2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
5E3QA 3H7HB 4LSZB 1BQNA 2HRYA 5GPAA 3C14B 1OR7A 1N54B 3IL2A 4EGZA 1S9GA 4PWDA 2WW8A 3ZZOA 3CJ4A 2GIVA 2XC9A 2VJ4A 4C3MA 3QAHA 2EV5A 1T8IA 1N6QB 3K1NA 1ZRCA 3I5BA 2VJVA 3DOMB 5D8HB 1B8IB 2CVIA 5KG1A 2DEIA 5D6EA 4MFBA 3VAKA 2IA0A 1K7AA 1RNLA 1FNNA 2YNFB 1VI7A 3JRBA 2KXFA 4QWQA 1JIHA 2MGZA 3QQCD 1JLGB 1HYSB 4E2FB 2AHOB 2QG9B 3KK3B 4GDFA 4Y13A 5K1YA 3UI3A 4JV5F 5J1UA 4HHJA 5DS7A 4B3RF 2Q1LA 1UG2A 3T1BA 5EZHA 2R8IA 4U0WA 1P7IA 2D41A 4LK1F 3IS9B 4BY1J 5E3RA 3L7OA 4I02A 1FTRA 2DGXA 3BO2A 1W5TA 3MEXA 4WCEQ 3ISND 2J7KA 3QJPA 3PIOF 2DO0A 1YK9A 2R7VA 3FUYA 2KRBA 4BGDA 1MNDA 1SVLA 1I39A 2QSGX 2FJXA 2W01A 2VUGA 1UWAA 1RT5B 3FXJA 3S8SA 3DHXA 1YE9A 4NRUA 1EH6A 5A6WA 1SV5A 3MMAB 2CJQA 1TQMA 3LFKA 1PJ7A 1RABB 2MH9A 2Z4PA 3GF2A 4OFZA 1PIEA 1HDDC 1S1VB 3CC7I 2H48B 2IC3B 4HYEA 1OSDA 3B73A 2EFOA 1P92A 4PWWA 2D3UA 3N05A 1KHVA 1I1GA 2EC0A 2RQPA 3PG9A 4DV0J 1ZM4A 5AJ3F 3T1YJ 5HLTA 3JQKA 3BV8A 2ZFWA 2LKSA 3WTXC 3OT9A 1B0VA 1FE0A 4BJTA 4TXSA 5SUHA 1FYMA 4NZ6A 5A76A 1LFUP 1UG0A 1K8AT 2HFVA 4BXUA 2Z5UA 3MD1A 4WE1A 3HSRA 1NH7A 2B4PA 2M4GA 4FPIA 3K9TA 2HZTA 3BSNA 1VQ7I 2VG5A 2UXBJ 2C2EA 4AD6A 1JUPA 1A6LA 3ZQCA 3OYGA 3K58A 2TDXA 3R6SA 1SUQB 1R8HA 2A3SA 3PW0A 1VQ5S 2O7OA 3DRSB 5CA5A 3GZ7A 4HTIA 3FEZA 1WZ2A 2R7WA 4A0YA 1J5OA 3QPTA 4PQUA 1F36A 2HBQB 2OPPB 1IDZA 5EJCA 3ZFVA 2OPTA 2MZQA 4TV7A 1S6QA 4LLLA 2WVFA 2AXLA 1GXUA 1MSFC 2V2ZA 5HLFA 4X84A 2BE2A 4NQWA 1SFOJ 4Z37A 4LBPA 1FYLA 2K9QA 1X9SA 5E41A 2KM8B 3CO7C 4NWBA 3ET6B 1BOBA 5LXRA 4G1PA 4PGHA 2HWVA 5EWEA 4Q44A 1URRA 4WIQA 2XYGB 4ED7A 3HHLB 2FVCA 2XB0X 2CUJA 5IP9J 1U0HB 3J81K 4ZP9A 2AS5F 2HS5A 3RYLA 1SCJB 4LGWA 2HHUA 4IFVA 3JTPA 1R43A 3T8TA 4UQTA 2XHWA 1T03B 4NLYA 2FSWA 5FFXA 3M9NB 3GG0A 5CXTA 3DFEA 3SCKE 1EQ0A 4EO6A 2GAUA 1JTXA 2EFQA 1NHUA 4HF0A 4CI0B 3QOPA 4HI2A 1QSYA 1HSTA 2VPZB 2E1PA 1YZ7A 3OYIA 2R93J 1WSRA 3MDFA 1TWHJ 3NGRA 4C2UA 1FJEB 1ZLKA 4DNCA 1JHHA 2RAQA 5LHGA 1YRUA 2M0CA 2IYIA 3G9CA 3DEWA 2ZBKA 1PYSB 1Y5NB 1HBNA 1ZRDA 1ZS6A 2XAGA 3GX4X 1U48A 4XSXF 3AG4H 1CULB 3JSBA 2IXSA 1IRFA 2BW3A 2HEOA 3V4IB 1YG2A 3S6EA 1X2MA 1N52B 3H20A 3FFIB 3E5XA 4XDCA 3CJ8A 4C11A 4M5MA 5E17F 3GFJA 4YEAA 2G9WA 4N76A 3CUQC 2JN6A 3VTIA 3W5ZA 2XF6A 3JQMA 3MTKA 4M5IA 3MEDA 4WU3A 4U8VA 1MDMA 2KT0A 4M9SA 2PIIA 3GLXA 3TRGA 4X4SA 2A2DA 3SQGB 4CO4A 1RT4A 1V4RA 1S1TB 2ADUA 2Z2ZA 4BCAA 4QLCU 4F4XA 4B9NA 5IV3A 4U7CA 2XMMA 5DZ7A 4ZKAA 2R5ZB 3N4WA 3KP4A 2RNGA 4FX4A 2VJUA 3NXZA 3V6HA 3MM8B 1Q4RA 5GP9A 3BZCA 4WXCA 2DJIA 3D28A 4L5EA 4Q0BB 3KZYA 4UV8A 2ASDA 3KNAA 1NHKL 2WB1D 2R8GA 1TQPA 4BEHA 3HOTA 5IZHA 3P9KA 2BM0A 3DBLB 1EB0A 5BS6A 5EN1A 5LMUF 4IRGA 1Q8LA 4UUTA 3P5JA 2E2JJ 3DLKA 2L9RA 3BCBA 3VAJA 2Y1JA 2LXIA 2HK2A 2ZD1B 3CNQP 2CFOA 4L5IA 2CA9A 2BVLA 4NC6A 1NPKA 5J40A 3A12A 3AL0B 3EUNA 5E79C 3ZPLA 2K27A 3TW7A 3ZCOA 1C0UB 4QU6A 3J7YJ 2DGTA 3UKGA 5C2GA 4X66J 4JYKA 3BQ0A 1U2WA 3BREA 1HLVA 2AJ0A 4CLZA 2NXNB 5GTIC 2M5YA 1OY9A 4BE1A 1WI8A 3VGUA 2IGOA 2V26A 1F9HA 2A3JA 4EJUA 2MPUA 3DRRA 4CRJA 4NOHA 5DO2A 2VICA 2WV1A 5GMKa 4HZFA 4CXFA 4C2TA 3EM1A 2JUGA 1OMSA 3GCXP 4KISA 2C6YA 2GLOA 2AMCB 4EO8A 2LEAA 2MLXA 3LSRA 3S15J 3OLAA 1BA5A 1FVQA 2KRCA 4KV8B 1BI3A 3BTJA 1HOMA 2M8EA 2I0XA 1R89A 3CJKB 4DWIA 1LFBA 4CSWA 1WD6A 2CG4A 2GXAA 1TAQA 3WHIA 1N0UA 3ENWA 2Y0SD 1BC8C 2IBKA 1AUDA 1T3NA 4FYXB 2BHZA 4U7UK 2XHKA 3GIMA 5ETMA 4ED6A 3D6MB 3HUGB 2ZFHA 2N7CA 1W5CC 2K5CA 3IH3A 2XKOA 1AZSA 3TO6A 4M3GA 2K9SA 4JV1A 1G1XA 4AUKA 2XI3A 3PVXA 3H5UA 1OWXA 2EINH 3EUHA 3OR1C 5JXSA 3CCQI 3WGIA 1XSDA 2ZM6F 4HRIA 2DH9A 3TO8A 1GTHA 1RT6B 1C4CA 2HPUA 3WIVA 2I9SA 3OFHA 4G94A 4FVCA 3HXLA 1WNEA 1FJLA 3P4UB 2AEMA 4OQJA 1RTDB 1SC7A 3NS5A 2I5JA 2LDYA 4J9QA 4NLDA 1RUNA 4P7VA 3H4BA 2RGVA 2RSQA 1R5ID 2VI6A 4B9MA 2N82B 5IM0A 4WK8F 4UY85 2BKPA 2KG0A 4C3HJ 1IRGA 1J9IA 4D5FA 1OJ4A 4A12A 4FNHA 3W6VA 3T5KA 2H1YA 4LF2A 3VAGA 4AU7A 3M3YJ 3CCJI 3A4TA 4U6PA 4DR1J 4XR6A 2N4DA 5L38A 2WB1A 2UVRA 1ITPA 2ZFUA 2WA0A 2CRLA 3GPAA 4RU9A 3M8RA 2YH0A 5GAGU 3MEKA 3E6DA 4HLXA 4YDDB 5D0GA 3ZXSA 3L1PA 2Q6CA 1OCZH 4NA3A 1F9FA 2OZ6A 2HFOA 4NXMJ 3KEOA 3MQ0A 5KFHA 4KA4A 4MH8A 5E3PA 5FKOA 3KP5A 2ZOMA 3CD0A 5ADZA 4P74A 4X4TA 3I96A 1T0FC 2HTJA 2E35A 4PCQA 3KJVA 1S4FA 2L01A 5A8KA 4JX4A 4OZ0A 3CO9A 1XWLA 1QJHA 3BM7A 2PEXA 2QQ8A 4CT9A 1VF9A 3PJWA 1V6HA 3UN3A 4QW8A 5KK1A 2D1VA 2C2OB 4OZ5A 3A1YA 3WX4A 3FXQA 4QR0A 4RBUA 1K1QA 3QWPA 3DTEA 4YIFA 2E7XA 3J80U 4TLRA 4J9PA 3OYFA 2F5GA 3UWTA 4PAAA 3UNGC 2P6SA 2VJJA 3C15B 1JLEB 5KG6A 3M6WA 2HBRB 1KYZA 1BQMB 1MMAA 2MSTA 4F50A 2W82A 3OW2R 1IN5A 1R3NA 1HBOB 5GAEJ 3G4SI 4HDHA 1YS7A 2Y0SA 2V9VA 4X6AJ 1OO0B 3N6MA 1XK8A 2KL4A 3VOEA 4DV0F 1S1XA 2JX2A 4B09A 2NNYA 4LB6B 3T1YF 2VOOA 3CCMI 1NK6A 3CIMA 2GV1A 3Q8UA 3GMEA 4LT6A 2J76E 1IQTA 1CS4B 4M6YA 2NVXJ 4AXJA 3BS9A 5IP6A 2J5OA 1GNKA 3A02A 2LU2A 3BDPA 1IR0A 1NDLA 4E7LA 4BWJA 4L3NA 3RUBL 1C1BB 2JC0A 1QO0D 5EX0A 3D7SB 2STTA 1Y0UA 4ZVHA 3QMQA 4QPXA 1IC8A 3E0JB 5F0WA 3GP9A 3FMRA 1Y1WJ 4CGZA 3S8PA 2HURA 3NGUA 4LRCA 5J2QB 3ZGKA 2IPQX 4WF9Q 4K4SA 4P5OA 3NMAA 4D7NA 3CJ3A 4LSNB 3M8JA 3ZN1A 1NSAA 1IZ1A 4X65J 1J2XA 4P71A 5AE2A 3F22A 2KJCA 1P4AA 3GFZA 1H88C 1JB0C 3RU0A 3G71S 1ZG1A 1WTFA 2NZ4A 2JA6J 1CJVA 5LMNJ 2GIZA 4IH5A 1OCPA 1LW0B 1NK8A 1S4EA 7AT1B 2C3YA 1E6VA 3CCYA 2B3TB 3MCSA 3V7CA 2LY1A 4BE2A 1LVAA 1D8ZA 1NCLA 4WKYA 5C3EJ 3MF5A 3G2XA 3R0AA 1D0XA 5EUHA 4L6V3 3TEDA 2DJWA 4IH7A 1QU3A 4CNZA 1V3FA 2DMUA 1CGPA 1RWPB 4EM1A 3TX0A 2FJEB 2FJAB 4UVAA 1B3TA 4QWEA 2HQDA 1XMQJ 5H6QA 1OQYA 1WKLA 1X4PA 1VC5A 3U1DA 1PCAA 2A6HF 2H5JB 1HNIB 3CJ5A 4DR3J 2FLOA 4A4JA 1PSDA 2DTRA 3I5CA 3DI6A 4PUSA 1VQKS 3FSIA 2ZCWA 2YKNA 4HV5A 2CQGA 1ZZFA 2XSJB 1RAJA 3ABMH 4AT1B 3J7AN 4IKAA 3TW0A 5BYRA 3I53A 3ZQGA 1IBKF 3RKYA 3OS1A 4Q8FA 4ALZA 2JLEA 5GAHU 2OEMA 2E2IJ 1V55H 2F63A 2JT1A 2LXFA 3GFLA 1ZR4A 4RW4A 3KTQA 5B5EC 1T02A 3MWBA 3D9BA 2IRYA 4HH0A 2VQFJ 1S0NA 1TL1A 1RLCL 1GT0C 2VKEA 4DFPA 1WHWA 2FZCB 4RJVA 4O23A 3JAMU 3I0SB 3NRVA 2OPQA 4HACA 1UZCA 2E71A 2B0GA 2P9EA 1RESA 3HFVA 4P10A 3OL6A 3AQOA 4HLBA 5I3PA 3BBBA 3GIKA 4CLSA 5LD2C 3CJ0A 4Q2MA 2D9OA 5SZTA 3IN5A 1RAEB 3UDEA 2B7BB 4ECSA 2VDHA 5J8CA 5IT9Y 2CQDA 3DM2A 1I6JA 2XY5A 3CIZA 4JV2A 1FRJA 1N56A 1WC5A 3EUAA 3D0IE 3ESWB 1S7EA 3CTAA 4ED0A 3S7RA 4XLEA 4WYWA 5L3GA 1FSEA 2HNYA 2BEOA 2V1NA 3MCMA 2ZBPA 2E9RX 2CPZA 1U5TA 5JMNA 3LPEA 2IJNA 2KFYA 3S3OA 5JLWA 1EX8A 3C6TA 4RL1A 1IKWB 3CJQB 2PI0A 2M9KA 3R2CJ 2WADA 2A6OA 2WOMB 3KHGA 2POKA 3DLJA 3LFUA 3DRPA 3MECA 2V2KA 4I2PB 3R9LA 3CMAS 3GWZA 4OHXA 1IN8A 2UXCF 2PD1A 2B9EA 4I2OA 4DV6J 1JKRC 3FNNA 3DGPA 3GR0A 2MKIA 2O0YA 4HNTA 4DQPA 1BWEA 1M1EB 1RT7B 3MKYB 2VFTA 4MKAA 1YQAA 2V6CA 2LDIA 5J6XA 2CZ4A 4USTA 3ZC4A 2LA4A 1H7WA 2YKQA 2M2EA 2JZ5A 4KIBA 2YWFA 2OPSA 1ZQ3P 1UVJA 1TFWA 2I10A 8RUCA 1HNZF 3BR3A 4HLYA 3VAFA 3T1HJ 1EJ9A 4GC7A 1BUXA 4GRSA 4KAIA 1N5QA 4ZVEA 5I42A 2VT2A 1LE8A 2HQGA 2CUYA 2ILZA 2DISA 4NLSA 3BP8A 2J5AA 1K1SA 1P9YA 4HDUA 4WIIA 1UHMA 5U47A 3K7RA 2XEXA 1EKRA 4X4QA 2ASJA 4WWCA 4AWXB 1FDDA 1VQMS 1HF0A 1BI1A 1YDLA 2MH2A 2JA7J 3DMJA 4A3MJ 4YN3B 3KLGA 2OP5A 3C2PA 3FBNB 4U95A 2R2TA 3IWNC 1RWKB 1TBXA 4Z2XA 3K8WA 1HA1A 3MOZA 2WBRA 3LP0B 4U96A 2IS2A 2EA2A 3S32A 4LR8A 2HHXA 3KLFB 2NS7A 2Q8KA 4I2QA 3CW2C 4KY3A 2WV0A 4DHVA 5IQ6A 3SJMA 1ERDA 1G6NA 2IY5B 3R6LB 3GZNB 2HG4A 2J6SA 2Y8YA 4RUHA 2ATLA 3FKIJ 5DRKA 4L18B 4DUTA 3JRGA 3KLIA 2E7VA 3R5GA 3CCLI 3BN4A 3H5AA 3VZIA 1KLNA 4R0JA 4C7QA 2GOXB 3WBZA 5LFAA 4LQ3A 5DGBA 5EGOA 1WOPA 2FB0A 4HNVA 4DR4J 6FD1A 5KFFA 2WB4A 2VG6A 4ECVA 3IP4B 3R7NB 2QX0A 3NOCA 2H94A 3GLJA 2XYPB 4M3FA 1IQZA 3GTKJ 2AT1B 3NOGA 2ZH6A 4AE5A 4PJ0C 4S0MA 1BJZA 1UAWA 2VONA 3IRRA 2BYVE 1U09A 5L3CA 3SYTA 3EE3A 3P5TL 3DOLB 4DR1F 5K20B 4P2SA 3EQLF 2B63J 1KKHA 1NJZA 1LNWA 3W2WA 1VQ8I 3V6DB 3L2WA 4F67A 2JVGA 3A1YG 2DCEA 5B0AA 4PWUA 1FHTA 1ZKGA 2C28A 3DLBA 4NXMF 3GMGA 4CQ1A 1DJ0A 3IG1B 3J7ZI 1WKKA 1R36A 2ZE2B 3BR9A 2GBYA 2R2SA 1M5OC 2AJFE 5L1LA 3HHEA 5A8WB 1OCCH 4G8XA 1U0JA 5B1AH 3GVAA 2DA7A 5L1IA 2WY8Q 1FWZA 1BM9A 1IWAA 3CCTA 1AXQA 4RLEA 3AFGA 3GXOA 4OV1A 4A0XA 1V54H 1J5EJ 4B44A 1Y3KA 5KG4A 2A2CA 4LD5A 3FHNA 4A3BJ 2I6WA 3GB0A 3NGTA 3I54A 5IYBJ 3M30A 2JRTA 1JJCB 4B3SF 1RWUA 1NMEB 1ULRA 2GGPA 4DSIA 2XM3A 1D8YA 2XG8A 4YRVA 2HZAA 1PG5B 5B09A 1K0TA 2GVZA 1BIBA 3JREA 2LLKA 3JRIA 4LITA 4ZJQA 4B3TF 3QSYB 1PUFA 4A6DA 1WSVA 1REVB 2O66A 4DSLA 2LD5A 3C46A 1W4MA 2JRSA 2K06A 1GK8A 4A8SA 1YJWI 4PG7A 1FBUA 2DN0A 2BY3A 3BTIA 4LOCA 3J7YU 3B4DA 4YFKF 2XF7A 4OYAA 3BT9A 2XWYA 4ER8A 3C6UA 1UMJA 3CF5Q 1ETXA 1SJFA 2WONA 4ZVPB 4DQIA 4UF4A 1OKRA 2VJIA 2LVSA 3PUBA 5HP1A 4U7BA 1O0PA 1Q7YT 2FDNA 3I56I 2QRRA 4IG3A 5IT9Z 4CM0A 3GV7B 4ECWA 4ZC3A 1X5TA 3CD6I 1POGA 2UUAF 4X65F 1YJ7A 4I1TA 2HLTA 3O3LA 2B5JB 3SDBA 1A9NB 4FETA 2XWXA 1UWBA 2LY9A 1XDUA 1RBLA 3OQ2A 3DEUA 1UCNA 2AJ4A 5K8NA 4RUCA 4BDPA 3THVA 3H5SA 4JI6J 3EDRB 2ESNA 4K4XA 3SCIE 3A8KA 4HQMA 4G7OF 2O1PA 1NJIT 3U1LA 3A03A 3C18A 3FM5A 2QQ9A 1WG5A 4LG0B 1UFWA 3DOKB 2HFUA 3HXMA 3PJRA 2E44A 5B0BA 2E36A 3CESA 2QL5B 5DUKA 2MG4A 4IG0A 4FS2A 2IA1A 3TP2A 5EEAA 2BYCA 1I3OB 2XV4S 3PM1A 3L95X 2OTLS 4PABA 1VQNI 1OCTC 1KQFB 4F2RA 3Q83A 4C2MA 2UXDJ 2IFXA 2JPCA 4ICLA 4MKVA 1YITS 2AO9A 3ETMA 4MIAA 2YTCA 5F8HA 4NBQA 2ZSIB 3C3LA 2QL9B 1X3ZB 3MMBA 5J1EA 2VN2A 2P9CA 3PHEA 1N77A 1W7PD 1FWLA 4KFBA 1W1WE 2ELKA 2C3OA 1EQMA 1KU9A 4DR3F 4KBIA 4RAZA 5C42A 1Q81T 2BVMA 1R58A 2OQGA 5GADI 2W7AA 5DV5A 2AQ4A 4M3EA 5E33A 3EPZA 2IAJA 3K7AJ 2B9SA 1RYSA 1U1PA 5ICGA 3QQAA 3IR6B 4WP8A 1S59A 3KG1A 2Z3YA 3TZYA 4OI2A 4MEYF 1UHSA 3K6GA 2FMYA 3FQLA 2ZH5A 1KEKA 1LWFA 4KRWA 3PR5B 4G7ZF 1DDNA 4Y3CA 4PG4A 1QE1B 4X4UA 2V4RA 1UW4A 3OIQA 4ZN3A 1U6FA 3MPVA 3CF2A 2JPBA 2WAFA 3WG7H 1R5GA 2NUUG 4QR2A 5JI6A 3D6FB 2V7FA 2CPFA 1RTHA 4A47A 4B43A 2RRNA 1RADB 4OHZA 3LL7A 2YNHA 4ID5A 3LAMA 4BH9A 1RHUB 2V8PA 2YVSA 3V42A 1T95A 2UZKA 1T2KA 2JFKA 3PACA 4XLAA 2W24A 3MM9B 3MD2A 2MQMA 3EPGA 1FMVA 4QBUA 1IV8A 2RU9A 2CO5A 3X1LB 1T9VA 1VJWA 3O6BB 5HMXA 2A6EF 3CMES 1SIZA 3KMSA 1R31A 4A8OA 1HFEL 4TNOA 3BGFA 4R0EA 3GONA 2KDZA 4D3HA 3DKYA 3KWMA 3CCEI 2DRDA 3CCVI 3N4MA 4QW9A 4O3PA 4NYOA 4KT5C 2CRGA 2KVQE 1TC3C 4YUDA 2HGNA 4NLGA 1M90T 1KZHA 3K59A 3Q0AA 5EZGA 4BNCA 4XK4A 3G1LA 3WE2A 2IIHA 4I09A 1RYRA 3VR1A 1MW7A 2QA4S 4AXIA 4J9MA 3WODF 4ATNA 4DQ2A 3ML6A 4P6QA 4DX7A 2LC2A 2CJYB 5CYMA 1NRKA 3ZZRA 2U2FA 2K7JA 3K4NA 3Q0WA 2GW8A 2GJ2A 1MMLA 3UD4P 3KOAA 1SMTA 2EIMH 4I7FA 1S9GB 2H4YB 3ZQLA 2ESHA 5D0EA 4CZCA 4X4PA 5HK4A 3RW7A 3T1HF 1IG7A 4J9KA 1KGSA 5FD6A 2BMBA 2MHEA 5C2CA 2DGVA 4IRKA 4EQQA 3W65A 1K47A 4QOTA 1KQKA 2M0MA 1HMVB 4F7VA 5AE3A 4Q8EA 2XGXA 2QT7A 2EVZA 2KLOA 3ERED 4FTHA 5FKLA 1W7PA 3KDNA 2F48A 3M1VA 3K1PA 2O61A 4X1EA 5DCMB 2CH0A 3RTRA 2NS8A 3BY6A 4RU2A 3KEQA 2UUTA 3N5FA 5F1RA 5DUIA 1U1OA 3VAIA 1X9MA 1CQNA 2E5LJ 3I4NJ 2HWHA 3VWBA 2E5IA 4KJIA 4FP9A 1FFGB 3CF5F 3A8IA 2ZJQQ 4RWWA 3HJEA 2OCCH 4IQMA 5B0FA 5DDPC 2AYEA 3ILOA 5D15A 3GFHA 1LVKA 3IM8A 4O44B 4CDIA 1ONVA 2YWEA 2Z0GA 3ZMZA 2MKYA 5DS9A 1PDNC 4J9VA 2ZSHB 2OQRA 2MQ8A 1U6GA 3T5XA 4IOAQ 4XIUA 4I76A 4LFCJ 3DKDA 3TNVA 4KGMA 3CO6C 3KEYA 2FUG2 3FSXA 1FYKA 1ZRFA 4ETZA 3BQZA 4YB1P 3G8TA 1MN9A 2XMTA 2C3UA 4F4WA 2JL9A 2M30A 4DR4F 2E1MC 1A35A 1HKTA 4DUYJ 4KB7A 3FDYA 5HS9A 2FMLA 4UTGA 3C16B 3QPHA 1HNXJ 2HNZA 5BR8J 2Y30A 2DGOA 3MUMP 4CCKA 1XMBA 2BXJA 4C97A 4ILLA 1JLAB 3NEUA 2PT0A 4X62F 3TDUC 3UQSA 2EBIA 4IEJA 1YTYA 4JOMA 4KE5A 4HF2A 3U27A 4BHCA 4A8WA 5F8MA 4M95A 4II3A 2RHSB 3IRQA 4AFFA 2KH9A 5KFTA 2EKYA 3BG9A 2IM2A 4PJLA 2M70A 4RB1A 4EBEA 1DP7P 3HMJG 2LKPA 3BH7B 5EG0A 2HIYA 5K7HA 2XAFA 4QSHA 4KO0B 4H4OB 1LEAA 1R7IA 4WE1B 4B3MJ 1N32F 2ZXHA 1FK9B 2FU4A 4X4OA 1GX5A 4P9UA 2TCTA 3H9JA 5K14A 4DU7A 2F4IA 4B48A 5L3FA 4NLQA 1FIPA 5L3DA 4NNJA 3HPOA 2FQQB 4GMKA 5CAAA 2VPLA 2Z56B 3BGRA 5F3ZA 4OINF 4Q48A 1HQ2A 2EV6A 5KFJA 1S5ZA 3H36A 2ZDOA 3I31A 3F0CA 4DJAA 1USTA 2UWMA 4Q5VA 4U7DA 1X31C 4URQU 3E3VA 4GVBA 3TP0A 3OVSA 2DT7B 1BMQB 4YR0A 3MM5A 2XZWA 1SVOA 2VKZG 1RWMB 4B9LA 1U1LA 2XQCA 4IPAA 2OFGX 4UB6C 4BQQA 4GFBA 3BDEA 3CDAA 2ZVIA 3BG7A 5LSRA 3R3TA 2J0SD 5HLFB 4LF6J 4UZCA 2COLA 2E9TA 2DNRA 3I6PA 5KFDA 4DR6J 3A0HC 5CZXA 1U1MA 1HD1A 1MMGA 1U6BA 1R6RA 2LLZA 4YY3J 3H59A 3J7Z5 4M9XA 1XDSA 3ZQQA 4XPCA 3L2VA 3KLEA 1E6YA 3P9CA 2H27A 3H2LA 4A3IJ 2MQOA 3WQPA 5ERIA 4PXEA 3W6JB 2D1HA 2I2YA 2FHOB 4XO0A 1D9AA 2IRFG 4NCBA 4EGLA 3QT5A 4J37A 4ANCA 4NLXA 5BJRA 1T05A 1FY7A 2IS1A 4NA2A 2W2QP 3TVZA 2UUBJ 2XB2D 5FRNA 5G0RA 1J5YA 1P1LA 1XSVA 2DY1A 4JI3J 1T33A 4L0YB 4B47A 2RD5C 3ZRGA 3DXJF 1XMXA 3W1YC 5DQGA 1NU4A 4GVLA 3FXRA 4NLPA 3D1QA 2WWYA 3CMMA 3MMJA 4EZ6A 2P7CB 5HROA 3ENQA 4IFYB 3GBGA 2DGQA 2ACMA 3GJQB 2D7SA 2MKKA 4FASD 4ECXA 1N34J 3MWMA 4XAKA 4WK1A 4QIFA 3R6GB 4NI2A 4LR7A 1JT6A 3AA8A 2ILYA 2HW3A 1RCOB 2K3FA 2RAEA 2F8MA 1T9TA 1WG1A 4NL5A 2LEPA 3MM7A 1VOMA 4OX8A 5J47A 3DKXA 1FKOB 3TA0A 2AP6A 3QYFA 4HYKA 2LY2A 4CICA 5L39A 3TL4X 4NXNF 3DHWC 1M5HA 3HBLA 1GXPA 2JOQA 2NREA 4L5JA 1LWEB 3FKBA 3EICA 1FE4A 3IBFB 1UKUA 1KWMA 1I50J 2VLAA 1Q95G 3K0JA 2QENA 4ZYEA 3D1HA 4NASA 4FZVA 4OLOA 2DH7A 3EGVA 2XLKA 2UXDF 1FFWB 2F8EX 5E3NA 2FJBB 1IKYA 2ZHBA 4RNMA 1UZDA 5HS7A 4LMYA 4ECZA 2DOFA 5CKTA 4BL0B 3DYAA 1ZM2A 3Q24A 4EM2A 2EILH 5L3EA 4I7HA 2DW4A 2M8DB 5B66C 2DHSA 1UJ4A 2QQAA 4A48A 1VQ9I 2ZDPA 5IWAF 1WRJA 4B1RA 1VBZA 5BYSA 3BR6A 2MHNA 5E8GA 2ZJQF 4C3JJ 2B4OA 4FYVB 3Q22A 5K9FA 4CLFA 1MBFA 2CUZA 5KAFC 4USIA 1WJAA 1RT3B 2CPEA 3EVWA 4OYIA 4U67Q 1HNWJ 2FVRA 2HHPA 3OR2A 1X1PA 4RMNA 4IOAF 5KCMA 1JLQB 3BCAA 2MA3A 1U49A 4IHTA 5HDNA 3DRRB 1UVMA 3OUYA 3BBFA 2NVUB 3I59B 3VWSA 4KIFA 1HQEA 2AU0A 4K4ZA 5H9EK 3TEGA 2P5VA 1IW7F 1QVUA 4D5CA 3QGPA 4LK0F 2GA7A 2YH1A 1G4CA 4ANDA 2HAIA 3GFYA 1LKZA 4DV3F 2FNAA 1WF1A 3TR5A 2F9JA 2NYXA 3V5RA 1UCRA 1JLFA 5FLMJ 2B6AA 4OJ3A 1VQ7S 5KT5A 1G2HA 3CLOA 1VFJA 2D1CA 5AONA 4DR7J 5L46A 5E1XA 4YHHJ 2DR7A 3SZ2A 1Z2LA 4WPAA 1U1QA 2C2MB 3PW5A 3M07A 1UA0A 1AZSB 4K7QA 3HVAA 3S2DJ 1V3RA 4KHMA 2CIMA 3MMCB 1N5SA 2L9SA 2O03A 4HBLA 5KFWA 3AOCA 1GXTA 3K10A 1NB2A 1YIOA 3TAMA 4WFBQ 2VC0A 1P27B 2I38A 1AA7A 2DR9A 2UVVA 1K79A 3I9V9 1ETVA 1TL5A 3WGGA 2OU2A 2VG7B 2OMOA 2DTJA 4CYCA 1Z1DA 2VOPA 2VPWB 2ZH1A 3KLVA 4IX7A 3VCDA 2I5JB 4KYWA 5HNHA 1ZM9A 1RBAA 1FX4A 1SH2A 1XR6A 2QSFA 5HS8A 1WCMJ 1IR1A 3LWFA 2XIGA 3KLHB 2IRUA 2KIMA 2L0KA 2K9MA 3WHCA 4PEOA 1BXNA 2AYGA 4DXLA 2IVMA 4FF1A 2DYSH 5IM0B 4FISA 2FE3A 2LFVA 2RS2A 2C2RA 4RBTA 1VTNC 1XPXA 3JW4A 1QHHD 9RUBA 4IDKA 1H8AC 3KIOA 3IWXA 4DV1F 2G2YA 3H5NA 3HT0A 4EUVA 3SQOP 2YQ0A 2X1FA 3CJRB 2J7WA 4D7MA 2MKJA 2PMUA 3CVKA 2DNQA 3VDXA 3CCZA 3CJTA 3PFIA 4GC6A 2WVBA 4M5KA 2I1RA 3AB2B 1QQIA 1HQUB 4EJTA 1FX7A 4ZH4F 1PVEA 4LSLB 1FKAF 1SL2A 1X1BA 3WTZA 1EHWA 1F9EB 2BANA 4IO9Q 3HTSB 3AJ2A 3ISPA 3ZQ7A 2J0QD 2FOWA 5CPRB 3U1KA 4Y34A 1T8EA 4UY8T 2MKSA 1SH0A 3VAHA 3I87A 5HMYA 4EI2A 2K4BA 2PI5A 5GAGI 4ZDLA 4IZZA 2OBPA 1N5YA 4B3OB 4ESJA 3KJVB 3ECOA 5D8LB 4ENKA 1FFSB 3JYTB 1WUUA 3AODA 2GO9A 1KSPA 3SFZA 5A0YB 4DX6A 2AGOA 5CYQB 2RREA 2HVEA 1VQLI 3BC8A 2B4VA 5K8OA 3FRZA 4ZPWR 4DCOB 3KK2A 3C19A 1L0OC 4CA0A 4MIBA 1IRXA 2HGLA 4RS8A 4CH7A 1Q8IA 3KK1B 4M6VA 4ZK7M 3KZZA 4QWBA 3ITHB 1T94A 1JKOC 2DIVA 3PFEA 3QYYA 2PMWA 4N9IA 4DUYF 3F41A 3M2VA 1YJ9I 2WAQD 1HNXF 2EEYA 2BZ2A 5A2QK 1TKZA 2DMPA 1ON1A 2NXUA 3RJPA 3A13A 4M5DA 3W62A 3HOSA 2YR2A 2EPIA 1RBOB 2DPJA 2ZXWH 4M94A 1TTYA 1S1XB 4A46A 1FCAA 3KP2A 4CUGA 1YJUA 2IDEA 4RW9A 2NOJB 3MR2A 1F5CA 3RDIA 2DFFA 1F9NA 2G2OA 2RU3A 2DNMA 4BS2A 2FC9A 3AT1B 4A3EJ 4X64J 2XRNA 4OX9F 3L09A 4HL9A 1OY8A 1FOXA 3SEQA 5F0UA 4FPRA 4FBTA 3SI8A 1Y6IA 3FX3A 3S1MJ 3REOA 2ZWPA 4Y52J 2DA2A 4PPZA 1YOVB 3QIPA 3BKTA 2C42A 1REGX 2LQBA 4U0YA 4IHSA 2R2UA 3GYNA 4PFOA 3H8YA 3LW5C 2EWHA 4LFBF 3F72A 3KPHA 2OD4A 2YX7A 2ZNZA 1IRZA 3SFIA 1HW8A 3BR5A 3G1MA 1EP4A 3QT8A 3TVKA 2X4HA 2GIFA 2D2WA 1D0EA 1V5EA 1HHTP 1Z7LA 3I0RB 1FJ7A 3BTLA 2VA3A 1ZG5A 4USMA 4K4WA 2E9ZA 1RTJA 3EUKL 1B0TA 3OMYA 3JSYA 1N33J 3I4PA 4AYBD 4A2UA 1RR7A 1E17A 5HN0A 5H20A 5LM7E 5K5RA 2CZ9A 3J80Y 2DGUA 5JR3A 3OIPA 5LGNA 3PCOB 1PBAA 2R9LA 4GRIA 2HRUA 4LF6F 4ZVQB 4ZVUB 4J01A 4DCJB 4DR6F 1KQ0A 1D1BA 1B72A 5D77A 4HT7A 1VYAA 4YY3F 3C2HA 2DCLA 5F27A 2QIFA 1KQGB 1SEUA 3NGKA 2ZH9A 1RGVA 3R8YA 3ZZ0A 1TVRB 2QL7B 3KX2A 2KP6A 2HFHA 3H0DA 4PR6A 1AKHA 4E4HA 3CCQS 2Z2YB 3WZ0A 3GEZA 3M2UA 3CCUS 5CYJA 5A8RB 2AGPA 2CG8A 2DNKA 2HVZA 4Q45A 4A93J 1NPRA 2RF2A 2CV2A 4H4MB 4RM2A 1TK5A 4P9SA 1HW9A 4USWA 1WSUA 2XNRA 2UUBF 5IT9U 4RGXA 2SXLA 1DPUA 4JI3F 2CQ4A 2B43A 3V81A 4MTEA 2DMQA 4Y6IA 6PAXA 4NDLA 4DV2J 1G8XA 3OTBA 5RUBA 2X48A 1OLTA 2LCWA 5E2QA 3KNGA 1XNQF 3L3CA 2KXNB 3OL4A 4RBOA 2QLBB 2M45A 4DL3A 1SL1A 5LBQA 1U9NA 4ENMA 4RNHA 5LJ5Y 1KLMB 4XLHA 5JHUA 1N34F 2W9BB 2NLWA 2FPHX 3BPVA 1KFDA 5E3AA 2W2PP 2WB1N 3CCJS 3UPFA 1H2TZ 4ZOSA 3QLHA 2WAQA 4HPQA 4JB8B 4F25A 2OH2A 1XGNA 3UNYA 3KHHA 1G3OA 3VGVA 1DURA 5HMWA 2P6TA 1TL1B 5IV4A 2DFHA 1IKVA 3M8SA 2V4JA 3HKZA 3MCNA 1TT5B 3P3DA 2PQ8A 4P2MA 1LQ1A 3CMYA 3CUQB 4HACB 3PRDA 1NSPA 1UHWA 2XGEA 3NQOA 3VV2B 3FZ2A 3KP6A 1S72I 5KFRA 4IXAA 4CO2A 3RAXA 2BX6A 4YR3A 3BG3A 4L9JA 4B9TA 1X4CA 1GV2A 1EETA 3PXGa 2J0WA 2IW5A 3GJRB 4C8OA 3A0BC 4K4TA 3UFCX 4K4YA 2CKWA 4F4KA 2TRTA 3ZTOA 1A6QA 3HZEA 1Z7UA 2CQ7A 4IO9F 4ECRA 3F8MA 2HNYB 3GIIA 3TOQA 4JI5F 1NNDA 4MTPA 2CXEA 1CJKA 5E0OA 5ICFA 2DNPA 2FC8A 3SXLA 4XICA 1Q1KA 3C6TB 1SVDA 2E5ZA 3Q0UA 2PN6A 1YJRA 5HMZA 1LWCB 2L7MP 1S1UB 4AYBA 3MECB 3HSDA 3MR5A 2R4FA 1AYEA 3DQVC 3DF8A 1FRHA 3RYPA 4PZVA 2Y0SN 2CQKA 3HJVA 1HNWF 2HKOA 1ICEB 3G4SS 2HS4A 1U8SA 3RB6A 3F9KA 1BI0A 4WYLA 3NG8A 4JBAA 4JI2F 1T56A 3LA3A 1SXLA 3CCMS 1A6IA 1ZREA 4PRFA 2OPSB 1EA3A 4E7KA 4DZJA 2H51B 3DGVA 4YMEA 2ZHAA 1GXLA 2YKMB 1HNVA 1R0AA 3O44A 3HRSA 4USKA 3WE3A 3PEJA 3JAMY 3DLEA 5I42B 1D5VA 1NJWA 4PSXA 5HBMB 1OR7C 3BZKA 2OV7A 5FJ4A 3PNTA 2GQQA 2MZSA 2CSOA 1OYIA 3CP2A 4M5LA 2X1AA 4DR7F 2N4CA 3U9GA 9ATCB 3OOUA 4HDVA 3KJNB 5DZ6A 5EX3A 4ZTFA 1JUMA 2OUMA 5HNFA 4Q2LA 3P96A 4OZ3A 4XPEA 3DMJB 1QZEA 1N0VC 4ZDNA 1SPBP 3LWMA 1GV5A 5DD8A 4OMFG 1FWPA 3H0PA 3OXGA 3D54A 3RQ4A 3HLUA 3LP1A 4DV7F 1YW9A 3FKJA 2RQKA 4ENNA 3OTOF 1X1AA 1SB6A 4TN2A 2A5YB 2GVDA 1MWQA 1TTHB 3QJJA 1TKXB 1FEHA 4W97A 2IMOA 1LWXA 4I2QB 4WXHA 3OR1B 2DRAA 3J81Z 3KYLA 4ZITA 2W4CA 4PK4A 3OFEA 4AQYJ 1S1WA 2L7KA 4KIGA 1CQTA 2FHJA 3KLIB 4YFXF 1RR8C 2QMWA 2DPIA 3A8EA 4YB6A 4ED2A 2O01C 5TISC 1LDKB 4EBDA 2M3AA 4TU7A 1I3AA 4V2FA 4ZYHA 3MZ8A 3M8PB 5H9FJ 3GCMA 3OV7A 3LSGA 1RKWA 3PQKA 2OTJI 3PX4A 2V67A 3QRFF 4UVCA 1EF4A 4PSWA 1RTIB 1FSHA 2DK2A 2GZWA 4ZYDA 2Y9YA 1YRXA 5D6GA 3OHAA 4ECTA 4G6TB 1JT0A 1Z67A 4GXOA 5HL7Q 2K4JA 5THWA 1C1CA 3W2WB 2XVCA 2MQLA 4G65A 4OJGA 3BZQA 1B9MA 3QGIA 1QVTA 4L74A 5ETKA 2BQ3A 2ME0A 4D3GA 4G1QA 3UE2A 1SFEA 3AQPA 1TL8A 1PC4A 3DWLE 4F7ZA 1ETKA 5FFZA 3OYJA 2CQPA 3RZOJ 4RW8B 1GT8A 2A05A 2CUFA 4IRDA 2BE7D 5BPIA 3TVYA 1I5OB 2CFXA 1U8WA 2HYJA 2C2ZB 2K86A 4C98A 3GR1A 1ZH5A 5K8PA 3KFWX 3SYZA 4JI7J 4LJZF 1OMIA 1FP2A 4IO1A 4K0KJ 1MU2A 5JFRA 5LSLA 2IM1A 2L9VA 5LRRA 2KG1A 2MB0B 4PDKA 2QV6A 1Y10A 2E7WA 3C3WA 4WP3A 3N01A 5IPAA 1ZR2A 4RNFA 3BWGA 1Q8KA 1FNMA 2HDWA 2K1RA 3TJAA 2VBZA 2Z2MA 4OYZA 2GGPB 3MKWB 3CJSA 3GSIA 1IXRC 1KVIA 1ETYA 1TK8A 1TKTB 3P45B 5C25B 5F0CA 1RKTA 1FRKA 4O0IA 3K5MA 3K5OA 1VK8A 2CDQA 3ZTSA 1YHQS 3BQYA 1XEZA 2PJRA 2BVZA 1PUFB 4ZYGA 3BJYA 3QPLA 5D3GA 1ETQA 2NUHA 3DRYA 2KHMA 1PJ5A 5FLXK 4PQAA 3EJMA 2BXZA 3G87A 2V68A 2BOAA 3U1MA 2DMTA 4ZPBA 5KFVA 3BSOA 1TR0A 2E1OA 1LW2A 5KFYA 2GAGC 3EGNA 3A3PB 4Y2MA 2AX1A 3CSKA 2DR5A 5D8KB 2WONB 3C14A 2OEJA 3H35A 4A3JJ 5C24B 2J6UA 1U1KA 2LBFA 1ETWA 3F6VA 1NJXA 3GTMJ 3K5LA 1QDUB 4CCLA 4P55A 1YYVA 3J7YI 2CU7A 4C0HA 3BQ2A 3DOMA 4WCGA 5KHDA 2XY7A 3PEHA 1TELA 1RK8A 1Q16B 1RHKB 3F44A 3KXDA 5HVGA 2YU9J 3G1OA 4DLEA 5GAGJ 3ISZA 1HYSA 2N3OA 2HOEA 3BB5A 3KK3A 4FVMA 3CCWA 3V8KA 3NWTA 3EVMA 1IN6A 1N33F 2DXEA 3DLGA 4I4BA 4J9UE 4ERDA 2X1GA 3H98A 4IOBA 5JHFA 2O8XA 2IJRA 3WX8A 1K6YA 1H9GA 4XKWA 3AA9A 3IS9A 4UOFA 3NNHA 5AXKA 3OYDA 1N48A 4JI8J 1LEBA 3QO9A 4ZIWA 1KS2A 3LAPA 2RDIA 4ZLNA 2FJWA 2DNZA 3HJFA 1XN9A 3JS9A 4DV4J 3G82B 3GWCA 1QNTA 3M05A 4CO1A 1P7JA 5ILSA 1WI3A 1HKQA 1KRPA 2W48A 2V1UA 4ICLB 3FXMA 3QWLA 2KJWA 4A3KJ 3MEGA 3MMAA 4XN0A 5EDNA 3T6JA 1XN7A 3PV8A 2DA3A 2V0NA 3MMBB 4LBHA 1KU3A 4FKYA 3EYZA 2W8KA 2DCUB 3GTOJ 2IAIA 1Q86T 4KFBB 4RKUC 2VXZA 3ILLA 3M1EA 2Z33A 4MHGA 2V9WA 4B9SA 3CCLS 4DV2F 2DU9A 1RC9A 4ES1A 4EJWA 4LIWA 2QF7A 4A8MP 2WVDA 4DN9A 3RB0A 2D9PA 4MQVA 2IAJB 4DPWA 4KN7X 1ZPWX 1OCOH 5KFIA 4CCHA 1PKUA 2AYMA 2R7SA 1WEXA 3RKQA 3RR8A 2RRBA 2MZJA 3QPSA 5AXNA 2KZGA 5EYRA 3B82A 2PMZA 3QPIA 2AZ1A 5FDLB 1FOYA 1VQ8S 1N75A 2J9DE 3NWSA 1MBGA 3FM3A 1GVJA 3QBCA 2PG4A 5B1BH 1U47A 4HH1A 1SD4A 1SUQA 2HYFA 2ISYA 3R1LA 4BDZA 2RN7A 5KT4A 2FXAA 3BSCA 2VASA 1BL0A 1PYTA 3DRSA 2YBVA 2L5QA 5DGAA 1RTHB 3UN2A 2LP0A 1U24A 1VRTB 3QYBA 2FZKB 2HGMA 2OC6A 2K3KA 3OSGA 1RTZA 2V94A 3VQTA 2KB2A 4USJC 5HLGA 4ID5B 3LANA 1P4WA 1VBYA 2BBEA 3I82A 4FKXA 2L08A 2H4WB 2COMA 3IWFA 2BABA 3M7GA 3RZDJ 3PW4A 2JLFA 1IF1A 1D8JA 4MQ9F 1WH7A 2X1EA 1HARA 3ET6A 1G7CB 1NDCA 1XD7A 4KH1B 3KP7A 1JXEA 2DXIA 3PJXA 2VJ5A 2NXJA 4G6QA 2J5PA 1HHSA 4WFYA 4ESBA 1VBXA 4W98A 4XMYA 1JKQC 3EUHC 1W2BR 5AXLA 4N4NB 3FEYB 2GA1A 3HHLA 3NGDA 2PA8D 2A1BA 3D3CJ 1JKPC 3IH2A 2V50A 1QAJA 4UUVA 3E5UA 2DHHA 1WJCA 1AFJA 3MKLA 2FNPA 4LFAJ 4RGSA 1URNA 1U9OA 4DZPA 1EAYC 3LA2A 1VHIA 4PJNA 2HVRA 4L75A 5CYMB 5AE1A 1FXRA 3R2DJ 3SEOA 3RG6A 3HRMA 2XAJA 1KR4A 4MGRA 3KP3A 4P96A 1XIQA 3NAHA 5GAEI 2YXLA 1IWGA 3LUYA 4I7FB 5D6FA 3VPRA 2LKZA 5EEGA 2WRMA 1RACB 3HT3A 4IR9A 1SQFA 4U87A 4XL9A 1VS3A 1IBLJ 3ZZPA 4IRIA 2Y2ZA 3CPWR 1O5JA 1MKMA 2V2QA 2Z1DA 2Z8QA 2LMIA 2W9CB 1W7PB 3F0NA 2H65B 3FFIA 2YNGB 3FC9A 5LOQA 4CYDA 4ZJLA 1J27A 3JSRA 5GAHJ 1B70B 4PXCA 3I56S 1VRUA 4N8NA 4BBRJ 1TZ0A 2F5FA 5KVRA 2OD6A 4OIPF 2ZOFA 2YKPA 4XN3A 2HOSA 1ZTTA 1F0XA 3SQGA 3CD6S 1I5ZA 1G4DA 2NRAC 4KKOA 4FHTA 1PUEE 5E7OB 4A8KA 3OTCA 2WTEA 2JHEA 2EK1A 5BXIA 3MM8A 1PC5A 2IVFB 3R97A 3DDKA 3K4LA 1VJQA 1Y5IB 5TGTA 1ELOA 2HKXA 2ZITA 4Q0BA 3EDPA 2W85A 2WC2A 2FBIA 5KT2A 4B9UA 4LVNP 3TQEA 2RV8A 2OPRB 2KFNA 3OYCA 4DR2F 2QBYA 4C8KA 3L2QA 1KN6A 4JI4J 3O2IA 2GIRA 2HNZB 2GOMA 2UVUA 2RKHA 1QSLA 3R4KA 5F1JA 4BHBA 2ZZNA 1QAXA 2BV6A 4M8LA 1Z0XA 2WK4A 3HB9A 2BW2A 2BJ3A 2NXNA 2HDCA 1S6LA 3IAS2 2ACJA 4HG2A 2RE1A 3MOJB 2LF8A 4RR5A 2L41A 3MPDA 3OYLA 2H5EA 2DYRH 4XORA 5F8IA 1DLOA 2MYFA 2QYGA 3OXFA 4UVBA 1HBMB 3ZXWA 4LIRA 1GFWB 2JVOA 3UDVA 1WC6A 2STWA 4URGA 3T5JA 1BC6A 4IOCQ 3R27A 3MZIA 3ERMA 3OY9A 1A5JA 4TU9A 1WHUA 2AWZA 2V8DA 5K14B 3JRAA 4DBQA 2L4MA 3B02A 3P7NA 4E98A 2B9WA 2JWTA 2Q2EB 1FD8A 3BGRB 4N0BA 3PYFA 3CJKA 4FBUA 5KAKA 2CWXA 4IUFA 4LF9J 2CWKA 4JBCA 4JI7F 5E1WA 2XBPA 3OLBA 3HDDA 4K0KF 1CJTB 3E1SA 1UL3A 4CP5A 2I8DA 3LSTA 3HUGA 2L48A 4DPTA 4ANJA 2XZDB 5T7LA 5KFOA 4J9OA 3NCPA 2KRHA 2OLWA 5KG2A 2KFZA 2GWRA 1S9HA 3KLNA 4J5OA 2GCFA 3JCUC 1OJLA 5F64A 2EK5A 4ZHRA 3I55I 1PAUB 2QMUB 1RT6A 2M1BA 3F6OA 5ETSA 1WQ2A 3J7A1 3VVTA 4PG8A 4HF1A 1E6YB 3SQNA 1MWYA 4QJVA 1IKXA 1IO2A 4QIWN 4FXVA 1D0ZA 2HHQA 3I4HX 4XLFA 3KUHA 2R8KA 1FOKA 3GTGJ 2ALZA 2Z58B 2L3MA 3UD5A 3UVJA 4ED5A 1TV6B 3HIFA 1M1GA 3M4XA 4DG1B 1T05B 4L9VA 3ZR8X 4DU8A 1H98A 4EVIA 1UEVA 4EGYA 4CLLA 3CCES 2M5WA 3CCVS 2P8TA 1Z6RA 3QP5A 3E01B 1NK7A 2DH8A 2X3GA 2RKIA 1R27B 1FRIA 5KTQA 2DPUA 2J0XA 1R49A 4YFNF 1DY3A 4H54A 4RW7A 1USSA 3IRXA 4NLOA 2V8VA 1U8RA 2G9OA 2G2ZA 4GO7X 4CO0A 2EFVA 1XC9A 3HZJA 4QYZJ 3N6LA 2E5HA 4WXDA 1JMTA 2KJBA 4HVZA 2JRMA 4TVAB 1H0MA 1UPPA 4DV5J 3EDQB 1WWXA 2XLJA 5CVRA 2JH3A 4OHWA 5M3FJ 1APSA 2W00A 1FXLA 1E0EA 4C0OC 2V4QA 2HMIA 3K89A 4DSFA 1NZAA 4JI8F 2RNJA 2HBYB 2QMXA 3DLLQ 2JEJA 1H74A 2KI2A 4DV4F 3TGNA 2V8HA 1K61A 3BJOA 4J9RA 2MSYA 2IVYA 1BR2A 1K83J 2W2NP 1R6VA 1XS9A 1VDHA 4KHRA 2DNOA 4RUAA 1XR7A 1N5TA 3CMAI 3AKZA 1HD0A 1JLEA 3DYAB 1XMOJ 1BQMA 3QOEA 1S48A 2LF7A 4HT5A 3FMWA 3NEKA 1HDPA 3OJUA 2EKNA 3ABUA 1WEYA 4DSEA 4DL2A 2X6XA 3VFZA 2BE5F 1NO8A 1U4BA 1CLFA 4HR2A 4LF7J 1X4GA 3PX0A 1U5TC 2OMLA 4V2GA 4QZVB 5IY5H 1IUJA 3VYSB 1HI1A 2QYCA 9ANTA 1HWJA 2L7FP 2V6AA 4CLTA 2W7PA 1WELA 4C6AA 4F0MA 3T41A 3LP2B 1DTTB 1C2PA 3VQSA 3GFIA 1C1BA 2IA2A 1STZA 2KYZA 3U21A 4ZJZA 3D68A 2V9KA 2F5EA 1TFYA 3LSPA 4F92B 4DOZA 2PBIA 1S6PB 2NVQJ 3R5AA 2XPVA 1A36A 4CO8A 2V2VA 5J2QA 1VQMI 4A8QA 3MGJA 4EMSA 1ULYA 3I0TA 3BO4A 1WORA 5DCFA 5F3TA 3BTCA 4ED8A 3M8ZA 1JLFB 4O3SA 2LG4A 4UZBA 3LWLA 1X2NA 5IOLA 2HPMA 1PP8F 3VSKA 2VE9A 1KONA 2IT0A 2O5DA 2DBBA 1C0TB 3H2VE 4Y65A 1JNZB 2WHOA 4BC7A 2M87A 4OIOF 4ZCKA 4FXDA 5DDQC 3CXCR 5HVQC 3COAC 2Q1ZB 5LHHA 4DSJA 4C48A 2R5YB 1LW0A 4IOCF 1W7WA 4LRAA 3SDEB 1S6UA 3ZTRA 2QUFA 3IAM9 1SJRA 4I6AA 5B0DA 2GX8A 1FNXH 2EBEA 1Q5VA 2VU5A 3CGIA 4I0WA 4PJJA 1H89C 3BJ6A 2DB1A 5M5WJ 4IF4A 4CTAA 2BA9A 3NL0A 2XMJA 2IM0A 1WC1A 5KFBA 5J2MA 4F93B 2XSFA 1S12A 3NWGA 5IT4A 4KHPJ 1HW2A 1KVKA 2YY3A 2DIUA 1RAAB 3HO1A 1XTAA 1FTTA 4LFAF 1JTYA 5E5NA 1HNIA 2VBYA 1GH8A 2LDUA 4F36A 4IRHA 3WTUC 2DQRA 3PNYA 4RNNA 3ZQIA 4U9RA 1I94J 4IDKB 2Q0OA 2ABYA 2RQQA 5HATA 3THPA 1NKBA 3EETA 1RB0A 1T38A 1DU6A 3CCSS 2X51A 2F4OB 1IJWC 1A04A 3WDOA 1YQHA 2XGDA 3S14J 3S93A 3X2QH 3ZP5A 4FYYB 4ID8A 3ONQA 1MMNA 2VIHA 2YWWA 2RUGA 3G96A 1TWGJ 2HU9A 2KKHA 4I0BA 2ZZTA 4F91B 1JI8A 1CEZA 1BI2A 1HPZB 4BXFA 2KZVA 4MKBA 4E6KG 3J81U 2H6BA 2FVSA 4U88A 2RDDA 3I0SA 4E7JA 4IHYA 3Q23A 1B7FA 1Y1VJ 1XGMA 3ECHA 2AQFA 2HNDB 2E1AA 3JTOA 1SC4B 4C9YA 3FJ2A 2NAZA 5DJBA 1LB2A 4HAMA 3TZXA 2J9CA 1O3QA 4OI4A 4V19J 4TQRA 4HOBA 2NPIA 3SSQA 4X0GA 1ZETA 2XMUA 4OYWA 3LA0A 5CCMA 3KE2A 3DU5A 2NVTJ 4WZQA 1MBEA 1M1HA 2H1LA 1RLDA 3CT9A 2WSCC 5J2PB 1YG0A 3HOVJ 3H9QA 3QU3A 5BPDA 5E3CA 1S7AA 3JRHA 2E1MB 2WOMA 2VKHA 2K7LA 1F1BB 3NWRA 4JX5A 2ZC3A 2HQFA 2F7VA 2CGPA 3F8NA 5HANA 5M5XJ 5FD5A 3I5AA 2QSWA 3OXLA 5HAOA 1BW5A 3TOAA 3CDWA 3V6JA 1DGWY 3HSEA 2JC1A 3W9IA 3DLLF 3HHGA 3F23A 2IGMA 1HWKA 1HA8A 2BJEA 1VQ9S 4RW9B 3KMQA 3KLOA 4KC5A 1IN0A 2FHMA 4J9SA 1WGXA 4Z7YA 2LQ5A 1NK0A 2FLPA 3L00A 4KGVB 3JB9k 2LMDA 3GYGA 2DT6A 3CC2S 2DA6A 3Q8VA 3VZHA 3Q8RB 2EA4A 3W9JA 2ZH7A 3TARA 1SAUA 4F04B 1LV5A 2OF7A 3D1OA 1ZLJA 3GIRA 1U0SA 3K4JA 3MAAA 4E7IA 4QPTA 2LQ9A 2Y0BB 1IUFA 4O6JA 3TP3A 4ZPAA 1WHVA 3BPXA 2AGQA 2QVOA 3W61A 1I3QJ 1EP4B 5EHHA 2XAHA 1UB9A 3N97A 2UXBF 1RTJB 2FIUA 4CLUA 3M9AA 3OTDA 1GAOA 4F0KA 4DN0A 1MJBA 3NS7B 4WZMA 2EZKA 5H6RA 4KQZA 2W7OA 1RI7A 3ZNJ1 1FRLA 4E7ZA 1UA1A 2MSSA 3LP0A 3PSIA 4J90A 2RT3A 3PO5A 3EXYA 2A10A 4HKQA 2F8HA 3KLFA 2MLZA 4UOGA 2VHGA 3E6CC 4O3RA 3RKWA 3M8QB 1IXSB 3R0JA 1B6AA 2OAZA 1O57A 3UDCA 3G8SA 3L7UA 3OS2A 4ES3A 1SKRA 4ETSA 3GZ5A 4UT4A 1TMJA 4OIQF 2E5JA 5DG8A 4CH0S 2CJJA 1DPRA 1Y0NA 3AAWB 5D4PA 4E7SA 2RF2B 1J0RA 1Y9OA 1B0PA 3TANA 1B1BA 4ITSA 2CZVC 2CPJA 4ELTA 1K9MT 3L4BC 3EGZA 4NLUA 1SD7A 4ILMA 3LOUA 3SIPB 4AVZA 4B17A 5BQTA 4R25A 1M5SA 4DX5A 1FDNA 3DOLA 1YRNB 3LSKA 5IOZA 5KFPA 4HHHA 2EG1A 2JUCA 3RBXA 1ZARA 1WOOA 4WJBA 5KT3A 4KGKA 2CQXA 1VQ6I 4C8NA 3E2EA 3IBWA 3M6VA 3QU6A 3LGNA 1V9OA 2ELHA 3MEEA 3EXCX 3I9ZA 3VGSA 2DPDA 3HDSA 3HHDA 1PJRA 2C2DA 5C44J 1R8CA 2UUCJ 1ZYRF 4MNUA 4CCJA 2G0CA 3EVOA 2YKAA 2Z2SB 1TP7A 1X3WB 4DV5F 4CM2A 3IR5B 3Q8YA 2BJ8A 1ZELA 4BS9A 3RW6A 3IG1A 2ACYA 4UW2A 2KTQA 2ZE2A 2HFSA 1F2HA 5A8WA 4DL7A 4XK8C 1BIAA 4KICA 4M3BA 1RKJA 1QBJA 2NVYJ 3G8QA 1BD6A 5KT7A 3PDNA 2ZKTA 3NRBA 2DFIA 1FA0A 1QVGR 5CD4H 3WC2A 2M4KA 2K8GA 1QD1A 1CVJA 3OWTA 5FRMA 1RHRB 4DR5J 2L54A 2EB7A 5FIIA 2YKOA 1ZGWA 1AWCA 1EETB 3CUNA 1BQXA 4ILRA 1FNOA 2DO4A 3TYTA 5D5XB 2KL8A 3K57A 4FS1A 2DR8A 4CWBA 1S9EB 3RPQA 2XYHB 5K5MA 3ZZZA 1VQLS 5AT1B 1XMOF 3ELKA 4XLCA 2VFVA 3OFGA 2WVCA 3HOWJ 2MC4A 2H9ZA 1CJKB 1X5OA 1VQOI 1NKCA 2G0JA 1HHQA 2LK2A 2GC8A 4F3QA 4WFAQ 2WZ1A 1REVA 1AB8A 1ZK8A 2JEIA 5C7PA 2YPYA 1NK5A 1NK9A 2FJVA 1WDDA 3HHKA 4R5PB 4NPOA 1KTVA 2HXOA 4DDFA 3T19A 2HQNA 2GAHC 2XI2A 1YJ9S 2L9WA 2XB5A 2VODA 3OS0A 1DAXA 1FT8A 3RBDA 1TZLA 3DDIA 4BUPA 3KJFB 1VLYA 4E70A 2FQ4A 4X4NA 4Q5SF 1UVIA 3QRQA 1M5PC 3ENVA 3T6BA 3U02A 3NAIA 2MZTA 4XOTA 2D3ZA 2W4DA 4NE9C 2CAJA 2GQ2A 4UHTA 2HHSA 3JR9A 3WTWC 1RIOH 1R8BA 4X66F 1O8BA 2HTSA 1WKJA 2CNOB 1UETA 1P8GA 2VXDA 1SJ1A 1U02A 4TU8A 2E5GA 1FDAA 4ITVA 3OYEA 2O3FA 3DLEB 1UFKA 1FKPA 2R4GA 4H4KC 5J2NB 2CJKA 3NGSA 3HC7A 3GE9A 3BROA 5CZVA 5KFQA 1R4NB 3D4JA 2B5JA 3MM6B 2A68F 2X6YA 3ULHA 2FX0A 1IM6A 1YKWA 3GV5B 4PYDA 2CNLB 3FWEA 4EFAC 5L3BA 3AFHA 1SJQA 3HHHA 1DZ5A 4ZPVR 1NUEA 5D5UB 4HX4A 2IM3A 3QP6A 4B8XA 1S99A 3HSFA 4ECUA 3KZIC 1SIWB 2ALYB 4LG0A 3B8HA 3DOKA 3R7SB 4DFMA 3MFIA 2O67A 3W8PA 4ZP7A 2VFUA 1FF2A 4YS2A 3U2RA 2DA1A 5CYVA 4J91A 1VQSA 3E8OA 2KHCA 2DHAA 3FXLA 4K50A 1TLHB 1APLC 1YI2I 1XTZA 3CCRI 2O5RA 1U2RA 1WI6A 2Y9ZA 1LDDA 3SSSA 4KHPF 3GJSB 5GADU 3PUFA 1HSJA 3D5SC 5I3UB 4AM3A 4P9FA 3SZPA 5ILUA 1PYOB 2ZNYA 4MFDA 1I94F 1XMKA 3QAEA 3BG5A 2JEFA 4I64A 1ZAVA 3J81j 2BR0A 1FEEA 2D74B 2L9DA 1S97A 2LNBA 3ABKH 5HSPA 5ICEA 2CDRB 1EKEA 2MTLA 3CTRA 2W84A 1YGYA 3CMQA 1HR0J 2QKLB 1LPQA 4CYUB 4NA1A 4G1QB 2H6CA 4Y0FA 4KN4X 1GHCA 4ZP6A 1QE1A 4F0HA 2DODA 1GMUA 3UR3C 2LSOA 2WAQN 1OPIA 2AW0A 4IJAA 2DNLA 3DDNA 5LT5A 1OIAA 2PFDA 2QLFB 1VI0A 2ZBQA 4NLVA 2Y75A 2CJXB 3MHYA 2QCOA 2Y69H 1XG1A 2EZIA 3HKZN 5KOWA 1V3ZA 2DDBA 2BDPA 2DGSA 4DS4A 3VVUA 5HQMA 2CQQA 2IA6A 2EZLA 1Z6TA 1N4LA 4DF4A 2HHVA 3QRPA 5KFEA 5IYDJ 2DT9A 2RH3A 3MM9A 5M2UA 1S72S 1AUSL 1Y5LB 3K70C 2ICWG 2V1DA 3F21A 2HQAA 4TLQA 4YIRX 1SD6A 4HEA2 3QNWB 3VHQA 1S76D 4K8RA 3A3NB 4Y33A 2XMWA 2KHDA 1TW2A 2MJUA 5AXMA 2IGNA 3HG9A 4U8YA 1RPWA 4XLNF 2X85A 3FISA 3PIPQ 3K2AA 2ATCB 1RWNB 1V5IB 1MNMC 3UW1A 5L1KA 3D2WA 1R7JA 1R5HA 2A61A 4AYBN 4KGZB 1Z3XA 2W1BA 3TA2A 5D4SA 2GIQA 3IGNA 4P7TA 2VKVA 3BKFA 1EIYB 2DNNA 1LDJA 3D5LA 4YB7A 4V19X 2FBHA 3MPUB 3HHNB 3S1NJ 1QM9A 2HVQA 3POTB 1UZHA 3CC4I 4KT0C 3VF0B 4I68A 2LBFB 1MD0A 3NY0A 2P81A 5HQLA 1NM2A 2BQUA 1I6HJ 4OYPA 3ETOA 5MLCV 4R8UB 2E66A 1HMVA 3PYGA 1Y39A 1RU2A 2ZBIA 3PSFA 2B7CB 2HZCA 4EV0A 1A7GE 4S05A 4JUZA 4DI6A 1C0WA 3MR3A 1HBXG 4HQEA 5DCMA 3NS6A 5F8LA 1AROP 2CQCA 2KT2A 5L8RC 3A01B 3GJTB 4M1KA 4ZZDA 3DLGB 2CWEA 1F4KA 1ACIA 1ZA1B 4DQSA 3PQJA 1B64A 2EK6A 1TU0B 1MGTA 2HHTA 2PFFB 3HVWA 4QIWD 5H9FK 3VSLA 4O44A 3QO9B 4RAFA 1XQIA 5FGMA 4BQAA 2O3DA 2Z9OA 3PM9A 4KFCA 4FE4A 1RKIA 3JXOA 4N7TA 4F02A 3OBIA 3RCOA 2XO7A 1JJ2R 5B3SH 2VL1A 3ZZTA 4XBFA 3D6HB 3V4MA 4XKCA 5LMNF 4LB5A 5JVGQ 1RUOA 3MEGB 2VH7A 4MEXF 1IAWA 1VHFA 4AIDA 5D5VB 1QHGA 3GIJA 2DOEA 2PMHA 4OYOA 1P9QC 3C16A 4AD9A 1PJ6A 3FK6A 5DLGA 3IAS9 1JLAA 5F04A 1VR6A 4JQFA 4D0PA 4Y3OA 2A6TA 2CPDA 3ROUA 3FBFA 2C22A 3M1CA 1JLCB 3LGMA 2VZ9A 1I1SA 2Q6BA 4WXOA 1XMQF 3BJAA 5F08A 4WK3A 2ROPA 5LGTA 2KPMA 1IV6A 2OTJS 3TDZC 4OIRF 1MBHA 3GFXA 4UUWA 2GXGA 4KJZA 4ZS6A 4DL5A 2NSBA 2UUCF 4KO0A 2MMYA 4H4OA 4HV6A 1F2GA 1W0UA 4OZNA 3RGIA 2ZUAA 3LQRA 1JLBB 3UCGA 2XCPA 3G6ES 1FK9A 4ZDPA 1EJ7L 1S7HA 2KO1A 2XCAA 2XS7A 1RAIB 2FGOA 3OR2C 1HI8A 1NG6A 4GKJJ 4P52A 1QPIA 2F6CA 4OZ1A 3VYUB 4M5HA 3OPKA 1XNRJ 3SMZA 2VQCA 2QFIA 4O4RA 1KOHA 3W7BA 2DNYA 2A69F 3RRHA 1OCRH 1DTQB 3QFHA 4FXWA 2R2RA 1W2IA 3PO3J 5AIQA 1QAYA 2R7RA 3OTEA 1RAFB 4DR5F 2DJNA 2VQFF 2V8GA 4LMZA 3M2RA 5H9EJ 5CVIA 4YIIA 4OZ2A 1X19A 4QCLA 5A2QZ 5KFLA 3OSPA 1JJHA 4WF2A 3EZUA 1WF0A 3TWZA 1C4AA 4IHXA 1CC8A 2JFDA 4TKTA 5K5QA 3S2HJ 3QRRA 3S3MA 1P6RA 3RAMA 1CSJA 3HYIA 4OAYA 5J4YA 3RIRA 3PR4A 2HWTA 3M9OB 1LEOA 4A69C 2W2MP 1NLKL 1FRMA 3ZOBA 4L9TA 4N77A 3MD3A 1VQ4I 4K2JA 4JOUA 5KFSA 3IHUA 4JV0A 4YP3A 3CD7A 4F4YA 4M73A 3Q89A 4RLFA 2MW8A 1JNRB 1RHJB 1RT2A 4B3XA 4BE0A 3HVTB 1LFWA 1M0SA 1U8BA 2N8GA 1HXDA 3IR7B 2CJBA 8ATCB 3NMRA 4QWDA 5E18F 2QEXS 3JRFA 3L9ZA 1TL3B 4P2XA 3OYMA 4R79A 5E3LA 1TNTA 4C8LA 1BJAA 1K4TA 4IFYA 2UU9J 3LAJA 3TA1A 1FPQA 3W60A 4DV6F 2ZJPQ 1H38A 1U2FA 5K5OA 3JSMB 2HXIA 1TWFJ 4FT8A 2UXNA 1F3VA 1IBKJ 1SFKA 2OCEA 4O0NA 1QVFR 4Q43A 3GO5A 3K70D 5D4OA 3AOAA 3PIPF 3M6UA 2KKOA 3LQVA 1BQNB 1O4XA 4H4KA 2XROA 3MR7A 1AOYA 4PWDB 1NH3A 3KJQB 1VRUB 2JEGA 1PO6A 1EZZB 3OSFA 2M88A 1FKOA 3UR0A 3J80K 2DRBA 4KPCA 2BW7A 1A31A 2RHQB 2HHWA 3AHPA 4QIVA 2R3VA 1XERA 2X1BA 2VT3A 1IJEB 4MFBB 4YB5A 4KKOB 5HDKA 2WAEA 1KQ8A 2NXEA 2NCKL 1LWEA 4EYHB 2LYVA 4CDGA 2MGZB 2MY7A 4W1UA 2M8GX 2IS4A 3HOZJ 1IJFB 1N8RT 2DLLA 1AU7A 4IHWA 4C8MA 1PP7U 3LA7A 5BNGA 3F73A 1E3HA 4NHJA 2F4VJ 2HIQA 3GCWP 3PNVA 5A6PA 2ZXIA 2DFEA 2M3DA 3MAHA 3D6TB 1FTZA 4OMYA 2QBYB 4LVOP 1OY6A 4QIEA 3K1MA 2BKNA 2A5WA 2IHR1 4LUBA 4S04A 4PPDA 1QZZA 4L0ZB 1NG7A 3G6YA 4P2FA 3LPYA 3TUJC 1YBAA 3B78A 4UUXA 5HVFA 2V6EA 4BY7J 3H5XA 4WBFA 1RDRA 3N6NA 2UXCJ 3KDOA 1VBKA 4J00A 2GXBA 3X3UA 2ZMEA 1SV5B 1RT3A 5FLXY 4IQXA 2E5NA 2AEJA 3HD1A 3N9UC 3VALA 3IGVA 1JLQA 4CZZA 1TT0A 1MMSA 3IXQA 1HR0F 4N9HA 2JLGA 1KVJA 2ZC2A 1DLOB 1LQ9A 2ZH3A 2WTFA 3I59A 2NXCA 2YSRA 3HPHA 3BEGB 3V6KA 4LRBA 1MH3A 3ZQHA 5JVGF 3VYRB 1HNZJ 4C3LA 3HK2A 1H7XA 4NCGA 2JQ7A 2PMZN 3ZQFA 2A6MA 2O6GE 1WF2A 3MI7X 4A3CJ 1FBQA 3C2GA 3D0GE 2Z99A 2HQCA 2LR8A 4QQBA 2H5IB 3CWJA 1FI4A 4GGGA 1WFXA 2VG5B 1GEHA 2A0FB 5T7LB 2DNHA 1E3PA 4PYAA 1O7LA 3IV5A 3TMOA 3HM5A 3MMCA 4BC9A 2ADCA 1DQAA 1T11A 2HBZB 3CCUI 4ZHRB 3I71A 2C3PA 1SJ3P 1J5EF 2DK8A 1AA1B 1VC6A 4PJMA 3SFGA 1J5OB 4PQUB 1KC8T 1F3FA 1TWCJ 2XPUA 5GMEA 2VG7A 2CJ9A 2QGFB 3M8EA 1PAEX 3R5JB 2KIFA 1TUWA 1IKXB 1S6QB 1K44A 4DLGA 1HBUA 3HFKA 4XOPA 1KOOA 1X4EA 1JE8A 1ZGAA 3F8FA 2V69A 3C66A 2XASA 2BE2B 4NQWB 3UVJB 3KLHA 2DVIA 3THTA 2VFSA 3EZ5A 1U1NA 4MIMA 4F52A 1MNEA 2PDAA 1Q79A 1Q8BA 4UUSA 6AT1B 2HOAA 4RW6A 1NB7A 2ZXJA 1T98A 2RKIB 2QC3A 3AB4B 3KYCB 3CJRA 1HQCA 3OSNA 4XSZF 1RAHB 1UMQA 4QTRA 4RW7B 3IRXB 2CW7A 3JAMK 4IFVB 4ZP8A 3QYEA 4CLPA 3FIWA 2PSZA 1HQUA 2FVPA 1JXSA 4MYTA 4BAYA 1S7IA 4LSLA 3M8FA 1HKAA 2XAUA 2IJFA 2YX1A 2YWHA 3ZO7A 3EGWB 2JVHA 3PJ9A 3B54A 3HI9A 1R0BG 2NYIA 3IUOA 1D1CA 3O8GA 2WSEC 1FRXA 1TP4A 2NS0A 1YIJI 3T5HA 4B3OA 2BGCA 2HYGD 3BKUA 4DGWB 1WC3A 4Q4ZF 3JYTA 1HBNB 1NH8A 2ECBA 2HMIB 5A0YA 3EYYA 2MY8A 4FX0A 5CYQA 3BZ6A 4F26A 2BW3B 1D1UA 4I56A 2V4JC 3HOUJ 1L3VA 3FF5A 2ZJPF 3MPWA 4I98B 1NHVA 4C11B 2OJED 4KMUX 4DZ6A 2W8LA 2MQQA 4JI6F 3MEDB 1QAIA 1MDMB 3SCJE 4RGRA 1ITYA 5ETPA 2L3DA 3PO4A 4B3SJ 3KK1A 5LRSA 3AJDA 4NRTA 1RT4B 4HDGA 3ITHA 1Y00A 4O5VA 2WY7Q 1AW0A 5IFMA 1XR5A 1Q0NA 3BDDA 3OJSA 4FF2A 1CQMA 3MR6A 4D1QA 4MFEA 4OAZA 1O3SA 3MCZA 4B3TJ 1SFUA 1FEXA 1MBJA 4ZN1A 4USUA 4M6XA 1FX2A 1P6TA 5M2RA 2DAOA 2ZZMA 2Y8WA 1MH4A 2VIXA 3DPTA 4Y2IA 4BEHB 2W7NA 1Y7PA 4RWXA 3VGTA 1FDBA 1N5VA 4G9YA 1BWVA 5FKNA 1Q53A 2Q43A 2W25A 5C5JA 3E6MA 2Z30B 3DLKB 4TYAA 3HRTA 4L9NA 1T6SA 4ZIVA 1RHQB 1YX5A 2VKDA 4XRMA 2PA3A 2X1CA 3HGYA 4ED4A 1QTMA 1YJNI 1QLNA 3PW7A 2RVCA 3UO0A 4GKJF 1OQ6A 2HYIB 4GO1A 3CC7S 5EEHA 4F55A 2Y9HA 3MKZA 1XNRF 3H9GA 1WG4A 2IP2A 2QYOA 2HEKA 2K02A 3T1AA 1BN5A 1TUVA 4QWAA 2CQ0A 2F1FA 1PBUA 2QFJA 4NEZA 4Z6YA 4NLTA 2UUAJ 1H6KX 2FY8A 3I0RA 4KR0B 4Q47A 1SC6A 3OHBA 1ZTRA 1B99A 1MZBA 2XGCA 1X1DA 4FE7A 3V7SA 3DRXA 3FGVA 1G3YA 3WTYC 5GVQA 2UV8A 2GHWA 3IC1A 2P5KA 3BG6A 4GYIA 4ZLPA 3OIOA 3M6XA 4JP0A 1X58A 5FLXZ 4DL4A 1GVDA 1TVRA 3CB4A 2COBA 2CYYA 4CTAB 3BPSP 1HW5A 2H8WA 2QJ3A 4GYGA 4L72B 1D1AA 2HWIA 3I55S 3CQZJ 5A8RA 4HW0A 5FLVA 3HF5A 5J2MB 1JXVA 1O3RA 3I9V2 5D4LA 2D45A 4H4MA 1MSEC 2YX4A 4E0DA 4MYUA 4QYZK 2MEWA 4S0HB 1ZTWA 1RAGB 1FJGJ 4IHVA 1L3KA 3OL7A 2G4BA 5CJ9A 1YW7A 5HODA 1ZZNA 3CULA 1Q82T 1UW9A 2IRXA 5FKKA 4UQGA 2R7FA 3W5YA 3QZ7A 2FD5A 5M2PA 3T9NA 3VAMA 2DO7A 4LQ9A 3WGHA 3BGLA 2UU9F 1KHWA 3DFGA 3WU0A 4K4UA 1KLMA 1CJUA 2XC7A 1ZGJA 4KNYA 3FXUA 2LECA 2JA8J 2W9BA 5EWGA 4DYRA 4RX6A 2CQBA 4O3OA 2IMWP 3GFMA 3GTLJ 3BR8A 2Y1IA 4DYQA 5BYQA 2XZTB 3NNCA 3DLAA 2UZAA 2FTRA 1SFXA 1FERA 2AJQA 4ELUA 1TL7A 1VQPI 4EJOA 3QT7A 2QKMB 4XIDA 4I99C 2BY1A 3GTJJ 4ABZA 1VIOA 4DQQA 5K7FA 4DX8H 3IM9A 2FD2A 4D9JA 3K4MA 3BGOP 1NBEB 3ZMDA 2ZHOA 3F8BA 2AJ1A 2G0IA 1U78A 3CUQA 5KFGA 3CLQA 4AUXA 2F9DA 5EWFA 3HKWA 4DYCA 2D5VA 2QA1A 2YPRA 3LSMA 2M8HA 4BU2A 3LSJA 1KTQA 2OELA 1YHQI 4YG2F 1GX6A 2XULA 1NDPA 3LF0A 2E5LF 1GMVA 5DM6Q 1VISA 3HFZB 5LLQA 2ZJ2A 2F4VF 5A8KB 2FBKA 4DF8A 1AFIA 4W90B 3OVAA 2R7XA 2B51A 4QPOA 1G3WA 4MT1A 3T0YA 4CCMA 1KYWA 2L4AA 2ECCA 1G59A 3CZ6A 4A3GJ 2ISZA 5L9XA 3LNQA 2R7ZJ 4LFCF 3OYAA 1ZPVA 3UCUP 1XGSA 1LWCA 1S1UA 1Z9CA 4OX6A 4B02A 4PFPA 3O1LA 1S3JA 4OYBA 2DA4A 4DPUA 2KQRA 4IKFA 3KKFA 2FJ1A 2FRHA 5AIPA 4KDPA 4WFNQ 1WJFA 3FCHA 4BYYA 2F2EA 2A07F 1RUSA 3KYDB 5BR8F 2DMNA 3BR0A 2LP4A 5CHCB 5LGUA 4C2MJ 1BGXT 1R22A 5D5WB 4PUOA 3HKZD 3FZBA 4ZYAA 4M5NA 3MUVP 3AOBA 2YKMA 3BBCA 2K85A 3TO7A 2VA2A 1SC3B 4QYRA 5GPCA 3J81Y 3BOQA 1S79A 3H42A 2JSXA 1VC0A 2AV5A 2OSRA 3UD3P 5F8JA 4MK7A 7FD1A 5HBMA 3MAAB 2RIJA 4RAGA 2DITA 4EEFG 5D0RA 4JP8A 3TW6A 3TI0A 4P75A 3RBZA 2AYBA 4B3MF 2PI4A 4Q7AA 3Q9SA 3FBEA 5JUMA 3RI4A 2HFZA 5IQQA 4ANEA 2R0QC 1NAQA 4WX9A 4OI3A 2P9GA 1X5PA 1RP5A 3RAQA 1LFPA 3RSNA 2XRLA 4LF5J 4OJ1A 3E5QA 3PX6A 3WU1B 2YNIA 2VBWA 1IM4A 1VZ0A 3J7AO 1HKSA 4KIAA 4MJKA 4LG3A 3Q8SB 5H2FC 1NSKL 3HZGA 4K59A 1TKXA 2OD5A 4ELVA 1WKMA 2OUGA 5LHIA 3OR1A 2G0EA 2MABA 4K5RA 1VRQC 3FEXB 3GU0A 4LR9A 2ZEJA 1JQGA 4RZRA 2L7ZA 4DZDA 3RR7A 3R5DA 2BM1A 4ED3A 2NS1B 3QT6A 3E3XA 1RA6A 5JVTA 1FO1A 3GLLA 4USHA 4CCOA 3MXHP 3MZHA 4FN5A 1CJVB 5B08A 2ROEA 3PFYA 1JX4A 2DHGA 5D4RA 1E6VB 3M8PA 2EG2A 2MD5A 1H3DA 4L76A 2AQEA 1GLNA 3MCOA 1RTIA 4X62J 5F9LA 3PFOA 1B59A 1RCXB 1ON2A 2QSFX 5IS2A 1FJCA 5H1SV 4FYDA 1Q5YA 3HSJA 2J7UA 3FMQA 5I4MA 4XRSA 1UJ5A 2HHHJ 3FBBA 4K2XA 3MEEB 4O3QA 3MN2A 2F4FA 3HSGA 1ZAOA 2XAQA 4V19K 2W2OP 1N32J 1X5SA 5IXUA 1H2VZ 3DI6B 6FDRA 2A18A 3HM9A 2YKNB 5E1ZB 1WHYA 4RW8A 2W57A 1CF7A 2QQBA 2JZYA 2ZH8A 2J9DA 5C4XJ 1ZN2A 2HQ3A 2ELJA 4OIXA 2ID3A 4IH6A 3TX8A 2KISA 1IBMJ 3J7AY 4TY8A 5JJBA 1GQEA 2B7EA 3K2ZA 2GFFA 3O5TB 2Q66A 4PZJA 1MSWD 1DQUA 1T0FA 3ZN0A 5I3QA 2M34A 4AL5A 3DPUA 4AL6A 4RW4B 3QJLA 3I32A 1D9DA 2AD9A 3FBCA 3R5CA 1M5KC 2B8PA 3P5BP 3L2UA 1X0FA 2FHJD 1FZPB 3GILA 2UV1A 4HEA9 1W36C 1T9YA 1ZYQA 1ZM3A 2MLYA 2WBMA 5GAHI 3IA0A 2EFNA 4IL6C 3DN9A 2OPQB 3D5RC 1TKTA 5C25A 2BZTA 4M71A 4UOHA 1HWUA 1ZBTA 3M9MB 1HWIA 2EBGA 1SKWA 1TAUA 4EZ9A 4IRCA 1JKHA 2NR0A 4HX7A 3DM2B 4CLYA 2UUZA 1TUGB 3W63A 3PNIA 3GTQJ 2ROGA 2JNJA 5HOOA 3N79A 3JTGA 3SEZA 2KM8C 3ZZUA 2QA4G 3SZTA 1XCBA 3PKYA 2JA2A 3QSIA 5CABA 1RSCA 2JMWA 2P8IA 1U5TB 2DD8S 2F5DA 1MMDA 3HHLC 5DM6F 3WTSC 3A2KA 1QA6A 1WC0A 3CDIA 5FB2A 2X0LA 2H8RA 4ZCLA 1JJ4A 2EV0A 2OSQA 3FHZA 4QWCA 3LSIA 3DRPB 5C24A 1MWZA 1ODDA 3OL8A 2KYXA 3DGPB 4WFZA 2G1HA 4RA2A 3H5RA 4DS5A 2UV8G 1IGNA 1Y3JA 5KFMA 3UDLA 1Z4UA 1G6BA 3Q9VA 2OZUA 4XLPF 5E3MA 2HQ5A 3DU6A 2ZWOA 5A2QU 1FKPB 2MKHA 2L9NA 2UP1A 2UUWA 3T8RA 2B9YA 4RBVA 2ID6A 1P4XA 4QR1A 1EH7A 1XSXA 3CDBA 3Q86A 2D69A 1L3TA 2DGWA 3CDEA 1RT1A 1NDKA 3M32A 2PEHA 3HP6A 3SHFA 3JQJA 3LO3A 1RETA 3NBPA 4HA8A 2HSEB 4JYAJ 5D4NA 5HDGA 3OD2A 3QAUA 1QY7A 1TQLA 4NXNJ 4LREA 1LE8B 4O4GA 2BBYA 2BRLA 5KFZA 2B0LA 4AIKA 2R7OA 2DEJA 4PGGA 2M7BA 3IO1A 1ACMB 3PZPA 2FVQA 2QZ8A 1D3WA 3G82A 3HOXJ 4YHHF 4BKXA 1RWOB 3Q2TC 2JSPA 1SH3A 5HQ8A 4DFKA 2EIJH 2FOKA 4NC7A 5DDRC 1B4SA 3TKYA 4BBYA 2PLYA 3KLGB 3BYRA 2WW4A 2G13A 3FK7A 1JUSA 1OYWA 2DDAA 3K0LA 2AXTC 2J9EA 3G73A 3FVYA 5KG5A 1FJGF 4C8YA 2CVEA 2DXFA 5IWAJ 4JX6A 1UVNA 2CMPA 1FP1D 5FO5A 4G1IA 2WSFC 2PEBA 1TNSA 4NMXA 2XO6A 1YS6A 3VB2A 2K40A 4PG6A 3C2BA 3P6YC 3SV4A 1WWHA 4ZTJA 4FF4A 4K2EA 3AL0C 2W4SA 5EGOB 1D3YA 4URSA 3L9FA 3B6BA 2BACA 2M2BA 2VG6B 4F3MA 1NHAA 4ZPDA 1N36J 2W4PA 7FDRA 4AC0A 1F60B 5FJ8J 2NSCA 2QE5A 3L2RA 3S1QJ 4RPFA 5FDLA 3KG0A 1KBRA 1VQ6S 1ZOTA 1UJ6A 1FVSA 1MROA 2Z2LA 3ZMTA 3NARA 1HCRA 3IRWP 4DV3J 4NX9A 1UEKA 1IVZA 2E2HJ 1B4AA 1S8NA 5J4VA 4A3LJ 4MK9A 1VRTA 2FZGB 3MURP 1VQ5I 5IP7J 5LJ3Y 2ZB9A 4ZA1A 2ZKUA 1OSCA 2BQRA 1Z2ZA 3AG1H 1VFCA 2NYHA 2WVEA 2ZBRA 3RRKA 2LRDA 3P8BB 5DM7Q 3W2VA 2VF3A 4JI0J 1S0OA 3QATA 1MJAA 5D78A 1RWVB 2F5VA 3W8GA 2ZH2A 2QLWA 1QUVA 3SZGA 4ENJA 3D67A 1GUUA 1R4MB 2PE8A 5DQIA 2Y1LB 1AHDP 3D5MA 3M30B 2XHCA 1JJ6C 3MPYA 1N78A 2HVHA 4M3DA 4YEJA 2LYCA 4DIQA 2HZVA 5E3OA 2F5CA 4BQNA 2WCXA 5GAEU 3F56A 2KJVA 3R61A 1EKSA 1VQOS 4CNYA 3S01A 2EFGA 3AH6A 2GVZB 1DUXC 1D0YA 1X4AA 4Y4RA 4ZVRB 4J9NA 4KTQA 1IXKA 2PMZD 3OV8A 3TBIA 2FF4A 1VK3A 3MTJA 2YS9A 4PXDA 4P1WA 3ILIA 4WKRA 2YUSA 4MMOA 4DV1J 2LKXA 3GG1A 1FLIA 5LEJA 2KRFA 4PG5A 4W4MA 4JK1X 2V1XA 4NLRA 5EGYA 3H3UA 2D3O1 1W36D 2XMAA 2CW8A 3HTUA 1K78A 1V5VA 4OV6A 1RU1A 4LLNA 5J1RA 1FBSA 1MBKA 1HC8A 2E29A 2ZC4A 1XGOA 3N5BA 2IPOB 1XX5A 2W9CA 2VV5A 3C6UB 2XPWA 2MGQA 2YNGA 4X64F 1R1TA 3FCWA 3K2YA 5HJXA 3PW2A 1F5BA 1R0CB 2R92J 4OHYA 1BY9A 4DJBA 1N6QA 5HP1B 2JJ4D 2CQ3A 2M0GB 4LF5F 2GA2A 5E20A 4IG3B 1B8IA 3V8JA 2FYXA 1XJWB 1U3EM 3ZTQA 4I01A 1PILA 2KZZA 4OX7A 2V5HG 2YNFA 1X4OA 2Q3PA 2L02A 3TEHB 4K4VA 2KT5A 1GDTA 1WJBA 4DUZJ 1JWWA 2MFZA 1KQ9A 3F8CA 1P2FA 1JLGA 4OI1A 1R1VA 4IQ4A 4B3AA 4M5GA 4NMLA 2HQRA 3HHLD 1UWBB 4CO3A 3PYEA 3M8WA 4XRSG 4LFUA 1M5VC 5DG9A 2DHXA 1KFSA 3V7RA 3MVPA 1MIJA 2OPRA 3KG4A 1X4DA 4HHUA 1HL6A 1V5GA 2DYAA 1DP3A