1S7OA

Crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYPHDEYLQEKISILTSIDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM
publication title Structure of the putative DNA-binding protein SP_1288 from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m3
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7oA00
1U5TA 4OOIA 4UHTA 4ZZDA 4HDUA 1B9NA 3ROUA 4O5VA 5JHUA 4CZZA 2LDUA 2Z99A 5FB2A 1YW8A 4L18B 4RB1A 1GXQA 4LMYA 1LQ1A 4GO1A 3CO6C 5ICGA 2J5OA 2QYOA 4BQAA 4MGRA 1QO0D 2JT1A 4HLXA 1W4MA 1ZH5A 3I4PA 3W6KB 3QPTA 4OMZA 4RB2C 2RC4A 5FFXA 1OPCA 1LEAA 1FWZA 5D5VB 1F9NA 1RIOH 2UWMA 3HUGA 3BP8A 1O7LA 2ZXJA 2QQBA 4G6DA 3JTHA 1XSVA 4RAYA 1PDNC 2GWRA 1L3LA 2HWVA 2MLGA 3KZZA 1P4AA 2PFBA 2STWA 3DF8A 1Z05A 4NHJA 1F4KA 3ZN0A 4LK1F 1K6OA 4LGWA 3H92A 2ZCWA 2JPCA 1JHFA 1JHHA 5JVTA 5K5QA 3QOPA 1YFHA 3R6SA 4K2EA 1ZYRF 5TJJA 1YG2A 1J0RA 1FT9A 5HOOA 1L0OC 1Z6RA 3JTGA 5LEJA 2HYFA 4CXFA 4G6QA 4Q5SF 4XRFA 2K7LA 3BOQA 4UVAA 1WRJA 4KIFA 5L3EA 3F23A 4RB0A 1DP7P 3NEUA 3VB2A 2KIUA 3V7SA 4KIGA 2EJRA 4AIHA 3LQQA 2L4AA 3G3ZA 2IP2A 1LVAA 3DFGA 1YS6A 2L01A 4EJUA 3RDIA 2CW0F 3U9GA 4EJTA 3IKVA 4JK1X 4N9IA 3MQ0A 4EJOA 3J7AO 3TGNA 2PBIA 1ULYA 2MLKA 2ZNZA 2XHKA 2Z5UA 3I59B 3C18A 5FD6A 1HW2A 4HF1A 2ISYA 4IVNA 1TNTA 2EA4A 3F21A 1D8JA 3P7NA 3GVAA 4ZYHA 2RN7A 1WSUA 4I02A 2M30A 3EYYA 2O0YA 1Y0UA 1UHMA 3I71A 1B6AA 5E18F 3F72A 2CG4A 2TDXA 4UVBA 4MQ9F 5JI6A 1IXRC 3ULQB 5K1YA 2HFHA 1C0WA 2VXZA 3FMSA 3KEQA 1QZZA 1KQ9A 3V7CA 3SHFA 4E70A 2BEOA 4R79A 3R60A 2K86A 5CVUA 1KYWA 1T0FA 2EV6A 1BIBA 4WXHA 5HS9A 2IRFG 4G94A 1WKMA 4N0BA 5H20A 3CUQA 4O3MA 2JPBA 5L3GA 1R58A 4XSXF 4GYIA 3JSPA 1IZ1A 3O3KA 4YG2F 5EEHA 1YIOA 5TRDA 4IXAA 2ZFWA 4LD5A 3I54A 3IC7A 1JE8A 5FLXK 1HSTA 2VBXA 1K78A 2VONA 3WGHA 1FOKA 1S29A 3FM3A 3LA7A 1G3SA 4OIRF 3B02A 1KYZA 3D0SA 4UXNA 3BJ6A 4HYEA 1JXSA 3GXOA 2BV6A 3QU6A 1I6XA 3BROA 3WU0A 3QP6A 1LEBA 4ON0A 1K79A 3GFJA 3KLNA 2P8TA 2XROA 1SMTA 1ZGAA 1UHWA 4KMUX 5LHHA 3K2ZA 3KP4A 3F8BA 4I98B 3L7WA 1GVJA 2FQ3A 5J8CA 3AAFA 1GXPA 4RAZA 4XBFA 4OIOF 2X0LA 3F8MA 3F3XA 2D45A 1HKTA 4D0PA 3K1NA 4UVCA 2F5FA 2VOPA 4KA4A 1OMIA 5ICFA 3HYIA 4G7OF 3ABTA 4M9ZA 2V79A 4HQEA 3QU3A 1OKRA 4EGZA 1RI7A 4UV9A 4P9FA 1VTNC 3QPHA 5ERIA 4PGHA 3K9TA 4BXUA 2FRHA 2LNBA 1ZAOA 3IKTA 2J5PA 2YX4A 2ELHA 3MWMA 2Y75A 1R1VA 1S6LA 2P5LC 1YTYA 3ZMUA 2DTRA 3OOPA 1XGSA 1FSEA 3BDDA 4N9HA 3E5XA 2ZMEA 2A5YB 4LB5A 3CTAA 2R3SA 2A61A 4R8HA 2OQRA 3N4MA 3L09A 5BPDA 4OU0A 1SD7A 3CO7C 3N97A 1V3FA 3IHUA 4Y17A 2VBYA 2D1HA 2BBYA 1TW2A 5DCMA 4L9JA 5HLGA 5CVJA 4KN7X 1ZRDA 5BPIA 3REOA 2GXGA 1FLIA 2HTSA 2HGCA 2VODA 3DPLC 2CO5A 1Z6TA 1HKQA 1FBSA 4HV6A 3VOEA 1ZRCA 1HBXG 5H6RA 1P92A 3MCZA 1JGSA 4QLCU 2F2EA 3I53A 4M6XA 2GA1A 3KETA 3Q9VA 1HSJA 3FMRA 2G7UA 3ERED 3FZVA 2YPRA 3ZMTA 5LHIA 5D6FA 3HOTA 4MNUA 2ZO4A 2BGCA 1HW5A 3WE3A 1X3UA 2VE9A 3BJAA 1SFUA 1YW7A 2STTA 3ZPLA 2ISZA 3ZMZA 2R7DA 5LGTA 3T0YA 3F6VA 4PZJA 2FBIA 4EJWA 4KMFA 3RTRA 4ENMA 4CHUA 5J6XA 2H94A 4M74A 2NNYA 1WQ2A 2PJPA 3E6DA 3HTUA 3I5UA 1W5SA 2FMLA 2A3SA 2V1DA 2XAQA 1ZN2A 2VE8A 1W7PD 2OBPA 4ZYEA 3E6MA 3LFKA 1AWCA 1MJ9A 5EEGA 1IN4A 1MJAA 1WI9A 2PMUA 5HS7A 1T39A 4WF2A 3ML6A 1S3JA 4KYWA 2A6EF 3CUOA 5D4RA 2F5CA 3OV8A 5F1RA 2C6YA 2ZBKA 5DCMB 4L5IA 1PUEE 2QUFA 2ZJ2A 1XSXA 3SZPA 3WTTC 2CWEA 3FMQA 4BYYA 1FYMA 2ETHA 3COAC 1R7JA 1OR7A 2QLZA 4S05A 1RUNA 3MZYA 4LJZF 1BI3A 3P9KA 3RPUA 5HDGA 3GUDA 1IUYA 5ILUA 2MD5A 1SAXA 2FNPA 1ZGJA 2VC1A 3I59A 5E8IA 2K4JA 5ILSA 2IJLA 4ESJA 2KJCA 2PN6A 2P6SA 3FXRA 3DV8A 3EYIA 4G9YA 2FXAA 1S7AA 3IRRA 4EJVA 1IN6A 1RUOA 2DW4A 2HR3A 4G7HF 1K7AA 3RJPA 1MGTA 2IPQX 1R00A 1I1SA 2WC2A 3GO5A 2HOEA 2LSOA 5CVIA 2GA2A 4MEXF 3R61A 3M1EA 2EFQA 5DD4A 4HLYA 1OYWA 1I5ZA 3RIRA 5DDGA 2Z33A 2RKHA 3KE2A 3FM5A 2M87A 1ZRFA 4IRHA 4PCQA 2GAUA 4MTEA 2IA2A 3T8TA 2ESNA 3WTXC 2NYXA 2O61A 1ZARA 2PMHA 2MH2A 2XKOA 3TO6A 3GZ6A 1BI0A 3F8CA 2P5VA 3CDHA 2DO7A 3H3UA 5FLXZ 3M9AA 4WWCA 3WU1B 4CGZA 3GZ5A 1IF1A 5DD8A 4B8XA 4Y15A 3ZMSA 4NB5A 2LF8A 5BOXA 2YU3A 3TOBA 4PDKA 3TDZC 4KIBA 4IPAA 3H3ZA 1R22A 1Z7UA 3DPTA 3JAMK 3IRQA 1ODDA 2QQAA 3KFWX 3DQVC 2DK5A 4Q47A 1R5HA 2IVMA 4UUVA 3R0JA 2LF7A 3TKYA 1H9GA 1HKSA 1UCRA 3BPXA 4KUMA 4LLLA 2O6GE 4ZYDA 2JRTA 1D5VA 4P9UA 4RS8A 2DT5A 2HKOA 4FX4A 3JSOA 2EA2A 2FU4A 4A6DA 3CLOA 3HOSA 4BHBA 2WV0A 4KT5C 4H0EA 3BY6A 5H6QA 4Z2YA 3ISPA 1HQCA 4WCGA 4Y13A 1G4DA 1YYVA 2PEXA 3FXQA 1R5GA 3WODF 1IN5A 2DLLA 5HDKA 3HHHA 2DI3A 2XAGA 4LG0B 1ZG1A 2H6BA 4OIQF 1MD0A 5BQTA 1HXDA 4I7HA 1QPMA 1ZLKA 2COMA 4L9NA 2YSRA 1UFMA 2V1UA 4A0YA 1FC3A 2O8XA 3J81K 1BI2A 4XLPF 4WK8F 3F22A 2JTVA 3KZYA 3D5LA 1TLHB 1IXCA 1KQ8A 1XSDA 3SQNA 2BE5F 4GCVA 2FMYA 4XLNF 4EM1A 1H0MA 3IL2A 3GW2A 3K1MA 2QENA 3J80Z 4YFKF 2M1BA 1XCVA 3LAPA 2QWWA 5D6EA 4P96A 4I0AA 2Z3YA 1UB9A 5BS6A 1ZLJA 2OA4A 5D8KB 4HX7A 3GYHX 5E8GA 4AIKA 4LK0F 4ENKA 2XIGA 4IHTA 3ZP5A 3P9IA 2VC0A 4RGXA 3RKWA 4IF4A 1FBQA 1R23A 1YLFA 2QBYB 2OQGA 1FYLA 2B0LA 4NQWA 1QQIA 4P5OA 3ZMDA 4IRGA 3MZHA 4HBLA 4RGRA 3G73A 1DPUA 3KP5A 1IN8A 5D5XB 3TO9A 4L9VA 2V6CA 3PFIA 1XMKA 4M9XA 2KRFA 1E17A 5DUKA 5D5WB 4FX0A 2PG4A 1XGNA 4BHPA 4FHTA 1B59A 4HX4A 2BYVE 5ILVA 4BAYA 1DPRA 1P2FA 1IN7A 3L00A 2AS5F 3R0AA 4XSZF 2HQNA 1SD6A 4BHCA 2JSCA 3PQJA 3RKYA 4U0YA 2CGPA 2DQRA 4GGGA 4HV5A 1STZA 4M72A 5DV5A 3WGGA 4MEYF 2XRNA 1F5TA 4IRIA 2XAJA 1R1TA 4OINF 3GFMA 4ESFA 1XCBA 1KGSA 4Q48A 4HDVA 1ZG3A 1G3TA 3GLXA 3DP7A 2P5KA 2H27A 1TBXA 3VEPA 4CICA 3E3VA 4S04A 3ABUA 2RV8A 1BI1A 3WTSC 2HYGD 3HTSB 4ENJA 3J80K 2L54A 4CDGA 3S2WA 2VOOA 2UZKA 3SZTA 4YIFA 4AIJA 3F6OA 5LRRA 3EUHA 1DUXC 1YO5C 3O2PE 4B09A 3HSEA 1SMYF 2FBHA 2ACJA 4RGUA 2XKPA 4FT8A 3T5XA 5CVVA 1T2KA 4LLNA 2VBZA 2MH9A 1WWXA 2L4MA 4M71A 1SFEA 3NQOA 3K69A 4HZFA 1MDMB 5A2QK 2LKPA 3E5UA 3EETA 2E7XA 2EK5A 4GXOA 1ON2A 5LGNA 4LLGF 5CJ9A 2G7HA 2K02A 1U8RA 2XAHA 4RGSA 2XV4S 4M73A 1R1UA 2EV0A 3HSRA 1LDDA 3V7RA 2HS5A 4ASNA 2K4BA 1KA8A 2EFPA 5CLSA 1FSHA 1LDJA 2Q0OA 4A5MA 4U7BA 1P4XA 3I58A 3M8EA 2UXXA 1XB4A 2O3FA 2OD5A 1LB2A 5HDNA 3LWFA 5E20A 1SD4A 3KEOA 4ENNA 4A12A 1J5YA 3IWFA 4L0YB 2FNAA 2GZWA 3FX3A 3K1PA 1Q1HA 1J75A 2DBBA 2A6HF 1USSA 2HZTA 3ZN1A 4JQFA 2HDCA 3CJNA 5DYMA 3KP7A 1BIAA 4TV7A 2CQKA 2O03A 2WWYA 5ICCA 1H9TA 5CYVA 2OU2A 2W25A 5E1ZB 2QZ8A 1XDSA 1R36A 3O6BB 2FBKA 5JFRA 5FFZA 3JAMZ 1G3WA 4DNCA 1Z91A 3E97A 3GFLA 3KLOA 4ZH4F 1QBJA 3EDPA 3DXJF 2JZYA 4HF0A 1IRGA 1ON1A 1P4WA 1W5TA 1O3SA 4I09A 4WXDA 2EB7A 3L9FA 4I2OA 1P6RA 3M8FA 1B1BA 3C7JA 1LJ9A 3L2CA 4IHSA 1IAWA 1EH7A 3KP6A 2VT2A 3B73A 2KIFA 3GFIA 2KIMA 5IT3A 2KKOA 1KU3A 4WX9A 1W7PB 1BBYA 2P6TA 1AOYA 1T6SA 5E1WA 2ZNYA 4CO8A 2VT3A 1BN5A 1FP2A 4L5JA 4AD9A 4UNOA 1U5TC 1G3YA 1S8NA 4LG0A 2W57A 2M45A 2GXBA 1T98A 1SFXA 3JW4A 2YX7A 2RVCA 4WXCA 3TOAA 2D2WA 3WTVC 2W85A 2DPUA 2ESHA 1LNWA 2AXLA 3KP2A 2EFWA 3KCCA 4JBAA 3V8JA 3FWEA 3J81Z 3EQLF 4EVIA 4LB6B 4HX8A 1O3QA 1TQPA 3R4KA 3V4GA 4PGGA 2MBFA 5LEKA 3GEZA 2RGVA 1EV7A 4L0ZB 3PQKA 4HF2A 2V9VA 2YR2A 1U2WA 5D8LB 4ETSA 2RDPA 1GHCA 3E6BA 4I01A 3V8KA 2DPDA 4HW0A 2CYYA 4HOBA 1FYKA 1MZBA 4EV0A 3ZQ7A 5F64A 3WG9A 4O6JA 5DEQA 5LRSA 3WTYC 1CF7A 1KU2A 1XMAA 4R1HA 1U5TB 3FF5A 2RNJA 3F8NA 4HQMA 2PI0A 5E1XA 1ZHFA 2QBYA 1ZREA 1O7FA 4CYDA 5ICEA 2NAZA 5CVRA 2XASA 2EFNA 5JR3A 2UXNA 4U0VA 1USTA 1ONVA 2DK8A 1RNLA 4QWQA 2H6CA 1J7KA 4L9TA 3ZMVA 1B9MA 1PP8F 3HSFA 1SD5A 5FD5A 1G6NA 4GYGA 2FOKA 4MHGA 1FP1D 4M6YA 1RZ4A 5IT9Z 1KU9A 1E2XA 6PAXA 1ZG5A 3I64A 2E7WA 3TO7A 1FX7A 5L3BA 2H09A 1O3TA 3QP5A 2NNNA 2PQ8A 1A04A 2GQQA 2MC3A 4IJAA 3FXUA 4U0WA 3DEUA 4BH9A 3LAJA 2FA5A 3WTUC 4RB3C 2E1CA 3LSTA 4EM2A 2HKXA 3GX4X 4G7ZF 2GIVA 1TQIA 4M9SA 4KICA 2HEOA 3RKXA 1XGOA 1OYIA 1CGPA 4KNYA 3TDUC 3WTWC 1FPQA 2V1XA 1IRFA 1EH8A 2VN2A 5LGUA 4AWXB 5HLIA 4Q4ZF 4HA8A 4F7ZA 4KDPA 2M8EA 2XGXA 3W6JB 4OMYA 5F6FA 1XGMA 3HHGA 1YQAA 2FEZA 3SXYA 2OZUA 1MJBA 1CF7B 2P7CB 5AIQA 3CUQC 3RYPA 5FO5A 3GF2A 1TW3A 5A2QZ 5ED4A 1BC8C 1MDMA 1HW1A 2F5EA 5LLQA 2Y0MA 5DCFA 1U78A 2W24A 1IW7F 3E6CC 2HQRA 3C1DA 1BOAA 3HRUA 2X4HA 5L3FA 2IW5A 1DDNA 4BNCA 2W84A 4EGYA 4ZYGA 1QGPA 3HIFA 1NHAA 1O57A 1Z1DA 4KN4X 1U3EM 5IT9K 1I1GA 3QAHA 5J8FA 5FGMA 2ADUA 3ECHA 3K0LA 2FE3A 3MFKA 2EV5A 2FSWA 2QQ9A 4HAMA 4U7DA 3RYRA 3C3WA 2OAZA 4YFNF 2L02A 4AVPA 5E17F 1PP7U 3RI4A 2IT0A 3HRTA 3CUQB 4ZZLA 3IWZA 3MAJA 2FF4A 2A68F 1FZPB 1TTYA 5DUIA 4KFCA 4UV8A 2PLYA 4A2UA 5HVQC 3HRSA 1O3RA 1K78B 2DQLA 5LHGA 5D4SA 1U6GA 2XUBA 3E5QA 3P9CA 1KU7A 2CSOA 2A07F 4ESBA 1XN7A 1J2XA 4DQ2A 1YS7A 3LA2A 4A0XA 3FHZA 2ZKZA 3V8LA 5L3CA 2M5WA 2P4WA 3LQRA 2Q2EA 1QZYA 3VFZA 4A5NA 4U88A 1S7OA 5AONA 2MA3A 4P55A 5HLHA 2NS0A 3F8FA 1YW9A 1MKMA 1W7PA 1FNNA 1B4AA 1IXSB 1KQ0A 1XD7A 4EM0B 2EFOA 5AIPA 3T1BA 4OIPF 1EH6A 3SFZA 3WGIA 2VBWA 4YIIA 3MEXA 5KVRA 2DAOA 2E1NA 1XDUA 3DKWA 2G9WA 5D5UB 2EWNA 2WTEA 3QRFF 3T8RA 2A69F 2Z9OA 3TQNA 1J9IA 2Q8KA 5K5RA 5K5OA 4MTDA 2IA0A 2R7FA 3BPVA 1V4RA 3BZ6A 3WTZA 2DU9A 4LFUA 1QNTA 1J59A 1FBUA 2CFXA 4MQVA 4G8XA 2F5DA 4A6EA 1TNSA 2RQPA 3Q5FA 3Q9SA 2K27A 4EQQA 2D1VA 1FY7A 2IA1A 3WE2A 3KP3A 5HS8A 1D3YA 2DFIA 1I27A 3HRMA 2KJBA 2HTJA 3GWZA 5LBQA 1F1ZA 2Y48A 2ZMEB 2OZ6A 4YFXF 2XVCA 4EMSA 3ECOA 3M7GA 1TQMA 3ELKA 3LA3A 1LDKB 2L3DA 1REPC 1OYYA 3VODA 3BWGA 3BJOA 3U2RA 2QM3A 4A0ZA 1Z9CA 3RPQA 5L3DA 2QVOA 4I0BA 1T38A 3I0TA 1BJAA 2P7VB 3NRVA 1BC7C 1BM9A 5KK1A 1D8KA 2XAFA 5BMZA 3U1DA 2NRAC
chains in the Genus database with same CATH superfamily
1U5TA 1I3QJ 1HCRA 4OOIA 4UHTA 2B63J 1G2HA 4NNJA 4D9JA 2TRTA 3OL4A 3BQZA 4ZZDA 4HDUA 1B9NA 3ROUA 4O5VA 4UB6C 2IS1A 2V26A 3OYKA 1GV5A 5JHUA 4CZZA 2LDUA 2Z99A 1MMGA 5FB2A 1YW8A 3L1PA 3GTOJ 4L18B 4RB1A 1GXQA 3K4LA 1T95A 2R7RA 4LMYA 1ZGWA 1G8XA 4GO1A 3LSRA 3MN2A 1LQ1A 3X2QH 1K4SA 3RQ4A 3CJQB 3CO6C 5ICGA 2J5OA 3BR5A 4XN0A 2QYOA 4BQAA 1FIAA 1RESA 4MGRA 1QO0D 2JT1A 1DU6A 4HLXA 1W4MA 1ZH5A 3I4PA 4FE4A 1ACIA 2K9QA 3W6KB 3QPTA 1OR7C 4OMZA 3MKYB 2JA7J 4RB2C 2L7KA 2RC4A 5FFXA 4HPQA 1OPCA 1LEAA 2CQXA 4PFPA 1M1EB 1FWZA 5D5VB 3AG3H 1F9NA 1RIOH 2UWMA 3OL3A 3L2RA 2KLOA 1ITYA 3HUGA 2IGMA 3BP8A 3BC8A 1O7LA 2ZXJA 2QQBA 4G6DA 5FKNA 3JTHA 1XSVA 4RAYA 1VI0A 1ZKGA 5TGTA 2LY1A 1PDNC 2GWRA 1L3LA 2HWVA 2MLGA 3S15J 3KZZA 1P4AA 1UELB 2PFBA 3HDDA 4KJZA 3IAS2 2Y31A 1QPIA 2STWA 3DF8A 2N8GA 1Z05A 4NHJA 3HPGA 1MMDA 3G1OA 3ZN0A 1F4KA 5B1AH 4LK1F 1K6OA 4B44A 4LGWA 3H92A 1EA3A 2ZCWA 2JPCA 3K4CA 1JHFA 1JHHA 2OUMA 5JVTA 2XB5A 3DTIA 4HNTA 5K5QA 3QOPA 2LKXA 1YFHA 3R6SA 4K2EA 1ZYRF 4RMNA 1X2NA 4BE2A 3ASNH 9ANTA 1YI2I 3OYMA 5TJJA 2DXIA 1MH3A 1YG2A 1J0RA 4MLOA 1FT9A 2NOJB 3MKWB 3JRBA 3FK7A 5IP9J 5HOOA 4YEJA 5C4XJ 1L0OC 1H88C 3EPZA 1Z6RA 2EBIA 2OC6A 3JTGA 2O8KA 1IUFA 2X6WA 3K6GA 5LEJA 2Z16A 3OYHA 2HYFA 1MMAA 1W36D 4CXFA 4G6QA 3CCLI 2R92J 4Q5SF 3DKXA 4XRFA 2K7LA 3HZJA 3BOQA 4UVAA 1WRJA 3TP0A 4KIFA 3OWTA 5FLVA 3BR3A 5L3EA 3F23A 1T56A 4RB0A 2L7MP 4V19K 2M9HA 2ID3A 2P0WA 1DP7P 3NEUA 3VB2A 2KIUA 2W4SA 5F04A 3V7SA 4XLCA 3A0BC 4KIGA 2EJRA 1HDPA 4AIHA 2Y9YA 2L4AA 3LQQA 3G3ZA 3A1YA 2JMWA 2IP2A 1LVAA 3DFGA 2YU9J 1YS6A 3U1DA 2L01A 4PJJA 2F4IA 3OS2A 4C2UA 4EJUA 2QEXI 3RDIA 2CW0F 3FDYA 2M7BA 3U9GA 1Z0XA 4CCNA 4EJTA 2YS9A 3IKVA 4JK1X 5E79C 1DQUA 4MFEA 3OYNA 4N9IA 4GFBA 3MQ0A 4EJOA 1ORKA 3PNVA 1YJWI 3J7AO 3TGNA 2XC7A 2PBIA 2F5VA 1R4NB 1ULYA 2CH0A 2MLKA 2OCCH 2XHKA 2Z5UA 2ZNZA 3I59B 2LC2A 4M3EA 5EDNA 4JOMA 3QPLA 3C18A 5FD6A 1HW2A 4HF1A 3I56I 2ISYA 1OCPA 4IVNA 2DN0A 1TNTA 1Y8RB 2EA4A 4RBOA 4XMYA 3F21A 3P7NA 2KT0A 1D8JA 2A05A 3CF2A 3GVAA 5H2FC 4ZYHA 1V55H 2XSJC 2RN7A 1WSUA 1OCZH 4I02A 2M30A 3EYYA 2WAQN 2O0YA 4CH7A 1Y0UA 1SFOJ 1UHMA 1MBHA 2ZJRF 3Q3SA 3I71A 1B6AA 3HUGB 5K7FA 3GTLJ 5E18F 3F72A 2CG4A 2JQ7A 2TDXA 4UVBA 1YRNA 2Y69H 4MQ9F 3S3OA 5JI6A 3H9QA 3H5AA 5K7ZA 1IXRC 3D5RC 3ULQB 2HFHA 2HOAA 2X1DA 5K1YA 3IUOA 3K7AJ 2JA5J 1C0WA 2DOEA 2VXZA 4JX5A 2X6YA 2Q1ZB 3FMSA 2HVRA 2RAEA 3KEQA 1QZZA 1KQ9A 3V7CA 3SHFA 4MFDA 3CCJI 2DA1A 4E70A 1QU3A 2BEOA 4X1EA 2K85A 1FOWA 4R79A 3R60A 2K86A 5JHFA 5CVUA 1KYWA 4CYCB 1T0FA 3CCYA 4ITVA 2EV6A 4A3KJ 1BIBA 1VQ8I 1PVEA 4WXHA 5HS9A 3OYIA 2IRFG 1WFXA 2LBFA 4G94A 1WKMA 2L5QA 2FX0A 4N0BA 5H20A 2R7OA 3CUQA 4O3MA 1F43A 2JPBA 2DFFA 5L3GA 1R58A 4XSXF 1ZK8A 2VJJA 4GYIA 3JSPA 2R7XA 2K3FA 1K61A 1IZ1A 3O3KA 4YG2F 5EEHA 1YIOA 5TRDA 4IXAA 2PJRB 2ZFWA 4JX6A 4LD5A 3I54A 3IC7A 4DBRA 1JE8A 5FLXK 2IBDA 1HSTA 2VBXA 3WU2C 1K78A 3PO2J 2VONA 3WGHA 3NAUA 2VJ4A 1SVMA 2F4OB 4XLEA 2JUGA 1FOKA 1T08B 2I8DA 1S29A 5GPAA 3FM3A 3G71I 3LA7A 1FTTA 4DOZA 1GLNA 3FK6A 1G3SA 1N75A 4OIRF 3B02A 1KYZA 3CMYA 3D0SA 2K9LA 4UXNA 3CCQI 3HOZJ 1VQKI 3BJ6A 4HYEA 1JXSA 1JT0A 3GXOA 5HNFA 4AM3A 2MFZA 2BV6A 2D5VA 2ECBA 2GBYA 3QU6A 4BEHA 2VKHA 1VQ6I 1D1AA 1I6XA 4RLFA 1MSEC 3LFUA 2AXTC 4D1QA 1QHHD 2DA5A 3BROA 3WU0A 4A3EJ 2MYSA 3QP6A 1LEBA 4ON0A 2JA8J 1K79A 2H8RA 3GFJA 3KLNA 2P8TA 2XROA 1SMTA 1ZGAA 4BUPA 3W2VA 1YJ9I 2GXAA 2QF7A 1UHWA 4KMUX 4E6KG 5LHHA 3K2ZA 3OYBA 3KP4A 3F8BA 1A31A 3HBLA 4I98B 3ZRGA 2KZVA 3L7WA 1GVJA 2B9SA 4ZDLA 3GTGJ 2DMNA 2LY2A 3DBHB 2FQ3A 2GOMA 5J8CA 2X1EA 4F91B 3K70C 2JA2A 3BR1A 3AAFA 1GXPA 4RAZA 5CPRB 3CC7I 4XBFA 1XPXA 1LVKA 4G6TB 2LKSA 2X0LA 3F8MA 1RKWA 4OIOF 3F3XA 5TISC 2D45A 1XX5A 5F08A 5EZGA 1HKTA 4D0PA 3K1NA 5E3OA 4UVCA 3OS0A 2XDVA 2F5FA 2VOPA 1WZ2A 4KA4A 4BQOA 1R6RA 1WJBA 4BACA 1OMIA 2EZHA 5ICFA 1W0UA 3HYIA 4JYKA 4G7OF 3ABTA 4M9ZA 2CMPA 2V79A 4HQEA 1D0YA 3QU3A 2KDOA 4QSHA 4Y7NJ 3IV5A 1OKRA 4EGZA 1RI7A 1VQLI 1R5ID 4NC7A 4UV9A 4P9FA 2K3PA 2VB6A 1VTNC 2E60A 3QPHA 3KYDB 5ERIA 4PGHA 3K9TA 3BZKA 4BXUA 2QQ8A 5J1RA 2FRHA 2LNBA 1ZAOA 3IKTA 2EZLA 2J5PA 2YX4A 2ELHA 3MWMA 2Y75A 1R1VA 4D5FA 1S6LA 1FOYA 2P5LC 1YTYA 3ZMUA 2DTRA 3OOPA 1XGSA 1FSEA 2EH3A 3BDDA 4N9HA 3E5XA 2ZMEA 2A5YB 1Z3YA 2VPRA 4LB5A 1V5EA 3CTAA 4MIMA 1YX3A 2CW7A 2R3SA 2A61A 3QQAA 3RSNA 3OYCA 1JTXA 2OQRA 4R8HA 3L09A 3N4MA 5BPDA 3GLLA 2EIJH 4OU0A 4PSXA 1SD7A 3PFYA 2MG4A 3LSJA 3E0JB 3CO7C 2IEKA 3N97A 1V3FA 3HM5A 3IHUA 1LFPA 3A01A 5FKKA 4I99C 4CCLA 4Y17A 2VBYA 2D1HA 2BBYA 1RR7A 1TW2A 5DCMA 4L9JA 4PJMA 2NVYJ 5HLGA 3FXJA 4NDLA 5CVJA 4KN7X 2Y0SA 3A2KA 4XRSA 2W00A 1ETKA 1ZRDA 1BW5A 5BPIA 4DZPA 3REOA 2GXGA 2MABA 1FLIA 2HTSA 2HGCA 2VODA 3DPLC 2CO5A 2JVHA 3J7AY 3MD2A 1X4OA 1Z6TA 4BEHB 1HKQA 1FBSA 5LD2C 3OYAA 4M3GA 4HV6A 2WY8Q 5M5XJ 4IEJA 3VOEA 1ZRCA 3SDBA 1MIJA 5H6RA 4B47A 1HBXG 1WH7A 1P92A 2L9NA 3MCZA 4BJTA 1JGSA 1VQ7I 3P5JA 3CC2I 4QLCU 2F2EA 5C3EJ 3I53A 4M6XA 1CQTA 4UUSB 1H8AC 2GA1A 3KETA 3Q9VA 4P1WA 1NG7A 2E34A 3PUBA 4NQWB 1OCTC 4PUSA 1HSJA 1FMWA 3FMRA 2G7UA 3FXLA 3ERED 3VYRB 1TWCJ 5CQEA 3FZVA 2YPRA 4YIRX 4RM2A 4S0HB 3CESA 3ZMTA 5LHIA 4BDZA 5D6FA 3HOTA 4MNUA 4FTHA 2ZO4A 1V5GA 2BGCA 3PJRA 1HW5A 2L7FP 3OYDA 3HOVJ 4ZC3A 3WE3A 2L2OA 1X3UA 4OAZA 2VE9A 3EUHC 2OCEA 1PUFB 3BJAA 2CV2A 1SFUA 1YW7A 1Y6IA 3CMEI 3S14J 4RLQA 1JTYA 3G1LA 2VXDA 4CCJA 5M3FJ 2STTA 3ZPLA 2ISZA 4V2GA 3ZMZA 2R7DA 3H1CA 5EGOB 5LGTA 1NK3P 3O8HA 4PJNA 3T0YA 3BLYA 2DDBA 3F6VA 1FIPA 4PZJA 2Y2ZA 2FBIA 3BTCA 2OJED 4Y33A 4C30A 4EJWA 4KMFA 3RTRA 3DU6A 4ENMA 2R0QC 1BJZA 4CHUA 5J6XA 2H94A 3F0CA 1PJRA 4M74A 3S1RJ 3ESWB 2NNYA 4E7KA 1WQ2A 2DDAA 3FXMA 2PJPA 3E6DA 2WAEA 1QVUA 3HTUA 3I5UA 1W5SA 2FMLA 4FETA 2A3SA 3OR2C 1TT0A 2V1DA 2XAQA 3FIWA 1ZN2A 2DJNA 2VE8A 1W7PD 2OBPA 4ZYEA 2X6OA 3E6MA 4E7ZA 3MMYB 3CJRB 1RC9A 1JJ8C 3LFKA 4RA2A 1AWCA 5KAFC 2YUSA 3LNQA 4DW6A 1MJ9A 2DCEA 1IGNA 5EEGA 1IN4A 2ECCA 3D1NI 1MJAA 1WI9A 2AQEA 1U9NA 4M3DA 2PMUA 5HS7A 1T39A 1DGWY 3DLLF 4WF2A 2OTJI 3ML6A 3TW6A 1QZEA 4F55A 1S3JA 4KYWA 1WVRA 2L9VA 1G59A 2A6EF 3CUOA 5D4RA 5C44J 3J7YJ 2F5CA 3OV8A 5F1RA 2C6YA 2ZBKA 5DCMB 4RAFA 4L5IA 1PUEE 2QUFA 2ZJ2A 3JRAA 1XSXA 3K4NA 2LTPA 3SZPA 3WTTC 1FOXA 1VF9A 2CWEA 2PX9A 3FMQA 4PJ0C 4BYYA 1FYMA 2ETHA 1IDYA 1XS9A 3H0DA 3COAC 1R7JA 1OR7A 2QLZA 4S05A 1MMSA 3S1MJ 1JGGA 2ME0A 4RDUA 1SEUA 1RUNA 4XKWA 4Y3OA 1X4PA 3MZYA 2IGOA 1HOMA 4LJZF 3PO3J 1BI3A 3P9KA 3RPUA 5HDGA 3GUDA 3ZQGA 2E19A 1IUYA 3PSFA 3BQYA 1BOBA 1K4TA 2HQAA 1WJEA 5ILUA 2MD5A 5J1UA 3S2DJ 1SAXA 2FNPA 1ZGJA 3V42A 2JN6A 2VC1A 1AA7A 1UZCA 4M3FA 2WB1A 2LFBA 3I59A 5EF6A 5E8IA 2K4JA 1V54H 5ILSA 2HDWA 2IJLA 4ESJA 2LP0A 4ZTJA 1BR2A 2KJCA 2PN6A 2P6SA 4LG3A 4IOCF 4QIWN 1R49A 2DMQA 2VKVA 5M3MJ 3RQIA 2VL8A 3FXRA 2HPIA 3DV8A 3EYIA 4HNUA 4G9YA 2FXAA 3I9V2 2CS3A 3VSLA 1S7AA 3BR6A 3IRRA 4EJVA 1IN6A 1RUOA 2DW4A 2HR3A 1ETWA 2CUZA 4G7HF 1K7AA 4BY7J 2EQRA 3RJPA 1MGTA 2IPQX 2NS8A 4BXFA 4Y52J 4HNVA 1R00A 1I1SA 2WC2A 3GO5A 4DBQA 3M4OJ 2XRLA 2HNHA 2HOEA 2LSOA 5CVIA 2GA2A 1TWHJ 1Z21A 4MEXF 2R7TA 3R61A 2BW3B 3M1EA 2EFQA 4F52A 5DD4A 4HLYA 1OYWA 1I5ZA 3K10A 2VJIA 3H0GJ 3RIRA 5DDGA 3RPUD 3S1NJ 2Z33A 2RKHA 2VQHA 4HSTA 3L2QA 2DYRH 3KE2A 3HOWJ 3FM5A 1RKTA 1FMVA 2M87A 1ZRFA 4IRHA 4PCQA 4CYCA 2GAUA 4MTEA 1LPQA 2Z2SB 1Z77A 2LD5A 2IA2A 3T8TA 2ESNA 3WTXC 2X51A 2LY9A 1E3HA 2NYXA 4XLAA 2A6TA 4B1RA 3HOUJ 2O61A 1ZARA 2W82A 3QODA 2PMHA 3HC7A 2MH2A 1WJFA 2IGKA 2XKOA 3TO6A 3QOEA 3OYEA 2BY3A 3MZ8A 3GZ6A 1BI0A 1N78A 1TWFJ 1MSFC 3F8CA 1XC5A 2P5VA 3CDHA 2VKDA 2DO7A 3H3UA 5FLXZ 1MNDA 4BJ6C 3M9AA 4E7SA 2PJRA 1TWAJ 5FROA 4OWRB 4G12A 1D5YA 4WWCA 3WU1B 4CGZA 3GZ5A 1IF1A 1W36C 5DD8A 1WJDA 4B8XA 2NS7A 2DMUA 2XAUA 4Y15A 2L7ZA 2CRGA 3Q0VA 3ZMSA 4NB5A 2EZKA 2LF8A 1D0XA 3FHNA 5BOXA 2YU3A 3F9KA 2EIMH 3TOBA 2M0MA 4JX4A 4PDKA 4A3FJ 4GDFA 3TDZC 1DP3A 2HOTA 1WCMJ 4KIBA 1YE9A 2HQ5A 4IPAA 1O4XA 3CCRI 4I6ZA 3H3ZA 1R22A 1Z7UA 3DPTA 1HDDC 3JAMK 1I39A 5EJCA 3BTIA 3IRQA 1ODDA 2QQAA 1WPKA 3KFWX 3DQVC 2DMTA 4M6VA 2XB0X 4BGDA 2XGCA 3RZOJ 1HLVA 2DK5A 4Q47A 1R5HA 2IVMA 4UUVA 3N05A 3A4CA 3R0JA 2LF7A 1J09A 1JKOC 3TKYA 3HGYA 1H9GA 3ZQLA 1TL8A 4XN3A 2K40A 1HKSA 1UCRA 4W97A 4J00A 4DGWB 5F0CA 3BPXA 3BG5A 3DCFA 4KUMA 4W1UA 2TCTA 4LLLA 1YHQI 4ABZA 2O6GE 4ZYDA 2JRTA 1D5VA 4P9UA 3CQZJ 3OS1A 1KZHA 3M07A 2DT5A 4RS8A 2HKOA 4FX4A 3JSOA 4IL6C 4PJLA 2EA2A 2FU4A 4A6DA 2LLKA 3ZCOA 5KHDA 3CLOA 2EPFA 4BHBA 3HOSA 1Q1VA 2WV0A 4KT5C 4FCYA 3DBLB 4H0EA 3BY6A 5H6QA 4Z2YA 4DYQA 1H89C 3ISPA 2VPLA 1Z67A 1HQCA 4WCGA 4Y13A 5GTIC 2LREA 1G4DA 1YYVA 2PEXA 3FXQA 3K4KA 1R5GA 3WODF 1IN5A 2DLLA 2FOWA 5HDKA 3HHHA 1IV6A 1R71A 2DI3A 2JSPA 2XAGA 2CUFA 3HKZN 4LG0B 4MO7A 1ZG1A 2KZGA 3OY9A 4C3IJ 3G4SI 3A0HC 2H6BA 2HI3A 2VLAA 4OIQF 1MD0A 1Y1VJ 3S3NA 4DJAA 4A3CJ 4LITA 5BQTA 1HXDA 4I7HA 2VKEA 1QPMA 3G1MA 5FRMA 1S72I 3DPUA 4ZDOA 1ZLKA 1DGRM 2COMA 2DT7B 2R5ZB 4L9NA 2ME6A 2YSRA 1UFMA 1BR1A 1ZELA 2XPUA 3I55I 2DA4A 4LIVA 3CF5F 2V1UA 3G2BA 4A0YA 3S3MA 1FC3A 2O8XA 4BY1J 1MBFA 3LSIA 3J81K 1BI2A 3VPRA 4XLPF 1XG1A 4WK8F 3GTMJ 1JJ6C 1MBKA 4II2A 2JTVA 3F22A 3KZYA 3ABKH 3D5LA 1TLHB 1IXCA 1KQ8A 5J47A 2E2HJ 1XSDA 4E4HA 3H5RA 3SQNA 1B8IB 2DA7A 2BE5F 2X85A 4B3XA 2O9LA 4GCVA 4CCKA 3MKLA 1JUSA 2DA6A 2FMYA 3C2HA 4XLNF 4EM1A 1H0MA 3IL2A 3GW2A 2Y0SN 2QENA 3K1MA 3J80Z 4YFKF 2XF6A 2M1BA 1XCVA 3LAPA 3EUKL 2JRMA 2QWWA 5D6EA 4BJ5C 3GCMA 2R5YB 3BG9A 4NUBA 4P96A 3ZOBA 2E2IJ 4I0AA 3ERMA 4KT6A 4PK4A 2Z3YA 1X1BA 3Q0UA 3GTQJ 1UB9A 5BS6A 3Q0WA 3HL2A 2NVXJ 1ZLJA 2X1CA 1RPWA 3W6VA 2OA4A 5D8KB 2R7UA 3K2AA 3WHBA 4AVZA 4HX7A 3GYHX 5E8GA 4AIKA 2E71A 2IS6A 4LK0F 4ENKA 1AU7A 2DA3A 4BDYA 2IXSA 4M3BA 2XIGA 4IHTA 3ZP5A 3P9IA 2VC0A 4RGXA 3RKWA 4IF4A 1FBQA 1R23A 4UUSA 2JA6J 1YLFA 2QBYB 2OQGA 1FYLA 2B0LA 3BG7A 3PL8A 3ZQQA 4NQWA 1QQIA 4U87A 2L9SA 2QSFX 4P5OA 3ZMDA 3FBIB 4IRGA 4XOTA 4CCMA 1FJLA 3MZHA 4HBLA 4RGRA 3G73A 3GMEA 3NWSA 2JJ7A 1DPUA 2X48A 1I6HJ 3KP5A 5IYBJ 1IN8A 1MBJA 5D5XB 4QPOA 3TO9A 4L9VA 1ZR2A 2V6CA 1PUFA 2V9KA 1XMKA 3PFIA 3ZQFA 4M9XA 3FKIJ 1MMNA 2KRFA 1X2MA 1GT0C 1E17A 3O8GA 5BNGA 4BS9A 3FKJA 3CZ6A 5DUKA 1U8BA 3GTKJ 5D5WB 4FX0A 2PG4A 5EGOA 5F0FA 1LKXA 1XGNA 2NRAC 3CP8A 4B3AA 5B1BH 4BHPA 1GVDA 1UHSA 2IS2A 1TWGJ 4FHTA 4ZYAA 1B59A 4HX4A 1I3AA 1LFBA 3K4BA 4L5EA 2BYVE 5ILVA 2W1OA 3ONQA 4BAYA 3U21A 1DPRA 1P2FA 3HJEA 1IN7A 3BZCA 4HG2A 3L00A 3W2WA 1SAUA 4C2MJ 3CCMI 2LRDA 3R0AA 2AS5F 4XSZF 2HQNA 1ZTRA 2BVMA 1VQ5I 1HF0A 2R7ZJ 4UUTA 1SD6A 4BHCA 2JSCA 3J7ZI 3PQJA 4XLHA 3RKYA 4U0YA 2CGPA 3UNGC 3ABMH 2DQRA 3JRIA 4GGGA 4HV5A 3H3VK 1P7JA 2KISA 2CJJA 2DT6A 3SFIA 2M4GA 3I4NJ 2V7FA 2XGEA 4B48A 3C2BA 2HVQA 2VQLA 1STZA 4M72A 3TBIA 4CUGA 2GLOA 5DV5A 3WGGA 4MEYF 3L2UA 3D5SC 2XRNA 1F5TA 1B72B 4IRIA 3AL0C 2XAJA 1R1TA 3JRGA 4OINF 2R7SA 1EKEA 4II3A 1X19A 3GFMA 4ESFA 3KYLA 1XCBA 1KGSA 4Q48A 5B3SH 2FUG2 1WJ5A 2M2EA 4HDVA 1ZG3A 1G3TA 2ZXIA 3GLXA 3DP7A 2E35A 2ZC2A 5HNHA 3S16J 2F48A 5GP9A 2P5KA 2BOLA 2H27A 2KHMA 1TBXA 3VEPA 4AYBA 4CICA 3E3VA 4S04A 1JKPC 1T8IA 4YELA 3ABUA 2RV8A 1BI1A 3WTSC 2HYGD 3HTSB 4ENJA 2LG4A 3J80K 2L54A 4CDGA 2UV1A 4N4NB 3S2WA 2VOOA 4Y4RA 2UZKA 4FASD 3JR9A 3SZTA 2ICWG 4YIFA 5CKTA 3GTJJ 4QTRA 4AIJA 1HC8A 4D7MA 3F6OA 5LRRA 4X6AJ 3EUHA 1DUXC 1Y8QB 1YO5C 3O2PE 3CJTB 4B09A 2EILH 3HSEA 4CSWA 1SMYF 2KQRA 2FBHA 2ACJA 2E5ZA 2O7OA 2DOAA 3EUAA 1MH4A 4RGUA 3LSHA 2LOOA 3PIPF 2XKPA 4FT8A 2WB1N 3T5XA 5CVVA 1T2KA 4LLNA 3SDGA 1TC3C 2VBZA 2MH9A 1WWXA 2L4MA 3HGGA 1IRXA 3QPSA 4M71A 1SFEA 3NQOA 3K69A 4HZFA 1MDMB 2F4MB 5A2QK 4AC0A 3JRDA 2LKPA 3E5UA 5FKOA 3EETA 2DODA 5GAGJ 2E7XA 4AUXA 2EK5A 3KZIC 2BXYA 4GXOA 1ON2A 2UUZA 4LLGF 5CJ9A 2G7HA 2K02A 3SYTA 5LGNA 1U8RA 3ZQCA 2XAHA 4RGSA 3CCSI 4BE0A 4FISA 3HG9A 2XV4S 4M73A 1R1UA 2EV0A 3HSRA 3BG3A 3NARA 4E7HA 1AKHB 1LDDA 4IZZA 3V7RA 1W0TA 2HS5A 3CDLA 4ASNA 5IOZA 2K4BA 2V9PA 1KA8A 2EFPA 5CLSA 1FSHA 1IO2A 1SFKA 3VDXA 1LDJA 3VSKA 3AL0B 2VUMJ 1ENHA 4ZJZA 2Q0OA 3S8PA 4A5MA 4U7BA 1P4XA 3I58A 3M8EA 5J40A 2UXXA 1UG2A 5DTDA 1XB4A 1A6QA 1IV8A 2NVTJ 2O3FA 2OD5A 4F3QA 2BW3A 4NC6A 4IO9F 2M0CA 3KEYA 1LB2A 2QKMB 5HDNA 3LWFA 5E20A 4E7JA 1SD4A 2L0KA 2VASA 2KMUA 3KEOA 4ENNA 3TW7A 3OMYA 1WH5A 5LFAA 4C2TA 1APLC 5DS9A 4A12A 4BE1A 1J5YA 3IWFA 4L0YB 2FNAA 2GZWA 3FX3A 3K1PA 1Q1HA 2R7VA 3PUFA 2ZXWH 1J75A 3OOUA 2DBBA 2A6HF 4XKBA 3FXKA 1VQPI 3RKQA 1USSA 2HZTA 3ZN1A 4JQFA 1GUUA 3LSPA 2HDCA 3CJNA 2ZFUA 5DYMA 3KP7A 2FD5A 5B5EC 3PM1A 1BIAA 4TV7A 1XMXA 2G0EA 2QKLB 2MSYA 4FE7A 2CQKA 2O03A 1POGA 5GTHC 4NC8A 2WWYA 5ICCA 1FEXA 2HXOA 3E1SA 1H9TA 5CYVA 2CU7A 2EIKH 2OU2A 3QYEA 2W25A 5E1ZB 4XNFA 2QZ8A 1XDSA 2XPWA 1LUJB 1R36A 3O6BB 3GTPJ 1X3WB 2OTLI 2FBKA 5JFRA 1T33A 1LFUP 4IHVA 5IP6A 3L2VA 2KDZA 1D1BA 3RZDJ 1VQ4I 5FFZA 3JAMZ 1G3WA 2XGDA 4B4CA 4IKFA 1VNDA 2M7AA 4DNCA 1UMQA 1Z91A 3E97A 3GFLA 3KLOA 4ZH4F 1QBJA 2WV1A 2VQCA 4CCOA 3EDPA 3DXJF 2JZYA 1LE8A 2ID6A 3DTEA 4HF0A 2E1MC 2RNGA 4BQNA 1IRGA 3LSKA 1ON1A 4DYRA 4J19A 1N77A 1P4WA 1EF4A 1W5TA 3IH4A 3CMAI 1O3SA 4I09A 4WXDA 5FKMA 5M5YJ 4IHYA 3OIOA 1W5CC 2EB7A 3BCAA 2Q2EB 2H1LA 3L9FA 3FISA 4I2OA 1P6RA 3M8FA 1B1BA 2E5NA 3L2WA 3C7JA 3OIQA 4GRIA 1LJ9A 4XKCA 3L2CA 4IHSA 3ZQIA 1IAWA 1ETVA 3NWTA 3VYSB 1TT5B 1EH7A 1IJWC 1OCCH 3KP6A 2VT2A 3B73A 1UJ8A 3LMMA 4V2FA 2KIFA 3GFIA 3KYCB 5JLWA 2KIMA 5IT3A 3A02A 2KKOA 1KU3A 2BXZA 4WX9A 1WGXA 3M3YJ 1D1CA 1V5FA 1W7PB 1QHGA 2FJ1A 3PIOF 2R7QA 2V6EA 1BBYA 4BKXA 2P6TA 2MW8A 4DZJA 1AOYA 1SANA 1T6SA 5E1WA 3CC4I 2ZNYA 4CO8A 2PMZA 3DLAA 3I3LA 3IAM2 2L9RA 1WI3A 4A3JJ 2LYCA 2VT3A 3HPHA 1BN5A 1ZQ3P 1FP2A 4L5JA 3ASOH 4LOCA 4AD9A 4UNOA 1U5TC 3M1CA 1G3YA 2F6CA 1N25A 1S8NA 4LG0A 2JUCA 2W57A 2KPMA 1OQYA 2M45A 2GXBA 2O5RA 1T98A 2CUEA 4ANJA 5KNLA 4XICA 1SFXA 3JW4A 2YX7A 3TMOA 2ELKA 2RVCA 4WXCA 3TOAA 2D2WA 3QYFA 3WTVC 1JKRC 2ZJQF 1NTCA 1SVLA 2W85A 1SVOA 2DPUA 2ESHA 1LNWA 2XPVA 2AXLA 3KP2A 2R5ZA 2EFWA 3KCCA 4JBAA 2JVGA 4XRSG 3CP2A 3V8JA 1Z3XA 2WADA 3FWEA 3J81Z 2KL4A 4A3GJ 5GAEJ 3EQLF 4BU2A 3OYFA 3SZGA 4EVIA 3CCUI 4LB6B 4XLFA 4CA0A 2E1MB 3B6CA 2CV1A 3AG2H 3JRHA 3FBNB 4HX8A 1O3QA 4AU7A 1TQPA 2WA0A 5J4VA 3H5NA 1OJLA 2P81A 3R4KA 2QSHX 3U1KA 2R4GA 3A03A 5IPAA 1B8IA 3V4GA 1JKQC 4PGGA 1VQMI 2MBFA 5DM7F 2BY0A 2QCOA 5LEKA 2K9SA 3GEZA 1Z7LA 2RGVA 1GDTA 3OIPA 1EV7A 4L0ZB 3PQKA 4IQJA 1TZLA 4HF2A 3CMMA 2V9VA 2YR2A 1U2WA 3DEWA 5D8LB 1TP4A 4C3JJ 2RDPA 2W48A 4ETSA 2R5YA 1GHCA 3E6BA 4DIQA 3CCVI 4I01A 3V8KA 1OLTA 3OR1C 2DPDA 4HW0A 1LE8B 2CYYA 3BT9A 4HOBA 1FYKA 1MZBA 1I50J 3BR0A 1X1AA 4EV0A 3GBGA 2KRCA 5K7HA 1E3OC 1GV2A 3GZNB 3WG7H 3ZQ7A 1VQNI 2A5WA 5F64A 3WG9A 3I4MJ 4O6JA 5DEQA 5LRSA 3TL4X 3WTYC 1CF7A 1KU2A 1XMAA 5CQGA 4R1HA 1U5TB 2K5CA 3FF5A 4OAYA 2R93J 2AQFA 2RNJA 3F8NA 4HQMA 1ZR4A 5E1XA 2PI0A 1ZHFA 4H4KC 3VYTB 2QBYA 1ZREA 1O7FA 4CYDA 5ICEA 2CV0A 5FLMJ 2NAZA 2IAIA 3PSIA 1RRJA 4XRMA 2I5UA 5CVRA 3CCEI 2XASA 3HXLA 1VFCA 2EFNA 5JR3A 3DTKA 2UXNA 2HPMA 1ERDA 4U0VA 1USTA 5EZHA 4A3BJ 1ONVA 2DK8A 1RNLA 2GOXB 4XORA 5J3LA 4QWQA 2H6CA 1J7KA 2DJIA 2GIZA 1F36A 3AG4H 4DYCA 3DEEA 4L9TA 3ZMVA 3WHCA 2E2JJ 5EG0A 1B9MA 2LH9A 2Z1DA 5J4YA 1PP8F 3HSFA 5GAHJ 5J1YA 2BHZA 2HVSA 1SD5A 4Z6YA 2NXNB 5FD5A 1G6NA 3S17J 2JK3A 4GYGA 3S32A 5DM6F 2ZSIB 2FOKA 4MHGA 2DFHA 1FP1D 3OYLA 4M6YA 3W2AA 1RZ4A 5IT9Z 1KU9A 1E2XA 2GM4A 2CQ7A 4EEFG 3JCUC 5C4JJ 4IQ4A 6PAXA 1ZG5A 3I64A 2FQ4A 2DMPA 1BW6A 2E7WA 3TO7A 2K9NA 3AKZA 1FX7A 1WHUA 5L3BA 2H09A 1O3TA 3QP5A 2NNNA 2PQ8A 1A04A 2GQQA 3LSMA 4BQQA 2MC3A 4IJAA 3SEQA 2OV7A 1E3PA 3FXUA 4U0WA 3UR3C 2W7NA 3DEUA 3IH2A 4HSRA 1IDZA 4BH9A 5KAIC 3LAJA 1MNMC 1S7EA 1IRZA 2FA5A 3WTUC 2HXIA 4RB3C 2E1CA 1B72A 3KPHA 3LSTA 4A3LJ 4EM2A 2OF7A 3M8JA 1VQ9I 2HKXA 3GX4X 3CDIA 4G7ZF 3RCOA 4AYBN 4YRVA 2GIVA 3G6EI 1TQIA 1SC7A 4M9SA 4KICA 2HEOA 3RKXA 1XGOA 1FTZA 1OYIA 1P9QC 1CGPA 4BXXJ 4KNYA 4E7IA 2X6XA 2M34A 3TDUC 3WTWC 1FPQA 2V1XA 1IRFA 2BVLA 1EH8A 2VN2A 4XM3A 3CD6I 5LGUA 2Y9ZA 2JWTA 4AWXB 5HLIA 4Q4ZF 2MC4A 3LOCA 4HA8A 2R7WA 4F7ZA 4KDPA 2M8EA 2XGXA 3W6JB 4OMYA 5F6FA 1XGMA 3MVPA 1ETOA 3QYBA 3HHGA 1YQAA 3HOXJ 2FEZA 2DOFA 3SXYA 4F93B 3SJMA 1T0FC 1QA6A 1A6IA 1NG6A 3DU5A 2OZUA 4A3DJ 2NVUB 4BBSJ 1MJBA 1CF7B 2P7CB 1WJAA 3BG6A 3FXOA 4IHXA 4A93J 1YITI 1JUPA 4XR6A 5AIQA 3CUQC 4EATA 4B43A 3RYPA 5HLTA 1BR4A 5FO5A 3GF2A 1MBEA 4KITB 1TW3A 2E36A 1AHDP 5A2QZ 5ED4A 5BMZA 2RREA 1BC8C 2K9MA 3DKYA 1HW1A 1MDMA 2F5EA 2V1NA 1UAAA 5LLQA 2DYSH 1ETYA 2Y0MA 5DCFA 1X58A 1U78A 2LVSA 4F92B 4FQGA 4RAGA 2W24A 2Y30A 3H9GA 1IW7F 1A35A 5HODA 3E6CC 2H1KA 2BY2A 2HQRA 3IP4B 5EG0B 3S2HJ 3C1DA 1YOVB 4HRIA 1BOAA 2X9DA 5FJ8J 3HRUA 5IOYA 1S5LC 2M3AA 1AKHA 3S1QJ 2X4HA 5L3FA 2IW5A 5EEAA 1DDNA 1R9TJ 4BNCA 2W84A 3BTJA 5IY5H 4IOAF 1JI8A 4EGYA 3K70D 4ZYGA 1QGPA 3HIFA 5FKLA 4NBQA 2XF5A 1NHAA 5E3MA 1U9OA 1QRYA 1Y0NA 1E0EA 1UG0A 1O57A 1RETA 2V4JC 1YRNB 1MW7A 1Z1DA 3OSGA 4KN4X 1U3EM 5IT9K 3W3CA 5F27A 3OYGA 2H8WA 4XQFA 1I1GA 2WAQA 3QAHA 5J8FA 2RQQA 5EYRA 2CQNA 3DWLE 4HEA2 4UB8C 5FGMA 4QPQA 2ADUA 2B7EA 1IC8A 3AFHA 4A69C 1RR8C 4RM3A 2MD0A 3BR2A 3ECHA 3HKZA 3K0LA 2QA4I 2BY1A 3UKGA 2FE3A 3K4JA 2EV5A 3MFKA 1EJ9A 4XOPA 2ZSHB 2FSWA 2HOSA 1BA5A 2EINH 2QQ9A 3H35A 4HAMA 3SEZA 4U7DA 3HEFA 2HZDA 3RYRA 3BTLA 3C3WA 1IG7A 2OAZA 2MGQA 2L02A 4AVPA 3QWLA 4YFNF 2VJ5A 4C9YA 5E17F 4LIUA 2LBFB 1PP7U 3RI4A 2IT0A 3HRTA 3CUQB 4BL0B 1Y56A 4ZZLA 3IWZA 4AIDA 1YX5A 4XL9A 2E1OA 3MAJA 3KX2A 2FF4A 2A68F 1JT6A 1FZPB 1TTYA 4D5CA 5DUIA 3E7LA 2HDDA 1PYVA 3ZQHA 4KFCA 4UV8A 1WJCA 1ETQA 2PLYA 4A2UA 5HVQC 3HRSA 2DFEA 1O3RA 4UY8I 1X1DA 1K78B 1U0JA 5E3NA 2DQLA 1D0ZA 5LHGA 1QVTA 5D4SA 1U6GA 3VYUB 2LK2A 2XUBA 3E5QA 2CQQA 3P9CA 1KU7A 4CZCA 2CSOA 2A07F 4ESBA 4XKVA 1XN7A 1J2XA 4JP0A 4DQ2A 1YS7A 3LA2A 4A3MJ 2AO9A 4A0XA 4ZDPA 3FHZA 3PNTA 3KIOA 5F0HA 2AHQA 1S9HA 2ZKZA 3DBRB 5FRNA 3V8LA 5L3CA 2BHYA 2M5WA 2P4WA 3LQRA 2ZMEC 2CUJA 2Q2EA 1QZYA 3CLQA 2QSGX 5GPCA 1A36A 3VFZA 1HA8A 2IS4A 2VQGA 3ZGKA 2VI6A 5F1JA 2I10A 4XK4A 2BZTA 4A5NA 4U88A 1MBGA 1YJNI 1DU0A 1S7OA 3S93A 5AONA 3TP3A 5M5WJ 2MA3A 2OPTA 1Y39A 1Y1WJ 4P55A 5HLHA 2VIXA 4X0GA 2NS0A 1OISA 5JLXA 2HYJA 2PMZN 3F8FA 1MKMA 1YW9A 1VZ0A 1W7PA 1FNNA 1B4AA 1IXSB 1KQ0A 5KCMA 3OSFA 3OYJA 1XD7A 2LMDA 4EM0B 2COBA 2EFOA 1BL0A 5AIPA 3T1BA 4OIPF 4I76A 3MKZA 4PFOA 1EH6A 4ZTFA 3SFZA 3WGIA 5GADJ 2VBWA 4YIIA 5B66C 3MEXA 5KVRA 4D7NA 2DAOA 3ABLH 4IHWA 3JRFA 2E1NA 1VQOI 1XDUA 2KIQA 3DKWA 3AG1H 2G9WA 5D5UB 4E7LA 2WTEA 2EWNA 2KP6A 3TEDA 2M8GX 2WAFA 2A69F 3T8RA 3QRFF 3HB9A 2Z9OA 1NH3A 3TQNA 3B6AA 1P7IA 3VWBA 2Q8KA 2KRHA 5K5RA 2EZIA 5K5OA 1J9IA 4MTDA 2IA0A 2XF7A 2R7FA 3LSGA 1OFCX 3BPVA 4IX7A 1V4RA 2QGUA 3BZ6A 4A3IJ 3WTZA 5IYCJ 5E3LA 2DU9A 1NK2P 1MNEA 4LFUA 4XONA 1QNTA 1X1PA 2NVQJ 1J59A 1FBUA 2CFXA 2IGNA 3BCBA 4MQVA 1X3ZB 3HOYJ 2WY7Q 4G8XA 2XSDC 2F5DA 2WBMA 4A6EA 1TNSA 2RQPA 3Q5FA 3Q9SA 2K27A 2M4KA 4EQQA 2D1VA 1FY7A 2NOGA 2IA1A 3WE2A 3ZR8X 3KP3A 5JVGF 1YIJI 5HS8A 2DTZA 1D3YA 2DFIA 3K4MA 4XIDA 1I27A 1OCOH 2LR8A 3HRMA 1OCRH 2KJBA 5IP7J 2HTJA 4C3HJ 1XTAA 3GWZA 5LBQA 1W1WE 1F1ZA 2Y48A 2ZMEB 2OZ6A 4YFXF 2XVCA 1K83J 4EMSA 1JUMA 3ECOA 3M7GA 1TQMA 1KONA 4PSWA 2CW8A 3ELKA 3JREA 2DA2A 3H9JA 1LDKB 3LA3A 1R4MB 2L3DA 1REPC 1OYYA 3VODA 2ZXHA 4KISA 4J01A 3BWGA 4N4OB 3BJOA 3U2RA 2QM3A 4A0ZA 1Z9CA 3A01B 3RPQA 5L3DA 2ELJA 1ETXA 2QVOA 2CFOA 4I0BA 3ZXSA 1T38A 2ZB9A 1X1CA 2HU9A 1BJAA 2P7VB 3I0TA 3NRVA 3PNYA 1BC7C 1A5JA 1BM9A 5KK1A 1K6YA 1D8KA 2XAFA 2KFDA 3IH3A 2ZJPF 3LL7A 3C2GA 3JRCA 3H36A 5IYDJ 4BBRJ
chains in the Genus database with same CATH topology
1U5TA 4OOIA 4UHTA 4ZZDA 4HDUA 1B9NA 3ROUA 4O5VA 5JHUA 4CZZA 2LDUA 2Z99A 5FB2A 1YW8A 4L18B 4RB1A 1GXQA 4LMYA 1LQ1A 4GO1A 3CO6C 5ICGA 2J5OA 2QYOA 4BQAA 4MGRA 1QO0D 2JT1A 4HLXA 1W4MA 1ZH5A 3I4PA 3W6KB 3QPTA 4OMZA 4RB2C 2RC4A 5FFXA 1OPCA 1LEAA 1FWZA 5D5VB 1F9NA 1RIOH 2UWMA 3HUGA 3BP8A 1O7LA 2ZXJA 2QQBA 4G6DA 3JTHA 1XSVA 4RAYA 1PDNC 2GWRA 1L3LA 2HWVA 2MLGA 3KZZA 1P4AA 2PFBA 2STWA 3DF8A 1Z05A 4NHJA 1F4KA 3ZN0A 4LK1F 1K6OA 4LGWA 3H92A 2ZCWA 2JPCA 1JHFA 1JHHA 5JVTA 5K5QA 3QOPA 1YFHA 3R6SA 4K2EA 1ZYRF 5TJJA 1YG2A 1J0RA 1FT9A 5HOOA 1L0OC 1Z6RA 3JTGA 5LEJA 2HYFA 4CXFA 4G6QA 4Q5SF 4XRFA 2K7LA 3BOQA 4UVAA 1WRJA 4KIFA 5L3EA 3F23A 4RB0A 1DP7P 3NEUA 3VB2A 2KIUA 3V7SA 4KIGA 2EJRA 4AIHA 3LQQA 2L4AA 3G3ZA 2IP2A 1LVAA 3DFGA 1YS6A 2L01A 4EJUA 3RDIA 2CW0F 3U9GA 4EJTA 3IKVA 4JK1X 4N9IA 3MQ0A 4EJOA 3J7AO 3TGNA 2PBIA 1ULYA 2MLKA 2ZNZA 2XHKA 2Z5UA 3I59B 3C18A 5FD6A 1HW2A 4HF1A 2ISYA 4IVNA 1TNTA 2EA4A 3F21A 1D8JA 3P7NA 3GVAA 4ZYHA 2RN7A 1WSUA 4I02A 2M30A 3EYYA 2O0YA 1Y0UA 1UHMA 3I71A 1B6AA 5E18F 3F72A 2CG4A 2TDXA 4UVBA 4MQ9F 5JI6A 1IXRC 3ULQB 5K1YA 2HFHA 1C0WA 2VXZA 3FMSA 3KEQA 1QZZA 1KQ9A 3V7CA 3SHFA 4E70A 2BEOA 4R79A 3R60A 2K86A 5CVUA 1KYWA 1T0FA 2EV6A 1BIBA 4WXHA 5HS9A 2IRFG 4G94A 1WKMA 4N0BA 5H20A 3CUQA 4O3MA 2JPBA 5L3GA 1R58A 4XSXF 4GYIA 3JSPA 1IZ1A 3O3KA 4YG2F 5EEHA 1YIOA 5TRDA 4IXAA 2ZFWA 4LD5A 3I54A 3IC7A 1JE8A 5FLXK 1HSTA 2VBXA 1K78A 2VONA 3WGHA 1FOKA 1S29A 3FM3A 3LA7A 1G3SA 4OIRF 3B02A 1KYZA 3D0SA 4UXNA 3BJ6A 4HYEA 1JXSA 3GXOA 2BV6A 3QU6A 1I6XA 3BROA 3WU0A 3QP6A 1LEBA 4ON0A 1K79A 3GFJA 3KLNA 2P8TA 2XROA 1SMTA 1ZGAA 1UHWA 4KMUX 5LHHA 3K2ZA 3KP4A 3F8BA 4I98B 3L7WA 1GVJA 2FQ3A 5J8CA 3AAFA 1GXPA 4RAZA 4XBFA 4OIOF 2X0LA 3F8MA 3F3XA 2D45A 1HKTA 4D0PA 3K1NA 4UVCA 2F5FA 2VOPA 4KA4A 1OMIA 5ICFA 3HYIA 4G7OF 3ABTA 4M9ZA 2V79A 4HQEA 3QU3A 1OKRA 4EGZA 1RI7A 4UV9A 4P9FA 1VTNC 3QPHA 5ERIA 4PGHA 3K9TA 4BXUA 2FRHA 2LNBA 1ZAOA 3IKTA 2J5PA 2YX4A 2ELHA 3MWMA 2Y75A 1R1VA 1S6LA 2P5LC 1YTYA 3ZMUA 2DTRA 3OOPA 1XGSA 1FSEA 3BDDA 4N9HA 3E5XA 2ZMEA 2A5YB 4LB5A 3CTAA 2R3SA 2A61A 4R8HA 2OQRA 3N4MA 3L09A 5BPDA 4OU0A 1SD7A 3CO7C 3N97A 1V3FA 3IHUA 4Y17A 2VBYA 2D1HA 2BBYA 1TW2A 5DCMA 4L9JA 5HLGA 5CVJA 4KN7X 1ZRDA 5BPIA 3REOA 2GXGA 1FLIA 2HTSA 2HGCA 2VODA 3DPLC 2CO5A 1Z6TA 1HKQA 1FBSA 4HV6A 3VOEA 1ZRCA 1HBXG 5H6RA 1P92A 3MCZA 1JGSA 4QLCU 2F2EA 3I53A 4M6XA 2GA1A 3KETA 3Q9VA 1HSJA 3FMRA 2G7UA 3ERED 3FZVA 2YPRA 3ZMTA 5LHIA 5D6FA 3HOTA 4MNUA 2ZO4A 2BGCA 1HW5A 3WE3A 1X3UA 2VE9A 3BJAA 1SFUA 1YW7A 2STTA 3ZPLA 2ISZA 3ZMZA 2R7DA 5LGTA 3T0YA 3F6VA 4PZJA 2FBIA 4EJWA 4KMFA 3RTRA 4ENMA 4CHUA 5J6XA 2H94A 4M74A 2NNYA 1WQ2A 2PJPA 3E6DA 3HTUA 3I5UA 1W5SA 2FMLA 2A3SA 2V1DA 2XAQA 1ZN2A 2VE8A 1W7PD 2OBPA 4ZYEA 3E6MA 3LFKA 1AWCA 1MJ9A 5EEGA 1IN4A 1MJAA 1WI9A 2PMUA 5HS7A 1T39A 4WF2A 3ML6A 1S3JA 4KYWA 2A6EF 3CUOA 5D4RA 2F5CA 3OV8A 5F1RA 2C6YA 2ZBKA 5DCMB 4L5IA 1PUEE 2QUFA 2ZJ2A 1XSXA 3SZPA 3WTTC 2CWEA 3FMQA 4BYYA 1FYMA 2ETHA 3COAC 1R7JA 1OR7A 2QLZA 4S05A 1RUNA 3MZYA 4LJZF 1BI3A 3P9KA 3RPUA 5HDGA 3GUDA 1IUYA 5ILUA 2MD5A 1SAXA 2FNPA 1ZGJA 2VC1A 3I59A 5E8IA 2K4JA 5ILSA 2IJLA 4ESJA 2KJCA 2PN6A 2P6SA 3FXRA 3DV8A 3EYIA 4G9YA 2FXAA 1S7AA 3IRRA 4EJVA 1IN6A 1RUOA 2DW4A 2HR3A 4G7HF 1K7AA 3RJPA 1MGTA 2IPQX 1R00A 1I1SA 2WC2A 3GO5A 2HOEA 2LSOA 5CVIA 2GA2A 4MEXF 3R61A 3M1EA 2EFQA 5DD4A 4HLYA 1OYWA 1I5ZA 3RIRA 5DDGA 2Z33A 2RKHA 3KE2A 3FM5A 2M87A 1ZRFA 4IRHA 4PCQA 2GAUA 4MTEA 2IA2A 3T8TA 2ESNA 3WTXC 2NYXA 2O61A 1ZARA 2PMHA 2MH2A 2XKOA 3TO6A 3GZ6A 1BI0A 3F8CA 2P5VA 3CDHA 2DO7A 3H3UA 5FLXZ 3M9AA 4WWCA 3WU1B 4CGZA 3GZ5A 1IF1A 5DD8A 4B8XA 4Y15A 3ZMSA 4NB5A 2LF8A 5BOXA 2YU3A 3TOBA 4PDKA 3TDZC 4KIBA 4IPAA 3H3ZA 1R22A 1Z7UA 3DPTA 3JAMK 3IRQA 1ODDA 2QQAA 3KFWX 3DQVC 2DK5A 4Q47A 1R5HA 2IVMA 4UUVA 3R0JA 2LF7A 3TKYA 1H9GA 1HKSA 1UCRA 3BPXA 4KUMA 4LLLA 2O6GE 4ZYDA 2JRTA 1D5VA 4P9UA 4RS8A 2DT5A 2HKOA 4FX4A 3JSOA 2EA2A 2FU4A 4A6DA 3CLOA 3HOSA 4BHBA 2WV0A 4KT5C 4H0EA 3BY6A 5H6QA 4Z2YA 3ISPA 1HQCA 4WCGA 4Y13A 1G4DA 1YYVA 2PEXA 3FXQA 1R5GA 3WODF 1IN5A 2DLLA 5HDKA 3HHHA 2DI3A 2XAGA 4LG0B 1ZG1A 2H6BA 4OIQF 1MD0A 5BQTA 1HXDA 4I7HA 1QPMA 1ZLKA 2COMA 4L9NA 2YSRA 1UFMA 2V1UA 4A0YA 1FC3A 2O8XA 3J81K 1BI2A 4XLPF 4WK8F 3F22A 2JTVA 3KZYA 3D5LA 1TLHB 1IXCA 1KQ8A 1XSDA 3SQNA 2BE5F 4GCVA 2FMYA 4XLNF 4EM1A 1H0MA 3IL2A 3GW2A 3K1MA 2QENA 3J80Z 4YFKF 2M1BA 1XCVA 3LAPA 2QWWA 5D6EA 4P96A 4I0AA 2Z3YA 1UB9A 5BS6A 1ZLJA 2OA4A 5D8KB 4HX7A 3GYHX 5E8GA 4AIKA 4LK0F 4ENKA 2XIGA 4IHTA 3ZP5A 3P9IA 2VC0A 4RGXA 3RKWA 4IF4A 1FBQA 1R23A 1YLFA 2QBYB 2OQGA 1FYLA 2B0LA 4NQWA 1QQIA 4P5OA 3ZMDA 4IRGA 3MZHA 4HBLA 4RGRA 3G73A 1DPUA 3KP5A 1IN8A 5D5XB 3TO9A 4L9VA 2V6CA 3PFIA 1XMKA 4M9XA 2KRFA 1E17A 5DUKA 5D5WB 4FX0A 2PG4A 1XGNA 4BHPA 4FHTA 1B59A 4HX4A 2BYVE 5ILVA 4BAYA 1DPRA 1P2FA 1IN7A 3L00A 2AS5F 3R0AA 4XSZF 2HQNA 1SD6A 4BHCA 2JSCA 3PQJA 3RKYA 4U0YA 2CGPA 2DQRA 4GGGA 4HV5A 1STZA 4M72A 5DV5A 3WGGA 4MEYF 2XRNA 1F5TA 4IRIA 2XAJA 1R1TA 4OINF 3GFMA 4ESFA 1XCBA 1KGSA 4Q48A 4HDVA 1ZG3A 1G3TA 3GLXA 3DP7A 2P5KA 2H27A 1TBXA 3VEPA 4CICA 3E3VA 4S04A 3ABUA 2RV8A 1BI1A 3WTSC 2HYGD 3HTSB 4ENJA 3J80K 2L54A 4CDGA 3S2WA 2VOOA 2UZKA 3SZTA 4YIFA 4AIJA 3F6OA 5LRRA 3EUHA 1DUXC 1YO5C 3O2PE 4B09A 3HSEA 1SMYF 2FBHA 2ACJA 4RGUA 2XKPA 4FT8A 3T5XA 5CVVA 1T2KA 4LLNA 2VBZA 2MH9A 1WWXA 2L4MA 4M71A 1SFEA 3NQOA 3K69A 4HZFA 1MDMB 5A2QK 2LKPA 3E5UA 3EETA 2E7XA 2EK5A 4GXOA 1ON2A 5LGNA 4LLGF 5CJ9A 2G7HA 2K02A 1U8RA 2XAHA 4RGSA 2XV4S 4M73A 1R1UA 2EV0A 3HSRA 1LDDA 3V7RA 2HS5A 4ASNA 2K4BA 1KA8A 2EFPA 5CLSA 1FSHA 1LDJA 2Q0OA 4A5MA 4U7BA 1P4XA 3I58A 3M8EA 2UXXA 1XB4A 2O3FA 2OD5A 1LB2A 5HDNA 3LWFA 5E20A 1SD4A 3KEOA 4ENNA 4A12A 1J5YA 3IWFA 4L0YB 2FNAA 2GZWA 3FX3A 3K1PA 1Q1HA 1J75A 2DBBA 2A6HF 1USSA 2HZTA 3ZN1A 4JQFA 2HDCA 3CJNA 5DYMA 3KP7A 1BIAA 4TV7A 2CQKA 2O03A 2WWYA 5ICCA 1H9TA 5CYVA 2OU2A 2W25A 5E1ZB 2QZ8A 1XDSA 1R36A 3O6BB 2FBKA 5JFRA 5FFZA 3JAMZ 1G3WA 4DNCA 1Z91A 3E97A 3GFLA 3KLOA 4ZH4F 1QBJA 3EDPA 3DXJF 2JZYA 4HF0A 1IRGA 1ON1A 1P4WA 1W5TA 1O3SA 4I09A 4WXDA 2EB7A 3L9FA 4I2OA 1P6RA 3M8FA 1B1BA 3C7JA 1LJ9A 3L2CA 4IHSA 1IAWA 1EH7A 3KP6A 2VT2A 3B73A 2KIFA 3GFIA 2KIMA 5IT3A 2KKOA 1KU3A 4WX9A 1W7PB 1BBYA 2P6TA 1AOYA 1T6SA 5E1WA 2ZNYA 4CO8A 2VT3A 1BN5A 1FP2A 4L5JA 4AD9A 4UNOA 1U5TC 1G3YA 1S8NA 4LG0A 2W57A 2M45A 2GXBA 1T98A 1SFXA 3JW4A 2YX7A 2RVCA 4WXCA 3TOAA 2D2WA 3WTVC 2W85A 2DPUA 2ESHA 1LNWA 2AXLA 3KP2A 2EFWA 3KCCA 4JBAA 3V8JA 3FWEA 3J81Z 3EQLF 4EVIA 4LB6B 4HX8A 1O3QA 1TQPA 3R4KA 3V4GA 4PGGA 2MBFA 5LEKA 3GEZA 2RGVA 1EV7A 4L0ZB 3PQKA 4HF2A 2V9VA 2YR2A 1U2WA 5D8LB 4ETSA 2RDPA 1GHCA 3E6BA 4I01A 3V8KA 2DPDA 4HW0A 2CYYA 4HOBA 1FYKA 1MZBA 4EV0A 3ZQ7A 5F64A 3WG9A 4O6JA 5DEQA 5LRSA 3WTYC 1CF7A 1KU2A 1XMAA 4R1HA 1U5TB 3FF5A 2RNJA 3F8NA 4HQMA 2PI0A 5E1XA 1ZHFA 2QBYA 1ZREA 1O7FA 4CYDA 5ICEA 2NAZA 5CVRA 2XASA 2EFNA 5JR3A 2UXNA 4U0VA 1USTA 1ONVA 2DK8A 1RNLA 4QWQA 2H6CA 1J7KA 4L9TA 3ZMVA 1B9MA 1PP8F 3HSFA 1SD5A 5FD5A 1G6NA 4GYGA 2FOKA 4MHGA 1FP1D 4M6YA 1RZ4A 5IT9Z 1KU9A 1E2XA 6PAXA 1ZG5A 3I64A 2E7WA 3TO7A 1FX7A 5L3BA 2H09A 1O3TA 3QP5A 2NNNA 2PQ8A 1A04A 2GQQA 2MC3A 4IJAA 3FXUA 4U0WA 3DEUA 4BH9A 3LAJA 2FA5A 3WTUC 4RB3C 2E1CA 3LSTA 4EM2A 2HKXA 3GX4X 4G7ZF 2GIVA 1TQIA 4M9SA 4KICA 2HEOA 3RKXA 1XGOA 1OYIA 1CGPA 4KNYA 3TDUC 3WTWC 1FPQA 2V1XA 1IRFA 1EH8A 2VN2A 5LGUA 4AWXB 5HLIA 4Q4ZF 4HA8A 4F7ZA 4KDPA 2M8EA 2XGXA 3W6JB 4OMYA 5F6FA 1XGMA 3HHGA 1YQAA 2FEZA 3SXYA 2OZUA 1MJBA 1CF7B 2P7CB 5AIQA 3CUQC 3RYPA 5FO5A 3GF2A 1TW3A 5A2QZ 5ED4A 1BC8C 1MDMA 1HW1A 2F5EA 5LLQA 2Y0MA 5DCFA 1U78A 2W24A 1IW7F 3E6CC 2HQRA 3C1DA 1BOAA 3HRUA 2X4HA 5L3FA 2IW5A 1DDNA 4BNCA 2W84A 4EGYA 4ZYGA 1QGPA 3HIFA 1NHAA 1O57A 1Z1DA 4KN4X 1U3EM 5IT9K 1I1GA 3QAHA 5J8FA 5FGMA 2ADUA 3ECHA 3K0LA 2FE3A 3MFKA 2EV5A 2FSWA 2QQ9A 4HAMA 4U7DA 3RYRA 3C3WA 2OAZA 4YFNF 2L02A 4AVPA 5E17F 1PP7U 3RI4A 2IT0A 3HRTA 3CUQB 4ZZLA 3IWZA 3MAJA 2FF4A 2A68F 1FZPB 1TTYA 5DUIA 4KFCA 4UV8A 2PLYA 4A2UA 5HVQC 3HRSA 1O3RA 1K78B 2DQLA 5LHGA 5D4SA 1U6GA 2XUBA 3E5QA 3P9CA 1KU7A 2CSOA 2A07F 4ESBA 1XN7A 1J2XA 4DQ2A 1YS7A 3LA2A 4A0XA 3FHZA 2ZKZA 3V8LA 5L3CA 2M5WA 2P4WA 3LQRA 2Q2EA 1QZYA 3VFZA 4A5NA 4U88A 1S7OA 5AONA 2MA3A 4P55A 5HLHA 2NS0A 3F8FA 1YW9A 1MKMA 1W7PA 1FNNA 1B4AA 1IXSB 1KQ0A 1XD7A 4EM0B 2EFOA 5AIPA 3T1BA 4OIPF 1EH6A 3SFZA 3WGIA 2VBWA 4YIIA 3MEXA 5KVRA 2DAOA 2E1NA 1XDUA 3DKWA 2G9WA 5D5UB 2EWNA 2WTEA 3QRFF 3T8RA 2A69F 2Z9OA 3TQNA 1J9IA 2Q8KA 5K5RA 5K5OA 4MTDA 2IA0A 2R7FA 3BPVA 1V4RA 3BZ6A 3WTZA 2DU9A 4LFUA 1QNTA 1J59A 1FBUA 2CFXA 4MQVA 4G8XA 2F5DA 4A6EA 1TNSA 2RQPA 3Q5FA 3Q9SA 2K27A 4EQQA 2D1VA 1FY7A 2IA1A 3WE2A 3KP3A 5HS8A 1D3YA 2DFIA 1I27A 3HRMA 2KJBA 2HTJA 3GWZA 5LBQA 1F1ZA 2Y48A 2ZMEB 2OZ6A 4YFXF 2XVCA 4EMSA 3ECOA 3M7GA 1TQMA 3ELKA 3LA3A 1LDKB 2L3DA 1REPC 1OYYA 3VODA 3BWGA 3BJOA 3U2RA 2QM3A 4A0ZA 1Z9CA 3RPQA 5L3DA 2QVOA 4I0BA 1T38A 3I0TA 1BJAA 2P7VB 3NRVA 1BC7C 1BM9A 5KK1A 1D8KA 2XAFA 5BMZA 3U1DA 2NRAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5T A;  4OOI A;  4UHT A;  4ZZD A;  4HDU A;  1B9N A;  3ROU A;  4O5V A;  5JHU A;  4CZZ A;  2LDU A;  2Z99 A;  5FB2 A;  1YW8 A;  4L18 B;  4RB1 A;  1GXQ A;  4LMY A;  1LQ1 A;  4GO1 A;  3CO6 C;  5ICG A;  2J5O A;  2QYO A;  4BQA A;  4MGR A;  1QO0 D;  2JT1 A;  4HLX A;  1W4M A;  1ZH5 A;  3I4P A;  3W6K B;  3QPT A;  4OMZ A;  4RB2 C;  2RC4 A;  5FFX A;  1OPC A;  1LEA A;  1FWZ A;  5D5V B;  1F9N A;  1RIO H;  2UWM A;  3HUG A;  3BP8 A;  1O7L A;  2ZXJ A;  2QQB A;  4G6D A;  3JTH A;  1XSV A;  4RAY A;  1PDN C;  2GWR A;  1L3L A;  2HWV A;  2MLG A;  3KZZ A;  1P4A A;  2PFB A;  2STW A;  3DF8 A;  1Z05 A;  4NHJ A;  1F4K A;  3ZN0 A;  4LK1 F;  1K6O A;  4LGW A;  3H92 A;  2ZCW A;  2JPC A;  1JHF A;  1JHH A;  5JVT A;  5K5Q A;  3QOP A;  1YFH A;  3R6S A;  4K2E A;  1ZYR F;  5TJJ A;  1YG2 A;  1J0R A;  1FT9 A;  5HOO A;  1L0O C;  1Z6R A;  3JTG A;  5LEJ A;  2HYF A;  4CXF A;  4G6Q A;  4Q5S F;  4XRF A;  2K7L A;  3BOQ A;  4UVA A;  1WRJ A;  4KIF A;  5L3E A;  3F23 A;  4RB0 A;  1DP7 P;  3NEU A;  3VB2 A;  2KIU A;  3V7S A;  4KIG A;  2EJR A;  4AIH A;  3LQQ A;  2L4A A;  3G3Z A;  2IP2 A;  1LVA A;  3DFG A;  1YS6 A;  2L01 A;  4EJU A;  3RDI A;  2CW0 F;  3U9G A;  4EJT A;  3IKV A;  4JK1 X;  4N9I A;  3MQ0 A;  4EJO A;  3J7A O;  3TGN A;  2PBI A;  1ULY A;  2MLK A;  2ZNZ A;  2XHK A;  2Z5U A;  3I59 B;  3C18 A;  5FD6 A;  1HW2 A;  4HF1 A;  2ISY A;  4IVN A;  1TNT A;  2EA4 A;  3F21 A;  1D8J A;  3P7N A;  3GVA A;  4ZYH A;  2RN7 A;  1WSU A;  4I02 A;  2M30 A;  3EYY A;  2O0Y A;  1Y0U A;  1UHM A;  3I71 A;  1B6A A;  5E18 F;  3F72 A;  2CG4 A;  2TDX A;  4UVB A;  4MQ9 F;  5JI6 A;  1IXR C;  3ULQ B;  5K1Y A;  2HFH A;  1C0W A;  2VXZ A;  3FMS A;  3KEQ A;  1QZZ A;  1KQ9 A;  3V7C A;  3SHF A;  4E70 A;  2BEO A;  4R79 A;  3R60 A;  2K86 A;  5CVU A;  1KYW A;  1T0F A;  2EV6 A;  1BIB A;  4WXH A;  5HS9 A;  2IRF G;  4G94 A;  1WKM A;  4N0B A;  5H20 A;  3CUQ A;  4O3M A;  2JPB A;  5L3G A;  1R58 A;  4XSX F;  4GYI A;  3JSP A;  1IZ1 A;  3O3K A;  4YG2 F;  5EEH A;  1YIO A;  5TRD A;  4IXA A;  2ZFW A;  4LD5 A;  3I54 A;  3IC7 A;  1JE8 A;  5FLX K;  1HST A;  2VBX A;  1K78 A;  2VON A;  3WGH A;  1FOK A;  1S29 A;  3FM3 A;  3LA7 A;  1G3S A;  4OIR F;  3B02 A;  1KYZ A;  3D0S A;  4UXN A;  3BJ6 A;  4HYE A;  1JXS A;  3GXO A;  2BV6 A;  3QU6 A;  1I6X A;  3BRO A;  3WU0 A;  3QP6 A;  1LEB A;  4ON0 A;  1K79 A;  3GFJ A;  3KLN A;  2P8T A;  2XRO A;  1SMT A;  1ZGA A;  1UHW A;  4KMU X;  5LHH A;  3K2Z A;  3KP4 A;  3F8B A;  4I98 B;  3L7W A;  1GVJ A;  2FQ3 A;  5J8C A;  3AAF A;  1GXP A;  4RAZ A;  4XBF A;  4OIO F;  2X0L A;  3F8M A;  3F3X A;  2D45 A;  1HKT A;  4D0P A;  3K1N A;  4UVC A;  2F5F A;  2VOP A;  4KA4 A;  1OMI A;  5ICF A;  3HYI A;  4G7O F;  3ABT A;  4M9Z A;  2V79 A;  4HQE A;  3QU3 A;  1OKR A;  4EGZ A;  1RI7 A;  4UV9 A;  4P9F A;  1VTN C;  3QPH A;  5ERI A;  4PGH A;  3K9T A;  4BXU A;  2FRH A;  2LNB A;  1ZAO A;  3IKT A;  2J5P A;  2YX4 A;  2ELH A;  3MWM A;  2Y75 A;  1R1V A;  1S6L A;  2P5L C;  1YTY A;  3ZMU A;  2DTR A;  3OOP A;  1XGS A;  1FSE A;  3BDD A;  4N9H A;  3E5X A;  2ZME A;  2A5Y B;  4LB5 A;  3CTA A;  2R3S A;  2A61 A;  4R8H A;  2OQR A;  3N4M A;  3L09 A;  5BPD A;  4OU0 A;  1SD7 A;  3CO7 C;  3N97 A;  1V3F A;  3IHU A;  4Y17 A;  2VBY A;  2D1H A;  2BBY A;  1TW2 A;  5DCM A;  4L9J A;  5HLG A;  5CVJ A;  4KN7 X;  1ZRD A;  5BPI A;  3REO A;  2GXG A;  1FLI A;  2HTS A;  2HGC A;  2VOD A;  3DPL C;  2CO5 A;  1Z6T A;  1HKQ A;  1FBS A;  4HV6 A;  3VOE A;  1ZRC A;  1HBX G;  5H6R A;  1P92 A;  3MCZ A;  1JGS A;  4QLC U;  2F2E A;  3I53 A;  4M6X A;  2GA1 A;  3KET A;  3Q9V A;  1HSJ A;  3FMR A;  2G7U A;  3ERE D;  3FZV A;  2YPR A;  3ZMT A;  5LHI A;  5D6F A;  3HOT A;  4MNU A;  2ZO4 A;  2BGC A;  1HW5 A;  3WE3 A;  1X3U A;  2VE9 A;  3BJA A;  1SFU A;  1YW7 A;  2STT A;  3ZPL A;  2ISZ A;  3ZMZ A;  2R7D A;  5LGT A;  3T0Y A;  3F6V A;  4PZJ A;  2FBI A;  4EJW A;  4KMF A;  3RTR A;  4ENM A;  4CHU A;  5J6X A;  2H94 A;  4M74 A;  2NNY A;  1WQ2 A;  2PJP A;  3E6D A;  3HTU A;  3I5U A;  1W5S A;  2FML A;  2A3S A;  2V1D A;  2XAQ A;  1ZN2 A;  2VE8 A;  1W7P D;  2OBP A;  4ZYE A;  3E6M A;  3LFK A;  1AWC A;  1MJ9 A;  5EEG A;  1IN4 A;  1MJA A;  1WI9 A;  2PMU A;  5HS7 A;  1T39 A;  4WF2 A;  3ML6 A;  1S3J A;  4KYW A;  2A6E F;  3CUO A;  5D4R A;  2F5C A;  3OV8 A;  5F1R A;  2C6Y A;  2ZBK A;  5DCM B;  4L5I A;  1PUE E;  2QUF A;  2ZJ2 A;  1XSX A;  3SZP A;  3WTT C;  2CWE A;  3FMQ A;  4BYY A;  1FYM A;  2ETH A;  3COA C;  1R7J A;  1OR7 A;  2QLZ A;  4S05 A;  1RUN A;  3MZY A;  4LJZ F;  1BI3 A;  3P9K A;  3RPU A;  5HDG A;  3GUD A;  1IUY A;  5ILU A;  2MD5 A;  1SAX A;  2FNP A;  1ZGJ A;  2VC1 A;  3I59 A;  5E8I A;  2K4J A;  5ILS A;  2IJL A;  4ESJ A;  2KJC A;  2PN6 A;  2P6S A;  3FXR A;  3DV8 A;  3EYI A;  4G9Y A;  2FXA A;  1S7A A;  3IRR A;  4EJV A;  1IN6 A;  1RUO A;  2DW4 A;  2HR3 A;  4G7H F;  1K7A A;  3RJP A;  1MGT A;  2IPQ X;  1R00 A;  1I1S A;  2WC2 A;  3GO5 A;  2HOE A;  2LSO A;  5CVI A;  2GA2 A;  4MEX F;  3R61 A;  3M1E A;  2EFQ A;  5DD4 A;  4HLY A;  1OYW A;  1I5Z A;  3RIR A;  5DDG A;  2Z33 A;  2RKH A;  3KE2 A;  3FM5 A;  2M87 A;  1ZRF A;  4IRH A;  4PCQ A;  2GAU A;  4MTE A;  2IA2 A;  3T8T A;  2ESN A;  3WTX C;  2NYX A;  2O61 A;  1ZAR A;  2PMH A;  2MH2 A;  2XKO A;  3TO6 A;  3GZ6 A;  1BI0 A;  3F8C A;  2P5V A;  3CDH A;  2DO7 A;  3H3U A;  5FLX Z;  3M9A A;  4WWC A;  3WU1 B;  4CGZ A;  3GZ5 A;  1IF1 A;  5DD8 A;  4B8X A;  4Y15 A;  3ZMS A;  4NB5 A;  2LF8 A;  5BOX A;  2YU3 A;  3TOB A;  4PDK A;  3TDZ C;  4KIB A;  4IPA A;  3H3Z A;  1R22 A;  1Z7U A;  3DPT A;  3JAM K;  3IRQ A;  1ODD A;  2QQA A;  3KFW X;  3DQV C;  2DK5 A;  4Q47 A;  1R5H A;  2IVM A;  4UUV A;  3R0J A;  2LF7 A;  3TKY A;  1H9G A;  1HKS A;  1UCR A;  3BPX A;  4KUM A;  4LLL A;  2O6G E;  4ZYD A;  2JRT A;  1D5V A;  4P9U A;  4RS8 A;  2DT5 A;  2HKO A;  4FX4 A;  3JSO A;  2EA2 A;  2FU4 A;  4A6D A;  3CLO A;  3HOS A;  4BHB A;  2WV0 A;  4KT5 C;  4H0E A;  3BY6 A;  5H6Q A;  4Z2Y A;  3ISP A;  1HQC A;  4WCG A;  4Y13 A;  1G4D A;  1YYV A;  2PEX A;  3FXQ A;  1R5G A;  3WOD F;  1IN5 A;  2DLL A;  5HDK A;  3HHH A;  2DI3 A;  2XAG A;  4LG0 B;  1ZG1 A;  2H6B A;  4OIQ F;  1MD0 A;  5BQT A;  1HXD A;  4I7H A;  1QPM A;  1ZLK A;  2COM A;  4L9N A;  2YSR A;  1UFM A;  2V1U A;  4A0Y A;  1FC3 A;  2O8X A;  3J81 K;  1BI2 A;  4XLP F;  4WK8 F;  3F22 A;  2JTV A;  3KZY A;  3D5L A;  1TLH B;  1IXC A;  1KQ8 A;  1XSD A;  3SQN A;  2BE5 F;  4GCV A;  2FMY A;  4XLN F;  4EM1 A;  1H0M A;  3IL2 A;  3GW2 A;  3K1M A;  2QEN A;  3J80 Z;  4YFK F;  2M1B A;  1XCV A;  3LAP A;  2QWW A;  5D6E A;  4P96 A;  4I0A A;  2Z3Y A;  1UB9 A;  5BS6 A;  1ZLJ A;  2OA4 A;  5D8K B;  4HX7 A;  3GYH X;  5E8G A;  4AIK A;  4LK0 F;  4ENK A;  2XIG A;  4IHT A;  3ZP5 A;  3P9I A;  2VC0 A;  4RGX A;  3RKW A;  4IF4 A;  1FBQ A;  1R23 A;  1YLF A;  2QBY B;  2OQG A;  1FYL A;  2B0L A;  4NQW A;  1QQI A;  4P5O A;  3ZMD A;  4IRG A;  3MZH A;  4HBL A;  4RGR A;  3G73 A;  1DPU A;  3KP5 A;  1IN8 A;  5D5X B;  3TO9 A;  4L9V A;  2V6C A;  3PFI A;  1XMK A;  4M9X A;  2KRF A;  1E17 A;  5DUK A;  5D5W B;  4FX0 A;  2PG4 A;  1XGN A;  4BHP A;  4FHT A;  1B59 A;  4HX4 A;  2BYV E;  5ILV A;  4BAY A;  1DPR A;  1P2F A;  1IN7 A;  3L00 A;  2AS5 F;  3R0A A;  4XSZ F;  2HQN A;  1SD6 A;  4BHC A;  2JSC A;  3PQJ A;  3RKY A;  4U0Y A;  2CGP A;  2DQR A;  4GGG A;  4HV5 A;  1STZ A;  4M72 A;  5DV5 A;  3WGG A;  4MEY F;  2XRN A;  1F5T A;  4IRI A;  2XAJ A;  1R1T A;  4OIN F;  3GFM A;  4ESF A;  1XCB A;  1KGS A;  4Q48 A;  4HDV A;  1ZG3 A;  1G3T A;  3GLX A;  3DP7 A;  2P5K A;  2H27 A;  1TBX A;  3VEP A;  4CIC A;  3E3V A;  4S04 A;  3ABU A;  2RV8 A;  1BI1 A;  3WTS C;  2HYG D;  3HTS B;  4ENJ A;  3J80 K;  2L54 A;  4CDG A;  3S2W A;  2VOO A;  2UZK A;  3SZT A;  4YIF A;  4AIJ A;  3F6O A;  5LRR A;  3EUH A;  1DUX C;  1YO5 C;  3O2P E;  4B09 A;  3HSE A;  1SMY F;  2FBH A;  2ACJ A;  4RGU A;  2XKP A;  4FT8 A;  3T5X A;  5CVV A;  1T2K A;  4LLN A;  2VBZ A;  2MH9 A;  1WWX A;  2L4M A;  4M71 A;  1SFE A;  3NQO A;  3K69 A;  4HZF A;  1MDM B;  5A2Q K;  2LKP A;  3E5U A;  3EET A;  2E7X A;  2EK5 A;  4GXO A;  1ON2 A;  5LGN A;  4LLG F;  5CJ9 A;  2G7H A;  2K02 A;  1U8R A;  2XAH A;  4RGS A;  2XV4 S;  4M73 A;  1R1U A;  2EV0 A;  3HSR A;  1LDD A;  3V7R A;  2HS5 A;  4ASN A;  2K4B A;  1KA8 A;  2EFP A;  5CLS A;  1FSH A;  1LDJ A;  2Q0O A;  4A5M A;  4U7B A;  1P4X A;  3I58 A;  3M8E A;  2UXX A;  1XB4 A;  2O3F A;  2OD5 A;  1LB2 A;  5HDN A;  3LWF A;  5E20 A;  1SD4 A;  3KEO A;  4ENN A;  4A12 A;  1J5Y A;  3IWF A;  4L0Y B;  2FNA A;  2GZW A;  3FX3 A;  3K1P A;  1Q1H A;  1J75 A;  2DBB A;  2A6H F;  1USS A;  2HZT A;  3ZN1 A;  4JQF A;  2HDC A;  3CJN A;  5DYM A;  3KP7 A;  1BIA A;  4TV7 A;  2CQK A;  2O03 A;  2WWY A;  5ICC A;  1H9T A;  5CYV A;  2OU2 A;  2W25 A;  5E1Z B;  2QZ8 A;  1XDS A;  1R36 A;  3O6B B;  2FBK A;  5JFR A;  5FFZ A;  3JAM Z;  1G3W A;  4DNC A;  1Z91 A;  3E97 A;  3GFL A;  3KLO A;  4ZH4 F;  1QBJ A;  3EDP A;  3DXJ F;  2JZY A;  4HF0 A;  1IRG A;  1ON1 A;  1P4W A;  1W5T A;  1O3S A;  4I09 A;  4WXD A;  2EB7 A;  3L9F A;  4I2O A;  1P6R A;  3M8F A;  1B1B A;  3C7J A;  1LJ9 A;  3L2C A;  4IHS A;  1IAW A;  1EH7 A;  3KP6 A;  2VT2 A;  3B73 A;  2KIF A;  3GFI A;  2KIM A;  5IT3 A;  2KKO A;  1KU3 A;  4WX9 A;  1W7P B;  1BBY A;  2P6T A;  1AOY A;  1T6S A;  5E1W A;  2ZNY A;  4CO8 A;  2VT3 A;  1BN5 A;  1FP2 A;  4L5J A;  4AD9 A;  4UNO A;  1U5T C;  1G3Y A;  1S8N A;  4LG0 A;  2W57 A;  2M45 A;  2GXB A;  1T98 A;  1SFX A;  3JW4 A;  2YX7 A;  2RVC A;  4WXC A;  3TOA A;  2D2W A;  3WTV C;  2W85 A;  2DPU A;  2ESH A;  1LNW A;  2AXL A;  3KP2 A;  2EFW A;  3KCC A;  4JBA A;  3V8J A;  3FWE A;  3J81 Z;  3EQL F;  4EVI A;  4LB6 B;  4HX8 A;  1O3Q A;  1TQP A;  3R4K A;  3V4G A;  4PGG A;  2MBF A;  5LEK A;  3GEZ A;  2RGV A;  1EV7 A;  4L0Z B;  3PQK A;  4HF2 A;  2V9V A;  2YR2 A;  1U2W A;  5D8L B;  4ETS A;  2RDP A;  1GHC A;  3E6B A;  4I01 A;  3V8K A;  2DPD A;  4HW0 A;  2CYY A;  4HOB A;  1FYK A;  1MZB A;  4EV0 A;  3ZQ7 A;  5F64 A;  3WG9 A;  4O6J A;  5DEQ A;  5LRS A;  3WTY C;  1CF7 A;  1KU2 A;  1XMA A;  4R1H A;  1U5T B;  3FF5 A;  2RNJ A;  3F8N A;  4HQM A;  2PI0 A;  5E1X A;  1ZHF A;  2QBY A;  1ZRE A;  1O7F A;  4CYD A;  5ICE A;  2NAZ A;  5CVR A;  2XAS A;  2EFN A;  5JR3 A;  2UXN A;  4U0V A;  1UST A;  1ONV A;  2DK8 A;  1RNL A;  4QWQ A;  2H6C A;  1J7K A;  4L9T A;  3ZMV A;  1B9M A;  1PP8 F;  3HSF A;  1SD5 A;  5FD5 A;  1G6N A;  4GYG A;  2FOK A;  4MHG A;  1FP1 D;  4M6Y A;  1RZ4 A;  5IT9 Z;  1KU9 A;  1E2X A;  6PAX A;  1ZG5 A;  3I64 A;  2E7W A;  3TO7 A;  1FX7 A;  5L3B A;  2H09 A;  1O3T A;  3QP5 A;  2NNN A;  2PQ8 A;  1A04 A;  2GQQ A;  2MC3 A;  4IJA A;  3FXU A;  4U0W A;  3DEU A;  4BH9 A;  3LAJ A;  2FA5 A;  3WTU C;  4RB3 C;  2E1C A;  3LST A;  4EM2 A;  2HKX A;  3GX4 X;  4G7Z F;  2GIV A;  1TQI A;  4M9S A;  4KIC A;  2HEO A;  3RKX A;  1XGO A;  1OYI A;  1CGP A;  4KNY A;  3TDU C;  3WTW C;  1FPQ A;  2V1X A;  1IRF A;  1EH8 A;  2VN2 A;  5LGU A;  4AWX B;  5HLI A;  4Q4Z F;  4HA8 A;  4F7Z A;  4KDP A;  2M8E A;  2XGX A;  3W6J B;  4OMY A;  5F6F A;  1XGM A;  3HHG A;  1YQA A;  2FEZ A;  3SXY A;  2OZU A;  1MJB A;  1CF7 B;  2P7C B;  5AIQ A;  3CUQ C;  3RYP A;  5FO5 A;  3GF2 A;  1TW3 A;  5A2Q Z;  5ED4 A;  1BC8 C;  1MDM A;  1HW1 A;  2F5E A;  5LLQ A;  2Y0M A;  5DCF A;  1U78 A;  2W24 A;  1IW7 F;  3E6C C;  2HQR A;  3C1D A;  1BOA A;  3HRU A;  2X4H A;  5L3F A;  2IW5 A;  1DDN A;  4BNC A;  2W84 A;  4EGY A;  4ZYG A;  1QGP A;  3HIF A;  1NHA A;  1O57 A;  1Z1D A;  4KN4 X;  1U3E M;  5IT9 K;  1I1G A;  3QAH A;  5J8F A;  5FGM A;  2ADU A;  3ECH A;  3K0L A;  2FE3 A;  3MFK A;  2EV5 A;  2FSW A;  2QQ9 A;  4HAM A;  4U7D A;  3RYR A;  3C3W A;  2OAZ A;  4YFN F;  2L02 A;  4AVP A;  5E17 F;  1PP7 U;  3RI4 A;  2IT0 A;  3HRT A;  3CUQ B;  4ZZL A;  3IWZ A;  3MAJ A;  2FF4 A;  2A68 F;  1FZP B;  1TTY A;  5DUI A;  4KFC A;  4UV8 A;  2PLY A;  4A2U A;  5HVQ C;  3HRS A;  1O3R A;  1K78 B;  2DQL A;  5LHG A;  5D4S A;  1U6G A;  2XUB A;  3E5Q A;  3P9C A;  1KU7 A;  2CSO A;  2A07 F;  4ESB A;  1XN7 A;  1J2X A;  4DQ2 A;  1YS7 A;  3LA2 A;  4A0X A;  3FHZ A;  2ZKZ A;  3V8L A;  5L3C A;  2M5W A;  2P4W A;  3LQR A;  2Q2E A;  1QZY A;  3VFZ A;  4A5N A;  4U88 A;  1S7O A;  5AON A;  2MA3 A;  4P55 A;  5HLH A;  2NS0 A;  3F8F A;  1YW9 A;  1MKM A;  1W7P A;  1FNN A;  1B4A A;  1IXS B;  1KQ0 A;  1XD7 A;  4EM0 B;  2EFO A;  5AIP A;  3T1B A;  4OIP F;  1EH6 A;  3SFZ A;  3WGI A;  2VBW A;  4YII A;  3MEX A;  5KVR A;  2DAO A;  2E1N A;  1XDU A;  3DKW A;  2G9W A;  5D5U B;  2EWN A;  2WTE A;  3QRF F;  3T8R A;  2A69 F;  2Z9O A;  3TQN A;  1J9I A;  2Q8K A;  5K5R A;  5K5O A;  4MTD A;  2IA0 A;  2R7F A;  3BPV A;  1V4R A;  3BZ6 A;  3WTZ A;  2DU9 A;  4LFU A;  1QNT A;  1J59 A;  1FBU A;  2CFX A;  4MQV A;  4G8X A;  2F5D A;  4A6E A;  1TNS A;  2RQP A;  3Q5F A;  3Q9S A;  2K27 A;  4EQQ A;  2D1V A;  1FY7 A;  2IA1 A;  3WE2 A;  3KP3 A;  5HS8 A;  1D3Y A;  2DFI A;  1I27 A;  3HRM A;  2KJB A;  2HTJ A;  3GWZ A;  5LBQ A;  1F1Z A;  2Y48 A;  2ZME B;  2OZ6 A;  4YFX F;  2XVC A;  4EMS A;  3ECO A;  3M7G A;  1TQM A;  3ELK A;  3LA3 A;  1LDK B;  2L3D A;  1REP C;  1OYY A;  3VOD A;  3BWG A;  3BJO A;  3U2R A;  2QM3 A;  4A0Z A;  1Z9C A;  3RPQ A;  5L3D A;  2QVO A;  4I0B A;  1T38 A;  3I0T A;  1BJA A;  2P7V B;  3NRV A;  1BC7 C;  1BM9 A;  5KK1 A;  1D8K A;  2XAF A;  5BMZ A;  3U1D A;  2NRA C; 
#chains in the Genus database with same CATH topology
 1U5T A;  1I3Q J;  1HCR A;  4OOI A;  4UHT A;  2B63 J;  1G2H A;  4NNJ A;  4D9J A;  2TRT A;  3OL4 A;  3BQZ A;  4ZZD A;  4HDU A;  1B9N A;  3ROU A;  4O5V A;  4UB6 C;  2IS1 A;  2V26 A;  3OYK A;  1GV5 A;  5JHU A;  4CZZ A;  2LDU A;  2Z99 A;  1MMG A;  5FB2 A;  1YW8 A;  3L1P A;  3GTO J;  4L18 B;  4RB1 A;  1GXQ A;  3K4L A;  1T95 A;  2R7R A;  4LMY A;  1ZGW A;  1G8X A;  4GO1 A;  3LSR A;  3MN2 A;  1LQ1 A;  3X2Q H;  1K4S A;  3RQ4 A;  3CJQ B;  3CO6 C;  5ICG A;  2J5O A;  3BR5 A;  4XN0 A;  2QYO A;  4BQA A;  1FIA A;  1RES A;  4MGR A;  1QO0 D;  2JT1 A;  1DU6 A;  4HLX A;  1W4M A;  1ZH5 A;  3I4P A;  4FE4 A;  1ACI A;  2K9Q A;  3W6K B;  3QPT A;  1OR7 C;  4OMZ A;  3MKY B;  2JA7 J;  4RB2 C;  2L7K A;  2RC4 A;  5FFX A;  4HPQ A;  1OPC A;  1LEA A;  2CQX A;  4PFP A;  1M1E B;  1FWZ A;  5D5V B;  3AG3 H;  1F9N A;  1RIO H;  2UWM A;  3OL3 A;  3L2R A;  2KLO A;  1ITY A;  3HUG A;  2IGM A;  3BP8 A;  3BC8 A;  1O7L A;  2ZXJ A;  2QQB A;  4G6D A;  5FKN A;  3JTH A;  1XSV A;  4RAY A;  1VI0 A;  1ZKG A;  5TGT A;  2LY1 A;  1PDN C;  2GWR A;  1L3L A;  2HWV A;  2MLG A;  3S15 J;  3KZZ A;  1P4A A;  1UEL B;  2PFB A;  3HDD A;  4KJZ A;  3IAS 2;  2Y31 A;  1QPI A;  2STW A;  3DF8 A;  2N8G A;  1Z05 A;  4NHJ A;  3HPG A;  1MMD A;  3G1O A;  3ZN0 A;  1F4K A;  5B1A H;  4LK1 F;  1K6O A;  4B44 A;  4LGW A;  3H92 A;  1EA3 A;  2ZCW A;  2JPC A;  3K4C A;  1JHF A;  1JHH A;  2OUM A;  5JVT A;  2XB5 A;  3DTI A;  4HNT A;  5K5Q A;  3QOP A;  2LKX A;  1YFH A;  3R6S A;  4K2E A;  1ZYR F;  4RMN A;  1X2N A;  4BE2 A;  3ASN H;  9ANT A;  1YI2 I;  3OYM A;  5TJJ A;  2DXI A;  1MH3 A;  1YG2 A;  1J0R A;  4MLO A;  1FT9 A;  2NOJ B;  3MKW B;  3JRB A;  3FK7 A;  5IP9 J;  5HOO A;  4YEJ A;  5C4X J;  1L0O C;  1H88 C;  3EPZ A;  1Z6R A;  2EBI A;  2OC6 A;  3JTG A;  2O8K A;  1IUF A;  2X6W A;  3K6G A;  5LEJ A;  2Z16 A;  3OYH A;  2HYF A;  1MMA A;  1W36 D;  4CXF A;  4G6Q A;  3CCL I;  2R92 J;  4Q5S F;  3DKX A;  4XRF A;  2K7L A;  3HZJ A;  3BOQ A;  4UVA A;  1WRJ A;  3TP0 A;  4KIF A;  3OWT A;  5FLV A;  3BR3 A;  5L3E A;  3F23 A;  1T56 A;  4RB0 A;  2L7M P;  4V19 K;  2M9H A;  2ID3 A;  2P0W A;  1DP7 P;  3NEU A;  3VB2 A;  2KIU A;  2W4S A;  5F04 A;  3V7S A;  4XLC A;  3A0B C;  4KIG A;  2EJR A;  1HDP A;  4AIH A;  2Y9Y A;  2L4A A;  3LQQ A;  3G3Z A;  3A1Y A;  2JMW A;  2IP2 A;  1LVA A;  3DFG A;  2YU9 J;  1YS6 A;  3U1D A;  2L01 A;  4PJJ A;  2F4I A;  3OS2 A;  4C2U A;  4EJU A;  2QEX I;  3RDI A;  2CW0 F;  3FDY A;  2M7B A;  3U9G A;  1Z0X A;  4CCN A;  4EJT A;  2YS9 A;  3IKV A;  4JK1 X;  5E79 C;  1DQU A;  4MFE A;  3OYN A;  4N9I A;  4GFB A;  3MQ0 A;  4EJO A;  1ORK A;  3PNV A;  1YJW I;  3J7A O;  3TGN A;  2XC7 A;  2PBI A;  2F5V A;  1R4N B;  1ULY A;  2CH0 A;  2MLK A;  2OCC H;  2XHK A;  2Z5U A;  2ZNZ A;  3I59 B;  2LC2 A;  4M3E A;  5EDN A;  4JOM A;  3QPL A;  3C18 A;  5FD6 A;  1HW2 A;  4HF1 A;  3I56 I;  2ISY A;  1OCP A;  4IVN A;  2DN0 A;  1TNT A;  1Y8R B;  2EA4 A;  4RBO A;  4XMY A;  3F21 A;  3P7N A;  2KT0 A;  1D8J A;  2A05 A;  3CF2 A;  3GVA A;  5H2F C;  4ZYH A;  1V55 H;  2XSJ C;  2RN7 A;  1WSU A;  1OCZ H;  4I02 A;  2M30 A;  3EYY A;  2WAQ N;  2O0Y A;  4CH7 A;  1Y0U A;  1SFO J;  1UHM A;  1MBH A;  2ZJR F;  3Q3S A;  3I71 A;  1B6A A;  3HUG B;  5K7F A;  3GTL J;  5E18 F;  3F72 A;  2CG4 A;  2JQ7 A;  2TDX A;  4UVB A;  1YRN A;  2Y69 H;  4MQ9 F;  3S3O A;  5JI6 A;  3H9Q A;  3H5A A;  5K7Z A;  1IXR C;  3D5R C;  3ULQ B;  2HFH A;  2HOA A;  2X1D A;  5K1Y A;  3IUO A;  3K7A J;  2JA5 J;  1C0W A;  2DOE A;  2VXZ A;  4JX5 A;  2X6Y A;  2Q1Z B;  3FMS A;  2HVR A;  2RAE A;  3KEQ A;  1QZZ A;  1KQ9 A;  3V7C A;  3SHF A;  4MFD A;  3CCJ I;  2DA1 A;  4E70 A;  1QU3 A;  2BEO A;  4X1E A;  2K85 A;  1FOW A;  4R79 A;  3R60 A;  2K86 A;  5JHF A;  5CVU A;  1KYW A;  4CYC B;  1T0F A;  3CCY A;  4ITV A;  2EV6 A;  4A3K J;  1BIB A;  1VQ8 I;  1PVE A;  4WXH A;  5HS9 A;  3OYI A;  2IRF G;  1WFX A;  2LBF A;  4G94 A;  1WKM A;  2L5Q A;  2FX0 A;  4N0B A;  5H20 A;  2R7O A;  3CUQ A;  4O3M A;  1F43 A;  2JPB A;  2DFF A;  5L3G A;  1R58 A;  4XSX F;  1ZK8 A;  2VJJ A;  4GYI A;  3JSP A;  2R7X A;  2K3F A;  1K61 A;  1IZ1 A;  3O3K A;  4YG2 F;  5EEH A;  1YIO A;  5TRD A;  4IXA A;  2PJR B;  2ZFW A;  4JX6 A;  4LD5 A;  3I54 A;  3IC7 A;  4DBR A;  1JE8 A;  5FLX K;  2IBD A;  1HST A;  2VBX A;  3WU2 C;  1K78 A;  3PO2 J;  2VON A;  3WGH A;  3NAU A;  2VJ4 A;  1SVM A;  2F4O B;  4XLE A;  2JUG A;  1FOK A;  1T08 B;  2I8D A;  1S29 A;  5GPA A;  3FM3 A;  3G71 I;  3LA7 A;  1FTT A;  4DOZ A;  1GLN A;  3FK6 A;  1G3S A;  1N75 A;  4OIR F;  3B02 A;  1KYZ A;  3CMY A;  3D0S A;  2K9L A;  4UXN A;  3CCQ I;  3HOZ J;  1VQK I;  3BJ6 A;  4HYE A;  1JXS A;  1JT0 A;  3GXO A;  5HNF A;  4AM3 A;  2MFZ A;  2BV6 A;  2D5V A;  2ECB A;  2GBY A;  3QU6 A;  4BEH A;  2VKH A;  1VQ6 I;  1D1A A;  1I6X A;  4RLF A;  1MSE C;  3LFU A;  2AXT C;  4D1Q A;  1QHH D;  2DA5 A;  3BRO A;  3WU0 A;  4A3E J;  2MYS A;  3QP6 A;  1LEB A;  4ON0 A;  2JA8 J;  1K79 A;  2H8R A;  3GFJ A;  3KLN A;  2P8T A;  2XRO A;  1SMT A;  1ZGA A;  4BUP A;  3W2V A;  1YJ9 I;  2GXA A;  2QF7 A;  1UHW A;  4KMU X;  4E6K G;  5LHH A;  3K2Z A;  3OYB A;  3KP4 A;  3F8B A;  1A31 A;  3HBL A;  4I98 B;  3ZRG A;  2KZV A;  3L7W A;  1GVJ A;  2B9S A;  4ZDL A;  3GTG J;  2DMN A;  2LY2 A;  3DBH B;  2FQ3 A;  2GOM A;  5J8C A;  2X1E A;  4F91 B;  3K70 C;  2JA2 A;  3BR1 A;  3AAF A;  1GXP A;  4RAZ A;  5CPR B;  3CC7 I;  4XBF A;  1XPX A;  1LVK A;  4G6T B;  2LKS A;  2X0L A;  3F8M A;  1RKW A;  4OIO F;  3F3X A;  5TIS C;  2D45 A;  1XX5 A;  5F08 A;  5EZG A;  1HKT A;  4D0P A;  3K1N A;  5E3O A;  4UVC A;  3OS0 A;  2XDV A;  2F5F A;  2VOP A;  1WZ2 A;  4KA4 A;  4BQO A;  1R6R A;  1WJB A;  4BAC A;  1OMI A;  2EZH A;  5ICF A;  1W0U A;  3HYI A;  4JYK A;  4G7O F;  3ABT A;  4M9Z A;  2CMP A;  2V79 A;  4HQE A;  1D0Y A;  3QU3 A;  2KDO A;  4QSH A;  4Y7N J;  3IV5 A;  1OKR A;  4EGZ A;  1RI7 A;  1VQL I;  1R5I D;  4NC7 A;  4UV9 A;  4P9F A;  2K3P A;  2VB6 A;  1VTN C;  2E60 A;  3QPH A;  3KYD B;  5ERI A;  4PGH A;  3K9T A;  3BZK A;  4BXU A;  2QQ8 A;  5J1R A;  2FRH A;  2LNB A;  1ZAO A;  3IKT A;  2EZL A;  2J5P A;  2YX4 A;  2ELH A;  3MWM A;  2Y75 A;  1R1V A;  4D5F A;  1S6L A;  1FOY A;  2P5L C;  1YTY A;  3ZMU A;  2DTR A;  3OOP A;  1XGS A;  1FSE A;  2EH3 A;  3BDD A;  4N9H A;  3E5X A;  2ZME A;  2A5Y B;  1Z3Y A;  2VPR A;  4LB5 A;  1V5E A;  3CTA A;  4MIM A;  1YX3 A;  2CW7 A;  2R3S A;  2A61 A;  3QQA A;  3RSN A;  3OYC A;  1JTX A;  2OQR A;  4R8H A;  3L09 A;  3N4M A;  5BPD A;  3GLL A;  2EIJ H;  4OU0 A;  4PSX A;  1SD7 A;  3PFY A;  2MG4 A;  3LSJ A;  3E0J B;  3CO7 C;  2IEK A;  3N97 A;  1V3F A;  3HM5 A;  3IHU A;  1LFP A;  3A01 A;  5FKK A;  4I99 C;  4CCL A;  4Y17 A;  2VBY A;  2D1H A;  2BBY A;  1RR7 A;  1TW2 A;  5DCM A;  4L9J A;  4PJM A;  2NVY J;  5HLG A;  3FXJ A;  4NDL A;  5CVJ A;  4KN7 X;  2Y0S A;  3A2K A;  4XRS A;  2W00 A;  1ETK A;  1ZRD A;  1BW5 A;  5BPI A;  4DZP A;  3REO A;  2GXG A;  2MAB A;  1FLI A;  2HTS A;  2HGC A;  2VOD A;  3DPL C;  2CO5 A;  2JVH A;  3J7A Y;  3MD2 A;  1X4O A;  1Z6T A;  4BEH B;  1HKQ A;  1FBS A;  5LD2 C;  3OYA A;  4M3G A;  4HV6 A;  2WY8 Q;  5M5X J;  4IEJ A;  3VOE A;  1ZRC A;  3SDB A;  1MIJ A;  5H6R A;  4B47 A;  1HBX G;  1WH7 A;  1P92 A;  2L9N A;  3MCZ A;  4BJT A;  1JGS A;  1VQ7 I;  3P5J A;  3CC2 I;  4QLC U;  2F2E A;  5C3E J;  3I53 A;  4M6X A;  1CQT A;  4UUS B;  1H8A C;  2GA1 A;  3KET A;  3Q9V A;  4P1W A;  1NG7 A;  2E34 A;  3PUB A;  4NQW B;  1OCT C;  4PUS A;  1HSJ A;  1FMW A;  3FMR A;  2G7U A;  3FXL A;  3ERE D;  3VYR B;  1TWC J;  5CQE A;  3FZV A;  2YPR A;  4YIR X;  4RM2 A;  4S0H B;  3CES A;  3ZMT A;  5LHI A;  4BDZ A;  5D6F A;  3HOT A;  4MNU A;  4FTH A;  2ZO4 A;  1V5G A;  2BGC A;  3PJR A;  1HW5 A;  2L7F P;  3OYD A;  3HOV J;  4ZC3 A;  3WE3 A;  2L2O A;  1X3U A;  4OAZ A;  2VE9 A;  3EUH C;  2OCE A;  1PUF B;  3BJA A;  2CV2 A;  1SFU A;  1YW7 A;  1Y6I A;  3CME I;  3S14 J;  4RLQ A;  1JTY A;  3G1L A;  2VXD A;  4CCJ A;  5M3F J;  2STT A;  3ZPL A;  2ISZ A;  4V2G A;  3ZMZ A;  2R7D A;  3H1C A;  5EGO B;  5LGT A;  1NK3 P;  3O8H A;  4PJN A;  3T0Y A;  3BLY A;  2DDB A;  3F6V A;  1FIP A;  4PZJ A;  2Y2Z A;  2FBI A;  3BTC A;  2OJE D;  4Y33 A;  4C30 A;  4EJW A;  4KMF A;  3RTR A;  3DU6 A;  4ENM A;  2R0Q C;  1BJZ A;  4CHU A;  5J6X A;  2H94 A;  3F0C A;  1PJR A;  4M74 A;  3S1R J;  3ESW B;  2NNY A;  4E7K A;  1WQ2 A;  2DDA A;  3FXM A;  2PJP A;  3E6D A;  2WAE A;  1QVU A;  3HTU A;  3I5U A;  1W5S A;  2FML A;  4FET A;  2A3S A;  3OR2 C;  1TT0 A;  2V1D A;  2XAQ A;  3FIW A;  1ZN2 A;  2DJN A;  2VE8 A;  1W7P D;  2OBP A;  4ZYE A;  2X6O A;  3E6M A;  4E7Z A;  3MMY B;  3CJR B;  1RC9 A;  1JJ8 C;  3LFK A;  4RA2 A;  1AWC A;  5KAF C;  2YUS A;  3LNQ A;  4DW6 A;  1MJ9 A;  2DCE A;  1IGN A;  5EEG A;  1IN4 A;  2ECC A;  3D1N I;  1MJA A;  1WI9 A;  2AQE A;  1U9N A;  4M3D A;  2PMU A;  5HS7 A;  1T39 A;  1DGW Y;  3DLL F;  4WF2 A;  2OTJ I;  3ML6 A;  3TW6 A;  1QZE A;  4F55 A;  1S3J A;  4KYW A;  1WVR A;  2L9V A;  1G59 A;  2A6E F;  3CUO A;  5D4R A;  5C44 J;  3J7Y J;  2F5C A;  3OV8 A;  5F1R A;  2C6Y A;  2ZBK A;  5DCM B;  4RAF A;  4L5I A;  1PUE E;  2QUF A;  2ZJ2 A;  3JRA A;  1XSX A;  3K4N A;  2LTP A;  3SZP A;  3WTT C;  1FOX A;  1VF9 A;  2CWE A;  2PX9 A;  3FMQ A;  4PJ0 C;  4BYY A;  1FYM A;  2ETH A;  1IDY A;  1XS9 A;  3H0D A;  3COA C;  1R7J A;  1OR7 A;  2QLZ A;  4S05 A;  1MMS A;  3S1M J;  1JGG A;  2ME0 A;  4RDU A;  1SEU A;  1RUN A;  4XKW A;  4Y3O A;  1X4P A;  3MZY A;  2IGO A;  1HOM A;  4LJZ F;  3PO3 J;  1BI3 A;  3P9K A;  3RPU A;  5HDG A;  3GUD A;  3ZQG A;  2E19 A;  1IUY A;  3PSF A;  3BQY A;  1BOB A;  1K4T A;  2HQA A;  1WJE A;  5ILU A;  2MD5 A;  5J1U A;  3S2D J;  1SAX A;  2FNP A;  1ZGJ A;  3V42 A;  2JN6 A;  2VC1 A;  1AA7 A;  1UZC A;  4M3F A;  2WB1 A;  2LFB A;  3I59 A;  5EF6 A;  5E8I A;  2K4J A;  1V54 H;  5ILS A;  2HDW A;  2IJL A;  4ESJ A;  2LP0 A;  4ZTJ A;  1BR2 A;  2KJC A;  2PN6 A;  2P6S A;  4LG3 A;  4IOC F;  4QIW N;  1R49 A;  2DMQ A;  2VKV A;  5M3M J;  3RQI A;  2VL8 A;  3FXR A;  2HPI A;  3DV8 A;  3EYI A;  4HNU A;  4G9Y A;  2FXA A;  3I9V 2;  2CS3 A;  3VSL A;  1S7A A;  3BR6 A;  3IRR A;  4EJV A;  1IN6 A;  1RUO A;  2DW4 A;  2HR3 A;  1ETW A;  2CUZ A;  4G7H F;  1K7A A;  4BY7 J;  2EQR A;  3RJP A;  1MGT A;  2IPQ X;  2NS8 A;  4BXF A;  4Y52 J;  4HNV A;  1R00 A;  1I1S A;  2WC2 A;  3GO5 A;  4DBQ A;  3M4O J;  2XRL A;  2HNH A;  2HOE A;  2LSO A;  5CVI A;  2GA2 A;  1TWH J;  1Z21 A;  4MEX F;  2R7T A;  3R61 A;  2BW3 B;  3M1E A;  2EFQ A;  4F52 A;  5DD4 A;  4HLY A;  1OYW A;  1I5Z A;  3K10 A;  2VJI A;  3H0G J;  3RIR A;  5DDG A;  3RPU D;  3S1N J;  2Z33 A;  2RKH A;  2VQH A;  4HST A;  3L2Q A;  2DYR H;  3KE2 A;  3HOW J;  3FM5 A;  1RKT A;  1FMV A;  2M87 A;  1ZRF A;  4IRH A;  4PCQ A;  4CYC A;  2GAU A;  4MTE A;  1LPQ A;  2Z2S B;  1Z77 A;  2LD5 A;  2IA2 A;  3T8T A;  2ESN A;  3WTX C;  2X51 A;  2LY9 A;  1E3H A;  2NYX A;  4XLA A;  2A6T A;  4B1R A;  3HOU J;  2O61 A;  1ZAR A;  2W82 A;  3QOD A;  2PMH A;  3HC7 A;  2MH2 A;  1WJF A;  2IGK A;  2XKO A;  3TO6 A;  3QOE A;  3OYE A;  2BY3 A;  3MZ8 A;  3GZ6 A;  1BI0 A;  1N78 A;  1TWF J;  1MSF C;  3F8C A;  1XC5 A;  2P5V A;  3CDH A;  2VKD A;  2DO7 A;  3H3U A;  5FLX Z;  1MND A;  4BJ6 C;  3M9A A;  4E7S A;  2PJR A;  1TWA J;  5FRO A;  4OWR B;  4G12 A;  1D5Y A;  4WWC A;  3WU1 B;  4CGZ A;  3GZ5 A;  1IF1 A;  1W36 C;  5DD8 A;  1WJD A;  4B8X A;  2NS7 A;  2DMU A;  2XAU A;  4Y15 A;  2L7Z A;  2CRG A;  3Q0V A;  3ZMS A;  4NB5 A;  2EZK A;  2LF8 A;  1D0X A;  3FHN A;  5BOX A;  2YU3 A;  3F9K A;  2EIM H;  3TOB A;  2M0M A;  4JX4 A;  4PDK A;  4A3F J;  4GDF A;  3TDZ C;  1DP3 A;  2HOT A;  1WCM J;  4KIB A;  1YE9 A;  2HQ5 A;  4IPA A;  1O4X A;  3CCR I;  4I6Z A;  3H3Z A;  1R22 A;  1Z7U A;  3DPT A;  1HDD C;  3JAM K;  1I39 A;  5EJC A;  3BTI A;  3IRQ A;  1ODD A;  2QQA A;  1WPK A;  3KFW X;  3DQV C;  2DMT A;  4M6V A;  2XB0 X;  4BGD A;  2XGC A;  3RZO J;  1HLV A;  2DK5 A;  4Q47 A;  1R5H A;  2IVM A;  4UUV A;  3N05 A;  3A4C A;  3R0J A;  2LF7 A;  1J09 A;  1JKO C;  3TKY A;  3HGY A;  1H9G A;  3ZQL A;  1TL8 A;  4XN3 A;  2K40 A;  1HKS A;  1UCR A;  4W97 A;  4J00 A;  4DGW B;  5F0C A;  3BPX A;  3BG5 A;  3DCF A;  4KUM A;  4W1U A;  2TCT A;  4LLL A;  1YHQ I;  4ABZ A;  2O6G E;  4ZYD A;  2JRT A;  1D5V A;  4P9U A;  3CQZ J;  3OS1 A;  1KZH A;  3M07 A;  2DT5 A;  4RS8 A;  2HKO A;  4FX4 A;  3JSO A;  4IL6 C;  4PJL A;  2EA2 A;  2FU4 A;  4A6D A;  2LLK A;  3ZCO A;  5KHD A;  3CLO A;  2EPF A;  4BHB A;  3HOS A;  1Q1V A;  2WV0 A;  4KT5 C;  4FCY A;  3DBL B;  4H0E A;  3BY6 A;  5H6Q A;  4Z2Y A;  4DYQ A;  1H89 C;  3ISP A;  2VPL A;  1Z67 A;  1HQC A;  4WCG A;  4Y13 A;  5GTI C;  2LRE A;  1G4D A;  1YYV A;  2PEX A;  3FXQ A;  3K4K A;  1R5G A;  3WOD F;  1IN5 A;  2DLL A;  2FOW A;  5HDK A;  3HHH A;  1IV6 A;  1R71 A;  2DI3 A;  2JSP A;  2XAG A;  2CUF A;  3HKZ N;  4LG0 B;  4MO7 A;  1ZG1 A;  2KZG A;  3OY9 A;  4C3I J;  3G4S I;  3A0H C;  2H6B A;  2HI3 A;  2VLA A;  4OIQ F;  1MD0 A;  1Y1V J;  3S3N A;  4DJA A;  4A3C J;  4LIT A;  5BQT A;  1HXD A;  4I7H A;  2VKE A;  1QPM A;  3G1M A;  5FRM A;  1S72 I;  3DPU A;  4ZDO A;  1ZLK A;  1DGR M;  2COM A;  2DT7 B;  2R5Z B;  4L9N A;  2ME6 A;  2YSR A;  1UFM A;  1BR1 A;  1ZEL A;  2XPU A;  3I55 I;  2DA4 A;  4LIV A;  3CF5 F;  2V1U A;  3G2B A;  4A0Y A;  3S3M A;  1FC3 A;  2O8X A;  4BY1 J;  1MBF A;  3LSI A;  3J81 K;  1BI2 A;  3VPR A;  4XLP F;  1XG1 A;  4WK8 F;  3GTM J;  1JJ6 C;  1MBK A;  4II2 A;  2JTV A;  3F22 A;  3KZY A;  3ABK H;  3D5L A;  1TLH B;  1IXC A;  1KQ8 A;  5J47 A;  2E2H J;  1XSD A;  4E4H A;  3H5R A;  3SQN A;  1B8I B;  2DA7 A;  2BE5 F;  2X85 A;  4B3X A;  2O9L A;  4GCV A;  4CCK A;  3MKL A;  1JUS A;  2DA6 A;  2FMY A;  3C2H A;  4XLN F;  4EM1 A;  1H0M A;  3IL2 A;  3GW2 A;  2Y0S N;  2QEN A;  3K1M A;  3J80 Z;  4YFK F;  2XF6 A;  2M1B A;  1XCV A;  3LAP A;  3EUK L;  2JRM A;  2QWW A;  5D6E A;  4BJ5 C;  3GCM A;  2R5Y B;  3BG9 A;  4NUB A;  4P96 A;  3ZOB A;  2E2I J;  4I0A A;  3ERM A;  4KT6 A;  4PK4 A;  2Z3Y A;  1X1B A;  3Q0U A;  3GTQ J;  1UB9 A;  5BS6 A;  3Q0W A;  3HL2 A;  2NVX J;  1ZLJ A;  2X1C A;  1RPW A;  3W6V A;  2OA4 A;  5D8K B;  2R7U A;  3K2A A;  3WHB A;  4AVZ A;  4HX7 A;  3GYH X;  5E8G A;  4AIK A;  2E71 A;  2IS6 A;  4LK0 F;  4ENK A;  1AU7 A;  2DA3 A;  4BDY A;  2IXS A;  4M3B A;  2XIG A;  4IHT A;  3ZP5 A;  3P9I A;  2VC0 A;  4RGX A;  3RKW A;  4IF4 A;  1FBQ A;  1R23 A;  4UUS A;  2JA6 J;  1YLF A;  2QBY B;  2OQG A;  1FYL A;  2B0L A;  3BG7 A;  3PL8 A;  3ZQQ A;  4NQW A;  1QQI A;  4U87 A;  2L9S A;  2QSF X;  4P5O A;  3ZMD A;  3FBI B;  4IRG A;  4XOT A;  4CCM A;  1FJL A;  3MZH A;  4HBL A;  4RGR A;  3G73 A;  3GME A;  3NWS A;  2JJ7 A;  1DPU A;  2X48 A;  1I6H J;  3KP5 A;  5IYB J;  1IN8 A;  1MBJ A;  5D5X B;  4QPO A;  3TO9 A;  4L9V A;  1ZR2 A;  2V6C A;  1PUF A;  2V9K A;  1XMK A;  3PFI A;  3ZQF A;  4M9X A;  3FKI J;  1MMN A;  2KRF A;  1X2M A;  1GT0 C;  1E17 A;  3O8G A;  5BNG A;  4BS9 A;  3FKJ A;  3CZ6 A;  5DUK A;  1U8B A;  3GTK J;  5D5W B;  4FX0 A;  2PG4 A;  5EGO A;  5F0F A;  1LKX A;  1XGN A;  2NRA C;  3CP8 A;  4B3A A;  5B1B H;  4BHP A;  1GVD A;  1UHS A;  2IS2 A;  1TWG J;  4FHT A;  4ZYA A;  1B59 A;  4HX4 A;  1I3A A;  1LFB A;  3K4B A;  4L5E A;  2BYV E;  5ILV A;  2W1O A;  3ONQ A;  4BAY A;  3U21 A;  1DPR A;  1P2F A;  3HJE A;  1IN7 A;  3BZC A;  4HG2 A;  3L00 A;  3W2W A;  1SAU A;  4C2M J;  3CCM I;  2LRD A;  3R0A A;  2AS5 F;  4XSZ F;  2HQN A;  1ZTR A;  2BVM A;  1VQ5 I;  1HF0 A;  2R7Z J;  4UUT A;  1SD6 A;  4BHC A;  2JSC A;  3J7Z I;  3PQJ A;  4XLH A;  3RKY A;  4U0Y A;  2CGP A;  3UNG C;  3ABM H;  2DQR A;  3JRI A;  4GGG A;  4HV5 A;  3H3V K;  1P7J A;  2KIS A;  2CJJ A;  2DT6 A;  3SFI A;  2M4G A;  3I4N J;  2V7F A;  2XGE A;  4B48 A;  3C2B A;  2HVQ A;  2VQL A;  1STZ A;  4M72 A;  3TBI A;  4CUG A;  2GLO A;  5DV5 A;  3WGG A;  4MEY F;  3L2U A;  3D5S C;  2XRN A;  1F5T A;  1B72 B;  4IRI A;  3AL0 C;  2XAJ A;  1R1T A;  3JRG A;  4OIN F;  2R7S A;  1EKE A;  4II3 A;  1X19 A;  3GFM A;  4ESF A;  3KYL A;  1XCB A;  1KGS A;  4Q48 A;  5B3S H;  2FUG 2;  1WJ5 A;  2M2E A;  4HDV A;  1ZG3 A;  1G3T A;  2ZXI A;  3GLX A;  3DP7 A;  2E35 A;  2ZC2 A;  5HNH A;  3S16 J;  2F48 A;  5GP9 A;  2P5K A;  2BOL A;  2H27 A;  2KHM A;  1TBX A;  3VEP A;  4AYB A;  4CIC A;  3E3V A;  4S04 A;  1JKP C;  1T8I A;  4YEL A;  3ABU A;  2RV8 A;  1BI1 A;  3WTS C;  2HYG D;  3HTS B;  4ENJ A;  2LG4 A;  3J80 K;  2L54 A;  4CDG A;  2UV1 A;  4N4N B;  3S2W A;  2VOO A;  4Y4R A;  2UZK A;  4FAS D;  3JR9 A;  3SZT A;  2ICW G;  4YIF A;  5CKT A;  3GTJ J;  4QTR A;  4AIJ A;  1HC8 A;  4D7M A;  3F6O A;  5LRR A;  4X6A J;  3EUH A;  1DUX C;  1Y8Q B;  1YO5 C;  3O2P E;  3CJT B;  4B09 A;  2EIL H;  3HSE A;  4CSW A;  1SMY F;  2KQR A;  2FBH A;  2ACJ A;  2E5Z A;  2O7O A;  2DOA A;  3EUA A;  1MH4 A;  4RGU A;  3LSH A;  2LOO A;  3PIP F;  2XKP A;  4FT8 A;  2WB1 N;  3T5X A;  5CVV A;  1T2K A;  4LLN A;  3SDG A;  1TC3 C;  2VBZ A;  2MH9 A;  1WWX A;  2L4M A;  3HGG A;  1IRX A;  3QPS A;  4M71 A;  1SFE A;  3NQO A;  3K69 A;  4HZF A;  1MDM B;  2F4M B;  5A2Q K;  4AC0 A;  3JRD A;  2LKP A;  3E5U A;  5FKO A;  3EET A;  2DOD A;  5GAG J;  2E7X A;  4AUX A;  2EK5 A;  3KZI C;  2BXY A;  4GXO A;  1ON2 A;  2UUZ A;  4LLG F;  5CJ9 A;  2G7H A;  2K02 A;  3SYT A;  5LGN A;  1U8R A;  3ZQC A;  2XAH A;  4RGS A;  3CCS I;  4BE0 A;  4FIS A;  3HG9 A;  2XV4 S;  4M73 A;  1R1U A;  2EV0 A;  3HSR A;  3BG3 A;  3NAR A;  4E7H A;  1AKH B;  1LDD A;  4IZZ A;  3V7R A;  1W0T A;  2HS5 A;  3CDL A;  4ASN A;  5IOZ A;  2K4B A;  2V9P A;  1KA8 A;  2EFP A;  5CLS A;  1FSH A;  1IO2 A;  1SFK A;  3VDX A;  1LDJ A;  3VSK A;  3AL0 B;  2VUM J;  1ENH A;  4ZJZ A;  2Q0O A;  3S8P A;  4A5M A;  4U7B A;  1P4X A;  3I58 A;  3M8E A;  5J40 A;  2UXX A;  1UG2 A;  5DTD A;  1XB4 A;  1A6Q A;  1IV8 A;  2NVT J;  2O3F A;  2OD5 A;  4F3Q A;  2BW3 A;  4NC6 A;  4IO9 F;  2M0C A;  3KEY A;  1LB2 A;  2QKM B;  5HDN A;  3LWF A;  5E20 A;  4E7J A;  1SD4 A;  2L0K A;  2VAS A;  2KMU A;  3KEO A;  4ENN A;  3TW7 A;  3OMY A;  1WH5 A;  5LFA A;  4C2T A;  1APL C;  5DS9 A;  4A12 A;  4BE1 A;  1J5Y A;  3IWF A;  4L0Y B;  2FNA A;  2GZW A;  3FX3 A;  3K1P A;  1Q1H A;  2R7V A;  3PUF A;  2ZXW H;  1J75 A;  3OOU A;  2DBB A;  2A6H F;  4XKB A;  3FXK A;  1VQP I;  3RKQ A;  1USS A;  2HZT A;  3ZN1 A;  4JQF A;  1GUU A;  3LSP A;  2HDC A;  3CJN A;  2ZFU A;  5DYM A;  3KP7 A;  2FD5 A;  5B5E C;  3PM1 A;  1BIA A;  4TV7 A;  1XMX A;  2G0E A;  2QKL B;  2MSY A;  4FE7 A;  2CQK A;  2O03 A;  1POG A;  5GTH C;  4NC8 A;  2WWY A;  5ICC A;  1FEX A;  2HXO A;  3E1S A;  1H9T A;  5CYV A;  2CU7 A;  2EIK H;  2OU2 A;  3QYE A;  2W25 A;  5E1Z B;  4XNF A;  2QZ8 A;  1XDS A;  2XPW A;  1LUJ B;  1R36 A;  3O6B B;  3GTP J;  1X3W B;  2OTL I;  2FBK A;  5JFR A;  1T33 A;  1LFU P;  4IHV A;  5IP6 A;  3L2V A;  2KDZ A;  1D1B A;  3RZD J;  1VQ4 I;  5FFZ A;  3JAM Z;  1G3W A;  2XGD A;  4B4C A;  4IKF A;  1VND A;  2M7A A;  4DNC A;  1UMQ A;  1Z91 A;  3E97 A;  3GFL A;  3KLO A;  4ZH4 F;  1QBJ A;  2WV1 A;  2VQC A;  4CCO A;  3EDP A;  3DXJ F;  2JZY A;  1LE8 A;  2ID6 A;  3DTE A;  4HF0 A;  2E1M C;  2RNG A;  4BQN A;  1IRG A;  3LSK A;  1ON1 A;  4DYR A;  4J19 A;  1N77 A;  1P4W A;  1EF4 A;  1W5T A;  3IH4 A;  3CMA I;  1O3S A;  4I09 A;  4WXD A;  5FKM A;  5M5Y J;  4IHY A;  3OIO A;  1W5C C;  2EB7 A;  3BCA A;  2Q2E B;  2H1L A;  3L9F A;  3FIS A;  4I2O A;  1P6R A;  3M8F A;  1B1B A;  2E5N A;  3L2W A;  3C7J A;  3OIQ A;  4GRI A;  1LJ9 A;  4XKC A;  3L2C A;  4IHS A;  3ZQI A;  1IAW A;  1ETV A;  3NWT A;  3VYS B;  1TT5 B;  1EH7 A;  1IJW C;  1OCC H;  3KP6 A;  2VT2 A;  3B73 A;  1UJ8 A;  3LMM A;  4V2F A;  2KIF A;  3GFI A;  3KYC B;  5JLW A;  2KIM A;  5IT3 A;  3A02 A;  2KKO A;  1KU3 A;  2BXZ A;  4WX9 A;  1WGX A;  3M3Y J;  1D1C A;  1V5F A;  1W7P B;  1QHG A;  2FJ1 A;  3PIO F;  2R7Q A;  2V6E A;  1BBY A;  4BKX A;  2P6T A;  2MW8 A;  4DZJ A;  1AOY A;  1SAN A;  1T6S A;  5E1W A;  3CC4 I;  2ZNY A;  4CO8 A;  2PMZ A;  3DLA A;  3I3L A;  3IAM 2;  2L9R A;  1WI3 A;  4A3J J;  2LYC A;  2VT3 A;  3HPH A;  1BN5 A;  1ZQ3 P;  1FP2 A;  4L5J A;  3ASO H;  4LOC A;  4AD9 A;  4UNO A;  1U5T C;  3M1C A;  1G3Y A;  2F6C A;  1N25 A;  1S8N A;  4LG0 A;  2JUC A;  2W57 A;  2KPM A;  1OQY A;  2M45 A;  2GXB A;  2O5R A;  1T98 A;  2CUE A;  4ANJ A;  5KNL A;  4XIC A;  1SFX A;  3JW4 A;  2YX7 A;  3TMO A;  2ELK A;  2RVC A;  4WXC A;  3TOA A;  2D2W A;  3QYF A;  3WTV C;  1JKR C;  2ZJQ F;  1NTC A;  1SVL A;  2W85 A;  1SVO A;  2DPU A;  2ESH A;  1LNW A;  2XPV A;  2AXL A;  3KP2 A;  2R5Z A;  2EFW A;  3KCC A;  4JBA A;  2JVG A;  4XRS G;  3CP2 A;  3V8J A;  1Z3X A;  2WAD A;  3FWE A;  3J81 Z;  2KL4 A;  4A3G J;  5GAE J;  3EQL F;  4BU2 A;  3OYF A;  3SZG A;  4EVI A;  3CCU I;  4LB6 B;  4XLF A;  4CA0 A;  2E1M B;  3B6C A;  2CV1 A;  3AG2 H;  3JRH A;  3FBN B;  4HX8 A;  1O3Q A;  4AU7 A;  1TQP A;  2WA0 A;  5J4V A;  3H5N A;  1OJL A;  2P81 A;  3R4K A;  2QSH X;  3U1K A;  2R4G A;  3A03 A;  5IPA A;  1B8I A;  3V4G A;  1JKQ C;  4PGG A;  1VQM I;  2MBF A;  5DM7 F;  2BY0 A;  2QCO A;  5LEK A;  2K9S A;  3GEZ A;  1Z7L A;  2RGV A;  1GDT A;  3OIP A;  1EV7 A;  4L0Z B;  3PQK A;  4IQJ A;  1TZL A;  4HF2 A;  3CMM A;  2V9V A;  2YR2 A;  1U2W A;  3DEW A;  5D8L B;  1TP4 A;  4C3J J;  2RDP A;  2W48 A;  4ETS A;  2R5Y A;  1GHC A;  3E6B A;  4DIQ A;  3CCV I;  4I01 A;  3V8K A;  1OLT A;  3OR1 C;  2DPD A;  4HW0 A;  1LE8 B;  2CYY A;  3BT9 A;  4HOB A;  1FYK A;  1MZB A;  1I50 J;  3BR0 A;  1X1A A;  4EV0 A;  3GBG A;  2KRC A;  5K7H A;  1E3O C;  1GV2 A;  3GZN B;  3WG7 H;  3ZQ7 A;  1VQN I;  2A5W A;  5F64 A;  3WG9 A;  3I4M J;  4O6J A;  5DEQ A;  5LRS A;  3TL4 X;  3WTY C;  1CF7 A;  1KU2 A;  1XMA A;  5CQG A;  4R1H A;  1U5T B;  2K5C A;  3FF5 A;  4OAY A;  2R93 J;  2AQF A;  2RNJ A;  3F8N A;  4HQM A;  1ZR4 A;  5E1X A;  2PI0 A;  1ZHF A;  4H4K C;  3VYT B;  2QBY A;  1ZRE A;  1O7F A;  4CYD A;  5ICE A;  2CV0 A;  5FLM J;  2NAZ A;  2IAI A;  3PSI A;  1RRJ A;  4XRM A;  2I5U A;  5CVR A;  3CCE I;  2XAS A;  3HXL A;  1VFC A;  2EFN A;  5JR3 A;  3DTK A;  2UXN A;  2HPM A;  1ERD A;  4U0V A;  1UST A;  5EZH A;  4A3B J;  1ONV A;  2DK8 A;  1RNL A;  2GOX B;  4XOR A;  5J3L A;  4QWQ A;  2H6C A;  1J7K A;  2DJI A;  2GIZ A;  1F36 A;  3AG4 H;  4DYC A;  3DEE A;  4L9T A;  3ZMV A;  3WHC A;  2E2J J;  5EG0 A;  1B9M A;  2LH9 A;  2Z1D A;  5J4Y A;  1PP8 F;  3HSF A;  5GAH J;  5J1Y A;  2BHZ A;  2HVS A;  1SD5 A;  4Z6Y A;  2NXN B;  5FD5 A;  1G6N A;  3S17 J;  2JK3 A;  4GYG A;  3S32 A;  5DM6 F;  2ZSI B;  2FOK A;  4MHG A;  2DFH A;  1FP1 D;  3OYL A;  4M6Y A;  3W2A A;  1RZ4 A;  5IT9 Z;  1KU9 A;  1E2X A;  2GM4 A;  2CQ7 A;  4EEF G;  3JCU C;  5C4J J;  4IQ4 A;  6PAX A;  1ZG5 A;  3I64 A;  2FQ4 A;  2DMP A;  1BW6 A;  2E7W A;  3TO7 A;  2K9N A;  3AKZ A;  1FX7 A;  1WHU A;  5L3B A;  2H09 A;  1O3T A;  3QP5 A;  2NNN A;  2PQ8 A;  1A04 A;  2GQQ A;  3LSM A;  4BQQ A;  2MC3 A;  4IJA A;  3SEQ A;  2OV7 A;  1E3P A;  3FXU A;  4U0W A;  3UR3 C;  2W7N A;  3DEU A;  3IH2 A;  4HSR A;  1IDZ A;  4BH9 A;  5KAI C;  3LAJ A;  1MNM C;  1S7E A;  1IRZ A;  2FA5 A;  3WTU C;  2HXI A;  4RB3 C;  2E1C A;  1B72 A;  3KPH A;  3LST A;  4A3L J;  4EM2 A;  2OF7 A;  3M8J A;  1VQ9 I;  2HKX A;  3GX4 X;  3CDI A;  4G7Z F;  3RCO A;  4AYB N;  4YRV A;  2GIV A;  3G6E I;  1TQI A;  1SC7 A;  4M9S A;  4KIC A;  2HEO A;  3RKX A;  1XGO A;  1FTZ A;  1OYI A;  1P9Q C;  1CGP A;  4BXX J;  4KNY A;  4E7I A;  2X6X A;  2M34 A;  3TDU C;  3WTW C;  1FPQ A;  2V1X A;  1IRF A;  2BVL A;  1EH8 A;  2VN2 A;  4XM3 A;  3CD6 I;  5LGU A;  2Y9Z A;  2JWT A;  4AWX B;  5HLI A;  4Q4Z F;  2MC4 A;  3LOC A;  4HA8 A;  2R7W A;  4F7Z A;  4KDP A;  2M8E A;  2XGX A;  3W6J B;  4OMY A;  5F6F A;  1XGM A;  3MVP A;  1ETO A;  3QYB A;  3HHG A;  1YQA A;  3HOX J;  2FEZ A;  2DOF A;  3SXY A;  4F93 B;  3SJM A;  1T0F C;  1QA6 A;  1A6I A;  1NG6 A;  3DU5 A;  2OZU A;  4A3D J;  2NVU B;  4BBS J;  1MJB A;  1CF7 B;  2P7C B;  1WJA A;  3BG6 A;  3FXO A;  4IHX A;  4A93 J;  1YIT I;  1JUP A;  4XR6 A;  5AIQ A;  3CUQ C;  4EAT A;  4B43 A;  3RYP A;  5HLT A;  1BR4 A;  5FO5 A;  3GF2 A;  1MBE A;  4KIT B;  1TW3 A;  2E36 A;  1AHD P;  5A2Q Z;  5ED4 A;  5BMZ A;  2RRE A;  1BC8 C;  2K9M A;  3DKY A;  1HW1 A;  1MDM A;  2F5E A;  2V1N A;  1UAA A;  5LLQ A;  2DYS H;  1ETY A;  2Y0M A;  5DCF A;  1X58 A;  1U78 A;  2LVS A;  4F92 B;  4FQG A;  4RAG A;  2W24 A;  2Y30 A;  3H9G A;  1IW7 F;  1A35 A;  5HOD A;  3E6C C;  2H1K A;  2BY2 A;  2HQR A;  3IP4 B;  5EG0 B;  3S2H J;  3C1D A;  1YOV B;  4HRI A;  1BOA A;  2X9D A;  5FJ8 J;  3HRU A;  5IOY A;  1S5L C;  2M3A A;  1AKH A;  3S1Q J;  2X4H A;  5L3F A;  2IW5 A;  5EEA A;  1DDN A;  1R9T J;  4BNC A;  2W84 A;  3BTJ A;  5IY5 H;  4IOA F;  1JI8 A;  4EGY A;  3K70 D;  4ZYG A;  1QGP A;  3HIF A;  5FKL A;  4NBQ A;  2XF5 A;  1NHA A;  5E3M A;  1U9O A;  1QRY A;  1Y0N A;  1E0E A;  1UG0 A;  1O57 A;  1RET A;  2V4J C;  1YRN B;  1MW7 A;  1Z1D A;  3OSG A;  4KN4 X;  1U3E M;  5IT9 K;  3W3C A;  5F27 A;  3OYG A;  2H8W A;  4XQF A;  1I1G A;  2WAQ A;  3QAH A;  5J8F A;  2RQQ A;  5EYR A;  2CQN A;  3DWL E;  4HEA 2;  4UB8 C;  5FGM A;  4QPQ A;  2ADU A;  2B7E A;  1IC8 A;  3AFH A;  4A69 C;  1RR8 C;  4RM3 A;  2MD0 A;  3BR2 A;  3ECH A;  3HKZ A;  3K0L A;  2QA4 I;  2BY1 A;  3UKG A;  2FE3 A;  3K4J A;  2EV5 A;  3MFK A;  1EJ9 A;  4XOP A;  2ZSH B;  2FSW A;  2HOS A;  1BA5 A;  2EIN H;  2QQ9 A;  3H35 A;  4HAM A;  3SEZ A;  4U7D A;  3HEF A;  2HZD A;  3RYR A;  3BTL A;  3C3W A;  1IG7 A;  2OAZ A;  2MGQ A;  2L02 A;  4AVP A;  3QWL A;  4YFN F;  2VJ5 A;  4C9Y A;  5E17 F;  4LIU A;  2LBF B;  1PP7 U;  3RI4 A;  2IT0 A;  3HRT A;  3CUQ B;  4BL0 B;  1Y56 A;  4ZZL A;  3IWZ A;  4AID A;  1YX5 A;  4XL9 A;  2E1O A;  3MAJ A;  3KX2 A;  2FF4 A;  2A68 F;  1JT6 A;  1FZP B;  1TTY A;  4D5C A;  5DUI A;  3E7L A;  2HDD A;  1PYV A;  3ZQH A;  4KFC A;  4UV8 A;  1WJC A;  1ETQ A;  2PLY A;  4A2U A;  5HVQ C;  3HRS A;  2DFE A;  1O3R A;  4UY8 I;  1X1D A;  1K78 B;  1U0J A;  5E3N A;  2DQL A;  1D0Z A;  5LHG A;  1QVT A;  5D4S A;  1U6G A;  3VYU B;  2LK2 A;  2XUB A;  3E5Q A;  2CQQ A;  3P9C A;  1KU7 A;  4CZC A;  2CSO A;  2A07 F;  4ESB A;  4XKV A;  1XN7 A;  1J2X A;  4JP0 A;  4DQ2 A;  1YS7 A;  3LA2 A;  4A3M J;  2AO9 A;  4A0X A;  4ZDP A;  3FHZ A;  3PNT A;  3KIO A;  5F0H A;  2AHQ A;  1S9H A;  2ZKZ A;  3DBR B;  5FRN A;  3V8L A;  5L3C A;  2BHY A;  2M5W A;  2P4W A;  3LQR A;  2ZME C;  2CUJ A;  2Q2E A;  1QZY A;  3CLQ A;  2QSG X;  5GPC A;  1A36 A;  3VFZ A;  1HA8 A;  2IS4 A;  2VQG A;  3ZGK A;  2VI6 A;  5F1J A;  2I10 A;  4XK4 A;  2BZT A;  4A5N A;  4U88 A;  1MBG A;  1YJN I;  1DU0 A;  1S7O A;  3S93 A;  5AON A;  3TP3 A;  5M5W J;  2MA3 A;  2OPT A;  1Y39 A;  1Y1W J;  4P55 A;  5HLH A;  2VIX A;  4X0G A;  2NS0 A;  1OIS A;  5JLX A;  2HYJ A;  2PMZ N;  3F8F A;  1MKM A;  1YW9 A;  1VZ0 A;  1W7P A;  1FNN A;  1B4A A;  1IXS B;  1KQ0 A;  5KCM A;  3OSF A;  3OYJ A;  1XD7 A;  2LMD A;  4EM0 B;  2COB A;  2EFO A;  1BL0 A;  5AIP A;  3T1B A;  4OIP F;  4I76 A;  3MKZ A;  4PFO A;  1EH6 A;  4ZTF A;  3SFZ A;  3WGI A;  5GAD J;  2VBW A;  4YII A;  5B66 C;  3MEX A;  5KVR A;  4D7N A;  2DAO A;  3ABL H;  4IHW A;  3JRF A;  2E1N A;  1VQO I;  1XDU A;  2KIQ A;  3DKW A;  3AG1 H;  2G9W A;  5D5U B;  4E7L A;  2WTE A;  2EWN A;  2KP6 A;  3TED A;  2M8G X;  2WAF A;  2A69 F;  3T8R A;  3QRF F;  3HB9 A;  2Z9O A;  1NH3 A;  3TQN A;  3B6A A;  1P7I A;  3VWB A;  2Q8K A;  2KRH A;  5K5R A;  2EZI A;  5K5O A;  1J9I A;  4MTD A;  2IA0 A;  2XF7 A;  2R7F A;  3LSG A;  1OFC X;  3BPV A;  4IX7 A;  1V4R A;  2QGU A;  3BZ6 A;  4A3I J;  3WTZ A;  5IYC J;  5E3L A;  2DU9 A;  1NK2 P;  1MNE A;  4LFU A;  4XON A;  1QNT A;  1X1P A;  2NVQ J;  1J59 A;  1FBU A;  2CFX A;  2IGN A;  3BCB A;  4MQV A;  1X3Z B;  3HOY J;  2WY7 Q;  4G8X A;  2XSD C;  2F5D A;  2WBM A;  4A6E A;  1TNS A;  2RQP A;  3Q5F A;  3Q9S A;  2K27 A;  2M4K A;  4EQQ A;  2D1V A;  1FY7 A;  2NOG A;  2IA1 A;  3WE2 A;  3ZR8 X;  3KP3 A;  5JVG F;  1YIJ I;  5HS8 A;  2DTZ A;  1D3Y A;  2DFI A;  3K4M A;  4XID A;  1I27 A;  1OCO H;  2LR8 A;  3HRM A;  1OCR H;  2KJB A;  5IP7 J;  2HTJ A;  4C3H J;  1XTA A;  3GWZ A;  5LBQ A;  1W1W E;  1F1Z A;  2Y48 A;  2ZME B;  2OZ6 A;  4YFX F;  2XVC A;  1K83 J;  4EMS A;  1JUM A;  3ECO A;  3M7G A;  1TQM A;  1KON A;  4PSW A;  2CW8 A;  3ELK A;  3JRE A;  2DA2 A;  3H9J A;  1LDK B;  3LA3 A;  1R4M B;  2L3D A;  1REP C;  1OYY A;  3VOD A;  2ZXH A;  4KIS A;  4J01 A;  3BWG A;  4N4O B;  3BJO A;  3U2R A;  2QM3 A;  4A0Z A;  1Z9C A;  3A01 B;  3RPQ A;  5L3D A;  2ELJ A;  1ETX A;  2QVO A;  2CFO A;  4I0B A;  3ZXS A;  1T38 A;  2ZB9 A;  1X1C A;  2HU9 A;  1BJA A;  2P7V B;  3I0T A;  3NRV A;  3PNY A;  1BC7 C;  1A5J A;  1BM9 A;  5KK1 A;  1K6Y A;  1D8K A;  2XAF A;  2KFD A;  3IH3 A;  2ZJP F;  3LL7 A;  3C2G A;  3JRC A;  3H36 A;  5IYD J;  4BBR J; 
#chains in the Genus database with same CATH homology
 1U5T A;  4OOI A;  4UHT A;  4ZZD A;  4HDU A;  1B9N A;  3ROU A;  4O5V A;  5JHU A;  4CZZ A;  2LDU A;  2Z99 A;  5FB2 A;  1YW8 A;  4L18 B;  4RB1 A;  1GXQ A;  4LMY A;  1LQ1 A;  4GO1 A;  3CO6 C;  5ICG A;  2J5O A;  2QYO A;  4BQA A;  4MGR A;  1QO0 D;  2JT1 A;  4HLX A;  1W4M A;  1ZH5 A;  3I4P A;  3W6K B;  3QPT A;  4OMZ A;  4RB2 C;  2RC4 A;  5FFX A;  1OPC A;  1LEA A;  1FWZ A;  5D5V B;  1F9N A;  1RIO H;  2UWM A;  3HUG A;  3BP8 A;  1O7L A;  2ZXJ A;  2QQB A;  4G6D A;  3JTH A;  1XSV A;  4RAY A;  1PDN C;  2GWR A;  1L3L A;  2HWV A;  2MLG A;  3KZZ A;  1P4A A;  2PFB A;  2STW A;  3DF8 A;  1Z05 A;  4NHJ A;  1F4K A;  3ZN0 A;  4LK1 F;  1K6O A;  4LGW A;  3H92 A;  2ZCW A;  2JPC A;  1JHF A;  1JHH A;  5JVT A;  5K5Q A;  3QOP A;  1YFH A;  3R6S A;  4K2E A;  1ZYR F;  5TJJ A;  1YG2 A;  1J0R A;  1FT9 A;  5HOO A;  1L0O C;  1Z6R A;  3JTG A;  5LEJ A;  2HYF A;  4CXF A;  4G6Q A;  4Q5S F;  4XRF A;  2K7L A;  3BOQ A;  4UVA A;  1WRJ A;  4KIF A;  5L3E A;  3F23 A;  4RB0 A;  1DP7 P;  3NEU A;  3VB2 A;  2KIU A;  3V7S A;  4KIG A;  2EJR A;  4AIH A;  3LQQ A;  2L4A A;  3G3Z A;  2IP2 A;  1LVA A;  3DFG A;  1YS6 A;  2L01 A;  4EJU A;  3RDI A;  2CW0 F;  3U9G A;  4EJT A;  3IKV A;  4JK1 X;  4N9I A;  3MQ0 A;  4EJO A;  3J7A O;  3TGN A;  2PBI A;  1ULY A;  2MLK A;  2ZNZ A;  2XHK A;  2Z5U A;  3I59 B;  3C18 A;  5FD6 A;  1HW2 A;  4HF1 A;  2ISY A;  4IVN A;  1TNT A;  2EA4 A;  3F21 A;  1D8J A;  3P7N A;  3GVA A;  4ZYH A;  2RN7 A;  1WSU A;  4I02 A;  2M30 A;  3EYY A;  2O0Y A;  1Y0U A;  1UHM A;  3I71 A;  1B6A A;  5E18 F;  3F72 A;  2CG4 A;  2TDX A;  4UVB A;  4MQ9 F;  5JI6 A;  1IXR C;  3ULQ B;  5K1Y A;  2HFH A;  1C0W A;  2VXZ A;  3FMS A;  3KEQ A;  1QZZ A;  1KQ9 A;  3V7C A;  3SHF A;  4E70 A;  2BEO A;  4R79 A;  3R60 A;  2K86 A;  5CVU A;  1KYW A;  1T0F A;  2EV6 A;  1BIB A;  4WXH A;  5HS9 A;  2IRF G;  4G94 A;  1WKM A;  4N0B A;  5H20 A;  3CUQ A;  4O3M A;  2JPB A;  5L3G A;  1R58 A;  4XSX F;  4GYI A;  3JSP A;  1IZ1 A;  3O3K A;  4YG2 F;  5EEH A;  1YIO A;  5TRD A;  4IXA A;  2ZFW A;  4LD5 A;  3I54 A;  3IC7 A;  1JE8 A;  5FLX K;  1HST A;  2VBX A;  1K78 A;  2VON A;  3WGH A;  1FOK A;  1S29 A;  3FM3 A;  3LA7 A;  1G3S A;  4OIR F;  3B02 A;  1KYZ A;  3D0S A;  4UXN A;  3BJ6 A;  4HYE A;  1JXS A;  3GXO A;  2BV6 A;  3QU6 A;  1I6X A;  3BRO A;  3WU0 A;  3QP6 A;  1LEB A;  4ON0 A;  1K79 A;  3GFJ A;  3KLN A;  2P8T A;  2XRO A;  1SMT A;  1ZGA A;  1UHW A;  4KMU X;  5LHH A;  3K2Z A;  3KP4 A;  3F8B A;  4I98 B;  3L7W A;  1GVJ A;  2FQ3 A;  5J8C A;  3AAF A;  1GXP A;  4RAZ A;  4XBF A;  4OIO F;  2X0L A;  3F8M A;  3F3X A;  2D45 A;  1HKT A;  4D0P A;  3K1N A;  4UVC A;  2F5F A;  2VOP A;  4KA4 A;  1OMI A;  5ICF A;  3HYI A;  4G7O F;  3ABT A;  4M9Z A;  2V79 A;  4HQE A;  3QU3 A;  1OKR A;  4EGZ A;  1RI7 A;  4UV9 A;  4P9F A;  1VTN C;  3QPH A;  5ERI A;  4PGH A;  3K9T A;  4BXU A;  2FRH A;  2LNB A;  1ZAO A;  3IKT A;  2J5P A;  2YX4 A;  2ELH A;  3MWM A;  2Y75 A;  1R1V A;  1S6L A;  2P5L C;  1YTY A;  3ZMU A;  2DTR A;  3OOP A;  1XGS A;  1FSE A;  3BDD A;  4N9H A;  3E5X A;  2ZME A;  2A5Y B;  4LB5 A;  3CTA A;  2R3S A;  2A61 A;  4R8H A;  2OQR A;  3N4M A;  3L09 A;  5BPD A;  4OU0 A;  1SD7 A;  3CO7 C;  3N97 A;  1V3F A;  3IHU A;  4Y17 A;  2VBY A;  2D1H A;  2BBY A;  1TW2 A;  5DCM A;  4L9J A;  5HLG A;  5CVJ A;  4KN7 X;  1ZRD A;  5BPI A;  3REO A;  2GXG A;  1FLI A;  2HTS A;  2HGC A;  2VOD A;  3DPL C;  2CO5 A;  1Z6T A;  1HKQ A;  1FBS A;  4HV6 A;  3VOE A;  1ZRC A;  1HBX G;  5H6R A;  1P92 A;  3MCZ A;  1JGS A;  4QLC U;  2F2E A;  3I53 A;  4M6X A;  2GA1 A;  3KET A;  3Q9V A;  1HSJ A;  3FMR A;  2G7U A;  3ERE D;  3FZV A;  2YPR A;  3ZMT A;  5LHI A;  5D6F A;  3HOT A;  4MNU A;  2ZO4 A;  2BGC A;  1HW5 A;  3WE3 A;  1X3U A;  2VE9 A;  3BJA A;  1SFU A;  1YW7 A;  2STT A;  3ZPL A;  2ISZ A;  3ZMZ A;  2R7D A;  5LGT A;  3T0Y A;  3F6V A;  4PZJ A;  2FBI A;  4EJW A;  4KMF A;  3RTR A;  4ENM A;  4CHU A;  5J6X A;  2H94 A;  4M74 A;  2NNY A;  1WQ2 A;  2PJP A;  3E6D A;  3HTU A;  3I5U A;  1W5S A;  2FML A;  2A3S A;  2V1D A;  2XAQ A;  1ZN2 A;  2VE8 A;  1W7P D;  2OBP A;  4ZYE A;  3E6M A;  3LFK A;  1AWC A;  1MJ9 A;  5EEG A;  1IN4 A;  1MJA A;  1WI9 A;  2PMU A;  5HS7 A;  1T39 A;  4WF2 A;  3ML6 A;  1S3J A;  4KYW A;  2A6E F;  3CUO A;  5D4R A;  2F5C A;  3OV8 A;  5F1R A;  2C6Y A;  2ZBK A;  5DCM B;  4L5I A;  1PUE E;  2QUF A;  2ZJ2 A;  1XSX A;  3SZP A;  3WTT C;  2CWE A;  3FMQ A;  4BYY A;  1FYM A;  2ETH A;  3COA C;  1R7J A;  1OR7 A;  2QLZ A;  4S05 A;  1RUN A;  3MZY A;  4LJZ F;  1BI3 A;  3P9K A;  3RPU A;  5HDG A;  3GUD A;  1IUY A;  5ILU A;  2MD5 A;  1SAX A;  2FNP A;  1ZGJ A;  2VC1 A;  3I59 A;  5E8I A;  2K4J A;  5ILS A;  2IJL A;  4ESJ A;  2KJC A;  2PN6 A;  2P6S A;  3FXR A;  3DV8 A;  3EYI A;  4G9Y A;  2FXA A;  1S7A A;  3IRR A;  4EJV A;  1IN6 A;  1RUO A;  2DW4 A;  2HR3 A;  4G7H F;  1K7A A;  3RJP A;  1MGT A;  2IPQ X;  1R00 A;  1I1S A;  2WC2 A;  3GO5 A;  2HOE A;  2LSO A;  5CVI A;  2GA2 A;  4MEX F;  3R61 A;  3M1E A;  2EFQ A;  5DD4 A;  4HLY A;  1OYW A;  1I5Z A;  3RIR A;  5DDG A;  2Z33 A;  2RKH A;  3KE2 A;  3FM5 A;  2M87 A;  1ZRF A;  4IRH A;  4PCQ A;  2GAU A;  4MTE A;  2IA2 A;  3T8T A;  2ESN A;  3WTX C;  2NYX A;  2O61 A;  1ZAR A;  2PMH A;  2MH2 A;  2XKO A;  3TO6 A;  3GZ6 A;  1BI0 A;  3F8C A;  2P5V A;  3CDH A;  2DO7 A;  3H3U A;  5FLX Z;  3M9A A;  4WWC A;  3WU1 B;  4CGZ A;  3GZ5 A;  1IF1 A;  5DD8 A;  4B8X A;  4Y15 A;  3ZMS A;  4NB5 A;  2LF8 A;  5BOX A;  2YU3 A;  3TOB A;  4PDK A;  3TDZ C;  4KIB A;  4IPA A;  3H3Z A;  1R22 A;  1Z7U A;  3DPT A;  3JAM K;  3IRQ A;  1ODD A;  2QQA A;  3KFW X;  3DQV C;  2DK5 A;  4Q47 A;  1R5H A;  2IVM A;  4UUV A;  3R0J A;  2LF7 A;  3TKY A;  1H9G A;  1HKS A;  1UCR A;  3BPX A;  4KUM A;  4LLL A;  2O6G E;  4ZYD A;  2JRT A;  1D5V A;  4P9U A;  4RS8 A;  2DT5 A;  2HKO A;  4FX4 A;  3JSO A;  2EA2 A;  2FU4 A;  4A6D A;  3CLO A;  3HOS A;  4BHB A;  2WV0 A;  4KT5 C;  4H0E A;  3BY6 A;  5H6Q A;  4Z2Y A;  3ISP A;  1HQC A;  4WCG A;  4Y13 A;  1G4D A;  1YYV A;  2PEX A;  3FXQ A;  1R5G A;  3WOD F;  1IN5 A;  2DLL A;  5HDK A;  3HHH A;  2DI3 A;  2XAG A;  4LG0 B;  1ZG1 A;  2H6B A;  4OIQ F;  1MD0 A;  5BQT A;  1HXD A;  4I7H A;  1QPM A;  1ZLK A;  2COM A;  4L9N A;  2YSR A;  1UFM A;  2V1U A;  4A0Y A;  1FC3 A;  2O8X A;  3J81 K;  1BI2 A;  4XLP F;  4WK8 F;  3F22 A;  2JTV A;  3KZY A;  3D5L A;  1TLH B;  1IXC A;  1KQ8 A;  1XSD A;  3SQN A;  2BE5 F;  4GCV A;  2FMY A;  4XLN F;  4EM1 A;  1H0M A;  3IL2 A;  3GW2 A;  3K1M A;  2QEN A;  3J80 Z;  4YFK F;  2M1B A;  1XCV A;  3LAP A;  2QWW A;  5D6E A;  4P96 A;  4I0A A;  2Z3Y A;  1UB9 A;  5BS6 A;  1ZLJ A;  2OA4 A;  5D8K B;  4HX7 A;  3GYH X;  5E8G A;  4AIK A;  4LK0 F;  4ENK A;  2XIG A;  4IHT A;  3ZP5 A;  3P9I A;  2VC0 A;  4RGX A;  3RKW A;  4IF4 A;  1FBQ A;  1R23 A;  1YLF A;  2QBY B;  2OQG A;  1FYL A;  2B0L A;  4NQW A;  1QQI A;  4P5O A;  3ZMD A;  4IRG A;  3MZH A;  4HBL A;  4RGR A;  3G73 A;  1DPU A;  3KP5 A;  1IN8 A;  5D5X B;  3TO9 A;  4L9V A;  2V6C A;  3PFI A;  1XMK A;  4M9X A;  2KRF A;  1E17 A;  5DUK A;  5D5W B;  4FX0 A;  2PG4 A;  1XGN A;  4BHP A;  4FHT A;  1B59 A;  4HX4 A;  2BYV E;  5ILV A;  4BAY A;  1DPR A;  1P2F A;  1IN7 A;  3L00 A;  2AS5 F;  3R0A A;  4XSZ F;  2HQN A;  1SD6 A;  4BHC A;  2JSC A;  3PQJ A;  3RKY A;  4U0Y A;  2CGP A;  2DQR A;  4GGG A;  4HV5 A;  1STZ A;  4M72 A;  5DV5 A;  3WGG A;  4MEY F;  2XRN A;  1F5T A;  4IRI A;  2XAJ A;  1R1T A;  4OIN F;  3GFM A;  4ESF A;  1XCB A;  1KGS A;  4Q48 A;  4HDV A;  1ZG3 A;  1G3T A;  3GLX A;  3DP7 A;  2P5K A;  2H27 A;  1TBX A;  3VEP A;  4CIC A;  3E3V A;  4S04 A;  3ABU A;  2RV8 A;  1BI1 A;  3WTS C;  2HYG D;  3HTS B;  4ENJ A;  3J80 K;  2L54 A;  4CDG A;  3S2W A;  2VOO A;  2UZK A;  3SZT A;  4YIF A;  4AIJ A;  3F6O A;  5LRR A;  3EUH A;  1DUX C;  1YO5 C;  3O2P E;  4B09 A;  3HSE A;  1SMY F;  2FBH A;  2ACJ A;  4RGU A;  2XKP A;  4FT8 A;  3T5X A;  5CVV A;  1T2K A;  4LLN A;  2VBZ A;  2MH9 A;  1WWX A;  2L4M A;  4M71 A;  1SFE A;  3NQO A;  3K69 A;  4HZF A;  1MDM B;  5A2Q K;  2LKP A;  3E5U A;  3EET A;  2E7X A;  2EK5 A;  4GXO A;  1ON2 A;  5LGN A;  4LLG F;  5CJ9 A;  2G7H A;  2K02 A;  1U8R A;  2XAH A;  4RGS A;  2XV4 S;  4M73 A;  1R1U A;  2EV0 A;  3HSR A;  1LDD A;  3V7R A;  2HS5 A;  4ASN A;  2K4B A;  1KA8 A;  2EFP A;  5CLS A;  1FSH A;  1LDJ A;  2Q0O A;  4A5M A;  4U7B A;  1P4X A;  3I58 A;  3M8E A;  2UXX A;  1XB4 A;  2O3F A;  2OD5 A;  1LB2 A;  5HDN A;  3LWF A;  5E20 A;  1SD4 A;  3KEO A;  4ENN A;  4A12 A;  1J5Y A;  3IWF A;  4L0Y B;  2FNA A;  2GZW A;  3FX3 A;  3K1P A;  1Q1H A;  1J75 A;  2DBB A;  2A6H F;  1USS A;  2HZT A;  3ZN1 A;  4JQF A;  2HDC A;  3CJN A;  5DYM A;  3KP7 A;  1BIA A;  4TV7 A;  2CQK A;  2O03 A;  2WWY A;  5ICC A;  1H9T A;  5CYV A;  2OU2 A;  2W25 A;  5E1Z B;  2QZ8 A;  1XDS A;  1R36 A;  3O6B B;  2FBK A;  5JFR A;  5FFZ A;  3JAM Z;  1G3W A;  4DNC A;  1Z91 A;  3E97 A;  3GFL A;  3KLO A;  4ZH4 F;  1QBJ A;  3EDP A;  3DXJ F;  2JZY A;  4HF0 A;  1IRG A;  1ON1 A;  1P4W A;  1W5T A;  1O3S A;  4I09 A;  4WXD A;  2EB7 A;  3L9F A;  4I2O A;  1P6R A;  3M8F A;  1B1B A;  3C7J A;  1LJ9 A;  3L2C A;  4IHS A;  1IAW A;  1EH7 A;  3KP6 A;  2VT2 A;  3B73 A;  2KIF A;  3GFI A;  2KIM A;  5IT3 A;  2KKO A;  1KU3 A;  4WX9 A;  1W7P B;  1BBY A;  2P6T A;  1AOY A;  1T6S A;  5E1W A;  2ZNY A;  4CO8 A;  2VT3 A;  1BN5 A;  1FP2 A;  4L5J A;  4AD9 A;  4UNO A;  1U5T C;  1G3Y A;  1S8N A;  4LG0 A;  2W57 A;  2M45 A;  2GXB A;  1T98 A;  1SFX A;  3JW4 A;  2YX7 A;  2RVC A;  4WXC A;  3TOA A;  2D2W A;  3WTV C;  2W85 A;  2DPU A;  2ESH A;  1LNW A;  2AXL A;  3KP2 A;  2EFW A;  3KCC A;  4JBA A;  3V8J A;  3FWE A;  3J81 Z;  3EQL F;  4EVI A;  4LB6 B;  4HX8 A;  1O3Q A;  1TQP A;  3R4K A;  3V4G A;  4PGG A;  2MBF A;  5LEK A;  3GEZ A;  2RGV A;  1EV7 A;  4L0Z B;  3PQK A;  4HF2 A;  2V9V A;  2YR2 A;  1U2W A;  5D8L B;  4ETS A;  2RDP A;  1GHC A;  3E6B A;  4I01 A;  3V8K A;  2DPD A;  4HW0 A;  2CYY A;  4HOB A;  1FYK A;  1MZB A;  4EV0 A;  3ZQ7 A;  5F64 A;  3WG9 A;  4O6J A;  5DEQ A;  5LRS A;  3WTY C;  1CF7 A;  1KU2 A;  1XMA A;  4R1H A;  1U5T B;  3FF5 A;  2RNJ A;  3F8N A;  4HQM A;  2PI0 A;  5E1X A;  1ZHF A;  2QBY A;  1ZRE A;  1O7F A;  4CYD A;  5ICE A;  2NAZ A;  5CVR A;  2XAS A;  2EFN A;  5JR3 A;  2UXN A;  4U0V A;  1UST A;  1ONV A;  2DK8 A;  1RNL A;  4QWQ A;  2H6C A;  1J7K A;  4L9T A;  3ZMV A;  1B9M A;  1PP8 F;  3HSF A;  1SD5 A;  5FD5 A;  1G6N A;  4GYG A;  2FOK A;  4MHG A;  1FP1 D;  4M6Y A;  1RZ4 A;  5IT9 Z;  1KU9 A;  1E2X A;  6PAX A;  1ZG5 A;  3I64 A;  2E7W A;  3TO7 A;  1FX7 A;  5L3B A;  2H09 A;  1O3T A;  3QP5 A;  2NNN A;  2PQ8 A;  1A04 A;  2GQQ A;  2MC3 A;  4IJA A;  3FXU A;  4U0W A;  3DEU A;  4BH9 A;  3LAJ A;  2FA5 A;  3WTU C;  4RB3 C;  2E1C A;  3LST A;  4EM2 A;  2HKX A;  3GX4 X;  4G7Z F;  2GIV A;  1TQI A;  4M9S A;  4KIC A;  2HEO A;  3RKX A;  1XGO A;  1OYI A;  1CGP A;  4KNY A;  3TDU C;  3WTW C;  1FPQ A;  2V1X A;  1IRF A;  1EH8 A;  2VN2 A;  5LGU A;  4AWX B;  5HLI A;  4Q4Z F;  4HA8 A;  4F7Z A;  4KDP A;  2M8E A;  2XGX A;  3W6J B;  4OMY A;  5F6F A;  1XGM A;  3HHG A;  1YQA A;  2FEZ A;  3SXY A;  2OZU A;  1MJB A;  1CF7 B;  2P7C B;  5AIQ A;  3CUQ C;  3RYP A;  5FO5 A;  3GF2 A;  1TW3 A;  5A2Q Z;  5ED4 A;  1BC8 C;  1MDM A;  1HW1 A;  2F5E A;  5LLQ A;  2Y0M A;  5DCF A;  1U78 A;  2W24 A;  1IW7 F;  3E6C C;  2HQR A;  3C1D A;  1BOA A;  3HRU A;  2X4H A;  5L3F A;  2IW5 A;  1DDN A;  4BNC A;  2W84 A;  4EGY A;  4ZYG A;  1QGP A;  3HIF A;  1NHA A;  1O57 A;  1Z1D A;  4KN4 X;  1U3E M;  5IT9 K;  1I1G A;  3QAH A;  5J8F A;  5FGM A;  2ADU A;  3ECH A;  3K0L A;  2FE3 A;  3MFK A;  2EV5 A;  2FSW A;  2QQ9 A;  4HAM A;  4U7D A;  3RYR A;  3C3W A;  2OAZ A;  4YFN F;  2L02 A;  4AVP A;  5E17 F;  1PP7 U;  3RI4 A;  2IT0 A;  3HRT A;  3CUQ B;  4ZZL A;  3IWZ A;  3MAJ A;  2FF4 A;  2A68 F;  1FZP B;  1TTY A;  5DUI A;  4KFC A;  4UV8 A;  2PLY A;  4A2U A;  5HVQ C;  3HRS A;  1O3R A;  1K78 B;  2DQL A;  5LHG A;  5D4S A;  1U6G A;  2XUB A;  3E5Q A;  3P9C A;  1KU7 A;  2CSO A;  2A07 F;  4ESB A;  1XN7 A;  1J2X A;  4DQ2 A;  1YS7 A;  3LA2 A;  4A0X A;  3FHZ A;  2ZKZ A;  3V8L A;  5L3C A;  2M5W A;  2P4W A;  3LQR A;  2Q2E A;  1QZY A;  3VFZ A;  4A5N A;  4U88 A;  1S7O A;  5AON A;  2MA3 A;  4P55 A;  5HLH A;  2NS0 A;  3F8F A;  1YW9 A;  1MKM A;  1W7P A;  1FNN A;  1B4A A;  1IXS B;  1KQ0 A;  1XD7 A;  4EM0 B;  2EFO A;  5AIP A;  3T1B A;  4OIP F;  1EH6 A;  3SFZ A;  3WGI A;  2VBW A;  4YII A;  3MEX A;  5KVR A;  2DAO A;  2E1N A;  1XDU A;  3DKW A;  2G9W A;  5D5U B;  2EWN A;  2WTE A;  3QRF F;  3T8R A;  2A69 F;  2Z9O A;  3TQN A;  1J9I A;  2Q8K A;  5K5R A;  5K5O A;  4MTD A;  2IA0 A;  2R7F A;  3BPV A;  1V4R A;  3BZ6 A;  3WTZ A;  2DU9 A;  4LFU A;  1QNT A;  1J59 A;  1FBU A;  2CFX A;  4MQV A;  4G8X A;  2F5D A;  4A6E A;  1TNS A;  2RQP A;  3Q5F A;  3Q9S A;  2K27 A;  4EQQ A;  2D1V A;  1FY7 A;  2IA1 A;  3WE2 A;  3KP3 A;  5HS8 A;  1D3Y A;  2DFI A;  1I27 A;  3HRM A;  2KJB A;  2HTJ A;  3GWZ A;  5LBQ A;  1F1Z A;  2Y48 A;  2ZME B;  2OZ6 A;  4YFX F;  2XVC A;  4EMS A;  3ECO A;  3M7G A;  1TQM A;  3ELK A;  3LA3 A;  1LDK B;  2L3D A;  1REP C;  1OYY A;  3VOD A;  3BWG A;  3BJO A;  3U2R A;  2QM3 A;  4A0Z A;  1Z9C A;  3RPQ A;  5L3D A;  2QVO A;  4I0B A;  1T38 A;  3I0T A;  1BJA A;  2P7V B;  3NRV A;  1BC7 C;  1BM9 A;  5KK1 A;  1D8K A;  2XAF A;  5BMZ A;  3U1D A;  2NRA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...