1S7OA

Crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYPHDEYLQEKISILTSIDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM
publication title Structure of the putative DNA-binding protein SP_1288 from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m3
molecule tags Structural genomics, unknown function
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7oA00
2RV8A 1FT9A 2RN7A 3CUQB 1QZZA 1F4KA 1V4RA 2HQRA 4PZJA 3W6KB 5FFZA 4ZZDA 5D5XB 1RUNA 1FBSA 2A07F 3AAFA 2IJLA 2FMLA 5LRRA 3JW4A 2YU3A 1ZHFA 2DPUA 1XD7A 1U5TA 5D8KB 3E5XA 2PQ8A 1IXRC 4OU0A 3J81K 2DO7A 1MJAA 2QQBA 2EA4A 4HLYA 1Z9CA 2ZJ2A 1XGNA 1HKSA 4ENNA 3RYPA 2PBIA 4UXNA 5BPDA 2RDPA 4IVNA 3I5UA 5KK1A 1ZH5A 1YG2A 3ZN0A 3K1PA 3WTVC 3QP6A 2WTEA 5E20A 1XN7A 3FXUA 2QZ8A 4O3MA 2MLKA 4IRGA 4RB0A 3MCZA 4UHTA 2K27A 3GFIA 2L3DA 5FFXA 2PEXA 5DCMA 1J7KA 2JSCA 2TDXA 1LJ9A 2R7DA 1G3TA 1ZG3A 2A6EF 5K5OA 2Y75A 3FWEA 5CYVA 2K86A 2D1HA 1USSA 1J0RA 1H0MA 3CUQC 4YFXF 1ON2A 2FA5A 3GVAA 4G6QA 3B73A 1GHCA 2ZCWA 3ABTA 4RB3C 3BP8A 4M72A 2CWEA 1TTYA 4XLPF 1QBJA 1GXQA 1IN8A 3ZMDA 2R7FA 3Q9VA 1BN5A 1RNLA 3IWZA 4O6JA 4CYDA 4OIPF 2IVMA 4PCQA 3ZN1A 1K78B 2P6SA 4A6EA 1JXSA 1OYWA 2RNJA 1TBXA 2YSRA 3W6JB 2ISZA 1TW2A 2FE3A 2XVCA 2WV0A 1BOAA 1HW5A 3L09A 3F8BA 1U3EM 3CTAA 3J80K 2YPRA 5FD6A 2EJRA 2D2WA 4LLNA 5H20A 4BH9A 5EEHA 5A2QZ 1LDDA 3M7GA 3ECHA 2XGXA 3SXYA 4I0AA 3P9CA 1OYIA 3RPUA 5LHGA 3TO6A 1D3YA 4ESFA 4ZZLA 2Z5UA 3BY6A 4LG0A 4EM0B 4M9XA 4NHJA 1F9NA 1Z7UA 2IA0A 3K1MA 3C18A 1LDJA 5BOXA 3VB2A 1TNTA 5HVQC 1U5TB 3FXRA 5F6FA 5DDGA 1BJAA 1KU3A 2EFPA 2VT2A 2XV4S 4L9TA 2ZFWA 3EUHA 3DXJF 1CF7A 2IW5A 1MD0A 2DU9A 5IT3A 3F22A 1QO0D 3KP6A 2X0LA 4KICA 2FXAA 3DKWA 2P7CB 1R5GA 1RZ4A 3V7RA 1QZYA 3KZZA 4M9ZA 5BMZA 2V79A 1C0WA 5DCMB 1MZBA 4UNOA 3WG9A 5F1RA 2HGCA 4MEYF 5FLXZ 2Y48A 3COAC 2O0YA 4I98B 3I53A 3WTWC 3O3KA 4I02A 3M8EA 4HLXA 2H6CA 3G73A 2C6YA 2F5DA 3ROUA 1I5ZA 2VE9A 3QU6A 2OD5A 5DYMA 4KN7X 1ONVA 2D45A 1IZ1A 3CO7C 1E2XA 3KEOA 4Q48A 4ETSA 2FEZA 2NAZA 1JGSA 1L0OC 1WI9A 2VOPA 1U5TC 3FM5A 2VONA 3EYYA 2W24A 4U0YA 3ELKA 3K0LA 3TO9A 4FX4A 3T1BA 3P9KA 3R61A 2V9VA 1AOYA 1KYZA 1SMTA 3RDIA 3WGHA 1Z6RA 3T8TA 4I2OA 1F5TA 1T98A 3F8FA 1WRJA 3GLXA 4HF0A 1BIBA 2W25A 1ZG5A 5ILSA 3LAJA 3SHFA 4HA8A 2OZ6A 3J81Z 5TJJA 3NRVA 1ULYA 2LF8A 1P4AA 2E1NA 4R79A 4EM1A 3HRTA 5CLSA 1FLIA 5J8FA 4OMYA 1XSVA 3R6SA 2EV5A 2QENA 2HKOA 4YIFA 2KRFA 3I71A 4LG0B 5D5UB 5E17F 2AXLA 1Y0UA 4GXOA 5DD8A 1Z91A 3KLNA 2ZNZA 3HOSA 1T0FA 4Y17A 3WODF 1IN6A 2K02A 3U2RA 4JQFA 1BIAA 1P4XA 2GAUA 1FYMA 3I0TA 1Z1DA 3B02A 1ZLKA 2Z99A 1TQMA 1MJBA 2KKOA 5K1YA 4N0BA 1D8KA 1RIOH 3KLOA 4CO8A 1FY7A 1S7OA 1SD6A 1ZGAA 3C7JA 4EJTA 1XDSA 3WTYC 3HTSB 5LGUA 2FRHA 5L3CA 1XSXA 1JHFA 2V1UA 3P9IA 3LFKA 1FWZA 4CICA 4YIIA 2ETHA 2L02A 4XSZF 2DPDA 1U78A 3TQNA 1KU7A 1XB4A 1KU2A 2HS5A 5JR3A 1U2WA 4GO1A 2EA2A 2HTJA 3BPXA 4UV8A 4HF1A 3ZP5A 2M45A 2DBBA 4OINF 4HQEA 3VFZA 3EETA 1HQCA 2L01A 1YS6A 2QBYA 3J7AO 1QQIA 1B9MA 2XAQA 2KIUA 2OA4A 4ENJA 4AVPA 3J80Z 1UHMA 4F7ZA 2ZBKA 2QLZA 3GW2A 3DP7A 4IPAA 1FYLA 2HYGD 5D8LB 3SZTA 1U8RA 1KA8A 2HYFA 2RGVA 3I4PA 4EVIA 1O3QA 3HOTA 2OZUA 5JFRA 4IJAA 4M6XA 4LK1F 2M30A 2HOEA 4XLNF 3LAPA 4HBLA 1XGSA 1UCRA 4LFUA 2OBPA 2GIVA 2LF7A 2FU4A 4MTEA 4LJZF 3QU3A 4CXFA 4L5IA 2XUBA 2DK8A 2FQ3A 5HDGA 2FBKA 2CGPA 2VXZA 2DFIA 2UZKA 3KEQA 3Q5FA 2ACJA 4IRIA 3L9FA 3IL2A 4RGXA 4BAYA 4Y15A 2VT3A 5HS7A 2KJCA 1B4AA 1WKMA 1XSDA 4A0YA 4LD5A 1KGSA 4M73A 4FT8A 3DEUA 3HRSA 1ZLJA 1LB2A 1F1ZA 3RPQA 2ESNA 3RIRA 2XKOA 3IC7A 3VOEA 1I1GA 3F8MA 1Z6TA 4GYIA 3HIFA 3KZYA 3MQ0A 1R22A 4L0YB 1S8NA 2NYXA 2ZKZA 4IXAA 2H27A 1EH7A 3O6BB 5LGTA 3WE2A 3BROA 1IN7A 3FHZA 2K7LA 3L7WA 5D6FA 3IHUA 3CDHA 4P9UA 1NHAA 2KIMA 3U9GA 2FSWA 3WTSC 4P9FA 4EGYA 5FGMA 2ADUA 3E97A 2HWVA 1IN4A 4HF2A 2QQ9A 2NNNA 4IRHA 2GZWA 2EK5A 5ED4A 2BYVE 1BI0A 1OYYA 1HSJA 4MGRA 1BI3A 3P7NA 2ZMEA 5DD4A 2KJBA 3DV8A 2QVOA 1HBXG 2VBYA 1R5HA 1I1SA 5LHHA 4HDUA 2BBYA 2O61A 4O5VA 2Q0OA 4EGZA 1IRGA 3HRMA 3QP5A 5E8IA 1R1UA 1HW1A 4EMSA 3FXQA 1FBQA 2QBYB 2A3SA 1W7PA 1P4WA 2ZNYA 3HHGA 2DAOA 4FHTA 5K5QA 2O03A 2O3FA 3O2PE 3MAJA 3ULQB 2VBWA 4G9YA 1USTA 3QPHA 3TO7A 3IWFA 2P8TA 4XSXF 4LLGF 2DTRA 1TLHB 1O7LA 3QOPA 4M71A 1MDMA 5CVUA 4WXHA 5CVIA 2CO5A 3RKWA 3MEXA 2VN2A 3F72A 3REOA 2XHKA 5J6XA 4HZFA 3M8FA 1R00A 4UV9A 4WF2A 4HQMA 4I0BA 4U0WA 3C1DA 4RS8A 4M6YA 1SD7A 4OMZA 5FD5A 4PDKA 3RKYA 3RI4A 2F5EA 2XROA 4A0ZA 1YW9A 1TQIA 1IUYA 4P96A 1G3SA 2GA1A 1LQ1A 1ZN2A 2ESHA 4ASNA 1Z05A 3SQNA 5JHUA 1QNTA 2EV0A 3ML6A 1IF1A 2NNYA 1R36A 5BS6A 2O6GE 3R0AA 1UHWA 1L3LA 4KIBA 3E6BA 5CJ9A 2XAJA 2UXXA 1I6XA 1J5YA 3NQOA 1O57A 2EFWA 2EB7A 4KMFA 2CYYA 2E1CA 2XAFA 4LK0F 2IT0A 4ENMA 3U1DA 2E7XA 3KCCA 4MNUA 4RGRA 1K7AA 2EWNA 1OKRA 3DQVC 3F6VA 4PGHA 2VOOA 2IRFG 2BV6A 3ZPLA 3GUDA 5IT9K 3GEZA 2CQKA 4BHBA 2A61A 4L5JA 4ON0A 3QRFF 2VBXA 4I7HA 5F64A 3CLOA 1T6SA 3T0YA 4S05A 1SD4A 1FSHA 3BJOA 4EM2A 1FBUA 1J75A 2HTSA 4D0PA 2F5CA 4EJWA 3WTXC 1R7JA 4UUVA 1ZARA 3F3XA 4MQ9F 4EJOA 1EH6A 2L4MA 2LKPA 4RAYA 2MBFA 4ZYEA 4JK1X 4KIFA 1HKQA 3V8JA 1EH8A 2FBIA 4HX7A 4P5OA 4R1HA 4LLLA 1R1TA 3H92A 4CGZA 1W7PB 4RGUA 1U6GA 1D5VA 3BJAA 2L4AA 3RJPA 2EFNA 4AWXB 2G9WA 4ENKA 4KMUX 3LQQA 3TOAA 3V7CA 2DK5A 1HW2A 2P5KA 5HDNA 4PGGA 2M1BA 2JTVA 3MWMA 3T8RA 2FNPA 1MDMB 5L3DA 1KQ0A 1SD5A 3KP3A 3LQRA 1HSTA 3GXOA 3M9AA 2E7WA 3QAHA 4WK8F 1LVAA 3HSEA 1DPRA 1W7PD 2Z33A 2VODA 2BEOA 2A6HF 2L54A 2K4BA 4I09A 1EV7A 1FZPB 3D5LA 1QPMA 5HLHA 3WGGA 1YLFA 3WE3A 3CJNA 2CG4A 2M5WA 4EV0A 3KP4A 4UVAA 1B1BA 3JSOA 1P92A 5E1XA 1MJ9A 4RB1A 4MQVA 3JAMK 1CF7B 3WTZA 2DI3A 2Q8KA 2WWYA 3IKVA 1T2KA 3V7SA 2CFXA 3H3UA 2PFBA 2PI0A 4Y13A 2DLLA 3GX4X 4BQAA 1YS7A 4HV5A 1BI2A 5AONA 3E5UA 4Q47A 5LEKA 1T38A 4CDGA 2LSOA 3E3VA 1FX7A 5D4SA 5ICEA 4BNCA 2GXGA 4FX0A 2FNAA 2P4WA 5H6QA 4BXUA 1TNSA 2PN6A 1P2FA 3V8LA 2IP2A 4A5NA 2PMUA 5BPIA 3KE2A 4AIKA 4L9NA 4IHSA 4E70A 1TQPA 1BBYA 1SFUA 5DV5A 3GFMA 1GVJA 3M1EA 1IAWA 3KP2A 3E6MA 2STWA 1J2XA 3BPVA 4GYGA 1YYVA 1CGPA 1XGOA 4HYEA 1DPUA 1JE8A 3R60A 4ESBA 2B0LA 1K6OA 2WC2A 3MZYA 2HEOA 4BHCA 4G7OF 1PP8F 5LRSA 3F6OA 4M74A 2VC0A 4L9VA 1ZYRF 1KQ9A 2MC3A 3ERED 1B9NA 1BM9A 3F8CA 3FM3A 1UFMA 2M8EA 2QM3A 4Z2YA 2HKXA 1SFXA 3E5QA 3K69A 2K4JA 3WU1B 1P6RA 1XCVA 5HOOA 4CZZA 2GWRA 3FMSA 4B09A 1FP2A 2W57A 3RTRA 4ZYHA 2DQLA 4YFKF 3GZ6A 2UXNA 3KFWX 1S6LA 2P7VB 4U7BA 3BOQA 2DQRA 4MEXF 2V1XA 3GWZA 3PFIA 4ZYGA 5HDKA 2BE5F 2IA1A 3K9TA 3DF8A 2PJPA 1IXSB 5KVRA 5ERIA 4A6DA 4HW0A 2LDUA 4JBAA 3F21A 2H09A 2XKPA 1O3SA 4MTDA 1BC7C 1ODDA 4WX9A 4ZYDA 2QWWA 3LWFA 3GF2A 4A0XA 3IRRA 3ZMSA 3LA2A 4G6DA 3H3ZA 5HLGA 4KFCA 4LB5A 3WTTC 1WQ2A 2QQAA 3FMRA 1DP7P 2QUFA 5AIPA 2V1DA 2J5PA 1R58A 3GFLA 3R0JA 4KYWA 5HLIA 3F23A 1PDNC 4HV6A 4RGSA 1OR7A 4HDVA 2A5YB 5K5RA 2JT1A 3D0SA 3DPTA 2HZTA 5CVRA 3ABUA 1XDUA 4XRFA 2MA3A 3HUGA 1G6NA 3WTUC 3HRUA 3G3ZA 3FF5A 1YQAA 1YIOA 5E18F 1YO5C 1ZGJA 4R8HA 3MZHA 3EYIA 4U88A 5IT9Z 1ZG1A 1V3FA 5ICFA 1G3WA 1DUXC 2P6TA 5BQTA 2FBHA 1FC3A 1UB9A 5DUIA 2EFQA 4Q4ZF 4KT5C 2YR2A 2UWMA 1J59A 1SAXA 3KP7A 1TW3A 1RI7A 4KUMA 5HS8A 2IPQX 2LNBA 4TV7A 1KQ8A 5D4RA 2PLYA 3N4MA 1B59A 3LA7A 4RAZA 3OOPA 4I01A 3V8KA 4WCGA 3FMQA 5ICGA 5D5WB 4AIJA 3L2CA 1X3UA 4G8XA 2YX7A 1ZRDA 2XRNA 3QPTA 3BZ6A 4ZH4F 4L9JA 5CVVA 3BJ6A 2HDCA 2DW4A 5L3EA 1XMAA 3CO6C 3K1NA 1BC8C 2XAHA 5DCFA 4WXCA 5HS9A 3ZMUA 2W84A 1HKTA 2R3SA 2A69F 3PQJA 2RVCA 4BHPA 1DDNA 3OV8A 2RC4A 2FMYA 3JSPA 1O3RA 3T5XA 3SZPA 2A68F 2W85A 3ZMVA 5E1ZB 3SFZA 1E17A 2J5OA 3Q9SA 1YFHA 1FYKA 4WXDA 1IN5A 2Z3YA 2F5FA 2G7UA 3GO5A 4NB5A 1STZA 4G7HF 2EFOA 3BDDA 3TGNA 2STTA 2YX4A 2OQGA 4U0VA 4KA4A 3KETA 2P5LC 4CHUA 1W4MA 3TOBA 1VTNC 4OIOF 4RB2C 1SMYF 1YW8A 3JAMZ 1IRFA 3E6DA 2OQRA 1S29A 4N9IA 1I27A 1FPQA 4U7DA 1FOKA 1J9IA 4NQWA 1H9TA 3DPLC 1K79A 2Y0MA 4AD9A 3LSTA 4EJVA 2JRTA 4OIQF 3FX3A 1O3TA 5L3BA 1MGTA 3EDPA 4UVCA 3I59A 1S7AA 3IRQA 2QYOA 3WGIA 2ISYA 1O7FA 4DNCA 1HXDA 1S3JA 2O8XA 3I58A 1ZRCA 1SFEA 2MH2A 2KIFA 4OOIA 1AWCA 2JPBA 4G94A 4LMYA 3WU0A 5TRDA 4EJUA 4UVBA 1IW7F 5DEQA 4L18B 3JTHA 3L00A 1G3YA 3GFJA 2HQNA 4BYYA 2GQQA 3R4KA 2M87A 1RUOA 1ZRFA 5LHIA 2VC1A 5AIQA 1T39A 1XCBA 2RQPA 4DQ2A 1PP7U 3HSFA 3VODA 5H6RA 2ZMEB 4KIGA 4KDPA 2XIGA 3I54A 2PG4A 3JTGA 4ESJA 1JHHA 4XBFA 4GCVA 3IKTA 3CUOA 5D6EA 4EQQA 2HR3A 4S04A 4A2UA 3K2ZA 1W5TA 3CUQA 1ON1A 2IA2A 1OPCA 3FZVA 2NS0A 1GXPA 2GXBA 1QGPA 1W5SA 3TKYA 3ZMTA 2XAGA 5FB2A 5JI6A 3GZ5A 2Q2EA 5LGNA 1KU9A 2OAZA 2ZO4A 1FNNA 3GYHX 4IHTA 2JPCA 4N9HA 4YG2F 5L3GA 4HAMA 3TDUC 4HOBA 1YTYA 2XASA 5JVTA 4M9SA 4KN4X 2MH9A 5ILVA 5A2QK 3HSRA 1IXCA 2V6CA 4A12A 5DUKA 3HTUA 3LA3A 3N97A 4WWCA 2FF4A 6PAXA 5EEGA 1WWXA 3ISPA 5ILUA 3I64A 4Q5SF 5ICCA 4AIHA 1KYWA 4YFNF 3RKXA 4QWQA 3ZQ7A 4HX8A 1G4DA 1ZAOA 3MFKA 1LNWA 5CVJA 2RKHA 2COMA 5L3FA 1BI1A 3ECOA 1XGMA 2CSOA 2HFHA 2NRAC 1Q1HA 5LBQA 3S2WA 3HHHA 1LEBA 1XMKA 3I59B 2H94A 4P55A 2PMHA 2P5VA 5J8CA 3C3WA 4H0EA 2VBZA 3RYRA 2JZYA 5E1WA 2AS5F 3V4GA 4LB6B 4OIRF 3NEUA 2ELHA 1WSUA 1FSEA 2OU2A 1LEAA 2BGCA 4L0ZB 5FLXK 4IF4A 2G7HA 1A04A 4HX4A 4G7ZF 1ZREA 1R1VA 1H9GA 2DT5A 4A5MA 2EV6A 1K78A 2D1VA 4KNYA 1REPC 2FOKA 2MLGA 2GA2A 2CW0F 1LDKB 2H6BA 2X4HA 5FO5A 2F2EA 3PQKA 4MHGA 5E8GA 1YW7A 1PUEE 1R23A 2VE8A 3KP5A 1B6AA 2MD5A 1D8JA 4LGWA 1OMIA 3BWGA 3F8NA 3TDZC 2ZXJA 4K2EA 4QLCU 3HYIA 5LLQA 4GGGA 5LEJA 3ZMZA 3EQLF 5D5VB 1MKMA 3VEPA 2Z9OA 1FP1D 3DFGA 4B8XA 3E6CC
chains in the Genus database with same CATH superfamily
2RV8A 3CCQI 3K10A 1FT9A 1WJCA 3OIPA 2JA8J 2RN7A 3H5RA 1JJ6C 3CUQB 1GV2A 2E1MB 1QZZA 1F4KA 1V4RA 1ETVA 4RDUA 2W48A 3FK6A 3SJMA 2HQRA 5GTHC 4RMNA 4PZJA 1LPQA 3W6KB 5FFZA 5IYDJ 4ZZDA 5D5XB 1RUNA 2BW3B 1VQ4I 3ABLH 1FBSA 4XKBA 2A07F 3AAFA 3S1QJ 1LUJB 3ZQFA 4XIDA 1WJDA 2IJLA 1T95A 2FMLA 2Q2EB 3JW4A 5LRRA 2YU3A 1D0XA 4DJAA 1ZHFA 2DPUA 3TW6A 1XD7A 4A3CJ 1U5TA 5D8KB 3E5XA 2PQ8A 1IXRC 4OU0A 2CMPA 3J81K 2DO7A 5IOYA 1MJAA 3CESA 4G6TB 2QQBA 2EA4A 4HLYA 1Z9CA 2ZJ2A 1XGNA 2ZSHB 1HKSA 4LIVA 4ENNA 3RYPA 2PBIA 4UXNA 4HRIA 3LL7A 3PNYA 2ZJQF 5BPDA 2RDPA 1Z0XA 1WGXA 4IVNA 4HNVA 1XS9A 3I5UA 5KK1A 1ZH5A 3OYKA 3CJTB 1YG2A 3ZN0A 1HOMA 3K1PA 3WTVC 3QP6A 2MW8A 2WTEA 5E20A 3BG3A 1Y8RB 1XN7A 3FXUA 4BGDA 2QZ8A 3SEQA 1QA6A 5IYCJ 4O3MA 2MLKA 4IRGA 4RB0A 3MCZA 4UHTA 2K27A 4HG2A 3GFIA 2L3DA 2L7FP 2L9NA 2DJIA 5FFXA 1YHQI 2LYCA 2VQCA 2PEXA 5DCMA 3HC7A 1J7KA 2JSCA 3RQ4A 2TDXA 1LJ9A 3MVPA 1FEXA 2DA3A 1MH3A 2R7DA 1G3TA 1ZG3A 3VSLA 2JN6A 3AL0B 2A6EF 5K5OA 3CC2I 2HI3A 2Y75A 2IS4A 3FWEA 1KONA 1JUPA 5CYVA 4ZDPA 2K86A 2KHMA 4XORA 2D1HA 3S15J 2JA5J 1USSA 2MC4A 1J0RA 3G1OA 4CSWA 1H0MA 3CUQC 2E1MC 2VQGA 2ME6A 1ZKGA 3J7AY 4YFXF 1ON2A 2FA5A 3GVAA 1LFPA 4G6QA 3B73A 1GHCA 1JKPC 2ZCWA 1D1CA 3PM1A 2OUMA 3ABTA 4PJLA 3JCUC 3BP8A 4M72A 3HEFA 5B1AH 4RB3C 2CWEA 1JKQC 1TTYA 5CQGA 4XLPF 1QBJA 4D7MA 4D7NA 1GXQA 1U8BA 4ZDOA 1IN8A 3ZMDA 1X1AA 2R7FA 3A01A 2LBFB 5FKMA 3Q9VA 4HSRA 1BN5A 5CPRB 1RNLA 3S3MA 3IWZA 4O6JA 4FE7A 4CYDA 4OIPF 3DCFA 2W7NA 2ZJPF 4IX7A 2K9MA 2IVMA 4PCQA 3ZN1A 3M3YJ 1K78B 4JOMA 2P6SA 4A6EA 1JXSA 4MFDA 2P0WA 3ZQGA 1JT0A 4BY1J 3H9QA 2CQXA 1OYWA 1Q1VA 2RNJA 3CF2A 1TBXA 2YSRA 1ZR4A 1A5JA 3W6JB 1TT5B 5LFAA 2ISZA 1YJ9I 1TW2A 2FE3A 2VKHA 3QPSA 1F36A 1MNMC 2XVCA 2WV0A 1X1BA 1BOAA 1HW5A 3KYCB 3L09A 3HOUJ 1OCPA 3F8BA 5JLXA 2IEKA 1U3EM 3CTAA 3J80K 3CZ6A 1MBJA 2OCCH 2YPRA 5FD6A 2DA6A 1Z3XA 3D1NI 3ZRGA 1NK3P 2Z16A 1MH4A 2EJRA 2D2WA 4LLNA 1IJWC 5H20A 3DLLF 4BH9A 4A3IJ 3AL0C 1QVUA 5EEHA 5A2QZ 1VQ6I 1LDDA 3M7GA 3ECHA 1TZLA 2XGXA 1OCTC 5M5XJ 3SXYA 2K5CA 4I0AA 3P9CA 5GADJ 1OYIA 3L2RA 1VFCA 5TISC 1N75A 3RPUA 5LHGA 5EG0A 2K3FA 3TO6A 1ZR2A 1AHDP 1ZK8A 1SVLA 1D3YA 4ESFA 4ZZLA 2Z5UA 3BY6A 1LE8A 1ENHA 4LG0A 4EM0B 1K4SA 4M9XA 4NHJA 2KFDA 1F9NA 1Z7UA 2IA0A 3K1MA 2LOOA 2VXDA 3C18A 3LSKA 2O8KA 2DFHA 3K4KA 1LDJA 2JWTA 5BOXA 1VQ9I 3HL2A 2EILH 1TNTA 3VB2A 4IQJA 2XPUA 5HVQC 4IHYA 1U5TB 3FXRA 3H5NA 5F6FA 5DDGA 2BZTA 1MIJA 1BJAA 2L9RA 2VQLA 1KU3A 1NG7A 1ETYA 2EFPA 2VT2A 4M3EA 3ESWB 2XV4S 2M7AA 4L9TA 3ERMA 2ZFWA 2EIKH 3ZOBA 2CJJA 3EUHA 2COBA 3DXJF 1CF7A 2IW5A 3BQZA 1MD0A 2DU9A 2VKVA 3GTJJ 3PFYA 1RESA 2LFBA 5IT3A 2V6EA 3F22A 2JQ7A 4ANJA 2R7UA 3BR5A 4A3JJ 1QO0D 3KP6A 2X0LA 3S1MJ 4KICA 2FXAA 3DKWA 2P7CB 2GBYA 2ZC2A 1R5GA 1QHHD 1V55H 3ASOH 1AA7A 2NS8A 2I5UA 3ONQA 3S3NA 3K4JA 1RZ4A 1TP4A 5FKKA 3V7RA 1QZYA 3KZZA 3BG7A 1FIPA 3PNTA 4M9ZA 2WAEA 2OF7A 5BMZA 4E7LA 2KT0A 2V79A 2EZLA 4DZJA 1C0WA 5F0FA 5DCMB 1MZBA 4UNOA 3WG9A 5F1RA 5CKTA 2HGCA 4MEYF 1GDTA 1FJLA 5FLXZ 2Y48A 2FQ4A 3H5AA 4FQGA 1NTCA 3COAC 2XGDA 4JX4A 2O0YA 3DTEA 4I98B 3I53A 3WTWC 2XC7A 3O3KA 3SYTA 3KYLA 2GM4A 5F08A 2HNHA 2BVLA 1K83J 2DMNA 4I02A 4IHVA 3M8EA 4BEHA 3G6EI 4IL6C 4B44A 3RQIA 4HLXA 2H6CA 3G73A 4E7SA 2C6YA 2F5DA 1WHUA 3ROUA 5M3FJ 1I5ZA 1I6HJ 2CUZA 2VE9A 3QU6A 2OD5A 5DYMA 4KN7X 1ONVA 1V5EA 2D45A 1QU3A 4A69C 1IZ1A 3CO7C 1BJZA 3IUOA 3OS2A 2HU9A 1E2XA 4CUGA 4E4HA 4BS9A 4XLEA 3C2GA 3KEOA 5GPCA 4Q48A 2DMTA 2FEZA 4MLOA 4ETSA 2NAZA 1JGSA 1L0OC 1WI9A 2VOPA 5JHFA 4BBRJ 1U5TC 1JTYA 3SZGA 3FM5A 2VONA 5M5WJ 3EYYA 2BY2A 4BE0A 1BR2A 3E0JB 2JMWA 2W24A 3A01B 1VQ8I 2HDWA 2LY9A 2LKXA 2E5NA 4U0YA 3ELKA 4D9JA 2FUG2 3S17J 3K0LA 3TO9A 3T1BA 4FX4A 2KISA 2WBMA 3P9KA 2B63J 1SVMA 4DYQA 3R61A 2V9VA 2R7SA 1AOYA 1KYZA 1SMTA 3Q0UA 3RDIA 1OQYA 2F48A 3WGHA 4Y7NJ 1S9HA 1Z6RA 2JVGA 3T8TA 2V9KA 4XOTA 4I2OA 1F5TA 1T98A 2DMUA 3F8FA 1WRJA 4ZJZA 1RC9A 3GLXA 3M8JA 4HF0A 1BIBA 3S2DJ 3PIOF 1Y0NA 4D1QA 4NBQA 1YX3A 3PJRA 2W25A 1ZG5A 4Y4RA 5ILSA 1B72A 2QSGX 3LAJA 3IV5A 3SHFA 4HA8A 5EF6A 3TW7A 2OZ6A 2E5ZA 4CCJA 3J81Z 1OR7C 3HKZN 3H0DA 3AG2H 5TJJA 3NRVA 3X2QH 1DU0A 3TL4X 1ULYA 2WY7Q 1S72I 2LF8A 1P4AA 1VQKI 2E1NA 4AYBN 4BDYA 4R79A 1IC8A 3HOXJ 4EM1A 5K7HA 3HRTA 5CLSA 3BG9A 2ZXHA 1ETXA 1FLIA 5J8FA 4OMYA 1XSVA 3R6SA 3SEZA 2EV5A 2QENA 3I4MJ 2XAUA 5EG0B 1FOXA 2HKOA 4YIFA 1UHSA 3F9KA 3JRAA 4RAFA 2KRFA 1LE8B 1R9TJ 3I71A 4LG0B 1WJEA 4B3AA 3LFUA 1TWFJ 5F1JA 1JI8A 5KNLA 2JA6J 5D5UB 5E17F 1D5YA 1R4MB 2AXLA 1Y0UA 4GXOA 5DD8A 1EA3A 3JREA 1Z91A 3KLNA 2ZNZA 1EJ9A 3HOSA 3U21A 1T0FA 4Y17A 3WODF 4E7KA 1IN6A 2K02A 2LRDA 2NOJB 3I9V2 2X48A 3U2RA 4JQFA 3BTCA 4EATA 1BIAA 4BQNA 3FHNA 1P4XA 4AVZA 4PUSA 4NQWB 2GAUA 1FYMA 4Y52J 3I0TA 1LVKA 2DYRH 3BR2A 3HZJA 4M3BA 3RZDJ 4A3EJ 2K9QA 1Z1DA 2ZB9A 3B02A 1ZLKA 1X58A 3M07A 1I39A 1ZELA 2Z99A 3JRDA 1TQMA 3RPUD 1MJBA 2KKOA 5K1YA 4N0BA 1D8KA 1RIOH 1K61A 1O4XA 3KLOA 4GRIA 4CO8A 2DOFA 1FY7A 1S7OA 1MSEC 1SD6A 1GUUA 1ZGAA 3C7JA 4EJTA 1T08B 1XDSA 3FXJA 3WTYC 2NOGA 3G4SI 3K7AJ 3HTSB 2CUEA 2E34A 1MMSA 1X2MA 2M8GX 1TWCJ 2FRHA 4UB6C 5L3CA 5LGUA 1XSXA 4IOCF 1VQOI 2OJED 2NS7A 1JHFA 3OIOA 2LVSA 1BL0A 1Z3YA 2V1UA 3P9IA 2R7VA 2MG4A 3LFKA 1FWZA 2A5WA 2KIQA 4OAZA 1WFXA 4CICA 4YIIA 2ETHA 2LD5A 2L02A 4XSZF 3D5RC 2DPDA 4J01A 1G2HA 3ZQCA 1U78A 1UG0A 2HPIA 3CCYA 3H1CA 1CQTA 1A6IA 3Q3SA 1GV5A 4CZCA 2R7OA 3TQNA 5J40A 1KU7A 1XB4A 1KU2A 2HS5A 3K4MA 5KAFC 4F92B 1HA8A 5JR3A 2L7KA 1U2WA 4GO1A 4B3XA 2EA2A 2R7XA 2AHQA 5FKOA 2HTJA 3S3OA 4BEHB 3CDIA 3ZQIA 3BPXA 2AQFA 4UV8A 1WJBA 4HF1A 3A02A 3ZP5A 2M45A 2DBBA 4OINF 4F3QA 4D5FA 4HQEA 3VFZA 3EETA 1MBKA 4BUPA 1HQCA 2HVSA 1W0TA 2MD0A 4ITVA 4E7IA 4E7ZA 2L01A 1YS6A 1YRNA 2QBYA 3J7AO 1QQIA 1WJFA 4D5CA 1B9MA 2LTPA 2KIUA 2XAQA 4MFEA 1IRZA 1X19A 2OA4A 4ENJA 4PFPA 4DGWB 3TP0A 4M6VA 4AVPA 4FASD 3J80Z 1UHMA 3Q0VA 4XR6A 4F7ZA 2JJ7A 2ZBKA 1RETA 2QLZA 3GCMA 3S8PA 3GW2A 3DP7A 1ZGWA 4IPAA 2OTJI 1FYLA 2HYGD 5D8LB 3SZTA 1U8RA 2CW8A 2VASA 1KA8A 3EPZA 2HYFA 3ZQQA 3I56I 3M4OJ 2RGVA 3I4PA 4EVIA 3FBNB 1O3QA 5IPAA 3HOTA 3OOUA 2OZUA 4UUSA 4M3DA 5JFRA 3K70C 3AG3H 4IJAA 3GZNB 1LFUP 1RPWA 2L0KA 3CD6I 4M6XA 4LK1F 3HGGA 3EUHC 2LK2A 2M30A 3BG6A 2DN0A 2HOEA 2OPTA 4I6ZA 4XLNF 3LAPA 4HBLA 3QYFA 1XGSA 1HDDC 1UCRA 3FK7A 4LFUA 3H0GJ 2OBPA 5EJCA 3OYNA 2GIVA 3OYGA 2ECBA 2LF7A 2KMUA 2O5RA 2FU4A 4MTEA 2KDOA 4LJZF 3QU3A 5FRNA 4CXFA 4L5IA 2XUBA 2DK8A 2HQ5A 2FQ3A 3VPRA 2BY0A 1SVOA 2HVRA 5HDGA 2FBKA 4XN0A 2V1NA 2CGPA 2VXZA 2GXAA 2DFIA 3SDBA 4KITB 1W36C 2UZKA 2DJNA 3KEQA 3Q5FA 3FKJA 2ACJA 1TWGJ 2HOAA 3BLYA 4OAYA 4IRIA 1Y1VJ 3L9FA 1MSFC 5J1UA 4RGXA 3IL2A 4BAYA 4Y15A 1FOWA 2VT3A 5HS7A 4RA2A 2KJCA 2CV2A 1B4AA 3EUAA 1WKMA 1ETQA 3OYHA 1FIAA 1XSDA 4A0YA 4LD5A 4AYBA 3A03A 1YX5A 5TGTA 2AQEA 2QEXI 3HPGA 1KGSA 4M73A 4FT8A 4B1RA 3DEUA 2F4IA 3HRSA 1ZLJA 3B6CA 3BCAA 1F1ZA 1LB2A 3RPQA 2ESNA 2E2JJ 3DEEA 4ZC3A 2XSDC 2JVHA 3F0CA 3RIRA 1HC8A 2XKOA 4XM3A 4XLFA 1EF4A 2XGCA 3IC7A 3GLLA 3VOEA 2XPWA 2ZJRF 1I1GA 3F8MA 3VDXA 1N78A 2Y9ZA 1Z6TA 3IH4A 4GYIA 3HIFA 3KZYA 3MQ0A 2MYSA 1R22A 2VB6A 1E0EA 2XPVA 4L0YB 1S8NA 1ORKA 4DYRA 1VQMI 2NYXA 2ZKZA 4IXAA 2H27A 1EH7A 2EZKA 3O6BB 5LGTA 1WJAA 3WE2A 3JRGA 4XOPA 3BROA 2NVXJ 3AG4H 1IN7A 4UY8I 3FHZA 1T33A 2K7LA 3L7WA 5D6FA 3IHUA 3CDHA 4P9UA 1V54H 4S0HB 1NHAA 2KIMA 3U9GA 1XMXA 1A6QA 1U9OA 2FSWA 2IBDA 4C3HJ 3WTSC 2HXOA 4P9FA 5FGMA 4EGYA 4DYCA 2LMDA 2ADUA 3E97A 2DA7A 1OFCX 2E2IJ 4FCYA 2HWVA 1IN4A 3DTKA 4HF2A 1ZQ3P 2QQ9A 2NNNA 1Z67A 4IRHA 2QQ8A 2GZWA 2EK5A 5B1BH 5ED4A 2FX0A 2BYVE 1BI0A 1OYYA 3Q0WA 2XB0X 1IV6A 3GTKJ 2Y2ZA 1HSJA 1I50J 1BI3A 3P7NA 4MGRA 4B43A 3I55I 2ZMEA 2G0EA 2LC2A 5DD4A 2DT6A 2ZXIA 2KJBA 2X1EA 2L2OA 3DV8A 5E79C 2QVOA 3CCVI 2WAQN 4XQFA 1PUFA 1HBXG 2VBYA 1R5HA 4U87A 1I1SA 5LHHA 4HDUA 2BBYA 4BE2A 2O61A 2R5ZA 3CCJI 2ELKA 2WA0A 4O5VA 2Q0OA 5IOZA 4EGZA 1GT0C 1IRGA 3HRMA 3QP5A 5E8IA 2NVQJ 3P5JA 1R1UA 1HW1A 1JTXA 3FXQA 4EMSA 2DYSH 1FBQA 1JJ8C 1YRNB 2QBYB 2F6CA 2A3SA 4XRMA 1W7PA 4LG3A 1P4WA 2ZNYA 3HHGA 1IUFA 2WB1N 2DAOA 1NG6A 4FISA 1WCMJ 2QKLB 1XTAA 4FHTA 3SFIA 4PSXA 5K5QA 2O03A 4NNJA 3WG7H 2O3FA 1T0FC 1MMDA 3O2PE 2VI6A 3HBLA 3S93A 3MAJA 3ULQB 2VBWA 4G9YA 1USTA 4QIWN 1QZEA 2D5VA 3QPHA 3TO7A 2KZGA 3IWFA 1BR1A 1Y39A 2P8TA 3CP2A 3HDDA 3HM5A 4UUSB 4XSXF 3HB9A 4LLGF 2DTRA 1TLHB 1O7LA 3QOPA 4M71A 1MDMA 5CVUA 2PX9A 4WXHA 5CVIA 5E3LA 2CO5A 4C2MJ 3RKWA 3MEXA 3CC7I 2M4GA 2VN2A 3F72A 3REOA 2XHKA 5J6XA 1J09A 1EKEA 3FDYA 2R93J 4HZFA 3M8FA 1R00A 3H35A 4UV9A 2L9SA 4LIUA 3OMYA 4HQMA 4WF2A 4I0BA 4U0WA 5J47A 3OYAA 3C1DA 1GLNA 3LSMA 5C44J 4RS8A 4M6YA 2NVYJ 1SD7A 3OSFA 4OMZA 5FD5A 2R92J 2O7OA 4KT6A 4PDKA 4FETA 3GTQJ 3NAUA 1HLVA 3RKYA 2M0MA 2JK3A 3RI4A 3VYRB 2F5EA 5J1RA 4XKWA 2XROA 1FMWA 4A0ZA 2RAEA 4RBOA 1YW9A 2ECCA 2BHYA 1TQIA 2QA4I 2EQRA 1IUYA 4PJJA 4P96A 1G3SA 2FJ1A 4N4NB 4HSTA 2CQ7A 2GA1A 4II3A 1LQ1A 3UKGA 1ZN2A 4E7HA 3HGYA 4DBQA 4C9YA 5GAEJ 3CCLI 1S5LC 2ESHA 4ASNA 3FBIB 1Z05A 1TWAJ 3BQYA 3SQNA 3HXLA 4F93B 5JHUA 1QNTA 2EV0A 2X51A 5J1YA 5FRMA 3ML6A 1HDPA 1IF1A 1A35A 1T56A 4ZTJA 2NNYA 1R36A 2QCOA 2AXTC 1BOBA 5BS6A 5C4JJ 2R7TA 3CC4I 2O6GE 3R0AA 1UHWA 2FOWA 4V19K 4IOAF 1L3LA 4KIBA 3E6BA 4X1EA 5CJ9A 2R7ZJ 2XAJA 1IV8A 2EZIA 3PSIA 1M1EB 2UXXA 3ZR8X 2Z2SB 4B48A 1I6XA 1PYVA 1PVEA 1J5YA 2ID3A 2CQNA 3NQOA 1O57A 2X6YA 3CMMA 3MN2A 2EB7A 4RLQA 4JP0A 2EFWA 2CYYA 4KMFA 2UUZA 2E1CA 2ELJA 2DFEA 2OTLI 2XAFA 2HXIA 3PSFA 2IXSA 2Z1DA 2O9LA 4LK0F 3OYFA 3NARA 2IT0A 4ENMA 4XONA 3U1DA 2DOEA 2DODA 4L5EA 1LKXA 2K40A 2E7XA 2X1DA 3KCCA 4MNUA 3RSNA 5DS9A 1ITYA 4RGRA 3CJRB 2EIJH 3IAM2 1WVRA 1K7AA 2W00A 4BE1A 2EWNA 2XF7A 5FJ8J 2HYJA 2E36A 1OKRA 3RKQA 2DDAA 3DQVC 4XMYA 3F6VA 3DEWA 4PGHA 2VOOA 1SFKA 2IRFG 4HNTA 2BV6A 3ZPLA 3GUDA 4F91B 5IT9K 3GEZA 2CQKA 4BHBA 3BR1A 2A61A 3PO2J 4L5JA 4ON0A 4NC8A 1MBHA 2VBXA 4J00A 3QRFF 4I7HA 5F64A 4A93J 2OC6A 2LY1A 3CLOA 3CDLA 1E3OC 3A4CA 4NDLA 1T6SA 3T0YA 5E3NA 2L5QA 1SD4A 4S05A 1FSHA 3KX2A 3BJOA 4CH7A 4EM2A 4BBSJ 1NK2P 2KZVA 3HG9A 1FBUA 2XSJC 1J75A 2HTSA 4D0PA 2F5CA 4EJWA 2M34A 3WTXC 4QSHA 1R7JA 4UUVA 1ZARA 1PUFB 3F3XA 4MQ9F 4EJOA 1RR7A 1EH6A 3CMEI 2L4MA 2LKPA 4RAYA 2MBFA 5HNFA 1VQPI 4ZYEA 4JK1X 4KIFA 1HKQA 3V8JA 3HOVJ 2M3AA 1EH8A 2FBIA 2R5ZB 4HX7A 4P5OA 4R1HA 3KYDB 2NVUB 2EBIA 3OR1C 3IH3A 2Y9YA 2EIMH 1UMQA 4LLLA 1WPKA 1HCRA 2VJ4A 4V2GA 1R1TA 2IGNA 3H92A 4IHWA 4LOCA 3OR2C 4CGZA 2CRGA 4AM3A 2V26A 2CFOA 1W7PB 4RGUA 1U6GA 2WAQA 1D5VA 1MNDA 3BJAA 2L4AA 3RJPA 2EFNA 4AWXB 2G9WA 2VJIA 4ENKA 4KMUX 3LQQA 3CCRI 3K4CA 3TOAA 2EPFA 2W1OA 2BW3A 3S16J 3OL3A 3V7CA 2DK5A 3BR6A 3L2WA 2I8DA 1HW2A 2JUGA 4XNFA 2P5KA 5EGOA 3C2HA 1MBGA 2E1OA 3QODA 1JKRC 2NVTJ 5HDNA 5F04A 1W1WE 5GAGJ 4CCNA 4PGGA 1DU6A 2M1BA 2JTVA 1WH5A 4YIRX 3MWMA 3G1LA 1BA5A 3T8RA 2FNPA 1MDMB 5L3DA 1T8IA 2E71A 5B3SH 1KQ0A 2K9NA 1IRXA 1D1BA 1MMGA 1N77A 1SD5A 3KP3A 3LQRA 1HSTA 3GXOA 3M9AA 1JKOC 2E7WA 3QAHA 4WK8F 1LVAA 1VQ7I 3WHBA 3HSEA 4MO7A 1DPRA 5CQEA 2HDDA 3FKIJ 1W7PD 3L2QA 3ASNH 2Z33A 2VODA 2BEOA 2A6HF 2DFFA 2L54A 2XF6A 2K4BA 3OS1A 1ETKA 5GAHJ 2R7RA 4I09A 5C3EJ 2DA5A 1EV7A 4QPQA 4P1WA 2R5YA 1FZPB 3D5LA 9ANTA 3KZIC 1QPMA 1IDZA 5HLHA 3WGGA 3LSJA 5KHDA 1YLFA 3WE3A 4I76A 3CJNA 1D1AA 2CG4A 2M5WA 3OYIA 3ZCOA 4EV0A 3KP4A 4UVAA 1B1BA 1ZTRA 2AO9A 2JUCA 1P92A 3JSOA 1AU7A 5E1XA 1MJ9A 4RB1A 4MQVA 3JAMK 1CF7B 1D0ZA 2DI3A 3WTZA 1BW5A 2Q8KA 2WWYA 4A3LJ 3IKVA 1T2KA 1B8IA 4IEJA 3V7SA 4IO9F 2CFXA 3H3UA 2PFBA 2PI0A 5B5EC 2DA2A 2I10A 4CA0A 2HOTA 4Y13A 2DLLA 3GX4X 4B4CA 4BQAA 3ABKH 3AG1H 3ZXSA 1YS7A 3ZQLA 1FOYA 4HV5A 5E3MA 1BI2A 1XX5A 5AONA 3E5UA 3SDGA 3ZGKA 4Q47A 5LEKA 4M3GA 4CDGA 1T38A 1IGNA 1R71A 2LSOA 3E3VA 1FX7A 2DT7B 3O8HA 2B7EA 3CQZJ 2Q1ZB 2HOSA 2VJJA 5D4SA 5ICEA 1G8XA 2CW7A 2K9SA 4BNCA 2GXGA 4FX0A 2FNAA 2P4WA 1JGGA 5H6QA 4BXUA 1TNSA 2PN6A 2W4SA 1P2FA 3VYSB 3V8LA 1Z7LA 2IP2A 4A5NA 1FTTA 2H1KA 2PMUA 3OWTA 2KPMA 5BPIA 4E7JA 4QPOA 3KE2A 3LSIA 4AIKA 4L9NA 4IHSA 1ACIA 3S14J 4E70A 1TQPA 1AKHA 1VI0A 1DGWY 3LNQA 1BBYA 4G12A 4AC0A 2M7BA 1SFUA 5DV5A 1E3HA 1S7EA 3GFMA 1GVJA 3M1EA 2VLAA 1R49A 1IAWA 2GIZA 3RCOA 1DQUA 3KP2A 3VYTB 3PL8A 2QSHX 4BQQA 1Z21A 4BXXJ 3E6MA 5E3OA 2L7ZA 2STWA 1J2XA 4AU7A 3OS0A 3BPVA 4GYGA 1YYVA 2IS1A 1CGPA 1XGOA 4HYEA 2LP0A 2M0CA 2QF7A 1DPUA 1JE8A 3R60A 2XDVA 4ESBA 2B0LA 2QGUA 2PJRA 1N25A 1K6OA 2WC2A 3MZYA 3DKXA 2HEOA 4BHCA 1I3AA 4G7OF 3TEDA 1PP8F 2LKSA 3K4NA 3W6VA 5LRSA 3F6OA 4M74A 2VC0A 5J4YA 4L9VA 1ZYRF 5EZGA 2GOMA 3K2AA 2V9PA 1KQ9A 2MC3A 1K4TA 2W82A 1YJNI 3ERED 1B9NA 2RREA 1BM9A 3OYEA 3CF5F 4BDZA 3F8CA 1K6YA 4IQ4A 2VPLA 2Y69H 3FM3A 1UFMA 2M8EA 2QM3A 4Z2YA 2HKXA 1SFXA 3E5QA 3K69A 2K4JA 2DTZA 5KAIC 3DBLB 2R7WA 3WU1B 1P6RA 3DU5A 1RRJA 1Y6IA 1XCVA 3IH2A 3FXLA 5HOOA 2V4JC 2A05A 4CZZA 2GWRA 2HZDA 3OYJA 3A1YA 1POGA 3FMSA 4B09A 3MKYB 3MD2A 2DXIA 1FP2A 1QVTA 2W57A 3RTRA 2P81A 2DQLA 3DLAA 4YFKF 4ZYHA 5J3LA 4W1UA 3GZ6A 1B72B 2X9DA 2UXNA 3H9GA 1QRYA 3KFWX 1KZHA 1S6LA 2WADA 2P7VB 4AIDA 4U7BA 3BOQA 2IGKA 2MFZA 1VZ0A 3BR0A 2DQRA 3QWLA 3OYLA 3MKLA 4MEXF 1R6RA 2V1XA 4X0GA 3GWZA 3PFIA 5F0CA 2BVMA 2IGMA 4ZYGA 5HDKA 4Y3OA 4A3GJ 2Y0SN 2BE5F 2IA1A 3IAS2 1A31A 3OYMA 3K9TA 3DF8A 4HEA2 2PJPA 1IXSB 5EGOB 5KVRA 3BZKA 4XLCA 3GTGJ 5M3MJ 5ERIA 1OCCH 1V5FA 3CCEI 3S1RJ 4A6DA 4HW0A 2LDUA 4JBAA 3VSKA 4NUBA 3F21A 1W0UA 2H09A 1QPIA 2XKPA 2M2EA 3KPHA 3CCUI 3HKZA 4YEJA 1O3SA 4MTDA 4C2TA 4JX5A 1BC7C 2VQHA 1ODDA 3QPLA 3A0BC 4WX9A 4ZYDA 3KIOA 2QWWA 3LWFA 3GF2A 5GTIC 3G2BA 1WH7A 4A0XA 4Z6YA 3IRRA 2GOXB 1IO2A 1IDYA 3ZMSA 3LA2A 1UG2A 5M5YJ 2DMPA 1OCZH 3L2UA 4G6DA 3QQAA 3H3ZA 2X6OA 2IAIA 5HLGA 4KFCA 4LB5A 3OL4A 1DP3A 3WTTC 1WQ2A 2QQAA 3FMRA 2V7FA 2VJ5A 5HNHA 1DP7P 2QUFA 1H89C 2ZFUA 1FMVA 2JA2A 5AIPA 2V1DA 2R5YB 2J5PA 2K85A 2BXYA 2H1LA 1R58A 5EDNA 3GFLA 3R0JA 1VNDA 4KYWA 2DCEA 5J4VA 3DBHB 4ZYAA 1TT0A 5F0HA 4QTRA 3DKYA 3PIPF 5HLIA 5FLVA 2M9HA 4AUXA 3F23A 1ERDA 4JYKA 1XG1A 3BTLA 5EZHA 1PDNC 4HV6A 1XC5A 2F4MB 2LREA 3IP4B 4RGSA 1OR7A 4BJ5C 4KISA 2VL8A 4XL9A 3GMEA 4HDVA 2A5YB 5K5RA 3OY9A 2JT1A 3D0SA 1B8IB 3D5SC 3G1MA 4RLFA 3DPTA 3QYBA 2HZTA 5CVRA 3ABUA 2KDZA 1XDUA 3QOEA 4XRFA 2MA3A 3HUGA 1TC3C 1G6NA 1SEUA 1X3ZB 3WTUC 5JVGF 4BQOA 3HRUA 3G3ZA 3FF5A 2Y31A 1YQAA 1YIOA 5E18F 1YO5C 3FXOA 1ZGJA 2ICWG 4R8HA 3MZHA 3A2KA 3EYIA 4U88A 5IT9Z 2E2HJ 1ZG1A 1V3FA 3QYEA 2PMZN 5ICFA 4CYCA 2MSYA 1G3WA 1DUXC 3NWTA 2P6TA 4PK4A 2CUJA 5BQTA 2FBHA 5FROA 1QHGA 1FC3A 3L2VA 1UB9A 2H8WA 3S1NJ 2M4KA 2JA7J 5DUIA 2EFQA 4Q4ZF 2BOLA 4KT5C 2YR2A 2UWMA 1J59A 1SAXA 3KP7A 3DTIA 1TW3A 2ZXWH 1YI2I 1RI7A 2X6WA 4KUMA 5HS8A 2IPQX 2KP6A 2LNBA 4NC7A 1MW7A 4TV7A 5D4RA 1KQ8A 1SANA 3BTJA 2PLYA 1AKHB 3GTOJ 1Z77A 3DBRB 1XPXA 3W3CA 3LSGA 3N4MA 1B59A 3H36A 3LA7A 4RAZA 3OOPA 4GDFA 4I01A 3V8KA 4WCGA 1FTZA 3FXKA 3FMQA 5ICGA 3CMAI 5D5WB 5C4XJ 1JUMA 3JRFA 4PFOA 4AIJA 1YOVB 4XICA 3L2CA 1X3UA 1APLC 4G8XA 2YX7A 1ZRDA 3BTIA 2XRNA 2ZSIB 3QPTA 2YU9J 3PO3J 3BZ6A 3CCSI 4ZH4F 2MGQA 1YITI 1MBFA 1PJRA 4BJ6C 2PJRB 2IS6A 2EH3A 4L9JA 1OCOH 5CVVA 2R0QC 3BJ6A 1VQNI 2WAFA 4UUTA 2HDCA 1X2NA 2DW4A 3H9JA 4V2FA 5L3EA 1XMAA 2UV1A 3CO6C 3K1NA 2CV0A 3VWBA 3TBIA 1BC8C 2BY1A 2XAHA 4WXCA 1ETOA 2KRCA 5DCFA 2YS9A 5HS9A 3AFHA 3ZMUA 1ETWA 2W84A 1HKTA 2R3SA 2A69F 4XRSA 1Y1WJ 3HOYJ 1P7IA 2EZHA 3PQJA 2X6XA 1P7JA 2RVCA 5IYBJ 4BHPA 1DDNA 2XGEA 2BHZA 2QKMB 3KEYA 3OV8A 3L1PA 4ZTFA 2DOAA 2OV7A 2RC4A 2FMYA 3JSPA 2K3PA 3T5XA 1O3RA 3JR9A 4BACA 4C30A 3SZPA 4FE4A 2A68F 2W85A 3ZMVA 5E1ZB 3SFZA 2LH9A 1Y8QB 4BJTA 1E3PA 1E17A 2J5OA 3BCBA 1OJLA 3Q9SA 1YFHA 1FYKA 1VQLI 4WXDA 1IN5A 2Z3YA 2F5FA 2G7UA 3GO5A 3A0HC 4NB5A 1BW6A 1STZA 3H3VK 4G7HF 2EFOA 3BDDA 5IY5H 3TGNA 4HNUA 3I4NJ 3BC8A 3LMMA 4CCMA 2STTA 2YX4A 4RM3A 1X3WB 4OWRB 2OQGA 4U0VA 4KA4A 3LSPA 3KETA 2P5LC 4CHUA 4ZDLA 1W4MA 3TOBA 1VTNC 4OIOF 4RB2C 1SMYF 3TP3A 1YW8A 2YUSA 3BG5A 4MIMA 1IRFA 3E6DA 4DIQA 2OQRA 3JAMZ 1X4OA 4IKFA 1S29A 3W2VA 4N9IA 1G59A 4A3FJ 1I27A 1FPQA 4ABZA 4U7DA 5IP6A 1FOKA 1J9IA 4NQWA 1H9TA 4JX6A 2Y0SA 4PJMA 5EYRA 3DPLC 1K79A 2K9LA 2E60A 5IP7J 3S2HJ 2Y0MA 4XLAA 4AD9A 3LSTA 2WY8Q 2L9VA 3B6AA 2CV1A 4EJVA 2JRTA 4OIQF 3FX3A 4A3KJ 1O3TA 5L3BA 5B66C 1MGTA 3EDPA 4UVCA 3I59A 3GTPJ 1S7AA 4H4KC 3IRQA 2QYOA 5F27A 5EEAA 3WGIA 5DM7F 2ISYA 2DA4A 3VYUB 1O7FA 3LOCA 3UR3C 4DNCA 3WHCA 2CUFA 3OYDA 4J19A 1HXDA 5IP9J 3C2BA 1S3JA 2N8GA 2O8XA 3I58A 1ZRCA 1SFEA 2MH2A 2KIFA 4OOIA 2DMQA 1AWCA 2JPBA 4G94A 1UJ8A 2XB5A 5BNGA 4LMYA 2KQRA 3CJQB 1WZ2A 3MKWB 4XK4A 2A6TA 3WU0A 4E6KG 3PUFA 4EJUA 4UVBA 5TRDA 3HOWJ 3GTLJ 1IW7F 3HUGB 1JT6A 5DEQA 3OYBA 5DM6F 4L18B 3GBGA 1X1CA 3JTHA 3LSHA 3L00A 3GTMJ 1G3YA 3CLQA 5JLWA 3GFJA 2HQNA 3K4BA 4BYYA 2GQQA 3U1KA 3R4KA 2M87A 2VUMJ 2QSFX 3JRBA 3G71I 3HOZJ 1RUOA 4M3FA 3J7ZI 1ZRFA 5LHIA 3ZQHA 4IHXA 4CYCB 1RKWA 5FKLA 3BZCA 2VC1A 4PSWA 5AIQA 1T39A 1OLTA 3BT9A 1XCBA 3N05A 4DOZA 5K7FA 2RQPA 2Y30A 4DQ2A 1PP7U 3FXMA 1VQ5I 3HSFA 3VODA 5H6RA 2ZMEB 4EEFG 4KIGA 4KDPA 3E1SA 3CCMI 2H8RA 2XIGA 3I54A 2PG4A 3JTGA 4ESJA 1JHHA 2CU7A 4XN3A 4XBFA 4GCVA 1P9QC 1DGRM 3CUOA 3M1CA 5D6EA 3IKTA 3JRHA 2PMZA 4EQQA 4FTHA 1H8AC 5KCMA 2OCEA 2HR3A 1TWHJ 2NXNB 3BR3A 4XRSG 4BL0B 5H2FC 1UZCA 4I99C 2XRLA 5HLTA 2TCTA 2IS2A 4S04A 2LG4A 4A2UA 5K7ZA 4C2UA 1H88C 3K2ZA 3DPUA 1W5TA 3CUQA 1ON1A 2IA2A 3O8GA 4YELA 1OPCA 3OYCA 3FZVA 1IG7A 5GPAA 2NS0A 4F52A 1GXPA 1OISA 2GXBA 1QGPA 1W5SA 4W97A 1MMNA 2JRMA 3TKYA 2E35A 3ZMTA 2XAGA 5FB2A 5JI6A 1MMAA 1MNEA 3GZ5A 2CS3A 1I3QJ 4CCKA 1X1DA 2Q2EA 5LGNA 2BXZA 4X6AJ 1KU9A 2OAZA 2VIXA 1FNNA 2ZO4A 3GYHX 4IHTA 4CCOA 2JPCA 1X4PA 4N9HA 2X1CA 1JUSA 4YG2F 5L3GA 4HAMA 1WI3A 3TDUC 2WB1A 4BKXA 4HOBA 2FD5A 1YTYA 2XASA 1BR4A 5JVTA 4M9SA 2JSPA 4N4OB 4KN4X 4KJZA 4DZPA 2MH9A 5ILVA 2R4GA 1OCRH 3HJEA 5A2QK 3HSRA 3TMOA 1IXCA 3OSGA 2E19A 1RR8C 1LFBA 2V6CA 4A12A 2EINH 5DUKA 5HODA 3J7YJ 2CH0A 3HTUA 4IZZA 1GVDA 2KL4A 2WV1A 3LA3A 5DTDA 3N97A 4WWCA 2FF4A 6PAXA 5EEGA 2HPMA 1WWXA 2VKDA 2CQQA 2F5VA 3ABMH 3RZOJ 3ISPA 5ILUA 4BY7J 4LITA 4BXFA 1D0YA 3I64A 4Q5SF 5ICCA 4AIHA 1MBEA 1A36A 1TL8A 3W2AA 4DBRA 1KYWA 1UELB 2HQAA 2LY2A 4YFNF 1YJWI 3RKXA 2ZMEC 4QWQA 4CCLA 5FKNA 3K4LA 3ZQ7A 5LD2C 4HX8A 2ME0A 4PJ0C 2RNGA 1G4DA 1ZAOA 3AKZA 2IGOA 3DU6A 3MFKA 1LNWA 5CVJA 2BY3A 3UNGC 2RKHA 4BU2A 2RQQA 4UB8C 4GFBA 2COMA 4F55A 5L3FA 1BI1A 3ECOA 1NH3A 3NWSA 2F4OB 1XGMA 1HF0A 2CSOA 2DDBA 2XF5A 2HFHA 4XKVA 4RM2A 2NRAC 1Q1HA 5LBQA 1Y56A 3S2WA 3HHHA 2B9SA 2KRHA 3HPHA 1LEBA 2MABA 4C3JJ 1XMKA 3I59B 2H94A 4P55A 1W5CC 3K6GA 2PMHA 1R4NB 1WJ5A 2LLKA 4NC6A 3JRCA 2P5VA 2ID6A 1F43A 5J8CA 3C3WA 4A3MJ 4H0EA 2VBZA 3RYRA 2JZYA 3PUBA 5E1WA 4II2A 4PJNA 3OIQA 2AS5F 3S32A 3I3LA 3JRIA 1SFOJ 3V4GA 4LB6B 4OIRF 3NEUA 2ELHA 1WSUA 1FSEA 2TRTA 1R5ID 3FISA 2OU2A 1LEAA 2DA1A 5GP9A 5FLMJ 2BGCA 4L0ZB 3WU2C 5FLXK 2LBFA 4IF4A 2G7HA 3MMYB 4YRVA 1A04A 4HX4A 4G7ZF 3K70D 1ZREA 1R1VA 1U9NA 1H9GA 2R7QA 4C3IJ 3V42A 2DT5A 4A5MA 1YE9A 1V5GA 1VF9A 2L7MP 3LSRA 2EV6A 1K78A 2D1VA 4KNYA 3E7LA 3DWLE 1REPC 2HVQA 2LR8A 2X85A 2FOKA 2MLGA 2GA2A 2CW0F 3MZ8A 4XLHA 1LDKB 2H6BA 2X4HA 3CMYA 5FO5A 1YIJI 2F2EA 3PQKA 1X1PA 4MHGA 4XKCA 5E8GA 4HPQA 1YW7A 1PUEE 4RAGA 3W2WA 1R23A 2VE8A 3KP5A 1B6AA 2MD5A 3MKZA 1UAAA 4A3DJ 1D8JA 4LGWA 3EUKL 4B47A 1RKTA 1OMIA 1SC7A 2GLOA 1SAUA 3BWGA 3F8NA 3TDZC 2ZXJA 2VPRA 4K2EA 3FIWA 3CP8A 4DW6A 4QLCU 1U0JA 3HYIA 5LLQA 4GGGA 5LEJA 1W36D 3PNVA 4Y33A 2KLOA 2VKEA 3ZMZA 3EQLF 5D5VB 1MKMA 4A3BJ 3VEPA 2Z9OA 1FP1D 3DFGA 4B8XA 3E6CC
chains in the Genus database with same CATH topology
2RV8A 1FT9A 2RN7A 3CUQB 1QZZA 1F4KA 1V4RA 2HQRA 4PZJA 3W6KB 5FFZA 4ZZDA 5D5XB 1RUNA 1FBSA 2A07F 3AAFA 2IJLA 2FMLA 5LRRA 3JW4A 2YU3A 1ZHFA 2DPUA 1XD7A 1U5TA 5D8KB 3E5XA 2PQ8A 1IXRC 4OU0A 3J81K 2DO7A 1MJAA 2QQBA 2EA4A 4HLYA 1Z9CA 2ZJ2A 1XGNA 1HKSA 4ENNA 3RYPA 2PBIA 4UXNA 5BPDA 2RDPA 4IVNA 3I5UA 5KK1A 1ZH5A 1YG2A 3ZN0A 3K1PA 3WTVC 3QP6A 2WTEA 5E20A 1XN7A 3FXUA 2QZ8A 4O3MA 2MLKA 4IRGA 4RB0A 3MCZA 4UHTA 2K27A 3GFIA 2L3DA 5FFXA 2PEXA 5DCMA 1J7KA 2JSCA 2TDXA 1LJ9A 2R7DA 1G3TA 1ZG3A 2A6EF 5K5OA 2Y75A 3FWEA 5CYVA 2K86A 2D1HA 1USSA 1J0RA 1H0MA 3CUQC 4YFXF 1ON2A 2FA5A 3GVAA 4G6QA 3B73A 1GHCA 2ZCWA 3ABTA 4RB3C 3BP8A 4M72A 2CWEA 1TTYA 4XLPF 1QBJA 1GXQA 1IN8A 3ZMDA 2R7FA 3Q9VA 1BN5A 1RNLA 3IWZA 4O6JA 4CYDA 4OIPF 2IVMA 4PCQA 3ZN1A 1K78B 2P6SA 4A6EA 1JXSA 1OYWA 2RNJA 1TBXA 2YSRA 3W6JB 2ISZA 1TW2A 2FE3A 2XVCA 2WV0A 1BOAA 1HW5A 3L09A 3F8BA 1U3EM 3CTAA 3J80K 2YPRA 5FD6A 2EJRA 2D2WA 4LLNA 5H20A 4BH9A 5EEHA 5A2QZ 1LDDA 3M7GA 3ECHA 2XGXA 3SXYA 4I0AA 3P9CA 1OYIA 3RPUA 5LHGA 3TO6A 1D3YA 4ESFA 4ZZLA 2Z5UA 3BY6A 4LG0A 4EM0B 4M9XA 4NHJA 1F9NA 1Z7UA 2IA0A 3K1MA 3C18A 1LDJA 5BOXA 3VB2A 1TNTA 5HVQC 1U5TB 3FXRA 5F6FA 5DDGA 1BJAA 1KU3A 2EFPA 2VT2A 2XV4S 4L9TA 2ZFWA 3EUHA 3DXJF 1CF7A 2IW5A 1MD0A 2DU9A 5IT3A 3F22A 1QO0D 3KP6A 2X0LA 4KICA 2FXAA 3DKWA 2P7CB 1R5GA 1RZ4A 3V7RA 1QZYA 3KZZA 4M9ZA 5BMZA 2V79A 1C0WA 5DCMB 1MZBA 4UNOA 3WG9A 5F1RA 2HGCA 4MEYF 5FLXZ 2Y48A 3COAC 2O0YA 4I98B 3I53A 3WTWC 3O3KA 4I02A 3M8EA 4HLXA 2H6CA 3G73A 2C6YA 2F5DA 3ROUA 1I5ZA 2VE9A 3QU6A 2OD5A 5DYMA 4KN7X 1ONVA 2D45A 1IZ1A 3CO7C 1E2XA 3KEOA 4Q48A 4ETSA 2FEZA 2NAZA 1JGSA 1L0OC 1WI9A 2VOPA 1U5TC 3FM5A 2VONA 3EYYA 2W24A 4U0YA 3ELKA 3K0LA 3TO9A 4FX4A 3T1BA 3P9KA 3R61A 2V9VA 1AOYA 1KYZA 1SMTA 3RDIA 3WGHA 1Z6RA 3T8TA 4I2OA 1F5TA 1T98A 3F8FA 1WRJA 3GLXA 4HF0A 1BIBA 2W25A 1ZG5A 5ILSA 3LAJA 3SHFA 4HA8A 2OZ6A 3J81Z 5TJJA 3NRVA 1ULYA 2LF8A 1P4AA 2E1NA 4R79A 4EM1A 3HRTA 5CLSA 1FLIA 5J8FA 4OMYA 1XSVA 3R6SA 2EV5A 2QENA 2HKOA 4YIFA 2KRFA 3I71A 4LG0B 5D5UB 5E17F 2AXLA 1Y0UA 4GXOA 5DD8A 1Z91A 3KLNA 2ZNZA 3HOSA 1T0FA 4Y17A 3WODF 1IN6A 2K02A 3U2RA 4JQFA 1BIAA 1P4XA 2GAUA 1FYMA 3I0TA 1Z1DA 3B02A 1ZLKA 2Z99A 1TQMA 1MJBA 2KKOA 5K1YA 4N0BA 1D8KA 1RIOH 3KLOA 4CO8A 1FY7A 1S7OA 1SD6A 1ZGAA 3C7JA 4EJTA 1XDSA 3WTYC 3HTSB 5LGUA 2FRHA 5L3CA 1XSXA 1JHFA 2V1UA 3P9IA 3LFKA 1FWZA 4CICA 4YIIA 2ETHA 2L02A 4XSZF 2DPDA 1U78A 3TQNA 1KU7A 1XB4A 1KU2A 2HS5A 5JR3A 1U2WA 4GO1A 2EA2A 2HTJA 3BPXA 4UV8A 4HF1A 3ZP5A 2M45A 2DBBA 4OINF 4HQEA 3VFZA 3EETA 1HQCA 2L01A 1YS6A 2QBYA 3J7AO 1QQIA 1B9MA 2XAQA 2KIUA 2OA4A 4ENJA 4AVPA 3J80Z 1UHMA 4F7ZA 2ZBKA 2QLZA 3GW2A 3DP7A 4IPAA 1FYLA 2HYGD 5D8LB 3SZTA 1U8RA 1KA8A 2HYFA 2RGVA 3I4PA 4EVIA 1O3QA 3HOTA 2OZUA 5JFRA 4IJAA 4M6XA 4LK1F 2M30A 2HOEA 4XLNF 3LAPA 4HBLA 1XGSA 1UCRA 4LFUA 2OBPA 2GIVA 2LF7A 2FU4A 4MTEA 4LJZF 3QU3A 4CXFA 4L5IA 2XUBA 2DK8A 2FQ3A 5HDGA 2FBKA 2CGPA 2VXZA 2DFIA 2UZKA 3KEQA 3Q5FA 2ACJA 4IRIA 3L9FA 3IL2A 4RGXA 4BAYA 4Y15A 2VT3A 5HS7A 2KJCA 1B4AA 1WKMA 1XSDA 4A0YA 4LD5A 1KGSA 4M73A 4FT8A 3DEUA 3HRSA 1ZLJA 1LB2A 1F1ZA 3RPQA 2ESNA 3RIRA 2XKOA 3IC7A 3VOEA 1I1GA 3F8MA 1Z6TA 4GYIA 3HIFA 3KZYA 3MQ0A 1R22A 4L0YB 1S8NA 2NYXA 2ZKZA 4IXAA 2H27A 1EH7A 3O6BB 5LGTA 3WE2A 3BROA 1IN7A 3FHZA 2K7LA 3L7WA 5D6FA 3IHUA 3CDHA 4P9UA 1NHAA 2KIMA 3U9GA 2FSWA 3WTSC 4P9FA 4EGYA 5FGMA 2ADUA 3E97A 2HWVA 1IN4A 4HF2A 2QQ9A 2NNNA 4IRHA 2GZWA 2EK5A 5ED4A 2BYVE 1BI0A 1OYYA 1HSJA 4MGRA 1BI3A 3P7NA 2ZMEA 5DD4A 2KJBA 3DV8A 2QVOA 1HBXG 2VBYA 1R5HA 1I1SA 5LHHA 4HDUA 2BBYA 2O61A 4O5VA 2Q0OA 4EGZA 1IRGA 3HRMA 3QP5A 5E8IA 1R1UA 1HW1A 4EMSA 3FXQA 1FBQA 2QBYB 2A3SA 1W7PA 1P4WA 2ZNYA 3HHGA 2DAOA 4FHTA 5K5QA 2O03A 2O3FA 3O2PE 3MAJA 3ULQB 2VBWA 4G9YA 1USTA 3QPHA 3TO7A 3IWFA 2P8TA 4XSXF 4LLGF 2DTRA 1TLHB 1O7LA 3QOPA 4M71A 1MDMA 5CVUA 4WXHA 5CVIA 2CO5A 3RKWA 3MEXA 2VN2A 3F72A 3REOA 2XHKA 5J6XA 4HZFA 3M8FA 1R00A 4UV9A 4WF2A 4HQMA 4I0BA 4U0WA 3C1DA 4RS8A 4M6YA 1SD7A 4OMZA 5FD5A 4PDKA 3RKYA 3RI4A 2F5EA 2XROA 4A0ZA 1YW9A 1TQIA 1IUYA 4P96A 1G3SA 2GA1A 1LQ1A 1ZN2A 2ESHA 4ASNA 1Z05A 3SQNA 5JHUA 1QNTA 2EV0A 3ML6A 1IF1A 2NNYA 1R36A 5BS6A 2O6GE 3R0AA 1UHWA 1L3LA 4KIBA 3E6BA 5CJ9A 2XAJA 2UXXA 1I6XA 1J5YA 3NQOA 1O57A 2EFWA 2EB7A 4KMFA 2CYYA 2E1CA 2XAFA 4LK0F 2IT0A 4ENMA 3U1DA 2E7XA 3KCCA 4MNUA 4RGRA 1K7AA 2EWNA 1OKRA 3DQVC 3F6VA 4PGHA 2VOOA 2IRFG 2BV6A 3ZPLA 3GUDA 5IT9K 3GEZA 2CQKA 4BHBA 2A61A 4L5JA 4ON0A 3QRFF 2VBXA 4I7HA 5F64A 3CLOA 1T6SA 3T0YA 4S05A 1SD4A 1FSHA 3BJOA 4EM2A 1FBUA 1J75A 2HTSA 4D0PA 2F5CA 4EJWA 3WTXC 1R7JA 4UUVA 1ZARA 3F3XA 4MQ9F 4EJOA 1EH6A 2L4MA 2LKPA 4RAYA 2MBFA 4ZYEA 4JK1X 4KIFA 1HKQA 3V8JA 1EH8A 2FBIA 4HX7A 4P5OA 4R1HA 4LLLA 1R1TA 3H92A 4CGZA 1W7PB 4RGUA 1U6GA 1D5VA 3BJAA 2L4AA 3RJPA 2EFNA 4AWXB 2G9WA 4ENKA 4KMUX 3LQQA 3TOAA 3V7CA 2DK5A 1HW2A 2P5KA 5HDNA 4PGGA 2M1BA 2JTVA 3MWMA 3T8RA 2FNPA 1MDMB 5L3DA 1KQ0A 1SD5A 3KP3A 3LQRA 1HSTA 3GXOA 3M9AA 2E7WA 3QAHA 4WK8F 1LVAA 3HSEA 1DPRA 1W7PD 2Z33A 2VODA 2BEOA 2A6HF 2L54A 2K4BA 4I09A 1EV7A 1FZPB 3D5LA 1QPMA 5HLHA 3WGGA 1YLFA 3WE3A 3CJNA 2CG4A 2M5WA 4EV0A 3KP4A 4UVAA 1B1BA 3JSOA 1P92A 5E1XA 1MJ9A 4RB1A 4MQVA 3JAMK 1CF7B 3WTZA 2DI3A 2Q8KA 2WWYA 3IKVA 1T2KA 3V7SA 2CFXA 3H3UA 2PFBA 2PI0A 4Y13A 2DLLA 3GX4X 4BQAA 1YS7A 4HV5A 1BI2A 5AONA 3E5UA 4Q47A 5LEKA 1T38A 4CDGA 2LSOA 3E3VA 1FX7A 5D4SA 5ICEA 4BNCA 2GXGA 4FX0A 2FNAA 2P4WA 5H6QA 4BXUA 1TNSA 2PN6A 1P2FA 3V8LA 2IP2A 4A5NA 2PMUA 5BPIA 3KE2A 4AIKA 4L9NA 4IHSA 4E70A 1TQPA 1BBYA 1SFUA 5DV5A 3GFMA 1GVJA 3M1EA 1IAWA 3KP2A 3E6MA 2STWA 1J2XA 3BPVA 4GYGA 1YYVA 1CGPA 1XGOA 4HYEA 1DPUA 1JE8A 3R60A 4ESBA 2B0LA 1K6OA 2WC2A 3MZYA 2HEOA 4BHCA 4G7OF 1PP8F 5LRSA 3F6OA 4M74A 2VC0A 4L9VA 1ZYRF 1KQ9A 2MC3A 3ERED 1B9NA 1BM9A 3F8CA 3FM3A 1UFMA 2M8EA 2QM3A 4Z2YA 2HKXA 1SFXA 3E5QA 3K69A 2K4JA 3WU1B 1P6RA 1XCVA 5HOOA 4CZZA 2GWRA 3FMSA 4B09A 1FP2A 2W57A 3RTRA 4ZYHA 2DQLA 4YFKF 3GZ6A 2UXNA 3KFWX 1S6LA 2P7VB 4U7BA 3BOQA 2DQRA 4MEXF 2V1XA 3GWZA 3PFIA 4ZYGA 5HDKA 2BE5F 2IA1A 3K9TA 3DF8A 2PJPA 1IXSB 5KVRA 5ERIA 4A6DA 4HW0A 2LDUA 4JBAA 3F21A 2H09A 2XKPA 1O3SA 4MTDA 1BC7C 1ODDA 4WX9A 4ZYDA 2QWWA 3LWFA 3GF2A 4A0XA 3IRRA 3ZMSA 3LA2A 4G6DA 3H3ZA 5HLGA 4KFCA 4LB5A 3WTTC 1WQ2A 2QQAA 3FMRA 1DP7P 2QUFA 5AIPA 2V1DA 2J5PA 1R58A 3GFLA 3R0JA 4KYWA 5HLIA 3F23A 1PDNC 4HV6A 4RGSA 1OR7A 4HDVA 2A5YB 5K5RA 2JT1A 3D0SA 3DPTA 2HZTA 5CVRA 3ABUA 1XDUA 4XRFA 2MA3A 3HUGA 1G6NA 3WTUC 3HRUA 3G3ZA 3FF5A 1YQAA 1YIOA 5E18F 1YO5C 1ZGJA 4R8HA 3MZHA 3EYIA 4U88A 5IT9Z 1ZG1A 1V3FA 5ICFA 1G3WA 1DUXC 2P6TA 5BQTA 2FBHA 1FC3A 1UB9A 5DUIA 2EFQA 4Q4ZF 4KT5C 2YR2A 2UWMA 1J59A 1SAXA 3KP7A 1TW3A 1RI7A 4KUMA 5HS8A 2IPQX 2LNBA 4TV7A 1KQ8A 5D4RA 2PLYA 3N4MA 1B59A 3LA7A 4RAZA 3OOPA 4I01A 3V8KA 4WCGA 3FMQA 5ICGA 5D5WB 4AIJA 3L2CA 1X3UA 4G8XA 2YX7A 1ZRDA 2XRNA 3QPTA 3BZ6A 4ZH4F 4L9JA 5CVVA 3BJ6A 2HDCA 2DW4A 5L3EA 1XMAA 3CO6C 3K1NA 1BC8C 2XAHA 5DCFA 4WXCA 5HS9A 3ZMUA 2W84A 1HKTA 2R3SA 2A69F 3PQJA 2RVCA 4BHPA 1DDNA 3OV8A 2RC4A 2FMYA 3JSPA 1O3RA 3T5XA 3SZPA 2A68F 2W85A 3ZMVA 5E1ZB 3SFZA 1E17A 2J5OA 3Q9SA 1YFHA 1FYKA 4WXDA 1IN5A 2Z3YA 2F5FA 2G7UA 3GO5A 4NB5A 1STZA 4G7HF 2EFOA 3BDDA 3TGNA 2STTA 2YX4A 2OQGA 4U0VA 4KA4A 3KETA 2P5LC 4CHUA 1W4MA 3TOBA 1VTNC 4OIOF 4RB2C 1SMYF 1YW8A 3JAMZ 1IRFA 3E6DA 2OQRA 1S29A 4N9IA 1I27A 1FPQA 4U7DA 1FOKA 1J9IA 4NQWA 1H9TA 3DPLC 1K79A 2Y0MA 4AD9A 3LSTA 4EJVA 2JRTA 4OIQF 3FX3A 1O3TA 5L3BA 1MGTA 3EDPA 4UVCA 3I59A 1S7AA 3IRQA 2QYOA 3WGIA 2ISYA 1O7FA 4DNCA 1HXDA 1S3JA 2O8XA 3I58A 1ZRCA 1SFEA 2MH2A 2KIFA 4OOIA 1AWCA 2JPBA 4G94A 4LMYA 3WU0A 5TRDA 4EJUA 4UVBA 1IW7F 5DEQA 4L18B 3JTHA 3L00A 1G3YA 3GFJA 2HQNA 4BYYA 2GQQA 3R4KA 2M87A 1RUOA 1ZRFA 5LHIA 2VC1A 5AIQA 1T39A 1XCBA 2RQPA 4DQ2A 1PP7U 3HSFA 3VODA 5H6RA 2ZMEB 4KIGA 4KDPA 2XIGA 3I54A 2PG4A 3JTGA 4ESJA 1JHHA 4XBFA 4GCVA 3IKTA 3CUOA 5D6EA 4EQQA 2HR3A 4S04A 4A2UA 3K2ZA 1W5TA 3CUQA 1ON1A 2IA2A 1OPCA 3FZVA 2NS0A 1GXPA 2GXBA 1QGPA 1W5SA 3TKYA 3ZMTA 2XAGA 5FB2A 5JI6A 3GZ5A 2Q2EA 5LGNA 1KU9A 2OAZA 2ZO4A 1FNNA 3GYHX 4IHTA 2JPCA 4N9HA 4YG2F 5L3GA 4HAMA 3TDUC 4HOBA 1YTYA 2XASA 5JVTA 4M9SA 4KN4X 2MH9A 5ILVA 5A2QK 3HSRA 1IXCA 2V6CA 4A12A 5DUKA 3HTUA 3LA3A 3N97A 4WWCA 2FF4A 6PAXA 5EEGA 1WWXA 3ISPA 5ILUA 3I64A 4Q5SF 5ICCA 4AIHA 1KYWA 4YFNF 3RKXA 4QWQA 3ZQ7A 4HX8A 1G4DA 1ZAOA 3MFKA 1LNWA 5CVJA 2RKHA 2COMA 5L3FA 1BI1A 3ECOA 1XGMA 2CSOA 2HFHA 2NRAC 1Q1HA 5LBQA 3S2WA 3HHHA 1LEBA 1XMKA 3I59B 2H94A 4P55A 2PMHA 2P5VA 5J8CA 3C3WA 4H0EA 2VBZA 3RYRA 2JZYA 5E1WA 2AS5F 3V4GA 4LB6B 4OIRF 3NEUA 2ELHA 1WSUA 1FSEA 2OU2A 1LEAA 2BGCA 4L0ZB 5FLXK 4IF4A 2G7HA 1A04A 4HX4A 4G7ZF 1ZREA 1R1VA 1H9GA 2DT5A 4A5MA 2EV6A 1K78A 2D1VA 4KNYA 1REPC 2FOKA 2MLGA 2GA2A 2CW0F 1LDKB 2H6BA 2X4HA 5FO5A 2F2EA 3PQKA 4MHGA 5E8GA 1YW7A 1PUEE 1R23A 2VE8A 3KP5A 1B6AA 2MD5A 1D8JA 4LGWA 1OMIA 3BWGA 3F8NA 3TDZC 2ZXJA 4K2EA 4QLCU 3HYIA 5LLQA 4GGGA 5LEJA 3ZMZA 3EQLF 5D5VB 1MKMA 3VEPA 2Z9OA 1FP1D 3DFGA 4B8XA 3E6CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RV8 A;  1FT9 A;  2RN7 A;  3CUQ B;  1QZZ A;  1F4K A;  1V4R A;  2HQR A;  4PZJ A;  3W6K B;  5FFZ A;  4ZZD A;  5D5X B;  1RUN A;  1FBS A;  2A07 F;  3AAF A;  2IJL A;  2FML A;  5LRR A;  3JW4 A;  2YU3 A;  1ZHF A;  2DPU A;  1XD7 A;  1U5T A;  5D8K B;  3E5X A;  2PQ8 A;  1IXR C;  4OU0 A;  3J81 K;  2DO7 A;  1MJA A;  2QQB A;  2EA4 A;  4HLY A;  1Z9C A;  2ZJ2 A;  1XGN A;  1HKS A;  4ENN A;  3RYP A;  2PBI A;  4UXN A;  5BPD A;  2RDP A;  4IVN A;  3I5U A;  5KK1 A;  1ZH5 A;  1YG2 A;  3ZN0 A;  3K1P A;  3WTV C;  3QP6 A;  2WTE A;  5E20 A;  1XN7 A;  3FXU A;  2QZ8 A;  4O3M A;  2MLK A;  4IRG A;  4RB0 A;  3MCZ A;  4UHT A;  2K27 A;  3GFI A;  2L3D A;  5FFX A;  2PEX A;  5DCM A;  1J7K A;  2JSC A;  2TDX A;  1LJ9 A;  2R7D A;  1G3T A;  1ZG3 A;  2A6E F;  5K5O A;  2Y75 A;  3FWE A;  5CYV A;  2K86 A;  2D1H A;  1USS A;  1J0R A;  1H0M A;  3CUQ C;  4YFX F;  1ON2 A;  2FA5 A;  3GVA A;  4G6Q A;  3B73 A;  1GHC A;  2ZCW A;  3ABT A;  4RB3 C;  3BP8 A;  4M72 A;  2CWE A;  1TTY A;  4XLP F;  1QBJ A;  1GXQ A;  1IN8 A;  3ZMD A;  2R7F A;  3Q9V A;  1BN5 A;  1RNL A;  3IWZ A;  4O6J A;  4CYD A;  4OIP F;  2IVM A;  4PCQ A;  3ZN1 A;  1K78 B;  2P6S A;  4A6E A;  1JXS A;  1OYW A;  2RNJ A;  1TBX A;  2YSR A;  3W6J B;  2ISZ A;  1TW2 A;  2FE3 A;  2XVC A;  2WV0 A;  1BOA A;  1HW5 A;  3L09 A;  3F8B A;  1U3E M;  3CTA A;  3J80 K;  2YPR A;  5FD6 A;  2EJR A;  2D2W A;  4LLN A;  5H20 A;  4BH9 A;  5EEH A;  5A2Q Z;  1LDD A;  3M7G A;  3ECH A;  2XGX A;  3SXY A;  4I0A A;  3P9C A;  1OYI A;  3RPU A;  5LHG A;  3TO6 A;  1D3Y A;  4ESF A;  4ZZL A;  2Z5U A;  3BY6 A;  4LG0 A;  4EM0 B;  4M9X A;  4NHJ A;  1F9N A;  1Z7U A;  2IA0 A;  3K1M A;  3C18 A;  1LDJ A;  5BOX A;  3VB2 A;  1TNT A;  5HVQ C;  1U5T B;  3FXR A;  5F6F A;  5DDG A;  1BJA A;  1KU3 A;  2EFP A;  2VT2 A;  2XV4 S;  4L9T A;  2ZFW A;  3EUH A;  3DXJ F;  1CF7 A;  2IW5 A;  1MD0 A;  2DU9 A;  5IT3 A;  3F22 A;  1QO0 D;  3KP6 A;  2X0L A;  4KIC A;  2FXA A;  3DKW A;  2P7C B;  1R5G A;  1RZ4 A;  3V7R A;  1QZY A;  3KZZ A;  4M9Z A;  5BMZ A;  2V79 A;  1C0W A;  5DCM B;  1MZB A;  4UNO A;  3WG9 A;  5F1R A;  2HGC A;  4MEY F;  5FLX Z;  2Y48 A;  3COA C;  2O0Y A;  4I98 B;  3I53 A;  3WTW C;  3O3K A;  4I02 A;  3M8E A;  4HLX A;  2H6C A;  3G73 A;  2C6Y A;  2F5D A;  3ROU A;  1I5Z A;  2VE9 A;  3QU6 A;  2OD5 A;  5DYM A;  4KN7 X;  1ONV A;  2D45 A;  1IZ1 A;  3CO7 C;  1E2X A;  3KEO A;  4Q48 A;  4ETS A;  2FEZ A;  2NAZ A;  1JGS A;  1L0O C;  1WI9 A;  2VOP A;  1U5T C;  3FM5 A;  2VON A;  3EYY A;  2W24 A;  4U0Y A;  3ELK A;  3K0L A;  3TO9 A;  4FX4 A;  3T1B A;  3P9K A;  3R61 A;  2V9V A;  1AOY A;  1KYZ A;  1SMT A;  3RDI A;  3WGH A;  1Z6R A;  3T8T A;  4I2O A;  1F5T A;  1T98 A;  3F8F A;  1WRJ A;  3GLX A;  4HF0 A;  1BIB A;  2W25 A;  1ZG5 A;  5ILS A;  3LAJ A;  3SHF A;  4HA8 A;  2OZ6 A;  3J81 Z;  5TJJ A;  3NRV A;  1ULY A;  2LF8 A;  1P4A A;  2E1N A;  4R79 A;  4EM1 A;  3HRT A;  5CLS A;  1FLI A;  5J8F A;  4OMY A;  1XSV A;  3R6S A;  2EV5 A;  2QEN A;  2HKO A;  4YIF A;  2KRF A;  3I71 A;  4LG0 B;  5D5U B;  5E17 F;  2AXL A;  1Y0U A;  4GXO A;  5DD8 A;  1Z91 A;  3KLN A;  2ZNZ A;  3HOS A;  1T0F A;  4Y17 A;  3WOD F;  1IN6 A;  2K02 A;  3U2R A;  4JQF A;  1BIA A;  1P4X A;  2GAU A;  1FYM A;  3I0T A;  1Z1D A;  3B02 A;  1ZLK A;  2Z99 A;  1TQM A;  1MJB A;  2KKO A;  5K1Y A;  4N0B A;  1D8K A;  1RIO H;  3KLO A;  4CO8 A;  1FY7 A;  1S7O A;  1SD6 A;  1ZGA A;  3C7J A;  4EJT A;  1XDS A;  3WTY C;  3HTS B;  5LGU A;  2FRH A;  5L3C A;  1XSX A;  1JHF A;  2V1U A;  3P9I A;  3LFK A;  1FWZ A;  4CIC A;  4YII A;  2ETH A;  2L02 A;  4XSZ F;  2DPD A;  1U78 A;  3TQN A;  1KU7 A;  1XB4 A;  1KU2 A;  2HS5 A;  5JR3 A;  1U2W A;  4GO1 A;  2EA2 A;  2HTJ A;  3BPX A;  4UV8 A;  4HF1 A;  3ZP5 A;  2M45 A;  2DBB A;  4OIN F;  4HQE A;  3VFZ A;  3EET A;  1HQC A;  2L01 A;  1YS6 A;  2QBY A;  3J7A O;  1QQI A;  1B9M A;  2XAQ A;  2KIU A;  2OA4 A;  4ENJ A;  4AVP A;  3J80 Z;  1UHM A;  4F7Z A;  2ZBK A;  2QLZ A;  3GW2 A;  3DP7 A;  4IPA A;  1FYL A;  2HYG D;  5D8L B;  3SZT A;  1U8R A;  1KA8 A;  2HYF A;  2RGV A;  3I4P A;  4EVI A;  1O3Q A;  3HOT A;  2OZU A;  5JFR A;  4IJA A;  4M6X A;  4LK1 F;  2M30 A;  2HOE A;  4XLN F;  3LAP A;  4HBL A;  1XGS A;  1UCR A;  4LFU A;  2OBP A;  2GIV A;  2LF7 A;  2FU4 A;  4MTE A;  4LJZ F;  3QU3 A;  4CXF A;  4L5I A;  2XUB A;  2DK8 A;  2FQ3 A;  5HDG A;  2FBK A;  2CGP A;  2VXZ A;  2DFI A;  2UZK A;  3KEQ A;  3Q5F A;  2ACJ A;  4IRI A;  3L9F A;  3IL2 A;  4RGX A;  4BAY A;  4Y15 A;  2VT3 A;  5HS7 A;  2KJC A;  1B4A A;  1WKM A;  1XSD A;  4A0Y A;  4LD5 A;  1KGS A;  4M73 A;  4FT8 A;  3DEU A;  3HRS A;  1ZLJ A;  1LB2 A;  1F1Z A;  3RPQ A;  2ESN A;  3RIR A;  2XKO A;  3IC7 A;  3VOE A;  1I1G A;  3F8M A;  1Z6T A;  4GYI A;  3HIF A;  3KZY A;  3MQ0 A;  1R22 A;  4L0Y B;  1S8N A;  2NYX A;  2ZKZ A;  4IXA A;  2H27 A;  1EH7 A;  3O6B B;  5LGT A;  3WE2 A;  3BRO A;  1IN7 A;  3FHZ A;  2K7L A;  3L7W A;  5D6F A;  3IHU A;  3CDH A;  4P9U A;  1NHA A;  2KIM A;  3U9G A;  2FSW A;  3WTS C;  4P9F A;  4EGY A;  5FGM A;  2ADU A;  3E97 A;  2HWV A;  1IN4 A;  4HF2 A;  2QQ9 A;  2NNN A;  4IRH A;  2GZW A;  2EK5 A;  5ED4 A;  2BYV E;  1BI0 A;  1OYY A;  1HSJ A;  4MGR A;  1BI3 A;  3P7N A;  2ZME A;  5DD4 A;  2KJB A;  3DV8 A;  2QVO A;  1HBX G;  2VBY A;  1R5H A;  1I1S A;  5LHH A;  4HDU A;  2BBY A;  2O61 A;  4O5V A;  2Q0O A;  4EGZ A;  1IRG A;  3HRM A;  3QP5 A;  5E8I A;  1R1U A;  1HW1 A;  4EMS A;  3FXQ A;  1FBQ A;  2QBY B;  2A3S A;  1W7P A;  1P4W A;  2ZNY A;  3HHG A;  2DAO A;  4FHT A;  5K5Q A;  2O03 A;  2O3F A;  3O2P E;  3MAJ A;  3ULQ B;  2VBW A;  4G9Y A;  1UST A;  3QPH A;  3TO7 A;  3IWF A;  2P8T A;  4XSX F;  4LLG F;  2DTR A;  1TLH B;  1O7L A;  3QOP A;  4M71 A;  1MDM A;  5CVU A;  4WXH A;  5CVI A;  2CO5 A;  3RKW A;  3MEX A;  2VN2 A;  3F72 A;  3REO A;  2XHK A;  5J6X A;  4HZF A;  3M8F A;  1R00 A;  4UV9 A;  4WF2 A;  4HQM A;  4I0B A;  4U0W A;  3C1D A;  4RS8 A;  4M6Y A;  1SD7 A;  4OMZ A;  5FD5 A;  4PDK A;  3RKY A;  3RI4 A;  2F5E A;  2XRO A;  4A0Z A;  1YW9 A;  1TQI A;  1IUY A;  4P96 A;  1G3S A;  2GA1 A;  1LQ1 A;  1ZN2 A;  2ESH A;  4ASN A;  1Z05 A;  3SQN A;  5JHU A;  1QNT A;  2EV0 A;  3ML6 A;  1IF1 A;  2NNY A;  1R36 A;  5BS6 A;  2O6G E;  3R0A A;  1UHW A;  1L3L A;  4KIB A;  3E6B A;  5CJ9 A;  2XAJ A;  2UXX A;  1I6X A;  1J5Y A;  3NQO A;  1O57 A;  2EFW A;  2EB7 A;  4KMF A;  2CYY A;  2E1C A;  2XAF A;  4LK0 F;  2IT0 A;  4ENM A;  3U1D A;  2E7X A;  3KCC A;  4MNU A;  4RGR A;  1K7A A;  2EWN A;  1OKR A;  3DQV C;  3F6V A;  4PGH A;  2VOO A;  2IRF G;  2BV6 A;  3ZPL A;  3GUD A;  5IT9 K;  3GEZ A;  2CQK A;  4BHB A;  2A61 A;  4L5J A;  4ON0 A;  3QRF F;  2VBX A;  4I7H A;  5F64 A;  3CLO A;  1T6S A;  3T0Y A;  4S05 A;  1SD4 A;  1FSH A;  3BJO A;  4EM2 A;  1FBU A;  1J75 A;  2HTS A;  4D0P A;  2F5C A;  4EJW A;  3WTX C;  1R7J A;  4UUV A;  1ZAR A;  3F3X A;  4MQ9 F;  4EJO A;  1EH6 A;  2L4M A;  2LKP A;  4RAY A;  2MBF A;  4ZYE A;  4JK1 X;  4KIF A;  1HKQ A;  3V8J A;  1EH8 A;  2FBI A;  4HX7 A;  4P5O A;  4R1H A;  4LLL A;  1R1T A;  3H92 A;  4CGZ A;  1W7P B;  4RGU A;  1U6G A;  1D5V A;  3BJA A;  2L4A A;  3RJP A;  2EFN A;  4AWX B;  2G9W A;  4ENK A;  4KMU X;  3LQQ A;  3TOA A;  3V7C A;  2DK5 A;  1HW2 A;  2P5K A;  5HDN A;  4PGG A;  2M1B A;  2JTV A;  3MWM A;  3T8R A;  2FNP A;  1MDM B;  5L3D A;  1KQ0 A;  1SD5 A;  3KP3 A;  3LQR A;  1HST A;  3GXO A;  3M9A A;  2E7W A;  3QAH A;  4WK8 F;  1LVA A;  3HSE A;  1DPR A;  1W7P D;  2Z33 A;  2VOD A;  2BEO A;  2A6H F;  2L54 A;  2K4B A;  4I09 A;  1EV7 A;  1FZP B;  3D5L A;  1QPM A;  5HLH A;  3WGG A;  1YLF A;  3WE3 A;  3CJN A;  2CG4 A;  2M5W A;  4EV0 A;  3KP4 A;  4UVA A;  1B1B A;  3JSO A;  1P92 A;  5E1X A;  1MJ9 A;  4RB1 A;  4MQV A;  3JAM K;  1CF7 B;  3WTZ A;  2DI3 A;  2Q8K A;  2WWY A;  3IKV A;  1T2K A;  3V7S A;  2CFX A;  3H3U A;  2PFB A;  2PI0 A;  4Y13 A;  2DLL A;  3GX4 X;  4BQA A;  1YS7 A;  4HV5 A;  1BI2 A;  5AON A;  3E5U A;  4Q47 A;  5LEK A;  1T38 A;  4CDG A;  2LSO A;  3E3V A;  1FX7 A;  5D4S A;  5ICE A;  4BNC A;  2GXG A;  4FX0 A;  2FNA A;  2P4W A;  5H6Q A;  4BXU A;  1TNS A;  2PN6 A;  1P2F A;  3V8L A;  2IP2 A;  4A5N A;  2PMU A;  5BPI A;  3KE2 A;  4AIK A;  4L9N A;  4IHS A;  4E70 A;  1TQP A;  1BBY A;  1SFU A;  5DV5 A;  3GFM A;  1GVJ A;  3M1E A;  1IAW A;  3KP2 A;  3E6M A;  2STW A;  1J2X A;  3BPV A;  4GYG A;  1YYV A;  1CGP A;  1XGO A;  4HYE A;  1DPU A;  1JE8 A;  3R60 A;  4ESB A;  2B0L A;  1K6O A;  2WC2 A;  3MZY A;  2HEO A;  4BHC A;  4G7O F;  1PP8 F;  5LRS A;  3F6O A;  4M74 A;  2VC0 A;  4L9V A;  1ZYR F;  1KQ9 A;  2MC3 A;  3ERE D;  1B9N A;  1BM9 A;  3F8C A;  3FM3 A;  1UFM A;  2M8E A;  2QM3 A;  4Z2Y A;  2HKX A;  1SFX A;  3E5Q A;  3K69 A;  2K4J A;  3WU1 B;  1P6R A;  1XCV A;  5HOO A;  4CZZ A;  2GWR A;  3FMS A;  4B09 A;  1FP2 A;  2W57 A;  3RTR A;  4ZYH A;  2DQL A;  4YFK F;  3GZ6 A;  2UXN A;  3KFW X;  1S6L A;  2P7V B;  4U7B A;  3BOQ A;  2DQR A;  4MEX F;  2V1X A;  3GWZ A;  3PFI A;  4ZYG A;  5HDK A;  2BE5 F;  2IA1 A;  3K9T A;  3DF8 A;  2PJP A;  1IXS B;  5KVR A;  5ERI A;  4A6D A;  4HW0 A;  2LDU A;  4JBA A;  3F21 A;  2H09 A;  2XKP A;  1O3S A;  4MTD A;  1BC7 C;  1ODD A;  4WX9 A;  4ZYD A;  2QWW A;  3LWF A;  3GF2 A;  4A0X A;  3IRR A;  3ZMS A;  3LA2 A;  4G6D A;  3H3Z A;  5HLG A;  4KFC A;  4LB5 A;  3WTT C;  1WQ2 A;  2QQA A;  3FMR A;  1DP7 P;  2QUF A;  5AIP A;  2V1D A;  2J5P A;  1R58 A;  3GFL A;  3R0J A;  4KYW A;  5HLI A;  3F23 A;  1PDN C;  4HV6 A;  4RGS A;  1OR7 A;  4HDV A;  2A5Y B;  5K5R A;  2JT1 A;  3D0S A;  3DPT A;  2HZT A;  5CVR A;  3ABU A;  1XDU A;  4XRF A;  2MA3 A;  3HUG A;  1G6N A;  3WTU C;  3HRU A;  3G3Z A;  3FF5 A;  1YQA A;  1YIO A;  5E18 F;  1YO5 C;  1ZGJ A;  4R8H A;  3MZH A;  3EYI A;  4U88 A;  5IT9 Z;  1ZG1 A;  1V3F A;  5ICF A;  1G3W A;  1DUX C;  2P6T A;  5BQT A;  2FBH A;  1FC3 A;  1UB9 A;  5DUI A;  2EFQ A;  4Q4Z F;  4KT5 C;  2YR2 A;  2UWM A;  1J59 A;  1SAX A;  3KP7 A;  1TW3 A;  1RI7 A;  4KUM A;  5HS8 A;  2IPQ X;  2LNB A;  4TV7 A;  1KQ8 A;  5D4R A;  2PLY A;  3N4M A;  1B59 A;  3LA7 A;  4RAZ A;  3OOP A;  4I01 A;  3V8K A;  4WCG A;  3FMQ A;  5ICG A;  5D5W B;  4AIJ A;  3L2C A;  1X3U A;  4G8X A;  2YX7 A;  1ZRD A;  2XRN A;  3QPT A;  3BZ6 A;  4ZH4 F;  4L9J A;  5CVV A;  3BJ6 A;  2HDC A;  2DW4 A;  5L3E A;  1XMA A;  3CO6 C;  3K1N A;  1BC8 C;  2XAH A;  5DCF A;  4WXC A;  5HS9 A;  3ZMU A;  2W84 A;  1HKT A;  2R3S A;  2A69 F;  3PQJ A;  2RVC A;  4BHP A;  1DDN A;  3OV8 A;  2RC4 A;  2FMY A;  3JSP A;  1O3R A;  3T5X A;  3SZP A;  2A68 F;  2W85 A;  3ZMV A;  5E1Z B;  3SFZ A;  1E17 A;  2J5O A;  3Q9S A;  1YFH A;  1FYK A;  4WXD A;  1IN5 A;  2Z3Y A;  2F5F A;  2G7U A;  3GO5 A;  4NB5 A;  1STZ A;  4G7H F;  2EFO A;  3BDD A;  3TGN A;  2STT A;  2YX4 A;  2OQG A;  4U0V A;  4KA4 A;  3KET A;  2P5L C;  4CHU A;  1W4M A;  3TOB A;  1VTN C;  4OIO F;  4RB2 C;  1SMY F;  1YW8 A;  3JAM Z;  1IRF A;  3E6D A;  2OQR A;  1S29 A;  4N9I A;  1I27 A;  1FPQ A;  4U7D A;  1FOK A;  1J9I A;  4NQW A;  1H9T A;  3DPL C;  1K79 A;  2Y0M A;  4AD9 A;  3LST A;  4EJV A;  2JRT A;  4OIQ F;  3FX3 A;  1O3T A;  5L3B A;  1MGT A;  3EDP A;  4UVC A;  3I59 A;  1S7A A;  3IRQ A;  2QYO A;  3WGI A;  2ISY A;  1O7F A;  4DNC A;  1HXD A;  1S3J A;  2O8X A;  3I58 A;  1ZRC A;  1SFE A;  2MH2 A;  2KIF A;  4OOI A;  1AWC A;  2JPB A;  4G94 A;  4LMY A;  3WU0 A;  5TRD A;  4EJU A;  4UVB A;  1IW7 F;  5DEQ A;  4L18 B;  3JTH A;  3L00 A;  1G3Y A;  3GFJ A;  2HQN A;  4BYY A;  2GQQ A;  3R4K A;  2M87 A;  1RUO A;  1ZRF A;  5LHI A;  2VC1 A;  5AIQ A;  1T39 A;  1XCB A;  2RQP A;  4DQ2 A;  1PP7 U;  3HSF A;  3VOD A;  5H6R A;  2ZME B;  4KIG A;  4KDP A;  2XIG A;  3I54 A;  2PG4 A;  3JTG A;  4ESJ A;  1JHH A;  4XBF A;  4GCV A;  3IKT A;  3CUO A;  5D6E A;  4EQQ A;  2HR3 A;  4S04 A;  4A2U A;  3K2Z A;  1W5T A;  3CUQ A;  1ON1 A;  2IA2 A;  1OPC A;  3FZV A;  2NS0 A;  1GXP A;  2GXB A;  1QGP A;  1W5S A;  3TKY A;  3ZMT A;  2XAG A;  5FB2 A;  5JI6 A;  3GZ5 A;  2Q2E A;  5LGN A;  1KU9 A;  2OAZ A;  2ZO4 A;  1FNN A;  3GYH X;  4IHT A;  2JPC A;  4N9H A;  4YG2 F;  5L3G A;  4HAM A;  3TDU C;  4HOB A;  1YTY A;  2XAS A;  5JVT A;  4M9S A;  4KN4 X;  2MH9 A;  5ILV A;  5A2Q K;  3HSR A;  1IXC A;  2V6C A;  4A12 A;  5DUK A;  3HTU A;  3LA3 A;  3N97 A;  4WWC A;  2FF4 A;  6PAX A;  5EEG A;  1WWX A;  3ISP A;  5ILU A;  3I64 A;  4Q5S F;  5ICC A;  4AIH A;  1KYW A;  4YFN F;  3RKX A;  4QWQ A;  3ZQ7 A;  4HX8 A;  1G4D A;  1ZAO A;  3MFK A;  1LNW A;  5CVJ A;  2RKH A;  2COM A;  5L3F A;  1BI1 A;  3ECO A;  1XGM A;  2CSO A;  2HFH A;  2NRA C;  1Q1H A;  5LBQ A;  3S2W A;  3HHH A;  1LEB A;  1XMK A;  3I59 B;  2H94 A;  4P55 A;  2PMH A;  2P5V A;  5J8C A;  3C3W A;  4H0E A;  2VBZ A;  3RYR A;  2JZY A;  5E1W A;  2AS5 F;  3V4G A;  4LB6 B;  4OIR F;  3NEU A;  2ELH A;  1WSU A;  1FSE A;  2OU2 A;  1LEA A;  2BGC A;  4L0Z B;  5FLX K;  4IF4 A;  2G7H A;  1A04 A;  4HX4 A;  4G7Z F;  1ZRE A;  1R1V A;  1H9G A;  2DT5 A;  4A5M A;  2EV6 A;  1K78 A;  2D1V A;  4KNY A;  1REP C;  2FOK A;  2MLG A;  2GA2 A;  2CW0 F;  1LDK B;  2H6B A;  2X4H A;  5FO5 A;  2F2E A;  3PQK A;  4MHG A;  5E8G A;  1YW7 A;  1PUE E;  1R23 A;  2VE8 A;  3KP5 A;  1B6A A;  2MD5 A;  1D8J A;  4LGW A;  1OMI A;  3BWG A;  3F8N A;  3TDZ C;  2ZXJ A;  4K2E A;  4QLC U;  3HYI A;  5LLQ A;  4GGG A;  5LEJ A;  3ZMZ A;  3EQL F;  5D5V B;  1MKM A;  3VEP A;  2Z9O A;  1FP1 D;  3DFG A;  4B8X A;  3E6C C; 
#chains in the Genus database with same CATH topology
 2RV8 A;  3CCQ I;  3K10 A;  1FT9 A;  1WJC A;  3OIP A;  2JA8 J;  2RN7 A;  3H5R A;  1JJ6 C;  3CUQ B;  1GV2 A;  2E1M B;  1QZZ A;  1F4K A;  1V4R A;  1ETV A;  4RDU A;  2W48 A;  3FK6 A;  3SJM A;  2HQR A;  5GTH C;  4RMN A;  4PZJ A;  1LPQ A;  3W6K B;  5FFZ A;  5IYD J;  4ZZD A;  5D5X B;  1RUN A;  2BW3 B;  1VQ4 I;  3ABL H;  1FBS A;  4XKB A;  2A07 F;  3AAF A;  3S1Q J;  1LUJ B;  3ZQF A;  4XID A;  1WJD A;  2IJL A;  1T95 A;  2FML A;  2Q2E B;  3JW4 A;  5LRR A;  2YU3 A;  1D0X A;  4DJA A;  1ZHF A;  2DPU A;  3TW6 A;  1XD7 A;  4A3C J;  1U5T A;  5D8K B;  3E5X A;  2PQ8 A;  1IXR C;  4OU0 A;  2CMP A;  3J81 K;  2DO7 A;  5IOY A;  1MJA A;  3CES A;  4G6T B;  2QQB A;  2EA4 A;  4HLY A;  1Z9C A;  2ZJ2 A;  1XGN A;  2ZSH B;  1HKS A;  4LIV A;  4ENN A;  3RYP A;  2PBI A;  4UXN A;  4HRI A;  3LL7 A;  3PNY A;  2ZJQ F;  5BPD A;  2RDP A;  1Z0X A;  1WGX A;  4IVN A;  4HNV A;  1XS9 A;  3I5U A;  5KK1 A;  1ZH5 A;  3OYK A;  3CJT B;  1YG2 A;  3ZN0 A;  1HOM A;  3K1P A;  3WTV C;  3QP6 A;  2MW8 A;  2WTE A;  5E20 A;  3BG3 A;  1Y8R B;  1XN7 A;  3FXU A;  4BGD A;  2QZ8 A;  3SEQ A;  1QA6 A;  5IYC J;  4O3M A;  2MLK A;  4IRG A;  4RB0 A;  3MCZ A;  4UHT A;  2K27 A;  4HG2 A;  3GFI A;  2L3D A;  2L7F P;  2L9N A;  2DJI A;  5FFX A;  1YHQ I;  2LYC A;  2VQC A;  2PEX A;  5DCM A;  3HC7 A;  1J7K A;  2JSC A;  3RQ4 A;  2TDX A;  1LJ9 A;  3MVP A;  1FEX A;  2DA3 A;  1MH3 A;  2R7D A;  1G3T A;  1ZG3 A;  3VSL A;  2JN6 A;  3AL0 B;  2A6E F;  5K5O A;  3CC2 I;  2HI3 A;  2Y75 A;  2IS4 A;  3FWE A;  1KON A;  1JUP A;  5CYV A;  4ZDP A;  2K86 A;  2KHM A;  4XOR A;  2D1H A;  3S15 J;  2JA5 J;  1USS A;  2MC4 A;  1J0R A;  3G1O A;  4CSW A;  1H0M A;  3CUQ C;  2E1M C;  2VQG A;  2ME6 A;  1ZKG A;  3J7A Y;  4YFX F;  1ON2 A;  2FA5 A;  3GVA A;  1LFP A;  4G6Q A;  3B73 A;  1GHC A;  1JKP C;  2ZCW A;  1D1C A;  3PM1 A;  2OUM A;  3ABT A;  4PJL A;  3JCU C;  3BP8 A;  4M72 A;  3HEF A;  5B1A H;  4RB3 C;  2CWE A;  1JKQ C;  1TTY A;  5CQG A;  4XLP F;  1QBJ A;  4D7M A;  4D7N A;  1GXQ A;  1U8B A;  4ZDO A;  1IN8 A;  3ZMD A;  1X1A A;  2R7F A;  3A01 A;  2LBF B;  5FKM A;  3Q9V A;  4HSR A;  1BN5 A;  5CPR B;  1RNL A;  3S3M A;  3IWZ A;  4O6J A;  4FE7 A;  4CYD A;  4OIP F;  3DCF A;  2W7N A;  2ZJP F;  4IX7 A;  2K9M A;  2IVM A;  4PCQ A;  3ZN1 A;  3M3Y J;  1K78 B;  4JOM A;  2P6S A;  4A6E A;  1JXS A;  4MFD A;  2P0W A;  3ZQG A;  1JT0 A;  4BY1 J;  3H9Q A;  2CQX A;  1OYW A;  1Q1V A;  2RNJ A;  3CF2 A;  1TBX A;  2YSR A;  1ZR4 A;  1A5J A;  3W6J B;  1TT5 B;  5LFA A;  2ISZ A;  1YJ9 I;  1TW2 A;  2FE3 A;  2VKH A;  3QPS A;  1F36 A;  1MNM C;  2XVC A;  2WV0 A;  1X1B A;  1BOA A;  1HW5 A;  3KYC B;  3L09 A;  3HOU J;  1OCP A;  3F8B A;  5JLX A;  2IEK A;  1U3E M;  3CTA A;  3J80 K;  3CZ6 A;  1MBJ A;  2OCC H;  2YPR A;  5FD6 A;  2DA6 A;  1Z3X A;  3D1N I;  3ZRG A;  1NK3 P;  2Z16 A;  1MH4 A;  2EJR A;  2D2W A;  4LLN A;  1IJW C;  5H20 A;  3DLL F;  4BH9 A;  4A3I J;  3AL0 C;  1QVU A;  5EEH A;  5A2Q Z;  1VQ6 I;  1LDD A;  3M7G A;  3ECH A;  1TZL A;  2XGX A;  1OCT C;  5M5X J;  3SXY A;  2K5C A;  4I0A A;  3P9C A;  5GAD J;  1OYI A;  3L2R A;  1VFC A;  5TIS C;  1N75 A;  3RPU A;  5LHG A;  5EG0 A;  2K3F A;  3TO6 A;  1ZR2 A;  1AHD P;  1ZK8 A;  1SVL A;  1D3Y A;  4ESF A;  4ZZL A;  2Z5U A;  3BY6 A;  1LE8 A;  1ENH A;  4LG0 A;  4EM0 B;  1K4S A;  4M9X A;  4NHJ A;  2KFD A;  1F9N A;  1Z7U A;  2IA0 A;  3K1M A;  2LOO A;  2VXD A;  3C18 A;  3LSK A;  2O8K A;  2DFH A;  3K4K A;  1LDJ A;  2JWT A;  5BOX A;  1VQ9 I;  3HL2 A;  2EIL H;  1TNT A;  3VB2 A;  4IQJ A;  2XPU A;  5HVQ C;  4IHY A;  1U5T B;  3FXR A;  3H5N A;  5F6F A;  5DDG A;  2BZT A;  1MIJ A;  1BJA A;  2L9R A;  2VQL A;  1KU3 A;  1NG7 A;  1ETY A;  2EFP A;  2VT2 A;  4M3E A;  3ESW B;  2XV4 S;  2M7A A;  4L9T A;  3ERM A;  2ZFW A;  2EIK H;  3ZOB A;  2CJJ A;  3EUH A;  2COB A;  3DXJ F;  1CF7 A;  2IW5 A;  3BQZ A;  1MD0 A;  2DU9 A;  2VKV A;  3GTJ J;  3PFY A;  1RES A;  2LFB A;  5IT3 A;  2V6E A;  3F22 A;  2JQ7 A;  4ANJ A;  2R7U A;  3BR5 A;  4A3J J;  1QO0 D;  3KP6 A;  2X0L A;  3S1M J;  4KIC A;  2FXA A;  3DKW A;  2P7C B;  2GBY A;  2ZC2 A;  1R5G A;  1QHH D;  1V55 H;  3ASO H;  1AA7 A;  2NS8 A;  2I5U A;  3ONQ A;  3S3N A;  3K4J A;  1RZ4 A;  1TP4 A;  5FKK A;  3V7R A;  1QZY A;  3KZZ A;  3BG7 A;  1FIP A;  3PNT A;  4M9Z A;  2WAE A;  2OF7 A;  5BMZ A;  4E7L A;  2KT0 A;  2V79 A;  2EZL A;  4DZJ A;  1C0W A;  5F0F A;  5DCM B;  1MZB A;  4UNO A;  3WG9 A;  5F1R A;  5CKT A;  2HGC A;  4MEY F;  1GDT A;  1FJL A;  5FLX Z;  2Y48 A;  2FQ4 A;  3H5A A;  4FQG A;  1NTC A;  3COA C;  2XGD A;  4JX4 A;  2O0Y A;  3DTE A;  4I98 B;  3I53 A;  3WTW C;  2XC7 A;  3O3K A;  3SYT A;  3KYL A;  2GM4 A;  5F08 A;  2HNH A;  2BVL A;  1K83 J;  2DMN A;  4I02 A;  4IHV A;  3M8E A;  4BEH A;  3G6E I;  4IL6 C;  4B44 A;  3RQI A;  4HLX A;  2H6C A;  3G73 A;  4E7S A;  2C6Y A;  2F5D A;  1WHU A;  3ROU A;  5M3F J;  1I5Z A;  1I6H J;  2CUZ A;  2VE9 A;  3QU6 A;  2OD5 A;  5DYM A;  4KN7 X;  1ONV A;  1V5E A;  2D45 A;  1QU3 A;  4A69 C;  1IZ1 A;  3CO7 C;  1BJZ A;  3IUO A;  3OS2 A;  2HU9 A;  1E2X A;  4CUG A;  4E4H A;  4BS9 A;  4XLE A;  3C2G A;  3KEO A;  5GPC A;  4Q48 A;  2DMT A;  2FEZ A;  4MLO A;  4ETS A;  2NAZ A;  1JGS A;  1L0O C;  1WI9 A;  2VOP A;  5JHF A;  4BBR J;  1U5T C;  1JTY A;  3SZG A;  3FM5 A;  2VON A;  5M5W J;  3EYY A;  2BY2 A;  4BE0 A;  1BR2 A;  3E0J B;  2JMW A;  2W24 A;  3A01 B;  1VQ8 I;  2HDW A;  2LY9 A;  2LKX A;  2E5N A;  4U0Y A;  3ELK A;  4D9J A;  2FUG 2;  3S17 J;  3K0L A;  3TO9 A;  3T1B A;  4FX4 A;  2KIS A;  2WBM A;  3P9K A;  2B63 J;  1SVM A;  4DYQ A;  3R61 A;  2V9V A;  2R7S A;  1AOY A;  1KYZ A;  1SMT A;  3Q0U A;  3RDI A;  1OQY A;  2F48 A;  3WGH A;  4Y7N J;  1S9H A;  1Z6R A;  2JVG A;  3T8T A;  2V9K A;  4XOT A;  4I2O A;  1F5T A;  1T98 A;  2DMU A;  3F8F A;  1WRJ A;  4ZJZ A;  1RC9 A;  3GLX A;  3M8J A;  4HF0 A;  1BIB A;  3S2D J;  3PIO F;  1Y0N A;  4D1Q A;  4NBQ A;  1YX3 A;  3PJR A;  2W25 A;  1ZG5 A;  4Y4R A;  5ILS A;  1B72 A;  2QSG X;  3LAJ A;  3IV5 A;  3SHF A;  4HA8 A;  5EF6 A;  3TW7 A;  2OZ6 A;  2E5Z A;  4CCJ A;  3J81 Z;  1OR7 C;  3HKZ N;  3H0D A;  3AG2 H;  5TJJ A;  3NRV A;  3X2Q H;  1DU0 A;  3TL4 X;  1ULY A;  2WY7 Q;  1S72 I;  2LF8 A;  1P4A A;  1VQK I;  2E1N A;  4AYB N;  4BDY A;  4R79 A;  1IC8 A;  3HOX J;  4EM1 A;  5K7H A;  3HRT A;  5CLS A;  3BG9 A;  2ZXH A;  1ETX A;  1FLI A;  5J8F A;  4OMY A;  1XSV A;  3R6S A;  3SEZ A;  2EV5 A;  2QEN A;  3I4M J;  2XAU A;  5EG0 B;  1FOX A;  2HKO A;  4YIF A;  1UHS A;  3F9K A;  3JRA A;  4RAF A;  2KRF A;  1LE8 B;  1R9T J;  3I71 A;  4LG0 B;  1WJE A;  4B3A A;  3LFU A;  1TWF J;  5F1J A;  1JI8 A;  5KNL A;  2JA6 J;  5D5U B;  5E17 F;  1D5Y A;  1R4M B;  2AXL A;  1Y0U A;  4GXO A;  5DD8 A;  1EA3 A;  3JRE A;  1Z91 A;  3KLN A;  2ZNZ A;  1EJ9 A;  3HOS A;  3U21 A;  1T0F A;  4Y17 A;  3WOD F;  4E7K A;  1IN6 A;  2K02 A;  2LRD A;  2NOJ B;  3I9V 2;  2X48 A;  3U2R A;  4JQF A;  3BTC A;  4EAT A;  1BIA A;  4BQN A;  3FHN A;  1P4X A;  4AVZ A;  4PUS A;  4NQW B;  2GAU A;  1FYM A;  4Y52 J;  3I0T A;  1LVK A;  2DYR H;  3BR2 A;  3HZJ A;  4M3B A;  3RZD J;  4A3E J;  2K9Q A;  1Z1D A;  2ZB9 A;  3B02 A;  1ZLK A;  1X58 A;  3M07 A;  1I39 A;  1ZEL A;  2Z99 A;  3JRD A;  1TQM A;  3RPU D;  1MJB A;  2KKO A;  5K1Y A;  4N0B A;  1D8K A;  1RIO H;  1K61 A;  1O4X A;  3KLO A;  4GRI A;  4CO8 A;  2DOF A;  1FY7 A;  1S7O A;  1MSE C;  1SD6 A;  1GUU A;  1ZGA A;  3C7J A;  4EJT A;  1T08 B;  1XDS A;  3FXJ A;  3WTY C;  2NOG A;  3G4S I;  3K7A J;  3HTS B;  2CUE A;  2E34 A;  1MMS A;  1X2M A;  2M8G X;  1TWC J;  2FRH A;  4UB6 C;  5L3C A;  5LGU A;  1XSX A;  4IOC F;  1VQO I;  2OJE D;  2NS7 A;  1JHF A;  3OIO A;  2LVS A;  1BL0 A;  1Z3Y A;  2V1U A;  3P9I A;  2R7V A;  2MG4 A;  3LFK A;  1FWZ A;  2A5W A;  2KIQ A;  4OAZ A;  1WFX A;  4CIC A;  4YII A;  2ETH A;  2LD5 A;  2L02 A;  4XSZ F;  3D5R C;  2DPD A;  4J01 A;  1G2H A;  3ZQC A;  1U78 A;  1UG0 A;  2HPI A;  3CCY A;  3H1C A;  1CQT A;  1A6I A;  3Q3S A;  1GV5 A;  4CZC A;  2R7O A;  3TQN A;  5J40 A;  1KU7 A;  1XB4 A;  1KU2 A;  2HS5 A;  3K4M A;  5KAF C;  4F92 B;  1HA8 A;  5JR3 A;  2L7K A;  1U2W A;  4GO1 A;  4B3X A;  2EA2 A;  2R7X A;  2AHQ A;  5FKO A;  2HTJ A;  3S3O A;  4BEH B;  3CDI A;  3ZQI A;  3BPX A;  2AQF A;  4UV8 A;  1WJB A;  4HF1 A;  3A02 A;  3ZP5 A;  2M45 A;  2DBB A;  4OIN F;  4F3Q A;  4D5F A;  4HQE A;  3VFZ A;  3EET A;  1MBK A;  4BUP A;  1HQC A;  2HVS A;  1W0T A;  2MD0 A;  4ITV A;  4E7I A;  4E7Z A;  2L01 A;  1YS6 A;  1YRN A;  2QBY A;  3J7A O;  1QQI A;  1WJF A;  4D5C A;  1B9M A;  2LTP A;  2KIU A;  2XAQ A;  4MFE A;  1IRZ A;  1X19 A;  2OA4 A;  4ENJ A;  4PFP A;  4DGW B;  3TP0 A;  4M6V A;  4AVP A;  4FAS D;  3J80 Z;  1UHM A;  3Q0V A;  4XR6 A;  4F7Z A;  2JJ7 A;  2ZBK A;  1RET A;  2QLZ A;  3GCM A;  3S8P A;  3GW2 A;  3DP7 A;  1ZGW A;  4IPA A;  2OTJ I;  1FYL A;  2HYG D;  5D8L B;  3SZT A;  1U8R A;  2CW8 A;  2VAS A;  1KA8 A;  3EPZ A;  2HYF A;  3ZQQ A;  3I56 I;  3M4O J;  2RGV A;  3I4P A;  4EVI A;  3FBN B;  1O3Q A;  5IPA A;  3HOT A;  3OOU A;  2OZU A;  4UUS A;  4M3D A;  5JFR A;  3K70 C;  3AG3 H;  4IJA A;  3GZN B;  1LFU P;  1RPW A;  2L0K A;  3CD6 I;  4M6X A;  4LK1 F;  3HGG A;  3EUH C;  2LK2 A;  2M30 A;  3BG6 A;  2DN0 A;  2HOE A;  2OPT A;  4I6Z A;  4XLN F;  3LAP A;  4HBL A;  3QYF A;  1XGS A;  1HDD C;  1UCR A;  3FK7 A;  4LFU A;  3H0G J;  2OBP A;  5EJC A;  3OYN A;  2GIV A;  3OYG A;  2ECB A;  2LF7 A;  2KMU A;  2O5R A;  2FU4 A;  4MTE A;  2KDO A;  4LJZ F;  3QU3 A;  5FRN A;  4CXF A;  4L5I A;  2XUB A;  2DK8 A;  2HQ5 A;  2FQ3 A;  3VPR A;  2BY0 A;  1SVO A;  2HVR A;  5HDG A;  2FBK A;  4XN0 A;  2V1N A;  2CGP A;  2VXZ A;  2GXA A;  2DFI A;  3SDB A;  4KIT B;  1W36 C;  2UZK A;  2DJN A;  3KEQ A;  3Q5F A;  3FKJ A;  2ACJ A;  1TWG J;  2HOA A;  3BLY A;  4OAY A;  4IRI A;  1Y1V J;  3L9F A;  1MSF C;  5J1U A;  4RGX A;  3IL2 A;  4BAY A;  4Y15 A;  1FOW A;  2VT3 A;  5HS7 A;  4RA2 A;  2KJC A;  2CV2 A;  1B4A A;  3EUA A;  1WKM A;  1ETQ A;  3OYH A;  1FIA A;  1XSD A;  4A0Y A;  4LD5 A;  4AYB A;  3A03 A;  1YX5 A;  5TGT A;  2AQE A;  2QEX I;  3HPG A;  1KGS A;  4M73 A;  4FT8 A;  4B1R A;  3DEU A;  2F4I A;  3HRS A;  1ZLJ A;  3B6C A;  3BCA A;  1F1Z A;  1LB2 A;  3RPQ A;  2ESN A;  2E2J J;  3DEE A;  4ZC3 A;  2XSD C;  2JVH A;  3F0C A;  3RIR A;  1HC8 A;  2XKO A;  4XM3 A;  4XLF A;  1EF4 A;  2XGC A;  3IC7 A;  3GLL A;  3VOE A;  2XPW A;  2ZJR F;  1I1G A;  3F8M A;  3VDX A;  1N78 A;  2Y9Z A;  1Z6T A;  3IH4 A;  4GYI A;  3HIF A;  3KZY A;  3MQ0 A;  2MYS A;  1R22 A;  2VB6 A;  1E0E A;  2XPV A;  4L0Y B;  1S8N A;  1ORK A;  4DYR A;  1VQM I;  2NYX A;  2ZKZ A;  4IXA A;  2H27 A;  1EH7 A;  2EZK A;  3O6B B;  5LGT A;  1WJA A;  3WE2 A;  3JRG A;  4XOP A;  3BRO A;  2NVX J;  3AG4 H;  1IN7 A;  4UY8 I;  3FHZ A;  1T33 A;  2K7L A;  3L7W A;  5D6F A;  3IHU A;  3CDH A;  4P9U A;  1V54 H;  4S0H B;  1NHA A;  2KIM A;  3U9G A;  1XMX A;  1A6Q A;  1U9O A;  2FSW A;  2IBD A;  4C3H J;  3WTS C;  2HXO A;  4P9F A;  5FGM A;  4EGY A;  4DYC A;  2LMD A;  2ADU A;  3E97 A;  2DA7 A;  1OFC X;  2E2I J;  4FCY A;  2HWV A;  1IN4 A;  3DTK A;  4HF2 A;  1ZQ3 P;  2QQ9 A;  2NNN A;  1Z67 A;  4IRH A;  2QQ8 A;  2GZW A;  2EK5 A;  5B1B H;  5ED4 A;  2FX0 A;  2BYV E;  1BI0 A;  1OYY A;  3Q0W A;  2XB0 X;  1IV6 A;  3GTK J;  2Y2Z A;  1HSJ A;  1I50 J;  1BI3 A;  3P7N A;  4MGR A;  4B43 A;  3I55 I;  2ZME A;  2G0E A;  2LC2 A;  5DD4 A;  2DT6 A;  2ZXI A;  2KJB A;  2X1E A;  2L2O A;  3DV8 A;  5E79 C;  2QVO A;  3CCV I;  2WAQ N;  4XQF A;  1PUF A;  1HBX G;  2VBY A;  1R5H A;  4U87 A;  1I1S A;  5LHH A;  4HDU A;  2BBY A;  4BE2 A;  2O61 A;  2R5Z A;  3CCJ I;  2ELK A;  2WA0 A;  4O5V A;  2Q0O A;  5IOZ A;  4EGZ A;  1GT0 C;  1IRG A;  3HRM A;  3QP5 A;  5E8I A;  2NVQ J;  3P5J A;  1R1U A;  1HW1 A;  1JTX A;  3FXQ A;  4EMS A;  2DYS H;  1FBQ A;  1JJ8 C;  1YRN B;  2QBY B;  2F6C A;  2A3S A;  4XRM A;  1W7P A;  4LG3 A;  1P4W A;  2ZNY A;  3HHG A;  1IUF A;  2WB1 N;  2DAO A;  1NG6 A;  4FIS A;  1WCM J;  2QKL B;  1XTA A;  4FHT A;  3SFI A;  4PSX A;  5K5Q A;  2O03 A;  4NNJ A;  3WG7 H;  2O3F A;  1T0F C;  1MMD A;  3O2P E;  2VI6 A;  3HBL A;  3S93 A;  3MAJ A;  3ULQ B;  2VBW A;  4G9Y A;  1UST A;  4QIW N;  1QZE A;  2D5V A;  3QPH A;  3TO7 A;  2KZG A;  3IWF A;  1BR1 A;  1Y39 A;  2P8T A;  3CP2 A;  3HDD A;  3HM5 A;  4UUS B;  4XSX F;  3HB9 A;  4LLG F;  2DTR A;  1TLH B;  1O7L A;  3QOP A;  4M71 A;  1MDM A;  5CVU A;  2PX9 A;  4WXH A;  5CVI A;  5E3L A;  2CO5 A;  4C2M J;  3RKW A;  3MEX A;  3CC7 I;  2M4G A;  2VN2 A;  3F72 A;  3REO A;  2XHK A;  5J6X A;  1J09 A;  1EKE A;  3FDY A;  2R93 J;  4HZF A;  3M8F A;  1R00 A;  3H35 A;  4UV9 A;  2L9S A;  4LIU A;  3OMY A;  4HQM A;  4WF2 A;  4I0B A;  4U0W A;  5J47 A;  3OYA A;  3C1D A;  1GLN A;  3LSM A;  5C44 J;  4RS8 A;  4M6Y A;  2NVY J;  1SD7 A;  3OSF A;  4OMZ A;  5FD5 A;  2R92 J;  2O7O A;  4KT6 A;  4PDK A;  4FET A;  3GTQ J;  3NAU A;  1HLV A;  3RKY A;  2M0M A;  2JK3 A;  3RI4 A;  3VYR B;  2F5E A;  5J1R A;  4XKW A;  2XRO A;  1FMW A;  4A0Z A;  2RAE A;  4RBO A;  1YW9 A;  2ECC A;  2BHY A;  1TQI A;  2QA4 I;  2EQR A;  1IUY A;  4PJJ A;  4P96 A;  1G3S A;  2FJ1 A;  4N4N B;  4HST A;  2CQ7 A;  2GA1 A;  4II3 A;  1LQ1 A;  3UKG A;  1ZN2 A;  4E7H A;  3HGY A;  4DBQ A;  4C9Y A;  5GAE J;  3CCL I;  1S5L C;  2ESH A;  4ASN A;  3FBI B;  1Z05 A;  1TWA J;  3BQY A;  3SQN A;  3HXL A;  4F93 B;  5JHU A;  1QNT A;  2EV0 A;  2X51 A;  5J1Y A;  5FRM A;  3ML6 A;  1HDP A;  1IF1 A;  1A35 A;  1T56 A;  4ZTJ A;  2NNY A;  1R36 A;  2QCO A;  2AXT C;  1BOB A;  5BS6 A;  5C4J J;  2R7T A;  3CC4 I;  2O6G E;  3R0A A;  1UHW A;  2FOW A;  4V19 K;  4IOA F;  1L3L A;  4KIB A;  3E6B A;  4X1E A;  5CJ9 A;  2R7Z J;  2XAJ A;  1IV8 A;  2EZI A;  3PSI A;  1M1E B;  2UXX A;  3ZR8 X;  2Z2S B;  4B48 A;  1I6X A;  1PYV A;  1PVE A;  1J5Y A;  2ID3 A;  2CQN A;  3NQO A;  1O57 A;  2X6Y A;  3CMM A;  3MN2 A;  2EB7 A;  4RLQ A;  4JP0 A;  2EFW A;  2CYY A;  4KMF A;  2UUZ A;  2E1C A;  2ELJ A;  2DFE A;  2OTL I;  2XAF A;  2HXI A;  3PSF A;  2IXS A;  2Z1D A;  2O9L A;  4LK0 F;  3OYF A;  3NAR A;  2IT0 A;  4ENM A;  4XON A;  3U1D A;  2DOE A;  2DOD A;  4L5E A;  1LKX A;  2K40 A;  2E7X A;  2X1D A;  3KCC A;  4MNU A;  3RSN A;  5DS9 A;  1ITY A;  4RGR A;  3CJR B;  2EIJ H;  3IAM 2;  1WVR A;  1K7A A;  2W00 A;  4BE1 A;  2EWN A;  2XF7 A;  5FJ8 J;  2HYJ A;  2E36 A;  1OKR A;  3RKQ A;  2DDA A;  3DQV C;  4XMY A;  3F6V A;  3DEW A;  4PGH A;  2VOO A;  1SFK A;  2IRF G;  4HNT A;  2BV6 A;  3ZPL A;  3GUD A;  4F91 B;  5IT9 K;  3GEZ A;  2CQK A;  4BHB A;  3BR1 A;  2A61 A;  3PO2 J;  4L5J A;  4ON0 A;  4NC8 A;  1MBH A;  2VBX A;  4J00 A;  3QRF F;  4I7H A;  5F64 A;  4A93 J;  2OC6 A;  2LY1 A;  3CLO A;  3CDL A;  1E3O C;  3A4C A;  4NDL A;  1T6S A;  3T0Y A;  5E3N A;  2L5Q A;  1SD4 A;  4S05 A;  1FSH A;  3KX2 A;  3BJO A;  4CH7 A;  4EM2 A;  4BBS J;  1NK2 P;  2KZV A;  3HG9 A;  1FBU A;  2XSJ C;  1J75 A;  2HTS A;  4D0P A;  2F5C A;  4EJW A;  2M34 A;  3WTX C;  4QSH A;  1R7J A;  4UUV A;  1ZAR A;  1PUF B;  3F3X A;  4MQ9 F;  4EJO A;  1RR7 A;  1EH6 A;  3CME I;  2L4M A;  2LKP A;  4RAY A;  2MBF A;  5HNF A;  1VQP I;  4ZYE A;  4JK1 X;  4KIF A;  1HKQ A;  3V8J A;  3HOV J;  2M3A A;  1EH8 A;  2FBI A;  2R5Z B;  4HX7 A;  4P5O A;  4R1H A;  3KYD B;  2NVU B;  2EBI A;  3OR1 C;  3IH3 A;  2Y9Y A;  2EIM H;  1UMQ A;  4LLL A;  1WPK A;  1HCR A;  2VJ4 A;  4V2G A;  1R1T A;  2IGN A;  3H92 A;  4IHW A;  4LOC A;  3OR2 C;  4CGZ A;  2CRG A;  4AM3 A;  2V26 A;  2CFO A;  1W7P B;  4RGU A;  1U6G A;  2WAQ A;  1D5V A;  1MND A;  3BJA A;  2L4A A;  3RJP A;  2EFN A;  4AWX B;  2G9W A;  2VJI A;  4ENK A;  4KMU X;  3LQQ A;  3CCR I;  3K4C A;  3TOA A;  2EPF A;  2W1O A;  2BW3 A;  3S16 J;  3OL3 A;  3V7C A;  2DK5 A;  3BR6 A;  3L2W A;  2I8D A;  1HW2 A;  2JUG A;  4XNF A;  2P5K A;  5EGO A;  3C2H A;  1MBG A;  2E1O A;  3QOD A;  1JKR C;  2NVT J;  5HDN A;  5F04 A;  1W1W E;  5GAG J;  4CCN A;  4PGG A;  1DU6 A;  2M1B A;  2JTV A;  1WH5 A;  4YIR X;  3MWM A;  3G1L A;  1BA5 A;  3T8R A;  2FNP A;  1MDM B;  5L3D A;  1T8I A;  2E71 A;  5B3S H;  1KQ0 A;  2K9N A;  1IRX A;  1D1B A;  1MMG A;  1N77 A;  1SD5 A;  3KP3 A;  3LQR A;  1HST A;  3GXO A;  3M9A A;  1JKO C;  2E7W A;  3QAH A;  4WK8 F;  1LVA A;  1VQ7 I;  3WHB A;  3HSE A;  4MO7 A;  1DPR A;  5CQE A;  2HDD A;  3FKI J;  1W7P D;  3L2Q A;  3ASN H;  2Z33 A;  2VOD A;  2BEO A;  2A6H F;  2DFF A;  2L54 A;  2XF6 A;  2K4B A;  3OS1 A;  1ETK A;  5GAH J;  2R7R A;  4I09 A;  5C3E J;  2DA5 A;  1EV7 A;  4QPQ A;  4P1W A;  2R5Y A;  1FZP B;  3D5L A;  9ANT A;  3KZI C;  1QPM A;  1IDZ A;  5HLH A;  3WGG A;  3LSJ A;  5KHD A;  1YLF A;  3WE3 A;  4I76 A;  3CJN A;  1D1A A;  2CG4 A;  2M5W A;  3OYI A;  3ZCO A;  4EV0 A;  3KP4 A;  4UVA A;  1B1B A;  1ZTR A;  2AO9 A;  2JUC A;  1P92 A;  3JSO A;  1AU7 A;  5E1X A;  1MJ9 A;  4RB1 A;  4MQV A;  3JAM K;  1CF7 B;  1D0Z A;  2DI3 A;  3WTZ A;  1BW5 A;  2Q8K A;  2WWY A;  4A3L J;  3IKV A;  1T2K A;  1B8I A;  4IEJ A;  3V7S A;  4IO9 F;  2CFX A;  3H3U A;  2PFB A;  2PI0 A;  5B5E C;  2DA2 A;  2I10 A;  4CA0 A;  2HOT A;  4Y13 A;  2DLL A;  3GX4 X;  4B4C A;  4BQA A;  3ABK H;  3AG1 H;  3ZXS A;  1YS7 A;  3ZQL A;  1FOY A;  4HV5 A;  5E3M A;  1BI2 A;  1XX5 A;  5AON A;  3E5U A;  3SDG A;  3ZGK A;  4Q47 A;  5LEK A;  4M3G A;  4CDG A;  1T38 A;  1IGN A;  1R71 A;  2LSO A;  3E3V A;  1FX7 A;  2DT7 B;  3O8H A;  2B7E A;  3CQZ J;  2Q1Z B;  2HOS A;  2VJJ A;  5D4S A;  5ICE A;  1G8X A;  2CW7 A;  2K9S A;  4BNC A;  2GXG A;  4FX0 A;  2FNA A;  2P4W A;  1JGG A;  5H6Q A;  4BXU A;  1TNS A;  2PN6 A;  2W4S A;  1P2F A;  3VYS B;  3V8L A;  1Z7L A;  2IP2 A;  4A5N A;  1FTT A;  2H1K A;  2PMU A;  3OWT A;  2KPM A;  5BPI A;  4E7J A;  4QPO A;  3KE2 A;  3LSI A;  4AIK A;  4L9N A;  4IHS A;  1ACI A;  3S14 J;  4E70 A;  1TQP A;  1AKH A;  1VI0 A;  1DGW Y;  3LNQ A;  1BBY A;  4G12 A;  4AC0 A;  2M7B A;  1SFU A;  5DV5 A;  1E3H A;  1S7E A;  3GFM A;  1GVJ A;  3M1E A;  2VLA A;  1R49 A;  1IAW A;  2GIZ A;  3RCO A;  1DQU A;  3KP2 A;  3VYT B;  3PL8 A;  2QSH X;  4BQQ A;  1Z21 A;  4BXX J;  3E6M A;  5E3O A;  2L7Z A;  2STW A;  1J2X A;  4AU7 A;  3OS0 A;  3BPV A;  4GYG A;  1YYV A;  2IS1 A;  1CGP A;  1XGO A;  4HYE A;  2LP0 A;  2M0C A;  2QF7 A;  1DPU A;  1JE8 A;  3R60 A;  2XDV A;  4ESB A;  2B0L A;  2QGU A;  2PJR A;  1N25 A;  1K6O A;  2WC2 A;  3MZY A;  3DKX A;  2HEO A;  4BHC A;  1I3A A;  4G7O F;  3TED A;  1PP8 F;  2LKS A;  3K4N A;  3W6V A;  5LRS A;  3F6O A;  4M74 A;  2VC0 A;  5J4Y A;  4L9V A;  1ZYR F;  5EZG A;  2GOM A;  3K2A A;  2V9P A;  1KQ9 A;  2MC3 A;  1K4T A;  2W82 A;  1YJN I;  3ERE D;  1B9N A;  2RRE A;  1BM9 A;  3OYE A;  3CF5 F;  4BDZ A;  3F8C A;  1K6Y A;  4IQ4 A;  2VPL A;  2Y69 H;  3FM3 A;  1UFM A;  2M8E A;  2QM3 A;  4Z2Y A;  2HKX A;  1SFX A;  3E5Q A;  3K69 A;  2K4J A;  2DTZ A;  5KAI C;  3DBL B;  2R7W A;  3WU1 B;  1P6R A;  3DU5 A;  1RRJ A;  1Y6I A;  1XCV A;  3IH2 A;  3FXL A;  5HOO A;  2V4J C;  2A05 A;  4CZZ A;  2GWR A;  2HZD A;  3OYJ A;  3A1Y A;  1POG A;  3FMS A;  4B09 A;  3MKY B;  3MD2 A;  2DXI A;  1FP2 A;  1QVT A;  2W57 A;  3RTR A;  2P81 A;  2DQL A;  3DLA A;  4YFK F;  4ZYH A;  5J3L A;  4W1U A;  3GZ6 A;  1B72 B;  2X9D A;  2UXN A;  3H9G A;  1QRY A;  3KFW X;  1KZH A;  1S6L A;  2WAD A;  2P7V B;  4AID A;  4U7B A;  3BOQ A;  2IGK A;  2MFZ A;  1VZ0 A;  3BR0 A;  2DQR A;  3QWL A;  3OYL A;  3MKL A;  4MEX F;  1R6R A;  2V1X A;  4X0G A;  3GWZ A;  3PFI A;  5F0C A;  2BVM A;  2IGM A;  4ZYG A;  5HDK A;  4Y3O A;  4A3G J;  2Y0S N;  2BE5 F;  2IA1 A;  3IAS 2;  1A31 A;  3OYM A;  3K9T A;  3DF8 A;  4HEA 2;  2PJP A;  1IXS B;  5EGO B;  5KVR A;  3BZK A;  4XLC A;  3GTG J;  5M3M J;  5ERI A;  1OCC H;  1V5F A;  3CCE I;  3S1R J;  4A6D A;  4HW0 A;  2LDU A;  4JBA A;  3VSK A;  4NUB A;  3F21 A;  1W0U A;  2H09 A;  1QPI A;  2XKP A;  2M2E A;  3KPH A;  3CCU I;  3HKZ A;  4YEJ A;  1O3S A;  4MTD A;  4C2T A;  4JX5 A;  1BC7 C;  2VQH A;  1ODD A;  3QPL A;  3A0B C;  4WX9 A;  4ZYD A;  3KIO A;  2QWW A;  3LWF A;  3GF2 A;  5GTI C;  3G2B A;  1WH7 A;  4A0X A;  4Z6Y A;  3IRR A;  2GOX B;  1IO2 A;  1IDY A;  3ZMS A;  3LA2 A;  1UG2 A;  5M5Y J;  2DMP A;  1OCZ H;  3L2U A;  4G6D A;  3QQA A;  3H3Z A;  2X6O A;  2IAI A;  5HLG A;  4KFC A;  4LB5 A;  3OL4 A;  1DP3 A;  3WTT C;  1WQ2 A;  2QQA A;  3FMR A;  2V7F A;  2VJ5 A;  5HNH A;  1DP7 P;  2QUF A;  1H89 C;  2ZFU A;  1FMV A;  2JA2 A;  5AIP A;  2V1D A;  2R5Y B;  2J5P A;  2K85 A;  2BXY A;  2H1L A;  1R58 A;  5EDN A;  3GFL A;  3R0J A;  1VND A;  4KYW A;  2DCE A;  5J4V A;  3DBH B;  4ZYA A;  1TT0 A;  5F0H A;  4QTR A;  3DKY A;  3PIP F;  5HLI A;  5FLV A;  2M9H A;  4AUX A;  3F23 A;  1ERD A;  4JYK A;  1XG1 A;  3BTL A;  5EZH A;  1PDN C;  4HV6 A;  1XC5 A;  2F4M B;  2LRE A;  3IP4 B;  4RGS A;  1OR7 A;  4BJ5 C;  4KIS A;  2VL8 A;  4XL9 A;  3GME A;  4HDV A;  2A5Y B;  5K5R A;  3OY9 A;  2JT1 A;  3D0S A;  1B8I B;  3D5S C;  3G1M A;  4RLF A;  3DPT A;  3QYB A;  2HZT A;  5CVR A;  3ABU A;  2KDZ A;  1XDU A;  3QOE A;  4XRF A;  2MA3 A;  3HUG A;  1TC3 C;  1G6N A;  1SEU A;  1X3Z B;  3WTU C;  5JVG F;  4BQO A;  3HRU A;  3G3Z A;  3FF5 A;  2Y31 A;  1YQA A;  1YIO A;  5E18 F;  1YO5 C;  3FXO A;  1ZGJ A;  2ICW G;  4R8H A;  3MZH A;  3A2K A;  3EYI A;  4U88 A;  5IT9 Z;  2E2H J;  1ZG1 A;  1V3F A;  3QYE A;  2PMZ N;  5ICF A;  4CYC A;  2MSY A;  1G3W A;  1DUX C;  3NWT A;  2P6T A;  4PK4 A;  2CUJ A;  5BQT A;  2FBH A;  5FRO A;  1QHG A;  1FC3 A;  3L2V A;  1UB9 A;  2H8W A;  3S1N J;  2M4K A;  2JA7 J;  5DUI A;  2EFQ A;  4Q4Z F;  2BOL A;  4KT5 C;  2YR2 A;  2UWM A;  1J59 A;  1SAX A;  3KP7 A;  3DTI A;  1TW3 A;  2ZXW H;  1YI2 I;  1RI7 A;  2X6W A;  4KUM A;  5HS8 A;  2IPQ X;  2KP6 A;  2LNB A;  4NC7 A;  1MW7 A;  4TV7 A;  5D4R A;  1KQ8 A;  1SAN A;  3BTJ A;  2PLY A;  1AKH B;  3GTO J;  1Z77 A;  3DBR B;  1XPX A;  3W3C A;  3LSG A;  3N4M A;  1B59 A;  3H36 A;  3LA7 A;  4RAZ A;  3OOP A;  4GDF A;  4I01 A;  3V8K A;  4WCG A;  1FTZ A;  3FXK A;  3FMQ A;  5ICG A;  3CMA I;  5D5W B;  5C4X J;  1JUM A;  3JRF A;  4PFO A;  4AIJ A;  1YOV B;  4XIC A;  3L2C A;  1X3U A;  1APL C;  4G8X A;  2YX7 A;  1ZRD A;  3BTI A;  2XRN A;  2ZSI B;  3QPT A;  2YU9 J;  3PO3 J;  3BZ6 A;  3CCS I;  4ZH4 F;  2MGQ A;  1YIT I;  1MBF A;  1PJR A;  4BJ6 C;  2PJR B;  2IS6 A;  2EH3 A;  4L9J A;  1OCO H;  5CVV A;  2R0Q C;  3BJ6 A;  1VQN I;  2WAF A;  4UUT A;  2HDC A;  1X2N A;  2DW4 A;  3H9J A;  4V2F A;  5L3E A;  1XMA A;  2UV1 A;  3CO6 C;  3K1N A;  2CV0 A;  3VWB A;  3TBI A;  1BC8 C;  2BY1 A;  2XAH A;  4WXC A;  1ETO A;  2KRC A;  5DCF A;  2YS9 A;  5HS9 A;  3AFH A;  3ZMU A;  1ETW A;  2W84 A;  1HKT A;  2R3S A;  2A69 F;  4XRS A;  1Y1W J;  3HOY J;  1P7I A;  2EZH A;  3PQJ A;  2X6X A;  1P7J A;  2RVC A;  5IYB J;  4BHP A;  1DDN A;  2XGE A;  2BHZ A;  2QKM B;  3KEY A;  3OV8 A;  3L1P A;  4ZTF A;  2DOA A;  2OV7 A;  2RC4 A;  2FMY A;  3JSP A;  2K3P A;  3T5X A;  1O3R A;  3JR9 A;  4BAC A;  4C30 A;  3SZP A;  4FE4 A;  2A68 F;  2W85 A;  3ZMV A;  5E1Z B;  3SFZ A;  2LH9 A;  1Y8Q B;  4BJT A;  1E3P A;  1E17 A;  2J5O A;  3BCB A;  1OJL A;  3Q9S A;  1YFH A;  1FYK A;  1VQL I;  4WXD A;  1IN5 A;  2Z3Y A;  2F5F A;  2G7U A;  3GO5 A;  3A0H C;  4NB5 A;  1BW6 A;  1STZ A;  3H3V K;  4G7H F;  2EFO A;  3BDD A;  5IY5 H;  3TGN A;  4HNU A;  3I4N J;  3BC8 A;  3LMM A;  4CCM A;  2STT A;  2YX4 A;  4RM3 A;  1X3W B;  4OWR B;  2OQG A;  4U0V A;  4KA4 A;  3LSP A;  3KET A;  2P5L C;  4CHU A;  4ZDL A;  1W4M A;  3TOB A;  1VTN C;  4OIO F;  4RB2 C;  1SMY F;  3TP3 A;  1YW8 A;  2YUS A;  3BG5 A;  4MIM A;  1IRF A;  3E6D A;  4DIQ A;  2OQR A;  3JAM Z;  1X4O A;  4IKF A;  1S29 A;  3W2V A;  4N9I A;  1G59 A;  4A3F J;  1I27 A;  1FPQ A;  4ABZ A;  4U7D A;  5IP6 A;  1FOK A;  1J9I A;  4NQW A;  1H9T A;  4JX6 A;  2Y0S A;  4PJM A;  5EYR A;  3DPL C;  1K79 A;  2K9L A;  2E60 A;  5IP7 J;  3S2H J;  2Y0M A;  4XLA A;  4AD9 A;  3LST A;  2WY8 Q;  2L9V A;  3B6A A;  2CV1 A;  4EJV A;  2JRT A;  4OIQ F;  3FX3 A;  4A3K J;  1O3T A;  5L3B A;  5B66 C;  1MGT A;  3EDP A;  4UVC A;  3I59 A;  3GTP J;  1S7A A;  4H4K C;  3IRQ A;  2QYO A;  5F27 A;  5EEA A;  3WGI A;  5DM7 F;  2ISY A;  2DA4 A;  3VYU B;  1O7F A;  3LOC A;  3UR3 C;  4DNC A;  3WHC A;  2CUF A;  3OYD A;  4J19 A;  1HXD A;  5IP9 J;  3C2B A;  1S3J A;  2N8G A;  2O8X A;  3I58 A;  1ZRC A;  1SFE A;  2MH2 A;  2KIF A;  4OOI A;  2DMQ A;  1AWC A;  2JPB A;  4G94 A;  1UJ8 A;  2XB5 A;  5BNG A;  4LMY A;  2KQR A;  3CJQ B;  1WZ2 A;  3MKW B;  4XK4 A;  2A6T A;  3WU0 A;  4E6K G;  3PUF A;  4EJU A;  4UVB A;  5TRD A;  3HOW J;  3GTL J;  1IW7 F;  3HUG B;  1JT6 A;  5DEQ A;  3OYB A;  5DM6 F;  4L18 B;  3GBG A;  1X1C A;  3JTH A;  3LSH A;  3L00 A;  3GTM J;  1G3Y A;  3CLQ A;  5JLW A;  3GFJ A;  2HQN A;  3K4B A;  4BYY A;  2GQQ A;  3U1K A;  3R4K A;  2M87 A;  2VUM J;  2QSF X;  3JRB A;  3G71 I;  3HOZ J;  1RUO A;  4M3F A;  3J7Z I;  1ZRF A;  5LHI A;  3ZQH A;  4IHX A;  4CYC B;  1RKW A;  5FKL A;  3BZC A;  2VC1 A;  4PSW A;  5AIQ A;  1T39 A;  1OLT A;  3BT9 A;  1XCB A;  3N05 A;  4DOZ A;  5K7F A;  2RQP A;  2Y30 A;  4DQ2 A;  1PP7 U;  3FXM A;  1VQ5 I;  3HSF A;  3VOD A;  5H6R A;  2ZME B;  4EEF G;  4KIG A;  4KDP A;  3E1S A;  3CCM I;  2H8R A;  2XIG A;  3I54 A;  2PG4 A;  3JTG A;  4ESJ A;  1JHH A;  2CU7 A;  4XN3 A;  4XBF A;  4GCV A;  1P9Q C;  1DGR M;  3CUO A;  3M1C A;  5D6E A;  3IKT A;  3JRH A;  2PMZ A;  4EQQ A;  4FTH A;  1H8A C;  5KCM A;  2OCE A;  2HR3 A;  1TWH J;  2NXN B;  3BR3 A;  4XRS G;  4BL0 B;  5H2F C;  1UZC A;  4I99 C;  2XRL A;  5HLT A;  2TCT A;  2IS2 A;  4S04 A;  2LG4 A;  4A2U A;  5K7Z A;  4C2U A;  1H88 C;  3K2Z A;  3DPU A;  1W5T A;  3CUQ A;  1ON1 A;  2IA2 A;  3O8G A;  4YEL A;  1OPC A;  3OYC A;  3FZV A;  1IG7 A;  5GPA A;  2NS0 A;  4F52 A;  1GXP A;  1OIS A;  2GXB A;  1QGP A;  1W5S A;  4W97 A;  1MMN A;  2JRM A;  3TKY A;  2E35 A;  3ZMT A;  2XAG A;  5FB2 A;  5JI6 A;  1MMA A;  1MNE A;  3GZ5 A;  2CS3 A;  1I3Q J;  4CCK A;  1X1D A;  2Q2E A;  5LGN A;  2BXZ A;  4X6A J;  1KU9 A;  2OAZ A;  2VIX A;  1FNN A;  2ZO4 A;  3GYH X;  4IHT A;  4CCO A;  2JPC A;  1X4P A;  4N9H A;  2X1C A;  1JUS A;  4YG2 F;  5L3G A;  4HAM A;  1WI3 A;  3TDU C;  2WB1 A;  4BKX A;  4HOB A;  2FD5 A;  1YTY A;  2XAS A;  1BR4 A;  5JVT A;  4M9S A;  2JSP A;  4N4O B;  4KN4 X;  4KJZ A;  4DZP A;  2MH9 A;  5ILV A;  2R4G A;  1OCR H;  3HJE A;  5A2Q K;  3HSR A;  3TMO A;  1IXC A;  3OSG A;  2E19 A;  1RR8 C;  1LFB A;  2V6C A;  4A12 A;  2EIN H;  5DUK A;  5HOD A;  3J7Y J;  2CH0 A;  3HTU A;  4IZZ A;  1GVD A;  2KL4 A;  2WV1 A;  3LA3 A;  5DTD A;  3N97 A;  4WWC A;  2FF4 A;  6PAX A;  5EEG A;  2HPM A;  1WWX A;  2VKD A;  2CQQ A;  2F5V A;  3ABM H;  3RZO J;  3ISP A;  5ILU A;  4BY7 J;  4LIT A;  4BXF A;  1D0Y A;  3I64 A;  4Q5S F;  5ICC A;  4AIH A;  1MBE A;  1A36 A;  1TL8 A;  3W2A A;  4DBR A;  1KYW A;  1UEL B;  2HQA A;  2LY2 A;  4YFN F;  1YJW I;  3RKX A;  2ZME C;  4QWQ A;  4CCL A;  5FKN A;  3K4L A;  3ZQ7 A;  5LD2 C;  4HX8 A;  2ME0 A;  4PJ0 C;  2RNG A;  1G4D A;  1ZAO A;  3AKZ A;  2IGO A;  3DU6 A;  3MFK A;  1LNW A;  5CVJ A;  2BY3 A;  3UNG C;  2RKH A;  4BU2 A;  2RQQ A;  4UB8 C;  4GFB A;  2COM A;  4F55 A;  5L3F A;  1BI1 A;  3ECO A;  1NH3 A;  3NWS A;  2F4O B;  1XGM A;  1HF0 A;  2CSO A;  2DDB A;  2XF5 A;  2HFH A;  4XKV A;  4RM2 A;  2NRA C;  1Q1H A;  5LBQ A;  1Y56 A;  3S2W A;  3HHH A;  2B9S A;  2KRH A;  3HPH A;  1LEB A;  2MAB A;  4C3J J;  1XMK A;  3I59 B;  2H94 A;  4P55 A;  1W5C C;  3K6G A;  2PMH A;  1R4N B;  1WJ5 A;  2LLK A;  4NC6 A;  3JRC A;  2P5V A;  2ID6 A;  1F43 A;  5J8C A;  3C3W A;  4A3M J;  4H0E A;  2VBZ A;  3RYR A;  2JZY A;  3PUB A;  5E1W A;  4II2 A;  4PJN A;  3OIQ A;  2AS5 F;  3S32 A;  3I3L A;  3JRI A;  1SFO J;  3V4G A;  4LB6 B;  4OIR F;  3NEU A;  2ELH A;  1WSU A;  1FSE A;  2TRT A;  1R5I D;  3FIS A;  2OU2 A;  1LEA A;  2DA1 A;  5GP9 A;  5FLM J;  2BGC A;  4L0Z B;  3WU2 C;  5FLX K;  2LBF A;  4IF4 A;  2G7H A;  3MMY B;  4YRV A;  1A04 A;  4HX4 A;  4G7Z F;  3K70 D;  1ZRE A;  1R1V A;  1U9N A;  1H9G A;  2R7Q A;  4C3I J;  3V42 A;  2DT5 A;  4A5M A;  1YE9 A;  1V5G A;  1VF9 A;  2L7M P;  3LSR A;  2EV6 A;  1K78 A;  2D1V A;  4KNY A;  3E7L A;  3DWL E;  1REP C;  2HVQ A;  2LR8 A;  2X85 A;  2FOK A;  2MLG A;  2GA2 A;  2CW0 F;  3MZ8 A;  4XLH A;  1LDK B;  2H6B A;  2X4H A;  3CMY A;  5FO5 A;  1YIJ I;  2F2E A;  3PQK A;  1X1P A;  4MHG A;  4XKC A;  5E8G A;  4HPQ A;  1YW7 A;  1PUE E;  4RAG A;  3W2W A;  1R23 A;  2VE8 A;  3KP5 A;  1B6A A;  2MD5 A;  3MKZ A;  1UAA A;  4A3D J;  1D8J A;  4LGW A;  3EUK L;  4B47 A;  1RKT A;  1OMI A;  1SC7 A;  2GLO A;  1SAU A;  3BWG A;  3F8N A;  3TDZ C;  2ZXJ A;  2VPR A;  4K2E A;  3FIW A;  3CP8 A;  4DW6 A;  4QLC U;  1U0J A;  3HYI A;  5LLQ A;  4GGG A;  5LEJ A;  1W36 D;  3PNV A;  4Y33 A;  2KLO A;  2VKE A;  3ZMZ A;  3EQL F;  5D5V B;  1MKM A;  4A3B J;  3VEP A;  2Z9O A;  1FP1 D;  3DFG A;  4B8X A;  3E6C C; 
#chains in the Genus database with same CATH homology
 2RV8 A;  1FT9 A;  2RN7 A;  3CUQ B;  1QZZ A;  1F4K A;  1V4R A;  2HQR A;  4PZJ A;  3W6K B;  5FFZ A;  4ZZD A;  5D5X B;  1RUN A;  1FBS A;  2A07 F;  3AAF A;  2IJL A;  2FML A;  5LRR A;  3JW4 A;  2YU3 A;  1ZHF A;  2DPU A;  1XD7 A;  1U5T A;  5D8K B;  3E5X A;  2PQ8 A;  1IXR C;  4OU0 A;  3J81 K;  2DO7 A;  1MJA A;  2QQB A;  2EA4 A;  4HLY A;  1Z9C A;  2ZJ2 A;  1XGN A;  1HKS A;  4ENN A;  3RYP A;  2PBI A;  4UXN A;  5BPD A;  2RDP A;  4IVN A;  3I5U A;  5KK1 A;  1ZH5 A;  1YG2 A;  3ZN0 A;  3K1P A;  3WTV C;  3QP6 A;  2WTE A;  5E20 A;  1XN7 A;  3FXU A;  2QZ8 A;  4O3M A;  2MLK A;  4IRG A;  4RB0 A;  3MCZ A;  4UHT A;  2K27 A;  3GFI A;  2L3D A;  5FFX A;  2PEX A;  5DCM A;  1J7K A;  2JSC A;  2TDX A;  1LJ9 A;  2R7D A;  1G3T A;  1ZG3 A;  2A6E F;  5K5O A;  2Y75 A;  3FWE A;  5CYV A;  2K86 A;  2D1H A;  1USS A;  1J0R A;  1H0M A;  3CUQ C;  4YFX F;  1ON2 A;  2FA5 A;  3GVA A;  4G6Q A;  3B73 A;  1GHC A;  2ZCW A;  3ABT A;  4RB3 C;  3BP8 A;  4M72 A;  2CWE A;  1TTY A;  4XLP F;  1QBJ A;  1GXQ A;  1IN8 A;  3ZMD A;  2R7F A;  3Q9V A;  1BN5 A;  1RNL A;  3IWZ A;  4O6J A;  4CYD A;  4OIP F;  2IVM A;  4PCQ A;  3ZN1 A;  1K78 B;  2P6S A;  4A6E A;  1JXS A;  1OYW A;  2RNJ A;  1TBX A;  2YSR A;  3W6J B;  2ISZ A;  1TW2 A;  2FE3 A;  2XVC A;  2WV0 A;  1BOA A;  1HW5 A;  3L09 A;  3F8B A;  1U3E M;  3CTA A;  3J80 K;  2YPR A;  5FD6 A;  2EJR A;  2D2W A;  4LLN A;  5H20 A;  4BH9 A;  5EEH A;  5A2Q Z;  1LDD A;  3M7G A;  3ECH A;  2XGX A;  3SXY A;  4I0A A;  3P9C A;  1OYI A;  3RPU A;  5LHG A;  3TO6 A;  1D3Y A;  4ESF A;  4ZZL A;  2Z5U A;  3BY6 A;  4LG0 A;  4EM0 B;  4M9X A;  4NHJ A;  1F9N A;  1Z7U A;  2IA0 A;  3K1M A;  3C18 A;  1LDJ A;  5BOX A;  3VB2 A;  1TNT A;  5HVQ C;  1U5T B;  3FXR A;  5F6F A;  5DDG A;  1BJA A;  1KU3 A;  2EFP A;  2VT2 A;  2XV4 S;  4L9T A;  2ZFW A;  3EUH A;  3DXJ F;  1CF7 A;  2IW5 A;  1MD0 A;  2DU9 A;  5IT3 A;  3F22 A;  1QO0 D;  3KP6 A;  2X0L A;  4KIC A;  2FXA A;  3DKW A;  2P7C B;  1R5G A;  1RZ4 A;  3V7R A;  1QZY A;  3KZZ A;  4M9Z A;  5BMZ A;  2V79 A;  1C0W A;  5DCM B;  1MZB A;  4UNO A;  3WG9 A;  5F1R A;  2HGC A;  4MEY F;  5FLX Z;  2Y48 A;  3COA C;  2O0Y A;  4I98 B;  3I53 A;  3WTW C;  3O3K A;  4I02 A;  3M8E A;  4HLX A;  2H6C A;  3G73 A;  2C6Y A;  2F5D A;  3ROU A;  1I5Z A;  2VE9 A;  3QU6 A;  2OD5 A;  5DYM A;  4KN7 X;  1ONV A;  2D45 A;  1IZ1 A;  3CO7 C;  1E2X A;  3KEO A;  4Q48 A;  4ETS A;  2FEZ A;  2NAZ A;  1JGS A;  1L0O C;  1WI9 A;  2VOP A;  1U5T C;  3FM5 A;  2VON A;  3EYY A;  2W24 A;  4U0Y A;  3ELK A;  3K0L A;  3TO9 A;  4FX4 A;  3T1B A;  3P9K A;  3R61 A;  2V9V A;  1AOY A;  1KYZ A;  1SMT A;  3RDI A;  3WGH A;  1Z6R A;  3T8T A;  4I2O A;  1F5T A;  1T98 A;  3F8F A;  1WRJ A;  3GLX A;  4HF0 A;  1BIB A;  2W25 A;  1ZG5 A;  5ILS A;  3LAJ A;  3SHF A;  4HA8 A;  2OZ6 A;  3J81 Z;  5TJJ A;  3NRV A;  1ULY A;  2LF8 A;  1P4A A;  2E1N A;  4R79 A;  4EM1 A;  3HRT A;  5CLS A;  1FLI A;  5J8F A;  4OMY A;  1XSV A;  3R6S A;  2EV5 A;  2QEN A;  2HKO A;  4YIF A;  2KRF A;  3I71 A;  4LG0 B;  5D5U B;  5E17 F;  2AXL A;  1Y0U A;  4GXO A;  5DD8 A;  1Z91 A;  3KLN A;  2ZNZ A;  3HOS A;  1T0F A;  4Y17 A;  3WOD F;  1IN6 A;  2K02 A;  3U2R A;  4JQF A;  1BIA A;  1P4X A;  2GAU A;  1FYM A;  3I0T A;  1Z1D A;  3B02 A;  1ZLK A;  2Z99 A;  1TQM A;  1MJB A;  2KKO A;  5K1Y A;  4N0B A;  1D8K A;  1RIO H;  3KLO A;  4CO8 A;  1FY7 A;  1S7O A;  1SD6 A;  1ZGA A;  3C7J A;  4EJT A;  1XDS A;  3WTY C;  3HTS B;  5LGU A;  2FRH A;  5L3C A;  1XSX A;  1JHF A;  2V1U A;  3P9I A;  3LFK A;  1FWZ A;  4CIC A;  4YII A;  2ETH A;  2L02 A;  4XSZ F;  2DPD A;  1U78 A;  3TQN A;  1KU7 A;  1XB4 A;  1KU2 A;  2HS5 A;  5JR3 A;  1U2W A;  4GO1 A;  2EA2 A;  2HTJ A;  3BPX A;  4UV8 A;  4HF1 A;  3ZP5 A;  2M45 A;  2DBB A;  4OIN F;  4HQE A;  3VFZ A;  3EET A;  1HQC A;  2L01 A;  1YS6 A;  2QBY A;  3J7A O;  1QQI A;  1B9M A;  2XAQ A;  2KIU A;  2OA4 A;  4ENJ A;  4AVP A;  3J80 Z;  1UHM A;  4F7Z A;  2ZBK A;  2QLZ A;  3GW2 A;  3DP7 A;  4IPA A;  1FYL A;  2HYG D;  5D8L B;  3SZT A;  1U8R A;  1KA8 A;  2HYF A;  2RGV A;  3I4P A;  4EVI A;  1O3Q A;  3HOT A;  2OZU A;  5JFR A;  4IJA A;  4M6X A;  4LK1 F;  2M30 A;  2HOE A;  4XLN F;  3LAP A;  4HBL A;  1XGS A;  1UCR A;  4LFU A;  2OBP A;  2GIV A;  2LF7 A;  2FU4 A;  4MTE A;  4LJZ F;  3QU3 A;  4CXF A;  4L5I A;  2XUB A;  2DK8 A;  2FQ3 A;  5HDG A;  2FBK A;  2CGP A;  2VXZ A;  2DFI A;  2UZK A;  3KEQ A;  3Q5F A;  2ACJ A;  4IRI A;  3L9F A;  3IL2 A;  4RGX A;  4BAY A;  4Y15 A;  2VT3 A;  5HS7 A;  2KJC A;  1B4A A;  1WKM A;  1XSD A;  4A0Y A;  4LD5 A;  1KGS A;  4M73 A;  4FT8 A;  3DEU A;  3HRS A;  1ZLJ A;  1LB2 A;  1F1Z A;  3RPQ A;  2ESN A;  3RIR A;  2XKO A;  3IC7 A;  3VOE A;  1I1G A;  3F8M A;  1Z6T A;  4GYI A;  3HIF A;  3KZY A;  3MQ0 A;  1R22 A;  4L0Y B;  1S8N A;  2NYX A;  2ZKZ A;  4IXA A;  2H27 A;  1EH7 A;  3O6B B;  5LGT A;  3WE2 A;  3BRO A;  1IN7 A;  3FHZ A;  2K7L A;  3L7W A;  5D6F A;  3IHU A;  3CDH A;  4P9U A;  1NHA A;  2KIM A;  3U9G A;  2FSW A;  3WTS C;  4P9F A;  4EGY A;  5FGM A;  2ADU A;  3E97 A;  2HWV A;  1IN4 A;  4HF2 A;  2QQ9 A;  2NNN A;  4IRH A;  2GZW A;  2EK5 A;  5ED4 A;  2BYV E;  1BI0 A;  1OYY A;  1HSJ A;  4MGR A;  1BI3 A;  3P7N A;  2ZME A;  5DD4 A;  2KJB A;  3DV8 A;  2QVO A;  1HBX G;  2VBY A;  1R5H A;  1I1S A;  5LHH A;  4HDU A;  2BBY A;  2O61 A;  4O5V A;  2Q0O A;  4EGZ A;  1IRG A;  3HRM A;  3QP5 A;  5E8I A;  1R1U A;  1HW1 A;  4EMS A;  3FXQ A;  1FBQ A;  2QBY B;  2A3S A;  1W7P A;  1P4W A;  2ZNY A;  3HHG A;  2DAO A;  4FHT A;  5K5Q A;  2O03 A;  2O3F A;  3O2P E;  3MAJ A;  3ULQ B;  2VBW A;  4G9Y A;  1UST A;  3QPH A;  3TO7 A;  3IWF A;  2P8T A;  4XSX F;  4LLG F;  2DTR A;  1TLH B;  1O7L A;  3QOP A;  4M71 A;  1MDM A;  5CVU A;  4WXH A;  5CVI A;  2CO5 A;  3RKW A;  3MEX A;  2VN2 A;  3F72 A;  3REO A;  2XHK A;  5J6X A;  4HZF A;  3M8F A;  1R00 A;  4UV9 A;  4WF2 A;  4HQM A;  4I0B A;  4U0W A;  3C1D A;  4RS8 A;  4M6Y A;  1SD7 A;  4OMZ A;  5FD5 A;  4PDK A;  3RKY A;  3RI4 A;  2F5E A;  2XRO A;  4A0Z A;  1YW9 A;  1TQI A;  1IUY A;  4P96 A;  1G3S A;  2GA1 A;  1LQ1 A;  1ZN2 A;  2ESH A;  4ASN A;  1Z05 A;  3SQN A;  5JHU A;  1QNT A;  2EV0 A;  3ML6 A;  1IF1 A;  2NNY A;  1R36 A;  5BS6 A;  2O6G E;  3R0A A;  1UHW A;  1L3L A;  4KIB A;  3E6B A;  5CJ9 A;  2XAJ A;  2UXX A;  1I6X A;  1J5Y A;  3NQO A;  1O57 A;  2EFW A;  2EB7 A;  4KMF A;  2CYY A;  2E1C A;  2XAF A;  4LK0 F;  2IT0 A;  4ENM A;  3U1D A;  2E7X A;  3KCC A;  4MNU A;  4RGR A;  1K7A A;  2EWN A;  1OKR A;  3DQV C;  3F6V A;  4PGH A;  2VOO A;  2IRF G;  2BV6 A;  3ZPL A;  3GUD A;  5IT9 K;  3GEZ A;  2CQK A;  4BHB A;  2A61 A;  4L5J A;  4ON0 A;  3QRF F;  2VBX A;  4I7H A;  5F64 A;  3CLO A;  1T6S A;  3T0Y A;  4S05 A;  1SD4 A;  1FSH A;  3BJO A;  4EM2 A;  1FBU A;  1J75 A;  2HTS A;  4D0P A;  2F5C A;  4EJW A;  3WTX C;  1R7J A;  4UUV A;  1ZAR A;  3F3X A;  4MQ9 F;  4EJO A;  1EH6 A;  2L4M A;  2LKP A;  4RAY A;  2MBF A;  4ZYE A;  4JK1 X;  4KIF A;  1HKQ A;  3V8J A;  1EH8 A;  2FBI A;  4HX7 A;  4P5O A;  4R1H A;  4LLL A;  1R1T A;  3H92 A;  4CGZ A;  1W7P B;  4RGU A;  1U6G A;  1D5V A;  3BJA A;  2L4A A;  3RJP A;  2EFN A;  4AWX B;  2G9W A;  4ENK A;  4KMU X;  3LQQ A;  3TOA A;  3V7C A;  2DK5 A;  1HW2 A;  2P5K A;  5HDN A;  4PGG A;  2M1B A;  2JTV A;  3MWM A;  3T8R A;  2FNP A;  1MDM B;  5L3D A;  1KQ0 A;  1SD5 A;  3KP3 A;  3LQR A;  1HST A;  3GXO A;  3M9A A;  2E7W A;  3QAH A;  4WK8 F;  1LVA A;  3HSE A;  1DPR A;  1W7P D;  2Z33 A;  2VOD A;  2BEO A;  2A6H F;  2L54 A;  2K4B A;  4I09 A;  1EV7 A;  1FZP B;  3D5L A;  1QPM A;  5HLH A;  3WGG A;  1YLF A;  3WE3 A;  3CJN A;  2CG4 A;  2M5W A;  4EV0 A;  3KP4 A;  4UVA A;  1B1B A;  3JSO A;  1P92 A;  5E1X A;  1MJ9 A;  4RB1 A;  4MQV A;  3JAM K;  1CF7 B;  3WTZ A;  2DI3 A;  2Q8K A;  2WWY A;  3IKV A;  1T2K A;  3V7S A;  2CFX A;  3H3U A;  2PFB A;  2PI0 A;  4Y13 A;  2DLL A;  3GX4 X;  4BQA A;  1YS7 A;  4HV5 A;  1BI2 A;  5AON A;  3E5U A;  4Q47 A;  5LEK A;  1T38 A;  4CDG A;  2LSO A;  3E3V A;  1FX7 A;  5D4S A;  5ICE A;  4BNC A;  2GXG A;  4FX0 A;  2FNA A;  2P4W A;  5H6Q A;  4BXU A;  1TNS A;  2PN6 A;  1P2F A;  3V8L A;  2IP2 A;  4A5N A;  2PMU A;  5BPI A;  3KE2 A;  4AIK A;  4L9N A;  4IHS A;  4E70 A;  1TQP A;  1BBY A;  1SFU A;  5DV5 A;  3GFM A;  1GVJ A;  3M1E A;  1IAW A;  3KP2 A;  3E6M A;  2STW A;  1J2X A;  3BPV A;  4GYG A;  1YYV A;  1CGP A;  1XGO A;  4HYE A;  1DPU A;  1JE8 A;  3R60 A;  4ESB A;  2B0L A;  1K6O A;  2WC2 A;  3MZY A;  2HEO A;  4BHC A;  4G7O F;  1PP8 F;  5LRS A;  3F6O A;  4M74 A;  2VC0 A;  4L9V A;  1ZYR F;  1KQ9 A;  2MC3 A;  3ERE D;  1B9N A;  1BM9 A;  3F8C A;  3FM3 A;  1UFM A;  2M8E A;  2QM3 A;  4Z2Y A;  2HKX A;  1SFX A;  3E5Q A;  3K69 A;  2K4J A;  3WU1 B;  1P6R A;  1XCV A;  5HOO A;  4CZZ A;  2GWR A;  3FMS A;  4B09 A;  1FP2 A;  2W57 A;  3RTR A;  4ZYH A;  2DQL A;  4YFK F;  3GZ6 A;  2UXN A;  3KFW X;  1S6L A;  2P7V B;  4U7B A;  3BOQ A;  2DQR A;  4MEX F;  2V1X A;  3GWZ A;  3PFI A;  4ZYG A;  5HDK A;  2BE5 F;  2IA1 A;  3K9T A;  3DF8 A;  2PJP A;  1IXS B;  5KVR A;  5ERI A;  4A6D A;  4HW0 A;  2LDU A;  4JBA A;  3F21 A;  2H09 A;  2XKP A;  1O3S A;  4MTD A;  1BC7 C;  1ODD A;  4WX9 A;  4ZYD A;  2QWW A;  3LWF A;  3GF2 A;  4A0X A;  3IRR A;  3ZMS A;  3LA2 A;  4G6D A;  3H3Z A;  5HLG A;  4KFC A;  4LB5 A;  3WTT C;  1WQ2 A;  2QQA A;  3FMR A;  1DP7 P;  2QUF A;  5AIP A;  2V1D A;  2J5P A;  1R58 A;  3GFL A;  3R0J A;  4KYW A;  5HLI A;  3F23 A;  1PDN C;  4HV6 A;  4RGS A;  1OR7 A;  4HDV A;  2A5Y B;  5K5R A;  2JT1 A;  3D0S A;  3DPT A;  2HZT A;  5CVR A;  3ABU A;  1XDU A;  4XRF A;  2MA3 A;  3HUG A;  1G6N A;  3WTU C;  3HRU A;  3G3Z A;  3FF5 A;  1YQA A;  1YIO A;  5E18 F;  1YO5 C;  1ZGJ A;  4R8H A;  3MZH A;  3EYI A;  4U88 A;  5IT9 Z;  1ZG1 A;  1V3F A;  5ICF A;  1G3W A;  1DUX C;  2P6T A;  5BQT A;  2FBH A;  1FC3 A;  1UB9 A;  5DUI A;  2EFQ A;  4Q4Z F;  4KT5 C;  2YR2 A;  2UWM A;  1J59 A;  1SAX A;  3KP7 A;  1TW3 A;  1RI7 A;  4KUM A;  5HS8 A;  2IPQ X;  2LNB A;  4TV7 A;  1KQ8 A;  5D4R A;  2PLY A;  3N4M A;  1B59 A;  3LA7 A;  4RAZ A;  3OOP A;  4I01 A;  3V8K A;  4WCG A;  3FMQ A;  5ICG A;  5D5W B;  4AIJ A;  3L2C A;  1X3U A;  4G8X A;  2YX7 A;  1ZRD A;  2XRN A;  3QPT A;  3BZ6 A;  4ZH4 F;  4L9J A;  5CVV A;  3BJ6 A;  2HDC A;  2DW4 A;  5L3E A;  1XMA A;  3CO6 C;  3K1N A;  1BC8 C;  2XAH A;  5DCF A;  4WXC A;  5HS9 A;  3ZMU A;  2W84 A;  1HKT A;  2R3S A;  2A69 F;  3PQJ A;  2RVC A;  4BHP A;  1DDN A;  3OV8 A;  2RC4 A;  2FMY A;  3JSP A;  1O3R A;  3T5X A;  3SZP A;  2A68 F;  2W85 A;  3ZMV A;  5E1Z B;  3SFZ A;  1E17 A;  2J5O A;  3Q9S A;  1YFH A;  1FYK A;  4WXD A;  1IN5 A;  2Z3Y A;  2F5F A;  2G7U A;  3GO5 A;  4NB5 A;  1STZ A;  4G7H F;  2EFO A;  3BDD A;  3TGN A;  2STT A;  2YX4 A;  2OQG A;  4U0V A;  4KA4 A;  3KET A;  2P5L C;  4CHU A;  1W4M A;  3TOB A;  1VTN C;  4OIO F;  4RB2 C;  1SMY F;  1YW8 A;  3JAM Z;  1IRF A;  3E6D A;  2OQR A;  1S29 A;  4N9I A;  1I27 A;  1FPQ A;  4U7D A;  1FOK A;  1J9I A;  4NQW A;  1H9T A;  3DPL C;  1K79 A;  2Y0M A;  4AD9 A;  3LST A;  4EJV A;  2JRT A;  4OIQ F;  3FX3 A;  1O3T A;  5L3B A;  1MGT A;  3EDP A;  4UVC A;  3I59 A;  1S7A A;  3IRQ A;  2QYO A;  3WGI A;  2ISY A;  1O7F A;  4DNC A;  1HXD A;  1S3J A;  2O8X A;  3I58 A;  1ZRC A;  1SFE A;  2MH2 A;  2KIF A;  4OOI A;  1AWC A;  2JPB A;  4G94 A;  4LMY A;  3WU0 A;  5TRD A;  4EJU A;  4UVB A;  1IW7 F;  5DEQ A;  4L18 B;  3JTH A;  3L00 A;  1G3Y A;  3GFJ A;  2HQN A;  4BYY A;  2GQQ A;  3R4K A;  2M87 A;  1RUO A;  1ZRF A;  5LHI A;  2VC1 A;  5AIQ A;  1T39 A;  1XCB A;  2RQP A;  4DQ2 A;  1PP7 U;  3HSF A;  3VOD A;  5H6R A;  2ZME B;  4KIG A;  4KDP A;  2XIG A;  3I54 A;  2PG4 A;  3JTG A;  4ESJ A;  1JHH A;  4XBF A;  4GCV A;  3IKT A;  3CUO A;  5D6E A;  4EQQ A;  2HR3 A;  4S04 A;  4A2U A;  3K2Z A;  1W5T A;  3CUQ A;  1ON1 A;  2IA2 A;  1OPC A;  3FZV A;  2NS0 A;  1GXP A;  2GXB A;  1QGP A;  1W5S A;  3TKY A;  3ZMT A;  2XAG A;  5FB2 A;  5JI6 A;  3GZ5 A;  2Q2E A;  5LGN A;  1KU9 A;  2OAZ A;  2ZO4 A;  1FNN A;  3GYH X;  4IHT A;  2JPC A;  4N9H A;  4YG2 F;  5L3G A;  4HAM A;  3TDU C;  4HOB A;  1YTY A;  2XAS A;  5JVT A;  4M9S A;  4KN4 X;  2MH9 A;  5ILV A;  5A2Q K;  3HSR A;  1IXC A;  2V6C A;  4A12 A;  5DUK A;  3HTU A;  3LA3 A;  3N97 A;  4WWC A;  2FF4 A;  6PAX A;  5EEG A;  1WWX A;  3ISP A;  5ILU A;  3I64 A;  4Q5S F;  5ICC A;  4AIH A;  1KYW A;  4YFN F;  3RKX A;  4QWQ A;  3ZQ7 A;  4HX8 A;  1G4D A;  1ZAO A;  3MFK A;  1LNW A;  5CVJ A;  2RKH A;  2COM A;  5L3F A;  1BI1 A;  3ECO A;  1XGM A;  2CSO A;  2HFH A;  2NRA C;  1Q1H A;  5LBQ A;  3S2W A;  3HHH A;  1LEB A;  1XMK A;  3I59 B;  2H94 A;  4P55 A;  2PMH A;  2P5V A;  5J8C A;  3C3W A;  4H0E A;  2VBZ A;  3RYR A;  2JZY A;  5E1W A;  2AS5 F;  3V4G A;  4LB6 B;  4OIR F;  3NEU A;  2ELH A;  1WSU A;  1FSE A;  2OU2 A;  1LEA A;  2BGC A;  4L0Z B;  5FLX K;  4IF4 A;  2G7H A;  1A04 A;  4HX4 A;  4G7Z F;  1ZRE A;  1R1V A;  1H9G A;  2DT5 A;  4A5M A;  2EV6 A;  1K78 A;  2D1V A;  4KNY A;  1REP C;  2FOK A;  2MLG A;  2GA2 A;  2CW0 F;  1LDK B;  2H6B A;  2X4H A;  5FO5 A;  2F2E A;  3PQK A;  4MHG A;  5E8G A;  1YW7 A;  1PUE E;  1R23 A;  2VE8 A;  3KP5 A;  1B6A A;  2MD5 A;  1D8J A;  4LGW A;  1OMI A;  3BWG A;  3F8N A;  3TDZ C;  2ZXJ A;  4K2E A;  4QLC U;  3HYI A;  5LLQ A;  4GGG A;  5LEJ A;  3ZMZ A;  3EQL F;  5D5V B;  1MKM A;  3VEP A;  2Z9O A;  1FP1 D;  3DFG A;  4B8X A;  3E6C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...