2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
2F8MA 4MMOA 5CLSA 3LA0A 1J5OA 4BWJA 1QRYA 5HLIA 4ZOSA 4RNOA 5DM7Q 1S97A 3M30B 4NRTA 4FP9A 4WXHA 2UZAA 2Q2EA 5K8NA 4GO5X 4TY8B 1FXRA 9ANTA 1T9UA 4ECTA 3BQZA 1HBOA 5D5XB 3HG9A 4IFYA 1RT4A 1VQNI 3CMAS 1B1BA 3DEWA 2V94A 5KG4A 3U2RA 2Q6BA 2XCPA 3KJQB 1HYSB 2BX6A 7FDRA 3W6VA 4KITB 1UW9A 1RZMA 2VKDA 1RGVA 4A6DA 2ZM6F 3W64A 3TJAA 2DK5A 4KA4A 3IRRA 3NOGA 5GAGJ 2RU9A 1C0UB 4XRSA 2N7YA 5ILUA 4K2EA 2JA7J 2GC8A 3BR8A 5FJ4A 1E3OC 1YG0A 1XD7A 2HHHJ 4PXBA 1KFSA 3BTCA 2YQ1A 3DEEA 3MECA 1MBEA 3WHBA 3RB4A 2LP4A 3CCVS 4K8RA 3I9V9 5BYQA 4OV1A 2DD8S 1RT7B 3T1AA 1YRXA 2MJNA 3EZOA 2H5IB 5J6XA 3R5DA 2L08A 1HBNA 2Y69H 1U1PA 3QAUA 2J0XA 3CJ3A 1K6YA 1TZLA 5F0WA 2KFZA 3HVTB 2XI3A 3UKGA 3WC2A 1JJ6C 1H2TZ 1ZAXA 2XHCA 3GR1A 3IWZA 4O3PA 4I2PA 3GTMJ 3A1YA 4X84A 1CG2A 3LWLA 3HD2A 4BHPA 1VI0A 3IGNA 1Q79A 1WKKA 5D4LA 2LBFA 2CQQA 2VFUA 4OI1A 3BWGA 1NAQA 3K0JA 5K5OA 3HUGB 3IGVA 4KYZA 4JI6F 4X66J 1JK9B 1QSLA 3JSPA 2ZXHA 4HR2A 3BG7A 4ON0A 4PXDA 3US5A 2BDPA 3K4JA 4H4OB 2YKOA 2CV0A 3ISNC 2DOAA 5JVTA 2MHEA 3C8YA 3DTEA 3VGTA 3NWSA 3CCUS 2BW3A 3A02A 4KMUX 3MM5A 2MYFA 3TP2A 3P5JA 3GV7B 4FQGA 1NJIT 1RT5A 2G2OA 5GAEU 3S3MA 5K1YA 1FE4A 3LP0A 3CPWR 4MIAA 5HNFA 5F41A 4PXCA 4UW2A 1IZ1A 2KVQE 2AHQA 2ICWG 3J81Y 2RNEA 5CYQA 3AJ1A 3H3VK 5KG3A 4KUMA 3QGGA 3QZ7A 2V1DA 4MIBA 3CJTA 4WCEQ 1SUQA 2M9HA 4A3IJ 4ETXA 2LA4A 3CJSA 5DUIA 4P73A 3ISND 3SDEB 1IM6A 4HA8A 2L5QA 1VQ4I 2IJRA 5AXKA 2EIKH 1B64A 2ZBPA 4YR3A 2R7ZJ 2XSFA 5KFHA 2PMZD 4WKRA 3BN4A 4L75A 4PEOA 3IR5B 4XRFA 1Z4UA 4ED5A 1IQZA 5FB2A 4USMA 4JI8F 2RQQA 3NNHA 4JI7F 4J9VA 1ETYA 2VBZA 3GFJA 3HVWA 3VZHA 4EFAC 2QQ9A 4TLRA 4DV6F 1IGNA 2C6YA 5LXYA 4OJGA 1TU0B 5DG8A 1SFEA 2Z57B 1W36C 4NNJA 5B66C 2DFFA 2XQCA 5HAOA 2QEXS 2Q1LA 1TTYA 2ZCWA 4B47A 4LRAA 2ECBA 2CGPA 3KLOA 2EW9A 1EP4A 2XCAA 2WONA 2E36A 4RW6B 3DPTA 4NYPA 3CLQA 5J2MA 3NL0A 4A3MJ 1IN6A 1XGNA 3HSZA 1CLFA 4IO1A 3RG6A 1VQMS 1XB4A 3M8FA 3D5MA 5KT2A 4YP3A 1HI8A 3PJ9A 2OTJS 1HD0A 1LWCB 3PJRA 2KDOA 1SV5B 3LP1A 3TVZA 2LKZA 3VCDA 4C0OC 2NUUG 4YFKF 1YRUA 1TL8A 4G1QA 1YE9A 3Q24A 3FBEA 2GX8A 1V54H 3CCTA 2A61A 3GTYX 1NK3P 4G1IA 4A3EJ 2VE9A 5KT4A 3LANA 3BEGB 4LFAF 5CAAA 4U6PA 3O6QA 5KFZA 2DPIA 1D0ZA 3OMYA 3N05A 5M2PA 2ATCB 1DQ9A 5H6RA 1QLNA 2CQNA 4Q8EA 3B8HA 4DN9A 3OYLA 3LGNA 2Y31A 4YB1P 2C3PA 1T0FC 1N36J 1SL1A 3FQLA 1XK8A 2CJ9A 4RAFA 1USTA 5F8JA 1RT1A 4IOAF 4A6EA 5JFRA 1S7OA 4NI2B 3UR3C 1IAWA 3FCWA 2K4BA 2DMPA 3R60A 4YN3B 4QTRA 1QM9A 1S9EB 4OJ1A 5LLQA 3WX8A 1BWEA 3WTTC 1IF1A 2Q79A 2KISA 1TL3B 2CU7A 4LF5J 3EUKL 2K06A 2IVMA 1VQNS 3J80Z 1HD1A 3H7HB 3BQYA 2VI6A 4BQNA 5RUBA 3IN5A 1HNVB 3W5YA 3F9KA 5HLHA 3CIMA 2WC2A 3G1MA 1PYTA 2H1KA 4Y6IA 2LDUA 3KFWX 1BR2A 3VTIA 3P4UB 2M3AA 4LSNA 2JA5J 1S5ZA 4JX5A 2F4OB 3WGIA 2BVZA 1BR4A 2IVYA 5BJRA 4WFZA 5JLXA 4HACA 2X6OA 1FE0A 2L0KA 2VXDA 3C16A 2PMHA 4KN7X 3FEZA 3QPSA 4XK8C 2J8SA 3AG3H 2KXHA 3BZQA 4X66F 4JI6J 1RWVB 2MW8A 4IO9F 3EWGA 2H9ZA 3QT8A 3Q2TC 4QWEA 3MKLA 2BQUA 1U6GA 2MZ1A 1X19A 5F9LA 5DG7A 3RR8A 4LF2A 4FXVA 3I56I 2RNJA 3K2AA 3SDGA 3MPVA 2B9WA 4U95A 3QYYA 3JAMZ 1VFJA 2B9XA 3A0HC 4U0YA 3TEHB 1BN5A 1RTZA 3L2RA 2GVDB 3DXBA 4FXDA 2VDIA 1U5TA 3QP5A 4D5FA 2AJQA 3MM8A 3PJWA 1XR7A 4ZLNA 2QL9B 1JQGA 2KT2A 3O2IA 4AUXA 2R9LA 1RP5A 2E5ZA 1NDKA 2GVZB 2OGUA 3RBDA 1GLNA 2KFNA 2DGOA 4EJUA 1R22A 4BEHB 4XKVA 1UP1A 2STWA 5IT9Y 1X9SA 4JI2F 2GCFA 2NZ4A 1DP7P 2ZJQQ 1O3RA 5C2GA 4HEA9 4MK8A 3RKQA 3CDBA 3HT3A 1OSDA 1KR4A 2HS0A 4F0MA 5L1JA 2VPLA 4PAAA 1FEXA 3NBPB 2X7IA 2X6YA 4WJBA 2L01A 1GAOA 3VWSA 1QD1A 3FXOA 3JR9A 1K4TA 2IW5A 4ZPWR 2OQGA 4CO8A 4P9FA 4B3AA 2CFXA 2BE2B 5IYBJ 2F4MB 2VXZA 2CJAA 3TKYA 4IQMA 4OYWA 1FWKA 1RAJA 4KPYA 3U7JA 2R2RA 4RGRA 2ZXWH 1XMQJ 2MD0A 1SBRA 2PEHA 2CJKA 2CJQA 2B9SA 5IQQA 4UUVA 1MH3A 2DISA 1N0UA 2MZQA 5BPIA 1S6QA 4XQFA 5KHDA 3W1YC 2MLKA 4UNOA 4BY7J 4BXUA 5HI7A 3HVAA 4RNNA 1AU7A 1JLCB 1M5KC 1NG7A 4N47A 2V4RA 3ISPA 4HNUA 1PP7U 3HHLA 4EYIB 4FYXB 3MM9A 4RB0A 1KD1T 1HBNB 3QLHB 3F8BA 3E5UA 1U1NA 4C3IJ 3G8QA 4WX9A 4AWXB 2G0CA 3KP2A 3CCLI 2XS5A 1LFPA 3GILA 2V1XA 3GMEA 2NYHA 3FXQA 4NMXA 1YJUA 3X3UA 2ZBIA 3BREA 4MGRA 1JTYA 1L3VA 4D3HA 1PP8F 4ZPBA 5D8LB 1RPWA 4HSRA 3KDNA 1S76D 4HOBA 2DEJA 3K7AJ 2RS2A 1DJ0A 1X60A 2YWGA 2VJJA 4ILMA 3JTHA 1N6QA 4ITVA 1G6NA 3OYJA 1MJBA 1IKVA 2LRDA 1XMKA 1HQ2A 2QSHX 4ZCLA 2U1AA 3IRXB 2UXBJ 2GAGC 3OR1B 3EDPA 2FJ1A 3BR0A 2EKNA 1R8CA 2VPZB 1RWXB 2LDIA 3ELKA 4PSWA 2YQ0A 1MWZA 1VC5A 1SVOA 1RHRB 2YS9A 4P55A 1XMBA 3VPRA 3M9NB 2FUG9 3LQQA 1RA7A 1TKZA 1YITS 1SFOJ 4Y2AA 2D5VA 1K47A 1W1WE 4DQPA 3S1MJ 3D0GE 3GIJA 1RI7A 2XLJA 4FKYA 5CYJA 1TL4A 2HAFA 2AEMA 2I8DA 1KSPA 2ID6A 1YYVA 2HFVA 2R4FA 3MUVP 2J9DE 2CPEA 3OW2R 2Y1JA 4XLPF 2FJBB 2QFIA 2LXFA 4QR1A 1XCVA 4AL7A 3SDEA 4HG2A 1LK5A 2BJDA 3KLEB 3CD7A 3IC1A 2XKOA 1IKXA 4E8UA 1NXIA 1X5OA 4FKXA 1NTCA 3OVBA 2KJCA 3CW2C 1IRFA 2A1BA 2LY2A 2CVEA 1N32F 4DL4A 3HRMA 1Y6IA 1WCMJ 2MZJA 1LE8B 5KFBA 3QBCA 4LR8A 2DNPA 2FD5A 3IS9B 1E0EA 2LMDA 1X5TA 2TCTA 3HHKA 3DRRB 1WH7A 4R8HA 3W8GA 3H36A 1SJ3P 1NZAA 3KP6A 3WGHA 3PNVA 2KXNB 3GIMA 4WXDA 2FY1A 2ZZTA 3C6TB 2HQDA 4E2FB 2YTCA 2NYXA 1CJVB 1JLEA 2IVFB 2WAEA 3EE3A 4HH1A 3M8ZA 2Q0OA 3W3SA 1F5BA 5AIQA 1EP4B 3RB3A 3HO1A 4ZHRB 2YWHA 1T9VA 3NAHA 3MAHA 3Q8UA 3HZJA 4OYZA 1ZAVA 3I82A 1K1QA 1VCTA 4DYQA 2LY9A 4OZJA 5GMEA 3BJOA 4A46A 2KH9A 3I59A 1TBXA 3ZQIA 2A0FB 1IR0A 1W4MA 3J7AN 3GIRA 4KY3A 4FNIA 5ETKA 3FWEA 1OIAA 3M1VB 1IBMF 3KK1A 1H7XA 3V5RA 2KM8C 4GC7A 2LK2A 4PXEA 1QSYA 5TJJA 1VOMA 3TAPA 3LUYA 3DU6A 1T05B 3MTKA 4IG3A 4J19A 1U9OA 4WTOB 5J4VA 5T7LA 3W61A 3JSBA 1Q8LA 3OXFA 2EFGA 1XR6A 3EGVA 4HZFA 4R5PA 4GKJJ 3S2WA 2H51B 1ENHA 3DRSA 3E5XA 4UVAA 2IAJB 2J8AA 1B8IA 1NHAA 5M5YJ 4WXOA 1HSJA 4PZJA 3CD0A 2JHEA 1T38A 3CCQI 3OS1A 4LF4F 2P6TA 1GK8A 2QWWA 1T9YA 3MMBB 3KK2B 3RTVA 4EMDA 2A6EF 1P2FA 3HOWJ 1FX4A 5A8WA 1WC0A 1DY3A 3G9CA 4UHTA 2MTLA 5E8IA 2VFRA 3CJ5A 1FD8A 1B99A 3D2WA 1QAIA 4TYAA 1GT0C 4P52A 2RRNA 3CCLS 1GV2A 3H92A 1ETQA 1R4NB 1M1GA 2APOA 2D45A 1H72C 3HHLD 3RYPA 1H3DA 4K0KJ 1LW0A 4ECRA 5E20A 1SJFA 2MH9A 3BV8A 3DM2B 1DP3A 4WYWA 2CPFA 5DG9A 2NUHA 1O3QA 4K4VA 4D1QA 1D09B 1QQIA 4ED2A 3AB2B 5D8KB 4C3JJ 4L18B 4OYPA 4G94A 2R7VA 2CNNB 4OI6A 4DF8A 5E3PA 4MAKA 5CVRA 4PWDB 3IO1A 2Y0SN 5HODA 5DQGA 3IRWP 1NH7A 2XGQA 2ASYA 2BMBA 2CVIA 1G3TA 1FFWB 1QTMA 1VQ6S 2BJ9A 1GVDA 3VEPA 4OYXA 1QE1B 2CUJA 4CNZA 4G8XA 1C0WA 2DY9A 5FFXA 4L9JA 3K8VA 1BBYA 4KSEB 4KIAA 4K4SA 1G3SA 2W4DA 3RRKA 2HQCA 1XS9A 3IBFB 1XMXA 4ICLA 4CO3A 4X62F 2HRUA 3KKFA 2CJBA 1FYLA 3M2VB 4NDLA 1FRMA 3F6OA 1PYVA 4D5CA 2L02A 3EPZA 4QWBA 1M5HA 3SQGA 4O4GB 4B3RJ 1WHWA 2UVVA 2DFEA 2RV8A 2RN7A 2H3EB 3VHQA 5E17F 3AJDA 3KJFB 5GMKa 4YB7A 2FPHX 2KKHA 2L9VA 2DR5A 3BOQA 3O2PE 1R0AB 4QOTA 1SQGA 3THVA 4BS9A 4ECYA 3R8YA 3JS9A 3VZIA 5AIPA 3M4XA 2JRTA 1U8WA 2FNAA 2XDVA 1CBKA 3FM5A 3OYEA 4CYCA 1VDHA 4NLTA 1YSJA 3NGRA 3E6CC 1U5TC 4PJNA 4I02A 4NLSA 4A5NA 5GPCA 1YO5C 4P9UA 2SXLA 4CCOA 1XMOJ 1LJ9A 2BJ8A 2P2CB 1P4WA 1WACA 3QO9A 1QPMA 4F92B 1HARA 3PHTA 2B0LA 2HQRA 3G4SI 3V6JA 5EN1A 4NA1A 4JYAF 2HURA 2DR6A 1AWCA 2W9AA 5ADZA 5A8RA 2DXFA 4B9VA 5IWAJ 1Z21A 5GAHU 1S6QB 1JJ4A 1YJ9I 4CH0S 4W92B 1J27A 1Q8IA 1BI0A 3V6KA 1RU1A 5LSOA 1FBUA 2UUAF 2LNBA 4W98A 1ZAOA 2QQBA 3ROUA 3NGTA 3NG8A 2K3KA 3HHLB 3MAAA 4BNCA 2MSYA 1CC8A 1FOWA 3MF5A 1KVIA 5LSRA 1L3SA 3K9TA 5DS7A 1IBMJ 4I6YA 4ELTA 1F9HA 2LTPA 4D7NA 4DBRA 1RETA 1F0XA 4XKBA 5EX3A 1ZZFA 2OA4A 3SQNA 2FE3A 1X1AA 1UETA 4P5OA 3U1MA 2EV5A 4OAYA 2BY0A 2EZLA 4NWBA 2UZKA 3R61A 1SD5A 3ECOA 4RS8A 2ILYA 1WF0A 2XM3A 2DODA 5IOLA 1TL5A 2R8KA 3T0YA 1JLGA 3ML6A 5EJCA 4PR6A 4DX7A 3KMQA 3I55I 4CO5A 4LG0A 3SZ2A 3UR0A 1TP7A 4G1PA 3EMTA 4XLAA 2ACYA 3D5LA 2F4FA 2DXIA 3T1BA 5ETQA 3H9JA 5B7WA 2C3UA 1S3JA 4CH1A 2CRGA 4M5DB 4RBUA 1UEKA 2HXOA 1BA5A 1LKXA 1OQYA 3F8FA 3HT0A 3QAEA 1ZELA 2NS8A 2DT6A 1X4HA 4DW6A 2HS3A 1YW7A 3MEKA 4FF3A 3BG5A 4YS2A 4B9UA 4DR1J 4I7FA 3OSPA 2KJBA 2WWYA 3S1RJ 5GAEJ 1LFBA 4I99C 2HW3A 4ZJLA 4B9NA 2L9NA 4P7TA 3CTRA 2MMYA 3RBXA 4QPTA 2B9EA 4C9DA 4DR3F 2CDRB 3OXLA 1H38A 4LRBA 2KRFA 2NS0A 1NUEA 1VJQA 4M5LA 4C2UA 2FHKA 4M94A 2H8WA 4AYBD 4CCLA 1HHQA 2W7OA 3MCOA 1I27A 3FBIB 1WWHA 1VQMI 2MKKA 4J01A 1OCRH 3RZDJ 1VQLI 1YS6A 3R97A 2CQKA 5J1NA 2DTZA 3EPGA 3JXOA 1UPPA 4TU9A 1FOYA 2XAHA 1KDNA 4OQJA 4TY8A 2H27A 4X4RA 4M5KA 3W6JB 5HLFA 1RT4B 2DMQA 4J5OA 5ICEA 3TUJC 2DTJA 4CGZA 3IS9A 2XF6A 3FMRA 3QRRA 3FCVA 4DL5A 2R7DA 4ZP7A 2M45A 2K1RA 5AJ3J 2JNJA 2YVSA 4AD9A 1UJ6A 2NXEA 3CC2S 3H0GJ 4K5RA 4OJHA 2VPRA 1NDLA 1O6XA 2GGPB 2YKQA 2AXTC 2HFHA 4HAMA 4PG8A 1A36A 5DGBA 4ZHRA 5E3RA 4NXNJ 4RB3C 4KV8B 4KHMA 4DR4J 5IC4B 2CQ2A 2OF7A 3OJSA 1VBYA 1QZYA 2B4OA 3H35A 1HPZB 2HNDA 4OHXA 3PVXA 2H1YA 3GFIA 3DXSX 5KFEA 2A05A 3V4GA 1RDRA 1EX8A 2OEJA 3NS6A 3REOA 1WRJA 3V4IA 1PYOB 3LAJA 4I0BA 3IM9A 3HRUA 4M6XA 3HVTA 4E7SA 2UUCJ 1N4LA 2UUTA 1FTZA 5D4NA 3S01A 3HSDA 4ZC3A 1WI6A 3EQLF 3K17A 3MEGB 1UWBB 4C8LA 4IPAA 3LWFA 2G9WA 4O5VA 2UP1A 1KC8T 3I31A 4NLDA 4DX6A 3KDOA 2LBFB 1ELOA 2J9EA 2DNQA 3OL9A 1I6JA 4R5PB 3EDRB 4EEFG 4JI2J 2IJFA 2HPIA 1O5JA 4QCLA 1B8IB 1HI1A 3E6DA 3UO0A 5J1PA 3Q2SC 1I39A 4X1EA 1MDMB 8RUCA 4C2TA 5KFOA 4MKYA 4JI3F 3DRPA 2GS8A 1J5YA 1BOBA 2F7VA 4MKAA 2A2CA 3EXYA 1Z0XA 2DITA 1VMBA 3VF0B 3DLLQ 3KLGA 3TZWA 3R1HA 2XHKA 4J37A 5L3DA 5B0BA 4Y34A 5KOXA 4EQQA 2DPDA 2IRXA 1G8XA 3TO6A 2W7AA 3FUYA 5L9NA 2WHOA 2JEGA 4HX8A 2HTJA 2B8PA 3RW7A 2VC1A 4DV3F 1FDAA 4OZLA 1KA8A 1W36D 4C0BA 1KRPA 4A47A 2BM1A 3D1NI 2EWHA 2L9SA 4MYTA 1FOKA 3VAMA 1FK9A 1VYAA 2YNIA 1KLMB 1IV6A 4NUBA 1HBMB 4IH6A 3V6DB 1EV7A 5HANA 3CCVI 2JA2A 5DCFA 4BY1J 2B63J 3THTA 2LG4A 2GHVC 2QMWA 3LSTA 3TGNA 3HM9A 2XGCA 1BIAA 4M6VA 1Y5LB 1AHDP 3BQ2A 4B48A 1JUSA 4QR0A 5J1YA 4UV8A 3OBIA 4ELUA 3ZFVA 2MQOA 2WAQN 1RKWA 3GBGA 3N97A 1MGTA 3IFEA 4G6TB 3VVTA 4I0AA 2IT0A 2F5GA 1LWEB 1LW2B 1RLDA 2KLOA 5GADI 4LITA 1EIYB 3IAM2 2Q8KA 2YPRA 3K70C 4KMFA 3S1QJ 1QVFR 1TQLA 1SAUA 3UE2A 3VYRB 5HP1A 1YLXA 3PX4A 3GONA 4ICLB 3CMAI 4ZVHA 2QYCA 4XORA 1XJWB 2WONB 4O6JA 3WTSC 2V8GA 3SQGB 1PO6A 2PMUA 1IR1A 1RWMB 2OH2A 3SSQA 4OZ0A 3TX8A 4DGWB 3CJ4A 2XMMA 3UDCA 2VQCA 1JLFB 4C3MA 1XNQJ 1RT3A 4USIA 4BDZA 2AQEA 5IS2A 4G1QB 1NNDA 1F2GA 4IR1A 3D54A 3S14J 5MLCV 2OCCH 1SD6A 3RBZA 5CJ9A 1NK6A 3M6WA 2DMUA 2BRKA 3M9OB 2FQQB 3POTA 2E1MB 3LFUA 1C0TB 4OZ3A 4QW8A 4OMYA 1NKEA 5HDNA 1HLVA 4DQQA 3OYKA 1TUVA 1RHKB 2KP6A 1PCAA 3MKZA 4MFBB 2YWKA 2ZXIA 3D66A 2Y1RI 2Z58B 1NSQA 3SEQA 2ASDA 2BYCA 1NJXA 5F6FA 1GH8A 4IYQA 3ZMVA 2FHOB 3VWBA 2AJ0A 1RT1B 2HXIA 1YJRA 3M2RA 1PC4A 3LSPA 2W9BA 1SFUA 2L7ZA 2D2WA 4DPYA 2QA4I 2ZKTA 1VQPS 4Q0BA 4LG3A 6FDRA 4B3TJ 1KP6A 1S9EA 1Y11A 3LSKA 3F0NA 1BQXA 2KDZA 4MEXF 1Q7LB 1VR6A 4CNYA 4KC5A 5ETVA 2K9SA 4DV4J 3UNYA 2KT0A 3OPKA 4BQQA 4Q48A 1URRA 2GBYA 4U67Q 3SEZA 2BJEA 5DV5A 2HS4A 3EUHC 1UEVA 4M3BA 1PAUB 4CLYA 1KU9A 1RAIB 2CQ1A 2E66A 3OYIA 3FKBA 4ZLPA 2Z2ZA 4XO0A 3DP7A 1WKLA 5IY5H 4RAGA 3HB9A 4MJKA 2F6CA 3R27A 4K4XA 4RW8A 2G1HA 1JLGB 3C16B 4LG0B 2DA1A 1OR7C 2HIYA 3KG4A 3Q8YA 4A3BJ 4ATNA 1VQKI 2LEPA 4QIFA 5IP9J 2V7FA 4JOMA 2YKNA 5HJXA 3I4HX 2RF2A 3AXKA 5HVGA 2CWEA 4H4MA 2YBVA 3NARA 4IL6C 4OYOA 2RDJA 4LRFA 5KAKA 4P2FA 3PEJA 3R5BA 1C1BB 5A2QU 1YJ7A 3DTIA 1BWVA 5GAEI 3JREA 2HBQB 3OYCA 4UZCA 2YNHB 1ZTRA 5I3PA 2FYXA 4O44A 5HROB 4IX7A 3HSFA 4HF0A 1Q5VA 3A13A 3K5PA 4RBOA 4ZYAA 3KLVA 2RIJA 2XASA 1U48A 3IP4B 1RBLA 1ZR2A 2C2NA 2JC1A 4Y13A 1GMWD 3K4MA 2J0SD 1S0MA 2BJ7A 2ZFWA 1YRTA 2YUSA 3K4CA 4MNUA 3GLXA 2DNYA 1Y3JA 4LB5A 4A8OA 1WORA 4OZ2A 1OYIA 2EEYA 3HOSA 2JEFA 4DV0J 2A3SA 4V19J 4IRCA 2CW7A 3Q0VA 2YY3A 4GVBA 1WI9A 1H7WA 5ILSA 3BP8A 2FVCA 3G6YA 3NY0A 1W25A 3WHCA 2OAZA 4IVNA 1R00A 2H54B 1BC6A 4KGMA 5LRSA 1JLQA 4ESBA 3DF8A 3HFKA 3RAQA 1T6SA 2PG4A 3H2UB 1I1SA 4FF2A 4FHTA 6AT1B 2F4VF 1HBUA 1KQ0A 1UVNA 2OQRA 3IXQA 2H6CA 3J7AY 4I2QA 3PNIA 1RWOB 1JUPA 4LGWA 2XUBA 3LA2A 1GQEA 4KV8A 1SEUA 4HH0A 4ED8A 3LA3A 2KB2A 2KYXA 1WSVA 2NSCA 2HNDB 2XGDA 1TNSA 3GEZA 1V5FA 2ZMEB 4K2XA 4ZCIA 2ZUGA 3LSHA 2E2IJ 3JSYA 4IHWA 4DX5A 4TU8A 4FZVA 1IW7F 4DUYJ 2Z2LA 4NA2A 2AV5A 2ZSHB 2GA2A 4E7JA 3P45B 3GSDA 4QWCA 3K57A 3ZNJ1 2M5WA 1TL7A 2HR3A 3FISA 3PIOF 3HSRA 2XMWA 2BBYA 3VALA 3F23A 4B3SF 1GVJA 5GP9A 1FYKA 4N41A 1JT6A 2B4VA 1IVZA 3S1TA 3CJKB 3HKZA 5L3GA 4X62J 2HOEA 4DFPA 1G1XA 4ZVUB 1VQ9S 1YI2I 5KFPA 2VFTA 3BBFA 2ACJA 2KZGA 2DIUA 1WOSA 3CC7S 3K1NA 2XLKA 1T9WA 3LL7A 2I0XA 2N3OA 4CH7A 1V4RA 1L0OC 2J0WA 3OV8A 4X4VA 5LL6d 2H48B 2LU1A 2XV4S 1FJGF 2KQRA 2HHVA 1PG5B 4ED7A 2KRCA 1VQ8I 3RQ4A 3KP5A 2CPYA 1R8AA 3SZTA 1H98A 2W2MP 1Z91A 3SV3A 1N5SA 2HHWA 3VQTA 2LKPA 1FCAA 1R0BG 2DGUA 3CP2A 5KG0A 2QYGA 2FVRA 2EJRA 2DHXA 2ZE2B 1RT2B 1J0RA 3MUTP 4JP8A 4W97A 3K1PA 1Y0HA 5CQEA 3OTBA 1ZGAA 2MLGA 5ETTA 5J1EB 2TRTA 4EUVA 2C28A 1FK9B 2I10A 1Q81T 2UUBJ 1S59A 3CCJI 3V6DA 3PX0A 2GQCA 1W7PD 3EYYA 1OYYA 5I42A 3VGVA 5KCMA 3PYFA 4PUOA 4OHVA 1X8DA 3PQJA 1ZPWX 2L9WA 4NYOA 4MIMA 4DCPB 1JKPC 2I5JB 2AYGA 1WD6A 1O7FA 3QJLA 4D3GA 2BOAA 4LF6J 1Q78A 2RE1A 4CO2A 5A0YB 5D8HB 1QVUA 4HDUA 1MW7A 3ZRGA 4ESJA 2VA2A 3CDUA 4YIRX 5LJ3Y 2ROEA 5L1IA 4XONA 1X1BA 2HWHA 2CQXA 3J7Z5 4BKXA 4KRWA 1BI2A 5H9EJ 1TV6B 3PX6A 1X4PA 4J00A 2R92J 4ZS6A 3DLEA 4XN0A 1YG2A 4XDDA 4GRIA 2MC3A 2RKHA 3BO3A 3HOYJ 3L7OA 4YY3F 5IP6A 2B8QA 2GMHA 4U87A 1KTVA 3TRGA 4QR2A 2ADUA 4PDKA 2DKOB 2HS5A 2EZKA 2VBXA 2IM3A 1N54B 1Y5NB 2JVGA 5J2NB 3N01A 3WTYC 2VQFF 4HX7A 3H0PA 3PM9A 3TO9A 1I3OB 3O3KA 2L41A 1G3OA 4NZ6A 2YH0A 4PJLA 3DOKB 2HRYA 3VYTB 1DQAA 4CCNA 1MSEC 3EUHA 1DQUA 4LRDA 5HO4A 1K0TA 2YWEA 3KG1A 2J6UA 1MNDA 3ETOA 3LH2S 4EBDA 3POTB 1ZPVA 3A2KA 1U6BA 3IP0A 1JXVA 3SFUA 2K7JA 2ZNYA 2RDDA 5A8KB 1G3WA 1S6PA 1FA0A 3D7SB 3G2XA 4QIWD 5L3EA 4HT7A 2DH9A 5K14B 3MTJA 2ZC4A 3G87A 2KYZA 1T0FA 4QWDA 4UY85 2GIQA 1NK8A 3F56A 2OO4A 1HNIA 4PG4A 1NK2P 5DDQC 4IRIA 2DR8A 2VQLA 5ETMA 5LBQA 4DJBA 4HEA2 2XEXA 3SHFA 1POGA 2W9BB 2QO3A 4C2MJ 1J2VA 1U1LA 3FHNA 3W9JA 4NZ7A 4EGYA 5IT9U 3D0SA 2OELA 4ZVOB 5JVGQ 4F4ZA 2AGQA 4PGHA 3S32A 2W2OP 4B1RA 4ZLJA 1WJDA 2QE5A 2F5VA 4DZPA 1SIWB 1FJ7A 4Y0FA 2WY8Q 3F6VA 2RGVA 2DGSA 3JAMY 5DEQA 1F5CA 2DR9A 3M3YJ 4HQMA 2BZ2A 2XAGA 2LYVA 4ZJQA 2NREA 3VGUA 1QY7A 2FD2A 1XSXA 3DM2A 2HAIA 2VG5A 2QC3A 2NCKL 3H20A 1KS2A 4LF8J 2XPVA 2VF3A 1D5VA 4DPXA 4DPWA 2KG1A 5K20B 3DLAA 5CHCB 1RTIA 1REPC 2J6SA 3UN5A 4ENNA 3QGIA 2VPXB 3D4JA 3OFEA 4J9OA 2IBOA 1HI0P 4URQU 3LP2B 4DV5J 3CT9A 2AEFA 4IFVB 3A8IA 1BLUA 3JTPA 2KHDA 2VJVA 4M3GA 2LR8A 1R0CB 2JVOA 2HOTA 5I3UA 3VAFA 5HDGA 4RR5A 1LDDA 3CMEI 5MAOA 2HVSA 2QMXA 4WPAA 3SIPB 2QG9B 4ILRA 3W6KB 4HI1A 4F67A 3KK3A 1WVRA 1KHVA 1EQ0A 2BUNA 3TDZC 1RCXB 2GQ2A 3NKYA 2K9QA 3PCOB 2ZWOA 4UUSB 2GJ2A 4F04B 3WTVC 4N4NB 3BGFA 3W66A 1SL0A 4TNOA 3SYZA 3ZTQA 2VHGA 2COLA 1FKAF 2ZHOA 4JI3J 1XSVA 2QA4G 1TL1B 1FESA 2CQIA 1SKSA 2VJIA 3CF2A 1Q95G 1ZRCA 1RSCA 2D3OR 2Z56B 3D1HA 5L1KA 1XNRF 4V2FA 3ZN1A 3MN2A 1TC3C 2FA5A 4L9TA 1R8HA 3MMCA 3T1YJ 2F63A 2OPTA 4I67A 2NXCA 3QWPA 1Z1ZA 3G86A 3KYDB 2Q6CA 4ZKAA 1HQEA 1BJAA 5FDLB 1FRHA 3RGIA 4JUZA 4USTA 1E6VB 4ZVRB 2R8JA 3EGNA 1DGRM 1S1WA 3QSIA 5T14A 1JLQB 4CTAA 3QZ8A 2MG4A 3TMOA 4KB7A 3KCCA 3AG4H 2P7CB 1TK0A 2M0CA 1KTQA 4A4JA 1H0HB 2OPQA 2VKEA 3LSJA 2KT5A 3LGHA 4BDPA 1XMAA 5FKKA 3D3CJ 3CJRA 5LMNJ 5F0HA 5KFXA 5D3GA 4A69C 1DRZA 2QENA 4TLQA 3G3ZA 2BHYA 1RTJA 3ILIA 1JKQC 3E1SA 1FF2A 3UDLA 1A7GE 2OZUA 1N0VC 2RSQA 3MAAB 5E3QA 1D9DA 1SANA 2FJDB 1QO0D 1B7FA 1GEHA 3I9V2 3QAHA 4UOFA 3AQPA 4IQJA 3BH7B 2QFJA 4BYYA 3DI6A 4IG0A 4C3KA 5FLXY 1R7JA 2DT9A 3VODA 3Q8SB 2FTRA 2V9WA 4OMZA 1UL3A 3QIPB 5CVJA 4EBCA 3JAMK 2MXYA 5KFCA 2FOKA 2QQ8A 3OL6A 3HOXJ 3CJQA 4A8SA 3TOBA 2V69A 1UAWA 1FSHA 1F2HA 3CUQB 1REVB 1S10A 1TT0A 2XZWA 5K8OA 1GMVA 3TUZC 4A3FJ 4K7QA 1O7LA 2MB0B 1IV8A 3CEDA 4D9JA 2OU2A 4P2SA 5KFSA 1KQ8A 3D6TB 2DCEA 4L76A 2VL8A 4B44A 2V68A 1OFCX 1IJWC 4AYBN 4A3CJ 1UFLA 3O3LA 4HHUA 2R8HA 3M6VA 3Q8RB 1RYSA 2E5JA 2HBRB 3V8LA 2R3VA 1NK5A 1RACB 4DL3A 2NPFA 3IBWA 1WC1A 2RREA 2CKWA 4M1KA 2FRHA 2CS3A 4EM1A 1S4FA 4OIRF 4NLYA 5CYQB 2ZE2A 5KG2A 2Y1LB 3ITHB 1S0OA 2XWXA 4B3XA 3TI0A 3TBIA 1S57A 3HJVA 1RXOB 2V0NA 2M52A 3R5JB 3HJEA 2WAQD 4CCJA 3DKYA 1SUQB 2JL9A 3BGRB 2E60A 4L9NA 1RTHA 4RW7A 2FNPA 2WA0A 3E6MA 3DLGA 3TVYA 2DOFA 4HF1A 3ZZRA 3WE3A 4I6ZA 2OMLA 5HVHA 3C3LA 3IL2A 3LMMA 3QRFF 1UHMA 4RNFA 4Q2LA 1TWHJ 1YBUA 2RHSB 1UA1A 5KT5A 2W2PP 3PW2A 3I0RB 4LSLB 4NLXA 3MMJA 1GV5A 4J9RA 1N5YB 4KGXB 1WI3A 3WU1B 1JWWA 3FX3A 1GXPA 1FJCA 2HYJA 1BMQB 4CLKA 4IDKB 2K1RB 3GFXA 1UJ8A 3IV5A 4BHBA 2ZUAA 5FLVA 1E6YB 3HHNB 1G4DA 1W7WA 4IZZA 3KHHA 1MNMC 1BXNA 1JJCB 4OX8A 2I5UA 3HX9A 4IRKA 1X1CA 1VRTA 2OUGA 1XC9A 2IM1A 2ERRA 3LOCA 1LEBA 3QIDA 4NLUA 3JSMB 1FIAA 2J7KA 5IXUA 3T19A 4MFEA 2W57A 1KOHA 4UF4A 4DG1B 4CWBA 4ENOA 1YRNB 3HPGA 3CDHA 2YKMA 2FZCB 4F26A 1LWCA 5DM6F 2FU4A 3BSOA 1T0TV 1XERA 1A04A 1BOAA 1SPBP 3TA0A 4JBAA 2K7KA 1UHSA 1MKMA 1MWYA 1ODDA 1MN7A 2YSRA 3K1MA 2LECA 2OD4A 4DV7F 1UFWA 2HRTA 3RJMB 4XBFA 3D6MB 2JWTA 1TMJA 1T33A 3B4MA 3MOZA 4NCAA 2RS8A 3PFIA 4OYMA 3H5RA 5FD1A 1YKWA 2O0YA 2AP6A 3S8SA 2Y9YA 2O66A 4B43A 2Z9OA 1F3VA 3W2AA 5EHHA 3BO2A 2K7LA 4FVCA 3ZR8X 2EG2A 2XMKA 2B4UA 4WU3A 4Q43A 1DARA 2ZH6A 3FXLA 3FZ2A 3TO8A 1HNIB 3GWCA 2BYVE 3DFGA 2EFNA 2E5IA 2DVIA 2RMLA 5F8LA 3QGHA 2D1VA 2FUG2 3I5BA 1Z9CA 4N7TA 1FERA 5J3LA 3TL4X 5HSPA 1Z67A 5IV4A 1V5EA 4HPQA 5LRRA 4BACA 3OYDA 1N34F 1OQ6A 2BRLA 1N8RT 4DR1F 2L7KA 4XLEA 1BC7C 3OSNA 3CCZA 1FBSA 3VSLA 1WKMA 3GF2A 4RW4A 4L0ZB 2CJJA 4ZTJA 1V5VA 4BBYA 1AUDA 2IYIA 3L2VA 3ECHA 4U7UD 3QWLA 1U0HA 5HOOA 4ZZLA 2MD5A 4F55A 3IG1B 2ZH5A 3DYAB 3L00A 5D5UB 4ENMA 1Z2ZA 2JWNA 5J8FA 1S1XA 5KT3A 4F4YA 4EJOA 5F8GA 4OIOF 2VDHA 3AOAA 1YJNI 3CP8A 1R89A 1X4FA 1B6AA 4H4KA 1HKQA 2OIHA 3TUPA 2QSWA 4HACB 1S12A 5KNLA 2CYYA 3N5FA 2E1PA 4NLWA 3MEEA 1JJ2R 2P8IA 3SSRA 2MFZA 4M3DA 4G6QA 3EDQB 4DX8H 2LQJA 2ASJA 2RD5C 3N4WA 2QMUB 4LJMA 3ELHA 3KP7A 2W25A 2V8HA 1H9GA 2HYFA 4OIXA 2VBYA 1APSA 3I5AA 2L54A 3LP2A 2O5DA 2QVOA 4ABZA 3BCBA 1X5SA 5KAIC 1RTDB 1RNLA 4GCVA 2GJIA 4B02A 2FJEB 4AIHA 3BBBA 3Q0UA 3ZC4A 1RE1B 5J40A 3R7NB 4PCQA 4DQSA 4OX9F 2ISYA 3BPDA 3H42A 2NR0A 4AXJA 5BQTA 1F43A 3GU0A 3BJ6A 4C4WA 2XPUA 1ZHFA 2HFOA 4XK4A 4FPIA 1OY6A 1IRZA 4LVOP 1U09A 4NXNF 1S5LC 1Q86T 4DR4F 1DHMA 3N5BA 1V3SA 2LDYA 5C2CA 3CWJA 2GVZA 4B9SA 5SUHA 2HQGA 2E5NA 3HEFA 2K02A 4BEHA 3UPFA 2DEIA 4RM2A 3GUDA 2ZO4A 1AA7A 5EWFA 4U0VA 1MU2A 1OMSA 1TW3A 1NHKL 3PUFA 1SJ1A 2GQQA 2FSWA 4E7IA 3O44A 5LM7E 1BE4A 4LUBA 2ZKUA 2O5RA 3UCZP 2L3MA 4ES3A 5IV3A 1C0TA 2C22A 4CO1A 2MC4A 4AYBA 4I64A 4LF5F 3U27A 2BXZA 2RILA 1SH2A 3MFIA 3CO7C 1Y3KA 3MZIA 4HX4A 2ZD1B 2IYGA 1TTHB 1VI7A 4B9MA 2JOQA 1BM9A 2BE2A 4PKDB 5AT1B 4KO0B 2IEKA 3UVJB 3HYIA 2V2ZA 4C9YA 3QMQA 4XLCA 4DLGA 1SXLA 1RB0A 2ATLA 4LF6F 3JRBA 4KH1B 4LMYA 5D3GB 2CG8A 2ELJA 3N6NA 4N9HA 2XNQA 2JLEA 1ERDA 3TYTA 2BR0A 2NNNA 1NK4A 1B3TA 2ZJRQ 2IGKA 3ZO7A 1ZRFA 4FASD 4X2BA 1BQMB 2QSFA 3RYLA 1ZQ3P 3R7SB 4IOCQ 2HIQA 3RW6A 5E3NA 2V6CA 2JFKA 5EGYA 3LNQA 3A8JA 1C1CB 3GZNB 3E5QA 2LKSA 2C3YA 3BB5A 3DI6B 3K59A 5JVHQ 4DV2F 3HPHA 1RWKB 4M3FA 4S0HB 2BY3A 3PNTA 5E7OB 3V8JA 2D69A 1T3NA 1MROA 2FDNA 3KLIA 3HTSB 2H4WB 3J80Y 5K5QA 3SJMA 3SZGA 2EPFA 1HW8A 3CJQB 1FMWA 2QTWA 2EKYA 4DR5J 1R5ID 2JRMA 4TVAB 3I0SB 2MQNA 1B9MA 1S1VA 4NHJA 3WG7H 1JI8A 4L72B 2J7UA 4XICA 2CV2A 1RUNA 1ZG1A 4S05A 2B6AB 3ENVA 3HP6A 4LK1F 1QUPA 1OR7A 1P27B 3IRXA 3HHHA 1MG7A 2AGOA 1S7AA 1IN0A 1R1TA 3AD8C 1C1BA 2LVSA 4DL0C 3KLHA 2OPPB 1VQ8S 3KEOA 1WH5A 4G9YA 4HT5A 3GV8B 2FLOA 4NQWA 2JJ4D 3FNNA 4O44B 2L9RA 4YIFA 1FZPB 2GAHC 2ADBA 2QUFA 4NRUA 4CXFA 3WX4A 4BC9A 5L1LA 3L95X 1K73T 3ITHA 3THPA 1HWLA 2E9TA 3DKWA 2AKWB 4ZIWA 1YI2S 4WP9A 3I54A 2LQ8A 4JI4F 5F0UA 2XULA 4J90A 1OO0B 4Q5VA 3FZVA 1YDLA 3QPIA 3CCEI 1QAJA 3OOUA 5AXNA 4A8KA 5E3CA 3R5CA 4ANDA 4DCJB 4C8MA 2DO0A 2XMVA 4XPEA 3KUHA 1HWIA 3E01B 1R5HA 1HBOB 3AA8A 1ULRA 4MFDA 2XPWA 2DLLA 5C25A 1IBKF 1TAQA 3OTEA 4LSLA 1HDPA 4W1UA 1USSA 1CQMA 4RGUA 3W9IA 1N5YA 2OPSA 3SXLA 1ZN2A 2O8XA 3VYUB 3MWMA 4KDPA 1R6YA 3RB6A 2Y0MA 1A9NB 3QU6A 1YJVA 3OSGA 5B3SH 2M30A 1OKRA 3PRBA 5D5VB 3QT7A 1LK7A 2V2KA 2EFQA 4AL5A 1VRTB 2BW2A 1FYMA 1OJLA 5LEJA 2ACMA 3OQ2A 4JK1X 1RT7A 4URSA 1SIZA 4BWMA 1HBXG 4LIUA 2ZMEA 4FS1A 2XO6A 2ALYB 1U2WA 3C7JA 2LA6A 1HNXF 3M1VA 4YUDA 4RU9A 2AMCB 4DV4F 3O8WA 1LVKA 4ZVSB 2D9PA 2ZDOA 1W2IA 4C11A 3ET6B 1BW5A 5I4MA 3OL7A 3JYTB 4DL6A 4IG3B 4J9NA 2LF7A 2WSFC 3DGPA 3MM6B 5T7LB 3NMAA 3ZQCA 2X1FA 4CLFA 3KWMA 1FO1A 1YWXA 1HKSA 4WE1B 1MH4A 3BTIA 2E35A 4PRFA 4I56A 1VQOS 4A5MA 2VV5A 4X4PA 1ITYA 4LQ3A 3OL3A 1CEZA 2IRYA 5J2PA 3J81j 1FKOA 2ZVIA 2IAJA 1XDSA 3GZ5A 5CA5A 4GO1A 4HYEA 3EVMA 2RKIB 3KP4A 4OLPA 3ICLA 4YEAA 2O67A 2JSXA 1I5ZA 2N82B 4A3DJ 4FDFA 2E29A 1U9NA 3PR4A 2QN6B 3MMBA 3NS7B 2HNZB 1JLBA 2FGCA 1QZEA 2ME0A 1RT5B 2R2SA 3I32A 2EIMH 3KP3A 1XNRJ 2BABA 3HL2A 3LP0B 1UVIA 2OTLS 1NPRA 2K3FA 3WTXC 1HMVB 3GIIA 1LPQA 3NWRA 1K4SA 1L5UA 4KHPF 5B1AH 1YIJI 3AOCA 4WYLA 5FROA 1EB0A 5ICGA 2DQLA 2W1BA 1U0HB 2BXJA 1FIPA 1QTNB 4M72A 1U78A 1LW0B 2KL4A 2R7WA 2OMOA 2OLWA 1CS4A 2AYBA 1X4DA 2DHGA 3DOLA 3MWBA 4OHZA 5HS9A 2BOPA 2LQ9A 1TQIA 3TP3A 2PLYA 5I42B 2OBPA 2O7OA 3E3VA 3ZZOA 2F40A 3OLAA 3Q3SA 3OVSA 4DV6J 3BSCA 5LMNF 3F8NA 2DPUA 2LQ5A 1GTHA 4GVLA 4CDGA 4A0ZA 4USUA 5FIIA 3DN9A 2BEFA 1IM4A 4F2RA 3DLHA 3H5SA 1TV6A 3J80U 1QE1A 3ABUA 3MD2A 3DLEB 3BO4A 3NNCA 4BGDA 4RJVA 3LWMA 2XZTB 1J5EF 4RLFA 3FBBA 2KFYA 1SKRA 1WWXA 1VQPI 4TKTA 3CD6I 3GTKJ 2JVHA 1LNQA 4MTEA 5LEKA 3FGVA 2EQRA 3EX7B 3CDEA 1FMVA 1JXLA 4FE7A 3U1NA 1PJRA 1MBJA 5J2NA 3J81U 3T1HJ 4G7ZF 5DDGA 1NCLA 1UZHA 2QQAA 1TKXB 3MZ8A 3L9FA 4DQ2A 1UPMB 2AU0A 2QKLB 3LP1B 3MURP 4IRDA 4NXMJ 3DC2A 3OSFA 1RWNB 1R0AA 2YKAA 1HWJA 1FBQA 4Q45A 3IWNC 3ILJA 2CPIA 5H2FC 2WBRA 3HMJG 2WRMA 3LAMA 3KNGA 3ZQLA 4DUYF 2FX0A 3U02A 2HYGD 5F1RA 3CCSS 2MKIA 3NQOA 1H6KX 5KFWA 5L9XA 5BR8J 2NAZA 4R79A 5FLXK 1WEXA 4E4HA 1NJYA 4DR2F 1HR0J 4XRMA 4IOCF 4ZP6A 2PMZA 2FXAA 3BDEA 3SFIA 4A3JJ 3S6EA 1D8ZA 2RUGA 3J7YI 4KTQA 1M1KT 4ES1A 1YW9A 1VF9A 4FYYB 4K0KF 2YX7A 2ZZNA 3S2HJ 2HTSA 2GMJA 1R27B 4KQZA 1MSFC 3RPUD 3HCXA 4M9SA 2ZH3A 4M6YA 2VPYB 1UZCA 3PHEA 4NI2A 1RJJA 5GADJ 3M05A 4HDVA 1YX5A 3ZQQA 4F8RA 3KG0A 3EUNA 3T6JA 4IXAA 4UVBA 1TL3A 5C42A 1LFWA 4ZJOA 2BZTA 3W65A 1I1GA 4F4WA 1XN7A 1WUUA 1ON2A 1HNXJ 1Y1VJ 2Z2MA 4B3OB 1WPKA 4C8ZA 2LKXA 1ACMB 1SJ4P 5L3FA 2HMIA 2NRAC 4X64F 1UHWA 2IBDA 2E1NA 4HDGA 4C7QA 2D41A 3MPUB 2CNOB 5JXSA 3C66A 4RKUC 2Y2ZA 4LSNB 2X6XA 1FJEB 5GMDA 4HRIA 1LUJB 4P2XA 1TVRB 2GXAA 3GPAA 2MGZA 3FK4A 4F0KA 3JAMU 1Q5YA 3OTOJ 2RJZA 1EQMA 1YFHA 2XB2D 1NBEB 2A18A 2U2FA 3M32B 4AE5A 2XS2A 4EYHB 1HIYA 4R1HA 2XMAA 3FMSA 2QA2A 4P1WA 3R3TA 3NCQA 3UDVA 3IKTA 3TX0A 2L4MA 1ZRDA 4KR0B 2OUMA 1R31A 3L1PA 2K40A 4O3NA 2ISZA 3WG9A 4UXNA 4WK8F 3SCIE 2F1FA 4NCGA 4USWA 1TAUA 1D0EA 4FTHA 4LB6B 3OXGA 2Q66A 2IMWP 4I2OA 4DI6A 4MT1A 1NRKA 2MKYA 2R3SA 4BDYA 1S49A 2LU2A 5CCLA 3B6AA 1BHNA 5FD5A 4JI5J 3CNQP 5HQLA 2ZH4A 1WC4A 4RO0A 5EUHA 5D4PA 4O3SA 2ROGA 1R71A 4C3HJ 1RUSA 3GYHX 4OYIA 3PACA 4LT6A 2OSRA 2VA3A 2AT1B 4BXFA 1Y0NA 4FBUA 3KZZA 3PO3J 5F3ZA 3QNWB 2HSEB 2EK5A 3ZQHA 1UA0A 4LLLA 3MMCB 2Z2YB 1MWQA 2MSSA 5FKLA 3TZXA 2CPXA 3B02A 3KIOA 1KOOA 2F8EX 1QA6A 3PRVA 1OPIA 2QLXA 1QDUB 4AQYF 2OPSB 4GMKA 4YDXA 2V6EA 5H9EK 3OYAA 1J9IA 3J7YU 2VD3A 3DRXA 5E8GA 1SH0A 2VKZG 1U3EM 3BYRA 5CYVA 3RRHA 3SBMA 5ETLA 4ANEA 4CICA 1ROFA 4QIEA 2LF8A 4M74A 3KTQA 3IAS2 2Z1DA 2Z2SB 3CUQC 1EKEA 4ECWA 1UMJA 1JHFA 5DRKA 3FSIA 4PG6A 1YBTA 3IWXA 3TO7A 2GW8A 1H2UX 3CCMS 3ULQB 1FT8A 1RTJB 1X1DA 3BR5A 3L4BC 2EXUA 4YFUA 5F64A 3CC2I 2R7FA 3JSRA 4XN3A 4WFYA 2PJRB 3KHGA 3D9BA 1VHFA 2XBPA 4HTIA 2NXNB 3B4DA 2FBHA 2JMWA 3K0LA 3RUBL 1ICEB 2BA9A 3P49B 2C2RA 4N5SA 5IT9K 2ZM6J 1LKZA 5IP7J 3EZ5A 1P6RA 2N8GA 4C11B 1FWPA 1S6OA 1GNKA 2KJVA 4B3MJ 5BR8F 1MMGA 1U8RA 3DBLB 1HHSA 1X0FA 2W9CB 2R7RA 1YW8A 2K9MA 1ZLKA 3B78A 1HA1A 1Y10A 4L5JA 4U88A 3CUQA 1G7CB 7FD1A 2R5YA 5ED4A 2GIZA 2BE5F 5J2PB 3ZQGA 4GRSA 3I6PA 1FKOB 4JX4A 2M8EA 4E7LA 2OEMA 3I4MJ 4QIVA 4ECUA 1S8NA 3AKZA 4QBUA 3PW7A 4QPQA 1EHWA 1SMTA 1O3SA 2VASA 2HFSA 4C8OA 2AJ4A 1WHYA 4Y2KA 4DV5F 4XM3A 1MDMA 1RC9A 3C2HA 2XY6A 4F4KA 3DRPB 1X4OA 4UZBA 3JTOA 1S9GA 5J2QA 1EH6A 2HNZA 4AIKA 4CT9A 2YKPA 2B51A 1VK3A 2FHJA 1LWXA 4Q5SF 2DNHA 1EETB 3F3XA 2HZCA 1FNOA 1PYSB 2QLJB 2K8GA 3D0IE 1UELB 2GA7A 4F4AA 4LFCF 3FJ2A 1YLFA 2RHQB 3BH6B 2TDXA 3J81K 4DSFA 4X64J 1KQ9A 1SB6A 2CQ3A 1I94F 1RADB 5DDOC 4I01A 1AKHB 3VQSA 2V34A 1SD4A 4CUGA 1CS4B 1RTHB 4RW7B 5GTHC 1KLMA 3R9LA 2PEXA 3DOLB 5THWA 5F8HA 1FX2A 5DYMA 2HNYA 1WDDA 3OTOF 1U8BA 1SMYF 1IKXB 3MDFA 3ILOA 3O5TB 3HIFA 4ERDA 2Z33A 1LE8A 2IHR1 1FHTA 2KXFA 3I0RA 2JH3A 3EM1A 3M2UB 4OIQF 3I53A 4AVZA 2OPRA 4B9TA 4MH8A 3VVUA 3DLLF 2VG7A 2YH1A 4AC0A 3TA1A 4Y2MA 1LWEA 1LW2A 4PABA 2FZKB 4DR5F 3L09A 4PWUA 3ZZ0A 3GTQJ 4KKOA 4ZJZA 2XF5A 2A5YB 1CJVA 5HBMB 5HP1B 3CMES 4DV2J 2V9KA 1GXLA 2BVLA 5KFMA 1T39A 4B08A 4C8YA 4AT1B 1YJ9S 4W90B 3BZ6A 3WC0A 3CMMA 1PGZA 4JI5F 2DY1A 2CQGA 2CJXB 3NMRA 1VQ7I 2C2MB 2ADCA 1R6VA 2JSPA 2V79A 3G4SS 3E0JB 1T08B 3NEKA 1F3FA 4CO4A 4Q2MA 2X3DA 3UWTA 5EGOB 3L7UA 3D5RC 4LFBF 4O3MA 3BR6A 1R7IA 4I0WA 2DNMA 4JI7J 1ZOTA 1N78A 2IC3A 4Z2XA 2HPUA 2W48A 2CA9A 3VV2B 5ETOA 1KKHA 5GAGU 5EF6A 4BBRJ 4L3NA 2CZ4A 2IS6A 3FK6A 2XWYA 3ZTPA 2DNRA 4N76A 5FLXZ 4USVA 3VB2A 3K10A 8AT1B 4GKJF 3PYDA 2MZSA 1X4CA 1VQ5S 2WOMB 3FBFA 2CZVC 4DV3J 2O01C 5EWEA 1JKOC 4A3KJ 1K1SA 1V5IB 5CABA 2FBIA 1R43A 4LF4J 3FQKA 4JI0J 1NMEB 2RDPA 2KIUA 1H88C 1R3NA 3CSKA 2XKPA 5ITHA 2JLFA 4WP8A 4M5NA 3QFWA 1MD0A 4B09A 3ABLH 3MR5A 2D3O1 1M5VC 2QA1A 3FXKA 4NBQA 1NHUA 1ZG3A 2FBKA 2VL1A 2ESHA 4UY8I 4ZMMA 4Y4RA 5KTQA 3ZZYA 1U26A 2IA6A 2ZJ2A 4LLGF 4LBIA 2W8LA 3FBNB 1B7YB 2WVFA 4P6QA 3MKWB 2JN6A 5G4DA 4ELVA 4BLGA 4XR6A 1P1LA 1EH8A 3TUIC 4H4KC 3D3BJ 2AXLA 3A4CA 4U9RA 1X5PA 4U0WA 4RW8B 4WFXA 3CTAA 1FDDA 3GJTB 2O61A 1RR8C 1FRIA 3EVOA 3MM7A 5ETNA 4IOBA 3QGPA 4KIBA 4XLNF 1FRKA 3BR9A 4E70A 2K27A 1HWUA 3CDAA 4ZK7M 5E79C 3S2DJ 1T11A 1UTAA 1A6QA 5L8RC 1U7LA 5CVUA 3G1LA 1NJWA 1OCPA 4HKQA 1EKRA 5L46A 2DO4A 2KHMA 4M3EA 1JKRC 5CXTA 1P7IA 2XB0X 2HFZA 2CPZA 2JSCA 3DMJB 3E3XA 4DL2A 3HGGA 1WFXA 3MUMP 5GPAA 2KT3A 1CJUB 2ZOGA 1PUFB 2RQCA 2H6BA 3G8TA 3H3ZA 2W7PA 1K0VA 2DGVA 3GCWP 1S4EA 5ETPA 2KHCA 2A2DA 5E3LA 2FJWA 3IHUA 3F21A 2HFUA 1I5OB 2E1MC 4M5GA 4X4QA 1WHXA 2MQMA 4Z7YA 4XKWA 2GM4A 3L2WA 2P0WA 1BR1A 4HLBA 3CCJS 2A5WA 2QL7B 3RPUA 1MU2B 4YMEA 3FXMA 4XMYA 4DPUA 2DPJA 3IKVA 3KHLA 2DA7A 3PTWA 1U45A 1H0MA 5GTIC 4EO8A 1EAYC 4F50A 1SFKA 2RQPA 3R0JA 3Q0WA 5TGTA 2KIFA 1XMOF 1UW4A 4AVPA 3Q8VA 1U1MA 4QSHA 1WJFA 2A68F 3CDWA 1A6IA 1UVKA 2AJ1A 4BS2A 4DUZJ 3IAM9 1C2PA 4HDHA 1AUSL 4A2UA 5M3FJ 2LD5A 2UVUA 4YR0A 5FKNA 3CMQA 3L9ZA 2WW4A 4E6KG 2JFDA 1IBLF 1N77A 5BYSA 3WIUA 2GZOA 1VIOA 3HFVA 2WTFA 3TDUC 1XCBA 4F02A 2MKSA 2JEJA 1R8PA 4XSZF 3W60A 1E17A 2YPYA 3M8QB 3HZEA 2FOWA 2G0EA 1ZBTA 3HULA 5D4OA 4JX6A 1VQ9I 4ZA1A 3V2UC 5IWAF 5C24A 4RA2A 1BQMA 3I9ZA 3FRZA 2CW0F 1FC3A 5JHFA 1EJ7L 5IT4A 1VC0A 4BUPA 2NXNA 2CPDA 2KRBA 2E1OA 4ED3A 2JPCA 2V4JA 1J5EJ 4L0YB 4YQWA 2UV8A 4JP0A 2XSDC 1F6TA 4ER8A 5F08A 2ZFUA 4OX7A 5IZHA 3OT9A 2VFSA 3NRBA 3T5KA 1MROB 4RX6A 3Q8PB 3WQPA 2XVCA 1HA8A 3HKZD 3Q22A 2KMUA 5JR3A 1KHWA 4NLQA 2MEWA 3I0SA 1CULA 4L5EA 5DCMA 4D7MA 1NPPA 3LALA 2B6AA 5TISC 3T3FA 2HK2A 4UV9A 1IXSB 1VRUB 2FLNA 5GVQA 1N5VA 2MPUA 3T1HF 5ERIA 3P9IA 1CJTB 3KOAA 1S9GB 2A6TA 5J2QB 4OL8A 5JHUA 3M7VA 5BNGA 1KU2A 2GHPA 3GTLJ 4OX9J 3W2WA 3OYFA 2H8RA 1IRGA 1X1PA 4IHSA 1S7EA 4RLEA 1UAAA 4RMNA 3BCAA 4WIQA 1D8KA 3BTLA 3GVAA 3M1EA 3OYMA 4ZVFA 1FNMA 2KJWA 3FRYA 3D28A 4G6DA 3ZCOA 3QJPA 2D1HA 1AKHA 2K86A 5D4SA 5B0DA 1H9TA 4NLGA 4Y17A 4DR3J 2DDAA 2HVQA 1WG4A 3GP9A 2F4VJ 1UCRA 1QHGA 1NH8A 3A3PB 1YZ7A 4K4UA 2DHHA 2NQPA 3A01B 2VH7A 3T41A 2YNFB 3E01A 4PUOB 4ZPTR 3RYRA 1SVDA 5HLFB 3SI8A 5C25B 2EV6A 4OOIA 4XLFA 5D0HA 5A0YA 4NB5A 4XOTA 3HVRA 2E1AA 1EARA 3ZZZA 1UCNA 3GXOA 4KFBB 3T8TA 1R1UA 2H4YB 3AXMA 2ZOFA 2ZOMA 1FX7A 3LOUA 3FMWA 3P8BB 2ABYA 2GWRA 1SC4B 1X0PA 1FWZA 4LF9J 3KE2A 1CGPA 1RIOH 4N4OB 3PIPQ 3AFGA 2GGPA 1JT0A 1Q1KA 2CQHA 3D5SC 1YX3A 4B3SJ 3MD1A 3L2QA 2P7VB 4DUTA 1XC5A 3CO0P 2W8KA 3PRDA 1KFDA 1YQHA 4XL9A 2G13A 1VQKS 3R6LB 1R6RA 4CO0A 1S1TA 2E2JJ 1HPZA 1NK7A 3SEOA 3OFFA 3B73A 4CZZA 3L2UA 5D15A 3MCMA 4PPDA 2UUCF 2DQRA 5EZGA 5DLGA 5H9FJ 1V3FA 3DOKA 1CQNA 4XIDA 1CQTA 3M6XA 1KQSR 3A12A 3V4IB 1AXQA 2JRSA 4P9SA 2HQ5A 4ETSA 1HCRA 1U1KA 5KFQA 3B6BA 5HMYA 3JYTA 1WJAA 3ZMZA 5LXRA 3LPEA 4DPOA 3DGPB 4ID5B 3Q0AA 2K3IA 2A6MA 2AGPA 1X3WB 4JI1F 2HQAA 2F8HA 4NPOA 1O0PA 2B9YA 3G1OA 3C2GA 1HW9A 2XYGB 2WVDA 1SKWA 2XO7A 5FLMJ 4QW9A 3GQCA 1VBKA 2LEBA 3PUBA 3S1NJ 1ZETA 5AXLA 2QA4S 2WVCA 3AAFA 1B4SA 1HKAA 4FBTA 2Z5UA 2CNKB 3MFHA 2VN2A 1TMMA 4NYZA 3H2VE 4BBSJ 2R7OA 2P6SA 3SYTA 4N8OA 2F5DA 2FVSA 4AQYJ 4YB6A 4RAYA 1DQ8A 2OD6A 1U47A 4DYRA 2QLWA 2EWNA 2VUGA 2IS2A 2DO7A 1B59A 1IO2A 2VC0A 2FVQA 4C97A 2VLAA 4XNFA 4P74A 4OINF 3I56S 3BR3A 2AF6A 3CO6C 1BQNA 2EBEA 3NWTA 3HSGA 2M2EA 3K7RA 2LVWA 1T95A 2EB7A 3R6GB 3FVYA 3CD5A 3F8CA 1WJCA 5KG7A 1OISA 2BACA 4ZYGA 5CYMB 4JI4J 4IQ4A 4E7KA 2HOAA 1ORKA 2VG5B 3B54A 3EPIA 1L3KA 2H1LA 1RAFB 3S93A 3C1DA 1GXUA 2R93J 4JV1A 3W5XA 3NP5A 4WIIA 1ETXA 2ID3A 4KYWA 3AL0C 3AA9A 1FP2A 1MNEA 1U49A 3QJJA 4PWWA 3E7LA 4FYVB 3I5CA 3AJ2A 4OMFG 2IJLA 3LFKA 5C3EJ 3OFHA 1UG2A 2IGOA 4TN2A 4H0EA 2UXCF 4A3GJ 1RT6A 4N56A 3GE9A 4OZ1A 3JQMA 4B3MF 2IDEA 5I3UB 3EZUA 5EYRA 2IJNA 3DKXA 1ZLJA 2CQDA 4M5MA 1RKTA 4HL9A 1Y7PA 2E1RA 2DI3A 1D8YA 1VBZA 4OHYA 1LOUA 3HXMA 3KX2A 1Q7YT 3HM5A 2X85A 3DMJA 4RL1A 2W24A 2QBYB 1S0VA 1ZK8A 1Z77A 3DTKA 1L3TA 2HHTA 2EZIA 3K69A 1TNTA 4KISA 2PDAA 2P4WA 3TOQA 1J7KA 1Q53A 2WZ1A 3MD3A 3HSEA 4WF2A 2BY1A 2ZDPA 3GMGA 4U7CA 1RK8A 4RW9B 2LC2A 1JLFA 4O4RA 2W85A 3PG9A 1B0TA 2DBBA 3TQNA 3LSRA 4R25A 2MQ8A 1RT3B 1T98A 1S1UA 1BIBA 4KE5A 4OI3A 3ISZA 3D67A 1WDTA 1SCJB 5FKOA 2RAQA 3IH4A 4Z37A 1J2XA 2RH3A 3FCHA 1JE8A 3MCNA 2QV6A 4HYKA 2X1GA 2M70A 3PSFA 2E5HA 5IOYA 2DXEA 3ZN0A 2R0QC 5I3QA 2V6AA 2ZSIB 4RBVA 2DDBA 2V63A 1G3YA 3DV8A 2ZB9A 4YG2F 1S1WB 1OMIA 3CCMI 1FVQA 5LD2C 1UB9A 1ETWA 3QOPA 3BS9A 2OTJI 1FLIA 4PYDA 2A10A 4B3RF 2HWIA 4P7VA 4URGA 5CZVA 3U9GA 2BV3A 5E3OA 2FHJD 3TQEA 2JA6J 2PSZA 3IMQJ 1IXKA 2EG1A 2UXDF 3CJRB 1ZM2A 3GJRB 3UNGC 1I94J 2YU3A 4WBFA 1HWKA 1T9TA 1PSDA 4BAYA 2R7UA 2ZJPQ 4LQ9A 3OS2A 1RCOB 2QEXI 3I58A 2RT3A 2EH3A 5HLTA 3F73A 1OYEA 3U1DA 2ASLA 1XBWA 1IXRC 3NLCA 2B7BB 2QLBB 5DM7F 4B3OA 5D6GA 3NNAA 1NEEA 4GDFA 2HHQA 3GTJJ 2HWTA 4QYZK 3GTPJ 2HMIB 1W7PB 4LSZB 1U6FA 1Q16B 3CULA 4F7VA 4EGLA 2XMJA 1WTBA 3VR1A 3DFEA 1IN4A 2HVEA 2WVEA 1K79A 4XOPA 2VKVA 1LFUP 1KGSA 4PQUA 1REVA 5HL7Q 4M95A 1DGWY 2HK3A 2UUWA 3FKJA 1BC8C 2PN6A 5DCMB 4K4ZA 1R4MB 1KNZA 2BE7D 2YKNB 1MBKA 4FVMA 4F36A 4ZYEA 2RF2B 4MKBA 4PPZA 4K50A 4EMSA 1CJTA 2E19A 1NG6A 2NOGA 3SCKE 4TXSA 1NB7A 2E71A 1AROP 3K5OA 3T1YF 3HHGA 4J9KA 4NLOA 3P3DA 2UU9J 2JLGA 3A4TA 1F9EB 5FRMA 2GLOA 2XGXA 2YNHA 3ZMDA 1WHUA 1U0JA 3CCUI 2MKHA 1VISA 2VOOA 5B5EC 3BYPA 2CH0A 4RWXA 3MZHA 3NXZA 4BJ6C 2M34A 5LHHA 1HQUB 3Q9VA 3O8GA 2Y0SD 2M4MA 4L74A 5CD4H 4V19K 1AFIA 4BH9A 4OIPF 2COBA 5M2UA 4WZMA 1VQLS 3C6UA 4AUKA 5DGAA 2V5HG 4CSWA 2DH8A 2M8DB 4DLEA 1R1VA 4MIWA 4ZP9A 4YEJA 2EC2A 2FEZA 7AT1B 1B4AA 3GTGJ 3D0HE 4DMZA 3VGSA 3FEYB 4I98B 1HYSA 4PSXA 4J9SA 4KFBA 1HR0F 1U0SA 4DSJA 1G4CA 2BE9B 3HDDA 1U2RA 3H90A 3QQAA 1WHVA 1LXJA 4EO6A 2XSJC 4AU7A 5HMWA 4D0PA 4HNVA 1E6YA 1ZG5A 5D5WB 2ZVSA 1HLWA 2F2EA 4ZYDA 5GAGI 2IP2A 1J59A 1D3WA 2FY8A 2C2ZB 3FFIA 4ZYHA 1K8AT 3N6LA 1BW6A 3RIRA 4ANJA 4I2QB 3MECB 4U8YA 1WOOA 3BPXA 4BL0B 2PD1A 4OU0A 2DT5A 1S1TB 3JSMA 3FM3A 5KFYA 3V42A 5HVQC 2GAUA 2H5EA 4Q8FA 1T03B 1ONVA 3CJ2A 2PMZN 2UXBF 3S17J 1WTFA 3I55S 2PGCA 1FRJA 3RTRA 4FT8A 5KFKA 3OIPA 2DNOA 1NPKA 1TK8A 2I1RA 1MZBA 3BG9A 1Z3YA 1HQCA 5D0GA 3K8WA 2NOJB 3HHLC 1DFDA 4Y15A 4EJTA 4ZDOA 2GV1A 4USKA 1FTRA 2FB0A 1RUOA 2XSJA 3J7ZT 2CW8A 3TAMA 4ID5A 1YQAA 2FC9A 1ETOA 2ZJQF 2CZ9A 1P4AA 2FJXA 2R42A 1HW1A 1SI9A 1XPXA 1D9FA 2M9KA 4YDDB 4DJAA 5J1RA 2DJWA 3X2QH 4PFPA 4C0HA 3CJKA 3IR6B 1P1TA 1NHVA 1FT9A 3CD6S 2XRLA 3HRTA 1H2VZ 1OYWA 2UXDJ 1I51B 2AYMA 1NH3A 1O8BA 1W0TA 3TANA 4WU2A 1MIJA 2BW3B 1APLC 4PK4A 4NE9C 3MR7A 2XIGA 2NZCA 2FGOA 1STZA 2B5JB 1EETA 3GFLA 4DR7J 4GGGA 2QGFB 3CVKA 3BKTA 4YHHJ 2HZVA 2E34A 1R58A 4KT5C 4UY8T 2DYSH 2HVRA 1T02A 1I3AA 3G71S 3IG1A 4PYAA 2HEKA 4GKKJ 3DYAA 1JGSA 4ES2A 3CJTB 1V3RA 5J1EA 5CYMA 1NKCA 2CUYA 1YZ6A 4ZCMA 2D9OA 2QIFA 3SCLE 4UQGA 1GFWB 2R7SA 1WG5A 1SJRA 1Q1VA 2HNYB 2DNKA 5LMUJ 3DPUA 2EC0A 3HI9A 2V26A 2KFDA 2COMA 3FDSA 4KGZB 3AFHA 6FD1A 2DFHA 3DLJA 4WKYA 2OD5A 1EJ9A 2OTLI 2KRRA 3VAJA 1XIQA 3M2UA 3QYFA 1T8EA 2NLWA 2VG7B 4DU8A 2DYAA 4QZVB 2I2YA 4NCBA 4NEZA 2ZHBA 3DLBA 2PT0A 2LYCA 4N77A 2MZRA 2OJED 4DBQA 2DNZA 1GX6A 1VLYA 2CQCA 9RUBA 2BQRA 3SFZA 2IIHA 2MLZA 5KFAA 4ECZA 4IRHA 4DU7A 2EBIA 2P9GA 3UFCX 1K9MT 3MVPA 1X4EA 1OYDA 3OIQA 1XWLA 1N5QA 5IT0A 3QU3A 5E1XA 1VQOI 2BANB 2WSEC 3C18A 2WB4A 2RRBA 3HHEA 2MJUA 4LREA 5KFLA 4UUWA 3D1QA 1QVTA 5KG1A 3SCJE 5EGOA 1OS5A 2CPJA 3J81Z 4KIFA 5K5RA 4LRCA 1RKIA 3PR5B 4X4SA 3IWFA 4USHA 1A6LA 3K5NA 1W5CC 2PA3A 1FP1D 6PAXA 4PGGA 1RHQB 4FS2A 5F8IA 2W4SA 4MO7A 1KZHA 5LGTA 1FVSA 1JJ8C 3NCRA 2DA5A 4LIRA 3GFZA 2BOLA 2FC8A 1DPRA 1TLHB 1NSPA 4NLVA 1OCTC 4PFOA 2V4JC 4E7HA 3GWZA 1PILA 5A8KA 5HS8A 3JRIA 4IEJA 4CT8A 1S6PB 2B3TB 4DV1F 1P9YA 1TW2A 1VLOA 4K4WA 3J7ZI 4RDUA 4K5SA 3OY9A 1IDZA 2J7WA 3HOVJ 2HVDA 5C4JJ 2BBEA 3GSIA 2J5OA 1EKSA 5KVRA 1T8IA 2LH9A 3HKWA 2OSQA 3C14B 3KUEA 3S15J 1PVEA 2XG8A 2DYRH 1J09A 3CMYA 2C2KB 2N4CA 3IR7B 4TU7A 3M4OJ 4OFZA 3MEDB 2XHWA 1W5SA 4RPFA 2N3LA 1NK9A 4X6AJ 2MQLA 1FNXH 1I6HJ 2F65A 2GXGA 3T6BA 4YIIA 5AONA 4UVCA 3PW0A 3CC4S 1T9XA 2QT7A 4C2MA 4ZITA 1XX5A 1WSUA 1N48A 4M8LA 1Y00A 4UB8C 3NGUA 4NC7A 2ZC3A 3EYZA 4F25A 5E3AA 2STTA 3KEQA 1C1CA 1U1OA 2K2PA 1CF7B 4LFCJ 3OR1C 3E97A 1HNVA 1J75A 1MMNA 4DF4A 1WKJA 4U7BA 2K9NA 3IC7A 5DJBA 2WAQA 2UUZA 3WU0A 1P92A 2XZDB 4RUCA 3LF0A 3JRHA 1VRQC 3H3UA 1MMLA 3WU2C 3RB0A 3R2CJ 1QVGR 3MR3A 4PUSA 4EZ9A 2Z16A 2XLIA 1N33F 1R36A 3U1KA 2RB7A 3R2DJ 2DK8A 2NVYJ 4DS5A 1TKTA 3BTJA 2IM2A 1IUFA 1P9QC 1BI3A 1RQ0A 1RABB 1KONA 2LQBA 4MK9A 4ZPVR 2JA8J 4OV6A 2CNLB 2O8KA 3FZBA 2MZTA 4LR9A 4YB5A 4A8MP 3BQ1A 3TP0A 1CVJA 4X4OA 2Z99A 3K2ZA 1TWGJ 3Q23A 2DB1A 4K59A 3PKYA 3NGSA 5AXMA 4A0XA 1PKUA 2OPPA 3MHYA 1FFGB 4ZIVA 2M5YA 4HV6A 2ZC2A 1G2HA 2J9CA 4DR7F 3DQVC 3LO3A 2A69F 5G0RB 2MHNA 3N6MA 2MYSA 2L9DA 2XAFA 2A3JA 1CJUA 1KEKA 2DOEA 3QYEA 1DU0A 4QIGA 1PBAA 2E9RX 4KGVB 1NDPA 5KT6A 1GUUA 1Y5IB 1SC3B 2OFGX 3DEUA 1MSWD 1HSTA 2C1EB 2YPZA 3RDIA 3FEXB 4JYAJ 1Z6TA 3EUAA 2W84A 2HGMA 4V19X 3I71A 3BG3A 2M2BA 1AZSA 3C6UB 1W0UA 2HBZB 3FKIJ 2F9JA 2C2DA 1N5TA 3LQRA 2KTQA 2XY7A 3F72A 2EZHA 4AXIA 3ADAC 5D77A 3I0TA 1M5SA 1QZZA 3OL4A 4QYZJ 5FDLA 2BKOA 3UDEA 1E6VA 2RRAA 4ZLLA 1NU4A 2XC9A 4OX6A 1YITI 3LPYA 3W7BA 1RBOB 1H73A 4F91B 3BGLA 2K4JA 3ZPLA 5CCMA 3JRGA 2J9DA 3ESWB 2Q43A 5KFRA 4F3MA 2O3DA 2OPQB 3W2VB 2X1CA 2FIUA 5M3MJ 1LXNA 2HBYB 2HGLA 4OI2A 1U4BA 2F5CA 4ALZA 2HLUA 3R5GA 2D74B 4X65F 5B0GA 1ZR4A 2YQ3A 1Y56A 1GT8A 4PJJA 1TFWA 3LSMA 5C24B 4TQSA 3WDOA 2ZH2A 1YTYA 3AAWB 2DCUB 4FF4A 2KKOA 3PNYA 1HF0A 3PM1A 5FJ8J 1OCCH 3SQOP 1HHTP 4WFAQ 4G7OF 5DQIA 2GO8A 1TWAJ 3ERMA 4I6WA 1PUEE 1ZGWA 5KFDA 5F04A 3RSNA 5IT3A 3W9HA 1EF4A 1DU6A 3QIPA 4NC6A 3MM6A 2AWZA 2HHPA 3CUNA 4OJ3A 3CESA 2RAEA 3ABTA 4CZCA 3HBLA 2DXDA 2HU9A 1TQPA 1IUYA 3K5LA 3TW7A 2CUZA 3ZTSA 2G0JA 4DIQA 4UB6C 4NMLA 3H5YA 3MPWA 1N6QB 1VC6A 2NSBA 1IKVB 3L3CA 4LBPA 2AX1A 3OTCA 4FX0A 2ELKA 2IFXA 4IR9A 1RAHB 4I68A 4RU2A 3OYHA 2F4IA 4J9QA 2EFWA 4G6VB 3M9AA 3DOMA 3HF5A 3NEUA 2PFBA 3G6EI 1VQ5I 3BF4A 2HZDA 3V7SA 1M0SA 2QGUA 1IBKJ 3AD9C 5B09A 3CUOA 2BKPA 2O03A 1KLNA 2VG6B 4A8XA 2ZBQA 4DWIA 1LWFB 1H8AC 3Q8QB 5D0EA 4PJ0C 4L3KA 1YK9A 4ZH4F 3TZZA 3NAIA 3HC7A 1MN9A 3TZYA 4X4TA 3GX4X 4DHVA 2DGXA 3PFYA 1RRJA 3ETMA 1AA1B 4ZVPB 2J5AA 4Z7CA 2EIJH 2XI2A 2D3ZA 3M30A 2C2EA 4ZDPA 3M8RA 5F0CA 1VQ7S 1MMAA 4NC8A 3PL8A 1JIHA 3ILLA 2YNFA 2EV0A 3FHZA 5KT7A 3MAQA 1UMQA 5HNHA 1WC6A 4IFYB 1AYEA 5FKMA 1IWAA 1W26A 4ZN1A 4Z2YA 2LY1A 4ZDLA 3OFGA 1QUVA 2VE8A 4HW0A 2DJNA 5KFJA 3HOZJ 3ZMTA 1TR0A 4G65A 5IQ6A 3H8YA 1Z3XA 2LFBA 1A0OB 1N32J 2ZH9A 2EINH 3G73A 4ENKA 2NS1B 1EZZB 3ENQA 1A31A 4Y2IA 3Q83A 1NKBA 2NVTJ 1JLAB 1P8GA 2IY5B 5F0FA 3WODF 2ZZMA 3HFZB 4EV0A 1PJ7A 2NYIA 5A76A 3ERED 5F1JA 3QPTA 3OWTA 5FLXU 3M8WA 3GJQB 2VKHA 2M88A 1FXLA 4KBIA 2I9SA 2ZH8A 1NB2A 1AB8A 1VBXA 4QPOA 2IPQX 2JX2A 2ROPA 4NZ0A 2HI3A 3DDNA 3BPVA 1IDYA 3M8YA 4DG1A 4DQIA 1YRNA 3I59B 3MPDA 2YX4A 4FF1A 2OJ3A 4KICA 3BG6A 3DLKB 3HKZN 4ECVA 3C3WA 3NOCA 3KK1B 2JEIA 3DHWC 3A1YG 2ZEJA 1T05A 2M7AA 2M1BA 3BKFA 3DKDA 4I2PB 3EGZA 4KHPJ 2R2TA 3JCUC 2C3OA 1NZ8A 1FFSB 1PDNC 3NGDA 3K2YA 2GO9A 4HF2A 2ZXJA 1FTTA 3CXCR 4MYUA 1OCZH 4YFXF 3E2EA 1L3LA 3A03A 3OYGA 2QF7A 2DGTA 2VQFJ 4Q7AA 3UD3P 4MEYF 1Z7LA 1LNWA 4NL5A 3VAGA 3HXLA 5B0AA 1S99A 2DNNA 4J9UE 1DUXC 4FN5A 2LOOA 2A6HF 1V5GA 2IS4A 2WY7Q 4R8UB 4WP3A 5BPDA 3QFHA 1DTTB 4DSEA 3VAIA 3KK2A 1IJFB 1M5PC 2DU9A 3MM5B 5IFMA 1F4KA 2AD9A 1FRXA 2IA2A 4I69A 1FI4A 4J9PA 5A8WB 2M3DA 4AM3A 2QX0A 4CDIA 4WK3A 2KO1A 2MH2A 2KL8A 2CQ7A 2G7HA 1VGYA 4RW4B 1HXDA 3K5MA 1ZM4A 1N34J 3GZ6A 3GCXP 5KG5A 2G2YA 2MLXA 4MQVA 1M1EB 4CM0A 5B08A 2VICA 2ZJRF 3LGMA 1N36F 3BR2A 3W8PA 3OJUA 2CFOA 1IJEB 2KI2A 2DMTA 1BL0A 5KG6A 3HTUA 1B9NA 5HDKA 1TUGB 2WADA 1ZARA 3MEEB 3K70D 1NK0A 4L5IA 4Y2CA 4FE4A 2AZ3A 4G12A 3ZQFA 3TEDA 3J7YJ 1TKTB 5HS7A 3MMYB 2JZ5A 5E41A 4PWDA 4JBCA 4I09A 2JQ7A 4CLTA 4QYRA 2H94A 2Z30B 2WK4A 5C44J 3OVAA 3KXDA 4OYBA 3M8SA 3ULHA 1QPIA 2VJUA 5H20A 4NCGB 4JV0A 1GMWA 1K78A 4CCHA 4HV5A 3BDPA 4Z6YA 2QBYA 4KAIA 4Y7NJ 2DRDA 3WIVA 1PBUA 4N0BA 3UCUP 4RW6A 1XEZA 2WTEA 3H0DA 3RKXA 2HLTA 3IAS9 4O4GA 3IA0A 3OHBA 2X3GA 4H54A 4C6AA 1WNEA 4BE2A 4BHCA 1E2XA 2QM3A 3DCFA 5HN0A 4GYGA 2QLZA 2HQFA 2DHAA 1DLOB 3IH3A 5KFIA 1VQ4S 2R4GA 3CJ8A 1UVMA 5GAHJ 2XAJA 5H9FK 3OS0A 2QL5B 4IQXA 1LDJA 2QLFB 3QRQA 3RKYA 1FOXA 1DAXA 4WWCA 1PIEA 3CQZJ 4NEYA 5BYRA 5DETA 2GFFA 2I38A 4TY9A 4CYCB 4ZVEA 5C7PA 3T8RA 2JT1A 1JX4A 4FYWB 1MLAA 4CYUA 2M4GA 3U21A 3LAKA 4BJ5C 1E3HA 1I6XA 1MBFA 3MR6A 2QKMB 4YHHF 4CLWA 3GV5B 2QZ8A 3WTUC 4KFCA 3P5TL 4KO0A 3NGKA 2POKA 3UVJA 1ZYRF 3AQOA 2AO9A 1Q4RA 2UUAJ 3PO2J 4NX9A 3HOUJ 4TYBA 2IDLA 1O4XA 2CQBA 3QT5A 4GKKF 2IRUA 4E98A 2KG0A 2CDQA 2P9EA 4BHQA 1S9FA 4LK0F 4MKVA 4M5IA 3QODA 5EEGA 2PFFB 2FHMA 5F27A 5A2QK 3S3OA 5LMUF 2PJRA 4F93B 3OYBA 1DTQA 2Z3YA 2DW4A 4IHTA 1Y0UA 1S9HA 4DFJA 1KU7A 3BJAA 2W7NA 3V7CA 4ZVGA 2ESNA 1WZ2A 4J9MA 1Y4ZB 3E8OA 3FMBA 4IH7A 5EWGA 2K9LA 1XTAA 5DTDA 3G6XA 1KU3A 1JJHA 2XTJP 4KJZA 1XMQF 3H59A 3R0AA 5JUMA 3GB0A 1JTXA 3DBRB 4IJAA 2O1PA 2VQGA 1B0PA 3AH6A 3UN3A 1TQMA 2GNKA 1S1VB 3K89A 2GA1A 4BQOA 2DA3A 1RWUA 2R2UA 2YWFA 1QAYA 2LSOA 3FDYA 2V1UA 2PO4A 1V3ZA 5CH7B 1X9WA 1OQ3A 2LMIA 2ECCA 3SSSA 3DOMB 3TJ8A 1ULYA 2L7FP 4BQAA 3BZKA 1XTZA 1QNTA 1C4AA 4ZVTB 1VZ0A 4LIWA 3KLHB 2LREA 2G0IA 2H09A 4FYDA 1YHQI 2YWWA 2BY2A 4DV1J 3MFKA 4Q47A 4NQWB 3DCAA 2FJVA 1K83J 2Y75A 1IBCB 2E1CA 2Y9ZA 1BGXT 3CCSI 3WBZA 5DM6Q 4FXWA 2QJ3A 3IBCB 3ONQA 4LFUA 2PE8A 1HDDC 2YXLA 4DS4A 2PC6A 3BY6A 1FDBA 4CM2A 4ED1A 2CQ0A 2Y8YA 4A8WA 1ZGJA 5BMZA 4RUHA 2KRHA 1JB0C 1IN5A 4J9LA 3WTZA 2M0MA 1KYWA 4UUTA 4LLNA 2O6GE 1ZTWA 1VQSA 4LF1A 3ZZPA 2BW7A 2F48A 2M7SA 3GIKA 4DOZA 4U7UK 2J76E 1A35A 2DK2A 1TELA 3PYEA 3TNVA 3GG1A 5KFFA 4ZCKA 5JMNA 2RVCA 5AJ3F 4GC6A 1HOMA 3KZIC 2DH7A 1ZZNA 2WVBA 5EEHA 2JZYA 2V2QA 1E3PA 3IH2A 4GO7X 3MKYB 4UT4A 2WAFA 1Z2LA 3AOBA 3TR5A 2E9ZA 4CLZA 4JQFA 3AD7C 2LEAA 2JJ7A 2HDWA 4LR7A 4EM2A 1KBRA 2NS7A 2XYHB 3RU0A 2Q1ZB 3C46A 2W01A 1N33J 2V67A 4P2MA 4AD6A 4ED6A 4M9XA 2G1DA 4IOAQ 3DPLC 2CO5A 2PA8D 4M5HA 1K61A 2JPBA 3MZYA 4CIOA 4QU7A 1KN6A 2CWXA 1BJZA 3I4NJ 2ELHA 4CLSA 1MBGA 3RI4A 3CJ0A 4RUAA 3ZP5A 2X48A 3BGUA 4EZ6A 4NOHA 2ME6A 1GX5A 1WF1A 2IC3B 3GFHA 3DLKA 3MCSA 1OCOH 2RNGA 2HKEA 5KFGA 3ET6A 1YIJS 1FJGJ 3BN7A 4QQBA 1GHCA 2EK1A 3TAMB 2ZJPF 2VUMJ 3MMAA 1UWBA 3MEGA 1UFMA 4YOEA 4Y00A 1QGPA 1SJQA 2QRRA 1VJWA 4XRSG 4ZZDA 3JRAA 2ZITA 4WE1A 1SAXA 4CRJA 2DGWA 3ABMH 1QAXA 2EILH 5K7FA 3TAQA 1MMDA 2RKIA 2CG4A 1U1QA 4DSLA 2BGCA 1D3YA 3LSIA 3N79A 1B0VA 1LEAA 3T5XA 3BSAA 2XC7A 2R8IA 1DTTA 2X1BA 3BROA 4YELA 2Y1IA 1U2CA 1RBAA 1JLBB 4WK1A 3OYNA 3FF5A 2IRFG 2OZ6A 2UU9F 3F41A 2GOXB 4ASNA 2IBKA 4RM3A 2B5JA 4M5JA 3NAUA 3MOJB 4B17A 5B1BH 5CQGA 4MTDA 1HMVA 1WC3A 5LGNA 4OZNA 1X2NA 2FQ3A 3FK7A 2EI5A 3C15B 3P5BP 1LV5A 3VOEA 3WGGA 1R8BA 2B43A 3H98A 1MMSA 2ZWPA 1U6ZA 2X0LA 1AOYA 2RQ4A 5U47A 3OR2C 4ZTFA 4X65J 3KLNA 2HDCA 1U02A 2YNIB 1HBMA 3K6GA 3KLEA 2HHUA 3HHDA 1UG0A 3QYBA 3MXHP 3MQ0A 3MM7B 1T7PA 3IM8A 3HLUA 3JSOA 4F52A 4CLLA 3ZTOA 2I6WA 4ED4A 3M6UA 4PZVA 2HZAA 3G6VA 2DA6A 2F5FA 3A3OB 1T2KA 3M7GA 4DSKA 5H1SV 2N7CA 3I96A 4DR6F