1FZPB

Crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
AITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(P*AP*TP*AP*TP*AP*TP*A)-3'
publication title Crystal structures of SarA, a pleiotropic regulator of virulence genes in S. aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 23
structure length 105
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fzpB00
2NNYA 1E17A 3GUDA 4KUMA 2GIVA 3JSOA 3VFZA 1B4AA 1R1VA 4Q47A 4O3MA 1ULYA 5F1RA 4A0ZA 3MAJA 3E3VA 3HOSA 2DK8A 3JTGA 5AIPA 1A04A 4ESBA 3ISPA 1R1UA 4RB1A 5D6FA 1H0MA 2F5FA 3ROUA 2YX7A 1QQIA 3BJAA 2HS5A 4EM2A 1MKMA 1Z7UA 3JAMZ 4PGHA 1B9MA 1J75A 2M5WA 2W25A 1YTYA 2LKPA 5D5XB 4G7HF 4BYYA 4BXUA 3JW4A 2DW4A 3I58A 2MA3A 5HDGA 2RGVA 3RPQA 3CO7C 5L3FA 4XSXF 3E6MA 4KIGA 2GZWA 2BV6A 4L5IA 3I53A 3R0JA 5H6QA 4CZZA 4EGZA 2QM3A 1FY7A 2IA1A 5HDKA 3WE2A 2DAOA 1P4AA 4I01A 3PQJA 1EV7A 1P6RA 1FWZA 5DV5A 2QUFA 2VC0A 2Y48A 1S29A 4EGYA 3CUQC 5HS7A 1ZN2A 3ERED 4WF2A 2HEOA 1XGMA 2PFBA 2E1CA 1SFEA 1FBQA 1SFXA 2VT2A 1WQ2A 2JPCA 4CYDA 2PN6A 4FT8A 3E6DA 2Y0MA 2NRAC 1KU7A 5CLSA 3BP8A 1BC8C 3GFJA 4BHCA 2X0LA 1WRJA 2HZTA 2JT1A 3HOTA 3N97A 3J80Z 4ZYDA 2MC3A 4YIFA 1LDJA 2RC4A 3FM3A 3WG9A 1IN6A 3T1BA 4G6DA 5ILSA 2IT0A 2F5EA 1T39A 4LMYA 4IF4A 1NHAA 1WWXA 3O6BB 4HF2A 2RN7A 2KJBA 2L54A 1LQ1A 5D5VB 5FLXZ 1OYIA 2K02A 4LLNA 3RKWA 3WGIA 4KN7X 2OAZA 2H6BA 1TTYA 3KZZA 5E20A 4S04A 2HTSA 3KCCA 2DPDA 4HV6A 3MZYA 3QP6A 1I27A 2A61A 2WWYA 2P7CB 1FX7A 4G6QA 2P8TA 4RS8A 3L00A 4Y13A 5E17F 1YIOA 2L4MA 1OR7A 4UVAA 2KRFA 4GO1A 3V8JA 2XVCA 5DCFA 3LSTA 3C1DA 4O5VA 1LVAA 3J81Z 2HYGD 1XB4A 4ETSA 3CJNA 2QQAA 1FOKA 3HSFA 1G3TA 1FSHA 1ZYRF 6PAXA 5ICFA 3R61A 5LGUA 1PP7U 1K78B 2FNPA 5FB2A 5L3CA 4XLPF 2DFIA 3P9KA 2E7WA 4L18B 3HIFA 2Z5UA 2VE8A 4M9SA 4CICA 1JXSA 3WTYC 4KFCA 2P5VA 3GYHX 1O57A 3F21A 2CG4A 2FMYA 2HTJA 4KA4A 2XRNA 1RI7A 3GFLA 3CUQA 5IT9Z 2Q0OA 4Q5SF 3OOPA 3FMSA 2VBYA 4R1HA 3O2PE 3U2RA 1V4RA 1IRGA 4KIFA 4LJZF 3L7WA 5L3BA 5DD4A 4MTDA 1S8NA 3BROA 1FP1D 4R8HA 3DPLC 3CTAA 4RAYA 3C3WA 2OA4A 4HX4A 2GA2A 1LDKB 1U8RA 4L9NA 2M1BA 1Z91A 5D4RA 1LEAA 4KDPA 3F3XA 1UFMA 3M1EA 4CO8A 2ESHA 3U9GA 3F72A 2ADUA 3DF8A 1SMTA 1ZREA 1K78A 3TO7A 3GO5A 4KMUX 5HS9A 2AS5F 3H3UA 1QO0D 1USTA 5TRDA 3ZP5A 1YFHA 2C6YA 2XASA 2RQPA 2MLKA 1FBSA 2XAJA 2EFQA 1W5TA 1ZG3A 1F4KA 1UHMA 3I64A 5H20A 1QZYA 4WXDA 3B73A 2QZ8A 1ON1A 1BI3A 4OMYA 3QU6A 5AIQA 4HDVA 2IA0A 3B02A 1OKRA 3FZVA 3REOA 4G8XA 1R36A 1FPQA 4ASNA 2JTVA 1D5VA 4EJOA 2YPRA 3G3ZA 4PGGA 3VOEA 3IRQA 5DYMA 2IW5A 5J8FA 3HSEA 2IRFG 4L9VA 3P7NA 1O3RA 1ZGAA 2D1HA 1B9NA 1E2XA 1D3YA 3TO6A 2UXNA 3I4PA 2QBYB 2YX4A 4HDUA 2P4WA 4BNCA 4OIPF 2BE5F 2V79A 3CUOA 4AIJA 4NHJA 1CGPA 2DPUA 2VOPA 1LEBA 3MFKA 4Q48A 1R7JA 4LB6B 5FFZA 3U1DA 4EQQA 4RGRA 2CFXA 4WX9A 4M6YA 3TOBA 1T98A 3L09A 3WGHA 5ICCA 4A0YA 1OYYA 2FBIA 4P9FA 1DUXC 3WTUC 4QLCU 2QENA 2ELHA 3HYIA 1HSTA 4M71A 5KK1A 3K69A 1UCRA 4XSZF 4WWCA 1EH6A 5CVJA 4YG2F 3ZMDA 4GYGA 5LHGA 2Z3YA 5BQTA 1IXCA 2QVOA 1TNSA 1R5GA 5F64A 4Y15A 2P5KA 1ZRFA 3ECHA 3FWEA 3ZMVA 4LG0B 3GX4X 3F8NA 3W6KB 5D8LB 2LDUA 4MHGA 4I0AA 1U5TC 1JHFA 2EFOA 4U7BA 1TQPA 1VTNC 5HS8A 2B0LA 4OMZA 3IC7A 4ZZDA 1LDDA 4UUVA 4IHSA 4A12A 2H94A 2G7HA 2WTEA 3VEPA 2EA4A 1JE8A 3GFMA 1ZARA 2V1UA 2ZXJA 2VOOA 2QBYA 4WXHA 3CLOA 1SD7A 1PUEE 4RGUA 5D5WB 1K79A 3FMQA 2NS0A 4UHTA 1TLHB 1J7KA 1STZA 3PFIA 4IJAA 4WCGA 2DBBA 2O61A 3HRUA 2VXZA 4XRFA 3C18A 3T8RA 2IPQX 4IHTA 5EEHA 1HKQA 4HF0A 4LLGF 5E8IA 1F9NA 3LA7A 3SFZA 1IZ1A 1HSJA 3MQ0A 2R3SA 3VB2A 1I5ZA 2JSCA 3TDUC 2G7UA 3FXQA 4EVIA 2FNAA 1IAWA 4KNYA 2Z99A 2NAZA 2XV4S 2NNNA 4I0BA 3ELKA 3F6OA 5ILVA 2PI0A 3QP5A 3WODF 4OINF 3K0LA 1TBXA 3I59B 4LG0A 1R00A 2AXLA 1SD5A 2A07F 4H0EA 3V8LA 2YSRA 4P55A 2ETHA 2MH2A 1P4WA 2PMUA 2EFWA 1IW7F 5KVRA 5FD5A 2HGCA 2COMA 2EFPA 4PZJA 5AONA 3SHFA 1ZG1A 1BIAA 1MJBA 5BS6A 3ZMTA 3DXJF 5D5UB 4KT5C 2XKPA 5TJJA 4IRIA 3DQVC 4U88A 1IXSB 1QGPA 1XCBA 2ACJA 2E1NA 2Y75A 4NB5A 2P6SA 3HRSA 3HTSB 1YS6A 3GLXA 4I09A 4OOIA 1BJAA 1KYWA 2RDPA 2KKOA 2DI3A 1T6SA 5JVTA 1Z6TA 1BN5A 4HAMA 5LGNA 2L01A 2FBKA 3E6BA 4EV0A 3KETA 1Y0UA 3I59A 5HLHA 4JQFA 3E5QA 2VODA 2OBPA 2H27A 1IN4A 1KA8A 1S7AA 4AD9A 1GXQA 2K7LA 5J8CA 1RNLA 1TW3A 1P2FA 1YS7A 1ZGJA 3BJOA 3FX3A 4EMSA 1D8JA 3IKVA 5A2QZ 3IKTA 3RKYA 2STWA 4U7DA 1ZLKA 1O3QA 4GYIA 2A3SA 3GXOA 3EYYA 5LHHA 3ZMZA 3DV8A 2UWMA 3CUQB 1FLIA 1R58A 1XGOA 3F8MA 4MQVA 5LLQA 4HX7A 2KIUA 3F8FA 2EFNA 3V4GA 1XSDA 3QPTA 1OMIA 4IRHA 4LFUA 3RYPA 4NQWA 4G9YA 3EDPA 1FT9A 2W85A 4GGGA 4HF1A 3GW2A 4F7ZA 4MEYF 2LSOA 2FQ3A 1T0FA 2XAGA 2K86A 3F8BA 2JRTA 3KEQA 2WV0A 4L9JA 5LGTA 3BOQA 5FFXA 1U78A 5FO5A 3QAHA 1YG2A 1QZZA 4GXOA 3ZQ7A 4HA8A 5LRRA 1B6AA 3KP6A 1BBYA 2HKOA 4ON0A 4XLNF 1XCVA 1MJAA 3QU3A 3WTSC 1K6OA 4BH9A 3KZYA 5D4SA 1HW1A 1W4MA 4P96A 3CO6C 2M30A 2F5DA 4ENKA 5K5RA 4UV9A 2HR3A 4R79A 1GXPA 1B59A 1F1ZA 2DTRA 2GA1A 3K1PA 4HQEA 4BAYA 2J5OA 3RTRA 1LNWA 1GVJA 1R22A 4KMFA 2YU3A 4KICA 1G3SA 3WTWC 2NYXA 4CDGA 4M6XA 2DU9A 2J5PA 1CF7B 4UVBA 4OIQF 2IJLA 3G73A 3D0SA 1T2KA 1YQAA 3I0TA 1S6LA 2V6CA 4M73A 4HQMA 2FXAA 1RZ4A 5ERIA 2VE9A 3COAC 2M87A 5FD6A 2KIFA 5JI6A 2IVMA 1MJ9A 3Q9SA 3WTTC 5L3GA 1XDUA 5LRSA 4ENNA 3RI4A 3V7CA 1X3UA 2CQKA 3HSRA 2IP2A 2HFHA 4RGSA 3N4MA 1YLFA 2IA2A 2G9WA 2RVCA 1HQCA 4JBAA 1Q1HA 3HTUA 3RKXA 3ZMUA 2RNJA 1KYZA 1Z9CA 1O7LA 2D45A 1PP8F 3BPVA 1WI9A 2WC2A 1I6XA 5D8KB 4P9UA 3LA3A 1W7PD 3IRRA 2FRHA 1K7AA 4EJTA 4RAZA 2EB7A 3JAMK 1L0OC 4RB3C 3RPUA 4N9IA 2QYOA 1JGSA 2HYFA 3TDZC 2A6EF 4A5NA 2XAQA 1CF7A 4M74A 5LBQA 2FSWA 2LF8A 4G7OF 3M7GA 1BI1A 2V1DA 2ZNYA 3KLOA 4EJWA 4U0VA 3GEZA 2XUBA 2JZYA 1KU2A 3KP5A 3LFKA 3V7RA 1ZRDA 1KU9A 1SMYF 4LK1F 3GWZA 1FZPB 3LQRA 2Q2EA 2YR2A 2UZKA 3QRFF 3KE2A 1MDMB 1TQIA 2O03A 2EK5A 3HUGA 4A0XA 1OPCA 1G3YA 4MEXF 3R60A 1QNTA 2DT5A 3FXRA 3R4KA 2A6HF 1P92A 1TNTA 4I02A 1KQ8A 4WXCA 2QQBA 4MGRA 2DO7A 3IWZA 1HW5A 4UNOA 2KIMA 3EYIA 4A5MA 1ZH5A 2F5CA 1AOYA 4MNUA 1XDSA 1O3TA 3K2ZA 1U6GA 1WKMA 3M8EA 1JHHA 2STTA 4B09A 2O0YA 3J80K 2A69F 5DCMB 2P5LC 3GZ6A 1G4DA 2HWVA 2OQRA 4ZYHA 2EJRA 4Q4ZF 5ICGA 2MD5A 4WK8F 1XMKA 3BY6A 5K1YA 4YFXF 1ZRCA 5LHIA 2XROA 4HW0A 5FLXK 1IN7A 4EJUA 2HQRA 1Z1DA 1IF1A 4AIKA 1HKTA 2ISZA 4MQ9F 1MDMA 4HBLA 1BOAA 2EWNA 1YO5C 3K1MA 4EJVA 4A6EA 1EH8A 2GXGA 2L3DA 5DEQA 2PQ8A 4FHTA 4YFNF 2ZJ2A 3RDIA 4N9HA 4I98B 2D2WA 2OZUA 3SXYA 5BOXA 3NQOA 5DDGA 1H9GA 3J81K 1U5TB 4IPAA 3ZN1A 3K1NA 1BI2A 4ESJA 1KQ0A 5K5QA 1UHWA 3TKYA 2Z33A 2V1XA 1I1GA 2BYVE 4AIHA 3SQNA 5HLIA 3R6SA 2FOKA 2K4BA 5DCMA 1I1SA 2QLZA 1XSXA 3FF5A 3KFWX 2M45A 3QOPA 3QPHA 3DPTA 1ZAOA 2OQGA 2ZMEB 2EV0A 4K2EA 2BBYA 1V3FA 3Q9VA 1EH7A 3L9FA 4RB0A 1UB9A 1L3LA 2FU4A 4ENMA 5E1ZB 3ZN0A 4B8XA 5IT9K 1XSVA 4HX8A 2H6CA 4BHBA 4KIBA 3FHZA 4I2OA 5E8GA 1Z05A 4LLLA 2OD5A 4U0WA 1U2WA 3V8KA 1YW7A 2QWWA 3WU1B 2KJCA 4ZYEA 1USSA 5H6RA 2PMHA 1G6NA 3SZPA 4G7ZF 2TDXA 3KP7A 5ILUA 2E7XA 3WU0A 1DPRA 1U5TA 5JFRA 3HRMA 4ESFA 1IRFA 2DQLA 1RUOA 2EV6A 3KEOA 1FP2A 1FC3A 2Z9OA 3WTZA 1DP7P 2R7FA 1BM9A 2A68F 2MLGA 3DEUA 5BPIA 2XAFA 4BQAA 1WSUA 4RGXA 4A2UA 2EA2A 4ZH4F 1S3JA 4P5OA 5JHUA 3GF2A 1G3WA 4LK0F 5CJ9A 2R7DA 2ZMEA 5LEKA 3IWFA 3PQKA 1IN5A 1PDNC 5DUKA 3LQQA 3F23A 1U3EM 2FF4A 1J59A 4PDKA 2XAHA 4A6DA 3DFGA 3KP3A 4BHPA 5HVQC 1SFUA 1YW8A 5EEGA 3SZTA 5DUIA 2CWEA 2FEZA 3E6CC 2EV5A 2OU2A 3LAPA 1ON2A 2GWRA 2W24A 3HHGA 1HBXG 2ISYA 3RYRA 2CW0F 3GZ5A 1ZG5A 3BDDA 5K5OA 2LF7A 4LD5A 2CYYA 1J9IA 2FMLA 5CVRA 1W7PB 3OV8A 4GCVA 1DPUA 3NRVA 3I5UA 2W84A 1FNNA 3E5UA 1BC7C 2XIGA 4ZZLA 5E1XA 3T5XA 3TOAA 5CYVA 5L3DA 3E97A 3FMRA 5CVIA 3WTXC 1TW2A 3KLNA 2HDCA 1SD6A 4ZYGA 2VBXA 4FX4A 3GFIA 1XMAA 5E1WA 3F22A 5HLGA 2XHKA 2PBIA 1LB2A 2VONA 3ZPLA 2CGPA 4DQ2A 2GXBA 4OIRF 2ZO4A 4OU0A 5BPDA 1YYVA 3DP7A 4LGWA 4M9XA 4RB2C 3TO9A 3D5LA 3VODA 2Q8KA 1FYMA 2FE3A 3Q5FA 1D8KA 3I71A 2PEXA 4EM1A 2ESNA 2BEOA 2LNBA 3MWMA 1KQ9A 2FA5A 3KP4A 1P4XA 5CVVA 1B1BA 5E18F 3JSPA 1S7OA 1H9TA 1OYWA 4M9ZA 3TQNA 2GQQA 4G94A 1HW2A 2DK5A 4OIOF 1YW9A 1R5HA 4TV7A 3H3ZA 1RIOH 5JR3A 1SD4A 1W7PA 5HDNA 2D1VA 3W6JB 4HLXA 3WE3A 3K9TA 5FGMA 3C7JA 5ED4A 1RUNA 3RIRA 3LWFA 3M9AA 2RV8A 1FBUA 4IVNA 3ABTA 1XGSA 4O6JA 1MD0A 2ZNZA 3EETA 3V7SA 3ULQB 4HV5A 3ML6A 1O3SA 1R23A 4UXNA 1AWCA 4MTEA 1XGNA 3WGGA 2CO5A 1QBJA 1ZLJA 3EQLF 3ABUA 4EM0B 2VBZA 2UXXA 3I54A 5ICEA 1REPC 3RJPA 3JTHA 3FXUA 4U0YA 2ZBKA 4HLYA 2HKXA 4FX0A 2GAUA 4UV8A 1R1TA 1MZBA 4PCQA 1QPMA 2RKHA 1LJ9A 1ZHFA 4CHUA 3ECOA 2O6GE 1J2XA 2H09A 1Z6RA 2ZKZA 1HXDA 5J6XA 3F6VA 3M8FA 1KGSA 4HZFA 1O7FA 2BGCA 3EUHA 1XD7A 4Y17A 1IXRC 2MH9A 4CXFA 2HOEA 2V9VA 4I7HA 4IXAA 2OZ6A 3LA2A 4AWXB 2P6TA 3DKWA 4ENJA 1DDNA 3IHUA 4M72A 2CSOA 4YIIA 1KU3A 5LEJA 3ZMSA 1BIBA 4L0ZB 3S2WA 2K4JA 3KP2A 3P9IA 2P7VB 2XKOA 2XGXA 1J5YA 4D0PA 5CVUA 5F6FA 2K27A 4DNCA 3WTVC 3BWGA 2HQNA 3J7AO 1TQMA 2X4HA 3BJ6A 2FBHA 2W57A 3NEUA 5IT3A 1ONVA 3T0YA 2DLLA 5BMZA 4JK1X 4IRGA 3HHHA 4KN4X 1BI0A 3L2CA 2VN2A 3BZ6A 4UVCA 3IL2A 1HKSA 1ODDA 2DQRA 2ZFWA 1F5TA 2M8EA 4KYWA 1FSEA 2ZCWA 3CDHA 2O8XA 2JPBA 3H92A 4L0YB 1W5SA 5A2QK 2A5YB 3GVAA 4QWQA 5D6EA 3MEXA 5HOOA 3BPXA 4Z2YA 3P9CA 1SAXA 4N0BA 1FYKA 1FYLA 4HYEA 1XN7A 3TGNA 5DD8A 1IN8A 2O3FA 1C0WA 4CGZA 2QQ9A 3MZHA 3HRTA 2MBFA 2VT3A 4YFKF 2VC1A 2L4AA 3O3KA 4L9TA 2PJPA 2PG4A 4XBFA 4AVPA 1IUYA 1GHCA 3R0AA 4L5JA 3T8TA 4HOBA 2F2EA 4E70A 4LB5A 3FM5A 3AAFA 2L02A 3F8CA 1T38A 3MCZA 1J0RA 3LAJA 2VBWA 3E5XA 4S05A 1MGTA 2PLYA 5L3EA
chains in the Genus database with same CATH superfamily
2NNYA 2V1NA 4LOCA 1E17A 3GUDA 2V9PA 2FUG2 2QKLB 1PYVA 2R5YB 4KUMA 2GIVA 1FTTA 3JSOA 1Y39A 3VFZA 1B4AA 4PJMA 1HF0A 3G1OA 1R1VA 4YEJA 4Q47A 3LSPA 4O3MA 3F0CA 3DEWA 1ULYA 4V2GA 5FJ8J 4JX5A 2IEKA 3K10A 5F1RA 3CCLI 5J47A 4C2MJ 4A0ZA 3MAJA 3E3VA 5EG0B 3PNTA 3HOSA 2DK8A 2L7FP 5AIPA 3JTGA 1A04A 3P5JA 2XGEA 3L2VA 4ESBA 3ISPA 1R1UA 4RB1A 3S1NJ 5D6FA 1H0MA 2F5FA 3ROUA 4II2A 1VQPI 1OR7C 2YX7A 2DA2A 1QQIA 2LKXA 3BJAA 1W0UA 2HS5A 4D7MA 4EM2A 5GAEJ 1MKMA 1Z7UA 3PM1A 3JAMZ 3I4MJ 4PGHA 1R4MB 3VDXA 1B9MA 1J75A 2Y30A 1LPQA 2M5WA 2W25A 3DTEA 1YTYA 2E5ZA 3ABMH 4MO7A 2F48A 2LKPA 5D5XB 4G7HF 4BYYA 4E7ZA 2ZB9A 4DYQA 5F0HA 4BXUA 4KITB 4F92B 1JKOC 1HLVA 1DGRM 3CJRB 4IRIA 3JW4A 2E71A 2DW4A 3I58A 4XOPA 2HVSA 2W82A 2LP0A 2MA3A 4G12A 5HDGA 5C4JJ 1JT0A 4BXFA 4N4NB 2RGVA 3RPQA 3KIOA 3CO7C 4DYRA 5L3FA 4XSXF 3CCJI 3E6MA 4KIGA 3J7AY 2GZWA 2BV6A 4L5IA 3DPUA 3I53A 3R0JA 5H6QA 4CZZA 4EGZA 3OY9A 3GTMJ 3FXKA 2QM3A 4B3AA 5GADJ 2FD5A 4D7NA 1FY7A 2CUJA 2IA1A 4JX4A 3S1RJ 1XTAA 5HDKA 3WE2A 5EGOB 2DAOA 1MSFC 1IG7A 1P4AA 4I01A 2NVYJ 3H9QA 2M3AA 3PQJA 4YIRX 2KZGA 4LG3A 1EV7A 3M4OJ 2XAUA 1P6RA 1T95A 1XX5A 1FWZA 3LSGA 2QUFA 5DV5A 2VC0A 2Y48A 1S29A 3QPSA 4EGYA 2H1LA 3CUQC 2ZJPF 5HS7A 1Y56A 1ZN2A 1F36A 2R5YA 3ERED 4WF2A 1LE8B 2OC6A 2HEOA 1XGMA 2PFBA 2E1CA 1SFEA 2MABA 2X6YA 1FBQA 1SFXA 3TP3A 2VT2A 1WQ2A 2VKEA 4CCJA 2JPCA 5IPAA 4CYDA 2PN6A 1JTYA 4FT8A 3E6DA 4X0GA 2JA5J 1TWAJ 2Y0MA 2LC2A 4NBQA 2NRAC 3G1LA 1KU7A 5CLSA 5EG0A 1TP4A 3AG1H 3BP8A 1QZEA 2VPLA 5M3MJ 1BC8C 3GFJA 4BHCA 2K9LA 2YS9A 3DKXA 2X0LA 4IX7A 2P81A 2ELJA 4C3JJ 1WRJA 2HZTA 2JT1A 3HOTA 4E7IA 3OIOA 2JRMA 2L5QA 3N97A 5DTDA 3J80Z 4B3XA 4ZYDA 3PSIA 4ZTFA 2MC3A 4YIFA 4A3LJ 1R49A 1LDJA 1LVKA 4EEFG 3VYUB 4BGDA 2RC4A 3FM3A 3WG9A 1R5ID 1I6HJ 1IN6A 4UB6C 2MC4A 1WFXA 3L2QA 3T1BA 2LYCA 4G6DA 4F55A 3BG3A 5ILSA 2E36A 3OYHA 2L9NA 2IT0A 2WY8Q 3ASNH 2F5EA 1T39A 1W36C 4LMYA 3OS2A 4IF4A 1NHAA 1WWXA 3O6BB 4HNTA 4HF2A 3V42A 2VKHA 2RN7A 5GTHC 2KJBA 1T08B 2KMUA 2L54A 1H88C 3TMOA 1OLTA 1LQ1A 5D5VB 5FLXZ 1OYIA 2K02A 4LLNA 3RKWA 3N05A 2EIMH 2XSJC 1W0TA 3WGIA 3OYLA 4KN7X 2OAZA 2CW8A 3WG7H 1BW6A 3CC7I 2H6BA 3MVPA 1TTYA 3QYEA 1R4NB 5EGOA 1HA8A 3KZZA 3KYDB 4IZZA 5E20A 4S04A 2HTSA 3KCCA 2ZXHA 3ZGKA 2DPDA 4HV6A 3MZYA 3QP6A 2CMPA 4PSWA 2DN0A 1I27A 3CCQI 1G59A 2KP6A 2RAEA 2FOWA 2A61A 2WWYA 2P7CB 2R4GA 1FX7A 4G6QA 3H1CA 4BJTA 2P8TA 4RS8A 1MNEA 4DGWB 1LE8A 3L00A 4Y13A 5E17F 1YIOA 2HOAA 2L4MA 1OFCX 1OR7A 4V19K 1MBFA 2KRFA 4UVAA 2LD5A 4GO1A 3V8JA 2XVCA 1BR4A 5DCFA 2ID6A 3LSTA 3C1DA 2WBMA 4O5VA 1LVAA 3J81Z 3H0GJ 5CQGA 5FKKA 2HYGD 4FQGA 1XB4A 2R7OA 3CDLA 3HL2A 3KYLA 4ETSA 3CJNA 1R71A 2F6CA 2QQAA 3FDYA 2GXAA 1OCCH 1FOKA 3LMMA 2EZKA 2F4IA 3HSFA 1G3TA 4F93B 2V7FA 5EZHA 1FSHA 3B6AA 1ZYRF 2E1MC 3BR6A 6PAXA 1ZGWA 3LSIA 1MH3A 5ICFA 3A0BC 3R61A 5LGUA 1RRJA 3GBGA 1PP7U 1K78B 5IYDJ 2FNPA 4PUSA 5FB2A 5L3CA 3FISA 2E1OA 2X1EA 4XLPF 2DFIA 2QKMB 3P9KA 2A5WA 2E7WA 4L18B 3HIFA 2Z5UA 2CW7A 2VE8A 2OCCH 4M9SA 4CICA 5E79C 5DM7F 1JXSA 4RDUA 5FKMA 1WJEA 3WTYC 2WA0A 3UKGA 4KFCA 3S17J 1NG6A 3CCYA 5F08A 3OOUA 1K4TA 2P5VA 2XPWA 3IUOA 4BBSJ 3F9KA 2DA3A 3GYHX 1O57A 2CG4A 3F21A 2FMYA 2OF7A 3S93A 4XLEA 1A35A 2H1KA 4BS9A 2HTJA 4KA4A 2XRNA 2DYSH 1RI7A 3GFLA 3CUQA 2VJ5A 5IT9Z 1JUSA 2LH9A 5IP6A 2CV1A 2HVRA 4HPQA 2Q0OA 2ZXWH 4Q5SF 3PO3J 3DKYA 3OOPA 3OYBA 3FMSA 2VBYA 4JP0A 2FJ1A 2HZDA 3O2PE 4R1HA 3U2RA 1V4RA 4PSXA 1IRGA 2N8GA 4XKCA 4IHWA 1IDZA 4KIFA 4KT6A 4LJZF 3L7WA 1X1AA 4B48A 4NNJA 5L3BA 3HXLA 5DD4A 2LBFB 2QSFX 4H4KC 3S1MJ 4MTDA 1S8NA 1GV5A 3BROA 1U9NA 3NARA 1FP1D 4R8HA 1E3OC 4E7HA 3DBHB 2M4KA 3DPLC 3CTAA 4RAYA 3C3WA 2OA4A 4HX4A 5EZGA 4CCLA 1IRZA 2GA2A 1LDKB 1U8RA 3QPLA 2HDWA 4L9NA 2M1BA 5GPCA 1VQ5I 4E7KA 1Z91A 3VSKA 3OL4A 4RM2A 5D4RA 4UB8C 3H5RA 4CUGA 1LEAA 1GUUA 4KDPA 3F3XA 1YI2I 1UFMA 2BVMA 3M1EA 4LIVA 3W2VA 4CO8A 4HNUA 2ESHA 2IS1A 2AQEA 4UUSB 4XKVA 3U9GA 3F72A 1X19A 3OYGA 2E2IJ 2ADUA 2HU9A 3DF8A 1E0EA 5FKLA 1SMTA 2CH0A 2CRGA 1ZREA 1K78A 2DJIA 4Y33A 1NH3A 3U21A 3TO7A 1ETXA 3GO5A 4KMUX 5HS9A 4IOCF 3H3UA 3QYBA 4BBRJ 2AS5F 1K6YA 1QO0D 1USTA 5TRDA 1GLNA 3ZP5A 1YFHA 1JUMA 3SEQA 3ZQQA 2C6YA 3H0DA 1Z7LA 2DMPA 2XASA 2RQPA 2DMTA 2MLKA 3S32A 1FBSA 5E3MA 2XAJA 2IGOA 2EFQA 1W5TA 1ZG3A 4CYCB 1F4KA 1UHMA 3I64A 5H20A 1QZYA 2OCEA 3S3NA 1ZR4A 1PUFB 2GBYA 3B73A 4WXDA 2QZ8A 3AG3H 1ON1A 3SDGA 2JVHA 1BI3A 2HYJA 4OMYA 3PL8A 3QU6A 1UG0A 2IS4A 3IP4B 2A6TA 5AIQA 5FKOA 4HDVA 2IA0A 3B02A 2ZXIA 2CQQA 3ZXSA 1OKRA 3FZVA 3REOA 4G8XA 1R36A 2VKVA 3BR5A 1IC8A 1FPQA 4ASNA 2EILH 3M1CA 2R93J 3DLLF 2AO9A 4M3DA 2JTVA 3MZ8A 1D5VA 1D0ZA 1XC5A 2LRDA 4EJOA 4IKFA 2DOAA 2YPRA 3G3ZA 4PGGA 3OR2C 3VOEA 3IRQA 5DYMA 2LBFA 4A3CJ 2IW5A 5J8FA 3HSEA 1W36D 2IRFG 4L9VA 3W2AA 3P7NA 1O3RA 1ZGAA 2D1HA 1B9NA 1SFKA 1E2XA 1D3YA 4AM3A 2BVLA 3TO6A 2UXNA 2BY2A 4GRIA 3I4PA 4DZJA 3TP0A 3HGYA 2QBYB 2YX4A 4HDUA 2P4WA 4BNCA 4OIPF 5EYRA 2BE5F 2V79A 3CUOA 4AIJA 4NHJA 2L7KA 1CGPA 2DPUA 2VOPA 2VJ4A 1S7EA 3NAUA 1LEBA 4A3MJ 3MFKA 4Q48A 1R7JA 1RESA 4LB6B 4XMYA 2HXOA 3VSLA 5IY5H 5EF6A 4XL9A 5FFZA 3U1DA 4DW6A 4EQQA 3GTGJ 4XONA 4RGRA 3G2BA 2CFXA 4WX9A 4M6YA 1QVTA 3TOBA 1T98A 3L09A 3WGHA 5ICCA 4A0YA 4UUSA 4D5CA 1X2MA 1OYYA 2FBIA 4P9FA 1DUXC 3I4NJ 1TWCJ 1PVEA 5F0CA 3WTUC 1VQNI 5JHFA 3VWBA 5KHDA 4CCMA 1ZQ3P 1P7JA 1BOBA 1YE9A 1Y8RB 3RPUD 1MW7A 3JREA 2OV7A 4QLCU 1JKRC 2QENA 5IP7J 2KRHA 2ELHA 3HYIA 3OS1A 1MMNA 2WAQA 1HSTA 4M71A 5KK1A 3K69A 3ZQGA 1UCRA 4XSZF 5JLXA 4WWCA 3K4CA 1EH6A 5CVJA 5GAGJ 2R7VA 4YG2F 3BR0A 3ZMDA 2HXIA 4BE0A 1VQ4I 4GYGA 1I3AA 3PUBA 5LHGA 2Z3YA 2CV0A 5BQTA 1IXCA 2QVOA 4XICA 4UY8I 1TNSA 4CYCA 1R5GA 2NVTJ 5F64A 1PUFA 4Y15A 2BW3B 1R6RA 2P5KA 1ZRFA 1QRYA 3ECHA 1D0XA 2NOJB 3FWEA 3FK7A 4LIUA 3ZMVA 4LG0B 3GX4X 3F8NA 3W6KB 3ABLH 5D8LB 1FMWA 4Y52J 1N75A 2LDUA 2DCEA 3CCEI 5M3FJ 4MHGA 4I0AA 1U5TC 1JHFA 2EFOA 4U7BA 3AG2H 3HC7A 3G1MA 1TQPA 3MKYB 1VTNC 1Y6IA 1HDPA 5HS8A 1Z3XA 3ERMA 2B0LA 4OMZA 3QYFA 2EH3A 5FRMA 3H36A 3IC7A 4ZZDA 5EJCA 2O8KA 4FETA 1LDDA 1B8IB 2GM4A 3RZOJ 4UUVA 2ZJQF 1ZTRA 4A3IJ 4IHSA 4A12A 2H94A 2G7HA 3A03A 2WTEA 3VEPA 2EA4A 3E1SA 2O5RA 1DQUA 4FE7A 1JE8A 3GFMA 1JTXA 1ZARA 1WJDA 4ITVA 2WAQN 3ASOH 3FIWA 2ZXJA 2V1UA 2VOOA 2QBYA 4WXHA 3CLOA 1U9OA 1SD7A 3IV5A 1PUEE 1W5CC 2DA1A 4RGUA 5D5WB 1K79A 1H8AC 2CFOA 3FMQA 1P9QC 2NS0A 1J09A 4UHTA 1TLHB 1J7KA 1STZA 5CKTA 3OYDA 3TBIA 2GOMA 3PFIA 4IJAA 2Y9YA 4WCGA 3MKZA 2ZMEC 1LKXA 2DBBA 3HRUA 2O61A 2VXZA 4XRFA 3C18A 3T8RA 4C30A 4Y7NJ 2HVQA 2IPQX 4IHTA 1WJBA 5EEHA 1HKQA 4HF0A 4LLGF 1OISA 5E8IA 1F9NA 1TWGJ 5HNFA 3LA7A 3SFZA 2BXYA 4IHVA 3KX2A 2JMWA 1RPWA 2XPUA 1IZ1A 1HSJA 3MQ0A 5FKNA 3FXJA 2R3SA 3VB2A 2RQQA 1I5ZA 4BQNA 2JSCA 3TDUC 2G7UA 3FXQA 4EVIA 2CQNA 3CDIA 4CCKA 1DU0A 4IEJA 3H5NA 2FNAA 2EBIA 2W48A 2L9VA 4BQOA 1IAWA 2BXZA 5TISC 4KNYA 2Z99A 1JT6A 3OYKA 2NAZA 2XV4S 2NNNA 4I0BA 3ELKA 3F6OA 5ILVA 1WJCA 4XKWA 3U1KA 1ETYA 5GTIC 2MW8A 2PI0A 3QP5A 3WODF 1RETA 3K4JA 3IAM2 4OINF 2LR8A 3A4CA 2BW3A 3K0LA 2IGMA 2ECBA 1TBXA 3I59B 4LG0A 1R00A 1X2NA 2AXLA 1HOMA 4E7SA 2YU9J 1IO2A 3OYFA 1SD5A 2A07F 1T0FC 4H0EA 3VYTB 3V8LA 1QA6A 4CCNA 3LSMA 2YSRA 3CJQB 3SDBA 4BJ5C 4P55A 2ETHA 3C2BA 2MH2A 1P4WA 2PMUA 2EFWA 3BTIA 3ZQIA 1IW7F 1RC9A 5KVRA 1B8IA 3RKQA 4Z6YA 1BR1A 5FD5A 1UJ8A 4RLFA 4AU7A 2HGCA 2COMA 3LOCA 2EFPA 4PZJA 2CV2A 5AONA 3SHFA 1ZG1A 1BIAA 1RKWA 1MNDA 4RM3A 4ZYAA 5M5YJ 1MJBA 5BS6A 3WHBA 5DM6F 3TL4X 2QCOA 3ZMTA 1Z0XA 1YHQI 2DMUA 3DXJF 3S3OA 2OJED 2E19A 5D5UB 4KT5C 3OSFA 2XKPA 1FIPA 5TJJA 4J19A 3DQVC 3FXLA 4U88A 1IXSB 2VXDA 1QGPA 3HEFA 4II3A 3CCUI 4BY1J 1TT5B 2XB0X 1IUFA 4BE2A 3GTJJ 1XCBA 2ZC2A 4I99C 2K9MA 2XPVA 2ACJA 2E1NA 2Y75A 4NB5A 1ACIA 5K7ZA 2P6SA 2KDZA 2M7AA 3HRSA 3HTSB 3CMMA 1YS6A 2W1OA 3GLXA 3VYSB 4I09A 1I50J 5BNGA 4OOIA 3PJRA 3JRIA 3TW7A 1BJAA 4CSWA 1QU3A 1KYWA 4BKXA 5E3OA 3BZCA 1IDYA 2M9HA 2RDPA 3LSHA 3HG9A 2JA7J 2KKOA 2B63J 2DI3A 4HRIA 1T6SA 3S15J 5JVTA 4CCOA 1Z6TA 1S5LC 1BN5A 4V2FA 5GP9A 4HAMA 5LGNA 2H8RA 2L01A 5J1RA 1VQ7I 2CQ7A 4A3JJ 2FBKA 4JOMA 3E6BA 4EV0A 4ZJZA 3OYJA 1Z67A 3CP8A 3KETA 1WVRA 5CPRB 1QHGA 1Y0UA 3I59A 1OCOH 5HLHA 1V5GA 4JQFA 1YJWI 1LFUP 2UUZA 3OYIA 1M1EB 3E5QA 1X3WB 1K83J 2OBPA 4QSHA 2VODA 1VQ9I 2H27A 3AKZA 1FOXA 1IN4A 1KA8A 3ZQCA 2D5VA 1S7AA 4AD9A 1GXQA 4DZPA 2DOEA 2XDVA 2K7LA 5J8CA 1RNLA 1MMGA 5C44J 1TW3A 1P2FA 1YS7A 4XLAA 1ZGJA 3BJOA 2IS2A 3FX3A 1JI8A 4EMSA 1D8JA 3IKVA 3ZOBA 1YJ9I 4ZC3A 3K6GA 3BQYA 5A2QZ 2X1CA 2XF5A 1T33A 3L2RA 3IKTA 3I3LA 5KNLA 3GTQJ 3RKYA 2STWA 4U7DA 3HDDA 1D1CA 1OQYA 1ZLKA 3K4MA 3S2HJ 3OYEA 3OWTA 4AYBA 1O3QA 5FROA 3A01B 5KCMA 3CMAI 4GYIA 1VNDA 2A3SA 1RKTA 4WXCA 4M3FA 3GXOA 3EYYA 3ZMZA 5LHHA 3DV8A 1NG7A 2UWMA 2CQXA 2DOFA 3CUQB 3VPRA 4FCYA 3DBLB 1FLIA 1CQTA 1R58A 1XGOA 2DFFA 1Z3YA 1UHSA 3F8MA 4MQVA 5LLQA 1N77A 4DIQA 4HX7A 2KIUA 2K85A 1MMAA 4M3GA 3F8FA 3MKLA 2EFNA 3OL3A 3V4GA 1XSDA 3S8PA 1HDDC 3QPTA 4M6VA 1OMIA 4IRHA 4LFUA 1UAAA 5B5EC 3RYPA 4NQWA 4G9YA 1GT0C 1WJ5A 3EDPA 2DODA 1FT9A 1P7IA 2W85A 4EATA 4GGGA 3H9GA 2E5NA 4HF1A 3GW2A 5J4VA 4F7ZA 4MEYF 2LSOA 2DFHA 2EIJH 1ITYA 3A0HC 4IO9F 1OCTC 2FQ3A 1T0FA 2VQCA 2XAGA 2K86A 3F8BA 2JRTA 2WV1A 3KEQA 4G6TB 2WV0A 3E0JB 3CCMI 2I8DA 4L9JA 4PJ0C 2IBDA 2KL4A 5LGTA 3BOQA 5FFXA 3EUHC 1U78A 4AYBN 3L2UA 2KISA 2VASA 2JA2A 5FO5A 3QAHA 1YG2A 2M2EA 4YELA 1MIJA 9ANTA 4C9YA 1VQ6I 1QZZA 2IGNA 4GXOA 2M8GX 3ZQ7A 3DWLE 4HA8A 5LRRA 1B6AA 2GOXB 3SJMA 3KP6A 2RNGA 2Y69H 1DP3A 1BBYA 2HKOA 4ON0A 3PNVA 4XLNF 4XOTA 1Y0NA 1XCVA 3OR1C 4NDLA 1MJAA 2EIKH 3QU3A 3LNQA 3WTSC 2LFBA 2LY2A 1K6OA 2X1DA 1YOVB 4BH9A 3KZYA 5D4SA 2WAFA 1HW1A 1W4MA 4P96A 3CO6C 2M30A 3DBRB 2F5DA 3DU5A 4XN3A 5K5RA 3G6EI 2ZFUA 4ENKA 1H89C 4UV9A 2HR3A 2QF7A 4XM3A 2TCTA 4R79A 2KIQA 3A01A 1GXPA 3SFIA 1B59A 1F1ZA 2DTRA 3CC2I 2GA1A 2NVXJ 3K1PA 3HOZJ 1U8BA 5C3EJ 4HQEA 1K61A 3GTOJ 3W3CA 4BAYA 2VJIA 4KJZA 2XSDC 1POGA 2J5OA 3OMYA 3L1PA 3RTRA 5C4XJ 1LNWA 4BE1A 2E2HJ 1GVJA 1R22A 3K70C 3CCVI 1UELB 1VQLI 4KMFA 2YU3A 4KICA 1G3SA 1OCRH 3WTWC 1WCMJ 2NYXA 2O7OA 1IRXA 4CDGA 4M6XA 3JRFA 3H3VK 1BR2A 1X4OA 2DU9A 3WU2C 2J5PA 1CF7B 4UVBA 3HJEA 2G0EA 4XLCA 4OIQF 2IJLA 1EF4A 3G73A 3D0SA 3GTLJ 3BTCA 1T2KA 1YQAA 2NXNB 2R7RA 2Z1DA 3I0TA 2NOGA 1TWFJ 1S6LA 2V6CA 4M73A 3IAS2 3M07A 4HQMA 2FXAA 3NWTA 3CMEI 1RZ4A 5ERIA 2R7TA 5CQEA 5GAHJ 3PNYA 2VE9A 3COAC 2M87A 1XG1A 2E35A 5FD6A 2KIFA 2E1MB 2V26A 1KZHA 3DTKA 5JI6A 2DA4A 3RQIA 2IVMA 1MJ9A 2GLOA 3CC4I 3Q9SA 1A6IA 1X1BA 3WTTC 3OYCA 2MD0A 4F91B 2DA6A 5L3GA 1XDUA 4U87A 2E2JJ 5LRSA 1V54H 4ENNA 2ZSHB 3RI4A 3V7CA 1X3UA 2CQKA 3SYTA 3HSRA 2IP2A 2DYRH 2HFHA 4C2UA 1ZK8A 4IL6C 4RGSA 3C2HA 3HUGB 3TEDA 3N4MA 1YLFA 2IA2A 3LSJA 2G9WA 2RVCA 1HQCA 4JBAA 1Q1HA 1WJAA 3HTUA 2R7SA 3RKXA 3ZMUA 3W6VA 2RNJA 5F1JA 1KYZA 1Z9CA 1O7LA 1SC7A 2D45A 1PP8F 3BPVA 1WI9A 2WC2A 1GDTA 1I6XA 5D8KB 2PMZA 3G71I 4P9UA 1YJNI 1AKHB 5K7HA 3LA3A 1VQKI 1W7PD 1DGWY 3IRRA 5J4YA 1HCRA 4OWRB 3HOUJ 2AQFA 2FRHA 1K7AA 2DTZA 1MNMC 4EJTA 1X1CA 4BU2A 3KEYA 4RAZA 2EB7A 3JRCA 3JAMK 1L0OC 4RB3C 3RPUA 4N9IA 4BL0B 2R7UA 4J01A 1UG2A 2QYOA 3GLLA 1JGSA 5TGTA 2HYFA 3TDZC 1ZKGA 2A6EF 4A5NA 2XAQA 1CF7A 5J1YA 4M74A 5LBQA 2E34A 1IGNA 4IHYA 4A3GJ 2BOLA 4A93J 1FEXA 2FSWA 2LF8A 4G7OF 2LLKA 5E3NA 4ANJA 3M7GA 1BI1A 3D1NI 3BCAA 3EUAA 3HPHA 2V1DA 2ZNYA 3BR3A 2FX0A 3KLOA 3HBLA 4EJWA 4U0VA 3GEZA 1WHUA 2XUBA 1TL8A 3A1YA 2ZSIB 2JZYA 3DU6A 2V4JC 1KU2A 3S14J 1ETWA 3KP5A 3LFKA 4XNFA 5F0FA 3V7RA 2PMZN 4LITA 4BJ6C 1G2HA 1ZRDA 1KU9A 1SMYF 4LK1F 3GWZA 1BW5A 1FZPB 3LQRA 3M3YJ 1I3QJ 2COBA 3W2WA 1SAUA 1Y8QB 2Q2EA 2YR2A 2UZKA 3WHCA 3KE2A 3QRFF 5EEAA 2V6EA 2Q1ZB 1A5JA 1MDMB 2NS8A 1TQIA 1LFPA 1FJLA 2R7QA 4RBOA 4RAFA 2HOTA 4C2TA 2O03A 5F27A 2EK5A 1FOWA 1MBGA 1TT0A 3HUGA 4A0XA 3GTPJ 3FBNB 3H9JA 1HC8A 1OPCA 2DXIA 1G3YA 4MEXF 5B3SH 3ZQLA 2NVQJ 2R7ZJ 3R60A 3BTLA 3ZCOA 2JVGA 1GV2A 1QNTA 2K40A 2DT5A 3FXRA 3R4KA 2A6HF 1P92A 1TNTA 4I02A 4AIDA 1KQ8A 3EPZA 2JJ7A 2M34A 2QQBA 3Q0VA 2DO7A 2EZIA 1HW5A 2LMDA 3IWZA 4HEA2 4MGRA 4UNOA 1EA3A 1Z21A 2CUZA 2KIMA 3GZNB 3EYIA 4A5MA 1ZH5A 2F5CA 1AOYA 4MNUA 1XDSA 1YX5A 4AC0A 2L2OA 3K2ZA 1O3TA 1U6GA 1AKHA 2HQ5A 1WKMA 3M8EA 1JHHA 2TRTA 2STTA 3MD2A 4BACA 4B09A 1W1WE 2O0YA 3SEZA 4BEHB 3J80K 4FTHA 2A69F 3J7YJ 1V5FA 1APLC 5DCMB 4DBQA 3EUKL 4ZDLA 2H8WA 2L7ZA 2L0KA 2P5LC 1BL0A 3GZ6A 2KQRA 1G4DA 2VIXA 2VL8A 4F52A 2HWVA 2OQRA 3CF2A 4ZYHA 2EJRA 2DA5A 2Y31A 5LFAA 4Q4ZF 1S72I 2XGCA 4C3IJ 2MD5A 5ICGA 4WK8F 1YRNA 3KZIC 1XMKA 3BY6A 3ABKH 5K1YA 5FRNA 4YFXF 1ZRCA 5LHIA 4FASD 2K5CA 2XROA 1LUJB 4HW0A 1UMQA 5FLXK 1IN7A 3K70D 1OCZH 4EJUA 4A69C 3H35A 4ZTJA 4QIWN 1MSEC 2LG4A 2HQRA 1Z1DA 2X9DA 2A05A 1IF1A 3FKJA 4AIKA 3OYAA 1YX3A 1F43A 1HKTA 1WPKA 5GPAA 2ISZA 4MQ9F 1MDMA 1VI0A 2K3FA 3RQ4A 4D9JA 2E60A 4HBLA 1BOAA 2EWNA 2L7MP 3DTIA 1YO5C 1ORKA 3K1MA 4EJVA 2KHMA 3JRBA 4A6EA 3OYMA 2Y2ZA 1EH8A 2GXGA 3FBIB 2L3DA 3O8GA 5DEQA 2KPMA 2DFEA 2PQ8A 4FHTA 2ZJ2A 3ESWB 2BY0A 4QPOA 4N9HA 3RDIA 4YFNF 4I98B 1T8IA 2D2WA 2OZUA 3SXYA 3CP2A 5BOXA 3NQOA 5DDGA 4A3BJ 1H9GA 1V5EA 2CS3A 5KAIC 4B4CA 3J81K 1U5TB 4IPAA 3ZN1A 3K1NA 1BI2A 3DCFA 4ESJA 1WH5A 1KQ0A 5K5QA 1UHWA 3TKYA 2Z33A 1NTCA 1I1GA 2V1XA 2BYVE 1DU6A 4AIHA 2NS7A 3SQNA 4BEHA 3CCSI 3JR9A 5HLIA 4A3KJ 4HNVA 2MG4A 3R6SA 2FOKA 2K4BA 5DCMA 1I1SA 2R7WA 4XK4A 2QLZA 3ZQFA 3DLAA 1XSXA 3IH2A 3PIPF 3FF5A 3KFWX 2M45A 3QOPA 2K9SA 3QPHA 4JYKA 4XKBA 2CU7A 2X6WA 1Z77A 2KFDA 4UUTA 1T56A 2I10A 3DPTA 2RREA 1ZAOA 1UZCA 2OQGA 2ZMEB 2EV0A 2BY1A 2BBYA 2MGQA 4K2EA 1V3FA 2HNHA 2Z2SB 3Q9VA 1EH7A 2KDOA 3L9FA 2OTJI 4RB0A 2JUCA 3K4LA 2LVSA 3LL7A 1UB9A 2R0QC 1L3LA 2FU4A 3A02A 3BG7A 4ENMA 4B1RA 3CLQA 5E1ZB 4W1UA 3ZN0A 2QSHX 4B8XA 5IT9K 1XSVA 2GIZA 4HX8A 3JCUC 1D0YA 2H6CA 4BHBA 4KIBA 2F5VA 4A3FJ 3LSKA 3UR3C 2F4MB 3RZDJ 3FHZA 4I2OA 5E8GA 1Z05A 4LLLA 2OD5A 4U0WA 4DOZA 1U2WA 3V8KA 1YW7A 1MBHA 2QWWA 4N4OB 3PSFA 3WU1B 2KJCA 1MBEA 1USSA 4ZYEA 2VB6A 4NQWB 3HOXJ 1LFBA 2BY3A 5H6RA 3S2DJ 2PMHA 3UNGC 1K4SA 4C3HJ 5IYBJ 3SZGA 1G6NA 3SZPA 2VLAA 4G7ZF 3HOVJ 2TDXA 2L9RA 3KP7A 5ILUA 2E7XA 4ABZA 1SFOJ 3WU0A 3X2QH 2HPMA 1DPRA 3K2AA 1U5TA 2ME6A 1QPIA 1B72B 4AUXA 5JFRA 3HRMA 4ESFA 1RR8C 1IRFA 2DQLA 4F3QA 3BZKA 2EV6A 1RUOA 3KEOA 1FP2A 3PUFA 1FC3A 2Z9OA 3WTZA 1DP7P 4YRVA 1RR7A 2R7FA 1BM9A 2A68F 2MLGA 4IQ4A 4MFDA 3JRHA 4KISA 3DEUA 5BPIA 2XAFA 1SVLA 5J3LA 4BQAA 1WSUA 1D1AA 4RGXA 4A2UA 2EA2A 4ZH4F 1S3JA 3HZJA 1WGXA 4P5OA 3BG5A 2JSPA 2MFZA 5JHUA 1VQ8I 3GF2A 4I6ZA 1G3WA 4A3EJ 3A2KA 4LK0F 5CJ9A 2X51A 2R7DA 1VQOI 2ZMEA 1OCPA 4Y4RA 5LEKA 3JRGA 3FXMA 3IWFA 1IN5A 3PQKA 3Q3SA 1X58A 3QQAA 4D5FA 1PDNC 2BHZA 2HOSA 2O9LA 5M5WJ 2XB5A 5DUKA 2LOOA 4ZDPA 3LQQA 3F23A 4GFBA 3CZ6A 3C2GA 1X1PA 1U3EM 2FF4A 4RAGA 1J59A 4PDKA 2XAHA 3JRDA 4A6DA 3DEEA 3DFGA 2HPIA 2DJNA 2ID3A 3KP3A 2VI6A 2UV1A 3QODA 2I5UA 2EINH 4BHPA 5HVQC 1SFUA 1YW8A 5EEGA 4QPQA 3SZTA 5DUIA 1JJ8C 2EQRA 2CWEA 2FEZA 2ZJRF 3E6CC 2EV5A 4BUPA 2HI3A 2OU2A 2ELKA 3FK6A 3LAPA 2JWTA 3FHNA 1WZ2A 1ON2A 5B1BH 4XQFA 3MKWB 4BQQA 2MYSA 2GWRA 2W24A 3HHGA 2OUMA 1HBXG 2ISYA 1FMVA 3RYRA 2CW0F 3GZ5A 1ZG5A 3BDDA 2VJJA 1XMXA 2X48A 5K5OA 2LF7A 4LD5A 2CYYA 1J9IA 2FMLA 4X6AJ 4RA2A 2XGDA 2AHQA 1E3PA 5FLMJ 2BZTA 3QWLA 1TWHJ 2LTPA 3KPHA 2CUEA 1B72A 5CVRA 3E7LA 1W7PB 3OV8A 4GCVA 1DPUA 3NRVA 4B44A 3I5UA 2XF7A 2W84A 1FNNA 3E5UA 4OAZA 1BC7C 2XIGA 4ZZLA 5E1XA 3T5XA 3TOAA 5CYVA 3GCMA 4NC7A 5L3DA 2R5ZB 3VYRB 3E97A 3FMRA 3TW6A 5CVIA 3WTXC 1TW2A 3KLNA 4BDZA 2HDCA 2PJRB 4IOAF 4E6KG 1SD6A 4XLHA 3I9V2 4ZYGA 1Q1VA 2VBXA 1WJFA 1S9HA 4FX4A 3GFIA 3JRAA 3S3MA 4RLQA 1XMAA 2B7EA 5E1WA 3F22A 2DMNA 5HLGA 2XHKA 4ZDOA 2PBIA 4XIDA 5JVGF 1LB2A 2VONA 3AG4H 2CGPA 3ZPLA 1NK3P 4DQ2A 2DT7B 5IP9J 2GXBA 4OIRF 1IV6A 2ZO4A 4OU0A 2DA7A 3CMYA 4W97A 5DS9A 2W00A 5BPDA 1A6QA 2XC7A 1YYVA 3DP7A 3IH3A 2DDBA 4LGWA 4M9XA 4RB2C 1BA5A 3TO9A 3D5LA 1VFCA 3VODA 3BT9A 2Q8KA 1FYMA 2FE3A 3BR1A 1IJWC 3Q5FA 5HLTA 1D1BA 5E3LA 1D8KA 3IH4A 3I71A 2PEXA 4EM1A 4JX6A 1MBJA 2ESNA 1OJLA 2BEOA 4DJAA 2LNBA 2V9KA 2VQGA 4HSRA 4XRSG 3MWMA 4CA0A 1TC3C 3CQZJ 1KQ9A 2FA5A 3HB9A 2JK3A 3KP4A 4CH7A 1P4XA 3H5AA 3HKZA 3D5SC 4B47A 4S0HB 5CVVA 3AL0C 1B1BA 2VPRA 2M7BA 5E18F 2AXTC 3CJTB 1S7OA 3JSPA 1H9TA 1OYWA 4M9ZA 3TQNA 2KZVA 2GQQA 4G94A 1HW2A 2DK5A 4OIOF 1YW9A 3I56I 1R5HA 4TV7A 5H2FC 1IV8A 3K4BA 2HQAA 3H3ZA 2KRCA 1RIOH 4BXXJ 3K4NA 3HM5A 2NVUB 5JR3A 2LK2A 1SD4A 1W7PA 3B6CA 4PFPA 3L2WA 1GVDA 5HDNA 2D1VA 3W6JB 2JQ7A 2OTLI 2X6XA 4HLXA 4OAYA 3WE3A 1X4PA 3K9TA 5FGMA 1VZ0A 3C7JA 4PK4A 4XLFA 1SEUA 5EDNA 1Y1VJ 4PJJA 5ED4A 1A31A 1RUNA 4AVZA 4DYCA 1ERDA 2FQ4A 3OYNA 3RIRA 2R5ZA 3LWFA 3M9AA 2Q2EB 2RV8A 1FBUA 4IVNA 1VF9A 4XORA 4CZCA 3ABTA 4MFEA 2PJRA 1WH7A 1XGSA 4O6JA 1MD0A 1V55H 4BDYA 1ENHA 5F04A 4I76A 2ZNZA 3EETA 3V7SA 3MN2A 3ULQB 4FE4A 5J40A 4HV5A 1VQMI 3FXOA 3ML6A 1AHDP 1O3SA 3Q0UA 1R23A 3HKZN 4HSTA 4UXNA 1U0JA 1ZELA 4PJLA 4NC8A 4MTEA 1AWCA 1XGNA 4MLOA 1Y1WJ 3WGGA 2CO5A 2LREA 1JKPC 1QBJA 3S1QJ 4XR6A 2CUFA 3PO2J 1ZLJA 3EQLF 2Z16A 3ABUA 3BCBA 3PIOF 1MH4A 4M3EA 4EM0B 3QOEA 2WB1A 2WADA 2VBZA 2UXXA 3I54A 5ICEA 1REPC 1E3HA 3RJPA 2QEXI 1JJ6C 3OS0A 4IQJA 2EZLA 3JTHA 3FXUA 1ETOA 2M4GA 2IAIA 4L5EA 2EZHA 3HOYJ 4U0YA 2K9NA 5J1UA 2JA6J 4DBRA 2IGKA 2ZBKA 3AL0B 3S16J 4HLYA 2HKXA 2JUGA 4FX0A 1X3ZB 2GAUA 1AU7A 2ICWG 4UV8A 2OPTA 3ZQHA 1R1TA 1MZBA 4PCQA 1QPMA 1ETKA 4IHXA 1ZR2A 3PFYA 2RKHA 1LJ9A 1ZHFA 4CHUA 3ECOA 2O6GE 1J2XA 2H09A 1Z6RA 4GDFA 2ZKZA 1HXDA 5J6XA 1KONA 4XN0A 2QQ8A 3F6VA 2XRLA 3M8FA 4A3DJ 1KGSA 2K9QA 4HZFA 1O4XA 1NK2P 1O7FA 1QVUA 2BGCA 3BLYA 5FLVA 1YRNB 1QHHD 1TZLA 2CJJA 3EUHA 2JN6A 1XD7A 3K4KA 4Y17A 1IXRC 2MH9A 5LD2C 4CXFA 2HOEA 2V9VA 4I7HA 4M3BA 3CF5F 2KLOA 4IXAA 1ETVA 2OZ6A 2M0MA 3LA2A 4PFOA 4XRMA 2WB1N 3BR2A 3KYCB 1AA7A 2P6TA 3DKWA 1MMDA 4AWXB 3I55I 2B9SA 4ENJA 1DDNA 3BG9A 3IHUA 4M72A 2CSOA 4YIIA 4B43A 4E7JA 1KU3A 2XF6A 5LEJA 3ZMSA 1BIBA 3AFHA 1X1DA 4L0ZB 2LY9A 3BC8A 2ME0A 2IS6A 5IYCJ 3OIPA 5HODA 3S2WA 2K4JA 3KP2A 1SVMA 3P9IA 2K3PA 2P7VB 5IOYA 1YITI 2XKOA 5M5XJ 3OSGA 2XGXA 1FTZA 2BHYA 1J5YA 1MBKA 3O8HA 4D0PA 2X6OA 3HGGA 5CVUA 3NWSA 2K27A 5F6FA 1G8XA 4DNCA 3WTVC 2W7NA 3BWGA 2HQNA 3Q0WA 2MSYA 3J7AO 2R7XA 2LY1A 3LFUA 2ECCA 2PX9A 1TQMA 1R9TJ 2R92J 3HOWJ 1XS9A 2X4HA 5IOZA 3MMYB 2X85A 3ONQA 3BJ6A 3CESA 2FBHA 2W57A 3NEUA 3CD6I 5IT3A 1BJZA 1ONVA 3T0YA 2Y9ZA 2DLLA 2EPFA 4QTRA 5BMZA 4JK1X 1ETQA 2VUMJ 4FISA 3M8JA 4PJNA 2DT6A 4RMNA 2QGUA 4IRGA 2KT0A 3CCRI 3HHHA 2QA4I 4KN4X 2IXSA 3BQZA 1JGGA 1JKQC 1BI0A 3L2CA 3ZRGA 2VN2A 1SANA 2F4OB 3BZ6A 4UVCA 3IL2A 1HKSA 1ODDA 2DQRA 2ZFWA 1F5TA 1MMSA 2L9SA 2M8EA 1FSEA 2ZCWA 3CDHA 4KYWA 2O8XA 2JPBA 4P1WA 3H92A 4NUBA 4D1QA 4X1EA 1W5SA 5HNHA 2QSGX 4L0YB 5A2QK 4MIMA 2A5YB 3LSRA 3GVAA 4QWQA 5D6EA 3MEXA 2Y0SA 1I39A 5HOOA 3BPXA 2WAEA 4Z2YA 3P9CA 3J7ZI 1YIJI 1WI3A 3BG6A 5K7FA 4BY7J 1SAXA 4N0BA 3OIQA 1FYKA 1FYLA 3G4SI 4HYEA 1XN7A 5B66C 4J00A 3TGNA 5DD8A 1IN8A 1EKEA 2VQLA 2O3FA 1JUPA 1C0WA 4CGZA 3GTKJ 2QQ9A 3MZHA 2DMQA 3HRTA 2MBFA 3FKIJ 1FIAA 3K7AJ 2VT3A 4YFKF 1D5YA 1PJRA 5JLWA 2VC1A 2L4AA 3O3KA 4L9TA 1XPXA 3RSNA 5B1AH 2M0CA 2PJPA 2VQHA 4HG2A 2PG4A 4XBFA 2YUSA 3D5RC 4AVPA 1IUYA 1GHCA 2W4SA 3RCOA 2JA8J 3R0AA 4L5JA 3T8TA 4HOBA 1SVOA 2F2EA 1N25A 4E70A 4E7LA 1A36A 4LB5A 2P0WA 3FM5A 4NC6A 3AAFA 2L02A 2DDAA 1FOYA 3HPGA 2HDDA 3F8CA 1EJ9A 1T38A 2VKDA 1N78A 3ZR8X 3MCZA 1J0RA 4XRSA 3LAJA 2VBWA 3BTJA 2WY7Q 3E5XA 4E4HA 4Y3OA 4S05A 1MGTA 2LKSA 3GMEA 5KAFC 2PLYA 2Y0SN 5L3EA
chains in the Genus database with same CATH topology
2NNYA 1E17A 3GUDA 4KUMA 2GIVA 3JSOA 3VFZA 1B4AA 1R1VA 4Q47A 4O3MA 1ULYA 5F1RA 4A0ZA 3MAJA 3E3VA 3HOSA 2DK8A 3JTGA 5AIPA 1A04A 4ESBA 3ISPA 1R1UA 4RB1A 5D6FA 1H0MA 2F5FA 3ROUA 2YX7A 1QQIA 3BJAA 2HS5A 4EM2A 1MKMA 1Z7UA 3JAMZ 4PGHA 1B9MA 1J75A 2M5WA 2W25A 1YTYA 2LKPA 5D5XB 4G7HF 4BYYA 4BXUA 3JW4A 2DW4A 3I58A 2MA3A 5HDGA 2RGVA 3RPQA 3CO7C 5L3FA 4XSXF 3E6MA 4KIGA 2GZWA 2BV6A 4L5IA 3I53A 3R0JA 5H6QA 4CZZA 4EGZA 2QM3A 1FY7A 2IA1A 5HDKA 3WE2A 2DAOA 1P4AA 4I01A 3PQJA 1EV7A 1P6RA 1FWZA 5DV5A 2QUFA 2VC0A 2Y48A 1S29A 4EGYA 3CUQC 5HS7A 1ZN2A 3ERED 4WF2A 2HEOA 1XGMA 2PFBA 2E1CA 1SFEA 1FBQA 1SFXA 2VT2A 1WQ2A 2JPCA 4CYDA 2PN6A 4FT8A 3E6DA 2Y0MA 2NRAC 1KU7A 5CLSA 3BP8A 1BC8C 3GFJA 4BHCA 2X0LA 1WRJA 2HZTA 2JT1A 3HOTA 3N97A 3J80Z 4ZYDA 2MC3A 4YIFA 1LDJA 2RC4A 3FM3A 3WG9A 1IN6A 3T1BA 4G6DA 5ILSA 2IT0A 2F5EA 1T39A 4LMYA 4IF4A 1NHAA 1WWXA 3O6BB 4HF2A 2RN7A 2KJBA 2L54A 1LQ1A 5D5VB 5FLXZ 1OYIA 2K02A 4LLNA 3RKWA 3WGIA 4KN7X 2OAZA 2H6BA 1TTYA 3KZZA 5E20A 4S04A 2HTSA 3KCCA 2DPDA 4HV6A 3MZYA 3QP6A 1I27A 2A61A 2WWYA 2P7CB 1FX7A 4G6QA 2P8TA 4RS8A 3L00A 4Y13A 5E17F 1YIOA 2L4MA 1OR7A 4UVAA 2KRFA 4GO1A 3V8JA 2XVCA 5DCFA 3LSTA 3C1DA 4O5VA 1LVAA 3J81Z 2HYGD 1XB4A 4ETSA 3CJNA 2QQAA 1FOKA 3HSFA 1G3TA 1FSHA 1ZYRF 6PAXA 5ICFA 3R61A 5LGUA 1PP7U 1K78B 2FNPA 5FB2A 5L3CA 4XLPF 2DFIA 3P9KA 2E7WA 4L18B 3HIFA 2Z5UA 2VE8A 4M9SA 4CICA 1JXSA 3WTYC 4KFCA 2P5VA 3GYHX 1O57A 3F21A 2CG4A 2FMYA 2HTJA 4KA4A 2XRNA 1RI7A 3GFLA 3CUQA 5IT9Z 2Q0OA 4Q5SF 3OOPA 3FMSA 2VBYA 4R1HA 3O2PE 3U2RA 1V4RA 1IRGA 4KIFA 4LJZF 3L7WA 5L3BA 5DD4A 4MTDA 1S8NA 3BROA 1FP1D 4R8HA 3DPLC 3CTAA 4RAYA 3C3WA 2OA4A 4HX4A 2GA2A 1LDKB 1U8RA 4L9NA 2M1BA 1Z91A 5D4RA 1LEAA 4KDPA 3F3XA 1UFMA 3M1EA 4CO8A 2ESHA 3U9GA 3F72A 2ADUA 3DF8A 1SMTA 1ZREA 1K78A 3TO7A 3GO5A 4KMUX 5HS9A 2AS5F 3H3UA 1QO0D 1USTA 5TRDA 3ZP5A 1YFHA 2C6YA 2XASA 2RQPA 2MLKA 1FBSA 2XAJA 2EFQA 1W5TA 1ZG3A 1F4KA 1UHMA 3I64A 5H20A 1QZYA 4WXDA 3B73A 2QZ8A 1ON1A 1BI3A 4OMYA 3QU6A 5AIQA 4HDVA 2IA0A 3B02A 1OKRA 3FZVA 3REOA 4G8XA 1R36A 1FPQA 4ASNA 2JTVA 1D5VA 4EJOA 2YPRA 3G3ZA 4PGGA 3VOEA 3IRQA 5DYMA 2IW5A 5J8FA 3HSEA 2IRFG 4L9VA 3P7NA 1O3RA 1ZGAA 2D1HA 1B9NA 1E2XA 1D3YA 3TO6A 2UXNA 3I4PA 2QBYB 2YX4A 4HDUA 2P4WA 4BNCA 4OIPF 2BE5F 2V79A 3CUOA 4AIJA 4NHJA 1CGPA 2DPUA 2VOPA 1LEBA 3MFKA 4Q48A 1R7JA 4LB6B 5FFZA 3U1DA 4EQQA 4RGRA 2CFXA 4WX9A 4M6YA 3TOBA 1T98A 3L09A 3WGHA 5ICCA 4A0YA 1OYYA 2FBIA 4P9FA 1DUXC 3WTUC 4QLCU 2QENA 2ELHA 3HYIA 1HSTA 4M71A 5KK1A 3K69A 1UCRA 4XSZF 4WWCA 1EH6A 5CVJA 4YG2F 3ZMDA 4GYGA 5LHGA 2Z3YA 5BQTA 1IXCA 2QVOA 1TNSA 1R5GA 5F64A 4Y15A 2P5KA 1ZRFA 3ECHA 3FWEA 3ZMVA 4LG0B 3GX4X 3F8NA 3W6KB 5D8LB 2LDUA 4MHGA 4I0AA 1U5TC 1JHFA 2EFOA 4U7BA 1TQPA 1VTNC 5HS8A 2B0LA 4OMZA 3IC7A 4ZZDA 1LDDA 4UUVA 4IHSA 4A12A 2H94A 2G7HA 2WTEA 3VEPA 2EA4A 1JE8A 3GFMA 1ZARA 2V1UA 2ZXJA 2VOOA 2QBYA 4WXHA 3CLOA 1SD7A 1PUEE 4RGUA 5D5WB 1K79A 3FMQA 2NS0A 4UHTA 1TLHB 1J7KA 1STZA 3PFIA 4IJAA 4WCGA 2DBBA 2O61A 3HRUA 2VXZA 4XRFA 3C18A 3T8RA 2IPQX 4IHTA 5EEHA 1HKQA 4HF0A 4LLGF 5E8IA 1F9NA 3LA7A 3SFZA 1IZ1A 1HSJA 3MQ0A 2R3SA 3VB2A 1I5ZA 2JSCA 3TDUC 2G7UA 3FXQA 4EVIA 2FNAA 1IAWA 4KNYA 2Z99A 2NAZA 2XV4S 2NNNA 4I0BA 3ELKA 3F6OA 5ILVA 2PI0A 3QP5A 3WODF 4OINF 3K0LA 1TBXA 3I59B 4LG0A 1R00A 2AXLA 1SD5A 2A07F 4H0EA 3V8LA 2YSRA 4P55A 2ETHA 2MH2A 1P4WA 2PMUA 2EFWA 1IW7F 5KVRA 5FD5A 2HGCA 2COMA 2EFPA 4PZJA 5AONA 3SHFA 1ZG1A 1BIAA 1MJBA 5BS6A 3ZMTA 3DXJF 5D5UB 4KT5C 2XKPA 5TJJA 4IRIA 3DQVC 4U88A 1IXSB 1QGPA 1XCBA 2ACJA 2E1NA 2Y75A 4NB5A 2P6SA 3HRSA 3HTSB 1YS6A 3GLXA 4I09A 4OOIA 1BJAA 1KYWA 2RDPA 2KKOA 2DI3A 1T6SA 5JVTA 1Z6TA 1BN5A 4HAMA 5LGNA 2L01A 2FBKA 3E6BA 4EV0A 3KETA 1Y0UA 3I59A 5HLHA 4JQFA 3E5QA 2VODA 2OBPA 2H27A 1IN4A 1KA8A 1S7AA 4AD9A 1GXQA 2K7LA 5J8CA 1RNLA 1TW3A 1P2FA 1YS7A 1ZGJA 3BJOA 3FX3A 4EMSA 1D8JA 3IKVA 5A2QZ 3IKTA 3RKYA 2STWA 4U7DA 1ZLKA 1O3QA 4GYIA 2A3SA 3GXOA 3EYYA 5LHHA 3ZMZA 3DV8A 2UWMA 3CUQB 1FLIA 1R58A 1XGOA 3F8MA 4MQVA 5LLQA 4HX7A 2KIUA 3F8FA 2EFNA 3V4GA 1XSDA 3QPTA 1OMIA 4IRHA 4LFUA 3RYPA 4NQWA 4G9YA 3EDPA 1FT9A 2W85A 4GGGA 4HF1A 3GW2A 4F7ZA 4MEYF 2LSOA 2FQ3A 1T0FA 2XAGA 2K86A 3F8BA 2JRTA 3KEQA 2WV0A 4L9JA 5LGTA 3BOQA 5FFXA 1U78A 5FO5A 3QAHA 1YG2A 1QZZA 4GXOA 3ZQ7A 4HA8A 5LRRA 1B6AA 3KP6A 1BBYA 2HKOA 4ON0A 4XLNF 1XCVA 1MJAA 3QU3A 3WTSC 1K6OA 4BH9A 3KZYA 5D4SA 1HW1A 1W4MA 4P96A 3CO6C 2M30A 2F5DA 4ENKA 5K5RA 4UV9A 2HR3A 4R79A 1GXPA 1B59A 1F1ZA 2DTRA 2GA1A 3K1PA 4HQEA 4BAYA 2J5OA 3RTRA 1LNWA 1GVJA 1R22A 4KMFA 2YU3A 4KICA 1G3SA 3WTWC 2NYXA 4CDGA 4M6XA 2DU9A 2J5PA 1CF7B 4UVBA 4OIQF 2IJLA 3G73A 3D0SA 1T2KA 1YQAA 3I0TA 1S6LA 2V6CA 4M73A 4HQMA 2FXAA 1RZ4A 5ERIA 2VE9A 3COAC 2M87A 5FD6A 2KIFA 5JI6A 2IVMA 1MJ9A 3Q9SA 3WTTC 5L3GA 1XDUA 5LRSA 4ENNA 3RI4A 3V7CA 1X3UA 2CQKA 3HSRA 2IP2A 2HFHA 4RGSA 3N4MA 1YLFA 2IA2A 2G9WA 2RVCA 1HQCA 4JBAA 1Q1HA 3HTUA 3RKXA 3ZMUA 2RNJA 1KYZA 1Z9CA 1O7LA 2D45A 1PP8F 3BPVA 1WI9A 2WC2A 1I6XA 5D8KB 4P9UA 3LA3A 1W7PD 3IRRA 2FRHA 1K7AA 4EJTA 4RAZA 2EB7A 3JAMK 1L0OC 4RB3C 3RPUA 4N9IA 2QYOA 1JGSA 2HYFA 3TDZC 2A6EF 4A5NA 2XAQA 1CF7A 4M74A 5LBQA 2FSWA 2LF8A 4G7OF 3M7GA 1BI1A 2V1DA 2ZNYA 3KLOA 4EJWA 4U0VA 3GEZA 2XUBA 2JZYA 1KU2A 3KP5A 3LFKA 3V7RA 1ZRDA 1KU9A 1SMYF 4LK1F 3GWZA 1FZPB 3LQRA 2Q2EA 2YR2A 2UZKA 3QRFF 3KE2A 1MDMB 1TQIA 2O03A 2EK5A 3HUGA 4A0XA 1OPCA 1G3YA 4MEXF 3R60A 1QNTA 2DT5A 3FXRA 3R4KA 2A6HF 1P92A 1TNTA 4I02A 1KQ8A 4WXCA 2QQBA 4MGRA 2DO7A 3IWZA 1HW5A 4UNOA 2KIMA 3EYIA 4A5MA 1ZH5A 2F5CA 1AOYA 4MNUA 1XDSA 1O3TA 3K2ZA 1U6GA 1WKMA 3M8EA 1JHHA 2STTA 4B09A 2O0YA 3J80K 2A69F 5DCMB 2P5LC 3GZ6A 1G4DA 2HWVA 2OQRA 4ZYHA 2EJRA 4Q4ZF 5ICGA 2MD5A 4WK8F 1XMKA 3BY6A 5K1YA 4YFXF 1ZRCA 5LHIA 2XROA 4HW0A 5FLXK 1IN7A 4EJUA 2HQRA 1Z1DA 1IF1A 4AIKA 1HKTA 2ISZA 4MQ9F 1MDMA 4HBLA 1BOAA 2EWNA 1YO5C 3K1MA 4EJVA 4A6EA 1EH8A 2GXGA 2L3DA 5DEQA 2PQ8A 4FHTA 4YFNF 2ZJ2A 3RDIA 4N9HA 4I98B 2D2WA 2OZUA 3SXYA 5BOXA 3NQOA 5DDGA 1H9GA 3J81K 1U5TB 4IPAA 3ZN1A 3K1NA 1BI2A 4ESJA 1KQ0A 5K5QA 1UHWA 3TKYA 2Z33A 2V1XA 1I1GA 2BYVE 4AIHA 3SQNA 5HLIA 3R6SA 2FOKA 2K4BA 5DCMA 1I1SA 2QLZA 1XSXA 3FF5A 3KFWX 2M45A 3QOPA 3QPHA 3DPTA 1ZAOA 2OQGA 2ZMEB 2EV0A 4K2EA 2BBYA 1V3FA 3Q9VA 1EH7A 3L9FA 4RB0A 1UB9A 1L3LA 2FU4A 4ENMA 5E1ZB 3ZN0A 4B8XA 5IT9K 1XSVA 4HX8A 2H6CA 4BHBA 4KIBA 3FHZA 4I2OA 5E8GA 1Z05A 4LLLA 2OD5A 4U0WA 1U2WA 3V8KA 1YW7A 2QWWA 3WU1B 2KJCA 4ZYEA 1USSA 5H6RA 2PMHA 1G6NA 3SZPA 4G7ZF 2TDXA 3KP7A 5ILUA 2E7XA 3WU0A 1DPRA 1U5TA 5JFRA 3HRMA 4ESFA 1IRFA 2DQLA 1RUOA 2EV6A 3KEOA 1FP2A 1FC3A 2Z9OA 3WTZA 1DP7P 2R7FA 1BM9A 2A68F 2MLGA 3DEUA 5BPIA 2XAFA 4BQAA 1WSUA 4RGXA 4A2UA 2EA2A 4ZH4F 1S3JA 4P5OA 5JHUA 3GF2A 1G3WA 4LK0F 5CJ9A 2R7DA 2ZMEA 5LEKA 3IWFA 3PQKA 1IN5A 1PDNC 5DUKA 3LQQA 3F23A 1U3EM 2FF4A 1J59A 4PDKA 2XAHA 4A6DA 3DFGA 3KP3A 4BHPA 5HVQC 1SFUA 1YW8A 5EEGA 3SZTA 5DUIA 2CWEA 2FEZA 3E6CC 2EV5A 2OU2A 3LAPA 1ON2A 2GWRA 2W24A 3HHGA 1HBXG 2ISYA 3RYRA 2CW0F 3GZ5A 1ZG5A 3BDDA 5K5OA 2LF7A 4LD5A 2CYYA 1J9IA 2FMLA 5CVRA 1W7PB 3OV8A 4GCVA 1DPUA 3NRVA 3I5UA 2W84A 1FNNA 3E5UA 1BC7C 2XIGA 4ZZLA 5E1XA 3T5XA 3TOAA 5CYVA 5L3DA 3E97A 3FMRA 5CVIA 3WTXC 1TW2A 3KLNA 2HDCA 1SD6A 4ZYGA 2VBXA 4FX4A 3GFIA 1XMAA 5E1WA 3F22A 5HLGA 2XHKA 2PBIA 1LB2A 2VONA 3ZPLA 2CGPA 4DQ2A 2GXBA 4OIRF 2ZO4A 4OU0A 5BPDA 1YYVA 3DP7A 4LGWA 4M9XA 4RB2C 3TO9A 3D5LA 3VODA 2Q8KA 1FYMA 2FE3A 3Q5FA 1D8KA 3I71A 2PEXA 4EM1A 2ESNA 2BEOA 2LNBA 3MWMA 1KQ9A 2FA5A 3KP4A 1P4XA 5CVVA 1B1BA 5E18F 3JSPA 1S7OA 1H9TA 1OYWA 4M9ZA 3TQNA 2GQQA 4G94A 1HW2A 2DK5A 4OIOF 1YW9A 1R5HA 4TV7A 3H3ZA 1RIOH 5JR3A 1SD4A 1W7PA 5HDNA 2D1VA 3W6JB 4HLXA 3WE3A 3K9TA 5FGMA 3C7JA 5ED4A 1RUNA 3RIRA 3LWFA 3M9AA 2RV8A 1FBUA 4IVNA 3ABTA 1XGSA 4O6JA 1MD0A 2ZNZA 3EETA 3V7SA 3ULQB 4HV5A 3ML6A 1O3SA 1R23A 4UXNA 1AWCA 4MTEA 1XGNA 3WGGA 2CO5A 1QBJA 1ZLJA 3EQLF 3ABUA 4EM0B 2VBZA 2UXXA 3I54A 5ICEA 1REPC 3RJPA 3JTHA 3FXUA 4U0YA 2ZBKA 4HLYA 2HKXA 4FX0A 2GAUA 4UV8A 1R1TA 1MZBA 4PCQA 1QPMA 2RKHA 1LJ9A 1ZHFA 4CHUA 3ECOA 2O6GE 1J2XA 2H09A 1Z6RA 2ZKZA 1HXDA 5J6XA 3F6VA 3M8FA 1KGSA 4HZFA 1O7FA 2BGCA 3EUHA 1XD7A 4Y17A 1IXRC 2MH9A 4CXFA 2HOEA 2V9VA 4I7HA 4IXAA 2OZ6A 3LA2A 4AWXB 2P6TA 3DKWA 4ENJA 1DDNA 3IHUA 4M72A 2CSOA 4YIIA 1KU3A 5LEJA 3ZMSA 1BIBA 4L0ZB 3S2WA 2K4JA 3KP2A 3P9IA 2P7VB 2XKOA 2XGXA 1J5YA 4D0PA 5CVUA 5F6FA 2K27A 4DNCA 3WTVC 3BWGA 2HQNA 3J7AO 1TQMA 2X4HA 3BJ6A 2FBHA 2W57A 3NEUA 5IT3A 1ONVA 3T0YA 2DLLA 5BMZA 4JK1X 4IRGA 3HHHA 4KN4X 1BI0A 3L2CA 2VN2A 3BZ6A 4UVCA 3IL2A 1HKSA 1ODDA 2DQRA 2ZFWA 1F5TA 2M8EA 4KYWA 1FSEA 2ZCWA 3CDHA 2O8XA 2JPBA 3H92A 4L0YB 1W5SA 5A2QK 2A5YB 3GVAA 4QWQA 5D6EA 3MEXA 5HOOA 3BPXA 4Z2YA 3P9CA 1SAXA 4N0BA 1FYKA 1FYLA 4HYEA 1XN7A 3TGNA 5DD8A 1IN8A 2O3FA 1C0WA 4CGZA 2QQ9A 3MZHA 3HRTA 2MBFA 2VT3A 4YFKF 2VC1A 2L4AA 3O3KA 4L9TA 2PJPA 2PG4A 4XBFA 4AVPA 1IUYA 1GHCA 3R0AA 4L5JA 3T8TA 4HOBA 2F2EA 4E70A 4LB5A 3FM5A 3AAFA 2L02A 3F8CA 1T38A 3MCZA 1J0RA 3LAJA 2VBWA 3E5XA 4S05A 1MGTA 2PLYA 5L3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NNY A;  1E17 A;  3GUD A;  4KUM A;  2GIV A;  3JSO A;  3VFZ A;  1B4A A;  1R1V A;  4Q47 A;  4O3M A;  1ULY A;  5F1R A;  4A0Z A;  3MAJ A;  3E3V A;  3HOS A;  2DK8 A;  3JTG A;  5AIP A;  1A04 A;  4ESB A;  3ISP A;  1R1U A;  4RB1 A;  5D6F A;  1H0M A;  2F5F A;  3ROU A;  2YX7 A;  1QQI A;  3BJA A;  2HS5 A;  4EM2 A;  1MKM A;  1Z7U A;  3JAM Z;  4PGH A;  1B9M A;  1J75 A;  2M5W A;  2W25 A;  1YTY A;  2LKP A;  5D5X B;  4G7H F;  4BYY A;  4BXU A;  3JW4 A;  2DW4 A;  3I58 A;  2MA3 A;  5HDG A;  2RGV A;  3RPQ A;  3CO7 C;  5L3F A;  4XSX F;  3E6M A;  4KIG A;  2GZW A;  2BV6 A;  4L5I A;  3I53 A;  3R0J A;  5H6Q A;  4CZZ A;  4EGZ A;  2QM3 A;  1FY7 A;  2IA1 A;  5HDK A;  3WE2 A;  2DAO A;  1P4A A;  4I01 A;  3PQJ A;  1EV7 A;  1P6R A;  1FWZ A;  5DV5 A;  2QUF A;  2VC0 A;  2Y48 A;  1S29 A;  4EGY A;  3CUQ C;  5HS7 A;  1ZN2 A;  3ERE D;  4WF2 A;  2HEO A;  1XGM A;  2PFB A;  2E1C A;  1SFE A;  1FBQ A;  1SFX A;  2VT2 A;  1WQ2 A;  2JPC A;  4CYD A;  2PN6 A;  4FT8 A;  3E6D A;  2Y0M A;  2NRA C;  1KU7 A;  5CLS A;  3BP8 A;  1BC8 C;  3GFJ A;  4BHC A;  2X0L A;  1WRJ A;  2HZT A;  2JT1 A;  3HOT A;  3N97 A;  3J80 Z;  4ZYD A;  2MC3 A;  4YIF A;  1LDJ A;  2RC4 A;  3FM3 A;  3WG9 A;  1IN6 A;  3T1B A;  4G6D A;  5ILS A;  2IT0 A;  2F5E A;  1T39 A;  4LMY A;  4IF4 A;  1NHA A;  1WWX A;  3O6B B;  4HF2 A;  2RN7 A;  2KJB A;  2L54 A;  1LQ1 A;  5D5V B;  5FLX Z;  1OYI A;  2K02 A;  4LLN A;  3RKW A;  3WGI A;  4KN7 X;  2OAZ A;  2H6B A;  1TTY A;  3KZZ A;  5E20 A;  4S04 A;  2HTS A;  3KCC A;  2DPD A;  4HV6 A;  3MZY A;  3QP6 A;  1I27 A;  2A61 A;  2WWY A;  2P7C B;  1FX7 A;  4G6Q A;  2P8T A;  4RS8 A;  3L00 A;  4Y13 A;  5E17 F;  1YIO A;  2L4M A;  1OR7 A;  4UVA A;  2KRF A;  4GO1 A;  3V8J A;  2XVC A;  5DCF A;  3LST A;  3C1D A;  4O5V A;  1LVA A;  3J81 Z;  2HYG D;  1XB4 A;  4ETS A;  3CJN A;  2QQA A;  1FOK A;  3HSF A;  1G3T A;  1FSH A;  1ZYR F;  6PAX A;  5ICF A;  3R61 A;  5LGU A;  1PP7 U;  1K78 B;  2FNP A;  5FB2 A;  5L3C A;  4XLP F;  2DFI A;  3P9K A;  2E7W A;  4L18 B;  3HIF A;  2Z5U A;  2VE8 A;  4M9S A;  4CIC A;  1JXS A;  3WTY C;  4KFC A;  2P5V A;  3GYH X;  1O57 A;  3F21 A;  2CG4 A;  2FMY A;  2HTJ A;  4KA4 A;  2XRN A;  1RI7 A;  3GFL A;  3CUQ A;  5IT9 Z;  2Q0O A;  4Q5S F;  3OOP A;  3FMS A;  2VBY A;  4R1H A;  3O2P E;  3U2R A;  1V4R A;  1IRG A;  4KIF A;  4LJZ F;  3L7W A;  5L3B A;  5DD4 A;  4MTD A;  1S8N A;  3BRO A;  1FP1 D;  4R8H A;  3DPL C;  3CTA A;  4RAY A;  3C3W A;  2OA4 A;  4HX4 A;  2GA2 A;  1LDK B;  1U8R A;  4L9N A;  2M1B A;  1Z91 A;  5D4R A;  1LEA A;  4KDP A;  3F3X A;  1UFM A;  3M1E A;  4CO8 A;  2ESH A;  3U9G A;  3F72 A;  2ADU A;  3DF8 A;  1SMT A;  1ZRE A;  1K78 A;  3TO7 A;  3GO5 A;  4KMU X;  5HS9 A;  2AS5 F;  3H3U A;  1QO0 D;  1UST A;  5TRD A;  3ZP5 A;  1YFH A;  2C6Y A;  2XAS A;  2RQP A;  2MLK A;  1FBS A;  2XAJ A;  2EFQ A;  1W5T A;  1ZG3 A;  1F4K A;  1UHM A;  3I64 A;  5H20 A;  1QZY A;  4WXD A;  3B73 A;  2QZ8 A;  1ON1 A;  1BI3 A;  4OMY A;  3QU6 A;  5AIQ A;  4HDV A;  2IA0 A;  3B02 A;  1OKR A;  3FZV A;  3REO A;  4G8X A;  1R36 A;  1FPQ A;  4ASN A;  2JTV A;  1D5V A;  4EJO A;  2YPR A;  3G3Z A;  4PGG A;  3VOE A;  3IRQ A;  5DYM A;  2IW5 A;  5J8F A;  3HSE A;  2IRF G;  4L9V A;  3P7N A;  1O3R A;  1ZGA A;  2D1H A;  1B9N A;  1E2X A;  1D3Y A;  3TO6 A;  2UXN A;  3I4P A;  2QBY B;  2YX4 A;  4HDU A;  2P4W A;  4BNC A;  4OIP F;  2BE5 F;  2V79 A;  3CUO A;  4AIJ A;  4NHJ A;  1CGP A;  2DPU A;  2VOP A;  1LEB A;  3MFK A;  4Q48 A;  1R7J A;  4LB6 B;  5FFZ A;  3U1D A;  4EQQ A;  4RGR A;  2CFX A;  4WX9 A;  4M6Y A;  3TOB A;  1T98 A;  3L09 A;  3WGH A;  5ICC A;  4A0Y A;  1OYY A;  2FBI A;  4P9F A;  1DUX C;  3WTU C;  4QLC U;  2QEN A;  2ELH A;  3HYI A;  1HST A;  4M71 A;  5KK1 A;  3K69 A;  1UCR A;  4XSZ F;  4WWC A;  1EH6 A;  5CVJ A;  4YG2 F;  3ZMD A;  4GYG A;  5LHG A;  2Z3Y A;  5BQT A;  1IXC A;  2QVO A;  1TNS A;  1R5G A;  5F64 A;  4Y15 A;  2P5K A;  1ZRF A;  3ECH A;  3FWE A;  3ZMV A;  4LG0 B;  3GX4 X;  3F8N A;  3W6K B;  5D8L B;  2LDU A;  4MHG A;  4I0A A;  1U5T C;  1JHF A;  2EFO A;  4U7B A;  1TQP A;  1VTN C;  5HS8 A;  2B0L A;  4OMZ A;  3IC7 A;  4ZZD A;  1LDD A;  4UUV A;  4IHS A;  4A12 A;  2H94 A;  2G7H A;  2WTE A;  3VEP A;  2EA4 A;  1JE8 A;  3GFM A;  1ZAR A;  2V1U A;  2ZXJ A;  2VOO A;  2QBY A;  4WXH A;  3CLO A;  1SD7 A;  1PUE E;  4RGU A;  5D5W B;  1K79 A;  3FMQ A;  2NS0 A;  4UHT A;  1TLH B;  1J7K A;  1STZ A;  3PFI A;  4IJA A;  4WCG A;  2DBB A;  2O61 A;  3HRU A;  2VXZ A;  4XRF A;  3C18 A;  3T8R A;  2IPQ X;  4IHT A;  5EEH A;  1HKQ A;  4HF0 A;  4LLG F;  5E8I A;  1F9N A;  3LA7 A;  3SFZ A;  1IZ1 A;  1HSJ A;  3MQ0 A;  2R3S A;  3VB2 A;  1I5Z A;  2JSC A;  3TDU C;  2G7U A;  3FXQ A;  4EVI A;  2FNA A;  1IAW A;  4KNY A;  2Z99 A;  2NAZ A;  2XV4 S;  2NNN A;  4I0B A;  3ELK A;  3F6O A;  5ILV A;  2PI0 A;  3QP5 A;  3WOD F;  4OIN F;  3K0L A;  1TBX A;  3I59 B;  4LG0 A;  1R00 A;  2AXL A;  1SD5 A;  2A07 F;  4H0E A;  3V8L A;  2YSR A;  4P55 A;  2ETH A;  2MH2 A;  1P4W A;  2PMU A;  2EFW A;  1IW7 F;  5KVR A;  5FD5 A;  2HGC A;  2COM A;  2EFP A;  4PZJ A;  5AON A;  3SHF A;  1ZG1 A;  1BIA A;  1MJB A;  5BS6 A;  3ZMT A;  3DXJ F;  5D5U B;  4KT5 C;  2XKP A;  5TJJ A;  4IRI A;  3DQV C;  4U88 A;  1IXS B;  1QGP A;  1XCB A;  2ACJ A;  2E1N A;  2Y75 A;  4NB5 A;  2P6S A;  3HRS A;  3HTS B;  1YS6 A;  3GLX A;  4I09 A;  4OOI A;  1BJA A;  1KYW A;  2RDP A;  2KKO A;  2DI3 A;  1T6S A;  5JVT A;  1Z6T A;  1BN5 A;  4HAM A;  5LGN A;  2L01 A;  2FBK A;  3E6B A;  4EV0 A;  3KET A;  1Y0U A;  3I59 A;  5HLH A;  4JQF A;  3E5Q A;  2VOD A;  2OBP A;  2H27 A;  1IN4 A;  1KA8 A;  1S7A A;  4AD9 A;  1GXQ A;  2K7L A;  5J8C A;  1RNL A;  1TW3 A;  1P2F A;  1YS7 A;  1ZGJ A;  3BJO A;  3FX3 A;  4EMS A;  1D8J A;  3IKV A;  5A2Q Z;  3IKT A;  3RKY A;  2STW A;  4U7D A;  1ZLK A;  1O3Q A;  4GYI A;  2A3S A;  3GXO A;  3EYY A;  5LHH A;  3ZMZ A;  3DV8 A;  2UWM A;  3CUQ B;  1FLI A;  1R58 A;  1XGO A;  3F8M A;  4MQV A;  5LLQ A;  4HX7 A;  2KIU A;  3F8F A;  2EFN A;  3V4G A;  1XSD A;  3QPT A;  1OMI A;  4IRH A;  4LFU A;  3RYP A;  4NQW A;  4G9Y A;  3EDP A;  1FT9 A;  2W85 A;  4GGG A;  4HF1 A;  3GW2 A;  4F7Z A;  4MEY F;  2LSO A;  2FQ3 A;  1T0F A;  2XAG A;  2K86 A;  3F8B A;  2JRT A;  3KEQ A;  2WV0 A;  4L9J A;  5LGT A;  3BOQ A;  5FFX A;  1U78 A;  5FO5 A;  3QAH A;  1YG2 A;  1QZZ A;  4GXO A;  3ZQ7 A;  4HA8 A;  5LRR A;  1B6A A;  3KP6 A;  1BBY A;  2HKO A;  4ON0 A;  4XLN F;  1XCV A;  1MJA A;  3QU3 A;  3WTS C;  1K6O A;  4BH9 A;  3KZY A;  5D4S A;  1HW1 A;  1W4M A;  4P96 A;  3CO6 C;  2M30 A;  2F5D A;  4ENK A;  5K5R A;  4UV9 A;  2HR3 A;  4R79 A;  1GXP A;  1B59 A;  1F1Z A;  2DTR A;  2GA1 A;  3K1P A;  4HQE A;  4BAY A;  2J5O A;  3RTR A;  1LNW A;  1GVJ A;  1R22 A;  4KMF A;  2YU3 A;  4KIC A;  1G3S A;  3WTW C;  2NYX A;  4CDG A;  4M6X A;  2DU9 A;  2J5P A;  1CF7 B;  4UVB A;  4OIQ F;  2IJL A;  3G73 A;  3D0S A;  1T2K A;  1YQA A;  3I0T A;  1S6L A;  2V6C A;  4M73 A;  4HQM A;  2FXA A;  1RZ4 A;  5ERI A;  2VE9 A;  3COA C;  2M87 A;  5FD6 A;  2KIF A;  5JI6 A;  2IVM A;  1MJ9 A;  3Q9S A;  3WTT C;  5L3G A;  1XDU A;  5LRS A;  4ENN A;  3RI4 A;  3V7C A;  1X3U A;  2CQK A;  3HSR A;  2IP2 A;  2HFH A;  4RGS A;  3N4M A;  1YLF A;  2IA2 A;  2G9W A;  2RVC A;  1HQC A;  4JBA A;  1Q1H A;  3HTU A;  3RKX A;  3ZMU A;  2RNJ A;  1KYZ A;  1Z9C A;  1O7L A;  2D45 A;  1PP8 F;  3BPV A;  1WI9 A;  2WC2 A;  1I6X A;  5D8K B;  4P9U A;  3LA3 A;  1W7P D;  3IRR A;  2FRH A;  1K7A A;  4EJT A;  4RAZ A;  2EB7 A;  3JAM K;  1L0O C;  4RB3 C;  3RPU A;  4N9I A;  2QYO A;  1JGS A;  2HYF A;  3TDZ C;  2A6E F;  4A5N A;  2XAQ A;  1CF7 A;  4M74 A;  5LBQ A;  2FSW A;  2LF8 A;  4G7O F;  3M7G A;  1BI1 A;  2V1D A;  2ZNY A;  3KLO A;  4EJW A;  4U0V A;  3GEZ A;  2XUB A;  2JZY A;  1KU2 A;  3KP5 A;  3LFK A;  3V7R A;  1ZRD A;  1KU9 A;  1SMY F;  4LK1 F;  3GWZ A;  1FZP B;  3LQR A;  2Q2E A;  2YR2 A;  2UZK A;  3QRF F;  3KE2 A;  1MDM B;  1TQI A;  2O03 A;  2EK5 A;  3HUG A;  4A0X A;  1OPC A;  1G3Y A;  4MEX F;  3R60 A;  1QNT A;  2DT5 A;  3FXR A;  3R4K A;  2A6H F;  1P92 A;  1TNT A;  4I02 A;  1KQ8 A;  4WXC A;  2QQB A;  4MGR A;  2DO7 A;  3IWZ A;  1HW5 A;  4UNO A;  2KIM A;  3EYI A;  4A5M A;  1ZH5 A;  2F5C A;  1AOY A;  4MNU A;  1XDS A;  1O3T A;  3K2Z A;  1U6G A;  1WKM A;  3M8E A;  1JHH A;  2STT A;  4B09 A;  2O0Y A;  3J80 K;  2A69 F;  5DCM B;  2P5L C;  3GZ6 A;  1G4D A;  2HWV A;  2OQR A;  4ZYH A;  2EJR A;  4Q4Z F;  5ICG A;  2MD5 A;  4WK8 F;  1XMK A;  3BY6 A;  5K1Y A;  4YFX F;  1ZRC A;  5LHI A;  2XRO A;  4HW0 A;  5FLX K;  1IN7 A;  4EJU A;  2HQR A;  1Z1D A;  1IF1 A;  4AIK A;  1HKT A;  2ISZ A;  4MQ9 F;  1MDM A;  4HBL A;  1BOA A;  2EWN A;  1YO5 C;  3K1M A;  4EJV A;  4A6E A;  1EH8 A;  2GXG A;  2L3D A;  5DEQ A;  2PQ8 A;  4FHT A;  4YFN F;  2ZJ2 A;  3RDI A;  4N9H A;  4I98 B;  2D2W A;  2OZU A;  3SXY A;  5BOX A;  3NQO A;  5DDG A;  1H9G A;  3J81 K;  1U5T B;  4IPA A;  3ZN1 A;  3K1N A;  1BI2 A;  4ESJ A;  1KQ0 A;  5K5Q A;  1UHW A;  3TKY A;  2Z33 A;  2V1X A;  1I1G A;  2BYV E;  4AIH A;  3SQN A;  5HLI A;  3R6S A;  2FOK A;  2K4B A;  5DCM A;  1I1S A;  2QLZ A;  1XSX A;  3FF5 A;  3KFW X;  2M45 A;  3QOP A;  3QPH A;  3DPT A;  1ZAO A;  2OQG A;  2ZME B;  2EV0 A;  4K2E A;  2BBY A;  1V3F A;  3Q9V A;  1EH7 A;  3L9F A;  4RB0 A;  1UB9 A;  1L3L A;  2FU4 A;  4ENM A;  5E1Z B;  3ZN0 A;  4B8X A;  5IT9 K;  1XSV A;  4HX8 A;  2H6C A;  4BHB A;  4KIB A;  3FHZ A;  4I2O A;  5E8G A;  1Z05 A;  4LLL A;  2OD5 A;  4U0W A;  1U2W A;  3V8K A;  1YW7 A;  2QWW A;  3WU1 B;  2KJC A;  4ZYE A;  1USS A;  5H6R A;  2PMH A;  1G6N A;  3SZP A;  4G7Z F;  2TDX A;  3KP7 A;  5ILU A;  2E7X A;  3WU0 A;  1DPR A;  1U5T A;  5JFR A;  3HRM A;  4ESF A;  1IRF A;  2DQL A;  1RUO A;  2EV6 A;  3KEO A;  1FP2 A;  1FC3 A;  2Z9O A;  3WTZ A;  1DP7 P;  2R7F A;  1BM9 A;  2A68 F;  2MLG A;  3DEU A;  5BPI A;  2XAF A;  4BQA A;  1WSU A;  4RGX A;  4A2U A;  2EA2 A;  4ZH4 F;  1S3J A;  4P5O A;  5JHU A;  3GF2 A;  1G3W A;  4LK0 F;  5CJ9 A;  2R7D A;  2ZME A;  5LEK A;  3IWF A;  3PQK A;  1IN5 A;  1PDN C;  5DUK A;  3LQQ A;  3F23 A;  1U3E M;  2FF4 A;  1J59 A;  4PDK A;  2XAH A;  4A6D A;  3DFG A;  3KP3 A;  4BHP A;  5HVQ C;  1SFU A;  1YW8 A;  5EEG A;  3SZT A;  5DUI A;  2CWE A;  2FEZ A;  3E6C C;  2EV5 A;  2OU2 A;  3LAP A;  1ON2 A;  2GWR A;  2W24 A;  3HHG A;  1HBX G;  2ISY A;  3RYR A;  2CW0 F;  3GZ5 A;  1ZG5 A;  3BDD A;  5K5O A;  2LF7 A;  4LD5 A;  2CYY A;  1J9I A;  2FML A;  5CVR A;  1W7P B;  3OV8 A;  4GCV A;  1DPU A;  3NRV A;  3I5U A;  2W84 A;  1FNN A;  3E5U A;  1BC7 C;  2XIG A;  4ZZL A;  5E1X A;  3T5X A;  3TOA A;  5CYV A;  5L3D A;  3E97 A;  3FMR A;  5CVI A;  3WTX C;  1TW2 A;  3KLN A;  2HDC A;  1SD6 A;  4ZYG A;  2VBX A;  4FX4 A;  3GFI A;  1XMA A;  5E1W A;  3F22 A;  5HLG A;  2XHK A;  2PBI A;  1LB2 A;  2VON A;  3ZPL A;  2CGP A;  4DQ2 A;  2GXB A;  4OIR F;  2ZO4 A;  4OU0 A;  5BPD A;  1YYV A;  3DP7 A;  4LGW A;  4M9X A;  4RB2 C;  3TO9 A;  3D5L A;  3VOD A;  2Q8K A;  1FYM A;  2FE3 A;  3Q5F A;  1D8K A;  3I71 A;  2PEX A;  4EM1 A;  2ESN A;  2BEO A;  2LNB A;  3MWM A;  1KQ9 A;  2FA5 A;  3KP4 A;  1P4X A;  5CVV A;  1B1B A;  5E18 F;  3JSP A;  1S7O A;  1H9T A;  1OYW A;  4M9Z A;  3TQN A;  2GQQ A;  4G94 A;  1HW2 A;  2DK5 A;  4OIO F;  1YW9 A;  1R5H A;  4TV7 A;  3H3Z A;  1RIO H;  5JR3 A;  1SD4 A;  1W7P A;  5HDN A;  2D1V A;  3W6J B;  4HLX A;  3WE3 A;  3K9T A;  5FGM A;  3C7J A;  5ED4 A;  1RUN A;  3RIR A;  3LWF A;  3M9A A;  2RV8 A;  1FBU A;  4IVN A;  3ABT A;  1XGS A;  4O6J A;  1MD0 A;  2ZNZ A;  3EET A;  3V7S A;  3ULQ B;  4HV5 A;  3ML6 A;  1O3S A;  1R23 A;  4UXN A;  1AWC A;  4MTE A;  1XGN A;  3WGG A;  2CO5 A;  1QBJ A;  1ZLJ A;  3EQL F;  3ABU A;  4EM0 B;  2VBZ A;  2UXX A;  3I54 A;  5ICE A;  1REP C;  3RJP A;  3JTH A;  3FXU A;  4U0Y A;  2ZBK A;  4HLY A;  2HKX A;  4FX0 A;  2GAU A;  4UV8 A;  1R1T A;  1MZB A;  4PCQ A;  1QPM A;  2RKH A;  1LJ9 A;  1ZHF A;  4CHU A;  3ECO A;  2O6G E;  1J2X A;  2H09 A;  1Z6R A;  2ZKZ A;  1HXD A;  5J6X A;  3F6V A;  3M8F A;  1KGS A;  4HZF A;  1O7F A;  2BGC A;  3EUH A;  1XD7 A;  4Y17 A;  1IXR C;  2MH9 A;  4CXF A;  2HOE A;  2V9V A;  4I7H A;  4IXA A;  2OZ6 A;  3LA2 A;  4AWX B;  2P6T A;  3DKW A;  4ENJ A;  1DDN A;  3IHU A;  4M72 A;  2CSO A;  4YII A;  1KU3 A;  5LEJ A;  3ZMS A;  1BIB A;  4L0Z B;  3S2W A;  2K4J A;  3KP2 A;  3P9I A;  2P7V B;  2XKO A;  2XGX A;  1J5Y A;  4D0P A;  5CVU A;  5F6F A;  2K27 A;  4DNC A;  3WTV C;  3BWG A;  2HQN A;  3J7A O;  1TQM A;  2X4H A;  3BJ6 A;  2FBH A;  2W57 A;  3NEU A;  5IT3 A;  1ONV A;  3T0Y A;  2DLL A;  5BMZ A;  4JK1 X;  4IRG A;  3HHH A;  4KN4 X;  1BI0 A;  3L2C A;  2VN2 A;  3BZ6 A;  4UVC A;  3IL2 A;  1HKS A;  1ODD A;  2DQR A;  2ZFW A;  1F5T A;  2M8E A;  4KYW A;  1FSE A;  2ZCW A;  3CDH A;  2O8X A;  2JPB A;  3H92 A;  4L0Y B;  1W5S A;  5A2Q K;  2A5Y B;  3GVA A;  4QWQ A;  5D6E A;  3MEX A;  5HOO A;  3BPX A;  4Z2Y A;  3P9C A;  1SAX A;  4N0B A;  1FYK A;  1FYL A;  4HYE A;  1XN7 A;  3TGN A;  5DD8 A;  1IN8 A;  2O3F A;  1C0W A;  4CGZ A;  2QQ9 A;  3MZH A;  3HRT A;  2MBF A;  2VT3 A;  4YFK F;  2VC1 A;  2L4A A;  3O3K A;  4L9T A;  2PJP A;  2PG4 A;  4XBF A;  4AVP A;  1IUY A;  1GHC A;  3R0A A;  4L5J A;  3T8T A;  4HOB A;  2F2E A;  4E70 A;  4LB5 A;  3FM5 A;  3AAF A;  2L02 A;  3F8C A;  1T38 A;  3MCZ A;  1J0R A;  3LAJ A;  2VBW A;  3E5X A;  4S05 A;  1MGT A;  2PLY A;  5L3E A; 
#chains in the Genus database with same CATH topology
 2NNY A;  2V1N A;  4LOC A;  1E17 A;  3GUD A;  2V9P A;  2FUG 2;  2QKL B;  1PYV A;  2R5Y B;  4KUM A;  2GIV A;  1FTT A;  3JSO A;  1Y39 A;  3VFZ A;  1B4A A;  4PJM A;  1HF0 A;  3G1O A;  1R1V A;  4YEJ A;  4Q47 A;  3LSP A;  4O3M A;  3F0C A;  3DEW A;  1ULY A;  4V2G A;  5FJ8 J;  4JX5 A;  2IEK A;  3K10 A;  5F1R A;  3CCL I;  5J47 A;  4C2M J;  4A0Z A;  3MAJ A;  3E3V A;  5EG0 B;  3PNT A;  3HOS A;  2DK8 A;  2L7F P;  5AIP A;  3JTG A;  1A04 A;  3P5J A;  2XGE A;  3L2V A;  4ESB A;  3ISP A;  1R1U A;  4RB1 A;  3S1N J;  5D6F A;  1H0M A;  2F5F A;  3ROU A;  4II2 A;  1VQP I;  1OR7 C;  2YX7 A;  2DA2 A;  1QQI A;  2LKX A;  3BJA A;  1W0U A;  2HS5 A;  4D7M A;  4EM2 A;  5GAE J;  1MKM A;  1Z7U A;  3PM1 A;  3JAM Z;  3I4M J;  4PGH A;  1R4M B;  3VDX A;  1B9M A;  1J75 A;  2Y30 A;  1LPQ A;  2M5W A;  2W25 A;  3DTE A;  1YTY A;  2E5Z A;  3ABM H;  4MO7 A;  2F48 A;  2LKP A;  5D5X B;  4G7H F;  4BYY A;  4E7Z A;  2ZB9 A;  4DYQ A;  5F0H A;  4BXU A;  4KIT B;  4F92 B;  1JKO C;  1HLV A;  1DGR M;  3CJR B;  4IRI A;  3JW4 A;  2E71 A;  2DW4 A;  3I58 A;  4XOP A;  2HVS A;  2W82 A;  2LP0 A;  2MA3 A;  4G12 A;  5HDG A;  5C4J J;  1JT0 A;  4BXF A;  4N4N B;  2RGV A;  3RPQ A;  3KIO A;  3CO7 C;  4DYR A;  5L3F A;  4XSX F;  3CCJ I;  3E6M A;  4KIG A;  3J7A Y;  2GZW A;  2BV6 A;  4L5I A;  3DPU A;  3I53 A;  3R0J A;  5H6Q A;  4CZZ A;  4EGZ A;  3OY9 A;  3GTM J;  3FXK A;  2QM3 A;  4B3A A;  5GAD J;  2FD5 A;  4D7N A;  1FY7 A;  2CUJ A;  2IA1 A;  4JX4 A;  3S1R J;  1XTA A;  5HDK A;  3WE2 A;  5EGO B;  2DAO A;  1MSF C;  1IG7 A;  1P4A A;  4I01 A;  2NVY J;  3H9Q A;  2M3A A;  3PQJ A;  4YIR X;  2KZG A;  4LG3 A;  1EV7 A;  3M4O J;  2XAU A;  1P6R A;  1T95 A;  1XX5 A;  1FWZ A;  3LSG A;  2QUF A;  5DV5 A;  2VC0 A;  2Y48 A;  1S29 A;  3QPS A;  4EGY A;  2H1L A;  3CUQ C;  2ZJP F;  5HS7 A;  1Y56 A;  1ZN2 A;  1F36 A;  2R5Y A;  3ERE D;  4WF2 A;  1LE8 B;  2OC6 A;  2HEO A;  1XGM A;  2PFB A;  2E1C A;  1SFE A;  2MAB A;  2X6Y A;  1FBQ A;  1SFX A;  3TP3 A;  2VT2 A;  1WQ2 A;  2VKE A;  4CCJ A;  2JPC A;  5IPA A;  4CYD A;  2PN6 A;  1JTY A;  4FT8 A;  3E6D A;  4X0G A;  2JA5 J;  1TWA J;  2Y0M A;  2LC2 A;  4NBQ A;  2NRA C;  3G1L A;  1KU7 A;  5CLS A;  5EG0 A;  1TP4 A;  3AG1 H;  3BP8 A;  1QZE A;  2VPL A;  5M3M J;  1BC8 C;  3GFJ A;  4BHC A;  2K9L A;  2YS9 A;  3DKX A;  2X0L A;  4IX7 A;  2P81 A;  2ELJ A;  4C3J J;  1WRJ A;  2HZT A;  2JT1 A;  3HOT A;  4E7I A;  3OIO A;  2JRM A;  2L5Q A;  3N97 A;  5DTD A;  3J80 Z;  4B3X A;  4ZYD A;  3PSI A;  4ZTF A;  2MC3 A;  4YIF A;  4A3L J;  1R49 A;  1LDJ A;  1LVK A;  4EEF G;  3VYU B;  4BGD A;  2RC4 A;  3FM3 A;  3WG9 A;  1R5I D;  1I6H J;  1IN6 A;  4UB6 C;  2MC4 A;  1WFX A;  3L2Q A;  3T1B A;  2LYC A;  4G6D A;  4F55 A;  3BG3 A;  5ILS A;  2E36 A;  3OYH A;  2L9N A;  2IT0 A;  2WY8 Q;  3ASN H;  2F5E A;  1T39 A;  1W36 C;  4LMY A;  3OS2 A;  4IF4 A;  1NHA A;  1WWX A;  3O6B B;  4HNT A;  4HF2 A;  3V42 A;  2VKH A;  2RN7 A;  5GTH C;  2KJB A;  1T08 B;  2KMU A;  2L54 A;  1H88 C;  3TMO A;  1OLT A;  1LQ1 A;  5D5V B;  5FLX Z;  1OYI A;  2K02 A;  4LLN A;  3RKW A;  3N05 A;  2EIM H;  2XSJ C;  1W0T A;  3WGI A;  3OYL A;  4KN7 X;  2OAZ A;  2CW8 A;  3WG7 H;  1BW6 A;  3CC7 I;  2H6B A;  3MVP A;  1TTY A;  3QYE A;  1R4N B;  5EGO A;  1HA8 A;  3KZZ A;  3KYD B;  4IZZ A;  5E20 A;  4S04 A;  2HTS A;  3KCC A;  2ZXH A;  3ZGK A;  2DPD A;  4HV6 A;  3MZY A;  3QP6 A;  2CMP A;  4PSW A;  2DN0 A;  1I27 A;  3CCQ I;  1G59 A;  2KP6 A;  2RAE A;  2FOW A;  2A61 A;  2WWY A;  2P7C B;  2R4G A;  1FX7 A;  4G6Q A;  3H1C A;  4BJT A;  2P8T A;  4RS8 A;  1MNE A;  4DGW B;  1LE8 A;  3L00 A;  4Y13 A;  5E17 F;  1YIO A;  2HOA A;  2L4M A;  1OFC X;  1OR7 A;  4V19 K;  1MBF A;  2KRF A;  4UVA A;  2LD5 A;  4GO1 A;  3V8J A;  2XVC A;  1BR4 A;  5DCF A;  2ID6 A;  3LST A;  3C1D A;  2WBM A;  4O5V A;  1LVA A;  3J81 Z;  3H0G J;  5CQG A;  5FKK A;  2HYG D;  4FQG A;  1XB4 A;  2R7O A;  3CDL A;  3HL2 A;  3KYL A;  4ETS A;  3CJN A;  1R71 A;  2F6C A;  2QQA A;  3FDY A;  2GXA A;  1OCC H;  1FOK A;  3LMM A;  2EZK A;  2F4I A;  3HSF A;  1G3T A;  4F93 B;  2V7F A;  5EZH A;  1FSH A;  3B6A A;  1ZYR F;  2E1M C;  3BR6 A;  6PAX A;  1ZGW A;  3LSI A;  1MH3 A;  5ICF A;  3A0B C;  3R61 A;  5LGU A;  1RRJ A;  3GBG A;  1PP7 U;  1K78 B;  5IYD J;  2FNP A;  4PUS A;  5FB2 A;  5L3C A;  3FIS A;  2E1O A;  2X1E A;  4XLP F;  2DFI A;  2QKM B;  3P9K A;  2A5W A;  2E7W A;  4L18 B;  3HIF A;  2Z5U A;  2CW7 A;  2VE8 A;  2OCC H;  4M9S A;  4CIC A;  5E79 C;  5DM7 F;  1JXS A;  4RDU A;  5FKM A;  1WJE A;  3WTY C;  2WA0 A;  3UKG A;  4KFC A;  3S17 J;  1NG6 A;  3CCY A;  5F08 A;  3OOU A;  1K4T A;  2P5V A;  2XPW A;  3IUO A;  4BBS J;  3F9K A;  2DA3 A;  3GYH X;  1O57 A;  2CG4 A;  3F21 A;  2FMY A;  2OF7 A;  3S93 A;  4XLE A;  1A35 A;  2H1K A;  4BS9 A;  2HTJ A;  4KA4 A;  2XRN A;  2DYS H;  1RI7 A;  3GFL A;  3CUQ A;  2VJ5 A;  5IT9 Z;  1JUS A;  2LH9 A;  5IP6 A;  2CV1 A;  2HVR A;  4HPQ A;  2Q0O A;  2ZXW H;  4Q5S F;  3PO3 J;  3DKY A;  3OOP A;  3OYB A;  3FMS A;  2VBY A;  4JP0 A;  2FJ1 A;  2HZD A;  3O2P E;  4R1H A;  3U2R A;  1V4R A;  4PSX A;  1IRG A;  2N8G A;  4XKC A;  4IHW A;  1IDZ A;  4KIF A;  4KT6 A;  4LJZ F;  3L7W A;  1X1A A;  4B48 A;  4NNJ A;  5L3B A;  3HXL A;  5DD4 A;  2LBF B;  2QSF X;  4H4K C;  3S1M J;  4MTD A;  1S8N A;  1GV5 A;  3BRO A;  1U9N A;  3NAR A;  1FP1 D;  4R8H A;  1E3O C;  4E7H A;  3DBH B;  2M4K A;  3DPL C;  3CTA A;  4RAY A;  3C3W A;  2OA4 A;  4HX4 A;  5EZG A;  4CCL A;  1IRZ A;  2GA2 A;  1LDK B;  1U8R A;  3QPL A;  2HDW A;  4L9N A;  2M1B A;  5GPC A;  1VQ5 I;  4E7K A;  1Z91 A;  3VSK A;  3OL4 A;  4RM2 A;  5D4R A;  4UB8 C;  3H5R A;  4CUG A;  1LEA A;  1GUU A;  4KDP A;  3F3X A;  1YI2 I;  1UFM A;  2BVM A;  3M1E A;  4LIV A;  3W2V A;  4CO8 A;  4HNU A;  2ESH A;  2IS1 A;  2AQE A;  4UUS B;  4XKV A;  3U9G A;  3F72 A;  1X19 A;  3OYG A;  2E2I J;  2ADU A;  2HU9 A;  3DF8 A;  1E0E A;  5FKL A;  1SMT A;  2CH0 A;  2CRG A;  1ZRE A;  1K78 A;  2DJI A;  4Y33 A;  1NH3 A;  3U21 A;  3TO7 A;  1ETX A;  3GO5 A;  4KMU X;  5HS9 A;  4IOC F;  3H3U A;  3QYB A;  4BBR J;  2AS5 F;  1K6Y A;  1QO0 D;  1UST A;  5TRD A;  1GLN A;  3ZP5 A;  1YFH A;  1JUM A;  3SEQ A;  3ZQQ A;  2C6Y A;  3H0D A;  1Z7L A;  2DMP A;  2XAS A;  2RQP A;  2DMT A;  2MLK A;  3S32 A;  1FBS A;  5E3M A;  2XAJ A;  2IGO A;  2EFQ A;  1W5T A;  1ZG3 A;  4CYC B;  1F4K A;  1UHM A;  3I64 A;  5H20 A;  1QZY A;  2OCE A;  3S3N A;  1ZR4 A;  1PUF B;  2GBY A;  3B73 A;  4WXD A;  2QZ8 A;  3AG3 H;  1ON1 A;  3SDG A;  2JVH A;  1BI3 A;  2HYJ A;  4OMY A;  3PL8 A;  3QU6 A;  1UG0 A;  2IS4 A;  3IP4 B;  2A6T A;  5AIQ A;  5FKO A;  4HDV A;  2IA0 A;  3B02 A;  2ZXI A;  2CQQ A;  3ZXS A;  1OKR A;  3FZV A;  3REO A;  4G8X A;  1R36 A;  2VKV A;  3BR5 A;  1IC8 A;  1FPQ A;  4ASN A;  2EIL H;  3M1C A;  2R93 J;  3DLL F;  2AO9 A;  4M3D A;  2JTV A;  3MZ8 A;  1D5V A;  1D0Z A;  1XC5 A;  2LRD A;  4EJO A;  4IKF A;  2DOA A;  2YPR A;  3G3Z A;  4PGG A;  3OR2 C;  3VOE A;  3IRQ A;  5DYM A;  2LBF A;  4A3C J;  2IW5 A;  5J8F A;  3HSE A;  1W36 D;  2IRF G;  4L9V A;  3W2A A;  3P7N A;  1O3R A;  1ZGA A;  2D1H A;  1B9N A;  1SFK A;  1E2X A;  1D3Y A;  4AM3 A;  2BVL A;  3TO6 A;  2UXN A;  2BY2 A;  4GRI A;  3I4P A;  4DZJ A;  3TP0 A;  3HGY A;  2QBY B;  2YX4 A;  4HDU A;  2P4W A;  4BNC A;  4OIP F;  5EYR A;  2BE5 F;  2V79 A;  3CUO A;  4AIJ A;  4NHJ A;  2L7K A;  1CGP A;  2DPU A;  2VOP A;  2VJ4 A;  1S7E A;  3NAU A;  1LEB A;  4A3M J;  3MFK A;  4Q48 A;  1R7J A;  1RES A;  4LB6 B;  4XMY A;  2HXO A;  3VSL A;  5IY5 H;  5EF6 A;  4XL9 A;  5FFZ A;  3U1D A;  4DW6 A;  4EQQ A;  3GTG J;  4XON A;  4RGR A;  3G2B A;  2CFX A;  4WX9 A;  4M6Y A;  1QVT A;  3TOB A;  1T98 A;  3L09 A;  3WGH A;  5ICC A;  4A0Y A;  4UUS A;  4D5C A;  1X2M A;  1OYY A;  2FBI A;  4P9F A;  1DUX C;  3I4N J;  1TWC J;  1PVE A;  5F0C A;  3WTU C;  1VQN I;  5JHF A;  3VWB A;  5KHD A;  4CCM A;  1ZQ3 P;  1P7J A;  1BOB A;  1YE9 A;  1Y8R B;  3RPU D;  1MW7 A;  3JRE A;  2OV7 A;  4QLC U;  1JKR C;  2QEN A;  5IP7 J;  2KRH A;  2ELH A;  3HYI A;  3OS1 A;  1MMN A;  2WAQ A;  1HST A;  4M71 A;  5KK1 A;  3K69 A;  3ZQG A;  1UCR A;  4XSZ F;  5JLX A;  4WWC A;  3K4C A;  1EH6 A;  5CVJ A;  5GAG J;  2R7V A;  4YG2 F;  3BR0 A;  3ZMD A;  2HXI A;  4BE0 A;  1VQ4 I;  4GYG A;  1I3A A;  3PUB A;  5LHG A;  2Z3Y A;  2CV0 A;  5BQT A;  1IXC A;  2QVO A;  4XIC A;  4UY8 I;  1TNS A;  4CYC A;  1R5G A;  2NVT J;  5F64 A;  1PUF A;  4Y15 A;  2BW3 B;  1R6R A;  2P5K A;  1ZRF A;  1QRY A;  3ECH A;  1D0X A;  2NOJ B;  3FWE A;  3FK7 A;  4LIU A;  3ZMV A;  4LG0 B;  3GX4 X;  3F8N A;  3W6K B;  3ABL H;  5D8L B;  1FMW A;  4Y52 J;  1N75 A;  2LDU A;  2DCE A;  3CCE I;  5M3F J;  4MHG A;  4I0A A;  1U5T C;  1JHF A;  2EFO A;  4U7B A;  3AG2 H;  3HC7 A;  3G1M A;  1TQP A;  3MKY B;  1VTN C;  1Y6I A;  1HDP A;  5HS8 A;  1Z3X A;  3ERM A;  2B0L A;  4OMZ A;  3QYF A;  2EH3 A;  5FRM A;  3H36 A;  3IC7 A;  4ZZD A;  5EJC A;  2O8K A;  4FET A;  1LDD A;  1B8I B;  2GM4 A;  3RZO J;  4UUV A;  2ZJQ F;  1ZTR A;  4A3I J;  4IHS A;  4A12 A;  2H94 A;  2G7H A;  3A03 A;  2WTE A;  3VEP A;  2EA4 A;  3E1S A;  2O5R A;  1DQU A;  4FE7 A;  1JE8 A;  3GFM A;  1JTX A;  1ZAR A;  1WJD A;  4ITV A;  2WAQ N;  3ASO H;  3FIW A;  2ZXJ A;  2V1U A;  2VOO A;  2QBY A;  4WXH A;  3CLO A;  1U9O A;  1SD7 A;  3IV5 A;  1PUE E;  1W5C C;  2DA1 A;  4RGU A;  5D5W B;  1K79 A;  1H8A C;  2CFO A;  3FMQ A;  1P9Q C;  2NS0 A;  1J09 A;  4UHT A;  1TLH B;  1J7K A;  1STZ A;  5CKT A;  3OYD A;  3TBI A;  2GOM A;  3PFI A;  4IJA A;  2Y9Y A;  4WCG A;  3MKZ A;  2ZME C;  1LKX A;  2DBB A;  3HRU A;  2O61 A;  2VXZ A;  4XRF A;  3C18 A;  3T8R A;  4C30 A;  4Y7N J;  2HVQ A;  2IPQ X;  4IHT A;  1WJB A;  5EEH A;  1HKQ A;  4HF0 A;  4LLG F;  1OIS A;  5E8I A;  1F9N A;  1TWG J;  5HNF A;  3LA7 A;  3SFZ A;  2BXY A;  4IHV A;  3KX2 A;  2JMW A;  1RPW A;  2XPU A;  1IZ1 A;  1HSJ A;  3MQ0 A;  5FKN A;  3FXJ A;  2R3S A;  3VB2 A;  2RQQ A;  1I5Z A;  4BQN A;  2JSC A;  3TDU C;  2G7U A;  3FXQ A;  4EVI A;  2CQN A;  3CDI A;  4CCK A;  1DU0 A;  4IEJ A;  3H5N A;  2FNA A;  2EBI A;  2W48 A;  2L9V A;  4BQO A;  1IAW A;  2BXZ A;  5TIS C;  4KNY A;  2Z99 A;  1JT6 A;  3OYK A;  2NAZ A;  2XV4 S;  2NNN A;  4I0B A;  3ELK A;  3F6O A;  5ILV A;  1WJC A;  4XKW A;  3U1K A;  1ETY A;  5GTI C;  2MW8 A;  2PI0 A;  3QP5 A;  3WOD F;  1RET A;  3K4J A;  3IAM 2;  4OIN F;  2LR8 A;  3A4C A;  2BW3 A;  3K0L A;  2IGM A;  2ECB A;  1TBX A;  3I59 B;  4LG0 A;  1R00 A;  1X2N A;  2AXL A;  1HOM A;  4E7S A;  2YU9 J;  1IO2 A;  3OYF A;  1SD5 A;  2A07 F;  1T0F C;  4H0E A;  3VYT B;  3V8L A;  1QA6 A;  4CCN A;  3LSM A;  2YSR A;  3CJQ B;  3SDB A;  4BJ5 C;  4P55 A;  2ETH A;  3C2B A;  2MH2 A;  1P4W A;  2PMU A;  2EFW A;  3BTI A;  3ZQI A;  1IW7 F;  1RC9 A;  5KVR A;  1B8I A;  3RKQ A;  4Z6Y A;  1BR1 A;  5FD5 A;  1UJ8 A;  4RLF A;  4AU7 A;  2HGC A;  2COM A;  3LOC A;  2EFP A;  4PZJ A;  2CV2 A;  5AON A;  3SHF A;  1ZG1 A;  1BIA A;  1RKW A;  1MND A;  4RM3 A;  4ZYA A;  5M5Y J;  1MJB A;  5BS6 A;  3WHB A;  5DM6 F;  3TL4 X;  2QCO A;  3ZMT A;  1Z0X A;  1YHQ I;  2DMU A;  3DXJ F;  3S3O A;  2OJE D;  2E19 A;  5D5U B;  4KT5 C;  3OSF A;  2XKP A;  1FIP A;  5TJJ A;  4J19 A;  3DQV C;  3FXL A;  4U88 A;  1IXS B;  2VXD A;  1QGP A;  3HEF A;  4II3 A;  3CCU I;  4BY1 J;  1TT5 B;  2XB0 X;  1IUF A;  4BE2 A;  3GTJ J;  1XCB A;  2ZC2 A;  4I99 C;  2K9M A;  2XPV A;  2ACJ A;  2E1N A;  2Y75 A;  4NB5 A;  1ACI A;  5K7Z A;  2P6S A;  2KDZ A;  2M7A A;  3HRS A;  3HTS B;  3CMM A;  1YS6 A;  2W1O A;  3GLX A;  3VYS B;  4I09 A;  1I50 J;  5BNG A;  4OOI A;  3PJR A;  3JRI A;  3TW7 A;  1BJA A;  4CSW A;  1QU3 A;  1KYW A;  4BKX A;  5E3O A;  3BZC A;  1IDY A;  2M9H A;  2RDP A;  3LSH A;  3HG9 A;  2JA7 J;  2KKO A;  2B63 J;  2DI3 A;  4HRI A;  1T6S A;  3S15 J;  5JVT A;  4CCO A;  1Z6T A;  1S5L C;  1BN5 A;  4V2F A;  5GP9 A;  4HAM A;  5LGN A;  2H8R A;  2L01 A;  5J1R A;  1VQ7 I;  2CQ7 A;  4A3J J;  2FBK A;  4JOM A;  3E6B A;  4EV0 A;  4ZJZ A;  3OYJ A;  1Z67 A;  3CP8 A;  3KET A;  1WVR A;  5CPR B;  1QHG A;  1Y0U A;  3I59 A;  1OCO H;  5HLH A;  1V5G A;  4JQF A;  1YJW I;  1LFU P;  2UUZ A;  3OYI A;  1M1E B;  3E5Q A;  1X3W B;  1K83 J;  2OBP A;  4QSH A;  2VOD A;  1VQ9 I;  2H27 A;  3AKZ A;  1FOX A;  1IN4 A;  1KA8 A;  3ZQC A;  2D5V A;  1S7A A;  4AD9 A;  1GXQ A;  4DZP A;  2DOE A;  2XDV A;  2K7L A;  5J8C A;  1RNL A;  1MMG A;  5C44 J;  1TW3 A;  1P2F A;  1YS7 A;  4XLA A;  1ZGJ A;  3BJO A;  2IS2 A;  3FX3 A;  1JI8 A;  4EMS A;  1D8J A;  3IKV A;  3ZOB A;  1YJ9 I;  4ZC3 A;  3K6G A;  3BQY A;  5A2Q Z;  2X1C A;  2XF5 A;  1T33 A;  3L2R A;  3IKT A;  3I3L A;  5KNL A;  3GTQ J;  3RKY A;  2STW A;  4U7D A;  3HDD A;  1D1C A;  1OQY A;  1ZLK A;  3K4M A;  3S2H J;  3OYE A;  3OWT A;  4AYB A;  1O3Q A;  5FRO A;  3A01 B;  5KCM A;  3CMA I;  4GYI A;  1VND A;  2A3S A;  1RKT A;  4WXC A;  4M3F A;  3GXO A;  3EYY A;  3ZMZ A;  5LHH A;  3DV8 A;  1NG7 A;  2UWM A;  2CQX A;  2DOF A;  3CUQ B;  3VPR A;  4FCY A;  3DBL B;  1FLI A;  1CQT A;  1R58 A;  1XGO A;  2DFF A;  1Z3Y A;  1UHS A;  3F8M A;  4MQV A;  5LLQ A;  1N77 A;  4DIQ A;  4HX7 A;  2KIU A;  2K85 A;  1MMA A;  4M3G A;  3F8F A;  3MKL A;  2EFN A;  3OL3 A;  3V4G A;  1XSD A;  3S8P A;  1HDD C;  3QPT A;  4M6V A;  1OMI A;  4IRH A;  4LFU A;  1UAA A;  5B5E C;  3RYP A;  4NQW A;  4G9Y A;  1GT0 C;  1WJ5 A;  3EDP A;  2DOD A;  1FT9 A;  1P7I A;  2W85 A;  4EAT A;  4GGG A;  3H9G A;  2E5N A;  4HF1 A;  3GW2 A;  5J4V A;  4F7Z A;  4MEY F;  2LSO A;  2DFH A;  2EIJ H;  1ITY A;  3A0H C;  4IO9 F;  1OCT C;  2FQ3 A;  1T0F A;  2VQC A;  2XAG A;  2K86 A;  3F8B A;  2JRT A;  2WV1 A;  3KEQ A;  4G6T B;  2WV0 A;  3E0J B;  3CCM I;  2I8D A;  4L9J A;  4PJ0 C;  2IBD A;  2KL4 A;  5LGT A;  3BOQ A;  5FFX A;  3EUH C;  1U78 A;  4AYB N;  3L2U A;  2KIS A;  2VAS A;  2JA2 A;  5FO5 A;  3QAH A;  1YG2 A;  2M2E A;  4YEL A;  1MIJ A;  9ANT A;  4C9Y A;  1VQ6 I;  1QZZ A;  2IGN A;  4GXO A;  2M8G X;  3ZQ7 A;  3DWL E;  4HA8 A;  5LRR A;  1B6A A;  2GOX B;  3SJM A;  3KP6 A;  2RNG A;  2Y69 H;  1DP3 A;  1BBY A;  2HKO A;  4ON0 A;  3PNV A;  4XLN F;  4XOT A;  1Y0N A;  1XCV A;  3OR1 C;  4NDL A;  1MJA A;  2EIK H;  3QU3 A;  3LNQ A;  3WTS C;  2LFB A;  2LY2 A;  1K6O A;  2X1D A;  1YOV B;  4BH9 A;  3KZY A;  5D4S A;  2WAF A;  1HW1 A;  1W4M A;  4P96 A;  3CO6 C;  2M30 A;  3DBR B;  2F5D A;  3DU5 A;  4XN3 A;  5K5R A;  3G6E I;  2ZFU A;  4ENK A;  1H89 C;  4UV9 A;  2HR3 A;  2QF7 A;  4XM3 A;  2TCT A;  4R79 A;  2KIQ A;  3A01 A;  1GXP A;  3SFI A;  1B59 A;  1F1Z A;  2DTR A;  3CC2 I;  2GA1 A;  2NVX J;  3K1P A;  3HOZ J;  1U8B A;  5C3E J;  4HQE A;  1K61 A;  3GTO J;  3W3C A;  4BAY A;  2VJI A;  4KJZ A;  2XSD C;  1POG A;  2J5O A;  3OMY A;  3L1P A;  3RTR A;  5C4X J;  1LNW A;  4BE1 A;  2E2H J;  1GVJ A;  1R22 A;  3K70 C;  3CCV I;  1UEL B;  1VQL I;  4KMF A;  2YU3 A;  4KIC A;  1G3S A;  1OCR H;  3WTW C;  1WCM J;  2NYX A;  2O7O A;  1IRX A;  4CDG A;  4M6X A;  3JRF A;  3H3V K;  1BR2 A;  1X4O A;  2DU9 A;  3WU2 C;  2J5P A;  1CF7 B;  4UVB A;  3HJE A;  2G0E A;  4XLC A;  4OIQ F;  2IJL A;  1EF4 A;  3G73 A;  3D0S A;  3GTL J;  3BTC A;  1T2K A;  1YQA A;  2NXN B;  2R7R A;  2Z1D A;  3I0T A;  2NOG A;  1TWF J;  1S6L A;  2V6C A;  4M73 A;  3IAS 2;  3M07 A;  4HQM A;  2FXA A;  3NWT A;  3CME I;  1RZ4 A;  5ERI A;  2R7T A;  5CQE A;  5GAH J;  3PNY A;  2VE9 A;  3COA C;  2M87 A;  1XG1 A;  2E35 A;  5FD6 A;  2KIF A;  2E1M B;  2V26 A;  1KZH A;  3DTK A;  5JI6 A;  2DA4 A;  3RQI A;  2IVM A;  1MJ9 A;  2GLO A;  3CC4 I;  3Q9S A;  1A6I A;  1X1B A;  3WTT C;  3OYC A;  2MD0 A;  4F91 B;  2DA6 A;  5L3G A;  1XDU A;  4U87 A;  2E2J J;  5LRS A;  1V54 H;  4ENN A;  2ZSH B;  3RI4 A;  3V7C A;  1X3U A;  2CQK A;  3SYT A;  3HSR A;  2IP2 A;  2DYR H;  2HFH A;  4C2U A;  1ZK8 A;  4IL6 C;  4RGS A;  3C2H A;  3HUG B;  3TED A;  3N4M A;  1YLF A;  2IA2 A;  3LSJ A;  2G9W A;  2RVC A;  1HQC A;  4JBA A;  1Q1H A;  1WJA A;  3HTU A;  2R7S A;  3RKX A;  3ZMU A;  3W6V A;  2RNJ A;  5F1J A;  1KYZ A;  1Z9C A;  1O7L A;  1SC7 A;  2D45 A;  1PP8 F;  3BPV A;  1WI9 A;  2WC2 A;  1GDT A;  1I6X A;  5D8K B;  2PMZ A;  3G71 I;  4P9U A;  1YJN I;  1AKH B;  5K7H A;  3LA3 A;  1VQK I;  1W7P D;  1DGW Y;  3IRR A;  5J4Y A;  1HCR A;  4OWR B;  3HOU J;  2AQF A;  2FRH A;  1K7A A;  2DTZ A;  1MNM C;  4EJT A;  1X1C A;  4BU2 A;  3KEY A;  4RAZ A;  2EB7 A;  3JRC A;  3JAM K;  1L0O C;  4RB3 C;  3RPU A;  4N9I A;  4BL0 B;  2R7U A;  4J01 A;  1UG2 A;  2QYO A;  3GLL A;  1JGS A;  5TGT A;  2HYF A;  3TDZ C;  1ZKG A;  2A6E F;  4A5N A;  2XAQ A;  1CF7 A;  5J1Y A;  4M74 A;  5LBQ A;  2E34 A;  1IGN A;  4IHY A;  4A3G J;  2BOL A;  4A93 J;  1FEX A;  2FSW A;  2LF8 A;  4G7O F;  2LLK A;  5E3N A;  4ANJ A;  3M7G A;  1BI1 A;  3D1N I;  3BCA A;  3EUA A;  3HPH A;  2V1D A;  2ZNY A;  3BR3 A;  2FX0 A;  3KLO A;  3HBL A;  4EJW A;  4U0V A;  3GEZ A;  1WHU A;  2XUB A;  1TL8 A;  3A1Y A;  2ZSI B;  2JZY A;  3DU6 A;  2V4J C;  1KU2 A;  3S14 J;  1ETW A;  3KP5 A;  3LFK A;  4XNF A;  5F0F A;  3V7R A;  2PMZ N;  4LIT A;  4BJ6 C;  1G2H A;  1ZRD A;  1KU9 A;  1SMY F;  4LK1 F;  3GWZ A;  1BW5 A;  1FZP B;  3LQR A;  3M3Y J;  1I3Q J;  2COB A;  3W2W A;  1SAU A;  1Y8Q B;  2Q2E A;  2YR2 A;  2UZK A;  3WHC A;  3KE2 A;  3QRF F;  5EEA A;  2V6E A;  2Q1Z B;  1A5J A;  1MDM B;  2NS8 A;  1TQI A;  1LFP A;  1FJL A;  2R7Q A;  4RBO A;  4RAF A;  2HOT A;  4C2T A;  2O03 A;  5F27 A;  2EK5 A;  1FOW A;  1MBG A;  1TT0 A;  3HUG A;  4A0X A;  3GTP J;  3FBN B;  3H9J A;  1HC8 A;  1OPC A;  2DXI A;  1G3Y A;  4MEX F;  5B3S H;  3ZQL A;  2NVQ J;  2R7Z J;  3R60 A;  3BTL A;  3ZCO A;  2JVG A;  1GV2 A;  1QNT A;  2K40 A;  2DT5 A;  3FXR A;  3R4K A;  2A6H F;  1P92 A;  1TNT A;  4I02 A;  4AID A;  1KQ8 A;  3EPZ A;  2JJ7 A;  2M34 A;  2QQB A;  3Q0V A;  2DO7 A;  2EZI A;  1HW5 A;  2LMD A;  3IWZ A;  4HEA 2;  4MGR A;  4UNO A;  1EA3 A;  1Z21 A;  2CUZ A;  2KIM A;  3GZN B;  3EYI A;  4A5M A;  1ZH5 A;  2F5C A;  1AOY A;  4MNU A;  1XDS A;  1YX5 A;  4AC0 A;  2L2O A;  3K2Z A;  1O3T A;  1U6G A;  1AKH A;  2HQ5 A;  1WKM A;  3M8E A;  1JHH A;  2TRT A;  2STT A;  3MD2 A;  4BAC A;  4B09 A;  1W1W E;  2O0Y A;  3SEZ A;  4BEH B;  3J80 K;  4FTH A;  2A69 F;  3J7Y J;  1V5F A;  1APL C;  5DCM B;  4DBQ A;  3EUK L;  4ZDL A;  2H8W A;  2L7Z A;  2L0K A;  2P5L C;  1BL0 A;  3GZ6 A;  2KQR A;  1G4D A;  2VIX A;  2VL8 A;  4F52 A;  2HWV A;  2OQR A;  3CF2 A;  4ZYH A;  2EJR A;  2DA5 A;  2Y31 A;  5LFA A;  4Q4Z F;  1S72 I;  2XGC A;  4C3I J;  2MD5 A;  5ICG A;  4WK8 F;  1YRN A;  3KZI C;  1XMK A;  3BY6 A;  3ABK H;  5K1Y A;  5FRN A;  4YFX F;  1ZRC A;  5LHI A;  4FAS D;  2K5C A;  2XRO A;  1LUJ B;  4HW0 A;  1UMQ A;  5FLX K;  1IN7 A;  3K70 D;  1OCZ H;  4EJU A;  4A69 C;  3H35 A;  4ZTJ A;  4QIW N;  1MSE C;  2LG4 A;  2HQR A;  1Z1D A;  2X9D A;  2A05 A;  1IF1 A;  3FKJ A;  4AIK A;  3OYA A;  1YX3 A;  1F43 A;  1HKT A;  1WPK A;  5GPA A;  2ISZ A;  4MQ9 F;  1MDM A;  1VI0 A;  2K3F A;  3RQ4 A;  4D9J A;  2E60 A;  4HBL A;  1BOA A;  2EWN A;  2L7M P;  3DTI A;  1YO5 C;  1ORK A;  3K1M A;  4EJV A;  2KHM A;  3JRB A;  4A6E A;  3OYM A;  2Y2Z A;  1EH8 A;  2GXG A;  3FBI B;  2L3D A;  3O8G A;  5DEQ A;  2KPM A;  2DFE A;  2PQ8 A;  4FHT A;  2ZJ2 A;  3ESW B;  2BY0 A;  4QPO A;  4N9H A;  3RDI A;  4YFN F;  4I98 B;  1T8I A;  2D2W A;  2OZU A;  3SXY A;  3CP2 A;  5BOX A;  3NQO A;  5DDG A;  4A3B J;  1H9G A;  1V5E A;  2CS3 A;  5KAI C;  4B4C A;  3J81 K;  1U5T B;  4IPA A;  3ZN1 A;  3K1N A;  1BI2 A;  3DCF A;  4ESJ A;  1WH5 A;  1KQ0 A;  5K5Q A;  1UHW A;  3TKY A;  2Z33 A;  1NTC A;  1I1G A;  2V1X A;  2BYV E;  1DU6 A;  4AIH A;  2NS7 A;  3SQN A;  4BEH A;  3CCS I;  3JR9 A;  5HLI A;  4A3K J;  4HNV A;  2MG4 A;  3R6S A;  2FOK A;  2K4B A;  5DCM A;  1I1S A;  2R7W A;  4XK4 A;  2QLZ A;  3ZQF A;  3DLA A;  1XSX A;  3IH2 A;  3PIP F;  3FF5 A;  3KFW X;  2M45 A;  3QOP A;  2K9S A;  3QPH A;  4JYK A;  4XKB A;  2CU7 A;  2X6W A;  1Z77 A;  2KFD A;  4UUT A;  1T56 A;  2I10 A;  3DPT A;  2RRE A;  1ZAO A;  1UZC A;  2OQG A;  2ZME B;  2EV0 A;  2BY1 A;  2BBY A;  2MGQ A;  4K2E A;  1V3F A;  2HNH A;  2Z2S B;  3Q9V A;  1EH7 A;  2KDO A;  3L9F A;  2OTJ I;  4RB0 A;  2JUC A;  3K4L A;  2LVS A;  3LL7 A;  1UB9 A;  2R0Q C;  1L3L A;  2FU4 A;  3A02 A;  3BG7 A;  4ENM A;  4B1R A;  3CLQ A;  5E1Z B;  4W1U A;  3ZN0 A;  2QSH X;  4B8X A;  5IT9 K;  1XSV A;  2GIZ A;  4HX8 A;  3JCU C;  1D0Y A;  2H6C A;  4BHB A;  4KIB A;  2F5V A;  4A3F J;  3LSK A;  3UR3 C;  2F4M B;  3RZD J;  3FHZ A;  4I2O A;  5E8G A;  1Z05 A;  4LLL A;  2OD5 A;  4U0W A;  4DOZ A;  1U2W A;  3V8K A;  1YW7 A;  1MBH A;  2QWW A;  4N4O B;  3PSF A;  3WU1 B;  2KJC A;  1MBE A;  1USS A;  4ZYE A;  2VB6 A;  4NQW B;  3HOX J;  1LFB A;  2BY3 A;  5H6R A;  3S2D J;  2PMH A;  3UNG C;  1K4S A;  4C3H J;  5IYB J;  3SZG A;  1G6N A;  3SZP A;  2VLA A;  4G7Z F;  3HOV J;  2TDX A;  2L9R A;  3KP7 A;  5ILU A;  2E7X A;  4ABZ A;  1SFO J;  3WU0 A;  3X2Q H;  2HPM A;  1DPR A;  3K2A A;  1U5T A;  2ME6 A;  1QPI A;  1B72 B;  4AUX A;  5JFR A;  3HRM A;  4ESF A;  1RR8 C;  1IRF A;  2DQL A;  4F3Q A;  3BZK A;  2EV6 A;  1RUO A;  3KEO A;  1FP2 A;  3PUF A;  1FC3 A;  2Z9O A;  3WTZ A;  1DP7 P;  4YRV A;  1RR7 A;  2R7F A;  1BM9 A;  2A68 F;  2MLG A;  4IQ4 A;  4MFD A;  3JRH A;  4KIS A;  3DEU A;  5BPI A;  2XAF A;  1SVL A;  5J3L A;  4BQA A;  1WSU A;  1D1A A;  4RGX A;  4A2U A;  2EA2 A;  4ZH4 F;  1S3J A;  3HZJ A;  1WGX A;  4P5O A;  3BG5 A;  2JSP A;  2MFZ A;  5JHU A;  1VQ8 I;  3GF2 A;  4I6Z A;  1G3W A;  4A3E J;  3A2K A;  4LK0 F;  5CJ9 A;  2X51 A;  2R7D A;  1VQO I;  2ZME A;  1OCP A;  4Y4R A;  5LEK A;  3JRG A;  3FXM A;  3IWF A;  1IN5 A;  3PQK A;  3Q3S A;  1X58 A;  3QQA A;  4D5F A;  1PDN C;  2BHZ A;  2HOS A;  2O9L A;  5M5W J;  2XB5 A;  5DUK A;  2LOO A;  4ZDP A;  3LQQ A;  3F23 A;  4GFB A;  3CZ6 A;  3C2G A;  1X1P A;  1U3E M;  2FF4 A;  4RAG A;  1J59 A;  4PDK A;  2XAH A;  3JRD A;  4A6D A;  3DEE A;  3DFG A;  2HPI A;  2DJN A;  2ID3 A;  3KP3 A;  2VI6 A;  2UV1 A;  3QOD A;  2I5U A;  2EIN H;  4BHP A;  5HVQ C;  1SFU A;  1YW8 A;  5EEG A;  4QPQ A;  3SZT A;  5DUI A;  1JJ8 C;  2EQR A;  2CWE A;  2FEZ A;  2ZJR F;  3E6C C;  2EV5 A;  4BUP A;  2HI3 A;  2OU2 A;  2ELK A;  3FK6 A;  3LAP A;  2JWT A;  3FHN A;  1WZ2 A;  1ON2 A;  5B1B H;  4XQF A;  3MKW B;  4BQQ A;  2MYS A;  2GWR A;  2W24 A;  3HHG A;  2OUM A;  1HBX G;  2ISY A;  1FMV A;  3RYR A;  2CW0 F;  3GZ5 A;  1ZG5 A;  3BDD A;  2VJJ A;  1XMX A;  2X48 A;  5K5O A;  2LF7 A;  4LD5 A;  2CYY A;  1J9I A;  2FML A;  4X6A J;  4RA2 A;  2XGD A;  2AHQ A;  1E3P A;  5FLM J;  2BZT A;  3QWL A;  1TWH J;  2LTP A;  3KPH A;  2CUE A;  1B72 A;  5CVR A;  3E7L A;  1W7P B;  3OV8 A;  4GCV A;  1DPU A;  3NRV A;  4B44 A;  3I5U A;  2XF7 A;  2W84 A;  1FNN A;  3E5U A;  4OAZ A;  1BC7 C;  2XIG A;  4ZZL A;  5E1X A;  3T5X A;  3TOA A;  5CYV A;  3GCM A;  4NC7 A;  5L3D A;  2R5Z B;  3VYR B;  3E97 A;  3FMR A;  3TW6 A;  5CVI A;  3WTX C;  1TW2 A;  3KLN A;  4BDZ A;  2HDC A;  2PJR B;  4IOA F;  4E6K G;  1SD6 A;  4XLH A;  3I9V 2;  4ZYG A;  1Q1V A;  2VBX A;  1WJF A;  1S9H A;  4FX4 A;  3GFI A;  3JRA A;  3S3M A;  4RLQ A;  1XMA A;  2B7E A;  5E1W A;  3F22 A;  2DMN A;  5HLG A;  2XHK A;  4ZDO A;  2PBI A;  4XID A;  5JVG F;  1LB2 A;  2VON A;  3AG4 H;  2CGP A;  3ZPL A;  1NK3 P;  4DQ2 A;  2DT7 B;  5IP9 J;  2GXB A;  4OIR F;  1IV6 A;  2ZO4 A;  4OU0 A;  2DA7 A;  3CMY A;  4W97 A;  5DS9 A;  2W00 A;  5BPD A;  1A6Q A;  2XC7 A;  1YYV A;  3DP7 A;  3IH3 A;  2DDB A;  4LGW A;  4M9X A;  4RB2 C;  1BA5 A;  3TO9 A;  3D5L A;  1VFC A;  3VOD A;  3BT9 A;  2Q8K A;  1FYM A;  2FE3 A;  3BR1 A;  1IJW C;  3Q5F A;  5HLT A;  1D1B A;  5E3L A;  1D8K A;  3IH4 A;  3I71 A;  2PEX A;  4EM1 A;  4JX6 A;  1MBJ A;  2ESN A;  1OJL A;  2BEO A;  4DJA A;  2LNB A;  2V9K A;  2VQG A;  4HSR A;  4XRS G;  3MWM A;  4CA0 A;  1TC3 C;  3CQZ J;  1KQ9 A;  2FA5 A;  3HB9 A;  2JK3 A;  3KP4 A;  4CH7 A;  1P4X A;  3H5A A;  3HKZ A;  3D5S C;  4B47 A;  4S0H B;  5CVV A;  3AL0 C;  1B1B A;  2VPR A;  2M7B A;  5E18 F;  2AXT C;  3CJT B;  1S7O A;  3JSP A;  1H9T A;  1OYW A;  4M9Z A;  3TQN A;  2KZV A;  2GQQ A;  4G94 A;  1HW2 A;  2DK5 A;  4OIO F;  1YW9 A;  3I56 I;  1R5H A;  4TV7 A;  5H2F C;  1IV8 A;  3K4B A;  2HQA A;  3H3Z A;  2KRC A;  1RIO H;  4BXX J;  3K4N A;  3HM5 A;  2NVU B;  5JR3 A;  2LK2 A;  1SD4 A;  1W7P A;  3B6C A;  4PFP A;  3L2W A;  1GVD A;  5HDN A;  2D1V A;  3W6J B;  2JQ7 A;  2OTL I;  2X6X A;  4HLX A;  4OAY A;  3WE3 A;  1X4P A;  3K9T A;  5FGM A;  1VZ0 A;  3C7J A;  4PK4 A;  4XLF A;  1SEU A;  5EDN A;  1Y1V J;  4PJJ A;  5ED4 A;  1A31 A;  1RUN A;  4AVZ A;  4DYC A;  1ERD A;  2FQ4 A;  3OYN A;  3RIR A;  2R5Z A;  3LWF A;  3M9A A;  2Q2E B;  2RV8 A;  1FBU A;  4IVN A;  1VF9 A;  4XOR A;  4CZC A;  3ABT A;  4MFE A;  2PJR A;  1WH7 A;  1XGS A;  4O6J A;  1MD0 A;  1V55 H;  4BDY A;  1ENH A;  5F04 A;  4I76 A;  2ZNZ A;  3EET A;  3V7S A;  3MN2 A;  3ULQ B;  4FE4 A;  5J40 A;  4HV5 A;  1VQM I;  3FXO A;  3ML6 A;  1AHD P;  1O3S A;  3Q0U A;  1R23 A;  3HKZ N;  4HST A;  4UXN A;  1U0J A;  1ZEL A;  4PJL A;  4NC8 A;  4MTE A;  1AWC A;  1XGN A;  4MLO A;  1Y1W J;  3WGG A;  2CO5 A;  2LRE A;  1JKP C;  1QBJ A;  3S1Q J;  4XR6 A;  2CUF A;  3PO2 J;  1ZLJ A;  3EQL F;  2Z16 A;  3ABU A;  3BCB A;  3PIO F;  1MH4 A;  4M3E A;  4EM0 B;  3QOE A;  2WB1 A;  2WAD A;  2VBZ A;  2UXX A;  3I54 A;  5ICE A;  1REP C;  1E3H A;  3RJP A;  2QEX I;  1JJ6 C;  3OS0 A;  4IQJ A;  2EZL A;  3JTH A;  3FXU A;  1ETO A;  2M4G A;  2IAI A;  4L5E A;  2EZH A;  3HOY J;  4U0Y A;  2K9N A;  5J1U A;  2JA6 J;  4DBR A;  2IGK A;  2ZBK A;  3AL0 B;  3S16 J;  4HLY A;  2HKX A;  2JUG A;  4FX0 A;  1X3Z B;  2GAU A;  1AU7 A;  2ICW G;  4UV8 A;  2OPT A;  3ZQH A;  1R1T A;  1MZB A;  4PCQ A;  1QPM A;  1ETK A;  4IHX A;  1ZR2 A;  3PFY A;  2RKH A;  1LJ9 A;  1ZHF A;  4CHU A;  3ECO A;  2O6G E;  1J2X A;  2H09 A;  1Z6R A;  4GDF A;  2ZKZ A;  1HXD A;  5J6X A;  1KON A;  4XN0 A;  2QQ8 A;  3F6V A;  2XRL A;  3M8F A;  4A3D J;  1KGS A;  2K9Q A;  4HZF A;  1O4X A;  1NK2 P;  1O7F A;  1QVU A;  2BGC A;  3BLY A;  5FLV A;  1YRN B;  1QHH D;  1TZL A;  2CJJ A;  3EUH A;  2JN6 A;  1XD7 A;  3K4K A;  4Y17 A;  1IXR C;  2MH9 A;  5LD2 C;  4CXF A;  2HOE A;  2V9V A;  4I7H A;  4M3B A;  3CF5 F;  2KLO A;  4IXA A;  1ETV A;  2OZ6 A;  2M0M A;  3LA2 A;  4PFO A;  4XRM A;  2WB1 N;  3BR2 A;  3KYC B;  1AA7 A;  2P6T A;  3DKW A;  1MMD A;  4AWX B;  3I55 I;  2B9S A;  4ENJ A;  1DDN A;  3BG9 A;  3IHU A;  4M72 A;  2CSO A;  4YII A;  4B43 A;  4E7J A;  1KU3 A;  2XF6 A;  5LEJ A;  3ZMS A;  1BIB A;  3AFH A;  1X1D A;  4L0Z B;  2LY9 A;  3BC8 A;  2ME0 A;  2IS6 A;  5IYC J;  3OIP A;  5HOD A;  3S2W A;  2K4J A;  3KP2 A;  1SVM A;  3P9I A;  2K3P A;  2P7V B;  5IOY A;  1YIT I;  2XKO A;  5M5X J;  3OSG A;  2XGX A;  1FTZ A;  2BHY A;  1J5Y A;  1MBK A;  3O8H A;  4D0P A;  2X6O A;  3HGG A;  5CVU A;  3NWS A;  2K27 A;  5F6F A;  1G8X A;  4DNC A;  3WTV C;  2W7N A;  3BWG A;  2HQN A;  3Q0W A;  2MSY A;  3J7A O;  2R7X A;  2LY1 A;  3LFU A;  2ECC A;  2PX9 A;  1TQM A;  1R9T J;  2R92 J;  3HOW J;  1XS9 A;  2X4H A;  5IOZ A;  3MMY B;  2X85 A;  3ONQ A;  3BJ6 A;  3CES A;  2FBH A;  2W57 A;  3NEU A;  3CD6 I;  5IT3 A;  1BJZ A;  1ONV A;  3T0Y A;  2Y9Z A;  2DLL A;  2EPF A;  4QTR A;  5BMZ A;  4JK1 X;  1ETQ A;  2VUM J;  4FIS A;  3M8J A;  4PJN A;  2DT6 A;  4RMN A;  2QGU A;  4IRG A;  2KT0 A;  3CCR I;  3HHH A;  2QA4 I;  4KN4 X;  2IXS A;  3BQZ A;  1JGG A;  1JKQ C;  1BI0 A;  3L2C A;  3ZRG A;  2VN2 A;  1SAN A;  2F4O B;  3BZ6 A;  4UVC A;  3IL2 A;  1HKS A;  1ODD A;  2DQR A;  2ZFW A;  1F5T A;  1MMS A;  2L9S A;  2M8E A;  1FSE A;  2ZCW A;  3CDH A;  4KYW A;  2O8X A;  2JPB A;  4P1W A;  3H92 A;  4NUB A;  4D1Q A;  4X1E A;  1W5S A;  5HNH A;  2QSG X;  4L0Y B;  5A2Q K;  4MIM A;  2A5Y B;  3LSR A;  3GVA A;  4QWQ A;  5D6E A;  3MEX A;  2Y0S A;  1I39 A;  5HOO A;  3BPX A;  2WAE A;  4Z2Y A;  3P9C A;  3J7Z I;  1YIJ I;  1WI3 A;  3BG6 A;  5K7F A;  4BY7 J;  1SAX A;  4N0B A;  3OIQ A;  1FYK A;  1FYL A;  3G4S I;  4HYE A;  1XN7 A;  5B66 C;  4J00 A;  3TGN A;  5DD8 A;  1IN8 A;  1EKE A;  2VQL A;  2O3F A;  1JUP A;  1C0W A;  4CGZ A;  3GTK J;  2QQ9 A;  3MZH A;  2DMQ A;  3HRT A;  2MBF A;  3FKI J;  1FIA A;  3K7A J;  2VT3 A;  4YFK F;  1D5Y A;  1PJR A;  5JLW A;  2VC1 A;  2L4A A;  3O3K A;  4L9T A;  1XPX A;  3RSN A;  5B1A H;  2M0C A;  2PJP A;  2VQH A;  4HG2 A;  2PG4 A;  4XBF A;  2YUS A;  3D5R C;  4AVP A;  1IUY A;  1GHC A;  2W4S A;  3RCO A;  2JA8 J;  3R0A A;  4L5J A;  3T8T A;  4HOB A;  1SVO A;  2F2E A;  1N25 A;  4E70 A;  4E7L A;  1A36 A;  4LB5 A;  2P0W A;  3FM5 A;  4NC6 A;  3AAF A;  2L02 A;  2DDA A;  1FOY A;  3HPG A;  2HDD A;  3F8C A;  1EJ9 A;  1T38 A;  2VKD A;  1N78 A;  3ZR8 X;  3MCZ A;  1J0R A;  4XRS A;  3LAJ A;  2VBW A;  3BTJ A;  2WY7 Q;  3E5X A;  4E4H A;  4Y3O A;  4S05 A;  1MGT A;  2LKS A;  3GME A;  5KAF C;  2PLY A;  2Y0S N;  5L3E A; 
#chains in the Genus database with same CATH homology
 2NNY A;  1E17 A;  3GUD A;  4KUM A;  2GIV A;  3JSO A;  3VFZ A;  1B4A A;  1R1V A;  4Q47 A;  4O3M A;  1ULY A;  5F1R A;  4A0Z A;  3MAJ A;  3E3V A;  3HOS A;  2DK8 A;  3JTG A;  5AIP A;  1A04 A;  4ESB A;  3ISP A;  1R1U A;  4RB1 A;  5D6F A;  1H0M A;  2F5F A;  3ROU A;  2YX7 A;  1QQI A;  3BJA A;  2HS5 A;  4EM2 A;  1MKM A;  1Z7U A;  3JAM Z;  4PGH A;  1B9M A;  1J75 A;  2M5W A;  2W25 A;  1YTY A;  2LKP A;  5D5X B;  4G7H F;  4BYY A;  4BXU A;  3JW4 A;  2DW4 A;  3I58 A;  2MA3 A;  5HDG A;  2RGV A;  3RPQ A;  3CO7 C;  5L3F A;  4XSX F;  3E6M A;  4KIG A;  2GZW A;  2BV6 A;  4L5I A;  3I53 A;  3R0J A;  5H6Q A;  4CZZ A;  4EGZ A;  2QM3 A;  1FY7 A;  2IA1 A;  5HDK A;  3WE2 A;  2DAO A;  1P4A A;  4I01 A;  3PQJ A;  1EV7 A;  1P6R A;  1FWZ A;  5DV5 A;  2QUF A;  2VC0 A;  2Y48 A;  1S29 A;  4EGY A;  3CUQ C;  5HS7 A;  1ZN2 A;  3ERE D;  4WF2 A;  2HEO A;  1XGM A;  2PFB A;  2E1C A;  1SFE A;  1FBQ A;  1SFX A;  2VT2 A;  1WQ2 A;  2JPC A;  4CYD A;  2PN6 A;  4FT8 A;  3E6D A;  2Y0M A;  2NRA C;  1KU7 A;  5CLS A;  3BP8 A;  1BC8 C;  3GFJ A;  4BHC A;  2X0L A;  1WRJ A;  2HZT A;  2JT1 A;  3HOT A;  3N97 A;  3J80 Z;  4ZYD A;  2MC3 A;  4YIF A;  1LDJ A;  2RC4 A;  3FM3 A;  3WG9 A;  1IN6 A;  3T1B A;  4G6D A;  5ILS A;  2IT0 A;  2F5E A;  1T39 A;  4LMY A;  4IF4 A;  1NHA A;  1WWX A;  3O6B B;  4HF2 A;  2RN7 A;  2KJB A;  2L54 A;  1LQ1 A;  5D5V B;  5FLX Z;  1OYI A;  2K02 A;  4LLN A;  3RKW A;  3WGI A;  4KN7 X;  2OAZ A;  2H6B A;  1TTY A;  3KZZ A;  5E20 A;  4S04 A;  2HTS A;  3KCC A;  2DPD A;  4HV6 A;  3MZY A;  3QP6 A;  1I27 A;  2A61 A;  2WWY A;  2P7C B;  1FX7 A;  4G6Q A;  2P8T A;  4RS8 A;  3L00 A;  4Y13 A;  5E17 F;  1YIO A;  2L4M A;  1OR7 A;  4UVA A;  2KRF A;  4GO1 A;  3V8J A;  2XVC A;  5DCF A;  3LST A;  3C1D A;  4O5V A;  1LVA A;  3J81 Z;  2HYG D;  1XB4 A;  4ETS A;  3CJN A;  2QQA A;  1FOK A;  3HSF A;  1G3T A;  1FSH A;  1ZYR F;  6PAX A;  5ICF A;  3R61 A;  5LGU A;  1PP7 U;  1K78 B;  2FNP A;  5FB2 A;  5L3C A;  4XLP F;  2DFI A;  3P9K A;  2E7W A;  4L18 B;  3HIF A;  2Z5U A;  2VE8 A;  4M9S A;  4CIC A;  1JXS A;  3WTY C;  4KFC A;  2P5V A;  3GYH X;  1O57 A;  3F21 A;  2CG4 A;  2FMY A;  2HTJ A;  4KA4 A;  2XRN A;  1RI7 A;  3GFL A;  3CUQ A;  5IT9 Z;  2Q0O A;  4Q5S F;  3OOP A;  3FMS A;  2VBY A;  4R1H A;  3O2P E;  3U2R A;  1V4R A;  1IRG A;  4KIF A;  4LJZ F;  3L7W A;  5L3B A;  5DD4 A;  4MTD A;  1S8N A;  3BRO A;  1FP1 D;  4R8H A;  3DPL C;  3CTA A;  4RAY A;  3C3W A;  2OA4 A;  4HX4 A;  2GA2 A;  1LDK B;  1U8R A;  4L9N A;  2M1B A;  1Z91 A;  5D4R A;  1LEA A;  4KDP A;  3F3X A;  1UFM A;  3M1E A;  4CO8 A;  2ESH A;  3U9G A;  3F72 A;  2ADU A;  3DF8 A;  1SMT A;  1ZRE A;  1K78 A;  3TO7 A;  3GO5 A;  4KMU X;  5HS9 A;  2AS5 F;  3H3U A;  1QO0 D;  1UST A;  5TRD A;  3ZP5 A;  1YFH A;  2C6Y A;  2XAS A;  2RQP A;  2MLK A;  1FBS A;  2XAJ A;  2EFQ A;  1W5T A;  1ZG3 A;  1F4K A;  1UHM A;  3I64 A;  5H20 A;  1QZY A;  4WXD A;  3B73 A;  2QZ8 A;  1ON1 A;  1BI3 A;  4OMY A;  3QU6 A;  5AIQ A;  4HDV A;  2IA0 A;  3B02 A;  1OKR A;  3FZV A;  3REO A;  4G8X A;  1R36 A;  1FPQ A;  4ASN A;  2JTV A;  1D5V A;  4EJO A;  2YPR A;  3G3Z A;  4PGG A;  3VOE A;  3IRQ A;  5DYM A;  2IW5 A;  5J8F A;  3HSE A;  2IRF G;  4L9V A;  3P7N A;  1O3R A;  1ZGA A;  2D1H A;  1B9N A;  1E2X A;  1D3Y A;  3TO6 A;  2UXN A;  3I4P A;  2QBY B;  2YX4 A;  4HDU A;  2P4W A;  4BNC A;  4OIP F;  2BE5 F;  2V79 A;  3CUO A;  4AIJ A;  4NHJ A;  1CGP A;  2DPU A;  2VOP A;  1LEB A;  3MFK A;  4Q48 A;  1R7J A;  4LB6 B;  5FFZ A;  3U1D A;  4EQQ A;  4RGR A;  2CFX A;  4WX9 A;  4M6Y A;  3TOB A;  1T98 A;  3L09 A;  3WGH A;  5ICC A;  4A0Y A;  1OYY A;  2FBI A;  4P9F A;  1DUX C;  3WTU C;  4QLC U;  2QEN A;  2ELH A;  3HYI A;  1HST A;  4M71 A;  5KK1 A;  3K69 A;  1UCR A;  4XSZ F;  4WWC A;  1EH6 A;  5CVJ A;  4YG2 F;  3ZMD A;  4GYG A;  5LHG A;  2Z3Y A;  5BQT A;  1IXC A;  2QVO A;  1TNS A;  1R5G A;  5F64 A;  4Y15 A;  2P5K A;  1ZRF A;  3ECH A;  3FWE A;  3ZMV A;  4LG0 B;  3GX4 X;  3F8N A;  3W6K B;  5D8L B;  2LDU A;  4MHG A;  4I0A A;  1U5T C;  1JHF A;  2EFO A;  4U7B A;  1TQP A;  1VTN C;  5HS8 A;  2B0L A;  4OMZ A;  3IC7 A;  4ZZD A;  1LDD A;  4UUV A;  4IHS A;  4A12 A;  2H94 A;  2G7H A;  2WTE A;  3VEP A;  2EA4 A;  1JE8 A;  3GFM A;  1ZAR A;  2V1U A;  2ZXJ A;  2VOO A;  2QBY A;  4WXH A;  3CLO A;  1SD7 A;  1PUE E;  4RGU A;  5D5W B;  1K79 A;  3FMQ A;  2NS0 A;  4UHT A;  1TLH B;  1J7K A;  1STZ A;  3PFI A;  4IJA A;  4WCG A;  2DBB A;  2O61 A;  3HRU A;  2VXZ A;  4XRF A;  3C18 A;  3T8R A;  2IPQ X;  4IHT A;  5EEH A;  1HKQ A;  4HF0 A;  4LLG F;  5E8I A;  1F9N A;  3LA7 A;  3SFZ A;  1IZ1 A;  1HSJ A;  3MQ0 A;  2R3S A;  3VB2 A;  1I5Z A;  2JSC A;  3TDU C;  2G7U A;  3FXQ A;  4EVI A;  2FNA A;  1IAW A;  4KNY A;  2Z99 A;  2NAZ A;  2XV4 S;  2NNN A;  4I0B A;  3ELK A;  3F6O A;  5ILV A;  2PI0 A;  3QP5 A;  3WOD F;  4OIN F;  3K0L A;  1TBX A;  3I59 B;  4LG0 A;  1R00 A;  2AXL A;  1SD5 A;  2A07 F;  4H0E A;  3V8L A;  2YSR A;  4P55 A;  2ETH A;  2MH2 A;  1P4W A;  2PMU A;  2EFW A;  1IW7 F;  5KVR A;  5FD5 A;  2HGC A;  2COM A;  2EFP A;  4PZJ A;  5AON A;  3SHF A;  1ZG1 A;  1BIA A;  1MJB A;  5BS6 A;  3ZMT A;  3DXJ F;  5D5U B;  4KT5 C;  2XKP A;  5TJJ A;  4IRI A;  3DQV C;  4U88 A;  1IXS B;  1QGP A;  1XCB A;  2ACJ A;  2E1N A;  2Y75 A;  4NB5 A;  2P6S A;  3HRS A;  3HTS B;  1YS6 A;  3GLX A;  4I09 A;  4OOI A;  1BJA A;  1KYW A;  2RDP A;  2KKO A;  2DI3 A;  1T6S A;  5JVT A;  1Z6T A;  1BN5 A;  4HAM A;  5LGN A;  2L01 A;  2FBK A;  3E6B A;  4EV0 A;  3KET A;  1Y0U A;  3I59 A;  5HLH A;  4JQF A;  3E5Q A;  2VOD A;  2OBP A;  2H27 A;  1IN4 A;  1KA8 A;  1S7A A;  4AD9 A;  1GXQ A;  2K7L A;  5J8C A;  1RNL A;  1TW3 A;  1P2F A;  1YS7 A;  1ZGJ A;  3BJO A;  3FX3 A;  4EMS A;  1D8J A;  3IKV A;  5A2Q Z;  3IKT A;  3RKY A;  2STW A;  4U7D A;  1ZLK A;  1O3Q A;  4GYI A;  2A3S A;  3GXO A;  3EYY A;  5LHH A;  3ZMZ A;  3DV8 A;  2UWM A;  3CUQ B;  1FLI A;  1R58 A;  1XGO A;  3F8M A;  4MQV A;  5LLQ A;  4HX7 A;  2KIU A;  3F8F A;  2EFN A;  3V4G A;  1XSD A;  3QPT A;  1OMI A;  4IRH A;  4LFU A;  3RYP A;  4NQW A;  4G9Y A;  3EDP A;  1FT9 A;  2W85 A;  4GGG A;  4HF1 A;  3GW2 A;  4F7Z A;  4MEY F;  2LSO A;  2FQ3 A;  1T0F A;  2XAG A;  2K86 A;  3F8B A;  2JRT A;  3KEQ A;  2WV0 A;  4L9J A;  5LGT A;  3BOQ A;  5FFX A;  1U78 A;  5FO5 A;  3QAH A;  1YG2 A;  1QZZ A;  4GXO A;  3ZQ7 A;  4HA8 A;  5LRR A;  1B6A A;  3KP6 A;  1BBY A;  2HKO A;  4ON0 A;  4XLN F;  1XCV A;  1MJA A;  3QU3 A;  3WTS C;  1K6O A;  4BH9 A;  3KZY A;  5D4S A;  1HW1 A;  1W4M A;  4P96 A;  3CO6 C;  2M30 A;  2F5D A;  4ENK A;  5K5R A;  4UV9 A;  2HR3 A;  4R79 A;  1GXP A;  1B59 A;  1F1Z A;  2DTR A;  2GA1 A;  3K1P A;  4HQE A;  4BAY A;  2J5O A;  3RTR A;  1LNW A;  1GVJ A;  1R22 A;  4KMF A;  2YU3 A;  4KIC A;  1G3S A;  3WTW C;  2NYX A;  4CDG A;  4M6X A;  2DU9 A;  2J5P A;  1CF7 B;  4UVB A;  4OIQ F;  2IJL A;  3G73 A;  3D0S A;  1T2K A;  1YQA A;  3I0T A;  1S6L A;  2V6C A;  4M73 A;  4HQM A;  2FXA A;  1RZ4 A;  5ERI A;  2VE9 A;  3COA C;  2M87 A;  5FD6 A;  2KIF A;  5JI6 A;  2IVM A;  1MJ9 A;  3Q9S A;  3WTT C;  5L3G A;  1XDU A;  5LRS A;  4ENN A;  3RI4 A;  3V7C A;  1X3U A;  2CQK A;  3HSR A;  2IP2 A;  2HFH A;  4RGS A;  3N4M A;  1YLF A;  2IA2 A;  2G9W A;  2RVC A;  1HQC A;  4JBA A;  1Q1H A;  3HTU A;  3RKX A;  3ZMU A;  2RNJ A;  1KYZ A;  1Z9C A;  1O7L A;  2D45 A;  1PP8 F;  3BPV A;  1WI9 A;  2WC2 A;  1I6X A;  5D8K B;  4P9U A;  3LA3 A;  1W7P D;  3IRR A;  2FRH A;  1K7A A;  4EJT A;  4RAZ A;  2EB7 A;  3JAM K;  1L0O C;  4RB3 C;  3RPU A;  4N9I A;  2QYO A;  1JGS A;  2HYF A;  3TDZ C;  2A6E F;  4A5N A;  2XAQ A;  1CF7 A;  4M74 A;  5LBQ A;  2FSW A;  2LF8 A;  4G7O F;  3M7G A;  1BI1 A;  2V1D A;  2ZNY A;  3KLO A;  4EJW A;  4U0V A;  3GEZ A;  2XUB A;  2JZY A;  1KU2 A;  3KP5 A;  3LFK A;  3V7R A;  1ZRD A;  1KU9 A;  1SMY F;  4LK1 F;  3GWZ A;  1FZP B;  3LQR A;  2Q2E A;  2YR2 A;  2UZK A;  3QRF F;  3KE2 A;  1MDM B;  1TQI A;  2O03 A;  2EK5 A;  3HUG A;  4A0X A;  1OPC A;  1G3Y A;  4MEX F;  3R60 A;  1QNT A;  2DT5 A;  3FXR A;  3R4K A;  2A6H F;  1P92 A;  1TNT A;  4I02 A;  1KQ8 A;  4WXC A;  2QQB A;  4MGR A;  2DO7 A;  3IWZ A;  1HW5 A;  4UNO A;  2KIM A;  3EYI A;  4A5M A;  1ZH5 A;  2F5C A;  1AOY A;  4MNU A;  1XDS A;  1O3T A;  3K2Z A;  1U6G A;  1WKM A;  3M8E A;  1JHH A;  2STT A;  4B09 A;  2O0Y A;  3J80 K;  2A69 F;  5DCM B;  2P5L C;  3GZ6 A;  1G4D A;  2HWV A;  2OQR A;  4ZYH A;  2EJR A;  4Q4Z F;  5ICG A;  2MD5 A;  4WK8 F;  1XMK A;  3BY6 A;  5K1Y A;  4YFX F;  1ZRC A;  5LHI A;  2XRO A;  4HW0 A;  5FLX K;  1IN7 A;  4EJU A;  2HQR A;  1Z1D A;  1IF1 A;  4AIK A;  1HKT A;  2ISZ A;  4MQ9 F;  1MDM A;  4HBL A;  1BOA A;  2EWN A;  1YO5 C;  3K1M A;  4EJV A;  4A6E A;  1EH8 A;  2GXG A;  2L3D A;  5DEQ A;  2PQ8 A;  4FHT A;  4YFN F;  2ZJ2 A;  3RDI A;  4N9H A;  4I98 B;  2D2W A;  2OZU A;  3SXY A;  5BOX A;  3NQO A;  5DDG A;  1H9G A;  3J81 K;  1U5T B;  4IPA A;  3ZN1 A;  3K1N A;  1BI2 A;  4ESJ A;  1KQ0 A;  5K5Q A;  1UHW A;  3TKY A;  2Z33 A;  2V1X A;  1I1G A;  2BYV E;  4AIH A;  3SQN A;  5HLI A;  3R6S A;  2FOK A;  2K4B A;  5DCM A;  1I1S A;  2QLZ A;  1XSX A;  3FF5 A;  3KFW X;  2M45 A;  3QOP A;  3QPH A;  3DPT A;  1ZAO A;  2OQG A;  2ZME B;  2EV0 A;  4K2E A;  2BBY A;  1V3F A;  3Q9V A;  1EH7 A;  3L9F A;  4RB0 A;  1UB9 A;  1L3L A;  2FU4 A;  4ENM A;  5E1Z B;  3ZN0 A;  4B8X A;  5IT9 K;  1XSV A;  4HX8 A;  2H6C A;  4BHB A;  4KIB A;  3FHZ A;  4I2O A;  5E8G A;  1Z05 A;  4LLL A;  2OD5 A;  4U0W A;  1U2W A;  3V8K A;  1YW7 A;  2QWW A;  3WU1 B;  2KJC A;  4ZYE A;  1USS A;  5H6R A;  2PMH A;  1G6N A;  3SZP A;  4G7Z F;  2TDX A;  3KP7 A;  5ILU A;  2E7X A;  3WU0 A;  1DPR A;  1U5T A;  5JFR A;  3HRM A;  4ESF A;  1IRF A;  2DQL A;  1RUO A;  2EV6 A;  3KEO A;  1FP2 A;  1FC3 A;  2Z9O A;  3WTZ A;  1DP7 P;  2R7F A;  1BM9 A;  2A68 F;  2MLG A;  3DEU A;  5BPI A;  2XAF A;  4BQA A;  1WSU A;  4RGX A;  4A2U A;  2EA2 A;  4ZH4 F;  1S3J A;  4P5O A;  5JHU A;  3GF2 A;  1G3W A;  4LK0 F;  5CJ9 A;  2R7D A;  2ZME A;  5LEK A;  3IWF A;  3PQK A;  1IN5 A;  1PDN C;  5DUK A;  3LQQ A;  3F23 A;  1U3E M;  2FF4 A;  1J59 A;  4PDK A;  2XAH A;  4A6D A;  3DFG A;  3KP3 A;  4BHP A;  5HVQ C;  1SFU A;  1YW8 A;  5EEG A;  3SZT A;  5DUI A;  2CWE A;  2FEZ A;  3E6C C;  2EV5 A;  2OU2 A;  3LAP A;  1ON2 A;  2GWR A;  2W24 A;  3HHG A;  1HBX G;  2ISY A;  3RYR A;  2CW0 F;  3GZ5 A;  1ZG5 A;  3BDD A;  5K5O A;  2LF7 A;  4LD5 A;  2CYY A;  1J9I A;  2FML A;  5CVR A;  1W7P B;  3OV8 A;  4GCV A;  1DPU A;  3NRV A;  3I5U A;  2W84 A;  1FNN A;  3E5U A;  1BC7 C;  2XIG A;  4ZZL A;  5E1X A;  3T5X A;  3TOA A;  5CYV A;  5L3D A;  3E97 A;  3FMR A;  5CVI A;  3WTX C;  1TW2 A;  3KLN A;  2HDC A;  1SD6 A;  4ZYG A;  2VBX A;  4FX4 A;  3GFI A;  1XMA A;  5E1W A;  3F22 A;  5HLG A;  2XHK A;  2PBI A;  1LB2 A;  2VON A;  3ZPL A;  2CGP A;  4DQ2 A;  2GXB A;  4OIR F;  2ZO4 A;  4OU0 A;  5BPD A;  1YYV A;  3DP7 A;  4LGW A;  4M9X A;  4RB2 C;  3TO9 A;  3D5L A;  3VOD A;  2Q8K A;  1FYM A;  2FE3 A;  3Q5F A;  1D8K A;  3I71 A;  2PEX A;  4EM1 A;  2ESN A;  2BEO A;  2LNB A;  3MWM A;  1KQ9 A;  2FA5 A;  3KP4 A;  1P4X A;  5CVV A;  1B1B A;  5E18 F;  3JSP A;  1S7O A;  1H9T A;  1OYW A;  4M9Z A;  3TQN A;  2GQQ A;  4G94 A;  1HW2 A;  2DK5 A;  4OIO F;  1YW9 A;  1R5H A;  4TV7 A;  3H3Z A;  1RIO H;  5JR3 A;  1SD4 A;  1W7P A;  5HDN A;  2D1V A;  3W6J B;  4HLX A;  3WE3 A;  3K9T A;  5FGM A;  3C7J A;  5ED4 A;  1RUN A;  3RIR A;  3LWF A;  3M9A A;  2RV8 A;  1FBU A;  4IVN A;  3ABT A;  1XGS A;  4O6J A;  1MD0 A;  2ZNZ A;  3EET A;  3V7S A;  3ULQ B;  4HV5 A;  3ML6 A;  1O3S A;  1R23 A;  4UXN A;  1AWC A;  4MTE A;  1XGN A;  3WGG A;  2CO5 A;  1QBJ A;  1ZLJ A;  3EQL F;  3ABU A;  4EM0 B;  2VBZ A;  2UXX A;  3I54 A;  5ICE A;  1REP C;  3RJP A;  3JTH A;  3FXU A;  4U0Y A;  2ZBK A;  4HLY A;  2HKX A;  4FX0 A;  2GAU A;  4UV8 A;  1R1T A;  1MZB A;  4PCQ A;  1QPM A;  2RKH A;  1LJ9 A;  1ZHF A;  4CHU A;  3ECO A;  2O6G E;  1J2X A;  2H09 A;  1Z6R A;  2ZKZ A;  1HXD A;  5J6X A;  3F6V A;  3M8F A;  1KGS A;  4HZF A;  1O7F A;  2BGC A;  3EUH A;  1XD7 A;  4Y17 A;  1IXR C;  2MH9 A;  4CXF A;  2HOE A;  2V9V A;  4I7H A;  4IXA A;  2OZ6 A;  3LA2 A;  4AWX B;  2P6T A;  3DKW A;  4ENJ A;  1DDN A;  3IHU A;  4M72 A;  2CSO A;  4YII A;  1KU3 A;  5LEJ A;  3ZMS A;  1BIB A;  4L0Z B;  3S2W A;  2K4J A;  3KP2 A;  3P9I A;  2P7V B;  2XKO A;  2XGX A;  1J5Y A;  4D0P A;  5CVU A;  5F6F A;  2K27 A;  4DNC A;  3WTV C;  3BWG A;  2HQN A;  3J7A O;  1TQM A;  2X4H A;  3BJ6 A;  2FBH A;  2W57 A;  3NEU A;  5IT3 A;  1ONV A;  3T0Y A;  2DLL A;  5BMZ A;  4JK1 X;  4IRG A;  3HHH A;  4KN4 X;  1BI0 A;  3L2C A;  2VN2 A;  3BZ6 A;  4UVC A;  3IL2 A;  1HKS A;  1ODD A;  2DQR A;  2ZFW A;  1F5T A;  2M8E A;  4KYW A;  1FSE A;  2ZCW A;  3CDH A;  2O8X A;  2JPB A;  3H92 A;  4L0Y B;  1W5S A;  5A2Q K;  2A5Y B;  3GVA A;  4QWQ A;  5D6E A;  3MEX A;  5HOO A;  3BPX A;  4Z2Y A;  3P9C A;  1SAX A;  4N0B A;  1FYK A;  1FYL A;  4HYE A;  1XN7 A;  3TGN A;  5DD8 A;  1IN8 A;  2O3F A;  1C0W A;  4CGZ A;  2QQ9 A;  3MZH A;  3HRT A;  2MBF A;  2VT3 A;  4YFK F;  2VC1 A;  2L4A A;  3O3K A;  4L9T A;  2PJP A;  2PG4 A;  4XBF A;  4AVP A;  1IUY A;  1GHC A;  3R0A A;  4L5J A;  3T8T A;  4HOB A;  2F2E A;  4E70 A;  4LB5 A;  3FM5 A;  3AAF A;  2L02 A;  3F8C A;  1T38 A;  3MCZ A;  1J0R A;  3LAJ A;  2VBW A;  3E5X A;  4S05 A;  1MGT A;  2PLY A;  5L3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...