2E1MC

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
b'VRPATNAYGGGSTTDNPNRFMYYPSHPVPGTQGGVVLAAYSWSDDAARWDSFDDAERYGYALENLQSVHGRRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSLKHAWIEGAVETAVRAAIAVNEAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 28
structure length 151
sequence length 151
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1620 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mC02
3.30.70.2100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e1mC01
2E1MC
chains in the Genus database with same CATH superfamily
2KRHA 1ZTTA 1RLCL 1NK6A 2NVXJ 2ZE2A 3F6OA 1IXRC 3HSZA 4CT8A 3DM2B 4DV1J 4IHTA 2AW0A 3MUTP 2HKOA 1S0OA 2Q1ZB 4NI2A 4ES1A 3Q8PB 2I5JA 4RLQA 2KLOA 3KLOA 4OI1A 1EKSA 4TY9A 4P1WA 2BKOA 2UWMA 3MCZA 4FNHA 1RAIB 1F0XA 3CF5Q 2DOAA 3B4DA 5KFBA 3OPKA 3OJSA 2B43A 3J7AY 1C1BB 5B5EC 1HNWF 1OCRH 1ZYQA 2R0QC 4YIRX 5EUHA 4DF8A 2YY3A 3F22A 3QAEA 4PAAA 2YKAA 1RYRA 2LDIA 4DV6J 1T0FA 4KT6A 3QP5A 2QBYB 1IN0A 2BRLA 3QGIA 3WE3A 2DT5A 3HT0A 3BQ2A 3S1RJ 4ZVSB 1AROP 1UPMB 2H9ZA 1LFUP 2L3DA 2DGTA 3PRBA 7FDRA 4MH8A 2WVCA 4IQMA 2BE7D 2IRUA 5FRNA 2VODA 1FLIA 2XUBA 3J7YI 3J7Z5 1MMSA 3CB4A 4HH1A 2EBEA 4E6KG 2FJVA 1OPIA 3N79A 3NWTA 4IVNA 3W65A 2AJFE 2DGUA 1WH5A 3MXHP 4XLHA 4L3NA 3FXOA 4OJHA 1I94F 4DN9A 1W5TA 5KG5A 1RWMB 4XDCA 5LMUJ 1CVJA 1O7LA 1VQ4I 4FHTA 2MZQA 1D0EA 1K6YA 1E0EA 5ETMA 2MHEA 5LHGA 2OO4A 5LJ3Y 3TW7A 2B4OA 3I56S 4NLGA 3MM7A 1T95A 1QU3A 1TP4A 2Y48A 2O66A 1OMIA 4IOBA 3B73A 4OYPA 3OQ2A 4RJVA 2ZDPA 1X4AA 3MAAA 2C1EB 1KD1T 2RRBA 3TZZA 4I6WA 4YEJA 2P2CB 3FMSA 1F5TA 5LSLA 2LTPA 2RHSB 4K2XA 1F9FA 4OHXA 5JVGQ 2UVWA 3Q24A 1Y5IB 3H92A 2F2EA 5E0OA 1ACMB 3N05A 1W25A 2X6YA 1B0TA 2FGCA 2HVDA 2ELJA 4U7CA 2XQCA 4J9LA 1RADB 3K9TA 5D6EA 3D67A 2DNNA 3IRXA 5FD5A 1BIBA 4RAZA 1SL2A 3BG6A 2ZEJA 2OGUA 4I98B 2V6AA 4EGLA 2AQFA 2QTWA 3UR0A 4HYEA 2K4BA 1I27A 1GQEA 1S0MA 2MQ8A 1HBMA 4WCEQ 5G4DA 4F92B 1D0YA 3NOGA 3FBFA 1FDNA 1R0AB 4Z6YA 1FJLA 1VQKI 2LK2A 1RT5B 3HSEA 3T5XA 3T0YA 4BBRJ 5HLTA 4MFBA 2DNPA 3IMQJ 3K69A 2R7RA 5T14A 2ZM6F 1NK2P 5E5NA 3UCZP 1P8GA 4O5VA 2Q2EB 3LP1B 2PFDA 5DG7A 3OVSA 1TP7A 2FYXA 3QAUA 1FERA 1M0SA 4ZS6A 5KFHA 1HNXF 5GPCA 2B9WA 3IN5A 5DGAA 2XGQA 5GAHJ 3I53A 2PDAA 1QZYA 1W0UA 2KKOA 4GO7X 3CCSI 4FF1A 5KFAA 1G7CB 3GYXB 2JC1A 4QU7A 4N47A 4CLUA 1CG2A 3U2RA 2IM1A 5EDWA 3MKWB 3LH2S 5IT0A 4IXAA 1SJ1A 3PXGa 4BUPA 4QR2A 4TN2A 5C4JJ 3OFHA 2AF6A 3P5TL 2CQBA 1UMQA 4DGWB 1G3YA 3PHEA 4U7BA 4I6ZA 1HWLA 2BXJA 3MZIA 3DNCA 2F4MB 1QHHD 3CUOA 1Q5YA 2KXHA 2V4JA 1QSLA 2ZBIA 5KHDA 2WVDA 4ZYGA 2PJRA 2CW8A 1PUFB 3L2VA 1JLEA 1RTHA 3DLGA 2O3DA 4IJAA 4II3A 2K9LA 1QBJA 1WDTA 4MJKA 3CCRI 1NSQA 3H9QA 5KFWA 4XRSG 1ZLJA 3F41A 1JUSA 1YBUA 2IS1A 1QAJA 4BHBA 2UUCF 3M07A 3O6BB 3FHZA 2CZVC 1XNQJ 2VKVA 3HVAA 3K5PA 4XKVA 3H8YA 2M7AA 1P7JA 3GF2A 1TL3B 3GCXP 1HQUA 1LE8A 1QNTA 3U02A 3PL8A 3BV8A 3SJMA 4OMYA 2HNZA 2CG4A 1YX5A 2XYPB 1QSYA 4PDKA 2R5ZA 4FF4A 3DOLA 1LDDA 3M8JA 3WGIA 1WEYA 1FX4A 3O44A 2YNGB 5KAFC 1MROA 2ZNZA 1RXOB 4NI2B 3PRDA 3FUYA 2V6CA 2VOOA 2I5JB 5C24B 5H6RA 3ET6A 4HL9A 3G3ZA 1XMOF 2LEBA 1U5TC 1B9NA 3DCFA 4BJ6C 1N6QA 2WWYA 1UZHA 1WKKA 3CJ2A 4HYKA 1MJAA 3M9AA 2BOAA 4A6EA 3W63A 2P4WA 2N3OA 4LLLA 3HJEA 1OMSA 2C2KB 5A0YA 5LXRA 1NTCA 2JLGA 3FBCA 3RKWA 3CC2S 1YITS 4KV8B 3CCUS 2KPMA 3EPGA 1S10A 4F91B 1LFWA 4U0YA 3KLIA 1XPXA 1QVFR 4NMLA 3BOQA 1RTIB 4Q5SF 4NC7A 3ETMA 2N8GA 4DSFA 2K9MA 4DPXA 5B0AA 2RQ4A 1FPQA 2OIHA 1HW8A 2ZBQA 2WAQD 3A8IA 3MD1A 3C2PA 2AO9A 4J90A 3HJVA 2WB1N 4H0EA 1HBOA 1HNIA 1WFXA 1BI1A 2AEMA 2XAJA 2Z2YB 3RU0A 3B6AA 4JX4A 3EUHA 1T9TA 5AJ3F 4IO9F 3LQVA 1RWNB 3D6FB 2RU3A 4DR2J 2EZLA 3AXKA 3HF5A 3VTIA 1N56A 1T9VA 3ZC4A 4RU2A 3N5BA 3QSYB 4A3CJ 3WQPA 5ETPA 3Q8RB 1IVZA 4ZK7M 1XR5A 2CQ2A 2MB0B 5F3TA 3MM7B 3OSFA 2Q6BA 3CO9A 2CO5A 2UV8A 1X5SA 4UT4A 2ILZA 2NYIA 5HOOA 4DNCA 3GIMA 4Q2MA 5E8GA 2BY3A 4NL5A 4FS1A 3ENWA 2HFUA 1VQ9S 1ZBTA 4G6VB 5D3GA 2UU9F 4CTAB 4RWXA 2MKSA 3CIMA 1BW6A 1YHQI 2DT7B 3S8SA 3M4XA 1XGNA 2MDAA 3T41A 4DV1F 1G4DA 3BG7A 3DLKA 5F8JA 2ZCWA 3C14A 1FNNA 1XSVA 3LA2A 2IVMA 1AZSA 4KHPJ 3IRXB 4DR7J 3LFKA 4ZCLA 3IHUA 3S8PA 2ZFHA 3BTJA 2KVQE 1TNSA 3UKGA 3GCWP 2RAEA 1KU3A 2A5WA 4IG3A 4IPAA 4F25A 3LPEA 5EZGA 5F0FA 3W9JA 2FY8A 1TL8A 3RPUA 2B56A 3HB9A 2HXIA 2KFYA 3DXJF 2MQPA 2DBBA 3KPHA 5FFXA 2Y0SN 5IP9J 3GJQB 2RVCA 3IWZA 2LXUA 2GJ2A 1H2UX 1KS2A 1RTJA 2NXJA 1FC3A 4P55A 3J7ZI 1LWCB 5KFTA 3KP2A 1ON1A 3DFGA 4EYHB 1FMWA 4GDFA 2I9SA 4RB1A 2MSTA 5C25A 3VSLA 1B4SA 1WOOA 3OTOJ 2LQ8A 4EU0A 2HHUA 2VU5A 1W0TA 4E0DA 3OTEA 1VQ7S 1Q8KA 1U9NA 3R7SB 1IBLJ 3HSGA 4DS4A 2DR8A 1PJ6A 5JHFA 4LFBJ 1VIXA 3RB6A 4NRTA 3BR0A 4RZRA 1FXDA 4HTIA 2JRMA 4LREA 3MR2A 4NA1A 4AIKA 5LMUF 2PJPA 2YWFA 2ATLA 3W9HA 2XEXA 4USMA 3MOZA 4M1KA 1BI0A 1PVEA 2YPRA 2QRRA 4II2A 2V4JB 2H65B 3FHNA 2C2MB 4Y2AA 1OJ4A 2FB0A 3NWGA 2DLLA 3RG6A 1J7KA 2ECBA 3AG1H 2LKXA 2PJRB 4NZ7A 1JLEB 2R3SA 3DLGB 4EQQA 3GTKJ 3JQMA 4FXWA 5F8MA 1IBKJ 4PJLA 1LVKA 1NK3P 2F5FA 1FWPA 1Q1HA 2VN2A 2XVCA 3GIJA 2DIUA 1YFHA 4CT9A 2EC0A 3BQZA 2K7JA 4L0YB 1RAEB 5L1IA 1G3OA 2CV2A 2AD9A 5JMNA 2FVRA 1R23A 5GADI 4K4UA 2KFZA 3WTZA 1HQUB 3KDNA 1LE8B 3MM6A 2BV3A 3D28A 2IW5A 3M8QB 4NUBA 4G65A 3B6CA 5HSPA 3QOEA 1U09A 1RAOA 5J2NA 2R5ZB 4DV7J 3BGLA 1Y8RB 1UJ5A 3Q3SA 3SEQA 5F9NA 2BABA 3IS9A 1ULYA 2XZDB 1NK0A 2FHJD 2XBPA 3CCJS 3IM8A 4K59A 4ANJA 4I64A 2EVZA 4OYBA 5KT6A 4UVCA 5DD4A 4PR6A 2UVUA 2Z2SB 2ADUA 3T1BA 2GXGA 2G0EA 4EJVA 1N6QB 4I4BA 1FTZA 2FJXA 4ZIWA 4HR2A 4A3JJ 1KLMB 3ADAC 1V5FA 2UZAA 5J1PA 4F8RA 2V8DA 2LYCA 2NZCA 2YBVA 3NLCA 3W5XA 3BR2A 1N75A 3FBNB 3M2VB 4BQOA 1FRIA 3MWMA 5KFDA 1P6TA 4ANCA 4TXSA 1IF1A 2ID6A 2Z3YA 3S16J 2IA2A 1FHTA 4BH9A 2BDPA 3KLIB 1FKAF 2IM0A 3DBLB 3DU6A 2B9EA 1Z2LA 2QA4S 2FLPA 2D1VA 2J7WA 3BZ6A 1WI6A 3AY0A 1T05A 1SVDA 3L4BC 3MTKA 3GWZA 4B02A 3WDOA 2RKIA 3TEDA 1VBKA 2DD8S 3ZTPA 5F8GA 4HI1A 1RKJA 3SFIA 4AIJA 3RPQA 4M5KA 5KTQA 1LFPA 1HNIB 4LSZB 4DXLA 4QWQA 3CCVI 1OCPA 4WIQA 1T38A 2LA6A 1QTMA 3NWRA 4ZYAA 4O0IA 1G6NA 4PSWA 2J6TA 2Y75A 2L4MA 4ZP7A 5ILVA 2EFPA 4ZYHA 1J9IA 3CP2A 2DCUB 1XNRJ 1L3TA 3MKZA 3UN5A 2E2JJ 5M3MJ 4OIRF 4Y6IA 3CF2A 3B8HA 4LF8J 1HD0A 4EM1A 4M5GA 4OHVA 2FOWA 1JB0C 3U1LA 1VC0A 1S72I 3TANA 2F8EX 3LQRA 5C44J 1KVIA 2GIZA 4WXHA 1UW4A 5E7OB 4B9LA 3DLHA 3G9CA 4NLPA 1Q53A 2ZZNA 4MTDA 3IM9A 3N9UC 2DMTA 2DQLA 4ILMA 4JI8F 3CCLS 1MBEA 4Q0BA 3PIPF 3IL2A 1HSTA 2BGCA 2C42A 4B9NA 2FQ3A 3WTVC 3R6LB 5D3GB 3J81j 2FD5A 1SVLA 5A2QK 1ITPA 2I10A 2JH3A 2MGZA 2R8GA 4L72B 1K8AT 5EDNA 3DLKB 3E6MA 1HW2A 3C14B 1O5JA 1F6TA 4QIGA 1Q1KA 4CCHA 1HDPA 2FXAA 1AZSB 2CUJA 4A93J 5CCLA 1QZEA 1X0PA 1X8DA 2DXEA 2ZHOA 2HHVA 2J0SD 3CO6C 1D3YA 1IC8A 2H1YA 3H59A 3ZMVA 1JNZB 3VZIA 3M9OB 1ZA2B 3MD2A 4IG3B 4A0XA 4LF2A 2E9TA 5IC6B 2R7WA 3QU6A 2MLXA 3E3VA 4Y2IA 2XGEA 3VVUA 1EIYB 4QYZK 4U8VA 1YLFA 2ZH3A 5L38A 3HGYA 3L09A 3MMCA 4ECYA 1DQAA 3GSDA 2DODA 2XGXA 1QAIA 3KP5A 4R79A 4V19K 1LVAA 3H5SA 5IM0A 3AJ1A 3IA0A 4RW8A 3GXOA 1EKRA 1EZZB 2RUSA 1T7PA 3FK7A 4B3TF 1HNVA 3RCOA 2DFFA 3MMBA 4A69C 3ZCOA 3R0AA 3TL4X 1ULRA 4I6YA 2O01C 3MAQA 3KZIC 3KYDB 2Y9ZA 2K27A 5F0UA 2GXBA 3GG0A 5KFMA 2W8LA 4W90B 4A46A 2JX2A 5KVRA 2DR6A 4HDUA 4HI2A 3UDVA 4IFVB 1U1NA 4USJC 3QMQA 2QWWA 5HLHA 2CDQA 2E19A 3VAKA 1RKIA 4DR2F 1H9TA 1H2VZ 2I5UA 4OX7A 3CQZJ 3WTXC 1HHTP 1RC9A 3OL3A 5HDKA 2Q3PA 4Z2XA 1U24A 4YS2A 2DXDA 5HVFA 1SKWA 3ZMSA 4KMFA 1FFWB 2Q43A 1N48A 1J09A 1VQKS 2LRDA 2CRLA 2VBYA 2BHZA 3OSPA 3KJQB 2DNQA 3ZNJ1 4ECSA 3R5DA 4MGRA 1VRQC 4U8YA 2DY9A 2FF4A 1QPMA 2HFZA 3HHLD 3I87A 1BJZA 3NG8A 4CWBA 5L9NA 2NVYJ 3BSNA 2MPUA 3IKVA 1GMWD 4F0MA 1HNZJ 3G2XA 2DTJA 2V50A 2DMUA 3VAJA 3D5RC 4WKRA 4F4AA 3LL7A 2OPSA 9ATCB 3SDBA 3G8SA 1LPQA 3HLUA 2COLA 3MM6B 4ZPBA 2PX9A 3JRAA 3KMSA 4MK7A 3TQEA 4KHPF 5CQGA 4DYCA 4NLUA 1RT4B 4AL5A 2VKZG 1UP1A 4DR7F 3O5TB 4LBPA 2CVEA 2KM8C 4BGDA 5AIQA 2VF3A 2DGXA 2JSXA 3FSXA 5GMKa 1RYSA 4LF6J 2HHQA 3CMEI 3OR2A 4DL6A 3OXGA 3J7YU 3BGRA 4AVZA 2QSHX 5GAEJ 1BJAA 2MD0A 3ZQIA 3FNNA 2GZWA 1KN6A 1RKTA 2K40A 2ZWOA 3CC7I 2IA0A 1YJWI 3C18A 2DOEA 3SQNA 2GHVC 1WELA 3IH2A 4DV0J 5TRDA 2E34A 2DGWA 4CH0S 4A3BJ 4JI1J 3P6YC 3FMWA 3EGNA 2Y1JA 1I5ZA 2YVSA 1VQLS 2XY5A 2QYGA 3PY8A 4D7MA 4Y28C 1UJ8A 4X4OA 2J6UA 3OTOF 3TVKA 4UZCA 2W7AA 3OJUA 1WG4A 4ZKAA 1EH7A 2ATCB 1IBLF 1R49A 4LFBF 1T3NA 4CH7A 1VQNI 3FM3A 2RKIB 4NLXA 2RRNA 2O5DA 1KU9A 4WWCA 2ZJPF 1RAFB 1YRUA 2AKWB 2EG2A 1PBAA 3D9BA 4R5PA 3SV4A 1S6PA 3PW4A 3CMAS 4G6TB 2RD5C 1S4FA 1YRNA 3K4BA 1GAOA 3M32B 3WTSC 4ZVQB 4IH6A 2JT1A 5KFJA 1IBKF 1MG7A 3SZGA 4PCQA 2DDAA 1OCTC 1GTEA 1JXSA 3M8FA 4EJUA 2QLZA 3BCAA 2YNIA 3QRRA 5DQIA 2OU2A 2G9OA 4NBQA 3EE3A 3MMAA 3H5RA 1CS4A 3NP5A 4EEFG 1J5YA 4OZ3A 2XZWA 4N41A 3M1VA 4EV0A 3I55I 1RABB 1SD7A 5KAIC 3QJPA 2APOA 4MIWA 3A13A 4Q0BB 5BJRA 1U48A 2V8VA 1QUVA 1E6YA 1F1ZA 4CCLA 4NYZA 3SQOP 3I32A 4A3IJ 2VKHA 4DV7F 3I54A 5FLVA 4KYWA 3DF8A 3EVMA 3LP0B 4J91A 4DYRA 1IXSB 4A8OA 4RX6A 4M94A 3IP0A 2BBEA 1RHJB 3VGSA 2K06A 4NHJA 4YG2F 1LWEA 2C3MA 3DOMA 4A3GJ 1KQFB 4IDKB 3WTWC 4QW8A 4C2TA 3LSJA 2QQ8A 1KOOA 4USKA 1V4RA 2F65A 2E29A 4FS2A 5B09A 3KLNA 5J4VA 1X9WA 3SZTA 1UFMA 4NCBA 1F60B 5IWAJ 4M71A 2AHOB 5A8WA 4XPCA 2P6TA 4PXBA 2D1HA 3MMCB 1KYZA 4XSXF 1B7FA 2V68A 4GO1A 4P71A 3BDPA 2XSJC 4PYDA 3VALA 2R7SA 2JDJA 4LRCA 3H90A 5IM0B 2LA4A 4RW8B 3KFWX 4FE7A 3ZRGA 2W4CA 2OTJI 1NZ8A 1X1BA 3CJ0A 3E0JB 5KFOA 3OIOA 3MMBB 1K0TA 4DMZA 4ELUA 1H98A 4ASNA 4U7UD 2N4DA 5GVQA 2QM3A 1YHQS 4QWAA 4QR1A 4PG4A 2CA9A 3M8SA 2XM3A 4B3AA 3I5CA 4ZDPA 4N0BA 4LRDA 1ZETA 3K58A 1RT1B 3DRSA 1XNRF 3GWCA 4F50A 2VE9A 1S8NA 4ZN1A 4HBLA 1HFEL 2LMIA 1S1TA 5F3ZA 4LF8F 2B9SA 2DRAA 3WGGA 5K9FA 3Q8YA 2Z57B 2XG8A 2ZDOA 4NLYA 1R5ID 4DL7A 1X0FA 1B4AA 3TW6A 1ON2A 1RBOB 3PEHA 4MNUA 4KFCA 2MGQA 4QYZJ 3PIPQ 4JI4J 4F3OA 3V8KA 2C6YA 1VGYA 4OI3A 2NXCA 2UXCJ 1KEKA 1HWJA 1CEZA 2OPSB 2IBOA 2W4DA 4LITA 3ZQHA 5L3EA 3OMYA 1IR2A 4WU3A 4DQPA 2BUNA 3RJPA 1S9GB 3R7BB 4WFAQ 3LAKA 1QTNB 3DPUA 1RSCA 3ZMDA 3IBFB 1K1QA 4O4RA 1HSJA 3LSRA 2CPFA 3NRBA 2CMPA 1STZA 5G0RA 1SV5A 1WHYA 3R6GB 1U25A 3OR2B 4JI3F 3BZCA 1RJJA 4PGGA 5M5XJ 3QYYA 2EIJH 2QX0A 3PTWA 4ZMMA 2CJXB 5K8PA 4P10A 4C8OA 2AZ3A 1FY7A 1FRLA 2NOGA 5D5WB 4IR1A 2HVIA 2KJVA 1Z1DA 2W8KA 3QYEA 3QQAA 2PI0A 2AZ1A 1HYSA 3U27A 2XPWA 2XHWA 3DTEA 2HQGA 3K7RA 4ANDA 3GILA 2H6CA 3WC0A 2YSRA 2G13A 4KR0B 2A5YB 3CUNA 4HHUA 2VJVA 4PJMA 3FEYB 3HKZD 1RRJA 2DA1A 2DCEA 2VJJA 3CMYA 4IKFA 3KP3A 2LFBA 2WB1D 4X65J 2EINH 4KH0B 1NDLA 3WC2A 1O51A 2ETHA 4DCJB 2YKNA 1NH8A 1NH7A 3CJ4A 1YWXA 2NCKL 4LIVA 3UD5A 2NAZA 2JHEA 3BQ1A 2DJWA 2OAZA 5E3MA 3CD7A 4DR1J 2VPWB 4R5PB 1J59A 1S6PB 4X84A 1YRNB 5AONA 1ONVA 4XLFA 4IHYA 3HHGA 1RAAB 4WFXA 3D7SB 3CJ5A 4HKQA 3QRFF 2EV5A 2QQBA 2PMZA 2X0LA 1K1SA 3D1QA 2F1FA 2QL9B 3CD6I 2ZXWH 3U1DA 4ETZA 2BVLA 5LXYA 2VQFJ 4J9RA 5F04A 1HNZF 1T98A 1SIZA 2XLKA 4LB6B 3MMAB 3CW2C 1CS4B 3HK2A 4P96A 1RK8A 3EDRB 1HHSA 3M1VB 2HKXA 2EZIA 2RUGA 1X4EA 2VJIA 3KHGA 1TW2A 1USTA 1E6YB 2ZJQF 1DGRM 4N4OB 1VRTA 4XOTA 4USIA 2JVGA 1IRFA 2FU4A 4HX8A 1M1GA 3O8WA 5IT4A 2FDNA 2OD4A 4LF6F 2BY1A 4CO0A 4M3EA 3HOYJ 3US5A 4ALZA 2BM1A 3ZZRA 4RLFA 3KYCB 4KJZA 2MKJA 4LF5J 1AT1B 3MTJA 3EETA 2L0KA 1LWEB 5D78A 2F4VJ 3CDWA 2Y0SD 1WVRA 2DIVA 4RMNA 1SJ4P 5KT4A 3GEZA 4DV0F 2V1DA 1YQHA 4JI1F 3AOBA 2C2RA 3EZ5A 3OYNA 3KJNB 4FX0A 2ZB9A 3RRGA 1DLOA 2LH9A 4B9MA 5DEQA 1XGOA 1JKRC 2YH0A 2CJAA 5A8WB 1ACIA 5LRSA 2ZNYA 1KLNA 4K2EA 2JJ4D 4CICA 4FPRA 1XR6A 3SIPB 4B1RA 3GTMJ 3DOKA 1EA3A 2IYGA 1C0WA 1ZG3A 3NAUA 2VI6A 2C2ZB 5DDPC 2VXZA 4QJVA 3ZFVA 5ETTA 1SH2A 2DFIA 2YKQA 4HT7A 2ZJPQ 1R0CB 1QD1A 1MJ9A 2LBFB 2OEMA 1WG5A 4FNIA 3G1OA 1V55H 1GMVA 2EA2A 4HT5A 2DH7A 2G0JA 4X0GA 1FX2A 3KLGA 4L76A 2QLXA 4E7KA 3DRSB 4NCGA 4OX9J 2CADA 3UE2A 3H3ZA 1U6FA 1S29A 2EK5A 3TZYA 4I2QA 2OEJA 2VG5A 4U87A 4F0HA 4M9ZA 3WODF 5CZVA 2Z9OA 2KQRA 4YB7A 1WH7A 4HH0A 1SAXA 1JK9B 2IS4A 1YW9A 1ZREA 3OL9A 3OBIA 4IFYA 1K61A 2YKMB 4OINF 5ETRA 2YNFA 3TOAA 3NY0A 3UDCA 1I6JA 4IHVA 2LDUA 4MAKA 3CE8A 2YQ3A 1JHHA 1VC5A 2PMZN 3ISZA 2HLUA 5H9FJ 3QWPA 3UCGA 3T5HA 1S9EA 1RWVB 3TARA 4F7VA 3JRCA 1FEEA 2DO4A 4TYBA 1VBYA 4OFZA 4CLWA 2V2QA 3H40A 2FJEB 5CKTA 2KRFA 3QU3A 1T0FC 2IJFA 2OUGA 5A76A 3M8WA 5IOZA 2E2HJ 3WGHA 2QV6A 5LSRA 2Y1IA 3RRKA 5G0RB 1SV5B 2V5HG 4PJNA 2ZUGA 1OPCA 2LVSA 1WI3A 5K7ZA 3G6ES 2VBWA 3VFZA 2M0MA 5KFGA 1JMTA 2CWXA 2WA0A 5FJ4A 5IWAF 3OYJA 4O3MA 3G6VA 3LUYA 3QZ7A 1T33A 3TP0A 2WVFA 2QQAA 2DT6A 2RU9A 2NS0A 2KB2A 1HYSB 3FKIJ 4RU9A 2GC8A 1WJFA 3LNQA 5E18F 1ZARA 1JJCB 1HW9A 3FGVA 3HMJG 1JUPA 1UKUA 3BN7A 2RC4A 5GAHU 4I2PB 5EX0A 3JSOA 4LR8A 3V6KA 4I09A 4LIUA 4Z7CA 2K86A 2LF8A 1I1SA 2IPQX 3HEFA 1UWAA 3FBBA 2HDCA 3Q0AA 3OS0A 1SPBP 2XC7A 3PSFA 1N78A 1IM4A 2LC2A 3H35A 2HHPA 2YKNB 2KDOA 5DDOC 1R1TA 5CAAA 4GKJJ 3RJMB 2F3JA 1FDAA 2DA5A 5HS7A 3HD2A 8AT1B 4UVBA 1APLC 5H2FC 3CJ8A 2L7KA 3W61A 4FXVA 4KC5A 3D4JA 3JQJA 4P2MA 5LBQA 1TTHB 1VQ8I 1XD7A 3H3UA 1JLFA 4CCMA 2GOMA 4W97A 1BI2A 5F1JA 4A3DJ 1NHUA 5EX3A 4PZVA 4HW0A 2J7KA 1G3WA 3CC4I 3EZUA 4MYUA 2G4BA 3QRQA 3CC7S 2J0XA 1YJWS 4TV7A 3S1QJ 4JI4F 1PYVA 2MC3A 4MQ9F 2GGPA 5IY5H 4ZPWR 1WF0A 3CULA 1U5TA 1A6QA 2HZAA 3CUQA 2QE5A 4U96A 1PIEA 3NS5A 5K8NA 5F6FA 2UXCF 4E98A 5DJBA 2RS2A 4DV5F 3KEOA 1BY9A 4CI0B 4CLPA 2LECA 1T8EA 3UN2A 3M9MB 1WC4A 1FRJA 3FZVA 3VODA 1MN7A 3JRIA 3C3LA 2MFZA 2BOPA 5HVHA 4DR5J 2AQEA 5C2GA 4WZQA 5I3QA 1UMJA 2KI2A 2XNRA 1OSCA 5JLWA 2DNLA 2V8PA 3T1YJ 2HWIA 4H4KA 3SQGB 4ED5A 2YKPA 4A8KA 1JLAA 3VZHA 3K59A 3FKBA 2HNHA 2X1BA 5ICFA 2GM4A 2FIUA 2QKLB 3OY9A 1Q78A 2V69A 1L0OC 4C30A 2V2VA 3ISND 5HQ8A 1FJGF 2A6TA 2O7OA 2OCCH 3ZTSA 2VBZA 2NLWA 2UUAJ 4DIQA 2J9DA 3SCKE 1JKOC 2EPIA 1ZA1B 5HNFA 4AFFA 4L73A 5DUKA 2RAQA 3ILOA 4UQGA 3NKYA 2O0YA 3MAJA 5B0GA 2L9RA 4FISA 1OYEA 3QAHA 1MMGA 4FTHA 3ENAA 4HDVA 2F5GA 2E1NA 3BR8A 1U1LA 3Q2SC 4L6V3 4OLOA 2W2PP 3KOAA 2KZZA 2MJUA 1C0TA 1O7FA 4M5MA 4PYAA 4LF4J 2DMQA 4M5LA 5LRRA 3ULHA 3LAMA 2DI3A 3BKTA 1O6XA 3H5YA 4A0ZA 1VFJA 2M8GX 1J27A 4JX5A 1ZYRF 4DR1F 1O3RA 3BREA 4B47A 3BG9A 3H2UB 2AU0A 2CUEA 1BXNA 4B3MJ 2MQMA 2AGOA 3LSKA 2VT2A 1S49A 1BC6A 3DWLE 5D0RA 4I2QB 1QO0D 2VG6A 4ECXA 3P9IA 2Y69H 1O3SA 2P9GA 4CDGA 2H27A 2A6MA 4AVPA 2XNQA 4CLZA 1LXJA 2VQFF 4LG0A 4C8MA 1VQYA 5LGTA 2CQ3A 2DK2A 1KQSR 4DZ6A 3K7AJ 9ANTA 4JP0A 4UY8T 3EGWB 3EX7B 4J9KA 4UQTA 2YNFB 3A0HC 4HLYA 2OJED 4XTTA 3W64A 3F72A 2CQ0A 2ZJQQ 1NK7A 2G9WA 3PG9A 4JI2J 1HBUA 3IR7B 1QSSA 2OTJS 3RYPA 1CJVA 4ZVEA 1S9EB 1KQKA 3KNAA 1VTNC 3CDUA 3OTBA 1X3ZB 3FXQA 3VSKA 2PEBA 1FA0A 2ZSIB 1HKTA 1D1UA 1ORKA 5IV4A 3TX0A 4HF1A 4LF5F 1HBNA 1NXIA 4D7NA 2XB0X 3M8ZA 2HHSA 2EFQA 3DRPA 3CJKB 3EXCX 4LQ9A 4AQYJ 2F4VF 4CO5A 4DR6F 1B64A 4W1UA 4PZJA 3VHQA 1RT6A 2M5YA 3ENVA 3CD5A 3OR1A 1IN7A 2KYXA 2DFEA 2PMUA 1BQMA 1LK5A 4PG5A 3SSQA 3PJ9A 3RQ4A 7AT1B 2ZHAA 1FJ7A 5CVIA 2PT0A 1D5YA 4BXUA 4M3FA 3EUHC 3MEKA 4OZ5A 3DEUA 4EZ9A 3G4SS 2B4PA 5JLXA 2LQJA 4NWBA 4J37A 1RBLA 4Y65A 4KBIA 4DFJA 1RWOB 2O3FA 2IAIA 2BJEA 4DL2A 3FZ2A 5EEAA 4USVA 4ID8A 2NVTJ 5J8CA 1WC6A 3GU0A 3K4MA 3E97A 2GIRA 1N52B 4E8UA 2CU7A 2AGQA 1U1PA 1JLCB 3O3KA 3UD3P 3D66A 1J0RA 4P74A 3E3XA 2VOPA 2LVWA 1XB4A 3IG1A 5HDGA 2K9NA 1YZ6A 1R0BG 3W6JB 4RW7A 4OX9F 2GO9A 4OX6A 1T56A 2DO7A 1NDCA 3ABTA 3U21A 3FCHA 1TFWA 2IS6A 3A3OB 2LOOA 4JOMA 2QQ9A 3K4KA 1XMXA 1S57A 4ZP8A 3KK3A 1JLFB 1REGX 3NNHA 3RBZA 1QA6A 1QQIA 2CPXA 2D3O1 4Y2CA 1PAUB 5E41A 3P8BB 1HPZA 5BPDA 1UHWA 1J5EJ 1ZAOA 4LOCA 2GGPB 3LWMA 1DGWY 4P2FA 1U5TB 2BR0A 3GFLA 3V4IA 3CUQB 4K4XA 4PWUA 2EW9A 4YB5A 3V81B 2K1RA 1WWXA 3RB4A 2ROGA 4EO8A 1U2CA 5D77A 3G2BA 1WJBA 4QU6A 2D74B 3TA1A 4XICA 3EYYA 3BSAA 1E2XA 2R5YB 3SCIE 1JGSA 4KTQA 3KZYA 3I9ZA 2NXEA 2O67A 5D4LA 2E1RA 4CUGA 4FYXB 4D3HA 6FDRA 3EQLF 3QO9A 1RWPB 3MZYA 4ECVA 4C4WA 4K8RA 1UPPA 5KFRA 4B09A 4A8XA 3DKYA 3NRVA 1JLAB 1U8SA 2VT3A 4XO0A 2WB4A 2FJWA 2N7CA 2W82A 1VJWA 3Q9SA 4TU8A 2OCEA 1V5IB 5KNLA 3S15J 2DXIA 3HRMA 3VPRA 2FTRA 1R4MB 3HSRA 5KFKA 5CVUA 5LHIA 2HVEA 1R8CA 1JKQC 3ERMA 4IOCF 3IO1A 4I67A 1CF7B 3I9V9 2HGMA 4UY85 3WX8A 4L0ZB 1AWCA 2CFOA 2F40A 2SXLA 5CYVA 5C42A 3KUHA 5EWFA 3M8PA 4OYXA 2EXUA 4HQMA 1IXKA 2LU2A 2LREA 3MQ0A 3TP3A 1DHMA 1C0TB 1PILA 4GKJF 4DW6A 3CT9A 2OZ6A 4L74A 1VLOA 1LDKB 1TV6B 5CCMA 1FRMA 4ECRA 1U4BA 4OHWA 2NRAC 4DJBA 1MKMA 2W1BA 4WTYA 1C4AA 1Y3KA 3HPGA 4U95A 2HHTA 4NLDA 3TP2A 3ILLA 1R1VA 4E7JA 2UZKA 1Y39A 2V2KA 4QZVB 1E3OC 1X5PA 1RB0A 2AJ0A 3M7VA 3ECOA 1ZTWA 4Y52J 3FEZA 3QATA 4F0KA 3OIPA 4C8LA 1B1BA 3ZQGA 2VG6B 2V4RA 3ZMZA 5TJJA 2KHDA 2W85A 4G7OF 2XYGB 2BJ1A 2XMWA 2Q66A 3ZP5A 3JSRA 1V5EA 1BA5A 1IWGA 3ZN1A 2BY0A 1VQMS 2XF7A 3WX4A 1T3OA 4DPTA 1D9AA 1BR4A 2ALZA 4A2UA 3V6HA 1REVA 5LGUA 2V79A 1SJQA 1UJ4A 1NKCA 4X62J 4NZ6A 4J00A 3I64A 4BAYA 1UTAA 4AXIA 1JWWA 3T1YF 4XM3A 1CJVB 2G1HA 4NYOA 2VPLA 2RREA 1OQ6A 1UEKA 4ZA1A 1FEXA 1ZM4A 2WBRA 1ZH5A 4B3OB 4XR6A 1EKEA 5JUMA 1WUUA 4ENKA 1FOKA 4OJ1A 4CO8A 3HUGB 3DRPB 1YX3A 4A3MJ 1DARA 2NSCA 2DYSH 4CNYA 4CNZA 2UUAF 3QWUA 3BQYA 1RT6B 4JBAA 1G6BA 3Q8SB 3OR1B 1OFCX 4MK8A 1AUDA 5L3BA 3TDZC 2KVIA 3ZGKA 3VGTA 1HKAA 2QMXA 3AQOA 3BR9A 4HF2A 3HM5A 3JXOA 2FRHA 1YZ7A 3EYZA 2KHMA 1NSAA 1OISA 5BS6A 3IGVA 4KO0B 4NXNJ 3QT8A 4XLCA 3BTIA 3PFYA 1EH8A 2ZXHA 1N4LA 1BGXT 2HDWA 2ESHA 4LF4F 2XMVA 1B0PA 3DC2A 3C2BA 3GFZA 1NJZA 3J7AO 2BKPA 2DQRA 2LR8A 4KFBB 5EGYA 4C9YA 2XCPA 3R97A 3H36A 3NGTA 2EK1A 4L18B 4ED7A 5HANA 2FLNA 2RNJA 2AT1B 4F4ZA 1LWXA 1WTBA 3OYFA 3LSMA 3OYGA 3DLAA 1IZ1A 2ZC3A 1ZLKA 4BCAA 3IG1B 1Y1VJ 2BANA 4JYAJ 4F55A 2R9LA 1W7PD 4YHHJ 4A8SA 1LEAA 4NLRA 5CQEA 1W36D 2J76E 4ZPAA 1Y10A 4KMUX 1IW7F 1RCXB 1SIWB 2QT7A 3PYFA 2D45A 2DMNA 4BL0B 1GNKA 1FWLA 3UD4P 1MU2A 2FA5A 4LRAA 4FP9A 3PFEA 5CPRB 2BE5F 3CCEI 1SH0A 2ICWG 4P75A 1YJ9S 2GBYA 5FKMA 1CGPA 4RGUA 4OYIA 1HPZB 1L3VA 1R9TJ 2ZBPA 3PZPA 1IRXA 4KHRA 5K7FA 1KONA 4AYBN 2X6XA 1P7IA 3V4IB 1DAXA 4DPYA 4JI2F 1RU1A 1JTXA 3LMMA 4A3KJ 5IFMA 2R7FA 1Z7UA 4KPYA 3MGJA 3MFHA 5BMZA 4KICA 1TQPA 1R8PA 3MM8B 2NS1B 5BXIA 3I0RA 2UXDF 2OPTA 5HS8A 3LGNA 2JSCA 2I38A 3SXLA 2AHQA 4EJTA 2M0GB 2M5WA 2R7QA 3FJ2A 3DKDA 4M9XA 2BV6A 4AQYF 4DX7A 3GLXA 4C98A 2OMOA 3W2VA 2XZTB 4Q2LA 4XAKA 1HA1A 3H9JA 4PQUA 1K79A 2F9JA 3ZQ7A 3DXSX 2HFNA 2NYHA 2ZJRF 4E7IA 4NEYA 3GYGA 4LK1F 5E1XA 1WEZA 3DHXA 4E70A 2V1UA 1MWQA 2ZHBA 3BPVA 3OS2A 1FVQA 3R4KA 1V3RA 4C9DA 1YI2I 1RZ4A 2DNRA 4NPOA 1IN5A 4ZJZA 1WC3A 3FKJA 2H54B 2DK5A 1YIJS 3C46A 1JGGA 2Q8KA 1XDUA 1Z3YA 2CJYB 1UVNA 1G3SA 1FRXA 5C5JA 1W1WE 1IRZA 2DPDA 2R7DA 4ESFA 4UB8C 2OF7A 2H1KA 3GZ6A 2STWA 1H74A 5CD4H 1YOVB 3AG3H 3DDIA 2GA2A 5C42B 4DV4J 2QG9B 3CD0A 2HWTA 5GPAA 1Q8BA 3M2RB 1DU0A 1SXLA 1X1AA 4DL4A 1DTQA 1MBJA 4GVLA 3ASNH 3TAMA 4WXWA 1XCBA 2VQEJ 4BXXJ 1T39A 2BQ3A 4FKYA 2VD3A 4A47A 2F5EA 3ZZYA 2MLKA 3J7YJ 1XMKA 1RHMB 1DBDA 4ANEA 4ENOA 4ZJQA 2W00A 5KFSA 3J80Z 1V3SA 2MY8A 3EUAA 2UVVA 1Z7LA 1HLWA 5D6GA 4OI0A 3TAPA 3NWSA 5AT1B 5BYRA 1LEOA 5F0CA 4I1TA 4L3KA 1C4CA 5KT2A 1QZZA 2D3UA 3HHLC 4KGVB 1X1DA 3MR6A 2B3TB 2FLLA 4S0MA 1J5EF 4A3FJ 1YJRA 4DZJA 2LMDA 2YWKA 3O3LA 2R8KA 4NXMJ 3OR2C 1MBGA 3BPXA 5LEJA 5CVJA 1IQTA 3M7GA 4XKCA 2LQ9A 4PXCA 1RUNA 3SSRA 2FX0A 2JA5J 4TNOA 2QSFX 4ZHRA 1OQ3A 5D15A 1REVB 4EGYA 2VFTA 4WK1A 2QYCA 5DCFA 1KSPA 5HVQC 2HLTA 5GTHC 4W98A 2IM2A 1MBFA 5KT7A 5E17F 5FB2A 3OYEA 4OV6A 2A3JA 4WKYA 3MFIA 3GJSB 1FYMA 1U45A 1IG7A 2MZJA 4RBOA 2M30A 1FCAA 2NS8A 3M1EA 4DQRA 2WC2A 4KY3A 4A6DA 4ZJOA 2J8AA 3RIRA 2BZ2A 2GO8A 1T6SA 2NNNA 1CC7A 3QLHA 4ZOSA 4LJMA 1FBQA 3SI8A 3C6UA 2XGDA 2DYRH 3BBCA 3G6XA 2JL9A 4HNVA 4M6XA 2AX0A 1XSDA 1RHQB 3SMZA 3EGZA 3G71I 1TW3A 1H9GA 4TU7A 2W57A 5DD8A 1N8RT 2X1CA 3QJLA 4QWCA 1XDSA 2VPZB 3CJTA 2ZKZA 4Q4ZF 2HIYA 5D4RA 3WG9A 4PKDB 2BX6A 1HXDA 1SUQA 1KU2A 2JN6A 1P1LA 1TUGB 4IQJA 1S9FA 3PRVA 3ZOBA 2DGSA 3ECHA 1YIOA 1ETKA 3C2GA 4GVBA 1WJ5A 1D1CA 4ZLJA 5A2QU 4CYUA 2TCTA 2M70A 3IV5A 1K83J 4BQQA 2XWXA 1BQXA 1EX8A 5KFLA 5EWEA 3RR8A 1IBCB 4WPAA 2HBQB 2EPFA 2XAFA 4HLXA 2OMLA 2YTCA 3ZXSA 4DDFA 3JAMY 4P9UA 4P7VA 1B99A 2BANB 2MD5A 2ZZMA 4CSWA 2KFNA 2QEXI 4J9NA 3TA0A 3HTSB 1C0UB 3LF0A 5IS2A 1P1TA 2QBYA 2XSFA 3QYBA 1U9OA 3CGIA 3NGSA 1X9MA 2EV6A 3RAQA 1UHMA 1MU2B 4LR9A 5HI7A 3VVTA 2GQ2A 1SQGA 1NJIT 4WE1B 4XPEA 1SD4A 2DNKA 2QGUA 4XQFA 3QBCA 5D0HA 3QT6A 5M3FJ 4UXNA 3PJWA 1NKBA 4YR2A 5B0BA 4ENJA 1YJNI 1RACB 2CAJA 4X62F 4NC8A 3KP7A 2JMWA 3GIKA 2V26A 3IRQA 4MTEA 2JRTA 2ZVIA 2CYYA 2GX8A 4O3NA 2YNHA 4KB7A 4IHWA 3I0RB 2GIFA 1RT3A 4M9SA 3D0GE 2O03A 4YQWA 2H8RA 4QCLA 2XS5A 2ISYA 2AQ4A 3RRHA 5KCMA 2WV1A 2WTFA 2VXDA 4FX4A 2CQGA 1YQAA 3DLEA 3DXBA 3COAC 1G59A 3E5XA 4CZCA 1IN6A 4F3QA 5H6QA 4AWXB 2MQOA 5FGMA 2KZGA 2B63J 1H8AC 3OLAA 4RS8A 2O8XA 5HMWA 4PQUB 4ZP9A 2O6GE 4K2JA 3J80Y 4RGRA 4LFCF 4WP8A 2EWNA 3SZPA 5J2PB 1MD0A 3J81Y 2ZMEC 2KG0A 1K9MT 5HBMA 2CQKA 1ZM9A 1SB6A 2RVJA 1ZM3A 3HTUA 2MLYA 4Z2YA 2H5IB 4QIEA 1VFCA 3B02A 2DDBA 4NXNF 2RRAA 4WIIA 1T08B 2UXNA 1LNQA 3BDEA 2F63A 4M6YA 2RS8A 3AODA 2R3VA 5F0WA 4LGWA 4G7ZF 1YO5C 2HZTA 2ADBA 2BW7A 1WRJA 2HVQA 4IQ4A 3JTHA 1HW5A 1QY7A 1O4XA 1JUMA 2M2BA 2CQIA 2YPZA 5IV3A 2A2DA 3HOVJ 4WFYA 2DVIA 1D3WA 2E1CA 3D1OA 1RT5A 4JYAF 2NQPA 2WK4A 5A8RA 5CA5A 4YHHF 3ZN0A 4MKAA 1X3WB 1P4AA 3H5UA 1VCTA 2HK2A 3QGHA 2CPDA 3K1NA 2LEPA 3N4WA 2ASLA 4IRDA 4LG3A 5F9LA 3LP1A 3JRGA 4M73A 4GCVA 4ELTA 2RIJA 5TGTA 3QIDA 3VYTB 3MR7A 5IT9Z 2DHGA 2H5EA 3MPVA 4F4YA 3H0PA 5ICCA 4XORA 3AB4B 4MK9A 4FF2A 5D6FA 1B0VA 3RTVA 3DTIA 4DSIA 3OHBA 2QL7B 3PW5A 2W24A 4OYZA 2G0IA 3POTA 1ZOTA 3CJQA 3GG1A 4RWWA 3OIQA 3CPWR 5B7WA 1EAYC 3CDBA 4Y3OA 4LBIA 2Y0MA 2HQIA 4XOPA 2BEOA 2KZMA 3GFMA 4C97A 1UL3A 2BHYA 2ZOMA 1ZTRA 2HS0A 4DOZA 1A36A 1XJWB 4DL0C 3MCSA 3JRHA 3H4BA 2I1RA 2E1MC 5E2QA 4C2MJ 3GX4X 1CJTA 4IH5A 4YP3A 4WYWA 1B72B 2YQ0A 2M8EA 4O3OA 4PK4A 4A48A 2FUG2 4BQNA 6AT1B 1S1XA 1RCOB 4U88A 2ZJRQ 1M5PC 3NAIA 2IBKA 5IPAA 2GA1A 2EKNA 4ZZLA 1Q4RA 2EBGA 4NDLA 5E3PA 5FD6A 3TYTA 3W9IA 3QLHB 1PAEX 3C6UB 1X4CA 1QPIA 3T19A 1TL3A 5I3UB 4DX8H 2VA2A 1VJQA 3GMGA 2TRTA 4R0JA 2ME6A 4DUZF 1FYLA 5FJ8J 4QOTA 2CQ1A 4B43A 4HDHA 5HVGA 1Z2ZA 1H6KX 3QWLA 2Y1RI 3CJTB 2KU7A 3A02A 3A4CA 4XLNF 1WSRA 4XLAA 1JXLA 1MMLA 3HBLA 1R31A 4DV4F 3V2UC 2KISA 4XLEA 1SUQB 3SFZA 4W4MA 2NVQJ 3OUYA 4OV1A 3CMQA 2Q0OA 4MMOA 2YNGA 6PAXA 1D8YA 5A6WA 2IT0A 4K50A 3EPIA 2XB2D 3BYPA 2CNNB 4Y2KA 2G7HA 1ENHA 4BS9A 5K8MA 4M63A 5C24A 1URNA 3DEWA 4GVBB 4OX8A 4G6DA 3KZZA 2K3IA 3P96A 2QA2A 4CYUB 5KOXA 2HW3A 4WF2A 5D0EA 4PJJA 5FROA 2OFGX 3MUVP 4OJ3A 1N34J 2I2YA 2IJRA 4CO1A 5IP7J 3WTTC 1FBUA 2XV4S 2AYEA 5B0DA 5ERIA 3L2CA 1RR8C 3JTOA 4BLGA 5B0CA 1FBSA 2LXFA 3CO0P 5KFEA 5J40A 5J2QA 2UUTA 4KV8A 1VOMA 2QC3A 3F3XA 3V42A 3WU1B 1R6VA 1KQ8A 2VBXA 3PUBA 1NDPA 1RTIA 4NXMF 1H89C 2ZC4A 2NNYA 3D0HE 1OR7C 3C7JA 3CXCR 3NEUA 2KT0A 3BGOP 4R0EA 3TRGA 2BYCA 1VC6A 1W4MA 2K8GA 3B4MA 1TKTA 2PQ8A 2VIXA 1V3ZA 3EVWA 2RNEA 2VKDA 2P81A 2HQ5A 3WZ0A 2F4IA 2OQRA 2ABYA 5GADJ 5B3SH 3KK2B 2YNHB 1G3TA 3ZQLA 1ZR4A 3FWEA 5KG0A 2XKOA 1RT3B 1D9DA 4BHCA 3FMBA 3VAHA 3R0JA 1ZZFA 2JQ7A 3OFGA 4HSTA 4I01A 3TX8A 4ETSA 4FETA 2MW8A 2OTLI 3DLEB 2DA3A 2X1EA 2WOMA 3GFIA 2IAJA 3SEOA 3BT9A 2QENA 2A07F 1WHXA 3H25A 4RBVA 5IZHA 2NXNA 4RUBA 2MSYA 1MH4A 2L02A 3E01A 3RZOJ 2IGOA 2CJBA 4OWRB 2OZUA 5HBMB 4EJOA 2R2UA 1NK4A 4CTAA 3JTNA 1Q8LA 5IT9Y 2JUGA 4FDFA 1FFSB 1ZK8A 3EYIA 2IJNA 4O44A 4LB5A 3TJ9A 5E3QA 1ZS6A 4WK8F 3RTRA 4UF4A 1JKHB 2NXUA 2RILA 4DL3A 4NYPA 5IOLA 2Y8WA 2E71A 2VPXB 1FNOA 4EJWA 3BGUA 5EZHA 3GTPJ 2RF2A 2MZTA 2MQLA 3G86A 3JRFA 1BHNA 2ZBCA 1OYYA 1WI8A 1VQPI 1GFWB 1VNDA 4ZPTR 3GYHX 5IP6A 5A8RB 2UV1A 1CC8A 1AYEA 4YOEA 1M5OC 3RDIA 2DY1A 4CM0A 1S7HA 5DQGA 2OFHX 1ITYA 1TT0A 4GGGA 2E35A 4N8OA 4GFBA 3KJVA 2XMMA 4LSLA 4JI7J 2DJIA 1LWCA 4MKBA 2DPJA 5BOXA 3A8KA 3KMQA 4JOUA 5DDGA 4AIDA 1OCZH 2IM3A 2BBYA 2X3GA 4PUOA 2AJ1A 2HQRA 3MMYB 4QIVA 1MW7A 4IF4A 1N0VC 3POTB 3CJQB 3FSYA 2QJ3A 1YI2S 1L3LA 4G1PA 2JZ5A 4J9SA 4NQWA 2H51B 1SKRA 2KTQA 4QLCU 3J7A1 5J8FA 3QYFA 4BWMA 2DNYA 3DHWC 1OYIA 3PO5A 1UFWA 5HO4A 2CNKB 2IJLA 3R2CJ 7FD1A 2A0FB 5DDRC 3VYUB 3HHEA 4V1Ak 1GX5A 1X4HA 5DS7A 5LGNA 1HHQA 2AEJA 1VLYA 4ON0A 2PC6A 1U7LA 2VJ4A 3KEYA 1U6BA 1CJTB 2IY5B 2F4OB 5I4MA 2NUHA 1HLVA 2BJ9A 3TVYA 1FTTA 1TC3C 2M7BA 1S1XB 2NOJB 3VOEA 2JEJA 4L5IA 2JWNA 1IUFA 3EDPA 4C2UA 1TT5B 3T9ZA 3IC7A 3E51A 1W5SA 3JB9k 1FK9A 4UOCA 4IRKA 4HTJA 4XKWA 2V94A 1AXQA 1YK9A 2GVDB 3M8QA 3HD1A 1DJ0A 1IBMJ 3R7NB 2HHWA 1LNWA 3AA9A 3MOJB 4EMSA 3UR3C 5CABA 2QFJA 2E1OA 1SANA 4ABZA 1H7XA 1YSJA 4UUXA 1WHUA 1Z0XA 3ZZTA 3ZTQA 4FT8A 1T0TV 3OUYB 1N77A 3O8GA 4ZLLA 2E5LJ 1R6YA 3ABLH 1YG2A 1U0JA 3OYCA 1M5VC 3UFCX 1QLNA 4FYDA 2P8IA 1KQGB 5FLXZ 2Y31A 3TJAA 2LP4A 3CUQC 5LLQA 4HVZA 4A3LJ 4UOFA 4OZ0A 5GAGI 1KLMA 3KLVA 2MZSA 1M1HA 3HL2A 1D8ZA 4PQAA 8ATCB 2QIFA 1MWYA 4LLGF 3M2VA 1D0ZA 4JI6J 3ILJA 4J9OA 1WC5A 1NUEA 4K4VA 5J2QB 1RBAA 2CQ7A 3GIIA 2AMCB 4EMDA 4BKXA 3KYLA 4FYWB 3SV3A 2J6SA 2UVRA 1X1PA 3FK6A 2ACYA 4H4KC 1HF0A 1FD8A 4CLTA 3GCMA 4AYBD 4A5MA 2MKHA 2M0CA 3TNVA 3G1LA 1AB8A 5B0FA 3ISPA 5ITHA 2XRLA 3G71S 1VR6A 2HXOA 2NZ4A 2CWEA 3CP8A 3H98A 4KT5C 3D3CJ 1Y0NA 2OV7A 1S76D 3G1MA 1EP4B 5AE1A 5J2MB 2DKOB 1X2NA 1R1UA 2QSFA 3DCAA 2QYOA 1LQ9A 4F04B 1Y1WJ 2M1BA 1IAWA 1B70B 2EB7A 1TKTB 3N5FA 4QIFA 2M87A 2QLFB 1BR2A 4CCNA 4ETXA 2P0WA 3AT1B 1XIQA 4UUVA 4NRUA 4G94A 3L7UA 1FDDA 4M3DA 1U3EM 5L1JA 3GTLJ 2XIGA 1SFXA 2Y8YA 3TUIC 2C2NA 3ISNC 3M9NB 3U1KA 1P4XA 5JXSA 3OVAA 4O4GA 2WAQA 3FK4A 4JI5J 3TUZC 2ZD1A 3V7CA 2CXEA 2WOMB 4OYOA 2IAJB 2BVMA 1LFBA 4LRBA 3UWTA 3EUKL 1P2FA 2DTZA 1TWFJ 5D5UB 4J9UE 2NXNB 3M3YJ 3VAGA 3PDNA 3TMOA 3LOUA 2JPBA 3E01B 3UDEA 3L00A 2ZITA 2HQCA 2R92J 2V8GA 4UHTA 1VRUB 4OIXA 4K7QA 1DZ5A 2CFXA 4OHYA 1RNLA 4F93B 4RW6A 2IS2A 1REPC 2STTA 4FKXA 2NVUB 1YKWA 4O44B 2M88A 4CO4A 2JTVA 3EWGA 1AKHA 5ADZA 1YJNS 2KIMA 2L4AA 4E7LA 2Z8QA 2GAHC 2UXXA 3LOCA 1LDJA 4D9JA 5AXKA 2EFGA 3MF5A 2K7LA 2OH2A 3I31A 1YYVA 3K2ZA 2RF2B 3M6VA 1N34F 1EH6A 4B4CA 2RQQA 3OOPA 1KGSA 2VL1A 3AB2B 1UEUA 4C8YA 1YDLA 5AIPA 4UNOA 4OMFG 2HQFA 3Q0UA 2NR0A 1IRGA 3ZZPA 5HP1B 1UWBA 2A6OA 2PEHA 4IX7A 4E7ZA 4XK4A 2E7VA 4DV6F 2IMWP 1S99A 4OU0A 3IUOA 4DZPA 2CH0A 3ULQB 5HROA 4J01A 3KJVB 4LSLB 4DS5A 1AA1B 3QPTA 1TQIA 2XYHB 2B4UA 3QNWB 1Q1VA 3I56I 1FT9A 2DGVA 1IR1A 4PUOB 1F5AA 1NSKL 1ETYA 4Q8FA 2OA4A 4LMYA 5GP9A 3BC8A 1OCCH 2V9PA 4IFVA 2IEKA 1WOPA 4UUWA 1IN8A 2VIHA 3L7PA 3OR1C 4O0NA 4NQWB 5ETVA 2XDVA 1TKZA 1IKVA 3PYGA 2KFDA 4BWJA 2M3DA 2A18A 2XGPA 1Z3XA 1N33J 3LAPA 2QN6B 5FFZA 2VONA 3G73A 3BO3A 3ZNUA 3E7LA 1JJHA 1BL0A 4L9TA 3TO9A 3R2DJ 2HFOA 4JV0A 4KIGA 3OYDA 2H8WA 3KP6A 4JK1X 2IBDA 5FLXY 3HCXA 2HEKA 3NGDA 1CPZA 2F8MA 5HQLA 1IXCA 3HSDA 4BACA 2M4MA 4IR9A 2IVFB 4ID5A 2KYZA 1HI1A 1GXUA 2ZXJA 1YJTA 5K5QA 3QGPA 2L7ZA 3Q8UA 4DG1A 5EHHA 1FK9B 3LP2A 1Q95G 2E9RX 2Z0GA 1C1CA 3OOUA 1FKOB 3EM1A 1F9HA 1KWMA 2FZKB 2XAGA 3GR1A 4I6AA 4ZVTB 2GV1A 1VZ0A 1WKMA 4R8UA 3W6VA 2IRXA 1RT4A 3SDEB 4DQ2A 3BSCA 2JLEA 3BPSP 1H2TZ 3RYLA 2IIHA 1OCOH 2HNYA 1R6RA 1FNMA 4R1HA 5L1KA 1SCJB 2HYGD 3C1DA 3VQSA 3HGGA 4ZDOA 3Q22A 2H94A 2M9HA 4J9QA 2QGFB 1ZAXA 3B82A 5CYJA 3HFVA 1FNXH 4TKTA 3FISA 4Q7AA 3MCMA 2VJUA 4JI7F 5E3AA 3ERED 2FHJA 2PE8A 1A9NB 1X5OA 3FCWA 1NPRA 3RW6A 2FPHX 1RWUA 1Z9CA 2V2ZA 4DEZA 3JSBA 4GYIA 2DR7A 4PRFA 2WSCC 2FQ4A 4Z7YA 2J7UA 3OD2A 2PEXA 3VEPA 3G8TA 5L46A 2ZZTA 4RNNA 1RZMA 4ZCIA 3U1MA 5BYSA 1S7AA 1PCAA 2CKWA 2DNZA 3VF0B 3T8RA 4YY3J 3K4JA 4IRGA 2FHKA 3DBRB 1UG0A 4BNCA 3W62A 2WRMA 3U1NA 1HWIA 3GYNA 3LFUA 2W2QP 2VC1A 5HDNA 1WKLA 3EMTA 4PSXA 2VFSA 1LV5A 2BW2A 3M32A 1DU6A 1WWHA 2HEOA 2OPRA 1S6QB 1B59A 2HQNA 3KHRA 1UZDA 4UTGA 2RMLA 3KLHA 4DFPA 3LWFA 2NPFA 2EK6A 4O4GB 4G3IA 4RGXA 4N9HA 1FDBA 4ILRA 2H6BA 3B54A 2MKYA 3B6BA 3AG4H 2U1AA 2M4KA 3UQSA 3E6CC 2ZD1B 4M8LA 3BQ0A 4KGMA 1XNQF 4ZCMA 1FIPA 3G8QA 4TYAA 2B8QA 2EWHA 1V5VA 1VI0A 2A6EF 1GTHA 1ZM2A 4ZVGA 4UB6C 4GC7A 3MN2A 3F21A 2J9CA 1RPWA 3GFYA 2R8JA 1RT2A 1FD2A 3A3NB 5ETLA 4JX6A 4RM3A 1YITI 3NNAA 4RW6B 3CCUI 3LP0A 4CO2A 3PNIA 4F02A 2CZ9A 3BY6A 1A6IA 2E5LF 1SFKA 4C8NA 4ZVOB 1NEEA 3PNVA 3OYBA 1AKHB 2RQKA 3P5BP 4OI4A 4KYZA 3K0JA 1X5TA 3KKFA 1BIAA 1ZELA 4IDKA 1TMJA 3MAHA 3JQKA 2KRCA 2P7CB 2MH2A 4C3KA 4YB1P 4DX5A 1S7EA 1VQ4S 2FVSA 3DRYA 2QF7A 5CXTA 2ZH5A 3D6HB 2V9WA 5M5WJ 1F2HA 2ZKUA 4JI6F 1ZRCA 4ZVFA 5D4PA 3S1MJ 5F08A 3F8FA 1UWBB 3HPOA 4BQAA 4QQBA 1I51B 3EGVA 2JVHA 4DUYJ 1NMEB 1NK5A 3HIFA 2GCFA 1VK3A 5HROB 2HAFA 2D9OA 3MWBA 4M5NA 2JZYA 4YFNF 5HL7Q 1OPZA 1OQYA 2G2OA 5JR3A 1U6GA 3W5ZA 5K20B 5SUHA 4P9FA 3DMJA 4ELVA 1XTAA 2DISA 2KHCA 2G2YA 4PXDA 4PG8A 1TAUA 2DPIA 2DRBA 2PN6A 4Y7NJ 2L9SA 1GXLA 4Y4RA 4MYTA 3ZXWA 1Q79A 1LEBA 4ED4A 3KETA 2E2IJ 4YDDB 1FP2A 1NH3A 1AW0A 1U1KA 3GZ5A 3P45B 4IO9Q 4LT6A 4D0PA 4OLPA 1TKZB 4HRIA 1IKVB 2KIUA 2LF7A 4ZDNA 1RT1A 1NPKA 3EPZA 2MY7A 2XAHA 5HMZA 3DPLC 4RAGA 4ESJA 3UNGC 5D0GA 2XF6A 2JC0A 2C3OA 3I82A 3GO5A 2DNOA 1JJ8C 2P5VA 3BTLA 4JUZA 3BJYA 1TL4A 2FNAA 1NB2A 3BZQA 2RGVA 1IJFB 4I0BA 1BR1A 4OZ2A 3T1AA 2WBMA 2XLJA 2CJQA 4RGSA 1A04A 4NE9C 2LP0A 3DPTA 1RE1B 2GIQA 2A05A 3VGUA 1NG7A 2FNPA 1S7IA 1HQCA 1DQ8A 2V1NA 4ZDLA 4ID5B 3OL7A 5D8LB 1KC8T 2QCOA 2MLZA 4CO3A 2IRFG 1FE4A 4DG1B 3MI7X 3LP2B 4OZ1A 2FBIA 4YUDA 3HHNB 1C1CB 1S9GA 1X60A 2AJ2A 4K5SA 1Z91A 3TA2A 2YUSA 3PM1A 2ZH1A 3P5JA 2QUFA 4R8UB 3HHLA 3CCSS 1PG5B 5CLSA 3TZXA 2Q6CA 4U0VA 1GMWA 2PA8D 3QGGA 3CEDA 4BE0A 2DGOA 2WV0A 2HNYB 4YIIA 2KT2A 1RLDA 3S14J 3Q5FA 3RKQA 1SFEA 4C7QA 4XSZF 1W36C 1VQ7I 3BG3A 4P6QA 2NUUG 2ACJA 1SI9A 4BDPA 1ZRFA 4C2MA 2ZFWA 5ETNA 4DR3J 1TR0A 4X6AJ 1WHVA 3H1CA 3BKUA 4LR7A 1A5JA 5ED4A 3CCRS 5KFFA 1T2KA 4ZTFA 3ZR8X 4HEA2 3QPIA 3IAS9 5KFVA 3UDLA 2X1AA 2Q1LA 3MZ8A 4A8WA 4ES3A 4AUKA 3BO4A 3KEQA 3F44A 3A2KA 3A01A 2MLGA 1FSEA 1SC6A 1YX2A 1XMOJ 3I4HX 4DSJA 3DGPB 1F5BA 4YELA 2DJNA 1D0XA 1S5ZA 3HRTA 3K5LA 4TY8A 5FIIA 4EBCA 2W4SA 3HYIA 2XHCA 1T03B 1JT6A 3DKXA 3H9GA 3CJ3A 3OLBA 2N3LA 3F9KA 2H4YB 2F5VA 4QPOA 1EQ0A 4JQFA 1F4KA 3R5GA 5CJ9A 4F2SA 4KIAA 1PYTA 4HHHA 1S79A 2BYVE 2OPRB 3AAWB 1TWAJ 2D3ZA 2HKEA 3FM5A 3BBFA 4C3MA 2PMHA 3KLHB 2WCXA 4TLRA 1Q7YT 4RR5A 3Q86A 2HQAA 5CVRA 2VPYB 4KGZB 1TFYA 4CRJA 3FXJA 2GHPA 1PDNC 4CLKA 4CM2A 1ZG5A 5FO5A 3VYRB 3MKLA 4F7ZA 5DG9A 3MCOA 4P9SA 4U0WA 3DLJA 5DM6F 5H20A 3PIOF 2HOEA 4NA3A 1W5CC 4LF7J 2A2CA 2F5CA 2RQPA 5DGBA 4BXFA 3KUGA 5DUIA 1K6OA 4RW4A 1V6HA 2P9CA 2L5QA 1IKWA 4ZPCA 3ROUA 1VK8A 1IJWC 1JLGA 2OPQA 4RNMA 3KDOA 1RT2B 1TL1A 4F26A 3Q23A 2Z5UA 2IDLA 4ZH4F 1U8BA 4DFKA 1LOUA 2ZVSA 4X4TA 1GX6A 4ED6A 1EQMA 2FC8A 2OEKA 3M2UA 1R7JA 1X19A 1K4SA 4RW9A 1LW0B 4A12A 3JTGA 2G0CA 4AC0A 1S1VA 3C3WA 4O23A 3F73A 1PJ5A 4P72A 3PEJA 1EF4A 2L9NA 2GOXB 4DQIA 3KE2A 3HHHA 3CIZA 5AE2A 1YTYA 1NK8A 3DFEA 2DHAA 3NAHA 2J5PA 1XTZA 1IQZA 3DTKA 2C3PA 2AEFA 3I58A 5BNGA 5MLCV 1W26A 2HZVA 1VS3A 4I0WA 3MD3A 4V2GA 1MJBA 4AIHA 1V3FA 2CW0F 1P92A 1CJUA 4RUCA 4AU7A 1PUEE 2MJNA 5LMNJ 2HZCA 2QLWA 2BZTA 3OT9A 3DMJB 5HN0A 2AGPA 4YY3F 1U2FA 3KX2A 1TUWA 2BA9A 2FC9A 4OL8A 3HOWJ 3PCOB 2ZMEA 4KRWA 4U6PA 2MC4A 2LBFA 2N7YA 3BR1A 1S6OA 3H5NA 2RSQA 1GLNA 4J9MA 3CCLI 2VB6A 5J6XA 1XBWA 4K4WA 1X58A 1O57A 2ROEA 2V7FA 2CQPA 3LSHA 2POKA 2HI3A 1GXTA 1L3KA 1HW1A 1XS9A 1U1MA 3Q2TC 1T9YA 1KDNA 3PFIA 2RN7A 4EVIA 3GR0A 1XN9A 5ICEA 1IKYA 4HACB 5D4NA 1HQEB 2ASDA 1OYDA 2CPZA 1VMBA 1JIHA 3M05A 3MPYA 5GMDA 2LKSA 1WZ2A 3GVAA 2HVSA 2H5JB 1DP7P 3ZZ0A 2YKMA 4DHVA 2DEIA 5IT3A 3MEDA 3I5UA 4BDYA 1FVSA 2YWEA 5GAGU 2GZOA 4I02A 3MDFA 2F4FA 2RB7A 2CJJA 4IOAF 1BW5A 3P49B 3TOBA 4G9YA 4MFDA 1UA1A 3KNGA 4V19J 2X6OA 4WBFA 3G6YA 5DM7F 3EZOA 2JOQA 1NHAA 1ZAWA 1NO8A 1KA8A 1V5GA 2XMKA 2VLAA 2L9DA 2R7ZJ 3OTCA 3PW7A 3HHLB 5E33A 3BO2A 3MEXA 3TJ8A 2B0LA 3O8HA 3NS7B 3N28A 4A4JA 4ZVPB 3D54A 2W9CB 2IC3A 4GKKJ 3G82B 3QT7A 3AXMA 1KYWA 1T02A 2D5VA 1Q7LB 4AT1B 2B51A 3ABMH 1Q86T 4DU7A 3AJDA 5M5YJ 1H7WA 4XRMA 3OXFA 3I5BA 4BC9A 1GUUA 3JAMK 2X48A 3FDSA 4ECTA 4B48A 4Q43A 2RT3A 2C2DA 1N25A 3C66A 1GHCA 4DUYF 2K9SA 4PWDA 3IAS2 3BEGB 1HDDC 1JJ4A 4B3SJ 2LEAA 2NSBA 3TO6A 2OD6A 4I2PA 4CLSA 2CG8A 3T9NA 3IKTA 2VKRA 2DK8A 3S2HJ 2FGOA 4KGXB 4B8XA 1JX4A 3A01B 4MQVA 2HMIB 3W8PA 4TY8B 5L39A 4CQ1A 2HZDA 1AHDP 2GW8A 2DYAA 2PGCA 2V6EA 1Z4UA 1ELOA 4USUA 1D09B 1WJEA 1FOXA 1PYOB 3TQNA 2PFFB 5J3LA 3HKZA 2X9DA 4CH1A 4A5NA 1VYAA 3F8BA 2WB1A 3IAM2 1UVIA 4YR0A 4FVMA 2QL5B 3O1LA 1N5SA 1ZAVA 3M6UA 2WY8Q 2HOTA 1DUXC 4H4MA 4ATNA 4TU9A 2G1DA 4V2FA 2F7VA 3GE9A 4X4UA 3IRRA 1G8XA 1A6LA 3BM7A 3GSIA 4A8QA 2DA4A 2MYSA 4DU8A 1L3UA 3J80K 3THPA 5KFIA 3D0IE 3J81K 3HHKA 2W2OP 1LJ9A 3LW5C 3BWGA 2ZH9A 4BY1J 3HKWA 4IKAA 3PX4A 4RW4B 3O2IA 5J1YA 1IKWB 4J19A 1WD6A 3BROA 1JLGB 1XMQJ 2A3SA 2OPQB 2YU3A 3FCVA 5LJ5Y 4P7TA 1VQLI 1NHKL 1TL1B 1O0PA 3SQGA 1BOBA 1ROFA 5KG7A 5CHCB 2P5LC 2JA8J 1I3AA 3D1NI 1BE4A 1OR7A 1T8IA 1JNRB 1U1QA 2HPUA 5L1LA 3HOUJ 2B9XA 5LHHA 4FYYB 3S2DJ 4RNFA 4QPTA 4RPFA 5IYCJ 3M8EA 2HBRB 3M2UB 3Q83A 3CCVS 2ILYA 4LSNA 4RW9B 4X4RA 1MNMC 4TQRA 2W9AA 2WTEA 2BQUA 1K47A 4JI8J 1SMTA 4HOBA 5K1YA 3GTYX 1T9XA 1RUSA 3AOAA 1S1VB 4DR3F 4CYDA 2DO0A 2MKCA 3D0SA 4OAZA 1FEHA 4DF4A 2ZE2B 3BSOA 1NB7A 2VUGA 1MH3A 2HWHA 1DQ9A 3CMAI 1PC4A 4XBFA 1FSHA 3V7SA 2VJ5A 2Y0SA 1S72S 1KVJA 4OZJA 3DBHB 1XQIA 1TZ0A 4GYGA 2WSEC 3R1LA 1CJUB 1RWKB 4NZ0A 4ECWA 3RAXA 2M34A 3NMRA 4G1QA 3HDSA 5ETSA 5IQQA 5DZ6A 3UO0A 5DS9A 1X31C 3DDNA 2XKPA 4Y17A 4B44A 1LB2A 4DL5A 3JREA 3S01A 4V19X 4Y2MA 3E8OA 4CCKA 5E3NA 2ZMEB 2Y3YA 2M8DB 2Y30A 4XIDA 2OSQA 3I3LA 5GADU 4XNFA 3D3BJ 4MKYA 2E60A 5KFZA 1NPPA 2VH7A 5D8HB 3HZEA 2PBIA 2JVOA 1FJCA 2D1CA 1RHKB 3S2WA 4UOHA 2YH1A 3CCZA 2X6WA 3QQCD 1XN7A 1JXVA 2RE1A 4U9RA 3W1YC 2HHHJ 4B3TJ 4OIOF 2HGCA 3EUNA 4G7HF 3ELHA 3HSJA 4X4VA 4ENMA 3HKZN 1FO1A 2ROPA 1YVFA 4FXDA 1IKYB 2G7UA 3EVOA 5DM6Q 3PIOQ 1OY9A 1RQ0A 2DCLA 3OV7A 3KK1A 3AAFA 4LF7F 5DO2A 4BY7J 9RUBA 2LLZA 3TKYA 1C2PA 2RQCA 3MEDB 1VHIA 4LVOP 3VV2B 4OYMA 1KP6A 1Q5VA 3IR5B 2JA7J 3L2RA 3JTPA 4MIBA 1Y4ZB 3L95X 2HBZB 4B3RJ 5DCMA 3MUMP 3CJRA 5SZTA 3R6SA 2EBIA 3N6NA 2R8IA 4ED8A 2CJ9A 3QT5A 2XPUA 3F0NA 2WVBA 2CS3A 4XLPF 3BP8A 2JEGA 1SBRA 1TLHB 3I71A 1WEXA 3MAAB 3CJKA 2ZH6A 2AYMA 2IC3B 3JR9A 5FLMJ 1SKSA 1R89A 1M90T 2W48A 1CULA 3FRYA 2OPPA 3TI0A 4UVAA 3S3NA 5EEGA 1VQ5I 1HWKA 2X7IA 1U0SA 2FE3A 1KNZA 1XK8A 3R5BA 5TISC 3RPUD 3ZQQA 3R5AA 3PKYA 1R4NB 2HK3A 3KHHA 4C8KA 1UCRA 1TZLA 2BY2A 1OLTA 4PWDB 4XL9A 4BBYA 2E1MB 1Y5LB 3A12A 2PSZA 1CQNA 5LMNF 4MEYF 3K2YA 1N5TA 1H88C 2LQBA 5FD1A 1HBMB 3GTQJ 1P9YA 1VF9A 4X64J 5GMEA 3CWJA 2XB5A 4KQZA 4G12A 4UV9A 1JLCA 3QPHA 1UVKA 2ZOFA 1WKJA 1OIAA 2DR9A 4MFBB 1MSWD 2V63A 3A8JA 1FJEB 2HOAA 3SCJE 3DGVA 1WC0A 1S1WA 4BJ5C 2VZ9A 4L9VA 1BD6A 3SEZA 2KH9A 1N36J 2ECCA 2M3AA 4MTPA 1R36A 4C11A 4BJTA 3UVJA 2HS5A 4BHQA 1KRPA 3H0DA 2YX1A 2K7KA 3CMES 3RBEA 1NLKL 1APSA 2BE2A 2O1PA 2PMWA 4H4MB 4WFBQ 2DNMA 3HSFA 3G96A 3ENQA 1DY3A 4B08A 3GPAA 2DT9A 2NREA 1UVMA 2CDRB 4D5CA 5EEHA 4IOAQ 4BBSJ 2HG4A 2HRUA 4DCPB 3V81A 3TEHB 2CNOB 2J9DE 3DP7A 3LSGA 1OS5A 3FXRA 2GA7A 3P4UB 1TAQA 1W7WA 5DM7Q 1RAJA 4C3LA 4A0YA 2X1FA 2YWGA 2XCAA 4K5RA 4K0KJ 4EZ6A 2CWKA 5IT9K 4PG6A 4K4TA 2MXYA 2R5YA 5KFCA 2HTJA 1RTHB 3KTQA 4PJ0C 2PD1A 2MSSA 3VWBA 2ZJ2A 1ICEB 3OVBA 2CVIA 5I42A 5D4SA 4GKKF 3PO3J 1UCNA 3ILIA 1VQNS 3ITHA 1MBKA 1IR0A 1K78A 4QIWN 1U47A 1IN4A 5T7LA 2HYFA 4CGZA 4G8XA 1CQTA 3H7HB 1IUYA 4DBQA 3CZ6A 1NKEA 4LSNB 1GK8A 3N6LA 3ZO7A 4CCOA 1VDHA 2E9ZA 3PSIA 2BQRA 3W2AA 3R5CA 2IA1A 1Z6TA 1UJ6A 3MPWA 2HNZB 3CSKA 4Y33A 2MZ1A 2R8HA 3TO7A 4B3SF 3DOLB 3CDEA 1CF7A 3AL0C 1MGTA 2WAEA 4ZCKA 3GTGJ 2GS8A 1YS6A 3V8JA 2Y0BB 1MROB 2M7SA 3K1MA 5HMYA 3BR6A 1QGPA 4DSEA 3Q8VA 3ET6B 2WZ1A 5JVHQ 4Y3CA 1IKXA 4X65F 3U7JA 3GONA 4DJAA 2WAFA 3IR6B 4G1QB 3I55S 1CJKA 3EJMA 2XTJP 4RBUA 1TV6A 1JTYA 3PW0A 2EJRA 2QLBB 1ETVA 2YWHA 1Y0UA 5K8OA 5A0YB 1MWZA 2LFVA 3AH6A 4NLOA 5KFNA 1BM9A 2ZOGA 2W9BA 3N4MA 2FVQA 4NC6A 2L7FP 3SSSA 5JFRA 5JVTA 3M1CA 2FEZA 2UP1A 4WZMA 1O3QA 4JBCA 2C3YA 3O2PE 1SC1B 3PFOA 4LJZF 1QAYA 4KN4X 4FZVA 2J0WA 3DU5A 3K5NA 4WU2A 2QSGX 5AE3A 1V54H 3W8GA 2XS7A 3WTYC 4TVAB 3X3UA 3CDAA 2CJKA 4DV2J 3BJ6A 5E1ZB 1R71A 3LSTA 1I1GA 1OKRA 1UA0A 2JVRA 4F4WA 1HIYA 1HBOB 4CXFA 2ISZA 1TK5A 2GMLA 2F8HA 3KK1B 4KDPA 2JJ7A 1F36A 5LOQA 5K5MA 1N32J 1ZGWA 2B0GA 1DQUA 2OKQA 3PQJA 1WDDA 2HS4A 1USSA 1N5YA 4DZDA 1WGXA 4FPIA 3DRRA 2QA1A 2LY1A 5DETA 1XMQF 2E44A 1QJHA 3F8MA 3TO8A 1TBXA 5JI6A 2LQ5A 3AQPA 2F9DA 2ELHA 5DCMB 3CJRB 3E5UA 3GBGA 5GAHI 4CCJA 2A61A 1WQ2A 4RL1A 4FYVB 3L2QA 4LD5A 3PVXA 2R42A 1SFUA 4CLYA 1BMQB 2CUZA 4B3OA 1YLXA 1D8JA 1BWVA 3DLLF 5B1AH 4Z37A 2LD5A 3I4PA 3HUGA 3UW1A 3MPDA 2XC9A 4BEHA 3PJXA 4KIFA 1SMYF 3HX9A 4USWA 2FVPA 2PO4A 3EICA 1ODDA 4DV3J 4DPOA 3V6DA 1W2IA 1XG1A 3GTJJ 3D5SC 1CULB 2OPPB 2LY9A 2RNGA 3LA0A 4WF9Q 4C0HA 2N82B 3VAMA 4I7HA 2GFFA 5D5XB 5HATA 4XDDA 3CTRA 2P7VB 2B4VA 2LKPA 2V1XA 4MFEA 3OWTA 4ICLA 1VBZA 2LU1A 1P6RA 3ZTRA 2B7CB 4ECQA 2HRTA 3PX0A 1EJ9A 4KO0A 2MQQA 1NG6A 2CRGA 3P9KA 3W66A 3HG9A 2PI5A 2EILH 2RDPA 5KT5A 4ED3A 2GMJA 2DITA 1Z77A 2FVCA 4JI3J 2V4QA 4YB6A 2CQXA 2Q79A 1JT0A 1FRKA 3B78A 4KFBA 3QPLA 2KJWA 3A1YG 1AUSL 4PABA 2CPHA 4RO0A 2CNLB 4IQXA 5DLGA 1FXRA 2DMPA 5HJXA 5L8RC 2YU9J 2EIKH 2M45A 1S1WB 1Y7PA 1HC8A 2CUFA 1SQEA 3WIUA 1RTJB 2W2NP 2CGPA 1OO0B 1H38A 1RKWA 3DDKA 2C2OB 2HHHF 4N7TA 4C11B 3UVJB 3IBCB 2JNJA 4GXOA 2HURA 5E3LA 5C25B 3MM9A 1YG0A 2HAIA 4WWSA 2ME0A 1R43A 2BE2B 1RP5A 3BTCA 1JQGA 2R7XA 2KRBA 4ER8A 2G2ZA 3IH4A 4C8ZA 3T5KA 1S77D 2JEIA 1RAGB 3FMRA 3FX3A 1FF2A 2CPEA 2XMAA 4Y13A 3NGKA 3G6EI 2ZUAA 2FSWA 1F2GA 4ITVA 2HR3A 4B3RF 1KTVA 1S48A 1HR0J 4NCAA 1H72C 3FXMA 1NM2A 3C6TA 3NCPA 1DPUA 3MM8A 4BE1A 3OYKA 3PV8A 4MT1A 4X66J 4X4QA 3OV8A 5M2UA 4NASA 2L7MP 1BN5A 1M1EB 1XC9A 3FEXB 4YN3B 4OJGA 3K0LA 1AU7A 3BDDA 1XCVA 5I42B 1MNDA 2K85A 3ITHB 2HYIB 1K78B 2L08A 3FBIB 3SZ2A 2VKEA 1X4FA 5T7LB 1FP1D 3IWNC 2XI2A 4X2BA 1SL1A 3T3FA 2VQHA 4UUTA 4KKOA 5AXNA 2DTRA 3TGNA 1D1BA 3UNYA 2W7OA 1NJXA 3RQIA 3I0SA 4N9IA 4I56A 1S0VA 4OZNA 4L9JA 4K4ZA 5J2NB 4N4NB 2FJBB 2UUBJ 3QZ8A 3IS9B 2A68F 3OFEA 2KZVA 3CD6S 1AFJA 1RA7A 4X64F 2HPIA 1D8KA 4G1IA 5L9XA 2A10A 5FKLA 2AX1A 3M2RA 2WY7Q 2AIRB 1IKXB 2BMBA 4OQJA 2R4FA 2BJ7A 1WI9A 3MR5A 1M5KC 2DNHA 3E5QA 2J5AA 2RH3A 1CJKB 3CJSA 4IEJA 5DV5A 1EHWA 1N36F 2GJIA 2GIVA 4N76A 4HX4A 3KWMA 2C22A 2W9BB 4LFAJ 1WTFA 2X1GA 2HRYA 4FE4A 3ZZUA 4N56A 2EA4A 4CLFA 5DRKA 4ZZDA 5ETOA 1T05B 1TTYA 1WJDA 4JV2A 4RB2C 2ZBRA 3FXKA 5FLXK 2DXFA 1RTZA 2VFRA 3HVTA 4JI0J 3RSNA 2K2PA 1E17A 4ECUA 2W7NA 4IH7A 2AYGA 3CJNA 5DG8A 4I99C 4BS2A 2VG7A 3BCBA 1BLUA 2BXYA 2OAUA 2XASA 4K0KF 2XAUA 4M74A 4QTRA 4EEYA 1N5YB 3CNQP 2CZ4A 2R2TA 4DR5F 2GVZA 1OYWA 1WHWA 3DRRB 2UXBJ 3DV8A 1DP3A 1EETA 1CBKA 5H9EK 1WCMJ 3CCYA 3H20A 1UFLA 4LK0F 1XMBA 2A6HF 4S0HB 1UFKA 2E1AA 1SD5A 1Y9OA 4NLSA 1YJUA 3HHDA 3C2HA 1UEVA 4D5FA 2L9WA 2B5JA 5KFPA 5F8HA 3NL0A 5ICGA 2YX7A 4BEHB 1I6XA 3H2LA 5E1WA 5IQ6A 3V6DB 3U9GA 3GUDA 3CCMI 4NLQA 5CVVA 5J1UA 1MDMA 3GQCA 2Z30B 2A69F 3S7RA 4MO7A 2HFHA 3QJJA 2MGZB 4DSKA 1F1BB 2COMA 3W60A 4ICLB 4JB8B 3LGMA 5MAOA 3BJOA 3OW2R 1VHFA 3T8TA 4YRVA 1BC7C 1IUJA 1LKZA 4DPWA 2DW4A 4QBUA 5F8NA 1CSJA 4I69A 2VFUA 4X4SA 4ITSA 1WC1A 3BGFA 1SVMA 2DHXA 1CLFA 5KT3A 3CCQI 2UUWA 4QPQA 5GTIC 3D68A 3S1NJ 4PPDA 4Y00A 4M5DA 3A4TA 1QE1A 4LRFA 5H9FK 4B3MF 1YW8A 3SYZA 4DLGA 2GAUA 2BW3A 3K70D 1XR7A 2HPMA 4MHGA 2E66A 1C0UA 1N0UA 1WOSA 4TQSA 1HNVB 1KBRA 2B6AA 3BH6B 4B9TA 3M8RA 4DV2F 4KPCA 3NBPA 1I3OB 3MM9B 5KG6A 3PNYA 3ABKH 1U6ZA 3T5JA 4XRSA 3N6MA 1VQ5S 1QVTA 5F8LA 4WE1A 3RR7A 1N88A 1W7PA 2K3FA 1N32F 1RUOA 2VV5A 3SYTA 1NJWA 2OUMA 3MECA 4BE2A 3HRUA 3VR1A 2JRSA 2JUCA 3ZQFA 4O3PA 3GJRB 1TVRA 3D5LA 4C0BA 3HOTA 3BB5A 3W6KB 3WHCA 2W1OA 2AJQA 2HNDA 3GJTB 3C6TB 2H1LA 3HXLA 4KNYA 4B9UA 4ILLA 4HG2A 2GHWA 4GC6A 5EYRA 1SQFA 1Y5NB 4DI6A 3AJ2A 4NB5A 5BPIA 3G4SI 3DLLQ 2ERRA 5EG0A 5A8KA 2VQLA 4ZN3A 3CVKA 2WW8A 2QKMB 1T11A 4DV3F 1KKHA 4Q48A 1PP7U 2EEYA 2W7PA 3F0CA 4J7CA 2HQ3A 3HRSA 4DV5J 4PXEA 5J2PA 5B66C 2VDIA 2E5ZA 2JFDA 1VQ8S 5IOYA 4EM0B 2J9EA 1FE0A 4KKOB 1DPRA 2E5NA 2LG4A 3N97A 1D5VA 2MKIA 5HK4A 2JLFA 4NLVA 3I0SB 2NYXA 1UAAA 1KR4A 1Y56A 3CC4S 1S7OA 3AD9C 3OTDA 2CPJA 2AJ4A 4DR4J 1S59A 4FBUA 2AV5A 2M9KA 3PUFA 2Y9YA 4MIMA 3BGRB 2OJ3A 1HOMA 3K1PA 1RU2A 1IGNA 4XIUA 1FJGJ 4ZVUB 2UV8G 4LQ3A 4B9VA 4QPXA 1XGSA 3V8LA 1DDNA 3GTOJ 2OLWA 3MHYA 2I8EA 4XMYA 3SFGA 3OSNA 4ZPVR 1SKUB 5KFQA 2C28A 2CPYA 3IWLA 1G2HA 5BYQA 2F5DA 2AS5F 3GFHA 3QOPA 1S9HA 4OI2A 1ZG1A 2KL4A 2Z99A 3VCDA 3WE2A 3LSPA 3BBBA 1EJ7L 3F23A 4PGHA 2IGMA 4KH1B 1D1AA 2QA4G 1WSVA 1UHSA 5F0HA 3NCRA 1QVUA 2IP2A 2DNGA 3K6GA 5CZXA 1BC8C 3HVTB 2VL8A 1UG2A 2CQCA 3W3CA 1NBEB 2R93J 3LANA 3ML6A 2PMZD 3IXQA 4KITB 4CLLA 2HYJA 2VG7B 1IV8A 3DEEA 3GZNB 1HR0F 1RAHB 4M3GA 1RISA 3EDQB 4PFOA 4X66F 5HNHA 2DOFA 3K4CA 3V4MA 2GVZB 3W2WA 2D2WA 2QO3A 1EETB 4Q45A 4MLOA 2H4WB 4CHUA 2Z16A 2B7BB 5RUBA 3WU2C 2R7TA 4LMZA 4LUBA 3Q89A 3H3VK 2FQQB 1WPKA 5E79C 1B72A 2K9QA 2YNIB 3NQOA 4OHZA 1PP8F 2ZWPA 3CCTA 2XF5A 3OXLA 4YFKF 2B5JB 5I3PA 2FUG9 1Z21A 3S93A 4OIPF 4H4OA 2DAOA 2BJDA 4K4SA 2DH8A 4UY8I 3T5LA 3TVZA 4HF0A 4DQQA 4IOCQ 5I3UA 4DCOB 1MDMB 4PWWA 5E3CA 2FJDB 2VUMJ 2UUBF 2NPIA 3R61A 8RUCA 4FF3A 2QZ8A 1Q8IA 1XGMA 2X4HA 2CUYA 3TR5A 2ZH2A 4ZVRB 2MABA 1B6AA 2QMUB 3KXDA 1XSXA 1YS7A 2UUZA 4C3HJ 3DOMB 2KIQA 4DR6J 3MEGA 4EO6A 3AFGA 3VAFA 4ZVHA 2O61A 4XRFA 1VI7A 1QRYA 2FY1A 3ABUA 4NNJA 2ESNA 1VQMI 4N5SA 4JV5J 4HPQA 3L1PA 3NXZA 5H9EJ 4M5DB 2BVZA 4LFAF 2PA3A 1FMVA 2ZBKA 1Y3JA 1QE1B 2BRKA 4YEAA 3N01A 5KK1A 1Q81T 3I4MJ 2BW3B 3P7NA 5D5VB 1FI4A 5C7PA 1POGA 3AG2H 4A3EJ 1GDTA