2H8WA

Solution structure of ribosomal protein l11
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
147
structure length
147
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
publication title The Structure of Free L11 and Functional Dynamics of L11 in Free, L11-rRNA(58 nt) Binary and L11-rRNA(58 nt)-thiostrepton Ternary Complexes.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 15
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2h8wA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2h8wA01
3EGVB 1YHQI 5GAEJ 2FOWA 1VQLI 3CMEI 2ZJPF 5DM6F 3CF5F 2E34A 5GAHJ 3I55I 3G4SI 3CCVI 3J7YJ 3CJRB 2QA4I 2H8WA 5GADJ 1YJWI 1FOXA 5GAGJ 2JQ7A 1VQ5I 1VQOI 1FOYA 3I56I 4UY8I 4IOAF 2QEXI 2ZJQF 3CC2I 1VQKI 3CCRI 1S72I 3CCJI 2OTJI 1FOWA 3CJTB 3CJQB 3CC7I 1YI2I 1VQPI 3CCMI 3CCSI 3DLLF 2NXNB 3CCQI 1VQ7I 1YIJI 2OTLI 1MMSA 3CCLI 3CMAI 3G71I 2E35A 3G6EI 1VQ8I 2K3FA 1YITI 1WIBA 3CCUI 1VQ6I 1VQNI 1QA6A 4IO9F 1VQ4I 4V19K 3CJSB 3J7ZI 3CD6I 1YJ9I 3PIOF 3PIPF 2E36A 5JVGF 3CC4I 3CCEI 1Y39A 1VQ9I 1ACIA 1VQMI 2ZJRF 1YJNI 5DM7F 1HC8A 4IOCF
chains in the Genus database with same CATH superfamily
2HNHA 2BY2A 3FXQA 3VSKA 2ECBA 3RTRA 2L54A 4GXOA 3VB2A 1P7JA 1L0OC 2I8DA 4Z6YA 5E1ZB 3GO5A 4OAZA 4HLYA 2QENA 3OV8A 2M0CA 1H8AC 5FKKA 3ZMZA 4LLLA 2K02A 4A12A 1U0JA 2LRDA 1WJFA 2A6EF 3LSTA 4CCOA 4DBRA 5TRDA 2A07F 2DPDA 4BXXJ 1F9NA 4EGZA 2ZMEC 4ZDPA 2O7OA 3IV5A 2CJJA 2MYSA 4RB0A 3S32A 2FU4A 5EEHA 3P9KA 3WTWC 2XHKA 4EEFG 4N9IA 2JMWA 1RR7A 1MH4A 2ISZA 4CGZA 3FK6A 5JHUA 2GXBA 2H8RA 1YIOA 3LOCA 4IRIA 3ELKA 5LBQA 2MH9A 4R79A 3P9CA 3CP2A 2H94A 3QODA 1QPMA 3GZ6A 4MFEA 1RPWA 3RCOA 1SMTA 3S1MJ 1TQMA 3T5XA 5D5XB 4DYCA 2ZCWA 3CF2A 5B1AH 1WJBA 4A3EJ 3E97A 4G8XA 3TO7A 1XGMA 2L4MA 1QBJA 2Y2ZA 4LJZF 2STTA 2MH2A 3GZ5A 1H0MA 1WFXA 3RZOJ 4HPQA 1LVKA 3HB9A 1S8NA 2TDXA 2QWWA 1DPRA 1KU9A 3CCSI 5J47A 2EPFA 5EG0B 4II2A 3F8NA 1YTYA 3TQNA 2FD5A 3H5NA 5J1YA 3CUQB 5AIQA 1TWCJ 2CWEA 5CKTA 1IUFA 1LDKB 4FE7A 3D0SA 1IXSB 3GFIA 3PJRA 2VOOA 2BE5F 1ETQA 1PP7U 1ZN2A 1X1AA 2F4MB 3BPXA 4L0ZB 1X58A 4ZDLA 4HQMA 2VOPA 1U5TA 3VODA 2QQBA 2L7ZA 4M9SA 4PJ0C 4XNFA 2ZSHB 3BR3A 2YUSA 1LE8B 1AOYA 1B6AA 1FTTA 2HQNA 4IXAA 2Q2EB 1JKOC 1QA6A 2DJIA 3LSJA 1F1ZA 5DEQA 3IWZA 1BI0A 4MQVA 1TBXA 1BR4A 2NOJB 3TL4X 1ETXA 1HSTA 4XLHA 5AONA 3VYRB 1RIOH 2ESNA 2MGQA 4HV5A 2H27A 1Y39A 2IPQX 1VZ0A 1VQ9I 2XSJC 5M5YJ 1T0FC 5J8CA 4E7KA 3A03A 4D5CA 2XUBA 1Z05A 4ZH4F 2LNBA 3TGNA 3RKWA 1MSFC 1GUUA 3VFZA 1A35A 3A02A 4IVNA 2FOWA 2GIZA 4HRIA 3Q9SA 4AIJA 3AAFA 1CGPA 1X2MA 2E2IJ 3O2PE 4LLGF 2COBA 1EH6A 1V5GA 3J80Z 4YRVA 2LY2A 4J19A 2CQQA 1E3HA 3K0LA 3HSEA 2D2WA 3BG3A 4FT8A 4KMUX 3CJNA 1MBJA 4RGUA 3NRVA 1MKMA 3MZHA 2CV2A 2EV0A 2MSYA 1R7JA 3SZTA 3C2GA 1VQ5I 2VLAA 2X48A 3L9FA 3CLOA 4IHVA 3FBNB 4CICA 3U21A 3ZCOA 5HDKA 4PGHA 1U8RA 2ZNZA 4L9VA 2DK8A 3S17J 1K78A 1OCTC 1E3OC 2ZMEB 2F6CA 2P7VB 4WK8F 1A5JA 4C3IJ 1KQ9A 2JVHA 4UV9A 3MZ8A 1HF0A 2F4OB 1YRNA 1IXRC 4LD5A 1T95A 2XB0X 3SFIA 1JUMA 2LH9A 2ZNYA 4QIWN 2D1HA 2ICWG 3HPGA 3CCMI 5DCMA 3VSLA 4E4HA 3A01A 1BI3A 2BXZA 1VQ7I 4S05A 3GFMA 2FXAA 2KRHA 3BOQA 3F8CA 4A5MA 4NUBA 1K6OA 1UELB 1VNDA 2IGKA 1V3FA 2LFBA 2UUZA 2VBYA 3S2HJ 4ESJA 3JRAA 3L2VA 3PNVA 4A0XA 2W48A 1XPXA 2ME6A 3QOPA 1BBYA 4JX5A 2KIMA 3F3XA 5IPAA 1OPCA 1UAAA 4I2OA 2ELJA 3AG4H 2VBWA 4UUVA 4IHSA 2FSWA 4C3JJ 3CD6I 2HVSA 1S7EA 2IGMA 2JT1A 1JGGA 1W5TA 5F0FA 4M9ZA 3AFHA 1PYVA 2LLKA 2IS1A 1FJLA 1ZRFA 4RGXA 2HDCA 1MBHA 1IN7A 2PMZA 1Z67A 3I4NJ 1P4AA 1J2XA 4I0BA 3V8JA 5FRMA 4XK4A 2EZIA 3JR9A 1RETA 4XL9A 1Z9CA 3W6VA 3FHNA 4AIKA 5LEKA 3IH4A 1YOVB 3KX2A 3BY6A 4PJMA 2FNPA 4BHPA 2JSPA 5TGTA 3OYHA 1Y0UA 1W5SA 4R8HA 2EFWA 2RAEA 1RRJA 1WSUA 2IP2A 3F23A 4C3HJ 2PLYA 4KUMA 4RM2A 3EYIA 4PJJA 3B6AA 3OYKA 4IHXA 2E34A 3TOAA 5FB2A 4IPAA 4IHWA 5L3BA 4BXFA 3HBLA 1LJ9A 2Q8KA 1BA5A 2M9HA 3K9TA 2BGCA 1I1GA 1X4PA 3JRDA 1OYYA 4FQGA 2H8WA 4EJTA 4XLAA 2OQRA 2DA6A 1MMGA 4AIDA 3HGGA 4ENKA 2ZXJA 2R92J 2ZB9A 4A0YA 3W2AA 2R7UA 2K3PA 1SVOA 3OS2A 1G6NA 3LSRA 4A93J 2FOKA 1OCCH 4IOAF 1JE8A 3M8JA 4CSWA 3QP5A 5LEJA 4QPQA 4A3DJ 2X9DA 3KLNA 2MLGA 4N4OB 3E6BA 3OL4A 1W0TA 4MHGA 1D8JA 3MAJA 4KMFA 2DDAA 5ILUA 2Q2EA 4N9HA 3AKZA 3H5AA 2RVCA 5EGOA 3QRFF 2PMZN 2OAZA 3CMYA 1I3QJ 2V79A 4B47A 1GDTA 2M34A 2A05A 2DW4A 1Y0NA 3U2RA 1H9GA 2ISYA 3BTLA 3EPZA 2PQ8A 3PQJA 3ZQCA 2KLOA 3LSGA 2W24A 3R4KA 3ZQHA 4OWRB 1MMSA 1P9QC 2BVMA 3DP7A 5LHIA 4CCKA 4HX7A 1ZR2A 1HCRA 4F93B 2R7QA 4ENJA 2EJRA 3CESA 5FROA 5ICFA 1J5YA 3EYYA 1WJ5A 4JYKA 3Q5FA 2CV0A 2WY7Q 1WJEA 3B73A 1UHWA 4NBQA 3OYBA 3PIOF 3V42A 3TBIA 2E36A 5GPCA 4HV6A 2E19A 3BTIA 2W85A 2VBXA 4EM0B 1X1BA 4GYGA 5D5VB 4RM3A 5FFZA 3BCBA 3FZVA 2ZO4A 3QPTA 3GTGJ 4II3A 3WTTC 3WTZA 3WU2C 4FCYA 2LG4A 2W1OA 2JA7J 3VPRA 5EDNA 4PGGA 3JREA 2XF6A 4RAZA 2P5VA 1A31A 3SHFA 5D8LB 4A6EA 3FXKA 5F27A 1ZGAA 3RKYA 3ERED 5CVVA 3SDBA 3MCZA 2P5KA 1FBUA 3MFKA 4HLXA 2ZMEA 1F4KA 1BM9A 4NQWB 4B44A 4O3MA 3LA7A 4XBFA 4ZTFA 4HX8A 2ELKA 2V7FA 3FXRA 4CCMA 3SJMA 1B4AA 3ERMA 5LGUA 2KISA 2XDVA 4FETA 4JP0A 2Y30A 4J01A 3OYCA 3K4MA 2QA4I 3PSFA 2ZXIA 3G1MA 5GADJ 4FX4A 3WTYC 1YJWI 5GAGJ 3W3CA 3HL2A 2R5YB 1RUOA 2K7LA 1BR1A 4XLEA 1FSHA 1V4RA 3O6BB 1WJCA 2VBZA 1MDMA 5JI6A 2GWRA 3BZ6A 1N78A 5HODA 4RLFA 2JJ7A 2VASA 3F9KA 2X1CA 2ZJ2A 3ZGKA 2NNYA 4Q48A 2Z3YA 3WE2A 4ZJZA 3F8MA 2E60A 3WG7H 3K4CA 3CCJI 3DWLE 3AL0C 1R5ID 2CS3A 2JUCA 3RKXA 4EJUA 5BPIA 4MGRA 5BNGA 4EV0A 4B1RA 4L18B 1F43A 1WH5A 4ZYEA 1FMWA 4ZTJA 4ABZA 2GAUA 1DDNA 2GZWA 2XASA 1VFCA 5GTIC 2L3DA 5F6FA 2PMUA 3QP6A 2ZFWA 2RNGA 1SFUA 1RC9A 2V26A 2JPBA 1P4XA 4D1QA 3PSIA 1TW3A 2PEXA 2F4IA 2DFIA 3BR5A 4F55A 3M4OJ 3AG3H 1APLC 2P81A 4D9JA 1OJLA 3PQKA 1XS9A 3ZMUA 1SMYF 2QSGX 3GUDA 4KISA 2DYSH 1P4WA 2XRNA 5H2FC 2L9VA 2R7ZJ 3CP8A 1U6GA 1FY7A 3E5XA 4I0AA 2JVGA 3DEUA 3DXJF 3BT9A 1OLTA 5K1YA 3GLLA 5JFRA 2OZUA 3S3MA 3J7AY 2M4GA 3C2HA 4HW0A 2G7HA 1TC3C 4MO7A 1R22A 2VJIA 2OPTA 3ONQA 2KRFA 1HW2A 4UNOA 3K4LA 1EV7A 2VONA 1Y1VJ 4BE0A 1D5YA 3KYDB 2FMYA 2F5FA 4AYBA 2L9NA 4OMZA 4F91B 1W4MA 2L7MP 3KEQA 5EEGA 2DDBA 4O5VA 1GHCA 2EFOA 3WTVC 4M72A 1W7PD 3ZQLA 2HYGD 5E3LA 3L7WA 1RESA 1LVAA 1K4SA 4V2GA 1TLHB 1FP1D 2J5OA 4YELA 4KIGA 3NAUA 4WXCA 2ZSIB 3IL2A 3GTMJ 2VKEA 3A0HC 4BBSJ 3FXLA 1WVRA 3CO7C 4A3BJ 1JUSA 1Z6TA 2CG4A 4B4CA 1JUPA 1YW9A 2WV0A 5L3DA 4BL0B 4BQNA 4UHTA 3QOEA 1U9OA 3O8HA 2DI3A 2XGEA 4KITB 3HOXJ 5BPDA 1R71A 2V1UA 3C2BA 1SAUA 3HSFA 1I39A 3CCRI 3FF5A 5E8IA 1FSEA 1MGTA 1KGSA 4RBOA 2V1NA 1JT0A 3FM3A 2K9SA 2VUMJ 4IQ4A 2HFHA 3CJTB 5DUKA 3MKYB 2VT2A 1V5FA 2DA4A 4Q5SF 3M7GA 1PUFB 2LOOA 2HDWA 2PMHA 4RS8A 5HS9A 3ZQ7A 4CYDA 2X1EA 3R61A 4WX9A 4C9YA 1ZG1A 1J9IA 3Q0UA 2RGVA 1D0XA 1IRFA 3WTUC 2JA2A 1DU0A 4KIFA 4KICA 5CYVA 3DLLF 4KDPA 1IGNA 3LWFA 3HZJA 3E3VA 2HVQA 3BLYA 3K4KA 3W2WA 5BMZA 4WXHA 5D6EA 4MEYF 1LFPA 1I6HJ 3DBLB 4NC6A 1TT5B 3CZ6A 5F08A 4M6YA 5FKMA 3CCLI 1HOMA 2Y31A 2VPRA 1IN6A 3U1KA 3BR2A 4D0PA 5TJJA 1I6XA 4HF0A 3F0CA 4A69C 3WU0A 2K3FA 5DDGA 2W82A 2EZLA 3S1QJ 1T08B 4LGWA 3QPSA 9ANTA 2IA0A 2YR2A 3FXOA 2DMUA 3ABUA 2TCTA 5GPAA 2GOMA 4GRIA 3TDZC 1T2KA 3C1DA 2PJRA 4Y17A 3Q9VA 5L3CA 1R00A 1R1TA 3HJEA 4YEJA 5DD4A 1IC8A 2KIFA 1B9MA 2CUFA 5IY5H 3JRFA 2IRFG 3E6MA 4LB5A 4CZZA 3FKJA 2K86A 2CUEA 3QWLA 5E8GA 1IRXA 1K78B 4FISA 3OSFA 1FTZA 3ZQQA 4HDVA 2F5DA 1MJBA 3EGVB 1ON2A 1D5VA 2H09A 2QGUA 1ERDA 2EWNA 3ABKH 1MNEA 3ZQIA 3WHCA 2XGXA 3H9QA 4KN7X 3GTQJ 3CLQA 4CDGA 5J4VA 2Y48A 3CCYA 5DCMB 2LF8A 2UXXA 3CF5F 1NG6A 2R4GA 1FC3A 1WRJA 4LITA 2Z33A 3SZPA 3QPLA 3UNGC 4BQOA 3HOSA 2K9NA 3HEFA 4ESFA 2DK5A 1S7AA 2A61A 4JQFA 2HVRA 2STWA 2JQ7A 2P5LC 3GWZA 3LL7A 4OIQF 4JBAA 3E6DA 3H35A 2E1OA 1TNSA 4DNCA 3LNQA 3ZN1A 1R6RA 2B0LA 3NQOA 1PP8F 4AVPA 3B02A 2TRTA 3E1SA 5D4SA 2L9RA 4ANJA 2NS8A 1ITYA 4NB5A 4BACA 5FLXK 1Z3YA 4I6ZA 2JPCA 2KHMA 2Y75A 2M7AA 3OS1A 4BDZA 4ZYGA 2BHZA 2EIMH 4Y4RA 4B43A 2CW0F 4F52A 2Y69H 3HM5A 1A6IA 4XR6A 4OMYA 2NVYJ 2LVSA 4M3BA 1D3YA 2NXNB 3KP4A 1F36A 5A2QK 2B9SA 1T38A 3OYLA 1RNLA 3GMEA 4A6DA 3KCCA 1KU7A 4A3FJ 3BCAA 3FX3A 3CDLA 2LF7A 3HG9A 1FBQA 3K7AJ 3ULQB 2G9WA 2A5WA 1W36C 2OZ6A 1PDNC 2E1MC 3CTAA 2DMQA 4OAYA 1EH8A 5BS6A 4RB3C 4IO9F 1R9TJ 3HIFA 4HNVA 2XAGA 1XGOA 2ZXWH 1XG1A 4HSRA 2RREA 3GCMA 3MKWB 4K2EA 3BR1A 2BEOA 4NNJA 2G7UA 3DF8A 2XROA 1IN5A 4UV8A 4Y33A 1VQMI 5JLXA 5L3GA 1U78A 1JKPC 2AQFA 3IKVA 2LMDA 1USTA 5LLQA 1ODDA 5B3SH 4U0YA 2CSOA 2DA5A 2ELHA 4BXUA 4IOCF 1ETVA 4X6AJ 1S5LC 2KZGA 5EGOB 4BKXA 1VQLI 3K69A 1S29A 2IA2A 3KP3A 4XKBA 1TP4A 4P55A 1WJAA 3GTLJ 1I5ZA 1YYVA 5FKLA 4D7MA 4XONA 2L9SA 1PUFA 4BJ5C 3BR6A 3S3OA 2VJ5A 5F64A 5H6QA 1MMAA 2K4BA 5JVTA 1TTYA 5C4JJ 5F1RA 2E1CA 3CUOA 1W36D 4N4NB 4EM2A 5J40A 1MSEC 1AKHA 4HBLA 1D0YA 2YX4A 1FIAA 2Q1ZB 3IWFA 3REOA 1JKRC 1OFCX 4QTRA 2A69F 1ZRCA 3GTJJ 3H9GA 3HKZA 2FX0A 3DLAA 4BQAA 5EJCA 5HS7A 3HXLA 4XRFA 2LTPA 1QZYA 3HRUA 3O3KA 5BOXA 3SFZA 3I71A 3TMOA 1FEXA 1YS6A 1KONA 3RI4A 3WGHA 4FX0A 1P6RA 5J4YA 1FOKA 2DMNA 5M3MJ 2VIXA 1FIPA 3SQNA 2E5ZA 3KE2A 1XSDA 1BC7C 2QQAA 1USSA 1W7PA 3K10A 1W0UA 1ZRDA 3QQAA 4LIUA 3KYLA 1YG2A 2QSFX 2KJBA 3M9AA 4HOBA 4NHJA 3BG5A 3SXYA 1IN8A 2V9VA 2FBIA 5B5EC 1FPQA 2PBIA 3BWGA 2OTLI 5BQTA 4HA8A 3RYRA 2MD0A 3L2QA 2QZ8A 3KZYA 2IBDA 1YE9A 3CMAI 4M3EA 4BHBA 4PDKA 3JSOA 1MJAA 3NWTA 2H6CA 1WI9A 2RNJA 3CDIA 3R60A 4O6JA 3VOEA 3VYTB 4PUSA 4AUXA 2X4HA 4GCVA 1C0WA 1FWZA 1NG7A 4PJLA 1WIBA 3JCUC 1HQCA 4BJTA 4A3CJ 3GW2A 1T39A 3PIPF 1UHSA 5JHFA 4RAFA 1Z6RA 2JN6A 2VKHA 4XLCA 5HLHA 1ZHFA 1MDMB 2EA4A 2WTEA 2HYFA 1SD4A 4FASD 2W7NA 4XORA 3OR2C 2XKPA 4IKFA 3JRCA 2VJ4A 3HRTA 4UVAA 3RSNA 4B09A 2DN0A 3GF2A 3I64A 5F04A 2KQRA 1IW7F 3A1YA 3HOUJ 1A04A 1Z7UA 2YU3A 4NC7A 3ASOH 4L9JA 3FXUA 3DPLC 4BNCA 3JSPA 1B72A 2HZTA 2OD5A 1NK3P 1TNTA 1JJ8C 3E5UA 5DM6F 1CQTA 4A3LJ 2F5VA 5FKNA 2XIGA 1BW5A 5FGMA 3V4GA 2XPUA 3WODF 3LAPA 2KIUA 2WWYA 3ASNH 2L4AA 2X6OA 3PUFA 4YFNF 3TEDA 2DA1A 1BJAA 4RDUA 2LDUA 2V6EA 1BIBA 3GFLA 2B63J 3GXOA 2UWMA 1UG2A 1LNWA 2ETHA 2PJPA 1VQOI 3ML6A 1FOYA 2VB6A 4NC8A 2P6SA 3BQYA 3JRIA 5FLXZ 2VXZA 3X2QH 5D8KB 1WHUA 2MD5A 2HTSA 3ZXSA 1IV6A 3IH2A 1WQ2A 5HLGA 3VEPA 4CXFA 2QYOA 2Z9OA 1X19A 3S15J 4H0EA 2V9KA 4E7SA 4ZYDA 1RZ4A 3GLXA 3KZIC 3MZYA 3R6SA 3G3ZA 2R0QC 1Z1DA 1GV5A 4OU0A 4UUSA 4QSHA 1PUEE 1HXDA 4XSXF 3ZOBA 1O3TA 2WADA 3FMRA 1VQPI 4FTHA 5A2QZ 4Y7NJ 4EJOA 2JSCA 2NOGA 5FKOA 4LG3A 4UB6C 4ZDOA 3KYCB 4IRHA 3CCQI 3M3YJ 1ONVA 1OYIA 3QYBA 3NEUA 3DV8A 5HNFA 4CYCA 1TW2A 2R7WA 2GBYA 3OYDA 4L9NA 4E7LA 3BP8A 3E7LA 1ULYA 3MD2A 1O57A 3BG7A 4LOCA 4UVCA 3DEEA 4C30A 2N8GA 2KKOA 5TISC 2DCEA 2VXDA 1MZBA 4OINF 3GFJA 3JTGA 1QU3A 1BC8C 3M07A 4XKCA 2BV6A 2UZKA 2CMPA 4GDFA 1VQ6I 1XCBA 2VQLA 1Z77A 2DXIA 4H4KC 4M3GA 2PFBA 4LK0F 2LR8A 4BYYA 2XSDC 4GYIA 2NRAC 4BU2A 1STZA 2XB5A 1V55H 3F22A 2DTRA 5K5QA 3HDDA 3I59B 2FRHA 3LA3A 4KIBA 2Z2SB 3OYIA 1R23A 3G1OA 1IRZA 3QU3A 1D1AA 4RAYA 1B1BA 4BY7J 1MBGA 5J1UA 4XN0A 2ZFUA 2R7DA 1BIAA 2LBFA 2AS5F 2AQEA 5DYMA 4IZZA 1AHDP 3BR0A 3C3WA 1FYLA 5CVRA 4ETSA 3TDUC 2O0YA 1IF1A 1I1SA 4XLNF 5B66C 3OYFA 1KQ8A 4F92B 3K1MA 3A0BC 2EZKA 2R7FA 3EQLF 3FDYA 3ZMSA 3ZN0A 3O8GA 1BI2A 4BHCA 1YQAA 2K5CA 1HW1A 1MBEA 3G4SI 5C44J 2GM4A 4IQJA 3E0JB 1G3YA 1Y8RB 2DJNA 2GA1A 5HDGA 3OYEA 1BOAA 2VKVA 3CJRB 4RAGA 3F72A 1L3LA 1ORKA 1JI8A 3JAMK 1QVTA 1RI7A 1AA7A 2P0WA 4V2FA 1FZPB 1FMVA 1REPC 4E7JA 1SEUA 3VYUB 1HDDC 5C4XJ 3BJOA 1Q1VA 4UVBA 4DBQA 1GVJA 2L0KA 5EYRA 2VPLA 2ZJQF 4U88A 1QRYA 1YLFA 2M45A 4GFBA 1HLVA 2CFXA 1BW6A 2Q0OA 3R0AA 1OCPA 2PJRB 1IXCA 5F0HA 4XICA 2XAJA 1SFEA 3ZP5A 2EILH 1YI2I 2CFOA 5IYCJ 3DKWA 3DTKA 1FYKA 3EUKL 2H1LA 3V8LA 1T8IA 3HC7A 2WAEA 1DP7P 3I53A 2R7RA 3K1NA 4S04A 1X1PA 2FJ1A 4XRSA 3IRQA 1SFOJ 3LQRA 1ETOA 2MC4A 1S9HA 5IT3A 3ABTA 1LFBA 1Z7LA 3ZRGA 2P6TA 4IRGA 3G6EI 3MKZA 3WE3A 2L7KA 1ZARA 2WV1A 3RYPA 1LFUP 1HSJA 1FYMA 2GOXB 1TWHJ 1S6LA 3KEOA 5J3LA 3V7SA 1UMQA 2DOEA 2XAQA 1XSXA 2X0LA 4EJWA 1U9NA 3RQ4A 2CO5A 3AG2H 2RC4A 4MLOA 5GTHC 2HGCA 4D5FA 2DTZA 2HU9A 2OUMA 1IAWA 2IJLA 5KK1A 1SVMA 5E3NA 2A6TA 1DQUA 2Y9YA 4L5JA 5J6XA 2HYJA 2V1DA 4M9XA 1YJNI 2DFHA 2QLZA 3B6CA 1BJZA 4LMYA 4IX7A 2I5UA 2R5ZA 2MC3A 4F7ZA 2WB1A 1G3TA 1WH7A 1SD6A 2HEOA 1FBSA 4Y15A 2QQ9A 5KHDA 3Q0WA 1OISA 1AU7A 1T0FA 3SDGA 1POGA 3IHUA 4XOPA 3LFKA 4CA0A 2XGCA 2YU9J 4DIQA 4A3IJ 1NK2P 1FX7A 1OQYA 3PFIA 4PSXA 3I55I 3E6CC 2V9PA 5FLVA 1U3EM 2JUGA 2EV6A 3G2BA 3DTEA 1DU6A 2Z5UA 4HAMA 1T33A 1OR7C 4RA2A 1TWFJ 5IP6A 2QBYA 3TW7A 2DQLA 3RIRA 4EM1A 2DLLA 1MIJA 2D5VA 1D8KA 3DKYA 3M8FA 1K4TA 1QVUA 2AXLA 3CC2I 1ETKA 4JX6A 4M6XA 1JHHA 2GLOA 2BOLA 1R5GA 5LRSA 4RB2C 1NTCA 5FLMJ 5LHGA 2KMUA 4MEXF 3PNYA 5FD6A 5M5XJ 1MNMC 4Y52J 1PJRA 4WXDA 3I4PA 4YIIA 4HYEA 3L2WA 2DMTA 3BJ6A 3KIOA 4EQQA 3CC7I 2ESHA 3MKLA 1BOBA 4XQFA 2IT0A 3K6GA 1OCZH 5HLIA 1Q1HA 3W6JB 2FBKA 4I02A 2BY3A 2BYVE 3CQZJ 3L2UA 3FISA 2EIJH 4M3FA 4A5NA 1TWAJ 3GTOJ 3S93A 3UKGA 3FBIB 3I59A 4PFOA 5DS9A 5KVRA 1LPQA 2WB1N 1IDYA 4M6VA 2CYYA 3KP5A 3S2DJ 2Y0MA 1E3PA 3KPHA 3SEQA 3AG1H 2BXYA 4CO8A 2O3FA 3G71I 5E17F 1B9NA 1VTNC 3ZMVA 2EV5A 1ZYRF 4I09A 4I7HA 4G9YA 3L2RA 5FFXA 1IV8A 1JHFA 4ZYAA 1KYZA 1XMAA 2MABA 1RKWA 4D7NA 1EKEA 3J7ZI 1AKHB 2KZVA 4XIDA 5FRNA 3HTUA 5LHHA 2H6BA 3QYEA 4OIOF 5K7HA 3CC4I 1R36A 3OYAA 2ADUA 3AL0B 4AYBN 4BS9A 2EH3A 1EH7A 1XDSA 2A5YB 2LSOA 3QAHA 1DGWY 1WCMJ 2M4KA 3HYIA 2E71A 4PCQA 1LDJA 3HRSA 3OYNA 3RKQA 1QQIA 2LREA 2LKSA 4BY1J 1K79A 4B8XA 4HSTA 1JTXA 1JTYA 1O7LA 1UHMA 3F8FA 3QPHA 1O3SA 1HC8A 1N77A 2H1KA 2M0MA 2DA7A 1V5EA 1R4MB 3TW6A 2KRCA 2HPIA 3G73A 3I4MJ 5IOZA 2M30A 5GP9A 1W7PB 1ZLJA 3CUQC 3RPQA 2WBMA 1ZG3A 2O03A 4HZFA 2KDZA 1XD7A 3T8RA 1I27A 2HOEA 2HXIA 3IP4B 2FBHA 1X3UA 3MN2A 5FO5A 5GAHJ 2NS0A 2AXTC 3JAMZ 3G1LA 2GQQA 2WAQA 5EZHA 3S16J 1VI0A 3RPUD 1UG0A 2ID3A 3CDHA 3WU1B 5IYBJ 2V4JC 1O4XA 5B1BH 5ICCA 2KT0A 1MMNA 2K4JA 1J75A 2R7XA 3I9V2 2NVUB 3ROUA 4ESBA 4Y13A 2BHYA 4XRMA 1BI1A 1UCRA 1UJ8A 2FQ3A 3D1NI 2L7FP 1SD7A 4E7IA 2M2EA 2IS6A 2DODA 3HOTA 4EATA 2M1BA 4A3JJ 3JRBA 3NARA 2MA3A 2EA2A 3BTJA 3EETA 3HOVJ 2XF7A 3K2ZA 2K85A 1XB4A 2HXOA 1KZHA 1NHAA 3CJQB 3FM5A 3T8TA 4YIFA 5IT9K 4AIHA 1AWCA 4HNUA 4EJVA 3DKXA 5IP7J 3WTSC 3TKYA 4RLQA 2LD5A 2P8TA 4C2TA 3BQZA 3CMMA 1MH3A 3S1RJ 4CZCA 1WKMA 2YPRA 5CVJA 4QLCU 5IYDJ 1B72B 5H6RA 2HQAA 4P9UA 3GX4X 3K2AA 4Q47A 4XMYA 5E3OA 1YS7A 4XOTA 4DYRA 3L1PA 2OF7A 3A4CA 2FNAA 2YS9A 1HW5A 5HVQC 3M8EA 5E79C 1G3WA 2WAQN 4G12A 3OSGA 4U0WA 2HKXA 1OMIA 2DPUA 5JVGF 1Z21A 2COMA 2BVLA 4HDUA 2OA4A 4DJAA 1MBFA 3LSIA 3EUAA 3LSMA 3KP7A 1IDZA 5M5WJ 2GXGA 4HQEA 4PFPA 1GXPA 4G7ZF 5KNLA 3FHZA 1OCRH 1QHGA 3JW4A 1HDPA 1UB9A 1CF7A 3L09A 1TZLA 1E0EA 1P2FA 2KL4A 4UUSB 3FXJA 2QVOA 3KZZA 3IUOA 4UUTA 3CMEI 3IRRA 2BZTA 3OYJA 1HA8A 5E3MA 2HOAA 2IGNA 2VJJA 3HGYA 5KAIC 1ZLKA 2A3SA 1M1EB 4MTDA 2EB7A 4CYCB 2E1NA 2O8XA 3EUHC 3KETA 3ISPA 4KJZA 3H0GJ 3PUBA 4LG0A 3KFWX 2LKXA 3ABLH 3I56I 2E5NA 1HKTA 1QHHD 3SYTA 2GIVA 2M5WA 4G6TB 1JJ6C 3OY9A 4KT6A 5CVIA 2DAOA 2BY1A 3HHGA 3ZMDA 3HOZJ 2CUZA 4DOZA 1S72I 3QU6A 3V7RA 1ON1A 1P92A 3TO6A 1WI3A 4W97A 3K70C 2L5QA 3HSRA 3DFGA 2Z1DA 3BG9A 2VODA 2OV7A 3BDDA 2BY0A 2O9LA 4MIMA 4JK1X 4JOMA 2QQ8A 2R7TA 3ECHA 4M74A 1YW7A 2JRTA 3LAJA 1Y56A 2LBFB 3ABMH 5KAFC 2XPWA 4BQQA 2DU9A 3K1PA 4PK4A 1ENHA 1X3ZB 4OIRF 3OIQA 3BG6A 2EINH 1R4NB 2JZYA 3I0TA 2J5PA 3OS0A 5D5WB 3LSHA 1FT9A 2CUJA 1KQ0A 1PVEA 3PNTA 2BW3B 2CW8A 3RJPA 2DT6A 2HI3A 2RV8A 1F5TA 1Y1WJ 2X85A 1OYWA 2A6HF 3IH3A 1YX3A 3DCFA 1QGPA 1D1BA 1X3WB 2HKOA 2LY1A 1GVDA 2E2HJ 1ZR4A 4A0ZA 2EFNA 4M3DA 3I5UA 4FE4A 3CCEI 3DBRB 2DOFA 4B3XA 2WAFA 1Z0XA 1IN4A 1Y8QB 6PAXA 2XAUA 3K70D 5CLSA 1A36A 2XRLA 2HOTA 3IAS2 1MNDA 2L02A 4P5OA 2CW7A 4P96A 2CQ7A 4HEA2 5HDNA 2MLKA 2M3AA 2O5RA 1ZK8A 3PO2J 3D5SC 2MFZA 2YSRA 1MBKA 3I54A 5GAEJ 3GYHX 3LA2A 1B8IB 4WF2A 4HF1A 1ZGJA 3L2CA 4G7OF 2EK5A 1R58A 1OR7A 4JX4A 4PZJA 3HUGB 2HWVA 3BPVA 1YW8A 3HKZN 4FHTA 1JGSA 1IRGA 3H3UA 5K5OA 2E1MB 3DPTA 1SFKA 2LKPA 4I99C 3HOWJ 3V7CA 2IS4A 1FOXA 1R49A 4CCLA 4F3QA 1I3AA 2IW5A 2O61A 1H89C 5LFAA 1TQPA 2DA2A 1ZAOA 4BAYA 2IA1A 1DUXC 2K9LA 3FKIJ 4A2UA 2O8KA 5K7ZA 3H3VK 2DMPA 2XAFA 1W1WE 3FIWA 3N05A 1XMXA 2DT7B 4IL6C 2M8GX 3LQQA 3H1CA 2RN7A 3F21A 5IT9Z 1JT6A 1YX5A 2NAZA 2RKHA 4IEJA 2JTVA 3GBGA 1GT0C 4N0BA 2G0EA 4J00A 4ZZDA 3N97A 5CPRB 4BEHB 2LP0A 2JK3A 2F2EA 3COAC 2EIKH 3MMYB 5AIPA 3P5JA 2R5ZB 3MEXA 2AHQA 3RPUA 4XKWA 3OYGA 2X1DA 3OIOA 2QKLB 3OOUA 4GO1A 1WWXA 3I58A 2ZC2A 5HS8A 3S3NA 1X2NA 4OOIA 3TP3A 2P7CB 3IKTA 2HS5A 3S8PA 3E5QA 3FXMA 5E1WA 5F0CA 3VYSB 3H36A 5CJ9A 4WWCA 3GTKJ 1X1DA 1KU3A 1LDDA 5ILSA 4BE1A 4G7HF 1KU2A 3KEYA 3P9IA 2P4WA 4KN4X 1GLNA 4ZYHA 2F5EA 1BR2A 1GV2A 4U0VA 2QBYB 1LEBA 1ZTRA 1MW7A 3H3ZA 4KA4A 2M87A 2XGDA 4YFXF 1DPUA 4EVIA 4L0YB 2MW8A 3M1CA 3EDPA 2RQPA 2X6XA 1N25A 4EGYA 5CQGA 1ACIA 2EFQA 4BE2A 4I01A 3LFUA 1SC7A 2BBYA 2VI6A 1H9TA 5IOYA 1V54H 3KP2A 2A68F 3BROA 3OMYA 2DYRH 5EG0A 2ECCA 1GXQA 3ESWB 5E1XA 5J1RA 4CHUA 4Y3OA 5LGTA 3CUQA 4RMNA 5CQEA 1BN5A 3FMSA 2W00A 2Z99A 4XM3A 2GA2A 3I3LA 3Q3SA 1YHQI 4C2UA 5IP9J 1MMDA 3C18A 5D5UB 5CVUA 5DUIA 5D4RA 2E7XA 2OBPA 2K27A 2GXAA 3M1EA 4ON0A 4AWXB 2LYCA 3ZPLA 5LD2C 1LEAA 3GVAA 2QSHX 3DTIA 3P7NA 1EF4A 1HBXG 1XTAA 5E18F 3SEZA 2W4SA 4DGWB 5LRRA 3BC8A 1IZ1A 1Z3XA 2CU7A 3MVPA 3OOPA 2VN2A 2EBIA 2FQ4A 1LE8A 2UXNA 3H9JA 4AC0A 4CCNA 4ZC3A 1HKSA 3CO6C 4KT5C 4L5EA 1SD5A 1YFHA 1RR8C 1FP2A 4MNUA 5M3FJ 1U8BA 2VKDA 3J7AO 4DZPA 5FD5A 1ETYA 1TT0A 2E7WA 2W57A 1O3RA 2RDPA 2R7SA 2VQHA 1XX5A 3J81K 2R7OA 3HHHA 1FOWA 3JRGA 2OCEA 4IHYA 2BW3A 1G4DA 2X6YA 2F48A 4AD9A 1G8XA 4M71A 3TOBA 4IF4A 4XKVA 4ENMA 5DD8A 3NWSA 4U7BA 1O7FA 4X0GA 2DQRA 2V1XA 5HNHA 2XPVA 4AM3A 4RGRA 2OU2A 1Y6IA 1B59A 2ZXHA 3L00A 4PSWA 4QPOA 5KCMA 1IO2A 2QF7A 2NS7A 4PJNA 2HOSA 2EZHA 2D45A 2C6YA 4KNYA 5FJ8J 1XDUA 2HQRA 3UR3C 1I50J 2E35A 3WGIA 4RB1A 2HDDA 3FK7A 2QM3A 2L2OA 3H5RA 5DTDA 1K7AA 3Q0VA 1VQ8I 3T0YA 4BBRJ 1YITI 1B8IA 1E17A 1TQIA 5D6FA 1Z91A 3KLOA 2Y0SA 3CCUI 3GTPJ 3R0JA 1U5TC 2VE8A 1VQ4I 4IJAA 4DW6A 4BUPA 2DBBA 1D1CA 1J0RA 3PFYA 3QYFA 4LFUA 4A3KJ 2FEZA 2F5CA 1T6SA 3HUGA 1TWGJ 1G3SA 1QZZA 2CQKA 4HG2A 3HPHA 4OIPF 1QZEA 4LB6B 4Z2YA 4BGDA 2KPMA 4MQ9F 1MD0A 1ETWA 1EJ9A 4LK1F 1QNTA 5L3FA 2LY9A 4HF2A 2IAIA 3FMQA 1P7IA 2W84A 2PN6A 2VL8A 4XRSG 2NYXA 5ERIA 4A3MJ 4G6DA 1O3QA 5J8FA 2ZJPF 2QUFA 2KIQA 1LB2A 3VDXA 4KYWA 3EUHA 4L5IA 2FA5A 3ZMTA 2HTJA 1XGSA 2X6WA 4MTEA 4KFCA 5EF6A 3BJAA 2OJED 1ZH5A 2L01A 3HTSB 2ACJA 4UXNA 3DQVC 3ECOA 1K6YA 2DA3A 3MQ0A 3RDIA 2QCOA 3WG9A 2CV1A 3DPUA 1J7KA 4CCJA 2M7BA 4BEHA 1XSVA 2JA5J 2ZKZA 4Q4ZF 5DV5A 4YFKF 3H0DA 2M8EA 2FMLA 4XLPF 4NDLA 2IGOA 3F6VA 2PX9A 3ZR8X 1XC5A 1ZGWA 2QEXI 1RUNA 2JA6J 3RQIA 1VQKI 2FE3A 2ID6A 1RKTA 3JRHA 1ZQ3P 2Y0SN 1N75A 4S0HB 4DYQA 2CH0A 4A3GJ 3IAM2 1FNNA 3IC7A 5E20A 1XMKA 2PI0A 1E2XA 2OCCH 1IG7A 2V6CA 4E7HA 1KYWA 3BZCA 4ENNA 2LK2A 2R93J 5ICGA 3LMMA 1JXSA 5C3EJ 4C2MJ 2K9QA 1J59A 1R5HA 3W2VA 1NH3A 3OWTA 1LQ1A 1CF7B 3HRMA 3U1DA 2NVTJ 2DO7A 2CQXA 2FUG2 3FWEA 4I98B 4E6KG 1YIJI 1KA8A 2IVMA 4U87A 4XSZF 4HNTA 2OC6A 4BJ6C 4YG2F 2WC2A 1XCVA 4ASNA 5ILVA 3F6OA 2DFFA 1LUJB 2FF4A 3BZKA 1X1CA 1K61A 2KDOA 3OL3A 4U7DA 2DOAA 3W6KB 2D1VA 2NNNA 3DU5A 3OIPA 2CRGA 5HOOA 2UV1A 2IEKA 2O6GE 1VQNI 1OCOH 3S14J 3CJSB 4DZJA 1IJWC 2R3SA 4G94A 4B48A 4LG0B 3JTHA 2W25A 5ED4A 2XC7A 2VQGA 4HX4A 1SANA 4WCGA 1T98A 1U2WA 4TV7A 3DU6A 3K4NA 1WZ2A 4ITVA 3H92A 2PG4A 3BTCA 1R1VA 2X51A 1ZREA 3GZNB 3DEWA 3S1NJ 1K83J 2VT3A 1UZCA 4DQ2A 5L3EA 4XN3A 1A6QA 5DM7F 1UFMA 5HLTA 2R7VA 2HR3A 1U5TB 1XGNA 3K4BA 2ME0A 1TL8A 2KFDA 1J09A 1SFXA 2DT5A 1S3JA 4GGGA 1SVLA 4MFDA 1JKQC 1MJ9A 4CH7A 1LKXA 2XVCA 1G59A 2OQGA 4G6QA 1T56A 3WGGA 3D5RC 4AVZA 4AU7A 5DCFA 3S2WA 2MG4A 1D0ZA 1W5CC 5H20A 2XKOA 1QPIA 3J80K 3CCVI 3J7YJ 1SAXA 4I76A 2K40A 2XF5A 3C7JA 2CQNA 1OKRA 3LSPA 5K7FA 2JWTA 2MBFA 1WPKA 4UY8I 2Z16A 1DP3A 2XAHA 3N4MA 3K4JA 5EZGA 4P1WA 2KJCA 3WHBA 3DBHB 3J81Z 2B7EA 1VF9A 2HPMA 2WY8Q 3TO9A 3SZGA 4CUGA 1ZG5A 4YIRX 5ICEA 4RGSA 2OTJI 1X4OA 3HOYJ 5LGNA 2NVXJ 2AO9A 2DFEA 4BH9A 1G2HA 4B3AA 5JLWA 3MWMA 1WJDA 4E70A 1R1UA 5K5RA 1ZKGA 3PM1A 3OR1C 4NQWA 1FLIA 2QKMB 2HZDA 1BL0A 1WGXA 2VQCA 2Y9ZA 3TP0A 2YX7A 1QO0D 1HKQA 4P9FA 2WA0A 2XV4S 3KP6A 2LC2A 2VC1A 2R5YA 3PL8A 1IUYA 2HQ5A 4L9TA 4XLFA 3F8BA 3ZQFA 2E2JJ 4M73A 2EFPA 4R1HA 2IS2A 1YRNB 1EA3A 4W1UA 3A2KA 4E7ZA 3OYMA 2K9MA 3WTXC 4V19K 3PO3J 1YJ9I 2CGPA 2NVQJ 2IXSA 4UB8C 1ZELA 4LIVA 3RZDJ 2KP6A 3A01B 3V8KA 4X1EA 2EQRA 1XN7A 2I10A 1S7OA 2JRMA 3LSKA 1H88C 2JA8J 3T1BA 5EEAA 4QWQA 5F1JA 2RQQA 4BDYA 3VWBA 4LLNA 2VE9A 2ZBKA 3D5LA 2ZJRF 2VC0A 4EMSA 1DGRM 3ZQGA 4ZZLA 1YO5C 4IHTA 3GEZA 3U9GA 5JR3A
chains in the Genus database with same CATH topology
3EGVB 1YHQI 5GAEJ 2FOWA 1VQLI 3CMEI 2ZJPF 5DM6F 3CF5F 2E34A 5GAHJ 3I55I 3G4SI 3CCVI 3J7YJ 3CJRB 2QA4I 2H8WA 5GADJ 1YJWI 1FOXA 5GAGJ 2JQ7A 1VQ5I 1VQOI 1FOYA 3I56I 4UY8I 4IOAF 2QEXI 2ZJQF 3CC2I 1VQKI 3CCRI 1S72I 3CCJI 2OTJI 1FOWA 3CJTB 3CJQB 3CC7I 1YI2I 1VQPI 3CCMI 3CCSI 3DLLF 2NXNB 3CCQI 1VQ7I 1YIJI 2OTLI 1MMSA 3CCLI 3CMAI 3G71I 2E35A 3G6EI 1VQ8I 2K3FA 1YITI 1WIBA 3CCUI 1VQ6I 1VQNI 1QA6A 4IO9F 1VQ4I 4V19K 3CJSB 3J7ZI 3CD6I 1YJ9I 3PIOF 3PIPF 2E36A 5JVGF 3CC4I 3CCEI 1Y39A 1VQ9I 1ACIA 1VQMI 2ZJRF 1YJNI 5DM7F 1HC8A 4IOCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGV B;  1YHQ I;  5GAE J;  2FOW A;  1VQL I;  3CME I;  2ZJP F;  5DM6 F;  3CF5 F;  2E34 A;  5GAH J;  3I55 I;  3G4S I;  3CCV I;  3J7Y J;  3CJR B;  2QA4 I;  2H8W A;  5GAD J;  1YJW I;  1FOX A;  5GAG J;  2JQ7 A;  1VQ5 I;  1VQO I;  1FOY A;  3I56 I;  4UY8 I;  4IOA F;  2QEX I;  2ZJQ F;  3CC2 I;  1VQK I;  3CCR I;  1S72 I;  3CCJ I;  2OTJ I;  1FOW A;  3CJT B;  3CJQ B;  3CC7 I;  1YI2 I;  1VQP I;  3CCM I;  3CCS I;  3DLL F;  2NXN B;  3CCQ I;  1VQ7 I;  1YIJ I;  2OTL I;  1MMS A;  3CCL I;  3CMA I;  3G71 I;  2E35 A;  3G6E I;  1VQ8 I;  2K3F A;  1YIT I;  1WIB A;  3CCU I;  1VQ6 I;  1VQN I;  1QA6 A;  4IO9 F;  1VQ4 I;  4V19 K;  3CJS B;  3J7Z I;  3CD6 I;  1YJ9 I;  3PIO F;  3PIP F;  2E36 A;  5JVG F;  3CC4 I;  3CCE I;  1Y39 A;  1VQ9 I;  1ACI A;  1VQM I;  2ZJR F;  1YJN I;  5DM7 F;  1HC8 A;  4IOC F; 
#chains in the Genus database with same CATH topology
 2HNH A;  2BY2 A;  3FXQ A;  3VSK A;  2ECB A;  3RTR A;  2L54 A;  4GXO A;  3VB2 A;  1P7J A;  1L0O C;  2I8D A;  4Z6Y A;  5E1Z B;  3GO5 A;  4OAZ A;  4HLY A;  2QEN A;  3OV8 A;  2M0C A;  1H8A C;  5FKK A;  3ZMZ A;  4LLL A;  2K02 A;  4A12 A;  1U0J A;  2LRD A;  1WJF A;  2A6E F;  3LST A;  4CCO A;  4DBR A;  5TRD A;  2A07 F;  2DPD A;  4BXX J;  1F9N A;  4EGZ A;  2ZME C;  4ZDP A;  2O7O A;  3IV5 A;  2CJJ A;  2MYS A;  4RB0 A;  3S32 A;  2FU4 A;  5EEH A;  3P9K A;  3WTW C;  2XHK A;  4EEF G;  4N9I A;  2JMW A;  1RR7 A;  1MH4 A;  2ISZ A;  4CGZ A;  3FK6 A;  5JHU A;  2GXB A;  2H8R A;  1YIO A;  3LOC A;  4IRI A;  3ELK A;  5LBQ A;  2MH9 A;  4R79 A;  3P9C A;  3CP2 A;  2H94 A;  3QOD A;  1QPM A;  3GZ6 A;  4MFE A;  1RPW A;  3RCO A;  1SMT A;  3S1M J;  1TQM A;  3T5X A;  5D5X B;  4DYC A;  2ZCW A;  3CF2 A;  5B1A H;  1WJB A;  4A3E J;  3E97 A;  4G8X A;  3TO7 A;  1XGM A;  2L4M A;  1QBJ A;  2Y2Z A;  4LJZ F;  2STT A;  2MH2 A;  3GZ5 A;  1H0M A;  1WFX A;  3RZO J;  4HPQ A;  1LVK A;  3HB9 A;  1S8N A;  2TDX A;  2QWW A;  1DPR A;  1KU9 A;  3CCS I;  5J47 A;  2EPF A;  5EG0 B;  4II2 A;  3F8N A;  1YTY A;  3TQN A;  2FD5 A;  3H5N A;  5J1Y A;  3CUQ B;  5AIQ A;  1TWC J;  2CWE A;  5CKT A;  1IUF A;  1LDK B;  4FE7 A;  3D0S A;  1IXS B;  3GFI A;  3PJR A;  2VOO A;  2BE5 F;  1ETQ A;  1PP7 U;  1ZN2 A;  1X1A A;  2F4M B;  3BPX A;  4L0Z B;  1X58 A;  4ZDL A;  4HQM A;  2VOP A;  1U5T A;  3VOD A;  2QQB A;  2L7Z A;  4M9S A;  4PJ0 C;  4XNF A;  2ZSH B;  3BR3 A;  2YUS A;  1LE8 B;  1AOY A;  1B6A A;  1FTT A;  2HQN A;  4IXA A;  2Q2E B;  1JKO C;  1QA6 A;  2DJI A;  3LSJ A;  1F1Z A;  5DEQ A;  3IWZ A;  1BI0 A;  4MQV A;  1TBX A;  1BR4 A;  2NOJ B;  3TL4 X;  1ETX A;  1HST A;  4XLH A;  5AON A;  3VYR B;  1RIO H;  2ESN A;  2MGQ A;  4HV5 A;  2H27 A;  1Y39 A;  2IPQ X;  1VZ0 A;  1VQ9 I;  2XSJ C;  5M5Y J;  1T0F C;  5J8C A;  4E7K A;  3A03 A;  4D5C A;  2XUB A;  1Z05 A;  4ZH4 F;  2LNB A;  3TGN A;  3RKW A;  1MSF C;  1GUU A;  3VFZ A;  1A35 A;  3A02 A;  4IVN A;  2FOW A;  2GIZ A;  4HRI A;  3Q9S A;  4AIJ A;  3AAF A;  1CGP A;  1X2M A;  2E2I J;  3O2P E;  4LLG F;  2COB A;  1EH6 A;  1V5G A;  3J80 Z;  4YRV A;  2LY2 A;  4J19 A;  2CQQ A;  1E3H A;  3K0L A;  3HSE A;  2D2W A;  3BG3 A;  4FT8 A;  4KMU X;  3CJN A;  1MBJ A;  4RGU A;  3NRV A;  1MKM A;  3MZH A;  2CV2 A;  2EV0 A;  2MSY A;  1R7J A;  3SZT A;  3C2G A;  1VQ5 I;  2VLA A;  2X48 A;  3L9F A;  3CLO A;  4IHV A;  3FBN B;  4CIC A;  3U21 A;  3ZCO A;  5HDK A;  4PGH A;  1U8R A;  2ZNZ A;  4L9V A;  2DK8 A;  3S17 J;  1K78 A;  1OCT C;  1E3O C;  2ZME B;  2F6C A;  2P7V B;  4WK8 F;  1A5J A;  4C3I J;  1KQ9 A;  2JVH A;  4UV9 A;  3MZ8 A;  1HF0 A;  2F4O B;  1YRN A;  1IXR C;  4LD5 A;  1T95 A;  2XB0 X;  3SFI A;  1JUM A;  2LH9 A;  2ZNY A;  4QIW N;  2D1H A;  2ICW G;  3HPG A;  3CCM I;  5DCM A;  3VSL A;  4E4H A;  3A01 A;  1BI3 A;  2BXZ A;  1VQ7 I;  4S05 A;  3GFM A;  2FXA A;  2KRH A;  3BOQ A;  3F8C A;  4A5M A;  4NUB A;  1K6O A;  1UEL B;  1VND A;  2IGK A;  1V3F A;  2LFB A;  2UUZ A;  2VBY A;  3S2H J;  4ESJ A;  3JRA A;  3L2V A;  3PNV A;  4A0X A;  2W48 A;  1XPX A;  2ME6 A;  3QOP A;  1BBY A;  4JX5 A;  2KIM A;  3F3X A;  5IPA A;  1OPC A;  1UAA A;  4I2O A;  2ELJ A;  3AG4 H;  2VBW A;  4UUV A;  4IHS A;  2FSW A;  4C3J J;  3CD6 I;  2HVS A;  1S7E A;  2IGM A;  2JT1 A;  1JGG A;  1W5T A;  5F0F A;  4M9Z A;  3AFH A;  1PYV A;  2LLK A;  2IS1 A;  1FJL A;  1ZRF A;  4RGX A;  2HDC A;  1MBH A;  1IN7 A;  2PMZ A;  1Z67 A;  3I4N J;  1P4A A;  1J2X A;  4I0B A;  3V8J A;  5FRM A;  4XK4 A;  2EZI A;  3JR9 A;  1RET A;  4XL9 A;  1Z9C A;  3W6V A;  3FHN A;  4AIK A;  5LEK A;  3IH4 A;  1YOV B;  3KX2 A;  3BY6 A;  4PJM A;  2FNP A;  4BHP A;  2JSP A;  5TGT A;  3OYH A;  1Y0U A;  1W5S A;  4R8H A;  2EFW A;  2RAE A;  1RRJ A;  1WSU A;  2IP2 A;  3F23 A;  4C3H J;  2PLY A;  4KUM A;  4RM2 A;  3EYI A;  4PJJ A;  3B6A A;  3OYK A;  4IHX A;  2E34 A;  3TOA A;  5FB2 A;  4IPA A;  4IHW A;  5L3B A;  4BXF A;  3HBL A;  1LJ9 A;  2Q8K A;  1BA5 A;  2M9H A;  3K9T A;  2BGC A;  1I1G A;  1X4P A;  3JRD A;  1OYY A;  4FQG A;  2H8W A;  4EJT A;  4XLA A;  2OQR A;  2DA6 A;  1MMG A;  4AID A;  3HGG A;  4ENK A;  2ZXJ A;  2R92 J;  2ZB9 A;  4A0Y A;  3W2A A;  2R7U A;  2K3P A;  1SVO A;  3OS2 A;  1G6N A;  3LSR A;  4A93 J;  2FOK A;  1OCC H;  4IOA F;  1JE8 A;  3M8J A;  4CSW A;  3QP5 A;  5LEJ A;  4QPQ A;  4A3D J;  2X9D A;  3KLN A;  2MLG A;  4N4O B;  3E6B A;  3OL4 A;  1W0T A;  4MHG A;  1D8J A;  3MAJ A;  4KMF A;  2DDA A;  5ILU A;  2Q2E A;  4N9H A;  3AKZ A;  3H5A A;  2RVC A;  5EGO A;  3QRF F;  2PMZ N;  2OAZ A;  3CMY A;  1I3Q J;  2V79 A;  4B47 A;  1GDT A;  2M34 A;  2A05 A;  2DW4 A;  1Y0N A;  3U2R A;  1H9G A;  2ISY A;  3BTL A;  3EPZ A;  2PQ8 A;  3PQJ A;  3ZQC A;  2KLO A;  3LSG A;  2W24 A;  3R4K A;  3ZQH A;  4OWR B;  1MMS A;  1P9Q C;  2BVM A;  3DP7 A;  5LHI A;  4CCK A;  4HX7 A;  1ZR2 A;  1HCR A;  4F93 B;  2R7Q A;  4ENJ A;  2EJR A;  3CES A;  5FRO A;  5ICF A;  1J5Y A;  3EYY A;  1WJ5 A;  4JYK A;  3Q5F A;  2CV0 A;  2WY7 Q;  1WJE A;  3B73 A;  1UHW A;  4NBQ A;  3OYB A;  3PIO F;  3V42 A;  3TBI A;  2E36 A;  5GPC A;  4HV6 A;  2E19 A;  3BTI A;  2W85 A;  2VBX A;  4EM0 B;  1X1B A;  4GYG A;  5D5V B;  4RM3 A;  5FFZ A;  3BCB A;  3FZV A;  2ZO4 A;  3QPT A;  3GTG J;  4II3 A;  3WTT C;  3WTZ A;  3WU2 C;  4FCY A;  2LG4 A;  2W1O A;  2JA7 J;  3VPR A;  5EDN A;  4PGG A;  3JRE A;  2XF6 A;  4RAZ A;  2P5V A;  1A31 A;  3SHF A;  5D8L B;  4A6E A;  3FXK A;  5F27 A;  1ZGA A;  3RKY A;  3ERE D;  5CVV A;  3SDB A;  3MCZ A;  2P5K A;  1FBU A;  3MFK A;  4HLX A;  2ZME A;  1F4K A;  1BM9 A;  4NQW B;  4B44 A;  4O3M A;  3LA7 A;  4XBF A;  4ZTF A;  4HX8 A;  2ELK A;  2V7F A;  3FXR A;  4CCM A;  3SJM A;  1B4A A;  3ERM A;  5LGU A;  2KIS A;  2XDV A;  4FET A;  4JP0 A;  2Y30 A;  4J01 A;  3OYC A;  3K4M A;  2QA4 I;  3PSF A;  2ZXI A;  3G1M A;  5GAD J;  4FX4 A;  3WTY C;  1YJW I;  5GAG J;  3W3C A;  3HL2 A;  2R5Y B;  1RUO A;  2K7L A;  1BR1 A;  4XLE A;  1FSH A;  1V4R A;  3O6B B;  1WJC A;  2VBZ A;  1MDM A;  5JI6 A;  2GWR A;  3BZ6 A;  1N78 A;  5HOD A;  4RLF A;  2JJ7 A;  2VAS A;  3F9K A;  2X1C A;  2ZJ2 A;  3ZGK A;  2NNY A;  4Q48 A;  2Z3Y A;  3WE2 A;  4ZJZ A;  3F8M A;  2E60 A;  3WG7 H;  3K4C A;  3CCJ I;  3DWL E;  3AL0 C;  1R5I D;  2CS3 A;  2JUC A;  3RKX A;  4EJU A;  5BPI A;  4MGR A;  5BNG A;  4EV0 A;  4B1R A;  4L18 B;  1F43 A;  1WH5 A;  4ZYE A;  1FMW A;  4ZTJ A;  4ABZ A;  2GAU A;  1DDN A;  2GZW A;  2XAS A;  1VFC A;  5GTI C;  2L3D A;  5F6F A;  2PMU A;  3QP6 A;  2ZFW A;  2RNG A;  1SFU A;  1RC9 A;  2V26 A;  2JPB A;  1P4X A;  4D1Q A;  3PSI A;  1TW3 A;  2PEX A;  2F4I A;  2DFI A;  3BR5 A;  4F55 A;  3M4O J;  3AG3 H;  1APL C;  2P81 A;  4D9J A;  1OJL A;  3PQK A;  1XS9 A;  3ZMU A;  1SMY F;  2QSG X;  3GUD A;  4KIS A;  2DYS H;  1P4W A;  2XRN A;  5H2F C;  2L9V A;  2R7Z J;  3CP8 A;  1U6G A;  1FY7 A;  3E5X A;  4I0A A;  2JVG A;  3DEU A;  3DXJ F;  3BT9 A;  1OLT A;  5K1Y A;  3GLL A;  5JFR A;  2OZU A;  3S3M A;  3J7A Y;  2M4G A;  3C2H A;  4HW0 A;  2G7H A;  1TC3 C;  4MO7 A;  1R22 A;  2VJI A;  2OPT A;  3ONQ A;  2KRF A;  1HW2 A;  4UNO A;  3K4L A;  1EV7 A;  2VON A;  1Y1V J;  4BE0 A;  1D5Y A;  3KYD B;  2FMY A;  2F5F A;  4AYB A;  2L9N A;  4OMZ A;  4F91 B;  1W4M A;  2L7M P;  3KEQ A;  5EEG A;  2DDB A;  4O5V A;  1GHC A;  2EFO A;  3WTV C;  4M72 A;  1W7P D;  3ZQL A;  2HYG D;  5E3L A;  3L7W A;  1RES A;  1LVA A;  1K4S A;  4V2G A;  1TLH B;  1FP1 D;  2J5O A;  4YEL A;  4KIG A;  3NAU A;  4WXC A;  2ZSI B;  3IL2 A;  3GTM J;  2VKE A;  3A0H C;  4BBS J;  3FXL A;  1WVR A;  3CO7 C;  4A3B J;  1JUS A;  1Z6T A;  2CG4 A;  4B4C A;  1JUP A;  1YW9 A;  2WV0 A;  5L3D A;  4BL0 B;  4BQN A;  4UHT A;  3QOE A;  1U9O A;  3O8H A;  2DI3 A;  2XGE A;  4KIT B;  3HOX J;  5BPD A;  1R71 A;  2V1U A;  3C2B A;  1SAU A;  3HSF A;  1I39 A;  3CCR I;  3FF5 A;  5E8I A;  1FSE A;  1MGT A;  1KGS A;  4RBO A;  2V1N A;  1JT0 A;  3FM3 A;  2K9S A;  2VUM J;  4IQ4 A;  2HFH A;  3CJT B;  5DUK A;  3MKY B;  2VT2 A;  1V5F A;  2DA4 A;  4Q5S F;  3M7G A;  1PUF B;  2LOO A;  2HDW A;  2PMH A;  4RS8 A;  5HS9 A;  3ZQ7 A;  4CYD A;  2X1E A;  3R61 A;  4WX9 A;  4C9Y A;  1ZG1 A;  1J9I A;  3Q0U A;  2RGV A;  1D0X A;  1IRF A;  3WTU C;  2JA2 A;  1DU0 A;  4KIF A;  4KIC A;  5CYV A;  3DLL F;  4KDP A;  1IGN A;  3LWF A;  3HZJ A;  3E3V A;  2HVQ A;  3BLY A;  3K4K A;  3W2W A;  5BMZ A;  4WXH A;  5D6E A;  4MEY F;  1LFP A;  1I6H J;  3DBL B;  4NC6 A;  1TT5 B;  3CZ6 A;  5F08 A;  4M6Y A;  5FKM A;  3CCL I;  1HOM A;  2Y31 A;  2VPR A;  1IN6 A;  3U1K A;  3BR2 A;  4D0P A;  5TJJ A;  1I6X A;  4HF0 A;  3F0C A;  4A69 C;  3WU0 A;  2K3F A;  5DDG A;  2W82 A;  2EZL A;  3S1Q J;  1T08 B;  4LGW A;  3QPS A;  9ANT A;  2IA0 A;  2YR2 A;  3FXO A;  2DMU A;  3ABU A;  2TCT A;  5GPA A;  2GOM A;  4GRI A;  3TDZ C;  1T2K A;  3C1D A;  2PJR A;  4Y17 A;  3Q9V A;  5L3C A;  1R00 A;  1R1T A;  3HJE A;  4YEJ A;  5DD4 A;  1IC8 A;  2KIF A;  1B9M A;  2CUF A;  5IY5 H;  3JRF A;  2IRF G;  3E6M A;  4LB5 A;  4CZZ A;  3FKJ A;  2K86 A;  2CUE A;  3QWL A;  5E8G A;  1IRX A;  1K78 B;  4FIS A;  3OSF A;  1FTZ A;  3ZQQ A;  4HDV A;  2F5D A;  1MJB A;  3EGV B;  1ON2 A;  1D5V A;  2H09 A;  2QGU A;  1ERD A;  2EWN A;  3ABK H;  1MNE A;  3ZQI A;  3WHC A;  2XGX A;  3H9Q A;  4KN7 X;  3GTQ J;  3CLQ A;  4CDG A;  5J4V A;  2Y48 A;  3CCY A;  5DCM B;  2LF8 A;  2UXX A;  3CF5 F;  1NG6 A;  2R4G A;  1FC3 A;  1WRJ A;  4LIT A;  2Z33 A;  3SZP A;  3QPL A;  3UNG C;  4BQO A;  3HOS A;  2K9N A;  3HEF A;  4ESF A;  2DK5 A;  1S7A A;  2A61 A;  4JQF A;  2HVR A;  2STW A;  2JQ7 A;  2P5L C;  3GWZ A;  3LL7 A;  4OIQ F;  4JBA A;  3E6D A;  3H35 A;  2E1O A;  1TNS A;  4DNC A;  3LNQ A;  3ZN1 A;  1R6R A;  2B0L A;  3NQO A;  1PP8 F;  4AVP A;  3B02 A;  2TRT A;  3E1S A;  5D4S A;  2L9R A;  4ANJ A;  2NS8 A;  1ITY A;  4NB5 A;  4BAC A;  5FLX K;  1Z3Y A;  4I6Z A;  2JPC A;  2KHM A;  2Y75 A;  2M7A A;  3OS1 A;  4BDZ A;  4ZYG A;  2BHZ A;  2EIM H;  4Y4R A;  4B43 A;  2CW0 F;  4F52 A;  2Y69 H;  3HM5 A;  1A6I A;  4XR6 A;  4OMY A;  2NVY J;  2LVS A;  4M3B A;  1D3Y A;  2NXN B;  3KP4 A;  1F36 A;  5A2Q K;  2B9S A;  1T38 A;  3OYL A;  1RNL A;  3GME A;  4A6D A;  3KCC A;  1KU7 A;  4A3F J;  3BCA A;  3FX3 A;  3CDL A;  2LF7 A;  3HG9 A;  1FBQ A;  3K7A J;  3ULQ B;  2G9W A;  2A5W A;  1W36 C;  2OZ6 A;  1PDN C;  2E1M C;  3CTA A;  2DMQ A;  4OAY A;  1EH8 A;  5BS6 A;  4RB3 C;  4IO9 F;  1R9T J;  3HIF A;  4HNV A;  2XAG A;  1XGO A;  2ZXW H;  1XG1 A;  4HSR A;  2RRE A;  3GCM A;  3MKW B;  4K2E A;  3BR1 A;  2BEO A;  4NNJ A;  2G7U A;  3DF8 A;  2XRO A;  1IN5 A;  4UV8 A;  4Y33 A;  1VQM I;  5JLX A;  5L3G A;  1U78 A;  1JKP C;  2AQF A;  3IKV A;  2LMD A;  1UST A;  5LLQ A;  1ODD A;  5B3S H;  4U0Y A;  2CSO A;  2DA5 A;  2ELH A;  4BXU A;  4IOC F;  1ETV A;  4X6A J;  1S5L C;  2KZG A;  5EGO B;  4BKX A;  1VQL I;  3K69 A;  1S29 A;  2IA2 A;  3KP3 A;  4XKB A;  1TP4 A;  4P55 A;  1WJA A;  3GTL J;  1I5Z A;  1YYV A;  5FKL A;  4D7M A;  4XON A;  2L9S A;  1PUF A;  4BJ5 C;  3BR6 A;  3S3O A;  2VJ5 A;  5F64 A;  5H6Q A;  1MMA A;  2K4B A;  5JVT A;  1TTY A;  5C4J J;  5F1R A;  2E1C A;  3CUO A;  1W36 D;  4N4N B;  4EM2 A;  5J40 A;  1MSE C;  1AKH A;  4HBL A;  1D0Y A;  2YX4 A;  1FIA A;  2Q1Z B;  3IWF A;  3REO A;  1JKR C;  1OFC X;  4QTR A;  2A69 F;  1ZRC A;  3GTJ J;  3H9G A;  3HKZ A;  2FX0 A;  3DLA A;  4BQA A;  5EJC A;  5HS7 A;  3HXL A;  4XRF A;  2LTP A;  1QZY A;  3HRU A;  3O3K A;  5BOX A;  3SFZ A;  3I71 A;  3TMO A;  1FEX A;  1YS6 A;  1KON A;  3RI4 A;  3WGH A;  4FX0 A;  1P6R A;  5J4Y A;  1FOK A;  2DMN A;  5M3M J;  2VIX A;  1FIP A;  3SQN A;  2E5Z A;  3KE2 A;  1XSD A;  1BC7 C;  2QQA A;  1USS A;  1W7P A;  3K10 A;  1W0U A;  1ZRD A;  3QQA A;  4LIU A;  3KYL A;  1YG2 A;  2QSF X;  2KJB A;  3M9A A;  4HOB A;  4NHJ A;  3BG5 A;  3SXY A;  1IN8 A;  2V9V A;  2FBI A;  5B5E C;  1FPQ A;  2PBI A;  3BWG A;  2OTL I;  5BQT A;  4HA8 A;  3RYR A;  2MD0 A;  3L2Q A;  2QZ8 A;  3KZY A;  2IBD A;  1YE9 A;  3CMA I;  4M3E A;  4BHB A;  4PDK A;  3JSO A;  1MJA A;  3NWT A;  2H6C A;  1WI9 A;  2RNJ A;  3CDI A;  3R60 A;  4O6J A;  3VOE A;  3VYT B;  4PUS A;  4AUX A;  2X4H A;  4GCV A;  1C0W A;  1FWZ A;  1NG7 A;  4PJL A;  1WIB A;  3JCU C;  1HQC A;  4BJT A;  4A3C J;  3GW2 A;  1T39 A;  3PIP F;  1UHS A;  5JHF A;  4RAF A;  1Z6R A;  2JN6 A;  2VKH A;  4XLC A;  5HLH A;  1ZHF A;  1MDM B;  2EA4 A;  2WTE A;  2HYF A;  1SD4 A;  4FAS D;  2W7N A;  4XOR A;  3OR2 C;  2XKP A;  4IKF A;  3JRC A;  2VJ4 A;  3HRT A;  4UVA A;  3RSN A;  4B09 A;  2DN0 A;  3GF2 A;  3I64 A;  5F04 A;  2KQR A;  1IW7 F;  3A1Y A;  3HOU J;  1A04 A;  1Z7U A;  2YU3 A;  4NC7 A;  3ASO H;  4L9J A;  3FXU A;  3DPL C;  4BNC A;  3JSP A;  1B72 A;  2HZT A;  2OD5 A;  1NK3 P;  1TNT A;  1JJ8 C;  3E5U A;  5DM6 F;  1CQT A;  4A3L J;  2F5V A;  5FKN A;  2XIG A;  1BW5 A;  5FGM A;  3V4G A;  2XPU A;  3WOD F;  3LAP A;  2KIU A;  2WWY A;  3ASN H;  2L4A A;  2X6O A;  3PUF A;  4YFN F;  3TED A;  2DA1 A;  1BJA A;  4RDU A;  2LDU A;  2V6E A;  1BIB A;  3GFL A;  2B63 J;  3GXO A;  2UWM A;  1UG2 A;  1LNW A;  2ETH A;  2PJP A;  1VQO I;  3ML6 A;  1FOY A;  2VB6 A;  4NC8 A;  2P6S A;  3BQY A;  3JRI A;  5FLX Z;  2VXZ A;  3X2Q H;  5D8K B;  1WHU A;  2MD5 A;  2HTS A;  3ZXS A;  1IV6 A;  3IH2 A;  1WQ2 A;  5HLG A;  3VEP A;  4CXF A;  2QYO A;  2Z9O A;  1X19 A;  3S15 J;  4H0E A;  2V9K A;  4E7S A;  4ZYD A;  1RZ4 A;  3GLX A;  3KZI C;  3MZY A;  3R6S A;  3G3Z A;  2R0Q C;  1Z1D A;  1GV5 A;  4OU0 A;  4UUS A;  4QSH A;  1PUE E;  1HXD A;  4XSX F;  3ZOB A;  1O3T A;  2WAD A;  3FMR A;  1VQP I;  4FTH A;  5A2Q Z;  4Y7N J;  4EJO A;  2JSC A;  2NOG A;  5FKO A;  4LG3 A;  4UB6 C;  4ZDO A;  3KYC B;  4IRH A;  3CCQ I;  3M3Y J;  1ONV A;  1OYI A;  3QYB A;  3NEU A;  3DV8 A;  5HNF A;  4CYC A;  1TW2 A;  2R7W A;  2GBY A;  3OYD A;  4L9N A;  4E7L A;  3BP8 A;  3E7L A;  1ULY A;  3MD2 A;  1O57 A;  3BG7 A;  4LOC A;  4UVC A;  3DEE A;  4C30 A;  2N8G A;  2KKO A;  5TIS C;  2DCE A;  2VXD A;  1MZB A;  4OIN F;  3GFJ A;  3JTG A;  1QU3 A;  1BC8 C;  3M07 A;  4XKC A;  2BV6 A;  2UZK A;  2CMP A;  4GDF A;  1VQ6 I;  1XCB A;  2VQL A;  1Z77 A;  2DXI A;  4H4K C;  4M3G A;  2PFB A;  4LK0 F;  2LR8 A;  4BYY A;  2XSD C;  4GYI A;  2NRA C;  4BU2 A;  1STZ A;  2XB5 A;  1V55 H;  3F22 A;  2DTR A;  5K5Q A;  3HDD A;  3I59 B;  2FRH A;  3LA3 A;  4KIB A;  2Z2S B;  3OYI A;  1R23 A;  3G1O A;  1IRZ A;  3QU3 A;  1D1A A;  4RAY A;  1B1B A;  4BY7 J;  1MBG A;  5J1U A;  4XN0 A;  2ZFU A;  2R7D A;  1BIA A;  2LBF A;  2AS5 F;  2AQE A;  5DYM A;  4IZZ A;  1AHD P;  3BR0 A;  3C3W A;  1FYL A;  5CVR A;  4ETS A;  3TDU C;  2O0Y A;  1IF1 A;  1I1S A;  4XLN F;  5B66 C;  3OYF A;  1KQ8 A;  4F92 B;  3K1M A;  3A0B C;  2EZK A;  2R7F A;  3EQL F;  3FDY A;  3ZMS A;  3ZN0 A;  3O8G A;  1BI2 A;  4BHC A;  1YQA A;  2K5C A;  1HW1 A;  1MBE A;  3G4S I;  5C44 J;  2GM4 A;  4IQJ A;  3E0J B;  1G3Y A;  1Y8R B;  2DJN A;  2GA1 A;  5HDG A;  3OYE A;  1BOA A;  2VKV A;  3CJR B;  4RAG A;  3F72 A;  1L3L A;  1ORK A;  1JI8 A;  3JAM K;  1QVT A;  1RI7 A;  1AA7 A;  2P0W A;  4V2F A;  1FZP B;  1FMV A;  1REP C;  4E7J A;  1SEU A;  3VYU B;  1HDD C;  5C4X J;  3BJO A;  1Q1V A;  4UVB A;  4DBQ A;  1GVJ A;  2L0K A;  5EYR A;  2VPL A;  2ZJQ F;  4U88 A;  1QRY A;  1YLF A;  2M45 A;  4GFB A;  1HLV A;  2CFX A;  1BW6 A;  2Q0O A;  3R0A A;  1OCP A;  2PJR B;  1IXC A;  5F0H A;  4XIC A;  2XAJ A;  1SFE A;  3ZP5 A;  2EIL H;  1YI2 I;  2CFO A;  5IYC J;  3DKW A;  3DTK A;  1FYK A;  3EUK L;  2H1L A;  3V8L A;  1T8I A;  3HC7 A;  2WAE A;  1DP7 P;  3I53 A;  2R7R A;  3K1N A;  4S04 A;  1X1P A;  2FJ1 A;  4XRS A;  3IRQ A;  1SFO J;  3LQR A;  1ETO A;  2MC4 A;  1S9H A;  5IT3 A;  3ABT A;  1LFB A;  1Z7L A;  3ZRG A;  2P6T A;  4IRG A;  3G6E I;  3MKZ A;  3WE3 A;  2L7K A;  1ZAR A;  2WV1 A;  3RYP A;  1LFU P;  1HSJ A;  1FYM A;  2GOX B;  1TWH J;  1S6L A;  3KEO A;  5J3L A;  3V7S A;  1UMQ A;  2DOE A;  2XAQ A;  1XSX A;  2X0L A;  4EJW A;  1U9N A;  3RQ4 A;  2CO5 A;  3AG2 H;  2RC4 A;  4MLO A;  5GTH C;  2HGC A;  4D5F A;  2DTZ A;  2HU9 A;  2OUM A;  1IAW A;  2IJL A;  5KK1 A;  1SVM A;  5E3N A;  2A6T A;  1DQU A;  2Y9Y A;  4L5J A;  5J6X A;  2HYJ A;  2V1D A;  4M9X A;  1YJN I;  2DFH A;  2QLZ A;  3B6C A;  1BJZ A;  4LMY A;  4IX7 A;  2I5U A;  2R5Z A;  2MC3 A;  4F7Z A;  2WB1 A;  1G3T A;  1WH7 A;  1SD6 A;  2HEO A;  1FBS A;  4Y15 A;  2QQ9 A;  5KHD A;  3Q0W A;  1OIS A;  1AU7 A;  1T0F A;  3SDG A;  1POG A;  3IHU A;  4XOP A;  3LFK A;  4CA0 A;  2XGC A;  2YU9 J;  4DIQ A;  4A3I J;  1NK2 P;  1FX7 A;  1OQY A;  3PFI A;  4PSX A;  3I55 I;  3E6C C;  2V9P A;  5FLV A;  1U3E M;  2JUG A;  2EV6 A;  3G2B A;  3DTE A;  1DU6 A;  2Z5U A;  4HAM A;  1T33 A;  1OR7 C;  4RA2 A;  1TWF J;  5IP6 A;  2QBY A;  3TW7 A;  2DQL A;  3RIR A;  4EM1 A;  2DLL A;  1MIJ A;  2D5V A;  1D8K A;  3DKY A;  3M8F A;  1K4T A;  1QVU A;  2AXL A;  3CC2 I;  1ETK A;  4JX6 A;  4M6X A;  1JHH A;  2GLO A;  2BOL A;  1R5G A;  5LRS A;  4RB2 C;  1NTC A;  5FLM J;  5LHG A;  2KMU A;  4MEX F;  3PNY A;  5FD6 A;  5M5X J;  1MNM C;  4Y52 J;  1PJR A;  4WXD A;  3I4P A;  4YII A;  4HYE A;  3L2W A;  2DMT A;  3BJ6 A;  3KIO A;  4EQQ A;  3CC7 I;  2ESH A;  3MKL A;  1BOB A;  4XQF A;  2IT0 A;  3K6G A;  1OCZ H;  5HLI A;  1Q1H A;  3W6J B;  2FBK A;  4I02 A;  2BY3 A;  2BYV E;  3CQZ J;  3L2U A;  3FIS A;  2EIJ H;  4M3F A;  4A5N A;  1TWA J;  3GTO J;  3S93 A;  3UKG A;  3FBI B;  3I59 A;  4PFO A;  5DS9 A;  5KVR A;  1LPQ A;  2WB1 N;  1IDY A;  4M6V A;  2CYY A;  3KP5 A;  3S2D J;  2Y0M A;  1E3P A;  3KPH A;  3SEQ A;  3AG1 H;  2BXY A;  4CO8 A;  2O3F A;  3G71 I;  5E17 F;  1B9N A;  1VTN C;  3ZMV A;  2EV5 A;  1ZYR F;  4I09 A;  4I7H A;  4G9Y A;  3L2R A;  5FFX A;  1IV8 A;  1JHF A;  4ZYA A;  1KYZ A;  1XMA A;  2MAB A;  1RKW A;  4D7N A;  1EKE A;  3J7Z I;  1AKH B;  2KZV A;  4XID A;  5FRN A;  3HTU A;  5LHH A;  2H6B A;  3QYE A;  4OIO F;  5K7H A;  3CC4 I;  1R36 A;  3OYA A;  2ADU A;  3AL0 B;  4AYB N;  4BS9 A;  2EH3 A;  1EH7 A;  1XDS A;  2A5Y B;  2LSO A;  3QAH A;  1DGW Y;  1WCM J;  2M4K A;  3HYI A;  2E71 A;  4PCQ A;  1LDJ A;  3HRS A;  3OYN A;  3RKQ A;  1QQI A;  2LRE A;  2LKS A;  4BY1 J;  1K79 A;  4B8X A;  4HST A;  1JTX A;  1JTY A;  1O7L A;  1UHM A;  3F8F A;  3QPH A;  1O3S A;  1HC8 A;  1N77 A;  2H1K A;  2M0M A;  2DA7 A;  1V5E A;  1R4M B;  3TW6 A;  2KRC A;  2HPI A;  3G73 A;  3I4M J;  5IOZ A;  2M30 A;  5GP9 A;  1W7P B;  1ZLJ A;  3CUQ C;  3RPQ A;  2WBM A;  1ZG3 A;  2O03 A;  4HZF A;  2KDZ A;  1XD7 A;  3T8R A;  1I27 A;  2HOE A;  2HXI A;  3IP4 B;  2FBH A;  1X3U A;  3MN2 A;  5FO5 A;  5GAH J;  2NS0 A;  2AXT C;  3JAM Z;  3G1L A;  2GQQ A;  2WAQ A;  5EZH A;  3S16 J;  1VI0 A;  3RPU D;  1UG0 A;  2ID3 A;  3CDH A;  3WU1 B;  5IYB J;  2V4J C;  1O4X A;  5B1B H;  5ICC A;  2KT0 A;  1MMN A;  2K4J A;  1J75 A;  2R7X A;  3I9V 2;  2NVU B;  3ROU A;  4ESB A;  4Y13 A;  2BHY A;  4XRM A;  1BI1 A;  1UCR A;  1UJ8 A;  2FQ3 A;  3D1N I;  2L7F P;  1SD7 A;  4E7I A;  2M2E A;  2IS6 A;  2DOD A;  3HOT A;  4EAT A;  2M1B A;  4A3J J;  3JRB A;  3NAR A;  2MA3 A;  2EA2 A;  3BTJ A;  3EET A;  3HOV J;  2XF7 A;  3K2Z A;  2K85 A;  1XB4 A;  2HXO A;  1KZH A;  1NHA A;  3CJQ B;  3FM5 A;  3T8T A;  4YIF A;  5IT9 K;  4AIH A;  1AWC A;  4HNU A;  4EJV A;  3DKX A;  5IP7 J;  3WTS C;  3TKY A;  4RLQ A;  2LD5 A;  2P8T A;  4C2T A;  3BQZ A;  3CMM A;  1MH3 A;  3S1R J;  4CZC A;  1WKM A;  2YPR A;  5CVJ A;  4QLC U;  5IYD J;  1B72 B;  5H6R A;  2HQA A;  4P9U A;  3GX4 X;  3K2A A;  4Q47 A;  4XMY A;  5E3O A;  1YS7 A;  4XOT A;  4DYR A;  3L1P A;  2OF7 A;  3A4C A;  2FNA A;  2YS9 A;  1HW5 A;  5HVQ C;  3M8E A;  5E79 C;  1G3W A;  2WAQ N;  4G12 A;  3OSG A;  4U0W A;  2HKX A;  1OMI A;  2DPU A;  5JVG F;  1Z21 A;  2COM A;  2BVL A;  4HDU A;  2OA4 A;  4DJA A;  1MBF A;  3LSI A;  3EUA A;  3LSM A;  3KP7 A;  1IDZ A;  5M5W J;  2GXG A;  4HQE A;  4PFP A;  1GXP A;  4G7Z F;  5KNL A;  3FHZ A;  1OCR H;  1QHG A;  3JW4 A;  1HDP A;  1UB9 A;  1CF7 A;  3L09 A;  1TZL A;  1E0E A;  1P2F A;  2KL4 A;  4UUS B;  3FXJ A;  2QVO A;  3KZZ A;  3IUO A;  4UUT A;  3CME I;  3IRR A;  2BZT A;  3OYJ A;  1HA8 A;  5E3M A;  2HOA A;  2IGN A;  2VJJ A;  3HGY A;  5KAI C;  1ZLK A;  2A3S A;  1M1E B;  4MTD A;  2EB7 A;  4CYC B;  2E1N A;  2O8X A;  3EUH C;  3KET A;  3ISP A;  4KJZ A;  3H0G J;  3PUB A;  4LG0 A;  3KFW X;  2LKX A;  3ABL H;  3I56 I;  2E5N A;  1HKT A;  1QHH D;  3SYT A;  2GIV A;  2M5W A;  4G6T B;  1JJ6 C;  3OY9 A;  4KT6 A;  5CVI A;  2DAO A;  2BY1 A;  3HHG A;  3ZMD A;  3HOZ J;  2CUZ A;  4DOZ A;  1S72 I;  3QU6 A;  3V7R A;  1ON1 A;  1P92 A;  3TO6 A;  1WI3 A;  4W97 A;  3K70 C;  2L5Q A;  3HSR A;  3DFG A;  2Z1D A;  3BG9 A;  2VOD A;  2OV7 A;  3BDD A;  2BY0 A;  2O9L A;  4MIM A;  4JK1 X;  4JOM A;  2QQ8 A;  2R7T A;  3ECH A;  4M74 A;  1YW7 A;  2JRT A;  3LAJ A;  1Y56 A;  2LBF B;  3ABM H;  5KAF C;  2XPW A;  4BQQ A;  2DU9 A;  3K1P A;  4PK4 A;  1ENH A;  1X3Z B;  4OIR F;  3OIQ A;  3BG6 A;  2EIN H;  1R4N B;  2JZY A;  3I0T A;  2J5P A;  3OS0 A;  5D5W B;  3LSH A;  1FT9 A;  2CUJ A;  1KQ0 A;  1PVE A;  3PNT A;  2BW3 B;  2CW8 A;  3RJP A;  2DT6 A;  2HI3 A;  2RV8 A;  1F5T A;  1Y1W J;  2X85 A;  1OYW A;  2A6H F;  3IH3 A;  1YX3 A;  3DCF A;  1QGP A;  1D1B A;  1X3W B;  2HKO A;  2LY1 A;  1GVD A;  2E2H J;  1ZR4 A;  4A0Z A;  2EFN A;  4M3D A;  3I5U A;  4FE4 A;  3CCE I;  3DBR B;  2DOF A;  4B3X A;  2WAF A;  1Z0X A;  1IN4 A;  1Y8Q B;  6PAX A;  2XAU A;  3K70 D;  5CLS A;  1A36 A;  2XRL A;  2HOT A;  3IAS 2;  1MND A;  2L02 A;  4P5O A;  2CW7 A;  4P96 A;  2CQ7 A;  4HEA 2;  5HDN A;  2MLK A;  2M3A A;  2O5R A;  1ZK8 A;  3PO2 J;  3D5S C;  2MFZ A;  2YSR A;  1MBK A;  3I54 A;  5GAE J;  3GYH X;  3LA2 A;  1B8I B;  4WF2 A;  4HF1 A;  1ZGJ A;  3L2C A;  4G7O F;  2EK5 A;  1R58 A;  1OR7 A;  4JX4 A;  4PZJ A;  3HUG B;  2HWV A;  3BPV A;  1YW8 A;  3HKZ N;  4FHT A;  1JGS A;  1IRG A;  3H3U A;  5K5O A;  2E1M B;  3DPT A;  1SFK A;  2LKP A;  4I99 C;  3HOW J;  3V7C A;  2IS4 A;  1FOX A;  1R49 A;  4CCL A;  4F3Q A;  1I3A A;  2IW5 A;  2O61 A;  1H89 C;  5LFA A;  1TQP A;  2DA2 A;  1ZAO A;  4BAY A;  2IA1 A;  1DUX C;  2K9L A;  3FKI J;  4A2U A;  2O8K A;  5K7Z A;  3H3V K;  2DMP A;  2XAF A;  1W1W E;  3FIW A;  3N05 A;  1XMX A;  2DT7 B;  4IL6 C;  2M8G X;  3LQQ A;  3H1C A;  2RN7 A;  3F21 A;  5IT9 Z;  1JT6 A;  1YX5 A;  2NAZ A;  2RKH A;  4IEJ A;  2JTV A;  3GBG A;  1GT0 C;  4N0B A;  2G0E A;  4J00 A;  4ZZD A;  3N97 A;  5CPR B;  4BEH B;  2LP0 A;  2JK3 A;  2F2E A;  3COA C;  2EIK H;  3MMY B;  5AIP A;  3P5J A;  2R5Z B;  3MEX A;  2AHQ A;  3RPU A;  4XKW A;  3OYG A;  2X1D A;  3OIO A;  2QKL B;  3OOU A;  4GO1 A;  1WWX A;  3I58 A;  2ZC2 A;  5HS8 A;  3S3N A;  1X2N A;  4OOI A;  3TP3 A;  2P7C B;  3IKT A;  2HS5 A;  3S8P A;  3E5Q A;  3FXM A;  5E1W A;  5F0C A;  3VYS B;  3H36 A;  5CJ9 A;  4WWC A;  3GTK J;  1X1D A;  1KU3 A;  1LDD A;  5ILS A;  4BE1 A;  4G7H F;  1KU2 A;  3KEY A;  3P9I A;  2P4W A;  4KN4 X;  1GLN A;  4ZYH A;  2F5E A;  1BR2 A;  1GV2 A;  4U0V A;  2QBY B;  1LEB A;  1ZTR A;  1MW7 A;  3H3Z A;  4KA4 A;  2M87 A;  2XGD A;  4YFX F;  1DPU A;  4EVI A;  4L0Y B;  2MW8 A;  3M1C A;  3EDP A;  2RQP A;  2X6X A;  1N25 A;  4EGY A;  5CQG A;  1ACI A;  2EFQ A;  4BE2 A;  4I01 A;  3LFU A;  1SC7 A;  2BBY A;  2VI6 A;  1H9T A;  5IOY A;  1V54 H;  3KP2 A;  2A68 F;  3BRO A;  3OMY A;  2DYR H;  5EG0 A;  2ECC A;  1GXQ A;  3ESW B;  5E1X A;  5J1R A;  4CHU A;  4Y3O A;  5LGT A;  3CUQ A;  4RMN A;  5CQE A;  1BN5 A;  3FMS A;  2W00 A;  2Z99 A;  4XM3 A;  2GA2 A;  3I3L A;  3Q3S A;  1YHQ I;  4C2U A;  5IP9 J;  1MMD A;  3C18 A;  5D5U B;  5CVU A;  5DUI A;  5D4R A;  2E7X A;  2OBP A;  2K27 A;  2GXA A;  3M1E A;  4ON0 A;  4AWX B;  2LYC A;  3ZPL A;  5LD2 C;  1LEA A;  3GVA A;  2QSH X;  3DTI A;  3P7N A;  1EF4 A;  1HBX G;  1XTA A;  5E18 F;  3SEZ A;  2W4S A;  4DGW B;  5LRR A;  3BC8 A;  1IZ1 A;  1Z3X A;  2CU7 A;  3MVP A;  3OOP A;  2VN2 A;  2EBI A;  2FQ4 A;  1LE8 A;  2UXN A;  3H9J A;  4AC0 A;  4CCN A;  4ZC3 A;  1HKS A;  3CO6 C;  4KT5 C;  4L5E A;  1SD5 A;  1YFH A;  1RR8 C;  1FP2 A;  4MNU A;  5M3F J;  1U8B A;  2VKD A;  3J7A O;  4DZP A;  5FD5 A;  1ETY A;  1TT0 A;  2E7W A;  2W57 A;  1O3R A;  2RDP A;  2R7S A;  2VQH A;  1XX5 A;  3J81 K;  2R7O A;  3HHH A;  1FOW A;  3JRG A;  2OCE A;  4IHY A;  2BW3 A;  1G4D A;  2X6Y A;  2F48 A;  4AD9 A;  1G8X A;  4M71 A;  3TOB A;  4IF4 A;  4XKV A;  4ENM A;  5DD8 A;  3NWS A;  4U7B A;  1O7F A;  4X0G A;  2DQR A;  2V1X A;  5HNH A;  2XPV A;  4AM3 A;  4RGR A;  2OU2 A;  1Y6I A;  1B59 A;  2ZXH A;  3L00 A;  4PSW A;  4QPO A;  5KCM A;  1IO2 A;  2QF7 A;  2NS7 A;  4PJN A;  2HOS A;  2EZH A;  2D45 A;  2C6Y A;  4KNY A;  5FJ8 J;  1XDU A;  2HQR A;  3UR3 C;  1I50 J;  2E35 A;  3WGI A;  4RB1 A;  2HDD A;  3FK7 A;  2QM3 A;  2L2O A;  3H5R A;  5DTD A;  1K7A A;  3Q0V A;  1VQ8 I;  3T0Y A;  4BBR J;  1YIT I;  1B8I A;  1E17 A;  1TQI A;  5D6F A;  1Z91 A;  3KLO A;  2Y0S A;  3CCU I;  3GTP J;  3R0J A;  1U5T C;  2VE8 A;  1VQ4 I;  4IJA A;  4DW6 A;  4BUP A;  2DBB A;  1D1C A;  1J0R A;  3PFY A;  3QYF A;  4LFU A;  4A3K J;  2FEZ A;  2F5C A;  1T6S A;  3HUG A;  1TWG J;  1G3S A;  1QZZ A;  2CQK A;  4HG2 A;  3HPH A;  4OIP F;  1QZE A;  4LB6 B;  4Z2Y A;  4BGD A;  2KPM A;  4MQ9 F;  1MD0 A;  1ETW A;  1EJ9 A;  4LK1 F;  1QNT A;  5L3F A;  2LY9 A;  4HF2 A;  2IAI A;  3FMQ A;  1P7I A;  2W84 A;  2PN6 A;  2VL8 A;  4XRS G;  2NYX A;  5ERI A;  4A3M J;  4G6D A;  1O3Q A;  5J8F A;  2ZJP F;  2QUF A;  2KIQ A;  1LB2 A;  3VDX A;  4KYW A;  3EUH A;  4L5I A;  2FA5 A;  3ZMT A;  2HTJ A;  1XGS A;  2X6W A;  4MTE A;  4KFC A;  5EF6 A;  3BJA A;  2OJE D;  1ZH5 A;  2L01 A;  3HTS B;  2ACJ A;  4UXN A;  3DQV C;  3ECO A;  1K6Y A;  2DA3 A;  3MQ0 A;  3RDI A;  2QCO A;  3WG9 A;  2CV1 A;  3DPU A;  1J7K A;  4CCJ A;  2M7B A;  4BEH A;  1XSV A;  2JA5 J;  2ZKZ A;  4Q4Z F;  5DV5 A;  4YFK F;  3H0D A;  2M8E A;  2FML A;  4XLP F;  4NDL A;  2IGO A;  3F6V A;  2PX9 A;  3ZR8 X;  1XC5 A;  1ZGW A;  2QEX I;  1RUN A;  2JA6 J;  3RQI A;  1VQK I;  2FE3 A;  2ID6 A;  1RKT A;  3JRH A;  1ZQ3 P;  2Y0S N;  1N75 A;  4S0H B;  4DYQ A;  2CH0 A;  4A3G J;  3IAM 2;  1FNN A;  3IC7 A;  5E20 A;  1XMK A;  2PI0 A;  1E2X A;  2OCC H;  1IG7 A;  2V6C A;  4E7H A;  1KYW A;  3BZC A;  4ENN A;  2LK2 A;  2R93 J;  5ICG A;  3LMM A;  1JXS A;  5C3E J;  4C2M J;  2K9Q A;  1J59 A;  1R5H A;  3W2V A;  1NH3 A;  3OWT A;  1LQ1 A;  1CF7 B;  3HRM A;  3U1D A;  2NVT J;  2DO7 A;  2CQX A;  2FUG 2;  3FWE A;  4I98 B;  4E6K G;  1YIJ I;  1KA8 A;  2IVM A;  4U87 A;  4XSZ F;  4HNT A;  2OC6 A;  4BJ6 C;  4YG2 F;  2WC2 A;  1XCV A;  4ASN A;  5ILV A;  3F6O A;  2DFF A;  1LUJ B;  2FF4 A;  3BZK A;  1X1C A;  1K61 A;  2KDO A;  3OL3 A;  4U7D A;  2DOA A;  3W6K B;  2D1V A;  2NNN A;  3DU5 A;  3OIP A;  2CRG A;  5HOO A;  2UV1 A;  2IEK A;  2O6G E;  1VQN I;  1OCO H;  3S14 J;  3CJS B;  4DZJ A;  1IJW C;  2R3S A;  4G94 A;  4B48 A;  4LG0 B;  3JTH A;  2W25 A;  5ED4 A;  2XC7 A;  2VQG A;  4HX4 A;  1SAN A;  4WCG A;  1T98 A;  1U2W A;  4TV7 A;  3DU6 A;  3K4N A;  1WZ2 A;  4ITV A;  3H92 A;  2PG4 A;  3BTC A;  1R1V A;  2X51 A;  1ZRE A;  3GZN B;  3DEW A;  3S1N J;  1K83 J;  2VT3 A;  1UZC A;  4DQ2 A;  5L3E A;  4XN3 A;  1A6Q A;  5DM7 F;  1UFM A;  5HLT A;  2R7V A;  2HR3 A;  1U5T B;  1XGN A;  3K4B A;  2ME0 A;  1TL8 A;  2KFD A;  1J09 A;  1SFX A;  2DT5 A;  1S3J A;  4GGG A;  1SVL A;  4MFD A;  1JKQ C;  1MJ9 A;  4CH7 A;  1LKX A;  2XVC A;  1G59 A;  2OQG A;  4G6Q A;  1T56 A;  3WGG A;  3D5R C;  4AVZ A;  4AU7 A;  5DCF A;  3S2W A;  2MG4 A;  1D0Z A;  1W5C C;  5H20 A;  2XKO A;  1QPI A;  3J80 K;  3CCV I;  3J7Y J;  1SAX A;  4I76 A;  2K40 A;  2XF5 A;  3C7J A;  2CQN A;  1OKR A;  3LSP A;  5K7F A;  2JWT A;  2MBF A;  1WPK A;  4UY8 I;  2Z16 A;  1DP3 A;  2XAH A;  3N4M A;  3K4J A;  5EZG A;  4P1W A;  2KJC A;  3WHB A;  3DBH B;  3J81 Z;  2B7E A;  1VF9 A;  2HPM A;  2WY8 Q;  3TO9 A;  3SZG A;  4CUG A;  1ZG5 A;  4YIR X;  5ICE A;  4RGS A;  2OTJ I;  1X4O A;  3HOY J;  5LGN A;  2NVX J;  2AO9 A;  2DFE A;  4BH9 A;  1G2H A;  4B3A A;  5JLW A;  3MWM A;  1WJD A;  4E70 A;  1R1U A;  5K5R A;  1ZKG A;  3PM1 A;  3OR1 C;  4NQW A;  1FLI A;  2QKM B;  2HZD A;  1BL0 A;  1WGX A;  2VQC A;  2Y9Z A;  3TP0 A;  2YX7 A;  1QO0 D;  1HKQ A;  4P9F A;  2WA0 A;  2XV4 S;  3KP6 A;  2LC2 A;  2VC1 A;  2R5Y A;  3PL8 A;  1IUY A;  2HQ5 A;  4L9T A;  4XLF A;  3F8B A;  3ZQF A;  2E2J J;  4M73 A;  2EFP A;  4R1H A;  2IS2 A;  1YRN B;  1EA3 A;  4W1U A;  3A2K A;  4E7Z A;  3OYM A;  2K9M A;  3WTX C;  4V19 K;  3PO3 J;  1YJ9 I;  2CGP A;  2NVQ J;  2IXS A;  4UB8 C;  1ZEL A;  4LIV A;  3RZD J;  2KP6 A;  3A01 B;  3V8K A;  4X1E A;  2EQR A;  1XN7 A;  2I10 A;  1S7O A;  2JRM A;  3LSK A;  1H88 C;  2JA8 J;  3T1B A;  5EEA A;  4QWQ A;  5F1J A;  2RQQ A;  4BDY A;  3VWB A;  4LLN A;  2VE9 A;  2ZBK A;  3D5L A;  2ZJR F;  2VC0 A;  4EMS A;  1DGR M;  3ZQG A;  4ZZL A;  1YO5 C;  4IHT A;  3GEZ A;  3U9G A;  5JR3 A; 
#chains in the Genus database with same CATH homology
 3EGV B;  1YHQ I;  5GAE J;  2FOW A;  1VQL I;  3CME I;  2ZJP F;  5DM6 F;  3CF5 F;  2E34 A;  5GAH J;  3I55 I;  3G4S I;  3CCV I;  3J7Y J;  3CJR B;  2QA4 I;  2H8W A;  5GAD J;  1YJW I;  1FOX A;  5GAG J;  2JQ7 A;  1VQ5 I;  1VQO I;  1FOY A;  3I56 I;  4UY8 I;  4IOA F;  2QEX I;  2ZJQ F;  3CC2 I;  1VQK I;  3CCR I;  1S72 I;  3CCJ I;  2OTJ I;  1FOW A;  3CJT B;  3CJQ B;  3CC7 I;  1YI2 I;  1VQP I;  3CCM I;  3CCS I;  3DLL F;  2NXN B;  3CCQ I;  1VQ7 I;  1YIJ I;  2OTL I;  1MMS A;  3CCL I;  3CMA I;  3G71 I;  2E35 A;  3G6E I;  1VQ8 I;  2K3F A;  1YIT I;  1WIB A;  3CCU I;  1VQ6 I;  1VQN I;  1QA6 A;  4IO9 F;  1VQ4 I;  4V19 K;  3CJS B;  3J7Z I;  3CD6 I;  1YJ9 I;  3PIO F;  3PIP F;  2E36 A;  5JVG F;  3CC4 I;  3CCE I;  1Y39 A;  1VQ9 I;  1ACI A;  1VQM I;  2ZJR F;  1YJN I;  5DM7 F;  1HC8 A;  4IOC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...