2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
3Q9VA 5GAGI 2QGFB 3MCOA 1UWBB 5DDPC 4ILLA 2HK3A 2FUG2 4HNTA 1VDHA 3K2AA 3Q8QB 3JQJA 1NK0A 1YZ7A 1D8KA 5H9FJ 3OUYB 1S7OA 4G9YA 4QJVA 3MFIA 4BKXA 1Q1VA 1MDMB 3VHQA 4X0GA 2W7NA 1R1VA 1BQMA 4TYAA 5D78A 2Y31A 3ILOA 3TGNA 2F5EA 4DR2J 4A8YA 3W5XA 1WHVA 1APLC 1U6BA 4HA8A 3OY9A 2DYAA 1VYAA 4J9QA 1RABB 2VXZA 2XF5A 4XLCA 2V1DA 4Y33A 4I1TA 3DC2A 3DU5A 2KHMA 2BXJA 5E3QA 2MLGA 5B66C 4TNOA 2LDUA 1E3PA 4N4OB 2IRUA 1YJ7A 5KTQA 2E1NA 1KBRA 4XR6A 2Y1JA 3EVOA 3B54A 2O0YA 3WG7H 4A5MA 2V8VA 5CYVA 5THWA 2F4VJ 2C3YA 2KJBA 2EW9A 3VGVA 3KK1B 1K78A 1EP4A 4FETA 1LQ9A 5DQHA 3K4CA 3K69A 4PEOA 2V67A 1RR7A 2C22A 5LRSA 1OIAA 1S9EB 4IKFA 1JXLA 2BUNA 1V55H 1B70B 3GBGA 3ENQA 1WTFA 3R0JA 4MKBA 4O4GA 2LLZA 4LBPA 3DWLE 4A8FA 2QMUB 3AOAA 1HNZJ 1X4OA 2FGCA 4ESBA 2HQNA 4XLNF 3SFIA 3D1OA 4M5IA 3R6SA 2RKIA 3N4WA 4CO4A 3FM5A 4BHPA 1X1BA 3BBCA 3BEGB 2K9MA 5D0GA 1X5SA 2GX8A 2C1EB 2AYGA 2JA2A 2KLOA 3KP4A 2ZVSA 4A47A 5HROB 2F2EA 1ZBTA 3KE2A 5ITHA 2L7FP 4BLGA 4G1QA 4ED7A 2V1XA 2YWGA 1XSDA 1SD4A 4C3IJ 3UW1A 2MQLA 1ON1A 1RWVB 3SEOA 1RGVA 5DETA 1CS4B 5JHFA 2V6EA 4A8KA 2AP6A 3LP1A 4CO3A 1SIWB 2M4KA 1OY9A 2LMIA 1T56A 1VQ4S 1YJTA 5H6QA 2RQCA 2W9BA 5EJCA 1AHDP 1R8BA 4USVA 2AJ4A 4HLXA 4OI0A 4BCAA 2EG2A 4FVMA 3ETMA 1KYZA 2MW8A 2OJ3A 1CJVA 2LSOA 2HS3A 1PUFA 2GA7A 3TOQA 2RNGA 3ZNJ1 2HWTA 3RRKA 4DV3J 2AX1A 4USUA 2ZM6F 2WSEC 2M7SA 2VJ4A 2VJUA 1W0TA 4ECRA 1FTRA 1HHTP 4BBYA 4DR7J 2R7VA 4BHCA 2DK2A 3A2KA 5BQTA 5D0HA 5DZ6A 1ZTRA 2HI3A 3DRPA 1QE1A 4HSRA 1UHMA 2DXIA 1D9AA 4OQJA 4DGWB 5AJ3J 2YNHA 2FU4A 2ERRA 2ATCB 2AGQA 3ZN0A 2KIUA 3I4NJ 1B99A 4RW7B 2NXJA 2EVZA 4AL7A 2QN6B 1MMAA 2D3O1 4WFXA 1VQLI 1U45A 4LF9F 2BM0A 2K3PA 3IAS9 4HQMA 2OZUA 2PFBA 3PW4A 2BYVE 3ZZRA 1UCRA 1IG7A 3B78A 2GQCA 5LD2C 2HG4A 3R9LA 1BL0A 4H4MA 4RW9A 3H4DA 1MBKA 1RQ0A 3FMQA 2XG8A 3M4XA 4BGDA 3I3LA 2XY5A 1TT0A 1QHGA 3BM7A 1FXRA 1NKCA 1FRMA 1NLKL 3EZUA 4USWA 1S29A 2RKIB 1SJ4P 5FRMA 5DQIA 1CJTA 3QRFF 2FSWA 2JUCA 2EBEA 4CLWA 1SVMA 3DLBA 4XIDA 1TWHJ 2WY7Q 4MIMA 3ULQB 2E2JJ 1RRJA 2F5GA 3H90A 4G1QB 2HYIB 4PXBA 2KZGA 3KZZA 1D09B 3OHBA 5L9XA 4FCYA 4DR7F 2GWRA 3N0VA 1C2PA 3V4IA 2YY3A 4PSWA 5HNFA 2K7KA 1T9XA 2MLYA 4RL1A 5A2QZ 1ZH5A 3ZZUA 2HFVA 3MR6A 3CCQS 4BH9A 3TAQA 2PE8A 4WK8F 1LEAA 2ABYA 4OHXA 4PG7A 1CJVB 5KFKA 2OF7A 2VKDA 1FZPB 2R5YA 1DBDA 1YOVB 5D5UB 4RDUA 3W2AA 3QT6A 2EA2A 3PUBA 2GCFA 3PG9A 2KXFA 4D5FA 2JVOA 5FLMJ 1UFKA 4DU8A 2VT2A 2UV8A 3R5CA 2ECCA 2HKOA 2DTZA 2KL4A 4MKAA 3ZQHA 4J9NA 2B3TB 1VRTA 2M8HA 2J8AA 1U78A 1R5GA 4TN2A 3EX7B 5A6WA 4AE5A 3UCZP 1R5HA 2FJEB 4G1PA 1PAEX 4O0IA 1QE1B 3O6BB 1JUPA 2XMWA 3MCMA 2YNHB 2GJ2A 4MIAA 1MZBA 3C6TA 2CV1A 3DCFA 4J00A 3CJKA 5BNGA 4I56A 2Q0OA 5LEJA 2QLWA 2AJ0A 3LH2S 2L4MA 2DA7A 1S9GA 4LIRA 2WV1A 4KYZA 4QWBA 1ZREA 2V79A 5CQEA 3HJFA 1X5TA 5FDLA 4IHYA 3P49B 5CD4A 2WVCA 4BAYA 2BE2B 2Z1DA 5LJ5Y 5F08A 3QWUA 3CCLS 3S01A 1U25A 2VFRA 3DFEA 3BR1A 4H4MB 3DF8A 3KG0A 5FKKA 4EGYA 4RW9B 4U88A 4PQUA 1SBRA 4DS5A 1WKKA 4EEFG 1YRUA 4BC7A 2JWNA 2MEWA 3BC8A 1DDNA 3H20A 2KHDA 2VOOA 3CC7S 1FF2A 2M5YA 3C16B 2XWXA 2B9XA 4CYCB 3OIPA 2P6SA 3OYCA 1CJTB 2LDIA 1FIPA 2LU1A 1RBOB 4M63A 2A5YB 4W1UA 2R7WA 4L9VA 1HQCA 2PX9A 1JT0A 4HYKA 4F8RA 4KGKA 3K5PA 2FHMA 3CXCR 1XMBA 5B7WA 2CQ4A 1HQUA 2RUSA 3VAKA 4BXUA 3GJRB 1G2HA 2NCKL 3P3DA 4A3IJ 1HW9A 3KOAA 1RBLA 2ZFHA 3SQGA 3E3XA 2VT3A 5HQMA 2WK4A 1I51B 1JUSA 2AQEA 2ROEA 2VPXB 1JT6A 1RP5A 3CCRS 4FNHA 1JHFA 4RLEA 3J7ZI 3MAJA 1DJ0A 2BKOA 4F3OA 1UMQA 3CMAI 1OKRA 4QYZJ 1I6XA 3OQ2A 2PBIA 2EBIA 5H9EJ 3G73A 2YX4A 2DHGA 4O23A 3U1DA 3QRPA 4OYIA 2OSRA 2DPDA 3HG9A 3CO6C 4F50A 2IDLA 2A6OA 1SKSA 4RW8B 5CYQB 4KTQA 2UXBF 3ICLA 4IHSA 5CLSA 5C5JA 3VDXA 3OR2C 3LGNA 4RU2A 1VRTB 2K02A 1X9SA 3K1NA 3ZZ0A 3TDZC 1PBUA 3P96A 3GYNA 4DZJA 2MC4A 4ZPBA 2JMWA 5L3EA 4UOFA 4ID5A 4QBUA 2LTPA 4NC6A 5J1EA 3Q8SB 1DQAA 1G6NA 2A18A 1R1UA 3CJKB 1A36A 3SV4A 2GNKA 1TTYA 1WCMJ 3F22A 1T6SA 2MZTA 2WCXA 4DZDA 4BE0A 5FDLB 1WJEA 3W9JA 6FD1A 4M5LA 4Y00A 3D7SB 1RWWB 3AG2H 3OXLA 2EBGA 1V3RA 1LW2B 3NL0A 5LLQA 2EK1A 4FYDA 2Z30B 2Z57B 4P75A 3EYYA 1JLGA 4PQUB 1Q86T 4P9SA 4OIXA 4C3MA 2R7FA 2X1DA 1SAUA 3KHRA 4NYZA 3JRCA 2JEFA 2EFQA 1Y1VJ 2ESHA 3TYTA 1TQPA 3MMAA 5SUHA 1URRA 4UZBA 2B8PA 2P9EA 4OL8A 3FMRA 3TO6A 4IFYA 4KY3A 1FC3A 3JSYA 5EZGA 3EICA 2WZ1A 2DGVA 5D15A 2DYRH 3MM5A 1N54B 3EM1A 4KQZA 1HQUB 2HDDA 3G1LA 3C46A 3C3WA 2CUJA 1ZRCA 4DR5J 3D5LA 1YJNS 1B4AA 1BWEA 2BVLA 1KZHA 3SQGB 1FWPA 1ROFA 3CMEI 2NYIA 3FM3A 4LFUA 3NCPA 2JVRA 2BA9A 2XB2D 4JV1A 4U7DA 5CYJA 3F21A 2HHXA 2VPRA 3DDKA 2E2IJ 3PHEA 1RZMA 1UHSA 3OLBA 2E1AA 1Z7UA 3NGUA 2L54A 1R71A 5CA5A 2W7OA 5KFDA 3GJSB 3KDNA 2HVQA 4IVNA 3VSKA 2HQRA 4C3JJ 2GFFA 3J81Z 4PGGA 2J0QD 4OYPA 1FFSB 3GTPJ 4M5GA 1TQLA 3T1HF 3OSPA 4LF7J 4N47A 2DNOA 3FWEA 1TT5B 2DNPA 1MIJA 2ZMEA 4KGXB 1MBJA 4IQ4A 4ZVPB 5DD8A 4ID5B 1RU2A 1S76D 4NLUA 3AAFA 3HSGA 4EWTA 4OAZA 5J1EB 1I6JA 2MA3A 3LQVA 3FISA 1XR6A 5A76A 2MSTA 3RAXA 3GTLJ 4XRMA 1R0CB 4YFUA 2DGTA 3ZXWA 4DG1A 3BCBA 1GX6A 1KR4A 3BTJA 2YNIA 4QW8A 2CH0A 4EMSA 2KZMA 1F43A 2XB0X 3I31A 3J7YI 4KHRA 5IYDJ 3VQTA 1L3SA 1K61A 3ERMA 2L9WA 3KG4A 4DR5F 2CPEA 1H8AC 2HHHJ 3K4BA 1JLGB 4A3FJ 4QWCA 1F9NA 5B09A 4IQMA 5CH7B 1MW7A 4HOBA 4U7BA 1CC8A 5F8HA 5IT3A 4YDXA 3DPTA 1IV8A 3RU0A 4C8OA 1N6QA 2HQIA 2BW2A 3GJQB 4DV2F 3MMAB 4DX6A 3BSCA 1K8AT 3C66A 2QLFB 3MQ0A 1OYIA 2QLXA 4CYDA 4IFYB 3PUFA 1OISA 4N8OA 1XC5A 3MM5B 4A3JJ 2KP6A 2M34A 3ZCOA 3J81U 1YQHA 2FLNA 4LFBF 4OHWA 2ELKA 3BS9A 1WG5A 2K86A 4A3LJ 1XR7A 4G8XA 3RYRA 2V68A 1VQ7I 4S05A 1H73A 4KGMA 4G12A 3A3OB 1FEHA 3EUKL 2FHJA 2CPYA 2M4GA 1FKPA 3F56A 5EGYA 4H4OA 5EYRA 3EPIA 2KMUA 2H4YB 2QKMB 2VA3A 3HC7A 1VQMI 5KT7A 3FBIB 1UAAA 1M0SA 5GAHU 1IJWC 2VUGA 3PEJA 1S6QA 4I09A 4B9VA 2CXEA 3S1MJ 4CGZA 5D4NA 4DV1J 3JRDA 3M9MB 1HNWJ 1HPZB 2HRYA 2CWKA 2DHSA 5K1YA 3WC2A 2DODA 4EM2A 1LEBA 4DL3A 2HHHF 1M5HA 3KP2A 5KFBA 2L41A 3K57A 2ZMEB 3HOYJ 2GHWA 3H1CA 4F0KA 2ZXHA 3V6KA 3GQCA 2XUBA 2JUGA 3NAUA 4M74A 3O44A 5HVQC 1T39A 5GPCA 4WWCA 1IKWA 4ABZA 3OYMA 4IO1A 2CKWA 3AD8C 2OCEA 5TRDA 2M2BA 4DG1B 5F6FA 3R3TA 2GBYA 3CB4A 4CLFA 3R2DJ 2JOQA 1R36A 4NC7A 2YNIB 3S2HJ 2G2YA 1RSCA 2MH9A 4DV4J 3V4GA 4UQTA 1F5AA 1MLAA 1ZR2A 4CCHA 4IJAA 1J5OA 3M6WA 3C3LA 1N5SA 2JFDA 5FJ8J 5J40A 1HWIA 3V7RA 4QSHA 1F1ZA 2OPRA 3GTOJ 1N52B 2JA6J 1OSDA 5LMUJ 4IRDA 3HSEA 1NSKL 4KN4X 1L3UA 1N6QB 3TL4X 3TOAA 2O3DA 2CQHA 1IJFB 1S10A 2V34A 2Z56B 3HJEA 2QSFX 2RUGA 3GIRA 3FSYA 4DCOB 1Q8KA 1SMYF 1RDRA 2AF6A 3QLHA 3DKXA 1FNNA 2CJAA 1Q78A 1FHTA 3D0GE 1HCRA 2ZDOA 4MTPA 1E3OC 1TC3C 3AB4B 3JB9k 5ETTA 3M8QB 3S14J 2XRNA 4F2RA 4A3MJ 2UUCJ 2IFXA 4X64J 2X6WA 1K0TA 2UXCJ 1YLXA 4D9JA 2CDRB 4U6PA 1SC6A 2DMPA 1FJLA 3MHYA 4QR0A 1UVMA 5HL7Q 3G1OA 3PTWA 1XD7A 4L3NA 1B4SA 2CS3A 1TVRA 2CJQA 3DTEA 1FKPB 4ZYGA 4KE5A 4H4OB 2VQFF 1FNOA 2A6TA 3ZQCA 3FHNA 1Y00A 5E5NA 1I3OB 2RIJA 3LNQA 5M3FJ 1S6QB 4AYBA 2DJWA 4DV4F 2DTJA 3MMBA 2JH3A 3QYBA 2MB0B 1NDPA 1O0PA 4AVPA 1S72I 1CC7A 4BS9A 2AMCB 2FHKA 2AT1B 1TFWA 5HANA 2OHDA 3MKLA 2KG0A 3H9QA 3C2BA 3GFJA 2JA7J 4CLSA 4CRJA 2XC9A 3BKFA 2IBOA 4CO2A 4IQJA 2RAQA 3JSOA 3UDLA 1RETA 1M5OC 4ANEA 1QAYA 4CT9A 3M2RA 2MLKA 1D0YA 4I7FA 4DYCA 4RNOA 1J5OB 2NRAC 3FMWA 5C44J 1Z2LA 3HI9A 1NB7A 2FB0A 2C28A 2GZWA 1QVTA 2YWKA 1FESA 1ZARA 2HOTA 2HGMA 2DA5A 2OPRB 2QSWA 2W1BA 3A3NB 2EILH 2ILZA 1JLCB 1S1WA 5GADJ 4F3MA 3BJAA 4L0YB 1OMSA 3M8YA 5KAFC 1F60B 1G3WA 3K8WA 1E6YA 1WC1A 3HT3A 2VIHA 1G7CB 3FXLA 4WP9A 3SXLA 4A8WA 5EWGA 1X3WB 2U1AA 2V2KA 3HGGA 3KNGA 3QLHB 5IP6A 3D0HE 4U95A 3KUEA 3DU6A 4XKCA 3OYNA 2EB7A 1NK5A 2VV5A 2N4DA 3J7AN 3AFHA 1HBMA 5E8IA 3GFYA 3FJ2A 3CO0P 4OJ3A 1HC8A 4ZLPA 4KNYA 2QVOA 2R7OA 3P5BP 3M8FA 1HWUA 1BQNA 1LVKA 3DRYA 2ZOGA 4B09A 1FNXH 2VQHA 1XX5A 1ETQA 3TW0A 3IKTA 2ZH3A 1X1AA 4DL7A 2E5NA 1YS7A 4OYZA 3OL9A 1Z9CA 1TVRB 3HD1A 4XPCA 3RQIA 1SL2A 2E7XA 1IRXA 2FD2A 2IVYA 2XDVA 2RREA 5ETMA 3ESWB 1O3RA 2NYXA 3CD6S 4HG2A 2QFJA 2W85A 3R6GB 1X0PA 2FZGB 1EX8A 3OYBA 4PGHA 1K83J 3ENVA 3QU3A 4OZ5A 2KT5A 3P6YC 2VFTA 3NEKA 3CWJA 2HAFA 4MQVA 4ECVA 1HIYA 1IBLJ 4A6EA 2HYGD 1NHKL 2FD5A 1GUUA 4WYWA 2VPYB 3NS5A 4M1KA 1K0VA 3KFWX 4O3QA 5F3TA 5M2UA 2HHUA 4KFCA 1JK9B 5FGMA 1XGOA 1TQIA 4PZJA 4KGVB 4HVZA 3TA0A 2EG1A 3Q22A 3I56S 1VTNC 4DF4A 3LF0A 5IPAA 3SFGA 4DQQA 2HQDA 3M2RB 2NPFA 5L1KA 4I7FB 5GAHJ 1BA5A 3VAMA 2C3MA 1TKTA 4PYDA 4ZPDA 5T14A 1FY7A 2AXLA 2FZCB 3QSYB 3UCUP 2LY2A 4C9DA 2JLFA 4AC0A 5D6GA 2CQBA 1FJ7A 4BEHA 1RT4A 3AA9A 3GCXP 4H54A 1H2UX 1G4DA 2ISZA 1S1WB 2QL7B 3MM6A 4UVBA 1KU9A 1TZ0A 2IHR1 2MLZA 3I32A 4OI4A 2DN0A 5LSLA 1T95A 1S0NA 2CRGA 3BJ6A 3DKWA 2WY8Q 2DCLA 1HD1A 2VQGA 2WA0A 2W00A 3BSNA 3OYHA 1HBMB 2DA4A 1QVUA 1U8BA 3HOUJ 4RU9A 4ZJLA 4RW6A 3BGFA 3HZGA 3IC1A 4FYWB 3FHZA 2EC2A 2GHPA 4DPOA 2VDIA 1BQNB 1YW9A 2JPBA 5DS7A 4ECZA 3UNYA 1KC8T 4HDGA 1IBLF 3GYXB 4CP5A 4HZFA 1GQEA 3UD5A 4WYLA 3T1YJ 3W3CA 3HXLA 1EQ0A 4P9UA 4B3TJ 4IFVB 5FD5A 4XO0A 2XF7A 2NSCA 5D5VB 3N79A 3D6FB 2QM3A 1P9YA 1MMNA 1U09A 2C2EA 2VUMJ 3PQKA 2MZQA 3BREA 2B7CB 4Y17A 2X51A 2ADCA 4QIGA 1U1RA 4QPQA 4EBDA 3KLOA 4PJ0C 3QODA 4WE1A 4ZTJA 2RQMA 3H59A 2I5UA 1EH6A 3T5KA 1OR7C 4S04A 2E19A 1YIOA 1XMAA 3P8BB 4R8UA 1KQSR 1NMEB 2FLOA 4ENJA 4LIWA 2R8GA 3W2WA 1O57A 3EYZA 3TVYA 4ZJOA 3RCOA 2BQUA 3JRFA 2OO4A 4AXIA 3HRTA 4QZVB 1ZAWA 1VQYA 5KOXA 4O0NA 1BR4A 3S8PA 1H3DA 1I1GA 2GXAA 2OLWA 3CP2A 4XK8C 4JI6J 1WHWA 2I2YA 3VAJA 3H9GA 1RHUB 1TUGB 4URGA 2OAUA 3CIMA 2VB6A 2A0FB 2OUMA 3JAMY 2VG5A 4XKWA 5BOXA 1FCAA 4XPEA 1OWXA 3AQPA 2L7MP 2CG8A 2F4FA 2MYFA 1H0MA 1Y3KA 3G86A 4B3MF 1TKTB 3J7ZT 4DQ2A 3B6BA 4NRUA 3VYUB 1U0SA 5KFNA 3TZYA 1DTTA 4JX6A 1U6GA 2VXDA 1FE0A 4KC5A 2IJLA 1UMJA 5KAKA 3MM6B 2QEXI 4FKXA 4RM2A 4B3TF 3RKXA 2RMLA 4NA1A 2BY1A 1FLIA 4E70A 4WU3A 2UUZA 2YXLA 4NQWA 5DDOC 5DUKA 5MLCV 3JTOA 2BXZA 2F9DA 1VFCA 4ZIWA 1CSJA 1M5KC 4XORA 3H0PA 3W1YC 1EZZB 2AJ2A 3TEHB 2RH3A 2XLIA 3N01A 3KX2A 2G0JA 4PSXA 4E8UA 3VYRB 1T94A 4UB8C 5LHIA 3K7AJ 2CA9A 5ICGA 4CCLA 5J47A 1G2EA 4NXNF 2D9PA 4QPXA 4ANJA 1B64A 1QVFR 3HHNB 3QT5A 1NK4A 1B8IB 1RPWA 4RAYA 3LSMA 4BDZA 1RC9A 2DQRA 3PHTA 1U3EM 2H1KA 1RADB 1RE1B 1P7IA 1S12A 5J6XA 1ZM2A 2FHJD 3C7JA 3PRBA 1IKXB 3RAQA 1S77D 1DURA 2M88A 4LF1A 2C2DA 1VQNI 3CF2A 1U49A 1SC7A 4A3BJ 2XAQA 3BZCA 4WE1B 4B9SA 3HKZN 2PLYA 4HDHA 2QE5A 1QZEA 1WJFA 4B43A 1EKSA 4DDFA 5BYSA 2RF2B 1YJWI 4I7HA 3LFKA 4R8UB 2FZKB 3W2WB 4OHVA 4KH1B 4ASNA 1HI8A 1T98A 1CLFA 2HHQA 4RGUA 3UQSA 3P5TL 3CCMS 1TNTA 4XKVA 2K5CA 2HS4A 2DPIA 3JRHA 4Y3CA 1QGPA 4XRSA 4PXEA 4RBVA 3O8GA 4ED2A 2CGPA 4LF2A 4HW0A 4A48A 1KQ9A 7FDRA 4CDIA 4I6ZA 2F63A 2K4JA 3HKZD 2YX7A 2DNNA 2X9DA 2Z2LA 5JHUA 3BTCA 4YHHJ 2IM1A 2JSPA 2VG5B 1BMQB 4R5PA 3CMQA 5DCFA 1RTZA 5DGBA 3JSBA 3HOVJ 3MCSA 2YTCA 3C8YA 3PFIA 3F0CA 4U9RA 1YJUA 3I9V2 1D0XA 3OYLA 1RWKB 2JA8J 1BHNA 2QL9B 1JUMA 1DTTB 5D0RA 4K59A 4KV8A 1FYLA 2V4RA 2BM1A 3BSAA 1H9TA 2KZZA 4ID8A 3H35A 2FQQB 3VWSA 4II2A 2W2QP 3R1HA 4XM3A 2YKAA 2QC3A 1ZLKA 1GMWA 4FZVA 1X1PA 1B7FA 4PPDA 2DT9A 3E0JB 4C0BA 3UN3A 4NQWB 1JKQC 2CSOA 4DYRA 1MMLA 2LXIA 2PEHA 1Z6TA 3RYLA 1NH8A 2XHKA 2MQPA 4N9IA 3ROUA 1UKUA 2VONA 3DOLA 2Z4PA 3LA7A 1FDDA 3QO9A 2COBA 1U5TA 2V1NA 2JC1A 3IUOA 2B5JA 2MY8A 1J0RA 1SJ1A 2QQBA 4O44A 2RE1A 1ZAXA 3EDRB 4A8SA 2NSBA 4DSEA 2VBZA 5F8LA 9ANTA 1FX4A 3NGKA 3C14A 2Y1RI 4FASD 1IC8A 5ETOA 1TL1A 3EPGA 5HLGA 5GAEU 3RB0A 1KOHA 5A0YA 1RZ4A 3CMMA 4F67A 2MG4A 2VD3A 3OL7A 4ZCIA 3IP0A 4FN5A 1FT8A 1CF7A 2YWHA 4B9MA 4DCPB 4AYBD 2XKPA 1QU3A 3GTMJ 1EB0A 3V6DA 1EH8A 1NG6A 3HUGA 3JAMK 2AU0A 3E7LA 4JI3J 1WNEA 2HEOA 1UG0A 4MH8A 4HF0A 4O3PA 1B0PA 1IXRC 2HQFA 1WZ2A 4B8XA 1UA1A 3G6EI 4JUZA 4BY1J 3W9IA 4PK4A 1N5VA 2DR7A 2N3LA 3RZDJ 4DCJB 2F6CA 3IP4B 2W2NP 2CPHA 3FXQA 3D0IE 1DY3A 4R5PB 3RTVA 1QZYA 1N33J 3SDEB 3IWLA 2PMUA 5F9LA 1JTXA 2H9ZA 1PC4A 2CFXA 1P9QC 3DLGB 5IOLA 4B3SJ 2HNYA 4FHTA 1LFPA 1QNTA 2GMHA 3MPDA 3AXKA 4P5OA 1S3JA 2ADUA 1AROP 5H1SV 2FOWA 4C3LA 3UE2A 2PEXA 2RU9A 4LF6F 5DD4A 4OJGA 4EI2A 4LR7A 3VVUA 1X3ZB 1BW5A 1SKUB 2DRDA 4NNJA 4MTEA 1BM9A 4NC8A 2OD5A 1C1CA 1BI3A 2CQDA 3QO9B 4IDKA 2M7AA 3PYEA 1U5TB 2OJED 3ZOBA 1JXVA 1RTDA 2H51B 3QIPA 3BO3A 2B5JB 2IPQX 2CPZA 4O44B 5LGNA 4N9HA 1RB0A 1UJ5A 3OYIA 4B3RJ 2IGMA 3CPWR 3QSIA 2L7ZA 3GCWP 3C14B 3M30A 3B73A 4DV0F 4RAZA 3GVAA 3GO5A 1TL1B 2XZDB 3RW6A 3DP7A 3GFXA 3FEYB 1S9FA 3WX4A 2Y48A 1VOMA 1WC3A 5KT2A 1VQOI 1T8EA 2RGVA 3LFUA 1ZA1B 1CF7B 1U2WA 2VJIA 5L39A 2MQMA 3WIUA 2HLUA 2E34A 2RS2A 1P4XA 1YX2A 3HUGB 1NJWA 2W8LA 2E5IA 3GUDA 4UUXA 4G6QA 4YY3J 3WDOA 1TTHB 2KPMA 3F72A 3ZQFA 2DO0A 1XG1A 3KKFA 1NKEA 2J76E 4HACA 4KSEB 4QLCU 2HQ5A 2UUAJ 5K8OA 1OJLA 3GIMA 4CTAA 3M7VA 5DJBA 2ZH1A 4G6DA 1MBFA 3MOZA 5F0WA 4AXJA 3SEZA 4LD5A 1YG2A 2V2QA 3TUJC 4TQSA 3S93A 3CDIA 4KICA 2DA3A 3ZQ7A 3TKYA 1SQEA 2XS2A 3G82B 4DQIA 2BHYA 4FX0A 4V19K 2MHNA 1N5QA 5HQ8A 3LAPA 3FCWA 1ZTWA 4JV0A 3A1YA 1MKMA 1Q95G 1LKXA 4FQGA 1VQPS 2HNYB 4GO7X 1L3KA 2EWHA 2NUUG 4HTJA 1U1LA 5D8KB 2A6MA 4P55A 1XNRJ 4KFBA 4DUZJ 2HVHA 4P7VA 3CUQC 4LK0F 1H38A 5LHGA 3W6VA 4B3RF 3ZTRA 1J7KA 4IH6A 4YB1P 2O9LA 3OW2R 2NYHA 1CGPA 3EUAA 1ZK8A 1Z0XA 2X1CA 1U9NA 4WTOB 2X3GA 2H48B 4F36A 3TO8A 4B08A 1F3FA 1DHMA 2E35A 2A2CA 1AB8A 1IWAA 2HFNA 3JQMA 5DGAA 5L46A 5EGOA 4IDKB 2B43A 1NCLA 1S6UA 3QIPB 2XBPA 3V4MA 2OTJI 1OPIA 1HBOB 2LC2A 3QP6A 2F3JA 4J9PA 5D5XB 1W26A 1NDCA 3KMQA 1YIJI 5GAGJ 3CMES 2X6YA 5J8CA 1H2VZ 2UUAF 1IN5A 2HBRB 5K5RA 2J0WA 3Q24A 1LQ1A 2XCPA 1FJCA 2EFPA 4OOIA 4RB3C 4DV7F 4OV1A 2DO4A 1VQ5S 4XQFA 4GKJJ 2LXFA 1T9TA 2B9EA 2OIHA 2KTQA 5L3FA 1WD6A 4X4QA 4HLBA 1AU7A 2R2RA 5B3SH 3VAGA 3KLEB 1ORKA 2HBYB 5E7OB 3HOSA 2C2ZB 3ABUA 5LJ3Y 3C2PA 2F5FA 4DUZF 1U8WA 3P4UB 4HACB 5HI7A 3M2UA 3AD7C 3KETA 4CTAB 4HT5A 4FNIA 4NX9A 4NLOA 4L9TA 4EM1A 1DTQA 1O51A 3OL3A 1RYSA 5L3DA 3VQSA 2O5RA 3E97A 2MYSA 3TOBA 3GG0A 4WXDA 2W48A 1RHQB 4EM0B 1HQEA 5AE2A 3T6BA 3DQVC 2CVEA 4CM2A 5IV4A 2HKEA 1REPC 3A12A 3OYFA 4DQRA 3TA2A 4FYYB 4BDPA 1UEKA 3C15A 2DR9A 4KFBB 2PJRA 3LQRA 2Q3PA 4FXVA 1MMSA 3IWXA 1DU6A 2GQQA 1Y56A 1BY9A 4ZVEA 4ZCLA 5FKNA 4DR6J 1P8GA 1KVKA 4UV9A 4PUSA 2Y69H 2ID3A 3B4MA 4PCQA 3I4HX 5EGOB 1F2HA 4GKJF 3H7HB 3R4KA 4JI8F 2AO9A 2BW3A 1E0EA 2J7KA 1YI2I 3UDEA 3GTJJ 2Y8WA 1BUXA 1FWLA 4DSLA 2CWEA 4I6WA 4NI2A 2JWTA 5K5OA 1K9MT 2AWZA 5BYQA 2XV4S 1S6LA 3AHPA 2BHZA 2NNYA 4W90B 3SFUA 3DDNA 3BR2A 3MZHA 4BL0B 5M2RA 4U0WA 4L74A 4NCGB 4K0KF 4ED4A 3CJSA 5FROA 3O8HA 3OOUA 1ZLJA 2VPLA 5B1AH 1ZG3A 2L4AA 2CG4A 2POKA 4IEJA 2A10A 2JPCA 4PJLA 3QU6A 1QAJA 5A8KA 4F02A 2QQ8A 3S3NA 1HHQA 2AYMA 5G4DA 2QSFA 3HSFA 4MFBA 2OU2A 5GADI 2ADBA 1RXOB 1HA8A 4J9KA 3ISND 3ET6A 4UUTA 1S0MA 2KL8A 3Q86A 8RUCA 4QOTA 2R3VA 5ILUA 1ACIA 3N6LA 1U0JA 4JOUA 3VODA 4KT5C 2WONA 2PG4A 4AVZA 2FGOA 2VG6A 4E7LA 2CQPA 4YRVA 1TWGJ 4X4PA 1O7FA 1O3QA 3S1QJ 3TO9A 1UZHA 3S8SA 2KRRA 2GVZA 5J1RA 1SCJB 4LSNB 3BOQA 4IUFA 3SFZA 5F0FA 3GWZA 2WAFA 4EFAC 1SL1A 5KFVA 3A02A 4B17A 2UUBF 3HHKA 5IWAJ 4DOZA 3AODA 3SHFA 1JJ4A 1HQEB 2A6EF 4G7OF 3ZTPA 5KG6A 3EUHA 1UFWA 1VJQA 2FJWA 1XWLA 2HEKA 2EPFA 1WH5A 3C15B 3A8JA 3BZ6A 3WTVC 2R92J 4PFPA 4OYMA 5F1RA 4NLQA 2PJRB 1ZZNA 5F8JA 3DEUA 1URNA 1DU0A 2C2KB 4Q45A 2C3UA 4F04B 1LDKB 2BR0A 5JVTA 2CQ0A 4NOHA 4HR2A 4PJNA 1MNDA 1LV5A 5HMZA 1TAQA 3US5A 4FE4A 1IVZA 2R2UA 4JI7J 4QW9A 2CQKA 3NWGA 2F9JA 1WOOA 1YJ9I 1ZYRF 1JXSA 1LKZA 2CJBA 1MU2A 2I9SA 3QWLA 1RCOB 2G4BA 2MD0A 4J9VA 2BW3B 3RUBL 3RRHA 3HHLA 3FIWA 4GCVA 4KITB 2L9DA 1D8YA 3N97A 2OTLS 1JLBA 3C1DA 2DNGA 3L7UA 5KFLA 3ISNC 3O6QA 5C25B 2RQKA 4BYYA 2KXHA 3CJ5A 1P4AA 1UZDA 2ZWOA 3THTA 1VQ6S 3I4PA 5IFMA 1G3SA 1T33A 1YS6A 1RTIA 4ALZA 1RWPB 5F9NA 5HSPA 1H6KX 3JREA 1SVLA 1RAEB 1LK5A 2ZNYA 2PQ8A 4WCEQ 3CZ6A 5F0HA 2G9OA 4JV5J 1P2FA 3IHUA 2HZDA 5GAHI 4ZS6A 3W6KB 2EFNA 3VYTB 4IYQA 4JI1F 2H5JB 3BBBA 5A8KB 2K9SA 3G8TA 3I4MJ 1WEYA 4OYOA 2CW8A 5LRRA 3Q8YA 1N5YA 4ZJZA 2ZH7A 2RQ4A 1GXTA 3TJAA 3R1LA 2LRDA 3FDYA 4P72A 5E41A 4JYAJ 3HOZJ 3DLLF 5J2PA 4FVCA 4UQGA 1C0UA 3IH2A 1X9MA 5FKLA 2WONB 2VG6B 3GYHX 2QGUA 1UWAA 1BI2A 4NB5A 2G1HA 3BR6A 4Z37A 3CCUS 1WJCA 4A8MP 1OQ3A 1RR8C 2GVZB 4JI7F 3DNCA 4B9LA 3ML6A 4ECQA 1V5GA 2R7XA 3SYZA 4DV6F 2Y9ZA 1I27A 3PFYA 3BTIA 5FFXA 4A8OA 3MAAA 3LSJA 3HFKA 2QT7A 4ATNA 3CCVI 1FKOA 2E44A 4Q47A 1FOWA 2V4JA 3M8EA 2ZJPQ 2OPQA 3VEPA 3DKYA 3BZKA 1B3TA 5HP1A 2QYCA 1D9FA 3THPA 1NZAA 1MN7A 3JAMZ 3L2WA 2DITA 3G71I 2R7ZJ 1NHUA 3V6HA 2OA4A 1MROA 4U7UK 4J9SA 4K50A 4LLGF 2PN6A 1W7PA 1N0UA 1YBUA 2DNKA 2QLJB 3RKWA 1AOYA 2V9KA 1MU2B 3E01A 2G2OA 3HHLB 3ASOH 3I6PA 2RC4A 1V54H 2LQJA 2EJRA 5HS8A 3LA0A 5LOQA 1DQUA 1JLBB 4HTIA 4HEA9 1HLVA 3HLUA 3THVA 4KPYA 1R6RA 2STTA 2GLOA 2JEIA 1IM6A 1X4HA 4NHJA 1HNIB 4BACA 4JYAF 3SZPA 3EXYA 1RTIB 2AD9A 2BXYA 3PJRA 2LKSA 3BJOA 3LMMA 3BWGA 2C2MB 1YJRA 1ULYA 5K9FA 2QLZA 4CIOA 2XPVA 1XNQJ 1N78A 2HGCA 2DFFA 2EZHA 4F92B 3DGPA 3N28A 2WB1A 3GIIA 3FVYA 4QPOA 2RDPA 2ASJA 3V5RA 4EJOA 3QPSA 2MJUA 3TP2A 1OYYA 3OYGA 3J7AY 4FXWA 3B82A 2ZBCA 3ZQLA 3N5BA 3CC2S 5J2PB 1SD7A 1TUVA 4NLSA 3GSDA 4OIRF 2A68F 1B6AA 5J1UA 1XTZA 1NK7A 3V8LA 3JAMU 4LFCF 2GIVA 2RV8A 1RT2A 4I02A 1LWCA 3Q8PB 1QRYA 2NVUB 2M3AA 2IMOA 4AIDA 1NDLA 4FDFA 3SJMA 2JVHA 4PG4A 2E7VA 1NK3P 1YW8A 4K2EA 2EV0A 3LSHA 2Y3YA 1BOBA 3MAAB 4F7ZA 1CPZA 1UVNA 1NU4A 2Z33A 3H5RA 1T05A 1FKOB 2WC2A 1SC3B 2Y0SN 2G7HA 2R2SA 3PO3J 1NJYA 1IV6A 1A0OB 2IBDA 3DCAA 2V4JB 1YFHA 3FFIA 2OPQB 2HURA 1TUWA 1XK8A 3PO2J 3OTCA 3RB3A 1B72A 5HP1B 3TQNA 3MKZA 3KTQA 3HZEA 3LWMA 5FD6A 3VFZA 3NKYA 4DQSA 2OQRA 1GXUA 3OL8A 3ISZA 4Y2KA 4HHJA 3JRGA 1IKVA 4AIHA 2LQ5A 1YTYA 2YSRA 1HDPA 4IOBA 3PIPF 5ICEA 1W7PB 4BQNA 3I82A 1W4MA 1HNXF 2Y0SD 3E01B 2M45A 2H4WB 5J8FA 1IQTA 1XR5A 5K5QA 2Q43A 3MGJA 3R5AA 1R5ID 5JUMA 1U48A 3PW2A 4JI5F 5HVHA 1R27B 3IRWP 5E3CA 3R61A 1ZN2A 3PW7A 3ZMTA 3D5MA 2Q79A 3G4SS 5IYBJ 2KJCA 2CJ9A 1RKWA 4K5RA 1HYSA 4ZPAA 4NEZA 1C4AA 3KP7A 1RWOB 3T41A 2TRTA 2J9DA 2C6YA 1L5UA 3MD3A 5KFTA 1CQNA 4MQ9F 3L7WA 4EJWA 4V19X 3IS9A 4USTA 4DSKA 3PIPQ 3NGSA 1JKOC 4JP8A 3BJYA 3BDDA 1HNVA 5ETNA 1GH8A 5B0AA 4YR3A 3DGPB 3UR3C 2HPUA 3IWNC 2HFSA 3EGNA 1IKYA 2ECBA 1K6OA 1VRQC 4PQAA 2NAZA 4C2UA 1RUSA 3TQEA 1F6TA 2QMXA 2JVGA 4BWMA 3L00A 1HKQA 2XS7A 1P1LA 3TW6A 1U1PA 2CV0A 4I01A 2VBWA 2ZNZA 3K1PA 1D8ZA 2WVEA 4YMEA 4ED5A 3LGMA 1JI8A 2F5DA 1FD2A 5KT4A 1FO1A 4RUBA 2RRBA 5KK1A 2VN2A 1RT2B 1LWCB 3K4MA 1LEOA 3MM7A 1PBAA 4YDDB 2QUFA 4K4ZA 1X4CA 2G1DA 3DI6B 4EYIB 2JJ4D 4RAGA 4NLTA 3RG6A 4C8YA 1WUUA 1WWHA 4OI3A 4UY8I 3HT0A 4GMKA 2WW4A 4CCNA 2FIUA 4DR1J 1T05B 2XAUA 1Z91A 4Z2XA 1I3AA 1JKHB 1F36A 3V6JA 2ME0A 5LM7E 4OI2A 3FFIB 1LPQA 1ERDA 4ZYEA 2DHXA 2LVSA 1OYWA 2XKOA 4OMFG 2QCOA 1YKWA 4YG2F 1WI9A 3AG1H 2NXNA 3EE3A 1PP8F 1J2VA 2GXGA 1BR1A 4EO8A 2IGNA 3H8YA 2J5AA 1TAUA 2B0GA 1S9HA 4NLXA 1HR0F 1I6HJ 1QJHA 4ZPTR 3CC4I 1ICEB 3TRGA 1HKAA 3Q9SA 1MH4A 2QA4G 5CZXA 4IR1A 3CUOA 3DKDA 3IFEA 2K4BA 4PJJA 2I5JA 3C18A 2LDYA 2ZJRF 2IS2A 2GS8A 2H54B 4IOCQ 2CIMA 4P6QA 1XSXA 1TMMA 4LF8J 4ZPWR 2FBKA 1FMVA 4RX6A 2CQQA 3OLAA 1FDNA 3K70D 4ZVUB 4N56A 1FERA 1HYSB 3O3KA 1YRXA 3WTWC 3I96A 2GIZA 5ETKA 4C0OC 4K2XA 2TDXA 5CVIA 3HJVA 3GFMA 2DBBA 2DW4A 4MHGA 1WRJA 1N5TA 5LXYA 3DHXA 1Z2ZA 2V1UA 3WIVA 2PI0A 2XGQA 1S4EA 4M94A 3FBNB 2FEZA 3OBIA 1FFWB 2BKNA 3G96A 3CCSS 3EGWB 2ZJRQ 2KI2A 1D3YA 5DDGA 4NDLA 4X62J 5D77A 4EEYA 1IKYB 2M2EA 2BJ1A 5BMZA 5HATA 3TAPA 1BIAA 1F9FA 2ZBRA 4A8QA 4M5MA 2UVRA 3L7OA 2LR8A 3NCRA 2DGXA 1VISA 2DH7A 1HBNA 1FDAA 1ZETA 1XBWA 1BN5A 4OINF 3R8YA 4LREA 1QHHD 4CO8A 4UUVA 3CCEI 5C4JJ 5DUIA 2O3FA 3NRBA 1B9NA 5F27A 3S3OA 1FWZA 4PYAA 1GAOA 2LH9A 2ZFUA 3MM7B 1YQAA 4RWXA 4R25A 1QA6A 3IN5A 2PI4A 2WAQA 3TO7A 2L08A 3OTOJ 3KNAA 2FVCA 4WP8A 5DTDA 3ENAA 1OCZH 3MWMA 3UCGA 2O1PA 3KP5A 1XDUA 1UWBA 4M5NA 2XNRA 5K7HA 3K70C 1R49A 5DLGA 4D3GA 4II3A 2B9WA 1Q16B 3T5JA 3DHWC 2MLXA 3IGVA 3KJNB 1R31A 2E66A 1IWGA 4ZCMA 3OUYA 1MJAA 5IT0A 1G4CA 2NXNB 3REOA 4J7CA 2J6UA 1O8BA 4B02A 1NPKA 3T8TA 1R43A 1MDMA 4FS1A 3J7Z5 2BACA 1X8DA 4YFKF 3CTAA 4Q48A 4H4KA 2AW0A 1TWCJ 4ZCKA 3IAM2 2E2HJ 3OVAA 1W5TA 3FRYA 5ETLA 1RI7A 5G0RB 3BG7A 3HHLD 3TJ8A 4GVBA 3NBPA 2YPYA 4A69C 2DPUA 1ETVA 4RGRA 4IHVA 3DOMB 4NLDA 2KHCA 4DIQA 3V2UC 2ZBQA 3DRSB 3IWFA 2G2ZA 4XDDA 4M95A 4A93J 3RSNA 5CVRA 3T1AA 3CCWA 2HIQA 5T7LA 5D0EA 2VE8A 5H2FC 1NB2A 3MR3A 2ZBPA 3FSXA 5HS7A 3MPYA 2J9DE 4TU7A 2W9AA 1RT3B 5BPIA 1NNDA 1UEVA 4ZVGA 2QYGA 1ITPA 4L5EA 1SFEA 2M87A 4AT1B 5HBMA 2R2TA 3CD5A 1QPIA 1T9WA 1NTCA 3V7SA 3L7PA 5LT5A 4RM3A 1MWZA 4LRBA 4DU7A 3R7BB 4QU6A 1MBEA 2W24A 4KA4A 1ZS6A 1VCTA 4LBHA 3L9FA 1ZGWA 3EYIA 3L2UA 1FE4A 1N0VC 3LW5C 3I59B 1HBNB 1FJGF 1WQ2A 4WU2A 4ES1A 4KIAA 3KHHA 4JI2J 3TNVA 4MIWA 4F2SA 4NLVA 1KFDA 4ZN3A 2HVIA 4USMA 3G6ES 4XIUA 1FVQA 1QDUB 4KPCA 4RKUC 2VKZG 5KG7A 2HNZA 1D1CA 3EETA 3N05A 2W01A 1TNSA 3G6YA 5DM6F 3I87A 4ZC3A 1Y0HA 3HHLC 3WTTC 1WH7A 1OJ4A 3NQOA 1DPUA 3KLGA 3GLXA 1R00A 3ZMUA 3IG1A 4R0EA 5M3MJ 1Y8QB 1HFEL 5L3GA 4N0BA 4CZCA 1A31A 1DPRA 1C1BA 3I5UA 4BJ6C 3FBEA 3HPGA 5E79C 4ZK7M 4MT1A 4AIJA 1NJXA 4S0MA 4IH7A 3KLFB 1E17A 5DM6Q 2IC3B 2XQCA 4XLPF 2XIGA 3VSLA 3PFEA 1R8HA 2EKNA 2DMNA 1SL0A 4GVBB 4O5VA 3OR1B 3NBPB 2CFOA 4ZLLA 3PR5B 3SZ2A 1VQ4I 4EQQA 3F8NA 1X9WA 2GA2A 3QYYA 5HLTA 1S7AA 2R8HA 1OQ6A 2C2RA 2VL8A 4EJTA 3WBZA 4C4WA 4OFZA 2GHVC 1AW0A 2CPDA 3TAMA 5D3GB 2A6HF 2NXUA 5BJRA 1K7AA 1WSRA 4G6TB 2Y1LB 3K17A 4YFNF 5T7LB 1GK8A 3IRQA 2GMLA 1WSVA 4JI2F 4V19J 4ZVQB 4RW7A 4MFDA 2QA1A 3L3CA 3HTUA 3TANA 1PP7U 4M9SA 2XPUA 3GIJA 2ZM6J 5T41A 3CULA 5F1JA 5HBMB 4RJVA 4N76A 2VQEJ 1RT1A 1I3QJ 2UVVA 3VR1A 3M8JA 1NHVA 2WB1D 2X1AA 1PYSB 2CQGA 5LXRA 4IQXA 3MM8B 2HWVA 1R8PA 2LF7A 1FX2A 2MQNA 4P2MA 4E6KG 2GXBA 4PDKA 1FRXA 4RS8A 2LBFB 4YB6A 4L0ZB 1IO2A 2CPFA 1H2TZ 3GZ7A 2BE5F 4A8XA 3VVTA 3B6CA 4UUWA 2Y0MA 4F93B 5D6FA 5CYMB 4GKKF 1AFJA 2ZH6A 2XROA 1P27B 4LF9J 2CZVC 4P10A 3MEKA 4C6AA 2DCEA 2QF7A 3UN2A 1X4GA 4CM0A 3OHAA 4U8VA 2HNZB 2HQ3A 3ETOA 4U0VA 2DH8A 4LVOP 4HNUA 3CP8A 1HBUA 2JC0A 3M1VA 5I3QA 3QNWB 1TL3A 1OYEA 3R60A 3N9UC 1WC6A 3LAKA 2B9SA 2QIFA 1T3NA 5K8PA 3WU0A 1HWJA 3KLGB 3IG1B 1WEZA 2ZO4A 3RJMB 4AD6A 5H20A 2XGPA 3K59A 2UP1A 2KT0A 5IXUA 1UZCA 5BR8F 4M3BA 1U1KA 2EV6A 2FJAB 1C1BB 2E7WA 4FXDA 2F48A 4A12A 1LJ9A 3K5OA 2F4OB 3U7JA 3QOPA 1RJJA 2XO6A 2VBXA 3Q0WA 2JZYA 4IRGA 1U9OA 3AD9C 2BV3A 2M3DA 2KYZA 2KRFA 3D9BA 3TP3A 3D5SC 4KN7X 2Z16A 2DNMA 2E1MB 2VQEF 2LREA 1KLNA 1ETKA 1PILA 1SI9A 2G0CA 4HH0A 3PNYA 2HNDA 3TAMB 2VF3A 2ME6A 3OWTA 1Z21A 3CCQI 2OD6A 2V8HA 3NWTA 4AM3A 1S6PA 3GV7B 4BBRJ 1Y8RB 3F8BA 4HI2A 4WFZA 2VFVA 3SMZA 3BLYA 1N25A 2L9RA 3KG1A 4BWJA 3FSIA 3PVXA 1VFJA 4OX6A 1KVIA 4TYBA 2FVSA 1VZ0A 4K4SA 5C7PA 1QLNA 1UW9A 1Q82T 1B1BA 3GIKA 3UDVA 2LQBA 2BE2A 1RT1B 2DDBA 2BJDA 2QA4S 3ZQGA 4KJZA 3BG3A 3QT7A 2OP5A 1VIXA 3MPVA 2V7FA 3HSDA 2D41A 4YEAA 3TDUC 2JT1A 2P81A 2PO4A 9RUBA 3UVJB 3PJ9A 3TX8A 4BHBA 2ZSHB 1WEXA 3C16A 4CYCA 2XAFA 1QSLA 1S4FA 3Q23A 5DDQC 2F8EX 3IBFB 3A01B 2NS1B 2D1HA 3CCJI 4XSXF 3SBMA 1LW0A 4BQAA 1OY8A 4YR2A 3CCLI 1RWUA 3X3UA 3LSKA 3TVKA 4EJVA 2HOSA 1HBUB 3M1VB 2HSEB 1TL3B 1IF1A 3B6AA 5F8IA 3LSRA 4OLOA 4USIA 3AL0B 1JKRC 5KFUA 4RUCA 4M72A 3CJRA 3HRMA 1S79A 1R9TJ 5KNLA 1YBTA 3GFHA 1MJBA 2ZSIB 1NK9A 2DJIA 1T0FA 1TBXA 3MURP 1PVEA 3BKTA 4UB6C 3VAIA 4C97A 2IRYA 2JLGA 5LSRA 3GX4X 1X4FA 2ZC2A 1WJAA 4RW8A 4DI6A 5CYQA 1YW7A 1F3VA 1SFOJ 3T5LA 4O3SA 3ADAC 2DAOA 3PEHA 1QSSA 5TISC 3FZVA 4DR3F 1RNLA 3VALA 2ZEJA 3RYPA 2HLTA 1G1XA 2IEKA 2KJVA 2BV6A 3CCRI 4Y52J 1Y9OA 2E1CA 2HNDB 1Q5YA 1JJ6C 1M1HA 1AA1B 3M6XA 3BDPA 1WG1A 3BQ2A 1TL7B 1U1MA 1D1UA 4QIEA 1S6PB 4LB6B 1NHAA 2B6AA 1IN7A 4TXSA 2MPUA 3SCJE 1AKHA 2DT5A 3RB6A 2MTLA 3KUHA 3WGGA 2UUWA 3K2YA 4WX9A 4WXCA 2GOXB 4V2FA 4PJMA 2XI3A 2BYCA 4ZVTB 2HFOA 2PA3A 4X2BA 2UXBJ 4XOPA 1DGWY 2HMIB 1BJAA 2AJQA 4XN0A 2WSFC 4LIUA 2QENA 3D0SA 3GFIA 1LW2A 3OXFA 1IUJA 4WPAA 2GGPA 1NBEB 5E2QA 2W4SA 4WP3A 2XGEA 3LWLA 1DZ5A 1APSA 1SJRA 4BU2A 1WVRA 1SH0A 1JGGA 1Z6RA 4LF4J 4WFAQ 2M8EA 3DLJA 4FT8A 4Y6IA 1UEUA 2QQ9A 1WC4A 4M8LA 2FUG9 1GDTA 5HMYA 3OYJA 1Y39A 3QPTA 4TU8A 2FLPA 3SIPB 4XICA 2ZDPA 4DX8H 3Q8UA 1LW0B 3T8RA 5KG0A 4FF1A 5H9EK 3FX3A 2HDCA 3H36A 3KJQB 2BZTA 1R4MB 2YNFA 2R8JA 2J7WA 3P9IA 1DAXA 1F0XA 5E3MA 5FD1A 1IBKF 4D5CA 3TUPA 4HF1A 3CJRB 1BQXA 3A8KA 2MKHA 2ZZMA 1G3TA 2KRBA 5F8MA 1R0BG 1XIQA 2IPOB 3KLNA 1ZR4A 4ITSA 1KD1T 2FC8A 2I38A 3HULA 3EWGA 2DNZA 1IN6A 3BG9A 2DA6A 2LK2A 5L1LA 2E5GA 3FCHA 1FVSA 2PMZA 3WTZA 5JJBA 2VL1A 2YKNA 5A2QY 3CD0A 1I39A 5CCMA 4WF2A 1IN4A 1HMVA 1XCBA 5FKOA 2HNHA 3GV8B 2VLAA 4NCBA 4IHTA 2PFDA 4RMNA 1RWMB 5EF6A 4DYQA 1GFWB 2BQRA 3BO2A 4QIVA 4KUMA 4N5SA 4LF4F 4E0DA 4GFBA 1H72C 3CDLA 2VU5A 4WJBA 2B6AB 3VB2A 3ERED 3A03A 1AKHB 2KM8B 3DLEA 4EJUA 4ES2A 2MBFA 5EHHA 3RW7A 1SAXA 2FXAA 3D4JA 1RWXB 4NMXA 2RVJA 5IS2A 2V9PA 3CO7C 1YYVA 1GV2A 4ZVRB 3T1HJ 3A13A 2A3SA 2CWXA 4WZQA 3FEXB 2GGPB 3E6CC 2EQRA 3CO9A 4NRTA 3QGIA 4Q44A 3SXYA 2CZ4A 1DLOA 1TWAJ 3UDCA 1UJ8A 2M30A 1G3OA 1SD6A 2DXEA 3DGVA 4I64A 5BYRA 2L2OA 2DB1A 1XC9A 1DARA 4IOAF 2MKJA 2RJZA 4IG3A 2DVIA 2LYVA 4DPTA 4CDGA 2ELHA 3FXJA 2ZBKA 2KIMA 4H4KC 3HHHA 2W9CA 2P0WA 4FBTA 2P9GA 5DS9A 4HLYA 3LL7A 2V63A 4ON0A 3DBLB 1R22A 1WJDA 2UXDF 1Y0UA 2YNFB 4OU0A 3M1CA 1R0AB 4U87A 2XMMA 4QR1A 2ZH4A 2AX0A 3MUTP 3I9ZA 3QPHA 1F9EB 5KAIC 4OZ3A 2B4VA 2XMAA 3IBCB 2FY1A 2AQFA 3W63A 4IOAQ 4DV2J 3V8JA 2CAJA 2DKOB 1WTBA 2E9ZA 4ZYHA 3M9NB 3ELKA 4UZCA 3BG6A 1UCNA 4IL6C 2B9YA 4RB1A 2R5ZA 2XLKA 4ICLA 3QGGA 4BJ5C 3G71S 2P7CB 2YKNB 5F8NA 4KRWA 1KGSA 4P96A 3H2UB 3BQZA 3FDSA 1VQ8S 4ZPVR 1Y5LB 3CJ8A 1HMVB 2EFGA 2HOEA 1CEZA 1QM9A 4LFBJ 4TLRA 1MNMC 2XC7A 2FPHX 4BHQA 1VR6A 1YHQS 2F8HA 4FBUA 3W2VA 1HPZA 4WIIA 3OMYA 4ELTA 4LLLA 1MN9A 4AD9A 3GU0A 2BRLA 4K4UA 1IUYA 4MAKA 1JLFA 3BH6B 2V26A 3GJTB 3Q2TC 4D3HA 4UOGA 4AL5A 2Y1IA 4C8KA 5FFZA 4XKBA 2F65A 4LR8A 5JLXA 1NM2A 1H0HB 1R8AA 2R7RA 1UFMA 3DLEB 3R2CJ 3GV5B 2GM4A 4ENOA 1IXSB 5AE3A 1BJZA 3H5YA 4X4RA 3OJSA 5RUBA 3EMTA 2FTRA 2HFHA 2IS1A 2EZIA 4NLRA 2D9OA 4KHPJ 2BBYA 5IP7J 4XNFA 1OY6A 2IMWP 2CQXA 1X2MA 3I55S 3RBEA 4UXNA 4D0PA 4Q43A 4X4VA 5J2MA 3VAHA 1XMQJ 3K5NA 3K10A 4KB7A 3PSIA 1DLOB 1W5SA 2BJ3A 2FF4A 1AZSA 3NNCA 3GWCA 4EBEA 1WJ5A 1JNZB 3LSTA 1PKUA 3HEFA 1FMWA 3UNGC 4EK2A 5DQGA 4NYPA 1V3SA 3LP0A 4IG3B 1F4KA 4ZZDA 1UHWA 2L02A 3E6BA 4TY8A 3LSGA 1AUSL 3LTOA 1PCAA 2B4PA 2CJKA 2F5VA 1IW7F 4UOHA 2W9CB 5F0CA 4IPAA 1UB9A 2E1MC 3M8QA 3ONQA 3K0JA 5A2QK 1HW2A 1RT5B 5E18F 3I5AA 4WIQA 3WHIA 4Q5SF 2O5DA 2BRKA 1M5VC 1PSDA 2R7SA 3AH6A 1GXLA 2MC3A 4E7JA 5J2QB 3OYEA 5JVGF 3RGIA 1U1QA 4M5JA 2GIQA 2AXTC 1NXIA 5B0CA 5I42A 1LDDA 2R5ZB 4ICLB 1JMTA 2J5PA 2F8MA 7AT1B 2H6CA 1OYDA 1AA7A 4YQWA 1R6VA 3R5DA 5GVQA 1PUEE 2IDEA 3IR5B 1MGTA 1HDDC 2DMUA 1H98A 3Q2SC 1TV6A 2P4WA 2ZCWA 3NCQA 3NMAA 5J3LA 4KHPF 2JEJA 1SJQA 4FF2A 5AT1B 1H7XA 3E8OA 3W2VB 4LSZB 1ON2A 2PEBA 4QIWD 4ED8A 1KQGB 1JLFB 4XLEA 1XMQF 2VQLA 3MD2A 1GTEA 1EKRA 4FTHA 4ELUA 6AT1B 3BQYA 3GCMA 5E3RA 2YNGB 3MEDA 2XCAA 1VC0A 3E1SA 2VQFJ 2PMWA 1YRTA 2VICA 1SFUA 5FB2A 4ZH4F 3CJ0A 2IA2A 4C30A 1N77A 2DIUA 2MZJA 3HKWA 3IV5A 5AIQA 2R3SA 1HLWA 5L9NA 1Q4RA 2IM0A 4C8NA 4LIVA 4HRIA 2YKMA 5JLWA 4KIBA 2DD8S 1Q1KA 3SDGA 5J2MB 3EJMA 1DQ9A 2FQ3A 3QZ7A 1AZSB 4EMDA 2Y8YA 1JLCA 2NPIA 3ZTSA 5J2NA 2V8DA 3BT9A 2YX1A 4GRSA 3GR0A 3LP0B 3OV7A 2IS6A 4ERDA 2AGOA 2XS5A 3HP6A 4XLHA 4TY8B 4Y28C 5ETVA 1I94F 3W66A 3KK3A 5KG3A 3VZHA 5KFMA 4CYUA 2ROPA 1ZG5A 3HVTA 3HOWJ 3A4TA 4CT8A 4DN0A 2EIKH 1UPPA 5D8HB 2HVZA 2F4IA 1J5EF 3NEUA 1VLYA 4ENMA 3E5UA 3S2WA 2CDQA 3OR2A 4L75A 2DOAA 2K2PA 2WHOA 1X31C 1HQ2A 5B08A 4ED0A 2H6BA 4BJTA 1OO0B 5KFAA 1SJFA 1S5LC 3BKUA 1Y11A 2OSQA 3NS6A 2QRRA 2HAIA 4FF4A 4WF9Q 1O3SA 2XO7A 2DNRA 4ZLNA 2WVFA 2KG1A 5I42B 3IAS2 2EEYA 1X19A 5HLHA 3D6TB 4NLPA 2NS0A 5KFFA 1K47A 4TV7A 1IN0A 2ZUGA 4M9ZA 2E5LF 4LF5J 2G7UA 1T9VA 4IF4A 3MEEB 3CCYA 1RAOA 1BW6A 1TV6B 3H2VE 1TQMA 2CV2A 3BR3A 3CCZA 3UD3P 2EIJH 4ZA1A 4DW6A 5JR3A 4HKQA 1ZKGA 3ZMVA 2DHAA 3WE3A 4ZMMA 1TL4A 3KEOA 4YEJA 3OOPA 3M8SA 2EWNA 4ESJA 4NUBA 2RU3A 3OJUA 4G7HF 4ZOSA 1VI7A 1QTMA 2VASA 1Q8IA 2XULA 3GB0A 4X4TA 3MEDB 4Q5VA 1KNZA 3NWSA 1LFBA 2IJNA 2MZRA 4U8YA 5SZTA 4JI0J 3HGYA 4EU0A 3CD6I 4J37A 2JL9A 1YITS 1R6YA 1TKZA 3I0SA 3R0AA 5L3BA 4L72B 1WF0A 2DK5A 1YE9A 4FISA 1FPQA 2KIQA 3PL8A 4OX9F 4USJC 5AXMA 3CIZA 2PGCA 2XGDA 4NMLA 1VBZA 2YKMB 3OIQA 3IH4A 2P2CB 2CW7A 1HA1A 1XMKA 2FJXA 5LGTA 4TQRA 1Q79A 2D1CA 4HX4A 3QWPA 1EHWA 2AEFA 2BZ2A 3EZOA 3JS9A 4CXFA 3LAJA 5HK4A 4F7VA 4PG8A 1X7VA 5J2NB 5TJJA 4WXHA 2P6TA 5HDNA 3IMQJ 5KG5A 4OMZA 5KFPA 2LLKA 2V2ZA 1PYOB 4ENNA 4KMUX 3I56I 1SD5A 3SV3A 3MKWB 3FCVA 2QMWA 3IGNA 4N77A 3KK3B 1T0TV 3BH7B 5IQ6A 4CYUB 4DN9A 3HVTB 4LF5F 4LR9A 3M7GA 5IYCJ 3I5BA 4P52A 2DMTA 3PRVA 2E36A 4LJMA 3PKYA 4LBIA 2FVPA 2XLJA 5EWEA 2QG9B 4KT0C 3OR2B 2JLEA 1T7PA 1GVJA 4YIRX 3WE2A 4OZ0A 2PT0A 3BGOP 3D1QA 4A4JA 1HF0A 4ZP8A 1M1GA 5HLFA 4HH1A 2GAGC 2FBHA 1QBJA 1D3WA 3R7SB 5JI6A 4IFVA 2LNBA 3G8QA 1FBQA 4OIQF 2X85A 1TR0A 4JI0F 4ZJQA 3ZMDA 4NLWA 4M3EA 4M5DB 1DP7P 1S1UA 4X66F 3FXMA 2X7IA 4ILRA 3QMQA 3H5UA 4Z7CA 3F9KA 3Q0UA 5E33A 2N82B 3BYRA 2FJDB 3BGRA 2VKVA 2B51A 1FKAF 1XMXA 2DRAA 2HS5A 2LMDA 1H88C 3OFHA 2RT3A 3M8WA 3K1MA 2HYJA 2JNJA 4ZVOB 4LLNA 3BB5A 4IHXA 1C0TA 3FK4A 4HSTA 4NASA 2KFDA 3V42A 4BQOA 4AQYJ 3F6VA 3CNQP 4F4AA 3L9ZA 1E2XA 2GIRA 3I0SB 1TKZB 3HVWA 3R7NB 3Q8VA 1FX7A 4MYTA 3J81j 2KFYA 4PWDB 2DFEA 4QQBA 5E1XA 4CLYA 4J9MA 4PR6A 3CCTA 2JN6A 4DPWA 3DV8A 4GYIA 1Q7LB 1DP3A 2V8GA 4HV6A 3FUYA 5KG2A 3SSQA 4A3EJ 2UXXA 4DPXA 4CI0B 4I6YA 4X65F 2YUSA 2COMA 3I71A 3SZTA 4GRIA 1U4BA 1VRUA 2YWEA 1K73T 4I4BA 3ABKH 1N8RT 1UVJA 3ZP5A 5IT9U 4EZ9A 2DIVA 2EFVA 3NLCA 1ZZFA 5L38A 2IXSA 4CQ1A 2K27A 1LWFA 4NPOA 1M1KT 3H0GJ 3G8SA 2GAUA 4B3MJ 1YRNA 3BN4A 1FP1D 3VPRA 4GC6A 3E5QA 4Q2MA 1FEEA 2DEIA 5IP9J 1TW3A 3A4CA 1SV5A 3TVZA 1HKSA 2M4MA 2XMTA 1FD8A 3EPZA 3MXHP 3DXBA 3HPHA 2I8DA 1Z7LA 3U1KA 1B8IA 3BG5A 5HLFB 3QPIA 2F40A 2DFIA 3IR7B 4JV2A 3WQPA 1O3TA 2WOMA 1ZPVA 1IKXA 1IN8A 4A2UA 1XDSA 4AQYF 4K4VA 1FOYA 3ZC4A 2TCTA 4A46A 4P9FA 1UP1A 1IJEB 2GJFA 3L2QA 1S1UB 3WZ0A 3MPWA 3GYGA 1ZRDA 1SKRA 3AJ1A 4DR2F 2XAHA 5IZHA 5F04A 4OMYA 4FPIA 2M0MA 2RF2A 1FEXA 1HSTA 2GMJA 3BGRB 1P4WA 4EBCA 2XEXA 3HMJG 4NXNJ 2Z5UA 2Z2SB 4FYXB 2HOAA 2W7PA 3IRRA 4ZP9A 3AT1B 1WHYA 1SH3A 3PX0A 1C0TB 2N4CA 3D6MB 1EARA 4A0ZA 1PJ6A 3RR7A 2VA2A 3MMYB 4PPZA 1UETA 4DQPA 2DOEA 1Q53A 2F4VF 2K9NA 1KOOA 2WADA 1P6RA 1BQMB 4LT6A 1AUDA 4DXLA 1JLAA 4C8LA 4DBRA 4BY7J 2WB4A 4DSFA 1T02A 2G13A 3S2DJ 4FE7A 4LOCA 1KTVA 2X1EA 1Y5IB 3CCMI 2ACYA 3ZZZA 3HRSA 2P5VA 3AJDA 5EN1A 3QT8A 4WFBQ 2JRTA 1O6XA 2K40A 1LWEA 4BE2A 2A3JA 2XGCA 3L1PA 5A6PA 4QWEA 1XERA 1TP4A 3PYDA 3PNTA 3PM9A 1YGYA 2EH3A 4O3NA 1VRUB 3G6VA 1JGSA 1HNZF 1Z4UA 2DOFA 4ZHRA 1QAXA 2CUEA 2FQ4A 2VFSA 2KU7A 4EGZA 1K78B 1TK8A 1EP4B 5ETRA 2W4PA 4MK9A 1LWFB 1X3UA 2X4HA 5KFWA 1VHFA 4PG6A 5HO4A 1J27A 4RUHA 4AIKA 3HL2A 4RNNA 1YRNB 5IC4B 5F41A 4HT7A 2ZD1A 4ZKAA 1KDNA 2OEMA 2HS0A 1SV5B 3HRUA 2MJNA 1K44A 4O4GB 4O3MA 3KYDB 4Q8FA 2VFUA 4G6VB 2JFKA 3IO1A 3BR5A 2YQ0A 3BR0A 2WV0A 1FIAA 3GLJA 4DL4A 2UV8G 4QCLA 2HDWA 2ZMEC 5GTHC 2E9RX 1R23A 2UUTA 1NPRA 2WOMB 1JNRB 4IXAA 2GVDA 2KZVA 3K5LA 3KWMA 4D1QA 4G1IA 3DXSX 4EUVA 3T0YA 4DJAA 4N7TA 3X2QH 1KN6A 2D3OR 2BW7A 2HRUA 3BTLA 3E6DA 3F73A 1FRKA 1IDZA 3MWBA 1D5VA 2HZVA 3T9NA 4M6XA 4DV3F 5LBQA 2FLLA 4X4NA 2EV5A 3QJPA 4ESFA 1VMBA 4LGWA 2YWFA 3RDIA 1OQYA 4OLPA 3LP1B 3VGUA 3QQAA 2EK6A 2NVXJ 1T9YA 2PI5A 4DEZA 4Q0BA 1TL8A 3VZIA 1REVA 2H8WA 3BV8A 1FOXA 4LRCA 4BQQA 3S32A 1QO0D 1W25A 4RZRA 2W9BB 1QY7A 3OFEA 5KFGA 3MCNA 5U47A 4JOMA 4RGXA 4G7ZF 5DG9A 5AJ3F 2R9LA 4JI4J 5EG0A 1WWXA 2JK3A 2V94A 4BE1A 2R7DA 1MSFC 3ZZOA 3MECA 2JJ7A 2EIMH 1CULA 2O6GE 1F2GA 3GTYX 1PUFB 2EFWA 1JLAB 2FYXA 2W7AA 2XSFA 2DGQA 3SDEA 1XN9A 2J9CA 1FTTA 2QFIA 4ES3A 1H89C 1VQLS 5B0FA 1E6VA 5HN0A 2KT2A 2OD4A 2ALYB 3GSIA 5JMNA 2AKWB 1MSEC 3DLGA 3LAMA 1GNKA 2GA1A 2VJ5A 1BWVA 3C2HA 2BE9B 1OFCX 3LOUA 1X58A 1LWEB 4NZ7A 2MABA 1RIOH 3KLHA 1PO6A 1OCTC 3GZ6A 5L3CA 4G94A 4B3OA 4DFMA 2OPTA 2LKPA 3DRPB 9ATCB 1S0OA 3P9KA 1B59A 1WDDA 4ZHRB 2C2NA 3GW2A 1UTAA 3JTPA 1F1BB 2ZH5A 4KISA 5DZ7A 4E7ZA 3IC7A 3FNNA 3GTKJ 5C3EJ 2VODA 4W98A 2VJJA 1REGX 3QRRA 4I69A 4BXXJ 1BXNA 2X1BA 3HYIA 5B5EC 1U0HA 3T5HA 3OYDA 2WBMA 3CCJS 3Q3SA 1JWWA 2ZD1B 2MKKA 4YFXF 2NVYJ 3HDDA 3TQ1A 4AYBN 4ZVSB 3AXMA 1KQ0A 1S0VA 1Z77A 1SVOA 3JR9A 2DRBA 5L1IA 4EV0A 1X1CA 2BJ9A 3RQ4A 5FO5A 3I0TA 4B4CA 4LF6J 2M70A 1CQMA 3KXDA 5LFAA 3HXMA 3SQOP 1Q7YT 1W7WA 4CCOA 5A2QU 4JI4F 5LSOA 3WU2C 2GVDB 1POGA 4ZVFA 3TZWA 2QTWA 4OYAA 5E3NA 3UFCX 1BD6A 2AQ4A 2JHEA 3ZQIA 2XWYA 3CJ2A 4DNCA 1N88A 3KUGA 3ITHA 3FF5A 1TL5A 1TELA 2OV7A 1FTZA 1HL6A 3K4LA 3L2CA 3V4IB 5IM0A 3CDHA 4Q0BB 3LQQA 4WCGA 4DV0J 3Q83A 1REVB 1IBMJ 3O2IA 1CG2A 5E3AA 4RWWA 2DI3A 2I0XA 2DR8A 1ZAOA 2VH7A 3BGUA 5EG0B 4CNYA 3TMOA 1IRGA 2IM2A 4OV6A 2RHSB 2E9TA 4USKA 5H6RA 3MECB 3B4DA 1CULB 2R5YB 2CU7A 2PD1A 4AUKA 3G82A 4QR2A 1WKMA 1LFWA 4PWUA 2LP0A 2IJFA 3FXOA 2K7LA 2ZKZA 1E6VB 4W4MA 3PO5A 5K5MA 4K4YA 2UVWA 4XL9A 2FX0A 2ZH8A 1SQFA 2MFZA 1GEHA 2GJIA 3IRXA 2C3PA 3MEXA 4E7IA 2ASYA 1SC4B 4DFKA 3KLHB 2EA4A 3SSRA 4XN3A 3HM5A 5CD4H 4B3OB 2MQOA 3O1LA 3U21A 3C6TB 2Q6CA 3K6GA 2FY8A 1KS2A 2KKHA 2XZTB 3K8VA 3QFHA 1S9GB 2O8KA 2D7SA 2AHQA 3B02A 3HFZB 3LGHA 3S6EA 2MSSA 1OR7A 1U0HB 3MR2A 1EJ7L 1BR2A 1MG7A 1VQPI 2M52A 3H92A 4JYKA 2HVDA 5IY5H 4RO0A 1KYWA 4OZ1A 2DNHA 3UWTA 2RILA 2YH0A 2C3OA 2CNLB 1S59A 1HBOA 4LG0A 1LUJB 5FIIA 3QJJA 4WTYA 4LMYA 2XAJA 2DA2A 2IVMA 4J90A 2N8GA 4X1EA 1IBMF 1U1NA 3F3XA 1Z3XA 2ACMA 2DNQA 3H3UA 1G3YA 2KISA 5J4VA 1Q5VA 1QPMA 4C8MA 1ZGAA 4R0JA 4FP9A 2XYPB 2YWWA 3CMAS 1LVAA 5B0BA 3LA2A 2YPRA 3WTSC 3RKYA 3K0LA 3VTIA 4XAKA 1XGSA 2OKQA 1RT6A 4Y0FA 2XAGA 2KYXA 1FWKA 1R3NA 1WC5A 1X4DA 2ZZNA 2NUHA 3ITHB 3KP6A 5C4XJ 4V2GA 1VQSA 3GLLA 4LSLA 3KLEA 2WTEA 1FSEA 1RAHB 3AOBA 2D1VA 4ZITA 2KB2A 1RK8A 3MTKA 5IM0B 2ZITA 1NRKA 4ZP6A 4E4HA 3S1TA 1Y1WJ 4CWBA 4RNMA 3PX4A 1KRPA 4MEXF 2VZ9A 3RPUA 1LE8A 5E0OA 3CVKA 4C2TA 3COAC 1RISA 4TKTA 1GHCA 3RBXA 1IM4A 1VQ5I 3EGVA 3OVBA 5KFXA 3JXOA 3WC0A 2MGZA 4DV7J 2RSQA 2X1FA 1Y3JA 3QZ8A 2NOGA 3FXRA 3F41A 4A3KJ 1NZ8A 2PJPA 1T08B 4F91B 1AWCA 4CO5A 5LMNJ 2CQIA 1R7JA 3ELHA 2E5ZA 1WC0A 1A6QA 2M5WA 5CXTA 3KDOA 4MTDA 4J91A 4XTTA 1PJ7A 2AZ3A 3GP9A 2LD5A 3EGZA 3IRXB 5GADU 5KHDA 1YVFA 2C2OB 4YB5A 2L9VA 1VJWA 2XPWA 1OCPA 1PIEA 3HSZA 2WW8A 3HTSB 2IJRA 4O4RA 4M71A 2H5EA 2YQ1A 4BS2A 4Z6YA 2CQNA 3H25A 2ZHBA 3DXJF 3DTIA 4B9NA 3BN7A 4CH1A 4GVLA 1E3HA 2K9LA 3MZ8A 3TBIA 3PACA 1D0EA 2ICWG 3GFZA 4LJZF 2QA2A 1KHVA 2CO5A 4DZ6A 4ENKA 1CJUA 2IA1A 3RBDA 3SYTA 5ICFA 1JE8A 4Y3OA 4PRFA 2LA6A 5CKTA 2ELJA 2YU9J 4LG0B 2Y0BB 5D4RA 4DJBA 2DISA 2Q6BA 3W7BA 1NAQA 2MMYA 4UF4A 4LITA 3RBZA 3JSPA 4PG5A 4KIFA 1FRJA 5CVJA 3T5XA 1X0FA 2H1YA 5C2GA 4LUBA 2FA5A 1SC1B 1S1VA 3L95X 5KFQA 4CLLA 4RLQA 4NCGA 5C2CA 2IIHA 3NNHA 4U7UD 2CUZA 4KT6A 1BC7C 4K2JA 4GYGA 2DEJA 3TEGA 2BY3A 1HBXG 5B0EA 4JI8J 5LMNF 1RT6B 3WTUC 3MZIA 5HDGA 3LALA 4LSLB 4ILMA 3K4JA 2B0LA 4Y15A 3PM1A 1RLDA 4IRHA 3J80Y 2R93J 4LF7F 3O8WA 2OPSA 3BPXA 3G1MA 2IS4A 2CNNB 1SQGA 3I9V9 2I1RA 3OSGA 1LE8B 3U27A 3D5RC 2HR3A 2V6CA 1WPKA 1S6OA 1KKHA 2MGZB 4CLKA 4X4SA 4K4XA 2Z99A 4K0KJ 2O03A 4YUDA 1HW1A 5GAEJ 5CJ9A 2V2VA 3ZNUA 4LSNA 1G8XA 3A3PB 3OVSA 3RAMA 3G3ZA 2QJ3A 3O3LA 3ZMSA 4NBQA 3M05A 2DTRA 3UD4P 6PAXA 2GW8A 4E98A 1LXNA 3EQLF 2NQPA 3K4KA 3OIOA 4DPYA 8ATCB 2MKYA 3QBCA 2IRXA 3TX0A 1IBCB 2IM3A 4UY85 2XB5A 1FYKA 5D6EA 1W2IA 3DN9A 2DFHA 2BANA 2E5HA 2DT7B 1GX5A 4L5JA 1U6ZA 2MD5A 2J0XA 1KEKA 4DX7A 2E71A 4Y2IA 1R4NB 3HKZA 3T19A 3W62A 1HXDA 4HHHA 2KKOA 1AT1B 2QBYA 1RAJA 1MNEA 1S5ZA 3JSRA 3U1LA 2UUBJ 1FBUA 2DO7A 3MZYA 1NEEA 1CJUB 4PAAA 1GT8A 1AYEA 2HPIA 1K4TA 2ALZA 2LA4A 3FK7A 4C2MJ 1GXQA 1TZLA 2RD5C 3LOCA 3ZR8X 5C25A 4HNVA 4Y13A 2QYOA 1ZYQA 2OQGA 4DUYJ 2AIRB 2I8EA 2MKSA 2W4DA 3ABMH 2DGSA 4ZPCA 2D5VA 3BSOA 1VQ7S 4E2FB 3V8KA 2MKIA 2ZE2A 3ZZPA 1S1VB 3NARA 1PC5A 1HKTA 2VKRA 5F0UA 4Y2CA 2ZOMA 4LMZA 1EJ9A 4M3DA 3HHEA 2OTLI 2YBVA 2V6AA 2LP4A 3M8RA 1VQMS 3RIRA 1M90T 3GTQJ 2RNEA 4LVNP 4ECSA 1RCXB 3ZZTA 4DV1F 3EDQB 1JTYA 1HNWF 1VQ6I 5DEQA 2OPSB 1P1TA 2BGCA 1OMIA 3KP3A 5HMWA 4UNOA 2LEPA 5DLFA 3PX6A 2OMLA 4I0WA 4L18B 1HARA 5KFCA 2VKHA 4DLGA 4CLUA 4ZIVA 4QPTA 2NLWA 2AYEA 3CD7A 3MAQA 4RBUA 4IO9F 4KHMA 3RZOJ 1JJHA 5E3OA 4JI1J 2DGUA 1W0UA 4XLAA 5K20B 5KCMA 2MY7A 1RACB 2FOKA 1R8CA 4M6VA 1FT9A 1SFXA 4EYHB 1V5VA 5HNHA 3KLVA 3MUVP 4MIBA 2HHTA 4MMOA 1Q1HA 1Y10A 5DCMA 3GMGA 3PFOA 4M5HA 3PNIA 1AFIA 2J6TA 2X3DA 1ONVA 4BC9A 2BANB 1U02A 1R7IA 1JLQA 5FLXY 5LMUF 4WK3A 2HYFA 5CVUA 1S7IA 4DUYF 4I2PA 4C3KA 2L7KA 3TUIC 3CCUI 3SCKE 3OS2A 1IKWB 1GMWD 3CQZJ 3IH3A 2WWYA 1R1TA 2OELA 4RA2A 4IO9Q 2XHCA 3O2PE 2QBYB 1T11A 2CPIA 4NCAA 4DV6J 1NJIT 2RB7A 2YR2A 1TKDA 1X4BA 1FI4A 2LEAA 4JP0A 3ZRGA 3W8GA 4R79A 3M6VA 3QAUA 4RLFA 2LYCA 2DYSH 3BCAA 2HZAA 1YO5C 2UUCF 3BROA 4I2QA 2KVIA 4X64F 4UTGA 1IAWA 2UXCF 1HWKA 1DRZA 3FKJA 4UVAA 2NS7A 3PCOB 2BABA 4ECYA 4N41A 4DL5A 1HNIA 2ISYA 4BNCA 5M5XJ 2WAEA 4IRKA 3J80K 1SPBP 3RB4A 1A5JA 1X5OA 2BDPA 3N4MA 2ZE2B 2EXUA 3W8PA 2M8DB 3SI8A 4MKVA 3M6UA 1YZ6A 1KU2A 1QZZA 3QYFA 1P7JA 2BKPA 2BEOA 1I5OB 4MK8A 4OHYA 2KRCA 4W97A 1XSVA 4I2OA 4DV5J 1TLHB 3ASNH 3P7NA 2DNLA 2OMOA 4F4WA 1UPMB 2GQ2A 2ZC4A 2Q1ZB 2IP2A 2AYBA 4OAYA 3F0NA 4RPFA 4DWIA 3UI3A 4RNFA 1VIOA 1VF9A 4P74A 1V5IB 3Q0VA 3CUQA 4J5OA 2LQ8A 2VPZB 1S72S 3W61A 1T2KA 3TWZA 2A07F 1F9HA 3OD2A 2GZOA 3G9CA 4OIOF 3EZ5A 2RRNA 1F5BA 4NYOA 3D2WA 4NWBA 3ZXSA 3R5JB 1RLCL 4B9UA 2FRHA 1P6TA 3HSRA 4J01A 3WHCA 3NGDA 1IZ1A 3KJFB 2N7CA 1IR0A 4NZ6A 1W1WE 2GV1A 1U5TC 2KFZA 3MMBB 2YKQA 1VLOA 1I1SA 3D28A 5K8NA 4BUPA 3RI4A 2DXFA 2R8IA 3FQLA 5DCMB 4GC7A 4Q2LA 3CC2I 2OFGX 3WTXC 1M5SA 3IM9A 1EV7A 1J59A 3DLLQ 4USHA 1JLQB 5IT4A 2K06A 2NZCA 2BY0A 2KDZA 1BI0A 3AA8A 3JQKA 2Y9HA 4I2PB 5HJXA 3GONA 4U96A 3N5FA 4WXWA 4LFCJ 2A5WA 4F0HA 1B9MA 4LK1F 2GO8A 4XMYA 4WK1A 5J1PA 1U26A 5TGTA 4A0YA 3EUNA 1EAYC 1NH7A 2V50A 4DV5F 3MOJB 2EC0A 4F25A 2H09A 4HDUA 1F5TA 2MHEA 2R0QC 3A0HC 1Y5NB 4K4TA 4I2QB 4RAFA 2BX6A 1H74A 1RTJA 2K9QA 3CDWA 1ZG1A 5FRNA 3SCIE 1KQKA 3KEYA 1E6YB 2J7UA 3NWRA 3H2LA 3M1EA 2DY1A 2QV6A 2YQ3A 4I0AA 1LK7A 2FVRA 2VQCA 3RKQA 4NLYA 4A0XA 4DFJA 3FK6A 1NK2P 2UZKA 2CZ9A 3JTNA 3QRQA 3VWBA 3NMRA 2A69F 1HNXJ 4GO5X 1QUVA 4JBCA 3BGLA 4JI5J 2HBZB 3G4SI 2MH2A 1JLEA 1M1EB 1VK3A 3MD1A 2M0GB 1WOPA 2H3EB 2XSDC 1PGZA 1RA6A 1B7YB 3ABLH 4ZDPA 3RTRA 1BOAA 2ZXJA 3CUQB 2R7QA 4BBSJ 2L48A 1TK0A 1CJKA 2CQ2A 3RPUD 1UL3A 2Z9OA 2ZZTA 2CQCA 1U2RA 2AJ1A 1JX4A 2Y2ZA 4ZTFA 2LKZA 4MFEA 2K8GA 2WBRA 4HI1A 2FC9A 5FLXK 3QFWA 2KXNB 1QD1A 1SFKA 3J7A1 1J9IA 2MQ8A 2ZB9A 3DPUA 3DI6A 2ZC3A 2HVSA 3JW4A 1ZTTA 3IR6B 3ABTA 2ASDA 1ZA2B 1D9DA 3JTHA 1CBKA 4OYWA 3ILLA 1K6YA 4ECUA 1HHSA 4XBFA 2V5HG 2IAIA 1WG4A 2HVEA 1JKHA 4KR0B 4W92B 3NS7B 1V9OA 5LEKA 1NH3A 1WI3A 1N75A 1VBXA 1BE4A 2FHOB 3M32A 2K7JA 1VQ9I 1I5ZA 1SVDA 4RBOA 2CMPA 1XCVA 1SB6A 4DS4A 2BJ7A 5J1NA 2HXIA 5KFEA 3F44A 1D1BA 1XGMA 2XSJA 1RYRA 1V4RA 1RHKB 1UJ4A 4ECXA 2BJEA 2DT6A 1MMGA 5IC6B 2DGOA 1RHJB 2QQAA 1TW2A 5DO2A 4I68A 1UG2A 3OPKA 2V9VA 5LL6d 3A8EA 3WG9A 2CPXA 2UWMA 2CUFA 4F4YA 4GGGA 4TU9A 3F8MA 3W9HA 1WJBA 5CPRB 1UA0A 5D8LB 1JXEA 2ZOFA 2VKEA 3AAWB 4BEHB 1RT4B 1RTJB 1JKPC 1C0WA 3FBCA 2R4GA 2D3UA 1VQKI 4XONA 3BPVA 2DHHA 3MTJA 1YX3A 3T1YF 2IA6A 5AE1A 2B7BB 5L8RC 2LQ9A 4DLEA 1VBYA 4GXOA 5HVFA 1VI0A 5AIPA 2F7VA 4DX5A 4MJKA 1HR0J 1D8JA 1FTCA 1SXLA 4XRSG 3OL6A 2U2FA 5AXLA 2BY2A 4L9JA 4HL9A 2V69A 4I98B 2BEFA 3RPQA 3OT9A 1UJ6A 1MWYA 4DL0C 1L0OC 4CHUA 4NL5A 2UZAA 1JLEB 3M4OJ 3DEWA 1SANA 3FEZA 4RW6B 2BBEA 1DUXC 2G0EA 4JK1X 2W84A 1ETOA 3QGPA 1QAIA 4A3GJ 1I50J 1ETYA 2H27A 1S57A 2XHWA 4YS2A 4FF3A 3UR0A 4P2XA 3I54A 3BZQA 4ECTA 1CJKB 3WX8A 3OXGA 1S7HA 4JX4A 2D74B 4JI6F 4HDVA 2VDHA 2DDAA 2Q2EA 3LUYA 5HMXA 1HOMA 4P73A 1FXDA 1T9UA 3JSMA 2Y30A 4QU7A 1SH2A 2HQCA 2W2PP 3WU1B 3CCSI 1PJ5A 2M0CA 1XMOJ 2XY6A 2ZH9A 5DDRC 3SZGA 3TR5A 4ZYDA 2E29A 2V9WA 1XN7A 2WVBA 4IKAA 3CLOA 5K14A 3GZ5A 1ZRFA 5E3LA 2LU2A 2ZKUA 1DGRM 1XJWB 2KN4A 1KA8A 2Y75A 4ER8A 3HCXA 4I67A 3WHBA 1Z3YA 1D5YA 2L3MA 4BXFA 2LFBA 3M32B 3BPDA 4ZZLA 1IUFA 4AU7A 4IRIA 4JBAA 3CMYA 3BPSP 3GILA 4TVAB 2P9CA 1MBGA 5EEAA 2XSJB 2JTVA 3TA1A 4Y2MA 2QEXS 3BR9A 1Z05A 1NPPA 2COLA 3CJ3A 3IA0A 4L6V3 4HBLA 4HX8A 1U24A 4NZ0A 2ZJ2A 4CZZA 1QUPA 1WJ9A 2KRHA 5G0RA 4ANDA 2FMYA 3JCUC 1HI1A 3S7RA 4UW2A 3DOMA 3TARA 4J9OA 5I4MA 5L1JA 5GAGU 3DRSA 1KQFB 2K1RA 2FNPA 2PC6A 3KEQA 2J5OA 3NOCA 1HW5A 3AQOA 3CESA 3ZQQA 3HM9A 1BC8C 2HZCA 4DR4J 1U8SA 4Y7NJ 5EX0A 3LSPA 1DFDA 4CNZA 1EH7A 1IR1A 1U2FA 2XNQA 2OH2A 1RT3A 2BQ3A 1J09A 4X4OA 3PR4A 1XMOF 4ED6A 1MBHA 5HODA 1TK5A 3GEZA 1IRZA 3R97A 4I6AA 1VQNS 1BBYA 1GMVA 3JTGA 4L9NA 3NG8A 3G87A 5BPDA 1Y0NA 3H3VK 1MD0A 2LY1A 1A6IA 3PDNA 1FA0A 2BE7D 1YJWS 1RBAA 3JRBA 4OYXA 2BVZA 3FMSA 3I59A 4C3HJ 1WKLA 2RQPA 3KJVA 2XASA 3HOTA 1FYMA 1CQTA 5ERIA 3KHLA 2Q2EB 1ZOTA