSA 5K5OA 4HF2A 3F72A 4RB1A 3PQKA 2CQKA 1F4KA 3I53A 3E5QA 2VODA 3FMRA 2E1NA 3JAMZ 1BI3A 4HA8A 2ZMEA 1BBYA 2PQ8A 3KEOA 1XD7A 1USTA 5EEHA 3I5UA 1ZGAA 3F8NA 4LMYA 2M30A 1ONVA 3N4MA 3ZMZA 2G7UA 1U3EM 2H94A 5IT3A 2P7VB 2NAZA 1LDJA 4PDKA 4HLXA 3LA2A 1AOYA 2K27A 2L4AA 2MLKA 1YS7A 1FBQA 5D6FA 1I1GA 2YX7A 2HR3A 3H3UA 1KU2A 4WXHA 4M74A 2GXGA 2JTVA 2OQRA 3NEUA 2Z5UA 3DFGA 4HV6A 3ISPA 1U2WA 3B02A 4L9TA 4QLCU 5LRRA 3HOSA 1KYWA 3ECHA 3I54A 4M9SA 3B73A 1HW2A 3QP5A 1LJ9A 3LSTA 2ZNYA 4YG2F 1QQIA 3WGGA 1Z6TA 2ZO4A 2FE3A 3V7RA 2P5LC 2PI0A 1KQ9A 2BYVE 2D45A 4Y13A 3EDPA 4Y15A 2YU3A 2O61A 3L09A 2YPRA 2UWMA 2P5KA 5DUIA 1RI7A 4IHTA 2GAUA 1RUOA 3FF5A 2ZXJA 1P4WA 5L3GA 3RTRA 3VODA 2UZKA 1JHFA 2Q2EA 4MTDA 1YTYA 1HSJA 2EFWA 2XROA 3FMQA 3M7GA 2GA1A 1BM9A 5DV5A 1S7AA 1WKMA 1BIBA 1DPUA 1ZRFA 4L5JA 1ZG5A 1R58A 3PQJA 5HDKA 1ULYA 3F3XA 3GFIA 3RI4A 5LHIA 1E2XA 1FT9A 3F23A 3S2WA 4HYEA 3T0YA 4CHUA 3REOA 3TO9A 4EM1A 1IN6A 1RIOH 3LQQA 3GZ6A 2IVMA 3TOAA 3MZYA 4N9HA 2JT1A 1JHHA 2KIMA 2VT3A 4AWXB 3KP2A 2CO5A 1K79A 3ROUA 5LEJA 3I59A 3FWEA 4HV5A 2M45A 1DPRA 2FMYA 4CICA 5BMZA 3EETA 5AIPA 2Y75A 2DU9A 2VC1A 1SD6A 2ESNA 2PMHA 3R0AA 3E6BA 1GHCA 4KMFA 2A5YB 3FX3A 5EEGA 3F8BA 4NHJA 1FYMA 2Z3YA 3ML6A 4Y17A 3H3ZA 1E17A 1XGOA 3DF8A 4MTEA 4XSZF 1DDNA 2XV4S 2FA5A 2LF7A 2GZWA 1SD7A 2KIUA 4ZYDA 1MZBA 3FMSA 5FLXZ 3J7AO 4ENJA 1ZARA 2ZJ2A 2O03A 4A0ZA 1D3YA 5FO5A 4LK1F 5E8GA 5HLHA 3F8MA 1XCBA 4WWCA 2QQ9A 1FYLA 1OYWA 4EJTA 3ZMTA 1MJ9A 1Z7UA 3WE3A 3K69A 4G94A 1LQ1A 1SFUA 1T39A 1Z9CA 4FX0A 3IC7A 3ECOA 1FBUA 3D5LA 2QQBA 2VE8A 3NRVA 2G7HA 1H9GA 2V6CA 3C18A 2EFOA 4IRIA 4WXDA 4RAYA 2O3FA 5E17F 3GFLA 4M71A 4M73A 2EV6A 3E97A 4ENNA 4I98B 4Q48A 2L54A 2W24A 4HBLA 4L9VA 2G9WA 4G9YA 2WWYA 3HTUA 2VBYA 2VE9A 3HHGA 4LB5A 4G7HF 1UHMA 3LAPA 2DK8A 2P5VA 5IT9K 2A6EF 3G73A 3BDDA 3BJAA 3CUQB 1IZ1A 3LQRA 4JQFA 1ZYRF 1B9NA 4G7ZF 1J9IA 5AONA 1I27A 1K6OA 1AWCA 1QO0D 5D5WB 3ELKA 2EK5A 5ILUA 4HX7A 5TJJA 2KKOA 1S7OA 2BGCA 5JR3A 1P6RA 3OOPA 4OIRF 4HOBA 5ILVA 1ON1A 3KP4A 2AXLA 2HS5A 4OIPF 2ISYA 3JTHA 2DTRA 2OAZA 1T2KA 2FEZA 3F6VA 3IKTA 1G4DA 2VXZA 1B9MA 2ISZA 4BXUA 2OD5A 1K78B 1DUXC 3J81K 4L9JA 3M8FA 5KK1A 5D5VB 1FBSA 5HLGA 3BPXA 2K7LA 3CO6C 2W25A 1V3FA 2CYYA 5CLSA 4YFNF 3V7SA 4KDPA 1LEBA 2PBIA 4O5VA 2KJCA 2F2EA 5ICEA 1T0FA 3E5UA 1H9TA 3RKWA 4XRFA 2PN6A 4M6YA 1QBJA 4O6JA 3IRQA 4IXAA 4LLLA 2P7CB 2DO7A 2EFPA 2ZNZA 4KMUX 5L3FA 4A0YA 2FBKA 1J59A 1F5TA 3C1DA 3WTXC 2F5DA 1HW5A 5BOXA 1YIOA 3TGNA 3ZMDA 2ADUA 1WRJA 3L9FA 4M9ZA 1W7PA 1WSUA 4RGRA 1BC7C 1SD4A 4H0EA 3BJ6A 2GIVA 2DLLA 3JW4A 1O7FA 2HZTA 4YIFA 2FNAA 3KZYA 3SQNA 1USSA 4LD5A 4CYDA 3M9AA 4M72A 1UCRA 2V9VA 3E6DA 3MAJA 4HDUA 3RYPA 1IXCA 4U0VA 5D8KB 2IRFG 4B8XA 3DKWA 1JXSA 1LNWA 3V8LA 3RYRA 2OZUA 1FP2A 3RKXA 2NS0A 2F5CA 2VBWA 4KFCA 5J8FA 4L0YB 1EH6A 2HOEA 2LF8A 2ELHA 3C3WA 1U78A 1W4MA 3GFMA 1V4RA 4Z2YA 5D8LB 1FP1D 3ABTA 2ESHA 4IHSA 4EJOA 3GW2A 1FZPB 1O7LA 4KT5C 2VOOA 2L02A 1D8JA 1Y0UA 3FM3A 3KP7A 2DQRA 4UVCA 1JE8A 4RGSA 3HTSB 4EQQA 1P4AA 5ED4A 1J7KA 2LDUA 1S8NA 4DQ2A 2J5OA 3KLNA 4EM0B 2XGXA 5HOOA 2YR2A 5LHGA 5AIQA 5A2QZ 3R60A 2PMUA 5JHUA 3VB2A 4A0XA 4PCQA 1T38A 2WTEA 2K4BA 3ZPLA 1EV7A 4ZYHA 1P92A 2QUFA 5L3DA 1BOAA 2XHKA 3LWFA 2Z9OA 4LGWA 2OQGA 4KN7X 3KETA 1U5TB 4P9UA 2RQPA 2FBHA 2D2WA 2LSOA 1YW8A 1ZH5A 4LLNA 4RS8A 2C6YA 1IW7F 4ENMA 1YYVA 2P8TA 2BV6A 1BI0A 4XLNF 4AIJA 4U7BA 2IA1A 4ON0A 3P7NA 1A04A 3K1MA 4PZJA 2H6CA 1OR7A 1PUEE 4IRHA 3DPTA 2EA2A 4UV8A 2FU4A 1W5TA 1RNLA 3L2CA 1GXQA 1TW2A 4RB0A 2QQAA 2H6BA 1EH7A 4I0BA 1O3TA 1IRFA 4KYWA 4BH9A 1SD5A 2XASA 2Q0OA 1MDMB 3JSPA 3ZQ7A 1ON2A 4KICA 3U1DA 5D4RA 3ZP5A 1I6XA 2HTJA 3M8EA 3FHZA 4HF0A 1IUYA 2BEOA 1FSHA 5FB2A 4EJUA 1YLFA 3KCCA 4ESBA 2DQLA 1ZLJA 5K1YA 1R1VA 3P9CA 5BQTA 5E18F 3J80K 2COMA 3WTZA 2IPQX 3GVAA 1CF7B 4I0AA 1OYIA 4ZZDA 1O3RA 5ILSA 2L4MA 1C0WA 1YW7A 5BPIA 1XB4A 3COAC 2IP2A 1XCVA 3CTAA 3R4KA 1W7PD 5CVIA 5CYVA 3AAFA 1YFHA 2IW5A 2ZFWA 2RC4A 4ZYGA 4QWQA 3CUQC 3HRTA 1GXPA 1J2XA 2O8XA 4P5OA 3FXUA 1KYZA 3V4GA 3ZN1A 5E1ZB 1Q1HA 1FSEA 1MKMA 4B09A 1XMKA 3F6OA 5FD5A 1TNTA 4ZH4F 2AS5F 3D0SA 4A12A 2A07F 3T8TA 2ZBKA 4RB3C 3TDZC 3V8KA 1LDDA 1TNSA 1IN7A 1IF1A 4L18B 2BBYA 2W57A 2M5WA 2QBYA 4OIOF 1XGSA 4P96A 3K1NA 1HXDA 1XDUA 4OMZA 1U6GA 3LAJA 2XAHA 3HSEA 5IT9Z 1QZYA 4KN4X 1TQIA 2W85A 5J8CA 1IRGA 4LG0A 4EM2A 1ZREA 3DEUA 2ZKZA 1RZ4A 1Z05A 2NNYA 2RV8A 5HDGA 4I2OA 4S05A 1TW3A 3KLOA 2Q8KA 1T98A 5DCMA 4CXFA 2E7WA 2BE5F 3HRSA 3NQOA 1FWZA 2JRTA 2HWVA 1FYKA 1XSXA 1HKSA 4BHBA 3WU1B 3Q9SA 1R1UA 2EFQA 3HRUA 1Z1DA 1J5YA 2OA4A 2V1UA 1SFXA 4AIKA 2P6TA 2CWEA 3F22A 4TV7A 4FHTA 3KZZA 3K1PA 3J81Z 1XDSA 4WCGA 4EJVA 3ERED 1EH8A 2A69F 4ASNA 3F8CA 3WTVC 2NNNA 2XUBA 3ULQB 4IJAA 1LEAA 4HF1A 3KP5A 1KQ0A 4EGYA 1XN7A 4WF2A 4N0BA 3KE2A 5HS7A 3KP3A 2RDPA 1FOKA 3GEZA 5LEKA 3BZ6A 3TOBA 2FSWA 1QZZA 4RGUA 1NHAA 2P4WA 3JSOA 1G3WA 5H6RA 1HBXG 2A3SA 1B1BA 1OYYA 2ZMEB 5DCFA 4I01A 1J75A 5HVQC 4N9IA 4EGZA 2OU2A 2R7FA 2L3DA 2X0LA 4ENKA 4YFKF 4OOIA 4XBFA 5HLIA 5JI6A 2EV5A 2HKOA 5CVVA 4KIFA 5HS9A 3TDUC 3QU6A 4G7OF 3GFJA 4ESFA 3QOPA 1YO5C 4BNCA 3P9IA 4LB6B 4KIGA 2JPBA 4E70A 1PP8F 5DDGA 2UXNA 3T8RA 3TO7A 2IA2A 2MH9A 1B4AA 2YSRA 4IVNA 3CO7C 4XSXF 5K5RA 4BQAA 5FGMA 4LLGF 5FLXK 3W6KB 3ZN0A 4U7DA 1YG2A 3L7WA 4UXNA 4GYGA 4LFUA 4MEXF 4AIHA 2GWRA 2XKOA 3TQNA 3HRMA 5FD6A 6PAXA 2CFXA 1U5TC 4OINF 2L01A 3MQ0A 5ICGA 1ZG3A 3DV8A 2HQNA 3R0JA 1F1ZA 1I5ZA 1HKTA 2XKPA 4KIBA 4HQMA 2LKPA 2HFHA 1SMTA 1WI9A 2V1XA 1D5VA 5FFZA 1RUNA 3I58A 1HW1A 3DPLC 1HSTA 1KU7A 1MJAA 1BIAA 2VOPA 2VBZA 2WC2A 3TKYA 4BHCA 4OU0A 2FMLA 2A68F 1P4XA 1ODDA 1ZHFA 4WK8F 4MQ9F 2DI3A 3R61A 2EWNA 2K02A 4L0ZB 2Y0MA 2J5PA 2EA4A 2EFNA 2KRFA 3MEXA 4FT8A 1U8RA 1R5GA 1R36A 1G3YA 3HSRA 4MNUA 3VFZA 1LB2A 2OZ6A 2HYGD 1R00A 3V8JA 3R6SA 3LFKA 2WV0A 3JTGA 3I59B 4HZFA 2XRNA 4AD9A 1YS6A 2VC0A 4MEYF 4LJZF 2RVCA 2XAJA 5LGTA 1B6AA 2ETHA 3HYIA 4G8XA 5E20A 4NB5A 2GA2A 4IF4A 4PGHA 3CJNA 5DYMA 5HS8A 3MCZA 3SZPA 2MLGA 3O6BB 2A61A 3V7CA 2V1DA 3J80Z 2B0LA 4GGGA 1FY7A 4G6DA 1X3UA 3IRRA 1XSDA 2XIGA 3GWZA 3LA7A 1SFEA 1H0MA 5DD8A 3G3ZA 4RB2C 5D6EA 1D8KA 2EV0A 5F6FA 4HX8A 1O3QA 1XGNA 4UVAA 4WX9A 5ICCA 1ZG1A 1HQCA 1WWXA 5J6XA 2R3SA 2K4JA 4UUVA 2IA0A 4Q4ZF 3U2RA 5BS6A 1LVAA 4I02A 2MA3A 4HX4A 1KGSA 3EUHA 4A6EA 1BI2A 3CUQA 3HSFA 4Q47A 2DK5A 1T6SA 2H27A 4XLPF 2D1HA 2PLYA 4O3MA 3O3KA 3ZMUA 1L3LA 1O57A 4UHTA 2JZYA 2CSOA 4A5MA 4GXOA 4CZZA 4D0PA 2FXAA 3BY6A 2RN7A 2O6GE 2MC3A 3RJPA 4EMSA 1ZAOA 3ZMSA 1BC8C 2PFBA 3KEQA 3WTUC 1OPCA 5CVJA 1G3SA 1K78A 1QPMA 5JFRA 1PP7U 3EYYA 5JVTA 2VT2A 2E1CA 3QRFF 3P9KA 1W5SA 2V79A 2XAQA 3I64A 3SXYA 1K7AA 2MH2A 5D5UB 4OIQF 3WTYC 3RIRA 3ABUA 3QAHA 3WG9A 1GVJA 3WTTC 5L3CA 3HUGA 3GF2A 3E5XA 4IRGA 3RPUA 4A2UA 1TTYA 2VBXA 4I7HA 1BI1A 2EJRA 5K5QA 3JAMK 2FOKA 3EYIA 1FC3A 2Y48A 4Q5SF 5F64A 5A2QK 5HDNA 3BJOA 1REPC 3MWMA 2E7XA 3BOQA 4OMYA 4HLYA 4P55A 2R7DA 1TQPA 1UB9A 4EVIA 2JPCA 2QLZA 2OBPA 4S04A 2DPUA 3WU0A 5KVRA 3T1BA
chains in the Genus database with same CATH superfamily
1HDPA 1HC8A 2Y9YA 1OISA 3HIFA 5LBQA 1FNNA 2XVCA 3WHBA 3DQVC 4BBRJ 1MSFC 3D5RC 1PDNC 4LIUA 1STZA 3M3YJ 3FXOA 1IXRC 3BTIA 4XICA 2IT0A 2QENA 5E1XA 1E3OC 1RESA 4ZZLA 2HEOA 1F9NA 3C7JA 4IPAA 3O2PE 1MBHA 3N97A 3DBHB 4V2GA 1IN5A 1FX7A 1FLIA 2JRMA 2MBFA 1ETVA 3V42A 2KRHA 4LK0F 3VOEA 4C3JJ 4R79A 3QYFA 2TCTA 4WXCA 5BPDA 2X1CA 1ZQ3P 3W2AA 4FISA 3TW7A 3A1YA 1X3WB 5KCMA 2UXXA 5KNLA 5M3FJ 3CUOA 3GX4X 1TL8A 3MKLA 3M1CA 5GPAA 1W7PB 1Z7LA 2XDVA 4XM3A 3BWGA 2STTA 3I4PA 3C2HA 2F4OB 2H09A 4YIIA 1WH7A 5EDNA 2JSCA 1G3TA 4P1WA 5LLQA 2LR8A 3MVPA 5F04A 3LSHA 2LNBA 2OCEA 2ZCWA 5D5XB 3OS2A 3BQZA 1JUSA 5H2FC 2VASA 4RGXA 1TWGJ 5HNFA 2M1BA 1SAXA 2KJBA 2GQQA 4M6XA 2F5EA 3M1EA 5FKLA 3WTWC 3MMYB 2RKHA 3A0HC 2FF4A 1P2FA 3ZMVA 4UUSA 3L2QA 4BXFA 2CW8A 3U9GA 3OSGA 2HTSA 3GZ5A 1U0JA 4EJWA 4E7IA 4D9JA 3WGIA 2MD0A 4BYYA 3OYMA 4GO1A 4R1HA 5EZGA 1MH3A 1IN8A 3FM5A 5F0HA 4UNOA 1I39A 5FJ8J 1CGPA 2LG4A 1XS9A 4L9NA 2M8EA 4BE2A 2CH0A 1FPQA 2VJ5A 1A31A 1BJAA 1OMIA 2RNJA 2FRHA 2QWWA 3KP6A 3CF5F 4HNVA 5H20A 2L7KA 1Z91A 1ZGJA 3WODF 2LLKA 1D1CA 3GO5A 1TC3C 3IHUA 3TMOA 2EINH 4Y33A 1OJLA 1JUPA 2ACJA 3B6CA 4U88A 2KPMA 2CQQA 1ZTRA 3DBLB 1IUFA 1QGPA 5ERIA 4CCNA 1LFPA 3SEZA 2WAEA 4F92B 3T5XA 1VTNC 1XC5A 5GPCA 1I1SA 5TRDA 3QYEA 3DP7A 2UUZA 3LSKA 4L5IA 3JRIA 1ERDA 3F0CA 1UHWA 3BTJA 3OV8A 4KA4A 1U5TA 4NQWA 3OS1A 1ZLKA 1YQAA 4Y7NJ 3Q9VA 3IAS2 2MSYA 4BY7J 5GTHC 1SAUA 2X9DA 2HKXA 3IAM2 2Y30A 1ETKA 1YE9A 2DT5A 2ZSHB 2YX4A 3GLLA 3IWZA 2BZTA 3OIQA 2Y9ZA 1I6HJ 2EB7A 4Y52J 3Q0WA 5GAEJ 1JTXA 3NWSA 3HOYJ 4V19K 1QNTA 4ESJA 1TZLA 2FX0A 1WQ2A 3I71A 3MFKA 1MMGA 1L0OC 3L1PA 4IOCF 3ABKH 3MZ8A 2LD5A 2DN0A 1LDKB 2LKSA 4FX4A 4YEJA 1MJBA 2HGCA 4E7LA 2DA2A 4ZYEA 2P6SA 3GLXA 3S8PA 2QYOA 1HKQA 4B48A 2L9NA 1JGGA 3KIOA 3RQIA 1KA8A 2DAOA 2KIFA 4PJ0C 2Z99A 2L9SA 3TO6A 1ETOA 1BN5A 4QSHA 3K6GA 2O0YA 2XAFA 2FNPA 3DEWA 2W84A 3W6JB 3E6MA 1Z6RA 2YUSA 3HOTA 3K0LA 4HDVA 1YW9A 1G6NA 2M34A 5LGUA 4BEHA 4JBAA 2QM3A 3CDHA 2DBBA 4YFXF 5E8IA 3MN2A 5CQEA 3SZTA 2FQ3A 1JUMA 1OKRA 5CVUA 1R1TA 3QU3A 4I09A 2ME6A 3I0TA 1TLHB 3SFZA 1MDMA 2LMDA 1TQMA 1OCRH 3HZJA 3RDIA 4HQEA 5CJ9A 1B59A 4FTHA 1Y6IA 2WY8Q 3OYEA 3FZVA 3PFIA 3IH4A 3AG2H 3BR3A 3QPTA 2R7VA 4CCMA 1FOWA 2R7XA 2QKLB 1KU3A 2DFIA 2L9RA 3BROA 3VSKA 3K7AJ 4JK1X 2VIXA 4IQ4A 5CVRA 2HDCA 5L3EA 4D1QA 3GUDA 2DPDA 4M3GA 3SHFA 3RPUD 2QZ8A 1ZRCA 2BVLA 3PIOF 4P9FA 1IXSB 1H8AC 2HYFA 1AKHB 4AVPA 2MD5A 4GCVA 5E79C 2BW3A 1QPIA 1IN4A 1F36A 3QPHA 4D5FA 1B72A 5EYRA 4N4NB 3SDGA 5LRSA 4DIQA 3GYHX 1CF7A 3VEPA 2F5FA 2I8DA 3CP8A 4KNYA 2K86A 2RGVA 4FQGA 3W2VA 3CQZJ 2Z2SB 3DEEA 4BAYA 4HW0A 1NK3P 4R8HA 3E3VA 2KT0A 3BR2A 5LHHA 2JQ7A 4EATA 1FTZA 3RKYA 1W5CC 4EV0A 2DW4A 3KFWX 1WVRA 2ICWG 3SFIA 4F93B 2QVOA 2IEKA 5E3MA 1O3SA 4LITA 1B8IB 1OFCX 2AQEA 2TDXA 4BHPA 3MZHA 1EA3A 2VKVA 2D1VA 5L3BA 4B4CA 4UVBA 3C2BA 3O8GA 1X1PA 3DKYA 1RKTA 2CW7A 3F8FA 4II2A 2CGPA 1XSVA 4M9XA 2CU7A 5H6QA 2PJPA 4MGRA 2VPRA 1IAWA 2R7TA 3FXJA 1Z0XA 3IWFA 4U0YA 1A6QA 5E1WA 1DP7P 5D4SA 5FKOA 2GLOA 4XORA 3H92A 3P5JA 2FBIA 1NG6A 3JRHA 4UB6C 3U21A 2KFDA 1UG0A 2CG4A 4K2EA 4BBSJ 1XGMA 3WE2A 1HOMA 1Y8QB 4PGGA 3FXQA 2WY7Q 4A5NA 5ICFA 4CDGA 2R7WA 2Z33A 1WPKA 3K2ZA 5DUKA 3X2QH 1DP3A 2P0WA 3AG1H 2M4GA 2M87A 1BL0A 3CLOA 4GYIA 3Q5FA 2XGEA 3EQLF 3IL2A 3ZQCA 4MQVA 1S29A 4F3QA 1MMSA 1LVKA 1ZRDA 2AQFA 1XMAA 3L00A 1FIAA 3HPGA 4CGZA 3BPVA 2EIKH 4RAZA 1X1AA 4MHGA 2STWA 3K9TA 1TBXA 3PO2J 3LMMA 2BY1A 2IGMA 2IGNA 3QP6A 3PUFA 2R5ZA 2PG4A 3WGHA 3DTEA 3DXJF 1VQ9I 1Y56A 3E6CC 3IV5A 2CUFA 4AYBA 3S2DJ 4Z6YA 2IBDA 1ZR2A 3FXRA 1S3JA 1S6LA 4EEFG 1ZN2A 1R22A 2NYXA 2DJIA 2RREA 1ETQA 3CCEI 4IHXA 2VN2A 3JCUC 2F5VA 4G6QA 1VQLI 2HVRA 3RZOJ 2VL8A 4DYCA 4A6DA 4XRSA 2A6HF 2NRAC 5EGOB 2PEXA 4CO8A 3HHHA 3WTSC 1D0YA 5LD2C 2QBYB 1QZEA 2K9LA 1D0ZA 3F21A 2PJRA 3JREA 1AA7A 5E3OA 4W1UA 1KU9A 4M3DA 1G8XA 1MGTA 4F7ZA 4C3HJ 2IJLA 5KAIC 1XG1A 3LA3A 3K10A 3L2UA 3W2WA 1X4OA 3FISA 1JI8A 3GXOA 1DU6A 5DM7F 2XF5A 5DEQA 3BP8A 4LG0B 1MMAA 3IKVA 2X4HA 3OR1C 4UV9A 1KQ8A 1R7JA 1MD0A 1R5HA 4KUMA 1WJBA 1E0EA 2CW0F 1R23A 1T0FC 5F1RA 2HQRA 2IGKA 1ITYA 1G2HA 5DD4A 1J0RA 1FEXA 1IG7A 2XAGA 1SMYF 2EQRA 3BC8A 5DCMB 4ETSA 5FFXA 1WH5A 2ECCA 2CFOA 5J47A 1OCTC 1UFMA 1RPWA 3RPQA 4DNCA 3S93A 2GXBA 3FIWA 4U0WA 3K70D 1Z3XA 5LGNA 2LVSA 2OV7A 4HAMA 2VONA 3A02A 1JGSA 3J7YJ 2RQQA 3TP0A 5K5OA 3CCVI 4HF2A 3F72A 3OR2C 3OL4A 4ZJZA 2IS6A 4RB1A 1FTTA 2AO9A 3PQKA 5K7ZA 2XF6A 1ACIA 2CQKA 3TL4X 5J4VA 2WADA 1F4KA 3GTPJ 1WJEA 2M7AA 3I53A 3LFUA 5EJCA 3E5QA 3FXLA 2VODA 3FMRA 2E1NA 3S3NA 3JAMZ 4HG2A 1BI3A 4HA8A 2ZMEA 1BBYA 4DZJA 2PQ8A 1S9HA 2V6EA 3KEOA 3GTKJ 5J3LA 1XD7A 1USTA 5EEHA 3I5UA 1ZGAA 3F8NA 1GT0C 4LMYA 2K9SA 2LBFB 2M30A 1ONVA 3N4MA 3ZMZA 2G7UA 1UG2A 1U3EM 3HJEA 2H94A 4J00A 1N78A 5FROA 3KPHA 3GTLJ 2DFEA 5FRMA 4RLQA 2QEXI 5IT3A 2P7VB 2NAZA 1LDJA 3FKJA 4OAZA 4PDKA 4HLXA 4CCLA 4BU2A 2GIZA 1JKPC 4QIWN 1WGXA 3LA2A 1Y1VJ 3ASNH 4BGDA 2K27A 2L4AA 1AOYA 2MLKA 1YS7A 1FBQA 5D6FA 1MMNA 1I1GA 3FBNB 2JUCA 2YX7A 2HR3A 4V2FA 3H3UA 3IP4B 1KU2A 5TISC 1YRNA 4WXHA 3BR1A 4OAYA 4JP0A 1VQ6I 2E19A 4M74A 2GXGA 2JTVA 2JA8J 2OQRA 3NEUA 4XRMA 2Z5UA 1LFBA 2ZFUA 3DFGA 4HV6A 3ISPA 2DT6A 2HOTA 1VQKI 1U2WA 3B02A 3JRCA 2L7MP 4L9TA 4QLCU 2VLAA 3LSJA 2DDBA 5LRRA 3HOSA 2PX9A 1KYWA 3ECHA 4FASD 4KT6A 3I54A 4M9SA 5LFAA 1VQ4I 3B73A 4XOPA 3LOCA 2IGOA 1HW2A 3QP5A 3CJTB 1LJ9A 3QYBA 3LSTA 2A6TA 2ZNYA 2AHQA 3CC4I 4YG2F 1QQIA 2K9QA 4XONA 2XC7A 1TT5B 2A05A 1OCZH 1Z6TA 3WGGA 4B43A 2VKDA 1S5LC 4BQNA 3HDDA 2CQNA 2ZO4A 2FE3A 3V7RA 2P5LC 2PI0A 1KQ9A 1VQMI 2BYVE 2CV2A 2L2OA 3GBGA 1IV8A 3PJRA 2D45A 5E3NA 2CV1A 3DU5A 4Y13A 3EDPA 4RAFA 2YU3A 4Y15A 2O61A 4CSWA 1ZKGA 2XGCA 3L09A 2R5YA 2YPRA 2UWMA 2P5KA 2XPVA 5DUIA 1RI7A 4IHTA 2DCEA 2GAUA 1RUOA 4M6VA 3FF5A 2CJJA 2NVYJ 2ZXJA 2F6CA 1XMXA 2R0QC 3BG7A 5GP9A 1P4WA 3DTIA 5L3GA 3RTRA 1ETXA 4I99C 3HOXJ 3PSIA 3VODA 2BY0A 1JHFA 2UZKA 3NARA 4RMNA 4A3JJ 1MNEA 2Q2EA 5EG0A 4MTDA 1YTYA 1HSJA 2EFWA 2XROA 3FMQA 5M3MJ 3JRFA 3DTKA 3M7GA 2GA1A 4NC7A 1BM9A 2W00A 5DV5A 2NVQJ 1AHDP 4BDYA 1S7AA 1WKMA 5HODA 4XKBA 1BIBA 1DPUA 1ZRFA 4L5JA 3KZIC 1ZG5A 1R58A 3PQJA 5FKNA 5HDKA 2IS2A 1ULYA 3CCRI 4XLAA 1U8BA 3F3XA 3GFIA 3RI4A 5LHIA 1E2XA 2DDAA 1UAAA 1FT9A 2FQ4A 5GTIC 2R7UA 3F23A 1IGNA 2HPIA 1EKEA 3FHNA 3S2WA 1P7IA 1VQ5I 4HYEA 3T0YA 4HSRA 4CHUA 2HQAA 1OR7C 3REOA 4A3CJ 3TO9A 3CF2A 2ZB9A 2MW8A 1IN6A 4EM1A 1RIOH 3LQQA 3GZ6A 1HCRA 2IVMA 3TOAA 2DA1A 5B3SH 3MZYA 2O7OA 4N9HA 2JT1A 1R6RA 2V7FA 3O8HA 1JHHA 2KIMA 2VT3A 4AWXB 3CCJI 2KDOA 3KP2A 2CO5A 1K79A 5JLWA 3ROUA 5LEJA 3I59A 3FWEA 2ID6A 1K4SA 4HV5A 2M9HA 2M45A 1DPRA 4IO9F 4II3A 2EZLA 4OWRB 1RR8C 2FMYA 1JTYA 2B7EA 4CICA 2M7BA 5BMZA 2BXZA 4GRIA 2E35A 3EETA 5AIPA 2Y75A 4YELA 4M3FA 2DU9A 2VC1A 1SD6A 2ESNA 2PMHA 3R0AA 1MIJA 3E6BA 1GHCA 4KMFA 2A5YB 3PM1A 3G6EI 3FX3A 5EEGA 1SVOA 2GOMA 3F8BA 1X1BA 4NHJA 4GDFA 1FYMA 1TWFJ 2Z3YA 3ML6A 2OUMA 3H3ZA 4Y17A 1E17A 1XGOA 3DF8A 4MTEA 1JKOC 1PVEA 1NTCA 4XSZF 1YJWI 1DDNA 2XV4S 2FA5A 3G71I 1Q1VA 2LF7A 1YIJI 2GZWA 1BA5A 1UELB 1SD7A 2KIUA 1MZBA 3FMSA 5FLXZ 4ZYDA 3OYHA 3J7AO 4ENJA 1ZARA 1WJAA 2O03A 2ZJ2A 4A0ZA 1R4NB 1D3YA 3SYTA 5FO5A 3FK7A 4LK1F 3M07A 5E8GA 5HLHA 3H5AA 3F8MA 1PUFB 4PJJA 1XCBA 4WWCA 2LRDA 4XQFA 2QQ9A 2QSHX 2ELJA 1IV6A 1Z21A 4CYCA 3H9GA 3BR0A 1FYLA 1OYWA 1R49A 4AYBN 4EJTA 2EZIA 2ZJRF 3CCLI 4ABZA 3ZMTA 2COBA 1MJ9A 1Z7UA 3WE3A 1G59A 2E1OA 1N77A 3K69A 1IC8A 4G94A 2R7QA 1Y1WJ 1LQ1A 2X6WA 1SFUA 1T39A 2F48A 3K4NA 1Z9CA 4FX0A 3IC7A 3NAUA 2NOGA 2VI6A 3ECOA 1FBUA 3D5LA 2H1KA 2QQBA 2VE8A 3VYUB 2JUGA 3DU6A 2P81A 3NRVA 4FETA 3UR3C 2G7HA 4XN0A 4A69C 1H9GA 2V6CA 1GV2A 3C18A 2EFOA 4IRIA 4ZDPA 4WXDA 4RAYA 2O3FA 2HVSA 5E17F 2VJ4A 2XSJC 3GFLA 1VQPI 4M71A 2YS9A 4M73A 4E7HA 2EV6A 3E97A 5M5YJ 4ENNA 3S3MA 4I98B 4Q48A 1PJRA 3ONQA 3BZCA 2L54A 3UNGC 5JVGF 2W24A 2K5CA 4HBLA 2X85A 3FXMA 4I76A 2G9WA 4L9VA 3ZQQA 4G9YA 2WAFA 3K4CA 2WWYA 4J19A 3VWBA 4DBQA 4N4OB 2XAUA 1NH3A 3HTUA 2VBYA 2VE9A 2RAEA 5GAGJ 3CESA 3S16J 4RA2A 3HHGA 4LB5A 4ZC3A 5IP9J 3DPUA 1RRJA 1GDTA 5EF6A 4G7HF 1D0XA 1YITI 1V5FA 2EILH 3N05A 1UHMA 3LAPA 2DK8A 2OPTA 2P5VA 5IT9K 3LSGA 2A6EF 4YIRX 4E4HA 3HG9A 4X6AJ 2VJIA 3G73A 2EH3A 1NG7A 4KITB 1V55H 4B1RA 1T08B 4PJMA 3BDDA 3BJAA 4AIDA 1RKWA 2QCOA 2G0EA 3CUQB 1IZ1A 3LQRA 4JQFA 4BKXA 1ZYRF 1V54H 2KL4A 1B9NA 2QKMB 3FBIB 4CA0A 4G7ZF 2V26A 3CC7I 3HBLA 2JVHA 4F52A 1TP4A 2IXSA 1J9IA 5AONA 1I27A 3PNVA 5K7HA 1K6OA 5IY5H 1AWCA 1QO0D 5D5WB 3ELKA 2EK5A 5ILUA 4HX7A 2DMQA 4JX6A 2KKOA 5TJJA 3UKGA 1S7OA 1S7EA 3FKIJ 2BGCA 5JR3A 1EJ9A 1IDYA 1P6RA 3OOPA 4OIRF 1P7JA 5C44J 2F4IA 2MYSA 4HOBA 4D5CA 5ILVA 4JX4A 1ON1A 3KP4A 1D1BA 2AXLA 3PUBA 2HS5A 1IRXA 5EZHA 4OIPF 2ISYA 3JTHA 2DTRA 3A0BC 4CCOA 1SEUA 4BQOA 2OAZA 1T2KA 1IJWC 2FEZA 3F6VA 2LY9A 3CCUI 4DGWB 1OLTA 3IKTA 1LE8B 1G4DA 2VXZA 5F08A 2X1DA 3ZQIA 1B9MA 4MFEA 3WU2C 2ISZA 1FMVA 3OY9A 2Q1ZB 4BXUA 4A3MJ 3G1LA 2OD5A 4F91B 1K78B 1DUXC 1WCMJ 3J81K 4L9JA 2V1NA 3M8FA 5KK1A 2ID3A 5D5VB 2FUG2 1FBSA 3JRGA 5HLGA 3BPXA 4PSXA 3GMEA 2K7LA 4XLFA 3CO6C 4PK4A 2W25A 4A3EJ 4L5EA 1I3QJ 1V3FA 2CYYA 3ZQGA 5CLSA 4YFNF 3V7SA 4KDPA 3A01A 1LEBA 2DXIA 2PBIA 4O5VA 2KJCA 2KMUA 2F2EA 4XRSG 2DFFA 2WB1A 5ICEA 1T0FA 2DOEA 3E5UA 1H9TA 2E2JJ 2HXIA 1VFCA 3RKWA 5B5EC 4XRFA 2PN6A 3HXLA 3K70C 4M6YA 1QBJA 4O6JA 4BY1J 5FKKA 4HSTA 3IRQA 4IXAA 2L0KA 2K9MA 4LLLA 3HUGB 2P7CB 2DO7A 2EFPA 2ZNZA 1Z3YA 1VF9A 4KMUX 5L3FA 4A0YA 2FBKA 2NVUB 1J59A 1F5TA 4XN3A 2Y2ZA 3C1DA 3SDBA 2MFZA 3WTXC 2F5DA 2M4KA 2ZXWH 1HW5A 5BOXA 3D1NI 1YIOA 3TGNA 2XRLA 1RC9A 5IYDJ 4BE1A 4XLHA 4PFOA 4XKWA 1Y39A 2E1MB 3ZMDA 2ADUA 1WRJA 2EIJH 3G4SI 3L9FA 4IKFA 2JN6A 4M3BA 2GOXB 4M9ZA 1K83J 1W7PA 1WSUA 1YOVB 4RGRA 1BC7C 1SD4A 5FKMA 4H0EA 3BJ6A 2E60A 3I9V2 4GFBA 2WA0A 2GIVA 4RM3A 2DLLA 3JW4A 1O7FA 3GCMA 2HZTA 2KZVA 4YIFA 2E71A 3KYDB 2FNAA 3KZYA 2ELKA 4HEA2 3SQNA 2UV1A 1USSA 4LD5A 4CYDA 1E3HA 3VYRB 1YHQI 5K7FA 1D1AA 3M9AA 4M72A 1UCRA 3S32A 2JVGA 3H1CA 3HPHA 2V9VA 3E6DA 2ZSIB 2RNGA 3MAJA 2ZJPF 5C4XJ 4IL6C 2MC4A 2X1EA 4HDUA 3RYPA 1IXCA 4U0VA 2LOOA 2M0CA 2HQ5A 1OCCH 5D8KB 3CMAI 2IRFG 4B8XA 3DKWA 1JXSA 2HU9A 1LNWA 3V8LA 5GAHJ 3RYRA 2OZUA 4B3XA 1FP2A 3OYLA 1WJDA 3RKXA 1JT0A 2NS0A 2BY3A 1I3AA 4KISA 2CS3A 2F5CA 2VBWA 4KFCA 5J8FA 4L0YB 1EH6A 2HOEA 2E2HJ 2LF8A 2ELHA 3C3WA 1U78A 1W4MA 2JJ7A 1F43A 3GFMA 1SC7A 1V4RA 4Z2YA 4DJAA 5E3LA 4QPOA 3H35A 5D8LB 5HLTA 1FP1D 3ABTA 4F55A 3MKYB 4HRIA 2KDZA 4XKCA 2ESHA 4IHSA 4EJOA 3GW2A 3TP3A 5FLMJ 4U87A 1SANA 2CRGA 1FZPB 4UUSB 1O7LA 4KT5C 3RQ4A 3G1MA 2VOOA 2DT7B 2L02A 1D8JA 2V4JC 1Y0UA 3FM3A 3ZQHA 3AG4H 4DYQA 4A3FJ 3KP7A 2EZHA 3QQAA 1U9OA 1M1EB 2WAQA 2DQRA 4UVCA 2K9NA 1YJNI 1JE8A 4RGSA 1DGWY 4XR6A 3HTSB 4EQQA 1P4AA 5ED4A 1J7KA 2LDUA 1S8NA 2M2EA 3VPRA 1UJ8A 4DQ2A 3CMMA 2J5OA 1VNDA 2Y0SA 1VQ7I 3KLNA 1T56A 2V9KA 4EM0B 2VQGA 2XGXA 5CKTA 2XF7A 4BL0B 5HOOA 4NBQA 1VZ0A 2L7FP 1BR2A 2YR2A 5LHGA 5AIQA 4XIDA 3OYJA 4G12A 5A2QZ 1R9TJ 3R60A 3TEDA 2PMUA 1W1WE 3BCAA 3LSIA 5JHUA 3VB2A 1J09A 4A0XA 1VQOI 3BR6A 3HGYA 4PCQA 1HF0A 1T38A 2FD5A 2WTEA 2K4BA 4A93J 3ZPLA 2KLOA 1EV7A 1A6IA 4NUBA 4DBRA 4ZYHA 3CC2I 1P92A 2QUFA 5L3DA 3J7AY 1BOAA 2XHKA 3LWFA 2Z9OA 4LGWA 2ECBA 2EZKA 2OQGA 1Y0NA 4KN7X 2GBYA 3KETA 1U5TB 3A03A 5CPRB 4NQWB 3VSLA 4P9UA 1MNMC 3E0JB 2CV0A 2RQPA 1IRZA 2FBHA 9ANTA 2D2WA 2LSOA 1YW8A 1ZH5A 4YRVA 4CZCA 2K3FA 1SFOJ 4LLNA 4RS8A 2C6YA 1A36A 1WZ2A 3AFHA 2OTLI 2L7ZA 1IW7F 2R7OA 4ENMA 1YYVA 2P8TA 3CDIA 3FDYA 4A3LJ 2BV6A 1BI0A 4BE0A 3HM5A 4XLNF 2QGUA 4AIJA 2DMNA 3QOEA 4U7BA 5KHDA 2IA1A 5IP6A 4ON0A 3P7NA 1A04A 2M8GX 3K1MA 4PZJA 2H6CA 2HXOA 1OR7A 3JRAA 4UUTA 1PUEE 4IRHA 3DBRB 4X1EA 5IP7J 4A3DJ 1BJZA 3DPTA 2EA2A 4UV8A 4DW6A 1AKHA 2XB0X 2FU4A 3HB9A 2CQ7A 1W5TA 4XK4A 3IH2A 1RNLA 2H1LA 2R7SA 3ZOBA 3S1QJ 2R7ZJ 2IS1A 1YX3A 3L2CA 4BEHB 1GXQA 2OC6A 1TW2A 2B63J 4RB0A 2QQAA 3E7LA 4M3EA 2H6BA 2XGDA 5J4YA 2BHYA 2E5NA 1EH7A 4I0BA 1O3TA 1IRFA 4KYWA 4MIMA 5M5WJ 4BH9A 1SD5A 2XASA 2O9LA 2Q0OA 1MDMB 3OYFA 2LC2A 3JSPA 2QSGX 1GLNA 3ZQ7A 3K4LA 4C3IJ 1HDDC 3ZXSA 1EF4A 1ON2A 4KICA 3U1DA 5D4RA 1FMWA 1WJ5A 2ZC2A 3ZP5A 1I6XA 1B8IA 2HTJA 3M8EA 3FHZA 4ZDLA 1DGRM 2B9SA 4HF0A 1X2NA 1WJCA 3VYTB 3CD6I 1IUYA 2BEOA 2L5QA 1FSHA 5FB2A 4EJUA 1YLFA 3KCCA 2E34A 4ESBA 1OCOH 2DQLA 1X19A 1ZLJA 5K1YA 1T33A 1R1VA 3P9CA 3QPSA 2V9PA 3K4BA 5BQTA 5E18F 4IZZA 3J80K 1Y8RB 5DS9A 2COMA 3ASOH 3K2AA 3WTZA 1B72B 2IPQX 3GVAA 1CF7B 4I0AA 1OYIA 2QF7A 1K4TA 4ZZDA 1ZELA 3AL0C 1O3RA 5ILSA 2L4MA 1C0WA 3LSPA 1YW7A 3BG3A 2DODA 5BPIA 1XB4A 3COAC 2VQHA 4AM3A 2HOSA 1BR1A 2IP2A 1XCVA 3CTAA 2VPLA 3I4NJ 3R4KA 1W7PD 5CVIA 5CYVA 3AAFA 3OYKA 2MABA 1YFHA 1FOXA 1TT0A 2IW5A 4IEJA 3C2GA 4E7JA 4HNTA 2ZFWA 2RC4A 3EUHC 1GV5A 4ZYGA 1FOYA 4QWQA 2Y31A 3CUQC 3ABMH 3BCBA 4C9YA 3U1KA 3HRTA 1GXPA 2VKEA 3OL3A 3QODA 1J2XA 2O8XA 2XPUA 1X3ZB 3FXUA 4P5OA 1KYZA 3CJRB 1W36D 3V4GA 2DMUA 3ZCOA 3RZDJ 3ZN1A 1QRYA 5E1ZB 5HNHA 1Q1HA 1FSEA 5J40A 1MKMA 1MBEA 4S0HB 4RBOA 4B09A 1XMKA 2DA3A 2NXNB 1V5EA 3F6OA 3HKZA 1TNTA 5FD5A 3S3OA 2GXAA 5B66C 4ZH4F 2AS5F 3D0SA 2H8RA 4A12A 2A07F 3T8TA 2ZBKA 5FLVA 2M0MA 2Y69H 3TDZC 4RB3C 3V8KA 3BTCA 3DLAA 1LFUP 1LDDA 3H9JA 1TNSA 1IN7A 5J1YA 2D5VA 1IF1A 4L18B 3HOVJ 2BBYA 5EGOA 2VQCA 1X4PA 3K4MA 4PJNA 2N8GA 4E7KA 2W57A 2M5WA 1R71A 1QVUA 2QBYA 4OIOF 1XGSA 4DZPA 3OIPA 4P96A 3K1NA 1HXDA 1XDUA 4OMZA 3ABLH 1U6GA 3LAJA 2WB1N 2XAHA 3HSEA 3GTOJ 5IT9Z 4PUSA 1QZYA 4KN4X 1TQIA 2W85A 2BHZA 1KZHA 1TWAJ 5J8CA 1DQUA 1LPQA 1IRGA 4LG0A 2HVQA 3EPZA 4UB8C 3MKZA 3BT9A 2R5ZB 4EM2A 1NK2P 3IUOA 1ZREA 2F4MB 5F27A 3DEUA 3DLLF 2K85A 2ZKZA 1RZ4A 1Z05A 2NNYA 2RV8A 3KYCB 5HDGA 4I2OA 4S05A 1TW3A 3KLOA 2Q8KA 5DM6F 3LNQA 2VQLA 1T98A 5DCMA 3BG6A 4CXFA 2E7WA 3S1NJ 5IYBJ 2BE5F 3A4CA 3HRSA 1K6YA 3FK6A 3NQOA 4C2UA 1IO2A 3ERMA 4C2TA 1K61A 3PIPF 2JA6J 1FWZA 2L9VA 2JRTA 2HWVA 2WV1A 4PSWA 1FYKA 1XSXA 1HKSA 2PJRB 4BHBA 3WU1B 3Q9SA 3FXKA 1R1UA 2EFQA 3HRUA 1I50J 2OCCH 5KAFC 1JKRC 2LP0A 4HNUA 1Z1DA 1MBFA 1J5YA 2OA4A 2V1UA 1SFXA 4AIKA 2P6TA 2CWEA 2GM4A 2E1MC 3F22A 1HLVA 4JX5A 3JR9A 4TV7A 4FHTA 2HNHA 3K1PA 3KZZA 3J81Z 3KEYA 2W4SA 1XDSA 4WCGA 1ZR4A 2VXDA 4EJVA 3ERED 2A5WA 1RETA 1EH8A 3D5SC 2A69F 4ASNA 3SJMA 5BNGA 5F1JA 2LBFA 3F8CA 1SFKA 4MO7A 3WTVC 2NNNA 2XUBA 2X51A 2IS4A 2K3PA 3ULQB 4IJAA 3W3CA 1X2MA 4FE7A 5F0FA 1LEAA 2W7NA 4HF1A 2HYJA 2Z16A 3KP5A 2QQ8A 4BDZA 1XX5A 4CUGA 2NOJB 2W48A 1JKQC 1MMDA 1KQ0A 4EGYA 1XN7A 2OJED 4WF2A 3RKQA 1ETYA 1Z67A 4N0BA 5IOZA 2BVMA 3KE2A 5HS7A 1U9NA 5TGTA 4RAGA 3CJQB 2RDPA 3KP3A 1WI3A 4E6KG 3K4JA 2I10A 1FOKA 3GEZA 5LEKA 2ZXHA 3OYGA 3SEQA 3DKXA 3BZ6A 3TOBA 2FSWA 3PO3J 1QHGA 1MH4A 1IDZA 4AVZA 1QZZA 4RGUA 4C30A 1NHAA 1RR7A 2P4WA 3OYBA 4W97A 3JSOA 1G3WA 5H6RA 1E3PA 1N75A 1HBXG 3RCOA 4E7SA 2A3SA 1B1BA 2I5UA 1OYYA 4XMYA 2ZMEB 5DCFA 4I01A 1J75A 5HVQC 3AL0B 4N9IA 4EGZA 2OU2A 1V5GA 2R7FA 4D7NA 1ZK8A 2L3DA 2X0LA 4ENKA 1TWCJ 3H5RA 3MD2A 4YFKF 2JMWA 2JA2A 4OOIA 4XBFA 2QA4I 5HLIA 2X6OA 2WAQN 2M3AA 5JI6A 1GUUA 2EV5A 2HKOA 3CMEI 5CVVA 5CQGA 4IHWA 4BACA 4A3GJ 2R4GA 3PFYA 4CCJA 4KIFA 5HS9A 4QPQA 3TDUC 2Y0SN 5IPAA 2AXTC 1BR4A 3H9QA 3QU6A 2R93J 4G7OF 2X6XA 4ZDOA 3EUAA 1YI2I 5FRNA 3CCQI 4JOMA 4XL9A 1MBJA 3GFJA 4ESFA 2O8KA 3QOPA 1YO5C 4BNCA 3P9IA 4ANJA 2R92J 5GADJ 2YU9J 4LB6B 4KIGA 2JPBA 4E70A 1YRNB 2DA4A 2KRCA 1PP8F 5DDGA 2NVXJ 3GTMJ 2UXNA 3W6VA 2PMZA 1HA8A 1OQYA 3T8RA 1MNDA 3TO7A 2IA2A 2EPFA 2MH9A 4Y4RA 1FJLA 3M4OJ 1B4AA 2YSRA 4IVNA 3JRDA 2LKXA 3CO7C 4XSXF 3ZQLA 5K5RA 4MLOA 4A3KJ 4BQAA 5FGMA 4BUPA 2LYCA 4C2MJ 4LLGF 5FLXK 3W6KB 4PJLA 3ZN0A 4U7DA 1XPXA 1YG2A 3L7WA 2JK3A 4FE4A 4UXNA 2XPWA 1TWHJ 2KP6A 4GYGA 4LFUA 4MEXF 2XSDC 4AIHA 2GWRA 1ETWA 2XKOA 1BW5A 3TQNA 2FOWA 3HRMA 5FD6A 6PAXA 2CFXA 3CLQA 1QHHD 4MFDA 1U5TC 4OINF 1LUJB 2H8WA 2L01A 1KONA 3MQ0A 2EBIA 2KHMA 1YJ9I 2X48A 5ICGA 4HPQA 1ZG3A 3DV8A 2VJJA 2HQNA 2LY1A 1T95A 3GZNB 1WHUA 4NC8A 1VI0A 3R0JA 4ZTFA 1F1ZA 1I5ZA 1UMQA 4LIVA 1HKTA 1VQNI 4DOZA 2XKPA 2JSPA 2DMTA 4NC6A 2BXYA 4KIBA 4HQMA 2LKPA 3WHCA 2R5YB 3HGGA 5DTDA 3VDXA 3BG9A 2DA7A 2HFHA 2VB6A 2OF7A 1SMTA 5M5XJ 1WI9A 4XLCA 3CZ6A 3Q3SA 4AU7A 2V1XA 1D5VA 5FFZA 1RUNA 3BTLA 2NS7A 3I58A 1HW1A 2E36A 3DPLC 3S1RJ 1HSTA 2Q2EB 5EG0B 1KU7A 4BQQA 1X1DA 2CQXA 5F0CA 1MJAA 1OCPA 1BIAA 4XOTA 1GVDA 1T8IA 2VOPA 3OMYA 2DMPA 4A3BJ 2VBZA 2WC2A 1QA6A 3TKYA 4BHCA 3GTGJ 4OU0A 3QPLA 2FMLA 1FIPA 2A68F 1P4XA 4ZTJA 1ODDA 1ZHFA 4BJTA 4WK8F 1QU3A 4MQ9F 2DI3A 3R61A 5J1UA 2CUEA 3BG5A 4IHVA 3NWTA 2EWNA 2DA6A 1D5YA 2K02A 1MW7A 1QVTA 2Y0MA 2J5PA 2EA4A 2EFNA 2KRFA 3HEFA 4L0ZB 1O4XA 3S1MJ 3BQYA 3MEXA 4FT8A 1U8RA 1R5GA 3OWTA 3S15J 1POGA 1R36A 1G3YA 3HSRA 4D7MA 2BOLA 4BJ5C 4MNUA 3OYIA 2MG4A 2LH9A 2CUZA 3VFZA 1LB2A 2OZ6A 2HYGD 1JT6A 3GTJJ 2HDDA 2IAIA 2VUMJ 1R00A 3AKZA 5C3EJ 3V8JA 1A35A 1VQ8I 3R6SA 3LFKA 3ESWB 5J1RA 2WV0A 2CUJA 3I59B 3JTGA 4HZFA 1PUFA 3SZGA 2ZJQF 3BZKA 3I3LA 2XRNA 4AD9A 1YS6A 4LG3A 2VC0A 2KZGA 4LJZF 3CDLA 4MEYF 4E7ZA 5EEAA 2QSFX 1SVLA 2RVCA 3HKZN 4X0GA 1W0UA 4NDLA 2XAJA 4DYRA 1MBGA 3I55I 3ZR8X 3MKWB 5LGTA 3CP2A 3A2KA 3OYDA 1B6AA 2ETHA 3HYIA 4G8XA 1H89C 2NVTJ 3H5NA 5E20A 4NB5A 1WFXA 2GA2A 3M8JA 4IF4A 4PGHA 3CJNA 3OOUA 1X1CA 5DYMA 5HS8A 3MCZA 3TW6A 3SZPA 2W1OA 2MLGA 5B1AH 2DJNA 3O6BB 2NS8A 3IH3A 2KISA 2A61A 3ZGKA 2R7RA 3V7CA 2K40A 3LSRA 2LK2A 2MGQA 2HI3A 2V1DA 3J80Z 2B0LA 4GGGA 1FY7A 2HPMA 4G6DA 3G1OA 1PYVA 2ZXIA 4NNJA 1UHSA 3CCMI 1SVMA 3J7ZI 1X3UA 3IRRA 1XSDA 3H0GJ 2XIGA 4BS9A 3GWZA 4QTRA 3LA7A 4CYCB 1LKXA 3OYCA 4AC0A 3HC7A 1CQTA 2TRTA 1SFEA 1H0MA 5DD8A 4PFPA 2E2IJ 2BY2A 3K4KA 3Q0VA 3G3ZA 5B1BH 4RB2C 5D6EA 4RDUA 5IYCJ 1D8KA 2EV0A 5F6FA 4HX8A 1O3QA 4J01A 1XGNA 4UVAA 4WX9A 2DA5A 4RM2A 4CCKA 1BOBA 5ICCA 1HQCA 2W82A 5C4JJ 1ZG1A 4UY8I 1WWXA 2KIQA 3S2HJ 5J6XA 2R3SA 2K4JA 3ZRGA 4UUVA 2IA0A 4Q4ZF 3U2RA 5BS6A 1LVAA 4I02A 4IHYA 2HZDA 2MA3A 5JHFA 3DCFA 4HX4A 1KGSA 2O5RA 3PL8A 3EUHA 1JJ8C 2JA5J 3KYLA 4IQJA 4LOCA 4A6EA 1BI2A 1W36C 3CUQA 1R5ID 4KJZA 4IX7A 3HSFA 3L2WA 4JYKA 2JA7J 4AUXA 3B6AA 4Q47A 2DK5A 1T6SA 2H27A 3F9KA 2CMPA 3LL7A 1YX5A 4XLPF 3S17J 3S14J 2D1HA 2PLYA 3OYNA 2DOFA 3O3KA 4ITVA 3H0DA 4O3MA 2VKHA 1A5JA 3OS0A 3ZMUA 1N25A 1L3LA 1O57A 1MBKA 1R4MB 4UHTA 3LSMA 2JZYA 2CSOA 1UZCA 3TBIA 4A5MA 4GXOA 2KQRA 4CZZA 2HDWA 1P9QC 2FJ1A 3KX2A 4D0PA 2FXAA 3BY6A 2RN7A 1AU7A 2O6GE 2MC3A 2LTPA 4A3IJ 1S72I 2X6YA 3RJPA 4B47A 4G6TB 5JLXA 4EMSA 2JWTA 3BR5A 3WG7H 3ZQFA 1ZAOA 3ZMSA 4B44A 1BC8C 2PFBA 4BXXJ 2Z1DA 1W0TA 1Z77A 3KEQA 3Q0UA 3WTUC 1OPCA 1LE8A 3PSFA 5CVJA 1G3SA 4XKVA 3BLYA 1K78A 3PNYA 4XLEA 2LFBA 3OSFA 1MSEC 1QPMA 5JFRA 2DYRH 3I4MJ 1PP7U 4B3AA 3JRBA 3EYYA 2E5ZA 5JVTA 4Y3OA 1BW6A 2VT2A 4BJ6C 3I56I 3QRFF 2E1CA 3P9KA 2EIMH 4XNFA 1W5SA 1ENHA 2V79A 2XAQA 3I64A 3E1SA 3SXYA 1K7AA 2MH2A 5D5UB 4RLFA 1WJFA 3HL2A 2LY2A 4OIQF 1JJ6C 3WTYC 2LREA 3RIRA 2BW3B 3ABUA 4I6ZA 3QAHA 3RSNA 4IOAF 2DFHA 2ZMEC 3H36A 3WG9A 1GVJA 3WTTC 3VYSB 5L3CA 3HUGA 3L2RA 3L2VA 3GF2A 3E5XA 1H88C 4IRGA 2WBMA 3AG3H 3RPUA 4A2UA 3OYAA 4CH7A 3G2BA 1TTYA 2VBXA 4I7HA 5IOYA 1DU0A 1BI1A 3HOUJ 2EJRA 4H4KC 2ME0A 5K5QA 3GTQJ 3OIOA 3JAMK 2FOKA 3HOWJ 3EYIA 4ZYAA 1FC3A 2Y48A 4Q5SF 3DWLE 2HOAA 2DTZA 1APLC 2PMZN 3CCYA 5F64A 5A2QK 5HDNA 3CCSI 3BJOA 1REPC 2DOAA 3MWMA 4FCYA 2E7XA 2XB5A 3PNTA 3BOQA 4OMYA 1ORKA 3HOZJ 2OTJI 1XTAA 1X58A 4HLYA 3H3VK 3EUKL 4P55A 2R7DA 1TQPA 1UB9A 3A01B 4EVIA 2JPCA 2QLZA 2DYSH 2OBPA 3QWLA 4S04A 2DPUA 3WU0A 5KVRA 3T1BA 3CMYA 1ZGWA
chains in the Genus database with same CATH topology
3HIFA 5LBQA 1FNNA 2XVCA 3DQVC 1PDNC 1STZA 1IXRC 2IT0A 2QENA 5E1XA 4ZZLA 2HEOA 1F9NA 3C7JA 4IPAA 3O2PE 3N97A 1IN5A 1FX7A 1FLIA 2MBFA 4LK0F 3VOEA 4R79A 4WXCA 5BPDA 2UXXA 3CUOA 3GX4X 1W7PB 3BWGA 2STTA 3I4PA 4YIIA 2H09A 2JSCA 1G3TA 5LLQA 2LNBA 2ZCWA 5D5XB 4RGXA 2M1BA 1SAXA 2KJBA 2GQQA 4M6XA 2F5EA 3M1EA 3WTWC 2RKHA 2FF4A 1P2FA 3ZMVA 3U9GA 2HTSA 3GZ5A 4EJWA 3WGIA 4BYYA 4GO1A 4R1HA 4UNOA 3FM5A 1IN8A 1CGPA 4L9NA 2M8EA 1FPQA 1BJAA 1OMIA 2RNJA 2FRHA 2QWWA 3KP6A 5H20A 1Z91A 1ZGJA 3WODF 3GO5A 3IHUA 2ACJA 4U88A 1QGPA 5ERIA 3T5XA 1VTNC 1I1SA 5TRDA 3DP7A 4L5IA 1UHWA 3OV8A 4KA4A 1U5TA 4NQWA 1ZLKA 1YQAA 3Q9VA 2HKXA 2DT5A 2YX4A 3IWZA 2EB7A 1QNTA 4ESJA 1WQ2A 3I71A 3MFKA 1L0OC 1LDKB 4FX4A 1MJBA 2HGCA 4ZYEA 2P6SA 3GLXA 2QYOA 1HKQA 1KA8A 2DAOA 2KIFA 2Z99A 3TO6A 1BN5A 2O0YA 2XAFA 2FNPA 2W84A 3W6JB 3E6MA 1Z6RA 3HOTA 3K0LA 4HDVA 1YW9A 1G6NA 5LGUA 4JBAA 2QM3A 3CDHA 2DBBA 4YFXF 5E8IA 3SZTA 2FQ3A 1OKRA 5CVUA 1R1TA 3QU3A 4I09A 3SFZA 3I0TA 1TLHB 1MDMA 1TQMA 3RDIA 4HQEA 5CJ9A 1B59A 3FZVA 3PFIA 3QPTA 1KU3A 2DFIA 3BROA 4JK1X 5CVRA 2HDCA 5L3EA 3GUDA 2DPDA 3SHFA 2QZ8A 1ZRCA 4P9FA 1IXSB 2HYFA 4AVPA 2MD5A 4GCVA 1IN4A 3QPHA 5LRSA 3GYHX 1CF7A 3VEPA 2F5FA 4KNYA 2K86A 2RGVA 4BAYA 4HW0A 4R8HA 3E3VA 5LHHA 3RKYA 4EV0A 2DW4A 3KFWX 2QVOA 1O3SA 2TDXA 4BHPA 3MZHA 2D1VA 5L3BA 4UVBA 3F8FA 2CGPA 1XSVA 4M9XA 5H6QA 2PJPA 4MGRA 1IAWA 3IWFA 4U0YA 5E1WA 1DP7P 5D4SA 3H92A 2FBIA 2CG4A 4K2EA 1XGMA 3WE2A 4PGGA 3FXQA 4A5NA 5ICFA 4CDGA 2Z33A 3K2ZA 5DUKA 2M87A 3CLOA 4GYIA 3Q5FA 3EQLF 3IL2A 4MQVA 1S29A 1ZRDA 1XMAA 3L00A 4CGZA 3BPVA 4RAZA 4MHGA 2STWA 3K9TA 1TBXA 3QP6A 2PG4A 3WGHA 3DXJF 3E6CC 3FXRA 1S3JA 1S6LA 1ZN2A 1R22A 2NYXA 2VN2A 4G6QA 4A6DA 2A6HF 2NRAC 2PEXA 4CO8A 3HHHA 3WTSC 2QBYB 3F21A 1KU9A 1MGTA 4F7ZA 2IJLA 3LA3A 3GXOA 5DEQA 3BP8A 4LG0B 3IKVA 2X4HA 4UV9A 1KQ8A 1R7JA 1MD0A 1R5HA 4KUMA 2CW0F 1R23A 5F1RA 2HQRA 5DD4A 1J0RA 2XAGA 1SMYF 5DCMB 4ETSA 5FFXA 1UFMA 3RPQA 4DNCA 2GXBA 4U0WA 5LGNA 4HAMA 2VONA 1JGSA 5K5OA 4HF2A 3F72A 4RB1A 3PQKA 2CQKA 1F4KA 3I53A 3E5QA 2VODA 3FMRA 2E1NA 3JAMZ 1BI3A 4HA8A 2ZMEA 1BBYA 2PQ8A 3KEOA 1XD7A 1USTA 5EEHA 3I5UA 1ZGAA 3F8NA 4LMYA 2M30A 1ONVA 3N4MA 3ZMZA 2G7UA 1U3EM 2H94A 5IT3A 2P7VB 2NAZA 1LDJA 4PDKA 4HLXA 3LA2A 1AOYA 2K27A 2L4AA 2MLKA 1YS7A 1FBQA 5D6FA 1I1GA 2YX7A 2HR3A 3H3UA 1KU2A 4WXHA 4M74A 2GXGA 2JTVA 2OQRA 3NEUA 2Z5UA 3DFGA 4HV6A 3ISPA 1U2WA 3B02A 4L9TA 4QLCU 5LRRA 3HOSA 1KYWA 3ECHA 3I54A 4M9SA 3B73A 1HW2A 3QP5A 1LJ9A 3LSTA 2ZNYA 4YG2F 1QQIA 3WGGA 1Z6TA 2ZO4A 2FE3A 3V7RA 2P5LC 2PI0A 1KQ9A 2BYVE 2D45A 4Y13A 3EDPA 4Y15A 2YU3A 2O61A 3L09A 2YPRA 2UWMA 2P5KA 5DUIA 1RI7A 4IHTA 2GAUA 1RUOA 3FF5A 2ZXJA 1P4WA 5L3GA 3RTRA 3VODA 2UZKA 1JHFA 2Q2EA 4MTDA 1YTYA 1HSJA 2EFWA 2XROA 3FMQA 3M7GA 2GA1A 1BM9A 5DV5A 1S7AA 1WKMA 1BIBA 1DPUA 1ZRFA 4L5JA 1ZG5A 1R58A 3PQJA 5HDKA 1ULYA 3F3XA 3GFIA 3RI4A 5LHIA 1E2XA 1FT9A 3F23A 3S2WA 4HYEA 3T0YA 4CHUA 3REOA 3TO9A 4EM1A 1IN6A 1RIOH 3LQQA 3GZ6A 2IVMA 3TOAA 3MZYA 4N9HA 2JT1A 1JHHA 2KIMA 2VT3A 4AWXB 3KP2A 2CO5A 1K79A 3ROUA 5LEJA 3I59A 3FWEA 4HV5A 2M45A 1DPRA 2FMYA 4CICA 5BMZA 3EETA 5AIPA 2Y75A 2DU9A 2VC1A 1SD6A 2ESNA 2PMHA 3R0AA 3E6BA 1GHCA 4KMFA 2A5YB 3FX3A 5EEGA 3F8BA 4NHJA 1FYMA 2Z3YA 3ML6A 4Y17A 3H3ZA 1E17A 1XGOA 3DF8A 4MTEA 4XSZF 1DDNA 2XV4S 2FA5A 2LF7A 2GZWA 1SD7A 2KIUA 4ZYDA 1MZBA 3FMSA 5FLXZ 3J7AO 4ENJA 1ZARA 2ZJ2A 2O03A 4A0ZA 1D3YA 5FO5A 4LK1F 5E8GA 5HLHA 3F8MA 1XCBA 4WWCA 2QQ9A 1FYLA 1OYWA 4EJTA 3ZMTA 1MJ9A 1Z7UA 3WE3A 3K69A 4G94A 1LQ1A 1SFUA 1T39A 1Z9CA 4FX0A 3IC7A 3ECOA 1FBUA 3D5LA 2QQBA 2VE8A 3NRVA 2G7HA 1H9GA 2V6CA 3C18A 2EFOA 4IRIA 4WXDA 4RAYA 2O3FA 5E17F 3GFLA 4M71A 4M73A 2EV6A 3E97A 4ENNA 4I98B 4Q48A 2L54A 2W24A 4HBLA 4L9VA 2G9WA 4G9YA 2WWYA 3HTUA 2VBYA 2VE9A 3HHGA 4LB5A 4G7HF 1UHMA 3LAPA 2DK8A 2P5VA 5IT9K 2A6EF 3G73A 3BDDA 3BJAA 3CUQB 1IZ1A 3LQRA 4JQFA 1ZYRF 1B9NA 4G7ZF 1J9IA 5AONA 1I27A 1K6OA 1AWCA 1QO0D 5D5WB 3ELKA 2EK5A 5ILUA 4HX7A 5TJJA 2KKOA 1S7OA 2BGCA 5JR3A 1P6RA 3OOPA 4OIRF 4HOBA 5ILVA 1ON1A 3KP4A 2AXLA 2HS5A 4OIPF 2ISYA 3JTHA 2DTRA 2OAZA 1T2KA 2FEZA 3F6VA 3IKTA 1G4DA 2VXZA 1B9MA 2ISZA 4BXUA 2OD5A 1K78B 1DUXC 3J81K 4L9JA 3M8FA 5KK1A 5D5VB 1FBSA 5HLGA 3BPXA 2K7LA 3CO6C 2W25A 1V3FA 2CYYA 5CLSA 4YFNF 3V7SA 4KDPA 1LEBA 2PBIA 4O5VA 2KJCA 2F2EA 5ICEA 1T0FA 3E5UA 1H9TA 3RKWA 4XRFA 2PN6A 4M6YA 1QBJA 4O6JA 3IRQA 4IXAA 4LLLA 2P7CB 2DO7A 2EFPA 2ZNZA 4KMUX 5L3FA 4A0YA 2FBKA 1J59A 1F5TA 3C1DA 3WTXC 2F5DA 1HW5A 5BOXA 1YIOA 3TGNA 3ZMDA 2ADUA 1WRJA 3L9FA 4M9ZA 1W7PA 1WSUA 4RGRA 1BC7C 1SD4A 4H0EA 3BJ6A 2GIVA 2DLLA 3JW4A 1O7FA 2HZTA 4YIFA 2FNAA 3KZYA 3SQNA 1USSA 4LD5A 4CYDA 3M9AA 4M72A 1UCRA 2V9VA 3E6DA 3MAJA 4HDUA 3RYPA 1IXCA 4U0VA 5D8KB 2IRFG 4B8XA 3DKWA 1JXSA 1LNWA 3V8LA 3RYRA 2OZUA 1FP2A 3RKXA 2NS0A 2F5CA 2VBWA 4KFCA 5J8FA 4L0YB 1EH6A 2HOEA 2LF8A 2ELHA 3C3WA 1U78A 1W4MA 3GFMA 1V4RA 4Z2YA 5D8LB 1FP1D 3ABTA 2ESHA 4IHSA 4EJOA 3GW2A 1FZPB 1O7LA 4KT5C 2VOOA 2L02A 1D8JA 1Y0UA 3FM3A 3KP7A 2DQRA 4UVCA 1JE8A 4RGSA 3HTSB 4EQQA 1P4AA 5ED4A 1J7KA 2LDUA 1S8NA 4DQ2A 2J5OA 3KLNA 4EM0B 2XGXA 5HOOA 2YR2A 5LHGA 5AIQA 5A2QZ 3R60A 2PMUA 5JHUA 3VB2A 4A0XA 4PCQA 1T38A 2WTEA 2K4BA 3ZPLA 1EV7A 4ZYHA 1P92A 2QUFA 5L3DA 1BOAA 2XHKA 3LWFA 2Z9OA 4LGWA 2OQGA 4KN7X 3KETA 1U5TB 4P9UA 2RQPA 2FBHA 2D2WA 2LSOA 1YW8A 1ZH5A 4LLNA 4RS8A 2C6YA 1IW7F 4ENMA 1YYVA 2P8TA 2BV6A 1BI0A 4XLNF 4AIJA 4U7BA 2IA1A 4ON0A 3P7NA 1A04A 3K1MA 4PZJA 2H6CA 1OR7A 1PUEE 4IRHA 3DPTA 2EA2A 4UV8A 2FU4A 1W5TA 1RNLA 3L2CA 1GXQA 1TW2A 4RB0A 2QQAA 2H6BA 1EH7A 4I0BA 1O3TA 1IRFA 4KYWA 4BH9A 1SD5A 2XASA 2Q0OA 1MDMB 3JSPA 3ZQ7A 1ON2A 4KICA 3U1DA 5D4RA 3ZP5A 1I6XA 2HTJA 3M8EA 3FHZA 4HF0A 1IUYA 2BEOA 1FSHA 5FB2A 4EJUA 1YLFA 3KCCA 4ESBA 2DQLA 1ZLJA 5K1YA 1R1VA 3P9CA 5BQTA 5E18F 3J80K 2COMA 3WTZA 2IPQX 3GVAA 1CF7B 4I0AA 1OYIA 4ZZDA 1O3RA 5ILSA 2L4MA 1C0WA 1YW7A 5BPIA 1XB4A 3COAC 2IP2A 1XCVA 3CTAA 3R4KA 1W7PD 5CVIA 5CYVA 3AAFA 1YFHA 2IW5A 2ZFWA 2RC4A 4ZYGA 4QWQA 3CUQC 3HRTA 1GXPA 1J2XA 2O8XA 4P5OA 3FXUA 1KYZA 3V4GA 3ZN1A 5E1ZB 1Q1HA 1FSEA 1MKMA 4B09A 1XMKA 3F6OA 5FD5A 1TNTA 4ZH4F 2AS5F 3D0SA 4A12A 2A07F 3T8TA 2ZBKA 4RB3C 3TDZC 3V8KA 1LDDA 1TNSA 1IN7A 1IF1A 4L18B 2BBYA 2W57A 2M5WA 2QBYA 4OIOF 1XGSA 4P96A 3K1NA 1HXDA 1XDUA 4OMZA 1U6GA 3LAJA 2XAHA 3HSEA 5IT9Z 1QZYA 4KN4X 1TQIA 2W85A 5J8CA 1IRGA 4LG0A 4EM2A 1ZREA 3DEUA 2ZKZA 1RZ4A 1Z05A 2NNYA 2RV8A 5HDGA 4I2OA 4S05A 1TW3A 3KLOA 2Q8KA 1T98A 5DCMA 4CXFA 2E7WA 2BE5F 3HRSA 3NQOA 1FWZA 2JRTA 2HWVA 1FYKA 1XSXA 1HKSA 4BHBA 3WU1B 3Q9SA 1R1UA 2EFQA 3HRUA 1Z1DA 1J5YA 2OA4A 2V1UA 1SFXA 4AIKA 2P6TA 2CWEA 3F22A 4TV7A 4FHTA 3KZZA 3K1PA 3J81Z 1XDSA 4WCGA 4EJVA 3ERED 1EH8A 2A69F 4ASNA 3F8CA 3WTVC 2NNNA 2XUBA 3ULQB 4IJAA 1LEAA 4HF1A 3KP5A 1KQ0A 4EGYA 1XN7A 4WF2A 4N0BA 3KE2A 5HS7A 3KP3A 2RDPA 1FOKA 3GEZA 5LEKA 3BZ6A 3TOBA 2FSWA 1QZZA 4RGUA 1NHAA 2P4WA 3JSOA 1G3WA 5H6RA 1HBXG 2A3SA 1B1BA 1OYYA 2ZMEB 5DCFA 4I01A 1J75A 5HVQC 4N9IA 4EGZA 2OU2A 2R7FA 2L3DA 2X0LA 4ENKA 4YFKF 4OOIA 4XBFA 5HLIA 5JI6A 2EV5A 2HKOA 5CVVA 4KIFA 5HS9A 3TDUC 3QU6A 4G7OF 3GFJA 4ESFA 3QOPA 1YO5C 4BNCA 3P9IA 4LB6B 4KIGA 2JPBA 4E70A 1PP8F 5DDGA 2UXNA 3T8RA 3TO7A 2IA2A 2MH9A 1B4AA 2YSRA 4IVNA 3CO7C 4XSXF 5K5RA 4BQAA 5FGMA 4LLGF 5FLXK 3W6KB 3ZN0A 4U7DA 1YG2A 3L7WA 4UXNA 4GYGA 4LFUA 4MEXF 4AIHA 2GWRA 2XKOA 3TQNA 3HRMA 5FD6A 6PAXA 2CFXA 1U5TC 4OINF 2L01A 3MQ0A 5ICGA 1ZG3A 3DV8A 2HQNA 3R0JA 1F1ZA 1I5ZA 1HKTA 2XKPA 4KIBA 4HQMA 2LKPA 2HFHA 1SMTA 1WI9A 2V1XA 1D5VA 5FFZA 1RUNA 3I58A 1HW1A 3DPLC 1HSTA 1KU7A 1MJAA 1BIAA 2VOPA 2VBZA 2WC2A 3TKYA 4BHCA 4OU0A 2FMLA 2A68F 1P4XA 1ODDA 1ZHFA 4WK8F 4MQ9F 2DI3A 3R61A 2EWNA 2K02A 4L0ZB 2Y0MA 2J5PA 2EA4A 2EFNA 2KRFA 3MEXA 4FT8A 1U8RA 1R5GA 1R36A 1G3YA 3HSRA 4MNUA 3VFZA 1LB2A 2OZ6A 2HYGD 1R00A 3V8JA 3R6SA 3LFKA 2WV0A 3JTGA 3I59B 4HZFA 2XRNA 4AD9A 1YS6A 2VC0A 4MEYF 4LJZF 2RVCA 2XAJA 5LGTA 1B6AA 2ETHA 3HYIA 4G8XA 5E20A 4NB5A 2GA2A 4IF4A 4PGHA 3CJNA 5DYMA 5HS8A 3MCZA 3SZPA 2MLGA 3O6BB 2A61A 3V7CA 2V1DA 3J80Z 2B0LA 4GGGA 1FY7A 4G6DA 1X3UA 3IRRA 1XSDA 2XIGA 3GWZA 3LA7A 1SFEA 1H0MA 5DD8A 3G3ZA 4RB2C 5D6EA 1D8KA 2EV0A 5F6FA 4HX8A 1O3QA 1XGNA 4UVAA 4WX9A 5ICCA 1ZG1A 1HQCA 1WWXA 5J6XA 2R3SA 2K4JA 4UUVA 2IA0A 4Q4ZF 3U2RA 5BS6A 1LVAA 4I02A 2MA3A 4HX4A 1KGSA 3EUHA 4A6EA 1BI2A 3CUQA 3HSFA 4Q47A 2DK5A 1T6SA 2H27A 4XLPF 2D1HA 2PLYA 4O3MA 3O3KA 3ZMUA 1L3LA 1O57A 4UHTA 2JZYA 2CSOA 4A5MA 4GXOA 4CZZA 4D0PA 2FXAA 3BY6A 2RN7A 2O6GE 2MC3A 3RJPA 4EMSA 1ZAOA 3ZMSA 1BC8C 2PFBA 3KEQA 3WTUC 1OPCA 5CVJA 1G3SA 1K78A 1QPMA 5JFRA 1PP7U 3EYYA 5JVTA 2VT2A 2E1CA 3QRFF 3P9KA 1W5SA 2V79A 2XAQA 3I64A 3SXYA 1K7AA 2MH2A 5D5UB 4OIQF 3WTYC 3RIRA 3ABUA 3QAHA 3WG9A 1GVJA 3WTTC 5L3CA 3HUGA 3GF2A 3E5XA 4IRGA 3RPUA 4A2UA 1TTYA 2VBXA 4I7HA 1BI1A 2EJRA 5K5QA 3JAMK 2FOKA 3EYIA 1FC3A 2Y48A 4Q5SF 5F64A 5A2QK 5HDNA 3BJOA 1REPC 3MWMA 2E7XA 3BOQA 4OMYA 4HLYA 4P55A 2R7DA 1TQPA 1UB9A 4EVIA 2JPCA 2QLZA 2OBPA 4S04A 2DPUA 3WU0A 5KVRA 3T1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIF A;  5LBQ A;  1FNN A;  2XVC A;  3DQV C;  1PDN C;  1STZ A;  1IXR C;  2IT0 A;  2QEN A;  5E1X A;  4ZZL A;  2HEO A;  1F9N A;  3C7J A;  4IPA A;  3O2P E;  3N97 A;  1IN5 A;  1FX7 A;  1FLI A;  2MBF A;  4LK0 F;  3VOE A;  4R79 A;  4WXC A;  5BPD A;  2UXX A;  3CUO A;  3GX4 X;  1W7P B;  3BWG A;  2STT A;  3I4P A;  4YII A;  2H09 A;  2JSC A;  1G3T A;  5LLQ A;  2LNB A;  2ZCW A;  5D5X B;  4RGX A;  2M1B A;  1SAX A;  2KJB A;  2GQQ A;  4M6X A;  2F5E A;  3M1E A;  3WTW C;  2RKH A;  2FF4 A;  1P2F A;  3ZMV A;  3U9G A;  2HTS A;  3GZ5 A;  4EJW A;  3WGI A;  4BYY A;  4GO1 A;  4R1H A;  4UNO A;  3FM5 A;  1IN8 A;  1CGP A;  4L9N A;  2M8E A;  1FPQ A;  1BJA A;  1OMI A;  2RNJ A;  2FRH A;  2QWW A;  3KP6 A;  5H20 A;  1Z91 A;  1ZGJ A;  3WOD F;  3GO5 A;  3IHU A;  2ACJ A;  4U88 A;  1QGP A;  5ERI A;  3T5X A;  1VTN C;  1I1S A;  5TRD A;  3DP7 A;  4L5I A;  1UHW A;  3OV8 A;  4KA4 A;  1U5T A;  4NQW A;  1ZLK A;  1YQA A;  3Q9V A;  2HKX A;  2DT5 A;  2YX4 A;  3IWZ A;  2EB7 A;  1QNT A;  4ESJ A;  1WQ2 A;  3I71 A;  3MFK A;  1L0O C;  1LDK B;  4FX4 A;  1MJB A;  2HGC A;  4ZYE A;  2P6S A;  3GLX A;  2QYO A;  1HKQ A;  1KA8 A;  2DAO A;  2KIF A;  2Z99 A;  3TO6 A;  1BN5 A;  2O0Y A;  2XAF A;  2FNP A;  2W84 A;  3W6J B;  3E6M A;  1Z6R A;  3HOT A;  3K0L A;  4HDV A;  1YW9 A;  1G6N A;  5LGU A;  4JBA A;  2QM3 A;  3CDH A;  2DBB A;  4YFX F;  5E8I A;  3SZT A;  2FQ3 A;  1OKR A;  5CVU A;  1R1T A;  3QU3 A;  4I09 A;  3SFZ A;  3I0T A;  1TLH B;  1MDM A;  1TQM A;  3RDI A;  4HQE A;  5CJ9 A;  1B59 A;  3FZV A;  3PFI A;  3QPT A;  1KU3 A;  2DFI A;  3BRO A;  4JK1 X;  5CVR A;  2HDC A;  5L3E A;  3GUD A;  2DPD A;  3SHF A;  2QZ8 A;  1ZRC A;  4P9F A;  1IXS B;  2HYF A;  4AVP A;  2MD5 A;  4GCV A;  1IN4 A;  3QPH A;  5LRS A;  3GYH X;  1CF7 A;  3VEP A;  2F5F A;  4KNY A;  2K86 A;  2RGV A;  4BAY A;  4HW0 A;  4R8H A;  3E3V A;  5LHH A;  3RKY A;  4EV0 A;  2DW4 A;  3KFW X;  2QVO A;  1O3S A;  2TDX A;  4BHP A;  3MZH A;  2D1V A;  5L3B A;  4UVB A;  3F8F A;  2CGP A;  1XSV A;  4M9X A;  5H6Q A;  2PJP A;  4MGR A;  1IAW A;  3IWF A;  4U0Y A;  5E1W A;  1DP7 P;  5D4S A;  3H92 A;  2FBI A;  2CG4 A;  4K2E A;  1XGM A;  3WE2 A;  4PGG A;  3FXQ A;  4A5N A;  5ICF A;  4CDG A;  2Z33 A;  3K2Z A;  5DUK A;  2M87 A;  3CLO A;  4GYI A;  3Q5F A;  3EQL F;  3IL2 A;  4MQV A;  1S29 A;  1ZRD A;  1XMA A;  3L00 A;  4CGZ A;  3BPV A;  4RAZ A;  4MHG A;  2STW A;  3K9T A;  1TBX A;  3QP6 A;  2PG4 A;  3WGH A;  3DXJ F;  3E6C C;  3FXR A;  1S3J A;  1S6L A;  1ZN2 A;  1R22 A;  2NYX A;  2VN2 A;  4G6Q A;  4A6D A;  2A6H F;  2NRA C;  2PEX A;  4CO8 A;  3HHH A;  3WTS C;  2QBY B;  3F21 A;  1KU9 A;  1MGT A;  4F7Z A;  2IJL A;  3LA3 A;  3GXO A;  5DEQ A;  3BP8 A;  4LG0 B;  3IKV A;  2X4H A;  4UV9 A;  1KQ8 A;  1R7J A;  1MD0 A;  1R5H A;  4KUM A;  2CW0 F;  1R23 A;  5F1R A;  2HQR A;  5DD4 A;  1J0R A;  2XAG A;  1SMY F;  5DCM B;  4ETS A;  5FFX A;  1UFM A;  3RPQ A;  4DNC A;  2GXB A;  4U0W A;  5LGN A;  4HAM A;  2VON A;  1JGS A;  5K5O A;  4HF2 A;  3F72 A;  4RB1 A;  3PQK A;  2CQK A;  1F4K A;  3I53 A;  3E5Q A;  2VOD A;  3FMR A;  2E1N A;  3JAM Z;  1BI3 A;  4HA8 A;  2ZME A;  1BBY A;  2PQ8 A;  3KEO A;  1XD7 A;  1UST A;  5EEH A;  3I5U A;  1ZGA A;  3F8N A;  4LMY A;  2M30 A;  1ONV A;  3N4M A;  3ZMZ A;  2G7U A;  1U3E M;  2H94 A;  5IT3 A;  2P7V B;  2NAZ A;  1LDJ A;  4PDK A;  4HLX A;  3LA2 A;  1AOY A;  2K27 A;  2L4A A;  2MLK A;  1YS7 A;  1FBQ A;  5D6F A;  1I1G A;  2YX7 A;  2HR3 A;  3H3U A;  1KU2 A;  4WXH A;  4M74 A;  2GXG A;  2JTV A;  2OQR A;  3NEU A;  2Z5U A;  3DFG A;  4HV6 A;  3ISP A;  1U2W A;  3B02 A;  4L9T A;  4QLC U;  5LRR A;  3HOS A;  1KYW A;  3ECH A;  3I54 A;  4M9S A;  3B73 A;  1HW2 A;  3QP5 A;  1LJ9 A;  3LST A;  2ZNY A;  4YG2 F;  1QQI A;  3WGG A;  1Z6T A;  2ZO4 A;  2FE3 A;  3V7R A;  2P5L C;  2PI0 A;  1KQ9 A;  2BYV E;  2D45 A;  4Y13 A;  3EDP A;  4Y15 A;  2YU3 A;  2O61 A;  3L09 A;  2YPR A;  2UWM A;  2P5K A;  5DUI A;  1RI7 A;  4IHT A;  2GAU A;  1RUO A;  3FF5 A;  2ZXJ A;  1P4W A;  5L3G A;  3RTR A;  3VOD A;  2UZK A;  1JHF A;  2Q2E A;  4MTD A;  1YTY A;  1HSJ A;  2EFW A;  2XRO A;  3FMQ A;  3M7G A;  2GA1 A;  1BM9 A;  5DV5 A;  1S7A A;  1WKM A;  1BIB A;  1DPU A;  1ZRF A;  4L5J A;  1ZG5 A;  1R58 A;  3PQJ A;  5HDK A;  1ULY A;  3F3X A;  3GFI A;  3RI4 A;  5LHI A;  1E2X A;  1FT9 A;  3F23 A;  3S2W A;  4HYE A;  3T0Y A;  4CHU A;  3REO A;  3TO9 A;  4EM1 A;  1IN6 A;  1RIO H;  3LQQ A;  3GZ6 A;  2IVM A;  3TOA A;  3MZY A;  4N9H A;  2JT1 A;  1JHH A;  2KIM A;  2VT3 A;  4AWX B;  3KP2 A;  2CO5 A;  1K79 A;  3ROU A;  5LEJ A;  3I59 A;  3FWE A;  4HV5 A;  2M45 A;  1DPR A;  2FMY A;  4CIC A;  5BMZ A;  3EET A;  5AIP A;  2Y75 A;  2DU9 A;  2VC1 A;  1SD6 A;  2ESN A;  2PMH A;  3R0A A;  3E6B A;  1GHC A;  4KMF A;  2A5Y B;  3FX3 A;  5EEG A;  3F8B A;  4NHJ A;  1FYM A;  2Z3Y A;  3ML6 A;  4Y17 A;  3H3Z A;  1E17 A;  1XGO A;  3DF8 A;  4MTE A;  4XSZ F;  1DDN A;  2XV4 S;  2FA5 A;  2LF7 A;  2GZW A;  1SD7 A;  2KIU A;  4ZYD A;  1MZB A;  3FMS A;  5FLX Z;  3J7A O;  4ENJ A;  1ZAR A;  2ZJ2 A;  2O03 A;  4A0Z A;  1D3Y A;  5FO5 A;  4LK1 F;  5E8G A;  5HLH A;  3F8M A;  1XCB A;  4WWC A;  2QQ9 A;  1FYL A;  1OYW A;  4EJT A;  3ZMT A;  1MJ9 A;  1Z7U A;  3WE3 A;  3K69 A;  4G94 A;  1LQ1 A;  1SFU A;  1T39 A;  1Z9C A;  4FX0 A;  3IC7 A;  3ECO A;  1FBU A;  3D5L A;  2QQB A;  2VE8 A;  3NRV A;  2G7H A;  1H9G A;  2V6C A;  3C18 A;  2EFO A;  4IRI A;  4WXD A;  4RAY A;  2O3F A;  5E17 F;  3GFL A;  4M71 A;  4M73 A;  2EV6 A;  3E97 A;  4ENN A;  4I98 B;  4Q48 A;  2L54 A;  2W24 A;  4HBL A;  4L9V A;  2G9W A;  4G9Y A;  2WWY A;  3HTU A;  2VBY A;  2VE9 A;  3HHG A;  4LB5 A;  4G7H F;  1UHM A;  3LAP A;  2DK8 A;  2P5V A;  5IT9 K;  2A6E F;  3G73 A;  3BDD A;  3BJA A;  3CUQ B;  1IZ1 A;  3LQR A;  4JQF A;  1ZYR F;  1B9N A;  4G7Z F;  1J9I A;  5AON A;  1I27 A;  1K6O A;  1AWC A;  1QO0 D;  5D5W B;  3ELK A;  2EK5 A;  5ILU A;  4HX7 A;  5TJJ A;  2KKO A;  1S7O A;  2BGC A;  5JR3 A;  1P6R A;  3OOP A;  4OIR F;  4HOB A;  5ILV A;  1ON1 A;  3KP4 A;  2AXL A;  2HS5 A;  4OIP F;  2ISY A;  3JTH A;  2DTR A;  2OAZ A;  1T2K A;  2FEZ A;  3F6V A;  3IKT A;  1G4D A;  2VXZ A;  1B9M A;  2ISZ A;  4BXU A;  2OD5 A;  1K78 B;  1DUX C;  3J81 K;  4L9J A;  3M8F A;  5KK1 A;  5D5V B;  1FBS A;  5HLG A;  3BPX A;  2K7L A;  3CO6 C;  2W25 A;  1V3F A;  2CYY A;  5CLS A;  4YFN F;  3V7S A;  4KDP A;  1LEB A;  2PBI A;  4O5V A;  2KJC A;  2F2E A;  5ICE A;  1T0F A;  3E5U A;  1H9T A;  3RKW A;  4XRF A;  2PN6 A;  4M6Y A;  1QBJ A;  4O6J A;  3IRQ A;  4IXA A;  4LLL A;  2P7C B;  2DO7 A;  2EFP A;  2ZNZ A;  4KMU X;  5L3F A;  4A0Y A;  2FBK A;  1J59 A;  1F5T A;  3C1D A;  3WTX C;  2F5D A;  1HW5 A;  5BOX A;  1YIO A;  3TGN A;  3ZMD A;  2ADU A;  1WRJ A;  3L9F A;  4M9Z A;  1W7P A;  1WSU A;  4RGR A;  1BC7 C;  1SD4 A;  4H0E A;  3BJ6 A;  2GIV A;  2DLL A;  3JW4 A;  1O7F A;  2HZT A;  4YIF A;  2FNA A;  3KZY A;  3SQN A;  1USS A;  4LD5 A;  4CYD A;  3M9A A;  4M72 A;  1UCR A;  2V9V A;  3E6D A;  3MAJ A;  4HDU A;  3RYP A;  1IXC A;  4U0V A;  5D8K B;  2IRF G;  4B8X A;  3DKW A;  1JXS A;  1LNW A;  3V8L A;  3RYR A;  2OZU A;  1FP2 A;  3RKX A;  2NS0 A;  2F5C A;  2VBW A;  4KFC A;  5J8F A;  4L0Y B;  1EH6 A;  2HOE A;  2LF8 A;  2ELH A;  3C3W A;  1U78 A;  1W4M A;  3GFM A;  1V4R A;  4Z2Y A;  5D8L B;  1FP1 D;  3ABT A;  2ESH A;  4IHS A;  4EJO A;  3GW2 A;  1FZP B;  1O7L A;  4KT5 C;  2VOO A;  2L02 A;  1D8J A;  1Y0U A;  3FM3 A;  3KP7 A;  2DQR A;  4UVC A;  1JE8 A;  4RGS A;  3HTS B;  4EQQ A;  1P4A A;  5ED4 A;  1J7K A;  2LDU A;  1S8N A;  4DQ2 A;  2J5O A;  3KLN A;  4EM0 B;  2XGX A;  5HOO A;  2YR2 A;  5LHG A;  5AIQ A;  5A2Q Z;  3R60 A;  2PMU A;  5JHU A;  3VB2 A;  4A0X A;  4PCQ A;  1T38 A;  2WTE A;  2K4B A;  3ZPL A;  1EV7 A;  4ZYH A;  1P92 A;  2QUF A;  5L3D A;  1BOA A;  2XHK A;  3LWF A;  2Z9O A;  4LGW A;  2OQG A;  4KN7 X;  3KET A;  1U5T B;  4P9U A;  2RQP A;  2FBH A;  2D2W A;  2LSO A;  1YW8 A;  1ZH5 A;  4LLN A;  4RS8 A;  2C6Y A;  1IW7 F;  4ENM A;  1YYV A;  2P8T A;  2BV6 A;  1BI0 A;  4XLN F;  4AIJ A;  4U7B A;  2IA1 A;  4ON0 A;  3P7N A;  1A04 A;  3K1M A;  4PZJ A;  2H6C A;  1OR7 A;  1PUE E;  4IRH A;  3DPT A;  2EA2 A;  4UV8 A;  2FU4 A;  1W5T A;  1RNL A;  3L2C A;  1GXQ A;  1TW2 A;  4RB0 A;  2QQA A;  2H6B A;  1EH7 A;  4I0B A;  1O3T A;  1IRF A;  4KYW A;  4BH9 A;  1SD5 A;  2XAS A;  2Q0O A;  1MDM B;  3JSP A;  3ZQ7 A;  1ON2 A;  4KIC A;  3U1D A;  5D4R A;  3ZP5 A;  1I6X A;  2HTJ A;  3M8E A;  3FHZ A;  4HF0 A;  1IUY A;  2BEO A;  1FSH A;  5FB2 A;  4EJU A;  1YLF A;  3KCC A;  4ESB A;  2DQL A;  1ZLJ A;  5K1Y A;  1R1V A;  3P9C A;  5BQT A;  5E18 F;  3J80 K;  2COM A;  3WTZ A;  2IPQ X;  3GVA A;  1CF7 B;  4I0A A;  1OYI A;  4ZZD A;  1O3R A;  5ILS A;  2L4M A;  1C0W A;  1YW7 A;  5BPI A;  1XB4 A;  3COA C;  2IP2 A;  1XCV A;  3CTA A;  3R4K A;  1W7P D;  5CVI A;  5CYV A;  3AAF A;  1YFH A;  2IW5 A;  2ZFW A;  2RC4 A;  4ZYG A;  4QWQ A;  3CUQ C;  3HRT A;  1GXP A;  1J2X A;  2O8X A;  4P5O A;  3FXU A;  1KYZ A;  3V4G A;  3ZN1 A;  5E1Z B;  1Q1H A;  1FSE A;  1MKM A;  4B09 A;  1XMK A;  3F6O A;  5FD5 A;  1TNT A;  4ZH4 F;  2AS5 F;  3D0S A;  4A12 A;  2A07 F;  3T8T A;  2ZBK A;  4RB3 C;  3TDZ C;  3V8K A;  1LDD A;  1TNS A;  1IN7 A;  1IF1 A;  4L18 B;  2BBY A;  2W57 A;  2M5W A;  2QBY A;  4OIO F;  1XGS A;  4P96 A;  3K1N A;  1HXD A;  1XDU A;  4OMZ A;  1U6G A;  3LAJ A;  2XAH A;  3HSE A;  5IT9 Z;  1QZY A;  4KN4 X;  1TQI A;  2W85 A;  5J8C A;  1IRG A;  4LG0 A;  4EM2 A;  1ZRE A;  3DEU A;  2ZKZ A;  1RZ4 A;  1Z05 A;  2NNY A;  2RV8 A;  5HDG A;  4I2O A;  4S05 A;  1TW3 A;  3KLO A;  2Q8K A;  1T98 A;  5DCM A;  4CXF A;  2E7W A;  2BE5 F;  3HRS A;  3NQO A;  1FWZ A;  2JRT A;  2HWV A;  1FYK A;  1XSX A;  1HKS A;  4BHB A;  3WU1 B;  3Q9S A;  1R1U A;  2EFQ A;  3HRU A;  1Z1D A;  1J5Y A;  2OA4 A;  2V1U A;  1SFX A;  4AIK A;  2P6T A;  2CWE A;  3F22 A;  4TV7 A;  4FHT A;  3KZZ A;  3K1P A;  3J81 Z;  1XDS A;  4WCG A;  4EJV A;  3ERE D;  1EH8 A;  2A69 F;  4ASN A;  3F8C A;  3WTV C;  2NNN A;  2XUB A;  3ULQ B;  4IJA A;  1LEA A;  4HF1 A;  3KP5 A;  1KQ0 A;  4EGY A;  1XN7 A;  4WF2 A;  4N0B A;  3KE2 A;  5HS7 A;  3KP3 A;  2RDP A;  1FOK A;  3GEZ A;  5LEK A;  3BZ6 A;  3TOB A;  2FSW A;  1QZZ A;  4RGU A;  1NHA A;  2P4W A;  3JSO A;  1G3W A;  5H6R A;  1HBX G;  2A3S A;  1B1B A;  1OYY A;  2ZME B;  5DCF A;  4I01 A;  1J75 A;  5HVQ C;  4N9I A;  4EGZ A;  2OU2 A;  2R7F A;  2L3D A;  2X0L A;  4ENK A;  4YFK F;  4OOI A;  4XBF A;  5HLI A;  5JI6 A;  2EV5 A;  2HKO A;  5CVV A;  4KIF A;  5HS9 A;  3TDU C;  3QU6 A;  4G7O F;  3GFJ A;  4ESF A;  3QOP A;  1YO5 C;  4BNC A;  3P9I A;  4LB6 B;  4KIG A;  2JPB A;  4E70 A;  1PP8 F;  5DDG A;  2UXN A;  3T8R A;  3TO7 A;  2IA2 A;  2MH9 A;  1B4A A;  2YSR A;  4IVN A;  3CO7 C;  4XSX F;  5K5R A;  4BQA A;  5FGM A;  4LLG F;  5FLX K;  3W6K B;  3ZN0 A;  4U7D A;  1YG2 A;  3L7W A;  4UXN A;  4GYG A;  4LFU A;  4MEX F;  4AIH A;  2GWR A;  2XKO A;  3TQN A;  3HRM A;  5FD6 A;  6PAX A;  2CFX A;  1U5T C;  4OIN F;  2L01 A;  3MQ0 A;  5ICG A;  1ZG3 A;  3DV8 A;  2HQN A;  3R0J A;  1F1Z A;  1I5Z A;  1HKT A;  2XKP A;  4KIB A;  4HQM A;  2LKP A;  2HFH A;  1SMT A;  1WI9 A;  2V1X A;  1D5V A;  5FFZ A;  1RUN A;  3I58 A;  1HW1 A;  3DPL C;  1HST A;  1KU7 A;  1MJA A;  1BIA A;  2VOP A;  2VBZ A;  2WC2 A;  3TKY A;  4BHC A;  4OU0 A;  2FML A;  2A68 F;  1P4X A;  1ODD A;  1ZHF A;  4WK8 F;  4MQ9 F;  2DI3 A;  3R61 A;  2EWN A;  2K02 A;  4L0Z B;  2Y0M A;  2J5P A;  2EA4 A;  2EFN A;  2KRF A;  3MEX A;  4FT8 A;  1U8R A;  1R5G A;  1R36 A;  1G3Y A;  3HSR A;  4MNU A;  3VFZ A;  1LB2 A;  2OZ6 A;  2HYG D;  1R00 A;  3V8J A;  3R6S A;  3LFK A;  2WV0 A;  3JTG A;  3I59 B;  4HZF A;  2XRN A;  4AD9 A;  1YS6 A;  2VC0 A;  4MEY F;  4LJZ F;  2RVC A;  2XAJ A;  5LGT A;  1B6A A;  2ETH A;  3HYI A;  4G8X A;  5E20 A;  4NB5 A;  2GA2 A;  4IF4 A;  4PGH A;  3CJN A;  5DYM A;  5HS8 A;  3MCZ A;  3SZP A;  2MLG A;  3O6B B;  2A61 A;  3V7C A;  2V1D A;  3J80 Z;  2B0L A;  4GGG A;  1FY7 A;  4G6D A;  1X3U A;  3IRR A;  1XSD A;  2XIG A;  3GWZ A;  3LA7 A;  1SFE A;  1H0M A;  5DD8 A;  3G3Z A;  4RB2 C;  5D6E A;  1D8K A;  2EV0 A;  5F6F A;  4HX8 A;  1O3Q A;  1XGN A;  4UVA A;  4WX9 A;  5ICC A;  1ZG1 A;  1HQC A;  1WWX A;  5J6X A;  2R3S A;  2K4J A;  4UUV A;  2IA0 A;  4Q4Z F;  3U2R A;  5BS6 A;  1LVA A;  4I02 A;  2MA3 A;  4HX4 A;  1KGS A;  3EUH A;  4A6E A;  1BI2 A;  3CUQ A;  3HSF A;  4Q47 A;  2DK5 A;  1T6S A;  2H27 A;  4XLP F;  2D1H A;  2PLY A;  4O3M A;  3O3K A;  3ZMU A;  1L3L A;  1O57 A;  4UHT A;  2JZY A;  2CSO A;  4A5M A;  4GXO A;  4CZZ A;  4D0P A;  2FXA A;  3BY6 A;  2RN7 A;  2O6G E;  2MC3 A;  3RJP A;  4EMS A;  1ZAO A;  3ZMS A;  1BC8 C;  2PFB A;  3KEQ A;  3WTU C;  1OPC A;  5CVJ A;  1G3S A;  1K78 A;  1QPM A;  5JFR A;  1PP7 U;  3EYY A;  5JVT A;  2VT2 A;  2E1C A;  3QRF F;  3P9K A;  1W5S A;  2V79 A;  2XAQ A;  3I64 A;  3SXY A;  1K7A A;  2MH2 A;  5D5U B;  4OIQ F;  3WTY C;  3RIR A;  3ABU A;  3QAH A;  3WG9 A;  1GVJ A;  3WTT C;  5L3C A;  3HUG A;  3GF2 A;  3E5X A;  4IRG A;  3RPU A;  4A2U A;  1TTY A;  2VBX A;  4I7H A;  1BI1 A;  2EJR A;  5K5Q A;  3JAM K;  2FOK A;  3EYI A;  1FC3 A;  2Y48 A;  4Q5S F;  5F64 A;  5A2Q K;  5HDN A;  3BJO A;  1REP C;  3MWM A;  2E7X A;  3BOQ A;  4OMY A;  4HLY A;  4P55 A;  2R7D A;  1TQP A;  1UB9 A;  4EVI A;  2JPC A;  2QLZ A;  2OBP A;  4S04 A;  2DPU A;  3WU0 A;  5KVR A;  3T1B A; 
#chains in the Genus database with same CATH topology
 1HDP A;  1HC8 A;  2Y9Y A;  1OIS A;  3HIF A;  5LBQ A;  1FNN A;  2XVC A;  3WHB A;  3DQV C;  4BBR J;  1MSF C;  3D5R C;  1PDN C;  4LIU A;  1STZ A;  3M3Y J;  3FXO A;  1IXR C;  3BTI A;  4XIC A;  2IT0 A;  2QEN A;  5E1X A;  1E3O C;  1RES A;  4ZZL A;  2HEO A;  1F9N A;  3C7J A;  4IPA A;  3O2P E;  1MBH A;  3N97 A;  3DBH B;  4V2G A;  1IN5 A;  1FX7 A;  1FLI A;  2JRM A;  2MBF A;  1ETV A;  3V42 A;  2KRH A;  4LK0 F;  3VOE A;  4C3J J;  4R79 A;  3QYF A;  2TCT A;  4WXC A;  5BPD A;  2X1C A;  1ZQ3 P;  3W2A A;  4FIS A;  3TW7 A;  3A1Y A;  1X3W B;  5KCM A;  2UXX A;  5KNL A;  5M3F J;  3CUO A;  3GX4 X;  1TL8 A;  3MKL A;  3M1C A;  5GPA A;  1W7P B;  1Z7L A;  2XDV A;  4XM3 A;  3BWG A;  2STT A;  3I4P A;  3C2H A;  2F4O B;  2H09 A;  4YII A;  1WH7 A;  5EDN A;  2JSC A;  1G3T A;  4P1W A;  5LLQ A;  2LR8 A;  3MVP A;  5F04 A;  3LSH A;  2LNB A;  2OCE A;  2ZCW A;  5D5X B;  3OS2 A;  3BQZ A;  1JUS A;  5H2F C;  2VAS A;  4RGX A;  1TWG J;  5HNF A;  2M1B A;  1SAX A;  2KJB A;  2GQQ A;  4M6X A;  2F5E A;  3M1E A;  5FKL A;  3WTW C;  3MMY B;  2RKH A;  3A0H C;  2FF4 A;  1P2F A;  3ZMV A;  4UUS A;  3L2Q A;  4BXF A;  2CW8 A;  3U9G A;  3OSG A;  2HTS A;  3GZ5 A;  1U0J A;  4EJW A;  4E7I A;  4D9J A;  3WGI A;  2MD0 A;  4BYY A;  3OYM A;  4GO1 A;  4R1H A;  5EZG A;  1MH3 A;  1IN8 A;  3FM5 A;  5F0H A;  4UNO A;  1I39 A;  5FJ8 J;  1CGP A;  2LG4 A;  1XS9 A;  4L9N A;  2M8E A;  4BE2 A;  2CH0 A;  1FPQ A;  2VJ5 A;  1A31 A;  1BJA A;  1OMI A;  2RNJ A;  2FRH A;  2QWW A;  3KP6 A;  3CF5 F;  4HNV A;  5H20 A;  2L7K A;  1Z91 A;  1ZGJ A;  3WOD F;  2LLK A;  1D1C A;  3GO5 A;  1TC3 C;  3IHU A;  3TMO A;  2EIN H;  4Y33 A;  1OJL A;  1JUP A;  2ACJ A;  3B6C A;  4U88 A;  2KPM A;  2CQQ A;  1ZTR A;  3DBL B;  1IUF A;  1QGP A;  5ERI A;  4CCN A;  1LFP A;  3SEZ A;  2WAE A;  4F92 B;  3T5X A;  1VTN C;  1XC5 A;  5GPC A;  1I1S A;  5TRD A;  3QYE A;  3DP7 A;  2UUZ A;  3LSK A;  4L5I A;  3JRI A;  1ERD A;  3F0C A;  1UHW A;  3BTJ A;  3OV8 A;  4KA4 A;  1U5T A;  4NQW A;  3OS1 A;  1ZLK A;  1YQA A;  4Y7N J;  3Q9V A;  3IAS 2;  2MSY A;  4BY7 J;  5GTH C;  1SAU A;  2X9D A;  2HKX A;  3IAM 2;  2Y30 A;  1ETK A;  1YE9 A;  2DT5 A;  2ZSH B;  2YX4 A;  3GLL A;  3IWZ A;  2BZT A;  3OIQ A;  2Y9Z A;  1I6H J;  2EB7 A;  4Y52 J;  3Q0W A;  5GAE J;  1JTX A;  3NWS A;  3HOY J;  4V19 K;  1QNT A;  4ESJ A;  1TZL A;  2FX0 A;  1WQ2 A;  3I71 A;  3MFK A;  1MMG A;  1L0O C;  3L1P A;  4IOC F;  3ABK H;  3MZ8 A;  2LD5 A;  2DN0 A;  1LDK B;  2LKS A;  4FX4 A;  4YEJ A;  1MJB A;  2HGC A;  4E7L A;  2DA2 A;  4ZYE A;  2P6S A;  3GLX A;  3S8P A;  2QYO A;  1HKQ A;  4B48 A;  2L9N A;  1JGG A;  3KIO A;  3RQI A;  1KA8 A;  2DAO A;  2KIF A;  4PJ0 C;  2Z99 A;  2L9S A;  3TO6 A;  1ETO A;  1BN5 A;  4QSH A;  3K6G A;  2O0Y A;  2XAF A;  2FNP A;  3DEW A;  2W84 A;  3W6J B;  3E6M A;  1Z6R A;  2YUS A;  3HOT A;  3K0L A;  4HDV A;  1YW9 A;  1G6N A;  2M34 A;  5LGU A;  4BEH A;  4JBA A;  2QM3 A;  3CDH A;  2DBB A;  4YFX F;  5E8I A;  3MN2 A;  5CQE A;  3SZT A;  2FQ3 A;  1JUM A;  1OKR A;  5CVU A;  1R1T A;  3QU3 A;  4I09 A;  2ME6 A;  3I0T A;  1TLH B;  3SFZ A;  1MDM A;  2LMD A;  1TQM A;  1OCR H;  3HZJ A;  3RDI A;  4HQE A;  5CJ9 A;  1B59 A;  4FTH A;  1Y6I A;  2WY8 Q;  3OYE A;  3FZV A;  3PFI A;  3IH4 A;  3AG2 H;  3BR3 A;  3QPT A;  2R7V A;  4CCM A;  1FOW A;  2R7X A;  2QKL B;  1KU3 A;  2DFI A;  2L9R A;  3BRO A;  3VSK A;  3K7A J;  4JK1 X;  2VIX A;  4IQ4 A;  5CVR A;  2HDC A;  5L3E A;  4D1Q A;  3GUD A;  2DPD A;  4M3G A;  3SHF A;  3RPU D;  2QZ8 A;  1ZRC A;  2BVL A;  3PIO F;  4P9F A;  1IXS B;  1H8A C;  2HYF A;  1AKH B;  4AVP A;  2MD5 A;  4GCV A;  5E79 C;  2BW3 A;  1QPI A;  1IN4 A;  1F36 A;  3QPH A;  4D5F A;  1B72 A;  5EYR A;  4N4N B;  3SDG A;  5LRS A;  4DIQ A;  3GYH X;  1CF7 A;  3VEP A;  2F5F A;  2I8D A;  3CP8 A;  4KNY A;  2K86 A;  2RGV A;  4FQG A;  3W2V A;  3CQZ J;  2Z2S B;  3DEE A;  4BAY A;  4HW0 A;  1NK3 P;  4R8H A;  3E3V A;  2KT0 A;  3BR2 A;  5LHH A;  2JQ7 A;  4EAT A;  1FTZ A;  3RKY A;  1W5C C;  4EV0 A;  2DW4 A;  3KFW X;  1WVR A;  2ICW G;  3SFI A;  4F93 B;  2QVO A;  2IEK A;  5E3M A;  1O3S A;  4LIT A;  1B8I B;  1OFC X;  2AQE A;  2TDX A;  4BHP A;  3MZH A;  1EA3 A;  2VKV A;  2D1V A;  5L3B A;  4B4C A;  4UVB A;  3C2B A;  3O8G A;  1X1P A;  3DKY A;  1RKT A;  2CW7 A;  3F8F A;  4II2 A;  2CGP A;  1XSV A;  4M9X A;  2CU7 A;  5H6Q A;  2PJP A;  4MGR A;  2VPR A;  1IAW A;  2R7T A;  3FXJ A;  1Z0X A;  3IWF A;  4U0Y A;  1A6Q A;  5E1W A;  1DP7 P;  5D4S A;  5FKO A;  2GLO A;  4XOR A;  3H92 A;  3P5J A;  2FBI A;  1NG6 A;  3JRH A;  4UB6 C;  3U21 A;  2KFD A;  1UG0 A;  2CG4 A;  4K2E A;  4BBS J;  1XGM A;  3WE2 A;  1HOM A;  1Y8Q B;  4PGG A;  3FXQ A;  2WY7 Q;  4A5N A;  5ICF A;  4CDG A;  2R7W A;  2Z33 A;  1WPK A;  3K2Z A;  5DUK A;  3X2Q H;  1DP3 A;  2P0W A;  3AG1 H;  2M4G A;  2M87 A;  1BL0 A;  3CLO A;  4GYI A;  3Q5F A;  2XGE A;  3EQL F;  3IL2 A;  3ZQC A;  4MQV A;  1S29 A;  4F3Q A;  1MMS A;  1LVK A;  1ZRD A;  2AQF A;  1XMA A;  3L00 A;  1FIA A;  3HPG A;  4CGZ A;  3BPV A;  2EIK H;  4RAZ A;  1X1A A;  4MHG A;  2STW A;  3K9T A;  1TBX A;  3PO2 J;  3LMM A;  2BY1 A;  2IGM A;  2IGN A;  3QP6 A;  3PUF A;  2R5Z A;  2PG4 A;  3WGH A;  3DTE A;  3DXJ F;  1VQ9 I;  1Y56 A;  3E6C C;  3IV5 A;  2CUF A;  4AYB A;  3S2D J;  4Z6Y A;  2IBD A;  1ZR2 A;  3FXR A;  1S3J A;  1S6L A;  4EEF G;  1ZN2 A;  1R22 A;  2NYX A;  2DJI A;  2RRE A;  1ETQ A;  3CCE I;  4IHX A;  2VN2 A;  3JCU C;  2F5V A;  4G6Q A;  1VQL I;  2HVR A;  3RZO J;  2VL8 A;  4DYC A;  4A6D A;  4XRS A;  2A6H F;  2NRA C;  5EGO B;  2PEX A;  4CO8 A;  3HHH A;  3WTS C;  1D0Y A;  5LD2 C;  2QBY B;  1QZE A;  2K9L A;  1D0Z A;  3F21 A;  2PJR A;  3JRE A;  1AA7 A;  5E3O A;  4W1U A;  1KU9 A;  4M3D A;  1G8X A;  1MGT A;  4F7Z A;  4C3H J;  2IJL A;  5KAI C;  1XG1 A;  3LA3 A;  3K10 A;  3L2U A;  3W2W A;  1X4O A;  3FIS A;  1JI8 A;  3GXO A;  1DU6 A;  5DM7 F;  2XF5 A;  5DEQ A;  3BP8 A;  4LG0 B;  1MMA A;  3IKV A;  2X4H A;  3OR1 C;  4UV9 A;  1KQ8 A;  1R7J A;  1MD0 A;  1R5H A;  4KUM A;  1WJB A;  1E0E A;  2CW0 F;  1R23 A;  1T0F C;  5F1R A;  2HQR A;  2IGK A;  1ITY A;  1G2H A;  5DD4 A;  1J0R A;  1FEX A;  1IG7 A;  2XAG A;  1SMY F;  2EQR A;  3BC8 A;  5DCM B;  4ETS A;  5FFX A;  1WH5 A;  2ECC A;  2CFO A;  5J47 A;  1OCT C;  1UFM A;  1RPW A;  3RPQ A;  4DNC A;  3S93 A;  2GXB A;  3FIW A;  4U0W A;  3K70 D;  1Z3X A;  5LGN A;  2LVS A;  2OV7 A;  4HAM A;  2VON A;  3A02 A;  1JGS A;  3J7Y J;  2RQQ A;  3TP0 A;  5K5O A;  3CCV I;  4HF2 A;  3F72 A;  3OR2 C;  3OL4 A;  4ZJZ A;  2IS6 A;  4RB1 A;  1FTT A;  2AO9 A;  3PQK A;  5K7Z A;  2XF6 A;  1ACI A;  2CQK A;  3TL4 X;  5J4V A;  2WAD A;  1F4K A;  3GTP J;  1WJE A;  2M7A A;  3I53 A;  3LFU A;  5EJC A;  3E5Q A;  3FXL A;  2VOD A;  3FMR A;  2E1N A;  3S3N A;  3JAM Z;  4HG2 A;  1BI3 A;  4HA8 A;  2ZME A;  1BBY A;  4DZJ A;  2PQ8 A;  1S9H A;  2V6E A;  3KEO A;  3GTK J;  5J3L A;  1XD7 A;  1UST A;  5EEH A;  3I5U A;  1ZGA A;  3F8N A;  1GT0 C;  4LMY A;  2K9S A;  2LBF B;  2M30 A;  1ONV A;  3N4M A;  3ZMZ A;  2G7U A;  1UG2 A;  1U3E M;  3HJE A;  2H94 A;  4J00 A;  1N78 A;  5FRO A;  3KPH A;  3GTL J;  2DFE A;  5FRM A;  4RLQ A;  2QEX I;  5IT3 A;  2P7V B;  2NAZ A;  1LDJ A;  3FKJ A;  4OAZ A;  4PDK A;  4HLX A;  4CCL A;  4BU2 A;  2GIZ A;  1JKP C;  4QIW N;  1WGX A;  3LA2 A;  1Y1V J;  3ASN H;  4BGD A;  2K27 A;  2L4A A;  1AOY A;  2MLK A;  1YS7 A;  1FBQ A;  5D6F A;  1MMN A;  1I1G A;  3FBN B;  2JUC A;  2YX7 A;  2HR3 A;  4V2F A;  3H3U A;  3IP4 B;  1KU2 A;  5TIS C;  1YRN A;  4WXH A;  3BR1 A;  4OAY A;  4JP0 A;  1VQ6 I;  2E19 A;  4M74 A;  2GXG A;  2JTV A;  2JA8 J;  2OQR A;  3NEU A;  4XRM A;  2Z5U A;  1LFB A;  2ZFU A;  3DFG A;  4HV6 A;  3ISP A;  2DT6 A;  2HOT A;  1VQK I;  1U2W A;  3B02 A;  3JRC A;  2L7M P;  4L9T A;  4QLC U;  2VLA A;  3LSJ A;  2DDB A;  5LRR A;  3HOS A;  2PX9 A;  1KYW A;  3ECH A;  4FAS D;  4KT6 A;  3I54 A;  4M9S A;  5LFA A;  1VQ4 I;  3B73 A;  4XOP A;  3LOC A;  2IGO A;  1HW2 A;  3QP5 A;  3CJT B;  1LJ9 A;  3QYB A;  3LST A;  2A6T A;  2ZNY A;  2AHQ A;  3CC4 I;  4YG2 F;  1QQI A;  2K9Q A;  4XON A;  2XC7 A;  1TT5 B;  2A05 A;  1OCZ H;  1Z6T A;  3WGG A;  4B43 A;  2VKD A;  1S5L C;  4BQN A;  3HDD A;  2CQN A;  2ZO4 A;  2FE3 A;  3V7R A;  2P5L C;  2PI0 A;  1KQ9 A;  1VQM I;  2BYV E;  2CV2 A;  2L2O A;  3GBG A;  1IV8 A;  3PJR A;  2D45 A;  5E3N A;  2CV1 A;  3DU5 A;  4Y13 A;  3EDP A;  4RAF A;  2YU3 A;  4Y15 A;  2O61 A;  4CSW A;  1ZKG A;  2XGC A;  3L09 A;  2R5Y A;  2YPR A;  2UWM A;  2P5K A;  2XPV A;  5DUI A;  1RI7 A;  4IHT A;  2DCE A;  2GAU A;  1RUO A;  4M6V A;  3FF5 A;  2CJJ A;  2NVY J;  2ZXJ A;  2F6C A;  1XMX A;  2R0Q C;  3BG7 A;  5GP9 A;  1P4W A;  3DTI A;  5L3G A;  3RTR A;  1ETX A;  4I99 C;  3HOX J;  3PSI A;  3VOD A;  2BY0 A;  1JHF A;  2UZK A;  3NAR A;  4RMN A;  4A3J J;  1MNE A;  2Q2E A;  5EG0 A;  4MTD A;  1YTY A;  1HSJ A;  2EFW A;  2XRO A;  3FMQ A;  5M3M J;  3JRF A;  3DTK A;  3M7G A;  2GA1 A;  4NC7 A;  1BM9 A;  2W00 A;  5DV5 A;  2NVQ J;  1AHD P;  4BDY A;  1S7A A;  1WKM A;  5HOD A;  4XKB A;  1BIB A;  1DPU A;  1ZRF A;  4L5J A;  3KZI C;  1ZG5 A;  1R58 A;  3PQJ A;  5FKN A;  5HDK A;  2IS2 A;  1ULY A;  3CCR I;  4XLA A;  1U8B A;  3F3X A;  3GFI A;  3RI4 A;  5LHI A;  1E2X A;  2DDA A;  1UAA A;  1FT9 A;  2FQ4 A;  5GTI C;  2R7U A;  3F23 A;  1IGN A;  2HPI A;  1EKE A;  3FHN A;  3S2W A;  1P7I A;  1VQ5 I;  4HYE A;  3T0Y A;  4HSR A;  4CHU A;  2HQA A;  1OR7 C;  3REO A;  4A3C J;  3TO9 A;  3CF2 A;  2ZB9 A;  2MW8 A;  1IN6 A;  4EM1 A;  1RIO H;  3LQQ A;  3GZ6 A;  1HCR A;  2IVM A;  3TOA A;  2DA1 A;  5B3S H;  3MZY A;  2O7O A;  4N9H A;  2JT1 A;  1R6R A;  2V7F A;  3O8H A;  1JHH A;  2KIM A;  2VT3 A;  4AWX B;  3CCJ I;  2KDO A;  3KP2 A;  2CO5 A;  1K79 A;  5JLW A;  3ROU A;  5LEJ A;  3I59 A;  3FWE A;  2ID6 A;  1K4S A;  4HV5 A;  2M9H A;  2M45 A;  1DPR A;  4IO9 F;  4II3 A;  2EZL A;  4OWR B;  1RR8 C;  2FMY A;  1JTY A;  2B7E A;  4CIC A;  2M7B A;  5BMZ A;  2BXZ A;  4GRI A;  2E35 A;  3EET A;  5AIP A;  2Y75 A;  4YEL A;  4M3F A;  2DU9 A;  2VC1 A;  1SD6 A;  2ESN A;  2PMH A;  3R0A A;  1MIJ A;  3E6B A;  1GHC A;  4KMF A;  2A5Y B;  3PM1 A;  3G6E I;  3FX3 A;  5EEG A;  1SVO A;  2GOM A;  3F8B A;  1X1B A;  4NHJ A;  4GDF A;  1FYM A;  1TWF J;  2Z3Y A;  3ML6 A;  2OUM A;  3H3Z A;  4Y17 A;  1E17 A;  1XGO A;  3DF8 A;  4MTE A;  1JKO C;  1PVE A;  1NTC A;  4XSZ F;  1YJW I;  1DDN A;  2XV4 S;  2FA5 A;  3G71 I;  1Q1V A;  2LF7 A;  1YIJ I;  2GZW A;  1BA5 A;  1UEL B;  1SD7 A;  2KIU A;  1MZB A;  3FMS A;  5FLX Z;  4ZYD A;  3OYH A;  3J7A O;  4ENJ A;  1ZAR A;  1WJA A;  2O03 A;  2ZJ2 A;  4A0Z A;  1R4N B;  1D3Y A;  3SYT A;  5FO5 A;  3FK7 A;  4LK1 F;  3M07 A;  5E8G A;  5HLH A;  3H5A A;  3F8M A;  1PUF B;  4PJJ A;  1XCB A;  4WWC A;  2LRD A;  4XQF A;  2QQ9 A;  2QSH X;  2ELJ A;  1IV6 A;  1Z21 A;  4CYC A;  3H9G A;  3BR0 A;  1FYL A;  1OYW A;  1R49 A;  4AYB N;  4EJT A;  2EZI A;  2ZJR F;  3CCL I;  4ABZ A;  3ZMT A;  2COB A;  1MJ9 A;  1Z7U A;  3WE3 A;  1G59 A;  2E1O A;  1N77 A;  3K69 A;  1IC8 A;  4G94 A;  2R7Q A;  1Y1W J;  1LQ1 A;  2X6W A;  1SFU A;  1T39 A;  2F48 A;  3K4N A;  1Z9C A;  4FX0 A;  3IC7 A;  3NAU A;  2NOG A;  2VI6 A;  3ECO A;  1FBU A;  3D5L A;  2H1K A;  2QQB A;  2VE8 A;  3VYU B;  2JUG A;  3DU6 A;  2P81 A;  3NRV A;  4FET A;  3UR3 C;  2G7H A;  4XN0 A;  4A69 C;  1H9G A;  2V6C A;  1GV2 A;  3C18 A;  2EFO A;  4IRI A;  4ZDP A;  4WXD A;  4RAY A;  2O3F A;  2HVS A;  5E17 F;  2VJ4 A;  2XSJ C;  3GFL A;  1VQP I;  4M71 A;  2YS9 A;  4M73 A;  4E7H A;  2EV6 A;  3E97 A;  5M5Y J;  4ENN A;  3S3M A;  4I98 B;  4Q48 A;  1PJR A;  3ONQ A;  3BZC A;  2L54 A;  3UNG C;  5JVG F;  2W24 A;  2K5C A;  4HBL A;  2X85 A;  3FXM A;  4I76 A;  2G9W A;  4L9V A;  3ZQQ A;  4G9Y A;  2WAF A;  3K4C A;  2WWY A;  4J19 A;  3VWB A;  4DBQ A;  4N4O B;  2XAU A;  1NH3 A;  3HTU A;  2VBY A;  2VE9 A;  2RAE A;  5GAG J;  3CES A;  3S16 J;  4RA2 A;  3HHG A;  4LB5 A;  4ZC3 A;  5IP9 J;  3DPU A;  1RRJ A;  1GDT A;  5EF6 A;  4G7H F;  1D0X A;  1YIT I;  1V5F A;  2EIL H;  3N05 A;  1UHM A;  3LAP A;  2DK8 A;  2OPT A;  2P5V A;  5IT9 K;  3LSG A;  2A6E F;  4YIR X;  4E4H A;  3HG9 A;  4X6A J;  2VJI A;  3G73 A;  2EH3 A;  1NG7 A;  4KIT B;  1V55 H;  4B1R A;  1T08 B;  4PJM A;  3BDD A;  3BJA A;  4AID A;  1RKW A;  2QCO A;  2G0E A;  3CUQ B;  1IZ1 A;  3LQR A;  4JQF A;  4BKX A;  1ZYR F;  1V54 H;  2KL4 A;  1B9N A;  2QKM B;  3FBI B;  4CA0 A;  4G7Z F;  2V26 A;  3CC7 I;  3HBL A;  2JVH A;  4F52 A;  1TP4 A;  2IXS A;  1J9I A;  5AON A;  1I27 A;  3PNV A;  5K7H A;  1K6O A;  5IY5 H;  1AWC A;  1QO0 D;  5D5W B;  3ELK A;  2EK5 A;  5ILU A;  4HX7 A;  2DMQ A;  4JX6 A;  2KKO A;  5TJJ A;  3UKG A;  1S7O A;  1S7E A;  3FKI J;  2BGC A;  5JR3 A;  1EJ9 A;  1IDY A;  1P6R A;  3OOP A;  4OIR F;  1P7J A;  5C44 J;  2F4I A;  2MYS A;  4HOB A;  4D5C A;  5ILV A;  4JX4 A;  1ON1 A;  3KP4 A;  1D1B A;  2AXL A;  3PUB A;  2HS5 A;  1IRX A;  5EZH A;  4OIP F;  2ISY A;  3JTH A;  2DTR A;  3A0B C;  4CCO A;  1SEU A;  4BQO A;  2OAZ A;  1T2K A;  1IJW C;  2FEZ A;  3F6V A;  2LY9 A;  3CCU I;  4DGW B;  1OLT A;  3IKT A;  1LE8 B;  1G4D A;  2VXZ A;  5F08 A;  2X1D A;  3ZQI A;  1B9M A;  4MFE A;  3WU2 C;  2ISZ A;  1FMV A;  3OY9 A;  2Q1Z B;  4BXU A;  4A3M J;  3G1L A;  2OD5 A;  4F91 B;  1K78 B;  1DUX C;  1WCM J;  3J81 K;  4L9J A;  2V1N A;  3M8F A;  5KK1 A;  2ID3 A;  5D5V B;  2FUG 2;  1FBS A;  3JRG A;  5HLG A;  3BPX A;  4PSX A;  3GME A;  2K7L A;  4XLF A;  3CO6 C;  4PK4 A;  2W25 A;  4A3E J;  4L5E A;  1I3Q J;  1V3F A;  2CYY A;  3ZQG A;  5CLS A;  4YFN F;  3V7S A;  4KDP A;  3A01 A;  1LEB A;  2DXI A;  2PBI A;  4O5V A;  2KJC A;  2KMU A;  2F2E A;  4XRS G;  2DFF A;  2WB1 A;  5ICE A;  1T0F A;  2DOE A;  3E5U A;  1H9T A;  2E2J J;  2HXI A;  1VFC A;  3RKW A;  5B5E C;  4XRF A;  2PN6 A;  3HXL A;  3K70 C;  4M6Y A;  1QBJ A;  4O6J A;  4BY1 J;  5FKK A;  4HST A;  3IRQ A;  4IXA A;  2L0K A;  2K9M A;  4LLL A;  3HUG B;  2P7C B;  2DO7 A;  2EFP A;  2ZNZ A;  1Z3Y A;  1VF9 A;  4KMU X;  5L3F A;  4A0Y A;  2FBK A;  2NVU B;  1J59 A;  1F5T A;  4XN3 A;  2Y2Z A;  3C1D A;  3SDB A;  2MFZ A;  3WTX C;  2F5D A;  2M4K A;  2ZXW H;  1HW5 A;  5BOX A;  3D1N I;  1YIO A;  3TGN A;  2XRL A;  1RC9 A;  5IYD J;  4BE1 A;  4XLH A;  4PFO A;  4XKW A;  1Y39 A;  2E1M B;  3ZMD A;  2ADU A;  1WRJ A;  2EIJ H;  3G4S I;  3L9F A;  4IKF A;  2JN6 A;  4M3B A;  2GOX B;  4M9Z A;  1K83 J;  1W7P A;  1WSU A;  1YOV B;  4RGR A;  1BC7 C;  1SD4 A;  5FKM A;  4H0E A;  3BJ6 A;  2E60 A;  3I9V 2;  4GFB A;  2WA0 A;  2GIV A;  4RM3 A;  2DLL A;  3JW4 A;  1O7F A;  3GCM A;  2HZT A;  2KZV A;  4YIF A;  2E71 A;  3KYD B;  2FNA A;  3KZY A;  2ELK A;  4HEA 2;  3SQN A;  2UV1 A;  1USS A;  4LD5 A;  4CYD A;  1E3H A;  3VYR B;  1YHQ I;  5K7F A;  1D1A A;  3M9A A;  4M72 A;  1UCR A;  3S32 A;  2JVG A;  3H1C A;  3HPH A;  2V9V A;  3E6D A;  2ZSI B;  2RNG A;  3MAJ A;  2ZJP F;  5C4X J;  4IL6 C;  2MC4 A;  2X1E A;  4HDU A;  3RYP A;  1IXC A;  4U0V A;  2LOO A;  2M0C A;  2HQ5 A;  1OCC H;  5D8K B;  3CMA I;  2IRF G;  4B8X A;  3DKW A;  1JXS A;  2HU9 A;  1LNW A;  3V8L A;  5GAH J;  3RYR A;  2OZU A;  4B3X A;  1FP2 A;  3OYL A;  1WJD A;  3RKX A;  1JT0 A;  2NS0 A;  2BY3 A;  1I3A A;  4KIS A;  2CS3 A;  2F5C A;  2VBW A;  4KFC A;  5J8F A;  4L0Y B;  1EH6 A;  2HOE A;  2E2H J;  2LF8 A;  2ELH A;  3C3W A;  1U78 A;  1W4M A;  2JJ7 A;  1F43 A;  3GFM A;  1SC7 A;  1V4R A;  4Z2Y A;  4DJA A;  5E3L A;  4QPO A;  3H35 A;  5D8L B;  5HLT A;  1FP1 D;  3ABT A;  4F55 A;  3MKY B;  4HRI A;  2KDZ A;  4XKC A;  2ESH A;  4IHS A;  4EJO A;  3GW2 A;  3TP3 A;  5FLM J;  4U87 A;  1SAN A;  2CRG A;  1FZP B;  4UUS B;  1O7L A;  4KT5 C;  3RQ4 A;  3G1M A;  2VOO A;  2DT7 B;  2L02 A;  1D8J A;  2V4J C;  1Y0U A;  3FM3 A;  3ZQH A;  3AG4 H;  4DYQ A;  4A3F J;  3KP7 A;  2EZH A;  3QQA A;  1U9O A;  1M1E B;  2WAQ A;  2DQR A;  4UVC A;  2K9N A;  1YJN I;  1JE8 A;  4RGS A;  1DGW Y;  4XR6 A;  3HTS B;  4EQQ A;  1P4A A;  5ED4 A;  1J7K A;  2LDU A;  1S8N A;  2M2E A;  3VPR A;  1UJ8 A;  4DQ2 A;  3CMM A;  2J5O A;  1VND A;  2Y0S A;  1VQ7 I;  3KLN A;  1T56 A;  2V9K A;  4EM0 B;  2VQG A;  2XGX A;  5CKT A;  2XF7 A;  4BL0 B;  5HOO A;  4NBQ A;  1VZ0 A;  2L7F P;  1BR2 A;  2YR2 A;  5LHG A;  5AIQ A;  4XID A;  3OYJ A;  4G12 A;  5A2Q Z;  1R9T J;  3R60 A;  3TED A;  2PMU A;  1W1W E;  3BCA A;  3LSI A;  5JHU A;  3VB2 A;  1J09 A;  4A0X A;  1VQO I;  3BR6 A;  3HGY A;  4PCQ A;  1HF0 A;  1T38 A;  2FD5 A;  2WTE A;  2K4B A;  4A93 J;  3ZPL A;  2KLO A;  1EV7 A;  1A6I A;  4NUB A;  4DBR A;  4ZYH A;  3CC2 I;  1P92 A;  2QUF A;  5L3D A;  3J7A Y;  1BOA A;  2XHK A;  3LWF A;  2Z9O A;  4LGW A;  2ECB A;  2EZK A;  2OQG A;  1Y0N A;  4KN7 X;  2GBY A;  3KET A;  1U5T B;  3A03 A;  5CPR B;  4NQW B;  3VSL A;  4P9U A;  1MNM C;  3E0J B;  2CV0 A;  2RQP A;  1IRZ A;  2FBH A;  9ANT A;  2D2W A;  2LSO A;  1YW8 A;  1ZH5 A;  4YRV A;  4CZC A;  2K3F A;  1SFO J;  4LLN A;  4RS8 A;  2C6Y A;  1A36 A;  1WZ2 A;  3AFH A;  2OTL I;  2L7Z A;  1IW7 F;  2R7O A;  4ENM A;  1YYV A;  2P8T A;  3CDI A;  3FDY A;  4A3L J;  2BV6 A;  1BI0 A;  4BE0 A;  3HM5 A;  4XLN F;  2QGU A;  4AIJ A;  2DMN A;  3QOE A;  4U7B A;  5KHD A;  2IA1 A;  5IP6 A;  4ON0 A;  3P7N A;  1A04 A;  2M8G X;  3K1M A;  4PZJ A;  2H6C A;  2HXO A;  1OR7 A;  3JRA A;  4UUT A;  1PUE E;  4IRH A;  3DBR B;  4X1E A;  5IP7 J;  4A3D J;  1BJZ A;  3DPT A;  2EA2 A;  4UV8 A;  4DW6 A;  1AKH A;  2XB0 X;  2FU4 A;  3HB9 A;  2CQ7 A;  1W5T A;  4XK4 A;  3IH2 A;  1RNL A;  2H1L A;  2R7S A;  3ZOB A;  3S1Q J;  2R7Z J;  2IS1 A;  1YX3 A;  3L2C A;  4BEH B;  1GXQ A;  2OC6 A;  1TW2 A;  2B63 J;  4RB0 A;  2QQA A;  3E7L A;  4M3E A;  2H6B A;  2XGD A;  5J4Y A;  2BHY A;  2E5N A;  1EH7 A;  4I0B A;  1O3T A;  1IRF A;  4KYW A;  4MIM A;  5M5W J;  4BH9 A;  1SD5 A;  2XAS A;  2O9L A;  2Q0O A;  1MDM B;  3OYF A;  2LC2 A;  3JSP A;  2QSG X;  1GLN A;  3ZQ7 A;  3K4L A;  4C3I J;  1HDD C;  3ZXS A;  1EF4 A;  1ON2 A;  4KIC A;  3U1D A;  5D4R A;  1FMW A;  1WJ5 A;  2ZC2 A;  3ZP5 A;  1I6X A;  1B8I A;  2HTJ A;  3M8E A;  3FHZ A;  4ZDL A;  1DGR M;  2B9S A;  4HF0 A;  1X2N A;  1WJC A;  3VYT B;  3CD6 I;  1IUY A;  2BEO A;  2L5Q A;  1FSH A;  5FB2 A;  4EJU A;  1YLF A;  3KCC A;  2E34 A;  4ESB A;  1OCO H;  2DQL A;  1X19 A;  1ZLJ A;  5K1Y A;  1T33 A;  1R1V A;  3P9C A;  3QPS A;  2V9P A;  3K4B A;  5BQT A;  5E18 F;  4IZZ A;  3J80 K;  1Y8R B;  5DS9 A;  2COM A;  3ASO H;  3K2A A;  3WTZ A;  1B72 B;  2IPQ X;  3GVA A;  1CF7 B;  4I0A A;  1OYI A;  2QF7 A;  1K4T A;  4ZZD A;  1ZEL A;  3AL0 C;  1O3R A;  5ILS A;  2L4M A;  1C0W A;  3LSP A;  1YW7 A;  3BG3 A;  2DOD A;  5BPI A;  1XB4 A;  3COA C;  2VQH A;  4AM3 A;  2HOS A;  1BR1 A;  2IP2 A;  1XCV A;  3CTA A;  2VPL A;  3I4N J;  3R4K A;  1W7P D;  5CVI A;  5CYV A;  3AAF A;  3OYK A;  2MAB A;  1YFH A;  1FOX A;  1TT0 A;  2IW5 A;  4IEJ A;  3C2G A;  4E7J A;  4HNT A;  2ZFW A;  2RC4 A;  3EUH C;  1GV5 A;  4ZYG A;  1FOY A;  4QWQ A;  2Y31 A;  3CUQ C;  3ABM H;  3BCB A;  4C9Y A;  3U1K A;  3HRT A;  1GXP A;  2VKE A;  3OL3 A;  3QOD A;  1J2X A;  2O8X A;  2XPU A;  1X3Z B;  3FXU A;  4P5O A;  1KYZ A;  3CJR B;  1W36 D;  3V4G A;  2DMU A;  3ZCO A;  3RZD J;  3ZN1 A;  1QRY A;  5E1Z B;  5HNH A;  1Q1H A;  1FSE A;  5J40 A;  1MKM A;  1MBE A;  4S0H B;  4RBO A;  4B09 A;  1XMK A;  2DA3 A;  2NXN B;  1V5E A;  3F6O A;  3HKZ A;  1TNT A;  5FD5 A;  3S3O A;  2GXA A;  5B66 C;  4ZH4 F;  2AS5 F;  3D0S A;  2H8R A;  4A12 A;  2A07 F;  3T8T A;  2ZBK A;  5FLV A;  2M0M A;  2Y69 H;  3TDZ C;  4RB3 C;  3V8K A;  3BTC A;  3DLA A;  1LFU P;  1LDD A;  3H9J A;  1TNS A;  1IN7 A;  5J1Y A;  2D5V A;  1IF1 A;  4L18 B;  3HOV J;  2BBY A;  5EGO A;  2VQC A;  1X4P A;  3K4M A;  4PJN A;  2N8G A;  4E7K A;  2W57 A;  2M5W A;  1R71 A;  1QVU A;  2QBY A;  4OIO F;  1XGS A;  4DZP A;  3OIP A;  4P96 A;  3K1N A;  1HXD A;  1XDU A;  4OMZ A;  3ABL H;  1U6G A;  3LAJ A;  2WB1 N;  2XAH A;  3HSE A;  3GTO J;  5IT9 Z;  4PUS A;  1QZY A;  4KN4 X;  1TQI A;  2W85 A;  2BHZ A;  1KZH A;  1TWA J;  5J8C A;  1DQU A;  1LPQ A;  1IRG A;  4LG0 A;  2HVQ A;  3EPZ A;  4UB8 C;  3MKZ A;  3BT9 A;  2R5Z B;  4EM2 A;  1NK2 P;  3IUO A;  1ZRE A;  2F4M B;  5F27 A;  3DEU A;  3DLL F;  2K85 A;  2ZKZ A;  1RZ4 A;  1Z05 A;  2NNY A;  2RV8 A;  3KYC B;  5HDG A;  4I2O A;  4S05 A;  1TW3 A;  3KLO A;  2Q8K A;  5DM6 F;  3LNQ A;  2VQL A;  1T98 A;  5DCM A;  3BG6 A;  4CXF A;  2E7W A;  3S1N J;  5IYB J;  2BE5 F;  3A4C A;  3HRS A;  1K6Y A;  3FK6 A;  3NQO A;  4C2U A;  1IO2 A;  3ERM A;  4C2T A;  1K61 A;  3PIP F;  2JA6 J;  1FWZ A;  2L9V A;  2JRT A;  2HWV A;  2WV1 A;  4PSW A;  1FYK A;  1XSX A;  1HKS A;  2PJR B;  4BHB A;  3WU1 B;  3Q9S A;  3FXK A;  1R1U A;  2EFQ A;  3HRU A;  1I50 J;  2OCC H;  5KAF C;  1JKR C;  2LP0 A;  4HNU A;  1Z1D A;  1MBF A;  1J5Y A;  2OA4 A;  2V1U A;  1SFX A;  4AIK A;  2P6T A;  2CWE A;  2GM4 A;  2E1M C;  3F22 A;  1HLV A;  4JX5 A;  3JR9 A;  4TV7 A;  4FHT A;  2HNH A;  3K1P A;  3KZZ A;  3J81 Z;  3KEY A;  2W4S A;  1XDS A;  4WCG A;  1ZR4 A;  2VXD A;  4EJV A;  3ERE D;  2A5W A;  1RET A;  1EH8 A;  3D5S C;  2A69 F;  4ASN A;  3SJM A;  5BNG A;  5F1J A;  2LBF A;  3F8C A;  1SFK A;  4MO7 A;  3WTV C;  2NNN A;  2XUB A;  2X51 A;  2IS4 A;  2K3P A;  3ULQ B;  4IJA A;  3W3C A;  1X2M A;  4FE7 A;  5F0F A;  1LEA A;  2W7N A;  4HF1 A;  2HYJ A;  2Z16 A;  3KP5 A;  2QQ8 A;  4BDZ A;  1XX5 A;  4CUG A;  2NOJ B;  2W48 A;  1JKQ C;  1MMD A;  1KQ0 A;  4EGY A;  1XN7 A;  2OJE D;  4WF2 A;  3RKQ A;  1ETY A;  1Z67 A;  4N0B A;  5IOZ A;  2BVM A;  3KE2 A;  5HS7 A;  1U9N A;  5TGT A;  4RAG A;  3CJQ B;  2RDP A;  3KP3 A;  1WI3 A;  4E6K G;  3K4J A;  2I10 A;  1FOK A;  3GEZ A;  5LEK A;  2ZXH A;  3OYG A;  3SEQ A;  3DKX A;  3BZ6 A;  3TOB A;  2FSW A;  3PO3 J;  1QHG A;  1MH4 A;  1IDZ A;  4AVZ A;  1QZZ A;  4RGU A;  4C30 A;  1NHA A;  1RR7 A;  2P4W A;  3OYB A;  4W97 A;  3JSO A;  1G3W A;  5H6R A;  1E3P A;  1N75 A;  1HBX G;  3RCO A;  4E7S A;  2A3S A;  1B1B A;  2I5U A;  1OYY A;  4XMY A;  2ZME B;  5DCF A;  4I01 A;  1J75 A;  5HVQ C;  3AL0 B;  4N9I A;  4EGZ A;  2OU2 A;  1V5G A;  2R7F A;  4D7N A;  1ZK8 A;  2L3D A;  2X0L A;  4ENK A;  1TWC J;  3H5R A;  3MD2 A;  4YFK F;  2JMW A;  2JA2 A;  4OOI A;  4XBF A;  2QA4 I;  5HLI A;  2X6O A;  2WAQ N;  2M3A A;  5JI6 A;  1GUU A;  2EV5 A;  2HKO A;  3CME I;  5CVV A;  5CQG A;  4IHW A;  4BAC A;  4A3G J;  2R4G A;  3PFY A;  4CCJ A;  4KIF A;  5HS9 A;  4QPQ A;  3TDU C;  2Y0S N;  5IPA A;  2AXT C;  1BR4 A;  3H9Q A;  3QU6 A;  2R93 J;  4G7O F;  2X6X A;  4ZDO A;  3EUA A;  1YI2 I;  5FRN A;  3CCQ I;  4JOM A;  4XL9 A;  1MBJ A;  3GFJ A;  4ESF A;  2O8K A;  3QOP A;  1YO5 C;  4BNC A;  3P9I A;  4ANJ A;  2R92 J;  5GAD J;  2YU9 J;  4LB6 B;  4KIG A;  2JPB A;  4E70 A;  1YRN B;  2DA4 A;  2KRC A;  1PP8 F;  5DDG A;  2NVX J;  3GTM J;  2UXN A;  3W6V A;  2PMZ A;  1HA8 A;  1OQY A;  3T8R A;  1MND A;  3TO7 A;  2IA2 A;  2EPF A;  2MH9 A;  4Y4R A;  1FJL A;  3M4O J;  1B4A A;  2YSR A;  4IVN A;  3JRD A;  2LKX A;  3CO7 C;  4XSX F;  3ZQL A;  5K5R A;  4MLO A;  4A3K J;  4BQA A;  5FGM A;  4BUP A;  2LYC A;  4C2M J;  4LLG F;  5FLX K;  3W6K B;  4PJL A;  3ZN0 A;  4U7D A;  1XPX A;  1YG2 A;  3L7W A;  2JK3 A;  4FE4 A;  4UXN A;  2XPW A;  1TWH J;  2KP6 A;  4GYG A;  4LFU A;  4MEX F;  2XSD C;  4AIH A;  2GWR A;  1ETW A;  2XKO A;  1BW5 A;  3TQN A;  2FOW A;  3HRM A;  5FD6 A;  6PAX A;  2CFX A;  3CLQ A;  1QHH D;  4MFD A;  1U5T C;  4OIN F;  1LUJ B;  2H8W A;  2L01 A;  1KON A;  3MQ0 A;  2EBI A;  2KHM A;  1YJ9 I;  2X48 A;  5ICG A;  4HPQ A;  1ZG3 A;  3DV8 A;  2VJJ A;  2HQN A;  2LY1 A;  1T95 A;  3GZN B;  1WHU A;  4NC8 A;  1VI0 A;  3R0J A;  4ZTF A;  1F1Z A;  1I5Z A;  1UMQ A;  4LIV A;  1HKT A;  1VQN I;  4DOZ A;  2XKP A;  2JSP A;  2DMT A;  4NC6 A;  2BXY A;  4KIB A;  4HQM A;  2LKP A;  3WHC A;  2R5Y B;  3HGG A;  5DTD A;  3VDX A;  3BG9 A;  2DA7 A;  2HFH A;  2VB6 A;  2OF7 A;  1SMT A;  5M5X J;  1WI9 A;  4XLC A;  3CZ6 A;  3Q3S A;  4AU7 A;  2V1X A;  1D5V A;  5FFZ A;  1RUN A;  3BTL A;  2NS7 A;  3I58 A;  1HW1 A;  2E36 A;  3DPL C;  3S1R J;  1HST A;  2Q2E B;  5EG0 B;  1KU7 A;  4BQQ A;  1X1D A;  2CQX A;  5F0C A;  1MJA A;  1OCP A;  1BIA A;  4XOT A;  1GVD A;  1T8I A;  2VOP A;  3OMY A;  2DMP A;  4A3B J;  2VBZ A;  2WC2 A;  1QA6 A;  3TKY A;  4BHC A;  3GTG J;  4OU0 A;  3QPL A;  2FML A;  1FIP A;  2A68 F;  1P4X A;  4ZTJ A;  1ODD A;  1ZHF A;  4BJT A;  4WK8 F;  1QU3 A;  4MQ9 F;  2DI3 A;  3R61 A;  5J1U A;  2CUE A;  3BG5 A;  4IHV A;  3NWT A;  2EWN A;  2DA6 A;  1D5Y A;  2K02 A;  1MW7 A;  1QVT A;  2Y0M A;  2J5P A;  2EA4 A;  2EFN A;  2KRF A;  3HEF A;  4L0Z B;  1O4X A;  3S1M J;  3BQY A;  3MEX A;  4FT8 A;  1U8R A;  1R5G A;  3OWT A;  3S15 J;  1POG A;  1R36 A;  1G3Y A;  3HSR A;  4D7M A;  2BOL A;  4BJ5 C;  4MNU A;  3OYI A;  2MG4 A;  2LH9 A;  2CUZ A;  3VFZ A;  1LB2 A;  2OZ6 A;  2HYG D;  1JT6 A;  3GTJ J;  2HDD A;  2IAI A;  2VUM J;  1R00 A;  3AKZ A;  5C3E J;  3V8J A;  1A35 A;  1VQ8 I;  3R6S A;  3LFK A;  3ESW B;  5J1R A;  2WV0 A;  2CUJ A;  3I59 B;  3JTG A;  4HZF A;  1PUF A;  3SZG A;  2ZJQ F;  3BZK A;  3I3L A;  2XRN A;  4AD9 A;  1YS6 A;  4LG3 A;  2VC0 A;  2KZG A;  4LJZ F;  3CDL A;  4MEY F;  4E7Z A;  5EEA A;  2QSF X;  1SVL A;  2RVC A;  3HKZ N;  4X0G A;  1W0U A;  4NDL A;  2XAJ A;  4DYR A;  1MBG A;  3I55 I;  3ZR8 X;  3MKW B;  5LGT A;  3CP2 A;  3A2K A;  3OYD A;  1B6A A;  2ETH A;  3HYI A;  4G8X A;  1H89 C;  2NVT J;  3H5N A;  5E20 A;  4NB5 A;  1WFX A;  2GA2 A;  3M8J A;  4IF4 A;  4PGH A;  3CJN A;  3OOU A;  1X1C A;  5DYM A;  5HS8 A;  3MCZ A;  3TW6 A;  3SZP A;  2W1O A;  2MLG A;  5B1A H;  2DJN A;  3O6B B;  2NS8 A;  3IH3 A;  2KIS A;  2A61 A;  3ZGK A;  2R7R A;  3V7C A;  2K40 A;  3LSR A;  2LK2 A;  2MGQ A;  2HI3 A;  2V1D A;  3J80 Z;  2B0L A;  4GGG A;  1FY7 A;  2HPM A;  4G6D A;  3G1O A;  1PYV A;  2ZXI A;  4NNJ A;  1UHS A;  3CCM I;  1SVM A;  3J7Z I;  1X3U A;  3IRR A;  1XSD A;  3H0G J;  2XIG A;  4BS9 A;  3GWZ A;  4QTR A;  3LA7 A;  4CYC B;  1LKX A;  3OYC A;  4AC0 A;  3HC7 A;  1CQT A;  2TRT A;  1SFE A;  1H0M A;  5DD8 A;  4PFP A;  2E2I J;  2BY2 A;  3K4K A;  3Q0V A;  3G3Z A;  5B1B H;  4RB2 C;  5D6E A;  4RDU A;  5IYC J;  1D8K A;  2EV0 A;  5F6F A;  4HX8 A;  1O3Q A;  4J01 A;  1XGN A;  4UVA A;  4WX9 A;  2DA5 A;  4RM2 A;  4CCK A;  1BOB A;  5ICC A;  1HQC A;  2W82 A;  5C4J J;  1ZG1 A;  4UY8 I;  1WWX A;  2KIQ A;  3S2H J;  5J6X A;  2R3S A;  2K4J A;  3ZRG A;  4UUV A;  2IA0 A;  4Q4Z F;  3U2R A;  5BS6 A;  1LVA A;  4I02 A;  4IHY A;  2HZD A;  2MA3 A;  5JHF A;  3DCF A;  4HX4 A;  1KGS A;  2O5R A;  3PL8 A;  3EUH A;  1JJ8 C;  2JA5 J;  3KYL A;  4IQJ A;  4LOC A;  4A6E A;  1BI2 A;  1W36 C;  3CUQ A;  1R5I D;  4KJZ A;  4IX7 A;  3HSF A;  3L2W A;  4JYK A;  2JA7 J;  4AUX A;  3B6A A;  4Q47 A;  2DK5 A;  1T6S A;  2H27 A;  3F9K A;  2CMP A;  3LL7 A;  1YX5 A;  4XLP F;  3S17 J;  3S14 J;  2D1H A;  2PLY A;  3OYN A;  2DOF A;  3O3K A;  4ITV A;  3H0D A;  4O3M A;  2VKH A;  1A5J A;  3OS0 A;  3ZMU A;  1N25 A;  1L3L A;  1O57 A;  1MBK A;  1R4M B;  4UHT A;  3LSM A;  2JZY A;  2CSO A;  1UZC A;  3TBI A;  4A5M A;  4GXO A;  2KQR A;  4CZZ A;  2HDW A;  1P9Q C;  2FJ1 A;  3KX2 A;  4D0P A;  2FXA A;  3BY6 A;  2RN7 A;  1AU7 A;  2O6G E;  2MC3 A;  2LTP A;  4A3I J;  1S72 I;  2X6Y A;  3RJP A;  4B47 A;  4G6T B;  5JLX A;  4EMS A;  2JWT A;  3BR5 A;  3WG7 H;  3ZQF A;  1ZAO A;  3ZMS A;  4B44 A;  1BC8 C;  2PFB A;  4BXX J;  2Z1D A;  1W0T A;  1Z77 A;  3KEQ A;  3Q0U A;  3WTU C;  1OPC A;  1LE8 A;  3PSF A;  5CVJ A;  1G3S A;  4XKV A;  3BLY A;  1K78 A;  3PNY A;  4XLE A;  2LFB A;  3OSF A;  1MSE C;  1QPM A;  5JFR A;  2DYR H;  3I4M J;  1PP7 U;  4B3A A;  3JRB A;  3EYY A;  2E5Z A;  5JVT A;  4Y3O A;  1BW6 A;  2VT2 A;  4BJ6 C;  3I56 I;  3QRF F;  2E1C A;  3P9K A;  2EIM H;  4XNF A;  1W5S A;  1ENH A;  2V79 A;  2XAQ A;  3I64 A;  3E1S A;  3SXY A;  1K7A A;  2MH2 A;  5D5U B;  4RLF A;  1WJF A;  3HL2 A;  2LY2 A;  4OIQ F;  1JJ6 C;  3WTY C;  2LRE A;  3RIR A;  2BW3 B;  3ABU A;  4I6Z A;  3QAH A;  3RSN A;  4IOA F;  2DFH A;  2ZME C;  3H36 A;  3WG9 A;  1GVJ A;  3WTT C;  3VYS B;  5L3C A;  3HUG A;  3L2R A;  3L2V A;  3GF2 A;  3E5X A;  1H88 C;  4IRG A;  2WBM A;  3AG3 H;  3RPU A;  4A2U A;  3OYA A;  4CH7 A;  3G2B A;  1TTY A;  2VBX A;  4I7H A;  5IOY A;  1DU0 A;  1BI1 A;  3HOU J;  2EJR A;  4H4K C;  2ME0 A;  5K5Q A;  3GTQ J;  3OIO A;  3JAM K;  2FOK A;  3HOW J;  3EYI A;  4ZYA A;  1FC3 A;  2Y48 A;  4Q5S F;  3DWL E;  2HOA A;  2DTZ A;  1APL C;  2PMZ N;  3CCY A;  5F64 A;  5A2Q K;  5HDN A;  3CCS I;  3BJO A;  1REP C;  2DOA A;  3MWM A;  4FCY A;  2E7X A;  2XB5 A;  3PNT A;  3BOQ A;  4OMY A;  1ORK A;  3HOZ J;  2OTJ I;  1XTA A;  1X58 A;  4HLY A;  3H3V K;  3EUK L;  4P55 A;  2R7D A;  1TQP A;  1UB9 A;  3A01 B;  4EVI A;  2JPC A;  2QLZ A;  2DYS H;  2OBP A;  3QWL A;  4S04 A;  2DPU A;  3WU0 A;  5KVR A;  3T1B A;  3CMY A;  1ZGW A; 
#chains in the Genus database with same CATH homology
 3HIF A;  5LBQ A;  1FNN A;  2XVC A;  3DQV C;  1PDN C;  1STZ A;  1IXR C;  2IT0 A;  2QEN A;  5E1X A;  4ZZL A;  2HEO A;  1F9N A;  3C7J A;  4IPA A;  3O2P E;  3N97 A;  1IN5 A;  1FX7 A;  1FLI A;  2MBF A;  4LK0 F;  3VOE A;  4R79 A;  4WXC A;  5BPD A;  2UXX A;  3CUO A;  3GX4 X;  1W7P B;  3BWG A;  2STT A;  3I4P A;  4YII A;  2H09 A;  2JSC A;  1G3T A;  5LLQ A;  2LNB A;  2ZCW A;  5D5X B;  4RGX A;  2M1B A;  1SAX A;  2KJB A;  2GQQ A;  4M6X A;  2F5E A;  3M1E A;  3WTW C;  2RKH A;  2FF4 A;  1P2F A;  3ZMV A;  3U9G A;  2HTS A;  3GZ5 A;  4EJW A;  3WGI A;  4BYY A;  4GO1 A;  4R1H A;  4UNO A;  3FM5 A;  1IN8 A;  1CGP A;  4L9N A;  2M8E A;  1FPQ A;  1BJA A;  1OMI A;  2RNJ A;  2FRH A;  2QWW A;  3KP6 A;  5H20 A;  1Z91 A;  1ZGJ A;  3WOD F;  3GO5 A;  3IHU A;  2ACJ A;  4U88 A;  1QGP A;  5ERI A;  3T5X A;  1VTN C;  1I1S A;  5TRD A;  3DP7 A;  4L5I A;  1UHW A;  3OV8 A;  4KA4 A;  1U5T A;  4NQW A;  1ZLK A;  1YQA A;  3Q9V A;  2HKX A;  2DT5 A;  2YX4 A;  3IWZ A;  2EB7 A;  1QNT A;  4ESJ A;  1WQ2 A;  3I71 A;  3MFK A;  1L0O C;  1LDK B;  4FX4 A;  1MJB A;  2HGC A;  4ZYE A;  2P6S A;  3GLX A;  2QYO A;  1HKQ A;  1KA8 A;  2DAO A;  2KIF A;  2Z99 A;  3TO6 A;  1BN5 A;  2O0Y A;  2XAF A;  2FNP A;  2W84 A;  3W6J B;  3E6M A;  1Z6R A;  3HOT A;  3K0L A;  4HDV A;  1YW9 A;  1G6N A;  5LGU A;  4JBA A;  2QM3 A;  3CDH A;  2DBB A;  4YFX F;  5E8I A;  3SZT A;  2FQ3 A;  1OKR A;  5CVU A;  1R1T A;  3QU3 A;  4I09 A;  3SFZ A;  3I0T A;  1TLH B;  1MDM A;  1TQM A;  3RDI A;  4HQE A;  5CJ9 A;  1B59 A;  3FZV A;  3PFI A;  3QPT A;  1KU3 A;  2DFI A;  3BRO A;  4JK1 X;  5CVR A;  2HDC A;  5L3E A;  3GUD A;  2DPD A;  3SHF A;  2QZ8 A;  1ZRC A;  4P9F A;  1IXS B;  2HYF A;  4AVP A;  2MD5 A;  4GCV A;  1IN4 A;  3QPH A;  5LRS A;  3GYH X;  1CF7 A;  3VEP A;  2F5F A;  4KNY A;  2K86 A;  2RGV A;  4BAY A;  4HW0 A;  4R8H A;  3E3V A;  5LHH A;  3RKY A;  4EV0 A;  2DW4 A;  3KFW X;  2QVO A;  1O3S A;  2TDX A;  4BHP A;  3MZH A;  2D1V A;  5L3B A;  4UVB A;  3F8F A;  2CGP A;  1XSV A;  4M9X A;  5H6Q A;  2PJP A;  4MGR A;  1IAW A;  3IWF A;  4U0Y A;  5E1W A;  1DP7 P;  5D4S A;  3H92 A;  2FBI A;  2CG4 A;  4K2E A;  1XGM A;  3WE2 A;  4PGG A;  3FXQ A;  4A5N A;  5ICF A;  4CDG A;  2Z33 A;  3K2Z A;  5DUK A;  2M87 A;  3CLO A;  4GYI A;  3Q5F A;  3EQL F;  3IL2 A;  4MQV A;  1S29 A;  1ZRD A;  1XMA A;  3L00 A;  4CGZ A;  3BPV A;  4RAZ A;  4MHG A;  2STW A;  3K9T A;  1TBX A;  3QP6 A;  2PG4 A;  3WGH A;  3DXJ F;  3E6C C;  3FXR A;  1S3J A;  1S6L A;  1ZN2 A;  1R22 A;  2NYX A;  2VN2 A;  4G6Q A;  4A6D A;  2A6H F;  2NRA C;  2PEX A;  4CO8 A;  3HHH A;  3WTS C;  2QBY B;  3F21 A;  1KU9 A;  1MGT A;  4F7Z A;  2IJL A;  3LA3 A;  3GXO A;  5DEQ A;  3BP8 A;  4LG0 B;  3IKV A;  2X4H A;  4UV9 A;  1KQ8 A;  1R7J A;  1MD0 A;  1R5H A;  4KUM A;  2CW0 F;  1R23 A;  5F1R A;  2HQR A;  5DD4 A;  1J0R A;  2XAG A;  1SMY F;  5DCM B;  4ETS A;  5FFX A;  1UFM A;  3RPQ A;  4DNC A;  2GXB A;  4U0W A;  5LGN A;  4HAM A;  2VON A;  1JGS A;  5K5O A;  4HF2 A;  3F72 A;  4RB1 A;  3PQK A;  2CQK A;  1F4K A;  3I53 A;  3E5Q A;  2VOD A;  3FMR A;  2E1N A;  3JAM Z;  1BI3 A;  4HA8 A;  2ZME A;  1BBY A;  2PQ8 A;  3KEO A;  1XD7 A;  1UST A;  5EEH A;  3I5U A;  1ZGA A;  3F8N A;  4LMY A;  2M30 A;  1ONV A;  3N4M A;  3ZMZ A;  2G7U A;  1U3E M;  2H94 A;  5IT3 A;  2P7V B;  2NAZ A;  1LDJ A;  4PDK A;  4HLX A;  3LA2 A;  1AOY A;  2K27 A;  2L4A A;  2MLK A;  1YS7 A;  1FBQ A;  5D6F A;  1I1G A;  2YX7 A;  2HR3 A;  3H3U A;  1KU2 A;  4WXH A;  4M74 A;  2GXG A;  2JTV A;  2OQR A;  3NEU A;  2Z5U A;  3DFG A;  4HV6 A;  3ISP A;  1U2W A;  3B02 A;  4L9T A;  4QLC U;  5LRR A;  3HOS A;  1KYW A;  3ECH A;  3I54 A;  4M9S A;  3B73 A;  1HW2 A;  3QP5 A;  1LJ9 A;  3LST A;  2ZNY A;  4YG2 F;  1QQI A;  3WGG A;  1Z6T A;  2ZO4 A;  2FE3 A;  3V7R A;  2P5L C;  2PI0 A;  1KQ9 A;  2BYV E;  2D45 A;  4Y13 A;  3EDP A;  4Y15 A;  2YU3 A;  2O61 A;  3L09 A;  2YPR A;  2UWM A;  2P5K A;  5DUI A;  1RI7 A;  4IHT A;  2GAU A;  1RUO A;  3FF5 A;  2ZXJ A;  1P4W A;  5L3G A;  3RTR A;  3VOD A;  2UZK A;  1JHF A;  2Q2E A;  4MTD A;  1YTY A;  1HSJ A;  2EFW A;  2XRO A;  3FMQ A;  3M7G A;  2GA1 A;  1BM9 A;  5DV5 A;  1S7A A;  1WKM A;  1BIB A;  1DPU A;  1ZRF A;  4L5J A;  1ZG5 A;  1R58 A;  3PQJ A;  5HDK A;  1ULY A;  3F3X A;  3GFI A;  3RI4 A;  5LHI A;  1E2X A;  1FT9 A;  3F23 A;  3S2W A;  4HYE A;  3T0Y A;  4CHU A;  3REO A;  3TO9 A;  4EM1 A;  1IN6 A;  1RIO H;  3LQQ A;  3GZ6 A;  2IVM A;  3TOA A;  3MZY A;  4N9H A;  2JT1 A;  1JHH A;  2KIM A;  2VT3 A;  4AWX B;  3KP2 A;  2CO5 A;  1K79 A;  3ROU A;  5LEJ A;  3I59 A;  3FWE A;  4HV5 A;  2M45 A;  1DPR A;  2FMY A;  4CIC A;  5BMZ A;  3EET A;  5AIP A;  2Y75 A;  2DU9 A;  2VC1 A;  1SD6 A;  2ESN A;  2PMH A;  3R0A A;  3E6B A;  1GHC A;  4KMF A;  2A5Y B;  3FX3 A;  5EEG A;  3F8B A;  4NHJ A;  1FYM A;  2Z3Y A;  3ML6 A;  4Y17 A;  3H3Z A;  1E17 A;  1XGO A;  3DF8 A;  4MTE A;  4XSZ F;  1DDN A;  2XV4 S;  2FA5 A;  2LF7 A;  2GZW A;  1SD7 A;  2KIU A;  4ZYD A;  1MZB A;  3FMS A;  5FLX Z;  3J7A O;  4ENJ A;  1ZAR A;  2ZJ2 A;  2O03 A;  4A0Z A;  1D3Y A;  5FO5 A;  4LK1 F;  5E8G A;  5HLH A;  3F8M A;  1XCB A;  4WWC A;  2QQ9 A;  1FYL A;  1OYW A;  4EJT A;  3ZMT A;  1MJ9 A;  1Z7U A;  3WE3 A;  3K69 A;  4G94 A;  1LQ1 A;  1SFU A;  1T39 A;  1Z9C A;  4FX0 A;  3IC7 A;  3ECO A;  1FBU A;  3D5L A;  2QQB A;  2VE8 A;  3NRV A;  2G7H A;  1H9G A;  2V6C A;  3C18 A;  2EFO A;  4IRI A;  4WXD A;  4RAY A;  2O3F A;  5E17 F;  3GFL A;  4M71 A;  4M73 A;  2EV6 A;  3E97 A;  4ENN A;  4I98 B;  4Q48 A;  2L54 A;  2W24 A;  4HBL A;  4L9V A;  2G9W A;  4G9Y A;  2WWY A;  3HTU A;  2VBY A;  2VE9 A;  3HHG A;  4LB5 A;  4G7H F;  1UHM A;  3LAP A;  2DK8 A;  2P5V A;  5IT9 K;  2A6E F;  3G73 A;  3BDD A;  3BJA A;  3CUQ B;  1IZ1 A;  3LQR A;  4JQF A;  1ZYR F;  1B9N A;  4G7Z F;  1J9I A;  5AON A;  1I27 A;  1K6O A;  1AWC A;  1QO0 D;  5D5W B;  3ELK A;  2EK5 A;  5ILU A;  4HX7 A;  5TJJ A;  2KKO A;  1S7O A;  2BGC A;  5JR3 A;  1P6R A;  3OOP A;  4OIR F;  4HOB A;  5ILV A;  1ON1 A;  3KP4 A;  2AXL A;  2HS5 A;  4OIP F;  2ISY A;  3JTH A;  2DTR A;  2OAZ A;  1T2K A;  2FEZ A;  3F6V A;  3IKT A;  1G4D A;  2VXZ A;  1B9M A;  2ISZ A;  4BXU A;  2OD5 A;  1K78 B;  1DUX C;  3J81 K;  4L9J A;  3M8F A;  5KK1 A;  5D5V B;  1FBS A;  5HLG A;  3BPX A;  2K7L A;  3CO6 C;  2W25 A;  1V3F A;  2CYY A;  5CLS A;  4YFN F;  3V7S A;  4KDP A;  1LEB A;  2PBI A;  4O5V A;  2KJC A;  2F2E A;  5ICE A;  1T0F A;  3E5U A;  1H9T A;  3RKW A;  4XRF A;  2PN6 A;  4M6Y A;  1QBJ A;  4O6J A;  3IRQ A;  4IXA A;  4LLL A;  2P7C B;  2DO7 A;  2EFP A;  2ZNZ A;  4KMU X;  5L3F A;  4A0Y A;  2FBK A;  1J59 A;  1F5T A;  3C1D A;  3WTX C;  2F5D A;  1HW5 A;  5BOX A;  1YIO A;  3TGN A;  3ZMD A;  2ADU A;  1WRJ A;  3L9F A;  4M9Z A;  1W7P A;  1WSU A;  4RGR A;  1BC7 C;  1SD4 A;  4H0E A;  3BJ6 A;  2GIV A;  2DLL A;  3JW4 A;  1O7F A;  2HZT A;  4YIF A;  2FNA A;  3KZY A;  3SQN A;  1USS A;  4LD5 A;  4CYD A;  3M9A A;  4M72 A;  1UCR A;  2V9V A;  3E6D A;  3MAJ A;  4HDU A;  3RYP A;  1IXC A;  4U0V A;  5D8K B;  2IRF G;  4B8X A;  3DKW A;  1JXS A;  1LNW A;  3V8L A;  3RYR A;  2OZU A;  1FP2 A;  3RKX A;  2NS0 A;  2F5C A;  2VBW A;  4KFC A;  5J8F A;  4L0Y B;  1EH6 A;  2HOE A;  2LF8 A;  2ELH A;  3C3W A;  1U78 A;  1W4M A;  3GFM A;  1V4R A;  4Z2Y A;  5D8L B;  1FP1 D;  3ABT A;  2ESH A;  4IHS A;  4EJO A;  3GW2 A;  1FZP B;  1O7L A;  4KT5 C;  2VOO A;  2L02 A;  1D8J A;  1Y0U A;  3FM3 A;  3KP7 A;  2DQR A;  4UVC A;  1JE8 A;  4RGS A;  3HTS B;  4EQQ A;  1P4A A;  5ED4 A;  1J7K A;  2LDU A;  1S8N A;  4DQ2 A;  2J5O A;  3KLN A;  4EM0 B;  2XGX A;  5HOO A;  2YR2 A;  5LHG A;  5AIQ A;  5A2Q Z;  3R60 A;  2PMU A;  5JHU A;  3VB2 A;  4A0X A;  4PCQ A;  1T38 A;  2WTE A;  2K4B A;  3ZPL A;  1EV7 A;  4ZYH A;  1P92 A;  2QUF A;  5L3D A;  1BOA A;  2XHK A;  3LWF A;  2Z9O A;  4LGW A;  2OQG A;  4KN7 X;  3KET A;  1U5T B;  4P9U A;  2RQP A;  2FBH A;  2D2W A;  2LSO A;  1YW8 A;  1ZH5 A;  4LLN A;  4RS8 A;  2C6Y A;  1IW7 F;  4ENM A;  1YYV A;  2P8T A;  2BV6 A;  1BI0 A;  4XLN F;  4AIJ A;  4U7B A;  2IA1 A;  4ON0 A;  3P7N A;  1A04 A;  3K1M A;  4PZJ A;  2H6C A;  1OR7 A;  1PUE E;  4IRH A;  3DPT A;  2EA2 A;  4UV8 A;  2FU4 A;  1W5T A;  1RNL A;  3L2C A;  1GXQ A;  1TW2 A;  4RB0 A;  2QQA A;  2H6B A;  1EH7 A;  4I0B A;  1O3T A;  1IRF A;  4KYW A;  4BH9 A;  1SD5 A;  2XAS A;  2Q0O A;  1MDM B;  3JSP A;  3ZQ7 A;  1ON2 A;  4KIC A;  3U1D A;  5D4R A;  3ZP5 A;  1I6X A;  2HTJ A;  3M8E A;  3FHZ A;  4HF0 A;  1IUY A;  2BEO A;  1FSH A;  5FB2 A;  4EJU A;  1YLF A;  3KCC A;  4ESB A;  2DQL A;  1ZLJ A;  5K1Y A;  1R1V A;  3P9C A;  5BQT A;  5E18 F;  3J80 K;  2COM A;  3WTZ A;  2IPQ X;  3GVA A;  1CF7 B;  4I0A A;  1OYI A;  4ZZD A;  1O3R A;  5ILS A;  2L4M A;  1C0W A;  1YW7 A;  5BPI A;  1XB4 A;  3COA C;  2IP2 A;  1XCV A;  3CTA A;  3R4K A;  1W7P D;  5CVI A;  5CYV A;  3AAF A;  1YFH A;  2IW5 A;  2ZFW A;  2RC4 A;  4ZYG A;  4QWQ A;  3CUQ C;  3HRT A;  1GXP A;  1J2X A;  2O8X A;  4P5O A;  3FXU A;  1KYZ A;  3V4G A;  3ZN1 A;  5E1Z B;  1Q1H A;  1FSE A;  1MKM A;  4B09 A;  1XMK A;  3F6O A;  5FD5 A;  1TNT A;  4ZH4 F;  2AS5 F;  3D0S A;  4A12 A;  2A07 F;  3T8T A;  2ZBK A;  4RB3 C;  3TDZ C;  3V8K A;  1LDD A;  1TNS A;  1IN7 A;  1IF1 A;  4L18 B;  2BBY A;  2W57 A;  2M5W A;  2QBY A;  4OIO F;  1XGS A;  4P96 A;  3K1N A;  1HXD A;  1XDU A;  4OMZ A;  1U6G A;  3LAJ A;  2XAH A;  3HSE A;  5IT9 Z;  1QZY A;  4KN4 X;  1TQI A;  2W85 A;  5J8C A;  1IRG A;  4LG0 A;  4EM2 A;  1ZRE A;  3DEU A;  2ZKZ A;  1RZ4 A;  1Z05 A;  2NNY A;  2RV8 A;  5HDG A;  4I2O A;  4S05 A;  1TW3 A;  3KLO A;  2Q8K A;  1T98 A;  5DCM A;  4CXF A;  2E7W A;  2BE5 F;  3HRS A;  3NQO A;  1FWZ A;  2JRT A;  2HWV A;  1FYK A;  1XSX A;  1HKS A;  4BHB A;  3WU1 B;  3Q9S A;  1R1U A;  2EFQ A;  3HRU A;  1Z1D A;  1J5Y A;  2OA4 A;  2V1U A;  1SFX A;  4AIK A;  2P6T A;  2CWE A;  3F22 A;  4TV7 A;  4FHT A;  3KZZ A;  3K1P A;  3J81 Z;  1XDS A;  4WCG A;  4EJV A;  3ERE D;  1EH8 A;  2A69 F;  4ASN A;  3F8C A;  3WTV C;  2NNN A;  2XUB A;  3ULQ B;  4IJA A;  1LEA A;  4HF1 A;  3KP5 A;  1KQ0 A;  4EGY A;  1XN7 A;  4WF2 A;  4N0B A;  3KE2 A;  5HS7 A;  3KP3 A;  2RDP A;  1FOK A;  3GEZ A;  5LEK A;  3BZ6 A;  3TOB A;  2FSW A;  1QZZ A;  4RGU A;  1NHA A;  2P4W A;  3JSO A;  1G3W A;  5H6R A;  1HBX G;  2A3S A;  1B1B A;  1OYY A;  2ZME B;  5DCF A;  4I01 A;  1J75 A;  5HVQ C;  4N9I A;  4EGZ A;  2OU2 A;  2R7F A;  2L3D A;  2X0L A;  4ENK A;  4YFK F;  4OOI A;  4XBF A;  5HLI A;  5JI6 A;  2EV5 A;  2HKO A;  5CVV A;  4KIF A;  5HS9 A;  3TDU C;  3QU6 A;  4G7O F;  3GFJ A;  4ESF A;  3QOP A;  1YO5 C;  4BNC A;  3P9I A;  4LB6 B;  4KIG A;  2JPB A;  4E70 A;  1PP8 F;  5DDG A;  2UXN A;  3T8R A;  3TO7 A;  2IA2 A;  2MH9 A;  1B4A A;  2YSR A;  4IVN A;  3CO7 C;  4XSX F;  5K5R A;  4BQA A;  5FGM A;  4LLG F;  5FLX K;  3W6K B;  3ZN0 A;  4U7D A;  1YG2 A;  3L7W A;  4UXN A;  4GYG A;  4LFU A;  4MEX F;  4AIH A;  2GWR A;  2XKO A;  3TQN A;  3HRM A;  5FD6 A;  6PAX A;  2CFX A;  1U5T C;  4OIN F;  2L01 A;  3MQ0 A;  5ICG A;  1ZG3 A;  3DV8 A;  2HQN A;  3R0J A;  1F1Z A;  1I5Z A;  1HKT A;  2XKP A;  4KIB A;  4HQM A;  2LKP A;  2HFH A;  1SMT A;  1WI9 A;  2V1X A;  1D5V A;  5FFZ A;  1RUN A;  3I58 A;  1HW1 A;  3DPL C;  1HST A;  1KU7 A;  1MJA A;  1BIA A;  2VOP A;  2VBZ A;  2WC2 A;  3TKY A;  4BHC A;  4OU0 A;  2FML A;  2A68 F;  1P4X A;  1ODD A;  1ZHF A;  4WK8 F;  4MQ9 F;  2DI3 A;  3R61 A;  2EWN A;  2K02 A;  4L0Z B;  2Y0M A;  2J5P A;  2EA4 A;  2EFN A;  2KRF A;  3MEX A;  4FT8 A;  1U8R A;  1R5G A;  1R36 A;  1G3Y A;  3HSR A;  4MNU A;  3VFZ A;  1LB2 A;  2OZ6 A;  2HYG D;  1R00 A;  3V8J A;  3R6S A;  3LFK A;  2WV0 A;  3JTG A;  3I59 B;  4HZF A;  2XRN A;  4AD9 A;  1YS6 A;  2VC0 A;  4MEY F;  4LJZ F;  2RVC A;  2XAJ A;  5LGT A;  1B6A A;  2ETH A;  3HYI A;  4G8X A;  5E20 A;  4NB5 A;  2GA2 A;  4IF4 A;  4PGH A;  3CJN A;  5DYM A;  5HS8 A;  3MCZ A;  3SZP A;  2MLG A;  3O6B B;  2A61 A;  3V7C A;  2V1D A;  3J80 Z;  2B0L A;  4GGG A;  1FY7 A;  4G6D A;  1X3U A;  3IRR A;  1XSD A;  2XIG A;  3GWZ A;  3LA7 A;  1SFE A;  1H0M A;  5DD8 A;  3G3Z A;  4RB2 C;  5D6E A;  1D8K A;  2EV0 A;  5F6F A;  4HX8 A;  1O3Q A;  1XGN A;  4UVA A;  4WX9 A;  5ICC A;  1ZG1 A;  1HQC A;  1WWX A;  5J6X A;  2R3S A;  2K4J A;  4UUV A;  2IA0 A;  4Q4Z F;  3U2R A;  5BS6 A;  1LVA A;  4I02 A;  2MA3 A;  4HX4 A;  1KGS A;  3EUH A;  4A6E A;  1BI2 A;  3CUQ A;  3HSF A;  4Q47 A;  2DK5 A;  1T6S A;  2H27 A;  4XLP F;  2D1H A;  2PLY A;  4O3M A;  3O3K A;  3ZMU A;  1L3L A;  1O57 A;  4UHT A;  2JZY A;  2CSO A;  4A5M A;  4GXO A;  4CZZ A;  4D0P A;  2FXA A;  3BY6 A;  2RN7 A;  2O6G E;  2MC3 A;  3RJP A;  4EMS A;  1ZAO A;  3ZMS A;  1BC8 C;  2PFB A;  3KEQ A;  3WTU C;  1OPC A;  5CVJ A;  1G3S A;  1K78 A;  1QPM A;  5JFR A;  1PP7 U;  3EYY A;  5JVT A;  2VT2 A;  2E1C A;  3QRF F;  3P9K A;  1W5S A;  2V79 A;  2XAQ A;  3I64 A;  3SXY A;  1K7A A;  2MH2 A;  5D5U B;  4OIQ F;  3WTY C;  3RIR A;  3ABU A;  3QAH A;  3WG9 A;  1GVJ A;  3WTT C;  5L3C A;  3HUG A;  3GF2 A;  3E5X A;  4IRG A;  3RPU A;  4A2U A;  1TTY A;  2VBX A;  4I7H A;  1BI1 A;  2EJR A;  5K5Q A;  3JAM K;  2FOK A;  3EYI A;  1FC3 A;  2Y48 A;  4Q5S F;  5F64 A;  5A2Q K;  5HDN A;  3BJO A;  1REP C;  3MWM A;  2E7X A;  3BOQ A;  4OMY A;  4HLY A;  4P55 A;  2R7D A;  1TQP A;  1UB9 A;  4EVI A;  2JPC A;  2QLZ A;  2OBP A;  4S04 A;  2DPU A;  3WU0 A;  5KVR A;  3T1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...