1S7OA

Crystal structure of putative dna binding protein sp_1288 from streptococcus pygenes
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYPHDEYLQEKISILTSIDNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the putative DNA-binding protein SP_1288 from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m3
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0122 protein SPy1201/SpyM3_0842/SPs1042/spyM
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7oA00
3R0AA 5FD5A 1BC8C 1V4RA 3I59B 4F7ZA 4XRFA 1ZG5A 2X0LA 1YYVA 3P9CA 1BIBA 2EB7A 2M5WA 4Y13A 2A69F 4LG0A 2MH2A 4HLYA 2XRNA 1CF7A 2IVMA 2YX4A 3LA3A 3BWGA 4MEXF 3QU3A 4G7OF 3IWZA 1MZBA 1CGPA 4HBLA 3E6DA 4KIGA 1R58A 1YS7A 2PI0A 1SAXA 1H9GA 2M45A 5H6RA 3CUQB 3WTWC 3T0YA 2E1CA 1ZGJA 1RI7A 2L3DA 2XUBA 1G3TA 4CO8A 4FX0A 4L9VA 2LNBA 2DFIA 1B9MA 3T8RA 4IRIA 2DI3A 2VBWA 4M6YA 1YO5C 1OYWA 5DD4A 2P6TA 4A6DA 3BPVA 1G3WA 1WRJA 2P5VA 2CQKA 3REOA 1TQMA 4G7ZF 1DPUA 3GVAA 1O57A 4G6QA 3GXOA 4NHJA 2EV6A 2QENA 2CO5A 3ZQ7A 3M9AA 1ZN2A 3DXJF 5CVVA 1EH8A 4RGRA 2K7LA 3FMRA 1ZLKA 1TQPA 2O0YA 5L3GA 4XLNF 5CYVA 3FZVA 4EJUA 2OQRA 2MA3A 5FB2A 2IRFG 3QOPA 2FBIA 3LFKA 4LJZF 1W7PB 2PEXA 5LGTA 1B1BA 4XBFA 5HDNA 1E2XA 2P7CB 1XSDA 1MDMB 3EDPA 1OYYA 1DP7P 2NNYA 3RKYA 2L54A 3BPXA 1ZGAA 2QQBA 1R22A 1IN6A 4ZYEA 2VC1A 3DPLC 1I6XA 2HS5A 1SD5A 3BY6A 4I01A 1D8JA 3V7SA 2ESNA 4UXNA 4U0VA 2JRTA 2W57A 3K2ZA 3E5UA 1CF7B 1ZG3A 1FC3A 1SFXA 4HV5A 4WXDA 1BN5A 2LSOA 2GIVA 1U8RA 2W24A 2EK5A 3F8MA 3AAFA 3MQ0A 4IHTA 4EV0A 4KNYA 1USTA 4KN7X 1J7KA 1BI2A 1ZRFA 1KGSA 3ZPLA 3IL2A 5DUKA 2XAGA 2B0LA 4Q4ZF 1RNLA 3TOBA 2RN7A 3T5XA 4R1HA 3HRMA 2KRFA 1KQ8A 3N4MA 5JHUA 5TRDA 2P7VB 4O6JA 2WTEA 5E8IA 1F4KA 2KIUA 3EYIA 2CFXA 5DCMB 1W7PA 2QVOA 4HW0A 4OMZA 3KLNA 4MGRA 1QQIA 2H6BA 2VBZA 2DPDA 3K1NA 4L9TA 5KK1A 4HOBA 2FF4A 3V4GA 4FX4A 3G73A 3WE3A 3PFIA 4IPAA 2XVCA 1BI0A 3GLXA 3TOAA 2DK8A 1STZA 3JAMZ 4NB5A 1IW7F 3D0SA 2FBHA 2HKXA 5E1XA 2O3FA 2KJBA 3BDDA 4HAMA 2JPBA 2P4WA 3GF2A 2DTRA 3RDIA 5ILVA 4KDPA 2OQGA 2XIGA 3GZ5A 3DQVC 2F5FA 2XHKA 1IN7A 1O3RA 4BNCA 3MAJA 3ELKA 3JW4A 4OMYA 1HKTA 2GZWA 4G9YA 2Z5UA 4RS8A 2CGPA 1I27A 3BZ6A 5LRSA 1VTNC 3T1BA 4IXAA 5LEJA 3IKTA 2W85A 4OIPF 3KP2A 4O3MA 1USSA 4EGZA 4HDUA 1S8NA 4LK1F 1HW2A 4N9IA 3MZYA 2Z33A 2D45A 1W7PD 1FX7A 5E1ZB 1TW3A 5CJ9A 4AIHA 3R60A 1XGOA 3ZP5A 1ZYRF 5DCMA 1IRFA 4AWXB 1MJ9A 1FPQA 4RB2C 2Y0MA 4ENKA 1FZPB 4RB1A 1HXDA 2EJRA 4RB3C 3I58A 3GZ6A 3EQLF 4HX7A 1D3YA 3NQOA 2VODA 4WXHA 2MH9A 4MHGA 1AWCA 3ZMTA 1T38A 1IUYA 3ZN1A 2DPUA 3I64A 3F6OA 1Z05A 3E97A 1PDNC 3QP6A 4Q47A 1K6OA 1YG2A 3ZMSA 4UNOA 1HSTA 5D5UB 1JGSA 1FSHA 5HLGA 2M1BA 5FFZA 2Y75A 5D4RA 1B9NA 4GXOA 3N97A 5BOXA 4PGHA 1SD4A 1G3YA 2P8TA 2D1VA 1B4AA 4CDGA 3RIRA 2IT0A 3IRRA 2Q0OA 2Z9OA 3E5QA 1U5TC 2H94A 1IN8A 4RAZA 1R5GA 4CGZA 2DLLA 4OU0A 1UHMA 3V8JA 2KJCA 4ENJA 1AOYA 1W5TA 3KP7A 3LAPA 2OAZA 2LKPA 3HRUA 2HEOA 4MTEA 5IT9Z 2RGVA 5D5VB 4L9JA 1S7OA 3K69A 5FLXZ 2EA4A 2Q8KA 4KUMA 3QU6A 3Q5FA 4G6DA 3TDZC 5J8CA 3R6SA 2FA5A 2A6HF 1O3TA 3FHZA 1FLIA 1Z9CA 3I53A 2RNJA 3VEPA 2JTVA 4KMFA 3GFIA 5IT9K 2V1UA 3HSFA 1X3UA 2NAZA 2J5OA 5E17F 3WTUC 3O2PE 4HV6A 3EUHA 4JBAA 2A61A 2ISYA 1OR7A 4I09A 2VN2A 1E17A 2XV4S 5BMZA 1XSVA 2H09A 4M9ZA 4KYWA 1GVJA 4EM1A 4P5OA 5AONA 4HX8A 5K5QA 1G3SA 1TQIA 5CVJA 4EJVA 3CDHA 5LEKA 1PP7U 4I7HA 4EMSA 2PBIA 2PMUA 3ABUA 4M72A 1L0OC 3EETA 1ZHFA 2XAQA 5E1WA 2ZFWA 1XMAA 1S6LA 1WI9A 1KU2A 2HDCA 3KEQA 2Z3YA 1S3JA 1P2FA 3DP7A 4BHBA 1JHFA 2H6CA 3F23A 3BROA 1Z6TA 5JFRA 3KLOA 2FRHA 5CVIA 2OZUA 1UCRA 2DU9A 4ENNA 5FO5A 3HYIA 1JE8A 1O3SA 4ESBA 3MCZA 2G7HA 1T39A 4JK1X 4PDKA 2O03A 3I59A 2IP2A 2DBBA 3LWFA 3P7NA 3RYRA 1FP1D 1J2XA 4RGXA 1PUEE 5BPDA 5H6QA 4YFNF 3LAJA 1IZ1A 2MLGA 5LHGA 1W5SA 2CSOA 2HFHA 2PN6A 4A0YA 3KP6A 1W4MA 1P4WA 1FT9A 2ZBKA 3IWFA 1FSEA 1J9IA 2ZMEB 1DUXC 1U5TB 4HQEA 1Q1HA 3WE2A 2P6SA 1D5VA 3GYHX 2QQ9A 2KKOA 4U88A 3SXYA 2K4BA 1T0FA 1R1UA 4EJTA 4E70A 4M73A 5DCFA 3C7JA 2VBXA 3E6MA 2COMA 3PQJA 1R1TA 3RPQA 5J8FA 2XAHA 4RGSA 4QWQA 3V7CA 1ZLJA 1QNTA 1YS6A 4K2EA 5HS8A 3WU0A 2V6CA 4EJWA 1P92A 2JPCA 4L18B 4HYEA 3EYYA 1XN7A 2GA1A 1J5YA 1UHWA 1O3QA 3L7WA 3W6JB 1ZRCA 4L9NA 4WXCA 3ECOA 4U0WA 4HX4A 1WQ2A 1ULYA 2FE3A 1IN5A 2BEOA 2EV5A 1LNWA 5LLQA 3F8NA 1F1ZA 4ZZLA 2EFWA 5DUIA 3SZTA 4A12A 2BGCA 2ZJ2A 2XAFA 2OA4A 5K5RA 1IXRC 1U78A 1LVAA 3TO6A 3R0JA 1IXCA 1DDNA 3IC7A 1C0WA 2FEZA 4HF2A 3I0TA 1QZYA 4OOIA 1Y0UA 4IVNA 3U1DA 3KE2A 4Y17A 4D0PA 2F2EA 2A6EF 4P9UA 1UB9A 3E6CC 2D1HA 3J81K 2EFNA 5D6EA 3L9FA 4S04A 2O61A 5ED4A 2E7WA 5LRRA 1KYZA 4WX9A 2HYGD 5E8GA 1NHAA 5F6FA 1PP8F 3RYPA 5DEQA 4GO1A 1FBQA 2PMHA 1XGMA 3MZHA 2W84A 4CICA 4EM0B 3KZZA 3LA2A 5EEGA 4O5VA 5ICGA 4ENMA 2GWRA 2PJPA 3CLOA 4ASNA 4I0BA 3HUGA 2HGCA 4HLXA 1U5TA 2F5DA 3ZMDA 3RPUA 3QRFF 2M8EA 3CO6C 2CWEA 3TO9A 3CTAA 1HKQA 3QPHA 2R7FA 1K78B 1XCBA 1T6SA 3Q9SA 3H92A 3KP4A 2VE8A 1G4DA 3JTGA 5L3DA 5TJJA 1TNSA 1FP2A 1HQCA 1BIAA 4MQVA 5L3FA 3QPTA 3CO7C 4G8XA 1K79A 2QBYA 2A3SA 2QZ8A 2DW4A 4LK0F 1I1SA 4GYGA 1LDDA 2WV0A 1GHCA 4ZYHA 1TTYA 5JI6A 3J80K 2QUFA 2HOEA 5BS6A 2YPRA 3ECHA 1V3FA 4L0ZB 3LQRA 5L3EA 2A5YB 3PQKA 4GGGA 3HRTA 3R4KA 4BQAA 2MBFA 3RI4A 5LHHA 2HKOA 3BJ6A 4QLCU 2OU2A 4HDVA 4L0YB 3F22A 2XAJA 2GXGA 5J6XA 2UWMA 3FXQA 1YIOA 4A5MA 1R00A 1OPCA 1BOAA 2OD5A 1FBSA 3F21A 3CUQA 2DAOA 1LEBA 2UZKA 1IN4A 5FD6A 1SD6A 3FWEA 1MGTA 2EFQA 2CW0F 4G7HF 4M9XA 3KFWX 3GO5A 1GXPA 2H27A 2FU4A 4LG0B 3WTTC 3HIFA 1KQ0A 1HBXG 2ZXJA 3F72A 4M71A 3SQNA 2QBYB 1O7FA 2DQLA 2K02A 5DV5A 3BJAA 4YIIA 3TKYA 2RDPA 1SD7A 3HSRA 3L2CA 1ZREA 2X4HA 4Q48A 2CG4A 2W25A 3J81Z 2FNPA 1R5HA 2VOOA 2RKHA 3VFZA 2E7XA 1H0MA 4ZYGA 4FHTA 3WTSC 1LEAA 4KT5C 2DT5A 1F9NA 2R7DA 3SZPA 2DO7A 3O3KA 3FXRA 2JZYA 1R36A 1KU3A 6PAXA 1R7JA 2F5CA 3RJPA 4ETSA 1L3LA 1HKSA 2NRAC 4MNUA 1FYMA 1J0RA 3D5LA 2FMLA 4BYYA 4CYDA 2UXNA 2VC0A 1QBJA 4LLNA 2YSRA 5A2QK 3RKWA 3DEUA 2FXAA 4DQ2A 4BHPA 3C1DA 1TW2A 2FQ3A 4IHSA 3TO7A 2MLKA 1WWXA 3GW2A 4A6EA 5HDGA 1KU9A 1ZAOA 2FSWA 1ZRDA 2UXXA 1OYIA 1TLHB 3IRQA 2C6YA 2XKOA 5CLSA 2ZCWA 2BV6A 2HWVA 4ON0A 4UVBA 2QLZA 1LQ1A 2PLYA 4TV7A 2NYXA 3H3UA 5ICFA 2PFBA 2AXLA 5HVQC 5HS7A 5D5WB 3BJOA 3HTSB 4A0ZA 3WTXC 2CYYA 3C3WA 3WTVC 4I2OA 2NS0A 2V9VA 2GQQA 2QM3A 4M9SA 4P9FA 4IJAA 1KA8A 1U3EM 1R1VA 1YFHA 1ODDA 2RV8A 2ELHA 3RKXA 5L3BA 3B02A 4KICA 1Z91A 5CVRA 3E3VA 2IPQX 4EJOA 5KVRA 5LGUA 3ISPA 3KP3A 4RAYA 3HHGA 5HLHA 2HYFA 1XSXA 2IA1A 1LB2A 1FY7A 3DF8A 1BM9A 5EEHA 1TBXA 5K1YA 3JSPA 5D4SA 4I98B 1D8KA 4HF1A 1KYWA 1MKMA 2PQ8A 3WGIA 4N0BA 1YLFA 1I5ZA 3VOEA 4KIFA 4U7DA 3WU1B 3P9KA 5JVTA 5DDGA 5D6FA 4MEYF 1LJ9A 1ZARA 3CJNA 4LB5A 5K5OA 3ZMUA 3FM5A 5AIPA 3HSEA 1REPC 5ILSA 3GFJA 2DQRA 2HQNA 4ZZDA 1YW8A 1O7LA 2R3SA 4GYIA 4Y15A 4WF2A 2NNNA 3ZMZA 4KFCA 3GUDA 4EGYA 3F3XA 1Z6RA 4MQ9F 2O6GE 3F8CA 1Z1DA 3S2WA 3J80Z 2E1NA 4MTDA 3DKWA 4EM2A 3MWMA 2LDUA 3CUOA 4KIBA 1BC7C 5LHIA 4PZJA 4IRHA 1LDKB 4EVIA 1FOKA 5A2QZ 2QWWA 2ZNYA 2K4JA 2GXBA 4LD5A 4OINF 2V1DA 3O6BB 3JSOA 3SFZA 3HOTA 3IHUA 4A2UA 1FYLA 1WSUA 2V1XA 3JTHA 3KETA 2IW5A 4BAYA 3K9TA 2FNAA 4I0AA 1U2WA 2VOPA 2HQRA 2EFPA 1IF1A 1FNNA 2Q2EA 2VXZA 3G3ZA 4PGGA 3R61A 1DPRA 4YIFA 2HR3A 1I1GA 3U9GA 1U6GA 3DV8A 2VBYA 1J75A 2WC2A 4M74A 1IAWA 2BE5F 4HA8A 3VB2A 2XROA 2HTSA 1P6RA 4A0XA 1H9TA 2V79A 3JAMK 1YTYA 5ICCA 4CZZA 3WODF 4XLPF 4ESJA 3L00A 5ICEA 4UVCA 2AS5F 2IA2A 2ADUA 1ONVA 3IKVA 2BBYA 2Y48A 2VT2A 1ON1A 1FBUA 5FFXA 4KMUX 3NEUA 3K1MA 2LF7A 1JHHA 1T2KA 2STTA 3P9IA 4UVAA 1MD0A 2VONA 1YQAA 1P4AA 4WWCA 3M8EA 1XB4A 2JT1A 4YFKF 2K86A 2A07F 3CUQC 1IRGA 1EV7A 3FM3A 4NQWA 5HLIA 1FYKA 2QQAA 2P5KA 2MC3A 3KEOA 5BPIA 2RVCA 1BI1A 5BQTA 2MD5A 3V8LA 4P55A 5FGMA 4BH9A 1K7AA 5E20A 4LLGF 4IF4A 5HDKA 3Q9VA 4RB0A 1HW5A 3FMSA 1SFUA 4LFUA 3HRSA 1XGSA 2TDXA 2J5PA 1SMYF 2IA0A 4Z2YA 4HF0A 1S7AA 4ZYDA 1LDJA 4AD9A 4B8XA 3DPTA 1FWZA 3LA7A 1BJAA 3L09A 2GAUA 3V8KA 4OIQF 3FMQA 3F6VA 3HHHA 3BP8A 2VE9A 4UHTA 4L5IA 1QPMA 4LB6B 4ZH4F 2ZO4A 3T8TA 2PG4A 3TQNA 1WKMA 2D2WA 2FMYA 4A5NA 2QYOA 3E6BA 3ML6A 4N9HA 2IJLA 3FXUA 4ESFA 2ZMEA 2O8XA 3ROUA 3WG9A 3W6KB 2VT3A 2M87A 4RGUA 3COAC 4AIJA 1MJAA 5F1RA 2OBPA 4H0EA 2L01A 2EWNA 3I5UA 4HQMA 3WGGA 3F8BA 5D8LB 4R8HA 5HS9A 2RC4A 2KIFA 1OKRA 1BBYA 1UFMA 3E5XA 2Z99A 4BXUA 4DNCA 2G9WA 1B6AA 3M7GA 3OOPA 1RZ4A 3KZYA 4L5JA 1KQ9A 3FF5A 5HOOA 3H3ZA 3M8FA 3ERED 4IRGA 3MEXA 3K0LA 2GA2A 3C18A 3TDUC 1R23A 3FX3A 4FT8A 2K27A 3ZN0A 3WTYC 2DK5A 1RUOA 2LF8A 3KCCA 3KP5A 4GCVA 5FLXK 2M30A 1T98A 5H20A 2L4AA 1IXSB 4BHCA 2G7UA 3TGNA 2EA2A 3ULQB 2EFOA 2ISZA 3DFGA 2HZTA 4R79A 5IT3A 1HW1A 2FBKA 1RUNA 1TNTA 1XGNA 1J59A 5L3CA 3GWZA 3LQQA 2ZKZA 5CVUA 3F8FA 2HTJA 5F64A 4B09A 4WK8F 4LMYA 1XD7A 2L4MA 3BOQA 1F5TA 1JXSA 3ABTA 1OMIA 4WCGA 4AIKA 1ZH5A 2BYVE 4HZFA 2JSCA 3QAHA 3I4PA 3U2RA 4OIRF 2F5EA 4S05A 3V7RA 5DYMA 1XMKA 3OV8A 4EQQA 4UV8A 2OZ6A 5ERIA 3HOSA 1MJBA 4LLLA 3SHFA 3ZMVA 4XSXF 1S29A 3WGHA 1KU7A 1B59A 2EV0A 5JR3A 3J7AO 5DD8A 2YU3A 4I02A 4JQFA 5LBQA 3I54A 5ILUA 2XGXA 3NRVA 4UUVA 2YR2A 2XASA 1HSJA 2P5LC 3HTUA 4KN4X 1GXQA 3GX4X 1XDSA 5D5XB 4U7BA 5AIQA 1EH7A 1XCVA 2L02A 3LSTA 3GFLA 3MFKA 2ESHA 4OIOF 3GEZA 2FOKA 4YFXF 1G6NA 5E18F 1QGPA 1Z7UA 3I71A 1YW9A 1ON2A 1ZG1A 1SFEA 4CXFA 5D8KB 4UV9A 4AVPA 4CHUA 1P4XA 4YG2F 1A04A 1YW7A 1K78A 2RQPA 3M1EA 2STWA 4U0YA 3GFMA 2YX7A 4XSZF 5LGNA 4LGWA 2ACJA 4PCQA 3K1PA 1SMTA 2A68F 1QZZA 1RIOH 2ZNZA 3WTZA 3VODA 4Q5SF 2WWYA 1XDUA 3RTRA 2KIMA 2XKPA 4P96A 3QP5A 4M6XA 4G94A 1MDMA 1EH6A 1QO0D 3B73A 2ETHA 1BI3A 4KA4A
chains in the Genus database with same CATH superfamily
3R0AA 5FD5A 5EYRA 3ZQIA 1BC8C 1V4RA 2BZTA 3I59B 4F7ZA 4F93B 4XRFA 4LIVA 1ZG5A 1IGNA 3V42A 2X0LA 1YYVA 3PNTA 3P9CA 2ME0A 1BIBA 2EB7A 4C3HJ 2M5WA 4S0HB 2FOWA 4I6ZA 2E2IJ 4Y13A 2A69F 4LG0A 2DN0A 3KEYA 4XLEA 3RCOA 1TWGJ 2DTZA 3FXKA 2MH2A 2CUEA 4XOPA 2HOTA 4E6KG 4HLYA 2E1MB 2XRNA 1CF7A 3FXMA 2LYCA 2CQ7A 2IVMA 1XTAA 2YX4A 5HNHA 2VQHA 3LA3A 1V5FA 3DU6A 3BWGA 4MEXF 3ZQFA 3QU3A 1G2HA 1MMGA 2MD0A 4G7OF 3S15J 1ETVA 2IS6A 3IWZA 1MZBA 1CGPA 4HBLA 3E6DA 3PL8A 4KIGA 5GP9A 4NDLA 1R58A 1YS7A 2PMZA 3DBRB 2PI0A 1SAXA 3S1QJ 1H9GA 4DBRA 2M45A 3HOWJ 5H6RA 1NG6A 2V6EA 3CUQB 3WTWC 2VKEA 3T0YA 4X6AJ 2E1CA 1ZGJA 1RI7A 3SEZA 3PUFA 2L3DA 2XUBA 5DTDA 5HNFA 2E1OA 1G3TA 2DDBA 1RESA 4CO8A 2WAQN 2R7SA 4FX0A 3CCSI 1JUMA 4L9VA 2LNBA 4RLQA 4A3IJ 1RKTA 2K3PA 2DFIA 2E5NA 3S2DJ 1UAAA 1B9MA 3T8RA 4IRIA 2DI3A 3IAS2 2VBWA 4M6YA 2R7ZJ 1YO5C 2JA5J 1OYWA 4PSXA 5DD4A 4A3LJ 2P6TA 5IOZA 5KAFC 5FKKA 3OYFA 4A6DA 3BPVA 1G3WA 2QSFX 1WRJA 2P5VA 1WZ2A 2CQKA 3REOA 1TQMA 4G7ZF 1GV2A 4XONA 1DPUA 2Q2EB 3GVAA 3O8HA 1O57A 4G6QA 2BXYA 2XGEA 3GXOA 5B5EC 2DJNA 4M6VA 4CZCA 4NHJA 1I6HJ 2EV6A 2QENA 2CO5A 3ZQ7A 3M9AA 4BEHA 1ZN2A 3DXJF 5CVVA 2IGNA 1EH8A 4RGRA 2N8GA 9ANTA 4XLHA 1ZR2A 2K7LA 3HZJA 3FMRA 1ZLKA 2EINH 1TQPA 1AKHB 2M34A 2O0YA 5L3GA 4XLNF 1E3OC 3FDYA 3DLLF 1HDDC 1AU7A 2OUMA 5CYVA 2F6CA 3FZVA 4FETA 2CV0A 4EJUA 2OQRA 1N25A 3NWTA 2MA3A 3ASOH 3BR3A 4U87A 2F4OB 3RPUD 5FB2A 3LSRA 3FHNA 2IRFG 3QOPA 2HVSA 2FBIA 4IHXA 4KT6A 3LFKA 4LJZF 1JUSA 1W7PB 3MN2A 4UY8I 4C3JJ 2PEXA 3FKIJ 5LGTA 3ZQLA 1B1BA 1HCRA 1E3HA 4NBQA 4XBFA 4IHYA 5HDNA 1E2XA 4BGDA 2P7CB 1QHGA 4Z6YA 3HOVJ 1ZK8A 1XSDA 1W0UA 4BXXJ 1MDMB 5H2FC 3EDPA 5F0FA 1OYYA 1DP7P 2E19A 2NNYA 3RKYA 2L54A 3BPXA 1ZGAA 2YU9J 2F48A 4XN3A 2QQBA 2CMPA 1R22A 1IN6A 3GTPJ 4ZYEA 2VC1A 4MIMA 3DPLC 3DEWA 1I6XA 2HS5A 1SD5A 1D0YA 3BY6A 4N4NB 4BDYA 1ERDA 3HKZN 2O8KA 4I01A 4PJ0C 1IRZA 2OC6A 1D8JA 3V7SA 2ESNA 4XKCA 4UXNA 2LOOA 4U0VA 2JRTA 2W57A 3G2BA 3K2ZA 3E5UA 5E3LA 1CF7B 1ZG3A 1VZ0A 1O4XA 1G59A 4XORA 1FC3A 1SFXA 4HV5A 2X6XA 4WXDA 4CSWA 2HDDA 1BN5A 1YIJI 1XS9A 2LSOA 1OFCX 2GIVA 1U8RA 2W24A 2EK5A 3F8MA 1N75A 3AAFA 3MQ0A 4IHTA 4EV0A 4KNYA 1USTA 4KN7X 4A3JJ 1U0JA 3CCMI 1OQYA 1J7KA 3G4SI 1BI2A 4BE0A 1KGSA 4ZTJA 5IP6A 4QTRA 5DUKA 3IL2A 1JKOC 1ZRFA 2OTLI 3ZPLA 4XRMA 1FTTA 1I3QJ 2CJJA 3S2HJ 2XAGA 2B0LA 4M3BA 5C4JJ 4Q4ZF 1RNLA 3KYDB 3DU5A 4HSRA 4XL9A 3TOBA 2RN7A 3T5XA 4R1HA 3BG3A 5FJ8J 3HRMA 2KRFA 2LG4A 5F0CA 2MGQA 4A3FJ 1KQ8A 2FJ1A 3PO2J 1NK3P 1R6RA 3H35A 3N4MA 4RMNA 5JHUA 1ETXA 4RBOA 3MKZA 5TRDA 2P7VB 4O6JA 2WTEA 5E8IA 1F4KA 2KIUA 3EYIA 2CFXA 5DCMB 1U9NA 1W7PA 2IGOA 2QVOA 4HW0A 4D5FA 2O9LA 2CV2A 4OMZA 1UMQA 2LBFB 3KLNA 2L9NA 4MGRA 3GTOJ 4A3MJ 1QQIA 3BTJA 1X3WB 5KHDA 2H6BA 2D5VA 3AG4H 3WU2C 2QA4I 2VBZA 1MNMC 2DPDA 3K1NA 4L9TA 5KK1A 4HOBA 2FF4A 3V4GA 4FX4A 1IDYA 3G73A 3WE3A 3N05A 3PFIA 1J09A 4IPAA 2XVCA 1BI0A 3GLXA 3TOAA 1N77A 2DK8A 1STZA 3JAMZ 4NB5A 2EBIA 1IW7F 3D0SA 2BXZA 2FBHA 2DT6A 2HKXA 2O3FA 5E1XA 2KJBA 3BDDA 5J4YA 4HAMA 5TISC 2DDAA 2JPBA 2P4WA 3GF2A 3RZOJ 2DTRA 2ZFUA 3RDIA 5ILVA 1YX3A 4AUXA 4KDPA 4MLOA 2IS4A 2OQGA 2XIGA 2JWTA 3GZ5A 3DQVC 4A3GJ 2F5FA 2XHKA 3IP4B 2Y31A 4PUSA 2VQCA 2KRCA 1BW6A 1IN7A 4E7LA 1O3RA 2E2JJ 3HOXJ 4BNCA 3MAJA 3ELKA 3JW4A 4OMYA 1HKTA 1GDTA 4XIDA 2GZWA 1FOWA 2CW8A 2Z5UA 2BHYA 4G9YA 4N4OB 4RS8A 2CGPA 2HYJA 4XLAA 1EKEA 1I27A 3BZ6A 2ID6A 5LRSA 1LPQA 2DMQA 1VTNC 4M3FA 3T1BA 2DMUA 4IXAA 5LEJA 3IKTA 5IP9J 3BG9A 4E7JA 4FQGA 4FCYA 4A3KJ 1U9OA 1TT0A 2W85A 3G1OA 2HZDA 4OIPF 1A31A 1FMVA 3KP2A 4O3MA 3H9JA 1USSA 4EGZA 1IDZA 4HDUA 1S8NA 4LK1F 3LMMA 1HW2A 2ECBA 4N9IA 3MZYA 2Z33A 3JR9A 2QKMB 2D45A 3OYIA 1W7PD 1FX7A 1PVEA 2VQGA 3BQZA 5EDNA 1BR2A 5E1ZB 3W2AA 2V9KA 3ZQGA 2ZJPF 1TW3A 5CJ9A 4AIHA 3R60A 1XGOA 2I8DA 2XSDC 3ZP5A 1I3AA 1OCRH 1ZYRF 5DCMA 1IRFA 4AWXB 1MJ9A 1FPQA 3QPLA 1Z3XA 1E3PA 3VYTB 4AU7A 2Y0MA 4RB2C 4ENKA 2DA1A 1FZPB 4RB1A 2GXAA 1HXDA 2M9HA 2EJRA 4RB3C 2H8WA 2FUG2 3I58A 3JRAA 2DOFA 3GZ6A 2AQEA 3EQLF 2B9SA 4HX7A 3DBHB 1D3YA 3NQOA 2VODA 2UV1A 1JT0A 2OPTA 2NXNB 4L5EA 2Z2SB 4WXHA 2MH9A 2X6WA 4MHGA 1AWCA 1CQTA 5FRNA 3ZMTA 2LR8A 1T38A 1IUYA 2VKDA 1YE9A 2CRGA 3PIOF 2RREA 2HQAA 3ZN1A 1QVUA 2DPUA 2DMPA 3ONQA 4M3GA 1LFBA 3K4LA 3I64A 2VPLA 3F6OA 3BCBA 1UG0A 1Z05A 3E97A 1PDNC 3QP6A 4Q47A 1K6OA 2XDVA 1OLTA 3ZRGA 3A01A 1YG2A 3ZMSA 4UNOA 1HSTA 3MKLA 1X2MA 4IHWA 4XLCA 5D5UB 1JGSA 3FXJA 1BR1A 4BQNA 3HL2A 1FSHA 2GBYA 5HLGA 2ZXHA 5EGOA 2M1BA 5FFZA 3SZGA 3BQYA 4Y7NJ 2Y75A 5M5WJ 4C2TA 5D4RA 1DQUA 4OAZA 1B9NA 4GXOA 3N97A 5BOXA 2F4IA 4PGHA 1SD4A 1X2NA 4XN0A 3K70D 1G3YA 2P8TA 4NC8A 2YS9A 2LBFA 2ELJA 2D1VA 1HOMA 1B4AA 2GOMA 4CDGA 3RIRA 2IT0A 1LFUP 2QF7A 3IRRA 2CUJA 3OYGA 2XRLA 2Q0OA 2Z9OA 3E5QA 5M5XJ 1U5TC 4DZPA 3G1LA 2JA6J 1EA3A 2LY2A 2H94A 4LOCA 1IN8A 4RAZA 4IO9F 1D5YA 2GLOA 1T08B 3E7LA 1R5GA 2OCCH 4CGZA 2EH3A 2KIQA 2DLLA 4OU0A 1UHMA 2WY8Q 3V8JA 2KJCA 4ENJA 1R9TJ 3CCRI 1AOYA 1W5TA 3KP7A 3LAPA 2OAZA 2A5WA 2LKPA 3ABLH 4AM3A 3AKZA 4NNJA 3C2GA 3HRUA 2HEOA 4MTEA 5IT9Z 2RGVA 5D5VB 4L9JA 1S7OA 3K69A 1MBHA 1XMXA 2MABA 1VQPI 3LSGA 2EA4A 5FLXZ 2DT7B 2Q8KA 3I4MJ 4KUMA 3QU6A 3Q5FA 1SC7A 4G6DA 3MMYB 3TDZC 2DFHA 2E5ZA 5J8CA 3QYEA 1XC5A 3L1PA 3R6SA 2FA5A 1X3ZB 4B47A 2AO9A 3CF2A 3VPRA 2CUZA 2A6HF 1O3TA 3PUBA 3FHZA 1FLIA 1Z9CA 1DGWY 5F0HA 3I53A 2RNJA 3VEPA 2JTVA 2M7AA 1VQKI 1TT5B 3A03A 4RA2A 4KMFA 3GFIA 3OSGA 2Q1ZB 2LRDA 2V1UA 5IT9K 2VL8A 4HNVA 3JRBA 3OIQA 1IV8A 4ZYAA 3HSFA 1X3UA 1ETQA 2NAZA 4CYCB 4W1UA 4HNUA 2J5OA 5E17F 2DA4A 2LVSA 3WTUC 3LSHA 1BJZA 3OYMA 2CQNA 3O2PE 4HV6A 2XF5A 3EUHA 1QZEA 4JBAA 2A61A 2LKSA 2ISYA 1OR7A 1X19A 2VN2A 4I09A 1E17A 2XV4S 5BMZA 1XSVA 2H09A 3BR5A 4DW6A 1HC8A 3P5JA 4M9ZA 4KYWA 3ZQQA 1GVJA 4EM1A 4P5OA 5AONA 2HNHA 1F43A 4XK4A 2P0WA 2JRMA 4HX8A 5K5QA 3K4JA 1K4TA 1G3SA 1TQIA 5CVJA 4EJVA 3CDHA 3S32A 2ZJRF 1FOYA 3J7AY 1H89C 5LEKA 1PP7U 3CJQB 3GTMJ 4I7HA 4EMSA 2PBIA 2PMUA 3ZR8X 3ABUA 4M72A 2R7UA 3HG9A 1L0OC 3EETA 4D7NA 4UUSA 2BY1A 3BC8A 4QSHA 1D1AA 1Y39A 1ZHFA 2XAQA 3BR6A 5E1WA 3GTGJ 2ZFWA 3S1RJ 2KDOA 1XMAA 2JJ7A 2XAUA 3ZGKA 1S6LA 1WI9A 1KU2A 2HDCA 2JSPA 1S7EA 3U1KA 1ZR4A 3TBIA 1SVOA 3KEQA 5J3LA 2VLAA 4G12A 2Z3YA 3TEDA 1S3JA 3CCEI 1LE8A 1P2FA 3DP7A 3IH2A 2CV1A 1PYVA 4BHBA 2I10A 2IEKA 2ZXWH 1JHFA 2H6CA 2EIMH 5LFAA 3F23A 5HLTA 3BROA 4CA0A 3NARA 1Z6TA 5JFRA 3A01B 3KLOA 4ZDLA 2FRHA 5CVIA 3CESA 4JX4A 2OZUA 1UCRA 1Z67A 1WPKA 3VDXA 2DU9A 4ENNA 5FO5A 1SFKA 2KPMA 2CQQA 3HYIA 1JE8A 2E35A 1O3SA 4ESBA 1X1BA 3MCZA 3JREA 2G7HA 1MBGA 4OAYA 1T39A 2LFBA 4PJLA 1YX5A 4JK1X 1B8IA 2DFEA 4PDKA 2O03A 2E2HJ 3K4BA 2MG4A 3I59A 2IP2A 2DBBA 1T0FC 3LWFA 3P7NA 1FP1D 3RYRA 1J2XA 4RGXA 5BPDA 2MFZA 5H6QA 4YFNF 1PUEE 3LAJA 4BE1A 1IZ1A 1Z77A 2MLGA 5LHGA 4YEJA 1W5SA 2GOXB 5IYBJ 2CSOA 2HFHA 2PN6A 4A0YA 3KP6A 1W4MA 1P4WA 1FT9A 3K4KA 2VKVA 2KFDA 3GTKJ 2ZBKA 1Z3YA 3IWFA 4NUBA 4J19A 1FSEA 1J9IA 1IO2A 2ZMEB 3JCUC 2NVTJ 1DUXC 1U5TB 1Y1WJ 4HQEA 3HPGA 1Q1HA 4BQOA 5DS9A 2L9VA 2JA7J 3WE2A 2KMUA 2P6SA 1D5VA 2DOAA 3GYHX 2QQ9A 2KKOA 4U88A 3SXYA 3PIPF 1ZQ3P 1VQ9I 2K4BA 1A6IA 1T0FA 1R1UA 2V4JC 4EJTA 1JTYA 1BOBA 1TWCJ 4E70A 2WAQA 2LK2A 4M73A 2DA2A 3C7JA 5DCFA 4DYRA 2VBXA 3A02A 2JK3A 3SFIA 3E6MA 3HJEA 1TZLA 2COMA 2ID3A 3TW7A 1VQMI 3PQJA 1R1TA 3RPQA 3DKXA 5J8FA 1MW7A 2OJED 2XAHA 3BTIA 1K6YA 4RGSA 4QWQA 3V7CA 1ZLJA 1QNTA 1YS6A 4K2EA 2V7FA 5HS8A 3WU0A 2V6CA 5J1YA 4EJWA 1P92A 1UHSA 2JPCA 4L18B 4HYEA 1DU0A 3EYYA 1XN7A 2CQXA 2GA1A 1J5YA 1UHWA 2DA6A 4PFOA 1O3QA 3L7WA 2BY0A 4BS9A 2Z16A 3W6JB 1ZRCA 4L9NA 4WXCA 2NVXJ 2CS3A 3M3YJ 3ECOA 3FK7A 4U0WA 3HB9A 2JQ7A 4HX4A 3HGYA 1KONA 1WQ2A 4D5CA 1VQ5I 1V5GA 4RAGA 1ULYA 3S3MA 3G1MA 2FE3A 2MC4A 3OOUA 3VYUB 1IN5A 2BEOA 2EV5A 1LNWA 5LLQA 3F8NA 1VQNI 1GVDA 1F1ZA 2E71A 3F0CA 4ZZLA 4B3AA 1QVTA 4X0GA 2EPFA 3D5SC 4F52A 3ABKH 2EFWA 3D1NI 5DUIA 3SZTA 4A12A 2BGCA 2M8GX 2ZJ2A 2XAFA 3H0GJ 2OA4A 5K5RA 1IXRC 1U78A 1LVAA 3TO6A 2W82A 3R0JA 2R5YA 4XOTA 2DA7A 1W1WE 3CDIA 1IXCA 4FASD 3FK6A 1R4NB 1DDNA 2L7KA 1H8AC 2ME6A 3OYCA 3IC7A 1C0WA 2L7MP 2FEZA 1V54H 3QOEA 2R0QC 5J4VA 1N78A 4HF2A 3I0TA 3S8PA 1QZYA 2MW8A 4OOIA 4BKXA 1Y0UA 4IVNA 1ETKA 2WBMA 1X4PA 3OL4A 3U1DA 4B43A 1A35A 2LMDA 3Q0VA 1QPIA 1WCMJ 3KE2A 3OS1A 5FLVA 2A05A 5F1JA 2IXSA 4Y17A 4D0PA 2P81A 2F2EA 2A6EF 3W2VA 4P9UA 1UB9A 4BY7J 3E6CC 2KDZA 2D1HA 3J81K 2EFNA 1MBJA 3H5NA 3L9FA 2VI6A 5D6EA 4B48A 4S04A 2O61A 3HBLA 1X1PA 2E7WA 5ED4A 1MMDA 5LRRA 3H3VK 1KYZA 4WX9A 2HYGD 5E8GA 1NHAA 4NC6A 5F6FA 3RYPA 1PP8F 5DEQA 4GO1A 4PJJA 1FBQA 2PMHA 4D7MA 1ETYA 1XGMA 3MZHA 2NVQJ 3L2QA 2EIJH 2W7NA 1WJAA 2W84A 2M3AA 4CCMA 2R7VA 4EEFG 1MBKA 2LH9A 4CICA 4EM0B 2RQQA 3KZZA 2L2OA 2Y2ZA 4CCNA 4HPQA 3LA2A 3EUAA 2DOEA 5EEGA 4O5VA 3TP0A 5ICGA 4ENMA 2GM4A 2GWRA 2PJPA 4LG3A 1SFOJ 3CC2I 2ZSIB 2W00A 4ABZA 3CLOA 3BR2A 4ASNA 4I0BA 3HUGA 2HGCA 4Y3OA 3M8JA 5K7ZA 3OIPA 4HLXA 1U5TA 4FISA 4D9JA 4F92B 2F5DA 4QPQA 2CFOA 2KQRA 3ZMDA 3RPUA 2H8RA 4XR6A 4C2UA 5FKMA 1JT6A 4A3CJ 1OCTC 3PO3J 3QRFF 2M8EA 1QRYA 3CCJI 3VWBA 3CO6C 2CWEA 3CCQI 4DOZA 1FMWA 5FRMA 2ICWG 3TO9A 3CTAA 1HKQA 4HNTA 4V2GA 3QPHA 2R5YB 2R7FA 1K78B 1VQ6I 3OSFA 4G6TB 1XCBA 1T6SA 3Q9SA 3H92A 4BJTA 2A6TA 2CU7A 5CQGA 1H88C 3KP4A 5FLMJ 1MSFC 4KJZA 2VE8A 1B72B 2NOGA 1D0ZA 3JTGA 1G4DA 5L3DA 4BY1J 5C4XJ 5TJJA 2CW7A 1JGGA 1TNSA 3DPUA 1S5LC 1FP2A 1HQCA 2RAEA 3FKJA 2KP6A 1X1CA 5GADJ 1BIAA 2JUCA 1WGXA 4PJMA 2ZJQF 4A3BJ 4UB6C 4MQVA 4RAFA 5L3FA 2DYRH 2R7OA 2ZC2A 3FXLA 3QPTA 5FKOA 2JVGA 3CO7C 4G8XA 1K79A 4XRSA 5F27A 1R49A 3DKYA 2A3SA 2QBYA 2QZ8A 2DW4A 3DBLB 1JTXA 3LOCA 3IH3A 1WJEA 4LK0F 1MBFA 3MD2A 4GYGA 1I1SA 1LDDA 3W3CA 2WV0A 2R7TA 1GHCA 4ZYHA 1TTYA 5JI6A 4II3A 3J80K 2QUFA 3U21A 2HOEA 2WA0A 3RQ4A 3DTEA 2DMNA 5IPAA 5BS6A 3RZDJ 5JLXA 2YPRA 3ECHA 1V3FA 3K7AJ 4L0ZB 1MNEA 4HRIA 3LQRA 5L3EA 3LSPA 2A5YB 3JRDA 3PQKA 4GGGA 3HRTA 3DEEA 3R4KA 4M3DA 4B3XA 2V1NA 1Y8RB 4BQAA 2MBFA 3HM5A 3BR1A 4B1RA 5LHHA 2HKOA 3RI4A 2Y0SN 4AC0A 2PX9A 2QSHX 3BJ6A 3A0BC 4QLCU 3HOUJ 1AA7A 3O8GA 2OU2A 1MIJA 4HDVA 4L0YB 2DA5A 3HOYJ 3F22A 2XAJA 2GXGA 5J6XA 2UWMA 3SDGA 1XG1A 3FXQA 1YIOA 2VQLA 3CCYA 4A5MA 5GPAA 2EQRA 5KCMA 1MMSA 1R00A 4UB8C 1OPCA 2BY2A 1BOAA 3GTJJ 2OCEA 2OD5A 1FBSA 2ZXIA 3F21A 3CUQA 3BTLA 4E4HA 2DAOA 3K6GA 3UKGA 2DXIA 1LEBA 2UZKA 3QWLA 1IN4A 5FD6A 2XSJC 1SD6A 1WJFA 3FWEA 4A69C 3S3OA 1MGTA 1Z7LA 2EFQA 1ZTRA 3UNGC 2CW0F 1LVKA 2LLKA 3CCVI 4V19K 4G7HF 3ZQHA 4M9XA 4DJAA 3DTIA 3KFWX 5B3SH 3K4CA 4BDZA 3GO5A 3PJRA 2E36A 1GXPA 2H27A 2FU4A 3GBGA 4LG0B 4BXFA 3WTTC 3HIFA 3LNQA 3CMYA 2PJRA 1KQ0A 1HBXG 2X48A 2BY3A 2ZXJA 5HODA 3F72A 3DTKA 3LSMA 3OYKA 2OTJI 4M71A 3G71I 3GCMA 3SQNA 1BL0A 4BACA 5FKLA 3OS2A 1R5ID 5F08A 3C2HA 2QBYB 1O7FA 2DQLA 3VYRB 2K02A 1YJNI 5DV5A 3BJAA 4YIIA 3TKYA 2RDPA 1SD7A 3HSRA 3L2CA 1ZREA 2BHZA 1A6QA 2X4HA 5C44J 4Q48A 2L7ZA 3S1MJ 3VSKA 2CUFA 2VJ5A 2VIXA 4XQFA 4BE2A 1UG2A 2VB6A 2CG4A 2W25A 5E3OA 3J81Z 3CJTB 4FE4A 2KL4A 2FNPA 1R5HA 3K2AA 2VOOA 3H36A 2RKHA 3VFZA 4DBQA 2E7XA 5EGOB 1H0MA 4ZYGA 2R7XA 3OYEA 4A3DJ 2XPUA 4FHTA 3WTSC 3ZCOA 1B72A 1LEAA 4KT5C 4UUTA 2DT5A 4EATA 1F9NA 2R7DA 1UELB 2EZIA 3QQAA 3SZPA 4D1QA 2DO7A 3O3KA 3FXRA 4DIQA 1TL8A 1VQLI 4XICA 2JZYA 3LSIA 1R36A 1KU3A 6PAXA 5EF6A 2WAFA 1R7JA 2WY7Q 2F5CA 1G8XA 3RJPA 4ETSA 1ZKGA 1L3LA 1HKSA 5GPCA 2NRAC 1EF4A 4E7SA 4MNUA 5K7FA 3MKYB 2HQ5A 1FYMA 1JKPC 1J0RA 3D5LA 3OYHA 3AL0B 1X4OA 5EG0B 2FMLA 4BYYA 4CYDA 2UXNA 1S9HA 2VC0A 1QBJA 4DYQA 3JRFA 4LLNA 3GZNB 2YSRA 2F5VA 3HDDA 5A2QK 4BEHB 3M1CA 3RKWA 2E60A 3DEUA 2FXAA 3H5RA 2EZHA 3WHBA 4DQ2A 4BHPA 1K4SA 1V55H 3C1DA 1TW2A 1Y1VJ 2FQ3A 2XB5A 1RR8C 5F04A 4IHSA 5EJCA 1Z21A 1VNDA 3A2KA 5IY5H 3H0DA 3GMEA 3PSIA 3TO7A 3M4OJ 2MLKA 4PFPA 2KZGA 3FXOA 1WWXA 3PFYA 1RR7A 3GW2A 3VYSB 4A6EA 4CUGA 4MO7A 3CJRB 5HDGA 3ASNH 1IC8A 1KU9A 1ZAOA 2FSWA 1ZRDA 3HC7A 2UXXA 2R4GA 2IBDA 1OYIA 1TLHB 1MSEC 3IRQA 2C6YA 2XKOA 3I56I 5CLSA 2QEXI 2ZCWA 4ZJZA 3TMOA 4CYCA 5LD2C 2BV6A 1T33A 2HOAA 2HWVA 2X6YA 4ON0A 1QHHD 4UVBA 2QLZA 1LQ1A 2PLYA 4TV7A 2NYXA 3H3UA 1VF9A 1VI0A 3A0HC 5ICFA 2PFBA 1SEUA 2AXLA 3CMMA 2G0EA 4I99C 5HVQC 2QSGX 5HS7A 5D5WB 3BJOA 3HTSB 3H1CA 2VJIA 1WH5A 4A0ZA 3WTXC 2UUZA 2CYYA 1U8BA 3C3WA 3FBNB 3WTVC 3AG3H 4I2OA 3DWLE 4JX6A 2NS0A 5GAGJ 4GRIA 2V9VA 3K70C 2GQQA 5GAHJ 4ZDPA 2QM3A 3W2WA 1P7IA 3OYAA 5J40A 4M9SA 1Y56A 4P9FA 2PJRB 1K61A 4IJAA 1KA8A 4UUSB 1U3EM 1R1VA 2BVLA 1T8IA 1YFHA 2I5UA 1OCOH 2HI3A 1ODDA 2RV8A 3B6AA 3SYTA 2ELHA 3RKXA 5L3BA 3B02A 2MYSA 1Z91A 4KICA 5CVRA 2L7FP 3E3VA 1T95A 2IPQX 1WI3A 4EJOA 5KVRA 4F3QA 4ZC3A 4AIDA 5LGUA 3ISPA 3Q0WA 3LSJA 3KP3A 3KYCB 4RAYA 3HHGA 3L2WA 1R71A 4E7KA 5HLHA 2HYFA 3L2UA 1XSXA 2IA1A 2IS1A 2V9PA 1LB2A 1FY7A 3DF8A 3RQIA 1BM9A 5EEHA 1TBXA 5K1YA 2L9RA 3JSPA 1YITI 3S93A 2K40A 3I55I 5D4SA 4I98B 2Y69H 3TP3A 3FBIB 4Y52J 1D8KA 4HF1A 2COBA 2HDWA 3OYBA 1KYWA 4IEJA 5JVGF 1MKMA 2PQ8A 2B7EA 2DJIA 3F9KA 3DCFA 3WGIA 4N0BA 1DP3A 1YLFA 1I5ZA 2BW3B 4CCJA 4E7ZA 2R93J 1MMNA 3VOEA 4KIFA 2K9NA 4U7DA 3WU1B 3P9KA 5JVTA 3I3LA 1NTCA 1D1BA 5DDGA 5D6FA 2M0MA 4MEYF 3PM1A 3A4CA 1D1CA 2JVHA 3CZ6A 3JRCA 1LJ9A 1ZARA 1WJ5A 4BJ6C 3CJNA 2XGDA 3HKZA 3ZOBA 4LB5A 1MMAA 5K5OA 3K4NA 3ZMUA 4BQQA 4RM3A 4YRVA 1IUFA 3FM5A 4I76A 5BNGA 1HLVA 5AIPA 4XNFA 1UJ8A 1BW5A 3HSEA 1REPC 5ILSA 3GFJA 2DQRA 2HQNA 4ZZDA 4RDUA 2Y9ZA 1YW8A 1Z0XA 1O7LA 2K9LA 2W1OA 3HPHA 2Y9YA 3H9GA 5CQEA 3QPSA 2R3SA 4GYIA 4Y15A 4WF2A 2GIZA 2NNNA 2O7OA 3ZMZA 4KFCA 3S16J 3BG6A 2K9SA 2BOLA 3HEFA 2ELKA 3KPHA 3GUDA 1V5EA 3BR0A 4EGYA 3F3XA 4XRSG 2R5ZA 4II2A 3OS0A 1Z6RA 4MQ9F 2O6GE 3F8CA 4H4KC 3OYNA 1Z1DA 3S2WA 3J80Z 2E1NA 4IQJA 4MTDA 2E34A 3DKWA 4EM2A 4CH7A 3MWMA 1I39A 2LDUA 3BZCA 1WFXA 4BBSJ 1LFPA 4PSWA 4B44A 4MFDA 4JOMA 3CUOA 4KIBA 5FROA 2KRHA 1BC7C 3KIOA 5LHIA 4PZJA 5CPRB 3QODA 2RNGA 4IRHA 1LDKB 1T56A 4EVIA 1FOKA 1OCPA 2QWWA 3CP2A 5A2QZ 3JRGA 4P1WA 2ZNYA 2K4JA 1YJ9I 2GXBA 4X1EA 4LD5A 4OINF 2KLOA 3WG7H 4W97A 2TRTA 2V1DA 3JRIA 1JJ8C 3O6BB 3JSOA 3SFZA 3IHUA 4A2UA 3HOTA 1JJ6C 1FYLA 3BG5A 4J01A 2NVYJ 1WSUA 2LY9A 2OV7A 2V1XA 3ERMA 4NQWB 3JTHA 3C2BA 3KETA 2IGMA 2IW5A 4BAYA 1IJWC 3K9TA 2FNAA 4I0AA 1U2WA 2VOPA 2HQRA 2EFPA 1IF1A 1NK2P 1FNNA 4JX5A 2WAEA 2Q2EA 3SJMA 1SAUA 2VXZA 3G3ZA 4PGGA 4PJNA 3X2QH 1D0XA 3R61A 1DPRA 4ANJA 4YIFA 2HR3A 4QIWN 3FISA 2X1EA 2WB1A 1Y6IA 1I1GA 1ORKA 3U9GA 1IRXA 1U6GA 4BJ5C 5EEAA 1JKQC 2ECCA 4FTHA 3DV8A 2VBYA 1J75A 2WC2A 4M74A 1IAWA 1AKHA 2BE5F 4HA8A 4BL0B 3GTLJ 2M2EA 3VB2A 1X1AA 1RPWA 2XROA 4HG2A 3MKWB 2HTSA 1P6RA 4A0XA 1H9TA 2V79A 3JAMK 2LREA 1YTYA 5ICCA 4CZZA 1IG7A 3WODF 4XLPF 2R5ZB 4ZDOA 4ESJA 3L00A 2R7WA 2M4GA 5ICEA 4UVCA 5M3MJ 2AS5F 3H9QA 2IA2A 2ADUA 1ONVA 3IKVA 2BBYA 2Y48A 4IQ4A 2VT2A 1ON1A 3PSFA 1FBUA 3Q0UA 5FFXA 4Y33A 4KMUX 3NEUA 2OF7A 3K1MA 2LF7A 3GLLA 1JHHA 3OYLA 2L0KA 5DM6F 4XM3A 1T2KA 2STTA 1BR4A 2HOSA 2X9DA 3P9IA 1TC3C 3IV5A 1JUPA 4UVAA 5E79C 1MD0A 5CKTA 2VONA 4E7HA 1OCZH 1ZGWA 1YQAA 1P4AA 3SDBA 2EIKH 4WWCA 2X1CA 3M8EA 1JI8A 1XB4A 1RRJA 4A93J 2JT1A 1FOXA 2FD5A 4ITVA 5GTIC 2Z1DA 3KX2A 4XKVA 4YFKF 2K86A 2A07F 3A1YA 3CUQC 3ESWB 4AYBA 1IRGA 1IV6A 5B1AH 1WH7A 1QU3A 1EV7A 3FM3A 2DFFA 3VSLA 4NQWA 5GTHC 2NS8A 1FTZA 5HLIA 2K9MA 1FYKA 3H5AA 2QQAA 1TWFJ 3HXLA 2P5KA 2MC3A 3KEOA 3BZKA 5BPIA 2RVCA 1BI1A 3OL3A 5BQTA 3CCUI 2MD5A 2WV1A 1DGRM 1LE8B 2IS2A 3V8LA 3CMAI 3QYFA 4P55A 5FGMA 4BH9A 1K7AA 5E20A 4LLGF 2O5RA 4IF4A 5HDKA 4V2FA 4HSTA 3Q9VA 5J1UA 4RB0A 2HPIA 1HW5A 3FMSA 4BUPA 2M0CA 3AG2H 4DGWB 4IX7A 3IAM2 1SFUA 2K5CA 4CCOA 4LFUA 3HRSA 2NVUB 1XGSA 2TDXA 2H1KA 1Q1VA 2J5PA 2JUGA 1FEXA 1SMYF 2IA0A 4Z2YA 1VQ4I 4HF0A 1S7AA 4ZYDA 1LDJA 4IHVA 2DCEA 4AD9A 4B8XA 4J00A 1Y8QB 3CDLA 3AFHA 3DPTA 1FWZA 3LA7A 3QYBA 3IUOA 2L5QA 1BJAA 3L09A 5EZGA 2GAUA 2FX0A 3V8KA 5J47A 4OIQF 3FMQA 3F6VA 3HHHA 2EZKA 3OIOA 5TGTA 3BP8A 2VE9A 3S14J 2XF6A 2DA3A 4UHTA 2XC7A 1GUUA 4XLFA 4L5IA 3CF5F 2EILH 1QPMA 4LB6B 2BVMA 1R4MB 4ZH4F 1Y0NA 2YUSA 2ZO4A 4RLFA 3FIWA 3CC4I 3T8TA 2PG4A 2F4MB 1WKMA 2D2WA 2FMYA 2XGCA 3TQNA 4IOAF 4A5NA 2QYOA 3E6BA 3KYLA 3ML6A 4N9HA 4RM2A 2IJLA 3FXUA 4ESFA 5M5YJ 2VXDA 1MH3A 2ZMEA 2HU9A 1OR7C 2O8XA 3ROUA 4F55A 3CP8A 3WHCA 3WG9A 2JN6A 3W6KB 1MBEA 3D5RC 2VT3A 3I4NJ 4MFEA 2M87A 4RGUA 4BBRJ 3HGGA 1MJAA 3COAC 4AIJA 2XF7A 5F1RA 2OBPA 4H0EA 1DU6A 2L01A 4KITB 5EZHA 3J7YJ 2EWNA 5K7HA 2HXOA 5JLWA 1GV5A 3I5UA 4HQMA 3WGGA 1KZHA 2DMTA 3L2VA 3F8BA 4C3IJ 5D8LB 2WADA 1ITYA 1AHDP 4R8HA 5HS9A 2RC4A 1YRNB 2KIFA 3CMEI 2AQFA 3S3NA 4C9YA 1OKRA 1BBYA 1YJWI 1B8IB 3PNVA 1MNDA 3GTQJ 1UFMA 1HDPA 3E5XA 4GFBA 2QKLB 2IAIA 3I9V2 3K10A 4YELA 2Z99A 2VASA 3LL7A 4BXUA 4DNCA 1VQOI 2G9WA 3BT9A 2B63J 3B6CA 2JMWA 2M7BA 3MZ8A 1B6AA 1P9QC 3M7GA 5E3MA 3OOPA 4JP0A 3CC7I 1WJDA 1VFCA 1W36C 1RZ4A 3KZYA 3S17J 2XB0X 4L5JA 1F36A 3L2RA 2K3FA 1KQ9A 3FF5A 5FKNA 5HOOA 2HVRA 3KZIC 3H3ZA 3M8FA 3UR3C 1NG7A 3ERED 2LKXA 3AG1H 4IRGA 1HF0A 1ENHA 1A5JA 3MEXA 4LIUA 2W4SA 3K0LA 2VJ4A 2GA2A 3BTCA 3C18A 3SEQA 4DZJA 3J7ZI 4Y4RA 3TDUC 1R23A 3FX3A 2EZLA 3ABMH 4FT8A 2HPMA 3OYDA 2K27A 5IP7J 4CCKA 1SANA 1QA6A 1RKWA 3ZN0A 3WTYC 1JKRC 2DK5A 1PUFB 1RUOA 2LF8A 2KISA 3CLQA 3BCAA 3KCCA 3KP5A 4GCVA 5FLXK 2M30A 1T98A 3ZXSA 2XPWA 4CCLA 2JA8J 3E1SA 2LD5A 1YI2I 5H20A 3EUKL 3CCLI 1VQ7I 2L4AA 2QCOA 1IXSB 2VJJA 5E3NA 4HEA2 2DODA 2KZVA 4BHCA 1SVLA 2G7UA 3TGNA 2EA2A 3ULQB 2EFOA 4A3EJ 2ISZA 3DFGA 2HZTA 3NAUA 4R79A 2VPRA 2QGUA 2IGKA 5IT3A 1HW1A 5DM7F 2FBKA 1RUNA 1TNTA 1E0EA 4OWRB 1XGNA 1M1EB 2Y0SA 2R7QA 1J59A 5L3CA 2DYSH 3OR2C 3GWZA 4DYCA 3LQQA 1YRNA 5JHFA 5B66C 2ZKZA 2PMZN 5CVUA 1A36A 2ZMEC 5KNLA 4M3EA 3F8FA 5EG0A 2HTJA 4IZZA 5F64A 3ZQCA 1OJLA 3LFUA 4B09A 2LC2A 4LMYA 4WK8F 1WJBA 2TCTA 1XD7A 2L4MA 3BOQA 1F5TA 1TWAJ 3ABTA 1JXSA 1OMIA 2E1MC 3CQZJ 4WCGA 3EUHC 4AIKA 1ZH5A 4ZTFA 1MH4A 2WB1N 5C3EJ 1X1DA 1APLC 1X58A 1YHQI 2BYVE 3M07A 4E7IA 4QPOA 1RC9A 2NS7A 3HOZJ 2X1DA 4HZFA 2KT0A 2JSCA 3QAHA 4BU2A 1XX5A 3I4PA 3HUGB 3U2RA 4OIRF 1S72I 1WVRA 2F5EA 2XPVA 4FE7A 4S05A 3V7RA 1LUJB 1W0TA 5DYMA 1XMKA 1ZELA 2JA2A 3OV8A 4EQQA 2K85A 1BA5A 1W5CC 3BG7A 4UV8A 2OZ6A 5ERIA 3HOSA 1VQ8I 1MJBA 4LLLA 3SHFA 3ZMVA 4XSXF 3AL0C 1S29A 3WGHA 1KU7A 2LP0A 1FIAA 1B59A 2HVQA 2EV0A 5JR3A 3W6VA 1OISA 2AXTC 3OYJA 1TP4A 5IYCJ 1GLNA 3J7AO 3E0JB 5DD8A 2YU3A 4I02A 4JQFA 4IOCF 5LBQA 3I54A 2R92J 3NWSA 3PNYA 3JRHA 5IOYA 5ILUA 2XGXA 3NRVA 4IKFA 4XKBA 5M3FJ 4XKWA 4UUVA 2X85A 2YR2A 2XASA 4C30A 1WJCA 3BLYA 1HSJA 5J1RA 4LITA 1RETA 2LY1A 3HTUA 4C2MJ 2P5LC 4KN4X 3OWTA 4B4CA 1GXQA 3TW6A 1FIPA 5B1BH 5IYDJ 3GX4X 2CH0A 1XDSA 3K4MA 5D5XB 4U7BA 5AIQA 1EH7A 3OY9A 1XCVA 1EJ9A 2L02A 3LSTA 3GFLA 3MFKA 1UZCA 2LTPA 2ESHA 1P7JA 1ACIA 1I50J 4PK4A 4KISA 5KAIC 2ZSHB 3RKQA 1GT0C 3GEZA 4OIOF 1OCCH 2FOKA 4YFXF 2VKHA 1G6NA 3MVPA 4AVZA 5E18F 1QGPA 2ZB9A 3CD6I 1Z7UA 2W48A 1XPXA 3I71A 1YW9A 1ON2A 2QQ8A 1FJLA 1SFEA 4CXFA 1ZG1A 5D8KB 1SVMA 4UV9A 4AVPA 4JYKA 3LSKA 1PUFA 3G6EI 3TL4X 4CHUA 2X51A 1P4XA 3EPZA 4YG2F 1A04A 1YW7A 1K78A 2VUMJ 4XMYA 2H1LA 2RQPA 2L9SA 3M1EA 2AHQA 1LKXA 2STWA 3Q3SA 1K83J 1POGA 4U0YA 2K9QA 3GFMA 2YX7A 4XSZF 1TWHJ 1YOVB 2M4KA 2Y30A 4NC7A 5LGNA 4LGWA 2ACJA 1WHUA 4PCQA 3K1PA 2KHMA 1SMTA 2A68F 3IH4A 1QZZA 4YIRX 2BW3A 2ZNZA 1RIOH 3WTZA 3VODA 4Q5SF 2X6OA 3RSNA 4F91B 1ETWA 1PJRA 1NH3A 2NOJB 2WWYA 1XDUA 3RTRA 2KIMA 2XKPA 3OMYA 4P96A 1W36D 3QP5A 4IL6C 4M6XA 3S1NJ 4G94A 5GAEJ 2R7RA 2V26A 1MDMA 1HA8A 3OR1C 1EH6A 1QO0D 2HXIA 2MSYA 4GDFA 3B73A 1ETOA 2ETHA 4AYBN 1BI3A 3DLAA 4KA4A 2FQ4A
chains in the Genus database with same CATH topology
3R0AA 5FD5A 1BC8C 1V4RA 3I59B 4F7ZA 4XRFA 1ZG5A 2X0LA 1YYVA 3P9CA 1BIBA 2EB7A 2M5WA 4Y13A 2A69F 4LG0A 2MH2A 4HLYA 2XRNA 1CF7A 2IVMA 2YX4A 3LA3A 3BWGA 4MEXF 3QU3A 4G7OF 3IWZA 1MZBA 1CGPA 4HBLA 3E6DA 4KIGA 1R58A 1YS7A 2PI0A 1SAXA 1H9GA 2M45A 5H6RA 3CUQB 3WTWC 3T0YA 2E1CA 1ZGJA 1RI7A 2L3DA 2XUBA 1G3TA 4CO8A 4FX0A 4L9VA 2LNBA 2DFIA 1B9MA 3T8RA 4IRIA 2DI3A 2VBWA 4M6YA 1YO5C 1OYWA 5DD4A 2P6TA 4A6DA 3BPVA 1G3WA 1WRJA 2P5VA 2CQKA 3REOA 1TQMA 4G7ZF 1DPUA 3GVAA 1O57A 4G6QA 3GXOA 4NHJA 2EV6A 2QENA 2CO5A 3ZQ7A 3M9AA 1ZN2A 3DXJF 5CVVA 1EH8A 4RGRA 2K7LA 3FMRA 1ZLKA 1TQPA 2O0YA 5L3GA 4XLNF 5CYVA 3FZVA 4EJUA 2OQRA 2MA3A 5FB2A 2IRFG 3QOPA 2FBIA 3LFKA 4LJZF 1W7PB 2PEXA 5LGTA 1B1BA 4XBFA 5HDNA 1E2XA 2P7CB 1XSDA 1MDMB 3EDPA 1OYYA 1DP7P 2NNYA 3RKYA 2L54A 3BPXA 1ZGAA 2QQBA 1R22A 1IN6A 4ZYEA 2VC1A 3DPLC 1I6XA 2HS5A 1SD5A 3BY6A 4I01A 1D8JA 3V7SA 2ESNA 4UXNA 4U0VA 2JRTA 2W57A 3K2ZA 3E5UA 1CF7B 1ZG3A 1FC3A 1SFXA 4HV5A 4WXDA 1BN5A 2LSOA 2GIVA 1U8RA 2W24A 2EK5A 3F8MA 3AAFA 3MQ0A 4IHTA 4EV0A 4KNYA 1USTA 4KN7X 1J7KA 1BI2A 1ZRFA 1KGSA 3ZPLA 3IL2A 5DUKA 2XAGA 2B0LA 4Q4ZF 1RNLA 3TOBA 2RN7A 3T5XA 4R1HA 3HRMA 2KRFA 1KQ8A 3N4MA 5JHUA 5TRDA 2P7VB 4O6JA 2WTEA 5E8IA 1F4KA 2KIUA 3EYIA 2CFXA 5DCMB 1W7PA 2QVOA 4HW0A 4OMZA 3KLNA 4MGRA 1QQIA 2H6BA 2VBZA 2DPDA 3K1NA 4L9TA 5KK1A 4HOBA 2FF4A 3V4GA 4FX4A 3G73A 3WE3A 3PFIA 4IPAA 2XVCA 1BI0A 3GLXA 3TOAA 2DK8A 1STZA 3JAMZ 4NB5A 1IW7F 3D0SA 2FBHA 2HKXA 5E1XA 2O3FA 2KJBA 3BDDA 4HAMA 2JPBA 2P4WA 3GF2A 2DTRA 3RDIA 5ILVA 4KDPA 2OQGA 2XIGA 3GZ5A 3DQVC 2F5FA 2XHKA 1IN7A 1O3RA 4BNCA 3MAJA 3ELKA 3JW4A 4OMYA 1HKTA 2GZWA 4G9YA 2Z5UA 4RS8A 2CGPA 1I27A 3BZ6A 5LRSA 1VTNC 3T1BA 4IXAA 5LEJA 3IKTA 2W85A 4OIPF 3KP2A 4O3MA 1USSA 4EGZA 4HDUA 1S8NA 4LK1F 1HW2A 4N9IA 3MZYA 2Z33A 2D45A 1W7PD 1FX7A 5E1ZB 1TW3A 5CJ9A 4AIHA 3R60A 1XGOA 3ZP5A 1ZYRF 5DCMA 1IRFA 4AWXB 1MJ9A 1FPQA 4RB2C 2Y0MA 4ENKA 1FZPB 4RB1A 1HXDA 2EJRA 4RB3C 3I58A 3GZ6A 3EQLF 4HX7A 1D3YA 3NQOA 2VODA 4WXHA 2MH9A 4MHGA 1AWCA 3ZMTA 1T38A 1IUYA 3ZN1A 2DPUA 3I64A 3F6OA 1Z05A 3E97A 1PDNC 3QP6A 4Q47A 1K6OA 1YG2A 3ZMSA 4UNOA 1HSTA 5D5UB 1JGSA 1FSHA 5HLGA 2M1BA 5FFZA 2Y75A 5D4RA 1B9NA 4GXOA 3N97A 5BOXA 4PGHA 1SD4A 1G3YA 2P8TA 2D1VA 1B4AA 4CDGA 3RIRA 2IT0A 3IRRA 2Q0OA 2Z9OA 3E5QA 1U5TC 2H94A 1IN8A 4RAZA 1R5GA 4CGZA 2DLLA 4OU0A 1UHMA 3V8JA 2KJCA 4ENJA 1AOYA 1W5TA 3KP7A 3LAPA 2OAZA 2LKPA 3HRUA 2HEOA 4MTEA 5IT9Z 2RGVA 5D5VB 4L9JA 1S7OA 3K69A 5FLXZ 2EA4A 2Q8KA 4KUMA 3QU6A 3Q5FA 4G6DA 3TDZC 5J8CA 3R6SA 2FA5A 2A6HF 1O3TA 3FHZA 1FLIA 1Z9CA 3I53A 2RNJA 3VEPA 2JTVA 4KMFA 3GFIA 5IT9K 2V1UA 3HSFA 1X3UA 2NAZA 2J5OA 5E17F 3WTUC 3O2PE 4HV6A 3EUHA 4JBAA 2A61A 2ISYA 1OR7A 4I09A 2VN2A 1E17A 2XV4S 5BMZA 1XSVA 2H09A 4M9ZA 4KYWA 1GVJA 4EM1A 4P5OA 5AONA 4HX8A 5K5QA 1G3SA 1TQIA 5CVJA 4EJVA 3CDHA 5LEKA 1PP7U 4I7HA 4EMSA 2PBIA 2PMUA 3ABUA 4M72A 1L0OC 3EETA 1ZHFA 2XAQA 5E1WA 2ZFWA 1XMAA 1S6LA 1WI9A 1KU2A 2HDCA 3KEQA 2Z3YA 1S3JA 1P2FA 3DP7A 4BHBA 1JHFA 2H6CA 3F23A 3BROA 1Z6TA 5JFRA 3KLOA 2FRHA 5CVIA 2OZUA 1UCRA 2DU9A 4ENNA 5FO5A 3HYIA 1JE8A 1O3SA 4ESBA 3MCZA 2G7HA 1T39A 4JK1X 4PDKA 2O03A 3I59A 2IP2A 2DBBA 3LWFA 3P7NA 3RYRA 1FP1D 1J2XA 4RGXA 1PUEE 5BPDA 5H6QA 4YFNF 3LAJA 1IZ1A 2MLGA 5LHGA 1W5SA 2CSOA 2HFHA 2PN6A 4A0YA 3KP6A 1W4MA 1P4WA 1FT9A 2ZBKA 3IWFA 1FSEA 1J9IA 2ZMEB 1DUXC 1U5TB 4HQEA 1Q1HA 3WE2A 2P6SA 1D5VA 3GYHX 2QQ9A 2KKOA 4U88A 3SXYA 2K4BA 1T0FA 1R1UA 4EJTA 4E70A 4M73A 5DCFA 3C7JA 2VBXA 3E6MA 2COMA 3PQJA 1R1TA 3RPQA 5J8FA 2XAHA 4RGSA 4QWQA 3V7CA 1ZLJA 1QNTA 1YS6A 4K2EA 5HS8A 3WU0A 2V6CA 4EJWA 1P92A 2JPCA 4L18B 4HYEA 3EYYA 1XN7A 2GA1A 1J5YA 1UHWA 1O3QA 3L7WA 3W6JB 1ZRCA 4L9NA 4WXCA 3ECOA 4U0WA 4HX4A 1WQ2A 1ULYA 2FE3A 1IN5A 2BEOA 2EV5A 1LNWA 5LLQA 3F8NA 1F1ZA 4ZZLA 2EFWA 5DUIA 3SZTA 4A12A 2BGCA 2ZJ2A 2XAFA 2OA4A 5K5RA 1IXRC 1U78A 1LVAA 3TO6A 3R0JA 1IXCA 1DDNA 3IC7A 1C0WA 2FEZA 4HF2A 3I0TA 1QZYA 4OOIA 1Y0UA 4IVNA 3U1DA 3KE2A 4Y17A 4D0PA 2F2EA 2A6EF 4P9UA 1UB9A 3E6CC 2D1HA 3J81K 2EFNA 5D6EA 3L9FA 4S04A 2O61A 5ED4A 2E7WA 5LRRA 1KYZA 4WX9A 2HYGD 5E8GA 1NHAA 5F6FA 1PP8F 3RYPA 5DEQA 4GO1A 1FBQA 2PMHA 1XGMA 3MZHA 2W84A 4CICA 4EM0B 3KZZA 3LA2A 5EEGA 4O5VA 5ICGA 4ENMA 2GWRA 2PJPA 3CLOA 4ASNA 4I0BA 3HUGA 2HGCA 4HLXA 1U5TA 2F5DA 3ZMDA 3RPUA 3QRFF 2M8EA 3CO6C 2CWEA 3TO9A 3CTAA 1HKQA 3QPHA 2R7FA 1K78B 1XCBA 1T6SA 3Q9SA 3H92A 3KP4A 2VE8A 1G4DA 3JTGA 5L3DA 5TJJA 1TNSA 1FP2A 1HQCA 1BIAA 4MQVA 5L3FA 3QPTA 3CO7C 4G8XA 1K79A 2QBYA 2A3SA 2QZ8A 2DW4A 4LK0F 1I1SA 4GYGA 1LDDA 2WV0A 1GHCA 4ZYHA 1TTYA 5JI6A 3J80K 2QUFA 2HOEA 5BS6A 2YPRA 3ECHA 1V3FA 4L0ZB 3LQRA 5L3EA 2A5YB 3PQKA 4GGGA 3HRTA 3R4KA 4BQAA 2MBFA 3RI4A 5LHHA 2HKOA 3BJ6A 4QLCU 2OU2A 4HDVA 4L0YB 3F22A 2XAJA 2GXGA 5J6XA 2UWMA 3FXQA 1YIOA 4A5MA 1R00A 1OPCA 1BOAA 2OD5A 1FBSA 3F21A 3CUQA 2DAOA 1LEBA 2UZKA 1IN4A 5FD6A 1SD6A 3FWEA 1MGTA 2EFQA 2CW0F 4G7HF 4M9XA 3KFWX 3GO5A 1GXPA 2H27A 2FU4A 4LG0B 3WTTC 3HIFA 1KQ0A 1HBXG 2ZXJA 3F72A 4M71A 3SQNA 2QBYB 1O7FA 2DQLA 2K02A 5DV5A 3BJAA 4YIIA 3TKYA 2RDPA 1SD7A 3HSRA 3L2CA 1ZREA 2X4HA 4Q48A 2CG4A 2W25A 3J81Z 2FNPA 1R5HA 2VOOA 2RKHA 3VFZA 2E7XA 1H0MA 4ZYGA 4FHTA 3WTSC 1LEAA 4KT5C 2DT5A 1F9NA 2R7DA 3SZPA 2DO7A 3O3KA 3FXRA 2JZYA 1R36A 1KU3A 6PAXA 1R7JA 2F5CA 3RJPA 4ETSA 1L3LA 1HKSA 2NRAC 4MNUA 1FYMA 1J0RA 3D5LA 2FMLA 4BYYA 4CYDA 2UXNA 2VC0A 1QBJA 4LLNA 2YSRA 5A2QK 3RKWA 3DEUA 2FXAA 4DQ2A 4BHPA 3C1DA 1TW2A 2FQ3A 4IHSA 3TO7A 2MLKA 1WWXA 3GW2A 4A6EA 5HDGA 1KU9A 1ZAOA 2FSWA 1ZRDA 2UXXA 1OYIA 1TLHB 3IRQA 2C6YA 2XKOA 5CLSA 2ZCWA 2BV6A 2HWVA 4ON0A 4UVBA 2QLZA 1LQ1A 2PLYA 4TV7A 2NYXA 3H3UA 5ICFA 2PFBA 2AXLA 5HVQC 5HS7A 5D5WB 3BJOA 3HTSB 4A0ZA 3WTXC 2CYYA 3C3WA 3WTVC 4I2OA 2NS0A 2V9VA 2GQQA 2QM3A 4M9SA 4P9FA 4IJAA 1KA8A 1U3EM 1R1VA 1YFHA 1ODDA 2RV8A 2ELHA 3RKXA 5L3BA 3B02A 4KICA 1Z91A 5CVRA 3E3VA 2IPQX 4EJOA 5KVRA 5LGUA 3ISPA 3KP3A 4RAYA 3HHGA 5HLHA 2HYFA 1XSXA 2IA1A 1LB2A 1FY7A 3DF8A 1BM9A 5EEHA 1TBXA 5K1YA 3JSPA 5D4SA 4I98B 1D8KA 4HF1A 1KYWA 1MKMA 2PQ8A 3WGIA 4N0BA 1YLFA 1I5ZA 3VOEA 4KIFA 4U7DA 3WU1B 3P9KA 5JVTA 5DDGA 5D6FA 4MEYF 1LJ9A 1ZARA 3CJNA 4LB5A 5K5OA 3ZMUA 3FM5A 5AIPA 3HSEA 1REPC 5ILSA 3GFJA 2DQRA 2HQNA 4ZZDA 1YW8A 1O7LA 2R3SA 4GYIA 4Y15A 4WF2A 2NNNA 3ZMZA 4KFCA 3GUDA 4EGYA 3F3XA 1Z6RA 4MQ9F 2O6GE 3F8CA 1Z1DA 3S2WA 3J80Z 2E1NA 4MTDA 3DKWA 4EM2A 3MWMA 2LDUA 3CUOA 4KIBA 1BC7C 5LHIA 4PZJA 4IRHA 1LDKB 4EVIA 1FOKA 5A2QZ 2QWWA 2ZNYA 2K4JA 2GXBA 4LD5A 4OINF 2V1DA 3O6BB 3JSOA 3SFZA 3HOTA 3IHUA 4A2UA 1FYLA 1WSUA 2V1XA 3JTHA 3KETA 2IW5A 4BAYA 3K9TA 2FNAA 4I0AA 1U2WA 2VOPA 2HQRA 2EFPA 1IF1A 1FNNA 2Q2EA 2VXZA 3G3ZA 4PGGA 3R61A 1DPRA 4YIFA 2HR3A 1I1GA 3U9GA 1U6GA 3DV8A 2VBYA 1J75A 2WC2A 4M74A 1IAWA 2BE5F 4HA8A 3VB2A 2XROA 2HTSA 1P6RA 4A0XA 1H9TA 2V79A 3JAMK 1YTYA 5ICCA 4CZZA 3WODF 4XLPF 4ESJA 3L00A 5ICEA 4UVCA 2AS5F 2IA2A 2ADUA 1ONVA 3IKVA 2BBYA 2Y48A 2VT2A 1ON1A 1FBUA 5FFXA 4KMUX 3NEUA 3K1MA 2LF7A 1JHHA 1T2KA 2STTA 3P9IA 4UVAA 1MD0A 2VONA 1YQAA 1P4AA 4WWCA 3M8EA 1XB4A 2JT1A 4YFKF 2K86A 2A07F 3CUQC 1IRGA 1EV7A 3FM3A 4NQWA 5HLIA 1FYKA 2QQAA 2P5KA 2MC3A 3KEOA 5BPIA 2RVCA 1BI1A 5BQTA 2MD5A 3V8LA 4P55A 5FGMA 4BH9A 1K7AA 5E20A 4LLGF 4IF4A 5HDKA 3Q9VA 4RB0A 1HW5A 3FMSA 1SFUA 4LFUA 3HRSA 1XGSA 2TDXA 2J5PA 1SMYF 2IA0A 4Z2YA 4HF0A 1S7AA 4ZYDA 1LDJA 4AD9A 4B8XA 3DPTA 1FWZA 3LA7A 1BJAA 3L09A 2GAUA 3V8KA 4OIQF 3FMQA 3F6VA 3HHHA 3BP8A 2VE9A 4UHTA 4L5IA 1QPMA 4LB6B 4ZH4F 2ZO4A 3T8TA 2PG4A 3TQNA 1WKMA 2D2WA 2FMYA 4A5NA 2QYOA 3E6BA 3ML6A 4N9HA 2IJLA 3FXUA 4ESFA 2ZMEA 2O8XA 3ROUA 3WG9A 3W6KB 2VT3A 2M87A 4RGUA 3COAC 4AIJA 1MJAA 5F1RA 2OBPA 4H0EA 2L01A 2EWNA 3I5UA 4HQMA 3WGGA 3F8BA 5D8LB 4R8HA 5HS9A 2RC4A 2KIFA 1OKRA 1BBYA 1UFMA 3E5XA 2Z99A 4BXUA 4DNCA 2G9WA 1B6AA 3M7GA 3OOPA 1RZ4A 3KZYA 4L5JA 1KQ9A 3FF5A 5HOOA 3H3ZA 3M8FA 3ERED 4IRGA 3MEXA 3K0LA 2GA2A 3C18A 3TDUC 1R23A 3FX3A 4FT8A 2K27A 3ZN0A 3WTYC 2DK5A 1RUOA 2LF8A 3KCCA 3KP5A 4GCVA 5FLXK 2M30A 1T98A 5H20A 2L4AA 1IXSB 4BHCA 2G7UA 3TGNA 2EA2A 3ULQB 2EFOA 2ISZA 3DFGA 2HZTA 4R79A 5IT3A 1HW1A 2FBKA 1RUNA 1TNTA 1XGNA 1J59A 5L3CA 3GWZA 3LQQA 2ZKZA 5CVUA 3F8FA 2HTJA 5F64A 4B09A 4WK8F 4LMYA 1XD7A 2L4MA 3BOQA 1F5TA 1JXSA 3ABTA 1OMIA 4WCGA 4AIKA 1ZH5A 2BYVE 4HZFA 2JSCA 3QAHA 3I4PA 3U2RA 4OIRF 2F5EA 4S05A 3V7RA 5DYMA 1XMKA 3OV8A 4EQQA 4UV8A 2OZ6A 5ERIA 3HOSA 1MJBA 4LLLA 3SHFA 3ZMVA 4XSXF 1S29A 3WGHA 1KU7A 1B59A 2EV0A 5JR3A 3J7AO 5DD8A 2YU3A 4I02A 4JQFA 5LBQA 3I54A 5ILUA 2XGXA 3NRVA 4UUVA 2YR2A 2XASA 1HSJA 2P5LC 3HTUA 4KN4X 1GXQA 3GX4X 1XDSA 5D5XB 4U7BA 5AIQA 1EH7A 1XCVA 2L02A 3LSTA 3GFLA 3MFKA 2ESHA 4OIOF 3GEZA 2FOKA 4YFXF 1G6NA 5E18F 1QGPA 1Z7UA 3I71A 1YW9A 1ON2A 1ZG1A 1SFEA 4CXFA 5D8KB 4UV9A 4AVPA 4CHUA 1P4XA 4YG2F 1A04A 1YW7A 1K78A 2RQPA 3M1EA 2STWA 4U0YA 3GFMA 2YX7A 4XSZF 5LGNA 4LGWA 2ACJA 4PCQA 3K1PA 1SMTA 2A68F 1QZZA 1RIOH 2ZNZA 3WTZA 3VODA 4Q5SF 2WWYA 1XDUA 3RTRA 2KIMA 2XKPA 4P96A 3QP5A 4M6XA 4G94A 1MDMA 1EH6A 1QO0D 3B73A 2ETHA 1BI3A 4KA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0A A;  5FD5 A;  1BC8 C;  1V4R A;  3I59 B;  4F7Z A;  4XRF A;  1ZG5 A;  2X0L A;  1YYV A;  3P9C A;  1BIB A;  2EB7 A;  2M5W A;  4Y13 A;  2A69 F;  4LG0 A;  2MH2 A;  4HLY A;  2XRN A;  1CF7 A;  2IVM A;  2YX4 A;  3LA3 A;  3BWG A;  4MEX F;  3QU3 A;  4G7O F;  3IWZ A;  1MZB A;  1CGP A;  4HBL A;  3E6D A;  4KIG A;  1R58 A;  1YS7 A;  2PI0 A;  1SAX A;  1H9G A;  2M45 A;  5H6R A;  3CUQ B;  3WTW C;  3T0Y A;  2E1C A;  1ZGJ A;  1RI7 A;  2L3D A;  2XUB A;  1G3T A;  4CO8 A;  4FX0 A;  4L9V A;  2LNB A;  2DFI A;  1B9M A;  3T8R A;  4IRI A;  2DI3 A;  2VBW A;  4M6Y A;  1YO5 C;  1OYW A;  5DD4 A;  2P6T A;  4A6D A;  3BPV A;  1G3W A;  1WRJ A;  2P5V A;  2CQK A;  3REO A;  1TQM A;  4G7Z F;  1DPU A;  3GVA A;  1O57 A;  4G6Q A;  3GXO A;  4NHJ A;  2EV6 A;  2QEN A;  2CO5 A;  3ZQ7 A;  3M9A A;  1ZN2 A;  3DXJ F;  5CVV A;  1EH8 A;  4RGR A;  2K7L A;  3FMR A;  1ZLK A;  1TQP A;  2O0Y A;  5L3G A;  4XLN F;  5CYV A;  3FZV A;  4EJU A;  2OQR A;  2MA3 A;  5FB2 A;  2IRF G;  3QOP A;  2FBI A;  3LFK A;  4LJZ F;  1W7P B;  2PEX A;  5LGT A;  1B1B A;  4XBF A;  5HDN A;  1E2X A;  2P7C B;  1XSD A;  1MDM B;  3EDP A;  1OYY A;  1DP7 P;  2NNY A;  3RKY A;  2L54 A;  3BPX A;  1ZGA A;  2QQB A;  1R22 A;  1IN6 A;  4ZYE A;  2VC1 A;  3DPL C;  1I6X A;  2HS5 A;  1SD5 A;  3BY6 A;  4I01 A;  1D8J A;  3V7S A;  2ESN A;  4UXN A;  4U0V A;  2JRT A;  2W57 A;  3K2Z A;  3E5U A;  1CF7 B;  1ZG3 A;  1FC3 A;  1SFX A;  4HV5 A;  4WXD A;  1BN5 A;  2LSO A;  2GIV A;  1U8R A;  2W24 A;  2EK5 A;  3F8M A;  3AAF A;  3MQ0 A;  4IHT A;  4EV0 A;  4KNY A;  1UST A;  4KN7 X;  1J7K A;  1BI2 A;  1ZRF A;  1KGS A;  3ZPL A;  3IL2 A;  5DUK A;  2XAG A;  2B0L A;  4Q4Z F;  1RNL A;  3TOB A;  2RN7 A;  3T5X A;  4R1H A;  3HRM A;  2KRF A;  1KQ8 A;  3N4M A;  5JHU A;  5TRD A;  2P7V B;  4O6J A;  2WTE A;  5E8I A;  1F4K A;  2KIU A;  3EYI A;  2CFX A;  5DCM B;  1W7P A;  2QVO A;  4HW0 A;  4OMZ A;  3KLN A;  4MGR A;  1QQI A;  2H6B A;  2VBZ A;  2DPD A;  3K1N A;  4L9T A;  5KK1 A;  4HOB A;  2FF4 A;  3V4G A;  4FX4 A;  3G73 A;  3WE3 A;  3PFI A;  4IPA A;  2XVC A;  1BI0 A;  3GLX A;  3TOA A;  2DK8 A;  1STZ A;  3JAM Z;  4NB5 A;  1IW7 F;  3D0S A;  2FBH A;  2HKX A;  5E1X A;  2O3F A;  2KJB A;  3BDD A;  4HAM A;  2JPB A;  2P4W A;  3GF2 A;  2DTR A;  3RDI A;  5ILV A;  4KDP A;  2OQG A;  2XIG A;  3GZ5 A;  3DQV C;  2F5F A;  2XHK A;  1IN7 A;  1O3R A;  4BNC A;  3MAJ A;  3ELK A;  3JW4 A;  4OMY A;  1HKT A;  2GZW A;  4G9Y A;  2Z5U A;  4RS8 A;  2CGP A;  1I27 A;  3BZ6 A;  5LRS A;  1VTN C;  3T1B A;  4IXA A;  5LEJ A;  3IKT A;  2W85 A;  4OIP F;  3KP2 A;  4O3M A;  1USS A;  4EGZ A;  4HDU A;  1S8N A;  4LK1 F;  1HW2 A;  4N9I A;  3MZY A;  2Z33 A;  2D45 A;  1W7P D;  1FX7 A;  5E1Z B;  1TW3 A;  5CJ9 A;  4AIH A;  3R60 A;  1XGO A;  3ZP5 A;  1ZYR F;  5DCM A;  1IRF A;  4AWX B;  1MJ9 A;  1FPQ A;  4RB2 C;  2Y0M A;  4ENK A;  1FZP B;  4RB1 A;  1HXD A;  2EJR A;  4RB3 C;  3I58 A;  3GZ6 A;  3EQL F;  4HX7 A;  1D3Y A;  3NQO A;  2VOD A;  4WXH A;  2MH9 A;  4MHG A;  1AWC A;  3ZMT A;  1T38 A;  1IUY A;  3ZN1 A;  2DPU A;  3I64 A;  3F6O A;  1Z05 A;  3E97 A;  1PDN C;  3QP6 A;  4Q47 A;  1K6O A;  1YG2 A;  3ZMS A;  4UNO A;  1HST A;  5D5U B;  1JGS A;  1FSH A;  5HLG A;  2M1B A;  5FFZ A;  2Y75 A;  5D4R A;  1B9N A;  4GXO A;  3N97 A;  5BOX A;  4PGH A;  1SD4 A;  1G3Y A;  2P8T A;  2D1V A;  1B4A A;  4CDG A;  3RIR A;  2IT0 A;  3IRR A;  2Q0O A;  2Z9O A;  3E5Q A;  1U5T C;  2H94 A;  1IN8 A;  4RAZ A;  1R5G A;  4CGZ A;  2DLL A;  4OU0 A;  1UHM A;  3V8J A;  2KJC A;  4ENJ A;  1AOY A;  1W5T A;  3KP7 A;  3LAP A;  2OAZ A;  2LKP A;  3HRU A;  2HEO A;  4MTE A;  5IT9 Z;  2RGV A;  5D5V B;  4L9J A;  1S7O A;  3K69 A;  5FLX Z;  2EA4 A;  2Q8K A;  4KUM A;  3QU6 A;  3Q5F A;  4G6D A;  3TDZ C;  5J8C A;  3R6S A;  2FA5 A;  2A6H F;  1O3T A;  3FHZ A;  1FLI A;  1Z9C A;  3I53 A;  2RNJ A;  3VEP A;  2JTV A;  4KMF A;  3GFI A;  5IT9 K;  2V1U A;  3HSF A;  1X3U A;  2NAZ A;  2J5O A;  5E17 F;  3WTU C;  3O2P E;  4HV6 A;  3EUH A;  4JBA A;  2A61 A;  2ISY A;  1OR7 A;  4I09 A;  2VN2 A;  1E17 A;  2XV4 S;  5BMZ A;  1XSV A;  2H09 A;  4M9Z A;  4KYW A;  1GVJ A;  4EM1 A;  4P5O A;  5AON A;  4HX8 A;  5K5Q A;  1G3S A;  1TQI A;  5CVJ A;  4EJV A;  3CDH A;  5LEK A;  1PP7 U;  4I7H A;  4EMS A;  2PBI A;  2PMU A;  3ABU A;  4M72 A;  1L0O C;  3EET A;  1ZHF A;  2XAQ A;  5E1W A;  2ZFW A;  1XMA A;  1S6L A;  1WI9 A;  1KU2 A;  2HDC A;  3KEQ A;  2Z3Y A;  1S3J A;  1P2F A;  3DP7 A;  4BHB A;  1JHF A;  2H6C A;  3F23 A;  3BRO A;  1Z6T A;  5JFR A;  3KLO A;  2FRH A;  5CVI A;  2OZU A;  1UCR A;  2DU9 A;  4ENN A;  5FO5 A;  3HYI A;  1JE8 A;  1O3S A;  4ESB A;  3MCZ A;  2G7H A;  1T39 A;  4JK1 X;  4PDK A;  2O03 A;  3I59 A;  2IP2 A;  2DBB A;  3LWF A;  3P7N A;  3RYR A;  1FP1 D;  1J2X A;  4RGX A;  1PUE E;  5BPD A;  5H6Q A;  4YFN F;  3LAJ A;  1IZ1 A;  2MLG A;  5LHG A;  1W5S A;  2CSO A;  2HFH A;  2PN6 A;  4A0Y A;  3KP6 A;  1W4M A;  1P4W A;  1FT9 A;  2ZBK A;  3IWF A;  1FSE A;  1J9I A;  2ZME B;  1DUX C;  1U5T B;  4HQE A;  1Q1H A;  3WE2 A;  2P6S A;  1D5V A;  3GYH X;  2QQ9 A;  2KKO A;  4U88 A;  3SXY A;  2K4B A;  1T0F A;  1R1U A;  4EJT A;  4E70 A;  4M73 A;  5DCF A;  3C7J A;  2VBX A;  3E6M A;  2COM A;  3PQJ A;  1R1T A;  3RPQ A;  5J8F A;  2XAH A;  4RGS A;  4QWQ A;  3V7C A;  1ZLJ A;  1QNT A;  1YS6 A;  4K2E A;  5HS8 A;  3WU0 A;  2V6C A;  4EJW A;  1P92 A;  2JPC A;  4L18 B;  4HYE A;  3EYY A;  1XN7 A;  2GA1 A;  1J5Y A;  1UHW A;  1O3Q A;  3L7W A;  3W6J B;  1ZRC A;  4L9N A;  4WXC A;  3ECO A;  4U0W A;  4HX4 A;  1WQ2 A;  1ULY A;  2FE3 A;  1IN5 A;  2BEO A;  2EV5 A;  1LNW A;  5LLQ A;  3F8N A;  1F1Z A;  4ZZL A;  2EFW A;  5DUI A;  3SZT A;  4A12 A;  2BGC A;  2ZJ2 A;  2XAF A;  2OA4 A;  5K5R A;  1IXR C;  1U78 A;  1LVA A;  3TO6 A;  3R0J A;  1IXC A;  1DDN A;  3IC7 A;  1C0W A;  2FEZ A;  4HF2 A;  3I0T A;  1QZY A;  4OOI A;  1Y0U A;  4IVN A;  3U1D A;  3KE2 A;  4Y17 A;  4D0P A;  2F2E A;  2A6E F;  4P9U A;  1UB9 A;  3E6C C;  2D1H A;  3J81 K;  2EFN A;  5D6E A;  3L9F A;  4S04 A;  2O61 A;  5ED4 A;  2E7W A;  5LRR A;  1KYZ A;  4WX9 A;  2HYG D;  5E8G A;  1NHA A;  5F6F A;  1PP8 F;  3RYP A;  5DEQ A;  4GO1 A;  1FBQ A;  2PMH A;  1XGM A;  3MZH A;  2W84 A;  4CIC A;  4EM0 B;  3KZZ A;  3LA2 A;  5EEG A;  4O5V A;  5ICG A;  4ENM A;  2GWR A;  2PJP A;  3CLO A;  4ASN A;  4I0B A;  3HUG A;  2HGC A;  4HLX A;  1U5T A;  2F5D A;  3ZMD A;  3RPU A;  3QRF F;  2M8E A;  3CO6 C;  2CWE A;  3TO9 A;  3CTA A;  1HKQ A;  3QPH A;  2R7F A;  1K78 B;  1XCB A;  1T6S A;  3Q9S A;  3H92 A;  3KP4 A;  2VE8 A;  1G4D A;  3JTG A;  5L3D A;  5TJJ A;  1TNS A;  1FP2 A;  1HQC A;  1BIA A;  4MQV A;  5L3F A;  3QPT A;  3CO7 C;  4G8X A;  1K79 A;  2QBY A;  2A3S A;  2QZ8 A;  2DW4 A;  4LK0 F;  1I1S A;  4GYG A;  1LDD A;  2WV0 A;  1GHC A;  4ZYH A;  1TTY A;  5JI6 A;  3J80 K;  2QUF A;  2HOE A;  5BS6 A;  2YPR A;  3ECH A;  1V3F A;  4L0Z B;  3LQR A;  5L3E A;  2A5Y B;  3PQK A;  4GGG A;  3HRT A;  3R4K A;  4BQA A;  2MBF A;  3RI4 A;  5LHH A;  2HKO A;  3BJ6 A;  4QLC U;  2OU2 A;  4HDV A;  4L0Y B;  3F22 A;  2XAJ A;  2GXG A;  5J6X A;  2UWM A;  3FXQ A;  1YIO A;  4A5M A;  1R00 A;  1OPC A;  1BOA A;  2OD5 A;  1FBS A;  3F21 A;  3CUQ A;  2DAO A;  1LEB A;  2UZK A;  1IN4 A;  5FD6 A;  1SD6 A;  3FWE A;  1MGT A;  2EFQ A;  2CW0 F;  4G7H F;  4M9X A;  3KFW X;  3GO5 A;  1GXP A;  2H27 A;  2FU4 A;  4LG0 B;  3WTT C;  3HIF A;  1KQ0 A;  1HBX G;  2ZXJ A;  3F72 A;  4M71 A;  3SQN A;  2QBY B;  1O7F A;  2DQL A;  2K02 A;  5DV5 A;  3BJA A;  4YII A;  3TKY A;  2RDP A;  1SD7 A;  3HSR A;  3L2C A;  1ZRE A;  2X4H A;  4Q48 A;  2CG4 A;  2W25 A;  3J81 Z;  2FNP A;  1R5H A;  2VOO A;  2RKH A;  3VFZ A;  2E7X A;  1H0M A;  4ZYG A;  4FHT A;  3WTS C;  1LEA A;  4KT5 C;  2DT5 A;  1F9N A;  2R7D A;  3SZP A;  2DO7 A;  3O3K A;  3FXR A;  2JZY A;  1R36 A;  1KU3 A;  6PAX A;  1R7J A;  2F5C A;  3RJP A;  4ETS A;  1L3L A;  1HKS A;  2NRA C;  4MNU A;  1FYM A;  1J0R A;  3D5L A;  2FML A;  4BYY A;  4CYD A;  2UXN A;  2VC0 A;  1QBJ A;  4LLN A;  2YSR A;  5A2Q K;  3RKW A;  3DEU A;  2FXA A;  4DQ2 A;  4BHP A;  3C1D A;  1TW2 A;  2FQ3 A;  4IHS A;  3TO7 A;  2MLK A;  1WWX A;  3GW2 A;  4A6E A;  5HDG A;  1KU9 A;  1ZAO A;  2FSW A;  1ZRD A;  2UXX A;  1OYI A;  1TLH B;  3IRQ A;  2C6Y A;  2XKO A;  5CLS A;  2ZCW A;  2BV6 A;  2HWV A;  4ON0 A;  4UVB A;  2QLZ A;  1LQ1 A;  2PLY A;  4TV7 A;  2NYX A;  3H3U A;  5ICF A;  2PFB A;  2AXL A;  5HVQ C;  5HS7 A;  5D5W B;  3BJO A;  3HTS B;  4A0Z A;  3WTX C;  2CYY A;  3C3W A;  3WTV C;  4I2O A;  2NS0 A;  2V9V A;  2GQQ A;  2QM3 A;  4M9S A;  4P9F A;  4IJA A;  1KA8 A;  1U3E M;  1R1V A;  1YFH A;  1ODD A;  2RV8 A;  2ELH A;  3RKX A;  5L3B A;  3B02 A;  4KIC A;  1Z91 A;  5CVR A;  3E3V A;  2IPQ X;  4EJO A;  5KVR A;  5LGU A;  3ISP A;  3KP3 A;  4RAY A;  3HHG A;  5HLH A;  2HYF A;  1XSX A;  2IA1 A;  1LB2 A;  1FY7 A;  3DF8 A;  1BM9 A;  5EEH A;  1TBX A;  5K1Y A;  3JSP A;  5D4S A;  4I98 B;  1D8K A;  4HF1 A;  1KYW A;  1MKM A;  2PQ8 A;  3WGI A;  4N0B A;  1YLF A;  1I5Z A;  3VOE A;  4KIF A;  4U7D A;  3WU1 B;  3P9K A;  5JVT A;  5DDG A;  5D6F A;  4MEY F;  1LJ9 A;  1ZAR A;  3CJN A;  4LB5 A;  5K5O A;  3ZMU A;  3FM5 A;  5AIP A;  3HSE A;  1REP C;  5ILS A;  3GFJ A;  2DQR A;  2HQN A;  4ZZD A;  1YW8 A;  1O7L A;  2R3S A;  4GYI A;  4Y15 A;  4WF2 A;  2NNN A;  3ZMZ A;  4KFC A;  3GUD A;  4EGY A;  3F3X A;  1Z6R A;  4MQ9 F;  2O6G E;  3F8C A;  1Z1D A;  3S2W A;  3J80 Z;  2E1N A;  4MTD A;  3DKW A;  4EM2 A;  3MWM A;  2LDU A;  3CUO A;  4KIB A;  1BC7 C;  5LHI A;  4PZJ A;  4IRH A;  1LDK B;  4EVI A;  1FOK A;  5A2Q Z;  2QWW A;  2ZNY A;  2K4J A;  2GXB A;  4LD5 A;  4OIN F;  2V1D A;  3O6B B;  3JSO A;  3SFZ A;  3HOT A;  3IHU A;  4A2U A;  1FYL A;  1WSU A;  2V1X A;  3JTH A;  3KET A;  2IW5 A;  4BAY A;  3K9T A;  2FNA A;  4I0A A;  1U2W A;  2VOP A;  2HQR A;  2EFP A;  1IF1 A;  1FNN A;  2Q2E A;  2VXZ A;  3G3Z A;  4PGG A;  3R61 A;  1DPR A;  4YIF A;  2HR3 A;  1I1G A;  3U9G A;  1U6G A;  3DV8 A;  2VBY A;  1J75 A;  2WC2 A;  4M74 A;  1IAW A;  2BE5 F;  4HA8 A;  3VB2 A;  2XRO A;  2HTS A;  1P6R A;  4A0X A;  1H9T A;  2V79 A;  3JAM K;  1YTY A;  5ICC A;  4CZZ A;  3WOD F;  4XLP F;  4ESJ A;  3L00 A;  5ICE A;  4UVC A;  2AS5 F;  2IA2 A;  2ADU A;  1ONV A;  3IKV A;  2BBY A;  2Y48 A;  2VT2 A;  1ON1 A;  1FBU A;  5FFX A;  4KMU X;  3NEU A;  3K1M A;  2LF7 A;  1JHH A;  1T2K A;  2STT A;  3P9I A;  4UVA A;  1MD0 A;  2VON A;  1YQA A;  1P4A A;  4WWC A;  3M8E A;  1XB4 A;  2JT1 A;  4YFK F;  2K86 A;  2A07 F;  3CUQ C;  1IRG A;  1EV7 A;  3FM3 A;  4NQW A;  5HLI A;  1FYK A;  2QQA A;  2P5K A;  2MC3 A;  3KEO A;  5BPI A;  2RVC A;  1BI1 A;  5BQT A;  2MD5 A;  3V8L A;  4P55 A;  5FGM A;  4BH9 A;  1K7A A;  5E20 A;  4LLG F;  4IF4 A;  5HDK A;  3Q9V A;  4RB0 A;  1HW5 A;  3FMS A;  1SFU A;  4LFU A;  3HRS A;  1XGS A;  2TDX A;  2J5P A;  1SMY F;  2IA0 A;  4Z2Y A;  4HF0 A;  1S7A A;  4ZYD A;  1LDJ A;  4AD9 A;  4B8X A;  3DPT A;  1FWZ A;  3LA7 A;  1BJA A;  3L09 A;  2GAU A;  3V8K A;  4OIQ F;  3FMQ A;  3F6V A;  3HHH A;  3BP8 A;  2VE9 A;  4UHT A;  4L5I A;  1QPM A;  4LB6 B;  4ZH4 F;  2ZO4 A;  3T8T A;  2PG4 A;  3TQN A;  1WKM A;  2D2W A;  2FMY A;  4A5N A;  2QYO A;  3E6B A;  3ML6 A;  4N9H A;  2IJL A;  3FXU A;  4ESF A;  2ZME A;  2O8X A;  3ROU A;  3WG9 A;  3W6K B;  2VT3 A;  2M87 A;  4RGU A;  3COA C;  4AIJ A;  1MJA A;  5F1R A;  2OBP A;  4H0E A;  2L01 A;  2EWN A;  3I5U A;  4HQM A;  3WGG A;  3F8B A;  5D8L B;  4R8H A;  5HS9 A;  2RC4 A;  2KIF A;  1OKR A;  1BBY A;  1UFM A;  3E5X A;  2Z99 A;  4BXU A;  4DNC A;  2G9W A;  1B6A A;  3M7G A;  3OOP A;  1RZ4 A;  3KZY A;  4L5J A;  1KQ9 A;  3FF5 A;  5HOO A;  3H3Z A;  3M8F A;  3ERE D;  4IRG A;  3MEX A;  3K0L A;  2GA2 A;  3C18 A;  3TDU C;  1R23 A;  3FX3 A;  4FT8 A;  2K27 A;  3ZN0 A;  3WTY C;  2DK5 A;  1RUO A;  2LF8 A;  3KCC A;  3KP5 A;  4GCV A;  5FLX K;  2M30 A;  1T98 A;  5H20 A;  2L4A A;  1IXS B;  4BHC A;  2G7U A;  3TGN A;  2EA2 A;  3ULQ B;  2EFO A;  2ISZ A;  3DFG A;  2HZT A;  4R79 A;  5IT3 A;  1HW1 A;  2FBK A;  1RUN A;  1TNT A;  1XGN A;  1J59 A;  5L3C A;  3GWZ A;  3LQQ A;  2ZKZ A;  5CVU A;  3F8F A;  2HTJ A;  5F64 A;  4B09 A;  4WK8 F;  4LMY A;  1XD7 A;  2L4M A;  3BOQ A;  1F5T A;  1JXS A;  3ABT A;  1OMI A;  4WCG A;  4AIK A;  1ZH5 A;  2BYV E;  4HZF A;  2JSC A;  3QAH A;  3I4P A;  3U2R A;  4OIR F;  2F5E A;  4S05 A;  3V7R A;  5DYM A;  1XMK A;  3OV8 A;  4EQQ A;  4UV8 A;  2OZ6 A;  5ERI A;  3HOS A;  1MJB A;  4LLL A;  3SHF A;  3ZMV A;  4XSX F;  1S29 A;  3WGH A;  1KU7 A;  1B59 A;  2EV0 A;  5JR3 A;  3J7A O;  5DD8 A;  2YU3 A;  4I02 A;  4JQF A;  5LBQ A;  3I54 A;  5ILU A;  2XGX A;  3NRV A;  4UUV A;  2YR2 A;  2XAS A;  1HSJ A;  2P5L C;  3HTU A;  4KN4 X;  1GXQ A;  3GX4 X;  1XDS A;  5D5X B;  4U7B A;  5AIQ A;  1EH7 A;  1XCV A;  2L02 A;  3LST A;  3GFL A;  3MFK A;  2ESH A;  4OIO F;  3GEZ A;  2FOK A;  4YFX F;  1G6N A;  5E18 F;  1QGP A;  1Z7U A;  3I71 A;  1YW9 A;  1ON2 A;  1ZG1 A;  1SFE A;  4CXF A;  5D8K B;  4UV9 A;  4AVP A;  4CHU A;  1P4X A;  4YG2 F;  1A04 A;  1YW7 A;  1K78 A;  2RQP A;  3M1E A;  2STW A;  4U0Y A;  3GFM A;  2YX7 A;  4XSZ F;  5LGN A;  4LGW A;  2ACJ A;  4PCQ A;  3K1P A;  1SMT A;  2A68 F;  1QZZ A;  1RIO H;  2ZNZ A;  3WTZ A;  3VOD A;  4Q5S F;  2WWY A;  1XDU A;  3RTR A;  2KIM A;  2XKP A;  4P96 A;  3QP5 A;  4M6X A;  4G94 A;  1MDM A;  1EH6 A;  1QO0 D;  3B73 A;  2ETH A;  1BI3 A;  4KA4 A; 
#chains in the Genus database with same CATH topology
 3R0A A;  5FD5 A;  5EYR A;  3ZQI A;  1BC8 C;  1V4R A;  2BZT A;  3I59 B;  4F7Z A;  4F93 B;  4XRF A;  4LIV A;  1ZG5 A;  1IGN A;  3V42 A;  2X0L A;  1YYV A;  3PNT A;  3P9C A;  2ME0 A;  1BIB A;  2EB7 A;  4C3H J;  2M5W A;  4S0H B;  2FOW A;  4I6Z A;  2E2I J;  4Y13 A;  2A69 F;  4LG0 A;  2DN0 A;  3KEY A;  4XLE A;  3RCO A;  1TWG J;  2DTZ A;  3FXK A;  2MH2 A;  2CUE A;  4XOP A;  2HOT A;  4E6K G;  4HLY A;  2E1M B;  2XRN A;  1CF7 A;  3FXM A;  2LYC A;  2CQ7 A;  2IVM A;  1XTA A;  2YX4 A;  5HNH A;  2VQH A;  3LA3 A;  1V5F A;  3DU6 A;  3BWG A;  4MEX F;  3ZQF A;  3QU3 A;  1G2H A;  1MMG A;  2MD0 A;  4G7O F;  3S15 J;  1ETV A;  2IS6 A;  3IWZ A;  1MZB A;  1CGP A;  4HBL A;  3E6D A;  3PL8 A;  4KIG A;  5GP9 A;  4NDL A;  1R58 A;  1YS7 A;  2PMZ A;  3DBR B;  2PI0 A;  1SAX A;  3S1Q J;  1H9G A;  4DBR A;  2M45 A;  3HOW J;  5H6R A;  1NG6 A;  2V6E A;  3CUQ B;  3WTW C;  2VKE A;  3T0Y A;  4X6A J;  2E1C A;  1ZGJ A;  1RI7 A;  3SEZ A;  3PUF A;  2L3D A;  2XUB A;  5DTD A;  5HNF A;  2E1O A;  1G3T A;  2DDB A;  1RES A;  4CO8 A;  2WAQ N;  2R7S A;  4FX0 A;  3CCS I;  1JUM A;  4L9V A;  2LNB A;  4RLQ A;  4A3I J;  1RKT A;  2K3P A;  2DFI A;  2E5N A;  3S2D J;  1UAA A;  1B9M A;  3T8R A;  4IRI A;  2DI3 A;  3IAS 2;  2VBW A;  4M6Y A;  2R7Z J;  1YO5 C;  2JA5 J;  1OYW A;  4PSX A;  5DD4 A;  4A3L J;  2P6T A;  5IOZ A;  5KAF C;  5FKK A;  3OYF A;  4A6D A;  3BPV A;  1G3W A;  2QSF X;  1WRJ A;  2P5V A;  1WZ2 A;  2CQK A;  3REO A;  1TQM A;  4G7Z F;  1GV2 A;  4XON A;  1DPU A;  2Q2E B;  3GVA A;  3O8H A;  1O57 A;  4G6Q A;  2BXY A;  2XGE A;  3GXO A;  5B5E C;  2DJN A;  4M6V A;  4CZC A;  4NHJ A;  1I6H J;  2EV6 A;  2QEN A;  2CO5 A;  3ZQ7 A;  3M9A A;  4BEH A;  1ZN2 A;  3DXJ F;  5CVV A;  2IGN A;  1EH8 A;  4RGR A;  2N8G A;  9ANT A;  4XLH A;  1ZR2 A;  2K7L A;  3HZJ A;  3FMR A;  1ZLK A;  2EIN H;  1TQP A;  1AKH B;  2M34 A;  2O0Y A;  5L3G A;  4XLN F;  1E3O C;  3FDY A;  3DLL F;  1HDD C;  1AU7 A;  2OUM A;  5CYV A;  2F6C A;  3FZV A;  4FET A;  2CV0 A;  4EJU A;  2OQR A;  1N25 A;  3NWT A;  2MA3 A;  3ASO H;  3BR3 A;  4U87 A;  2F4O B;  3RPU D;  5FB2 A;  3LSR A;  3FHN A;  2IRF G;  3QOP A;  2HVS A;  2FBI A;  4IHX A;  4KT6 A;  3LFK A;  4LJZ F;  1JUS A;  1W7P B;  3MN2 A;  4UY8 I;  4C3J J;  2PEX A;  3FKI J;  5LGT A;  3ZQL A;  1B1B A;  1HCR A;  1E3H A;  4NBQ A;  4XBF A;  4IHY A;  5HDN A;  1E2X A;  4BGD A;  2P7C B;  1QHG A;  4Z6Y A;  3HOV J;  1ZK8 A;  1XSD A;  1W0U A;  4BXX J;  1MDM B;  5H2F C;  3EDP A;  5F0F A;  1OYY A;  1DP7 P;  2E19 A;  2NNY A;  3RKY A;  2L54 A;  3BPX A;  1ZGA A;  2YU9 J;  2F48 A;  4XN3 A;  2QQB A;  2CMP A;  1R22 A;  1IN6 A;  3GTP J;  4ZYE A;  2VC1 A;  4MIM A;  3DPL C;  3DEW A;  1I6X A;  2HS5 A;  1SD5 A;  1D0Y A;  3BY6 A;  4N4N B;  4BDY A;  1ERD A;  3HKZ N;  2O8K A;  4I01 A;  4PJ0 C;  1IRZ A;  2OC6 A;  1D8J A;  3V7S A;  2ESN A;  4XKC A;  4UXN A;  2LOO A;  4U0V A;  2JRT A;  2W57 A;  3G2B A;  3K2Z A;  3E5U A;  5E3L A;  1CF7 B;  1ZG3 A;  1VZ0 A;  1O4X A;  1G59 A;  4XOR A;  1FC3 A;  1SFX A;  4HV5 A;  2X6X A;  4WXD A;  4CSW A;  2HDD A;  1BN5 A;  1YIJ I;  1XS9 A;  2LSO A;  1OFC X;  2GIV A;  1U8R A;  2W24 A;  2EK5 A;  3F8M A;  1N75 A;  3AAF A;  3MQ0 A;  4IHT A;  4EV0 A;  4KNY A;  1UST A;  4KN7 X;  4A3J J;  1U0J A;  3CCM I;  1OQY A;  1J7K A;  3G4S I;  1BI2 A;  4BE0 A;  1KGS A;  4ZTJ A;  5IP6 A;  4QTR A;  5DUK A;  3IL2 A;  1JKO C;  1ZRF A;  2OTL I;  3ZPL A;  4XRM A;  1FTT A;  1I3Q J;  2CJJ A;  3S2H J;  2XAG A;  2B0L A;  4M3B A;  5C4J J;  4Q4Z F;  1RNL A;  3KYD B;  3DU5 A;  4HSR A;  4XL9 A;  3TOB A;  2RN7 A;  3T5X A;  4R1H A;  3BG3 A;  5FJ8 J;  3HRM A;  2KRF A;  2LG4 A;  5F0C A;  2MGQ A;  4A3F J;  1KQ8 A;  2FJ1 A;  3PO2 J;  1NK3 P;  1R6R A;  3H35 A;  3N4M A;  4RMN A;  5JHU A;  1ETX A;  4RBO A;  3MKZ A;  5TRD A;  2P7V B;  4O6J A;  2WTE A;  5E8I A;  1F4K A;  2KIU A;  3EYI A;  2CFX A;  5DCM B;  1U9N A;  1W7P A;  2IGO A;  2QVO A;  4HW0 A;  4D5F A;  2O9L A;  2CV2 A;  4OMZ A;  1UMQ A;  2LBF B;  3KLN A;  2L9N A;  4MGR A;  3GTO J;  4A3M J;  1QQI A;  3BTJ A;  1X3W B;  5KHD A;  2H6B A;  2D5V A;  3AG4 H;  3WU2 C;  2QA4 I;  2VBZ A;  1MNM C;  2DPD A;  3K1N A;  4L9T A;  5KK1 A;  4HOB A;  2FF4 A;  3V4G A;  4FX4 A;  1IDY A;  3G73 A;  3WE3 A;  3N05 A;  3PFI A;  1J09 A;  4IPA A;  2XVC A;  1BI0 A;  3GLX A;  3TOA A;  1N77 A;  2DK8 A;  1STZ A;  3JAM Z;  4NB5 A;  2EBI A;  1IW7 F;  3D0S A;  2BXZ A;  2FBH A;  2DT6 A;  2HKX A;  2O3F A;  5E1X A;  2KJB A;  3BDD A;  5J4Y A;  4HAM A;  5TIS C;  2DDA A;  2JPB A;  2P4W A;  3GF2 A;  3RZO J;  2DTR A;  2ZFU A;  3RDI A;  5ILV A;  1YX3 A;  4AUX A;  4KDP A;  4MLO A;  2IS4 A;  2OQG A;  2XIG A;  2JWT A;  3GZ5 A;  3DQV C;  4A3G J;  2F5F A;  2XHK A;  3IP4 B;  2Y31 A;  4PUS A;  2VQC A;  2KRC A;  1BW6 A;  1IN7 A;  4E7L A;  1O3R A;  2E2J J;  3HOX J;  4BNC A;  3MAJ A;  3ELK A;  3JW4 A;  4OMY A;  1HKT A;  1GDT A;  4XID A;  2GZW A;  1FOW A;  2CW8 A;  2Z5U A;  2BHY A;  4G9Y A;  4N4O B;  4RS8 A;  2CGP A;  2HYJ A;  4XLA A;  1EKE A;  1I27 A;  3BZ6 A;  2ID6 A;  5LRS A;  1LPQ A;  2DMQ A;  1VTN C;  4M3F A;  3T1B A;  2DMU A;  4IXA A;  5LEJ A;  3IKT A;  5IP9 J;  3BG9 A;  4E7J A;  4FQG A;  4FCY A;  4A3K J;  1U9O A;  1TT0 A;  2W85 A;  3G1O A;  2HZD A;  4OIP F;  1A31 A;  1FMV A;  3KP2 A;  4O3M A;  3H9J A;  1USS A;  4EGZ A;  1IDZ A;  4HDU A;  1S8N A;  4LK1 F;  3LMM A;  1HW2 A;  2ECB A;  4N9I A;  3MZY A;  2Z33 A;  3JR9 A;  2QKM B;  2D45 A;  3OYI A;  1W7P D;  1FX7 A;  1PVE A;  2VQG A;  3BQZ A;  5EDN A;  1BR2 A;  5E1Z B;  3W2A A;  2V9K A;  3ZQG A;  2ZJP F;  1TW3 A;  5CJ9 A;  4AIH A;  3R60 A;  1XGO A;  2I8D A;  2XSD C;  3ZP5 A;  1I3A A;  1OCR H;  1ZYR F;  5DCM A;  1IRF A;  4AWX B;  1MJ9 A;  1FPQ A;  3QPL A;  1Z3X A;  1E3P A;  3VYT B;  4AU7 A;  2Y0M A;  4RB2 C;  4ENK A;  2DA1 A;  1FZP B;  4RB1 A;  2GXA A;  1HXD A;  2M9H A;  2EJR A;  4RB3 C;  2H8W A;  2FUG 2;  3I58 A;  3JRA A;  2DOF A;  3GZ6 A;  2AQE A;  3EQL F;  2B9S A;  4HX7 A;  3DBH B;  1D3Y A;  3NQO A;  2VOD A;  2UV1 A;  1JT0 A;  2OPT A;  2NXN B;  4L5E A;  2Z2S B;  4WXH A;  2MH9 A;  2X6W A;  4MHG A;  1AWC A;  1CQT A;  5FRN A;  3ZMT A;  2LR8 A;  1T38 A;  1IUY A;  2VKD A;  1YE9 A;  2CRG A;  3PIO F;  2RRE A;  2HQA A;  3ZN1 A;  1QVU A;  2DPU A;  2DMP A;  3ONQ A;  4M3G A;  1LFB A;  3K4L A;  3I64 A;  2VPL A;  3F6O A;  3BCB A;  1UG0 A;  1Z05 A;  3E97 A;  1PDN C;  3QP6 A;  4Q47 A;  1K6O A;  2XDV A;  1OLT A;  3ZRG A;  3A01 A;  1YG2 A;  3ZMS A;  4UNO A;  1HST A;  3MKL A;  1X2M A;  4IHW A;  4XLC A;  5D5U B;  1JGS A;  3FXJ A;  1BR1 A;  4BQN A;  3HL2 A;  1FSH A;  2GBY A;  5HLG A;  2ZXH A;  5EGO A;  2M1B A;  5FFZ A;  3SZG A;  3BQY A;  4Y7N J;  2Y75 A;  5M5W J;  4C2T A;  5D4R A;  1DQU A;  4OAZ A;  1B9N A;  4GXO A;  3N97 A;  5BOX A;  2F4I A;  4PGH A;  1SD4 A;  1X2N A;  4XN0 A;  3K70 D;  1G3Y A;  2P8T A;  4NC8 A;  2YS9 A;  2LBF A;  2ELJ A;  2D1V A;  1HOM A;  1B4A A;  2GOM A;  4CDG A;  3RIR A;  2IT0 A;  1LFU P;  2QF7 A;  3IRR A;  2CUJ A;  3OYG A;  2XRL A;  2Q0O A;  2Z9O A;  3E5Q A;  5M5X J;  1U5T C;  4DZP A;  3G1L A;  2JA6 J;  1EA3 A;  2LY2 A;  2H94 A;  4LOC A;  1IN8 A;  4RAZ A;  4IO9 F;  1D5Y A;  2GLO A;  1T08 B;  3E7L A;  1R5G A;  2OCC H;  4CGZ A;  2EH3 A;  2KIQ A;  2DLL A;  4OU0 A;  1UHM A;  2WY8 Q;  3V8J A;  2KJC A;  4ENJ A;  1R9T J;  3CCR I;  1AOY A;  1W5T A;  3KP7 A;  3LAP A;  2OAZ A;  2A5W A;  2LKP A;  3ABL H;  4AM3 A;  3AKZ A;  4NNJ A;  3C2G A;  3HRU A;  2HEO A;  4MTE A;  5IT9 Z;  2RGV A;  5D5V B;  4L9J A;  1S7O A;  3K69 A;  1MBH A;  1XMX A;  2MAB A;  1VQP I;  3LSG A;  2EA4 A;  5FLX Z;  2DT7 B;  2Q8K A;  3I4M J;  4KUM A;  3QU6 A;  3Q5F A;  1SC7 A;  4G6D A;  3MMY B;  3TDZ C;  2DFH A;  2E5Z A;  5J8C A;  3QYE A;  1XC5 A;  3L1P A;  3R6S A;  2FA5 A;  1X3Z B;  4B47 A;  2AO9 A;  3CF2 A;  3VPR A;  2CUZ A;  2A6H F;  1O3T A;  3PUB A;  3FHZ A;  1FLI A;  1Z9C A;  1DGW Y;  5F0H A;  3I53 A;  2RNJ A;  3VEP A;  2JTV A;  2M7A A;  1VQK I;  1TT5 B;  3A03 A;  4RA2 A;  4KMF A;  3GFI A;  3OSG A;  2Q1Z B;  2LRD A;  2V1U A;  5IT9 K;  2VL8 A;  4HNV A;  3JRB A;  3OIQ A;  1IV8 A;  4ZYA A;  3HSF A;  1X3U A;  1ETQ A;  2NAZ A;  4CYC B;  4W1U A;  4HNU A;  2J5O A;  5E17 F;  2DA4 A;  2LVS A;  3WTU C;  3LSH A;  1BJZ A;  3OYM A;  2CQN A;  3O2P E;  4HV6 A;  2XF5 A;  3EUH A;  1QZE A;  4JBA A;  2A61 A;  2LKS A;  2ISY A;  1OR7 A;  1X19 A;  2VN2 A;  4I09 A;  1E17 A;  2XV4 S;  5BMZ A;  1XSV A;  2H09 A;  3BR5 A;  4DW6 A;  1HC8 A;  3P5J A;  4M9Z A;  4KYW A;  3ZQQ A;  1GVJ A;  4EM1 A;  4P5O A;  5AON A;  2HNH A;  1F43 A;  4XK4 A;  2P0W A;  2JRM A;  4HX8 A;  5K5Q A;  3K4J A;  1K4T A;  1G3S A;  1TQI A;  5CVJ A;  4EJV A;  3CDH A;  3S32 A;  2ZJR F;  1FOY A;  3J7A Y;  1H89 C;  5LEK A;  1PP7 U;  3CJQ B;  3GTM J;  4I7H A;  4EMS A;  2PBI A;  2PMU A;  3ZR8 X;  3ABU A;  4M72 A;  2R7U A;  3HG9 A;  1L0O C;  3EET A;  4D7N A;  4UUS A;  2BY1 A;  3BC8 A;  4QSH A;  1D1A A;  1Y39 A;  1ZHF A;  2XAQ A;  3BR6 A;  5E1W A;  3GTG J;  2ZFW A;  3S1R J;  2KDO A;  1XMA A;  2JJ7 A;  2XAU A;  3ZGK A;  1S6L A;  1WI9 A;  1KU2 A;  2HDC A;  2JSP A;  1S7E A;  3U1K A;  1ZR4 A;  3TBI A;  1SVO A;  3KEQ A;  5J3L A;  2VLA A;  4G12 A;  2Z3Y A;  3TED A;  1S3J A;  3CCE I;  1LE8 A;  1P2F A;  3DP7 A;  3IH2 A;  2CV1 A;  1PYV A;  4BHB A;  2I10 A;  2IEK A;  2ZXW H;  1JHF A;  2H6C A;  2EIM H;  5LFA A;  3F23 A;  5HLT A;  3BRO A;  4CA0 A;  3NAR A;  1Z6T A;  5JFR A;  3A01 B;  3KLO A;  4ZDL A;  2FRH A;  5CVI A;  3CES A;  4JX4 A;  2OZU A;  1UCR A;  1Z67 A;  1WPK A;  3VDX A;  2DU9 A;  4ENN A;  5FO5 A;  1SFK A;  2KPM A;  2CQQ A;  3HYI A;  1JE8 A;  2E35 A;  1O3S A;  4ESB A;  1X1B A;  3MCZ A;  3JRE A;  2G7H A;  1MBG A;  4OAY A;  1T39 A;  2LFB A;  4PJL A;  1YX5 A;  4JK1 X;  1B8I A;  2DFE A;  4PDK A;  2O03 A;  2E2H J;  3K4B A;  2MG4 A;  3I59 A;  2IP2 A;  2DBB A;  1T0F C;  3LWF A;  3P7N A;  1FP1 D;  3RYR A;  1J2X A;  4RGX A;  5BPD A;  2MFZ A;  5H6Q A;  4YFN F;  1PUE E;  3LAJ A;  4BE1 A;  1IZ1 A;  1Z77 A;  2MLG A;  5LHG A;  4YEJ A;  1W5S A;  2GOX B;  5IYB J;  2CSO A;  2HFH A;  2PN6 A;  4A0Y A;  3KP6 A;  1W4M A;  1P4W A;  1FT9 A;  3K4K A;  2VKV A;  2KFD A;  3GTK J;  2ZBK A;  1Z3Y A;  3IWF A;  4NUB A;  4J19 A;  1FSE A;  1J9I A;  1IO2 A;  2ZME B;  3JCU C;  2NVT J;  1DUX C;  1U5T B;  1Y1W J;  4HQE A;  3HPG A;  1Q1H A;  4BQO A;  5DS9 A;  2L9V A;  2JA7 J;  3WE2 A;  2KMU A;  2P6S A;  1D5V A;  2DOA A;  3GYH X;  2QQ9 A;  2KKO A;  4U88 A;  3SXY A;  3PIP F;  1ZQ3 P;  1VQ9 I;  2K4B A;  1A6I A;  1T0F A;  1R1U A;  2V4J C;  4EJT A;  1JTY A;  1BOB A;  1TWC J;  4E70 A;  2WAQ A;  2LK2 A;  4M73 A;  2DA2 A;  3C7J A;  5DCF A;  4DYR A;  2VBX A;  3A02 A;  2JK3 A;  3SFI A;  3E6M A;  3HJE A;  1TZL A;  2COM A;  2ID3 A;  3TW7 A;  1VQM I;  3PQJ A;  1R1T A;  3RPQ A;  3DKX A;  5J8F A;  1MW7 A;  2OJE D;  2XAH A;  3BTI A;  1K6Y A;  4RGS A;  4QWQ A;  3V7C A;  1ZLJ A;  1QNT A;  1YS6 A;  4K2E A;  2V7F A;  5HS8 A;  3WU0 A;  2V6C A;  5J1Y A;  4EJW A;  1P92 A;  1UHS A;  2JPC A;  4L18 B;  4HYE A;  1DU0 A;  3EYY A;  1XN7 A;  2CQX A;  2GA1 A;  1J5Y A;  1UHW A;  2DA6 A;  4PFO A;  1O3Q A;  3L7W A;  2BY0 A;  4BS9 A;  2Z16 A;  3W6J B;  1ZRC A;  4L9N A;  4WXC A;  2NVX J;  2CS3 A;  3M3Y J;  3ECO A;  3FK7 A;  4U0W A;  3HB9 A;  2JQ7 A;  4HX4 A;  3HGY A;  1KON A;  1WQ2 A;  4D5C A;  1VQ5 I;  1V5G A;  4RAG A;  1ULY A;  3S3M A;  3G1M A;  2FE3 A;  2MC4 A;  3OOU A;  3VYU B;  1IN5 A;  2BEO A;  2EV5 A;  1LNW A;  5LLQ A;  3F8N A;  1VQN I;  1GVD A;  1F1Z A;  2E71 A;  3F0C A;  4ZZL A;  4B3A A;  1QVT A;  4X0G A;  2EPF A;  3D5S C;  4F52 A;  3ABK H;  2EFW A;  3D1N I;  5DUI A;  3SZT A;  4A12 A;  2BGC A;  2M8G X;  2ZJ2 A;  2XAF A;  3H0G J;  2OA4 A;  5K5R A;  1IXR C;  1U78 A;  1LVA A;  3TO6 A;  2W82 A;  3R0J A;  2R5Y A;  4XOT A;  2DA7 A;  1W1W E;  3CDI A;  1IXC A;  4FAS D;  3FK6 A;  1R4N B;  1DDN A;  2L7K A;  1H8A C;  2ME6 A;  3OYC A;  3IC7 A;  1C0W A;  2L7M P;  2FEZ A;  1V54 H;  3QOE A;  2R0Q C;  5J4V A;  1N78 A;  4HF2 A;  3I0T A;  3S8P A;  1QZY A;  2MW8 A;  4OOI A;  4BKX A;  1Y0U A;  4IVN A;  1ETK A;  2WBM A;  1X4P A;  3OL4 A;  3U1D A;  4B43 A;  1A35 A;  2LMD A;  3Q0V A;  1QPI A;  1WCM J;  3KE2 A;  3OS1 A;  5FLV A;  2A05 A;  5F1J A;  2IXS A;  4Y17 A;  4D0P A;  2P81 A;  2F2E A;  2A6E F;  3W2V A;  4P9U A;  1UB9 A;  4BY7 J;  3E6C C;  2KDZ A;  2D1H A;  3J81 K;  2EFN A;  1MBJ A;  3H5N A;  3L9F A;  2VI6 A;  5D6E A;  4B48 A;  4S04 A;  2O61 A;  3HBL A;  1X1P A;  2E7W A;  5ED4 A;  1MMD A;  5LRR A;  3H3V K;  1KYZ A;  4WX9 A;  2HYG D;  5E8G A;  1NHA A;  4NC6 A;  5F6F A;  3RYP A;  1PP8 F;  5DEQ A;  4GO1 A;  4PJJ A;  1FBQ A;  2PMH A;  4D7M A;  1ETY A;  1XGM A;  3MZH A;  2NVQ J;  3L2Q A;  2EIJ H;  2W7N A;  1WJA A;  2W84 A;  2M3A A;  4CCM A;  2R7V A;  4EEF G;  1MBK A;  2LH9 A;  4CIC A;  4EM0 B;  2RQQ A;  3KZZ A;  2L2O A;  2Y2Z A;  4CCN A;  4HPQ A;  3LA2 A;  3EUA A;  2DOE A;  5EEG A;  4O5V A;  3TP0 A;  5ICG A;  4ENM A;  2GM4 A;  2GWR A;  2PJP A;  4LG3 A;  1SFO J;  3CC2 I;  2ZSI B;  2W00 A;  4ABZ A;  3CLO A;  3BR2 A;  4ASN A;  4I0B A;  3HUG A;  2HGC A;  4Y3O A;  3M8J A;  5K7Z A;  3OIP A;  4HLX A;  1U5T A;  4FIS A;  4D9J A;  4F92 B;  2F5D A;  4QPQ A;  2CFO A;  2KQR A;  3ZMD A;  3RPU A;  2H8R A;  4XR6 A;  4C2U A;  5FKM A;  1JT6 A;  4A3C J;  1OCT C;  3PO3 J;  3QRF F;  2M8E A;  1QRY A;  3CCJ I;  3VWB A;  3CO6 C;  2CWE A;  3CCQ I;  4DOZ A;  1FMW A;  5FRM A;  2ICW G;  3TO9 A;  3CTA A;  1HKQ A;  4HNT A;  4V2G A;  3QPH A;  2R5Y B;  2R7F A;  1K78 B;  1VQ6 I;  3OSF A;  4G6T B;  1XCB A;  1T6S A;  3Q9S A;  3H92 A;  4BJT A;  2A6T A;  2CU7 A;  5CQG A;  1H88 C;  3KP4 A;  5FLM J;  1MSF C;  4KJZ A;  2VE8 A;  1B72 B;  2NOG A;  1D0Z A;  3JTG A;  1G4D A;  5L3D A;  4BY1 J;  5C4X J;  5TJJ A;  2CW7 A;  1JGG A;  1TNS A;  3DPU A;  1S5L C;  1FP2 A;  1HQC A;  2RAE A;  3FKJ A;  2KP6 A;  1X1C A;  5GAD J;  1BIA A;  2JUC A;  1WGX A;  4PJM A;  2ZJQ F;  4A3B J;  4UB6 C;  4MQV A;  4RAF A;  5L3F A;  2DYR H;  2R7O A;  2ZC2 A;  3FXL A;  3QPT A;  5FKO A;  2JVG A;  3CO7 C;  4G8X A;  1K79 A;  4XRS A;  5F27 A;  1R49 A;  3DKY A;  2A3S A;  2QBY A;  2QZ8 A;  2DW4 A;  3DBL B;  1JTX A;  3LOC A;  3IH3 A;  1WJE A;  4LK0 F;  1MBF A;  3MD2 A;  4GYG A;  1I1S A;  1LDD A;  3W3C A;  2WV0 A;  2R7T A;  1GHC A;  4ZYH A;  1TTY A;  5JI6 A;  4II3 A;  3J80 K;  2QUF A;  3U21 A;  2HOE A;  2WA0 A;  3RQ4 A;  3DTE A;  2DMN A;  5IPA A;  5BS6 A;  3RZD J;  5JLX A;  2YPR A;  3ECH A;  1V3F A;  3K7A J;  4L0Z B;  1MNE A;  4HRI A;  3LQR A;  5L3E A;  3LSP A;  2A5Y B;  3JRD A;  3PQK A;  4GGG A;  3HRT A;  3DEE A;  3R4K A;  4M3D A;  4B3X A;  2V1N A;  1Y8R B;  4BQA A;  2MBF A;  3HM5 A;  3BR1 A;  4B1R A;  5LHH A;  2HKO A;  3RI4 A;  2Y0S N;  4AC0 A;  2PX9 A;  2QSH X;  3BJ6 A;  3A0B C;  4QLC U;  3HOU J;  1AA7 A;  3O8G A;  2OU2 A;  1MIJ A;  4HDV A;  4L0Y B;  2DA5 A;  3HOY J;  3F22 A;  2XAJ A;  2GXG A;  5J6X A;  2UWM A;  3SDG A;  1XG1 A;  3FXQ A;  1YIO A;  2VQL A;  3CCY A;  4A5M A;  5GPA A;  2EQR A;  5KCM A;  1MMS A;  1R00 A;  4UB8 C;  1OPC A;  2BY2 A;  1BOA A;  3GTJ J;  2OCE A;  2OD5 A;  1FBS A;  2ZXI A;  3F21 A;  3CUQ A;  3BTL A;  4E4H A;  2DAO A;  3K6G A;  3UKG A;  2DXI A;  1LEB A;  2UZK A;  3QWL A;  1IN4 A;  5FD6 A;  2XSJ C;  1SD6 A;  1WJF A;  3FWE A;  4A69 C;  3S3O A;  1MGT A;  1Z7L A;  2EFQ A;  1ZTR A;  3UNG C;  2CW0 F;  1LVK A;  2LLK A;  3CCV I;  4V19 K;  4G7H F;  3ZQH A;  4M9X A;  4DJA A;  3DTI A;  3KFW X;  5B3S H;  3K4C A;  4BDZ A;  3GO5 A;  3PJR A;  2E36 A;  1GXP A;  2H27 A;  2FU4 A;  3GBG A;  4LG0 B;  4BXF A;  3WTT C;  3HIF A;  3LNQ A;  3CMY A;  2PJR A;  1KQ0 A;  1HBX G;  2X48 A;  2BY3 A;  2ZXJ A;  5HOD A;  3F72 A;  3DTK A;  3LSM A;  3OYK A;  2OTJ I;  4M71 A;  3G71 I;  3GCM A;  3SQN A;  1BL0 A;  4BAC A;  5FKL A;  3OS2 A;  1R5I D;  5F08 A;  3C2H A;  2QBY B;  1O7F A;  2DQL A;  3VYR B;  2K02 A;  1YJN I;  5DV5 A;  3BJA A;  4YII A;  3TKY A;  2RDP A;  1SD7 A;  3HSR A;  3L2C A;  1ZRE A;  2BHZ A;  1A6Q A;  2X4H A;  5C44 J;  4Q48 A;  2L7Z A;  3S1M J;  3VSK A;  2CUF A;  2VJ5 A;  2VIX A;  4XQF A;  4BE2 A;  1UG2 A;  2VB6 A;  2CG4 A;  2W25 A;  5E3O A;  3J81 Z;  3CJT B;  4FE4 A;  2KL4 A;  2FNP A;  1R5H A;  3K2A A;  2VOO A;  3H36 A;  2RKH A;  3VFZ A;  4DBQ A;  2E7X A;  5EGO B;  1H0M A;  4ZYG A;  2R7X A;  3OYE A;  4A3D J;  2XPU A;  4FHT A;  3WTS C;  3ZCO A;  1B72 A;  1LEA A;  4KT5 C;  4UUT A;  2DT5 A;  4EAT A;  1F9N A;  2R7D A;  1UEL B;  2EZI A;  3QQA A;  3SZP A;  4D1Q A;  2DO7 A;  3O3K A;  3FXR A;  4DIQ A;  1TL8 A;  1VQL I;  4XIC A;  2JZY A;  3LSI A;  1R36 A;  1KU3 A;  6PAX A;  5EF6 A;  2WAF A;  1R7J A;  2WY7 Q;  2F5C A;  1G8X A;  3RJP A;  4ETS A;  1ZKG A;  1L3L A;  1HKS A;  5GPC A;  2NRA C;  1EF4 A;  4E7S A;  4MNU A;  5K7F A;  3MKY B;  2HQ5 A;  1FYM A;  1JKP C;  1J0R A;  3D5L A;  3OYH A;  3AL0 B;  1X4O A;  5EG0 B;  2FML A;  4BYY A;  4CYD A;  2UXN A;  1S9H A;  2VC0 A;  1QBJ A;  4DYQ A;  3JRF A;  4LLN A;  3GZN B;  2YSR A;  2F5V A;  3HDD A;  5A2Q K;  4BEH B;  3M1C A;  3RKW A;  2E60 A;  3DEU A;  2FXA A;  3H5R A;  2EZH A;  3WHB A;  4DQ2 A;  4BHP A;  1K4S A;  1V55 H;  3C1D A;  1TW2 A;  1Y1V J;  2FQ3 A;  2XB5 A;  1RR8 C;  5F04 A;  4IHS A;  5EJC A;  1Z21 A;  1VND A;  3A2K A;  5IY5 H;  3H0D A;  3GME A;  3PSI A;  3TO7 A;  3M4O J;  2MLK A;  4PFP A;  2KZG A;  3FXO A;  1WWX A;  3PFY A;  1RR7 A;  3GW2 A;  3VYS B;  4A6E A;  4CUG A;  4MO7 A;  3CJR B;  5HDG A;  3ASN H;  1IC8 A;  1KU9 A;  1ZAO A;  2FSW A;  1ZRD A;  3HC7 A;  2UXX A;  2R4G A;  2IBD A;  1OYI A;  1TLH B;  1MSE C;  3IRQ A;  2C6Y A;  2XKO A;  3I56 I;  5CLS A;  2QEX I;  2ZCW A;  4ZJZ A;  3TMO A;  4CYC A;  5LD2 C;  2BV6 A;  1T33 A;  2HOA A;  2HWV A;  2X6Y A;  4ON0 A;  1QHH D;  4UVB A;  2QLZ A;  1LQ1 A;  2PLY A;  4TV7 A;  2NYX A;  3H3U A;  1VF9 A;  1VI0 A;  3A0H C;  5ICF A;  2PFB A;  1SEU A;  2AXL A;  3CMM A;  2G0E A;  4I99 C;  5HVQ C;  2QSG X;  5HS7 A;  5D5W B;  3BJO A;  3HTS B;  3H1C A;  2VJI A;  1WH5 A;  4A0Z A;  3WTX C;  2UUZ A;  2CYY A;  1U8B A;  3C3W A;  3FBN B;  3WTV C;  3AG3 H;  4I2O A;  3DWL E;  4JX6 A;  2NS0 A;  5GAG J;  4GRI A;  2V9V A;  3K70 C;  2GQQ A;  5GAH J;  4ZDP A;  2QM3 A;  3W2W A;  1P7I A;  3OYA A;  5J40 A;  4M9S A;  1Y56 A;  4P9F A;  2PJR B;  1K61 A;  4IJA A;  1KA8 A;  4UUS B;  1U3E M;  1R1V A;  2BVL A;  1T8I A;  1YFH A;  2I5U A;  1OCO H;  2HI3 A;  1ODD A;  2RV8 A;  3B6A A;  3SYT A;  2ELH A;  3RKX A;  5L3B A;  3B02 A;  2MYS A;  1Z91 A;  4KIC A;  5CVR A;  2L7F P;  3E3V A;  1T95 A;  2IPQ X;  1WI3 A;  4EJO A;  5KVR A;  4F3Q A;  4ZC3 A;  4AID A;  5LGU A;  3ISP A;  3Q0W A;  3LSJ A;  3KP3 A;  3KYC B;  4RAY A;  3HHG A;  3L2W A;  1R71 A;  4E7K A;  5HLH A;  2HYF A;  3L2U A;  1XSX A;  2IA1 A;  2IS1 A;  2V9P A;  1LB2 A;  1FY7 A;  3DF8 A;  3RQI A;  1BM9 A;  5EEH A;  1TBX A;  5K1Y A;  2L9R A;  3JSP A;  1YIT I;  3S93 A;  2K40 A;  3I55 I;  5D4S A;  4I98 B;  2Y69 H;  3TP3 A;  3FBI B;  4Y52 J;  1D8K A;  4HF1 A;  2COB A;  2HDW A;  3OYB A;  1KYW A;  4IEJ A;  5JVG F;  1MKM A;  2PQ8 A;  2B7E A;  2DJI A;  3F9K A;  3DCF A;  3WGI A;  4N0B A;  1DP3 A;  1YLF A;  1I5Z A;  2BW3 B;  4CCJ A;  4E7Z A;  2R93 J;  1MMN A;  3VOE A;  4KIF A;  2K9N A;  4U7D A;  3WU1 B;  3P9K A;  5JVT A;  3I3L A;  1NTC A;  1D1B A;  5DDG A;  5D6F A;  2M0M A;  4MEY F;  3PM1 A;  3A4C A;  1D1C A;  2JVH A;  3CZ6 A;  3JRC A;  1LJ9 A;  1ZAR A;  1WJ5 A;  4BJ6 C;  3CJN A;  2XGD A;  3HKZ A;  3ZOB A;  4LB5 A;  1MMA A;  5K5O A;  3K4N A;  3ZMU A;  4BQQ A;  4RM3 A;  4YRV A;  1IUF A;  3FM5 A;  4I76 A;  5BNG A;  1HLV A;  5AIP A;  4XNF A;  1UJ8 A;  1BW5 A;  3HSE A;  1REP C;  5ILS A;  3GFJ A;  2DQR A;  2HQN A;  4ZZD A;  4RDU A;  2Y9Z A;  1YW8 A;  1Z0X A;  1O7L A;  2K9L A;  2W1O A;  3HPH A;  2Y9Y A;  3H9G A;  5CQE A;  3QPS A;  2R3S A;  4GYI A;  4Y15 A;  4WF2 A;  2GIZ A;  2NNN A;  2O7O A;  3ZMZ A;  4KFC A;  3S16 J;  3BG6 A;  2K9S A;  2BOL A;  3HEF A;  2ELK A;  3KPH A;  3GUD A;  1V5E A;  3BR0 A;  4EGY A;  3F3X A;  4XRS G;  2R5Z A;  4II2 A;  3OS0 A;  1Z6R A;  4MQ9 F;  2O6G E;  3F8C A;  4H4K C;  3OYN A;  1Z1D A;  3S2W A;  3J80 Z;  2E1N A;  4IQJ A;  4MTD A;  2E34 A;  3DKW A;  4EM2 A;  4CH7 A;  3MWM A;  1I39 A;  2LDU A;  3BZC A;  1WFX A;  4BBS J;  1LFP A;  4PSW A;  4B44 A;  4MFD A;  4JOM A;  3CUO A;  4KIB A;  5FRO A;  2KRH A;  1BC7 C;  3KIO A;  5LHI A;  4PZJ A;  5CPR B;  3QOD A;  2RNG A;  4IRH A;  1LDK B;  1T56 A;  4EVI A;  1FOK A;  1OCP A;  2QWW A;  3CP2 A;  5A2Q Z;  3JRG A;  4P1W A;  2ZNY A;  2K4J A;  1YJ9 I;  2GXB A;  4X1E A;  4LD5 A;  4OIN F;  2KLO A;  3WG7 H;  4W97 A;  2TRT A;  2V1D A;  3JRI A;  1JJ8 C;  3O6B B;  3JSO A;  3SFZ A;  3IHU A;  4A2U A;  3HOT A;  1JJ6 C;  1FYL A;  3BG5 A;  4J01 A;  2NVY J;  1WSU A;  2LY9 A;  2OV7 A;  2V1X A;  3ERM A;  4NQW B;  3JTH A;  3C2B A;  3KET A;  2IGM A;  2IW5 A;  4BAY A;  1IJW C;  3K9T A;  2FNA A;  4I0A A;  1U2W A;  2VOP A;  2HQR A;  2EFP A;  1IF1 A;  1NK2 P;  1FNN A;  4JX5 A;  2WAE A;  2Q2E A;  3SJM A;  1SAU A;  2VXZ A;  3G3Z A;  4PGG A;  4PJN A;  3X2Q H;  1D0X A;  3R61 A;  1DPR A;  4ANJ A;  4YIF A;  2HR3 A;  4QIW N;  3FIS A;  2X1E A;  2WB1 A;  1Y6I A;  1I1G A;  1ORK A;  3U9G A;  1IRX A;  1U6G A;  4BJ5 C;  5EEA A;  1JKQ C;  2ECC A;  4FTH A;  3DV8 A;  2VBY A;  1J75 A;  2WC2 A;  4M74 A;  1IAW A;  1AKH A;  2BE5 F;  4HA8 A;  4BL0 B;  3GTL J;  2M2E A;  3VB2 A;  1X1A A;  1RPW A;  2XRO A;  4HG2 A;  3MKW B;  2HTS A;  1P6R A;  4A0X A;  1H9T A;  2V79 A;  3JAM K;  2LRE A;  1YTY A;  5ICC A;  4CZZ A;  1IG7 A;  3WOD F;  4XLP F;  2R5Z B;  4ZDO A;  4ESJ A;  3L00 A;  2R7W A;  2M4G A;  5ICE A;  4UVC A;  5M3M J;  2AS5 F;  3H9Q A;  2IA2 A;  2ADU A;  1ONV A;  3IKV A;  2BBY A;  2Y48 A;  4IQ4 A;  2VT2 A;  1ON1 A;  3PSF A;  1FBU A;  3Q0U A;  5FFX A;  4Y33 A;  4KMU X;  3NEU A;  2OF7 A;  3K1M A;  2LF7 A;  3GLL A;  1JHH A;  3OYL A;  2L0K A;  5DM6 F;  4XM3 A;  1T2K A;  2STT A;  1BR4 A;  2HOS A;  2X9D A;  3P9I A;  1TC3 C;  3IV5 A;  1JUP A;  4UVA A;  5E79 C;  1MD0 A;  5CKT A;  2VON A;  4E7H A;  1OCZ H;  1ZGW A;  1YQA A;  1P4A A;  3SDB A;  2EIK H;  4WWC A;  2X1C A;  3M8E A;  1JI8 A;  1XB4 A;  1RRJ A;  4A93 J;  2JT1 A;  1FOX A;  2FD5 A;  4ITV A;  5GTI C;  2Z1D A;  3KX2 A;  4XKV A;  4YFK F;  2K86 A;  2A07 F;  3A1Y A;  3CUQ C;  3ESW B;  4AYB A;  1IRG A;  1IV6 A;  5B1A H;  1WH7 A;  1QU3 A;  1EV7 A;  3FM3 A;  2DFF A;  3VSL A;  4NQW A;  5GTH C;  2NS8 A;  1FTZ A;  5HLI A;  2K9M A;  1FYK A;  3H5A A;  2QQA A;  1TWF J;  3HXL A;  2P5K A;  2MC3 A;  3KEO A;  3BZK A;  5BPI A;  2RVC A;  1BI1 A;  3OL3 A;  5BQT A;  3CCU I;  2MD5 A;  2WV1 A;  1DGR M;  1LE8 B;  2IS2 A;  3V8L A;  3CMA I;  3QYF A;  4P55 A;  5FGM A;  4BH9 A;  1K7A A;  5E20 A;  4LLG F;  2O5R A;  4IF4 A;  5HDK A;  4V2F A;  4HST A;  3Q9V A;  5J1U A;  4RB0 A;  2HPI A;  1HW5 A;  3FMS A;  4BUP A;  2M0C A;  3AG2 H;  4DGW B;  4IX7 A;  3IAM 2;  1SFU A;  2K5C A;  4CCO A;  4LFU A;  3HRS A;  2NVU B;  1XGS A;  2TDX A;  2H1K A;  1Q1V A;  2J5P A;  2JUG A;  1FEX A;  1SMY F;  2IA0 A;  4Z2Y A;  1VQ4 I;  4HF0 A;  1S7A A;  4ZYD A;  1LDJ A;  4IHV A;  2DCE A;  4AD9 A;  4B8X A;  4J00 A;  1Y8Q B;  3CDL A;  3AFH A;  3DPT A;  1FWZ A;  3LA7 A;  3QYB A;  3IUO A;  2L5Q A;  1BJA A;  3L09 A;  5EZG A;  2GAU A;  2FX0 A;  3V8K A;  5J47 A;  4OIQ F;  3FMQ A;  3F6V A;  3HHH A;  2EZK A;  3OIO A;  5TGT A;  3BP8 A;  2VE9 A;  3S14 J;  2XF6 A;  2DA3 A;  4UHT A;  2XC7 A;  1GUU A;  4XLF A;  4L5I A;  3CF5 F;  2EIL H;  1QPM A;  4LB6 B;  2BVM A;  1R4M B;  4ZH4 F;  1Y0N A;  2YUS A;  2ZO4 A;  4RLF A;  3FIW A;  3CC4 I;  3T8T A;  2PG4 A;  2F4M B;  1WKM A;  2D2W A;  2FMY A;  2XGC A;  3TQN A;  4IOA F;  4A5N A;  2QYO A;  3E6B A;  3KYL A;  3ML6 A;  4N9H A;  4RM2 A;  2IJL A;  3FXU A;  4ESF A;  5M5Y J;  2VXD A;  1MH3 A;  2ZME A;  2HU9 A;  1OR7 C;  2O8X A;  3ROU A;  4F55 A;  3CP8 A;  3WHC A;  3WG9 A;  2JN6 A;  3W6K B;  1MBE A;  3D5R C;  2VT3 A;  3I4N J;  4MFE A;  2M87 A;  4RGU A;  4BBR J;  3HGG A;  1MJA A;  3COA C;  4AIJ A;  2XF7 A;  5F1R A;  2OBP A;  4H0E A;  1DU6 A;  2L01 A;  4KIT B;  5EZH A;  3J7Y J;  2EWN A;  5K7H A;  2HXO A;  5JLW A;  1GV5 A;  3I5U A;  4HQM A;  3WGG A;  1KZH A;  2DMT A;  3L2V A;  3F8B A;  4C3I J;  5D8L B;  2WAD A;  1ITY A;  1AHD P;  4R8H A;  5HS9 A;  2RC4 A;  1YRN B;  2KIF A;  3CME I;  2AQF A;  3S3N A;  4C9Y A;  1OKR A;  1BBY A;  1YJW I;  1B8I B;  3PNV A;  1MND A;  3GTQ J;  1UFM A;  1HDP A;  3E5X A;  4GFB A;  2QKL B;  2IAI A;  3I9V 2;  3K10 A;  4YEL A;  2Z99 A;  2VAS A;  3LL7 A;  4BXU A;  4DNC A;  1VQO I;  2G9W A;  3BT9 A;  2B63 J;  3B6C A;  2JMW A;  2M7B A;  3MZ8 A;  1B6A A;  1P9Q C;  3M7G A;  5E3M A;  3OOP A;  4JP0 A;  3CC7 I;  1WJD A;  1VFC A;  1W36 C;  1RZ4 A;  3KZY A;  3S17 J;  2XB0 X;  4L5J A;  1F36 A;  3L2R A;  2K3F A;  1KQ9 A;  3FF5 A;  5FKN A;  5HOO A;  2HVR A;  3KZI C;  3H3Z A;  3M8F A;  3UR3 C;  1NG7 A;  3ERE D;  2LKX A;  3AG1 H;  4IRG A;  1HF0 A;  1ENH A;  1A5J A;  3MEX A;  4LIU A;  2W4S A;  3K0L A;  2VJ4 A;  2GA2 A;  3BTC A;  3C18 A;  3SEQ A;  4DZJ A;  3J7Z I;  4Y4R A;  3TDU C;  1R23 A;  3FX3 A;  2EZL A;  3ABM H;  4FT8 A;  2HPM A;  3OYD A;  2K27 A;  5IP7 J;  4CCK A;  1SAN A;  1QA6 A;  1RKW A;  3ZN0 A;  3WTY C;  1JKR C;  2DK5 A;  1PUF B;  1RUO A;  2LF8 A;  2KIS A;  3CLQ A;  3BCA A;  3KCC A;  3KP5 A;  4GCV A;  5FLX K;  2M30 A;  1T98 A;  3ZXS A;  2XPW A;  4CCL A;  2JA8 J;  3E1S A;  2LD5 A;  1YI2 I;  5H20 A;  3EUK L;  3CCL I;  1VQ7 I;  2L4A A;  2QCO A;  1IXS B;  2VJJ A;  5E3N A;  4HEA 2;  2DOD A;  2KZV A;  4BHC A;  1SVL A;  2G7U A;  3TGN A;  2EA2 A;  3ULQ B;  2EFO A;  4A3E J;  2ISZ A;  3DFG A;  2HZT A;  3NAU A;  4R79 A;  2VPR A;  2QGU A;  2IGK A;  5IT3 A;  1HW1 A;  5DM7 F;  2FBK A;  1RUN A;  1TNT A;  1E0E A;  4OWR B;  1XGN A;  1M1E B;  2Y0S A;  2R7Q A;  1J59 A;  5L3C A;  2DYS H;  3OR2 C;  3GWZ A;  4DYC A;  3LQQ A;  1YRN A;  5JHF A;  5B66 C;  2ZKZ A;  2PMZ N;  5CVU A;  1A36 A;  2ZME C;  5KNL A;  4M3E A;  3F8F A;  5EG0 A;  2HTJ A;  4IZZ A;  5F64 A;  3ZQC A;  1OJL A;  3LFU A;  4B09 A;  2LC2 A;  4LMY A;  4WK8 F;  1WJB A;  2TCT A;  1XD7 A;  2L4M A;  3BOQ A;  1F5T A;  1TWA J;  3ABT A;  1JXS A;  1OMI A;  2E1M C;  3CQZ J;  4WCG A;  3EUH C;  4AIK A;  1ZH5 A;  4ZTF A;  1MH4 A;  2WB1 N;  5C3E J;  1X1D A;  1APL C;  1X58 A;  1YHQ I;  2BYV E;  3M07 A;  4E7I A;  4QPO A;  1RC9 A;  2NS7 A;  3HOZ J;  2X1D A;  4HZF A;  2KT0 A;  2JSC A;  3QAH A;  4BU2 A;  1XX5 A;  3I4P A;  3HUG B;  3U2R A;  4OIR F;  1S72 I;  1WVR A;  2F5E A;  2XPV A;  4FE7 A;  4S05 A;  3V7R A;  1LUJ B;  1W0T A;  5DYM A;  1XMK A;  1ZEL A;  2JA2 A;  3OV8 A;  4EQQ A;  2K85 A;  1BA5 A;  1W5C C;  3BG7 A;  4UV8 A;  2OZ6 A;  5ERI A;  3HOS A;  1VQ8 I;  1MJB A;  4LLL A;  3SHF A;  3ZMV A;  4XSX F;  3AL0 C;  1S29 A;  3WGH A;  1KU7 A;  2LP0 A;  1FIA A;  1B59 A;  2HVQ A;  2EV0 A;  5JR3 A;  3W6V A;  1OIS A;  2AXT C;  3OYJ A;  1TP4 A;  5IYC J;  1GLN A;  3J7A O;  3E0J B;  5DD8 A;  2YU3 A;  4I02 A;  4JQF A;  4IOC F;  5LBQ A;  3I54 A;  2R92 J;  3NWS A;  3PNY A;  3JRH A;  5IOY A;  5ILU A;  2XGX A;  3NRV A;  4IKF A;  4XKB A;  5M3F J;  4XKW A;  4UUV A;  2X85 A;  2YR2 A;  2XAS A;  4C30 A;  1WJC A;  3BLY A;  1HSJ A;  5J1R A;  4LIT A;  1RET A;  2LY1 A;  3HTU A;  4C2M J;  2P5L C;  4KN4 X;  3OWT A;  4B4C A;  1GXQ A;  3TW6 A;  1FIP A;  5B1B H;  5IYD J;  3GX4 X;  2CH0 A;  1XDS A;  3K4M A;  5D5X B;  4U7B A;  5AIQ A;  1EH7 A;  3OY9 A;  1XCV A;  1EJ9 A;  2L02 A;  3LST A;  3GFL A;  3MFK A;  1UZC A;  2LTP A;  2ESH A;  1P7J A;  1ACI A;  1I50 J;  4PK4 A;  4KIS A;  5KAI C;  2ZSH B;  3RKQ A;  1GT0 C;  3GEZ A;  4OIO F;  1OCC H;  2FOK A;  4YFX F;  2VKH A;  1G6N A;  3MVP A;  4AVZ A;  5E18 F;  1QGP A;  2ZB9 A;  3CD6 I;  1Z7U A;  2W48 A;  1XPX A;  3I71 A;  1YW9 A;  1ON2 A;  2QQ8 A;  1FJL A;  1SFE A;  4CXF A;  1ZG1 A;  5D8K B;  1SVM A;  4UV9 A;  4AVP A;  4JYK A;  3LSK A;  1PUF A;  3G6E I;  3TL4 X;  4CHU A;  2X51 A;  1P4X A;  3EPZ A;  4YG2 F;  1A04 A;  1YW7 A;  1K78 A;  2VUM J;  4XMY A;  2H1L A;  2RQP A;  2L9S A;  3M1E A;  2AHQ A;  1LKX A;  2STW A;  3Q3S A;  1K83 J;  1POG A;  4U0Y A;  2K9Q A;  3GFM A;  2YX7 A;  4XSZ F;  1TWH J;  1YOV B;  2M4K A;  2Y30 A;  4NC7 A;  5LGN A;  4LGW A;  2ACJ A;  1WHU A;  4PCQ A;  3K1P A;  2KHM A;  1SMT A;  2A68 F;  3IH4 A;  1QZZ A;  4YIR X;  2BW3 A;  2ZNZ A;  1RIO H;  3WTZ A;  3VOD A;  4Q5S F;  2X6O A;  3RSN A;  4F91 B;  1ETW A;  1PJR A;  1NH3 A;  2NOJ B;  2WWY A;  1XDU A;  3RTR A;  2KIM A;  2XKP A;  3OMY A;  4P96 A;  1W36 D;  3QP5 A;  4IL6 C;  4M6X A;  3S1N J;  4G94 A;  5GAE J;  2R7R A;  2V26 A;  1MDM A;  1HA8 A;  3OR1 C;  1EH6 A;  1QO0 D;  2HXI A;  2MSY A;  4GDF A;  3B73 A;  1ETO A;  2ETH A;  4AYB N;  1BI3 A;  3DLA A;  4KA4 A;  2FQ4 A; 
#chains in the Genus database with same CATH homology
 3R0A A;  5FD5 A;  1BC8 C;  1V4R A;  3I59 B;  4F7Z A;  4XRF A;  1ZG5 A;  2X0L A;  1YYV A;  3P9C A;  1BIB A;  2EB7 A;  2M5W A;  4Y13 A;  2A69 F;  4LG0 A;  2MH2 A;  4HLY A;  2XRN A;  1CF7 A;  2IVM A;  2YX4 A;  3LA3 A;  3BWG A;  4MEX F;  3QU3 A;  4G7O F;  3IWZ A;  1MZB A;  1CGP A;  4HBL A;  3E6D A;  4KIG A;  1R58 A;  1YS7 A;  2PI0 A;  1SAX A;  1H9G A;  2M45 A;  5H6R A;  3CUQ B;  3WTW C;  3T0Y A;  2E1C A;  1ZGJ A;  1RI7 A;  2L3D A;  2XUB A;  1G3T A;  4CO8 A;  4FX0 A;  4L9V A;  2LNB A;  2DFI A;  1B9M A;  3T8R A;  4IRI A;  2DI3 A;  2VBW A;  4M6Y A;  1YO5 C;  1OYW A;  5DD4 A;  2P6T A;  4A6D A;  3BPV A;  1G3W A;  1WRJ A;  2P5V A;  2CQK A;  3REO A;  1TQM A;  4G7Z F;  1DPU A;  3GVA A;  1O57 A;  4G6Q A;  3GXO A;  4NHJ A;  2EV6 A;  2QEN A;  2CO5 A;  3ZQ7 A;  3M9A A;  1ZN2 A;  3DXJ F;  5CVV A;  1EH8 A;  4RGR A;  2K7L A;  3FMR A;  1ZLK A;  1TQP A;  2O0Y A;  5L3G A;  4XLN F;  5CYV A;  3FZV A;  4EJU A;  2OQR A;  2MA3 A;  5FB2 A;  2IRF G;  3QOP A;  2FBI A;  3LFK A;  4LJZ F;  1W7P B;  2PEX A;  5LGT A;  1B1B A;  4XBF A;  5HDN A;  1E2X A;  2P7C B;  1XSD A;  1MDM B;  3EDP A;  1OYY A;  1DP7 P;  2NNY A;  3RKY A;  2L54 A;  3BPX A;  1ZGA A;  2QQB A;  1R22 A;  1IN6 A;  4ZYE A;  2VC1 A;  3DPL C;  1I6X A;  2HS5 A;  1SD5 A;  3BY6 A;  4I01 A;  1D8J A;  3V7S A;  2ESN A;  4UXN A;  4U0V A;  2JRT A;  2W57 A;  3K2Z A;  3E5U A;  1CF7 B;  1ZG3 A;  1FC3 A;  1SFX A;  4HV5 A;  4WXD A;  1BN5 A;  2LSO A;  2GIV A;  1U8R A;  2W24 A;  2EK5 A;  3F8M A;  3AAF A;  3MQ0 A;  4IHT A;  4EV0 A;  4KNY A;  1UST A;  4KN7 X;  1J7K A;  1BI2 A;  1ZRF A;  1KGS A;  3ZPL A;  3IL2 A;  5DUK A;  2XAG A;  2B0L A;  4Q4Z F;  1RNL A;  3TOB A;  2RN7 A;  3T5X A;  4R1H A;  3HRM A;  2KRF A;  1KQ8 A;  3N4M A;  5JHU A;  5TRD A;  2P7V B;  4O6J A;  2WTE A;  5E8I A;  1F4K A;  2KIU A;  3EYI A;  2CFX A;  5DCM B;  1W7P A;  2QVO A;  4HW0 A;  4OMZ A;  3KLN A;  4MGR A;  1QQI A;  2H6B A;  2VBZ A;  2DPD A;  3K1N A;  4L9T A;  5KK1 A;  4HOB A;  2FF4 A;  3V4G A;  4FX4 A;  3G73 A;  3WE3 A;  3PFI A;  4IPA A;  2XVC A;  1BI0 A;  3GLX A;  3TOA A;  2DK8 A;  1STZ A;  3JAM Z;  4NB5 A;  1IW7 F;  3D0S A;  2FBH A;  2HKX A;  5E1X A;  2O3F A;  2KJB A;  3BDD A;  4HAM A;  2JPB A;  2P4W A;  3GF2 A;  2DTR A;  3RDI A;  5ILV A;  4KDP A;  2OQG A;  2XIG A;  3GZ5 A;  3DQV C;  2F5F A;  2XHK A;  1IN7 A;  1O3R A;  4BNC A;  3MAJ A;  3ELK A;  3JW4 A;  4OMY A;  1HKT A;  2GZW A;  4G9Y A;  2Z5U A;  4RS8 A;  2CGP A;  1I27 A;  3BZ6 A;  5LRS A;  1VTN C;  3T1B A;  4IXA A;  5LEJ A;  3IKT A;  2W85 A;  4OIP F;  3KP2 A;  4O3M A;  1USS A;  4EGZ A;  4HDU A;  1S8N A;  4LK1 F;  1HW2 A;  4N9I A;  3MZY A;  2Z33 A;  2D45 A;  1W7P D;  1FX7 A;  5E1Z B;  1TW3 A;  5CJ9 A;  4AIH A;  3R60 A;  1XGO A;  3ZP5 A;  1ZYR F;  5DCM A;  1IRF A;  4AWX B;  1MJ9 A;  1FPQ A;  4RB2 C;  2Y0M A;  4ENK A;  1FZP B;  4RB1 A;  1HXD A;  2EJR A;  4RB3 C;  3I58 A;  3GZ6 A;  3EQL F;  4HX7 A;  1D3Y A;  3NQO A;  2VOD A;  4WXH A;  2MH9 A;  4MHG A;  1AWC A;  3ZMT A;  1T38 A;  1IUY A;  3ZN1 A;  2DPU A;  3I64 A;  3F6O A;  1Z05 A;  3E97 A;  1PDN C;  3QP6 A;  4Q47 A;  1K6O A;  1YG2 A;  3ZMS A;  4UNO A;  1HST A;  5D5U B;  1JGS A;  1FSH A;  5HLG A;  2M1B A;  5FFZ A;  2Y75 A;  5D4R A;  1B9N A;  4GXO A;  3N97 A;  5BOX A;  4PGH A;  1SD4 A;  1G3Y A;  2P8T A;  2D1V A;  1B4A A;  4CDG A;  3RIR A;  2IT0 A;  3IRR A;  2Q0O A;  2Z9O A;  3E5Q A;  1U5T C;  2H94 A;  1IN8 A;  4RAZ A;  1R5G A;  4CGZ A;  2DLL A;  4OU0 A;  1UHM A;  3V8J A;  2KJC A;  4ENJ A;  1AOY A;  1W5T A;  3KP7 A;  3LAP A;  2OAZ A;  2LKP A;  3HRU A;  2HEO A;  4MTE A;  5IT9 Z;  2RGV A;  5D5V B;  4L9J A;  1S7O A;  3K69 A;  5FLX Z;  2EA4 A;  2Q8K A;  4KUM A;  3QU6 A;  3Q5F A;  4G6D A;  3TDZ C;  5J8C A;  3R6S A;  2FA5 A;  2A6H F;  1O3T A;  3FHZ A;  1FLI A;  1Z9C A;  3I53 A;  2RNJ A;  3VEP A;  2JTV A;  4KMF A;  3GFI A;  5IT9 K;  2V1U A;  3HSF A;  1X3U A;  2NAZ A;  2J5O A;  5E17 F;  3WTU C;  3O2P E;  4HV6 A;  3EUH A;  4JBA A;  2A61 A;  2ISY A;  1OR7 A;  4I09 A;  2VN2 A;  1E17 A;  2XV4 S;  5BMZ A;  1XSV A;  2H09 A;  4M9Z A;  4KYW A;  1GVJ A;  4EM1 A;  4P5O A;  5AON A;  4HX8 A;  5K5Q A;  1G3S A;  1TQI A;  5CVJ A;  4EJV A;  3CDH A;  5LEK A;  1PP7 U;  4I7H A;  4EMS A;  2PBI A;  2PMU A;  3ABU A;  4M72 A;  1L0O C;  3EET A;  1ZHF A;  2XAQ A;  5E1W A;  2ZFW A;  1XMA A;  1S6L A;  1WI9 A;  1KU2 A;  2HDC A;  3KEQ A;  2Z3Y A;  1S3J A;  1P2F A;  3DP7 A;  4BHB A;  1JHF A;  2H6C A;  3F23 A;  3BRO A;  1Z6T A;  5JFR A;  3KLO A;  2FRH A;  5CVI A;  2OZU A;  1UCR A;  2DU9 A;  4ENN A;  5FO5 A;  3HYI A;  1JE8 A;  1O3S A;  4ESB A;  3MCZ A;  2G7H A;  1T39 A;  4JK1 X;  4PDK A;  2O03 A;  3I59 A;  2IP2 A;  2DBB A;  3LWF A;  3P7N A;  3RYR A;  1FP1 D;  1J2X A;  4RGX A;  1PUE E;  5BPD A;  5H6Q A;  4YFN F;  3LAJ A;  1IZ1 A;  2MLG A;  5LHG A;  1W5S A;  2CSO A;  2HFH A;  2PN6 A;  4A0Y A;  3KP6 A;  1W4M A;  1P4W A;  1FT9 A;  2ZBK A;  3IWF A;  1FSE A;  1J9I A;  2ZME B;  1DUX C;  1U5T B;  4HQE A;  1Q1H A;  3WE2 A;  2P6S A;  1D5V A;  3GYH X;  2QQ9 A;  2KKO A;  4U88 A;  3SXY A;  2K4B A;  1T0F A;  1R1U A;  4EJT A;  4E70 A;  4M73 A;  5DCF A;  3C7J A;  2VBX A;  3E6M A;  2COM A;  3PQJ A;  1R1T A;  3RPQ A;  5J8F A;  2XAH A;  4RGS A;  4QWQ A;  3V7C A;  1ZLJ A;  1QNT A;  1YS6 A;  4K2E A;  5HS8 A;  3WU0 A;  2V6C A;  4EJW A;  1P92 A;  2JPC A;  4L18 B;  4HYE A;  3EYY A;  1XN7 A;  2GA1 A;  1J5Y A;  1UHW A;  1O3Q A;  3L7W A;  3W6J B;  1ZRC A;  4L9N A;  4WXC A;  3ECO A;  4U0W A;  4HX4 A;  1WQ2 A;  1ULY A;  2FE3 A;  1IN5 A;  2BEO A;  2EV5 A;  1LNW A;  5LLQ A;  3F8N A;  1F1Z A;  4ZZL A;  2EFW A;  5DUI A;  3SZT A;  4A12 A;  2BGC A;  2ZJ2 A;  2XAF A;  2OA4 A;  5K5R A;  1IXR C;  1U78 A;  1LVA A;  3TO6 A;  3R0J A;  1IXC A;  1DDN A;  3IC7 A;  1C0W A;  2FEZ A;  4HF2 A;  3I0T A;  1QZY A;  4OOI A;  1Y0U A;  4IVN A;  3U1D A;  3KE2 A;  4Y17 A;  4D0P A;  2F2E A;  2A6E F;  4P9U A;  1UB9 A;  3E6C C;  2D1H A;  3J81 K;  2EFN A;  5D6E A;  3L9F A;  4S04 A;  2O61 A;  5ED4 A;  2E7W A;  5LRR A;  1KYZ A;  4WX9 A;  2HYG D;  5E8G A;  1NHA A;  5F6F A;  1PP8 F;  3RYP A;  5DEQ A;  4GO1 A;  1FBQ A;  2PMH A;  1XGM A;  3MZH A;  2W84 A;  4CIC A;  4EM0 B;  3KZZ A;  3LA2 A;  5EEG A;  4O5V A;  5ICG A;  4ENM A;  2GWR A;  2PJP A;  3CLO A;  4ASN A;  4I0B A;  3HUG A;  2HGC A;  4HLX A;  1U5T A;  2F5D A;  3ZMD A;  3RPU A;  3QRF F;  2M8E A;  3CO6 C;  2CWE A;  3TO9 A;  3CTA A;  1HKQ A;  3QPH A;  2R7F A;  1K78 B;  1XCB A;  1T6S A;  3Q9S A;  3H92 A;  3KP4 A;  2VE8 A;  1G4D A;  3JTG A;  5L3D A;  5TJJ A;  1TNS A;  1FP2 A;  1HQC A;  1BIA A;  4MQV A;  5L3F A;  3QPT A;  3CO7 C;  4G8X A;  1K79 A;  2QBY A;  2A3S A;  2QZ8 A;  2DW4 A;  4LK0 F;  1I1S A;  4GYG A;  1LDD A;  2WV0 A;  1GHC A;  4ZYH A;  1TTY A;  5JI6 A;  3J80 K;  2QUF A;  2HOE A;  5BS6 A;  2YPR A;  3ECH A;  1V3F A;  4L0Z B;  3LQR A;  5L3E A;  2A5Y B;  3PQK A;  4GGG A;  3HRT A;  3R4K A;  4BQA A;  2MBF A;  3RI4 A;  5LHH A;  2HKO A;  3BJ6 A;  4QLC U;  2OU2 A;  4HDV A;  4L0Y B;  3F22 A;  2XAJ A;  2GXG A;  5J6X A;  2UWM A;  3FXQ A;  1YIO A;  4A5M A;  1R00 A;  1OPC A;  1BOA A;  2OD5 A;  1FBS A;  3F21 A;  3CUQ A;  2DAO A;  1LEB A;  2UZK A;  1IN4 A;  5FD6 A;  1SD6 A;  3FWE A;  1MGT A;  2EFQ A;  2CW0 F;  4G7H F;  4M9X A;  3KFW X;  3GO5 A;  1GXP A;  2H27 A;  2FU4 A;  4LG0 B;  3WTT C;  3HIF A;  1KQ0 A;  1HBX G;  2ZXJ A;  3F72 A;  4M71 A;  3SQN A;  2QBY B;  1O7F A;  2DQL A;  2K02 A;  5DV5 A;  3BJA A;  4YII A;  3TKY A;  2RDP A;  1SD7 A;  3HSR A;  3L2C A;  1ZRE A;  2X4H A;  4Q48 A;  2CG4 A;  2W25 A;  3J81 Z;  2FNP A;  1R5H A;  2VOO A;  2RKH A;  3VFZ A;  2E7X A;  1H0M A;  4ZYG A;  4FHT A;  3WTS C;  1LEA A;  4KT5 C;  2DT5 A;  1F9N A;  2R7D A;  3SZP A;  2DO7 A;  3O3K A;  3FXR A;  2JZY A;  1R36 A;  1KU3 A;  6PAX A;  1R7J A;  2F5C A;  3RJP A;  4ETS A;  1L3L A;  1HKS A;  2NRA C;  4MNU A;  1FYM A;  1J0R A;  3D5L A;  2FML A;  4BYY A;  4CYD A;  2UXN A;  2VC0 A;  1QBJ A;  4LLN A;  2YSR A;  5A2Q K;  3RKW A;  3DEU A;  2FXA A;  4DQ2 A;  4BHP A;  3C1D A;  1TW2 A;  2FQ3 A;  4IHS A;  3TO7 A;  2MLK A;  1WWX A;  3GW2 A;  4A6E A;  5HDG A;  1KU9 A;  1ZAO A;  2FSW A;  1ZRD A;  2UXX A;  1OYI A;  1TLH B;  3IRQ A;  2C6Y A;  2XKO A;  5CLS A;  2ZCW A;  2BV6 A;  2HWV A;  4ON0 A;  4UVB A;  2QLZ A;  1LQ1 A;  2PLY A;  4TV7 A;  2NYX A;  3H3U A;  5ICF A;  2PFB A;  2AXL A;  5HVQ C;  5HS7 A;  5D5W B;  3BJO A;  3HTS B;  4A0Z A;  3WTX C;  2CYY A;  3C3W A;  3WTV C;  4I2O A;  2NS0 A;  2V9V A;  2GQQ A;  2QM3 A;  4M9S A;  4P9F A;  4IJA A;  1KA8 A;  1U3E M;  1R1V A;  1YFH A;  1ODD A;  2RV8 A;  2ELH A;  3RKX A;  5L3B A;  3B02 A;  4KIC A;  1Z91 A;  5CVR A;  3E3V A;  2IPQ X;  4EJO A;  5KVR A;  5LGU A;  3ISP A;  3KP3 A;  4RAY A;  3HHG A;  5HLH A;  2HYF A;  1XSX A;  2IA1 A;  1LB2 A;  1FY7 A;  3DF8 A;  1BM9 A;  5EEH A;  1TBX A;  5K1Y A;  3JSP A;  5D4S A;  4I98 B;  1D8K A;  4HF1 A;  1KYW A;  1MKM A;  2PQ8 A;  3WGI A;  4N0B A;  1YLF A;  1I5Z A;  3VOE A;  4KIF A;  4U7D A;  3WU1 B;  3P9K A;  5JVT A;  5DDG A;  5D6F A;  4MEY F;  1LJ9 A;  1ZAR A;  3CJN A;  4LB5 A;  5K5O A;  3ZMU A;  3FM5 A;  5AIP A;  3HSE A;  1REP C;  5ILS A;  3GFJ A;  2DQR A;  2HQN A;  4ZZD A;  1YW8 A;  1O7L A;  2R3S A;  4GYI A;  4Y15 A;  4WF2 A;  2NNN A;  3ZMZ A;  4KFC A;  3GUD A;  4EGY A;  3F3X A;  1Z6R A;  4MQ9 F;  2O6G E;  3F8C A;  1Z1D A;  3S2W A;  3J80 Z;  2E1N A;  4MTD A;  3DKW A;  4EM2 A;  3MWM A;  2LDU A;  3CUO A;  4KIB A;  1BC7 C;  5LHI A;  4PZJ A;  4IRH A;  1LDK B;  4EVI A;  1FOK A;  5A2Q Z;  2QWW A;  2ZNY A;  2K4J A;  2GXB A;  4LD5 A;  4OIN F;  2V1D A;  3O6B B;  3JSO A;  3SFZ A;  3HOT A;  3IHU A;  4A2U A;  1FYL A;  1WSU A;  2V1X A;  3JTH A;  3KET A;  2IW5 A;  4BAY A;  3K9T A;  2FNA A;  4I0A A;  1U2W A;  2VOP A;  2HQR A;  2EFP A;  1IF1 A;  1FNN A;  2Q2E A;  2VXZ A;  3G3Z A;  4PGG A;  3R61 A;  1DPR A;  4YIF A;  2HR3 A;  1I1G A;  3U9G A;  1U6G A;  3DV8 A;  2VBY A;  1J75 A;  2WC2 A;  4M74 A;  1IAW A;  2BE5 F;  4HA8 A;  3VB2 A;  2XRO A;  2HTS A;  1P6R A;  4A0X A;  1H9T A;  2V79 A;  3JAM K;  1YTY A;  5ICC A;  4CZZ A;  3WOD F;  4XLP F;  4ESJ A;  3L00 A;  5ICE A;  4UVC A;  2AS5 F;  2IA2 A;  2ADU A;  1ONV A;  3IKV A;  2BBY A;  2Y48 A;  2VT2 A;  1ON1 A;  1FBU A;  5FFX A;  4KMU X;  3NEU A;  3K1M A;  2LF7 A;  1JHH A;  1T2K A;  2STT A;  3P9I A;  4UVA A;  1MD0 A;  2VON A;  1YQA A;  1P4A A;  4WWC A;  3M8E A;  1XB4 A;  2JT1 A;  4YFK F;  2K86 A;  2A07 F;  3CUQ C;  1IRG A;  1EV7 A;  3FM3 A;  4NQW A;  5HLI A;  1FYK A;  2QQA A;  2P5K A;  2MC3 A;  3KEO A;  5BPI A;  2RVC A;  1BI1 A;  5BQT A;  2MD5 A;  3V8L A;  4P55 A;  5FGM A;  4BH9 A;  1K7A A;  5E20 A;  4LLG F;  4IF4 A;  5HDK A;  3Q9V A;  4RB0 A;  1HW5 A;  3FMS A;  1SFU A;  4LFU A;  3HRS A;  1XGS A;  2TDX A;  2J5P A;  1SMY F;  2IA0 A;  4Z2Y A;  4HF0 A;  1S7A A;  4ZYD A;  1LDJ A;  4AD9 A;  4B8X A;  3DPT A;  1FWZ A;  3LA7 A;  1BJA A;  3L09 A;  2GAU A;  3V8K A;  4OIQ F;  3FMQ A;  3F6V A;  3HHH A;  3BP8 A;  2VE9 A;  4UHT A;  4L5I A;  1QPM A;  4LB6 B;  4ZH4 F;  2ZO4 A;  3T8T A;  2PG4 A;  3TQN A;  1WKM A;  2D2W A;  2FMY A;  4A5N A;  2QYO A;  3E6B A;  3ML6 A;  4N9H A;  2IJL A;  3FXU A;  4ESF A;  2ZME A;  2O8X A;  3ROU A;  3WG9 A;  3W6K B;  2VT3 A;  2M87 A;  4RGU A;  3COA C;  4AIJ A;  1MJA A;  5F1R A;  2OBP A;  4H0E A;  2L01 A;  2EWN A;  3I5U A;  4HQM A;  3WGG A;  3F8B A;  5D8L B;  4R8H A;  5HS9 A;  2RC4 A;  2KIF A;  1OKR A;  1BBY A;  1UFM A;  3E5X A;  2Z99 A;  4BXU A;  4DNC A;  2G9W A;  1B6A A;  3M7G A;  3OOP A;  1RZ4 A;  3KZY A;  4L5J A;  1KQ9 A;  3FF5 A;  5HOO A;  3H3Z A;  3M8F A;  3ERE D;  4IRG A;  3MEX A;  3K0L A;  2GA2 A;  3C18 A;  3TDU C;  1R23 A;  3FX3 A;  4FT8 A;  2K27 A;  3ZN0 A;  3WTY C;  2DK5 A;  1RUO A;  2LF8 A;  3KCC A;  3KP5 A;  4GCV A;  5FLX K;  2M30 A;  1T98 A;  5H20 A;  2L4A A;  1IXS B;  4BHC A;  2G7U A;  3TGN A;  2EA2 A;  3ULQ B;  2EFO A;  2ISZ A;  3DFG A;  2HZT A;  4R79 A;  5IT3 A;  1HW1 A;  2FBK A;  1RUN A;  1TNT A;  1XGN A;  1J59 A;  5L3C A;  3GWZ A;  3LQQ A;  2ZKZ A;  5CVU A;  3F8F A;  2HTJ A;  5F64 A;  4B09 A;  4WK8 F;  4LMY A;  1XD7 A;  2L4M A;  3BOQ A;  1F5T A;  1JXS A;  3ABT A;  1OMI A;  4WCG A;  4AIK A;  1ZH5 A;  2BYV E;  4HZF A;  2JSC A;  3QAH A;  3I4P A;  3U2R A;  4OIR F;  2F5E A;  4S05 A;  3V7R A;  5DYM A;  1XMK A;  3OV8 A;  4EQQ A;  4UV8 A;  2OZ6 A;  5ERI A;  3HOS A;  1MJB A;  4LLL A;  3SHF A;  3ZMV A;  4XSX F;  1S29 A;  3WGH A;  1KU7 A;  1B59 A;  2EV0 A;  5JR3 A;  3J7A O;  5DD8 A;  2YU3 A;  4I02 A;  4JQF A;  5LBQ A;  3I54 A;  5ILU A;  2XGX A;  3NRV A;  4UUV A;  2YR2 A;  2XAS A;  1HSJ A;  2P5L C;  3HTU A;  4KN4 X;  1GXQ A;  3GX4 X;  1XDS A;  5D5X B;  4U7B A;  5AIQ A;  1EH7 A;  1XCV A;  2L02 A;  3LST A;  3GFL A;  3MFK A;  2ESH A;  4OIO F;  3GEZ A;  2FOK A;  4YFX F;  1G6N A;  5E18 F;  1QGP A;  1Z7U A;  3I71 A;  1YW9 A;  1ON2 A;  1ZG1 A;  1SFE A;  4CXF A;  5D8K B;  4UV9 A;  4AVP A;  4CHU A;  1P4X A;  4YG2 F;  1A04 A;  1YW7 A;  1K78 A;  2RQP A;  3M1E A;  2STW A;  4U0Y A;  3GFM A;  2YX7 A;  4XSZ F;  5LGN A;  4LGW A;  2ACJ A;  4PCQ A;  3K1P A;  1SMT A;  2A68 F;  1QZZ A;  1RIO H;  2ZNZ A;  3WTZ A;  3VOD A;  4Q5S F;  2WWY A;  1XDU A;  3RTR A;  2KIM A;  2XKP A;  4P96 A;  3QP5 A;  4M6X A;  4G94 A;  1MDM A;  1EH6 A;  1QO0 D;  3B73 A;  2ETH A;  1BI3 A;  4KA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...