1FZPB

Crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
AITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of SarA, a pleiotropic regulator of virulence genes in S. aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords 5'-D(P*AP*TP*AP*TP*AP*TP*A)-3'
total genus 23
structure length 105
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fzpB00
2YX4A 3WGGA 4HQEA 2PG4A 1H9GA 5K5QA 3F8MA 5BQTA 2RDPA 2RNJA 4MTEA 1SFUA 3E6MA 3FMRA 1K7AA 4L5JA 3IL2A 4IHTA 4MTDA 2VODA 3JW4A 3GW2A 2Q0OA 1GHCA 1WRJA 1YO5C 1IW7F 2X0LA 2ISZA 5HOOA 1WQ2A 4ENJA 4NQWA 4P9FA 3V8KA 3K2ZA 4PGGA 5LRSA 2OAZA 1XGMA 3WTTC 1YIOA 3GWZA 4HX4A 4HDUA 3R61A 1UCRA 2LSOA 1SD6A 1ZLKA 2VBXA 4Y17A 4BYYA 3K1PA 3WTSC 1K79A 4OIOF 4UV8A 3HOSA 2HYGD 1MD0A 5D5VB 4U0YA 4HLXA 1U3EM 5LLQA 5HLHA 5D5WB 1JXSA 4FHTA 3F8FA 4Q5SF 4ZH4F 1BIAA 1FC3A 3IRRA 2CQKA 3CDHA 1T0FA 5AIPA 2DK5A 2HTJA 2P5LC 2ZO4A 3WGIA 2Z99A 3H92A 3WU1B 5CYVA 2KJBA 2STTA 3E97A 2V79A 4HF2A 2A07F 3LAPA 3J7AO 3BOQA 4I01A 3TO9A 3O3KA 1D8KA 4MGRA 2FRHA 2EFOA 1I1GA 1PP7U 4E70A 1MJAA 3TQNA 3KFWX 1UB9A 4YIFA 5DUKA 2Q8KA 1AOYA 4HAMA 5JI6A 4BQAA 1J0RA 2V1DA 4Z2YA 5ICFA 2PEXA 1P4AA 3CJNA 2HYFA 3WGHA 1E17A 2K4JA 3V7RA 1GXQA 2CYYA 1QZYA 2YU3A 4PZJA 4U88A 1YTYA 5IT3A 2G7HA 1EH6A 2XAQA 2GXGA 5CVUA 1F5TA 3FX3A 3JSOA 5HDGA 2XAHA 3J81Z 1R36A 3P9CA 2Q2EA 1UFMA 2GAUA 2XROA 2JPCA 1I5ZA 1I6XA 3L00A 2WTEA 2QVOA 3EDPA 5E1XA 5J6XA 5E20A 4EJTA 2E1CA 1STZA 5JR3A 1TNSA 3MZYA 2EFPA 1R7JA 3IRQA 3M7GA 3FM3A 3CLOA 3KP2A 4N9IA 3F22A 1MJBA 2BV6A 2COMA 1ON1A 2PFBA 2D45A 1O57A 1D8JA 3E5UA 1S6LA 3VEPA 4L5IA 2DQLA 2P7CB 4AIHA 3I5UA 4OIRF 5L3EA 2DO7A 5CJ9A 2A3SA 5DCMB 6PAXA 3WTVC 3RPQA 3V8JA 5D8LB 1BBYA 1KQ9A 4BAYA 1EH7A 4A0XA 2P6SA 1W4MA 2K86A 1RI7A 3SZTA 3DPTA 3F6VA 4G6QA 3I59B 2YSRA 1FWZA 5J8FA 2QENA 1TW2A 2BYVE 1Z91A 1TW3A 1T2KA 1W5SA 4LK1F 5DUIA 4JQFA 3EYIA 3WTYC 2LNBA 2BEOA 2DTRA 3WE2A 1B59A 4P55A 2D2WA 1JE8A 5ICGA 3RYPA 3GXOA 3EQLF 1A04A 2QQBA 2OBPA 2ESHA 1R5HA 1IXCA 2O03A 4UUVA 4ENMA 1YFHA 4LG0A 3GYHX 3ZN1A 2DT5A 2CSOA 4F7ZA 2NRAC 3BY6A 1O7LA 1ZREA 1UHMA 1JHFA 3RTRA 4A5NA 4LLLA 2YR2A 4GYGA 2FSWA 1KU7A 3I53A 2W84A 4CZZA 1ZRCA 1BI1A 2A69F 5CLSA 4DNCA 2CGPA 3WTZA 4U7BA 3C3WA 1MZBA 1KYWA 2PMHA 2B0LA 5BMZA 3J81K 1ZGAA 3IKVA 2HKXA 5LRRA 2XIGA 2UWMA 2OD5A 1YYVA 1HBXG 1TLHB 4ZZLA 1J75A 1L0OC 1W7PD 3I71A 1IXSB 4G7HF 1YG2A 4L9NA 4WXHA 1XSXA 4MEYF 3FF5A 4GXOA 5E8IA 2LF7A 2XAFA 2V9VA 2FNPA 3DV8A 2OQRA 3V7SA 2EA4A 2E1NA 3GO5A 3GLXA 1G3SA 4OU0A 2VBYA 2TDXA 3H3ZA 1TTYA 2P8TA 3T1BA 1OMIA 4L0ZB 2QLZA 4M71A 2DAOA 5BPIA 5D5XB 3D0SA 4ASNA 1F4KA 4WX9A 4LGWA 2Y75A 4M9ZA 1FPQA 1Z6TA 4O3MA 3RJPA 2DPUA 1JGSA 4NB5A 1B6AA 3QP5A 4YIIA 1FBUA 4G9YA 4M73A 3FMSA 2A68F 1ZG1A 3ECHA 3E6CC 1LEBA 3F23A 3M9AA 4AD9A 3GFMA 3LA7A 2L4AA 1Z9CA 4UXNA 3MEXA 1MGTA 3DP7A 4HX7A 3HHGA 1LNWA 3ZMUA 2EFQA 3R4KA 3F6OA 3CUQC 1W7PB 5D8KB 1ZYRF 5D6FA 1J5YA 3GFLA 5A2QZ 3MQ0A 1O3TA 3KP6A 4U7DA 4LLGF 3OV8A 2IVMA 4L9TA 2P5VA 1U5TA 1YW8A 2O8XA 3TDZC 1QZZA 2XUBA 2QBYB 1T39A 2VBZA 1S8NA 4ZYGA 3FMQA 1Z1DA 4EVIA 5FGMA 2EK5A 1W5TA 2MH2A 4UVAA 2Z9OA 4EJWA 2W85A 4BXUA 3ZMTA 2QM3A 4U0VA 5D5UB 1PUEE 4WXCA 5ILVA 4MNUA 3T8RA 4YFXF 3WE3A 3ROUA 4GCVA 3J80Z 2WC2A 4HV6A 2GQQA 4HLYA 1SFXA 3JSPA 5F1RA 2OU2A 5HLGA 1KQ8A 1YW7A 2RKHA 4UHTA 2XAGA 3W6JB 2FBIA 3MCZA 5CVJA 1R22A 5K1YA 1R5GA 1BM9A 1ZGJA 2F5FA 5L3DA 5HDNA 2L3DA 2VOPA 1P4WA 1U6GA 1ON2A 2M8EA 4G94A 3EUHA 4RGRA 1KU3A 3L2CA 1LDKB 2HQRA 2OZ6A 3ELKA 2RGVA 1D5VA 1FBSA 2W25A 2IW5A 3RYRA 2FNAA 3F8BA 5BPDA 2QBYA 3FXQA 1SD7A 1SMTA 4BHBA 5ICCA 3F8NA 2UXXA 1WWXA 1KQ0A 2WV0A 3K0LA 1B9MA 4HZFA 4LD5A 3KE2A 2L01A 4ESBA 3ZMVA 2HKOA 1MDMB 4IJAA 1I27A 1LQ1A 3R6SA 5DYMA 1IN4A 2CG4A 2Y48A 5L3BA 1LDDA 4KA4A 2HZTA 1ZG5A 3KLNA 3VB2A 3RKXA 1R00A 3BWGA 2MBFA 3MFKA 1OKRA 3TOAA 4RB0A 3ERED 1RZ4A 2VT3A 1ZG3A 2Y0MA 3BP8A 3HTUA 1S7OA 5CVRA 3I0TA 3P7NA 2CW0F 4LB5A 4G6DA 1K78B 1X3UA 2FU4A 4IPAA 3O6BB 4LMYA 4P5OA 5FB2A 4XSZF 1HKTA 4O6JA 4CDGA 5L3FA 3PQJA 1O3RA 1IRGA 2KIFA 2MD5A 3CUQA 1U78A 4LB6B 3ABTA 3I59A 5FFXA 4Q48A 2HR3A 4UVBA 4OMYA 3CO7C 1V3FA 3CTAA 2P6TA 1DDNA 3HOTA 2O6GE 2JZYA 4ENKA 1FNNA 3WODF 1SAXA 4KIGA 1HW5A 2ZJ2A 1IN7A 5LGUA 1ZRDA 5K5OA 3Q9VA 3QU3A 5BS6A 1TQIA 4GGGA 3E6BA 3RDIA 1R58A 2CO5A 3I58A 1UHWA 5H20A 3G3ZA 5IT9K 2DW4A 2O3FA 2NNNA 3LA3A 4KIFA 4A0ZA 1E2XA 2M1BA 3HSEA 2XAJA 5HS9A 3KLOA 2UXNA 1YS6A 4IVNA 3NRVA 2HDCA 1S7AA 3KZYA 4LFUA 1OYWA 2PBIA 3HRSA 1O7FA 2VE8A 1QQIA 1XSVA 4PCQA 4IXAA 3T5XA 2HQNA 2QZ8A 4EJUA 5J8CA 4G8XA 4WF2A 4QLCU 4I02A 1ZRFA 3HHHA 1Z05A 4LJZF 4HBLA 4UVCA 3BJOA 3REOA 2D1VA 5EEHA 4ETSA 3IHUA 3BZ6A 4HDVA 3L09A 4RB3C 2PMUA 2IA2A 2C6YA 2KIMA 3FZVA 4XLPF 5JVTA 3E6DA 2UZKA 2L4MA 4L9JA 2E7WA 2ACJA 1FYMA 4JK1X 4RS8A 4GYIA 4RB1A 5JHUA 1GXPA 4H0EA 1FP2A 4KMUX 3HRTA 5LGTA 1DPUA 3WG9A 1P2FA 4HQMA 2A6HF 2YX7A 5H6QA 5ILSA 1T98A 5DD8A 2O0YA 4CXFA 4HYEA 1B4AA 1F1ZA 1R23A 3DQVC 1P4XA 2Z5UA 1QBJA 3R0JA 2A6EF 2Z33A 3TO6A 4RAYA 3KP7A 5LHGA 4U0WA 1FLIA 4I09A 2KRFA 1HW2A 4KT5C 3HRUA 1J59A 3I64A 1U8RA 1SMYF 5FLXK 1B1BA 2QWWA 3T0YA 4HF1A 3WTUC 4Y15A 2BGCA 3U1DA 2EV5A 1DP7P 2P4WA 2QYOA 3N4MA 3QPTA 4EGZA 1RIOH 2DPDA 5HVQC 5DCFA 2ZKZA 4WWCA 2RVCA 5DEQA 2XASA 2FMYA 1SD5A 2PI0A 4LK0F 2IA1A 1OR7A 3TO7A 1RUOA 1USSA 1ZHFA 1ZH5A 2XRNA 1SD4A 2VN2A 3V4GA 4HW0A 2NYXA 3HRMA 1TQPA 4BHCA 4OIQF 3K1MA 4R79A 3MZHA 4L18B 2XV4S 4DQ2A 1NHAA 4JBAA 1IN8A 1CF7A 1H9TA 2ZXJA 4I2OA 2MH9A 1FSHA 3KP4A 1BIBA 2VC0A 3B73A 5BOXA 2IP2A 5E8GA 5A2QK 5HDKA 5ICEA 3GVAA 5TRDA 1V4RA 3Q9SA 3LA2A 4G7ZF 2G7UA 2HTSA 1QPMA 1IXRC 1FSEA 1R1TA 4I7HA 4Q47A 1XGNA 2ISYA 5E1ZB 4EV0A 4EQQA 3GEZA 3RPUA 2AXLA 3ZMDA 3CUQB 3HYIA 1BI2A 1O3QA 2RQPA 1BC8C 1HSTA 1RNLA 1OYYA 3O2PE 2WWYA 3COAC 1ZARA 4EGYA 5FD5A 4KNYA 2LDUA 1PP8F 4OMZA 4I0BA 3FXUA 5HLIA 3JTHA 1HW1A 1REPC 2L54A 2JSCA 4OINF 5AONA 2J5PA 3FXRA 1T6SA 3FM5A 4CICA 2K02A 3LQRA 4BHPA 2HGCA 3IWZA 1MKMA 3TGNA 3E5XA 4ZZDA 1FBQA 4ZYHA 2QQAA 4HX8A 2VONA 1O3SA 1F9NA 2K4BA 4XSXF 2DU9A 3V7CA 4FX4A 3ZN0A 1IN5A 5D4SA 1ZLJA 4IF4A 4CO8A 2PLYA 5KVRA 2HFHA 2HS5A 2FBHA 2ZFWA 1J7KA 1ZN2A 1LEAA 2JTVA 2FXAA 3P9KA 2EFWA 3DEUA 3KEOA 2IT0A 1G4DA 3Q5FA 4M9SA 4IHSA 3C1DA 1QGPA 3M8EA 4FT8A 4KICA 4TV7A 1WI9A 2RC4A 4RGSA 2XKPA 1JHHA 2HWVA 2NNYA 5DV5A 4P96A 3F3XA 2GZWA 4ZYEA 3IWFA 1KYZA 4FX0A 3R60A 1Q1HA 3G73A 2PN6A 3HTSB 2GXBA 4G7OF 3NEUA 4QWQA 5TJJA 2KJCA 3BJ6A 2ZCWA 2Z3YA 1BI0A 2EA2A 3ZP5A 2EWNA 1TNTA 1WKMA 4RB2C 2K7LA 1CGPA 1IZ1A 5CVVA 2PJPA 5LGNA 1S3JA 3DPLC 1XDUA 3D5LA 3FHZA 3B02A 2QUFA 1OYIA 5ED4A 3PFIA 2DLLA 3CO6C 3GZ5A 4LG0B 3SHFA 5D4RA 1K78A 2H94A 1R1UA 2EJRA 5HS7A 1FYLA 1DPRA 2M30A 4IRIA 2HOEA 3M1EA 2ETHA 1SFEA 5E1WA 1XCBA 3H3UA 2V1UA 3ZQ7A 3R0AA 2K27A 2W24A 2NS0A 1TBXA 4M9XA 1YS7A 5ERIA 2G9WA 1BOAA 3BPVA 2DBBA 1U2WA 2BE5F 3QRFF 4XBFA 2F5EA 3SZPA 1FOKA 2ADUA 2FOKA 1G3WA 2QQ9A 2EB7A 2V6CA 3RKYA 2H6CA 2R3SA 1LVAA 1XGOA 1XSDA 3I4PA 3QP6A 3GFIA 3MWMA 2M87A 4AIKA 4EM0B 3BDDA 3CUOA 2W57A 1DUXC 4YFNF 3V8LA 1YW9A 3LAJA 1OPCA 2IA0A 1PDNC 1HXDA 1LB2A 2R7FA 4KN7X 4PGHA 1FZPB 3K1NA 5DD4A 3QOPA 3E3VA 4N9HA 4ESJA 2GIVA 5EEGA 1L3LA 3TOBA 2GWRA 3ISPA 4NHJA 4HA8A 2XVCA 1J2XA 3F8CA 3L7WA 5CVIA 3TDUC 1IN6A 4AVPA 3RI4A 2OQGA 2GA1A 1HQCA 3QPHA 3K9TA 2R7DA 1HKQA 4A0YA 1IF1A 1QO0D 1Z6RA 1LDJA 4OIPF 3QAHA 4HF0A 3WTXC 2XKOA 5LBQA 4GO1A 2F2EA 4BH9A 4MEXF 1BC7C 3GUDA 1LJ9A 2OA4A 3U2RA 4KIBA 2FMLA 4WK8F 2A61A 3IC7A 3SQNA 3ULQB 5E17F 2ESNA 5L3GA 5ILUA 1TQMA 1U5TB 5LHHA 4WCGA 5FLXZ 4IRHA 5FO5A 1K6OA 4MQVA 2A5YB 4UV9A 1RUNA 4R1HA 1T38A 3OOPA 4RGUA 3JAMZ 5FFZA 4A6EA 1VTNC 3ZMSA 3M8FA 3ML6A 3PQKA 1CF7B 3J80K 3BROA 4K2EA 4N0BA 5F64A 1XGSA 2ZNYA 2CFXA 3I54A 2STWA 2E7XA 1ZAOA 2LKPA 1XDSA 3KCCA 1IUYA 5F6FA 3MAJA 4KUMA 1G3TA 3DFGA 2DI3A 4L0YB 2DFIA 1XD7A 1U5TC 2RV8A 2O61A 2H6BA 2FE3A 1KU2A 4KDPA 2JPBA 1XB4A 1WSUA 5FD6A 1GVJA 3BJAA 4I0AA 2KKOA 3HIFA 3QU6A 3SXYA 1J9IA 2FEZA 1I1SA 2P7VB 5LEKA 5LEJA 4CHUA 2VBWA 4WXDA 3KP5A 5DCMA 2XGXA 1KA8A 3TKYA 2ELHA 3GX4X 2VOOA 4ESFA 2YPRA 4A12A 2MA3A 1AWCA 3IKTA 5L3CA 2EV0A 4S04A 3K69A 3HSRA 4R8HA 3C7JA 4EJVA 2VC1A 4EJOA 2IRFG 2X4HA 1QNTA 3FWEA 4MHGA 2FQ3A 1FT9A 1Z7UA 3E5QA 4ENNA 1MJ9A 4BNCA 3GFJA 1IRFA 4IRGA 1YQAA 2VE9A 2VXZA 2ZMEB 2M45A 2EFNA 1MDMA 2MC3A 1KGSA 1H0MA 1XN7A 4YG2F 4KYWA 5E18F 2M5WA 1BJAA 3GZ6A 4A6DA 5LHIA 1FP1D 3L9FA 3DF8A 3ZMZA 3P9IA 2BBYA 4HV5A 1EH8A 1B9NA 3GF2A 4OOIA 3WU0A 1KU9A 2JT1A 2OZUA 2ZBKA 3C18A 4AWXB 4EMSA 2JRTA 3T8TA 2IJLA 2FF4A 3VFZA 1FYKA 4CGZA 3JAMK 1XMKA 5AIQA 4O5VA 5K5RA 1HSJA 5HS8A 1R1VA 2FBKA 3JTGA 1YLFA 2IPQX 1XMAA 2F5DA 4M72A 2XHKA 2DQRA 4B09A 3HUGA 1ULYA 1S29A 5H6RA 2HEOA 4P9UA 4CYDA 2GA2A 3RIRA 4YFKF 3EETA 2NAZA 2KIUA 1G3YA 3BPXA 3AAFA 3ZPLA 3W6KB 2V1XA 5IT9Z 2L02A 3DXJF 3NQOA 3VOEA 4RGXA 2RN7A 3DKWA 3HSFA 4A5MA 2H27A 4LLNA 1IAWA 1FX7A 1D3YA 2ZMEA 3KP3A 2VT2A 2MLGA 2DK8A 4ZYDA 4D0PA 1HKSA 3N97A 4KN4X 2MLKA 3S2WA 3VODA 2F5CA 3EYYA 5KK1A 4Y13A 5D6EA 4KFCA 1P6RA 1ODDA 1BI3A 1ONVA 2H09A 3LQQA 4UNOA 3LSTA 2AS5F 2CWEA 4L9VA 4EM1A 3SFZA 2D1HA 3LWFA 1Y0UA 4XRFA 4AIJA 2ZNZA 3KEQA 2LF8A 5JFRA 1P92A 4MQ9F 3KETA 2PQ8A 4S05A 2EV6A 4I98B 4RAZA 4EM2A 4PDKA 2J5OA 3WTWC 4Q4ZF 1USTA 1FY7A 2FA5A 1XCVA 1BN5A 1W7PA 4ON0A 3ECOA 1C0WA 2P5KA 3KZZA 3RKWA 4B8XA 1EV7A 4M6XA 5DDGA 4KMFA 4XLNF 3F21A 4A2UA 3U9GA 4M74A 3ABUA 1G6NA 4HOBA 4M6YA 3F72A 3LFKA
chains in the Genus database with same CATH superfamily
2YX4A 3WGGA 4HQEA 2PG4A 1H9GA 5K5QA 5EYRA 3F8MA 5BQTA 1P7IA 1UG0A 2RDPA 3IH2A 3CF5F 1JKPC 4J01A 4II2A 2RNJA 5CPRB 4W1UA 4BKXA 4MTEA 1SFUA 1JKQC 3E6MA 2E19A 3FMRA 1K7AA 1FIAA 2JN6A 4L5JA 1QHHD 2WY8Q 3DLAA 3IL2A 2DFEA 5JHFA 4BJ6C 3DBLB 3FBNB 4AYBN 4IHTA 4MTDA 2G0EA 4D9JA 2VODA 2VJIA 2KZGA 2V4JC 3JW4A 4XLFA 3G1MA 3GW2A 2Q0OA 2WB1A 4PJJA 1GHCA 1WRJA 1YO5C 2H1KA 1IW7F 3D5SC 2X0LA 2ISZA 5HOOA 1IO2A 1WQ2A 4ENJA 2IS4A 4NQWA 4P9FA 3V8KA 3BZKA 3K2ZA 4PGGA 5LRSA 1UELB 3BQYA 2OAZA 2K5CA 4D7NA 3ZQLA 3C2BA 2BXZA 4EATA 3CCVI 1XGMA 3WTTC 4HNVA 1YIOA 3GWZA 4HX4A 4HDUA 1A6IA 3R61A 1B8IB 1MNMC 3HOVJ 2BHZA 1UCRA 2LSOA 2CU7A 1SD6A 1ZLKA 2HXOA 3S1RJ 4DIQA 2JA6J 1UJ8A 2VBXA 4XONA 4Y17A 4BYYA 2B63J 3K1PA 3WTSC 1K79A 1AHDP 4OIOF 2QSGX 3BZCA 4EEFG 4UV8A 3HOSA 2F4IA 2HYGD 1MD0A 5D5VB 5C4JJ 4HLXA 4U0YA 2DMUA 1MH3A 1U3EM 1VI0A 2VKVA 5LLQA 2CQ7A 3CLQA 3E0JB 5HLHA 2LR8A 5D5WB 2RQQA 1JXSA 1Z3YA 4FHTA 3F8FA 3CCJI 4Q5SF 3FK6A 4ZH4F 2KMUA 3OMYA 1BIAA 3PM1A 1FC3A 2ECCA 5M5XJ 4I76A 3IRRA 5EEAA 2CQKA 2E1MC 2GOMA 3CDHA 3L2UA 1T0FA 4BE1A 5AIPA 1WFXA 2HNHA 4E4HA 2DK5A 2HTJA 2WBMA 2XSJC 2VASA 4B48A 2P5LC 4AU7A 3HOWJ 1GV5A 1YJNI 2ZO4A 3WGIA 2Z99A 3SFIA 4A3JJ 1RESA 2W48A 3H92A 3WU1B 3MMYB 4BQQA 1X1CA 4DYQA 1KZHA 5J1YA 1BW6A 5F0HA 1U0JA 3Q0WA 5CYVA 2KJBA 2K3FA 1TT5B 2STTA 3CMMA 3E97A 2V79A 1IRZA 2NVYJ 3QWLA 1WI3A 4HF2A 2JUGA 1UMQA 2A07F 3LAPA 3EPZA 2VQLA 5FKOA 3J7AO 5DS9A 2HOAA 3BOQA 2OJED 4I01A 1ZR2A 4YIRX 3TO9A 2MC4A 5C44J 3JR9A 3O3KA 1D8KA 4MGRA 2EFOA 2FRHA 3LNQA 1I1GA 3ABMH 3ZGKA 1PP7U 4E70A 1MJAA 3GMEA 3TQNA 3KFWX 2CQNA 1UB9A 1M1EB 4YIFA 2FUG2 3GLLA 5DUKA 2Q8KA 3S14J 1AKHA 1AOYA 2RAEA 4AUXA 4HAMA 1W1WE 2Y9ZA 3VYRB 1WCMJ 5IYBJ 5JI6A 1RKWA 4BQAA 1J0RA 2V1DA 5DM6F 1W0TA 4Z2YA 5ICFA 2PEXA 1P4AA 1ZELA 3CJNA 3VSLA 2HYFA 3WGHA 1GVDA 1E17A 2K4JA 4A93J 2MFZA 1K4TA 3V7RA 5M5WJ 4JOMA 1GXQA 4AM3A 2AQEA 3SDBA 2ZJPF 2CYYA 1QZYA 2YU3A 2JQ7A 4PZJA 4U88A 1YTYA 3WHBA 3B6CA 2IS2A 1H88C 5IT3A 2G7HA 1EH6A 2XAQA 2K9QA 2V7FA 2GXGA 1TP4A 5CVUA 1F5TA 4II3A 3FX3A 3JSOA 5HDGA 3X2QH 2XAHA 2DCEA 4OAYA 3J81Z 1R36A 3CCQI 3BG5A 3P9CA 2Q2EA 4FETA 1UFMA 2LRDA 1Y1VJ 2GAUA 2M7BA 3ZQGA 1IDZA 4BQNA 3QOEA 1A36A 2XROA 3HC7A 1MMDA 2QEXI 1DGWY 2JPCA 1I5ZA 1I6XA 3BR6A 4MFEA 3L00A 2WTEA 4S0HB 2EIJH 2OF7A 2QVOA 1YHQI 3LSGA 3EDPA 5E1XA 3HEFA 4YRVA 5J6XA 2R7ZJ 1EJ9A 5E20A 4EJTA 1LFUP 2E1CA 1STZA 2CUEA 5JR3A 3S3NA 1TNSA 3MZYA 2EFPA 4U87A 2L7FP 1QZEA 1R7JA 2HQAA 2R5ZB 3MKWB 3IRQA 3M7GA 4BQOA 2ME6A 3FM3A 1NH3A 3CLOA 3DTKA 3KP2A 3G71I 3OS1A 4A3LJ 2ID3A 3JCUC 4N9IA 3F22A 2PJRA 1MJBA 2BV6A 2CFOA 2COMA 2MYSA 2IGNA 1ON1A 2PFBA 2D45A 1O57A 1D8JA 4KISA 4PJNA 3N05A 2N8GA 4YELA 3M8JA 3S3MA 3E5UA 1S6LA 3CP8A 3VEPA 1E3HA 2EZKA 4L5IA 4W97A 2DQLA 4IO9F 2P7CB 4AIHA 3I5UA 1CQTA 1VNDA 2IEKA 2KLOA 4OIRF 5EG0B 5L3EA 3ZQCA 2DO7A 5CJ9A 3GTGJ 2A3SA 5FLMJ 3AKZA 3PNTA 5DCMB 3WTVC 6PAXA 3RPQA 3V8JA 5D8LB 1V5EA 5EZHA 2H1LA 2YS9A 1BBYA 1KQ9A 1U8BA 4C9YA 4BAYA 1EH7A 1J09A 2HDDA 4A0XA 4GFBA 3K4BA 2QSFX 3HUGB 1Z77A 2P6SA 1W4MA 2K86A 1RI7A 1X2MA 3SZTA 3DPTA 3F6VA 1YI2I 2IAIA 4G6QA 3ABKH 3OOUA 1DP3A 3CCMI 2M3AA 1JI8A 3I59B 4ZC3A 2YSRA 2O7OA 3JRCA 1FWZA 5J8FA 4BXXJ 4E7JA 2QENA 1TW2A 4E7SA 2RREA 4E7IA 4BBSJ 5E79C 4XICA 2BYVE 1Z91A 3L2RA 2E2IJ 4DYRA 1TW3A 4G6TB 3HKZA 1T2KA 4BY1J 1W5SA 4LK1F 4LITA 1QPIA 2DA3A 2JSPA 3ZQQA 5DUIA 3I3LA 2RNGA 1BR2A 2DXIA 4JQFA 3EYIA 3WTYC 2LNBA 2BEOA 1S7EA 3EUAA 2DTRA 3WE2A 4A3DJ 1B59A 1RPWA 4P55A 2EIKH 1WPKA 2GIZA 2D2WA 4N4OB 1JE8A 1SVLA 2XRLA 5ICGA 4IOCF 3RYPA 2DFFA 3GXOA 3EQLF 1A04A 2QQBA 1D0XA 2OBPA 3HZJA 2ESHA 1R5HA 2WAEA 1IXCA 2I10A 3VPRA 2O03A 4Y4RA 1X4OA 4UUVA 3JRGA 4ENMA 1YFHA 2MD0A 4BL0B 4LG0A 4FE7A 3GYHX 3ZN1A 1XS9A 2DT5A 2CSOA 4F7ZA 2NRAC 3BY6A 1O7LA 1ZREA 1UHMA 2KFDA 1JHFA 1XX5A 3H9JA 2M0MA 3OYAA 3RTRA 4A5NA 2VKEA 4LLLA 2YR2A 5EDNA 4GYGA 2KISA 2FSWA 4DZPA 1KU7A 2E1OA 2W84A 3I53A 4CZZA 1BI1A 2A69F 1ZRCA 4F92B 4RM3A 4XM3A 3HGGA 5CLSA 3K70D 3QPSA 2XF6A 3BTLA 3A4CA 1Y1WJ 4DNCA 5K7ZA 2CGPA 2MG4A 5E3LA 3WTZA 4U7BA 1MNDA 3C3WA 3QYFA 3A1YA 3OYIA 1K61A 1MZBA 5KAFC 1KYWA 1X1AA 3OWTA 2PMHA 5TISC 1B8IA 2B0LA 4LOCA 5BMZA 4QSHA 3J81K 4L5EA 1ZGAA 3IKVA 1WJBA 2HKXA 3F9KA 1IDYA 4AIDA 5LRRA 2XIGA 2UV1A 2UWMA 2BY1A 1HF0A 2OD5A 1YYVA 2KDZA 3S1QJ 1HBXG 1TLHB 2CJJA 2VI6A 2X85A 4ZZLA 4F93B 1J75A 1L0OC 1W7PD 2R7UA 3LSIA 1VQ6I 1I39A 2BW3B 3I71A 5J4VA 5CQGA 2FOWA 1PUFA 1JUMA 1IXSB 4G7HF 3FHNA 1YG2A 4L9NA 1YX5A 4WXHA 1POGA 1BOBA 1XSXA 4MEYF 2Q1ZB 2CW8A 2X6OA 3S8PA 3FF5A 4GXOA 2OCEA 4XKBA 2DA7A 2L9RA 4NDLA 2CMPA 3CDLA 4XN0A 5E8IA 4RDUA 2W4SA 2LF7A 2I8DA 2ME0A 2XAFA 4AC0A 4X0GA 2V9VA 2FNPA 3DV8A 3BT9A 5GAHJ 2OQRA 3JRAA 3V7SA 2EA4A 2QF7A 3M4OJ 2E1NA 2K9MA 2LY9A 2F4MB 2LP0A 3GO5A 3GLXA 3KX2A 1G3SA 1E0EA 2MGQA 5TGTA 2HVSA 4OU0A 2VBYA 1SANA 2TDXA 5HNFA 3H1CA 3H3ZA 1TTYA 2P8TA 1DQUA 1YITI 3T1BA 1OMIA 4L0ZB 2QLZA 4E6KG 2DTZA 4M71A 2DAOA 4ZYAA 3KYLA 5BPIA 5D5XB 3D0SA 2CV2A 4ASNA 3VSKA 2KT0A 1F4KA 4AYBA 4WX9A 3GTQJ 2EILH 4IEJA 3ZOBA 4LGWA 2Y75A 3TMOA 4M9ZA 1FPQA 1Z6TA 2XB0X 4O3MA 1HDDC 1BW5A 3RJPA 2V26A 3S2HJ 2JRMA 2DPUA 1JGSA 4NB5A 4C3IJ 1B6AA 3QP5A 4ABZA 3JREA 2Z16A 4YIIA 1FBUA 2IXSA 5EF6A 4OAZA 4G9YA 4M73A 3FMSA 2A68F 2L9VA 1JJ6C 1ZG1A 4BJ5C 3ECHA 5B3SH 1NK2P 1PJRA 3E6CC 1X58A 1LEBA 3G2BA 1UAAA 3ZR8X 2XPWA 3F23A 3M9AA 2R7SA 4XKWA 4AD9A 3BG9A 3GFMA 3LA7A 1OJLA 3OL3A 2L4AA 2O5RA 5GAGJ 1Z9CA 4UXNA 5B5EC 3MEXA 2LG4A 1MGTA 3DP7A 4HX7A 3HHGA 4B44A 1LNWA 5IOYA 3S1MJ 4NC7A 3ZMUA 1ETXA 3BTJA 2EFQA 1R4NB 3R4KA 3F6OA 3CUQC 1E3PA 1W7PB 5D8KB 3G4SI 1ZYRF 1QU3A 5D6FA 1J5YA 1BR1A 3BTIA 3GFLA 3S17J 1WJ5A 5A2QZ 1ZR4A 2XGDA 4F3QA 1W5CC 2R5YA 3MQ0A 1FIPA 3OYLA 1O3TA 3KP6A 2W82A 3QYEA 4U7DA 4LLGF 3OV8A 3SDGA 2IVMA 4L9TA 3J7AY 2P5VA 3RZOJ 4XL9A 2DA2A 4DW6A 1U5TA 1YW8A 2O8XA 3PSFA 3TDZC 3OR2C 1GLNA 1QZZA 2XUBA 2DMQA 2WAQN 1D1CA 2QBYB 3G1LA 1T39A 1VZ0A 2VQCA 3J7YJ 1VQKI 2VBZA 3TP3A 1S8NA 1APLC 1N25A 4ZYGA 3GCMA 3ONQA 5F0CA 3FMQA 2EZHA 4CA0A 2K40A 1Z1DA 1R6RA 4BEHB 4EVIA 5FGMA 4RAGA 1G2HA 2QCOA 4C3HJ 2KPMA 3M3YJ 2NVQJ 2EK5A 4BU2A 1JUSA 1TWHJ 1W5TA 2MH2A 4UVAA 5EJCA 2Z9OA 3FXJA 4HPQA 4EJWA 2W85A 3PSIA 4BXUA 3ZMTA 3SEZA 1FTZA 2QM3A 3HKZN 4U0VA 5D5UB 1O4XA 4WXCA 1PUEE 4QPQA 5B66C 5ILVA 4MNUA 2V9PA 3CCUI 3T8RA 3ZQFA 3LSRA 4YFXF 1JT0A 3WE3A 3ROUA 4GCVA 3J80Z 2WC2A 5BNGA 4HV6A 1Y6IA 2NXNB 4C3JJ 2GQQA 4HLYA 1SFXA 4FE4A 3JSPA 4RM2A 5F1RA 2OU2A 4M3BA 5HLGA 3JRIA 1KQ8A 3H36A 2Z1DA 1YW7A 2RKHA 4UHTA 2XAGA 3W6JB 1HOMA 1D1BA 4F52A 2FBIA 3MCZA 5CVJA 1R22A 3OS2A 4XLAA 5K1YA 5GAEJ 1R5GA 4XKVA 2GOXB 1BM9A 1ZGJA 2F5FA 2P81A 5L3DA 2XAUA 5F04A 5HDNA 2L3DA 2VOPA 1P4WA 1U6GA 1YOVB 2ZSHB 1ON2A 1SVOA 4UUTA 2M8EA 4G94A 4I6ZA 2L9NA 3EUHA 4FASD 4RGRA 4C2UA 1KU3A 3L2CA 4X6AJ 1LDKB 2HQRA 2OZ6A 2LLKA 4G12A 3ELKA 3G6EI 2RGVA 1SC7A 3IP4B 3VDXA 1FBSA 4BBRJ 2WADA 1MMNA 2W25A 1D5VA 2IW5A 4HG2A 3MD2A 3RYRA 2FNAA 2IBDA 4FISA 3F8BA 5BPDA 2QBYA 3FXQA 2BY2A 2KRHA 2BY3A 2K3PA 2HVRA 1SD7A 2HU9A 3H5RA 1SMTA 3NWSA 4LG3A 2VKHA 2Y9YA 4BHBA 2OCCH 5ICCA 3PJRA 3F8NA 2UXXA 4UUSB 2QSHX 1WWXA 1KQ0A 3TW7A 2WV0A 3K0LA 1B9MA 1Y8RB 2DDAA 1R9TJ 2ICWG 3ASNH 4HZFA 4LD5A 1FEXA 3KE2A 2L01A 4ESBA 3ZMVA 2HKOA 1MDMB 1H89C 4IJAA 4ZDOA 1I27A 1LQ1A 1N75A 3BR0A 3R6SA 2L2OA 1EKEA 5DYMA 1IN4A 1RC9A 2CG4A 2Y48A 5L3BA 4J00A 2X6XA 1LDDA 4KA4A 3PUFA 2HZTA 4IHYA 1ZG5A 1SFKA 2ZXHA 3KLNA 3VB2A 2LY2A 3RKXA 1R00A 3BWGA 2MBFA 1WH5A 2HI3A 3MFKA 5FKNA 1OKRA 5HLTA 3TOAA 4YEJA 2IS6A 4RB0A 2ZB9A 1JJ8C 1XTAA 3ERED 1RZ4A 2Q2EB 2VT3A 1ZG3A 2Y0MA 3BP8A 3BC8A 3C2HA 3HTUA 3KEYA 2JJ7A 1S7OA 5CVRA 3I0TA 3P7NA 1FOXA 2XGCA 2CW0F 1UG2A 3K10A 4LB5A 5HODA 4CCOA 4G6DA 1K78B 1X3UA 1OR7C 2FU4A 4IPAA 3O6BB 4LMYA 1DGRM 4JP0A 3LSHA 2LFBA 3CDIA 1OCRH 2XSDC 1X1BA 3ABLH 4P5OA 5FB2A 4XSZF 2VJ5A 5C4XJ 1HKTA 4O6JA 4CDGA 5IP7J 5FRNA 3GZNB 3PL8A 4XN3A 4DJAA 3PQJA 5L3FA 4BACA 1O3RA 1IRGA 3H3VK 2KIFA 2WA0A 1MBEA 4D7MA 2MD5A 3CUQA 1U78A 4XKCA 4A3GJ 4LB6B 2A5WA 3ABTA 1GDTA 3I59A 4KJZA 3A2KA 1BR4A 5FFXA 4Q48A 2HR3A 4UVBA 4HSRA 1NG6A 4OMYA 4M3DA 2LYCA 1N77A 1N78A 2KP6A 3CO7C 1V3FA 3CTAA 2L7KA 2P6TA 1DDNA 1MSFC 2E2JJ 3HOTA 4NBQA 2M9HA 2X1EA 1RRJA 2O6GE 4C2TA 2JZYA 2VKDA 1JGGA 4IHXA 4ENKA 1FNNA 2LBFA 3WODF 4ANJA 1SAXA 5FLVA 1DU6A 5GPAA 4KIGA 2VL8A 1GUUA 5KHDA 1HW5A 2ZJ2A 3E7LA 1IN7A 4XORA 5LGUA 1ZRDA 1B72A 2XGEA 5K5OA 3Q9VA 4V19K 5KNLA 5DM7F 5DTDA 4PSXA 3QU3A 3C2GA 2DA6A 3CCEI 2DMNA 5BS6A 5FROA 2HZDA 1TQIA 4GGGA 3E6BA 3RDIA 1R58A 2CO5A 3I58A 4JX4A 1I50J 1UHWA 2AO9A 2E5ZA 5H20A 3G3ZA 5IT9K 2DW4A 2O3FA 2NNNA 3HPGA 1Y8QB 3LA3A 3H0DA 4KIFA 2Y2ZA 2W7NA 4A0ZA 1E2XA 2M1BA 3HSEA 2XAJA 5HS9A 3KLOA 4M3EA 2ZMEC 2YU9J 2P0WA 3KIOA 3D1NI 2UXNA 1YS6A 4IVNA 3NRVA 2HDCA 1S7AA 3KZYA 2DA5A 4LFUA 1OYWA 3P5JA 2XPVA 2PBIA 3HRSA 3SYTA 1O7FA 2VE8A 1QQIA 2JVHA 4GDFA 1XSVA 2R7OA 2DJIA 4PCQA 3IH3A 1GT0C 4IXAA 2R7RA 3T5XA 3CCLI 2TRTA 1MBKA 1WJFA 2HQNA 2QZ8A 4EJUA 2KRCA 5J8CA 3IV5A 2XF7A 4G8XA 4WF2A 1T0FC 4I02A 4QLCU 1W0UA 3HHHA 1Z05A 1ZRFA 1T56A 2JA2A 1NTCA 4LJZF 4HBLA 3MKLA 4UVCA 4A3EJ 3BJOA 1PVEA 1MH4A 1OCOH 2EZLA 2BVMA 2JK3A 3REOA 2D1VA 5EEHA 4ETSA 4HRIA 3IHUA 4IHVA 2QGUA 3BZ6A 4HDVA 2A05A 3L09A 4RB3C 4J19A 1ETKA 2PMUA 2Z2SB 1ETOA 2IA2A 2V9KA 3A03A 1EA3A 1IV6A 2C6YA 3O8GA 4A3BJ 2KIMA 3FZVA 4XLPF 1TC3C 1ZKGA 3CJTB 5JVTA 3E6DA 2UZKA 2L4MA 4L9JA 2E7WA 1R49A 2ACJA 1FYMA 4JK1X 3QQAA 2KDOA 4RS8A 2VPRA 3FBIB 4GYIA 4QIWN 4RB1A 3JRHA 3LSMA 1WGXA 5JHUA 1X2NA 3NAUA 1FP2A 2WY7Q 3OYNA 4H0EA 1GXPA 4KMUX 4BGDA 3DTEA 2BOLA 2LVSA 3HRTA 5LGTA 1DPUA 3WG9A 2R93J 1P2FA 2WV1A 4HQMA 3HM5A 2A6HF 2YX7A 1VQPI 5H6QA 5ILSA 1T98A 1I3AA 3K4MA 2GBYA 5DD8A 2XC7A 2KIQA 3ZXSA 4PK4A 2O0YA 1OCCH 4CXFA 4HYEA 1B4AA 1F1ZA 1XG1A 2OPTA 2QKLB 1R23A 2MABA 2V1NA 3DQVC 1NG7A 1P4XA 1TWCJ 4XNFA 2LTPA 5KAIC 3RPUD 2L5QA 1E3OC 2F4OB 2Z5UA 1P7JA 5IP6A 1B72B 1QBJA 5FKKA 3Q0UA 4M3GA 3R0JA 3H5NA 2A6EF 3HGYA 2Z33A 3TO6A 2IGKA 4IKFA 4RAYA 3LMMA 2JA5J 1U9OA 4ZTFA 3KP7A 5EZGA 2FX0A 5LHGA 4U0WA 2EQRA 1RR8C 4A3FJ 2B9SA 2CQQA 3TBIA 4D5FA 1FLIA 4I09A 1T33A 2NS8A 2LC2A 2WAFA 2KRFA 1HW2A 4KT5C 3HRUA 4D1QA 1J59A 3I64A 1U8RA 1SMYF 5FLXK 1B1BA 3HB9A 4XLEA 2M4KA 2HPMA 2QWWA 3T0YA 4HF1A 2E71A 3WTUC 3I56I 5CKTA 4Y15A 1TT0A 2BGCA 3U1DA 2EV5A 2CUFA 1DP7P 2P4WA 2QYOA 1V5GA 3N4MA 2HOSA 3VWBA 3QPTA 4EGZA 4X1EA 1RIOH 2BVLA 2DPDA 3UNGC 4DGWB 2EINH 5HVQC 4Y33A 4FCYA 5DCFA 2ZKZA 3OYDA 2B7EA 4WWCA 3RKQA 2CUJA 2RVCA 3CF2A 5DEQA 2XASA 1ENHA 3DTIA 1HDPA 3DEWA 4UUSA 2FMYA 1SD5A 3OYBA 3RCOA 2PI0A 4LK0F 3QYBA 2IA1A 2EH3A 1OR7A 4IL6C 3TO7A 1VQ7I 1RUOA 5H2FC 3CJQB 1USSA 3PFYA 1ZHFA 5LD2C 1ZH5A 2XRNA 1SD4A 2CUZA 2VN2A 3K4LA 2LD5A 2VUMJ 3BR2A 3V4GA 4HW0A 2NYXA 3HRMA 2VIXA 4E7LA 1TQPA 4BHCA 2E36A 3K1MA 2BZTA 4OIQF 4R79A 3A0BC 4RA2A 5FJ8J 3UR3C 1Y39A 3MZHA 4JX6A 4XQFA 3FIWA 1K4SA 3W3CA 4L18B 2XV4S 1F43A 5CQEA 4DQ2A 1OCPA 1NHAA 4JBAA 3K4CA 1IN8A 1CF7A 1H9TA 1MW7A 2ZFUA 3BTCA 2ZC2A 2ZXJA 4I2OA 2MH9A 1G59A 2ZXWH 3KP4A 1FSHA 1SFOJ 4KITB 3VYUB 1BIBA 2VC0A 3B73A 2EZIA 2DOFA 1ETQA 5HNHA 1UHSA 2AXTC 5BOXA 3S15J 4H4KC 2IP2A 5E8GA 5A2QK 2K9NA 2X6WA 3K4KA 5HDKA 1VQ4I 2X51A 1YRNB 5F08A 2QA4I 2NOJB 3GVAA 5ICEA 5TRDA 1V4RA 3AG1H 1IV8A 1AA7A 3WU2C 3Q9SA 3LA2A 5GPCA 2CW7A 3OR1C 4G7ZF 2G7UA 2HTSA 3HJEA 1QPMA 1IXRC 1FSEA 1R1TA 4I7HA 2CH0A 4Q47A 1XGNA 1AKHB 2ISYA 5E1ZB 3K2AA 2DA1A 4EV0A 4EQQA 3GEZA 3RPUA 1TWAJ 2AXLA 3ZMDA 3CUQB 3HYIA 4CH7A 1QRYA 4F55A 2X48A 2DFHA 3LSKA 3CESA 1BI2A 1O3QA 2OTLI 2RQPA 2DODA 4LIUA 1HSTA 1YIJI 1BC8C 1RNLA 1OYYA 3O2PE 2WWYA 2KZVA 3COAC 1ZARA 4EGYA 2DOAA 5FD5A 4KNYA 9ANTA 1S9HA 2LDUA 1W36D 1PP8F 5FRMA 4PJMA 5GTIC 4OMZA 1X19A 4I0BA 1VQOI 3FXUA 4QTRA 5HLIA 1JKRC 3JTHA 1HW1A 2H8WA 3OYMA 1REPC 2L54A 2BY0A 3PIPF 2LBFB 2JSCA 3S3OA 4PFPA 1IUFA 4OINF 5AONA 3BG3A 5C3EJ 1VQLI 2J5PA 3LSPA 1WJDA 3FXRA 1ZTRA 1T6SA 2FQ4A 3FM5A 2NVUB 4CICA 2K02A 1DU0A 2X6YA 3LQRA 1X1DA 3BG7A 3HG9A 2IGOA 2HGCA 4NUBA 3IWZA 4BHPA 1T8IA 4LIVA 2VXDA 1MKMA 1D1AA 3TGNA 3E5XA 3HOYJ 4ZZDA 1FBQA 1LUJB 3PO3J 5B1BH 5J3LA 4ZYHA 2QQAA 4HX8A 3FKJA 2LK2A 3CD6I 2VONA 2L9SA 3O8HA 1O3SA 1F9NA 2DA4A 2K4BA 5FKMA 4XSXF 2DU9A 3V7CA 4FX4A 3ZN0A 4F91B 1IN5A 2XB5A 5D4SA 3NWTA 3QODA 2XDVA 5IP9J 3OIQA 4NC8A 1ZLJA 2R5ZA 3H35A 2ELJA 4IF4A 4CO8A 2PLYA 5KVRA 2HFHA 2HS5A 4BY7J 2FBHA 2ZFWA 3DBRB 1J7KA 1ZN2A 1JUPA 4Y7NJ 1VFCA 4CCNA 1LEAA 2JTVA 3LL7A 2FXAA 3P9KA 2EFWA 3DEUA 1R5ID 3KEOA 1QHGA 2IT0A 1G4DA 3Q5FA 4HSTA 4M9SA 4IHSA 4P1WA 3C1DA 5EG0A 1QGPA 2DYSH 3M8EA 4FT8A 1BA5A 4KICA 3MKYB 4TV7A 4UB8C 4DZJA 1WI9A 2LREA 4BE2A 1V54H 4RAFA 4QPOA 4E7ZA 1JT6A 2VPLA 3OIPA 1ZQ3P 2RC4A 2ZJQF 4RGSA 2VLAA 2XKPA 1JHHA 3L2WA 2HWVA 2W1OA 3K6GA 3HBLA 2NNYA 1MBHA 5DV5A 3VYTB 4P96A 3F3XA 2GZWA 4ZYEA 3MVPA 4ZDPA 3IWFA 1VQMI 1VQ5I 3PUBA 1KYZA 3GTPJ 4FX0A 3IH4A 3R60A 1Q1HA 3G73A 2PN6A 3HTSB 2GXBA 4RLQA 1AU7A 3PO2J 4G7OF 2COBA 2M34A 2NS7A 4IZZA 3NEUA 4RMNA 2HQ5A 2CQXA 4PSWA 4QWQA 3GTJJ 5TJJA 4XOTA 2KJCA 3M1CA 2JA7J 3BJ6A 2ZCWA 1V5FA 1BI0A 2Z3YA 1A5JA 2EA2A 4NC6A 3ZP5A 2ID6A 1RETA 2EWNA 1TNTA 2VQHA 1WZ2A 1WKMA 4RB2C 4Y3OA 3DKYA 3IAS2 2K7LA 3F0CA 4E7HA 4V2FA 1LE8B 1IZ1A 4A3KJ 1CGPA 1FMWA 3Q3SA 5CVVA 5FKLA 3OYJA 2PJPA 3I55I 5IYDJ 4MO7A 5LGNA 1S3JA 2LOOA 3DPLC 3BR1A 2NVXJ 1XDUA 4ZTJA 3D5LA 3CMAI 4CCLA 3S93A 3FHZA 2IS1A 3B02A 2M8GX 2LH9A 2QUFA 4XRSG 1OYIA 3CMEI 2OV7A 3SJMA 5ED4A 3PFIA 3BLYA 2DLLA 3CO6C 3GZ5A 4LG0B 4JYKA 3SHFA 2DT6A 3H9QA 5D4RA 1K78A 3BG6A 2H94A 1BJZA 1JTXA 4AVZA 2R7TA 1R1UA 1Q1VA 1D0ZA 5IYCJ 2M2EA 3RSNA 2NVTJ 1LFPA 1WJEA 1T08B 1YJ9I 2E2HJ 2EJRA 4BDYA 5HS7A 1MSEC 3BQZA 3MN2A 1FYLA 2HDWA 4B47A 3B6AA 2F6CA 3PNYA 1DPRA 2M30A 1X1PA 4IRIA 2NOGA 3BR3A 2HOEA 3M1EA 2QQ8A 1ZGWA 2E1MB 2ETHA 1SFEA 4PJ0C 3CC7I 1Z3XA 4HEA2 1JTYA 5E1WA 3KZIC 1XCBA 3H3UA 3OSGA 1VQ9I 2V1UA 3ZQ7A 2E34A 3R0AA 2K27A 2W24A 2NS0A 4MIMA 2CRGA 1TBXA 4M9XA 3AG3H 4DOZA 2H8RA 1YS7A 3W2AA 4UY8I 2BW3A 3CZ6A 3U21A 3H0GJ 2R7WA 5ERIA 2G9WA 1BOAA 4NNJA 3FISA 4XMYA 3BPVA 2DBBA 1F36A 1U2WA 5J40A 4XRSA 1LPQA 2BE5F 3QRFF 2KQRA 4XBFA 2F5EA 3SZPA 1IGNA 3GTLJ 2WAQA 4M6VA 5J47A 1FOKA 2ADUA 2FOKA 1XMXA 1G3WA 2L7ZA 5F27A 3BR5A 1S5LC 5J4YA 2QQ9A 2EB7A 2V6CA 3RKYA 4ZJZA 3OS0A 2DOEA 2H6CA 2R3SA 2ELKA 3A01A 1QVTA 1LVAA 1SAUA 1XGOA 1XSDA 2HPIA 3I4PA 3QP6A 3GFIA 1HLVA 3MWMA 2M87A 4AIKA 3SZGA 4EM0B 3BDDA 3MZ8A 3H5AA 3CUOA 2MW8A 2W57A 1DUXC 4YFNF 2XF5A 3V8LA 1YW9A 3LAJA 2R7QA 1OPCA 2IA0A 1YJWI 1PDNC 1HXDA 2K9SA 3J7ZI 2HVQA 2R0QC 5GTHC 1LB2A 2R7FA 2IGMA 4KN7X 4PGHA 1FZPB 3K1NA 4XK4A 1WJAA 1X4PA 5DD4A 1YX3A 5EGOB 2R7XA 3I9V2 3QOPA 3E3VA 3OYFA 3HOZJ 4ITVA 3EUKL 4N9HA 4ESJA 5B1AH 2GIVA 1OCTC 5EEGA 1L3LA 3TOBA 5JLWA 1MBFA 2GWRA 2GM4A 3ISPA 4NHJA 5J1RA 4CSWA 3SEQA 1XC5A 3IAM2 4HA8A 2XVCA 3L2VA 1J2XA 3F8CA 2W00A 2DN0A 4XR6A 3DU6A 1RKTA 2TCTA 3L7WA 5CVIA 3TDUC 2CV1A 1A31A 3V42A 2HYJA 1IN6A 4XRMA 2VQGA 4AVPA 1VQ8I 3FXLA 5K7FA 3RI4A 3DBHB 2OQGA 2GA1A 1HQCA 3QPHA 2OUMA 3K9TA 2R7DA 1HKQA 4A0YA 1IF1A 3I4NJ 1QO0D 4V2GA 1Z6RA 1LDJA 4OIPF 3QAHA 1YE9A 4BJTA 3RQ4A 3S2DJ 4HF0A 2DJNA 3WTXC 1R4MB 2XKOA 1WVRA 5LBQA 3OYHA 3TEDA 4GO1A 2JA8J 2F2EA 4BH9A 4MEXF 1BC7C 3GUDA 3OIOA 2K85A 1LJ9A 4PFOA 2OA4A 3ERMA 3U2RA 4KIBA 4BDZA 2FMLA 3PIOF 4A3MJ 3FXOA 4WK8F 2DT7B 3AG2H 1OCZH 2A61A 3IC7A 3SQNA 4ZDLA 3A02A 3ULQB 2Y0SN 5E17F 2ESNA 1UZCA 5L3GA 3LSJA 1VF9A 5ILUA 1OFCX 1TQMA 1U5TB 4A69C 5E3MA 5LHHA 3AL0C 4WCGA 1FOYA 1MBGA 2EBIA 5FLXZ 4IRHA 4N4NB 5FO5A 1K6OA 4MQVA 2A5YB 4UV9A 3ZQHA 1XPXA 1RUNA 4CYCB 4R1HA 4DBQA 1T38A 3OOPA 4RGUA 3OY9A 3JAMZ 5FFZA 4A6EA 1VTNC 4BEHA 3KYDB 4XOPA 3ZMSA 1A35A 1FOWA 3M8FA 3ML6A 3PQKA 2FD5A 2M7AA 1CF7B 3J80K 1RR7A 2LMDA 2EPFA 4M3FA 3DLLF 3BROA 4K2EA 2AHQA 2JVGA 4N0BA 5F64A 4A3IJ 2D5VA 2R92J 1XGSA 2VB6A 2ZNYA 3K70C 2CFXA 1I6HJ 3K7AJ 3S1NJ 1WH7A 1TZLA 2X1CA 5GADJ 4D5CA 3I54A 2STWA 2E7XA 1ZAOA 3UKGA 2LKPA 1XDSA 3KCCA 3OYEA 1YRNA 3GTOJ 3D5RC 1IUYA 5F6FA 3JRFA 3MAJA 4KUMA 1G3TA 3DFGA 3DWLE 2DI3A 3FDYA 1MMSA 3FK7A 3GBGA 3HL2A 4L0YB 5M3MJ 2DFIA 1XD7A 2PMZA 1U5TC 3IUOA 2RV8A 2O61A 3OL4A 2H6BA 2X1DA 4BXFA 2FE3A 3DKXA 3K4JA 1KU2A 4KDPA 1Z67A 3CQZJ 3OYKA 2JPBA 1XB4A 5LFAA 2M4GA 3CMYA 3WG7H 1WSUA 1ETWA 5FD6A 4A3CJ 3OYGA 2OTJI 1GVJA 3BJAA 4I0AA 1G8XA 1TL8A 2KKOA 3HIFA 4RLFA 3QU6A 1HC8A 2WB1N 1ACIA 4B3AA 3SXYA 5E3OA 2MSYA 1BL0A 1J9IA 1MBJA 2FEZA 1I1SA 2P7VB 5LEKA 5LEJA 3VYSB 1NK3P 4CHUA 2VBWA 3EUHC 2GXAA 4WXDA 3KP5A 5DCMA 1ERDA 2XGXA 2DYRH 3CCYA 4PJLA 2CV0A 2X9DA 3MKZA 1KA8A 2L7MP 3TKYA 2ELHA 3GX4X 2XPUA 4BS9A 1EF4A 2VOOA 1WHUA 4ESFA 2PJRB 2YPRA 4A12A 2E35A 2MA3A 4CYCA 1AWCA 1LKXA 3IKTA 2F5VA 4IQ4A 5L3CA 1JKOC 2EV0A 3AG4H 4CCKA 4S04A 3K69A 3HSRA 4R8HA 3C7JA 4EJVA 3GTKJ 3W2VA 3HOUJ 2VC1A 4EJOA 5JVGF 2IRFG 2X4HA 1QNTA 5M3FJ 3FWEA 4MHGA 4E7KA 2FQ3A 1FT9A 1Z7UA 3E5QA 2ECBA 3QPLA 1MJ9A 4ENNA 4BNCA 3S16J 3GFJA 1IRFA 2R4GA 4IRGA 1YQAA 2BXYA 2VE9A 2O8KA 2VXZA 2BHYA 2ZMEB 2O9LA 2M45A 1ZK8A 2EFNA 1MDMA 1ITYA 5K7HA 2ZSIB 2MC3A 2KL4A 1KGSA 1H0MA 1VQNI 1XN7A 4YG2F 4KYWA 1Y0NA 2FJ1A 3LOCA 4CCJA 3Q0VA 1OLTA 2ZXIA 5E18F 2M5WA 4DBRA 1BJAA 1GV2A 3GZ6A 1FJLA 4A6DA 3GTMJ 5LHIA 1FP1D 3L9FA 3RQIA 3S32A 4IHWA 3DF8A 4BE0A 3ZMZA 1WJCA 3P9IA 2BBYA 4HV5A 5F0FA 3TL4X 1Y56A 1EH8A 2Y30A 2E5NA 1B9NA 3GF2A 4OOIA 3WU0A 2LKXA 3TW6A 1KU9A 2JT1A 2OZUA 2JWTA 2ZBKA 3C18A 3DCFA 4AWXB 4EMSA 3G1OA 3ZQIA 2JRTA 2CS3A 3E1SA 3T8TA 3DEEA 3W6VA 4Z6YA 3PNVA 2IJLA 1V55H 1T95A 2FF4A 3VFZA 4C30A 1HCRA 1FYKA 4CGZA 3JAMK 1XMKA 3CC2I 2EIMH 4B43A 5AIQA 4O5VA 5K5RA 2QKMB 5KCMA 1HSJA 5HS8A 1A6QA 1R1VA 1ORKA 2OC6A 2FBKA 4HNUA 3JTGA 1YLFA 2IPQX 1MMAA 1XMAA 2F5DA 3FKIJ 2JMWA 4MLOA 4M72A 1SEUA 2XHKA 2DQRA 4B09A 1FMVA 3HUGA 1IC8A 1SVMA 1ULYA 3OSFA 4B1RA 1S29A 1QVUA 3DU5A 3KYCB 5H6RA 3TP0A 4P9UA 2HEOA 2YUSA 4CYDA 2GA2A 1Z7LA 3RIRA 4YFKF 3EETA 2V6EA 2NAZA 4CZCA 3HDDA 1IRXA 4PUSA 5IPAA 2F48A 4BUPA 2KIUA 1G3YA 1IJWC 3L2QA 3ZCOA 1Z21A 3BCBA 3BPXA 3L1PA 3AAFA 3W6KB 3ZPLA 1LE8A 2V1XA 5IT9Z 2L02A 4IQJA 1LFBA 2HXIA 2A6TA 4CCMA 2PMZN 2PX9A 3DXJF 3NQOA 2Y31A 3VOEA 4RGXA 1OQYA 2L0KA 2RN7A 1P9QC 2VJ4A 3DKWA 3WHCA 1IG7A 5EGOA 1U9NA 2R7VA 1X3ZB 2K9LA 1I3QJ 2AQFA 3HSFA 1LVKA 3RZDJ 3LFUA 5F1JA 4A5MA 2H27A 3CC4I 4LLNA 4CUGA 1IAWA 2E60A 5IY5H 1FX7A 4XLHA 1D3YA 2ZMEA 1FTTA 2Y0SA 3KP3A 1PYVA 2VT2A 2MLGA 1X3WB 2DK8A 4ZYDA 4UB6C 4D0PA 1HKSA 3N97A 2DMPA 4KN4X 4C2MJ 2MLKA 1TWFJ 3S2WA 2VJJA 3ASOH 3VODA 2F5CA 4Y52J 3EYYA 5KK1A 4Y13A 5D6EA 2DDBA 4KFCA 3AL0B 3I4MJ 4IOAF 1P6RA 3CCRI 4B4CA 3ZRGA 1ODDA 1BI3A 1ONVA 2H09A 3LQQA 1R71A 1HA8A 2LY1A 4UNOA 1K6YA 3DPUA 3LSTA 1K83J 4XLCA 1ETYA 4MFDA 2ZJRF 2AS5F 4I99C 5GP9A 2CWEA 4L9VA 4EM1A 3HXLA 3SFZA 4JX5A 1QA6A 2D1HA 3AFHA 3CP2A 1MIJA 3LWFA 1Y0UA 2DMTA 3NARA 4HNTA 4XRFA 1KONA 4AIJA 2UUZA 5E3NA 5JLXA 1MMGA 5IOZA 3HPHA 2ZNZA 3KEQA 4B3XA 4FQGA 3CCSI 2LF8A 4XIDA 2KHMA 5JFRA 3JRBA 1P92A 4MQ9F 3KETA 2PQ8A 4NQWB 4S05A 1S72I 3A0HC 4DYCA 5M5YJ 3CJRB 3FXKA 1MNEA 2EV6A 2JUCA 2Y69H 1PUFB 4I98B 4RAZA 3OYCA 3BCAA 4GRIA 4EM2A 4PDKA 2J5OA 3KPHA 3WTWC 4Q4ZF 1USTA 1Z0XA 3FXMA 2GLOA 4KT6A 1FY7A 3A01B 2FA5A 1XCVA 1D0YA 1W36C 1D5YA 3W2WA 1BN5A 1W7PA 2I5UA 5J1UA 4ON0A 3JRDA 3ECOA 1C0WA 1ETVA 2P5KA 3KZZA 3RKWA 4B8XA 1EV7A 3HOXJ 4OWRB 2HOTA 4M6XA 5DDGA 1H8AC 2R5YB 3K4NA 4KMFA 4XLNF 3F21A 4A2UA 3U9GA 3H9GA 2M0CA 4M74A 4RBOA 4FTHA 3ESWB 1OISA 3ABUA 2LKSA 4IX7A 3M07A 1G6NA 4HOBA 3U1KA 4M6YA 1TWGJ 3F72A 3LFKA
chains in the Genus database with same CATH topology
2YX4A 3WGGA 4HQEA 2PG4A 1H9GA 5K5QA 3F8MA 5BQTA 2RDPA 2RNJA 4MTEA 1SFUA 3E6MA 3FMRA 1K7AA 4L5JA 3IL2A 4IHTA 4MTDA 2VODA 3JW4A 3GW2A 2Q0OA 1GHCA 1WRJA 1YO5C 1IW7F 2X0LA 2ISZA 5HOOA 1WQ2A 4ENJA 4NQWA 4P9FA 3V8KA 3K2ZA 4PGGA 5LRSA 2OAZA 1XGMA 3WTTC 1YIOA 3GWZA 4HX4A 4HDUA 3R61A 1UCRA 2LSOA 1SD6A 1ZLKA 2VBXA 4Y17A 4BYYA 3K1PA 3WTSC 1K79A 4OIOF 4UV8A 3HOSA 2HYGD 1MD0A 5D5VB 4U0YA 4HLXA 1U3EM 5LLQA 5HLHA 5D5WB 1JXSA 4FHTA 3F8FA 4Q5SF 4ZH4F 1BIAA 1FC3A 3IRRA 2CQKA 3CDHA 1T0FA 5AIPA 2DK5A 2HTJA 2P5LC 2ZO4A 3WGIA 2Z99A 3H92A 3WU1B 5CYVA 2KJBA 2STTA 3E97A 2V79A 4HF2A 2A07F 3LAPA 3J7AO 3BOQA 4I01A 3TO9A 3O3KA 1D8KA 4MGRA 2FRHA 2EFOA 1I1GA 1PP7U 4E70A 1MJAA 3TQNA 3KFWX 1UB9A 4YIFA 5DUKA 2Q8KA 1AOYA 4HAMA 5JI6A 4BQAA 1J0RA 2V1DA 4Z2YA 5ICFA 2PEXA 1P4AA 3CJNA 2HYFA 3WGHA 1E17A 2K4JA 3V7RA 1GXQA 2CYYA 1QZYA 2YU3A 4PZJA 4U88A 1YTYA 5IT3A 2G7HA 1EH6A 2XAQA 2GXGA 5CVUA 1F5TA 3FX3A 3JSOA 5HDGA 2XAHA 3J81Z 1R36A 3P9CA 2Q2EA 1UFMA 2GAUA 2XROA 2JPCA 1I5ZA 1I6XA 3L00A 2WTEA 2QVOA 3EDPA 5E1XA 5J6XA 5E20A 4EJTA 2E1CA 1STZA 5JR3A 1TNSA 3MZYA 2EFPA 1R7JA 3IRQA 3M7GA 3FM3A 3CLOA 3KP2A 4N9IA 3F22A 1MJBA 2BV6A 2COMA 1ON1A 2PFBA 2D45A 1O57A 1D8JA 3E5UA 1S6LA 3VEPA 4L5IA 2DQLA 2P7CB 4AIHA 3I5UA 4OIRF 5L3EA 2DO7A 5CJ9A 2A3SA 5DCMB 6PAXA 3WTVC 3RPQA 3V8JA 5D8LB 1BBYA 1KQ9A 4BAYA 1EH7A 4A0XA 2P6SA 1W4MA 2K86A 1RI7A 3SZTA 3DPTA 3F6VA 4G6QA 3I59B 2YSRA 1FWZA 5J8FA 2QENA 1TW2A 2BYVE 1Z91A 1TW3A 1T2KA 1W5SA 4LK1F 5DUIA 4JQFA 3EYIA 3WTYC 2LNBA 2BEOA 2DTRA 3WE2A 1B59A 4P55A 2D2WA 1JE8A 5ICGA 3RYPA 3GXOA 3EQLF 1A04A 2QQBA 2OBPA 2ESHA 1R5HA 1IXCA 2O03A 4UUVA 4ENMA 1YFHA 4LG0A 3GYHX 3ZN1A 2DT5A 2CSOA 4F7ZA 2NRAC 3BY6A 1O7LA 1ZREA 1UHMA 1JHFA 3RTRA 4A5NA 4LLLA 2YR2A 4GYGA 2FSWA 1KU7A 3I53A 2W84A 4CZZA 1ZRCA 1BI1A 2A69F 5CLSA 4DNCA 2CGPA 3WTZA 4U7BA 3C3WA 1MZBA 1KYWA 2PMHA 2B0LA 5BMZA 3J81K 1ZGAA 3IKVA 2HKXA 5LRRA 2XIGA 2UWMA 2OD5A 1YYVA 1HBXG 1TLHB 4ZZLA 1J75A 1L0OC 1W7PD 3I71A 1IXSB 4G7HF 1YG2A 4L9NA 4WXHA 1XSXA 4MEYF 3FF5A 4GXOA 5E8IA 2LF7A 2XAFA 2V9VA 2FNPA 3DV8A 2OQRA 3V7SA 2EA4A 2E1NA 3GO5A 3GLXA 1G3SA 4OU0A 2VBYA 2TDXA 3H3ZA 1TTYA 2P8TA 3T1BA 1OMIA 4L0ZB 2QLZA 4M71A 2DAOA 5BPIA 5D5XB 3D0SA 4ASNA 1F4KA 4WX9A 4LGWA 2Y75A 4M9ZA 1FPQA 1Z6TA 4O3MA 3RJPA 2DPUA 1JGSA 4NB5A 1B6AA 3QP5A 4YIIA 1FBUA 4G9YA 4M73A 3FMSA 2A68F 1ZG1A 3ECHA 3E6CC 1LEBA 3F23A 3M9AA 4AD9A 3GFMA 3LA7A 2L4AA 1Z9CA 4UXNA 3MEXA 1MGTA 3DP7A 4HX7A 3HHGA 1LNWA 3ZMUA 2EFQA 3R4KA 3F6OA 3CUQC 1W7PB 5D8KB 1ZYRF 5D6FA 1J5YA 3GFLA 5A2QZ 3MQ0A 1O3TA 3KP6A 4U7DA 4LLGF 3OV8A 2IVMA 4L9TA 2P5VA 1U5TA 1YW8A 2O8XA 3TDZC 1QZZA 2XUBA 2QBYB 1T39A 2VBZA 1S8NA 4ZYGA 3FMQA 1Z1DA 4EVIA 5FGMA 2EK5A 1W5TA 2MH2A 4UVAA 2Z9OA 4EJWA 2W85A 4BXUA 3ZMTA 2QM3A 4U0VA 5D5UB 1PUEE 4WXCA 5ILVA 4MNUA 3T8RA 4YFXF 3WE3A 3ROUA 4GCVA 3J80Z 2WC2A 4HV6A 2GQQA 4HLYA 1SFXA 3JSPA 5F1RA 2OU2A 5HLGA 1KQ8A 1YW7A 2RKHA 4UHTA 2XAGA 3W6JB 2FBIA 3MCZA 5CVJA 1R22A 5K1YA 1R5GA 1BM9A 1ZGJA 2F5FA 5L3DA 5HDNA 2L3DA 2VOPA 1P4WA 1U6GA 1ON2A 2M8EA 4G94A 3EUHA 4RGRA 1KU3A 3L2CA 1LDKB 2HQRA 2OZ6A 3ELKA 2RGVA 1D5VA 1FBSA 2W25A 2IW5A 3RYRA 2FNAA 3F8BA 5BPDA 2QBYA 3FXQA 1SD7A 1SMTA 4BHBA 5ICCA 3F8NA 2UXXA 1WWXA 1KQ0A 2WV0A 3K0LA 1B9MA 4HZFA 4LD5A 3KE2A 2L01A 4ESBA 3ZMVA 2HKOA 1MDMB 4IJAA 1I27A 1LQ1A 3R6SA 5DYMA 1IN4A 2CG4A 2Y48A 5L3BA 1LDDA 4KA4A 2HZTA 1ZG5A 3KLNA 3VB2A 3RKXA 1R00A 3BWGA 2MBFA 3MFKA 1OKRA 3TOAA 4RB0A 3ERED 1RZ4A 2VT3A 1ZG3A 2Y0MA 3BP8A 3HTUA 1S7OA 5CVRA 3I0TA 3P7NA 2CW0F 4LB5A 4G6DA 1K78B 1X3UA 2FU4A 4IPAA 3O6BB 4LMYA 4P5OA 5FB2A 4XSZF 1HKTA 4O6JA 4CDGA 5L3FA 3PQJA 1O3RA 1IRGA 2KIFA 2MD5A 3CUQA 1U78A 4LB6B 3ABTA 3I59A 5FFXA 4Q48A 2HR3A 4UVBA 4OMYA 3CO7C 1V3FA 3CTAA 2P6TA 1DDNA 3HOTA 2O6GE 2JZYA 4ENKA 1FNNA 3WODF 1SAXA 4KIGA 1HW5A 2ZJ2A 1IN7A 5LGUA 1ZRDA 5K5OA 3Q9VA 3QU3A 5BS6A 1TQIA 4GGGA 3E6BA 3RDIA 1R58A 2CO5A 3I58A 1UHWA 5H20A 3G3ZA 5IT9K 2DW4A 2O3FA 2NNNA 3LA3A 4KIFA 4A0ZA 1E2XA 2M1BA 3HSEA 2XAJA 5HS9A 3KLOA 2UXNA 1YS6A 4IVNA 3NRVA 2HDCA 1S7AA 3KZYA 4LFUA 1OYWA 2PBIA 3HRSA 1O7FA 2VE8A 1QQIA 1XSVA 4PCQA 4IXAA 3T5XA 2HQNA 2QZ8A 4EJUA 5J8CA 4G8XA 4WF2A 4QLCU 4I02A 1ZRFA 3HHHA 1Z05A 4LJZF 4HBLA 4UVCA 3BJOA 3REOA 2D1VA 5EEHA 4ETSA 3IHUA 3BZ6A 4HDVA 3L09A 4RB3C 2PMUA 2IA2A 2C6YA 2KIMA 3FZVA 4XLPF 5JVTA 3E6DA 2UZKA 2L4MA 4L9JA 2E7WA 2ACJA 1FYMA 4JK1X 4RS8A 4GYIA 4RB1A 5JHUA 1GXPA 4H0EA 1FP2A 4KMUX 3HRTA 5LGTA 1DPUA 3WG9A 1P2FA 4HQMA 2A6HF 2YX7A 5H6QA 5ILSA 1T98A 5DD8A 2O0YA 4CXFA 4HYEA 1B4AA 1F1ZA 1R23A 3DQVC 1P4XA 2Z5UA 1QBJA 3R0JA 2A6EF 2Z33A 3TO6A 4RAYA 3KP7A 5LHGA 4U0WA 1FLIA 4I09A 2KRFA 1HW2A 4KT5C 3HRUA 1J59A 3I64A 1U8RA 1SMYF 5FLXK 1B1BA 2QWWA 3T0YA 4HF1A 3WTUC 4Y15A 2BGCA 3U1DA 2EV5A 1DP7P 2P4WA 2QYOA 3N4MA 3QPTA 4EGZA 1RIOH 2DPDA 5HVQC 5DCFA 2ZKZA 4WWCA 2RVCA 5DEQA 2XASA 2FMYA 1SD5A 2PI0A 4LK0F 2IA1A 1OR7A 3TO7A 1RUOA 1USSA 1ZHFA 1ZH5A 2XRNA 1SD4A 2VN2A 3V4GA 4HW0A 2NYXA 3HRMA 1TQPA 4BHCA 4OIQF 3K1MA 4R79A 3MZHA 4L18B 2XV4S 4DQ2A 1NHAA 4JBAA 1IN8A 1CF7A 1H9TA 2ZXJA 4I2OA 2MH9A 1FSHA 3KP4A 1BIBA 2VC0A 3B73A 5BOXA 2IP2A 5E8GA 5A2QK 5HDKA 5ICEA 3GVAA 5TRDA 1V4RA 3Q9SA 3LA2A 4G7ZF 2G7UA 2HTSA 1QPMA 1IXRC 1FSEA 1R1TA 4I7HA 4Q47A 1XGNA 2ISYA 5E1ZB 4EV0A 4EQQA 3GEZA 3RPUA 2AXLA 3ZMDA 3CUQB 3HYIA 1BI2A 1O3QA 2RQPA 1BC8C 1HSTA 1RNLA 1OYYA 3O2PE 2WWYA 3COAC 1ZARA 4EGYA 5FD5A 4KNYA 2LDUA 1PP8F 4OMZA 4I0BA 3FXUA 5HLIA 3JTHA 1HW1A 1REPC 2L54A 2JSCA 4OINF 5AONA 2J5PA 3FXRA 1T6SA 3FM5A 4CICA 2K02A 3LQRA 4BHPA 2HGCA 3IWZA 1MKMA 3TGNA 3E5XA 4ZZDA 1FBQA 4ZYHA 2QQAA 4HX8A 2VONA 1O3SA 1F9NA 2K4BA 4XSXF 2DU9A 3V7CA 4FX4A 3ZN0A 1IN5A 5D4SA 1ZLJA 4IF4A 4CO8A 2PLYA 5KVRA 2HFHA 2HS5A 2FBHA 2ZFWA 1J7KA 1ZN2A 1LEAA 2JTVA 2FXAA 3P9KA 2EFWA 3DEUA 3KEOA 2IT0A 1G4DA 3Q5FA 4M9SA 4IHSA 3C1DA 1QGPA 3M8EA 4FT8A 4KICA 4TV7A 1WI9A 2RC4A 4RGSA 2XKPA 1JHHA 2HWVA 2NNYA 5DV5A 4P96A 3F3XA 2GZWA 4ZYEA 3IWFA 1KYZA 4FX0A 3R60A 1Q1HA 3G73A 2PN6A 3HTSB 2GXBA 4G7OF 3NEUA 4QWQA 5TJJA 2KJCA 3BJ6A 2ZCWA 2Z3YA 1BI0A 2EA2A 3ZP5A 2EWNA 1TNTA 1WKMA 4RB2C 2K7LA 1CGPA 1IZ1A 5CVVA 2PJPA 5LGNA 1S3JA 3DPLC 1XDUA 3D5LA 3FHZA 3B02A 2QUFA 1OYIA 5ED4A 3PFIA 2DLLA 3CO6C 3GZ5A 4LG0B 3SHFA 5D4RA 1K78A 2H94A 1R1UA 2EJRA 5HS7A 1FYLA 1DPRA 2M30A 4IRIA 2HOEA 3M1EA 2ETHA 1SFEA 5E1WA 1XCBA 3H3UA 2V1UA 3ZQ7A 3R0AA 2K27A 2W24A 2NS0A 1TBXA 4M9XA 1YS7A 5ERIA 2G9WA 1BOAA 3BPVA 2DBBA 1U2WA 2BE5F 3QRFF 4XBFA 2F5EA 3SZPA 1FOKA 2ADUA 2FOKA 1G3WA 2QQ9A 2EB7A 2V6CA 3RKYA 2H6CA 2R3SA 1LVAA 1XGOA 1XSDA 3I4PA 3QP6A 3GFIA 3MWMA 2M87A 4AIKA 4EM0B 3BDDA 3CUOA 2W57A 1DUXC 4YFNF 3V8LA 1YW9A 3LAJA 1OPCA 2IA0A 1PDNC 1HXDA 1LB2A 2R7FA 4KN7X 4PGHA 1FZPB 3K1NA 5DD4A 3QOPA 3E3VA 4N9HA 4ESJA 2GIVA 5EEGA 1L3LA 3TOBA 2GWRA 3ISPA 4NHJA 4HA8A 2XVCA 1J2XA 3F8CA 3L7WA 5CVIA 3TDUC 1IN6A 4AVPA 3RI4A 2OQGA 2GA1A 1HQCA 3QPHA 3K9TA 2R7DA 1HKQA 4A0YA 1IF1A 1QO0D 1Z6RA 1LDJA 4OIPF 3QAHA 4HF0A 3WTXC 2XKOA 5LBQA 4GO1A 2F2EA 4BH9A 4MEXF 1BC7C 3GUDA 1LJ9A 2OA4A 3U2RA 4KIBA 2FMLA 4WK8F 2A61A 3IC7A 3SQNA 3ULQB 5E17F 2ESNA 5L3GA 5ILUA 1TQMA 1U5TB 5LHHA 4WCGA 5FLXZ 4IRHA 5FO5A 1K6OA 4MQVA 2A5YB 4UV9A 1RUNA 4R1HA 1T38A 3OOPA 4RGUA 3JAMZ 5FFZA 4A6EA 1VTNC 3ZMSA 3M8FA 3ML6A 3PQKA 1CF7B 3J80K 3BROA 4K2EA 4N0BA 5F64A 1XGSA 2ZNYA 2CFXA 3I54A 2STWA 2E7XA 1ZAOA 2LKPA 1XDSA 3KCCA 1IUYA 5F6FA 3MAJA 4KUMA 1G3TA 3DFGA 2DI3A 4L0YB 2DFIA 1XD7A 1U5TC 2RV8A 2O61A 2H6BA 2FE3A 1KU2A 4KDPA 2JPBA 1XB4A 1WSUA 5FD6A 1GVJA 3BJAA 4I0AA 2KKOA 3HIFA 3QU6A 3SXYA 1J9IA 2FEZA 1I1SA 2P7VB 5LEKA 5LEJA 4CHUA 2VBWA 4WXDA 3KP5A 5DCMA 2XGXA 1KA8A 3TKYA 2ELHA 3GX4X 2VOOA 4ESFA 2YPRA 4A12A 2MA3A 1AWCA 3IKTA 5L3CA 2EV0A 4S04A 3K69A 3HSRA 4R8HA 3C7JA 4EJVA 2VC1A 4EJOA 2IRFG 2X4HA 1QNTA 3FWEA 4MHGA 2FQ3A 1FT9A 1Z7UA 3E5QA 4ENNA 1MJ9A 4BNCA 3GFJA 1IRFA 4IRGA 1YQAA 2VE9A 2VXZA 2ZMEB 2M45A 2EFNA 1MDMA 2MC3A 1KGSA 1H0MA 1XN7A 4YG2F 4KYWA 5E18F 2M5WA 1BJAA 3GZ6A 4A6DA 5LHIA 1FP1D 3L9FA 3DF8A 3ZMZA 3P9IA 2BBYA 4HV5A 1EH8A 1B9NA 3GF2A 4OOIA 3WU0A 1KU9A 2JT1A 2OZUA 2ZBKA 3C18A 4AWXB 4EMSA 2JRTA 3T8TA 2IJLA 2FF4A 3VFZA 1FYKA 4CGZA 3JAMK 1XMKA 5AIQA 4O5VA 5K5RA 1HSJA 5HS8A 1R1VA 2FBKA 3JTGA 1YLFA 2IPQX 1XMAA 2F5DA 4M72A 2XHKA 2DQRA 4B09A 3HUGA 1ULYA 1S29A 5H6RA 2HEOA 4P9UA 4CYDA 2GA2A 3RIRA 4YFKF 3EETA 2NAZA 2KIUA 1G3YA 3BPXA 3AAFA 3ZPLA 3W6KB 2V1XA 5IT9Z 2L02A 3DXJF 3NQOA 3VOEA 4RGXA 2RN7A 3DKWA 3HSFA 4A5MA 2H27A 4LLNA 1IAWA 1FX7A 1D3YA 2ZMEA 3KP3A 2VT2A 2MLGA 2DK8A 4ZYDA 4D0PA 1HKSA 3N97A 4KN4X 2MLKA 3S2WA 3VODA 2F5CA 3EYYA 5KK1A 4Y13A 5D6EA 4KFCA 1P6RA 1ODDA 1BI3A 1ONVA 2H09A 3LQQA 4UNOA 3LSTA 2AS5F 2CWEA 4L9VA 4EM1A 3SFZA 2D1HA 3LWFA 1Y0UA 4XRFA 4AIJA 2ZNZA 3KEQA 2LF8A 5JFRA 1P92A 4MQ9F 3KETA 2PQ8A 4S05A 2EV6A 4I98B 4RAZA 4EM2A 4PDKA 2J5OA 3WTWC 4Q4ZF 1USTA 1FY7A 2FA5A 1XCVA 1BN5A 1W7PA 4ON0A 3ECOA 1C0WA 2P5KA 3KZZA 3RKWA 4B8XA 1EV7A 4M6XA 5DDGA 4KMFA 4XLNF 3F21A 4A2UA 3U9GA 4M74A 3ABUA 1G6NA 4HOBA 4M6YA 3F72A 3LFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX4 A;  3WGG A;  4HQE A;  2PG4 A;  1H9G A;  5K5Q A;  3F8M A;  5BQT A;  2RDP A;  2RNJ A;  4MTE A;  1SFU A;  3E6M A;  3FMR A;  1K7A A;  4L5J A;  3IL2 A;  4IHT A;  4MTD A;  2VOD A;  3JW4 A;  3GW2 A;  2Q0O A;  1GHC A;  1WRJ A;  1YO5 C;  1IW7 F;  2X0L A;  2ISZ A;  5HOO A;  1WQ2 A;  4ENJ A;  4NQW A;  4P9F A;  3V8K A;  3K2Z A;  4PGG A;  5LRS A;  2OAZ A;  1XGM A;  3WTT C;  1YIO A;  3GWZ A;  4HX4 A;  4HDU A;  3R61 A;  1UCR A;  2LSO A;  1SD6 A;  1ZLK A;  2VBX A;  4Y17 A;  4BYY A;  3K1P A;  3WTS C;  1K79 A;  4OIO F;  4UV8 A;  3HOS A;  2HYG D;  1MD0 A;  5D5V B;  4U0Y A;  4HLX A;  1U3E M;  5LLQ A;  5HLH A;  5D5W B;  1JXS A;  4FHT A;  3F8F A;  4Q5S F;  4ZH4 F;  1BIA A;  1FC3 A;  3IRR A;  2CQK A;  3CDH A;  1T0F A;  5AIP A;  2DK5 A;  2HTJ A;  2P5L C;  2ZO4 A;  3WGI A;  2Z99 A;  3H92 A;  3WU1 B;  5CYV A;  2KJB A;  2STT A;  3E97 A;  2V79 A;  4HF2 A;  2A07 F;  3LAP A;  3J7A O;  3BOQ A;  4I01 A;  3TO9 A;  3O3K A;  1D8K A;  4MGR A;  2FRH A;  2EFO A;  1I1G A;  1PP7 U;  4E70 A;  1MJA A;  3TQN A;  3KFW X;  1UB9 A;  4YIF A;  5DUK A;  2Q8K A;  1AOY A;  4HAM A;  5JI6 A;  4BQA A;  1J0R A;  2V1D A;  4Z2Y A;  5ICF A;  2PEX A;  1P4A A;  3CJN A;  2HYF A;  3WGH A;  1E17 A;  2K4J A;  3V7R A;  1GXQ A;  2CYY A;  1QZY A;  2YU3 A;  4PZJ A;  4U88 A;  1YTY A;  5IT3 A;  2G7H A;  1EH6 A;  2XAQ A;  2GXG A;  5CVU A;  1F5T A;  3FX3 A;  3JSO A;  5HDG A;  2XAH A;  3J81 Z;  1R36 A;  3P9C A;  2Q2E A;  1UFM A;  2GAU A;  2XRO A;  2JPC A;  1I5Z A;  1I6X A;  3L00 A;  2WTE A;  2QVO A;  3EDP A;  5E1X A;  5J6X A;  5E20 A;  4EJT A;  2E1C A;  1STZ A;  5JR3 A;  1TNS A;  3MZY A;  2EFP A;  1R7J A;  3IRQ A;  3M7G A;  3FM3 A;  3CLO A;  3KP2 A;  4N9I A;  3F22 A;  1MJB A;  2BV6 A;  2COM A;  1ON1 A;  2PFB A;  2D45 A;  1O57 A;  1D8J A;  3E5U A;  1S6L A;  3VEP A;  4L5I A;  2DQL A;  2P7C B;  4AIH A;  3I5U A;  4OIR F;  5L3E A;  2DO7 A;  5CJ9 A;  2A3S A;  5DCM B;  6PAX A;  3WTV C;  3RPQ A;  3V8J A;  5D8L B;  1BBY A;  1KQ9 A;  4BAY A;  1EH7 A;  4A0X A;  2P6S A;  1W4M A;  2K86 A;  1RI7 A;  3SZT A;  3DPT A;  3F6V A;  4G6Q A;  3I59 B;  2YSR A;  1FWZ A;  5J8F A;  2QEN A;  1TW2 A;  2BYV E;  1Z91 A;  1TW3 A;  1T2K A;  1W5S A;  4LK1 F;  5DUI A;  4JQF A;  3EYI A;  3WTY C;  2LNB A;  2BEO A;  2DTR A;  3WE2 A;  1B59 A;  4P55 A;  2D2W A;  1JE8 A;  5ICG A;  3RYP A;  3GXO A;  3EQL F;  1A04 A;  2QQB A;  2OBP A;  2ESH A;  1R5H A;  1IXC A;  2O03 A;  4UUV A;  4ENM A;  1YFH A;  4LG0 A;  3GYH X;  3ZN1 A;  2DT5 A;  2CSO A;  4F7Z A;  2NRA C;  3BY6 A;  1O7L A;  1ZRE A;  1UHM A;  1JHF A;  3RTR A;  4A5N A;  4LLL A;  2YR2 A;  4GYG A;  2FSW A;  1KU7 A;  3I53 A;  2W84 A;  4CZZ A;  1ZRC A;  1BI1 A;  2A69 F;  5CLS A;  4DNC A;  2CGP A;  3WTZ A;  4U7B A;  3C3W A;  1MZB A;  1KYW A;  2PMH A;  2B0L A;  5BMZ A;  3J81 K;  1ZGA A;  3IKV A;  2HKX A;  5LRR A;  2XIG A;  2UWM A;  2OD5 A;  1YYV A;  1HBX G;  1TLH B;  4ZZL A;  1J75 A;  1L0O C;  1W7P D;  3I71 A;  1IXS B;  4G7H F;  1YG2 A;  4L9N A;  4WXH A;  1XSX A;  4MEY F;  3FF5 A;  4GXO A;  5E8I A;  2LF7 A;  2XAF A;  2V9V A;  2FNP A;  3DV8 A;  2OQR A;  3V7S A;  2EA4 A;  2E1N A;  3GO5 A;  3GLX A;  1G3S A;  4OU0 A;  2VBY A;  2TDX A;  3H3Z A;  1TTY A;  2P8T A;  3T1B A;  1OMI A;  4L0Z B;  2QLZ A;  4M71 A;  2DAO A;  5BPI A;  5D5X B;  3D0S A;  4ASN A;  1F4K A;  4WX9 A;  4LGW A;  2Y75 A;  4M9Z A;  1FPQ A;  1Z6T A;  4O3M A;  3RJP A;  2DPU A;  1JGS A;  4NB5 A;  1B6A A;  3QP5 A;  4YII A;  1FBU A;  4G9Y A;  4M73 A;  3FMS A;  2A68 F;  1ZG1 A;  3ECH A;  3E6C C;  1LEB A;  3F23 A;  3M9A A;  4AD9 A;  3GFM A;  3LA7 A;  2L4A A;  1Z9C A;  4UXN A;  3MEX A;  1MGT A;  3DP7 A;  4HX7 A;  3HHG A;  1LNW A;  3ZMU A;  2EFQ A;  3R4K A;  3F6O A;  3CUQ C;  1W7P B;  5D8K B;  1ZYR F;  5D6F A;  1J5Y A;  3GFL A;  5A2Q Z;  3MQ0 A;  1O3T A;  3KP6 A;  4U7D A;  4LLG F;  3OV8 A;  2IVM A;  4L9T A;  2P5V A;  1U5T A;  1YW8 A;  2O8X A;  3TDZ C;  1QZZ A;  2XUB A;  2QBY B;  1T39 A;  2VBZ A;  1S8N A;  4ZYG A;  3FMQ A;  1Z1D A;  4EVI A;  5FGM A;  2EK5 A;  1W5T A;  2MH2 A;  4UVA A;  2Z9O A;  4EJW A;  2W85 A;  4BXU A;  3ZMT A;  2QM3 A;  4U0V A;  5D5U B;  1PUE E;  4WXC A;  5ILV A;  4MNU A;  3T8R A;  4YFX F;  3WE3 A;  3ROU A;  4GCV A;  3J80 Z;  2WC2 A;  4HV6 A;  2GQQ A;  4HLY A;  1SFX A;  3JSP A;  5F1R A;  2OU2 A;  5HLG A;  1KQ8 A;  1YW7 A;  2RKH A;  4UHT A;  2XAG A;  3W6J B;  2FBI A;  3MCZ A;  5CVJ A;  1R22 A;  5K1Y A;  1R5G A;  1BM9 A;  1ZGJ A;  2F5F A;  5L3D A;  5HDN A;  2L3D A;  2VOP A;  1P4W A;  1U6G A;  1ON2 A;  2M8E A;  4G94 A;  3EUH A;  4RGR A;  1KU3 A;  3L2C A;  1LDK B;  2HQR A;  2OZ6 A;  3ELK A;  2RGV A;  1D5V A;  1FBS A;  2W25 A;  2IW5 A;  3RYR A;  2FNA A;  3F8B A;  5BPD A;  2QBY A;  3FXQ A;  1SD7 A;  1SMT A;  4BHB A;  5ICC A;  3F8N A;  2UXX A;  1WWX A;  1KQ0 A;  2WV0 A;  3K0L A;  1B9M A;  4HZF A;  4LD5 A;  3KE2 A;  2L01 A;  4ESB A;  3ZMV A;  2HKO A;  1MDM B;  4IJA A;  1I27 A;  1LQ1 A;  3R6S A;  5DYM A;  1IN4 A;  2CG4 A;  2Y48 A;  5L3B A;  1LDD A;  4KA4 A;  2HZT A;  1ZG5 A;  3KLN A;  3VB2 A;  3RKX A;  1R00 A;  3BWG A;  2MBF A;  3MFK A;  1OKR A;  3TOA A;  4RB0 A;  3ERE D;  1RZ4 A;  2VT3 A;  1ZG3 A;  2Y0M A;  3BP8 A;  3HTU A;  1S7O A;  5CVR A;  3I0T A;  3P7N A;  2CW0 F;  4LB5 A;  4G6D A;  1K78 B;  1X3U A;  2FU4 A;  4IPA A;  3O6B B;  4LMY A;  4P5O A;  5FB2 A;  4XSZ F;  1HKT A;  4O6J A;  4CDG A;  5L3F A;  3PQJ A;  1O3R A;  1IRG A;  2KIF A;  2MD5 A;  3CUQ A;  1U78 A;  4LB6 B;  3ABT A;  3I59 A;  5FFX A;  4Q48 A;  2HR3 A;  4UVB A;  4OMY A;  3CO7 C;  1V3F A;  3CTA A;  2P6T A;  1DDN A;  3HOT A;  2O6G E;  2JZY A;  4ENK A;  1FNN A;  3WOD F;  1SAX A;  4KIG A;  1HW5 A;  2ZJ2 A;  1IN7 A;  5LGU A;  1ZRD A;  5K5O A;  3Q9V A;  3QU3 A;  5BS6 A;  1TQI A;  4GGG A;  3E6B A;  3RDI A;  1R58 A;  2CO5 A;  3I58 A;  1UHW A;  5H20 A;  3G3Z A;  5IT9 K;  2DW4 A;  2O3F A;  2NNN A;  3LA3 A;  4KIF A;  4A0Z A;  1E2X A;  2M1B A;  3HSE A;  2XAJ A;  5HS9 A;  3KLO A;  2UXN A;  1YS6 A;  4IVN A;  3NRV A;  2HDC A;  1S7A A;  3KZY A;  4LFU A;  1OYW A;  2PBI A;  3HRS A;  1O7F A;  2VE8 A;  1QQI A;  1XSV A;  4PCQ A;  4IXA A;  3T5X A;  2HQN A;  2QZ8 A;  4EJU A;  5J8C A;  4G8X A;  4WF2 A;  4QLC U;  4I02 A;  1ZRF A;  3HHH A;  1Z05 A;  4LJZ F;  4HBL A;  4UVC A;  3BJO A;  3REO A;  2D1V A;  5EEH A;  4ETS A;  3IHU A;  3BZ6 A;  4HDV A;  3L09 A;  4RB3 C;  2PMU A;  2IA2 A;  2C6Y A;  2KIM A;  3FZV A;  4XLP F;  5JVT A;  3E6D A;  2UZK A;  2L4M A;  4L9J A;  2E7W A;  2ACJ A;  1FYM A;  4JK1 X;  4RS8 A;  4GYI A;  4RB1 A;  5JHU A;  1GXP A;  4H0E A;  1FP2 A;  4KMU X;  3HRT A;  5LGT A;  1DPU A;  3WG9 A;  1P2F A;  4HQM A;  2A6H F;  2YX7 A;  5H6Q A;  5ILS A;  1T98 A;  5DD8 A;  2O0Y A;  4CXF A;  4HYE A;  1B4A A;  1F1Z A;  1R23 A;  3DQV C;  1P4X A;  2Z5U A;  1QBJ A;  3R0J A;  2A6E F;  2Z33 A;  3TO6 A;  4RAY A;  3KP7 A;  5LHG A;  4U0W A;  1FLI A;  4I09 A;  2KRF A;  1HW2 A;  4KT5 C;  3HRU A;  1J59 A;  3I64 A;  1U8R A;  1SMY F;  5FLX K;  1B1B A;  2QWW A;  3T0Y A;  4HF1 A;  3WTU C;  4Y15 A;  2BGC A;  3U1D A;  2EV5 A;  1DP7 P;  2P4W A;  2QYO A;  3N4M A;  3QPT A;  4EGZ A;  1RIO H;  2DPD A;  5HVQ C;  5DCF A;  2ZKZ A;  4WWC A;  2RVC A;  5DEQ A;  2XAS A;  2FMY A;  1SD5 A;  2PI0 A;  4LK0 F;  2IA1 A;  1OR7 A;  3TO7 A;  1RUO A;  1USS A;  1ZHF A;  1ZH5 A;  2XRN A;  1SD4 A;  2VN2 A;  3V4G A;  4HW0 A;  2NYX A;  3HRM A;  1TQP A;  4BHC A;  4OIQ F;  3K1M A;  4R79 A;  3MZH A;  4L18 B;  2XV4 S;  4DQ2 A;  1NHA A;  4JBA A;  1IN8 A;  1CF7 A;  1H9T A;  2ZXJ A;  4I2O A;  2MH9 A;  1FSH A;  3KP4 A;  1BIB A;  2VC0 A;  3B73 A;  5BOX A;  2IP2 A;  5E8G A;  5A2Q K;  5HDK A;  5ICE A;  3GVA A;  5TRD A;  1V4R A;  3Q9S A;  3LA2 A;  4G7Z F;  2G7U A;  2HTS A;  1QPM A;  1IXR C;  1FSE A;  1R1T A;  4I7H A;  4Q47 A;  1XGN A;  2ISY A;  5E1Z B;  4EV0 A;  4EQQ A;  3GEZ A;  3RPU A;  2AXL A;  3ZMD A;  3CUQ B;  3HYI A;  1BI2 A;  1O3Q A;  2RQP A;  1BC8 C;  1HST A;  1RNL A;  1OYY A;  3O2P E;  2WWY A;  3COA C;  1ZAR A;  4EGY A;  5FD5 A;  4KNY A;  2LDU A;  1PP8 F;  4OMZ A;  4I0B A;  3FXU A;  5HLI A;  3JTH A;  1HW1 A;  1REP C;  2L54 A;  2JSC A;  4OIN F;  5AON A;  2J5P A;  3FXR A;  1T6S A;  3FM5 A;  4CIC A;  2K02 A;  3LQR A;  4BHP A;  2HGC A;  3IWZ A;  1MKM A;  3TGN A;  3E5X A;  4ZZD A;  1FBQ A;  4ZYH A;  2QQA A;  4HX8 A;  2VON A;  1O3S A;  1F9N A;  2K4B A;  4XSX F;  2DU9 A;  3V7C A;  4FX4 A;  3ZN0 A;  1IN5 A;  5D4S A;  1ZLJ A;  4IF4 A;  4CO8 A;  2PLY A;  5KVR A;  2HFH A;  2HS5 A;  2FBH A;  2ZFW A;  1J7K A;  1ZN2 A;  1LEA A;  2JTV A;  2FXA A;  3P9K A;  2EFW A;  3DEU A;  3KEO A;  2IT0 A;  1G4D A;  3Q5F A;  4M9S A;  4IHS A;  3C1D A;  1QGP A;  3M8E A;  4FT8 A;  4KIC A;  4TV7 A;  1WI9 A;  2RC4 A;  4RGS A;  2XKP A;  1JHH A;  2HWV A;  2NNY A;  5DV5 A;  4P96 A;  3F3X A;  2GZW A;  4ZYE A;  3IWF A;  1KYZ A;  4FX0 A;  3R60 A;  1Q1H A;  3G73 A;  2PN6 A;  3HTS B;  2GXB A;  4G7O F;  3NEU A;  4QWQ A;  5TJJ A;  2KJC A;  3BJ6 A;  2ZCW A;  2Z3Y A;  1BI0 A;  2EA2 A;  3ZP5 A;  2EWN A;  1TNT A;  1WKM A;  4RB2 C;  2K7L A;  1CGP A;  1IZ1 A;  5CVV A;  2PJP A;  5LGN A;  1S3J A;  3DPL C;  1XDU A;  3D5L A;  3FHZ A;  3B02 A;  2QUF A;  1OYI A;  5ED4 A;  3PFI A;  2DLL A;  3CO6 C;  3GZ5 A;  4LG0 B;  3SHF A;  5D4R A;  1K78 A;  2H94 A;  1R1U A;  2EJR A;  5HS7 A;  1FYL A;  1DPR A;  2M30 A;  4IRI A;  2HOE A;  3M1E A;  2ETH A;  1SFE A;  5E1W A;  1XCB A;  3H3U A;  2V1U A;  3ZQ7 A;  3R0A A;  2K27 A;  2W24 A;  2NS0 A;  1TBX A;  4M9X A;  1YS7 A;  5ERI A;  2G9W A;  1BOA A;  3BPV A;  2DBB A;  1U2W A;  2BE5 F;  3QRF F;  4XBF A;  2F5E A;  3SZP A;  1FOK A;  2ADU A;  2FOK A;  1G3W A;  2QQ9 A;  2EB7 A;  2V6C A;  3RKY A;  2H6C A;  2R3S A;  1LVA A;  1XGO A;  1XSD A;  3I4P A;  3QP6 A;  3GFI A;  3MWM A;  2M87 A;  4AIK A;  4EM0 B;  3BDD A;  3CUO A;  2W57 A;  1DUX C;  4YFN F;  3V8L A;  1YW9 A;  3LAJ A;  1OPC A;  2IA0 A;  1PDN C;  1HXD A;  1LB2 A;  2R7F A;  4KN7 X;  4PGH A;  1FZP B;  3K1N A;  5DD4 A;  3QOP A;  3E3V A;  4N9H A;  4ESJ A;  2GIV A;  5EEG A;  1L3L A;  3TOB A;  2GWR A;  3ISP A;  4NHJ A;  4HA8 A;  2XVC A;  1J2X A;  3F8C A;  3L7W A;  5CVI A;  3TDU C;  1IN6 A;  4AVP A;  3RI4 A;  2OQG A;  2GA1 A;  1HQC A;  3QPH A;  3K9T A;  2R7D A;  1HKQ A;  4A0Y A;  1IF1 A;  1QO0 D;  1Z6R A;  1LDJ A;  4OIP F;  3QAH A;  4HF0 A;  3WTX C;  2XKO A;  5LBQ A;  4GO1 A;  2F2E A;  4BH9 A;  4MEX F;  1BC7 C;  3GUD A;  1LJ9 A;  2OA4 A;  3U2R A;  4KIB A;  2FML A;  4WK8 F;  2A61 A;  3IC7 A;  3SQN A;  3ULQ B;  5E17 F;  2ESN A;  5L3G A;  5ILU A;  1TQM A;  1U5T B;  5LHH A;  4WCG A;  5FLX Z;  4IRH A;  5FO5 A;  1K6O A;  4MQV A;  2A5Y B;  4UV9 A;  1RUN A;  4R1H A;  1T38 A;  3OOP A;  4RGU A;  3JAM Z;  5FFZ A;  4A6E A;  1VTN C;  3ZMS A;  3M8F A;  3ML6 A;  3PQK A;  1CF7 B;  3J80 K;  3BRO A;  4K2E A;  4N0B A;  5F64 A;  1XGS A;  2ZNY A;  2CFX A;  3I54 A;  2STW A;  2E7X A;  1ZAO A;  2LKP A;  1XDS A;  3KCC A;  1IUY A;  5F6F A;  3MAJ A;  4KUM A;  1G3T A;  3DFG A;  2DI3 A;  4L0Y B;  2DFI A;  1XD7 A;  1U5T C;  2RV8 A;  2O61 A;  2H6B A;  2FE3 A;  1KU2 A;  4KDP A;  2JPB A;  1XB4 A;  1WSU A;  5FD6 A;  1GVJ A;  3BJA A;  4I0A A;  2KKO A;  3HIF A;  3QU6 A;  3SXY A;  1J9I A;  2FEZ A;  1I1S A;  2P7V B;  5LEK A;  5LEJ A;  4CHU A;  2VBW A;  4WXD A;  3KP5 A;  5DCM A;  2XGX A;  1KA8 A;  3TKY A;  2ELH A;  3GX4 X;  2VOO A;  4ESF A;  2YPR A;  4A12 A;  2MA3 A;  1AWC A;  3IKT A;  5L3C A;  2EV0 A;  4S04 A;  3K69 A;  3HSR A;  4R8H A;  3C7J A;  4EJV A;  2VC1 A;  4EJO A;  2IRF G;  2X4H A;  1QNT A;  3FWE A;  4MHG A;  2FQ3 A;  1FT9 A;  1Z7U A;  3E5Q A;  4ENN A;  1MJ9 A;  4BNC A;  3GFJ A;  1IRF A;  4IRG A;  1YQA A;  2VE9 A;  2VXZ A;  2ZME B;  2M45 A;  2EFN A;  1MDM A;  2MC3 A;  1KGS A;  1H0M A;  1XN7 A;  4YG2 F;  4KYW A;  5E18 F;  2M5W A;  1BJA A;  3GZ6 A;  4A6D A;  5LHI A;  1FP1 D;  3L9F A;  3DF8 A;  3ZMZ A;  3P9I A;  2BBY A;  4HV5 A;  1EH8 A;  1B9N A;  3GF2 A;  4OOI A;  3WU0 A;  1KU9 A;  2JT1 A;  2OZU A;  2ZBK A;  3C18 A;  4AWX B;  4EMS A;  2JRT A;  3T8T A;  2IJL A;  2FF4 A;  3VFZ A;  1FYK A;  4CGZ A;  3JAM K;  1XMK A;  5AIQ A;  4O5V A;  5K5R A;  1HSJ A;  5HS8 A;  1R1V A;  2FBK A;  3JTG A;  1YLF A;  2IPQ X;  1XMA A;  2F5D A;  4M72 A;  2XHK A;  2DQR A;  4B09 A;  3HUG A;  1ULY A;  1S29 A;  5H6R A;  2HEO A;  4P9U A;  4CYD A;  2GA2 A;  3RIR A;  4YFK F;  3EET A;  2NAZ A;  2KIU A;  1G3Y A;  3BPX A;  3AAF A;  3ZPL A;  3W6K B;  2V1X A;  5IT9 Z;  2L02 A;  3DXJ F;  3NQO A;  3VOE A;  4RGX A;  2RN7 A;  3DKW A;  3HSF A;  4A5M A;  2H27 A;  4LLN A;  1IAW A;  1FX7 A;  1D3Y A;  2ZME A;  3KP3 A;  2VT2 A;  2MLG A;  2DK8 A;  4ZYD A;  4D0P A;  1HKS A;  3N97 A;  4KN4 X;  2MLK A;  3S2W A;  3VOD A;  2F5C A;  3EYY A;  5KK1 A;  4Y13 A;  5D6E A;  4KFC A;  1P6R A;  1ODD A;  1BI3 A;  1ONV A;  2H09 A;  3LQQ A;  4UNO A;  3LST A;  2AS5 F;  2CWE A;  4L9V A;  4EM1 A;  3SFZ A;  2D1H A;  3LWF A;  1Y0U A;  4XRF A;  4AIJ A;  2ZNZ A;  3KEQ A;  2LF8 A;  5JFR A;  1P92 A;  4MQ9 F;  3KET A;  2PQ8 A;  4S05 A;  2EV6 A;  4I98 B;  4RAZ A;  4EM2 A;  4PDK A;  2J5O A;  3WTW C;  4Q4Z F;  1UST A;  1FY7 A;  2FA5 A;  1XCV A;  1BN5 A;  1W7P A;  4ON0 A;  3ECO A;  1C0W A;  2P5K A;  3KZZ A;  3RKW A;  4B8X A;  1EV7 A;  4M6X A;  5DDG A;  4KMF A;  4XLN F;  3F21 A;  4A2U A;  3U9G A;  4M74 A;  3ABU A;  1G6N A;  4HOB A;  4M6Y A;  3F72 A;  3LFK A; 
#chains in the Genus database with same CATH topology
 2YX4 A;  3WGG A;  4HQE A;  2PG4 A;  1H9G A;  5K5Q A;  5EYR A;  3F8M A;  5BQT A;  1P7I A;  1UG0 A;  2RDP A;  3IH2 A;  3CF5 F;  1JKP C;  4J01 A;  4II2 A;  2RNJ A;  5CPR B;  4W1U A;  4BKX A;  4MTE A;  1SFU A;  1JKQ C;  3E6M A;  2E19 A;  3FMR A;  1K7A A;  1FIA A;  2JN6 A;  4L5J A;  1QHH D;  2WY8 Q;  3DLA A;  3IL2 A;  2DFE A;  5JHF A;  4BJ6 C;  3DBL B;  3FBN B;  4AYB N;  4IHT A;  4MTD A;  2G0E A;  4D9J A;  2VOD A;  2VJI A;  2KZG A;  2V4J C;  3JW4 A;  4XLF A;  3G1M A;  3GW2 A;  2Q0O A;  2WB1 A;  4PJJ A;  1GHC A;  1WRJ A;  1YO5 C;  2H1K A;  1IW7 F;  3D5S C;  2X0L A;  2ISZ A;  5HOO A;  1IO2 A;  1WQ2 A;  4ENJ A;  2IS4 A;  4NQW A;  4P9F A;  3V8K A;  3BZK A;  3K2Z A;  4PGG A;  5LRS A;  1UEL B;  3BQY A;  2OAZ A;  2K5C A;  4D7N A;  3ZQL A;  3C2B A;  2BXZ A;  4EAT A;  3CCV I;  1XGM A;  3WTT C;  4HNV A;  1YIO A;  3GWZ A;  4HX4 A;  4HDU A;  1A6I A;  3R61 A;  1B8I B;  1MNM C;  3HOV J;  2BHZ A;  1UCR A;  2LSO A;  2CU7 A;  1SD6 A;  1ZLK A;  2HXO A;  3S1R J;  4DIQ A;  2JA6 J;  1UJ8 A;  2VBX A;  4XON A;  4Y17 A;  4BYY A;  2B63 J;  3K1P A;  3WTS C;  1K79 A;  1AHD P;  4OIO F;  2QSG X;  3BZC A;  4EEF G;  4UV8 A;  3HOS A;  2F4I A;  2HYG D;  1MD0 A;  5D5V B;  5C4J J;  4HLX A;  4U0Y A;  2DMU A;  1MH3 A;  1U3E M;  1VI0 A;  2VKV A;  5LLQ A;  2CQ7 A;  3CLQ A;  3E0J B;  5HLH A;  2LR8 A;  5D5W B;  2RQQ A;  1JXS A;  1Z3Y A;  4FHT A;  3F8F A;  3CCJ I;  4Q5S F;  3FK6 A;  4ZH4 F;  2KMU A;  3OMY A;  1BIA A;  3PM1 A;  1FC3 A;  2ECC A;  5M5X J;  4I76 A;  3IRR A;  5EEA A;  2CQK A;  2E1M C;  2GOM A;  3CDH A;  3L2U A;  1T0F A;  4BE1 A;  5AIP A;  1WFX A;  2HNH A;  4E4H A;  2DK5 A;  2HTJ A;  2WBM A;  2XSJ C;  2VAS A;  4B48 A;  2P5L C;  4AU7 A;  3HOW J;  1GV5 A;  1YJN I;  2ZO4 A;  3WGI A;  2Z99 A;  3SFI A;  4A3J J;  1RES A;  2W48 A;  3H92 A;  3WU1 B;  3MMY B;  4BQQ A;  1X1C A;  4DYQ A;  1KZH A;  5J1Y A;  1BW6 A;  5F0H A;  1U0J A;  3Q0W A;  5CYV A;  2KJB A;  2K3F A;  1TT5 B;  2STT A;  3CMM A;  3E97 A;  2V79 A;  1IRZ A;  2NVY J;  3QWL A;  1WI3 A;  4HF2 A;  2JUG A;  1UMQ A;  2A07 F;  3LAP A;  3EPZ A;  2VQL A;  5FKO A;  3J7A O;  5DS9 A;  2HOA A;  3BOQ A;  2OJE D;  4I01 A;  1ZR2 A;  4YIR X;  3TO9 A;  2MC4 A;  5C44 J;  3JR9 A;  3O3K A;  1D8K A;  4MGR A;  2EFO A;  2FRH A;  3LNQ A;  1I1G A;  3ABM H;  3ZGK A;  1PP7 U;  4E70 A;  1MJA A;  3GME A;  3TQN A;  3KFW X;  2CQN A;  1UB9 A;  1M1E B;  4YIF A;  2FUG 2;  3GLL A;  5DUK A;  2Q8K A;  3S14 J;  1AKH A;  1AOY A;  2RAE A;  4AUX A;  4HAM A;  1W1W E;  2Y9Z A;  3VYR B;  1WCM J;  5IYB J;  5JI6 A;  1RKW A;  4BQA A;  1J0R A;  2V1D A;  5DM6 F;  1W0T A;  4Z2Y A;  5ICF A;  2PEX A;  1P4A A;  1ZEL A;  3CJN A;  3VSL A;  2HYF A;  3WGH A;  1GVD A;  1E17 A;  2K4J A;  4A93 J;  2MFZ A;  1K4T A;  3V7R A;  5M5W J;  4JOM A;  1GXQ A;  4AM3 A;  2AQE A;  3SDB A;  2ZJP F;  2CYY A;  1QZY A;  2YU3 A;  2JQ7 A;  4PZJ A;  4U88 A;  1YTY A;  3WHB A;  3B6C A;  2IS2 A;  1H88 C;  5IT3 A;  2G7H A;  1EH6 A;  2XAQ A;  2K9Q A;  2V7F A;  2GXG A;  1TP4 A;  5CVU A;  1F5T A;  4II3 A;  3FX3 A;  3JSO A;  5HDG A;  3X2Q H;  2XAH A;  2DCE A;  4OAY A;  3J81 Z;  1R36 A;  3CCQ I;  3BG5 A;  3P9C A;  2Q2E A;  4FET A;  1UFM A;  2LRD A;  1Y1V J;  2GAU A;  2M7B A;  3ZQG A;  1IDZ A;  4BQN A;  3QOE A;  1A36 A;  2XRO A;  3HC7 A;  1MMD A;  2QEX I;  1DGW Y;  2JPC A;  1I5Z A;  1I6X A;  3BR6 A;  4MFE A;  3L00 A;  2WTE A;  4S0H B;  2EIJ H;  2OF7 A;  2QVO A;  1YHQ I;  3LSG A;  3EDP A;  5E1X A;  3HEF A;  4YRV A;  5J6X A;  2R7Z J;  1EJ9 A;  5E20 A;  4EJT A;  1LFU P;  2E1C A;  1STZ A;  2CUE A;  5JR3 A;  3S3N A;  1TNS A;  3MZY A;  2EFP A;  4U87 A;  2L7F P;  1QZE A;  1R7J A;  2HQA A;  2R5Z B;  3MKW B;  3IRQ A;  3M7G A;  4BQO A;  2ME6 A;  3FM3 A;  1NH3 A;  3CLO A;  3DTK A;  3KP2 A;  3G71 I;  3OS1 A;  4A3L J;  2ID3 A;  3JCU C;  4N9I A;  3F22 A;  2PJR A;  1MJB A;  2BV6 A;  2CFO A;  2COM A;  2MYS A;  2IGN A;  1ON1 A;  2PFB A;  2D45 A;  1O57 A;  1D8J A;  4KIS A;  4PJN A;  3N05 A;  2N8G A;  4YEL A;  3M8J A;  3S3M A;  3E5U A;  1S6L A;  3CP8 A;  3VEP A;  1E3H A;  2EZK A;  4L5I A;  4W97 A;  2DQL A;  4IO9 F;  2P7C B;  4AIH A;  3I5U A;  1CQT A;  1VND A;  2IEK A;  2KLO A;  4OIR F;  5EG0 B;  5L3E A;  3ZQC A;  2DO7 A;  5CJ9 A;  3GTG J;  2A3S A;  5FLM J;  3AKZ A;  3PNT A;  5DCM B;  3WTV C;  6PAX A;  3RPQ A;  3V8J A;  5D8L B;  1V5E A;  5EZH A;  2H1L A;  2YS9 A;  1BBY A;  1KQ9 A;  1U8B A;  4C9Y A;  4BAY A;  1EH7 A;  1J09 A;  2HDD A;  4A0X A;  4GFB A;  3K4B A;  2QSF X;  3HUG B;  1Z77 A;  2P6S A;  1W4M A;  2K86 A;  1RI7 A;  1X2M A;  3SZT A;  3DPT A;  3F6V A;  1YI2 I;  2IAI A;  4G6Q A;  3ABK H;  3OOU A;  1DP3 A;  3CCM I;  2M3A A;  1JI8 A;  3I59 B;  4ZC3 A;  2YSR A;  2O7O A;  3JRC A;  1FWZ A;  5J8F A;  4BXX J;  4E7J A;  2QEN A;  1TW2 A;  4E7S A;  2RRE A;  4E7I A;  4BBS J;  5E79 C;  4XIC A;  2BYV E;  1Z91 A;  3L2R A;  2E2I J;  4DYR A;  1TW3 A;  4G6T B;  3HKZ A;  1T2K A;  4BY1 J;  1W5S A;  4LK1 F;  4LIT A;  1QPI A;  2DA3 A;  2JSP A;  3ZQQ A;  5DUI A;  3I3L A;  2RNG A;  1BR2 A;  2DXI A;  4JQF A;  3EYI A;  3WTY C;  2LNB A;  2BEO A;  1S7E A;  3EUA A;  2DTR A;  3WE2 A;  4A3D J;  1B59 A;  1RPW A;  4P55 A;  2EIK H;  1WPK A;  2GIZ A;  2D2W A;  4N4O B;  1JE8 A;  1SVL A;  2XRL A;  5ICG A;  4IOC F;  3RYP A;  2DFF A;  3GXO A;  3EQL F;  1A04 A;  2QQB A;  1D0X A;  2OBP A;  3HZJ A;  2ESH A;  1R5H A;  2WAE A;  1IXC A;  2I10 A;  3VPR A;  2O03 A;  4Y4R A;  1X4O A;  4UUV A;  3JRG A;  4ENM A;  1YFH A;  2MD0 A;  4BL0 B;  4LG0 A;  4FE7 A;  3GYH X;  3ZN1 A;  1XS9 A;  2DT5 A;  2CSO A;  4F7Z A;  2NRA C;  3BY6 A;  1O7L A;  1ZRE A;  1UHM A;  2KFD A;  1JHF A;  1XX5 A;  3H9J A;  2M0M A;  3OYA A;  3RTR A;  4A5N A;  2VKE A;  4LLL A;  2YR2 A;  5EDN A;  4GYG A;  2KIS A;  2FSW A;  4DZP A;  1KU7 A;  2E1O A;  2W84 A;  3I53 A;  4CZZ A;  1BI1 A;  2A69 F;  1ZRC A;  4F92 B;  4RM3 A;  4XM3 A;  3HGG A;  5CLS A;  3K70 D;  3QPS A;  2XF6 A;  3BTL A;  3A4C A;  1Y1W J;  4DNC A;  5K7Z A;  2CGP A;  2MG4 A;  5E3L A;  3WTZ A;  4U7B A;  1MND A;  3C3W A;  3QYF A;  3A1Y A;  3OYI A;  1K61 A;  1MZB A;  5KAF C;  1KYW A;  1X1A A;  3OWT A;  2PMH A;  5TIS C;  1B8I A;  2B0L A;  4LOC A;  5BMZ A;  4QSH A;  3J81 K;  4L5E A;  1ZGA A;  3IKV A;  1WJB A;  2HKX A;  3F9K A;  1IDY A;  4AID A;  5LRR A;  2XIG A;  2UV1 A;  2UWM A;  2BY1 A;  1HF0 A;  2OD5 A;  1YYV A;  2KDZ A;  3S1Q J;  1HBX G;  1TLH B;  2CJJ A;  2VI6 A;  2X85 A;  4ZZL A;  4F93 B;  1J75 A;  1L0O C;  1W7P D;  2R7U A;  3LSI A;  1VQ6 I;  1I39 A;  2BW3 B;  3I71 A;  5J4V A;  5CQG A;  2FOW A;  1PUF A;  1JUM A;  1IXS B;  4G7H F;  3FHN A;  1YG2 A;  4L9N A;  1YX5 A;  4WXH A;  1POG A;  1BOB A;  1XSX A;  4MEY F;  2Q1Z B;  2CW8 A;  2X6O A;  3S8P A;  3FF5 A;  4GXO A;  2OCE A;  4XKB A;  2DA7 A;  2L9R A;  4NDL A;  2CMP A;  3CDL A;  4XN0 A;  5E8I A;  4RDU A;  2W4S A;  2LF7 A;  2I8D A;  2ME0 A;  2XAF A;  4AC0 A;  4X0G A;  2V9V A;  2FNP A;  3DV8 A;  3BT9 A;  5GAH J;  2OQR A;  3JRA A;  3V7S A;  2EA4 A;  2QF7 A;  3M4O J;  2E1N A;  2K9M A;  2LY9 A;  2F4M B;  2LP0 A;  3GO5 A;  3GLX A;  3KX2 A;  1G3S A;  1E0E A;  2MGQ A;  5TGT A;  2HVS A;  4OU0 A;  2VBY A;  1SAN A;  2TDX A;  5HNF A;  3H1C A;  3H3Z A;  1TTY A;  2P8T A;  1DQU A;  1YIT I;  3T1B A;  1OMI A;  4L0Z B;  2QLZ A;  4E6K G;  2DTZ A;  4M71 A;  2DAO A;  4ZYA A;  3KYL A;  5BPI A;  5D5X B;  3D0S A;  2CV2 A;  4ASN A;  3VSK A;  2KT0 A;  1F4K A;  4AYB A;  4WX9 A;  3GTQ J;  2EIL H;  4IEJ A;  3ZOB A;  4LGW A;  2Y75 A;  3TMO A;  4M9Z A;  1FPQ A;  1Z6T A;  2XB0 X;  4O3M A;  1HDD C;  1BW5 A;  3RJP A;  2V26 A;  3S2H J;  2JRM A;  2DPU A;  1JGS A;  4NB5 A;  4C3I J;  1B6A A;  3QP5 A;  4ABZ A;  3JRE A;  2Z16 A;  4YII A;  1FBU A;  2IXS A;  5EF6 A;  4OAZ A;  4G9Y A;  4M73 A;  3FMS A;  2A68 F;  2L9V A;  1JJ6 C;  1ZG1 A;  4BJ5 C;  3ECH A;  5B3S H;  1NK2 P;  1PJR A;  3E6C C;  1X58 A;  1LEB A;  3G2B A;  1UAA A;  3ZR8 X;  2XPW A;  3F23 A;  3M9A A;  2R7S A;  4XKW A;  4AD9 A;  3BG9 A;  3GFM A;  3LA7 A;  1OJL A;  3OL3 A;  2L4A A;  2O5R A;  5GAG J;  1Z9C A;  4UXN A;  5B5E C;  3MEX A;  2LG4 A;  1MGT A;  3DP7 A;  4HX7 A;  3HHG A;  4B44 A;  1LNW A;  5IOY A;  3S1M J;  4NC7 A;  3ZMU A;  1ETX A;  3BTJ A;  2EFQ A;  1R4N B;  3R4K A;  3F6O A;  3CUQ C;  1E3P A;  1W7P B;  5D8K B;  3G4S I;  1ZYR F;  1QU3 A;  5D6F A;  1J5Y A;  1BR1 A;  3BTI A;  3GFL A;  3S17 J;  1WJ5 A;  5A2Q Z;  1ZR4 A;  2XGD A;  4F3Q A;  1W5C C;  2R5Y A;  3MQ0 A;  1FIP A;  3OYL A;  1O3T A;  3KP6 A;  2W82 A;  3QYE A;  4U7D A;  4LLG F;  3OV8 A;  3SDG A;  2IVM A;  4L9T A;  3J7A Y;  2P5V A;  3RZO J;  4XL9 A;  2DA2 A;  4DW6 A;  1U5T A;  1YW8 A;  2O8X A;  3PSF A;  3TDZ C;  3OR2 C;  1GLN A;  1QZZ A;  2XUB A;  2DMQ A;  2WAQ N;  1D1C A;  2QBY B;  3G1L A;  1T39 A;  1VZ0 A;  2VQC A;  3J7Y J;  1VQK I;  2VBZ A;  3TP3 A;  1S8N A;  1APL C;  1N25 A;  4ZYG A;  3GCM A;  3ONQ A;  5F0C A;  3FMQ A;  2EZH A;  4CA0 A;  2K40 A;  1Z1D A;  1R6R A;  4BEH B;  4EVI A;  5FGM A;  4RAG A;  1G2H A;  2QCO A;  4C3H J;  2KPM A;  3M3Y J;  2NVQ J;  2EK5 A;  4BU2 A;  1JUS A;  1TWH J;  1W5T A;  2MH2 A;  4UVA A;  5EJC A;  2Z9O A;  3FXJ A;  4HPQ A;  4EJW A;  2W85 A;  3PSI A;  4BXU A;  3ZMT A;  3SEZ A;  1FTZ A;  2QM3 A;  3HKZ N;  4U0V A;  5D5U B;  1O4X A;  4WXC A;  1PUE E;  4QPQ A;  5B66 C;  5ILV A;  4MNU A;  2V9P A;  3CCU I;  3T8R A;  3ZQF A;  3LSR A;  4YFX F;  1JT0 A;  3WE3 A;  3ROU A;  4GCV A;  3J80 Z;  2WC2 A;  5BNG A;  4HV6 A;  1Y6I A;  2NXN B;  4C3J J;  2GQQ A;  4HLY A;  1SFX A;  4FE4 A;  3JSP A;  4RM2 A;  5F1R A;  2OU2 A;  4M3B A;  5HLG A;  3JRI A;  1KQ8 A;  3H36 A;  2Z1D A;  1YW7 A;  2RKH A;  4UHT A;  2XAG A;  3W6J B;  1HOM A;  1D1B A;  4F52 A;  2FBI A;  3MCZ A;  5CVJ A;  1R22 A;  3OS2 A;  4XLA A;  5K1Y A;  5GAE J;  1R5G A;  4XKV A;  2GOX B;  1BM9 A;  1ZGJ A;  2F5F A;  2P81 A;  5L3D A;  2XAU A;  5F04 A;  5HDN A;  2L3D A;  2VOP A;  1P4W A;  1U6G A;  1YOV B;  2ZSH B;  1ON2 A;  1SVO A;  4UUT A;  2M8E A;  4G94 A;  4I6Z A;  2L9N A;  3EUH A;  4FAS D;  4RGR A;  4C2U A;  1KU3 A;  3L2C A;  4X6A J;  1LDK B;  2HQR A;  2OZ6 A;  2LLK A;  4G12 A;  3ELK A;  3G6E I;  2RGV A;  1SC7 A;  3IP4 B;  3VDX A;  1FBS A;  4BBR J;  2WAD A;  1MMN A;  2W25 A;  1D5V A;  2IW5 A;  4HG2 A;  3MD2 A;  3RYR A;  2FNA A;  2IBD A;  4FIS A;  3F8B A;  5BPD A;  2QBY A;  3FXQ A;  2BY2 A;  2KRH A;  2BY3 A;  2K3P A;  2HVR A;  1SD7 A;  2HU9 A;  3H5R A;  1SMT A;  3NWS A;  4LG3 A;  2VKH A;  2Y9Y A;  4BHB A;  2OCC H;  5ICC A;  3PJR A;  3F8N A;  2UXX A;  4UUS B;  2QSH X;  1WWX A;  1KQ0 A;  3TW7 A;  2WV0 A;  3K0L A;  1B9M A;  1Y8R B;  2DDA A;  1R9T J;  2ICW G;  3ASN H;  4HZF A;  4LD5 A;  1FEX A;  3KE2 A;  2L01 A;  4ESB A;  3ZMV A;  2HKO A;  1MDM B;  1H89 C;  4IJA A;  4ZDO A;  1I27 A;  1LQ1 A;  1N75 A;  3BR0 A;  3R6S A;  2L2O A;  1EKE A;  5DYM A;  1IN4 A;  1RC9 A;  2CG4 A;  2Y48 A;  5L3B A;  4J00 A;  2X6X A;  1LDD A;  4KA4 A;  3PUF A;  2HZT A;  4IHY A;  1ZG5 A;  1SFK A;  2ZXH A;  3KLN A;  3VB2 A;  2LY2 A;  3RKX A;  1R00 A;  3BWG A;  2MBF A;  1WH5 A;  2HI3 A;  3MFK A;  5FKN A;  1OKR A;  5HLT A;  3TOA A;  4YEJ A;  2IS6 A;  4RB0 A;  2ZB9 A;  1JJ8 C;  1XTA A;  3ERE D;  1RZ4 A;  2Q2E B;  2VT3 A;  1ZG3 A;  2Y0M A;  3BP8 A;  3BC8 A;  3C2H A;  3HTU A;  3KEY A;  2JJ7 A;  1S7O A;  5CVR A;  3I0T A;  3P7N A;  1FOX A;  2XGC A;  2CW0 F;  1UG2 A;  3K10 A;  4LB5 A;  5HOD A;  4CCO A;  4G6D A;  1K78 B;  1X3U A;  1OR7 C;  2FU4 A;  4IPA A;  3O6B B;  4LMY A;  1DGR M;  4JP0 A;  3LSH A;  2LFB A;  3CDI A;  1OCR H;  2XSD C;  1X1B A;  3ABL H;  4P5O A;  5FB2 A;  4XSZ F;  2VJ5 A;  5C4X J;  1HKT A;  4O6J A;  4CDG A;  5IP7 J;  5FRN A;  3GZN B;  3PL8 A;  4XN3 A;  4DJA A;  3PQJ A;  5L3F A;  4BAC A;  1O3R A;  1IRG A;  3H3V K;  2KIF A;  2WA0 A;  1MBE A;  4D7M A;  2MD5 A;  3CUQ A;  1U78 A;  4XKC A;  4A3G J;  4LB6 B;  2A5W A;  3ABT A;  1GDT A;  3I59 A;  4KJZ A;  3A2K A;  1BR4 A;  5FFX A;  4Q48 A;  2HR3 A;  4UVB A;  4HSR A;  1NG6 A;  4OMY A;  4M3D A;  2LYC A;  1N77 A;  1N78 A;  2KP6 A;  3CO7 C;  1V3F A;  3CTA A;  2L7K A;  2P6T A;  1DDN A;  1MSF C;  2E2J J;  3HOT A;  4NBQ A;  2M9H A;  2X1E A;  1RRJ A;  2O6G E;  4C2T A;  2JZY A;  2VKD A;  1JGG A;  4IHX A;  4ENK A;  1FNN A;  2LBF A;  3WOD F;  4ANJ A;  1SAX A;  5FLV A;  1DU6 A;  5GPA A;  4KIG A;  2VL8 A;  1GUU A;  5KHD A;  1HW5 A;  2ZJ2 A;  3E7L A;  1IN7 A;  4XOR A;  5LGU A;  1ZRD A;  1B72 A;  2XGE A;  5K5O A;  3Q9V A;  4V19 K;  5KNL A;  5DM7 F;  5DTD A;  4PSX A;  3QU3 A;  3C2G A;  2DA6 A;  3CCE I;  2DMN A;  5BS6 A;  5FRO A;  2HZD A;  1TQI A;  4GGG A;  3E6B A;  3RDI A;  1R58 A;  2CO5 A;  3I58 A;  4JX4 A;  1I50 J;  1UHW A;  2AO9 A;  2E5Z A;  5H20 A;  3G3Z A;  5IT9 K;  2DW4 A;  2O3F A;  2NNN A;  3HPG A;  1Y8Q B;  3LA3 A;  3H0D A;  4KIF A;  2Y2Z A;  2W7N A;  4A0Z A;  1E2X A;  2M1B A;  3HSE A;  2XAJ A;  5HS9 A;  3KLO A;  4M3E A;  2ZME C;  2YU9 J;  2P0W A;  3KIO A;  3D1N I;  2UXN A;  1YS6 A;  4IVN A;  3NRV A;  2HDC A;  1S7A A;  3KZY A;  2DA5 A;  4LFU A;  1OYW A;  3P5J A;  2XPV A;  2PBI A;  3HRS A;  3SYT A;  1O7F A;  2VE8 A;  1QQI A;  2JVH A;  4GDF A;  1XSV A;  2R7O A;  2DJI A;  4PCQ A;  3IH3 A;  1GT0 C;  4IXA A;  2R7R A;  3T5X A;  3CCL I;  2TRT A;  1MBK A;  1WJF A;  2HQN A;  2QZ8 A;  4EJU A;  2KRC A;  5J8C A;  3IV5 A;  2XF7 A;  4G8X A;  4WF2 A;  1T0F C;  4I02 A;  4QLC U;  1W0U A;  3HHH A;  1Z05 A;  1ZRF A;  1T56 A;  2JA2 A;  1NTC A;  4LJZ F;  4HBL A;  3MKL A;  4UVC A;  4A3E J;  3BJO A;  1PVE A;  1MH4 A;  1OCO H;  2EZL A;  2BVM A;  2JK3 A;  3REO A;  2D1V A;  5EEH A;  4ETS A;  4HRI A;  3IHU A;  4IHV A;  2QGU A;  3BZ6 A;  4HDV A;  2A05 A;  3L09 A;  4RB3 C;  4J19 A;  1ETK A;  2PMU A;  2Z2S B;  1ETO A;  2IA2 A;  2V9K A;  3A03 A;  1EA3 A;  1IV6 A;  2C6Y A;  3O8G A;  4A3B J;  2KIM A;  3FZV A;  4XLP F;  1TC3 C;  1ZKG A;  3CJT B;  5JVT A;  3E6D A;  2UZK A;  2L4M A;  4L9J A;  2E7W A;  1R49 A;  2ACJ A;  1FYM A;  4JK1 X;  3QQA A;  2KDO A;  4RS8 A;  2VPR A;  3FBI B;  4GYI A;  4QIW N;  4RB1 A;  3JRH A;  3LSM A;  1WGX A;  5JHU A;  1X2N A;  3NAU A;  1FP2 A;  2WY7 Q;  3OYN A;  4H0E A;  1GXP A;  4KMU X;  4BGD A;  3DTE A;  2BOL A;  2LVS A;  3HRT A;  5LGT A;  1DPU A;  3WG9 A;  2R93 J;  1P2F A;  2WV1 A;  4HQM A;  3HM5 A;  2A6H F;  2YX7 A;  1VQP I;  5H6Q A;  5ILS A;  1T98 A;  1I3A A;  3K4M A;  2GBY A;  5DD8 A;  2XC7 A;  2KIQ A;  3ZXS A;  4PK4 A;  2O0Y A;  1OCC H;  4CXF A;  4HYE A;  1B4A A;  1F1Z A;  1XG1 A;  2OPT A;  2QKL B;  1R23 A;  2MAB A;  2V1N A;  3DQV C;  1NG7 A;  1P4X A;  1TWC J;  4XNF A;  2LTP A;  5KAI C;  3RPU D;  2L5Q A;  1E3O C;  2F4O B;  2Z5U A;  1P7J A;  5IP6 A;  1B72 B;  1QBJ A;  5FKK A;  3Q0U A;  4M3G A;  3R0J A;  3H5N A;  2A6E F;  3HGY A;  2Z33 A;  3TO6 A;  2IGK A;  4IKF A;  4RAY A;  3LMM A;  2JA5 J;  1U9O A;  4ZTF A;  3KP7 A;  5EZG A;  2FX0 A;  5LHG A;  4U0W A;  2EQR A;  1RR8 C;  4A3F J;  2B9S A;  2CQQ A;  3TBI A;  4D5F A;  1FLI A;  4I09 A;  1T33 A;  2NS8 A;  2LC2 A;  2WAF A;  2KRF A;  1HW2 A;  4KT5 C;  3HRU A;  4D1Q A;  1J59 A;  3I64 A;  1U8R A;  1SMY F;  5FLX K;  1B1B A;  3HB9 A;  4XLE A;  2M4K A;  2HPM A;  2QWW A;  3T0Y A;  4HF1 A;  2E71 A;  3WTU C;  3I56 I;  5CKT A;  4Y15 A;  1TT0 A;  2BGC A;  3U1D A;  2EV5 A;  2CUF A;  1DP7 P;  2P4W A;  2QYO A;  1V5G A;  3N4M A;  2HOS A;  3VWB A;  3QPT A;  4EGZ A;  4X1E A;  1RIO H;  2BVL A;  2DPD A;  3UNG C;  4DGW B;  2EIN H;  5HVQ C;  4Y33 A;  4FCY A;  5DCF A;  2ZKZ A;  3OYD A;  2B7E A;  4WWC A;  3RKQ A;  2CUJ A;  2RVC A;  3CF2 A;  5DEQ A;  2XAS A;  1ENH A;  3DTI A;  1HDP A;  3DEW A;  4UUS A;  2FMY A;  1SD5 A;  3OYB A;  3RCO A;  2PI0 A;  4LK0 F;  3QYB A;  2IA1 A;  2EH3 A;  1OR7 A;  4IL6 C;  3TO7 A;  1VQ7 I;  1RUO A;  5H2F C;  3CJQ B;  1USS A;  3PFY A;  1ZHF A;  5LD2 C;  1ZH5 A;  2XRN A;  1SD4 A;  2CUZ A;  2VN2 A;  3K4L A;  2LD5 A;  2VUM J;  3BR2 A;  3V4G A;  4HW0 A;  2NYX A;  3HRM A;  2VIX A;  4E7L A;  1TQP A;  4BHC A;  2E36 A;  3K1M A;  2BZT A;  4OIQ F;  4R79 A;  3A0B C;  4RA2 A;  5FJ8 J;  3UR3 C;  1Y39 A;  3MZH A;  4JX6 A;  4XQF A;  3FIW A;  1K4S A;  3W3C A;  4L18 B;  2XV4 S;  1F43 A;  5CQE A;  4DQ2 A;  1OCP A;  1NHA A;  4JBA A;  3K4C A;  1IN8 A;  1CF7 A;  1H9T A;  1MW7 A;  2ZFU A;  3BTC A;  2ZC2 A;  2ZXJ A;  4I2O A;  2MH9 A;  1G59 A;  2ZXW H;  3KP4 A;  1FSH A;  1SFO J;  4KIT B;  3VYU B;  1BIB A;  2VC0 A;  3B73 A;  2EZI A;  2DOF A;  1ETQ A;  5HNH A;  1UHS A;  2AXT C;  5BOX A;  3S15 J;  4H4K C;  2IP2 A;  5E8G A;  5A2Q K;  2K9N A;  2X6W A;  3K4K A;  5HDK A;  1VQ4 I;  2X51 A;  1YRN B;  5F08 A;  2QA4 I;  2NOJ B;  3GVA A;  5ICE A;  5TRD A;  1V4R A;  3AG1 H;  1IV8 A;  1AA7 A;  3WU2 C;  3Q9S A;  3LA2 A;  5GPC A;  2CW7 A;  3OR1 C;  4G7Z F;  2G7U A;  2HTS A;  3HJE A;  1QPM A;  1IXR C;  1FSE A;  1R1T A;  4I7H A;  2CH0 A;  4Q47 A;  1XGN A;  1AKH B;  2ISY A;  5E1Z B;  3K2A A;  2DA1 A;  4EV0 A;  4EQQ A;  3GEZ A;  3RPU A;  1TWA J;  2AXL A;  3ZMD A;  3CUQ B;  3HYI A;  4CH7 A;  1QRY A;  4F55 A;  2X48 A;  2DFH A;  3LSK A;  3CES A;  1BI2 A;  1O3Q A;  2OTL I;  2RQP A;  2DOD A;  4LIU A;  1HST A;  1YIJ I;  1BC8 C;  1RNL A;  1OYY A;  3O2P E;  2WWY A;  2KZV A;  3COA C;  1ZAR A;  4EGY A;  2DOA A;  5FD5 A;  4KNY A;  9ANT A;  1S9H A;  2LDU A;  1W36 D;  1PP8 F;  5FRM A;  4PJM A;  5GTI C;  4OMZ A;  1X19 A;  4I0B A;  1VQO I;  3FXU A;  4QTR A;  5HLI A;  1JKR C;  3JTH A;  1HW1 A;  2H8W A;  3OYM A;  1REP C;  2L54 A;  2BY0 A;  3PIP F;  2LBF B;  2JSC A;  3S3O A;  4PFP A;  1IUF A;  4OIN F;  5AON A;  3BG3 A;  5C3E J;  1VQL I;  2J5P A;  3LSP A;  1WJD A;  3FXR A;  1ZTR A;  1T6S A;  2FQ4 A;  3FM5 A;  2NVU B;  4CIC A;  2K02 A;  1DU0 A;  2X6Y A;  3LQR A;  1X1D A;  3BG7 A;  3HG9 A;  2IGO A;  2HGC A;  4NUB A;  3IWZ A;  4BHP A;  1T8I A;  4LIV A;  2VXD A;  1MKM A;  1D1A A;  3TGN A;  3E5X A;  3HOY J;  4ZZD A;  1FBQ A;  1LUJ B;  3PO3 J;  5B1B H;  5J3L A;  4ZYH A;  2QQA A;  4HX8 A;  3FKJ A;  2LK2 A;  3CD6 I;  2VON A;  2L9S A;  3O8H A;  1O3S A;  1F9N A;  2DA4 A;  2K4B A;  5FKM A;  4XSX F;  2DU9 A;  3V7C A;  4FX4 A;  3ZN0 A;  4F91 B;  1IN5 A;  2XB5 A;  5D4S A;  3NWT A;  3QOD A;  2XDV A;  5IP9 J;  3OIQ A;  4NC8 A;  1ZLJ A;  2R5Z A;  3H35 A;  2ELJ A;  4IF4 A;  4CO8 A;  2PLY A;  5KVR A;  2HFH A;  2HS5 A;  4BY7 J;  2FBH A;  2ZFW A;  3DBR B;  1J7K A;  1ZN2 A;  1JUP A;  4Y7N J;  1VFC A;  4CCN A;  1LEA A;  2JTV A;  3LL7 A;  2FXA A;  3P9K A;  2EFW A;  3DEU A;  1R5I D;  3KEO A;  1QHG A;  2IT0 A;  1G4D A;  3Q5F A;  4HST A;  4M9S A;  4IHS A;  4P1W A;  3C1D A;  5EG0 A;  1QGP A;  2DYS H;  3M8E A;  4FT8 A;  1BA5 A;  4KIC A;  3MKY B;  4TV7 A;  4UB8 C;  4DZJ A;  1WI9 A;  2LRE A;  4BE2 A;  1V54 H;  4RAF A;  4QPO A;  4E7Z A;  1JT6 A;  2VPL A;  3OIP A;  1ZQ3 P;  2RC4 A;  2ZJQ F;  4RGS A;  2VLA A;  2XKP A;  1JHH A;  3L2W A;  2HWV A;  2W1O A;  3K6G A;  3HBL A;  2NNY A;  1MBH A;  5DV5 A;  3VYT B;  4P96 A;  3F3X A;  2GZW A;  4ZYE A;  3MVP A;  4ZDP A;  3IWF A;  1VQM I;  1VQ5 I;  3PUB A;  1KYZ A;  3GTP J;  4FX0 A;  3IH4 A;  3R60 A;  1Q1H A;  3G73 A;  2PN6 A;  3HTS B;  2GXB A;  4RLQ A;  1AU7 A;  3PO2 J;  4G7O F;  2COB A;  2M34 A;  2NS7 A;  4IZZ A;  3NEU A;  4RMN A;  2HQ5 A;  2CQX A;  4PSW A;  4QWQ A;  3GTJ J;  5TJJ A;  4XOT A;  2KJC A;  3M1C A;  2JA7 J;  3BJ6 A;  2ZCW A;  1V5F A;  1BI0 A;  2Z3Y A;  1A5J A;  2EA2 A;  4NC6 A;  3ZP5 A;  2ID6 A;  1RET A;  2EWN A;  1TNT A;  2VQH A;  1WZ2 A;  1WKM A;  4RB2 C;  4Y3O A;  3DKY A;  3IAS 2;  2K7L A;  3F0C A;  4E7H A;  4V2F A;  1LE8 B;  1IZ1 A;  4A3K J;  1CGP A;  1FMW A;  3Q3S A;  5CVV A;  5FKL A;  3OYJ A;  2PJP A;  3I55 I;  5IYD J;  4MO7 A;  5LGN A;  1S3J A;  2LOO A;  3DPL C;  3BR1 A;  2NVX J;  1XDU A;  4ZTJ A;  3D5L A;  3CMA I;  4CCL A;  3S93 A;  3FHZ A;  2IS1 A;  3B02 A;  2M8G X;  2LH9 A;  2QUF A;  4XRS G;  1OYI A;  3CME I;  2OV7 A;  3SJM A;  5ED4 A;  3PFI A;  3BLY A;  2DLL A;  3CO6 C;  3GZ5 A;  4LG0 B;  4JYK A;  3SHF A;  2DT6 A;  3H9Q A;  5D4R A;  1K78 A;  3BG6 A;  2H94 A;  1BJZ A;  1JTX A;  4AVZ A;  2R7T A;  1R1U A;  1Q1V A;  1D0Z A;  5IYC J;  2M2E A;  3RSN A;  2NVT J;  1LFP A;  1WJE A;  1T08 B;  1YJ9 I;  2E2H J;  2EJR A;  4BDY A;  5HS7 A;  1MSE C;  3BQZ A;  3MN2 A;  1FYL A;  2HDW A;  4B47 A;  3B6A A;  2F6C A;  3PNY A;  1DPR A;  2M30 A;  1X1P A;  4IRI A;  2NOG A;  3BR3 A;  2HOE A;  3M1E A;  2QQ8 A;  1ZGW A;  2E1M B;  2ETH A;  1SFE A;  4PJ0 C;  3CC7 I;  1Z3X A;  4HEA 2;  1JTY A;  5E1W A;  3KZI C;  1XCB A;  3H3U A;  3OSG A;  1VQ9 I;  2V1U A;  3ZQ7 A;  2E34 A;  3R0A A;  2K27 A;  2W24 A;  2NS0 A;  4MIM A;  2CRG A;  1TBX A;  4M9X A;  3AG3 H;  4DOZ A;  2H8R A;  1YS7 A;  3W2A A;  4UY8 I;  2BW3 A;  3CZ6 A;  3U21 A;  3H0G J;  2R7W A;  5ERI A;  2G9W A;  1BOA A;  4NNJ A;  3FIS A;  4XMY A;  3BPV A;  2DBB A;  1F36 A;  1U2W A;  5J40 A;  4XRS A;  1LPQ A;  2BE5 F;  3QRF F;  2KQR A;  4XBF A;  2F5E A;  3SZP A;  1IGN A;  3GTL J;  2WAQ A;  4M6V A;  5J47 A;  1FOK A;  2ADU A;  2FOK A;  1XMX A;  1G3W A;  2L7Z A;  5F27 A;  3BR5 A;  1S5L C;  5J4Y A;  2QQ9 A;  2EB7 A;  2V6C A;  3RKY A;  4ZJZ A;  3OS0 A;  2DOE A;  2H6C A;  2R3S A;  2ELK A;  3A01 A;  1QVT A;  1LVA A;  1SAU A;  1XGO A;  1XSD A;  2HPI A;  3I4P A;  3QP6 A;  3GFI A;  1HLV A;  3MWM A;  2M87 A;  4AIK A;  3SZG A;  4EM0 B;  3BDD A;  3MZ8 A;  3H5A A;  3CUO A;  2MW8 A;  2W57 A;  1DUX C;  4YFN F;  2XF5 A;  3V8L A;  1YW9 A;  3LAJ A;  2R7Q A;  1OPC A;  2IA0 A;  1YJW I;  1PDN C;  1HXD A;  2K9S A;  3J7Z I;  2HVQ A;  2R0Q C;  5GTH C;  1LB2 A;  2R7F A;  2IGM A;  4KN7 X;  4PGH A;  1FZP B;  3K1N A;  4XK4 A;  1WJA A;  1X4P A;  5DD4 A;  1YX3 A;  5EGO B;  2R7X A;  3I9V 2;  3QOP A;  3E3V A;  3OYF A;  3HOZ J;  4ITV A;  3EUK L;  4N9H A;  4ESJ A;  5B1A H;  2GIV A;  1OCT C;  5EEG A;  1L3L A;  3TOB A;  5JLW A;  1MBF A;  2GWR A;  2GM4 A;  3ISP A;  4NHJ A;  5J1R A;  4CSW A;  3SEQ A;  1XC5 A;  3IAM 2;  4HA8 A;  2XVC A;  3L2V A;  1J2X A;  3F8C A;  2W00 A;  2DN0 A;  4XR6 A;  3DU6 A;  1RKT A;  2TCT A;  3L7W A;  5CVI A;  3TDU C;  2CV1 A;  1A31 A;  3V42 A;  2HYJ A;  1IN6 A;  4XRM A;  2VQG A;  4AVP A;  1VQ8 I;  3FXL A;  5K7F A;  3RI4 A;  3DBH B;  2OQG A;  2GA1 A;  1HQC A;  3QPH A;  2OUM A;  3K9T A;  2R7D A;  1HKQ A;  4A0Y A;  1IF1 A;  3I4N J;  1QO0 D;  4V2G A;  1Z6R A;  1LDJ A;  4OIP F;  3QAH A;  1YE9 A;  4BJT A;  3RQ4 A;  3S2D J;  4HF0 A;  2DJN A;  3WTX C;  1R4M B;  2XKO A;  1WVR A;  5LBQ A;  3OYH A;  3TED A;  4GO1 A;  2JA8 J;  2F2E A;  4BH9 A;  4MEX F;  1BC7 C;  3GUD A;  3OIO A;  2K85 A;  1LJ9 A;  4PFO A;  2OA4 A;  3ERM A;  3U2R A;  4KIB A;  4BDZ A;  2FML A;  3PIO F;  4A3M J;  3FXO A;  4WK8 F;  2DT7 B;  3AG2 H;  1OCZ H;  2A61 A;  3IC7 A;  3SQN A;  4ZDL A;  3A02 A;  3ULQ B;  2Y0S N;  5E17 F;  2ESN A;  1UZC A;  5L3G A;  3LSJ A;  1VF9 A;  5ILU A;  1OFC X;  1TQM A;  1U5T B;  4A69 C;  5E3M A;  5LHH A;  3AL0 C;  4WCG A;  1FOY A;  1MBG A;  2EBI A;  5FLX Z;  4IRH A;  4N4N B;  5FO5 A;  1K6O A;  4MQV A;  2A5Y B;  4UV9 A;  3ZQH A;  1XPX A;  1RUN A;  4CYC B;  4R1H A;  4DBQ A;  1T38 A;  3OOP A;  4RGU A;  3OY9 A;  3JAM Z;  5FFZ A;  4A6E A;  1VTN C;  4BEH A;  3KYD B;  4XOP A;  3ZMS A;  1A35 A;  1FOW A;  3M8F A;  3ML6 A;  3PQK A;  2FD5 A;  2M7A A;  1CF7 B;  3J80 K;  1RR7 A;  2LMD A;  2EPF A;  4M3F A;  3DLL F;  3BRO A;  4K2E A;  2AHQ A;  2JVG A;  4N0B A;  5F64 A;  4A3I J;  2D5V A;  2R92 J;  1XGS A;  2VB6 A;  2ZNY A;  3K70 C;  2CFX A;  1I6H J;  3K7A J;  3S1N J;  1WH7 A;  1TZL A;  2X1C A;  5GAD J;  4D5C A;  3I54 A;  2STW A;  2E7X A;  1ZAO A;  3UKG A;  2LKP A;  1XDS A;  3KCC A;  3OYE A;  1YRN A;  3GTO J;  3D5R C;  1IUY A;  5F6F A;  3JRF A;  3MAJ A;  4KUM A;  1G3T A;  3DFG A;  3DWL E;  2DI3 A;  3FDY A;  1MMS A;  3FK7 A;  3GBG A;  3HL2 A;  4L0Y B;  5M3M J;  2DFI A;  1XD7 A;  2PMZ A;  1U5T C;  3IUO A;  2RV8 A;  2O61 A;  3OL4 A;  2H6B A;  2X1D A;  4BXF A;  2FE3 A;  3DKX A;  3K4J A;  1KU2 A;  4KDP A;  1Z67 A;  3CQZ J;  3OYK A;  2JPB A;  1XB4 A;  5LFA A;  2M4G A;  3CMY A;  3WG7 H;  1WSU A;  1ETW A;  5FD6 A;  4A3C J;  3OYG A;  2OTJ I;  1GVJ A;  3BJA A;  4I0A A;  1G8X A;  1TL8 A;  2KKO A;  3HIF A;  4RLF A;  3QU6 A;  1HC8 A;  2WB1 N;  1ACI A;  4B3A A;  3SXY A;  5E3O A;  2MSY A;  1BL0 A;  1J9I A;  1MBJ A;  2FEZ A;  1I1S A;  2P7V B;  5LEK A;  5LEJ A;  3VYS B;  1NK3 P;  4CHU A;  2VBW A;  3EUH C;  2GXA A;  4WXD A;  3KP5 A;  5DCM A;  1ERD A;  2XGX A;  2DYR H;  3CCY A;  4PJL A;  2CV0 A;  2X9D A;  3MKZ A;  1KA8 A;  2L7M P;  3TKY A;  2ELH A;  3GX4 X;  2XPU A;  4BS9 A;  1EF4 A;  2VOO A;  1WHU A;  4ESF A;  2PJR B;  2YPR A;  4A12 A;  2E35 A;  2MA3 A;  4CYC A;  1AWC A;  1LKX A;  3IKT A;  2F5V A;  4IQ4 A;  5L3C A;  1JKO C;  2EV0 A;  3AG4 H;  4CCK A;  4S04 A;  3K69 A;  3HSR A;  4R8H A;  3C7J A;  4EJV A;  3GTK J;  3W2V A;  3HOU J;  2VC1 A;  4EJO A;  5JVG F;  2IRF G;  2X4H A;  1QNT A;  5M3F J;  3FWE A;  4MHG A;  4E7K A;  2FQ3 A;  1FT9 A;  1Z7U A;  3E5Q A;  2ECB A;  3QPL A;  1MJ9 A;  4ENN A;  4BNC A;  3S16 J;  3GFJ A;  1IRF A;  2R4G A;  4IRG A;  1YQA A;  2BXY A;  2VE9 A;  2O8K A;  2VXZ A;  2BHY A;  2ZME B;  2O9L A;  2M45 A;  1ZK8 A;  2EFN A;  1MDM A;  1ITY A;  5K7H A;  2ZSI B;  2MC3 A;  2KL4 A;  1KGS A;  1H0M A;  1VQN I;  1XN7 A;  4YG2 F;  4KYW A;  1Y0N A;  2FJ1 A;  3LOC A;  4CCJ A;  3Q0V A;  1OLT A;  2ZXI A;  5E18 F;  2M5W A;  4DBR A;  1BJA A;  1GV2 A;  3GZ6 A;  1FJL A;  4A6D A;  3GTM J;  5LHI A;  1FP1 D;  3L9F A;  3RQI A;  3S32 A;  4IHW A;  3DF8 A;  4BE0 A;  3ZMZ A;  1WJC A;  3P9I A;  2BBY A;  4HV5 A;  5F0F A;  3TL4 X;  1Y56 A;  1EH8 A;  2Y30 A;  2E5N A;  1B9N A;  3GF2 A;  4OOI A;  3WU0 A;  2LKX A;  3TW6 A;  1KU9 A;  2JT1 A;  2OZU A;  2JWT A;  2ZBK A;  3C18 A;  3DCF A;  4AWX B;  4EMS A;  3G1O A;  3ZQI A;  2JRT A;  2CS3 A;  3E1S A;  3T8T A;  3DEE A;  3W6V A;  4Z6Y A;  3PNV A;  2IJL A;  1V55 H;  1T95 A;  2FF4 A;  3VFZ A;  4C30 A;  1HCR A;  1FYK A;  4CGZ A;  3JAM K;  1XMK A;  3CC2 I;  2EIM H;  4B43 A;  5AIQ A;  4O5V A;  5K5R A;  2QKM B;  5KCM A;  1HSJ A;  5HS8 A;  1A6Q A;  1R1V A;  1ORK A;  2OC6 A;  2FBK A;  4HNU A;  3JTG A;  1YLF A;  2IPQ X;  1MMA A;  1XMA A;  2F5D A;  3FKI J;  2JMW A;  4MLO A;  4M72 A;  1SEU A;  2XHK A;  2DQR A;  4B09 A;  1FMV A;  3HUG A;  1IC8 A;  1SVM A;  1ULY A;  3OSF A;  4B1R A;  1S29 A;  1QVU A;  3DU5 A;  3KYC B;  5H6R A;  3TP0 A;  4P9U A;  2HEO A;  2YUS A;  4CYD A;  2GA2 A;  1Z7L A;  3RIR A;  4YFK F;  3EET A;  2V6E A;  2NAZ A;  4CZC A;  3HDD A;  1IRX A;  4PUS A;  5IPA A;  2F48 A;  4BUP A;  2KIU A;  1G3Y A;  1IJW C;  3L2Q A;  3ZCO A;  1Z21 A;  3BCB A;  3BPX A;  3L1P A;  3AAF A;  3W6K B;  3ZPL A;  1LE8 A;  2V1X A;  5IT9 Z;  2L02 A;  4IQJ A;  1LFB A;  2HXI A;  2A6T A;  4CCM A;  2PMZ N;  2PX9 A;  3DXJ F;  3NQO A;  2Y31 A;  3VOE A;  4RGX A;  1OQY A;  2L0K A;  2RN7 A;  1P9Q C;  2VJ4 A;  3DKW A;  3WHC A;  1IG7 A;  5EGO A;  1U9N A;  2R7V A;  1X3Z B;  2K9L A;  1I3Q J;  2AQF A;  3HSF A;  1LVK A;  3RZD J;  3LFU A;  5F1J A;  4A5M A;  2H27 A;  3CC4 I;  4LLN A;  4CUG A;  1IAW A;  2E60 A;  5IY5 H;  1FX7 A;  4XLH A;  1D3Y A;  2ZME A;  1FTT A;  2Y0S A;  3KP3 A;  1PYV A;  2VT2 A;  2MLG A;  1X3W B;  2DK8 A;  4ZYD A;  4UB6 C;  4D0P A;  1HKS A;  3N97 A;  2DMP A;  4KN4 X;  4C2M J;  2MLK A;  1TWF J;  3S2W A;  2VJJ A;  3ASO H;  3VOD A;  2F5C A;  4Y52 J;  3EYY A;  5KK1 A;  4Y13 A;  5D6E A;  2DDB A;  4KFC A;  3AL0 B;  3I4M J;  4IOA F;  1P6R A;  3CCR I;  4B4C A;  3ZRG A;  1ODD A;  1BI3 A;  1ONV A;  2H09 A;  3LQQ A;  1R71 A;  1HA8 A;  2LY1 A;  4UNO A;  1K6Y A;  3DPU A;  3LST A;  1K83 J;  4XLC A;  1ETY A;  4MFD A;  2ZJR F;  2AS5 F;  4I99 C;  5GP9 A;  2CWE A;  4L9V A;  4EM1 A;  3HXL A;  3SFZ A;  4JX5 A;  1QA6 A;  2D1H A;  3AFH A;  3CP2 A;  1MIJ A;  3LWF A;  1Y0U A;  2DMT A;  3NAR A;  4HNT A;  4XRF A;  1KON A;  4AIJ A;  2UUZ A;  5E3N A;  5JLX A;  1MMG A;  5IOZ A;  3HPH A;  2ZNZ A;  3KEQ A;  4B3X A;  4FQG A;  3CCS I;  2LF8 A;  4XID A;  2KHM A;  5JFR A;  3JRB A;  1P92 A;  4MQ9 F;  3KET A;  2PQ8 A;  4NQW B;  4S05 A;  1S72 I;  3A0H C;  4DYC A;  5M5Y J;  3CJR B;  3FXK A;  1MNE A;  2EV6 A;  2JUC A;  2Y69 H;  1PUF B;  4I98 B;  4RAZ A;  3OYC A;  3BCA A;  4GRI A;  4EM2 A;  4PDK A;  2J5O A;  3KPH A;  3WTW C;  4Q4Z F;  1UST A;  1Z0X A;  3FXM A;  2GLO A;  4KT6 A;  1FY7 A;  3A01 B;  2FA5 A;  1XCV A;  1D0Y A;  1W36 C;  1D5Y A;  3W2W A;  1BN5 A;  1W7P A;  2I5U A;  5J1U A;  4ON0 A;  3JRD A;  3ECO A;  1C0W A;  1ETV A;  2P5K A;  3KZZ A;  3RKW A;  4B8X A;  1EV7 A;  3HOX J;  4OWR B;  2HOT A;  4M6X A;  5DDG A;  1H8A C;  2R5Y B;  3K4N A;  4KMF A;  4XLN F;  3F21 A;  4A2U A;  3U9G A;  3H9G A;  2M0C A;  4M74 A;  4RBO A;  4FTH A;  3ESW B;  1OIS A;  3ABU A;  2LKS A;  4IX7 A;  3M07 A;  1G6N A;  4HOB A;  3U1K A;  4M6Y A;  1TWG J;  3F72 A;  3LFK A; 
#chains in the Genus database with same CATH homology
 2YX4 A;  3WGG A;  4HQE A;  2PG4 A;  1H9G A;  5K5Q A;  3F8M A;  5BQT A;  2RDP A;  2RNJ A;  4MTE A;  1SFU A;  3E6M A;  3FMR A;  1K7A A;  4L5J A;  3IL2 A;  4IHT A;  4MTD A;  2VOD A;  3JW4 A;  3GW2 A;  2Q0O A;  1GHC A;  1WRJ A;  1YO5 C;  1IW7 F;  2X0L A;  2ISZ A;  5HOO A;  1WQ2 A;  4ENJ A;  4NQW A;  4P9F A;  3V8K A;  3K2Z A;  4PGG A;  5LRS A;  2OAZ A;  1XGM A;  3WTT C;  1YIO A;  3GWZ A;  4HX4 A;  4HDU A;  3R61 A;  1UCR A;  2LSO A;  1SD6 A;  1ZLK A;  2VBX A;  4Y17 A;  4BYY A;  3K1P A;  3WTS C;  1K79 A;  4OIO F;  4UV8 A;  3HOS A;  2HYG D;  1MD0 A;  5D5V B;  4U0Y A;  4HLX A;  1U3E M;  5LLQ A;  5HLH A;  5D5W B;  1JXS A;  4FHT A;  3F8F A;  4Q5S F;  4ZH4 F;  1BIA A;  1FC3 A;  3IRR A;  2CQK A;  3CDH A;  1T0F A;  5AIP A;  2DK5 A;  2HTJ A;  2P5L C;  2ZO4 A;  3WGI A;  2Z99 A;  3H92 A;  3WU1 B;  5CYV A;  2KJB A;  2STT A;  3E97 A;  2V79 A;  4HF2 A;  2A07 F;  3LAP A;  3J7A O;  3BOQ A;  4I01 A;  3TO9 A;  3O3K A;  1D8K A;  4MGR A;  2FRH A;  2EFO A;  1I1G A;  1PP7 U;  4E70 A;  1MJA A;  3TQN A;  3KFW X;  1UB9 A;  4YIF A;  5DUK A;  2Q8K A;  1AOY A;  4HAM A;  5JI6 A;  4BQA A;  1J0R A;  2V1D A;  4Z2Y A;  5ICF A;  2PEX A;  1P4A A;  3CJN A;  2HYF A;  3WGH A;  1E17 A;  2K4J A;  3V7R A;  1GXQ A;  2CYY A;  1QZY A;  2YU3 A;  4PZJ A;  4U88 A;  1YTY A;  5IT3 A;  2G7H A;  1EH6 A;  2XAQ A;  2GXG A;  5CVU A;  1F5T A;  3FX3 A;  3JSO A;  5HDG A;  2XAH A;  3J81 Z;  1R36 A;  3P9C A;  2Q2E A;  1UFM A;  2GAU A;  2XRO A;  2JPC A;  1I5Z A;  1I6X A;  3L00 A;  2WTE A;  2QVO A;  3EDP A;  5E1X A;  5J6X A;  5E20 A;  4EJT A;  2E1C A;  1STZ A;  5JR3 A;  1TNS A;  3MZY A;  2EFP A;  1R7J A;  3IRQ A;  3M7G A;  3FM3 A;  3CLO A;  3KP2 A;  4N9I A;  3F22 A;  1MJB A;  2BV6 A;  2COM A;  1ON1 A;  2PFB A;  2D45 A;  1O57 A;  1D8J A;  3E5U A;  1S6L A;  3VEP A;  4L5I A;  2DQL A;  2P7C B;  4AIH A;  3I5U A;  4OIR F;  5L3E A;  2DO7 A;  5CJ9 A;  2A3S A;  5DCM B;  6PAX A;  3WTV C;  3RPQ A;  3V8J A;  5D8L B;  1BBY A;  1KQ9 A;  4BAY A;  1EH7 A;  4A0X A;  2P6S A;  1W4M A;  2K86 A;  1RI7 A;  3SZT A;  3DPT A;  3F6V A;  4G6Q A;  3I59 B;  2YSR A;  1FWZ A;  5J8F A;  2QEN A;  1TW2 A;  2BYV E;  1Z91 A;  1TW3 A;  1T2K A;  1W5S A;  4LK1 F;  5DUI A;  4JQF A;  3EYI A;  3WTY C;  2LNB A;  2BEO A;  2DTR A;  3WE2 A;  1B59 A;  4P55 A;  2D2W A;  1JE8 A;  5ICG A;  3RYP A;  3GXO A;  3EQL F;  1A04 A;  2QQB A;  2OBP A;  2ESH A;  1R5H A;  1IXC A;  2O03 A;  4UUV A;  4ENM A;  1YFH A;  4LG0 A;  3GYH X;  3ZN1 A;  2DT5 A;  2CSO A;  4F7Z A;  2NRA C;  3BY6 A;  1O7L A;  1ZRE A;  1UHM A;  1JHF A;  3RTR A;  4A5N A;  4LLL A;  2YR2 A;  4GYG A;  2FSW A;  1KU7 A;  3I53 A;  2W84 A;  4CZZ A;  1ZRC A;  1BI1 A;  2A69 F;  5CLS A;  4DNC A;  2CGP A;  3WTZ A;  4U7B A;  3C3W A;  1MZB A;  1KYW A;  2PMH A;  2B0L A;  5BMZ A;  3J81 K;  1ZGA A;  3IKV A;  2HKX A;  5LRR A;  2XIG A;  2UWM A;  2OD5 A;  1YYV A;  1HBX G;  1TLH B;  4ZZL A;  1J75 A;  1L0O C;  1W7P D;  3I71 A;  1IXS B;  4G7H F;  1YG2 A;  4L9N A;  4WXH A;  1XSX A;  4MEY F;  3FF5 A;  4GXO A;  5E8I A;  2LF7 A;  2XAF A;  2V9V A;  2FNP A;  3DV8 A;  2OQR A;  3V7S A;  2EA4 A;  2E1N A;  3GO5 A;  3GLX A;  1G3S A;  4OU0 A;  2VBY A;  2TDX A;  3H3Z A;  1TTY A;  2P8T A;  3T1B A;  1OMI A;  4L0Z B;  2QLZ A;  4M71 A;  2DAO A;  5BPI A;  5D5X B;  3D0S A;  4ASN A;  1F4K A;  4WX9 A;  4LGW A;  2Y75 A;  4M9Z A;  1FPQ A;  1Z6T A;  4O3M A;  3RJP A;  2DPU A;  1JGS A;  4NB5 A;  1B6A A;  3QP5 A;  4YII A;  1FBU A;  4G9Y A;  4M73 A;  3FMS A;  2A68 F;  1ZG1 A;  3ECH A;  3E6C C;  1LEB A;  3F23 A;  3M9A A;  4AD9 A;  3GFM A;  3LA7 A;  2L4A A;  1Z9C A;  4UXN A;  3MEX A;  1MGT A;  3DP7 A;  4HX7 A;  3HHG A;  1LNW A;  3ZMU A;  2EFQ A;  3R4K A;  3F6O A;  3CUQ C;  1W7P B;  5D8K B;  1ZYR F;  5D6F A;  1J5Y A;  3GFL A;  5A2Q Z;  3MQ0 A;  1O3T A;  3KP6 A;  4U7D A;  4LLG F;  3OV8 A;  2IVM A;  4L9T A;  2P5V A;  1U5T A;  1YW8 A;  2O8X A;  3TDZ C;  1QZZ A;  2XUB A;  2QBY B;  1T39 A;  2VBZ A;  1S8N A;  4ZYG A;  3FMQ A;  1Z1D A;  4EVI A;  5FGM A;  2EK5 A;  1W5T A;  2MH2 A;  4UVA A;  2Z9O A;  4EJW A;  2W85 A;  4BXU A;  3ZMT A;  2QM3 A;  4U0V A;  5D5U B;  1PUE E;  4WXC A;  5ILV A;  4MNU A;  3T8R A;  4YFX F;  3WE3 A;  3ROU A;  4GCV A;  3J80 Z;  2WC2 A;  4HV6 A;  2GQQ A;  4HLY A;  1SFX A;  3JSP A;  5F1R A;  2OU2 A;  5HLG A;  1KQ8 A;  1YW7 A;  2RKH A;  4UHT A;  2XAG A;  3W6J B;  2FBI A;  3MCZ A;  5CVJ A;  1R22 A;  5K1Y A;  1R5G A;  1BM9 A;  1ZGJ A;  2F5F A;  5L3D A;  5HDN A;  2L3D A;  2VOP A;  1P4W A;  1U6G A;  1ON2 A;  2M8E A;  4G94 A;  3EUH A;  4RGR A;  1KU3 A;  3L2C A;  1LDK B;  2HQR A;  2OZ6 A;  3ELK A;  2RGV A;  1D5V A;  1FBS A;  2W25 A;  2IW5 A;  3RYR A;  2FNA A;  3F8B A;  5BPD A;  2QBY A;  3FXQ A;  1SD7 A;  1SMT A;  4BHB A;  5ICC A;  3F8N A;  2UXX A;  1WWX A;  1KQ0 A;  2WV0 A;  3K0L A;  1B9M A;  4HZF A;  4LD5 A;  3KE2 A;  2L01 A;  4ESB A;  3ZMV A;  2HKO A;  1MDM B;  4IJA A;  1I27 A;  1LQ1 A;  3R6S A;  5DYM A;  1IN4 A;  2CG4 A;  2Y48 A;  5L3B A;  1LDD A;  4KA4 A;  2HZT A;  1ZG5 A;  3KLN A;  3VB2 A;  3RKX A;  1R00 A;  3BWG A;  2MBF A;  3MFK A;  1OKR A;  3TOA A;  4RB0 A;  3ERE D;  1RZ4 A;  2VT3 A;  1ZG3 A;  2Y0M A;  3BP8 A;  3HTU A;  1S7O A;  5CVR A;  3I0T A;  3P7N A;  2CW0 F;  4LB5 A;  4G6D A;  1K78 B;  1X3U A;  2FU4 A;  4IPA A;  3O6B B;  4LMY A;  4P5O A;  5FB2 A;  4XSZ F;  1HKT A;  4O6J A;  4CDG A;  5L3F A;  3PQJ A;  1O3R A;  1IRG A;  2KIF A;  2MD5 A;  3CUQ A;  1U78 A;  4LB6 B;  3ABT A;  3I59 A;  5FFX A;  4Q48 A;  2HR3 A;  4UVB A;  4OMY A;  3CO7 C;  1V3F A;  3CTA A;  2P6T A;  1DDN A;  3HOT A;  2O6G E;  2JZY A;  4ENK A;  1FNN A;  3WOD F;  1SAX A;  4KIG A;  1HW5 A;  2ZJ2 A;  1IN7 A;  5LGU A;  1ZRD A;  5K5O A;  3Q9V A;  3QU3 A;  5BS6 A;  1TQI A;  4GGG A;  3E6B A;  3RDI A;  1R58 A;  2CO5 A;  3I58 A;  1UHW A;  5H20 A;  3G3Z A;  5IT9 K;  2DW4 A;  2O3F A;  2NNN A;  3LA3 A;  4KIF A;  4A0Z A;  1E2X A;  2M1B A;  3HSE A;  2XAJ A;  5HS9 A;  3KLO A;  2UXN A;  1YS6 A;  4IVN A;  3NRV A;  2HDC A;  1S7A A;  3KZY A;  4LFU A;  1OYW A;  2PBI A;  3HRS A;  1O7F A;  2VE8 A;  1QQI A;  1XSV A;  4PCQ A;  4IXA A;  3T5X A;  2HQN A;  2QZ8 A;  4EJU A;  5J8C A;  4G8X A;  4WF2 A;  4QLC U;  4I02 A;  1ZRF A;  3HHH A;  1Z05 A;  4LJZ F;  4HBL A;  4UVC A;  3BJO A;  3REO A;  2D1V A;  5EEH A;  4ETS A;  3IHU A;  3BZ6 A;  4HDV A;  3L09 A;  4RB3 C;  2PMU A;  2IA2 A;  2C6Y A;  2KIM A;  3FZV A;  4XLP F;  5JVT A;  3E6D A;  2UZK A;  2L4M A;  4L9J A;  2E7W A;  2ACJ A;  1FYM A;  4JK1 X;  4RS8 A;  4GYI A;  4RB1 A;  5JHU A;  1GXP A;  4H0E A;  1FP2 A;  4KMU X;  3HRT A;  5LGT A;  1DPU A;  3WG9 A;  1P2F A;  4HQM A;  2A6H F;  2YX7 A;  5H6Q A;  5ILS A;  1T98 A;  5DD8 A;  2O0Y A;  4CXF A;  4HYE A;  1B4A A;  1F1Z A;  1R23 A;  3DQV C;  1P4X A;  2Z5U A;  1QBJ A;  3R0J A;  2A6E F;  2Z33 A;  3TO6 A;  4RAY A;  3KP7 A;  5LHG A;  4U0W A;  1FLI A;  4I09 A;  2KRF A;  1HW2 A;  4KT5 C;  3HRU A;  1J59 A;  3I64 A;  1U8R A;  1SMY F;  5FLX K;  1B1B A;  2QWW A;  3T0Y A;  4HF1 A;  3WTU C;  4Y15 A;  2BGC A;  3U1D A;  2EV5 A;  1DP7 P;  2P4W A;  2QYO A;  3N4M A;  3QPT A;  4EGZ A;  1RIO H;  2DPD A;  5HVQ C;  5DCF A;  2ZKZ A;  4WWC A;  2RVC A;  5DEQ A;  2XAS A;  2FMY A;  1SD5 A;  2PI0 A;  4LK0 F;  2IA1 A;  1OR7 A;  3TO7 A;  1RUO A;  1USS A;  1ZHF A;  1ZH5 A;  2XRN A;  1SD4 A;  2VN2 A;  3V4G A;  4HW0 A;  2NYX A;  3HRM A;  1TQP A;  4BHC A;  4OIQ F;  3K1M A;  4R79 A;  3MZH A;  4L18 B;  2XV4 S;  4DQ2 A;  1NHA A;  4JBA A;  1IN8 A;  1CF7 A;  1H9T A;  2ZXJ A;  4I2O A;  2MH9 A;  1FSH A;  3KP4 A;  1BIB A;  2VC0 A;  3B73 A;  5BOX A;  2IP2 A;  5E8G A;  5A2Q K;  5HDK A;  5ICE A;  3GVA A;  5TRD A;  1V4R A;  3Q9S A;  3LA2 A;  4G7Z F;  2G7U A;  2HTS A;  1QPM A;  1IXR C;  1FSE A;  1R1T A;  4I7H A;  4Q47 A;  1XGN A;  2ISY A;  5E1Z B;  4EV0 A;  4EQQ A;  3GEZ A;  3RPU A;  2AXL A;  3ZMD A;  3CUQ B;  3HYI A;  1BI2 A;  1O3Q A;  2RQP A;  1BC8 C;  1HST A;  1RNL A;  1OYY A;  3O2P E;  2WWY A;  3COA C;  1ZAR A;  4EGY A;  5FD5 A;  4KNY A;  2LDU A;  1PP8 F;  4OMZ A;  4I0B A;  3FXU A;  5HLI A;  3JTH A;  1HW1 A;  1REP C;  2L54 A;  2JSC A;  4OIN F;  5AON A;  2J5P A;  3FXR A;  1T6S A;  3FM5 A;  4CIC A;  2K02 A;  3LQR A;  4BHP A;  2HGC A;  3IWZ A;  1MKM A;  3TGN A;  3E5X A;  4ZZD A;  1FBQ A;  4ZYH A;  2QQA A;  4HX8 A;  2VON A;  1O3S A;  1F9N A;  2K4B A;  4XSX F;  2DU9 A;  3V7C A;  4FX4 A;  3ZN0 A;  1IN5 A;  5D4S A;  1ZLJ A;  4IF4 A;  4CO8 A;  2PLY A;  5KVR A;  2HFH A;  2HS5 A;  2FBH A;  2ZFW A;  1J7K A;  1ZN2 A;  1LEA A;  2JTV A;  2FXA A;  3P9K A;  2EFW A;  3DEU A;  3KEO A;  2IT0 A;  1G4D A;  3Q5F A;  4M9S A;  4IHS A;  3C1D A;  1QGP A;  3M8E A;  4FT8 A;  4KIC A;  4TV7 A;  1WI9 A;  2RC4 A;  4RGS A;  2XKP A;  1JHH A;  2HWV A;  2NNY A;  5DV5 A;  4P96 A;  3F3X A;  2GZW A;  4ZYE A;  3IWF A;  1KYZ A;  4FX0 A;  3R60 A;  1Q1H A;  3G73 A;  2PN6 A;  3HTS B;  2GXB A;  4G7O F;  3NEU A;  4QWQ A;  5TJJ A;  2KJC A;  3BJ6 A;  2ZCW A;  2Z3Y A;  1BI0 A;  2EA2 A;  3ZP5 A;  2EWN A;  1TNT A;  1WKM A;  4RB2 C;  2K7L A;  1CGP A;  1IZ1 A;  5CVV A;  2PJP A;  5LGN A;  1S3J A;  3DPL C;  1XDU A;  3D5L A;  3FHZ A;  3B02 A;  2QUF A;  1OYI A;  5ED4 A;  3PFI A;  2DLL A;  3CO6 C;  3GZ5 A;  4LG0 B;  3SHF A;  5D4R A;  1K78 A;  2H94 A;  1R1U A;  2EJR A;  5HS7 A;  1FYL A;  1DPR A;  2M30 A;  4IRI A;  2HOE A;  3M1E A;  2ETH A;  1SFE A;  5E1W A;  1XCB A;  3H3U A;  2V1U A;  3ZQ7 A;  3R0A A;  2K27 A;  2W24 A;  2NS0 A;  1TBX A;  4M9X A;  1YS7 A;  5ERI A;  2G9W A;  1BOA A;  3BPV A;  2DBB A;  1U2W A;  2BE5 F;  3QRF F;  4XBF A;  2F5E A;  3SZP A;  1FOK A;  2ADU A;  2FOK A;  1G3W A;  2QQ9 A;  2EB7 A;  2V6C A;  3RKY A;  2H6C A;  2R3S A;  1LVA A;  1XGO A;  1XSD A;  3I4P A;  3QP6 A;  3GFI A;  3MWM A;  2M87 A;  4AIK A;  4EM0 B;  3BDD A;  3CUO A;  2W57 A;  1DUX C;  4YFN F;  3V8L A;  1YW9 A;  3LAJ A;  1OPC A;  2IA0 A;  1PDN C;  1HXD A;  1LB2 A;  2R7F A;  4KN7 X;  4PGH A;  1FZP B;  3K1N A;  5DD4 A;  3QOP A;  3E3V A;  4N9H A;  4ESJ A;  2GIV A;  5EEG A;  1L3L A;  3TOB A;  2GWR A;  3ISP A;  4NHJ A;  4HA8 A;  2XVC A;  1J2X A;  3F8C A;  3L7W A;  5CVI A;  3TDU C;  1IN6 A;  4AVP A;  3RI4 A;  2OQG A;  2GA1 A;  1HQC A;  3QPH A;  3K9T A;  2R7D A;  1HKQ A;  4A0Y A;  1IF1 A;  1QO0 D;  1Z6R A;  1LDJ A;  4OIP F;  3QAH A;  4HF0 A;  3WTX C;  2XKO A;  5LBQ A;  4GO1 A;  2F2E A;  4BH9 A;  4MEX F;  1BC7 C;  3GUD A;  1LJ9 A;  2OA4 A;  3U2R A;  4KIB A;  2FML A;  4WK8 F;  2A61 A;  3IC7 A;  3SQN A;  3ULQ B;  5E17 F;  2ESN A;  5L3G A;  5ILU A;  1TQM A;  1U5T B;  5LHH A;  4WCG A;  5FLX Z;  4IRH A;  5FO5 A;  1K6O A;  4MQV A;  2A5Y B;  4UV9 A;  1RUN A;  4R1H A;  1T38 A;  3OOP A;  4RGU A;  3JAM Z;  5FFZ A;  4A6E A;  1VTN C;  3ZMS A;  3M8F A;  3ML6 A;  3PQK A;  1CF7 B;  3J80 K;  3BRO A;  4K2E A;  4N0B A;  5F64 A;  1XGS A;  2ZNY A;  2CFX A;  3I54 A;  2STW A;  2E7X A;  1ZAO A;  2LKP A;  1XDS A;  3KCC A;  1IUY A;  5F6F A;  3MAJ A;  4KUM A;  1G3T A;  3DFG A;  2DI3 A;  4L0Y B;  2DFI A;  1XD7 A;  1U5T C;  2RV8 A;  2O61 A;  2H6B A;  2FE3 A;  1KU2 A;  4KDP A;  2JPB A;  1XB4 A;  1WSU A;  5FD6 A;  1GVJ A;  3BJA A;  4I0A A;  2KKO A;  3HIF A;  3QU6 A;  3SXY A;  1J9I A;  2FEZ A;  1I1S A;  2P7V B;  5LEK A;  5LEJ A;  4CHU A;  2VBW A;  4WXD A;  3KP5 A;  5DCM A;  2XGX A;  1KA8 A;  3TKY A;  2ELH A;  3GX4 X;  2VOO A;  4ESF A;  2YPR A;  4A12 A;  2MA3 A;  1AWC A;  3IKT A;  5L3C A;  2EV0 A;  4S04 A;  3K69 A;  3HSR A;  4R8H A;  3C7J A;  4EJV A;  2VC1 A;  4EJO A;  2IRF G;  2X4H A;  1QNT A;  3FWE A;  4MHG A;  2FQ3 A;  1FT9 A;  1Z7U A;  3E5Q A;  4ENN A;  1MJ9 A;  4BNC A;  3GFJ A;  1IRF A;  4IRG A;  1YQA A;  2VE9 A;  2VXZ A;  2ZME B;  2M45 A;  2EFN A;  1MDM A;  2MC3 A;  1KGS A;  1H0M A;  1XN7 A;  4YG2 F;  4KYW A;  5E18 F;  2M5W A;  1BJA A;  3GZ6 A;  4A6D A;  5LHI A;  1FP1 D;  3L9F A;  3DF8 A;  3ZMZ A;  3P9I A;  2BBY A;  4HV5 A;  1EH8 A;  1B9N A;  3GF2 A;  4OOI A;  3WU0 A;  1KU9 A;  2JT1 A;  2OZU A;  2ZBK A;  3C18 A;  4AWX B;  4EMS A;  2JRT A;  3T8T A;  2IJL A;  2FF4 A;  3VFZ A;  1FYK A;  4CGZ A;  3JAM K;  1XMK A;  5AIQ A;  4O5V A;  5K5R A;  1HSJ A;  5HS8 A;  1R1V A;  2FBK A;  3JTG A;  1YLF A;  2IPQ X;  1XMA A;  2F5D A;  4M72 A;  2XHK A;  2DQR A;  4B09 A;  3HUG A;  1ULY A;  1S29 A;  5H6R A;  2HEO A;  4P9U A;  4CYD A;  2GA2 A;  3RIR A;  4YFK F;  3EET A;  2NAZ A;  2KIU A;  1G3Y A;  3BPX A;  3AAF A;  3ZPL A;  3W6K B;  2V1X A;  5IT9 Z;  2L02 A;  3DXJ F;  3NQO A;  3VOE A;  4RGX A;  2RN7 A;  3DKW A;  3HSF A;  4A5M A;  2H27 A;  4LLN A;  1IAW A;  1FX7 A;  1D3Y A;  2ZME A;  3KP3 A;  2VT2 A;  2MLG A;  2DK8 A;  4ZYD A;  4D0P A;  1HKS A;  3N97 A;  4KN4 X;  2MLK A;  3S2W A;  3VOD A;  2F5C A;  3EYY A;  5KK1 A;  4Y13 A;  5D6E A;  4KFC A;  1P6R A;  1ODD A;  1BI3 A;  1ONV A;  2H09 A;  3LQQ A;  4UNO A;  3LST A;  2AS5 F;  2CWE A;  4L9V A;  4EM1 A;  3SFZ A;  2D1H A;  3LWF A;  1Y0U A;  4XRF A;  4AIJ A;  2ZNZ A;  3KEQ A;  2LF8 A;  5JFR A;  1P92 A;  4MQ9 F;  3KET A;  2PQ8 A;  4S05 A;  2EV6 A;  4I98 B;  4RAZ A;  4EM2 A;  4PDK A;  2J5O A;  3WTW C;  4Q4Z F;  1UST A;  1FY7 A;  2FA5 A;  1XCV A;  1BN5 A;  1W7P A;  4ON0 A;  3ECO A;  1C0W A;  2P5K A;  3KZZ A;  3RKW A;  4B8X A;  1EV7 A;  4M6X A;  5DDG A;  4KMF A;  4XLN F;  3F21 A;  4A2U A;  3U9G A;  4M74 A;  3ABU A;  1G6N A;  4HOB A;  4M6Y A;  3F72 A;  3LFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...