1R6RA

Solution structure of dengue virus capsid protein reveals a new fold
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
NRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Solution structure of dengue virus capsid protein reveals another fold
pubmed doi rcsb
source organism Dengue virus 2 puerto rico/pr159-s1/1969
molecule tags Viral protein
total genus 20
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1r6rA00
1SFKA 1R6RA
chains in the Genus database with same CATH superfamily
1MSEC 2FQ3A 1PJRA 1Q1VA 3FXQA 1R1UA 5K7HA 2EFPA 2LRDA 2EK5A 4DYRA 3HOUJ 2VKVA 2IS4A 4MLOA 4CGZA 2QSFX 4D5CA 5IP9J 1D0YA 3O8GA 3WHBA 3IWFA 2EBIA 5C4XJ 3W2VA 4S05A 1E0EA 2NS7A 3E6MA 4A0YA 1R1TA 5ICFA 1RZ4A 4D7MA 1HDPA 3MD2A 1X3WB 2JSPA 3GFJA 4LJZF 5DS9A 5D5WB 2PN6A 2VUMJ 5CJ9A 2XRNA 1XN7A 1BN5A 3CCYA 5E8IA 2CWEA 4ZYAA 5J4YA 1STZA 1O3RA 4OWRB 3G71I 1ERDA 5ILUA 1XMAA 2DO7A 2JUGA 3S17J 4WXCA 2WAQN 1SD4A 2PX9A 2VPRA 4M9SA 4U0VA 4N0BA 1QQIA 1R5HA 3CMEI 4LLGF 1FIAA 1LFPA 1PP8F 2F5CA 1BC7C 2L4AA 3TMOA 1MJAA 3FBIB 1JHFA 1ZELA 2VJIA 2YU3A 3R0JA 5IP7J 2ACJA 3HOSA 2XGCA 3K10A 4NC7A 1MD0A 3BLYA 3BG3A 3V8LA 3OL3A 4BDYA 2O8XA 2DA5A 1R5GA 5AIPA 3OYGA 1ORKA 3HOZJ 2EZHA 2HYFA 1XGSA 2TRTA 3FXMA 4ANJA 1QPMA 2LBFB 2ZMEC 4IQ4A 4RB0A 2GXBA 2E1MC 3CCJI 1TZLA 3BCBA 2NVXJ 2WAFA 2OJED 1TP4A 3SZGA 3I3LA 2ZO4A 1U3EM 2YR2A 3EUHC 4HDVA 4JBAA 4ZYEA 5IT9K 5K5OA 3D1NI 3RQ4A 4DZJA 1LVKA 3F8NA 1YTYA 3OR1C 4LK0F 2CJJA 2VPLA 3BZCA 3IH3A 3PQJA 5E79C 1V54H 2P4WA 4ENJA 4M6VA 3J7AO 4WX9A 1U8RA 2P6SA 5FLMJ 5EGOB 1WKMA 5EEAA 2KIUA 6PAXA 1SAUA 4CCLA 2VKDA 1PDNC 3JTHA 5TGTA 4MGRA 1P92A 4KT5C 1ZH5A 4LG3A 4RLQA 2ZXJA 1WSUA 1NTCA 3KCCA 1WH7A 1YE9A 4A6EA 2R5YB 1L0OC 3PNYA 4CICA 4IKFA 2GOXB 5LGUA 1OR7A 3DWLE 2MH2A 3KIOA 3I53A 5HLIA 3W3CA 5BNGA 3JREA 3TL4X 1EH8A 5A2QK 1PUEE 4YFNF 3CCLI 2PMZA 3LA3A 1D1AA 3RJPA 1Z0XA 4QTRA 2QSGX 4A5MA 2ZBKA 3EPZA 3KE2A 2ZXIA 2X1CA 2HPMA 2M2EA 4KMFA 2OCEA 3BR5A 4I99C 2BOLA 5CVVA 3SFZA 4OINF 5D4RA 2UWMA 2UXXA 4HYEA 3WGGA 1TW3A 2E1OA 4ITVA 4ZJZA 1R4MB 4HRIA 1VTNC 5CVRA 4MQ9F 3CDHA 1D8JA 3QPHA 1ZRCA 4CA0A 5L3EA 3ERMA 3BTLA 2E7XA 2RKHA 3HOWJ 1AKHA 3DLLF 2LR8A 1UCRA 3RIRA 3PIPF 3BDDA 3ROUA 3B6CA 2ZMEA 4LIUA 1RR8C 1BIAA 3FK7A 5B5EC 2FUG2 1FT9A 4HF1A 2F5DA 3OYNA 1S8NA 2K9LA 3G1OA 2L54A 3E5XA 3FMQA 1PP7U 1ON1A 5EG0A 5DCFA 1PUFB 3ZMDA 2VKEA 1XSDA 4EGZA 3FM3A 1WJFA 1M1EB 2DODA 1FSEA 3WU1B 4BDZA 1HF0A 2VXZA 3CLQA 1QPIA 1VF9A 2DA2A 2IVMA 1YS7A 1LVAA 1YQAA 1TTYA 2CO5A 2K7LA 3FM5A 4E7SA 1YITI 2D1VA 1FNNA 2HOSA 2ICWG 3VSLA 1EH7A 1VQ6I 5H6QA 2XSDC 4A3DJ 3TQNA 2YU9J 2W1OA 4FETA 2KPMA 2LNBA 3RPUA 4LD5A 2M9HA 1B9NA 2HTJA 1BM9A 2XPVA 4KA4A 3OIPA 1XGMA 4E7HA 3TGNA 2FD5A 1YJNI 2E36A 4EMSA 3R6SA 1D8KA 1UZCA 4HQMA 2QENA 1Y6IA 3GZ5A 5FFXA 5GAEJ 4RM2A 4UNOA 1HW5A 3F3XA 4IRHA 4RLFA 2DPDA 2DPUA 3OMYA 5DM6F 2UZKA 3I58A 4OMZA 4HG2A 3N05A 3HOXJ 2EINH 2M0CA 3HUGB 5JR3A 3I64A 1S6LA 3B6AA 2GM4A 3HL2A 4N9HA 3IKTA 5BS6A 3E5UA 3OIOA 2R7UA 3JAMK 1RKWA 2DT7B 2MD0A 3LOCA 3I59A 3BC8A 3RYRA 2P6TA 4CCNA 3S3NA 3I71A 2QBYB 2JA6J 1ZGWA 4ASNA 1W1WE 3KZYA 3DLAA 2BW3B 3OYFA 4BGDA 3H0DA 3WTYC 3HJEA 4XLEA 2OA4A 5J1YA 1J59A 4I01A 2BEOA 2OCCH 5D5XB 3H3ZA 4XBFA 2JSCA 3N97A 2JVGA 2EZKA 1T56A 4IXAA 2JA7J 1JJ6C 3DTEA 1YRNB 5LD2C 3H0GJ 5EDNA 2X0LA 4X0GA 2L9NA 3DBHB 3CMAI 2CYYA 2DYSH 1HLVA 1E3OC 2XKOA 2Y0SN 3PNTA 2HXIA 2MC3A 3AL0C 5K5RA 3C7JA 1SFKA 3I4MJ 2E19A 1ITYA 4UV9A 4CH7A 4RGUA 4EM1A 1WWXA 5BPDA 1ZLKA 2XASA 2DT5A 2O61A 2QVOA 3NQOA 3SDBA 5C44J 2FBIA 5KAFC 5FGMA 1X1DA 3FMRA 1GDTA 3CD6I 2DFFA 5KVRA 1MGTA 2UUZA 3DXJF 4RGXA 2R5ZB 1UAAA 3DEUA 1F1ZA 3HXLA 3S16J 4HF0A 4PJMA 1TT5B 2X6YA 1QHGA 3MWMA 2IS2A 2R7VA 4J19A 3A01B 2D45A 2CV1A 2PJRB 4EM0B 4PFOA 4XOTA 5CQEA 3BJ6A 4BU2A 2IPQX 1S7OA 4RGSA 1X1PA 3V8KA 2E5NA 3BJOA 4FHTA 1BI1A 2KRFA 3BTIA 3Q9SA 4WWCA 1XSVA 4LB6B 1YI2I 1K83J 2HVSA 3H35A 2XPWA 2FMYA 2WV0A 1FIPA 2CUEA 3VYTB 5EEHA 4ETSA 4KIFA 4IRGA 4ZTFA 1K61A 4YELA 3ASNH 1G6NA 2GIZA 3O8HA 1BI0A 1XMXA 4I02A 2NVYJ 4M3FA 2JTVA 2CU7A 4BYYA 3GUDA 2K5CA 5AONA 1KU2A 2M4KA 1K79A 4CCJA 2LD5A 4EQQA 4U0WA 1I5ZA 4P9UA 3L09A 3GLLA 4IOCF 3VYUB 5K7FA 4UVCA 5EZHA 1QO0D 3HOVJ 3LSJA 4R8HA 1HDDC 5LEKA 1IXCA 3NWTA 1R23A 2P7VB 4G9YA 3Q5FA 3GO5A 1TWHJ 2O9LA 3PJRA 2KLOA 2OU2A 5LEJA 4F91B 5M3FJ 1LDKB 3ONQA 4XRFA 1HXDA 2XGEA 3CO7C 1RIOH 4XOPA 3GTGJ 3J7AY 3TDUC 1H0MA 3CESA 4F52A 3E3VA 3LSPA 2X9DA 3DU6A 2KISA 1ZN2A 3OYAA 3F6OA 5IYBJ 4M3EA 2WB1N 4EGYA 1VFCA 3ZN0A 1SFUA 1OCZH 2LKPA 2XKPA 2KZGA 5GAHJ 1MNMC 3GX4X 2DAOA 4GGGA 3V7SA 2EJRA 4EJOA 3IP4B 2MBFA 4F92B 1TWCJ 5D6EA 1UELB 4NHJA 2E2JJ 2CMPA 4MO7A 3KP3A 4HOBA 3EETA 2BHZA 1FJLA 1QGPA 2F2EA 3SHFA 1WH5A 4L5JA 1TWAJ 2MFZA 2LLKA 3R61A 2HR3A 3L2UA 4FTHA 2ZJRF 3VYRB 4U7DA 2B9SA 4IHTA 1E17A 1ZRDA 1XMKA 1Z3YA 2J5OA 2GQQA 1MNEA 4GCVA 2JQ7A 3DPUA 1Y8QB 4XKWA 4DYCA 1LFBA 2WADA 1T0FC 3W2WA 1Q1HA 3PSFA 1EA3A 2XVCA 2DJNA 2OAZA 3ZMZA 3OYDA 5B66C 4XLPF 1HW1A 4KFCA 3HSEA 3SXYA 3GW2A 4UUSA 4A3LJ 3OR2C 1I50J 1Y0UA 1S3JA 4QWQA 4QLCU 4ESJA 3LSGA 3PUBA 2K9SA 2IA1A 2JMWA 2DDBA 5LHIA 3H9QA 3R60A 1PVEA 2EQRA 1Y56A 3HEFA 1FOXA 1Y8RB 2VODA 2CW8A 2WA0A 3A4CA 2P0WA 4CYDA 1YX3A 3WHCA 3LSTA 4OIOF 2OTLI 2DA3A 2B63J 1KYWA 2LF8A 5F64A 4KN7X 2KIFA 3LFUA 2VBWA 3T8TA 1JTXA 1XCBA 3VODA 2VOOA 2BY0A 2L4MA 2C6YA 1QRYA 2OZUA 5CPRB 4L9JA 2A07F 1G59A 3FXKA 4XKCA 5DCMA 3JRDA 1HOMA 2YX7A 2NOGA 4C3HJ 1XSXA 2IXSA 3QAHA 4MQVA 1IN4A 1IN6A 1V4RA 3DBLB 1ZTRA 2E2IJ 1OCPA 5TRDA 1TWGJ 2DXIA 2JVHA 2VL8A 3VOEA 2CQXA 3I55I 3KYLA 3BR2A 1I39A 5L3BA 5JFRA 2G7HA 1ZRFA 2IRFG 3NARA 3ZQQA 2QSHX 1YJWI 5FKLA 3TW6A 1B4AA 3HKZA 5IPAA 3AG1H 4HNUA 3LAPA 3IH2A 1R22A 4WXDA 1UG2A 2M87A 1WPKA 2PBIA 2L0KA 3LL7A 3ZQGA 2JWTA 2RVCA 1GV5A 2PFBA 2QQ9A 2Z9OA 3E97A 3F21A 3AG4H 4L5EA 1K4TA 1SFXA 2DDAA 2ZNYA 2EZLA 2CW0F 4A0XA 3FXOA 1MJBA 3LQRA 1W5TA 1C0WA 2EFOA 4C3JJ 1SAXA 4XM3A 1YFHA 3OWTA 3HB9A 4A12A 2ZC2A 3ESWB 3P9KA 1W4MA 2RC4A 3HSFA 2V9PA 1FMVA 1MBGA 2L7ZA 4DOZA 2LSOA 4KIBA 3OYEA 5HS9A 3KZZA 5LHHA 4CXFA 3HHGA 3CC2I 1FTZA 2X85A 1GT0C 2VASA 4ABZA 4HSTA 1APLC 3BG7A 5L3DA 1MMNA 3DU5A 1IG7A 1AHDP 1XD7A 3BY6A 4W97A 2EIMH 4DJAA 3OYLA 1U9OA 4XLAA 1LDDA 2XAQA 3KFWX 4N4OB 3SYTA 3LNQA 2HTSA 2LOOA 5JI6A 3GTMJ 2MLKA 4QPOA 1D5VA 3SEZA 2AQEA 2PMUA 3M4OJ 3OSGA 2DCEA 2JPBA 2LVSA 3VWBA 1A6QA 1Y0NA 5K7ZA 3PO3J 2Q8KA 5M3MJ 1FOYA 4PSXA 4KNYA 4CZZA 5D8LB 2WAEA 5HNFA 3K2AA 3SQNA 2YSRA 2XF5A 3GBGA 1WFXA 2Y31A 4XORA 3QOEA 3DKWA 2FXAA 1BIBA 1W5CC 4AIHA 2HVQA 1U5TA 2UV1A 4LK1F 2V9KA 1JI8A 3JTGA 2BVMA 4Y52J 2HOTA 2HYJA 5GP9A 1TL8A 4LG0B 3K6GA 4FISA 2DMUA 2DMPA 2R7XA 1IXSB 3K2ZA 3KYCB 3B73A 1ZQ3P 1T8IA 2OZ6A 2CH0A 4NQWB 4P55A 1MBFA 1MBEA 4AWXB 3GXOA 2HEOA 2EFNA 2LREA 2OBPA 3T8RA 3SZPA 2LC2A 3I0TA 2DTZA 4PGHA 1ZR2A 1KQ9A 2AXTC 1MIJA 2IAIA 4IJAA 1OYWA 1XGOA 4C2MJ 3WTVC 3CCVI 2PMHA 5L3CA 5JHFA 1LUJB 2LMDA 3GCMA 3IUOA 1IV8A 2OPTA 2Z16A 1H8AC 2MH9A 2X6OA 1O57A 3RZDJ 3IL2A 4HV5A 3E1SA 3RPQA 3U1KA 4RM3A 1TT0A 4E7JA 3CUQA 2KRCA 2B7EA 1YOVB 2DFIA 3F8FA 5ILSA 4A93J 3HTUA 1KGSA 1D0XA 5FD6A 1IXRC 3ZQCA 2YS9A 3RI4A 1BR2A 1IRXA 1Z67A 1J9IA 5DM7F 3BPVA 5D6FA 4JX4A 2CRGA 2E1NA 2ISYA 4LLLA 2CQNA 1T33A 2FBKA 3P7NA 1IUYA 2FE3A 3H3VK 1NG6A 1K4SA 1TNSA 2VC1A 2V1NA 4IHWA 3F8CA 3IAS2 2B0LA 1Z7UA 1GLNA 2BY3A 3RKQA 1ZHFA 3F0CA 4B3XA 4U87A 5E3MA 1W7PA 2CUFA 3ABUA 1IDYA 3QOPA 1RUNA 4M3GA 1SVLA 2HKXA 3S1NJ 5F0FA 4DBRA 3WGIA 2DA4A 2JN6A 3DQVC 4BKXA 1J5YA 3OS0A 4RB2C 1BL0A 1IO2A 4HPQA 2JT1A 2FEZA 3GWZA 2V1UA 2ESHA 4IHVA 1D0ZA 1LPQA 5IT9Z 2HQAA 1H9GA 4G7ZF 1IN7A 3I4NJ 4AIDA 2IGKA 2EA4A 1H88C 3CMMA 4D7NA 2GOMA 1B72A 1Z6TA 2OV7A 3H9JA 3HPGA 1TW2A 3HIFA 3CUOA 2R7SA 2VI6A 3GLXA 1ZGJA 3V42A 5FKKA 1VQOI 4BUPA 2M30A 2MGQA 4A3KJ 2XGXA 1ZLJA 5B3SH 5DD4A 1DU6A 3K69A 1J75A 1RKTA 5E8GA 2E7WA 3G6EI 3QP5A 1SFEA 1FLIA 1G3TA 2EB7A 5E18F 3F23A 3KYDB 1BOBA 2ZFWA 3DKYA 3JRAA 2ME0A 3FXLA 5KAIC 2NS0A 3H3UA 4BY7J 2ELJA 3ZQLA 1X1BA 5F1RA 1D5YA 1A6IA 4A3JJ 2DMTA 3ISPA 4GYIA 4N4NB 3FHNA 2E60A 2FU4A 3G73A 3IC7A 1SANA 1MBKA 5A2QZ 1YJ9I 4MHGA 2JJ7A 1ZARA 3E0JB 1BW5A 5J3LA 1D1CA 4UUTA 3L7WA 1JGSA 2HNHA 3GF2A 1GVDA 3TO9A 3BCAA 1OYYA 3A02A 2CUZA 1B59A 4BQQA 3Q9VA 3JRIA 5FB2A 2EZIA 2ID6A 3H9GA 3BR1A 1X4PA 4BNCA 3HG9A 3QU6A 1EH6A 5E17F 5FLXZ 2ZNZA 2Y9ZA 1CF7A 1SD7A 5FLXK 1FBSA 1SFOJ 2ZSHB 2HOAA 2D2WA 1JUSA 2GA2A 5H6RA 4RBOA 2GXAA 1FP2A 3TO7A 4HX7A 3T0YA 4M9XA 3DPTA 3ZCOA 4NNJA 2VE9A 1OISA 2PMZN 3ZMUA 2W4SA 4G6TB 4YIFA 1VQ7I 4PZJA 3KLNA 4DNCA 5HVQC 2LY1A 1XCVA 2Q2EB 3Q0WA 5ILVA 4UVBA 3DEWA 2L01A 2XDVA 3EUHA 3WTZA 5KNLA 4IHXA 4OAYA 2WV1A 2QZ8A 1IUFA 1VZ0A 4K2EA 4HAMA 2ZJQF 2M8EA 3WE2A 4CSWA 2VQHA 2L2OA 1R7JA 4E7LA 2FOWA 2FBHA 2M7AA 3P9IA 4D1QA 4ESFA 1YW8A 3KP2A 1T95A 1UMQA 2VT2A 5KHDA 4Y15A 3SJMA 2XAHA 2ZXHA 3EUAA 3IWZA 2M8GX 1FWZA 3K4CA 2RV8A 2XC7A 2N8GA 2V26A 3TEDA 1DP7P 3J7YJ 2F6CA 3Q3SA 2OQRA 4M6XA 3V7RA 4Q5SF 2DJIA 3NAUA 1FTTA 1MBJA 2BZTA 1W5SA 1OPCA 4XKVA 3HRSA 1L3LA 2ECCA 2TCTA 3WG7H 4Y33A 1ETYA 2VBYA 2NVQJ 1USSA 2TDXA 4CCMA 1F43A 1RPWA 4EJVA 1HSTA 1XX5A 5J1RA 1MDMB 1XS9A 3JRHA 1NH3A 5GPCA 4A2UA 1UJ8A 4KYWA 5TJJA 1P4AA 4FCYA 3RKYA 3QYEA 3IH4A 3JSPA 4Z2YA 2MLGA 2D5VA 4BQOA 5DYMA 1Z91A 1RETA 4AYBA 3UR3C 3LAJA 2FQ4A 3QWLA 1JXSA 4I09A 4B48A 2VJ5A 1LE8B 3ASOH 1ETXA 4N9IA 1QZYA 2Z3YA 1DQUA 4BHPA 2D1HA 1CQTA 2IGOA 3I4PA 3M8FA 1WI9A 4XSZF 3AG3H 4XONA 1J7KA 3HSRA 1YO5C 4JK1X 3QPSA 2LKSA 5FROA 3HPHA 3JAMZ 2L3DA 4XQFA 3S15J 1K78A 1FX7A 5M5YJ 5JLWA 5EF6A 3O2PE 3KEYA 4S04A 3SZTA 2QUFA 1G8XA 1DDNA 4PJJA 3A1YA 1G3WA 3A03A 2XROA 3S14J 1X19A 1O7FA 2MD5A 3DKXA 3W6KB 4BQNA 4M3BA 4YRVA 4WK8F 1T98A 2XB0X 3C3WA 3CDLA 2G7UA 3FMSA 4E7KA 2K3PA 2VJJA 1F9NA 3TKYA 3VB2A 3W2AA 1B8IB 2QQ8A 2W25A 2BV6A 2V4JC 3ZMVA 1WCMJ 2CS3A 1DP3A 2A68F 3CJRB 3DP7A 2IW5A 4KUMA 2VQGA 4J01A 2CG4A 1SVOA 2BVLA 1R36A 2JUCA 2VB6A 2G9WA 2WBMA 1KU3A 3OL4A 4GRIA 2STTA 4A6DA 2ID3A 5GAGJ 3BTJA 4IOAF 2NYXA 3KP7A 4X1EA 1FEXA 3S1RJ 1QA6A 3J80K 1WJCA 1IN5A 2K9NA 4P5OA 2FOKA 4HV6A 2H27A 4B1RA 2DI3A 3GEZA 2R7TA 4UVAA 4HW0A 5DUKA 2LP0A 2QKLB 1MKMA 3F6VA 5FKNA 1AWCA 4M6YA 2STWA 1U6GA 2W00A 5ED4A 4BQAA 3OOUA 2H6CA 5TISC 4EJWA 2O5RA 4XMYA 2Y69H 4FX0A 4XN0A 3CTAA 4G7HF 4A5NA 3CCQI 3V8JA 2Z33A 5DEQA 4BH9A 1GXPA 1V55H 1HBXG 4AUXA 2PEXA 2RREA 4Q47A 3S3MA 2QYOA 4I76A 1YLFA 2EIJH 5DV5A 5LRRA 3BQZA 3L9FA 3PIOF 4F3QA 1RESA 2EIKH 1IZ1A 1WVRA 1XDSA 5IYCJ 1JT0A 2EFQA 1TQIA 2PQ8A 1K7AA 3LWFA 4ENMA 3T1BA 1T08B 1S7EA 1KU7A 2IS1A 3TW7A 3ZRGA 3OYCA 5KK1A 2BXZA 4V2GA 3CO6C 4JYKA 3DTIA 4R79A 3CC7I 4IHYA 2IJLA 2QGUA 5DTDA 3HBLA 3IHUA 4OIRF 1QVTA 1JE8A 4OAZA 2V1DA 4YG2F 5IT3A 2JK3A 2X51A 1NK2P 1QU3A 5HDGA 3JRGA 3L00A 5JHUA 2HPIA 2I5UA 4RS8A 4RB3C 2A5YB 2XAUA 4MFEA 3OS2A 4PDKA 1V5EA 1U9NA 3JCUC 3WTUC 1QHHD 2XF7A 3FISA 1MMAA 4CCKA 5JLXA 3R0AA 1UHSA 3U9GA 1Y1VJ 2DQLA 3EQLF 3E6CC 2KL4A 3MFKA 4TV7A 3BR3A 3OY9A 2VBXA 4UB8C 2KZVA 3DF8A 2IEKA 3MKYB 1VQ5I 2CQQA 2V79A 4HLXA 3FBNB 4ZDPA 4YFXF 5IY5H 5D4SA 4E7IA 5AIQA 3FXUA 3RKWA 2LBFA 1FC3A 2DFHA 2F5FA 3MZYA 4XLCA 3RDIA 3HOTA 1O4XA 2E35A 4A3IJ 3ERED 1G4DA 3RQIA 3W6VA 2K02A 2QQBA 1JUMA 4XICA 3AKZA 1MH3A 3LSRA 1ZREA 1X3ZB 4HLYA 4BHBA 3WU0A 4HF2A 5HNHA 1N75A 2JA2A 2P5LC 1VQKI 3H36A 5J4VA 2VJ4A 1MZBA 2DOFA 4E4HA 3JRFA 2HWVA 4B4CA 1U2WA 4IHSA 2ZCWA 2GAUA 1K6YA 2F4MB 1TWFJ 4X6AJ 2O8KA 3QPLA 5EGOA 5GPAA 2JA8J 4MEYF 1LFUP 3OYKA 4FT8A 4F55A 3E6BA 2L7MP 3BZ6A 2HDWA 4JX5A 3M3YJ 4W1UA 2XB5A 1WJAA 1B6AA 1JT6A 1MNDA 3NRVA 1V5GA 4AU7A 1Z21A 3D5SC 3NEUA 1WJBA 2YX4A 4ZZLA 2R0QC 3I54A 2R5YA 3KP6A 4NB5A 3IV5A 5KCMA 3O6BB 2DTRA 4BJTA 4HNVA 4BJ5C 4D0PA 5E3NA 1MJ9A 3JR9A 3CCUI 4FE7A 5IYDJ 1F36A 1MMGA 3PNVA 2VC0A 3L2QA 2DQRA 5DUIA 2AXLA 1TBXA 1BJZA 3GYHX 3PSIA 5E3OA 5FJ8J 2CSOA 3G1LA 3MKLA 1R9TJ 3REOA 3SDGA 3CCRI 2WWYA 3GTJJ 1JHHA 2KDZA 4U0YA 3K4MA 4HQEA 3S93A 3M07A 1W0TA 2IGNA 3K4BA 4ZYDA 3Q0VA 2P8TA 4D9JA 4LGWA 4YIRX 4I2OA 3J81K 4LOCA 5JVGF 5BMZA 2ZFUA 1RNLA 4C2UA 2L9VA 1ETWA 1RI7A 2DK5A 4G94A 1ZG1A 3EDPA 4YIIA 2PJPA 4IZZA 1AKHB 1HW2A 4Y3OA 5FKMA 2O7OA 2VE8A 3F22A 2ZMEB 2QCOA 3GTPJ 3CJNA 2AO9A 4II2A 1IV6A 1IRFA 4II3A 2CV2A 3M8JA 2CV0A 4M74A 1VQMI 4BAYA 1R58A 3G4SI 5EG0B 5BPIA 1P7IA 4RAFA 3IKVA 2KP6A 2CQ7A 5H2FC 5DDGA 1PUFA 4BXXJ 2EV5A 3TOAA 3KX2A 4EM2A 4B8XA 2ISZA 4KMUX 4BBRJ 3FF5A 4UXNA 5F0CA 5CVJA 2JPCA 2NVTJ 1SC7A 5ERIA 2DOEA 2QWWA 3K70C 4V19K 3AG2H 4AM3A 4I7HA 3V7CA 3CP2A 4F93B 2H1KA 4LMYA 3HTSB 4HZFA 3D5RC 3FDYA 4HX8A 4E6KG 2XV4S 3K70D 3LSHA 2ME6A 4MEXF 2KIQA 2W7NA 1J09A 2KJBA 4P9FA 2FNAA 3BG9A 3ULQB 2M34A 4B43A 1JKOC 1T0FA 1BBYA 2MC4A 2F48A 3FKJA 5J8FA 3HKZN 1X1AA 2ELKA 3WU2C 1QZEA 1YS6A 2LF7A 3BJAA 4A3EJ 3BROA 2O3FA 2DFEA 2LKXA 1VQ8I 1Z05A 3CMYA 4C2TA 1ZR4A 2E34A 3G2BA 3MAJA 2IT0A 3TDZC 3K1PA 1MDMA 1FBUA 3FHZA 3H5AA 4OOIA 5LGTA 2KQRA 3BP8A 5FRMA 2OQGA 3OYJA 4NBQA 4NUBA 5L3FA 3K1NA 4IVNA 2FMLA 3ABTA 2DU9A 2HFHA 4WF2A 2RGVA 2X6WA 3HUGA 2MG4A 1Z3XA 2H09A 3X2QH 1DGRM 5J1UA 1Y1WJ 1ULYA 3CDIA 3QODA 4BJ6C 2HOEA 4EVIA 2NNYA 4L9VA 1G3SA 1MW7A 2L5QA 4IEJA 5HLTA 2HDCA 2HS5A 2QBYA 5FRNA 2XAJA 2V6CA 4P96A 4A0ZA 3J7ZI 2BW3A 4GFBA 1E3HA 3OIQA 3ZQHA 4AD9A 2ESNA 3AFHA 4KITB 4B47A 2HZTA 1S29A 1FOKA 1IRZA 4BE0A 1QBJA 4XRSG 2FSWA 2RN7A 4MNUA 2EILH 1UHMA 2KFDA 1YRNA 1Z7LA 3CCMI 1G2HA 3WTTC 5FLVA 1ETKA 3FZVA 1VI0A 1VQNI 1FYLA 3WTXC 4Z6YA 5FFZA 4XIDA 1DPRA 2W48A 2XGDA 5FO5A 1ENHA 4UB6C 3RTRA 2DOAA 1OLTA 2DMQA 4HDUA 4XKBA 1BR4A 1FY7A 4HNTA 3PQKA 2GBYA 2Y0MA 2UXNA 2F4IA 1POGA 3HRMA 2R7WA 1OFCX 1R00A 1WJDA 1OYIA 2X1DA 4AIJA 1Y39A 1H9TA 4BE2A 2PI0A 2R5ZA 1HC8A 1YG2A 2KMUA 2DT6A 4DZPA 4ZYGA 3A0HC 3ECHA 2WAQA 3MVPA 4MTEA 2HGCA 2NVUB 3A01A 2PJRA 1X2NA 3TO6A 3OYIA 1S9HA 5IOYA 1F5TA 2FF4A 3K0LA 3CQZJ 1WGXA 4I6ZA 1R6RA 5EZGA 4UY8I 5CYVA 2FJ1A 5JVTA 3GFIA 4QPQA 5LLQA 2HYGD 2L9SA 2EA2A 2AQFA 2WY7Q 1QZZA 3BG5A 4ESBA 2FNPA 1CGPA 4BXUA 5GADJ 3BPXA 1OCTC 2VXDA 3CF5F 1N25A 1OR7C 4HEA2 3ZOBA 2DBBA 3QYFA 3TP0A 1GV2A 4FQGA 3LQQA 1BI2A 3FX3A 4BE1A 4L0ZB 1UFMA 5H20A 2K4BA 2A61A 4IQJA 1HKTA 1E3PA 2BGCA 3ABKH 5J6XA 1JKPC 4M73A 3BZKA 3MZHA 3JRCA 3CLOA 2XRLA 2Z5UA 1I3QJ 1X58A 2GA1A 2VN2A 1TC3C 3B02A 1ZKGA 2GIVA 2L9RA 2MABA 3K1MA 3WTSC 5HLGA 3RCOA 4OIPF 1XPXA 1FOWA 2Z1DA 1JJ8C 2EV0A 3M9AA 2NS8A 4S0HB 4ZC3A 4JP0A 1QVUA 3F8BA 3HGGA 4IL6C 3F8MA 3HRUA 2EWNA 4M72A 1IDZA 3AL0B 4IF4A 2JRMA 4AVZA 1DPUA 3K4JA 3IRQA 3R4KA 2COBA 5LHGA 2ZB9A 3S32A 3DV8A 2LYCA 3OSFA 2BBYA 4IX7A 1O3TA 5FKOA 2AHQA 2QF7A 2NAZA 1REPC 3BTCA 2R7DA 2WTEA 2R4GA 4DIQA 2WY8Q 1O3SA 1I6HJ 3V4GA 2Y48A 4LLNA 1KQ8A 1FBQA 5HLHA 3CC4I 3E5QA 3C2HA 1ZAOA 1P7JA 1S7AA 1IGNA 1DGWY 2HU9A 3SEQA 1VQLI 4RA2A 2IP2A 1A31A 2LH9A 5F0HA 3RZOJ 4BY1J 3DBRB 4CDGA 4M3DA 1JKRC 1WZ2A 2R3SA 1A36A 1P9QC 1OKRA 3EUKL 1BA5A 3LSIA 2A05A 1HA8A 2LFBA 1KQ0A 2XAGA 2BYVE 4XN3A 1NG7A 4UUSB 1I6XA 3KEOA 3VEPA 2COMA 3F72A 3RPUD 5CKTA 2DLLA 1R1VA 2GXGA 1MH4A 5GTHC 2OTJI 3GZ6A 4KICA 4CZCA 2KRHA 1V5FA 2O03A 1RUOA 2GWRA 1SMYF 2EPFA 2FA5A 1T38A 4RB1A 4G12A 2MYSA 2LTPA 3GFMA 4RDUA 3LSKA 1VNDA 3WE3A 4I0AA 3I9V2 5HS8A 3MQ0A 4EJUA 1B1BA 5LBQA 5M5WJ 2BE5F 1ETQA 2MA3A 3WG9A 1JKQC 4E70A 2VOPA 3PO2J 1JGGA 1WHUA 3P5JA 4RMNA 3OV8A 4NC6A 3VPRA 1SMTA 5DCMB 1ON2A 2JRTA 2H8WA 1TQPA 4V2FA 1RC9A 4A3CJ 2Y30A 3K4LA 4BACA 4GXOA 3S3OA 2XHKA 2ADUA 2W84A 5C4JJ 3KP5A 3I5UA 1YYVA 2K40A 1D1BA 2QQAA 3QYBA 5E3LA 3D0SA 1FZPB 3PFIA 3CJQB 5J47A 1BOAA 1HQCA 1NK3P 1GHCA 1I27A 1FYMA 3KETA 4RGRA 3PL8A 4I98B 2RNJA 3S2DJ 1UG0A 3BQYA 1UB9A 1D3YA 4D5FA 2Z2SB 4M9ZA 4EEFG 3JRBA 4U88A 4AC0A 5L3GA 3K7AJ 3ZPLA 1QNTA 5J40A 3QPTA 3H1CA 5E1WA 2XIGA 1T6SA 5ICCA 1YW9A 1PYVA 2K3FA 1OCCH 4G8XA 4YFKF 5C3EJ 3WGHA 2YUSA 3KLOA 1USTA 2NXNB 4BHCA 2CFOA 1OQYA 3T5XA 3S8PA 5E1ZB 2R93J 4OU0A 3S2WA 2HQRA 5D8KB 4XR6A 3MN2A 3RYPA 4B3AA 3VYSB 1IN8A 4U7BA 3I56I 4ENKA 2HDDA 1HSJA 2Y9YA 1OJLA 2V6EA 3FXJA 2G0EA 2Q1ZB 3DPLC 4A69C 2M5WA 1X1CA 2EH3A 4C3IJ 3RSNA 2QLZA 1A35A 1WRJA 3ABMH 3LSMA 4WXHA 1J0RA 3UNGC 3PUFA 4XL9A 3ZN1A 4JQFA 4CHUA 4CUGA 1N78A 4P1WA 5LGNA 4LB5A 3Q0UA 2NNNA 5FD5A 3E7LA 4AYBN 3L2RA 4EATA 1UHWA 2RDPA 3GMEA 2X1EA 3TBIA 4A3MJ 1Z1DA 2KIMA 2EV6A 2Y0SA 2BHYA 1W0UA 4GDFA 2F4OB 3ZQIA 2O0YA 2H6BA 4UV8A 2PG4A 4ZYHA 1ZGAA 2KJCA 2W24A 2E5ZA 3H5NA 2E2HJ 3QP6A 2RQQA 3VSKA 2P5VA 1ONVA 2DN0A 2DA6A 3MKWB 3MCZA 3D5LA 4DGWB 2XUBA 4CYCB 3GTLJ 1VQ4I 2JZYA 3J80Z 4DYQA 1U5TB 1MBHA 4BEHB 1R5ID 4H0EA 2AS5F 3L2CA 4KT6A 3DFGA 2HZDA 3ABLH 1SVMA 3OYHA 2KDOA 4BBSJ 3GTQJ 2R7RA 3G3ZA 4HSRA 1DUXC 4FE4A 4LG0A 3TP3A 3LA7A 1AOYA 1BI3A 5E20A 4PJ0C 4XSXF 2IA0A 2YPRA 3HZJA 2IBDA 3FKIJ 4LITA 1O7LA 1SEUA 1WJ5A 4NDLA 4NQWA 2K85A 2M7BA 5BOXA 4KIGA 5M5XJ 1VQ9I 3U21A 3NWSA 4DW6A 4UHTA 4ZDLA 1XB4A 1XGNA 1ZG3A 1S5LC 4C9YA 3CUQB 2BXYA 3QU3A 2X48A 1BW6A 2Z99A 4ON0A 2DMNA 2R7QA 2XF6A 3HHHA 2DA1A 3IAM2 4PCQA 5CLSA 1V3FA 2PLYA 1ETOA 2ELHA 4JX6A 2OD5A 2H1LA 3W6JB 4ZTJA 3M1EA 2QEXI 2WC2A 1KU9A 3S1QJ 1ZK8A 4CCOA 5HS7A 2W85A 4C30A 1Z6RA 2ZSIB 1XTAA 3CZ6A 1SD6A 2LG4A 1IJWC 3BG6A 2V1XA 4B44A 2I10A 1YIJI 1IC8A 1LDJA 1F4KA 3ML6A 1KONA 4M71A 1TQMA 3DEEA 1XG1A 3ZMSA 1W7PB 2ZJ2A 2VONA 2V9VA 1LB2A 2DW4A 2WB1A 4A3BJ 2DK8A 3BOQA 3ZQFA 3JW4A 4O3MA 4F7ZA 4G6QA 4AIKA 3LA2A 4G6DA 4O5VA 5IP6A 1KA8A 3HYIA 3HM5A 4MFDA 3KPHA 4HA8A 2OF7A 2M1BA 4HX4A 3CP8A 5F27A 4AVPA 1S72I 3K9TA 5B1BH 3FXRA 3L2WA 3BWGA 2E71A 2A3SA 1B72B 3QQAA 2RAEA 3K4KA 1P2FA 2RQPA 2A6HF 4Y7NJ 2H94A 4EV0A 5HODA 4MTDA 1FMWA 4KDPA 5GTIC 1OMIA 3TOBA 4ZH4F 1WI3A 4ENNA 4LIVA 5BQTA 4BS9A 3CF2A 4A3FJ 5CQGA 2IA2A 5F1JA 2K86A 1WQ2A 3MMYB 1TNTA 1AU7A 1B9MA 1I3AA 2W57A 2XPUA 2MSYA 3KP4A 1FP1D 3O3KA 5LFAA 5D5VB 5HDKA 4L18B 2ECBA 3C2GA 4PSWA 1Z9CA 2VIXA 1O3QA 3GTKJ 4XLHA 3P9CA 4PUSA 2CGPA 4Y13A 4QSHA 4JOMA 3WTWC 3KZIC 4Y17A 1U0JA 4Q4ZF 1LQ1A 2KT0A 5EJCA 4FX4A 4L0YB 2VKHA 4RAYA 4LFUA 2LDUA 3QRFF 3GTOJ 1SD5A 3G1MA 3AAFA 4B09A 2ZJPF 3M7GA 1HKQA 4L9TA 2ETHA 1U78A 2NOJB 3SFIA 3ZQ7A 1T39A 1EF4A 3LFKA 2XSJC 4O6JA 3HOYJ 4J00A 2BY2A 2FRHA 5J8CA 2JA5J 3CCSI 4GO1A 1X3UA 4XLNF 1BC8C 2A6TA 4YEJA 4Y4RA 4IPAA 3L1PA 1CF7B 4A3GJ 1LNWA 2P5KA 4RAGA 3J81Z 2BY1A 3MKZA 5DD8A 1TLHB 4RAZA 4BXFA 2QA4I 4XRMA 4XK4A 3OS1A 1VQPI 3HRTA 1MMSA 5B1AH 1GXQA 2L7FP 2R7ZJ 1ODDA 4L9NA 3S2HJ 2MW8A 4Q48A 4DBQA 1RRJA 2P7CB 2E1MB 3VFZA 4G7OF 3C1DA 2ZXWH 3BR6A 1HKSA 3GFLA 2IS6A 3DTKA 2Q2EA 3E6DA 1KYZA 2R7OA 3HC7A 1X2MA 2OUMA 1ZYRF 4MIMA 2VBZA 3IRRA 4OMYA 3A2KA 1U8BA 1R71A 2DA7A 2L02A 3MZ8A 3LMMA 3F9KA 4PGGA 3L2VA 2CUJA 2HXOA 1FSHA 2F5EA 3FIWA 3ZXSA 1HCRA 4QIWN 1X4OA 3OYMA 1U5TC 4L5IA 3H5RA 2A5WA 2E1CA 1EKEA 3GZNB 1P4XA 3H92A 2HVRA 2Y75A 3U1DA 2GZWA 4HBLA 5D5UB 3CCEI 3COAC 1IW7F 4WCGA 2LY9A 1FPQA 2KKOA 4I0BA 1NHAA 2VQLA 3KEQA 1XC5A 2KHMA 3K4NA 4GYGA 4PJLA 2NRAC 3RKXA 1A5JA 4BL0B 1OCRH 5EEGA 1YW7A 1KZHA 4FASD 5K5QA 2J5PA 2K9MA 3BT9A 3ECOA 4ZZDA 2M3AA 5E1XA 3PM1A 2Q0OA 3S1MJ 1H89C 4IO9F 1P6RA 1EJ9A 5F6FA 2EFWA 3EYIA 1JTYA 2VLAA 1JUPA 2M0MA 3M1CA 3GVAA 2K9QA 5F08A 3ZP5A 5CVUA 2M4GA 1J2XA 3CUQC 1YX5A 2L7KA 2HKOA 2VT3A 1LE8A 1IAWA 2I8DA 1OCOH 2P81A 2A6EF 1GUUA 3VDXA 3DCFA 1BJAA 1MSFC 3OOPA 1P4WA 4PFPA 1K78B 2CFXA 2K4JA 4KN4X 2CQKA 4UUVA 2K27A 1XDUA 3I59B 3WODF 3MEXA 2R92J 2F5VA 2LK2A 2X4HA 4R1HA 4DQ2A 1I1SA 5K1YA 1IF1A 2X6XA 2O6GE 3C18A 1G3YA 4EJTA 1R49A 4OIQF 3UKGA 3ELKA 1B8IA 1K6OA 3CJTB 2HQNA 4XNFA 4H4KC 5LRSA 1EV7A 2IGMA 2HQ5A 2VQCA 2V7FA 1AA7A 1W36C 5EYRA 4ZDOA 1W7PD 4NC8A 1I1GA 3FWEA 3HGYA 5F04A 4KISA 4XLFA 3A0BC 1LKXA 4KJZA 3N4MA 1RR7A 2M45A 2Y2ZA 1MMDA 4E7ZA 5ICEA 1W36D 3JSOA 1T2KA 4IRIA 3PFYA 4CYCA 3EYYA 5HDNA 5HOOA 1E2XA 3ZR8X 3OYBA 3ZGKA 3FK6A 4BEHA 1ETVA 2HI3A 3U2RA 2ZKZA 3BR0A 1YHQI 4PK4A 3M8EA 1LEAA 1IRGA 4XRSA 9ANTA 2R7FA 1GVJA 2W82A 5CVIA 1BR1A 3ZMTA 1LEBA 2CW7A 2DYRH 2OC6A 3C2BA 1LJ9A 1R4NB 1ACIA 2H8RA 1FYKA 4PJNA 5ICGA 2GLOA 1A04A 2LY2A 1Z77A 2QM3A 2A69F 1N77A 1YIOA 3HDDA 1WJEA 1ZG5A 2FX0A 4CO8A 2QKMB 5IOZA 1DU0A 2RNGA 2XAFA
chains in the Genus database with same CATH topology
2RREA 1G59A 4XKCA 3S3MA 1PJRA 2IXSA 2LRDA 3K4LA 4BACA 4F3QA 3S3OA 2IS4A 4MLOA 1D0YA 2DXIA 3QYBA 1D1BA 2JVHA 2VL8A 3CJQB 3W2VA 1E0EA 3KYLA 2IS1A 3PL8A 3MD2A 3ZRGA 3OYCA 2JSPA 1UG0A 3ZQQA 2Z2SB 3DTIA 3HKZA 4ZYAA 4R79A 4OWRB 4HNUA 1ERDA 4OAZA 2JUGA 2X51A 1QU3A 2HPIA 3LL7A 1PYVA 2XAUA 3OS2A 1LFPA 1V5EA 1QHHD 2XF7A 3TMOA 3FBIB 1MMAA 4CCKA 1ZELA 2VJIA 2CFOA 3HOSA 3S8PA 4XM3A 3OWTA 2KL4A 3K10A 4NC7A 3BLYA 4BDYA 3OL3A 3OY9A 4XR6A 2KZVA 3OYGA 3MKYB 3VYSB 3FBNB 4ZDPA 4U7BA 4ANJA 1FMVA 2LBFB 4IQ4A 4E7IA 2LBFA 2E1MC 4DOZA 3OYEA 1TZLA 3BCBA 4XLCA 3HOTA 2WAFA 2V6EA 3SZGA 3I3LA 2Q1ZB 2X85A 3DPLC 2VASA 3EUHC 1X1CA 4HSTA 3AKZA 3BG7A 3RSNA 1MMNA 3DU5A 3RQ4A 1LVKA 4DJAA 3LSMA 3UNGC 3OR1C 3OYLA 4XL9A 2VPLA 5HNHA 1N75A 4JQFA 2JA2A 4XLAA 4CUGA 1N78A 4P1WA 4N4OB 2VJ4A 4E4HA 3SYTA 2LOOA 1K6YA 3L2RA 4EATA 2X1EA 4QPOA 3TBIA 3SEZA 3OYKA 1SAUA 2AQEA 4F55A 2Y0SA 4CCLA 2HDWA 2VKDA 5TGTA 2DCEA 1WJAA 4LG3A 3VWBA 1MNDA 4AU7A 1V5GA 4RLQA 1Z21A 2E5ZA 3D5SC 3H5NA 1WJBA 2RQQA 4PSXA 3VSKA 1YE9A 2WAEA 5HNFA 3PNYA 3MKWB 3D5LA 5KCMA 4DGWB 2XF5A 3GBGA 4IKFA 4BJTA 1WFXA 4BJ5C 4XORA 2GOXB 1MMGA 3PNVA 3QOEA 4BEHB 3L2QA 2HVQA 3DWLE 3W3CA 2UV1A 1JI8A 2V9KA 4KT6A 3TL4X 2HZDA 3PSIA 3OYHA 2BVMA 2KDOA 2PMZA 2R7RA 1D1AA 4HSRA 3K6GA 3EPZA 2HPMA 2ZXIA 2X1CA 3K4MA 2R7XA 3S93A 2BOLA 2CH0A 2IGNA 4NQWB 4LITA 3K4BA 1WJ5A 2LREA 2M7BA 2UWMA 2LC2A 4D9JA 3U21A 3NWSA 4ITVA 4ZJZA 4HRIA 5JHFA 4C2UA 2ZFUA 3IUOA 2Z16A 4ZDLA 4CA0A 4IZZA 4Y3OA 3E1SA 4C9YA 4RM3A 1TT0A 4E7JA 2KRCA 4LIUA 4II2A 2R7QA 2XF6A 3IAM2 4II3A 2FUG2 1D0XA 2CV2A 3M8JA 2CV0A 3OYNA 2K9LA 1IRXA 1BR2A 4ZTJA 2KP6A 4CCOA 3KX2A 1WJFA 4C30A 4BDZA 2ZSIB 1NG6A 2VXZA 3CZ6A 2LG4A 3BG6A 3K70C 4B44A 2V1NA 3CP2A 3IAS2 4F93B 1GLNA 1KONA 3D5RC 3FDYA 4B3XA 4U87A 3DEEA 4E6KG 3LSHA 4E7SA 3K70D 2W7NA 1J09A 2WB1A 3VSLA 4B43A 2MC4A 2W1OA 3FKJA 4DBRA 4FETA 2KPMA 1X1AA 3DQVC 3OS0A 3OIPA 4E7HA 4HPQA 3CP8A 4C2TA 3G2BA 1D0ZA 2HQAA 3L2WA 2IGKA 3H5AA 3CMMA 2KQRA 3K4KA 1Y6IA 2GOMA 5FRMA 2OV7A 3H9JA 4RM2A 3OYJA 3HPGA 4RLFA 4NUBA 2R7SA 3OMYA 3V42A 1FMWA 4HG2A 3N05A 4BUPA 4LIVA 3HUGB 4BS9A 3CF2A 2X6WA 5CQGA 3MMYB 1Z3XA 3HL2A 5LFAA 1DGRM 2R7UA 3C2GA 4PSWA 4BJ6C 3QODA 2VIXA 2DT7B 1BOBA 2MD0A 4XLHA 4PUSA 3DKYA 3BC8A 4CCNA 3S3NA 4JOMA 1MW7A 2L5QA 5HLTA 1U0JA 2ELJA 3DLAA 5FRNA 2BW3B 1X1BA 2VKHA 3OYFA 4BGDA 2BW3A 3H0DA 4XLEA 3OIQA 4N4NB 3AFHA 3FHNA 4KITB 2E60A 4B47A 2JVGA 4BE0A 3DTEA 5LD2C 3E0JB 1Z7LA 1D1CA 2NOJB 4X0GA 2L9NA 2XSJC 2HNHA 3PNTA 3BCAA 4J00A 2CUZA 4BQQA 3AL0C 1SFKA 3H9GA 2A6TA 3RTRA 1X4PA 2DOAA 4YEJA 1OLTA 3HG9A 4XKBA 4Y4RA 4CH7A 1BR4A 4HNTA 3MKZA 2ZSHB 2F4IA 3SDBA 4BXFA 1X1DA 2R7WA 3OS1A 1WJDA 2X1DA 3ZCOA 2UUZA 3DPTA 4NNJA 1UAAA 4DBQA 4BE2A 2W4SA 4G6TB 2E1MB 3HXLA 5HVQC 4PJMA 2LY1A 2KMUA 2DT6A 2Q2EB 2X6YA 1QHGA 2IS2A 2WAQA 2R7VA 2IS6A 3DTKA 2CV1A 2PJRB 2XDVA 4PFOA 2R7OA 3HC7A 4XOTA 5CQEA 5KNLA 2PJRA 2OUMA 4OAYA 4BU2A 3OYIA 1S9HA 1VZ0A 2E5NA 3A2KA 4CSWA 1R6RA 2VQHA 2L2OA 4E7LA 2M7AA 2HVSA 3H35A 3F9KA 3LMMA 3L2VA 2CUJA 4QPQA 2L9SA 3VYTB 3ZXSA 4D1QA 2AQFA 2WY7Q 4ZTFA 1T95A 1X4OA 4YELA 2VXDA 3OYMA 5KHDA 1OR7C 4HEA2 3QYFA 3H5RA 2A5WA 2ZXHA 3EUAA 2K5CA 3K4CA 2M4KA 2XC7A 4BE1A 2HVRA 4CCJA 2V26A 2F6CA 4IQJA 2DJIA 3VYUB 2VQLA 4XKVA 3K4NA 2KHMA 3NWTA 4PJLA 4BL0B 4Y33A 3PJRA 2KLOA 4CCMA 4F91B 4FASD 2MABA 1LDKB 3ONQA 2K9MA 3RCOA 2M3AA 4XOPA 3J7AY 2Z1DA 3CESA 4F52A 3QYEA 4ZC3A 2VLAA 3DU6A 2M0MA 3M1CA 3OYAA 4BQOA 4AYBA 3UR3C 2M4GA 1YX5A 4B48A 3AL0B 2L7KA 2VJ5A 4AVZA 3K4JA 1DQUA 2I8DA 2IGOA 3IP4B 4F92B 4XONA 3VDXA 3S32A 1UELB 2LYCA 2CMPA 4IX7A 4PFPA 5FROA 3HPHA 4XQFA 2R4GA 4DIQA 2WY8Q 3KEYA 2F5VA 1G8XA 4PJJA 3A1YA 1X19A 2MFZA 4BQNA 3DKXA 3L2UA 3C2HA 3VYRB 4YRVA 1DGWY 2HU9A 3SEQA 2X6XA 1Z3YA 4E7KA 2K3PA 1MNEA 2LH9A 2VJJA 3W2AA 3DPUA 4XKWA 2V4JC 2WADA 2CS3A 1T0FC 4XNFA 1P9QC 3W2WA 4H4KC 3PSFA 1EA3A 2IGMA 2V7FA 3EUKL 2VQCA 1AA7A 3CJRB 1W36C 4ZDOA 3LSIA 1DP3A 4NC8A 2VQGA 3OYDA 4J01A 1HA8A 4KISA 4XLFA 4XN3A 2BVLA 1NG7A 2VB6A 1LKXA 4KJZA 2WBMA 4E7ZA 1MMDA 1W36D 3RPUD 3OL4A 4GRIA 5CKTA 3OR2C 3PFYA 5HOOA 3LSGA 3PUBA 3ZGKA 1WJCA 3ZR8X 4P5OA 3OYBA 4CZCA 4BEHA 2KRHA 1V5FA 3H9QA 2R7TA 2QKLB 4PK4A 2W00A 2MYSA 1Y56A 3LSKA 3OOUA 2CW8A 3I9V2 2WA0A 3A4CA 2P0WA 2W82A 1BR1A 1YX3A 2CW7A 2O5RA 2OC6A 4XMYA 4XN0A 3LFUA 4PJNA 2LY2A 4RMNA 1N77A 1WJEA 2QKMB 2RNGA 5CPRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFK A;  1R6R A; 
#chains in the Genus database with same CATH topology
 1MSE C;  2FQ3 A;  1PJR A;  1Q1V A;  3FXQ A;  1R1U A;  5K7H A;  2EFP A;  2LRD A;  2EK5 A;  4DYR A;  3HOU J;  2VKV A;  2IS4 A;  4MLO A;  4CGZ A;  2QSF X;  4D5C A;  5IP9 J;  1D0Y A;  3O8G A;  3WHB A;  3IWF A;  2EBI A;  5C4X J;  3W2V A;  4S05 A;  1E0E A;  2NS7 A;  3E6M A;  4A0Y A;  1R1T A;  5ICF A;  1RZ4 A;  4D7M A;  1HDP A;  3MD2 A;  1X3W B;  2JSP A;  3GFJ A;  4LJZ F;  5DS9 A;  5D5W B;  2PN6 A;  2VUM J;  5CJ9 A;  2XRN A;  1XN7 A;  1BN5 A;  3CCY A;  5E8I A;  2CWE A;  4ZYA A;  5J4Y A;  1STZ A;  1O3R A;  4OWR B;  3G71 I;  1ERD A;  5ILU A;  1XMA A;  2DO7 A;  2JUG A;  3S17 J;  4WXC A;  2WAQ N;  1SD4 A;  2PX9 A;  2VPR A;  4M9S A;  4U0V A;  4N0B A;  1QQI A;  1R5H A;  3CME I;  4LLG F;  1FIA A;  1LFP A;  1PP8 F;  2F5C A;  1BC7 C;  2L4A A;  3TMO A;  1MJA A;  3FBI B;  1JHF A;  1ZEL A;  2VJI A;  2YU3 A;  3R0J A;  5IP7 J;  2ACJ A;  3HOS A;  2XGC A;  3K10 A;  4NC7 A;  1MD0 A;  3BLY A;  3BG3 A;  3V8L A;  3OL3 A;  4BDY A;  2O8X A;  2DA5 A;  1R5G A;  5AIP A;  3OYG A;  1ORK A;  3HOZ J;  2EZH A;  2HYF A;  1XGS A;  2TRT A;  3FXM A;  4ANJ A;  1QPM A;  2LBF B;  2ZME C;  4IQ4 A;  4RB0 A;  2GXB A;  2E1M C;  3CCJ I;  1TZL A;  3BCB A;  2NVX J;  2WAF A;  2OJE D;  1TP4 A;  3SZG A;  3I3L A;  2ZO4 A;  1U3E M;  2YR2 A;  3EUH C;  4HDV A;  4JBA A;  4ZYE A;  5IT9 K;  5K5O A;  3D1N I;  3RQ4 A;  4DZJ A;  1LVK A;  3F8N A;  1YTY A;  3OR1 C;  4LK0 F;  2CJJ A;  2VPL A;  3BZC A;  3IH3 A;  3PQJ A;  5E79 C;  1V54 H;  2P4W A;  4ENJ A;  4M6V A;  3J7A O;  4WX9 A;  1U8R A;  2P6S A;  5FLM J;  5EGO B;  1WKM A;  5EEA A;  2KIU A;  6PAX A;  1SAU A;  4CCL A;  2VKD A;  1PDN C;  3JTH A;  5TGT A;  4MGR A;  1P92 A;  4KT5 C;  1ZH5 A;  4LG3 A;  4RLQ A;  2ZXJ A;  1WSU A;  1NTC A;  3KCC A;  1WH7 A;  1YE9 A;  4A6E A;  2R5Y B;  1L0O C;  3PNY A;  4CIC A;  4IKF A;  2GOX B;  5LGU A;  1OR7 A;  3DWL E;  2MH2 A;  3KIO A;  3I53 A;  5HLI A;  3W3C A;  5BNG A;  3JRE A;  3TL4 X;  1EH8 A;  5A2Q K;  1PUE E;  4YFN F;  3CCL I;  2PMZ A;  3LA3 A;  1D1A A;  3RJP A;  1Z0X A;  4QTR A;  2QSG X;  4A5M A;  2ZBK A;  3EPZ A;  3KE2 A;  2ZXI A;  2X1C A;  2HPM A;  2M2E A;  4KMF A;  2OCE A;  3BR5 A;  4I99 C;  2BOL A;  5CVV A;  3SFZ A;  4OIN F;  5D4R A;  2UWM A;  2UXX A;  4HYE A;  3WGG A;  1TW3 A;  2E1O A;  4ITV A;  4ZJZ A;  1R4M B;  4HRI A;  1VTN C;  5CVR A;  4MQ9 F;  3CDH A;  1D8J A;  3QPH A;  1ZRC A;  4CA0 A;  5L3E A;  3ERM A;  3BTL A;  2E7X A;  2RKH A;  3HOW J;  1AKH A;  3DLL F;  2LR8 A;  1UCR A;  3RIR A;  3PIP F;  3BDD A;  3ROU A;  3B6C A;  2ZME A;  4LIU A;  1RR8 C;  1BIA A;  3FK7 A;  5B5E C;  2FUG 2;  1FT9 A;  4HF1 A;  2F5D A;  3OYN A;  1S8N A;  2K9L A;  3G1O A;  2L54 A;  3E5X A;  3FMQ A;  1PP7 U;  1ON1 A;  5EG0 A;  5DCF A;  1PUF B;  3ZMD A;  2VKE A;  1XSD A;  4EGZ A;  3FM3 A;  1WJF A;  1M1E B;  2DOD A;  1FSE A;  3WU1 B;  4BDZ A;  1HF0 A;  2VXZ A;  3CLQ A;  1QPI A;  1VF9 A;  2DA2 A;  2IVM A;  1YS7 A;  1LVA A;  1YQA A;  1TTY A;  2CO5 A;  2K7L A;  3FM5 A;  4E7S A;  1YIT I;  2D1V A;  1FNN A;  2HOS A;  2ICW G;  3VSL A;  1EH7 A;  1VQ6 I;  5H6Q A;  2XSD C;  4A3D J;  3TQN A;  2YU9 J;  2W1O A;  4FET A;  2KPM A;  2LNB A;  3RPU A;  4LD5 A;  2M9H A;  1B9N A;  2HTJ A;  1BM9 A;  2XPV A;  4KA4 A;  3OIP A;  1XGM A;  4E7H A;  3TGN A;  2FD5 A;  1YJN I;  2E36 A;  4EMS A;  3R6S A;  1D8K A;  1UZC A;  4HQM A;  2QEN A;  1Y6I A;  3GZ5 A;  5FFX A;  5GAE J;  4RM2 A;  4UNO A;  1HW5 A;  3F3X A;  4IRH A;  4RLF A;  2DPD A;  2DPU A;  3OMY A;  5DM6 F;  2UZK A;  3I58 A;  4OMZ A;  4HG2 A;  3N05 A;  3HOX J;  2EIN H;  2M0C A;  3HUG B;  5JR3 A;  3I64 A;  1S6L A;  3B6A A;  2GM4 A;  3HL2 A;  4N9H A;  3IKT A;  5BS6 A;  3E5U A;  3OIO A;  2R7U A;  3JAM K;  1RKW A;  2DT7 B;  2MD0 A;  3LOC A;  3I59 A;  3BC8 A;  3RYR A;  2P6T A;  4CCN A;  3S3N A;  3I71 A;  2QBY B;  2JA6 J;  1ZGW A;  4ASN A;  1W1W E;  3KZY A;  3DLA A;  2BW3 B;  3OYF A;  4BGD A;  3H0D A;  3WTY C;  3HJE A;  4XLE A;  2OA4 A;  5J1Y A;  1J59 A;  4I01 A;  2BEO A;  2OCC H;  5D5X B;  3H3Z A;  4XBF A;  2JSC A;  3N97 A;  2JVG A;  2EZK A;  1T56 A;  4IXA A;  2JA7 J;  1JJ6 C;  3DTE A;  1YRN B;  5LD2 C;  3H0G J;  5EDN A;  2X0L A;  4X0G A;  2L9N A;  3DBH B;  3CMA I;  2CYY A;  2DYS H;  1HLV A;  1E3O C;  2XKO A;  2Y0S N;  3PNT A;  2HXI A;  2MC3 A;  3AL0 C;  5K5R A;  3C7J A;  1SFK A;  3I4M J;  2E19 A;  1ITY A;  4UV9 A;  4CH7 A;  4RGU A;  4EM1 A;  1WWX A;  5BPD A;  1ZLK A;  2XAS A;  2DT5 A;  2O61 A;  2QVO A;  3NQO A;  3SDB A;  5C44 J;  2FBI A;  5KAF C;  5FGM A;  1X1D A;  3FMR A;  1GDT A;  3CD6 I;  2DFF A;  5KVR A;  1MGT A;  2UUZ A;  3DXJ F;  4RGX A;  2R5Z B;  1UAA A;  3DEU A;  1F1Z A;  3HXL A;  3S16 J;  4HF0 A;  4PJM A;  1TT5 B;  2X6Y A;  1QHG A;  3MWM A;  2IS2 A;  2R7V A;  4J19 A;  3A01 B;  2D45 A;  2CV1 A;  2PJR B;  4EM0 B;  4PFO A;  4XOT A;  5CQE A;  3BJ6 A;  4BU2 A;  2IPQ X;  1S7O A;  4RGS A;  1X1P A;  3V8K A;  2E5N A;  3BJO A;  4FHT A;  1BI1 A;  2KRF A;  3BTI A;  3Q9S A;  4WWC A;  1XSV A;  4LB6 B;  1YI2 I;  1K83 J;  2HVS A;  3H35 A;  2XPW A;  2FMY A;  2WV0 A;  1FIP A;  2CUE A;  3VYT B;  5EEH A;  4ETS A;  4KIF A;  4IRG A;  4ZTF A;  1K61 A;  4YEL A;  3ASN H;  1G6N A;  2GIZ A;  3O8H A;  1BI0 A;  1XMX A;  4I02 A;  2NVY J;  4M3F A;  2JTV A;  2CU7 A;  4BYY A;  3GUD A;  2K5C A;  5AON A;  1KU2 A;  2M4K A;  1K79 A;  4CCJ A;  2LD5 A;  4EQQ A;  4U0W A;  1I5Z A;  4P9U A;  3L09 A;  3GLL A;  4IOC F;  3VYU B;  5K7F A;  4UVC A;  5EZH A;  1QO0 D;  3HOV J;  3LSJ A;  4R8H A;  1HDD C;  5LEK A;  1IXC A;  3NWT A;  1R23 A;  2P7V B;  4G9Y A;  3Q5F A;  3GO5 A;  1TWH J;  2O9L A;  3PJR A;  2KLO A;  2OU2 A;  5LEJ A;  4F91 B;  5M3F J;  1LDK B;  3ONQ A;  4XRF A;  1HXD A;  2XGE A;  3CO7 C;  1RIO H;  4XOP A;  3GTG J;  3J7A Y;  3TDU C;  1H0M A;  3CES A;  4F52 A;  3E3V A;  3LSP A;  2X9D A;  3DU6 A;  2KIS A;  1ZN2 A;  3OYA A;  3F6O A;  5IYB J;  4M3E A;  2WB1 N;  4EGY A;  1VFC A;  3ZN0 A;  1SFU A;  1OCZ H;  2LKP A;  2XKP A;  2KZG A;  5GAH J;  1MNM C;  3GX4 X;  2DAO A;  4GGG A;  3V7S A;  2EJR A;  4EJO A;  3IP4 B;  2MBF A;  4F92 B;  1TWC J;  5D6E A;  1UEL B;  4NHJ A;  2E2J J;  2CMP A;  4MO7 A;  3KP3 A;  4HOB A;  3EET A;  2BHZ A;  1FJL A;  1QGP A;  2F2E A;  3SHF A;  1WH5 A;  4L5J A;  1TWA J;  2MFZ A;  2LLK A;  3R61 A;  2HR3 A;  3L2U A;  4FTH A;  2ZJR F;  3VYR B;  4U7D A;  2B9S A;  4IHT A;  1E17 A;  1ZRD A;  1XMK A;  1Z3Y A;  2J5O A;  2GQQ A;  1MNE A;  4GCV A;  2JQ7 A;  3DPU A;  1Y8Q B;  4XKW A;  4DYC A;  1LFB A;  2WAD A;  1T0F C;  3W2W A;  1Q1H A;  3PSF A;  1EA3 A;  2XVC A;  2DJN A;  2OAZ A;  3ZMZ A;  3OYD A;  5B66 C;  4XLP F;  1HW1 A;  4KFC A;  3HSE A;  3SXY A;  3GW2 A;  4UUS A;  4A3L J;  3OR2 C;  1I50 J;  1Y0U A;  1S3J A;  4QWQ A;  4QLC U;  4ESJ A;  3LSG A;  3PUB A;  2K9S A;  2IA1 A;  2JMW A;  2DDB A;  5LHI A;  3H9Q A;  3R60 A;  1PVE A;  2EQR A;  1Y56 A;  3HEF A;  1FOX A;  1Y8R B;  2VOD A;  2CW8 A;  2WA0 A;  3A4C A;  2P0W A;  4CYD A;  1YX3 A;  3WHC A;  3LST A;  4OIO F;  2OTL I;  2DA3 A;  2B63 J;  1KYW A;  2LF8 A;  5F64 A;  4KN7 X;  2KIF A;  3LFU A;  2VBW A;  3T8T A;  1JTX A;  1XCB A;  3VOD A;  2VOO A;  2BY0 A;  2L4M A;  2C6Y A;  1QRY A;  2OZU A;  5CPR B;  4L9J A;  2A07 F;  1G59 A;  3FXK A;  4XKC A;  5DCM A;  3JRD A;  1HOM A;  2YX7 A;  2NOG A;  4C3H J;  1XSX A;  2IXS A;  3QAH A;  4MQV A;  1IN4 A;  1IN6 A;  1V4R A;  3DBL B;  1ZTR A;  2E2I J;  1OCP A;  5TRD A;  1TWG J;  2DXI A;  2JVH A;  2VL8 A;  3VOE A;  2CQX A;  3I55 I;  3KYL A;  3BR2 A;  1I39 A;  5L3B A;  5JFR A;  2G7H A;  1ZRF A;  2IRF G;  3NAR A;  3ZQQ A;  2QSH X;  1YJW I;  5FKL A;  3TW6 A;  1B4A A;  3HKZ A;  5IPA A;  3AG1 H;  4HNU A;  3LAP A;  3IH2 A;  1R22 A;  4WXD A;  1UG2 A;  2M87 A;  1WPK A;  2PBI A;  2L0K A;  3LL7 A;  3ZQG A;  2JWT A;  2RVC A;  1GV5 A;  2PFB A;  2QQ9 A;  2Z9O A;  3E97 A;  3F21 A;  3AG4 H;  4L5E A;  1K4T A;  1SFX A;  2DDA A;  2ZNY A;  2EZL A;  2CW0 F;  4A0X A;  3FXO A;  1MJB A;  3LQR A;  1W5T A;  1C0W A;  2EFO A;  4C3J J;  1SAX A;  4XM3 A;  1YFH A;  3OWT A;  3HB9 A;  4A12 A;  2ZC2 A;  3ESW B;  3P9K A;  1W4M A;  2RC4 A;  3HSF A;  2V9P A;  1FMV A;  1MBG A;  2L7Z A;  4DOZ A;  2LSO A;  4KIB A;  3OYE A;  5HS9 A;  3KZZ A;  5LHH A;  4CXF A;  3HHG A;  3CC2 I;  1FTZ A;  2X85 A;  1GT0 C;  2VAS A;  4ABZ A;  4HST A;  1APL C;  3BG7 A;  5L3D A;  1MMN A;  3DU5 A;  1IG7 A;  1AHD P;  1XD7 A;  3BY6 A;  4W97 A;  2EIM H;  4DJA A;  3OYL A;  1U9O A;  4XLA A;  1LDD A;  2XAQ A;  3KFW X;  4N4O B;  3SYT A;  3LNQ A;  2HTS A;  2LOO A;  5JI6 A;  3GTM J;  2MLK A;  4QPO A;  1D5V A;  3SEZ A;  2AQE A;  2PMU A;  3M4O J;  3OSG A;  2DCE A;  2JPB A;  2LVS A;  3VWB A;  1A6Q A;  1Y0N A;  5K7Z A;  3PO3 J;  2Q8K A;  5M3M J;  1FOY A;  4PSX A;  4KNY A;  4CZZ A;  5D8L B;  2WAE A;  5HNF A;  3K2A A;  3SQN A;  2YSR A;  2XF5 A;  3GBG A;  1WFX A;  2Y31 A;  4XOR A;  3QOE A;  3DKW A;  2FXA A;  1BIB A;  1W5C C;  4AIH A;  2HVQ A;  1U5T A;  2UV1 A;  4LK1 F;  2V9K A;  1JI8 A;  3JTG A;  2BVM A;  4Y52 J;  2HOT A;  2HYJ A;  5GP9 A;  1TL8 A;  4LG0 B;  3K6G A;  4FIS A;  2DMU A;  2DMP A;  2R7X A;  1IXS B;  3K2Z A;  3KYC B;  3B73 A;  1ZQ3 P;  1T8I A;  2OZ6 A;  2CH0 A;  4NQW B;  4P55 A;  1MBF A;  1MBE A;  4AWX B;  3GXO A;  2HEO A;  2EFN A;  2LRE A;  2OBP A;  3T8R A;  3SZP A;  2LC2 A;  3I0T A;  2DTZ A;  4PGH A;  1ZR2 A;  1KQ9 A;  2AXT C;  1MIJ A;  2IAI A;  4IJA A;  1OYW A;  1XGO A;  4C2M J;  3WTV C;  3CCV I;  2PMH A;  5L3C A;  5JHF A;  1LUJ B;  2LMD A;  3GCM A;  3IUO A;  1IV8 A;  2OPT A;  2Z16 A;  1H8A C;  2MH9 A;  2X6O A;  1O57 A;  3RZD J;  3IL2 A;  4HV5 A;  3E1S A;  3RPQ A;  3U1K A;  4RM3 A;  1TT0 A;  4E7J A;  3CUQ A;  2KRC A;  2B7E A;  1YOV B;  2DFI A;  3F8F A;  5ILS A;  4A93 J;  3HTU A;  1KGS A;  1D0X A;  5FD6 A;  1IXR C;  3ZQC A;  2YS9 A;  3RI4 A;  1BR2 A;  1IRX A;  1Z67 A;  1J9I A;  5DM7 F;  3BPV A;  5D6F A;  4JX4 A;  2CRG A;  2E1N A;  2ISY A;  4LLL A;  2CQN A;  1T33 A;  2FBK A;  3P7N A;  1IUY A;  2FE3 A;  3H3V K;  1NG6 A;  1K4S A;  1TNS A;  2VC1 A;  2V1N A;  4IHW A;  3F8C A;  3IAS 2;  2B0L A;  1Z7U A;  1GLN A;  2BY3 A;  3RKQ A;  1ZHF A;  3F0C A;  4B3X A;  4U87 A;  5E3M A;  1W7P A;  2CUF A;  3ABU A;  1IDY A;  3QOP A;  1RUN A;  4M3G A;  1SVL A;  2HKX A;  3S1N J;  5F0F A;  4DBR A;  3WGI A;  2DA4 A;  2JN6 A;  3DQV C;  4BKX A;  1J5Y A;  3OS0 A;  4RB2 C;  1BL0 A;  1IO2 A;  4HPQ A;  2JT1 A;  2FEZ A;  3GWZ A;  2V1U A;  2ESH A;  4IHV A;  1D0Z A;  1LPQ A;  5IT9 Z;  2HQA A;  1H9G A;  4G7Z F;  1IN7 A;  3I4N J;  4AID A;  2IGK A;  2EA4 A;  1H88 C;  3CMM A;  4D7N A;  2GOM A;  1B72 A;  1Z6T A;  2OV7 A;  3H9J A;  3HPG A;  1TW2 A;  3HIF A;  3CUO A;  2R7S A;  2VI6 A;  3GLX A;  1ZGJ A;  3V42 A;  5FKK A;  1VQO I;  4BUP A;  2M30 A;  2MGQ A;  4A3K J;  2XGX A;  1ZLJ A;  5B3S H;  5DD4 A;  1DU6 A;  3K69 A;  1J75 A;  1RKT A;  5E8G A;  2E7W A;  3G6E I;  3QP5 A;  1SFE A;  1FLI A;  1G3T A;  2EB7 A;  5E18 F;  3F23 A;  3KYD B;  1BOB A;  2ZFW A;  3DKY A;  3JRA A;  2ME0 A;  3FXL A;  5KAI C;  2NS0 A;  3H3U A;  4BY7 J;  2ELJ A;  3ZQL A;  1X1B A;  5F1R A;  1D5Y A;  1A6I A;  4A3J J;  2DMT A;  3ISP A;  4GYI A;  4N4N B;  3FHN A;  2E60 A;  2FU4 A;  3G73 A;  3IC7 A;  1SAN A;  1MBK A;  5A2Q Z;  1YJ9 I;  4MHG A;  2JJ7 A;  1ZAR A;  3E0J B;  1BW5 A;  5J3L A;  1D1C A;  4UUT A;  3L7W A;  1JGS A;  2HNH A;  3GF2 A;  1GVD A;  3TO9 A;  3BCA A;  1OYY A;  3A02 A;  2CUZ A;  1B59 A;  4BQQ A;  3Q9V A;  3JRI A;  5FB2 A;  2EZI A;  2ID6 A;  3H9G A;  3BR1 A;  1X4P A;  4BNC A;  3HG9 A;  3QU6 A;  1EH6 A;  5E17 F;  5FLX Z;  2ZNZ A;  2Y9Z A;  1CF7 A;  1SD7 A;  5FLX K;  1FBS A;  1SFO J;  2ZSH B;  2HOA A;  2D2W A;  1JUS A;  2GA2 A;  5H6R A;  4RBO A;  2GXA A;  1FP2 A;  3TO7 A;  4HX7 A;  3T0Y A;  4M9X A;  3DPT A;  3ZCO A;  4NNJ A;  2VE9 A;  1OIS A;  2PMZ N;  3ZMU A;  2W4S A;  4G6T B;  4YIF A;  1VQ7 I;  4PZJ A;  3KLN A;  4DNC A;  5HVQ C;  2LY1 A;  1XCV A;  2Q2E B;  3Q0W A;  5ILV A;  4UVB A;  3DEW A;  2L01 A;  2XDV A;  3EUH A;  3WTZ A;  5KNL A;  4IHX A;  4OAY A;  2WV1 A;  2QZ8 A;  1IUF A;  1VZ0 A;  4K2E A;  4HAM A;  2ZJQ F;  2M8E A;  3WE2 A;  4CSW A;  2VQH A;  2L2O A;  1R7J A;  4E7L A;  2FOW A;  2FBH A;  2M7A A;  3P9I A;  4D1Q A;  4ESF A;  1YW8 A;  3KP2 A;  1T95 A;  1UMQ A;  2VT2 A;  5KHD A;  4Y15 A;  3SJM A;  2XAH A;  2ZXH A;  3EUA A;  3IWZ A;  2M8G X;  1FWZ A;  3K4C A;  2RV8 A;  2XC7 A;  2N8G A;  2V26 A;  3TED A;  1DP7 P;  3J7Y J;  2F6C A;  3Q3S A;  2OQR A;  4M6X A;  3V7R A;  4Q5S F;  2DJI A;  3NAU A;  1FTT A;  1MBJ A;  2BZT A;  1W5S A;  1OPC A;  4XKV A;  3HRS A;  1L3L A;  2ECC A;  2TCT A;  3WG7 H;  4Y33 A;  1ETY A;  2VBY A;  2NVQ J;  1USS A;  2TDX A;  4CCM A;  1F43 A;  1RPW A;  4EJV A;  1HST A;  1XX5 A;  5J1R A;  1MDM B;  1XS9 A;  3JRH A;  1NH3 A;  5GPC A;  4A2U A;  1UJ8 A;  4KYW A;  5TJJ A;  1P4A A;  4FCY A;  3RKY A;  3QYE A;  3IH4 A;  3JSP A;  4Z2Y A;  2MLG A;  2D5V A;  4BQO A;  5DYM A;  1Z91 A;  1RET A;  4AYB A;  3UR3 C;  3LAJ A;  2FQ4 A;  3QWL A;  1JXS A;  4I09 A;  4B48 A;  2VJ5 A;  1LE8 B;  3ASO H;  1ETX A;  4N9I A;  1QZY A;  2Z3Y A;  1DQU A;  4BHP A;  2D1H A;  1CQT A;  2IGO A;  3I4P A;  3M8F A;  1WI9 A;  4XSZ F;  3AG3 H;  4XON A;  1J7K A;  3HSR A;  1YO5 C;  4JK1 X;  3QPS A;  2LKS A;  5FRO A;  3HPH A;  3JAM Z;  2L3D A;  4XQF A;  3S15 J;  1K78 A;  1FX7 A;  5M5Y J;  5JLW A;  5EF6 A;  3O2P E;  3KEY A;  4S04 A;  3SZT A;  2QUF A;  1G8X A;  1DDN A;  4PJJ A;  3A1Y A;  1G3W A;  3A03 A;  2XRO A;  3S14 J;  1X19 A;  1O7F A;  2MD5 A;  3DKX A;  3W6K B;  4BQN A;  4M3B A;  4YRV A;  4WK8 F;  1T98 A;  2XB0 X;  3C3W A;  3CDL A;  2G7U A;  3FMS A;  4E7K A;  2K3P A;  2VJJ A;  1F9N A;  3TKY A;  3VB2 A;  3W2A A;  1B8I B;  2QQ8 A;  2W25 A;  2BV6 A;  2V4J C;  3ZMV A;  1WCM J;  2CS3 A;  1DP3 A;  2A68 F;  3CJR B;  3DP7 A;  2IW5 A;  4KUM A;  2VQG A;  4J01 A;  2CG4 A;  1SVO A;  2BVL A;  1R36 A;  2JUC A;  2VB6 A;  2G9W A;  2WBM A;  1KU3 A;  3OL4 A;  4GRI A;  2STT A;  4A6D A;  2ID3 A;  5GAG J;  3BTJ A;  4IOA F;  2NYX A;  3KP7 A;  4X1E A;  1FEX A;  3S1R J;  1QA6 A;  3J80 K;  1WJC A;  1IN5 A;  2K9N A;  4P5O A;  2FOK A;  4HV6 A;  2H27 A;  4B1R A;  2DI3 A;  3GEZ A;  2R7T A;  4UVA A;  4HW0 A;  5DUK A;  2LP0 A;  2QKL B;  1MKM A;  3F6V A;  5FKN A;  1AWC A;  4M6Y A;  2STW A;  1U6G A;  2W00 A;  5ED4 A;  4BQA A;  3OOU A;  2H6C A;  5TIS C;  4EJW A;  2O5R A;  4XMY A;  2Y69 H;  4FX0 A;  4XN0 A;  3CTA A;  4G7H F;  4A5N A;  3CCQ I;  3V8J A;  2Z33 A;  5DEQ A;  4BH9 A;  1GXP A;  1V55 H;  1HBX G;  4AUX A;  2PEX A;  2RRE A;  4Q47 A;  3S3M A;  2QYO A;  4I76 A;  1YLF A;  2EIJ H;  5DV5 A;  5LRR A;  3BQZ A;  3L9F A;  3PIO F;  4F3Q A;  1RES A;  2EIK H;  1IZ1 A;  1WVR A;  1XDS A;  5IYC J;  1JT0 A;  2EFQ A;  1TQI A;  2PQ8 A;  1K7A A;  3LWF A;  4ENM A;  3T1B A;  1T08 B;  1S7E A;  1KU7 A;  2IS1 A;  3TW7 A;  3ZRG A;  3OYC A;  5KK1 A;  2BXZ A;  4V2G A;  3CO6 C;  4JYK A;  3DTI A;  4R79 A;  3CC7 I;  4IHY A;  2IJL A;  2QGU A;  5DTD A;  3HBL A;  3IHU A;  4OIR F;  1QVT A;  1JE8 A;  4OAZ A;  2V1D A;  4YG2 F;  5IT3 A;  2JK3 A;  2X51 A;  1NK2 P;  1QU3 A;  5HDG A;  3JRG A;  3L00 A;  5JHU A;  2HPI A;  2I5U A;  4RS8 A;  4RB3 C;  2A5Y B;  2XAU A;  4MFE A;  3OS2 A;  4PDK A;  1V5E A;  1U9N A;  3JCU C;  3WTU C;  1QHH D;  2XF7 A;  3FIS A;  1MMA A;  4CCK A;  5JLX A;  3R0A A;  1UHS A;  3U9G A;  1Y1V J;  2DQL A;  3EQL F;  3E6C C;  2KL4 A;  3MFK A;  4TV7 A;  3BR3 A;  3OY9 A;  2VBX A;  4UB8 C;  2KZV A;  3DF8 A;  2IEK A;  3MKY B;  1VQ5 I;  2CQQ A;  2V79 A;  4HLX A;  3FBN B;  4ZDP A;  4YFX F;  5IY5 H;  5D4S A;  4E7I A;  5AIQ A;  3FXU A;  3RKW A;  2LBF A;  1FC3 A;  2DFH A;  2F5F A;  3MZY A;  4XLC A;  3RDI A;  3HOT A;  1O4X A;  2E35 A;  4A3I J;  3ERE D;  1G4D A;  3RQI A;  3W6V A;  2K02 A;  2QQB A;  1JUM A;  4XIC A;  3AKZ A;  1MH3 A;  3LSR A;  1ZRE A;  1X3Z B;  4HLY A;  4BHB A;  3WU0 A;  4HF2 A;  5HNH A;  1N75 A;  2JA2 A;  2P5L C;  1VQK I;  3H36 A;  5J4V A;  2VJ4 A;  1MZB A;  2DOF A;  4E4H A;  3JRF A;  2HWV A;  4B4C A;  1U2W A;  4IHS A;  2ZCW A;  2GAU A;  1K6Y A;  2F4M B;  1TWF J;  4X6A J;  2O8K A;  3QPL A;  5EGO A;  5GPA A;  2JA8 J;  4MEY F;  1LFU P;  3OYK A;  4FT8 A;  4F55 A;  3E6B A;  2L7M P;  3BZ6 A;  2HDW A;  4JX5 A;  3M3Y J;  4W1U A;  2XB5 A;  1WJA A;  1B6A A;  1JT6 A;  1MND A;  3NRV A;  1V5G A;  4AU7 A;  1Z21 A;  3D5S C;  3NEU A;  1WJB A;  2YX4 A;  4ZZL A;  2R0Q C;  3I54 A;  2R5Y A;  3KP6 A;  4NB5 A;  3IV5 A;  5KCM A;  3O6B B;  2DTR A;  4BJT A;  4HNV A;  4BJ5 C;  4D0P A;  5E3N A;  1MJ9 A;  3JR9 A;  3CCU I;  4FE7 A;  5IYD J;  1F36 A;  1MMG A;  3PNV A;  2VC0 A;  3L2Q A;  2DQR A;  5DUI A;  2AXL A;  1TBX A;  1BJZ A;  3GYH X;  3PSI A;  5E3O A;  5FJ8 J;  2CSO A;  3G1L A;  3MKL A;  1R9T J;  3REO A;  3SDG A;  3CCR I;  2WWY A;  3GTJ J;  1JHH A;  2KDZ A;  4U0Y A;  3K4M A;  4HQE A;  3S93 A;  3M07 A;  1W0T A;  2IGN A;  3K4B A;  4ZYD A;  3Q0V A;  2P8T A;  4D9J A;  4LGW A;  4YIR X;  4I2O A;  3J81 K;  4LOC A;  5JVG F;  5BMZ A;  2ZFU A;  1RNL A;  4C2U A;  2L9V A;  1ETW A;  1RI7 A;  2DK5 A;  4G94 A;  1ZG1 A;  3EDP A;  4YII A;  2PJP A;  4IZZ A;  1AKH B;  1HW2 A;  4Y3O A;  5FKM A;  2O7O A;  2VE8 A;  3F22 A;  2ZME B;  2QCO A;  3GTP J;  3CJN A;  2AO9 A;  4II2 A;  1IV6 A;  1IRF A;  4II3 A;  2CV2 A;  3M8J A;  2CV0 A;  4M74 A;  1VQM I;  4BAY A;  1R58 A;  3G4S I;  5EG0 B;  5BPI A;  1P7I A;  4RAF A;  3IKV A;  2KP6 A;  2CQ7 A;  5H2F C;  5DDG A;  1PUF A;  4BXX J;  2EV5 A;  3TOA A;  3KX2 A;  4EM2 A;  4B8X A;  2ISZ A;  4KMU X;  4BBR J;  3FF5 A;  4UXN A;  5F0C A;  5CVJ A;  2JPC A;  2NVT J;  1SC7 A;  5ERI A;  2DOE A;  2QWW A;  3K70 C;  4V19 K;  3AG2 H;  4AM3 A;  4I7H A;  3V7C A;  3CP2 A;  4F93 B;  2H1K A;  4LMY A;  3HTS B;  4HZF A;  3D5R C;  3FDY A;  4HX8 A;  4E6K G;  2XV4 S;  3K70 D;  3LSH A;  2ME6 A;  4MEX F;  2KIQ A;  2W7N A;  1J09 A;  2KJB A;  4P9F A;  2FNA A;  3BG9 A;  3ULQ B;  2M34 A;  4B43 A;  1JKO C;  1T0F A;  1BBY A;  2MC4 A;  2F48 A;  3FKJ A;  5J8F A;  3HKZ N;  1X1A A;  2ELK A;  3WU2 C;  1QZE A;  1YS6 A;  2LF7 A;  3BJA A;  4A3E J;  3BRO A;  2O3F A;  2DFE A;  2LKX A;  1VQ8 I;  1Z05 A;  3CMY A;  4C2T A;  1ZR4 A;  2E34 A;  3G2B A;  3MAJ A;  2IT0 A;  3TDZ C;  3K1P A;  1MDM A;  1FBU A;  3FHZ A;  3H5A A;  4OOI A;  5LGT A;  2KQR A;  3BP8 A;  5FRM A;  2OQG A;  3OYJ A;  4NBQ A;  4NUB A;  5L3F A;  3K1N A;  4IVN A;  2FML A;  3ABT A;  2DU9 A;  2HFH A;  4WF2 A;  2RGV A;  2X6W A;  3HUG A;  2MG4 A;  1Z3X A;  2H09 A;  3X2Q H;  1DGR M;  5J1U A;  1Y1W J;  1ULY A;  3CDI A;  3QOD A;  4BJ6 C;  2HOE A;  4EVI A;  2NNY A;  4L9V A;  1G3S A;  1MW7 A;  2L5Q A;  4IEJ A;  5HLT A;  2HDC A;  2HS5 A;  2QBY A;  5FRN A;  2XAJ A;  2V6C A;  4P96 A;  4A0Z A;  3J7Z I;  2BW3 A;  4GFB A;  1E3H A;  3OIQ A;  3ZQH A;  4AD9 A;  2ESN A;  3AFH A;  4KIT B;  4B47 A;  2HZT A;  1S29 A;  1FOK A;  1IRZ A;  4BE0 A;  1QBJ A;  4XRS G;  2FSW A;  2RN7 A;  4MNU A;  2EIL H;  1UHM A;  2KFD A;  1YRN A;  1Z7L A;  3CCM I;  1G2H A;  3WTT C;  5FLV A;  1ETK A;  3FZV A;  1VI0 A;  1VQN I;  1FYL A;  3WTX C;  4Z6Y A;  5FFZ A;  4XID A;  1DPR A;  2W48 A;  2XGD A;  5FO5 A;  1ENH A;  4UB6 C;  3RTR A;  2DOA A;  1OLT A;  2DMQ A;  4HDU A;  4XKB A;  1BR4 A;  1FY7 A;  4HNT A;  3PQK A;  2GBY A;  2Y0M A;  2UXN A;  2F4I A;  1POG A;  3HRM A;  2R7W A;  1OFC X;  1R00 A;  1WJD A;  1OYI A;  2X1D A;  4AIJ A;  1Y39 A;  1H9T A;  4BE2 A;  2PI0 A;  2R5Z A;  1HC8 A;  1YG2 A;  2KMU A;  2DT6 A;  4DZP A;  4ZYG A;  3A0H C;  3ECH A;  2WAQ A;  3MVP A;  4MTE A;  2HGC A;  2NVU B;  3A01 A;  2PJR A;  1X2N A;  3TO6 A;  3OYI A;  1S9H A;  5IOY A;  1F5T A;  2FF4 A;  3K0L A;  3CQZ J;  1WGX A;  4I6Z A;  1R6R A;  5EZG A;  4UY8 I;  5CYV A;  2FJ1 A;  5JVT A;  3GFI A;  4QPQ A;  5LLQ A;  2HYG D;  2L9S A;  2EA2 A;  2AQF A;  2WY7 Q;  1QZZ A;  3BG5 A;  4ESB A;  2FNP A;  1CGP A;  4BXU A;  5GAD J;  3BPX A;  1OCT C;  2VXD A;  3CF5 F;  1N25 A;  1OR7 C;  4HEA 2;  3ZOB A;  2DBB A;  3QYF A;  3TP0 A;  1GV2 A;  4FQG A;  3LQQ A;  1BI2 A;  3FX3 A;  4BE1 A;  4L0Z B;  1UFM A;  5H20 A;  2K4B A;  2A61 A;  4IQJ A;  1HKT A;  1E3P A;  2BGC A;  3ABK H;  5J6X A;  1JKP C;  4M73 A;  3BZK A;  3MZH A;  3JRC A;  3CLO A;  2XRL A;  2Z5U A;  1I3Q J;  1X58 A;  2GA1 A;  2VN2 A;  1TC3 C;  3B02 A;  1ZKG A;  2GIV A;  2L9R A;  2MAB A;  3K1M A;  3WTS C;  5HLG A;  3RCO A;  4OIP F;  1XPX A;  1FOW A;  2Z1D A;  1JJ8 C;  2EV0 A;  3M9A A;  2NS8 A;  4S0H B;  4ZC3 A;  4JP0 A;  1QVU A;  3F8B A;  3HGG A;  4IL6 C;  3F8M A;  3HRU A;  2EWN A;  4M72 A;  1IDZ A;  3AL0 B;  4IF4 A;  2JRM A;  4AVZ A;  1DPU A;  3K4J A;  3IRQ A;  3R4K A;  2COB A;  5LHG A;  2ZB9 A;  3S32 A;  3DV8 A;  2LYC A;  3OSF A;  2BBY A;  4IX7 A;  1O3T A;  5FKO A;  2AHQ A;  2QF7 A;  2NAZ A;  1REP C;  3BTC A;  2R7D A;  2WTE A;  2R4G A;  4DIQ A;  2WY8 Q;  1O3S A;  1I6H J;  3V4G A;  2Y48 A;  4LLN A;  1KQ8 A;  1FBQ A;  5HLH A;  3CC4 I;  3E5Q A;  3C2H A;  1ZAO A;  1P7J A;  1S7A A;  1IGN A;  1DGW Y;  2HU9 A;  3SEQ A;  1VQL I;  4RA2 A;  2IP2 A;  1A31 A;  2LH9 A;  5F0H A;  3RZO J;  4BY1 J;  3DBR B;  4CDG A;  4M3D A;  1JKR C;  1WZ2 A;  2R3S A;  1A36 A;  1P9Q C;  1OKR A;  3EUK L;  1BA5 A;  3LSI A;  2A05 A;  1HA8 A;  2LFB A;  1KQ0 A;  2XAG A;  2BYV E;  4XN3 A;  1NG7 A;  4UUS B;  1I6X A;  3KEO A;  3VEP A;  2COM A;  3F72 A;  3RPU D;  5CKT A;  2DLL A;  1R1V A;  2GXG A;  1MH4 A;  5GTH C;  2OTJ I;  3GZ6 A;  4KIC A;  4CZC A;  2KRH A;  1V5F A;  2O03 A;  1RUO A;  2GWR A;  1SMY F;  2EPF A;  2FA5 A;  1T38 A;  4RB1 A;  4G12 A;  2MYS A;  2LTP A;  3GFM A;  4RDU A;  3LSK A;  1VND A;  3WE3 A;  4I0A A;  3I9V 2;  5HS8 A;  3MQ0 A;  4EJU A;  1B1B A;  5LBQ A;  5M5W J;  2BE5 F;  1ETQ A;  2MA3 A;  3WG9 A;  1JKQ C;  4E70 A;  2VOP A;  3PO2 J;  1JGG A;  1WHU A;  3P5J A;  4RMN A;  3OV8 A;  4NC6 A;  3VPR A;  1SMT A;  5DCM B;  1ON2 A;  2JRT A;  2H8W A;  1TQP A;  4V2F A;  1RC9 A;  4A3C J;  2Y30 A;  3K4L A;  4BAC A;  4GXO A;  3S3O A;  2XHK A;  2ADU A;  2W84 A;  5C4J J;  3KP5 A;  3I5U A;  1YYV A;  2K40 A;  1D1B A;  2QQA A;  3QYB A;  5E3L A;  3D0S A;  1FZP B;  3PFI A;  3CJQ B;  5J47 A;  1BOA A;  1HQC A;  1NK3 P;  1GHC A;  1I27 A;  1FYM A;  3KET A;  4RGR A;  3PL8 A;  4I98 B;  2RNJ A;  3S2D J;  1UG0 A;  3BQY A;  1UB9 A;  1D3Y A;  4D5F A;  2Z2S B;  4M9Z A;  4EEF G;  3JRB A;  4U88 A;  4AC0 A;  5L3G A;  3K7A J;  3ZPL A;  1QNT A;  5J40 A;  3QPT A;  3H1C A;  5E1W A;  2XIG A;  1T6S A;  5ICC A;  1YW9 A;  1PYV A;  2K3F A;  1OCC H;  4G8X A;  4YFK F;  5C3E J;  3WGH A;  2YUS A;  3KLO A;  1UST A;  2NXN B;  4BHC A;  2CFO A;  1OQY A;  3T5X A;  3S8P A;  5E1Z B;  2R93 J;  4OU0 A;  3S2W A;  2HQR A;  5D8K B;  4XR6 A;  3MN2 A;  3RYP A;  4B3A A;  3VYS B;  1IN8 A;  4U7B A;  3I56 I;  4ENK A;  2HDD A;  1HSJ A;  2Y9Y A;  1OJL A;  2V6E A;  3FXJ A;  2G0E A;  2Q1Z B;  3DPL C;  4A69 C;  2M5W A;  1X1C A;  2EH3 A;  4C3I J;  3RSN A;  2QLZ A;  1A35 A;  1WRJ A;  3ABM H;  3LSM A;  4WXH A;  1J0R A;  3UNG C;  3PUF A;  4XL9 A;  3ZN1 A;  4JQF A;  4CHU A;  4CUG A;  1N78 A;  4P1W A;  5LGN A;  4LB5 A;  3Q0U A;  2NNN A;  5FD5 A;  3E7L A;  4AYB N;  3L2R A;  4EAT A;  1UHW A;  2RDP A;  3GME A;  2X1E A;  3TBI A;  4A3M J;  1Z1D A;  2KIM A;  2EV6 A;  2Y0S A;  2BHY A;  1W0U A;  4GDF A;  2F4O B;  3ZQI A;  2O0Y A;  2H6B A;  4UV8 A;  2PG4 A;  4ZYH A;  1ZGA A;  2KJC A;  2W24 A;  2E5Z A;  3H5N A;  2E2H J;  3QP6 A;  2RQQ A;  3VSK A;  2P5V A;  1ONV A;  2DN0 A;  2DA6 A;  3MKW B;  3MCZ A;  3D5L A;  4DGW B;  2XUB A;  4CYC B;  3GTL J;  1VQ4 I;  2JZY A;  3J80 Z;  4DYQ A;  1U5T B;  1MBH A;  4BEH B;  1R5I D;  4H0E A;  2AS5 F;  3L2C A;  4KT6 A;  3DFG A;  2HZD A;  3ABL H;  1SVM A;  3OYH A;  2KDO A;  4BBS J;  3GTQ J;  2R7R A;  3G3Z A;  4HSR A;  1DUX C;  4FE4 A;  4LG0 A;  3TP3 A;  3LA7 A;  1AOY A;  1BI3 A;  5E20 A;  4PJ0 C;  4XSX F;  2IA0 A;  2YPR A;  3HZJ A;  2IBD A;  3FKI J;  4LIT A;  1O7L A;  1SEU A;  1WJ5 A;  4NDL A;  4NQW A;  2K85 A;  2M7B A;  5BOX A;  4KIG A;  5M5X J;  1VQ9 I;  3U21 A;  3NWS A;  4DW6 A;  4UHT A;  4ZDL A;  1XB4 A;  1XGN A;  1ZG3 A;  1S5L C;  4C9Y A;  3CUQ B;  2BXY A;  3QU3 A;  2X48 A;  1BW6 A;  2Z99 A;  4ON0 A;  2DMN A;  2R7Q A;  2XF6 A;  3HHH A;  2DA1 A;  3IAM 2;  4PCQ A;  5CLS A;  1V3F A;  2PLY A;  1ETO A;  2ELH A;  4JX6 A;  2OD5 A;  2H1L A;  3W6J B;  4ZTJ A;  3M1E A;  2QEX I;  2WC2 A;  1KU9 A;  3S1Q J;  1ZK8 A;  4CCO A;  5HS7 A;  2W85 A;  4C30 A;  1Z6R A;  2ZSI B;  1XTA A;  3CZ6 A;  1SD6 A;  2LG4 A;  1IJW C;  3BG6 A;  2V1X A;  4B44 A;  2I10 A;  1YIJ I;  1IC8 A;  1LDJ A;  1F4K A;  3ML6 A;  1KON A;  4M71 A;  1TQM A;  3DEE A;  1XG1 A;  3ZMS A;  1W7P B;  2ZJ2 A;  2VON A;  2V9V A;  1LB2 A;  2DW4 A;  2WB1 A;  4A3B J;  2DK8 A;  3BOQ A;  3ZQF A;  3JW4 A;  4O3M A;  4F7Z A;  4G6Q A;  4AIK A;  3LA2 A;  4G6D A;  4O5V A;  5IP6 A;  1KA8 A;  3HYI A;  3HM5 A;  4MFD A;  3KPH A;  4HA8 A;  2OF7 A;  2M1B A;  4HX4 A;  3CP8 A;  5F27 A;  4AVP A;  1S72 I;  3K9T A;  5B1B H;  3FXR A;  3L2W A;  3BWG A;  2E71 A;  2A3S A;  1B72 B;  3QQA A;  2RAE A;  3K4K A;  1P2F A;  2RQP A;  2A6H F;  4Y7N J;  2H94 A;  4EV0 A;  5HOD A;  4MTD A;  1FMW A;  4KDP A;  5GTI C;  1OMI A;  3TOB A;  4ZH4 F;  1WI3 A;  4ENN A;  4LIV A;  5BQT A;  4BS9 A;  3CF2 A;  4A3F J;  5CQG A;  2IA2 A;  5F1J A;  2K86 A;  1WQ2 A;  3MMY B;  1TNT A;  1AU7 A;  1B9M A;  1I3A A;  2W57 A;  2XPU A;  2MSY A;  3KP4 A;  1FP1 D;  3O3K A;  5LFA A;  5D5V B;  5HDK A;  4L18 B;  2ECB A;  3C2G A;  4PSW A;  1Z9C A;  2VIX A;  1O3Q A;  3GTK J;  4XLH A;  3P9C A;  4PUS A;  2CGP A;  4Y13 A;  4QSH A;  4JOM A;  3WTW C;  3KZI C;  4Y17 A;  1U0J A;  4Q4Z F;  1LQ1 A;  2KT0 A;  5EJC A;  4FX4 A;  4L0Y B;  2VKH A;  4RAY A;  4LFU A;  2LDU A;  3QRF F;  3GTO J;  1SD5 A;  3G1M A;  3AAF A;  4B09 A;  2ZJP F;  3M7G A;  1HKQ A;  4L9T A;  2ETH A;  1U78 A;  2NOJ B;  3SFI A;  3ZQ7 A;  1T39 A;  1EF4 A;  3LFK A;  2XSJ C;  4O6J A;  3HOY J;  4J00 A;  2BY2 A;  2FRH A;  5J8C A;  2JA5 J;  3CCS I;  4GO1 A;  1X3U A;  4XLN F;  1BC8 C;  2A6T A;  4YEJ A;  4Y4R A;  4IPA A;  3L1P A;  1CF7 B;  4A3G J;  1LNW A;  2P5K A;  4RAG A;  3J81 Z;  2BY1 A;  3MKZ A;  5DD8 A;  1TLH B;  4RAZ A;  4BXF A;  2QA4 I;  4XRM A;  4XK4 A;  3OS1 A;  1VQP I;  3HRT A;  1MMS A;  5B1A H;  1GXQ A;  2L7F P;  2R7Z J;  1ODD A;  4L9N A;  3S2H J;  2MW8 A;  4Q48 A;  4DBQ A;  1RRJ A;  2P7C B;  2E1M B;  3VFZ A;  4G7O F;  3C1D A;  2ZXW H;  3BR6 A;  1HKS A;  3GFL A;  2IS6 A;  3DTK A;  2Q2E A;  3E6D A;  1KYZ A;  2R7O A;  3HC7 A;  1X2M A;  2OUM A;  1ZYR F;  4MIM A;  2VBZ A;  3IRR A;  4OMY A;  3A2K A;  1U8B A;  1R71 A;  2DA7 A;  2L02 A;  3MZ8 A;  3LMM A;  3F9K A;  4PGG A;  3L2V A;  2CUJ A;  2HXO A;  1FSH A;  2F5E A;  3FIW A;  3ZXS A;  1HCR A;  4QIW N;  1X4O A;  3OYM A;  1U5T C;  4L5I A;  3H5R A;  2A5W A;  2E1C A;  1EKE A;  3GZN B;  1P4X A;  3H92 A;  2HVR A;  2Y75 A;  3U1D A;  2GZW A;  4HBL A;  5D5U B;  3CCE I;  3COA C;  1IW7 F;  4WCG A;  2LY9 A;  1FPQ A;  2KKO A;  4I0B A;  1NHA A;  2VQL A;  3KEQ A;  1XC5 A;  2KHM A;  3K4N A;  4GYG A;  4PJL A;  2NRA C;  3RKX A;  1A5J A;  4BL0 B;  1OCR H;  5EEG A;  1YW7 A;  1KZH A;  4FAS D;  5K5Q A;  2J5P A;  2K9M A;  3BT9 A;  3ECO A;  4ZZD A;  2M3A A;  5E1X A;  3PM1 A;  2Q0O A;  3S1M J;  1H89 C;  4IO9 F;  1P6R A;  1EJ9 A;  5F6F A;  2EFW A;  3EYI A;  1JTY A;  2VLA A;  1JUP A;  2M0M A;  3M1C A;  3GVA A;  2K9Q A;  5F08 A;  3ZP5 A;  5CVU A;  2M4G A;  1J2X A;  3CUQ C;  1YX5 A;  2L7K A;  2HKO A;  2VT3 A;  1LE8 A;  1IAW A;  2I8D A;  1OCO H;  2P81 A;  2A6E F;  1GUU A;  3VDX A;  3DCF A;  1BJA A;  1MSF C;  3OOP A;  1P4W A;  4PFP A;  1K78 B;  2CFX A;  2K4J A;  4KN4 X;  2CQK A;  4UUV A;  2K27 A;  1XDU A;  3I59 B;  3WOD F;  3MEX A;  2R92 J;  2F5V A;  2LK2 A;  2X4H A;  4R1H A;  4DQ2 A;  1I1S A;  5K1Y A;  1IF1 A;  2X6X A;  2O6G E;  3C18 A;  1G3Y A;  4EJT A;  1R49 A;  4OIQ F;  3UKG A;  3ELK A;  1B8I A;  1K6O A;  3CJT B;  2HQN A;  4XNF A;  4H4K C;  5LRS A;  1EV7 A;  2IGM A;  2HQ5 A;  2VQC A;  2V7F A;  1AA7 A;  1W36 C;  5EYR A;  4ZDO A;  1W7P D;  4NC8 A;  1I1G A;  3FWE A;  3HGY A;  5F04 A;  4KIS A;  4XLF A;  3A0B C;  1LKX A;  4KJZ A;  3N4M A;  1RR7 A;  2M45 A;  2Y2Z A;  1MMD A;  4E7Z A;  5ICE A;  1W36 D;  3JSO A;  1T2K A;  4IRI A;  3PFY A;  4CYC A;  3EYY A;  5HDN A;  5HOO A;  1E2X A;  3ZR8 X;  3OYB A;  3ZGK A;  3FK6 A;  4BEH A;  1ETV A;  2HI3 A;  3U2R A;  2ZKZ A;  3BR0 A;  1YHQ I;  4PK4 A;  3M8E A;  1LEA A;  1IRG A;  4XRS A;  9ANT A;  2R7F A;  1GVJ A;  2W82 A;  5CVI A;  1BR1 A;  3ZMT A;  1LEB A;  2CW7 A;  2DYR H;  2OC6 A;  3C2B A;  1LJ9 A;  1R4N B;  1ACI A;  2H8R A;  1FYK A;  4PJN A;  5ICG A;  2GLO A;  1A04 A;  2LY2 A;  1Z77 A;  2QM3 A;  2A69 F;  1N77 A;  1YIO A;  3HDD A;  1WJE A;  1ZG5 A;  2FX0 A;  4CO8 A;  2QKM B;  5IOZ A;  1DU0 A;  2RNG A;  2XAF A; 
#chains in the Genus database with same CATH homology
 2RRE A;  1G59 A;  4XKC A;  3S3M A;  1PJR A;  2IXS A;  2LRD A;  3K4L A;  4BAC A;  4F3Q A;  3S3O A;  2IS4 A;  4MLO A;  1D0Y A;  2DXI A;  3QYB A;  1D1B A;  2JVH A;  2VL8 A;  3CJQ B;  3W2V A;  1E0E A;  3KYL A;  2IS1 A;  3PL8 A;  3MD2 A;  3ZRG A;  3OYC A;  2JSP A;  1UG0 A;  3ZQQ A;  2Z2S B;  3DTI A;  3HKZ A;  4ZYA A;  4R79 A;  4OWR B;  4HNU A;  1ERD A;  4OAZ A;  2JUG A;  2X51 A;  1QU3 A;  2HPI A;  3LL7 A;  1PYV A;  2XAU A;  3OS2 A;  1LFP A;  1V5E A;  1QHH D;  2XF7 A;  3TMO A;  3FBI B;  1MMA A;  4CCK A;  1ZEL A;  2VJI A;  2CFO A;  3HOS A;  3S8P A;  4XM3 A;  3OWT A;  2KL4 A;  3K10 A;  4NC7 A;  3BLY A;  4BDY A;  3OL3 A;  3OY9 A;  4XR6 A;  2KZV A;  3OYG A;  3MKY B;  3VYS B;  3FBN B;  4ZDP A;  4U7B A;  4ANJ A;  1FMV A;  2LBF B;  4IQ4 A;  4E7I A;  2LBF A;  2E1M C;  4DOZ A;  3OYE A;  1TZL A;  3BCB A;  4XLC A;  3HOT A;  2WAF A;  2V6E A;  3SZG A;  3I3L A;  2Q1Z B;  2X85 A;  3DPL C;  2VAS A;  3EUH C;  1X1C A;  4HST A;  3AKZ A;  3BG7 A;  3RSN A;  1MMN A;  3DU5 A;  3RQ4 A;  1LVK A;  4DJA A;  3LSM A;  3UNG C;  3OR1 C;  3OYL A;  4XL9 A;  2VPL A;  5HNH A;  1N75 A;  4JQF A;  2JA2 A;  4XLA A;  4CUG A;  1N78 A;  4P1W A;  4N4O B;  2VJ4 A;  4E4H A;  3SYT A;  2LOO A;  1K6Y A;  3L2R A;  4EAT A;  2X1E A;  4QPO A;  3TBI A;  3SEZ A;  3OYK A;  1SAU A;  2AQE A;  4F55 A;  2Y0S A;  4CCL A;  2HDW A;  2VKD A;  5TGT A;  2DCE A;  1WJA A;  4LG3 A;  3VWB A;  1MND A;  4AU7 A;  1V5G A;  4RLQ A;  1Z21 A;  2E5Z A;  3D5S C;  3H5N A;  1WJB A;  2RQQ A;  4PSX A;  3VSK A;  1YE9 A;  2WAE A;  5HNF A;  3PNY A;  3MKW B;  3D5L A;  5KCM A;  4DGW B;  2XF5 A;  3GBG A;  4IKF A;  4BJT A;  1WFX A;  4BJ5 C;  4XOR A;  2GOX B;  1MMG A;  3PNV A;  3QOE A;  4BEH B;  3L2Q A;  2HVQ A;  3DWL E;  3W3C A;  2UV1 A;  1JI8 A;  2V9K A;  4KT6 A;  3TL4 X;  2HZD A;  3PSI A;  3OYH A;  2BVM A;  2KDO A;  2PMZ A;  2R7R A;  1D1A A;  4HSR A;  3K6G A;  3EPZ A;  2HPM A;  2ZXI A;  2X1C A;  3K4M A;  2R7X A;  3S93 A;  2BOL A;  2CH0 A;  2IGN A;  4NQW B;  4LIT A;  3K4B A;  1WJ5 A;  2LRE A;  2M7B A;  2UWM A;  2LC2 A;  4D9J A;  3U21 A;  3NWS A;  4ITV A;  4ZJZ A;  4HRI A;  5JHF A;  4C2U A;  2ZFU A;  3IUO A;  2Z16 A;  4ZDL A;  4CA0 A;  4IZZ A;  4Y3O A;  3E1S A;  4C9Y A;  4RM3 A;  1TT0 A;  4E7J A;  2KRC A;  4LIU A;  4II2 A;  2R7Q A;  2XF6 A;  3IAM 2;  4II3 A;  2FUG 2;  1D0X A;  2CV2 A;  3M8J A;  2CV0 A;  3OYN A;  2K9L A;  1IRX A;  1BR2 A;  4ZTJ A;  2KP6 A;  4CCO A;  3KX2 A;  1WJF A;  4C30 A;  4BDZ A;  2ZSI B;  1NG6 A;  2VXZ A;  3CZ6 A;  2LG4 A;  3BG6 A;  3K70 C;  4B44 A;  2V1N A;  3CP2 A;  3IAS 2;  4F93 B;  1GLN A;  1KON A;  3D5R C;  3FDY A;  4B3X A;  4U87 A;  3DEE A;  4E6K G;  3LSH A;  4E7S A;  3K70 D;  2W7N A;  1J09 A;  2WB1 A;  3VSL A;  4B43 A;  2MC4 A;  2W1O A;  3FKJ A;  4DBR A;  4FET A;  2KPM A;  1X1A A;  3DQV C;  3OS0 A;  3OIP A;  4E7H A;  4HPQ A;  3CP8 A;  4C2T A;  3G2B A;  1D0Z A;  2HQA A;  3L2W A;  2IGK A;  3H5A A;  3CMM A;  2KQR A;  3K4K A;  1Y6I A;  2GOM A;  5FRM A;  2OV7 A;  3H9J A;  4RM2 A;  3OYJ A;  3HPG A;  4RLF A;  4NUB A;  2R7S A;  3OMY A;  3V42 A;  1FMW A;  4HG2 A;  3N05 A;  4BUP A;  4LIV A;  3HUG B;  4BS9 A;  3CF2 A;  2X6W A;  5CQG A;  3MMY B;  1Z3X A;  3HL2 A;  5LFA A;  1DGR M;  2R7U A;  3C2G A;  4PSW A;  4BJ6 C;  3QOD A;  2VIX A;  2DT7 B;  1BOB A;  2MD0 A;  4XLH A;  4PUS A;  3DKY A;  3BC8 A;  4CCN A;  3S3N A;  4JOM A;  1MW7 A;  2L5Q A;  5HLT A;  1U0J A;  2ELJ A;  3DLA A;  5FRN A;  2BW3 B;  1X1B A;  2VKH A;  3OYF A;  4BGD A;  2BW3 A;  3H0D A;  4XLE A;  3OIQ A;  4N4N B;  3AFH A;  3FHN A;  4KIT B;  2E60 A;  4B47 A;  2JVG A;  4BE0 A;  3DTE A;  5LD2 C;  3E0J B;  1Z7L A;  1D1C A;  2NOJ B;  4X0G A;  2L9N A;  2XSJ C;  2HNH A;  3PNT A;  3BCA A;  4J00 A;  2CUZ A;  4BQQ A;  3AL0 C;  1SFK A;  3H9G A;  2A6T A;  3RTR A;  1X4P A;  2DOA A;  4YEJ A;  1OLT A;  3HG9 A;  4XKB A;  4Y4R A;  4CH7 A;  1BR4 A;  4HNT A;  3MKZ A;  2ZSH B;  2F4I A;  3SDB A;  4BXF A;  1X1D A;  2R7W A;  3OS1 A;  1WJD A;  2X1D A;  3ZCO A;  2UUZ A;  3DPT A;  4NNJ A;  1UAA A;  4DBQ A;  4BE2 A;  2W4S A;  4G6T B;  2E1M B;  3HXL A;  5HVQ C;  4PJM A;  2LY1 A;  2KMU A;  2DT6 A;  2Q2E B;  2X6Y A;  1QHG A;  2IS2 A;  2WAQ A;  2R7V A;  2IS6 A;  3DTK A;  2CV1 A;  2PJR B;  2XDV A;  4PFO A;  2R7O A;  3HC7 A;  4XOT A;  5CQE A;  5KNL A;  2PJR A;  2OUM A;  4OAY A;  4BU2 A;  3OYI A;  1S9H A;  1VZ0 A;  2E5N A;  3A2K A;  4CSW A;  1R6R A;  2VQH A;  2L2O A;  4E7L A;  2M7A A;  2HVS A;  3H35 A;  3F9K A;  3LMM A;  3L2V A;  2CUJ A;  4QPQ A;  2L9S A;  3VYT B;  3ZXS A;  4D1Q A;  2AQF A;  2WY7 Q;  4ZTF A;  1T95 A;  1X4O A;  4YEL A;  2VXD A;  3OYM A;  5KHD A;  1OR7 C;  4HEA 2;  3QYF A;  3H5R A;  2A5W A;  2ZXH A;  3EUA A;  2K5C A;  3K4C A;  2M4K A;  2XC7 A;  4BE1 A;  2HVR A;  4CCJ A;  2V26 A;  2F6C A;  4IQJ A;  2DJI A;  3VYU B;  2VQL A;  4XKV A;  3K4N A;  2KHM A;  3NWT A;  4PJL A;  4BL0 B;  4Y33 A;  3PJR A;  2KLO A;  4CCM A;  4F91 B;  4FAS D;  2MAB A;  1LDK B;  3ONQ A;  2K9M A;  3RCO A;  2M3A A;  4XOP A;  3J7A Y;  2Z1D A;  3CES A;  4F52 A;  3QYE A;  4ZC3 A;  2VLA A;  3DU6 A;  2M0M A;  3M1C A;  3OYA A;  4BQO A;  4AYB A;  3UR3 C;  2M4G A;  1YX5 A;  4B48 A;  3AL0 B;  2L7K A;  2VJ5 A;  4AVZ A;  3K4J A;  1DQU A;  2I8D A;  2IGO A;  3IP4 B;  4F92 B;  4XON A;  3VDX A;  3S32 A;  1UEL B;  2LYC A;  2CMP A;  4IX7 A;  4PFP A;  5FRO A;  3HPH A;  4XQF A;  2R4G A;  4DIQ A;  2WY8 Q;  3KEY A;  2F5V A;  1G8X A;  4PJJ A;  3A1Y A;  1X19 A;  2MFZ A;  4BQN A;  3DKX A;  3L2U A;  3C2H A;  3VYR B;  4YRV A;  1DGW Y;  2HU9 A;  3SEQ A;  2X6X A;  1Z3Y A;  4E7K A;  2K3P A;  1MNE A;  2LH9 A;  2VJJ A;  3W2A A;  3DPU A;  4XKW A;  2V4J C;  2WAD A;  2CS3 A;  1T0F C;  4XNF A;  1P9Q C;  3W2W A;  4H4K C;  3PSF A;  1EA3 A;  2IGM A;  2V7F A;  3EUK L;  2VQC A;  1AA7 A;  3CJR B;  1W36 C;  4ZDO A;  3LSI A;  1DP3 A;  4NC8 A;  2VQG A;  3OYD A;  4J01 A;  1HA8 A;  4KIS A;  4XLF A;  4XN3 A;  2BVL A;  1NG7 A;  2VB6 A;  1LKX A;  4KJZ A;  2WBM A;  4E7Z A;  1MMD A;  1W36 D;  3RPU D;  3OL4 A;  4GRI A;  5CKT A;  3OR2 C;  3PFY A;  5HOO A;  3LSG A;  3PUB A;  3ZGK A;  1WJC A;  3ZR8 X;  4P5O A;  3OYB A;  4CZC A;  4BEH A;  2KRH A;  1V5F A;  3H9Q A;  2R7T A;  2QKL B;  4PK4 A;  2W00 A;  2MYS A;  1Y56 A;  3LSK A;  3OOU A;  2CW8 A;  3I9V 2;  2WA0 A;  3A4C A;  2P0W A;  2W82 A;  1BR1 A;  1YX3 A;  2CW7 A;  2O5R A;  2OC6 A;  4XMY A;  4XN0 A;  3LFU A;  4PJN A;  2LY2 A;  4RMN A;  1N77 A;  1WJE A;  2QKM B;  2RNG A;  5CPR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...