2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
4IEJA 2R3VA 4XLFA 3QAUA 2DTZA 3TRGA 4YR0A 3DLLQ 2STTA 3NG8A 1V4RA 3W64A 1CQMA 3QSIA 1XDSA 3MM6A 4XN3A 5BOXA 4JX6A 2HDWA 4YG2F 2ZJRQ 3CJTA 1SFOJ 4IYQA 2V4JC 1N75A 3RSNA 1GDTA 2MGQA 2M4GA 3BCBA 1SVMA 1X3UA 4CQ1A 4BE0A 5D78A 4PJJA 1ETOA 1U2WA 2HYIB 2XTJP 2P5LC 3BQ2A 3EDPA 3CEDA 5LMNJ 1D8YA 3ERMA 2CQPA 4X4TA 2VC1A 1RC9A 1XN9A 5F8NA 1Z67A 1UZHA 3H5XA 2LY2A 2FVCA 3I5BA 1T3OA 1R3NA 2FC9A 2P8TA 3QLHA 3PYGA 1RHUB 3G8TA 3KK3A 4C6AA 4C11A 2FLPA 2WONB 3W63A 5DM6Q 2LVSA 2DA6A 2GIZA 1OY6A 4AM3A 3NOCA 4ZPBA 4WKYA 5A2QZ 2UZKA 3F23A 2WAQA 3GEZA 3GQCA 1U5TC 2BDPA 1EETB 2ISYA 3UDCA 3C14B 9ANTA 2A2DA 1J7KA 3OYKA 1IV8A 1AKHA 2NS0A 4PQAA 4LF8F 4RBVA 2FJXA 2J9DA 2AIRB 2EWHA 5FDLA 2MHEA 1WHYA 4PJ0C 3HOYJ 3MAAB 1A36A 4PSXA 3CC2I 3FQKA 4HL9A 5EG0A 3J7ZT 3BGRA 4Q2MA 4KH1B 2RQMA 2XI2A 4DPWA 5KOXA 5IT9Y 1HBNA 3UNYA 5FLXZ 5K5QA 1BE4A 4MTDA 4NZ7A 2UXNA 2W1BA 1J5EF 4J9SA 2KTQA 4NMLA 2APOA 4FX4A 4ZVQB 1AUSL 3TNVA 1SI9A 3BM7A 2X3DA 2P7CB 4XRSA 3VALA 1MDMB 3GE9A 3CDAA 1OLTA 2W00A 3HZJA 1WACA 3ECOA 3J81Y 2DFHA 3M30B 4LFAJ 4FCYA 5LT5A 4B9NA 4IPAA 1N54B 4LF1A 2IBKA 4QPOA 4A3DJ 2PFDA 5BQTA 3MM7A 4KYZA 4Q5SF 4PEOA 3UN2A 1XGSA 4B43A 1TL1A 1USTA 1FRKA 1U9OA 3KHRA 3A8JA 5LGNA 3ITHA 4GYGA 2J6SA 4H4MA 1G1XA 3E6MA 3B4DA 2VJVA 4M5KA 2PIIA 3H5YA 1YDLA 3SQNA 4ZVTB 4CLLA 1WKMA 4A8FA 1LW0B 4DV4F 2D3ZA 2GMLA 3KHLA 3B02A 5LSLA 3G4SS 4G6QA 3B82A 5EX3A 4YFKF 4EM1A 5L8RC 2C3UA 3C19A 3AL0B 2OSRA 4DR2F 1WEYA 2F5GA 2I38A 4HVZA 4I6YA 4WP8A 2O03A 4F2RA 1JXSA 2C28A 3CD0A 2EFOA 3OV7A 1M5VC 1BR1A 5A8WA 4JOUA 4KPYA 3FZBA 2NYXA 1FJCA 1FLIA 4ZPVR 3MZYA 1JLAA 3KP2A 2STWA 1Q1VA 1T8EA 2VKVA 5DTDA 1OJ4A 1QU3A 3KUGA 3GILA 4FBUA 5J40A 3NNCA 1AZSB 4CSWA 3HX9A 4RZRA 1YZ6A 2NRAC 5FKMA 3M9AA 4JBCA 2CA9A 4C2TA 2FHJA 1QQIA 1NK5A 5C3EJ 4IO9Q 4KT0C 4BXUA 3DGPA 1P1LA 3D6FB 2IM2A 3CJQA 1LDDA 4F2SA 2M7SA 4DCOB 4ZDOA 1WKJA 2A0FB 3OUYA 4JI5J 2QRRA 1REPC 2M1BA 2AKWB 3IR7B 3MEDB 1DTQA 3DLEA 5DLFA 1BW6A 2QF7A 2HWIA 4IZZA 4YB7A 5KFOA 2V4QA 2Z8QA 3FDYA 3K7RA 2GGPA 4OX7A 2DLLA 3OYFA 4IOBA 3TL4X 1M5PC 2QGFB 3DOMB 5M2RA 2HRUA 2MZSA 3R5JB 1URNA 1F5AA 2K3PA 4HF2A 2N4CA 4TKTA 3BH7B 1WSUA 5GMDA 3EM1A 2EFVA 4HLYA 4NXNJ 4HAMA 1RHRB 1VQOI 3GFXA 2HS0A 5L3EA 4HQMA 2DO7A 4AUKA 1FOKA 2O5DA 2L2OA 2ROEA 3OHBA 1SC1B 4URSA 2RB7A 1TKDA 1T94A 3PHEA 5KT7A 1RWXB 1A9NB 4ECVA 2BYVE 1TR0A 4GVBB 3KZYA 5J47A 2YKMA 3VTIA 2W7NA 4CLYA 2V67A 1I3QJ 4I64A 1HHTP 3WGGA 3BGFA 1G6BA 5KFBA 4OI6A 3IBFB 3HP6A 3C2PA 3CNQP 3HKZN 1UFLA 1RAIB 4A48A 1IBMJ 2VPWB 3NGUA 2VG7A 4GO5X 5IP9J 2KXFA 5ADZA 3M7GA 2RNJA 4F0KA 2DW4A 3GMEA 2HHWA 4BY7J 4K2JA 4OHXA 4R25A 3CCLI 2Y9YA 1VQKI 2DR9A 2UVRA 2QMXA 3GV7B 4MIWA 1U45A 4RB0A 1H7XA 1RHQB 5KT3A 5B1AH 1X0PA 2KYXA 1H8AC 4ECRA 1NJIT 2AYBA 4OFZA 3IAM9 5L3DA 5K8MA 4NOHA 4JUZA 1IM6A 3CMAI 3UN5A 1WJAA 2H9ZA 2KRBA 3P3DA 4ZCLA 2ZBKA 4ATNA 5FFZA 2J5PA 1ZYRF 4A93J 4B48A 1I94F 3H2VE 5B0BA 5CH7B 1TL3A 1FESA 2WW4A 3JRGA 4IRGA 3ENQA 5IV3A 3DHXA 2XKPA 4OI1A 2KFYA 2FMLA 3IA0A 2BE2A 1ZTTA 3KEYA 2UUWA 5EZHA 1S9FA 1XERA 4B9UA 1WFXA 4WKRA 3MFHA 1ACIA 3JW4A 1WTBA 3Q0UA 4LB5A 1NUEA 4LIUA 1HBMA 3S6EA 3U7JA 4C8LA 3UO0A 2BVLA 3IAM2 3L2UA 1K4TA 3NLCA 3CUNA 2L9DA 2QM3A 1KVIA 2VU5A 4L5IA 4KUMA 3EPGA 3W8PA 2HFUA 3LH2S 3AG4H 1OCTC 5HVFA 2JWNA 1BN5A 3TDZC 1VQ6S 2BOAA 1SFXA 2G2ZA 3C66A 1OCPA 2H4WB 1S1XA 2K9QA 1RKJA 4CH1A 1WNEA 5HSPA 2VG7B 2DCUB 4LF6F 5HVGA 2C2NA 2ZDPA 5DG9A 4WYWA 4LF9J 4PGGA 3C1DA 3S7RA 4IFVB 3K70C 4O4GB 2NYIA 3HC7A 2OEMA 3JRDA 4MKBA 2V8VA 1WOPA 4B44A 1IRGA 4JK1X 2M8GX 5D8LB 1UA1A 4NC8A 3KIOA 2V8HA 3GIKA 4QIFA 4A69C 4OI2A 1QUVA 3VAJA 2EJRA 2OPTA 2XMKA 2KQRA 3PM9A 4BLGA 1WC6A 2C2RA 4MLOA 4Y2IA 5A8KB 2XF6A 1RXOB 3U1NA 3RR7A 4UUSB 3FEZA 2UXXA 2RREA 1FWLA 3ISPA 3S32A 4C3HJ 4WXCA 3PTWA 1XSVA 2H8WA 2DHAA 4OIRF 2ATCB 4IXAA 5EGOB 2MQPA 3R5AA 4NB5A 2UUTA 1RTHB 3CCRS 5E79C 1GVJA 1S4EA 4N4OB 2K2PA 3HRUA 5CVUA 2EZHA 4ZJLA 3EX7B 1Q4RA 5THWA 4X4NA 4QWBA 4YR2A 4FF3A 2KM8C 4IH5A 2LNBA 2TCTA 3IWXA 4OV1A 3VYRB 2HK2A 1TWAJ 2B4UA 5EZGA 4F0MA 3TQEA 1MW7A 3Q0AA 4UY8I 3MFKA 5D5WB 3DBLB 1CJTB 3D1HA 3GPAA 3A8IA 4RUAA 2W8LA 2ZJQQ 4HYKA 5A0YA 2VQFJ 3PX0A 2WY8Q 1QDUB 3H5UA 4OHWA 2MQOA 2P4WA 3VGSA 2N3LA 4IRDA 1JLGA 1HXDA 3OD2A 2X9DA 2R9LA 1KKHA 2M3DA 1G7CB 4JI7J 3JB9k 4BBYA 3SCKE 1H7WA 1BA5A 2HVSA 5IM0A 1UWBA 2IS4A 2L9NA 1SUQA 1GHCA 4ZVHA 4X65J 1RABB 2V8PA 3FRYA 4CYUB 4CCNA 5J1EA 1D3YA 2X6WA 1R49A 3CDBA 3SEQA 3CLQA 1RE1B 3NCPA 2G1DA 3I55S 3D1NI 1K1SA 1NPKA 4WF2A 1NTCA 4A8MP 2CQ1A 1GV5A 4DR5F 1BQNA 3OPKA 2F8EX 2HIYA 4O4GA 4IG3A 2XSDC 1ZRCA 3CCQS 2KRCA 1G4DA 5KFZA 4KQZA 1UELB 1DLOB 1NDCA 2DXIA 2JEJA 2XMUA 5F3ZA 1VTNC 2B4OA 5L3GA 3LA2A 2AJ4A 3DFGA 4ASNA 3MCNA 2ADCA 3QLHB 2W2MP 5J1RA 1YGYA 5E8GA 4OYAA 2DR5A 3GCMA 2K06A 3N6NA 2DMUA 2V2QA 1TTYA 2A68F 2BE5F 2N82B 1R5GA 1MD0A 1NPPA 5U47A 1CEZA 2V4JB 5CCMA 4Y2CA 3LALA 2XB0X 3S8PA 1RT7A 1A5JA 3U21A 3MEEB 4W4MA 4KO0B 3LSTA 5GVQA 4ED2A 2AZ1A 2XROA 4M5DA 2K7LA 2CIMA 1MROA 4ON0A 3ZZTA 1KR4A 1TKXB 1NK4A 5E3QA 3BN7A 3P45B 5F41A 3O2PE 2L9RA 2CQBA 1C2PA 3BR3A 1C0UA 4C0BA 1M1KT 2D1HA 1I94J 2R5ZA 2PGCA 1UKUA 4CIOA 5GAEI 2MZQA 4OI0A 5CVIA 3QO9B 2DHSA 4AE5A 2FNAA 2VG5A 3HZEA 1WSVA 4OYOA 4MYTA 1A6IA 1SVDA 1YLXA 4C3LA 1AROP 1KVJA 1RT1B 1I3OB 3RTVA 4LF2A 4XSZF 2DVIA 3G82B 1WHXA 4J9LA 4EGLA 4CCHA 3TAPA 4DZDA 5ITHA 1ON1A 1S0OA 4ID8A 2DPIA 1UA0A 3BV8A 3UWTA 3HO1A 1XTZA 3I82A 1Y5NB 3ET6B 2KT2A 4ZDNA 1VI7A 5EG0B 1QVTA 2IPQX 3N97A 4C8OA 2QENA 2OPSA 1T9YA 5BYSA 2EH3A 1GT0C 5IYBJ 3P6YC 4C7QA 5B08A 4YY3F 5F8JA 2J9CA 2QJ3A 3LP1A 3AXKA 4EJUA 1S7EA 5G0RB 3CUQA 4JX4A 2FTRA 3MMYB 4ETSA 3J81Z 1X3ZB 4A6DA 4YFNF 3R27A 3PEHA 5KFPA 2Y2ZA 2EA4A 4ZHRA 4GCVA 3ET6A 4ECUA 4BYYA 1FI4A 3NWGA 2DY9A 2KO1A 1Z3XA 1YI2S 4F4YA 3HHNB 2QSHX 1TUVA 1X4OA 4B3AA 1VFCA 1USSA 1PDNC 4BL0B 3P9CA 2X1AA 1RPWA 1KQGB 2HNDB 2NZCA 3J80Z 3OXGA 2MSYA 2VKEA 2R7WA 1F1BB 3BROA 2GA7A 4P5OA 3ISND 5CVJA 1IWAA 4EO6A 2VPYB 3K4CA 1YW9A 1IDYA 4RLQA 3PEJA 1U8RA 2P9EA 3W5XA 1U6FA 4I4BA 2NNNA 5FD5A 2LKSA 5AXKA 4H4MB 2E1MC 2CJ9A 2Z56B 3WU2C 4G1IA 4IG3B 4IOAQ 1BQNB 2OELA 2E7WA 4ZN3A 3IUOA 1M1GA 2ZVIA 3T0YA 5KK1A 3LNQA 1D09B 1FDDA 3I58A 4UOCA 2GQCA 3M6WA 3OWTA 1R1VA 2LR8A 3G8SA 3BYPA 4EQQA 2DK2A 3KLHA 4DS5A 4KGKA 5FRNA 3D4JA 4CLPA 1VMBA 3WU0A 4Q48A 4ZITA 2XB2D 1N4LA 3LPYA 4R0JA 3ZNJ1 2NOJB 4Q8FA 3ZZZA 3B73A 1LE8A 4MKVA 4DEZA 1QRYA 3ENAA 4RUHA 4UVCA 1EA3A 3DGPB 1EAYC 3FKBA 1VQ7I 2VQCA 1JLBB 4DX6A 3Q22A 4BBRJ 3LP2A 3BGLA 1KVKA 1AFJA 5HATA 2NPFA 3CMMA 2B8QA 2I2YA 3H5NA 2DGVA 3OVAA 1E6YA 1ZZNA 3OFFA 1SFEA 5HP1A 2XWYA 1HKAA 3KLFA 5B1BH 2GHPA 4YEJA 1AWCA 1F60B 3FXQA 5CVRA 1KQFB 1W7WA 4FT8A 2BBEA 1UW4A 2E1CA 2YH1A 4ZOSA 5LL6d 1LFUP 4FVMA 3HRTA 2P0WA 2JN6A 4DDFA 1YS6A 2MGZB 1IV6A 3IC7A 3OR2B 1FPQA 2R2TA 2JOQA 2EV5A 1PAUB 4U7BA 2L7FP 4RKUC 1BL0A 3I0SA 3TA0A 1HWIA 5KG6A 5AE3A 4ETZA 1Y5IB 3M3YJ 2AU0A 3W5ZA 3CF5Q 3QT8A 1TELA 2R2SA 1HW5A 3KPHA 1QE1B 4UW2A 4FS1A 1WEZA 1S6PA 4FASD 3BPSP 2EZIA 2CNOB 3OL4A 3MZIA 3M9OB 4CCKA 1X8DA 4ECTA 3DU6A 2R7FA 1CGPA 2HKOA 2CQIA 4ZJOA 2KFZA 1U6BA 3A4TA 4KH0B 4OIPF 1PC4A 3MMBB 1UVKA 4NCGB 3D0IE 4PYAA 2FBKA 2DYAA 3OFHA 2D3UA 4ZPCA 2A6TA 1RISA 2ZBPA 1Y56A 1Q0NA 2E5HA 1Y10A 2V9KA 3QSYB 5SZTA 3PNTA 3M2VA 3HFZB 3TUZC 1UJ6A 3SCJE 2AYGA 2DT9A 1FK9B 4BY1J 4KBIA 2DITA 4XAKA 2F4IA 3MCOA 2VKDA 2RU3A 2F5DA 4DV5J 3GP9A 3J7Z5 2BE2B 3BTIA 3VQTA 2KRFA 3K69A 1R7JA 2YNHB 4PG8A 2IC3B 1BJAA 2M87A 3OXFA 2Z58B 3EQLF 4JI1F 1YIJI 2OEKA 3DMJB 4CZCA 3EYZA 3NAUA 4OL8A 2PMWA 4LOCA 3I0RB 4NCBA 5ETPA 3EVOA 5DD8A 2LDYA 2BM0A 2KIMA 3HGGA 1U4BA 3I54A 3CESA 2VPZB 3POTA 4IHXA 4BGDA 1VQ5S 1IGNA 4XBFA 1VC6A 2DBBA 1RSCA 1KWMA 4G65A 2WONA 4UZBA 2DMPA 1S0NA 3Q8YA 2CVEA 3J80K 2VT3A 4ELUA 3CCYA 4YHHF 2WBMA 5E3CA 1BOBA 1Z77A 1MBGA 4UV9A 4B3RF 5FFXA 4WE1B 4O0NA 4M5LA 2GX8A 1NB2A 1R31A 2AQ4A 4OINF 2WSFC 2R8JA 4IO1A 3FSYA 5M5WJ 3HDSA 1IKWA 1XEZA 4K59A 1C0TB 4YRVA 2OPRA 1AT1B 2EK5A 2F5CA 3H5AA 2DNYA 1CQTA 3LSRA 4U0VA 5L9XA 3UD5A 4BDZA 1AZSA 2Y1IA 1YIJS 3CMYA 5E20A 2LEAA 5EYRA 2EBGA 5BYRA 3WDOA 4F3MA 4USJC 3HMJG 3OFGA 3LSIA 3VYSB 1XJWB 4F26A 5D0HA 4DQPA 2CH0A 2W4PA 2P81A 2E1MB 2R0QC 1VRQC 5DCMA 1S48A 2GJFA 1CG2A 2B0GA 4W90B 2DNQA 5HLHA 3DF8A 4QYZJ 1YKWA 4C3KA 3HSFA 1FBSA 5J1PA 4IFVA 4NI2A 1PKUA 2CZ4A 2VE9A 3KP6A 3CB4A 5KHDA 2OEJA 2HK3A 2CXEA 5GADU 2OJED 1S9GA 1QSLA 5HLIA 4PG4A 1QZEA 4MHGA 2DNRA 3K2ZA 5LM7E 4QU6A 2LBFB 4ECZA 3DLLF 1JJ4A 2RQKA 1TL8A 3DV8A 2OAUA 3AAWB 3CUQB 2Z2ZA 3IRXA 3OVSA 3IL2A 2KRHA 3R97A 4U87A 3SSRA 2ZJRF 1QZYA 3FMQA 1WVRA 3VWBA 3J7AN 4P52A 4DCJB 2FJBB 3VODA 2P6TA 2RUSA 3KOAA 3Q8PB 2XMAA 3GLXA 5KFMA 3DLGA 4K4VA 2CMPA 3V6HA 4I2PB 3KG4A 3GFIA 1B9MA 3HVTB 4JBAA 1M5OC 4FYYB 2YKAA 5DGBA 1FEEA 4CNZA 1VBYA 1T3NA 1RT3A 3DLKA 2C42A 3W66A 1FVSA 4F3OA 4ALZA 3RPUA 1VCTA 1XSXA 2DOAA 2V1XA 2XGEA 3HSRA 4XKVA 2KT0A 3CCMS 3WBZA 2OH2A 2JA7J 4BWMA 2AF6A 3UPFA 3K5MA 1KHVA 4MK8A 4XORA 2ZD1B 3DLKB 4K4ZA 3J80Y 1YWXA 2R5ZB 4O5VA 4UF4A 1P8GA 4ED8A 2DOEA 4X66F 3KE2A 2B3TB 2CSOA 1FO1A 1WWHA 2UUAJ 1JX4A 2J0QD 2LDUA 4EFAC 2IAIA 3M4OJ 2GAHC 4A46A 1PC5A 4M3EA 2HGMA 4KGZB 1K6OA 3GJRB 4CRJA 2GS8A 2Q66A 1IZ1A 1MMSA 3S3MA 4A8OA 3K70D 2Y31A 3JSPA 1VQYA 4AL7A 5ETMA 3CGIA 2R42A 5HI7A 4KICA 4XL9A 1UVNA 1XDUA 4DR5J 5K9FA 3T5XA 3MAJA 2ETHA 4R8UA 4HKQA 4HNVA 1P7IA 1YQAA 4F36A 2H65B 2JVHA 2X6XA 1KU9A 3F3XA 2ZOFA 1QAIA 4DSEA 3I59A 2IA0A 3PJRA 1AA7A 2V2VA 3BT9A 2N4DA 5KFWA 3C2HA 1DGWY 2HQFA 1PYOB 2U2FA 3O6BB 3OJSA 2KU7A 2LDIA 2E1RA 1OQYA 2Z99A 3WTVC 2FYXA 2HHXA 2G0JA 4M72A 1DP3A 4A8WA 3JTOA 2AS5F 2ZITA 1C0UB 2JWTA 1X9WA 3EVWA 1H98A 4DR7J 3R2CJ 1T9VA 2ZE2B 4L9TA 3RBDA 1HA8A 5IZHA 1FKPB 2IJFA 4F4ZA 3VYUB 2F2EA 4WX9A 1H3DA 4D1QA 4PQUA 3D3BJ 3BQYA 3R5DA 4TY9A 2E35A 2Y8YA 2CJKA 3D7SB 4IG0A 5B0AA 2ALZA 4A8XA 2GXAA 1V55H 3MMJA 1R9TJ 1JKRC 3T1YJ 3JCUC 3H5RA 1ZRFA 1KLMB 4LVOP 3QRPA 2IA2A 3S1RJ 3FRZA 2YWFA 3OS1A 2J8SA 2VPRA 1QPMA 3LWLA 1R8BA 2ZHAA 3CO7C 4XKBA 1RT4A 4NLYA 1P1TA 1Y11A 4M94A 3J7ZI 3TBIA 5LD2C 3VSKA 5IOLA 4ZVRB 4G1PA 2A5YB 2E19A 4LRBA 4IOCQ 3T5HA 2H51B 4YB6A 2JPBA 1R43A 4USIA 1JLFB 4C98A 1GH8A 2D41A 2IBDA 3ASOH 2GLOA 3NGKA 2J0WA 2WOMA 4FHTA 3SZPA 2KM8B 4Q7AA 2XEXA 2H48B 1FTRA 3FBBA 2EWNA 3DRPA 4TU9A 1R5ID 5H9FK 2R8KA 1UPMB 4IOAF 4CCJA 4U7UK 3PFEA 2DPUA 4A4JA 1F2GA 3DBRB 5FLMJ 2VPLA 3TEGA 3OSPA 2HVQA 2LYVA 3I53A 4LR8A 1EB0A 3D6MB 5KFFA 2OTLS 3W2VA 2JC1A 4UQGA 4GKKF 3PIPQ 2VBXA 3M8EA 3COAC 1MG7A 1YBUA 2J6TA 1WWXA 1ZR4A 2JEFA 4DSJA 5J2PA 2DT6A 3VYTB 1IN4A 1HMVA 3HM5A 4AQYJ 3I5AA 5CKTA 4QU7A 1IXRC 2KJBA 2ZBCA 2VKRA 1Y4ZB 5GADJ 1BW5A 1SL0A 1LFPA 2PMZD 2CG4A 3QZ8A 6PAXA 4JI8F 4X62J 5F0HA 5BS6A 3BKFA 4WBFA 4IQXA 2LC2A 2FHKA 3C2BA 4JYAJ 3NARA 1U2RA 4XLCA 4RW9B 2VONA 2Y0MA 3BBBA 4FETA 1Y7PA 4EBCA 3V7RA 4ZYGA 2RHQB 2JSCA 3Q8QB 4K5RA 4HX4A 4LQ3A 4YQWA 3LWFA 2OTLI 2DU9A 2XGQA 5F08A 2WC2A 1X5TA 2CZ9A 1HNXJ 1JXEA 2LEPA 3FMSA 4RNOA 1WI9A 4LSZB 1IQZA 5KFKA 2M70A 1WH5A 2R7UA 4LIWA 3BDPA 1HWUA 4QBUA 4OHVA 1GMWD 1N88A 1G3SA 3E1SA 3ZZYA 3L2CA 4G8XA 5G0RA 3LAKA 2CQ4A 2MD0A 1LB2A 4O44B 2HR3A 4JP0A 3NKYA 2J0SD 1LXJA 5KG2A 2AW0A 2Y30A 2E5LF 1FRJA 2W01A 4DL2A 2XLIA 3KLVA 3MD1A 3WIVA 4ETXA 3MECA 2NXCA 4M9SA 4AT1B 2VKZG 4Z7CA 4EJWA 1KEKA 2JEIA 1IN5A 2VASA 3TI0A 3E3VA 1GXLA 1JIHA 2ZMEC 2BRKA 2ZFHA 1N8RT 1WC3A 3RI4A 1L3LA 3R6GB 3W62A 2HG4A 1VQSA 2HVEA 3N6MA 1FYKA 4UOHA 4Y52J 1UJ5A 2C3PA 4ZZDA 2HBZB 4Q45A 2KIQA 1H38A 2CQCA 1PIEA 2ASJA 4YB5A 5CZVA 2O01C 4Q2LA 2J8AA 2G7HA 1G4CA 2MGZA 1VQMS 1N5TA 3A8KA 1MMDA 2H5EA 2ZBIA 1W7PD 2M7AA 2UVVA 3UI3A 3VFZA 3DBHB 2O1PA 5AIPA 4EBDA 2ZB9A 3HI9A 4DPUA 3KJNB 4WFNQ 3ZZOA 1UW9A 3GFYA 3CD7A 3MMCB 2AZ3A 3SHFA 4I6ZA 2QO3A 2VFSA 4K4YA 5SUHA 4YEAA 4DQSA 3DRXA 2HQDA 4NRTA 2FUG9 4I7FB 4NX9A 3TKYA 4BACA 1XSDA 4NPOA 3J7A1 3MEDA 5FLXY 4F4XA 3A02A 4BXXJ 3QPIA 5JXSA 4LBIA 1U1KA 1BC8C 2DR7A 3RJMB 5HVHA 4E98A 2XB5A 3I5CA 5JLXA 1RI7A 3LA3A 1N5VA 1EJ9A 2LECA 4I0BA 4OX9F 2PD1A 2XAHA 4XK4A 2E2IJ 1TV6B 4DIQA 3TA2A 1E0EA 2OU2A 3SV3A 3DTKA 1IKXB 3EE3A 3OS0A 1H0HB 2ZBRA 4ZHRB 2VIXA 2NXNB 4Y65A 2EI5A 1VISA 1NH8A 1Q8LA 3FBEA 3IH3A 3W6KB 5ETNA 4GXOA 3QGIA 2MLYA 2XMWA 4DI6A 4JYKA 2BABA 1LV5A 2AYEA 3C15A 2R93J 4ZLJA 2MJNA 4USMA 5KFQA 1N5YB 3HOSA 3J7YI 1W2IA 2HYFA 2X1FA 2QUFA 2MZ1A 4KHPF 5DM6F 4ENMA 1VQ8I 1LWCA 1VR6A 2M2EA 3Q8UA 2ZXIA 4O3OA 4W92B 1RTJB 2HVRA 3ZGKA 3U9GA 2AJQA 1S59A 1Z9CA 3JSMA 4DV1F 4RBTA 1C4CA 1U8WA 1JMTA 2D2WA 1HC8A 5RUBA 4XMYA 3R5BA 2UXDF 3BN4A 5HLFB 4GRIA 2EKNA 4XSXF 2YWKA 1X5PA 2FVPA 3DKWA 2P6SA 1ZA2B 4XRFA 1RT1A 4RB3C 4HEA9 5D5UB 1RADB 3I6PA 4WZMA 4DR4F 4D5FA 1FRIA 3F44A 4XDDA 5LEKA 1QA6A 4BQNA 4EATA 2DAOA 3TZZA 1NSAA 4F4WA 4HSTA 4R0EA 1WI6A 3U27A 1Q95G 1Z3YA 3LTOA 1ZM3A 2UXCF 2AQEA 4LFBJ 2DNZA 4IRHA 2LP4A 3AHPA 2JLFA 1X1CA 4IKAA 3CT9A 3FXOA 4UB8C 2AO9A 2OPQB 3GFLA 3I55I 2XZTB 2ATLA 3I5UA 4XTTA 1RT2A 3M32B 2J5OA 3CP8A 1VQ9S 1N0UA 3CTRA 3FKIJ 2JPCA 1B7YB 3QT6A 2E60A 3JAMZ 1MBHA 1ZGJA 4WWCA 1FTZA 2EIMH 2XGCA 1VQKS 3KX2A 1R00A 2F48A 2K3FA 3OR1B 1OYYA 2FIUA 2MLXA 4DFJA 4EV0A 2HQRA 4U7CA 2CADA 1XIQA 4Y0FA 2IGOA 3PRBA 3CMAS 2Z2LA 2B0LA 2QLBB 3QO9A 3M05A 2XS2A 3MFIA 4JI4F 4PR6A 5D0GA 1U1LA 5F27A 2GVDB 2ASYA 2RAQA 5D0RA 4PZJA 1UFKA 2JJ4D 3MKYB 3MPWA 1TP7A 3C6UB 1YW8A 3CDHA 1HD1A 5DQIA 5B66C 1D1AA 4A5NA 3Q24A 5BYQA 4ANDA 2UVUA 3SQGA 3GLJA 3LW5C 3BY6A 2CV0A 2E36A 4X0GA 3LQQA 2GAUA 4IDKB 5K5OA 2GOMA 2GFFA 1LWFA 3F8NA 2AQFA 1U1MA 2EK1A 2DTRA 1VLOA 1REVB 3AXMA 4BH9A 4EM2A 1RT2B 5KT6A 2LSOA 3Q5FA 2CW7A 3NY0A 5LSRA 4DQQA 2ZNYA 3AT1B 2QFJA 4S0MA 1FX4A 2QLWA 3VCDA 2XRLA 4P55A 2AT1B 3MECB 4BKXA 2A07F 1PBAA 2AGOA 1T38A 2QL9B 3M6XA 4PRFA 4EYIB 3UR3C 1T95A 5CABA 1VQOS 1BOAA 3UDVA 5K8OA 1NB7A 4DL4A 1D0EA 4E7IA 3X2QH 1TZ0A 2F9JA 1H72C 1TK5A 2F3JA 3S01A 2JLEA 3JS9A 3IM8A 1KD1T 2XY6A 3R6SA 1HNWF 3G6VA 3KMSA 4PPZA 2LQBA 3RB3A 5H2FC 2IXSA 3OTEA 2L7ZA 3O5TB 4I2QB 2EINH 2H1LA 3SFUA 4C9YA 3QPHA 1BWVA 3DRRA 6AT1B 4G7OF 2RQPA 3KLNA 4TVAB 3HD2A 4JI3F 1SL2A 1WZ2A 4CLTA 3TP2A 3UD3P 1ZM9A 1JGGA 2RKIB 4DZPA 2QLZA 3HKZD 2K8GA 4NASA 1S1XB 1B3TA 1ZAVA 1HPZB 3K5NA 1U49A 3W2AA 4EO8A 1B59A 3AKZA 1D8KA 3AA9A 2OF7A 3IG1B 2WTEA 1VQLS 2DNPA 3VR1A 4ZKAA 3EZ5A 4RLFA 2RVCA 2ZXWH 1KONA 1IWGA 1LQ9A 4Y15A 4ANJA 3FMBA 2VA2A 4ITSA 4IG0B 1Y0HA 4NXMJ 1ZKGA 3RB6A 1C1BB 1DRZA 2KHDA 4PUOA 3BDEA 3EUHA 1S1WB 3GYNA 5MLCV 1WHUA 2K9MA 2R5YB 1IKWB 2K85A 5LFAA 5GMKa 1FRMA 1Z1DA 3ZC4A 1J75A 2E7VA 3DC2A 5A0YB 2M8DB 4WFXA 4XPEA 3GFZA 3ISZA 4N0BA 2N3OA 1NRKA 5A8KA 2EW9A 3LWMA 3D0SA 5D0EA 5I4MA 2VZ9A 2VJUA 5TJJA 5LRRA 2ZWPA 1I6HJ 1KN6A 2ZHBA 2VDHA 3CMES 2W84A 3OL7A 3BR0A 5GAGJ 1MZBA 3V8KA 1RBOB 4A3CJ 1IXKA 2MG4A 5DDOC 2LF8A 1XD7A 4DGWB 2BRLA 2K7JA 3D1OA 6FDRA 4DCPB 2XIGA 8AT1B 1QJHA 2ZC4A 5AIQA 3JREA 4F91B 1TL7B 3ENWA 2BZTA 3GR1A 2ZVSA 4RNHA 2WY7Q 2YNIB 4YR3A 3I31A 2XF7A 3CCQI 3Q23A 3TA1A 4FKXA 2FBHA 1KTVA 3L1PA 3H2LA 3V6JA 2H3EB 4WWSA 4A5MA 1ITYA 4Y7NJ 1N33J 2CFOA 3PYFA 2B9SA 3CCEI 4UXNA 4L0YB 1R22A 2M4MA 3HM9A 4A2UA 1DP7P 4KIAA 1DBDA 2PJRB 3TEHB 4L9NA 1GV2A 2OA4A 5B0GA 3S2DJ 3U1LA 4ZVOB 2X1EA 5A8WB 3TJ8A 4K8RA 1ZHFA 3LSPA 2W8KA 5KT5A 2NREA 5K5MA 1PYSB 2B7BB 3CMEI 2JRMA 5LMUF 5B0DA 4AWXB 3JTGA 1ZOTA 5I3UA 1VYAA 2V1UA 2RDPA 1LXNA 1N32F 4HDGA 1MDMA 2CVIA 2IRYA 1W26A 2HPIA 3F56A 3HVRA 5K8NA 4UOGA 2R5YA 1OPZA 2R7ZJ 3IS9B 1JB0C 5GAHI 4J9RA 2PC6A 1BI2A 1GMWA 4IHYA 2BQRA 2KJVA 4QWQA 5D8KB 4CO4A 2QA4I 2YNGA 1J5OA 2L9SA 3TO6A 1MBEA 4DZJA 1HNZJ 5DUKA 2V34A 5J2PB 2KH9A 1FX2A 2B9XA 2DXDA 4C8KA 4DPOA 3CCES 2F4VJ 2ADUA 1S1VA 3JRFA 4NC7A 3LGNA 5AJ3J 5AE1A 2QX0A 2HOTA 1GXPA 3DLEB 4KO0A 3Q0VA 4IQMA 1XMXA 4HDVA 4ICLA 4F67A 3CC4I 1OKRA 1RTZA 2BE9B 3IRXB 1U6GA 4ZPWR 2HHUA 2HAIA 1PP8F 3FXLA 4KDPA 3NBPA 3Q2TC 2V50A 1T03B 2VN2A 1KYWA 3CJ0A 2QBYB 4S0HB 2HKEA 2HTJA 1N78A 1N6QA 1QPIA 5HDGA 2KLOA 4WXOA 3ZQCA 1OPCA 2BX6A 2MDAA 3GIRA 5KOWA 1NK9A 3TVKA 3A3PB 4IRKA 1NJXA 1TQPA 1I50J 3KLGA 4OLOA 3R7NB 3ZZPA 4GVBA 2NVYJ 2NYHA 2EFQA 4E2FB 5AE2A 1ZETA 2JA2A 4U0WA 2OPPA 5IQQA 3R6LB 1XNQJ 4L9VA 4XQFA 1E3HA 5HN0A 1EF4A 2CWKA 1HPZA 4Q8EA 3F8BA 2QV6A 4NZ0A 4OZ2A 4PK4A 1OO0B 1N34F 5DEQA 2E71A 3OLAA 3DWLE 3LFKA 3HHLD 1FEHA 1O6XA 1X9SA 5K7HA 3TEDA 2CS3A 2M5WA 4B1RA 4QW8A 1H73A 3PQKA 2PT0A 3F0NA 2EFNA 3LL7A 3FMRA 1JLEA 1B6AA 4D9JA 4DYCA 3MM6B 1RWPB 1SQGA 3FXJA 3CIMA 2VA3A 3JSMB 3TAMB 3FJ2A 4FF1A 4N9IA 3NMRA 2ESNA 3K89A 4LK0F 1LEBA 4OZ3A 2LEBA 1RAFB 2BMBA 4LIVA 1U6ZA 1VQ9I 3D68A 3H3UA 1D5YA 5KT2A 3OQ2A 2ZFWA 1VQPI 4P9SA 3A0BC 2Z4PA 2EC2A 3DXSX 3MMAA 3ITHB 1DAXA 2UXDJ 1S1TB 1X31C 1IKYB 4DR1F 3W65A 2R8HA 3HJVA 3MHYA 1MNMC 2DGUA 1FIAA 1OMSA 1GX6A 3RQIA 4JV2A 2BY2A 1KLMA 5KAIC 3LGMA 1I51B 4DL6A 1TW2A 4CA0A 2YPZA 4HRIA 1J0RA 2DY1A 5EN1A 1FX7A 2J9DE 4Z7YA 4M5MA 2QKMB 3T9NA 2IRUA 2Q2EA 2QEXS 4B9TA 1S1UA 1W5CC 3SZ2A 3REOA 2XAQA 4BC9A 4DQ2A 2AHOB 2BA9A 3THVA 2MQQA 3FCHA 3LUYA 1DHMA 1K7AA 1EKRA 2W2OP 5KG3A 4AIHA 2EZLA 3FBNB 1PYVA 3Q0WA 2KKHA 4XIDA 4ZH4F 2ZH9A 1S6OA 1X5SA 2PA8D 4J9OA 3C6TA 1BR2A 3GG1A 2OPPB 2BW2A 2QMWA 1TFYA 4ESBA 2W25A 5K1YA 3B78A 1Y3KA 4YDDB 2AGPA 3M1VB 1FT9A 2BKNA 3H5SA 3BC8A 3GTJJ 5LJ5Y 3DDKA 1PUFB 1XGOA 5ETTA 1R6YA 4DR6F 5KFDA 4IHVA 4DS4A 1IF1A 2HPMA 1OCZH 1RZ4A 4G12A 3HHGA 2K9NA 4LQ9A 5GAHU 2F1FA 5F8LA 3SYTA 2XAFA 1ZTRA 4IH7A 1NMEB 2L54A 3O8WA 4RX6A 2YQ3A 3FX3A 3BPXA 4Z2XA 5I42A 3PJWA 3CCMI 2JQ7A 5F3TA 1T05A 1ZRDA 4NCGA 5E3PA 3CLOA 2V2KA 1FC3A 4PJNA 2Q1LA 2QL7B 2YKPA 2V9VA 1W7PB 4JI6F 3SZTA 1JKQC 2DR6A 2CQXA 3C8YA 4M5JA 1MJAA 1JTYA 2H8RA 3HHLC 1NKEA 1L5UA 4YFXF 3I9ZA 4WTOB 4L18B 1RTDA 2KYZA 1MWQA 3HOTA 1Q16B 4O3PA 1K78A 2XMVA 2RUGA 3V7CA 1T08B 4USHA 1TFWA 2IVMA 2BBYA 4QWEA 4Z37A 1JKPC 2OC6A 1RT5B 3DM2A 1FNXH 4PDKA 2RSQA 5C2GA 3L2QA 3KNGA 2ZXHA 3KJVB 2HQNA 5F8IA 2CPZA 2IIHA 3C14A 2IRXA 1FA0A 1UJ8A 2V79A 1HNIB 2LA4A 3SXYA 5K14A 2KG0A 5KFTA 1VQ6I 4KKOA 1S6UA 1JT6A 3GZNB 1OCCH 3W2WA 1GXQA 1RRJA 5M2UA 3PRDA 3RCOA 2Q8KA 3ROUA 4ZP7A 5BJRA 4RAZA 2ADBA 4O3QA 2ECBA 3JTNA 2W1OA 4DPXA 2V8GA 4ENNA 4L75A 2DFIA 2BQ3A 1D9DA 5H20A 5L3BA 2YWEA 3K0JA 3U2RA 3MR2A 3T3FA 4V19X 1KU2A 3I71A 3QNWB 3QP5A 3CCUS 4A3MJ 4X65F 3D5MA 2NQPA 4Y13A 4CGZA 5EDNA 1Q78A 2HURA 4YIFA 1CQNA 3PKYA 2ZKTA 3W61A 2P5KA 5KCMA 4DG1B 5D6GA 2HHHJ 4O6JA 2W9BB 1SPBP 1NJYA 1S76D 3SCIE 3QYBA 3BLYA 3V6KA 2XCPA 1SKUB 1V5FA 2UV1A 5M3MJ 2CO5A 4I09A 5DDGA 3FC9A 5K14B 4A0ZA 3Q86A 4G1QA 4K2XA 2E1AA 4K4UA 2VG6A 1UMQA 4I56A 3TUJC 1Z7LA 4N8NA 3MZHA 1D0YA 1LWCB 1UB9A 4XRSG 3S1MJ 1D9FA 1WPKA 3R7SB 2DA2A 4USKA 3HVWA 1SD4A 2N7YA 4CO5A 1K6YA 3GU0A 3HG9A 1H2TZ 2RJZA 4WK1A 4RW4B 2QC3A 1RETA 3NS5A 4JOMA 1FMWA 2CQKA 1QD1A 1DTTB 1D8ZA 4URGA 1EH6A 3T8RA 3HUGB 4ZIWA 3N4MA 1NK3P 3V81B 3P5BP 2ILYA 3G73A 2CJAA 5KFIA 1UEKA 5LLQA 2V6CA 3KK1A 1D1BA 3CD6S 2U1AA 2HGLA 2Q3PA 2H5JB 1L3KA 4C2UA 2WVFA 1XR5A 5HMWA 3DQVC 2FBIA 2XGXA 2YH0A 2OJ3A 1JUSA 4OI4A 2ECCA 2XLKA 2Z2MA 1S1VB 1YLFA 1B4SA 3OHAA 2AP6A 1W5SA 2YXLA 4AD6A 2VIHA 5F04A 2CQ0A 2WZ1A 2DHGA 1T11A 2D9OA 2GBYA 5A6PA 4YMEA 5KFJA 1AB8A 1FYMA 4FF2A 1KA8A 3ZP5A 1K79A 3IKVA 1FIPA 3WC2A 3DRSB 3TAMA 2BXYA 1YHQS 4DR7F 2X3GA 2KFNA 1N56A 4AIKA 4QIWD 2BVMA 2RC4A 2DEJA 5DJBA 4TY8A 4GO7X 4QIEA 4NQWB 2Z2YB 1HOMA 1IXCA 1O57A 4LF8J 3L4BC 1OCRH 2OI2A 4DLEA 1Z6RA 4Y6IA 3N01A 5CAAA 3EYIA 1Y6IA 4MKAA 1T39A 2FB0A 2A18A 4UZCA 1AOYA 1EQ0A 1NDKA 2CDQA 2OQGA 2GC8A 2NLWA 2B6AB 2WAQD 2YSRA 3NGRA 4MAKA 2QN6B 1N36J 2XPUA 3MVPA 2UUCF 2QSFX 2ZSHB 1YJ9I 4UTGA 1Z0XA 3FVYA 3PR4A 5CXTA 3W2WB 2DO0A 2B63J 4X64F 4A0YA 1OR7C 4DR3J 2MEWA 3TOQA 2DA7A 4USUA 3IH4A 1UMJA 4HI2A 1RA7A 2DK8A 2L4MA 4ZVFA 1K8AT 1F4KA 2CJYB 5C25A 2H1YA 3THPA 4FXDA 3LQRA 1XCBA 1ODDA 3V8LA 4DU8A 2YWWA 2ZZTA 5F6FA 4AUXA 3SFIA 2L08A 2RIJA 1UWAA 3W3SA 3K1MA 4M3GA 2XO6A 3S93A 1DURA 3ETMA 4I2PA 1X4BA 4QPQA 1WI8A 4NLUA 2DCLA 2AJFE 1TKTA 1TTHB 3MOJB 1FOWA 2O8KA 2XC7A 2VPXB 2GW8A 1HBOB 2ZDOA 1FZPB 2PI4A 3EUAA 1FJGF 3K1NA 4EK2A 1U3EM 3M8RA 2BHZA 5DM7F 1ZS6A 4HDUA 1SXLA 2G4BA 1J9IA 4RWWA 2GA2A 3QPLA 4OHZA 4I98B 1J27A 2UU9J 3EZUA 2CJBA 1KS2A 3MR5A 2FJWA 3X1LB 1AYEA 3ZMTA 3B54A 3CCTA 4B8XA 3JQKA 3BBCA 3VDXA 3KEOA 4GVLA 3E6CC 3GTPJ 3GW2A 4MIAA 2NSCA 2G0IA 3I96A 4J37A 2RRBA 1YW7A 1PVEA 3IV5A 1HNVB 2HHHF 2FQ3A 3FK6A 2NUUG 3WX8A 1RUSA 3L09A 5DDRC 3C16B 2OD4A 5F9LA 5GAEJ 3E3XA 4A3EJ 4KJIA 1UVIA 2BUNA 1XMBA 4KFBB 5JFRA 4XLAA 1NDPA 2FD2A 1XMQJ 3VAHA 2QSFA 3TQ1A 1RUOA 4KGVB 3MD2A 5HQMA 3FSIA 2LU2A 2K40A 1ETXA 1JJ8C 3OTDA 3LFUA 2YQ0A 1NZAA 1T9UA 4DV2F 5ETVA 5LEJA 2MQ8A 2CQHA 4OMZA 5HBMA 3ILOA 2ZFUA 2IA6A 1VNDA 1TQMA 4C8ZA 2I8EA 1Q86T 2WRMA 3DDNA 3HOUJ 1TUWA 4FKYA 5T14A 1STZA 1CF7A 2G9WA 2CW8A 3TX8A 4UY85 1LW0A 3GYGA 4F92B 2HFSA 2MKKA 5AXLA 4GO1A 5D4LA 2MKJA 2FHJD 2MH9A 4J9VA 3WODF 5HJYA 4F50A 3NEUA 4MK7A 1EH8A 3NNAA 1HHSA 3DRSA 4M9XA 2BOLA 1N32J 3HDDA 5HJXA 2O5RA 5M2PA 4E7LA 1XQIA 1O3SA 3EXCX 5JVHQ 4RWXA 3BH6B 1LKXA 2PJPA 3UKGA 5E3MA 3D66A 4UY8T 4M71A 4ZLNA 9ATCB 2EEYA 1R0AB 3ELKA 3MI7X 2ZD1A 1PBUA 1IBCB 5T7LB 2BV6A 4EJOA 2E9TA 1IRFA 1K83J 3D3CJ 2V69A 4N56A 3S1TA 2ZSIB 1SJ3P 3FK4A 2WV1A 1RR8C 4ZVSB 1I5ZA 4MH8A 5IT9K 1A6QA 1ETQA 3I59B 4PPDA 2GZOA 4XONA 4WP9A 2O61A 4KHMA 1YE9A 3B6BA 2K86A 2XF5A 4DX7A 4KR0B 3BSOA 1SFKA 3TAQA 5AONA 5LXYA 3CCUI 4FXWA 4U8VA 4NEYA 2KL8A 4N41A 2V4RA 3MPYA 3HOXJ 1FJ7A 1HKTA 4ZTFA 1T02A 2D3O1 3PIPF 2BJ1A 3FMWA 3N5FA 4B3MJ 1D5VA 4QCLA 4WCGA 2CUFA 3HL2A 2WB1D 4O3MA 3FBCA 2B7CB 5GAGU 1FOXA 5ETSA 3IFEA 2AV5A 3FEXB 2VQFF 4UUXA 1WJ9A 1E17A 1JLGB 4WF9Q 2BM1A 2KHCA 5BR8F 3L00A 4BQOA 1NSPA 3R5GA 1JLBA 3M7VA 1YVFA 1ZG1A 4B9VA 5EJCA 1EH7A 2QBYA 1WEXA 1F1ZA 1AW0A 1SH2A 4KFBA 4PWWA 1TUGB 2VUGA 1IRXA 3RUBL 2AWZA 2ZBQA 3H9QA 3G9CA 2OO4A 4WXDA 3H90A 7FD1A 2HNZB 4KIBA 4BJTA 4DZ6A 4PAAA 2R8GA 2EFPA 4F0HA 4IL6C 1EV7A 4NC6A 2VODA 2QWWA 1O7FA 4PQUB 1S77D 2HHQA 2CRLA 4V1Ak 4KHRA 3ZTOA 2VQEF 4YDXA 2XQCA 4K0KF 4LSLB 1SH0A 3TANA 3ABKH 5KG0A 2AHQA 3ETOA 3BR2A 5EGOA 2MY8A 3NL0A 2G2OA 2WVCA 1DY3A 4FX0A 2G0EA 4I2OA 1HLWA 3DNCA 1V54H 3RKXA 2DRDA 1VOMA 3VVUA 4XKCA 2L9VA 4QOTA 3ECHA 3VB2A 4HX7A 2DNKA 2L9WA 2ACYA 3MAQA 2BANB 1B0TA 1C4AA 2VFRA 3TW0A 4IHSA 2QT7A 1BBYA 4HACA 2BY3A 3X3UA 1Q79A 3QGHA 3E6BA 3MN2A 2NXNA 4X4UA 2QQ8A 4ZN1A 2RN7A 1WHVA 3NGDA 5IWAF 1SMTA 3FCVA 4LF5F 2V1NA 1FJLA 4PFOA 1NBEB 1APSA 3KUEA 3HXLA 2BXJA 2HS3A 3BB5A 1UCRA 4KNYA 3PO2J 2J76E 4ZYDA 2XY5A 3HHHA 5KFHA 1F43A 3QJLA 5EGYA 4DV4J 1NK2P 1RWVB 4F55A 4BS2A 3BR6A 1G3WA 1H9GA 3Q89A 2XHKA 2H54B 1PGZA 2HI3A 2K1RB 2FJ1A 3QYYA 3BO3A 3MEKA 2O66A 2Z0GA 4EZ6A 1OISA 2M7BA 5LMUJ 4ZYEA 5GAEU 5EUHA 2IYIA 2JFKA 5KG4A 2GVZB 1CS4B 1XMOF 4JI4J 1WI3A 1S57A 2EILH 3JYTA 2L3MA 3P5TL 4A3GJ 5CPRB 5D4SA 2CRGA 3KTQA 2DCEA 2FD5A 1POGA 1FYLA 2CQDA 3QOPA 1S9EB 1C1CA 3QAEA 5C4XJ 3ZQQA 1MBFA 3GV8B 4NLDA 2E5NA 4CTAB 4ED5A 1SV5A 2E9ZA 2KDZA 3FM5A 3HSDA 1KC8T 5BNGA 3D6HB 3CC2S 5KAFC 1JE8A 2L7KA 1RTJA 3GFMA 1OY8A 2BQUA 2HHPA 3MTKA 4RB2C 1X5OA 3EUHC 5FLXU 5DLGA 4FE7A 1TKXA 1O4XA 5FJ4A 3OR1C 3SSQA 4UNOA 1IBLJ 4DN9A 2DFEA 3VEPA 1EKSA 2V9WA 3GWCA 4RS8A 1WKLA 4IRIA 3SEOA 1BI1A 3DLAA 2ZM6F 4CLSA 1CC7A 1Y00A 5K20B 2G1HA 5DV5A 2BJ7A 3PJXA 3WTUC 5HANA 3J80U 4KJZA 5KG5A 1K1QA 4TU8A 5IC4B 3EZOA 3H2UB 1QUPA 1SD6A 2JX2A 5FJ8J 1UTAA 2LK2A 3FFIB 2A6HF 2R3SA 2HWHA 3EGWB 4F25A 3A4CA 3S16J 3VAGA 1GT8A 2WA0A 2HFNA 2MTLA 2AXTC 2W85A 4I01A 2MLZA 5D6EA 2I8DA 2E66A 3RKQA 5HS8A 1NKCA 3A3NB 4DW6A 3FXKA 4ED6A 3ISNC 4ZJZA 2QLXA 1FFSB 3KUHA 4DV3F 4MTPA 3IAS9 3LA7A 2ME6A 4LRCA 3MMCA 3TUPA 3OBIA 4LUBA 1AKHB 1S7HA 4ED7A 2XV4S 1EHWA 3AD8C 3DGVA 3G4SI 3SDGA 1P6RA 4J9PA 1Z91A 3HGYA 2ZO4A 1RUNA 2FMYA 1BLUA 3ENVA 2LXFA 1J59A 3K9TA 1KNZA 1NM2A 1RAJA 2EKYA 4LIRA 4OQJA 3BO2A 3OV8A 5CA5A 2HYJA 3PG9A 4AL5A 2X51A 2Y3YA 3HHKA 2QSWA 5BR8J 3G6YA 1MH3A 5GPCA 2QLJB 1HMVB 2RV8A 2K27A 1JGSA 3FZVA 2LQ8A 3QMQA 2ZH2A 3DOKB 5HODA 2F8MA 3HB9A 3CP2A 4NLRA 5C25B 2VL1A 2UU9F 2ABYA 4CI0B 1YJ9S 4CXFA 4A8QA 1IG7A 1RWOB 4Y34A 4NXMF 4FTHA 1SVOA 1TKTB 3SJMA 1RKIA 5CHCB 4CICA 1W1WE 4B3MF 5E3OA 4L5JA 3V4GA 3MCMA 3KNAA 4P71A 3DYAA 3KETA 1XWLA 4DSKA 1DTQB 4E6KG 3T1HF 4BJ6C 4K4WA 4HQEA 2NS8A 5LHIA 2DH9A 5JVTA 2GMJA 4RW8B 4MIMA 3NP5A 1FP1D 4HLXA 4AYBD 4WE1A 1LNWA 5LBQA 1FMVA 1BY9A 2OFHX 3IN5A 3T9ZA 1FY7A 2ZKZA 3GTMJ 3G82A 1IJEB 3EMTA 3H4BA 1TK0A 2M9HA 2P7VB 3GFJA 2UUAF 3GTLJ 2DIUA 1FTCA 4NLOA 3K5OA 1OFCX 2MKYA 3RU0A 3OIOA 5K7FA 1WC4A 3HOZJ 4CO0A 2G7UA 4OWRB 3BQ0A 4JI1J 3PRVA 5L1LA 2XUBA 1SAUA 1SQFA 2HVHA 3BJAA 1JLAB 1ON2A 1R6RA 1HKQA 5GADI 2JRSA 2DDBA 1HHQA 4UQTA 2XC9A 3Q8VA 3FXRA 4DYQA 5J3LA 2XDVA 4O3SA 3F41A 2J6UA 2ZJ2A 3ULHA 3LOUA 3F73A 4DR2J 2BKPA 1C0TA 1MWYA 2EBEA 2MA3A 4EEFG 4ZVUB 2E5IA 4G1QB 2P8IA 4LRAA 4B09A 4ZVGA 4DQIA 5IT4A 1T0FA 2DODA 1Z4UA 1TAQA 3FXMA 4L3KA 4ZP9A 4KB7A 5EHHA 4GC7A 1U1RA 2E5JA 1N33F 5C44J 3V8JA 4PG5A 3CJ4A 1PILA 1CLFA 3F8MA 2CQGA 4K50A 1PUEE 3MMBA 3T41A 3HT3A 2GIVA 3CD6I 2X1BA 2IFXA 2D1VA 3BGUA 1ZARA 4RW7B 1S99A 3DKDA 4E8UA 3CF2A 3K8WA 1IJWC 2OZUA 1SUQB 2GMHA 1XC9A 1MWZA 1Y1VJ 1U78A 1FWKA 1V5GA 1KQSR 2JA5J 2DI3A 3V6DA 3OYHA 3LSHA 4L9JA 1GMVA 2QL5B 3GZ7A 5D15A 5DRKA 2XYGB 4JV0A 1WDDA 3ZQFA 1U8SA 2UZAA 2M8HA 1BR4A 3CC7I 2UUZA 5J2QB 2HZTA 3F9KA 1IUYA 1OQ6A 1G6NA 1CJTA 4IKFA 4ENKA 2JK3A 1SC4B 3K2YA 4RNFA 2MQNA 1W36C 4KHPJ 2B9WA 3MM9B 5DM7Q 2AEFA 1U02A 2I5JB 4IFYA 4F8RA 3AG3H 3K8VA 1P4WA 2LLKA 2ESHA 3M8ZA 2W9BA 2HEOA 5DQHA 2Q1ZB 2RQCA 4I0AA 4Z2YA 1NXIA 5KFVA 4N4NB 3LQVA 1SEUA 3OS2A 4A12A 3IWFA 5E18F 4ZDPA 4ED1A 3DCFA 1H0MA 3NGTA 1FCAA 2ZNZA 4X4QA 3RTRA 5M3FJ 3MKZA 3ZTPA 1ZQ3P 3GZ6A 4FISA 2X4HA 2FJAB 2WAEA 1NK7A 2I6WA 3HCXA 1MSWD 3B8HA 2UXCJ 1L3SA 1CULB 1HI1A 3CJNA 3F21A 4FDFA 4K4SA 3H4DA 2V1DA 1OPIA 5E0OA 1JLFA 1R4NB 1RHJB 4L72B 1SC7A 1YG0A 4WP3A 4HPQA 3E5UA 1KU7A 3V4IB 5FKNA 1T9XA 1TK8A 2LH9A 4HI1A 2OUGA 2FLNA 2NVQJ 1X4GA 3QFWA 3CCVS 2ELJA 2XBPA 5J4YA 3VWSA 1SJFA 5KFXA 3DHWC 5LMNF 3AOAA 3UQSA 2YNFB 4X64J 2COMA 1QHGA 3UDEA 1S6QA 1UG2A 4LF7F 1R0CB 4OZNA 5TISC 1GAOA 4GC6A 2OQRA 2R2RA 3KLEB 1MNEA 1TNTA 2H94A 4CO3A 2TDXA 4A47A 2BHYA 1HLVA 3KJVA 2MQMA 1S10A 1K47A 1B9NA 3M1EA 2WBRA 2JUCA 1IBMF 1SFUA 4DL3A 2F4MB 2LKXA 1A7GE 3EGVA 3PW7A 1SB6A 2E1PA 1V9OA 1UZCA 1GK8A 1U25A 4P9FA 5CJ9A 1FD2A 5KFNA 3TO9A 1V3FA 1P4XA 2W4DA 4J9QA 4M74A 3J7YJ 2R2UA 2A1BA 2IGNA 5D5XB 2X85A 1Y8RB 4RM3A 3FEYB 3HF5A 4Q5VA 3SFZA 3KKFA 3PJ9A 2DEIA 3LP2B 2PLYA 2FE3A 1RT4B 2A61A 3Q2SC 3PNYA 5KFSA 2CJXB 5J1NA 3NWTA 5HL7Q 2HWVA 2M2BA 1T05B 1HQUB 2IHR1 1TQIA 1VS3A 2LFVA 3EGNA 5DQGA 3L95X 4W97A 3BZQA 3ICLA 4IHWA 5F8GA 2M30A 3OFEA 4BAYA 3RZOJ 1AU7A 1R8AA 2XULA 3FZ2A 5J1UA 3M9MB 1NK6A 4L0ZB 2IBOA 3K4JA 3CWJA 4EVIA 2B4VA 5A76A 1X4EA 3MEGA 2C3MA 4N7TA 3BZCA 4Y33A 3C3LA 1VBXA 3GSIA 2FJVA 2WK4A 3TWZA 1R8CA 3HSJA 1FBQA 2IVFB 1QAJA 5HQ8A 3FUYA 2XY7A 2Y1JA 4S05A 1K0VA 3GMGA 2CG8A 4BE1A 1Q5VA 2DH7A 3ZQ7A 1GXUA 3BR8A 4R5PA 4QR2A 1ZR2A 2HXOA 2QEXI 1RT7B 2R7DA 2ZUAA 2AX1A 4EBEA 1E3OC 3LSJA 4I69A 3S3OA 3PNIA 4MNUA 2ZEJA 1EARA 2GXBA 1ZPVA 3PO4A 4GFBA 3MGJA 2LXIA 1HW9A 2BW3A 4RU9A 1YX3A 2HMIA 3I0SB 4RBOA 1IXSB 2C2EA 4U96A 3ASNH 1RU1A 3J81U 3G1OA 1YZ7A 3RYLA 2V9PA 1M5SA 1BI3A 1F9EB 1P9QC 4UT4A 2DNGA 1FE4A 5TRDA 3IM9A 1FWZA 5E2QA 2Z57B 5GTHC 1QVGR 3BEGB 4KE5A 3HLUA 1K9MT 1RWUA 1U26A 2M45A 2NCKL 5D8HB 3S3NA 4XLPF 2YKNB 1YTYA 1YQHA 2M9KA 4Y2KA 2FF4A 1JLQB 3RGIA 3PSIA 3O3KA 4EJTA 3ZPLA 2BJ3A 1BQMB 4O23A 1ZLJA 3HFKA 4ZYAA 2JJ7A 4NYOA 3SXLA 2XGPA 3W9JA 1URRA 1YRNB 2GIQA 4OJ1A 2RRAA 3LMMA 4WIIA 2RF2A 5J8CA 1BJZA 2V6AA 4USVA 4DV7J 4LMYA 1A35A 2NR0A 2CPFA 2MZJA 3MTJA 1P7JA 3D2WA 4DUTA 3CJSA 1H89C 4L73A 2LP0A 1YHQI 3HHEA 3TZXA 1VJWA 2XVCA 4W98A 1WQ2A 1ZELA 3CCJS 1PJ5A 2A6OA 3OYGA 3BOQA 1X2NA 1HD0A 1X4CA 3NGSA 4OU0A 4JYAF 3QWUA 4M1KA 1HA1A 3QQCD 2VFVA 4O3RA 3TW6A 2M4KA 5DS9A 1VRTB 3KP7A 3KLIB 3BR1A 1ETVA 1XR7A 3MMAB 3LAMA 1JKHB 2G2YA 4ZCKA 3ZFVA 1RACB 1NO8A 3M1CA 4G7ZF 5B0CA 2GO8A 2KRRA 1X19A 1HQCA 2C3YA 4P1WA 3K5PA 4YELA 2WOMB 4MQVA 5HS7A 2CUZA 1ENHA 2CGPA 5IS2A 2PFBA 3SMZA 1IM4A 2O9LA 1O5JA 2KFDA 1JXLA 2Y9HA 4NXNF 2JSXA 3MM9A 1RT6B 5F9NA 4MEYF 1JT0A 3QT5A 2ZH1A 1IBKF 2IY5B 5HDNA 1VI0A 1I27A 3VZHA 1TV6A 4LVNP 2RAEA 3BR9A 1RNLA 3KDNA 2AX0A 5C42B 1XX5A 3HHLA 1L3TA 5C24A 1P92A 2BW7A 3MUMP 3O3LA 3N0VA 1UG0A 2B43A 3T5LA 3E7LA 4XLHA 4Y3OA 1YS7A 4LF7J 3D6TB 4C8NA 2DDAA 5HNHA 1FSHA 1G2EA 3B4MA 4ELTA 1KYZA 2CQQA 3MQ0A 1SQEA 2Y1LB 2CPYA 5B0FA 3V4MA 1WUUA 2OPSB 2AJ1A 1VF9A 4PG6A 1WC5A 4M9ZA 1G2HA 4FE4A 1IN7A 4LFCJ 2IA1A 1Y3JA 2Y48A 4DL7A 3W6VA 5H9EK 4FQGA 2RDIA 4N47A 2LU1A 1XMAA 1LVKA 2PO4A 2E34A 1M5KC 1A31A 2UXBF 4KN4X 5IOZA 3ZZUA 1RESA 3RYPA 1WG5A 2WB4A 3AQOA 2UUBJ 3VSLA 1FERA 2C1EB 2VKHA 2M8EA 4DYRA 2J7KA 3J7YU 4I7HA 2EPIA 2AXLA 1ZG3A 3OUYB 3RZAA 4H4OB 2PN6A 2COBA 4RGXA 2ZH4A 5HLGA 1RDRA 1ETKA 3OR2A 2H5IB 2V5HG 1J5OB 3L3CA 5J2QA 2VL8A 4U7DA 1XG1A 4O0IA 4DOZA 1AA1B 1I6XA 1U47A 2NZ4A 4CM0A 4ELVA 4XRMA 2PJRA 5KFYA 2YKQA 3EETA 3M8QA 1T2KA 2L01A 1XR6A 4CLUA 3CCRI 1VBZA 3OXLA 4H4KC 3GF2A 1U0HA 1JJ2R 1IR0A 2MQLA 2HLTA 3LP1B 2OPQA 2VOPA 2DGOA 4EEYA 4A8YA 3V2UC 3KLFB 1FEXA 4LR9A 3K5LA 4HNUA 1LK7A 2F5VA 2RU9A 3PO5A 3GYXB 1YRTA 1OMIA 1LW2B 4BC7A 3RPQA 3P9KA 2J7WA 1F3VA 4A3LJ 5FLXK 2GIRA 1VQNS 5IY5H 2CNNB 4C4WA 3WX4A 2PG4A 3NQOA 1YJ7A 3A1YG 5B09A 3PM1A 2V8DA 3WC0A 4WCEQ 1Z7UA 5H1SV 1R0BG 3VHQA 2IW5A 4KPCA 3MF5A 2AD9A 4J19A 1HYSB 2DXEA 3KG0A 2HMIB 1BUXA 1D1CA 4HOBA 1N77A 1VLYA 2JRTA 3OYEA 4XLNF 1R27B 3BO4A 2F6CA 1DGRM 3O8HA 3NRVA 1T9WA 1MMLA 1TLHB 1RT3B 2W9CB 4MIBA 2DOFA 1SCJB 3CO0P 5F0WA 2FJEB 1HW1A 3I4HX 1DARA 1YK9A 1QTNB 3F8FA 1RWWB 4OYMA 1VQ4I 4P74A 4X4PA 2QQAA 1H2VZ 1ZBTA 2V0NA 2XYHB 2DGQA 1BI0A 1KGSA 1HQEB 4CT8A 4C11B 4LFBF 3ZNUA 4B47A 3NS6A 4B9SA 5ICEA 1R5HA 5ETQA 4KGXB 3J7AO 4M5IA 2DB1A 2QTWA 2OD5A 3QJPA 3GONA 1IBKJ 2QCOA 2K5CA 3N5BA 1X4HA 2M34A 1H6KX 3RRGA 1U1OA 4BEHA 3EWGA 3M6UA 4MGRA 2COLA 1E3PA 5FKOA 1UCNA 1TZLA 4OIQF 2EPFA 1TBXA 2BJ9A 4B9MA 2FVQA 2E2JJ 4ZDLA 3V6DB 3H20A 4DV6F 5ICCA 2GM4A 2ZE2A 1ICEB 1APLC 3BGRB 3C6UA 1OS5A 3WGIA 2HGNA 4PXCA 3AB2B 3WIUA 1L0OC 3PR5B 2GGPB 4C8MA 4FYXB 1NEEA 3KLIA 2MLGA 1HBUB 4B3RJ 1Q7LB 5FIIA 3KMQA 4PZVA 2YBVA 2I5JA 1BIBA 3HKZA 2X48A 1SH3A 1FVQA 1I1GA 4CCMA 1RIOH 5DS7A 3OSFA 5IT3A 2HLUA 3ADAC 1ZPWX 3NAIA 4UVBA 2X7IA 2VFTA 2JFDA 3LO3A 1V5IB 4KIGA 4XLEA 2QQ9A 3NEKA 3QZ7A 4FF4A 2OIHA 2BOPA 3RJPA 1VHIA 3S1QJ 4NI2B 4D7MA 1K78B 2R7QA 3KK2A 4OYIA 3MM8A 2HOEA 2A5WA 1YX5A 2B7EA 3DKYA 3WG9A 2WADA 1J2VA 1P27B 1YG2A 2VQHA 4X4SA 1PYTA 4KV8A 2C22A 3K4MA 3PFOA 1CJVA 1FRHA 2AGQA 4D0PA 1X58A 1RR7A 2K3KA 1LFWA 4YY3J 7FDRA 2AMCB 3AJ1A 4NQWA 5JR3A 5JVGF 4U8YA 4WFAQ 3CJTB 5KAKA 3W9IA 1W4MA 1QAXA 4P73A 4CWBA 3VF0B 2KL4A 4DUZF 2KJCA 3CCLS 4MFEA 4BNCA 3EJMA 2DN0A 5IYCJ 2I0XA 5A2QY 2MKHA 2VHGA 2FHMA 2EV6A 3Q3SA 5HO4A 2ZC3A 1MKMA 2ERRA 1JJ6C 1IN0A 3KDOA 1LDKB 4XOPA 3AD9C 3BGOP 2Z3YA 4BDPA 1S12A 1NHAA 4DL0C 2LMDA 3ZQGA 3BP8A 1IC8A 2Q6BA 2E1NA 3JQJA 3CCJI 4JV1A 2QQBA 4B3OA 2QYOA 3KHHA 1BQXA 2P5VA 1MBKA 4I68A 4J00A 3CULA 1SJRA 4YS2A 4USTA 3CCWA 1PCAA 3R3TA 1IUJA 1IRZA 1U24A 4FYVB 1O51A 3S1NJ 2DHXA 3I87A 4AYBA 2HTSA 3K57A 3HTSB 1S6QB 3T8TA 2VOOA 4QWDA 4TV7A 1X9MA 4QPXA 1DTTA 1DLOA 2IDLA 1UL3A 3NNHA 2Y0SA 3CO9A 4ILRA 3JQMA 1HWJA 3P96A 4HACB 4RO0A 4LG0A 3CDLA 2FRHA 2QA4G 4N77A 2DA4A 3EDRB 1OY9A 1NJWA 1CS4A 2LY9A 1IKYA 1ZK8A 3F0CA 3WE3A 4G6VB 5IT0A 3MPUB 4NA1A 4JI5F 1LWEB 2QMUB 3CCSI 4PABA 2PI5A 1F5BA 4B9LA 2QVOA 1MMAA 4CUGA 1RWNB 3CJRB 2PA3A 1EETA 4V2FA 5DD4A 1WTFA 2DD8S 2DGSA 2VJJA 1VRTA 1U0SA 1DZ5A 1YBTA 2A6MA 5TGTA 5IM0B 1X1DA 2CJJA 2KHMA 5EWFA 2HVZA 3CO6C 3MDFA 4P2MA 5CCLA 1DPUA 5IOYA 2HS4A 1XNRF 3G71I 4RL1A 1CJKA 3V4IA 2GV1A 3UVJA 2NVXJ 1V5EA 2WAQN 4C2MJ 3JAMY 1OWXA 3FHNA 3TZWA 4OI3A 2JEGA 2OUMA 2YR2A 2NXUA 2W7OA 1MJ9A 2C2KB 5J1YA 3D5LA 3T19A 5LHHA 4I2QA 4EMDA 3DRPB 1TWGJ 2VV5A 1SIWB 4DHVA 1EQMA 4OYPA 3RBXA 3EVMA 3ERED 2FQQB 2RS2A 4DSLA 4QJVA 2MABA 2Y75A 4DV0J 3V5RA 1NU4A 2GO9A 3GLLA 1ZGWA 1HNIA 2C3OA 3ZOBA 1N5QA 2IPOB 2L5QA 3IWNC 3R60A 3ZXWA 3AODA 2GOXB 2Z30B 3CJ5A 3RDIA 4CLFA 2AJ0A 1NSKL 1J5YA 2CPJA 3MM5A 4RW6A 1FE0A 3QAHA 3I9V9 4AL6A 5HOOA 4LF9F 5F1RA 4FXVA 1I3AA 1G3OA 3L7WA 1NHUA 2ISZA 1NK8A 4DFPA 5E41A 3MXHP 5F1JA 1Q1HA 2ME0A 1MROB 4FVCA 1GVDA 3AG2H 4RB1A 1TWFJ 2L4AA 5B3SH 5FKKA 5J2MB 1X4PA 2CQNA 3ABTA 3OTOF 2HBQB 4HH0A 4YOEA 5JHUA 4KT5C 1UHMA 3ZRGA 4QR0A 4FPRA 2MLKA 2WVBA 2DIVA 1RKTA 5IP7J 3WTSC 3MCSA 4LMZA 3DXJF 2YNHA 4ZPDA 3HUGA 1U9NA 5FKLA 1MMGA 3K17A 1S29A 2MZRA 1XC5A 4AYBN 4U67Q 5CYJA 5E1WA 4C3JJ 5FB2A 4U9RA 2OSQA 4X1EA 2R7XA 2EIKH 1K0TA 2M3AA 2IJNA 2YKMB 1QNTA 3K58A 1QO0D 3CD5A 2XLJA 4RJVA 4LJZF 3HOVJ 2JC0A 3DM2B 3QBCA 4U7UD 4ZP6A 3K7AJ 5F8MA 1C0WA 5E3AA 3BWGA 4Q43A 4RW9A 4I6AA 1CPZA 3ZMSA 2A69F 4P2XA 2BZ2A 3EUKL 4G9YA 3W6JB 4ZPAA 2YTCA 2DHHA 4OOIA 2HSEB 2VBZA 2BEFA 3LGHA 2HOAA 4DUYF 3M2RB 4X4VA 5I3QA 2GJ2A 1BXNA 4QYZK 5D6FA 4TQRA 4Q47A 2ZZMA 3OL8A 4J7CA 2F7VA 2DO4A 2JZ5A 5ICGA 3IH2A 1R36A 5CYQB 1MSFC 4XN0A 1WG4A 3VOEA 4DUZJ 1IJFB 4J91A 1RP5A 1U7LA 3UFCX 5L38A 2YPYA 1VQ8S 3HPHA 1E6VA 1QHHD 1PG5B 2Y0BB 4RAFA 1DQAA 3EYYA 4HHHA 2W4CA 1TL3B 2KZVA 1RT6A 2BY1A 1WC1A 1JWWA 5DCFA 4NLWA 2YU3A 2DQLA 3GIIA 1UETA 2MYFA 1NSQA 2D1CA 3BG7A 1FFGB 1HL6A 1GX5A 4OX9J 3DLGB 1TT0A 3H8YA 3G2XA 2OFGX 1YI2I 2W9CA 3OY9A 2IT0A 2VD3A 2IMWP 2W7PA 4UB6C 4CO2A 2MKSA 1LEAA 5HP1B 1HDDC 3SFGA 1PP7U 1X7VA 2PEXA 4LGWA 2RDDA 2QYCA 3GXOA 4J9MA 2NUHA 4AIJA 1SBRA 2HNDA 1NDLA 3PFIA 3HRMA 3OR2C 4FPIA 3W60A 1YRUA 1Y5LB 1OYEA 4EUVA 3CVKA 2EXUA 1S7IA 3DPLC 3KP5A 4JX5A 4ENOA 3TOBA 1XPXA 1AHDP 2MSSA 5AJ3F 3GZ5A 2CNLB 3L9ZA 2O8XA 2HBRB 3ZMVA 4CH7A 4JI2J 4F52A 3NWRA 3WHBA 3TX0A 1ETYA 2M88A 3OL6A 2Y9ZA 5J1EB 4MEXF 3WE2A 1BWEA 2CDRB 3BKUA 3PIOQ 3NXZA 4IR1A 3HFVA 4Y00A 2LCWA 2DR8A 1F3FA 4BU2A 4DSFA 2FLLA 3LAJA 2ILZA 1OIAA 3ABLH 4F93B 2N8GA 5CVVA 1Y1WJ 3N6LA 4OYZA 3ML6A 1JNRB 2FOKA 1ZM4A 2LREA 3G8QA 4C0OC 1S9EA 5HDKA 1X60A 4H54A 2V68A 3NS7B 2ICWG 1HARA 2BW3B 4WYLA 1TVRB 4P9UA 5K5RA 2LQ5A 3CJQB 4KRWA 4RPFA 3W8GA 2RVJA 2X1GA 1W0UA 3K59A 1WRJA 3IAS2 4EMSA 4ZTJA 2QYGA 4ED4A 2PI0A 2FGCA 1WCMJ 3D54A 4IUFA 1SMYF 5L3FA 1D1UA 5L39A 2PFFB 4F7ZA 2KT5A 5KG7A 1EZZB 3JSRA 2FZKB 1FF2A 5E3NA 1Q8IA 3TP3A 3POTB 2HRYA 4M5DB 1QSSA 4NLPA 4URQU 3D5SC 4J5OA 1S6LA 2HQAA 4I0WA 1SV5B 1GXTA 3O44A 1UAAA 5CYVA 4A3IJ 1O3QA 8ATCB 3PQJA 3TMOA 1V3RA 5KFLA 3DXBA 1DFDA 3CZ6A 2DYRH 2DMTA 3C46A 5D4PA 2ZOGA 3H3ZA 4DN0A 5LHGA 3PO3J 4NLQA 3KK3B 4OZ1A 5LGTA 2GQ2A 2HQIA 3FBFA 1KQ0A 4CCOA 4EI2A 2XASA 2JSPA 2F5EA 1Z2LA 3P4UB 3GJQB 4IH6A 4DR1J 4CZZA 4YN3B 4K2EA 3JYTB 4EZ9A 3OYAA 5IPAA 3WTXC 4YUDA 3I64A 1W5TA 2K7KA 4PYDA 3K4LA 3FDSA 2PX9A 4ECWA 1MN7A 5EWGA 2CJQA 3R1LA 4OJ3A 2Z9OA 5J6XA 1ELOA 4TQSA 3IKTA 1S8NA 4V2GA 4BQQA 3I4NJ 5H9FJ 3JTPA 4Q0BB 5IT9Z 4HEA2 4D3GA 1VQLI 4WFYA 3G96A 4A8KA 3M30A 2FA5A 4ZJQA 1L3VA 1P9YA 2YX1A 3C3WA 3MEGB 3BF4A 5FO5A 3MM8B 4PJLA 2L02A 1F2HA 3RPUD 1T7PA 3H36A 4RAYA 4BHBA 4KA4A 3FCWA 2FX0A 5E1ZB 3QATA 5H6QA 1E6YB 2HU9A 5DYMA 3UDLA 5K8PA 5DUIA 1TKZA 3I56I 4AVZA 1H9TA 2UXBJ 1RB0A 3WQPA 2PMZN 3GTOJ 2QLFB 3I3LA 2L0KA 1JJCB 4I76A 5HS9A 2W2QP 2ZZNA 4M8LA 3ZQLA 3BG5A 2UWMA 1WOSA 1TL5A 1IQTA 4ZS6A 2VQEJ 3JR9A 3K4NA 5LRSA 3GR0A 2VQGA 1WHWA 1R4MB 2Y8WA 3US5A 1KLNA 1HBUA 2F9DA 4K0KJ 2CUYA 1SKRA 4NHJA 3F6OA 5T41A 4NE9C 1KDNA 2DRBA 3VPRA 1I6JA 4EJVA 5DG7A 4K4TA 2RHSB 3GB0A 2KN4A 1HCRA 3CJRA 2XSJA 5JHFA 1T03A 3UCGA 4L3NA 3MUTP 2DNNA 4LSLA 3A01A 1SD7A 1ZYQA 4TY8B 5CQGA 4RNMA 4PUSA 5E5NA 2Z2SB 3I4MJ 1OYIA 5H9EJ 1TT5B 4M3FA 4KMFA 1H88C 5ILUA 2D69A 1KHWA 2XAGA 1YO5C 3G1LA 4E7ZA 5A8RA 2IGKA 1FNOA 4MQ9F 1T8IA 1G3YA 1CJKB 3BR5A 4I1TA 2KG1A 2ROPA 4C3MA 1TWHJ 3AH6A 1ROFA 1S72S 2ZXJA 3N05A 1KU3A 3BJOA 3DLHA 2E29A 3KEQA 3KYLA 2ZH6A 4H4KA 4HH1A 3KCCA 1WELA 2ZJQF 1HQEA 3ZCOA 4R5PB 2DT7B 1B8IB 2BGCA 1R8PA 3FF5A 3PW0A 3FIWA 3TGNA 4FS2A 3R61A 2MPUA 3GTGJ 1JNZB 2OAZA 4V19J 3WTTC 3N28A 2DA5A 4C9DA 2E5ZA 1LFBA 4LITA 2UUCJ 1WF2A 1A04A 3PW4A 2LOOA 3DP7A 3VAFA 1GFWB 3DI6A 2MC3A 1S3JA 2R7VA 3IGVA 1FXLA 3HD1A 2ZC2A 3PNVA 2JHEA 3BSAA 1LWFB 3QGGA 3BBFA 3PACA 1R1TA 4LD5A 3T1BA 4NRUA 6FD1A 2R4GA 2IGMA 2HNZA 4BWJA 2JMWA 1UJ4A 3ABUA 5F0FA 1OJLA 4ZCIA 1TAUA 3DRRB 4AFFA 3RBEA 1JQGA 2HS5A 4I6WA 3A13A 1LDJA 2JUGA 2XSJC 3I0RA 3SCLE 5F8HA 4DLGA 3BPVA 3OOUA 4QZVB 5HROB 1OQ3A 2GVDA 3OJUA 1ITPA 3QU6A 1OYDA 3GFHA 1YJNS 3GO5A 3WTYC 2NVTJ 2HHTA 4LLLA 2CYYA 5FD6A 2KB2A 1FSEA 2ZH8A 5HMYA 1ZLKA 5E3RA 2J0XA 5IWAJ 4XPCA 3GYHX 1K4SA 2ELHA 2ROGA 1YYVA 4HV6A 8RUCA 1UHSA 1U5TA 2IS6A 3A8EA 5BPDA 4RR5A 3JSOA 2O7OA 1FWPA 1YJVA 2FXAA 4BCAA 2JNJA 2AEJA 1HBMB 4AXJA 3BSNA 3WTWC 3M2VB 3EXYA 3MEEA 2XZDB 3UCZP 1YFHA 4HT5A 3KK2B 3KFWX 1HNXF 1IBLF 4HTJA 4KITB 4M5HA 2VXZA 3D5RC 1C1CB 4YB1P 1GTHA 1LE8B 1IKVB 2DTJA 3A3OB 3RB4A 4XNFA 5LJ3Y 3D1QA 2MB0B 4E70A 1EX8A 1MH4A 2PE8A 2PMZA 3KXDA 1L3UA 4QPTA 1CULA 4G6TB 3QYFA 5HBMB 2NOGA 1R0AA 1LK5A 1PO6A 3E5QA 2IM0A 2OZ6A 1WDTA 5EEHA 4ZVEA 1XMQF 2K3IA 4ILMA 2CPHA 1R6VA 4JV5J 2BE7D 4LG3A 1EP4A 4JI0F 3VAKA 2HZVA 2GJIA 3SI8A 1GTEA 4WU2A 2FVRA 3D28A 3DPUA 4CT9A 3BZ6A 3G6XA 3SBMA 2GNKA 2B56A 2K4JA 4ZZLA 4JI7F 3VAMA 2IVYA 1NLKL 2GCFA 4KC5A 2CNKB 2WAFA 4MMOA 3G86A 4RDUA 2XMTA 4TNOA 1BMQB 3BJ6A 5IT9U 1MJBA 2P9CA 2LVWA 1F36A 4CO8A 2Q79A 1RT5A 3RZDJ 3F72A 4X4OA 2BJEA 2CW0F 3GIMA 1G59A 3CDWA 2HFHA 2XG8A 2I1RA 2DJWA 1AFIA 3IP0A 2RNGA 2FJDB 1HFEL 4A6EA 2BEOA 3AA8A 2A6EF 3KYDB 2KKOA 4KT6A 1RLDA 2YKOA 2VJ5A 3ESWB 3AY0A 3E01B 1R89A 1BQMA 4ES3A 2D45A 3JTHA 2XS7A 4DFKA 2DYSH 1FT8A 3NCQA 2B4PA 3FGVA 2Z16A 3I56S 1JXVA 1KSPA 4B4CA 3PX4A 1YRXA 4N5SA 1RU2A 5E8IA 4E4HA 1PJ6A 4IRCA 4ERDA 4G7HF 4UV8A 2JLGA 3W1YC 3EPIA 1DU0A 2HIQA 3PV8A 1N36F 3H35A 4DPYA 2D5VA 1ZAOA 4FYDA 5HNFA 4DR3F 1IKVA 2VJ4A 4TN2A 4NDLA 2A2CA 3A12A 1F9FA 3Q8RB 3H0DA 1WH7A 4TU7A 3OYJA 2D9PA 4YP3A 2ZUGA 4UOFA 1R58A 1B1BA 3P7NA 3M8WA 5DDPC 1HW2A 1U1PA 5KTQA 2RDJA 3L2VA 1GUUA 3OYLA 2R92J 2EK6A 2E5LJ 3AD7C 4DR6J 4ES2A 4BDYA 4NBQA 2HQ3A 3MPDA 1ULYA 1CJVB 4HF1A 3D9BA 2F4VF 1GEHA 5KT4A 3UD4P 2HW3A 2LF7A 5F0CA 2XMJA 5JI6A 4XDCA 3SZGA 4U95A 1EJ7L 4CO1A 3ILLA 2HPUA 1VC0A 5GPAA 1KFDA 4QWCA 1REVA 3ZTRA 1Q1KA 1S72I 3TO7A 2QA4S 1KFSA 2XS5A 2E1OA 4I67A 3OTOJ 2R8IA 4Y28C 3RRKA 2J5AA 2FZGB 5H6RA 2WVEA 5EEGA 1UVMA 3T1AA 2HZDA 1ZREA 4KKOB 1WJCA 4OV6A 2L3DA 2VFUA 2IJLA 2O0YA 1CC8A 3MUVP 3E8OA 2BJ8A 4WJBA 1SIZA 4WK8F 4R1HA 3G6EI 2GZWA 3BTLA 3CUQC 2UUBF 2FC8A 1YBAA 4CYCB 5ED4A 3BREA 4B17A 2HWTA 3I0TA 3BDDA 4LFAF 1ZG5A 3DYAB 1MN9A 5IP6A 3U02A 4ANCA 1YJRA 1T0TV 2Q6CA 2KISA 4RU2A 1P2FA 4D5CA 3GSDA 2H1KA 5GAGI 1JHFA 2FHOB 4D3HA 4ZC3A 3CMQA 2MMYA 3UR0A 4C8YA 2XPVA 1IDZA 2XNQA 3QWLA 4NLXA 3G1MA 1UWBB 1FHTA 3DOLA 1TVRA 4BHQA 4UUVA 4KIFA 5C7PA 1Q53A 1WJEA 3MR7A 4DV0F 1QY7A 1BGXT 5JVGQ 1O8BA 4M6XA 1CBKA 5IQ6A 2W57A 4IJAA 4BEHB 5D77A 4CTAA 2L7MP 2DK5A 3DEUA 4F7VA 1QE1A 4DG1A 2FLOA 2QZ8A 1X4FA 4HT7A 2JZYA 3DTEA 4K5SA 4LF5J 1Z2ZA 3PYEA 2C6YA 5C24B 3ZN0A 4KTQA 2HQGA 3PXGa 3JRBA 4G3IA 2VQLA 2A3JA 1PJ7A 2KI2A 2VBYA 3RQ4A 3HYIA 1LNQA 1WF0A 2CKWA 1O3TA 3GCWP 3R1HA 1C1BA 3M1VA 1S0MA 4FNHA 3A01B 1M1EB 3FNNA 2VE8A 1W0TA 3ZMZA 1OR7A 3TARA 4HA8A 2CV1A 5FDLB 1VQNI 4HYEA 1XTAA 2XGDA 2OCCH 2IJRA 1Z6TA 4CYUA 3OTCA 1NG6A 2RD5C 3QGPA 2RKIA 1XN7A 3SDEA 2CPXA 3KLEA 3RRHA 3KWMA 4ECYA 1WKKA 4IVNA 1TWCJ 3S8SA 1LOUA 2VICA 2HQ5A 3TDUC 3IC1A 4TLQA 1JLCB 1NK0A 5EX0A 1EIYB 4Z6YA 3TW7A 4DBRA 1S1UB 4M73A 4II3A 2HHVA 3PIOF 2WVDA 2YPRA 3TOAA 3CDIA 3VV2B 1R71A 1SJ1A 1VQ4S 1N5SA 1XS9A 2E2HJ 4YIIA 1B72A 4JI3J 2OHDA 1SC6A 1DJ0A 3PFYA 5D3GB 1MIJA 3N79A 2MXYA 2OD6A 2O3FA 4MJKA 4ZCMA 2G9OA 4DU7A 5AT1B 1RWKB 2K4BA 1ZM2A 1O0PA 3CDUA 2XM3A 1DPRA 2ZJPF 2ID3A 1M5HA 3CJ3A 3HSGA 2DGWA 5ETRA 3QIDA 1UEUA 1HSTA 1QVUA 1P4AA 2QFIA 3GV5B 4OZJA 3DKXA 1MBJA 5L1IA 3RYRA 3WZ0A 2JA8J 4H4OA 4I7FA 2B51A 3BTCA 4E7JA 3EPZA 2P2CB 4IFYB 3J7AY 1FDNA 5I3PA 3OYIA 4LFUA 4TYBA 2PMUA 2E44A 3AFHA 1VQ7S 4IO9F 1TNSA 3EGZA 4LREA 1X1AA 4TLRA 4B3SJ 3GX4X 2D7SA 2VC0A 2PBIA 1F5TA 5E7OB 3KP3A 4KISA 3PYDA 2BXZA 3IHUA 2LFBA 1LW2A 1NNDA 3THTA 4DX8H 3DMJA 3PDNA 1HWKA 1XK8A 3QOEA 2K1RA 4OYBA 3HRSA 4ID5B 1Q81T 3UW1A 3DDIA 3TP0A 2E5GA 1ZA1B 4KY3A 1TL7A 3AJDA 5CD4A 3LF0A 1HQ2A 2KP6A 3ZTSA 3MWBA 4X6AJ 5IV4A 2F4FA 4KAIA 1BIAA 2P9GA 5HMXA 4DV3J 3NRBA 5FROA 5DDQC 1KZHA 3LP0A 3H59A 4NLSA 2FNPA 5JMNA 2I9SA 2BV3A 1ERDA 1FK9A 2W2PP 3BKTA 3MKLA 4CLWA 2R7RA 4IQJA 4WU3A 1ZN2A 3VGTA 4X4RA 4ZVPB 4U6PA 3GJTB 2YX7A 5CD4H 3BSCA 3M8PB 4LF4J 3IR6B 4OIOF 2VUMJ 3W9HA 3HJFA 5GTIC 3BS9A 4NLTA 4DF4A 5FRMA 1NHKL 2ZH7A 5KG1A 2ZMEA 2BYCA 1G8XA 1TP4A 2C2OB 1PUFA 2VG5B 4HHJA 1U48A 1ONVA 2C2ZB 4RGSA 1K61A 4HNTA 1IR1A 2BVZA 2EC0A 2CUJA 2H6CA 2PEBA 3HT0A 1S5ZA 4NZ6A 3IWLA 4EGZA 4HTIA 1OSDA 3R8YA 2HKXA 2XRNA 3OW2R 2KMUA 1YIOA 2R7SA 2QGUA 2DJNA 4Y2AA 1RHMB 1FP2A 4BHPA 5HLTA 2CPDA 3KZZA 1QVFR 1HW8A 4Q44A 4N9HA 1FJEB 1D8JA 1ORKA 2VJIA 2DPDA