1R6RA

Solution structure of dengue virus capsid protein reveals a new fold
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
NRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of dengue virus capsid protein reveals another fold
pubmed doi rcsb
source organism Dengue virus 2 puerto rico/pr159-s1/1969
molecule tags Viral protein
molecule keywords Genome polyprotein
total genus 20
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1r6rA00
1SFKA 1R6RA
chains in the Genus database with same CATH superfamily
3GBGA 5HS9A 1ETVA 3G2BA 2Z5UA 3AG1H 2DTRA 4GDFA 1R5ID 4XRSG 4U7BA 2ELHA 9ANTA 3JTHA 4PJNA 2QWWA 2L5QA 2OC6A 4E7JA 4P96A 2GIZA 4PSWA 4ZDLA 3S3NA 2XAJA 1A04A 2F5FA 3GTGJ 5LEJA 3HOUJ 4E7SA 1TNTA 1FBQA 2HWVA 3DLLF 1WJFA 3BTJA 3R0AA 5HNFA 1U2WA 4I98B 1YYVA 3I59A 4I99C 1IN6A 3LSKA 4LITA 2DPDA 3WHCA 1B72A 3WG9A 1D8JA 2EBIA 4BHCA 3EPZA 4DJAA 2CUJA 1TQPA 4EJTA 3RKQA 5LD2C 1KZHA 3WTZA 4O3MA 1D0ZA 2OCEA 5CYVA 2X1DA 3M8FA 2BEOA 1NG6A 3OYKA 2QVOA 4DW6A 3S1QJ 1MMGA 2PX9A 2TCTA 2RNGA 4HF0A 4AIKA 3TKYA 3HOXJ 3HZJA 5J8CA 3I3LA 3GLXA 3BQYA 3K4NA 3QP6A 1U6GA 3JREA 1YG2A 2V9PA 1W7PD 2EH3A 5BNGA 3IHUA 1O7LA 3IWZA 3T1BA 4BS9A 3S15J 3OIOA 2WAEA 1SFXA 1UMQA 4RB3C 3LSRA 3H92A 3BY6A 3CLOA 2VQHA 1LEBA 2C6YA 3WGHA 2NNNA 2E5ZA 3LA3A 3CUQB 1ETYA 1ETKA 1YW7A 2KMUA 4LIUA 3MN2A 2ZXIA 3DPLC 4JQFA 1ZRCA 3U1KA 5LRRA 4EJVA 1AOYA 4XQFA 2FBIA 2DOAA 3K1NA 1ON2A 1N77A 2JUCA 5E3OA 1WI3A 2Z99A 2IA1A 3KP7A 2HVSA 2AS5F 2VBXA 4D5CA 2HFHA 2ZC2A 3HOYJ 3JRDA 3G73A 2P7VB 1U5TA 4AIJA 1XS9A 2KJBA 2W84A 1DQUA 1EF4A 1YTYA 3DTEA 4IO9F 1T33A 1ZGJA 3IKTA 2O7OA 2K27A 4ZYGA 2EIKH 4P55A 1RETA 2P5KA 1EJ9A 3TOAA 2EWNA 3HOTA 2OU2A 5M5WJ 3FXKA 2FJ1A 1IGNA 2R93J 1KYZA 2CQ7A 1YRNB 3FXRA 2NNYA 1C0WA 2H27A 2BBYA 2E1OA 4RAGA 4HX4A 3WTYC 5JVTA 4ZZDA 4F3QA 2EK5A 2VB6A 2HYJA 3WODF 3OS0A 2DJIA 1XMAA 4HLYA 3MEXA 1BR2A 2HDWA 3F23A 1RI7A 5F64A 2H6CA 2BHZA 1K79A 2NS8A 1A5JA 3ONQA 1PJRA 2X51A 3LAPA 4XOTA 3HIFA 3S93A 1S9HA 1RUNA 1HSJA 4O6JA 2OAZA 3KZYA 3R61A 2R4GA 4M3FA 1LE8A 2M7BA 4UUSA 3HG9A 4QPOA 5F04A 4A5NA 5BS6A 3HSFA 3MD2A 3K10A 4KIGA 2ZSHB 1Y39A 2XRNA 1FOWA 2KDZA 3PIOF 1IRGA 2E5NA 3QWLA 1KQ0A 1RKWA 1YIOA 2E60A 2OZ6A 1TWAJ 4E7IA 4HV6A 1G6NA 1S6LA 1VI0A 4EJUA 1KYWA 2QSFX 3ZQIA 2AO9A 2DMQA 4IHVA 1TWHJ 3OL3A 2CWEA 2XASA 4YELA 2MD5A 3IRRA 3F9KA 1KQ8A 3H9JA 4M3EA 5E1XA 3KYDB 4I0AA 2JRMA 4BJTA 3ZQ7A 1D1AA 2GBYA 2KFDA 1Z7UA 3DKWA 4IRHA 2ECBA 2WY7Q 3FF5A 3CC4I 3K9TA 4DBQA 1H89C 2E1NA 4NC6A 4YRVA 3ABMH 4P9UA 5ICEA 2DMUA 3OYHA 2IS1A 1B4AA 1QU3A 1UCRA 1ZG1A 2B7EA 3KP2A 1L0OC 1WPKA 3CF2A 5LRSA 3HM5A 1SANA 4B8XA 2L7FP 5J47A 3R4KA 3I58A 3L2VA 5TISC 2ESNA 4II2A 1MMAA 2E7WA 3C2HA 3CJRB 2FUG2 3HOZJ 2M34A 2Z3YA 4Q47A 2RV8A 4RGSA 4B3XA 1IXSB 2XDVA 3B6AA 2QF7A 2FD5A 2COMA 2DMTA 2UXXA 3PJRA 1IXRC 2GIVA 3CJNA 3UNGC 4BL0B 2R7FA 5L3DA 2VC0A 2W48A 3TL4X 3F22A 1FMWA 2RQPA 2HYFA 5J4YA 4AYBA 4WWCA 2ID6A 4CCJA 3V7CA 2CV0A 2DA5A 2VI6A 3Q0WA 3H3UA 3SDBA 2JA5J 1YQAA 1V5FA 1DU0A 1G4DA 1HDPA 1SVMA 2PI0A 2D5VA 5H2FC 5F08A 2R92J 3W6VA 4G8XA 1MBHA 4YEJA 2AQFA 2H94A 3A02A 3CQZJ 2KHMA 3DKXA 3K4KA 5FROA 2L0KA 4V2GA 4MO7A 5LGTA 3QU6A 2L02A 3IH2A 2F4MB 2XROA 1BI0A 2MBFA 4RAYA 1Y0NA 2L01A 1BR4A 4AC0A 4OOIA 3CP8A 4CUGA 1LDDA 2QQAA 3H35A 2OF7A 3K70D 2OUMA 1AKHB 1K78B 4BDZA 2CW7A 4MFEA 1IUFA 1QQIA 1U9NA 3EUHA 5LEKA 1Z9CA 2WWYA 1HW5A 3ULQB 2CYYA 1E0EA 1SD7A 4UY8I 3GEZA 2Q2EB 1PUFB 4A5MA 3JRFA 2FNPA 3JRIA 2JA2A 1XMXA 3RKXA 3KYLA 3DWLE 3F8FA 3V4GA 3FXMA 3X2QH 2OPTA 2AXLA 3DTKA 4HA8A 2KT0A 3BC8A 1GDTA 1OYYA 3JAMZ 4G7HF 1X3ZB 3BZKA 4L5JA 2VBZA 1JTYA 3GTOJ 1H9GA 3FK7A 2JA7J 3HTSB 1RZ4A 2CRGA 1R4MB 3E6BA 4HOBA 3FXUA 4XNFA 1YJWI 1Y56A 1FEXA 1MBGA 4QSHA 5CJ9A 1RIOH 5ICGA 1XTAA 2XGEA 2EA2A 2VN2A 4AVPA 2DTZA 4I7HA 3DCFA 4A93J 1E17A 2E34A 2OTLI 3HRUA 2HKXA 5DD4A 2EZKA 4XKVA 5JFRA 4B44A 3DV8A 1HQCA 2HDCA 4EEFG 3K1MA 3TMOA 3F8CA 2A61A 4ON0A 5CVJA 2R5ZA 3S1MJ 1VQOI 4IEJA 4U87A 4NQWA 2VQCA 4ANJA 3JSOA 2ZKZA 3AL0C 1SEUA 2FQ3A 1SMTA 1ITYA 2D2WA 2HOEA 1W36C 4BXFA 1OKRA 5FRNA 1XX5A 3FBIB 1FMVA 4LB6B 4YIRX 1QPIA 1D0XA 2P0WA 2XB5A 3QAHA 2L7MP 1X1DA 3MWMA 3WGIA 3L2QA 2XSJC 4EGZA 3F8MA 1WRJA 5M5YJ 1MNDA 3BG7A 4HEA2 1QZYA 2K4JA 3IAS2 5FGMA 5AIPA 4M73A 2Y30A 2PLYA 1R1UA 2HPMA 1D1CA 3C3WA 3H9GA 4FASD 1ZARA 4J19A 4XM3A 1QGPA 2PJRB 2STWA 2JSCA 3HOWJ 4E7HA 1HW2A 1ULYA 2YR2A 2BW3B 3V8LA 5IT9K 2DPUA 3RPUA 4N0BA 2BY3A 2ZBKA 5IYCJ 3H5RA 4E6KG 2Q1ZB 3I4NJ 2M4GA 4IHTA 4X6AJ 1JUSA 2LREA 2XAQA 3B73A 1LDKB 3I9V2 4RLQA 5J3LA 2V4JC 3FXLA 3AAFA 3L2WA 5D8LB 4V19K 2R7RA 3DP7A 1S72I 4BYYA 1QVUA 2MH2A 5HS8A 2YX7A 2DYSH 3GTJJ 1Z3XA 4CCMA 3JCUC 3MKLA 5CVRA 4ITVA 1FT9A 1SFKA 3A01A 4Y17A 3EQLF 3PSIA 3ZOBA 1T2KA 3OIPA 4XIDA 1V5EA 4RB2C 3DEWA 2M0CA 1F43A 4XL9A 5EEHA 3R0JA 1HW1A 5D6FA 3SXYA 4HDUA 1F9NA 3ABLH 2KPMA 3S3MA 4A3IJ 2ZXHA 4PSXA 1IAWA 2DXIA 1D3YA 4ZDPA 1IRZA 3JRGA 1BN5A 3KFWX 4FHTA 2VIXA 1GV2A 5TGTA 2XHKA 2EFQA 3DBHB 3UKGA 2LG4A 1UAAA 3ZXSA 3HHHA 2VPRA 1T39A 2KIFA 3KX2A 5JR3A 3JRBA 2D1HA 5HLGA 2JSPA 3HBLA 1ODDA 1E3OC 3BCBA 2QYOA 4KISA 3G3ZA 2VKHA 3OYLA 5A2QZ 3OYJA 2L2OA 2BGCA 4E70A 2IS4A 1ZK8A 1HKSA 4EM2A 3CP2A 1R5GA 4XLAA 1XDSA 5DDGA 1OR7C 4DBRA 2B63J 5EEGA 1POGA 2W85A 3RZOJ 2QUFA 3D1NI 1LQ1A 2E1CA 2FQ4A 1U5TC 1K4TA 2R7QA 3JRHA 1U0JA 1MDMA 1IXCA 1N25A 1FOKA 3BOQA 4G7ZF 4WX9A 5J4VA 1W7PA 1JKPC 3FMRA 4I0BA 1YITI 5K5RA 1VQ4I 1RRJA 3W3CA 3QRFF 2ZMEB 3CCRI 1DDNA 1RUOA 3F72A 1PYVA 1CQTA 2XAHA 4BEHB 4BHBA 4M72A 4R1HA 2B0LA 4CXFA 1YRNA 1G2HA 3H0GJ 3TW6A 4MQVA 3C1DA 2CS3A 3ZQQA 3CO7C 4OMYA 3G1MA 2JWTA 2A05A 3NARA 1H9TA 1NHAA 2X85A 5GTIC 4A3LJ 1YLFA 1IRXA 3HSRA 3W2WA 2Y0SA 4LG3A 4FETA 1OYIA 3FIWA 5FKOA 2DO7A 2O03A 1BI2A 2V1XA 3I59B 4I6ZA 3IUOA 2BW3A 1YS7A 2JT1A 5IP7J 2ZSIB 3LSMA 1JHFA 2E7XA 5LGUA 3ZQHA 1IN5A 1JT6A 2MFZA 1S3JA 3WU1B 1XC5A 1CF7A 2FBKA 4PCQA 5ED4A 1ZR4A 2DA6A 3HSEA 4C30A 3ZPLA 1O3QA 3QPHA 4Q4ZF 1O3RA 2EIJH 2I10A 2VJJA 2WTEA 2ELJA 4W1UA 4X0GA 3LNQA 4HQEA 3ZQLA 3TO9A 1WJEA 1Y8RB 4M9SA 2CU7A 1R36A 2M0MA 2VQGA 1GVJA 1UG2A 2HPIA 2QQ8A 2IVMA 2D1VA 3MAJA 2XF7A 2H8WA 2KIMA 1F5TA 4P1WA 3E7LA 1I3QJ 4HW0A 2DK8A 2PJRA 2O8KA 1B9NA 4BXUA 1OCZH 3OS1A 3GFJA 1AKHA 1ORKA 3RIRA 5D5XB 5HLTA 2RGVA 3J81Z 4RM3A 4J00A 4DIQA 3JSPA 1X19A 2P4WA 1VF9A 2JMWA 2X6XA 3ERMA 3OOUA 2PEXA 3F21A 2F48A 3H9QA 1LFUP 2YSRA 1JI8A 2W57A 4EGYA 2H09A 4A12A 3ZP5A 1X2MA 1WWXA 4NUBA 3A2KA 3P9KA 5FLMJ 2LSOA 2M87A 2ZFWA 4Z6YA 4UVCA 4XLHA 3DEEA 2PBIA 4UHTA 2X9DA 5B3SH 2IBDA 2R5YB 2DA4A 4BQAA 3PIPF 1MKMA 4UXNA 2OBPA 1G3YA 3I0TA 3JW4A 4BY1J 5FLVA 3BCAA 1JJ8C 5F6FA 1LUJB 4L18B 2XPUA 2NYXA 4FCYA 4HAMA 2MC4A 3S8PA 5J8FA 4FE7A 2IAIA 3VYTB 4A3KJ 2QBYB 2HKOA 1WI9A 3M3YJ 5B1BH 1FX7A 2JVGA 2ZNZA 1EKEA 1OR7A 2QSGX 5E1WA 3G71I 1FLIA 4MGRA 4DQ2A 3H5AA 3BZ6A 2CO5A 1FWZA 3CCUI 3FM5A 5CVVA 3ISPA 1Z05A 1ETXA 4YIFA 2K9NA 1BW6A 2PJPA 1D1BA 2Y9YA 2V6EA 3PO2J 5L3CA 1ZELA 2VXDA 3FM3A 2BHYA 3TDZC 1K83J 5FD5A 3VDXA 3HOSA 4M6YA 2WADA 1E3PA 3V8KA 5E8GA 1KU3A 2L3DA 3VFZA 2X4HA 4FTHA 1MMDA 4GFBA 2CJJA 1P4AA 1YS6A 1LPQA 4YFKF 4WXCA 3CCSI 4B48A 3FMSA 2Q0OA 2YPRA 1DPUA 4I76A 2CQXA 2VOPA 5A2QK 5J6XA 1WJCA 4FX0A 2BYVE 2IA2A 3MFKA 2LD5A 2QENA 4AM3A 2OZUA 4MHGA 3LL7A 3PUFA 2O6GE 2A6TA 4PFPA 1KU2A 2M45A 3CJTB 2L4MA 1SFUA 4JX6A 1VQMI 3CC2I 4LD5A 2ADUA 2W7NA 3MMYB 3OWTA 1X4OA 2Y0MA 2BXZA 1S7OA 2QSHX 1WH5A 1OFCX 2OCCH 2AHQA 3QU3A 3HXLA 2OD5A 3OYIA 1BM9A 1GXQA 4ZJZA 4OAZA 3CMAI 2E2IJ 2DT6A 3J7AO 1RR7A 1V5GA 2WA0A 4FISA 2H1KA 2KP6A 2EA4A 1BC7C 1E2XA 1YO5C 2DYRH 4CYCB 3VWBA 3G6EI 3U21A 2XKOA 2HQAA 3HRSA 1VQNI 1IC8A 1NK3P 3DU6A 4IRIA 2HOSA 2QCOA 1W5SA 1TWCJ 3GFLA 1XD7A 4UVBA 3OYBA 2EILH 2GXBA 5LHHA 3SDGA 5IP6A 1ZRDA 2JPCA 1DP3A 4M6XA 1HBXG 2TDXA 5HDNA 2XC7A 4H0EA 1XB4A 4ENKA 4AWXB 2IGMA 3H3VK 3BPXA 4A3BJ 1VZ0A 3C2BA 4ZDOA 3SQNA 2NXNB 2HNHA 3SEQA 5L3FA 1W7PB 4D1QA 4IL6C 2LF7A 3VSLA 3RPUD 3LSIA 1RESA 3P5JA 3VOEA 2IS2A 3HHGA 2DW4A 1SMYF 2KRCA 5E20A 1I6XA 1QNTA 1FYLA 1LDJA 1BI3A 4Y4RA 1QO0D 3GVAA 1TP4A 1YW8A 2XGCA 2P81A 2CGPA 1GXPA 3SJMA 3F8NA 5ERIA 1SAUA 3LSJA 4KDPA 1OQYA 1VNDA 3Q0UA 5E1ZB 2ZJ2A 3BTLA 2YUSA 4BQQA 3FKIJ 2ESHA 1I39A 2MW8A 1Z6RA 1R58A 3I71A 1SAXA 4ZC3A 5CQEA 4MEYF 3RTRA 2JRTA 4WF2A 4A3MJ 5C3EJ 2BY1A 2BZTA 3C7JA 3GW2A 5EYRA 5GAEJ 3KCCA 3RQ4A 1TQMA 3VYSB 4S0HB 4IF4A 5FFXA 3TBIA 4UUVA 2I8DA 1XGNA 4IKFA 2DDBA 2CSOA 3BG9A 4GXOA 2M5WA 1REPC 3J7AY 3TW7A 3LOCA 2JQ7A 1VQ9I 3BJAA 2XKPA 2K40A 4HF2A 4X1EA 2Y2ZA 3SYTA 4BE1A 3SFZA 2EQRA 4A0XA 2K02A 1TWFJ 5FO5A 1N78A 4E7KA 3ZRGA 3BTIA 4N9HA 3OSFA 1JHHA 3K4BA 2LTPA 3GX4X 3GXOA 4XSXF 2ECCA 2CUEA 1O3SA 1OJLA 4G6QA 2DBBA 1Y1WJ 2K9QA 2V1NA 1ZH5A 4XONA 2WAQN 2DT5A 5J1YA 1N75A 4C9YA 4BQNA 3ASOH 2MD0A 1LKXA 5GADJ 1LB2A 3ZMTA 4UB6C 4B09A 4U0YA 3BG5A 2VUMJ 1ACIA 5K5OA 3QPSA 2LDUA 5B66C 3QYFA 1Z3YA 1TBXA 2VC1A 3TO6A 1NG7A 1QHGA 2MC3A 4AVZA 1KONA 3EUKL 5IYDJ 2FMLA 2NVYJ 3A1YA 3U9GA 4KA4A 1O57A 3FKJA 5D5UB 2W4SA 2ZXJA 3VYUB 4DYCA 1FPQA 2Q2EA 4KUMA 1QA6A 3G1OA 2IEKA 1ZGWA 1HXDA 1IN7A 4CCNA 2K9LA 4A3DJ 5TJJA 4C3JJ 2DOEA 1T0FA 4FX4A 1W4MA 4EJOA 1BC8C 3F8BA 4E7ZA 1LFPA 1OCTC 2RKHA 4U7DA 1R49A 5HDKA 2V7FA 2R7UA 4IPAA 5D8KB 3ZQCA 2Z2SB 1QZZA 2E36A 2X6OA 1RC9A 3B02A 5K7HA 5FKMA 4XLNF 4G7OF 1UG0A 1YHQI 3B6CA 2NVXJ 4W97A 4BH9A 1T98A 3WU0A 2AQEA 3MKYB 2WB1A 3BG6A 2ZJPF 3E1SA 3BR0A 3DTIA 1TWGJ 1FTTA 4Y15A 1OCPA 4KIBA 2LY9A 2CFXA 3M07A 3RPQA 2XPWA 3HUGB 3V7RA 4ETSA 2WV1A 4C2TA 1ZN2A 3WHBA 2ACJA 4B43A 4XLFA 5HODA 1HDDC 2JA8J 2HEOA 2EV0A 1BIAA 2MABA 1U8RA 5K7FA 3T5XA 1IW7F 1R71A 4DGWB 4F52A 4G94A 4IVNA 1FBSA 1OCOH 2ZJQF 1QZEA 4IQ4A 2O8XA 3FZVA 4PJ0C 3CD6I 3RZDJ 2X6WA 2EFOA 1DUXC 3DBLB 4G12A 1XDUA 3PL8A 1T95A 4HSRA 2W1OA 4MEXF 3I53A 1HKQA 1ZYRF 2F5CA 4ZYEA 5EG0B 1FIPA 2ME0A 4KITB 4A3FJ 2CMPA 1HA8A 4CZZA 1J75A 5E18F 2HXOA 4Q48A 1AHDP 2IGKA 2OQRA 5ILUA 3O8GA 4ENMA 5IOYA 1IZ1A 1W5TA 3V7SA 4XBFA 3E6DA 3GFIA 1PP8F 4BACA 2XPVA 3KEOA 3M9AA 2GXGA 3RI4A 2RDPA 3FISA 3JTGA 1X2NA 4XK4A 4RLFA 5BPDA 2HQNA 3M7GA 2ZMEA 3LSGA 3COAC 4LG0B 3PQKA 1J59A 5FRMA 2R7SA 4OIPF 3EETA 2V1DA 5GPAA 1Z21A 2ISYA 4XKWA 4B47A 4XLPF 4PGGA 1D5YA 3Q3SA 4GGGA 3GTMJ 2H8RA 1P2FA 4BKXA 1K61A 2LRDA 2KDOA 3RKWA 4ENNA 2ID3A 4BEHA 3EYIA 3CUQC 3CLQA 4M74A 4UV8A 3WTWC 3HC7A 1OISA 5FKKA 3OIQA 1RKTA 3KZIC 3PFYA 2UUZA 2KZVA 2A6HF 1WH7A 3KP4A 4N4NB 4QTRA 1A36A 4EMSA 5HLHA 3C2GA 5CQGA 4UUSB 3I64A 3SZPA 2FE3A 2YS9A 1SD6A 1Z1DA 4M9XA 4IXAA 4RGUA 2XB0X 3RYRA 3SZGA 3GZ6A 4BGDA 1I6HJ 2W82A 2X6YA 1YE9A 2KL4A 2LKSA 1UFMA 2ETHA 3D5SC 4HPQA 5IY5H 3OS2A 3K4CA 4CYDA 4XN0A 1ETQA 2J5OA 4HRIA 2VT2A 5C44J 2D45A 1G3TA 2XAFA 4LG0A 5BPIA 4CYCA 5IOZA 3L7WA 3NEUA 5CLSA 2R0QC 3A01B 1IJWC 2AXTC 2O3FA 3MCZA 3OR2C 2O9LA 1PUEE 2GWRA 3IH3A 2NVQJ 3HGYA 4EM0B 3F6VA 2NRAC 1V3FA 2FX0A 2NS7A 4KMUX 2V9KA 3DPTA 2IPQX 2P5VA 3A03A 2BE5F 3WTUC 2Z33A 1ZR2A 2G0EA 2DFIA 4EATA 3MQ0A 1J5YA 4HBLA 1AA7A 3A4CA 4H4KC 2PN6A 4N4OB 3WG7H 3S1RJ 2HVQA 1QVTA 4S05A 1UZCA 4ZTFA 3BP8A 3QQAA 4TV7A 3E5XA 1J9IA 2FNAA 1ZLKA 2VKDA 4A3GJ 4G9YA 3TDUC 1VQ8I 3CF5F 4IQJA 3CDLA 2Y75A 2K3PA 2IRFG 4L9VA 1U5TB 3CUQA 1QPMA 3EDPA 5IPAA 5DM7F 4JOMA 5EG0A 1TTYA 1D8KA 1GHCA 3K70C 5FD6A 4LIVA 2RVCA 5LLQA 2HI3A 1H8AC 1PVEA 2HS5A 4LMYA 5CVUA 4KICA 2EZLA 2WBMA 2ZMEC 3CZ6A 1APLC 4OAYA 2HOAA 2KZGA 3T0YA 2LNBA 3OMYA 3QP5A 3VSKA 2QQ9A 4MTDA 2LKPA 4HV5A 4FQGA 3QOPA 4XKCA 5FJ8J 4PGHA 4ASNA 3IP4B 4CO8A 3ZMUA 2FEZA 2ICWG 2NS0A 4XICA 4OU0A 2VJ5A 1X58A 3ASNH 4GRIA 2EV5A 3BJOA 3KLOA 1O7FA 4HYEA 3GFMA 3H5NA 1MBFA 1GVDA 2ZB9A 3PNYA 3HKZA 2RC4A 1QHHD 2VBWA 2EINH 4NBQA 2LK2A 1IF1A 4PZJA 3KP5A 5L3BA 1YIJI 5D5WB 3CDHA 3BR3A 1T08B 1ZGAA 2FOWA 5EEAA 2YU9J 4M3GA 3J81K 1X1PA 4YG2F 2K5CA 3K1PA 1MH4A 3KYCB 5KHDA 2VOOA 5DCMA 4ZYHA 2IP2A 2R7TA 4IOAF 2HXIA 2HQ5A 5CVIA 2LOOA 3FMQA 5GP9A 1HLVA 5FFZA 3Q0VA 1X4PA 2HVRA 2K86A 1TT0A 4BE0A 4IHXA 1I5ZA 3O6BB 3K4MA 2BV6A 5DD8A 1P7JA 2E2HJ 2IS6A 1P4XA 5JHFA 5KVRA 2UV1A 4B3AA 4Y13A 1ERDA 4PFOA 4XORA 4DOZA 4M9ZA 1YI2I 1ZG5A 1F1ZA 4RDUA 1ZKGA 4F7ZA 5ICFA 3JR9A 2CUZA 1P92A 2RAEA 3DBRB 2DDAA 2ZO4A 2O5RA 3SHFA 2EIMH 1TNSA 1ENHA 2M2EA 4N9IA 3ZMVA 3M4OJ 4LLGF 1UHMA 3KE2A 4F55A 4QLCU 1PUFA 4PDKA 2DLLA 3KETA 4HX8A 3HKZN 4BBSJ 4CGZA 2XV4S 4LK1F 2OJED 3ZN1A 1K6YA 5IT3A 1T38A 3M1CA 2E19A 4C2MJ 1R6RA 2P6SA 3ZQGA 3Q5FA 4OIQF 4RMNA 4I09A 4LGWA 3NWTA 3T8TA 1P7IA 5FKNA 4E4HA 4D7MA 3I4PA 2ZXWH 2B9SA 1FTZA 3O2PE 2LF8A 1R9TJ 1BOAA 3PQJA 4P5OA 3H3ZA 3CCYA 5DUIA 1KA8A 3F0CA 2M4KA 5DCMB 4XOPA 2CFOA 4BE2A 1JUPA 1K7AA 1R1TA 1FIAA 2NAZA 5F0CA 3G4SI 3FXQA 4QWQA 1HCRA 1D5VA 3OYGA 1T6SA 5L3EA 5E8IA 3ESWB 4O5VA 1WFXA 2ZCWA 3OYFA 1SD5A 1O3TA 3CTAA 3LSTA 4CZCA 2K9MA 3AL0B 1T0FC 3RSNA 3JAMK 1I50J 4PJMA 2DJNA 3S14J 3BR2A 4B1RA 4HNVA 5KNLA 4RM2A 3BQZA 4XRSA 1BOBA 1MNMC 3E0JB 2GXAA 1P6RA 3S1NJ 5DEQA 2VASA 2VKVA 1IRFA 3ROUA 5FLXK 1TL8A 2Z9OA 1JKOC 1R5HA 3OYEA 2RQQA 1ETOA 5J40A 5M5XJ 1HKTA 3D5RC 4XRMA 3VPRA 2VJ4A 2WAFA 1X3WB 2HTJA 3BZCA 3S32A 1Y6IA 2GOXB 4YIIA 3N4MA 1R00A 1B8IB 3QODA 3HTUA 2BY2A 1IV6A 4WCGA 3GF2A 1CGPA 4BXXJ 4A3EJ 2DI3A 1FOYA 2MLGA 3W6KB 1WKMA 4L0ZB 4A3CJ 1NK2P 3SEZA 1YJNI 1A31A 2VODA 1MSEC 3WTSC 4MIMA 5FB2A 2DQRA 4HNUA 1I3AA 1USSA 3REOA 2VONA 3L1PA 2CV1A 5F0FA 5D4RA 3BR5A 1W0TA 3CJQB 4BJ6C 3DU5A 3CCJI 2WY8Q 4K2EA 3JRAA 1G3SA 1DGRM 3K0LA 1SFOJ 1XCBA 4Y3OA 2QKMB 3TP3A 5F1RA 3IKVA 1F4KA 4ESJA 4IOCF 1LNWA 5EGOA 1NH3A 4LFUA 1T56A 1YX3A 2IA0A 2GAUA 4LJZF 1MSFC 2H6BA 5BQTA 3OOPA 4S04A 2RREA 2FXAA 4JYKA 1UELB 4ESFA 5TRDA 3SZTA 2XIGA 1E3HA 2LLKA 2Z16A 1YFHA 3EUHC 5HS7A 2GM4A 2VBYA 1MW7A 2KRFA 3DQVC 4DNCA 1G3WA 4RB0A 1MGTA 4RA2A 3G1LA 1FNNA 2CQNA 4MLOA 3IL2A 1Y1VJ 1B1BA 2JUGA 2LY1A 1T8IA 4HZFA 5ILVA 1WHUA 2LH9A 4J01A 1WSUA 3W2VA 3CCQI 4RGXA 4KN7X 2LVSA 2FRHA 1M1EB 2HTSA 5LBQA 2F4IA 2A5YB 2G7UA 3Q9VA 4GO1A 3AG4H 3BR1A 4E7LA 1ZQ3P 4A3JJ 2JN6A 2EJRA 2VPLA 3Q9SA 3ZMZA 5FLXZ 3CCEI 2NVUB 2CW0F 4R8HA 4ZYDA 2DA7A 2F5DA 4I2OA 3BT9A 3LFUA 5E17F 3U2RA 1DPRA 2E71A 3A0HC 2EFPA 3VEPA 2KRHA 3GTPJ 1WQ2A 2PMZN 2LKXA 3EYYA 4NQWB 4Q5SF 3HYIA 3GWZA 2HOTA 2E1MC 5IT9Z 5EJCA 3QYBA 4C3IJ 4IHSA 2J5PA 2L7KA 2OTJI 1ETWA 1R4NB 2YX4A 3E6MA 2X48A 1MD0A 3HPHA 3ERED 4ENJA 4G6DA 2GLOA 2MSYA 2DMNA 2QBYA 3L2CA 1A6IA 3KLNA 1ONVA 2G7HA 4UNOA 2QGUA 4IHYA 3O8HA 2R7ZJ 2HR3A 3FHNA 1ZAOA 3S2WA 1BJAA 2Y31A 2CUFA 3DKYA 3NQOA 3E5QA 3K2AA 3KZZA 1AWCA 3QPLA 1R7JA 2M8EA 3IV5A 2DODA 1K4SA 2VJIA 2ZFUA 3OYAA 2P5LC 2G9WA 1P4WA 1B72B 3GTQJ 3PUBA 2HU9A 1F36A 2RN7A 4MTEA 3ZCOA 2V9VA 4DZJA 1ZREA 3AG3H 1S7AA 3CUOA 1PDNC 4GCVA 2GOMA 2LFBA 1BL0A 1OYWA 3F3XA 3OL4A 2JTVA 4EM1A 4L9NA 4NC7A 4OINF 2FU4A 1WVRA 2PQ8A 4C2UA 4M71A 5H6RA 3WGGA 1AU7A 2HQRA 1FBUA 4WK8F 5AONA 1MZBA 2F2EA 1L3LA 2HZDA 3J80K 1JKRC 3P7NA 2COBA 5D4SA 3BLYA 2ME6A 3OSGA 1X3UA 3QYEA 3ZGKA 1TLHB 4IHWA 3GTKJ 1U9OA 1WGXA 1B59A 1G59A 1HSTA 1RPWA 1WJDA 2WAQA 5JVGF 2V1UA 1R1VA 3LSHA 3EUAA 1ZRFA 3PSFA 4EV0A 4FE4A 5K5QA 3UR3C 4FT8A 1ZHFA 3VYRB 5DS9A 2XF6A 3CCVI 4A0ZA 2TRTA 4XN3A 3MKWB 1GV5A 4D0PA 3TOBA 3OYNA 2EPFA 1R23A 4KMFA 2PG4A 1MH3A 4PJJA 3WTVC 1TW2A 2NOJB 3RDIA 1S29A 1SVLA 2E35A 2M30A 4CCLA 2DA2A 2R7OA 4I01A 3GZ5A 3K4JA 1BA5A 1Q1VA 2FBHA 4LLNA 4M3BA 4Z2YA 5M3FJ 2ELKA 1LJ9A 2FF4A 4JK1X 1LVKA 3RCOA 1J09A 2Y0SN 1P9QC 3TGNA 3KP6A 4NB5A 2LMDA 4BU2A 1Y0UA 1XCVA 3D0SA 4U0WA 4ZYAA 5DM6F 4JX5A 4UB8C 1EV7A 4LLLA 5EDNA 1W36D 1USTA 3KEYA 2LP0A 3DXJF 4NNJA 1JGSA 4AU7A 4D7NA 4DYQA 2F4OB 3HGGA 4U0VA 1X1BA 4RS8A 3OYMA 4AYBN 3R60A 2L4AA 4CDGA 4Y52J 3ABUA 3GTLJ 3BPVA 3ZMSA 3PNVA 3L2UA 4DYRA 1ON1A 5GAGJ 2M1BA 1VQKI 3I5UA 3I55I 2M8GX 5LHGA 3ZMDA 3ABKH 3M8EA 3BJ6A 3RKYA 4A0YA 3WU2C 2W24A 4B4CA 3IRQA 4MQ9F 1VQ5I 1JTXA 4BAYA 4CA0A 4F91B 3S16J 1BJZA 1SFEA 3FK6A 5C4XJ 2JK3A 1NTCA 3DLAA 5FKLA 2XGDA 3HOVJ 4WXHA 5ILSA 3U1DA 4R79A 2FMYA 2OV7A 5DV5A 2LBFA 2L54A 1Y8QB 2LBFB 1HC8A 2EFWA 5M3MJ 1BI1A 1MBKA 3FDYA 1FY7A 4EVIA 3P9CA 2MH9A 3S2DJ 1VQ6I 2XUBA 3CMMA 3ML6A 2JPBA 1XSDA 1LE8B 2V6CA 2Q8KA 4YFXF 1J0RA 3RQIA 3E6CC 4IZZA 5AIQA 1OCCH 2QEXI 2L9VA 4U88A 5GPCA 4ESBA 5DCFA 5B1AH 2FA5A 5E3LA 2LY2A 1X1CA 4I02A 3TO7A 2XAUA 2BY0A 1XSVA 5IP9J 5HNHA 1D0YA 2P7CB 1KU7A 4F93B 5EGOB 2R7WA 2MG4A 1Z77A 5E3NA 3FX3A 3WTXC 1V55H 2OA4A 3VB2A 3OYDA 1BBYA 1EH6A 1S5LC 2JVHA 2XVCA 4CSWA 4QIWN 3BROA 4HQMA 4HSTA 4PJLA 2KISA 2X1EA 4PK4A 2KIUA 3MVPA 4AIDA 2DOFA 3GLLA 4OWRB 1JJ6C 1FYMA 4XRFA 1YJ9I 3QPTA 2CW8A 1IG7A 2L9RA 4L5EA 2DK5A 1Z6TA 2GQQA 3K69A 5ICCA 4F92B 4RAFA 5J1UA 3KIOA 2H1LA 4Y33A 2EZIA 2XF5A 1YX5A 3RJPA 1FP2A 5EZGA 4G6TB 1MNEA 5HVQC 1IV8A 1FSEA 3JRCA 3HL2A 2VE9A 3S2HJ 3HUGA 5D5VB 2CH0A 4L9TA 2KQRA 1UJ8A 4MFDA 3HEFA 3A0BC 4ZTJA 2FOKA 1XMKA 3MZ8A 3LAJA 2R7XA 2K9SA 4RBOA 5K7ZA 2KKOA 3CDIA 1IN8A 3K4LA 3SFIA 2IXSA 3J7YJ 2QQBA 4RGRA 2A07F 3E3VA 3W6JB 2I5UA 3N05A 3LQRA 2MYSA 3IAM2 3L09A 3OV8A 3OY9A 1Q1HA 4KNYA 3GYHX 4AIHA 4BUPA 2L9NA 4BDYA 3S3OA 3TEDA 2K85A 2UXNA 2Y69H 2K3FA 2A69F 4A2UA 3GCMA 2HGCA 1MJ9A 1R22A 1TW3A 2EV6A 2R5ZB 2ISZA 1IDYA 1V4RA 2QA4I 2WV0A 3WE2A 3I56I 1OCRH 2VT3A 4C3HJ 3OYCA 2XRLA 3F6OA 1S7EA 2BVMA 2R5YA 3I54A 1GT0C 3CCMI 1YW9A 3PO3J 2MLKA 1KQ9A 2XGXA 3IH4A 5HLIA 4BBRJ 1I27A 4HG2A 4GYGA 1LVAA 5BMZA 1FSHA 5HOOA 1DP7P 1JKQC 1JT0A 2K7LA 1TZLA 2DAOA 3V8JA 4BJ5C 4QPQA 3J7ZI 3GUDA 2R7VA 4NDLA 2W00A 1O4XA 3M1EA 4KIFA 2E2JJ 1XN7A 2QLZA 3R6SA 3MKZA 1K78A 1J7KA 3IC7A 5F1JA 2X0LA 1U3EM 2DQLA 2P8TA 1IUYA 1KGSA 1MJBA 2R7DA 1XGOA 4CCKA 1CF7B 4HX7A 3BWGA 1KU9A 2R3SA 4NC8A 3ZR8X 5EF6A 2A68F 4KN4X 4XR6A 1TT5B 3BTCA 5BOXA 3H36A 4XLCA 3L2RA 4L9JA 2EFNA 2HZTA 2O0YA 1PP7U 1JE8A 1FP1D 2STTA 1OPCA 3BG3A 1GLNA 1UHSA 1QRYA 1STZA 4ABZA 1H0MA 2FSWA 1DGWY 3LMMA 3TP0A 5HDGA 5LHIA 3HPGA 1XGMA 2UWMA 4Y7NJ 1W1WE 2VXZA 4EQQA 2L7ZA 2JA6J 3K6GA 3QOEA 1EH7A 2HYGD 1FOXA 2M3AA 4UUTA 1EH8A 2LC2A 4KYWA 2QM3A 3CMYA 3BDDA 2V79A 1S8NA 2GZWA 1UB9A 4AD9A 3BR6A 1U78A 1JXSA 3LWFA 4L5IA 2ZJRF 3H0DA 1FC3A 2EZHA 1WCMJ 1IDZA 1W5CC 2IW5A 2EB7A 2VE8A 3K2ZA 2DN0A 3ECOA 3NAUA 3ABTA 2GA2A 2VKEA 1YOVB 5JLXA 1VFCA 1Z91A 1IN4A 1IO2A 3HB9A 3GMEA 3FXOA 2KLOA 2L9SA 2E1MB 2BVLA 3S17J 3LQQA 3RYPA 4WXDA 3LSPA 2DA3A 5JI6A 2LR8A 2IGOA 3T8RA 1FYKA 1OLTA 4GYIA 4CHUA 4BQOA 3FHZA 5E79C 3GO5A 5JLWA 1K6OA 2KJCA 1VQPI 2Y9ZA 1XSXA 3KEQA 4EJWA 2DFFA 2VQLA 4UV9A 4CICA 3WTTC 3VODA 1WZ2A 3DF8A 4UVAA 3ELKA 1Z7LA 2BOLA 2MA3A 3DEUA 3FWEA 2XSDC 2CV2A 1SC7A 3H1CA 5F0HA 3W2AA 4OIOF 2M9HA 5CPRB 1A6QA 1X1AA 3FBNB 1I1GA 4JBAA 5LGNA 1QBJA 4RAZA 2P6TA 1ZLJA 2OQGA 2A6EF 3CC7I 3KPHA 5K1YA 4NHJA 2K4BA 2YU3A 5GAHJ 1B6AA 2IGNA 2DMPA 4KJZA 5F27A 5KK1A 1EA3A 1MMSA 2Y48A 1U8BA 2PFBA 2RNJA 4A6EA 2DT7B 3GZNB 3D5LA 2V26A 3AG2H 1MIJA 1ZTRA 2GA1A 4XKBA 1TC3C 1Z0XA 1J2XA 5CKTA 2O61A 2KIQA 1RR8C 2PMHA 5KAIC 5GTHC 4L0YB 1MDMB 6PAXA 5C4JJ 4BNCA 4M6VA 5H20A 1UHWA 2VL8A 4CCOA 1W0UA 2CQKA 4YFNF 4LB5A 3N97A 5JHUA 2XAGA 1B8IA 5E3MA 1MJAA 4JP0A 3DFGA 3E5UA 1H88C 3TQNA 3V42A 4HNTA 4KT5C 1WJBA 4HF1A 2DCEA 2NVTJ 1ZG3A 3CO6C 3DPUA 3NWSA 2M7AA 1MMNA 5H6QA 5LFAA 2A5WA 2QKLB 2DA1A 4IX7A 3PNTA 1VTNC 3AFHA 2W25A 2MGQA 1MBJA 4BY7J 2HDDA 3K7AJ 2DU9A 3NRVA 1DU6A 3ZQFA 1VQLI 4KT6A 3OR1C 1OMIA 4RB1A 1BW5A 3I4MJ 1B9MA 3HDDA 2WB1N 1VQ7I 2VLAA 1A35A 5KCMA 1BR1A 2PMZA 2X1CA 5D6EA 1XPXA 3HJEA 3C18A 2IT0A 4ZH4F 2LYCA 3MZYA 1Z67A 4II3A 5KAFC 1FZPB 2F5EA 1HOMA 3LFKA 2Z1DA 2WC2A 4MNUA 4CH7A 4HLXA 4IJAA 5DYMA 2JZYA 4D9JA 4OIRF 2PMUA 2CQQA 1MBEA 2F5VA 2NOGA 4PUSA 1I1SA 4XLEA 3WE3A 2ZNYA 5L3GA 4A69C 3J80Z 5DTDA 1WJ5A 2QZ8A 3O3KA 4IRGA 4A6DA 3L00A 3HRTA 3P9IA 3CESA 2DFHA 3PFIA 5B5EC 1G8XA 3M8JA 3LA2A 2F6CA 4D5FA 1XG1A 2CG4A 3E97A 1TQIA 1XGSA 3FXJA 3AKZA 5J1RA 1RNLA 3L9FA 4ZZLA 4HDVA 3ZN0A 3PM1A 3HRMA 4JX4A 4OMZA 4XSZF 5EZHA 4KFCA 1SD4A 1LFBA 1WJAA 2DFEA 4BHPA 3MZHA 4LK0F 4LOCA 1HF0A 1BIBA 5DUKA 3ECHA 2JJ7A 4M3DA 4AUXA 3CCLI 3IWFA 1JGGA 4DZPA 2IJLA 4V2FA 5IYBJ 1FJLA 3CMEI 2UZKA 1LEAA 1SVOA 2A3SA 1JUMA 2BXYA 3KP3A 4P9FA 1V54H 4XMYA 2N8GA 1GUUA 3LA7A
chains in the Genus database with same CATH topology
3LSHA 3EUAA 3GBGA 3PSFA 4BEHB 3G2BA 3HC7A 3UR3C 3OIQA 4U7BA 3VYRB 2CS3A 4PJNA 3PFYA 2UUZA 2KZVA 2L5QA 2XF6A 4XN3A 3ZQQA 2OC6A 3MKWB 4E7JA 4N4NB 4PSWA 4ZDLA 3OYNA 3C2GA 5CQGA 3S3NA 4PJJA 2NOJB 2X85A 1IRXA 3W2WA 4E7SA 2Y0SA 4CCLA 4LG3A 4FETA 2R7OA 1WJFA 3K4JA 5HNFA 3SZGA 4BGDA 2W82A 2X6YA 1YE9A 2KL4A 3D5SC 3LSKA 4LITA 4HPQA 3OS2A 3K4CA 1LVKA 4XN0A 3RCOA 4HRIA 1J09A 2BW3A 3IUOA 3EPZA 1P9QC 4DJAA 2CUJA 2ZSIB 3LSMA 4BU2A 5LD2C 4ZYAA 2MFZA 1D0ZA 2X1DA 1W36D 3OR2C 3KEYA 1NG6A 3OYKA 4NNJA 4AU7A 4C30A 1MMGA 2RNGA 2V9KA 3DPTA 2VJJA 1X1BA 2ELJA 3I3LA 4X0GA 3K4NA 1WJEA 3OYMA 4EATA 2HPIA 2M0MA 1AA7A 2VQGA 3A4CA 4H4KC 3PNVA 4N4OB 3L2UA 2HVQA 4BS9A 2XF7A 2WAEA 4ZTFA 4P1WA 2PJRA 2VKDA 3OS1A 2VQHA 4IQJA 4CA0A 4F91B 2E5ZA 5HLTA 2K3PA 4RM3A 4J00A 4DIQA 1X19A 2X6XA 3OOUA 3DLAA 2KMUA 4LIUA 3H9QA 2ZXIA 3DPLC 4JQFA 1JI8A 4JOMA 4R79A 4XQFA 2OV7A 2DOAA 1N77A 2LBFA 3K70C 2HVSA 4LIVA 2LBFB 4NUBA 3A2KA 3FDYA 2WBMA 4XLHA 3CZ6A 3DEEA 1DQUA 4OAYA 3DTEA 3OMYA 3CMMA 3VSKA 4XKCA 4IZZA 3BCAA 3IP4B 3HOTA 2MC4A 3S8PA 3VYTB 2VJ5A 4GRIA 2LY2A 1X1CA 2JVGA 2XAUA 3H5NA 3PNYA 3HKZA 4F3QA 5HNHA 3H5AA 2VB6A 1QHHD 1D0YA 4F93B 3OS0A 2DJIA 2R7WA 1BR2A 2HDWA 3OYDA 2JVHA 4CSWA 1D1BA 2V6EA 4HSTA 4PJLA 3ONQA 1PJRA 2K5CA 2X1EA 2X51A 1ZELA 2VXDA 4PK4A 4XOTA 5KHDA 3S93A 1S9HA 2R7TA 4OWRB 3VDXA 3HOSA 2WADA 2CW8A 2LOOA 2R4GA 2M7BA 3HG9A 1X4PA 4QPOA 2HVRA 3MD2A 3K10A 1TT0A 4BE0A 3K4MA 2ZSHB 1MMDA 2E5NA 2IS6A 4F92B 4B48A 5JHFA 4Y33A 2UV1A 2XF5A 1YX5A 1ERDA 2E60A 4PFOA 4XORA 4DOZA 1WJCA 4G6TB 4E7IA 1MNEA 3LL7A 5HVQC 2A6TA 3OL3A 4YELA 4PFPA 2CUZA 3F9KA 3HL2A 3H9JA 2CH0A 4BJTA 2KQRA 1D1AA 2W7NA 2WY7Q 2O5RA 3MMYB 3OWTA 4DBQA 1X4OA 4ZTJA 4YRVA 2IS1A 3OYHA 2R7XA 3HXLA 4F55A 1QU3A 3OYIA 4ZJZA 3K4LA 4OAZA 2IXSA 2DT6A 1V5GA 2WA0A 3CF2A 2KP6A 1K6YA 3N05A 3L2VA 2MYSA 3IAM2 3M1CA 3U21A 3OY9A 2HQAA 3VWBA 4II2A 1MMAA 1R6RA 3C2HA 3CJRB 4BUPA 2L9NA 4BDYA 3S3OA 4RMNA 3DU6A 2FUG2 3NWTA 3OYBA 4E4HA 4B3XA 2XDVA 1DP3A 3PJRA 2XC7A 4P5OA 3UNGC 2IGMA 4BL0B 1VZ0A 2M4KA 4ZDOA 4XOPA 2CFOA 3OYCA 4BE2A 3TL4X 2HNHA 3SEQA 2BVMA 4D1QA 3VSLA 1FMWA 3RPUD 3OYGA 4AYBA 3LSIA 4CCJA 2CV0A 3SDBA 1V5FA 1WFXA 2IS2A 4HG2A 3OYFA 4CZCA 5HOOA 2KRCA 2K9MA 3AL0B 1T0FC 4Y4RA 3RSNA 1TZLA 4PJMA 4BJ5C 4QPQA 2R7VA 2W00A 4YEJA 5KNLA 2AQFA 4RM2A 1SAUA 3MKZA 1BOBA 2KHMA 3DKXA 3K4KA 3E0JB 5FROA 4BQQA 2VASA 3OYEA 2RQQA 3D5RC 4CCKA 1BR4A 4NC8A 4ZC3A 3ZR8X 2VJ4A 2WAFA 3CP8A 4XR6A 4CUGA 5CQEA 3H35A 3RTRA 3K70D 3L2RA 4XLCA 3S32A 2OUMA 1Y6IA 2GOXB 4BDZA 2CW7A 3QODA 3RQ4A 3VYSB 3TBIA 1GLNA 2I8DA 3SEZA 4HNUA 4IKFA 1E0EA 1DGWY 3LMMA 2Q2EB 3HPGA 2UWMA 3J7AY 2CV1A 2JA2A 2VXZA 3K6GA 3QOEA 3CJQB 4BJ6C 3DU5A 3KYLA 2M3AA 2WY8Q 3DWLE 2LC2A 3DTKA 3SYTA 1DGRM 3BC8A 4BE1A 4Y3OA 2QKMB 3H0DA 1N78A 4E7KA 3ZRGA 1YX3A 4XNFA 1Y56A 3K4BA 2RREA 1UELB 2V1NA 4XONA 2Z16A 2KLOA 2L9SA 3EUHC 4XKVA 2E1MB 4B44A 2BVLA 1MW7A 1N75A 4C9YA 4BQNA 2MD0A 3DQVC 3TMOA 1LKXA 2IGOA 1OLTA 4U87A 4MLOA 4BQOA 2JUGA 2LY1A 2VQCA 4ANJA 2LH9A 4J01A 3AL0C 3W2VA 3QYFA 2VQLA 1Z3YA 1W36C 1NG7A 1QHGA 1Z7LA 2BOLA 4AVZA 4BXFA 2CV2A 1KONA 3EUKL 5FRNA 2F4IA 3FBIB 1FMVA 3A1YA 3W2AA 3FKJA 1D0XA 2W4SA 3VYUB 2P0WA 5CPRB 3L2QA 1X1DA 4E7LA 2XSJC 1X1AA 3FBNB 1MNDA 3BG7A 2VPLA 4HEA2 3IAS2 2K9LA 4CCNA 2HPMA 1D1CA 3H9GA 4FASD 4XM3A 4E7ZA 1LFPA 2IGNA 4KJZA 2PJRB 3LFUA 1EA3A 2V7FA 4E7HA 2R7UA 2DT7B 2Z2SB 3D5LA 2BW3B 2V26A 2KRHA 4XKBA 1UG0A 4NQWB 3H5RA 4E6KG 2Q1ZB 2E1MC 2M4GA 5CKTA 2AQEA 3QYBA 3MKYB 2LREA 3I9V2 1LDKB 2WB1A 4RLQA 2L7KA 2V4JC 3BG6A 3E1SA 2VL8A 3DTIA 4CCOA 3L2WA 3HPHA 2R7RA 3HUGB 3V42A 4HNTA 1WJBA 2DCEA 1Z3XA 4CCMA 3DPUA 3NWSA 2M7AA 1MMNA 4C2TA 5LFAA 4ITVA 2A5WA 2QKLB 1SFKA 4B43A 4IX7A 3PNTA 4XLFA 3AFHA 3PSIA 3FHNA 2MABA 3OIPA 1V5EA 4KT6A 4DGWB 4F52A 3DKYA 4XL9A 3OR1C 2KPMA 3S3MA 2ZXHA 4PSXA 2DXIA 4ZDPA 4IQ4A 2VLAA 2VIXA 5KCMA 1BR1A 5TGTA 2PMZA 2X6WA 2VJIA 2X1CA 2LG4A 2ZFUA 3OYAA 1UAAA 3PL8A 1T95A 4HSRA 3ZXSA 2LYCA 2W1OA 3KX2A 4II3A 3PUBA 2HU9A 4KITB 2CMPA 3ZCOA 2Z1DA 2JSPA 1HA8A 4CH7A 4D9JA 3BCBA 4KISA 2F5VA 2GOMA 4PUSA 2VKHA 3OYLA 2IGKA 3OYJA 2L2OA 3OL4A 4XLEA 4NC7A 2IS4A 1WJ5A 4C2UA 3CP2A 3CESA 4XLAA 4BACA 1G8XA 1OR7C 4DBRA 3M8JA 2F6CA 4RLFA 3AKZA 2HZDA 3LSGA 2R7QA 3BLYA 5FRMA 1U0JA 2R7SA 1WJAA 1Z21A 4XKWA 4B47A 3QYEA 3ZGKA 2LRDA 1G59A 2KDOA 1WJDA 2WAQA 3W3CA 4XMYA 4BEHA 1PYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFK A;  1R6R A; 
#chains in the Genus database with same CATH topology
 3GBG A;  5HS9 A;  1ETV A;  3G2B A;  2Z5U A;  3AG1 H;  2DTR A;  4GDF A;  1R5I D;  4XRS G;  4U7B A;  2ELH A;  9ANT A;  3JTH A;  4PJN A;  2QWW A;  2L5Q A;  2OC6 A;  4E7J A;  4P96 A;  2GIZ A;  4PSW A;  4ZDL A;  3S3N A;  2XAJ A;  1A04 A;  2F5F A;  3GTG J;  5LEJ A;  3HOU J;  4E7S A;  1TNT A;  1FBQ A;  2HWV A;  3DLL F;  1WJF A;  3BTJ A;  3R0A A;  5HNF A;  1U2W A;  4I98 B;  1YYV A;  3I59 A;  4I99 C;  1IN6 A;  3LSK A;  4LIT A;  2DPD A;  3WHC A;  1B72 A;  3WG9 A;  1D8J A;  2EBI A;  4BHC A;  3EPZ A;  4DJA A;  2CUJ A;  1TQP A;  4EJT A;  3RKQ A;  5LD2 C;  1KZH A;  3WTZ A;  4O3M A;  1D0Z A;  2OCE A;  5CYV A;  2X1D A;  3M8F A;  2BEO A;  1NG6 A;  3OYK A;  2QVO A;  4DW6 A;  3S1Q J;  1MMG A;  2PX9 A;  2TCT A;  2RNG A;  4HF0 A;  4AIK A;  3TKY A;  3HOX J;  3HZJ A;  5J8C A;  3I3L A;  3GLX A;  3BQY A;  3K4N A;  3QP6 A;  1U6G A;  3JRE A;  1YG2 A;  2V9P A;  1W7P D;  2EH3 A;  5BNG A;  3IHU A;  1O7L A;  3IWZ A;  3T1B A;  4BS9 A;  3S15 J;  3OIO A;  2WAE A;  1SFX A;  1UMQ A;  4RB3 C;  3LSR A;  3H92 A;  3BY6 A;  3CLO A;  2VQH A;  1LEB A;  2C6Y A;  3WGH A;  2NNN A;  2E5Z A;  3LA3 A;  3CUQ B;  1ETY A;  1ETK A;  1YW7 A;  2KMU A;  4LIU A;  3MN2 A;  2ZXI A;  3DPL C;  4JQF A;  1ZRC A;  3U1K A;  5LRR A;  4EJV A;  1AOY A;  4XQF A;  2FBI A;  2DOA A;  3K1N A;  1ON2 A;  1N77 A;  2JUC A;  5E3O A;  1WI3 A;  2Z99 A;  2IA1 A;  3KP7 A;  2HVS A;  2AS5 F;  2VBX A;  4D5C A;  2HFH A;  2ZC2 A;  3HOY J;  3JRD A;  3G73 A;  2P7V B;  1U5T A;  4AIJ A;  1XS9 A;  2KJB A;  2W84 A;  1DQU A;  1EF4 A;  1YTY A;  3DTE A;  4IO9 F;  1T33 A;  1ZGJ A;  3IKT A;  2O7O A;  2K27 A;  4ZYG A;  2EIK H;  4P55 A;  1RET A;  2P5K A;  1EJ9 A;  3TOA A;  2EWN A;  3HOT A;  2OU2 A;  5M5W J;  3FXK A;  2FJ1 A;  1IGN A;  2R93 J;  1KYZ A;  2CQ7 A;  1YRN B;  3FXR A;  2NNY A;  1C0W A;  2H27 A;  2BBY A;  2E1O A;  4RAG A;  4HX4 A;  3WTY C;  5JVT A;  4ZZD A;  4F3Q A;  2EK5 A;  2VB6 A;  2HYJ A;  3WOD F;  3OS0 A;  2DJI A;  1XMA A;  4HLY A;  3MEX A;  1BR2 A;  2HDW A;  3F23 A;  1RI7 A;  5F64 A;  2H6C A;  2BHZ A;  1K79 A;  2NS8 A;  1A5J A;  3ONQ A;  1PJR A;  2X51 A;  3LAP A;  4XOT A;  3HIF A;  3S93 A;  1S9H A;  1RUN A;  1HSJ A;  4O6J A;  2OAZ A;  3KZY A;  3R61 A;  2R4G A;  4M3F A;  1LE8 A;  2M7B A;  4UUS A;  3HG9 A;  4QPO A;  5F04 A;  4A5N A;  5BS6 A;  3HSF A;  3MD2 A;  3K10 A;  4KIG A;  2ZSH B;  1Y39 A;  2XRN A;  1FOW A;  2KDZ A;  3PIO F;  1IRG A;  2E5N A;  3QWL A;  1KQ0 A;  1RKW A;  1YIO A;  2E60 A;  2OZ6 A;  1TWA J;  4E7I A;  4HV6 A;  1G6N A;  1S6L A;  1VI0 A;  4EJU A;  1KYW A;  2QSF X;  3ZQI A;  2AO9 A;  2DMQ A;  4IHV A;  1TWH J;  3OL3 A;  2CWE A;  2XAS A;  4YEL A;  2MD5 A;  3IRR A;  3F9K A;  1KQ8 A;  3H9J A;  4M3E A;  5E1X A;  3KYD B;  4I0A A;  2JRM A;  4BJT A;  3ZQ7 A;  1D1A A;  2GBY A;  2KFD A;  1Z7U A;  3DKW A;  4IRH A;  2ECB A;  2WY7 Q;  3FF5 A;  3CC4 I;  3K9T A;  4DBQ A;  1H89 C;  2E1N A;  4NC6 A;  4YRV A;  3ABM H;  4P9U A;  5ICE A;  2DMU A;  3OYH A;  2IS1 A;  1B4A A;  1QU3 A;  1UCR A;  1ZG1 A;  2B7E A;  3KP2 A;  1L0O C;  1WPK A;  3CF2 A;  5LRS A;  3HM5 A;  1SAN A;  4B8X A;  2L7F P;  5J47 A;  3R4K A;  3I58 A;  3L2V A;  5TIS C;  2ESN A;  4II2 A;  1MMA A;  2E7W A;  3C2H A;  3CJR B;  2FUG 2;  3HOZ J;  2M34 A;  2Z3Y A;  4Q47 A;  2RV8 A;  4RGS A;  4B3X A;  1IXS B;  2XDV A;  3B6A A;  2QF7 A;  2FD5 A;  2COM A;  2DMT A;  2UXX A;  3PJR A;  1IXR C;  2GIV A;  3CJN A;  3UNG C;  4BL0 B;  2R7F A;  5L3D A;  2VC0 A;  2W48 A;  3TL4 X;  3F22 A;  1FMW A;  2RQP A;  2HYF A;  5J4Y A;  4AYB A;  4WWC A;  2ID6 A;  4CCJ A;  3V7C A;  2CV0 A;  2DA5 A;  2VI6 A;  3Q0W A;  3H3U A;  3SDB A;  2JA5 J;  1YQA A;  1V5F A;  1DU0 A;  1G4D A;  1HDP A;  1SVM A;  2PI0 A;  2D5V A;  5H2F C;  5F08 A;  2R92 J;  3W6V A;  4G8X A;  1MBH A;  4YEJ A;  2AQF A;  2H94 A;  3A02 A;  3CQZ J;  2KHM A;  3DKX A;  3K4K A;  5FRO A;  2L0K A;  4V2G A;  4MO7 A;  5LGT A;  3QU6 A;  2L02 A;  3IH2 A;  2F4M B;  2XRO A;  1BI0 A;  2MBF A;  4RAY A;  1Y0N A;  2L01 A;  1BR4 A;  4AC0 A;  4OOI A;  3CP8 A;  4CUG A;  1LDD A;  2QQA A;  3H35 A;  2OF7 A;  3K70 D;  2OUM A;  1AKH B;  1K78 B;  4BDZ A;  2CW7 A;  4MFE A;  1IUF A;  1QQI A;  1U9N A;  3EUH A;  5LEK A;  1Z9C A;  2WWY A;  1HW5 A;  3ULQ B;  2CYY A;  1E0E A;  1SD7 A;  4UY8 I;  3GEZ A;  2Q2E B;  1PUF B;  4A5M A;  3JRF A;  2FNP A;  3JRI A;  2JA2 A;  1XMX A;  3RKX A;  3KYL A;  3DWL E;  3F8F A;  3V4G A;  3FXM A;  3X2Q H;  2OPT A;  2AXL A;  3DTK A;  4HA8 A;  2KT0 A;  3BC8 A;  1GDT A;  1OYY A;  3JAM Z;  4G7H F;  1X3Z B;  3BZK A;  4L5J A;  2VBZ A;  1JTY A;  3GTO J;  1H9G A;  3FK7 A;  2JA7 J;  3HTS B;  1RZ4 A;  2CRG A;  1R4M B;  3E6B A;  4HOB A;  3FXU A;  4XNF A;  1YJW I;  1Y56 A;  1FEX A;  1MBG A;  4QSH A;  5CJ9 A;  1RIO H;  5ICG A;  1XTA A;  2XGE A;  2EA2 A;  2VN2 A;  4AVP A;  2DTZ A;  4I7H A;  3DCF A;  4A93 J;  1E17 A;  2E34 A;  2OTL I;  3HRU A;  2HKX A;  5DD4 A;  2EZK A;  4XKV A;  5JFR A;  4B44 A;  3DV8 A;  1HQC A;  2HDC A;  4EEF G;  3K1M A;  3TMO A;  3F8C A;  2A61 A;  4ON0 A;  5CVJ A;  2R5Z A;  3S1M J;  1VQO I;  4IEJ A;  4U87 A;  4NQW A;  2VQC A;  4ANJ A;  3JSO A;  2ZKZ A;  3AL0 C;  1SEU A;  2FQ3 A;  1SMT A;  1ITY A;  2D2W A;  2HOE A;  1W36 C;  4BXF A;  1OKR A;  5FRN A;  1XX5 A;  3FBI B;  1FMV A;  4LB6 B;  4YIR X;  1QPI A;  1D0X A;  2P0W A;  2XB5 A;  3QAH A;  2L7M P;  1X1D A;  3MWM A;  3WGI A;  3L2Q A;  2XSJ C;  4EGZ A;  3F8M A;  1WRJ A;  5M5Y J;  1MND A;  3BG7 A;  4HEA 2;  1QZY A;  2K4J A;  3IAS 2;  5FGM A;  5AIP A;  4M73 A;  2Y30 A;  2PLY A;  1R1U A;  2HPM A;  1D1C A;  3C3W A;  3H9G A;  4FAS D;  1ZAR A;  4J19 A;  4XM3 A;  1QGP A;  2PJR B;  2STW A;  2JSC A;  3HOW J;  4E7H A;  1HW2 A;  1ULY A;  2YR2 A;  2BW3 B;  3V8L A;  5IT9 K;  2DPU A;  3RPU A;  4N0B A;  2BY3 A;  2ZBK A;  5IYC J;  3H5R A;  4E6K G;  2Q1Z B;  3I4N J;  2M4G A;  4IHT A;  4X6A J;  1JUS A;  2LRE A;  2XAQ A;  3B73 A;  1LDK B;  3I9V 2;  4RLQ A;  5J3L A;  2V4J C;  3FXL A;  3AAF A;  3L2W A;  5D8L B;  4V19 K;  2R7R A;  3DP7 A;  1S72 I;  4BYY A;  1QVU A;  2MH2 A;  5HS8 A;  2YX7 A;  2DYS H;  3GTJ J;  1Z3X A;  4CCM A;  3JCU C;  3MKL A;  5CVR A;  4ITV A;  1FT9 A;  1SFK A;  3A01 A;  4Y17 A;  3EQL F;  3PSI A;  3ZOB A;  1T2K A;  3OIP A;  4XID A;  1V5E A;  4RB2 C;  3DEW A;  2M0C A;  1F43 A;  4XL9 A;  5EEH A;  3R0J A;  1HW1 A;  5D6F A;  3SXY A;  4HDU A;  1F9N A;  3ABL H;  2KPM A;  3S3M A;  4A3I J;  2ZXH A;  4PSX A;  1IAW A;  2DXI A;  1D3Y A;  4ZDP A;  1IRZ A;  3JRG A;  1BN5 A;  3KFW X;  4FHT A;  2VIX A;  1GV2 A;  5TGT A;  2XHK A;  2EFQ A;  3DBH B;  3UKG A;  2LG4 A;  1UAA A;  3ZXS A;  3HHH A;  2VPR A;  1T39 A;  2KIF A;  3KX2 A;  5JR3 A;  3JRB A;  2D1H A;  5HLG A;  2JSP A;  3HBL A;  1ODD A;  1E3O C;  3BCB A;  2QYO A;  4KIS A;  3G3Z A;  2VKH A;  3OYL A;  5A2Q Z;  3OYJ A;  2L2O A;  2BGC A;  4E70 A;  2IS4 A;  1ZK8 A;  1HKS A;  4EM2 A;  3CP2 A;  1R5G A;  4XLA A;  1XDS A;  5DDG A;  1OR7 C;  4DBR A;  2B63 J;  5EEG A;  1POG A;  2W85 A;  3RZO J;  2QUF A;  3D1N I;  1LQ1 A;  2E1C A;  2FQ4 A;  1U5T C;  1K4T A;  2R7Q A;  3JRH A;  1U0J A;  1MDM A;  1IXC A;  1N25 A;  1FOK A;  3BOQ A;  4G7Z F;  4WX9 A;  5J4V A;  1W7P A;  1JKP C;  3FMR A;  4I0B A;  1YIT I;  5K5R A;  1VQ4 I;  1RRJ A;  3W3C A;  3QRF F;  2ZME B;  3CCR I;  1DDN A;  1RUO A;  3F72 A;  1PYV A;  1CQT A;  2XAH A;  4BEH B;  4BHB A;  4M72 A;  4R1H A;  2B0L A;  4CXF A;  1YRN A;  1G2H A;  3H0G J;  3TW6 A;  4MQV A;  3C1D A;  2CS3 A;  3ZQQ A;  3CO7 C;  4OMY A;  3G1M A;  2JWT A;  2A05 A;  3NAR A;  1H9T A;  1NHA A;  2X85 A;  5GTI C;  4A3L J;  1YLF A;  1IRX A;  3HSR A;  3W2W A;  2Y0S A;  4LG3 A;  4FET A;  1OYI A;  3FIW A;  5FKO A;  2DO7 A;  2O03 A;  1BI2 A;  2V1X A;  3I59 B;  4I6Z A;  3IUO A;  2BW3 A;  1YS7 A;  2JT1 A;  5IP7 J;  2ZSI B;  3LSM A;  1JHF A;  2E7X A;  5LGU A;  3ZQH A;  1IN5 A;  1JT6 A;  2MFZ A;  1S3J A;  3WU1 B;  1XC5 A;  1CF7 A;  2FBK A;  4PCQ A;  5ED4 A;  1ZR4 A;  2DA6 A;  3HSE A;  4C30 A;  3ZPL A;  1O3Q A;  3QPH A;  4Q4Z F;  1O3R A;  2EIJ H;  2I10 A;  2VJJ A;  2WTE A;  2ELJ A;  4W1U A;  4X0G A;  3LNQ A;  4HQE A;  3ZQL A;  3TO9 A;  1WJE A;  1Y8R B;  4M9S A;  2CU7 A;  1R36 A;  2M0M A;  2VQG A;  1GVJ A;  1UG2 A;  2HPI A;  2QQ8 A;  2IVM A;  2D1V A;  3MAJ A;  2XF7 A;  2H8W A;  2KIM A;  1F5T A;  4P1W A;  3E7L A;  1I3Q J;  4HW0 A;  2DK8 A;  2PJR A;  2O8K A;  1B9N A;  4BXU A;  1OCZ H;  3OS1 A;  3GFJ A;  1AKH A;  1ORK A;  3RIR A;  5D5X B;  5HLT A;  2RGV A;  3J81 Z;  4RM3 A;  4J00 A;  4DIQ A;  3JSP A;  1X19 A;  2P4W A;  1VF9 A;  2JMW A;  2X6X A;  3ERM A;  3OOU A;  2PEX A;  3F21 A;  2F48 A;  3H9Q A;  1LFU P;  2YSR A;  1JI8 A;  2W57 A;  4EGY A;  2H09 A;  4A12 A;  3ZP5 A;  1X2M A;  1WWX A;  4NUB A;  3A2K A;  3P9K A;  5FLM J;  2LSO A;  2M87 A;  2ZFW A;  4Z6Y A;  4UVC A;  4XLH A;  3DEE A;  2PBI A;  4UHT A;  2X9D A;  5B3S H;  2IBD A;  2R5Y B;  2DA4 A;  4BQA A;  3PIP F;  1MKM A;  4UXN A;  2OBP A;  1G3Y A;  3I0T A;  3JW4 A;  4BY1 J;  5FLV A;  3BCA A;  1JJ8 C;  5F6F A;  1LUJ B;  4L18 B;  2XPU A;  2NYX A;  4FCY A;  4HAM A;  2MC4 A;  3S8P A;  5J8F A;  4FE7 A;  2IAI A;  3VYT B;  4A3K J;  2QBY B;  2HKO A;  1WI9 A;  3M3Y J;  5B1B H;  1FX7 A;  2JVG A;  2ZNZ A;  1EKE A;  1OR7 A;  2QSG X;  5E1W A;  3G71 I;  1FLI A;  4MGR A;  4DQ2 A;  3H5A A;  3BZ6 A;  2CO5 A;  1FWZ A;  3CCU I;  3FM5 A;  5CVV A;  3ISP A;  1Z05 A;  1ETX A;  4YIF A;  2K9N A;  1BW6 A;  2PJP A;  1D1B A;  2Y9Y A;  2V6E A;  3PO2 J;  5L3C A;  1ZEL A;  2VXD A;  3FM3 A;  2BHY A;  3TDZ C;  1K83 J;  5FD5 A;  3VDX A;  3HOS A;  4M6Y A;  2WAD A;  1E3P A;  3V8K A;  5E8G A;  1KU3 A;  2L3D A;  3VFZ A;  2X4H A;  4FTH A;  1MMD A;  4GFB A;  2CJJ A;  1P4A A;  1YS6 A;  1LPQ A;  4YFK F;  4WXC A;  3CCS I;  4B48 A;  3FMS A;  2Q0O A;  2YPR A;  1DPU A;  4I76 A;  2CQX A;  2VOP A;  5A2Q K;  5J6X A;  1WJC A;  4FX0 A;  2BYV E;  2IA2 A;  3MFK A;  2LD5 A;  2QEN A;  4AM3 A;  2OZU A;  4MHG A;  3LL7 A;  3PUF A;  2O6G E;  2A6T A;  4PFP A;  1KU2 A;  2M45 A;  3CJT B;  2L4M A;  1SFU A;  4JX6 A;  1VQM I;  3CC2 I;  4LD5 A;  2ADU A;  2W7N A;  3MMY B;  3OWT A;  1X4O A;  2Y0M A;  2BXZ A;  1S7O A;  2QSH X;  1WH5 A;  1OFC X;  2OCC H;  2AHQ A;  3QU3 A;  3HXL A;  2OD5 A;  3OYI A;  1BM9 A;  1GXQ A;  4ZJZ A;  4OAZ A;  3CMA I;  2E2I J;  2DT6 A;  3J7A O;  1RR7 A;  1V5G A;  2WA0 A;  4FIS A;  2H1K A;  2KP6 A;  2EA4 A;  1BC7 C;  1E2X A;  1YO5 C;  2DYR H;  4CYC B;  3VWB A;  3G6E I;  3U21 A;  2XKO A;  2HQA A;  3HRS A;  1VQN I;  1IC8 A;  1NK3 P;  3DU6 A;  4IRI A;  2HOS A;  2QCO A;  1W5S A;  1TWC J;  3GFL A;  1XD7 A;  4UVB A;  3OYB A;  2EIL H;  2GXB A;  5LHH A;  3SDG A;  5IP6 A;  1ZRD A;  2JPC A;  1DP3 A;  4M6X A;  1HBX G;  2TDX A;  5HDN A;  2XC7 A;  4H0E A;  1XB4 A;  4ENK A;  4AWX B;  2IGM A;  3H3V K;  3BPX A;  4A3B J;  1VZ0 A;  3C2B A;  4ZDO A;  3SQN A;  2NXN B;  2HNH A;  3SEQ A;  5L3F A;  1W7P B;  4D1Q A;  4IL6 C;  2LF7 A;  3VSL A;  3RPU D;  3LSI A;  1RES A;  3P5J A;  3VOE A;  2IS2 A;  3HHG A;  2DW4 A;  1SMY F;  2KRC A;  5E20 A;  1I6X A;  1QNT A;  1FYL A;  1LDJ A;  1BI3 A;  4Y4R A;  1QO0 D;  3GVA A;  1TP4 A;  1YW8 A;  2XGC A;  2P81 A;  2CGP A;  1GXP A;  3SJM A;  3F8N A;  5ERI A;  1SAU A;  3LSJ A;  4KDP A;  1OQY A;  1VND A;  3Q0U A;  5E1Z B;  2ZJ2 A;  3BTL A;  2YUS A;  4BQQ A;  3FKI J;  2ESH A;  1I39 A;  2MW8 A;  1Z6R A;  1R58 A;  3I71 A;  1SAX A;  4ZC3 A;  5CQE A;  4MEY F;  3RTR A;  2JRT A;  4WF2 A;  4A3M J;  5C3E J;  2BY1 A;  2BZT A;  3C7J A;  3GW2 A;  5EYR A;  5GAE J;  3KCC A;  3RQ4 A;  1TQM A;  3VYS B;  4S0H B;  4IF4 A;  5FFX A;  3TBI A;  4UUV A;  2I8D A;  1XGN A;  4IKF A;  2DDB A;  2CSO A;  3BG9 A;  4GXO A;  2M5W A;  1REP C;  3J7A Y;  3TW7 A;  3LOC A;  2JQ7 A;  1VQ9 I;  3BJA A;  2XKP A;  2K40 A;  4HF2 A;  4X1E A;  2Y2Z A;  3SYT A;  4BE1 A;  3SFZ A;  2EQR A;  4A0X A;  2K02 A;  1TWF J;  5FO5 A;  1N78 A;  4E7K A;  3ZRG A;  3BTI A;  4N9H A;  3OSF A;  1JHH A;  3K4B A;  2LTP A;  3GX4 X;  3GXO A;  4XSX F;  2ECC A;  2CUE A;  1O3S A;  1OJL A;  4G6Q A;  2DBB A;  1Y1W J;  2K9Q A;  2V1N A;  1ZH5 A;  4XON A;  2WAQ N;  2DT5 A;  5J1Y A;  1N75 A;  4C9Y A;  4BQN A;  3ASO H;  2MD0 A;  1LKX A;  5GAD J;  1LB2 A;  3ZMT A;  4UB6 C;  4B09 A;  4U0Y A;  3BG5 A;  2VUM J;  1ACI A;  5K5O A;  3QPS A;  2LDU A;  5B66 C;  3QYF A;  1Z3Y A;  1TBX A;  2VC1 A;  3TO6 A;  1NG7 A;  1QHG A;  2MC3 A;  4AVZ A;  1KON A;  3EUK L;  5IYD J;  2FML A;  2NVY J;  3A1Y A;  3U9G A;  4KA4 A;  1O57 A;  3FKJ A;  5D5U B;  2W4S A;  2ZXJ A;  3VYU B;  4DYC A;  1FPQ A;  2Q2E A;  4KUM A;  1QA6 A;  3G1O A;  2IEK A;  1ZGW A;  1HXD A;  1IN7 A;  4CCN A;  2K9L A;  4A3D J;  5TJJ A;  4C3J J;  2DOE A;  1T0F A;  4FX4 A;  1W4M A;  4EJO A;  1BC8 C;  3F8B A;  4E7Z A;  1LFP A;  1OCT C;  2RKH A;  4U7D A;  1R49 A;  5HDK A;  2V7F A;  2R7U A;  4IPA A;  5D8K B;  3ZQC A;  2Z2S B;  1QZZ A;  2E36 A;  2X6O A;  1RC9 A;  3B02 A;  5K7H A;  5FKM A;  4XLN F;  4G7O F;  1UG0 A;  1YHQ I;  3B6C A;  2NVX J;  4W97 A;  4BH9 A;  1T98 A;  3WU0 A;  2AQE A;  3MKY B;  2WB1 A;  3BG6 A;  2ZJP F;  3E1S A;  3BR0 A;  3DTI A;  1TWG J;  1FTT A;  4Y15 A;  1OCP A;  4KIB A;  2LY9 A;  2CFX A;  3M07 A;  3RPQ A;  2XPW A;  3HUG B;  3V7R A;  4ETS A;  2WV1 A;  4C2T A;  1ZN2 A;  3WHB A;  2ACJ A;  4B43 A;  4XLF A;  5HOD A;  1HDD C;  2JA8 J;  2HEO A;  2EV0 A;  1BIA A;  2MAB A;  1U8R A;  5K7F A;  3T5X A;  1IW7 F;  1R71 A;  4DGW B;  4F52 A;  4G94 A;  4IVN A;  1FBS A;  1OCO H;  2ZJQ F;  1QZE A;  4IQ4 A;  2O8X A;  3FZV A;  4PJ0 C;  3CD6 I;  3RZD J;  2X6W A;  2EFO A;  1DUX C;  3DBL B;  4G12 A;  1XDU A;  3PL8 A;  1T95 A;  4HSR A;  2W1O A;  4MEX F;  3I53 A;  1HKQ A;  1ZYR F;  2F5C A;  4ZYE A;  5EG0 B;  1FIP A;  2ME0 A;  4KIT B;  4A3F J;  2CMP A;  1HA8 A;  4CZZ A;  1J75 A;  5E18 F;  2HXO A;  4Q48 A;  1AHD P;  2IGK A;  2OQR A;  5ILU A;  3O8G A;  4ENM A;  5IOY A;  1IZ1 A;  1W5T A;  3V7S A;  4XBF A;  3E6D A;  3GFI A;  1PP8 F;  4BAC A;  2XPV A;  3KEO A;  3M9A A;  2GXG A;  3RI4 A;  2RDP A;  3FIS A;  3JTG A;  1X2N A;  4XK4 A;  4RLF A;  5BPD A;  2HQN A;  3M7G A;  2ZME A;  3LSG A;  3COA C;  4LG0 B;  3PQK A;  1J59 A;  5FRM A;  2R7S A;  4OIP F;  3EET A;  2V1D A;  5GPA A;  1Z21 A;  2ISY A;  4XKW A;  4B47 A;  4XLP F;  4PGG A;  1D5Y A;  3Q3S A;  4GGG A;  3GTM J;  2H8R A;  1P2F A;  4BKX A;  1K61 A;  2LRD A;  2KDO A;  3RKW A;  4ENN A;  2ID3 A;  4BEH A;  3EYI A;  3CUQ C;  3CLQ A;  4M74 A;  4UV8 A;  3WTW C;  3HC7 A;  1OIS A;  5FKK A;  3OIQ A;  1RKT A;  3KZI C;  3PFY A;  2UUZ A;  2KZV A;  2A6H F;  1WH7 A;  3KP4 A;  4N4N B;  4QTR A;  1A36 A;  4EMS A;  5HLH A;  3C2G A;  5CQG A;  4UUS B;  3I64 A;  3SZP A;  2FE3 A;  2YS9 A;  1SD6 A;  1Z1D A;  4M9X A;  4IXA A;  4RGU A;  2XB0 X;  3RYR A;  3SZG A;  3GZ6 A;  4BGD A;  1I6H J;  2W82 A;  2X6Y A;  1YE9 A;  2KL4 A;  2LKS A;  1UFM A;  2ETH A;  3D5S C;  4HPQ A;  5IY5 H;  3OS2 A;  3K4C A;  4CYD A;  4XN0 A;  1ETQ A;  2J5O A;  4HRI A;  2VT2 A;  5C44 J;  2D45 A;  1G3T A;  2XAF A;  4LG0 A;  5BPI A;  4CYC A;  5IOZ A;  3L7W A;  3NEU A;  5CLS A;  2R0Q C;  3A01 B;  1IJW C;  2AXT C;  2O3F A;  3MCZ A;  3OR2 C;  2O9L A;  1PUE E;  2GWR A;  3IH3 A;  2NVQ J;  3HGY A;  4EM0 B;  3F6V A;  2NRA C;  1V3F A;  2FX0 A;  2NS7 A;  4KMU X;  2V9K A;  3DPT A;  2IPQ X;  2P5V A;  3A03 A;  2BE5 F;  3WTU C;  2Z33 A;  1ZR2 A;  2G0E A;  2DFI A;  4EAT A;  3MQ0 A;  1J5Y A;  4HBL A;  1AA7 A;  3A4C A;  4H4K C;  2PN6 A;  4N4O B;  3WG7 H;  3S1R J;  2HVQ A;  1QVT A;  4S05 A;  1UZC A;  4ZTF A;  3BP8 A;  3QQA A;  4TV7 A;  3E5X A;  1J9I A;  2FNA A;  1ZLK A;  2VKD A;  4A3G J;  4G9Y A;  3TDU C;  1VQ8 I;  3CF5 F;  4IQJ A;  3CDL A;  2Y75 A;  2K3P A;  2IRF G;  4L9V A;  1U5T B;  3CUQ A;  1QPM A;  3EDP A;  5IPA A;  5DM7 F;  4JOM A;  5EG0 A;  1TTY A;  1D8K A;  1GHC A;  3K70 C;  5FD6 A;  4LIV A;  2RVC A;  5LLQ A;  2HI3 A;  1H8A C;  1PVE A;  2HS5 A;  4LMY A;  5CVU A;  4KIC A;  2EZL A;  2WBM A;  2ZME C;  3CZ6 A;  1APL C;  4OAY A;  2HOA A;  2KZG A;  3T0Y A;  2LNB A;  3OMY A;  3QP5 A;  3VSK A;  2QQ9 A;  4MTD A;  2LKP A;  4HV5 A;  4FQG A;  3QOP A;  4XKC A;  5FJ8 J;  4PGH A;  4ASN A;  3IP4 B;  4CO8 A;  3ZMU A;  2FEZ A;  2ICW G;  2NS0 A;  4XIC A;  4OU0 A;  2VJ5 A;  1X58 A;  3ASN H;  4GRI A;  2EV5 A;  3BJO A;  3KLO A;  1O7F A;  4HYE A;  3GFM A;  3H5N A;  1MBF A;  1GVD A;  2ZB9 A;  3PNY A;  3HKZ A;  2RC4 A;  1QHH D;  2VBW A;  2EIN H;  4NBQ A;  2LK2 A;  1IF1 A;  4PZJ A;  3KP5 A;  5L3B A;  1YIJ I;  5D5W B;  3CDH A;  3BR3 A;  1T08 B;  1ZGA A;  2FOW A;  5EEA A;  2YU9 J;  4M3G A;  3J81 K;  1X1P A;  4YG2 F;  2K5C A;  3K1P A;  1MH4 A;  3KYC B;  5KHD A;  2VOO A;  5DCM A;  4ZYH A;  2IP2 A;  2R7T A;  4IOA F;  2HXI A;  2HQ5 A;  5CVI A;  2LOO A;  3FMQ A;  5GP9 A;  1HLV A;  5FFZ A;  3Q0V A;  1X4P A;  2HVR A;  2K86 A;  1TT0 A;  4BE0 A;  4IHX A;  1I5Z A;  3O6B B;  3K4M A;  2BV6 A;  5DD8 A;  1P7J A;  2E2H J;  2IS6 A;  1P4X A;  5JHF A;  5KVR A;  2UV1 A;  4B3A A;  4Y13 A;  1ERD A;  4PFO A;  4XOR A;  4DOZ A;  4M9Z A;  1YI2 I;  1ZG5 A;  1F1Z A;  4RDU A;  1ZKG A;  4F7Z A;  5ICF A;  3JR9 A;  2CUZ A;  1P92 A;  2RAE A;  3DBR B;  2DDA A;  2ZO4 A;  2O5R A;  3SHF A;  2EIM H;  1TNS A;  1ENH A;  2M2E A;  4N9I A;  3ZMV A;  3M4O J;  4LLG F;  1UHM A;  3KE2 A;  4F55 A;  4QLC U;  1PUF A;  4PDK A;  2DLL A;  3KET A;  4HX8 A;  3HKZ N;  4BBS J;  4CGZ A;  2XV4 S;  4LK1 F;  2OJE D;  3ZN1 A;  1K6Y A;  5IT3 A;  1T38 A;  3M1C A;  2E19 A;  4C2M J;  1R6R A;  2P6S A;  3ZQG A;  3Q5F A;  4OIQ F;  4RMN A;  4I09 A;  4LGW A;  3NWT A;  3T8T A;  1P7I A;  5FKN A;  4E4H A;  4D7M A;  3I4P A;  2ZXW H;  2B9S A;  1FTZ A;  3O2P E;  2LF8 A;  1R9T J;  1BOA A;  3PQJ A;  4P5O A;  3H3Z A;  3CCY A;  5DUI A;  1KA8 A;  3F0C A;  2M4K A;  5DCM B;  4XOP A;  2CFO A;  4BE2 A;  1JUP A;  1K7A A;  1R1T A;  1FIA A;  2NAZ A;  5F0C A;  3G4S I;  3FXQ A;  4QWQ A;  1HCR A;  1D5V A;  3OYG A;  1T6S A;  5L3E A;  5E8I A;  3ESW B;  4O5V A;  1WFX A;  2ZCW A;  3OYF A;  1SD5 A;  1O3T A;  3CTA A;  3LST A;  4CZC A;  2K9M A;  3AL0 B;  1T0F C;  3RSN A;  3JAM K;  1I50 J;  4PJM A;  2DJN A;  3S14 J;  3BR2 A;  4B1R A;  4HNV A;  5KNL A;  4RM2 A;  3BQZ A;  4XRS A;  1BOB A;  1MNM C;  3E0J B;  2GXA A;  1P6R A;  3S1N J;  5DEQ A;  2VAS A;  2VKV A;  1IRF A;  3ROU A;  5FLX K;  1TL8 A;  2Z9O A;  1JKO C;  1R5H A;  3OYE A;  2RQQ A;  1ETO A;  5J40 A;  5M5X J;  1HKT A;  3D5R C;  4XRM A;  3VPR A;  2VJ4 A;  2WAF A;  1X3W B;  2HTJ A;  3BZC A;  3S32 A;  1Y6I A;  2GOX B;  4YII A;  3N4M A;  1R00 A;  1B8I B;  3QOD A;  3HTU A;  2BY2 A;  1IV6 A;  4WCG A;  3GF2 A;  1CGP A;  4BXX J;  4A3E J;  2DI3 A;  1FOY A;  2MLG A;  3W6K B;  1WKM A;  4L0Z B;  4A3C J;  1NK2 P;  3SEZ A;  1YJN I;  1A31 A;  2VOD A;  1MSE C;  3WTS C;  4MIM A;  5FB2 A;  2DQR A;  4HNU A;  1I3A A;  1USS A;  3REO A;  2VON A;  3L1P A;  2CV1 A;  5F0F A;  5D4R A;  3BR5 A;  1W0T A;  3CJQ B;  4BJ6 C;  3DU5 A;  3CCJ I;  2WY8 Q;  4K2E A;  3JRA A;  1G3S A;  1DGR M;  3K0L A;  1SFO J;  1XCB A;  4Y3O A;  2QKM B;  3TP3 A;  5F1R A;  3IKV A;  1F4K A;  4ESJ A;  4IOC F;  1LNW A;  5EGO A;  1NH3 A;  4LFU A;  1T56 A;  1YX3 A;  2IA0 A;  2GAU A;  4LJZ F;  1MSF C;  2H6B A;  5BQT A;  3OOP A;  4S04 A;  2RRE A;  2FXA A;  4JYK A;  1UEL B;  4ESF A;  5TRD A;  3SZT A;  2XIG A;  1E3H A;  2LLK A;  2Z16 A;  1YFH A;  3EUH C;  5HS7 A;  2GM4 A;  2VBY A;  1MW7 A;  2KRF A;  3DQV C;  4DNC A;  1G3W A;  4RB0 A;  1MGT A;  4RA2 A;  3G1L A;  1FNN A;  2CQN A;  4MLO A;  3IL2 A;  1Y1V J;  1B1B A;  2JUG A;  2LY1 A;  1T8I A;  4HZF A;  5ILV A;  1WHU A;  2LH9 A;  4J01 A;  1WSU A;  3W2V A;  3CCQ I;  4RGX A;  4KN7 X;  2LVS A;  2FRH A;  1M1E B;  2HTS A;  5LBQ A;  2F4I A;  2A5Y B;  2G7U A;  3Q9V A;  4GO1 A;  3AG4 H;  3BR1 A;  4E7L A;  1ZQ3 P;  4A3J J;  2JN6 A;  2EJR A;  2VPL A;  3Q9S A;  3ZMZ A;  5FLX Z;  3CCE I;  2NVU B;  2CW0 F;  4R8H A;  4ZYD A;  2DA7 A;  2F5D A;  4I2O A;  3BT9 A;  3LFU A;  5E17 F;  3U2R A;  1DPR A;  2E71 A;  3A0H C;  2EFP A;  3VEP A;  2KRH A;  3GTP J;  1WQ2 A;  2PMZ N;  2LKX A;  3EYY A;  4NQW B;  4Q5S F;  3HYI A;  3GWZ A;  2HOT A;  2E1M C;  5IT9 Z;  5EJC A;  3QYB A;  4C3I J;  4IHS A;  2J5P A;  2L7K A;  2OTJ I;  1ETW A;  1R4N B;  2YX4 A;  3E6M A;  2X48 A;  1MD0 A;  3HPH A;  3ERE D;  4ENJ A;  4G6D A;  2GLO A;  2MSY A;  2DMN A;  2QBY A;  3L2C A;  1A6I A;  3KLN A;  1ONV A;  2G7H A;  4UNO A;  2QGU A;  4IHY A;  3O8H A;  2R7Z J;  2HR3 A;  3FHN A;  1ZAO A;  3S2W A;  1BJA A;  2Y31 A;  2CUF A;  3DKY A;  3NQO A;  3E5Q A;  3K2A A;  3KZZ A;  1AWC A;  3QPL A;  1R7J A;  2M8E A;  3IV5 A;  2DOD A;  1K4S A;  2VJI A;  2ZFU A;  3OYA A;  2P5L C;  2G9W A;  1P4W A;  1B72 B;  3GTQ J;  3PUB A;  2HU9 A;  1F36 A;  2RN7 A;  4MTE A;  3ZCO A;  2V9V A;  4DZJ A;  1ZRE A;  3AG3 H;  1S7A A;  3CUO A;  1PDN C;  4GCV A;  2GOM A;  2LFB A;  1BL0 A;  1OYW A;  3F3X A;  3OL4 A;  2JTV A;  4EM1 A;  4L9N A;  4NC7 A;  4OIN F;  2FU4 A;  1WVR A;  2PQ8 A;  4C2U A;  4M71 A;  5H6R A;  3WGG A;  1AU7 A;  2HQR A;  1FBU A;  4WK8 F;  5AON A;  1MZB A;  2F2E A;  1L3L A;  2HZD A;  3J80 K;  1JKR C;  3P7N A;  2COB A;  5D4S A;  3BLY A;  2ME6 A;  3OSG A;  1X3U A;  3QYE A;  3ZGK A;  1TLH B;  4IHW A;  3GTK J;  1U9O A;  1WGX A;  1B59 A;  1G59 A;  1HST A;  1RPW A;  1WJD A;  2WAQ A;  5JVG F;  2V1U A;  1R1V A;  3LSH A;  3EUA A;  1ZRF A;  3PSF A;  4EV0 A;  4FE4 A;  5K5Q A;  3UR3 C;  4FT8 A;  1ZHF A;  3VYR B;  5DS9 A;  2XF6 A;  3CCV I;  4A0Z A;  2TRT A;  4XN3 A;  3MKW B;  1GV5 A;  4D0P A;  3TOB A;  3OYN A;  2EPF A;  1R23 A;  4KMF A;  2PG4 A;  1MH3 A;  4PJJ A;  3WTV C;  1TW2 A;  2NOJ B;  3RDI A;  1S29 A;  1SVL A;  2E35 A;  2M30 A;  4CCL A;  2DA2 A;  2R7O A;  4I01 A;  3GZ5 A;  3K4J A;  1BA5 A;  1Q1V A;  2FBH A;  4LLN A;  4M3B A;  4Z2Y A;  5M3F J;  2ELK A;  1LJ9 A;  2FF4 A;  4JK1 X;  1LVK A;  3RCO A;  1J09 A;  2Y0S N;  1P9Q C;  3TGN A;  3KP6 A;  4NB5 A;  2LMD A;  4BU2 A;  1Y0U A;  1XCV A;  3D0S A;  4U0W A;  4ZYA A;  5DM6 F;  4JX5 A;  4UB8 C;  1EV7 A;  4LLL A;  5EDN A;  1W36 D;  1UST A;  3KEY A;  2LP0 A;  3DXJ F;  4NNJ A;  1JGS A;  4AU7 A;  4D7N A;  4DYQ A;  2F4O B;  3HGG A;  4U0V A;  1X1B A;  4RS8 A;  3OYM A;  4AYB N;  3R60 A;  2L4A A;  4CDG A;  4Y52 J;  3ABU A;  3GTL J;  3BPV A;  3ZMS A;  3PNV A;  3L2U A;  4DYR A;  1ON1 A;  5GAG J;  2M1B A;  1VQK I;  3I5U A;  3I55 I;  2M8G X;  5LHG A;  3ZMD A;  3ABK H;  3M8E A;  3BJ6 A;  3RKY A;  4A0Y A;  3WU2 C;  2W24 A;  4B4C A;  3IRQ A;  4MQ9 F;  1VQ5 I;  1JTX A;  4BAY A;  4CA0 A;  4F91 B;  3S16 J;  1BJZ A;  1SFE A;  3FK6 A;  5C4X J;  2JK3 A;  1NTC A;  3DLA A;  5FKL A;  2XGD A;  3HOV J;  4WXH A;  5ILS A;  3U1D A;  4R79 A;  2FMY A;  2OV7 A;  5DV5 A;  2LBF A;  2L54 A;  1Y8Q B;  2LBF B;  1HC8 A;  2EFW A;  5M3M J;  1BI1 A;  1MBK A;  3FDY A;  1FY7 A;  4EVI A;  3P9C A;  2MH9 A;  3S2D J;  1VQ6 I;  2XUB A;  3CMM A;  3ML6 A;  2JPB A;  1XSD A;  1LE8 B;  2V6C A;  2Q8K A;  4YFX F;  1J0R A;  3RQI A;  3E6C C;  4IZZ A;  5AIQ A;  1OCC H;  2QEX I;  2L9V A;  4U88 A;  5GPC A;  4ESB A;  5DCF A;  5B1A H;  2FA5 A;  5E3L A;  2LY2 A;  1X1C A;  4I02 A;  3TO7 A;  2XAU A;  2BY0 A;  1XSV A;  5IP9 J;  5HNH A;  1D0Y A;  2P7C B;  1KU7 A;  4F93 B;  5EGO B;  2R7W A;  2MG4 A;  1Z77 A;  5E3N A;  3FX3 A;  3WTX C;  1V55 H;  2OA4 A;  3VB2 A;  3OYD A;  1BBY A;  1EH6 A;  1S5L C;  2JVH A;  2XVC A;  4CSW A;  4QIW N;  3BRO A;  4HQM A;  4HST A;  4PJL A;  2KIS A;  2X1E A;  4PK4 A;  2KIU A;  3MVP A;  4AID A;  2DOF A;  3GLL A;  4OWR B;  1JJ6 C;  1FYM A;  4XRF A;  1YJ9 I;  3QPT A;  2CW8 A;  1IG7 A;  2L9R A;  4L5E A;  2DK5 A;  1Z6T A;  2GQQ A;  3K69 A;  5ICC A;  4F92 B;  4RAF A;  5J1U A;  3KIO A;  2H1L A;  4Y33 A;  2EZI A;  2XF5 A;  1YX5 A;  3RJP A;  1FP2 A;  5EZG A;  4G6T B;  1MNE A;  5HVQ C;  1IV8 A;  1FSE A;  3JRC A;  3HL2 A;  2VE9 A;  3S2H J;  3HUG A;  5D5V B;  2CH0 A;  4L9T A;  2KQR A;  1UJ8 A;  4MFD A;  3HEF A;  3A0B C;  4ZTJ A;  2FOK A;  1XMK A;  3MZ8 A;  3LAJ A;  2R7X A;  2K9S A;  4RBO A;  5K7Z A;  2KKO A;  3CDI A;  1IN8 A;  3K4L A;  3SFI A;  2IXS A;  3J7Y J;  2QQB A;  4RGR A;  2A07 F;  3E3V A;  3W6J B;  2I5U A;  3N05 A;  3LQR A;  2MYS A;  3IAM 2;  3L09 A;  3OV8 A;  3OY9 A;  1Q1H A;  4KNY A;  3GYH X;  4AIH A;  4BUP A;  2L9N A;  4BDY A;  3S3O A;  3TED A;  2K85 A;  2UXN A;  2Y69 H;  2K3F A;  2A69 F;  4A2U A;  3GCM A;  2HGC A;  1MJ9 A;  1R22 A;  1TW3 A;  2EV6 A;  2R5Z B;  2ISZ A;  1IDY A;  1V4R A;  2QA4 I;  2WV0 A;  3WE2 A;  3I56 I;  1OCR H;  2VT3 A;  4C3H J;  3OYC A;  2XRL A;  3F6O A;  1S7E A;  2BVM A;  2R5Y A;  3I54 A;  1GT0 C;  3CCM I;  1YW9 A;  3PO3 J;  2MLK A;  1KQ9 A;  2XGX A;  3IH4 A;  5HLI A;  4BBR J;  1I27 A;  4HG2 A;  4GYG A;  1LVA A;  5BMZ A;  1FSH A;  5HOO A;  1DP7 P;  1JKQ C;  1JT0 A;  2K7L A;  1TZL A;  2DAO A;  3V8J A;  4BJ5 C;  4QPQ A;  3J7Z I;  3GUD A;  2R7V A;  4NDL A;  2W00 A;  1O4X A;  3M1E A;  4KIF A;  2E2J J;  1XN7 A;  2QLZ A;  3R6S A;  3MKZ A;  1K78 A;  1J7K A;  3IC7 A;  5F1J A;  2X0L A;  1U3E M;  2DQL A;  2P8T A;  1IUY A;  1KGS A;  1MJB A;  2R7D A;  1XGO A;  4CCK A;  1CF7 B;  4HX7 A;  3BWG A;  1KU9 A;  2R3S A;  4NC8 A;  3ZR8 X;  5EF6 A;  2A68 F;  4KN4 X;  4XR6 A;  1TT5 B;  3BTC A;  5BOX A;  3H36 A;  4XLC A;  3L2R A;  4L9J A;  2EFN A;  2HZT A;  2O0Y A;  1PP7 U;  1JE8 A;  1FP1 D;  2STT A;  1OPC A;  3BG3 A;  1GLN A;  1UHS A;  1QRY A;  1STZ A;  4ABZ A;  1H0M A;  2FSW A;  1DGW Y;  3LMM A;  3TP0 A;  5HDG A;  5LHI A;  3HPG A;  1XGM A;  2UWM A;  4Y7N J;  1W1W E;  2VXZ A;  4EQQ A;  2L7Z A;  2JA6 J;  3K6G A;  3QOE A;  1EH7 A;  2HYG D;  1FOX A;  2M3A A;  4UUT A;  1EH8 A;  2LC2 A;  4KYW A;  2QM3 A;  3CMY A;  3BDD A;  2V79 A;  1S8N A;  2GZW A;  1UB9 A;  4AD9 A;  3BR6 A;  1U78 A;  1JXS A;  3LWF A;  4L5I A;  2ZJR F;  3H0D A;  1FC3 A;  2EZH A;  1WCM J;  1IDZ A;  1W5C C;  2IW5 A;  2EB7 A;  2VE8 A;  3K2Z A;  2DN0 A;  3ECO A;  3NAU A;  3ABT A;  2GA2 A;  2VKE A;  1YOV B;  5JLX A;  1VFC A;  1Z91 A;  1IN4 A;  1IO2 A;  3HB9 A;  3GME A;  3FXO A;  2KLO A;  2L9S A;  2E1M B;  2BVL A;  3S17 J;  3LQQ A;  3RYP A;  4WXD A;  3LSP A;  2DA3 A;  5JI6 A;  2LR8 A;  2IGO A;  3T8R A;  1FYK A;  1OLT A;  4GYI A;  4CHU A;  4BQO A;  3FHZ A;  5E79 C;  3GO5 A;  5JLW A;  1K6O A;  2KJC A;  1VQP I;  2Y9Z A;  1XSX A;  3KEQ A;  4EJW A;  2DFF A;  2VQL A;  4UV9 A;  4CIC A;  3WTT C;  3VOD A;  1WZ2 A;  3DF8 A;  4UVA A;  3ELK A;  1Z7L A;  2BOL A;  2MA3 A;  3DEU A;  3FWE A;  2XSD C;  2CV2 A;  1SC7 A;  3H1C A;  5F0H A;  3W2A A;  4OIO F;  2M9H A;  5CPR B;  1A6Q A;  1X1A A;  3FBN B;  1I1G A;  4JBA A;  5LGN A;  1QBJ A;  4RAZ A;  2P6T A;  1ZLJ A;  2OQG A;  2A6E F;  3CC7 I;  3KPH A;  5K1Y A;  4NHJ A;  2K4B A;  2YU3 A;  5GAH J;  1B6A A;  2IGN A;  2DMP A;  4KJZ A;  5F27 A;  5KK1 A;  1EA3 A;  1MMS A;  2Y48 A;  1U8B A;  2PFB A;  2RNJ A;  4A6E A;  2DT7 B;  3GZN B;  3D5L A;  2V26 A;  3AG2 H;  1MIJ A;  1ZTR A;  2GA1 A;  4XKB A;  1TC3 C;  1Z0X A;  1J2X A;  5CKT A;  2O61 A;  2KIQ A;  1RR8 C;  2PMH A;  5KAI C;  5GTH C;  4L0Y B;  1MDM B;  6PAX A;  5C4J J;  4BNC A;  4M6V A;  5H20 A;  1UHW A;  2VL8 A;  4CCO A;  1W0U A;  2CQK A;  4YFN F;  4LB5 A;  3N97 A;  5JHU A;  2XAG A;  1B8I A;  5E3M A;  1MJA A;  4JP0 A;  3DFG A;  3E5U A;  1H88 C;  3TQN A;  3V42 A;  4HNT A;  4KT5 C;  1WJB A;  4HF1 A;  2DCE A;  2NVT J;  1ZG3 A;  3CO6 C;  3DPU A;  3NWS A;  2M7A A;  1MMN A;  5H6Q A;  5LFA A;  2A5W A;  2QKL B;  2DA1 A;  4IX7 A;  3PNT A;  1VTN C;  3AFH A;  2W25 A;  2MGQ A;  1MBJ A;  4BY7 J;  2HDD A;  3K7A J;  2DU9 A;  3NRV A;  1DU6 A;  3ZQF A;  1VQL I;  4KT6 A;  3OR1 C;  1OMI A;  4RB1 A;  1BW5 A;  3I4M J;  1B9M A;  3HDD A;  2WB1 N;  1VQ7 I;  2VLA A;  1A35 A;  5KCM A;  1BR1 A;  2PMZ A;  2X1C A;  5D6E A;  1XPX A;  3HJE A;  3C18 A;  2IT0 A;  4ZH4 F;  2LYC A;  3MZY A;  1Z67 A;  4II3 A;  5KAF C;  1FZP B;  2F5E A;  1HOM A;  3LFK A;  2Z1D A;  2WC2 A;  4MNU A;  4CH7 A;  4HLX A;  4IJA A;  5DYM A;  2JZY A;  4D9J A;  4OIR F;  2PMU A;  2CQQ A;  1MBE A;  2F5V A;  2NOG A;  4PUS A;  1I1S A;  4XLE A;  3WE3 A;  2ZNY A;  5L3G A;  4A69 C;  3J80 Z;  5DTD A;  1WJ5 A;  2QZ8 A;  3O3K A;  4IRG A;  4A6D A;  3L00 A;  3HRT A;  3P9I A;  3CES A;  2DFH A;  3PFI A;  5B5E C;  1G8X A;  3M8J A;  3LA2 A;  2F6C A;  4D5F A;  1XG1 A;  2CG4 A;  3E97 A;  1TQI A;  1XGS A;  3FXJ A;  3AKZ A;  5J1R A;  1RNL A;  3L9F A;  4ZZL A;  4HDV A;  3ZN0 A;  3PM1 A;  3HRM A;  4JX4 A;  4OMZ A;  4XSZ F;  5EZH A;  4KFC A;  1SD4 A;  1LFB A;  1WJA A;  2DFE A;  4BHP A;  3MZH A;  4LK0 F;  4LOC A;  1HF0 A;  1BIB A;  5DUK A;  3ECH A;  2JJ7 A;  4M3D A;  4AUX A;  3CCL I;  3IWF A;  1JGG A;  4DZP A;  2IJL A;  4V2F A;  5IYB J;  1FJL A;  3CME I;  2UZK A;  1LEA A;  1SVO A;  2A3S A;  1JUM A;  2BXY A;  3KP3 A;  4P9F A;  1V54 H;  4XMY A;  2N8G A;  1GUU A;  3LA7 A; 
#chains in the Genus database with same CATH homology
 3LSH A;  3EUA A;  3GBG A;  3PSF A;  4BEH B;  3G2B A;  3HC7 A;  3UR3 C;  3OIQ A;  4U7B A;  3VYR B;  2CS3 A;  4PJN A;  3PFY A;  2UUZ A;  2KZV A;  2L5Q A;  2XF6 A;  4XN3 A;  3ZQQ A;  2OC6 A;  3MKW B;  4E7J A;  4N4N B;  4PSW A;  4ZDL A;  3OYN A;  3C2G A;  5CQG A;  3S3N A;  4PJJ A;  2NOJ B;  2X85 A;  1IRX A;  3W2W A;  4E7S A;  2Y0S A;  4CCL A;  4LG3 A;  4FET A;  2R7O A;  1WJF A;  3K4J A;  5HNF A;  3SZG A;  4BGD A;  2W82 A;  2X6Y A;  1YE9 A;  2KL4 A;  3D5S C;  3LSK A;  4LIT A;  4HPQ A;  3OS2 A;  3K4C A;  1LVK A;  4XN0 A;  3RCO A;  4HRI A;  1J09 A;  2BW3 A;  3IUO A;  3EPZ A;  1P9Q C;  4DJA A;  2CUJ A;  2ZSI B;  3LSM A;  4BU2 A;  5LD2 C;  4ZYA A;  2MFZ A;  1D0Z A;  2X1D A;  1W36 D;  3OR2 C;  3KEY A;  1NG6 A;  3OYK A;  4NNJ A;  4AU7 A;  4C30 A;  1MMG A;  2RNG A;  2V9K A;  3DPT A;  2VJJ A;  1X1B A;  2ELJ A;  3I3L A;  4X0G A;  3K4N A;  1WJE A;  3OYM A;  4EAT A;  2HPI A;  2M0M A;  1AA7 A;  2VQG A;  3A4C A;  4H4K C;  3PNV A;  4N4O B;  3L2U A;  2HVQ A;  4BS9 A;  2XF7 A;  2WAE A;  4ZTF A;  4P1W A;  2PJR A;  2VKD A;  3OS1 A;  2VQH A;  4IQJ A;  4CA0 A;  4F91 B;  2E5Z A;  5HLT A;  2K3P A;  4RM3 A;  4J00 A;  4DIQ A;  1X19 A;  2X6X A;  3OOU A;  3DLA A;  2KMU A;  4LIU A;  3H9Q A;  2ZXI A;  3DPL C;  4JQF A;  1JI8 A;  4JOM A;  4R79 A;  4XQF A;  2OV7 A;  2DOA A;  1N77 A;  2LBF A;  3K70 C;  2HVS A;  4LIV A;  2LBF B;  4NUB A;  3A2K A;  3FDY A;  2WBM A;  4XLH A;  3CZ6 A;  3DEE A;  1DQU A;  4OAY A;  3DTE A;  3OMY A;  3CMM A;  3VSK A;  4XKC A;  4IZZ A;  3BCA A;  3IP4 B;  3HOT A;  2MC4 A;  3S8P A;  3VYT B;  2VJ5 A;  4GRI A;  2LY2 A;  1X1C A;  2JVG A;  2XAU A;  3H5N A;  3PNY A;  3HKZ A;  4F3Q A;  5HNH A;  3H5A A;  2VB6 A;  1QHH D;  1D0Y A;  4F93 B;  3OS0 A;  2DJI A;  2R7W A;  1BR2 A;  2HDW A;  3OYD A;  2JVH A;  4CSW A;  1D1B A;  2V6E A;  4HST A;  4PJL A;  3ONQ A;  1PJR A;  2K5C A;  2X1E A;  2X51 A;  1ZEL A;  2VXD A;  4PK4 A;  4XOT A;  5KHD A;  3S93 A;  1S9H A;  2R7T A;  4OWR B;  3VDX A;  3HOS A;  2WAD A;  2CW8 A;  2LOO A;  2R4G A;  2M7B A;  3HG9 A;  1X4P A;  4QPO A;  2HVR A;  3MD2 A;  3K10 A;  1TT0 A;  4BE0 A;  3K4M A;  2ZSH B;  1MMD A;  2E5N A;  2IS6 A;  4F92 B;  4B48 A;  5JHF A;  4Y33 A;  2UV1 A;  2XF5 A;  1YX5 A;  1ERD A;  2E60 A;  4PFO A;  4XOR A;  4DOZ A;  1WJC A;  4G6T B;  4E7I A;  1MNE A;  3LL7 A;  5HVQ C;  2A6T A;  3OL3 A;  4YEL A;  4PFP A;  2CUZ A;  3F9K A;  3HL2 A;  3H9J A;  2CH0 A;  4BJT A;  2KQR A;  1D1A A;  2W7N A;  2WY7 Q;  2O5R A;  3MMY B;  3OWT A;  4DBQ A;  1X4O A;  4ZTJ A;  4YRV A;  2IS1 A;  3OYH A;  2R7X A;  3HXL A;  4F55 A;  1QU3 A;  3OYI A;  4ZJZ A;  3K4L A;  4OAZ A;  2IXS A;  2DT6 A;  1V5G A;  2WA0 A;  3CF2 A;  2KP6 A;  1K6Y A;  3N05 A;  3L2V A;  2MYS A;  3IAM 2;  3M1C A;  3U21 A;  3OY9 A;  2HQA A;  3VWB A;  4II2 A;  1MMA A;  1R6R A;  3C2H A;  3CJR B;  4BUP A;  2L9N A;  4BDY A;  3S3O A;  4RMN A;  3DU6 A;  2FUG 2;  3NWT A;  3OYB A;  4E4H A;  4B3X A;  2XDV A;  1DP3 A;  3PJR A;  2XC7 A;  4P5O A;  3UNG C;  2IGM A;  4BL0 B;  1VZ0 A;  2M4K A;  4ZDO A;  4XOP A;  2CFO A;  3OYC A;  4BE2 A;  3TL4 X;  2HNH A;  3SEQ A;  2BVM A;  4D1Q A;  3VSL A;  1FMW A;  3RPU D;  3OYG A;  4AYB A;  3LSI A;  4CCJ A;  2CV0 A;  3SDB A;  1V5F A;  1WFX A;  2IS2 A;  4HG2 A;  3OYF A;  4CZC A;  5HOO A;  2KRC A;  2K9M A;  3AL0 B;  1T0F C;  4Y4R A;  3RSN A;  1TZL A;  4PJM A;  4BJ5 C;  4QPQ A;  2R7V A;  2W00 A;  4YEJ A;  5KNL A;  2AQF A;  4RM2 A;  1SAU A;  3MKZ A;  1BOB A;  2KHM A;  3DKX A;  3K4K A;  3E0J B;  5FRO A;  4BQQ A;  2VAS A;  3OYE A;  2RQQ A;  3D5R C;  4CCK A;  1BR4 A;  4NC8 A;  4ZC3 A;  3ZR8 X;  2VJ4 A;  2WAF A;  3CP8 A;  4XR6 A;  4CUG A;  5CQE A;  3H35 A;  3RTR A;  3K70 D;  3L2R A;  4XLC A;  3S32 A;  2OUM A;  1Y6I A;  2GOX B;  4BDZ A;  2CW7 A;  3QOD A;  3RQ4 A;  3VYS B;  3TBI A;  1GLN A;  2I8D A;  3SEZ A;  4HNU A;  4IKF A;  1E0E A;  1DGW Y;  3LMM A;  2Q2E B;  3HPG A;  2UWM A;  3J7A Y;  2CV1 A;  2JA2 A;  2VXZ A;  3K6G A;  3QOE A;  3CJQ B;  4BJ6 C;  3DU5 A;  3KYL A;  2M3A A;  2WY8 Q;  3DWL E;  2LC2 A;  3DTK A;  3SYT A;  1DGR M;  3BC8 A;  4BE1 A;  4Y3O A;  2QKM B;  3H0D A;  1N78 A;  4E7K A;  3ZRG A;  1YX3 A;  4XNF A;  1Y56 A;  3K4B A;  2RRE A;  1UEL B;  2V1N A;  4XON A;  2Z16 A;  2KLO A;  2L9S A;  3EUH C;  4XKV A;  2E1M B;  4B44 A;  2BVL A;  1MW7 A;  1N75 A;  4C9Y A;  4BQN A;  2MD0 A;  3DQV C;  3TMO A;  1LKX A;  2IGO A;  1OLT A;  4U87 A;  4MLO A;  4BQO A;  2JUG A;  2LY1 A;  2VQC A;  4ANJ A;  2LH9 A;  4J01 A;  3AL0 C;  3W2V A;  3QYF A;  2VQL A;  1Z3Y A;  1W36 C;  1NG7 A;  1QHG A;  1Z7L A;  2BOL A;  4AVZ A;  4BXF A;  2CV2 A;  1KON A;  3EUK L;  5FRN A;  2F4I A;  3FBI B;  1FMV A;  3A1Y A;  3W2A A;  3FKJ A;  1D0X A;  2W4S A;  3VYU B;  2P0W A;  5CPR B;  3L2Q A;  1X1D A;  4E7L A;  2XSJ C;  1X1A A;  3FBN B;  1MND A;  3BG7 A;  2VPL A;  4HEA 2;  3IAS 2;  2K9L A;  4CCN A;  2HPM A;  1D1C A;  3H9G A;  4FAS D;  4XM3 A;  4E7Z A;  1LFP A;  2IGN A;  4KJZ A;  2PJR B;  3LFU A;  1EA3 A;  2V7F A;  4E7H A;  2R7U A;  2DT7 B;  2Z2S B;  3D5L A;  2BW3 B;  2V26 A;  2KRH A;  4XKB A;  1UG0 A;  4NQW B;  3H5R A;  4E6K G;  2Q1Z B;  2E1M C;  2M4G A;  5CKT A;  2AQE A;  3QYB A;  3MKY B;  2LRE A;  3I9V 2;  1LDK B;  2WB1 A;  4RLQ A;  2L7K A;  2V4J C;  3BG6 A;  3E1S A;  2VL8 A;  3DTI A;  4CCO A;  3L2W A;  3HPH A;  2R7R A;  3HUG B;  3V42 A;  4HNT A;  1WJB A;  2DCE A;  1Z3X A;  4CCM A;  3DPU A;  3NWS A;  2M7A A;  1MMN A;  4C2T A;  5LFA A;  4ITV A;  2A5W A;  2QKL B;  1SFK A;  4B43 A;  4IX7 A;  3PNT A;  4XLF A;  3AFH A;  3PSI A;  3FHN A;  2MAB A;  3OIP A;  1V5E A;  4KT6 A;  4DGW B;  4F52 A;  3DKY A;  4XL9 A;  3OR1 C;  2KPM A;  3S3M A;  2ZXH A;  4PSX A;  2DXI A;  4ZDP A;  4IQ4 A;  2VLA A;  2VIX A;  5KCM A;  1BR1 A;  5TGT A;  2PMZ A;  2X6W A;  2VJI A;  2X1C A;  2LG4 A;  2ZFU A;  3OYA A;  1UAA A;  3PL8 A;  1T95 A;  4HSR A;  3ZXS A;  2LYC A;  2W1O A;  3KX2 A;  4II3 A;  3PUB A;  2HU9 A;  4KIT B;  2CMP A;  3ZCO A;  2Z1D A;  2JSP A;  1HA8 A;  4CH7 A;  4D9J A;  3BCB A;  4KIS A;  2F5V A;  2GOM A;  4PUS A;  2VKH A;  3OYL A;  2IGK A;  3OYJ A;  2L2O A;  3OL4 A;  4XLE A;  4NC7 A;  2IS4 A;  1WJ5 A;  4C2U A;  3CP2 A;  3CES A;  4XLA A;  4BAC A;  1G8X A;  1OR7 C;  4DBR A;  3M8J A;  2F6C A;  4RLF A;  3AKZ A;  2HZD A;  3LSG A;  2R7Q A;  3BLY A;  5FRM A;  1U0J A;  2R7S A;  1WJA A;  1Z21 A;  4XKW A;  4B47 A;  3QYE A;  3ZGK A;  2LRD A;  1G59 A;  2KDO A;  1WJD A;  2WAQ A;  3W3C A;  4XMY A;  4BEH A;  1PYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...