2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
1HF0A 4EWTA 1I6HJ 2EK5A 2L54A 4HX7A 2KZGA 5FKOA 2R7QA 1UW9A 5GAHU 3OJUA 4KT5C 1RPWA 2F4VJ 5G0RA 1NNDA 2PMZN 4EM2A 4MFBB 3OVSA 3A8IA 3NL0A 3DDIA 2OIHA 3J7AO 1XJWB 2Z33A 4WK3A 1U4BA 4ZDLA 1FIAA 2AT1B 3MEGA 4B9UA 3CCTA 2GIVA 2RC4A 4KO0B 1NHUA 2UVVA 2XNQA 1MDMB 4ED4A 3BR5A 5CCMA 4Y6IA 3S8SA 4KV8B 5ICGA 4BHCA 3ZQGA 2LVSA 5KFLA 1QHHD 2GAHC 2NVXJ 1GXQA 1RUOA 3DRSA 2Z2YB 3FBEA 3DKXA 3I9V2 3OWTA 2Q1LA 2UXBF 2NCKL 4UY85 4UVBA 5CXTA 1MSEC 2VJ4A 1SJRA 4DYCA 4KT0C 5D0HA 3JCUC 4LK1F 3RTRA 5E3AA 1IQZA 2OEMA 1RESA 3MEGB 1P4WA 1Y0UA 1NH3A 3EETA 2RDDA 3TVYA 1RT3A 2D7SA 2B9XA 2BE2B 4DL7A 3BZCA 2N7CA 1XNRJ 5E41A 3M1VA 5HQLA 3JRAA 1VQ5S 5EWGA 1C0UB 2DPIA 1HHSA 2G4BA 2XY5A 4NQWB 2WADA 2ZDOA 3O1LA 3D6FB 2FQQB 2PMUA 4EBEA 2AD9A 3CESA 4ANEA 4J9OA 3N05A 2O3FA 1VJQA 5TJJA 2BOLA 2FGOA 1Y00A 2KXFA 3BZKA 5K8PA 3F73A 3P96A 5C4JJ 4A3CJ 2BJ1A 2MH9A 5D8HB 4EM1A 2ZMEA 3HC7A 4QR0A 3CC4S 3MUVP 2DNMA 1LE8B 4O0NA 4L74A 2IJFA 2UXNA 1P6RA 4ECTA 3ICLA 3I54A 3KP7A 2W2OP 3GFZA 3A1YA 2X0LA 1WC1A 3QSIA 3ILLA 1HW1A 1EH7A 4JX5A 3FHZA 1NDCA 4QWQA 4J9VA 3M8RA 4P73A 2CUZA 1Q1HA 2WAQA 5EG0A 5HS7A 3MUMP 1RZMA 3I4PA 2YNGB 1FXDA 4OIOF 2LOOA 3IA0A 3LFKA 1FJLA 3BS9A 1PGZA 3MM8B 3LGNA 1Y8QB 2O67A 4DL6A 2DA7A 4IRKA 4KIGA 1M1EB 2O66A 1VYAA 4KYZA 3MR6A 4MT1A 5E0OA 3PR4A 1K4SA 2CYYA 4A8XA 1KVKA 3MVPA 4F4KA 5C42A 1VK3A 4HDHA 4DPUA 2UWMA 2DI3A 2I8EA 1IXRC 3OV7A 1Q16B 1QD1A 3DLEB 3UFCX 2HFZA 2A2CA 2VPZB 3GTKJ 1UFWA 3KX2A 1SJQA 1T95A 1R5ID 1RB0A 3RUBL 3HP6A 3DLKB 1CULB 1S6PB 3D9BA 2LEPA 1C0WA 4OYAA 4B3MF 3ABUA 3F72A 4PQUA 1T03A 1CG2A 1D9DA 2IDEA 4C2TA 5U47A 3GIJA 5RUBA 3BPSP 3ERMA 5CKTA 1RWUA 1O57A 2CQ3A 1NK9A 2BRKA 5E3LA 2HQNA 4XKVA 2MC3A 1OFCX 3I64A 2OH2A 2EKYA 3FQKA 2XC7A 1YS6A 3I4NJ 3HD1A 5KFOA 4BDYA 3HDDA 3OTEA 2V1DA 1Q81T 4YFKF 5KVRA 4C3KA 2FJAB 2CPFA 3EXYA 4KGVB 1U02A 4XONA 5EX3A 1MW7A 3NAIA 1F36A 1IUJA 4UY8I 2HYFA 2H6CA 4FASD 5KFDA 2RMLA 3BZ6A 1PYTA 1U0SA 3JSYA 2VKEA 4WIQA 2OU2A 3HOVJ 1R4MB 2RS2A 4G6VB 2DA2A 4K4XA 3MKLA 4EO6A 4TU9A 5FFZA 4AIJA 2CUJA 2VD3A 4FPRA 3AFHA 3OSPA 5LFAA 3PYFA 5ILVA 2Y1IA 2M8DB 3L7WA 5FLXK 2DW4A 4U96A 1UWBB 3SQNA 3GU0A 4C6AA 1SD6A 1DQAA 2R93J 5HMZA 4MTPA 1BD6A 1WCMJ 5D4PA 2RNGA 1CBKA 2JNJA 4R1HA 1YX3A 4MTDA 2EH3A 4EZ9A 4AUXA 3I56I 2QIFA 4PFPA 3LQQA 4FE4A 2KZMA 3AJ1A 5A2QU 4NXMJ 2MY8A 2X1DA 2HZTA 1YJ7A 2DR6A 2VH7A 1SD5A 3ISNC 2XZDB 3DHXA 3NWGA 1FX7A 1HBNA 4IHSA 2JFKA 3OYDA 2CJQA 3OYHA 3HKZA 3IC1A 2NQPA 3Q8YA 3J7YU 1HBXG 3JTHA 4F4ZA 3TO7A 1ZZFA 2A61A 3QPIA 1X0FA 1IRZA 3ZNJ1 3TP0A 2XB2D 2VFUA 3LWMA 3RCOA 3U1NA 3H9JA 1WOSA 1NKEA 4XPCA 5L1KA 2AV5A 1JUMA 1T3OA 3BYPA 4LSLB 2EFOA 2IM3A 1JKRC 2KISA 4TY8B 2NVQJ 5IT4A 2G1HA 3QT6A 1NTCA 4B48A 4N56A 4UB8C 1RAGB 2NVYJ 4GGGA 2CZ4A 1CJKB 1SIWB 1UFLA 4YQWA 1R3NA 1ACIA 2W2PP 2WB4A 1IJWC 2JMWA 4PZVA 1MD0A 2DA6A 3U1MA 3K4CA 4GDFA 4PPZA 1T05B 1FCAA 1RUSA 1ITYA 4R0JA 4EJVA 2UP1A 2WBRA 1CQTA 3OS2A 4EBCA 3CWJA 1BOBA 2GJIA 4BXUA 4ZVPB 4QU7A 4CHUA 2YNHB 4B17A 4OI4A 4LG0A 1BR1A 4B43A 2A69F 4RU2A 3H90A 2ZFUA 1HBUA 2L0KA 3F56A 3POTA 5F0CA 1Q8BA 4BACA 2EVZA 1EIYB 5KG5A 1HBUB 2J5AA 2DTJA 5HBMB 1VQ7S 2STWA 1TLHB 2WB1D 1TL8A 3AFGA 3VVUA 3V6JA 2E7VA 2XPWA 4GKJJ 3K69A 2V2VA 3GFYA 4KIBA 3WQPA 2HPMA 3TDZC 1XGMA 4DLGA 3AG2H 3MTJA 5F08A 2YH0A 4RB3C 1D5VA 1CJVB 5L3CA 5A2QZ 5EZGA 1TKTB 4C8NA 3AOBA 5BNGA 5B0CA 2BV6A 1WG4A 5D3GA 3PNYA 4RS8A 2Z2SB 3U7JA 4MMOA 5BJRA 1TL1B 1FJ7A 1S3JA 3HSGA 2AZ1A 3JR9A 2EC0A 4CYUB 4PUOB 2ME0A 4CICA 2DO4A 3D6MB 5HQMA 2GXGA 1GH8A 5CLSA 3RZDJ 2CPZA 4CXFA 2HWTA 3OHAA 4FS1A 5A76A 4I0BA 3IM9A 3LL7A 2IGNA 2DT5A 1NZAA 1LK5A 3QJPA 4K2XA 1S0NA 1VQOS 1Y0HA 1Y9OA 4URSA 2MHEA 4IH7A 3E6DA 2IC3A 1QPMA 4YRVA 3UDVA 5EEAA 3DLGB 1UEVA 4FYXB 2JUGA 4PFOA 1S1WA 4ILRA 3ZN1A 1KDNA 5E8GA 1TL4A 2VJUA 4X64J 2VIXA 2ZKUA 3DGPB 4MK7A 1KQ9A 5HMYA 5IFMA 2HZDA 2QKLB 1TR0A 3WHBA 2NOJB 1H3DA 5J1EB 2YU3A 4OOIA 3T19A 1XMQJ 4DV4J 2K85A 4XIDA 2BUNA 4A3EJ 2Q6BA 4UUWA 2ASDA 5IT0A 3DLJA 2DXIA 3K2AA 2WK4A 2CQ7A 3ESWB 4WZMA 2BY1A 2VFVA 3TUPA 3K70D 1R6YA 2BJDA 1RYRA 1XERA 4FZVA 5IP7J 3HHGA 1EJ9A 5BYSA 1D0EA 1D3YA 4IPAA 4NLWA 2DH9A 2W4CA 1FVSA 4XLFA 2GJ2A 1H7WA 4LSNB 3JRGA 4FYYB 4A93J 4X4PA 5HS8A 3P5TL 3CDAA 1NK6A 4Q8EA 3BTLA 3FDYA 2E1RA 4B9NA 5HSPA 2DODA 4C98A 3VWSA 2ADBA 1DZ5A 1QAIA 1BC8C 1GNKA 2DNQA 2PO4A 1JLFA 3GUDA 1IXKA 1P27B 1HQ2A 2BJ7A 2QL7B 1JXSA 3PKYA 1SIZA 2ALZA 3NMRA 5DDQC 3BB5A 4IDKA 2CWEA 1WHXA 3JQKA 2EG1A 2HSEB 3QOEA 2V8GA 1G3WA 4QR2A 4ZPTR 3WG7H 2RF2B 3CLQA 3G3ZA 4Y3OA 3T6JA 4X65F 1X1DA 1D5YA 1K79A 3MD3A 2Q1ZB 4M6VA 1S1WB 4ENNA 1UVLA 3ZQCA 5C42B 4HAMA 1FP2A 4RAYA 3IH2A 1DURA 2BXJA 2DIUA 3MMCB 3C46A 1U8SA 4URQU 2CSOA 3S32A 4PJNA 4QYZK 4U0WA 3K5OA 3MPUB 3DOMB 2YX7A 4F93B 4KA4A 2ID3A 5J2PB 3K59A 1UHMA 2HMIA 4OIXA 3WX4A 3MPVA 4H4KA 1BR2A 2LNBA 2R42A 1J9IA 2F5EA 2FQ4A 3ZZUA 5BXIA 4QWDA 3PRVA 4LF7F 3ZXSA 2OC6A 1BGXT 2MABA 4RW4B 2VPYB 4Q2LA 2O9LA 5KFNA 4IOCQ 4CYUA 4DSJA 5DDRC 4PUOA 4DSEA 3HPOA 3MR3A 3PKMA 4F67A 2ZBQA 2BZTA 5HROB 3ZCOA 1VI0A 2ACYA 4R0EA 3PYEA 4CWBA 3M4XA 4P10A 2L3DA 5IV4A 3C2BA 2QEXS 4M3GA 1J5EF 4ZZLA 3W65A 5DZ7A 5C24A 1N34F 4YR3A 4J00A 2CRLA 1ITPA 2M2EA 4FF2A 4UUSB 3RYLA 3LOCA 3RQIA 2K7JA 4WXHA 5ILSA 3TEDA 5C24B 1ZBTA 4UB6C 2V69A 1F5AA 3B6BA 1MN7A 2FD2A 1ZARA 2IP2A 2JHEA 2R4FA 5B0DA 2C28A 2DYAA 4DZDA 1R1VA 2XKOA 3L95X 4EATA 1IUFA 4RW4A 3OFHA 4OX7A 2XY6A 2QYOA 4EMSA 2X51A 4AYBD 4CLYA 3ASOH 5E33A 4DZ6A 5F0HA 2F6CA 3H0DA 2FLPA 2X1BA 2YVSA 4CO1A 3D28A 4HF2A 5IY5H 3S2DJ 3UE2A 2GMHA 3HHLB 5A0YA 3ECHA 2B4UA 2W48A 2DDAA 2M5YA 2UVWA 5FFXA 2XDVA 4DWIA 3TA0A 2DK2A 1IXCA 3O5TB 2MZRA 4TY8A 4OX9F 4ZPAA 4KV8A 4O0IA 3EGNA 3CCZA 2VQHA 2E5NA 4A69C 3ITHB 4UT4A 3DQVC 1IO2A 4W1UA 4DR3J 1KZHA 4J9UE 5KCMA 1D0XA 1UWBA 1FRLA 1OCTC 4ZTFA 1QJHA 2E9TA 5K5RA 3SDEB 4UY8T 3B8HA 1ONVA 2KL4A 2UU9F 2GGPA 1R89A 3FKBA 2DHGA 3DTIA 2W2NP 2MPUA 2ZKZA 3OL8A 2U1AA 1KU3A 1SD4A 2QA4G 4ECQA 1ULYA 2DTZA 1FK9A 4Q45A 2XMUA 3B4DA 1YKWA 4HX8A 3CIZA 3CPWR 4ESJA 3JTGA 4DV3F 2VHGA 2L01A 1Y4ZB 3CJ8A 2IBDA 2VKRA 3G4SI 2YQ0A 2C2NA 2M7SA 2JRSA 1M1GA 2R8JA 2VKZG 3PO2J 1U5TB 1VRTB 2G0JA 2VONA 1P8GA 4RNFA 4LITA 3BCBA 1PJ5A 5DO2A 5DG7A 4YEJA 4H4MA 1WG1A 2X1EA 2FXAA 4PWWA 2R2SA 1QAYA 3TGNA 3BPDA 1YZ7A 4O5VA 4U67Q 4OYMA 1XDSA 4ZVOB 2DR7A 2UXBJ 5JHFA 4OHYA 4C3HJ 3IG1A 4MTEA 3IRQA 1YW7A 1TWHJ 1ETKA 3QGPA 4M5IA 1QTMA 3QSYB 1TT0A 3NRBA 3J7YI 4TV7A 1IKVB 1XMKA 1D1AA 2H8RA 1MJAA 5GMEA 4X4QA 2OQRA 1B9MA 5DEQA 4P2FA 5LSLA 1Q79A 3A01B 2Y0SD 2VBYA 3BDPA 4BCAA 3CNQP 1YLFA 2BJ3A 3Q2TC 1LWEA 2DO0A 3J7ZT 3IXQA 3MF5A 3TARA 4TNOA 2HQDA 2ZEJA 1JK9B 1Y8RB 1BMQB 1ZYRF 1KLMB 3JTNA 4XOTA 3QODA 3GFLA 3M8ZA 2Q66A 3OYIA 3BOQA 3PL8A 1UPPA 4BJ5C 2YKMA 3P45B 1OPCA 2BYCA 4ZVEA 3HTSB 1PAEX 3GYXB 3PNTA 1PIEA 2AU0A 5J40A 3ERED 4DOZA 4IYQA 5H9FJ 7FDRA 5AONA 2R7ZJ 2CV0A 3GZ5A 1A6IA 5GADI 4LIWA 5IP9J 3M7GA 3HHNB 2C2EA 3B6CA 4NZ6A 1F0XA 3OUYB 2DPJA 2ECCA 3PX4A 4NNJA 4MIMA 5A2QK 4ZJZA 1H0HB 1EH8A 2HS0A 2H48B 5KFXA 3CW2C 3LPEA 4HI2A 2WOMA 2XVCA 1FDNA 1WSUA 4ELVA 5DRKA 3LQRA 2FJWA 3GIIA 1Z21A 4PYAA 2ZB9A 1ZPWX 1FIPA 3W6KB 5AXKA 2XMAA 3EPIA 1XCBA 3MAAA 3RW6A 2ROEA 2CQXA 2WAQN 1DFDA 1A31A 1V9OA 3K0LA 4IFVA 2N7YA 2KDOA 5JLXA 1RWKB 1YJTA 1IBKF 3KJVB 2F4MB 4Q5VA 2AYMA 1N32F 1T9TA 2EK6A 1PP8F 2ZJQF 4QIGA 1SUQA 4PJMA 3HHEA 4ZCLA 3B02A 5L1LA 5I42B 4B9LA 3CJTA 3I59B 1TNTA 1PYOB 4UNOA 3CCVS 5IQ6A 1HDDC 4NCBA 5IS2A 1QTNB 4B3MJ 5LM7E 2V26A 1F3FA 2UUTA 4U7UK 3BGFA 3SI8A 2BBYA 2DT6A 4B3RJ 2OJED 3HSZA 1NJYA 3BSOA 2LBFB 4RUBA 5EX0A 3W60A 4FISA 2DBBA 2NREA 1B3TA 3ELKA 4V19X 3DBLB 1AT1B 1TV6B 3DGVA 5LJ3Y 2VFRA 2GZWA 2E2IJ 1FXRA 3WGHA 2YU9J 3SDGA 4ZDOA 1YO5C 4KO0A 2QTWA 2C3MA 3CDLA 5HJYA 4P2MA 1HWIA 3GTLJ 5MAOA 3GJSB 1GMUA 4HH1A 2Y0SA 1T9WA 1W2IA 1K8AT 2F2EA 2H3EB 4DG1B 5CQGA 4PQAA 3U2RA 3L4BC 2ID6A 2DK8A 2LU1A 3GIMA 3CCYA 1V5EA 3DRSB 1HPZA 1IG7A 3E01A 2YUSA 1IR0A 4G1PA 1VGYA 2UUCF 1IN5A 3CTRA 2K3IA 2V8PA 1VQOI 4NL5A 3IO1A 2ERRA 2Q43A 4MQ9F 3AJDA 4CI0B 1M5PC 3GIKA 3CCLI 2GMLA 3FMSA 4IO9Q 1OKRA 1ULRA 2VQFF 4ED0A 1D1CA 5C25B 1OPZA 2YKNB 3KMQA 3PX6A 4ZZDA 3GCWP 1S4EA 3J80Y 2OELA 4F04B 4DYRA 4DQPA 4HV6A 3GLXA 4OZ3A 1FLIA 3OFEA 3KETA 2B56A 2WOMB 1HKSA 4P9UA 3W63A 1YW8A 5JLWA 1S0OA 2XO6A 1G7CB 1TFWA 5DGBA 4ANDA 5H2FC 4XSZF 3RPUA 2VN2A 3KHLA 3D54A 2P5LC 4JI8J 1FBSA 1K1QA 1MNEA 1AOYA 2Q79A 4P9SA 1IW7F 2VPWB 5F0WA 1DDNA 2FUG9 2ZH6A 4GRIA 3HHLD 3UKGA 2DNZA 4BBSJ 2WAFA 3MMAB 1RA6A 2DGVA 1ZG3A 1L3TA 3MZYA 4Z2YA 3WTZA 1L0OC 2ZH4A 2CQ1A 2P5VA 3P6YC 3WTVC 2EZHA 5L3DA 4PQUB 2DRAA 1T0FA 4BUPA 1EX8A 4I01A 4CCLA 1K4TA 2AKWB 2X6WA 3CC7I 3V81B 2D1CA 3O44A 4A47A 2KJCA 4JI5F 3D0IE 1STZA 3NS6A 5HVQC 3KLHB 3DLEA 2XAQA 2LU2A 3DOLB 2RREA 1VBYA 2XKPA 2VU5A 2OPSA 1YIJI 1FWZA 4M9ZA 3H5NA 3OIOA 1Z9CA 2GLOA 4BDZA 4YR2A 2CH0A 1Q4RA 3A4TA 3F3XA 4ZDPA 3HUGB 4LLLA 3DKWA 2X6XA 2HHXA 1JKQC 3SFGA 4RM3A 2OCEA 1C1CB 3BQYA 3H2UB 3ZZRA 4AXIA 4CUGA 2DHHA 3R5GA 3V42A 1BY9A 2N3LA 2D9PA 1TU0B 4Z6YA 4N9IA 2MQLA 4OI1A 3W5YA 3M2VB 1DLOB 4M3BA 1FO1A 2ZFWA 4XR6A 2UUZA 1WH7A 3OL4A 2R5ZA 4LFBF 4M3EA 1JKOC 4JX4A 2WTEA 3V6KA 4I64A 1WC5A 1FFSB 4MK9A 3KG0A 1J0RA 3ZMUA 2R8KA 2EZLA 2MYSA 3BTJA 2CUYA 2K4BA 4KHMA 2FC9A 1RK8A 2LC2A 4FYDA 1S9HA 1U6FA 1XN9A 4QLCU 3TJAA 1R00A 3F8FA 3FHNA 1OQ3A 1EKRA 5C5JA 3AQOA 5EZHA 1RTIB 1OMIA 2HS4A 5KFVA 4FP9A 4HYKA 1I3AA 4XTTA 2H6BA 3PIOQ 2P7CB 4NB5A 3UCGA 1WVRA 3ET6B 3VALA 3ADAC 4ES2A 4L5EA 1UA1A 2I5UA 1C4AA 5D0GA 4FF1A 2NYHA 4USKA 1DTQB 2ZWPA 4PSXA 3CJQA 2O6GE 4UHTA 3C14B 1J75A 2ZHAA 4FXDA 2E5HA 2Q6CA 4IKFA 1HMVB 3IBFB 5HP1A 3QMQA 1HBOB 1WC3A 2CQ2A 3FQLA 5AXMA 3W2VA 3MAHA 4OZLA 4RW9B 2IVMA 3A0HC 3EZOA 5KFBA 4ZP9A 3EUHC 4ASNA 3ZTOA 3HFKA 1GXUA 1X58A 3TUJC 3WBZA 5B0AA 3LSRA 1S1TA 1X4PA 4CQ1A 3BPXA 4DR1F 1HNZF 2Y48A 1R58A 3RKXA 1RJJA 3FGVA 5E7OB 4Y34A 5I3UB 3IMQJ 1EP4A 4IXAA 2BY3A 2QO3A 5LJ5Y 2IA2A 2R7FA 4LF8J 4RNNA 1GX6A 3H59A 3SDBA 1FX4A 5A8RA 1GTHA 1NB7A 1S76D 1B0TA 4S0MA 1QO0D 2MJNA 3BGRB 3QU3A 2LY9A 3AG1H 4JQFA 2X3GA 1OO0B 2AEJA 1FJGF 5M2RA 1FRKA 1T11A 3ZC4A 4NCGB 2J0WA 4U0YA 3BREA 4WXOA 2DPDA 4LUBA 1OYDA 2IAIA 3MPWA 2M7AA 5LRSA 4QR1A 4IRCA 3Q8SB 5FIIA 2Y31A 2CQKA 3GFMA 2O3DA 4WF9Q 3DM2A 3JYTA 1QVUA 1LDDA 2DHXA 3OYKA 3SJMA 2XMMA 1Q78A 4ZVRB 1U1LA 1W2BR 4Z7CA 1H72C 4U6PA 2K1RA 3L2UA 4IJAA 5I3QA 1RWPB 2RNJA 3ZFVA 3GMGA 1B72A 4BHPA 3K1NA 1DTTA 3ZN0A 3CMQA 4DR2F 5HDKA 3HKZD 1N6QB 2VUGA 1MN9A 4DUYF 2P2CB 1UVJA 4NLQA 2Z2LA 2YWKA 1H73A 2I1RA 3BTCA 3H9GA 3HL2A 2JEJA 3MAQA 5FRNA 4X1EA 4HSRA 5EEGA 3DYAB 1W7PA 2BVMA 1FESA 2ZZNA 5CZXA 1SKSA 3LALA 5J8CA 2P8TA 3OXLA 2QSHX 3OR1C 2WVCA 4B9VA 1Y10A 5J8FA 3C6TA 4PJJA 1T0TV 4ZIVA 3IN5A 3DEWA 2N4DA 4F36A 4DR6F 4E70A 3M6XA 3FEYB 3I55I 4AD6A 3KK1A 4GVBB 3CDUA 1KEKA 2UV1A 3V4IB 1UAAA 1IN8A 4HEA2 1P7IA 4E8UA 3BG3A 3R6SA 2KFNA 1LEAA 4QWAA 1RT6A 1NDPA 3PRDA 1RHJB 3WC0A 3GP9A 3J7AN 2WONA 4HBLA 2BANB 1FRJA 2CQIA 1U1NA 3H92A 3W3SA 5KG6A 4BE2A 3LA2A 4DIQA 3SFZA 4DYQA 1S0VA 3D6TB 1VHFA 2FGCA 3LP1B 2LVWA 4D7MA 3JSPA 4U7DA 3PW2A 4IQ4A 3OYLA 1CF7A 2GZOA 1JJCB 2IJNA 2IAJB 2IM2A 1IBMJ 1B99A 1WJ5A 3TZZA 3CD6I 4M63A 4WWCA 3VYTB 2EPIA 3SFUA 4C0BA 3SCKE 4KICA 4N76A 3H8YA 1IM4A 2F5VA 3ZTSA 2MTLA 1VQ8S 2IS2A 3SCJE 5E1WA 2TRTA 1JKPC 1OR7A 3FM5A 4LF4F 1HR0J 4WF2A 4DPYA 4PSWA 1HWUA 2DDBA 1Q5VA 1ZKGA 3IR6B 2J8SA 1FRHA 4XMYA 3D0HE 4YIRX 2C22A 5KFEA 3EYYA 4DL2A 3N4WA 1MJ9A 1HIYA 3RR8A 3MM9A 4I6YA 2H51B 4O23A 2H5IB 2BBEA 4FBTA 3AKZA 2RT3A 5HNHA 4RA2A 4E7JA 4EUVA 3FXKA 3H40A 2M0GB 4I6ZA 2ZM6F 2DISA 1R5HA 2ZZMA 1OJ4A 3EDQB 4AL5A 1S5LC 1Z6RA 3SEZA 4DV7J 3OV8A 4X84A 3THPA 3D1OA 2HHUA 2DMTA 1S72S 2D1HA 1WJFA 3K4MA 2PN6A 1VQLS 1H2TZ 2H27A 3ZZOA 2F8MA 4NEYA 5J1EA 2LQ8A 1OY8A 4TU8A 1ZAVA 1S29A 1U49A 1W5CC 4L73A 3CO9A 3WTXC 2VL1A 4D3HA 1SEUA 4PGGA 1NAQA 2KIUA 4XBFA 1YTYA 4TQRA 3VZHA 3FMRA 4DJBA 4BDPA 1LKZA 4B3AA 3TBIA 4NC7A 5LRRA 1V5IB 3MZHA 4IHYA 3V6DA 1TWFJ 1XNQF 1R0BG 3AODA 1CS4A 4P2XA 2CW8A 2BXYA 2X6OA 1Z77A 4ZYGA 1BM9A 4JOUA 2FHJA 2H4YB 3TR5A 1HNXF 3KUHA 3ZR8X 5D15A 4ER8A 3V7SA 3KK3A 3VAKA 2Y9ZA 2HTJA 4OJ1A 3KCCA 5ERIA 3ITHA 1SC7A 2LLKA 1TL7B 2B9SA 2LQ9A 5FKLA 2C42A 4KHRA 4LMYA 2R2TA 3MM5B 1N56A 3GX4X 1PVEA 5DV5A 3RBEA 4LFUA 4L5IA 4B3SJ 3MCSA 1MBHA 3D1NI 4ZP6A 4UVAA 1UHSA 3RB4A 4BQNA 2BANA 1HW8A 1AZSA 4A6EA 3KJQB 4CSWA 5LSRA 2M5WA 3KMSA 4Z2XA 1EARA 3G8SA 1R71A 3MCNA 2F4OB 5C4XJ 3OYFA 1QSLA 3V4GA 5HOOA 4ES1A 1REVA 3G87A 5BOXA 2JTVA 4WKYA 1A6QA 3N6MA 1G3YA 4CM0A 4P5OA 2NS7A 3JS9A 3PXGa 1C1BB 3UDEA 2RIJA 2HHHJ 3GE9A 1RETA 3EVOA 3TO9A 5TRDA 4DV1F 1HI1A 5B66C 2LMDA 1VC6A 3DPLC 4JI0J 2DLLA 4EM0B 3MKZA 1GFWB 4X66F 4NUBA 5GAEU 3MD2A 4AFFA 1WOOA 2CXEA 1IJEB 5K20B 4QWBA 4B44A 4C8LA 2D1VA 1IKXB 2R3SA 1VOMA 4DN9A 3M07A 5H6QA 4IG0B 1EETB 2W2QP 4ZN1A 5LGTA 1PYSB 2PC6A 1R31A 4XKCA 1ZQ3P 5JXSA 2Z16A 2V79A 2AHQA 4DZJA 1N6QA 3VAFA 4CIOA 2HFVA 3MMBA 2YWWA 1ZM3A 5CYVA 1B72B 3UR3C 3I53A 3M7VA 5JJBA 4OINF 3RRHA 2KFDA 3H9QA 2FNPA 2MKJA 3T5JA 3FBFA 3WC2A 2PFFB 2QEXI 3MUTP 1MU2B 2FU4A 3KWMA 2HR3A 4ITVA 1F9FA 5BR8F 3LSKA 1HWJA 1T39A 2NYXA 2ADCA 1BUXA 4LF1A 2NXNB 2GMJA 1YITS 3RKYA 1RR8C 2AQ4A 2P81A 2IYIA 1TQPA 2XGDA 3WIVA 2J7WA 3BC8A 1X9WA 2OPTA 4NCGA 2BE5F 3H2VE 1AZSB 1RT5A 5F8LA 1LUJB 5A8KB 4LRDA 5HK4A 4J9PA 5DJBA 4CZCA 1RT1B 3DEEA 5FLXY 2ZH9A 2GIQA 2FHOB 1NJXA 4KHPF 2R8IA 3PV8A 1QY7A 3OPKA 2R8GA 3ISPA 5KFKA 4WKRA 3K4BA 2V4JC 2B5JA 2MLGA 2RV8A 4O3RA 3BSCA 2BW3B 4DCOB 3TW6A 3MKWB 1MBJA 1O7LA 2X1AA 4DR5F 3P3DA 4N8NA 5HDNA 4QIWN 3ZZPA 1PJ7A 5J2MB 3N4MA 5FGMA 4KUMA 2DA5A 1JLAB 3G2XA 1TNSA 4RLEA 2JK3A 2BKPA 1QNTA 1U2CA 2PJRA 4W98A 3W2VB 5M3MJ 2HYIB 3UW1A 2HZVA 4H4KC 1ETWA 1VQ5I 4MKVA 2J5PA 1UB9A 3V6DB 5J2NB 1S59A 3F0CA 2WB1A 3BG7A 4KISA 1HQUB 3CMYA 1PC4A 4HF0A 1PC5A 2YKAA 2WV1A 4I99C 1KQ0A 1QRYA 2CQQA 4EJOA 2VE8A 5H6RA 1A7GE 1FTTA 3WU2C 2J9EA 4USJC 1KWMA 4ETZA 3G8TA 1OJLA 4LFAJ 2B8QA 2M4MA 2OTLI 1XNRF 4KSEB 3BSAA 3R5BA 2DY9A 2WA0A 3VAJA 4ESFA 2JLFA 4DSIA 2OSRA 3FZVA 3AQPA 3ML6A 1K83J 4IR9A 5EYRA 2M2BA 4L3NA 2R92J 2GHWA 1NSQA 3L9FA 2XSDC 4DZPA 1C4CA 2QZ8A 3GSIA 3IAS2 4XRFA 3QFHA 4ATNA 5DS9A 2HWHA 1WUUA 2VFSA 3CJ4A 2P9CA 1ETQA 1CULA 3KLIB 3CJRA 1RWNB 5HQ8A 1WJEA 3QP5A 2Z1DA 3VGVA 1G2EA 2KIQA 3OXGA 2MQQA 5LHIA 1FT8A 2HOAA 3VWBA 1RWVB 3LSPA 3AOCA 1WI3A 4NA1A 5M2PA 1G59A 2RQQA 3OFGA 4FVCA 1ZG5A 2XUBA 5LXYA 1RTHB 2VG6A 5J2QB 1S1XB 5F8NA 4LT6A 3A03A 2M3AA 4ED3A 1IDYA 2D9OA 2X1CA 1K44A 2E19A 4MIBA 1OQYA 3IS9B 1U5TC 3K4JA 1YHQS 1RT7A 2KIFA 1GTEA 2E36A 3C3WA 4N4NB 3OL7A 4KT6A 1N48A 2I0XA 3QWLA 4BHBA 3VTIA 2W7NA 1T08B 3KUEA 2IA6A 2VL8A 2W7AA 1R6RA 2KMUA 3TQNA 4Y52J 1M0SA 3ETMA 2K9SA 3U02A 3W6JB 3H5SA 5EDWA 2NVTJ 3LSJA 2OZUA 3CCRI 2L3MA 3Q5FA 1FFWB 2ZNZA 3D5MA 3S16J 1KFSA 4PWDB 4Q43A 4LG3A 4ZLPA 3IBWA 1CJVA 5F9NA 3T8TA 1FEHA 4NWBA 4K5SA 4N8OA 3K4LA 1EA3A 1MROA 4HG2A 4O3QA 3G71I 4BQQA 3HTUA 1Y1VJ 2F3JA 3PJWA 3ZQQA 1B7YB 2ZWOA 1ZLJA 2QLXA 1TMJA 3MEDB 3QOPA 4P55A 1TMMA 2OEJA 4M5HA 1QM9A 2JN6A 5E18F 2RDPA 1SMTA 3CJ0A 3CQZJ 3KDOA 5D4RA 2DMQA 4XLHA 2A6EF 2CDQA 1E6YB 4I56A 3F6VA 4I69A 1NPRA 3MI7X 2AJQA 2AIRB 1L3LA 4E7IA 2M4KA 2PT0A 5L8RC 2CV1A 3CLOA 4HHJA 2JUCA 2OFGX 4DUZF 2HBQB 3HGGA 4IF4A 4YOEA 1ZGAA 3EDPA 4WYLA 2VICA 4M5DA 2VF3A 1I94F 2O1PA 1B6AA 4ECUA 4DJAA 1Y5NB 5KTQA 1LWFA 3GEZA 4RR5A 2MQ8A 2ATLA 2XS5A 3WODF 1S7IA 5KG3A 5EGYA 3BDDA 1KYWA 1BOAA 2F9JA 3KZIC 3HOZJ 3KLEB 4G94A 2XASA 3CSKA 1BHNA 3TVZA 2ZH1A 2UXDF 2IS6A 3HIFA 3TOBA 2BACA 1LFUP 3R27A 1VBXA 4XDDA 4USWA 3SMZA 1KNZA 3S2WA 3KJFB 5LMNJ 3SZPA 3C66A 3REOA 2EBEA 3JREA 4HNVA 5K1YA 4S05A 4J91A 3I5UA 4NLUA 1NXIA 2X6YA 2ZJRQ 3E1SA 1W36C 1SFOJ 3T1BA 3NKYA 4HT5A 4QW8A 3DLLF 2BE7D 5DD8A 3KNGA 2BM1A 3GCXP 4G7HF 3SYTA 4ZVGA 4CLWA 4JI3J 3QAHA 2B9EA 2HBYB 5A6WA 4RW6B 3UD3P 1OQ6A 3BGRA 4K2EA 4A8KA 3OR2B 3MURP 2BABA 4NXNF 5FB2A 1R4NB 4Z37A 4I67A 3I59A 4E7HA 4XRMA 2E1CA 4M5DB 1FZPB 2OD4A 2DGWA 4GC6A 3SHFA 3JQJA 3E3VA 2RUSA 1O7FA 4IEJA 2E1PA 4KMUX 1E3PA 1K73T 2K7KA 4NI2B 2HW3A 1VQPI 2LTPA 2OBPA 1B8IA 1WHUA 4OZNA 2JVOA 3MD1A 2UUAF 2XPVA 1TC3C 1YBTA 2JC0A 3HEFA 2IDLA 1RE1B 2FLLA 5D4OA 4JK1X 2FHJD 2IM0A 1KN6A 1UELB 4QQBA 1ELOA 4KQZA 3VQSA 1JGGA 4BYYA 2MKHA 3DFGA 2OO4A 4RW7B 2EV6A 2XYHB 1N0UA 2OMOA 2DQLA 1N36F 3LF0A 3S3NA 3VOEA 1S5ZA 3TUZC 4EGLA 3KJNB 3HM5A 3JRFA 1Q53A 1WSRA 2VQEF 2RVCA 1RP5A 5DQIA 1V4RA 2OJ3A 3QRQA 5D6FA 2HQIA 3MM6A 3Q0UA 5A6PA 4G9YA 1QAXA 4CRJA 2HGMA 4PWDA 4Y4RA 3KYLA 3S14J 1IVZA 1VK8A 4B9SA 4OAZA 1S6UA 1F9HA 5BPIA 1O5JA 2IA0A 4XORA 4X4NA 2XGCA 3FK4A 2DQRA 2YQ1A 3IRXA 2OUMA 3D3CJ 3AA9A 4OYIA 4V2GA 4XNFA 2GM4A 4O3OA 2XAGA 2YKQA 2HZCA 3BJAA 1HKTA 4HHUA 2BZ2A 4AD9A 1SPBP 2MG4A 2IW5A 3AHPA 3PQJA 2D3O1 5IWAJ 4USMA 2LR8A 2F40A 2KRFA 1T9YA 4RGRA 5CVIA 3ILJA 4X62J 1S97A 2CIMA 4HR2A 5GAHJ 4DMZA 3CCMS 5FROA 2ZBIA 3EZ5A 2D69A 1EB0A 3KHGA 5KFZA 2HFUA 3MQ0A 5FKMA 2MDAA 1B1BA 2EBGA 5H20A 3MMJA 3THTA 4JV2A 3RW7A 2R2UA 2HEOA 3JSOA 4I98B 2DCUB 1NRKA 1IQTA 3CD6S 4PWUA 3MM6B 2OPSB 4H0EA 2AW0A 3S1QJ 2K27A 1WSVA 4OZ2A 2VUMJ 2ASJA 5DM6F 2ZJ2A 1WD6A 4F8RA 3B82A 2YNGA 1WDTA 2HHTA 1SL2A 3IM8A 5DETA 5DDPC 2PMWA 3L7PA 2XBPA 2CNNB 1W25A 4ANJA 4YB6A 2JEIA 1QGPA 4YG2F 4RW7A 1RXOB 2YNIB 4M94A 3CUQC 2AX0A 1WWXA 1GVJA 3VYSB 3E0JB 4H4MB 2EFVA 1VFCA 1YSJA 1VTNC 4WE1A 1W0TA 1NPKA 4K4ZA 4AE5A 4PJ0C 3PIOF 2DK5A 2RNEA 2KG0A 4X2BA 1LE8A 3W66A 4FQGA 4CP5A 3KFWX 2KJWA 1B8IB 5ADZA 4U8YA 1JB0C 4RB0A 1AYEA 3R6GB 4JYAJ 1S49A 4N4OB 3GJQB 2Y8YA 1SV5A 3RBDA 1DU0A 4NLGA 3FCVA 4DQIA 1KOOA 4ZHRA 3K7RA 4JI6J 1FSEA 1G8XA 4Q48A 3ZMTA 4KH1B 5H9FK 2QQ8A 3QAUA 3GTGJ 2J5OA 3WTUC 1RAIB 4RW6A 3OLBA 3V8LA 3UI3A 4YS2A 5GADJ 1MGTA 4JI4F 2MLZA 2F1FA 4UUVA 4ZPBA 1LFPA 2DGTA 5F8IA 1P6TA 3ELHA 2OA4A 3HSDA 5ETKA 3RTVA 2DGSA 1SAUA 5HLGA 1OSDA 2O03A 2BEOA 4DCJB 1TFYA 2KQRA 5M3FJ 2BW3A 2ZE2A 3BBFA 4ECYA 3OSNA 2RUGA 3J7AY 4BBYA 1IV6A 3T5HA 3GONA 2NR0A 1UZHA 4GC7A 3HPGA 4NC8A 2EZKA 3TZYA 3W61A 2V7FA 1DRZA 1LWFB 3MECB 3ENQA 2DYSH 5EHHA 4DV7F 1PDNC 4EK2A 4C8ZA 1Z3XA 3U9GA 2RKIA 2LMIA 1XTAA 1XTZA 1B4SA 4AIDA 1D8JA 3CO6C 2HRTA 2E5GA 2NXNA 3N0VA 3MPDA 2PEHA 3RYPA 4E7KA 3GTQJ 1BJAA 3M32A 1KLNA 1X4AA 4RBUA 4C7QA 5J1NA 2BVLA 3CMMA 2OKQA 4WK1A 1VZ0A 4KRWA 2WW4A 5EN1A 5ED4A 2UV8A 1N33F 2V4JA 3MMBB 3FM3A 2Y69H 2EIMH 4L9JA 3M8EA 5I42A 1TP4A 3OTBA 3I0SA 2EIJH 2AP6A 3ZO7A 4I0WA 4UQTA 1JXVA 2V8HA 3K10A 1L3SA 2WCXA 4YR0A 2RE1A 2AGPA 4YDXA 4PDKA 3CMEI 3LA3A 3T5LA 2ESNA 4FX4A 3PRBA 3PHEA 5KT3A 1QPIA 3CF2A 2FJDB 3R3TA 3CCRS 3DDNA 2HKOA 1X8DA 3DOKB 2C3YA 2R8HA 2C3PA 3F8BA 2PFDA 1FNMA 4G3IA 5KAKA 5J1UA 4W4MA 2CRGA 2GX8A 1N75A 4OYOA 3IHUA 1FKPB 1N34J 2VASA 3G1MA 3A1YG 3TQ1A 3T9ZA 2ZJPQ 3H0PA 2ZKTA 4UVCA 2WVDA 3R4KA 4NLTA 1NB2A 3E8OA 4KN4X 2M88A 4F50A 3QRRA 3D2WA 4TVAB 1VFJA 3DKYA 1WHYA 3IS9A 2XSJB 3TYTA 3R7SB 4G1QA 2N82B 1VQ4S 3PFIA 3R6LB 1O3TA 1WF2A 1F9NA 1DUXC 2FIUA 4I76A 2JVHA 5C3EJ 4CCOA 3MMCA 4WFXA 6FDRA 1WI9A 1YZ6A 3J81j 4B02A 2JC1A 1ZR4A 4LF2A 1FEXA 2J8AA 3TO6A 4IQMA 3QPLA 2ICWG 4TYBA 2EA4A 3BJ6A 4DUTA 3KLVA 1MH4A 3KYDB 4BGDA 1ZA1B 3SBMA 3HGYA 3FK7A 5H9EK 2KM8B 3RB0A 1M5SA 3CTAA 2LXFA 2XSFA 2ZFHA 1VQKS 3BYRA 3EGZA 4LIUA 4BE0A 2JEFA 3L2RA 2JZYA 2BA9A 3WTWC 4NMLA 1ZH5A 3DRRB 2KKOA 3K2YA 4ECWA 4OZJA 1WEXA 1S79A 4YDDB 1J5YA 2G9WA 3CE8A 1ZGWA 2FQ3A 4OX9J 1IJFB 3VF0B 1VQSA 2ETHA 4RO0A 2VJ5A 1MWQA 1WH5A 3H98A 2CG8A 1VC5A 1H9GA 4HYEA 5F0FA 3PYGA 2YPYA 3WU1B 3OYGA 2W2MP 2NAZA 2M1BA 3N5FA 2P6SA 1LDJA 3NQOA 1RT2B 2B6AB 3FUYA 2WV0A 1XEZA 2H1YA 3K4KA 5GPAA 1WKKA 4HDGA 4EBDA 4KKOB 1WJDA 2K40A 1WFXA 4FTHA 1V5VA 3FRZA 4DPWA 2L08A 3HO1A 2QC3A 2DCEA 1R8CA 3PSIA 1N88A 4IHWA 1YWXA 1ZETA 2M0CA 2HAFA 3CIMA 4EEFG 2N3OA 4WFNQ 3ISZA 1FBQA 3S8PA 4ETXA 3OTOF 3LSTA 1G3SA 1H0MA 3DLBA 3OTDA 3IL2A 1I50J 1AWCA 2MB0B 1PUEE 1QVGR 3VEPA 3ZZ0A 3NAHA 3GTYX 3Q22A 3F8MA 2AZ3A 3CVKA 1KSPA 2HXOA 3EGWB 2NPFA 3QGIA 4OMFG 3VYRB 1FK9B 1PAUB 1XMOJ 4C97A 3I9ZA 2B5JB 3SXLA 3RJPA 1UCNA 1DY3A 3IAM2 4AVZA 2F48A 4AIKA 2V9KA 1WNEA 2V9VA 2IRYA 2CGPA 4TQSA 1ACMB 2JDJA 3G73A 5FD6A 1NH8A 4I4BA 3KP6A 1I39A 2V1UA 1U9OA 3M8SA 2PI0A 1CC7A 4FKXA 2CQDA 2ZSIB 4CO3A 2QL9B 4DF4A 4A0ZA 3HKZN 8AT1B 2KHMA 2VDHA 3VGSA 4XM3A 4B3OB 5LGUA 1U2FA 4OI6A 2C2DA 2JJ4D 3QZ8A 1T56A 2A05A 1ZZNA 4ZLJA 5IT3A 3IV5A 5K7HA 3BKFA 3O2IA 2Z3YA 1RU1A 3KDNA 1SAXA 2HGLA 1R0CB 2KU7A 2NXCA 2WONB 2JT1A 1RHRB 5JVTA 5E3CA 1LW0A 3A3NB 3SV4A 4DFJA 4HSTA 4ZPCA 4I0AA 1VQ9S 1SC6A 1YQAA 2K9QA 4QIEA 2B0LA 5CHCB 3WX8A 1B9NA 4QU6A 2BYVE 2C3UA 1FT9A 1JLBA 2XMWA 4YMEA 1OCCH 3VAIA 2QA1A 4K5RA 5J4YA 3I96A 4CO8A 2CDRB 2M45A 3ENAA 3EUHA 4NA2A 5ETLA 3F21A 4FKYA 3S6EA 1V3SA 2HNDA 2IRXA 3DYAA 3ABMH 2ACMA 3L7OA 3OS0A 4KPYA 1L3UA 2HKXA 1KU7A 1S1UA 1BQMB 4BY1J 3OYNA 4M1KA 5D78A 3LP0A 4AU7A 3D5LA 4Y2AA 3ZQFA 2EA2A 2KB2A 1ZG1A 5JMNA 1FDBA 1RAHB 1WHVA 3FX3A 3FFIA 4RLQA 3HOTA 2HGNA 2Q3PA 4XLNF 1JXEA 1LPQA 1IKXA 1S9GB 4F25A 5FDLA 4ED1A 2AO9A 4AL7A 3OL3A 2DGOA 1XR5A 1FJCA 1SVDA 1F43A 5DZ6A 3RJMB 4D1QA 3MTKA 2K1RB 2ZC3A 2E5JA 2GV1A 4DX8H 2CNKB 1IZ1A 4E7LA 3I0RB 5B5EC 1R22A 1BQNA 3OD2A 4ZVFA 1WF1A 4YIFA 4IRIA 3TJ8A 2A2DA 2FMLA 1L3VA 4FF3A 2GHVC 2IFXA 2XYPB 3MXHP 2L7ZA 1RT7B 2I8DA 3O6QA 2YS9A 3KKFA 3AD8C 4OX8A 3JW4A 1E17A 2VIHA 5JHUA 1HD1A 1NJIT 2CQ0A 2GC8A 4KFBB 1RDRA 2EV5A 3DBRB 1W5TA 1FYLA 3L09A 1JI8A 4U87A 3HVRA 4BHQA 2X1GA 1EKSA 2CPHA 6PAXA 5AE1A 1XC5A 3KG1A 5LOQA 4DV6F 4IRDA 2JZ5A 4IH6A 4ED2A 2XQCA 3MOZA 2W7PA 3G8QA 4M5JA 3WZ0A 2M9HA 2RF2A 3RRGA 1JUSA 3I5BA 6FD1A 1W7PD 3DRXA 1FRIA 2YNFA 2ZITA 4M3DA 4IDKB 3HJFA 2XLJA 1RTDA 3GR1A 2QKMB 3BKTA 4PKDB 3M2UA 4FN5A 4XIUA 4M9XA 1XD7A 2OAZA 4RW9A 4A8MP 3E6MA 1S8NA 3CUQB 1ZLKA 4AQYF 1O0PA 3NCPA 2DMPA 1BI1A 3IKVA 3DCAA 3M30B 4FCYA 1TAUA 1MNMC 1BI2A 2QMXA 3QWPA 1YBAA 5BYQA 3R97A 2QMUB 3R7BB 1JJ2R 5K5MA 3SZTA 1WDDA 4LSNA 4RW8A 1VF9A 4I2QB 1ZA2B 3CJ5A 1LDKB 4HL9A 1LNWA 4LIVA 2XF5A 2F9DA 4JX6A 2M0MA 1TTHB 2BR0A 2IRFG 2BHZA 2P0WA 4I2QA 3MCMA 2D41A 3FKIJ 1C2PA 4BQAA 5HVGA 3BQ1A 1CJUB 1AA1B 3H0GJ 3GV5B 3L2CA 4EJTA 1WHWA 5LMUF 2X48A 3PNVA 5KFQA 5F27A 2KPMA 1OYYA 2PA8D 4OYBA 3HT3A 4DV0F 1TKZA 3M1EA 3M30A 5KFMA 1NEEA 4C8MA 3JAMU 3JB9k 1FBUA 3MWMA 1CJTB 2IA1A 2NRAC 2RDIA 4DSFA 2QV6A 1VRQC 4I2PA 3I82A 3RB3A 4WFAQ 3T9NA 2DYRH 1CQMA 2DRBA 2K02A 4A5NA 2NXUA 4ECVA 2EV0A 4EO8A 1WJ9A 2WHOA 2JL9A 4GMKA 4ZLNA 3FMBA 3UD5A 3W2WA 5L1IA 2LCWA 4HV5A 4OLOA 3C19A 2IT0A 1RSCA 2E5LF 3PZPA 1R27B 3DXSX 3PFOA 1UFKA 2XYGB 2WAEA 1YJVA 3WG9A 3JSMA 1KQFB 3O8HA 5IYCJ 2E29A 4TN2A 3F6OA 5J1PA 2AGQA 2MW8A 4ZITA 2MFZA 3K7AJ 5F0UA 1YJ9I 3DU6A 3VSKA 2X85A 4D9JA 5A8KA 5JVGQ 3D67A 2LKZA 4BAYA 4KDPA 2QL5B 2M87A 3EE3A 1EV7A 1R8HA 4JI5J 3HVAA 4CDGA 2VG7A 3DFEA 2V2KA 2HLTA 5HN0A 3L3CA 2K5CA 1BXNA 4GVBA 2UXCJ 3R5JB 1BQNB 2DFHA 3GTOJ 4EVIA 4I7FB 4UV9A 3VFZA 2CA9A 5IC4B 5E79C 1M5HA 2R7OA 1G6NA 1HLWA 2HBRB 3CZ6A 2CFOA 2MSTA 2AYEA 4CCNA 4CTAB 4HX4A 4JBAA 1P1LA 4BLGA 3KLGB 2J7UA 1KONA 2GOXB 2RU9A 3FFIB 4P7TA 3NWRA 1QZEA 3HOUJ 3FF5A 3QNWB 2MZJA 3CJSA 3ZMDA 5ICFA 3DV8A 3SCIE 4FS2A 4RBVA 4ECXA 2V4QA 2FB0A 3R0JA 4K4WA 4LJZF 1JJ6C 3L2WA 1WTBA 3H20A 5KFIA 3FRYA 3TAQA 1OCOH 3F23A 1D8KA 5CYQA 3ECOA 2W9AA 3POTB 1P9YA 2SXLA 3JAMZ 5C25A 3M32B 4E7ZA 1FFGB 3C16A 2MGQA 4FNIA 3QFWA 1W36D 3KPHA 5HMXA 2L02A 3EUAA 3S01A 2MQPA 2HRYA 4DL3A 1FP1D 2HVZA 3PFYA 3VB2A 2VQCA 4FVMA 2CS3A 1SH2A 2W1OA 4Q5SF 1T05A 2XMTA 4J9LA 3QRPA 1UVKA 5HATA 1DTTB 3ABTA 2QBYB 2E1AA 3GV7B 4A3JJ 4P9FA 2CZVC 2EW9A 2RN7A 4UUXA 4LLGF 2ZXJA 4I2OA 4NLRA 4KH0B 2W24A 2YY3A 5IC6B 3PM9A 1G6BA 2L9RA 4EQQA 4ZYDA 2HPUA 3ASNH 1RRJA 2QA4S 3O3KA 2V6AA 2AWZA 3QYYA 2LFVA 1YFHA 2W82A 4LF9F 2ZUGA 3M2RB 2E2HJ 4IZZA 4PG7A 2J9CA 3IGNA 3F0NA 3HRTA 2Q8KA 2ZBKA 5F3ZA 4M8LA 4WWSA 1R1UA 1U3EM 4Y2MA 2HHQA 3E3XA 2LBFA 2BQ3A 2UUBF 2VT3A 1NK5A 3FXUA 2NSCA 2CZ9A 1U1QA 1TBXA 4NA3A 5IYDJ 2WSFC 3DLHA 5K8NA 3SZ2A 2HGCA 2HVSA 3VGUA 4ZVUB 1J59A 1UVNA 1IM6A 1LVKA 1UEKA 4DBRA 2HZAA 1F4KA 4QSHA 3W64A 3A3PB 3F41A 5DLFA 1TK5A 5B0EA 4FE7A 2LKXA 4ZJOA 2DXDA 4DV3J 1JXLA 5K9FA 4N9HA 3CP2A 2GHPA 3LPYA 1V54H 1VLYA 1HMVA 1IRFA 2LEBA 1BW5A 2WVBA 4DN0A 5GTHC 1S77D 1N52B 5GAGJ 2CU7A 1WI6A 3BJOA 1BE4A 2ZVSA 3MMYB 4DW6A 2HNYA 3COAC 4JI2J 3LH2S 2BOAA 2J9DE 1S9EA 2V4RA 2XB0X 5K5QA 1H88C 3VCDA 2DN0A 3LTOA 1WC4A 4YB5A 4MFEA 4LR8A 4HHHA 4WXCA 3OR2C 3T1AA 2FF4A 4ZLLA 5C7PA 3T5KA 3HLUA 1UJ4A 4XICA 3JRDA 1QQIA 3CCQI 3MAJA 3KK2B 1RT2A 1ON2A 1Z0XA 4OZ1A 3ZMVA 3PY8A 4M5MA 3KYCB 3LGHA 2ILYA 1GUUA 1C1CA 4TU7A 3OW2R 3R1HA 2A5YB 1SH0A 1IKWA 1GXLA 3ZP5A 2BMBA 3PO4A 4DX6A 4IHXA 3BJYA 1VC0A 1MG7A 2XM3A 4ON0A 3DRRA 3IWXA 2JRMA 2HVQA 3M8QA 4O6JA 1N33J 3DLKA 4MIAA 1F2GA 5B3SH 2XGPA 4LF5J 3ZOBA 3M2VA 2N4CA 4U9RA 5A2QY 4PG5A 5KG4A 4L75A 3S1TA 1CF7B 1KLMA 3Q0VA 2Y30A 1ZR2A 3NY0A 2KYXA 2MLXA 1GDTA 3KLFA 2FJXA 2XS7A 1BBYA 1DHMA 1UZCA 2JEGA 3LP1A 2ZVIA 3H7HB 2DOEA 3NCRA 1VQNI 3R2CJ 1IKWB 5LSOA 5J1YA 3J81K 2ACJA 5HAOA 4NOHA 1REPC 4HH0A 3VDXA 4ES3A 3LSHA 1RISA 4S0HB 4XLCA 4F3MA 2XAJA 3OIQA 2XIGA 2PBIA 4EU0A 1ZRCA 3DWLE 5L3FA 4ID8A 3LP2A 2GO8A 3M9MB 2ZC2A 2YX4A 5J6XA 1P4XA 1Y1WJ 2LQJA 4MKAA 4ECRA 5DQGA 5KFPA 4KPCA 2KO1A 4MYTA 2CAJA 4WK8F 3W1YC 2B9WA 3FDSA 2IGKA 1LXNA 5AXLA 2QQ9A 2KKHA 3RGIA 1JUPA 2DH8A 5F1JA 2ZC4A 2FNAA 4NI2A 4PXDA 1TK8A 2Z2MA 4YIIA 1YJUA 4DU7A 1YHQI 1HW2A 2BY2A 4J9KA 2FD5A 1ETVA 1XB4A 1YW9A 3ZMZA 1ERDA 4AYBN 1ETOA 1WTFA 3R5DA 2V4JB 2E9RX 3IAS9 2CPJA 1J5OB 4IFYB 1HPZB 1Z91A 3PR5B 3OR2A 3V8KA 5FLMJ 2MLKA 4NQWA 2J0QD 1FKAF 4A8FA 1N5TA 3SDEA 3RI4A 4OI2A 3EDRB 1WPKA 3M1VB 3W8PA 2LXIA 2HNHA 2AJ2A 1P4AA 3OYAA 4NASA 4A3FJ 4DV2J 3BLYA 1I1SA 3KEOA 3A8KA 4II3A 4QPXA 2AYGA 2CQHA 2VLAA 1KVIA 4WJBA 2VG5B 1SC1B 4OMYA 5D77A 3M2RA 4EI2A 1SMYF 3PW4A 1EHWA 1TV6A 1V3ZA 3KUGA 1POGA 5DCFA 1I3QJ 4WXWA 4WFZA 2E71A 1NSAA 3KG4A 4BWMA 3GQCA 3KLEA 1XBWA 2L41A 1RWMB 2LREA 2V68A 1AHDP 2ATCB 3G2BA 1RHMB 4DFPA 1HNXJ 4ID5B 1KHWA 4V19K 1T02A 3I71A 1S7HA 1OY9A 1VQ6I 2VQLA 2CVEA 4RPFA 3I5CA 1EH6A 2PE8A 4BWJA 1YQHA 3Q8RB 2DR8A 3HOYJ 1VNDA 4PG4A 1J27A 5AE2A 1YRXA 2NNYA 1OIAA 3VAMA 4PZJA 1TUGB 3FXMA 1TQLA 3HOSA 1UFMA 2MGZB 2KH9A 4L0ZB 4Q7AA 3QJLA 3BSNA 3ILIA 3S17J 1Y3KA 2LA4A 3TQEA 2NNNA 2AEFA 1PUFA 4ZHRB 3OIPA 1GLNA 4AM3A 3TA2A 2EILH 3OQ2A 4DPOA 1QVFR 1SUQB 4C8OA 5IT9K 3WTSC 1F3VA 2EK1A 3GCMA 2JLGA 2CO5A 4IL6C 1WKJA 1RTIA 5F04A 2HQFA 2UUWA 1YRUA 2MMYA 4DV1J 4ZIWA 4CTAA 3ZQ7A 3RAXA 2VOPA 2JX2A 3Q2SC 2NUUG 1S7OA 3LNQA 3HG9A 3HMJG 5L9XA 4D0PA 3OOUA 1WACA 4R8HA 2XAHA 2JH3A 4ZP8A 2FEZA 4U7BA 2B4OA 3GZ7A 2EWHA 1I1GA 4QJVA 4G6DA 4AUKA 4K4TA 3ILOA 3TI0A 2FJVA 2HQGA 1FF2A 4I7HA 3UCZP 5T7LB 3QPTA 1OY6A 2R7VA 3ZPLA 5D8KB 4G8XA 2HMIB 2K8GA 2LQ5A 4UTGA 2QUFA 3A13A 5DUKA 3G82A 3GFHA 1LWEB 1YK9A 4B9TA 1RTHA 3MCOA 2F8EX 3CJNA 2KRCA 1IRGA 1GQEA 3G86A 5LGNA 4G1IA 3FXJA 3I4MJ 4RB1A 2OPQA 5KG2A 2YXLA 1K78A 1AA7A 2VKHA 3V7RA 3BH7B 2HS5A 2J9DA 3LA0A 4CLPA 2W4DA 3Q8QB 5A8WB 2CQBA 2KRBA 4K2JA 4MKYA 3GIRA 3KLFB 5KG0A 3I56S 3CJKA 2D2WA 3BR9A 2YKMB 5B08A 3G6ES 5JR3A 4C9YA 4WBFA 5AT1B 3N6NA 1WWHA 2JA8J 3AB2B 2Y75A 1NK0A 4ENKA 2GQ2A 3K5MA 2B51A 2FVCA 2PLYA 2KLOA 1JLFB 2AJ4A 3OSGA 1JWWA 2M34A 1L5UA 5ILUA 2YBVA 1N0VC 4M5GA 2B4VA 3UO0A 3QPHA 1F5BA 2DNGA 2OTJS 3UN3A 8RUCA 2PDAA 3T1YF 1RKIA 2WVFA 3WGGA 2V5HG 2LDUA 5HODA 4NXMF 1VQMS 5SZTA 7FD1A 1U45A 3PIPQ 1RGVA 3KNAA 4FXVA 3J81U 3HFVA 3QP6A 4C8YA 2ZHBA 4C30A 3O2PE 4LD5A 5EUHA 4C9DA 2HNYB 2VPXB 1D3WA 1AFIA 1ODDA 1Q8LA 1RLCL 1F2HA 1SQEA 3EZUA 1XMXA 4CT9A 2CMPA 4OHVA 1SFKA 2PJRB 1LV5A 3SCLE 4NRUA 2KHDA 3M6WA 1O3QA 4DQSA 3NWTA 3TKYA 3K17A 5EEHA 1VLOA 4YB7A 5IOLA 2LEAA 1XGSA 3GYHX 4LVOP 4ENOA 3F22A 3BR6A 3NXZA 3RKQA 2WW8A 3KP3A 1VIXA 5DYMA 1FTZA 4YP3A 4HTJA 2HU9A 5LHGA 4OQJA 5IZHA 1U24A 5HO4A 4LF8F 3N9UC 1UL3A 2XO7A 4G6QA 2HFSA 1Q1VA 2ZCWA 4URGA 2I5JA 2HG4A 3DMJA 3OLAA 2EFWA 1RT1A 1FEEA 1FY7A 4KGXB 4AQYJ 4LRAA 2MJUA 1PJ6A 4A8YA 4MGRA 2KYZA 1K1SA 3FZ2A 1R8AA 4WZQA 1BIBA 3W7BA 4L6V3 1Y0NA 2QGFB 3AG4H 4A3BJ 5BQTA 1RABB 2IMWP 3AD7C 4W92B 3MGJA 1NHAA 1YJRA 2YWHA 4BH9A 1V3FA 2HOEA 1DQ9A 3LUYA 1QUVA 1ZK8A 3EUNA 3I4HX 3GR0A 3K5NA 3QT5A 4EFAC 2K3KA 2JA7J 5CJ9A 1TL1A 4IO9F 4DFKA 4FDFA 4N47A 5L38A 3RKWA 2B0GA 4K4YA 2L2OA 1APSA 2CNLB 2ZMEC 3U1LA 3QGHA 1BI3A 1U09A 2DNHA 2BEFA 4ZH4F 5F64A 1MKMA 4TLQA 3OYBA 4IOCF 4DR2J 3B54A 3MM7A 4J9SA 4DQRA 2LF8A 4CO5A 1RAOA 4DUYJ 2G7UA 2F5GA 4LFCF 5KT4A 5DGAA 2V9PA 1AKHB 1HW9A 4TKTA 1S1UB 2DHAA 4IFVB 1MSWD 5EGOA 5HLTA 1XCVA 4EJUA 1KQGB 4YFXF 3DPUA 4B4CA 3K6GA 2CWKA 2EWNA 3HJVA 2R7SA 1O8BA 4RUHA 5FJ4A 2W57A 3NLCA 4HNUA 4JV5F 5C2CA 1V5FA 2IBKA 2FVSA 1JLCB 1JLBB 2RQPA 3AXMA 1SFXA 3MEDA 3FIWA 2D3UA 2GIZA 3MM7B 4EGZA 2OF7A 2XS2A 2G2ZA 3AG3H 2VB6A 1HARA 3W2AA 1RQ0A 2CKWA 2D74B 2YR2A 2ZHOA 3JSRA 5C2GA 2VKVA 1YRNB 1IN0A 5K8OA 4XLEA 3A02A 1NBEB 2GVZA 5BPDA 3U1DA 2IHR1 3HRMA 1OMSA 3GMEA 5DDGA 1NZ8A 1Z05A 5IP6A 4BBRJ 4BXXJ 4NX9A 4F4YA 1N78A 1KQSR 4F4WA 2QA2A 3OYCA 5IXUA 3UDCA 4HVZA 1YOVB 3MEEB 2R4GA 4NRTA 1TL7A 4BNCA 1JTYA 2QENA 4BE1A 4QPTA 5B0FA 1PILA 4WPAA 3HD2A 2LKSA 2OEKA 1V55H 4R8UA 1T8EA 3KK3B 3EJMA 2EEYA 1U1OA 3LQVA 3VAGA 4ZC3A 3DOMA 2XZWA 3DI6A 1ZYQA 1N5YA 3VR1A 1J7KA 2Y0MA 5ITHA 1LK7A 2GA1A 3T5XA 4FBUA 3BR3A 2LFBA 3LO3A 2AJ0A 4RAFA 4KE5A 3HRUA 2BJ9A 3PJ9A 4KIAA 1MBGA 1ZRDA 4ALZA 3KEQA 2HVRA 3R61A 1T9XA 1VRUA 3MHYA 4RBTA 3UN2A 1J09A 4PEOA 3GWZA 4CLKA 4USIA 3EQLF 4RZRA 1LOUA 1SKWA 2BXZA 1DAXA 4JI3F 4DS5A 1Z1DA 2DNRA 4JI1J 2QJ3A 2QSGX 3UDLA 1S6QA 3DRPA 4G6TB 2BQRA 3BG5A 1VRTA 5KOWA 1U5TA 4ZPDA 1WEZA 4MJKA 4M71A 4QIFA 2LF7A 3QYBA 1GXPA 1IC8A 1EQMA 5K8MA 1VBZA 3HJEA 3L2QA 3NBPB 1EZZB 2MKCA 1JGSA 4LQ9A 4X65J 2IPQX 1U25A 3FC9A 1WEYA 3DGPA 3CB4A 4X64F 1YG2A 2MQOA 3PM1A 2D3OR 3NBPA 3AD9C 2PMZA 4UOGA 2PI4A 3Q9SA 4CA0A 1CVJA 2AEMA 1YI2I 3AAWB 5LD2C 1G1XA 2EBIA 3D0SA 2CPEA 4RM2A 3JTPA 2XPUA 2A6OA 2WTFA 3HZJA 4P75A 1S6QB 3GG0A 4PR6A 2R7DA 4E6KG 2OP5A 3A8JA 2B3TB 1SKRA 4OJGA 1RYSA 1XNQJ 5I3PA 1NK2P 3M2UB 3D3BJ 3N28A 4X4TA 1X31C 2VQEJ 1Q1KA 4F7ZA 4HTIA 2IAJA 2H9ZA 2NZ4A 1PJRA 4NLXA 4IG3B 2DOAA 2DGUA 5EDNA 1LW2B 5E1XA 2DXFA 2PIIA 3FEXB 1W0UA 1WGXA 4OYXA 3KP2A 3ZQHA 4ELUA 2IIHA 2LG4A 1S0MA 2AYBA 1J5EJ 2XMVA 1FWLA 1OSCA 4B3SF 1X1BA 4KFBA 1TKTA 2E5ZA 3G82B 4Q4ZF 1MZBA 1N5YB 1IBCB 2AQEA 3VHQA 1M1HA 2LH9A 2OV7A 3KP5A 4JI2F 2LRDA 4U0VA 4GO5X 3S3MA 1BW6A 2GQQA 2VC0A 5EG0B 1S7EA 2OMLA 2Z4PA 4IUFA 2VA3A 1D8ZA 3LWFA 1RUNA 3WTTC 2XULA 2LP0A 2OQGA 4MFDA 3HK2A 1G4DA 1YITI 3CDEA 4A8QA 2OHDA 1YJ9S 1DPUA 2MKSA 4KGKA 3WU0A 1JLQB 2GVZB 1QSSA 3OJSA 1LEOA 2LECA 5GADU 2CQPA 2K3PA 1N8RT 4WTOB 4IOAQ 4LG0B 4JI0F 3M3YJ 4G7OF 2LDIA 1U1MA 2RHQB 4BL0B 1YRTA 3SEOA 1S9FA 4ERDA 2G2OA 3RBZA 4UUSA 3T3FA 2QFIA 1UAWA 1OR7C 1Y39A 1EETA 2WVEA 4U88A 4JYKA 3PIPF 1Z6TA 3M6UA 2M8HA 2MD5A 3QO9A 1VISA 2XGXA 1DGWY 2PMZD 2HAIA 1UETA 4P1WA 1IN7A 1TVRB 2ZJQQ 1O6XA 2DFIA 3QPSA 2RS8A 5BR8J 3GYNA 4BC9A 3CP8A 5EGOB 5KT6A 4FXWA 4WYWA 4P52A 2YNHA 3PFEA 1GMWD 2H54B 5F1RA 4CH0S 2YX1A 4D3GA 2FVQA 1T33A 3D0GE 4L9TA 5M2UA 4MQVA 3K1MA 3PO5A 1Z3YA 1K6YA 3TEGA 4Z7YA 2ELHA 5AIPA 2HURA 4ID5A 3B78A 2E35A 4PUSA 1Z1ZA 2FBIA 3LSGA 3BM7A 2ELJA 3J80Z 4OYPA 2WAQD 3JSBA 3VQTA 3LFUA 2DFFA 1QE1B 4JV1A 3NGRA 3HXLA 2M9KA 5A8RB 2MZ1A 1X4EA 2RRBA 1U7LA 2XAFA 4CLTA 4RDUA 4OHXA 4O44A 3IWNC 2IRUA 3PJXA 4OI0A 4UOFA 1ZPVA 1Q7YT 5E3RA 2VG5A 1YDLA 2M52A 4FHTA 5I3UA 2GO9A 4DR5J 3PSFA 4C2MA 5FO5A 2B43A 2GXAA 1KKHA 3CD0A 1IF1A 2CVIA 3JQMA 2WB1N 2CJ9A 1ZRFA 2MKIA 3ULHA 2ZOFA 4MFBA 1NK8A 3IRWP 4ZMMA 3D4JA 5L9NA 1AB8A 4CM2A 1JMTA 5GAHI 3BN7A 2YQ3A 4WFBQ 1NCLA 4C3IJ 5HI7A 3M8YA 4DR7F 4IFYA 3H3UA 4FNHA 2ZOMA 5THWA 3NNAA 2DU9A 1K0VA 3IBCB 5FD1A 1XG1A 3ZZYA 2MD0A 4Y15A 1XQIA 3GG1A 2ZH5A 3FVYA 1YS7A 1Q95G 1RHKB 4A8OA 2XLKA 3BEGB 3CCJI 2W7OA 4M73A 4LFAF 4Y2CA 4XLPF 2B7BB 1MMNA 4DR3F 1U8RA 1YGYA 2PA3A 1NK7A 3GO5A 2P5KA 4FYVB 5CVRA 1P92A 3ZMSA 1IRXA 3CDWA 2B63J 3IR5B 1S7AA 2R3VA 4BC7A 3LP2B 3H5AA 1GV5A 3R2DJ 3PUBA 5ICCA 2KT3A 5K7ZA 3M8WA 2EFGA 2YKOA 1SL1A 4CT8A 1RZ4A 4DNCA 1GMWA 2WSEC 1VS3A 1LWXA 3WHCA 1QVTA 2ECBA 1MMLA 2R7WA 3FXOA 2VC1A 1Y5IB 3DPTA 3RQ4A 2A1BA 1OWXA 1R9TJ 1VMBA 2GCFA 4IVNA 5KFAA 1WJAA 1FKOA 2IS1A 3DOLA 4LB6B 1K61A 3SYZA 3TJ9A 3MM8A 2LA6A 3CCSI 3FCWA 4Y7NJ 2JSPA 4R8UB 5J4VA 2GXBA 3DHWC 3ZGKA 2HHPA 3MWBA 1QA6A 3B6AA 2DXEA 5E3OA 4DGWB 4F0MA 3OHBA 2R7UA 4ECZA 2QSFX 1SB6A 1T38A 3S93A 5F3TA 3HVTA 2OPQB 1N5VA 1XMBA 1G2HA 1IN6A 3MDFA 4NYPA 1O3RA 1X4DA 4C0HA 4AVPA 1F5CA 3RPUD 3F8CA 3SIPB 2E44A 1BWVA 3Q8PB 3KK2A 2RRNA 2J0SD 2FE3A 4USUA 1X5OA 2E1MC 2XSJA 3FNNA 2QYGA 1HC8A 3CULA 2NXEA 3DF8A 2KHCA 3GILA 1CGPA 1I27A 1G3OA 1ZHFA 4OHZA 3V5RA 2QLJB 1P7JA 3RIRA 2L48A 2CQCA 4AIHA 3HT0A 4HLBA 5CD4H 4R5PA 4YB1P 5K14A 1JLCA 7AT1B 1HD0A 4KITB 2IVFB 4B3RF 4USVA 2G0EA 1VHIA 1N5SA 2EFNA 4R79A 2YKNA 1UVMA 4A8SA 1B64A 2VV5A 3CCVI 1W7PB 4KJIA 2A0FB 3K70C 2HOSA 3OMYA 3K5PA 3L2VA 3SV3A 5H9EJ 1GX5A 1Y11A 2D5VA 5SUHA 1OCRH 4KGMA 3LA7A 4DUZJ 3M05A 3OBIA 3I0SB 5EWFA 1MWZA 2ABYA 3WGIA 3A12A 2M4GA 4ZCIA 1I94J 2ZBCA 2EINH 2CJKA 3BCAA 5L39A 3OTOJ 2XROA 2D3ZA 2ZH8A 1FRMA 4AWXB 3M9NB 3UNGC 1FD2A 4Y65A 1Q8KA 4X4OA 4DG1A 4GVLA 4KB7A 3IWZA 2DT7B 3FSYA 3LMMA 2FMYA 1VI7A 1I6XA 4F0KA 2HDCA 2DH7A 3T1YJ 3LSIA 5D4LA 3HSEA 1T0FC 1LVAA 1WQ2A 2VPRA 3QATA 1XMOF 1XR6A 2V63A 1IBKJ 3MECA 4AYBA 3H25A 4RWXA 1RLDA 2A6HF 1AUDA 1LB2A 1HHQA 3DTEA 4M74A 2C3OA 5CCLA 1J2VA 4R25A 2HYJA 3GZ6A 2HWIA 3WTYC 3CD7A 1R49A 4ZOSA 2C2OB 4J9MA 3UD4P 2G9OA 3Q83A 1NJWA 2DNYA 5E8IA 2E7WA 2HFOA 3TX0A 3LAPA 4NXNJ 3P9KA 5E3PA 3VAHA 1XGNA 1FWKA 2W9BB 1LFWA 2Q2EB 2CPYA 5JUMA 2DO7A 3CMAS 1OYIA 4HACA 1HQCA 4M3FA 3E5XA 1FDAA 3ZQLA 3CDIA 4DEZA 2EXUA 4F26A 2O0YA 3JRCA 5G0RB 1K9MT 3C14A 4LVNP 3JTOA 4M5LA 5E2QA 6AT1B 4OZ0A 2MKKA 1YX2A 1H6KX 4DU8A 1RTJB 1DTQA 2KZZA 1NSPA 2GQCA 2OUGA 2E66A 1NDLA 1S10A 3CMAI 1NG6A 2XMKA 2KFYA 4QCLA 4XKBA 1OPIA 2MZSA 1SV5B 2L5QA 1HNVB 2M3DA 4IH5A 1SXLA 1U48A 4A3DJ 2KJVA 1XC9A 1SFEA 4A3KJ 4QPQA 1HWKA 1TQMA 3CD5A 1NO8A 1RHUB 4LK0F 3TRGA 3QIDA 3EVWA 3HVTB 1UW4A 5J1RA 1KFDA 2HK2A 4PG6A 3K4NA 1JNZB 2P4WA 3TVKA 1X3UA 3VPRA 1FNOA 4LR7A 4KIFA 2M30A 2YNIA 3C6UB 3CF5Q 2DB1A 1CLFA 2K7LA 4C3JJ 4L5JA 4MH8A 2R5ZB 5E1ZB 1UWAA 3FWEA 4ENMA 1WI8A 1Q0NA 3M8QB 2DMUA 2XI3A 4HZFA 1UEUA 1HQEB 5ETOA 2F5DA 3BR2A 2KI2A 4JI7F 2FVPA 2GWRA 4O4GA 4JI8F 5J2QA 5D0EA 2GBYA 1IWGA 3LW5C 3K8WA 2FTRA 2VDIA 3NAUA 1HNWJ 4F91B 5GAGI 4OAYA 1W7WA 1XSXA 1IV8A 2O8KA 2PSZA 5IM0B 1GHCA 3FBNB 2HIYA 2OCCH 3CGIA 1ZS6A 2COLA 4DL5A 1QU3A 3KLHA 2NVUB 2ESHA 4O3MA 1HQEA 1HBMB 5F8HA 4K0KF 2R7XA 2DVIA 2I9SA 2FVRA 1UCRA 4H4OA 2XI2A 5CPRB 2V1XA 3V81A 3HB9A 1IAWA 4F7VA 3TMOA 3A8EA 2U2FA 1S9EB 4KC5A 4CCJA 1NUEA 2BM0A 1Z2ZA 1X4GA 2QMWA 3AH6A 3N6LA 1Z7UA 3HX9A 5CYJA 5CQEA 2CQ4A 2V94A 4XRSG 3TO8A 3BTIA 3CJ2A 2Y1JA 1T7PA 1I51B 3RB6A 1R36A 3P5BP 3QYEA 2C2MB 2L9SA 4B3TF 4XN0A 4UF4A 3LSMA 2X3DA 2VKDA 2LP4A 4V19J 3CDBA 4A4JA 3M9AA 1FMWA 3V7CA 4ILMA 4DS4A 1Z4UA 3OTCA 5D6EA 4JYAF 4B3XA 4RW8B 2UV8G 5TISC 2RHSB 4Y17A 5KAFC 1PUFB 2OPRB 3EWGA 4U7CA 3NGDA 4LFBJ 2IJRA 1HQUA 2IXSA 3ULQB 4MAKA 4JI6F 1DP7P 4DX7A 1TWGJ 5ETVA 2Z58B 1S99A 1C0UA 4J9NA 2X7IA 1IBLF 2JVGA 3G1LA 3KTQA 2X4HA 3QQCD 3JRIA 5H1SV 2H4WB 3X2QH 3I0TA 1XDUA 1QZYA 3HHHA 2QLZA 4JI4J 2VJIA 2BGCA 1RTDB 2CJJA 2ISZA 3CMES 2YNFB 1U0JA 4A3GJ 5LMUJ 3H42A 4IRHA 4UXNA 1TW2A 2IY5B 2ZXIA 4C3LA 4L76A 4MKBA 5D5UB 2E5IA 3E6CC 2JFDA 4LQ3A 1L3KA 4DPTA 2Y0SN 2W01A 3NP5A 3UVJB 5AXNA 5JVHQ 3DU5A 3UPFA 4JI1F 1FMVA 1JKHA 2W9CB 3ZTRA 4DSKA 1YI2S 4L0YB 5KFGA 1F6TA 2FX0A 2B4PA 2GJFA 3MEKA 2FHKA 4ELTA 4FYWB 4GYIA 4K59A 4CDIA 4DV5F 4IX7A 2CWXA 1TKXB 5KFYA 1AW0A 1PSDA 1NKCA 2DNPA 3H5XA 1MDMA 1C0TB 5CAAA 2CW7A 3KZZA 5EF6A 4HW0A 1WC6A 1LXJA 5L46A 2JSXA 2P8IA 2DCLA 4WXDA 2IS4A 1IKYB 3QWUA 5LLQA 1RT4A 3PG9A 2YPZA 3OSFA 3DEUA 1EAYC 4MO7A 3ENWA 1FRXA 2TCTA 3H5YA 1J5OA 1FOKA 1KTQA 4MEYF 2MXYA 3RBXA 1FWPA 1I5OB 4KYWA 2UXCF 4YELA 3OVAA 2I2YA 1HXDA 5ICEA 1Y6IA 1U2RA 1TUVA 2LY1A 4D5FA 2NS8A 3ZZTA 4LIRA 2OLWA 3C16B 1OISA 5FLXZ 5LBQA 1X2NA 4EMDA 3GZNB 4UZCA 2EZIA 5HROA 3Q23A 4I1TA 1R0AA 1VR6A 1E6YA 3TW0A 5DCMB 2KRHA 3S15J 3TAMA 4GKJF 5T41A 2HXIA 2L4MA 4F55A 4I09A 3DXBA 5DS7A 2J6SA 5K14B 5DTDA 3PTWA 1FDDA 2DD8S 3HZGA 3BV8A 1YJNS 4XAKA 5LEJA 4IKAA 4Q44A 1LEBA 4HDVA 4CNZA 1UMJA 2AMCB 1MROB 3C1DA 2KTQA 3BR0A 1HHTP 3C15B 2DJWA 3H1CA 2OPPA 2G1DA 3GLLA 3KLGA 1RBAA 2NPIA 3FBCA 4F4AA 2XGQA 1MWYA 3R0AA 2KN4A 3JAMY 1KHVA 3T1HF 4LF4J 1HR0F 3FXLA 4D5CA 4KR0B 4DLEA 4HQMA 1S4FA 3JSMB 4B3OA 1YG0A 3RR7A 4C11A 4I7FA 3W9IA 1GVDA 4WU3A 2FJEB 5M5YJ 2V1NA 3Q86A 4HRIA 3BG9A 2J0XA 3NS7B 3G6EI 4BQOA 3RG6A 1UJ5A 2JA6J 3K89A 2QSFA 3UN5A 4P72A 3RZOJ 1ICEB 1B70B 4QIWD 1RIOH 3NGSA 3FXQA 1SQGA 1JLGA 1XN7A 5KAIC 1CJTA 1R43A 1S1XA 3N79A 1R6VA 3BO3A 3LANA 5DM7Q 3NGKA 3A01A 4CLZA 4DSLA 1RKWA 3RZAA 4NCAA 3MFKA 3PW5A 4IO1A 1QBJA 2HVHA 2WSCC 4CYCB 4LF9J 4CLFA 4CH1A 4RKUC 2RQ4A 3PO3J 3OL9A 2GVDA 1XMQF 1FE0A 3D6HB 1YJWI 2XHWA 3QIPB 3T0YA 2F65A 4WCEQ 1A36A 2DNNA 4G7ZF 2AQFA 2HHSA 3NOCA 4JV0A 1ENHA 4ABZA 1X0PA 4BU2A 4H54A 2J6UA 1M5VC 4HLYA 3MR2A 3BKUA 3H2LA 5DM6Q 4Y13A 2F4VF 1HOMA 2BJ8A 2HQ5A 3K57A 1JJ4A 3I3LA 1SC3B 2JRTA 1D8YA 1X4CA 3X3UA 3QLHB 2P9EA 2QT7A 4ILLA 2RD5C 3OOPA 2B8PA 1U0HB 2L9DA 2A18A 2GVDB 3GWCA 3OY9A 3QZ7A 1PBUA 2B6AA 4B09A 1MMSA 1U2WA 1BI0A 3O8WA 1JJ8C 3DLGA 3CC2I 3W5ZA 5B7WA 3IP4B 5J2NA 3ZTQA 3K8VA 1PO6A 3MZIA 2RSQA 4L9VA 1K47A 5ETNA 1ZAWA 3GYGA 2WZ1A 1RWXB 5LEKA 3DI6B 2HNZB 4DR7J 3CO7C 5BYRA 4DDFA 3AA8A 1R8PA 4ZA1A 2O7OA 1QDUB 1RKTA 4KY3A 5HMWA 4P71A 3V6HA 1FPQA 1URRA 1NPPA 1T98A 4L3KA 2DA3A 4X4UA 2BE9B 2OFHX 2K86A 2FBKA 3HHDA 3KP4A 2ZDPA 1H74A 1T9UA 3BGUA 3S1RJ 4RL1A 3W9JA 1N54B 2H94A 4ESBA 3AXKA 2Y2ZA 2A3SA 4Q0BB 4YN3B 2ASLA 4E4HA 1MMGA 1TW3A 3HHLA 4BEHA 3BT9A 2LQBA 4IHTA 4HA8A 1Q7LB 4BKXA 1SBRA 3BP8A 8ATCB 3LP0B 1SJFA 5D0RA 1HLVA 5LHHA 2ROPA 1RAFB 1XR7A 1U47A 2MHNA 4RB2C 2Y3YA 3M6VA 2FYXA 3DOKA 2RQMA 1S6LA 2RGVA 2KT0A 3J80K 3CT9A 5TGTA 3VYUB 5KNLA 5FDLB 1S9GA 4F0HA 9ANTA 1Q86T 3EUKL 2E9ZA 4XQFA 4V2FA 4A3IJ 3GVAA 4Y00A 4UZBA 4F2SA 5IV3A 2UVUA 3CCQS 3Q89A 5IOZA 4B1RA 4OI3A 1QZZA 3H35A 1IUYA 2JQ7A 1LW0B 1XWLA 3HCXA 2A6TA 3TUIC 3X1LB 3AY0A 1F60B 4QIVA 2KZVA 2IBOA 3R5AA 4DL4A 3NMAA 1YJNI 3M8PB 2ILZA 1KYZA 2K3FA 4DFMA 2GA2A 1SI9A 2MC4A 1ON1A 2CJBA 1ETXA 1X9SA 1CJKA 3Q0WA 2P9GA 4CCHA 3RAMA 4RAGA 1DBDA 3RRKA 1HL6A 3SXYA 2C2RA 4A6DA 3W6VA 1C1BA 1E2XA 2XB5A 1T8IA 1B4AA 4PPDA 4F52A 2H09A 1HYSB 4OIQF 1OS5A 3CO0P 4X66J 2ROGA 1VQMI 2BRLA 2EIKH 4C48A 2LSOA 4MK8A 3JRBA 3HSJA 2MLYA 5HLIA 4ZYHA 2VG7B 2RILA 4I6WA 1C0TA 1HFEL 3KXDA 5DD4A 1D9AA 3W9HA 1VDHA 1U1KA 4PRFA 5J2PA 3UCUP 2OTJI 1T9VA 1DU6A 1DJ0A 1NDKA 2DMNA 2FDNA 1NU4A 2G0IA 2CFXA 3SQGB 4DV2F 4EEYA 3S3OA 4MNUA 2VQGA 2GNKA 3VSLA 1JNRB 2I38A 4DV6J 2V6EA 3WDOA 4PG8A 2JJ7A 3FBBA 3E6BA 3K0JA 2BX6A 2MZTA 4ECSA 4EYHB 2KM8C 2Z30B 1X7VA 2COMA 3NEUA 4ICLA 1UPMB 3W8GA 4NE9C 2TDXA 3WHIA 1BQXA 1U8WA 2PEBA 1VQ7I 2EJRA 1KU9A 5E17F 1WJBA 2Y0BB 4LJMA 4J19A 2K9MA 4QTRA 3GTJJ 5CYMB 1QHGA 1UP1A 2QCOA 2FRHA 4OX6A 4I6AA 1DQUA 3FJ2A 3FMWA 1VCTA 4HLXA 4OWRB 1FD8A 4XN3A 2CQGA 1CJUA 1Q5YA 1P9QC 2A07F 4KKOA 4AT1B 3QQAA 4X4VA 3FK6A 3CCEI 1URNA 2EB7A 3LWLA 3DTKA 4A2UA 3C2HA 4DF8A 5CZVA 1SJ1A 4NYOA 1H38A 2W1BA 4TLRA 3BN4A 1TELA 5HVHA 4XKWA 4OFZA 4NLSA 4LLNA 1QLNA 2GW8A 3MFHA 3GF2A 1Y56A 4P96A 3BQZA 2ZO4A 3RU0A 4A0YA 3VODA 3H3VK 2MQNA 1TKDA 4PXBA 3BO4A 4DV0J 3CUQA 4J5OA 1ZELA 1D09B 1T03B 1DGRM 3NGTA 2VFTA 1REGX 2YWGA 3BWGA 5M5XJ 4DR4F 3HOXJ 3S1NJ 2FOKA 3GXOA 3IH4A 3BF4A 1S6PA 2YH1A 1X5TA 3PEHA 1TL5A 1SQFA 3CJKB 1R1TA 3SSRA 5B09A 3PJRA 2O8XA 1Y7PA 5CA5A 3IKTA 5A8WA 1TAQA 4ZCKA 5FLXU 3EX7B 1GV2A 5F8GA 4BJ6C 4A12A 2NYIA 2ZUAA 1UG2A 2VZ9A 2IC3B 3JXOA 3Q24A 4E0DA 1HNIB 3D5SC 2VOOA 5GP9A 2OI2A 2YWEA 2XGEA 3UQSA 2BQUA 1ORKA 1N5QA 4PABA 5D6GA 4KMFA 1RAEB 2XHKA 4LB5A 1ZTWA 2QN6B 4F02A 3R8YA 3HBLA 3HZEA 1ZTRA 4LSZB 3G6VA 1LKXA 4RUAA 1R5GA 3HI9A 1F1BB 3VVTA 1SANA 3EPGA 4ZS6A 1TUWA 4OIRF 5IT9Y 1X5SA 1I5ZA 4Y2IA 1HW5A 2M7BA 1FKPA 2W4PA 3EM1A 4C11B 4LMZA 1S72I 3CEDA 3EXCX 2HTSA 4QZVB 3VGTA 1TWAJ 3L1PA 2ZD1B 5KFCA 3MMAA 5KG7A 2IM1A 4L18B 4UV8A 5F8JA 2CNOB 4ZVQB 1UA0A 5D3GB 2X9DA 1YRNA 1RKJA 1MBFA 3TW7A 2NXJA 4K4SA 1RWWB 1PP7U 4RU9A 4QWEA 4HDUA 4DXLA 2HI3A 2KJBA 3TNVA 4C2MJ 1JLEB 2W00A 5KFFA 1J2XA 1TQIA 1YJWS 3J7ZI 3BDEA 4EZ6A 2JWTA 3BO2A 3SSSA 3KK1B 2EQRA 2DEJA 5F9LA 1Z7LA 3PEJA 4KAIA 1IR2A 1S1VA 4OZ5A 5GMKa 4YY3J 1WKLA 5HBMA 2XLIA 3UNYA 4JI7J 2HNDB 5AJ3F 1TL3A 3KLOA 2ZZTA 3DDKA 5D5VB 2JOQA 3NEKA 4GKKF 1I6JA 5BMZA 2HS3A 3Q8UA 1HNWF 2XHCA 4UQGA 4CYDA 2I10A 2HBZB 5DG9A 4ZYAA 1TK0A 5GAEJ 1BLUA 3GBGA 2QX0A 2PGCA 2RKIB 3Q0AA 2R5YA 1UTAA 2P7VB 2VBXA 2XV4S 3DC2A 4K0KJ 5HDGA 4LF6F 4WIIA 3CCUI 1U9NA 2DITA 1Y3JA 5DM7F 3HFZB 1W1WE 1T3NA 4RLFA 3HRSA 5AE3A 3QU6A 1MIJA 4ENJA 3C18A 1UMQA 2UZAA 4E2FB 3OS1A 3PW0A 5FKKA 4B47A 2J6TA