1S7OA

Crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYPHDEYLQEKISILTSIDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM
publication title Structure of the putative DNA-binding protein SP_1288 from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m3
molecule tags Structural genomics, unknown function
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7oA00
2VBXA 3LAPA 5KVRA 4RS8A 1PDNC 2VBZA 1YLFA 4ZYDA 1J5YA 2GXBA 2EFQA 2RVCA 3RTRA 3K69A 1HSJA 3ROUA 4AIHA 4JQFA 3K1MA 3WTXC 2VC1A 4A0XA 2EV0A 3NEUA 3K1NA 4U0VA 2ISZA 4K2EA 2L4MA 1J0RA 3GFIA 1STZA 1O7LA 2PI0A 3RKWA 3J81Z 3IL2A 2IVMA 4EJTA 4A0ZA 3TO7A 1TLHB 2HKXA 5DUKA 1XCVA 1PUEE 1QZZA 2ZJ2A 1ZG3A 4R8HA 1FBSA 3KE2A 3HOSA 4KIGA 2Y75A 3ML6A 4UV9A 5LGTA 4OIPF 2OAZA 1O3SA 1S3JA 3SZPA 5D5VB 4LG0A 2OA4A 5CVUA 3RKYA 2XAGA 2K02A 4HX8A 5DUIA 4ZYGA 1YYVA 3F23A 4OOIA 1L0OC 4RGRA 5L3DA 3M8EA 2FBKA 3PQKA 2UXNA 3KCCA 2OZ6A 5JFRA 1FNNA 4XLPF 3P9KA 3RDIA 1L3LA 1UHMA 2A3SA 1J2XA 2VXZA 4IPAA 4S04A 1OYWA 1ODDA 1QNTA 2EJRA 5E8IA 3DXJF 2FSWA 2Z99A 1TNTA 3FF5A 2HR3A 5HDGA 3IWZA 4OIRF 4AVPA 3ISPA 1X3UA 1ZGAA 5AIPA 5DEQA 4UXNA 4P55A 3HSEA 2MC3A 3ZN0A 4HLXA 4Y13A 3F22A 5E1WA 2M8EA 3H3ZA 4KFCA 5CVVA 4EJUA 2BEOA 5L3GA 5J8FA 5FLXZ 1EV7A 3EUHA 4R1HA 3QAHA 3KFWX 1RUOA 3ZMTA 1YS6A 4RAZA 5K5OA 3E5UA 1BI2A 3D0SA 3ZMUA 5FFXA 5D6EA 5HLIA 2FOKA 4Q4ZF 2DK5A 2Z5UA 1FY7A 1HW5A 1JHFA 1U5TC 3T8TA 5ED4A 4IHTA 1OPCA 1HXDA 4LB6B 3QRFF 4G94A 2DFIA 3K2ZA 1MJAA 2DPDA 2V6CA 4KN7X 4IVNA 1G3YA 2Z3YA 5HLGA 5D8KB 1RNLA 3K0LA 1B59A 3RKXA 4YFXF 3SFZA 3HRMA 1SD4A 4D0PA 5KK1A 3E5XA 4I09A 3N97A 3HHHA 3BOQA 2YX4A 1SD5A 5D5XB 4Q5SF 3JTGA 2QENA 1U8RA 1FC3A 3FM3A 1I1SA 2XVCA 3RYRA 4JK1X 3WE2A 1T39A 3NRVA 3WGIA 3ABUA 1FSHA 2DI3A 1H0MA 3E5QA 1RI7A 2DLLA 2OU2A 4BXUA 2A07F 2QBYB 2ZBKA 3DPTA 1HKSA 2P8TA 3BJAA 1WI9A 1P6RA 5CVJA 2PFBA 2BYVE 4M9SA 3FMSA 3HUGA 3ULQB 3GFJA 4O5VA 3IKVA 4P96A 2OD5A 3I0TA 4BYYA 2QYOA 3T5XA 3HRTA 3CLOA 1KQ0A 4EV0A 1XCBA 4LGWA 4RB0A 4U0WA 1OKRA 2P5VA 2YPRA 5DCMA 5CYVA 4M6XA 3L2CA 4UVCA 5F1RA 5L3EA 4WWCA 2XAHA 2RNJA 5FO5A 2IJLA 2QWWA 3FX3A 2IPQX 3ERED 2CSOA 1DPUA 5DD4A 4PZJA 3E6CC 2RQPA 2CG4A 1S29A 5ICFA 1G3TA 2KIFA 4HV5A 4A6EA 2IA2A 4CGZA 4GYGA 2RDPA 1P92A 3DF8A 1TNSA 4UNOA 2CWEA 4CXFA 5J6XA 3CO7C 1P2FA 3LFKA 4HA8A 1V4RA 3TOBA 2QQ9A 3M7GA 2GQQA 1O3RA 1IW7F 5J8CA 4OINF 3GWZA 5LBQA 2C6YA 5E18F 2M5WA 4IRHA 2P6TA 2NRAC 5LHIA 1TTYA 2YX7A 2J5PA 3SQNA 1GVJA 3V4GA 3EDPA 4U7BA 5LEJA 3D5LA 1LVAA 4F7ZA 1C0WA 1UHWA 3QU6A 3CUQA 1ZLJA 1FPQA 4FHTA 4ZYEA 2NYXA 4JBAA 4Q47A 5AIQA 2WWYA 3LSTA 1I6XA 4RB3C 3J81K 3W6KB 1B4AA 5K5RA 2H6CA 2G7HA 3DFGA 1IUYA 2EA4A 4WXHA 5BMZA 3HSRA 1W7PA 4HBLA 3V7CA 3U2RA 3F8CA 3BWGA 4GYIA 1XMAA 3H92A 4NHJA 2P7VB 3T8RA 4RB2C 4XSXF 3IHUA 2HQNA 2UZKA 1T38A 5H6QA 4G8XA 2A6HF 2P6SA 4HX7A 1IAWA 1GHCA 5LRSA 4ENKA 2Y0MA 2R7FA 3RPUA 5LRRA 4A6DA 5CVRA 1HQCA 3DPLC 4UUVA 3HRUA 2G9WA 1MZBA 4YIIA 2PQ8A 3KLNA 3JAMZ 3QP5A 2RGVA 1D8JA 2CFXA 1KQ8A 2WV0A 2BBYA 1FBUA 2FBHA 1BI1A 5BPDA 4LK1F 1T2KA 1MKMA 1ZH5A 3F8BA 2W57A 3ZMVA 4GO1A 3QPHA 1KYWA 4LJZF 1B9MA 4LG0B 1FYKA 4G9YA 2XKPA 1FYLA 5LHGA 2QQBA 2O3FA 2VT3A 2Q2EA 2DPUA 1ULYA 4A5MA 4UHTA 3F8FA 4N9HA 1K7AA 5ICGA 5FLXK 1T6SA 3F72A 1WSUA 1T0FA 2P5KA 3OOPA 4KNYA 5E20A 3BY6A 4ESBA 3WU0A 1T98A 3COAC 3CDHA 3NQOA 4ASNA 3FMRA 1R00A 1R36A 5ILVA 2D2WA 4PGGA 2EFPA 1LDJA 5LHHA 3LWFA 3P7NA 3EETA 1ZRFA 4FT8A 4KIBA 1YW7A 5F6FA 3DV8A 2W85A 3TO9A 1H9GA 3FMQA 2XASA 4BH9A 3MZYA 2F5EA 4G6QA 3GF2A 1J75A 2VBWA 4KA4A 1YW9A 4HDUA 4FX4A 3KZYA 3ZN1A 4P5OA 2STWA 1R22A 3HTUA 3VFZA 1TW3A 3ZPLA 1IXRC 1Z91A 1AWCA 1UFMA 4EM2A 3KEQA 5CJ9A 4HLYA 3MZHA 1ZGJA 4IJAA 5EEGA 1XMKA 4IHSA 3I5UA 1LDKB 3WTUC 1SFXA 2CO5A 5ERIA 3KP5A 2FQ3A 4WXCA 1B1BA 4MQ9F 4ENNA 3S2WA 3VEPA 1KGSA 3R0JA 4AD9A 2PN6A 1G6NA 4EJVA 1XDUA 4TV7A 2E7WA 1PP8F 2MLGA 1XB4A 2W25A 4IRIA 4LLLA 3JSOA 4HYEA 4A2UA 1QZYA 4HF2A 1WKMA 2F5FA 4IF4A 4RGXA 3I53A 2VOPA 1Z1DA 3KP3A 1W5SA 3WG9A 1A04A 2VODA 1ZYRF 3P9IA 2RC4A 3ECOA 1Q1HA 4KIFA 3CUOA 1G3SA 1R23A 3ZP5A 2KJCA 1FP2A 4YG2F 5L3CA 5ICCA 2VONA 4LFUA 2UWMA 2JPCA 2YU3A 1HBXG 4RGUA 2R3SA 5D4SA 4CHUA 1S7AA 5HLHA 2OQRA 2G7UA 4LB5A 1IXSB 3FXQA 1OMIA 2HDCA 1IRFA 2EFNA 2ETHA 2FNPA 2XIGA 2H94A 3Q5FA 3V8JA 4HZFA 1EH7A 4MEYF 4KYWA 2KIUA 1QPMA 4FX0A 4ZH4F 4KMUX 5DCMB 3E3VA 2X4HA 4BHCA 4HAMA 5IT9Z 3GXOA 1KQ9A 1RIOH 4AIKA 2ZO4A 3BPVA 1Z6TA 4H0EA 2H6BA 4EQQA 3BZ6A 4I98B 5JHUA 2KIMA 5ICEA 1P4WA 2M45A 1AOYA 3C1DA 3SZTA 4MTDA 1I1GA 1YQAA 2B0LA 1YFHA 2QQAA 2EB7A 4HDVA 2AS5F 2ZMEB 4KMFA 4EMSA 4KDPA 1YG2A 4NB5A 2IP2A 5HVQC 1FOKA 3I54A 5L3FA 2XRNA 4CO8A 3LA3A 2K27A 2VE8A 3HRSA 1FBQA 2DTRA 4L5JA 4U7DA 2L4AA 2O0YA 3TKYA 1R5GA 1F5TA 2FF4A 2D1VA 4I0AA 5D6FA 1XD7A 4AWXB 2W84A 1ZHFA 3FM5A 1OYYA 3PQJA 2XAJA 2BGCA 4G7HF 3CUQB 2FXAA 4M9ZA 2P7CB 4S05A 3JAMK 3W6JB 5LGUA 3SXYA 5H20A 1SFEA 3TQNA 2VE9A 1SAXA 2K4BA 3MWMA 1FWZA 1W7PB 4U88A 3F6VA 2KRFA 3GW2A 2RV8A 2MD5A 2ZKZA 1IXCA 2HWVA 3CJNA 2O8XA 5HS8A 3I4PA 5K1YA 1BIBA 3GVAA 2HS5A 1Z9CA 3L9FA 1IN5A 1I5ZA 2UXXA 2VOOA 4A0YA 4QWQA 4L9TA 1TW2A 3M9AA 4Y15A 4L18B 2FEZA 3FXUA 4WCGA 1S8NA 3GLXA 2FMLA 5FB2A 1GXPA 3GEZA 3GFMA 4UV8A 3EQLF 2FNAA 5D4RA 2F2EA 2LKPA 1IN4A 4GCVA 5DDGA 2RKHA 3BROA 4RB1A 2ZMEA 1KU2A 3R6SA 2COMA 3KP6A 1ZRDA 3KP7A 2QUFA 3VODA 2JTVA 3LQQA 2L01A 4I01A 1USTA 1RUNA 5CVIA 1G4DA 3ZMDA 3F8NA 3AAFA 1O7FA 3FWEA 1U2WA 4LLGF 1DPRA 3GFLA 1BI0A 1R7JA 4WK8F 2NNNA 4CYDA 1S6LA 3Q9VA 3E6DA 2DBBA 4ON0A 2EV6A 3KZZA 1UB9A 3QPTA 1OR7A 4MTEA 3V7SA 3WODF 2V79A 2FA5A 3CTAA 3HHGA 1TQIA 5TJJA 1O3QA 5ILUA 2V1DA 3I58A 3ZQ7A 1YO5C 2IT0A 4P9UA 2IA0A 3H3UA 3GZ6A 2FMYA 5DV5A 5D8LB 3LA2A 3B73A 3WE3A 1WQ2A 1ZG5A 2HEOA 2FRHA 1KU3A 3HYIA 3R0AA 1LEAA 3K9TA 3HSFA 1U78A 3J80Z 3I71A 3WTTC 2EFOA 1HW1A 5JI6A 2VN2A 2D45A 3MQ0A 2PMHA 4I2OA 1K6OA 4L9NA 1EH6A 2ZXJA 2KKOA 2LNBA 5HDNA 1IZ1A 1MJBA 3LAJA 1PP7U 1F4KA 3ELKA 1ZREA 1NHAA 3KP2A 4Z2YA 1DP7P 2EK5A 4L9JA 1XSXA 2ESNA 3L00A 1FP1D 2H27A 1QGPA 2A68F 5E17F 1O3TA 1H9TA 1K78A 4HQEA 2JRTA 2IW5A 1TBXA 4HOBA 4M73A 4B09A 1BI3A 4YIFA 3WU1B 1HKQA 1YW8A 3F21A 2V1UA 1SMTA 4EVIA 1MGTA 2M87A 3IKTA 5BPIA 1BM9A 4WXDA 1OYIA 5TRDA 3GUDA 2VC0A 3FHZA 2LSOA 4U0YA 2ZCWA 3HIFA 3BJOA 3MCZA 3ECHA 3QP6A 2Y48A 4HF1A 4MNUA 2DQLA 3DEUA 2Q8KA 5FFZA 1HKTA 2XROA 3GO5A 1U3EM 5IT9K 2ADUA 3RJPA 1ZAOA 4XSZF 2EFWA 5BS6A 1FT9A 3L7WA 1E17A 4YFKF 3RI4A 1XGSA 5HDKA 3GX4X 4N9IA 4P9FA 1O57A 2K7LA 1JXSA 1WRJA 1SFUA 4ETSA 4MQVA 1R1TA 2GA2A 3R61A 1MDMB 5BOXA 3WTWC 1KA8A 1REPC 2JZYA 3RIRA 2PMUA 3WTZA 3VB2A 2BE5F 3BDDA 4L0YB 4Y17A 1IN7A 2P5LC 1IF1A 1FZPB 2OBPA 5FD5A 1W5TA 1LNWA 1BC7C 2NNYA 5AONA 2HGCA 1XGNA 1W7PD 3KP4A 4EJWA 2HYFA 4OIOF 1R58A 1LEBA 4PDKA 4KN4X 3P9CA 1K79A 4LD5A 2LF8A 1YS7A 1SD6A 3OV8A 2PLYA 1RZ4A 1J7KA 1Z05A 1R5HA 3BPXA 1FX7A 3I59B 2Z9OA 4ZYHA 3E6BA 2HTSA 2JSCA 3TO6A 2EWNA 5D5UB 3N4MA 2GIVA 2RN7A 3JW4A 2QZ8A 5HOOA 4N0BA 5IT3A 2J5OA 3WGGA 4LK0F 4AIJA 3JSPA 3DQVC 3R60A 1ZLKA 4IRGA 1QBJA 2DU9A 3U1DA 1FSEA 4L0ZB 4E70A 4EM1A 3WTYC 3DKWA 1JE8A 3F6OA 2XGXA 2LF7A 3WTSC 2VBYA 4IXAA 1ONVA 2A69F 2MLKA 3ZMZA 4PGHA 4Q48A 2BV6A 4HX4A 4EGZA 4NQWA 1XGMA 3ZMSA 1U5TB 3O3KA 4BHBA 5L3BA 1MDMA 5ILSA 5A2QZ 2EV5A 2XUBA 3TDZC 4KICA 5DCFA 1F9NA 2QM3A 1GXQA 2X0LA 2P4WA 4M72A 1KU9A 1J59A 4M71A 1U6GA 1E2XA 1ON2A 2HOEA 2HQRA 4BNCA 2L3DA 2QLZA 3E97A 3GYHX 1Y0UA 2DO7A 3R4KA 2GXGA 4QLCU 3F3XA 3IRRA 4CICA 3K1PA 3SHFA 3M1EA 4WX9A 5H6RA 2FU4A 1BN5A 2E7XA 5HS9A 2ACJA 4ENMA 1P4XA 1Z7UA 3I59A 6PAXA 2HYGD 4G6DA 5E8GA 2GAUA 3EYYA 5EEHA 5D5WB 2GA1A 3C18A 1MJ9A 2R7DA 1FYMA 3C3WA 2H09A 1CF7B 3MAJA 3MFKA 4M6YA 1ZRCA 4EJOA 5FD6A 4UVBA 3IWFA 3RYPA 1LDDA 1ZARA 2QVOA 5BQTA 3LA7A 1F1ZA 4I7HA 4L5IA 3CO6C 4KUMA 4R79A 3J80K 4CZZA 1LQ1A 4GGGA 4M74A 2MBFA 1SD7A 3REOA 2E1CA 4RAYA 3WTVC 2A5YB 1QO0D 5F64A 1LB2A 1U5TA 3RPQA 3V8KA 2HZTA 1D8KA 1B6AA 2CW0F 3TDUC 4BAYA 3O6BB 2FE3A 2CYYA 3M8FA 4A12A 2LDUA 2DW4A 2ELHA 4OU0A 4MHGA 4O3MA 3G73A 3QU3A 2IA1A 3FZVA 3E6MA 3FXRA 5E1XA 5DYMA 2DAOA 2ZNYA 3TOAA 2XKOA 1XSDA 2HFHA 4DNCA 1VTNC 3CUQC 2M1BA 1XDSA 1S7OA 1J9IA 2M30A 2Z33A 2OQGA 2E1NA 4ZZLA 4WF2A 3KETA 4MEXF 2NS0A 2EA2A 4O6JA 2DK8A 1D5VA 2XAQA 2PBIA 3DP7A 3I64A 1TQPA 1B9NA 4HQMA 1I27A 2PJPA 4G7OF 2WC2A 1BC8C 2CQKA 2XHKA 3JTHA 4EGYA 1ZN2A 4G7ZF 4XLNF 1CF7A 5K5QA 3HTSB 3EYIA 3MEXA 3ABTA 4LMYA 2OZUA 3VOEA 2DT5A 5LLQA 3HOTA 1YIOA 3LQRA 3J7AO 1QQIA 2ISYA 3L09A 2L54A 4BQAA 1CGPA 3BP8A 2JT1A 1ZG1A 4ENJA 1K78B 3U9GA 1BJAA 3T1BA 2PG4A 2K86A 2MH9A 5E1ZB 2F5CA 1WWXA 3WGHA 1D3YA 2WTEA 2DQRA 2XAFA 2QBYA 2AXLA 4HF0A 4RGSA 5JVTA 1W4MA 5HS7A 3O2PE 4A5NA 2L02A 1DUXC 1JHHA 1G3WA 5FGMA 2GZWA 5LGNA 1DDNA 1Z6RA 4EM0B 2TDXA 4XRFA 4UVAA 3IC7A 2MH2A 4YFNF 2ZFWA 2ZNZA 4LLNA 2VT2A 2GWRA 4GXOA 4I02A 1KU7A 2A61A 2ESHA 4ZZDA 2HKOA 2V1XA 1BIAA 2KJBA 1FLIA 1IRGA 3BJ6A 4I0BA 1HSTA 4OIQF 2Q0OA 1JGSA 2IRFG 2MA3A 2K4JA 1P4AA 4ESFA 2STTA 4XBFA 1R1UA 4L9VA 1BOAA 1R1VA 4BHPA 4OMZA 2W24A 4ESJA 2O61A 1KYZA 3Q9SA 5JR3A 1TQMA 2O6GE 2JPBA 3KLOA 3T0YA 2V9VA 2NAZA 1XSVA 4HV6A 1LJ9A 1MD0A 3C7JA 4CDGA 3V8LA 2PEXA 1HW2A 4DQ2A 1UCRA 3KEOA 2YSRA 4M9XA 1SMYF 3PFIA 4MGRA 5DD8A 1IN6A 2D1HA 5CLSA 1YTYA 1EH8A 1IN8A 3TGNA 5LEKA 1XGOA 3V7RA 3G3ZA 5A2QK 4HW0A 2O03A 1BBYA 1XN7A 4B8XA 2FBIA 3F8MA 3QOPA 3GZ5A 2A6EF 1V3FA 3B02A 4OMYA 1ON1A 1USSA 2XV4S 2CGPA 4PCQA 3IRQA 2YR2A 4KT5C 2F5DA 2HTJA
chains in the Genus database with same CATH superfamily
2K9SA 2VBXA 3WHBA 3LAPA 1GVDA 4AUXA 5KVRA 4RS8A 1PDNC 2VBZA 1YLFA 4ZYDA 2M9HA 1HCRA 1VQ7I 2BY0A 2ZFUA 1J5YA 1RETA 2GXBA 2EFQA 2RVCA 3RTRA 3K69A 9ANTA 1HSJA 2ID6A 4NQWB 3ROUA 4BJ6C 4AIHA 3PUFA 4JQFA 3K1MA 3WTXC 4KITB 2VC1A 3HDDA 3KPHA 4A0XA 5J4YA 2EV0A 2F4IA 5IP7J 3NEUA 4G12A 2E2HJ 3K1NA 4U0VA 1HDDC 3AL0B 2ISZA 4K2EA 1GV5A 4H4KC 5F0FA 2L4MA 1J0RA 3GFIA 1STZA 1O7LA 3NAUA 2HOTA 2F4MB 2PI0A 3M1CA 4F3QA 3RKWA 4B43A 2HPIA 3J81Z 1F36A 3IL2A 2IVMA 4EJTA 4A0ZA 4AYBA 2JJ7A 1TLHB 3TO7A 3I55I 4UY8I 4ZYAA 4BS9A 2XC7A 3S2HJ 2HKXA 1BJZA 5DUKA 1XCVA 3D5RC 1PUEE 1QZZA 1X19A 1ZG3A 2ZJ2A 4R8HA 3DBRB 1FBSA 2OF7A 4FE7A 3KE2A 2GM4A 3ASOH 5EYRA 3HOSA 2M8GX 3HG9A 2Y75A 3ML6A 4KIGA 4UV9A 5LGTA 4BXFA 1WH7A 4OIPF 2OAZA 1O3SA 1S3JA 1A31A 3PFYA 3SZPA 5D5VB 1VQPI 2N8GA 4LG0A 3W2VA 2OA4A 5CVUA 3RKYA 1WJDA 2XAGA 3FXOA 3HGYA 4F55A 2K02A 4HX8A 1SANA 5DUIA 4ZYGA 2MW8A 5EGOA 2ZJQF 2DA4A 1YYVA 4BQNA 2R5YA 2IXSA 1RKWA 3F23A 3GTLJ 4OOIA 2BZTA 5FKNA 5IYBJ 1L0OC 3S2DJ 4RGRA 5L3DA 4MLOA 1H89C 4XRSA 5KAFC 1VQKI 3M8EA 1Z7LA 3BQYA 2R92J 2RNGA 4W97A 2O9LA 2E60A 2FBKA 3PQKA 2UXNA 2R7OA 3BQZA 3KCCA 2OZ6A 2BY2A 5JFRA 1IV8A 4A3FJ 1FNNA 1ETKA 4XLPF 1EJ9A 2E34A 3P9KA 4A3IJ 3RDIA 1L3LA 1UHMA 2A3SA 1J2XA 2VXZA 4IPAA 1I6HJ 4S04A 3G6EI 5HNFA 1OYWA 5C4JJ 2E2IJ 1ODDA 1QNTA 2VL8A 5FRNA 2EJRA 3F0CA 5E8IA 3DXJF 4LITA 3CESA 2L7FP 2FSWA 2Z99A 1TNTA 2Q1ZB 4YEJA 3U1KA 3FF5A 3O8HA 3OYGA 2HR3A 5HDGA 1M1EB 3IWZA 4OIRF 4AVPA 3ISPA 1X3UA 1ZGAA 2IGMA 5AIPA 5DEQA 4UXNA 1MBEA 4P55A 3K4BA 1B8IB 2KHMA 3HSEA 3M8JA 2MC3A 4UUSA 5DM7F 3ZN0A 4HLXA 3WHCA 1X3WB 4Y13A 3F22A 1JKRC 2V6EA 1V54H 5DM6F 5E1WA 2M8EA 2HNHA 4J01A 3BR2A 3H3ZA 4KFCA 4F92B 2ELKA 5CVVA 1OJLA 4ZDOA 4EJUA 5K7FA 2BEOA 3QWLA 2BY3A 5L3GA 5J8FA 5K7HA 3HUGB 2WY8Q 5FLXZ 4BE1A 1EV7A 2WV1A 3LMMA 5DS9A 4XIDA 3EUHA 4R1HA 5FKLA 3JRHA 1W0UA 3OMYA 3QAHA 4XQFA 1VFCA 2M34A 3KFWX 4I6ZA 2LYCA 1RUOA 3ZMTA 5KAIC 3I4NJ 1YS6A 4RAZA 5K5OA 3E5UA 1LE8B 5GAGJ 3HOUJ 1BI2A 2L9SA 3D0SA 1X58A 3HPGA 3ZMUA 5FFXA 4HG2A 1POGA 1FOYA 3CCSI 2W1OA 5D6EA 5HLIA 4FCYA 3OYNA 2FOKA 4Q4ZF 2DK5A 2Z5UA 4LIVA 1FY7A 4IL6C 2VIXA 4HRIA 5C44J 1HW5A 1JHFA 1TT0A 1U5TC 3FBIB 3GTGJ 1VQ4I 1SFOJ 3T8TA 2I10A 2OJED 3S8PA 5ED4A 4IHTA 2YUSA 5M5YJ 1MH3A 1OPCA 1HXDA 1X1AA 3G1MA 1QVUA 4LIUA 3WG7H 4LB6B 2R7WA 3IUOA 3QRFF 2CU7A 4G94A 2DFIA 3K2ZA 5BNGA 3OS0A 1W36D 1JT6A 2KZGA 2LK2A 3V42A 1MJAA 2DPDA 2V6CA 2IS2A 2HPMA 4KN7X 1PYVA 4IVNA 4DYQA 1G3YA 3G4SI 2Z3YA 5HLGA 3MD2A 5D8KB 3QYFA 1VQNI 1RNLA 3IH4A 3K0LA 1B59A 3RKXA 4YFXF 3W2AA 1YX3A 4Y3OA 3SFZA 3CP2A 3HRMA 3NARA 1SD4A 4YIRX 2KFDA 5J3LA 4D0PA 2X48A 5F1JA 5KK1A 3E5XA 4I09A 3S14J 3N97A 3DWLE 5FKOA 4FISA 4C2UA 4AVZA 3HHHA 3BOQA 2BY1A 2YX4A 4AU7A 1SD5A 2KL4A 5D5XB 4Q5SF 2JA8J 3JTGA 3GMEA 4B48A 2QENA 1U8RA 1FC3A 3FM3A 1JUPA 3QODA 4V2FA 2DA3A 1I1SA 2XVCA 3RYRA 4JK1X 3WE2A 4C9YA 1T39A 2VXDA 2K40A 3NRVA 2E1MB 3WGIA 3ABUA 1FSHA 1B8IA 2DI3A 1H0MA 3E5QA 1RI7A 2QCOA 4CH7A 2BHZA 2TRTA 2VKEA 4NC6A 2PMZA 3PIPF 2QEXI 2DLLA 3GTQJ 2OU2A 4BXUA 4D1QA 1ZR2A 4E7ZA 1GLNA 1MBFA 2A07F 2QBYB 4PJLA 2ZBKA 3DPTA 5M5WJ 1HKSA 2LKSA 1NH3A 4A3LJ 2P8TA 3BJAA 1WI9A 1P6RA 5CVJA 2PFBA 1TT5B 2BYVE 2ID3A 4XKBA 2DA6A 3FMSA 4M9SA 4PFPA 3HUGA 1J09A 2LOOA 1VQ8I 3ULQB 3CDIA 1I3QJ 3GFJA 3H35A 4O5VA 1Y8RB 2FX0A 3IKVA 3F9KA 3C2BA 3S3MA 2VB6A 4P96A 3W6VA 2CQQA 2OD5A 3I0TA 4BYYA 4BBRJ 2QYOA 3T5XA 3HRTA 1KONA 1NG6A 3IH3A 3S93A 3CCLI 4ANJA 3CLOA 1JI8A 3BCAA 5FRMA 1KQ0A 2O8KA 1LE8A 4EV0A 1VF9A 1WJFA 4ITVA 4BGDA 3E7LA 3S16J 2E1MC 3ZRGA 3MVPA 3IH2A 1XCBA 3MKWB 3M4OJ 1FIAA 2M3AA 1B72A 3HL2A 2HVSA 2R5ZB 4LGWA 4DZPA 4GRIA 4RB0A 2JN6A 4U0WA 1OKRA 2DJNA 2P5VA 4M6VA 1FOXA 2YPRA 5DCMA 2VJ5A 5CYVA 5GTIC 4M6XA 4DZJA 3L2CA 4UVCA 5F1RA 5L3EA 2B7EA 2ZXWH 1YJNI 4WWCA 2XAHA 2RNJA 3FXMA 3LSHA 5FO5A 2IJLA 2QWWA 3TMOA 2DMPA 1YITI 1X3ZB 3FX3A 4QTRA 3HGGA 2CV0A 1JUMA 2IPQX 4PJMA 2CUJA 2K9NA 4A3EJ 4HNVA 3ERED 2CSOA 3FHNA 1DPUA 5DD4A 2P0WA 2DMQA 4PZJA 3E6CC 2RQPA 2CG4A 3HKZA 3K7AJ 1S29A 5ICFA 1G3TA 2KIFA 5H2FC 4HV5A 4A6EA 3S3NA 1LKXA 2IA2A 4CGZA 4GYGA 3FK7A 2RDPA 1P92A 1VZ0A 2JA2A 3DF8A 2KPMA 3PM1A 2JA7J 1TNSA 4UNOA 2CWEA 1NK3P 4CXFA 5J6XA 4NUBA 3CO7C 3OYHA 2NVUB 1P2FA 3LFKA 1GUUA 3A4CA 4HA8A 5J4VA 1A6QA 2JA6J 1V4RA 3PNYA 3TOBA 2CV2A 2FJ1A 2QQ9A 2F6CA 3M7GA 2GQQA 1VI0A 1O3RA 3S1MJ 1ZGWA 3DKYA 1IW7F 5J8CA 4OINF 4QPQA 4NBQA 3GWZA 5LBQA 1V5FA 4V2GA 2C6YA 5E18F 2M5WA 4IRHA 1IDYA 4BE2A 2P6TA 4D5FA 5LHIA 2NRAC 2R7TA 1TTYA 1LVKA 2YX7A 5JLXA 3TEDA 2Q2EB 2J5PA 4I99C 2LY1A 3SQNA 2VJ4A 5B5EC 1GVJA 3D5SC 3V4GA 2XB0X 3EDPA 2DA7A 4BUPA 4U7BA 5LEJA 3D5LA 1ZR4A 1LVAA 1I39A 4F7ZA 1C0WA 1UHWA 3QU6A 1YX5A 3CUQA 1ZLJA 2VQLA 1FPQA 4FHTA 4ZYEA 1JT0A 2Z2SB 3BTJA 2NYXA 4JBAA 4Q47A 5AIQA 2HYJA 2WWYA 3N05A 4BY1J 4HSRA 5IT9K 3LSTA 1I6XA 4RB3C 3J81K 3RZDJ 4UB6C 1G8XA 3W6KB 4CYCA 1B4AA 5K5RA 2Z16A 2H6CA 2G7HA 3JREA 4CZCA 2X6YA 3DFGA 1IUYA 2EA4A 3VSLA 2KP6A 5HNHA 4A3MJ 4WXHA 3A2KA 1VNDA 5BMZA 2UV1A 3CMMA 3HSRA 1W7PA 4HBLA 5F04A 3V7CA 1D1BA 3U2RA 3CC7I 3F8CA 3BWGA 3VPRA 1RR8C 4GYIA 1XMAA 3H92A 4NHJA 2P7VB 3T8RA 2R5ZA 4CCOA 4XSXF 4RB2C 4DJAA 2GOXB 3IHUA 2HQNA 5FROA 2UZKA 1T38A 3PSIA 1BA5A 5H6QA 5GPAA 4G8XA 2A6HF 4XRMA 2P6SA 2LY9A 4HX7A 4PUSA 1OCTC 1IAWA 1GHCA 5LRSA 4ENKA 4DYRA 2GXAA 2Y0MA 3SFIA 3OYMA 3ZGKA 2R7FA 4XICA 3RPUA 2DA2A 5LRRA 2VKHA 2CMPA 4A6DA 4RMNA 3EUKL 4MO7A 2K5CA 5CVRA 1HQCA 3DPLC 3VDXA 3H5AA 3OYKA 4UUVA 1OCRH 1ZK8A 4IZZA 3VYSB 3L2QA 2E19A 3HRUA 3H3VK 4Z6YA 2G9WA 1MZBA 4YIIA 2PQ8A 3KLNA 3JAMZ 1Y6IA 2RAEA 3QP5A 4M3FA 5IOYA 3L2UA 2MFZA 2RGVA 3LSJA 2L5QA 3OR1C 2NVTJ 2HDDA 1D8JA 1ZKGA 2CFXA 5B66C 2WV0A 1KQ8A 2BBYA 1JTXA 1YJWI 2WADA 2ECCA 1FBUA 1XMXA 2FBHA 1BI1A 3QPSA 2HQ5A 3CJTB 5IP9J 5BPDA 4LK1F 1O4XA 3OIQA 1T2KA 4A3GJ 1MKMA 1ZH5A 3F8BA 3BG7A 2W57A 3ZMVA 4GO1A 2L7ZA 3QPHA 1KYWA 2IGKA 3K4LA 4LJZF 1BOBA 3Q0VA 1B9MA 4LG0B 1FYKA 4G9YA 2XKPA 1FYLA 5LHGA 1APLC 2LP0A 2VI6A 3A0BC 5EGOB 4AIDA 1FMWA 2K3FA 2QQBA 1LFBA 3MN2A 2O3FA 2H8WA 4PK4A 2DA1A 2QSHX 1FTTA 3BG3A 2A6TA 2VT3A 3FK6A 2Q2EA 3EUAA 2DPUA 2XF6A 1ULYA 4A5MA 4UHTA 3F8FA 4N9HA 1LPQA 4FQGA 1K7AA 5ICGA 3HM5A 1N75A 5FLXK 1T6SA 3F72A 1WSUA 1T0FA 2G0EA 4QSHA 3QYBA 2WA0A 2P5KA 3OOPA 4KNYA 5E20A 3JR9A 1AU7A 2BW3B 3BY6A 4ESBA 3AG4H 3WU0A 1T98A 4XORA 3QYEA 1T33A 3BC8A 3GTOJ 2DCEA 3W2WA 3COAC 3CDHA 5KNLA 3OOUA 4RAGA 1IJWC 3NQOA 4XN0A 4ASNA 4M3BA 3FMRA 2H1LA 1R00A 1R36A 1T08B 3DTIA 4A3CJ 5ILVA 2D2WA 1FEXA 3S1NJ 4PGGA 2MC4A 3HXLA 2EFPA 5TISC 1LDJA 1U0JA 4CCJA 5LHHA 3OYCA 4II2A 3LWFA 3P7NA 3EETA 1ZRFA 4FT8A 4KIBA 2WBMA 3CCVI 1YW7A 5F6FA 4UUSB 3DV8A 2W85A 4BBSJ 3TO9A 2LKXA 4FE4A 1H9GA 3FMQA 1R9TJ 2QSFX 5IYCJ 2XASA 4BH9A 3MZYA 2F5EA 5F27A 4G6QA 2NVXJ 1P9QC 2WB1A 5EF6A 4YRVA 1PVEA 2LBFA 4F93B 4XOTA 1NTCA 3GF2A 1J75A 1FMVA 2VBWA 2K9LA 4KA4A 3ASNH 2QF7A 1YW9A 5GP9A 4HDUA 4NC7A 4FX4A 3TW6A 4IHWA 5CKTA 1ZTRA 1JJ6C 3WU2C 3KZYA 3ZN1A 1OCPA 4P5OA 2STWA 1R22A 3HTUA 2HU9A 4OWRB 2LY2A 3VFZA 2LRDA 1E0EA 1HF0A 1TW3A 3DU6A 5B3SH 3LSKA 5EZHA 3ZPLA 2XAUA 1IXRC 1Z91A 1AWCA 1UFMA 4BQQA 1X1CA 5LFAA 1V5EA 1R6RA 2AO9A 4EM2A 3KEQA 5CJ9A 3TBIA 1H88C 2EBIA 3LOCA 4HLYA 3MZHA 1ZGJA 4IJAA 5EEGA 1XMKA 4IHSA 3CCMI 3I5UA 1LDKB 5GAHJ 1EA3A 3WTUC 3AL0C 1SFXA 2CO5A 1QU3A 5ERIA 2XPUA 5HLTA 1X4PA 2CJJA 1V55H 3EUHC 3PNVA 3KP5A 2FQ3A 4WXCA 4XMYA 3BR5A 1B1BA 4MQ9F 4ENNA 4V19K 3S2WA 3VEPA 3KYLA 1KGSA 2QSGX 3R0JA 1KZHA 1D5YA 2IS4A 3IAS2 4ZJZA 5FLVA 3OY9A 4XOPA 4ZDLA 2PN6A 1G6NA 4AD9A 4EJVA 1BL0A 1XDUA 4TV7A 2E7WA 1QVTA 1PP8F 2LTPA 2MABA 3CDLA 2MLGA 2BW3A 1XB4A 2W25A 3OS2A 4IRIA 4HPQA 4LLLA 2ELJA 3GTKJ 3JSOA 2EH3A 1TWGJ 1FTZA 3S17J 4HYEA 2WAQA 1UG0A 2E5ZA 4A2UA 3K4MA 4DGWB 2XSDC 1QZYA 4HF2A 2R7ZJ 1WPKA 3DPUA 5E3NA 3TP0A 4CCLA 3PJRA 4B47A 1WKMA 2F5FA 4IF4A 4RGXA 3I53A 2X51A 2L9NA 2VOPA 1Z1DA 5DTDA 1Y56A 3KP3A 1W5SA 3WG9A 1A04A 2LMDA 2IS1A 2VODA 1ZYRF 3P9IA 2RC4A 3ECOA 1Q1HA 3CUOA 4KIFA 5J1YA 4N4OB 1G3SA 1S7EA 1R23A 1ORKA 3ZP5A 2BOLA 3KYCB 2KJCA 5M5XJ 3PSFA 1T95A 1FP2A 4YG2F 2HOSA 1HDPA 3JRGA 3RCOA 5L3CA 5B1AH 5ICCA 4RDUA 1TL8A 2VONA 2X1CA 2PMZN 4LFUA 4XLFA 1WJAA 2UWMA 3CP8A 1XC5A 2VQGA 3LSGA 3ZOBA 2JPCA 2YU3A 1YRNB 4QPOA 2MG4A 3RKQA 1HBXG 3G1OA 4RGUA 2KDZA 1VQOI 2R3SA 3CMEI 5D4SA 1RC9A 4CHUA 1S7AA 3BZCA 4FASD 5HLHA 2OQRA 2JUCA 2Y69H 2G7UA 4LB5A 1IXSB 3HBLA 1TC3C 1TP4A 2IEKA 3FXQA 1OMIA 1A36A 2HDCA 1IRFA 2EFNA 2ETHA 2FNPA 2XIGA 3FKIJ 3W3CA 2H94A 3Q5FA 3V8JA 4HZFA 1EH7A 1QHGA 2LH9A 4MEYF 3A0HC 1Y8QB 2B9SA 4KYWA 1B72B 1U9OA 2KIUA 2HI3A 1I50J 1QPMA 4FX0A 5EG0A 4ZH4F 1Y1WJ 1ETOA 1DQUA 4B3AA 4KMUX 5DCMB 3E3VA 5CQEA 2R0QC 2HVQA 2CFOA 1SVMA 2X4HA 4EATA 4BHCA 4HAMA 3AKZA 5IT9Z 3GXOA 1KQ9A 1RIOH 4AIKA 1ERDA 2ZO4A 3BPVA 1OLTA 1Z6TA 4H0EA 4BDZA 1AKHA 4Y52J 2H6BA 4EQQA 3BZ6A 4I98B 1SVLA 4RM2A 2M7BA 1DGWY 2IAIA 1RPWA 1UJ8A 4F52A 5JHUA 3A01B 3PIOF 2KIMA 5ICEA 5M3MJ 1P4WA 2M45A 1AOYA 3C1DA 3SZTA 2XGCA 4MTDA 2QKMB 3CMYA 2KQRA 2W82A 1I1GA 3TP3A 1YQAA 2B0LA 1YFHA 2QQAA 2EB7A 1YIJI 3HKZN 4HDVA 1UAAA 2WAFA 1IGNA 2AS5F 2ZMEB 4KMFA 2E35A 4EMSA 3S32A 3G71I 1YG2A 4NB5A 4KDPA 4A3BJ 2IP2A 1UZCA 5HVQC 4DYCA 4PJ0C 2DFHA 4E7IA 1FOKA 2OV7A 3I54A 5L3FA 2XRNA 4JX5A 4CO8A 3LA3A 3AG1H 2K27A 3HZJA 4PFOA 2VE8A 3HRSA 1FBQA 4W1UA 2DTRA 4L5JA 4U7DA 2L4AA 2JMWA 2O0YA 3TKYA 1R5GA 1F5TA 4BQOA 2FF4A 2D1VA 4I0AA 1S72I 4IHYA 4N4NB 5D6FA 4CSWA 1Z3XA 1XD7A 4D7NA 2OCEA 3FKJA 2W84A 1ZHFA 3FM5A 1OYYA 3PQJA 4AWXB 2XAJA 2BGCA 4G7HF 2YS9A 3CUQB 2E1OA 2FXAA 4M9ZA 1N25A 1MNMC 4S05A 1YRNA 2P7CB 1P7JA 3DU5A 4PJJA 4A93J 3JAMK 3W6JB 2DOFA 1QA6A 5LGUA 4CYCB 3SXYA 1YJ9I 5H20A 1WZ2A 1SFEA 3HC7A 1JKPC 3JRDA 3TQNA 3OL3A 2VE9A 1CQTA 1LUJB 1SAXA 5KHDA 2M0MA 1OCZH 3AG2H 3TW7A 2FOWA 2K4BA 3MWMA 1FWZA 1W7PB 4BL0B 3OYEA 2VLAA 4U88A 3F6VA 2KRFA 1BW5A 3GW2A 3MKZA 2WAEA 3L2VA 2R7XA 4JX4A 2RV8A 2OTLI 1FIPA 2Y31A 3KZIC 2MD5A 1IC8A 2ZKZA 3J7AY 3OSFA 1VQ9I 2EILH 4B3XA 1IXCA 2HWVA 3CJNA 2O8XA 5HS8A 3I4PA 4Y7NJ 5K1YA 2NVYJ 1BIBA 3GVAA 1GDTA 2HS5A 1Z9CA 2XPWA 3ZQCA 3KEYA 1Y1VJ 1UG2A 3L9FA 1IN5A 1I5ZA 2UXXA 2VOOA 4A0YA 4QWQA 4L9TA 1TW2A 3DLAA 1A5JA 2JUGA 4CUGA 4YELA 3HEFA 3M9AA 2KIQA 4Y15A 4L18B 4PSWA 2FEZA 1TWCJ 1XPXA 3FXUA 3A01A 4XLHA 2ZJRF 4WCGA 1S8NA 3GLXA 2FMLA 3ZQLA 2LD5A 5FB2A 2AXTC 2CQXA 1GXPA 2OC6A 2X1DA 2O7OA 2XRLA 3FXKA 3G1LA 4BY7J 2CUZA 3GEZA 3GFMA 4UV8A 3EQLF 2FNAA 5D4RA 2F2EA 2Y0SN 1D0YA 2LKPA 1IN4A 4GCVA 1MNEA 5DDGA 5J1RA 2DA5A 2RKHA 1K4SA 4IHXA 2DDBA 1Y0NA 3OYIA 3BROA 1BW6A 4RB1A 2ZMEA 3BG9A 3SDGA 1KU2A 3R6SA 1DU0A 2COMA 3KP6A 1UHSA 3Q0WA 1ZRDA 2V9KA 2F5VA 3KP7A 3HOVJ 3K4KA 2ZJPF 1K83J 2E36A 2QUFA 1U9NA 4BJ5C 3SDBA 3VODA 2LC2A 3JRCA 4S0HB 2BXZA 2JTVA 3LQQA 1I3AA 2L01A 4I01A 1USTA 3K70C 1RUNA 5CVIA 1G4DA 5GADJ 5GTHC 1Q1VA 3ZMDA 3F8NA 1YOVB 3AAFA 2DOAA 1O7FA 4BE0A 3FWEA 1U2WA 1AHDP 4LLGF 4JOMA 2VPLA 1DPRA 3GFLA 1BI0A 1R7JA 4WK8F 2NNNA 3LSMA 4CYDA 1S6LA 3Q9VA 1BR2A 3E6DA 2DBBA 4ON0A 2EV6A 4E4HA 3QQAA 3KZZA 1JUSA 1UB9A 4EEFG 1MMDA 3QPTA 2OTJI 3VYUB 3LSPA 1OR7A 1WJBA 1A6IA 4MTEA 3A02A 3BLYA 3V7SA 2LVSA 3WODF 4KT6A 4HSTA 5FKMA 2UUZA 1N78A 2V79A 2FA5A 5JHFA 3UNGC 3CTAA 3HHGA 3JCUC 1TQIA 1SEUA 5TJJA 1NK2P 2H8RA 2JA5J 2V9PA 3ZQIA 1MBKA 1O3QA 4B1RA 5ILUA 2LFBA 2V1DA 3I58A 3ZQ7A 4A3JJ 1YO5C 2IT0A 2K85A 4P9UA 2IA0A 3H3UA 3GZ6A 2FMYA 5DV5A 1JKQC 5D8LB 3LA2A 3B73A 3BG6A 1AA7A 4ZTJA 3FISA 1X2NA 1K6YA 2HZDA 3JRFA 3S1QJ 4XKVA 4XNFA 3WE3A 2YU9J 1WQ2A 3E1SA 1ZG5A 2HEOA 2FRHA 2Z1DA 1FJLA 1KU3A 4HNTA 3LNQA 2JWTA 2O5RA 3HYIA 4IHVA 3R0AA 5LD2C 2XSJC 1LEAA 3K9TA 3HSFA 1U78A 2JVHA 3H36A 3J80Z 1TWFJ 3I71A 4IQJA 4X6AJ 2LBFB 3WTTC 2PJRB 4JP0A 2EFOA 2BXYA 5EJCA 2Y0SA 3K4JA 3HJEA 1HW1A 3DKXA 2M7AA 2Y9YA 3BR6A 3CJRB 5JI6A 2PX9A 1IDZA 1R4NB 3MKYB 1DP3A 2VN2A 2WB1N 2D45A 3K6GA 3MQ0A 4BJTA 3CD6I 2F4OB 3NWSA 3DBLB 2PMHA 4I2OA 1K6OA 4L9NA 2V26A 2Y2ZA 4I76A 2KRCA 3CF5F 1EH6A 2V1NA 2ZXJA 2R4GA 2KKOA 3OYJA 2LNBA 5HDNA 3CC4I 2JQ7A 1IZ1A 1MJBA 3QPLA 1YE9A 3LAJA 1WJCA 1PP7U 2VQCA 1F4KA 3ELKA 3ERMA 1OQYA 4D7MA 1ZREA 1WVRA 5IP6A 1WH5A 2KMUA 2EZIA 1NHAA 2TCTA 3I3LA 1LFPA 3KP2A 1JKOC 1TZLA 4Z2YA 3S3OA 4FETA 1DP7P 2PJRA 2EK5A 1T8IA 4L9JA 1XSXA 1IO2A 3DEEA 2ESNA 4IOCF 4LG3A 1VQ5I 2X85A 3L00A 4UB8C 1FP1D 2H27A 1QGPA 2A68F 5E17F 1O3TA 3ZQHA 1QHHD 1XS9A 1WGXA 2QQ8A 2EZLA 3HPHA 1H9TA 3U21A 1K78A 3OYDA 4HQEA 2JRTA 1OFCX 2QKLB 2CUFA 2VKVA 3VYRB 2IW5A 4IEJA 4C30A 1TBXA 4HOBA 4M73A 1ETWA 1Z0XA 3C2HA 1BI3A 4B09A 3H5RA 2DMTA 4XRSG 4CCKA 4YIFA 3WU1B 1XTAA 1HKQA 3FBNB 4C3JJ 3H9GA 1YW8A 3F21A 2V1UA 2R7SA 4E7KA 1SMTA 4EVIA 4II3A 2HQAA 3SEZA 1MGTA 2M87A 2CUEA 3IKTA 5BPIA 1BM9A 4WXDA 1OYIA 2W48A 4RA2A 5FKKA 3H5NA 5TRDA 3GUDA 1MSFC 4UUTA 2VC0A 3FHZA 2LSOA 4U0YA 1MIJA 2ZCWA 3HIFA 3OSGA 3BJOA 2JSPA 3MCZA 3ECHA 4XR6A 3QP6A 4DOZA 2Y48A 4HF1A 4MNUA 2WAQN 1QPIA 2DQLA 3DLLF 4E7LA 4DBRA 3DEUA 2Q8KA 1ITYA 5FFZA 2GOMA 1HKTA 3LL7A 2XROA 3GO5A 3ESWB 1U3EM 2BVMA 5J47A 2ADUA 3RJPA 1ZAOA 2IBDA 4XSZF 2EFWA 1VQLI 3H9JA 1FT9A 5BS6A 3L7WA 3KIOA 1E17A 2DOEA 4YFKF 3RI4A 1XGSA 5HDKA 3GX4X 2DYRH 4N9IA 1S5LC 4P9FA 4A69C 1O57A 2K7LA 4P1WA 1JXSA 1WRJA 1SFUA 1UMQA 4ETSA 2XB5A 4MQVA 3RQIA 2X6WA 1R1TA 2R7RA 1K4TA 2NVQJ 4QIWN 2GA2A 3LSIA 3R61A 3BT9A 1YI2I 1MDMB 4D5CA 5BOXA 3WTWC 1KA8A 4RLFA 1IV6A 3Q3SA 1REPC 2JZYA 5IY5H 3RIRA 1MBGA 2PMUA 3WTZA 4XLCA 3VB2A 2BE5F 1MNDA 1HOMA 3BDDA 3H1CA 3GCMA 2E71A 4L0YB 4Y17A 1IN7A 2V4JC 2P5LC 1IF1A 3OWTA 1FZPB 2IS6A 1XX5A 2OBPA 3OYAA 5EG0B 5FD5A 1W5TA 1RRJA 1LNWA 4GFBA 3BR1A 1BC7C 3GBGA 2F48A 2EPFA 1MBHA 2VKDA 5AONA 2HGCA 5IOZA 2NNYA 1XGNA 1W7PD 3ZR8X 2ME6A 3DTEA 3KP4A 4BACA 4EJWA 2HYFA 1X1PA 4OIOF 5E3LA 1R58A 3VWBA 1LEBA 4PDKA 4KN4X 3P9CA 1AKHB 1K79A 4LD5A 3DBHB 2LF8A 1YS7A 2OUMA 1IRXA 4G6TB 1RR7A 1SD6A 3OV8A 5EDNA 2W7NA 2PLYA 1RZ4A 1J7KA 2KLOA 5E79C 3UR3C 1Z05A 4XK4A 4XONA 1R5HA 3BPXA 3L1PA 1FX7A 3I59B 2Z9OA 1EF4A 4ZYHA 3E6BA 2HTSA 2JSCA 3TO6A 3OYBA 3RPUD 2EWNA 5D5UB 2FQ4A 3N4MA 1LFUP 2HDWA 3GTMJ 4KISA 2GIVA 3BTCA 3K70D 2RN7A 3JW4A 2QZ8A 5HOOA 4N0BA 1F43A 4B4CA 5IT3A 2J5OA 1RESA 2D5VA 1D1AA 3H0GJ 2H1KA 3CC2I 3ZQQA 3WGGA 4LK0F 4AIJA 2CS3A 3JSPA 3B6CA 3DQVC 3R60A 4KJZA 1ZLKA 2KDOA 3MKLA 2K9MA 3JRBA 4IRGA 1PUFA 1QBJA 2DU9A 3CCYA 3U1DA 4GDFA 1FSEA 4L0ZB 2CQNA 4E70A 2WY7Q 2ZB9A 5EZGA 2VQHA 4EM1A 3WTYC 2JK3A 3DKWA 1JE8A 1PJRA 2L7MP 3CLQA 3F6OA 2XGXA 3DTKA 3QOEA 4IKFA 2LF7A 3WTSC 4C3IJ 2VBYA 4IXAA 1ONVA 2A69F 2MLKA 4DBQA 1K61A 3ZMZA 3OYLA 4PGHA 4Q48A 1G59A 2BV6A 4HX4A 4EGZA 4NQWA 5F0HA 1ETXA 2DFEA 2VJIA 1XGMA 3ZMSA 4IO9F 1U5TB 2ZXIA 3O3KA 4BHBA 1BR1A 5L3BA 2V7FA 1RKTA 1MDMA 5ILSA 1MMSA 3HOXJ 5F0CA 5A2QZ 4NNJA 3SYTA 2EV5A 2XUBA 3BTIA 3IP4B 3TDZC 4KICA 5DCFA 4HEA2 1OCOH 1F9NA 2QM3A 1GXQA 2X0LA 2P4WA 1MW7A 1KU9A 2DMNA 4M72A 3M3YJ 1DU6A 1J59A 2BVLA 1WI3A 4M71A 1U6GA 2XPVA 1E2XA 1ON2A 3ABLH 4HNUA 3ONQA 4E7JA 2IGOA 1X1BA 3SJMA 1A35A 2HOEA 4RLQA 2HQRA 3PL8A 4BNCA 2ICWG 3JRAA 2L3DA 5GPCA 4MIMA 2QLZA 2R7UA 3E97A 3GYHX 3CQZJ 1Y0UA 2DO7A 3R4KA 2GXGA 4QLCU 5KCMA 3F3XA 4C3HJ 3IRRA 2OPTA 3GTJJ 4CICA 3K1PA 4BXXJ 3SHFA 5E3OA 2ECBA 3M1EA 5H6RA 4WX9A 2FU4A 3ZQGA 4MFEA 1BN5A 2E7XA 3D1NI 3GZNB 2B63J 5HS9A 2LR8A 2DTZA 2EIKH 5IPAA 2ACJA 3LSRA 4E7HA 2DDAA 4ENMA 3M07A 1P4XA 1Z7UA 3BZKA 3I59A 6PAXA 4X1EA 2HYGD 4G6DA 1JTYA 5FLMJ 5E8GA 2GAUA 3EYYA 2XF7A 5EEHA 2AHQA 5D5WB 2GA1A 2HOAA 3L2WA 3C18A 1MJ9A 4JYKA 2VJJA 2R7DA 2ZC2A 2EIMH 1E3PA 2EIJH 3J7ZI 2W4SA 3C3WA 2H09A 1FYMA 4Y33A 3ABKH 4BKXA 3RZOJ 5HODA 4D9JA 1FOWA 3PNTA 5FJ8J 1CF7B 3MAJA 4XLAA 2QA4I 4J19A 2ME0A 1NG7A 1BR4A 1TWHJ 2HVRA 2VUMJ 3MFKA 1WJEA 1N77A 3SEQA 1QZEA 4M6YA 1SFKA 2CV1A 1X1DA 4ZTFA 1ZELA 1ZRCA 3GLLA 5TGTA 4EJOA 1MMAA 4PSXA 1VQMI 2DMUA 5FD6A 4FTHA 1IUFA 3B6AA 3K2AA 4UVBA 3EPZA 3IWFA 1LDDA 1ZARA 1XG1A 2QVOA 3RYPA 5BQTA 3I56I 1R5ID 1WFXA 1Z67A 2MSYA 3LA7A 4B44A 3HOYJ 3BTLA 2R7QA 2RQQA 1F1ZA 1U8BA 2KT0A 1E3HA 1OCCH 4I7HA 2EZKA 4L5IA 3P5JA 3CO6C 3UKGA 4KUMA 4R79A 1MH4A 1X4OA 3J80K 4CZZA 1Y39A 2P81A 1Z21A 1LQ1A 1X2MA 2NXNB 5JLWA 3BR3A 3OIOA 4IX7A 1MBJA 4GGGA 4M74A 4BEHB 2MBFA 1SD7A 3REOA 2CH0A 1WHUA 3K4NA 4MFDA 4RAYA 2E1CA 2OCCH 3WTVC 2A5YB 2X1EA 1QO0D 2DFFA 3C2GA 2GBYA 2I5UA 5F64A 4AC0A 3HB9A 1LB2A 3E0JB 1U5TA 3RPQA 3V8KA 3NWTA 2HZTA 2ZMEC 1D8KA 1B6AA 2CW0F 5GAEJ 3TDUC 3CJQB 3FXLA 2AQEA 4JX6A 4BAYA 1Z77A 3O6BB 4AM3A 2M4GA 1R4MB 5J1UA 4F91B 2FE3A 3S1RJ 4XKCA 2CYYA 3M8FA 4A12A 2LDUA 4E6KG 3O8GA 3ZXSA 2AQFA 2DW4A 2ELHA 4OU0A 4MHGA 4L5EA 3G73A 4O3MA 2DYSH 1IG7A 3QU3A 2IA1A 3FZVA 3E6MA 2HXOA 3FXRA 5DYMA 5E1XA 3CZ6A 1WCMJ 2NOGA 3ABMH 1W5CC 2DAOA 3KYDB 2ZNYA 3MZ8A 4BU2A 3TOAA 4C2TA 2XKOA 3L2RA 1XSDA 1SVOA 2HFHA 4DNCA 1VTNC 3CUQC 1OR7C 3I4MJ 2M1BA 1XDSA 1S7OA 5K7ZA 1J9IA 2M30A 3G2BA 2Z33A 3CCEI 3OR2C 1WJ5A 4DIQA 2OQGA 1Z3YA 2COBA 2E1NA 4ZZLA 4WF2A 2KZVA 3FIWA 3KETA 4MEXF 2NS0A 2ZSIB 2EA2A 2XGDA 2MYSA 4O6JA 2DK8A 1D5VA 3CCJI 2XAQA 2PBIA 3DP7A 3I64A 1JGGA 2GIZA 1TQPA 1B9NA 1ETYA 1P7IA 4HQMA 1I27A 4M3EA 2PJPA 4G7OF 3AFHA 1IRZA 3CCQI 2WC2A 1ACIA 2A5WA 1BC8C 2CQKA 2XHKA 3JTHA 4EGYA 1ZN2A 3OS1A 4G7ZF 4XLNF 1CF7A 5K5QA 3HTSB 1MSEC 4NC8A 3EYIA 3MEXA 3ABTA 1ZQ3P 4LMYA 4OAZA 3PUBA 3PO3J 2OZUA 2XGEA 2W00A 3VOEA 3MMYB 3J7YJ 1OISA 2X6XA 1HC8A 3VSKA 2DT5A 5LLQA 2NS7A 3BR0A 3HOTA 4BDYA 2GLOA 3S15J 2R93J 2MGQA 2L2OA 1YIOA 1ENHA 1SC7A 2RREA 3DEWA 1S9HA 3CF2A 3RQ4A 3OYFA 3OIPA 3JRIA 3LQRA 3J7AO 2DT6A 1QQIA 2ISYA 3I9V2 3L09A 4PJNA 1MMGA 2L54A 4BQAA 3HOWJ 3AG3H 1CGPA 4CCNA 3BP8A 2I8DA 2MD0A 5IYDJ 2JT1A 2IGNA 2L9VA 4ENJA 1ZG1A 2DJIA 1R49A 1K78B 3U9GA 1BJAA 3T1BA 2PG4A 2K86A 1SAUA 2XF5A 2MH9A 4BEHA 5C4XJ 4J00A 2NOJB 1HA8A 2A05A 5E1ZB 2F5CA 2FD5A 2Y9ZA 3PO2J 1D0XA 1WWXA 1TWAJ 5C3EJ 3WGHA 2M2EA 1D3YA 2WTEA 2DQRA 2XAFA 2QBYA 2AXLA 4HF0A 4RGSA 3A1YA 3CCRI 5JVTA 5E3MA 1W4MA 5CPRB 5HS7A 3O2PE 2DODA 4A5NA 2L02A 1DUXC 3DCFA 1JHHA 2ZXHA 4RBOA 1G3WA 5FGMA 2EZHA 1ETQA 2GZWA 5LGNA 1DDNA 2DT7B 3SZGA 3LFUA 1Z6RA 3VYTB 2VASA 2VPRA 4EM0B 4DW6A 4XLEA 3CCUI 4ABZA 2TDXA 2HXIA 2LG4A 4XRFA 2M0CA 3IC7A 3K10A 4RM3A 1W1WE 4UVAA 2MH2A 4YFNF 2ZFWA 2E2JJ 2ZNZA 3Q0UA 4M3DA 4LLNA 1GV2A 1T0FC 1EKEA 4CA0A 2VT2A 2X9DA 3OL4A 2K9QA 2GWRA 4GXOA 1GT0C 4X0GA 3RSNA 4I02A 1R71A 2M4KA 5F08A 2LREA 3BG5A 1KU7A 3IAM2 2KISA 2A61A 1MMNA 2ESHA 3H9QA 1V5GA 1YHQI 4ZZDA 2HKOA 4A3KJ 4XKWA 2CW7A 3H0DA 2V1XA 1HLVA 2L7KA 1BIAA 2KJBA 1G2HA 1FLIA 1IRGA 4CCMA 3BJ6A 1D1CA 2CQ7A 4I0BA 1HSTA 5EEAA 4OIQF 2Q0OA 1JGSA 2IRFG 2EQRA 2MA3A 2K4JA 1P4AA 4ESFA 2ZSHB 2XDVA 1DGRM 2STTA 4XBFA 4IOAF 1R1UA 4L9VA 1BOAA 1R1VA 4BHPA 4OMZA 2W24A 4ESJA 3FDYA 2O61A 1KYZA 1UELB 3Q9SA 5JR3A 1TQMA 4E7SA 3GTPJ 2DN0A 2O6GE 2CW8A 2JPBA 3KLOA 2DXIA 2CRGA 3T0YA 2V9VA 2NAZA 1XSVA 4HV6A 1LJ9A 1MD0A 4U87A 1W36C 4NDLA 3C7JA 1W0TA 2Y30A 4CDGA 3V8LA 1D0ZA 2PEXA 4OAYA 2K3PA 3IV5A 1HW2A 2JRMA 4DQ2A 2BHYA 4AYBN 1UCRA 3KEOA 4XN3A 2YSRA 4M9XA 3ZCOA 1SMYF 3PFIA 2L9RA 3HOZJ 4ZDPA 1ETVA 2L0KA 4Y4RA 4IQ4A 2JVGA 4MGRA 4XL9A 5DD8A 1IN6A 2E5NA 4RAFA 2D1HA 2LLKA 5M3FJ 1JJ8C 5CQGA 2R5YB 5CLSA 1YTYA 3FXJA 1H8AC 1T56A 1EH8A 1VQ6I 1IN8A 5J40A 3TGNA 5LEKA 1XGOA 3V7RA 3G3ZA 5A2QK 4HW0A 4M3GA 2O03A 1BBYA 1XN7A 4XM3A 1E3OC 4ZC3A 4C2MJ 3TL4X 3X2QH 5JVGF 4B8XA 2FBIA 2EINH 3F8MA 3QOPA 3GZ5A 2A6EF 1V3FA 4LOCA 2FUG2 4A3DJ 2KRHA 3BCBA 3B02A 3CMAI 4OMYA 1ON1A 1USSA 2X6OA 2QGUA 2R7VA 5B1BH 2XV4S 1PUFB 2CGPA 4PCQA 3KX2A 3ZQFA 3IRQA 2YR2A 4KT5C 2F5DA 1QRYA 2HTJA 3A03A 3K4CA 2NS8A
chains in the Genus database with same CATH topology
2VBXA 3LAPA 5KVRA 4RS8A 1PDNC 2VBZA 1YLFA 4ZYDA 1J5YA 2GXBA 2EFQA 2RVCA 3RTRA 3K69A 1HSJA 3ROUA 4AIHA 4JQFA 3K1MA 3WTXC 2VC1A 4A0XA 2EV0A 3NEUA 3K1NA 4U0VA 2ISZA 4K2EA 2L4MA 1J0RA 3GFIA 1STZA 1O7LA 2PI0A 3RKWA 3J81Z 3IL2A 2IVMA 4EJTA 4A0ZA 3TO7A 1TLHB 2HKXA 5DUKA 1XCVA 1PUEE 1QZZA 2ZJ2A 1ZG3A 4R8HA 1FBSA 3KE2A 3HOSA 4KIGA 2Y75A 3ML6A 4UV9A 5LGTA 4OIPF 2OAZA 1O3SA 1S3JA 3SZPA 5D5VB 4LG0A 2OA4A 5CVUA 3RKYA 2XAGA 2K02A 4HX8A 5DUIA 4ZYGA 1YYVA 3F23A 4OOIA 1L0OC 4RGRA 5L3DA 3M8EA 2FBKA 3PQKA 2UXNA 3KCCA 2OZ6A 5JFRA 1FNNA 4XLPF 3P9KA 3RDIA 1L3LA 1UHMA 2A3SA 1J2XA 2VXZA 4IPAA 4S04A 1OYWA 1ODDA 1QNTA 2EJRA 5E8IA 3DXJF 2FSWA 2Z99A 1TNTA 3FF5A 2HR3A 5HDGA 3IWZA 4OIRF 4AVPA 3ISPA 1X3UA 1ZGAA 5AIPA 5DEQA 4UXNA 4P55A 3HSEA 2MC3A 3ZN0A 4HLXA 4Y13A 3F22A 5E1WA 2M8EA 3H3ZA 4KFCA 5CVVA 4EJUA 2BEOA 5L3GA 5J8FA 5FLXZ 1EV7A 3EUHA 4R1HA 3QAHA 3KFWX 1RUOA 3ZMTA 1YS6A 4RAZA 5K5OA 3E5UA 1BI2A 3D0SA 3ZMUA 5FFXA 5D6EA 5HLIA 2FOKA 4Q4ZF 2DK5A 2Z5UA 1FY7A 1HW5A 1JHFA 1U5TC 3T8TA 5ED4A 4IHTA 1OPCA 1HXDA 4LB6B 3QRFF 4G94A 2DFIA 3K2ZA 1MJAA 2DPDA 2V6CA 4KN7X 4IVNA 1G3YA 2Z3YA 5HLGA 5D8KB 1RNLA 3K0LA 1B59A 3RKXA 4YFXF 3SFZA 3HRMA 1SD4A 4D0PA 5KK1A 3E5XA 4I09A 3N97A 3HHHA 3BOQA 2YX4A 1SD5A 5D5XB 4Q5SF 3JTGA 2QENA 1U8RA 1FC3A 3FM3A 1I1SA 2XVCA 3RYRA 4JK1X 3WE2A 1T39A 3NRVA 3WGIA 3ABUA 1FSHA 2DI3A 1H0MA 3E5QA 1RI7A 2DLLA 2OU2A 4BXUA 2A07F 2QBYB 2ZBKA 3DPTA 1HKSA 2P8TA 3BJAA 1WI9A 1P6RA 5CVJA 2PFBA 2BYVE 4M9SA 3FMSA 3HUGA 3ULQB 3GFJA 4O5VA 3IKVA 4P96A 2OD5A 3I0TA 4BYYA 2QYOA 3T5XA 3HRTA 3CLOA 1KQ0A 4EV0A 1XCBA 4LGWA 4RB0A 4U0WA 1OKRA 2P5VA 2YPRA 5DCMA 5CYVA 4M6XA 3L2CA 4UVCA 5F1RA 5L3EA 4WWCA 2XAHA 2RNJA 5FO5A 2IJLA 2QWWA 3FX3A 2IPQX 3ERED 2CSOA 1DPUA 5DD4A 4PZJA 3E6CC 2RQPA 2CG4A 1S29A 5ICFA 1G3TA 2KIFA 4HV5A 4A6EA 2IA2A 4CGZA 4GYGA 2RDPA 1P92A 3DF8A 1TNSA 4UNOA 2CWEA 4CXFA 5J6XA 3CO7C 1P2FA 3LFKA 4HA8A 1V4RA 3TOBA 2QQ9A 3M7GA 2GQQA 1O3RA 1IW7F 5J8CA 4OINF 3GWZA 5LBQA 2C6YA 5E18F 2M5WA 4IRHA 2P6TA 2NRAC 5LHIA 1TTYA 2YX7A 2J5PA 3SQNA 1GVJA 3V4GA 3EDPA 4U7BA 5LEJA 3D5LA 1LVAA 4F7ZA 1C0WA 1UHWA 3QU6A 3CUQA 1ZLJA 1FPQA 4FHTA 4ZYEA 2NYXA 4JBAA 4Q47A 5AIQA 2WWYA 3LSTA 1I6XA 4RB3C 3J81K 3W6KB 1B4AA 5K5RA 2H6CA 2G7HA 3DFGA 1IUYA 2EA4A 4WXHA 5BMZA 3HSRA 1W7PA 4HBLA 3V7CA 3U2RA 3F8CA 3BWGA 4GYIA 1XMAA 3H92A 4NHJA 2P7VB 3T8RA 4RB2C 4XSXF 3IHUA 2HQNA 2UZKA 1T38A 5H6QA 4G8XA 2A6HF 2P6SA 4HX7A 1IAWA 1GHCA 5LRSA 4ENKA 2Y0MA 2R7FA 3RPUA 5LRRA 4A6DA 5CVRA 1HQCA 3DPLC 4UUVA 3HRUA 2G9WA 1MZBA 4YIIA 2PQ8A 3KLNA 3JAMZ 3QP5A 2RGVA 1D8JA 2CFXA 1KQ8A 2WV0A 2BBYA 1FBUA 2FBHA 1BI1A 5BPDA 4LK1F 1T2KA 1MKMA 1ZH5A 3F8BA 2W57A 3ZMVA 4GO1A 3QPHA 1KYWA 4LJZF 1B9MA 4LG0B 1FYKA 4G9YA 2XKPA 1FYLA 5LHGA 2QQBA 2O3FA 2VT3A 2Q2EA 2DPUA 1ULYA 4A5MA 4UHTA 3F8FA 4N9HA 1K7AA 5ICGA 5FLXK 1T6SA 3F72A 1WSUA 1T0FA 2P5KA 3OOPA 4KNYA 5E20A 3BY6A 4ESBA 3WU0A 1T98A 3COAC 3CDHA 3NQOA 4ASNA 3FMRA 1R00A 1R36A 5ILVA 2D2WA 4PGGA 2EFPA 1LDJA 5LHHA 3LWFA 3P7NA 3EETA 1ZRFA 4FT8A 4KIBA 1YW7A 5F6FA 3DV8A 2W85A 3TO9A 1H9GA 3FMQA 2XASA 4BH9A 3MZYA 2F5EA 4G6QA 3GF2A 1J75A 2VBWA 4KA4A 1YW9A 4HDUA 4FX4A 3KZYA 3ZN1A 4P5OA 2STWA 1R22A 3HTUA 3VFZA 1TW3A 3ZPLA 1IXRC 1Z91A 1AWCA 1UFMA 4EM2A 3KEQA 5CJ9A 4HLYA 3MZHA 1ZGJA 4IJAA 5EEGA 1XMKA 4IHSA 3I5UA 1LDKB 3WTUC 1SFXA 2CO5A 5ERIA 3KP5A 2FQ3A 4WXCA 1B1BA 4MQ9F 4ENNA 3S2WA 3VEPA 1KGSA 3R0JA 4AD9A 2PN6A 1G6NA 4EJVA 1XDUA 4TV7A 2E7WA 1PP8F 2MLGA 1XB4A 2W25A 4IRIA 4LLLA 3JSOA 4HYEA 4A2UA 1QZYA 4HF2A 1WKMA 2F5FA 4IF4A 4RGXA 3I53A 2VOPA 1Z1DA 3KP3A 1W5SA 3WG9A 1A04A 2VODA 1ZYRF 3P9IA 2RC4A 3ECOA 1Q1HA 4KIFA 3CUOA 1G3SA 1R23A 3ZP5A 2KJCA 1FP2A 4YG2F 5L3CA 5ICCA 2VONA 4LFUA 2UWMA 2JPCA 2YU3A 1HBXG 4RGUA 2R3SA 5D4SA 4CHUA 1S7AA 5HLHA 2OQRA 2G7UA 4LB5A 1IXSB 3FXQA 1OMIA 2HDCA 1IRFA 2EFNA 2ETHA 2FNPA 2XIGA 2H94A 3Q5FA 3V8JA 4HZFA 1EH7A 4MEYF 4KYWA 2KIUA 1QPMA 4FX0A 4ZH4F 4KMUX 5DCMB 3E3VA 2X4HA 4BHCA 4HAMA 5IT9Z 3GXOA 1KQ9A 1RIOH 4AIKA 2ZO4A 3BPVA 1Z6TA 4H0EA 2H6BA 4EQQA 3BZ6A 4I98B 5JHUA 2KIMA 5ICEA 1P4WA 2M45A 1AOYA 3C1DA 3SZTA 4MTDA 1I1GA 1YQAA 2B0LA 1YFHA 2QQAA 2EB7A 4HDVA 2AS5F 2ZMEB 4KMFA 4EMSA 4KDPA 1YG2A 4NB5A 2IP2A 5HVQC 1FOKA 3I54A 5L3FA 2XRNA 4CO8A 3LA3A 2K27A 2VE8A 3HRSA 1FBQA 2DTRA 4L5JA 4U7DA 2L4AA 2O0YA 3TKYA 1R5GA 1F5TA 2FF4A 2D1VA 4I0AA 5D6FA 1XD7A 4AWXB 2W84A 1ZHFA 3FM5A 1OYYA 3PQJA 2XAJA 2BGCA 4G7HF 3CUQB 2FXAA 4M9ZA 2P7CB 4S05A 3JAMK 3W6JB 5LGUA 3SXYA 5H20A 1SFEA 3TQNA 2VE9A 1SAXA 2K4BA 3MWMA 1FWZA 1W7PB 4U88A 3F6VA 2KRFA 3GW2A 2RV8A 2MD5A 2ZKZA 1IXCA 2HWVA 3CJNA 2O8XA 5HS8A 3I4PA 5K1YA 1BIBA 3GVAA 2HS5A 1Z9CA 3L9FA 1IN5A 1I5ZA 2UXXA 2VOOA 4A0YA 4QWQA 4L9TA 1TW2A 3M9AA 4Y15A 4L18B 2FEZA 3FXUA 4WCGA 1S8NA 3GLXA 2FMLA 5FB2A 1GXPA 3GEZA 3GFMA 4UV8A 3EQLF 2FNAA 5D4RA 2F2EA 2LKPA 1IN4A 4GCVA 5DDGA 2RKHA 3BROA 4RB1A 2ZMEA 1KU2A 3R6SA 2COMA 3KP6A 1ZRDA 3KP7A 2QUFA 3VODA 2JTVA 3LQQA 2L01A 4I01A 1USTA 1RUNA 5CVIA 1G4DA 3ZMDA 3F8NA 3AAFA 1O7FA 3FWEA 1U2WA 4LLGF 1DPRA 3GFLA 1BI0A 1R7JA 4WK8F 2NNNA 4CYDA 1S6LA 3Q9VA 3E6DA 2DBBA 4ON0A 2EV6A 3KZZA 1UB9A 3QPTA 1OR7A 4MTEA 3V7SA 3WODF 2V79A 2FA5A 3CTAA 3HHGA 1TQIA 5TJJA 1O3QA 5ILUA 2V1DA 3I58A 3ZQ7A 1YO5C 2IT0A 4P9UA 2IA0A 3H3UA 3GZ6A 2FMYA 5DV5A 5D8LB 3LA2A 3B73A 3WE3A 1WQ2A 1ZG5A 2HEOA 2FRHA 1KU3A 3HYIA 3R0AA 1LEAA 3K9TA 3HSFA 1U78A 3J80Z 3I71A 3WTTC 2EFOA 1HW1A 5JI6A 2VN2A 2D45A 3MQ0A 2PMHA 4I2OA 1K6OA 4L9NA 1EH6A 2ZXJA 2KKOA 2LNBA 5HDNA 1IZ1A 1MJBA 3LAJA 1PP7U 1F4KA 3ELKA 1ZREA 1NHAA 3KP2A 4Z2YA 1DP7P 2EK5A 4L9JA 1XSXA 2ESNA 3L00A 1FP1D 2H27A 1QGPA 2A68F 5E17F 1O3TA 1H9TA 1K78A 4HQEA 2JRTA 2IW5A 1TBXA 4HOBA 4M73A 4B09A 1BI3A 4YIFA 3WU1B 1HKQA 1YW8A 3F21A 2V1UA 1SMTA 4EVIA 1MGTA 2M87A 3IKTA 5BPIA 1BM9A 4WXDA 1OYIA 5TRDA 3GUDA 2VC0A 3FHZA 2LSOA 4U0YA 2ZCWA 3HIFA 3BJOA 3MCZA 3ECHA 3QP6A 2Y48A 4HF1A 4MNUA 2DQLA 3DEUA 2Q8KA 5FFZA 1HKTA 2XROA 3GO5A 1U3EM 5IT9K 2ADUA 3RJPA 1ZAOA 4XSZF 2EFWA 5BS6A 1FT9A 3L7WA 1E17A 4YFKF 3RI4A 1XGSA 5HDKA 3GX4X 4N9IA 4P9FA 1O57A 2K7LA 1JXSA 1WRJA 1SFUA 4ETSA 4MQVA 1R1TA 2GA2A 3R61A 1MDMB 5BOXA 3WTWC 1KA8A 1REPC 2JZYA 3RIRA 2PMUA 3WTZA 3VB2A 2BE5F 3BDDA 4L0YB 4Y17A 1IN7A 2P5LC 1IF1A 1FZPB 2OBPA 5FD5A 1W5TA 1LNWA 1BC7C 2NNYA 5AONA 2HGCA 1XGNA 1W7PD 3KP4A 4EJWA 2HYFA 4OIOF 1R58A 1LEBA 4PDKA 4KN4X 3P9CA 1K79A 4LD5A 2LF8A 1YS7A 1SD6A 3OV8A 2PLYA 1RZ4A 1J7KA 1Z05A 1R5HA 3BPXA 1FX7A 3I59B 2Z9OA 4ZYHA 3E6BA 2HTSA 2JSCA 3TO6A 2EWNA 5D5UB 3N4MA 2GIVA 2RN7A 3JW4A 2QZ8A 5HOOA 4N0BA 5IT3A 2J5OA 3WGGA 4LK0F 4AIJA 3JSPA 3DQVC 3R60A 1ZLKA 4IRGA 1QBJA 2DU9A 3U1DA 1FSEA 4L0ZB 4E70A 4EM1A 3WTYC 3DKWA 1JE8A 3F6OA 2XGXA 2LF7A 3WTSC 2VBYA 4IXAA 1ONVA 2A69F 2MLKA 3ZMZA 4PGHA 4Q48A 2BV6A 4HX4A 4EGZA 4NQWA 1XGMA 3ZMSA 1U5TB 3O3KA 4BHBA 5L3BA 1MDMA 5ILSA 5A2QZ 2EV5A 2XUBA 3TDZC 4KICA 5DCFA 1F9NA 2QM3A 1GXQA 2X0LA 2P4WA 4M72A 1KU9A 1J59A 4M71A 1U6GA 1E2XA 1ON2A 2HOEA 2HQRA 4BNCA 2L3DA 2QLZA 3E97A 3GYHX 1Y0UA 2DO7A 3R4KA 2GXGA 4QLCU 3F3XA 3IRRA 4CICA 3K1PA 3SHFA 3M1EA 4WX9A 5H6RA 2FU4A 1BN5A 2E7XA 5HS9A 2ACJA 4ENMA 1P4XA 1Z7UA 3I59A 6PAXA 2HYGD 4G6DA 5E8GA 2GAUA 3EYYA 5EEHA 5D5WB 2GA1A 3C18A 1MJ9A 2R7DA 1FYMA 3C3WA 2H09A 1CF7B 3MAJA 3MFKA 4M6YA 1ZRCA 4EJOA 5FD6A 4UVBA 3IWFA 3RYPA 1LDDA 1ZARA 2QVOA 5BQTA 3LA7A 1F1ZA 4I7HA 4L5IA 3CO6C 4KUMA 4R79A 3J80K 4CZZA 1LQ1A 4GGGA 4M74A 2MBFA 1SD7A 3REOA 2E1CA 4RAYA 3WTVC 2A5YB 1QO0D 5F64A 1LB2A 1U5TA 3RPQA 3V8KA 2HZTA 1D8KA 1B6AA 2CW0F 3TDUC 4BAYA 3O6BB 2FE3A 2CYYA 3M8FA 4A12A 2LDUA 2DW4A 2ELHA 4OU0A 4MHGA 4O3MA 3G73A 3QU3A 2IA1A 3FZVA 3E6MA 3FXRA 5E1XA 5DYMA 2DAOA 2ZNYA 3TOAA 2XKOA 1XSDA 2HFHA 4DNCA 1VTNC 3CUQC 2M1BA 1XDSA 1S7OA 1J9IA 2M30A 2Z33A 2OQGA 2E1NA 4ZZLA 4WF2A 3KETA 4MEXF 2NS0A 2EA2A 4O6JA 2DK8A 1D5VA 2XAQA 2PBIA 3DP7A 3I64A 1TQPA 1B9NA 4HQMA 1I27A 2PJPA 4G7OF 2WC2A 1BC8C 2CQKA 2XHKA 3JTHA 4EGYA 1ZN2A 4G7ZF 4XLNF 1CF7A 5K5QA 3HTSB 3EYIA 3MEXA 3ABTA 4LMYA 2OZUA 3VOEA 2DT5A 5LLQA 3HOTA 1YIOA 3LQRA 3J7AO 1QQIA 2ISYA 3L09A 2L54A 4BQAA 1CGPA 3BP8A 2JT1A 1ZG1A 4ENJA 1K78B 3U9GA 1BJAA 3T1BA 2PG4A 2K86A 2MH9A 5E1ZB 2F5CA 1WWXA 3WGHA 1D3YA 2WTEA 2DQRA 2XAFA 2QBYA 2AXLA 4HF0A 4RGSA 5JVTA 1W4MA 5HS7A 3O2PE 4A5NA 2L02A 1DUXC 1JHHA 1G3WA 5FGMA 2GZWA 5LGNA 1DDNA 1Z6RA 4EM0B 2TDXA 4XRFA 4UVAA 3IC7A 2MH2A 4YFNF 2ZFWA 2ZNZA 4LLNA 2VT2A 2GWRA 4GXOA 4I02A 1KU7A 2A61A 2ESHA 4ZZDA 2HKOA 2V1XA 1BIAA 2KJBA 1FLIA 1IRGA 3BJ6A 4I0BA 1HSTA 4OIQF 2Q0OA 1JGSA 2IRFG 2MA3A 2K4JA 1P4AA 4ESFA 2STTA 4XBFA 1R1UA 4L9VA 1BOAA 1R1VA 4BHPA 4OMZA 2W24A 4ESJA 2O61A 1KYZA 3Q9SA 5JR3A 1TQMA 2O6GE 2JPBA 3KLOA 3T0YA 2V9VA 2NAZA 1XSVA 4HV6A 1LJ9A 1MD0A 3C7JA 4CDGA 3V8LA 2PEXA 1HW2A 4DQ2A 1UCRA 3KEOA 2YSRA 4M9XA 1SMYF 3PFIA 4MGRA 5DD8A 1IN6A 2D1HA 5CLSA 1YTYA 1EH8A 1IN8A 3TGNA 5LEKA 1XGOA 3V7RA 3G3ZA 5A2QK 4HW0A 2O03A 1BBYA 1XN7A 4B8XA 2FBIA 3F8MA 3QOPA 3GZ5A 2A6EF 1V3FA 3B02A 4OMYA 1ON1A 1USSA 2XV4S 2CGPA 4PCQA 3IRQA 2YR2A 4KT5C 2F5DA 2HTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBX A;  3LAP A;  5KVR A;  4RS8 A;  1PDN C;  2VBZ A;  1YLF A;  4ZYD A;  1J5Y A;  2GXB A;  2EFQ A;  2RVC A;  3RTR A;  3K69 A;  1HSJ A;  3ROU A;  4AIH A;  4JQF A;  3K1M A;  3WTX C;  2VC1 A;  4A0X A;  2EV0 A;  3NEU A;  3K1N A;  4U0V A;  2ISZ A;  4K2E A;  2L4M A;  1J0R A;  3GFI A;  1STZ A;  1O7L A;  2PI0 A;  3RKW A;  3J81 Z;  3IL2 A;  2IVM A;  4EJT A;  4A0Z A;  3TO7 A;  1TLH B;  2HKX A;  5DUK A;  1XCV A;  1PUE E;  1QZZ A;  2ZJ2 A;  1ZG3 A;  4R8H A;  1FBS A;  3KE2 A;  3HOS A;  4KIG A;  2Y75 A;  3ML6 A;  4UV9 A;  5LGT A;  4OIP F;  2OAZ A;  1O3S A;  1S3J A;  3SZP A;  5D5V B;  4LG0 A;  2OA4 A;  5CVU A;  3RKY A;  2XAG A;  2K02 A;  4HX8 A;  5DUI A;  4ZYG A;  1YYV A;  3F23 A;  4OOI A;  1L0O C;  4RGR A;  5L3D A;  3M8E A;  2FBK A;  3PQK A;  2UXN A;  3KCC A;  2OZ6 A;  5JFR A;  1FNN A;  4XLP F;  3P9K A;  3RDI A;  1L3L A;  1UHM A;  2A3S A;  1J2X A;  2VXZ A;  4IPA A;  4S04 A;  1OYW A;  1ODD A;  1QNT A;  2EJR A;  5E8I A;  3DXJ F;  2FSW A;  2Z99 A;  1TNT A;  3FF5 A;  2HR3 A;  5HDG A;  3IWZ A;  4OIR F;  4AVP A;  3ISP A;  1X3U A;  1ZGA A;  5AIP A;  5DEQ A;  4UXN A;  4P55 A;  3HSE A;  2MC3 A;  3ZN0 A;  4HLX A;  4Y13 A;  3F22 A;  5E1W A;  2M8E A;  3H3Z A;  4KFC A;  5CVV A;  4EJU A;  2BEO A;  5L3G A;  5J8F A;  5FLX Z;  1EV7 A;  3EUH A;  4R1H A;  3QAH A;  3KFW X;  1RUO A;  3ZMT A;  1YS6 A;  4RAZ A;  5K5O A;  3E5U A;  1BI2 A;  3D0S A;  3ZMU A;  5FFX A;  5D6E A;  5HLI A;  2FOK A;  4Q4Z F;  2DK5 A;  2Z5U A;  1FY7 A;  1HW5 A;  1JHF A;  1U5T C;  3T8T A;  5ED4 A;  4IHT A;  1OPC A;  1HXD A;  4LB6 B;  3QRF F;  4G94 A;  2DFI A;  3K2Z A;  1MJA A;  2DPD A;  2V6C A;  4KN7 X;  4IVN A;  1G3Y A;  2Z3Y A;  5HLG A;  5D8K B;  1RNL A;  3K0L A;  1B59 A;  3RKX A;  4YFX F;  3SFZ A;  3HRM A;  1SD4 A;  4D0P A;  5KK1 A;  3E5X A;  4I09 A;  3N97 A;  3HHH A;  3BOQ A;  2YX4 A;  1SD5 A;  5D5X B;  4Q5S F;  3JTG A;  2QEN A;  1U8R A;  1FC3 A;  3FM3 A;  1I1S A;  2XVC A;  3RYR A;  4JK1 X;  3WE2 A;  1T39 A;  3NRV A;  3WGI A;  3ABU A;  1FSH A;  2DI3 A;  1H0M A;  3E5Q A;  1RI7 A;  2DLL A;  2OU2 A;  4BXU A;  2A07 F;  2QBY B;  2ZBK A;  3DPT A;  1HKS A;  2P8T A;  3BJA A;  1WI9 A;  1P6R A;  5CVJ A;  2PFB A;  2BYV E;  4M9S A;  3FMS A;  3HUG A;  3ULQ B;  3GFJ A;  4O5V A;  3IKV A;  4P96 A;  2OD5 A;  3I0T A;  4BYY A;  2QYO A;  3T5X A;  3HRT A;  3CLO A;  1KQ0 A;  4EV0 A;  1XCB A;  4LGW A;  4RB0 A;  4U0W A;  1OKR A;  2P5V A;  2YPR A;  5DCM A;  5CYV A;  4M6X A;  3L2C A;  4UVC A;  5F1R A;  5L3E A;  4WWC A;  2XAH A;  2RNJ A;  5FO5 A;  2IJL A;  2QWW A;  3FX3 A;  2IPQ X;  3ERE D;  2CSO A;  1DPU A;  5DD4 A;  4PZJ A;  3E6C C;  2RQP A;  2CG4 A;  1S29 A;  5ICF A;  1G3T A;  2KIF A;  4HV5 A;  4A6E A;  2IA2 A;  4CGZ A;  4GYG A;  2RDP A;  1P92 A;  3DF8 A;  1TNS A;  4UNO A;  2CWE A;  4CXF A;  5J6X A;  3CO7 C;  1P2F A;  3LFK A;  4HA8 A;  1V4R A;  3TOB A;  2QQ9 A;  3M7G A;  2GQQ A;  1O3R A;  1IW7 F;  5J8C A;  4OIN F;  3GWZ A;  5LBQ A;  2C6Y A;  5E18 F;  2M5W A;  4IRH A;  2P6T A;  2NRA C;  5LHI A;  1TTY A;  2YX7 A;  2J5P A;  3SQN A;  1GVJ A;  3V4G A;  3EDP A;  4U7B A;  5LEJ A;  3D5L A;  1LVA A;  4F7Z A;  1C0W A;  1UHW A;  3QU6 A;  3CUQ A;  1ZLJ A;  1FPQ A;  4FHT A;  4ZYE A;  2NYX A;  4JBA A;  4Q47 A;  5AIQ A;  2WWY A;  3LST A;  1I6X A;  4RB3 C;  3J81 K;  3W6K B;  1B4A A;  5K5R A;  2H6C A;  2G7H A;  3DFG A;  1IUY A;  2EA4 A;  4WXH A;  5BMZ A;  3HSR A;  1W7P A;  4HBL A;  3V7C A;  3U2R A;  3F8C A;  3BWG A;  4GYI A;  1XMA A;  3H92 A;  4NHJ A;  2P7V B;  3T8R A;  4RB2 C;  4XSX F;  3IHU A;  2HQN A;  2UZK A;  1T38 A;  5H6Q A;  4G8X A;  2A6H F;  2P6S A;  4HX7 A;  1IAW A;  1GHC A;  5LRS A;  4ENK A;  2Y0M A;  2R7F A;  3RPU A;  5LRR A;  4A6D A;  5CVR A;  1HQC A;  3DPL C;  4UUV A;  3HRU A;  2G9W A;  1MZB A;  4YII A;  2PQ8 A;  3KLN A;  3JAM Z;  3QP5 A;  2RGV A;  1D8J A;  2CFX A;  1KQ8 A;  2WV0 A;  2BBY A;  1FBU A;  2FBH A;  1BI1 A;  5BPD A;  4LK1 F;  1T2K A;  1MKM A;  1ZH5 A;  3F8B A;  2W57 A;  3ZMV A;  4GO1 A;  3QPH A;  1KYW A;  4LJZ F;  1B9M A;  4LG0 B;  1FYK A;  4G9Y A;  2XKP A;  1FYL A;  5LHG A;  2QQB A;  2O3F A;  2VT3 A;  2Q2E A;  2DPU A;  1ULY A;  4A5M A;  4UHT A;  3F8F A;  4N9H A;  1K7A A;  5ICG A;  5FLX K;  1T6S A;  3F72 A;  1WSU A;  1T0F A;  2P5K A;  3OOP A;  4KNY A;  5E20 A;  3BY6 A;  4ESB A;  3WU0 A;  1T98 A;  3COA C;  3CDH A;  3NQO A;  4ASN A;  3FMR A;  1R00 A;  1R36 A;  5ILV A;  2D2W A;  4PGG A;  2EFP A;  1LDJ A;  5LHH A;  3LWF A;  3P7N A;  3EET A;  1ZRF A;  4FT8 A;  4KIB A;  1YW7 A;  5F6F A;  3DV8 A;  2W85 A;  3TO9 A;  1H9G A;  3FMQ A;  2XAS A;  4BH9 A;  3MZY A;  2F5E A;  4G6Q A;  3GF2 A;  1J75 A;  2VBW A;  4KA4 A;  1YW9 A;  4HDU A;  4FX4 A;  3KZY A;  3ZN1 A;  4P5O A;  2STW A;  1R22 A;  3HTU A;  3VFZ A;  1TW3 A;  3ZPL A;  1IXR C;  1Z91 A;  1AWC A;  1UFM A;  4EM2 A;  3KEQ A;  5CJ9 A;  4HLY A;  3MZH A;  1ZGJ A;  4IJA A;  5EEG A;  1XMK A;  4IHS A;  3I5U A;  1LDK B;  3WTU C;  1SFX A;  2CO5 A;  5ERI A;  3KP5 A;  2FQ3 A;  4WXC A;  1B1B A;  4MQ9 F;  4ENN A;  3S2W A;  3VEP A;  1KGS A;  3R0J A;  4AD9 A;  2PN6 A;  1G6N A;  4EJV A;  1XDU A;  4TV7 A;  2E7W A;  1PP8 F;  2MLG A;  1XB4 A;  2W25 A;  4IRI A;  4LLL A;  3JSO A;  4HYE A;  4A2U A;  1QZY A;  4HF2 A;  1WKM A;  2F5F A;  4IF4 A;  4RGX A;  3I53 A;  2VOP A;  1Z1D A;  3KP3 A;  1W5S A;  3WG9 A;  1A04 A;  2VOD A;  1ZYR F;  3P9I A;  2RC4 A;  3ECO A;  1Q1H A;  4KIF A;  3CUO A;  1G3S A;  1R23 A;  3ZP5 A;  2KJC A;  1FP2 A;  4YG2 F;  5L3C A;  5ICC A;  2VON A;  4LFU A;  2UWM A;  2JPC A;  2YU3 A;  1HBX G;  4RGU A;  2R3S A;  5D4S A;  4CHU A;  1S7A A;  5HLH A;  2OQR A;  2G7U A;  4LB5 A;  1IXS B;  3FXQ A;  1OMI A;  2HDC A;  1IRF A;  2EFN A;  2ETH A;  2FNP A;  2XIG A;  2H94 A;  3Q5F A;  3V8J A;  4HZF A;  1EH7 A;  4MEY F;  4KYW A;  2KIU A;  1QPM A;  4FX0 A;  4ZH4 F;  4KMU X;  5DCM B;  3E3V A;  2X4H A;  4BHC A;  4HAM A;  5IT9 Z;  3GXO A;  1KQ9 A;  1RIO H;  4AIK A;  2ZO4 A;  3BPV A;  1Z6T A;  4H0E A;  2H6B A;  4EQQ A;  3BZ6 A;  4I98 B;  5JHU A;  2KIM A;  5ICE A;  1P4W A;  2M45 A;  1AOY A;  3C1D A;  3SZT A;  4MTD A;  1I1G A;  1YQA A;  2B0L A;  1YFH A;  2QQA A;  2EB7 A;  4HDV A;  2AS5 F;  2ZME B;  4KMF A;  4EMS A;  4KDP A;  1YG2 A;  4NB5 A;  2IP2 A;  5HVQ C;  1FOK A;  3I54 A;  5L3F A;  2XRN A;  4CO8 A;  3LA3 A;  2K27 A;  2VE8 A;  3HRS A;  1FBQ A;  2DTR A;  4L5J A;  4U7D A;  2L4A A;  2O0Y A;  3TKY A;  1R5G A;  1F5T A;  2FF4 A;  2D1V A;  4I0A A;  5D6F A;  1XD7 A;  4AWX B;  2W84 A;  1ZHF A;  3FM5 A;  1OYY A;  3PQJ A;  2XAJ A;  2BGC A;  4G7H F;  3CUQ B;  2FXA A;  4M9Z A;  2P7C B;  4S05 A;  3JAM K;  3W6J B;  5LGU A;  3SXY A;  5H20 A;  1SFE A;  3TQN A;  2VE9 A;  1SAX A;  2K4B A;  3MWM A;  1FWZ A;  1W7P B;  4U88 A;  3F6V A;  2KRF A;  3GW2 A;  2RV8 A;  2MD5 A;  2ZKZ A;  1IXC A;  2HWV A;  3CJN A;  2O8X A;  5HS8 A;  3I4P A;  5K1Y A;  1BIB A;  3GVA A;  2HS5 A;  1Z9C A;  3L9F A;  1IN5 A;  1I5Z A;  2UXX A;  2VOO A;  4A0Y A;  4QWQ A;  4L9T A;  1TW2 A;  3M9A A;  4Y15 A;  4L18 B;  2FEZ A;  3FXU A;  4WCG A;  1S8N A;  3GLX A;  2FML A;  5FB2 A;  1GXP A;  3GEZ A;  3GFM A;  4UV8 A;  3EQL F;  2FNA A;  5D4R A;  2F2E A;  2LKP A;  1IN4 A;  4GCV A;  5DDG A;  2RKH A;  3BRO A;  4RB1 A;  2ZME A;  1KU2 A;  3R6S A;  2COM A;  3KP6 A;  1ZRD A;  3KP7 A;  2QUF A;  3VOD A;  2JTV A;  3LQQ A;  2L01 A;  4I01 A;  1UST A;  1RUN A;  5CVI A;  1G4D A;  3ZMD A;  3F8N A;  3AAF A;  1O7F A;  3FWE A;  1U2W A;  4LLG F;  1DPR A;  3GFL A;  1BI0 A;  1R7J A;  4WK8 F;  2NNN A;  4CYD A;  1S6L A;  3Q9V A;  3E6D A;  2DBB A;  4ON0 A;  2EV6 A;  3KZZ A;  1UB9 A;  3QPT A;  1OR7 A;  4MTE A;  3V7S A;  3WOD F;  2V79 A;  2FA5 A;  3CTA A;  3HHG A;  1TQI A;  5TJJ A;  1O3Q A;  5ILU A;  2V1D A;  3I58 A;  3ZQ7 A;  1YO5 C;  2IT0 A;  4P9U A;  2IA0 A;  3H3U A;  3GZ6 A;  2FMY A;  5DV5 A;  5D8L B;  3LA2 A;  3B73 A;  3WE3 A;  1WQ2 A;  1ZG5 A;  2HEO A;  2FRH A;  1KU3 A;  3HYI A;  3R0A A;  1LEA A;  3K9T A;  3HSF A;  1U78 A;  3J80 Z;  3I71 A;  3WTT C;  2EFO A;  1HW1 A;  5JI6 A;  2VN2 A;  2D45 A;  3MQ0 A;  2PMH A;  4I2O A;  1K6O A;  4L9N A;  1EH6 A;  2ZXJ A;  2KKO A;  2LNB A;  5HDN A;  1IZ1 A;  1MJB A;  3LAJ A;  1PP7 U;  1F4K A;  3ELK A;  1ZRE A;  1NHA A;  3KP2 A;  4Z2Y A;  1DP7 P;  2EK5 A;  4L9J A;  1XSX A;  2ESN A;  3L00 A;  1FP1 D;  2H27 A;  1QGP A;  2A68 F;  5E17 F;  1O3T A;  1H9T A;  1K78 A;  4HQE A;  2JRT A;  2IW5 A;  1TBX A;  4HOB A;  4M73 A;  4B09 A;  1BI3 A;  4YIF A;  3WU1 B;  1HKQ A;  1YW8 A;  3F21 A;  2V1U A;  1SMT A;  4EVI A;  1MGT A;  2M87 A;  3IKT A;  5BPI A;  1BM9 A;  4WXD A;  1OYI A;  5TRD A;  3GUD A;  2VC0 A;  3FHZ A;  2LSO A;  4U0Y A;  2ZCW A;  3HIF A;  3BJO A;  3MCZ A;  3ECH A;  3QP6 A;  2Y48 A;  4HF1 A;  4MNU A;  2DQL A;  3DEU A;  2Q8K A;  5FFZ A;  1HKT A;  2XRO A;  3GO5 A;  1U3E M;  5IT9 K;  2ADU A;  3RJP A;  1ZAO A;  4XSZ F;  2EFW A;  5BS6 A;  1FT9 A;  3L7W A;  1E17 A;  4YFK F;  3RI4 A;  1XGS A;  5HDK A;  3GX4 X;  4N9I A;  4P9F A;  1O57 A;  2K7L A;  1JXS A;  1WRJ A;  1SFU A;  4ETS A;  4MQV A;  1R1T A;  2GA2 A;  3R61 A;  1MDM B;  5BOX A;  3WTW C;  1KA8 A;  1REP C;  2JZY A;  3RIR A;  2PMU A;  3WTZ A;  3VB2 A;  2BE5 F;  3BDD A;  4L0Y B;  4Y17 A;  1IN7 A;  2P5L C;  1IF1 A;  1FZP B;  2OBP A;  5FD5 A;  1W5T A;  1LNW A;  1BC7 C;  2NNY A;  5AON A;  2HGC A;  1XGN A;  1W7P D;  3KP4 A;  4EJW A;  2HYF A;  4OIO F;  1R58 A;  1LEB A;  4PDK A;  4KN4 X;  3P9C A;  1K79 A;  4LD5 A;  2LF8 A;  1YS7 A;  1SD6 A;  3OV8 A;  2PLY A;  1RZ4 A;  1J7K A;  1Z05 A;  1R5H A;  3BPX A;  1FX7 A;  3I59 B;  2Z9O A;  4ZYH A;  3E6B A;  2HTS A;  2JSC A;  3TO6 A;  2EWN A;  5D5U B;  3N4M A;  2GIV A;  2RN7 A;  3JW4 A;  2QZ8 A;  5HOO A;  4N0B A;  5IT3 A;  2J5O A;  3WGG A;  4LK0 F;  4AIJ A;  3JSP A;  3DQV C;  3R60 A;  1ZLK A;  4IRG A;  1QBJ A;  2DU9 A;  3U1D A;  1FSE A;  4L0Z B;  4E70 A;  4EM1 A;  3WTY C;  3DKW A;  1JE8 A;  3F6O A;  2XGX A;  2LF7 A;  3WTS C;  2VBY A;  4IXA A;  1ONV A;  2A69 F;  2MLK A;  3ZMZ A;  4PGH A;  4Q48 A;  2BV6 A;  4HX4 A;  4EGZ A;  4NQW A;  1XGM A;  3ZMS A;  1U5T B;  3O3K A;  4BHB A;  5L3B A;  1MDM A;  5ILS A;  5A2Q Z;  2EV5 A;  2XUB A;  3TDZ C;  4KIC A;  5DCF A;  1F9N A;  2QM3 A;  1GXQ A;  2X0L A;  2P4W A;  4M72 A;  1KU9 A;  1J59 A;  4M71 A;  1U6G A;  1E2X A;  1ON2 A;  2HOE A;  2HQR A;  4BNC A;  2L3D A;  2QLZ A;  3E97 A;  3GYH X;  1Y0U A;  2DO7 A;  3R4K A;  2GXG A;  4QLC U;  3F3X A;  3IRR A;  4CIC A;  3K1P A;  3SHF A;  3M1E A;  4WX9 A;  5H6R A;  2FU4 A;  1BN5 A;  2E7X A;  5HS9 A;  2ACJ A;  4ENM A;  1P4X A;  1Z7U A;  3I59 A;  6PAX A;  2HYG D;  4G6D A;  5E8G A;  2GAU A;  3EYY A;  5EEH A;  5D5W B;  2GA1 A;  3C18 A;  1MJ9 A;  2R7D A;  1FYM A;  3C3W A;  2H09 A;  1CF7 B;  3MAJ A;  3MFK A;  4M6Y A;  1ZRC A;  4EJO A;  5FD6 A;  4UVB A;  3IWF A;  3RYP A;  1LDD A;  1ZAR A;  2QVO A;  5BQT A;  3LA7 A;  1F1Z A;  4I7H A;  4L5I A;  3CO6 C;  4KUM A;  4R79 A;  3J80 K;  4CZZ A;  1LQ1 A;  4GGG A;  4M74 A;  2MBF A;  1SD7 A;  3REO A;  2E1C A;  4RAY A;  3WTV C;  2A5Y B;  1QO0 D;  5F64 A;  1LB2 A;  1U5T A;  3RPQ A;  3V8K A;  2HZT A;  1D8K A;  1B6A A;  2CW0 F;  3TDU C;  4BAY A;  3O6B B;  2FE3 A;  2CYY A;  3M8F A;  4A12 A;  2LDU A;  2DW4 A;  2ELH A;  4OU0 A;  4MHG A;  4O3M A;  3G73 A;  3QU3 A;  2IA1 A;  3FZV A;  3E6M A;  3FXR A;  5E1X A;  5DYM A;  2DAO A;  2ZNY A;  3TOA A;  2XKO A;  1XSD A;  2HFH A;  4DNC A;  1VTN C;  3CUQ C;  2M1B A;  1XDS A;  1S7O A;  1J9I A;  2M30 A;  2Z33 A;  2OQG A;  2E1N A;  4ZZL A;  4WF2 A;  3KET A;  4MEX F;  2NS0 A;  2EA2 A;  4O6J A;  2DK8 A;  1D5V A;  2XAQ A;  2PBI A;  3DP7 A;  3I64 A;  1TQP A;  1B9N A;  4HQM A;  1I27 A;  2PJP A;  4G7O F;  2WC2 A;  1BC8 C;  2CQK A;  2XHK A;  3JTH A;  4EGY A;  1ZN2 A;  4G7Z F;  4XLN F;  1CF7 A;  5K5Q A;  3HTS B;  3EYI A;  3MEX A;  3ABT A;  4LMY A;  2OZU A;  3VOE A;  2DT5 A;  5LLQ A;  3HOT A;  1YIO A;  3LQR A;  3J7A O;  1QQI A;  2ISY A;  3L09 A;  2L54 A;  4BQA A;  1CGP A;  3BP8 A;  2JT1 A;  1ZG1 A;  4ENJ A;  1K78 B;  3U9G A;  1BJA A;  3T1B A;  2PG4 A;  2K86 A;  2MH9 A;  5E1Z B;  2F5C A;  1WWX A;  3WGH A;  1D3Y A;  2WTE A;  2DQR A;  2XAF A;  2QBY A;  2AXL A;  4HF0 A;  4RGS A;  5JVT A;  1W4M A;  5HS7 A;  3O2P E;  4A5N A;  2L02 A;  1DUX C;  1JHH A;  1G3W A;  5FGM A;  2GZW A;  5LGN A;  1DDN A;  1Z6R A;  4EM0 B;  2TDX A;  4XRF A;  4UVA A;  3IC7 A;  2MH2 A;  4YFN F;  2ZFW A;  2ZNZ A;  4LLN A;  2VT2 A;  2GWR A;  4GXO A;  4I02 A;  1KU7 A;  2A61 A;  2ESH A;  4ZZD A;  2HKO A;  2V1X A;  1BIA A;  2KJB A;  1FLI A;  1IRG A;  3BJ6 A;  4I0B A;  1HST A;  4OIQ F;  2Q0O A;  1JGS A;  2IRF G;  2MA3 A;  2K4J A;  1P4A A;  4ESF A;  2STT A;  4XBF A;  1R1U A;  4L9V A;  1BOA A;  1R1V A;  4BHP A;  4OMZ A;  2W24 A;  4ESJ A;  2O61 A;  1KYZ A;  3Q9S A;  5JR3 A;  1TQM A;  2O6G E;  2JPB A;  3KLO A;  3T0Y A;  2V9V A;  2NAZ A;  1XSV A;  4HV6 A;  1LJ9 A;  1MD0 A;  3C7J A;  4CDG A;  3V8L A;  2PEX A;  1HW2 A;  4DQ2 A;  1UCR A;  3KEO A;  2YSR A;  4M9X A;  1SMY F;  3PFI A;  4MGR A;  5DD8 A;  1IN6 A;  2D1H A;  5CLS A;  1YTY A;  1EH8 A;  1IN8 A;  3TGN A;  5LEK A;  1XGO A;  3V7R A;  3G3Z A;  5A2Q K;  4HW0 A;  2O03 A;  1BBY A;  1XN7 A;  4B8X A;  2FBI A;  3F8M A;  3QOP A;  3GZ5 A;  2A6E F;  1V3F A;  3B02 A;  4OMY A;  1ON1 A;  1USS A;  2XV4 S;  2CGP A;  4PCQ A;  3IRQ A;  2YR2 A;  4KT5 C;  2F5D A;  2HTJ A; 
#chains in the Genus database with same CATH topology
 2K9S A;  2VBX A;  3WHB A;  3LAP A;  1GVD A;  4AUX A;  5KVR A;  4RS8 A;  1PDN C;  2VBZ A;  1YLF A;  4ZYD A;  2M9H A;  1HCR A;  1VQ7 I;  2BY0 A;  2ZFU A;  1J5Y A;  1RET A;  2GXB A;  2EFQ A;  2RVC A;  3RTR A;  3K69 A;  9ANT A;  1HSJ A;  2ID6 A;  4NQW B;  3ROU A;  4BJ6 C;  4AIH A;  3PUF A;  4JQF A;  3K1M A;  3WTX C;  4KIT B;  2VC1 A;  3HDD A;  3KPH A;  4A0X A;  5J4Y A;  2EV0 A;  2F4I A;  5IP7 J;  3NEU A;  4G12 A;  2E2H J;  3K1N A;  4U0V A;  1HDD C;  3AL0 B;  2ISZ A;  4K2E A;  1GV5 A;  4H4K C;  5F0F A;  2L4M A;  1J0R A;  3GFI A;  1STZ A;  1O7L A;  3NAU A;  2HOT A;  2F4M B;  2PI0 A;  3M1C A;  4F3Q A;  3RKW A;  4B43 A;  2HPI A;  3J81 Z;  1F36 A;  3IL2 A;  2IVM A;  4EJT A;  4A0Z A;  4AYB A;  2JJ7 A;  1TLH B;  3TO7 A;  3I55 I;  4UY8 I;  4ZYA A;  4BS9 A;  2XC7 A;  3S2H J;  2HKX A;  1BJZ A;  5DUK A;  1XCV A;  3D5R C;  1PUE E;  1QZZ A;  1X19 A;  1ZG3 A;  2ZJ2 A;  4R8H A;  3DBR B;  1FBS A;  2OF7 A;  4FE7 A;  3KE2 A;  2GM4 A;  3ASO H;  5EYR A;  3HOS A;  2M8G X;  3HG9 A;  2Y75 A;  3ML6 A;  4KIG A;  4UV9 A;  5LGT A;  4BXF A;  1WH7 A;  4OIP F;  2OAZ A;  1O3S A;  1S3J A;  1A31 A;  3PFY A;  3SZP A;  5D5V B;  1VQP I;  2N8G A;  4LG0 A;  3W2V A;  2OA4 A;  5CVU A;  3RKY A;  1WJD A;  2XAG A;  3FXO A;  3HGY A;  4F55 A;  2K02 A;  4HX8 A;  1SAN A;  5DUI A;  4ZYG A;  2MW8 A;  5EGO A;  2ZJQ F;  2DA4 A;  1YYV A;  4BQN A;  2R5Y A;  2IXS A;  1RKW A;  3F23 A;  3GTL J;  4OOI A;  2BZT A;  5FKN A;  5IYB J;  1L0O C;  3S2D J;  4RGR A;  5L3D A;  4MLO A;  1H89 C;  4XRS A;  5KAF C;  1VQK I;  3M8E A;  1Z7L A;  3BQY A;  2R92 J;  2RNG A;  4W97 A;  2O9L A;  2E60 A;  2FBK A;  3PQK A;  2UXN A;  2R7O A;  3BQZ A;  3KCC A;  2OZ6 A;  2BY2 A;  5JFR A;  1IV8 A;  4A3F J;  1FNN A;  1ETK A;  4XLP F;  1EJ9 A;  2E34 A;  3P9K A;  4A3I J;  3RDI A;  1L3L A;  1UHM A;  2A3S A;  1J2X A;  2VXZ A;  4IPA A;  1I6H J;  4S04 A;  3G6E I;  5HNF A;  1OYW A;  5C4J J;  2E2I J;  1ODD A;  1QNT A;  2VL8 A;  5FRN A;  2EJR A;  3F0C A;  5E8I A;  3DXJ F;  4LIT A;  3CES A;  2L7F P;  2FSW A;  2Z99 A;  1TNT A;  2Q1Z B;  4YEJ A;  3U1K A;  3FF5 A;  3O8H A;  3OYG A;  2HR3 A;  5HDG A;  1M1E B;  3IWZ A;  4OIR F;  4AVP A;  3ISP A;  1X3U A;  1ZGA A;  2IGM A;  5AIP A;  5DEQ A;  4UXN A;  1MBE A;  4P55 A;  3K4B A;  1B8I B;  2KHM A;  3HSE A;  3M8J A;  2MC3 A;  4UUS A;  5DM7 F;  3ZN0 A;  4HLX A;  3WHC A;  1X3W B;  4Y13 A;  3F22 A;  1JKR C;  2V6E A;  1V54 H;  5DM6 F;  5E1W A;  2M8E A;  2HNH A;  4J01 A;  3BR2 A;  3H3Z A;  4KFC A;  4F92 B;  2ELK A;  5CVV A;  1OJL A;  4ZDO A;  4EJU A;  5K7F A;  2BEO A;  3QWL A;  2BY3 A;  5L3G A;  5J8F A;  5K7H A;  3HUG B;  2WY8 Q;  5FLX Z;  4BE1 A;  1EV7 A;  2WV1 A;  3LMM A;  5DS9 A;  4XID A;  3EUH A;  4R1H A;  5FKL A;  3JRH A;  1W0U A;  3OMY A;  3QAH A;  4XQF A;  1VFC A;  2M34 A;  3KFW X;  4I6Z A;  2LYC A;  1RUO A;  3ZMT A;  5KAI C;  3I4N J;  1YS6 A;  4RAZ A;  5K5O A;  3E5U A;  1LE8 B;  5GAG J;  3HOU J;  1BI2 A;  2L9S A;  3D0S A;  1X58 A;  3HPG A;  3ZMU A;  5FFX A;  4HG2 A;  1POG A;  1FOY A;  3CCS I;  2W1O A;  5D6E A;  5HLI A;  4FCY A;  3OYN A;  2FOK A;  4Q4Z F;  2DK5 A;  2Z5U A;  4LIV A;  1FY7 A;  4IL6 C;  2VIX A;  4HRI A;  5C44 J;  1HW5 A;  1JHF A;  1TT0 A;  1U5T C;  3FBI B;  3GTG J;  1VQ4 I;  1SFO J;  3T8T A;  2I10 A;  2OJE D;  3S8P A;  5ED4 A;  4IHT A;  2YUS A;  5M5Y J;  1MH3 A;  1OPC A;  1HXD A;  1X1A A;  3G1M A;  1QVU A;  4LIU A;  3WG7 H;  4LB6 B;  2R7W A;  3IUO A;  3QRF F;  2CU7 A;  4G94 A;  2DFI A;  3K2Z A;  5BNG A;  3OS0 A;  1W36 D;  1JT6 A;  2KZG A;  2LK2 A;  3V42 A;  1MJA A;  2DPD A;  2V6C A;  2IS2 A;  2HPM A;  4KN7 X;  1PYV A;  4IVN A;  4DYQ A;  1G3Y A;  3G4S I;  2Z3Y A;  5HLG A;  3MD2 A;  5D8K B;  3QYF A;  1VQN I;  1RNL A;  3IH4 A;  3K0L A;  1B59 A;  3RKX A;  4YFX F;  3W2A A;  1YX3 A;  4Y3O A;  3SFZ A;  3CP2 A;  3HRM A;  3NAR A;  1SD4 A;  4YIR X;  2KFD A;  5J3L A;  4D0P A;  2X48 A;  5F1J A;  5KK1 A;  3E5X A;  4I09 A;  3S14 J;  3N97 A;  3DWL E;  5FKO A;  4FIS A;  4C2U A;  4AVZ A;  3HHH A;  3BOQ A;  2BY1 A;  2YX4 A;  4AU7 A;  1SD5 A;  2KL4 A;  5D5X B;  4Q5S F;  2JA8 J;  3JTG A;  3GME A;  4B48 A;  2QEN A;  1U8R A;  1FC3 A;  3FM3 A;  1JUP A;  3QOD A;  4V2F A;  2DA3 A;  1I1S A;  2XVC A;  3RYR A;  4JK1 X;  3WE2 A;  4C9Y A;  1T39 A;  2VXD A;  2K40 A;  3NRV A;  2E1M B;  3WGI A;  3ABU A;  1FSH A;  1B8I A;  2DI3 A;  1H0M A;  3E5Q A;  1RI7 A;  2QCO A;  4CH7 A;  2BHZ A;  2TRT A;  2VKE A;  4NC6 A;  2PMZ A;  3PIP F;  2QEX I;  2DLL A;  3GTQ J;  2OU2 A;  4BXU A;  4D1Q A;  1ZR2 A;  4E7Z A;  1GLN A;  1MBF A;  2A07 F;  2QBY B;  4PJL A;  2ZBK A;  3DPT A;  5M5W J;  1HKS A;  2LKS A;  1NH3 A;  4A3L J;  2P8T A;  3BJA A;  1WI9 A;  1P6R A;  5CVJ A;  2PFB A;  1TT5 B;  2BYV E;  2ID3 A;  4XKB A;  2DA6 A;  3FMS A;  4M9S A;  4PFP A;  3HUG A;  1J09 A;  2LOO A;  1VQ8 I;  3ULQ B;  3CDI A;  1I3Q J;  3GFJ A;  3H35 A;  4O5V A;  1Y8R B;  2FX0 A;  3IKV A;  3F9K A;  3C2B A;  3S3M A;  2VB6 A;  4P96 A;  3W6V A;  2CQQ A;  2OD5 A;  3I0T A;  4BYY A;  4BBR J;  2QYO A;  3T5X A;  3HRT A;  1KON A;  1NG6 A;  3IH3 A;  3S93 A;  3CCL I;  4ANJ A;  3CLO A;  1JI8 A;  3BCA A;  5FRM A;  1KQ0 A;  2O8K A;  1LE8 A;  4EV0 A;  1VF9 A;  1WJF A;  4ITV A;  4BGD A;  3E7L A;  3S16 J;  2E1M C;  3ZRG A;  3MVP A;  3IH2 A;  1XCB A;  3MKW B;  3M4O J;  1FIA A;  2M3A A;  1B72 A;  3HL2 A;  2HVS A;  2R5Z B;  4LGW A;  4DZP A;  4GRI A;  4RB0 A;  2JN6 A;  4U0W A;  1OKR A;  2DJN A;  2P5V A;  4M6V A;  1FOX A;  2YPR A;  5DCM A;  2VJ5 A;  5CYV A;  5GTI C;  4M6X A;  4DZJ A;  3L2C A;  4UVC A;  5F1R A;  5L3E A;  2B7E A;  2ZXW H;  1YJN I;  4WWC A;  2XAH A;  2RNJ A;  3FXM A;  3LSH A;  5FO5 A;  2IJL A;  2QWW A;  3TMO A;  2DMP A;  1YIT I;  1X3Z B;  3FX3 A;  4QTR A;  3HGG A;  2CV0 A;  1JUM A;  2IPQ X;  4PJM A;  2CUJ A;  2K9N A;  4A3E J;  4HNV A;  3ERE D;  2CSO A;  3FHN A;  1DPU A;  5DD4 A;  2P0W A;  2DMQ A;  4PZJ A;  3E6C C;  2RQP A;  2CG4 A;  3HKZ A;  3K7A J;  1S29 A;  5ICF A;  1G3T A;  2KIF A;  5H2F C;  4HV5 A;  4A6E A;  3S3N A;  1LKX A;  2IA2 A;  4CGZ A;  4GYG A;  3FK7 A;  2RDP A;  1P92 A;  1VZ0 A;  2JA2 A;  3DF8 A;  2KPM A;  3PM1 A;  2JA7 J;  1TNS A;  4UNO A;  2CWE A;  1NK3 P;  4CXF A;  5J6X A;  4NUB A;  3CO7 C;  3OYH A;  2NVU B;  1P2F A;  3LFK A;  1GUU A;  3A4C A;  4HA8 A;  5J4V A;  1A6Q A;  2JA6 J;  1V4R A;  3PNY A;  3TOB A;  2CV2 A;  2FJ1 A;  2QQ9 A;  2F6C A;  3M7G A;  2GQQ A;  1VI0 A;  1O3R A;  3S1M J;  1ZGW A;  3DKY A;  1IW7 F;  5J8C A;  4OIN F;  4QPQ A;  4NBQ A;  3GWZ A;  5LBQ A;  1V5F A;  4V2G A;  2C6Y A;  5E18 F;  2M5W A;  4IRH A;  1IDY A;  4BE2 A;  2P6T A;  4D5F A;  5LHI A;  2NRA C;  2R7T A;  1TTY A;  1LVK A;  2YX7 A;  5JLX A;  3TED A;  2Q2E B;  2J5P A;  4I99 C;  2LY1 A;  3SQN A;  2VJ4 A;  5B5E C;  1GVJ A;  3D5S C;  3V4G A;  2XB0 X;  3EDP A;  2DA7 A;  4BUP A;  4U7B A;  5LEJ A;  3D5L A;  1ZR4 A;  1LVA A;  1I39 A;  4F7Z A;  1C0W A;  1UHW A;  3QU6 A;  1YX5 A;  3CUQ A;  1ZLJ A;  2VQL A;  1FPQ A;  4FHT A;  4ZYE A;  1JT0 A;  2Z2S B;  3BTJ A;  2NYX A;  4JBA A;  4Q47 A;  5AIQ A;  2HYJ A;  2WWY A;  3N05 A;  4BY1 J;  4HSR A;  5IT9 K;  3LST A;  1I6X A;  4RB3 C;  3J81 K;  3RZD J;  4UB6 C;  1G8X A;  3W6K B;  4CYC A;  1B4A A;  5K5R A;  2Z16 A;  2H6C A;  2G7H A;  3JRE A;  4CZC A;  2X6Y A;  3DFG A;  1IUY A;  2EA4 A;  3VSL A;  2KP6 A;  5HNH A;  4A3M J;  4WXH A;  3A2K A;  1VND A;  5BMZ A;  2UV1 A;  3CMM A;  3HSR A;  1W7P A;  4HBL A;  5F04 A;  3V7C A;  1D1B A;  3U2R A;  3CC7 I;  3F8C A;  3BWG A;  3VPR A;  1RR8 C;  4GYI A;  1XMA A;  3H92 A;  4NHJ A;  2P7V B;  3T8R A;  2R5Z A;  4CCO A;  4XSX F;  4RB2 C;  4DJA A;  2GOX B;  3IHU A;  2HQN A;  5FRO A;  2UZK A;  1T38 A;  3PSI A;  1BA5 A;  5H6Q A;  5GPA A;  4G8X A;  2A6H F;  4XRM A;  2P6S A;  2LY9 A;  4HX7 A;  4PUS A;  1OCT C;  1IAW A;  1GHC A;  5LRS A;  4ENK A;  4DYR A;  2GXA A;  2Y0M A;  3SFI A;  3OYM A;  3ZGK A;  2R7F A;  4XIC A;  3RPU A;  2DA2 A;  5LRR A;  2VKH A;  2CMP A;  4A6D A;  4RMN A;  3EUK L;  4MO7 A;  2K5C A;  5CVR A;  1HQC A;  3DPL C;  3VDX A;  3H5A A;  3OYK A;  4UUV A;  1OCR H;  1ZK8 A;  4IZZ A;  3VYS B;  3L2Q A;  2E19 A;  3HRU A;  3H3V K;  4Z6Y A;  2G9W A;  1MZB A;  4YII A;  2PQ8 A;  3KLN A;  3JAM Z;  1Y6I A;  2RAE A;  3QP5 A;  4M3F A;  5IOY A;  3L2U A;  2MFZ A;  2RGV A;  3LSJ A;  2L5Q A;  3OR1 C;  2NVT J;  2HDD A;  1D8J A;  1ZKG A;  2CFX A;  5B66 C;  2WV0 A;  1KQ8 A;  2BBY A;  1JTX A;  1YJW I;  2WAD A;  2ECC A;  1FBU A;  1XMX A;  2FBH A;  1BI1 A;  3QPS A;  2HQ5 A;  3CJT B;  5IP9 J;  5BPD A;  4LK1 F;  1O4X A;  3OIQ A;  1T2K A;  4A3G J;  1MKM A;  1ZH5 A;  3F8B A;  3BG7 A;  2W57 A;  3ZMV A;  4GO1 A;  2L7Z A;  3QPH A;  1KYW A;  2IGK A;  3K4L A;  4LJZ F;  1BOB A;  3Q0V A;  1B9M A;  4LG0 B;  1FYK A;  4G9Y A;  2XKP A;  1FYL A;  5LHG A;  1APL C;  2LP0 A;  2VI6 A;  3A0B C;  5EGO B;  4AID A;  1FMW A;  2K3F A;  2QQB A;  1LFB A;  3MN2 A;  2O3F A;  2H8W A;  4PK4 A;  2DA1 A;  2QSH X;  1FTT A;  3BG3 A;  2A6T A;  2VT3 A;  3FK6 A;  2Q2E A;  3EUA A;  2DPU A;  2XF6 A;  1ULY A;  4A5M A;  4UHT A;  3F8F A;  4N9H A;  1LPQ A;  4FQG A;  1K7A A;  5ICG A;  3HM5 A;  1N75 A;  5FLX K;  1T6S A;  3F72 A;  1WSU A;  1T0F A;  2G0E A;  4QSH A;  3QYB A;  2WA0 A;  2P5K A;  3OOP A;  4KNY A;  5E20 A;  3JR9 A;  1AU7 A;  2BW3 B;  3BY6 A;  4ESB A;  3AG4 H;  3WU0 A;  1T98 A;  4XOR A;  3QYE A;  1T33 A;  3BC8 A;  3GTO J;  2DCE A;  3W2W A;  3COA C;  3CDH A;  5KNL A;  3OOU A;  4RAG A;  1IJW C;  3NQO A;  4XN0 A;  4ASN A;  4M3B A;  3FMR A;  2H1L A;  1R00 A;  1R36 A;  1T08 B;  3DTI A;  4A3C J;  5ILV A;  2D2W A;  1FEX A;  3S1N J;  4PGG A;  2MC4 A;  3HXL A;  2EFP A;  5TIS C;  1LDJ A;  1U0J A;  4CCJ A;  5LHH A;  3OYC A;  4II2 A;  3LWF A;  3P7N A;  3EET A;  1ZRF A;  4FT8 A;  4KIB A;  2WBM A;  3CCV I;  1YW7 A;  5F6F A;  4UUS B;  3DV8 A;  2W85 A;  4BBS J;  3TO9 A;  2LKX A;  4FE4 A;  1H9G A;  3FMQ A;  1R9T J;  2QSF X;  5IYC J;  2XAS A;  4BH9 A;  3MZY A;  2F5E A;  5F27 A;  4G6Q A;  2NVX J;  1P9Q C;  2WB1 A;  5EF6 A;  4YRV A;  1PVE A;  2LBF A;  4F93 B;  4XOT A;  1NTC A;  3GF2 A;  1J75 A;  1FMV A;  2VBW A;  2K9L A;  4KA4 A;  3ASN H;  2QF7 A;  1YW9 A;  5GP9 A;  4HDU A;  4NC7 A;  4FX4 A;  3TW6 A;  4IHW A;  5CKT A;  1ZTR A;  1JJ6 C;  3WU2 C;  3KZY A;  3ZN1 A;  1OCP A;  4P5O A;  2STW A;  1R22 A;  3HTU A;  2HU9 A;  4OWR B;  2LY2 A;  3VFZ A;  2LRD A;  1E0E A;  1HF0 A;  1TW3 A;  3DU6 A;  5B3S H;  3LSK A;  5EZH A;  3ZPL A;  2XAU A;  1IXR C;  1Z91 A;  1AWC A;  1UFM A;  4BQQ A;  1X1C A;  5LFA A;  1V5E A;  1R6R A;  2AO9 A;  4EM2 A;  3KEQ A;  5CJ9 A;  3TBI A;  1H88 C;  2EBI A;  3LOC A;  4HLY A;  3MZH A;  1ZGJ A;  4IJA A;  5EEG A;  1XMK A;  4IHS A;  3CCM I;  3I5U A;  1LDK B;  5GAH J;  1EA3 A;  3WTU C;  3AL0 C;  1SFX A;  2CO5 A;  1QU3 A;  5ERI A;  2XPU A;  5HLT A;  1X4P A;  2CJJ A;  1V55 H;  3EUH C;  3PNV A;  3KP5 A;  2FQ3 A;  4WXC A;  4XMY A;  3BR5 A;  1B1B A;  4MQ9 F;  4ENN A;  4V19 K;  3S2W A;  3VEP A;  3KYL A;  1KGS A;  2QSG X;  3R0J A;  1KZH A;  1D5Y A;  2IS4 A;  3IAS 2;  4ZJZ A;  5FLV A;  3OY9 A;  4XOP A;  4ZDL A;  2PN6 A;  1G6N A;  4AD9 A;  4EJV A;  1BL0 A;  1XDU A;  4TV7 A;  2E7W A;  1QVT A;  1PP8 F;  2LTP A;  2MAB A;  3CDL A;  2MLG A;  2BW3 A;  1XB4 A;  2W25 A;  3OS2 A;  4IRI A;  4HPQ A;  4LLL A;  2ELJ A;  3GTK J;  3JSO A;  2EH3 A;  1TWG J;  1FTZ A;  3S17 J;  4HYE A;  2WAQ A;  1UG0 A;  2E5Z A;  4A2U A;  3K4M A;  4DGW B;  2XSD C;  1QZY A;  4HF2 A;  2R7Z J;  1WPK A;  3DPU A;  5E3N A;  3TP0 A;  4CCL A;  3PJR A;  4B47 A;  1WKM A;  2F5F A;  4IF4 A;  4RGX A;  3I53 A;  2X51 A;  2L9N A;  2VOP A;  1Z1D A;  5DTD A;  1Y56 A;  3KP3 A;  1W5S A;  3WG9 A;  1A04 A;  2LMD A;  2IS1 A;  2VOD A;  1ZYR F;  3P9I A;  2RC4 A;  3ECO A;  1Q1H A;  3CUO A;  4KIF A;  5J1Y A;  4N4O B;  1G3S A;  1S7E A;  1R23 A;  1ORK A;  3ZP5 A;  2BOL A;  3KYC B;  2KJC A;  5M5X J;  3PSF A;  1T95 A;  1FP2 A;  4YG2 F;  2HOS A;  1HDP A;  3JRG A;  3RCO A;  5L3C A;  5B1A H;  5ICC A;  4RDU A;  1TL8 A;  2VON A;  2X1C A;  2PMZ N;  4LFU A;  4XLF A;  1WJA A;  2UWM A;  3CP8 A;  1XC5 A;  2VQG A;  3LSG A;  3ZOB A;  2JPC A;  2YU3 A;  1YRN B;  4QPO A;  2MG4 A;  3RKQ A;  1HBX G;  3G1O A;  4RGU A;  2KDZ A;  1VQO I;  2R3S A;  3CME I;  5D4S A;  1RC9 A;  4CHU A;  1S7A A;  3BZC A;  4FAS D;  5HLH A;  2OQR A;  2JUC A;  2Y69 H;  2G7U A;  4LB5 A;  1IXS B;  3HBL A;  1TC3 C;  1TP4 A;  2IEK A;  3FXQ A;  1OMI A;  1A36 A;  2HDC A;  1IRF A;  2EFN A;  2ETH A;  2FNP A;  2XIG A;  3FKI J;  3W3C A;  2H94 A;  3Q5F A;  3V8J A;  4HZF A;  1EH7 A;  1QHG A;  2LH9 A;  4MEY F;  3A0H C;  1Y8Q B;  2B9S A;  4KYW A;  1B72 B;  1U9O A;  2KIU A;  2HI3 A;  1I50 J;  1QPM A;  4FX0 A;  5EG0 A;  4ZH4 F;  1Y1W J;  1ETO A;  1DQU A;  4B3A A;  4KMU X;  5DCM B;  3E3V A;  5CQE A;  2R0Q C;  2HVQ A;  2CFO A;  1SVM A;  2X4H A;  4EAT A;  4BHC A;  4HAM A;  3AKZ A;  5IT9 Z;  3GXO A;  1KQ9 A;  1RIO H;  4AIK A;  1ERD A;  2ZO4 A;  3BPV A;  1OLT A;  1Z6T A;  4H0E A;  4BDZ A;  1AKH A;  4Y52 J;  2H6B A;  4EQQ A;  3BZ6 A;  4I98 B;  1SVL A;  4RM2 A;  2M7B A;  1DGW Y;  2IAI A;  1RPW A;  1UJ8 A;  4F52 A;  5JHU A;  3A01 B;  3PIO F;  2KIM A;  5ICE A;  5M3M J;  1P4W A;  2M45 A;  1AOY A;  3C1D A;  3SZT A;  2XGC A;  4MTD A;  2QKM B;  3CMY A;  2KQR A;  2W82 A;  1I1G A;  3TP3 A;  1YQA A;  2B0L A;  1YFH A;  2QQA A;  2EB7 A;  1YIJ I;  3HKZ N;  4HDV A;  1UAA A;  2WAF A;  1IGN A;  2AS5 F;  2ZME B;  4KMF A;  2E35 A;  4EMS A;  3S32 A;  3G71 I;  1YG2 A;  4NB5 A;  4KDP A;  4A3B J;  2IP2 A;  1UZC A;  5HVQ C;  4DYC A;  4PJ0 C;  2DFH A;  4E7I A;  1FOK A;  2OV7 A;  3I54 A;  5L3F A;  2XRN A;  4JX5 A;  4CO8 A;  3LA3 A;  3AG1 H;  2K27 A;  3HZJ A;  4PFO A;  2VE8 A;  3HRS A;  1FBQ A;  4W1U A;  2DTR A;  4L5J A;  4U7D A;  2L4A A;  2JMW A;  2O0Y A;  3TKY A;  1R5G A;  1F5T A;  4BQO A;  2FF4 A;  2D1V A;  4I0A A;  1S72 I;  4IHY A;  4N4N B;  5D6F A;  4CSW A;  1Z3X A;  1XD7 A;  4D7N A;  2OCE A;  3FKJ A;  2W84 A;  1ZHF A;  3FM5 A;  1OYY A;  3PQJ A;  4AWX B;  2XAJ A;  2BGC A;  4G7H F;  2YS9 A;  3CUQ B;  2E1O A;  2FXA A;  4M9Z A;  1N25 A;  1MNM C;  4S05 A;  1YRN A;  2P7C B;  1P7J A;  3DU5 A;  4PJJ A;  4A93 J;  3JAM K;  3W6J B;  2DOF A;  1QA6 A;  5LGU A;  4CYC B;  3SXY A;  1YJ9 I;  5H20 A;  1WZ2 A;  1SFE A;  3HC7 A;  1JKP C;  3JRD A;  3TQN A;  3OL3 A;  2VE9 A;  1CQT A;  1LUJ B;  1SAX A;  5KHD A;  2M0M A;  1OCZ H;  3AG2 H;  3TW7 A;  2FOW A;  2K4B A;  3MWM A;  1FWZ A;  1W7P B;  4BL0 B;  3OYE A;  2VLA A;  4U88 A;  3F6V A;  2KRF A;  1BW5 A;  3GW2 A;  3MKZ A;  2WAE A;  3L2V A;  2R7X A;  4JX4 A;  2RV8 A;  2OTL I;  1FIP A;  2Y31 A;  3KZI C;  2MD5 A;  1IC8 A;  2ZKZ A;  3J7A Y;  3OSF A;  1VQ9 I;  2EIL H;  4B3X A;  1IXC A;  2HWV A;  3CJN A;  2O8X A;  5HS8 A;  3I4P A;  4Y7N J;  5K1Y A;  2NVY J;  1BIB A;  3GVA A;  1GDT A;  2HS5 A;  1Z9C A;  2XPW A;  3ZQC A;  3KEY A;  1Y1V J;  1UG2 A;  3L9F A;  1IN5 A;  1I5Z A;  2UXX A;  2VOO A;  4A0Y A;  4QWQ A;  4L9T A;  1TW2 A;  3DLA A;  1A5J A;  2JUG A;  4CUG A;  4YEL A;  3HEF A;  3M9A A;  2KIQ A;  4Y15 A;  4L18 B;  4PSW A;  2FEZ A;  1TWC J;  1XPX A;  3FXU A;  3A01 A;  4XLH A;  2ZJR F;  4WCG A;  1S8N A;  3GLX A;  2FML A;  3ZQL A;  2LD5 A;  5FB2 A;  2AXT C;  2CQX A;  1GXP A;  2OC6 A;  2X1D A;  2O7O A;  2XRL A;  3FXK A;  3G1L A;  4BY7 J;  2CUZ A;  3GEZ A;  3GFM A;  4UV8 A;  3EQL F;  2FNA A;  5D4R A;  2F2E A;  2Y0S N;  1D0Y A;  2LKP A;  1IN4 A;  4GCV A;  1MNE A;  5DDG A;  5J1R A;  2DA5 A;  2RKH A;  1K4S A;  4IHX A;  2DDB A;  1Y0N A;  3OYI A;  3BRO A;  1BW6 A;  4RB1 A;  2ZME A;  3BG9 A;  3SDG A;  1KU2 A;  3R6S A;  1DU0 A;  2COM A;  3KP6 A;  1UHS A;  3Q0W A;  1ZRD A;  2V9K A;  2F5V A;  3KP7 A;  3HOV J;  3K4K A;  2ZJP F;  1K83 J;  2E36 A;  2QUF A;  1U9N A;  4BJ5 C;  3SDB A;  3VOD A;  2LC2 A;  3JRC A;  4S0H B;  2BXZ A;  2JTV A;  3LQQ A;  1I3A A;  2L01 A;  4I01 A;  1UST A;  3K70 C;  1RUN A;  5CVI A;  1G4D A;  5GAD J;  5GTH C;  1Q1V A;  3ZMD A;  3F8N A;  1YOV B;  3AAF A;  2DOA A;  1O7F A;  4BE0 A;  3FWE A;  1U2W A;  1AHD P;  4LLG F;  4JOM A;  2VPL A;  1DPR A;  3GFL A;  1BI0 A;  1R7J A;  4WK8 F;  2NNN A;  3LSM A;  4CYD A;  1S6L A;  3Q9V A;  1BR2 A;  3E6D A;  2DBB A;  4ON0 A;  2EV6 A;  4E4H A;  3QQA A;  3KZZ A;  1JUS A;  1UB9 A;  4EEF G;  1MMD A;  3QPT A;  2OTJ I;  3VYU B;  3LSP A;  1OR7 A;  1WJB A;  1A6I A;  4MTE A;  3A02 A;  3BLY A;  3V7S A;  2LVS A;  3WOD F;  4KT6 A;  4HST A;  5FKM A;  2UUZ A;  1N78 A;  2V79 A;  2FA5 A;  5JHF A;  3UNG C;  3CTA A;  3HHG A;  3JCU C;  1TQI A;  1SEU A;  5TJJ A;  1NK2 P;  2H8R A;  2JA5 J;  2V9P A;  3ZQI A;  1MBK A;  1O3Q A;  4B1R A;  5ILU A;  2LFB A;  2V1D A;  3I58 A;  3ZQ7 A;  4A3J J;  1YO5 C;  2IT0 A;  2K85 A;  4P9U A;  2IA0 A;  3H3U A;  3GZ6 A;  2FMY A;  5DV5 A;  1JKQ C;  5D8L B;  3LA2 A;  3B73 A;  3BG6 A;  1AA7 A;  4ZTJ A;  3FIS A;  1X2N A;  1K6Y A;  2HZD A;  3JRF A;  3S1Q J;  4XKV A;  4XNF A;  3WE3 A;  2YU9 J;  1WQ2 A;  3E1S A;  1ZG5 A;  2HEO A;  2FRH A;  2Z1D A;  1FJL A;  1KU3 A;  4HNT A;  3LNQ A;  2JWT A;  2O5R A;  3HYI A;  4IHV A;  3R0A A;  5LD2 C;  2XSJ C;  1LEA A;  3K9T A;  3HSF A;  1U78 A;  2JVH A;  3H36 A;  3J80 Z;  1TWF J;  3I71 A;  4IQJ A;  4X6A J;  2LBF B;  3WTT C;  2PJR B;  4JP0 A;  2EFO A;  2BXY A;  5EJC A;  2Y0S A;  3K4J A;  3HJE A;  1HW1 A;  3DKX A;  2M7A A;  2Y9Y A;  3BR6 A;  3CJR B;  5JI6 A;  2PX9 A;  1IDZ A;  1R4N B;  3MKY B;  1DP3 A;  2VN2 A;  2WB1 N;  2D45 A;  3K6G A;  3MQ0 A;  4BJT A;  3CD6 I;  2F4O B;  3NWS A;  3DBL B;  2PMH A;  4I2O A;  1K6O A;  4L9N A;  2V26 A;  2Y2Z A;  4I76 A;  2KRC A;  3CF5 F;  1EH6 A;  2V1N A;  2ZXJ A;  2R4G A;  2KKO A;  3OYJ A;  2LNB A;  5HDN A;  3CC4 I;  2JQ7 A;  1IZ1 A;  1MJB A;  3QPL A;  1YE9 A;  3LAJ A;  1WJC A;  1PP7 U;  2VQC A;  1F4K A;  3ELK A;  3ERM A;  1OQY A;  4D7M A;  1ZRE A;  1WVR A;  5IP6 A;  1WH5 A;  2KMU A;  2EZI A;  1NHA A;  2TCT A;  3I3L A;  1LFP A;  3KP2 A;  1JKO C;  1TZL A;  4Z2Y A;  3S3O A;  4FET A;  1DP7 P;  2PJR A;  2EK5 A;  1T8I A;  4L9J A;  1XSX A;  1IO2 A;  3DEE A;  2ESN A;  4IOC F;  4LG3 A;  1VQ5 I;  2X85 A;  3L00 A;  4UB8 C;  1FP1 D;  2H27 A;  1QGP A;  2A68 F;  5E17 F;  1O3T A;  3ZQH A;  1QHH D;  1XS9 A;  1WGX A;  2QQ8 A;  2EZL A;  3HPH A;  1H9T A;  3U21 A;  1K78 A;  3OYD A;  4HQE A;  2JRT A;  1OFC X;  2QKL B;  2CUF A;  2VKV A;  3VYR B;  2IW5 A;  4IEJ A;  4C30 A;  1TBX A;  4HOB A;  4M73 A;  1ETW A;  1Z0X A;  3C2H A;  1BI3 A;  4B09 A;  3H5R A;  2DMT A;  4XRS G;  4CCK A;  4YIF A;  3WU1 B;  1XTA A;  1HKQ A;  3FBN B;  4C3J J;  3H9G A;  1YW8 A;  3F21 A;  2V1U A;  2R7S A;  4E7K A;  1SMT A;  4EVI A;  4II3 A;  2HQA A;  3SEZ A;  1MGT A;  2M87 A;  2CUE A;  3IKT A;  5BPI A;  1BM9 A;  4WXD A;  1OYI A;  2W48 A;  4RA2 A;  5FKK A;  3H5N A;  5TRD A;  3GUD A;  1MSF C;  4UUT A;  2VC0 A;  3FHZ A;  2LSO A;  4U0Y A;  1MIJ A;  2ZCW A;  3HIF A;  3OSG A;  3BJO A;  2JSP A;  3MCZ A;  3ECH A;  4XR6 A;  3QP6 A;  4DOZ A;  2Y48 A;  4HF1 A;  4MNU A;  2WAQ N;  1QPI A;  2DQL A;  3DLL F;  4E7L A;  4DBR A;  3DEU A;  2Q8K A;  1ITY A;  5FFZ A;  2GOM A;  1HKT A;  3LL7 A;  2XRO A;  3GO5 A;  3ESW B;  1U3E M;  2BVM A;  5J47 A;  2ADU A;  3RJP A;  1ZAO A;  2IBD A;  4XSZ F;  2EFW A;  1VQL I;  3H9J A;  1FT9 A;  5BS6 A;  3L7W A;  3KIO A;  1E17 A;  2DOE A;  4YFK F;  3RI4 A;  1XGS A;  5HDK A;  3GX4 X;  2DYR H;  4N9I A;  1S5L C;  4P9F A;  4A69 C;  1O57 A;  2K7L A;  4P1W A;  1JXS A;  1WRJ A;  1SFU A;  1UMQ A;  4ETS A;  2XB5 A;  4MQV A;  3RQI A;  2X6W A;  1R1T A;  2R7R A;  1K4T A;  2NVQ J;  4QIW N;  2GA2 A;  3LSI A;  3R61 A;  3BT9 A;  1YI2 I;  1MDM B;  4D5C A;  5BOX A;  3WTW C;  1KA8 A;  4RLF A;  1IV6 A;  3Q3S A;  1REP C;  2JZY A;  5IY5 H;  3RIR A;  1MBG A;  2PMU A;  3WTZ A;  4XLC A;  3VB2 A;  2BE5 F;  1MND A;  1HOM A;  3BDD A;  3H1C A;  3GCM A;  2E71 A;  4L0Y B;  4Y17 A;  1IN7 A;  2V4J C;  2P5L C;  1IF1 A;  3OWT A;  1FZP B;  2IS6 A;  1XX5 A;  2OBP A;  3OYA A;  5EG0 B;  5FD5 A;  1W5T A;  1RRJ A;  1LNW A;  4GFB A;  3BR1 A;  1BC7 C;  3GBG A;  2F48 A;  2EPF A;  1MBH A;  2VKD A;  5AON A;  2HGC A;  5IOZ A;  2NNY A;  1XGN A;  1W7P D;  3ZR8 X;  2ME6 A;  3DTE A;  3KP4 A;  4BAC A;  4EJW A;  2HYF A;  1X1P A;  4OIO F;  5E3L A;  1R58 A;  3VWB A;  1LEB A;  4PDK A;  4KN4 X;  3P9C A;  1AKH B;  1K79 A;  4LD5 A;  3DBH B;  2LF8 A;  1YS7 A;  2OUM A;  1IRX A;  4G6T B;  1RR7 A;  1SD6 A;  3OV8 A;  5EDN A;  2W7N A;  2PLY A;  1RZ4 A;  1J7K A;  2KLO A;  5E79 C;  3UR3 C;  1Z05 A;  4XK4 A;  4XON A;  1R5H A;  3BPX A;  3L1P A;  1FX7 A;  3I59 B;  2Z9O A;  1EF4 A;  4ZYH A;  3E6B A;  2HTS A;  2JSC A;  3TO6 A;  3OYB A;  3RPU D;  2EWN A;  5D5U B;  2FQ4 A;  3N4M A;  1LFU P;  2HDW A;  3GTM J;  4KIS A;  2GIV A;  3BTC A;  3K70 D;  2RN7 A;  3JW4 A;  2QZ8 A;  5HOO A;  4N0B A;  1F43 A;  4B4C A;  5IT3 A;  2J5O A;  1RES A;  2D5V A;  1D1A A;  3H0G J;  2H1K A;  3CC2 I;  3ZQQ A;  3WGG A;  4LK0 F;  4AIJ A;  2CS3 A;  3JSP A;  3B6C A;  3DQV C;  3R60 A;  4KJZ A;  1ZLK A;  2KDO A;  3MKL A;  2K9M A;  3JRB A;  4IRG A;  1PUF A;  1QBJ A;  2DU9 A;  3CCY A;  3U1D A;  4GDF A;  1FSE A;  4L0Z B;  2CQN A;  4E70 A;  2WY7 Q;  2ZB9 A;  5EZG A;  2VQH A;  4EM1 A;  3WTY C;  2JK3 A;  3DKW A;  1JE8 A;  1PJR A;  2L7M P;  3CLQ A;  3F6O A;  2XGX A;  3DTK A;  3QOE A;  4IKF A;  2LF7 A;  3WTS C;  4C3I J;  2VBY A;  4IXA A;  1ONV A;  2A69 F;  2MLK A;  4DBQ A;  1K61 A;  3ZMZ A;  3OYL A;  4PGH A;  4Q48 A;  1G59 A;  2BV6 A;  4HX4 A;  4EGZ A;  4NQW A;  5F0H A;  1ETX A;  2DFE A;  2VJI A;  1XGM A;  3ZMS A;  4IO9 F;  1U5T B;  2ZXI A;  3O3K A;  4BHB A;  1BR1 A;  5L3B A;  2V7F A;  1RKT A;  1MDM A;  5ILS A;  1MMS A;  3HOX J;  5F0C A;  5A2Q Z;  4NNJ A;  3SYT A;  2EV5 A;  2XUB A;  3BTI A;  3IP4 B;  3TDZ C;  4KIC A;  5DCF A;  4HEA 2;  1OCO H;  1F9N A;  2QM3 A;  1GXQ A;  2X0L A;  2P4W A;  1MW7 A;  1KU9 A;  2DMN A;  4M72 A;  3M3Y J;  1DU6 A;  1J59 A;  2BVL A;  1WI3 A;  4M71 A;  1U6G A;  2XPV A;  1E2X A;  1ON2 A;  3ABL H;  4HNU A;  3ONQ A;  4E7J A;  2IGO A;  1X1B A;  3SJM A;  1A35 A;  2HOE A;  4RLQ A;  2HQR A;  3PL8 A;  4BNC A;  2ICW G;  3JRA A;  2L3D A;  5GPC A;  4MIM A;  2QLZ A;  2R7U A;  3E97 A;  3GYH X;  3CQZ J;  1Y0U A;  2DO7 A;  3R4K A;  2GXG A;  4QLC U;  5KCM A;  3F3X A;  4C3H J;  3IRR A;  2OPT A;  3GTJ J;  4CIC A;  3K1P A;  4BXX J;  3SHF A;  5E3O A;  2ECB A;  3M1E A;  5H6R A;  4WX9 A;  2FU4 A;  3ZQG A;  4MFE A;  1BN5 A;  2E7X A;  3D1N I;  3GZN B;  2B63 J;  5HS9 A;  2LR8 A;  2DTZ A;  2EIK H;  5IPA A;  2ACJ A;  3LSR A;  4E7H A;  2DDA A;  4ENM A;  3M07 A;  1P4X A;  1Z7U A;  3BZK A;  3I59 A;  6PAX A;  4X1E A;  2HYG D;  4G6D A;  1JTY A;  5FLM J;  5E8G A;  2GAU A;  3EYY A;  2XF7 A;  5EEH A;  2AHQ A;  5D5W B;  2GA1 A;  2HOA A;  3L2W A;  3C18 A;  1MJ9 A;  4JYK A;  2VJJ A;  2R7D A;  2ZC2 A;  2EIM H;  1E3P A;  2EIJ H;  3J7Z I;  2W4S A;  3C3W A;  2H09 A;  1FYM A;  4Y33 A;  3ABK H;  4BKX A;  3RZO J;  5HOD A;  4D9J A;  1FOW A;  3PNT A;  5FJ8 J;  1CF7 B;  3MAJ A;  4XLA A;  2QA4 I;  4J19 A;  2ME0 A;  1NG7 A;  1BR4 A;  1TWH J;  2HVR A;  2VUM J;  3MFK A;  1WJE A;  1N77 A;  3SEQ A;  1QZE A;  4M6Y A;  1SFK A;  2CV1 A;  1X1D A;  4ZTF A;  1ZEL A;  1ZRC A;  3GLL A;  5TGT A;  4EJO A;  1MMA A;  4PSX A;  1VQM I;  2DMU A;  5FD6 A;  4FTH A;  1IUF A;  3B6A A;  3K2A A;  4UVB A;  3EPZ A;  3IWF A;  1LDD A;  1ZAR A;  1XG1 A;  2QVO A;  3RYP A;  5BQT A;  3I56 I;  1R5I D;  1WFX A;  1Z67 A;  2MSY A;  3LA7 A;  4B44 A;  3HOY J;  3BTL A;  2R7Q A;  2RQQ A;  1F1Z A;  1U8B A;  2KT0 A;  1E3H A;  1OCC H;  4I7H A;  2EZK A;  4L5I A;  3P5J A;  3CO6 C;  3UKG A;  4KUM A;  4R79 A;  1MH4 A;  1X4O A;  3J80 K;  4CZZ A;  1Y39 A;  2P81 A;  1Z21 A;  1LQ1 A;  1X2M A;  2NXN B;  5JLW A;  3BR3 A;  3OIO A;  4IX7 A;  1MBJ A;  4GGG A;  4M74 A;  4BEH B;  2MBF A;  1SD7 A;  3REO A;  2CH0 A;  1WHU A;  3K4N A;  4MFD A;  4RAY A;  2E1C A;  2OCC H;  3WTV C;  2A5Y B;  2X1E A;  1QO0 D;  2DFF A;  3C2G A;  2GBY A;  2I5U A;  5F64 A;  4AC0 A;  3HB9 A;  1LB2 A;  3E0J B;  1U5T A;  3RPQ A;  3V8K A;  3NWT A;  2HZT A;  2ZME C;  1D8K A;  1B6A A;  2CW0 F;  5GAE J;  3TDU C;  3CJQ B;  3FXL A;  2AQE A;  4JX6 A;  4BAY A;  1Z77 A;  3O6B B;  4AM3 A;  2M4G A;  1R4M B;  5J1U A;  4F91 B;  2FE3 A;  3S1R J;  4XKC A;  2CYY A;  3M8F A;  4A12 A;  2LDU A;  4E6K G;  3O8G A;  3ZXS A;  2AQF A;  2DW4 A;  2ELH A;  4OU0 A;  4MHG A;  4L5E A;  3G73 A;  4O3M A;  2DYS H;  1IG7 A;  3QU3 A;  2IA1 A;  3FZV A;  3E6M A;  2HXO A;  3FXR A;  5DYM A;  5E1X A;  3CZ6 A;  1WCM J;  2NOG A;  3ABM H;  1W5C C;  2DAO A;  3KYD B;  2ZNY A;  3MZ8 A;  4BU2 A;  3TOA A;  4C2T A;  2XKO A;  3L2R A;  1XSD A;  1SVO A;  2HFH A;  4DNC A;  1VTN C;  3CUQ C;  1OR7 C;  3I4M J;  2M1B A;  1XDS A;  1S7O A;  5K7Z A;  1J9I A;  2M30 A;  3G2B A;  2Z33 A;  3CCE I;  3OR2 C;  1WJ5 A;  4DIQ A;  2OQG A;  1Z3Y A;  2COB A;  2E1N A;  4ZZL A;  4WF2 A;  2KZV A;  3FIW A;  3KET A;  4MEX F;  2NS0 A;  2ZSI B;  2EA2 A;  2XGD A;  2MYS A;  4O6J A;  2DK8 A;  1D5V A;  3CCJ I;  2XAQ A;  2PBI A;  3DP7 A;  3I64 A;  1JGG A;  2GIZ A;  1TQP A;  1B9N A;  1ETY A;  1P7I A;  4HQM A;  1I27 A;  4M3E A;  2PJP A;  4G7O F;  3AFH A;  1IRZ A;  3CCQ I;  2WC2 A;  1ACI A;  2A5W A;  1BC8 C;  2CQK A;  2XHK A;  3JTH A;  4EGY A;  1ZN2 A;  3OS1 A;  4G7Z F;  4XLN F;  1CF7 A;  5K5Q A;  3HTS B;  1MSE C;  4NC8 A;  3EYI A;  3MEX A;  3ABT A;  1ZQ3 P;  4LMY A;  4OAZ A;  3PUB A;  3PO3 J;  2OZU A;  2XGE A;  2W00 A;  3VOE A;  3MMY B;  3J7Y J;  1OIS A;  2X6X A;  1HC8 A;  3VSK A;  2DT5 A;  5LLQ A;  2NS7 A;  3BR0 A;  3HOT A;  4BDY A;  2GLO A;  3S15 J;  2R93 J;  2MGQ A;  2L2O A;  1YIO A;  1ENH A;  1SC7 A;  2RRE A;  3DEW A;  1S9H A;  3CF2 A;  3RQ4 A;  3OYF A;  3OIP A;  3JRI A;  3LQR A;  3J7A O;  2DT6 A;  1QQI A;  2ISY A;  3I9V 2;  3L09 A;  4PJN A;  1MMG A;  2L54 A;  4BQA A;  3HOW J;  3AG3 H;  1CGP A;  4CCN A;  3BP8 A;  2I8D A;  2MD0 A;  5IYD J;  2JT1 A;  2IGN A;  2L9V A;  4ENJ A;  1ZG1 A;  2DJI A;  1R49 A;  1K78 B;  3U9G A;  1BJA A;  3T1B A;  2PG4 A;  2K86 A;  1SAU A;  2XF5 A;  2MH9 A;  4BEH A;  5C4X J;  4J00 A;  2NOJ B;  1HA8 A;  2A05 A;  5E1Z B;  2F5C A;  2FD5 A;  2Y9Z A;  3PO2 J;  1D0X A;  1WWX A;  1TWA J;  5C3E J;  3WGH A;  2M2E A;  1D3Y A;  2WTE A;  2DQR A;  2XAF A;  2QBY A;  2AXL A;  4HF0 A;  4RGS A;  3A1Y A;  3CCR I;  5JVT A;  5E3M A;  1W4M A;  5CPR B;  5HS7 A;  3O2P E;  2DOD A;  4A5N A;  2L02 A;  1DUX C;  3DCF A;  1JHH A;  2ZXH A;  4RBO A;  1G3W A;  5FGM A;  2EZH A;  1ETQ A;  2GZW A;  5LGN A;  1DDN A;  2DT7 B;  3SZG A;  3LFU A;  1Z6R A;  3VYT B;  2VAS A;  2VPR A;  4EM0 B;  4DW6 A;  4XLE A;  3CCU I;  4ABZ A;  2TDX A;  2HXI A;  2LG4 A;  4XRF A;  2M0C A;  3IC7 A;  3K10 A;  4RM3 A;  1W1W E;  4UVA A;  2MH2 A;  4YFN F;  2ZFW A;  2E2J J;  2ZNZ A;  3Q0U A;  4M3D A;  4LLN A;  1GV2 A;  1T0F C;  1EKE A;  4CA0 A;  2VT2 A;  2X9D A;  3OL4 A;  2K9Q A;  2GWR A;  4GXO A;  1GT0 C;  4X0G A;  3RSN A;  4I02 A;  1R71 A;  2M4K A;  5F08 A;  2LRE A;  3BG5 A;  1KU7 A;  3IAM 2;  2KIS A;  2A61 A;  1MMN A;  2ESH A;  3H9Q A;  1V5G A;  1YHQ I;  4ZZD A;  2HKO A;  4A3K J;  4XKW A;  2CW7 A;  3H0D A;  2V1X A;  1HLV A;  2L7K A;  1BIA A;  2KJB A;  1G2H A;  1FLI A;  1IRG A;  4CCM A;  3BJ6 A;  1D1C A;  2CQ7 A;  4I0B A;  1HST A;  5EEA A;  4OIQ F;  2Q0O A;  1JGS A;  2IRF G;  2EQR A;  2MA3 A;  2K4J A;  1P4A A;  4ESF A;  2ZSH B;  2XDV A;  1DGR M;  2STT A;  4XBF A;  4IOA F;  1R1U A;  4L9V A;  1BOA A;  1R1V A;  4BHP A;  4OMZ A;  2W24 A;  4ESJ A;  3FDY A;  2O61 A;  1KYZ A;  1UEL B;  3Q9S A;  5JR3 A;  1TQM A;  4E7S A;  3GTP J;  2DN0 A;  2O6G E;  2CW8 A;  2JPB A;  3KLO A;  2DXI A;  2CRG A;  3T0Y A;  2V9V A;  2NAZ A;  1XSV A;  4HV6 A;  1LJ9 A;  1MD0 A;  4U87 A;  1W36 C;  4NDL A;  3C7J A;  1W0T A;  2Y30 A;  4CDG A;  3V8L A;  1D0Z A;  2PEX A;  4OAY A;  2K3P A;  3IV5 A;  1HW2 A;  2JRM A;  4DQ2 A;  2BHY A;  4AYB N;  1UCR A;  3KEO A;  4XN3 A;  2YSR A;  4M9X A;  3ZCO A;  1SMY F;  3PFI A;  2L9R A;  3HOZ J;  4ZDP A;  1ETV A;  2L0K A;  4Y4R A;  4IQ4 A;  2JVG A;  4MGR A;  4XL9 A;  5DD8 A;  1IN6 A;  2E5N A;  4RAF A;  2D1H A;  2LLK A;  5M3F J;  1JJ8 C;  5CQG A;  2R5Y B;  5CLS A;  1YTY A;  3FXJ A;  1H8A C;  1T56 A;  1EH8 A;  1VQ6 I;  1IN8 A;  5J40 A;  3TGN A;  5LEK A;  1XGO A;  3V7R A;  3G3Z A;  5A2Q K;  4HW0 A;  4M3G A;  2O03 A;  1BBY A;  1XN7 A;  4XM3 A;  1E3O C;  4ZC3 A;  4C2M J;  3TL4 X;  3X2Q H;  5JVG F;  4B8X A;  2FBI A;  2EIN H;  3F8M A;  3QOP A;  3GZ5 A;  2A6E F;  1V3F A;  4LOC A;  2FUG 2;  4A3D J;  2KRH A;  3BCB A;  3B02 A;  3CMA I;  4OMY A;  1ON1 A;  1USS A;  2X6O A;  2QGU A;  2R7V A;  5B1B H;  2XV4 S;  1PUF B;  2CGP A;  4PCQ A;  3KX2 A;  3ZQF A;  3IRQ A;  2YR2 A;  4KT5 C;  2F5D A;  1QRY A;  2HTJ A;  3A03 A;  3K4C A;  2NS8 A; 
#chains in the Genus database with same CATH homology
 2VBX A;  3LAP A;  5KVR A;  4RS8 A;  1PDN C;  2VBZ A;  1YLF A;  4ZYD A;  1J5Y A;  2GXB A;  2EFQ A;  2RVC A;  3RTR A;  3K69 A;  1HSJ A;  3ROU A;  4AIH A;  4JQF A;  3K1M A;  3WTX C;  2VC1 A;  4A0X A;  2EV0 A;  3NEU A;  3K1N A;  4U0V A;  2ISZ A;  4K2E A;  2L4M A;  1J0R A;  3GFI A;  1STZ A;  1O7L A;  2PI0 A;  3RKW A;  3J81 Z;  3IL2 A;  2IVM A;  4EJT A;  4A0Z A;  3TO7 A;  1TLH B;  2HKX A;  5DUK A;  1XCV A;  1PUE E;  1QZZ A;  2ZJ2 A;  1ZG3 A;  4R8H A;  1FBS A;  3KE2 A;  3HOS A;  4KIG A;  2Y75 A;  3ML6 A;  4UV9 A;  5LGT A;  4OIP F;  2OAZ A;  1O3S A;  1S3J A;  3SZP A;  5D5V B;  4LG0 A;  2OA4 A;  5CVU A;  3RKY A;  2XAG A;  2K02 A;  4HX8 A;  5DUI A;  4ZYG A;  1YYV A;  3F23 A;  4OOI A;  1L0O C;  4RGR A;  5L3D A;  3M8E A;  2FBK A;  3PQK A;  2UXN A;  3KCC A;  2OZ6 A;  5JFR A;  1FNN A;  4XLP F;  3P9K A;  3RDI A;  1L3L A;  1UHM A;  2A3S A;  1J2X A;  2VXZ A;  4IPA A;  4S04 A;  1OYW A;  1ODD A;  1QNT A;  2EJR A;  5E8I A;  3DXJ F;  2FSW A;  2Z99 A;  1TNT A;  3FF5 A;  2HR3 A;  5HDG A;  3IWZ A;  4OIR F;  4AVP A;  3ISP A;  1X3U A;  1ZGA A;  5AIP A;  5DEQ A;  4UXN A;  4P55 A;  3HSE A;  2MC3 A;  3ZN0 A;  4HLX A;  4Y13 A;  3F22 A;  5E1W A;  2M8E A;  3H3Z A;  4KFC A;  5CVV A;  4EJU A;  2BEO A;  5L3G A;  5J8F A;  5FLX Z;  1EV7 A;  3EUH A;  4R1H A;  3QAH A;  3KFW X;  1RUO A;  3ZMT A;  1YS6 A;  4RAZ A;  5K5O A;  3E5U A;  1BI2 A;  3D0S A;  3ZMU A;  5FFX A;  5D6E A;  5HLI A;  2FOK A;  4Q4Z F;  2DK5 A;  2Z5U A;  1FY7 A;  1HW5 A;  1JHF A;  1U5T C;  3T8T A;  5ED4 A;  4IHT A;  1OPC A;  1HXD A;  4LB6 B;  3QRF F;  4G94 A;  2DFI A;  3K2Z A;  1MJA A;  2DPD A;  2V6C A;  4KN7 X;  4IVN A;  1G3Y A;  2Z3Y A;  5HLG A;  5D8K B;  1RNL A;  3K0L A;  1B59 A;  3RKX A;  4YFX F;  3SFZ A;  3HRM A;  1SD4 A;  4D0P A;  5KK1 A;  3E5X A;  4I09 A;  3N97 A;  3HHH A;  3BOQ A;  2YX4 A;  1SD5 A;  5D5X B;  4Q5S F;  3JTG A;  2QEN A;  1U8R A;  1FC3 A;  3FM3 A;  1I1S A;  2XVC A;  3RYR A;  4JK1 X;  3WE2 A;  1T39 A;  3NRV A;  3WGI A;  3ABU A;  1FSH A;  2DI3 A;  1H0M A;  3E5Q A;  1RI7 A;  2DLL A;  2OU2 A;  4BXU A;  2A07 F;  2QBY B;  2ZBK A;  3DPT A;  1HKS A;  2P8T A;  3BJA A;  1WI9 A;  1P6R A;  5CVJ A;  2PFB A;  2BYV E;  4M9S A;  3FMS A;  3HUG A;  3ULQ B;  3GFJ A;  4O5V A;  3IKV A;  4P96 A;  2OD5 A;  3I0T A;  4BYY A;  2QYO A;  3T5X A;  3HRT A;  3CLO A;  1KQ0 A;  4EV0 A;  1XCB A;  4LGW A;  4RB0 A;  4U0W A;  1OKR A;  2P5V A;  2YPR A;  5DCM A;  5CYV A;  4M6X A;  3L2C A;  4UVC A;  5F1R A;  5L3E A;  4WWC A;  2XAH A;  2RNJ A;  5FO5 A;  2IJL A;  2QWW A;  3FX3 A;  2IPQ X;  3ERE D;  2CSO A;  1DPU A;  5DD4 A;  4PZJ A;  3E6C C;  2RQP A;  2CG4 A;  1S29 A;  5ICF A;  1G3T A;  2KIF A;  4HV5 A;  4A6E A;  2IA2 A;  4CGZ A;  4GYG A;  2RDP A;  1P92 A;  3DF8 A;  1TNS A;  4UNO A;  2CWE A;  4CXF A;  5J6X A;  3CO7 C;  1P2F A;  3LFK A;  4HA8 A;  1V4R A;  3TOB A;  2QQ9 A;  3M7G A;  2GQQ A;  1O3R A;  1IW7 F;  5J8C A;  4OIN F;  3GWZ A;  5LBQ A;  2C6Y A;  5E18 F;  2M5W A;  4IRH A;  2P6T A;  2NRA C;  5LHI A;  1TTY A;  2YX7 A;  2J5P A;  3SQN A;  1GVJ A;  3V4G A;  3EDP A;  4U7B A;  5LEJ A;  3D5L A;  1LVA A;  4F7Z A;  1C0W A;  1UHW A;  3QU6 A;  3CUQ A;  1ZLJ A;  1FPQ A;  4FHT A;  4ZYE A;  2NYX A;  4JBA A;  4Q47 A;  5AIQ A;  2WWY A;  3LST A;  1I6X A;  4RB3 C;  3J81 K;  3W6K B;  1B4A A;  5K5R A;  2H6C A;  2G7H A;  3DFG A;  1IUY A;  2EA4 A;  4WXH A;  5BMZ A;  3HSR A;  1W7P A;  4HBL A;  3V7C A;  3U2R A;  3F8C A;  3BWG A;  4GYI A;  1XMA A;  3H92 A;  4NHJ A;  2P7V B;  3T8R A;  4RB2 C;  4XSX F;  3IHU A;  2HQN A;  2UZK A;  1T38 A;  5H6Q A;  4G8X A;  2A6H F;  2P6S A;  4HX7 A;  1IAW A;  1GHC A;  5LRS A;  4ENK A;  2Y0M A;  2R7F A;  3RPU A;  5LRR A;  4A6D A;  5CVR A;  1HQC A;  3DPL C;  4UUV A;  3HRU A;  2G9W A;  1MZB A;  4YII A;  2PQ8 A;  3KLN A;  3JAM Z;  3QP5 A;  2RGV A;  1D8J A;  2CFX A;  1KQ8 A;  2WV0 A;  2BBY A;  1FBU A;  2FBH A;  1BI1 A;  5BPD A;  4LK1 F;  1T2K A;  1MKM A;  1ZH5 A;  3F8B A;  2W57 A;  3ZMV A;  4GO1 A;  3QPH A;  1KYW A;  4LJZ F;  1B9M A;  4LG0 B;  1FYK A;  4G9Y A;  2XKP A;  1FYL A;  5LHG A;  2QQB A;  2O3F A;  2VT3 A;  2Q2E A;  2DPU A;  1ULY A;  4A5M A;  4UHT A;  3F8F A;  4N9H A;  1K7A A;  5ICG A;  5FLX K;  1T6S A;  3F72 A;  1WSU A;  1T0F A;  2P5K A;  3OOP A;  4KNY A;  5E20 A;  3BY6 A;  4ESB A;  3WU0 A;  1T98 A;  3COA C;  3CDH A;  3NQO A;  4ASN A;  3FMR A;  1R00 A;  1R36 A;  5ILV A;  2D2W A;  4PGG A;  2EFP A;  1LDJ A;  5LHH A;  3LWF A;  3P7N A;  3EET A;  1ZRF A;  4FT8 A;  4KIB A;  1YW7 A;  5F6F A;  3DV8 A;  2W85 A;  3TO9 A;  1H9G A;  3FMQ A;  2XAS A;  4BH9 A;  3MZY A;  2F5E A;  4G6Q A;  3GF2 A;  1J75 A;  2VBW A;  4KA4 A;  1YW9 A;  4HDU A;  4FX4 A;  3KZY A;  3ZN1 A;  4P5O A;  2STW A;  1R22 A;  3HTU A;  3VFZ A;  1TW3 A;  3ZPL A;  1IXR C;  1Z91 A;  1AWC A;  1UFM A;  4EM2 A;  3KEQ A;  5CJ9 A;  4HLY A;  3MZH A;  1ZGJ A;  4IJA A;  5EEG A;  1XMK A;  4IHS A;  3I5U A;  1LDK B;  3WTU C;  1SFX A;  2CO5 A;  5ERI A;  3KP5 A;  2FQ3 A;  4WXC A;  1B1B A;  4MQ9 F;  4ENN A;  3S2W A;  3VEP A;  1KGS A;  3R0J A;  4AD9 A;  2PN6 A;  1G6N A;  4EJV A;  1XDU A;  4TV7 A;  2E7W A;  1PP8 F;  2MLG A;  1XB4 A;  2W25 A;  4IRI A;  4LLL A;  3JSO A;  4HYE A;  4A2U A;  1QZY A;  4HF2 A;  1WKM A;  2F5F A;  4IF4 A;  4RGX A;  3I53 A;  2VOP A;  1Z1D A;  3KP3 A;  1W5S A;  3WG9 A;  1A04 A;  2VOD A;  1ZYR F;  3P9I A;  2RC4 A;  3ECO A;  1Q1H A;  4KIF A;  3CUO A;  1G3S A;  1R23 A;  3ZP5 A;  2KJC A;  1FP2 A;  4YG2 F;  5L3C A;  5ICC A;  2VON A;  4LFU A;  2UWM A;  2JPC A;  2YU3 A;  1HBX G;  4RGU A;  2R3S A;  5D4S A;  4CHU A;  1S7A A;  5HLH A;  2OQR A;  2G7U A;  4LB5 A;  1IXS B;  3FXQ A;  1OMI A;  2HDC A;  1IRF A;  2EFN A;  2ETH A;  2FNP A;  2XIG A;  2H94 A;  3Q5F A;  3V8J A;  4HZF A;  1EH7 A;  4MEY F;  4KYW A;  2KIU A;  1QPM A;  4FX0 A;  4ZH4 F;  4KMU X;  5DCM B;  3E3V A;  2X4H A;  4BHC A;  4HAM A;  5IT9 Z;  3GXO A;  1KQ9 A;  1RIO H;  4AIK A;  2ZO4 A;  3BPV A;  1Z6T A;  4H0E A;  2H6B A;  4EQQ A;  3BZ6 A;  4I98 B;  5JHU A;  2KIM A;  5ICE A;  1P4W A;  2M45 A;  1AOY A;  3C1D A;  3SZT A;  4MTD A;  1I1G A;  1YQA A;  2B0L A;  1YFH A;  2QQA A;  2EB7 A;  4HDV A;  2AS5 F;  2ZME B;  4KMF A;  4EMS A;  4KDP A;  1YG2 A;  4NB5 A;  2IP2 A;  5HVQ C;  1FOK A;  3I54 A;  5L3F A;  2XRN A;  4CO8 A;  3LA3 A;  2K27 A;  2VE8 A;  3HRS A;  1FBQ A;  2DTR A;  4L5J A;  4U7D A;  2L4A A;  2O0Y A;  3TKY A;  1R5G A;  1F5T A;  2FF4 A;  2D1V A;  4I0A A;  5D6F A;  1XD7 A;  4AWX B;  2W84 A;  1ZHF A;  3FM5 A;  1OYY A;  3PQJ A;  2XAJ A;  2BGC A;  4G7H F;  3CUQ B;  2FXA A;  4M9Z A;  2P7C B;  4S05 A;  3JAM K;  3W6J B;  5LGU A;  3SXY A;  5H20 A;  1SFE A;  3TQN A;  2VE9 A;  1SAX A;  2K4B A;  3MWM A;  1FWZ A;  1W7P B;  4U88 A;  3F6V A;  2KRF A;  3GW2 A;  2RV8 A;  2MD5 A;  2ZKZ A;  1IXC A;  2HWV A;  3CJN A;  2O8X A;  5HS8 A;  3I4P A;  5K1Y A;  1BIB A;  3GVA A;  2HS5 A;  1Z9C A;  3L9F A;  1IN5 A;  1I5Z A;  2UXX A;  2VOO A;  4A0Y A;  4QWQ A;  4L9T A;  1TW2 A;  3M9A A;  4Y15 A;  4L18 B;  2FEZ A;  3FXU A;  4WCG A;  1S8N A;  3GLX A;  2FML A;  5FB2 A;  1GXP A;  3GEZ A;  3GFM A;  4UV8 A;  3EQL F;  2FNA A;  5D4R A;  2F2E A;  2LKP A;  1IN4 A;  4GCV A;  5DDG A;  2RKH A;  3BRO A;  4RB1 A;  2ZME A;  1KU2 A;  3R6S A;  2COM A;  3KP6 A;  1ZRD A;  3KP7 A;  2QUF A;  3VOD A;  2JTV A;  3LQQ A;  2L01 A;  4I01 A;  1UST A;  1RUN A;  5CVI A;  1G4D A;  3ZMD A;  3F8N A;  3AAF A;  1O7F A;  3FWE A;  1U2W A;  4LLG F;  1DPR A;  3GFL A;  1BI0 A;  1R7J A;  4WK8 F;  2NNN A;  4CYD A;  1S6L A;  3Q9V A;  3E6D A;  2DBB A;  4ON0 A;  2EV6 A;  3KZZ A;  1UB9 A;  3QPT A;  1OR7 A;  4MTE A;  3V7S A;  3WOD F;  2V79 A;  2FA5 A;  3CTA A;  3HHG A;  1TQI A;  5TJJ A;  1O3Q A;  5ILU A;  2V1D A;  3I58 A;  3ZQ7 A;  1YO5 C;  2IT0 A;  4P9U A;  2IA0 A;  3H3U A;  3GZ6 A;  2FMY A;  5DV5 A;  5D8L B;  3LA2 A;  3B73 A;  3WE3 A;  1WQ2 A;  1ZG5 A;  2HEO A;  2FRH A;  1KU3 A;  3HYI A;  3R0A A;  1LEA A;  3K9T A;  3HSF A;  1U78 A;  3J80 Z;  3I71 A;  3WTT C;  2EFO A;  1HW1 A;  5JI6 A;  2VN2 A;  2D45 A;  3MQ0 A;  2PMH A;  4I2O A;  1K6O A;  4L9N A;  1EH6 A;  2ZXJ A;  2KKO A;  2LNB A;  5HDN A;  1IZ1 A;  1MJB A;  3LAJ A;  1PP7 U;  1F4K A;  3ELK A;  1ZRE A;  1NHA A;  3KP2 A;  4Z2Y A;  1DP7 P;  2EK5 A;  4L9J A;  1XSX A;  2ESN A;  3L00 A;  1FP1 D;  2H27 A;  1QGP A;  2A68 F;  5E17 F;  1O3T A;  1H9T A;  1K78 A;  4HQE A;  2JRT A;  2IW5 A;  1TBX A;  4HOB A;  4M73 A;  4B09 A;  1BI3 A;  4YIF A;  3WU1 B;  1HKQ A;  1YW8 A;  3F21 A;  2V1U A;  1SMT A;  4EVI A;  1MGT A;  2M87 A;  3IKT A;  5BPI A;  1BM9 A;  4WXD A;  1OYI A;  5TRD A;  3GUD A;  2VC0 A;  3FHZ A;  2LSO A;  4U0Y A;  2ZCW A;  3HIF A;  3BJO A;  3MCZ A;  3ECH A;  3QP6 A;  2Y48 A;  4HF1 A;  4MNU A;  2DQL A;  3DEU A;  2Q8K A;  5FFZ A;  1HKT A;  2XRO A;  3GO5 A;  1U3E M;  5IT9 K;  2ADU A;  3RJP A;  1ZAO A;  4XSZ F;  2EFW A;  5BS6 A;  1FT9 A;  3L7W A;  1E17 A;  4YFK F;  3RI4 A;  1XGS A;  5HDK A;  3GX4 X;  4N9I A;  4P9F A;  1O57 A;  2K7L A;  1JXS A;  1WRJ A;  1SFU A;  4ETS A;  4MQV A;  1R1T A;  2GA2 A;  3R61 A;  1MDM B;  5BOX A;  3WTW C;  1KA8 A;  1REP C;  2JZY A;  3RIR A;  2PMU A;  3WTZ A;  3VB2 A;  2BE5 F;  3BDD A;  4L0Y B;  4Y17 A;  1IN7 A;  2P5L C;  1IF1 A;  1FZP B;  2OBP A;  5FD5 A;  1W5T A;  1LNW A;  1BC7 C;  2NNY A;  5AON A;  2HGC A;  1XGN A;  1W7P D;  3KP4 A;  4EJW A;  2HYF A;  4OIO F;  1R58 A;  1LEB A;  4PDK A;  4KN4 X;  3P9C A;  1K79 A;  4LD5 A;  2LF8 A;  1YS7 A;  1SD6 A;  3OV8 A;  2PLY A;  1RZ4 A;  1J7K A;  1Z05 A;  1R5H A;  3BPX A;  1FX7 A;  3I59 B;  2Z9O A;  4ZYH A;  3E6B A;  2HTS A;  2JSC A;  3TO6 A;  2EWN A;  5D5U B;  3N4M A;  2GIV A;  2RN7 A;  3JW4 A;  2QZ8 A;  5HOO A;  4N0B A;  5IT3 A;  2J5O A;  3WGG A;  4LK0 F;  4AIJ A;  3JSP A;  3DQV C;  3R60 A;  1ZLK A;  4IRG A;  1QBJ A;  2DU9 A;  3U1D A;  1FSE A;  4L0Z B;  4E70 A;  4EM1 A;  3WTY C;  3DKW A;  1JE8 A;  3F6O A;  2XGX A;  2LF7 A;  3WTS C;  2VBY A;  4IXA A;  1ONV A;  2A69 F;  2MLK A;  3ZMZ A;  4PGH A;  4Q48 A;  2BV6 A;  4HX4 A;  4EGZ A;  4NQW A;  1XGM A;  3ZMS A;  1U5T B;  3O3K A;  4BHB A;  5L3B A;  1MDM A;  5ILS A;  5A2Q Z;  2EV5 A;  2XUB A;  3TDZ C;  4KIC A;  5DCF A;  1F9N A;  2QM3 A;  1GXQ A;  2X0L A;  2P4W A;  4M72 A;  1KU9 A;  1J59 A;  4M71 A;  1U6G A;  1E2X A;  1ON2 A;  2HOE A;  2HQR A;  4BNC A;  2L3D A;  2QLZ A;  3E97 A;  3GYH X;  1Y0U A;  2DO7 A;  3R4K A;  2GXG A;  4QLC U;  3F3X A;  3IRR A;  4CIC A;  3K1P A;  3SHF A;  3M1E A;  4WX9 A;  5H6R A;  2FU4 A;  1BN5 A;  2E7X A;  5HS9 A;  2ACJ A;  4ENM A;  1P4X A;  1Z7U A;  3I59 A;  6PAX A;  2HYG D;  4G6D A;  5E8G A;  2GAU A;  3EYY A;  5EEH A;  5D5W B;  2GA1 A;  3C18 A;  1MJ9 A;  2R7D A;  1FYM A;  3C3W A;  2H09 A;  1CF7 B;  3MAJ A;  3MFK A;  4M6Y A;  1ZRC A;  4EJO A;  5FD6 A;  4UVB A;  3IWF A;  3RYP A;  1LDD A;  1ZAR A;  2QVO A;  5BQT A;  3LA7 A;  1F1Z A;  4I7H A;  4L5I A;  3CO6 C;  4KUM A;  4R79 A;  3J80 K;  4CZZ A;  1LQ1 A;  4GGG A;  4M74 A;  2MBF A;  1SD7 A;  3REO A;  2E1C A;  4RAY A;  3WTV C;  2A5Y B;  1QO0 D;  5F64 A;  1LB2 A;  1U5T A;  3RPQ A;  3V8K A;  2HZT A;  1D8K A;  1B6A A;  2CW0 F;  3TDU C;  4BAY A;  3O6B B;  2FE3 A;  2CYY A;  3M8F A;  4A12 A;  2LDU A;  2DW4 A;  2ELH A;  4OU0 A;  4MHG A;  4O3M A;  3G73 A;  3QU3 A;  2IA1 A;  3FZV A;  3E6M A;  3FXR A;  5E1X A;  5DYM A;  2DAO A;  2ZNY A;  3TOA A;  2XKO A;  1XSD A;  2HFH A;  4DNC A;  1VTN C;  3CUQ C;  2M1B A;  1XDS A;  1S7O A;  1J9I A;  2M30 A;  2Z33 A;  2OQG A;  2E1N A;  4ZZL A;  4WF2 A;  3KET A;  4MEX F;  2NS0 A;  2EA2 A;  4O6J A;  2DK8 A;  1D5V A;  2XAQ A;  2PBI A;  3DP7 A;  3I64 A;  1TQP A;  1B9N A;  4HQM A;  1I27 A;  2PJP A;  4G7O F;  2WC2 A;  1BC8 C;  2CQK A;  2XHK A;  3JTH A;  4EGY A;  1ZN2 A;  4G7Z F;  4XLN F;  1CF7 A;  5K5Q A;  3HTS B;  3EYI A;  3MEX A;  3ABT A;  4LMY A;  2OZU A;  3VOE A;  2DT5 A;  5LLQ A;  3HOT A;  1YIO A;  3LQR A;  3J7A O;  1QQI A;  2ISY A;  3L09 A;  2L54 A;  4BQA A;  1CGP A;  3BP8 A;  2JT1 A;  1ZG1 A;  4ENJ A;  1K78 B;  3U9G A;  1BJA A;  3T1B A;  2PG4 A;  2K86 A;  2MH9 A;  5E1Z B;  2F5C A;  1WWX A;  3WGH A;  1D3Y A;  2WTE A;  2DQR A;  2XAF A;  2QBY A;  2AXL A;  4HF0 A;  4RGS A;  5JVT A;  1W4M A;  5HS7 A;  3O2P E;  4A5N A;  2L02 A;  1DUX C;  1JHH A;  1G3W A;  5FGM A;  2GZW A;  5LGN A;  1DDN A;  1Z6R A;  4EM0 B;  2TDX A;  4XRF A;  4UVA A;  3IC7 A;  2MH2 A;  4YFN F;  2ZFW A;  2ZNZ A;  4LLN A;  2VT2 A;  2GWR A;  4GXO A;  4I02 A;  1KU7 A;  2A61 A;  2ESH A;  4ZZD A;  2HKO A;  2V1X A;  1BIA A;  2KJB A;  1FLI A;  1IRG A;  3BJ6 A;  4I0B A;  1HST A;  4OIQ F;  2Q0O A;  1JGS A;  2IRF G;  2MA3 A;  2K4J A;  1P4A A;  4ESF A;  2STT A;  4XBF A;  1R1U A;  4L9V A;  1BOA A;  1R1V A;  4BHP A;  4OMZ A;  2W24 A;  4ESJ A;  2O61 A;  1KYZ A;  3Q9S A;  5JR3 A;  1TQM A;  2O6G E;  2JPB A;  3KLO A;  3T0Y A;  2V9V A;  2NAZ A;  1XSV A;  4HV6 A;  1LJ9 A;  1MD0 A;  3C7J A;  4CDG A;  3V8L A;  2PEX A;  1HW2 A;  4DQ2 A;  1UCR A;  3KEO A;  2YSR A;  4M9X A;  1SMY F;  3PFI A;  4MGR A;  5DD8 A;  1IN6 A;  2D1H A;  5CLS A;  1YTY A;  1EH8 A;  1IN8 A;  3TGN A;  5LEK A;  1XGO A;  3V7R A;  3G3Z A;  5A2Q K;  4HW0 A;  2O03 A;  1BBY A;  1XN7 A;  4B8X A;  2FBI A;  3F8M A;  3QOP A;  3GZ5 A;  2A6E F;  1V3F A;  3B02 A;  4OMY A;  1ON1 A;  1USS A;  2XV4 S;  2CGP A;  4PCQ A;  3IRQ A;  2YR2 A;  4KT5 C;  2F5D A;  2HTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...