2H8WA

Solution structure of ribosomal protein l11
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
147
structure length
147
Chain Sequence
b'MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
molecule tags Rna binding protein
source organism Thermus thermophilus
publication title The Structure of Free L11 and Functional Dynamics of L11 in Free, L11-rRNA(58 nt) Binary and L11-rRNA(58 nt)-thiostrepton Ternary Complexes.
pubmed doi rcsb
total genus 15
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2h8wA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2h8wA01
5GADJ 1FOXA 2QEXI 2E34A 3CJSB 3EGVB 1FOWA 4V19K 2K3FA 3CC4I 1VQ6I 4IOAF 3CD6I 1YIJI 4IO9F 4IOCF 3CC7I 1VQ5I 3CMEI 5GAHJ 3J7ZI 3CCMI 1YJ9I 3CCVI 2OTJI 2JQ7A 1VQ9I 3CCEI 3G4SI 3CJQB 2E36A 1YJWI 2H8WA 1VQOI 3CCRI 3CMAI 1VQKI 3CJTB 3G71I 1ACIA 1Y39A 1MMSA 3CJRB 1VQPI 2QA4I 1YI2I 2E35A 1YITI 5DM6F 1FOYA 1S72I 2OTLI 1WIBA 1YHQI 3PIPF 5DM7F 3CCSI 1YJNI 1QA6A 1VQNI 2ZJPF 3DLLF 3CF5F 5JVGF 3J7YJ 1VQ7I 3CCUI 1HC8A 2ZJQF 3CCJI 3CC2I 2FOWA 5GAEJ 1VQ4I 3I56I 2ZJRF 3I55I 4UY8I 3CCQI 1VQ8I 2NXNB 1VQMI 5GAGJ 3PIOF 3CCLI 3G6EI 1VQLI
chains in the Genus database with same CATH superfamily
3LNQA 4IJAA 2L5QA 3LSGA 2Z9OA 2VPRA 2QBYA 3RYPA 3S15J 4CHUA 2L9VA 2RDPA 2RKHA 2IVMA 3DV8A 3GUDA 3GTMJ 4B43A 1ZLKA 5FJ8J 1YRNA 4UB6C 1ETQA 3WTXC 1VF9A 1A6QA 5HNFA 2V79A 4RBOA 4LK0F 3F3XA 1BOAA 4RGUA 1LKXA 2OUMA 5EEHA 1UG0A 2P6TA 1DU0A 1WQ2A 1R22A 1UJ8A 3J80K 2DT5A 3CCMI 3P5JA 4OMZA 3M1EA 2NRAC 1UELB 4HEA2 1P7IA 2FBKA 1RUOA 4PK4A 2XRLA 4ZC3A 5IPAA 2ZCWA 3MKLA 3S14J 1O7FA 4LGWA 4RGRA 3AG3H 3SFZA 4HSTA 2F48A 3JTHA 4B09A 5M5XJ 3I3LA 3SEZA 1ZREA 3TDUC 3K4CA 1F5TA 1UHWA 3IH2A 3TP0A 3ZMVA 1F43A 2HDCA 3BR6A 3MVPA 1APLC 1X1CA 2ME0A 2PMUA 3RZOJ 1TWAJ 4DZJA 3I4PA 2V6CA 4KIGA 5CQEA 2L3DA 3K70C 2XAQA 2XRNA 1KGSA 2E2IJ 2R7FA 2W48A 1YI2I 3R6SA 2JSCA 3ABMH 3ZQHA 2OF7A 4EATA 4XLEA 3OIOA 1EH7A 1FOYA 2YS9A 1DDNA 2X1CA 3HXLA 2XSDC 4D7MA 3JR9A 2HPMA 4FISA 1V3FA 5IP6A 1LJ9A 2P6SA 2JPCA 4YELA 3NAUA 2LRDA 2VKDA 3E0JB 4BL0B 1SVOA 3J7AY 1I3AA 4LIVA 1XPXA 1W7PA 1MNMC 5DV5A 3ELKA 2VE8A 4CO8A 3G1LA 4BDZA 5B1AH 4I2OA 4V2FA 2IA2A 1K79A 2QCOA 3WTYC 1ONVA 1Y1VJ 2YSRA 1E3OC 4BXUA 4OWRB 3CESA 4XORA 3PQKA 1R5ID 1PUEE 4YEJA 2EFQA 2YUSA 3I56I 2OCCH 4AYBA 2XV4S 1YW9A 1BM9A 3CCQI 1B59A 4XQFA 4RLFA 3IL2A 2EIKH 4N9HA 1TT5B 3ZMDA 4EJWA 3OS0A 1XDSA 1DPUA 1ULYA 4A5MA 2CRGA 4PGGA 2MBFA 5FO5A 2Z2SB 2VE9A 3VPRA 2Y0MA 3HRMA 3WTVC 3OWTA 1QBJA 3D5SC 2O61A 5JI6A 1PDNC 1MSEC 4M71A 2L9NA 2ZXJA 2K9QA 5E8GA 4DBRA 1K4TA 4PJMA 4KYWA 2DA1A 3QOPA 4ZYAA 5L3EA 5TGTA 3DWLE 3ZPLA 5D5WB 2HOTA 1MMAA 5FD6A 2XVCA 3DFGA 2CS3A 3ZXSA 3LAPA 5DS9A 5D5VB 4II2A 3S3MA 1FMWA 5LRSA 3LSJA 2FSWA 2K02A 1XG1A 2Z99A 2L2OA 2ZB9A 4R79A 1IW7F 1LVAA 2RC4A 2M7BA 4NB5A 4XRMA 3KPHA 5F0FA 2VBZA 5LHGA 3RQ4A 3CCEI 1WH7A 4P5OA 2LD5A 1FBSA 2M0MA 5GTHC 1N75A 1W36C 1FIPA 2ME6A 1W0UA 1IV6A 1ZGWA 5J8FA 4OIOF 4CXFA 4MEYF 3CCRI 2HGCA 2UXXA 2FXAA 4I76A 2DQLA 2UUZA 2FOKA 3HRTA 1XSDA 1U5TA 3PM1A 1MKMA 2M5WA 3S16J 4PJNA 2XPVA 5E3LA 1N77A 3CDLA 1SANA 2KMUA 1D1BA 1TQPA 1V54H 3BC8A 3K4KA 3BJ6A 2NVYJ 2AXLA 5F27A 4CYDA 1FSHA 1VI0A 4BHPA 4AUXA 1OCRH 1HKQA 3NARA 1S72I 3HKZA 1AKHB 3F0CA 1PVEA 2XAFA 3BCAA 2HQNA 1XMKA 3L2RA 1WIBA 1ZRCA 1QA6A 3R0JA 4WX9A 4MLOA 3G1OA 2CQ7A 3M1CA 1DQUA 4XSXF 2G7UA 3O8GA 4ESBA 1D5YA 1BI0A 3CMMA 4OU0A 5LGNA 4II3A 4XRSA 2O3FA 2HNHA 3N05A 3B6AA 2QKLB 1B1BA 4G8XA 2RQPA 3A2KA 5FLXZ 2D1VA 2F4OB 2K9MA 1Y56A 2GXGA 2KZGA 3BCBA 5LEJA 4L9TA 1WWXA 3BY6A 1P4WA 1JJ8C 4NHJA 3BR3A 3PSFA 4OAYA 2FF4A 3L2VA 3PSIA 1BIBA 4AIKA 4D0PA 5DCFA 1X3ZB 2WAQA 4NC7A 2UWMA 2UXNA 2KJCA 1IXSB 2Y2ZA 3G1MA 4MQ9F 4U7BA 2K40A 4IRGA 4E7JA 3BR2A 4GGGA 1R4MB 2DPDA 3BG6A 4FT8A 2R7VA 1ON1A 2HTSA 4BUPA 4XICA 4NQWB 3F8BA 3S1MJ 1GV2A 1XGOA 3ECHA 4DBQA 3KLOA 1W5CC 3DLAA 3O8HA 4IOCF 2VB6A 2JRMA 1EKEA 4HV5A 4ON0A 2OCEA 2VASA 5CPRB 1FTZA 2UV1A 2YR2A 3CMEI 1UHMA 1GT0C 5GAHJ 1IV8A 4EMSA 4QLCU 2MH9A 5CQGA 3IAM2 1JKPC 1Y1WJ 4A5NA 1IDYA 2PMZN 1YO5C 4ZDLA 1PUFA 1IN7A 3ZQLA 3HBLA 2DFHA 1J9IA 4XNFA 2E36A 1BC7C 9ANTA 2DCEA 4E7SA 3RPQA 4V2GA 2H8WA 1AU7A 3BZ6A 1JTXA 2IP2A 1BI3A 1MBFA 4CH7A 1MJBA 2CFOA 4BNCA 2DA6A 3K4BA 3M07A 2HXOA 5FRNA 3D0SA 1LB2A 1SD6A 2M87A 2Q0OA 2VT2A 3GZ5A 2JPBA 2X85A 2E35A 3T8RA 3WU1B 3RKQA 2A6TA 2CW7A 2F5DA 3VSLA 4BEHA 2MGQA 1KZHA 1K78A 1G3SA 4DNCA 1K6OA 5JLXA 3BTCA 3PIPF 5DM7F 1IUFA 3WODF 1SD5A 2BY3A 2V1DA 1HSTA 1YS7A 2MD5A 2MSYA 2KKOA 3HSEA 4N4NB 2R7RA 2ZJ2A 2DO7A 1P4AA 3K70D 3GZNB 4KN4X 5FLVA 1ETWA 4JBAA 5F64A 2LBFA 3ZQ7A 5F1RA 2BY2A 4RB2C 3HUGB 3LQQA 4PCQA 1ITYA 3ULQB 3CC2I 1IAWA 1FY7A 3C3WA 3LA3A 4IRHA 2R7XA 2L01A 1QQIA 2QGUA 1IRZA 1E0EA 3H9GA 3S2WA 4ESJA 1A5JA 1MDMB 3I0TA 2STTA 3KEOA 1U78A 1XGMA 4JQFA 3OYEA 5E17F 2M7AA 1F36A 2R7QA 3C7JA 2GXAA 4I0AA 4WXHA 5IOYA 3LMMA 1J09A 3AG1H 3OYDA 2K9NA 3MD2A 4L5EA 1HW5A 4XRFA 2VBXA 3FXRA 3DPUA 1Z05A 4BXFA 1KU2A 2W00A 4HOBA 4AIJA 1DGRM 1IO2A 3HOTA 2LF8A 3QPSA 4LG0B 2WY8Q 3IH3A 1RR8C 3V7CA 2FRHA 2NVQJ 1WH5A 2DW4A 3GMEA 1HDDC 3W2VA 4A6EA 1YJ9I 1EV7A 2VQGA 1ZKGA 4LFUA 2COBA 1O3RA 2JQ7A 2KPMA 1X1DA 3H9JA 1BJZA 2PMHA 3HUGA 3V42A 2JN6A 1VQ9I 2BXZA 3OIPA 2CU7A 1U9OA 1Y8QB 1ZLJA 3OS2A 5IP7J 1J7KA 4CUGA 4A3KJ 3FXLA 2OC6A 2L4MA 3E5UA 3REOA 1FWZA 2L9RA 3L2QA 3GTJJ 2DTZA 1NG6A 1YYVA 2ZMEC 2XPWA 1VQKI 3S17J 1BW5A 2IPQX 5E20A 4E7HA 3FMSA 1A6IA 2A68F 1TNSA 1ACIA 5KNLA 4S04A 2CJJA 1WJEA 4EM1A 1SVMA 1LDJA 1RZ4A 3G2BA 1SFUA 3KP3A 2MLKA 1WJBA 5DM6F 3E6DA 2MC3A 3G3ZA 1R1TA 5J40A 3A0BC 3I5UA 4WXCA 4M3DA 2L0KA 5AIPA 1MNDA 1I6HJ 5EJCA 1ERDA 3CUQC 2V26A 1TT0A 2EWNA 3MKZA 4LJZF 1TW2A 5EEGA 1TQIA 3TP3A 3U1KA 1MZBA 4A3IJ 2C6YA 5HODA 4BBSJ 2XROA 2CUZA 1S7OA 1LEBA 1K4SA 5FKNA 4DIQA 2DMPA 2XPUA 1WJAA 2HZDA 4A3JJ 3IRQA 2D5VA 4NUBA 4GYGA 4IHSA 3M8JA 3GW2A 4M73A 3QP6A 2NS0A 4OIRF 3L9FA 1ZRFA 5CVRA 3HRUA 5GAEJ 4KDPA 1NK3P 3OYCA 4HLYA 4BY1J 2CH0A 2M2EA 1RRJA 4LLLA 1ZELA 2VKVA 1WI3A 1UMQA 1G3TA 4FE7A 4PSXA 4X1EA 4MTEA 1DPRA 2GBYA 1D3YA 1SVLA 3DKWA 4XKCA 5GADJ 5IT3A 2GLOA 2HWVA 2HDDA 5IYBJ 4O6JA 1DUXC 1O7LA 2COMA 3A01A 3JRDA 1J5YA 3RI4A 5IY5H 3F9KA 3QWLA 2K3FA 2QKMB 4BQOA 3K69A 1S6LA 3L09A 2FUG2 2M45A 3F72A 2BZTA 4XLAA 2W4SA 4RA2A 3VFZA 4IHXA 3KIOA 1X19A 3QAHA 4F52A 3Q0UA 2DFIA 5TRDA 1ZGAA 4P55A 4RM2A 3RTRA 1QVTA 5J1RA 3JAMK 1D8KA 2WTEA 2H1LA 3HSRA 4G6TB 1Y8RB 4XMYA 1Z6TA 1MIJA 3JW4A 3HOUJ 3GWZA 3T1BA 2FMYA 2IS2A 3SDBA 1QZYA 2FD5A 2FQ3A 5HNHA 3OYNA 1J0RA 4J19A 1YW8A 4Y15A 2WB1A 2VKEA 2WV0A 4ZZDA 5DTDA 5LLQA 2Q8KA 3UR3C 3KX2A 2NVUB 1ZR2A 4XSZF 1IN5A 4YIFA 2IS1A 3ABTA 3EUHC 4OAZA 5KAFC 2KQRA 2V4JC 2IS4A 4F7ZA 1EF4A 4BYYA 5K1YA 1NTCA 1G2HA 3MAJA 4Y7NJ 4L18B 4I0BA 1MMSA 1LNWA 1VQPI 1GVJA 4Y33A 1YTYA 2A5WA 3U2RA 4Z6YA 5E1WA 1IN6A 5D4RA 1SFKA 3R61A 1XX5A 5ICEA 2UZKA 1TC3C 2EZHA 2E1MC 3U21A 4EGZA 5J1UA 2BOLA 3WU2C 4CA0A 2O9LA 5M5YJ 2Z33A 4I98B 3GFLA 4CZZA 4LB6B 4K2EA 1X4OA 2W85A 5FGMA 1D5VA 4XL9A 3KYCB 3AAFA 3LFKA 3IUOA 3V8LA 3FF5A 3ZQGA 3FWEA 4HLXA 1RPWA 2PFBA 2W25A 1TLHB 4L5IA 1XS9A 2W24A 4QPOA 4QPQA 1L3LA 5ICFA 1MDMA 3S93A 5D8KB 1Z91A 5J47A 1X4PA 4KITB 1W7PB 2NOGA 3FMRA 1TQMA 2JT1A 3PUBA 4KIBA 3FXOA 3I55I 3FK7A 3N4MA 3OYFA 2QBYB 4EJTA 3PFYA 2ZMEB 1X3WB 1CF7B 2M34A 2CUEA 3GTOJ 4KT5C 1R71A 3EYIA 5L3FA 2F5CA 1KQ9A 3T8TA 1WJCA 4XBFA 4J00A 1H88C 1FOXA 2QEXI 3EUKL 4GXOA 1S29A 4XONA 1FOWA 4HPQA 5K5OA 3LSMA 3ASNH 1XSXA 4LG3A 5TJJA 4XM3A 4B3AA 2TRTA 3CF2A 1D8JA 4BJTA 3BDDA 2EFOA 2E5NA 5LGUA 4A69C 1HA8A 1D0YA 1REPC 3M7GA 4OIPF 5EG0B 3BR5A 4C2UA 1FNNA 2NVTJ 3QOEA 2B0LA 5IYDJ 3LWFA 2A61A 4M3EA 1H9TA 2PQ8A 3NWSA 4PDKA 4I6ZA 2QYOA 3R60A 4U87A 3OYKA 2IAIA 4C2MJ 1XCBA 1IZ1A 2X51A 3ABLH 3CUOA 3ESWB 3FHZA 1GDTA 1IRFA 2LKSA 4UV8A 3K1PA 3WHCA 1R4NB 4UVAA 4A2UA 1R1VA 3DPLC 3LA2A 4FQGA 2OQGA 1V5EA 4GFBA 1S7AA 3VODA 3K1MA 1XC5A 2EB7A 3KP6A 1RI7A 4UV9A 5ILSA 4Y52J 2KIQA 5E1XA 4ZZLA 4HNUA 4J01A 4D9JA 2MD0A 2VONA 2R7UA 1YS6A 3WG9A 5H2FC 2MA3A 3NRVA 5L3DA 3BG3A 4QTRA 3EETA 1LVKA 1T56A 2ZO4A 3R4KA 2XB0X 5EEAA 3CJRB 1HF0A 2LREA 2HFHA 3H5NA 2X48A 1PUFB 2VIXA 3U9GA 5L3GA 1EH6A 3CTAA 3PFIA 1QHHD 3KEQA 2VJ5A 2JK3A 1SMYF 3SQNA 3H0DA 3UNGC 1V5GA 4PUSA 3MWMA 3LSPA 3CLOA 1O4XA 2E19A 2QF7A 4CCKA 4E70A 3RYRA 1BI2A 1OYYA 2EK5A 2XAJA 2ZXWH 1TNTA 5DYMA 2XF5A 1OMIA 3WG7H 4BU2A 3JSPA 3E5XA 2XF6A 3ECOA 2XGXA 5HS9A 1MMNA 3HYIA 2QSFX 1FIAA 5DD4A 5K7HA 4EEFG 3DKYA 3AG4H 2FE3A 3F8NA 1WPKA 2IBDA 1I3QJ 4IL6C 4L5JA 4D7NA 4CZCA 2HVSA 5F6FA 2IGOA 3B02A 2WADA 1LFUP 2JTVA 2NXNB 2VODA 3NWTA 3GCMA 4XKVA 1HLVA 4HF1A 5GAGJ 4ITVA 3PIOF 4U7DA 3AL0B 3FXMA 4HX4A 2GOMA 2D2WA 1JUMA 2O8KA 3WE3A 1KU7A 1R23A 3JRAA 3S1QJ 1R6RA 5DCMB 4M9ZA 2F6CA 5FB2A 2PI0A 2XGDA 2W82A 3IWFA 3D1NI 2A5YB 1WRJA 2R7SA 2DN0A 4LMYA 2J5PA 4LK1F 3KZYA 1NG7A 3VEPA 1YFHA 2MFZA 1OYIA 3CZ6A 4FX4A 3LFUA 2AS5F 1RKTA 3KEYA 1WJ5A 2Q2EA 3H3VK 3P9KA 4PJLA 3F21A 4HW0A 2R5YA 1ZR4A 1Q1VA 2HQRA 3D5RC 5BPIA 4UUSA 4IKFA 3TBIA 4U0YA 3FXKA 2HKXA 2BEOA 4M9XA 2M1BA 5FKLA 4AU7A 1I1SA 2Z16A 1BW6A 3KP7A 3JRBA 4CDGA 1WJDA 1J2XA 1U5TB 2R3SA 2M8EA 3DKXA 3OIQA 2X9DA 2LSOA 3ISPA 2KRHA 2P5LC 5E8IA 1FLIA 3E1SA 1JE8A 2X6WA 3BZKA 4QSHA 3LSTA 4JP0A 2VUMJ 2BBYA 5C4JJ 3X2QH 4RLQA 1WHUA 3K1NA 4HX8A 4CCOA 2OPTA 3IKTA 2IXSA 5HLTA 2ZXIA 4UXNA 2E5ZA 4FETA 3BTLA 2WA0A 4UHTA 4RB0A 3GTGJ 2K86A 2CQNA 4YG2F 1HXDA 2HOEA 2ZJPF 1RNLA 3ZN0A 3IHUA 4FTHA 3ZQCA 1OCZH 1VQ7I 3B73A 1N25A 2R7DA 1XTAA 3S3OA 4M6XA 5E79C 1FX7A 2F2EA 2D1HA 5GPAA 3JAMZ 5BMZA 1ZG1A 5K5RA 2VJJA 1X1BA 4BE2A 2GQQA 4LLNA 2EH3A 1LFBA 3ZP5A 1VQ4I 2ADUA 4N0BA 1O57A 4MIMA 1V55H 4XRSG 1DGWY 3DU5A 1VQ8I 4L9JA 1FYLA 5HS8A 5ERIA 3HOYJ 4FX0A 4MFDA 2EZIA 2VKHA 2HEOA 2V9PA 2ZNZA 1X2MA 1MMGA 3ABUA 3G6EI 1G6NA 1YW7A 4HX7A 1OR7C 3K4MA 3IAS2 2KDOA 3VYUB 1D1AA 4G7OF 2LFBA 4I99C 3EGVB 2WB1N 3LAJA 4M6YA 2E71A 3LSKA 4M3BA 4AC0A 2EZKA 2DMNA 4MGRA 1F9NA 2LDUA 2WAQN 1POGA 2DFFA 3GEZA 1R49A 4ZYGA 4IO9F 2Y0SN 2DDAA 3K0LA 3KETA 2E2HJ 4ZYDA 1IN8A 2EJRA 3DCFA 5L3CA 3PQJA 5F0HA 3H0GJ 5CVUA 2X6YA 2KJBA 1IC8A 4ZDOA 1DP7P 5FD5A 5EYRA 2HXIA 2O7OA 1OCOH 5DDGA 4G12A 3A02A 4DOZA 3CCVI 1FJLA 1T6SA 2L4AA 1ZG5A 4IHYA 2LMDA 1I50J 4CICA 1RUNA 4F92B 3DTEA 2ISZA 3OR2C 2ICWG 4HV6A 4A12A 4HRIA 3WTZA 3L2UA 6PAXA 2CSOA 3HEFA 2GAUA 2DK8A 1TWHJ 4YIRX 5DUKA 3QYFA 1A04A 3QODA 4KUMA 4LITA 5HLHA 2DA4A 4YFNF 3E6BA 1L0OC 1LUJB 2YX4A 1OR7A 1P9QC 2DTRA 3CJTB 3GYHX 1OJLA 3TO9A 3CLQA 2NNNA 3ZGKA 5FFZA 4CCNA 1Y39A 1JTYA 3BP8A 3TL4X 2RN7A 3JCUC 3VSKA 4M3GA 2AQFA 2IA1A 3E3VA 3M9AA 1IXCA 3O6BB 3VDXA 4Y13A 1JI8A 1H8AC 2ZNYA 2VBWA 3K10A 4BHCA 1Z1DA 4ENMA 1ZRDA 3A03A 1BIAA 3CCSI 1YG2A 1PP7U 1CF7A 3F23A 1KYWA 1BA5A 3GFJA 1S7EA 2LBFB 2QVOA 3I59A 3P9IA 4RGSA 3OYAA 2V1XA 2XASA 3MZ8A 2CO5A 1ETKA 3H5RA 1IGNA 1ZYRF 1UG2A 3QYBA 4OMYA 2VT3A 4R8HA 3LSHA 1G4DA 3PJRA 3SDGA 3BWGA 3Q0WA 5E18F 1BR2A 2OQRA 2QQAA 2ELJA 3F6VA 4GO1A 4Z2YA 3JTGA 1G59A 3GO5A 1BJAA 2XUBA 2YPRA 2ZFWA 3SZGA 2E2JJ 2DQRA 2R7ZJ 2DA5A 4M6VA 2A07F 4BE1A 2JMWA 2Y31A 3KP4A 2DLLA 2A69F 2D45A 1B4AA 4M9SA 5FKKA 2CV1A 1FYKA 4KN7X 3HTUA 2CUJA 4PFPA 3BROA 3TDZC 3DQVC 4DW6A 1S3JA 2GIZA 3DBLB 1X58A 4RB3C 1VQLI 2LY9A 3QU3A 3W3CA 3C2BA 5LRRA 4F55A 4XLNF 1G3YA 3FISA 3CMYA 3IP4B 4KMUX 4BKXA 2Y9YA 1MSFC 2Y9ZA 2RGVA 1HQCA 2PN6A 3NQOA 4KMFA 4F93B 3GTQJ 5F1JA 2ISYA 5H6RA 3MN2A 2E1MB 2EIJH 2LTPA 4XN0A 4A3FJ 4U88A 1TP4A 2RVCA 2VLAA 3HDDA 2FMLA 4A0ZA 2NVXJ 2CQXA 5K7FA 4C3JJ 1FZPB 1QPMA 3KYDB 2B7EA 5ICCA 1K6YA 3LL7A 1W5TA 4C3HJ 1QO0D 3L2WA 3OS1A 3IC7A 5C44J 5E3MA 1H89C 4R1HA 5A2QZ 3A4CA 1FMVA 1GHCA 2DA2A 3S32A 1VQOI 4ZTJA 2OAZA 4HBLA 3JRFA 3FIWA 4EM0B 2QM3A 1I5ZA 1X1PA 3HHHA 2KHMA 2YX7A 1S9HA 3ZN1A 4HNVA 3HOSA 5M3FJ 4HQMA 3RQIA 3T0YA 2M4KA 2XKPA 3GLXA 3P9CA 2P81A 1YQAA 2L7FP 2QQ8A 5KAIC 1IRGA 5GPCA 3OYMA 4UVBA 2X1EA 4S05A 1TWFJ 2HU9A 2WAEA 3WHBA 2KL4A 4BY7J 2AQEA 1T33A 4G7ZF 3OYBA 2N8GA 2BXYA 3WU0A 2Z3YA 2EFNA 4RAYA 2A6EF 2FA5A 3DF8A 3OYHA 3SZPA 1RESA 2OZ6A 2EA2A 5EZGA 5JHFA 2FBHA 1UAAA 2F4IA 2V1UA 3ZCOA 4BHBA 2CW0F 4BDYA 3OSFA 4HSRA 2FBIA 3RKYA 1GLNA 2CFXA 2XF7A 3W2WA 4A3MJ 2IRFG 5H6QA 1X3UA 4AIHA 5LHHA 1U8BA 3J81K 5LEKA 2DA3A 1VQMI 1RC9A 3I54A 1SAUA 4DYQA 4BGDA 3A01B 4UNOA 2DT6A 4HF0A 3VB2A 3HIFA 3KLNA 4XLHA 3GXOA 2CGPA 3K2AA 3HL2A 3L7WA 4H0EA 4HA8A 1NHAA 4KICA 1W0TA 3QU6A 2ZSHB 4F91B 2E34A 5TISC 3CP8A 3VWBA 4V19K 2GZWA 1V4RA 2PEXA 3QQAA 5JR3A 4WCGA 1SC7A 4PJ0C 2XDVA 2BYVE 1LE8A 3ZRGA 1VQ6I 3GVAA 4IOAF 4KJZA 4X0GA 3I71A 3K6GA 3CUQB 4I02A 4OINF 2HVRA 4AM3A 4YRVA 2HQAA 4BJ6C 3VYRB 2FEZA 3HG9A 2PLYA 1B9MA 4D5FA 2P4WA 1RR7A 2A05A 3HSFA 4C9YA 4TV7A 3M3YJ 2WBMA 1MW7A 1Z9CA 1B6AA 3J7ZI 3ZMZA 2GM4A 1JT0A 4UUTA 3JRHA 1BR1A 3GZ6A 1JUPA 1HKTA 2DMUA 2VBYA 2BV6A 1X2NA 3FKIJ 5HDNA 3C1DA 2Y0SA 3G4SI 3FXUA 5J8CA 3I4NJ 1JHFA 4IHVA 4BAYA 1JGGA 3DTIA 4ABZA 1YJWI 4PGHA 3V8JA 4ASNA 4D5CA 3HJEA 2ZFUA 1TL8A 3D5LA 1MBEA 4L9VA 2EZLA 3CMAI 4E7IA 5D5XB 1IF1A 3EDPA 1ZN2A 4Y3OA 5E3NA 2H1KA 1KYZA 5FROA 3MEXA 3TEDA 2ESHA 3S1NJ 3IRRA 1OCTC 1T0FC 1UZCA 2LY2A 3K2ZA 2IGNA 5D6FA 4BQNA 2LLKA 2L7KA 3HRSA 3BJOA 2DA7A 1YOVB 4A0YA 5HVQC 4XIDA 2BY1A 5JLWA 3RZDJ 4O3MA 1U9NA 2JA5J 4M74A 2FQ4A 4ENNA 3BR1A 5KVRA 3PO2J 3FBNB 4RAZA 3WGIA 1VQNI 1ETXA 4BXXJ 2K4JA 2Q2EB 3FM3A 1Z3XA 3J7YJ 4A3EJ 2H09A 1QZEA 2XGEA 2EINH 5DEQA 2KISA 4G6QA 2ZJQF 1YLFA 4UUSB 4A93J 3Q5FA 4D1QA 1NK2P 1AWCA 3I59B 2H6CA 4HQEA 3LSRA 2VC1A 1PYVA 4RDUA 3PNTA 1U2WA 3CCYA 3FXJA 5KK1A 1GXQA 1FBQA 2JJ7A 2KIFA 2Y69H 5HS7A 2M0CA 4XLFA 5FRMA 2K9LA 1JHHA 2OZUA 2O5RA 4ZTFA 3QYEA 4XLPF 5A2QK 3CCLI 2K3PA 2HVQA 1Y6IA 1Z6RA 2CMPA 4ENJA 1MBHA 2QSGX 4E7ZA 1LEAA 2O0YA 3WTUC 3FDYA 5AONA 3DEWA 2ZSIB 3BOQA 3TW6A 3ZMSA 1ZG3A 2Q1ZB 3BQZA 2ACJA 2R93J 2X6OA 4KFCA 1LDDA 1KU9A 5F08A 2HKOA 2LK2A 1Z7LA 5FFXA 2BW3B 1LE8B 1B72B 2F5EA 3S2DJ 2IS6A 3KZZA 3BG5A 4E7LA 2W57A 4PFOA 5LFAA 4YFXF 1SFXA 2ESNA 1U6GA 2QWWA 3OSGA 1U8RA 1ZQ3P 4PSWA 3HZJA 2CV0A 2I5UA 3BR0A 3OL4A 5L3BA 3H3UA 2ZKZA 4P96A 4RMNA 3I64A 2LR8A 1O3TA 5JVTA 2V7FA 3GTPJ 1N78A 3LSIA 4MEXF 2JRTA 5E3OA 4G94A 2PX9A 2R4GA 1H9GA 1ODDA 4B44A 3OYIA 3TMOA 2LG4A 4PJJA 3F8FA 3Q3SA 1WKMA 1T98A 3I58A 3VOEA 1KONA 1T95A 5JHUA 2BVMA 4AVPA 3TOBA 2DAOA 1T08B 2VN2A 4S0HB 4E4HA 1X1AA 2ZXHA 1ENHA 3TGNA 3HGGA 1ETOA 2LYCA 2KLOA 4MTDA 2K27A 4A3DJ 3HOZJ 2PG4A 2EBIA 2O8XA 5EGOB 2Y75A 3CQZJ 4DYRA 1HW2A 2XHKA 3RSNA 5GTIC 1ZAOA 1OISA 2ELKA 1HOMA 1PP8F 3RPUD 1KU3A 2HZTA 3DXJF 3CCUI 2QENA 3Q0VA 4LB5A 2BW3A 1HDPA 2R5ZB 5K5QA 1DU6A 1A31A 3KYLA 2K9SA 3E6MA 3ZQFA 4G9YA 4NNJA 2K7LA 1OYWA 1R9TJ 3RCOA 2M30A 3V7RA 1TTYA 2KIMA 4BBRJ 3OOUA 4B4CA 4BH9A 2JA6J 5BNGA 3ZMTA 4IXAA 4JOMA 1P4XA 2QLZA 1OCPA 1CGPA 2E1CA 3BT9A 3BLYA 4MFEA 1JKRC 2NNYA 1XGSA 2JA7J 4QWQA 1VTNC 1FT9A 1IDZA 1BL0A 3UKGA 2JSPA 4AIDA 1KA8A 2F4MB 2HTJA 3I4MJ 4N4OB 2JA2A 5E1ZB 3DEEA 4A3CJ 2DK5A 4Q48A 4IX7A 4A6DA 3P7NA 2DOAA 3M8EA 3ML6A 3OYLA 4RAGA 3LQRA 3SXYA 1SAXA 5ILUA 4L0YB 3BPVA 3FBIB 3KP2A 3CD6I 2HR3A 1T2KA 4EGYA 4AYBN 3H5AA 1I1GA 4EM2A 3CC7I 1XMAA 4ESFA 4EVIA 3IKVA 3RKWA 2XC7A 3MCZA 4M72A 3N97A 1K7AA 1S5LC 1QNTA 3IV5A 3PL8A 3MZHA 5BOXA 3OYGA 1T38A 2DYSH 3CUQA 3EUHA 4A3BJ 1T39A 3TOAA 4KISA 5CYVA 3VYSB 2R5ZA 4L9NA 3CJQB 4LOCA 1IXRC 2DT7B 1AKHA 3F8MA 2ZBKA 5HLIA 1Y0UA 5D6EA 3L00A 1JT6A 3PNVA 2KDZA 4RAFA 5B1BH 2E1OA 2EFWA 2LC2A 1SD7A 1MGTA 2PJRA 3WE2A 2CQKA 1MNEA 2H6BA 2VJIA 4NDLA 1W7PD 1IUYA 2K5CA 2ZMEA 1MJAA 2FNPA 5F04A 3E6CC 2VQCA 2R7OA 3HGYA 1IRXA 3BZCA 1B8IB 1R7JA 3L1PA 1FEXA 5J4VA 4ZJZA 3HOXJ 4OOIA 2E7WA 3PO3J 1YITI 4WF2A 1U3EM 1RKWA 4XK4A 3HPGA 1QU3A 3WGHA 3QP5A 3H9QA 2OTLI 1AOYA 2DJNA 5ICGA 1K83J 3FZVA 3HOWJ 3QPHA 4Q47A 2DYRH 3A1YA 2IEKA 1QPIA 1BR4A 4L0ZB 2ECCA 2VL8A 2M9HA 3JRIA 5IP9J 1RETA 5CVJA 1MH4A 1R36A 2M3AA 5J3LA 1OFCX 4FASD 2ID3A 1B8IA 4JK1X 5J6XA 2VJ4A 4BQAA 4OIQF 4M3FA 4UUVA 2FOWA 3KZIC 2AO9A 2JZYA 2F5VA 2O03A 4B8XA 4CGZA 3HB9A 4U0WA 1MD0A 2Y48A 4CCMA 1O3QA 2WC2A 2V6EA 3HKZN 2A6HF 2FX0A 4HG2A 5IOZA 2DXIA 3JRGA 2EFPA 3DPTA 3HC7A 3V8KA 1E3PA 1ZK8A 5LHIA 1BI1A 2IA0A 1JGSA 2EV0A 2OV7A 1W5SA 5EZHA 1R00A 2YU9J 2BHZA 3SHFA 2GA1A 4PZJA 1SEUA 3BTIA 4JX4A 2TDXA 4I01A 3FMQA 4C30A 3V7SA 4B1RA 4F3QA 3MKYB 4KNYA 1AA7A 1LPQA 1W4MA 4P1WA 2KP6A 2GXBA 1YIJI 2KFDA 2GWRA 2K4BA 1VQ5I 2DPUA 4N9IA 5M3MJ 3ERMA 2WWYA 3CDHA 2P5KA 3E97A 5IT9Z 3TKYA 2VI6A 4LIUA 1BBYA 2Z5UA 4E7KA 1FP2A 2H94A 1WVRA 1BOBA 2NS8A 2H8RA 2XGCA 1J75A 1ON2A 2RQQA 1TBXA 3H36A 2OD5A 3M8FA 2OU2A 2LVSA 5BPDA 3J7AO 4W97A 3H1CA 3W6VA 1YE9A 5GP9A 3FK6A 3OOPA 3MFKA 1ZHFA 3C18A 2V9VA 3G71I 3BG7A 4FE4A 2PMZA 2DMTA 4CYCB 1Z21A 2HDWA 2QA4I 1D1CA 2BHYA 2ID6A 3G73A 3I53A 1XCVA 1TZLA 2HPIA 2MG4A 2DI3A 4E6KG 1MBJA 2BGCA 3JRCA 5FLXK 3MQ0A 2QQ9A 2G9WA 3DBRB 2X0LA 4ZYEA 2P0WA 3ONQA 1A35A 1USSA 2CUFA 2LP0A 2BY0A 1UFMA 2RNGA 3TQNA 4LG0A 2DMQA 2G7HA 1RIOH 2FU4A 1WI9A 1VNDA 1O3SA 1MBGA 5JFRA 1DP3A 4MNUA 4KT6A 2XAUA 1MJ9A 2E1NA 1KQ0A 2HS5A 2VC0A 1FSEA 3KCCA 4BACA 5M5WJ 4HDVA 2M8GX 2QUFA 2KRCA 3ZOBA 5B66C 1YX3A 3FXQA 1I27A 1MBKA 2JA8J 2X1DA 3BTJA 2KZVA 3ZQIA 4XLCA 3J80Z 3QRFF 3WGGA 3GLLA 4IPAA 2IJLA 2DJIA 2HYGD 3CJNA 1A36A 2WV1A 2L02A 2RAEA 2JUGA 2XAGA 1JJ6C 4IQJA 2VOPA 4CYCA 5ILVA 5ED4A 2DOEA 5FLMJ 2LKXA 3ZMUA 2A3SA 3CC4I 3TO7A 3DU6A 3C2GA 2VXDA 2B9SA 3F6OA 2F5FA 2LF7A 4CCLA 1AHDP 2ETHA 4IRIA 3S8PA 3J81Z 4G7HF 1P92A 3FM5A 1SFEA 4CCJA 2OBPA 1FOKA 3RPUA 1QGPA 2HI3A 2MC4A 1QRYA 4HNTA 2MH2A 1P7JA 2AHQA 1B9NA 3TO6A 2LOOA 2STWA 4BJ5C 1ZH5A 2LY1A 4HF2A 4AD9A 2PJRB 3M4OJ 4RGXA 2I10A 2TCTA 3FHNA 2K85A 3K4LA 1EH8A 2BE5F 4IVNA 1YRNB 3B6CA 1U5TC 5KCMA 1OKRA 1S8NA 2E60A 4UB8C 4BEHB 1B72A 2IW5A 1MMDA 4EJUA 2JWTA 4W1UA 4WXDA 3H92A 2R5YB 1XDUA 2IGMA 1TWGJ 2MYSA 2ZC2A 4ANJA 4FCYA 3ERED 3QPLA 2L7MP 3SFIA 4LD5A 1GXPA 1W36D 1MH3A 4B48A 1YJNI 3NEUA 4IHWA 1E3HA 1I39A 3QPTA 4B47A 5JVGF 1VZ0A 4JYKA 1EJ9A 3I9V2 3FX3A 4RS8A 2DFEA 2XSJC 5IYCJ 5H20A 3KP5A 4DZPA 1HKSA 3SEQA 4EJOA 4BE0A 2JVGA 3EQLF 3S3NA 3PNYA 2HYFA 4GCVA 3WTWC 5HDGA 1V5FA 2FNAA 3CO6C 4JX5A 4HDUA 5AIQA 4HAMA 5LD2C 2HOAA 2VQLA 3PUFA 4Q4ZF 2FJ1A 4UY8I 1D0ZA 2L7ZA 3BJAA 1LQ1A 2I8DA 2IT0A 4I7HA 5C4XJ 2XIGA 1UHSA 1YX5A 1HW1A 3GX4X 4AVZA 2KIUA 3SZTA 4RM3A 1R1UA 3K7AJ 3C2HA 1G3WA 3IWZA 3A0HC 2CG4A 2EQRA 2JUCA 3DBHB 3MMYB 4IF4A 5J1YA 4GYIA 2PBIA 2EV6A 1KQ8A 1SMTA 3CJSB 5LGTA 2XKOA 2DOFA 2NAZA 2YU3A 4IEJA 2EA4A 4XKWA 3SYTA 2V9KA 2O6GE 2B63J 2PJPA 5EG0A 4NC6A 5DUIA 4DYCA 5F0CA 3MZYA 1WJFA 1ZTRA 4NC8A 5IT9K 5CLSA 3F8CA 1T0FA 4DGWB 2AXTC 2NS7A 4YIIA 3S2HJ 2DU9A 4U0VA 2LH9A 3GTLJ 3LA7A 3AG2H 1GUUA 3L2CA 4DQ2A 2OA4A 2P5VA 2OTJI 2IGKA 2Z1DA 1ETVA 3OY9A 1FBUA 2NOJB 1OQYA 1Z77A 2P7VB 1Z0XA 2W1OA 2W84A 3RDIA 3GFIA 1SFOJ 5FKOA 3GF2A 2RREA 3Q9SA 3COAC 2V1NA 3DEUA 2LNBA 4MHGA 2LKPA 5DD8A 2KT0A 3DP7A 3BPXA 2CWEA 2M4GA 4ZYHA 1XN7A 4RB1A 2GOXB 1D0XA 3Q9VA 5CJ9A 3T5XA 3RIRA 2CYYA 5BQTA 1T8IA 5HDKA 3ZQQA 1BN5A 2HQ5A 3V4GA 5CVIA 3EPZA 3OYJA 2QZ8A 2R92J 1WGXA 2DDBA 1OPCA 2G0EA 2ECBA 3R0AA 1YIOA 5CKTA 4DJAA 2HOSA 1USTA 2DBBA 4P9UA 3LOCA 3OL3A 1FYMA 2CQQA 1CQTA 1TWCJ 3WTSC 3W6KB 4EV0A 1LFPA 1W1WE 4C2TA 3GFMA 4MO7A 3DLLF 1PJRA 4G6DA 3CF5F 4HYEA 1Z3YA 3TW7A 2HYJA 1JKOC 1Y0NA 1NH3A 1FTTA 1QZZA 1BC8C 1TW3A 1HC8A 3HPHA 3O3KA 1XSVA 2EPFA 1P6RA 2GA2A 1J59A 4ETSA 3CCJI 3ABKH 4HZFA 5D8LB 4LLGF 4ENKA 1OCCH 4QIWN 1WZ2A 4P9FA 3FKJA 3OV8A 1HSJA 1F4KA 3AL0C 2XB5A 5D4SA 1JXSA 3BQYA 1XGNA 1HCRA 4GRIA 1ZGJA 2EIMH 5DCMA 1UCRA 4IHTA 4CSWA 3H3ZA 1OLTA 2VPLA 2RV8A 3DTKA 3RJPA 3S1RJ 5KHDA 1LDKB 3HHGA 4IQ4A 1HBXG 1C0WA 1FC3A 3O2PE 3AFHA 3CP2A 4NBQA 4XN3A 1K78B 1GV5A 3HOVJ 3KE2A 1UB9A 2WY7Q 4YFKF 4B3XA 2E7XA 1WSUA 3K4JA 5FKMA 2X6XA 3ZR8X 1WCMJ 1EA3A 4FHTA 1WFXA 1Q1HA 4A0XA 5LBQA 3WTTC 5D5UB 1ETYA 2P7CB 1I6XA 2ELHA 1XB4A 1QVUA 2R7WA 1JUSA 1P2FA 3JSOA 4XOPA 1GVDA 1XD7A 3HTSB 3U1DA 2KRFA 4KA4A 1SD4A 2NYXA 4XKBA 1M1EB 3K9TA 2X4HA 3BG9A 4MQVA 4XR6A 5EF6A 4EQQA 1FPQA 2XAHA 3VYTB 2CV2A 4ZH4F 4KIFA 3F22A 1JKQC 4X6AJ 3EUAA 4I09A 3SJMA 4AWXB 1Z67A 4XOTA 4EJVA 5B3SH 4GDFA 4A3GJ 3ASOH 3HM5A 2BVLA 4WK8F 4O5VA 1IN4A 2JVHA 2VQHA 1R5HA 3E5QA 2Y30A 2P8TA 3AKZA 4Y17A 3CDIA 5J4YA 1XMXA 4BS9A 3E7LA 5BS6A 3OR1C 1FP1D 1STZA 2L9SA 1IJWC 4ZDPA 2OJED 4JX6A 2J5OA 2R0QC 2H27A 4A3LJ 1R5GA 3H35A 4C3IJ 3GTKJ 1E17A 3JREA 4WWCA 3W2AA 1YHQI 3RKXA 3MKWB 3ROUA 2WAFA 1U0JA 4Q5SF 5HLGA 1VFCA 2QSHX 3W6JB 2QQBA 1G8XA 4IZZA 3OMYA 5HOOA 2DODA 4H4KC 2RNJA 2GIVA 5C3EJ 5EGOA 3CO7C 1R58A 1Z7UA 1K61A 3IH4A 5EDNA 2CW8A 2VOOA 2EILH 2MW8A 1H0MA 2ZJRF 2MABA 1E2XA 2VXZA 1IG7A 4Y4RA 2W7NA 2L54A 2MLGA 1F1ZA 4BQQA 3K4NA 3GBGA 5K7ZA 3EYYA 2R7TA 5B5EC 3KFWX 1QHGA 1ORKA 4NQWA 4UVCA 2EV5A 5CVVA 1ZARA
chains in the Genus database with same CATH topology
5GADJ 1FOXA 2QEXI 2E34A 3CJSB 3EGVB 1FOWA 4V19K 2K3FA 3CC4I 1VQ6I 4IOAF 3CD6I 1YIJI 4IO9F 4IOCF 3CC7I 1VQ5I 3CMEI 5GAHJ 3J7ZI 3CCMI 1YJ9I 3CCVI 2OTJI 2JQ7A 1VQ9I 3CCEI 3G4SI 3CJQB 2E36A 1YJWI 2H8WA 1VQOI 3CCRI 3CMAI 1VQKI 3CJTB 3G71I 1ACIA 1Y39A 1MMSA 3CJRB 1VQPI 2QA4I 1YI2I 2E35A 1YITI 5DM6F 1FOYA 1S72I 2OTLI 1WIBA 1YHQI 3PIPF 5DM7F 3CCSI 1YJNI 1QA6A 1VQNI 2ZJPF 3DLLF 3CF5F 5JVGF 3J7YJ 1VQ7I 3CCUI 1HC8A 2ZJQF 3CCJI 3CC2I 2FOWA 5GAEJ 1VQ4I 3I56I 2ZJRF 3I55I 4UY8I 3CCQI 1VQ8I 2NXNB 1VQMI 5GAGJ 3PIOF 3CCLI 3G6EI 1VQLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD J;  1FOX A;  2QEX I;  2E34 A;  3CJS B;  3EGV B;  1FOW A;  4V19 K;  2K3F A;  3CC4 I;  1VQ6 I;  4IOA F;  3CD6 I;  1YIJ I;  4IO9 F;  4IOC F;  3CC7 I;  1VQ5 I;  3CME I;  5GAH J;  3J7Z I;  3CCM I;  1YJ9 I;  3CCV I;  2OTJ I;  2JQ7 A;  1VQ9 I;  3CCE I;  3G4S I;  3CJQ B;  2E36 A;  1YJW I;  2H8W A;  1VQO I;  3CCR I;  3CMA I;  1VQK I;  3CJT B;  3G71 I;  1ACI A;  1Y39 A;  1MMS A;  3CJR B;  1VQP I;  2QA4 I;  1YI2 I;  2E35 A;  1YIT I;  5DM6 F;  1FOY A;  1S72 I;  2OTL I;  1WIB A;  1YHQ I;  3PIP F;  5DM7 F;  3CCS I;  1YJN I;  1QA6 A;  1VQN I;  2ZJP F;  3DLL F;  3CF5 F;  5JVG F;  3J7Y J;  1VQ7 I;  3CCU I;  1HC8 A;  2ZJQ F;  3CCJ I;  3CC2 I;  2FOW A;  5GAE J;  1VQ4 I;  3I56 I;  2ZJR F;  3I55 I;  4UY8 I;  3CCQ I;  1VQ8 I;  2NXN B;  1VQM I;  5GAG J;  3PIO F;  3CCL I;  3G6E I;  1VQL I; 
#chains in the Genus database with same CATH topology
 3LNQ A;  4IJA A;  2L5Q A;  3LSG A;  2Z9O A;  2VPR A;  2QBY A;  3RYP A;  3S15 J;  4CHU A;  2L9V A;  2RDP A;  2RKH A;  2IVM A;  3DV8 A;  3GUD A;  3GTM J;  4B43 A;  1ZLK A;  5FJ8 J;  1YRN A;  4UB6 C;  1ETQ A;  3WTX C;  1VF9 A;  1A6Q A;  5HNF A;  2V79 A;  4RBO A;  4LK0 F;  3F3X A;  1BOA A;  4RGU A;  1LKX A;  2OUM A;  5EEH A;  1UG0 A;  2P6T A;  1DU0 A;  1WQ2 A;  1R22 A;  1UJ8 A;  3J80 K;  2DT5 A;  3CCM I;  3P5J A;  4OMZ A;  3M1E A;  2NRA C;  1UEL B;  4HEA 2;  1P7I A;  2FBK A;  1RUO A;  4PK4 A;  2XRL A;  4ZC3 A;  5IPA A;  2ZCW A;  3MKL A;  3S14 J;  1O7F A;  4LGW A;  4RGR A;  3AG3 H;  3SFZ A;  4HST A;  2F48 A;  3JTH A;  4B09 A;  5M5X J;  3I3L A;  3SEZ A;  1ZRE A;  3TDU C;  3K4C A;  1F5T A;  1UHW A;  3IH2 A;  3TP0 A;  3ZMV A;  1F43 A;  2HDC A;  3BR6 A;  3MVP A;  1APL C;  1X1C A;  2ME0 A;  2PMU A;  3RZO J;  1TWA J;  4DZJ A;  3I4P A;  2V6C A;  4KIG A;  5CQE A;  2L3D A;  3K70 C;  2XAQ A;  2XRN A;  1KGS A;  2E2I J;  2R7F A;  2W48 A;  1YI2 I;  3R6S A;  2JSC A;  3ABM H;  3ZQH A;  2OF7 A;  4EAT A;  4XLE A;  3OIO A;  1EH7 A;  1FOY A;  2YS9 A;  1DDN A;  2X1C A;  3HXL A;  2XSD C;  4D7M A;  3JR9 A;  2HPM A;  4FIS A;  1V3F A;  5IP6 A;  1LJ9 A;  2P6S A;  2JPC A;  4YEL A;  3NAU A;  2LRD A;  2VKD A;  3E0J B;  4BL0 B;  1SVO A;  3J7A Y;  1I3A A;  4LIV A;  1XPX A;  1W7P A;  1MNM C;  5DV5 A;  3ELK A;  2VE8 A;  4CO8 A;  3G1L A;  4BDZ A;  5B1A H;  4I2O A;  4V2F A;  2IA2 A;  1K79 A;  2QCO A;  3WTY C;  1ONV A;  1Y1V J;  2YSR A;  1E3O C;  4BXU A;  4OWR B;  3CES A;  4XOR A;  3PQK A;  1R5I D;  1PUE E;  4YEJ A;  2EFQ A;  2YUS A;  3I56 I;  2OCC H;  4AYB A;  2XV4 S;  1YW9 A;  1BM9 A;  3CCQ I;  1B59 A;  4XQF A;  4RLF A;  3IL2 A;  2EIK H;  4N9H A;  1TT5 B;  3ZMD A;  4EJW A;  3OS0 A;  1XDS A;  1DPU A;  1ULY A;  4A5M A;  2CRG A;  4PGG A;  2MBF A;  5FO5 A;  2Z2S B;  2VE9 A;  3VPR A;  2Y0M A;  3HRM A;  3WTV C;  3OWT A;  1QBJ A;  3D5S C;  2O61 A;  5JI6 A;  1PDN C;  1MSE C;  4M71 A;  2L9N A;  2ZXJ A;  2K9Q A;  5E8G A;  4DBR A;  1K4T A;  4PJM A;  4KYW A;  2DA1 A;  3QOP A;  4ZYA A;  5L3E A;  5TGT A;  3DWL E;  3ZPL A;  5D5W B;  2HOT A;  1MMA A;  5FD6 A;  2XVC A;  3DFG A;  2CS3 A;  3ZXS A;  3LAP A;  5DS9 A;  5D5V B;  4II2 A;  3S3M A;  1FMW A;  5LRS A;  3LSJ A;  2FSW A;  2K02 A;  1XG1 A;  2Z99 A;  2L2O A;  2ZB9 A;  4R79 A;  1IW7 F;  1LVA A;  2RC4 A;  2M7B A;  4NB5 A;  4XRM A;  3KPH A;  5F0F A;  2VBZ A;  5LHG A;  3RQ4 A;  3CCE I;  1WH7 A;  4P5O A;  2LD5 A;  1FBS A;  2M0M A;  5GTH C;  1N75 A;  1W36 C;  1FIP A;  2ME6 A;  1W0U A;  1IV6 A;  1ZGW A;  5J8F A;  4OIO F;  4CXF A;  4MEY F;  3CCR I;  2HGC A;  2UXX A;  2FXA A;  4I76 A;  2DQL A;  2UUZ A;  2FOK A;  3HRT A;  1XSD A;  1U5T A;  3PM1 A;  1MKM A;  2M5W A;  3S16 J;  4PJN A;  2XPV A;  5E3L A;  1N77 A;  3CDL A;  1SAN A;  2KMU A;  1D1B A;  1TQP A;  1V54 H;  3BC8 A;  3K4K A;  3BJ6 A;  2NVY J;  2AXL A;  5F27 A;  4CYD A;  1FSH A;  1VI0 A;  4BHP A;  4AUX A;  1OCR H;  1HKQ A;  3NAR A;  1S72 I;  3HKZ A;  1AKH B;  3F0C A;  1PVE A;  2XAF A;  3BCA A;  2HQN A;  1XMK A;  3L2R A;  1WIB A;  1ZRC A;  1QA6 A;  3R0J A;  4WX9 A;  4MLO A;  3G1O A;  2CQ7 A;  3M1C A;  1DQU A;  4XSX F;  2G7U A;  3O8G A;  4ESB A;  1D5Y A;  1BI0 A;  3CMM A;  4OU0 A;  5LGN A;  4II3 A;  4XRS A;  2O3F A;  2HNH A;  3N05 A;  3B6A A;  2QKL B;  1B1B A;  4G8X A;  2RQP A;  3A2K A;  5FLX Z;  2D1V A;  2F4O B;  2K9M A;  1Y56 A;  2GXG A;  2KZG A;  3BCB A;  5LEJ A;  4L9T A;  1WWX A;  3BY6 A;  1P4W A;  1JJ8 C;  4NHJ A;  3BR3 A;  3PSF A;  4OAY A;  2FF4 A;  3L2V A;  3PSI A;  1BIB A;  4AIK A;  4D0P A;  5DCF A;  1X3Z B;  2WAQ A;  4NC7 A;  2UWM A;  2UXN A;  2KJC A;  1IXS B;  2Y2Z A;  3G1M A;  4MQ9 F;  4U7B A;  2K40 A;  4IRG A;  4E7J A;  3BR2 A;  4GGG A;  1R4M B;  2DPD A;  3BG6 A;  4FT8 A;  2R7V A;  1ON1 A;  2HTS A;  4BUP A;  4XIC A;  4NQW B;  3F8B A;  3S1M J;  1GV2 A;  1XGO A;  3ECH A;  4DBQ A;  3KLO A;  1W5C C;  3DLA A;  3O8H A;  4IOC F;  2VB6 A;  2JRM A;  1EKE A;  4HV5 A;  4ON0 A;  2OCE A;  2VAS A;  5CPR B;  1FTZ A;  2UV1 A;  2YR2 A;  3CME I;  1UHM A;  1GT0 C;  5GAH J;  1IV8 A;  4EMS A;  4QLC U;  2MH9 A;  5CQG A;  3IAM 2;  1JKP C;  1Y1W J;  4A5N A;  1IDY A;  2PMZ N;  1YO5 C;  4ZDL A;  1PUF A;  1IN7 A;  3ZQL A;  3HBL A;  2DFH A;  1J9I A;  4XNF A;  2E36 A;  1BC7 C;  9ANT A;  2DCE A;  4E7S A;  3RPQ A;  4V2G A;  2H8W A;  1AU7 A;  3BZ6 A;  1JTX A;  2IP2 A;  1BI3 A;  1MBF A;  4CH7 A;  1MJB A;  2CFO A;  4BNC A;  2DA6 A;  3K4B A;  3M07 A;  2HXO A;  5FRN A;  3D0S A;  1LB2 A;  1SD6 A;  2M87 A;  2Q0O A;  2VT2 A;  3GZ5 A;  2JPB A;  2X85 A;  2E35 A;  3T8R A;  3WU1 B;  3RKQ A;  2A6T A;  2CW7 A;  2F5D A;  3VSL A;  4BEH A;  2MGQ A;  1KZH A;  1K78 A;  1G3S A;  4DNC A;  1K6O A;  5JLX A;  3BTC A;  3PIP F;  5DM7 F;  1IUF A;  3WOD F;  1SD5 A;  2BY3 A;  2V1D A;  1HST A;  1YS7 A;  2MD5 A;  2MSY A;  2KKO A;  3HSE A;  4N4N B;  2R7R A;  2ZJ2 A;  2DO7 A;  1P4A A;  3K70 D;  3GZN B;  4KN4 X;  5FLV A;  1ETW A;  4JBA A;  5F64 A;  2LBF A;  3ZQ7 A;  5F1R A;  2BY2 A;  4RB2 C;  3HUG B;  3LQQ A;  4PCQ A;  1ITY A;  3ULQ B;  3CC2 I;  1IAW A;  1FY7 A;  3C3W A;  3LA3 A;  4IRH A;  2R7X A;  2L01 A;  1QQI A;  2QGU A;  1IRZ A;  1E0E A;  3H9G A;  3S2W A;  4ESJ A;  1A5J A;  1MDM B;  3I0T A;  2STT A;  3KEO A;  1U78 A;  1XGM A;  4JQF A;  3OYE A;  5E17 F;  2M7A A;  1F36 A;  2R7Q A;  3C7J A;  2GXA A;  4I0A A;  4WXH A;  5IOY A;  3LMM A;  1J09 A;  3AG1 H;  3OYD A;  2K9N A;  3MD2 A;  4L5E A;  1HW5 A;  4XRF A;  2VBX A;  3FXR A;  3DPU A;  1Z05 A;  4BXF A;  1KU2 A;  2W00 A;  4HOB A;  4AIJ A;  1DGR M;  1IO2 A;  3HOT A;  2LF8 A;  3QPS A;  4LG0 B;  2WY8 Q;  3IH3 A;  1RR8 C;  3V7C A;  2FRH A;  2NVQ J;  1WH5 A;  2DW4 A;  3GME A;  1HDD C;  3W2V A;  4A6E A;  1YJ9 I;  1EV7 A;  2VQG A;  1ZKG A;  4LFU A;  2COB A;  1O3R A;  2JQ7 A;  2KPM A;  1X1D A;  3H9J A;  1BJZ A;  2PMH A;  3HUG A;  3V42 A;  2JN6 A;  1VQ9 I;  2BXZ A;  3OIP A;  2CU7 A;  1U9O A;  1Y8Q B;  1ZLJ A;  3OS2 A;  5IP7 J;  1J7K A;  4CUG A;  4A3K J;  3FXL A;  2OC6 A;  2L4M A;  3E5U A;  3REO A;  1FWZ A;  2L9R A;  3L2Q A;  3GTJ J;  2DTZ A;  1NG6 A;  1YYV A;  2ZME C;  2XPW A;  1VQK I;  3S17 J;  1BW5 A;  2IPQ X;  5E20 A;  4E7H A;  3FMS A;  1A6I A;  2A68 F;  1TNS A;  1ACI A;  5KNL A;  4S04 A;  2CJJ A;  1WJE A;  4EM1 A;  1SVM A;  1LDJ A;  1RZ4 A;  3G2B A;  1SFU A;  3KP3 A;  2MLK A;  1WJB A;  5DM6 F;  3E6D A;  2MC3 A;  3G3Z A;  1R1T A;  5J40 A;  3A0B C;  3I5U A;  4WXC A;  4M3D A;  2L0K A;  5AIP A;  1MND A;  1I6H J;  5EJC A;  1ERD A;  3CUQ C;  2V26 A;  1TT0 A;  2EWN A;  3MKZ A;  4LJZ F;  1TW2 A;  5EEG A;  1TQI A;  3TP3 A;  3U1K A;  1MZB A;  4A3I J;  2C6Y A;  5HOD A;  4BBS J;  2XRO A;  2CUZ A;  1S7O A;  1LEB A;  1K4S A;  5FKN A;  4DIQ A;  2DMP A;  2XPU A;  1WJA A;  2HZD A;  4A3J J;  3IRQ A;  2D5V A;  4NUB A;  4GYG A;  4IHS A;  3M8J A;  3GW2 A;  4M73 A;  3QP6 A;  2NS0 A;  4OIR F;  3L9F A;  1ZRF A;  5CVR A;  3HRU A;  5GAE J;  4KDP A;  1NK3 P;  3OYC A;  4HLY A;  4BY1 J;  2CH0 A;  2M2E A;  1RRJ A;  4LLL A;  1ZEL A;  2VKV A;  1WI3 A;  1UMQ A;  1G3T A;  4FE7 A;  4PSX A;  4X1E A;  4MTE A;  1DPR A;  2GBY A;  1D3Y A;  1SVL A;  3DKW A;  4XKC A;  5GAD J;  5IT3 A;  2GLO A;  2HWV A;  2HDD A;  5IYB J;  4O6J A;  1DUX C;  1O7L A;  2COM A;  3A01 A;  3JRD A;  1J5Y A;  3RI4 A;  5IY5 H;  3F9K A;  3QWL A;  2K3F A;  2QKM B;  4BQO A;  3K69 A;  1S6L A;  3L09 A;  2FUG 2;  2M45 A;  3F72 A;  2BZT A;  4XLA A;  2W4S A;  4RA2 A;  3VFZ A;  4IHX A;  3KIO A;  1X19 A;  3QAH A;  4F52 A;  3Q0U A;  2DFI A;  5TRD A;  1ZGA A;  4P55 A;  4RM2 A;  3RTR A;  1QVT A;  5J1R A;  3JAM K;  1D8K A;  2WTE A;  2H1L A;  3HSR A;  4G6T B;  1Y8R B;  4XMY A;  1Z6T A;  1MIJ A;  3JW4 A;  3HOU J;  3GWZ A;  3T1B A;  2FMY A;  2IS2 A;  3SDB A;  1QZY A;  2FD5 A;  2FQ3 A;  5HNH A;  3OYN A;  1J0R A;  4J19 A;  1YW8 A;  4Y15 A;  2WB1 A;  2VKE A;  2WV0 A;  4ZZD A;  5DTD A;  5LLQ A;  2Q8K A;  3UR3 C;  3KX2 A;  2NVU B;  1ZR2 A;  4XSZ F;  1IN5 A;  4YIF A;  2IS1 A;  3ABT A;  3EUH C;  4OAZ A;  5KAF C;  2KQR A;  2V4J C;  2IS4 A;  4F7Z A;  1EF4 A;  4BYY A;  5K1Y A;  1NTC A;  1G2H A;  3MAJ A;  4Y7N J;  4L18 B;  4I0B A;  1MMS A;  1LNW A;  1VQP I;  1GVJ A;  4Y33 A;  1YTY A;  2A5W A;  3U2R A;  4Z6Y A;  5E1W A;  1IN6 A;  5D4R A;  1SFK A;  3R61 A;  1XX5 A;  5ICE A;  2UZK A;  1TC3 C;  2EZH A;  2E1M C;  3U21 A;  4EGZ A;  5J1U A;  2BOL A;  3WU2 C;  4CA0 A;  2O9L A;  5M5Y J;  2Z33 A;  4I98 B;  3GFL A;  4CZZ A;  4LB6 B;  4K2E A;  1X4O A;  2W85 A;  5FGM A;  1D5V A;  4XL9 A;  3KYC B;  3AAF A;  3LFK A;  3IUO A;  3V8L A;  3FF5 A;  3ZQG A;  3FWE A;  4HLX A;  1RPW A;  2PFB A;  2W25 A;  1TLH B;  4L5I A;  1XS9 A;  2W24 A;  4QPO A;  4QPQ A;  1L3L A;  5ICF A;  1MDM A;  3S93 A;  5D8K B;  1Z91 A;  5J47 A;  1X4P A;  4KIT B;  1W7P B;  2NOG A;  3FMR A;  1TQM A;  2JT1 A;  3PUB A;  4KIB A;  3FXO A;  3I55 I;  3FK7 A;  3N4M A;  3OYF A;  2QBY B;  4EJT A;  3PFY A;  2ZME B;  1X3W B;  1CF7 B;  2M34 A;  2CUE A;  3GTO J;  4KT5 C;  1R71 A;  3EYI A;  5L3F A;  2F5C A;  1KQ9 A;  3T8T A;  1WJC A;  4XBF A;  4J00 A;  1H88 C;  1FOX A;  2QEX I;  3EUK L;  4GXO A;  1S29 A;  4XON A;  1FOW A;  4HPQ A;  5K5O A;  3LSM A;  3ASN H;  1XSX A;  4LG3 A;  5TJJ A;  4XM3 A;  4B3A A;  2TRT A;  3CF2 A;  1D8J A;  4BJT A;  3BDD A;  2EFO A;  2E5N A;  5LGU A;  4A69 C;  1HA8 A;  1D0Y A;  1REP C;  3M7G A;  4OIP F;  5EG0 B;  3BR5 A;  4C2U A;  1FNN A;  2NVT J;  3QOE A;  2B0L A;  5IYD J;  3LWF A;  2A61 A;  4M3E A;  1H9T A;  2PQ8 A;  3NWS A;  4PDK A;  4I6Z A;  2QYO A;  3R60 A;  4U87 A;  3OYK A;  2IAI A;  4C2M J;  1XCB A;  1IZ1 A;  2X51 A;  3ABL H;  3CUO A;  3ESW B;  3FHZ A;  1GDT A;  1IRF A;  2LKS A;  4UV8 A;  3K1P A;  3WHC A;  1R4N B;  4UVA A;  4A2U A;  1R1V A;  3DPL C;  3LA2 A;  4FQG A;  2OQG A;  1V5E A;  4GFB A;  1S7A A;  3VOD A;  3K1M A;  1XC5 A;  2EB7 A;  3KP6 A;  1RI7 A;  4UV9 A;  5ILS A;  4Y52 J;  2KIQ A;  5E1X A;  4ZZL A;  4HNU A;  4J01 A;  4D9J A;  2MD0 A;  2VON A;  2R7U A;  1YS6 A;  3WG9 A;  5H2F C;  2MA3 A;  3NRV A;  5L3D A;  3BG3 A;  4QTR A;  3EET A;  1LVK A;  1T56 A;  2ZO4 A;  3R4K A;  2XB0 X;  5EEA A;  3CJR B;  1HF0 A;  2LRE A;  2HFH A;  3H5N A;  2X48 A;  1PUF B;  2VIX A;  3U9G A;  5L3G A;  1EH6 A;  3CTA A;  3PFI A;  1QHH D;  3KEQ A;  2VJ5 A;  2JK3 A;  1SMY F;  3SQN A;  3H0D A;  3UNG C;  1V5G A;  4PUS A;  3MWM A;  3LSP A;  3CLO A;  1O4X A;  2E19 A;  2QF7 A;  4CCK A;  4E70 A;  3RYR A;  1BI2 A;  1OYY A;  2EK5 A;  2XAJ A;  2ZXW H;  1TNT A;  5DYM A;  2XF5 A;  1OMI A;  3WG7 H;  4BU2 A;  3JSP A;  3E5X A;  2XF6 A;  3ECO A;  2XGX A;  5HS9 A;  1MMN A;  3HYI A;  2QSF X;  1FIA A;  5DD4 A;  5K7H A;  4EEF G;  3DKY A;  3AG4 H;  2FE3 A;  3F8N A;  1WPK A;  2IBD A;  1I3Q J;  4IL6 C;  4L5J A;  4D7N A;  4CZC A;  2HVS A;  5F6F A;  2IGO A;  3B02 A;  2WAD A;  1LFU P;  2JTV A;  2NXN B;  2VOD A;  3NWT A;  3GCM A;  4XKV A;  1HLV A;  4HF1 A;  5GAG J;  4ITV A;  3PIO F;  4U7D A;  3AL0 B;  3FXM A;  4HX4 A;  2GOM A;  2D2W A;  1JUM A;  2O8K A;  3WE3 A;  1KU7 A;  1R23 A;  3JRA A;  3S1Q J;  1R6R A;  5DCM B;  4M9Z A;  2F6C A;  5FB2 A;  2PI0 A;  2XGD A;  2W82 A;  3IWF A;  3D1N I;  2A5Y B;  1WRJ A;  2R7S A;  2DN0 A;  4LMY A;  2J5P A;  4LK1 F;  3KZY A;  1NG7 A;  3VEP A;  1YFH A;  2MFZ A;  1OYI A;  3CZ6 A;  4FX4 A;  3LFU A;  2AS5 F;  1RKT A;  3KEY A;  1WJ5 A;  2Q2E A;  3H3V K;  3P9K A;  4PJL A;  3F21 A;  4HW0 A;  2R5Y A;  1ZR4 A;  1Q1V A;  2HQR A;  3D5R C;  5BPI A;  4UUS A;  4IKF A;  3TBI A;  4U0Y A;  3FXK A;  2HKX A;  2BEO A;  4M9X A;  2M1B A;  5FKL A;  4AU7 A;  1I1S A;  2Z16 A;  1BW6 A;  3KP7 A;  3JRB A;  4CDG A;  1WJD A;  1J2X A;  1U5T B;  2R3S A;  2M8E A;  3DKX A;  3OIQ A;  2X9D A;  2LSO A;  3ISP A;  2KRH A;  2P5L C;  5E8I A;  1FLI A;  3E1S A;  1JE8 A;  2X6W A;  3BZK A;  4QSH A;  3LST A;  4JP0 A;  2VUM J;  2BBY A;  5C4J J;  3X2Q H;  4RLQ A;  1WHU A;  3K1N A;  4HX8 A;  4CCO A;  2OPT A;  3IKT A;  2IXS A;  5HLT A;  2ZXI A;  4UXN A;  2E5Z A;  4FET A;  3BTL A;  2WA0 A;  4UHT A;  4RB0 A;  3GTG J;  2K86 A;  2CQN A;  4YG2 F;  1HXD A;  2HOE A;  2ZJP F;  1RNL A;  3ZN0 A;  3IHU A;  4FTH A;  3ZQC A;  1OCZ H;  1VQ7 I;  3B73 A;  1N25 A;  2R7D A;  1XTA A;  3S3O A;  4M6X A;  5E79 C;  1FX7 A;  2F2E A;  2D1H A;  5GPA A;  3JAM Z;  5BMZ A;  1ZG1 A;  5K5R A;  2VJJ A;  1X1B A;  4BE2 A;  2GQQ A;  4LLN A;  2EH3 A;  1LFB A;  3ZP5 A;  1VQ4 I;  2ADU A;  4N0B A;  1O57 A;  4MIM A;  1V55 H;  4XRS G;  1DGW Y;  3DU5 A;  1VQ8 I;  4L9J A;  1FYL A;  5HS8 A;  5ERI A;  3HOY J;  4FX0 A;  4MFD A;  2EZI A;  2VKH A;  2HEO A;  2V9P A;  2ZNZ A;  1X2M A;  1MMG A;  3ABU A;  3G6E I;  1G6N A;  1YW7 A;  4HX7 A;  1OR7 C;  3K4M A;  3IAS 2;  2KDO A;  3VYU B;  1D1A A;  4G7O F;  2LFB A;  4I99 C;  3EGV B;  2WB1 N;  3LAJ A;  4M6Y A;  2E71 A;  3LSK A;  4M3B A;  4AC0 A;  2EZK A;  2DMN A;  4MGR A;  1F9N A;  2LDU A;  2WAQ N;  1POG A;  2DFF A;  3GEZ A;  1R49 A;  4ZYG A;  4IO9 F;  2Y0S N;  2DDA A;  3K0L A;  3KET A;  2E2H J;  4ZYD A;  1IN8 A;  2EJR A;  3DCF A;  5L3C A;  3PQJ A;  5F0H A;  3H0G J;  5CVU A;  2X6Y A;  2KJB A;  1IC8 A;  4ZDO A;  1DP7 P;  5FD5 A;  5EYR A;  2HXI A;  2O7O A;  1OCO H;  5DDG A;  4G12 A;  3A02 A;  4DOZ A;  3CCV I;  1FJL A;  1T6S A;  2L4A A;  1ZG5 A;  4IHY A;  2LMD A;  1I50 J;  4CIC A;  1RUN A;  4F92 B;  3DTE A;  2ISZ A;  3OR2 C;  2ICW G;  4HV6 A;  4A12 A;  4HRI A;  3WTZ A;  3L2U A;  6PAX A;  2CSO A;  3HEF A;  2GAU A;  2DK8 A;  1TWH J;  4YIR X;  5DUK A;  3QYF A;  1A04 A;  3QOD A;  4KUM A;  4LIT A;  5HLH A;  2DA4 A;  4YFN F;  3E6B A;  1L0O C;  1LUJ B;  2YX4 A;  1OR7 A;  1P9Q C;  2DTR A;  3CJT B;  3GYH X;  1OJL A;  3TO9 A;  3CLQ A;  2NNN A;  3ZGK A;  5FFZ A;  4CCN A;  1Y39 A;  1JTY A;  3BP8 A;  3TL4 X;  2RN7 A;  3JCU C;  3VSK A;  4M3G A;  2AQF A;  2IA1 A;  3E3V A;  3M9A A;  1IXC A;  3O6B B;  3VDX A;  4Y13 A;  1JI8 A;  1H8A C;  2ZNY A;  2VBW A;  3K10 A;  4BHC A;  1Z1D A;  4ENM A;  1ZRD A;  3A03 A;  1BIA A;  3CCS I;  1YG2 A;  1PP7 U;  1CF7 A;  3F23 A;  1KYW A;  1BA5 A;  3GFJ A;  1S7E A;  2LBF B;  2QVO A;  3I59 A;  3P9I A;  4RGS A;  3OYA A;  2V1X A;  2XAS A;  3MZ8 A;  2CO5 A;  1ETK A;  3H5R A;  1IGN A;  1ZYR F;  1UG2 A;  3QYB A;  4OMY A;  2VT3 A;  4R8H A;  3LSH A;  1G4D A;  3PJR A;  3SDG A;  3BWG A;  3Q0W A;  5E18 F;  1BR2 A;  2OQR A;  2QQA A;  2ELJ A;  3F6V A;  4GO1 A;  4Z2Y A;  3JTG A;  1G59 A;  3GO5 A;  1BJA A;  2XUB A;  2YPR A;  2ZFW A;  3SZG A;  2E2J J;  2DQR A;  2R7Z J;  2DA5 A;  4M6V A;  2A07 F;  4BE1 A;  2JMW A;  2Y31 A;  3KP4 A;  2DLL A;  2A69 F;  2D45 A;  1B4A A;  4M9S A;  5FKK A;  2CV1 A;  1FYK A;  4KN7 X;  3HTU A;  2CUJ A;  4PFP A;  3BRO A;  3TDZ C;  3DQV C;  4DW6 A;  1S3J A;  2GIZ A;  3DBL B;  1X58 A;  4RB3 C;  1VQL I;  2LY9 A;  3QU3 A;  3W3C A;  3C2B A;  5LRR A;  4F55 A;  4XLN F;  1G3Y A;  3FIS A;  3CMY A;  3IP4 B;  4KMU X;  4BKX A;  2Y9Y A;  1MSF C;  2Y9Z A;  2RGV A;  1HQC A;  2PN6 A;  3NQO A;  4KMF A;  4F93 B;  3GTQ J;  5F1J A;  2ISY A;  5H6R A;  3MN2 A;  2E1M B;  2EIJ H;  2LTP A;  4XN0 A;  4A3F J;  4U88 A;  1TP4 A;  2RVC A;  2VLA A;  3HDD A;  2FML A;  4A0Z A;  2NVX J;  2CQX A;  5K7F A;  4C3J J;  1FZP B;  1QPM A;  3KYD B;  2B7E A;  5ICC A;  1K6Y A;  3LL7 A;  1W5T A;  4C3H J;  1QO0 D;  3L2W A;  3OS1 A;  3IC7 A;  5C44 J;  5E3M A;  1H89 C;  4R1H A;  5A2Q Z;  3A4C A;  1FMV A;  1GHC A;  2DA2 A;  3S32 A;  1VQO I;  4ZTJ A;  2OAZ A;  4HBL A;  3JRF A;  3FIW A;  4EM0 B;  2QM3 A;  1I5Z A;  1X1P A;  3HHH A;  2KHM A;  2YX7 A;  1S9H A;  3ZN1 A;  4HNV A;  3HOS A;  5M3F J;  4HQM A;  3RQI A;  3T0Y A;  2M4K A;  2XKP A;  3GLX A;  3P9C A;  2P81 A;  1YQA A;  2L7F P;  2QQ8 A;  5KAI C;  1IRG A;  5GPC A;  3OYM A;  4UVB A;  2X1E A;  4S05 A;  1TWF J;  2HU9 A;  2WAE A;  3WHB A;  2KL4 A;  4BY7 J;  2AQE A;  1T33 A;  4G7Z F;  3OYB A;  2N8G A;  2BXY A;  3WU0 A;  2Z3Y A;  2EFN A;  4RAY A;  2A6E F;  2FA5 A;  3DF8 A;  3OYH A;  3SZP A;  1RES A;  2OZ6 A;  2EA2 A;  5EZG A;  5JHF A;  2FBH A;  1UAA A;  2F4I A;  2V1U A;  3ZCO A;  4BHB A;  2CW0 F;  4BDY A;  3OSF A;  4HSR A;  2FBI A;  3RKY A;  1GLN A;  2CFX A;  2XF7 A;  3W2W A;  4A3M J;  2IRF G;  5H6Q A;  1X3U A;  4AIH A;  5LHH A;  1U8B A;  3J81 K;  5LEK A;  2DA3 A;  1VQM I;  1RC9 A;  3I54 A;  1SAU A;  4DYQ A;  4BGD A;  3A01 B;  4UNO A;  2DT6 A;  4HF0 A;  3VB2 A;  3HIF A;  3KLN A;  4XLH A;  3GXO A;  2CGP A;  3K2A A;  3HL2 A;  3L7W A;  4H0E A;  4HA8 A;  1NHA A;  4KIC A;  1W0T A;  3QU6 A;  2ZSH B;  4F91 B;  2E34 A;  5TIS C;  3CP8 A;  3VWB A;  4V19 K;  2GZW A;  1V4R A;  2PEX A;  3QQA A;  5JR3 A;  4WCG A;  1SC7 A;  4PJ0 C;  2XDV A;  2BYV E;  1LE8 A;  3ZRG A;  1VQ6 I;  3GVA A;  4IOA F;  4KJZ A;  4X0G A;  3I71 A;  3K6G A;  3CUQ B;  4I02 A;  4OIN F;  2HVR A;  4AM3 A;  4YRV A;  2HQA A;  4BJ6 C;  3VYR B;  2FEZ A;  3HG9 A;  2PLY A;  1B9M A;  4D5F A;  2P4W A;  1RR7 A;  2A05 A;  3HSF A;  4C9Y A;  4TV7 A;  3M3Y J;  2WBM A;  1MW7 A;  1Z9C A;  1B6A A;  3J7Z I;  3ZMZ A;  2GM4 A;  1JT0 A;  4UUT A;  3JRH A;  1BR1 A;  3GZ6 A;  1JUP A;  1HKT A;  2DMU A;  2VBY A;  2BV6 A;  1X2N A;  3FKI J;  5HDN A;  3C1D A;  2Y0S A;  3G4S I;  3FXU A;  5J8C A;  3I4N J;  1JHF A;  4IHV A;  4BAY A;  1JGG A;  3DTI A;  4ABZ A;  1YJW I;  4PGH A;  3V8J A;  4ASN A;  4D5C A;  3HJE A;  2ZFU A;  1TL8 A;  3D5L A;  1MBE A;  4L9V A;  2EZL A;  3CMA I;  4E7I A;  5D5X B;  1IF1 A;  3EDP A;  1ZN2 A;  4Y3O A;  5E3N A;  2H1K A;  1KYZ A;  5FRO A;  3MEX A;  3TED A;  2ESH A;  3S1N J;  3IRR A;  1OCT C;  1T0F C;  1UZC A;  2LY2 A;  3K2Z A;  2IGN A;  5D6F A;  4BQN A;  2LLK A;  2L7K A;  3HRS A;  3BJO A;  2DA7 A;  1YOV B;  4A0Y A;  5HVQ C;  4XID A;  2BY1 A;  5JLW A;  3RZD J;  4O3M A;  1U9N A;  2JA5 J;  4M74 A;  2FQ4 A;  4ENN A;  3BR1 A;  5KVR A;  3PO2 J;  3FBN B;  4RAZ A;  3WGI A;  1VQN I;  1ETX A;  4BXX J;  2K4J A;  2Q2E B;  3FM3 A;  1Z3X A;  3J7Y J;  4A3E J;  2H09 A;  1QZE A;  2XGE A;  2EIN H;  5DEQ A;  2KIS A;  4G6Q A;  2ZJQ F;  1YLF A;  4UUS B;  4A93 J;  3Q5F A;  4D1Q A;  1NK2 P;  1AWC A;  3I59 B;  2H6C A;  4HQE A;  3LSR A;  2VC1 A;  1PYV A;  4RDU A;  3PNT A;  1U2W A;  3CCY A;  3FXJ A;  5KK1 A;  1GXQ A;  1FBQ A;  2JJ7 A;  2KIF A;  2Y69 H;  5HS7 A;  2M0C A;  4XLF A;  5FRM A;  2K9L A;  1JHH A;  2OZU A;  2O5R A;  4ZTF A;  3QYE A;  4XLP F;  5A2Q K;  3CCL I;  2K3P A;  2HVQ A;  1Y6I A;  1Z6R A;  2CMP A;  4ENJ A;  1MBH A;  2QSG X;  4E7Z A;  1LEA A;  2O0Y A;  3WTU C;  3FDY A;  5AON A;  3DEW A;  2ZSI B;  3BOQ A;  3TW6 A;  3ZMS A;  1ZG3 A;  2Q1Z B;  3BQZ A;  2ACJ A;  2R93 J;  2X6O A;  4KFC A;  1LDD A;  1KU9 A;  5F08 A;  2HKO A;  2LK2 A;  1Z7L A;  5FFX A;  2BW3 B;  1LE8 B;  1B72 B;  2F5E A;  3S2D J;  2IS6 A;  3KZZ A;  3BG5 A;  4E7L A;  2W57 A;  4PFO A;  5LFA A;  4YFX F;  1SFX A;  2ESN A;  1U6G A;  2QWW A;  3OSG A;  1U8R A;  1ZQ3 P;  4PSW A;  3HZJ A;  2CV0 A;  2I5U A;  3BR0 A;  3OL4 A;  5L3B A;  3H3U A;  2ZKZ A;  4P96 A;  4RMN A;  3I64 A;  2LR8 A;  1O3T A;  5JVT A;  2V7F A;  3GTP J;  1N78 A;  3LSI A;  4MEX F;  2JRT A;  5E3O A;  4G94 A;  2PX9 A;  2R4G A;  1H9G A;  1ODD A;  4B44 A;  3OYI A;  3TMO A;  2LG4 A;  4PJJ A;  3F8F A;  3Q3S A;  1WKM A;  1T98 A;  3I58 A;  3VOE A;  1KON A;  1T95 A;  5JHU A;  2BVM A;  4AVP A;  3TOB A;  2DAO A;  1T08 B;  2VN2 A;  4S0H B;  4E4H A;  1X1A A;  2ZXH A;  1ENH A;  3TGN A;  3HGG A;  1ETO A;  2LYC A;  2KLO A;  4MTD A;  2K27 A;  4A3D J;  3HOZ J;  2PG4 A;  2EBI A;  2O8X A;  5EGO B;  2Y75 A;  3CQZ J;  4DYR A;  1HW2 A;  2XHK A;  3RSN A;  5GTI C;  1ZAO A;  1OIS A;  2ELK A;  1HOM A;  1PP8 F;  3RPU D;  1KU3 A;  2HZT A;  3DXJ F;  3CCU I;  2QEN A;  3Q0V A;  4LB5 A;  2BW3 A;  1HDP A;  2R5Z B;  5K5Q A;  1DU6 A;  1A31 A;  3KYL A;  2K9S A;  3E6M A;  3ZQF A;  4G9Y A;  4NNJ A;  2K7L A;  1OYW A;  1R9T J;  3RCO A;  2M30 A;  3V7R A;  1TTY A;  2KIM A;  4BBR J;  3OOU A;  4B4C A;  4BH9 A;  2JA6 J;  5BNG A;  3ZMT A;  4IXA A;  4JOM A;  1P4X A;  2QLZ A;  1OCP A;  1CGP A;  2E1C A;  3BT9 A;  3BLY A;  4MFE A;  1JKR C;  2NNY A;  1XGS A;  2JA7 J;  4QWQ A;  1VTN C;  1FT9 A;  1IDZ A;  1BL0 A;  3UKG A;  2JSP A;  4AID A;  1KA8 A;  2F4M B;  2HTJ A;  3I4M J;  4N4O B;  2JA2 A;  5E1Z B;  3DEE A;  4A3C J;  2DK5 A;  4Q48 A;  4IX7 A;  4A6D A;  3P7N A;  2DOA A;  3M8E A;  3ML6 A;  3OYL A;  4RAG A;  3LQR A;  3SXY A;  1SAX A;  5ILU A;  4L0Y B;  3BPV A;  3FBI B;  3KP2 A;  3CD6 I;  2HR3 A;  1T2K A;  4EGY A;  4AYB N;  3H5A A;  1I1G A;  4EM2 A;  3CC7 I;  1XMA A;  4ESF A;  4EVI A;  3IKV A;  3RKW A;  2XC7 A;  3MCZ A;  4M72 A;  3N97 A;  1K7A A;  1S5L C;  1QNT A;  3IV5 A;  3PL8 A;  3MZH A;  5BOX A;  3OYG A;  1T38 A;  2DYS H;  3CUQ A;  3EUH A;  4A3B J;  1T39 A;  3TOA A;  4KIS A;  5CYV A;  3VYS B;  2R5Z A;  4L9N A;  3CJQ B;  4LOC A;  1IXR C;  2DT7 B;  1AKH A;  3F8M A;  2ZBK A;  5HLI A;  1Y0U A;  5D6E A;  3L00 A;  1JT6 A;  3PNV A;  2KDZ A;  4RAF A;  5B1B H;  2E1O A;  2EFW A;  2LC2 A;  1SD7 A;  1MGT A;  2PJR A;  3WE2 A;  2CQK A;  1MNE A;  2H6B A;  2VJI A;  4NDL A;  1W7P D;  1IUY A;  2K5C A;  2ZME A;  1MJA A;  2FNP A;  5F04 A;  3E6C C;  2VQC A;  2R7O A;  3HGY A;  1IRX A;  3BZC A;  1B8I B;  1R7J A;  3L1P A;  1FEX A;  5J4V A;  4ZJZ A;  3HOX J;  4OOI A;  2E7W A;  3PO3 J;  1YIT I;  4WF2 A;  1U3E M;  1RKW A;  4XK4 A;  3HPG A;  1QU3 A;  3WGH A;  3QP5 A;  3H9Q A;  2OTL I;  1AOY A;  2DJN A;  5ICG A;  1K83 J;  3FZV A;  3HOW J;  3QPH A;  4Q47 A;  2DYR H;  3A1Y A;  2IEK A;  1QPI A;  1BR4 A;  4L0Z B;  2ECC A;  2VL8 A;  2M9H A;  3JRI A;  5IP9 J;  1RET A;  5CVJ A;  1MH4 A;  1R36 A;  2M3A A;  5J3L A;  1OFC X;  4FAS D;  2ID3 A;  1B8I A;  4JK1 X;  5J6X A;  2VJ4 A;  4BQA A;  4OIQ F;  4M3F A;  4UUV A;  2FOW A;  3KZI C;  2AO9 A;  2JZY A;  2F5V A;  2O03 A;  4B8X A;  4CGZ A;  3HB9 A;  4U0W A;  1MD0 A;  2Y48 A;  4CCM A;  1O3Q A;  2WC2 A;  2V6E A;  3HKZ N;  2A6H F;  2FX0 A;  4HG2 A;  5IOZ A;  2DXI A;  3JRG A;  2EFP A;  3DPT A;  3HC7 A;  3V8K A;  1E3P A;  1ZK8 A;  5LHI A;  1BI1 A;  2IA0 A;  1JGS A;  2EV0 A;  2OV7 A;  1W5S A;  5EZH A;  1R00 A;  2YU9 J;  2BHZ A;  3SHF A;  2GA1 A;  4PZJ A;  1SEU A;  3BTI A;  4JX4 A;  2TDX A;  4I01 A;  3FMQ A;  4C30 A;  3V7S A;  4B1R A;  4F3Q A;  3MKY B;  4KNY A;  1AA7 A;  1LPQ A;  1W4M A;  4P1W A;  2KP6 A;  2GXB A;  1YIJ I;  2KFD A;  2GWR A;  2K4B A;  1VQ5 I;  2DPU A;  4N9I A;  5M3M J;  3ERM A;  2WWY A;  3CDH A;  2P5K A;  3E97 A;  5IT9 Z;  3TKY A;  2VI6 A;  4LIU A;  1BBY A;  2Z5U A;  4E7K A;  1FP2 A;  2H94 A;  1WVR A;  1BOB A;  2NS8 A;  2H8R A;  2XGC A;  1J75 A;  1ON2 A;  2RQQ A;  1TBX A;  3H36 A;  2OD5 A;  3M8F A;  2OU2 A;  2LVS A;  5BPD A;  3J7A O;  4W97 A;  3H1C A;  3W6V A;  1YE9 A;  5GP9 A;  3FK6 A;  3OOP A;  3MFK A;  1ZHF A;  3C18 A;  2V9V A;  3G71 I;  3BG7 A;  4FE4 A;  2PMZ A;  2DMT A;  4CYC B;  1Z21 A;  2HDW A;  2QA4 I;  1D1C A;  2BHY A;  2ID6 A;  3G73 A;  3I53 A;  1XCV A;  1TZL A;  2HPI A;  2MG4 A;  2DI3 A;  4E6K G;  1MBJ A;  2BGC A;  3JRC A;  5FLX K;  3MQ0 A;  2QQ9 A;  2G9W A;  3DBR B;  2X0L A;  4ZYE A;  2P0W A;  3ONQ A;  1A35 A;  1USS A;  2CUF A;  2LP0 A;  2BY0 A;  1UFM A;  2RNG A;  3TQN A;  4LG0 A;  2DMQ A;  2G7H A;  1RIO H;  2FU4 A;  1WI9 A;  1VND A;  1O3S A;  1MBG A;  5JFR A;  1DP3 A;  4MNU A;  4KT6 A;  2XAU A;  1MJ9 A;  2E1N A;  1KQ0 A;  2HS5 A;  2VC0 A;  1FSE A;  3KCC A;  4BAC A;  5M5W J;  4HDV A;  2M8G X;  2QUF A;  2KRC A;  3ZOB A;  5B66 C;  1YX3 A;  3FXQ A;  1I27 A;  1MBK A;  2JA8 J;  2X1D A;  3BTJ A;  2KZV A;  3ZQI A;  4XLC A;  3J80 Z;  3QRF F;  3WGG A;  3GLL A;  4IPA A;  2IJL A;  2DJI A;  2HYG D;  3CJN A;  1A36 A;  2WV1 A;  2L02 A;  2RAE A;  2JUG A;  2XAG A;  1JJ6 C;  4IQJ A;  2VOP A;  4CYC A;  5ILV A;  5ED4 A;  2DOE A;  5FLM J;  2LKX A;  3ZMU A;  2A3S A;  3CC4 I;  3TO7 A;  3DU6 A;  3C2G A;  2VXD A;  2B9S A;  3F6O A;  2F5F A;  2LF7 A;  4CCL A;  1AHD P;  2ETH A;  4IRI A;  3S8P A;  3J81 Z;  4G7H F;  1P92 A;  3FM5 A;  1SFE A;  4CCJ A;  2OBP A;  1FOK A;  3RPU A;  1QGP A;  2HI3 A;  2MC4 A;  1QRY A;  4HNT A;  2MH2 A;  1P7J A;  2AHQ A;  1B9N A;  3TO6 A;  2LOO A;  2STW A;  4BJ5 C;  1ZH5 A;  2LY1 A;  4HF2 A;  4AD9 A;  2PJR B;  3M4O J;  4RGX A;  2I10 A;  2TCT A;  3FHN A;  2K85 A;  3K4L A;  1EH8 A;  2BE5 F;  4IVN A;  1YRN B;  3B6C A;  1U5T C;  5KCM A;  1OKR A;  1S8N A;  2E60 A;  4UB8 C;  4BEH B;  1B72 A;  2IW5 A;  1MMD A;  4EJU A;  2JWT A;  4W1U A;  4WXD A;  3H92 A;  2R5Y B;  1XDU A;  2IGM A;  1TWG J;  2MYS A;  2ZC2 A;  4ANJ A;  4FCY A;  3ERE D;  3QPL A;  2L7M P;  3SFI A;  4LD5 A;  1GXP A;  1W36 D;  1MH3 A;  4B48 A;  1YJN I;  3NEU A;  4IHW A;  1E3H A;  1I39 A;  3QPT A;  4B47 A;  5JVG F;  1VZ0 A;  4JYK A;  1EJ9 A;  3I9V 2;  3FX3 A;  4RS8 A;  2DFE A;  2XSJ C;  5IYC J;  5H20 A;  3KP5 A;  4DZP A;  1HKS A;  3SEQ A;  4EJO A;  4BE0 A;  2JVG A;  3EQL F;  3S3N A;  3PNY A;  2HYF A;  4GCV A;  3WTW C;  5HDG A;  1V5F A;  2FNA A;  3CO6 C;  4JX5 A;  4HDU A;  5AIQ A;  4HAM A;  5LD2 C;  2HOA A;  2VQL A;  3PUF A;  4Q4Z F;  2FJ1 A;  4UY8 I;  1D0Z A;  2L7Z A;  3BJA A;  1LQ1 A;  2I8D A;  2IT0 A;  4I7H A;  5C4X J;  2XIG A;  1UHS A;  1YX5 A;  1HW1 A;  3GX4 X;  4AVZ A;  2KIU A;  3SZT A;  4RM3 A;  1R1U A;  3K7A J;  3C2H A;  1G3W A;  3IWZ A;  3A0H C;  2CG4 A;  2EQR A;  2JUC A;  3DBH B;  3MMY B;  4IF4 A;  5J1Y A;  4GYI A;  2PBI A;  2EV6 A;  1KQ8 A;  1SMT A;  3CJS B;  5LGT A;  2XKO A;  2DOF A;  2NAZ A;  2YU3 A;  4IEJ A;  2EA4 A;  4XKW A;  3SYT A;  2V9K A;  2O6G E;  2B63 J;  2PJP A;  5EG0 A;  4NC6 A;  5DUI A;  4DYC A;  5F0C A;  3MZY A;  1WJF A;  1ZTR A;  4NC8 A;  5IT9 K;  5CLS A;  3F8C A;  1T0F A;  4DGW B;  2AXT C;  2NS7 A;  4YII A;  3S2H J;  2DU9 A;  4U0V A;  2LH9 A;  3GTL J;  3LA7 A;  3AG2 H;  1GUU A;  3L2C A;  4DQ2 A;  2OA4 A;  2P5V A;  2OTJ I;  2IGK A;  2Z1D A;  1ETV A;  3OY9 A;  1FBU A;  2NOJ B;  1OQY A;  1Z77 A;  2P7V B;  1Z0X A;  2W1O A;  2W84 A;  3RDI A;  3GFI A;  1SFO J;  5FKO A;  3GF2 A;  2RRE A;  3Q9S A;  3COA C;  2V1N A;  3DEU A;  2LNB A;  4MHG A;  2LKP A;  5DD8 A;  2KT0 A;  3DP7 A;  3BPX A;  2CWE A;  2M4G A;  4ZYH A;  1XN7 A;  4RB1 A;  2GOX B;  1D0X A;  3Q9V A;  5CJ9 A;  3T5X A;  3RIR A;  2CYY A;  5BQT A;  1T8I A;  5HDK A;  3ZQQ A;  1BN5 A;  2HQ5 A;  3V4G A;  5CVI A;  3EPZ A;  3OYJ A;  2QZ8 A;  2R92 J;  1WGX A;  2DDB A;  1OPC A;  2G0E A;  2ECB A;  3R0A A;  1YIO A;  5CKT A;  4DJA A;  2HOS A;  1UST A;  2DBB A;  4P9U A;  3LOC A;  3OL3 A;  1FYM A;  2CQQ A;  1CQT A;  1TWC J;  3WTS C;  3W6K B;  4EV0 A;  1LFP A;  1W1W E;  4C2T A;  3GFM A;  4MO7 A;  3DLL F;  1PJR A;  4G6D A;  3CF5 F;  4HYE A;  1Z3Y A;  3TW7 A;  2HYJ A;  1JKO C;  1Y0N A;  1NH3 A;  1FTT A;  1QZZ A;  1BC8 C;  1TW3 A;  1HC8 A;  3HPH A;  3O3K A;  1XSV A;  2EPF A;  1P6R A;  2GA2 A;  1J59 A;  4ETS A;  3CCJ I;  3ABK H;  4HZF A;  5D8L B;  4LLG F;  4ENK A;  1OCC H;  4QIW N;  1WZ2 A;  4P9F A;  3FKJ A;  3OV8 A;  1HSJ A;  1F4K A;  3AL0 C;  2XB5 A;  5D4S A;  1JXS A;  3BQY A;  1XGN A;  1HCR A;  4GRI A;  1ZGJ A;  2EIM H;  5DCM A;  1UCR A;  4IHT A;  4CSW A;  3H3Z A;  1OLT A;  2VPL A;  2RV8 A;  3DTK A;  3RJP A;  3S1R J;  5KHD A;  1LDK B;  3HHG A;  4IQ4 A;  1HBX G;  1C0W A;  1FC3 A;  3O2P E;  3AFH A;  3CP2 A;  4NBQ A;  4XN3 A;  1K78 B;  1GV5 A;  3HOV J;  3KE2 A;  1UB9 A;  2WY7 Q;  4YFK F;  4B3X A;  2E7X A;  1WSU A;  3K4J A;  5FKM A;  2X6X A;  3ZR8 X;  1WCM J;  1EA3 A;  4FHT A;  1WFX A;  1Q1H A;  4A0X A;  5LBQ A;  3WTT C;  5D5U B;  1ETY A;  2P7C B;  1I6X A;  2ELH A;  1XB4 A;  1QVU A;  2R7W A;  1JUS A;  1P2F A;  3JSO A;  4XOP A;  1GVD A;  1XD7 A;  3HTS B;  3U1D A;  2KRF A;  4KA4 A;  1SD4 A;  2NYX A;  4XKB A;  1M1E B;  3K9T A;  2X4H A;  3BG9 A;  4MQV A;  4XR6 A;  5EF6 A;  4EQQ A;  1FPQ A;  2XAH A;  3VYT B;  2CV2 A;  4ZH4 F;  4KIF A;  3F22 A;  1JKQ C;  4X6A J;  3EUA A;  4I09 A;  3SJM A;  4AWX B;  1Z67 A;  4XOT A;  4EJV A;  5B3S H;  4GDF A;  4A3G J;  3ASO H;  3HM5 A;  2BVL A;  4WK8 F;  4O5V A;  1IN4 A;  2JVH A;  2VQH A;  1R5H A;  3E5Q A;  2Y30 A;  2P8T A;  3AKZ A;  4Y17 A;  3CDI A;  5J4Y A;  1XMX A;  4BS9 A;  3E7L A;  5BS6 A;  3OR1 C;  1FP1 D;  1STZ A;  2L9S A;  1IJW C;  4ZDP A;  2OJE D;  4JX6 A;  2J5O A;  2R0Q C;  2H27 A;  4A3L J;  1R5G A;  3H35 A;  4C3I J;  3GTK J;  1E17 A;  3JRE A;  4WWC A;  3W2A A;  1YHQ I;  3RKX A;  3MKW B;  3ROU A;  2WAF A;  1U0J A;  4Q5S F;  5HLG A;  1VFC A;  2QSH X;  3W6J B;  2QQB A;  1G8X A;  4IZZ A;  3OMY A;  5HOO A;  2DOD A;  4H4K C;  2RNJ A;  2GIV A;  5C3E J;  5EGO A;  3CO7 C;  1R58 A;  1Z7U A;  1K61 A;  3IH4 A;  5EDN A;  2CW8 A;  2VOO A;  2EIL H;  2MW8 A;  1H0M A;  2ZJR F;  2MAB A;  1E2X A;  2VXZ A;  1IG7 A;  4Y4R A;  2W7N A;  2L54 A;  2MLG A;  1F1Z A;  4BQQ A;  3K4N A;  3GBG A;  5K7Z A;  3EYY A;  2R7T A;  5B5E C;  3KFW X;  1QHG A;  1ORK A;  4NQW A;  4UVC A;  2EV5 A;  5CVV A;  1ZAR A; 
#chains in the Genus database with same CATH homology
 5GAD J;  1FOX A;  2QEX I;  2E34 A;  3CJS B;  3EGV B;  1FOW A;  4V19 K;  2K3F A;  3CC4 I;  1VQ6 I;  4IOA F;  3CD6 I;  1YIJ I;  4IO9 F;  4IOC F;  3CC7 I;  1VQ5 I;  3CME I;  5GAH J;  3J7Z I;  3CCM I;  1YJ9 I;  3CCV I;  2OTJ I;  2JQ7 A;  1VQ9 I;  3CCE I;  3G4S I;  3CJQ B;  2E36 A;  1YJW I;  2H8W A;  1VQO I;  3CCR I;  3CMA I;  1VQK I;  3CJT B;  3G71 I;  1ACI A;  1Y39 A;  1MMS A;  3CJR B;  1VQP I;  2QA4 I;  1YI2 I;  2E35 A;  1YIT I;  5DM6 F;  1FOY A;  1S72 I;  2OTL I;  1WIB A;  1YHQ I;  3PIP F;  5DM7 F;  3CCS I;  1YJN I;  1QA6 A;  1VQN I;  2ZJP F;  3DLL F;  3CF5 F;  5JVG F;  3J7Y J;  1VQ7 I;  3CCU I;  1HC8 A;  2ZJQ F;  3CCJ I;  3CC2 I;  2FOW A;  5GAE J;  1VQ4 I;  3I56 I;  2ZJR F;  3I55 I;  4UY8 I;  3CCQ I;  1VQ8 I;  2NXN B;  1VQM I;  5GAG J;  3PIO F;  3CCL I;  3G6E I;  1VQL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...