2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
4BXUA 1G2EA 1LDJA 1MJ9A 4FBTA 3HX9A 1VRTA 1GV2A 5EG0B 3MEDA 1RABB 5FJ4A 2EVZA 4OL8A 5L39A 3A4TA 3SDEB 2GIVA 5GAEJ 4JI3J 1X8DA 2ELKA 1RT7A 4AQYJ 3GV8B 4PWWA 2JOQA 3OXFA 2CQHA 1T0FC 2P9CA 5IOLA 4MK7A 4RW9B 4X4PA 4DV6F 2HPMA 3ZZTA 1U49A 3WTXC 1LE8A 4UB6C 1UL3A 2IRYA 3BT9A 3K8WA 3AAFA 2XMTA 3J81Y 3WTYC 2DBBA 2JEFA 3RUBL 4ITVA 1HSJA 1RWMB 2MSSA 4DV2J 2UV8A 1K1SA 1Y3KA 4XLAA 1ZG5A 2R3SA 2UVVA 4F0HA 2BV6A 5BYQA 2ZH8A 2MD0A 1SC3B 4UUTA 1WC4A 1VQ7S 2EFOA 1IRXA 4E2FB 1TELA 5GAEU 2WOMA 3I0RB 3BGUA 3REOA 3ZR8X 1YQHA 1PKUA 4IG3A 5F0HA 2GC8A 3GPAA 3R5JB 1R5GA 3DLEB 3FSIA 4PQUA 1WSUA 5JVGF 4DL3A 4RW7A 5DS7A 1HI8A 2QMUB 1X60A 1RWWB 1DP7P 3M30B 1FLIA 3A8EA 1F0XA 3VVTA 2LY9A 3IGNA 3IWZA 4Y33A 3AFHA 3VWBA 3MM7A 2KQRA 1CJVB 1H7WA 2GQCA 1MBEA 3GIIA 4BHPA 3DOMA 5JHUA 3QP5A 1OYIA 2AEJA 1G3YA 3F8FA 1D8YA 4ICLB 2Z16A 1P4WA 1CJTA 2DCUB 1YJUA 5KT2A 3LSJA 5ILSA 3QGHA 3HRTA 3LOUA 3D28A 5KT3A 3W6VA 2QM3A 4F91B 4Z2XA 4DR2J 1WWHA 2G0EA 3FBIB 3P6YC 2HTJA 5A2QK 4R8UA 1MD0A 4H4OA 2WAFA 1YJWS 3E5QA 4OYPA 2RJZA 2MQQA 2PT0A 3BGRA 3K58A 3JSMB 2EFGA 1NH3A 2CJYB 1WORA 4P7VA 2UUCF 2PA3A 2DXFA 2HGCA 2KXFA 2P5LC 5DCMB 2QEXI 2DGTA 1L3SA 3H2VE 1FWLA 1A35A 1RHUB 5JMNA 1TBXA 1UMQA 5KOXA 1VNDA 2QQ8A 1OY9A 2QIFA 1WHUA 2H6CA 1ZGJA 4MKYA 3HVTA 1WSVA 1B70B 4YEJA 4ERDA 2Q3PA 4QPTA 4RM3A 3I6PA 4XOPA 3G1LA 5RUBA 3HZJA 2F4IA 3L2CA 5J3LA 3KK3A 1FY7A 3DLKA 4HACA 6FD1A 1FP1D 1T9VA 4CLFA 4DMZA 1XR5A 1H6KX 2RKHA 3WTZA 4J90A 2H1KA 4HF2A 3U1LA 2RS2A 4HZFA 3QGPA 4UW2A 1LKXA 3GTGJ 2X85A 2QA4G 1OFCX 3Q8SB 1Y8RB 1N0UA 2W57A 3KHGA 4K50A 1M5OC 2OPQB 3TOAA 3M32B 4DFPA 2Z2YB 1NB7A 3SEOA 4KITB 4USHA 4ZA1A 3ISZA 2YR2A 1TL8A 2R7FA 1KQ8A 5ICFA 4ZITA 2QEXS 5KFTA 2DN0A 1WVRA 1WWXA 2MKSA 2V69A 1X1AA 1H0MA 4OYMA 4N41A 5D6EA 3FRYA 3CDBA 4XO0A 1N5YB 5TJJA 3IH2A 4PUSA 2CQ1A 2DB1A 1TL3A 3M4XA 5GMDA 4Q5SF 3W5XA 2DGXA 5KFAA 2M34A 3IKVA 2JJ4D 1RQ0A 2XKPA 3MTJA 2ICWG 2JSPA 4YR2A 2KZGA 2FY8A 2B8QA 2KXNB 1NDCA 4CCJA 2COMA 1JLAA 1PCAA 3QJLA 2XSJA 3H3UA 1T9XA 1IN4A 2EILH 1TMJA 1EKSA 3PNIA 1SVOA 2IW5A 3LFKA 1MMNA 3LSGA 3WDOA 1FBQA 1R6VA 1UZCA 3OSPA 2AX1A 3N05A 2M8DB 2EC0A 2JSXA 3PL8A 2QMXA 3GV7B 5HVHA 4LQ3A 2V1UA 1U48A 1UWBB 5DLGA 2HKXA 2H8RA 3CP2A 4UB8C 5FD6A 1HBNB 1MBJA 1RUOA 4UUXA 4BUPA 4I69A 3OR1B 3KG4A 4CLKA 3FXRA 3TAMA 4JI5F 2L48A 1NPKA 4K2JA 2DR6A 3OYNA 4ZP6A 3IG1A 5AE1A 1NKEA 1TQMA 2HNDA 4O3QA 4O0IA 5HNFA 5IYDJ 3W6JB 2B4VA 1C0TA 4B8XA 3BGRB 4I0WA 2J8AA 2XHCA 4P9FA 4U7DA 3BO3A 4PG8A 5B3SH 1TLHB 4Y28C 1X5OA 3GMEA 4ZDOA 4A3DJ 4CIOA 1T33A 2LEAA 2HHHF 3A02A 2CGPA 3H59A 3FQKA 2RQKA 4XRSA 1TWHJ 3P5BP 2X9DA 4ZYHA 1JQGA 4JI4J 1JLFA 3CCMS 3DDKA 2EFPA 3NWSA 1QA6A 1R49A 3UDEA 3KKFA 2ZXWH 3RI4A 3W9JA 3R97A 4JV0A 3H3ZA 3CMAI 3HOVJ 1CLFA 5FDLB 2BE2A 2X48A 2J7KA 3DMJA 2ZWOA 1ETYA 3MM6A 3MEEB 2VI6A 4F36A 5KFOA 4IQXA 2X1CA 1FRHA 1Y7PA 2CJBA 3OR2B 2YBVA 3I0RA 3FFIB 2GO8A 2K8GA 1DUXC 1FKPA 5IT9Z 3NNCA 4CT8A 4A46A 1KR4A 5DG8A 5M3MJ 3ZQCA 3MAAB 2AZ1A 4DSEA 2B4UA 1V3SA 4U88A 1Z05A 6PAXA 1RSCA 3FBBA 1R8BA 1FE4A 3C14B 3TA0A 2ZVSA 4M3DA 2FPHX 4RU2A 3D68A 1R4NB 1LKZA 3DRYA 4UUWA 3HM9A 4HNVA 2BE2B 1IWGA 4DI6A 3BKFA 3A01B 4DL4A 4XLHA 4XDCA 3BZQA 3H5YA 2P9EA 4CXFA 2QWWA 4GO7X 1RT6A 3KLGB 2AEMA 4IG0A 3ISNC 2ZMEC 4BH9A 4FCYA 2R7UA 3P96A 4FVCA 3F6VA 1P1TA 2V79A 3MCNA 5GAEI 2AO9A 2LSOA 3OL6A 4P71A 2GA2A 3HUGB 1YWXA 4ASNA 1U2CA 4G8XA 1VF9A 5K14B 4GRSA 1FYLA 2ZC4A 5BNGA 2ZJRQ 2PQ8A 5DJBA 2C2OB 2DMUA 4XM3A 5D5WB 3EUHC 5E8GA 3DTEA 2IVMA 5F64A 4FF1A 4U6PA 3VZIA 3G1OA 4IH6A 3MM9A 1PUFA 2YNFA 4NRUA 1O57A 5KK1A 4R1HA 2A69F 3A3PB 2EV0A 5F1JA 1CSJA 3BV8A 3JQKA 1O7LA 3GF2A 2Y3YA 2GGPB 3AJDA 4FXVA 1ON2A 1R7IA 2IA0A 3BREA 1JLAB 1XDUA 4GYIA 4DU7A 1XSXA 4RUBA 4ZOSA 3CESA 2ZJ2A 3BTJA 1Y39A 1CJUB 4D7MA 4NZ6A 5JHFA 2W7NA 2CV1A 3ZN0A 2E1AA 5DO2A 3Q8YA 2HHPA 1XMKA 3KZYA 4FKYA 3OUYA 2MBFA 3DRRA 1X4AA 3RBEA 1FX7A 2ZKUA 5ETQA 2F4VJ 2GHVC 3DGPB 2ZB9A 2J9EA 1HWLA 3LA7A 2R2SA 4LK1F 3R27A 4DR1F 4KJIA 5T14A 4CYCB 3K7RA 1U2FA 3PJRA 4G65A 1T02A 1AWCA 3ZXWA 3C14A 1N4LA 3NAIA 4U87A 3M8WA 2Y30A 1HPZA 1SFEA 4BJTA 4NLVA 1S6PA 1LXJA 5KFEA 2OBPA 5EEGA 2PMZD 6AT1B 1S10A 1W2BR 2KKHA 4Q2LA 2HGNA 3IBFB 1FHTA 2ZXHA 2JVHA 3HI9A 2R4GA 2CJAA 4PWUA 1FD8A 2Q79A 5AE3A 2WV0A 2QSWA 2PO4A 4K4YA 3GFXA 1AW0A 1AFIA 4J91A 4HDVA 4HOBA 4DR3J 2Z99A 2LC2A 1X1BA 2HAIA 4ECZA 3ET6A 2DTZA 3WHCA 4LF5J 3IWNC 3SHFA 3OTOJ 2VG5A 1YFHA 3A13A 2O03A 2IJFA 4RO0A 4FF4A 4OHYA 3NKYA 2KH9A 3G9CA 3TW6A 5C4XJ 3O8WA 2TCTA 1ZRDA 3TQEA 2W9BB 4ENOA 4LRBA 3TP3A 2CNNB 2AQ4A 1R0CB 2J0SD 2DR9A 3FUYA 1Y11A 4CP5A 4KN7X 1RAHB 3OTOF 1C0TB 4M5LA 3CCYA 2OPPA 4V19J 1OCOH 5T41A 4QIWN 3CJNA 1E6VB 4QIWD 5ICCA 1ZLJA 3DRSA 3AHPA 4C3MA 5L8RC 1D1BA 2YVSA 4GVBA 1RCXB 5LSRA 1LFWA 2DIUA 1UVJA 2UP1A 4ZVFA 1SC6A 2JHEA 2KKOA 3QIDA 2IP2A 3GMGA 4IFVA 2VA2A 3C6UB 3T1YJ 2JC1A 2EZKA 3M2VB 5FB2A 5KTQA 2HOSA 1OCRH 1U02A 1ZK8A 1Z77A 3BSAA 2GZOA 2HSEB 4M9SA 4ZP9A 2Z4PA 5KFXA 2D2WA 1C4CA 2LD5A 1GLNA 3W6KB 2CQQA 2HQIA 1VC5A 1TL4A 3LA2A 2XAFA 1ROFA 4A47A 1HL6A 3CCJS 1J5OA 1RA6A 2R4FA 2HHTA 3GWZA 1IKXB 4X66J 4RJVA 1HNIA 1O8BA 4DR5F 4E7HA 1F5TA 3OLAA 4W90B 3TP0A 4A69C 5E2QA 5DD4A 9ATCB 2W9CA 3UDVA 3RBXA 4B9VA 3D6MB 3UDCA 2H9ZA 5B0FA 5D77A 2BVLA 4HL9A 1PUFB 2W7OA 4TYAA 1FRIA 4ENNA 4EJVA 4CH1A 2EA2A 2RV8A 4Z7YA 3E5XA 3DEEA 3N79A 2MG4A 2R7TA 3UQSA 2V4JC 3HCXA 1RT1B 3GTQJ 3ZTQA 1A6QA 3OYKA 1EJ7L 4WP3A 1YZ6A 2L9DA 3V8LA 3MD1A 4JYAF 1YX5A 4JI0F 1A04A 4USKA 3J81K 2OCCH 5KG5A 2V1NA 1BI2A 2HS5A 2DNKA 1HQCA 4ILRA 2IGKA 4M5IA 1EH6A 2EK1A 4WIQA 2LECA 1SJFA 2LH9A 4DV1F 1UHSA 5L3GA 4ZPVR 1P7IA 4HX8A 1RHRB 2RRNA 2XGPA 1FJEB 4AIDA 4ECWA 3GYHX 1DZ5A 2KL8A 2LOOA 3FZ2A 4NZ0A 1DPUA 4I2QA 2X6XA 3H5SA 1U1RA 1NPPA 1X4BA 4KFBA 1CVJA 3TAQA 1MN7A 3BJAA 1WF0A 2ECCA 2JA6J 4P72A 1WHYA 2E2HJ 1RAOA 2FZKB 2VKRA 8RUCA 4LVNP 2HQAA 4QZVB 1C0WA 1FKOB 3BY6A 2KJCA 2ASLA 2EI5A 2VL1A 4BGDA 5KFPA 2GXBA 3UN2A 1FO1A 3K5NA 5FKMA 1X3UA 1GHCA 2GW8A 1KQGB 4FHTA 3KX2A 5J47A 3TWZA 4LFBF 1RHJB 2IY5B 5A2QZ 1U26A 4UTGA 4IEJA 1IN0A 4WXOA 1M5PC 1H9TA 4KIFA 2RF2A 1G59A 3S8SA 1HSTA 2FHJD 3DF8A 5E3QA 1ZPWX 2A6MA 1E0EA 1S5ZA 3HHEA 4NLOA 1RT6B 2BVZA 2JA5J 1S7AA 3BQ1A 2YH0A 2JMWA 3IKTA 2JL9A 2KG1A 3GFIA 3W2VA 4Q44A 4MEXF 2VA3A 1W7PD 4KPCA 1IBKJ 2VQFJ 4ECYA 4D7NA 2DKOB 3CJTB 1S1UB 2NS0A 2EW9A 2DRBA 3S2WA 1U0SA 4X4SA 4PQUB 1BE4A 4MTPA 1FXLA 1IO2A 1V6HA 2V5HG 4XIDA 2EG2A 3LANA 5C42A 1TNTA 4HQMA 2QKLB 3DPTA 4PQAA 3HZGA 2DK2A 3CMEI 4DL7A 1FKPB 5D4OA 1LK5A 2OF7A 3US5A 1KHVA 1SVLA 4H4MB 2WSFC 2VODA 3TAMB 1UFLA 3TA2A 5C42B 5HP1B 2V8PA 5ETPA 2AGQA 2DNYA 2UXDJ 3MAHA 2P8TA 4J9VA 2LREA 3CJTA 2YH1A 1FRMA 3OVSA 1RWPB 4M3BA 3BPSP 2RB7A 4NWBA 1GTEA 3HSJA 2ZNZA 1GXTA 1S0VA 5DM7Q 3RR7A 1J75A 4HQEA 5DCFA 4AIKA 1XMOJ 3CCQI 3BLYA 4V2GA 4WXHA 1QZEA 1D8JA 5KT5A 3QT6A 4ZTFA 1KEKA 2E5LJ 3NBPB 4FETA 4S04A 4YQWA 3IH3A 1X9WA 2G4BA 5THWA 1NG7A 3FJ2A 9RUBA 3KP4A 5BYSA 4ZYAA 3V5RA 2IEKA 4DJBA 1KQKA 4PG5A 1ICEB 2B7BB 4A3JJ 2C2RA 1RIOH 3GJQB 4OJHA 3DLHA 4OI2A 2R2RA 1VQYA 4JI8F 1N33J 2X1EA 2IAIA 5CLSA 2DGWA 2BM1A 5M2PA 5JI6A 1OCTC 1RT1A 2CPEA 1K4TA 4FXWA 1SH2A 3KJNB 9ANTA 2DHXA 2LEPA 2KIFA 2IBKA 4NLUA 4A3IJ 3H0GJ 4LFBJ 5HMWA 1UCNA 3O6QA 1UJ4A 2F5DA 3THTA 3LUYA 2L4MA 2VUGA 3QT8A 1W4MA 1SD5A 1JKHB 3CQZJ 2FJ1A 3RGIA 4Y2AA 4OQJA 3BR1A 5E33A 2DU9A 1N56A 2PI5A 2JA8J 5FFXA 3EWGA 3I59A 2MH9A 2B43A 2YNHB 3IR5B 4WBFA 3TEDA 1BC6A 2B0LA 2AGPA 1EQ0A 5DM7F 4EMDA 1G3SA 1X58A 5L9NA 4OMFG 2CVIA 3ISND 1S48A 3LSMA 1VQPI 4C8KA 3PIPF 4DX6A 4WFNQ 1P9QC 4WE1B 2Z9OA 1M5HA 1HD1A 1WQ2A 1WG1A 3FMBA 2JWTA 2VDHA 2R8GA 3CJ3A 1NXIA 3HJFA 2HBZB 1DTTA 2BY1A 4C2TA 5DQHA 4W4MA 4DQSA 5C44J 2HS0A 2I2YA 5KG3A 4F4YA 1FNNA 2ETHA 3PIOF 3IWLA 4P73A 4I7FB 4ZPWR 2AGOA 4U8YA 1T6SA 2IFXA 3VHQA 1ZG3A 4ZVGA 1HQ2A 3G4SI 2YXLA 4GYGA 3NOCA 2D45A 1HA8A 2ACMA 3GB0A 3CTRA 4FP9A 4WPAA 1RLDA 3R6LB 1LQ9A 2CWKA 3V4MA 5A8KA 2M4MA 4F52A 1SJQA 5L46A 3KHHA 2HVSA 3ZZPA 1Z1ZA 4L5IA 4OX6A 2L08A 3MCMA 4FDFA 2LYVA 1T95A 2DY9A 4DN0A 2OD6A 2W4DA 3JSMA 2PI4A 1Y1WJ 1PJRA 2XSDC 3MQ0A 1UB9A 2IMWP 4O6JA 5DZ6A 2G2YA 5FIIA 3NGRA 2DNPA 1GTHA 1FDAA 3D1HA 2OSRA 4MIAA 3RJPA 1JHHA 4OINF 1BWVA 1B9NA 2XMKA 4O3PA 2WVFA 4OZLA 5ETRA 2ZJRF 3U21A 3S1TA 4ECVA 2UZAA 3O3KA 4LSLB 1C4AA 1TP4A 1HPZB 3CJRB 1X4GA 2O3FA 1BI1A 3QWLA 4GC7A 2WB1D 1CJVA 1MU2B 4PG4A 1CF7B 3OLBA 3GTKJ 3MM5B 1U0HA 3CO7C 4NXNJ 2OD4A 1D1CA 1FRKA 5E3MA 5KFDA 1S1WB 2K7JA 4E0DA 2YU3A 2CNOB 4X64F 2H5IB 2YX1A 2BE5F 2V9PA 3F8NA 3T1HF 2OZUA 1QHHD 3TVYA 2LR8A 1XCBA 3NS6A 2BOPA 4K4VA 4IL6C 1W1WE 1RT7B 1IJFB 2DH7A 3BH6B 3WZ0A 2IJNA 3FC9A 2FE3A 1T3OA 2EEYA 6FDRA 2FLOA 1P1LA 3CJSA 2UXCF 4MFBA 3KK1B 4F93B 2PFFB 1W2IA 2IT0A 2K9LA 4XAKA 4Y3CA 2IRFG 4U7BA 2W24A 2H94A 1J2VA 5DRKA 3OV8A 3A4CA 2VC1A 3DWLE 2ZVIA 4R5PA 3H98A 4BY1J 2V8GA 4LUBA 4MFBB 3M1CA 3PNTA 3QNWB 1DTQA 4I56A 2ZM6J 2VPXB 4HSTA 1F6TA 3OL3A 2RE1A 4NLQA 1OMSA 5DTDA 5J2QA 3VF0B 4A0ZA 1URNA 4HX7A 4DU8A 1T39A 1LK7A 1JIHA 2K3FA 3OUYB 1O0PA 3SIPB 1U7LA 4P74A 4WXCA 5C2CA 2PN6A 3HZEA 4H4KC 3IBCB 5CD4H 3RPQA 4XLNF 4CNYA 5LM7E 1Z2ZA 2XIGA 5HLIA 1CF7A 3I32A 1NJXA 3K4MA 3H9GA 5KHDA 4KB7A 4M5DA 1S9HA 1X4PA 4QYZJ 3UE2A 4ZVPB 1A9NB 1FEXA 1HW9A 5LXRA 4XQFA 2RQPA 2M5WA 5A8KB 3ECHA 1GMVA 5HQMA 2DODA 3F21A 2BZTA 2I8DA 1IRFA 3K6GA 4OIPF 2W8LA 1ZRCA 4Y7NJ 3FF5A 3ZQIA 4LQ9A 4IYQA 2ALYB 3HSZA 5IT9U 3CD5A 2UUTA 2LFVA 2FJAB 3E3VA 2RAEA 1PBAA 4TLRA 1IBMJ 3M8PB 1Q95G 2QA1A 1H2UX 3C7JA 4MK8A 2YKQA 1B9MA 2MEWA 1Y9OA 3N5BA 2QENA 3TZWA 4NZ7A 4EM0B 1FDDA 4JI2F 2CUZA 1VISA 4OZJA 3BPXA 4OX7A 2FD2A 4B3MJ 4K8RA 3NCRA 4AL5A 4DYCA 2Y69H 1TQIA 4XORA 3ABMH 4UV9A 1IC8A 1C1CB 4PPZA 3UO0A 3ZRGA 2NR0A 5F0CA 4BE0A 2DT6A 4ANEA 3QU3A 3SSQA 2EA4A 3KLGA 3COAC 4BE1A 4L0YB 3CNQP 1HHTP 1EP4A 1J59A 5ILVA 3ELKA 4GCVA 4ID5A 3KUGA 2ILYA 4EJOA 2WW8A 4UF4A 1U24A 4ZHRB 1KTVA 5EZHA 1GMWA 4I01A 4QPQA 3QFHA 3KJQB 5DDOC 1VQLI 4AUXA 4DCPB 1B7FA 3OD2A 1BR4A 1NK8A 3PACA 2HKOA 3CTAA 1T94A 1SH0A 3FKIJ 1IW7F 3I9V2 3S3OA 4Q8EA 3TW7A 1HNXJ 4U0VA 2VV5A 5DQIA 2JN6A 2I8EA 4DV7J 2VKHA 1BA5A 1TWGJ 5F8HA 4ED2A 2ZHBA 1YIOA 1U25A 2FJDB 2IM1A 4MFEA 2RT3A 4CGZA 3ICLA 4E7KA 2DCEA 1EB0A 3M1VA 3T6JA 1SD7A 2AYEA 5J8FA 4ZN3A 5GADJ 5K20B 3BGFA 3RJMB 1TUGB 2DIVA 3GR1A 2IS4A 2JH3A 2QYGA 3K4CA 1XN9A 1R58A 3C16A 5D0RA 2PFDA 1YK9A 3T9NA 3SZGA 1N36J 5AJ3F 1LW2B 5EYRA 2PEBA 3MWMA 4M9XA 4DPOA 2W4CA 4XLCA 3WX8A 1TC3C 3HOWJ 4PGHA 2LCWA 4F4XA 1ORKA 2RDIA 4JOUA 1ZS6A 3CDAA 5FLMJ 2JC0A 5L1LA 2BJ1A 2M4GA 2PIIA 3SMZA 2LKPA 3GTOJ 3MPDA 3IP0A 3SQNA 4ZVSB 4UT4A 4DPTA 4L9JA 3L95X 2M0MA 1UEVA 3ULQB 3VSLA 3PO4A 3ABUA 4TV7A 5LRSA 1WG4A 5KFSA 4MMOA 3KMQA 4J9RA 1NM2A 3KLFA 3FFIA 1V3FA 1NLKL 4ITSA 4RW4A 2KRHA 4B4CA 3DLLF 2ZH9A 4UOFA 1IBKF 2ESHA 1DQAA 4V1Ak 2E7WA 3CJ8A 3PCOB 4NLRA 3GEZA 1RAEB 5A8WA 2IGNA 2VZ9A 2YX7A 2P6TA 3P5JA 2XPWA 4A3EJ 1HNXF 2ZUGA 3LTOA 3AJ2A 3L2RA 4C4WA 5TRDA 1XGMA 3EPZA 3KLNA 1UAAA 3A01A 1T2KA 1K6YA 2OJ3A 3HFVA 5IC6B 3RB6A 3BH7B 1WJAA 2HOAA 4LSNB 1PILA 3EDRB 3EVMA 2RQ4A 5HLHA 3QBCA 2IVFB 5AXKA 4AYBN 1MU2A 4NLGA 1WRJA 1WF2A 3QFWA 1IDYA 3RW6A 2LK2A 2VHGA 2NCKL 4P75A 2ZWPA 1RUNA 4QW8A 2E1PA 4MGRA 3SBMA 4KDPA 1R8AA 3H0PA 5E1ZB 3ZFVA 4N9IA 2GO9A 4O3OA 3TI0A 1YBAA 2HFNA 3V4IB 3GR0A 1YQAA 3AB4B 2BBEA 2FA5A 3PJ9A 2YNGB 3HJEA 2JNJA 4Q48A 4JB8B 1JNRB 4DV0J 3FISA 2YUSA 1XMXA 1WDTA 3FM5A 1K6OA 2CUEA 4OYWA 2K3KA 3DLKB 1PC5A 4DQRA 4RBUA 3CDLA 4K4WA 1YX3A 5IC4B 3S01A 2DD8S 5BOXA 3VSKA 2GLOA 3L4BC 3VAKA 2UXNA 1G3OA 1Y56A 1R43A 3JAMY 2LMDA 4DZ6A 4B3RF 4F3OA 1RKIA 1FXDA 1ZG1A 4ES1A 4D3GA 4BC9A 2HTSA 4MKVA 1HI0P 1LWFB 1NBEB 2EC2A 3FNNA 4NLTA 2Q0OA 1SQGA 4JI7F 3GO5A 3BDPA 4ES3A 1N78A 1TK8A 1IXSB 2UUZA 1REPC 1D0XA 2OUMA 1UTAA 4PWDA 2R5YB 3ONQA 3N9UC 3ZMTA 3R7SB 3QYEA 3KG0A 2QYCA 1S1XA 4ZPCA 1XGOA 1XNRJ 1EQMA 1JLEA 1D1UA 2Q1ZB 3BQZA 1A36A 2B6AB 2RVJA 2HRUA 3OJUA 1WNEA 3ZQQA 2LF7A 4L5JA 4MAKA 1IRZA 4FF2A 1MSWD 4LGWA 1FJCA 1BR1A 1ZYRF 3RRKA 3W64A 1N32J 1KHWA 3M6UA 3HF5A 2XS2A 1VK8A 4EO6A 1QAIA 1S1WA 1FVQA 3A8KA 2IC3A 4PAAA 4Q0BA 4DG1A 2IMOA 1KDNA 2W2MP 3Q9VA 2UXCJ 1VQ9S 3RBZA 1HWJA 3DHWC 1N6QA 1S1TA 1E3PA 3QO9B 4QTRA 1VQSA 3TNVA 4AVPA 4G7OF 1VOMA 1M1GA 2M30A 2GOMA 4NQWB 5IFMA 4A0YA 4KHMA 4C98A 1U4BA 1K0VA 4O44A 2XLKA 4RUHA 1XWLA 3PW7A 2MZ1A 1U1PA 5C5JA 1HKSA 4LFCF 3JQJA 3D5LA 2MKJA 2FMLA 1EARA 4PWDB 2LVSA 4E7ZA 2LQ9A 4UNOA 4OZ1A 2FEZA 4UZBA 3FXMA 2F4MB 2OI2A 5E18F 4YHHJ 4N47A 4A3BJ 2X7IA 3Q23A 2RS8A 3PSIA 4LFAF 1YJWI 3AOBA 1HA1A 3KLVA 2G0IA 3MM8B 1YJRA 4OZ2A 3QAHA 2BANA 3LPEA 3OMYA 2F8EX 3BGLA 1UVNA 3CPWR 1K79A 1U0HB 3IA0A 3E0JB 3FK4A 1RK8A 1R4MB 2MQMA 2HXOA 3SQGB 1RPWA 1LW0A 3DYAB 1ACMB 1IUJA 4ZC3A 2F5VA 1BJZA 2Q6CA 1KD1T 3MEXA 4OX9J 3ZXSA 4QJVA 2BKOA 2DR7A 3KUHA 4HT7A 1Y8QB 3M1VB 5D6FA 5T7LA 1CULA 4PEOA 4LF8J 3LNQA 3HGYA 4RAGA 2YNGA 3GCWP 4BWJA 3A03A 2CAJA 1RKWA 1CGPA 1NK0A 3I58A 2LDIA 1QVFR 2KT3A 1S7OA 5CZXA 1I51B 3BKTA 2XB0X 3JRGA 2XMWA 2BOLA 3J81Z 4EBCA 5ILUA 2BJ9A 1MWZA 5KT6A 1RWOB 1U2RA 3CLOA 1XNRF 3OFGA 1B0PA 4B3OB 2LKXA 4HI1A 4I1TA 5HANA 1B72B 2DT9A 3IAS9 2DMNA 4DV7F 3UD4P 1KFSA 1S4FA 2CNKB 1VI7A 2CQ0A 3H8YA 1YRNB 3K1NA 3HFZB 5SZTA 2HQCA 4JI5J 3MUVP 5KT4A 2R7XA 1R7JA 5GPAA 1RJJA 1T9UA 3JSOA 1WACA 2BGCA 1XS9A 2F2EA 4L9VA 4KKOA 3S2DJ 4CCKA 2BJ3A 4OHVA 5D8LB 1MWQA 2NLWA 2VT3A 3PQJA 3N4WA 1IXCA 3W63A 1SMTA 4F7VA 3E7LA 2DHSA 3HB9A 1FRXA 1XX5A 1WEYA 4LLLA 4I7HA 3S16J 2WK4A 4L5EA 1X4DA 1RA7A 4LBIA 1UJ6A 2VFSA 1HQEB 2CPZA 4HH0A 2HZCA 2ZOGA 3AL0C 3TVKA 4YHHF 4HDGA 3GFZA 5CVJA 2Q1LA 1APSA 1RTHB 2V2VA 4EYIB 2V2KA 2JQ7A 4E8UA 3I56S 3EDQB 1A0OB 2A18A 1V5FA 3D66A 4CYUB 3I59B 1TAQA 4YB6A 1OSDA 4A6DA 4NXMJ 2VH7A 2RC4A 4U7UD 2MKCA 4GVLA 5IT0A 5KFFA 1GX5A 3T1YF 1ON1A 3DQVC 1RGVA 3IGVA 2FOKA 3PX4A 1Q81T 1YS6A 1MDMB 2F40A 4ED5A 3L7WA 1JXVA 2BQUA 2XMMA 1BI3A 4OIXA 3FMSA 1Q8KA 2QUFA 4LF6F 2FLLA 3NGTA 1SMYF 3RAMA 2ZH2A 3ZN1A 4KA4A 1IBLF 4LRFA 2K85A 4DR5J 4X64J 3I4HX 3Q24A 1GNKA 1NSPA 4GMKA 4N5SA 2CV2A 2X51A 1T05A 2F48A 3R0AA 1WJDA 3EQLF 2XRLA 2K7KA 1RAGB 2HVRA 4C9DA 1Y3JA 4ETXA 2WHOA 2YPZA 1ZM9A 1J2XA 2V50A 2CJJA 3GONA 1ELOA 1G2HA 1ETWA 1FPQA 3DOKA 2AHQA 3H9JA 2EIJH 2LQ8A 3FEXB 2P2CB 3IS9A 1HDPA 2XAHA 1HBMB 5D8KB 1UG0A 3BROA 2QYOA 2M70A 3VYRB 1T8IA 1N52B 3OS0A 1FCAA 5M5XJ 1X4EA 5HMYA 4GO1A 1HLVA 2TRTA 1N88A 4A8WA 2RNEA 2HVIA 4X84A 5LGNA 3ZOBA 2OPSB 3KP6A 5KG1A 5AXMA 2VN2A 1F1ZA 1MMSA 1DTQB 3BZ6A 2VXDA 3LL7A 4KIBA 4Q4ZF 4X4RA 3NARA 4M6YA 2I9SA 1NKBA 1VK3A 3JTGA 2RAQA 2VU5A 1H74A 1K9MT 2EWNA 1S6LA 2QGUA 2M7SA 2FTRA 4GKKF 1DTTB 5F8NA 5CYJA 2C2EA 1IV6A 2JFDA 4XDDA 4M72A 3R2DJ 1TT5B 2MLYA 1UAWA 1DP3A 3DNCA 2XLJA 2E35A 2FLPA 3J7YU 3IWXA 4PXEA 2Z5UA 2MSTA 1FKOA 3I3LA 3A1YA 3LWMA 1T11A 2CSOA 3K1PA 2DQRA 2JDJA 1WDDA 4IR1A 1Y0UA 1TT0A 2GBYA 4CDGA 3SZTA 1KU3A 1E3HA 1D09B 5L38A 2ZH5A 2XB5A 3G8SA 4NLPA 3WX4A 2ZD1B 3CULA 3CGIA 2HVZA 2XG8A 3N97A 3LGNA 5CYQB 4Y2CA 1YRNA 4ED0A 2GGPA 3M1EA 2H1LA 2GXAA 3OYBA 2POKA 3HHNB 1HD0A 3CCZA 4JI2J 3KPHA 2Z30B 1L3TA 2R7RA 3BYRA 2DA3A 5KAFC 2EKNA 2F9DA 3Q22A 2IRXA 3RYRA 2QL9B 2FBHA 3HUGA 4B08A 3TUZC 4K59A 3NGUA 3HLUA 1CQMA 3LSHA 1Z4UA 2L5QA 2EH3A 4J9PA 4DL6A 3JRBA 3IFEA 5J2PB 2F4VF 1FWZA 4X4QA 3HPHA 4ZYGA 2GA1A 4FZVA 1GXUA 5B0DA 3EGNA 1HQEA 3BF4A 3MTKA 5L3EA 2CIMA 1HR0F 2HZDA 2O1PA 4YEAA 2OHDA 3EMTA 1W5CC 4XLEA 1UWBA 3ABTA 1HBUB 4N76A 2KT2A 1QQIA 3MECA 3ZTPA 2LXUA 5ETSA 3G86A 2O3DA 3OIOA 4WFAQ 4N8OA 3FBCA 4K5RA 1WCMJ 4KYWA 4J5OA 4WE1A 2KTQA 2VFVA 4LBPA 2WCXA 1U1KA 4M8LA 4FBUA 4PJNA 3VYSB 2AV5A 4OWRB 2GVDB 3CD6I 4I0AA 3MPUB 5D15A 3CJ5A 3FIWA 2VIXA 3BKUA 2BJEA 4N4NB 1ZKGA 3TQNA 1OKRA 5FJ8J 2MLXA 3J7YI 4CZZA 5K5MA 1RT5B 5LFAA 2OLWA 1PYTA 2GIZA 4KIGA 1E6YB 5FLXU 1CJUA 4I6YA 2J5OA 2E5GA 3H4DA 1UWAA 3D3CJ 3O1LA 3ENWA 2QJ3A 4RGRA 1BIBA 1NK5A 4U8VA 2W2QP 5D6GA 1S97A 1FK9A 2CH0A 4QWEA 2HS3A 1R5HA 2PGCA 3HHLC 5DDRC 1SC1B 2B5JA 1YLXA 1RTDB 3WTTC 2NVQJ 3QSYB 4M6XA 1S1VA 2Q6BA 3LALA 1S72S 1SFOJ 2HMIB 1TV6A 2MPUA 1BC8C 5FLVA 3BDEA 2QT7A 1RTJB 4QWDA 4CTAA 4ENMA 3OL4A 4B17A 4DLEA 2J9CA 3QU6A 4USUA 1MMLA 3Q8PB 2HLTA 1IF1A 4ES2A 1HF0A 4IH7A 5TGTA 3R3TA 4MH8A 3UW1A 5ETVA 2V2QA 4NRTA 4WP8A 3VGSA 1FA0A 1MIJA 1PBUA 1TL5A 2DO4A 3AJ1A 3RG6A 2HU9A 4J9QA 1SI9A 4AUKA 4L73A 4LR7A 3KETA 2MMYA 3QQAA 1R1UA 4UY85 3ET6B 1X5SA 4KAIA 4DBQA 2XY5A 5GMKa 1WOOA 4ZYEA 4ECQA 1HMVA 1X4OA 1WHXA 2CJXB 3T8TA 3W60A 4B43A 2XVCA 4OIOF 1L0OC 4HHUA 4YOEA 2D7SA 2MYSA 2VUMJ 2NVUB 2ACYA 3QOEA 4XRMA 1W7PA 2E2IJ 3CF5Q 3LP0A 2F5FA 2Y31A 1FE0A 1VCTA 1RU2A 5KG6A 3MUTP 1YLFA 4CICA 4TVAB 2A2CA 2BXZA 4RNHA 3H42A 2NXCA 2NXUA 1R89A 2DR8A 2RQMA 1N32F 3QPHA 2PFBA 5DDGA 4DCOB 1LFUP 4HV5A 2DH9A 4ZVHA 4RUAA 2NQPA 4LLGF 4UVAA 3O8GA 4GXOA 1TV6B 4XPEA 2X1FA 2XZTB 5M2UA 2FHJA 3KK1A 3GLJA 4ZMMA 1R1VA 3W8PA 2A5YB 3FEYB 3LP2B 4J9KA 1TZLA 2MD5A 5C4JJ 4MIMA 1G4DA 4WIIA 2HDCA 4Y52J 3TOBA 3TYTA 2BACA 4IRIA 3H36A 1F2GA 3OFEA 3LQQA 2CZ4A 1TP7A 1RHQB 2Y1IA 1NAQA 4K4ZA 5DD8A 1XJWB 2NZCA 4TQRA 1TL1B 2YWFA 1OMIA 3LA3A 4TY8A 5DV5A 3DEUA 1VYAA 4ED8A 2QC3A 1O6XA 2XWYA 1SJ1A 5IT3A 3K4LA 3IXQA 2BYVE 1REVA 4USIA 4CO5A 4NXMF 3NRVA 1JLBB 3LP2A 1ITYA 3CC2I 2IBDA 2DQLA 1STZA 4DPUA 1XSVA 2XF6A 4HHHA 1Y5NB 2E7XA 3DBLB 3LGHA 1GFWB 4ZPAA 3KLEA 2EFVA 4DUZJ 1RTDA 1S9GB 4ZDLA 1ZARA 1JMTA 1SUQB 1Q78A 3H5RA 4FE4A 3M6XA 1AB8A 1VQ6S 3VALA 2HQFA 3TQ1A 1R6RA 4JI1F 3V7SA 4NASA 3EPIA 3D6FB 4OJGA 2RDDA 3KTQA 1LVAA 1U5TC 3MKYB 3RPUA 3RKWA 2ZITA 3W2WB 4BU2A 2FZGB 1NK2P 3KJVB 5JVHQ 2B4PA 1YW8A 4EBDA 1VQ4S 1FERA 3UN5A 3CCRS 3DEWA 4J9OA 1T0FA 3HC7A 1B99A 3WE2A 3VEPA 2XGEA 3R1LA 3IWFA 1KZHA 2ZE2B 3Q9SA 3TZYA 3MKWB 2VASA 4XKCA 2RKIB 4WFZA 1DGWY 3M2UA 1K83J 4BY7J 1Q1VA 3EXYA 3EJMA 2K4BA 1UVMA 5IT9Y 2EFNA 3CCQS 2RRBA 2DNOA 2L7KA 3DRSB 4EVIA 4LREA 1IKVB 3KLFB 3V6DB 4HA8A 2BEOA 4N7TA 2HGMA 1DARA 2K3IA 3LPYA 2Y0SD 2HI3A 2HOEA 4DS4A 4JP0A 4AIJA 4M94A 1S99A 3DXSX 1P6RA 5K7HA 1TFWA 2ZUAA 5D78A 1O7FA 2KIUA 2QQ9A 2HEOA 4X4OA 3AOAA 3L1PA 1K1QA 1X5TA 4YFUA 1VQKI 5CVUA 3D67A 5CPRB 2CA9A 4MLOA 2EK6A 2HK3A 3W3SA 3ZZUA 3Q0WA 4P1WA 4WKRA 3JRIA 3CXCR 2A3JA 3MCSA 1I1GA 1S3JA 2XWXA 3WIUA 3IAS2 4ECTA 3M7GA 1LW2A 3PUFA 2XASA 1OJ4A 3HSGA 5FDLA 4HKQA 5EN1A 2XMVA 5A0YA 4CM2A 4RS8A 2VFTA 2P7CB 1B7YB 2MABA 4URQU 1R0AB 4EYHB 1JLCB 2IAJA 1FJ7A 1L3KA 4N9HA 4RB3C 2RNGA 1YVFA 4J7CA 3U1NA 2MW8A 4MKBA 2MDAA 4C6AA 2BZ2A 2WTFA 2M45A 2B9YA 2BEFA 5BYRA 4EATA 3PVXA 1PAEX 2Q43A 2JLFA 3S3MA 2BRLA 3BO2A 4OHXA 2XC7A 2VJ4A 4BJ6C 1OSCA 4OX9F 1YTYA 4CCMA 1DU6A 1X1PA 5HMZA 2JRMA 3PG9A 2D69A 1HARA 3V8KA 3MWBA 4CZCA 2BQ3A 3SDEA 3CCTA 1S0NA 3FCHA 1IKXA 2B9EA 2OC6A 3MUMP 1J5OB 3HHHA 4KSEB 3GSIA 1B3TA 3QZ7A 2L9WA 3T8RA 4K7QA 1NHAA 2J0XA 4DL2A 1JT6A 2B9SA 4D5FA 4ZJQA 4QWAA 4FPRA 1NKCA 1O3RA 4HR2A 4IPAA 2DK8A 1ZYQA 1HQUB 1U5TB 4ILMA 3DFGA 2BBYA 1TW2A 5K9FA 2O5RA 2XB2D 2EBGA 3T5JA 1HNZF 4GFBA 1IN7A 2BY3A 4BDYA 3UCZP 3TRGA 3ASOH 1X3WB 1VLOA 4ZTJA 1AXQA 2LKSA 3VR1A 4PXCA 2ASDA 5D4NA 2EV6A 4UHTA 3WG9A 4QQBA 3EYIA 3BSNA 1HNVA 3JCUC 2W4SA 3CCSI 3HBLA 5B0EA 3QPLA 4HYEA 3CCSS 2A6EF 5J2NA 2B51A 1MBFA 3UDLA 1ENHA 5J2PA 4CA0A 5J2QB 2XGQA 2XUBA 2BV3A 3UKGA 1U09A 2B5JB 4FYVB 4RLQA 4NB5A 1BW6A 1HCRA 3FZVA 1NRKA 2G2ZA 1KKHA 3MPYA 2FJXA 3VV2B 1ETOA 1H73A 1FWPA 4CO4A 3TUJC 3MFIA 4S05A 1AROP 4NYPA 4DQQA 3MKZA 3I9V9 2CDQA 4ID8A 4L3NA 3C15B 3W8GA 2CRLA 3MF5A 1SVDA 4ZCMA 2ADBA 3CWJA 4G6QA 4S0MA 5D0GA 2QF7A 2KPMA 3ZCOA 2ZD1A 5C24B 2TDXA 1E17A 3DGPA 3S1RJ 3OYIA 1WI3A 1NZAA 4DUZF 1KLNA 3AG4H 3QWPA 1LE8B 2HQ3A 3H7HB 2IS1A 4AXIA 3CCVS 2D9OA 1FOWA 2NREA 3K5LA 3CCLI 3K70D 1VQNI 4DN9A 2DOFA 2W4PA 1HKQA 2XAUA 1QUPA 4C0BA 1RTZA 1FT8A 2XY6A 2CADA 2MC3A 2NS8A 1EA3A 3KP3A 3D7SB 3CCES 1HNWJ 5FLXY 4Y2KA 2KB2A 3SCJE 1YE9A 1PYSB 1MN9A 1ZN2A 1G6BA 1K47A 2O0YA 2E34A 3VFZA 3H5AA 4OYBA 4NPOA 2DJIA 5DQGA 4KKOB 5EHHA 3J81U 4C0OC 3V7CA 3M9AA 2WTEA 4A8FA 5F8MA 2E9TA 4IOCF 4DR7F 4FYWB 3CUQC 3O2PE 2I5JB 4HH1A 5LMUJ 1HNZJ 3G8QA 2AZ3A 1VS3A 2KFDA 3NGKA 5HK4A 4UUSB 4CRJA 2HXIA 3IS9B 4YB5A 4TLQA 3LSPA 3SYTA 4OFZA 3F56A 2VKVA 2V34A 1D3YA 2LG4A 2QG9B 4YELA 4UQGA 5CH7B 3G87A 3F72A 3CJ4A 4XKVA 4G7HF 2M2EA 2HQNA 1IM6A 2P81A 3WQPA 2MQOA 3R5DA 3F22A 1YIJS 2H4YB 4K4XA 4C0HA 1AUDA 3AXMA 3ZTSA 1PUEE 2MC4A 2CQGA 3EXCX 4NLDA 3EZ5A 3EGWB 4MQVA 3BTLA 2HS4A 2NXJA 3CD0A 2HVEA 2YKMA 3DXBA 4FYXB 2D9PA 1DGRM 4R5PB 1TQLA 3POTB 5LEKA 2LY2A 1FIPA 3W3CA 1M5KC 3F23A 2LNBA 3M8QA 3GYNA 2QCOA 1IRGA 2CDRB 1TW3A 4C9YA 4FTHA 5KFJA 4MJKA 3K7AJ 2DISA 2IPQX 2OEKA 1RADB 4NA3A 2L9RA 5AT1B 1VQ6I 4P52A 5KAIC 4UY8T 2DO7A 3KJVA 4N8NA 3V8JA 2VJVA 1Q7LB 4DR3F 4RBTA 3LO3A 1TL3B 4N4OB 1A6LA 2VE9A 4CHUA 3MEKA 2LMIA 3BDDA 4HVZA 4ZP7A 2IM0A 5D8HB 4TXSA 1BQMB 4ZYDA 4AYBD 3KZZA 3QWUA 1HNWF 3RU0A 2KHDA 1JKHA 1WEZA 2KYXA 1MMAA 2QA4S 2YWEA 2WA0A 3TJ8A 3PW4A 1F9FA 3GTMJ 7AT1B 1U3EM 2W01A 3BOQA 4E7JA 2FHMA 5D0HA 1LQ1A 2WB4A 4JV2A 1NJYA 2WSEC 1VGYA 4ZVUB 3A0HC 3QPTA 3FWEA 3MEGA 4JI7J 4LRAA 2D1VA 5F27A 1BI0A 3A12A 1YSJA 4FS2A 1R8PA 3HJVA 2NNNA 4Y13A 2GJ2A 3H3VK 5K14A 3CMYA 3NP5A 1ZA2B 1MDMA 5B0AA 3QQCD 1QO0D 1F1BB 1UW4A 3CMMA 2UU9F 1PJ7A 4UUSA 2DGQA 2MZSA 1UPMB 2G2OA 2V6CA 3ZMDA 1CJKB 2VPYB 1H7XA 1RT3B 2E2JJ 1TTYA 4WWCA 2VONA 2DGUA 1YW9A 4WP9A 3VQTA 2YNFB 2F4FA 1RU1A 2CW0F 3MKLA 4A8YA 2GOXB 1QPMA 1BLUA 1PDNC 4C3KA 1K4SA 3L00A 3KCCA 4UY8I 1NEEA 3NCPA 4A2UA 1SUQA 1IR1A 5FKNA 2ZBPA 3JAMZ 3GG1A 2A2DA 4G9YA 3ADAC 4B3XA 2V1DA 4F4ZA 2R2TA 4USJC 1ZLKA 4M3EA 3CDEA 1CJKA 1F60B 4KH1B 3MCOA 4TNOA 4OHWA 5LRRA 1P8GA 4ICLA 1I6HJ 3OTBA 3TJAA 3MAAA 2CYYA 1C1BA 4C48A 2BHYA 1RT2B 4I0BA 4Y34A 4OI6A 3DRRB 2FXAA 4LB5A 5K5QA 4E4HA 4QR0A 2WVDA 4P5OA 2B0GA 1YBTA 3GQCA 4EV0A 1LWCA 2DW4A 2WB1A 3RQIA 2C22A 1SFUA 5EEAA 3HK2A 1Q7YT 2HBQB 2ID3A 3ISPA 1KRPA 2DGVA 3P8BB 3PFYA 1Y10A 2FGCA 1IZ1A 3N6LA 2DYAA 3FBFA 4DSLA 1QAYA 1TQPA 3JB9k 2FDNA 1ETXA 5HROA 4MO7A 3IRQA 3GIKA 2OPTA 4IRHA 4O5VA 7FD1A 5K8PA 5IP6A 3TKYA 3ENVA 2RHSB 1AU7A 1VQOS 1W5TA 3RTRA 5L9XA 2UXXA 2DNRA 4YG2F 2J6TA 1RETA 2K9NA 3TO9A 3DGVA 3DKWA 5IQ6A 4IKFA 5ETMA 3PRVA 4UV8A 1NG6A 2HIQA 4KV8B 2RRAA 1SBRA 3GJRB 2I0XA 3F8MA 1MH3A 1XG1A 2D3O1 3NGSA 3V7RA 1VZ0A 2R7QA 1S79A 2UVRA 2RDPA 1A5JA 3EGZA 3ZTOA 3OT9A 2A1BA 5J4YA 5AJ3J 2BW3B 1XR6A 1WC6A 4M9ZA 5CYMA 3HHKA 4YDDB 1SJRA 2GWRA 1H88C 2W8KA 3C3WA 1O51A 4LMZA 4U9RA 3OTDA 2VBYA 2V63A 4NCGB 2CW8A 2M0GB 1NK3P 1KP6A 4NXNF 1FVSA 2V9KA 4EZ6A 1MSFC 2OP5A 2M3AA 4P2FA 2O9LA 3C1DA 2CUFA 4LR8A 4H4KA 3SZ2A 3IRRA 1G4CA 3JQMA 2PMZA 2XULA 1VBZA 3F3XA 3S3NA 4WFXA 3S93A 3QP6A 5K7FA 3CIZA 1UP1A 3FXUA 3ZNUA 3V6HA 4L0ZB 1WOSA 3DCAA 3D9BA 2ZSIB 3LAPA 2NYHA 4LB6B 4KMFA 3QOPA 3KG1A 1M5VC 1FESA 3CCLS 3I5AA 3S15J 1VFJA 2CO5A 4HBLA 2QO3A 1ZBTA 3NWRA 4IJAA 2IC3B 3SJMA 2QLJB 5FFZA 3H5NA 4WXDA 2ZFHA 2VQGA 1WFXA 2IPOB 4E70A 4CWBA 1IR0A 3KWMA 1T98A 3ESWB 1E3OC 2A0FB 3JAMK 4DPXA 3RPUD 1MGTA 4CUGA 3BGOP 2O01C 2CPHA 4U67Q 1CQTA 3C46A 3RAXA 1YRTA 3NWTA 2D1HA 3UR3C 2DNLA 5HAOA 3CF5F 2VKDA 1C1CA 1Q4RA 5C7PA 2HURA 4PUOB 3AH6A 2GIRA 1HYSB 2WAEA 3U7JA 2VKZG 1RAIB 1OYEA 3BPDA 1VQ9I 4MT1A 2DY1A 2HVHA 4C30A 3ZMUA 2PEXA 2FHKA 3EPGA 5KFHA 4QPOA 4F4AA 2HEKA 3M8PA 1D0YA 3EX7B 1Q1HA 3C6TB 5LEJA 4XTTA 5J1PA 4ZHRA 4FNHA 3CCUI 3U1MA 2NYXA 2JVRA 3T5LA 2J0WA 3I5BA 2C2NA 5FGMA 2LLKA 3KOAA 4UXNA 3CO6C 3E01A 1FFWB 3S32A 4BDZA 3FHZA 1NK7A 3EYYA 1FI4A 2GQQA 4RNFA 3AA9A 2VOPA 3SDGA 2R5ZA 3RDIA 4P6QA 4BBYA 2XZDB 5LL6d 2CVEA 3DOMB 4J9MA 3E01B 2BOAA 3M8FA 4YFKF 3CCVI 3M2RA 4R0JA 3OVBA 2Z8QA 3BR5A 3C6UA 4M63A 1QVGR 1YO5C 5BPDA 3L2WA 3JREA 4PJ0C 4KO0B 4G12A 1Q82T 3ZGKA 2FC9A 2M87A 2ADCA 3H2UB 4QR1A 1RLCL 2E1MB 2C2DA 2AJQA 2MTLA 4MTDA 5GAHJ 1H8AC 4IHTA 1GDTA 3AODA 4DV3J 3DLEA 3QYYA 4CLTA 5LHHA 2V0NA 3E6BA 1KU2A 1S6OA 3VAMA 3AG1H 4YB1P 1Y6IA 1Z7UA 2VQLA 2C2MB 4KISA 4I09A 4YIIA 4DZJA 2N3OA 3QRFF 3KDOA 1VQ7I 4L74A 2DT5A 1C0UA 1W5SA 3GIMA 1EETB 2FX0A 4AU7A 3PRBA 3T3FA 5KAKA 4WFBQ 5LD2C 1JUSA 1U1MA 2ZMEB 1HNIB 4ENJA 3I5UA 3Q89A 2QQBA 4NC8A 2R8HA 1XNQJ 4LG0B 2K9MA 1TFYA 4YFNF 3FMWA 4ANJA 2P9GA 2CPFA 1K0TA 4JK1X 1I3OB 1B0TA 3WGHA 4D0PA 4DF8A 3CZ6A 2DA6A 1EP4B 4QYRA 3IAM2 1O4XA 1Y0HA 2C3OA 4I99C 1S59A 3OPKA 2KIMA 1NU4A 4Q2MA 5B66C 3QPSA 2ZEJA 5MLCV 2E19A 2IDLA 2DFFA 2ZC2A 2DNGA 4WU2A 2IA2A 1IUYA 3MM5A 3M8EA 1XTAA 1JI8A 1UPPA 3KFWX 5E1XA 1HC8A 2N4CA 3D6HB 1IJEB 1JJ6C 1OYWA 3R9LA 4KHPJ 3BSOA 4PCQA 4BACA 3OHAA 2SXLA 3BG3A 2U2FA 2KVQE 1BR2A 4XIUA 2XI2A 4Y17A 3N4MA 4NA2A 2HFUA 5H9EJ 3MEEA 1JJCB 3I0TA 4JI4F 1E6VA 4OLOA 3R4KA 1WOPA 3K5MA 4BL0B 1Z67A 1D9DA 2PEHA 3FDSA 4WF9Q 4LIVA 3OXLA 2XF7A 4FPIA 1U6BA 1RAJA 1OYDA 2XI3A 2QV6A 3K70C 2HQRA 3IHUA 3PSFA 4Y15A 5L1KA 4UUVA 2I5UA 2O5DA 4KGKA 1Q1KA 2KN4A 1FJGJ 4ZVRB 4ECSA 1I3QJ 2Z2MA 1U5TA 4HNUA 1RTIB 2CQCA 4DSIA 3PXGa 3GZNB 3JTOA 2X4HA 1SEUA 3O8HA 2DA5A 2LBFB 3F73A 1EF4A 5E79C 4QIEA 3W9IA 3TJ9A 3QZ8A 4BJ5C 2HHUA 1NMEB 3CC4S 3M7VA 4PKDB 3M30A 3O2IA 4OZNA 1NHVA 1F36A 3MR6A 2E44A 2FOWA 4BC7A 3ERMA 1AHDP 4II2A 5ETLA 3E8OA 2R7OA 2RREA 1SC7A 2C1EB 2FJBB 4M1KA 1B64A 2A61A 5HVFA 3SSRA 4X65F 2EZHA 3Q0AA 1K61A 3BR8A 2CPYA 1SXLA 3DTKA 5T7LB 2MY8A 2Y9ZA 2WRMA 5E3AA 2ZH4A 3CC2S 3DKXA 3TZXA 3LMMA 2CJKA 1DBDA 4B44A 3H5XA 2LA4A 1URRA 2ZKZA 3I9ZA 5F6FA 3M2UB 4KPYA 2Y8WA 4DSFA 2OEJA 3OXGA 2R7DA 2RQCA 2ZHAA 1YJNI 1HLWA 1X5PA 3RRGA 3BJYA 3QRPA 2KIQA 4G7ZF 4U0WA 1WH5A 3TEHB 3AQOA 4Q7AA 2AIRB 4OOIA 3W62A 1B72A 1YIJI 5EWGA 1WI8A 2P4WA 2IS6A 4B3OA 2AYBA 1UKUA 4L6V3 1N77A 3TO7A 1MMGA 1RDRA 1DDNA 1SKSA 2H6BA 1H2VZ 2CWEA 1X4HA 5HDNA 1VQOI 2H27A 1VLYA 4WJBA 2JEGA 3HHLB 2YWWA 2VJIA 2PJPA 3MMYB 2UUCJ 5HS7A 3C8YA 2QSFX 1BMQB 5DGAA 2LA6A 1NCLA 1VQKS 3BPVA 1BBYA 3MMJA 2FSWA 4V2FA 1HWUA 4RW4B 4ECUA 5F08A 1EETA 5J4VA 5CQEA 1JGGA 1WI6A 3DI6A 1SIWB 2VPLA 2AQFA 4X1EA 3J80K 1QTNB 2RQQA 4YR0A 3SI8A 1FOYA 5K5RA 1IBCB 3MMBA 3ZO7A 2HNYB 2PG4A 5EWEA 2JZ5A 3OOUA 2AJ4A 1MJAA 1GQEA 1WGXA 4XL9A 2WBRA 3P4UB 4NBQA 3DM2B 5BR8J 1XC5A 2MKKA 2R7SA 1SD6A 1QSSA 2HYIB 2AX0A 1WH7A 3P9CA 4EM2A 3KEOA 2UV8G 3I53A 3OL7A 2R92J 2B6AA 1EHWA 3CJ0A 4YIFA 1RYRA 1FC3A 1CS4B 4MK9A 3BG7A 3TARA 2IYIA 2PMWA 2QRRA 1KWMA 1RTJA 1HFEL 1YRXA 2XMUA 2RVCA 2MKYA 3HVRA 1T3NA 4USVA 4R8UB 4FE7A 5FRMA 3RB3A 2GA7A 1RWNB 1HKTA 1FMVA 3OYCA 3LP0B 4CLLA 4RWXA 1BC7C 3K59A 5LMNJ 1G1XA 3FXQA 1UVLA 3BN4A 2UVUA 2HFVA 4JI3F 5J6XA 2IM2A 1BM9A 3GXOA 5C25B 2EIKH 1SD4A 4EM1A 2XDVA 1KGSA 1FBSA 1PP8F 1ZTTA 4OI4A 2IHR1 4KO0A 1ZH5A 3MM6B 1E6YA 4G6DA 1N5VA 4PG7A 2FVRA 3AA8A 3BR6A 4XR6A 1ZTRA 1PGZA 2YKOA 2R5ZB 1HHSA 1ZAWA 3LSKA 1M1KT 1HR0J 2XQCA 2G1DA 5HI7A 3WTSC 3LF0A 4YY3F 2BKNA 4M5HA 2KJWA 1RXOB 4DFMA 4I2PB 2NXEA 5HP1A 2UU9J 3OTCA 2LP4A 2LDUA 1XQIA 2VBZA 2ZFUA 4MEYF 1S1XB 2DEIA 1U6GA 3QO9A 3J80U 4HTIA 3RZAA 3RRHA 3HRSA 2BW2A 1H9GA 3SFIA 5JVGQ 1XD7A 3QT5A 4BE2A 2BXJA 1U47A 3IBWA 2Z2SB 4ZCKA 4EWTA 2A07F 5E41A 3GCMA 4KH0B 4DFJA 4JX5A 3NS7B 1U78A 5EGYA 2ROEA 3RR8A 3G2XA 1FSEA 5F04A 2A6HF 5DG7A 1I39A 4X62F 1W0UA 2K86A 3VYUB 3NLCA 3IRXA 3V6KA 3H5UA 4WF2A 2QA4I 4IDKA 1PO6A 4JUZA 3K5PA 3JSYA 4XNFA 2DTRA 3DBHB 5AE2A 3QIPB 1EIYB 5IP7J 1MBHA 5HLGA 1QD1A 1D9AA 2NRAC 3H40A 2WC2A 2AP6A 2FQ4A 5SUHA 3FM3A 1RKTA 4F3QA 1NH8A 3R0JA 1R3NA 1FT9A 5D3GA 4NEYA 4ZDNA 3MZHA 1F5BA 5K5OA 2EPIA 3LGMA 2MJUA 2BW7A 3OTEA 1TKZB 1BIAA 2QSFA 5DS9A 2GAUA 1P4AA 2WV1A 2WWYA 3FRZA 5ETKA 4OAZA 3GTLJ 3KXDA 4KFBB 1L3UA 4DFKA 3VYTB 2GFFA 4OYIA 2HNHA 1RAAB 1TTHB 1F5AA 1R31A 3LH2S 3MMAB 4B3AA 4KJZA 4TU7A 2XPUA 1R27B 1XMQF 3KEYA 3CCWA 5HLTA 1JJ8C 3Q0UA 2M8HA 5C3EJ 4C11A 2GJIA 4MNUA 5D4PA 3CDUA 3KDNA 4LF4F 1GMUA 4H0EA 1B4SA 3HSDA 4DZDA 4MYTA 3B78A 1I50J 2ATLA 3GZ7A 4WXWA 5F8GA 2FYXA 2MB0B 1ZA1B 1FF2A 1NJZA 3CJKA 4MYUA 2D3OR 1B59A 2JUGA 2X1DA 3HULA 4CH0S 3BG5A 1R1TA 4A5MA 4A8KA 4MKAA 1QM9A 5J1EA 5K1YA 1BXNA 1YX2A 4OIQF 1RISA 4OYZA 1KU9A 2B8PA 2RGVA 1FOKA 3OR2C 2HRTA 3IV5A 3GTYX 3HKZN 2FC8A 3DLBA 3HOSA 4JP8A 4YIRX 4X4VA 2E5ZA 4ZVEA 4P9SA 1LVKA 4C2MA 4GVBB 2L2OA 1VRTB 1VIXA 2DITA 7FDRA 3K1MA 3MZ8A 2DNNA 2Q2EA 3B4DA 4A12A 4BKXA 4CO2A 3HD1A 3M6VA 4Q5VA 4HACB 1WHVA 3CUQB 5CA5A 1FTCA 1UG2A 3QAUA 5EX0A 4HPQA 2YKAA 2MLKA 2QBYA 1EKRA 2YKPA 1IXKA 1RWUA 2BY0A 3IM9A 3OY9A 3NNHA 3T5HA 3SQGA 4LF8F 3OYJA 1IVZA 3ZQFA 1S9EA 2LXIA 4LF9J 2XCAA 1YJ9I 4RAZA 1M5SA 3BC8A 3HL2A 1Q16B 1ODDA 3C16B 1Q53A 4XMYA 5EJCA 2W2NP 1V5VA 2EG1A 1ONVA 3UFCX 1CEZA 1QSYA 1Z0XA 4UQTA 5FKLA 1X4CA 3K2YA 4AD6A 3K17A 4ETZA 4ZLLA 4Y2IA 3VAJA 1ZGWA 3HT0A 5FD1A 2E5JA 2J5AA 2E71A 3GYXB 4LG3A 2PMUA 3J80Z 3SCIE 5IV3A 1YJNS 1NK9A 3PNYA 3TVZA 4XBFA 2RDJA 1YJ9S 3C18A 5GMEA 2ROPA 1PAUB 3UR0A 4PZVA 2Z33A 2UUBJ 2CUYA 1ZR4A 1KQ9A 4PYDA 2WOMB 2OD5A 2AJ2A 4IHVA 1FJLA 2X1AA 5LJ3Y 4EZ9A 1GUUA 4AQYF 4DV3F 1IKWB 4JBAA 2C2KB 4WTOB 1BOBA 2ELHA 1OR7A 1RESA 3KLIA 3ABLH 2DI3A 3SSSA 2F5GA 3CJQA 1DAXA 2FGOA 4DEZA 2FB0A 3MHYA 2ZBKA 4X6AJ 2HWIA 4CH7A 5L1IA 4PXBA 5A6WA 4G1PA 3W5ZA 4A0XA 3KNGA 1E2XA 2BQRA 4KUMA 1H98A 3TBIA 2KYZA 3CJQB 2KZMA 3QSIA 5B1BH 4HEA9 1YYVA 1Y00A 3IMQJ 1HI1A 1UHWA 4KICA 5B09A 3ZMSA 4U95A 1IKWA 1B1BA 1P7JA 3LWLA 4ABZA 1XR7A 3ZZZA 2QE5A 1FEHA 4QBUA 2V8VA 4BEHA 1M0SA 5C2GA 4EEFG 2GX8A 1S0MA 1JXEA 3OBIA 3F41A 3G73A 2DVIA 4B48A 4KGZB 3VODA 4NE9C 1N25A 2WAQA 3UVJA 1RHMB 1U8BA 3VQSA 3M2RB 1DHMA 4BXFA 2UWMA 3I4NJ 3EZUA 1R5ID 3JRAA 2W1OA 1T08B 3B02A 2C2ZB 2E7VA 2ZCWA 1JE8A 4BNCA 3PW0A 1S72I 4LIWA 5IT9K 3HYIA 3FKBA 4A3MJ 4ESBA 1SJ4P 4L9NA 3D6TB 3RIRA 3G6YA 1HXDA 3JRHA 1KBRA 4HX4A 2LP0A 3E97A 1X4FA 3JTHA 2F7VA 4YP3A 4BAYA 3QRRA 3K0LA 3GSDA 3HP6A 3A8JA 4Y6IA 3ZNJ1 5HJYA 4LRCA 5ADZA 3WTVC 1XTZA 2F5CA 5F0FA 1HYSA 3FBEA 1NK6A 2QLBB 3Q8QB 3CC4I 5J2MA 2RUSA 2KFNA 1I3AA 1KLMA 3M07A 5HDGA 1BD6A 4I6AA 3GILA 3TP2A 4P9UA 4B1RA 3W1YC 4NQWA 3CEDA 3CUNA 4DOZA 2E66A 1I6JA 3ML6A 5LXYA 2Z1DA 1S6PB 5KOWA 3DKDA 1WPKA 2IA6A 2G9WA 4F2SA 4EQQA 4HEA2 2ZXJA 4GC6A 4BS2A 5KFZA 2BUNA 2L3MA 4ZVQB 1SKWA 3SFZA 2GMHA 3C2BA 1FK9B 3P45B 2KRFA 1K8AT 5CCMA 2JJ7A 4IHWA 2Y0BB 3OS2A 3D0GE 4M5KA 3CDHA 5CVRA 3DRXA 2AJ0A 3BR2A 3OSFA 5IYBJ 5J1RA 4DR2F 3K2ZA 3HRMA 5IXUA 5ETOA 2DMQA 2RNJA 3RKYA 5IWAJ 4BCAA 2HYGD 3CO0P 4Q47A 4DS5A 4B02A 3T5KA 3ZMZA 3IUOA 4RA2A 1Q79A 4M74A 5L3BA 3R1HA 4F50A 3HIFA 3ROUA 1JWWA 3SFGA 2KFYA 2LRDA 4U7CA 3BZCA 4F4WA 1O3SA 1IKYB 1WC0A 2FVQA 4GDFA 3PYFA 3C15A 1SL1A 4KHRA 2R7VA 2W48A 2YKMB 4FISA 4C3JJ 1VQ4I 4P96A 5DG9A 3TDZC 4HT5A 3T0YA 3CVKA 1OJLA 4LJMA 1WF1A 2PBIA 5IZHA 1ZOTA 2HBYB 4LF6J 3NWGA 2DNQA 1JUPA 5KT7A 2L01A 2W9AA 1AYEA 1BJAA 2XYHB 4IHXA 1ZZNA 1Q5YA 4FX4A 3PW5A 1D5YA 3N6MA 5EGOB 5F3TA 5LLQA 4YB7A 5LHGA 4C8MA 1F43A 4X4UA 1V3ZA 3AD8C 5AIQA 4QW9A 3HHLD 3H35A 5KFIA 3FHNA 4QU7A 4E7SA 4A3KJ 2D3UA 3GX4X 1DURA 5CVVA 2BDPA 3WU1B 1FSHA 1H0HB 2IRUA 2RMLA 2V6EA 2DAOA 1H3DA 1NH7A 3NNAA 2ZH6A 3DPLC 5GVQA 1PP7U 3HKZA 3U1DA 3Q2SC 1MH4A 2XGXA 1T9YA 4O44B 2DCLA 3BZKA 1H89C 2HIYA 2ZBIA 4ZH4F 2CPXA 4DV1J 1VI0A 1JGSA 3QODA 2AXLA 4FN5A 3E6DA 4RGSA 4JOMA 1X0PA 4OYXA 5TISC 4YRVA 1YOVB 5E0OA 3GJTB 1XB4A 2WONA 3GYGA 4I67A 4IKAA 2J9DE 2V4JB 3UI3A 3PJWA 4KGXB 1I27A 1VQ8S 1TWCJ 1KS2A 3G96A 4HYKA 4QYZK 3H92A 1TKZA 2HZTA 2K2PA 2VIHA 4ZLJA 5KFKA 3G71S 1U0JA 1CG2A 2OSQA 3P49B 1X31C 1QVUA 1YRUA 4JI1J 3DLLQ 1V54H 4B3SJ 1LWEB 2MQLA 5E5NA 1S6QA 2V7FA 1NZ8A 2CQIA 3TX0A 2V9WA 2FNAA 4NHJA 4WU3A 4QLCU 2PJRA 5AXLA 3KLHB 3QIPA 2XMJA 1JLEB 3D54A 1OWXA 3ETOA 3FCVA 3LP1B 2BXYA 2AU0A 4CCOA 4QIVA 2CFXA 3M8QB 3QATA 1TK0A 1GT0C 4L72B 2GNKA 2A3SA 1NDLA 3OL9A 3POTA 3AB2B 2DHGA 3M9MB 1TWAJ 2LQJA 3SQOP 4DX8H 3TR5A 4A5NA 2G9OA 1JHFA 1WC1A 2GVZB 1JXLA 1VRUA 2RH3A 5LBQA 1OY6A 3N01A 2CQ7A 1S77D 1QE1A 3Q83A 4G94A 3VDXA 1WKMA 5HJXA 4ZLNA 1QHGA 2KDZA 3PYDA 4X62J 4LT6A 3SEQA 3PFEA 2HDDA 3PKMA 1DQ8A 4ED1A 4KMUX 3ETMA 1G7CB 5H1SV 4XSXF 2DRAA 2WVCA 4A3CJ 1GH8A 4IRCA 3O5TB 2ZOMA 2RU3A 2E1RA 5A8RA 1FMWA 4ZVOB 1TVRB 4G3IA 2JLGA 3LW5C 3PYEA 4P7TA 2LF8A 2VE8A 1HBXG 2DDAA 1OPZA 2AMCB 4C3IJ 4M5NA 3CD6S 2ME0A 1K78B 1O3TA 1CULB 3W2VB 1S57A 3OYGA 2F6CA 3G6EI 5K8NA 2KMUA 3J7A1 4C8LA 4W97A 3PHEA 5JR3A 2O61A 2FQQB 2Y8YA 2W84A 3MPVA 3HRUA 1K78A 2Y0SA 2GXGA 3LWFA 5CCLA 2K40A 3G4SS 1QY7A 5CXTA 2ISZA 4LF1A 3HGGA 3T19A 4YR3A 3BG9A 1UHMA 2HYFA 1B8IB 2OFGX 3R7BB 1ETQA 2XM3A 1RT4A 3EDPA 2CQPA 2KRBA 2CQ2A 3D0SA 3O3LA 4B3RJ 1BQMA 3HVAA 1FEEA 1QE1B 3WG7H 4L75A 2DJNA 5F41A 3OR1C 3JSRA 4UVCA 5GTHC 2KHMA 1IJWC 2V8HA 4CO3A 2V8DA 1J0RA 2NS1B 2ESNA 2ID6A 4F3MA 1VQPS 2NOGA 4II3A 2XYGB 1FXRA 1GAOA 4OYOA 1U1OA 2YWGA 4IZZA 2Y1JA 2JT1A 3C2PA 1YJTA 2EFWA 3KP5A 1N34F 5BQTA 2GV1A 2CZ9A 3OIPA 5B0BA 1XGSA 2VFRA 2N7YA 2DFEA 1LWEA 2M88A 5J1UA 2RSQA 5HO4A 1VHFA 5GADI 3BJ6A 4Q0BB 3RTVA 5CKTA 2IDEA 4ZS6A 3JW4A 4IHSA 4A48A 1CQNA 1FP2A 4I98B 4LF4J 2P8IA 4PJMA 3BEGB 1F2HA 2VQCA 3PEJA 3ZMVA 1WSRA 4EI2A 2CQ4A 3FGVA 4PFOA 1IGNA 1T0TV 2G0JA 1WI9A 4MTEA 3K8VA 5F0UA 1SL2A 5LGUA 4EMSA 5HS9A 2OO4A 1V4RA 3BR9A 3OYDA 1HW5A 1MBKA 4I2PA 2K1RA 2NUHA 4JBCA 4BLGA 1FRLA 2KJVA 3B6BA 3ZQLA 1SPBP 2OMLA 3S2HJ 3ILIA 2A6OA 2VJJA 2NYIA 3G82B 4B09A 3KEQA 2IJRA 1SFXA 4DUTA 2ZJPQ 4W98A 1VQLS 4F67A 4L9TA 1LWFA 1ITPA 3T9ZA 4LF7J 3AD9C 1G3WA 1N5QA 4G6TB 3FVYA 4MIBA 2BA9A 4LOCA 4DV2F 4LFUA 3THPA 2V2ZA 4ZZDA 3GFJA 1HOMA 3CMAS 4GRIA 5CHCB 1PG5B 1FYKA 3W7BA 4W92B 2JRTA 3AY0A 2C3MA 1WELA 4RUCA 3VVUA 5GAHI 1ZRFA 4RX6A 4ZJLA 3DU6A 3VWSA 2R42A 2UUAF 3ZZ0A 4C97A 2J76E 5JLWA 1D3WA 5G0RB 5D0EA 2JEJA 5IOYA 2GQ2A 3AG3H 1FRJA 5LOQA 3G71I 4IX7A 2QX0A 5GAGU 4RW8A 3RKQA 2XNRA 4FKXA 1PSDA 3PX6A 4QSHA 2ZC3A 4RWWA 1IM4A 4CDIA 2E9ZA 2HPUA 3HHLA 3G8TA 3HO1A 4USTA 1JLBA 5FLXK 4OHZA 4F0KA 2PJRB 1GXQA 3I56I 3OYLA 4DUYF 4NUBA 4KE5A 3KUEA 3PFOA 1JLCA 2IAJB 4AFFA 3ILJA 5I3UB 5AXNA 2HQDA 3H9QA 2GIQA 2OCEA 3GWCA 2MGZB 4AIHA 3ZP5A 1D0ZA 2ACJA 2F63A 3AOCA 5IM0B 4Q45A 3R5GA 2Y1LB 4LIUA 3CB4A 1JKRC 3DOKB 4EJTA 4I02A 2GAHC 4I64A 3SV4A 4IF4A 2C6YA 4OIRF 2WAQN 1V3RA 3A2KA 3MOJB 1PYVA 3W61A 1SAXA 3BSCA 3LAJA 4DHVA 3K0JA 2H4WB 3V81A 2EFQA 3MAJA 2DOAA 3L2UA 5J2NB 4E7LA 4XLPF 5E3RA 3NCQA 3TO6A 4NMXA 2LTPA 1ACIA 5J2MB 2CQ3A 5EG0A 4ZPDA 4KGVB 3ZZYA 3A1YG 2VQEJ 2KLOA 3D1OA 3WGGA 2HGLA 3KK2A 2ZJQQ 2CWXA 2ERRA 3D2WA 4BQOA 4WK3A 2IYGA 2NVYJ 2R8IA 3OYFA 4ED6A 5KFVA 5GAGI 5JVTA 2ZBRA 3SDBA 2AW0A 1UEUA 2VQFF 2Y2ZA 2EQRA 1U2WA 4PJLA 2MY7A 3P7NA 4YFXF 2E60A 1U8WA 4M71A 3MZYA 1RNLA 3NBPA 2B7EA 1S12A 2M9KA 3P3DA 1OLTA 3S8PA 4YN3B 3ITHB 1N48A 1QBJA 4AYBA 1ULRA 4FVMA 1U8SA 2FD5A 2VJ5A 4PFPA 1ETKA 3ZQ7A 4M5MA 5BXIA 2CFOA 2DK5A 2ZHOA 3UVJB 1RCOB 2MQNA 2EZLA 2O7OA 1UVKA 2VXZA 1JT0A 2D3ZA 4EO8A 3MURP 3GZ6A 1W36D 1C0UB 4LFAJ 4XK4A 2L02A 4RL1A 4RU9A 1EJ9A 4I6ZA 4C2UA 2L9VA 4H4MA 2GCFA 4GO5X 5H20A 2UVWA 2BKPA 2NNYA 1D8KA 1XNQF 4R25A 2GZWA 3GBGA 4A3LJ 2QGFB 4IRKA 5LMUF 4M5JA 3CJ2A 2UZKA 2W25A 3R60A 3H90A 3QLHA 1ZM4A 4KT6A 4GKJF 2F5EA 4EU0A 3I31A 1VQMS 1TL1A 3OJSA 1EZZB 1UEKA 2F3JA 2ZJQF 3T41A 1YJVA 2XO7A 2KRCA 2COBA 3I0SB 1I94J 5DYMA 5E8IA 1JNZB 3KLIB 3Q8VA 4BHQA 2DLLA 2XZWA 2HFSA 2MGZA 3F8CA 3WU0A 1Q8LA 3L09A 4DR6F 1EH8A 1LDDA 3BO4A 1OQ6A 2ZSHB 4ENKA 2YQ3A 2DNMA 5LSOA 2QVOA 2K06A 2G0CA 3I5CA 4LMYA 3KYLA 1RBOB 1SC4B 4FYDA 5CZVA 4EEYA 1IBMF 2UXBJ 4C8OA 2YX4A 5BMZA 5IT4A 1UZDA 4J9NA 2ZKTA 2MQ8A 4RW8B 4C8ZA 1HBMA 3F44A 1VIOA 1VC0A 1R71A 3WGIA 2K7LA 3KJFB 3M8RA 4NLYA 2CQXA 4J19A 1ZELA 1RP5A 1XK8A 4NLSA 2ZH7A 1MBGA 1KSPA 2ZH3A 2WVEA 4USMA 4L18B 1LV5A 2DHAA 1XGNA 1HNVB 1S49A 4NA1A 3AL0B 3DXJF 4XOTA 2OELA 3FK7A 3F6OA 3OS1A 5KVRA 2KRRA 1AFJA 2I1RA 3IL2A 1DLOA 4DV4F 3AXKA 5KFWA 2EV5A 1HW8A 2J0QD 5DUIA 4EGLA 1OIAA 3G2BA 5EUHA 1RE1B 1S9EB 4I2QB 2DNHA 5KFQA 3OWTA 4HF1A 5F0WA 3Q5FA 3CJKB 4F92B 3E51A 2NZ4A 3B8HA 3SXLA 3MGJA 4KHPF 3PDNA 5IP9J 1ZPVA 5KNLA 4ZJOA 1QSLA 2PMZN 1UELB 2HLUA 2HVQA 4AVZA 2OPRB 4HHJA 4OAYA 3MM9B 3GP9A 4BHBA 3MVPA 2DTJA 2YWKA 1Z91A 1NJWA 4J9SA 1T56A 4KV8A 1P6TA 3GW2A 1X0FA 4ZCLA 4RNMA 1VTNC 2RU9A 2ZBQA 5E7OB 4RW7B 3OVAA 2FMYA 1SKRA 4DX7A 1LWXA 3OFFA 5LJ5Y 2CU7A 1QAXA 1D5VA 2B7CB 1LEBA 1Y4ZB 2C3YA 1OO0B 1ZTWA 5HL7Q 2LKZA 1XMOF 2UV1A 4F02A 4DW6A 4X4NA 2EZIA 2DMPA 3GFMA 4Z7CA 2L7MP 1JLQB 5DZ7A 3ILOA 5H9FK 1LB2A 1DQUA 5EX3A 1KLMB 3PM9A 5IWAF 4DBRA 3CIMA 2DYSH 5KFYA 1AA1B 3NMRA 5B5EC 2XEXA 5IPAA 1SKUB 3TL4X 1Q0NA 3D1QA 1SQFA 2JLEA 3CCJI 3K2AA 3JR9A 2ZMEA 2KM8C 4LD5A 2PE8A 2DA4A 2EK5A 2CQNA 4OZ0A 3ULHA 2VQEF 3JYTA 2CW7A 2Z57B 3LQRA 5M5YJ 5HLFB 4CNZA 1TK5A 3DOLA 2I6WA 3FMRA 5HBMA 1HIYA 5HATA 1S29A 4XKBA 3I4PA 4F04B 5CABA 3GZ5A 4USWA 2W82A 2IA1A 1FTZA 2FUG2 2W7AA 1W7PB 4BBRJ 2Z2ZA 4TKTA 5J1YA 3S7RA 2MKIA 5F3ZA 3HMJG 2E5NA 1HW2A 1UJ5A 3QGIA 2K9SA 2DA1A 4DSKA 5J8CA 3ELHA 4DQIA 3F0NA 5E17F 2JX2A 2AHOB 4HDHA 5E3PA 1RKJA 1APLC 1TKTA 1X1CA 5CQGA 4FS1A 1U1NA 4BS9A 1FD2A 4KYZA 2M4KA 4R79A 2X6WA 1SANA 4A93J 2DPUA 2AYGA 4HF0A 1NNDA 4OYAA 2X1GA 3DN9A 3E5UA 2E5IA 5IM0A 1IR2A 1KVJA 2BVMA 2MLZA 3E2EA 2R7WA 2HNDB 4LLNA 5D5UB 2B9WA 1WEXA 2CZVC 3L2VA 3VAHA 2D74B 4AXJA 3MM8A 4ILLA 3K5OA 5CVIA 1YKWA 1V5GA 4HLBA 3CSKA 1REGX 2FBKA 2B56A 3AQPA 4IFYA 1WTFA 1Q8IA 3M32A 1UCRA 1TKXB 5B7WA 1EH7A 1VMBA 4AD9A 2ASYA 5M2RA 5IQQA 1IKVA 4EK2A 4NL5A 1Z1DA 3OYEA 1JLGB 2RN7A 2B63J 2E5HA 1S0OA 4B3MF 1N8RT 1YS7A 4YMEA 3BCBA 3P9IA 3J7Z5 2LDYA 1FJGF 2VBWA 2YS9A 2DA2A 1IN8A 4F8RA 1ERDA 3PY8A 2JWNA 1JLGA 1Z2LA 3NG8A 1ZQ3P 2BW3A 3JSBA 3BTCA 1FOXA 5ICEA 4RKUC 1OCPA 3I82A 3HVWA 5CAAA 4RMNA 1MLAA 1LNQA 3PYGA 2LY1A 2DFIA 4BXXJ 1V5IB 1D0EA 2QMWA 1I6XA 3HOXJ 3GFYA 4FNIA 2XSFA 2NS7A 3TDUC 1JLFB 3N0VA 4WTYA 2KU7A 3W66A 1SIZA 3L9ZA 3RAQA 1G6NA 1HDDC 5HQ8A 4ECRA 4WK8F 3MN2A 4RW6B 3SEZA 3DLAA 4KN4X 4CO8A 2Y9HA 1RR7A 3OIQA 4NC6A 2Q2EB 5FD5A 1EV7A 2JTVA 1S9GA 3LAMA 2LXFA 4JX6A 3HPGA 1S7HA 1QGPA 4KRWA 2W1BA 3D5RC 2FIUA 1RRJA 2XHKA 2N7CA 1RT3A 2BJ7A 3SV3A 1NHUA 1YHQS 4RBOA 3FX3A 3GUDA 3J7ZI 3BTIA 4KNYA 2XGDA 2F8MA 1BN5A 1NSAA 2EJRA 4IDKB 4MHGA 5H9EK 2KZZA 1SAUA 5DDPC 1B6AA 1YDLA 1IKYA 3MFKA 2BYCA 1JX4A 3M8ZA 4E7IA 2H3EB 1UFKA 2ROGA 4ZK7M 3DLJA 3R8YA 3TMOA 4TU8A 1IWAA 3DRPA 4XK8C 2OFHX 3LQVA 1KVIA 1YZ7A 2K9QA 2JEIA 2EINH 1TVRA 3GIJA 3ERED 2DNZA 3H4BA 2AT1B 1J9IA 4TN2A 1NSQA 1TU0B 3WC2A 4IG3B 3DKYA 4IOAF 2ZJPF 3WIVA 1FKAF 2P7VB 4ZZLA 2ZDOA 3PFIA 3DI6B 2QFIA 4GKKJ 2J9DA 3IC1A 1KYZA 2LFBA 2Y48A 2WVBA 1VQMI 4KIAA 2HR3A 5HODA 2GVZA 3PIOQ 4RW6A 1QLNA 1BW5A 2VKEA 1SFKA 3I87A 1A7GE 4E6KG 3C19A 5DETA 3NGDA 1N5YA 2HZVA 5FRNA 1QZZA 4UOCA 4IFYB 3MR3A 3TW0A 3EZOA 2JPBA 2OPSA 2JVOA 3BM7A 2L7FP 4ANCA 3SZPA 4DXLA 1BWEA 3MPWA 4IQJA 1XC9A 2AJ1A 2KM8B 5H2FC 1VDHA 1IDZA 3BS9A 4GKJJ 2DFHA 4O3MA 1JJHA 1NSKL 3AT1B 5EWFA 2QZ8A 4OZ5A 2X6YA 2NXNA 2DDBA 1W36C 1U9OA 2YNHA 4P2SA 3VAFA 5IYCJ 3W65A 1L5UA 2OGUA 4LG0A 1RT5A 4DYRA 2XAQA 1BY9A 5LGTA 3ASNH 4HLXA 1RHKB 2WAQD 1JKOC 1S76D 3QGGA 5ED4A 4AE5A 1B0VA 2XMAA 4DR4F 2A5WA 4BBSJ 4QWBA 3N5FA 4NLWA 1YBUA 2EWHA 3TA1A 2K4JA 1ZR2A 3UNGC 5GTIC 1T7PA 1TUVA 2HWVA 1WC5A 2C3UA 3KP7A 4X66F 3EUHA 4DJAA 3CDIA 2ILZA 4NI2A 3ENAA 2HMIA 2XCPA 3AD7C 2O67A 2ZOFA 3NEKA 4W1UA 2C28A 3IG1B 1UA1A 1SL0A 4M95A 3LAKA 4ZIWA 3K10A 1PJ5A 2JRSA 1AUSL 2O8KA 3RZOJ 1CPZA 3RKXA 1Q8BA 4ZLPA 2HW3A 4KR0B 2HPIA 2XAGA 2MJNA 3CF2A 4HG2A 1VRUB 3QYFA 2DJWA 4J9LA 4CYUA 2X6OA 3G6ES 4AC0A 2VPWB 3EGVA 2YNIB 4ZDPA 3R5BA 3KZIC 3FXJA 1YI2S 4ZJZA 2GMLA 3CW2C 3L7OA 4X2BA 1SV5A 4EGZA 4K5SA 3OSNA 1R0BG 4O3RA 3RYPA 2KJBA 3LSIA 3IR7B 2BHZA 2O8XA 2OKQA 4WCEQ 4ER8A 2QKMB 3S17J 4N56A 4JQFA 3DPUA 2KVIA 2V9VA 3C2HA 4OX8A 2XYPB 4R8HA 2CKWA 2YU9J 1M1EB 3UPFA 4Y3OA 3OFHA 4PSXA 2Z2LA 4G1QA 4IQMA 4LJZF 2RILA 2XHWA 2OAZA 2E36A 3H0DA 4BYYA 4ELVA 3HEFA 3T1BA 2STTA 4DV0F 3M9NB 2W7PA 1USSA 5DUKA 4D1QA 3SCLE 3PNVA 2WONB 1VQNS 3F9KA 2K5CA 4EUVA 4A4JA 4B9TA 1T03B 1RAFB 2HK2A 3MD3A 2OJED 5ERIA 3LSRA 3DMJB 2STWA 3PIPQ 1B8IA 3JSPA 2L9SA 4KGMA 4LSNA 2HBRB 2NXNB 1FYMA 2LBFA 1FDNA 1HW1A 4OMZA 1X2MA 3E6MA 3FMQA 4Z37A 1RYSA 2B9XA 5I3UA 2YKNA 2YQ1A 1HKAA 3R7NB 4EFAC 2L0KA 2EXUA 5B0GA 2HQGA 4A8SA 5F1RA 4ETSA 4DNCA 5LMNF 4ECXA 4TU9A 3B6CA 3B54A 4NC7A 2R3VA 2D5VA 1T9TA 4LIRA 2N3LA 1F3FA 1K44A 2WB1N 1HQUA 3Q8RB 3FXLA 4IFVB 4O3NA 1XIQA 3QYBA 3GE9A 1WJ9A 2M5YA 2FVSA 4P2MA 4G1QB 4UOHA 2KT5A 3HDSA 2OIHA 2OTLS 4DPYA 5FLXZ 2OQRA 3UNYA 4B3TF 2OA4A 4C3HJ 1HMVB 4PUOA 4DPWA 3L2QA 4Q8FA 3SYZA 2H1YA 2F4OB 2NSCA 2V68A 1KTQA 4BEHB 5AONA 2MZRA 2E1OA 1SV5B 2YWHA 3VTIA 2FHOB 3PR5B 3ZZRA 4ED3A 3MMCA 2OTJS 4B9SA 3BQYA 4I7FA 3I71A 5MAOA 5KFLA 4X0GA 4K4UA 2GM4A 2OTLI 2MZQA 3WHBA 1WZ2A 2VDIA 2V4RA 3IN5A 4XRSG 3V4IA 2HFOA 4QWCA 3HSRA 1YITS 1N75A 3A8IA 4I4BA 4KBIA 5DEQA 3ENQA 3GLXA 4C3LA 2EBIA 1JLQA 4AT1B 1XMQJ 2R0QC 2KI2A 5EDNA 4PR6A 2HKEA 3TGNA 2GAGC 1RB0A 4ZN1A 2HZAA 3WHIA 4M5GA 4NMLA 3DTIA 1F4KA 2PI0A 3OR2A 2IJLA 4A3FJ 1I5ZA 2C42A 4L76A 4K0KF 1SJ3P 3NS5A 2J6UA 3Q3SA 1Z9CA 4IH5A 3IH4A 1NUEA 4DIQA 4LK0F 1QRYA 5IY5H 1D9FA 5E3LA 2ZH1A 5D3GB 1KONA 2VG7B 2OV7A 4CCLA 5EDWA 4NCGA 2OPRA 4OV1A 4DF4A 3KK3B 2GVDA 3I96A 1VBXA 2J7WA 4O0NA 1Y5IB 3PZPA 2ABYA 1W26A 1N5SA 1P92A 1FX2A 3FSYA 3CCMI 1A31A 2FNPA 5FO5A 1DU0A