1R6RA

Solution structure of dengue virus capsid protein reveals a new fold
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
b'NRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Solution structure of dengue virus capsid protein reveals another fold
pubmed doi rcsb
source organism Dengue virus 2 puerto rico/pr159-s1/1969
molecule tags Viral protein
total genus 20
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1r6rA00
1R6RA 1SFKA
chains in the Genus database with same CATH superfamily
3FDYA 3LOCA 2OPTA 3K2ZA 3VODA 1AA7A 3ERED 2AS5F 2CGPA 2OCCH 2OQGA 4XM3A 5C4JJ 5JHFA 4L18B 2DOAA 2X6OA 2FMYA 3GFJA 2KMUA 3MZ8A 3CJQB 4DW6A 1OISA 2WB1N 3V7CA 4IJAA 3GWZA 1HOMA 4KIFA 4FE4A 2VJJA 3BG6A 1UG0A 3JAMK 2O61A 3LNQA 5ICFA 2QBYB 1R7JA 2HS5A 3PSIA 1Z77A 2OD5A 5HS8A 1QU3A 2GOMA 4CCOA 1XGOA 3MWMA 3HJEA 1K78A 2DA5A 3M8EA 4HF0A 5M3MJ 3IL2A 1Y0UA 3GYHX 1BBYA 5H6RA 5LGTA 2MGQA 2FOWA 3FXOA 2ACJA 2A07F 3RPUD 4KUMA 2H6CA 2DJIA 4HQMA 1MMSA 2Z33A 2HNHA 1MMNA 4BACA 3BR5A 1XPXA 5ILVA 3CP2A 2DOEA 4DQ2A 3LAPA 4FT8A 2E1MC 4U7BA 3LSMA 3D5SC 4ENJA 1VZ0A 3F3XA 2V1DA 3BZKA 4QPQA 3I4MJ 2CQXA 1DGRM 2LG4A 2OTJI 1BOAA 1V4RA 2GOXB 1X2NA 1HW2A 1WJEA 1WCMJ 3HXLA 3LWFA 3KP6A 3SEZA 3QQAA 2QSGX 1FBUA 2E2HJ 2R4GA 5IOYA 9ANTA 3F6VA 4RA2A 5FJ8J 3BCBA 1WJ5A 2WBMA 4IRIA 5EG0A 3JR9A 4WWCA 2KFDA 3W6VA 2VL8A 3EDPA 4E7JA 2VJIA 1DGWY 5DD4A 1BR1A 2DYRH 4OIQF 1KQ9A 3F6OA 4RM2A 4Y17A 4M73A 1Y56A 1X1AA 3LL7A 4HYEA 3S3MA 4R79A 2HDDA 4IRHA 3KEQA 2I5UA 1JJ6C 1Y1WJ 4AC0A 1HKTA 5JLWA 2B7EA 3REOA 1X3UA 4V19K 4KA4A 2FX0A 3F8BA 4EJTA 3J7AY 2EWNA 2KDOA 1U6GA 3FXMA 1BM9A 3FZVA 4YFNF 1SAXA 2ZSHB 4TV7A 2GBYA 2JZYA 1D0ZA 3LSJA 3M8FA 1YW9A 3TL4X 4C3HJ 3BZCA 4EJOA 1MIJA 3SZGA 3EUHA 5J8FA 3OOPA 1Q1HA 2BW3B 2GAUA 2ID6A 2DW4A 2WADA 1YX3A 4RLFA 2R7ZJ 2ZB9A 3HC7A 3WU0A 2QENA 1XSDA 4RAFA 3QOEA 1ZKGA 2NOJB 5TRDA 4B1RA 1WJCA 3B6CA 3BDDA 3BPXA 1S6LA 2A61A 5E79C 1IXRC 4AYBN 4AVZA 2K9SA 3MAJA 4UV8A 4JOMA 1ZK8A 1EH7A 3DTEA 5E8IA 2HQ5A 2D2WA 1P4AA 1QPMA 4OWRB 1P7JA 2ZO4A 3ZMSA 4ZDLA 3OMYA 3GW2A 1HSJA 3I3LA 1D0XA 2RNJA 2WAEA 4KT6A 4KN7X 5J1YA 4F3QA 5BPDA 5CKTA 3FXKA 2HR3A 1VI0A 2MW8A 4DYRA 3BROA 1IJWC 2GA2A 1FT9A 2VE9A 1QPIA 1NG7A 4NQWA 1AKHB 3K9TA 5D8LB 2NXNB 2JRMA 3R60A 3DBRB 3P5JA 3DEUA 4BKXA 4RBOA 1U9NA 3BTIA 3QYFA 2CUJA 4KT5C 2FF4A 2W7NA 1B59A 3A1YA 5J1UA 1YHQI 2BYVE 2FRHA 2XDVA 4GDFA 3KIOA 3O8GA 2X85A 3K4LA 4QPOA 3I56I 1TBXA 4HW0A 2L2OA 1V55H 3CESA 3JSOA 4OINF 1UJ8A 3WU1B 2FSWA 1J75A 3ZGKA 4O3MA 4XN3A 3CO7C 1UAAA 1FOKA 4BH9A 2KZVA 2PJPA 2NYXA 1YJWI 4NUBA 1UMQA 4CCKA 2N8GA 3M8JA 2E2JJ 1POGA 2LP0A 4UUTA 1LEAA 2WY7Q 5H6QA 3TW6A 1JKQC 2HOSA 1WRJA 3FF5A 4L9JA 3F8FA 1K61A 5A2QK 2JQ7A 4G6TB 3EUHC 5GP9A 2G7UA 3E5QA 3NAUA 4BAYA 1LUJB 3GX4X 4PGGA 4LLNA 4C3JJ 5JR3A 1OCTC 1JKRC 3CDHA 3DLAA 1MSEC 1MH3A 1TLHB 2GXGA 1Y8RB 4H0EA 3ASOH 2K5CA 1LPQA 2FNPA 3OR2C 3KYCB 1B1BA 1OPCA 3QRFF 4A3IJ 1F43A 3WTUC 2JA5J 3Q0VA 1SMYF 1K7AA 2JUCA 2KL4A 4JX5A 2PJRA 1IN7A 3HM5A 1YLFA 2XUBA 2QKLB 5CVIA 3T0YA 4ZDOA 2OQRA 3S14J 3HSFA 2CW7A 2COBA 2DA2A 3JRFA 1TW2A 1UHSA 4ANJA 3SQNA 1ZGJA 3KX2A 3ZN0A 1ZR4A 3DXJF 1SMTA 1K4TA 3BPVA 1NK3P 4DYCA 3N05A 3QOPA 5FB2A 3DP7A 5E1XA 3CUQA 1U5TA 4CCMA 5F1RA 1E0EA 4CCNA 1ZHFA 4FE7A 4YG2F 1Z7LA 2CQNA 2VASA 1O3TA 1KYZA 1YW8A 5DCMA 3V8JA 4DBRA 1KGSA 2RQQA 1NH3A 5HOOA 4PJLA 1NG6A 3LA3A 3HUGA 2MA3A 4ZTFA 3BY6A 1JUSA 4EGYA 2PX9A 2FU4A 2QUFA 4Q48A 3DWLE 4GRIA 3SDBA 1S3JA 3P9CA 3MD2A 4MFDA 2Z5UA 3W3CA 4XLPF 4S0HB 2DFHA 1V5GA 3L7WA 4M71A 5ICEA 4BL0B 1ZGWA 1UFMA 2Z2SB 2ECBA 2XRLA 1KZHA 3PIPF 1EJ9A 3OYCA 2EJRA 2L7MP 3NRVA 4EQQA 1O57A 1F4KA 2L4AA 5FRNA 1R5GA 1TT5B 3BTCA 3U1KA 3OYGA 2DMNA 1H89C 1P7IA 1A6IA 2DT6A 2JA2A 5HNFA 3KEYA 1ZH5A 1L3LA 3GMEA 3OOUA 2E2IJ 2F4OB 1SVOA 1FC3A 2BHZA 2Z1DA 2UWMA 1P4XA 1QQIA 1DDNA 3QPSA 4ESBA 5IPAA 1UHMA 2YU3A 1ZLKA 2FQ3A 1XS9A 4KNYA 1JGSA 3K1NA 4G6QA 3HIFA 3CO6C 3ZQFA 4YIRX 2LLKA 3G1OA 3LSTA 4OAZA 4OMZA 2J5OA 2KHMA 2FBKA 3O2PE 1YJ9I 4OU0A 2TDXA 3K4KA 3PL8A 2P5VA 3D5RC 3H5RA 1AOYA 3OYAA 1R5HA 5F27A 2O3FA 2O9LA 4KN4X 1Z9CA 1Q1VA 4WXCA 1FMWA 5GTIC 1MBKA 1Y1VJ 3P9IA 1N25A 4RB0A 4BGDA 5L3BA 5BOXA 4ZYAA 2KIFA 3D0SA 2QVOA 3F8CA 2UV1A 2Y31A 5BNGA 1FEXA 1D1CA 4FTHA 1BI1A 5IT9K 3MN2A 2V7FA 3FMSA 1FSEA 1OQYA 1A6QA 1G3WA 4QLCU 1ORKA 1MNDA 1VQKI 1R58A 1R6RA 1JHFA 2V9KA 1YO5C 2R7VA 5F0FA 3GUDA 4IOAF 1G3TA 2IA2A 1I1SA 1DP7P 2RNGA 5HVQC 3CUQC 1ONVA 1U5TC 3BG7A 2VPRA 1QZYA 2QBYA 3M4OJ 2DFIA 3KYLA 1ON1A 2J5PA 2W82A 4L9TA 2IGMA 4P1WA 5B5EC 1X3WB 4MLOA 3BJAA 1ZAOA 4N4OB 4WXDA 2R5ZB 2QSHX 4M6XA 1UCRA 1BJAA 3BR1A 4ABZA 1N77A 1BIBA 3S17J 3N4MA 3SZPA 1SC7A 5CVUA 3RDIA 5GPCA 3BQZA 4EVIA 4XIDA 1FTZA 3RKWA 3WTVC 4ZYEA 3PM1A 2VOPA 2X6XA 4Y52J 1FLIA 2VKVA 1DPUA 1X2MA 3W2AA 2JK3A 1LKXA 1X58A 4X6AJ 1QO0D 3OIPA 1RI7A 3P9KA 1MJBA 3ECOA 2VB6A 3ABTA 4ESJA 3ZMTA 2COMA 1YIJI 5DM7F 2M4GA 2EB7A 3ZCOA 1HQCA 3GFLA 4C9YA 3L00A 3KFWX 3HPGA 1R4NB 1X1CA 3BP8A 1IG7A 4HOBA 1FOXA 2LRDA 1A36A 2IS6A 1W1WE 2HVRA 2Q8KA 2K27A 4ASNA 3NQOA 4CO8A 3CQZJ 1GLNA 3K2AA 4BXXJ 4PSWA 5M5XJ 4PJJA 3V4GA 5FD6A 1N78A 4RGUA 3E1SA 4BHCA 3VYTB 3Q0WA 3FXQA 3EYYA 3ULQB 4EM1A 3CD6I 2ZXWH 4XOTA 1S72I 1Y6IA 1LB2A 2ELHA 2YPRA 5E3NA 4N9IA 3ZMUA 2RREA 1OCCH 3COAC 3BR6A 5JVTA 4HNVA 2ZMEB 3H5AA 4BHPA 3L2RA 4X0GA 1YI2I 1RPWA 4I99C 3G71I 4A2UA 4K2EA 2FBHA 4G12A 2K40A 4F52A 3HOVJ 3V7SA 3H35A 1H9TA 1U3EM 3AL0C 3IH4A 1IGNA 1WKMA 1TWGJ 1NK2P 3IRQA 3RSNA 5J47A 3LSRA 3SEQA 4ZH4F 2YUSA 4A3DJ 2Y9YA 3CLOA 1EH8A 3HBLA 3LSIA 2Y0MA 3I58A 3GTGJ 2NNNA 2XAQA 1IO2A 5CQGA 5IY5H 3CCRI 2ZXJA 2CUFA 3Q0UA 1IUFA 1QHHD 5D6FA 1D8JA 4YRVA 3S15J 4HZFA 2WAQN 1OYYA 1B9MA 2K3PA 2VN2A 5F64A 3M3YJ 2XAJA 1ERDA 3ECHA 3IC7A 4MQVA 1SD7A 3HGYA 1W5CC 2CSOA 2LF7A 3H3UA 2AXTC 3EUKL 3RYRA 3RPUA 2M2EA 1YE9A 4P9FA 4S04A 2GWRA 2BVLA 3S3NA 2VOOA 1TW3A 2QQBA 2ME6A 4R1HA 3ABKH 4FX4A 4F93B 3QPTA 3S1MJ 4XLEA 2Z16A 1B8IA 1O4XA 3NEUA 1LQ1A 2EZKA 1SD6A 4NBQA 2V6CA 1T08B 1ZN2A 3PQKA 2VQLA 2HOTA 4AWXB 2EZLA 1R23A 3E5UA 2P81A 1JTYA 3QODA 5CVVA 2VT3A 2K86A 3ZRGA 4BQAA 5KCMA 4RB2C 3K10A 2LYCA 5HDNA 1TT0A 3B02A 4LB6B 3OIQA 5HLGA 2KPMA 5F1JA 1XDUA 5JLXA 2M0CA 3I59A 4EM2A 2F5FA 2IAIA 2R93J 3EYIA 3HSRA 2LR8A 3CDLA 2HYJA 5D5VB 2QM3A 1T39A 5FFXA 4JK1X 1AKHA 1YW7A 1KA8A 2VLAA 3RTRA 3R0AA 2E19A 2L01A 2PQ8A 2VT2A 2GXAA 4Y4RA 3C2HA 4BUPA 1KU2A 5K1YA 4G7OF 2L9NA 3F72A 3CCLI 3W6KB 2FQ4A 2WB1A 4PDKA 4B3XA 1SFUA 1FOWA 4KIGA 4ZYGA 1DU0A 2KZGA 3CP8A 2FXAA 4X1EA 1T0FA 1FTTA 2LH9A 1JI8A 3HHGA 2BV6A 3BG5A 1MMAA 1TNSA 3J7ZI 2BE5F 4JX4A 2MFZA 5IP9J 3CC7I 5HS7A 1OFCX 4PUSA 1VQNI 4B47A 2HQRA 1MBJA 2XVCA 4ITVA 5DM6F 2QKMB 5AIPA 2JN6A 2L9VA 1QHGA 2E71A 2DMPA 1ON2A 3DFGA 2P7VB 3ZR8X 2IPQX 2NVYJ 1REPC 4OAYA 3LSPA 4E4HA 4RM3A 1R36A 1VQ5I 4UUVA 5FGMA 4D9JA 3W2WA 1G2HA 2EBIA 4C3IJ 2H1LA 5DS9A 2L7KA 4H4KC 1HSTA 2XHKA 2QA4I 4BJ5C 3WG9A 3M1CA 1O3SA 3IAS2 2V1UA 4QWQA 2B63J 1ETOA 3F23A 3FX3A 5L3DA 1I6XA 3T8TA 1FY7A 1G3YA 2W4SA 2CQKA 2LOOA 4GXOA 3TDZC 4NDLA 4A12A 4A3CJ 4L9NA 3GF2A 1I6HJ 2CUZA 3FM5A 3IRRA 3OYFA 1WHUA 3PFYA 1MD0A 2MSYA 2Y30A 2V4JC 3H3ZA 4BY7J 4LG3A 4FASD 1W4MA 1YS7A 2X1EA 5CLSA 4DJAA 2DN0A 1Z0XA 1Z6RA 1MBFA 1RR7A 2F5EA 4G6DA 5F6FA 2VODA 2LK2A 2H8WA 1BOBA 1F36A 1MBEA 2X51A 4E7ZA 3OL4A 3ZN1A 3K70C 3ISPA 4RAZA 1CF7B 2RC4A 3FXUA 2E36A 4OIPF 3ML6A 4WCGA 4E7SA 3CLQA 1JUMA 3L2WA 2MC4A 4LK1F 4ENMA 3BTJA 3FISA 2G9WA 1V5FA 1RZ4A 3N97A 1YYVA 1HBXG 1IXSB 3HTUA 3JAMZ 1JKOC 2K3FA 2KP6A 3IKTA 2CUEA 2HGCA 2H94A 1QGPA 1T0FC 2HZDA 2XASA 2R7TA 1V5EA 3JCUC 3BG3A 4HV5A 4BNCA 2GQQA 2OJED 1ZARA 1G4DA 4XKCA 4QIWN 5DUKA 2LBFB 4GYIA 2XSDC 2R0QC 4CXFA 4XKVA 3G6EI 1BW6A 3O6BB 4AIDA 4IHSA 2XAFA 1R49A 1KYWA 3E6MA 2K7LA 3CMEI 1A31A 2R7OA 5K5QA 1R71A 3HOWJ 5FKNA 2A05A 2DBBA 1I39A 2BXYA 3EUAA 2RDPA 3C1DA 3OYDA 4PJMA 1C0WA 4AYBA 2IT0A 1KU7A 4Y7NJ 2JWTA 4LLGF 1ZG5A 4CYCB 3FHZA 1BC7C 1NTCA 1MNEA 1T95A 2DT7B 4J01A 4U0VA 1T6SA 1MMGA 1HXDA 1SFKA 2EFNA 4PFOA 4F7ZA 4CSWA 1X1BA 3VYSB 4HDUA 1IRFA 2PN6A 2E60A 5EZGA 2VQGA 4AIHA 5FLVA 2DPDA 3DLLF 4MHGA 2Y0SA 1MMDA 1TWAJ 5LBQA 1GHCA 3FIWA 3HPHA 2PI0A 4RGRA 2CQQA 2M9HA 3BJOA 3DEWA 4LOCA 2JJ7A 4P5OA 1PDNC 4IKFA 5CJ9A 4Y33A 3J7YJ 2B0LA 4IHVA 1E3OC 5LRRA 4I0AA 1XCVA 3ZQ7A 3WGHA 4MO7A 1BI0A 3E97A 2DODA 1ZELA 1KU9A 4G9YA 4II3A 3WGIA 5CPRB 1TC3C 1J5YA 1UZCA 3KP2A 4KMFA 2Z99A 1Y0NA 1I1GA 3OSGA 3KE2A 4FHTA 1LFUP 3F0CA 4HSRA 4MGRA 2F2EA 2MABA 4NC6A 3ZOBA 4LG0B 1XGSA 2D5VA 4Q4ZF 3C2GA 1LDKB 2P6SA 5ED4A 3OS0A 4M3FA 3MCZA 3QYBA 4KITB 1ACIA 3IP4B 3BR2A 5DD8A 5DV5A 2LSOA 2L3DA 2X1CA 3GTKJ 4BBSJ 5D5WB 2ELJA 4F91B 1DP3A 1D1BA 2D1VA 3NARA 4IXAA 4A0XA 1DUXC 2JUGA 4I09A 3D1NI 5K5RA 2DA4A 3KP5A 1HW5A 3GEZA 3TP3A 3CTAA 2HVSA 4JYKA 1HA8A 2DMQA 3FHNA 3QPLA 4YIIA 5K7FA 1JKPC 5CVRA 4AU7A 3HOSA 3VDXA 3PSFA 2M5WA 2LY2A 5ILUA 2QF7A 3IV5A 2JPCA 4U7DA 3FMRA 3GTLJ 5E3OA 3OYKA 2W84A 1VF9A 4GGGA 4PSXA 5D4SA 1IXCA 3H0DA 3WU2C 1XGMA 4IOCF 5CVJA 5EYRA 3WTZA 3R61A 1O3RA 4GO1A 3EQLF 2VQHA 5IP6A 3G3ZA 4YFKF 1EV7A 3MKLA 2R7DA 2Y75A 2GIZA 4M3DA 2NVTJ 3PQJA 3VOEA 1XD7A 2UXNA 4HDVA 4IZZA 2KKOA 1WJFA 1DPRA 2ZMEA 1F5TA 1VQ8I 3ZQQA 1SFXA 2JVGA 4EEFG 2C6YA 2XB5A 1FYLA 3TO6A 4CCLA 2FA5A 3JRHA 3GVAA 2L9RA 4XRSA 3IAM2 5F0HA 4G8XA 3OYEA 2L7FP 3ZMVA 2HOEA 1IV8A 2OBPA 3QWLA 4FCYA 4AM3A 2A68F 1MBHA 5LFAA 2CRGA 2YX4A 2ZXHA 1JT0A 1VQ6I 2FOKA 3BT9A 2IA1A 1I27A 2MD0A 2KJCA 5IOZA 1RUOA 2XB0X 5EF6A 4P55A 1CQTA 4ETSA 1W5SA 3KZYA 3ZXSA 2EA4A 1FNNA 1CGPA 4PGHA 1JXSA 5LGNA 4DZJA 4PJNA 3QP5A 4OIRF 4DBQA 2BXZA 5GAHJ 4RDUA 1R9TJ 4EM0B 2DT5A 3CC4I 2Z3YA 3IUOA 2A6HF 1S7AA 3LQRA 4B48A 2L54A 5C3EJ 4G94A 3F8NA 2CFXA 2R7UA 1RNLA 3GLXA 2IBDA 4MFEA 2P0WA 2Q0OA 1YRNB 2E34A 4XR6A 3P7NA 2LKSA 1UHWA 4ZZLA 3U21A 1JGGA 2BEOA 2DK8A 4JBAA 4DOZA 2LF8A 2ZJQF 2ADUA 5A2QZ 3WHBA 1G6NA 2OA4A 2HQNA 1J0RA 2FMLA 3M9AA 3T5XA 3MKZA 2XAGA 3AKZA 1J09A 1K78B 3CDIA 4LMYA 3PFIA 1ZLJA 3HOTA 1E3PA 4NNJA 4BBRJ 3U9GA 2M4KA 3JREA 2XAHA 4BYYA 1GXQA 1GUUA 3QPHA 4D5CA 1IF1A 3ABMH 2DXIA 1A35A 3BZ6A 1ETWA 2IRFG 3JRAA 2R5YB 5HDGA 2EIKH 2BVMA 3JRCA 2FD5A 4ZTJA 4E6KG 1R5ID 3TOBA 3U2RA 2VUMJ 3DBHB 4N4NB 1IDYA 5LHIA 2KRHA 1P6RA 1UB9A 1P4WA 3MFKA 2NS8A 5GPAA 5IYCJ 3E7LA 1GXPA 3WODF 1HDPA 2B9SA 1V54H 1PJRA 2ZMEC 2W57A 2IGKA 2X6YA 1MW7A 4M3BA 4B3AA 1XMAA 1MSFC 3E6DA 3BLYA 4NB5A 2KT0A 3V8LA 1X3ZB 4A3KJ 4RLQA 2ZFUA 1DU6A 4AUXA 4L5EA 2DMTA 4MNUA 5LEJA 3WTYC 3MZHA 2BHYA 3LQQA 1L0OC 3W2VA 1U0JA 1ETVA 1H0MA 4A69C 3TO7A 1YFHA 2PMZN 1G3SA 1R00A 1VQ9I 2QEXI 2Q2EB 2GM4A 3DTIA 5M5WJ 1Z3YA 5E1WA 4ENKA 1IN6A 2JA7J 4XICA 5J3LA 5TJJA 3ZP5A 1TWHJ 1FYMA 1F1ZA 3GCMA 2ECCA 3SYTA 1ZRDA 1U78A 1IN8A 1RETA 3OYNA 5B3SH 3HEFA 1ZGAA 1G59A 1YQAA 4M9ZA 2WWYA 4G7HF 1OCRH 2VJ5A 4HLXA 3KCCA 3ROUA 2VBZA 1SAUA 4HAMA 2XF6A 1FX7A 1WPKA 4EMSA 1W0UA 2F4MB 2CMPA 1OYIA 1TNTA 2X48A 2ZJRF 1QVTA 3OV8A 2M45A 5EEHA 3FBNB 2HPMA 4BS9A 3RQIA 5DDGA 2NVUB 1LE8B 2YU9J 4WF2A 3WG7H 4IHYA 2MC3A 1GVJA 4R8HA 2A69F 3HRMA 3A03A 3OY9A 2IA0A 2EPFA 2QQAA 3TO9A 2RAEA 4BHBA 2XF7A 5FLMJ 5TISC 2WA0A 3CUOA 2KIQA 1JTXA 1YITI 4RS8A 4BXFA 2O03A 3HRTA 2ZC2A 2M8EA 1ZTRA 1P2FA 3X2QH 4AVPA 1TQIA 1SANA 1X19A 1D1AA 1ZREA 4IX7A 5AIQA 3HZJA 4AD9A 3CCVI 4XL9A 3PIOF 4CH7A 2DPUA 2STWA 4YELA 1RRJA 2CFOA 5IT9Z 1OR7A 2CU7A 2V6EA 2V9VA 3ABLH 4XONA 5JHUA 2W24A 3OWTA 4I7HA 4D7NA 3OYMA 3Q5FA 1IN4A 1SFEA 3J80K 1Z6TA 4KMUX 3WTSC 4UY8I 2VXZA 3QU6A 1EF4A 1HC8A 4IHWA 2ZBKA 2R7QA 4IQ4A 2FJ1A 2DFFA 3FK7A 1XGNA 2DA1A 4RGSA 2NS0A 1BI3A 5LHHA 4A3GJ 2QQ9A 3GTPJ 3M1EA 3CMAI 4NQWB 3RZDJ 1W5TA 3H9JA 2WAQA 2CV1A 3BCAA 2LBFA 4HX4A 3KPHA 2XKOA 2X0LA 4J00A 3K4JA 3DPLC 3ASNH 1HKQA 2E35A 1LDDA 2CJJA 4HBLA 3FXRA 3OSFA 4RB3C 1W0TA 1XDSA 2OU2A 4PFPA 2JPBA 3PNTA 2R92J 4KIBA 2CV2A 2GA1A 1OYWA 1X1DA 4BQNA 3HOXJ 1HF0A 5LHGA 3KLNA 4CUGA 1I3AA 1MJ9A 5E3MA 5M3FJ 5FRMA 2WC2A 1FOYA 1KQ0A 3RIRA 2YS9A 4B43A 2HWVA 4CYCA 2ZCWA 3I64A 4RAYA 3KZIC 3DTKA 5KAIC 4KJZA 4HNUA 1ZR2A 4XQFA 3HG9A 5JFRA 1ZG1A 2K4BA 4I6ZA 5TGTA 4L9VA 3CJNA 3V42A 3A01B 5E3LA 4AIKA 1MZBA 3GLLA 2RN7A 1S5LC 2ISZA 1A5JA 3FMQA 4JP0A 2IGNA 3A2KA 3UKGA 2BZTA 2RV8A 2BW3A 5HS9A 3UR3C 3S93A 3Q9SA 3HDDA 2D45A 4M3GA 2JMWA 4HLYA 4E7HA 2FNAA 4ZYHA 4A0YA 2QWWA 3GTMJ 2JSPA 1N75A 3VEPA 3BR3A 3C7JA 2ZNZA 2L9SA 1S8NA 1LEBA 1J7KA 2H27A 1P9QC 3G4SI 1W7PD 4L0YB 2XGCA 4DIQA 4A5NA 2EV6A 1GT0C 2DLLA 1OR7C 2MLGA 2STTA 3I9V2 4LG0A 2QSFX 1XSXA 2BBYA 2IW5A 3H0GJ 4U0YA 2XROA 1XSVA 1RUNA 2GIVA 3IHUA 2M7AA 2MD5A 1VFCA 3WTWC 4XNFA 1NHAA 5BMZA 3CC2I 3A0BC 4L5JA 3TQNA 1TL8A 3DPTA 3TGNA 3CUQB 1U5TB 3EPZA 4W1UA 2LC2A 3L2QA 2DU9A 1EA3A 4KDPA 1TQPA 2M8GX 3E5XA 3HOYJ 1J9IA 4HSTA 3KP4A 1BR2A 2HOAA 3HUGB 1OCOH 4HEA2 4UB6C 1Y39A 2KQRA 5FFZA 2R7SA 4LD5A 5FLXK 3TKYA 2H6BA 2Y48A 4D1QA 3J81Z 1WH5A 2HYFA 2R7XA 2MG4A 4ESFA 4Y3OA 4XN0A 3F21A 3HB9A 3AAFA 2H1KA 3H92A 2VI6A 1ZRCA 1OKRA 1RESA 1S7EA 1E17A 2BY3A 2TCTA 1BW5A 1D3YA 4GYGA 4I2OA 2E1OA 2HXOA 2V1XA 2NOGA 2FUG2 3VSLA 3HKZN 1PP8F 1ETQA 3L09A 1QVUA 3GTOJ 5HLIA 3GBGA 5C4XJ 1Z7UA 1K83J 3WTTC 1Z3XA 1STZA 2DDBA 4A93J 1D0YA 2EINH 1VQ7I 2Z9OA 1U9OA 4B09A 2XGEA 4A3EJ 4UVAA 1R4MB 3VSKA 2JVHA 1WI3A 4E7IA 3OS2A 1Z21A 3DBLB 3GZ5A 4RB1A 1GDTA 5J6XA 3CJTB 4XOPA 1B72B 1U8BA 1T98A 3BJ6A 3LFUA 4G7ZF 3DU5A 4LITA 4EJVA 1T8IA 2DDAA 5F0CA 3RYPA 3OYBA 1HLVA 2V26A 2MH2A 6PAXA 3FKJA 2M34A 2H8RA 1W7PB 2OV7A 5M5YJ 5J4VA 2A3SA 3FM3A 3AL0B 1KONA 4BE1A 3H3VK 3K6GA 2KRFA 1OCZH 4E7LA 1YRNA 2GLOA 4Z6YA 1WZ2A 4WX9A 4NC8A 3G73A 4XSZF 4M9XA 1XTAA 4UUSB 5KVRA 2IS2A 4XLNF 4L5IA 1LVKA 5AONA 2W25A 1W36D 5DYMA 5L3EA 2DQRA 2EIMH 2DMUA 2OF7A 4XLFA 3ZQHA 2EFWA 2AO9A 4HRIA 4IQJA 4Y13A 4U88A 4LIVA 4ZC3A 2F5VA 1O7FA 2A5WA 5DCFA 2R7FA 3D5LA 1WVRA 1TQMA 2DK5A 2DYSH 4LGWA 4XKWA 3ELKA 2LY1A 1XX5A 2ZXIA 1P92A 1ENHA 2CV0A 1YOVB 2OAZA 2R5YA 1VTNC 1VNDA 3GO5A 1KQ8A 3CJRB 1IRXA 3V8KA 3G1LA 2AQFA 3L2VA 3S32A 4EGZA 2XV4S 2E7WA 3OL3A 3HGGA 4BQQA 4C2MJ 5GADJ 5K5OA 5F04A 4P9UA 1G8XA 2A6TA 1XCBA 2VKEA 2CWEA 4XBFA 3C18A 3RQ4A 4IPAA 1ETKA 1JT6A 4MEYF 3I54A 4XMYA 4BXUA 1K6OA 2G7HA 1VQLI 2OZ6A 4BY1J 1Z1DA 2JRTA 4I98B 3LAJA 5FD5A 1WFXA 1YS6A 3HL2A 2ESNA 4ZYDA 1XC5A 4O5VA 4A5MA 4LIUA 2BOLA 4BU2A 3L2CA 3PUFA 3WGGA 5HLTA 1MBGA 1PUEE 2LREA 2W85A 3FKIJ 3KP7A 3KYDB 3T8RA 1SD4A 3C2BA 4XSXF 4FX0A 1FSHA 2ZFWA 2DCEA 1KU3A 2R7WA 3K70D 3S2HJ 2EZIA 1LVAA 5L3GA 2NVQJ 1DQUA 2NAZA 1B4AA 5CQEA 5E1ZB 5FROA 2NNYA 3HOUJ 2Q2EA 4PJ0C 4N0BA 3ZQIA 3PNYA 2KIUA 1IAWA 3HOZJ 3SJMA 4RGXA 3IWZA 4IHTA 4XORA 4RMNA 3ZQGA 3CCMI 3ZQLA 1R1VA 1JHHA 3HRSA 2M3AA 4WXHA 1GVDA 3B73A 2BY2A 1H9GA 1UG2A 1WQ2A 2LTPA 5D8KB 1WSUA 2LD5A 1TWFJ 3RKYA 2CQ7A 3S8PA 5GTHC 3L1PA 2VONA 1IW7F 1QRYA 4XLCA 5J8CA 1WWXA 3K4MA 2HKOA 2CW0F 2K9NA 3HRUA 1APLC 4C2UA 4RAGA 1LE8A 4V2FA 5EGOB 4HNTA 1SD5A 1VQOI 3BC8A 5H20A 3O3KA 3NWTA 4LJZF 3S1RJ 3HSEA 1FYKA 4XRFA 4OMYA 2ELKA 1TWCJ 2X4HA 2R5ZA 1OMIA 1LNWA 2EIJH 3CF2A 3LA2A 5E18F 1K6YA 2PBIA 5K7ZA 4BE2A 4MTDA 2IXSA 1RIOH 4CCJA 2HYGD 4UXNA 3WE3A 1AWCA 1U8RA 2O8KA 1ODDA 4XLAA 3O8HA 2O0YA 4II2A 4XK4A 3V7RA 1BA5A 2DOFA 1B8IB 2VPLA 4FISA 2VXDA 4MEXF 4UNOA 3I71A 4QSHA 1IRGA 2VJ4A 1SFOJ 1IUYA 5K7HA 1PUFB 1TTYA 2O7OA 2CH0A 3FBIB 4IL6C 4HA8A 3JW4A 3KZZA 2NRAC 1YIOA 2L7ZA 4FQGA 1IV6A 2XRNA 2CYYA 1SEUA 2M87A 2PEXA 2RGVA 2KLOA 2Y0SN 5EJCA 3FXJA 3MEXA 1QZZA 4S05A 3I59B 3VYUB 1FMVA 2UXXA 3K0LA 2PMHA 3H5NA 1BL0A 2ZNYA 2O6GE 2E1MB 3GFIA 1OLTA 2XPWA 2V79A 1FP1D 3LMMA 2LMDA 3F22A 1E2XA 2BY0A 4ZDPA 4B4CA 4M72A 1A04A 1VQ4I 2VBWA 5D4RA 1FZPB 2W1OA 3LSHA 1X4PA 1U2WA 2LY9A 1BI2A 4MQ9F 2ZSIB 3E6CC 2HU9A 3H9GA 4Z2YA 3MKWB 1RR8C 3GTQJ 2W00A 2QQ8A 2YX7A 5D6EA 4HF2A 2X6WA 4EJUA 3WTXC 3B6AA 2KIMA 4A6DA 1J2XA 3SFZA 1XMKA 4QTRA 5DUIA 4CICA 2HVQA 2G0EA 2UUZA 3I53A 2CS3A 4AIJA 1WJBA 2IVMA 4UVCA 1XB4A 3M7GA 4BEHB 4BE0A 3SXYA 3MQ0A 3DKXA 4M3EA 3K7AJ 3K4CA 4LLLA 3A01A 3RJPA 2Y2ZA 4M74A 3KP3A 3JRIA 5JI6A 1MNMC 2IJLA 2F6CA 2JA8J 2L0KA 2WAFA 3AFHA 1SVLA 3U1DA 1MDMB 4IF4A 2EV5A 1BN5A 2Y9ZA 2WTEA 1D8KA 1USSA 3SHFA 1VQMI 2ESHA 5JVGF 4UVBA 3MMYB 4BDYA 2NS7A 4CYDA 1HW1A 2EFQA 3TP0A 3S3OA 2XC7A 4M6VA 4HF1A 4NC7A 3CCJI 3KLOA 5LGUA 4CZCA 5LLQA 3DV8A 3A02A 1ZQ3P 1XMXA 3IWFA 4UB8C 1FIPA 4A6EA 2FEZA 3HHHA 2K02A 2P4WA 2YR2A 3M07A 4XKBA 3FXLA 1ZRFA 4HQEA 2E1CA 4GCVA 1LDJA 2M30A 2K9LA 1FWZA 4E70A 2LKXA 1YTYA 2PMZA 2VKHA 3BWGA 3ZMZA 3GZ6A 3GXOA 3FWEA 1WGXA 1T56A 1QZEA 2HDWA 4BJ6C 4C30A 2VQCA 2GZWA 1R22A 1MJAA 1O7LA 1ZG3A 5HODA 4JQFA 1EKEA 3RPQA 3RKXA 3TBIA 3L9FA 1S9HA 2O5RA 3VYRB 2M0MA 4F55A 1HCRA 1F9NA 2WV0A 3SZTA 3HTSB 2ICWG 3DEEA 2VBYA 3G2BA 3DQVC 4A3JJ 2D1HA 3BR0A 4M9SA 2DO7A 1IRZA 5BS6A 1AU7A 2KDZA 4BDZA 5CYVA 5ICCA 5B1BH 4HG2A 3C3WA 4D5FA 4GFBA 2K85A 4U0WA 3KEOA 5EG0B 4E7KA 2OC6A 2DAOA 2ZJ2A 4I76A 4CGZA 2M1BA 1IZ1A 1MGTA 1Y8QB 1ETXA 3TEDA 4ENNA 2R3SA 4I02A 1YG2A 3I4PA 5IYBJ 4CDGA 4IHXA 3OYLA 5BPIA 3TMOA 5D5XB 1QBJA 3WE2A 2EA2A 3CCYA 2OTLI 2HI3A 1LJ9A 4HX8A 3LFKA 4UHTA 4KFCA 3PNVA 3Q3SA 4P96A 2ZJPF 2X1DA 2EFPA 4IO9F 4C2TA 2KISA 4OIOF 2EILH 3S1QJ 1ZYRF 4ON0A 3K4NA 5HDKA 4MIMA 3S2WA 3DKYA 1B72A 2QYOA 3BQYA 2XSJC 4L0ZB 3EETA 3PUBA 3IKVA 4DYQA 3ONQA 1IN5A 1S7OA 4LFUA 4ZJZA 1I3QJ 3IH2A 3CCQI 5E8GA 5IT3A 2R7RA 2QGUA 3AG3H 4KICA 2W48A 3W6JB 1W7PA 3H9QA 5FKLA 3CCSI 2XAUA 1MH4A 1USTA 4N9HA 2DA6A 1QNTA 5ERIA 2P5LC 2XPUA 4O6JA 4Q47A 3KETA 2E7XA 3Q9VA 3QP6A 1HKSA 4UUSA 2F5CA 2IP2A 5C44J 1R1TA 2A5YB 4XRMA 5BQTA 5J4YA 1MKMA 3DKWA 1I5ZA 3CMMA 5B1AH 2VC0A 2PG4A 4NHJA 2CW8A 2BY1A 5FKKA 2DJNA 3DU6A 2P6TA 3QAHA 2MH9A 3DPUA 2EV0A 1PVEA 1EH6A 2TRTA 1AHDP 5IP7J 1CF7A 2EH3A 4IVNA 2OZUA 4F92B 3SDGA 5HNHA 1H88C 2E1NA 2NVXJ 1TZLA 3AG2H 3PO3J 2FE3A 1TP4A 1SVMA 3JRBA 1JUPA 2OCEA 5E20A 5ICGA 4B8XA 1XN7A 3LSGA 4YFXF 3JTGA 5E17F 5KNLA 2HTSA 5KAFC 2F4IA 3A4CA 1YJNI 1BC8C 2OUMA 2F48A 3OYIA 2XGXA 3PO2J 3RI4A 3J7AO 4I01A 3L2UA 5F08A 3S16J 2JSCA 5H2FC 5FO5A 4PK4A 4CA0A 2ISYA 3K1MA 2K9MA 2I8DA 4M6YA 3I5UA 3ZPLA 5D5UB 3AG4H 4LK0F 2V9PA 3H1CA 2FBIA 4PCQA 5FKOA 1B6AA 3LA7A 1WH7A 3IH3A 2F5DA 3I4NJ 3ZQCA 1WJAA 1VQPI 4V2GA 2I10A 4BQOA 2IEKA 2MBFA 3JTHA 3LSKA 5KK1A 4Q5SF 1ETYA 2ME0A 2JT1A 1FBQA 1JE8A 3GFMA 1Z91A 1V3FA 1RKTA 4A3LJ 1RC9A 3VFZA 3J80Z 1T33A 5FKMA 2WY8Q 4EATA 2AXLA 2AQEA 2LNBA 4DGWB 3HYIA 5GAGJ 1HDDC 2P7CB 4LB5A 2DFEA 1M1EB 3BTLA 3ERMA 5GAEJ 3A0HC 2DI3A 1JJ8C 3OYHA 1XG1A 1OCPA 2MLKA 1FBSA 5HLHA 1J59A 3R4KA 1RKWA 5EZHA 2XKPA 3CZ6A 4HPQA 2ID3A 1LFBA 2VE8A 2QZ8A 4ZZDA 3GZNB 4A3FJ 2HXIA 4PZJA 3JSPA 3ZMDA 5LRSA 2VBXA 2EK5A 2AHQA 3K1PA 3CMYA 3CCEI 1WI9A 3OS1A 5EGOA 4FETA 2PJRB 3T1BA 3MVPA 1ULYA 2L02A 4W97A 4YEJA 5L3FA 5IYDJ 2XF5A 1FP2A 3TW7A 2RVCA 1I50J 4EV0A 4CHUA 2KJBA 2VIXA 3OIOA 3MZYA 2PLYA 2IS1A 3F8MA 1IC8A 2JTVA 3BG9A 1B9NA 3RZOJ 2RKHA 3FK6A 4JX6A 2PFBA 2HPIA 3R0JA 3R6SA 2DA7A 2DTRA 4A3BJ 4XLHA 5L3CA 3PJRA 5EEGA 3OR1C 3J81K 1FIAA 4B44A 1PP7U 2DA3A 3HKZA 1K79A 3E3VA 4MTEA 4IRGA 3S1NJ 3G1MA 1BR4A 5B66C 3DF8A 2UZKA 4Y15A 3I0TA 4BJTA 2LDUA 5DCMB 3CF5F 3ABUA 1PUFA 2IS4A 1Z67A 1H8AC 1LFPA 3OYJA 4D0PA 1X4OA 2LKPA 4D7MA 4J19A 3E6BA 1T38A 1BJZA 2P5KA 1D5YA 2LVSA 2YSRA 2M7BA 2CG4A 5DEQA 3TOAA 4YIFA 4EJWA 5DTDA 1S29A 2LFBA 3F9KA 2P8TA 1WJDA 4UV9A 3E0JB 1BIAA 1QA6A 1IDZA 2HDCA 2ZKZA 2HTJA 2WV1A 2V1NA 4HV6A 3JRGA 2GXBA 1OJLA 2CO5A 4KYWA 1X1PA 2XPVA 4OOIA 2VC1A 2JA6J 2HKXA 3WHCA 1GV5A 2XIGA 3RCOA 3RKQA 2MYSA 3QU3A 2HEOA 1R1UA 1FPQA 4DNCA 3SFIA 2H09A 1PYVA 3CCUI 3VPRA 2HQAA 3JRDA 2X9DA 2EFOA 2L5QA 4U87A 5J40A 2EZHA 2VKDA 4I0BA 1GV2A 2DTZA 3K4BA 4A3MJ 2RQPA 3I55I 4CZZA 5KHDA 2ETHA 3VB2A 5J1RA 1D5VA 3MKYB 3K69A 2K4JA 2A6EF 2L4MA 1Z05A 1YX5A 2EQRA 2QCOA 1FJLA 5EEAA 2HZTA 2O8XA 5LEKA 2IGOA 4HX7A 4IEJA 2QLZA 3UNGC 4A0ZA 4BEHA 2HFHA 4XRSG 3BOQA 2Q1ZB 3VWBA 2BGCA 3H36A 3QYEA 2E5ZA 1K4SA 2KRCA 3S2DJ 5FLXZ 1UELB 4WK8F 2DQLA 3ESWB 3NWSA 1T2KA 3AG1H 5EDNA 4DZPA 3GTJJ 1O3QA 4KISA 1E3HA 2XGDA 3TDUC 2E5NA 1W36C 3DCFA 5LD2C 2Y69H 1ITYA 2K9QA 2PMUA 5ILSA 1MDMA
chains in the Genus database with same CATH topology
3FDYA 2KRHA 3H5AA 3L2RA 4II2A 4X0GA 1AA7A 4XM3A 5JHFA 2DOAA 2VPLA 2VXDA 2KMUA 3CJQB 1PJRA 2VJ4A 4F52A 2IGKA 2X6YA 1MW7A 3H35A 2CH0A 3BLYA 3FBIB 2VJJA 3BG6A 1UG0A 3AL0C 3PSIA 4RLQA 2ZFUA 1QU3A 3RSNA 2GOMA 4CCOA 3SEQA 2KLOA 3VYUB 3W2VA 1FMVA 3LSIA 1U0JA 5CQGA 3RPUD 3H5NA 1QHHD 2Q2EB 3DTIA 4YRVA 1Z3YA 2DJIA 2E1MB 1OLTA 2K3PA 1ERDA 2HNHA 3LMMA 1MMNA 4BACA 3SYTA 4ZDPA 3CP2A 2E1MC 2W1OA 4U7BA 3LSMA 3D5SC 3EUKL 3OYNA 1VZ0A 3LSHA 1YE9A 4QPQA 2BVLA 3S3NA 1G59A 1X4PA 2VJ5A 1DGRM 4F93B 2LG4A 2ZSIB 2HU9A 3H9GA 4XLEA 2Z16A 3MKWB 2W00A 2GOXB 1SAUA 2X6WA 2XF6A 2VQLA 2CMPA 1WJEA 3HXLA 2HVQA 3SEZA 2UUZA 3FBNB 3QODA 2CS3A 4BS9A 2HPMA 1WJBA 3ZRGA 4BE0A 5KCMA 2R4GA 4BEHB 3K10A 2LYCA 1TT0A 3OIQA 2KPMA 3DKXA 3BCBA 1WJ5A 3K4CA 2WBMA 3OY9A 2XF7A 2WA0A 2VL8A 4E7JA 2VJIA 1DGWY 1BR1A 4RM2A 2F6CA 4BXFA 1Y56A 2VLAA 3RTRA 1X1AA 2WAFA 3AFHA 3LL7A 3S3MA 4R79A 1X19A 1D1AA 4Y4RA 4IX7A 3C2HA 4BUPA 2L9NA 3MMYB 4XL9A 4BDYA 4CH7A 4YELA 3S3OA 2CFOA 2WB1A 2V6EA 2XC7A 4B3XA 4XONA 3OWTA 4NC7A 3J7AY 3CP8A 4CZCA 3OYMA 2KDOA 2LH9A 1JI8A 1MMAA 2ZSHB 2VXZA 1D0ZA 2MFZA 2R7QA 4IQ4A 4XKBA 3TL4X 4PUSA 4B47A 2K9LA 2PMZA 2VKHA 3SZGA 4NQWB 4ITVA 2BW3B 2QKMB 3H9JA 2WADA 1YX3A 2WAQA 4RLFA 2CV1A 1QHGA 3BCAA 2LBFA 3HC7A 2HDWA 4BJ6C 4C30A 3ZR8X 2VQCA 3K4JA 4J00A 3DPLC 3QOEA 4OAYA 2NOJB 4E4HA 4JQFA 4RM3A 3TBIA 1WJCA 4D9JA 3W2WA 1S9HA 4PFPA 3PNTA 2O5RA 4AVZA 2L7KA 4H4KC 3VYRB 2CV2A 1X1DA 2M0MA 4BQNA 4F55A 4JOMA 4CUGA 5FRMA 3DEEA 4BJ5C 3M1CA 3DTEA 3IAS2 3G2BA 4B43A 3DQVC 4OWRB 4ZDLA 3DTKA 4KJZA 2W4SA 3OMYA 4HNUA 2LOOA 4BDZA 4XQFA 3I3LA 3HG9A 1D0XA 2CUZA 2WAEA 4KT6A 4HG2A 3OYFA 3PFYA 4F3QA 5TGTA 5CKTA 3V42A 2V4JC 4E7KA 2OC6A 4LG3A 4FASD 2IGNA 3A2KA 2X1EA 4DJAA 1NG7A 2BW3A 3UR3C 3S93A 3OYLA 3TMOA 4E7HA 3QYFA 1BOBA 2JSPA 2X51A 4E7ZA 2CUJA 1N75A 3OL4A 3PNVA 3K70C 4C2TA 2W7NA 2X1DA 3A1YA 2L9SA 2XDVA 3K4NA 4E7SA 4QPOA 2X85A 3K4LA 3L2WA 1P9QC 2MC4A 3DKYA 2L2OA 3CESA 4DIQA 2XSJC 3PUBA 1V5FA 1OR7C 3ONQA 3ZGKA 3I9V2 4ZJZA 4XN3A 2KP6A 1UAAA 1T0FC 2HZDA 2R7RA 2R7TA 2KZVA 1V5EA 2M7AA 4NUBA 4XNFA 3H9QA 4CCKA 3M8JA 2WY7Q 2XAUA 3DPTA 4XKCA 3EPZA 2LBFB 2LC2A 3L2QA 1EA3A 4XKVA 4G6TB 3EUHC 4HSTA 1BR2A 2R7OA 3HUGB 4HEA2 3CMMA 3EUAA 3DLAA 2CW8A 2KQRA 3OYDA 3DU6A 4PJMA 4AYBA 2R7SA 3DPUA 2K5CA 3OR2C 4D1QA 4F92B 1T95A 1MNEA 2DT7B 2KL4A 5HNHA 2PJRA 4J01A 2QKLB 1TZLA 1MMGA 1SFKA 4PFOA 4ZDOA 2R7XA 4CSWA 2CW7A 1X1BA 4Y3OA 3VYSB 4XN0A 2E60A 2VQGA 3LSGA 2Y0SA 4ANJA 1MMDA 5KNLA 3KX2A 3HPHA 2F4IA 3A4CA 2FUG2 2OUMA 3VSLA 3OYIA 3N05A 4P5OA 4IKFA 3L2UA 4CCMA 4Y33A 1E0EA 3GBGA 4CCNA 4PK4A 4CA0A 1Z3XA 1Z7LA 2I8DA 2K9MA 2VASA 4DBRA 1D0YA 2RQQA 5HOOA 1ZELA 4II3A 1NG6A 4PJLA 5CPRB 3VSKA 4ZTFA 2JVHA 4E7IA 3OS2A 1Z21A 1WJAA 3DWLE 4GRIA 3SDBA 4XOPA 3MD2A 4BQOA 3LSKA 3LFUA 3W3CA 4HSRA 3DU5A 4LITA 2MABA 1V5GA 4BL0B 2Z2SB 3OYBA 3C2GA 1LDKB 2V26A 3OS0A 3OYCA 5FRNA 3FKJA 3QYBA 4KITB 2WY8Q 4EATA 3IP4B 2AQEA 4DGWB 3OYGA 2OV7A 2DT6A 2X1CA 2JA2A 5HNFA 3KEYA 2ELJA 3AL0B 4F91B 1KONA 3OYHA 1DP3A 3OOUA 4BE1A 1D1BA 3K6GA 2JUGA 4E7LA 4NC8A 2HVSA 1HA8A 3CZ6A 4HPQA 2Z1DA 2UWMA 3FHNA 2IS2A 1LVKA 1W36D 4AU7A 3HOSA 3VDXA 3PSFA 2LY2A 4OAZA 4XLFA 2KHMA 4HRIA 4IQJA 4LIVA 4ZC3A 2F5VA 3OYKA 2A5WA 3K4KA 4PSXA 3PL8A 3OS1A 3H0DA 3D5RC 3D5LA 3H5RA 4FETA 3OYAA 2PJRB 4XKWA 4YEJA 2VQHA 2XF5A 1FMWA 2LY1A 2ZXIA 2CV0A 2VIXA 4BGDA 2IS1A 3CJRB 1IRXA 4ZYAA 2UV1A 2AQFA 3L2VA 3S32A 2HPIA 4IZZA 3OL3A 4BQQA 1D1CA 1WJFA 1G8XA 2A6TA 3ZQQA 4XLHA 2JVGA 3PJRA 2V7FA 3RQ4A 3OR1C 4CCLA 4B44A 4XMYA 3HKZA 1MNDA 2V9KA 1R6RA 2R7VA 3IAM2 1BR4A 1WFXA 3OYEA 3HL2A 4BJTA 2RNGA 2IS4A 4LIUA 2BOLA 4BU2A 5HVQC 1LFPA 5LFAA 3OYJA 3BG7A 5HLTA 1X4OA 2LREA 2ZXHA 3KYLA 2W82A 2DCEA 2M7BA 2MD0A 3F9KA 2IGMA 2R7WA 4P1WA 3K70D 1WJDA 3E0JB 4MLOA 3ZXSA 4N4OB 1DQUA 2V1NA 4PJNA 5CQEA 4DBQA 1N77A 5FROA 3PNYA 3IUOA 3RCOA 2MYSA 2X6XA 4XORA 4RMNA 1PYVA 2HQAA 4B48A 3W2AA 1LKXA 2L5QA 4U87A 2VKDA 2M3AA 2R7UA 2P0WA 3OIPA 3K4BA 4XR6A 2VB6A 5KHDA 2M4GA 3U21A 4DOZA 3MKYB 3ZCOA 3S8PA 4C9YA 3HPGA 4XLCA 1X1CA 3MKZA 1YX5A 3K4MA 3AKZA 1J09A 2LRDA 2IS6A 4C2UA 2HVRA 2IGOA 3UNGC 3HOTA 4BEHA 4NNJA 4HNTA 3BC8A 2M4KA 1GLNA 2Q1ZB 3NWTA 4PSWA 3VWBA 3QYEA 2E5ZA 4PJJA 1N78A 2KRCA 1UELB 3E1SA 2DXIA 3VYTB 3NWSA 3CF2A 4XOTA 1K6YA 1Y6IA 4BE2A 4KISA 2BVMA 2IXSA 4ZTJA 2E5NA 4CCJA 2RREA 4E6KG 1W36C 5LD2C 4N4NB 4XLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6R A;  1SFK A; 
#chains in the Genus database with same CATH topology
 3FDY A;  3LOC A;  2OPT A;  3K2Z A;  3VOD A;  1AA7 A;  3ERE D;  2AS5 F;  2CGP A;  2OCC H;  2OQG A;  4XM3 A;  5C4J J;  5JHF A;  4L18 B;  2DOA A;  2X6O A;  2FMY A;  3GFJ A;  2KMU A;  3MZ8 A;  3CJQ B;  4DW6 A;  1OIS A;  2WB1 N;  3V7C A;  4IJA A;  3GWZ A;  1HOM A;  4KIF A;  4FE4 A;  2VJJ A;  3BG6 A;  1UG0 A;  3JAM K;  2O61 A;  3LNQ A;  5ICF A;  2QBY B;  1R7J A;  2HS5 A;  3PSI A;  1Z77 A;  2OD5 A;  5HS8 A;  1QU3 A;  2GOM A;  4CCO A;  1XGO A;  3MWM A;  3HJE A;  1K78 A;  2DA5 A;  3M8E A;  4HF0 A;  5M3M J;  3IL2 A;  1Y0U A;  3GYH X;  1BBY A;  5H6R A;  5LGT A;  2MGQ A;  2FOW A;  3FXO A;  2ACJ A;  2A07 F;  3RPU D;  4KUM A;  2H6C A;  2DJI A;  4HQM A;  1MMS A;  2Z33 A;  2HNH A;  1MMN A;  4BAC A;  3BR5 A;  1XPX A;  5ILV A;  3CP2 A;  2DOE A;  4DQ2 A;  3LAP A;  4FT8 A;  2E1M C;  4U7B A;  3LSM A;  3D5S C;  4ENJ A;  1VZ0 A;  3F3X A;  2V1D A;  3BZK A;  4QPQ A;  3I4M J;  2CQX A;  1DGR M;  2LG4 A;  2OTJ I;  1BOA A;  1V4R A;  2GOX B;  1X2N A;  1HW2 A;  1WJE A;  1WCM J;  3HXL A;  3LWF A;  3KP6 A;  3SEZ A;  3QQA A;  2QSG X;  1FBU A;  2E2H J;  2R4G A;  5IOY A;  9ANT A;  3F6V A;  4RA2 A;  5FJ8 J;  3BCB A;  1WJ5 A;  2WBM A;  4IRI A;  5EG0 A;  3JR9 A;  4WWC A;  2KFD A;  3W6V A;  2VL8 A;  3EDP A;  4E7J A;  2VJI A;  1DGW Y;  5DD4 A;  1BR1 A;  2DYR H;  4OIQ F;  1KQ9 A;  3F6O A;  4RM2 A;  4Y17 A;  4M73 A;  1Y56 A;  1X1A A;  3LL7 A;  4HYE A;  3S3M A;  4R79 A;  2HDD A;  4IRH A;  3KEQ A;  2I5U A;  1JJ6 C;  1Y1W J;  4AC0 A;  1HKT A;  5JLW A;  2B7E A;  3REO A;  1X3U A;  4V19 K;  4KA4 A;  2FX0 A;  3F8B A;  4EJT A;  3J7A Y;  2EWN A;  2KDO A;  1U6G A;  3FXM A;  1BM9 A;  3FZV A;  4YFN F;  1SAX A;  2ZSH B;  4TV7 A;  2GBY A;  2JZY A;  1D0Z A;  3LSJ A;  3M8F A;  1YW9 A;  3TL4 X;  4C3H J;  3BZC A;  4EJO A;  1MIJ A;  3SZG A;  3EUH A;  5J8F A;  3OOP A;  1Q1H A;  2BW3 B;  2GAU A;  2ID6 A;  2DW4 A;  2WAD A;  1YX3 A;  4RLF A;  2R7Z J;  2ZB9 A;  3HC7 A;  3WU0 A;  2QEN A;  1XSD A;  4RAF A;  3QOE A;  1ZKG A;  2NOJ B;  5TRD A;  4B1R A;  1WJC A;  3B6C A;  3BDD A;  3BPX A;  1S6L A;  2A61 A;  5E79 C;  1IXR C;  4AYB N;  4AVZ A;  2K9S A;  3MAJ A;  4UV8 A;  4JOM A;  1ZK8 A;  1EH7 A;  3DTE A;  5E8I A;  2HQ5 A;  2D2W A;  1P4A A;  1QPM A;  4OWR B;  1P7J A;  2ZO4 A;  3ZMS A;  4ZDL A;  3OMY A;  3GW2 A;  1HSJ A;  3I3L A;  1D0X A;  2RNJ A;  2WAE A;  4KT6 A;  4KN7 X;  5J1Y A;  4F3Q A;  5BPD A;  5CKT A;  3FXK A;  2HR3 A;  1VI0 A;  2MW8 A;  4DYR A;  3BRO A;  1IJW C;  2GA2 A;  1FT9 A;  2VE9 A;  1QPI A;  1NG7 A;  4NQW A;  1AKH B;  3K9T A;  5D8L B;  2NXN B;  2JRM A;  3R60 A;  3DBR B;  3P5J A;  3DEU A;  4BKX A;  4RBO A;  1U9N A;  3BTI A;  3QYF A;  2CUJ A;  4KT5 C;  2FF4 A;  2W7N A;  1B59 A;  3A1Y A;  5J1U A;  1YHQ I;  2BYV E;  2FRH A;  2XDV A;  4GDF A;  3KIO A;  3O8G A;  2X85 A;  3K4L A;  4QPO A;  3I56 I;  1TBX A;  4HW0 A;  2L2O A;  1V55 H;  3CES A;  3JSO A;  4OIN F;  1UJ8 A;  3WU1 B;  2FSW A;  1J75 A;  3ZGK A;  4O3M A;  4XN3 A;  3CO7 C;  1UAA A;  1FOK A;  4BH9 A;  2KZV A;  2PJP A;  2NYX A;  1YJW I;  4NUB A;  1UMQ A;  4CCK A;  2N8G A;  3M8J A;  2E2J J;  1POG A;  2LP0 A;  4UUT A;  1LEA A;  2WY7 Q;  5H6Q A;  3TW6 A;  1JKQ C;  2HOS A;  1WRJ A;  3FF5 A;  4L9J A;  3F8F A;  1K61 A;  5A2Q K;  2JQ7 A;  4G6T B;  3EUH C;  5GP9 A;  2G7U A;  3E5Q A;  3NAU A;  4BAY A;  1LUJ B;  3GX4 X;  4PGG A;  4LLN A;  4C3J J;  5JR3 A;  1OCT C;  1JKR C;  3CDH A;  3DLA A;  1MSE C;  1MH3 A;  1TLH B;  2GXG A;  1Y8R B;  4H0E A;  3ASO H;  2K5C A;  1LPQ A;  2FNP A;  3OR2 C;  3KYC B;  1B1B A;  1OPC A;  3QRF F;  4A3I J;  1F43 A;  3WTU C;  2JA5 J;  3Q0V A;  1SMY F;  1K7A A;  2JUC A;  2KL4 A;  4JX5 A;  2PJR A;  1IN7 A;  3HM5 A;  1YLF A;  2XUB A;  2QKL B;  5CVI A;  3T0Y A;  4ZDO A;  2OQR A;  3S14 J;  3HSF A;  2CW7 A;  2COB A;  2DA2 A;  3JRF A;  1TW2 A;  1UHS A;  4ANJ A;  3SQN A;  1ZGJ A;  3KX2 A;  3ZN0 A;  1ZR4 A;  3DXJ F;  1SMT A;  1K4T A;  3BPV A;  1NK3 P;  4DYC A;  3N05 A;  3QOP A;  5FB2 A;  3DP7 A;  5E1X A;  3CUQ A;  1U5T A;  4CCM A;  5F1R A;  1E0E A;  4CCN A;  1ZHF A;  4FE7 A;  4YG2 F;  1Z7L A;  2CQN A;  2VAS A;  1O3T A;  1KYZ A;  1YW8 A;  5DCM A;  3V8J A;  4DBR A;  1KGS A;  2RQQ A;  1NH3 A;  5HOO A;  4PJL A;  1NG6 A;  3LA3 A;  3HUG A;  2MA3 A;  4ZTF A;  3BY6 A;  1JUS A;  4EGY A;  2PX9 A;  2FU4 A;  2QUF A;  4Q48 A;  3DWL E;  4GRI A;  3SDB A;  1S3J A;  3P9C A;  3MD2 A;  4MFD A;  2Z5U A;  3W3C A;  4XLP F;  4S0H B;  2DFH A;  1V5G A;  3L7W A;  4M71 A;  5ICE A;  4BL0 B;  1ZGW A;  1UFM A;  2Z2S B;  2ECB A;  2XRL A;  1KZH A;  3PIP F;  1EJ9 A;  3OYC A;  2EJR A;  2L7M P;  3NRV A;  4EQQ A;  1O57 A;  1F4K A;  2L4A A;  5FRN A;  1R5G A;  1TT5 B;  3BTC A;  3U1K A;  3OYG A;  2DMN A;  1H89 C;  1P7I A;  1A6I A;  2DT6 A;  2JA2 A;  5HNF A;  3KEY A;  1ZH5 A;  1L3L A;  3GME A;  3OOU A;  2E2I J;  2F4O B;  1SVO A;  1FC3 A;  2BHZ A;  2Z1D A;  2UWM A;  1P4X A;  1QQI A;  1DDN A;  3QPS A;  4ESB A;  5IPA A;  1UHM A;  2YU3 A;  1ZLK A;  2FQ3 A;  1XS9 A;  4KNY A;  1JGS A;  3K1N A;  4G6Q A;  3HIF A;  3CO6 C;  3ZQF A;  4YIR X;  2LLK A;  3G1O A;  3LST A;  4OAZ A;  4OMZ A;  2J5O A;  2KHM A;  2FBK A;  3O2P E;  1YJ9 I;  4OU0 A;  2TDX A;  3K4K A;  3PL8 A;  2P5V A;  3D5R C;  3H5R A;  1AOY A;  3OYA A;  1R5H A;  5F27 A;  2O3F A;  2O9L A;  4KN4 X;  1Z9C A;  1Q1V A;  4WXC A;  1FMW A;  5GTI C;  1MBK A;  1Y1V J;  3P9I A;  1N25 A;  4RB0 A;  4BGD A;  5L3B A;  5BOX A;  4ZYA A;  2KIF A;  3D0S A;  2QVO A;  3F8C A;  2UV1 A;  2Y31 A;  5BNG A;  1FEX A;  1D1C A;  4FTH A;  1BI1 A;  5IT9 K;  3MN2 A;  2V7F A;  3FMS A;  1FSE A;  1OQY A;  1A6Q A;  1G3W A;  4QLC U;  1ORK A;  1MND A;  1VQK I;  1R58 A;  1R6R A;  1JHF A;  2V9K A;  1YO5 C;  2R7V A;  5F0F A;  3GUD A;  4IOA F;  1G3T A;  2IA2 A;  1I1S A;  1DP7 P;  2RNG A;  5HVQ C;  3CUQ C;  1ONV A;  1U5T C;  3BG7 A;  2VPR A;  1QZY A;  2QBY A;  3M4O J;  2DFI A;  3KYL A;  1ON1 A;  2J5P A;  2W82 A;  4L9T A;  2IGM A;  4P1W A;  5B5E C;  1X3W B;  4MLO A;  3BJA A;  1ZAO A;  4N4O B;  4WXD A;  2R5Z B;  2QSH X;  4M6X A;  1UCR A;  1BJA A;  3BR1 A;  4ABZ A;  1N77 A;  1BIB A;  3S17 J;  3N4M A;  3SZP A;  1SC7 A;  5CVU A;  3RDI A;  5GPC A;  3BQZ A;  4EVI A;  4XID A;  1FTZ A;  3RKW A;  3WTV C;  4ZYE A;  3PM1 A;  2VOP A;  2X6X A;  4Y52 J;  1FLI A;  2VKV A;  1DPU A;  1X2M A;  3W2A A;  2JK3 A;  1LKX A;  1X58 A;  4X6A J;  1QO0 D;  3OIP A;  1RI7 A;  3P9K A;  1MJB A;  3ECO A;  2VB6 A;  3ABT A;  4ESJ A;  3ZMT A;  2COM A;  1YIJ I;  5DM7 F;  2M4G A;  2EB7 A;  3ZCO A;  1HQC A;  3GFL A;  4C9Y A;  3L00 A;  3KFW X;  3HPG A;  1R4N B;  1X1C A;  3BP8 A;  1IG7 A;  4HOB A;  1FOX A;  2LRD A;  1A36 A;  2IS6 A;  1W1W E;  2HVR A;  2Q8K A;  2K27 A;  4ASN A;  3NQO A;  4CO8 A;  3CQZ J;  1GLN A;  3K2A A;  4BXX J;  4PSW A;  5M5X J;  4PJJ A;  3V4G A;  5FD6 A;  1N78 A;  4RGU A;  3E1S A;  4BHC A;  3VYT B;  3Q0W A;  3FXQ A;  3EYY A;  3ULQ B;  4EM1 A;  3CD6 I;  2ZXW H;  4XOT A;  1S72 I;  1Y6I A;  1LB2 A;  2ELH A;  2YPR A;  5E3N A;  4N9I A;  3ZMU A;  2RRE A;  1OCC H;  3COA C;  3BR6 A;  5JVT A;  4HNV A;  2ZME B;  3H5A A;  4BHP A;  3L2R A;  4X0G A;  1YI2 I;  1RPW A;  4I99 C;  3G71 I;  4A2U A;  4K2E A;  2FBH A;  4G12 A;  2K40 A;  4F52 A;  3HOV J;  3V7S A;  3H35 A;  1H9T A;  1U3E M;  3AL0 C;  3IH4 A;  1IGN A;  1WKM A;  1TWG J;  1NK2 P;  3IRQ A;  3RSN A;  5J47 A;  3LSR A;  3SEQ A;  4ZH4 F;  2YUS A;  4A3D J;  2Y9Y A;  3CLO A;  1EH8 A;  3HBL A;  3LSI A;  2Y0M A;  3I58 A;  3GTG J;  2NNN A;  2XAQ A;  1IO2 A;  5CQG A;  5IY5 H;  3CCR I;  2ZXJ A;  2CUF A;  3Q0U A;  1IUF A;  1QHH D;  5D6F A;  1D8J A;  4YRV A;  3S15 J;  4HZF A;  2WAQ N;  1OYY A;  1B9M A;  2K3P A;  2VN2 A;  5F64 A;  3M3Y J;  2XAJ A;  1ERD A;  3ECH A;  3IC7 A;  4MQV A;  1SD7 A;  3HGY A;  1W5C C;  2CSO A;  2LF7 A;  3H3U A;  2AXT C;  3EUK L;  3RYR A;  3RPU A;  2M2E A;  1YE9 A;  4P9F A;  4S04 A;  2GWR A;  2BVL A;  3S3N A;  2VOO A;  1TW3 A;  2QQB A;  2ME6 A;  4R1H A;  3ABK H;  4FX4 A;  4F93 B;  3QPT A;  3S1M J;  4XLE A;  2Z16 A;  1B8I A;  1O4X A;  3NEU A;  1LQ1 A;  2EZK A;  1SD6 A;  4NBQ A;  2V6C A;  1T08 B;  1ZN2 A;  3PQK A;  2VQL A;  2HOT A;  4AWX B;  2EZL A;  1R23 A;  3E5U A;  2P81 A;  1JTY A;  3QOD A;  5CVV A;  2VT3 A;  2K86 A;  3ZRG A;  4BQA A;  5KCM A;  4RB2 C;  3K10 A;  2LYC A;  5HDN A;  1TT0 A;  3B02 A;  4LB6 B;  3OIQ A;  5HLG A;  2KPM A;  5F1J A;  1XDU A;  5JLX A;  2M0C A;  3I59 A;  4EM2 A;  2F5F A;  2IAI A;  2R93 J;  3EYI A;  3HSR A;  2LR8 A;  3CDL A;  2HYJ A;  5D5V B;  2QM3 A;  1T39 A;  5FFX A;  4JK1 X;  1AKH A;  1YW7 A;  1KA8 A;  2VLA A;  3RTR A;  3R0A A;  2E19 A;  2L01 A;  2PQ8 A;  2VT2 A;  2GXA A;  4Y4R A;  3C2H A;  4BUP A;  1KU2 A;  5K1Y A;  4G7O F;  2L9N A;  3F72 A;  3CCL I;  3W6K B;  2FQ4 A;  2WB1 A;  4PDK A;  4B3X A;  1SFU A;  1FOW A;  4KIG A;  4ZYG A;  1DU0 A;  2KZG A;  3CP8 A;  2FXA A;  4X1E A;  1T0F A;  1FTT A;  2LH9 A;  1JI8 A;  3HHG A;  2BV6 A;  3BG5 A;  1MMA A;  1TNS A;  3J7Z I;  2BE5 F;  4JX4 A;  2MFZ A;  5IP9 J;  3CC7 I;  5HS7 A;  1OFC X;  4PUS A;  1VQN I;  4B47 A;  2HQR A;  1MBJ A;  2XVC A;  4ITV A;  5DM6 F;  2QKM B;  5AIP A;  2JN6 A;  2L9V A;  1QHG A;  2E71 A;  2DMP A;  1ON2 A;  3DFG A;  2P7V B;  3ZR8 X;  2IPQ X;  2NVY J;  1REP C;  4OAY A;  3LSP A;  4E4H A;  4RM3 A;  1R36 A;  1VQ5 I;  4UUV A;  5FGM A;  4D9J A;  3W2W A;  1G2H A;  2EBI A;  4C3I J;  2H1L A;  5DS9 A;  2L7K A;  4H4K C;  1HST A;  2XHK A;  2QA4 I;  4BJ5 C;  3WG9 A;  3M1C A;  1O3S A;  3IAS 2;  2V1U A;  4QWQ A;  2B63 J;  1ETO A;  3F23 A;  3FX3 A;  5L3D A;  1I6X A;  3T8T A;  1FY7 A;  1G3Y A;  2W4S A;  2CQK A;  2LOO A;  4GXO A;  3TDZ C;  4NDL A;  4A12 A;  4A3C J;  4L9N A;  3GF2 A;  1I6H J;  2CUZ A;  3FM5 A;  3IRR A;  3OYF A;  1WHU A;  3PFY A;  1MD0 A;  2MSY A;  2Y30 A;  2V4J C;  3H3Z A;  4BY7 J;  4LG3 A;  4FAS D;  1W4M A;  1YS7 A;  2X1E A;  5CLS A;  4DJA A;  2DN0 A;  1Z0X A;  1Z6R A;  1MBF A;  1RR7 A;  2F5E A;  4G6D A;  5F6F A;  2VOD A;  2LK2 A;  2H8W A;  1BOB A;  1F36 A;  1MBE A;  2X51 A;  4E7Z A;  3OL4 A;  3ZN1 A;  3K70 C;  3ISP A;  4RAZ A;  1CF7 B;  2RC4 A;  3FXU A;  2E36 A;  4OIP F;  3ML6 A;  4WCG A;  4E7S A;  3CLQ A;  1JUM A;  3L2W A;  2MC4 A;  4LK1 F;  4ENM A;  3BTJ A;  3FIS A;  2G9W A;  1V5F A;  1RZ4 A;  3N97 A;  1YYV A;  1HBX G;  1IXS B;  3HTU A;  3JAM Z;  1JKO C;  2K3F A;  2KP6 A;  3IKT A;  2CUE A;  2HGC A;  2H94 A;  1QGP A;  1T0F C;  2HZD A;  2XAS A;  2R7T A;  1V5E A;  3JCU C;  3BG3 A;  4HV5 A;  4BNC A;  2GQQ A;  2OJE D;  1ZAR A;  1G4D A;  4XKC A;  4QIW N;  5DUK A;  2LBF B;  4GYI A;  2XSD C;  2R0Q C;  4CXF A;  4XKV A;  3G6E I;  1BW6 A;  3O6B B;  4AID A;  4IHS A;  2XAF A;  1R49 A;  1KYW A;  3E6M A;  2K7L A;  3CME I;  1A31 A;  2R7O A;  5K5Q A;  1R71 A;  3HOW J;  5FKN A;  2A05 A;  2DBB A;  1I39 A;  2BXY A;  3EUA A;  2RDP A;  3C1D A;  3OYD A;  4PJM A;  1C0W A;  4AYB A;  2IT0 A;  1KU7 A;  4Y7N J;  2JWT A;  4LLG F;  1ZG5 A;  4CYC B;  3FHZ A;  1BC7 C;  1NTC A;  1MNE A;  1T95 A;  2DT7 B;  4J01 A;  4U0V A;  1T6S A;  1MMG A;  1HXD A;  1SFK A;  2EFN A;  4PFO A;  4F7Z A;  4CSW A;  1X1B A;  3VYS B;  4HDU A;  1IRF A;  2PN6 A;  2E60 A;  5EZG A;  2VQG A;  4AIH A;  5FLV A;  2DPD A;  3DLL F;  4MHG A;  2Y0S A;  1MMD A;  1TWA J;  5LBQ A;  1GHC A;  3FIW A;  3HPH A;  2PI0 A;  4RGR A;  2CQQ A;  2M9H A;  3BJO A;  3DEW A;  4LOC A;  2JJ7 A;  4P5O A;  1PDN C;  4IKF A;  5CJ9 A;  4Y33 A;  3J7Y J;  2B0L A;  4IHV A;  1E3O C;  5LRR A;  4I0A A;  1XCV A;  3ZQ7 A;  3WGH A;  4MO7 A;  1BI0 A;  3E97 A;  2DOD A;  1ZEL A;  1KU9 A;  4G9Y A;  4II3 A;  3WGI A;  5CPR B;  1TC3 C;  1J5Y A;  1UZC A;  3KP2 A;  4KMF A;  2Z99 A;  1Y0N A;  1I1G A;  3OSG A;  3KE2 A;  4FHT A;  1LFU P;  3F0C A;  4HSR A;  4MGR A;  2F2E A;  2MAB A;  4NC6 A;  3ZOB A;  4LG0 B;  1XGS A;  2D5V A;  4Q4Z F;  3C2G A;  1LDK B;  2P6S A;  5ED4 A;  3OS0 A;  4M3F A;  3MCZ A;  3QYB A;  4KIT B;  1ACI A;  3IP4 B;  3BR2 A;  5DD8 A;  5DV5 A;  2LSO A;  2L3D A;  2X1C A;  3GTK J;  4BBS J;  5D5W B;  2ELJ A;  4F91 B;  1DP3 A;  1D1B A;  2D1V A;  3NAR A;  4IXA A;  4A0X A;  1DUX C;  2JUG A;  4I09 A;  3D1N I;  5K5R A;  2DA4 A;  3KP5 A;  1HW5 A;  3GEZ A;  3TP3 A;  3CTA A;  2HVS A;  4JYK A;  1HA8 A;  2DMQ A;  3FHN A;  3QPL A;  4YII A;  5K7F A;  1JKP C;  5CVR A;  4AU7 A;  3HOS A;  3VDX A;  3PSF A;  2M5W A;  2LY2 A;  5ILU A;  2QF7 A;  3IV5 A;  2JPC A;  4U7D A;  3FMR A;  3GTL J;  5E3O A;  3OYK A;  2W84 A;  1VF9 A;  4GGG A;  4PSX A;  5D4S A;  1IXC A;  3H0D A;  3WU2 C;  1XGM A;  4IOC F;  5CVJ A;  5EYR A;  3WTZ A;  3R61 A;  1O3R A;  4GO1 A;  3EQL F;  2VQH A;  5IP6 A;  3G3Z A;  4YFK F;  1EV7 A;  3MKL A;  2R7D A;  2Y75 A;  2GIZ A;  4M3D A;  2NVT J;  3PQJ A;  3VOE A;  1XD7 A;  2UXN A;  4HDV A;  4IZZ A;  2KKO A;  1WJF A;  1DPR A;  2ZME A;  1F5T A;  1VQ8 I;  3ZQQ A;  1SFX A;  2JVG A;  4EEF G;  2C6Y A;  2XB5 A;  1FYL A;  3TO6 A;  4CCL A;  2FA5 A;  3JRH A;  3GVA A;  2L9R A;  4XRS A;  3IAM 2;  5F0H A;  4G8X A;  3OYE A;  2L7F P;  3ZMV A;  2HOE A;  1IV8 A;  2OBP A;  3QWL A;  4FCY A;  4AM3 A;  2A68 F;  1MBH A;  5LFA A;  2CRG A;  2YX4 A;  2ZXH A;  1JT0 A;  1VQ6 I;  2FOK A;  3BT9 A;  2IA1 A;  1I27 A;  2MD0 A;  2KJC A;  5IOZ A;  1RUO A;  2XB0 X;  5EF6 A;  4P55 A;  1CQT A;  4ETS A;  1W5S A;  3KZY A;  3ZXS A;  2EA4 A;  1FNN A;  1CGP A;  4PGH A;  1JXS A;  5LGN A;  4DZJ A;  4PJN A;  3QP5 A;  4OIR F;  4DBQ A;  2BXZ A;  5GAH J;  4RDU A;  1R9T J;  4EM0 B;  2DT5 A;  3CC4 I;  2Z3Y A;  3IUO A;  2A6H F;  1S7A A;  3LQR A;  4B48 A;  2L54 A;  5C3E J;  4G94 A;  3F8N A;  2CFX A;  2R7U A;  1RNL A;  3GLX A;  2IBD A;  4MFE A;  2P0W A;  2Q0O A;  1YRN B;  2E34 A;  4XR6 A;  3P7N A;  2LKS A;  1UHW A;  4ZZL A;  3U21 A;  1JGG A;  2BEO A;  2DK8 A;  4JBA A;  4DOZ A;  2LF8 A;  2ZJQ F;  2ADU A;  5A2Q Z;  3WHB A;  1G6N A;  2OA4 A;  2HQN A;  1J0R A;  2FML A;  3M9A A;  3T5X A;  3MKZ A;  2XAG A;  3AKZ A;  1J09 A;  1K78 B;  3CDI A;  4LMY A;  3PFI A;  1ZLJ A;  3HOT A;  1E3P A;  4NNJ A;  4BBR J;  3U9G A;  2M4K A;  3JRE A;  2XAH A;  4BYY A;  1GXQ A;  1GUU A;  3QPH A;  4D5C A;  1IF1 A;  3ABM H;  2DXI A;  1A35 A;  3BZ6 A;  1ETW A;  2IRF G;  3JRA A;  2R5Y B;  5HDG A;  2EIK H;  2BVM A;  3JRC A;  2FD5 A;  4ZTJ A;  4E6K G;  1R5I D;  3TOB A;  3U2R A;  2VUM J;  3DBH B;  4N4N B;  1IDY A;  5LHI A;  2KRH A;  1P6R A;  1UB9 A;  1P4W A;  3MFK A;  2NS8 A;  5GPA A;  5IYC J;  3E7L A;  1GXP A;  3WOD F;  1HDP A;  2B9S A;  1V54 H;  1PJR A;  2ZME C;  2W57 A;  2IGK A;  2X6Y A;  1MW7 A;  4M3B A;  4B3A A;  1XMA A;  1MSF C;  3E6D A;  3BLY A;  4NB5 A;  2KT0 A;  3V8L A;  1X3Z B;  4A3K J;  4RLQ A;  2ZFU A;  1DU6 A;  4AUX A;  4L5E A;  2DMT A;  4MNU A;  5LEJ A;  3WTY C;  3MZH A;  2BHY A;  3LQQ A;  1L0O C;  3W2V A;  1U0J A;  1ETV A;  1H0M A;  4A69 C;  3TO7 A;  1YFH A;  2PMZ N;  1G3S A;  1R00 A;  1VQ9 I;  2QEX I;  2Q2E B;  2GM4 A;  3DTI A;  5M5W J;  1Z3Y A;  5E1W A;  4ENK A;  1IN6 A;  2JA7 J;  4XIC A;  5J3L A;  5TJJ A;  3ZP5 A;  1TWH J;  1FYM A;  1F1Z A;  3GCM A;  2ECC A;  3SYT A;  1ZRD A;  1U78 A;  1IN8 A;  1RET A;  3OYN A;  5B3S H;  3HEF A;  1ZGA A;  1G59 A;  1YQA A;  4M9Z A;  2WWY A;  4G7H F;  1OCR H;  2VJ5 A;  4HLX A;  3KCC A;  3ROU A;  2VBZ A;  1SAU A;  4HAM A;  2XF6 A;  1FX7 A;  1WPK A;  4EMS A;  1W0U A;  2F4M B;  2CMP A;  1OYI A;  1TNT A;  2X48 A;  2ZJR F;  1QVT A;  3OV8 A;  2M45 A;  5EEH A;  3FBN B;  2HPM A;  4BS9 A;  3RQI A;  5DDG A;  2NVU B;  1LE8 B;  2YU9 J;  4WF2 A;  3WG7 H;  4IHY A;  2MC3 A;  1GVJ A;  4R8H A;  2A69 F;  3HRM A;  3A03 A;  3OY9 A;  2IA0 A;  2EPF A;  2QQA A;  3TO9 A;  2RAE A;  4BHB A;  2XF7 A;  5FLM J;  5TIS C;  2WA0 A;  3CUO A;  2KIQ A;  1JTX A;  1YIT I;  4RS8 A;  4BXF A;  2O03 A;  3HRT A;  2ZC2 A;  2M8E A;  1ZTR A;  1P2F A;  3X2Q H;  4AVP A;  1TQI A;  1SAN A;  1X19 A;  1D1A A;  1ZRE A;  4IX7 A;  5AIQ A;  3HZJ A;  4AD9 A;  3CCV I;  4XL9 A;  3PIO F;  4CH7 A;  2DPU A;  2STW A;  4YEL A;  1RRJ A;  2CFO A;  5IT9 Z;  1OR7 A;  2CU7 A;  2V6E A;  2V9V A;  3ABL H;  4XON A;  5JHU A;  2W24 A;  3OWT A;  4I7H A;  4D7N A;  3OYM A;  3Q5F A;  1IN4 A;  1SFE A;  3J80 K;  1Z6T A;  4KMU X;  3WTS C;  4UY8 I;  2VXZ A;  3QU6 A;  1EF4 A;  1HC8 A;  4IHW A;  2ZBK A;  2R7Q A;  4IQ4 A;  2FJ1 A;  2DFF A;  3FK7 A;  1XGN A;  2DA1 A;  4RGS A;  2NS0 A;  1BI3 A;  5LHH A;  4A3G J;  2QQ9 A;  3GTP J;  3M1E A;  3CMA I;  4NQW B;  3RZD J;  1W5T A;  3H9J A;  2WAQ A;  2CV1 A;  3BCA A;  2LBF A;  4HX4 A;  3KPH A;  2XKO A;  2X0L A;  4J00 A;  3K4J A;  3DPL C;  3ASN H;  1HKQ A;  2E35 A;  1LDD A;  2CJJ A;  4HBL A;  3FXR A;  3OSF A;  4RB3 C;  1W0T A;  1XDS A;  2OU2 A;  4PFP A;  2JPB A;  3PNT A;  2R92 J;  4KIB A;  2CV2 A;  2GA1 A;  1OYW A;  1X1D A;  4BQN A;  3HOX J;  1HF0 A;  5LHG A;  3KLN A;  4CUG A;  1I3A A;  1MJ9 A;  5E3M A;  5M3F J;  5FRM A;  2WC2 A;  1FOY A;  1KQ0 A;  3RIR A;  2YS9 A;  4B43 A;  2HWV A;  4CYC A;  2ZCW A;  3I64 A;  4RAY A;  3KZI C;  3DTK A;  5KAI C;  4KJZ A;  4HNU A;  1ZR2 A;  4XQF A;  3HG9 A;  5JFR A;  1ZG1 A;  2K4B A;  4I6Z A;  5TGT A;  4L9V A;  3CJN A;  3V42 A;  3A01 B;  5E3L A;  4AIK A;  1MZB A;  3GLL A;  2RN7 A;  1S5L C;  2ISZ A;  1A5J A;  3FMQ A;  4JP0 A;  2IGN A;  3A2K A;  3UKG A;  2BZT A;  2RV8 A;  2BW3 A;  5HS9 A;  3UR3 C;  3S93 A;  3Q9S A;  3HDD A;  2D45 A;  4M3G A;  2JMW A;  4HLY A;  4E7H A;  2FNA A;  4ZYH A;  4A0Y A;  2QWW A;  3GTM J;  2JSP A;  1N75 A;  3VEP A;  3BR3 A;  3C7J A;  2ZNZ A;  2L9S A;  1S8N A;  1LEB A;  1J7K A;  2H27 A;  1P9Q C;  3G4S I;  1W7P D;  4L0Y B;  2XGC A;  4DIQ A;  4A5N A;  2EV6 A;  1GT0 C;  2DLL A;  1OR7 C;  2MLG A;  2STT A;  3I9V 2;  4LG0 A;  2QSF X;  1XSX A;  2BBY A;  2IW5 A;  3H0G J;  4U0Y A;  2XRO A;  1XSV A;  1RUN A;  2GIV A;  3IHU A;  2M7A A;  2MD5 A;  1VFC A;  3WTW C;  4XNF A;  1NHA A;  5BMZ A;  3CC2 I;  3A0B C;  4L5J A;  3TQN A;  1TL8 A;  3DPT A;  3TGN A;  3CUQ B;  1U5T B;  3EPZ A;  4W1U A;  2LC2 A;  3L2Q A;  2DU9 A;  1EA3 A;  4KDP A;  1TQP A;  2M8G X;  3E5X A;  3HOY J;  1J9I A;  4HST A;  3KP4 A;  1BR2 A;  2HOA A;  3HUG B;  1OCO H;  4HEA 2;  4UB6 C;  1Y39 A;  2KQR A;  5FFZ A;  2R7S A;  4LD5 A;  5FLX K;  3TKY A;  2H6B A;  2Y48 A;  4D1Q A;  3J81 Z;  1WH5 A;  2HYF A;  2R7X A;  2MG4 A;  4ESF A;  4Y3O A;  4XN0 A;  3F21 A;  3HB9 A;  3AAF A;  2H1K A;  3H92 A;  2VI6 A;  1ZRC A;  1OKR A;  1RES A;  1S7E A;  1E17 A;  2BY3 A;  2TCT A;  1BW5 A;  1D3Y A;  4GYG A;  4I2O A;  2E1O A;  2HXO A;  2V1X A;  2NOG A;  2FUG 2;  3VSL A;  3HKZ N;  1PP8 F;  1ETQ A;  3L09 A;  1QVU A;  3GTO J;  5HLI A;  3GBG A;  5C4X J;  1Z7U A;  1K83 J;  3WTT C;  1Z3X A;  1STZ A;  2DDB A;  4A93 J;  1D0Y A;  2EIN H;  1VQ7 I;  2Z9O A;  1U9O A;  4B09 A;  2XGE A;  4A3E J;  4UVA A;  1R4M B;  3VSK A;  2JVH A;  1WI3 A;  4E7I A;  3OS2 A;  1Z21 A;  3DBL B;  3GZ5 A;  4RB1 A;  1GDT A;  5J6X A;  3CJT B;  4XOP A;  1B72 B;  1U8B A;  1T98 A;  3BJ6 A;  3LFU A;  4G7Z F;  3DU5 A;  4LIT A;  4EJV A;  1T8I A;  2DDA A;  5F0C A;  3RYP A;  3OYB A;  1HLV A;  2V26 A;  2MH2 A;  6PAX A;  3FKJ A;  2M34 A;  2H8R A;  1W7P B;  2OV7 A;  5M5Y J;  5J4V A;  2A3S A;  3FM3 A;  3AL0 B;  1KON A;  4BE1 A;  3H3V K;  3K6G A;  2KRF A;  1OCZ H;  4E7L A;  1YRN A;  2GLO A;  4Z6Y A;  1WZ2 A;  4WX9 A;  4NC8 A;  3G73 A;  4XSZ F;  4M9X A;  1XTA A;  4UUS B;  5KVR A;  2IS2 A;  4XLN F;  4L5I A;  1LVK A;  5AON A;  2W25 A;  1W36 D;  5DYM A;  5L3E A;  2DQR A;  2EIM H;  2DMU A;  2OF7 A;  4XLF A;  3ZQH A;  2EFW A;  2AO9 A;  4HRI A;  4IQJ A;  4Y13 A;  4U88 A;  4LIV A;  4ZC3 A;  2F5V A;  1O7F A;  2A5W A;  5DCF A;  2R7F A;  3D5L A;  1WVR A;  1TQM A;  2DK5 A;  2DYS H;  4LGW A;  4XKW A;  3ELK A;  2LY1 A;  1XX5 A;  2ZXI A;  1P92 A;  1ENH A;  2CV0 A;  1YOV B;  2OAZ A;  2R5Y A;  1VTN C;  1VND A;  3GO5 A;  1KQ8 A;  3CJR B;  1IRX A;  3V8K A;  3G1L A;  2AQF A;  3L2V A;  3S32 A;  4EGZ A;  2XV4 S;  2E7W A;  3OL3 A;  3HGG A;  4BQQ A;  4C2M J;  5GAD J;  5K5O A;  5F04 A;  4P9U A;  1G8X A;  2A6T A;  1XCB A;  2VKE A;  2CWE A;  4XBF A;  3C18 A;  3RQ4 A;  4IPA A;  1ETK A;  1JT6 A;  4MEY F;  3I54 A;  4XMY A;  4BXU A;  1K6O A;  2G7H A;  1VQL I;  2OZ6 A;  4BY1 J;  1Z1D A;  2JRT A;  4I98 B;  3LAJ A;  5FD5 A;  1WFX A;  1YS6 A;  3HL2 A;  2ESN A;  4ZYD A;  1XC5 A;  4O5V A;  4A5M A;  4LIU A;  2BOL A;  4BU2 A;  3L2C A;  3PUF A;  3WGG A;  5HLT A;  1MBG A;  1PUE E;  2LRE A;  2W85 A;  3FKI J;  3KP7 A;  3KYD B;  3T8R A;  1SD4 A;  3C2B A;  4XSX F;  4FX0 A;  1FSH A;  2ZFW A;  2DCE A;  1KU3 A;  2R7W A;  3K70 D;  3S2H J;  2EZI A;  1LVA A;  5L3G A;  2NVQ J;  1DQU A;  2NAZ A;  1B4A A;  5CQE A;  5E1Z B;  5FRO A;  2NNY A;  3HOU J;  2Q2E A;  4PJ0 C;  4N0B A;  3ZQI A;  3PNY A;  2KIU A;  1IAW A;  3HOZ J;  3SJM A;  4RGX A;  3IWZ A;  4IHT A;  4XOR A;  4RMN A;  3ZQG A;  3CCM I;  3ZQL A;  1R1V A;  1JHH A;  3HRS A;  2M3A A;  4WXH A;  1GVD A;  3B73 A;  2BY2 A;  1H9G A;  1UG2 A;  1WQ2 A;  2LTP A;  5D8K B;  1WSU A;  2LD5 A;  1TWF J;  3RKY A;  2CQ7 A;  3S8P A;  5GTH C;  3L1P A;  2VON A;  1IW7 F;  1QRY A;  4XLC A;  5J8C A;  1WWX A;  3K4M A;  2HKO A;  2CW0 F;  2K9N A;  3HRU A;  1APL C;  4C2U A;  4RAG A;  1LE8 A;  4V2F A;  5EGO B;  4HNT A;  1SD5 A;  1VQO I;  3BC8 A;  5H20 A;  3O3K A;  3NWT A;  4LJZ F;  3S1R J;  3HSE A;  1FYK A;  4XRF A;  4OMY A;  2ELK A;  1TWC J;  2X4H A;  2R5Z A;  1OMI A;  1LNW A;  2EIJ H;  3CF2 A;  3LA2 A;  5E18 F;  1K6Y A;  2PBI A;  5K7Z A;  4BE2 A;  4MTD A;  2IXS A;  1RIO H;  4CCJ A;  2HYG D;  4UXN A;  3WE3 A;  1AWC A;  1U8R A;  2O8K A;  1ODD A;  4XLA A;  3O8H A;  2O0Y A;  4II2 A;  4XK4 A;  3V7R A;  1BA5 A;  2DOF A;  1B8I B;  2VPL A;  4FIS A;  2VXD A;  4MEX F;  4UNO A;  3I71 A;  4QSH A;  1IRG A;  2VJ4 A;  1SFO J;  1IUY A;  5K7H A;  1PUF B;  1TTY A;  2O7O A;  2CH0 A;  3FBI B;  4IL6 C;  4HA8 A;  3JW4 A;  3KZZ A;  2NRA C;  1YIO A;  2L7Z A;  4FQG A;  1IV6 A;  2XRN A;  2CYY A;  1SEU A;  2M87 A;  2PEX A;  2RGV A;  2KLO A;  2Y0S N;  5EJC A;  3FXJ A;  3MEX A;  1QZZ A;  4S05 A;  3I59 B;  3VYU B;  1FMV A;  2UXX A;  3K0L A;  2PMH A;  3H5N A;  1BL0 A;  2ZNY A;  2O6G E;  2E1M B;  3GFI A;  1OLT A;  2XPW A;  2V79 A;  1FP1 D;  3LMM A;  2LMD A;  3F22 A;  1E2X A;  2BY0 A;  4ZDP A;  4B4C A;  4M72 A;  1A04 A;  1VQ4 I;  2VBW A;  5D4R A;  1FZP B;  2W1O A;  3LSH A;  1X4P A;  1U2W A;  2LY9 A;  1BI2 A;  4MQ9 F;  2ZSI B;  3E6C C;  2HU9 A;  3H9G A;  4Z2Y A;  3MKW B;  1RR8 C;  3GTQ J;  2W00 A;  2QQ8 A;  2YX7 A;  5D6E A;  4HF2 A;  2X6W A;  4EJU A;  3WTX C;  3B6A A;  2KIM A;  4A6D A;  1J2X A;  3SFZ A;  1XMK A;  4QTR A;  5DUI A;  4CIC A;  2HVQ A;  2G0E A;  2UUZ A;  3I53 A;  2CS3 A;  4AIJ A;  1WJB A;  2IVM A;  4UVC A;  1XB4 A;  3M7G A;  4BEH B;  4BE0 A;  3SXY A;  3MQ0 A;  3DKX A;  4M3E A;  3K7A J;  3K4C A;  4LLL A;  3A01 A;  3RJP A;  2Y2Z A;  4M74 A;  3KP3 A;  3JRI A;  5JI6 A;  1MNM C;  2IJL A;  2F6C A;  2JA8 J;  2L0K A;  2WAF A;  3AFH A;  1SVL A;  3U1D A;  1MDM B;  4IF4 A;  2EV5 A;  1BN5 A;  2Y9Z A;  2WTE A;  1D8K A;  1USS A;  3SHF A;  1VQM I;  2ESH A;  5JVG F;  4UVB A;  3MMY B;  4BDY A;  2NS7 A;  4CYD A;  1HW1 A;  2EFQ A;  3TP0 A;  3S3O A;  2XC7 A;  4M6V A;  4HF1 A;  4NC7 A;  3CCJ I;  3KLO A;  5LGU A;  4CZC A;  5LLQ A;  3DV8 A;  3A02 A;  1ZQ3 P;  1XMX A;  3IWF A;  4UB8 C;  1FIP A;  4A6E A;  2FEZ A;  3HHH A;  2K02 A;  2P4W A;  2YR2 A;  3M07 A;  4XKB A;  3FXL A;  1ZRF A;  4HQE A;  2E1C A;  4GCV A;  1LDJ A;  2M30 A;  2K9L A;  1FWZ A;  4E70 A;  2LKX A;  1YTY A;  2PMZ A;  2VKH A;  3BWG A;  3ZMZ A;  3GZ6 A;  3GXO A;  3FWE A;  1WGX A;  1T56 A;  1QZE A;  2HDW A;  4BJ6 C;  4C30 A;  2VQC A;  2GZW A;  1R22 A;  1MJA A;  1O7L A;  1ZG3 A;  5HOD A;  4JQF A;  1EKE A;  3RPQ A;  3RKX A;  3TBI A;  3L9F A;  1S9H A;  2O5R A;  3VYR B;  2M0M A;  4F55 A;  1HCR A;  1F9N A;  2WV0 A;  3SZT A;  3HTS B;  2ICW G;  3DEE A;  2VBY A;  3G2B A;  3DQV C;  4A3J J;  2D1H A;  3BR0 A;  4M9S A;  2DO7 A;  1IRZ A;  5BS6 A;  1AU7 A;  2KDZ A;  4BDZ A;  5CYV A;  5ICC A;  5B1B H;  4HG2 A;  3C3W A;  4D5F A;  4GFB A;  2K85 A;  4U0W A;  3KEO A;  5EG0 B;  4E7K A;  2OC6 A;  2DAO A;  2ZJ2 A;  4I76 A;  4CGZ A;  2M1B A;  1IZ1 A;  1MGT A;  1Y8Q B;  1ETX A;  3TED A;  4ENN A;  2R3S A;  4I02 A;  1YG2 A;  3I4P A;  5IYB J;  4CDG A;  4IHX A;  3OYL A;  5BPI A;  3TMO A;  5D5X B;  1QBJ A;  3WE2 A;  2EA2 A;  3CCY A;  2OTL I;  2HI3 A;  1LJ9 A;  4HX8 A;  3LFK A;  4UHT A;  4KFC A;  3PNV A;  3Q3S A;  4P96 A;  2ZJP F;  2X1D A;  2EFP A;  4IO9 F;  4C2T A;  2KIS A;  4OIO F;  2EIL H;  3S1Q J;  1ZYR F;  4ON0 A;  3K4N A;  5HDK A;  4MIM A;  3S2W A;  3DKY A;  1B72 A;  2QYO A;  3BQY A;  2XSJ C;  4L0Z B;  3EET A;  3PUB A;  3IKV A;  4DYQ A;  3ONQ A;  1IN5 A;  1S7O A;  4LFU A;  4ZJZ A;  1I3Q J;  3IH2 A;  3CCQ I;  5E8G A;  5IT3 A;  2R7R A;  2QGU A;  3AG3 H;  4KIC A;  2W48 A;  3W6J B;  1W7P A;  3H9Q A;  5FKL A;  3CCS I;  2XAU A;  1MH4 A;  1UST A;  4N9H A;  2DA6 A;  1QNT A;  5ERI A;  2P5L C;  2XPU A;  4O6J A;  4Q47 A;  3KET A;  2E7X A;  3Q9V A;  3QP6 A;  1HKS A;  4UUS A;  2F5C A;  2IP2 A;  5C44 J;  1R1T A;  2A5Y B;  4XRM A;  5BQT A;  5J4Y A;  1MKM A;  3DKW A;  1I5Z A;  3CMM A;  5B1A H;  2VC0 A;  2PG4 A;  4NHJ A;  2CW8 A;  2BY1 A;  5FKK A;  2DJN A;  3DU6 A;  2P6T A;  3QAH A;  2MH9 A;  3DPU A;  2EV0 A;  1PVE A;  1EH6 A;  2TRT A;  1AHD P;  5IP7 J;  1CF7 A;  2EH3 A;  4IVN A;  2OZU A;  4F92 B;  3SDG A;  5HNH A;  1H88 C;  2E1N A;  2NVX J;  1TZL A;  3AG2 H;  3PO3 J;  2FE3 A;  1TP4 A;  1SVM A;  3JRB A;  1JUP A;  2OCE A;  5E20 A;  5ICG A;  4B8X A;  1XN7 A;  3LSG A;  4YFX F;  3JTG A;  5E17 F;  5KNL A;  2HTS A;  5KAF C;  2F4I A;  3A4C A;  1YJN I;  1BC8 C;  2OUM A;  2F48 A;  3OYI A;  2XGX A;  3PO2 J;  3RI4 A;  3J7A O;  4I01 A;  3L2U A;  5F08 A;  3S16 J;  2JSC A;  5H2F C;  5FO5 A;  4PK4 A;  4CA0 A;  2ISY A;  3K1M A;  2K9M A;  2I8D A;  4M6Y A;  3I5U A;  3ZPL A;  5D5U B;  3AG4 H;  4LK0 F;  2V9P A;  3H1C A;  2FBI A;  4PCQ A;  5FKO A;  1B6A A;  3LA7 A;  1WH7 A;  3IH3 A;  2F5D A;  3I4N J;  3ZQC A;  1WJA A;  1VQP I;  4V2G A;  2I10 A;  4BQO A;  2IEK A;  2MBF A;  3JTH A;  3LSK A;  5KK1 A;  4Q5S F;  1ETY A;  2ME0 A;  2JT1 A;  1FBQ A;  1JE8 A;  3GFM A;  1Z91 A;  1V3F A;  1RKT A;  4A3L J;  1RC9 A;  3VFZ A;  3J80 Z;  1T33 A;  5FKM A;  2WY8 Q;  4EAT A;  2AXL A;  2AQE A;  2LNB A;  4DGW B;  3HYI A;  5GAG J;  1HDD C;  2P7C B;  4LB5 A;  2DFE A;  1M1E B;  3BTL A;  3ERM A;  5GAE J;  3A0H C;  2DI3 A;  1JJ8 C;  3OYH A;  1XG1 A;  1OCP A;  2MLK A;  1FBS A;  5HLH A;  1J59 A;  3R4K A;  1RKW A;  5EZH A;  2XKP A;  3CZ6 A;  4HPQ A;  2ID3 A;  1LFB A;  2VE8 A;  2QZ8 A;  4ZZD A;  3GZN B;  4A3F J;  2HXI A;  4PZJ A;  3JSP A;  3ZMD A;  5LRS A;  2VBX A;  2EK5 A;  2AHQ A;  3K1P A;  3CMY A;  3CCE I;  1WI9 A;  3OS1 A;  5EGO A;  4FET A;  2PJR B;  3T1B A;  3MVP A;  1ULY A;  2L02 A;  4W97 A;  4YEJ A;  5L3F A;  5IYD J;  2XF5 A;  1FP2 A;  3TW7 A;  2RVC A;  1I50 J;  4EV0 A;  4CHU A;  2KJB A;  2VIX A;  3OIO A;  3MZY A;  2PLY A;  2IS1 A;  3F8M A;  1IC8 A;  2JTV A;  3BG9 A;  1B9N A;  3RZO J;  2RKH A;  3FK6 A;  4JX6 A;  2PFB A;  2HPI A;  3R0J A;  3R6S A;  2DA7 A;  2DTR A;  4A3B J;  4XLH A;  5L3C A;  3PJR A;  5EEG A;  3OR1 C;  3J81 K;  1FIA A;  4B44 A;  1PP7 U;  2DA3 A;  3HKZ A;  1K79 A;  3E3V A;  4MTE A;  4IRG A;  3S1N J;  3G1M A;  1BR4 A;  5B66 C;  3DF8 A;  2UZK A;  4Y15 A;  3I0T A;  4BJT A;  2LDU A;  5DCM B;  3CF5 F;  3ABU A;  1PUF A;  2IS4 A;  1Z67 A;  1H8A C;  1LFP A;  3OYJ A;  4D0P A;  1X4O A;  2LKP A;  4D7M A;  4J19 A;  3E6B A;  1T38 A;  1BJZ A;  2P5K A;  1D5Y A;  2LVS A;  2YSR A;  2M7B A;  2CG4 A;  5DEQ A;  3TOA A;  4YIF A;  4EJW A;  5DTD A;  1S29 A;  2LFB A;  3F9K A;  2P8T A;  1WJD A;  4UV9 A;  3E0J B;  1BIA A;  1QA6 A;  1IDZ A;  2HDC A;  2ZKZ A;  2HTJ A;  2WV1 A;  2V1N A;  4HV6 A;  3JRG A;  2GXB A;  1OJL A;  2CO5 A;  4KYW A;  1X1P A;  2XPV A;  4OOI A;  2VC1 A;  2JA6 J;  2HKX A;  3WHC A;  1GV5 A;  2XIG A;  3RCO A;  3RKQ A;  2MYS A;  3QU3 A;  2HEO A;  1R1U A;  1FPQ A;  4DNC A;  3SFI A;  2H09 A;  1PYV A;  3CCU I;  3VPR A;  2HQA A;  3JRD A;  2X9D A;  2EFO A;  2L5Q A;  4U87 A;  5J40 A;  2EZH A;  2VKD A;  4I0B A;  1GV2 A;  2DTZ A;  3K4B A;  4A3M J;  2RQP A;  3I55 I;  4CZZ A;  5KHD A;  2ETH A;  3VB2 A;  5J1R A;  1D5V A;  3MKY B;  3K69 A;  2K4J A;  2A6E F;  2L4M A;  1Z05 A;  1YX5 A;  2EQR A;  2QCO A;  1FJL A;  5EEA A;  2HZT A;  2O8X A;  5LEK A;  2IGO A;  4HX7 A;  4IEJ A;  2QLZ A;  3UNG C;  4A0Z A;  4BEH A;  2HFH A;  4XRS G;  3BOQ A;  2Q1Z B;  3VWB A;  2BGC A;  3H36 A;  3QYE A;  2E5Z A;  1K4S A;  2KRC A;  3S2D J;  5FLX Z;  1UEL B;  4WK8 F;  2DQL A;  3ESW B;  3NWS A;  1T2K A;  3AG1 H;  5EDN A;  4DZP A;  3GTJ J;  1O3Q A;  4KIS A;  1E3H A;  2XGD A;  3TDU C;  2E5N A;  1W36 C;  3DCF A;  5LD2 C;  2Y69 H;  1ITY A;  2K9Q A;  2PMU A;  5ILS A;  1MDM A; 
#chains in the Genus database with same CATH homology
 3FDY A;  2KRH A;  3H5A A;  3L2R A;  4II2 A;  4X0G A;  1AA7 A;  4XM3 A;  5JHF A;  2DOA A;  2VPL A;  2VXD A;  2KMU A;  3CJQ B;  1PJR A;  2VJ4 A;  4F52 A;  2IGK A;  2X6Y A;  1MW7 A;  3H35 A;  2CH0 A;  3BLY A;  3FBI B;  2VJJ A;  3BG6 A;  1UG0 A;  3AL0 C;  3PSI A;  4RLQ A;  2ZFU A;  1QU3 A;  3RSN A;  2GOM A;  4CCO A;  3SEQ A;  2KLO A;  3VYU B;  3W2V A;  1FMV A;  3LSI A;  1U0J A;  5CQG A;  3RPU D;  3H5N A;  1QHH D;  2Q2E B;  3DTI A;  4YRV A;  1Z3Y A;  2DJI A;  2E1M B;  1OLT A;  2K3P A;  1ERD A;  2HNH A;  3LMM A;  1MMN A;  4BAC A;  3SYT A;  4ZDP A;  3CP2 A;  2E1M C;  2W1O A;  4U7B A;  3LSM A;  3D5S C;  3EUK L;  3OYN A;  1VZ0 A;  3LSH A;  1YE9 A;  4QPQ A;  2BVL A;  3S3N A;  1G59 A;  1X4P A;  2VJ5 A;  1DGR M;  4F93 B;  2LG4 A;  2ZSI B;  2HU9 A;  3H9G A;  4XLE A;  2Z16 A;  3MKW B;  2W00 A;  2GOX B;  1SAU A;  2X6W A;  2XF6 A;  2VQL A;  2CMP A;  1WJE A;  3HXL A;  2HVQ A;  3SEZ A;  2UUZ A;  3FBN B;  3QOD A;  2CS3 A;  4BS9 A;  2HPM A;  1WJB A;  3ZRG A;  4BE0 A;  5KCM A;  2R4G A;  4BEH B;  3K10 A;  2LYC A;  1TT0 A;  3OIQ A;  2KPM A;  3DKX A;  3BCB A;  1WJ5 A;  3K4C A;  2WBM A;  3OY9 A;  2XF7 A;  2WA0 A;  2VL8 A;  4E7J A;  2VJI A;  1DGW Y;  1BR1 A;  4RM2 A;  2F6C A;  4BXF A;  1Y56 A;  2VLA A;  3RTR A;  1X1A A;  2WAF A;  3AFH A;  3LL7 A;  3S3M A;  4R79 A;  1X19 A;  1D1A A;  4Y4R A;  4IX7 A;  3C2H A;  4BUP A;  2L9N A;  3MMY B;  4XL9 A;  4BDY A;  4CH7 A;  4YEL A;  3S3O A;  2CFO A;  2WB1 A;  2V6E A;  2XC7 A;  4B3X A;  4XON A;  3OWT A;  4NC7 A;  3J7A Y;  3CP8 A;  4CZC A;  3OYM A;  2KDO A;  2LH9 A;  1JI8 A;  1MMA A;  2ZSH B;  2VXZ A;  1D0Z A;  2MFZ A;  2R7Q A;  4IQ4 A;  4XKB A;  3TL4 X;  4PUS A;  4B47 A;  2K9L A;  2PMZ A;  2VKH A;  3SZG A;  4NQW B;  4ITV A;  2BW3 B;  2QKM B;  3H9J A;  2WAD A;  1YX3 A;  2WAQ A;  4RLF A;  2CV1 A;  1QHG A;  3BCA A;  2LBF A;  3HC7 A;  2HDW A;  4BJ6 C;  4C30 A;  3ZR8 X;  2VQC A;  3K4J A;  4J00 A;  3DPL C;  3QOE A;  4OAY A;  2NOJ B;  4E4H A;  4JQF A;  4RM3 A;  3TBI A;  1WJC A;  4D9J A;  3W2W A;  1S9H A;  4PFP A;  3PNT A;  2O5R A;  4AVZ A;  2L7K A;  4H4K C;  3VYR B;  2CV2 A;  1X1D A;  2M0M A;  4BQN A;  4F55 A;  4JOM A;  4CUG A;  5FRM A;  3DEE A;  4BJ5 C;  3M1C A;  3DTE A;  3IAS 2;  3G2B A;  4B43 A;  3DQV C;  4OWR B;  4ZDL A;  3DTK A;  4KJZ A;  2W4S A;  3OMY A;  4HNU A;  2LOO A;  4BDZ A;  4XQF A;  3I3L A;  3HG9 A;  1D0X A;  2CUZ A;  2WAE A;  4KT6 A;  4HG2 A;  3OYF A;  3PFY A;  4F3Q A;  5TGT A;  5CKT A;  3V42 A;  2V4J C;  4E7K A;  2OC6 A;  4LG3 A;  4FAS D;  2IGN A;  3A2K A;  2X1E A;  4DJA A;  1NG7 A;  2BW3 A;  3UR3 C;  3S93 A;  3OYL A;  3TMO A;  4E7H A;  3QYF A;  1BOB A;  2JSP A;  2X51 A;  4E7Z A;  2CUJ A;  1N75 A;  3OL4 A;  3PNV A;  3K70 C;  4C2T A;  2W7N A;  2X1D A;  3A1Y A;  2L9S A;  2XDV A;  3K4N A;  4E7S A;  4QPO A;  2X85 A;  3K4L A;  3L2W A;  1P9Q C;  2MC4 A;  3DKY A;  2L2O A;  3CES A;  4DIQ A;  2XSJ C;  3PUB A;  1V5F A;  1OR7 C;  3ONQ A;  3ZGK A;  3I9V 2;  4ZJZ A;  4XN3 A;  2KP6 A;  1UAA A;  1T0F C;  2HZD A;  2R7R A;  2R7T A;  2KZV A;  1V5E A;  2M7A A;  4NUB A;  4XNF A;  3H9Q A;  4CCK A;  3M8J A;  2WY7 Q;  2XAU A;  3DPT A;  4XKC A;  3EPZ A;  2LBF B;  2LC2 A;  3L2Q A;  1EA3 A;  4XKV A;  4G6T B;  3EUH C;  4HST A;  1BR2 A;  2R7O A;  3HUG B;  4HEA 2;  3CMM A;  3EUA A;  3DLA A;  2CW8 A;  2KQR A;  3OYD A;  3DU6 A;  4PJM A;  4AYB A;  2R7S A;  3DPU A;  2K5C A;  3OR2 C;  4D1Q A;  4F92 B;  1T95 A;  1MNE A;  2DT7 B;  2KL4 A;  5HNH A;  2PJR A;  4J01 A;  2QKL B;  1TZL A;  1MMG A;  1SFK A;  4PFO A;  4ZDO A;  2R7X A;  4CSW A;  2CW7 A;  1X1B A;  4Y3O A;  3VYS B;  4XN0 A;  2E60 A;  2VQG A;  3LSG A;  2Y0S A;  4ANJ A;  1MMD A;  5KNL A;  3KX2 A;  3HPH A;  2F4I A;  3A4C A;  2FUG 2;  2OUM A;  3VSL A;  3OYI A;  3N05 A;  4P5O A;  4IKF A;  3L2U A;  4CCM A;  4Y33 A;  1E0E A;  3GBG A;  4CCN A;  4PK4 A;  4CA0 A;  1Z3X A;  1Z7L A;  2I8D A;  2K9M A;  2VAS A;  4DBR A;  1D0Y A;  2RQQ A;  5HOO A;  1ZEL A;  4II3 A;  1NG6 A;  4PJL A;  5CPR B;  3VSK A;  4ZTF A;  2JVH A;  4E7I A;  3OS2 A;  1Z21 A;  1WJA A;  3DWL E;  4GRI A;  3SDB A;  4XOP A;  3MD2 A;  4BQO A;  3LSK A;  3LFU A;  3W3C A;  4HSR A;  3DU5 A;  4LIT A;  2MAB A;  1V5G A;  4BL0 B;  2Z2S B;  3OYB A;  3C2G A;  1LDK B;  2V26 A;  3OS0 A;  3OYC A;  5FRN A;  3FKJ A;  3QYB A;  4KIT B;  2WY8 Q;  4EAT A;  3IP4 B;  2AQE A;  4DGW B;  3OYG A;  2OV7 A;  2DT6 A;  2X1C A;  2JA2 A;  5HNF A;  3KEY A;  2ELJ A;  3AL0 B;  4F91 B;  1KON A;  3OYH A;  1DP3 A;  3OOU A;  4BE1 A;  1D1B A;  3K6G A;  2JUG A;  4E7L A;  4NC8 A;  2HVS A;  1HA8 A;  3CZ6 A;  4HPQ A;  2Z1D A;  2UWM A;  3FHN A;  2IS2 A;  1LVK A;  1W36 D;  4AU7 A;  3HOS A;  3VDX A;  3PSF A;  2LY2 A;  4OAZ A;  4XLF A;  2KHM A;  4HRI A;  4IQJ A;  4LIV A;  4ZC3 A;  2F5V A;  3OYK A;  2A5W A;  3K4K A;  4PSX A;  3PL8 A;  3OS1 A;  3H0D A;  3D5R C;  3D5L A;  3H5R A;  4FET A;  3OYA A;  2PJR B;  4XKW A;  4YEJ A;  2VQH A;  2XF5 A;  1FMW A;  2LY1 A;  2ZXI A;  2CV0 A;  2VIX A;  4BGD A;  2IS1 A;  3CJR B;  1IRX A;  4ZYA A;  2UV1 A;  2AQF A;  3L2V A;  3S32 A;  2HPI A;  4IZZ A;  3OL3 A;  4BQQ A;  1D1C A;  1WJF A;  1G8X A;  2A6T A;  3ZQQ A;  4XLH A;  2JVG A;  3PJR A;  2V7F A;  3RQ4 A;  3OR1 C;  4CCL A;  4B44 A;  4XMY A;  3HKZ A;  1MND A;  2V9K A;  1R6R A;  2R7V A;  3IAM 2;  1BR4 A;  1WFX A;  3OYE A;  3HL2 A;  4BJT A;  2RNG A;  2IS4 A;  4LIU A;  2BOL A;  4BU2 A;  5HVQ C;  1LFP A;  5LFA A;  3OYJ A;  3BG7 A;  5HLT A;  1X4O A;  2LRE A;  2ZXH A;  3KYL A;  2W82 A;  2DCE A;  2M7B A;  2MD0 A;  3F9K A;  2IGM A;  2R7W A;  4P1W A;  3K70 D;  1WJD A;  3E0J B;  4MLO A;  3ZXS A;  4N4O B;  1DQU A;  2V1N A;  4PJN A;  5CQE A;  4DBQ A;  1N77 A;  5FRO A;  3PNY A;  3IUO A;  3RCO A;  2MYS A;  2X6X A;  4XOR A;  4RMN A;  1PYV A;  2HQA A;  4B48 A;  3W2A A;  1LKX A;  2L5Q A;  4U87 A;  2VKD A;  2M3A A;  2R7U A;  2P0W A;  3OIP A;  3K4B A;  4XR6 A;  2VB6 A;  5KHD A;  2M4G A;  3U21 A;  4DOZ A;  3MKY B;  3ZCO A;  3S8P A;  4C9Y A;  3HPG A;  4XLC A;  1X1C A;  3MKZ A;  1YX5 A;  3K4M A;  3AKZ A;  1J09 A;  2LRD A;  2IS6 A;  4C2U A;  2HVR A;  2IGO A;  3UNG C;  3HOT A;  4BEH A;  4NNJ A;  4HNT A;  3BC8 A;  2M4K A;  1GLN A;  2Q1Z B;  3NWT A;  4PSW A;  3VWB A;  3QYE A;  2E5Z A;  4PJJ A;  1N78 A;  2KRC A;  1UEL B;  3E1S A;  2DXI A;  3VYT B;  3NWS A;  3CF2 A;  4XOT A;  1K6Y A;  1Y6I A;  4BE2 A;  4KIS A;  2BVM A;  2IXS A;  4ZTJ A;  2E5N A;  4CCJ A;  2RRE A;  4E6K G;  1W36 C;  5LD2 C;  4N4N B;  4XLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...