1R6RA

Solution structure of dengue virus capsid protein reveals a new fold
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
NRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of dengue virus capsid protein reveals another fold
pubmed doi rcsb
source organism Dengue virus 2 puerto rico/pr159-s1/1969
molecule tags Viral protein
molecule keywords Genome polyprotein
total genus 20
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1r6rA00
1SFKA 1R6RA
chains in the Genus database with same CATH superfamily
2JSCA 2RN7A 4XMYA 3RTRA 3W2AA 3GTLJ 4V19K 3J80Z 4ON0A 3BR5A 1FPQA 1Y1VJ 1R1TA 3DEUA 2HXOA 2K40A 1WWXA 3CMMA 2A5WA 2MG4A 4ZC3A 2BVLA 1I3QJ 4UVBA 1Z6RA 3F23A 3DBRB 3K4NA 3M1CA 3ABTA 3H3UA 1B72A 4Z2YA 1BC8C 3KFWX 2X1EA 3JRIA 2XRLA 3WTZA 1HW1A 1QHHD 2XSJC 4Q48A 1RR8C 4BBSJ 1QZZA 4LLLA 2M3AA 5J1RA 1LFBA 3K2ZA 3I56I 4MIMA 2JRMA 2CW8A 4UNOA 1W7PD 4PJLA 2VQGA 2QENA 4P9FA 1F43A 2LK2A 2NNYA 3FDYA 3SFIA 1JHHA 1R5HA 5B1BH 5E79C 4XBFA 2W24A 3NWTA 3DTIA 4OMYA 2MA3A 2YSRA 3I4PA 1OFCX 3I9V2 2HTJA 4I0AA 5D8LB 3OYGA 1WJCA 3A2KA 1Y0UA 3HRUA 4XRSG 1VI0A 2DK5A 2ZNZA 1Z6TA 1KU7A 2VKHA 2R7ZJ 3DWLE 2FBIA 3RI4A 5LD2C 2VONA 2DTZA 1MBFA 3GZ6A 4X1EA 3BP8A 3NWSA 2NRAC 1MJAA 4G6TB 1OKRA 1FTTA 2HOEA 2XC7A 2X6WA 4A3FJ 3JRHA 2IS4A 2JWTA 2HPIA 4CCJA 5ICCA 2HOSA 2XGXA 4IHVA 1HKTA 3R60A 2E1OA 2KPMA 1D8JA 2VJJA 1ERDA 1I1SA 2FOWA 3F21A 2X6OA 3BR2A 1S7AA 4IQ4A 2PI0A 3QYBA 1VQPI 1J59A 2L2OA 1Z3XA 1TWCJ 3ZQGA 4DZPA 5JHFA 5BPDA 3Q0WA 3IKVA 3K4LA 1OQYA 1H0MA 2G7UA 1F36A 2M8GX 5J8FA 2RC4A 4F91B 4NB5A 2WV1A 1BW5A 2V1UA 2F4IA 1A36A 1ULYA 3C7JA 4KN7X 4N4NB 3WE2A 2Q0OA 4NDLA 1ZGJA 3LSKA 3BR3A 2GOXB 5L3DA 2XVCA 3BDDA 2ZMEA 1BI1A 3H1CA 4XRMA 1LKXA 2DFFA 2IVMA 2OCCH 3EUAA 4S04A 2JT1A 3KETA 2OTLI 2FD5A 3KZIC 2JRTA 3RPUA 1HSTA 2DCEA 3K7AJ 4KIFA 4BS9A 3PSFA 5E1ZB 4UVAA 3CUOA 3OYJA 3H0DA 1R4NB 5KAFC 2R5ZA 3CCSI 4Y33A 2GLOA 3P9IA 1K7AA 4CGZA 5E17F 3JCUC 1NTCA 1E2XA 4TV7A 2F48A 3R0JA 4K2EA 1IN5A 1LDJA 1MBGA 2HYGD 3D0SA 1X1CA 5D6EA 1VQ4I 1UZCA 4R1HA 3QQAA 2L5QA 3GXOA 2XB0X 2NYXA 4XLFA 4KICA 4EGZA 3WTXC 4I99C 5H2FC 3PNVA 3FMRA 1BOAA 2BHZA 4G94A 5F04A 3AL0B 2RNJA 4U0VA 4A6DA 3HXLA 1RRJA 4DYQA 4ENKA 4KT5C 2VE8A 1LE8B 1LFPA 3MKLA 1TWFJ 2FJ1A 5BQTA 1W0TA 5FJ8J 5C44J 1NG6A 2QSHX 1FP2A 4XK4A 5E1XA 2EFQA 1DPRA 4A3JJ 3PM1A 2FBHA 1MIJA 1D0ZA 1B6AA 1AKHA 4ZZDA 4DIQA 2EV6A 3LNQA 2X6YA 2Z16A 2YX7A 2XF7A 5CPRB 4C30A 1VQMI 4E6KG 2P5LC 3MCZA 2CMPA 1SD5A 2CUZA 3I55I 5LRRA 4YEJA 4HG2A 1TQMA 3J80K 2DBBA 4P96A 2CQKA 2L9SA 2R7WA 3ZPLA 4JYKA 3LMMA 2WWYA 2GAUA 2DU9A 2F2EA 1IAWA 2DPUA 1XCVA 1YITI 4Y4RA 4OWRB 5J4VA 4BDZA 4BJTA 1SFOJ 2L4MA 1SFXA 2K86A 3SDBA 4NC7A 3S8PA 2NVYJ 4C3HJ 1UAAA 1YG2A 2D1VA 2AHQA 3GTMJ 2VQCA 2QUFA 2WC2A 4HX4A 5CJ9A 3C1DA 3ECHA 1FP1D 4MHGA 5ICFA 3BQYA 2IP2A 4PSXA 3DBHB 4NUBA 2V7FA 4UUTA 1SVMA 5GP9A 3T0YA 5GPCA 3LSPA 5M3FJ 4B48A 4MEXF 1U3EM 3IAM2 3LOCA 3W3CA 2GM4A 1AHDP 3DQVC 1E0EA 2A69F 4FX0A 3NRVA 4E7ZA 4BE2A 1BIAA 2E7XA 2PFBA 2Y9YA 4GXOA 1QO0D 1FLIA 2NOGA 1U5TB 1Q1HA 4HZFA 2XV4S 2K85A 5CVRA 1GVDA 2XPVA 3A4CA 3RZOJ 1JI8A 1MBKA 2CJJA 3ELKA 2H8WA 2DMUA 1K6YA 2A6EF 4ZH4F 2W82A 5EEAA 3MVPA 1IDYA 3OS0A 4XR6A 2QKLB 4AUXA 4FE7A 1V55H 1B8IB 1UG2A 3WHCA 5E8IA 2E2IJ 1XPXA 3ML6A 2EFNA 1P92A 3BG5A 4PJJA 5KHDA 1B4AA 4G7ZF 3W2VA 5JLXA 3KLOA 4UXNA 2OUMA 5FLXZ 2CS3A 1OR7A 4E7IA 1PP7U 2PJPA 4WF2A 1IRZA 3RJPA 1F4KA 3SZPA 2Z3YA 2R7DA 5EF6A 2Y0SA 2R3SA 5EGOA 2JA5J 1ZKGA 3JAMK 3K70D 2EPFA 3RYPA 5IP7J 5DV5A 5F08A 2ACJA 3OYLA 4A0ZA 1YIJI 3ZQIA 3ZMSA 1RIOH 3HOVJ 2IRFG 1A04A 3JW4A 1ETKA 3HOSA 3FM3A 2V1XA 4RGSA 1F5TA 4KUMA 5J1YA 4I7HA 2HU9A 3K70C 4OIPF 4UUSA 2DW4A 2NS7A 5FKLA 2HZDA 3TEDA 1IRXA 1BA5A 3F8FA 2D2WA 3ERMA 3L2RA 1IW7F 2B0LA 3CP2A 4QWQA 2IS6A 4H0EA 4KMFA 3KX2A 1XDSA 5GADJ 1W5CC 2MBFA 3IWZA 3LSIA 3Q0VA 2HDDA 2GXBA 3F3XA 4ZYAA 3ECOA 4CO8A 1RESA 2OF7A 2ZMEC 4FHTA 3JRBA 2BOLA 4UVCA 2ELHA 2KRCA 2QVOA 3G1MA 1T2KA 2V9VA 3R0AA 2FNPA 4I02A 3KIOA 4O6JA 5F0HA 3BTJA 5AIPA 4C2UA 2DOEA 4J01A 3S3MA 3CLOA 5ERIA 2W57A 1POGA 4W1UA 5C4JJ 3BCBA 1HLVA 3G1LA 1B72B 2WBMA 4XLEA 2W4SA 4RM3A 2H1KA 5DS9A 3DXJF 1HW2A 5HNFA 3S2DJ 2Y69H 2A61A 3CDIA 2JJ7A 1TZLA 5LBQA 3KYLA 3PQJA 3IRQA 2XAQA 2ZFUA 2ESHA 4Y15A 2ISYA 3K4BA 1YYVA 3QRFF 1IXCA 1EF4A 1HKQA 3CCVI 2E2HJ 1GLNA 1SVOA 2Z5UA 4HSTA 3V7CA 2STTA 3BG9A 3H3VK 2W25A 1USSA 3ROUA 4EM0B 3MFKA 3G1OA 3GLXA 3F8NA 2LG4A 4M3DA 4EQQA 1TWAJ 4BHBA 2N8GA 3S1RJ 2O3FA 4ZYGA 2HTSA 3WG9A 2Y0SN 4XKWA 3QOEA 4CCOA 1MNMC 1EH8A 5CKTA 2EIJH 3ZN1A 4E7SA 1JTXA 3BR1A 1I50J 1U8BA 4UHTA 1JE8A 4XLPF 3BWGA 3JRGA 3ZMZA 3FXMA 2JPCA 1O57A 1XDUA 1E17A 1TTYA 2HGCA 2CW0F 1USTA 5HNHA 3GFIA 4HQEA 1R36A 3IUOA 2BW3A 3WTVC 4J19A 3VSLA 3J7AO 4U88A 4XOTA 1W7PA 3ZQQA 4HLXA 3LA7A 2YU3A 1FYMA 2IA2A 1X19A 1B8IA 2IT0A 5ICEA 2PQ8A 4MFEA 1ETWA 4ETSA 3DBLB 1I3AA 1W36C 1BR4A 2IEKA 3GEZA 1UHMA 1IN4A 3TMOA 2BY1A 3DLLF 1SAXA 2ZJ2A 5DTDA 3OR2C 4EM2A 1Q1VA 2BV6A 1X3ZB 3LSHA 1XMXA 2E36A 1KZHA 1OJLA 4RDUA 1S8NA 3DKYA 2LY1A 5CYVA 3BG7A 4AC0A 2RV8A 4S05A 1A6QA 3CZ6A 1TNTA 3OYFA 2IGNA 2V1NA 2DI3A 3E97A 1G59A 3OSFA 3K4CA 2W7NA 1TT0A 3WTSC 2PMUA 3HOWJ 1XSXA 1BJZA 4C2MJ 5GTIC 2V6EA 2L7FP 3WGGA 4Q4ZF 1X1AA 4B44A 4KITB 5B5EC 3V42A 3BZKA 3W2WA 1LVAA 1WJFA 2KL4A 1TBXA 2RQPA 2GIVA 3BR0A 1H9GA 5D8KB 2IA1A 1ETYA 1VQNI 3I4MJ 2IXSA 1HDPA 3HBLA 2E5ZA 3HOUJ 4RLQA 2XASA 2M8EA 4KIBA 4IX7A 1ZREA 1W4MA 1IRFA 1TT5B 2KIMA 3RKYA 2QQAA 3LSGA 4LJZF 3ZQFA 2R7OA 4BJ5C 5KVRA 2HNHA 3H5NA 4MNUA 3HZJA 5M5WJ 3A01B 3E1SA 1WJEA 1QVTA 1E3HA 1X2MA 1A6IA 2KISA 4B1RA 3WTWC 3C2BA 1X1DA 2QYOA 2ME0A 3H5RA 1P6RA 3ESWB 2CV2A 1XMKA 4L9VA 5A2QK 1NH3A 1EJ9A 2JVHA 4M71A 1UCRA 4A93J 2BZTA 4PJ0C 5FD6A 2MH2A 3HKZA 3HUGB 1Z67A 4HW0A 3OYCA 2DA2A 2FQ4A 3I64A 2DODA 2GBYA 2LBFA 2LFBA 2EK5A 1PUFA 4GGGA 1Z7LA 1B9NA 3O6BB 1OISA 3WU1B 5D4RA 2PX9A 3FXKA 2LKPA 4PSWA 1RPWA 2IW5A 1FOWA 4JBAA 5CVUA 3RYRA 2HFHA 2ADUA 4GCVA 2XGDA 4RLFA 1K78A 5CLSA 2QBYB 2IJLA 3VOEA 3HIFA 1IN6A 2M0MA 1M1EB 4L0ZB 4G7OF 3TO6A 3GO5A 3VYSB 4BQOA 3PQKA 5E3NA 2M7BA 4ANJA 5EJCA 1K83J 1ZRFA 2KJBA 2ZXIA 5M5XJ 3ZN0A 2R4GA 1VNDA 4DJAA 2IGKA 1N77A 3S3NA 1R71A 4MO7A 1WJAA 3H36A 2EIKH 4FT8A 2VPLA 4JX4A 3RKXA 4AVZA 2E60A 2L01A 3CUQC 1KYWA 4C9YA 4FTHA 2RNGA 1MKMA 2L7ZA 1RI7A 1I5ZA 1QQIA 2Q2EB 2HPMA 2H6BA 5LEKA 4EGYA 5DCMB 2KIFA 4HEA2 2R7FA 3NQOA 1MD0A 1T6SA 3HDDA 3PUFA 3CCMI 2M1BA 2JUGA 3D5LA 1XTAA 3P9CA 2EB7A 1MW7A 4RB2C 4A3IJ 2LD5A 3HPGA 3ASNH 3I4NJ 1DUXC 1F9NA 1JKPC 2X6XA 1H89C 2BXZA 1B59A 3A0HC 1B9MA 1YW9A 3KEYA 2W00A 2K9MA 1FBUA 1ON2A 3E5QA 1U8RA 1LFUP 3WHBA 2XB5A 3O8GA 3JRCA 5E3MA 1BIBA 5IP9J 4YFKF 1JJ6C 4EM1A 2EZKA 2CGPA 4PK4A 1LPQA 2NS0A 5KK1A 4B8XA 2FBKA 2HR3A 1ZGAA 2L7MP 2MC4A 4BGDA 1N78A 1MDMA 1IUFA 1EKEA 4ENMA 3ZR8X 3E5XA 4XKBA 1SFUA 4DOZA 1G8XA 4CHUA 4DQ2A 5CVIA 4IHWA 3BTCA 2EFPA 3LSMA 1PP8F 1JUPA 2DLLA 5J8CA 3BJAA 2EQRA 2M9HA 5F6FA 4A69C 4MLOA 2EJRA 3P7NA 1YHQI 3W6VA 3S14J 2L9RA 4M3GA 3SYTA 1HW5A 3A0BC 3O8HA 2NOJB 4N9HA 1HKSA 3SXYA 4EVIA 1T8IA 1QBJA 3QYEA 3F22A 1U2WA 3TO7A 3N97A 1K79A 1X3WB 2XPUA 2QQBA 1LJ9A 4MGRA 4X6AJ 1EV7A 1I1GA 2KDZA 1WKMA 3BY6A 3CUQA 2FEZA 3VEPA 2OBPA 3HUGA 1SMTA 1YLFA 2O8KA 3EPZA 4X0GA 3FXQA 2HQ5A 2NNNA 5IT9Z 1IO2A 1G3TA 2LLKA 4QPQA 3ZMTA 2KJCA 2E19A 2AXTC 1AOYA 3JAMZ 2NVXJ 3Q0UA 4OAZA 3EUKL 1MH3A 2BY3A 3VYUB 2AQEA 1MMSA 2RQQA 1D0YA 3E6DA 4YFNF 4CICA 4A3CJ 2BBYA 2HQNA 2GQQA 2BE5F 5F27A 4XSZF 2Z1DA 4A12A 1UELB 2DFEA 2HDCA 5C4XJ 4OMZA 2CWEA 2BYVE 4JK1X 1ZLJA 1P9QC 1HC8A 2ICWG 3RKQA 2JQ7A 4RGUA 1LE8A 3K1MA 3QPSA 2PN6A 2MFZA 3K1NA 5L3BA 4HBLA 3CO6C 1T39A 3P5JA 3WTYC 4RMNA 2QBYA 1QZEA 2B63J 2PG4A 2FNAA 3PFIA 3OS2A 1QVUA 3ABKH 2VOPA 2FA5A 2ZNYA 1UJ8A 2JPBA 2OCEA 5IOZA 2V26A 3LAPA 1WJBA 4QLCU 2O6GE 1JUMA 3E0JB 3FHNA 1X1PA 2MC3A 2R7QA 2VASA 2M87A 2XGCA 5ILSA 2LBFB 2CYYA 4A2UA 3UKGA 3DTKA 1RUOA 5F1JA 3ONQA 3U2RA 1KU3A 3F9KA 2ZMEB 3KYDB 4BACA 2DMQA 1BM9A 3QOPA 4XIDA 1NK3P 4IXAA 3CDHA 4N9IA 2XF6A 2M4KA 4P9UA 1IG7A 3CC4I 2DOAA 1W5SA 3KCCA 4WXHA 4EJTA 3HOYJ 3B6AA 3TW7A 4AWXB 3MD2A 1BI2A 1VFCA 4M73A 1YS6A 4LB5A 3GTGJ 1I27A 2F6CA 1XCBA 3EYYA 3L9FA 4BXXJ 2A6TA 1RUNA 3V8JA 1R58A 1I6XA 2KQRA 2M2EA 5K7ZA 3S2WA 4P55A 4U0WA 5HOOA 4LG0A 1LVKA 4HV6A 3AFHA 2DMTA 2KDOA 2XAJA 3IL2A 2AO9A 1X2NA 4IJAA 2KT0A 2FF4A 2KHMA 2KLOA 2HDWA 4HNVA 4AIJA 2ID6A 3G3ZA 2COBA 4XQFA 1FTZA 1V4RA 5HS9A 3CJRB 3GFMA 2E1NA 1PDNC 3K4MA 4M74A 2JK3A 3MN2A 4MEYF 1ZLKA 1R6RA 3E6MA 2CSOA 2JN6A 3BLYA 1BR2A 2EFWA 2CH0A 3DLAA 4BQAA 2E1MC 2PEXA 3COAC 2QQ8A 2JSPA 4RAYA 3PO2J 2CQ7A 1GXPA 4HF0A 3LFKA 3G6EI 2LKSA 2LDUA 4IRIA 4XM3A 4M6YA 3R6SA 4I2OA 2LP0A 3KP2A 3FM5A 1SMYF 2M4GA 2VBXA 1O4XA 4RM2A 5HLHA 2RREA 2F5CA 2DAOA 5BNGA 4G12A 3U21A 1FBQA 4E4HA 2HYJA 2IS2A 4Y3OA 2DQRA 2KZGA 4ZZLA 3CO7C 2FMYA 2DFHA 3CF2A 2BXYA 3Q3SA 1KU2A 2VQHA 3UNGC 1NG7A 4JP0A 5LHHA 3GTKJ 3OMYA 4UUSB 4CCKA 1YRNA 1ETOA 2MGQA 4M6XA 2VBYA 3F6VA 5E20A 1JT6A 2HVQA 5IYCJ 4GDFA 1V5EA 1Z3YA 4ZDPA 4D5FA 1FOYA 1ZN2A 2ETHA 1ODDA 3VDXA 2KFDA 3EQLF 1MBJA 4MQ9F 4BBRJ 3JRDA 1X4PA 4XSXF 1REPC 2XKPA 4XORA 2NVQJ 2DOFA 2LVSA 1UMQA 2VT3A 2H27A 2CUEA 3AL0C 1L0OC 3LQQA 1ZELA 4YFXF 3CJQB 1XG1A 2Z2SB 3ZQ7A 4HYEA 3HYIA 4M6VA 2XKOA 5K5QA 3OWTA 1MMGA 4A3EJ 1R1VA 1ONVA 2M0CA 3E3VA 1MBEA 2XAFA 3ZXSA 5ILVA 1YO5C 3HC7A 2H8RA 5KNLA 2TCTA 2LMDA 4DYCA 3CUQB 1YJWI 1BJAA 1P4AA 3QAHA 1XD7A 5FLVA 4OAYA 3BPXA 5HS7A 3C3WA 4XICA 3WGIA 4PDKA 2YUSA 1CF7A 2XROA 1WVRA 4FETA 4CCLA 4CCMA 5HVQC 3WE3A 3H92A 4XL9A 2KRHA 1XN7A 1Y8RB 3E6CC 1MMAA 1UHSA 3IH3A 4LIUA 2ISZA 2OU2A 3C2HA 1NHAA 5DEQA 2E34A 1YRNB 2VT2A 3GWZA 2L4AA 3AG3H 1IJWC 2D5VA 4CZZA 3AG4H 4BQQA 5CQGA 1MBHA 4D0PA 2P81A 4Y7NJ 3RSNA 4DZJA 3JSPA 3J81K 4M3EA 1X58A 4F52A 1ZARA 4L5JA 3R4KA 5IYDJ 2A05A 2ZO4A 3V7SA 4ZTJA 4PZJA 3CMEI 1P4XA 5ICGA 1A35A 4XLAA 4GO1A 1XGMA 4BHCA 3TDZC 1D1CA 3G4SI 5J1UA 2VI6A 1VQ9I 1LDDA 1GDTA 3S93A 2V1DA 3G2BA 5E1WA 3MEXA 3B02A 2HWVA 2K02A 5LEJA 1SD6A 3IP4B 3S1QJ 2WV0A 3MWMA 1Y8QB 3JRAA 3MZHA 3KP5A 5JLWA 2X1CA 3OYNA 1TQPA 1T56A 3LQRA 4IEJA 2F5DA 3DP7A 2ECBA 3E5UA 2B9SA 3CCQI 2EZLA 3ERED 2OC6A 1K78B 3GF2A 1QZYA 2DQLA 2M7AA 3FXJA 1DP3A 5M5YJ 2DDBA 3DKWA 3EETA 2RVCA 3W6JB 1L3LA 4EATA 3BR6A 2ZB9A 4LFUA 2R5YB 4LG0B 4CCNA 3W6KB 4C2TA 3L1PA 3GX4X 2EA2A 2XRNA 2KRFA 1GXQA 1H9TA 5HDGA 3KYCB 1QRYA 5FKKA 4OINF 1WQ2A 2WY8Q 3ZQCA 1W0UA 3N05A 1JXSA 1HXDA 3CC7I 3CD6I 3V7RA 1JHFA 2YR2A 1FMVA 5FKOA 4HNUA 2LC2A 1T0FC 1YJNI 1A31A 3FZVA 5IT3A 1K4TA 3ZGKA 2OV7A 1IRGA 5CVJA 1OCOH 1JKQC 4UUVA 3KP4A 2LY2A 3GTJJ 1I39A 5L3CA 3FBIB 4XNFA 4BJ6C 2E1CA 1DU6A 1QA6A 2ZSIB 5EDNA 4W97A 3IKTA 2DK8A 4U87A 4ASNA 2LYCA 1TL8A 1YX3A 3OIOA 5HDKA 5DDGA 1OPCA 5IPAA 2TRTA 1Z1DA 2A5YB 1RNLA 1APLC 4CH7A 4YRVA 2LF8A 2KMUA 1QPIA 1ZGWA 1BW6A 4HV5A 2FU4A 2JA8J 3A01A 3MZ8A 2GOMA 1S6LA 2EH3A 2XIGA 4I6ZA 3M8JA 2K5CA 1UHWA 2QEXI 3BG6A 3VPRA 3H3ZA 2B7EA 3IWFA 1IDZA 5LHGA 5K5RA 1X4OA 3HTSB 4E7LA 3FWEA 2P6TA 4MTDA 4PJMA 1UG0A 5HLGA 3OYAA 4AM3A 3SHFA 3TDUC 5TRDA 2WTEA 1QGPA 4B3XA 1OR7C 3ZQHA 2KIUA 3CCEI 1TW2A 2HKOA 3EUHA 1TLHB 2QSGX 3RDIA 1Z0XA 1ZHFA 1Z7UA 2MD0A 1E3PA 2EILH 3M1EA 2Q8KA 4CDGA 1YJ9I 3HRSA 1HBXG 3BG3A 2E35A 3GLLA 3IH4A 3OY9A 2HKXA 4HPQA 1QPMA 3K2AA 2RGVA 4AIHA 3ZMDA 4HF2A 2CUJA 3PL8A 1FEXA 2COMA 1U0JA 4LIVA 3CMAI 2W48A 4CZCA 1D0XA 4DGWB 3ABUA 1XGOA 3K6GA 4PGGA 2E7WA 1T08B 2K4BA 1ZH5A 1ETVA 1GV5A 4ZYEA 3V8LA 1FIAA 5JVTA 2Z9OA 1FIPA 4B43A 3VYTB 2JA2A 3OOUA 2W85A 4IOCF 3CCYA 4Y13A 4L5IA 2VPRA 3CF5F 4G7HF 1WSUA 2K9SA 3KEOA 1S7OA 1V5GA 3D5SC 2QF7A 3OR1C 5LGNA 2OQRA 4PCQA 2LNBA 5D5XB 5LLQA 2XGEA 1YOVB 1JUSA 3QPLA 3RQIA 1H88C 1LB2A 2PBIA 5CQEA 4LMYA 4PUSA 1HSJA 4II3A 1KYZA 4IHSA 4A3KJ 4KDPA 2L3DA 4O3MA 2F5VA 3ISPA 3RQ4A 2CG4A 3L2QA 5H6RA 4RGRA 3VODA 4ZTFA 3MMYB 2ESNA 3PNYA 3PFYA 2CQQA 1F1ZA 1FSHA 2DYSH 1KU9A 3S2HJ 2CO5A 5C3EJ 4QTRA 3WU2C 4RB1A 2J5PA 1G3SA 2QSFX 2LY9A 2VODA 4QPOA 1Z91A 2FE3A 4CYDA 2M34A 3I59A 2OQGA 2F4MB 3DTEA 3HM5A 2MLKA 2PMHA 3PUBA 3TP3A 2ZJQF 1MGTA 3RKWA 1V5FA 2DMNA 2L02A 2X48A 1U78A 3PSIA 2I8DA 3F0CA 4RAFA 2WB1N 4XN3A 1D1AA 1FX7A 2UWMA 2P6SA 4LLNA 1BOBA 2MLGA 2P7VB 3BZ6A 1ZG5A 1R5GA 6PAXA 4BUPA 5IOYA 4D1QA 2XUBA 2O61A 1WI9A 1OYIA 3RPQA 2ZC2A 2GWRA 2DJIA 1IZ1A 2EFOA 3MZYA 2K27A 2LR8A 3HKZN 4GFBA 4OOIA 2VIXA 3SJMA 2TDXA 1TWGJ 2CQXA 3KLNA 1OCCH 2M30A 2I5UA 4A5MA 4E7HA 3KE2A 1YI2I 1T95A 1T38A 3H35A 4HDUA 3RCOA 1EH6A 3BT9A 3HHGA 3CLQA 3K69A 5HLTA 2OTJI 2ZXJA 4HA8A 1SAUA 3ASOH 3B73A 4II2A 2MD5A 4LK0F 5FRNA 1O7FA 1J09A 3UR3C 1ZTRA 5F0CA 2HVSA 5FLXK 2WY7Q 3AG2H 2QLZA 4MQVA 3HPHA 3F8BA 3V4GA 1U6GA 3DFGA 3TL4X 1MSEC 3BZCA 3KP3A 4B3AA 3KP6A 2O8XA 2P8TA 2G0EA 3V8KA 3WTTC 3LSTA 1RZ4A 2EZHA 3WG7H 2Z33A 3FXLA 3K4JA 5FFXA 2CFXA 1R7JA 1IXSB 2K3FA 3B6CA 4I76A 1Z05A 1OCPA 1FOXA 2Q2EA 3QPTA 5EEHA 2DO7A 1OMIA 2E71A 3NEUA 3RZDJ 2RAEA 1WPKA 1AKHB 2VBZA 4NC8A 2QKMB 3FISA 3HRMA 2ZKZA 3JSOA 1R00A 1IN8A 1MSFC 5IYBJ 2ELKA 4FX4A 5GAHJ 3M3YJ 1V3FA 5J6XA 3LWFA 4GYIA 4A3BJ 2CFOA 3L2CA 1JKOC 1TC3C 4LG3A 2KZVA 2P5KA 2IA0A 3BC8A 3HL2A 3DPTA 1TP4A 2E2JJ 2ELJA 2VQLA 3FK6A 2F5FA 1IF1A 4EEFG 5FO5A 4P5OA 2VN2A 4IKFA 2P5VA 4Y17A 4B4CA 4RGXA 3RIRA 3VWBA 3HTUA 2R5ZB 4WXDA 5KCMA 2DMPA 3ZMVA 2EZIA 1LQ1A 3A02A 5BS6A 2JVGA 5JR3A 4BNCA 4EV0A 2WB1A 3BTLA 3R61A 1ACIA 4BDYA 2OZUA 1G2HA 2CQNA 3O2PE 4N4OB 3JR9A 4F7ZA 1DGWY 1ZR2A 2MYSA 2CUFA 3RPUD 1FYKA 4S0HB 2WAQA 5HDNA 3GTPJ 4AIDA 5FROA 4XRSA 1W7PB 4HX7A 2R7UA 1WJ5A 2ZFWA 4D7MA 1LEAA 1FJLA 2LF7A 2K9QA 4GRIA 2C6YA 4RBOA 3CCRI 2A07F 3I5UA 4A3GJ 4I01A 3AG1H 1VQ6I 5GPAA 1FSEA 2VBWA 2X0LA 3C18A 4LD5A 2CRGA 2IPQX 2VJ4A 4ZYDA 1VQKI 4U0YA 1ORKA 1FMWA 4B09A 2DT6A 4UY8I 2UUZA 4BL0B 3KEQA 3LL7A 4XONA 1ENHA 2MABA 2M45A 2BGCA 5EGOB 2H09A 5L3GA 3FMSA 3H0GJ 5LFAA 4E7JA 1XSDA 2EWNA 1MNEA 3DF8A 5KAIC 3OYBA 1JT0A 5F0FA 4RAGA 2V9KA 4OIOF 1O3QA 3HSFA 1Y0NA 4CXFA 1SVLA 1X3UA 2HOTA 1FYLA 4XLHA 5LHIA 3K9TA 2FMLA 1WJDA 2DXIA 1BBYA 2VJIA 5HODA 2IBDA 2Y9ZA 3F6OA 5FKMA 2JMWA 3HSEA 4FASD 1JJ8C 5EZHA 3L2WA 3ZP5A 4P1WA 4B47A 4KISA 2VL8A 2J5OA 5B1AH 2OD5A 4ESFA 2F4OB 4RS8A 1OLTA 2DA3A 1I6HJ 4IRHA 4DBQA 2L9NA 4PJNA 3M07A 3F8CA 2UXNA 5EYRA 4G8XA 1HDDC 4OIRF 4BEHB 1OYYA 4RB3C 4M9ZA 1JKRC 1TQIA 1Y6IA 3LSJA 4BHPA 4JX6A 3SEZA 4IF4A 2Z99A 4F92B 5DD4A 1W1WE 3FBNB 2OPTA 3KP7A 4YG2F 2O03A 2FSWA 2F5EA 2FRHA 3K4KA 4M72A 1BN5A 3OYKA 1VQ5I 4ENJA 4E70A 3QP5A 1J7KA 4HDVA 3F8MA 2DA5A 3QPHA 2WAEA 5JVGF 1PUEE 1ON1A 1T0FA 2NXNB 1U9OA 3EYIA 2LH9A 4CA0A 3SFZA 1W5TA 5E3OA 5IT9K 1D5VA 3FX3A 4UB6C 1MMNA 1VZ0A 4HX8A 4ESBA 3BOQA 1G3YA 5FFZA 4XRFA 1YIOA 2OA4A 3WGHA 5F1RA 3G71I 2MW8A 2Y75A 4HLYA 1ZYRF 1IUYA 4C3IJ 3FXOA 4IHTA 3I58A 2VKVA 4E7KA 4KMUX 5JHUA 5K1YA 4AIKA 4N0BA 3BJ6A 2Y48A 1WZ2A 1WI3A 2DN0A 3OSGA 3GBGA 3S17J 2EA4A 5A2QZ 4LGWA 1Y39A 1SFEA 5J4YA 3OIPA 1WCMJ 1Z9CA 2UXXA 1GVJA 3GYHX 1YQAA 5EEGA 3JTHA 4FISA 3SZTA 5JI6A 4BU2A 3TP0A 2ZXHA 3D1NI 4IL6C 1HCRA 2EV0A 1KQ0A 3DCFA 4V2GA 3O3KA 4NBQA 1UB9A 3ZOBA 4I98B 4HNTA 3U9GA 1AU7A 3F72A 2UV1A 2HS5A 2P4WA 4JQFA 4Q5SF 5GTHC 2R92J 4PGHA 2NVTJ 4A3LJ 1K6OA 1YW8A 2L7KA 2MSYA 2VE9A 1J75A 3C2GA 1VF9A 1N75A 3M4OJ 4WK8F 2BY2A 2V6CA 4A5NA 1TNSA 4ENNA 1T33A 1YS7A 2VKEA 3BJOA 3BQZA 1XB4A 2FOKA 2HQAA 4F3QA 2VOOA 3FIWA 2IGOA 1IN7A 1IXRC 1CQTA 3MKWB 4AVPA 1J9IA 2G9WA 1G3WA 3OIQA 1FNNA 2E5NA 2HQRA 5B66C 4CUGA 3QYFA 4QIWN 3GUDA 3T8RA 5F64A 3HGYA 4RB0A 2R7XA 1A5JA 2KIQA 3FMQA 2YPRA 3A1YA 1J5YA 4L9TA 3GTOJ 1GUUA 4MTEA 5H6QA 1PYVA 4KJZA 2KKOA 3GCMA 3JTGA 4BEHA 2R7TA 2BY0A 5B3SH 3OYMA 4A0YA 3M8FA 1STZA 2PLYA 5GAGJ 3DKXA 2HZTA 3Q9SA 2K9NA 1D8KA 2YS9A 4LK1F 5M3MJ 5EZGA 3ZQLA 4JX5A 1SEUA 3M9AA 2AXLA 4FCYA 1K4SA 2W84A 2A3SA 2FUG2 3TQNA 2VUMJ 2MH9A 1P7IA 2QM3A 3MKZA 1QU3A 4NC6A 3LAJA 5TJJA 1G6NA 2PMZN 4UV8A 3CQZJ 3HJEA 4C3JJ 3OV8A 1ZAOA 2FX0A 2VC1A 4MFDA 4O5VA 4GYGA 1P4WA 2RDPA 1R49A 2VXZA 5K7HA 2E1MB 4M9SA 4M3FA 5HS8A 4KNYA 1J2XA 3BCAA 3ABLH 3H5AA 3U1DA 4F55A 3L2UA 4BKXA 5K7FA 1S72I 4IZZA 2HVRA 2H6CA 5D5WB 1LNWA 1YE9A 2A68F 1VQOI 2YX4A 2JUCA 2EINH 3TW6A 3REOA 1ZQ3P 1RC9A 4PFPA 2Y0MA 5E8GA 3GMEA 3MQ0A 3HOTA 4YELA 4AU7A 4WX9A 1SANA 1C0WA 1ETQA 3TO9A 1JGSA 4I09A 1KONA 2DJNA 5GAEJ 1MH4A 2WAFA 2JTVA 1B1BA 1Z21A 2ZJRF 1D5YA 1ZRCA 3P9KA 1FWZA 2XDVA 5FKNA 2Y2ZA 1R5ID 1ZG3A 3L09A 3J7YJ 1S3JA 3KPHA 4KA4A 2QCOA 1YX5A 3TOAA 2O7OA 3JRFA 1WH5A 3QODA 5LGUA 3LA2A 2STWA 3OL3A 3CJTB 4WXCA 3AKZA 2XAHA 2EV5A 2D45A 5D5UB 3PJRA 1O7LA 5BOXA 2LOOA 5FLMJ 2G7HA 3PIPF 1S9HA 3KZZA 4G6QA 5D5VB 2QGUA 2DFIA 5TISC 4XN0A 3L7WA 2HEOA 2K7LA 1O3SA 5ED4A 4D5CA 4NQWA 5E18F 3CMYA 3CCLI 1XMAA 2GXGA 5DM6F 2ZJPF 2X51A 1JGGA 1YW7A 3E6BA 1VQLI 2X9DA 4HOBA 1KGSA 4ZDLA 1RETA 5DYMA 2HYFA 1GT0C 1EA3A 4IHYA 2LTPA 2DYRH 2HXIA 4RAZA 4UV9A 4BXFA 4KN4X 3CC2I 1BI0A 3OL4A 2BVMA 2IAIA 1HA8A 5K5OA 1U9NA 2NS8A 4G9YA 5HLIA 3ULQB 4OIQF 4M3BA 1TWHJ 2CU7A 4KT6A 4L9JA 3FK7A 4HF1A 1FC3A 5DUKA 1IV6A 3NAUA 5EG0B 4L18B 5AIQA 1WHUA 1U5TA 4V2FA 3BPVA 5FRMA 2GA1A 3SZGA 3I3LA 2X1DA 1R4MB 1O3RA 1MMDA 4KYWA 4EJOA 4IOAF 1DQUA 1QNTA 3VSKA 3H9JA 2LKXA 3PNTA 2DA4A 1ZR4A 3CP8A 2O9LA 1OCTC 3WU0A 4DW6A 3J7AY 3HGGA 2O5RA 2AQFA 2JA7J 4ZJZA 2QA4I 2ZBKA 1BC7C 4PFOA 3DU6A 3I53A 5FGMA 2DTRA 3SEQA 2V9PA 3FHZA 4UB8C 3QU6A 3DEEA 1ZRDA 2IGMA 3FF5A 2WADA 3IAS2 1RKTA 4YIRX 4Z6YA 3K10A 4U7BA 4RA2A 1LEBA 3VYRB 4BE1A 3K1PA 4KIGA 4XOPA 5DUIA 1OCZH 1OYWA 2XSDC 2QQ9A 3I54A 4HSRA 3HOXJ 2P0WA 1G4DA 3LA3A 1WGXA 5TGTA 1DDNA 1K61A 2ZCWA 5IP6A 2DA1A 3S16J 1MJ9A 2Q1ZB 1MNDA 5EG0A 4BXUA 5D4SA 4FE4A 1MJBA 1Z77A 2EBIA 3OYEA 1E3OC 1KQ8A 4HQMA 3IRRA 2JZYA 4YIFA 2GXAA 4L0YB 3I59B 1MZBA 3GZNB 3QP6A 3GVAA 1HQCA 4D9JA 4Q47A 1FOKA 3ZRGA 2XAGA 2BHYA 1S7EA 1Y56A 2CW7A 3FKIJ 1N25A 1U5TC 3N4MA 3CDLA 4NNJA 2YU9J 4NHJA 4LOCA 5DM7F 1BR1A 2Y31A 3HB9A 3ZMUA 4BAYA 1BI3A 4BQNA 2XAUA 5D6FA 1FY7A 1XSVA 3QWLA 1LDKB 4CYCA 1WH7A 2IS1A 3S1NJ 5DCMA 2PJRA 4L9NA 1LUJB 2VKDA 2R7RA 4XLCA 4HRIA 2K4JA 3T8TA 4D7NA 1D3YA 2DDAA 1QHGA 2R7SA 3OYHA 5BPIA 2HI3A 2DA7A 3S3OA 2OAZA 3EUHC 5IY5H 1VQ7I 1XGSA 5FB2A 3Q5FA 3CCJI 4L5EA 2W1OA 5H20A 3CESA 2BEOA 1S29A 3H9QA 1KQ9A 1HOMA 3S1MJ 5AONA 3GTQJ 4LITA 1PJRA 2V79A 4XLNF 2PMZA 3DPLC 3TOBA 4DNCA 1P7JA 4BH9A 3PIOF 1YFHA 4A3MJ 2R0QC 2XF5A 4A3DJ 4AYBA 2L0KA 2DT5A 2DPDA 5JFRA 3IH2A 2I10A 4IVNA 2ECCA 4IO9F 4ZDOA 3GW2A 2KP6A 1VTNC 2VJ5A 1R23A 3D5RC 2ZXWH 1PVEA 1PUFB 2RKHA 1DU0A 1BL0A 2OJED 2DA6A 5J47A 1O3TA 3G73A 3GZ5A 3KZYA 4ESJA 4H4KC 2XHKA 3L2VA 4R8HA 3DV8A 1Y1WJ 1GHCA 4LLGF 1R22A 2OZ6A 2VC0A 3OYIA 4EJWA 3CCUI 4EMSA 2HOAA 4JOMA 4R79A 1UFMA 4J00A 5J3LA 1NK2P 2ID3A 3HHHA 3S32A 3LSRA 4IHXA 2L54A 2X85A 1AWCA 3H9GA 4IRGA 1H8AC 2O0YA 2K9LA 3PO3J 4G6DA 2VXDA 4LB6B 4AD9A 4HAMA 2VB6A 4IQJA 3WODF 4QSHA 2K3PA 2UZKA 3ABMH 3M7GA 2ME6A 4IPAA 2R5YA 2M5WA 2QZ8A 1JTYA 3FXRA 3J81Z 5ILUA 2D1HA 1X1BA 1SD7A 4AYBN 1DP7P 3I0TA 1FT9A 2EIMH 2Y30A 3DPUA 2R93J 1WRJA 3A03A 4XKVA 5L3EA 3LFUA 1FZPB 1XX5A 2ZSHB 3VFZA 3SQNA 4BY1J 1S5LC 4BE0A 2QWWA 2A6HF 3L00A 1HF0A 1CGPA 3ZCOA 4A6EA 1IGNA 3MAJA 4YIIA 5DCFA 5FD5A 4KFCA 3CTAA 3K0LA 1ZK8A 1V54H 3EDPA 1RKWA 5E3LA 1SD4A 4DYRA 4WCGA 1ITYA 3NARA 3CJNA 3IC7A 4Y52J 3S15J 1XS9A 2H1LA 5DD8A 3OYDA 3TKYA 3E7LA 2GA2A 3JREA 4BYYA 1EH7A 5LRSA 2CV1A 1YTYA 1DPUA 3IV5A 4M9XA 5BMZA 1RR7A 4DBRA 5L3FA 1OCRH 1SFKA 4F93B 1SC7A 3VB2A 1ZG1A 3TGNA 3M8EA 1P2FA 2L9VA 4FQGA 1MDMB 1FBSA 3HSRA 2NVUB 3MKYB 2H94A 3OOPA 1AA7A 4ITVA 2JA6J 3HRTA 3GFLA 1WFXA 2R7VA 4ZYHA 2PJRB 4EJUA 4ABZA 3GFJA 4CYCB 4WWCA 2V4JC 2WAQN 3DEWA 3OS1A 3X2QH 3I71A 3IHUA 1IC8A 1R9TJ 3FXUA 4CSWA 3J7ZI 3AAFA 1CF7B 2AS5F 4BY7J 4XKCA 9ANTA 3T1BA 1D1BA 2BW3B 3TBIA 4NQWB 3DU5A 1XC5A 1GV2A 2GIZA 2LRDA 3WTUC 5J40A 2FXAA 4U7DA 1IV8A 4OU0A 1DGRM 3FKJA 2LSOA 2XPWA 2NAZA 3HEFA 1KA8A 3BTIA 1W36D 3BROA 2FQ3A 5LGTA 2WA0A 2VLAA 2P7CB 1VQ8I 2LREA 1XGNA 3HG9A 3Q9VA 3HOZJ 1J0RA 2DT7B 5CVVA 4EJVA 3SDGA 2CV0A 1T98A 2X4HA 1TW3A 4I0BA 1R1UA 4A0XA 2GZWA 1ETXA 3U1KA 3QU3A 3T5XA
chains in the Genus database with same CATH topology
4XMYA 3RTRA 3W2AA 2CV2A 2L7KA 1FMVA 4HNUA 2JVHA 2LC2A 1T0FC 3C2GA 1N75A 3HKZA 3HUGB 3OYCA 3CMMA 2A5WA 2LBFA 3ZGKA 2OV7A 4F3QA 2HQAA 4ZC3A 2BVLA 2IGOA 3MKWB 1Z7LA 2LY2A 3K4NA 4PSWA 3M1CA 3FBIB 3OIQA 2E5NA 4XNFA 4BJ6C 4RLFA 3QYFA 4CUGA 2X1EA 2ZSIB 1QHHD 2XSJC 2R7XA 2M0MA 3A1YA 2M3AA 4U87A 2LYCA 3VYSB 1YX3A 4BQOA 2M7BA 4ANJA 2CW8A 1PYVA 4KJZA 2ZXIA 2R4GA 4BEHA 4PJLA 2IGKA 2VQGA 4CH7A 4DJAA 3OYMA 3S3NA 1N77A 4YRVA 1WJAA 2KMUA 3FDYA 2VPLA 3DKXA 4AVZA 2E60A 3NWTA 2GOMA 3DTIA 4C9YA 3M8JA 2K5CA 3I9V2 2RNGA 3BG6A 3OYGA 1WJCA 2FUG2 3A2KA 2Q2EB 3MKZA 2HPMA 1X4OA 1QU3A 4E7LA 4HEA2 4PJMA 1UG0A 2VKHA 3OYAA 3DWLE 4B3XA 2JUGA 1OR7C 5LD2C 3D5LA 3NWSA 1MW7A 4G6TB 3HPGA 2XC7A 2X6WA 2IS4A 2HPIA 2X6XA 4CCJA 2MD0A 2KPMA 2VJJA 1ERDA 2VXZA 3OY9A 2E1MB 4HPQA 4IQ4A 3QYBA 3KEYA 2W00A 2L2OA 3BCAA 2K9MA 2CUJA 3H5AA 1Z3XA 3PL8A 1U0JA 4F55A 3L2UA 4IZZA 2HVRA 4LIVA 5JHFA 4CZCA 1D0XA 3K4LA 1YE9A 4DGWB 3K6GA 4PK4A 4F91B 4PFPA 3HOTA 4YELA 4AU7A 2F4IA 2MC4A 4BGDA 1KONA 4N4NB 1N78A 4B43A 2WAFA 3VYTB 2JA2A 1Z21A 3OOUA 3ZR8X 4XKBA 3LSKA 2GOXB 4DOZA 1G8XA 2XDVA 1V5GA 3D5SC 3OR1C 1LKXA 3EUAA 1YX5A 3LSMA 2DCEA 3QODA 4BS9A 3PSFA 5CQEA 4MLOA 3OYJA 4PUSA 3H0DA 3OL3A 4Y33A 3AKZA 4II3A 3SYTA 3PJRA 2LOOA 2F5VA 2NOJB 1S9HA 1X1CA 3RQ4A 3L2QA 4ZTFA 3MMYB 3PNYA 4XN0A 2L5QA 3QYEA 3PFYA 4XLFA 3PNVA 3AL0B 3HXLA 4QPOA 3EPZA 4X0GA 2X51A 1LFPA 3DTEA 4QPQA 4ZDLA 1NG6A 3PUBA 1EA3A 4OAZA 3EUKL 3VYUB 1V5FA 4BXFA 2AQEA 3PSIA 2I8DA 2RQQA 3OL4A 1D0YA 2BVMA 1D0ZA 4XN3A 1HA8A 1D1AA 2UWMA 4DIQA 1BOBA 4KT6A 4BUPA 4D1QA 2X6YA 2Z1DA 1UELB 2Z16A 2XF7A 5CPRB 4C30A 5FRMA 4E6KG 3SZGA 2CMPA 3I3LA 2DJIA 2X1DA 2CUZA 1P9QC 2R7TA 2VIXA 4YEJA 4HG2A 1MMDA 2L9SA 2R7WA 1DQUA 3VSKA 3LMMA 3H9JA 3PNTA 2MFZA 3CP8A 4E7HA 3J7AY 4RMNA 4Y4RA 1T95A 2O5RA 2AQFA 3H35A 4OWRB 3RCOA 4ZJZA 4BDZA 4BJTA 3OS2A 4PFOA 3SDBA 3DU6A 5HLTA 4NC7A 3S8PA 1UAAA 3SEQA 1SAUA 2VQCA 4II2A 3DEEA 2V26A 2IGMA 5FRNA 2WADA 3IAS2 1WJBA 1J09A 3E0JB 3FHNA 3K10A 3UR3C 4PSXA 4U7BA 2HVSA 3VYRB 2R7QA 4NUBA 4BE1A 2V7FA 2VASA 2WY7Q 3HPHA 4XOPA 4B48A 3TL4X 3IAM2 3W3CA 2LBFB 3DTKA 4HSRA 2P0WA 3DQVC 1E0EA 3ONQA 3F9KA 5TGTA 4BACA 4E7ZA 4BE2A 2XF6A 2M4KA 2DOAA 2Q1ZB 1MNDA 3K4JA 3MD2A 3A4CA 1JI8A 2F6CA 3OYEA 1K6YA 2A6TA 2W82A 3OS0A 4XR6A 2QKLB 2KQRA 4NC8A 2QKMB 5HOOA 1LVKA 3AFHA 4D9JA 4PJJA 5KHDA 3W2VA 3ZRGA 2KDOA 2OUMA 4E7IA 2CS3A 1Y56A 2CW7A 2Y0SA 2KHMA 3K70D 2CFOA 2KLOA 2HDWA 4XQFA 3OYLA 3CJRB 4LG3A 2KZVA 3BC8A 3K4MA 4NNJA 3HL2A 3DPTA 3HOSA 1BR1A 1R6RA 2ELJA 3BLYA 4BQNA 2VQLA 1BR2A 2XAUA 3K70C 2HU9A 2CH0A 3DLAA 1LDKB 2E1MC 4P5OA 4IKFA 2HZDA 2JSPA 2IS1A 1IRXA 2PJRA 3VWBA 2VKDA 2R7RA 5KCMA 4XLCA 4HRIA 3L2RA 4XM3A 3CP2A 2IS6A 3KX2A 2JVGA 1QHGA 2M4GA 3OYHA 2R7SA 3S3OA 3LSIA 4RM2A 2WB1A 3EUHC 4ZYAA 2RREA 4BDYA 2W1OA 4N4OB 2BOLA 3CESA 3U21A 1DGWY 2KRCA 4E4HA 2MYSA 3RPUD 3H9QA 2IS2A 4Y3OA 2WAQA 5FROA 3CF2A 4LITA 1PJRA 1WJ5A 2R7UA 2PMZA 3DPLC 4C2UA 2VQHA 3UNGC 4J01A 3S3MA 1NG7A 2XF5A 4GRIA 4AYBA 3OMYA 4CCKA 3BCBA 2WBMA 2HVQA 2W4SA 4RM3A 2VJ4A 4XLEA 4ZDOA 1V5EA 1Z3YA 2KP6A 4ZDPA 1FMWA 2DT6A 2VJ5A 3D5RC 5HNFA 2UUZA 4BL0B 3VDXA 3LL7A 4XONA 1TZLA 2MABA 3KYLA 5LFAA 4E7JA 1MNEA 2ZFUA 3OYBA 1X4PA 2V9KA 3K4BA 4H4KC 3L2VA 4XORA 1GLNA 4HSTA 3OYIA 3AL0C 4XLHA 4JOMA 4R79A 1ZELA 4J00A 3S32A 2X85A 2LG4A 2Z2SB 1WJDA 3CJQB 2DXIA 3H9GA 2VJIA 2K9LA 2VXDA 3OWTA 4XKWA 3QOEA 2VB6A 4CCOA 5CKTA 4IQJA 4FASD 1MMGA 2K3PA 4E7SA 3L2WA 4P1WA 3ZXSA 4B47A 4KISA 3HC7A 2VL8A 1X1BA 5KNLA 1OLTA 4DBQA 2L9NA 4PJNA 3DPUA 4OAYA 4XKVA 3LFUA 5HNHA 4BEHB 2ZSHB 1Y6IA 4BE0A 3IUOA 2BW3A 4FETA 4CCMA 4CCLA 5HVQC 3ZCOA 3VSLA 3SEZA 4XL9A 2KRHA 4XOTA 3ZQQA 1MMAA 4F92B 3FBNB 1X19A 4LIUA 3C2HA 3K4KA 4BQQA 3OYKA 3OYDA 1W36C 1BR4A 5CQGA 2WAEA 3TMOA 3RSNA 2CV1A 3OR2C 4F52A 2LH9A 4DBRA 3LSHA 4CA0A 1SFKA 4F93B 3DKYA 4ZTJA 2LY1A 1MMNA 1VZ0A 3BG7A 3CZ6A 3MKYB 4XLAA 3OYFA 2IGNA 1AA7A 2V1NA 4ITVA 1G59A 1WFXA 1D1CA 2R7VA 2PJRB 3K4CA 2W7NA 3S93A 1TT0A 3G2BA 2V4JC 4E7KA 3OS1A 4CSWA 3IP4B 2V6EA 3GBGA 4XKCA 1X1AA 4B44A 4KITB 1D1BA 2X1CA 2BW3B 3V42A 3W2WA 3TBIA 3OYNA 1WJFA 2KL4A 4NQWB 3OIPA 3DU5A 2LRDA 1DGRM 2OC6A 3FKJA 2IXSA 1DP3A 2M7AA 4BU2A 2E5ZA 2ZXHA 4RLQA 1W36D 4IX7A 4EATA 2WA0A 2VLAA 2LREA 4CCNA 3HG9A 3LSGA 4C2TA 2R7OA 2DT7B 4BJ5C 4HNTA 2CV0A 2HNHA 2UV1A 4JQFA 3H5NA 3E1SA 1WJEA 2WY8Q 1X1DA 3N05A 3H5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFK A;  1R6R A; 
#chains in the Genus database with same CATH topology
 2JSC A;  2RN7 A;  4XMY A;  3RTR A;  3W2A A;  3GTL J;  4V19 K;  3J80 Z;  4ON0 A;  3BR5 A;  1FPQ A;  1Y1V J;  1R1T A;  3DEU A;  2HXO A;  2K40 A;  1WWX A;  3CMM A;  2A5W A;  2MG4 A;  4ZC3 A;  2BVL A;  1I3Q J;  4UVB A;  1Z6R A;  3F23 A;  3DBR B;  3K4N A;  3M1C A;  3ABT A;  3H3U A;  1B72 A;  4Z2Y A;  1BC8 C;  3KFW X;  2X1E A;  3JRI A;  2XRL A;  3WTZ A;  1HW1 A;  1QHH D;  2XSJ C;  4Q48 A;  1RR8 C;  4BBS J;  1QZZ A;  4LLL A;  2M3A A;  5J1R A;  1LFB A;  3K2Z A;  3I56 I;  4MIM A;  2JRM A;  2CW8 A;  4UNO A;  1W7P D;  4PJL A;  2VQG A;  2QEN A;  4P9F A;  1F43 A;  2LK2 A;  2NNY A;  3FDY A;  3SFI A;  1JHH A;  1R5H A;  5B1B H;  5E79 C;  4XBF A;  2W24 A;  3NWT A;  3DTI A;  4OMY A;  2MA3 A;  2YSR A;  3I4P A;  1OFC X;  3I9V 2;  2HTJ A;  4I0A A;  5D8L B;  3OYG A;  1WJC A;  3A2K A;  1Y0U A;  3HRU A;  4XRS G;  1VI0 A;  2DK5 A;  2ZNZ A;  1Z6T A;  1KU7 A;  2VKH A;  2R7Z J;  3DWL E;  2FBI A;  3RI4 A;  5LD2 C;  2VON A;  2DTZ A;  1MBF A;  3GZ6 A;  4X1E A;  3BP8 A;  3NWS A;  2NRA C;  1MJA A;  4G6T B;  1OKR A;  1FTT A;  2HOE A;  2XC7 A;  2X6W A;  4A3F J;  3JRH A;  2IS4 A;  2JWT A;  2HPI A;  4CCJ A;  5ICC A;  2HOS A;  2XGX A;  4IHV A;  1HKT A;  3R60 A;  2E1O A;  2KPM A;  1D8J A;  2VJJ A;  1ERD A;  1I1S A;  2FOW A;  3F21 A;  2X6O A;  3BR2 A;  1S7A A;  4IQ4 A;  2PI0 A;  3QYB A;  1VQP I;  1J59 A;  2L2O A;  1Z3X A;  1TWC J;  3ZQG A;  4DZP A;  5JHF A;  5BPD A;  3Q0W A;  3IKV A;  3K4L A;  1OQY A;  1H0M A;  2G7U A;  1F36 A;  2M8G X;  5J8F A;  2RC4 A;  4F91 B;  4NB5 A;  2WV1 A;  1BW5 A;  2V1U A;  2F4I A;  1A36 A;  1ULY A;  3C7J A;  4KN7 X;  4N4N B;  3WE2 A;  2Q0O A;  4NDL A;  1ZGJ A;  3LSK A;  3BR3 A;  2GOX B;  5L3D A;  2XVC A;  3BDD A;  2ZME A;  1BI1 A;  3H1C A;  4XRM A;  1LKX A;  2DFF A;  2IVM A;  2OCC H;  3EUA A;  4S04 A;  2JT1 A;  3KET A;  2OTL I;  2FD5 A;  3KZI C;  2JRT A;  3RPU A;  1HST A;  2DCE A;  3K7A J;  4KIF A;  4BS9 A;  3PSF A;  5E1Z B;  4UVA A;  3CUO A;  3OYJ A;  3H0D A;  1R4N B;  5KAF C;  2R5Z A;  3CCS I;  4Y33 A;  2GLO A;  3P9I A;  1K7A A;  4CGZ A;  5E17 F;  3JCU C;  1NTC A;  1E2X A;  4TV7 A;  2F48 A;  3R0J A;  4K2E A;  1IN5 A;  1LDJ A;  1MBG A;  2HYG D;  3D0S A;  1X1C A;  5D6E A;  1VQ4 I;  1UZC A;  4R1H A;  3QQA A;  2L5Q A;  3GXO A;  2XB0 X;  2NYX A;  4XLF A;  4KIC A;  4EGZ A;  3WTX C;  4I99 C;  5H2F C;  3PNV A;  3FMR A;  1BOA A;  2BHZ A;  4G94 A;  5F04 A;  3AL0 B;  2RNJ A;  4U0V A;  4A6D A;  3HXL A;  1RRJ A;  4DYQ A;  4ENK A;  4KT5 C;  2VE8 A;  1LE8 B;  1LFP A;  3MKL A;  1TWF J;  2FJ1 A;  5BQT A;  1W0T A;  5FJ8 J;  5C44 J;  1NG6 A;  2QSH X;  1FP2 A;  4XK4 A;  5E1X A;  2EFQ A;  1DPR A;  4A3J J;  3PM1 A;  2FBH A;  1MIJ A;  1D0Z A;  1B6A A;  1AKH A;  4ZZD A;  4DIQ A;  2EV6 A;  3LNQ A;  2X6Y A;  2Z16 A;  2YX7 A;  2XF7 A;  5CPR B;  4C30 A;  1VQM I;  4E6K G;  2P5L C;  3MCZ A;  2CMP A;  1SD5 A;  2CUZ A;  3I55 I;  5LRR A;  4YEJ A;  4HG2 A;  1TQM A;  3J80 K;  2DBB A;  4P96 A;  2CQK A;  2L9S A;  2R7W A;  3ZPL A;  4JYK A;  3LMM A;  2WWY A;  2GAU A;  2DU9 A;  2F2E A;  1IAW A;  2DPU A;  1XCV A;  1YIT I;  4Y4R A;  4OWR B;  5J4V A;  4BDZ A;  4BJT A;  1SFO J;  2L4M A;  1SFX A;  2K86 A;  3SDB A;  4NC7 A;  3S8P A;  2NVY J;  4C3H J;  1UAA A;  1YG2 A;  2D1V A;  2AHQ A;  3GTM J;  2VQC A;  2QUF A;  2WC2 A;  4HX4 A;  5CJ9 A;  3C1D A;  3ECH A;  1FP1 D;  4MHG A;  5ICF A;  3BQY A;  2IP2 A;  4PSX A;  3DBH B;  4NUB A;  2V7F A;  4UUT A;  1SVM A;  5GP9 A;  3T0Y A;  5GPC A;  3LSP A;  5M3F J;  4B48 A;  4MEX F;  1U3E M;  3IAM 2;  3LOC A;  3W3C A;  2GM4 A;  1AHD P;  3DQV C;  1E0E A;  2A69 F;  4FX0 A;  3NRV A;  4E7Z A;  4BE2 A;  1BIA A;  2E7X A;  2PFB A;  2Y9Y A;  4GXO A;  1QO0 D;  1FLI A;  2NOG A;  1U5T B;  1Q1H A;  4HZF A;  2XV4 S;  2K85 A;  5CVR A;  1GVD A;  2XPV A;  3A4C A;  3RZO J;  1JI8 A;  1MBK A;  2CJJ A;  3ELK A;  2H8W A;  2DMU A;  1K6Y A;  2A6E F;  4ZH4 F;  2W82 A;  5EEA A;  3MVP A;  1IDY A;  3OS0 A;  4XR6 A;  2QKL B;  4AUX A;  4FE7 A;  1V55 H;  1B8I B;  1UG2 A;  3WHC A;  5E8I A;  2E2I J;  1XPX A;  3ML6 A;  2EFN A;  1P92 A;  3BG5 A;  4PJJ A;  5KHD A;  1B4A A;  4G7Z F;  3W2V A;  5JLX A;  3KLO A;  4UXN A;  2OUM A;  5FLX Z;  2CS3 A;  1OR7 A;  4E7I A;  1PP7 U;  2PJP A;  4WF2 A;  1IRZ A;  3RJP A;  1F4K A;  3SZP A;  2Z3Y A;  2R7D A;  5EF6 A;  2Y0S A;  2R3S A;  5EGO A;  2JA5 J;  1ZKG A;  3JAM K;  3K70 D;  2EPF A;  3RYP A;  5IP7 J;  5DV5 A;  5F08 A;  2ACJ A;  3OYL A;  4A0Z A;  1YIJ I;  3ZQI A;  3ZMS A;  1RIO H;  3HOV J;  2IRF G;  1A04 A;  3JW4 A;  1ETK A;  3HOS A;  3FM3 A;  2V1X A;  4RGS A;  1F5T A;  4KUM A;  5J1Y A;  4I7H A;  2HU9 A;  3K70 C;  4OIP F;  4UUS A;  2DW4 A;  2NS7 A;  5FKL A;  2HZD A;  3TED A;  1IRX A;  1BA5 A;  3F8F A;  2D2W A;  3ERM A;  3L2R A;  1IW7 F;  2B0L A;  3CP2 A;  4QWQ A;  2IS6 A;  4H0E A;  4KMF A;  3KX2 A;  1XDS A;  5GAD J;  1W5C C;  2MBF A;  3IWZ A;  3LSI A;  3Q0V A;  2HDD A;  2GXB A;  3F3X A;  4ZYA A;  3ECO A;  4CO8 A;  1RES A;  2OF7 A;  2ZME C;  4FHT A;  3JRB A;  2BOL A;  4UVC A;  2ELH A;  2KRC A;  2QVO A;  3G1M A;  1T2K A;  2V9V A;  3R0A A;  2FNP A;  4I02 A;  3KIO A;  4O6J A;  5F0H A;  3BTJ A;  5AIP A;  4C2U A;  2DOE A;  4J01 A;  3S3M A;  3CLO A;  5ERI A;  2W57 A;  1POG A;  4W1U A;  5C4J J;  3BCB A;  1HLV A;  3G1L A;  1B72 B;  2WBM A;  4XLE A;  2W4S A;  4RM3 A;  2H1K A;  5DS9 A;  3DXJ F;  1HW2 A;  5HNF A;  3S2D J;  2Y69 H;  2A61 A;  3CDI A;  2JJ7 A;  1TZL A;  5LBQ A;  3KYL A;  3PQJ A;  3IRQ A;  2XAQ A;  2ZFU A;  2ESH A;  4Y15 A;  2ISY A;  3K4B A;  1YYV A;  3QRF F;  1IXC A;  1EF4 A;  1HKQ A;  3CCV I;  2E2H J;  1GLN A;  1SVO A;  2Z5U A;  4HST A;  3V7C A;  2STT A;  3BG9 A;  3H3V K;  2W25 A;  1USS A;  3ROU A;  4EM0 B;  3MFK A;  3G1O A;  3GLX A;  3F8N A;  2LG4 A;  4M3D A;  4EQQ A;  1TWA J;  4BHB A;  2N8G A;  3S1R J;  2O3F A;  4ZYG A;  2HTS A;  3WG9 A;  2Y0S N;  4XKW A;  3QOE A;  4CCO A;  1MNM C;  1EH8 A;  5CKT A;  2EIJ H;  3ZN1 A;  4E7S A;  1JTX A;  3BR1 A;  1I50 J;  1U8B A;  4UHT A;  1JE8 A;  4XLP F;  3BWG A;  3JRG A;  3ZMZ A;  3FXM A;  2JPC A;  1O57 A;  1XDU A;  1E17 A;  1TTY A;  2HGC A;  2CW0 F;  1UST A;  5HNH A;  3GFI A;  4HQE A;  1R36 A;  3IUO A;  2BW3 A;  3WTV C;  4J19 A;  3VSL A;  3J7A O;  4U88 A;  4XOT A;  1W7P A;  3ZQQ A;  4HLX A;  3LA7 A;  2YU3 A;  1FYM A;  2IA2 A;  1X19 A;  1B8I A;  2IT0 A;  5ICE A;  2PQ8 A;  4MFE A;  1ETW A;  4ETS A;  3DBL B;  1I3A A;  1W36 C;  1BR4 A;  2IEK A;  3GEZ A;  1UHM A;  1IN4 A;  3TMO A;  2BY1 A;  3DLL F;  1SAX A;  2ZJ2 A;  5DTD A;  3OR2 C;  4EM2 A;  1Q1V A;  2BV6 A;  1X3Z B;  3LSH A;  1XMX A;  2E36 A;  1KZH A;  1OJL A;  4RDU A;  1S8N A;  3DKY A;  2LY1 A;  5CYV A;  3BG7 A;  4AC0 A;  2RV8 A;  4S05 A;  1A6Q A;  3CZ6 A;  1TNT A;  3OYF A;  2IGN A;  2V1N A;  2DI3 A;  3E97 A;  1G59 A;  3OSF A;  3K4C A;  2W7N A;  1TT0 A;  3WTS C;  2PMU A;  3HOW J;  1XSX A;  1BJZ A;  4C2M J;  5GTI C;  2V6E A;  2L7F P;  3WGG A;  4Q4Z F;  1X1A A;  4B44 A;  4KIT B;  5B5E C;  3V42 A;  3BZK A;  3W2W A;  1LVA A;  1WJF A;  2KL4 A;  1TBX A;  2RQP A;  2GIV A;  3BR0 A;  1H9G A;  5D8K B;  2IA1 A;  1ETY A;  1VQN I;  3I4M J;  2IXS A;  1HDP A;  3HBL A;  2E5Z A;  3HOU J;  4RLQ A;  2XAS A;  2M8E A;  4KIB A;  4IX7 A;  1ZRE A;  1W4M A;  1IRF A;  1TT5 B;  2KIM A;  3RKY A;  2QQA A;  3LSG A;  4LJZ F;  3ZQF A;  2R7O A;  4BJ5 C;  5KVR A;  2HNH A;  3H5N A;  4MNU A;  3HZJ A;  5M5W J;  3A01 B;  3E1S A;  1WJE A;  1QVT A;  1E3H A;  1X2M A;  1A6I A;  2KIS A;  4B1R A;  3WTW C;  3C2B A;  1X1D A;  2QYO A;  2ME0 A;  3H5R A;  1P6R A;  3ESW B;  2CV2 A;  1XMK A;  4L9V A;  5A2Q K;  1NH3 A;  1EJ9 A;  2JVH A;  4M71 A;  1UCR A;  4A93 J;  2BZT A;  4PJ0 C;  5FD6 A;  2MH2 A;  3HKZ A;  3HUG B;  1Z67 A;  4HW0 A;  3OYC A;  2DA2 A;  2FQ4 A;  3I64 A;  2DOD A;  2GBY A;  2LBF A;  2LFB A;  2EK5 A;  1PUF A;  4GGG A;  1Z7L A;  1B9N A;  3O6B B;  1OIS A;  3WU1 B;  5D4R A;  2PX9 A;  3FXK A;  2LKP A;  4PSW A;  1RPW A;  2IW5 A;  1FOW A;  4JBA A;  5CVU A;  3RYR A;  2HFH A;  2ADU A;  4GCV A;  2XGD A;  4RLF A;  1K78 A;  5CLS A;  2QBY B;  2IJL A;  3VOE A;  3HIF A;  1IN6 A;  2M0M A;  1M1E B;  4L0Z B;  4G7O F;  3TO6 A;  3GO5 A;  3VYS B;  4BQO A;  3PQK A;  5E3N A;  2M7B A;  4ANJ A;  5EJC A;  1K83 J;  1ZRF A;  2KJB A;  2ZXI A;  5M5X J;  3ZN0 A;  2R4G A;  1VND A;  4DJA A;  2IGK A;  1N77 A;  3S3N A;  1R71 A;  4MO7 A;  1WJA A;  3H36 A;  2EIK H;  4FT8 A;  2VPL A;  4JX4 A;  3RKX A;  4AVZ A;  2E60 A;  2L01 A;  3CUQ C;  1KYW A;  4C9Y A;  4FTH A;  2RNG A;  1MKM A;  2L7Z A;  1RI7 A;  1I5Z A;  1QQI A;  2Q2E B;  2HPM A;  2H6B A;  5LEK A;  4EGY A;  5DCM B;  2KIF A;  4HEA 2;  2R7F A;  3NQO A;  1MD0 A;  1T6S A;  3HDD A;  3PUF A;  3CCM I;  2M1B A;  2JUG A;  3D5L A;  1XTA A;  3P9C A;  2EB7 A;  1MW7 A;  4RB2 C;  4A3I J;  2LD5 A;  3HPG A;  3ASN H;  3I4N J;  1DUX C;  1F9N A;  1JKP C;  2X6X A;  1H89 C;  2BXZ A;  1B59 A;  3A0H C;  1B9M A;  1YW9 A;  3KEY A;  2W00 A;  2K9M A;  1FBU A;  1ON2 A;  3E5Q A;  1U8R A;  1LFU P;  3WHB A;  2XB5 A;  3O8G A;  3JRC A;  5E3M A;  1BIB A;  5IP9 J;  4YFK F;  1JJ6 C;  4EM1 A;  2EZK A;  2CGP A;  4PK4 A;  1LPQ A;  2NS0 A;  5KK1 A;  4B8X A;  2FBK A;  2HR3 A;  1ZGA A;  2L7M P;  2MC4 A;  4BGD A;  1N78 A;  1MDM A;  1IUF A;  1EKE A;  4ENM A;  3ZR8 X;  3E5X A;  4XKB A;  1SFU A;  4DOZ A;  1G8X A;  4CHU A;  4DQ2 A;  5CVI A;  4IHW A;  3BTC A;  2EFP A;  3LSM A;  1PP8 F;  1JUP A;  2DLL A;  5J8C A;  3BJA A;  2EQR A;  2M9H A;  5F6F A;  4A69 C;  4MLO A;  2EJR A;  3P7N A;  1YHQ I;  3W6V A;  3S14 J;  2L9R A;  4M3G A;  3SYT A;  1HW5 A;  3A0B C;  3O8H A;  2NOJ B;  4N9H A;  1HKS A;  3SXY A;  4EVI A;  1T8I A;  1QBJ A;  3QYE A;  3F22 A;  1U2W A;  3TO7 A;  3N97 A;  1K79 A;  1X3W B;  2XPU A;  2QQB A;  1LJ9 A;  4MGR A;  4X6A J;  1EV7 A;  1I1G A;  2KDZ A;  1WKM A;  3BY6 A;  3CUQ A;  2FEZ A;  3VEP A;  2OBP A;  3HUG A;  1SMT A;  1YLF A;  2O8K A;  3EPZ A;  4X0G A;  3FXQ A;  2HQ5 A;  2NNN A;  5IT9 Z;  1IO2 A;  1G3T A;  2LLK A;  4QPQ A;  3ZMT A;  2KJC A;  2E19 A;  2AXT C;  1AOY A;  3JAM Z;  2NVX J;  3Q0U A;  4OAZ A;  3EUK L;  1MH3 A;  2BY3 A;  3VYU B;  2AQE A;  1MMS A;  2RQQ A;  1D0Y A;  3E6D A;  4YFN F;  4CIC A;  4A3C J;  2BBY A;  2HQN A;  2GQQ A;  2BE5 F;  5F27 A;  4XSZ F;  2Z1D A;  4A12 A;  1UEL B;  2DFE A;  2HDC A;  5C4X J;  4OMZ A;  2CWE A;  2BYV E;  4JK1 X;  1ZLJ A;  1P9Q C;  1HC8 A;  2ICW G;  3RKQ A;  2JQ7 A;  4RGU A;  1LE8 A;  3K1M A;  3QPS A;  2PN6 A;  2MFZ A;  3K1N A;  5L3B A;  4HBL A;  3CO6 C;  1T39 A;  3P5J A;  3WTY C;  4RMN A;  2QBY A;  1QZE A;  2B63 J;  2PG4 A;  2FNA A;  3PFI A;  3OS2 A;  1QVU A;  3ABK H;  2VOP A;  2FA5 A;  2ZNY A;  1UJ8 A;  2JPB A;  2OCE A;  5IOZ A;  2V26 A;  3LAP A;  1WJB A;  4QLC U;  2O6G E;  1JUM A;  3E0J B;  3FHN A;  1X1P A;  2MC3 A;  2R7Q A;  2VAS A;  2M87 A;  2XGC A;  5ILS A;  2LBF B;  2CYY A;  4A2U A;  3UKG A;  3DTK A;  1RUO A;  5F1J A;  3ONQ A;  3U2R A;  1KU3 A;  3F9K A;  2ZME B;  3KYD B;  4BAC A;  2DMQ A;  1BM9 A;  3QOP A;  4XID A;  1NK3 P;  4IXA A;  3CDH A;  4N9I A;  2XF6 A;  2M4K A;  4P9U A;  1IG7 A;  3CC4 I;  2DOA A;  1W5S A;  3KCC A;  4WXH A;  4EJT A;  3HOY J;  3B6A A;  3TW7 A;  4AWX B;  3MD2 A;  1BI2 A;  1VFC A;  4M73 A;  1YS6 A;  4LB5 A;  3GTG J;  1I27 A;  2F6C A;  1XCB A;  3EYY A;  3L9F A;  4BXX J;  2A6T A;  1RUN A;  3V8J A;  1R58 A;  1I6X A;  2KQR A;  2M2E A;  5K7Z A;  3S2W A;  4P55 A;  4U0W A;  5HOO A;  4LG0 A;  1LVK A;  4HV6 A;  3AFH A;  2DMT A;  2KDO A;  2XAJ A;  3IL2 A;  2AO9 A;  1X2N A;  4IJA A;  2KT0 A;  2FF4 A;  2KHM A;  2KLO A;  2HDW A;  4HNV A;  4AIJ A;  2ID6 A;  3G3Z A;  2COB A;  4XQF A;  1FTZ A;  1V4R A;  5HS9 A;  3CJR B;  3GFM A;  2E1N A;  1PDN C;  3K4M A;  4M74 A;  2JK3 A;  3MN2 A;  4MEY F;  1ZLK A;  1R6R A;  3E6M A;  2CSO A;  2JN6 A;  3BLY A;  1BR2 A;  2EFW A;  2CH0 A;  3DLA A;  4BQA A;  2E1M C;  2PEX A;  3COA C;  2QQ8 A;  2JSP A;  4RAY A;  3PO2 J;  2CQ7 A;  1GXP A;  4HF0 A;  3LFK A;  3G6E I;  2LKS A;  2LDU A;  4IRI A;  4XM3 A;  4M6Y A;  3R6S A;  4I2O A;  2LP0 A;  3KP2 A;  3FM5 A;  1SMY F;  2M4G A;  2VBX A;  1O4X A;  4RM2 A;  5HLH A;  2RRE A;  2F5C A;  2DAO A;  5BNG A;  4G12 A;  3U21 A;  1FBQ A;  4E4H A;  2HYJ A;  2IS2 A;  4Y3O A;  2DQR A;  2KZG A;  4ZZL A;  3CO7 C;  2FMY A;  2DFH A;  3CF2 A;  2BXY A;  3Q3S A;  1KU2 A;  2VQH A;  3UNG C;  1NG7 A;  4JP0 A;  5LHH A;  3GTK J;  3OMY A;  4UUS B;  4CCK A;  1YRN A;  1ETO A;  2MGQ A;  4M6X A;  2VBY A;  3F6V A;  5E20 A;  1JT6 A;  2HVQ A;  5IYC J;  4GDF A;  1V5E A;  1Z3Y A;  4ZDP A;  4D5F A;  1FOY A;  1ZN2 A;  2ETH A;  1ODD A;  3VDX A;  2KFD A;  3EQL F;  1MBJ A;  4MQ9 F;  4BBR J;  3JRD A;  1X4P A;  4XSX F;  1REP C;  2XKP A;  4XOR A;  2NVQ J;  2DOF A;  2LVS A;  1UMQ A;  2VT3 A;  2H27 A;  2CUE A;  3AL0 C;  1L0O C;  3LQQ A;  1ZEL A;  4YFX F;  3CJQ B;  1XG1 A;  2Z2S B;  3ZQ7 A;  4HYE A;  3HYI A;  4M6V A;  2XKO A;  5K5Q A;  3OWT A;  1MMG A;  4A3E J;  1R1V A;  1ONV A;  2M0C A;  3E3V A;  1MBE A;  2XAF A;  3ZXS A;  5ILV A;  1YO5 C;  3HC7 A;  2H8R A;  5KNL A;  2TCT A;  2LMD A;  4DYC A;  3CUQ B;  1YJW I;  1BJA A;  1P4A A;  3QAH A;  1XD7 A;  5FLV A;  4OAY A;  3BPX A;  5HS7 A;  3C3W A;  4XIC A;  3WGI A;  4PDK A;  2YUS A;  1CF7 A;  2XRO A;  1WVR A;  4FET A;  4CCL A;  4CCM A;  5HVQ C;  3WE3 A;  3H92 A;  4XL9 A;  2KRH A;  1XN7 A;  1Y8R B;  3E6C C;  1MMA A;  1UHS A;  3IH3 A;  4LIU A;  2ISZ A;  2OU2 A;  3C2H A;  1NHA A;  5DEQ A;  2E34 A;  1YRN B;  2VT2 A;  3GWZ A;  2L4A A;  3AG3 H;  1IJW C;  2D5V A;  4CZZ A;  3AG4 H;  4BQQ A;  5CQG A;  1MBH A;  4D0P A;  2P81 A;  4Y7N J;  3RSN A;  4DZJ A;  3JSP A;  3J81 K;  4M3E A;  1X58 A;  4F52 A;  1ZAR A;  4L5J A;  3R4K A;  5IYD J;  2A05 A;  2ZO4 A;  3V7S A;  4ZTJ A;  4PZJ A;  3CME I;  1P4X A;  5ICG A;  1A35 A;  4XLA A;  4GO1 A;  1XGM A;  4BHC A;  3TDZ C;  1D1C A;  3G4S I;  5J1U A;  2VI6 A;  1VQ9 I;  1LDD A;  1GDT A;  3S93 A;  2V1D A;  3G2B A;  5E1W A;  3MEX A;  3B02 A;  2HWV A;  2K02 A;  5LEJ A;  1SD6 A;  3IP4 B;  3S1Q J;  2WV0 A;  3MWM A;  1Y8Q B;  3JRA A;  3MZH A;  3KP5 A;  5JLW A;  2X1C A;  3OYN A;  1TQP A;  1T56 A;  3LQR A;  4IEJ A;  2F5D A;  3DP7 A;  2ECB A;  3E5U A;  2B9S A;  3CCQ I;  2EZL A;  3ERE D;  2OC6 A;  1K78 B;  3GF2 A;  1QZY A;  2DQL A;  2M7A A;  3FXJ A;  1DP3 A;  5M5Y J;  2DDB A;  3DKW A;  3EET A;  2RVC A;  3W6J B;  1L3L A;  4EAT A;  3BR6 A;  2ZB9 A;  4LFU A;  2R5Y B;  4LG0 B;  4CCN A;  3W6K B;  4C2T A;  3L1P A;  3GX4 X;  2EA2 A;  2XRN A;  2KRF A;  1GXQ A;  1H9T A;  5HDG A;  3KYC B;  1QRY A;  5FKK A;  4OIN F;  1WQ2 A;  2WY8 Q;  3ZQC A;  1W0U A;  3N05 A;  1JXS A;  1HXD A;  3CC7 I;  3CD6 I;  3V7R A;  1JHF A;  2YR2 A;  1FMV A;  5FKO A;  4HNU A;  2LC2 A;  1T0F C;  1YJN I;  1A31 A;  3FZV A;  5IT3 A;  1K4T A;  3ZGK A;  2OV7 A;  1IRG A;  5CVJ A;  1OCO H;  1JKQ C;  4UUV A;  3KP4 A;  2LY2 A;  3GTJ J;  1I39 A;  5L3C A;  3FBI B;  4XNF A;  4BJ6 C;  2E1C A;  1DU6 A;  1QA6 A;  2ZSI B;  5EDN A;  4W97 A;  3IKT A;  2DK8 A;  4U87 A;  4ASN A;  2LYC A;  1TL8 A;  1YX3 A;  3OIO A;  5HDK A;  5DDG A;  1OPC A;  5IPA A;  2TRT A;  1Z1D A;  2A5Y B;  1RNL A;  1APL C;  4CH7 A;  4YRV A;  2LF8 A;  2KMU A;  1QPI A;  1ZGW A;  1BW6 A;  4HV5 A;  2FU4 A;  2JA8 J;  3A01 A;  3MZ8 A;  2GOM A;  1S6L A;  2EH3 A;  2XIG A;  4I6Z A;  3M8J A;  2K5C A;  1UHW A;  2QEX I;  3BG6 A;  3VPR A;  3H3Z A;  2B7E A;  3IWF A;  1IDZ A;  5LHG A;  5K5R A;  1X4O A;  3HTS B;  4E7L A;  3FWE A;  2P6T A;  4MTD A;  4PJM A;  1UG0 A;  5HLG A;  3OYA A;  4AM3 A;  3SHF A;  3TDU C;  5TRD A;  2WTE A;  1QGP A;  4B3X A;  1OR7 C;  3ZQH A;  2KIU A;  3CCE I;  1TW2 A;  2HKO A;  3EUH A;  1TLH B;  2QSG X;  3RDI A;  1Z0X A;  1ZHF A;  1Z7U A;  2MD0 A;  1E3P A;  2EIL H;  3M1E A;  2Q8K A;  4CDG A;  1YJ9 I;  3HRS A;  1HBX G;  3BG3 A;  2E35 A;  3GLL A;  3IH4 A;  3OY9 A;  2HKX A;  4HPQ A;  1QPM A;  3K2A A;  2RGV A;  4AIH A;  3ZMD A;  4HF2 A;  2CUJ A;  3PL8 A;  1FEX A;  2COM A;  1U0J A;  4LIV A;  3CMA I;  2W48 A;  4CZC A;  1D0X A;  4DGW B;  3ABU A;  1XGO A;  3K6G A;  4PGG A;  2E7W A;  1T08 B;  2K4B A;  1ZH5 A;  1ETV A;  1GV5 A;  4ZYE A;  3V8L A;  1FIA A;  5JVT A;  2Z9O A;  1FIP A;  4B43 A;  3VYT B;  2JA2 A;  3OOU A;  2W85 A;  4IOC F;  3CCY A;  4Y13 A;  4L5I A;  2VPR A;  3CF5 F;  4G7H F;  1WSU A;  2K9S A;  3KEO A;  1S7O A;  1V5G A;  3D5S C;  2QF7 A;  3OR1 C;  5LGN A;  2OQR A;  4PCQ A;  2LNB A;  5D5X B;  5LLQ A;  2XGE A;  1YOV B;  1JUS A;  3QPL A;  3RQI A;  1H88 C;  1LB2 A;  2PBI A;  5CQE A;  4LMY A;  4PUS A;  1HSJ A;  4II3 A;  1KYZ A;  4IHS A;  4A3K J;  4KDP A;  2L3D A;  4O3M A;  2F5V A;  3ISP A;  3RQ4 A;  2CG4 A;  3L2Q A;  5H6R A;  4RGR A;  3VOD A;  4ZTF A;  3MMY B;  2ESN A;  3PNY A;  3PFY A;  2CQQ A;  1F1Z A;  1FSH A;  2DYS H;  1KU9 A;  3S2H J;  2CO5 A;  5C3E J;  4QTR A;  3WU2 C;  4RB1 A;  2J5P A;  1G3S A;  2QSF X;  2LY9 A;  2VOD A;  4QPO A;  1Z91 A;  2FE3 A;  4CYD A;  2M34 A;  3I59 A;  2OQG A;  2F4M B;  3DTE A;  3HM5 A;  2MLK A;  2PMH A;  3PUB A;  3TP3 A;  2ZJQ F;  1MGT A;  3RKW A;  1V5F A;  2DMN A;  2L02 A;  2X48 A;  1U78 A;  3PSI A;  2I8D A;  3F0C A;  4RAF A;  2WB1 N;  4XN3 A;  1D1A A;  1FX7 A;  2UWM A;  2P6S A;  4LLN A;  1BOB A;  2MLG A;  2P7V B;  3BZ6 A;  1ZG5 A;  1R5G A;  6PAX A;  4BUP A;  5IOY A;  4D1Q A;  2XUB A;  2O61 A;  1WI9 A;  1OYI A;  3RPQ A;  2ZC2 A;  2GWR A;  2DJI A;  1IZ1 A;  2EFO A;  3MZY A;  2K27 A;  2LR8 A;  3HKZ N;  4GFB A;  4OOI A;  2VIX A;  3SJM A;  2TDX A;  1TWG J;  2CQX A;  3KLN A;  1OCC H;  2M30 A;  2I5U A;  4A5M A;  4E7H A;  3KE2 A;  1YI2 I;  1T95 A;  1T38 A;  3H35 A;  4HDU A;  3RCO A;  1EH6 A;  3BT9 A;  3HHG A;  3CLQ A;  3K69 A;  5HLT A;  2OTJ I;  2ZXJ A;  4HA8 A;  1SAU A;  3ASO H;  3B73 A;  4II2 A;  2MD5 A;  4LK0 F;  5FRN A;  1O7F A;  1J09 A;  3UR3 C;  1ZTR A;  5F0C A;  2HVS A;  5FLX K;  2WY7 Q;  3AG2 H;  2QLZ A;  4MQV A;  3HPH A;  3F8B A;  3V4G A;  1U6G A;  3DFG A;  3TL4 X;  1MSE C;  3BZC A;  3KP3 A;  4B3A A;  3KP6 A;  2O8X A;  2P8T A;  2G0E A;  3V8K A;  3WTT C;  3LST A;  1RZ4 A;  2EZH A;  3WG7 H;  2Z33 A;  3FXL A;  3K4J A;  5FFX A;  2CFX A;  1R7J A;  1IXS B;  2K3F A;  3B6C A;  4I76 A;  1Z05 A;  1OCP A;  1FOX A;  2Q2E A;  3QPT A;  5EEH A;  2DO7 A;  1OMI A;  2E71 A;  3NEU A;  3RZD J;  2RAE A;  1WPK A;  1AKH B;  2VBZ A;  4NC8 A;  2QKM B;  3FIS A;  3HRM A;  2ZKZ A;  3JSO A;  1R00 A;  1IN8 A;  1MSF C;  5IYB J;  2ELK A;  4FX4 A;  5GAH J;  3M3Y J;  1V3F A;  5J6X A;  3LWF A;  4GYI A;  4A3B J;  2CFO A;  3L2C A;  1JKO C;  1TC3 C;  4LG3 A;  2KZV A;  2P5K A;  2IA0 A;  3BC8 A;  3HL2 A;  3DPT A;  1TP4 A;  2E2J J;  2ELJ A;  2VQL A;  3FK6 A;  2F5F A;  1IF1 A;  4EEF G;  5FO5 A;  4P5O A;  2VN2 A;  4IKF A;  2P5V A;  4Y17 A;  4B4C A;  4RGX A;  3RIR A;  3VWB A;  3HTU A;  2R5Z B;  4WXD A;  5KCM A;  2DMP A;  3ZMV A;  2EZI A;  1LQ1 A;  3A02 A;  5BS6 A;  2JVG A;  5JR3 A;  4BNC A;  4EV0 A;  2WB1 A;  3BTL A;  3R61 A;  1ACI A;  4BDY A;  2OZU A;  1G2H A;  2CQN A;  3O2P E;  4N4O B;  3JR9 A;  4F7Z A;  1DGW Y;  1ZR2 A;  2MYS A;  2CUF A;  3RPU D;  1FYK A;  4S0H B;  2WAQ A;  5HDN A;  3GTP J;  4AID A;  5FRO A;  4XRS A;  1W7P B;  4HX7 A;  2R7U A;  1WJ5 A;  2ZFW A;  4D7M A;  1LEA A;  1FJL A;  2LF7 A;  2K9Q A;  4GRI A;  2C6Y A;  4RBO A;  3CCR I;  2A07 F;  3I5U A;  4A3G J;  4I01 A;  3AG1 H;  1VQ6 I;  5GPA A;  1FSE A;  2VBW A;  2X0L A;  3C18 A;  4LD5 A;  2CRG A;  2IPQ X;  2VJ4 A;  4ZYD A;  1VQK I;  4U0Y A;  1ORK A;  1FMW A;  4B09 A;  2DT6 A;  4UY8 I;  2UUZ A;  4BL0 B;  3KEQ A;  3LL7 A;  4XON A;  1ENH A;  2MAB A;  2M45 A;  2BGC A;  5EGO B;  2H09 A;  5L3G A;  3FMS A;  3H0G J;  5LFA A;  4E7J A;  1XSD A;  2EWN A;  1MNE A;  3DF8 A;  5KAI C;  3OYB A;  1JT0 A;  5F0F A;  4RAG A;  2V9K A;  4OIO F;  1O3Q A;  3HSF A;  1Y0N A;  4CXF A;  1SVL A;  1X3U A;  2HOT A;  1FYL A;  4XLH A;  5LHI A;  3K9T A;  2FML A;  1WJD A;  2DXI A;  1BBY A;  2VJI A;  5HOD A;  2IBD A;  2Y9Z A;  3F6O A;  5FKM A;  2JMW A;  3HSE A;  4FAS D;  1JJ8 C;  5EZH A;  3L2W A;  3ZP5 A;  4P1W A;  4B47 A;  4KIS A;  2VL8 A;  2J5O A;  5B1A H;  2OD5 A;  4ESF A;  2F4O B;  4RS8 A;  1OLT A;  2DA3 A;  1I6H J;  4IRH A;  4DBQ A;  2L9N A;  4PJN A;  3M07 A;  3F8C A;  2UXN A;  5EYR A;  4G8X A;  1HDD C;  4OIR F;  4BEH B;  1OYY A;  4RB3 C;  4M9Z A;  1JKR C;  1TQI A;  1Y6I A;  3LSJ A;  4BHP A;  4JX6 A;  3SEZ A;  4IF4 A;  2Z99 A;  4F92 B;  5DD4 A;  1W1W E;  3FBN B;  2OPT A;  3KP7 A;  4YG2 F;  2O03 A;  2FSW A;  2F5E A;  2FRH A;  3K4K A;  4M72 A;  1BN5 A;  3OYK A;  1VQ5 I;  4ENJ A;  4E70 A;  3QP5 A;  1J7K A;  4HDV A;  3F8M A;  2DA5 A;  3QPH A;  2WAE A;  5JVG F;  1PUE E;  1ON1 A;  1T0F A;  2NXN B;  1U9O A;  3EYI A;  2LH9 A;  4CA0 A;  3SFZ A;  1W5T A;  5E3O A;  5IT9 K;  1D5V A;  3FX3 A;  4UB6 C;  1MMN A;  1VZ0 A;  4HX8 A;  4ESB A;  3BOQ A;  1G3Y A;  5FFZ A;  4XRF A;  1YIO A;  2OA4 A;  3WGH A;  5F1R A;  3G71 I;  2MW8 A;  2Y75 A;  4HLY A;  1ZYR F;  1IUY A;  4C3I J;  3FXO A;  4IHT A;  3I58 A;  2VKV A;  4E7K A;  4KMU X;  5JHU A;  5K1Y A;  4AIK A;  4N0B A;  3BJ6 A;  2Y48 A;  1WZ2 A;  1WI3 A;  2DN0 A;  3OSG A;  3GBG A;  3S17 J;  2EA4 A;  5A2Q Z;  4LGW A;  1Y39 A;  1SFE A;  5J4Y A;  3OIP A;  1WCM J;  1Z9C A;  2UXX A;  1GVJ A;  3GYH X;  1YQA A;  5EEG A;  3JTH A;  4FIS A;  3SZT A;  5JI6 A;  4BU2 A;  3TP0 A;  2ZXH A;  3D1N I;  4IL6 C;  1HCR A;  2EV0 A;  1KQ0 A;  3DCF A;  4V2G A;  3O3K A;  4NBQ A;  1UB9 A;  3ZOB A;  4I98 B;  4HNT A;  3U9G A;  1AU7 A;  3F72 A;  2UV1 A;  2HS5 A;  2P4W A;  4JQF A;  4Q5S F;  5GTH C;  2R92 J;  4PGH A;  2NVT J;  4A3L J;  1K6O A;  1YW8 A;  2L7K A;  2MSY A;  2VE9 A;  1J75 A;  3C2G A;  1VF9 A;  1N75 A;  3M4O J;  4WK8 F;  2BY2 A;  2V6C A;  4A5N A;  1TNS A;  4ENN A;  1T33 A;  1YS7 A;  2VKE A;  3BJO A;  3BQZ A;  1XB4 A;  2FOK A;  2HQA A;  4F3Q A;  2VOO A;  3FIW A;  2IGO A;  1IN7 A;  1IXR C;  1CQT A;  3MKW B;  4AVP A;  1J9I A;  2G9W A;  1G3W A;  3OIQ A;  1FNN A;  2E5N A;  2HQR A;  5B66 C;  4CUG A;  3QYF A;  4QIW N;  3GUD A;  3T8R A;  5F64 A;  3HGY A;  4RB0 A;  2R7X A;  1A5J A;  2KIQ A;  3FMQ A;  2YPR A;  3A1Y A;  1J5Y A;  4L9T A;  3GTO J;  1GUU A;  4MTE A;  5H6Q A;  1PYV A;  4KJZ A;  2KKO A;  3GCM A;  3JTG A;  4BEH A;  2R7T A;  2BY0 A;  5B3S H;  3OYM A;  4A0Y A;  3M8F A;  1STZ A;  2PLY A;  5GAG J;  3DKX A;  2HZT A;  3Q9S A;  2K9N A;  1D8K A;  2YS9 A;  4LK1 F;  5M3M J;  5EZG A;  3ZQL A;  4JX5 A;  1SEU A;  3M9A A;  2AXL A;  4FCY A;  1K4S A;  2W84 A;  2A3S A;  2FUG 2;  3TQN A;  2VUM J;  2MH9 A;  1P7I A;  2QM3 A;  3MKZ A;  1QU3 A;  4NC6 A;  3LAJ A;  5TJJ A;  1G6N A;  2PMZ N;  4UV8 A;  3CQZ J;  3HJE A;  4C3J J;  3OV8 A;  1ZAO A;  2FX0 A;  2VC1 A;  4MFD A;  4O5V A;  4GYG A;  1P4W A;  2RDP A;  1R49 A;  2VXZ A;  5K7H A;  2E1M B;  4M9S A;  4M3F A;  5HS8 A;  4KNY A;  1J2X A;  3BCA A;  3ABL H;  3H5A A;  3U1D A;  4F55 A;  3L2U A;  4BKX A;  5K7F A;  1S72 I;  4IZZ A;  2HVR A;  2H6C A;  5D5W B;  1LNW A;  1YE9 A;  2A68 F;  1VQO I;  2YX4 A;  2JUC A;  2EIN H;  3TW6 A;  3REO A;  1ZQ3 P;  1RC9 A;  4PFP A;  2Y0M A;  5E8G A;  3GME A;  3MQ0 A;  3HOT A;  4YEL A;  4AU7 A;  4WX9 A;  1SAN A;  1C0W A;  1ETQ A;  3TO9 A;  1JGS A;  4I09 A;  1KON A;  2DJN A;  5GAE J;  1MH4 A;  2WAF A;  2JTV A;  1B1B A;  1Z21 A;  2ZJR F;  1D5Y A;  1ZRC A;  3P9K A;  1FWZ A;  2XDV A;  5FKN A;  2Y2Z A;  1R5I D;  1ZG3 A;  3L09 A;  3J7Y J;  1S3J A;  3KPH A;  4KA4 A;  2QCO A;  1YX5 A;  3TOA A;  2O7O A;  3JRF A;  1WH5 A;  3QOD A;  5LGU A;  3LA2 A;  2STW A;  3OL3 A;  3CJT B;  4WXC A;  3AKZ A;  2XAH A;  2EV5 A;  2D45 A;  5D5U B;  3PJR A;  1O7L A;  5BOX A;  2LOO A;  5FLM J;  2G7H A;  3PIP F;  1S9H A;  3KZZ A;  4G6Q A;  5D5V B;  2QGU A;  2DFI A;  5TIS C;  4XN0 A;  3L7W A;  2HEO A;  2K7L A;  1O3S A;  5ED4 A;  4D5C A;  4NQW A;  5E18 F;  3CMY A;  3CCL I;  1XMA A;  2GXG A;  5DM6 F;  2ZJP F;  2X51 A;  1JGG A;  1YW7 A;  3E6B A;  1VQL I;  2X9D A;  4HOB A;  1KGS A;  4ZDL A;  1RET A;  5DYM A;  2HYF A;  1GT0 C;  1EA3 A;  4IHY A;  2LTP A;  2DYR H;  2HXI A;  4RAZ A;  4UV9 A;  4BXF A;  4KN4 X;  3CC2 I;  1BI0 A;  3OL4 A;  2BVM A;  2IAI A;  1HA8 A;  5K5O A;  1U9N A;  2NS8 A;  4G9Y A;  5HLI A;  3ULQ B;  4OIQ F;  4M3B A;  1TWH J;  2CU7 A;  4KT6 A;  4L9J A;  3FK7 A;  4HF1 A;  1FC3 A;  5DUK A;  1IV6 A;  3NAU A;  5EG0 B;  4L18 B;  5AIQ A;  1WHU A;  1U5T A;  4V2F A;  3BPV A;  5FRM A;  2GA1 A;  3SZG A;  3I3L A;  2X1D A;  1R4M B;  1O3R A;  1MMD A;  4KYW A;  4EJO A;  4IOA F;  1DQU A;  1QNT A;  3VSK A;  3H9J A;  2LKX A;  3PNT A;  2DA4 A;  1ZR4 A;  3CP8 A;  2O9L A;  1OCT C;  3WU0 A;  4DW6 A;  3J7A Y;  3HGG A;  2O5R A;  2AQF A;  2JA7 J;  4ZJZ A;  2QA4 I;  2ZBK A;  1BC7 C;  4PFO A;  3DU6 A;  3I53 A;  5FGM A;  2DTR A;  3SEQ A;  2V9P A;  3FHZ A;  4UB8 C;  3QU6 A;  3DEE A;  1ZRD A;  2IGM A;  3FF5 A;  2WAD A;  3IAS 2;  1RKT A;  4YIR X;  4Z6Y A;  3K10 A;  4U7B A;  4RA2 A;  1LEB A;  3VYR B;  4BE1 A;  3K1P A;  4KIG A;  4XOP A;  5DUI A;  1OCZ H;  1OYW A;  2XSD C;  2QQ9 A;  3I54 A;  4HSR A;  3HOX J;  2P0W A;  1G4D A;  3LA3 A;  1WGX A;  5TGT A;  1DDN A;  1K61 A;  2ZCW A;  5IP6 A;  2DA1 A;  3S16 J;  1MJ9 A;  2Q1Z B;  1MND A;  5EG0 A;  4BXU A;  5D4S A;  4FE4 A;  1MJB A;  1Z77 A;  2EBI A;  3OYE A;  1E3O C;  1KQ8 A;  4HQM A;  3IRR A;  2JZY A;  4YIF A;  2GXA A;  4L0Y B;  3I59 B;  1MZB A;  3GZN B;  3QP6 A;  3GVA A;  1HQC A;  4D9J A;  4Q47 A;  1FOK A;  3ZRG A;  2XAG A;  2BHY A;  1S7E A;  1Y56 A;  2CW7 A;  3FKI J;  1N25 A;  1U5T C;  3N4M A;  3CDL A;  4NNJ A;  2YU9 J;  4NHJ A;  4LOC A;  5DM7 F;  1BR1 A;  2Y31 A;  3HB9 A;  3ZMU A;  4BAY A;  1BI3 A;  4BQN A;  2XAU A;  5D6F A;  1FY7 A;  1XSV A;  3QWL A;  1LDK B;  4CYC A;  1WH7 A;  2IS1 A;  3S1N J;  5DCM A;  2PJR A;  4L9N A;  1LUJ B;  2VKD A;  2R7R A;  4XLC A;  4HRI A;  2K4J A;  3T8T A;  4D7N A;  1D3Y A;  2DDA A;  1QHG A;  2R7S A;  3OYH A;  5BPI A;  2HI3 A;  2DA7 A;  3S3O A;  2OAZ A;  3EUH C;  5IY5 H;  1VQ7 I;  1XGS A;  5FB2 A;  3Q5F A;  3CCJ I;  4L5E A;  2W1O A;  5H20 A;  3CES A;  2BEO A;  1S29 A;  3H9Q A;  1KQ9 A;  1HOM A;  3S1M J;  5AON A;  3GTQ J;  4LIT A;  1PJR A;  2V79 A;  4XLN F;  2PMZ A;  3DPL C;  3TOB A;  4DNC A;  1P7J A;  4BH9 A;  3PIO F;  1YFH A;  4A3M J;  2R0Q C;  2XF5 A;  4A3D J;  4AYB A;  2L0K A;  2DT5 A;  2DPD A;  5JFR A;  3IH2 A;  2I10 A;  4IVN A;  2ECC A;  4IO9 F;  4ZDO A;  3GW2 A;  2KP6 A;  1VTN C;  2VJ5 A;  1R23 A;  3D5R C;  2ZXW H;  1PVE A;  1PUF B;  2RKH A;  1DU0 A;  1BL0 A;  2OJE D;  2DA6 A;  5J47 A;  1O3T A;  3G73 A;  3GZ5 A;  3KZY A;  4ESJ A;  4H4K C;  2XHK A;  3L2V A;  4R8H A;  3DV8 A;  1Y1W J;  1GHC A;  4LLG F;  1R22 A;  2OZ6 A;  2VC0 A;  3OYI A;  4EJW A;  3CCU I;  4EMS A;  2HOA A;  4JOM A;  4R79 A;  1UFM A;  4J00 A;  5J3L A;  1NK2 P;  2ID3 A;  3HHH A;  3S32 A;  3LSR A;  4IHX A;  2L54 A;  2X85 A;  1AWC A;  3H9G A;  4IRG A;  1H8A C;  2O0Y A;  2K9L A;  3PO3 J;  4G6D A;  2VXD A;  4LB6 B;  4AD9 A;  4HAM A;  2VB6 A;  4IQJ A;  3WOD F;  4QSH A;  2K3P A;  2UZK A;  3ABM H;  3M7G A;  2ME6 A;  4IPA A;  2R5Y A;  2M5W A;  2QZ8 A;  1JTY A;  3FXR A;  3J81 Z;  5ILU A;  2D1H A;  1X1B A;  1SD7 A;  4AYB N;  1DP7 P;  3I0T A;  1FT9 A;  2EIM H;  2Y30 A;  3DPU A;  2R93 J;  1WRJ A;  3A03 A;  4XKV A;  5L3E A;  3LFU A;  1FZP B;  1XX5 A;  2ZSH B;  3VFZ A;  3SQN A;  4BY1 J;  1S5L C;  4BE0 A;  2QWW A;  2A6H F;  3L00 A;  1HF0 A;  1CGP A;  3ZCO A;  4A6E A;  1IGN A;  3MAJ A;  4YII A;  5DCF A;  5FD5 A;  4KFC A;  3CTA A;  3K0L A;  1ZK8 A;  1V54 H;  3EDP A;  1RKW A;  5E3L A;  1SD4 A;  4DYR A;  4WCG A;  1ITY A;  3NAR A;  3CJN A;  3IC7 A;  4Y52 J;  3S15 J;  1XS9 A;  2H1L A;  5DD8 A;  3OYD A;  3TKY A;  3E7L A;  2GA2 A;  3JRE A;  4BYY A;  1EH7 A;  5LRS A;  2CV1 A;  1YTY A;  1DPU A;  3IV5 A;  4M9X A;  5BMZ A;  1RR7 A;  4DBR A;  5L3F A;  1OCR H;  1SFK A;  4F93 B;  1SC7 A;  3VB2 A;  1ZG1 A;  3TGN A;  3M8E A;  1P2F A;  2L9V A;  4FQG A;  1MDM B;  1FBS A;  3HSR A;  2NVU B;  3MKY B;  2H94 A;  3OOP A;  1AA7 A;  4ITV A;  2JA6 J;  3HRT A;  3GFL A;  1WFX A;  2R7V A;  4ZYH A;  2PJR B;  4EJU A;  4ABZ A;  3GFJ A;  4CYC B;  4WWC A;  2V4J C;  2WAQ N;  3DEW A;  3OS1 A;  3X2Q H;  3I71 A;  3IHU A;  1IC8 A;  1R9T J;  3FXU A;  4CSW A;  3J7Z I;  3AAF A;  1CF7 B;  2AS5 F;  4BY7 J;  4XKC A;  9ANT A;  3T1B A;  1D1B A;  2BW3 B;  3TBI A;  4NQW B;  3DU5 A;  1XC5 A;  1GV2 A;  2GIZ A;  2LRD A;  3WTU C;  5J40 A;  2FXA A;  4U7D A;  1IV8 A;  4OU0 A;  1DGR M;  3FKJ A;  2LSO A;  2XPW A;  2NAZ A;  3HEF A;  1KA8 A;  3BTI A;  1W36 D;  3BRO A;  2FQ3 A;  5LGT A;  2WA0 A;  2VLA A;  2P7C B;  1VQ8 I;  2LRE A;  1XGN A;  3HG9 A;  3Q9V A;  3HOZ J;  1J0R A;  2DT7 B;  5CVV A;  4EJV A;  3SDG A;  2CV0 A;  1T98 A;  2X4H A;  1TW3 A;  4I0B A;  1R1U A;  4A0X A;  2GZW A;  1ETX A;  3U1K A;  3QU3 A;  3T5X A; 
#chains in the Genus database with same CATH homology
 4XMY A;  3RTR A;  3W2A A;  2CV2 A;  2L7K A;  1FMV A;  4HNU A;  2JVH A;  2LC2 A;  1T0F C;  3C2G A;  1N75 A;  3HKZ A;  3HUG B;  3OYC A;  3CMM A;  2A5W A;  2LBF A;  3ZGK A;  2OV7 A;  4F3Q A;  2HQA A;  4ZC3 A;  2BVL A;  2IGO A;  3MKW B;  1Z7L A;  2LY2 A;  3K4N A;  4PSW A;  3M1C A;  3FBI B;  3OIQ A;  2E5N A;  4XNF A;  4BJ6 C;  4RLF A;  3QYF A;  4CUG A;  2X1E A;  2ZSI B;  1QHH D;  2XSJ C;  2R7X A;  2M0M A;  3A1Y A;  2M3A A;  4U87 A;  2LYC A;  3VYS B;  1YX3 A;  4BQO A;  2M7B A;  4ANJ A;  2CW8 A;  1PYV A;  4KJZ A;  2ZXI A;  2R4G A;  4BEH A;  4PJL A;  2IGK A;  2VQG A;  4CH7 A;  4DJA A;  3OYM A;  3S3N A;  1N77 A;  4YRV A;  1WJA A;  2KMU A;  3FDY A;  2VPL A;  3DKX A;  4AVZ A;  2E60 A;  3NWT A;  2GOM A;  3DTI A;  4C9Y A;  3M8J A;  2K5C A;  3I9V 2;  2RNG A;  3BG6 A;  3OYG A;  1WJC A;  2FUG 2;  3A2K A;  2Q2E B;  3MKZ A;  2HPM A;  1X4O A;  1QU3 A;  4E7L A;  4HEA 2;  4PJM A;  1UG0 A;  2VKH A;  3OYA A;  3DWL E;  4B3X A;  2JUG A;  1OR7 C;  5LD2 C;  3D5L A;  3NWS A;  1MW7 A;  4G6T B;  3HPG A;  2XC7 A;  2X6W A;  2IS4 A;  2HPI A;  2X6X A;  4CCJ A;  2MD0 A;  2KPM A;  2VJJ A;  1ERD A;  2VXZ A;  3OY9 A;  2E1M B;  4HPQ A;  4IQ4 A;  3QYB A;  3KEY A;  2W00 A;  2L2O A;  3BCA A;  2K9M A;  2CUJ A;  3H5A A;  1Z3X A;  3PL8 A;  1U0J A;  4F55 A;  3L2U A;  4IZZ A;  2HVR A;  4LIV A;  5JHF A;  4CZC A;  1D0X A;  3K4L A;  1YE9 A;  4DGW B;  3K6G A;  4PK4 A;  4F91 B;  4PFP A;  3HOT A;  4YEL A;  4AU7 A;  2F4I A;  2MC4 A;  4BGD A;  1KON A;  4N4N B;  1N78 A;  4B43 A;  2WAF A;  3VYT B;  2JA2 A;  1Z21 A;  3OOU A;  3ZR8 X;  4XKB A;  3LSK A;  2GOX B;  4DOZ A;  1G8X A;  2XDV A;  1V5G A;  3D5S C;  3OR1 C;  1LKX A;  3EUA A;  1YX5 A;  3LSM A;  2DCE A;  3QOD A;  4BS9 A;  3PSF A;  5CQE A;  4MLO A;  3OYJ A;  4PUS A;  3H0D A;  3OL3 A;  4Y33 A;  3AKZ A;  4II3 A;  3SYT A;  3PJR A;  2LOO A;  2F5V A;  2NOJ B;  1S9H A;  1X1C A;  3RQ4 A;  3L2Q A;  4ZTF A;  3MMY B;  3PNY A;  4XN0 A;  2L5Q A;  3QYE A;  3PFY A;  4XLF A;  3PNV A;  3AL0 B;  3HXL A;  4QPO A;  3EPZ A;  4X0G A;  2X51 A;  1LFP A;  3DTE A;  4QPQ A;  4ZDL A;  1NG6 A;  3PUB A;  1EA3 A;  4OAZ A;  3EUK L;  3VYU B;  1V5F A;  4BXF A;  2AQE A;  3PSI A;  2I8D A;  2RQQ A;  3OL4 A;  1D0Y A;  2BVM A;  1D0Z A;  4XN3 A;  1HA8 A;  1D1A A;  2UWM A;  4DIQ A;  1BOB A;  4KT6 A;  4BUP A;  4D1Q A;  2X6Y A;  2Z1D A;  1UEL B;  2Z16 A;  2XF7 A;  5CPR B;  4C30 A;  5FRM A;  4E6K G;  3SZG A;  2CMP A;  3I3L A;  2DJI A;  2X1D A;  2CUZ A;  1P9Q C;  2R7T A;  2VIX A;  4YEJ A;  4HG2 A;  1MMD A;  2L9S A;  2R7W A;  1DQU A;  3VSK A;  3LMM A;  3H9J A;  3PNT A;  2MFZ A;  3CP8 A;  4E7H A;  3J7A Y;  4RMN A;  4Y4R A;  1T95 A;  2O5R A;  2AQF A;  3H35 A;  4OWR B;  3RCO A;  4ZJZ A;  4BDZ A;  4BJT A;  3OS2 A;  4PFO A;  3SDB A;  3DU6 A;  5HLT A;  4NC7 A;  3S8P A;  1UAA A;  3SEQ A;  1SAU A;  2VQC A;  4II2 A;  3DEE A;  2V26 A;  2IGM A;  5FRN A;  2WAD A;  3IAS 2;  1WJB A;  1J09 A;  3E0J B;  3FHN A;  3K10 A;  3UR3 C;  4PSX A;  4U7B A;  2HVS A;  3VYR B;  2R7Q A;  4NUB A;  4BE1 A;  2V7F A;  2VAS A;  2WY7 Q;  3HPH A;  4XOP A;  4B48 A;  3TL4 X;  3IAM 2;  3W3C A;  2LBF B;  3DTK A;  4HSR A;  2P0W A;  3DQV C;  1E0E A;  3ONQ A;  3F9K A;  5TGT A;  4BAC A;  4E7Z A;  4BE2 A;  2XF6 A;  2M4K A;  2DOA A;  2Q1Z B;  1MND A;  3K4J A;  3MD2 A;  3A4C A;  1JI8 A;  2F6C A;  3OYE A;  1K6Y A;  2A6T A;  2W82 A;  3OS0 A;  4XR6 A;  2QKL B;  2KQR A;  4NC8 A;  2QKM B;  5HOO A;  1LVK A;  3AFH A;  4D9J A;  4PJJ A;  5KHD A;  3W2V A;  3ZRG A;  2KDO A;  2OUM A;  4E7I A;  2CS3 A;  1Y56 A;  2CW7 A;  2Y0S A;  2KHM A;  3K70 D;  2CFO A;  2KLO A;  2HDW A;  4XQF A;  3OYL A;  3CJR B;  4LG3 A;  2KZV A;  3BC8 A;  3K4M A;  4NNJ A;  3HL2 A;  3DPT A;  3HOS A;  1BR1 A;  1R6R A;  2ELJ A;  3BLY A;  4BQN A;  2VQL A;  1BR2 A;  2XAU A;  3K70 C;  2HU9 A;  2CH0 A;  3DLA A;  1LDK B;  2E1M C;  4P5O A;  4IKF A;  2HZD A;  2JSP A;  2IS1 A;  1IRX A;  2PJR A;  3VWB A;  2VKD A;  2R7R A;  5KCM A;  4XLC A;  4HRI A;  3L2R A;  4XM3 A;  3CP2 A;  2IS6 A;  3KX2 A;  2JVG A;  1QHG A;  2M4G A;  3OYH A;  2R7S A;  3S3O A;  3LSI A;  4RM2 A;  2WB1 A;  3EUH C;  4ZYA A;  2RRE A;  4BDY A;  2W1O A;  4N4O B;  2BOL A;  3CES A;  3U21 A;  1DGW Y;  2KRC A;  4E4H A;  2MYS A;  3RPU D;  3H9Q A;  2IS2 A;  4Y3O A;  2WAQ A;  5FRO A;  3CF2 A;  4LIT A;  1PJR A;  1WJ5 A;  2R7U A;  2PMZ A;  3DPL C;  4C2U A;  2VQH A;  3UNG C;  4J01 A;  3S3M A;  1NG7 A;  2XF5 A;  4GRI A;  4AYB A;  3OMY A;  4CCK A;  3BCB A;  2WBM A;  2HVQ A;  2W4S A;  4RM3 A;  2VJ4 A;  4XLE A;  4ZDO A;  1V5E A;  1Z3Y A;  2KP6 A;  4ZDP A;  1FMW A;  2DT6 A;  2VJ5 A;  3D5R C;  5HNF A;  2UUZ A;  4BL0 B;  3VDX A;  3LL7 A;  4XON A;  1TZL A;  2MAB A;  3KYL A;  5LFA A;  4E7J A;  1MNE A;  2ZFU A;  3OYB A;  1X4P A;  2V9K A;  3K4B A;  4H4K C;  3L2V A;  4XOR A;  1GLN A;  4HST A;  3OYI A;  3AL0 C;  4XLH A;  4JOM A;  4R79 A;  1ZEL A;  4J00 A;  3S32 A;  2X85 A;  2LG4 A;  2Z2S B;  1WJD A;  3CJQ B;  2DXI A;  3H9G A;  2VJI A;  2K9L A;  2VXD A;  3OWT A;  4XKW A;  3QOE A;  2VB6 A;  4CCO A;  5CKT A;  4IQJ A;  4FAS D;  1MMG A;  2K3P A;  4E7S A;  3L2W A;  4P1W A;  3ZXS A;  4B47 A;  4KIS A;  3HC7 A;  2VL8 A;  1X1B A;  5KNL A;  1OLT A;  4DBQ A;  2L9N A;  4PJN A;  3DPU A;  4OAY A;  4XKV A;  3LFU A;  5HNH A;  4BEH B;  2ZSH B;  1Y6I A;  4BE0 A;  3IUO A;  2BW3 A;  4FET A;  4CCM A;  4CCL A;  5HVQ C;  3ZCO A;  3VSL A;  3SEZ A;  4XL9 A;  2KRH A;  4XOT A;  3ZQQ A;  1MMA A;  4F92 B;  3FBN B;  1X19 A;  4LIU A;  3C2H A;  3K4K A;  4BQQ A;  3OYK A;  3OYD A;  1W36 C;  1BR4 A;  5CQG A;  2WAE A;  3TMO A;  3RSN A;  2CV1 A;  3OR2 C;  4F52 A;  2LH9 A;  4DBR A;  3LSH A;  4CA0 A;  1SFK A;  4F93 B;  3DKY A;  4ZTJ A;  2LY1 A;  1MMN A;  1VZ0 A;  3BG7 A;  3CZ6 A;  3MKY B;  4XLA A;  3OYF A;  2IGN A;  1AA7 A;  2V1N A;  4ITV A;  1G59 A;  1WFX A;  1D1C A;  2R7V A;  2PJR B;  3K4C A;  2W7N A;  3S93 A;  1TT0 A;  3G2B A;  2V4J C;  4E7K A;  3OS1 A;  4CSW A;  3IP4 B;  2V6E A;  3GBG A;  4XKC A;  1X1A A;  4B44 A;  4KIT B;  1D1B A;  2X1C A;  2BW3 B;  3V42 A;  3W2W A;  3TBI A;  3OYN A;  1WJF A;  2KL4 A;  4NQW B;  3OIP A;  3DU5 A;  2LRD A;  1DGR M;  2OC6 A;  3FKJ A;  2IXS A;  1DP3 A;  2M7A A;  4BU2 A;  2E5Z A;  2ZXH A;  4RLQ A;  1W36 D;  4IX7 A;  4EAT A;  2WA0 A;  2VLA A;  2LRE A;  4CCN A;  3HG9 A;  3LSG A;  4C2T A;  2R7O A;  2DT7 B;  4BJ5 C;  4HNT A;  2CV0 A;  2HNH A;  2UV1 A;  4JQF A;  3H5N A;  3E1S A;  1WJE A;  2WY8 Q;  1X1D A;  3N05 A;  3H5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...