2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
4WF9Q 1F0XA 4FS2A 1SD6A 1FRJA 2RUGA 2R7WA 2ZE2B 3TNVA 3AA9A 1TQLA 4JV1A 1U8WA 1U5TC 1OYDA 1R89A 3QQCD 4FYYB 1UMQA 1SH2A 3CDIA 1KZHA 4O3QA 2V8HA 4LQ3A 1AYEA 4DS4A 1H3DA 2I5UA 2MKKA 4L0ZB 3ENWA 2M3AA 1PGZA 3GZNB 1HW5A 4ENNA 3FMWA 5IQ6A 2ZUGA 1OWXA 1IAWA 4L74A 5J2NA 2G4BA 4MK8A 4RU9A 3EX7B 4WYWA 3PFOA 2E1NA 3GEZA 4XRFA 5KAIC 4X64F 1NTCA 4UW2A 2NREA 4XRMA 4X6AJ 3B02A 3H9GA 4IX7A 4DL0C 2B7BB 2E36A 3EPGA 3S2HJ 3MEXA 2CNNB 1EJ7L 4M5DA 1DU6A 4RBOA 2A0FB 2ACJA 4YELA 3JR9A 4ZLNA 4D1QA 2FVSA 1IF1A 3IWLA 2M30A 2HEKA 4YOEA 2ZMEB 2XSJB 3R60A 2L41A 4RAFA 4ZDLA 2Z1DA 4WXOA 4DOZA 3CW2C 4C8OA 1S1VA 2DPDA 4DL5A 1WF2A 3I55I 1XMQF 1P7IA 1WRJA 1RT1A 1NG7A 2KHMA 3R0JA 4FN5A 5DETA 4WFBQ 4CIOA 4NLGA 2YKMB 3OSGA 2ZD1A 2UXCJ 3D28A 3DRPB 3KKFA 1IN8A 1FOXA 3T1AA 4RW9A 5CYQA 1TELA 4FVMA 2CUEA 2CZ9A 4LFBF 3LH2S 3BN7A 1Z2LA 2FC8A 3R1LA 1TNTA 3AD7C 3ZR8X 2D9PA 2ZKUA 4J9PA 3S16J 3KJFB 4PYAA 2ZFWA 5KAFC 1PAUB 2MH9A 1UJ4A 3RPUD 4HHJA 2OF7A 2H5JB 3BPDA 2DA6A 3H4DA 4QQBA 4F8RA 4PG6A 2IA1A 5DEQA 5A2QK 2R7RA 4H4MA 1G4CA 2F63A 3SCKE 2IA0A 5D6FA 1B72B 1Q7LB 2KYXA 3HL2A 2OPQB 1RT4A 3W2WA 5KG2A 3DOLB 1JWWA 1LK5A 2QL5B 3WTUC 4JI5F 3P9CA 2A2DA 4C6AA 3FF5A 3OL8A 1V55H 4HRIA 2MSTA 2XAGA 5DZ6A 1WC1A 2JC1A 2ZBCA 1W2BR 5M5WJ 1EX8A 4ZP8A 2D69A 4DN0A 1LWXA 5GTIC 2JUCA 4ILRA 4B02A 2YH1A 3C2GA 3E6MA 2H9ZA 4RWXA 2NR0A 3CULA 4WE1B 2X4HA 1HL6A 3PUFA 2FYXA 3CJ4A 1G8XA 2P7VB 3KLFA 3A1YG 2PA3A 2M8DB 3WC0A 3KK2A 2RVCA 3NMRA 1R1VA 1NJXA 1T95A 4X4UA 2F5DA 1TBXA 3H3UA 1ROFA 1MNDA 1W7PD 4DEZA 4EJWA 2PFBA 3MCNA 2HNYB 3HFVA 5ETMA 1BOAA 4A8SA 3MQ0A 2Y31A 4AYBN 4BAYA 4BQAA 2QLJB 2VA2A 2ZZTA 2QQAA 3ZQFA 2FZCB 2VJUA 1O57A 2DNRA 3QP5A 1PP8F 2HTSA 3VAJA 1S1WB 4CZZA 5TRDA 2VT3A 2RH3A 2M4KA 2YU3A 2AGQA 5F0HA 1VHIA 2YSRA 1BC8C 1HNVA 1HNIB 2C3MA 3MN2A 3QJLA 2AHOB 2E5IA 5GAEI 2RQ4A 4ECZA 4ZDNA 3P5TL 4NI2A 1VC0A 1J2XA 2OPRA 2R8GA 1YS6A 1N48A 2IVMA 3LTOA 4RM2A 3BKFA 5BYQA 3CTAA 3P9KA 4B17A 3MFIA 5A8RB 4OYPA 5GAHU 3GZ6A 2ZH5A 4BBRJ 1RT6B 3W3CA 4LF8J 5LHGA 4ESFA 3TZWA 3IH4A 5F8HA 5EEGA 4I6WA 2VG5A 3WQPA 3VAFA 3V4IB 3LGMA 4ED0A 3BC8A 2BHZA 5HLTA 4F55A 5CD4A 5BYRA 3V6KA 4IVNA 1F3FA 3LSGA 3LFKA 4YR3A 4BDYA 1BY9A 1R6RA 1RR8C 1PUFB 5C7PA 1GX6A 1G2HA 2P0WA 3HPGA 2XY7A 4OYIA 1FEEA 2DNQA 2HS3A 4TKTA 3D67A 3ZGKA 2NQPA 1B64A 1B9MA 1SXLA 1YX5A 1Y00A 2HYJA 1G3TA 5F8JA 4A3EJ 2JPBA 1JXVA 1S4FA 2HVHA 3H2LA 3ZP5A 3ZTSA 1P8GA 5HJYA 2VL1A 1FI4A 3D5RC 2IHR1 8AT1B 4ELTA 3ZXSA 2MZRA 5K7ZA 3EVMA 3TW7A 2BACA 2CW0F 1LE8B 3HO1A 3BYPA 2VQGA 2DCLA 3F8NA 3HSRA 4LFUA 4XN0A 1X9WA 4Q8EA 3MAHA 2JMWA 2ELKA 3Q2SC 2CPFA 2B9XA 2RD5C 3COAC 2GS8A 2QYOA 4F67A 4LRBA 2OZUA 5GMDA 2CQ0A 4NEZA 3W2VA 3I4PA 2XC9A 1S4EA 2HHVA 1VC6A 3WGGA 3W61A 2HYIB 1IJFB 1CC7A 1TQIA 4KIGA 1S1UA 4F52A 2B5JA 3OFFA 2J9DA 2HWTA 2FMLA 1P9YA 4DFJA 4HNTA 3F21A 1M5SA 1NNDA 3VGTA 1MU2A 4R0JA 1B59A 1EA3A 1RETA 4KQZA 3LWMA 5T7LA 2M0GB 4KHPJ 4TNOA 2UV1A 3I54A 4KBIA 1R00A 4OZLA 1J7KA 5DDQC 4NA1A 2XRNA 3WGHA 5FKOA 4EU0A 4P96A 4URGA 2R8JA 1D09B 1SJ3P 5KOWA 1O3QA 5L3FA 1U26A 4EWTA 3DBRB 5CQEA 3CUOA 3OS0A 1W7PB 2F9JA 2HQNA 4I2QA 4HACB 3T8RA 4Z6YA 4MFBA 1TKTB 3U1NA 1CVJA 2EB7A 4EGZA 3OOPA 4NLRA 1AKHA 3MI7X 3TA2A 4TU8A 1OCRH 2PJRB 4FCYA 2CDQA 2IRYA 2MD0A 5B3SH 2ZVIA 2NUUG 4F3MA 3S1TA 4DS5A 3SDBA 2W2NP 3OLBA 4KUMA 2K02A 2Z58B 5D4SA 1HFEL 3PJXA 4M3BA 5JI6A 1W0TA 6PAXA 2D2WA 3RB6A 2XQCA 1DARA 2F5GA 3WG7H 5LRRA 2K4JA 4OFZA 3CCRS 1TV6A 3W8PA 1FJ7A 2YH0A 3SZGA 4AYBA 1JLFA 5D15A 2MHNA 2VL8A 4WYLA 3FZVA 3KHHA 1OO0B 4Y15A 5JHUA 3EXYA 4X2BA 3H0GJ 4U7UK 2B43A 3DOMA 2AGOA 3GV8B 4BWMA 5E1ZB 2LXFA 4USKA 1S0OA 2R7UA 4DBRA 2H5IB 4UOFA 3MF5A 4I0AA 5J2MB 4LK1F 2P81A 5BS6A 2GGPB 4Y33A 1U2CA 4KC5A 3PACA 1Z67A 4A47A 4TV7A 2Q3PA 3FHNA 3KE2A 5J40A 3CF5Q 1X7VA 3DM2A 4F7VA 2HHUA 1LJ9A 4WCEQ 3C16A 4AE5A 2HVEA 3CT9A 2W85A 3TO7A 5KFZA 1VISA 1U1NA 1BN5A 2ADUA 3MMCB 5IM0B 4DFMA 1WTFA 4A2UA 5E1WA 5L8RC 2GC8A 2KKHA 1O3TA 1OJ4A 2IAJB 3TUPA 1RTIA 4ZYHA 5DDPC 5KT5A 3G87A 2ZJ2A 3BSAA 2YKNB 4BC9A 1MD0A 4E7SA 1FTTA 4IYQA 2VPXB 2B0LA 2XCPA 3UD3P 3DV8A 2FGCA 2KIMA 1DJ0A 1IUJA 2DNLA 4ESBA 2KPMA 3P5JA 4B3RJ 1OMIA 1JQGA 2UU9J 3RW7A 4UOCA 3F8FA 5KFRA 3CCVS 1F9FA 1QPIA 1WCMJ 1RR7A 3J80U 1K83J 5CXTA 2K85A 4C3LA 2DNOA 4F92B 3CCMS 3GIRA 1HOMA 3MUTP 4LF8F 4NASA 1T94A 2LNBA 4BQNA 1PIEA 2CG8A 2IM3A 3HFKA 4EBEA 4LF7F 1OIAA 2IY5B 1GV5A 1HIYA 3GV5B 3MEEA 3R6SA 3SDGA 2B0GA 1IR2A 2ZO4A 3DRRA 1IXRC 3QSIA 3ABLH 4GMKA 1IR1A 5DDOC 2HZAA 1S9HA 4JB8B 4WK8F 3SYTA 3C8YA 4XTTA 1DFDA 1X31C 5LGNA 2CQPA 3DLKB 1AOYA 1JLGA 3GYXB 3GIIA 1UPPA 4LR8A 3HP6A 1VBXA 1GTHA 2XYPB 2YNIA 4U9RA 2MZQA 3US5A 2VHGA 2XMWA 1O0PA 1PC4A 1YQAA 1H2TZ 2JFDA 4UOHA 1QE1A 1Q95G 1C0UA 2RU9A 5JFRA 5EGOA 3T0YA 3OYKA 4G6QA 2RDJA 1NK9A 2JZ5A 1S1XB 2VD3A 3RRHA 1OLTA 1DURA 2CQHA 2IGKA 1CJVA 1WJBA 3K7AJ 3BN4A 1XC9A 3M30A 3NEKA 3PIOF 1T08B 1Z4UA 3I87A 2ADCA 2XTJP 3CJKA 4CLZA 1UFKA 4BC7A 1J09A 1B0PA 3FSXA 2LA6A 2UVWA 3C3WA 2ZBPA 2DI3A 1JLEA 2LG4A 1WKLA 1VFCA 2VODA 3I59A 1HLWA 2XGCA 4ZK7M 4HF2A 4KHPF 4XRSA 2H4YB 3ULQB 4QWDA 2XLKA 4JI0J 2W25A 1XMOF 1UVLA 3GFJA 4E7HA 1ZK8A 3ILOA 3BM7A 2V9WA 2JN6A 2V5HG 2Z30B 1N32F 3KLEB 2C2MB 4PPDA 4DQSA 3Q22A 1VZ0A 1YJUA 3EYZA 2MKYA 1U1KA 2ASYA 3CDEA 1TNSA 2WB1D 4QIVA 4A4JA 1IR0A 2XNQA 4QWBA 3AG2H 4Y52J 3GCWP 1NKEA 3VVUA 2EKNA 3CCUS 3C6TA 3VVTA 3MAAB 1AZSA 4ZPVR 3NS7B 4Z7YA 4XKWA 3PHTA 2G2ZA 4YMEA 1U1MA 3J7YJ 4DZ6A 4F0HA 3EWGA 5FKMA 2ZJPQ 4D9JA 2HZTA 3FWEA 4NDLA 1DTQB 4N8OA 2P8TA 3HHLA 3NCPA 2EV5A 3L09A 3CJSA 2E2JJ 1XCVA 1RT7B 1HHQA 4DQPA 4B43A 3DGPA 3JW4A 4BDPA 7AT1B 1RTZA 3IR7B 4ZZLA 3EYIA 1USSA 1FVSA 2VFTA 3BPVA 2IJRA 5LEKA 5FJ8J 2XB2D 1IQZA 1B6AA 2GMLA 1S97A 4GKKJ 1TKXA 4U8YA 1WQ2A 1YJ9I 3T6BA 2VQFF 5BJRA 2BV6A 4L75A 4AVPA 3DFEA 3JSYA 4OIQF 4GO1A 3AL0C 1ELOA 1NB2A 3K9TA 2OU2A 3J80Z 1JTYA 4F25A 1V3RA 4DV7F 1U45A 3A0BC 2QMUB 4IXAA 3Q0VA 4I6AA 5KTQA 3W9HA 3PHEA 2RQCA 3EGNA 3N6MA 2ADBA 5HVFA 4DIQA 2NZCA 4OL8A 4P2FA 3A0HC 3TVYA 3T3FA 1FKAF 1RAAB 3TDUC 3KJNB 4LVOP 1RT5A 3RBZA 1NPPA 3DLBA 3M8FA 2AJQA 2OH2A 4QYRA 1IBMF 5DTDA 2UXDJ 1JTXA 3RPQA 2GMHA 1MJBA 2RF2A 2QN6B 1V5VA 4LBPA 5H9EK 3KLGA 2HNZB 1FXLA 4HQMA 3RAMA 1K9MT 4MAKA 1YITS 1CF7B 2B9WA 1Y4ZB 4DPUA 4XIDA 1MBJA 3D9BA 1VQ7I 3W9JA 4B3RF 3LGHA 3OYNA 2YQ1A 4XLNF 2UU9F 3JTNA 3IM8A 4X62F 9ANTA 4PUOA 1QVUA 1C1CA 3CJTB 4I99C 4RZRA 4QIFA 2LVWA 2F5EA 5D5WB 4E7LA 2R7XA 2AU0A 4ZVEA 2TRTA 3MZ8A 1DTTA 4DL3A 1U0HA 4ETXA 3H0DA 2IVYA 3OR2B 1VRUA 5E8IA 4ZVGA 3GIMA 2L9DA 4WFYA 2ALYB 2W84A 1LKXA 4IRDA 2B7CB 4XKVA 4USUA 1FMVA 2LLKA 2K3IA 5ETTA 4UV9A 3N9UC 3PR4A 3LAMA 5ICGA 4A3JJ 4KGKA 3KLHB 4C3HJ 1KA8A 5D0HA 4N0BA 1HSTA 1RPWA 4DU7A 3PUBA 4K4SA 4K4VA 1SVOA 4J00A 2J9EA 3BBBA 4KKOB 1X1DA 3U7JA 1QPMA 1KNZA 4TU9A 1S77D 1SC3B 2HURA 4C98A 3FXKA 2OFHX 3C19A 2V2QA 1REVB 1N88A 2DA3A 3FVYA 1X5SA 3F23A 1V5EA 3BDPA 1XSXA 1YW8A 3OFGA 3EM1A 1MJAA 1OKRA 3JRHA 1AROP 1NKBA 3CLQA 2FQ3A 3H8YA 4XIUA 2C42A 1LQ1A 3SEZA 3C6UB 4GVBA 3W5XA 1SD7A 3GE9A 1TC3C 1UFWA 4ICLB 2P9EA 2XGDA 2JSCA 3W1YC 5H9FK 2RNJA 4PG5A 4LMZA 3DP7A 1RISA 3BG7A 1QAJA 1WSVA 1TWGJ 2QG9B 4EV0A 1KD1T 2YWEA 1HBMA 2UUZA 2CW8A 3MEGB 4RU2A 3JSPA 1Q16B 1P4XA 4Z37A 4OMZA 3FKBA 4BS2A 3L3CA 3QSYB 4C8ZA 2EXUA 4UY8I 3D7SB 4YDDB 2COLA 3VAHA 4BLGA 3CE8A 3UR3C 2YNHA 5KFVA 3PQKA 4CLPA 1TMJA 3I82A 4V19K 4DUZJ 2G9OA 4ZPTR 1DLOB 2M9HA 3TYTA 1Q81T 4CLTA 1CSJA 2BDPA 3D1QA 4GC7A 1YJ7A 3OFHA 2PMZN 2DRDA 3I0RB 3ZN0A 2Q66A 5B09A 2KHDA 2I5JB 3J7ZI 2LD5A 4ZCKA 5I3UA 2A05A 1XJWB 2MZSA 2EFNA 2W4DA 1UZDA 1VQ5S 3HM5A 4IDKA 3K0LA 3ZTQA 3OL4A 3WODF 4ZJQA 4PSXA 4B9SA 4C97A 4RNOA 3RJPA 3CCSS 1GXPA 1L3SA 4UXNA 2P6SA 2H6BA 3QPSA 3ZQIA 3CIMA 2L0KA 2R2UA 4OX6A 1F1ZA 1Q1HA 5IPAA 3HZJA 1IKXB 1I3OB 4KO0A 2R9LA 2DMPA 1TUGB 1XGMA 2DGXA 5IT0A 1RTJB 2XF5A 4XLPF 4P10A 3HSFA 1A31A 5D4OA 3BSNA 4IZZA 3QGGA 2F65A 2ELHA 2VOOA 1KYWA 4NLWA 4Q2MA 1KU3A 1SH0A 4NPOA 2J8AA 4Q0BB 4LFAJ 1NH3A 3AT1B 2EBEA 2FXAA 3OPKA 5JVTA 1JKQC 3D3CJ 4HHUA 5GAHI 2JH3A 1B0VA 1VQ4I 5LGTA 1ZGAA 2B9SA 3LL7A 4M5GA 1V5IB 2E35A 3HF5A 2RC4A 1WSRA 3DBHB 2WW4A 4LF6F 4BE2A 2BUNA 3G6EI 1AUSL 4M8LA 4FETA 4PQUB 3I5BA 2VPRA 2QGUA 4O0NA 2PI5A 2LQ9A 5FDLB 3N05A 4M6VA 4A0XA 1SFUA 2F48A 4CYUB 4GVLA 5ILVA 4LK0F 1B7YB 4FDFA 3K70D 1LEAA 3K5OA 1I6HJ 3EGWB 1WH7A 2XO6A 4P71A 3PW5A 5HLFB 4KIFA 1LDKB 2HQGA 3OYCA 3EVWA 3T1YJ 1N52B 3HDDA 2VBZA 5KFXA 2MA3A 2LCWA 3MURP 3NWTA 1HYSA 1E17A 1MGTA 2VI6A 3PG9A 3GFXA 3E97A 3IL2A 1IN6A 2OLWA 4DSKA 2HDWA 3N5FA 4M5NA 3HPOA 4LG0A 3SQOP 5DM6Q 1D0EA 3OTEA 4Y0FA 1JMTA 4KMUX 1T6SA 2EZHA 3PRDA 4BQOA 1F2GA 2Z99A 4KPYA 2VG7A 3DOKA 2WV1A 1FBQA 3WX4A 2JLFA 1LUJB 1KQ9A 3RKXA 1FDBA 2HWVA 2MD5A 4K7QA 1TL4A 2LYCA 1HBOA 2KQRA 4YHHF 3DLGB 3LF0A 4TXSA 2MKSA 4A8KA 1LW0A 2WOMA 1MDMB 3PNVA 1QLNA 1H74A 4UHTA 5D0GA 2VG6A 4GKJF 1GMWD 2WWYA 3AB2B 4NLXA 2EI5A 2Q79A 2CJAA 1D5VA 4LLGF 1V3SA 1SB6A 3S93A 4QCLA 3PEHA 2IGMA 1YO5C 1R4MB 2WONB 2ZC3A 2ZVSA 1EKRA 2IGNA 1RBOB 3HZEA 1LWCB 2FZKB 2X1AA 2XY5A 1IDZA 3MM7A 4LSZB 1Q1VA 2VE9A 3KHGA 1CULA 1RT3A 1XERA 2RVJA 3DYAB 4ED1A 1X4PA 2KFDA 1E0EA 2DNYA 3KLNA 2E1CA 1HKSA 1IKVA 3SSQA 4TLQA 5EG0B 2PMZA 1FRLA 3J81U 4YS2A 3D6FB 1YJTA 2QBYA 4ED2A 5FRNA 1KU9A 2O1PA 1Z91A 2XSJC 2JA5J 4Y2IA 1O3RA 3HD1A 4O4GA 2KTQA 1OPIA 2FJEB 1OSCA 2HNDA 3DLEB 2AIRB 1UG0A 2LFBA 2KKOA 2C3PA 2X6WA 1FNNA 2FA5A 3HCXA 4RBVA 1VQMI 3HUGB 3ISNC 2HYGD 1S6QA 1TVRB 2L9RA 1VQ6I 3ONQA 4KH0B 2AYBA 3FMSA 1HPZA 3QATA 5A8KB 1ZAXA 5F08A 2NPIA 4B9MA 5ICCA 2LMIA 2RHSB 2LXUA 3GTYX 1Q8KA 3L9FA 5CQGA 3GJQB 5D8HB 3V81B 2BA9A 2OAZA 1HC8A 2LRDA 1C1BA 2CQXA 1TKZA 3QP6A 1ZOTA 4USMA 3N4MA 1MN7A 2DOEA 2KT0A 2J9DE 3EDPA 5EX0A 4AT1B 3RBEA 2BY1A 2DNGA 2CQBA 1QQIA 1ZN2A 1GXTA 5L38A 3LA2A 5EF6A 2ESNA 3G82A 1GHCA 5LSRA 1UVIA 2N82B 4DI6A 3N6NA 4ZLLA 1DQUA 3KG1A 2G0JA 5K7FA 2QA1A 3TOQA 2LKSA 1E3PA 5ICEA 2RKIA 3G71S 3CMEI 1W1WE 4ENJA 1JKHB 3VEPA 1R58A 2NXNA 3CWJA 2K2PA 4K59A 3JRCA 1VRQC 4D7NA 2HR3A 1X3WB 1H0MA 2OAUA 1ZGJA 1F9EB 2QF7A 1FX2A 3SZTA 4A8YA 4V19X 3HB9A 3CC7I 1QDUB 4MFEA 2NCKL 3JTHA 3BR2A 4RB0A 2ZJQQ 3MMYB 4IHWA 1VRTB 4ZCIA 2BHYA 3AFHA 3M6WA 2J6SA 2JVOA 5EN1A 1Z1DA 2DDAA 2HHHJ 3PY8A 2KJCA 2E1MB 2BJDA 3SDEB 1FE0A 5A8WA 2W8LA 5CHCB 2QZ8A 4PK4A 3RQ4A 3GTMJ 4OYBA 3BG3A 1B3TA 4NCGA 4DX6A 5GAGJ 3IBCB 1FWPA 3I4NJ 1SD4A 5F0UA 1ORKA 3BDEA 5C2CA 3WTWC 4CLWA 2HLTA 2VIHA 2GM4A 1RHKB 3IRWP 4URQU 3A3OB 1IJEB 4ZPCA 1SVMA 4NXMJ 2EBIA 3AD9C 3D1HA 4DPXA 2EFQA 1W0UA 2B9EA 2WA0A 5IXUA 4ZVTB 4NC7A 4CSWA 1Y11A 4LBIA 4ED8A 2HFVA 3UVJB 2OUMA 2B6AB 2NAZA 3R2CJ 3DRSB 5HJXA 4QR2A 1WHVA 3SQGB 2W9CB 1ZR4A 1EKSA 3J7YU 4QPTA 4BS9A 3CD0A 1YIOA 4Q45A 2G7HA 2DGUA 4DFPA 2RNEA 4KB7A 4ERDA 2CXEA 2G7UA 4A5NA 2MTLA 4USWA 1JJ6C 3KLIB 3GBGA 1NRKA 3VGVA 2CQ2A 2OV7A 4XOPA 3OYJA 2RRBA 3PX4A 3QZ7A 8ATCB 2RS8A 3VPRA 4IH7A 1WG5A 1MMNA 1SFEA 4CCOA 1ZPVA 4CCLA 2EC0A 2KG1A 3CSKA 2R92J 2AJFE 2J8SA 2W1BA 4DL7A 2XULA 1YJ9S 3M7GA 4PG7A 2HGMA 3CTRA 4ITVA 5CZVA 2XPUA 3VYTB 3NGKA 1QSSA 3UO0A 7FD1A 2MBFA 2O9LA 4O3PA 1MJ9A 5L1KA 3BTCA 4ASNA 2AQ4A 3A13A 2WBRA 2W8KA 1VK3A 1BR2A 2ZH9A 2JDJA 5ILSA 3OR1B 3OTDA 2H65B 1HNXJ 2DRAA 1VQNI 4RW8B 2KU7A 5IWAF 2Y30A 2DU9A 3H40A 1FZPB 2EA2A 4GO7X 3OWTA 4OI2A 1MNEA 1R5ID 4ZDPA 3NGRA 5EJCA 1MROB 2N4DA 1FKPA 1TFWA 1I3AA 1YRNB 2VB6A 2AZ3A 3GVAA 3K1MA 4OZ1A 3ZZPA 3B6CA 1CQMA 2J7KA 4I56A 5C2GA 1G3WA 1HQUB 3ASNH 4A3MJ 2RT3A 5B1AH 2MQQA 3S3OA 3EXCX 1X58A 3S17J 2DGSA 4XDCA 1NO8A 2NOJB 4PWDB 4IHXA 4A6EA 4IRGA 1Z2ZA 2DYAA 2ZBIA 4DUYF 1JGSA 2MKHA 3OTCA 4EYHB 2IXSA 2DEJA 4HH0A 2CKWA 3PW7A 4MFDA 2XY6A 4WXDA 1EARA 1YYVA 3DXSX 1IUYA 3OSFA 1RHJB 5B5EC 2Z33A 1XS9A 3MM6B 3RCOA 2N4CA 1L5UA 2R2SA 2RN7A 4D7MA 4C11A 3TL4X 2CUJA 4F0KA 4IHYA 2XCAA 1PAEX 4P6QA 3LA7A 2OSQA 2FLPA 4XK4A 4ZTFA 4O44B 3KP7A 3M2RA 1JLCB 3KHLA 2HYFA 4LR9A 5KG3A 1HCRA 3BR0A 1NCLA 3EDQB 5ADZA 4E2FB 5HS8A 3OVBA 2V50A 3FK4A 3T9ZA 4ANEA 3OV8A 1WF1A 3PYGA 3HVTA 4I64A 2GHPA 1DUXC 2CDRB 3ET6A 2Y0SA 4M5HA 2IRUA 1G3SA 3NGSA 1YW9A 3SSSA 4B3TJ 3TKYA 2CGPA 3MXHP 3PIPF 3CP8A 2A1BA 3K10A 4QTRA 1PUEE 1NH7A 4C4WA 4ED7A 2R7VA 4LSNA 1X0PA 3PNTA 4L0YB 2FJVA 2DLLA 3MM5A 1VK8A 2YNGA 4EYIB 3MCOA 4WK3A 4XORA 3G86A 2KFNA 1ZLJA 3GMEA 4TYBA 1FKOB 1RT2B 2O7OA 1WZ2A 2BJEA 1BL0A 1WEYA 2RUSA 2CPJA 4DJBA 4Z2XA 1HA8A 3D1OA 4P7VA 1JUMA 5K14A 3QGIA 4M5JA 4DU8A 1KLMB 3ETOA 5DO2A 1D1CA 2W9AA 2BRLA 1ZTRA 4F4KA 1UJ6A 2PO4A 3OUYA 4W90B 3SZPA 3L4BC 1XD7A 1N5QA 3ZO7A 2EK5A 3S3MA 2BANB 1W2IA 3M8ZA 4ES3A 4FXWA 2VA3A 3BEGB 2FNPA 2V1DA 4Q4ZF 2LBFB 3CCJI 1QBJA 3L2UA 1ZPWX 5IYDJ 3VOEA 3MEDB 2Y69H 5HS9A 1FJGJ 1RTHB 2DMNA 9RUBA 2DXEA 4NBQA 2BOLA 3ZZYA 3Q8UA 5AT1B 2MLKA 3SCLE 5DD4A 1HWLA 4B9VA 3T41A 4WX9A 3EDRB 2M2BA 1BIBA 4RNFA 4DV4F 1FD8A 4UUWA 4B3OA 4QWQA 3MPUB 1OQYA 3I31A 1YHQI 2F4IA 4DW6A 4M6XA 4DV0J 4AU7A 3FQLA 2NVUB 2V1XA 2C22A 1UCRA 3AG3H 3OVAA 1URRA 5E0OA 3W66A 3N4WA 1H7WA 3BJ6A 5M2RA 4A69C 2GAGC 4NXMF 3AG4H 3ROUA 4DGWB 2AMCB 1JJ8C 3CCEI 1B9NA 2QMXA 2CQGA 3IKTA 1F4KA 2MGZB 1YS7A 3JRGA 2K9LA 4FE7A 4BKXA 1EQ0A 2ZKZA 2X1CA 3F6VA 4DV5F 5A6PA 4O5VA 1NM2A 1RHRB 2O6GE 2B4PA 4DV3F 3ERED 1UWAA 2E7WA 2XZWA 4G7ZF 1A6LA 1ZYQA 3CVKA 4JYAF 1SBRA 5KG5A 2H94A 2MJNA 5FKLA 5JUMA 2VQHA 2Y1LB 2MGQA 2DK2A 4DCPB 3GJSB 2FHKA 2AYGA 1IRGA 1JHFA 1N0VC 3L95X 4UY8T 3IR6B 3DLLQ 1N34J 4E7JA 1FBUA 4HF1A 2J5OA 1X1AA 3K59A 5ICFA 3IMQJ 1R8BA 1VQ4S 2RKHA 1VDHA 5LSOA 3FM3A 4RA2A 4L3NA 1SI9A 1N5TA 5HLHA 5G0RA 5HODA 2ILYA 3KMSA 1I5OB 3C46A 2Q43A 5F0WA 3PO5A 1AHDP 2V79A 4LLLA 5HNHA 4BDZA 1YGYA 4ZN3A 5IT3A 2GAHC 2VKEA 3M8RA 4ZVOB 2VDIA 1KU2A 5FO5A 1HW8A 3J7ZT 4A3BJ 3CZ6A 1WJFA 3BPXA 4ZJLA 3TVKA 3IWNC 1HBUA 3MTJA 2L9NA 3MPVA 2AGPA 2LFVA 2ICWG 2Y1JA 5DG9A 4PZVA 4K0KJ 4HNVA 3RKQA 3ZQCA 2Q1ZB 2XF6A 2QL7B 2E9ZA 3O6BB 4JI6J 5KFPA 1FESA 1C4AA 1ZM2A 1T3OA 1RE1B 4J9KA 3B6BA 2GFFA 2VV5A 4K2XA 3DU6A 1OJLA 4W92B 3KG0A 2C6YA 5DDGA 2XROA 2PSZA 2MLYA 2XAQA 4IG0A 4YFKF 2C2DA 1KQGB 2HQDA 3DF8A 1WF0A 1S0NA 3IRQA 2Q8KA 4WCGA 3OYDA 2VH7A 5F64A 1S7EA 2FJAB 3BO3A 1V4RA 3PTWA 4MTEA 1X4OA 5M5YJ 4DFKA 4PJMA 4X4SA 2CWKA 5J2NB 1ZH5A 2V8PA 5LM7E 5B7WA 3VZIA 4DYCA 5J1EB 2AHQA 4EM1A 5EWEA 3GCXP 3V5RA 3EPZA 2HFSA 4B3TF 2BEOA 5GADJ 3IS9A 4ECSA 3HKZN 3X2QH 4WFXA 3LAKA 1OYYA 3OXGA 3VQSA 2JFKA 3LSPA 1QD1A 1Y9OA 1NK7A 1I94F 4K4WA 2IPQX 2OBPA 3VB2A 4OLOA 1VIXA 4J9MA 3VTIA 4WWCA 2DD8S 2LP0A 2RGVA 4IKAA 3FBNB 5D77A 5DUKA 5LMNF 4RGUA 2GIFA 4ZVRB 1VOMA 2QLBB 3FFIA 4IOAQ 3FISA 5KT4A 1RJJA 4S0HB 1RT1B 3ZTPA 4M9SA 3BTJA 2CJJA 5C42A 2OIHA 4LSLA 2QLXA 1TKDA 1QNTA 2CS3A 4EUVA 4ILLA 1JXLA 1SIZA 2ZD1B 3FKIJ 2UXNA 3MD1A 2DISA 5DV5A 5K8NA 1G1XA 2BW3A 3LUYA 4RW9B 1BR4A 2XASA 2ELJA 2WBMA 4B3SJ 1SUQB 1X5PA 3J7AO 2D3ZA 1VQMS 2OEMA 5G4DA 2MDAA 1M0SA 3ILLA 4WXHA 4RGXA 5CD4H 3WTZA 5IOLA 1FJGF 3R27A 2Z2SB 3ECOA 1YI2I 1T38A 3O8HA 2UZAA 3HRMA 4H4MB 4AUKA 4KDPA 4C9YA 2M52A 2YKAA 3K0JA 2QGFB 3W2WB 2LYVA 1SFKA 2VONA 4Q5VA 4ZPDA 1NLKL 5BYSA 3QYBA 2DYSH 4Y13A 1K0TA 1O4XA 3DGVA 1KRPA 2M5YA 3BY6A 4L5IA 4AXJA 4A8WA 2EQRA 3JSOA 1Q8BA 2BMBA 4F26A 3F73A 1IQTA 4BXFA 3CMES 1K47A 2HFHA 4B1RA 1ZM4A 2RE1A 2HOSA 2YR2A 3EZ5A 5JVHQ 3BGRA 2CPEA 1RBAA 3KK2B 4DR3J 4NQWA 4ETSA 4D3HA 3IM9A 1Z05A 2VQEF 4BJTA 1WDTA 4PAAA 1SL0A 4JV0A 2R7FA 1WKMA 1UP1A 4NA2A 5J8FA 4HLYA 4A8MP 3P3DA 2IBDA 5HROA 1T9TA 2YXLA 1KEKA 2XGQA 2F3JA 2EC2A 3OR2C 1ETOA 1N34F 4A3KJ 3R7NB 4N7TA 2OELA 4KFBA 2Y0MA 2VJIA 1B7FA 2ZXWH 4ZDOA 4IFVA 1ZM3A 2ACMA 3P6YC 2K3KA 5HQMA 4MO7A 1L3KA 1Q4RA 3NNCA 3QOEA 1EAYC 1HNVB 4U0YA 1FOKA 3MCSA 5D5UB 5GAGU 3CEDA 2E19A 4NI2B 2OPRB 4RR5A 1S59A 4L9NA 2HW3A 3QFWA 4BHCA 4JP8A 4LBHA 5E3NA 4QIEA 1V3FA 2CFXA 5T14A 1ZKGA 2EJRA 4MQVA 2H6CA 2DXIA 3ICLA 3EGZA 1RHMB 1SL1A 2KIFA 3I71A 3EMTA 3LP2A 1XNQJ 3DRYA 4IUFA 5LBQA 2ILZA 3MKZA 3GXOA 4B9NA 2VG5B 3HHDA 2O01C 3GFHA 2VFVA 2DY9A 4QU7A 2V6CA 5EDNA 2GIQA 2GV1A 3MKYB 4L18B 2MLZA 2HHSA 1BGXT 3BTIA 4CO5A 2N7CA 3LALA 3HKZA 2HKXA 4FNHA 2Z2YB 2IT0A 3ABKH 1T56A 2ZE2A 3QU6A 1G6NA 3G6YA 4HA8A 4C0HA 4YEAA 3GSDA 2QQBA 4ZYAA 3Q3SA 1FVQA 1X8DA 4RAYA 3DPTA 1KC8T 2DPIA 3GFLA 4G7OF 2YWKA 4YFUA 1VQNS 1ZRCA 1R31A 1R3NA 2OTLS 1S6OA 4K4YA 2BVZA 5AE2A 2QYCA 2K5CA 2JVGA 4ECQA 1BHNA 2F6CA 3OYEA 1V5FA 2BM0A 3C7JA 2GA2A 2CV1A 5C24B 3VWBA 5DLFA 2BQ3A 5FKNA 4F4WA 2WVBA 2GXBA 1NXIA 3GTOJ 2V6AA 3V8JA 4HI2A 3JTOA 1RAEB 2P9GA 3RBDA 1IGNA 1ULYA 1R8CA 1FYMA 3F72A 2Q6CA 5D6GA 2L4MA 2MJUA 2B5JB 4NB5A 2DGOA 3RKWA 1IKWA 2ZM6F 1UKUA 1YJNS 3O44A 1QVGR 3CO9A 3VHQA 2JSPA 2WRMA 1QA6A 1TUVA 4J9VA 4OJ3A 3OW2R 5D3GA 3GG1A 4EGYA 4QPQA 4UVBA 1RU2A 2CPXA 2JA6J 3RDIA 5BQTA 4HG2A 2M34A 3GF2A 4QBUA 1S6PA 1IXCA 1TAUA 2H1LA 3AXMA 2E9RX 4IRIA 3FX3A 4ZVUB 2KXHA 2IDLA 1WG4A 2BYVE 4MFBB 1A36A 4LF9J 2BR0A 2V34A 1AKHB 1DHMA 2UZKA 4NXNF 1GVDA 1S79A 3F56A 4CT9A 3RYPA 3J7YI 2HVQA 3IC1A 1YFHA 3GIJA 1BLUA 4C2MA 3BGUA 2ZSHB 3VF0B 2GQQA 2FJ1A 2A6MA 3CPWR 2QJ3A 1IZ1A 1NJYA 3JS9A 1HHSA 2ZFHA 2FLNA 4G12A 4HHHA 3ZQGA 4IQ4A 3VZHA 3F8CA 4CI0B 4LIUA 4OIXA 4BCAA 3S1RJ 4X1EA 1H2UX 3ZN1A 1WNEA 5FD6A 3J7AY 1JLFB 1P1TA 4WFZA 5J2PB 4OWRB 3DOLA 1X4FA 1XR7A 1RYSA 2CVEA 5LEJA 2M4MA 3WZ0A 3W2AA 1ACIA 3S8PA 1ZM9A 1S5LC 4CYDA 3M6XA 5CYMB 4J9OA 2B8QA 3DOMB 3HG9A 2QA4G 5GVQA 2COBA 2HGCA 1ITYA 1R0BG 3H1CA 2LY9A 2LMDA 3MM8A 4C3MA 1TK5A 1WC3A 5I42A 1VJWA 2XZDB 3CCJS 4FBTA 1WPKA 2B63J 2CADA 3K2YA 2GXAA 1FMWA 5KFQA 1PILA 4DZPA 3CC2S 2DPJA 3PYDA 3C16B 2DY1A 3MOZA 5D4RA 4DSFA 4DR3F 2DHGA 3CUQC 2NUHA 3GQCA 3WTXC 1B70B 2FY1A 4J7CA 4J9UE 1RHQB 2YX7A 2HRYA 1UELB 4P1WA 4ZPAA 3J7AN 1RTIB 2OEKA 1UMJA 2K9SA 3S32A 1O7LA 4A48A 2K86A 3A02A 1RLDA 5HMXA 3HHKA 2VKHA 1TL1B 5IOZA 1XCBA 4KY3A 1APLC 3HSGA 1LV5A 1I5ZA 2OQGA 4AL6A 2R3VA 1RAFB 2DT5A 3WTVC 1KU7A 1STZA 2RAEA 1BD6A 3ZOBA 3CCES 2QSGX 5D5VB 3M1VA 4QZVB 1UA1A 2I8DA 2VXDA 1LNQA 1ODDA 3OD2A 4MKVA 1JI8A 2OQRA 4KISA 3B78A 4MIWA 2IDEA 1XNQF 2JQ7A 4URSA 1S99A 1C2PA 1GXUA 4WFAQ 3LW5C 3BV8A 1XC5A 5LJ5Y 3K4CA 1FIAA 3PJ9A 2RSQA 3TO9A 1KKHA 3QO9A 3L2RA 3OTOJ 4TVAB 3BKTA 5E1XA 3OYGA 4WIQA 3PW2A 1Q8LA 5IZHA 3OVSA 1XDUA 3DRRB 3EE3A 1N36J 3D0SA 3BP8A 1FERA 2HHTA 5AJ3J 2L54A 3FK7A 4NCBA 2VQLA 4G7HF 4OIPF 4C7QA 4KAIA 1X4AA 3A1YA 1TWAJ 5TGTA 2V8VA 4OQJA 3IUOA 2YNIB 4B9TA 3HOWJ 4QR1A 1E6VB 3B8HA 3M32A 4BY7J 3RPUA 3M6VA 1C0UB 5K8MA 2UUWA 4YIFA 4NZ6A 5EGOB 2XYGB 5DGAA 1LE8A 5KFIA 4LR7A 1PBAA 1MH4A 2FUG2 4NC6A 2ZWOA 3BSCA 1E2XA 3PM1A 2EH3A 4KITB 3K69A 3L7WA 4PEOA 2IS6A 1LEBA 2DGWA 3IG1A 1CJVB 4IFYA 2X0LA 3C14A 3M30B 2A3JA 1IW7F 5MAOA 3K70C 2AJ4A 2BX6A 5D4LA 2M8GX 2FUG9 3QGHA 2KDOA 2BV3A 5RUBA 4Q8FA 3CLOA 2ZHBA 4N9HA 1JLEB 4ZPBA 4DYQA 3I59B 3IXQA 2JTVA 4OINF 1TP7A 2FF4A 1KFSA 3IO1A 2HMIA 1C4CA 1VR6A 3V6DA 1TL7A 1WI9A 2DR8A 2QX0A 4BHQA 4OJ1A 4YP3A 2Z4PA 2M3DA 1JIHA 3HHEA 1LOUA 1RP5A 2HWIA 3VAMA 1MMLA 1U1RA 3GTKJ 2NNYA 4C2MJ 4H4OB 1TZ0A 1XPXA 1FFGB 1JLAB 4AL7A 3BREA 2V94A 4RUHA 4U67Q 1DAXA 5F27A 1EF4A 2TDXA 3BBCA 3HFZB 2XS5A 4X4QA 2C3UA 4DV1J 3MAQA 2X7IA 3MKLA 1OYEA 3C18A 3C6TB 5JVGF 1MSWD 4YY3J 2E1MC 4EO8A 1AZSB 2CNLB 1IBLJ 2ZHOA 3JXOA 1MZBA 1YQHA 3RIRA 2KFZA 4Y65A 3C66A 1OR7A 1M1EB 3SIPB 5GADU 1HDDC 2GJ2A 3HHLB 3T19A 3GTPJ 2ISZA 3ZQ7A 4ZYEA 2V6EA 3PIOQ 2NS7A 1Y5NB 2DHAA 4UNOA 3PZPA 2HXOA 4ZVPB 4EFAC 2NXJA 3DKWA 4LQ9A 5ETVA 1X4CA 3U9GA 2JVHA 3ZMZA 1SJ4P 5F0FA 3PX0A 3F6OA 2LK2A 4CHUA 1FDAA 1TKXB 2XGXA 3AJ1A 3MPYA 4A8QA 2YQ3A 5KHDA 1R0AB 2XM3A 2V4RA 1T11A 2PT0A 3ZRGA 2NS1B 3CJQA 2XRLA 3CCRI 3BGFA 1TL5A 2KRCA 3AQOA 4D3GA 1S7IA 3H5YA 5IT9U 5EEHA 2DITA 4OAYA 2PE8A 2F7VA 4H4KA 3NQOA 3H42A 4RW7A 1RT5B 5F0CA 2MLGA 4JI1J 4E7KA 1JJCB 1FE4A 4KPCA 1NG6A 3OR1C 1MIJA 5EZHA 4ID8A 4HL9A 4CH1A 4RAGA 2MQNA 3MD3A 2IJNA 2ZNYA 2B4UA 2IAJA 1JLBA 2F4FA 5L3CA 3G1LA 2FQQB 3QAUA 3PEJA 3KLGB 2OMLA 1Q5YA 1R1UA 1F3VA 2G9WA 1JJ2R 4M63A 2P5KA 3T5HA 3DLLF 2HS5A 4ENOA 3TUZC 2YY3A 2IW5A 1RBLA 2GHVC 2FTRA 2BQRA 2EZLA 2XAJA 4IPAA 2WSCC 1YX3A 3PFEA 4PUOB 5KG7A 1FPQA 3POTA 3IH3A 1C1CB 3DKYA 1X4EA 5B0CA 2V2ZA 2K06A 2CWEA 1GDTA 1VQSA 5KAKA 4UVAA 9ATCB 4O3SA 4AUXA 5A0YA 2VC1A 1DTTB 1KYZA 1U0HB 4UOGA 2QLZA 5E3OA 4MMOA 5JJBA 1YWXA 4MLOA 2GIVA 1ZA2B 2D5VA 4RL1A 2DH8A 2B56A 4RB1A 3SFGA 4LB6B 4J9SA 1T9YA 3CJ3A 3BLYA 2IA6A 2DK8A 3JRIA 1KOHA 3HLUA 1K44A 3CCVI 4N5SA 5F1RA 3Q8RB 4CTAA 2Z9OA 3S14J 1X3UA 1YK9A 3A8KA 3HZGA 4O3OA 1U3EM 3MECA 2XLJA 4NLSA 1KVIA 3OYMA 3DLKA 5DS7A 2R5YB 1XSDA 3E51A 4KGZB 4M3DA 3IC7A 2OKQA 2X6YA 5LSLA 3ZMSA 4PFPA 3KUEA 1AXQA 4M5LA 1XNRJ 1S7HA 3HOTA 4YEJA 1HW9A 4B3AA 2L7ZA 2GA7A 4FPIA 4GVBB 1KOOA 1OYIA 3V42A 1VQLS 4YN3B 3HTUA 4XONA 5KG4A 5K1YA 1S1XA 5BR8J 2LF8A 1MH3A 2WVCA 1UW9A 1UVMA 3BGLA 1NPKA 2KDZA 1S29A 3DCFA 1NMEB 1HBMB 2K7JA 1IBKF 2CH0A 4XOTA 1Y3KA 1UVNA 4LUBA 2DDBA 2X1EA 4S05A 2WB1N 2KRFA 1HQ2A 4HT5A 3SV4A 1VF9A 2FX0A 2ZOMA 3RG6A 1ON2A 2A69F 1E6YA 5B0GA 3BR9A 2RDDA 2HGNA 1R43A 5D4NA 2QTWA 3KP5A 4LT6A 1P4WA 1R36A 1DGRM 2WTFA 4XLEA 1VS3A 1CJUA 2XI2A 2ZITA 3SXYA 2HBZB 3M8YA 3J81Y 4DZJA 5FB2A 1GAOA 2L7MP 1HNWJ 4HX7A 2PLYA 3CQZJ 1JT0A 4UV8A 1QHHD 2IJFA 2HQRA 2V2VA 3TUIC 4C9DA 2BVLA 4KHRA 4F93B 1X2MA 1WJDA 2V7FA 2BE2B 2QE5A 3UD5A 3NGUA 2X1FA 1QVFR 4IJAA 2BJ1A 2G13A 4EATA 5I3UB 3TA1A 4DV1F 2XDVA 4UF4A 4ENKA 5KFYA 2AX1A 4CLLA 1T03A 4D0PA 3LSIA 3GU0A 3RR7A 3HSEA 4MKYA 4L5JA 1EETB 3H5NA 4WWSA 1IBLF 3K5NA 1FTCA 4PJJA 2PC6A 2IM0A 4CM0A 2CV2A 3GWCA 4JI7J 1NSAA 4A3DJ 3D5MA 4KO0B 1TTHB 1WC5A 4DXLA 3RKYA 5E18F 4WF2A 1ZZFA 4HSTA 3D3BJ 5F3TA 4HTJA 4XMYA 5L46A 1A6QA 2DT6A 4C2TA 3PNYA 1N6QA 2R3SA 3CCUI 2GAUA 1FA0A 1QM9A 5GAGI 1BI3A 1IO2A 1V9OA 3CDAA 1RKIA 2M4GA 4TN2A 3OYLA 4MIBA 4G1QB 3NAHA 3VSLA 5FROA 5EEAA 1U6FA 1PCAA 4C3KA 1PJRA 1YG2A 1J75A 2B7EA 1KQKA 3UDCA 3E3XA 3UD4P 3TRGA 4A0ZA 3BBFA 5IP9J 3RW6A 3OT9A 4ZIWA 4ZP9A 1PO6A 1IJWC 2AKWB 4JOMA 3TW6A 1MBFA 4ELVA 1TW2A 3C3LA 3M07A 1ACMB 2KN4A 4HX4A 4HDGA 4OJGA 4MEYF 3SFZA 2ECBA 3KP2A 1OY6A 3NS6A 2HQ5A 2FJBB 4JI1F 3T1BA 3W6KB 2F5CA 4KA4A 4X0GA 4U96A 3UW1A 2X3GA 3TZZA 1RWOB 2R7QA 1SJQA 2H5EA 4CICA 2NLWA 4R8UA 3ZQHA 1VCTA 2COMA 4KGVB 4A3LJ 3F0NA 5ETNA 3TAQA 3T1HJ 1HYSB 3DEEA 2BOAA 5A6WA 5F8GA 3QPHA 1MBKA 3E01A 2W7NA 3K1PA 1S3JA 1OISA 3AOBA 4A3GJ 2E1RA 2KJWA 5IP7J 4L72B 2ID3A 4ID5A 1BI0A 5J1YA 4K2JA 1S9EA 4FQGA 3HHGA 2A5WA 3DHXA 3SEOA 2FB0A 1EJ9A 3CJTA 4K5RA 1T8EA 2DR6A 3DOKB 4OU0A 2DN0A 4N76A 4LMYA 1HNZJ 1P4AA 2KZGA 2NYXA 2DNZA 2BKPA 1NHUA 1YITI 4W4MA 5F8MA 2XMTA 1HBOB 1VQPI 4O4RA 2C3OA 3FEYB 1WFXA 4OYWA 2E5GA 3TP0A 1N8RT 2G0CA 2YNFA 4RLFA 2DMUA 3QGPA 3C1DA 2VG6B 4G8XA 3OSNA 3ILJA 4HLBA 1YX2A 2CQKA 1G3OA 4JK1X 4OI1A 3MMBA 1YBTA 2V8DA 2O8XA 4FYDA 4P9UA 4OV6A 1AFJA 1D8ZA 4DR1F 1U9OA 4A0YA 4M3EA 3DFGA 1D1UA 2Y3YA 1WJ9A 4LD5A 4Q43A 1REVA 3D6TB 3RYLA 2R2RA 1GXLA 3BR6A 5FGMA 5CVJA 4X84A 1B8IA 3RU0A 1NSPA 1XNRF 4B09A 3X3UA 3TQNA 4W97A 4ANJA 3F8BA 3HEFA 1CULB 1RT3B 5K5MA 1ETKA 3UWTA 4F4YA 1IKVB 5BR8F 2JVRA 4DZDA 2LECA 2CW7A 2GO8A 4WIIA 1FNMA 4H54A 4QW8A 3HGGA 2KJBA 2KLOA 1TP4A 2BY3A 4JI2J 2HNDB 2NSCA 1GTEA 3OQ2A 1OYWA 3MUVP 3SHFA 3WTTC 1ZGWA 1QZEA 3DPLC 4JBCA 4YIRX 4BBYA 1FRKA 4JI8J 4K4ZA 2C2OB 4OIRF 2D7SA 4M3GA 1WEXA 2AW0A 1HPZB 1G3YA 3JSRA 2CRLA 2Z8QA 2WB4A 1P2FA 4ZYDA 4WXWA 4JV2A 2RREA 1KHWA 3MPWA 1Q79A 2O8KA 4X4TA 3T5LA 2VPLA 4WP9A 3HRSA 3QMQA 4OZ0A 3UI3A 4FKXA 1C1BB 4O6JA 1TKZB 3GJTB 4U7UD 4DHVA 3JSMB 3QFHA 3FM5A 2N7YA 3DXBA 2XV4S 2M0CA 4RAZA 2ZUAA 4I68A 4HH1A 2MSSA 1XR6A 2F4MB 2I5JA 4ZJZA 2ZC2A 5C4JJ 5HI7A 4CO1A 3VFZA 3WTSC 4EJVA 2GO9A 2RKIB 4R25A 4O3MA 4ZP7A 2J76E 3KNGA 1KBRA 2Z56B 2ZCWA 1ZYRF 1LFPA 5KT3A 2ZWPA 2CPDA 1OCOH 3PRVA 3W9IA 3D66A 2J6TA 1HKTA 4I2PA 3IP0A 2CQ4A 2Q6BA 1A04A 1M90T 3ZNJ1 5F3ZA 2ESHA 1U8SA 1F60B 5KFAA 1YOVB 4QSHA 1VQ5I 2NXCA 2E5LJ 1SMYF 4EQQA 3BOQA 2RHQB 3CCSI 3D1NI 5EHHA 3RTRA 5A8WB 3FBIB 3LOUA 2HBRB 3A8IA 4QW9A 3M05A 2Y0SD 1DPRA 2YWWA 3CO0P 4NCGB 3W7BA 4N8NA 3NBPA 3NGTA 4ANCA 4PJLA 4HDUA 1DGWY 1I6XA 5J1PA 3I5CA 3VV2B 5KFDA 2QYGA 1REGX 1T9WA 4FXVA 4OYZA 3QWUA 2DPUA 2XLIA 1H73A 3NL0A 2QRRA 2LY1A 4UB8C 4OV1A 3AH6A 3OL9A 3CMAI 3EVOA 1Q78A 1BBYA 2KZVA 2L7FP 1S5ZA 2HTJA 5FDLA 4P74A 2UXCF 1J5EJ 4CYUA 2JWTA 3CNQP 1LWEB 1TWFJ 4U7DA 2W9BA 3UDEA 2PGCA 1HQEA 3W3SA 3UN5A 5HLFA 1PBUA 2BKNA 3VGSA 2FDNA 3OY9A 2QSHX 1UEUA 1VYAA 5H20A 5AIQA 1NU4A 3GR1A 3BQ0A 1T3NA 2R7SA 5AE3A 2ABYA 1H7XA 3M8WA 3AOAA 5FFZA 4ECXA 4ZCLA 5K8PA 1S7AA 2KL4A 3TUJC 3CUQA 1S9FA 5DUIA 4DYRA 2EFGA 2HQCA 4F02A 3F0CA 3QWLA 2ASJA 3NKYA 3GIKA 3HPHA 1BOBA 4IQJA 1FWLA 4NZ7A 2FJXA 1R9TJ 2NYIA 3M7VA 2HZDA 3Q9SA 3IWFA 2DGVA 3WE2A 4PG8A 4Z7CA 2GQCA 2DJIA 2JJ7A 4P55A 3PCOB 1AW0A 5EWFA 1R23A 2VBWA 1IKYA 1GK8A 1QJHA 3KZIC 2AS5F 3CD6I 2IS1A 1YKWA 4M5KA 4NCAA 3PR5B 1X1PA 3AKZA 3N28A 3CCLS 3ITHA 2I8EA 4ECUA 5E5NA 2CPZA 2AYMA 4PJ0C 5EZGA 4TY8A 4K8RA 1D1BA 3HJEA 1V6HA 4M95A 3HVRA 4AD6A 2D41A 2I0XA 3N0VA 2EG2A 3SCIE 2JEFA 1IN7A 1NK6A 1CG2A 5KK1A 4WP8A 3CMMA 3U1KA 1M1KT 2RV8A 4OYAA 2VKZG 2C2EA 3G8QA 1LWCA 2H09A 4XLFA 4C11B 1RWPB 4DUTA 5BMZA 3BR8A 4DG1A 3CGIA 3IGNA 3RRGA 1YBAA 3DYAA 5B0FA 3QPTA 2FBIA 3UR0A 3GZ7A 2PMHA 4IO1A 4DCOB 2X1DA 4DNCA 1T0FC 2GA1A 1F43A 2CV0A 4AWXB 4EJOA 2XSFA 2H1KA 3MMJA 2FJDB 3BZKA 2BE7D 5GADI 1OPZA 1HI8A 4CO2A 2XO7A 1Y39A 5GP9A 4JI2F 4DV2J 1RAJA 2XPVA 2KB2A 3HVTB 4J01A 4CO0A 2IEKA 3PO3J 3DLEA 2Q1LA 4I2OA 1U1LA 4R79A 2FLOA 2I1RA 5HBMA 4EK2A 1T05A 3G4SS 3FQKA 4KYZA 3NNHA 4XKCA 2GCFA 2MHEA 4JI8F 2WTEA 3MM5B 4U0VA 2YNGB 1H9GA 1VBZA 3R2DJ 5A8KA 3RB3A 4I67A 3DEWA 4V19J 2LKZA 4WKRA 2MPUA 3IWZA 2YTCA 2RQMA 1EKEA 2DO4A 2XNRA 3FJ2A 3FXRA 5L1LA 2LKPA 3QYEA 4ALZA 5K14B 3PKMA 2BOPA 2HFUA 1IV8A 1F9NA 3SBMA 3I5AA 1WKKA 3P8BB 3KP6A 4EJTA 2EEYA 1PKUA 4NMLA 1Y0NA 5HATA 3TEHB 3QU3A 3TAMB 5IYCJ 2CJBA 1GMUA 2UUBJ 4WZMA 3D5SC 3AAFA 3EUKL 1XR5A 1SC6A 3ILIA 2UV8G 3CCTA 1WWXA 1U6ZA 1S10A 4NLVA 3NS5A 2G2OA 1QAXA 3LA0A 4LRAA 1RQ0A 4F4ZA 3MM9A 3UN2A 4NA3A 2IYGA 3L00A 1F2HA 3OJUA 2QA4I 2JRSA 1BQMA 4KTQA 2ZEJA 1J59A 2ERRA 5B08A 2R8HA 4I6YA 2DTRA 3F9KA 1ZREA 5CA5A 3HHHA 2JA7J 2XC7A 2ZOFA 1CJKB 4B3OB 3PIPQ 1D5YA 3VCDA 4EGLA 4ED6A 1FY7A 1CQNA 2KO1A 3G71I 2I6WA 5LXRA 2DA7A 4AVZA 5U47A 4FF2A 2R8IA 1F5CA 1Z21A 3FKJA 4MKAA 3EJMA 3TJ9A 2LKXA 1DP7P 1MBEA 4DX8H 2JT1A 2JC0A 3H36A 1TQPA 2DMTA 2J7UA 1CLFA 1FNXH 2L2OA 1CBKA 2JRMA 5BPIA 2QFIA 3Q8VA 3H7HB 5DD8A 3JQMA 5GMKa 2C2RA 2QO3A 3MEKA 5AXNA 3I58A 5J1NA 2L9WA 4CM2A 3V6JA 4HR2A 1F5AA 1T9XA 3H5UA 3RI4A 4HI1A 3BT9A 3GO5A 1NAQA 4FP9A 3T5KA 5E3AA 2B6AA 2XBPA 5B0BA 2PEHA 1WH5A 3QIDA 3JRFA 1J5EF 3FMRA 5FRMA 1WJEA 2CUZA 4J9LA 3TQ1A 3N01A 3UE2A 2ZJRQ 3FC9A 3KLIA 2DNMA 1I1SA 4CH7A 4A3FJ 3VALA 3AL0B 5HDNA 2M88A 2CRGA 2UUCJ 1EP4A 3GLJA 3ELKA 4LREA 2L01A 2KM8C 3KDOA 4ZCMA 3QBCA 1UHMA 2O03A 2ZHAA 5G0RB 4MIMA 4ELUA 2B4OA 2KZMA 3ZZTA 3DU5A 4IR9A 3C15A 1OCTC 3ZXWA 2U2FA 3I9V2 4I7FB 1H9TA 3KLVA 4I7HA 1BC7C 3Q2TC 4LJZF 3DCAA 2UUAJ 1HMVB 2PD1A 4JOUA 1HDPA 2ZDPA 4EBDA 2MY7A 2ROEA 1DPUA 1I1GA 4Q5SF 3TJAA 2IBKA 1M5KC 1HBUB 3HGYA 3P7NA 2I10A 2GXGA 4HV5A 4L73A 2VUGA 2Q2EA 3REOA 1HQUA 1SV5A 5F8LA 1K61A 4CCKA 4DR2J 1B4AA 4FS1A 3I9V9 2E5NA 1Z0XA 1TW3A 3OHBA 5H6QA 2P8IA 4RX6A 3Q0WA 2M7AA 2MB0B 1ZHFA 4P9SA 4R0EA 3HOSA 2DNHA 3B73A 1VQKI 3LP1B 1NJWA 1EV7A 2XB5A 2BJ3A 4HDVA 1Y3JA 4DN9A 4I6ZA 2V68A 4IG0B 3A12A 5FLVA 5B0AA 1C0TA 2YS9A 2L4AA 4XL9A 3LFUA 3BYRA 3MZYA 2ALZA 2K7KA 5HP1A 1HI0P 3NCQA 4LJMA 4PKDB 2FD5A 2AJ2A 6FDRA 3ZZUA 4B9LA 3R4KA 1VQPS 3MMAA 3UQSA 2RS2A 2YQ0A 4YQWA 2OPSA 2AF6A 1RGVA 2RQQA 3K4MA 3WU0A 2GOMA 2J9CA 2ZXHA 3ZQLA 4DV2F 4X64J 3KOAA 2Z3YA 3CJ2A 3S2DJ 1WHYA 3IKVA 3TOBA 4P9FA 1HBNB 4HYEA 1ETYA 2YBVA 5JLXA 3IS9B 2K3PA 1VLYA 2O5DA 2JLEA 1ITPA 4XNFA 2J0QD 2V9VA 1N25A 2NYHA 4DCJB 4U0WA 4EZ9A 3QODA 1SH3A 3GFMA 3G73A 1K78A 4NEYA 4HX8A 4K4UA 1QSYA 2VBXA 2OJED 3GZ5A 4RGRA 3K8WA 3FCHA 4DDFA 2CO5A 1FNOA 1MSFC 3FFIB 4C0BA 3V4GA 3NRVA 5C42B 5DS9A 2CPHA 4KR0B 3VGUA 2R4GA 1KLMA 1CS4A 3HHLC 3ZCOA 5KFSA 2FEZA 3FMBA 2DRBA 4XQFA 2IC3A 2HFOA 3MUMP 1SKSA 2D3OR 1I27A 3FK6A 2BANA 4LFBJ 2UUBF 3M2VA 2ZZNA 1YZ6A 4YB1P 4HEA2 4G9YA 1N5YA 4RWWA 4BJ6C 4NLTA 3H9QA 2MG4A 4Y2MA 1VFJA 2VPZB 3LMMA 1BWVA 3AJDA 2STWA 2IJLA 2ATCB 3OBIA 5CPRB 2K1RA 4YB7A 5CYVA 5E3CA 1J5OA 5E7OB 2ZXJA 2Y9YA 4P52A 1WEZA 2VQCA 1U5TA 4YFXF 3SFIA 2BW2A 1T9UA 2N3OA 4HEA9 1T8IA 4E98A 2J5PA 3CCQI 1KGSA 1WTBA 3LAJA 4NUBA 1K0VA 3B6AA 5L9NA 1NKCA 3W60A 1WHWA 3G96A 4XM3A 3ABMH 4RB3C 4JI5J 2K8GA 1JGGA 5H2FC 4PXCA 1YRUA 1FC3A 3E5QA 4DQQA 1KN6A 1RUNA 1RCOB 4N77A 4JI0F 5DRKA 3BG9A 3GUDA 3M1CA 2BZTA 4NWBA 4DF8A 2DHSA 1MN9A 1RKWA 3LQQA 4CA0A 4D5FA 2YWHA 3OYFA 3DDIA 1R22A 4QIGA 5THWA 4P2MA 1QTMA 1V54H 5LD2C 1Q0NA 2OTJI 3BGRB 2YX4A 5DCFA 2B4VA 1P9QC 4PPZA 5KFFA 2H8WA 4KJZA 2VKVA 1SJFA 4Q44A 3GONA 2HQAA 5FD5A 1JNRB 3Q9VA 3DMJA 3AXKA 3ASOH 1VLOA 4FF1A 3S2WA 4L3KA 1U2FA 4GRIA 2L3DA 1NUEA 2R8KA 3V7SA 4ZA1A 5HROB 2AJ0A 3CD7A 3MPDA 4LRFA 3M8SA 5C25A 4ECVA 2X51A 1XK8A 2UUCF 3C2PA 1H38A 3HKWA 3KJVB 1HWIA 2F2EA 1SAUA 3K4NA 4DL6A 2F8EX 5F9LA 1RIOH 5E3PA 1NK3P 2NVXJ 3LQRA 4CLYA 2NXEA 1RLCL 2R5ZA 4LF1A 5C44J 2HKOA 1S1TA 5HMZA 3ZZRA 3KK3A 4DLGA 3CMAS 3PFIA 1OCCH 2WHOA 4EEYA 2LP4A 4IF4A 5GPAA 1NK2P 3R3TA 1RWUA 2ETHA 1ZLKA 4CO8A 1PYSB 3ZTRA 4AC0A 4GKKF 4F2RA 2C2NA 1FX4A 5LOQA 4EM0B 1XMXA 2UP1A 3MZIA 3O3KA 1NK5A 1FYLA 2BZ2A 4XR6A 5J6XA 1XMBA 4O23A 3FXMA 3PNIA 2FJWA 2GZOA 1KWMA 5HMYA 4QOTA 3GPAA 2W4SA 4HPQA 1UAAA 4XSXF 5IOYA 2QKMB 5T41A 2MMYA 4ECWA 1WWHA 4AM3A 1O7FA 1R0CB 4NYOA 3GYNA 5EDWA 3CJRB 3V4MA 3TWZA 1FXDA 1E3HA 2SXLA 4TY9A 1QGPA 2UXDF 4N4OB 3M8QB 1IUFA 1GFWB 4GGGA 2PMWA 3MAJA 4IL6C 1URNA 4DWIA 1AUDA 2O67A 1Q8IA 1D9AA 4MHGA 1LVAA 3I56I 3CD6S 2O5RA 1Z6RA 1P6RA 4XLAA 5EGYA 2DA2A 3E5UA 2CQ1A 1I39A 5J1EA 3HJVA 4Y34A 4PUSA 1K4TA 1D0ZA 2MFZA 1A35A 4LF2A 4KIBA 4K5SA 5IC6B 5HVHA 5IP6A 2AXLA 3CCYA 2Y48A 3L7UA 5IQQA 2HEOA 1IKWB 4IH6A 4UQGA 3GW2A 4AIKA 2KRBA 1VQ9S 1UHSA 2ZKTA 3NWRA 4ITSA 1EB0A 3HMJG 5J2QA 5D3GB 1HW1A 5KFTA 1K4SA 1JLQA 1CQTA 1W26A 2MQ8A 1MBGA 5K9FA 2OP5A 1S6PB 2GMJA 2HFNA 2CUFA 2PI0A 3K7RA 3LP0B 3CP2A 2ZXIA 2EPFA 3ISZA 2OD6A 1SKWA 3O3LA 1X4HA 4QU6A 3I4MJ 1FWZA 3WIUA 1DU0A 5AXKA 1F1BB 2GVZB 2W7OA 2L3MA 3K2AA 2BXZA 1J2VA 1SUQA 3G1OA 3TP2A 3CC4I 5E3RA 2DR7A 5HLIA 3CXCR 3LSRA 5J1RA 2WVFA 4M72A 4AIDA 2K3FA 5FLXY 5LGUA 2VBYA 4DR6J 2FOWA 1GV2A 3M3YJ 1BM9A 3K2ZA 2ZMEC 5CCLA 1NHAA 4HT7A 4A6DA 4FASD 1WOPA 2H1YA 2NS0A 2CG4A 2IIHA 1RWNB 4HKQA 4IRCA 3UDVA 2M8HA 4G6TB 4A46A 3KEQA 2MZTA 3UNGC 1SC4B 3I53A 2D45A 1RZMA 3FSYA 2NRAC 4GO5X 4KNYA 5K8OA 4HAMA 2VFRA 3BDDA 1XGSA 2IS2A 3BO2A 2LXIA 1SAXA 4LVNP 3EUNA 5K5OA 3KNAA 5D78A 1NHKL 4ZLPA 2HS4A 3MM8B 5J3LA 1WOOA 5I42B 3E2EA 4DPOA 3CJ5A 3QIPB 1MMAA 2B8PA 4DUZF 4U8VA 3DLAA 3RYRA 1V3ZA 5M3FJ 2EWHA 2D1HA 1Y56A 4OYXA 1S72I 3A8JA 2KT2A 2DFHA 5CVRA 1XMAA 2W48A 1FT9A 2M2EA 3QT8A 5LJ3Y 2F5FA 4YUDA 1FFSB 2FHMA 1MW7A 1GXQA 2QA4S 2DOFA 3OS1A 3IN5A 2NZ4A 2IRFG 4AD9A 3M9AA 2GIRA 5LMUJ 2DH9A 4BQQA 1M5OC 1K6OA 4FF3A 3R9LA 3TANA 2FE3A 1XEZA 4P2XA 4F0MA 3I5UA 2XAUA 1F36A 3G8SA 4X65J 2C2ZB 2HXIA 1VBYA 2YWFA 2MQPA 2QKLB 2XWYA 4ZPWR 2DHXA 1S0MA 1IWAA 1SQEA 4IOCQ 2O66A 2KYZA 2YX1A 4L9JA 2JLGA 3PO2J 2DODA 3BQZA 3DQVC 3M1EA 1I50J 5IT9Y 1GMVA 1U2WA 4RO0A 3M1VB 4PG4A 3EUHC 2MYFA 4CCMA 1Z3XA 2HAIA 1X3ZB 4PWWA 5B0EA 4BY1J 2DKOB 4LFAF 3R5GA 1TT5B 4J19A 4KV8A 4CNZA 2M45A 5EUHA 3HYIA 1D8KA 5LHHA 2W01A 2HHQA 2MABA 4RUCA 2Z2ZA 2J6UA 3FXJA 4M9XA 4LF7J 1TL3A 4L6V3 3HT3A 1PYVA 5KG0A 2AEFA 5HN0A 3QO9B 2XSDC 4RNHA 2W7AA 4ZHRA 1G7CB 5DZ7A 3OMYA 3M6UA 3PW0A 1X1BA 4QIWD 2BJ8A 3W5YA 1PYTA 3QAEA 3J80K 3W5ZA 4CDIA 4DBQA 4FBUA 5BXIA 4FF4A 2V4JB 2UVUA 5KFEA 3G1MA 4WBFA 1UWBA 3EGVA 2DCEA 3QRRA 2HBQB 4I0BA 2UXBJ 3WC2A 5HQ8A 2KZZA 2FBHA 2WAQD 4A8OA 4X4NA 4RNNA 4CUGA 3DDKA 5BNGA 1R4NB 1RKJA 1KVJA 2DEIA 1ENHA 4CYCB 2EINH 3JRAA 3H2VE 3E6DA 3M32B 1FFWB 3T1YF 4C3IJ 2L7KA 2DFIA 3D0GE 4IKFA 1KQFB 1PJ7A 2DK5A 2E7VA 2HNHA 3U1DA 1VJQA 3OL7A 4WP3A 4X4RA 3FNNA 2AO9A 4KSEB 4OZNA 1IRFA 1M1HA 3DN9A 3S1NJ 5HVQC 3ULHA 5HDKA 3IG1B 5C24A 4DPWA 2CJXB 4IFYB 1Y7PA 3A4TA 4V2FA 1YJWI 3C14B 4NOHA 3ZC4A 3S8SA 1HWUA 4J9RA 4DQ2A 3MR5A 4KGXB 1Z3YA 1WACA 3GP9A 1DRZA 4Y3CA 2VDHA 2OTLI 2LQ5A 2QSFA 3CESA 3J81Z 3W6VA 1FRIA 4KFCA 1U6GA 3GILA 1LPQA 1VQKS 3VSKA 1HI1A 5TJJA 1ZG5A 1IM6A 3AHPA 2HMIB 3TEGA 1TL7B 3V6DB 3PJRA 1BW6A 1XSVA 5IV4A 1XMOJ 1T0FA 3FEZA 1E3OC 3DBLB 4DL4A 1RAOA 1M5HA 1PC5A 1SJRA 4FXDA 4ZN1A 2WSEC 5L9XA 3HD2A 3SSRA 2ZH2A 1U1QA 1N32J 3KZZA 3OYIA 1O3SA 3NLCA 3Q5FA 2HOTA 1Z9CA 4NLQA 4DMZA 2P9CA 4I0WA 1VNDA 4I09A 1YJNI 2DGTA 3F22A 4BACA 4K2EA 3F44A 3HXMA 2G1DA 5EX3A 4XPCA 4QWAA 3GFIA 4FKYA 2V8GA 4DQRA 1SD5A 2X48A 4OJHA 3KP3A 3TO8A 2QQ9A 3F41A 1J9IA 2E44A 3LSJA 2A6TA 2KIUA 4CCNA 2CPYA 2CNOB 2D3O1 2VT2A 4KHMA 3G3ZA 2X9DA 4OMYA 1U4BA 4DR6F 2JL9A 1BC6A 3HVAA 4RUBA 1WGXA 3BR1A 1RWMB 3A2KA 4OX8A 1T98A 5E79C 1H6KX 3KK1B 3E8OA 4K4XA 2JWNA 3SJMA 2QFJA 3JAMY 3QYFA 2E5ZA 3M2UA 3FRZA 3RBXA 1SQGA 1HWJA 5J2PA 5SUHA 1D0YA 3H3ZA 3S6EA 2OPTA 4NLPA 1RUOA 2JA2A 1GH8A 4QR0A 5J4VA 4K4TA 2RMLA 1NZAA 2VJJA 1HD0A 1TZLA 2E34A 5CYMA 3Q0AA 2HAFA 3LSHA 3UNYA 1ZETA 1EH7A 1BQNA 3Q8QB 2FHJD 2VQFJ 3X1LB 2C28A 4E6KG 4ZZDA 4X4VA 3CJQB 2W2OP 3FDYA 3H5AA 1BJAA 1YRTA 2NXUA 4RW4A 1FP2A 1Y5IB 2HPUA 1OQ6A 2NNNA 1LW2A 5AIPA 4DV7J 4J37A 3FZ2A 5LT5A 4L5EA 3CD5A 3SV3A 1NPRA 1RNLA 3UN3A 2EG1A 2F4OB 2OPPA 2DFFA 4LLNA 3WHCA 4NLDA 4RW7B 5C5JA 4JI4J 3RSNA 5LMUF 1ULRA 1LDDA 2DR9A 2JNJA 3OL6A 5JVGQ 5JXSA 3CCQS 3CJ8A 2X6XA 5C4XJ 1IBMJ 3NGDA 1JLBB 2ZJRF 3S1MJ 2VJ4A 1QVTA 1I51B 1RXOB 2CFOA 1Z7LA 3BZQA 1UAWA 4X65F 1OPCA 3CC2I 3ABTA 5L3GA 2FD2A 4Y2KA 4G6DA 5ED4A 3UCZP 1TL1A 1P1LA 4UUTA 4HF0A 4M71A 2E71A 1CJTB 4II3A 4CLKA 1Y10A 3D2WA 2IMOA 4U95A 4R5PA 4NNJA 1KR4A 2M5WA 3F8MA 5DQGA 4PXBA 4X62J 3POTB 2LEBA 4C8LA 4RKUC 1Q7YT 2HHHF 1W36D 2OTJS 1J5YA 1POGA 4XLHA 2L9SA 4ABZA 4FX0A 1YSJA 5A0YB 1D1AA 2FPHX 2MKIA 2BBEA 5KFHA 4OYMA 2HHWA 2CQCA 4JX4A 4DX5A 3FEXB 4B3MJ 1ETXA 2MQMA 5ETOA 2WK4A 1XB4A 2KT5A 3SXLA 1RTDA 4M1KA 3B4MA 3N79A 4J5OA 4PWUA 2VKRA 3TP3A 1S9GA 4CTAB 2X3DA 2R7TA 2RDPA 4BXUA 3MECB 3UKGA 3ML6A 3ENAA 2UXBF 2V9KA 4Y7NJ 2R2TA 3O8GA 4XAKA 3M8PA 2O3DA 2GVDB 3QT6A 1ZARA 2LSOA 4OI4A 2WVEA 2DGQA 2BW7A 2R4FA 1E6VA 3ZFVA 3HIFA 2LREA 3NXZA 3I64A 2L5QA 2R7OA 4IO9Q 2HVIA 3L7OA 1H72C 2A68F 3QLHB 3JTGA 3MD2A 5ITHA 5KT2A 1T9VA 1S12A 1D3WA 4KYWA 1FXRA 1YIJS 4PSWA 2AXTC 1IV6A 4C3JJ 3TZYA 2GLOA 3RB4A 3UDLA 2VXZA 1L3VA 3OLAA 3JYTA 4F3OA 3MZHA 5ETKA 1FLIA 1ETWA 3H9JA 4ATNA 1N0UA 3BWGA 4PABA 4LIVA 1HNXF 3JTPA 2YKOA 3TMOA 3NAIA 1LWFB 4MIAA 3OFEA 5LRSA 1O51A 2VC0A 3P49B 4UUSB 3BCAA 2QC3A 2UVVA 5DCMA 4XN3A 1DBDA 1E6YB 3HULA 2VKDA 1DP3A 2GW8A 1AFIA 3FBFA 2B3TB 1CJUB 5HSPA 3H2UB 1JKPC 3O5TB 1W5SA 3BG6A 2R42A 1B0TA 3FDSA 1SC1B 4N56A 3NWSA 2BVMA 1S57A 4USTA 1USTA 2EILH 1TAQA 4H4OA 2JEJA 1JLAA 3LO3A 3M9MB 4DF4A 4HVZA 1U1PA 4IRKA 1RK8A 3I56S 3RB0A 3AD8C 1X4GA 3HHNB 5KFUA 1NJIT 4OI0A 1CPZA 1VC5A 4WPAA 1W7WA 4MK7A 1WJ5A 1ZRFA 1T03B 1HKQA 1L0OC 4ZLJA 1TTYA 3P4UB 4IH5A 4Y28C 2Y9ZA 3HOXJ 4P5OA 4U6PA 2CJQA 4F7ZA 1U0JA 3H98A 4XICA 2LY2A 3DI6A 1QZZA 4G94A 4RM3A 3NMAA 4F04B 3BPSP 4YR2A 4RPFA 1IM4A 1S7OA 1D9FA 1AB8A 1IBCB 4DR7J 1JT6A 2Z2MA 2GIZA 1BJZA 4ZP6A 2LOOA 1R6VA 4ETZA 1N6QB 1LQ9A 2F8MA 3HTSB 4Q7AA 3I55S 2CMPA 2HGLA 2KP6A 4M5DB 2W1OA 2BEFA 3HX9A 2DBBA 5LL6d 2QL9B 5I3PA 3I32A 2H8RA 1MWYA 1S49A 2P4WA 3C2HA 3PKYA 1R0AA 3QQAA 4PQAA 5DM7Q 1ZBTA 2WAEA 2Y0BB 3CC4S 4LF6J 4NZ0A 1S1VB 2GBYA 2ASDA 4TYAA 3IR5B 8RUCA 2EK6A 2RU3A 4S04A 2PBIA 3FBEA 3IRXA 3R7BB 1HF0A 3GFYA 3DPUA 4R8HA 2ZB9A 4JI4F 2XEXA 2XYHB 5CYQB 1M1GA 1D8YA 2IP2A 2CNKB 1LXNA 2D9OA 3AFGA 2ZFUA 4MJKA 4UB6C 2JEGA 3PXGa 1A7GE 2OFGX 2IYIA 2XAFA 4Y4RA 2BY2A 4F91B 3R5AA 5KFKA 3R5JB 4R8UB 4OHYA 4OOIA 2ZC4A 2QMWA 2O61A 4RW6A 2RQPA 1NJZA 4DSLA 3FIWA 1K6YA 2HQIA 2BXJA 1QUPA 3JRBA 2NVTJ 3D0IE 3E01B 3ZQQA 1TU0B 3I0SA 1FTRA 3WIVA 2QM3A 1YBUA 4ID5B 3RZDJ 2ROPA 1RT4B 1S9EB 1D3YA 4B4CA 1MG7A 4OMFG 2E7XA 4C0OC 2DMQA 1S72S 5A2QY 4EBCA 2HK3A 2Y2ZA 2CSOA 4DV0F 2G0IA 3KMQA 3FXLA 2XGPA 2V9PA 1QSLA 1RZ4A 1UL3A 3QRQA 3VYUB 3KLOA 2F5VA 1P92A 3WBZA 4MK9A 2QVOA 2H3EB 2V63A 1X4DA 4B3MF 4YHHJ 3NY0A 2YNFB 3ERMA 1FIPA 2IM2A 3KDNA 4RNMA 3GB0A 2FU4A 7FDRA 4GKJJ 1R27B 3WTYC 3PVXA 3KLFB 4WFNQ 1AU7A 1RESA 3MMBB 2EIKH 2Z57B 3KUGA 2MEWA 2ECCA 3IAM2 4XBFA 3R61A 3SQNA 3KPHA 2EV6A 1WI8A 3TI0A 3CJ0A 4EEFG 4CCJA 2BY0A 3RZAA 2ZBRA 2R5YA 2NOGA 3PSIA 2AJ1A 4GYGA 5FIIA 3G6VA 1B8IB 1U2RA 3A01A 2CU7A 4QYZJ 4QJVA 1YE9A 3WHBA 2XMMA 1FSHA 4WJBA 1VQOI 4H0EA 2VPYB 2AT1B 1YDLA 4LG3A 2Y1IA 1U1OA 3IAM9 2HRUA 1FK9A 1SPBP 2KT3A 3EZUA 2VOPA 2WSFC 1FT8A 2CWXA 3MOJB 3MR6A 2EFPA 3DXJF 2L08A 1BUXA 3PYEA 4QLCU 1DDNA 4XK8C 5B1BH 1LDJA 3G2BA 2OMOA 1NK8A 3G9CA 4IRHA 4YRVA 4U7CA 4BEHA 3BF4A 4NC8A 3QPIA 4P7TA 2Y8WA 1M5PC 2A07F 1QY7A 3ZTOA 1VQLI 4AYBD 2CIMA 3J81K 1U8RA 3IRRA 2H48B 4IG3A 3H25A 3IHUA 2PG4A 4CZCA 3FHZA 1I6JA 4IQXA 5CJ9A 4E8UA 2KHCA 1HLVA 3TX0A 1R1TA 4R1HA 3HM9A 2R93J 2ZBKA 4ES1A 3NOGA 3IFEA 4K0KF 1LVKA 1NHVA 1P6TA 1RU1A 2XMJA 3DTIA 1QZYA 4HW0A 4ZIVA 1PYOB 1FRXA 4MH8A 4JI6F 2HHPA 1BE4A 3FXOA 1L3LA 3HXLA 3MHYA 2PN6A 1JB0C 4AXIA 3TR5A 2BE2A 3R97A 3H5XA 4M5IA 3LOCA 2Z2LA 2ZDOA 2KXNB 4QPOA 3MKWB 2DTZA 1YJWS 1A6IA 5KFOA 1Q86T 2PX9A 1ZA1B 2E66A 3IAS2 4RS8A 1FOYA 5CABA 1B1BA 1EETA 5D0RA 3IBFB 2UVRA 5LHIA 3BJOA 3R7SB 3HT0A 2HFZA 2W57A 2Q0OA 2PEXA 3E5XA 2LU1A 3Q8PB 4DL2A 3BR5A 4Y17A 4DJAA 3RJMB 4I2PB 1WUUA 3IAS9 2MLXA 4DR7F 3QJJA 1KONA 1RA7A 3W2VB 2XB0X 4NX9A 3KYDB 1CC8A 3LSMA 1TMMA 1WKJA 4HV6A 1S1UB 2POKA 3SFUA 1N77A 1Z7UA 1BA5A 1DY3A 5LXYA 4IHTA 2UXXA 1FDDA 3KP4A 3ZZ0A 4C48A 2HDCA 1MU2B 2ZH1A 4J91A 5D8KB 3FCWA 3HOUJ 3NBPB 5T7LB 5KFGA 4G1QA 5DQHA 1TR0A 4EMDA 3A3PB 2TCTA 2JX2A 3TO6A 2ZMEA 4HLXA 2MY8A 2XSJA 2EWNA 4IEJA 1T33A 3VYRB 1UZCA 1QUVA 3NNAA 1D8JA 3HOVJ 5GMEA 3CDHA 3DTKA 3LPYA 4UTGA 3R5BA 1QRYA 1YW7A 2A18A 4JUZA 4A8FA 4ECYA 1KS2A 4I76A 4I2QB 2YKMA 1MWQA 4GRSA 2VFSA 2QA2A 3DRPA 2XMVA 3FXQA 3CMYA 4G1IA 2B51A 3FXUA 3PDNA 2W9BB 2L02A 3M8JA 2RB7A 3V7RA 4BXXJ 2HS0A 1HQEB 4B3SF 2JZYA 2FNAA 4C30A 3PO4A 1KTQA 4FZVA 4ZC3A 3TEDA 2MKJA 2VUMJ 1MWZA 1XTZA 1A9NB 2P7CB 4GFBA 1S6LA 4CRJA 4RLEA 2A2CA 1H8AC 2H4WB 1BMQB 2OJ3A 1BXNA 1OQ3A 2EV0A 4C8YA 2XS2A 4KH1B 3RZOJ 4IOCF 1WD6A 5E3LA 2KI2A 1GT0C 5L3DA 4JV5J 1Y5LB 4N9IA 3HSDA 5ETQA 3TZXA 4ZMMA 3CUQB 1B72A 1TV6B 1GX5A 2J0XA 4LF5J 4E0DA 2MZJA 2OPQA 2W4PA 1LFBA 1K1QA 1FOWA 4UUVA 4ZOSA 2I2YA 2ISYA 2HQ3A 5IWAJ 2MQLA 3B82A 4LFCJ 2XHKA 4P75A 3M9NB 2DA1A 4USIA 5CVVA 3VQTA 2WADA 5DYMA 1PSDA 1IRZA 4G3IA 1IKYB 1FD2A 1FO1A 3TDZC 3GTLJ 1VQ8I 5DGBA 3U27A 4WE1A 2BE5F 3ITHB 2YPYA 1EHWA 5KT6A 1HBXG 5HNFA 4TY8B 3SCJE 5J8CA 2E5JA 1WOSA 3DM2B 3CDLA 3EUHA 2MW8A 3TGNA 2IM1A 2OEJA 1HR0J 2R0QC 4Y6IA 3EICA 1RCXB 2HZVA 2GJFA 4DUYJ 2VASA 3HDSA 3R8YA 5M3MJ 3BQYA 3A03A 3SEQA 1EH8A 4KE5A 2HNYA 3H5SA 2ME6A 1PG5B 1U48A 1IN0A 2DQLA 3N5BA 2VIXA 4DG1B 1SFXA 3HSJA 1N5SA 6FD1A 1JK9B 3BSOA 2FY8A 2DB1A 5LLQA 2QLWA 4HDHA 3HRUA 5MLCV 2VJVA 3TARA 1S1WA 3GLXA 2DJWA 4CLSA 1RYRA 3V8KA 2XZTB 1UHWA 2NSBA 1HNIA 4OZJA 3QZ8A 2FOKA 2XVCA 4N47A 3HHLD 3BQ1A 4FTHA 3MR2A 1UJ5A 2W2QP 1KQSR 4MYTA 4X66J 5F6FA 1MSEC 5HBMB 1T05B 5A8RA 4Q2LA 4XRSG 5K7HA 2H54B 3GSIA 3E6CC 3P9IA 3BO4A 2FIUA 1RT6A 5D5XB 3MCZA 3FZBA 1IWGA 4TQRA 2V4QA 3T5XA 1UEKA 2V2KA 3V4IA 3QT7A 4KIAA 1UPMB 2V1UA 3A3NB 1TFYA 3MEEB 2CYYA 2JPCA 3VAIA 1FRHA 2DQRA 4F36A 4BYYA 1J27A 4GDFA 1PUFA 3Q23A 4BE1A 5J47A 2G1HA 1U6BA 1O8BA 4FPRA 4PYDA 1KQ0A 1W25A 3OYAA 1ZAVA 2HPMA 4PFOA 3IBWA 1JLGB 3JSMA 2M8EA 4JBAA 1FF2A 1A0OB 1Y8QB 2ACYA 3ETMA 4JP0A 1L3TA 4USHA 3WGIA 2RNGA 4OX7A 1QE1B 2YPRA 2YWGA 2DOAA 4CT8A 2VICA 2Y0SN 4UY85 5IC4B 5DJBA 3K58A 2LDUA 1N33J 2HU9A 2DJNA 5CKTA 2VPWB 1N56A 1FP1D 2LQ8A 3MM9B 2N3LA 1BIAA 2R7ZJ 4BHPA 1BQMB 3NAUA 3OHAA 3OJSA 2D1CA 3HJFA 4M5MA 3ABUA 1MKMA 2LU2A 3CJKB 4DV4J 1XGOA 2ZH6A 3QRFF 3J7Z5 4WXCA 3ZNUA 4W98A 1AA1B 1UW4A 2BGCA 2HIQA 2JK3A 5HK4A 3DWLE 5KFNA 1MMSA 3P96A 2QCOA 2XGEA 1UA0A 2EPIA 2LVSA 5FLXU 1X19A 4B47A 2BJ9A 3KEYA 2HOEA 3GV7B 2M7BA 1FJCA 5E3QA 1U8BA 1TLHB 3CMQA 2HVRA 2OZ6A 1J0RA 1R71A 5M2UA 4C8NA 2ID6A 2DW4A 3CF5F 4Y2CA 1QHGA 3HSZA 3RR8A 1W7PA 3VODA 3D68A 3HC7A 2W7PA 1UTAA 4DV5J 2EIMH 3J81j 2CJKA 2M1BA 4DV3J 4HACA 1ZS6A 3HRTA 1LWEA 1TKTA 4M73A 4LF9F 3RRKA 3EETA 3JCUC 1R49A 1NSQA 4JYAJ 2PJRA 4OIOF 2VLAA 2D3UA 4ILMA 2XAHA 1JXEA 1TT0A 2KVQE 3AJ2A 4PZJA 1WG1A 4EMSA 4L76A 1SJ1A 3B54A 2E2HJ 1EP4B 1D0XA 1WC6A 1NDCA 2IVFB 3DDNA 4J9QA 4M94A 3FUYA 5AXMA 2R7DA 4JV5F 5IS2A 3W8GA 2K40A 3H0PA 3DGPB 1IC8A 3QAHA 4LF5F 4CDGA 2DIUA 2F4VJ 3R6LB 2W2MP 2V4JC 3VAGA 3JSBA 3C15B 2BXYA 1REPC 3OOUA 1U9NA 3LSKA 4YB5A 4ECTA 4XDDA 4YIIA 1WHXA 3ENVA 4LFCF 4II2A 1HARA 1S0VA 2V69A 1EQMA 4UQTA 5JLWA 1FJLA 3QJPA 4I98B 1ZG1A 2WY8Q 4B48A 2MZ1A 2VFUA 3L1PA 4BBSJ 2XKOA 3BH6B 1IN5A 2CUYA 2DVIA 3Q24A 2DA5A 1XGNA 5J2MA 3R0AA 2Q2EB 3H3VK 1SVLA