2DO7A

Solution structure of the winged helix-turn-helix motif of human cul-4b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GSSGSSGIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Cullin-4B
publication title Solution structure of the winged helix-turn-helix motif of human CUL-4B
rcsb
source organism Homo sapiens
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2do7A01
1ON1A 4L9VA 3QU3A 3ZMSA 3E3VA 1S6LA 2DI3A 3HTUA 4PGGA 4PGHA 1DPUA 2HYFA 2ZNZA 1L0OC 3ZN1A 5A2QK 4A0XA 3K0LA 3FHZA 1ZLKA 3WTZA 5FD5A 2M45A 5J6XA 1TNSA 1FWZA 3GO5A 3HOSA 2CW0F 2Y75A 4E70A 1FYMA 4ZYDA 4CDGA 2C6YA 1GHCA 3D5LA 4XLNF 4BXUA 3JTHA 2YPRA 1ZRDA 2JRTA 1FYKA 5D5VB 4KIBA 2VBYA 4BHCA 1SD4A 5HLHA 3L00A 5FO5A 3QRFF 1O3SA 1WQ2A 2EV5A 1XCVA 1T6SA 3KP4A 4P9UA 2H09A 2F5DA 4A6EA 2LKPA 3SHFA 2OU2A 2MH9A 1SAXA 2ISZA 5HLIA 2F5CA 5LRSA 4EJVA 2DLLA 5BPIA 2HYGD 5ICFA 3CDHA 2JSCA 3HHHA 4JK1X 2VE8A 3KETA 3R61A 1LDDA 4N0BA 5ILUA 2VONA 2VT2A 4L0YB 2IA0A 4UV8A 5H6QA 3F8CA 4WCGA 1IAWA 3I59B 1YIOA 4ZZLA 4XLPF 1OMIA 3NQOA 1MJAA 4IXAA 2HQRA 4KA4A 4UUVA 2H6CA 5CVRA 1C0WA 2YSRA 1W5TA 4CZZA 2XAQA 2XKPA 4U0YA 3CO7C 2LSOA 3ZMDA 2F5EA 5CVVA 1R00A 1TNTA 3MQ0A 2Q2EA 4MQ9F 2EB7A 4HQMA 2M8EA 3QP6A 3ISPA 1STZA 4IHTA 2L4MA 2JTVA 2P7VB 5IT3A 2VBWA 4IRIA 4EM1A 1XB4A 2ZXJA 2G9WA 5LHGA 2HTJA 2PMHA 2ZKZA 5JHUA 4ON0A 4RB0A 1FBUA 4WF2A 4RB1A 5DD4A 1ZHFA 2CGPA 5E8GA 2OA4A 3JSPA 1Q1HA 2MA3A 2DQRA 1D5VA 2ELHA 3F72A 3T1BA 2D1VA 5E18F 5CLSA 1X3UA 4WXCA 4ASNA 4OIRF 3I64A 1I6XA 2QLZA 4YFXF 1SFEA 3LA3A 1MGTA 3BJOA 2D1HA 4LMYA 3HRSA 2XASA 3HOTA 2OZUA 3M7GA 2J5PA 1H9GA 4WXDA 4LFUA 3DXJF 1FBQA 2IPQX 4ZH4F 4LB5A 2HDCA 2FMLA 2UWMA 1QGPA 2V1UA 3WTYC 1TQMA 4P96A 1IN8A 3J81Z 1LVAA 3V7SA 1OPCA 3HIFA 1O3TA 5KVRA 2A5YB 1S3JA 5AONA 3KLNA 1U5TC 2E1NA 1ZG3A 5L3GA 4MQVA 3TOAA 5ICCA 1R5GA 1QZZA 1Z7UA 1T2KA 2P7CB 1R22A 1BI0A 3BPVA 3WE3A 2H6BA 2IJLA 4UXNA 4OMYA 2HZTA 2CG4A 4FX4A 2A61A 2XKOA 2CQKA 1UCRA 3E6BA 2BE5F 1YO5C 1RNLA 1PUEE 3RIRA 4LK0F 3W6KB 1HQCA 2VC0A 4UVBA 3FMRA 3WTVC 4UNOA 4G94A 4WX9A 4RB2C 2V1DA 2K27A 3BPXA 1U8RA 2HTSA 2PFBA 4LLGF 4I02A 3GX4X 1I27A 2P5VA 4HBLA 2PJPA 4OIOF 4Y15A 3F8BA 3WGGA 1BBYA 4XBFA 2YU3A 3ZP5A 4KUMA 3KP6A 5E17F 1BI3A 2X4HA 5CJ9A 4LB6B 4OOIA 2XUBA 4BNCA 2H94A 1UB9A 1WRJA 2FBHA 3D0SA 4L5JA 3GFLA 4ZYGA 5DUIA 2CYYA 3CO6C 4IF4A 1G3TA 3K1NA 1W5SA 3F23A 2GZWA 1BN5A 5IT9K 2M1BA 4Y13A 2LF8A 5D5WB 1G4DA 1QNTA 2R3SA 3QU6A 3BOQA 1KU9A 3E5XA 5TJJA 2UZKA 3OV8A 4NQWA 1MDMA 2WC2A 3ELKA 1FP1D 3GWZA 1KQ0A 1HW1A 3QOPA 3CTAA 4QLCU 5CVJA 4KMFA 3I71A 4GCVA 3M1EA 4NB5A 5K5QA 3N4MA 2OZ6A 1DP7P 4ZYEA 2NS0A 4OU0A 3B02A 4PCQA 5DD8A 2DTRA 2LF7A 2O61A 3G73A 1HW2A 5H6RA 3GYHX 3BY6A 3HRMA 3LA7A 3GFMA 5D4SA 5CVUA 1F5TA 1O7FA 4LK1F 4A12A 1GVJA 2QM3A 2QVOA 3CLOA 5F1RA 1W7PB 3EUHA 1YQAA 2PN6A 1S29A 4LLLA 4BH9A 3LAPA 1JHHA 5LGNA 3JAMZ 4N9HA 3DFGA 1W7PA 2OAZA 1R7JA 2Z9OA 4M6XA 5E20A 3C3WA 5ICEA 2E7XA 1SMYF 3F8NA 2DAOA 1XDSA 5CYVA 4GXOA 3O3KA 1TTYA 1J59A 4UHTA 3HSFA 4HX4A 1MJ9A 3K2ZA 2L3DA 2O03A 4A5NA 1ZN2A 1O3RA 3BP8A 4IJAA 3F8FA 1XN7A 4P9FA 1NHAA 1XGSA 1ZARA 3EDPA 4G6DA 1Z6TA 3CJNA 4OIQF 3DQVC 3FWEA 4CO8A 4EVIA 3PFIA 1H9TA 3TDUC 5BQTA 1BOAA 4OINF 3S2WA 1ULYA 1E2XA 1RUOA 1L3LA 3I4PA 4I98B 3ZMUA 2L4AA 4EJWA 4L9NA 2PBIA 1MZBA 1Z05A 3RDIA 1HSJA 3FMQA 3BROA 4U0VA 4ZZDA 1BIBA 2ZCWA 3HRTA 2D45A 3WU0A 2HQNA 1SFXA 4AIJA 3V8KA 5FB2A 2FF4A 4LD5A 5HLGA 2O6GE 4EM0B 2RV8A 3LFKA 4RAYA 1BI2A 3ZPLA 1D8JA 4D0PA 3ERED 5E1ZB 1R1TA 2O8XA 4AIHA 1XGMA 4RB3C 4ETSA 1GXPA 1H0MA 3GUDA 4HW0A 2RC4A 2KJBA 3R4KA 4H0EA 3U9GA 2PLYA 1K79A 1SD5A 2VBZA 3ULQB 4Q47A 3QPHA 1IW7F 1ON2A 1R36A 3LQQA 2P8TA 2MD5A 1QQIA 4BQAA 4KN7X 3MZYA 3F21A 4M72A 2QQAA 3HYIA 2HKXA 1YW9A 3QP5A 3VEPA 3IWZA 2KIFA 2NNYA 1J0RA 2DPDA 1YYVA 1WKMA 1UHWA 2FSWA 3KP5A 3CUOA 3M8EA 3J81K 1EH8A 3F3XA 1K78B 1QO0D 1T38A 3F22A 4GYIA 2Y48A 5HOOA 1J5YA 2KJCA 4MEYF 2JPCA 1U3EM 2Z33A 2RQPA 3I59A 2ZJ2A 2GWRA 2EFOA 3BJAA 1FC3A 2M5WA 3ML6A 3U1DA 1YLFA 4M71A 2MLKA 5JR3A 5DEQA 2A07F 3FXUA 4ESJA 3T8TA 1B4AA 5E1XA 1B9MA 3DPTA 4HZFA 5DYMA 2JPBA 2VE9A 3MFKA 4M74A 2DQLA 2F5FA 2W24A 3RPQA 4HLYA 1K7AA 1Y0UA 1LB2A 4ZYHA 2XAJA 4IRGA 1JGSA 1QBJA 3DV8A 4I09A 1U5TB 1YW7A 4CXFA 3RKWA 2EWNA 4I2OA 3VB2A 1CGPA 3GVAA 3HSEA 5EEHA 4G7HF 3EYYA 1T98A 4B09A 3WG9A 3K1MA 2HOEA 3R0AA 2RKHA 5LRRA 4HX8A 3B73A 3L7WA 4ENNA 4P5OA 4KT5C 4FHTA 5F6FA 2QENA 2QYOA 2V6CA 5HVQC 4AD9A 1EH7A 1QPMA 5ICGA 4RGSA 4RS8A 4EV0A 2ADUA 1LDKB 1J2XA 3E6DA 5D6EA 1TW2A 5L3BA 1RUNA 1ZG5A 3RKXA 4ENJA 1TBXA 2JZYA 3FF5A 3P9CA 4ENKA 3DF8A 4R8HA 2PI0A 3TOBA 2L02A 3W6JB 4OIPF 2FE3A 4A6DA 3MZHA 3RJPA 1FSHA 3LQRA 3F6OA 2QWWA 1O57A 5J8FA 1REPC 4F7ZA 3O2PE 4LG0B 4FT8A 2VOOA 3LA2A 3GZ5A 3K69A 3KLOA 5D8KB 4MGRA 4LG0A 2VXZA 3ZQ7A 2DO7A 1FSEA 1IZ1A 1U78A 2F2EA 1MKMA 2IA1A 3MCZA 4R79A 4L18B 5K5RA 1FT9A 1IXCA 4I7HA 3ECHA 4I0AA 3I0TA 1B1BA 2TDXA 1BM9A 2VC1A 3H92A 1USTA 1TLHB 2OBPA 3JAMK 4Z2YA 2DFIA 5AIPA 2EFWA 3C1DA 1HKQA 4YIFA 1BI1A 1PP8F 5F64A 2FNPA 3H3UA 3FM5A 1XDUA 2A68F 3H3ZA 4EJOA 1LQ1A 4Q5SF 3Q9VA 2XAFA 4Y17A 1YFHA 5HS8A 2PMUA 2AXLA 4EJTA 4XSXF 3IWFA 1W4MA 2ZO4A 4L5IA 3F8MA 2QBYB 2EJRA 2XVCA 2CFXA 4MTDA 2R7FA 1FYLA 1GXQA 2QBYA 1I1SA 4MTEA 3WU1B 4EJUA 5J8CA 2B0LA 2P4WA 2MBFA 1R23A 2NAZA 4HAMA 3IRRA 1YTYA 2E7WA 3BWGA 4KNYA 4GO1A 3V8JA 3P9KA 2WV0A 3TO6A 2RVCA 4AWXB 3MEXA 2NYXA 2WWYA 4KN4X 3L2CA 1PDNC 3NEUA 2BBYA 2RN7A 1HBXG 1D3YA 2K86A 4L9JA 1SFUA 3F6VA 4CICA 1SMTA 4YFNF 2BGCA 2IRFG 4L0ZB 5L3FA 1Z9CA 1ZH5A 2CSOA 2PG4A 2DK5A 3KCCA 4EMSA 5JI6A 3GEZA 5D6FA 2FMYA 5LHIA 4S05A 4CYDA 5D4RA 3EYIA 2GXGA 1R58A 3TO9A 1KA8A 2V9VA 3WE2A 1IRFA 3ZMVA 2W25A 1AOYA 3IRQA 2XROA 1P4AA 2OQGA 3ZMTA 1V3FA 2X0LA 3ZN0A 4UV9A 1XMAA 2DU9A 5DDGA 2R7DA 2A3SA 3GFIA 2COMA 4TV7A 4WXHA 3WTXC 3BJ6A 1F1ZA 1WSUA 1FBSA 3KEQA 2IT0A 3LSTA 2M87A 1LDJA 1P4WA 2O3FA 2ZBKA 3TQNA 4IPAA 3TDZC 3C7JA 1TQPA 4WWCA 5K1YA 1QZYA 4A2UA 4A5MA 3Q9SA 4S04A 1RIOH 2V1XA 2FOKA 1FLIA 3DPLC 1IN4A 5LGTA 3ABUA 2CO5A 3HSRA 2DPUA 5H20A 1LEBA 1G3YA 5BOXA 3MWMA 2YR2A 4M73A 3I5UA 5L3DA 3SXYA 2XV4S 1P6RA 1DDNA 3MAJA 2W85A 2HEOA 2FU4A 2FBKA 1HKSA 2VODA 2Z99A 3GLXA 2E1CA 1OR7A 3KFWX 4G9YA 3FXRA 3CUQC 2GA1A 1TW3A 2NNNA 1XCBA 3V8LA 2LNBA 3PQJA 4KDPA 1R5HA 1ONVA 1KU7A 3E6MA 5HS7A 5D8LB 3IHUA 4LJZF 2AS5F 3GF2A 1A04A 4HOBA 1KQ9A 1F9NA 2P6SA 4UVCA 3J80Z 3T8RA 2HFHA 3RKYA 3JSOA 4RGXA 1SD7A 1KGSA 2QQBA 4MNUA 2EFNA 5DV5A 3ZMZA 3V4GA 2KIUA 2RGVA 2BEOA 3FZVA 5TRDA 5BMZA 4ESFA 4KIFA 2GQQA 3DEUA 3VFZA 3T5XA 3K1PA 3KZYA 1WWXA 1MD0A 4HV6A 3RYPA 1O3QA 4ENMA 1Z1DA 4YFKF 5L3CA 2UXNA 2ETHA 1S7OA 3I58A 1ZYRF 3HUGA 5K5OA 1UHMA 1S8NA 3PQKA 1RI7A 5ED4A 5D5UB 2CWEA 2Q8KA 2EFQA 3KE2A 2NRAC 2MLGA 5LBQA 4Q48A 3E6CC 1IXRC 3E5UA 3HTSB 1YG2A 5CVIA 4I0BA 1EV7A 1BIAA 5HDNA 3IKVA 4HF2A 3IL2A 4KIGA 4CGZA 2L01A 4K2EA 1BC8C 4KICA 2FQ3A 1K78A 3O6BB 5FLXZ 5HDKA 1HSTA 2D2WA 1G6NA 4O5VA 2KRFA 2VBXA 4G7OF 5JVTA 2H27A 4M9XA 1B9NA 1IUYA 1YS6A 2XRNA 5LHHA 1ODDA 5E1WA 3WODF 4P55A 4BAYA 1FY7A 1HW5A 5BS6A 2RDPA 1USSA 3QPTA 1ZG1A 3HHGA 4KYWA 2HR3A 5A2QZ 4U7BA 3G3ZA 2OD5A 4U7DA 3SZPA 5LEJA 3LWFA 4LGWA 5ERIA 2MH2A 4BYYA 3E97A 3KEOA 1E17A 2STTA 3T0YA 2UXXA 1ZREA 4IRHA 2OQRA 2RNJA 3K9TA 3TKYA 4O3MA 4U0WA 4EGYA 1FP2A 3R60A 3N97A 1U5TA 2XHKA 2A69F 1KYWA 4JBAA 5AIQA 2K4JA 3E5QA 1XD7A 4G6QA 1B6AA 4HQEA 1VTNC 4KMUX 2P5LC 1JHFA 2EV6A 2A6HF 3R6SA 3M8FA 1FX7A 2W84A 4HF0A 3V7CA 3RTRA 3FXQA 2ACJA 4XSZF 3WGHA 2GXBA 2BYVE 5FFXA 4B8XA 3JTGA 4A0ZA 3IC7A 2IP2A 4I01A 3L9FA 2FBIA 3KP3A 3Q5FA 3EETA 4RAZA 1Z6RA 1LNWA 2STWA 1EH6A 2DW4A 4YG2F 4N9IA 3TO7A 2K7LA 3SFZA 1UFMA 3TGNA 4UVAA 2Z3YA 5DCFA 4DNCA 5LEKA 4JQFA 1LEAA 1W7PD 1TQIA 4PZJA 4CHUA 1RZ4A 3LAJA 3ABTA 4EM2A 5JFRA 5E8IA 3WTSC 2L54A 1OYYA 1V4RA 3C18A 4HX7A 1FNNA 1ZAOA 3WTUC 4BHBA 1G3SA 3GFJA 4G7ZF 1KQ8A 2VT3A 3ROUA 1KU2A 4GYGA 1ZGAA 3SQNA 1U6GA 2KKOA 2YX4A 4XRFA 1HXDA 3GZ6A 3SZTA 3KP7A 4EQQA 2VN2A 3RYRA 4RGUA 1IF1A 1R1VA 2QQ9A 1PP7U 5KK1A 3GXOA 4QWQA 2XAGA 3V7RA 3M9AA 3I53A 4KFCA 4U88A 3U2RA 3VOEA 5LLQA 2BV6A 1T0FA 5ILVA 4O6JA 4LLNA 2HWVA 4PDKA 1IRGA 1XMKA 1IN5A 2XGXA 1FPQA 2LDUA 4HLXA 2XAHA 1B59A 2HKOA 2Y0MA 4M9ZA 1G3WA 3WGIA 1XSVA 2ESNA 3COAC 4A0YA 1K6OA 2HGCA 2DT5A 1AWCA 1P4XA 4YIIA 1ZRCA 1R1UA 1BJAA 2PEXA 2FEZA 2ISYA 2GAUA 1CF7B 6PAXA 2G7HA 4Q4ZF 4NHJA 3BDDA 3EQLF 1CF7A 3I54A 2FXAA 2A6EF 2Z5UA 3ECOA 3KP2A 2K4BA 1DPRA 1OYIA 4OMZA 4R1HA 1XGOA 1U2WA 1XSDA 3REOA 3WTTC 4RGRA 1KU3A 2ZNYA 1IN6A 3RI4A 1FZPB 2FNAA 4FX0A 3DKWA 4HDVA 1OYWA 1MDMB 2P5KA 3BZ6A 3IKTA 1XSXA 2Q0OA 5DCMB 2VOPA 4HF1A 1HKTA 2J5OA 2K02A 1F4KA 5HDGA 2M30A 1J9IA 4M9SA 3FMSA 1OKRA 3R0JA 2EV0A 2GIVA 4MHGA 5DCMA 1P92A 1I1GA 1MJBA 2ESHA 3J7AO 1LJ9A 2IA2A 5ILSA 5LGUA 4HA8A 2YX7A 3RPUA 2MC3A 1D8KA 1JXSA 2WTEA 5BPDA 3FX3A 2EFPA 3J80K 2KIMA 2GA2A 1ZLJA 1IXSB 1SD6A 2P6TA 4MEXF 1YW8A 3P7NA 4IVNA 1IN7A 2QUFA 4HDUA 5L3EA 1WI9A 1J7KA 2PQ8A 1T39A 1FOKA 5FFZA 1ZGJA 2DK8A 1I5ZA 3JW4A 4HV5A 3NRVA 3CUQB 1YS7A 3KZZA 4BHPA 5DUKA 4G8XA 1BC7C 4EGZA 1JE8A 4AVPA 2EK5A 2FRHA 4IHSA 3CUQA 2V79A 1J75A 5D5XB 4DQ2A 4HYEA 1ZRFA 2ZMEB 1XGNA 2EA2A 5FGMA 4AIKA 2W57A 3VODA 2G7UA 3FM3A 4WK8F 2HS5A 3OOPA 2QZ8A 2ZMEA 2IW5A 1DUXC 2DBBA 3GW2A 3L09A 2EA4A 3DP7A 3HRUA 1KYZA 4L9TA 2IVMA 1S7AA 5FD6A 5EEGA 1O7LA 5HS9A 3AAFA 2FA5A 3P9IA 2O0YA 4ESBA 3WTWC 1P2FA 4M6YA 1Z91A 3QAHA 5FLXK 2XIGA 2JT1A 2ZFWA 4GGGA 5IT9Z
chains in the Genus database with same CATH superfamily
1ON1A 1OCRH 4YRVA 2K9NA 3QQAA 4L9VA 3QU3A 3CC7I 2EIJH 3E3VA 2L7ZA 3MN2A 3M07A 1S6LA 3ZMSA 2P81A 3OYHA 2XAUA 2L7FP 2DI3A 3L2QA 4A93J 3HTUA 1MNDA 4PGHA 4PGGA 2NVUB 1IDZA 1DPUA 1JUPA 5FKLA 3KIOA 2HYFA 1MBEA 2VASA 3ZQCA 2Y2ZA 4BACA 1JTXA 1N77A 2ZNZA 2DXIA 1L0OC 1Z77A 3ZN1A 4CCOA 3J7ZI 5A2QK 4A0XA 3MKYB 2LP0A 3K0LA 3FHZA 1ZLKA 3WTZA 5FD5A 2M45A 4EATA 5J6XA 1TNSA 1FWZA 4XNFA 3KZIC 2CMPA 2JVHA 3GO5A 5DTDA 3HOSA 4CCMA 2CW0F 2Y75A 3DPUA 3KYCB 2DN0A 4E70A 1FYMA 4ZYDA 4CDGA 2C6YA 1GHCA 3OYCA 2X9DA 2WADA 2JSPA 2JWTA 3D5LA 4XLNF 5E79C 1JKOC 4M3FA 4BXUA 3JTHA 2YPRA 1A5JA 1ZRDA 2JRTA 2DODA 2K3PA 3FISA 1FYKA 5IYBJ 3AFHA 3H9GA 3OR2C 5D5VB 4FE4A 4KIBA 2VBYA 4BHCA 1MH4A 1SD4A 1F43A 5HLHA 5KAFC 3G6EI 5TISC 3A0BC 1K6YA 3L00A 3SEZA 5FO5A 3A2KA 3QRFF 4XLCA 5KHDA 4ZDPA 1O3SA 1WQ2A 2EV5A 1XCVA 1T6SA 3KP4A 4P9UA 2H09A 2F5DA 4F3QA 4A6EA 2XB5A 2WV1A 2LKPA 3HOWJ 3PO3J 3SHFA 2OU2A 2MH9A 1YJNI 1SAXA 2CV0A 2ISZA 5HLIA 1M1EB 2DA1A 2F5CA 4PFOA 3HEFA 1SC7A 5LRSA 4EJVA 2VUMJ 2DLLA 5BPIA 2HYGD 5ICFA 3CDHA 4V2GA 2JSCA 4C3IJ 3HHHA 5EDNA 4JK1X 3QPLA 2VE8A 2Z2SB 3W2WA 2QKMB 3PJRA 1Y1VJ 3KETA 5GAHJ 3R61A 3OSGA 1H8AC 1X2NA 1N75A 2O9LA 1LDDA 1Z7LA 4N0BA 5F27A 5F0FA 5ILUA 2VONA 1OQYA 1LKXA 2VT2A 4AYBN 2L0KA 4L0YB 2IGOA 2IA0A 4UV8A 5J40A 1T08B 9ANTA 5H6QA 2XPUA 3HZJA 1Y56A 3QYFA 4DBRA 3F8CA 2R0QC 4WCGA 1IAWA 2R7UA 1UZCA 2KL4A 3I59B 3ZRGA 1YIOA 4BJ6C 2WY8Q 2W48A 2VQHA 4ZZLA 4LIVA 4XLPF 3P5JA 1OMIA 4PFPA 3NQOA 4MO7A 1MJAA 4IXAA 2HQRA 4KA4A 4UUVA 2H6CA 3VYRB 5CVRA 3FDYA 1A6IA 5DS9A 2YSRA 1C0WA 1W5TA 2ZB9A 4NC8A 4CUGA 4ZYAA 4Y7NJ 3ABLH 2Z16A 4CZZA 1W1WE 3GCMA 2XAQA 4DYQA 2R7TA 3TBIA 2XKPA 4U0YA 4GDFA 2Q2EB 3CO7C 2LSOA 1MNMC 4YELA 3BCAA 3CMYA 3ZMDA 1SVLA 2F5EA 1MMAA 1WH5A 3CMAI 4RLFA 4LOCA 4J00A 2X6WA 5CVVA 1R00A 1TNTA 2L5QA 3MQ0A 2Q2EA 4I76A 4MQ9F 3CCSI 4IQJA 2EB7A 4HQMA 2M8EA 4IQ4A 4W1UA 2L7MP 4FQGA 3OOUA 4E7SA 3QP6A 3CCUI 3ISPA 3OYKA 4BE1A 4IHXA 1STZA 4IHTA 2L4MA 2XGCA 2OTLI 2JTVA 2P7VB 5IT3A 2EPFA 2BW3B 2VBWA 3AG4H 4EM1A 1XB4A 2ZXJA 1H88C 4IRIA 1VQ5I 4IX7A 3ZCOA 4M6VA 2G9WA 5LHGA 3H5NA 2HTJA 2PMHA 2ZKZA 2NOGA 5JHUA 4ON0A 3MKZA 1JTYA 4RB0A 1HOMA 4A3IJ 1FBUA 4WF2A 4RB1A 2BW3A 5DD4A 1ZHFA 2CGPA 1ETOA 3FXOA 2OA4A 5E8GA 3JSPA 1Q1HA 2BY0A 4OAZA 2XSDC 2MA3A 2DQRA 3TEDA 2EINH 3V42A 3OYDA 1D5VA 2ELHA 3ERMA 3F72A 3T1BA 2D1VA 3A4CA 5E18F 5CLSA 1QVUA 1X3UA 4WXCA 4ASNA 2NVQJ 3IH2A 2FOWA 3UKGA 2O7OA 2Y0SA 4UB6C 4OIRF 3I64A 4HPQA 1I6XA 2QLZA 4YFXF 3BQYA 1SFEA 3LA3A 3KEYA 3DLAA 1MGTA 3OS2A 3CCRI 3BJOA 4D9JA 2D1HA 4LMYA 1BW5A 3HRSA 2WB1N 2XASA 4PJLA 3HOTA 1VQ6I 2CS3A 2JUCA 1ZGWA 2OZUA 3M7GA 1VQ9I 2JA8J 2J5PA 1ENHA 2E35A 1H9GA 2ZSIB 2DA5A 2F4OB 2KDOA 4WXDA 2ELJA 4LFUA 5EZGA 3DCFA 3DXJF 1FBQA 2KZGA 2IPQX 2HQ5A 4ZH4F 4LB5A 2HDCA 5E3OA 4AM3A 2EBIA 4B1RA 1WJFA 2VLAA 3CCLI 2F4IA 2FMLA 2UWMA 1QGPA 2DA4A 2V1UA 4II2A 3U21A 4RAFA 3WTYC 1TQMA 4P96A 1IN8A 3J81Z 1LVAA 3V7SA 2WY7Q 3S1QJ 1OPCA 5K7ZA 3K4KA 3HIFA 1O3TA 5KVRA 2A5YB 3IV5A 1S3JA 1JKPC 1SANA 4NBQA 5AONA 3KLNA 2R7ZJ 3CDIA 1U5TC 2E1NA 1ZG3A 5L3GA 4MQVA 4ANJA 3TOAA 3OYBA 5ICCA 1R5GA 4XORA 2W4SA 1GVDA 1QZZA 1YOVB 1Z7UA 2WAQN 3GLLA 3HC7A 4DGWB 2V6EA 2CUJA 1T2KA 2P7CB 3DTEA 2X6YA 1R22A 1BI0A 4E7ZA 3BPVA 5HNHA 3WE3A 2H6BA 3RZDJ 1LFBA 2IJLA 4UXNA 4OMYA 4RM3A 2HZTA 2LY9A 1QA6A 2CG4A 4FX4A 1IRXA 1WJBA 2A61A 5FJ8J 2XKOA 2CQKA 1UCRA 2ID3A 3LFUA 3E6BA 2BE5F 1UG2A 2ZFUA 1YO5C 1RNLA 1PUEE 1E3PA 3RIRA 2BY3A 4LK0F 3W6KB 3BCBA 1HQCA 4JP0A 2VC0A 4UVBA 4XLFA 3FMRA 3WTVC 4UNOA 4G94A 4WX9A 3DTKA 4RB2C 2DT7B 4F93B 2V1DA 1TZLA 2V7FA 2K27A 5FKNA 3BPXA 2CW8A 3O8GA 1U8RA 2O8KA 4XICA 2HTSA 1Z21A 4UY8I 2PFBA 1S9HA 3PUFA 4I02A 4LLGF 2XRLA 5GADJ 1MMDA 2DCEA 3GX4X 1I27A 5J4YA 2P5VA 2GOMA 4HBLA 4Y3OA 3CLQA 2PJPA 4OIOF 1E3OC 2ID6A 4NUBA 4KJZA 3I4MJ 2E19A 1HA8A 4IHYA 1S5LC 4Y15A 3F8BA 3WGGA 1BBYA 4XBFA 3HDDA 2YU3A 3CCJI 4BE0A 3ZP5A 4RBOA 4KUMA 3KP6A 5E17F 3BR5A 4GFBA 1BI3A 2RQQA 2DDAA 2X4HA 5CJ9A 4LB6B 2FD5A 3VPRA 2RNGA 4OOIA 4M3GA 2XUBA 3RCOA 4BNCA 2H94A 1UB9A 1JUSA 1WRJA 1XPXA 4PJNA 3M8JA 2FBHA 3D0SA 4L5JA 3GFLA 4ZYGA 1VQMI 4BY1J 2LRDA 3L2WA 2KDZA 1QRYA 3VDXA 5DUIA 3W3CA 4BQNA 5J47A 2DDBA 2CYYA 4XOPA 5B5EC 4IF4A 3CO6C 1G3TA 3D5RC 3K1NA 1JJ8C 1W5SA 4XOTA 3F23A 1A31A 4FTHA 1NK2P 4BY7J 2GZWA 4XRSG 3BG7A 4NQWB 1BN5A 2TCTA 3S1RJ 3CMEI 5IT9K 2M1BA 4Y13A 3HPGA 3RQ4A 2LF8A 5D5WB 5EG0A 2X1DA 3JRHA 1G4DA 1QNTA 2R3SA 2WAFA 3BOQA 1KU9A 3E5XA 3QU6A 5TJJA 3BTIA 2KQRA 2UZKA 4BBSJ 3OV8A 1DU0A 4PJ0C 4PSXA 3MMYB 4NQWA 3Q0VA 1KZHA 4XONA 3BTJA 4AYBA 1MDMA 2JK3A 2WC2A 3ELKA 1TC3C 3LSJA 1FP1D 3GWZA 2GM4A 1UG0A 2H1KA 2NVTJ 1T0FC 4D5FA 3TP3A 1D0XA 4B3XA 1KQ0A 1I3QJ 1HW1A 3DBLB 1HCRA 3QOPA 3CTAA 4QLCU 1YI2I 5FLMJ 3GMEA 5CVJA 4KMFA 3I71A 2K40A 2CQNA 2M7AA 4GCVA 2K5CA 2PMZN 3M1EA 4NB5A 1BR4A 2KMUA 3K4NA 4AUXA 5K5QA 3N4MA 1TT5B 2OZ6A 1DP7P 1DQUA 4ZYEA 4E7HA 1Y8QB 2NS0A 5CQEA 3RSNA 4OU0A 3B02A 1W0UA 4PCQA 2IGMA 1Y6IA 3LSIA 5DD8A 1NH3A 2DTRA 2LF7A 4HNUA 3G73A 2O61A 3OL4A 1IO2A 2W82A 1HW2A 5H6RA 3GYHX 2OV7A 2KHMA 2E2JJ 3BY6A 3HRMA 3LA7A 5IP9J 1ETVA 3GFMA 5D4SA 5IY5H 5CVUA 1NK3P 1F5TA 1O7FA 4V19K 4ZDOA 4LK1F 1T33A 2EIMH 4A12A 1GVJA 2ZXHA 2QM3A 2QVOA 3CLOA 5F1RA 1W7PB 4AIDA 3EUHA 1WJCA 1YQAA 1RKWA 2PN6A 1S29A 4M3DA 2R7OA 5C4JJ 1SFOJ 2R7XA 2E34A 4LLLA 4BH9A 3LAPA 1JHHA 4LIUA 3I9V2 5LGNA 3JAMZ 1WH7A 1ETKA 4N9HA 3DFGA 4A3GJ 1W7PA 1X1AA 2AXTC 2OAZA 1R7JA 2Z9OA 4M6XA 4NC6A 5E20A 1JT0A 3C3WA 3H5AA 3SZGA 5ICEA 2E7XA 1SMYF 3AG3H 3F8NA 2DAOA 1XDSA 5CYVA 4DZJA 4GXOA 3O3KA 1TTYA 4UUSB 1J59A 5HODA 4UHTA 3HSFA 4HX4A 3CESA 1MJ9A 3K2ZA 4BJ5C 1MBKA 2I8DA 4XRMA 2L3DA 2LD5A 2A05A 2HVRA 3LSKA 2O03A 4V2FA 2DMNA 1YIJI 4UUSA 5EGOB 4A5NA 1ZN2A 1O3RA 1OLTA 2PJRA 3BP8A 3TP0A 3ASOH 2H8RA 4IJAA 3F8FA 1XN7A 3K70D 1NTCA 2ECBA 4P9FA 2KP6A 4BGDA 1VQ4I 1NHAA 2LH9A 2K3FA 1XGSA 1HLVA 1ZARA 3EDPA 5EGOA 4A3LJ 4G6DA 1BR1A 3I56I 1Z6TA 1PJRA 2DOFA 2WB1A 3CJNA 4QPQA 2QSHX 4X1EA 4CCJA 4OIQF 3DQVC 1Y0NA 3FWEA 4CO8A 4XM3A 4EVIA 3PFIA 1VQOI 1H9TA 1OCZH 3TDUC 3KYLA 5BQTA 1JJ6C 1BOAA 4OINF 4F52A 3JRGA 2BHZA 3S2WA 1Y39A 1ULYA 2CW7A 1ORKA 1E2XA 1RUOA 4D7NA 1L3LA 3DBHB 3I4PA 4A3JJ 3QWLA 2CV1A 4I98B 1NG7A 3ZMUA 2L4AA 2DA2A 4EJWA 2EIKH 4L9NA 2PBIA 3ABKH 1OCCH 1MZBA 1Z05A 1TWFJ 2CUFA 3RDIA 1HSJA 3FMQA 3DLLF 3BROA 1MBGA 4U0VA 3A03A 3OY9A 1MNEA 2W1OA 3FBIB 4ZZDA 1BIBA 2ZCWA 3HRTA 2D45A 3WU0A 4IHWA 1U0JA 2HQNA 2VQGA 3ZR8X 5C44J 1WJDA 2YUSA 2IS6A 1WHUA 3HG9A 1SFXA 4AIJA 2QKLB 1TWAJ 3V8KA 4E6KG 5FB2A 3OYEA 2FF4A 4MFEA 4BS9A 4LD5A 4XLEA 5HLGA 2WAQA 2HNHA 4AVZA 2O6GE 4N4OB 3BG6A 4RM2A 4C2UA 3QYEA 4EM0B 5DM7F 2RV8A 2VQCA 3LFKA 5FRNA 4RAYA 1BI2A 3CD6I 4II3A 3ZPLA 1D8JA 2HU9A 4JYKA 1U9NA 3OYMA 4D0PA 3ERED 4E4HA 4UUTA 2CRGA 5E1ZB 3FHNA 2B63J 5J1RA 1R1TA 3WHCA 2R7RA 4F92B 2O8XA 4AIHA 1GV2A 1XGMA 4RB3C 4JX6A 4ETSA 4XKWA 1GXPA 2FX0A 2DA3A 4EEFG 3GUDA 1H0MA 4HW0A 2RC4A 3BG3A 2KPMA 1IJWC 2XF5A 2KJBA 2MD0A 3R4KA 1RC9A 4H0EA 3U9GA 1A35A 2PLYA 1K79A 3H0GJ 3I3LA 4IHVA 1SD5A 2VBZA 3ULQB 4Q47A 2KLOA 2V9PA 2V4JC 3QPHA 3G1OA 1IW7F 1ON2A 1R36A 3E1SA 3DEWA 3LQQA 5E3NA 1OR7C 2P8TA 2MD5A 4A3FJ 1QQIA 2K9MA 3KYDB 1VQPI 4BQAA 1HDDC 4KN7X 3MZYA 1BA5A 3F21A 1N25A 4M72A 1R71A 5J4VA 1YHQI 2QQAA 3HYIA 5IOZA 2HKXA 4A69C 4F55A 3DKYA 1YW9A 5JLXA 2HXOA 3M1CA 3QP5A 1RR7A 4XKVA 4D5CA 1Z3YA 3VEPA 3IWZA 2KIFA 2NNYA 1J0RA 1WCMJ 3FBNB 3K4JA 2V1NA 3BC8A 4NC7A 1XC5A 2DPDA 1YYVA 3PNVA 1WKMA 1UHWA 2FSWA 3KP5A 1SVOA 3CUOA 3M8EA 3J81K 1EH8A 5IYDJ 3F3XA 4RLQA 1K78B 1K4TA 3AG2H 1QO0D 1T38A 4KITB 3F22A 4GYIA 2Y48A 4ZTJA 5HOOA 1J5YA 1D0ZA 3DTIA 2KJCA 1POGA 5E3MA 2VB6A 2JPCA 3BR0A 4MEYF 1U3EM 2VJ4A 1E0EA 2Z33A 2RQPA 3I59A 4RA2A 2ZJ2A 1WPKA 3FXKA 5GTHC 3FKJA 2GWRA 3PO2J 2EFOA 4IO9F 3QOEA 3BJAA 1FC3A 2HVQA 3O8HA 2LTPA 2M5WA 1XTAA 2MABA 3D1NI 3ML6A 3U1DA 2WBMA 1YLFA 2NS7A 1BJZA 4M71A 2MLKA 4N4NB 3S93A 5JR3A 5DEQA 2A07F 3FXUA 4ESJA 3T8TA 2DT6A 1B4AA 5E1XA 1HF0A 1B9MA 2DOAA 1ZELA 1APLC 3DPTA 4HZFA 3HOZJ 5DYMA 2JPBA 3TW7A 4A3EJ 5EJCA 4B48A 3PIOF 2VE9A 3MFKA 4M74A 2DQLA 2F5FA 4G6TB 3FIWA 1D1AA 2W24A 2E5NA 3RPQA 2PMZA 4HLYA 4IKFA 1K7AA 5FKOA 3CF5F 1Y0UA 4J19A 3B6AA 1LB2A 4ZYHA 2XAJA 4IRGA 1JGSA 1W5CC 2ICWG 2BVMA 1QBJA 3DV8A 4B44A 3EPZA 4I09A 1U5TB 1YW7A 4MFDA 5TGTA 4PSWA 3BTCA 4CXFA 4AC0A 4F91B 2L9NA 3IAS2 3RKWA 2EWNA 4I2OA 4QPOA 2LR8A 3VB2A 4XRSA 1CGPA 1UHSA 4W97A 3GVAA 3HSEA 4BE2A 4RDUA 2JN6A 5EEHA 4XN3A 3ZGKA 1VNDA 2M4KA 4G7HF 3EYYA 1T98A 2UV1A 1WZ2A 4B09A 3I4NJ 2ME6A 3BR3A 3WG9A 3G71I 2UUZA 3K1MA 2JRMA 2HOEA 3R0AA 2RKHA 2XGEA 5LRRA 2R5YB 3RPUD 4HX8A 2LLKA 3B73A 1IGNA 3K2AA 2BXZA 3L7WA 4XKCA 4ENNA 4P5OA 2IAIA 4B4CA 3NAUA 4KT5C 2R7SA 1D1CA 4XLHA 4FHTA 5F6FA 2QENA 2QYOA 3FXMA 3LL7A 2V6CA 1GDTA 1ERDA 2Y30A 3CP2A 5HVQC 1FTZA 1OCPA 2R5ZB 1LUJB 4LG3A 4AD9A 1ZK8A 1EH7A 1RRJA 1QPMA 1SAUA 5ICGA 2ECCA 1X2MA 4RGSA 2DMUA 4A3CJ 4RS8A 2QSFX 3MKLA 4EV0A 2ADUA 2BY1A 1LDKB 1J2XA 2JUGA 1XMXA 2MYSA 3E6DA 2OCEA 5D6EA 2ZC2A 1TW2A 2R5ZA 5L3BA 1RUNA 5F0HA 3K70C 2KISA 1ZG5A 3S2HJ 3RKXA 4ENJA 4BXFA 1TBXA 2JZYA 3FF5A 5J3LA 3Q0WA 3P9CA 4ENKA 1QPIA 1WI3A 1AKHB 3DF8A 3K4LA 4R8HA 2PI0A 3TOBA 2L02A 3W6JB 3ZQIA 2FE3A 2ZJPF 2M0CA 2BHYA 3W2AA 4OIPF 1GV5A 3HOUJ 4A6DA 3LSHA 3MZHA 3RJPA 1FSHA 3DU6A 3QPSA 5M3MJ 3LQRA 1AKHA 1YE9A 3F6OA 2LMDA 3GTPJ 2QWWA 4I6ZA 1I50J 2LY2A 3FXLA 1O57A 5J8FA 1REPC 1FMWA 4F7ZA 3OYLA 3OSFA 3O2PE 4YIRX 2DYSH 4FT8A 5GAGJ 4LG0B 2VOOA 3HKZA 3LA2A 2F48A 1N78A 1GT0C 3GZ5A 2L9SA 3ZQHA 2GBYA 3K69A 5DM6F 3KLOA 3HBLA 5D8KB 4MGRA 3FXJA 3CMMA 4LG0A 4CCNA 3OYFA 2VXZA 3ZQ7A 3PNTA 2DO7A 3DEEA 3H9JA 1FSEA 2DA6A 1FMVA 1EKEA 2M4GA 2VI6A 1S72I 1IZ1A 1U78A 5B1AH 3OMYA 2W00A 4BU2A 2F2EA 1MKMA 1PVEA 2IA1A 3MCZA 2M2EA 4R79A 4L18B 5K5RA 1FT9A 1FJLA 1IXCA 3MVPA 1RPWA 4I7HA 3ECHA 2Y69H 1LFPA 4I0AA 3I0TA 2QSGX 1B1BA 2TDXA 3UR3C 1BM9A 2VC1A 2HZDA 1USTA 3H92A 1TLHB 2OBPA 2TRTA 3JAMK 4Z2YA 2B9SA 2E1MC 2DFIA 5B3SH 3VSLA 5AIPA 2EFWA 5FLVA 3C1DA 3GTKJ 1HKQA 4YIFA 1BI1A 2QGUA 1PP8F 1F36A 5F64A 3BR2A 2FNPA 3M4OJ 3H3UA 3FM5A 5J1YA 1XDUA 2P0WA 5F04A 3H35A 2A68F 3H3ZA 1RESA 4EJOA 1LQ1A 4Q5SF 2XPVA 3Q9VA 4Y52J 2XAFA 4Y17A 1YFHA 5HS8A 2O5RA 2PMUA 2AXLA 4MLOA 2M0MA 2HQAA 5IOYA 4EJTA 2JVGA 4XSXF 3IWFA 1W4MA 2ZO4A 1QU3A 4L5IA 3F8MA 2LOOA 2QBYB 4BL0B 2EJRA 3ZQLA 4AU7A 2XVCA 2GOXB 2X1CA 2CFXA 4A3DJ 4MTDA 4ABZA 3PL8A 2R7FA 1IUFA 2DMQA 3G1MA 4FE7A 4C3HJ 1FYLA 1GXQA 2QBYA 3TMOA 2BOLA 1I1SA 4MTEA 2IS4A 4HNTA 3JRFA 2VIXA 3WU1B 3BG9A 4EJUA 1I39A 2A6TA 5J8CA 2B0LA 2P4WA 2MBFA 1R23A 3PSIA 1XS9A 2NAZA 4HAMA 4PJMA 2NVYJ 3IRRA 1YTYA 3HL2A 2E7WA 3S3OA 3BWGA 4KNYA 2LC2A 4IL6C 1MBHA 4GO1A 3L2UA 3V8JA 5FRMA 2XC7A 3P9KA 2K85A 1Y8RB 2WV0A 3OS1A 3TO6A 1Y1WJ 1X1PA 1WJAA 1A6QA 1VFCA 2XB0X 3IH3A 2RVCA 2X48A 2EZIA 4AWXB 2IBDA 3B6CA 2R93J 3MEXA 1X1CA 2NYXA 1TWHJ 2WWYA 4HEA2 4IOAF 4KN4X 5E3LA 4XL9A 4ZDLA 3L2CA 1PDNC 3NEUA 4P1WA 2QA4I 2BBYA 2LFBA 1ZR4A 2NXNB 1X4OA 2RN7A 1HBXG 1VI0A 1FOWA 2E71A 2L9RA 3JRAA 1D3YA 2K86A 4L9JA 1SFUA 3FK7A 3F6VA 4CICA 4DOZA 2G0EA 1WVRA 1SMTA 4YFNF 2BGCA 2DJIA 2IRFG 4L0ZB 5L3FA 1Z9CA 1ZH5A 2A5WA 2CSOA 2PG4A 2DK5A 3KCCA 1I6HJ 3GTGJ 4EMSA 1J09A 5JI6A 3J7YJ 3GEZA 4XMYA 5D6FA 3KX2A 2FMYA 1VQ7I 1MMNA 3F9KA 4FCYA 5LHIA 4S05A 4CYDA 4A3KJ 5D4RA 2DOEA 2L7KA 3EYIA 4B43A 2DMPA 2GXGA 1R58A 3HB9A 3PUBA 1VQLI 5F08A 3TO9A 3VWBA 2R7WA 2YU9J 5KCMA 2ZJRF 2VJJA 1KA8A 1X3ZB 2V9VA 3AG1H 3WE2A 5JHFA 4OWRB 1Z3XA 1HC8A 1IRFA 3ZMVA 2VKDA 2HVSA 3OS0A 2OUMA 2W25A 4IZZA 1FIAA 1AOYA 3IRQA 2XROA 5FKMA 4C9YA 2CV2A 1R49A 2ME0A 1IG7A 3U1KA 1P4AA 3X2QH 2HI3A 3QYBA 2OQGA 3ZMTA 1V3FA 2X0LA 3ZN0A 4UV9A 1LVKA 1G59A 1XMAA 2JA5J 2DU9A 5DDGA 2R7DA 1P7IA 2A3SA 2LKXA 3BQZA 2JA2A 3GFIA 2COMA 4TV7A 4XR6A 2W7NA 4NDLA 5HLTA 4WXHA 5M5XJ 1UMQA 2Y9YA 3J7AY 3WTXC 3BJ6A 1DGWY 1F1ZA 1WSUA 1FBSA 3KEQA 2IT0A 3LSTA 2M87A 3ZOBA 3LSPA 4D1QA 1LDJA 2H8WA 1P4WA 2O3FA 4M3BA 1K61A 2ZBKA 3TQNA 4IPAA 3TDZC 3IH4A 3C7JA 1TQPA 1WFXA 4WWCA 5K1YA 1HDPA 2IEKA 4XKBA 2KFDA 1JT6A 4BDYA 1MMGA 1QZYA 1R5ID 1U8BA 2LY1A 4A2UA 1Q1VA 4A5MA 2LK2A 1MW7A 3Q9SA 4S04A 3S1MJ 3L1PA 3N05A 3H0DA 1RIOH 4HG2A 1EF4A 2V1XA 2FOKA 1FLIA 3DPLC 1IN4A 5LGTA 3ZQGA 2JMWA 3ABUA 2HPMA 5CPRB 2CO5A 1IDYA 2X51A 3PIPF 2VKHA 3K4BA 5J1UA 3AL0C 4I99C 3HSRA 2DPUA 3HKZN 5H20A 3OYJA 1LEBA 1G3YA 2DFHA 2IGKA 5BOXA 5IP7J 3MWMA 2YR2A 4M73A 3I5UA 5L3DA 3H5RA 5K7HA 3SXYA 2XV4S 1G2HA 1P6RA 3UNGC 3GTLJ 1DDNA 3KPHA 1R6RA 3MAJA 3EUHC 2W85A 2HEOA 2FU4A 3HOXJ 2FBKA 1HKSA 3C2BA 2VODA 2Z99A 5EEAA 3GLXA 2E1CA 1OR7A 1SEUA 3PM1A 4HSTA 2L2OA 4CH7A 3KFWX 3HM5A 4G9YA 4XIDA 4U87A 3FXRA 3CUQC 2GA1A 1TW3A 2NNNA 2KT0A 1XCBA 3LNQA 3V8LA 4BXXJ 2LNBA 2PX9A 1V5GA 3PQJA 1DU6A 4KDPA 5CKTA 1R5HA 1ONVA 3SDGA 1KU7A 3E6MA 4Z6YA 5HS7A 2OF7A 5D8LB 3IHUA 1Z67A 4CYCB 2ZMEC 3DKXA 4LJZF 4CA0A 2AS5F 5GPCA 2F6CA 1A04A 3GF2A 2EZLA 4HOBA 4IEJA 2HOTA 1KQ9A 3VYSB 1F9NA 2P6SA 2NS8A 1UAAA 5IPAA 4UVCA 1LE8B 3J80Z 3T8RA 3CQZJ 2HFHA 3RKYA 3JSOA 1DP3A 4CYCA 1AHDP 1P7JA 4RGXA 1SD7A 1KGSA 1ETWA 2QQBA 1VQNI 5GAEJ 4MNUA 3OIPA 5EZHA 2EFNA 5DV5A 3ZMZA 4S0HB 3V4GA 1FIPA 2KIUA 3OL3A 4C2MJ 1LE8A 2RGVA 1AU7A 1JKQC 2BEOA 1ETXA 3FZVA 2WA0A 4Y33A 5TRDA 4CCKA 5BMZA 1BW6A 1RETA 4ESFA 4KIFA 2GQQA 3OYIA 3DEUA 1AA7A 1UELB 2EILH 3VFZA 2VKEA 3T5XA 3K1PA 1TL8A 3KZYA 4KISA 1D0YA 1WWXA 1MD0A 4HV6A 3RYPA 1V5EA 3ABMH 2M8GX 1W36D 1O3QA 4ENMA 3L2RA 1Z1DA 3HUGB 3MZ8A 1NG6A 4YFKF 3TL4X 3IP4B 5L3CA 2IS1A 1FOXA 1K83J 5GPAA 4DIQA 3H1CA 3LSRA 2UXNA 4JX4A 3CF2A 4ZC3A 3LSMA 3E0JB 2ETHA 3S16J 1S7OA 3I58A 1ZYRF 2LKSA 2Q1ZB 2M3AA 3HUGA 4RAGA 5K5OA 1VF9A 1GLNA 1UHMA 2RAEA 1S7EA 1S8NA 3A01B 3PQKA 4X6AJ 1RI7A 2K9SA 2CH0A 5ED4A 2CWEA 5D5UB 1QHHD 2Q8KA 4BDZA 2EFQA 3KE2A 3IUOA 1KONA 2MLGA 5B1BH 5LBQA 2NRAC 2X6XA 4Q48A 4E7JA 1XX5A 3JR9A 3E6CC 1IXRC 3E5UA 3HTSB 2HYJA 3A01A 4XQFA 2NVXJ 1YG2A 5CVIA 4I0BA 1EV7A 1BIAA 3WU2C 4DYRA 5HDNA 3ESWB 3IKVA 4HF2A 3OIOA 1QVTA 2ZXIA 3K10A 3IL2A 3CP8A 4KIGA 4A3BJ 1IV8A 4CGZA 5IP6A 2L01A 2AQFA 4K2EA 1JGGA 1BC8C 4KICA 3HGYA 2Z1DA 2FQ3A 3GTMJ 1K78A 3O6BB 5FLXZ 2GIZA 5HDKA 1YITI 4MIMA 1HSTA 2D2WA 3S3NA 1G6NA 4O5VA 2KRFA 2VBXA 3L2VA 1YJ9I 5JVTA 2H27A 4G7OF 3LOCA 1MBFA 3DBRB 4M9XA 2XDVA 1B9NA 4ZTFA 1IUYA 1YS6A 3H3VK 3G2BA 2XRNA 2DFFA 1ODDA 4RMNA 2BVLA 2EQRA 5E1WA 3VSKA 3WODF 5LHHA 4P55A 4BAYA 1FY7A 1HW5A 3GTJJ 3W6VA 4XN0A 2EH3A 3DU5A 3EUAA 2K9LA 5BS6A 2RDPA 1USSA 3QPTA 1X1DA 1ZG1A 2MFZA 3HHGA 3WHBA 1X4PA 2HDWA 2NOJB 4KYWA 2HR3A 5A2QZ 3S1NJ 4U7BA 1BOBA 3G3ZA 2OD5A 4U7DA 3SEQA 4DW6A 3SZPA 3ZQQA 5LEJA 1JI8A 1ZKGA 3LWFA 4LGWA 5KNLA 2JJ7A 5ERIA 2MH2A 4E7LA 2HPIA 4BYYA 3QODA 3E97A 1VZ0A 3KEOA 1E3HA 1E17A 2STTA 3T0YA 2UXXA 1ZREA 2Y31A 4IRHA 4JOMA 2OQRA 2X1EA 2D5VA 1Z0XA 2RNJA 2VJ5A 3K9TA 4E7KA 2N8GA 1XG1A 2F5VA 3TKYA 2CQXA 4O3MA 4U0WA 4EGYA 2L9VA 3HXLA 2KZVA 1FP2A 3R60A 1OISA 3N97A 2MSYA 4H4KC 1U5TA 2XHKA 2A69F 3CCVI 3BR1A 5IYCJ 3IAM2 1KYWA 2I5UA 4JBAA 3ZXSA 5GP9A 5AIQA 3S14J 2K4JA 3E5QA 4QIWN 1XD7A 2ZXWH 3LSGA 2FUG2 4G6QA 3ASNH 1B6AA 1IC8A 2XGDA 4HQEA 4CSWA 4X0GA 1VTNC 4KMUX 2P5LC 1JHFA 2V26A 2KRHA 3CC2I 2EV6A 2A6HF 3R6SA 1X1BA 4CZCA 3HOVJ 1TT0A 3H36A 3M8FA 1FX7A 3BLYA 2W84A 4HF0A 3V7CA 3C2HA 2R5YA 3RTRA 3FXQA 5F1JA 3CJTB 2ACJA 4KT6A 4XSZF 3WGHA 2GXBA 2BYVE 2FJ1A 1TWGJ 5FFXA 4B8XA 3JTGA 1PUFB 2JQ7A 4A0ZA 1ITYA 3RKQA 3IC7A 3LMMA 2XF7A 2IP2A 2VPLA 2DTZA 4I01A 4XLAA 2LBFB 3L9FA 2XPWA 2FBIA 3KP3A 1WJ5A 3PNYA 4FISA 3Q5FA 4JX5A 2M7BA 4CCLA 1DGRM 1PUFA 5M5YJ 3EETA 2V9KA 4RAZA 2E1OA 1Z6RA 1LNWA 2E1MB 2STWA 1ZR2A 4L5EA 3G4SI 2OTJI 1EH6A 2DW4A 4YG2F 4N9IA 2LBFA 3TO7A 2K7LA 3Q3SA 3SFZA 1UFMA 3TGNA 1P9QC 4UVAA 3G1LA 3VYTB 2Z3YA 5DCFA 4DNCA 1YJWI 5LEKA 1H89C 4JQFA 3CCQI 1X3WB 1W0TA 3OR1C 1QHGA 2AHQA 3JCUC 2QEXI 1LEAA 1MIJA 1W7PD 1ZTRA 2ZJQF 5C4XJ 3GTQJ 1TQIA 4PZJA 4CHUA 2VPRA 1RZ4A 2VQLA 2E60A 3GBGA 5FROA 1MBJA 1T56A 3LAJA 3Q0UA 1YRNB 3ABTA 3BTLA 4EM2A 5JFRA 2EZHA 3ZQFA 5E8IA 3WTSC 2L54A 3M3YJ 4GRIA 4QTRA 3OYGA 1OYYA 2R4GA 2ZSHB 1YX3A 1V4RA 2R7QA 3NWTA 2CQ7A 3C18A 4HRIA 2HOAA 3JRDA 3CDLA 4HX7A 2IS2A 2IGNA 5C3EJ 3JRBA 2B7EA 1YRNA 1U9OA 2DA7A 2GLOA 1FNNA 1ZAOA 2XF6A 3CCYA 3CJQB 3WTUC 4BHBA 1G3SA 3GFJA 3I55I 4G7ZF 5M5WJ 5H2FC 1JKRC 1KQ8A 2VT3A 3ROUA 1QZEA 1KU2A 2MW8A 2HXIA 4GYGA 1ZGAA 2HOSA 2BZTA 4A3MJ 3SQNA 4J01A 1U6GA 2KKOA 2YX4A 4XRFA 2KRCA 3OYNA 4C2TA 3RQIA 1HXDA 3GZ6A 3SZTA 1VQ8I 3KP7A 1MMSA 2E2HJ 4BEHB 3S2DJ 4EQQA 2VN2A 3RYRA 2CQQA 4RGUA 1IF1A 1R1VA 2CUZA 2DJNA 4ZJZA 2QQ9A 1PP7U 1RR8C 5KK1A 3GXOA 4QWQA 2XAGA 3V7RA 3PSFA 4BEHA 3M9AA 3I53A 2E2IJ 5GTIC 1ETYA 4M3EA 4KFCA 4DYCA 4U88A 3U2RA 5K7FA 4HSRA 2I10A 3VOEA 5LLQA 1B72B 2BV6A 1T0FA 5ILVA 2LREA 3CC4I 4O6JA 4BKXA 4LLNA 2HWVA 3JRCA 4PDKA 1IRGA 1B72A 2OJED 1XMKA 3HJEA 1IN5A 3BT9A 2XGXA 4OAYA 4BQQA 1FPQA 2LDUA 3DWLE 4HLXA 4DBQA 2XAHA 1B59A 3WG7H 2VL8A 1JUMA 2VKVA 2HKOA 4PK4A 1D1BA 2Y0MA 4M9ZA 1G3WA 3WGIA 1XSVA 2ESNA 4PJJA 5BNGA 2M34A 2MGQA 1R4NB 3COAC 4A0YA 1K6OA 4BQOA 2HGCA 2DT5A 1ETQA 1AWCA 1P4XA 2MC4A 4YIIA 2OC6A 5M3FJ 1W36C 1ZRCA 1ACIA 1R1UA 2Y9ZA 2KIQA 1BJAA 2PEXA 2FEZA 4B47A 2ISYA 4IOCF 2GAUA 4HNVA 1CF7B 2CJJA 6PAXA 2G7HA 5JLWA 2VJIA 3NARA 4Q4ZF 5JVGF 3EUKL 3S3MA 2R92J 1OCTC 2XSJC 1A36A 2K9QA 4NHJA 3BDDA 3EQLF 1CF7A 3S8PA 3I54A 3NWSA 2FXAA 4BBRJ 2A6EF 2Z5UA 3ECOA 3KP2A 4E7IA 4UB8C 4QSHA 2K4BA 1DPRA 1OYIA 4OMZA 4R1HA 4C3JJ 1XGOA 1PYVA 1MH3A 1U2WA 3HPHA 1XSDA 3HOYJ 5EG0B 1TP4A 1GUUA 3REOA 3GZNB 5EF6A 1MSEC 3A0HC 4RGRA 3WTTC 5F0CA 1KU3A 4BJTA 1MSFC 2ZNYA 1IN6A 3RI4A 4DJAA 1OFCX 1FZPB 2FNAA 4FX0A 2EZKA 3DKWA 3HGGA 1R9TJ 4HDVA 1OYWA 1MDMB 2P5KA 2QCOA 3BZ6A 3SYTA 3IKTA 1XSXA 3CZ6A 2BY2A 5EYRA 3CCMI 1B8IB 2Q0OA 5DCMB 3BR6A 1UJ8A 4LITA 2VOPA 4NNJA 4HF1A 1FEXA 1HKTA 2J5OA 2K02A 1F4KA 5HDGA 2M30A 1J9IA 4M9SA 3OIQA 4BUPA 4D7MA 2M9HA 1OKRA 3FMSA 3R0JA 3VYUB 1V55H 5LD2C 3S17J 2F4MB 2EV0A 2GIVA 3TW6A 4MHGA 5DCMA 1B8IA 1P92A 1I1GA 1MJBA 3FKIJ 1V54H 2CU7A 3MD2A 2ESHA 2E36A 3J7AO 1LJ9A 5LFAA 2IA2A 2X6OA 5ILSA 1ZQ3P 4PUSA 1FOYA 5LGUA 4HA8A 2HDDA 2YX7A 2X85A 3RPUA 3RZOJ 2QF7A 3AKZA 1RKTA 2MC3A 1D8KA 1JXSA 2DFEA 2WTEA 3S32A 1OCOH 3E7LA 1FTTA 1YX5A 5BPDA 3FX3A 2EFPA 2DMTA 3J80K 2KIMA 2GA2A 1ZLJA 3AL0B 5KAIC 1IXSB 1SD6A 2IXSA 2P6TA 4MEXF 1LFUP 1TWCJ 2ELKA 1YW8A 5B66C 3P7NA 4IVNA 3C2GA 3W2VA 3SFIA 1IN7A 2QUFA 3GTOJ 3JREA 2AQEA 5L3EA 4HDUA 1WI9A 1J7KA 1I3AA 2PQ8A 1T39A 4ITVA 3BG5A 1G8XA 3D5SC 3SDBA 2JA6J 1FOKA 5FFZA 1ZGJA 2DK8A 1WJEA 2OCCH 1BR2A 3CJRB 1I5ZA 3A1YA 2Y0SN 4FETA 2MG4A 3OWTA 3JW4A 3H9QA 4HV5A 2OPTA 2BXYA 3NRVA 3CUQB 1YS7A 3JRIA 1O4XA 3F0CA 3KZZA 4BHPA 4G12A 5DUKA 2GXAA 4G8XA 1BC7C 2E5ZA 4B3AA 1CQTA 5CQGA 1EJ9A 3CCEI 4EGZA 1JE8A 2RREA 1OJLA 1D5YA 2JA7J 4AVPA 2EK5A 2H1LA 2FRHA 1K4SA 1T95A 3BZCA 1SFKA 4IHSA 3CUQA 2V79A 2R7VA 1J75A 2LG4A 5D5XB 4DQ2A 1R4MB 4HYEA 1ZRFA 2ZMEB 1XGNA 2EA2A 3FK6A 5FGMA 4AIKA 3A02A 2W57A 4XK4A 1VQKI 3SJMA 2LVSA 2FQ4A 2QQ8A 3VODA 2G7UA 2CFOA 3FM3A 4WK8F 2PJRB 2HS5A 1EA3A 1IV6A 3OOPA 2WAEA 2QZ8A 2ZMEA 3S15J 2IW5A 1DUXC 1X19A 2DBBA 1V5FA 3GW2A 3BZKA 3K6GA 3L09A 2EA4A 2LYCA 3DP7A 1KYZA 3HRUA 2AO9A 4L9TA 2IVMA 1S7AA 2COBA 5FD6A 1IRZA 1T8IA 5EEGA 2VXDA 1O7LA 1X58A 2CUEA 5HS9A 3AAFA 3K4CA 2FA5A 3P9IA 1BL0A 1WGXA 5FKKA 2O0YA 4ESBA 3MKWB 3K7AJ 3WTWC 4FASD 3OYAA 1P2FA 4M6YA 3ONQA 1Z91A 3QAHA 3K4MA 4DZPA 2DYRH 4YEJA 5FLXK 1SVMA 1LPQA 2XIGA 3PFYA 4Y4RA 2YS9A 2JT1A 2ZFWA 4GGGA 5IT9Z 4C30A 5HNFA
chains in the Genus database with same CATH topology
1ON1A 4L9VA 3QU3A 3ZMSA 3E3VA 1S6LA 2DI3A 3HTUA 4PGGA 4PGHA 1DPUA 2HYFA 2ZNZA 1L0OC 3ZN1A 5A2QK 4A0XA 3K0LA 3FHZA 1ZLKA 3WTZA 5FD5A 2M45A 5J6XA 1TNSA 1FWZA 3GO5A 3HOSA 2CW0F 2Y75A 4E70A 1FYMA 4ZYDA 4CDGA 2C6YA 1GHCA 3D5LA 4XLNF 4BXUA 3JTHA 2YPRA 1ZRDA 2JRTA 1FYKA 5D5VB 4KIBA 2VBYA 4BHCA 1SD4A 5HLHA 3L00A 5FO5A 3QRFF 1O3SA 1WQ2A 2EV5A 1XCVA 1T6SA 3KP4A 4P9UA 2H09A 2F5DA 4A6EA 2LKPA 3SHFA 2OU2A 2MH9A 1SAXA 2ISZA 5HLIA 2F5CA 5LRSA 4EJVA 2DLLA 5BPIA 2HYGD 5ICFA 3CDHA 2JSCA 3HHHA 4JK1X 2VE8A 3KETA 3R61A 1LDDA 4N0BA 5ILUA 2VONA 2VT2A 4L0YB 2IA0A 4UV8A 5H6QA 3F8CA 4WCGA 1IAWA 3I59B 1YIOA 4ZZLA 4XLPF 1OMIA 3NQOA 1MJAA 4IXAA 2HQRA 4KA4A 4UUVA 2H6CA 5CVRA 1C0WA 2YSRA 1W5TA 4CZZA 2XAQA 2XKPA 4U0YA 3CO7C 2LSOA 3ZMDA 2F5EA 5CVVA 1R00A 1TNTA 3MQ0A 2Q2EA 4MQ9F 2EB7A 4HQMA 2M8EA 3QP6A 3ISPA 1STZA 4IHTA 2L4MA 2JTVA 2P7VB 5IT3A 2VBWA 4IRIA 4EM1A 1XB4A 2ZXJA 2G9WA 5LHGA 2HTJA 2PMHA 2ZKZA 5JHUA 4ON0A 4RB0A 1FBUA 4WF2A 4RB1A 5DD4A 1ZHFA 2CGPA 5E8GA 2OA4A 3JSPA 1Q1HA 2MA3A 2DQRA 1D5VA 2ELHA 3F72A 3T1BA 2D1VA 5E18F 5CLSA 1X3UA 4WXCA 4ASNA 4OIRF 3I64A 1I6XA 2QLZA 4YFXF 1SFEA 3LA3A 1MGTA 3BJOA 2D1HA 4LMYA 3HRSA 2XASA 3HOTA 2OZUA 3M7GA 2J5PA 1H9GA 4WXDA 4LFUA 3DXJF 1FBQA 2IPQX 4ZH4F 4LB5A 2HDCA 2FMLA 2UWMA 1QGPA 2V1UA 3WTYC 1TQMA 4P96A 1IN8A 3J81Z 1LVAA 3V7SA 1OPCA 3HIFA 1O3TA 5KVRA 2A5YB 1S3JA 5AONA 3KLNA 1U5TC 2E1NA 1ZG3A 5L3GA 4MQVA 3TOAA 5ICCA 1R5GA 1QZZA 1Z7UA 1T2KA 2P7CB 1R22A 1BI0A 3BPVA 3WE3A 2H6BA 2IJLA 4UXNA 4OMYA 2HZTA 2CG4A 4FX4A 2A61A 2XKOA 2CQKA 1UCRA 3E6BA 2BE5F 1YO5C 1RNLA 1PUEE 3RIRA 4LK0F 3W6KB 1HQCA 2VC0A 4UVBA 3FMRA 3WTVC 4UNOA 4G94A 4WX9A 4RB2C 2V1DA 2K27A 3BPXA 1U8RA 2HTSA 2PFBA 4LLGF 4I02A 3GX4X 1I27A 2P5VA 4HBLA 2PJPA 4OIOF 4Y15A 3F8BA 3WGGA 1BBYA 4XBFA 2YU3A 3ZP5A 4KUMA 3KP6A 5E17F 1BI3A 2X4HA 5CJ9A 4LB6B 4OOIA 2XUBA 4BNCA 2H94A 1UB9A 1WRJA 2FBHA 3D0SA 4L5JA 3GFLA 4ZYGA 5DUIA 2CYYA 3CO6C 4IF4A 1G3TA 3K1NA 1W5SA 3F23A 2GZWA 1BN5A 5IT9K 2M1BA 4Y13A 2LF8A 5D5WB 1G4DA 1QNTA 2R3SA 3QU6A 3BOQA 1KU9A 3E5XA 5TJJA 2UZKA 3OV8A 4NQWA 1MDMA 2WC2A 3ELKA 1FP1D 3GWZA 1KQ0A 1HW1A 3QOPA 3CTAA 4QLCU 5CVJA 4KMFA 3I71A 4GCVA 3M1EA 4NB5A 5K5QA 3N4MA 2OZ6A 1DP7P 4ZYEA 2NS0A 4OU0A 3B02A 4PCQA 5DD8A 2DTRA 2LF7A 2O61A 3G73A 1HW2A 5H6RA 3GYHX 3BY6A 3HRMA 3LA7A 3GFMA 5D4SA 5CVUA 1F5TA 1O7FA 4LK1F 4A12A 1GVJA 2QM3A 2QVOA 3CLOA 5F1RA 1W7PB 3EUHA 1YQAA 2PN6A 1S29A 4LLLA 4BH9A 3LAPA 1JHHA 5LGNA 3JAMZ 4N9HA 3DFGA 1W7PA 2OAZA 1R7JA 2Z9OA 4M6XA 5E20A 3C3WA 5ICEA 2E7XA 1SMYF 3F8NA 2DAOA 1XDSA 5CYVA 4GXOA 3O3KA 1TTYA 1J59A 4UHTA 3HSFA 4HX4A 1MJ9A 3K2ZA 2L3DA 2O03A 4A5NA 1ZN2A 1O3RA 3BP8A 4IJAA 3F8FA 1XN7A 4P9FA 1NHAA 1XGSA 1ZARA 3EDPA 4G6DA 1Z6TA 3CJNA 4OIQF 3DQVC 3FWEA 4CO8A 4EVIA 3PFIA 1H9TA 3TDUC 5BQTA 1BOAA 4OINF 3S2WA 1ULYA 1E2XA 1RUOA 1L3LA 3I4PA 4I98B 3ZMUA 2L4AA 4EJWA 4L9NA 2PBIA 1MZBA 1Z05A 3RDIA 1HSJA 3FMQA 3BROA 4U0VA 4ZZDA 1BIBA 2ZCWA 3HRTA 2D45A 3WU0A 2HQNA 1SFXA 4AIJA 3V8KA 5FB2A 2FF4A 4LD5A 5HLGA 2O6GE 4EM0B 2RV8A 3LFKA 4RAYA 1BI2A 3ZPLA 1D8JA 4D0PA 3ERED 5E1ZB 1R1TA 2O8XA 4AIHA 1XGMA 4RB3C 4ETSA 1GXPA 1H0MA 3GUDA 4HW0A 2RC4A 2KJBA 3R4KA 4H0EA 3U9GA 2PLYA 1K79A 1SD5A 2VBZA 3ULQB 4Q47A 3QPHA 1IW7F 1ON2A 1R36A 3LQQA 2P8TA 2MD5A 1QQIA 4BQAA 4KN7X 3MZYA 3F21A 4M72A 2QQAA 3HYIA 2HKXA 1YW9A 3QP5A 3VEPA 3IWZA 2KIFA 2NNYA 1J0RA 2DPDA 1YYVA 1WKMA 1UHWA 2FSWA 3KP5A 3CUOA 3M8EA 3J81K 1EH8A 3F3XA 1K78B 1QO0D 1T38A 3F22A 4GYIA 2Y48A 5HOOA 1J5YA 2KJCA 4MEYF 2JPCA 1U3EM 2Z33A 2RQPA 3I59A 2ZJ2A 2GWRA 2EFOA 3BJAA 1FC3A 2M5WA 3ML6A 3U1DA 1YLFA 4M71A 2MLKA 5JR3A 5DEQA 2A07F 3FXUA 4ESJA 3T8TA 1B4AA 5E1XA 1B9MA 3DPTA 4HZFA 5DYMA 2JPBA 2VE9A 3MFKA 4M74A 2DQLA 2F5FA 2W24A 3RPQA 4HLYA 1K7AA 1Y0UA 1LB2A 4ZYHA 2XAJA 4IRGA 1JGSA 1QBJA 3DV8A 4I09A 1U5TB 1YW7A 4CXFA 3RKWA 2EWNA 4I2OA 3VB2A 1CGPA 3GVAA 3HSEA 5EEHA 4G7HF 3EYYA 1T98A 4B09A 3WG9A 3K1MA 2HOEA 3R0AA 2RKHA 5LRRA 4HX8A 3B73A 3L7WA 4ENNA 4P5OA 4KT5C 4FHTA 5F6FA 2QENA 2QYOA 2V6CA 5HVQC 4AD9A 1EH7A 1QPMA 5ICGA 4RGSA 4RS8A 4EV0A 2ADUA 1LDKB 1J2XA 3E6DA 5D6EA 1TW2A 5L3BA 1RUNA 1ZG5A 3RKXA 4ENJA 1TBXA 2JZYA 3FF5A 3P9CA 4ENKA 3DF8A 4R8HA 2PI0A 3TOBA 2L02A 3W6JB 4OIPF 2FE3A 4A6DA 3MZHA 3RJPA 1FSHA 3LQRA 3F6OA 2QWWA 1O57A 5J8FA 1REPC 4F7ZA 3O2PE 4LG0B 4FT8A 2VOOA 3LA2A 3GZ5A 3K69A 3KLOA 5D8KB 4MGRA 4LG0A 2VXZA 3ZQ7A 2DO7A 1FSEA 1IZ1A 1U78A 2F2EA 1MKMA 2IA1A 3MCZA 4R79A 4L18B 5K5RA 1FT9A 1IXCA 4I7HA 3ECHA 4I0AA 3I0TA 1B1BA 2TDXA 1BM9A 2VC1A 3H92A 1USTA 1TLHB 2OBPA 3JAMK 4Z2YA 2DFIA 5AIPA 2EFWA 3C1DA 1HKQA 4YIFA 1BI1A 1PP8F 5F64A 2FNPA 3H3UA 3FM5A 1XDUA 2A68F 3H3ZA 4EJOA 1LQ1A 4Q5SF 3Q9VA 2XAFA 4Y17A 1YFHA 5HS8A 2PMUA 2AXLA 4EJTA 4XSXF 3IWFA 1W4MA 2ZO4A 4L5IA 3F8MA 2QBYB 2EJRA 2XVCA 2CFXA 4MTDA 2R7FA 1FYLA 1GXQA 2QBYA 1I1SA 4MTEA 3WU1B 4EJUA 5J8CA 2B0LA 2P4WA 2MBFA 1R23A 2NAZA 4HAMA 3IRRA 1YTYA 2E7WA 3BWGA 4KNYA 4GO1A 3V8JA 3P9KA 2WV0A 3TO6A 2RVCA 4AWXB 3MEXA 2NYXA 2WWYA 4KN4X 3L2CA 1PDNC 3NEUA 2BBYA 2RN7A 1HBXG 1D3YA 2K86A 4L9JA 1SFUA 3F6VA 4CICA 1SMTA 4YFNF 2BGCA 2IRFG 4L0ZB 5L3FA 1Z9CA 1ZH5A 2CSOA 2PG4A 2DK5A 3KCCA 4EMSA 5JI6A 3GEZA 5D6FA 2FMYA 5LHIA 4S05A 4CYDA 5D4RA 3EYIA 2GXGA 1R58A 3TO9A 1KA8A 2V9VA 3WE2A 1IRFA 3ZMVA 2W25A 1AOYA 3IRQA 2XROA 1P4AA 2OQGA 3ZMTA 1V3FA 2X0LA 3ZN0A 4UV9A 1XMAA 2DU9A 5DDGA 2R7DA 2A3SA 3GFIA 2COMA 4TV7A 4WXHA 3WTXC 3BJ6A 1F1ZA 1WSUA 1FBSA 3KEQA 2IT0A 3LSTA 2M87A 1LDJA 1P4WA 2O3FA 2ZBKA 3TQNA 4IPAA 3TDZC 3C7JA 1TQPA 4WWCA 5K1YA 1QZYA 4A2UA 4A5MA 3Q9SA 4S04A 1RIOH 2V1XA 2FOKA 1FLIA 3DPLC 1IN4A 5LGTA 3ABUA 2CO5A 3HSRA 2DPUA 5H20A 1LEBA 1G3YA 5BOXA 3MWMA 2YR2A 4M73A 3I5UA 5L3DA 3SXYA 2XV4S 1P6RA 1DDNA 3MAJA 2W85A 2HEOA 2FU4A 2FBKA 1HKSA 2VODA 2Z99A 3GLXA 2E1CA 1OR7A 3KFWX 4G9YA 3FXRA 3CUQC 2GA1A 1TW3A 2NNNA 1XCBA 3V8LA 2LNBA 3PQJA 4KDPA 1R5HA 1ONVA 1KU7A 3E6MA 5HS7A 5D8LB 3IHUA 4LJZF 2AS5F 3GF2A 1A04A 4HOBA 1KQ9A 1F9NA 2P6SA 4UVCA 3J80Z 3T8RA 2HFHA 3RKYA 3JSOA 4RGXA 1SD7A 1KGSA 2QQBA 4MNUA 2EFNA 5DV5A 3ZMZA 3V4GA 2KIUA 2RGVA 2BEOA 3FZVA 5TRDA 5BMZA 4ESFA 4KIFA 2GQQA 3DEUA 3VFZA 3T5XA 3K1PA 3KZYA 1WWXA 1MD0A 4HV6A 3RYPA 1O3QA 4ENMA 1Z1DA 4YFKF 5L3CA 2UXNA 2ETHA 1S7OA 3I58A 1ZYRF 3HUGA 5K5OA 1UHMA 1S8NA 3PQKA 1RI7A 5ED4A 5D5UB 2CWEA 2Q8KA 2EFQA 3KE2A 2NRAC 2MLGA 5LBQA 4Q48A 3E6CC 1IXRC 3E5UA 3HTSB 1YG2A 5CVIA 4I0BA 1EV7A 1BIAA 5HDNA 3IKVA 4HF2A 3IL2A 4KIGA 4CGZA 2L01A 4K2EA 1BC8C 4KICA 2FQ3A 1K78A 3O6BB 5FLXZ 5HDKA 1HSTA 2D2WA 1G6NA 4O5VA 2KRFA 2VBXA 4G7OF 5JVTA 2H27A 4M9XA 1B9NA 1IUYA 1YS6A 2XRNA 5LHHA 1ODDA 5E1WA 3WODF 4P55A 4BAYA 1FY7A 1HW5A 5BS6A 2RDPA 1USSA 3QPTA 1ZG1A 3HHGA 4KYWA 2HR3A 5A2QZ 4U7BA 3G3ZA 2OD5A 4U7DA 3SZPA 5LEJA 3LWFA 4LGWA 5ERIA 2MH2A 4BYYA 3E97A 3KEOA 1E17A 2STTA 3T0YA 2UXXA 1ZREA 4IRHA 2OQRA 2RNJA 3K9TA 3TKYA 4O3MA 4U0WA 4EGYA 1FP2A 3R60A 3N97A 1U5TA 2XHKA 2A69F 1KYWA 4JBAA 5AIQA 2K4JA 3E5QA 1XD7A 4G6QA 1B6AA 4HQEA 1VTNC 4KMUX 2P5LC 1JHFA 2EV6A 2A6HF 3R6SA 3M8FA 1FX7A 2W84A 4HF0A 3V7CA 3RTRA 3FXQA 2ACJA 4XSZF 3WGHA 2GXBA 2BYVE 5FFXA 4B8XA 3JTGA 4A0ZA 3IC7A 2IP2A 4I01A 3L9FA 2FBIA 3KP3A 3Q5FA 3EETA 4RAZA 1Z6RA 1LNWA 2STWA 1EH6A 2DW4A 4YG2F 4N9IA 3TO7A 2K7LA 3SFZA 1UFMA 3TGNA 4UVAA 2Z3YA 5DCFA 4DNCA 5LEKA 4JQFA 1LEAA 1W7PD 1TQIA 4PZJA 4CHUA 1RZ4A 3LAJA 3ABTA 4EM2A 5JFRA 5E8IA 3WTSC 2L54A 1OYYA 1V4RA 3C18A 4HX7A 1FNNA 1ZAOA 3WTUC 4BHBA 1G3SA 3GFJA 4G7ZF 1KQ8A 2VT3A 3ROUA 1KU2A 4GYGA 1ZGAA 3SQNA 1U6GA 2KKOA 2YX4A 4XRFA 1HXDA 3GZ6A 3SZTA 3KP7A 4EQQA 2VN2A 3RYRA 4RGUA 1IF1A 1R1VA 2QQ9A 1PP7U 5KK1A 3GXOA 4QWQA 2XAGA 3V7RA 3M9AA 3I53A 4KFCA 4U88A 3U2RA 3VOEA 5LLQA 2BV6A 1T0FA 5ILVA 4O6JA 4LLNA 2HWVA 4PDKA 1IRGA 1XMKA 1IN5A 2XGXA 1FPQA 2LDUA 4HLXA 2XAHA 1B59A 2HKOA 2Y0MA 4M9ZA 1G3WA 3WGIA 1XSVA 2ESNA 3COAC 4A0YA 1K6OA 2HGCA 2DT5A 1AWCA 1P4XA 4YIIA 1ZRCA 1R1UA 1BJAA 2PEXA 2FEZA 2ISYA 2GAUA 1CF7B 6PAXA 2G7HA 4Q4ZF 4NHJA 3BDDA 3EQLF 1CF7A 3I54A 2FXAA 2A6EF 2Z5UA 3ECOA 3KP2A 2K4BA 1DPRA 1OYIA 4OMZA 4R1HA 1XGOA 1U2WA 1XSDA 3REOA 3WTTC 4RGRA 1KU3A 2ZNYA 1IN6A 3RI4A 1FZPB 2FNAA 4FX0A 3DKWA 4HDVA 1OYWA 1MDMB 2P5KA 3BZ6A 3IKTA 1XSXA 2Q0OA 5DCMB 2VOPA 4HF1A 1HKTA 2J5OA 2K02A 1F4KA 5HDGA 2M30A 1J9IA 4M9SA 3FMSA 1OKRA 3R0JA 2EV0A 2GIVA 4MHGA 5DCMA 1P92A 1I1GA 1MJBA 2ESHA 3J7AO 1LJ9A 2IA2A 5ILSA 5LGUA 4HA8A 2YX7A 3RPUA 2MC3A 1D8KA 1JXSA 2WTEA 5BPDA 3FX3A 2EFPA 3J80K 2KIMA 2GA2A 1ZLJA 1IXSB 1SD6A 2P6TA 4MEXF 1YW8A 3P7NA 4IVNA 1IN7A 2QUFA 4HDUA 5L3EA 1WI9A 1J7KA 2PQ8A 1T39A 1FOKA 5FFZA 1ZGJA 2DK8A 1I5ZA 3JW4A 4HV5A 3NRVA 3CUQB 1YS7A 3KZZA 4BHPA 5DUKA 4G8XA 1BC7C 4EGZA 1JE8A 4AVPA 2EK5A 2FRHA 4IHSA 3CUQA 2V79A 1J75A 5D5XB 4DQ2A 4HYEA 1ZRFA 2ZMEB 1XGNA 2EA2A 5FGMA 4AIKA 2W57A 3VODA 2G7UA 3FM3A 4WK8F 2HS5A 3OOPA 2QZ8A 2ZMEA 2IW5A 1DUXC 2DBBA 3GW2A 3L09A 2EA4A 3DP7A 3HRUA 1KYZA 4L9TA 2IVMA 1S7AA 5FD6A 5EEGA 1O7LA 5HS9A 3AAFA 2FA5A 3P9IA 2O0YA 4ESBA 3WTWC 1P2FA 4M6YA 1Z91A 3QAHA 5FLXK 2XIGA 2JT1A 2ZFWA 4GGGA 5IT9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON1 A;  4L9V A;  3QU3 A;  3ZMS A;  3E3V A;  1S6L A;  2DI3 A;  3HTU A;  4PGG A;  4PGH A;  1DPU A;  2HYF A;  2ZNZ A;  1L0O C;  3ZN1 A;  5A2Q K;  4A0X A;  3K0L A;  3FHZ A;  1ZLK A;  3WTZ A;  5FD5 A;  2M45 A;  5J6X A;  1TNS A;  1FWZ A;  3GO5 A;  3HOS A;  2CW0 F;  2Y75 A;  4E70 A;  1FYM A;  4ZYD A;  4CDG A;  2C6Y A;  1GHC A;  3D5L A;  4XLN F;  4BXU A;  3JTH A;  2YPR A;  1ZRD A;  2JRT A;  1FYK A;  5D5V B;  4KIB A;  2VBY A;  4BHC A;  1SD4 A;  5HLH A;  3L00 A;  5FO5 A;  3QRF F;  1O3S A;  1WQ2 A;  2EV5 A;  1XCV A;  1T6S A;  3KP4 A;  4P9U A;  2H09 A;  2F5D A;  4A6E A;  2LKP A;  3SHF A;  2OU2 A;  2MH9 A;  1SAX A;  2ISZ A;  5HLI A;  2F5C A;  5LRS A;  4EJV A;  2DLL A;  5BPI A;  2HYG D;  5ICF A;  3CDH A;  2JSC A;  3HHH A;  4JK1 X;  2VE8 A;  3KET A;  3R61 A;  1LDD A;  4N0B A;  5ILU A;  2VON A;  2VT2 A;  4L0Y B;  2IA0 A;  4UV8 A;  5H6Q A;  3F8C A;  4WCG A;  1IAW A;  3I59 B;  1YIO A;  4ZZL A;  4XLP F;  1OMI A;  3NQO A;  1MJA A;  4IXA A;  2HQR A;  4KA4 A;  4UUV A;  2H6C A;  5CVR A;  1C0W A;  2YSR A;  1W5T A;  4CZZ A;  2XAQ A;  2XKP A;  4U0Y A;  3CO7 C;  2LSO A;  3ZMD A;  2F5E A;  5CVV A;  1R00 A;  1TNT A;  3MQ0 A;  2Q2E A;  4MQ9 F;  2EB7 A;  4HQM A;  2M8E A;  3QP6 A;  3ISP A;  1STZ A;  4IHT A;  2L4M A;  2JTV A;  2P7V B;  5IT3 A;  2VBW A;  4IRI A;  4EM1 A;  1XB4 A;  2ZXJ A;  2G9W A;  5LHG A;  2HTJ A;  2PMH A;  2ZKZ A;  5JHU A;  4ON0 A;  4RB0 A;  1FBU A;  4WF2 A;  4RB1 A;  5DD4 A;  1ZHF A;  2CGP A;  5E8G A;  2OA4 A;  3JSP A;  1Q1H A;  2MA3 A;  2DQR A;  1D5V A;  2ELH A;  3F72 A;  3T1B A;  2D1V A;  5E18 F;  5CLS A;  1X3U A;  4WXC A;  4ASN A;  4OIR F;  3I64 A;  1I6X A;  2QLZ A;  4YFX F;  1SFE A;  3LA3 A;  1MGT A;  3BJO A;  2D1H A;  4LMY A;  3HRS A;  2XAS A;  3HOT A;  2OZU A;  3M7G A;  2J5P A;  1H9G A;  4WXD A;  4LFU A;  3DXJ F;  1FBQ A;  2IPQ X;  4ZH4 F;  4LB5 A;  2HDC A;  2FML A;  2UWM A;  1QGP A;  2V1U A;  3WTY C;  1TQM A;  4P96 A;  1IN8 A;  3J81 Z;  1LVA A;  3V7S A;  1OPC A;  3HIF A;  1O3T A;  5KVR A;  2A5Y B;  1S3J A;  5AON A;  3KLN A;  1U5T C;  2E1N A;  1ZG3 A;  5L3G A;  4MQV A;  3TOA A;  5ICC A;  1R5G A;  1QZZ A;  1Z7U A;  1T2K A;  2P7C B;  1R22 A;  1BI0 A;  3BPV A;  3WE3 A;  2H6B A;  2IJL A;  4UXN A;  4OMY A;  2HZT A;  2CG4 A;  4FX4 A;  2A61 A;  2XKO A;  2CQK A;  1UCR A;  3E6B A;  2BE5 F;  1YO5 C;  1RNL A;  1PUE E;  3RIR A;  4LK0 F;  3W6K B;  1HQC A;  2VC0 A;  4UVB A;  3FMR A;  3WTV C;  4UNO A;  4G94 A;  4WX9 A;  4RB2 C;  2V1D A;  2K27 A;  3BPX A;  1U8R A;  2HTS A;  2PFB A;  4LLG F;  4I02 A;  3GX4 X;  1I27 A;  2P5V A;  4HBL A;  2PJP A;  4OIO F;  4Y15 A;  3F8B A;  3WGG A;  1BBY A;  4XBF A;  2YU3 A;  3ZP5 A;  4KUM A;  3KP6 A;  5E17 F;  1BI3 A;  2X4H A;  5CJ9 A;  4LB6 B;  4OOI A;  2XUB A;  4BNC A;  2H94 A;  1UB9 A;  1WRJ A;  2FBH A;  3D0S A;  4L5J A;  3GFL A;  4ZYG A;  5DUI A;  2CYY A;  3CO6 C;  4IF4 A;  1G3T A;  3K1N A;  1W5S A;  3F23 A;  2GZW A;  1BN5 A;  5IT9 K;  2M1B A;  4Y13 A;  2LF8 A;  5D5W B;  1G4D A;  1QNT A;  2R3S A;  3QU6 A;  3BOQ A;  1KU9 A;  3E5X A;  5TJJ A;  2UZK A;  3OV8 A;  4NQW A;  1MDM A;  2WC2 A;  3ELK A;  1FP1 D;  3GWZ A;  1KQ0 A;  1HW1 A;  3QOP A;  3CTA A;  4QLC U;  5CVJ A;  4KMF A;  3I71 A;  4GCV A;  3M1E A;  4NB5 A;  5K5Q A;  3N4M A;  2OZ6 A;  1DP7 P;  4ZYE A;  2NS0 A;  4OU0 A;  3B02 A;  4PCQ A;  5DD8 A;  2DTR A;  2LF7 A;  2O61 A;  3G73 A;  1HW2 A;  5H6R A;  3GYH X;  3BY6 A;  3HRM A;  3LA7 A;  3GFM A;  5D4S A;  5CVU A;  1F5T A;  1O7F A;  4LK1 F;  4A12 A;  1GVJ A;  2QM3 A;  2QVO A;  3CLO A;  5F1R A;  1W7P B;  3EUH A;  1YQA A;  2PN6 A;  1S29 A;  4LLL A;  4BH9 A;  3LAP A;  1JHH A;  5LGN A;  3JAM Z;  4N9H A;  3DFG A;  1W7P A;  2OAZ A;  1R7J A;  2Z9O A;  4M6X A;  5E20 A;  3C3W A;  5ICE A;  2E7X A;  1SMY F;  3F8N A;  2DAO A;  1XDS A;  5CYV A;  4GXO A;  3O3K A;  1TTY A;  1J59 A;  4UHT A;  3HSF A;  4HX4 A;  1MJ9 A;  3K2Z A;  2L3D A;  2O03 A;  4A5N A;  1ZN2 A;  1O3R A;  3BP8 A;  4IJA A;  3F8F A;  1XN7 A;  4P9F A;  1NHA A;  1XGS A;  1ZAR A;  3EDP A;  4G6D A;  1Z6T A;  3CJN A;  4OIQ F;  3DQV C;  3FWE A;  4CO8 A;  4EVI A;  3PFI A;  1H9T A;  3TDU C;  5BQT A;  1BOA A;  4OIN F;  3S2W A;  1ULY A;  1E2X A;  1RUO A;  1L3L A;  3I4P A;  4I98 B;  3ZMU A;  2L4A A;  4EJW A;  4L9N A;  2PBI A;  1MZB A;  1Z05 A;  3RDI A;  1HSJ A;  3FMQ A;  3BRO A;  4U0V A;  4ZZD A;  1BIB A;  2ZCW A;  3HRT A;  2D45 A;  3WU0 A;  2HQN A;  1SFX A;  4AIJ A;  3V8K A;  5FB2 A;  2FF4 A;  4LD5 A;  5HLG A;  2O6G E;  4EM0 B;  2RV8 A;  3LFK A;  4RAY A;  1BI2 A;  3ZPL A;  1D8J A;  4D0P A;  3ERE D;  5E1Z B;  1R1T A;  2O8X A;  4AIH A;  1XGM A;  4RB3 C;  4ETS A;  1GXP A;  1H0M A;  3GUD A;  4HW0 A;  2RC4 A;  2KJB A;  3R4K A;  4H0E A;  3U9G A;  2PLY A;  1K79 A;  1SD5 A;  2VBZ A;  3ULQ B;  4Q47 A;  3QPH A;  1IW7 F;  1ON2 A;  1R36 A;  3LQQ A;  2P8T A;  2MD5 A;  1QQI A;  4BQA A;  4KN7 X;  3MZY A;  3F21 A;  4M72 A;  2QQA A;  3HYI A;  2HKX A;  1YW9 A;  3QP5 A;  3VEP A;  3IWZ A;  2KIF A;  2NNY A;  1J0R A;  2DPD A;  1YYV A;  1WKM A;  1UHW A;  2FSW A;  3KP5 A;  3CUO A;  3M8E A;  3J81 K;  1EH8 A;  3F3X A;  1K78 B;  1QO0 D;  1T38 A;  3F22 A;  4GYI A;  2Y48 A;  5HOO A;  1J5Y A;  2KJC A;  4MEY F;  2JPC A;  1U3E M;  2Z33 A;  2RQP A;  3I59 A;  2ZJ2 A;  2GWR A;  2EFO A;  3BJA A;  1FC3 A;  2M5W A;  3ML6 A;  3U1D A;  1YLF A;  4M71 A;  2MLK A;  5JR3 A;  5DEQ A;  2A07 F;  3FXU A;  4ESJ A;  3T8T A;  1B4A A;  5E1X A;  1B9M A;  3DPT A;  4HZF A;  5DYM A;  2JPB A;  2VE9 A;  3MFK A;  4M74 A;  2DQL A;  2F5F A;  2W24 A;  3RPQ A;  4HLY A;  1K7A A;  1Y0U A;  1LB2 A;  4ZYH A;  2XAJ A;  4IRG A;  1JGS A;  1QBJ A;  3DV8 A;  4I09 A;  1U5T B;  1YW7 A;  4CXF A;  3RKW A;  2EWN A;  4I2O A;  3VB2 A;  1CGP A;  3GVA A;  3HSE A;  5EEH A;  4G7H F;  3EYY A;  1T98 A;  4B09 A;  3WG9 A;  3K1M A;  2HOE A;  3R0A A;  2RKH A;  5LRR A;  4HX8 A;  3B73 A;  3L7W A;  4ENN A;  4P5O A;  4KT5 C;  4FHT A;  5F6F A;  2QEN A;  2QYO A;  2V6C A;  5HVQ C;  4AD9 A;  1EH7 A;  1QPM A;  5ICG A;  4RGS A;  4RS8 A;  4EV0 A;  2ADU A;  1LDK B;  1J2X A;  3E6D A;  5D6E A;  1TW2 A;  5L3B A;  1RUN A;  1ZG5 A;  3RKX A;  4ENJ A;  1TBX A;  2JZY A;  3FF5 A;  3P9C A;  4ENK A;  3DF8 A;  4R8H A;  2PI0 A;  3TOB A;  2L02 A;  3W6J B;  4OIP F;  2FE3 A;  4A6D A;  3MZH A;  3RJP A;  1FSH A;  3LQR A;  3F6O A;  2QWW A;  1O57 A;  5J8F A;  1REP C;  4F7Z A;  3O2P E;  4LG0 B;  4FT8 A;  2VOO A;  3LA2 A;  3GZ5 A;  3K69 A;  3KLO A;  5D8K B;  4MGR A;  4LG0 A;  2VXZ A;  3ZQ7 A;  2DO7 A;  1FSE A;  1IZ1 A;  1U78 A;  2F2E A;  1MKM A;  2IA1 A;  3MCZ A;  4R79 A;  4L18 B;  5K5R A;  1FT9 A;  1IXC A;  4I7H A;  3ECH A;  4I0A A;  3I0T A;  1B1B A;  2TDX A;  1BM9 A;  2VC1 A;  3H92 A;  1UST A;  1TLH B;  2OBP A;  3JAM K;  4Z2Y A;  2DFI A;  5AIP A;  2EFW A;  3C1D A;  1HKQ A;  4YIF A;  1BI1 A;  1PP8 F;  5F64 A;  2FNP A;  3H3U A;  3FM5 A;  1XDU A;  2A68 F;  3H3Z A;  4EJO A;  1LQ1 A;  4Q5S F;  3Q9V A;  2XAF A;  4Y17 A;  1YFH A;  5HS8 A;  2PMU A;  2AXL A;  4EJT A;  4XSX F;  3IWF A;  1W4M A;  2ZO4 A;  4L5I A;  3F8M A;  2QBY B;  2EJR A;  2XVC A;  2CFX A;  4MTD A;  2R7F A;  1FYL A;  1GXQ A;  2QBY A;  1I1S A;  4MTE A;  3WU1 B;  4EJU A;  5J8C A;  2B0L A;  2P4W A;  2MBF A;  1R23 A;  2NAZ A;  4HAM A;  3IRR A;  1YTY A;  2E7W A;  3BWG A;  4KNY A;  4GO1 A;  3V8J A;  3P9K A;  2WV0 A;  3TO6 A;  2RVC A;  4AWX B;  3MEX A;  2NYX A;  2WWY A;  4KN4 X;  3L2C A;  1PDN C;  3NEU A;  2BBY A;  2RN7 A;  1HBX G;  1D3Y A;  2K86 A;  4L9J A;  1SFU A;  3F6V A;  4CIC A;  1SMT A;  4YFN F;  2BGC A;  2IRF G;  4L0Z B;  5L3F A;  1Z9C A;  1ZH5 A;  2CSO A;  2PG4 A;  2DK5 A;  3KCC A;  4EMS A;  5JI6 A;  3GEZ A;  5D6F A;  2FMY A;  5LHI A;  4S05 A;  4CYD A;  5D4R A;  3EYI A;  2GXG A;  1R58 A;  3TO9 A;  1KA8 A;  2V9V A;  3WE2 A;  1IRF A;  3ZMV A;  2W25 A;  1AOY A;  3IRQ A;  2XRO A;  1P4A A;  2OQG A;  3ZMT A;  1V3F A;  2X0L A;  3ZN0 A;  4UV9 A;  1XMA A;  2DU9 A;  5DDG A;  2R7D A;  2A3S A;  3GFI A;  2COM A;  4TV7 A;  4WXH A;  3WTX C;  3BJ6 A;  1F1Z A;  1WSU A;  1FBS A;  3KEQ A;  2IT0 A;  3LST A;  2M87 A;  1LDJ A;  1P4W A;  2O3F A;  2ZBK A;  3TQN A;  4IPA A;  3TDZ C;  3C7J A;  1TQP A;  4WWC A;  5K1Y A;  1QZY A;  4A2U A;  4A5M A;  3Q9S A;  4S04 A;  1RIO H;  2V1X A;  2FOK A;  1FLI A;  3DPL C;  1IN4 A;  5LGT A;  3ABU A;  2CO5 A;  3HSR A;  2DPU A;  5H20 A;  1LEB A;  1G3Y A;  5BOX A;  3MWM A;  2YR2 A;  4M73 A;  3I5U A;  5L3D A;  3SXY A;  2XV4 S;  1P6R A;  1DDN A;  3MAJ A;  2W85 A;  2HEO A;  2FU4 A;  2FBK A;  1HKS A;  2VOD A;  2Z99 A;  3GLX A;  2E1C A;  1OR7 A;  3KFW X;  4G9Y A;  3FXR A;  3CUQ C;  2GA1 A;  1TW3 A;  2NNN A;  1XCB A;  3V8L A;  2LNB A;  3PQJ A;  4KDP A;  1R5H A;  1ONV A;  1KU7 A;  3E6M A;  5HS7 A;  5D8L B;  3IHU A;  4LJZ F;  2AS5 F;  3GF2 A;  1A04 A;  4HOB A;  1KQ9 A;  1F9N A;  2P6S A;  4UVC A;  3J80 Z;  3T8R A;  2HFH A;  3RKY A;  3JSO A;  4RGX A;  1SD7 A;  1KGS A;  2QQB A;  4MNU A;  2EFN A;  5DV5 A;  3ZMZ A;  3V4G A;  2KIU A;  2RGV A;  2BEO A;  3FZV A;  5TRD A;  5BMZ A;  4ESF A;  4KIF A;  2GQQ A;  3DEU A;  3VFZ A;  3T5X A;  3K1P A;  3KZY A;  1WWX A;  1MD0 A;  4HV6 A;  3RYP A;  1O3Q A;  4ENM A;  1Z1D A;  4YFK F;  5L3C A;  2UXN A;  2ETH A;  1S7O A;  3I58 A;  1ZYR F;  3HUG A;  5K5O A;  1UHM A;  1S8N A;  3PQK A;  1RI7 A;  5ED4 A;  5D5U B;  2CWE A;  2Q8K A;  2EFQ A;  3KE2 A;  2NRA C;  2MLG A;  5LBQ A;  4Q48 A;  3E6C C;  1IXR C;  3E5U A;  3HTS B;  1YG2 A;  5CVI A;  4I0B A;  1EV7 A;  1BIA A;  5HDN A;  3IKV A;  4HF2 A;  3IL2 A;  4KIG A;  4CGZ A;  2L01 A;  4K2E A;  1BC8 C;  4KIC A;  2FQ3 A;  1K78 A;  3O6B B;  5FLX Z;  5HDK A;  1HST A;  2D2W A;  1G6N A;  4O5V A;  2KRF A;  2VBX A;  4G7O F;  5JVT A;  2H27 A;  4M9X A;  1B9N A;  1IUY A;  1YS6 A;  2XRN A;  5LHH A;  1ODD A;  5E1W A;  3WOD F;  4P55 A;  4BAY A;  1FY7 A;  1HW5 A;  5BS6 A;  2RDP A;  1USS A;  3QPT A;  1ZG1 A;  3HHG A;  4KYW A;  2HR3 A;  5A2Q Z;  4U7B A;  3G3Z A;  2OD5 A;  4U7D A;  3SZP A;  5LEJ A;  3LWF A;  4LGW A;  5ERI A;  2MH2 A;  4BYY A;  3E97 A;  3KEO A;  1E17 A;  2STT A;  3T0Y A;  2UXX A;  1ZRE A;  4IRH A;  2OQR A;  2RNJ A;  3K9T A;  3TKY A;  4O3M A;  4U0W A;  4EGY A;  1FP2 A;  3R60 A;  3N97 A;  1U5T A;  2XHK A;  2A69 F;  1KYW A;  4JBA A;  5AIQ A;  2K4J A;  3E5Q A;  1XD7 A;  4G6Q A;  1B6A A;  4HQE A;  1VTN C;  4KMU X;  2P5L C;  1JHF A;  2EV6 A;  2A6H F;  3R6S A;  3M8F A;  1FX7 A;  2W84 A;  4HF0 A;  3V7C A;  3RTR A;  3FXQ A;  2ACJ A;  4XSZ F;  3WGH A;  2GXB A;  2BYV E;  5FFX A;  4B8X A;  3JTG A;  4A0Z A;  3IC7 A;  2IP2 A;  4I01 A;  3L9F A;  2FBI A;  3KP3 A;  3Q5F A;  3EET A;  4RAZ A;  1Z6R A;  1LNW A;  2STW A;  1EH6 A;  2DW4 A;  4YG2 F;  4N9I A;  3TO7 A;  2K7L A;  3SFZ A;  1UFM A;  3TGN A;  4UVA A;  2Z3Y A;  5DCF A;  4DNC A;  5LEK A;  4JQF A;  1LEA A;  1W7P D;  1TQI A;  4PZJ A;  4CHU A;  1RZ4 A;  3LAJ A;  3ABT A;  4EM2 A;  5JFR A;  5E8I A;  3WTS C;  2L54 A;  1OYY A;  1V4R A;  3C18 A;  4HX7 A;  1FNN A;  1ZAO A;  3WTU C;  4BHB A;  1G3S A;  3GFJ A;  4G7Z F;  1KQ8 A;  2VT3 A;  3ROU A;  1KU2 A;  4GYG A;  1ZGA A;  3SQN A;  1U6G A;  2KKO A;  2YX4 A;  4XRF A;  1HXD A;  3GZ6 A;  3SZT A;  3KP7 A;  4EQQ A;  2VN2 A;  3RYR A;  4RGU A;  1IF1 A;  1R1V A;  2QQ9 A;  1PP7 U;  5KK1 A;  3GXO A;  4QWQ A;  2XAG A;  3V7R A;  3M9A A;  3I53 A;  4KFC A;  4U88 A;  3U2R A;  3VOE A;  5LLQ A;  2BV6 A;  1T0F A;  5ILV A;  4O6J A;  4LLN A;  2HWV A;  4PDK A;  1IRG A;  1XMK A;  1IN5 A;  2XGX A;  1FPQ A;  2LDU A;  4HLX A;  2XAH A;  1B59 A;  2HKO A;  2Y0M A;  4M9Z A;  1G3W A;  3WGI A;  1XSV A;  2ESN A;  3COA C;  4A0Y A;  1K6O A;  2HGC A;  2DT5 A;  1AWC A;  1P4X A;  4YII A;  1ZRC A;  1R1U A;  1BJA A;  2PEX A;  2FEZ A;  2ISY A;  2GAU A;  1CF7 B;  6PAX A;  2G7H A;  4Q4Z F;  4NHJ A;  3BDD A;  3EQL F;  1CF7 A;  3I54 A;  2FXA A;  2A6E F;  2Z5U A;  3ECO A;  3KP2 A;  2K4B A;  1DPR A;  1OYI A;  4OMZ A;  4R1H A;  1XGO A;  1U2W A;  1XSD A;  3REO A;  3WTT C;  4RGR A;  1KU3 A;  2ZNY A;  1IN6 A;  3RI4 A;  1FZP B;  2FNA A;  4FX0 A;  3DKW A;  4HDV A;  1OYW A;  1MDM B;  2P5K A;  3BZ6 A;  3IKT A;  1XSX A;  2Q0O A;  5DCM B;  2VOP A;  4HF1 A;  1HKT A;  2J5O A;  2K02 A;  1F4K A;  5HDG A;  2M30 A;  1J9I A;  4M9S A;  3FMS A;  1OKR A;  3R0J A;  2EV0 A;  2GIV A;  4MHG A;  5DCM A;  1P92 A;  1I1G A;  1MJB A;  2ESH A;  3J7A O;  1LJ9 A;  2IA2 A;  5ILS A;  5LGU A;  4HA8 A;  2YX7 A;  3RPU A;  2MC3 A;  1D8K A;  1JXS A;  2WTE A;  5BPD A;  3FX3 A;  2EFP A;  3J80 K;  2KIM A;  2GA2 A;  1ZLJ A;  1IXS B;  1SD6 A;  2P6T A;  4MEX F;  1YW8 A;  3P7N A;  4IVN A;  1IN7 A;  2QUF A;  4HDU A;  5L3E A;  1WI9 A;  1J7K A;  2PQ8 A;  1T39 A;  1FOK A;  5FFZ A;  1ZGJ A;  2DK8 A;  1I5Z A;  3JW4 A;  4HV5 A;  3NRV A;  3CUQ B;  1YS7 A;  3KZZ A;  4BHP A;  5DUK A;  4G8X A;  1BC7 C;  4EGZ A;  1JE8 A;  4AVP A;  2EK5 A;  2FRH A;  4IHS A;  3CUQ A;  2V79 A;  1J75 A;  5D5X B;  4DQ2 A;  4HYE A;  1ZRF A;  2ZME B;  1XGN A;  2EA2 A;  5FGM A;  4AIK A;  2W57 A;  3VOD A;  2G7U A;  3FM3 A;  4WK8 F;  2HS5 A;  3OOP A;  2QZ8 A;  2ZME A;  2IW5 A;  1DUX C;  2DBB A;  3GW2 A;  3L09 A;  2EA4 A;  3DP7 A;  3HRU A;  1KYZ A;  4L9T A;  2IVM A;  1S7A A;  5FD6 A;  5EEG A;  1O7L A;  5HS9 A;  3AAF A;  2FA5 A;  3P9I A;  2O0Y A;  4ESB A;  3WTW C;  1P2F A;  4M6Y A;  1Z91 A;  3QAH A;  5FLX K;  2XIG A;  2JT1 A;  2ZFW A;  4GGG A;  5IT9 Z; 
#chains in the Genus database with same CATH topology
 1ON1 A;  1OCR H;  4YRV A;  2K9N A;  3QQA A;  4L9V A;  3QU3 A;  3CC7 I;  2EIJ H;  3E3V A;  2L7Z A;  3MN2 A;  3M07 A;  1S6L A;  3ZMS A;  2P81 A;  3OYH A;  2XAU A;  2L7F P;  2DI3 A;  3L2Q A;  4A93 J;  3HTU A;  1MND A;  4PGH A;  4PGG A;  2NVU B;  1IDZ A;  1DPU A;  1JUP A;  5FKL A;  3KIO A;  2HYF A;  1MBE A;  2VAS A;  3ZQC A;  2Y2Z A;  4BAC A;  1JTX A;  1N77 A;  2ZNZ A;  2DXI A;  1L0O C;  1Z77 A;  3ZN1 A;  4CCO A;  3J7Z I;  5A2Q K;  4A0X A;  3MKY B;  2LP0 A;  3K0L A;  3FHZ A;  1ZLK A;  3WTZ A;  5FD5 A;  2M45 A;  4EAT A;  5J6X A;  1TNS A;  1FWZ A;  4XNF A;  3KZI C;  2CMP A;  2JVH A;  3GO5 A;  5DTD A;  3HOS A;  4CCM A;  2CW0 F;  2Y75 A;  3DPU A;  3KYC B;  2DN0 A;  4E70 A;  1FYM A;  4ZYD A;  4CDG A;  2C6Y A;  1GHC A;  3OYC A;  2X9D A;  2WAD A;  2JSP A;  2JWT A;  3D5L A;  4XLN F;  5E79 C;  1JKO C;  4M3F A;  4BXU A;  3JTH A;  2YPR A;  1A5J A;  1ZRD A;  2JRT A;  2DOD A;  2K3P A;  3FIS A;  1FYK A;  5IYB J;  3AFH A;  3H9G A;  3OR2 C;  5D5V B;  4FE4 A;  4KIB A;  2VBY A;  4BHC A;  1MH4 A;  1SD4 A;  1F43 A;  5HLH A;  5KAF C;  3G6E I;  5TIS C;  3A0B C;  1K6Y A;  3L00 A;  3SEZ A;  5FO5 A;  3A2K A;  3QRF F;  4XLC A;  5KHD A;  4ZDP A;  1O3S A;  1WQ2 A;  2EV5 A;  1XCV A;  1T6S A;  3KP4 A;  4P9U A;  2H09 A;  2F5D A;  4F3Q A;  4A6E A;  2XB5 A;  2WV1 A;  2LKP A;  3HOW J;  3PO3 J;  3SHF A;  2OU2 A;  2MH9 A;  1YJN I;  1SAX A;  2CV0 A;  2ISZ A;  5HLI A;  1M1E B;  2DA1 A;  2F5C A;  4PFO A;  3HEF A;  1SC7 A;  5LRS A;  4EJV A;  2VUM J;  2DLL A;  5BPI A;  2HYG D;  5ICF A;  3CDH A;  4V2G A;  2JSC A;  4C3I J;  3HHH A;  5EDN A;  4JK1 X;  3QPL A;  2VE8 A;  2Z2S B;  3W2W A;  2QKM B;  3PJR A;  1Y1V J;  3KET A;  5GAH J;  3R61 A;  3OSG A;  1H8A C;  1X2N A;  1N75 A;  2O9L A;  1LDD A;  1Z7L A;  4N0B A;  5F27 A;  5F0F A;  5ILU A;  2VON A;  1OQY A;  1LKX A;  2VT2 A;  4AYB N;  2L0K A;  4L0Y B;  2IGO A;  2IA0 A;  4UV8 A;  5J40 A;  1T08 B;  9ANT A;  5H6Q A;  2XPU A;  3HZJ A;  1Y56 A;  3QYF A;  4DBR A;  3F8C A;  2R0Q C;  4WCG A;  1IAW A;  2R7U A;  1UZC A;  2KL4 A;  3I59 B;  3ZRG A;  1YIO A;  4BJ6 C;  2WY8 Q;  2W48 A;  2VQH A;  4ZZL A;  4LIV A;  4XLP F;  3P5J A;  1OMI A;  4PFP A;  3NQO A;  4MO7 A;  1MJA A;  4IXA A;  2HQR A;  4KA4 A;  4UUV A;  2H6C A;  3VYR B;  5CVR A;  3FDY A;  1A6I A;  5DS9 A;  2YSR A;  1C0W A;  1W5T A;  2ZB9 A;  4NC8 A;  4CUG A;  4ZYA A;  4Y7N J;  3ABL H;  2Z16 A;  4CZZ A;  1W1W E;  3GCM A;  2XAQ A;  4DYQ A;  2R7T A;  3TBI A;  2XKP A;  4U0Y A;  4GDF A;  2Q2E B;  3CO7 C;  2LSO A;  1MNM C;  4YEL A;  3BCA A;  3CMY A;  3ZMD A;  1SVL A;  2F5E A;  1MMA A;  1WH5 A;  3CMA I;  4RLF A;  4LOC A;  4J00 A;  2X6W A;  5CVV A;  1R00 A;  1TNT A;  2L5Q A;  3MQ0 A;  2Q2E A;  4I76 A;  4MQ9 F;  3CCS I;  4IQJ A;  2EB7 A;  4HQM A;  2M8E A;  4IQ4 A;  4W1U A;  2L7M P;  4FQG A;  3OOU A;  4E7S A;  3QP6 A;  3CCU I;  3ISP A;  3OYK A;  4BE1 A;  4IHX A;  1STZ A;  4IHT A;  2L4M A;  2XGC A;  2OTL I;  2JTV A;  2P7V B;  5IT3 A;  2EPF A;  2BW3 B;  2VBW A;  3AG4 H;  4EM1 A;  1XB4 A;  2ZXJ A;  1H88 C;  4IRI A;  1VQ5 I;  4IX7 A;  3ZCO A;  4M6V A;  2G9W A;  5LHG A;  3H5N A;  2HTJ A;  2PMH A;  2ZKZ A;  2NOG A;  5JHU A;  4ON0 A;  3MKZ A;  1JTY A;  4RB0 A;  1HOM A;  4A3I J;  1FBU A;  4WF2 A;  4RB1 A;  2BW3 A;  5DD4 A;  1ZHF A;  2CGP A;  1ETO A;  3FXO A;  2OA4 A;  5E8G A;  3JSP A;  1Q1H A;  2BY0 A;  4OAZ A;  2XSD C;  2MA3 A;  2DQR A;  3TED A;  2EIN H;  3V42 A;  3OYD A;  1D5V A;  2ELH A;  3ERM A;  3F72 A;  3T1B A;  2D1V A;  3A4C A;  5E18 F;  5CLS A;  1QVU A;  1X3U A;  4WXC A;  4ASN A;  2NVQ J;  3IH2 A;  2FOW A;  3UKG A;  2O7O A;  2Y0S A;  4UB6 C;  4OIR F;  3I64 A;  4HPQ A;  1I6X A;  2QLZ A;  4YFX F;  3BQY A;  1SFE A;  3LA3 A;  3KEY A;  3DLA A;  1MGT A;  3OS2 A;  3CCR I;  3BJO A;  4D9J A;  2D1H A;  4LMY A;  1BW5 A;  3HRS A;  2WB1 N;  2XAS A;  4PJL A;  3HOT A;  1VQ6 I;  2CS3 A;  2JUC A;  1ZGW A;  2OZU A;  3M7G A;  1VQ9 I;  2JA8 J;  2J5P A;  1ENH A;  2E35 A;  1H9G A;  2ZSI B;  2DA5 A;  2F4O B;  2KDO A;  4WXD A;  2ELJ A;  4LFU A;  5EZG A;  3DCF A;  3DXJ F;  1FBQ A;  2KZG A;  2IPQ X;  2HQ5 A;  4ZH4 F;  4LB5 A;  2HDC A;  5E3O A;  4AM3 A;  2EBI A;  4B1R A;  1WJF A;  2VLA A;  3CCL I;  2F4I A;  2FML A;  2UWM A;  1QGP A;  2DA4 A;  2V1U A;  4II2 A;  3U21 A;  4RAF A;  3WTY C;  1TQM A;  4P96 A;  1IN8 A;  3J81 Z;  1LVA A;  3V7S A;  2WY7 Q;  3S1Q J;  1OPC A;  5K7Z A;  3K4K A;  3HIF A;  1O3T A;  5KVR A;  2A5Y B;  3IV5 A;  1S3J A;  1JKP C;  1SAN A;  4NBQ A;  5AON A;  3KLN A;  2R7Z J;  3CDI A;  1U5T C;  2E1N A;  1ZG3 A;  5L3G A;  4MQV A;  4ANJ A;  3TOA A;  3OYB A;  5ICC A;  1R5G A;  4XOR A;  2W4S A;  1GVD A;  1QZZ A;  1YOV B;  1Z7U A;  2WAQ N;  3GLL A;  3HC7 A;  4DGW B;  2V6E A;  2CUJ A;  1T2K A;  2P7C B;  3DTE A;  2X6Y A;  1R22 A;  1BI0 A;  4E7Z A;  3BPV A;  5HNH A;  3WE3 A;  2H6B A;  3RZD J;  1LFB A;  2IJL A;  4UXN A;  4OMY A;  4RM3 A;  2HZT A;  2LY9 A;  1QA6 A;  2CG4 A;  4FX4 A;  1IRX A;  1WJB A;  2A61 A;  5FJ8 J;  2XKO A;  2CQK A;  1UCR A;  2ID3 A;  3LFU A;  3E6B A;  2BE5 F;  1UG2 A;  2ZFU A;  1YO5 C;  1RNL A;  1PUE E;  1E3P A;  3RIR A;  2BY3 A;  4LK0 F;  3W6K B;  3BCB A;  1HQC A;  4JP0 A;  2VC0 A;  4UVB A;  4XLF A;  3FMR A;  3WTV C;  4UNO A;  4G94 A;  4WX9 A;  3DTK A;  4RB2 C;  2DT7 B;  4F93 B;  2V1D A;  1TZL A;  2V7F A;  2K27 A;  5FKN A;  3BPX A;  2CW8 A;  3O8G A;  1U8R A;  2O8K A;  4XIC A;  2HTS A;  1Z21 A;  4UY8 I;  2PFB A;  1S9H A;  3PUF A;  4I02 A;  4LLG F;  2XRL A;  5GAD J;  1MMD A;  2DCE A;  3GX4 X;  1I27 A;  5J4Y A;  2P5V A;  2GOM A;  4HBL A;  4Y3O A;  3CLQ A;  2PJP A;  4OIO F;  1E3O C;  2ID6 A;  4NUB A;  4KJZ A;  3I4M J;  2E19 A;  1HA8 A;  4IHY A;  1S5L C;  4Y15 A;  3F8B A;  3WGG A;  1BBY A;  4XBF A;  3HDD A;  2YU3 A;  3CCJ I;  4BE0 A;  3ZP5 A;  4RBO A;  4KUM A;  3KP6 A;  5E17 F;  3BR5 A;  4GFB A;  1BI3 A;  2RQQ A;  2DDA A;  2X4H A;  5CJ9 A;  4LB6 B;  2FD5 A;  3VPR A;  2RNG A;  4OOI A;  4M3G A;  2XUB A;  3RCO A;  4BNC A;  2H94 A;  1UB9 A;  1JUS A;  1WRJ A;  1XPX A;  4PJN A;  3M8J A;  2FBH A;  3D0S A;  4L5J A;  3GFL A;  4ZYG A;  1VQM I;  4BY1 J;  2LRD A;  3L2W A;  2KDZ A;  1QRY A;  3VDX A;  5DUI A;  3W3C A;  4BQN A;  5J47 A;  2DDB A;  2CYY A;  4XOP A;  5B5E C;  4IF4 A;  3CO6 C;  1G3T A;  3D5R C;  3K1N A;  1JJ8 C;  1W5S A;  4XOT A;  3F23 A;  1A31 A;  4FTH A;  1NK2 P;  4BY7 J;  2GZW A;  4XRS G;  3BG7 A;  4NQW B;  1BN5 A;  2TCT A;  3S1R J;  3CME I;  5IT9 K;  2M1B A;  4Y13 A;  3HPG A;  3RQ4 A;  2LF8 A;  5D5W B;  5EG0 A;  2X1D A;  3JRH A;  1G4D A;  1QNT A;  2R3S A;  2WAF A;  3BOQ A;  1KU9 A;  3E5X A;  3QU6 A;  5TJJ A;  3BTI A;  2KQR A;  2UZK A;  4BBS J;  3OV8 A;  1DU0 A;  4PJ0 C;  4PSX A;  3MMY B;  4NQW A;  3Q0V A;  1KZH A;  4XON A;  3BTJ A;  4AYB A;  1MDM A;  2JK3 A;  2WC2 A;  3ELK A;  1TC3 C;  3LSJ A;  1FP1 D;  3GWZ A;  2GM4 A;  1UG0 A;  2H1K A;  2NVT J;  1T0F C;  4D5F A;  3TP3 A;  1D0X A;  4B3X A;  1KQ0 A;  1I3Q J;  1HW1 A;  3DBL B;  1HCR A;  3QOP A;  3CTA A;  4QLC U;  1YI2 I;  5FLM J;  3GME A;  5CVJ A;  4KMF A;  3I71 A;  2K40 A;  2CQN A;  2M7A A;  4GCV A;  2K5C A;  2PMZ N;  3M1E A;  4NB5 A;  1BR4 A;  2KMU A;  3K4N A;  4AUX A;  5K5Q A;  3N4M A;  1TT5 B;  2OZ6 A;  1DP7 P;  1DQU A;  4ZYE A;  4E7H A;  1Y8Q B;  2NS0 A;  5CQE A;  3RSN A;  4OU0 A;  3B02 A;  1W0U A;  4PCQ A;  2IGM A;  1Y6I A;  3LSI A;  5DD8 A;  1NH3 A;  2DTR A;  2LF7 A;  4HNU A;  3G73 A;  2O61 A;  3OL4 A;  1IO2 A;  2W82 A;  1HW2 A;  5H6R A;  3GYH X;  2OV7 A;  2KHM A;  2E2J J;  3BY6 A;  3HRM A;  3LA7 A;  5IP9 J;  1ETV A;  3GFM A;  5D4S A;  5IY5 H;  5CVU A;  1NK3 P;  1F5T A;  1O7F A;  4V19 K;  4ZDO A;  4LK1 F;  1T33 A;  2EIM H;  4A12 A;  1GVJ A;  2ZXH A;  2QM3 A;  2QVO A;  3CLO A;  5F1R A;  1W7P B;  4AID A;  3EUH A;  1WJC A;  1YQA A;  1RKW A;  2PN6 A;  1S29 A;  4M3D A;  2R7O A;  5C4J J;  1SFO J;  2R7X A;  2E34 A;  4LLL A;  4BH9 A;  3LAP A;  1JHH A;  4LIU A;  3I9V 2;  5LGN A;  3JAM Z;  1WH7 A;  1ETK A;  4N9H A;  3DFG A;  4A3G J;  1W7P A;  1X1A A;  2AXT C;  2OAZ A;  1R7J A;  2Z9O A;  4M6X A;  4NC6 A;  5E20 A;  1JT0 A;  3C3W A;  3H5A A;  3SZG A;  5ICE A;  2E7X A;  1SMY F;  3AG3 H;  3F8N A;  2DAO A;  1XDS A;  5CYV A;  4DZJ A;  4GXO A;  3O3K A;  1TTY A;  4UUS B;  1J59 A;  5HOD A;  4UHT A;  3HSF A;  4HX4 A;  3CES A;  1MJ9 A;  3K2Z A;  4BJ5 C;  1MBK A;  2I8D A;  4XRM A;  2L3D A;  2LD5 A;  2A05 A;  2HVR A;  3LSK A;  2O03 A;  4V2F A;  2DMN A;  1YIJ I;  4UUS A;  5EGO B;  4A5N A;  1ZN2 A;  1O3R A;  1OLT A;  2PJR A;  3BP8 A;  3TP0 A;  3ASO H;  2H8R A;  4IJA A;  3F8F A;  1XN7 A;  3K70 D;  1NTC A;  2ECB A;  4P9F A;  2KP6 A;  4BGD A;  1VQ4 I;  1NHA A;  2LH9 A;  2K3F A;  1XGS A;  1HLV A;  1ZAR A;  3EDP A;  5EGO A;  4A3L J;  4G6D A;  1BR1 A;  3I56 I;  1Z6T A;  1PJR A;  2DOF A;  2WB1 A;  3CJN A;  4QPQ A;  2QSH X;  4X1E A;  4CCJ A;  4OIQ F;  3DQV C;  1Y0N A;  3FWE A;  4CO8 A;  4XM3 A;  4EVI A;  3PFI A;  1VQO I;  1H9T A;  1OCZ H;  3TDU C;  3KYL A;  5BQT A;  1JJ6 C;  1BOA A;  4OIN F;  4F52 A;  3JRG A;  2BHZ A;  3S2W A;  1Y39 A;  1ULY A;  2CW7 A;  1ORK A;  1E2X A;  1RUO A;  4D7N A;  1L3L A;  3DBH B;  3I4P A;  4A3J J;  3QWL A;  2CV1 A;  4I98 B;  1NG7 A;  3ZMU A;  2L4A A;  2DA2 A;  4EJW A;  2EIK H;  4L9N A;  2PBI A;  3ABK H;  1OCC H;  1MZB A;  1Z05 A;  1TWF J;  2CUF A;  3RDI A;  1HSJ A;  3FMQ A;  3DLL F;  3BRO A;  1MBG A;  4U0V A;  3A03 A;  3OY9 A;  1MNE A;  2W1O A;  3FBI B;  4ZZD A;  1BIB A;  2ZCW A;  3HRT A;  2D45 A;  3WU0 A;  4IHW A;  1U0J A;  2HQN A;  2VQG A;  3ZR8 X;  5C44 J;  1WJD A;  2YUS A;  2IS6 A;  1WHU A;  3HG9 A;  1SFX A;  4AIJ A;  2QKL B;  1TWA J;  3V8K A;  4E6K G;  5FB2 A;  3OYE A;  2FF4 A;  4MFE A;  4BS9 A;  4LD5 A;  4XLE A;  5HLG A;  2WAQ A;  2HNH A;  4AVZ A;  2O6G E;  4N4O B;  3BG6 A;  4RM2 A;  4C2U A;  3QYE A;  4EM0 B;  5DM7 F;  2RV8 A;  2VQC A;  3LFK A;  5FRN A;  4RAY A;  1BI2 A;  3CD6 I;  4II3 A;  3ZPL A;  1D8J A;  2HU9 A;  4JYK A;  1U9N A;  3OYM A;  4D0P A;  3ERE D;  4E4H A;  4UUT A;  2CRG A;  5E1Z B;  3FHN A;  2B63 J;  5J1R A;  1R1T A;  3WHC A;  2R7R A;  4F92 B;  2O8X A;  4AIH A;  1GV2 A;  1XGM A;  4RB3 C;  4JX6 A;  4ETS A;  4XKW A;  1GXP A;  2FX0 A;  2DA3 A;  4EEF G;  3GUD A;  1H0M A;  4HW0 A;  2RC4 A;  3BG3 A;  2KPM A;  1IJW C;  2XF5 A;  2KJB A;  2MD0 A;  3R4K A;  1RC9 A;  4H0E A;  3U9G A;  1A35 A;  2PLY A;  1K79 A;  3H0G J;  3I3L A;  4IHV A;  1SD5 A;  2VBZ A;  3ULQ B;  4Q47 A;  2KLO A;  2V9P A;  2V4J C;  3QPH A;  3G1O A;  1IW7 F;  1ON2 A;  1R36 A;  3E1S A;  3DEW A;  3LQQ A;  5E3N A;  1OR7 C;  2P8T A;  2MD5 A;  4A3F J;  1QQI A;  2K9M A;  3KYD B;  1VQP I;  4BQA A;  1HDD C;  4KN7 X;  3MZY A;  1BA5 A;  3F21 A;  1N25 A;  4M72 A;  1R71 A;  5J4V A;  1YHQ I;  2QQA A;  3HYI A;  5IOZ A;  2HKX A;  4A69 C;  4F55 A;  3DKY A;  1YW9 A;  5JLX A;  2HXO A;  3M1C A;  3QP5 A;  1RR7 A;  4XKV A;  4D5C A;  1Z3Y A;  3VEP A;  3IWZ A;  2KIF A;  2NNY A;  1J0R A;  1WCM J;  3FBN B;  3K4J A;  2V1N A;  3BC8 A;  4NC7 A;  1XC5 A;  2DPD A;  1YYV A;  3PNV A;  1WKM A;  1UHW A;  2FSW A;  3KP5 A;  1SVO A;  3CUO A;  3M8E A;  3J81 K;  1EH8 A;  5IYD J;  3F3X A;  4RLQ A;  1K78 B;  1K4T A;  3AG2 H;  1QO0 D;  1T38 A;  4KIT B;  3F22 A;  4GYI A;  2Y48 A;  4ZTJ A;  5HOO A;  1J5Y A;  1D0Z A;  3DTI A;  2KJC A;  1POG A;  5E3M A;  2VB6 A;  2JPC A;  3BR0 A;  4MEY F;  1U3E M;  2VJ4 A;  1E0E A;  2Z33 A;  2RQP A;  3I59 A;  4RA2 A;  2ZJ2 A;  1WPK A;  3FXK A;  5GTH C;  3FKJ A;  2GWR A;  3PO2 J;  2EFO A;  4IO9 F;  3QOE A;  3BJA A;  1FC3 A;  2HVQ A;  3O8H A;  2LTP A;  2M5W A;  1XTA A;  2MAB A;  3D1N I;  3ML6 A;  3U1D A;  2WBM A;  1YLF A;  2NS7 A;  1BJZ A;  4M71 A;  2MLK A;  4N4N B;  3S93 A;  5JR3 A;  5DEQ A;  2A07 F;  3FXU A;  4ESJ A;  3T8T A;  2DT6 A;  1B4A A;  5E1X A;  1HF0 A;  1B9M A;  2DOA A;  1ZEL A;  1APL C;  3DPT A;  4HZF A;  3HOZ J;  5DYM A;  2JPB A;  3TW7 A;  4A3E J;  5EJC A;  4B48 A;  3PIO F;  2VE9 A;  3MFK A;  4M74 A;  2DQL A;  2F5F A;  4G6T B;  3FIW A;  1D1A A;  2W24 A;  2E5N A;  3RPQ A;  2PMZ A;  4HLY A;  4IKF A;  1K7A A;  5FKO A;  3CF5 F;  1Y0U A;  4J19 A;  3B6A A;  1LB2 A;  4ZYH A;  2XAJ A;  4IRG A;  1JGS A;  1W5C C;  2ICW G;  2BVM A;  1QBJ A;  3DV8 A;  4B44 A;  3EPZ A;  4I09 A;  1U5T B;  1YW7 A;  4MFD A;  5TGT A;  4PSW A;  3BTC A;  4CXF A;  4AC0 A;  4F91 B;  2L9N A;  3IAS 2;  3RKW A;  2EWN A;  4I2O A;  4QPO A;  2LR8 A;  3VB2 A;  4XRS A;  1CGP A;  1UHS A;  4W97 A;  3GVA A;  3HSE A;  4BE2 A;  4RDU A;  2JN6 A;  5EEH A;  4XN3 A;  3ZGK A;  1VND A;  2M4K A;  4G7H F;  3EYY A;  1T98 A;  2UV1 A;  1WZ2 A;  4B09 A;  3I4N J;  2ME6 A;  3BR3 A;  3WG9 A;  3G71 I;  2UUZ A;  3K1M A;  2JRM A;  2HOE A;  3R0A A;  2RKH A;  2XGE A;  5LRR A;  2R5Y B;  3RPU D;  4HX8 A;  2LLK A;  3B73 A;  1IGN A;  3K2A A;  2BXZ A;  3L7W A;  4XKC A;  4ENN A;  4P5O A;  2IAI A;  4B4C A;  3NAU A;  4KT5 C;  2R7S A;  1D1C A;  4XLH A;  4FHT A;  5F6F A;  2QEN A;  2QYO A;  3FXM A;  3LL7 A;  2V6C A;  1GDT A;  1ERD A;  2Y30 A;  3CP2 A;  5HVQ C;  1FTZ A;  1OCP A;  2R5Z B;  1LUJ B;  4LG3 A;  4AD9 A;  1ZK8 A;  1EH7 A;  1RRJ A;  1QPM A;  1SAU A;  5ICG A;  2ECC A;  1X2M A;  4RGS A;  2DMU A;  4A3C J;  4RS8 A;  2QSF X;  3MKL A;  4EV0 A;  2ADU A;  2BY1 A;  1LDK B;  1J2X A;  2JUG A;  1XMX A;  2MYS A;  3E6D A;  2OCE A;  5D6E A;  2ZC2 A;  1TW2 A;  2R5Z A;  5L3B A;  1RUN A;  5F0H A;  3K70 C;  2KIS A;  1ZG5 A;  3S2H J;  3RKX A;  4ENJ A;  4BXF A;  1TBX A;  2JZY A;  3FF5 A;  5J3L A;  3Q0W A;  3P9C A;  4ENK A;  1QPI A;  1WI3 A;  1AKH B;  3DF8 A;  3K4L A;  4R8H A;  2PI0 A;  3TOB A;  2L02 A;  3W6J B;  3ZQI A;  2FE3 A;  2ZJP F;  2M0C A;  2BHY A;  3W2A A;  4OIP F;  1GV5 A;  3HOU J;  4A6D A;  3LSH A;  3MZH A;  3RJP A;  1FSH A;  3DU6 A;  3QPS A;  5M3M J;  3LQR A;  1AKH A;  1YE9 A;  3F6O A;  2LMD A;  3GTP J;  2QWW A;  4I6Z A;  1I50 J;  2LY2 A;  3FXL A;  1O57 A;  5J8F A;  1REP C;  1FMW A;  4F7Z A;  3OYL A;  3OSF A;  3O2P E;  4YIR X;  2DYS H;  4FT8 A;  5GAG J;  4LG0 B;  2VOO A;  3HKZ A;  3LA2 A;  2F48 A;  1N78 A;  1GT0 C;  3GZ5 A;  2L9S A;  3ZQH A;  2GBY A;  3K69 A;  5DM6 F;  3KLO A;  3HBL A;  5D8K B;  4MGR A;  3FXJ A;  3CMM A;  4LG0 A;  4CCN A;  3OYF A;  2VXZ A;  3ZQ7 A;  3PNT A;  2DO7 A;  3DEE A;  3H9J A;  1FSE A;  2DA6 A;  1FMV A;  1EKE A;  2M4G A;  2VI6 A;  1S72 I;  1IZ1 A;  1U78 A;  5B1A H;  3OMY A;  2W00 A;  4BU2 A;  2F2E A;  1MKM A;  1PVE A;  2IA1 A;  3MCZ A;  2M2E A;  4R79 A;  4L18 B;  5K5R A;  1FT9 A;  1FJL A;  1IXC A;  3MVP A;  1RPW A;  4I7H A;  3ECH A;  2Y69 H;  1LFP A;  4I0A A;  3I0T A;  2QSG X;  1B1B A;  2TDX A;  3UR3 C;  1BM9 A;  2VC1 A;  2HZD A;  1UST A;  3H92 A;  1TLH B;  2OBP A;  2TRT A;  3JAM K;  4Z2Y A;  2B9S A;  2E1M C;  2DFI A;  5B3S H;  3VSL A;  5AIP A;  2EFW A;  5FLV A;  3C1D A;  3GTK J;  1HKQ A;  4YIF A;  1BI1 A;  2QGU A;  1PP8 F;  1F36 A;  5F64 A;  3BR2 A;  2FNP A;  3M4O J;  3H3U A;  3FM5 A;  5J1Y A;  1XDU A;  2P0W A;  5F04 A;  3H35 A;  2A68 F;  3H3Z A;  1RES A;  4EJO A;  1LQ1 A;  4Q5S F;  2XPV A;  3Q9V A;  4Y52 J;  2XAF A;  4Y17 A;  1YFH A;  5HS8 A;  2O5R A;  2PMU A;  2AXL A;  4MLO A;  2M0M A;  2HQA A;  5IOY A;  4EJT A;  2JVG A;  4XSX F;  3IWF A;  1W4M A;  2ZO4 A;  1QU3 A;  4L5I A;  3F8M A;  2LOO A;  2QBY B;  4BL0 B;  2EJR A;  3ZQL A;  4AU7 A;  2XVC A;  2GOX B;  2X1C A;  2CFX A;  4A3D J;  4MTD A;  4ABZ A;  3PL8 A;  2R7F A;  1IUF A;  2DMQ A;  3G1M A;  4FE7 A;  4C3H J;  1FYL A;  1GXQ A;  2QBY A;  3TMO A;  2BOL A;  1I1S A;  4MTE A;  2IS4 A;  4HNT A;  3JRF A;  2VIX A;  3WU1 B;  3BG9 A;  4EJU A;  1I39 A;  2A6T A;  5J8C A;  2B0L A;  2P4W A;  2MBF A;  1R23 A;  3PSI A;  1XS9 A;  2NAZ A;  4HAM A;  4PJM A;  2NVY J;  3IRR A;  1YTY A;  3HL2 A;  2E7W A;  3S3O A;  3BWG A;  4KNY A;  2LC2 A;  4IL6 C;  1MBH A;  4GO1 A;  3L2U A;  3V8J A;  5FRM A;  2XC7 A;  3P9K A;  2K85 A;  1Y8R B;  2WV0 A;  3OS1 A;  3TO6 A;  1Y1W J;  1X1P A;  1WJA A;  1A6Q A;  1VFC A;  2XB0 X;  3IH3 A;  2RVC A;  2X48 A;  2EZI A;  4AWX B;  2IBD A;  3B6C A;  2R93 J;  3MEX A;  1X1C A;  2NYX A;  1TWH J;  2WWY A;  4HEA 2;  4IOA F;  4KN4 X;  5E3L A;  4XL9 A;  4ZDL A;  3L2C A;  1PDN C;  3NEU A;  4P1W A;  2QA4 I;  2BBY A;  2LFB A;  1ZR4 A;  2NXN B;  1X4O A;  2RN7 A;  1HBX G;  1VI0 A;  1FOW A;  2E71 A;  2L9R A;  3JRA A;  1D3Y A;  2K86 A;  4L9J A;  1SFU A;  3FK7 A;  3F6V A;  4CIC A;  4DOZ A;  2G0E A;  1WVR A;  1SMT A;  4YFN F;  2BGC A;  2DJI A;  2IRF G;  4L0Z B;  5L3F A;  1Z9C A;  1ZH5 A;  2A5W A;  2CSO A;  2PG4 A;  2DK5 A;  3KCC A;  1I6H J;  3GTG J;  4EMS A;  1J09 A;  5JI6 A;  3J7Y J;  3GEZ A;  4XMY A;  5D6F A;  3KX2 A;  2FMY A;  1VQ7 I;  1MMN A;  3F9K A;  4FCY A;  5LHI A;  4S05 A;  4CYD A;  4A3K J;  5D4R A;  2DOE A;  2L7K A;  3EYI A;  4B43 A;  2DMP A;  2GXG A;  1R58 A;  3HB9 A;  3PUB A;  1VQL I;  5F08 A;  3TO9 A;  3VWB A;  2R7W A;  2YU9 J;  5KCM A;  2ZJR F;  2VJJ A;  1KA8 A;  1X3Z B;  2V9V A;  3AG1 H;  3WE2 A;  5JHF A;  4OWR B;  1Z3X A;  1HC8 A;  1IRF A;  3ZMV A;  2VKD A;  2HVS A;  3OS0 A;  2OUM A;  2W25 A;  4IZZ A;  1FIA A;  1AOY A;  3IRQ A;  2XRO A;  5FKM A;  4C9Y A;  2CV2 A;  1R49 A;  2ME0 A;  1IG7 A;  3U1K A;  1P4A A;  3X2Q H;  2HI3 A;  3QYB A;  2OQG A;  3ZMT A;  1V3F A;  2X0L A;  3ZN0 A;  4UV9 A;  1LVK A;  1G59 A;  1XMA A;  2JA5 J;  2DU9 A;  5DDG A;  2R7D A;  1P7I A;  2A3S A;  2LKX A;  3BQZ A;  2JA2 A;  3GFI A;  2COM A;  4TV7 A;  4XR6 A;  2W7N A;  4NDL A;  5HLT A;  4WXH A;  5M5X J;  1UMQ A;  2Y9Y A;  3J7A Y;  3WTX C;  3BJ6 A;  1DGW Y;  1F1Z A;  1WSU A;  1FBS A;  3KEQ A;  2IT0 A;  3LST A;  2M87 A;  3ZOB A;  3LSP A;  4D1Q A;  1LDJ A;  2H8W A;  1P4W A;  2O3F A;  4M3B A;  1K61 A;  2ZBK A;  3TQN A;  4IPA A;  3TDZ C;  3IH4 A;  3C7J A;  1TQP A;  1WFX A;  4WWC A;  5K1Y A;  1HDP A;  2IEK A;  4XKB A;  2KFD A;  1JT6 A;  4BDY A;  1MMG A;  1QZY A;  1R5I D;  1U8B A;  2LY1 A;  4A2U A;  1Q1V A;  4A5M A;  2LK2 A;  1MW7 A;  3Q9S A;  4S04 A;  3S1M J;  3L1P A;  3N05 A;  3H0D A;  1RIO H;  4HG2 A;  1EF4 A;  2V1X A;  2FOK A;  1FLI A;  3DPL C;  1IN4 A;  5LGT A;  3ZQG A;  2JMW A;  3ABU A;  2HPM A;  5CPR B;  2CO5 A;  1IDY A;  2X51 A;  3PIP F;  2VKH A;  3K4B A;  5J1U A;  3AL0 C;  4I99 C;  3HSR A;  2DPU A;  3HKZ N;  5H20 A;  3OYJ A;  1LEB A;  1G3Y A;  2DFH A;  2IGK A;  5BOX A;  5IP7 J;  3MWM A;  2YR2 A;  4M73 A;  3I5U A;  5L3D A;  3H5R A;  5K7H A;  3SXY A;  2XV4 S;  1G2H A;  1P6R A;  3UNG C;  3GTL J;  1DDN A;  3KPH A;  1R6R A;  3MAJ A;  3EUH C;  2W85 A;  2HEO A;  2FU4 A;  3HOX J;  2FBK A;  1HKS A;  3C2B A;  2VOD A;  2Z99 A;  5EEA A;  3GLX A;  2E1C A;  1OR7 A;  1SEU A;  3PM1 A;  4HST A;  2L2O A;  4CH7 A;  3KFW X;  3HM5 A;  4G9Y A;  4XID A;  4U87 A;  3FXR A;  3CUQ C;  2GA1 A;  1TW3 A;  2NNN A;  2KT0 A;  1XCB A;  3LNQ A;  3V8L A;  4BXX J;  2LNB A;  2PX9 A;  1V5G A;  3PQJ A;  1DU6 A;  4KDP A;  5CKT A;  1R5H A;  1ONV A;  3SDG A;  1KU7 A;  3E6M A;  4Z6Y A;  5HS7 A;  2OF7 A;  5D8L B;  3IHU A;  1Z67 A;  4CYC B;  2ZME C;  3DKX A;  4LJZ F;  4CA0 A;  2AS5 F;  5GPC A;  2F6C A;  1A04 A;  3GF2 A;  2EZL A;  4HOB A;  4IEJ A;  2HOT A;  1KQ9 A;  3VYS B;  1F9N A;  2P6S A;  2NS8 A;  1UAA A;  5IPA A;  4UVC A;  1LE8 B;  3J80 Z;  3T8R A;  3CQZ J;  2HFH A;  3RKY A;  3JSO A;  1DP3 A;  4CYC A;  1AHD P;  1P7J A;  4RGX A;  1SD7 A;  1KGS A;  1ETW A;  2QQB A;  1VQN I;  5GAE J;  4MNU A;  3OIP A;  5EZH A;  2EFN A;  5DV5 A;  3ZMZ A;  4S0H B;  3V4G A;  1FIP A;  2KIU A;  3OL3 A;  4C2M J;  1LE8 A;  2RGV A;  1AU7 A;  1JKQ C;  2BEO A;  1ETX A;  3FZV A;  2WA0 A;  4Y33 A;  5TRD A;  4CCK A;  5BMZ A;  1BW6 A;  1RET A;  4ESF A;  4KIF A;  2GQQ A;  3OYI A;  3DEU A;  1AA7 A;  1UEL B;  2EIL H;  3VFZ A;  2VKE A;  3T5X A;  3K1P A;  1TL8 A;  3KZY A;  4KIS A;  1D0Y A;  1WWX A;  1MD0 A;  4HV6 A;  3RYP A;  1V5E A;  3ABM H;  2M8G X;  1W36 D;  1O3Q A;  4ENM A;  3L2R A;  1Z1D A;  3HUG B;  3MZ8 A;  1NG6 A;  4YFK F;  3TL4 X;  3IP4 B;  5L3C A;  2IS1 A;  1FOX A;  1K83 J;  5GPA A;  4DIQ A;  3H1C A;  3LSR A;  2UXN A;  4JX4 A;  3CF2 A;  4ZC3 A;  3LSM A;  3E0J B;  2ETH A;  3S16 J;  1S7O A;  3I58 A;  1ZYR F;  2LKS A;  2Q1Z B;  2M3A A;  3HUG A;  4RAG A;  5K5O A;  1VF9 A;  1GLN A;  1UHM A;  2RAE A;  1S7E A;  1S8N A;  3A01 B;  3PQK A;  4X6A J;  1RI7 A;  2K9S A;  2CH0 A;  5ED4 A;  2CWE A;  5D5U B;  1QHH D;  2Q8K A;  4BDZ A;  2EFQ A;  3KE2 A;  3IUO A;  1KON A;  2MLG A;  5B1B H;  5LBQ A;  2NRA C;  2X6X A;  4Q48 A;  4E7J A;  1XX5 A;  3JR9 A;  3E6C C;  1IXR C;  3E5U A;  3HTS B;  2HYJ A;  3A01 A;  4XQF A;  2NVX J;  1YG2 A;  5CVI A;  4I0B A;  1EV7 A;  1BIA A;  3WU2 C;  4DYR A;  5HDN A;  3ESW B;  3IKV A;  4HF2 A;  3OIO A;  1QVT A;  2ZXI A;  3K10 A;  3IL2 A;  3CP8 A;  4KIG A;  4A3B J;  1IV8 A;  4CGZ A;  5IP6 A;  2L01 A;  2AQF A;  4K2E A;  1JGG A;  1BC8 C;  4KIC A;  3HGY A;  2Z1D A;  2FQ3 A;  3GTM J;  1K78 A;  3O6B B;  5FLX Z;  2GIZ A;  5HDK A;  1YIT I;  4MIM A;  1HST A;  2D2W A;  3S3N A;  1G6N A;  4O5V A;  2KRF A;  2VBX A;  3L2V A;  1YJ9 I;  5JVT A;  2H27 A;  4G7O F;  3LOC A;  1MBF A;  3DBR B;  4M9X A;  2XDV A;  1B9N A;  4ZTF A;  1IUY A;  1YS6 A;  3H3V K;  3G2B A;  2XRN A;  2DFF A;  1ODD A;  4RMN A;  2BVL A;  2EQR A;  5E1W A;  3VSK A;  3WOD F;  5LHH A;  4P55 A;  4BAY A;  1FY7 A;  1HW5 A;  3GTJ J;  3W6V A;  4XN0 A;  2EH3 A;  3DU5 A;  3EUA A;  2K9L A;  5BS6 A;  2RDP A;  1USS A;  3QPT A;  1X1D A;  1ZG1 A;  2MFZ A;  3HHG A;  3WHB A;  1X4P A;  2HDW A;  2NOJ B;  4KYW A;  2HR3 A;  5A2Q Z;  3S1N J;  4U7B A;  1BOB A;  3G3Z A;  2OD5 A;  4U7D A;  3SEQ A;  4DW6 A;  3SZP A;  3ZQQ A;  5LEJ A;  1JI8 A;  1ZKG A;  3LWF A;  4LGW A;  5KNL A;  2JJ7 A;  5ERI A;  2MH2 A;  4E7L A;  2HPI A;  4BYY A;  3QOD A;  3E97 A;  1VZ0 A;  3KEO A;  1E3H A;  1E17 A;  2STT A;  3T0Y A;  2UXX A;  1ZRE A;  2Y31 A;  4IRH A;  4JOM A;  2OQR A;  2X1E A;  2D5V A;  1Z0X A;  2RNJ A;  2VJ5 A;  3K9T A;  4E7K A;  2N8G A;  1XG1 A;  2F5V A;  3TKY A;  2CQX A;  4O3M A;  4U0W A;  4EGY A;  2L9V A;  3HXL A;  2KZV A;  1FP2 A;  3R60 A;  1OIS A;  3N97 A;  2MSY A;  4H4K C;  1U5T A;  2XHK A;  2A69 F;  3CCV I;  3BR1 A;  5IYC J;  3IAM 2;  1KYW A;  2I5U A;  4JBA A;  3ZXS A;  5GP9 A;  5AIQ A;  3S14 J;  2K4J A;  3E5Q A;  4QIW N;  1XD7 A;  2ZXW H;  3LSG A;  2FUG 2;  4G6Q A;  3ASN H;  1B6A A;  1IC8 A;  2XGD A;  4HQE A;  4CSW A;  4X0G A;  1VTN C;  4KMU X;  2P5L C;  1JHF A;  2V26 A;  2KRH A;  3CC2 I;  2EV6 A;  2A6H F;  3R6S A;  1X1B A;  4CZC A;  3HOV J;  1TT0 A;  3H36 A;  3M8F A;  1FX7 A;  3BLY A;  2W84 A;  4HF0 A;  3V7C A;  3C2H A;  2R5Y A;  3RTR A;  3FXQ A;  5F1J A;  3CJT B;  2ACJ A;  4KT6 A;  4XSZ F;  3WGH A;  2GXB A;  2BYV E;  2FJ1 A;  1TWG J;  5FFX A;  4B8X A;  3JTG A;  1PUF B;  2JQ7 A;  4A0Z A;  1ITY A;  3RKQ A;  3IC7 A;  3LMM A;  2XF7 A;  2IP2 A;  2VPL A;  2DTZ A;  4I01 A;  4XLA A;  2LBF B;  3L9F A;  2XPW A;  2FBI A;  3KP3 A;  1WJ5 A;  3PNY A;  4FIS A;  3Q5F A;  4JX5 A;  2M7B A;  4CCL A;  1DGR M;  1PUF A;  5M5Y J;  3EET A;  2V9K A;  4RAZ A;  2E1O A;  1Z6R A;  1LNW A;  2E1M B;  2STW A;  1ZR2 A;  4L5E A;  3G4S I;  2OTJ I;  1EH6 A;  2DW4 A;  4YG2 F;  4N9I A;  2LBF A;  3TO7 A;  2K7L A;  3Q3S A;  3SFZ A;  1UFM A;  3TGN A;  1P9Q C;  4UVA A;  3G1L A;  3VYT B;  2Z3Y A;  5DCF A;  4DNC A;  1YJW I;  5LEK A;  1H89 C;  4JQF A;  3CCQ I;  1X3W B;  1W0T A;  3OR1 C;  1QHG A;  2AHQ A;  3JCU C;  2QEX I;  1LEA A;  1MIJ A;  1W7P D;  1ZTR A;  2ZJQ F;  5C4X J;  3GTQ J;  1TQI A;  4PZJ A;  4CHU A;  2VPR A;  1RZ4 A;  2VQL A;  2E60 A;  3GBG A;  5FRO A;  1MBJ A;  1T56 A;  3LAJ A;  3Q0U A;  1YRN B;  3ABT A;  3BTL A;  4EM2 A;  5JFR A;  2EZH A;  3ZQF A;  5E8I A;  3WTS C;  2L54 A;  3M3Y J;  4GRI A;  4QTR A;  3OYG A;  1OYY A;  2R4G A;  2ZSH B;  1YX3 A;  1V4R A;  2R7Q A;  3NWT A;  2CQ7 A;  3C18 A;  4HRI A;  2HOA A;  3JRD A;  3CDL A;  4HX7 A;  2IS2 A;  2IGN A;  5C3E J;  3JRB A;  2B7E A;  1YRN A;  1U9O A;  2DA7 A;  2GLO A;  1FNN A;  1ZAO A;  2XF6 A;  3CCY A;  3CJQ B;  3WTU C;  4BHB A;  1G3S A;  3GFJ A;  3I55 I;  4G7Z F;  5M5W J;  5H2F C;  1JKR C;  1KQ8 A;  2VT3 A;  3ROU A;  1QZE A;  1KU2 A;  2MW8 A;  2HXI A;  4GYG A;  1ZGA A;  2HOS A;  2BZT A;  4A3M J;  3SQN A;  4J01 A;  1U6G A;  2KKO A;  2YX4 A;  4XRF A;  2KRC A;  3OYN A;  4C2T A;  3RQI A;  1HXD A;  3GZ6 A;  3SZT A;  1VQ8 I;  3KP7 A;  1MMS A;  2E2H J;  4BEH B;  3S2D J;  4EQQ A;  2VN2 A;  3RYR A;  2CQQ A;  4RGU A;  1IF1 A;  1R1V A;  2CUZ A;  2DJN A;  4ZJZ A;  2QQ9 A;  1PP7 U;  1RR8 C;  5KK1 A;  3GXO A;  4QWQ A;  2XAG A;  3V7R A;  3PSF A;  4BEH A;  3M9A A;  3I53 A;  2E2I J;  5GTI C;  1ETY A;  4M3E A;  4KFC A;  4DYC A;  4U88 A;  3U2R A;  5K7F A;  4HSR A;  2I10 A;  3VOE A;  5LLQ A;  1B72 B;  2BV6 A;  1T0F A;  5ILV A;  2LRE A;  3CC4 I;  4O6J A;  4BKX A;  4LLN A;  2HWV A;  3JRC A;  4PDK A;  1IRG A;  1B72 A;  2OJE D;  1XMK A;  3HJE A;  1IN5 A;  3BT9 A;  2XGX A;  4OAY A;  4BQQ A;  1FPQ A;  2LDU A;  3DWL E;  4HLX A;  4DBQ A;  2XAH A;  1B59 A;  3WG7 H;  2VL8 A;  1JUM A;  2VKV A;  2HKO A;  4PK4 A;  1D1B A;  2Y0M A;  4M9Z A;  1G3W A;  3WGI A;  1XSV A;  2ESN A;  4PJJ A;  5BNG A;  2M34 A;  2MGQ A;  1R4N B;  3COA C;  4A0Y A;  1K6O A;  4BQO A;  2HGC A;  2DT5 A;  1ETQ A;  1AWC A;  1P4X A;  2MC4 A;  4YII A;  2OC6 A;  5M3F J;  1W36 C;  1ZRC A;  1ACI A;  1R1U A;  2Y9Z A;  2KIQ A;  1BJA A;  2PEX A;  2FEZ A;  4B47 A;  2ISY A;  4IOC F;  2GAU A;  4HNV A;  1CF7 B;  2CJJ A;  6PAX A;  2G7H A;  5JLW A;  2VJI A;  3NAR A;  4Q4Z F;  5JVG F;  3EUK L;  3S3M A;  2R92 J;  1OCT C;  2XSJ C;  1A36 A;  2K9Q A;  4NHJ A;  3BDD A;  3EQL F;  1CF7 A;  3S8P A;  3I54 A;  3NWS A;  2FXA A;  4BBR J;  2A6E F;  2Z5U A;  3ECO A;  3KP2 A;  4E7I A;  4UB8 C;  4QSH A;  2K4B A;  1DPR A;  1OYI A;  4OMZ A;  4R1H A;  4C3J J;  1XGO A;  1PYV A;  1MH3 A;  1U2W A;  3HPH A;  1XSD A;  3HOY J;  5EG0 B;  1TP4 A;  1GUU A;  3REO A;  3GZN B;  5EF6 A;  1MSE C;  3A0H C;  4RGR A;  3WTT C;  5F0C A;  1KU3 A;  4BJT A;  1MSF C;  2ZNY A;  1IN6 A;  3RI4 A;  4DJA A;  1OFC X;  1FZP B;  2FNA A;  4FX0 A;  2EZK A;  3DKW A;  3HGG A;  1R9T J;  4HDV A;  1OYW A;  1MDM B;  2P5K A;  2QCO A;  3BZ6 A;  3SYT A;  3IKT A;  1XSX A;  3CZ6 A;  2BY2 A;  5EYR A;  3CCM I;  1B8I B;  2Q0O A;  5DCM B;  3BR6 A;  1UJ8 A;  4LIT A;  2VOP A;  4NNJ A;  4HF1 A;  1FEX A;  1HKT A;  2J5O A;  2K02 A;  1F4K A;  5HDG A;  2M30 A;  1J9I A;  4M9S A;  3OIQ A;  4BUP A;  4D7M A;  2M9H A;  1OKR A;  3FMS A;  3R0J A;  3VYU B;  1V55 H;  5LD2 C;  3S17 J;  2F4M B;  2EV0 A;  2GIV A;  3TW6 A;  4MHG A;  5DCM A;  1B8I A;  1P92 A;  1I1G A;  1MJB A;  3FKI J;  1V54 H;  2CU7 A;  3MD2 A;  2ESH A;  2E36 A;  3J7A O;  1LJ9 A;  5LFA A;  2IA2 A;  2X6O A;  5ILS A;  1ZQ3 P;  4PUS A;  1FOY A;  5LGU A;  4HA8 A;  2HDD A;  2YX7 A;  2X85 A;  3RPU A;  3RZO J;  2QF7 A;  3AKZ A;  1RKT A;  2MC3 A;  1D8K A;  1JXS A;  2DFE A;  2WTE A;  3S32 A;  1OCO H;  3E7L A;  1FTT A;  1YX5 A;  5BPD A;  3FX3 A;  2EFP A;  2DMT A;  3J80 K;  2KIM A;  2GA2 A;  1ZLJ A;  3AL0 B;  5KAI C;  1IXS B;  1SD6 A;  2IXS A;  2P6T A;  4MEX F;  1LFU P;  1TWC J;  2ELK A;  1YW8 A;  5B66 C;  3P7N A;  4IVN A;  3C2G A;  3W2V A;  3SFI A;  1IN7 A;  2QUF A;  3GTO J;  3JRE A;  2AQE A;  5L3E A;  4HDU A;  1WI9 A;  1J7K A;  1I3A A;  2PQ8 A;  1T39 A;  4ITV A;  3BG5 A;  1G8X A;  3D5S C;  3SDB A;  2JA6 J;  1FOK A;  5FFZ A;  1ZGJ A;  2DK8 A;  1WJE A;  2OCC H;  1BR2 A;  3CJR B;  1I5Z A;  3A1Y A;  2Y0S N;  4FET A;  2MG4 A;  3OWT A;  3JW4 A;  3H9Q A;  4HV5 A;  2OPT A;  2BXY A;  3NRV A;  3CUQ B;  1YS7 A;  3JRI A;  1O4X A;  3F0C A;  3KZZ A;  4BHP A;  4G12 A;  5DUK A;  2GXA A;  4G8X A;  1BC7 C;  2E5Z A;  4B3A A;  1CQT A;  5CQG A;  1EJ9 A;  3CCE I;  4EGZ A;  1JE8 A;  2RRE A;  1OJL A;  1D5Y A;  2JA7 J;  4AVP A;  2EK5 A;  2H1L A;  2FRH A;  1K4S A;  1T95 A;  3BZC A;  1SFK A;  4IHS A;  3CUQ A;  2V79 A;  2R7V A;  1J75 A;  2LG4 A;  5D5X B;  4DQ2 A;  1R4M B;  4HYE A;  1ZRF A;  2ZME B;  1XGN A;  2EA2 A;  3FK6 A;  5FGM A;  4AIK A;  3A02 A;  2W57 A;  4XK4 A;  1VQK I;  3SJM A;  2LVS A;  2FQ4 A;  2QQ8 A;  3VOD A;  2G7U A;  2CFO A;  3FM3 A;  4WK8 F;  2PJR B;  2HS5 A;  1EA3 A;  1IV6 A;  3OOP A;  2WAE A;  2QZ8 A;  2ZME A;  3S15 J;  2IW5 A;  1DUX C;  1X19 A;  2DBB A;  1V5F A;  3GW2 A;  3BZK A;  3K6G A;  3L09 A;  2EA4 A;  2LYC A;  3DP7 A;  1KYZ A;  3HRU A;  2AO9 A;  4L9T A;  2IVM A;  1S7A A;  2COB A;  5FD6 A;  1IRZ A;  1T8I A;  5EEG A;  2VXD A;  1O7L A;  1X58 A;  2CUE A;  5HS9 A;  3AAF A;  3K4C A;  2FA5 A;  3P9I A;  1BL0 A;  1WGX A;  5FKK A;  2O0Y A;  4ESB A;  3MKW B;  3K7A J;  3WTW C;  4FAS D;  3OYA A;  1P2F A;  4M6Y A;  3ONQ A;  1Z91 A;  3QAH A;  3K4M A;  4DZP A;  2DYR H;  4YEJ A;  5FLX K;  1SVM A;  1LPQ A;  2XIG A;  3PFY A;  4Y4R A;  2YS9 A;  2JT1 A;  2ZFW A;  4GGG A;  5IT9 Z;  4C30 A;  5HNF A; 
#chains in the Genus database with same CATH homology
 1ON1 A;  4L9V A;  3QU3 A;  3ZMS A;  3E3V A;  1S6L A;  2DI3 A;  3HTU A;  4PGG A;  4PGH A;  1DPU A;  2HYF A;  2ZNZ A;  1L0O C;  3ZN1 A;  5A2Q K;  4A0X A;  3K0L A;  3FHZ A;  1ZLK A;  3WTZ A;  5FD5 A;  2M45 A;  5J6X A;  1TNS A;  1FWZ A;  3GO5 A;  3HOS A;  2CW0 F;  2Y75 A;  4E70 A;  1FYM A;  4ZYD A;  4CDG A;  2C6Y A;  1GHC A;  3D5L A;  4XLN F;  4BXU A;  3JTH A;  2YPR A;  1ZRD A;  2JRT A;  1FYK A;  5D5V B;  4KIB A;  2VBY A;  4BHC A;  1SD4 A;  5HLH A;  3L00 A;  5FO5 A;  3QRF F;  1O3S A;  1WQ2 A;  2EV5 A;  1XCV A;  1T6S A;  3KP4 A;  4P9U A;  2H09 A;  2F5D A;  4A6E A;  2LKP A;  3SHF A;  2OU2 A;  2MH9 A;  1SAX A;  2ISZ A;  5HLI A;  2F5C A;  5LRS A;  4EJV A;  2DLL A;  5BPI A;  2HYG D;  5ICF A;  3CDH A;  2JSC A;  3HHH A;  4JK1 X;  2VE8 A;  3KET A;  3R61 A;  1LDD A;  4N0B A;  5ILU A;  2VON A;  2VT2 A;  4L0Y B;  2IA0 A;  4UV8 A;  5H6Q A;  3F8C A;  4WCG A;  1IAW A;  3I59 B;  1YIO A;  4ZZL A;  4XLP F;  1OMI A;  3NQO A;  1MJA A;  4IXA A;  2HQR A;  4KA4 A;  4UUV A;  2H6C A;  5CVR A;  1C0W A;  2YSR A;  1W5T A;  4CZZ A;  2XAQ A;  2XKP A;  4U0Y A;  3CO7 C;  2LSO A;  3ZMD A;  2F5E A;  5CVV A;  1R00 A;  1TNT A;  3MQ0 A;  2Q2E A;  4MQ9 F;  2EB7 A;  4HQM A;  2M8E A;  3QP6 A;  3ISP A;  1STZ A;  4IHT A;  2L4M A;  2JTV A;  2P7V B;  5IT3 A;  2VBW A;  4IRI A;  4EM1 A;  1XB4 A;  2ZXJ A;  2G9W A;  5LHG A;  2HTJ A;  2PMH A;  2ZKZ A;  5JHU A;  4ON0 A;  4RB0 A;  1FBU A;  4WF2 A;  4RB1 A;  5DD4 A;  1ZHF A;  2CGP A;  5E8G A;  2OA4 A;  3JSP A;  1Q1H A;  2MA3 A;  2DQR A;  1D5V A;  2ELH A;  3F72 A;  3T1B A;  2D1V A;  5E18 F;  5CLS A;  1X3U A;  4WXC A;  4ASN A;  4OIR F;  3I64 A;  1I6X A;  2QLZ A;  4YFX F;  1SFE A;  3LA3 A;  1MGT A;  3BJO A;  2D1H A;  4LMY A;  3HRS A;  2XAS A;  3HOT A;  2OZU A;  3M7G A;  2J5P A;  1H9G A;  4WXD A;  4LFU A;  3DXJ F;  1FBQ A;  2IPQ X;  4ZH4 F;  4LB5 A;  2HDC A;  2FML A;  2UWM A;  1QGP A;  2V1U A;  3WTY C;  1TQM A;  4P96 A;  1IN8 A;  3J81 Z;  1LVA A;  3V7S A;  1OPC A;  3HIF A;  1O3T A;  5KVR A;  2A5Y B;  1S3J A;  5AON A;  3KLN A;  1U5T C;  2E1N A;  1ZG3 A;  5L3G A;  4MQV A;  3TOA A;  5ICC A;  1R5G A;  1QZZ A;  1Z7U A;  1T2K A;  2P7C B;  1R22 A;  1BI0 A;  3BPV A;  3WE3 A;  2H6B A;  2IJL A;  4UXN A;  4OMY A;  2HZT A;  2CG4 A;  4FX4 A;  2A61 A;  2XKO A;  2CQK A;  1UCR A;  3E6B A;  2BE5 F;  1YO5 C;  1RNL A;  1PUE E;  3RIR A;  4LK0 F;  3W6K B;  1HQC A;  2VC0 A;  4UVB A;  3FMR A;  3WTV C;  4UNO A;  4G94 A;  4WX9 A;  4RB2 C;  2V1D A;  2K27 A;  3BPX A;  1U8R A;  2HTS A;  2PFB A;  4LLG F;  4I02 A;  3GX4 X;  1I27 A;  2P5V A;  4HBL A;  2PJP A;  4OIO F;  4Y15 A;  3F8B A;  3WGG A;  1BBY A;  4XBF A;  2YU3 A;  3ZP5 A;  4KUM A;  3KP6 A;  5E17 F;  1BI3 A;  2X4H A;  5CJ9 A;  4LB6 B;  4OOI A;  2XUB A;  4BNC A;  2H94 A;  1UB9 A;  1WRJ A;  2FBH A;  3D0S A;  4L5J A;  3GFL A;  4ZYG A;  5DUI A;  2CYY A;  3CO6 C;  4IF4 A;  1G3T A;  3K1N A;  1W5S A;  3F23 A;  2GZW A;  1BN5 A;  5IT9 K;  2M1B A;  4Y13 A;  2LF8 A;  5D5W B;  1G4D A;  1QNT A;  2R3S A;  3QU6 A;  3BOQ A;  1KU9 A;  3E5X A;  5TJJ A;  2UZK A;  3OV8 A;  4NQW A;  1MDM A;  2WC2 A;  3ELK A;  1FP1 D;  3GWZ A;  1KQ0 A;  1HW1 A;  3QOP A;  3CTA A;  4QLC U;  5CVJ A;  4KMF A;  3I71 A;  4GCV A;  3M1E A;  4NB5 A;  5K5Q A;  3N4M A;  2OZ6 A;  1DP7 P;  4ZYE A;  2NS0 A;  4OU0 A;  3B02 A;  4PCQ A;  5DD8 A;  2DTR A;  2LF7 A;  2O61 A;  3G73 A;  1HW2 A;  5H6R A;  3GYH X;  3BY6 A;  3HRM A;  3LA7 A;  3GFM A;  5D4S A;  5CVU A;  1F5T A;  1O7F A;  4LK1 F;  4A12 A;  1GVJ A;  2QM3 A;  2QVO A;  3CLO A;  5F1R A;  1W7P B;  3EUH A;  1YQA A;  2PN6 A;  1S29 A;  4LLL A;  4BH9 A;  3LAP A;  1JHH A;  5LGN A;  3JAM Z;  4N9H A;  3DFG A;  1W7P A;  2OAZ A;  1R7J A;  2Z9O A;  4M6X A;  5E20 A;  3C3W A;  5ICE A;  2E7X A;  1SMY F;  3F8N A;  2DAO A;  1XDS A;  5CYV A;  4GXO A;  3O3K A;  1TTY A;  1J59 A;  4UHT A;  3HSF A;  4HX4 A;  1MJ9 A;  3K2Z A;  2L3D A;  2O03 A;  4A5N A;  1ZN2 A;  1O3R A;  3BP8 A;  4IJA A;  3F8F A;  1XN7 A;  4P9F A;  1NHA A;  1XGS A;  1ZAR A;  3EDP A;  4G6D A;  1Z6T A;  3CJN A;  4OIQ F;  3DQV C;  3FWE A;  4CO8 A;  4EVI A;  3PFI A;  1H9T A;  3TDU C;  5BQT A;  1BOA A;  4OIN F;  3S2W A;  1ULY A;  1E2X A;  1RUO A;  1L3L A;  3I4P A;  4I98 B;  3ZMU A;  2L4A A;  4EJW A;  4L9N A;  2PBI A;  1MZB A;  1Z05 A;  3RDI A;  1HSJ A;  3FMQ A;  3BRO A;  4U0V A;  4ZZD A;  1BIB A;  2ZCW A;  3HRT A;  2D45 A;  3WU0 A;  2HQN A;  1SFX A;  4AIJ A;  3V8K A;  5FB2 A;  2FF4 A;  4LD5 A;  5HLG A;  2O6G E;  4EM0 B;  2RV8 A;  3LFK A;  4RAY A;  1BI2 A;  3ZPL A;  1D8J A;  4D0P A;  3ERE D;  5E1Z B;  1R1T A;  2O8X A;  4AIH A;  1XGM A;  4RB3 C;  4ETS A;  1GXP A;  1H0M A;  3GUD A;  4HW0 A;  2RC4 A;  2KJB A;  3R4K A;  4H0E A;  3U9G A;  2PLY A;  1K79 A;  1SD5 A;  2VBZ A;  3ULQ B;  4Q47 A;  3QPH A;  1IW7 F;  1ON2 A;  1R36 A;  3LQQ A;  2P8T A;  2MD5 A;  1QQI A;  4BQA A;  4KN7 X;  3MZY A;  3F21 A;  4M72 A;  2QQA A;  3HYI A;  2HKX A;  1YW9 A;  3QP5 A;  3VEP A;  3IWZ A;  2KIF A;  2NNY A;  1J0R A;  2DPD A;  1YYV A;  1WKM A;  1UHW A;  2FSW A;  3KP5 A;  3CUO A;  3M8E A;  3J81 K;  1EH8 A;  3F3X A;  1K78 B;  1QO0 D;  1T38 A;  3F22 A;  4GYI A;  2Y48 A;  5HOO A;  1J5Y A;  2KJC A;  4MEY F;  2JPC A;  1U3E M;  2Z33 A;  2RQP A;  3I59 A;  2ZJ2 A;  2GWR A;  2EFO A;  3BJA A;  1FC3 A;  2M5W A;  3ML6 A;  3U1D A;  1YLF A;  4M71 A;  2MLK A;  5JR3 A;  5DEQ A;  2A07 F;  3FXU A;  4ESJ A;  3T8T A;  1B4A A;  5E1X A;  1B9M A;  3DPT A;  4HZF A;  5DYM A;  2JPB A;  2VE9 A;  3MFK A;  4M74 A;  2DQL A;  2F5F A;  2W24 A;  3RPQ A;  4HLY A;  1K7A A;  1Y0U A;  1LB2 A;  4ZYH A;  2XAJ A;  4IRG A;  1JGS A;  1QBJ A;  3DV8 A;  4I09 A;  1U5T B;  1YW7 A;  4CXF A;  3RKW A;  2EWN A;  4I2O A;  3VB2 A;  1CGP A;  3GVA A;  3HSE A;  5EEH A;  4G7H F;  3EYY A;  1T98 A;  4B09 A;  3WG9 A;  3K1M A;  2HOE A;  3R0A A;  2RKH A;  5LRR A;  4HX8 A;  3B73 A;  3L7W A;  4ENN A;  4P5O A;  4KT5 C;  4FHT A;  5F6F A;  2QEN A;  2QYO A;  2V6C A;  5HVQ C;  4AD9 A;  1EH7 A;  1QPM A;  5ICG A;  4RGS A;  4RS8 A;  4EV0 A;  2ADU A;  1LDK B;  1J2X A;  3E6D A;  5D6E A;  1TW2 A;  5L3B A;  1RUN A;  1ZG5 A;  3RKX A;  4ENJ A;  1TBX A;  2JZY A;  3FF5 A;  3P9C A;  4ENK A;  3DF8 A;  4R8H A;  2PI0 A;  3TOB A;  2L02 A;  3W6J B;  4OIP F;  2FE3 A;  4A6D A;  3MZH A;  3RJP A;  1FSH A;  3LQR A;  3F6O A;  2QWW A;  1O57 A;  5J8F A;  1REP C;  4F7Z A;  3O2P E;  4LG0 B;  4FT8 A;  2VOO A;  3LA2 A;  3GZ5 A;  3K69 A;  3KLO A;  5D8K B;  4MGR A;  4LG0 A;  2VXZ A;  3ZQ7 A;  2DO7 A;  1FSE A;  1IZ1 A;  1U78 A;  2F2E A;  1MKM A;  2IA1 A;  3MCZ A;  4R79 A;  4L18 B;  5K5R A;  1FT9 A;  1IXC A;  4I7H A;  3ECH A;  4I0A A;  3I0T A;  1B1B A;  2TDX A;  1BM9 A;  2VC1 A;  3H92 A;  1UST A;  1TLH B;  2OBP A;  3JAM K;  4Z2Y A;  2DFI A;  5AIP A;  2EFW A;  3C1D A;  1HKQ A;  4YIF A;  1BI1 A;  1PP8 F;  5F64 A;  2FNP A;  3H3U A;  3FM5 A;  1XDU A;  2A68 F;  3H3Z A;  4EJO A;  1LQ1 A;  4Q5S F;  3Q9V A;  2XAF A;  4Y17 A;  1YFH A;  5HS8 A;  2PMU A;  2AXL A;  4EJT A;  4XSX F;  3IWF A;  1W4M A;  2ZO4 A;  4L5I A;  3F8M A;  2QBY B;  2EJR A;  2XVC A;  2CFX A;  4MTD A;  2R7F A;  1FYL A;  1GXQ A;  2QBY A;  1I1S A;  4MTE A;  3WU1 B;  4EJU A;  5J8C A;  2B0L A;  2P4W A;  2MBF A;  1R23 A;  2NAZ A;  4HAM A;  3IRR A;  1YTY A;  2E7W A;  3BWG A;  4KNY A;  4GO1 A;  3V8J A;  3P9K A;  2WV0 A;  3TO6 A;  2RVC A;  4AWX B;  3MEX A;  2NYX A;  2WWY A;  4KN4 X;  3L2C A;  1PDN C;  3NEU A;  2BBY A;  2RN7 A;  1HBX G;  1D3Y A;  2K86 A;  4L9J A;  1SFU A;  3F6V A;  4CIC A;  1SMT A;  4YFN F;  2BGC A;  2IRF G;  4L0Z B;  5L3F A;  1Z9C A;  1ZH5 A;  2CSO A;  2PG4 A;  2DK5 A;  3KCC A;  4EMS A;  5JI6 A;  3GEZ A;  5D6F A;  2FMY A;  5LHI A;  4S05 A;  4CYD A;  5D4R A;  3EYI A;  2GXG A;  1R58 A;  3TO9 A;  1KA8 A;  2V9V A;  3WE2 A;  1IRF A;  3ZMV A;  2W25 A;  1AOY A;  3IRQ A;  2XRO A;  1P4A A;  2OQG A;  3ZMT A;  1V3F A;  2X0L A;  3ZN0 A;  4UV9 A;  1XMA A;  2DU9 A;  5DDG A;  2R7D A;  2A3S A;  3GFI A;  2COM A;  4TV7 A;  4WXH A;  3WTX C;  3BJ6 A;  1F1Z A;  1WSU A;  1FBS A;  3KEQ A;  2IT0 A;  3LST A;  2M87 A;  1LDJ A;  1P4W A;  2O3F A;  2ZBK A;  3TQN A;  4IPA A;  3TDZ C;  3C7J A;  1TQP A;  4WWC A;  5K1Y A;  1QZY A;  4A2U A;  4A5M A;  3Q9S A;  4S04 A;  1RIO H;  2V1X A;  2FOK A;  1FLI A;  3DPL C;  1IN4 A;  5LGT A;  3ABU A;  2CO5 A;  3HSR A;  2DPU A;  5H20 A;  1LEB A;  1G3Y A;  5BOX A;  3MWM A;  2YR2 A;  4M73 A;  3I5U A;  5L3D A;  3SXY A;  2XV4 S;  1P6R A;  1DDN A;  3MAJ A;  2W85 A;  2HEO A;  2FU4 A;  2FBK A;  1HKS A;  2VOD A;  2Z99 A;  3GLX A;  2E1C A;  1OR7 A;  3KFW X;  4G9Y A;  3FXR A;  3CUQ C;  2GA1 A;  1TW3 A;  2NNN A;  1XCB A;  3V8L A;  2LNB A;  3PQJ A;  4KDP A;  1R5H A;  1ONV A;  1KU7 A;  3E6M A;  5HS7 A;  5D8L B;  3IHU A;  4LJZ F;  2AS5 F;  3GF2 A;  1A04 A;  4HOB A;  1KQ9 A;  1F9N A;  2P6S A;  4UVC A;  3J80 Z;  3T8R A;  2HFH A;  3RKY A;  3JSO A;  4RGX A;  1SD7 A;  1KGS A;  2QQB A;  4MNU A;  2EFN A;  5DV5 A;  3ZMZ A;  3V4G A;  2KIU A;  2RGV A;  2BEO A;  3FZV A;  5TRD A;  5BMZ A;  4ESF A;  4KIF A;  2GQQ A;  3DEU A;  3VFZ A;  3T5X A;  3K1P A;  3KZY A;  1WWX A;  1MD0 A;  4HV6 A;  3RYP A;  1O3Q A;  4ENM A;  1Z1D A;  4YFK F;  5L3C A;  2UXN A;  2ETH A;  1S7O A;  3I58 A;  1ZYR F;  3HUG A;  5K5O A;  1UHM A;  1S8N A;  3PQK A;  1RI7 A;  5ED4 A;  5D5U B;  2CWE A;  2Q8K A;  2EFQ A;  3KE2 A;  2NRA C;  2MLG A;  5LBQ A;  4Q48 A;  3E6C C;  1IXR C;  3E5U A;  3HTS B;  1YG2 A;  5CVI A;  4I0B A;  1EV7 A;  1BIA A;  5HDN A;  3IKV A;  4HF2 A;  3IL2 A;  4KIG A;  4CGZ A;  2L01 A;  4K2E A;  1BC8 C;  4KIC A;  2FQ3 A;  1K78 A;  3O6B B;  5FLX Z;  5HDK A;  1HST A;  2D2W A;  1G6N A;  4O5V A;  2KRF A;  2VBX A;  4G7O F;  5JVT A;  2H27 A;  4M9X A;  1B9N A;  1IUY A;  1YS6 A;  2XRN A;  5LHH A;  1ODD A;  5E1W A;  3WOD F;  4P55 A;  4BAY A;  1FY7 A;  1HW5 A;  5BS6 A;  2RDP A;  1USS A;  3QPT A;  1ZG1 A;  3HHG A;  4KYW A;  2HR3 A;  5A2Q Z;  4U7B A;  3G3Z A;  2OD5 A;  4U7D A;  3SZP A;  5LEJ A;  3LWF A;  4LGW A;  5ERI A;  2MH2 A;  4BYY A;  3E97 A;  3KEO A;  1E17 A;  2STT A;  3T0Y A;  2UXX A;  1ZRE A;  4IRH A;  2OQR A;  2RNJ A;  3K9T A;  3TKY A;  4O3M A;  4U0W A;  4EGY A;  1FP2 A;  3R60 A;  3N97 A;  1U5T A;  2XHK A;  2A69 F;  1KYW A;  4JBA A;  5AIQ A;  2K4J A;  3E5Q A;  1XD7 A;  4G6Q A;  1B6A A;  4HQE A;  1VTN C;  4KMU X;  2P5L C;  1JHF A;  2EV6 A;  2A6H F;  3R6S A;  3M8F A;  1FX7 A;  2W84 A;  4HF0 A;  3V7C A;  3RTR A;  3FXQ A;  2ACJ A;  4XSZ F;  3WGH A;  2GXB A;  2BYV E;  5FFX A;  4B8X A;  3JTG A;  4A0Z A;  3IC7 A;  2IP2 A;  4I01 A;  3L9F A;  2FBI A;  3KP3 A;  3Q5F A;  3EET A;  4RAZ A;  1Z6R A;  1LNW A;  2STW A;  1EH6 A;  2DW4 A;  4YG2 F;  4N9I A;  3TO7 A;  2K7L A;  3SFZ A;  1UFM A;  3TGN A;  4UVA A;  2Z3Y A;  5DCF A;  4DNC A;  5LEK A;  4JQF A;  1LEA A;  1W7P D;  1TQI A;  4PZJ A;  4CHU A;  1RZ4 A;  3LAJ A;  3ABT A;  4EM2 A;  5JFR A;  5E8I A;  3WTS C;  2L54 A;  1OYY A;  1V4R A;  3C18 A;  4HX7 A;  1FNN A;  1ZAO A;  3WTU C;  4BHB A;  1G3S A;  3GFJ A;  4G7Z F;  1KQ8 A;  2VT3 A;  3ROU A;  1KU2 A;  4GYG A;  1ZGA A;  3SQN A;  1U6G A;  2KKO A;  2YX4 A;  4XRF A;  1HXD A;  3GZ6 A;  3SZT A;  3KP7 A;  4EQQ A;  2VN2 A;  3RYR A;  4RGU A;  1IF1 A;  1R1V A;  2QQ9 A;  1PP7 U;  5KK1 A;  3GXO A;  4QWQ A;  2XAG A;  3V7R A;  3M9A A;  3I53 A;  4KFC A;  4U88 A;  3U2R A;  3VOE A;  5LLQ A;  2BV6 A;  1T0F A;  5ILV A;  4O6J A;  4LLN A;  2HWV A;  4PDK A;  1IRG A;  1XMK A;  1IN5 A;  2XGX A;  1FPQ A;  2LDU A;  4HLX A;  2XAH A;  1B59 A;  2HKO A;  2Y0M A;  4M9Z A;  1G3W A;  3WGI A;  1XSV A;  2ESN A;  3COA C;  4A0Y A;  1K6O A;  2HGC A;  2DT5 A;  1AWC A;  1P4X A;  4YII A;  1ZRC A;  1R1U A;  1BJA A;  2PEX A;  2FEZ A;  2ISY A;  2GAU A;  1CF7 B;  6PAX A;  2G7H A;  4Q4Z F;  4NHJ A;  3BDD A;  3EQL F;  1CF7 A;  3I54 A;  2FXA A;  2A6E F;  2Z5U A;  3ECO A;  3KP2 A;  2K4B A;  1DPR A;  1OYI A;  4OMZ A;  4R1H A;  1XGO A;  1U2W A;  1XSD A;  3REO A;  3WTT C;  4RGR A;  1KU3 A;  2ZNY A;  1IN6 A;  3RI4 A;  1FZP B;  2FNA A;  4FX0 A;  3DKW A;  4HDV A;  1OYW A;  1MDM B;  2P5K A;  3BZ6 A;  3IKT A;  1XSX A;  2Q0O A;  5DCM B;  2VOP A;  4HF1 A;  1HKT A;  2J5O A;  2K02 A;  1F4K A;  5HDG A;  2M30 A;  1J9I A;  4M9S A;  3FMS A;  1OKR A;  3R0J A;  2EV0 A;  2GIV A;  4MHG A;  5DCM A;  1P92 A;  1I1G A;  1MJB A;  2ESH A;  3J7A O;  1LJ9 A;  2IA2 A;  5ILS A;  5LGU A;  4HA8 A;  2YX7 A;  3RPU A;  2MC3 A;  1D8K A;  1JXS A;  2WTE A;  5BPD A;  3FX3 A;  2EFP A;  3J80 K;  2KIM A;  2GA2 A;  1ZLJ A;  1IXS B;  1SD6 A;  2P6T A;  4MEX F;  1YW8 A;  3P7N A;  4IVN A;  1IN7 A;  2QUF A;  4HDU A;  5L3E A;  1WI9 A;  1J7K A;  2PQ8 A;  1T39 A;  1FOK A;  5FFZ A;  1ZGJ A;  2DK8 A;  1I5Z A;  3JW4 A;  4HV5 A;  3NRV A;  3CUQ B;  1YS7 A;  3KZZ A;  4BHP A;  5DUK A;  4G8X A;  1BC7 C;  4EGZ A;  1JE8 A;  4AVP A;  2EK5 A;  2FRH A;  4IHS A;  3CUQ A;  2V79 A;  1J75 A;  5D5X B;  4DQ2 A;  4HYE A;  1ZRF A;  2ZME B;  1XGN A;  2EA2 A;  5FGM A;  4AIK A;  2W57 A;  3VOD A;  2G7U A;  3FM3 A;  4WK8 F;  2HS5 A;  3OOP A;  2QZ8 A;  2ZME A;  2IW5 A;  1DUX C;  2DBB A;  3GW2 A;  3L09 A;  2EA4 A;  3DP7 A;  3HRU A;  1KYZ A;  4L9T A;  2IVM A;  1S7A A;  5FD6 A;  5EEG A;  1O7L A;  5HS9 A;  3AAF A;  2FA5 A;  3P9I A;  2O0Y A;  4ESB A;  3WTW C;  1P2F A;  4M6Y A;  1Z91 A;  3QAH A;  5FLX K;  2XIG A;  2JT1 A;  2ZFW A;  4GGG A;  5IT9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...