1R6RA

Solution structure of dengue virus capsid protein reveals a new fold
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
NRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Genome polyprotein
publication title Solution structure of dengue virus capsid protein reveals another fold
pubmed doi rcsb
source organism Dengue virus 2 puerto rico/pr159-s1/1969
total genus 20
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1r6rA00
1SFKA 1R6RA
chains in the Genus database with same CATH superfamily
2A05A 3DCFA 3UR3C 2K9QA 3Q3SA 1A6IA 3S3MA 1IG7A 3CMEI 1DDNA 2R7QA 2KZGA 5IT3A 4FHTA 1ON2A 3R0AA 4PFPA 2QCOA 3CLQA 3VOEA 3WHCA 4BUPA 4L9JA 3A2KA 2B9SA 3H5NA 1OYYA 3EUKL 5J8FA 1YJNI 2IS1A 1LNWA 1LFBA 1S7AA 2PMZA 3T8RA 1IJWC 5FRNA 3ZRGA 4MEXF 4PDKA 1PVEA 2KQRA 1ENHA 4CYCB 4JOMA 4LD5A 3I0TA 4CCJA 5CVUA 3HIFA 4IQ4A 5IP7J 1P4WA 3FIWA 1D8JA 4HOBA 2O3FA 2CQKA 3FKJA 3DF8A 2XF7A 2JWTA 2VKEA 3H35A 3FX3A 3RIRA 3CO7C 4HEA2 2LMDA 1RUOA 3HGGA 3LOCA 3BR0A 2KIQA 3K2AA 1BOAA 1QHGA 5DM7F 2X6OA 3J81Z 2DODA 5F27A 1O3QA 2Y9YA 5A2QK 3PNVA 2K4JA 2NRAC 4EGYA 5EYRA 2E2HJ 2ME6A 1TQIA 3E6CC 1ONVA 2HOTA 4BQOA 1U2WA 1BIBA 3FM5A 4PUSA 4RS8A 2R5ZA 4N9HA 4XNFA 1LVAA 5JHFA 2QA4I 1D5YA 2GBYA 4P55A 1UFMA 5HS8A 1NK3P 1R1VA 3HOXJ 2Q2EA 4FX0A 4DZPA 4KIFA 4HLYA 4QPQA 5L3FA 3GTJJ 1J09A 3OL4A 4ZZLA 3RPUA 3TO6A 4GDFA 1J2XA 3VEPA 2R3SA 2OV7A 2XVCA 1P6RA 1WQ2A 3IHUA 2AXLA 4G12A 1MMNA 3I58A 3FM3A 2XAGA 4LITA 4F3QA 1T38A 2V1DA 3MKWB 3BC8A 2IA0A 2BY0A 4M9SA 5HDGA 1WPKA 4G9YA 3HBLA 3ZQFA 4XIDA 3IL2A 1GXPA 2LKSA 3Q0VA 2DO7A 2VBZA 4YEJA 5DUIA 4B09A 4X0GA 1T98A 2JRMA 3G3ZA 1OISA 1S8NA 1VQ7I 1LKXA 4BJTA 1G6NA 3BLYA 4U87A 4IXAA 4LG3A 2M4GA 1YFHA 3JRAA 1P92A 4U88A 2EFQA 4RB1A 4RB3C 3P5JA 1IC8A 1SMYF 3E7LA 3FXRA 2IS6A 2H6BA 2HOEA 3HUGB 1Y6IA 4LK0F 1U78A 3LFUA 1LPQA 4E7KA 2DA2A 1BN5A 3P9IA 4CO8A 5L3EA 3LNQA 4FISA 2WADA 1QPMA 4PJNA 2Z3YA 2IA1A 1CF7A 2QM3A 4IQJA 2KHMA 4LOCA 4N9IA 1MSFC 2MABA 4I76A 1X19A 2DT5A 2R7DA 1Q1VA 3E6DA 2HZDA 4B1RA 2ZBKA 3KZYA 2M45A 4WX9A 2DPUA 3T8TA 1U9NA 2KRHA 3IWFA 1LE8A 2VOOA 1X1BA 1GUUA 4HX8A 1RUNA 5KVRA 4IHWA 1ZR4A 4M6VA 3BG7A 4KICA 5ICGA 2UZKA 5M5XJ 3U2RA 2K4BA 3G1MA 4E4HA 3Q9VA 3EUHC 1TWAJ 1FMWA 1OLTA 1W5CC 4XRFA 1MNMC 1IUFA 4HPQA 3VB2A 1QVUA 2QBYA 3QPSA 4KJZA 1ZH5A 2XAQA 1K4TA 1IAWA 5HNFA 3RPQA 3SFIA 2VBYA 1XCVA 3TDZC 1H9GA 5C3EJ 2DQRA 2IGNA 1P7JA 1W0TA 1T39A 1E17A 4XSXF 2JA8J 2RN7A 2QLZA 1ZGJA 5M5WJ 4AD9A 2VQLA 2Z2SB 4M6YA 4MLOA 4P1WA 1A31A 2IGMA 4A3CJ 2IT0A 2M7BA 3RCOA 1S7OA 2BY2A 3D1NI 3LSKA 2XRLA 2L54A 1T95A 2EFNA 2A07F 2L9NA 5F0FA 4D9JA 1V5GA 2H09A 4NC8A 3ISPA 1IXSB 1LFUP 4IHVA 2ZKZA 1Z7LA 5FO5A 5CKTA 1T08B 2BVMA 3DTIA 2K27A 3QOEA 5DCMA 2VJ5A 5JVGF 3GCMA 2BEOA 5J1RA 3HZJA 1H88C 2V1UA 3K70C 1KA8A 2OC6A 3JSOA 3KP3A 1HQCA 3I59B 3GTOJ 5B5EC 4LFUA 1FY7A 1HLVA 3H9QA 1UG0A 1ETXA 1F5TA 1I1SA 4A0YA 1QPIA 3TO7A 2R7UA 4ASNA 3S1MJ 5CVVA 2R7XA 1VQ6I 4DW6A 5DD8A 1MH4A 2DA5A 4D0PA 1O4XA 5F6FA 3VDXA 4A69C 1J7KA 5CVRA 2MLKA 3ZQCA 1MZBA 2QENA 5KHDA 4C9YA 3QODA 3GTKJ 2M7AA 2UUZA 2HKXA 4YFKF 4HDVA 2CWEA 3DKXA 3TP3A 2HWVA 2HDWA 1BI0A 1IV6A 2VXZA 2YUSA 5F64A 4DNCA 2LF8A 3TO9A 2BOLA 2NYXA 5CVJA 3OYBA 2HR3A 3RSNA 1U6GA 1D0ZA 1I6XA 3I4MJ 3KETA 4UNOA 1HSTA 1OCPA 2UXNA 1JTXA 2L3DA 4HX7A 1K78B 4LG0A 3DP7A 3OS2A 2Y2ZA 1RR7A 2FBIA 3BTLA 3TDUC 1U8RA 3T1BA 1WRJA 4WXHA 3CJRB 1EJ9A 5E3OA 3MZYA 4CHUA 3ZMDA 5ERIA 3I54A 4F7ZA 1VFCA 2XROA 5IP6A 2IRFG 4S05A 2KRCA 4HSTA 1QVTA 2DLLA 3CJQB 4Q48A 1F36A 5HS9A 3SZGA 4JX4A 1WJ5A 3WE2A 3GYHX 1B8IA 2FF4A 2OD5A 1B9NA 4UXNA 4B3XA 4BEHA 1G4DA 1N78A 1SD6A 1BR1A 3FHZA 3ELKA 4D7NA 2QSFX 1Y39A 3W2AA 3IP4B 4M72A 1HW2A 4NB5A 2ME0A 5EGOB 2G9WA 4E6KG 2BVLA 1E0EA 3OIPA 1QRYA 1TT5B 4OINF 1YIOA 2QQAA 5E1XA 2UV1A 4LLGF 2R7TA 2EB7A 4Z2YA 3AAFA 2NVUB 3CO6C 5GADJ 4I02A 4HNUA 3FXOA 1WFXA 5E1WA 4E7HA 5E8GA 3GBGA 4QTRA 2P7CB 4UY8I 4ZDOA 1TT0A 4A0ZA 4OMZA 3A01B 4N4OB 4NQWB 2E2JJ 2VKHA 2EZLA 2EIKH 1W36D 2KL4A 4NNJA 2EZIA 1FNNA 2PN6A 2HOAA 4KIGA 3RPUD 5FLVA 2L7KA 2YX4A 2O8KA 3M1CA 3AG2H 5LFAA 2R0QC 2Y0SA 1Q1HA 2EBIA 3L7WA 1NG6A 1D1CA 5IPAA 1R9TJ 3DXJF 4ZTJA 1FOKA 3HRUA 2JSPA 1XB4A 4RLQA 3CJNA 4RB2C 2CMPA 1UG2A 3OOPA 4B3AA 1R23A 1X1DA 3LA2A 2XPUA 1KZHA 3P7NA 4M3GA 3H3UA 1KGSA 3IWZA 4II3A 5DYMA 2IA2A 3MZHA 3M3YJ 2VQCA 1YJ9I 1XGNA 2ESNA 4MNUA 3I9V2 5K7FA 3IV5A 3J80Z 3ZPLA 1Z77A 2JTVA 1Z0XA 4JP0A 2MC3A 2LG4A 4HDUA 3FF5A 2ZMEA 4MEYF 5B1BH 3TOAA 2GQQA 1ACIA 1YG2A 4A3JJ 5LRSA 5HODA 2VONA 2VASA 4WWCA 3R0JA 1JT6A 1XS9A 3E97A 1QBJA 3BPVA 5J4YA 3A4CA 2NVQJ 5BOXA 1HKTA 1A04A 3KCCA 2R5YB 1LB2A 2VI6A 2Q0OA 2LLKA 4AYBN 4IZZA 2GOMA 3R61A 4M9ZA 5H20A 3I5UA 3A0BC 3W2WA 3PUBA 4XICA 1YHQI 2M1BA 3KP5A 1P4AA 2ZSHB 3BR2A 3FMQA 3R6SA 3T5XA 4XK4A 1GXQA 1IN7A 2BY1A 4UVBA 5EG0A 2LR8A 4EJVA 4A3KJ 1AU7A 3DTKA 3M07A 3RQIA 3TQNA 2H1KA 2OZUA 4BBRJ 4H0EA 1Y0NA 2N8GA 3J7ZI 2XSJC 4BYYA 2R7RA 1EH7A 2LFBA 1U9OA 3KZIC 5HDKA 2FA5A 4MTEA 3VSKA 5JR3A 3OYGA 3CDIA 4XN0A 3C2HA 4ZDLA 2VBXA 3K4BA 3KPHA 2FOKA 1F1ZA 4JYKA 3KP2A 3OS0A 3TMOA 1R4NB 3GZ6A 2ZJ2A 3ZMZA 4F55A 2VB6A 2W85A 3QYEA 5K5OA 5FLMJ 2DW4A 5CQGA 1WCMJ 2G7UA 2BY3A 2HU9A 3PFIA 1MBJA 2J5OA 3E3VA 4A6DA 4A3EJ 2LC2A 1LVKA 1XD7A 3K0LA 3MEXA 4CYDA 3F9KA 3JRHA 2RNGA 1WJFA 2HPMA 3EYIA 1APLC 3ABLH 4FE7A 2W84A 3D0SA 4XONA 3HOZJ 2JPBA 3HYIA 3IH4A 1SC7A 5GAGJ 5J3LA 3KZZA 4Y13A 3JRCA 2P6TA 5DTDA 1KQ9A 1MMDA 5HLHA 1YS6A 4ABZA 1MDMA 3BQYA 4XOTA 4BNCA 2DTRA 3SJMA 3LSIA 5D6EA 4G6DA 1X3WB 3CUOA 2MSYA 3S15J 2ID3A 3F8NA 4CZCA 3OYAA 2ZB9A 1AHDP 1UHMA 3V8LA 3JRGA 1I5ZA 4HRIA 1VQ9I 1JKQC 3DLLF 3EQLF 3H9GA 3ZOBA 3J7AY 3K7AJ 4EM1A 2D5VA 4BY7J 2O7OA 1R71A 1XSXA 4JX6A 2ZO4A 3F3XA 3LSTA 3NARA 4U0YA 2DJNA 4RGXA 4F92B 5HNHA 2Z5UA 3G1OA 4G6QA 2PI0A 3VODA 3LWFA 3F21A 3L2UA 4FQGA 5CYVA 1B59A 2DXIA 1PUFB 1ZRDA 2HQ5A 2M87A 3BJOA 4EJUA 3PNTA 4PFOA 1YYVA 2E60A 2E1OA 2KKOA 3QP6A 5BS6A 4BE1A 1Y1WJ 3U1KA 5K1YA 4A3BJ 1FOYA 2DTZA 9ANTA 3UNGC 4BH9A 2EK5A 3L00A 2DU9A 1IRXA 1REPC 5IOYA 2F4OB 4XMYA 5JFRA 2VQHA 1ZTRA 4BQAA 5AONA 3ZCOA 3MKLA 4V2GA 2K86A 2LBFA 2LKXA 2F5EA 4PJJA 1B4AA 4OIQF 2FMYA 1B72A 1ZELA 3ZP5A 2VE9A 5LD2C 4LGWA 2VLAA 1KQ0A 5J40A 1I39A 2XRNA 2GIZA 5K5RA 2A5WA 3WTZA 1EA3A 1WI9A 4HYEA 3S14J 1OFCX 1YI2I 5BPIA 3WTXC 4DYCA 3OL3A 1XX5A 2V1XA 3FXUA 3B6AA 2R93J 5CLSA 1I6HJ 4I98B 2HQNA 4HG2A 4BQQA 4D7MA 4KITB 4GGGA 1YW7A 2HPIA 2K40A 1YE9A 2DDBA 4BHPA 4A3GJ 1U5TA 2XASA 2A3SA 2VL8A 3LAPA 4P96A 1R49A 3GVAA 1ZARA 3SZTA 3LMMA 3S3NA 1B1BA 4KT6A 5M3MJ 3N4MA 3AFHA 1RNLA 1TW2A 4CCNA 4YRVA 1SAXA 3CCUI 3E5UA 3BR3A 1T2KA 2MD0A 2K9MA 1JGSA 3DKWA 3F0CA 3RQ4A 3QWLA 2P0WA 1JI8A 3DEEA 4P5OA 4IHTA 4OAZA 4I6ZA 5EF6A 4QSHA 3DBHB 3JW4A 1YX3A 4XRSG 5JLXA 5ICCA 2XSDC 1MMAA 2NVTJ 3GTQJ 2TCTA 2WAQA 3Q0WA 2Y48A 2DOFA 1QGPA 5F04A 1FZPB 3TL4X 5JLWA 2RKHA 3IC7A 2OF7A 3KP6A 4DBRA 1D0XA 3QPHA 1VZ0A 1TP4A 1MBGA 2FXAA 3DTEA 1YO5C 4QPOA 4JBAA 1FC3A 1V4RA 3UKGA 3BCAA 3M8EA 4GO1A 4Y33A 4UHTA 4CUGA 2B63J 2VN2A 2J5PA 1P7IA 2ECBA 1FT9A 4HZFA 3WGGA 5FD6A 1SFUA 2EIJH 3HB9A 5JI6A 1FIAA 1RR8C 1DGRM 3OYHA 4A3FJ 3CD6I 2CO5A 5C4XJ 2E34A 3MAJA 5GP9A 2LNBA 5LGTA 5IT9K 3FMSA 3HJEA 3QQAA 1ZKGA 2ELKA 1W7PD 3D5SC 5E20A 2IS2A 1FBSA 4ZYAA 4DIQA 2L4MA 1D0YA 1Z05A 2CQXA 3FBNB 3C18A 4IL6C 3MFKA 4PCQA 5CJ9A 2DYRH 2COMA 2DOAA 2QYOA 3GF2A 2KJCA 3BROA 1RPWA 2AO9A 2L4AA 3J7AO 2OTJI 1XMKA 3BTCA 3BPXA 2M4KA 1YLFA 4A2UA 3QRFF 2CV2A 2Z1DA 1Z91A 2WV0A 3M7GA 5FB2A 5EEAA 4CCMA 2PJRA 2ECCA 2V79A 2H94A 3BR5A 1RESA 1H0MA 4BU2A 4MQVA 2HQAA 1VQLI 2A6TA 3MWMA 2O6GE 3C2GA 2W48A 5IY5H 1BM9A 4RMNA 1WH7A 3G1LA 4UV8A 4ON0A 3E6MA 3BJ6A 4DYQA 1EKEA 4U7BA 1X3ZB 4HSRA 3K4JA 4LIUA 3CC4I 4PZJA 2JK3A 4FT8A 3EETA 1JE8A 3DLAA 1RKWA 3WE3A 4CA0A 2PMZN 2L0KA 1JKPC 3G4SI 2O9LA 5ICFA 1EH8A 2AQEA 3SQNA 1FLIA 3JR9A 1QU3A 3GEZA 4JX5A 1Z6TA 5D5XB 1K7AA 3ABTA 4IRIA 1SFKA 2DA6A 1UCRA 2R5ZB 1J75A 3BTJA 1USSA 4KIBA 4AIJA 1AKHA 4ENJA 2GWRA 1YX5A 2NVXJ 1IDYA 4XM3A 3HG9A 1Z7UA 5LRRA 4LLLA 3C3WA 1Y0UA 3BG9A 3LSGA 2TRTA 1OQYA 1V55H 4FTHA 3E5XA 1D1AA 2FE3A 2OJED 3O6BB 1TQMA 3MVPA 3MKZA 2NS0A 3HSFA 2V1NA 4KNYA 3OWTA 3ZQ7A 4XRMA 2KPMA 2LD5A 4X6AJ 1WVRA 2L7ZA 3HKZA 4S04A 1WWXA 2ESHA 1ETWA 2K9NA 5D4RA 1VI0A 1FP1D 2DAOA 4XKVA 4UVCA 3FK6A 4UVAA 3ZN0A 1IF1A 2MBFA 4WCGA 1VQ8I 1ZQ3P 2LP0A 5FKOA 4M74A 2EINH 2XGEA 3K1MA 1I3QJ 2FNAA 2JPCA 4MHGA 5L3GA 1W36C 1DU0A 1R1UA 2K02A 4HNVA 4BHBA 3CF5F 1JT0A 3JAMZ 1NG7A 5L3CA 5LBQA 4GXOA 3S17J 2HVQA 1G3YA 3NEUA 2FBKA 5JVTA 3R60A 2CFXA 2K3PA 4QWQA 3LFKA 2X1CA 2QUFA 2YU9J 2E2IJ 3K2ZA 3ASOH 2WC2A 1CF7B 2FUG2 2L9RA 2E71A 3S8PA 2IBDA 2CUJA 2LYCA 1JJ6C 4KA4A 2CV0A 1ZK8A 2PEXA 5FKMA 4Z6YA 3B6CA 2CUEA 4WXCA 1LE8B 1HW1A 2MW8A 4L18B 3RZOJ 4BDYA 3FXJA 2QQ8A 3U9GA 3JTGA 1GV5A 5FLXZ 4AVZA 3ECOA 4YIFA 1HXDA 1LEAA 1OCCH 4M73A 1BIAA 5HLGA 1OCTC 1ERDA 2ICWG 2K3FA 3S16J 2CG4A 1H89C 3HOUJ 5FGMA 2QBYB 3S2WA 1XG1A 2IGKA 1ETOA 4RLFA 5J6XA 4UUSB 3BZ6A 1R5ID 4LIVA 4KMUX 1N25A 3CCYA 2W82A 1ZGWA 1FOXA 2MH2A 3KLNA 3CF2A 2VIXA 4ESBA 2K85A 2JA7J 2XDVA 2JA2A 1D8KA 3U21A 3REOA 4JK1X 3NQOA 1XGOA 4XKBA 4XORA 3PO2J 1W4MA 3WTVC 2Q1ZB 1FBQA 1XGSA 3OR1C 3ABKH 2JMWA 2M5WA 2Y31A 2QGUA 2MD5A 3K4LA 4Y15A 4PSXA 2HTJA 2BBYA 2ZXJA 3E1SA 2EJRA 2R7WA 2P7VB 3J81K 1MGTA 2YSRA 3FXMA 2Y69H 3MZ8A 3N97A 3MQ0A 1T0FA 4F93B 2DMUA 2IS4A 4NC6A 3LSRA 3GZ5A 3O3KA 5HS7A 1AWCA 3WTTC 5M3FJ 4RDUA 3QYBA 2EPFA 1POGA 3OYLA 2DOEA 2EA2A 3DWLE 2X1EA 2DA3A 3OYMA 4LB6B 4XLPF 2E7XA 2JUGA 2LY1A 2FMLA 1N75A 2H27A 1VQOI 1G3TA 1KU7A 3QOPA 3OYEA 2EFPA 1GVDA 2NNYA 4MIMA 1V5EA 2H8WA 3LQRA 1D5VA 4RBOA 2VODA 3SDGA 3VYSB 4CCKA 1M1EB 3BT9A 3CJTB 3M8FA 1BI3A 4HX4A 4L5JA 3IKTA 1KYWA 1JHHA 2PX9A 2B7EA 4E7LA 5E79C 1IGNA 3RYPA 2P6SA 2RREA 3PQJA 5EGOA 4V19K 2WWYA 3WG7H 1DP3A 1KU2A 2PG4A 2V9PA 1VNDA 2F4MB 1DPRA 2ACJA 1HDDC 4BDZA 2DMTA 4OIOF 4A3LJ 5TRDA 2BZTA 2XAFA 4HF1A 1FPQA 2IJLA 2GLOA 1MD0A 2NOGA 2LREA 3GMEA 1QZEA 1FMVA 4RB0A 3KYLA 3HHHA 2I10A 3F6VA 3CMMA 1K6OA 2XKPA 3CDHA 4XLHA 2XGXA 5FFXA 4NQWA 1QA6A 2XAJA 2V6EA 4I01A 1B8IB 1WI3A 3HGYA 1WHUA 4BEHB 1SFXA 2EWNA 2O61A 1D1BA 2HEOA 5HLIA 4OMYA 4L9TA 3ZMTA 2HOSA 5FKNA 3K69A 3GLLA 3W3CA 1FTZA 1MBEA 4WK8F 5GTIC 3M1EA 4O6JA 1E3OC 1K79A 4ZYDA 3TP0A 2HFHA 4C2TA 4U0VA 3RKWA 2AHQA 3L2QA 3K4NA 4L0YB 2VBWA 1IN5A 2VUMJ 2VPLA 3A03A 4LK1F 1LFPA 1IV8A 4ESJA 1JKOC 2X0LA 5LGNA 4I2OA 2AXTC 3W6KB 2Z9OA 4IJAA 1Z1DA 3G73A 4Y52J 1Z6RA 3IH3A 2P5LC 4E7IA 2LDUA 2OZ6A 3CCLI 1I27A 5H2FC 2DBBA 1IN6A 1T33A 2FQ3A 2YU3A 4PJLA 4EV0A 4Y7NJ 4XKCA 1AOYA 4D1QA 1ZG1A 2E1MB 3K4CA 2W57A 1W5SA 1HW5A 3O8GA 2KDOA 3CESA 4MGRA 5AIPA 5J8CA 4NHJA 2LRDA 4ZYHA 1G59A 2ISZA 4TV7A 3SDBA 2X6YA 2KLOA 3ERED 2EFOA 5KAIC 4BJ5C 5AIQA 4MTDA 3AL0B 2JQ7A 4DGWB 2R5YA 3WU0A 1OCRH 1Z21A 1LUJB 4WF2A 4E7ZA 2OTLI 2VC1A 3CP8A 2HYFA 3L9FA 2Y0SN 1ZRFA 1SD5A 1ETKA 2A6EF 2WB1A 2QSHX 2VKDA 1BR2A 1LDJA 5BPDA 1ON1A 3GFMA 3H0GJ 4QIWN 1UZCA 4BE0A 2E1MC 3O8HA 2C6YA 2BGCA 5F0HA 5DUKA 2ZMEB 4XL9A 2DMNA 2H6CA 3I4PA 3ZQHA 4L5EA 1HC8A 4KFCA 3CCJI 3AL0C 1I3AA 4UB8C 2HYGD 2BYVE 1FBUA 2GOXB 3L09A 3TW7A 3TW6A 3ROUA 1W7PB 3W6VA 1FWZA 1Z3YA 4B48A 4GYGA 1IRFA 2OU2A 2L02A 2YR2A 3AG3H 2CH0A 3ZN1A 1VTNC 1USTA 2MGQA 2X48A 2CQQA 2PLYA 3CC7I 1MMGA 1FEXA 4XLCA 4X1EA 4ZYEA 3ABUA 4FE4A 1XN7A 4M3FA 2FU4A 2L9VA 3B02A 1JGGA 3ZQLA 1YW8A 4ZYGA 2R7ZJ 4MO7A 1E2XA 2R7FA 2Y9ZA 3M4OJ 2ZMEC 4CZZA 1G2HA 4AWXB 2KP6A 2OPTA 4L5IA 3FDYA 3DU6A 1E3PA 3ASNH 2QEXI 4AM3A 5EG0B 5ILUA 2IXSA 3IUOA 2ZNYA 2EZHA 1ZN2A 1XDUA 1T6SA 4BGDA 1FP2A 5F1RA 2K5CA 3NWSA 4R79A 5FKKA 4HV5A 5HDNA 3CUQB 4CH7A 4E70A 1OCOH 3CCRI 4BXUA 2F5CA 3BZCA 3K4MA 2I5UA 3ESWB 1O3RA 1O3TA 1IUYA 1XPXA 1T8IA 5FJ8J 3ZR8X 2LKPA 1VQMI 2KFDA 1ZAOA 1RETA 2VC0A 2GXGA 3A0HC 1TNSA 1G8XA 2HI3A 1ODDA 4PGGA 1YOVB 5E3LA 2UWMA 2JRTA 3M9AA 2HZTA 5A2QZ 3I71A 1P2FA 3L1PA 2H8RA 4ESFA 3LQQA 4S0HB 3WTYC 2L7FP 5LLQA 1OJLA 2R7VA 4F91B 4CICA 4UUVA 2O8XA 4ITVA 5K7ZA 3EDPA 3CUQC 1P4XA 4A5MA 2L7MP 2F2EA 1RC9A 1MBHA 3OIQA 2CS3A 3CCVI 4HF2A 2EV5A 2FQ4A 1XSVA 1G3SA 4R8HA 2O5RA 3N05A 2ISYA 4V2FA 1JJ8C 3KEOA 1RIOH 4N4NB 4B47A 1FTTA 2O0YA 1K6YA 1A36A 2HNHA 2W00A 3FBIB 3F8CA 1TZLA 2ZCWA 1GV2A 4U7DA 1DQUA 4A12A 2DFIA 1YRNB 2OQRA 2Y0MA 3PSFA 4II2A 5IYBJ 1MNEA 1IN8A 3CTAA 3PO3J 4EM2A 2DT7B 1JKRC 2VE8A 2VOPA 2M2EA 3OSGA 3EUAA 3HC7A 1YJWI 1BJAA 3TBIA 1MKMA 3HPGA 2BW3B 2PQ8A 1FSEA 4YELA 2O03A 3BR1A 2EV0A 3OS1A 2WY8Q 4IO9F 4XR6A 3L2VA 1WJBA 5DDGA 2F4IA 1WH5A 2LBFB 2ZFWA 1LQ1A 4EMSA 2D45A 5D5VB 5HOOA 5GAHJ 1EF4A 4OAYA 3I4NJ 2AQFA 3J80K 3V7CA 5FKLA 1K83J 1WJDA 4DBQA 5HLTA 2MYSA 5E18F 4XQFA 2YPRA 2DT6A 1QHHD 1ETVA 3SEZA 2P5VA 3TGNA 5M5YJ 4DZJA 2E5NA 1QO0D 4IRGA 2RQQA 4B43A 1HA8A 3H9JA 4RA2A 5TJJA 5K7HA 3S2DJ 5EEGA 1MW7A 1ULYA 1KU3A 1VQ4I 2OQGA 3LA3A 1SFOJ 4EJOA 3BG5A 5TGTA 2E5ZA 1A5JA 1OPCA 3JRBA 3PM1A 4Q47A 2XB0X 2W25A 3ZMSA 2F6CA 3K1PA 3COAC 3JRFA 5F1JA 4XKWA 1OR7C 1BC8C 4PGHA 2X1DA 2DPDA 3DPUA 1S5LC 2FD5A 4AUXA 3S1RJ 2JN6A 4ZTFA 3CCEI 1HOMA 3HM5A 2OAZA 1J9IA 4M71A 1W1WE 2V7FA 3H36A 3PJRA 2RQPA 4ZC3A 2CW0F 1LDKB 4C30A 3HOTA 4LJZF 1MBKA 1VQNI 3MCZA 5LEJA 1BI2A 2QVOA 3BTIA 3J7YJ 1VQKI 1J59A 1BI1A 1WJEA 1RKTA 2XAUA 5DEQA 5KK1A 1BA5A 4CYCA 3VFZA 2IGOA 1ZHFA 4IVNA 4XSZF 1IXCA 1PP7U 1SANA 2QWWA 1WKMA 3HSRA 1H8AC 2ZSIB 4GCVA 2BE5F 2DA1A 3A02A 1FOWA 3GW2A 4C2MJ 1GHCA 4BQNA 2M0MA 5L3BA 3WU2C 5LHIA 2STTA 2DN0A 1DU6A 1BOBA 1X4OA 4B4CA 1SAUA 2WBMA 2P8TA 1ZG5A 4O3MA 3M8JA 4RAFA 2WAQN 5H6RA 4YFXF 2WA0A 4YG2F 3MN2A 4HF0A 2LVSA 4IOAF 1UB9A 3DEWA 4CDGA 2M34A 3GWZA 3QPLA 5K5QA 2DCEA 4Y4RA 3CCQI 2HTSA 4ENKA 4M3BA 2LTPA 4HQMA 4EEFG 3MKYB 1ORKA 4OIPF 4FCYA 2HVRA 2V6CA 5FFZA 1N77A 4EATA 4P9FA 2YS9A 5GAEJ 3WTSC 1X1CA 3X2QH 4H4KC 1O7FA 5FROA 4I99C 1R7JA 2GA2A 3GUDA 1RI7A 1G3WA 3ZMVA 3S1NJ 3PNYA 3V4GA 4RM2A 2VQGA 1V3FA 1DUXC 2JA6J 2R7OA 1KONA 2CV1A 3PSIA 1L0OC 1R1TA 2JVGA 1X1PA 1A35A 3KX2A 2DFFA 2ELJA 2HDDA 3C2BA 3E0JB 2PJRB 1IXRC 3HPHA 4AIDA 5E8IA 3PL8A 4ZH4F 1K4SA 5D4SA 5LEKA 1S6LA 3QYFA 4I09A 1JUPA 2JVHA 5B66C 5FD5A 4PSWA 1R5HA 2MA3A 3G71I 2DFHA 2FBHA 2D1VA 2LY9A 2WAEA 3SZPA 1BC7C 1X1AA 3DBRB 3NWTA 3P9CA 3ML6A 5DM6F 2XAHA 3T0YA 2D1HA 3LL7A 4ZZDA 4EGZA 4BS9A 2XKOA 4GRIA 4DJAA 3ZMUA 2ETHA 2Q2EB 2WTEA 5E17F 3BP8A 5D6FA 5D8KB 1ZLJA 4HNTA 4HAMA 2L2OA 5J4VA 1UELB 2X85A 3CP2A 1TWCJ 4A3MJ 3HUGA 3C7JA 4BKXA 1VF9A 3IRQA 1SD7A 3KYCB 3FMRA 2CU7A 3EUHA 1BW6A 2CQNA 2CSOA 5GPCA 2WY7Q 2EH3A 1S72I 1O3SA 4A3DJ 1IN4A 1KYZA 1SVLA 4G7ZF 3RJPA 1LEBA 1ETQA 2BHYA 3OMYA 3DBLB 3R4KA 3BOQA 5C4JJ 3LSPA 2P4WA 3JRIA 2ZXWH 4NBQA 2ZNZA 4FASD 4HBLA 2FJ1A 1ZG3A 2QF7A 5TISC 3SXYA 3G6EI 1AKHB 3A1YA 3F6OA 5EEHA 1RRJA 3DPLC 1TWGJ 2A5YB 2HQRA 1VQ5I 3FWEA 4KUMA 2M8GX 3HRTA 3PIPF 1X2NA 3HOVJ 2F5FA 5CPRB 2LSOA 4OOIA 3I55I 3RZDJ 3H5RA 4AVPA 3QPTA 4I7HA 3OYCA 2RNJA 3S93A 1GT0C 1XSDA 1QZYA 1PDNC 2GM4A 3I56I 3LSMA 4ENNA 3F72A 1YITI 3GO5A 3S32A 1JHFA 4IHSA 1BL0A 3W6JB 3PUFA 3KEYA 4IRHA 3LA7A 2DYSH 3BCBA 1XMAA 3H0DA 4AC0A 1ZREA 3FXKA 1I50J 5KCMA 3HKZN 1FYKA 1SD4A 4C2UA 3FISA 3H5AA 2CYYA 2GAUA 2W7NA 2NOJB 2KDZA 1FJLA 4EVIA 3C1DA 1TWFJ 1D3YA 2DMQA 3QU6A 3ZGKA 3FK7A 1HF0A 2XF6A 5LHHA 5ED4A 2RV8A 3MMYB 3VYUB 1PP8F 4FETA 4IEJA 4IPAA 2XHKA 5D5WB 3H3VK 1PYVA 4UUSA 2MLGA 4DYRA 5EDNA 3JRDA 2GIVA 2Z16A 1MSEC 3S3OA 3CC2I 4NUBA 2K9LA 3GTGJ 5ICEA 3CDLA 3I59A 2PJPA 5E3MA 3HXLA 2FEZA 4W97A 4XRSA 2OBPA 5H6QA 3L2RA 2MFZA 2E1NA 1FSHA 4YIIA 2XV4S 2RAEA 1P9QC 2CUZA 2STWA 2A61A 2XPWA 2H1LA 5IOZA 3KFWX 1U3EM 3E6BA 1QNTA 5E3NA 1ZYRF 1TWHJ 1UHWA 1SFEA 1XGMA 3RTRA 3LAJA 2EV6A 1Z3XA 2IVMA 2ZC2A 3DPTA 1V54H 4A93J 5DCFA 1DP7P 2RVCA 1TW3A 4A5NA 2LF7A 3WGIA 1MBFA 3F8FA 4XOPA 5ILSA 1B9MA 1JTYA 2HKOA 1IDZA 3DEUA 2NS8A 3IAS2 3OYJA 2R92J 1WJAA 5DCMB 3QAHA 4U0WA 1R36A 3ABMH 5CVIA 3HEFA 2G7HA 3WG9A 1YS7A 4E7SA 1STZA 2XPVA 2EFWA 1U8BA 4R1HA 3HSEA 4MQ9F 1K78A 4KMFA 1S9HA 3P9KA 3NRVA 4HLXA 1EV7A 2DA4A 5J47A 2QKMB 1GVJA 2KIFA 4PK4A 2M3AA 1LJ9A 3WHBA 1IZ1A 2VT2A 3RKXA 4GFBA 2RGVA 4L9VA 1L3LA 2XGDA 3I3LA 4MFDA 3DU5A 3OR2C 2JUCA 2VJJA 4HA8A 2E35A 4DOZA 3SHFA 3GZNB 3H3ZA 3F22A 2X51A 4D5CA 2G0EA 3IRRA 3GFJA 5IYDJ 4LB5A 1NTCA 3OYFA 2EZKA 1SEUA 3F23A 3DFGA 3WTUC 2CW7A 4G7HF 5KNLA 1C0WA 5C44J 2QSGX 1R4MB 3DV8A 2Y75A 1ZGAA 5EJCA 1F43A 2W4SA 4UB6C 4XLFA 1CQTA 2PBIA 4CGZA 2XGCA 4XBFA 2X9DA 4CXFA 4YFNF 5BQTA 2BXZA 4CCOA 3ULQB 1KU9A 2JT1A 1ZLKA 4LG0B 1DGWY 3FKIJ 3Q5FA 4YIRX 1CGPA 1T0FC 2OCCH 2RC4A 4BE2A 4KDPA 3A01A 3RI4A 3HRSA 4HW0A 4C3IJ 2KIUA 4KT5C 1J0RA 3QU3A 3IH2A 3ERMA 2LY2A 2Q8KA 3HTSB 3HHGA 3K1NA 5KAFC 1UMQA 5CQEA 2DMPA 3BY6A 2X6XA 5B1AH 2NNNA 2CJJA 4D5FA 1SMTA 3LSHA 4M6XA 2KMUA 3WGHA 1NK2P 1ZR2A 1A6QA 4GYIA 1KQ8A 3KEQA 4HV6A 4G8XA 3V42A 5BNGA 2V9KA 5EZGA 1FYMA 1MMSA 2KJBA 4RGRA 2EA4A 2V9VA 3JAMK 3W2VA 2MG4A 4G6TB 1IRZA 2NVYJ 3GLXA 3K6GA 2LH9A 1B6AA 2WV1A 4KN4X 4RGSA 1FYLA 1TL8A 3JCUC 3F8MA 3E5QA 3HTUA 2K7LA 2PMUA 3AG1H 3FZVA 3HL2A 4HQEA 4J00A 4J19A 3OYNA 2V26A 1R58A 2P5KA 4IOCF 1BR4A 1TNTA 1GDTA 1UJ8A 1S3JA 4AYBA 3RDIA 4BXXJ 4KYWA 1FIPA 1XMXA 2LK2A 3SYTA 2CRGA 3OY9A 1R00A 1S29A 3H1CA 1ETYA 4ETSA 3OYKA 5GTHC 2DFEA 1NH3A 3NAUA 1R6RA 4M3EA 1EH6A 2WAFA 3KP4A 3S2HJ 1BJZA 3CLOA 2E19A 1HKSA 4KN7X 5BMZA 4IHXA 4BL0B 5FLXK 3TEDA 1YIJI 3KIOA 2W24A 1Y8QB 2IW5A 1OMIA 5B3SH 1MJ9A 2HYJA 2A6HF 3HOSA 1S7EA 1R22A 3V8JA 3DKYA 1BBYA 4BACA 1W0UA 1JUMA 3CQZJ 4JQFA 2KISA 2F5DA 1MH3A 2GZWA 3EPZA 5L3DA 1WJCA 3CMAI 2ZJPF 4WXDA 4QLCU 2FNPA 1W7PA 4LMYA 2JA5J 3VSLA 5E1ZB 2XB5A 4J01A 3HOWJ 4MFEA 3VWBA 2OCEA 4IHYA 2GA1A 2E1CA 3WODF 3OOUA 3BDDA 1IRGA 3BJAA 4Y17A 2MC4A 5F08A 3BWGA 2COBA 2E36A 2BHZA 1X3UA 4BXFA 1X58A 2IAIA 6PAXA 2FRHA 2VKVA 2VJIA 3KLOA 4EJTA 3ZQQA 1WZ2A 3GFLA 4N0BA 1AA7A 3TKYA 2M8EA 3K70D 4BY1J 1YW9A 2V4JC 3K9TA 2FOWA 4UUTA 1O57A 1U0JA 1MJBA 4I0AA 2L5QA 2PMHA 3VYTB 3FXLA 2VJ4A 4NC7A 2ZXIA 3H92A 3ECHA 3KE2A 2L01A 2WB1N 4XN3A 2EQRA 1TTYA 4PJ0C 2IEKA 2XUBA 2K9SA 4I0BA 2CW8A 2ELHA 1XTAA 2NXNB 2OUMA 3D5LA 1J5YA 3LSJA 1XCBA 3CUQA 5IT9Z 2D2WA 2IPQX 3V8KA 4B44A 4AIHA 2HDCA 3ZXSA 4C3HJ 5HVQC 2A68F 2I8DA 3EYYA 5GPAA 1XC5A 4M3DA 1FX7A 2DK5A 4XLAA 3SFZA 3GX4X 3JSPA 1V5FA 1MIJA 1DPUA 2DK8A 4KISA 3HRMA 2QQBA 3MD2A 3VPRA 1W5TA 2HXIA 3VYRB 4EM0B 2JJ7A 4RGUA 3OIOA 4CCLA 4A0XA 4BHCA 3FHNA 3PFYA 4DQ2A 3QP5A 1ITYA 4G94A 3JREA 5F0CA 3I53A 3CMYA 5FRMA 2Y30A 4O5VA 3V7RA 2XF5A 1PUFA 1PUEE 3WTWC 4EQQA 2L9SA 3IKVA 4CSWA 1TC3C 4A3IJ 1SVMA 3Q0UA 1MNDA 2F48A 2UXXA 3JTHA 2RDPA 2IP2A 4ZDPA 1IW7F 1MDMB 3ONQA 2HXOA 3BQZA 2GXAA 1OCZH 3OYIA 3D5RC 2OA4A 1R5GA 3PIOF 1F4KA 5JHUA 2F5VA 2CFOA 1Y56A 4RAGA 1YTYA 2EIMH 2Z33A 2ZFUA 3Q9SA 1YQAA 3O2PE 4BJ6C 2JSCA 3S1QJ 1QQIA 3FXQA 4RAZA 2XC7A 1YRNA 1X4PA 3BR6A 1VQPI 1K61A 3AKZA 4FX4A 4Q5SF 1Y8RB 3DQVC 1UAAA 2Z99A 2HVSA 1F9NA 5DV5A 1HCRA 3U1DA 2NS7A 5D5UB 1TLHB 1RZ4A 2DI3A 4A6EA 1LDDA 2DDAA 4AU7A 1OKRA 1Z67A 3HOYJ 2R4GA 2VT3A 2DA7A 3CCSI 4E7JA 3B73A 2VPRA 4OWRB 4LLNA 3L2WA 5J1YA 1XDSA 2BW3A 2JZYA 4L0ZB 1TQPA 2HGCA 4XLNF 3HDDA 3SEQA 4ANJA 2M0CA 4BBSJ 3RYRA 2ID6A 3AG4H 5EZHA 2E7WA 1JXSA 2GXBA 1HSJA 3PQKA 1SVOA 5ILVA 4W1UA 2ZJQF 3OYDA 1GLNA 4RAYA 4OU0A 1OR7A 2KRFA 2M30A 2QZ8A 3CZ6A 5DS9A 1B72B 4PJMA 3K4KA 4M9XA 2P81A 5D8LB 3OV8A 1IO2A 4UV9A 2LOOA 1I1GA 3CCMI 1HDPA 1WGXA 3ZQIA 1WSUA 4IX7A 1E3HA 1MJAA 4F52A 2B0LA 4XLEA 1OYIA 5LHGA 4IF4A 2ADUA 2KZVA 4EJWA 2X6WA 4Y3OA 2ZXHA 4C3JJ 2KIMA 2FX0A 1T56A 3WU1B 2QKLB 5DD4A 5J1UA 1Z9CA 4NDLA 1PJRA 3RKYA 4ENMA 3GXOA 3TOBA 3GFIA 3GTMJ 3GTLJ 4ZJZA 1TBXA 3V7SA 3OSFA 1QZZA 4L9NA 1U5TB 1HKQA 1BW5A 5IYCJ 2W1OA 3RKQA 2CUFA 2M9HA 3BG6A 2CQ7A 2EILH 2VXDA 4G7OF 4K2EA 1JUSA 2XIGA 2A69F 2TDXA 1Y1VJ 3BZKA 2DQLA 1O7LA 2X4HA 3KYDB 2BV6A 5LGUA 4B8XA 4RM3A 3F8BA 5IP9J 2NAZA 3BG3A 3K10A 2BXYA 2HS5A 3G2BA 2FSWA 3KP7A 1H9TA 1UHSA 3IAM2 2CGPA 4Q4ZF 4OIRF 1U5TC 4IKFA 1NHAA 2YX7A 2KT0A 3GTPJ 2R7SA 4P9UA 2PFBA 2DJIA 3I64A 2ZJRF 2MH9A 1HBXG 1OYWA 4AIKA 1ZRCA 1X2MA 2QQ9A 3L2CA 2AS5F 4BAYA 3ZQGA
chains in the Genus database with same CATH topology
3LSIA 5KCMA 3UR3C 4C2UA 3H5AA 4BEHB 3S3MA 2W7NA 2NOJB 4CZCA 1D1BA 2R7QA 3OYAA 4HRIA 4PFPA 3ZGKA 3W3CA 2XF6A 4BUPA 3H9GA 3J7AY 3A2KA 3MMYB 3H5NA 3VYUB 4C2TA 3EUKL 2IS1A 4FETA 2PMZA 5FRNA 1PYVA 3ZRGA 2KQRA 3L2QA 3K4NA 4F92B 4JOMA 4CCJA 5HNHA 4IQ4A 2VPLA 1LFPA 2Z16A 3L2UA 3FKJA 3S3OA 2XF7A 3H35A 2DXIA 4NUBA 2K9LA 4HEA2 3PNTA 4PFOA 4E7IA 2E60A 4BE1A 3HXLA 1QHGA 3L2RA 2MFZA 3PNVA 4PJLA 3UNGC 4XKCA 4D1QA 1P9QC 2CUZA 2E1MB 1IRXA 3K4CA 2KDOA 3CESA 2VQHA 4XMYA 2LRDA 1G59A 3ZCOA 4BQOA 3SDBA 2LBFA 2X6YA 2KLOA 4PUSA 4PJJA 3RTRA 1Z3XA 3DPTA 4BJ5C 4XNFA 3AL0B 1ZELA 4DGWB 5JHFA 5LD2C 4XOPA 1Z21A 4E7ZA 2VLAA 3CP8A 3IAS2 3OYJA 2A5WA 1EA3A 1WJAA 4QPQA 2WB1A 1J09A 2VKDA 1BR2A 3OL4A 3OL3A 4E7SA 4BE0A 2E1MC 2OV7A 1MMNA 4XL9A 1S9HA 4HG2A 4BQQA 4KITB 4LITA 4F3QA 3MKWB 3BC8A 2HPIA 3AL0C 2QKMB 1YE9A 2GOXB 2VL8A 4PK4A 2M3AA 4YEJA 1Z3YA 4B48A 4X0GA 2CH0A 3I3LA 3DU5A 3OR2C 1MMGA 3LMMA 4XLCA 3S3NA 1LKXA 4BJTA 4KT6A 3BLYA 2VJJA 4U87A 4DOZA 3AFHA 4CCNA 4LG3A 2M4GA 4YRVA 2X51A 2MD0A 2K9MA 3RQ4A 2IS6A 3OYFA 2P0WA 3HUGB 1Y6IA 2KP6A 3DEEA 1JI8A 3LFUA 4P5OA 4E7KA 2CW7A 4OAZA 5KNLA 3FDYA 2WADA 3DU6A 4PJNA 2W4SA 4XLFA 1YX3A 2KHMA 4IQJA 2MABA 1MMAA 1X19A 2IXSA 4CCOA 2WAQA 2HZDA 3IUOA 1DGWY 2KRHA 4BGDA 2K5CA 3NWSA 3TL4X 1T0FC 4BE2A 4R79A 4DBRA 1D0XA 1X1BA 1VZ0A 4CH7A 3DTEA 4QPOA 3K4MA 2LY2A 3BCAA 3BG7A 4Y33A 4CUGA 3ZR8X 5CQEA 4E4HA 2X6XA 3EUHC 1FMWA 1OLTA 1G8XA 4HPQA 2UWMA 3LSHA 1DGRM 3OYHA 2KMUA 4KJZA 3D5SC 2IS2A 4ZYAA 4DIQA 5HNFA 3V42A 1D0YA 2R7VA 3FBNB 2V9KA 4F91B 4ITVA 2IGNA 3W2VA 4G6TB 3K6GA 2LH9A 3OIQA 2CS3A 2DOAA 2VQLA 3HL2A 2Z2SB 4J00A 4MLOA 4P1WA 2IGMA 2O5RA 3OYNA 2V26A 3N05A 2M7BA 3RCOA 1BR4A 2M4KA 4N4NB 4B47A 2CV2A 2Z1DA 2PJRA 1K6YA 4CCMA 4AYBA 2HNHA 2W00A 3LSKA 3SYTA 3FBIB 1T95A 3OY9A 4BU2A 1TZLA 2HQAA 2L9NA 4D9JA 2A6TA 1V5GA 4NC8A 3OYKA 3C2GA 1DQUA 1R6RA 1Z7LA 4RMNA 3PSFA 2BVMA 3DTIA 5CKTA 3QOEA 4II2A 2WAFA 1MNEA 4U7BA 4HSRA 2VJ5A 3K4JA 4LIUA 4BL0B 3DLAA 3K70C 2DT7B 2OC6A 4CA0A 3EUAA 3HC7A 3H9QA 1UG0A 3HOSA 3TBIA 2AQEA 3DKYA 4BACA 3HPGA 2BW3B 4JQFA 4YELA 3EPZA 2R7UA 1WJCA 1QU3A 2R7XA 3OS1A 2WY8Q 4XR6A 3L2VA 1WJBA 2F4IA 3VDXA 2LBFB 3VSLA 1SFKA 4J01A 3VWBA 5HOOA 4OAYA 5KHDA 4C9YA 3QODA 2AQFA 2M7AA 3OOUA 2UUZA 1WJDA 2MC4A 3DKXA 4DBQA 2MYSA 5HLTA 4XQFA 1YX5A 2DT6A 1QHHD 2HDWA 4BXFA 2VXZA 4XM3A 3HG9A 3SEZA 2VJIA 2E5NA 3ZQQA 2BOLA 3OYBA 1AA7A 3K70D 3LSGA 3RSNA 2RQQA 4B43A 1D1AA 2V4JC 1D0ZA 3H9JA 1HA8A 1U0JA 1MW7A 3MKZA 2L5QA 2V1NA 3OWTA 3VYTB 2KPMA 5TGTA 2VJ4A 4NC7A 2E5ZA 2ZXIA 3HKZA 3OS2A 4XN3A 3CJRB 2F6CA 4XKVA 2CW8A 2OUMA 3D5LA 4XKWA 1OR7C 2X1DA 2KRCA 3DPUA 4HSTA 3CJQB 3SZGA 4B44A 1WJ5A 1W36C 3ZXSA 4B3XA 4BEHA 5HVQC 4ZTFA 1N78A 1BR1A 2I8DA 1NG7A 4XLAA 3W2AA 2V7FA 3PJRA 3IP4B 4ZC3A 1LDKB 1V5FA 2HVQA 4C30A 4E6KG 3HOTA 2BVLA 4KISA 1E0EA 3OIPA 2K3PA 2UV1A 3MD2A 2R7TA 2X1CA 1WJEA 2XAUA 3VYRB 4CCLA 2IGOA 3FHNA 3PFYA 4HNUA 1WFXA 2FUG2 3S8PA 4E7HA 2CUJA 2LYCA 2ZSIB 3GBGA 5FRMA 2XF5A 2CV0A 4ZDOA 4BQNA 2M0MA 2L9SA 1BOBA 1X4OA 1TT0A 4N4OB 1SAUA 4NQWB 2WBMA 4CSWA 2VKHA 1W36D 1MNDA 4ZDPA 2KL4A 4NNJA 3ONQA 4BDYA 3OYIA 3D5RC 3M8JA 3RPUD 2L7KA 4AVZA 2WA0A 2F5VA 2CFOA 1Y56A 3M1CA 5LFAA 2Y0SA 1NG6A 1D1CA 2ZFUA 4BJ6C 1ERDA 2DCEA 4Y4RA 4ZTJA 2XC7A 3MKYB 1X4PA 2JSPA 4RLQA 3AKZA 2CMPA 2HVRA 1X1DA 3DQVC 1UAAA 1N77A 2HVSA 4EATA 2IGKA 4II3A 1X1CA 4RLFA 4LIVA 4H4KC 5FROA 2VQCA 2W82A 4AU7A 3I9V2 2R4GA 3PNYA 4E7JA 4RM2A 2VQGA 3CF2A 4OWRB 2VIXA 3L2WA 2R7OA 1KONA 2BW3A 2CV1A 3PSIA 2XDVA 2JA2A 2LG4A 2JVGA 3SEQA 3U21A 3KX2A 2ELJA 4XKBA 4XORA 4ANJA 2Q1ZB 2VASA 3E0JB 2PJRB 3OR1C 3HPHA 3PL8A 3QYFA 3K4LA 2JVHA 4PSXA 3OYDA 1GLNA 4PSWA 3E1SA 3A4CA 2R7WA 3CZ6A 2WAEA 1X1AA 3NWTA 4PJMA 3K4KA 3LL7A 4IZZA 4F93B 2IS4A 2GOMA 4BS9A 4GRIA 4DJAA 2LOOA 2Q2EB 3W2WA 3PUBA 4HNTA 2L2OA 4IX7A 4F52A 1UELB 2X85A 3CP2A 3QYBA 3OYLA 2ZSHB 4XLEA 3DWLE 2X1EA 2KZVA 2X6WA 4Y3OA 2ZXHA 2JUGA 2LY1A 2WY7Q 2QKLB 1N75A 1PJRA 3DTKA 3OYEA 3OMYA 4ZJZA 1V5EA 2XSJC 2R7RA 3VYSB 3VSKA 4CCKA 3OYGA 4ZDLA 4XN0A 3C2HA 4FASD 2W1OA 3K4BA 4E7LA 3A1YA 3DPLC 3OS0A 3TMOA 2RREA 3BG6A 2VXDA 4F55A 2VB6A 1DP3A 3QYEA 5CQGA 2HU9A 5CPRB 4BDZA 3H5RA 4RM3A 3OYCA 2LC2A 1LVKA 3K10A 3S93A 3F9KA 3G2BA 2RNGA 1WJFA 2HPMA 2LREA 1FMVA 3LSMA 4XONA 3IAM2 3KYLA 4IKFA 3S32A 3CMMA 2R7SA 2DJIA 4XLHA 3KEYA 1MMDA 3BCBA 3H0DA 2V6EA 4XOTA 3OYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFK A;  1R6R A; 
#chains in the Genus database with same CATH topology
 2A05 A;  3DCF A;  3UR3 C;  2K9Q A;  3Q3S A;  1A6I A;  3S3M A;  1IG7 A;  3CME I;  1DDN A;  2R7Q A;  2KZG A;  5IT3 A;  4FHT A;  1ON2 A;  3R0A A;  4PFP A;  2QCO A;  3CLQ A;  3VOE A;  3WHC A;  4BUP A;  4L9J A;  3A2K A;  2B9S A;  3H5N A;  1OYY A;  3EUK L;  5J8F A;  1YJN I;  2IS1 A;  1LNW A;  1LFB A;  1S7A A;  2PMZ A;  3T8R A;  1IJW C;  5FRN A;  3ZRG A;  4MEX F;  4PDK A;  1PVE A;  2KQR A;  1ENH A;  4CYC B;  4JOM A;  4LD5 A;  3I0T A;  4CCJ A;  5CVU A;  3HIF A;  4IQ4 A;  5IP7 J;  1P4W A;  3FIW A;  1D8J A;  4HOB A;  2O3F A;  2CQK A;  3FKJ A;  3DF8 A;  2XF7 A;  2JWT A;  2VKE A;  3H35 A;  3FX3 A;  3RIR A;  3CO7 C;  4HEA 2;  2LMD A;  1RUO A;  3HGG A;  3LOC A;  3BR0 A;  2KIQ A;  3K2A A;  1BOA A;  1QHG A;  5DM7 F;  2X6O A;  3J81 Z;  2DOD A;  5F27 A;  1O3Q A;  2Y9Y A;  5A2Q K;  3PNV A;  2K4J A;  2NRA C;  4EGY A;  5EYR A;  2E2H J;  2ME6 A;  1TQI A;  3E6C C;  1ONV A;  2HOT A;  4BQO A;  1U2W A;  1BIB A;  3FM5 A;  4PUS A;  4RS8 A;  2R5Z A;  4N9H A;  4XNF A;  1LVA A;  5JHF A;  2QA4 I;  1D5Y A;  2GBY A;  4P55 A;  1UFM A;  5HS8 A;  1NK3 P;  1R1V A;  3HOX J;  2Q2E A;  4FX0 A;  4DZP A;  4KIF A;  4HLY A;  4QPQ A;  5L3F A;  3GTJ J;  1J09 A;  3OL4 A;  4ZZL A;  3RPU A;  3TO6 A;  4GDF A;  1J2X A;  3VEP A;  2R3S A;  2OV7 A;  2XVC A;  1P6R A;  1WQ2 A;  3IHU A;  2AXL A;  4G12 A;  1MMN A;  3I58 A;  3FM3 A;  2XAG A;  4LIT A;  4F3Q A;  1T38 A;  2V1D A;  3MKW B;  3BC8 A;  2IA0 A;  2BY0 A;  4M9S A;  5HDG A;  1WPK A;  4G9Y A;  3HBL A;  3ZQF A;  4XID A;  3IL2 A;  1GXP A;  2LKS A;  3Q0V A;  2DO7 A;  2VBZ A;  4YEJ A;  5DUI A;  4B09 A;  4X0G A;  1T98 A;  2JRM A;  3G3Z A;  1OIS A;  1S8N A;  1VQ7 I;  1LKX A;  4BJT A;  1G6N A;  3BLY A;  4U87 A;  4IXA A;  4LG3 A;  2M4G A;  1YFH A;  3JRA A;  1P92 A;  4U88 A;  2EFQ A;  4RB1 A;  4RB3 C;  3P5J A;  1IC8 A;  1SMY F;  3E7L A;  3FXR A;  2IS6 A;  2H6B A;  2HOE A;  3HUG B;  1Y6I A;  4LK0 F;  1U78 A;  3LFU A;  1LPQ A;  4E7K A;  2DA2 A;  1BN5 A;  3P9I A;  4CO8 A;  5L3E A;  3LNQ A;  4FIS A;  2WAD A;  1QPM A;  4PJN A;  2Z3Y A;  2IA1 A;  1CF7 A;  2QM3 A;  4IQJ A;  2KHM A;  4LOC A;  4N9I A;  1MSF C;  2MAB A;  4I76 A;  1X19 A;  2DT5 A;  2R7D A;  1Q1V A;  3E6D A;  2HZD A;  4B1R A;  2ZBK A;  3KZY A;  2M45 A;  4WX9 A;  2DPU A;  3T8T A;  1U9N A;  2KRH A;  3IWF A;  1LE8 A;  2VOO A;  1X1B A;  1GUU A;  4HX8 A;  1RUN A;  5KVR A;  4IHW A;  1ZR4 A;  4M6V A;  3BG7 A;  4KIC A;  5ICG A;  2UZK A;  5M5X J;  3U2R A;  2K4B A;  3G1M A;  4E4H A;  3Q9V A;  3EUH C;  1TWA J;  1FMW A;  1OLT A;  1W5C C;  4XRF A;  1MNM C;  1IUF A;  4HPQ A;  3VB2 A;  1QVU A;  2QBY A;  3QPS A;  4KJZ A;  1ZH5 A;  2XAQ A;  1K4T A;  1IAW A;  5HNF A;  3RPQ A;  3SFI A;  2VBY A;  1XCV A;  3TDZ C;  1H9G A;  5C3E J;  2DQR A;  2IGN A;  1P7J A;  1W0T A;  1T39 A;  1E17 A;  4XSX F;  2JA8 J;  2RN7 A;  2QLZ A;  1ZGJ A;  5M5W J;  4AD9 A;  2VQL A;  2Z2S B;  4M6Y A;  4MLO A;  4P1W A;  1A31 A;  2IGM A;  4A3C J;  2IT0 A;  2M7B A;  3RCO A;  1S7O A;  2BY2 A;  3D1N I;  3LSK A;  2XRL A;  2L54 A;  1T95 A;  2EFN A;  2A07 F;  2L9N A;  5F0F A;  4D9J A;  1V5G A;  2H09 A;  4NC8 A;  3ISP A;  1IXS B;  1LFU P;  4IHV A;  2ZKZ A;  1Z7L A;  5FO5 A;  5CKT A;  1T08 B;  2BVM A;  3DTI A;  2K27 A;  3QOE A;  5DCM A;  2VJ5 A;  5JVG F;  3GCM A;  2BEO A;  5J1R A;  3HZJ A;  1H88 C;  2V1U A;  3K70 C;  1KA8 A;  2OC6 A;  3JSO A;  3KP3 A;  1HQC A;  3I59 B;  3GTO J;  5B5E C;  4LFU A;  1FY7 A;  1HLV A;  3H9Q A;  1UG0 A;  1ETX A;  1F5T A;  1I1S A;  4A0Y A;  1QPI A;  3TO7 A;  2R7U A;  4ASN A;  3S1M J;  5CVV A;  2R7X A;  1VQ6 I;  4DW6 A;  5DD8 A;  1MH4 A;  2DA5 A;  4D0P A;  1O4X A;  5F6F A;  3VDX A;  4A69 C;  1J7K A;  5CVR A;  2MLK A;  3ZQC A;  1MZB A;  2QEN A;  5KHD A;  4C9Y A;  3QOD A;  3GTK J;  2M7A A;  2UUZ A;  2HKX A;  4YFK F;  4HDV A;  2CWE A;  3DKX A;  3TP3 A;  2HWV A;  2HDW A;  1BI0 A;  1IV6 A;  2VXZ A;  2YUS A;  5F64 A;  4DNC A;  2LF8 A;  3TO9 A;  2BOL A;  2NYX A;  5CVJ A;  3OYB A;  2HR3 A;  3RSN A;  1U6G A;  1D0Z A;  1I6X A;  3I4M J;  3KET A;  4UNO A;  1HST A;  1OCP A;  2UXN A;  1JTX A;  2L3D A;  4HX7 A;  1K78 B;  4LG0 A;  3DP7 A;  3OS2 A;  2Y2Z A;  1RR7 A;  2FBI A;  3BTL A;  3TDU C;  1U8R A;  3T1B A;  1WRJ A;  4WXH A;  3CJR B;  1EJ9 A;  5E3O A;  3MZY A;  4CHU A;  3ZMD A;  5ERI A;  3I54 A;  4F7Z A;  1VFC A;  2XRO A;  5IP6 A;  2IRF G;  4S05 A;  2KRC A;  4HST A;  1QVT A;  2DLL A;  3CJQ B;  4Q48 A;  1F36 A;  5HS9 A;  3SZG A;  4JX4 A;  1WJ5 A;  3WE2 A;  3GYH X;  1B8I A;  2FF4 A;  2OD5 A;  1B9N A;  4UXN A;  4B3X A;  4BEH A;  1G4D A;  1N78 A;  1SD6 A;  1BR1 A;  3FHZ A;  3ELK A;  4D7N A;  2QSF X;  1Y39 A;  3W2A A;  3IP4 B;  4M72 A;  1HW2 A;  4NB5 A;  2ME0 A;  5EGO B;  2G9W A;  4E6K G;  2BVL A;  1E0E A;  3OIP A;  1QRY A;  1TT5 B;  4OIN F;  1YIO A;  2QQA A;  5E1X A;  2UV1 A;  4LLG F;  2R7T A;  2EB7 A;  4Z2Y A;  3AAF A;  2NVU B;  3CO6 C;  5GAD J;  4I02 A;  4HNU A;  3FXO A;  1WFX A;  5E1W A;  4E7H A;  5E8G A;  3GBG A;  4QTR A;  2P7C B;  4UY8 I;  4ZDO A;  1TT0 A;  4A0Z A;  4OMZ A;  3A01 B;  4N4O B;  4NQW B;  2E2J J;  2VKH A;  2EZL A;  2EIK H;  1W36 D;  2KL4 A;  4NNJ A;  2EZI A;  1FNN A;  2PN6 A;  2HOA A;  4KIG A;  3RPU D;  5FLV A;  2L7K A;  2YX4 A;  2O8K A;  3M1C A;  3AG2 H;  5LFA A;  2R0Q C;  2Y0S A;  1Q1H A;  2EBI A;  3L7W A;  1NG6 A;  1D1C A;  5IPA A;  1R9T J;  3DXJ F;  4ZTJ A;  1FOK A;  3HRU A;  2JSP A;  1XB4 A;  4RLQ A;  3CJN A;  4RB2 C;  2CMP A;  1UG2 A;  3OOP A;  4B3A A;  1R23 A;  1X1D A;  3LA2 A;  2XPU A;  1KZH A;  3P7N A;  4M3G A;  3H3U A;  1KGS A;  3IWZ A;  4II3 A;  5DYM A;  2IA2 A;  3MZH A;  3M3Y J;  2VQC A;  1YJ9 I;  1XGN A;  2ESN A;  4MNU A;  3I9V 2;  5K7F A;  3IV5 A;  3J80 Z;  3ZPL A;  1Z77 A;  2JTV A;  1Z0X A;  4JP0 A;  2MC3 A;  2LG4 A;  4HDU A;  3FF5 A;  2ZME A;  4MEY F;  5B1B H;  3TOA A;  2GQQ A;  1ACI A;  1YG2 A;  4A3J J;  5LRS A;  5HOD A;  2VON A;  2VAS A;  4WWC A;  3R0J A;  1JT6 A;  1XS9 A;  3E97 A;  1QBJ A;  3BPV A;  5J4Y A;  3A4C A;  2NVQ J;  5BOX A;  1HKT A;  1A04 A;  3KCC A;  2R5Y B;  1LB2 A;  2VI6 A;  2Q0O A;  2LLK A;  4AYB N;  4IZZ A;  2GOM A;  3R61 A;  4M9Z A;  5H20 A;  3I5U A;  3A0B C;  3W2W A;  3PUB A;  4XIC A;  1YHQ I;  2M1B A;  3KP5 A;  1P4A A;  2ZSH B;  3BR2 A;  3FMQ A;  3R6S A;  3T5X A;  4XK4 A;  1GXQ A;  1IN7 A;  2BY1 A;  4UVB A;  5EG0 A;  2LR8 A;  4EJV A;  4A3K J;  1AU7 A;  3DTK A;  3M07 A;  3RQI A;  3TQN A;  2H1K A;  2OZU A;  4BBR J;  4H0E A;  1Y0N A;  2N8G A;  3J7Z I;  2XSJ C;  4BYY A;  2R7R A;  1EH7 A;  2LFB A;  1U9O A;  3KZI C;  5HDK A;  2FA5 A;  4MTE A;  3VSK A;  5JR3 A;  3OYG A;  3CDI A;  4XN0 A;  3C2H A;  4ZDL A;  2VBX A;  3K4B A;  3KPH A;  2FOK A;  1F1Z A;  4JYK A;  3KP2 A;  3OS0 A;  3TMO A;  1R4N B;  3GZ6 A;  2ZJ2 A;  3ZMZ A;  4F55 A;  2VB6 A;  2W85 A;  3QYE A;  5K5O A;  5FLM J;  2DW4 A;  5CQG A;  1WCM J;  2G7U A;  2BY3 A;  2HU9 A;  3PFI A;  1MBJ A;  2J5O A;  3E3V A;  4A6D A;  4A3E J;  2LC2 A;  1LVK A;  1XD7 A;  3K0L A;  3MEX A;  4CYD A;  3F9K A;  3JRH A;  2RNG A;  1WJF A;  2HPM A;  3EYI A;  1APL C;  3ABL H;  4FE7 A;  2W84 A;  3D0S A;  4XON A;  3HOZ J;  2JPB A;  3HYI A;  3IH4 A;  1SC7 A;  5GAG J;  5J3L A;  3KZZ A;  4Y13 A;  3JRC A;  2P6T A;  5DTD A;  1KQ9 A;  1MMD A;  5HLH A;  1YS6 A;  4ABZ A;  1MDM A;  3BQY A;  4XOT A;  4BNC A;  2DTR A;  3SJM A;  3LSI A;  5D6E A;  4G6D A;  1X3W B;  3CUO A;  2MSY A;  3S15 J;  2ID3 A;  3F8N A;  4CZC A;  3OYA A;  2ZB9 A;  1AHD P;  1UHM A;  3V8L A;  3JRG A;  1I5Z A;  4HRI A;  1VQ9 I;  1JKQ C;  3DLL F;  3EQL F;  3H9G A;  3ZOB A;  3J7A Y;  3K7A J;  4EM1 A;  2D5V A;  4BY7 J;  2O7O A;  1R71 A;  1XSX A;  4JX6 A;  2ZO4 A;  3F3X A;  3LST A;  3NAR A;  4U0Y A;  2DJN A;  4RGX A;  4F92 B;  5HNH A;  2Z5U A;  3G1O A;  4G6Q A;  2PI0 A;  3VOD A;  3LWF A;  3F21 A;  3L2U A;  4FQG A;  5CYV A;  1B59 A;  2DXI A;  1PUF B;  1ZRD A;  2HQ5 A;  2M87 A;  3BJO A;  4EJU A;  3PNT A;  4PFO A;  1YYV A;  2E60 A;  2E1O A;  2KKO A;  3QP6 A;  5BS6 A;  4BE1 A;  1Y1W J;  3U1K A;  5K1Y A;  4A3B J;  1FOY A;  2DTZ A;  9ANT A;  3UNG C;  4BH9 A;  2EK5 A;  3L00 A;  2DU9 A;  1IRX A;  1REP C;  5IOY A;  2F4O B;  4XMY A;  5JFR A;  2VQH A;  1ZTR A;  4BQA A;  5AON A;  3ZCO A;  3MKL A;  4V2G A;  2K86 A;  2LBF A;  2LKX A;  2F5E A;  4PJJ A;  1B4A A;  4OIQ F;  2FMY A;  1B72 A;  1ZEL A;  3ZP5 A;  2VE9 A;  5LD2 C;  4LGW A;  2VLA A;  1KQ0 A;  5J40 A;  1I39 A;  2XRN A;  2GIZ A;  5K5R A;  2A5W A;  3WTZ A;  1EA3 A;  1WI9 A;  4HYE A;  3S14 J;  1OFC X;  1YI2 I;  5BPI A;  3WTX C;  4DYC A;  3OL3 A;  1XX5 A;  2V1X A;  3FXU A;  3B6A A;  2R93 J;  5CLS A;  1I6H J;  4I98 B;  2HQN A;  4HG2 A;  4BQQ A;  4D7M A;  4KIT B;  4GGG A;  1YW7 A;  2HPI A;  2K40 A;  1YE9 A;  2DDB A;  4BHP A;  4A3G J;  1U5T A;  2XAS A;  2A3S A;  2VL8 A;  3LAP A;  4P96 A;  1R49 A;  3GVA A;  1ZAR A;  3SZT A;  3LMM A;  3S3N A;  1B1B A;  4KT6 A;  5M3M J;  3N4M A;  3AFH A;  1RNL A;  1TW2 A;  4CCN A;  4YRV A;  1SAX A;  3CCU I;  3E5U A;  3BR3 A;  1T2K A;  2MD0 A;  2K9M A;  1JGS A;  3DKW A;  3F0C A;  3RQ4 A;  3QWL A;  2P0W A;  1JI8 A;  3DEE A;  4P5O A;  4IHT A;  4OAZ A;  4I6Z A;  5EF6 A;  4QSH A;  3DBH B;  3JW4 A;  1YX3 A;  4XRS G;  5JLX A;  5ICC A;  2XSD C;  1MMA A;  2NVT J;  3GTQ J;  2TCT A;  2WAQ A;  3Q0W A;  2Y48 A;  2DOF A;  1QGP A;  5F04 A;  1FZP B;  3TL4 X;  5JLW A;  2RKH A;  3IC7 A;  2OF7 A;  3KP6 A;  4DBR A;  1D0X A;  3QPH A;  1VZ0 A;  1TP4 A;  1MBG A;  2FXA A;  3DTE A;  1YO5 C;  4QPO A;  4JBA A;  1FC3 A;  1V4R A;  3UKG A;  3BCA A;  3M8E A;  4GO1 A;  4Y33 A;  4UHT A;  4CUG A;  2B63 J;  2VN2 A;  2J5P A;  1P7I A;  2ECB A;  1FT9 A;  4HZF A;  3WGG A;  5FD6 A;  1SFU A;  2EIJ H;  3HB9 A;  5JI6 A;  1FIA A;  1RR8 C;  1DGR M;  3OYH A;  4A3F J;  3CD6 I;  2CO5 A;  5C4X J;  2E34 A;  3MAJ A;  5GP9 A;  2LNB A;  5LGT A;  5IT9 K;  3FMS A;  3HJE A;  3QQA A;  1ZKG A;  2ELK A;  1W7P D;  3D5S C;  5E20 A;  2IS2 A;  1FBS A;  4ZYA A;  4DIQ A;  2L4M A;  1D0Y A;  1Z05 A;  2CQX A;  3FBN B;  3C18 A;  4IL6 C;  3MFK A;  4PCQ A;  5CJ9 A;  2DYR H;  2COM A;  2DOA A;  2QYO A;  3GF2 A;  2KJC A;  3BRO A;  1RPW A;  2AO9 A;  2L4A A;  3J7A O;  2OTJ I;  1XMK A;  3BTC A;  3BPX A;  2M4K A;  1YLF A;  4A2U A;  3QRF F;  2CV2 A;  2Z1D A;  1Z91 A;  2WV0 A;  3M7G A;  5FB2 A;  5EEA A;  4CCM A;  2PJR A;  2ECC A;  2V79 A;  2H94 A;  3BR5 A;  1RES A;  1H0M A;  4BU2 A;  4MQV A;  2HQA A;  1VQL I;  2A6T A;  3MWM A;  2O6G E;  3C2G A;  2W48 A;  5IY5 H;  1BM9 A;  4RMN A;  1WH7 A;  3G1L A;  4UV8 A;  4ON0 A;  3E6M A;  3BJ6 A;  4DYQ A;  1EKE A;  4U7B A;  1X3Z B;  4HSR A;  3K4J A;  4LIU A;  3CC4 I;  4PZJ A;  2JK3 A;  4FT8 A;  3EET A;  1JE8 A;  3DLA A;  1RKW A;  3WE3 A;  4CA0 A;  2PMZ N;  2L0K A;  1JKP C;  3G4S I;  2O9L A;  5ICF A;  1EH8 A;  2AQE A;  3SQN A;  1FLI A;  3JR9 A;  1QU3 A;  3GEZ A;  4JX5 A;  1Z6T A;  5D5X B;  1K7A A;  3ABT A;  4IRI A;  1SFK A;  2DA6 A;  1UCR A;  2R5Z B;  1J75 A;  3BTJ A;  1USS A;  4KIB A;  4AIJ A;  1AKH A;  4ENJ A;  2GWR A;  1YX5 A;  2NVX J;  1IDY A;  4XM3 A;  3HG9 A;  1Z7U A;  5LRR A;  4LLL A;  3C3W A;  1Y0U A;  3BG9 A;  3LSG A;  2TRT A;  1OQY A;  1V55 H;  4FTH A;  3E5X A;  1D1A A;  2FE3 A;  2OJE D;  3O6B B;  1TQM A;  3MVP A;  3MKZ A;  2NS0 A;  3HSF A;  2V1N A;  4KNY A;  3OWT A;  3ZQ7 A;  4XRM A;  2KPM A;  2LD5 A;  4X6A J;  1WVR A;  2L7Z A;  3HKZ A;  4S04 A;  1WWX A;  2ESH A;  1ETW A;  2K9N A;  5D4R A;  1VI0 A;  1FP1 D;  2DAO A;  4XKV A;  4UVC A;  3FK6 A;  4UVA A;  3ZN0 A;  1IF1 A;  2MBF A;  4WCG A;  1VQ8 I;  1ZQ3 P;  2LP0 A;  5FKO A;  4M74 A;  2EIN H;  2XGE A;  3K1M A;  1I3Q J;  2FNA A;  2JPC A;  4MHG A;  5L3G A;  1W36 C;  1DU0 A;  1R1U A;  2K02 A;  4HNV A;  4BHB A;  3CF5 F;  1JT0 A;  3JAM Z;  1NG7 A;  5L3C A;  5LBQ A;  4GXO A;  3S17 J;  2HVQ A;  1G3Y A;  3NEU A;  2FBK A;  5JVT A;  3R60 A;  2CFX A;  2K3P A;  4QWQ A;  3LFK A;  2X1C A;  2QUF A;  2YU9 J;  2E2I J;  3K2Z A;  3ASO H;  2WC2 A;  1CF7 B;  2FUG 2;  2L9R A;  2E71 A;  3S8P A;  2IBD A;  2CUJ A;  2LYC A;  1JJ6 C;  4KA4 A;  2CV0 A;  1ZK8 A;  2PEX A;  5FKM A;  4Z6Y A;  3B6C A;  2CUE A;  4WXC A;  1LE8 B;  1HW1 A;  2MW8 A;  4L18 B;  3RZO J;  4BDY A;  3FXJ A;  2QQ8 A;  3U9G A;  3JTG A;  1GV5 A;  5FLX Z;  4AVZ A;  3ECO A;  4YIF A;  1HXD A;  1LEA A;  1OCC H;  4M73 A;  1BIA A;  5HLG A;  1OCT C;  1ERD A;  2ICW G;  2K3F A;  3S16 J;  2CG4 A;  1H89 C;  3HOU J;  5FGM A;  2QBY B;  3S2W A;  1XG1 A;  2IGK A;  1ETO A;  4RLF A;  5J6X A;  4UUS B;  3BZ6 A;  1R5I D;  4LIV A;  4KMU X;  1N25 A;  3CCY A;  2W82 A;  1ZGW A;  1FOX A;  2MH2 A;  3KLN A;  3CF2 A;  2VIX A;  4ESB A;  2K85 A;  2JA7 J;  2XDV A;  2JA2 A;  1D8K A;  3U21 A;  3REO A;  4JK1 X;  3NQO A;  1XGO A;  4XKB A;  4XOR A;  3PO2 J;  1W4M A;  3WTV C;  2Q1Z B;  1FBQ A;  1XGS A;  3OR1 C;  3ABK H;  2JMW A;  2M5W A;  2Y31 A;  2QGU A;  2MD5 A;  3K4L A;  4Y15 A;  4PSX A;  2HTJ A;  2BBY A;  2ZXJ A;  3E1S A;  2EJR A;  2R7W A;  2P7V B;  3J81 K;  1MGT A;  2YSR A;  3FXM A;  2Y69 H;  3MZ8 A;  3N97 A;  3MQ0 A;  1T0F A;  4F93 B;  2DMU A;  2IS4 A;  4NC6 A;  3LSR A;  3GZ5 A;  3O3K A;  5HS7 A;  1AWC A;  3WTT C;  5M3F J;  4RDU A;  3QYB A;  2EPF A;  1POG A;  3OYL A;  2DOE A;  2EA2 A;  3DWL E;  2X1E A;  2DA3 A;  3OYM A;  4LB6 B;  4XLP F;  2E7X A;  2JUG A;  2LY1 A;  2FML A;  1N75 A;  2H27 A;  1VQO I;  1G3T A;  1KU7 A;  3QOP A;  3OYE A;  2EFP A;  1GVD A;  2NNY A;  4MIM A;  1V5E A;  2H8W A;  3LQR A;  1D5V A;  4RBO A;  2VOD A;  3SDG A;  3VYS B;  4CCK A;  1M1E B;  3BT9 A;  3CJT B;  3M8F A;  1BI3 A;  4HX4 A;  4L5J A;  3IKT A;  1KYW A;  1JHH A;  2PX9 A;  2B7E A;  4E7L A;  5E79 C;  1IGN A;  3RYP A;  2P6S A;  2RRE A;  3PQJ A;  5EGO A;  4V19 K;  2WWY A;  3WG7 H;  1DP3 A;  1KU2 A;  2PG4 A;  2V9P A;  1VND A;  2F4M B;  1DPR A;  2ACJ A;  1HDD C;  4BDZ A;  2DMT A;  4OIO F;  4A3L J;  5TRD A;  2BZT A;  2XAF A;  4HF1 A;  1FPQ A;  2IJL A;  2GLO A;  1MD0 A;  2NOG A;  2LRE A;  3GME A;  1QZE A;  1FMV A;  4RB0 A;  3KYL A;  3HHH A;  2I10 A;  3F6V A;  3CMM A;  1K6O A;  2XKP A;  3CDH A;  4XLH A;  2XGX A;  5FFX A;  4NQW A;  1QA6 A;  2XAJ A;  2V6E A;  4I01 A;  1B8I B;  1WI3 A;  3HGY A;  1WHU A;  4BEH B;  1SFX A;  2EWN A;  2O61 A;  1D1B A;  2HEO A;  5HLI A;  4OMY A;  4L9T A;  3ZMT A;  2HOS A;  5FKN A;  3K69 A;  3GLL A;  3W3C A;  1FTZ A;  1MBE A;  4WK8 F;  5GTI C;  3M1E A;  4O6J A;  1E3O C;  1K79 A;  4ZYD A;  3TP0 A;  2HFH A;  4C2T A;  4U0V A;  3RKW A;  2AHQ A;  3L2Q A;  3K4N A;  4L0Y B;  2VBW A;  1IN5 A;  2VUM J;  2VPL A;  3A03 A;  4LK1 F;  1LFP A;  1IV8 A;  4ESJ A;  1JKO C;  2X0L A;  5LGN A;  4I2O A;  2AXT C;  3W6K B;  2Z9O A;  4IJA A;  1Z1D A;  3G73 A;  4Y52 J;  1Z6R A;  3IH3 A;  2P5L C;  4E7I A;  2LDU A;  2OZ6 A;  3CCL I;  1I27 A;  5H2F C;  2DBB A;  1IN6 A;  1T33 A;  2FQ3 A;  2YU3 A;  4PJL A;  4EV0 A;  4Y7N J;  4XKC A;  1AOY A;  4D1Q A;  1ZG1 A;  2E1M B;  3K4C A;  2W57 A;  1W5S A;  1HW5 A;  3O8G A;  2KDO A;  3CES A;  4MGR A;  5AIP A;  5J8C A;  4NHJ A;  2LRD A;  4ZYH A;  1G59 A;  2ISZ A;  4TV7 A;  3SDB A;  2X6Y A;  2KLO A;  3ERE D;  2EFO A;  5KAI C;  4BJ5 C;  5AIQ A;  4MTD A;  3AL0 B;  2JQ7 A;  4DGW B;  2R5Y A;  3WU0 A;  1OCR H;  1Z21 A;  1LUJ B;  4WF2 A;  4E7Z A;  2OTL I;  2VC1 A;  3CP8 A;  2HYF A;  3L9F A;  2Y0S N;  1ZRF A;  1SD5 A;  1ETK A;  2A6E F;  2WB1 A;  2QSH X;  2VKD A;  1BR2 A;  1LDJ A;  5BPD A;  1ON1 A;  3GFM A;  3H0G J;  4QIW N;  1UZC A;  4BE0 A;  2E1M C;  3O8H A;  2C6Y A;  2BGC A;  5F0H A;  5DUK A;  2ZME B;  4XL9 A;  2DMN A;  2H6C A;  3I4P A;  3ZQH A;  4L5E A;  1HC8 A;  4KFC A;  3CCJ I;  3AL0 C;  1I3A A;  4UB8 C;  2HYG D;  2BYV E;  1FBU A;  2GOX B;  3L09 A;  3TW7 A;  3TW6 A;  3ROU A;  1W7P B;  3W6V A;  1FWZ A;  1Z3Y A;  4B48 A;  4GYG A;  1IRF A;  2OU2 A;  2L02 A;  2YR2 A;  3AG3 H;  2CH0 A;  3ZN1 A;  1VTN C;  1UST A;  2MGQ A;  2X48 A;  2CQQ A;  2PLY A;  3CC7 I;  1MMG A;  1FEX A;  4XLC A;  4X1E A;  4ZYE A;  3ABU A;  4FE4 A;  1XN7 A;  4M3F A;  2FU4 A;  2L9V A;  3B02 A;  1JGG A;  3ZQL A;  1YW8 A;  4ZYG A;  2R7Z J;  4MO7 A;  1E2X A;  2R7F A;  2Y9Z A;  3M4O J;  2ZME C;  4CZZ A;  1G2H A;  4AWX B;  2KP6 A;  2OPT A;  4L5I A;  3FDY A;  3DU6 A;  1E3P A;  3ASN H;  2QEX I;  4AM3 A;  5EG0 B;  5ILU A;  2IXS A;  3IUO A;  2ZNY A;  2EZH A;  1ZN2 A;  1XDU A;  1T6S A;  4BGD A;  1FP2 A;  5F1R A;  2K5C A;  3NWS A;  4R79 A;  5FKK A;  4HV5 A;  5HDN A;  3CUQ B;  4CH7 A;  4E70 A;  1OCO H;  3CCR I;  4BXU A;  2F5C A;  3BZC A;  3K4M A;  2I5U A;  3ESW B;  1O3R A;  1O3T A;  1IUY A;  1XPX A;  1T8I A;  5FJ8 J;  3ZR8 X;  2LKP A;  1VQM I;  2KFD A;  1ZAO A;  1RET A;  2VC0 A;  2GXG A;  3A0H C;  1TNS A;  1G8X A;  2HI3 A;  1ODD A;  4PGG A;  1YOV B;  5E3L A;  2UWM A;  2JRT A;  3M9A A;  2HZT A;  5A2Q Z;  3I71 A;  1P2F A;  3L1P A;  2H8R A;  4ESF A;  3LQQ A;  4S0H B;  3WTY C;  2L7F P;  5LLQ A;  1OJL A;  2R7V A;  4F91 B;  4CIC A;  4UUV A;  2O8X A;  4ITV A;  5K7Z A;  3EDP A;  3CUQ C;  1P4X A;  4A5M A;  2L7M P;  2F2E A;  1RC9 A;  1MBH A;  3OIQ A;  2CS3 A;  3CCV I;  4HF2 A;  2EV5 A;  2FQ4 A;  1XSV A;  1G3S A;  4R8H A;  2O5R A;  3N05 A;  2ISY A;  4V2F A;  1JJ8 C;  3KEO A;  1RIO H;  4N4N B;  4B47 A;  1FTT A;  2O0Y A;  1K6Y A;  1A36 A;  2HNH A;  2W00 A;  3FBI B;  3F8C A;  1TZL A;  2ZCW A;  1GV2 A;  4U7D A;  1DQU A;  4A12 A;  2DFI A;  1YRN B;  2OQR A;  2Y0M A;  3PSF A;  4II2 A;  5IYB J;  1MNE A;  1IN8 A;  3CTA A;  3PO3 J;  4EM2 A;  2DT7 B;  1JKR C;  2VE8 A;  2VOP A;  2M2E A;  3OSG A;  3EUA A;  3HC7 A;  1YJW I;  1BJA A;  3TBI A;  1MKM A;  3HPG A;  2BW3 B;  2PQ8 A;  1FSE A;  4YEL A;  2O03 A;  3BR1 A;  2EV0 A;  3OS1 A;  2WY8 Q;  4IO9 F;  4XR6 A;  3L2V A;  1WJB A;  5DDG A;  2F4I A;  1WH5 A;  2LBF B;  2ZFW A;  1LQ1 A;  4EMS A;  2D45 A;  5D5V B;  5HOO A;  5GAH J;  1EF4 A;  4OAY A;  3I4N J;  2AQF A;  3J80 K;  3V7C A;  5FKL A;  1K83 J;  1WJD A;  4DBQ A;  5HLT A;  2MYS A;  5E18 F;  4XQF A;  2YPR A;  2DT6 A;  1QHH D;  1ETV A;  3SEZ A;  2P5V A;  3TGN A;  5M5Y J;  4DZJ A;  2E5N A;  1QO0 D;  4IRG A;  2RQQ A;  4B43 A;  1HA8 A;  3H9J A;  4RA2 A;  5TJJ A;  5K7H A;  3S2D J;  5EEG A;  1MW7 A;  1ULY A;  1KU3 A;  1VQ4 I;  2OQG A;  3LA3 A;  1SFO J;  4EJO A;  3BG5 A;  5TGT A;  2E5Z A;  1A5J A;  1OPC A;  3JRB A;  3PM1 A;  4Q47 A;  2XB0 X;  2W25 A;  3ZMS A;  2F6C A;  3K1P A;  3COA C;  3JRF A;  5F1J A;  4XKW A;  1OR7 C;  1BC8 C;  4PGH A;  2X1D A;  2DPD A;  3DPU A;  1S5L C;  2FD5 A;  4AUX A;  3S1R J;  2JN6 A;  4ZTF A;  3CCE I;  1HOM A;  3HM5 A;  2OAZ A;  1J9I A;  4M71 A;  1W1W E;  2V7F A;  3H36 A;  3PJR A;  2RQP A;  4ZC3 A;  2CW0 F;  1LDK B;  4C30 A;  3HOT A;  4LJZ F;  1MBK A;  1VQN I;  3MCZ A;  5LEJ A;  1BI2 A;  2QVO A;  3BTI A;  3J7Y J;  1VQK I;  1J59 A;  1BI1 A;  1WJE A;  1RKT A;  2XAU A;  5DEQ A;  5KK1 A;  1BA5 A;  4CYC A;  3VFZ A;  2IGO A;  1ZHF A;  4IVN A;  4XSZ F;  1IXC A;  1PP7 U;  1SAN A;  2QWW A;  1WKM A;  3HSR A;  1H8A C;  2ZSI B;  4GCV A;  2BE5 F;  2DA1 A;  3A02 A;  1FOW A;  3GW2 A;  4C2M J;  1GHC A;  4BQN A;  2M0M A;  5L3B A;  3WU2 C;  5LHI A;  2STT A;  2DN0 A;  1DU6 A;  1BOB A;  1X4O A;  4B4C A;  1SAU A;  2WBM A;  2P8T A;  1ZG5 A;  4O3M A;  3M8J A;  4RAF A;  2WAQ N;  5H6R A;  4YFX F;  2WA0 A;  4YG2 F;  3MN2 A;  4HF0 A;  2LVS A;  4IOA F;  1UB9 A;  3DEW A;  4CDG A;  2M34 A;  3GWZ A;  3QPL A;  5K5Q A;  2DCE A;  4Y4R A;  3CCQ I;  2HTS A;  4ENK A;  4M3B A;  2LTP A;  4HQM A;  4EEF G;  3MKY B;  1ORK A;  4OIP F;  4FCY A;  2HVR A;  2V6C A;  5FFZ A;  1N77 A;  4EAT A;  4P9F A;  2YS9 A;  5GAE J;  3WTS C;  1X1C A;  3X2Q H;  4H4K C;  1O7F A;  5FRO A;  4I99 C;  1R7J A;  2GA2 A;  3GUD A;  1RI7 A;  1G3W A;  3ZMV A;  3S1N J;  3PNY A;  3V4G A;  4RM2 A;  2VQG A;  1V3F A;  1DUX C;  2JA6 J;  2R7O A;  1KON A;  2CV1 A;  3PSI A;  1L0O C;  1R1T A;  2JVG A;  1X1P A;  1A35 A;  3KX2 A;  2DFF A;  2ELJ A;  2HDD A;  3C2B A;  3E0J B;  2PJR B;  1IXR C;  3HPH A;  4AID A;  5E8I A;  3PL8 A;  4ZH4 F;  1K4S A;  5D4S A;  5LEK A;  1S6L A;  3QYF A;  4I09 A;  1JUP A;  2JVH A;  5B66 C;  5FD5 A;  4PSW A;  1R5H A;  2MA3 A;  3G71 I;  2DFH A;  2FBH A;  2D1V A;  2LY9 A;  2WAE A;  3SZP A;  1BC7 C;  1X1A A;  3DBR B;  3NWT A;  3P9C A;  3ML6 A;  5DM6 F;  2XAH A;  3T0Y A;  2D1H A;  3LL7 A;  4ZZD A;  4EGZ A;  4BS9 A;  2XKO A;  4GRI A;  4DJA A;  3ZMU A;  2ETH A;  2Q2E B;  2WTE A;  5E17 F;  3BP8 A;  5D6F A;  5D8K B;  1ZLJ A;  4HNT A;  4HAM A;  2L2O A;  5J4V A;  1UEL B;  2X85 A;  3CP2 A;  1TWC J;  4A3M J;  3HUG A;  3C7J A;  4BKX A;  1VF9 A;  3IRQ A;  1SD7 A;  3KYC B;  3FMR A;  2CU7 A;  3EUH A;  1BW6 A;  2CQN A;  2CSO A;  5GPC A;  2WY7 Q;  2EH3 A;  1S72 I;  1O3S A;  4A3D J;  1IN4 A;  1KYZ A;  1SVL A;  4G7Z F;  3RJP A;  1LEB A;  1ETQ A;  2BHY A;  3OMY A;  3DBL B;  3R4K A;  3BOQ A;  5C4J J;  3LSP A;  2P4W A;  3JRI A;  2ZXW H;  4NBQ A;  2ZNZ A;  4FAS D;  4HBL A;  2FJ1 A;  1ZG3 A;  2QF7 A;  5TIS C;  3SXY A;  3G6E I;  1AKH B;  3A1Y A;  3F6O A;  5EEH A;  1RRJ A;  3DPL C;  1TWG J;  2A5Y B;  2HQR A;  1VQ5 I;  3FWE A;  4KUM A;  2M8G X;  3HRT A;  3PIP F;  1X2N A;  3HOV J;  2F5F A;  5CPR B;  2LSO A;  4OOI A;  3I55 I;  3RZD J;  3H5R A;  4AVP A;  3QPT A;  4I7H A;  3OYC A;  2RNJ A;  3S93 A;  1GT0 C;  1XSD A;  1QZY A;  1PDN C;  2GM4 A;  3I56 I;  3LSM A;  4ENN A;  3F72 A;  1YIT I;  3GO5 A;  3S32 A;  1JHF A;  4IHS A;  1BL0 A;  3W6J B;  3PUF A;  3KEY A;  4IRH A;  3LA7 A;  2DYS H;  3BCB A;  1XMA A;  3H0D A;  4AC0 A;  1ZRE A;  3FXK A;  1I50 J;  5KCM A;  3HKZ N;  1FYK A;  1SD4 A;  4C2U A;  3FIS A;  3H5A A;  2CYY A;  2GAU A;  2W7N A;  2NOJ B;  2KDZ A;  1FJL A;  4EVI A;  3C1D A;  1TWF J;  1D3Y A;  2DMQ A;  3QU6 A;  3ZGK A;  3FK7 A;  1HF0 A;  2XF6 A;  5LHH A;  5ED4 A;  2RV8 A;  3MMY B;  3VYU B;  1PP8 F;  4FET A;  4IEJ A;  4IPA A;  2XHK A;  5D5W B;  3H3V K;  1PYV A;  4UUS A;  2MLG A;  4DYR A;  5EDN A;  3JRD A;  2GIV A;  2Z16 A;  1MSE C;  3S3O A;  3CC2 I;  4NUB A;  2K9L A;  3GTG J;  5ICE A;  3CDL A;  3I59 A;  2PJP A;  5E3M A;  3HXL A;  2FEZ A;  4W97 A;  4XRS A;  2OBP A;  5H6Q A;  3L2R A;  2MFZ A;  2E1N A;  1FSH A;  4YII A;  2XV4 S;  2RAE A;  1P9Q C;  2CUZ A;  2STW A;  2A61 A;  2XPW A;  2H1L A;  5IOZ A;  3KFW X;  1U3E M;  3E6B A;  1QNT A;  5E3N A;  1ZYR F;  1TWH J;  1UHW A;  1SFE A;  1XGM A;  3RTR A;  3LAJ A;  2EV6 A;  1Z3X A;  2IVM A;  2ZC2 A;  3DPT A;  1V54 H;  4A93 J;  5DCF A;  1DP7 P;  2RVC A;  1TW3 A;  4A5N A;  2LF7 A;  3WGI A;  1MBF A;  3F8F A;  4XOP A;  5ILS A;  1B9M A;  1JTY A;  2HKO A;  1IDZ A;  3DEU A;  2NS8 A;  3IAS 2;  3OYJ A;  2R92 J;  1WJA A;  5DCM B;  3QAH A;  4U0W A;  1R36 A;  3ABM H;  5CVI A;  3HEF A;  2G7H A;  3WG9 A;  1YS7 A;  4E7S A;  1STZ A;  2XPV A;  2EFW A;  1U8B A;  4R1H A;  3HSE A;  4MQ9 F;  1K78 A;  4KMF A;  1S9H A;  3P9K A;  3NRV A;  4HLX A;  1EV7 A;  2DA4 A;  5J47 A;  2QKM B;  1GVJ A;  2KIF A;  4PK4 A;  2M3A A;  1LJ9 A;  3WHB A;  1IZ1 A;  2VT2 A;  3RKX A;  4GFB A;  2RGV A;  4L9V A;  1L3L A;  2XGD A;  3I3L A;  4MFD A;  3DU5 A;  3OR2 C;  2JUC A;  2VJJ A;  4HA8 A;  2E35 A;  4DOZ A;  3SHF A;  3GZN B;  3H3Z A;  3F22 A;  2X51 A;  4D5C A;  2G0E A;  3IRR A;  3GFJ A;  5IYD J;  4LB5 A;  1NTC A;  3OYF A;  2EZK A;  1SEU A;  3F23 A;  3DFG A;  3WTU C;  2CW7 A;  4G7H F;  5KNL A;  1C0W A;  5C44 J;  2QSG X;  1R4M B;  3DV8 A;  2Y75 A;  1ZGA A;  5EJC A;  1F43 A;  2W4S A;  4UB6 C;  4XLF A;  1CQT A;  2PBI A;  4CGZ A;  2XGC A;  4XBF A;  2X9D A;  4CXF A;  4YFN F;  5BQT A;  2BXZ A;  4CCO A;  3ULQ B;  1KU9 A;  2JT1 A;  1ZLK A;  4LG0 B;  1DGW Y;  3FKI J;  3Q5F A;  4YIR X;  1CGP A;  1T0F C;  2OCC H;  2RC4 A;  4BE2 A;  4KDP A;  3A01 A;  3RI4 A;  3HRS A;  4HW0 A;  4C3I J;  2KIU A;  4KT5 C;  1J0R A;  3QU3 A;  3IH2 A;  3ERM A;  2LY2 A;  2Q8K A;  3HTS B;  3HHG A;  3K1N A;  5KAF C;  1UMQ A;  5CQE A;  2DMP A;  3BY6 A;  2X6X A;  5B1A H;  2NNN A;  2CJJ A;  4D5F A;  1SMT A;  3LSH A;  4M6X A;  2KMU A;  3WGH A;  1NK2 P;  1ZR2 A;  1A6Q A;  4GYI A;  1KQ8 A;  3KEQ A;  4HV6 A;  4G8X A;  3V42 A;  5BNG A;  2V9K A;  5EZG A;  1FYM A;  1MMS A;  2KJB A;  4RGR A;  2EA4 A;  2V9V A;  3JAM K;  3W2V A;  2MG4 A;  4G6T B;  1IRZ A;  2NVY J;  3GLX A;  3K6G A;  2LH9 A;  1B6A A;  2WV1 A;  4KN4 X;  4RGS A;  1FYL A;  1TL8 A;  3JCU C;  3F8M A;  3E5Q A;  3HTU A;  2K7L A;  2PMU A;  3AG1 H;  3FZV A;  3HL2 A;  4HQE A;  4J00 A;  4J19 A;  3OYN A;  2V26 A;  1R58 A;  2P5K A;  4IOC F;  1BR4 A;  1TNT A;  1GDT A;  1UJ8 A;  1S3J A;  4AYB A;  3RDI A;  4BXX J;  4KYW A;  1FIP A;  1XMX A;  2LK2 A;  3SYT A;  2CRG A;  3OY9 A;  1R00 A;  1S29 A;  3H1C A;  1ETY A;  4ETS A;  3OYK A;  5GTH C;  2DFE A;  1NH3 A;  3NAU A;  1R6R A;  4M3E A;  1EH6 A;  2WAF A;  3KP4 A;  3S2H J;  1BJZ A;  3CLO A;  2E19 A;  1HKS A;  4KN7 X;  5BMZ A;  4IHX A;  4BL0 B;  5FLX K;  3TED A;  1YIJ I;  3KIO A;  2W24 A;  1Y8Q B;  2IW5 A;  1OMI A;  5B3S H;  1MJ9 A;  2HYJ A;  2A6H F;  3HOS A;  1S7E A;  1R22 A;  3V8J A;  3DKY A;  1BBY A;  4BAC A;  1W0U A;  1JUM A;  3CQZ J;  4JQF A;  2KIS A;  2F5D A;  1MH3 A;  2GZW A;  3EPZ A;  5L3D A;  1WJC A;  3CMA I;  2ZJP F;  4WXD A;  4QLC U;  2FNP A;  1W7P A;  4LMY A;  2JA5 J;  3VSL A;  5E1Z B;  2XB5 A;  4J01 A;  3HOW J;  4MFE A;  3VWB A;  2OCE A;  4IHY A;  2GA1 A;  2E1C A;  3WOD F;  3OOU A;  3BDD A;  1IRG A;  3BJA A;  4Y17 A;  2MC4 A;  5F08 A;  3BWG A;  2COB A;  2E36 A;  2BHZ A;  1X3U A;  4BXF A;  1X58 A;  2IAI A;  6PAX A;  2FRH A;  2VKV A;  2VJI A;  3KLO A;  4EJT A;  3ZQQ A;  1WZ2 A;  3GFL A;  4N0B A;  1AA7 A;  3TKY A;  2M8E A;  3K70 D;  4BY1 J;  1YW9 A;  2V4J C;  3K9T A;  2FOW A;  4UUT A;  1O57 A;  1U0J A;  1MJB A;  4I0A A;  2L5Q A;  2PMH A;  3VYT B;  3FXL A;  2VJ4 A;  4NC7 A;  2ZXI A;  3H92 A;  3ECH A;  3KE2 A;  2L01 A;  2WB1 N;  4XN3 A;  2EQR A;  1TTY A;  4PJ0 C;  2IEK A;  2XUB A;  2K9S A;  4I0B A;  2CW8 A;  2ELH A;  1XTA A;  2NXN B;  2OUM A;  3D5L A;  1J5Y A;  3LSJ A;  1XCB A;  3CUQ A;  5IT9 Z;  2D2W A;  2IPQ X;  3V8K A;  4B44 A;  4AIH A;  2HDC A;  3ZXS A;  4C3H J;  5HVQ C;  2A68 F;  2I8D A;  3EYY A;  5GPA A;  1XC5 A;  4M3D A;  1FX7 A;  2DK5 A;  4XLA A;  3SFZ A;  3GX4 X;  3JSP A;  1V5F A;  1MIJ A;  1DPU A;  2DK8 A;  4KIS A;  3HRM A;  2QQB A;  3MD2 A;  3VPR A;  1W5T A;  2HXI A;  3VYR B;  4EM0 B;  2JJ7 A;  4RGU A;  3OIO A;  4CCL A;  4A0X A;  4BHC A;  3FHN A;  3PFY A;  4DQ2 A;  3QP5 A;  1ITY A;  4G94 A;  3JRE A;  5F0C A;  3I53 A;  3CMY A;  5FRM A;  2Y30 A;  4O5V A;  3V7R A;  2XF5 A;  1PUF A;  1PUE E;  3WTW C;  4EQQ A;  2L9S A;  3IKV A;  4CSW A;  1TC3 C;  4A3I J;  1SVM A;  3Q0U A;  1MND A;  2F48 A;  2UXX A;  3JTH A;  2RDP A;  2IP2 A;  4ZDP A;  1IW7 F;  1MDM B;  3ONQ A;  2HXO A;  3BQZ A;  2GXA A;  1OCZ H;  3OYI A;  3D5R C;  2OA4 A;  1R5G A;  3PIO F;  1F4K A;  5JHU A;  2F5V A;  2CFO A;  1Y56 A;  4RAG A;  1YTY A;  2EIM H;  2Z33 A;  2ZFU A;  3Q9S A;  1YQA A;  3O2P E;  4BJ6 C;  2JSC A;  3S1Q J;  1QQI A;  3FXQ A;  4RAZ A;  2XC7 A;  1YRN A;  1X4P A;  3BR6 A;  1VQP I;  1K61 A;  3AKZ A;  4FX4 A;  4Q5S F;  1Y8R B;  3DQV C;  1UAA A;  2Z99 A;  2HVS A;  1F9N A;  5DV5 A;  1HCR A;  3U1D A;  2NS7 A;  5D5U B;  1TLH B;  1RZ4 A;  2DI3 A;  4A6E A;  1LDD A;  2DDA A;  4AU7 A;  1OKR A;  1Z67 A;  3HOY J;  2R4G A;  2VT3 A;  2DA7 A;  3CCS I;  4E7J A;  3B73 A;  2VPR A;  4OWR B;  4LLN A;  3L2W A;  5J1Y A;  1XDS A;  2BW3 A;  2JZY A;  4L0Z B;  1TQP A;  2HGC A;  4XLN F;  3HDD A;  3SEQ A;  4ANJ A;  2M0C A;  4BBS J;  3RYR A;  2ID6 A;  3AG4 H;  5EZH A;  2E7W A;  1JXS A;  2GXB A;  1HSJ A;  3PQK A;  1SVO A;  5ILV A;  4W1U A;  2ZJQ F;  3OYD A;  1GLN A;  4RAY A;  4OU0 A;  1OR7 A;  2KRF A;  2M30 A;  2QZ8 A;  3CZ6 A;  5DS9 A;  1B72 B;  4PJM A;  3K4K A;  4M9X A;  2P81 A;  5D8L B;  3OV8 A;  1IO2 A;  4UV9 A;  2LOO A;  1I1G A;  3CCM I;  1HDP A;  1WGX A;  3ZQI A;  1WSU A;  4IX7 A;  1E3H A;  1MJA A;  4F52 A;  2B0L A;  4XLE A;  1OYI A;  5LHG A;  4IF4 A;  2ADU A;  2KZV A;  4EJW A;  2X6W A;  4Y3O A;  2ZXH A;  4C3J J;  2KIM A;  2FX0 A;  1T56 A;  3WU1 B;  2QKL B;  5DD4 A;  5J1U A;  1Z9C A;  4NDL A;  1PJR A;  3RKY A;  4ENM A;  3GXO A;  3TOB A;  3GFI A;  3GTM J;  3GTL J;  4ZJZ A;  1TBX A;  3V7S A;  3OSF A;  1QZZ A;  4L9N A;  1U5T B;  1HKQ A;  1BW5 A;  5IYC J;  2W1O A;  3RKQ A;  2CUF A;  2M9H A;  3BG6 A;  2CQ7 A;  2EIL H;  2VXD A;  4G7O F;  4K2E A;  1JUS A;  2XIG A;  2A69 F;  2TDX A;  1Y1V J;  3BZK A;  2DQL A;  1O7L A;  2X4H A;  3KYD B;  2BV6 A;  5LGU A;  4B8X A;  4RM3 A;  3F8B A;  5IP9 J;  2NAZ A;  3BG3 A;  3K10 A;  2BXY A;  2HS5 A;  3G2B A;  2FSW A;  3KP7 A;  1H9T A;  1UHS A;  3IAM 2;  2CGP A;  4Q4Z F;  4OIR F;  1U5T C;  4IKF A;  1NHA A;  2YX7 A;  2KT0 A;  3GTP J;  2R7S A;  4P9U A;  2PFB A;  2DJI A;  3I64 A;  2ZJR F;  2MH9 A;  1HBX G;  1OYW A;  4AIK A;  1ZRC A;  1X2M A;  2QQ9 A;  3L2C A;  2AS5 F;  4BAY A;  3ZQG A; 
#chains in the Genus database with same CATH homology
 3LSI A;  5KCM A;  3UR3 C;  4C2U A;  3H5A A;  4BEH B;  3S3M A;  2W7N A;  2NOJ B;  4CZC A;  1D1B A;  2R7Q A;  3OYA A;  4HRI A;  4PFP A;  3ZGK A;  3W3C A;  2XF6 A;  4BUP A;  3H9G A;  3J7A Y;  3A2K A;  3MMY B;  3H5N A;  3VYU B;  4C2T A;  3EUK L;  2IS1 A;  4FET A;  2PMZ A;  5FRN A;  1PYV A;  3ZRG A;  2KQR A;  3L2Q A;  3K4N A;  4F92 B;  4JOM A;  4CCJ A;  5HNH A;  4IQ4 A;  2VPL A;  1LFP A;  2Z16 A;  3L2U A;  3FKJ A;  3S3O A;  2XF7 A;  3H35 A;  2DXI A;  4NUB A;  2K9L A;  4HEA 2;  3PNT A;  4PFO A;  4E7I A;  2E60 A;  4BE1 A;  3HXL A;  1QHG A;  3L2R A;  2MFZ A;  3PNV A;  4PJL A;  3UNG C;  4XKC A;  4D1Q A;  1P9Q C;  2CUZ A;  2E1M B;  1IRX A;  3K4C A;  2KDO A;  3CES A;  2VQH A;  4XMY A;  2LRD A;  1G59 A;  3ZCO A;  4BQO A;  3SDB A;  2LBF A;  2X6Y A;  2KLO A;  4PUS A;  4PJJ A;  3RTR A;  1Z3X A;  3DPT A;  4BJ5 C;  4XNF A;  3AL0 B;  1ZEL A;  4DGW B;  5JHF A;  5LD2 C;  4XOP A;  1Z21 A;  4E7Z A;  2VLA A;  3CP8 A;  3IAS 2;  3OYJ A;  2A5W A;  1EA3 A;  1WJA A;  4QPQ A;  2WB1 A;  1J09 A;  2VKD A;  1BR2 A;  3OL4 A;  3OL3 A;  4E7S A;  4BE0 A;  2E1M C;  2OV7 A;  1MMN A;  4XL9 A;  1S9H A;  4HG2 A;  4BQQ A;  4KIT B;  4LIT A;  4F3Q A;  3MKW B;  3BC8 A;  2HPI A;  3AL0 C;  2QKM B;  1YE9 A;  2GOX B;  2VL8 A;  4PK4 A;  2M3A A;  4YEJ A;  1Z3Y A;  4B48 A;  4X0G A;  2CH0 A;  3I3L A;  3DU5 A;  3OR2 C;  1MMG A;  3LMM A;  4XLC A;  3S3N A;  1LKX A;  4BJT A;  4KT6 A;  3BLY A;  2VJJ A;  4U87 A;  4DOZ A;  3AFH A;  4CCN A;  4LG3 A;  2M4G A;  4YRV A;  2X51 A;  2MD0 A;  2K9M A;  3RQ4 A;  2IS6 A;  3OYF A;  2P0W A;  3HUG B;  1Y6I A;  2KP6 A;  3DEE A;  1JI8 A;  3LFU A;  4P5O A;  4E7K A;  2CW7 A;  4OAZ A;  5KNL A;  3FDY A;  2WAD A;  3DU6 A;  4PJN A;  2W4S A;  4XLF A;  1YX3 A;  2KHM A;  4IQJ A;  2MAB A;  1MMA A;  1X19 A;  2IXS A;  4CCO A;  2WAQ A;  2HZD A;  3IUO A;  1DGW Y;  2KRH A;  4BGD A;  2K5C A;  3NWS A;  3TL4 X;  1T0F C;  4BE2 A;  4R79 A;  4DBR A;  1D0X A;  1X1B A;  1VZ0 A;  4CH7 A;  3DTE A;  4QPO A;  3K4M A;  2LY2 A;  3BCA A;  3BG7 A;  4Y33 A;  4CUG A;  3ZR8 X;  5CQE A;  4E4H A;  2X6X A;  3EUH C;  1FMW A;  1OLT A;  1G8X A;  4HPQ A;  2UWM A;  3LSH A;  1DGR M;  3OYH A;  2KMU A;  4KJZ A;  3D5S C;  2IS2 A;  4ZYA A;  4DIQ A;  5HNF A;  3V42 A;  1D0Y A;  2R7V A;  3FBN B;  2V9K A;  4F91 B;  4ITV A;  2IGN A;  3W2V A;  4G6T B;  3K6G A;  2LH9 A;  3OIQ A;  2CS3 A;  2DOA A;  2VQL A;  3HL2 A;  2Z2S B;  4J00 A;  4MLO A;  4P1W A;  2IGM A;  2O5R A;  3OYN A;  2V26 A;  3N05 A;  2M7B A;  3RCO A;  1BR4 A;  2M4K A;  4N4N B;  4B47 A;  2CV2 A;  2Z1D A;  2PJR A;  1K6Y A;  4CCM A;  4AYB A;  2HNH A;  2W00 A;  3LSK A;  3SYT A;  3FBI B;  1T95 A;  3OY9 A;  4BU2 A;  1TZL A;  2HQA A;  2L9N A;  4D9J A;  2A6T A;  1V5G A;  4NC8 A;  3OYK A;  3C2G A;  1DQU A;  1R6R A;  1Z7L A;  4RMN A;  3PSF A;  2BVM A;  3DTI A;  5CKT A;  3QOE A;  4II2 A;  2WAF A;  1MNE A;  4U7B A;  4HSR A;  2VJ5 A;  3K4J A;  4LIU A;  4BL0 B;  3DLA A;  3K70 C;  2DT7 B;  2OC6 A;  4CA0 A;  3EUA A;  3HC7 A;  3H9Q A;  1UG0 A;  3HOS A;  3TBI A;  2AQE A;  3DKY A;  4BAC A;  3HPG A;  2BW3 B;  4JQF A;  4YEL A;  3EPZ A;  2R7U A;  1WJC A;  1QU3 A;  2R7X A;  3OS1 A;  2WY8 Q;  4XR6 A;  3L2V A;  1WJB A;  2F4I A;  3VDX A;  2LBF B;  3VSL A;  1SFK A;  4J01 A;  3VWB A;  5HOO A;  4OAY A;  5KHD A;  4C9Y A;  3QOD A;  2AQF A;  2M7A A;  3OOU A;  2UUZ A;  1WJD A;  2MC4 A;  3DKX A;  4DBQ A;  2MYS A;  5HLT A;  4XQF A;  1YX5 A;  2DT6 A;  1QHH D;  2HDW A;  4BXF A;  2VXZ A;  4XM3 A;  3HG9 A;  3SEZ A;  2VJI A;  2E5N A;  3ZQQ A;  2BOL A;  3OYB A;  1AA7 A;  3K70 D;  3LSG A;  3RSN A;  2RQQ A;  4B43 A;  1D1A A;  2V4J C;  1D0Z A;  3H9J A;  1HA8 A;  1U0J A;  1MW7 A;  3MKZ A;  2L5Q A;  2V1N A;  3OWT A;  3VYT B;  2KPM A;  5TGT A;  2VJ4 A;  4NC7 A;  2E5Z A;  2ZXI A;  3HKZ A;  3OS2 A;  4XN3 A;  3CJR B;  2F6C A;  4XKV A;  2CW8 A;  2OUM A;  3D5L A;  4XKW A;  1OR7 C;  2X1D A;  2KRC A;  3DPU A;  4HST A;  3CJQ B;  3SZG A;  4B44 A;  1WJ5 A;  1W36 C;  3ZXS A;  4B3X A;  4BEH A;  5HVQ C;  4ZTF A;  1N78 A;  1BR1 A;  2I8D A;  1NG7 A;  4XLA A;  3W2A A;  2V7F A;  3PJR A;  3IP4 B;  4ZC3 A;  1LDK B;  1V5F A;  2HVQ A;  4C30 A;  4E6K G;  3HOT A;  2BVL A;  4KIS A;  1E0E A;  3OIP A;  2K3P A;  2UV1 A;  3MD2 A;  2R7T A;  2X1C A;  1WJE A;  2XAU A;  3VYR B;  4CCL A;  2IGO A;  3FHN A;  3PFY A;  4HNU A;  1WFX A;  2FUG 2;  3S8P A;  4E7H A;  2CUJ A;  2LYC A;  2ZSI B;  3GBG A;  5FRM A;  2XF5 A;  2CV0 A;  4ZDO A;  4BQN A;  2M0M A;  2L9S A;  1BOB A;  1X4O A;  1TT0 A;  4N4O B;  1SAU A;  4NQW B;  2WBM A;  4CSW A;  2VKH A;  1W36 D;  1MND A;  4ZDP A;  2KL4 A;  4NNJ A;  3ONQ A;  4BDY A;  3OYI A;  3D5R C;  3M8J A;  3RPU D;  2L7K A;  4AVZ A;  2WA0 A;  2F5V A;  2CFO A;  1Y56 A;  3M1C A;  5LFA A;  2Y0S A;  1NG6 A;  1D1C A;  2ZFU A;  4BJ6 C;  1ERD A;  2DCE A;  4Y4R A;  4ZTJ A;  2XC7 A;  3MKY B;  1X4P A;  2JSP A;  4RLQ A;  3AKZ A;  2CMP A;  2HVR A;  1X1D A;  3DQV C;  1UAA A;  1N77 A;  2HVS A;  4EAT A;  2IGK A;  4II3 A;  1X1C A;  4RLF A;  4LIV A;  4H4K C;  5FRO A;  2VQC A;  2W82 A;  4AU7 A;  3I9V 2;  2R4G A;  3PNY A;  4E7J A;  4RM2 A;  2VQG A;  3CF2 A;  4OWR B;  2VIX A;  3L2W A;  2R7O A;  1KON A;  2BW3 A;  2CV1 A;  3PSI A;  2XDV A;  2JA2 A;  2LG4 A;  2JVG A;  3SEQ A;  3U21 A;  3KX2 A;  2ELJ A;  4XKB A;  4XOR A;  4ANJ A;  2Q1Z B;  2VAS A;  3E0J B;  2PJR B;  3OR1 C;  3HPH A;  3PL8 A;  3QYF A;  3K4L A;  2JVH A;  4PSX A;  3OYD A;  1GLN A;  4PSW A;  3E1S A;  3A4C A;  2R7W A;  3CZ6 A;  2WAE A;  1X1A A;  3NWT A;  4PJM A;  3K4K A;  3LL7 A;  4IZZ A;  4F93 B;  2IS4 A;  2GOM A;  4BS9 A;  4GRI A;  4DJA A;  2LOO A;  2Q2E B;  3W2W A;  3PUB A;  4HNT A;  2L2O A;  4IX7 A;  4F52 A;  1UEL B;  2X85 A;  3CP2 A;  3QYB A;  3OYL A;  2ZSH B;  4XLE A;  3DWL E;  2X1E A;  2KZV A;  2X6W A;  4Y3O A;  2ZXH A;  2JUG A;  2LY1 A;  2WY7 Q;  2QKL B;  1N75 A;  1PJR A;  3DTK A;  3OYE A;  3OMY A;  4ZJZ A;  1V5E A;  2XSJ C;  2R7R A;  3VYS B;  3VSK A;  4CCK A;  3OYG A;  4ZDL A;  4XN0 A;  3C2H A;  4FAS D;  2W1O A;  3K4B A;  4E7L A;  3A1Y A;  3DPL C;  3OS0 A;  3TMO A;  2RRE A;  3BG6 A;  2VXD A;  4F55 A;  2VB6 A;  1DP3 A;  3QYE A;  5CQG A;  2HU9 A;  5CPR B;  4BDZ A;  3H5R A;  4RM3 A;  3OYC A;  2LC2 A;  1LVK A;  3K10 A;  3S93 A;  3F9K A;  3G2B A;  2RNG A;  1WJF A;  2HPM A;  2LRE A;  1FMV A;  3LSM A;  4XON A;  3IAM 2;  3KYL A;  4IKF A;  3S32 A;  3CMM A;  2R7S A;  2DJI A;  4XLH A;  3KEY A;  1MMD A;  3BCB A;  3H0D A;  2V6E A;  4XOT A;  3OYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...