2H8WA

Solution structure of ribosomal protein l11
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
147
structure length
147
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Free L11 and Functional Dynamics of L11 in Free, L11-rRNA(58 nt) Binary and L11-rRNA(58 nt)-thiostrepton Ternary Complexes.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
molecule keywords 50S ribosomal protein L11
total genus 15
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2h8wA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2h8wA01
2OTJI 1VQOI 3CCQI 1VQ5I 3CCLI 1S72I 1VQNI 3CMEI 3CC7I 2JQ7A 3J7ZI 3PIOF 2ZJQF 2ZJPF 3CC4I 1YJ9I 3CCVI 5GAHJ 1VQ6I 2OTLI 5DM7F 1Y39A 1YI2I 3CCUI 1YJWI 2E36A 1VQ7I 4IO9F 1FOWA 1FOXA 3J7YJ 3CC2I 3G4SI 5GAGJ 3CJRB 2FOWA 3I55I 5GAEJ 1VQLI 2H8WA 1WIBA 3CCEI 5GADJ 3CCJI 2ZJRF 1MMSA 1YJNI 2QEXI 1YHQI 1VQPI 1VQ9I 3CJQB 3CCMI 2E34A 3CJSB 3G71I 3CD6I 3CMAI 1VQ4I 3EGVB 1YITI 1HC8A 3I56I 3CJTB 3G6EI 4V19K 1VQKI 3PIPF 1VQ8I 4UY8I 3DLLF 3CCSI 1YIJI 1QA6A 5JVGF 2E35A 2NXNB 4IOAF 2K3FA 3CCRI 1VQMI 5DM6F 2QA4I 1ACIA 1FOYA 4IOCF 3CF5F
chains in the Genus database with same CATH superfamily
3F8CA 1F36A 1R9TJ 1J9IA 2BW3A 4B3XA 4LG3A 2FSWA 1G8XA 1J59A 1FWZA 1S72I 3PNYA 3DBLB 1YYVA 3T5XA 4NQWB 2YS9A 5IYBJ 4ZZLA 2WAFA 2HVRA 1OYYA 3K4KA 2R3SA 1TQPA 1H9TA 4EM1A 3S16J 1E0EA 3VSKA 2WBMA 3QPTA 3F22A 1KONA 1F4KA 2BW3B 1FPQA 2IA0A 4EM2A 2IGOA 3C2HA 2HPMA 2DFFA 3A0HC 1XTAA 4QLCU 4IPAA 3JRDA 5DEQA 1XMKA 1LB2A 4CCMA 4IL6C 1X3WB 4A2UA 4IHTA 1A36A 4PFPA 4AU7A 2BY0A 2FBIA 3BR2A 3HDDA 1G3WA 2BYVE 2KRFA 4ZDLA 4KFCA 4UUVA 1S6LA 5F1RA 3BC8A 4MQ9F 2CW7A 2MFZA 1NHAA 4XN0A 2E7XA 2F4IA 5K5RA 2PG4A 2AHQA 3GTGJ 4KNYA 1VFCA 2V1DA 4J19A 1I50J 5EDNA 9ANTA 2LFBA 2HQ5A 3GZ5A 2DOAA 2XAGA 1IC8A 4A3FJ 1FNNA 3TP0A 4EM0B 1JUSA 1MD0A 3IH3A 5CVRA 1YITI 2P81A 2X1CA 1JJ8C 2GXAA 3BCBA 4A3DJ 2Y9YA 2EV6A 3L2RA 2Y69H 2E2JJ 4BBSJ 2X1DA 2FXAA 3O8HA 2IGNA 3CQZJ 4RM2A 2VBYA 2VBWA 2FQ4A 3ZQIA 3MCZA 1M1EB 1W5CC 1ZYRF 4XQFA 2Q8KA 4ZZDA 4PUSA 2DPDA 3I3LA 3E1SA 1X1DA 1QA6A 4XLHA 4C2UA 2KQRA 5H6QA 1KYZA 2OZUA 1X19A 3CUQA 3LL7A 4B3AA 5L3FA 2R93J 4C30A 3WTZA 1GVJA 1ZGWA 3QOPA 4A3LJ 4YG2F 2ZB9A 3J80K 1QVTA 4MFDA 5HLHA 5H20A 2DMQA 2QYOA 3K4NA 3BG3A 3KP7A 2L9SA 1T56A 5HDKA 5M5XJ 3IL2A 4IHVA 2NVQJ 1YS7A 2R7VA 1YRNA 2XAFA 1P4XA 2CH0A 1FOYA 3KP6A 4RGRA 3K70C 1F9NA 4XLFA 5FKKA 3RKWA 2OTJI 1XSDA 2NRAC 3HBLA 4RAGA 4AIKA 2O0YA 1LFPA 3DU6A 4A3EJ 4HF0A 3OIOA 4AWXB 3BG7A 3H9GA 2R7ZJ 3CMYA 3T8RA 1O4XA 1K4SA 1MKMA 5E79C 1P4AA 1IRXA 4A12A 2XF6A 3WG9A 4G9YA 1ETQA 4ESJA 3IWFA 2J5PA 2YU3A 5DV5A 3WTYC 2WY7Q 1U5TA 5KAIC 1HXDA 5DCMB 3JRCA 4HZFA 5D4SA 4CCKA 2K7LA 4RGXA 3OIQA 3KPHA 1E3PA 4CYCA 1EJ9A 2QCOA 3ULQB 2L02A 3G4SI 5HLIA 3HL2A 1T95A 1B9MA 1D1AA 4D9JA 3RKXA 5A2QZ 1X1BA 2DA5A 4FETA 1TLHB 2EB7A 4P5OA 1WIBA 1ZR2A 2YSRA 2ZKZA 1MMSA 2HS5A 2BV6A 1W1WE 2OCCH 5ED4A 2EIMH 4DGWB 5ICGA 4G6QA 3BJ6A 2IP2A 3LA7A 4M9ZA 3J7AY 3ZN1A 1ZGAA 3DV8A 2E2IJ 4MEXF 1KU3A 2EBIA 3HEFA 1IN5A 4M9XA 1WJEA 3OYHA 4OIPF 3F9KA 1YE9A 4B48A 5FLXK 4HOBA 1TTYA 1IXCA 3ECHA 3HGGA 5B3SH 1MNDA 3LSTA 2Q1ZB 4XSXF 1BR2A 1YW9A 3FK7A 2N8GA 2K4JA 3DKYA 3KETA 4ZTFA 4XLEA 2DK8A 3L1PA 4FHTA 1H0MA 2QGUA 5LHHA 3FMQA 3JRBA 2CJJA 2EIJH 2V9KA 3JTGA 3M7GA 1N78A 4DBRA 2DYSH 5A2QK 1T0FA 1RC9A 4LK0F 2FOKA 3P7NA 3FXOA 1PUFA 1E3OC 4FASD 1ZARA 3HXLA 3U9GA 3K2ZA 1G3YA 5H2FC 2NXNB 1XCVA 3LSHA 2EV5A 3QOEA 5GPAA 3V7CA 3ZQGA 3CCRI 1AOYA 2AQEA 2M1BA 3CLOA 1AKHB 1ETWA 3OS0A 5H6RA 3RTRA 4BHPA 2FQ3A 1XN7A 1MDMA 2ISYA 4KIFA 1IRGA 2O5RA 1D8JA 1HW1A 2M87A 3OYNA 1ZK8A 2DMNA 2KLOA 4I76A 4HV6A 3S3OA 1XGOA 2IGKA 1FMWA 1J5YA 2W4SA 4AUXA 2L9NA 3IP4B 1TZLA 2JA7J 1QHHD 3S3NA 4BYYA 3H5AA 1ZG1A 3RPUD 4E7KA 5BOXA 3DKWA 4HX4A 1H8AC 5D6FA 3SDGA 1I39A 2STWA 3O3KA 2VI6A 2R7QA 5J6XA 2HDCA 4BE1A 3D5SC 3J7ZI 5EF6A 2D5VA 5TRDA 3EUHC 2ELHA 1P6RA 1Z05A 1T0FC 4UUTA 1BOAA 4R79A 3MMYB 2Z33A 3CCVI 2DK5A 2L01A 1GVDA 1OCOH 1IRFA 4BBRJ 4HQEA 1Y39A 1S7AA 4F93B 4XICA 5EG0B 3NQOA 1LKXA 2E36A 2RV8A 1EF4A 4Q4ZF 3F21A 3EPZA 4A0XA 2E5ZA 1JGGA 3QRFF 3S1MJ 4M9SA 3OYMA 2OUMA 2PMHA 1T08B 3IAM2 4HNUA 3EUHA 2IVMA 4EJWA 2ELKA 2L7MP 4IHSA 3V8JA 4PJ0C 2GA1A 1JTXA 4XR6A 1UAAA 2IW5A 2LOOA 4RB3C 1YFHA 4HV5A 1VZ0A 4C3JJ 2HI3A 3OYGA 3S8PA 1IN8A 3G73A 1BN5A 4I98B 2Y31A 3RPQA 3S2HJ 4RLQA 1R71A 2O8XA 2Z9OA 2IS4A 2F5DA 2ZJ2A 4I01A 4F3QA 1B8IA 3Q3SA 5HLGA 2P5VA 4YRVA 1U9NA 2KJBA 3A1YA 3DFGA 1SFOJ 1GXPA 3A03A 2ID6A 1S3JA 2XRNA 4BQNA 3Q0WA 2P8TA 2CQKA 3RIRA 4EMSA 4L5JA 2V6EA 2O6GE 5D5XB 2HFHA 2ETHA 1ULYA 2QSFX 3JTHA 4EJUA 2DQRA 1UB9A 4CCLA 5LRRA 3R4KA 1IF1A 2XIGA 3BCAA 3ZXSA 1MH4A 1OLTA 2R7DA 1TWGJ 1Z91A 3JSPA 2CUFA 2HKXA 2PLYA 1UZCA 4FTHA 3M8JA 3K70D 1VQMI 2PMZA 4WCGA 1YLFA 3COAC 4UUSA 3BP8A 1WZ2A 4ON0A 5DCFA 1R5GA 1ZQ3P 5DD8A 4F91B 3DEUA 2XAUA 1FP2A 2M8EA 2XGCA 1DQUA 3HOZJ 3GFJA 3VODA 3RCOA 4RBOA 1P9QC 2CUEA 4II2A 3HG9A 3CF2A 4LOCA 4YFNF 1IDYA 3P9IA 1Z3YA 3OR1C 3CP2A 1SFEA 4D5FA 1WI9A 5FO5A 2HDWA 4RAFA 3DF8A 1QU3A 3VFZA 1ERDA 1RKWA 3PUBA 2W25A 5ILSA 4XBFA 2TDXA 3TO6A 4CZZA 5DS9A 1R00A 1YI2I 3CDHA 3LOCA 2BHZA 3WTUC 1SFKA 2B0LA 3GX4X 2DT6A 3QPLA 1YX5A 5E18F 1O57A 1TP4A 4QTRA 2R5YB 3PJRA 2X6OA 1B6AA 4XLCA 2L7KA 3OYLA 2XKPA 1U6GA 3MVPA 5ICCA 2DBBA 1LVAA 1QO0D 2EPFA 1Z3XA 3CP8A 4ENKA 4IXAA 3S2DJ 1R49A 2KJCA 3EDPA 2ISZA 4AVZA 2LC2A 1G3SA 1S5LC 2E19A 3JAMZ 1MMGA 2K40A 2WAQN 5IT3A 1B59A 3OS1A 2HOTA 3BPXA 2OAZA 4E70A 2BXZA 4A6EA 2W84A 3IKTA 3GTLJ 1WH5A 4JK1X 3G1OA 2ZSHB 2HOSA 2BGCA 4LIVA 1JT0A 4A3BJ 4KDPA 2CV0A 4Y3OA 1WWXA 3I56I 1RZ4A 4B1RA 3HOVJ 2HTSA 5JR3A 1LQ1A 2W1OA 3SYTA 4XOPA 1JXSA 2VKEA 2QVOA 4ANJA 1LVKA 2QUFA 3H0GJ 1J75A 3HKZN 4ZYHA 2FRHA 4BS9A 1W0UA 3VYUB 1Z21A 2ZO4A 5D4RA 3ASOH 1IV8A 2BXYA 2HGCA 3WHCA 1AHDP 1X2NA 2VODA 5DD4A 2XV4S 3BLYA 5CVVA 2P6TA 4PJNA 5F04A 3L7WA 3U21A 3LAJA 2MSYA 3GF2A 2NVXJ 1LEAA 5CQGA 2NS0A 3E6MA 3JCUC 5DCMA 1HKQA 1H9GA 3AKZA 2OCEA 1LDKB 3M8EA 4WK8F 4IJAA 3UR3C 3MKYB 4GCVA 4IOCF 1FBQA 3FF5A 2LY9A 4ENNA 4LMYA 4D7MA 2A6TA 1KQ0A 5FB2A 1JKQC 3I4PA 2FEZA 3FKJA 2K3PA 5HLTA 3F23A 4BQOA 2E5NA 3ZMUA 3MFKA 3CMEI 2DFIA 3BR6A 1BJZA 2DMUA 3BDDA 3LWFA 4RLFA 1BL0A 1LPQA 2DW4A 5F6FA 4KMFA 3ZP5A 1ZELA 5GAHJ 4ZDOA 4A3GJ 1B1BA 2HQNA 3Q9VA 3EQLF 3BTCA 1K4TA 4XKCA 3CUOA 4GXOA 4L9NA 4NC6A 1RUOA 1MIJA 3Q9SA 1WRJA 3CUQC 1KZHA 3F8BA 4IO9F 4J01A 2KISA 1U2WA 2M8GX 3H1CA 2EFQA 3CUQB 3F8NA 2MA3A 3WGHA 2O61A 3PQKA 2BY2A 1ZGJA 1V5EA 4G8XA 1H89C 3OS2A 3TO7A 1MMAA 2W57A 1Y0UA 2RDPA 5IP6A 3C18A 2CMPA 2NOGA 2Q0OA 4IRIA 2IS6A 3FM5A 5GTIC 3TGNA 3O6BB 3AG4H 1NTCA 2Y30A 2R7RA 1DGRM 1V4RA 4XLAA 1X1CA 4OIOF 4ETSA 2O03A 3LSKA 5CLSA 4XOTA 4DYRA 5BPIA 1W7PD 1U0JA 4UVAA 1IXSB 2E1NA 1QVUA 1KQ9A 1VQ4I 2LF7A 3EGVB 3S1RJ 1YW7A 1XX5A 2DDAA 3LMMA 3SEQA 4CSWA 3PO2J 1OYIA 2DTRA 2ME6A 3MAJA 2CFOA 5KNLA 2BY3A 2QZ8A 4CZCA 4H4KC 1WH7A 2XROA 1FC3A 3GFLA 1YX3A 2GWRA 4PZJA 2L7ZA 4XORA 2NS7A 2DOFA 1FYLA 1YIJI 3HC7A 3LFUA 2QQBA 2R7OA 4PGHA 3BJOA 2NYXA 3TL4X 2AS5F 3BT9A 3HUGB 4OMYA 4L0YB 1B4AA 2EFOA 2VC0A 4P96A 3V42A 2KP6A 3OL4A 3MZHA 3DPLC 3BZ6A 2WA0A 4U0VA 2LNBA 3S2WA 2CGPA 4PJJA 5E1ZB 2VJ4A 4HDVA 3TOAA 2CUZA 1BI1A 2VOOA 4XONA 4EV0A 1MBKA 3WODF 2Z2SB 4I6ZA 2GQQA 2ZXIA 4UHTA 2VBZA 1TW3A 1XS9A 4QIWN 1LE8A 1UFMA 1XDSA 3FIWA 3OV8A 4EGYA 3BTLA 3SDBA 2R0QC 3OL3A 3GLLA 2LKPA 1WKMA 2R7FA 1UJ8A 1TT0A 2KRCA 4RB1A 3A4CA 2V9PA 3H9QA 2W24A 3DLAA 2ZFUA 2K4BA 1YJ9I 3CC4I 3L09A 2VOPA 2I8DA 2H6BA 2K9MA 4KYWA 2EZKA 5F64A 1R1VA 4Z2YA 1WI3A 2A6EF 4P1WA 1BIBA 1IO2A 1TNTA 4HAMA 1AA7A 3ZQQA 1VQ7I 2Y0SA 1ODDA 3H0DA 3E5QA 3I64A 4ZC3A 3GFMA 5HDNA 1FOXA 4M74A 4O6JA 4KT5C 1SD7A 2EFNA 5BNGA 3T0YA 3OYBA 5C4JJ 2ICWG 4Q48A 2CG4A 2VBXA 2H8WA 3AL0B 2ZBKA 5FFXA 3RKQA 1IDZA 2LY2A 1XSXA 5LD2C 3M3YJ 4DBQA 2WWYA 4ZYAA 5FGMA 3QQAA 3KP3A 3CJQB 2R7XA 2X48A 1FYKA 4DYQA 3BWGA 3HRTA 1XMAA 4BJ5C 2E34A 3VOEA 3E6CC 1QBJA 4EJTA 2VQHA 2KIFA 5J8FA 3EYIA 4XRMA 3JW4A 3G71I 1DUXC 4GDFA 3CMAI 4JP0A 5J4VA 2CWEA 3AFHA 1IXRC 3K4MA 2VT3A 1IW7F 1I1SA 2XUBA 3KEYA 4HEA2 3HRSA 3KYCB 4NC7A 2ESNA 2ZSIB 4OIQF 3ZMSA 4AVPA 2GM4A 2JRTA 3D1NI 2VLAA 3P5JA 3DLLF 3TKYA 3ISPA 3SZGA 3LQRA 3R6SA 5ICEA 1K79A 4HX8A 1J0RA 3RQIA 2V7FA 2VXZA 1SVMA 5LEJA 2E2HJ 3MZ8A 4CH7A 3BQYA 2DAOA 2M0CA 2DDBA 3I71A 4LK1F 2HYFA 2K3FA 4BY1J 4HNVA 2V1XA 2IS2A 4L9JA 4UXNA 2GA2A 2R7SA 3DBHB 1ENHA 5M5YJ 1JKRC 3HYIA 3BJAA 3SFIA 4IEJA 2H09A 4C2MJ 5JLXA 2HVQA 3FK6A 4Y4RA 1MNMC 4M71A 2EIKH 3BR5A 1LDJA 3DPUA 1E3HA 3K69A 2YX4A 2GAUA 3GXOA 4M3BA 4AM3A 1HDDC 3I4MJ 4S05A 1GDTA 2K9QA 3E6BA 2XPWA 4ENMA 2MH9A 2FA5A 2P5LC 1UHMA 3GCMA 2XDVA 4GYIA 3F72A 3UKGA 4M6YA 3FXJA 1FLIA 4PK4A 1TWFJ 2BVLA 5EGOB 4M3DA 3HTUA 4P9UA 1OCZH 4IVNA 2O3FA 1R36A 3ASNH 2X4HA 2DFEA 1XPXA 3ZMTA 2EINH 2WB1N 1XGSA 2VASA 4K2EA 4U7DA 1IAWA 5TGTA 3L2WA 1HCRA 4HF1A 3E0JB 3L00A 3K4LA 2X9DA 1USSA 1Y8RB 3IH4A 2EZHA 4V2FA 3MN2A 2XAQA 1LE8B 3PFIA 3M4OJ 4Y15A 1SC7A 3BG5A 2CO5A 3PSFA 4BXFA 1G59A 1FIPA 1D8KA 4I09A 1O3TA 2QBYB 1B72B 1XGMA 4OU0A 1K6YA 1T8IA 1MBFA 2CFXA 1IRZA 2XGDA 2L3DA 3W2VA 1UELB 4N4NB 3CCJI 5HS8A 3TOBA 5ILVA 1OFCX 1R1TA 4G7OF 2ECCA 1FT9A 1FBUA 4OINF 2HU9A 1KU9A 2EA4A 2RQQA 3T8TA 4BXUA 1Z0XA 1VQPI 4HSRA 3GTJJ 3QPHA 5FRMA 2FNPA 3CCYA 3ABLH 3HUGA 4PJLA 3WTTC 3BG6A 1ZRCA 3KP4A 4L18B 3TO9A 4X0GA 5CVJA 5GPCA 3DEWA 3DEEA 2BY1A 3PNVA 4IHXA 5L3EA 2A5YB 3PUFA 1GV2A 3F6OA 1FZPB 4NHJA 5AONA 5J1YA 2PJPA 1JUPA 2XASA 2HOAA 2OBPA 4LFUA 2KDOA 1MBJA 4XMYA 5EYRA 3H5NA 1W5SA 3KLOA 2EZIA 1XGNA 3RQ4A 1PDNC 2JPCA 3VWBA 2BE5F 1GXQA 3K1MA 3R61A 1HKTA 3CJNA 3DCFA 4YFXF 2JJ7A 2K9NA 1OPCA 2DQLA 2F4MB 4XLPF 1GV5A 4MFEA 2WB1A 2QKLB 4CDGA 3SHFA 2K9SA 5E20A 2B9SA 1SMTA 4O3MA 3I9V2 1V5GA 4KA4A 2Z5UA 5IP7J 1GT0C 2OPTA 4FX4A 2CV1A 3FHZA 2OV7A 4P9FA 1X3ZB 4QPQA 4BE2A 3KFWX 3QYBA 5D8KB 5HNFA 2IXSA 1VTNC 2BOLA 3OR2C 5EEHA 4RB2C 2PBIA 1PVEA 1U5TC 2CQNA 3D5RC 3Q0UA 4RA2A 5K7FA 3HOTA 1MW7A 3U1DA 1O7FA 2LKSA 3CC7I 1FIAA 1HLVA 2HYJA 4I0BA 1BW5A 3PIOF 1OQYA 3SZTA 3OYCA 4RS8A 2E60A 1VQ6I 3G1LA 1QQIA 2X6XA 2O7OA 1H88C 4YIFA 3CESA 3L9FA 3V7RA 2KRHA 1NK3P 2DA2A 4YEJA 2CYYA 1FX7A 2D1VA 2XF7A 5D8LB 4W1UA 3VYSB 4FT8A 2D2WA 3F6VA 3ERMA 4KMUX 4HX7A 2QKMB 1R5ID 5IPAA 1D0YA 1PYVA 3GMEA 2K5CA 5GADJ 2H8RA 6PAXA 1NG7A 2MBFA 4OAZA 2XF5A 1XSVA 2HTJA 3S1QJ 1TW2A 1B8IB 3MQ0A 5EZHA 1C0WA 1OKRA 4HLXA 3S1NJ 1IUYA 2A07F 1NH3A 2TCTA 2M2EA 2XPUA 3HHHA 1HOMA 1WJAA 4HBLA 3I58A 2GIZA 1XMXA 1Y56A 1WJFA 4M6VA 2WY8Q 5E3LA 3VPRA 3OOPA 5BMZA 2J5OA 4G6DA 4LG0A 3N05A 3HJEA 1RPWA 3IWZA 4E7LA 3WTXC 1LEBA 4NB5A 2B7EA 2Y48A 3DBRB 4RGUA 4E4HA 2QWWA 3H35A 2VE9A 2MC4A 3GO5A 1N75A 4BU2A 2TRTA 2ZNYA 4XLNF 3E97A 1MGTA 2RVCA 1SD4A 3KEQA 4RDUA 2LD5A 1EA3A 3RDIA 3HGYA 4LGWA 2VPLA 4BXXJ 1MJBA 3FXUA 1A31A 4TV7A 4BHCA 1W5TA 4DZJA 1UCRA 3FXLA 5EJCA 4F7ZA 2LREA 2UUZA 2XC7A 2FX0A 2ZC2A 5DUKA 2LKXA 3K10A 3QP5A 1SEUA 4CYDA 3ZQHA 2BZTA 1O3SA 3SEZA 5C3EJ 5JHFA 4YIIA 1Q1HA 4B44A 5C4XJ 3CCLI 2IEKA 4YIRX 3HRUA 4A93J 2XVCA 1MBHA 3C3WA 1Z1DA 1BI3A 2LTPA 4HNTA 3WU1B 1O3QA 3KZYA 1TWCJ 1XB4A 4RB0A 4XIDA 1BOBA 2CW0F 1JGSA 3EUAA 5LLQA 3HOSA 2DYRH 2KT0A 2F6CA 4ZYGA 2DXIA 2A69F 2UXNA 3A02A 5HDGA 1F43A 5DM7F 1HKSA 2FMYA 3C2BA 3TP3A 2ZNZA 2LP0A 5J8CA 1FOWA 1IN6A 5CJ9A 4U7BA 5E1XA 1WSUA 2IT0A 2UWMA 4X1EA 5F0HA 4H0EA 4KN4X 1DGWY 2HXOA 3CJRB 4WX9A 2FOWA 2NVYJ 1JTYA 3N97A 3QPSA 4B8XA 5FJ8J 1BC7C 3OIPA 4R1HA 2A05A 1Y1WJ 1UG2A 1VQLI 1OMIA 4BL0B 5LGNA 1PUEE 4UUSB 1J7KA 4L9TA 2DA6A 4GFBA 3A0BC 3I54A 2QLZA 2FMLA 1LDDA 4BKXA 4XKVA 3HOWJ 4KISA 2W82A 3FXRA 2XSJC 3FDYA 2F5EA 1MJ9A 3LSJA 3DWLE 4ESBA 1U8BA 2GXGA 1TT5B 1JT6A 1WPKA 2Z16A 5IYCJ 3H5RA 4LG0B 3HZJA 4M3GA 2GOMA 4N4OB 4A0YA 2KZVA 1MBGA 3V4GA 4HA8A 1FBSA 2D1HA 4MLOA 2ZCWA 3G6EI 2V4JC 4Y17A 1HBXG 3M07A 5LEKA 2OQGA 3FBIB 1ZRDA 3C2GA 2K86A 3RZDJ 5JI6A 4AYBA 5DDGA 3CCSI 1D5VA 4I7HA 5JHUA 2MW8A 5F27A 2DA3A 3AAFA 2H94A 2FJ1A 1ON1A 4DZPA 1SFXA 3FHNA 5TJJA 4I0AA 1T38A 5L3CA 3E7LA 4A69C 3QYFA 1ZG5A 3IC7A 1MJAA 1W7PA 3R0AA 2W00A 5KK1A 3DQVC 2QA4I 4BDZA 4LB6B 5IOYA 4N9HA 2LMDA 4HLYA 4BHBA 1ZAOA 4JX6A 1U3EM 3REOA 4BY7J 2E71A 5B5EC 1P2FA 3WTSC 4GGGA 5CVUA 2VJ5A 4AD9A 1YIOA 2COBA 4IX7A 2QF7A 3BQZA 2GXBA 2M3AA 2HPIA 1VQOI 3RYRA 3LSGA 2VL8A 3CCQI 2EFWA 2DMPA 2Y75A 1ONVA 3LFKA 3IRQA 1Z7UA 1I1GA 2GOXB 1YRNB 3GWZA 1I3AA 4E7HA 2HEOA 1MMDA 3HM5A 3ZR8X 2QQ8A 1REPC 2NNNA 2LY1A 1VI0A 2HQAA 2R7TA 4ZTJA 2M0MA 4M3EA 1YOVB 2RGVA 3I0TA 2CQXA 4RM3A 4XRSG 5B1AH 3GEZA 4HYEA 1R7JA 4OWRB 4XL9A 4BAYA 2C6YA 2LRDA 2ID3A 4KN7X 2ZXWH 1V5FA 2XAHA 3WE2A 4L0ZB 2VIXA 4JBAA 3JR9A 4IHWA 5FRNA 4D7NA 2VJIA 2WV1A 2XHKA 4BNCA 2JZYA 1OJLA 1QZYA 1UMQA 2Y0SN 1FJLA 2A6HF 1IGNA 1YG2A 1Z77A 2P7CB 4BJ6C 5K5OA 1LJ9A 2ZJRF 4V2GA 4S0HB 1SVLA 3GLXA 3ABTA 5JLWA 2KZGA 1K83J 4UNOA 3GTKJ 1AKHA 2IPQX 4LITA 1STZA 3MZYA 2X6YA 1U8RA 3EYYA 3PO3J 2JK3A 3CCMI 1PUFB 2F4OB 3GTPJ 2M7AA 3KX2A 2NAZA 3VYTB 3NARA 5BPDA 4MNUA 4UV9A 3W6JB 3WGIA 3WTWC 3AG1H 2I10A 3A2KA 4IF4A 5CQEA 5BQTA 3FKIJ 1Y1VJ 2VQLA 2BBYA 2EZLA 2LVSA 2VT2A 3SFZA 4JOMA 1JI8A 4Y7NJ 4UVCA 2HVSA 1GHCA 4ASNA 2X6WA 3OMYA 5JVTA 5L3GA 1W36D 1JKPC 1A5JA 4XRSA 3SQNA 5E3OA 1Y8QB 4BEHB 1VNDA 1I6XA 2F5FA 3D5LA 2IAIA 2W85A 2KL4A 4S04A 5LHGA 4Q5SF 4PSXA 2QENA 2YUSA 3PSIA 3DKXA 2QBYA 2VKHA 4MEYF 4WF2A 2ZMEB 3ERED 1ACIA 3HTSB 2EFPA 1A04A 1T98A 2FBHA 4NQWA 3J7AO 4U87A 1ETXA 4EJOA 3ZCOA 1Z6RA 4XKBA 1KGSA 3MWMA 3NEUA 4RAYA 2HZDA 4CYCB 2B63J 4ZJZA 4A3JJ 3O8GA 2CS3A 4XSZF 5FLMJ 4A0ZA 2P6SA 2WTEA 1S9HA 2Z99A 2A5WA 3ZQLA 5KHDA 2JQ7A 3HKZA 2EH3A 2JA2A 3K9TA 2NVUB 4J00A 3KZZA 3ABUA 2A3SA 3OYJA 3K7AJ 3LA2A 2LK2A 3OYDA 2IGMA 3M1EA 1O7LA 3FISA 2EJRA 2PMZN 2OTLI 4WXDA 5FKNA 1X58A 2G0EA 1FOKA 3U2RA 3CCUI 2ACJA 3HSEA 3BZCA 5CVIA 3JRGA 1X4OA 2BEOA 4N0BA 4XNFA 4XM3A 3CZ6A 2H1LA 2Q2EA 3WU2C 3KP5A 4CCJA 3BR3A 4LLGF 2G7UA 1DU6A 1L3LA 2F48A 1S7EA 1TWAJ 1V55H 4JX5A 4OIRF 5E17F 3I5UA 5K5QA 1ZREA 5GP9A 5F1JA 5FLXZ 1DDNA 2A61A 1D1CA 2HWVA 1YTYA 1Y6IA 1ZTRA 2UXXA 1I3QJ 4CCNA 4E7JA 3ABMH 1FY7A 1RESA 2WV0A 2L9VA 2VQCA 4IQ4A 1UG0A 2M7BA 5CYVA 4ZDPA 2DI3A 2AQFA 5IY5H 3TEDA 4N9IA 2RAEA 3JRHA 2M45A 1EH7A 1K61A 4KICA 3BR0A 3ZQ7A 5TISC 2ECBA 4A3CJ 2EWNA 4ZYDA 3V8KA 1YO5C 2VC1A 2CSOA 2DJIA 1R1UA 3JAMK 1HA8A 3GBGA 4A6DA 1AU7A 2M34A 2F2EA 4PDKA 2P4WA 5HNHA 3NRVA 3HOUJ 3PIPF 2V1UA 3TMOA 2KPMA 4Q47A 3FMSA 4OOIA 1W36C 3J81K 2GIVA 5IP9J 1HF0A 2LSOA 3PL8A 2STTA 1P7JA 5JVGF 1LNWA 3KP2A 2DLLA 2DCEA 2Q2EB 4KJZA 2HDDA 2QSHX 5LBQA 2CQ7A 1JE8A 2BVMA 1W4MA 3OY9A 3ZMVA 1ETVA 2XB0X 2UZKA 3K0LA 1J09A 2DA4A 2XGEA 2JRMA 2YX7A 2LG4A 3GYHX 1MH3A 3RKYA 4U88A 4HDUA 2GLOA 3MD2A 3I4NJ 3HIFA 3HHGA 1MSEC 5FFZA 4BQAA 1WFXA 3JRFA 1CF7B 4UB8C 3NAUA 4E7SA 4WWCA 1MSFC 5HOOA 4MGRA 4PCQA 3CLQA 1JHFA 1QZZA 4XN3A 1ZKGA 1KYWA 4Y33A 3EUKL 1ZH5A 3GTMJ 2JTVA 4LD5A 2R7WA 4ABZA 1SD6A 1ETYA 1JUMA 3F8FA 4Y52J 1HDPA 2R5ZB 2MG4A 2KKOA 4F55A 1W0TA 3ZRGA 1X1AA 1KA8A 2ZMEA 1HSJA 4CXFA 1JJ6C 2OD5A 3N4MA 3PQJA 4GRIA 2PJRA 1L0OC 4MO7A 3VEPA 1BIAA 4PSWA 3J7YJ 2H1KA 2H27A 1ZN2A 2RREA 2WADA 2VPRA 4BEHA 3UNGC 3B6AA 1XG1A 3OYEA 1MZBA 3GZNB 2K27A 5FROA 1WGXA 5GAEJ 3ABKH 1IN7A 1UHWA 1KU7A 4DYCA 2JN6A 1F1ZA 3OYFA 4XK4A 1EH6A 3TQNA 4C9YA 3LAPA 2AXTC 1R4MB 1IZ1A 1I6HJ 3SXYA 5F0CA 1BC8C 5EZGA 3CTAA 4CA0A 2HKOA 1CQTA 3ECOA 2VE8A 1VQ9I 4XRFA 1FSEA 1QZEA 4FQGA 3LNQA 2O8KA 2L2OA 4I2OA 3BTJA 1FSHA 2NOJB 1QPMA 1K7AA 2XRLA 5J3LA 1K78B 4DJAA 5M3FJ 2LR8A 3V8LA 4PFOA 4D1QA 5FD5A 2CQQA 2MD0A 3FM3A 1TWHJ 1VQKI 3OYKA 3OOUA 3H3UA 1F5TA 3D0SA 3TDZC 1HW5A 2D45A 5BS6A 4DQ2A 1BA5A 4B09A 2DMTA 2VQGA 5D5UB 2E35A 4M6XA 1JHHA 3TW6A 1XDUA 5LRSA 3DTKA 2JVGA 1OCCH 4MIMA 3Q0VA 3S17J 2OC6A 3BY6A 3ZN0A 1BJAA 3VDXA 4CO8A 3H3VK 1R5HA 3RPUA 2P5KA 5K1YA 2HR3A 4CUGA 4EEFG 4HPQA 2JT1A 4A5MA 3S32A 4G7ZF 3I53A 5CKTA 1YQAA 2ADUA 4MQVA 2PI0A 2KIUA 2DFHA 2ZXHA 3LSMA 4AYBN 3ZGKA 2JMWA 4NBQA 1AWCA 1N25A 1Z9CA 3KYLA 3BR1A 3RSNA 3K4CA 1I27A 3HSRA 3VSLA 3Q5FA 4HF2A 3KIOA 4QWQA 2R92J 4IRGA 3ZMDA 3WHBA 4WXHA 2ELJA 2V26A 5E1WA 3GZ6A 1EH8A 1G3TA 3CO7C 4ZH4F 4A3IJ 1MBEA 4IKFA 2IBDA 3BROA 3JREA 1QGPA 4IHYA 2DODA 1W7PB 3FXMA 4PGGA 2M5WA 5D6EA 3ZQCA 4DIQA 3E5UA 4M73A 3K4BA 2HNHA 4BGDA 3IV5A 3HSFA 3HRMA 3R60A 5EEAA 5E3MA 3FZVA 4KIBA 4AIDA 2R4GA 2HZTA 3FXQA 1RRJA 1N77A 4C3IJ 1YJNI 1WQ2A 1IV6A 2QEXI 2QQ9A 1YW8A 1QPIA 2M9HA 2KIQA 4R8HA 4CICA 3C1DA 1BR1A 1A35A 1TNSA 2VJJA 3KEOA 3TW7A 3QWLA 4EQQA 3W6VA 1E2XA 3B6CA 1VF9A 2IA2A 1MNEA 2PQ8A 3ZQFA 4E7IA 1RIOH 2PEXA 5K7HA 1HC8A 3FBNB 3PFYA 4DOZA 1FYMA 1Q1VA 3CDLA 2XB5A 1UHSA 2G9WA 2ZXJA 3WGGA 4CHUA 1GUUA 5IOZA 2HYGD 1VQ8I 3RZOJ 3P9CA 2IA1A 4AC0A 1V54H 3QYEA 2AXLA 2HOEA 1CGPA 2PMUA 1QRYA 2NS8A 2LBFB 4IOAF 4BUPA 3OYAA 5KAFC 2ZMEC 1D3YA 2X51A 2MABA 1SMYF 2R7UA 4ZYEA 1S8NA 2JA5J 1S29A 5HODA 1TBXA 3F8MA 3NWSA 2R5YA 1ZLKA 3LQQA 2X85A 4FISA 3E5XA 2IRFG 4LLLA 3WG7H 3IAS2 3W2AA 4LLNA 5FKOA 1POGA 2COMA 1SVOA 1G4DA 3CF5F 4I02A 4JYKA 3A01B 3M9AA 1XC5A 4F52A 1SD5A 1X4PA 1VQNI 4BH9A 4FX0A 2EK5A 3GW2A 3B73A 4AIJA 3BZKA 2PFBA 1R23A 4U0WA 1APLC 2LDUA 4MHGA 3JRAA 1Z6TA 1S7OA 3DTEA 3C7JA 4UVBA 2DN0A 4NDLA 3ML6A 5FKMA 2XGXA 3FMRA 1NK2P 2DJNA 3IHUA 3NWTA 3I59B 3K2AA 5DYMA 5AIQA 5FD6A 2VB6A 2LH9A 1YJWI 1IJWC 3HOXJ 3AG3H 4NUBA 4P55A 4B43A 1X2MA 2BHYA 1EKEA 2M30A 3I55I 4E7ZA 2V9VA 3AG2H 2RC4A 2GBYA 5IYDJ 1I5ZA 2GZWA 2OU2A 3CCEI 1ON2A 2OZ6A 3SJMA 1WHUA 2OA4A 3G2BA 1RR7A 1TQMA 3QU6A 4HQMA 3GTOJ 2F5VA 4DW6A 3E3VA 1TC3C 3GVAA 5HS9A 1NG6A 1DU0A 2CV2A 4NNJA 5GTHC 1U9OA 5K7ZA 3LA3A 5KCMA 5LHIA 1G6NA 2DO7A 1ZRFA 4DNCA 1BW6A 2RNJA 4GYGA 3CJSB 2K02A 3VYRB 1FMVA 3CD6I 3QAHA 4ITVA 1BR4A 2FU4A 4II3A 1WVRA 1ZLJA 3CJTB 2KDZA 4GO1A 2FE3A 1R4NB 3IUOA 3MKWB 2E1MB 4O5VA 3KE2A 4V19K 4KUMA 3BG9A 3M1CA 5J40A 3E6DA 2NNYA 2E1MC 2MD5A 3L2UA 2YU9J 4Y13A 4AIHA 2ZFWA 3ZPLA 3R0JA 2A68F 2E1OA 5ERIA 4D5CA 4B4CA 2I5UA 1SFUA 3RYPA 3DP7A 2Z1DA 2OJED 3ZOBA 1Z7LA 2EA2A 4QSHA 2L5QA 2XAJA 1ORKA 2HXIA 1FP1D 4C3HJ 1P92A 4MTDA 1T39A 2FF4A 2M4KA 1OR7C 3K6GA 5IT9K 3G1MA 1OISA 2JSCA 1BM9A 4E6KG 1ZHFA 2W7NA 1WCMJ 4WXCA 5EG0A 4KIGA 3DTIA 3CO6C 4OMZA 5ILUA 1HW2A 2L54A 1KU2A 4FE4A 1VQ5I 2X1EA 2FD5A 1TL8A 3HB9A 2VXDA 1Z67A 3H36A 3PNTA 2E7WA 3DU5A 2F5CA 3W2WA 1ITYA 4EATA 3AL0C 4ESFA 3SZPA 1ETKA 4B47A 4Z6YA 3I59A 3JSOA 2EV0A 4LB5A 3S14J 4G6TB 2JVHA 3V7SA 1K6OA 3MKZA 2LLKA 1J2XA 3FXKA 2Z3YA 5J1UA 1R58A 3CDIA 3FX3A 2ESHA 2FNAA 2UV1A 3WTVC 1WJDA 3OYIA 2MGQA 2HQRA 2Y0MA 2X0LA 1G2HA 4A5NA 2P0WA 2WC2A 4F92B 2H6CA 4X6AJ 2OQRA 1XD7A 2YR2A 3MEXA 2DA7A 1MMNA 3A01A 2KFDA 2ME0A 5GAGJ 2IS1A 3F3XA 3LSIA 1MDMB 5IT9Z 1T2KA 4FE7A 1D1BA 2V1NA 3FWEA 5AIPA 3RJPA 2YPRA 5LGUA 5LFAA 4OAYA 5L3DA 2QSGX 2VKVA 2V79A 1D5YA 4EGZA 2L9RA 3ROUA 3CMMA 4W97A 4BE0A 4KITB 3L2VA 4IZZA 1OR7A 2IJLA 1FEXA 3H92A 2KIMA 1FTTA 2LBFA 2DOEA 1T33A 4JX4A 3H3ZA 4A3MJ 3S3MA 2PN6A 1A6QA 4G7HF 3H9JA 3QODA 5F0FA 3IKVA 5B1BH 2CW8A 2FBKA 3L2CA 4RMNA 3M8FA 1QNTA 4KT6A 1LFBA 4LIUA 5KVRA 4BACA 3K1NA 4UB6C 3JRIA 1X3UA 2XPVA 2NVTJ 1RR8C 2AO9A 1BI0A 1BBYA 1WJ5A 1OCTC 3IRRA 2VKDA 1RI7A 4HSTA 1P7IA 5DUIA 1KQ8A 1RNLA 1B72A 4L9VA 3HPGA 2PJRB 2MLKA 3HOYJ 1ETOA 5JFRA 4A3KJ 1LFUP 2JWTA 3PM1A 4L5EA 2R5ZA 2MH2A 2WAEA 1SAXA 1OCRH 2Y2ZA 4RAZA 2CU7A 3QU3A 2DT7B 4PJMA 4BDYA 2L7FP 2JUGA 3EETA 1YS6A 3KYDB 3IH2A 1T6SA 2DTZA 4C2TA 1HSTA 2EILH 2G7HA 4FCYA 2K9LA 5E8GA 1PJRA 1U5TB 1XCBA 3DXJF 2DPUA 1D0ZA 1SAUA 1CF7A 5EGOA 1PP8F 5E3NA 4D0PA 5ICFA 2JUCA 1U78A 2OF7A 3WU0A 3K1PA 1WJBA 2RKHA 2JA8J 4M72A 2QQAA 3BOQA 3S15J 3S93A 3BTIA 1A6IA 2EQRA 1B9NA 4YFKF 2ZJQF 1FTZA 4G94A 2ZJPF 1R6RA 2DT5A 3ONQA 2M4GA 1TQIA 4XKWA 2VN2A 2L0KA 3ESWB 4JQFA 4ENJA 3OSGA 1Y0NA 1RETA 1DPRA 2MC3A 3GUDA 4EVIA 4RGSA 3T1BA 3U1KA 2JSPA 2RQPA 1DP7P 3K4JA 3TDUC 4BQQA 2FUG2 3CC2I 1D0XA 3J80Z 3RI4A 1SANA 4MTEA 5L3BA 3GFIA 2VONA 1OCPA 2CUJA 5J4YA 3TBIA 1QHGA 4HW0A 1E17A 3KZIC 1USTA 2O9LA 4IQJA 4LJZF 4U0YA 2L4MA 3W6KB 3DPTA 3F0CA 2VUMJ 1DPUA 3ELKA 2KHMA 5DTDA 4BJTA 2V6CA 1EV7A 2Y9ZA 3ZMZA 3QP6A 1YHQI 3HPHA 2MLGA 3KLNA 4L5IA 5FLVA 1HQCA 2K85A 1O3RA 1IN4A 3B02A 3P9KA 3WE3A 1X1PA 1RKTA 3OWTA 2P7VB 5CPRB 2WAQA 5EEGA 2LF8A 1LUJB 3OSFA 4I99C 3BPVA 2RN7A 2LYCA 5FKLA 2XKOA 3MKLA 3X2QH 5B66C 1BI2A 5J1RA 5C44J 1GLNA 2RNGA 1P4WA 5M5WJ 5D5VB 4HRIA 2CRGA 1JKOC 2JA6J 3LSRA 4HG2A 1RUNA 4UY8I 1K78A 3LSPA 4IRHA 2DU9A 5F08A 1IG7A 4NC8A 4G12A 1WJCA 1DP3A 3GTQJ 4EJVA 1V3FA 3VB2A 3W3CA 5HS7A 3G3ZA 5HVQC 3KCCA 3O2PE 2KMUA 5DM6F 1ZG3A 2JPBA 4YELA 4CCOA 1IUFA 1R22A 5E8IA 1PP7U 5LGTA 4CGZA 3L2QA 5J47A 4M3FA 5M3MJ 4QPOA 3J81Z 2MYSA 2PX9A 2QM3A 2W48A 4UV8A 2XSDC 5D5WB 2DA1A 2E1CA 1ZR4A 2L4AA 1OYWA
chains in the Genus database with same CATH topology
2OTJI 1VQOI 3CCQI 1VQ5I 3CCLI 1S72I 1VQNI 3CMEI 3CC7I 2JQ7A 3J7ZI 3PIOF 2ZJQF 2ZJPF 3CC4I 1YJ9I 3CCVI 5GAHJ 1VQ6I 2OTLI 5DM7F 1Y39A 1YI2I 3CCUI 1YJWI 2E36A 1VQ7I 4IO9F 1FOWA 1FOXA 3J7YJ 3CC2I 3G4SI 5GAGJ 3CJRB 2FOWA 3I55I 5GAEJ 1VQLI 2H8WA 1WIBA 3CCEI 5GADJ 3CCJI 2ZJRF 1MMSA 1YJNI 2QEXI 1YHQI 1VQPI 1VQ9I 3CJQB 3CCMI 2E34A 3CJSB 3G71I 3CD6I 3CMAI 1VQ4I 3EGVB 1YITI 1HC8A 3I56I 3CJTB 3G6EI 4V19K 1VQKI 3PIPF 1VQ8I 4UY8I 3DLLF 3CCSI 1YIJI 1QA6A 5JVGF 2E35A 2NXNB 4IOAF 2K3FA 3CCRI 1VQMI 5DM6F 2QA4I 1ACIA 1FOYA 4IOCF 3CF5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ I;  1VQO I;  3CCQ I;  1VQ5 I;  3CCL I;  1S72 I;  1VQN I;  3CME I;  3CC7 I;  2JQ7 A;  3J7Z I;  3PIO F;  2ZJQ F;  2ZJP F;  3CC4 I;  1YJ9 I;  3CCV I;  5GAH J;  1VQ6 I;  2OTL I;  5DM7 F;  1Y39 A;  1YI2 I;  3CCU I;  1YJW I;  2E36 A;  1VQ7 I;  4IO9 F;  1FOW A;  1FOX A;  3J7Y J;  3CC2 I;  3G4S I;  5GAG J;  3CJR B;  2FOW A;  3I55 I;  5GAE J;  1VQL I;  2H8W A;  1WIB A;  3CCE I;  5GAD J;  3CCJ I;  2ZJR F;  1MMS A;  1YJN I;  2QEX I;  1YHQ I;  1VQP I;  1VQ9 I;  3CJQ B;  3CCM I;  2E34 A;  3CJS B;  3G71 I;  3CD6 I;  3CMA I;  1VQ4 I;  3EGV B;  1YIT I;  1HC8 A;  3I56 I;  3CJT B;  3G6E I;  4V19 K;  1VQK I;  3PIP F;  1VQ8 I;  4UY8 I;  3DLL F;  3CCS I;  1YIJ I;  1QA6 A;  5JVG F;  2E35 A;  2NXN B;  4IOA F;  2K3F A;  3CCR I;  1VQM I;  5DM6 F;  2QA4 I;  1ACI A;  1FOY A;  4IOC F;  3CF5 F; 
#chains in the Genus database with same CATH topology
 3F8C A;  1F36 A;  1R9T J;  1J9I A;  2BW3 A;  4B3X A;  4LG3 A;  2FSW A;  1G8X A;  1J59 A;  1FWZ A;  1S72 I;  3PNY A;  3DBL B;  1YYV A;  3T5X A;  4NQW B;  2YS9 A;  5IYB J;  4ZZL A;  2WAF A;  2HVR A;  1OYY A;  3K4K A;  2R3S A;  1TQP A;  1H9T A;  4EM1 A;  3S16 J;  1E0E A;  3VSK A;  2WBM A;  3QPT A;  3F22 A;  1KON A;  1F4K A;  2BW3 B;  1FPQ A;  2IA0 A;  4EM2 A;  2IGO A;  3C2H A;  2HPM A;  2DFF A;  3A0H C;  1XTA A;  4QLC U;  4IPA A;  3JRD A;  5DEQ A;  1XMK A;  1LB2 A;  4CCM A;  4IL6 C;  1X3W B;  4A2U A;  4IHT A;  1A36 A;  4PFP A;  4AU7 A;  2BY0 A;  2FBI A;  3BR2 A;  3HDD A;  1G3W A;  2BYV E;  2KRF A;  4ZDL A;  4KFC A;  4UUV A;  1S6L A;  5F1R A;  3BC8 A;  4MQ9 F;  2CW7 A;  2MFZ A;  1NHA A;  4XN0 A;  2E7X A;  2F4I A;  5K5R A;  2PG4 A;  2AHQ A;  3GTG J;  4KNY A;  1VFC A;  2V1D A;  4J19 A;  1I50 J;  5EDN A;  9ANT A;  2LFB A;  2HQ5 A;  3GZ5 A;  2DOA A;  2XAG A;  1IC8 A;  4A3F J;  1FNN A;  3TP0 A;  4EM0 B;  1JUS A;  1MD0 A;  3IH3 A;  5CVR A;  1YIT I;  2P81 A;  2X1C A;  1JJ8 C;  2GXA A;  3BCB A;  4A3D J;  2Y9Y A;  2EV6 A;  3L2R A;  2Y69 H;  2E2J J;  4BBS J;  2X1D A;  2FXA A;  3O8H A;  2IGN A;  3CQZ J;  4RM2 A;  2VBY A;  2VBW A;  2FQ4 A;  3ZQI A;  3MCZ A;  1M1E B;  1W5C C;  1ZYR F;  4XQF A;  2Q8K A;  4ZZD A;  4PUS A;  2DPD A;  3I3L A;  3E1S A;  1X1D A;  1QA6 A;  4XLH A;  4C2U A;  2KQR A;  5H6Q A;  1KYZ A;  2OZU A;  1X19 A;  3CUQ A;  3LL7 A;  4B3A A;  5L3F A;  2R93 J;  4C30 A;  3WTZ A;  1GVJ A;  1ZGW A;  3QOP A;  4A3L J;  4YG2 F;  2ZB9 A;  3J80 K;  1QVT A;  4MFD A;  5HLH A;  5H20 A;  2DMQ A;  2QYO A;  3K4N A;  3BG3 A;  3KP7 A;  2L9S A;  1T56 A;  5HDK A;  5M5X J;  3IL2 A;  4IHV A;  2NVQ J;  1YS7 A;  2R7V A;  1YRN A;  2XAF A;  1P4X A;  2CH0 A;  1FOY A;  3KP6 A;  4RGR A;  3K70 C;  1F9N A;  4XLF A;  5FKK A;  3RKW A;  2OTJ I;  1XSD A;  2NRA C;  3HBL A;  4RAG A;  4AIK A;  2O0Y A;  1LFP A;  3DU6 A;  4A3E J;  4HF0 A;  3OIO A;  4AWX B;  3BG7 A;  3H9G A;  2R7Z J;  3CMY A;  3T8R A;  1O4X A;  1K4S A;  1MKM A;  5E79 C;  1P4A A;  1IRX A;  4A12 A;  2XF6 A;  3WG9 A;  4G9Y A;  1ETQ A;  4ESJ A;  3IWF A;  2J5P A;  2YU3 A;  5DV5 A;  3WTY C;  2WY7 Q;  1U5T A;  5KAI C;  1HXD A;  5DCM B;  3JRC A;  4HZF A;  5D4S A;  4CCK A;  2K7L A;  4RGX A;  3OIQ A;  3KPH A;  1E3P A;  4CYC A;  1EJ9 A;  2QCO A;  3ULQ B;  2L02 A;  3G4S I;  5HLI A;  3HL2 A;  1T95 A;  1B9M A;  1D1A A;  4D9J A;  3RKX A;  5A2Q Z;  1X1B A;  2DA5 A;  4FET A;  1TLH B;  2EB7 A;  4P5O A;  1WIB A;  1ZR2 A;  2YSR A;  2ZKZ A;  1MMS A;  2HS5 A;  2BV6 A;  1W1W E;  2OCC H;  5ED4 A;  2EIM H;  4DGW B;  5ICG A;  4G6Q A;  3BJ6 A;  2IP2 A;  3LA7 A;  4M9Z A;  3J7A Y;  3ZN1 A;  1ZGA A;  3DV8 A;  2E2I J;  4MEX F;  1KU3 A;  2EBI A;  3HEF A;  1IN5 A;  4M9X A;  1WJE A;  3OYH A;  4OIP F;  3F9K A;  1YE9 A;  4B48 A;  5FLX K;  4HOB A;  1TTY A;  1IXC A;  3ECH A;  3HGG A;  5B3S H;  1MND A;  3LST A;  2Q1Z B;  4XSX F;  1BR2 A;  1YW9 A;  3FK7 A;  2N8G A;  2K4J A;  3DKY A;  3KET A;  4ZTF A;  4XLE A;  2DK8 A;  3L1P A;  4FHT A;  1H0M A;  2QGU A;  5LHH A;  3FMQ A;  3JRB A;  2CJJ A;  2EIJ H;  2V9K A;  3JTG A;  3M7G A;  1N78 A;  4DBR A;  2DYS H;  5A2Q K;  1T0F A;  1RC9 A;  4LK0 F;  2FOK A;  3P7N A;  3FXO A;  1PUF A;  1E3O C;  4FAS D;  1ZAR A;  3HXL A;  3U9G A;  3K2Z A;  1G3Y A;  5H2F C;  2NXN B;  1XCV A;  3LSH A;  2EV5 A;  3QOE A;  5GPA A;  3V7C A;  3ZQG A;  3CCR I;  1AOY A;  2AQE A;  2M1B A;  3CLO A;  1AKH B;  1ETW A;  3OS0 A;  5H6R A;  3RTR A;  4BHP A;  2FQ3 A;  1XN7 A;  1MDM A;  2ISY A;  4KIF A;  1IRG A;  2O5R A;  1D8J A;  1HW1 A;  2M87 A;  3OYN A;  1ZK8 A;  2DMN A;  2KLO A;  4I76 A;  4HV6 A;  3S3O A;  1XGO A;  2IGK A;  1FMW A;  1J5Y A;  2W4S A;  4AUX A;  2L9N A;  3IP4 B;  1TZL A;  2JA7 J;  1QHH D;  3S3N A;  4BYY A;  3H5A A;  1ZG1 A;  3RPU D;  4E7K A;  5BOX A;  3DKW A;  4HX4 A;  1H8A C;  5D6F A;  3SDG A;  1I39 A;  2STW A;  3O3K A;  2VI6 A;  2R7Q A;  5J6X A;  2HDC A;  4BE1 A;  3D5S C;  3J7Z I;  5EF6 A;  2D5V A;  5TRD A;  3EUH C;  2ELH A;  1P6R A;  1Z05 A;  1T0F C;  4UUT A;  1BOA A;  4R79 A;  3MMY B;  2Z33 A;  3CCV I;  2DK5 A;  2L01 A;  1GVD A;  1OCO H;  1IRF A;  4BBR J;  4HQE A;  1Y39 A;  1S7A A;  4F93 B;  4XIC A;  5EG0 B;  3NQO A;  1LKX A;  2E36 A;  2RV8 A;  1EF4 A;  4Q4Z F;  3F21 A;  3EPZ A;  4A0X A;  2E5Z A;  1JGG A;  3QRF F;  3S1M J;  4M9S A;  3OYM A;  2OUM A;  2PMH A;  1T08 B;  3IAM 2;  4HNU A;  3EUH A;  2IVM A;  4EJW A;  2ELK A;  2L7M P;  4IHS A;  3V8J A;  4PJ0 C;  2GA1 A;  1JTX A;  4XR6 A;  1UAA A;  2IW5 A;  2LOO A;  4RB3 C;  1YFH A;  4HV5 A;  1VZ0 A;  4C3J J;  2HI3 A;  3OYG A;  3S8P A;  1IN8 A;  3G73 A;  1BN5 A;  4I98 B;  2Y31 A;  3RPQ A;  3S2H J;  4RLQ A;  1R71 A;  2O8X A;  2Z9O A;  2IS4 A;  2F5D A;  2ZJ2 A;  4I01 A;  4F3Q A;  1B8I A;  3Q3S A;  5HLG A;  2P5V A;  4YRV A;  1U9N A;  2KJB A;  3A1Y A;  3DFG A;  1SFO J;  1GXP A;  3A03 A;  2ID6 A;  1S3J A;  2XRN A;  4BQN A;  3Q0W A;  2P8T A;  2CQK A;  3RIR A;  4EMS A;  4L5J A;  2V6E A;  2O6G E;  5D5X B;  2HFH A;  2ETH A;  1ULY A;  2QSF X;  3JTH A;  4EJU A;  2DQR A;  1UB9 A;  4CCL A;  5LRR A;  3R4K A;  1IF1 A;  2XIG A;  3BCA A;  3ZXS A;  1MH4 A;  1OLT A;  2R7D A;  1TWG J;  1Z91 A;  3JSP A;  2CUF A;  2HKX A;  2PLY A;  1UZC A;  4FTH A;  3M8J A;  3K70 D;  1VQM I;  2PMZ A;  4WCG A;  1YLF A;  3COA C;  4UUS A;  3BP8 A;  1WZ2 A;  4ON0 A;  5DCF A;  1R5G A;  1ZQ3 P;  5DD8 A;  4F91 B;  3DEU A;  2XAU A;  1FP2 A;  2M8E A;  2XGC A;  1DQU A;  3HOZ J;  3GFJ A;  3VOD A;  3RCO A;  4RBO A;  1P9Q C;  2CUE A;  4II2 A;  3HG9 A;  3CF2 A;  4LOC A;  4YFN F;  1IDY A;  3P9I A;  1Z3Y A;  3OR1 C;  3CP2 A;  1SFE A;  4D5F A;  1WI9 A;  5FO5 A;  2HDW A;  4RAF A;  3DF8 A;  1QU3 A;  3VFZ A;  1ERD A;  1RKW A;  3PUB A;  2W25 A;  5ILS A;  4XBF A;  2TDX A;  3TO6 A;  4CZZ A;  5DS9 A;  1R00 A;  1YI2 I;  3CDH A;  3LOC A;  2BHZ A;  3WTU C;  1SFK A;  2B0L A;  3GX4 X;  2DT6 A;  3QPL A;  1YX5 A;  5E18 F;  1O57 A;  1TP4 A;  4QTR A;  2R5Y B;  3PJR A;  2X6O A;  1B6A A;  4XLC A;  2L7K A;  3OYL A;  2XKP A;  1U6G A;  3MVP A;  5ICC A;  2DBB A;  1LVA A;  1QO0 D;  2EPF A;  1Z3X A;  3CP8 A;  4ENK A;  4IXA A;  3S2D J;  1R49 A;  2KJC A;  3EDP A;  2ISZ A;  4AVZ A;  2LC2 A;  1G3S A;  1S5L C;  2E19 A;  3JAM Z;  1MMG A;  2K40 A;  2WAQ N;  5IT3 A;  1B59 A;  3OS1 A;  2HOT A;  3BPX A;  2OAZ A;  4E70 A;  2BXZ A;  4A6E A;  2W84 A;  3IKT A;  3GTL J;  1WH5 A;  4JK1 X;  3G1O A;  2ZSH B;  2HOS A;  2BGC A;  4LIV A;  1JT0 A;  4A3B J;  4KDP A;  2CV0 A;  4Y3O A;  1WWX A;  3I56 I;  1RZ4 A;  4B1R A;  3HOV J;  2HTS A;  5JR3 A;  1LQ1 A;  2W1O A;  3SYT A;  4XOP A;  1JXS A;  2VKE A;  2QVO A;  4ANJ A;  1LVK A;  2QUF A;  3H0G J;  1J75 A;  3HKZ N;  4ZYH A;  2FRH A;  4BS9 A;  1W0U A;  3VYU B;  1Z21 A;  2ZO4 A;  5D4R A;  3ASO H;  1IV8 A;  2BXY A;  2HGC A;  3WHC A;  1AHD P;  1X2N A;  2VOD A;  5DD4 A;  2XV4 S;  3BLY A;  5CVV A;  2P6T A;  4PJN A;  5F04 A;  3L7W A;  3U21 A;  3LAJ A;  2MSY A;  3GF2 A;  2NVX J;  1LEA A;  5CQG A;  2NS0 A;  3E6M A;  3JCU C;  5DCM A;  1HKQ A;  1H9G A;  3AKZ A;  2OCE A;  1LDK B;  3M8E A;  4WK8 F;  4IJA A;  3UR3 C;  3MKY B;  4GCV A;  4IOC F;  1FBQ A;  3FF5 A;  2LY9 A;  4ENN A;  4LMY A;  4D7M A;  2A6T A;  1KQ0 A;  5FB2 A;  1JKQ C;  3I4P A;  2FEZ A;  3FKJ A;  2K3P A;  5HLT A;  3F23 A;  4BQO A;  2E5N A;  3ZMU A;  3MFK A;  3CME I;  2DFI A;  3BR6 A;  1BJZ A;  2DMU A;  3BDD A;  3LWF A;  4RLF A;  1BL0 A;  1LPQ A;  2DW4 A;  5F6F A;  4KMF A;  3ZP5 A;  1ZEL A;  5GAH J;  4ZDO A;  4A3G J;  1B1B A;  2HQN A;  3Q9V A;  3EQL F;  3BTC A;  1K4T A;  4XKC A;  3CUO A;  4GXO A;  4L9N A;  4NC6 A;  1RUO A;  1MIJ A;  3Q9S A;  1WRJ A;  3CUQ C;  1KZH A;  3F8B A;  4IO9 F;  4J01 A;  2KIS A;  1U2W A;  2M8G X;  3H1C A;  2EFQ A;  3CUQ B;  3F8N A;  2MA3 A;  3WGH A;  2O61 A;  3PQK A;  2BY2 A;  1ZGJ A;  1V5E A;  4G8X A;  1H89 C;  3OS2 A;  3TO7 A;  1MMA A;  2W57 A;  1Y0U A;  2RDP A;  5IP6 A;  3C18 A;  2CMP A;  2NOG A;  2Q0O A;  4IRI A;  2IS6 A;  3FM5 A;  5GTI C;  3TGN A;  3O6B B;  3AG4 H;  1NTC A;  2Y30 A;  2R7R A;  1DGR M;  1V4R A;  4XLA A;  1X1C A;  4OIO F;  4ETS A;  2O03 A;  3LSK A;  5CLS A;  4XOT A;  4DYR A;  5BPI A;  1W7P D;  1U0J A;  4UVA A;  1IXS B;  2E1N A;  1QVU A;  1KQ9 A;  1VQ4 I;  2LF7 A;  3EGV B;  3S1R J;  1YW7 A;  1XX5 A;  2DDA A;  3LMM A;  3SEQ A;  4CSW A;  3PO2 J;  1OYI A;  2DTR A;  2ME6 A;  3MAJ A;  2CFO A;  5KNL A;  2BY3 A;  2QZ8 A;  4CZC A;  4H4K C;  1WH7 A;  2XRO A;  1FC3 A;  3GFL A;  1YX3 A;  2GWR A;  4PZJ A;  2L7Z A;  4XOR A;  2NS7 A;  2DOF A;  1FYL A;  1YIJ I;  3HC7 A;  3LFU A;  2QQB A;  2R7O A;  4PGH A;  3BJO A;  2NYX A;  3TL4 X;  2AS5 F;  3BT9 A;  3HUG B;  4OMY A;  4L0Y B;  1B4A A;  2EFO A;  2VC0 A;  4P96 A;  3V42 A;  2KP6 A;  3OL4 A;  3MZH A;  3DPL C;  3BZ6 A;  2WA0 A;  4U0V A;  2LNB A;  3S2W A;  2CGP A;  4PJJ A;  5E1Z B;  2VJ4 A;  4HDV A;  3TOA A;  2CUZ A;  1BI1 A;  2VOO A;  4XON A;  4EV0 A;  1MBK A;  3WOD F;  2Z2S B;  4I6Z A;  2GQQ A;  2ZXI A;  4UHT A;  2VBZ A;  1TW3 A;  1XS9 A;  4QIW N;  1LE8 A;  1UFM A;  1XDS A;  3FIW A;  3OV8 A;  4EGY A;  3BTL A;  3SDB A;  2R0Q C;  3OL3 A;  3GLL A;  2LKP A;  1WKM A;  2R7F A;  1UJ8 A;  1TT0 A;  2KRC A;  4RB1 A;  3A4C A;  2V9P A;  3H9Q A;  2W24 A;  3DLA A;  2ZFU A;  2K4B A;  1YJ9 I;  3CC4 I;  3L09 A;  2VOP A;  2I8D A;  2H6B A;  2K9M A;  4KYW A;  2EZK A;  5F64 A;  1R1V A;  4Z2Y A;  1WI3 A;  2A6E F;  4P1W A;  1BIB A;  1IO2 A;  1TNT A;  4HAM A;  1AA7 A;  3ZQQ A;  1VQ7 I;  2Y0S A;  1ODD A;  3H0D A;  3E5Q A;  3I64 A;  4ZC3 A;  3GFM A;  5HDN A;  1FOX A;  4M74 A;  4O6J A;  4KT5 C;  1SD7 A;  2EFN A;  5BNG A;  3T0Y A;  3OYB A;  5C4J J;  2ICW G;  4Q48 A;  2CG4 A;  2VBX A;  2H8W A;  3AL0 B;  2ZBK A;  5FFX A;  3RKQ A;  1IDZ A;  2LY2 A;  1XSX A;  5LD2 C;  3M3Y J;  4DBQ A;  2WWY A;  4ZYA A;  5FGM A;  3QQA A;  3KP3 A;  3CJQ B;  2R7X A;  2X48 A;  1FYK A;  4DYQ A;  3BWG A;  3HRT A;  1XMA A;  4BJ5 C;  2E34 A;  3VOE A;  3E6C C;  1QBJ A;  4EJT A;  2VQH A;  2KIF A;  5J8F A;  3EYI A;  4XRM A;  3JW4 A;  3G71 I;  1DUX C;  4GDF A;  3CMA I;  4JP0 A;  5J4V A;  2CWE A;  3AFH A;  1IXR C;  3K4M A;  2VT3 A;  1IW7 F;  1I1S A;  2XUB A;  3KEY A;  4HEA 2;  3HRS A;  3KYC B;  4NC7 A;  2ESN A;  2ZSI B;  4OIQ F;  3ZMS A;  4AVP A;  2GM4 A;  2JRT A;  3D1N I;  2VLA A;  3P5J A;  3DLL F;  3TKY A;  3ISP A;  3SZG A;  3LQR A;  3R6S A;  5ICE A;  1K79 A;  4HX8 A;  1J0R A;  3RQI A;  2V7F A;  2VXZ A;  1SVM A;  5LEJ A;  2E2H J;  3MZ8 A;  4CH7 A;  3BQY A;  2DAO A;  2M0C A;  2DDB A;  3I71 A;  4LK1 F;  2HYF A;  2K3F A;  4BY1 J;  4HNV A;  2V1X A;  2IS2 A;  4L9J A;  4UXN A;  2GA2 A;  2R7S A;  3DBH B;  1ENH A;  5M5Y J;  1JKR C;  3HYI A;  3BJA A;  3SFI A;  4IEJ A;  2H09 A;  4C2M J;  5JLX A;  2HVQ A;  3FK6 A;  4Y4R A;  1MNM C;  4M71 A;  2EIK H;  3BR5 A;  1LDJ A;  3DPU A;  1E3H A;  3K69 A;  2YX4 A;  2GAU A;  3GXO A;  4M3B A;  4AM3 A;  1HDD C;  3I4M J;  4S05 A;  1GDT A;  2K9Q A;  3E6B A;  2XPW A;  4ENM A;  2MH9 A;  2FA5 A;  2P5L C;  1UHM A;  3GCM A;  2XDV A;  4GYI A;  3F72 A;  3UKG A;  4M6Y A;  3FXJ A;  1FLI A;  4PK4 A;  1TWF J;  2BVL A;  5EGO B;  4M3D A;  3HTU A;  4P9U A;  1OCZ H;  4IVN A;  2O3F A;  1R36 A;  3ASN H;  2X4H A;  2DFE A;  1XPX A;  3ZMT A;  2EIN H;  2WB1 N;  1XGS A;  2VAS A;  4K2E A;  4U7D A;  1IAW A;  5TGT A;  3L2W A;  1HCR A;  4HF1 A;  3E0J B;  3L00 A;  3K4L A;  2X9D A;  1USS A;  1Y8R B;  3IH4 A;  2EZH A;  4V2F A;  3MN2 A;  2XAQ A;  1LE8 B;  3PFI A;  3M4O J;  4Y15 A;  1SC7 A;  3BG5 A;  2CO5 A;  3PSF A;  4BXF A;  1G59 A;  1FIP A;  1D8K A;  4I09 A;  1O3T A;  2QBY B;  1B72 B;  1XGM A;  4OU0 A;  1K6Y A;  1T8I A;  1MBF A;  2CFX A;  1IRZ A;  2XGD A;  2L3D A;  3W2V A;  1UEL B;  4N4N B;  3CCJ I;  5HS8 A;  3TOB A;  5ILV A;  1OFC X;  1R1T A;  4G7O F;  2ECC A;  1FT9 A;  1FBU A;  4OIN F;  2HU9 A;  1KU9 A;  2EA4 A;  2RQQ A;  3T8T A;  4BXU A;  1Z0X A;  1VQP I;  4HSR A;  3GTJ J;  3QPH A;  5FRM A;  2FNP A;  3CCY A;  3ABL H;  3HUG A;  4PJL A;  3WTT C;  3BG6 A;  1ZRC A;  3KP4 A;  4L18 B;  3TO9 A;  4X0G A;  5CVJ A;  5GPC A;  3DEW A;  3DEE A;  2BY1 A;  3PNV A;  4IHX A;  5L3E A;  2A5Y B;  3PUF A;  1GV2 A;  3F6O A;  1FZP B;  4NHJ A;  5AON A;  5J1Y A;  2PJP A;  1JUP A;  2XAS A;  2HOA A;  2OBP A;  4LFU A;  2KDO A;  1MBJ A;  4XMY A;  5EYR A;  3H5N A;  1W5S A;  3KLO A;  2EZI A;  1XGN A;  3RQ4 A;  1PDN C;  2JPC A;  3VWB A;  2BE5 F;  1GXQ A;  3K1M A;  3R61 A;  1HKT A;  3CJN A;  3DCF A;  4YFX F;  2JJ7 A;  2K9N A;  1OPC A;  2DQL A;  2F4M B;  4XLP F;  1GV5 A;  4MFE A;  2WB1 A;  2QKL B;  4CDG A;  3SHF A;  2K9S A;  5E20 A;  2B9S A;  1SMT A;  4O3M A;  3I9V 2;  1V5G A;  4KA4 A;  2Z5U A;  5IP7 J;  1GT0 C;  2OPT A;  4FX4 A;  2CV1 A;  3FHZ A;  2OV7 A;  4P9F A;  1X3Z B;  4QPQ A;  4BE2 A;  3KFW X;  3QYB A;  5D8K B;  5HNF A;  2IXS A;  1VTN C;  2BOL A;  3OR2 C;  5EEH A;  4RB2 C;  2PBI A;  1PVE A;  1U5T C;  2CQN A;  3D5R C;  3Q0U A;  4RA2 A;  5K7F A;  3HOT A;  1MW7 A;  3U1D A;  1O7F A;  2LKS A;  3CC7 I;  1FIA A;  1HLV A;  2HYJ A;  4I0B A;  1BW5 A;  3PIO F;  1OQY A;  3SZT A;  3OYC A;  4RS8 A;  2E60 A;  1VQ6 I;  3G1L A;  1QQI A;  2X6X A;  2O7O A;  1H88 C;  4YIF A;  3CES A;  3L9F A;  3V7R A;  2KRH A;  1NK3 P;  2DA2 A;  4YEJ A;  2CYY A;  1FX7 A;  2D1V A;  2XF7 A;  5D8L B;  4W1U A;  3VYS B;  4FT8 A;  2D2W A;  3F6V A;  3ERM A;  4KMU X;  4HX7 A;  2QKM B;  1R5I D;  5IPA A;  1D0Y A;  1PYV A;  3GME A;  2K5C A;  5GAD J;  2H8R A;  6PAX A;  1NG7 A;  2MBF A;  4OAZ A;  2XF5 A;  1XSV A;  2HTJ A;  3S1Q J;  1TW2 A;  1B8I B;  3MQ0 A;  5EZH A;  1C0W A;  1OKR A;  4HLX A;  3S1N J;  1IUY A;  2A07 F;  1NH3 A;  2TCT A;  2M2E A;  2XPU A;  3HHH A;  1HOM A;  1WJA A;  4HBL A;  3I58 A;  2GIZ A;  1XMX A;  1Y56 A;  1WJF A;  4M6V A;  2WY8 Q;  5E3L A;  3VPR A;  3OOP A;  5BMZ A;  2J5O A;  4G6D A;  4LG0 A;  3N05 A;  3HJE A;  1RPW A;  3IWZ A;  4E7L A;  3WTX C;  1LEB A;  4NB5 A;  2B7E A;  2Y48 A;  3DBR B;  4RGU A;  4E4H A;  2QWW A;  3H35 A;  2VE9 A;  2MC4 A;  3GO5 A;  1N75 A;  4BU2 A;  2TRT A;  2ZNY A;  4XLN F;  3E97 A;  1MGT A;  2RVC A;  1SD4 A;  3KEQ A;  4RDU A;  2LD5 A;  1EA3 A;  3RDI A;  3HGY A;  4LGW A;  2VPL A;  4BXX J;  1MJB A;  3FXU A;  1A31 A;  4TV7 A;  4BHC A;  1W5T A;  4DZJ A;  1UCR A;  3FXL A;  5EJC A;  4F7Z A;  2LRE A;  2UUZ A;  2XC7 A;  2FX0 A;  2ZC2 A;  5DUK A;  2LKX A;  3K10 A;  3QP5 A;  1SEU A;  4CYD A;  3ZQH A;  2BZT A;  1O3S A;  3SEZ A;  5C3E J;  5JHF A;  4YII A;  1Q1H A;  4B44 A;  5C4X J;  3CCL I;  2IEK A;  4YIR X;  3HRU A;  4A93 J;  2XVC A;  1MBH A;  3C3W A;  1Z1D A;  1BI3 A;  2LTP A;  4HNT A;  3WU1 B;  1O3Q A;  3KZY A;  1TWC J;  1XB4 A;  4RB0 A;  4XID A;  1BOB A;  2CW0 F;  1JGS A;  3EUA A;  5LLQ A;  3HOS A;  2DYR H;  2KT0 A;  2F6C A;  4ZYG A;  2DXI A;  2A69 F;  2UXN A;  3A02 A;  5HDG A;  1F43 A;  5DM7 F;  1HKS A;  2FMY A;  3C2B A;  3TP3 A;  2ZNZ A;  2LP0 A;  5J8C A;  1FOW A;  1IN6 A;  5CJ9 A;  4U7B A;  5E1X A;  1WSU A;  2IT0 A;  2UWM A;  4X1E A;  5F0H A;  4H0E A;  4KN4 X;  1DGW Y;  2HXO A;  3CJR B;  4WX9 A;  2FOW A;  2NVY J;  1JTY A;  3N97 A;  3QPS A;  4B8X A;  5FJ8 J;  1BC7 C;  3OIP A;  4R1H A;  2A05 A;  1Y1W J;  1UG2 A;  1VQL I;  1OMI A;  4BL0 B;  5LGN A;  1PUE E;  4UUS B;  1J7K A;  4L9T A;  2DA6 A;  4GFB A;  3A0B C;  3I54 A;  2QLZ A;  2FML A;  1LDD A;  4BKX A;  4XKV A;  3HOW J;  4KIS A;  2W82 A;  3FXR A;  2XSJ C;  3FDY A;  2F5E A;  1MJ9 A;  3LSJ A;  3DWL E;  4ESB A;  1U8B A;  2GXG A;  1TT5 B;  1JT6 A;  1WPK A;  2Z16 A;  5IYC J;  3H5R A;  4LG0 B;  3HZJ A;  4M3G A;  2GOM A;  4N4O B;  4A0Y A;  2KZV A;  1MBG A;  3V4G A;  4HA8 A;  1FBS A;  2D1H A;  4MLO A;  2ZCW A;  3G6E I;  2V4J C;  4Y17 A;  1HBX G;  3M07 A;  5LEK A;  2OQG A;  3FBI B;  1ZRD A;  3C2G A;  2K86 A;  3RZD J;  5JI6 A;  4AYB A;  5DDG A;  3CCS I;  1D5V A;  4I7H A;  5JHU A;  2MW8 A;  5F27 A;  2DA3 A;  3AAF A;  2H94 A;  2FJ1 A;  1ON1 A;  4DZP A;  1SFX A;  3FHN A;  5TJJ A;  4I0A A;  1T38 A;  5L3C A;  3E7L A;  4A69 C;  3QYF A;  1ZG5 A;  3IC7 A;  1MJA A;  1W7P A;  3R0A A;  2W00 A;  5KK1 A;  3DQV C;  2QA4 I;  4BDZ A;  4LB6 B;  5IOY A;  4N9H A;  2LMD A;  4HLY A;  4BHB A;  1ZAO A;  4JX6 A;  1U3E M;  3REO A;  4BY7 J;  2E71 A;  5B5E C;  1P2F A;  3WTS C;  4GGG A;  5CVU A;  2VJ5 A;  4AD9 A;  1YIO A;  2COB A;  4IX7 A;  2QF7 A;  3BQZ A;  2GXB A;  2M3A A;  2HPI A;  1VQO I;  3RYR A;  3LSG A;  2VL8 A;  3CCQ I;  2EFW A;  2DMP A;  2Y75 A;  1ONV A;  3LFK A;  3IRQ A;  1Z7U A;  1I1G A;  2GOX B;  1YRN B;  3GWZ A;  1I3A A;  4E7H A;  2HEO A;  1MMD A;  3HM5 A;  3ZR8 X;  2QQ8 A;  1REP C;  2NNN A;  2LY1 A;  1VI0 A;  2HQA A;  2R7T A;  4ZTJ A;  2M0M A;  4M3E A;  1YOV B;  2RGV A;  3I0T A;  2CQX A;  4RM3 A;  4XRS G;  5B1A H;  3GEZ A;  4HYE A;  1R7J A;  4OWR B;  4XL9 A;  4BAY A;  2C6Y A;  2LRD A;  2ID3 A;  4KN7 X;  2ZXW H;  1V5F A;  2XAH A;  3WE2 A;  4L0Z B;  2VIX A;  4JBA A;  3JR9 A;  4IHW A;  5FRN A;  4D7N A;  2VJI A;  2WV1 A;  2XHK A;  4BNC A;  2JZY A;  1OJL A;  1QZY A;  1UMQ A;  2Y0S N;  1FJL A;  2A6H F;  1IGN A;  1YG2 A;  1Z77 A;  2P7C B;  4BJ6 C;  5K5O A;  1LJ9 A;  2ZJR F;  4V2G A;  4S0H B;  1SVL A;  3GLX A;  3ABT A;  5JLW A;  2KZG A;  1K83 J;  4UNO A;  3GTK J;  1AKH A;  2IPQ X;  4LIT A;  1STZ A;  3MZY A;  2X6Y A;  1U8R A;  3EYY A;  3PO3 J;  2JK3 A;  3CCM I;  1PUF B;  2F4O B;  3GTP J;  2M7A A;  3KX2 A;  2NAZ A;  3VYT B;  3NAR A;  5BPD A;  4MNU A;  4UV9 A;  3W6J B;  3WGI A;  3WTW C;  3AG1 H;  2I10 A;  3A2K A;  4IF4 A;  5CQE A;  5BQT A;  3FKI J;  1Y1V J;  2VQL A;  2BBY A;  2EZL A;  2LVS A;  2VT2 A;  3SFZ A;  4JOM A;  1JI8 A;  4Y7N J;  4UVC A;  2HVS A;  1GHC A;  4ASN A;  2X6W A;  3OMY A;  5JVT A;  5L3G A;  1W36 D;  1JKP C;  1A5J A;  4XRS A;  3SQN A;  5E3O A;  1Y8Q B;  4BEH B;  1VND A;  1I6X A;  2F5F A;  3D5L A;  2IAI A;  2W85 A;  2KL4 A;  4S04 A;  5LHG A;  4Q5S F;  4PSX A;  2QEN A;  2YUS A;  3PSI A;  3DKX A;  2QBY A;  2VKH A;  4MEY F;  4WF2 A;  2ZME B;  3ERE D;  1ACI A;  3HTS B;  2EFP A;  1A04 A;  1T98 A;  2FBH A;  4NQW A;  3J7A O;  4U87 A;  1ETX A;  4EJO A;  3ZCO A;  1Z6R A;  4XKB A;  1KGS A;  3MWM A;  3NEU A;  4RAY A;  2HZD A;  4CYC B;  2B63 J;  4ZJZ A;  4A3J J;  3O8G A;  2CS3 A;  4XSZ F;  5FLM J;  4A0Z A;  2P6S A;  2WTE A;  1S9H A;  2Z99 A;  2A5W A;  3ZQL A;  5KHD A;  2JQ7 A;  3HKZ A;  2EH3 A;  2JA2 A;  3K9T A;  2NVU B;  4J00 A;  3KZZ A;  3ABU A;  2A3S A;  3OYJ A;  3K7A J;  3LA2 A;  2LK2 A;  3OYD A;  2IGM A;  3M1E A;  1O7L A;  3FIS A;  2EJR A;  2PMZ N;  2OTL I;  4WXD A;  5FKN A;  1X58 A;  2G0E A;  1FOK A;  3U2R A;  3CCU I;  2ACJ A;  3HSE A;  3BZC A;  5CVI A;  3JRG A;  1X4O A;  2BEO A;  4N0B A;  4XNF A;  4XM3 A;  3CZ6 A;  2H1L A;  2Q2E A;  3WU2 C;  3KP5 A;  4CCJ A;  3BR3 A;  4LLG F;  2G7U A;  1DU6 A;  1L3L A;  2F48 A;  1S7E A;  1TWA J;  1V55 H;  4JX5 A;  4OIR F;  5E17 F;  3I5U A;  5K5Q A;  1ZRE A;  5GP9 A;  5F1J A;  5FLX Z;  1DDN A;  2A61 A;  1D1C A;  2HWV A;  1YTY A;  1Y6I A;  1ZTR A;  2UXX A;  1I3Q J;  4CCN A;  4E7J A;  3ABM H;  1FY7 A;  1RES A;  2WV0 A;  2L9V A;  2VQC A;  4IQ4 A;  1UG0 A;  2M7B A;  5CYV A;  4ZDP A;  2DI3 A;  2AQF A;  5IY5 H;  3TED A;  4N9I A;  2RAE A;  3JRH A;  2M45 A;  1EH7 A;  1K61 A;  4KIC A;  3BR0 A;  3ZQ7 A;  5TIS C;  2ECB A;  4A3C J;  2EWN A;  4ZYD A;  3V8K A;  1YO5 C;  2VC1 A;  2CSO A;  2DJI A;  1R1U A;  3JAM K;  1HA8 A;  3GBG A;  4A6D A;  1AU7 A;  2M34 A;  2F2E A;  4PDK A;  2P4W A;  5HNH A;  3NRV A;  3HOU J;  3PIP F;  2V1U A;  3TMO A;  2KPM A;  4Q47 A;  3FMS A;  4OOI A;  1W36 C;  3J81 K;  2GIV A;  5IP9 J;  1HF0 A;  2LSO A;  3PL8 A;  2STT A;  1P7J A;  5JVG F;  1LNW A;  3KP2 A;  2DLL A;  2DCE A;  2Q2E B;  4KJZ A;  2HDD A;  2QSH X;  5LBQ A;  2CQ7 A;  1JE8 A;  2BVM A;  1W4M A;  3OY9 A;  3ZMV A;  1ETV A;  2XB0 X;  2UZK A;  3K0L A;  1J09 A;  2DA4 A;  2XGE A;  2JRM A;  2YX7 A;  2LG4 A;  3GYH X;  1MH3 A;  3RKY A;  4U88 A;  4HDU A;  2GLO A;  3MD2 A;  3I4N J;  3HIF A;  3HHG A;  1MSE C;  5FFZ A;  4BQA A;  1WFX A;  3JRF A;  1CF7 B;  4UB8 C;  3NAU A;  4E7S A;  4WWC A;  1MSF C;  5HOO A;  4MGR A;  4PCQ A;  3CLQ A;  1JHF A;  1QZZ A;  4XN3 A;  1ZKG A;  1KYW A;  4Y33 A;  3EUK L;  1ZH5 A;  3GTM J;  2JTV A;  4LD5 A;  2R7W A;  4ABZ A;  1SD6 A;  1ETY A;  1JUM A;  3F8F A;  4Y52 J;  1HDP A;  2R5Z B;  2MG4 A;  2KKO A;  4F55 A;  1W0T A;  3ZRG A;  1X1A A;  1KA8 A;  2ZME A;  1HSJ A;  4CXF A;  1JJ6 C;  2OD5 A;  3N4M A;  3PQJ A;  4GRI A;  2PJR A;  1L0O C;  4MO7 A;  3VEP A;  1BIA A;  4PSW A;  3J7Y J;  2H1K A;  2H27 A;  1ZN2 A;  2RRE A;  2WAD A;  2VPR A;  4BEH A;  3UNG C;  3B6A A;  1XG1 A;  3OYE A;  1MZB A;  3GZN B;  2K27 A;  5FRO A;  1WGX A;  5GAE J;  3ABK H;  1IN7 A;  1UHW A;  1KU7 A;  4DYC A;  2JN6 A;  1F1Z A;  3OYF A;  4XK4 A;  1EH6 A;  3TQN A;  4C9Y A;  3LAP A;  2AXT C;  1R4M B;  1IZ1 A;  1I6H J;  3SXY A;  5F0C A;  1BC8 C;  5EZG A;  3CTA A;  4CA0 A;  2HKO A;  1CQT A;  3ECO A;  2VE8 A;  1VQ9 I;  4XRF A;  1FSE A;  1QZE A;  4FQG A;  3LNQ A;  2O8K A;  2L2O A;  4I2O A;  3BTJ A;  1FSH A;  2NOJ B;  1QPM A;  1K7A A;  2XRL A;  5J3L A;  1K78 B;  4DJA A;  5M3F J;  2LR8 A;  3V8L A;  4PFO A;  4D1Q A;  5FD5 A;  2CQQ A;  2MD0 A;  3FM3 A;  1TWH J;  1VQK I;  3OYK A;  3OOU A;  3H3U A;  1F5T A;  3D0S A;  3TDZ C;  1HW5 A;  2D45 A;  5BS6 A;  4DQ2 A;  1BA5 A;  4B09 A;  2DMT A;  2VQG A;  5D5U B;  2E35 A;  4M6X A;  1JHH A;  3TW6 A;  1XDU A;  5LRS A;  3DTK A;  2JVG A;  1OCC H;  4MIM A;  3Q0V A;  3S17 J;  2OC6 A;  3BY6 A;  3ZN0 A;  1BJA A;  3VDX A;  4CO8 A;  3H3V K;  1R5H A;  3RPU A;  2P5K A;  5K1Y A;  2HR3 A;  4CUG A;  4EEF G;  4HPQ A;  2JT1 A;  4A5M A;  3S32 A;  4G7Z F;  3I53 A;  5CKT A;  1YQA A;  2ADU A;  4MQV A;  2PI0 A;  2KIU A;  2DFH A;  2ZXH A;  3LSM A;  4AYB N;  3ZGK A;  2JMW A;  4NBQ A;  1AWC A;  1N25 A;  1Z9C A;  3KYL A;  3BR1 A;  3RSN A;  3K4C A;  1I27 A;  3HSR A;  3VSL A;  3Q5F A;  4HF2 A;  3KIO A;  4QWQ A;  2R92 J;  4IRG A;  3ZMD A;  3WHB A;  4WXH A;  2ELJ A;  2V26 A;  5E1W A;  3GZ6 A;  1EH8 A;  1G3T A;  3CO7 C;  4ZH4 F;  4A3I J;  1MBE A;  4IKF A;  2IBD A;  3BRO A;  3JRE A;  1QGP A;  4IHY A;  2DOD A;  1W7P B;  3FXM A;  4PGG A;  2M5W A;  5D6E A;  3ZQC A;  4DIQ A;  3E5U A;  4M73 A;  3K4B A;  2HNH A;  4BGD A;  3IV5 A;  3HSF A;  3HRM A;  3R60 A;  5EEA A;  5E3M A;  3FZV A;  4KIB A;  4AID A;  2R4G A;  2HZT A;  3FXQ A;  1RRJ A;  1N77 A;  4C3I J;  1YJN I;  1WQ2 A;  1IV6 A;  2QEX I;  2QQ9 A;  1YW8 A;  1QPI A;  2M9H A;  2KIQ A;  4R8H A;  4CIC A;  3C1D A;  1BR1 A;  1A35 A;  1TNS A;  2VJJ A;  3KEO A;  3TW7 A;  3QWL A;  4EQQ A;  3W6V A;  1E2X A;  3B6C A;  1VF9 A;  2IA2 A;  1MNE A;  2PQ8 A;  3ZQF A;  4E7I A;  1RIO H;  2PEX A;  5K7H A;  1HC8 A;  3FBN B;  3PFY A;  4DOZ A;  1FYM A;  1Q1V A;  3CDL A;  2XB5 A;  1UHS A;  2G9W A;  2ZXJ A;  3WGG A;  4CHU A;  1GUU A;  5IOZ A;  2HYG D;  1VQ8 I;  3RZO J;  3P9C A;  2IA1 A;  4AC0 A;  1V54 H;  3QYE A;  2AXL A;  2HOE A;  1CGP A;  2PMU A;  1QRY A;  2NS8 A;  2LBF B;  4IOA F;  4BUP A;  3OYA A;  5KAF C;  2ZME C;  1D3Y A;  2X51 A;  2MAB A;  1SMY F;  2R7U A;  4ZYE A;  1S8N A;  2JA5 J;  1S29 A;  5HOD A;  1TBX A;  3F8M A;  3NWS A;  2R5Y A;  1ZLK A;  3LQQ A;  2X85 A;  4FIS A;  3E5X A;  2IRF G;  4LLL A;  3WG7 H;  3IAS 2;  3W2A A;  4LLN A;  5FKO A;  1POG A;  2COM A;  1SVO A;  1G4D A;  3CF5 F;  4I02 A;  4JYK A;  3A01 B;  3M9A A;  1XC5 A;  4F52 A;  1SD5 A;  1X4P A;  1VQN I;  4BH9 A;  4FX0 A;  2EK5 A;  3GW2 A;  3B73 A;  4AIJ A;  3BZK A;  2PFB A;  1R23 A;  4U0W A;  1APL C;  2LDU A;  4MHG A;  3JRA A;  1Z6T A;  1S7O A;  3DTE A;  3C7J A;  4UVB A;  2DN0 A;  4NDL A;  3ML6 A;  5FKM A;  2XGX A;  3FMR A;  1NK2 P;  2DJN A;  3IHU A;  3NWT A;  3I59 B;  3K2A A;  5DYM A;  5AIQ A;  5FD6 A;  2VB6 A;  2LH9 A;  1YJW I;  1IJW C;  3HOX J;  3AG3 H;  4NUB A;  4P55 A;  4B43 A;  1X2M A;  2BHY A;  1EKE A;  2M30 A;  3I55 I;  4E7Z A;  2V9V A;  3AG2 H;  2RC4 A;  2GBY A;  5IYD J;  1I5Z A;  2GZW A;  2OU2 A;  3CCE I;  1ON2 A;  2OZ6 A;  3SJM A;  1WHU A;  2OA4 A;  3G2B A;  1RR7 A;  1TQM A;  3QU6 A;  4HQM A;  3GTO J;  2F5V A;  4DW6 A;  3E3V A;  1TC3 C;  3GVA A;  5HS9 A;  1NG6 A;  1DU0 A;  2CV2 A;  4NNJ A;  5GTH C;  1U9O A;  5K7Z A;  3LA3 A;  5KCM A;  5LHI A;  1G6N A;  2DO7 A;  1ZRF A;  4DNC A;  1BW6 A;  2RNJ A;  4GYG A;  3CJS B;  2K02 A;  3VYR B;  1FMV A;  3CD6 I;  3QAH A;  4ITV A;  1BR4 A;  2FU4 A;  4II3 A;  1WVR A;  1ZLJ A;  3CJT B;  2KDZ A;  4GO1 A;  2FE3 A;  1R4N B;  3IUO A;  3MKW B;  2E1M B;  4O5V A;  3KE2 A;  4V19 K;  4KUM A;  3BG9 A;  3M1C A;  5J40 A;  3E6D A;  2NNY A;  2E1M C;  2MD5 A;  3L2U A;  2YU9 J;  4Y13 A;  4AIH A;  2ZFW A;  3ZPL A;  3R0J A;  2A68 F;  2E1O A;  5ERI A;  4D5C A;  4B4C A;  2I5U A;  1SFU A;  3RYP A;  3DP7 A;  2Z1D A;  2OJE D;  3ZOB A;  1Z7L A;  2EA2 A;  4QSH A;  2L5Q A;  2XAJ A;  1ORK A;  2HXI A;  1FP1 D;  4C3H J;  1P92 A;  4MTD A;  1T39 A;  2FF4 A;  2M4K A;  1OR7 C;  3K6G A;  5IT9 K;  3G1M A;  1OIS A;  2JSC A;  1BM9 A;  4E6K G;  1ZHF A;  2W7N A;  1WCM J;  4WXC A;  5EG0 A;  4KIG A;  3DTI A;  3CO6 C;  4OMZ A;  5ILU A;  1HW2 A;  2L54 A;  1KU2 A;  4FE4 A;  1VQ5 I;  2X1E A;  2FD5 A;  1TL8 A;  3HB9 A;  2VXD A;  1Z67 A;  3H36 A;  3PNT A;  2E7W A;  3DU5 A;  2F5C A;  3W2W A;  1ITY A;  4EAT A;  3AL0 C;  4ESF A;  3SZP A;  1ETK A;  4B47 A;  4Z6Y A;  3I59 A;  3JSO A;  2EV0 A;  4LB5 A;  3S14 J;  4G6T B;  2JVH A;  3V7S A;  1K6O A;  3MKZ A;  2LLK A;  1J2X A;  3FXK A;  2Z3Y A;  5J1U A;  1R58 A;  3CDI A;  3FX3 A;  2ESH A;  2FNA A;  2UV1 A;  3WTV C;  1WJD A;  3OYI A;  2MGQ A;  2HQR A;  2Y0M A;  2X0L A;  1G2H A;  4A5N A;  2P0W A;  2WC2 A;  4F92 B;  2H6C A;  4X6A J;  2OQR A;  1XD7 A;  2YR2 A;  3MEX A;  2DA7 A;  1MMN A;  3A01 A;  2KFD A;  2ME0 A;  5GAG J;  2IS1 A;  3F3X A;  3LSI A;  1MDM B;  5IT9 Z;  1T2K A;  4FE7 A;  1D1B A;  2V1N A;  3FWE A;  5AIP A;  3RJP A;  2YPR A;  5LGU A;  5LFA A;  4OAY A;  5L3D A;  2QSG X;  2VKV A;  2V79 A;  1D5Y A;  4EGZ A;  2L9R A;  3ROU A;  3CMM A;  4W97 A;  4BE0 A;  4KIT B;  3L2V A;  4IZZ A;  1OR7 A;  2IJL A;  1FEX A;  3H92 A;  2KIM A;  1FTT A;  2LBF A;  2DOE A;  1T33 A;  4JX4 A;  3H3Z A;  4A3M J;  3S3M A;  2PN6 A;  1A6Q A;  4G7H F;  3H9J A;  3QOD A;  5F0F A;  3IKV A;  5B1B H;  2CW8 A;  2FBK A;  3L2C A;  4RMN A;  3M8F A;  1QNT A;  4KT6 A;  1LFB A;  4LIU A;  5KVR A;  4BAC A;  3K1N A;  4UB6 C;  3JRI A;  1X3U A;  2XPV A;  2NVT J;  1RR8 C;  2AO9 A;  1BI0 A;  1BBY A;  1WJ5 A;  1OCT C;  3IRR A;  2VKD A;  1RI7 A;  4HST A;  1P7I A;  5DUI A;  1KQ8 A;  1RNL A;  1B72 A;  4L9V A;  3HPG A;  2PJR B;  2MLK A;  3HOY J;  1ETO A;  5JFR A;  4A3K J;  1LFU P;  2JWT A;  3PM1 A;  4L5E A;  2R5Z A;  2MH2 A;  2WAE A;  1SAX A;  1OCR H;  2Y2Z A;  4RAZ A;  2CU7 A;  3QU3 A;  2DT7 B;  4PJM A;  4BDY A;  2L7F P;  2JUG A;  3EET A;  1YS6 A;  3KYD B;  3IH2 A;  1T6S A;  2DTZ A;  4C2T A;  1HST A;  2EIL H;  2G7H A;  4FCY A;  2K9L A;  5E8G A;  1PJR A;  1U5T B;  1XCB A;  3DXJ F;  2DPU A;  1D0Z A;  1SAU A;  1CF7 A;  5EGO A;  1PP8 F;  5E3N A;  4D0P A;  5ICF A;  2JUC A;  1U78 A;  2OF7 A;  3WU0 A;  3K1P A;  1WJB A;  2RKH A;  2JA8 J;  4M72 A;  2QQA A;  3BOQ A;  3S15 J;  3S93 A;  3BTI A;  1A6I A;  2EQR A;  1B9N A;  4YFK F;  2ZJQ F;  1FTZ A;  4G94 A;  2ZJP F;  1R6R A;  2DT5 A;  3ONQ A;  2M4G A;  1TQI A;  4XKW A;  2VN2 A;  2L0K A;  3ESW B;  4JQF A;  4ENJ A;  3OSG A;  1Y0N A;  1RET A;  1DPR A;  2MC3 A;  3GUD A;  4EVI A;  4RGS A;  3T1B A;  3U1K A;  2JSP A;  2RQP A;  1DP7 P;  3K4J A;  3TDU C;  4BQQ A;  2FUG 2;  3CC2 I;  1D0X A;  3J80 Z;  3RI4 A;  1SAN A;  4MTE A;  5L3B A;  3GFI A;  2VON A;  1OCP A;  2CUJ A;  5J4Y A;  3TBI A;  1QHG A;  4HW0 A;  1E17 A;  3KZI C;  1UST A;  2O9L A;  4IQJ A;  4LJZ F;  4U0Y A;  2L4M A;  3W6K B;  3DPT A;  3F0C A;  2VUM J;  1DPU A;  3ELK A;  2KHM A;  5DTD A;  4BJT A;  2V6C A;  1EV7 A;  2Y9Z A;  3ZMZ A;  3QP6 A;  1YHQ I;  3HPH A;  2MLG A;  3KLN A;  4L5I A;  5FLV A;  1HQC A;  2K85 A;  1O3R A;  1IN4 A;  3B02 A;  3P9K A;  3WE3 A;  1X1P A;  1RKT A;  3OWT A;  2P7V B;  5CPR B;  2WAQ A;  5EEG A;  2LF8 A;  1LUJ B;  3OSF A;  4I99 C;  3BPV A;  2RN7 A;  2LYC A;  5FKL A;  2XKO A;  3MKL A;  3X2Q H;  5B66 C;  1BI2 A;  5J1R A;  5C44 J;  1GLN A;  2RNG A;  1P4W A;  5M5W J;  5D5V B;  4HRI A;  2CRG A;  1JKO C;  2JA6 J;  3LSR A;  4HG2 A;  1RUN A;  4UY8 I;  1K78 A;  3LSP A;  4IRH A;  2DU9 A;  5F08 A;  1IG7 A;  4NC8 A;  4G12 A;  1WJC A;  1DP3 A;  3GTQ J;  4EJV A;  1V3F A;  3VB2 A;  3W3C A;  5HS7 A;  3G3Z A;  5HVQ C;  3KCC A;  3O2P E;  2KMU A;  5DM6 F;  1ZG3 A;  2JPB A;  4YEL A;  4CCO A;  1IUF A;  1R22 A;  5E8I A;  1PP7 U;  5LGT A;  4CGZ A;  3L2Q A;  5J47 A;  4M3F A;  5M3M J;  4QPO A;  3J81 Z;  2MYS A;  2PX9 A;  2QM3 A;  2W48 A;  4UV8 A;  2XSD C;  5D5W B;  2DA1 A;  2E1C A;  1ZR4 A;  2L4A A;  1OYW A; 
#chains in the Genus database with same CATH homology
 2OTJ I;  1VQO I;  3CCQ I;  1VQ5 I;  3CCL I;  1S72 I;  1VQN I;  3CME I;  3CC7 I;  2JQ7 A;  3J7Z I;  3PIO F;  2ZJQ F;  2ZJP F;  3CC4 I;  1YJ9 I;  3CCV I;  5GAH J;  1VQ6 I;  2OTL I;  5DM7 F;  1Y39 A;  1YI2 I;  3CCU I;  1YJW I;  2E36 A;  1VQ7 I;  4IO9 F;  1FOW A;  1FOX A;  3J7Y J;  3CC2 I;  3G4S I;  5GAG J;  3CJR B;  2FOW A;  3I55 I;  5GAE J;  1VQL I;  2H8W A;  1WIB A;  3CCE I;  5GAD J;  3CCJ I;  2ZJR F;  1MMS A;  1YJN I;  2QEX I;  1YHQ I;  1VQP I;  1VQ9 I;  3CJQ B;  3CCM I;  2E34 A;  3CJS B;  3G71 I;  3CD6 I;  3CMA I;  1VQ4 I;  3EGV B;  1YIT I;  1HC8 A;  3I56 I;  3CJT B;  3G6E I;  4V19 K;  1VQK I;  3PIP F;  1VQ8 I;  4UY8 I;  3DLL F;  3CCS I;  1YIJ I;  1QA6 A;  5JVG F;  2E35 A;  2NXN B;  4IOA F;  2K3F A;  3CCR I;  1VQM I;  5DM6 F;  2QA4 I;  1ACI A;  1FOY A;  4IOC F;  3CF5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...