1FZPB

Crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
AITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*TP*AP*TP*AP*TP*A)-3'
publication title Crystal structures of SarA, a pleiotropic regulator of virulence genes in S. aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 23
structure length 105
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fzpB00
2BV6A 4KYWA 1C0WA 4HQMA 1OYWA 4KICA 4S04A 2ZMEB 1TQIA 1Z1DA 1P4WA 4L5JA 3ZMUA 3Q5FA 4UV9A 1IAWA 2VBYA 2QBYA 1R00A 4G94A 3C18A 1YW8A 3IWZA 2QZ8A 3RKYA 5H6QA 4LLGF 3GZ5A 4WCGA 3V8LA 2JZYA 4M9ZA 4AIHA 4ESJA 4M72A 1O3TA 1HSTA 2W85A 2L54A 4UNOA 5A2QZ 2OAZA 4LG0A 4ZYDA 2DPUA 4XSZF 4EJWA 4I98B 2L02A 2ESNA 4KIGA 2HKOA 5TJJA 4ZYGA 3BPVA 1SFXA 2OD5A 5DD8A 1FYKA 3IRRA 3FX3A 3LA3A 3VOEA 3GXOA 2QWWA 3HRUA 4BYYA 4YG2F 4AIKA 1P6RA 2M1BA 3ML6A 2LNBA 2STWA 3WTVC 3V7RA 2V1DA 3WU1B 1HW2A 2VODA 2VXZA 3BJOA 3KLNA 4A12A 3BROA 4G8XA 2J5OA 1CF7B 4KFCA 2WWYA 2VE8A 5E20A 1U78A 3HRTA 1TLHB 3OOPA 2O03A 3ROUA 2XKPA 2OQRA 3P9CA 2IVMA 3QOPA 5FO5A 4ENJA 2XIGA 3L9FA 5ED4A 3KCCA 3I0TA 2KJCA 4ZYHA 4RS8A 5F6FA 3DV8A 4UUVA 1FY7A 2HKXA 3TDZC 3DPTA 1H9TA 2RN7A 2YU3A 5BQTA 4O6JA 4FHTA 4KMUX 1V4RA 1TNSA 1YIOA 3TOAA 3GF2A 2EA4A 4G9YA 2VN2A 1W7PA 4HF1A 1EH6A 4HBLA 4ZZLA 3VB2A 2KJBA 2ISYA 4IVNA 1BBYA 1KU7A 2PQ8A 5LLQA 2LF8A 2V9VA 3F6OA 2LKPA 1I5ZA 4L18B 4RGRA 3V8KA 3BZ6A 2LF7A 3C1DA 4A6DA 2F5CA 4LK0F 2ACJA 1KYWA 1IN4A 1BI1A 4LLLA 2ZJ2A 5D5UB 5LHIA 3ZN1A 2M5WA 1RI7A 4ESBA 3KZZA 2L3DA 4BHBA 4KIBA 1BIAA 1BI2A 2HR3A 1ZGAA 4M74A 1XMKA 1BC8C 1P4XA 2FBKA 4OOIA 1OYYA 5JVTA 4L9JA 1XSVA 5ICFA 2YX7A 4HF2A 4EQQA 1E17A 1G3SA 4HDVA 4AVPA 3I4PA 3DKWA 3F8BA 4D0PA 4XLNF 1ZYRF 2GZWA 2EB7A 3LFKA 5HS8A 2HTSA 3LQRA 3ZMZA 3VEPA 2X0LA 2FOKA 1MKMA 2NNYA 2VONA 3TO7A 5HDKA 2O6GE 2V1UA 2EV0A 3U1DA 4P96A 2Z5UA 1IRFA 2RNJA 2CWEA 1O7FA 1KYZA 5IT9K 3HTSB 5ILSA 3W6JB 5FLXZ 4RB1A 1K78B 5L3BA 1Z7UA 5D4RA 4XLPF 1XDUA 3QP5A 3RI4A 5JFRA 4DQ2A 3ULQB 3TGNA 2HZTA 2IW5A 2WTEA 2FBIA 3HUGA 5HVQC 2IP2A 3EYIA 1YS7A 3HIFA 1LQ1A 5E8GA 1T2KA 5LEKA 3SZTA 1F5TA 1K78A 1D8JA 4EGYA 2QYOA 1Z6TA 4FX0A 5DDGA 3LA7A 3MAJA 2FU4A 2XHKA 2F5FA 4B09A 5K5RA 2CW0F 4A0XA 3KP7A 1IRGA 2FEZA 2GIVA 1FX7A 3ELKA 1LDDA 4ZYEA 4HV5A 3G3ZA 3C3WA 2ZBKA 1IUYA 3K0LA 5CVRA 1FP2A 2QQ9A 2QQBA 2MA3A 3KP6A 3JTHA 1Z91A 1R58A 1R1TA 3OV8A 4LK1F 2WV0A 3WGHA 3LAJA 3ZMSA 3SXYA 1T39A 2K02A 3HRSA 1Z05A 2YX4A 4UHTA 3K2ZA 1DUXC 5JR3A 1FBSA 4U88A 2UXNA 3B73A 3HTUA 3E3VA 4BXUA 1U5TB 1IXSB 3RIRA 3U2RA 2MBFA 1G3WA 3VFZA 1YS6A 1YG2A 4CDGA 4ETSA 2O0YA 2JPCA 5DCFA 1FYLA 1O3RA 3DXJF 2CGPA 1S7OA 3CJNA 4F7ZA 1OPCA 3H3ZA 4GO1A 2EA2A 4HLXA 2L01A 5CVJA 2VT2A 2EWNA 1QGPA 3F72A 4U0YA 2RGVA 3LWFA 1H0MA 4MEXF 3T8TA 1ZG3A 1KQ0A 2NS0A 4L9TA 4PGHA 4AD9A 4OMYA 2XGXA 2FXAA 1LEAA 1SMYF 1P4AA 4ON0A 2P6SA 4IHSA 1KU2A 3R6SA 2XASA 5E17F 3I53A 3M7GA 2IA0A 1XN7A 3KLOA 4IHTA 1SMTA 2ZKZA 4A5MA 2ELHA 1O7LA 1FLIA 3F8CA 2PG4A 1JGSA 1T98A 3S2WA 4G7OF 1WKMA 4JBAA 1FPQA 2X4HA 3BWGA 2BGCA 5DCMB 2IRFG 2D1VA 4I09A 4ENKA 2W25A 2A6HF 1LB2A 5D5XB 2HEOA 4A2UA 4DNCA 1QQIA 1WI9A 1LJ9A 5ICCA 1U2WA 4RB0A 3E5QA 2FSWA 1B4AA 1SD7A 4ZH4F 3RDIA 3SQNA 1IXCA 2H6BA 3K1PA 2W84A 3DP7A 4K2EA 4YFKF 2XV4S 2IA2A 3QAHA 1RUOA 1BM9A 1R5HA 1XD7A 4M6XA 1J59A 2K7LA 3KP2A 3WE3A 1K6OA 3E6DA 2HWVA 5D5WB 1IXRC 5DCMA 2D45A 2QBYB 1XMAA 4G7ZF 3GWZA 3LA2A 4HAMA 4LGWA 2K4BA 1JHHA 4KUMA 3T0YA 3FMSA 4RAYA 3JW4A 2OU2A 2R7FA 1T6SA 3N4MA 4G6QA 2DK5A 4LG0B 3BY6A 2Y75A 1ZGJA 2VOOA 6PAXA 3CUQB 2OQGA 4HOBA 5D4SA 2EV6A 4N0BA 2HQNA 3E6BA 3WTSC 1ZHFA 1J9IA 4MHGA 4OIOF 2CG4A 3ZPLA 2VC1A 3F8MA 3E6CC 3F21A 2PLYA 1SAXA 4MGRA 2G9WA 1J2XA 4QWQA 1MJAA 2FQ3A 4NHJA 3I64A 1D8KA 3NRVA 1HXDA 2DK8A 4RB2C 5BPDA 3D0SA 4Y13A 3D5LA 5HDNA 3QPTA 3CUQA 3GZ6A 1ONVA 3FMRA 4M9XA 4LB5A 2BEOA 3E5XA 2E7WA 3HRMA 2P5VA 1S29A 1Z9CA 4A5NA 1G6NA 2A69F 1UFMA 3MEXA 3RTRA 4A0YA 4O3MA 4I7HA 5ILVA 5E1XA 4CHUA 4I0AA 1W7PB 3I59B 1QPMA 5ICEA 1KU9A 3CO6C 3KEQA 2UXXA 1SFEA 4MTDA 5HDGA 5JI6A 1SD6A 1IZ1A 3Q9VA 5J8CA 3GFIA 3GLXA 5AIPA 4R8HA 3SFZA 1U5TC 3GFJA 4E70A 3RPUA 1E2XA 5FGMA 3R0AA 2DLLA 2CFXA 4EJOA 2DW4A 2QM3A 2PMUA 3U9GA 2A61A 3EYYA 1HQCA 4L0YB 3F8FA 2HYGD 4PZJA 2DI3A 2NNNA 3PFIA 1UCRA 5L3FA 3C7JA 1B59A 2L4MA 1R5GA 3I59A 1FNNA 4ENMA 3V7SA 1MGTA 1IN8A 2PEXA 3ZP5A 1YW9A 1ZLKA 1OMIA 3J81K 4KMFA 1LEBA 2HTJA 4KN4X 5LRSA 1TQMA 3BJAA 1T0FA 4HYEA 2OZUA 5IT9Z 5LBQA 4B8XA 3J80K 1BOAA 5H20A 4NQWA 3F22A 2E1CA 1B9MA 1MD0A 3HOTA 5HOOA 1MJ9A 2VBWA 2NRAC 3WU0A 4U0VA 1W7PD 4WXHA 5D5VB 4S05A 1W5TA 4HZFA 2KKOA 3F6VA 3I5UA 2NYXA 3FHZA 2Q2EA 4AWXB 2VOPA 1YQAA 3DEUA 2L4AA 2RQPA 1V3FA 4L0ZB 3GFMA 3E5UA 2FBHA 2QVOA 1WSUA 2JPBA 3FXUA 3TO6A 1XCVA 2RVCA 5ILUA 3MWMA 4XSXF 1YW7A 1J5YA 2EFQA 2P6TA 5JHUA 2HOEA 3I54A 3LAPA 5HLGA 1OR7A 5HLHA 3CDHA 3SZPA 2DU9A 3LQQA 1I27A 2KRFA 5L3GA 4LLNA 4WXCA 2D1HA 1R1VA 5F1RA 1KGSA 3RKXA 2EFNA 2A3SA 1JXSA 4WXDA 4MQ9F 1IN5A 2YSRA 3ISPA 2GAUA 1G3YA 4CGZA 3ZN0A 3M1EA 4BAYA 4Y17A 3TO9A 2HQRA 4HW0A 2MH9A 4GXOA 1YYVA 4L9VA 4CICA 2RDPA 2XAJA 2V1XA 1ZG5A 2QLZA 2HGCA 3T5XA 1HW5A 1F4KA 1UB9A 4ASNA 5AONA 1ZLJA 2F2EA 4IRIA 1XGMA 3L7WA 2FF4A 2XAFA 1FWZA 1XSXA 1ZG1A 1PUEE 4CXFA 2FNPA 3KP5A 2XAGA 2XKOA 3RPQA 3JAMK 1U8RA 2UWMA 5L3EA 5K1YA 2HYFA 2CO5A 2MH2A 4KIFA 1XCBA 3H92A 2BE5F 1CGPA 1ON1A 1I6XA 2KIFA 3DFGA 4HX8A 1XB4A 5LEJA 1P92A 3EQLF 3IHUA 4P9FA 2ISZA 2ZNZA 2B0LA 2H27A 1TBXA 4R79A 2Z3YA 4I0BA 2ESHA 2FRHA 3V7CA 4LD5A 5E18F 1DPRA 4TV7A 5J8FA 2H09A 1DPUA 4ENNA 2ZNYA 3NEUA 1TW3A 1L3LA 4PGGA 2A6EF 3J7AO 4RGSA 1AWCA 5LHHA 1HKSA 3WTXC 2BBYA 3WGIA 2JSCA 3P9IA 4ESFA 2GA2A 1XGOA 3TDUC 4U0WA 3HOSA 3HYIA 5L3CA 4ZZDA 5E8IA 1SD5A 1AOYA 1NHAA 1YO5C 3KZYA 4QLCU 2NAZA 4EJTA 3MQ0A 4PCQA 3E97A 2P8TA 3K1MA 3GYHX 1FSEA 1QZZA 3IL2A 5HS7A 3PQJA 3WTUC 1STZA 5EEHA 1UHMA 1IN7A 1L0OC 2PBIA 4GYGA 1ZARA 3IKTA 2IA1A 3I71A 4HV6A 1X3UA 2E1NA 2XAQA 1FSHA 2RKHA 5KK1A 3GO5A 3R4KA 3IWFA 4XRFA 5IT3A 2LDUA 3DPLC 2Q0OA 1PP7U 1KA8A 3K69A 1OYIA 1RUNA 3KETA 3MCZA 2G7UA 4P55A 5TRDA 2PN6A 1RIOH 4LJZF 2F5EA 2K27A 1ZN2A 3MFKA 1USTA 3MZHA 1USSA 5DV5A 1MDMB 1LVAA 2M30A 3KE2A 3M8FA 3ZMTA 2DTRA 5BMZA 1EV7A 3T8RA 1ODDA 1DDNA 4LMYA 2CYYA 1GXQA 3Q9SA 4A6EA 1R22A 2MLKA 1R23A 3GVAA 2CSOA 3WE2A 1GXPA 4CYDA 2AXLA 3BDDA 1EH7A 3GW2A 3FZVA 2Z33A 1FOKA 2XROA 3KP3A 3CTAA 4OU0A 2IJLA 4HF0A 5CYVA 1MDMA 3JSPA 1J75A 5FFXA 3QPHA 2GQQA 2EV5A 2GXBA 2JRTA 2ZO4A 3F23A 1B9NA 3HSEA 4EMSA 4R1HA 2MC3A 4U7DA 2RC4A 1XGNA 2MLGA 3IKVA 3BPXA 3BJ6A 2XRNA 1S7AA 3BP8A 4P9UA 1UHWA 1GVJA 2H6CA 2OA4A 5CVUA 3H3UA 3O6BB 4BHPA 4IPAA 4N9IA 3BOQA 2O61A 2JT1A 3RJPA 4OIPF 1R7JA 4YIFA 1QO0D 1I1GA 5BS6A 3GFLA 2DT5A 4RGUA 3HSFA 1QZYA 3RYPA 1QNTA 1S6LA 2W57A 3R61A 2HS5A 1TW2A 2ZMEA 4CZZA 3WG9A 1S3JA 4EM0B 4EJUA 3K1NA 2VBXA 3J81Z 3JTGA 2D2WA 4IRGA 3CO7C 4P5OA 4IF4A 1PP8F 2GWRA 4L9NA 3NQOA 1BI3A 3QU6A 3GUDA 4MEYF 3J80Z 2ETHA 4WK8F 1G4DA 4GGGA 4RAZA 5HLIA 2XVCA 5K5QA 1K7AA 4MTEA 2EFOA 3O2PE 1W4MA 3ECHA 3E6MA 2LSOA 4I2OA 2GA1A 1MZBA 2DAOA 1KU3A 5LGUA 1WWXA 1QBJA 5CJ9A 1I1SA 2OZ6A 3R60A 1MJBA 3WTZA 5A2QK 2P7VB 3WGGA 4UVBA 1RNLA 5AIQA 3GEZA 1B6AA 4BH9A 2XUBA 4EM1A 3R0JA 1G3TA 2G7HA 1WRJA 5DUKA 5DYMA 2W24A 1CF7A 1EH8A 4KN7X 3IC7A 3TKYA 2F5DA 5CVVA 1VTNC 2FA5A 3ZQ7A 3ABUA 4M6YA 4HDUA 2AS5F 2XAHA 2ZXJA 2PJPA 1KQ8A 1XDSA 1TTYA 4KA4A 2PI0A 2PFBA 4UV8A 4HLYA 5KVRA 3DF8A 4KDPA 3CUOA 3M8EA 3VODA 5FB2A 3B02A 3FF5A 3ZMDA 5EEGA 1Z6RA 3LSTA 2MD5A 1YFHA 1XSDA 5CVIA 5ICGA 2GXGA 3F8NA 4I02A 2STTA 1B1BA 3FWEA 1BI0A 1U6GA 4CO8A 1LDKB 3HHGA 4L5IA 4OMZA 4M9SA 2M8EA 2HDCA 4OIRF 4Q48A 3V4GA 3G73A 5BPIA 1FBUA 5HS9A 2FMLA 1Q1HA 2K4JA 1W5SA 3ECOA 4Q47A 4JQFA 4BHCA 5D6FA 2V6CA 4M73A 4BNCA 2EFPA 5L3DA 1FBQA 5LGTA 2FMYA 3JAMZ 2EFWA 4PDKA 5DUIA 1A04A 2M45A 2TDXA 4HX7A 2EK5A 4IJAA 1BC7C 1HKQA 1ZREA 5CLSA 5J6XA 5LRRA 3CUQC 2DPDA 3KEOA 2V79A 5K5OA 4EGZA 1FC3A 2QUFA 3REOA 1ZRCA 4OINF 2DQRA 1TNTA 4AIJA 5FD6A 1FZPB 1ZRDA 1RZ4A 2YPRA 2K86A 3FXRA 4XBFA 3WTWC 1FT9A 1ON2A 1HBXG 1O3QA 1SFUA 3I58A 1HKTA 2DFIA 4YIIA 4Q5SF 1D5VA 2HFHA 3AAFA 3WTYC 4MNUA 3TOBA 1H9GA 1J0RA 5DD4A 3M9AA 5F64A 1BJAA 5LGNA 2C6YA 1PDNC 4YFXF 4MQVA 5FLXK 2VC0A 2RV8A 1HSJA 2IPQX 4OIQF 1DP7P 2KIUA 2CQKA 2A07F 4Y15A 2P5KA 2VT3A 4NB5A 3FM3A 3ZMVA 2COMA 4O5VA 1BIBA 2A5YB 3W6KB 3TQNA 4EVIA 3MZYA 3K9TA 1BN5A 2VE9A 4A0ZA 2Z9OA 3QP6A 2Z99A 2Q8KA 3ABTA 1S8NA 1FYMA 2A68F 4UXNA 2O8XA 3EUHA 5DEQA 1R36A 3KFWX 5LHGA 3WODF 1ZRFA 4RGXA 3QU3A 4LB6B 4WWCA 4G6DA 5BOXA 3ERED 2OBPA 1REPC 1O57A 4JK1X 1XGSA 4GYIA 1Y0UA 3RKWA 4LFUA 2ZFWA 2WC2A 2E7XA 2VBZA 2DBBA 2R3SA 1F9NA 3KP4A 2QENA 3FXQA 4UVCA 4BQAA 4FT8A 1WQ2A 3RYRA 2DO7A 5FFZA 3WTTC 4HA8A 2QQAA 3CLOA 5E1WA 1YTYA 3N97A 4YFNF 1JE8A 1U5TA 4GCVA 1JHFA 3T1BA 4RB3C 3GX4X 4M71A 1GHCA 2ADUA 3L09A 2H94A 3HSRA 3EDPA 4IRHA 2O3FA 2BYVE 5D6EA 4KT5C 1ZAOA 3FMQA 4EJVA 5D8KB 3V8JA 4HQEA 3F3XA 5FD5A 4I01A 1FP1D 1R1UA 2EJRA 3O3KA 1SD4A 1F1ZA 4Q4ZF 1YLFA 3L00A 1LDJA 1IF1A 3SHFA 4WX9A 2IT0A 2DQLA 4U7BA 1J7KA 2P5LC 4HX4A 2YR2A 1P2FA 3PQKA 4UVAA 2M87A 3FM5A 4EM2A 3EETA 1TQPA 3P7NA 3L2CA 4EV0A 3QRFF 1T38A 1D3YA 5E1ZB 4KNYA 1IW7F 4H0EA 4IXAA 2UZKA 1ZH5A 2R7DA 3DQVC 2Y48A 3IRQA 4G7HF 2JTVA 1LNWA 2J5PA 4WF2A 1HW1A 2FNAA 5ERIA 1KQ9A 2ZCWA 1IN6A 3HHHA 1O3SA 4FX4A 2P4WA 3JSOA 2KIMA 5D8LB 2P7CB 1ULYA 5H6RA 2PMHA 1U3EM 3COAC 3P9KA 4N9HA 2FE3A 4Z2YA 1OKRA 2Y0MA 1K79A
chains in the Genus database with same CATH superfamily
2BV6A 3DTEA 5E3MA 4KYWA 2ME0A 1C0WA 4HQMA 1OYWA 2XGDA 1IDZA 3CCUI 4KICA 1R49A 4S04A 4GDFA 2DJIA 3HJEA 2ZMEB 1TQIA 1Z1DA 4ZTFA 1BL0A 1P4WA 4L5JA 4XR6A 4J00A 5C4XJ 2XAUA 1JJ8C 3ZMUA 3Q5FA 2E2JJ 1JT6A 2LC2A 4UV9A 1IAWA 2HQAA 3HPHA 4MO7A 2HXOA 2VBYA 2ID6A 3HEFA 1MNEA 2DMTA 2QBYA 1R00A 4G94A 2ID3A 1YW8A 3C18A 3CJRB 3IWZA 3K4JA 2QZ8A 3RKYA 3OSFA 2M9HA 5H6QA 1Z67A 4LLGF 3GZ5A 4A3BJ 5HODA 4RAFA 1SVLA 4WCGA 3V8LA 2XF5A 4QTRA 2JZYA 4M9ZA 4AIHA 4ESJA 5E3NA 1IUFA 1K4SA 4M72A 2M0CA 2MABA 1O3TA 1HSTA 5M5WJ 2JQ7A 5DM6F 2JUCA 4UB6C 4BE1A 2W85A 2L54A 5FKOA 4UNOA 4Y7NJ 4PFOA 5A2QZ 2OAZA 4LG0A 4ZYDA 3OYAA 4XSZF 4EJWA 2DPUA 4I98B 3OS2A 5JLWA 2X48A 3CC7I 2L02A 2ESNA 4PSWA 1H88C 4KIGA 2HKOA 5TJJA 1Y56A 5FKKA 1EJ9A 4CH7A 4MFEA 4ZYGA 3BPVA 1MNDA 4B47A 1SFXA 2E1OA 2OD5A 1GLNA 5DD8A 5IPAA 5FJ8J 2XSDC 2VQLA 1FYKA 1WGXA 3IRRA 1IC8A 2IGNA 3FX3A 3LA3A 1TWAJ 4BJ6C 3VOEA 1W1WE 4BJTA 3GXOA 5J1YA 2QWWA 3HRUA 2CRGA 4BYYA 1X4PA 5GP9A 4YG2F 4AIKA 2JVHA 1ETVA 2DDBA 1P6RA 3H9QA 3NWTA 5C4JJ 1FIPA 2M1BA 1S7EA 3ML6A 1LUJB 1HOMA 2LNBA 2STWA 3WTVC 2ZJQF 1WJ5A 3V7RA 2V1DA 5FLMJ 3WU1B 1AHDP 1HW2A 2VODA 2VXZA 3BJOA 3KLNA 4A12A 3TP0A 3BROA 3I4MJ 4G8XA 4A93J 2J5OA 1CF7B 4KFCA 2E1MB 2WWYA 3C2GA 3S1NJ 1FEXA 2VE8A 2LFBA 5E20A 1JT0A 1U78A 3HRTA 1TLHB 1NK3P 1BA5A 3OOPA 4BY7J 4M6VA 3ONQA 1BOBA 3OYKA 2O03A 3ROUA 4IKFA 2XKPA 2OQRA 2M3AA 2X51A 1Y1WJ 2OTJI 1XMXA 3P9CA 4C30A 2IVMA 3VWBA 1ENHA 2V6EA 2HOAA 3QOPA 5FO5A 4ENJA 2XIGA 1I39A 3L9FA 5ED4A 3KCCA 3I0TA 2KJCA 3ABKH 4ZYHA 4RS8A 5F6FA 2WY7Q 3DV8A 4UUVA 2DCEA 1FY7A 1S72I 2HKXA 4Y3OA 3TDZC 3DPTA 3SEZA 1H9TA 2M7AA 2RN7A 1H89C 2YU3A 5KNLA 5BQTA 4O6JA 4FHTA 4KMUX 1V4RA 2L9SA 4I6ZA 2HZDA 3VYRB 1TNSA 1YIOA 3RQ4A 2X9DA 3TOAA 1B8IB 3GF2A 4XLCA 4RA2A 2EA4A 2WADA 4G9YA 3H9GA 1Z77A 4LITA 1W5CC 2VN2A 4ITVA 4A3GJ 3CQZJ 1W7PA 4HF1A 1VZ0A 5IY5H 1EH6A 4HBLA 2DMNA 2X6XA 3DWLE 4ZZLA 3RZDJ 2QGUA 3VB2A 2KJBA 5M3FJ 2ISYA 4IVNA 4D5CA 3CCEI 1BBYA 1KU7A 5B5EC 2PQ8A 5LLQA 2LF8A 2MW8A 1MSEC 2V9VA 2Y0SA 3F6OA 1TWHJ 3RZOJ 1ZK8A 5B1AH 4BE0A 4XRMA 2LKPA 1I5ZA 2UUZA 4L18B 4RGRA 1ETQA 3H3VK 4PJLA 3V8KA 1UHSA 1A31A 1U9OA 3BZ6A 2LF7A 2KDOA 3PNTA 4QIWN 3C1DA 4A6DA 1JJ6C 2F5CA 4ABZA 4LK0F 2ACJA 1PJRA 1KYWA 5JHFA 1IN4A 1BI1A 4LLLA 4IO9F 2ZJ2A 1LKXA 5D5UB 1WVRA 2D5VA 5LHIA 3ZN1A 2M5WA 1RI7A 3P5JA 4ESBA 3KZZA 2L3DA 4BHBA 4KIBA 1BIAA 1WH7A 1BI2A 2HR3A 1ZGAA 4M74A 3AFHA 3J7AY 4B48A 1XMKA 1BC8C 2P81A 3GTJJ 1P4XA 2FBKA 4OOIA 3BR6A 5HNHA 2VXDA 1VI0A 1OYYA 5JVTA 2FX0A 2IGKA 4L9JA 1PUFA 3Q0UA 4XICA 4XNFA 3S3NA 1XSVA 2IS4A 5ICFA 2YX7A 3HKZA 4HF2A 4EQQA 2GXAA 2LH9A 3BR5A 1E17A 4FASD 1G3SA 2E71A 4L5EA 1AA7A 3ZR8X 3G4SI 4HDVA 3W6VA 4AVPA 3I4PA 3DKWA 3F8BA 4D0PA 2LP0A 4XLNF 1ZYRF 2GZWA 2DA5A 2BVLA 2EB7A 3LFKA 5HS8A 2HTSA 3LQRA 2CQNA 2KL4A 3VEPA 3ZMZA 4FISA 4BXXJ 2X0LA 4DYRA 1A36A 2FOKA 1MKMA 2MGQA 2NNYA 1TZLA 2VONA 1BJZA 3JRHA 3TO7A 4IHVA 1JKQC 3CCSI 5HDKA 2O6GE 1TL8A 2E2IJ 2V1UA 4QPOA 1OCOH 1QU3A 2X6OA 3HUGB 2BXZA 2EV0A 4DBQA 4HRIA 4A3LJ 1DP3A 3D1NI 3U1DA 1X1AA 2Z5UA 1PVEA 2Y9YA 4P96A 4MLOA 1VQ9I 1IRFA 2RNJA 1HDDC 2CWEA 3OSGA 1O7FA 1DU0A 3A0HC 3OIOA 1KYZA 1MW7A 2ZB9A 2E35A 3LSGA 5IT9K 2CW7A 2LKSA 3HTSB 3F0CA 5ILSA 3W6JB 4FETA 4A3CJ 5FLXZ 4RB1A 1K78B 2OJED 3HGGA 2HVQA 2K9QA 5L3BA 1Z7UA 5CKTA 4ZDLA 1X1CA 5GAGJ 5D4RA 4XLPF 1YIJI 1XDUA 1D5YA 3QP5A 4M3EA 3RI4A 2L9RA 4B4CA 2MG4A 5JFRA 4DQ2A 3ULQB 2OPTA 3FK7A 3A02A 4E7SA 5E79C 2KZVA 2ZMEC 3RCOA 3TGNA 2HZTA 2Y30A 2IW5A 2WTEA 2FBIA 3HUGA 5HVQC 1SVMA 1YJ9I 2IP2A 3EYIA 2IS2A 3UKGA 1JUSA 4M3BA 1YS7A 3HIFA 1LQ1A 1JTYA 1JGGA 2HXIA 4JX6A 4XOTA 3HXLA 5E8GA 1T2KA 2L7MP 1BR2A 2K85A 5LEKA 3SFIA 3SZTA 2EIKH 3E0JB 1F5TA 5EEAA 1E3PA 2KZGA 3CMMA 1K78A 3K7AJ 2E2HJ 1D8JA 3KPHA 4A3MJ 4EGYA 2QYOA 3OR1C 3A01A 1Z6TA 4FX0A 5DDGA 1FOXA 3LA7A 3MAJA 1Y1VJ 2FU4A 2XHKA 1HC8A 2F5FA 4B09A 5K5RA 3SZGA 2VKVA 3CF2A 2CW0F 4LOCA 5H2FC 4A0XA 1E0EA 2M4KA 3KP7A 1IRGA 2FEZA 4P1WA 2GIVA 4F55A 5HLTA 1FX7A 2ZFUA 3ELKA 4CYCA 2X6YA 1LDDA 5JVGF 3S2DJ 2QKLB 4ZYEA 4HV5A 3G3ZA 3L2UA 4CZCA 1P7JA 3PFYA 3C3WA 1D1AA 1OCCH 2ZBKA 3BTJA 3TL4X 2R7QA 1IUYA 4CSWA 3K0LA 5CVRA 3S16J 1WHUA 1FP2A 1MMGA 2QQ9A 2QSFX 2CU7A 2QQBA 4C2TA 2MA3A 1JKPC 3KP6A 3JTHA 3OYDA 1Z91A 4JP0A 4BJ5C 3PUFA 1R58A 1ETYA 3GTKJ 1R1TA 3OV8A 3L1PA 3Q0VA 4LK1F 3LNQA 2WV0A 4FE7A 3WGHA 3LAJA 3ZMSA 5IP6A 3SXYA 1T39A 2K02A 3HRSA 3CJQB 1Z05A 2YX4A 2DODA 2MFZA 4UHTA 3LSPA 2W00A 3ZQIA 3K2ZA 1DUXC 5JR3A 1FBSA 4U88A 2UXNA 3B73A 2KT0A 2E1MC 3S8PA 3HTUA 1HA8A 3E3VA 2HNHA 2GLOA 4BXUA 2GOMA 1U5TB 3WHCA 3Q3SA 1IXSB 2B7EA 3RIRA 4IHWA 2WAQA 3K4CA 1GT0C 3U2RA 2MBFA 1NG7A 1G3WA 2RAEA 2ZJPF 1ZQ3P 1NTCA 5F27A 3HL2A 2EPFA 1X4OA 3L2VA 3PNVA 3O8HA 3VFZA 3KEYA 2R5YA 1YS6A 1YG2A 1K61A 4CDGA 4ETSA 2IBDA 2O0YA 2BY1A 2JPCA 1QHHD 3IP4B 5DCFA 1FYLA 1O3RA 3DXJF 3G6EI 2CGPA 1S7OA 2VPRA 3CJNA 4F7ZA 1RKTA 3H35A 1OJLA 1OPCA 3VSLA 3H3ZA 4GO1A 2EA2A 4HLXA 2L01A 4PK4A 3CP8A 2K9SA 4NC7A 5F0HA 5F0FA 1YHQI 2EH3A 5CVJA 2VT2A 2EWNA 1QGPA 3F72A 4U0YA 2CMPA 3K6GA 2RGVA 1AU7A 5IP9J 3LWFA 3VYTB 3OS1A 1H0MA 1XG1A 1VQOI 4MEXF 3H5AA 1Z3XA 3PM1A 3T8TA 1ACIA 1ZG3A 4IEJA 1KQ0A 2NS0A 5J4VA 1YJWI 4L9TA 3RSNA 2R5ZA 4PGHA 4AD9A 3S3MA 4OMYA 2XGXA 2FXAA 3IH2A 1LEAA 1SMYF 1P4AA 4ON0A 2P6SA 1E3HA 2L7KA 1KU2A 3IUOA 4IHSA 2L0KA 2CQQA 3R6SA 2XASA 5E17F 2R7TA 3FXJA 3QWLA 2VQCA 2ECBA 3I53A 1A35A 3M7GA 4KISA 1E3OC 2IA0A 1XN7A 3SYTA 3KLOA 4IHTA 1SMTA 1Z0XA 2ZKZA 4A5MA 3O8GA 3S2HJ 2ELHA 1O7LA 1WJEA 1FLIA 3F8CA 3JRBA 2PG4A 3OS0A 2VKDA 4E4HA 1JGSA 1T98A 3S2WA 5EG0A 4G7OF 1A6QA 1WKMA 1Z21A 1GUUA 4JBAA 1FPQA 1MMAA 2F6CA 2X4HA 1BW5A 3BWGA 2BGCA 2LMDA 5DCMB 2IRFG 2D1VA 3QPLA 1OLTA 3DTIA 3IAS2 4I09A 4ENKA 2W25A 2A6HF 1LB2A 2KLOA 5D5XB 2YS9A 4A2UA 5KAIC 2HEOA 5FKLA 3MVPA 4XORA 3OYGA 4DNCA 1TWGJ 2L9VA 1QQIA 1WI9A 1LJ9A 3FXOA 2EILH 5B1BH 5ICCA 1U2WA 2K5CA 4HSTA 4UUTA 4RB0A 2CJJA 3E5QA 1WPKA 2FSWA 1B4AA 1SD7A 4ZH4F 3M8JA 3S3OA 3BT9A 3RDIA 3SQNA 4N4OB 2Y31A 2ICWG 4BQNA 1IJWC 1IXCA 4XN0A 2DTZA 4BY1J 3C2HA 2H6BA 3DKYA 3GLLA 3K1PA 2W84A 1S9HA 2KQRA 1T95A 1UG0A 1NK2P 1PYVA 4KJZA 2DFHA 3DP7A 5IYBJ 4K2EA 3CESA 4YFKF 2XV4S 2IA2A 3QAHA 1RUOA 5FLVA 1BM9A 2LLKA 2H1LA 1R5HA 1XD7A 3M1CA 4M6XA 4RAGA 1J59A 2K7LA 1LVKA 2W82A 2HOSA 4BEHA 1EKEA 2DMPA 4DJAA 3KP2A 5TISC 3WE3A 3L2RA 1RRJA 1K6OA 3E6DA 2HWVA 2R0QC 5D5WB 2JA7J 4HSRA 1IXRC 5DCMA 1KZHA 2COBA 3I56I 2D45A 2KFDA 5K7FA 2QBYB 3WU2C 1MBFA 1XMAA 2QF7A 3BQYA 4G7ZF 2NVXJ 3GWZA 3LA2A 4HAMA 3HOWJ 4LGWA 2K4BA 1JHHA 2CW8A 3H1CA 3DU6A 1W36D 4KUMA 3T0YA 2CQ7A 3OYIA 2Y69H 3VPRA 1QZEA 1HF0A 3FMSA 4RAYA 3JW4A 4NDLA 1V55H 4G6TB 3LOCA 2OU2A 2R7FA 1T6SA 1Y8RB 3N4MA 1ETXA 2DK5A 2HDWA 4G6QA 4A3EJ 4LG0B 3BY6A 2DDAA 2Y75A 5E3OA 1ZGJA 2VOOA 4CCKA 6PAXA 3CUQB 1SFOJ 2DMQA 2OQGA 4HOBA 4FE4A 2JN6A 5D4SA 2DT7B 2EV6A 4A3JJ 2EZHA 4N0BA 1TC3C 2HQNA 1YRNA 3E6BA 1V54H 1OISA 3OY9A 2MYSA 2XPVA 3LSIA 3WTSC 3OYEA 1ZHFA 1J9IA 4MHGA 4OIOF 1MNMC 2CG4A 4Y33A 4JX5A 3ZPLA 1AKHA 2VC1A 1LFBA 3NAUA 2VJJA 3F8MA 3A2KA 1G2HA 3E6CC 5KCMA 3F21A 2PLYA 2B63J 3VDXA 4AU7A 2O9LA 3CCJI 1SAXA 4F3QA 4Y52J 4MGRA 2G9WA 1O4XA 4XKBA 4AM3A 1J2XA 2CFOA 3FKJA 1MJAA 4QWQA 5J1UA 2FQ3A 5GTHC 4NHJA 3I64A 1D8KA 4XMYA 2FD5A 2Y9ZA 3NRVA 1HXDA 2DK8A 4RB2C 5BPDA 3D0SA 1POGA 4NNJA 3CCVI 4Y13A 4ZJZA 3EUHC 1Y8QB 3D5LA 5HDNA 5GTIC 3JRFA 3QPTA 3LSRA 3CUQA 4PJMA 2XGEA 3BTLA 3GZ6A 5J1RA 2M4GA 1ONVA 3FMRA 2X85A 4M9XA 3CMYA 4LB5A 5J47A 1LFUP 2BEOA 3E5XA 2E7WA 3H5NA 3HRMA 2P5VA 3ZQCA 1X1DA 1S29A 1Z9CA 4A5NA 1G6NA 2A69F 1DGRM 1UFMA 3AG3H 3MEXA 2ZSIB 2ME6A 3RTRA 2JWTA 4A0YA 3GTQJ 4O3MA 1VQNI 4I7HA 5ILVA 4RMNA 4ZDOA 3S1MJ 3GZNB 5E1XA 3MZ8A 4CHUA 2JA2A 5F1JA 2VUMJ 4I0AA 2R7SA 1W7PB 4XQFA 1R4MB 2F4IA 3FDYA 3I59B 1QPMA 3DCFA 5ICEA 2EZKA 1KU9A 4XIDA 3CO6C 2R7VA 3KEQA 2UXXA 3JCUC 1SFEA 3K4NA 2LD5A 4MTDA 3A0BC 5HDGA 5JI6A 1R6RA 1SD6A 1IZ1A 3Q9VA 5J8CA 2BY2A 1UELB 3GLXA 5AIPA 3JRDA 3GFIA 2R7WA 2JA8J 4R8HA 2AO9A 3SFZA 1U5TC 2OTLI 3TMOA 1JTXA 4XKWA 3GFJA 1FJLA 3ABMH 3A4CA 1VFCA 4E70A 3RPUA 2KRHA 1E2XA 5FGMA 3R0AA 2DLLA 2CFXA 1TWCJ 4EJOA 5C44J 2DW4A 2QM3A 2NS7A 2PMUA 4XLHA 2I10A 4NQWB 3U9GA 4CCJA 2A61A 3EYYA 4UUSA 1HQCA 1WJCA 3CZ6A 4L0YB 3F8FA 4X0GA 2HYGD 2R4GA 4PZJA 5FRMA 5F08A 4D9JA 2DI3A 3OL3A 1RC9A 2NNNA 3PFIA 1UCRA 5L3FA 3C7JA 3OL4A 4G12A 1B59A 2L4MA 1R5GA 3I59A 3WG7H 4GFBA 4N4NB 1FNNA 1PUFB 1GV2A 4ENMA 2VKHA 3V7SA 2Y2ZA 1MGTA 3QYEA 5EZHA 1IN8A 4PJJA 2PEXA 3ZP5A 1YW9A 1HCRA 1ZLKA 1OMIA 3J81K 1W36C 4KMFA 2KISA 1LEBA 1ERDA 2HTJA 4KN4X 4CA0A 5LRSA 1X1BA 3ERMA 3M07A 1YE9A 1TQMA 3CMEI 1B72A 2QSGX 3MKZA 3BJAA 2VL8A 3IH4A 3OYMA 1T0FA 4HYEA 2PJRB 2OZUA 5IT9Z 5LBQA 4B8XA 3J80K 1BOAA 5H20A 4NQWA 3F22A 1JKRC 2W48A 3WHBA 3G1LA 2E1CA 1B9MA 3MKLA 4QPQA 1MD0A 4XONA 3HOTA 2JA5J 5HOOA 3OYFA 1MJ9A 3CDLA 2VBWA 2NRAC 1MH4A 2JSPA 1X1PA 3HBLA 3WU0A 2LRDA 4U0VA 2IGOA 2Y0SN 1W7PD 3LL7A 2VLAA 1Q1VA 4WXHA 5M5YJ 5D5VB 2XGCA 4S05A 2WB1A 1W5TA 3JRCA 2DFFA 4CCLA 3K10A 3D5SC 2PMZA 4HZFA 2OUMA 2WA0A 2KKOA 1FOWA 3F6VA 3I5UA 1N25A 3GTMJ 2NYXA 3FHZA 2Q2EA 4AWXB 2VOPA 3EUAA 2VIXA 1YQAA 3DEUA 2L4AA 2RQPA 1V3FA 3SEQA 4L0ZB 3D5RC 1RR8C 2E5ZA 3GFMA 3E5UA 2FBHA 2QVOA 2PJRA 3BR3A 4CCOA 1WSUA 1EF4A 2JPBA 1BW6A 3MKYB 3FXUA 2CUJA 3TO6A 1XCVA 2RVCA 4J19A 1VQ5I 5KAFC 5DS9A 2E5NA 5ILUA 4M3FA 3MWMA 2AQEA 4B3XA 1SVOA 2E34A 4CCNA 3G2BA 1K83J 4XSXF 1YW7A 1J5YA 1MBEA 2HQ5A 2EFQA 2P6TA 5JHUA 2HOEA 3BG6A 3PL8A 3W2AA 3I54A 3HKZN 3LAPA 3H0GJ 3LFUA 5HLGA 1OR7A 5HLHA 1GVDA 2M8GX 3CDHA 1TWFJ 2L7FP 3SZPA 2MC4A 4IQJA 2NOGA 2DU9A 2F4OB 3LQQA 1I27A 2A5WA 2KRFA 2V1NA 4XKCA 4E7ZA 5L3GA 1P7IA 4LLNA 4GRIA 4NUBA 4ZDPA 4WXCA 2D1HA 4H4KC 1R1VA 3A01B 5F1RA 1KGSA 3TBIA 4BS9A 3RKXA 4OAYA 3CCMI 4BUPA 3MMYB 4BQOA 4HNVA 3HOVJ 4DBRA 2EFNA 1XX5A 2A3SA 1ETKA 2CV1A 1KONA 1GDTA 1JXSA 4WXDA 2VB6A 4MQ9F 2YSRA 1IN5A 4CYCB 2WAFA 3ISPA 2GAUA 1G3YA 5J4YA 4CGZA 3ZN0A 2DOEA 3GBGA 3M1EA 4BAYA 4Y17A 2V9KA 3TO9A 2KDZA 3HOZJ 2HQRA 2NVQJ 3IV5A 4YIRX 4HW0A 2K3PA 1ZR2A 2MH9A 4GXOA 1YYVA 4L9VA 4CICA 4UY8I 3PO3J 3KYCB 2RDPA 2XAJA 3G1MA 2V1XA 1ZG5A 2QLZA 2HGCA 4IHXA 1G8XA 3T5XA 2LYCA 3LSJA 1HW5A 5DM7F 4OAZA 1F4KA 3H36A 1UB9A 4ASNA 3AG2H 2O5RA 1UG2A 1R71A 2OC6A 5AONA 3W3CA 1ZLJA 4E7LA 2QKMB 3PNYA 5CQGA 2F2EA 3QYFA 3LSMA 1W0UA 4DYQA 4IRIA 1V5FA 1XGMA 2NVTJ 2OCEA 3L7WA 1XS9A 3M4OJ 4AVZA 2FF4A 2OCCH 2XAFA 3OYBA 1FWZA 1XSXA 1ZG1A 1PUEE 5E3LA 1QVUA 4AUXA 4CXFA 3FIWA 4PFPA 2FNPA 3KP5A 2XAGA 1OCTC 2XKOA 1FMWA 4XM3A 4BBSJ 3RPQA 3JAMK 1Z3YA 1U8RA 2UWMA 5L3EA 5K1YA 2HYFA 3DLLF 2CO5A 3BCBA 2MH2A 4KIFA 2R5YB 4LIUA 1LFPA 1XCBA 1T08B 2VJ4A 3H92A 2WBMA 2BE5F 1CGPA 1ON1A 1I6XA 2LVSA 2KIFA 4RDUA 2NVYJ 1XTAA 3DFGA 3G71I 2DA1A 4HX8A 1QA6A 1IRZA 2IAIA 3E7LA 1VQPI 1XB4A 5LEJA 1P92A 2L2OA 2HYJA 3EQLF 3IHUA 2DFEA 2CQXA 4BACA 4P9FA 2BVMA 2ISZA 2ZNZA 2B0LA 2H27A 1TBXA 1U8BA 3GTLJ 4R79A 1ETWA 2Z3YA 4I0BA 4XLFA 2MD0A 2ESHA 2FRHA 3DEWA 3V7CA 4HNTA 4LD5A 5E18F 1DPRA 4TV7A 5CQEA 5J3LA 2R5ZB 2R7ZJ 5J8FA 1F36A 2H1KA 5F0CA 2H09A 3N05A 3W2WA 3ZQGA 1DPUA 3DEEA 4V2FA 2OF7A 3DBRB 4BQQA 1QPIA 3CCQI 4ENNA 2ZNYA 3NEUA 1TW3A 1L3LA 4PGGA 4MFDA 4PUSA 2A6EF 3J7AO 4U87A 4RGSA 2IEKA 4IX7A 1Y6IA 4JX4A 4V2GA 5LHHA 1AWCA 3KYLA 1IGNA 2KMUA 1HKSA 1ORKA 3WTXC 3BR2A 3CCLI 2BBYA 3CC4I 4A3DJ 3S93A 3S17J 3WGIA 4E7IA 2JSCA 2XB0X 3P9IA 4ESFA 5CPRB 2GA2A 5EG0B 2CV2A 3QQAA 1XGOA 1SFKA 3TDUC 4DIQA 4U0WA 3HOSA 3HYIA 3H9JA 5L3CA 2E60A 4ZZDA 3ZOBA 2WAQN 5E8IA 1SD5A 1AOYA 1NHAA 1YO5C 1NG6A 3KZYA 4QLCU 2NAZA 2VJ5A 3MQ0A 3OYCA 4EJTA 2XB5A 4PCQA 3E97A 2BZTA 2P8TA 4EEFG 4A3KJ 2AXTC 2IGMA 3BR1A 3K1MA 2ELJA 3HG9A 3GYHX 1FSEA 1QZZA 4ZTJA 3IL2A 5HS7A 3CD6I 3PQJA 3WTUC 2F4MB 1STZA 5EEHA 3J7YJ 1UHMA 1IN7A 1L0OC 2PBIA 4GYGA 1ZARA 4Z6YA 2IA1A 3IKTA 3GCMA 3AL0B 3FBIB 4HPQA 3K4MA 3BLYA 3I71A 4HV6A 1X3UA 4XN3A 4XRSA 2E1NA 2XAQA 1FSHA 2RKHA 5KK1A 3GO5A 2FOWA 4W1UA 3R4KA 3IWFA 1OCPA 4XRFA 3MKWB 3HC7A 3ZQQA 2NS8A 3FXKA 4LIVA 1ETOA 4BEHB 5IT3A 4D7MA 1IDYA 2LDUA 4XL9A 4UB8C 3S32A 3HOXJ 4XK4A 3DPLC 3I55I 2LKXA 4F91B 2Z2SB 2Q0OA 1PP7U 4A69C 4C3HJ 4BDZA 1KA8A 2AHQA 2KP6A 3K69A 1OYIA 2XF7A 3PJRA 1RUNA 3BG5A 1DU6A 3RKQA 3KETA 3MCZA 2G7UA 3ZXSA 4C9YA 4P55A 4BKXA 2EIJH 1DGWY 4IOCF 5TRDA 2N8GA 2PN6A 2NXNB 3PUBA 5IYCJ 1RIOH 4LJZF 2F5EA 1D1BA 2K27A 3SDGA 1ZN2A 3MFKA 1USTA 3MZHA 1USSA 5DV5A 1MDMB 1LVAA 4FQGA 2M30A 3KE2A 3OYHA 4KITB 2DYSH 3M8FA 1MBHA 1RPWA 3ZMTA 2DTRA 5BMZA 1EV7A 1ZELA 3T8RA 1ODDA 4AYBA 1DDNA 4C3JJ 4LMYA 3GTGJ 2CYYA 2KPMA 3BZCA 1X3ZB 1H8AC 1Y0NA 3HOUJ 2ZC2A 1Y39A 5K7HA 1GXQA 3Q9SA 2GM4A 2CV0A 3FXMA 1YRNB 3DPUA 4A6EA 3BTCA 1R22A 2MLKA 1R23A 2A05A 1V5EA 3GVAA 2CSOA 2A6TA 3WE2A 1JUPA 1GXPA 4CYDA 3CMAI 1AKHB 1YI2I 2AXLA 1WFXA 3BDDA 1EH7A 4DOZA 3GW2A 2HU9A 3FBNB 3FZVA 2Z33A 4KT6A 1K4TA 1OCZH 1FOKA 2E36A 2XROA 2QCOA 3KP3A 2I5UA 5IOZA 3CTAA 4OU0A 3VSKA 1V5GA 2LREA 4NC8A 2HPIA 2IJLA 2CUZA 5BNGA 4II2A 1CQTA 4HF0A 5CYVA 2BY3A 1MDMA 3JSPA 3BG9A 1J75A 5FFXA 2GIZA 4S0HB 3I4NJ 4M3GA 3QPHA 2GQQA 5J40A 2EV5A 4B43A 1P9QC 2HPMA 2GXBA 1WCMJ 2BHYA 3SJMA 4C2MJ 2JRTA 2ZO4A 5EJCA 3F23A 2X1DA 2V26A 1B9NA 1APLC 4HNUA 2G0EA 1N75A 4IQ4A 3HSEA 2DJNA 4JYKA 4RM2A 4EMSA 1YX3A 2DA4A 4R1HA 2MC3A 4U7DA 2RC4A 3V42A 1XGNA 4FTHA 2MLGA 2MSYA 3IKVA 3BPXA 3BJ6A 2XRNA 3AKZA 5EDNA 1S7AA 2YUSA 3BP8A 4IOAF 2CUFA 2LY2A 2EBIA 5EZGA 2VQHA 4IHYA 5EGOA 4Y4RA 4P9UA 1UHWA 1GVJA 2H6CA 2OA4A 3QYBA 3G1OA 2VQGA 5CVUA 3H3UA 3O6BB 2DMUA 4BHPA 4IPAA 3HZJA 4N9IA 3BOQA 1MIJA 3OIQA 2O61A 2JT1A 3RJPA 3OR2C 4OIPF 1WH5A 1WJDA 1R7JA 2LBFA 3B6AA 4NBQA 1SEUA 4YIFA 1Z7LA 1FTZA 1QO0D 1I1GA 2DA3A 2DT6A 3CP2A 5BS6A 3GFLA 1EA3A 3OOUA 2DT5A 1A6IA 4E7JA 3GTPJ 4RGUA 1MMSA 3UNGC 3HSFA 5M5XJ 1QZYA 1GV5A 3RYPA 9ANTA 3PSIA 2KHMA 1QNTA 1S6LA 3FKIJ 2W1OA 1YITI 2W57A 3R61A 3ESWB 3HM5A 2HS5A 1VNDA 3S14J 2R7OA 1TW2A 2ZMEA 1VQKI 4CZZA 1I50J 3WG9A 1S3JA 2L7ZA 4E6KG 4M3DA 4RLFA 4UUSB 4EM0B 4EJUA 3FHNA 3K1NA 1X19A 2VBXA 3J81Z 2YU9J 1OQYA 3BG7A 3JTGA 2D2WA 1QVTA 4BGDA 4IRGA 3CO7C 3TW6A 2WAEA 1G59A 4P5OA 4IF4A 1SAUA 1PP8F 1I3AA 2GWRA 4L9NA 3K2AA 2IS6A 2EQRA 2FUG2 3NQOA 1BI3A 3QU6A 3GUDA 4MEYF 3J80Z 2V7FA 5F04A 2ETHA 2NOJB 4WK8F 4W97A 3PO2J 5EYRA 1G4DA 4GGGA 4IZZA 1JUMA 4ZYAA 4RAZA 3HDDA 5HLIA 3BC8A 4J01A 1XC5A 2XVCA 4FCYA 5K5QA 1K7AA 1B72B 3C2BA 4MTEA 5FRNA 2B9SA 2QQ8A 2EFOA 3O2PE 1W4MA 3ZRGA 3QPSA 3JRAA 3ECHA 4DW6A 5GAHJ 5LFAA 2XDVA 2HVSA 3KX2A 2M34A 3E6MA 1RKWA 3EUKL 1X58A 4DYCA 2LSOA 2DN0A 4I2OA 2GA1A 2GOXB 3ZQHA 5GPAA 1MZBA 4DGWB 2EINH 5K7ZA 2DAOA 1KU3A 5LGUA 1WWXA 1QBJA 5CJ9A 1I1SA 2OZ6A 3R60A 3MN2A 3DBHB 1MJBA 2O7OA 3PIOF 1RETA 3WTZA 5A2QK 2P7VB 1UMQA 3WGGA 4AIDA 2DA7A 4UVBA 1RNLA 5AIQA 3GEZA 1B6AA 4BH9A 1UZCA 4I76A 2XUBA 4EM1A 3R0JA 1G3TA 2G7HA 1WRJA 3IAM2 3OYJA 3GTOJ 2DXIA 5DUKA 1D1CA 3DLAA 3QOEA 4MIMA 4XOPA 1R5ID 4F93B 1LE8B 2JA6J 5DYMA 2BY0A 2W24A 1X2NA 3B6CA 3JR9A 1U9NA 2Q2EB 4CCMA 3ZQLA 1CF7A 1EH8A 2WY8Q 2ECCA 3BTIA 4KN7X 1FMVA 3IC7A 2K3FA 3TKYA 2F5DA 3KZIC 3CF5F 5CVVA 1VTNC 2FA5A 1T56A 2ZXHA 4XRSG 3AL0C 3ZQ7A 3RPUD 2JK3A 4RBOA 3ABUA 3OWTA 4M6YA 4HDUA 2AS5F 3ZQFA 2XAHA 3BQZA 1FIAA 2ZXJA 1ITYA 2PJPA 1VQ7I 3SDBA 1KQ8A 1J09A 3KIOA 1XDSA 3HPGA 1YOVB 1TTYA 4KA4A 1NH3A 1YJNI 1ZGWA 2PI0A 2JUGA 2PFBA 3H5RA 4UV8A 4HLYA 5KVRA 3DF8A 5DTDA 4KDPA 3CUOA 3M8EA 3VODA 5FB2A 1VF9A 3B02A 3FF5A 1VQMI 3ZMDA 5EEGA 3F9KA 4BBRJ 3KYDB 1Z6RA 3LSTA 2MD5A 2TRTA 2UV1A 1S5LC 2Z16A 1YFHA 1LE8A 1B8IA 3Q0WA 5C3EJ 1XSDA 4YEJA 5CVIA 3VYSB 5ICGA 5IP7J 2GXGA 3F8NA 4I02A 4AC0A 1B1BA 2STTA 3S15J 3FWEA 1BI0A 3DU5A 2QEXI 4BDYA 3QODA 1SC7A 1U6GA 4CO8A 1LDKB 3AG4H 3HHGA 4L5IA 4OMZA 2QA4I 4M9SA 2VJIA 2M8EA 2WV1A 2HDCA 4OIRF 5IOYA 2K9LA 2DA2A 4LG3A 1WI3A 4Q48A 1T33A 3V4GA 2H8RA 4BL0B 3G73A 5BPIA 2WB1N 3FK6A 1FBUA 2LOOA 4OWRB 1I3QJ 5HS9A 2PMZN 3A03A 2FMLA 4YELA 1Q1HA 2K4JA 3MD2A 2R7UA 3K4BA 3TEDA 4BXFA 1W5SA 1SANA 3ECOA 2V4JC 2H8WA 4Q47A 4JQFA 4BHCA 5D6FA 2V6CA 2Q1ZB 2W7NA 4M73A 3JREA 2EFPA 5L3DA 1JKOC 4BNCA 4NC6A 1XPXA 2DOAA 1FBQA 3OYNA 5LGTA 2BXYA 3HB9A 4II3A 4I99C 2CH0A 2FMYA 3NARA 3JAMZ 2W4SA 2HDDA 2EFWA 2P0WA 5KHDA 4PDKA 5DUIA 2LG4A 4B1RA 1A04A 2XSJC 2M45A 4F52A 3JRIA 2TDXA 3BZKA 3CLQA 3FXLA 4HX7A 3K70D 2EK5A 2K9NA 4IJAA 1BC7C 5IYDJ 2EZLA 1HKQA 1ZREA 3J7ZI 4A3FJ 2E19A 5CLSA 5J6XA 1D0YA 5LRRA 4ZC3A 3CUQC 3HGYA 2DPDA 4C3IJ 3KEOA 2V79A 5K5OA 4EGZA 1FC3A 2JVGA 2QUFA 4B44A 3TW7A 3REOA 4YRVA 1ZRCA 4C2UA 2XPWA 4OINF 5GADJ 2DQRA 1TNTA 2KIQA 3LSHA 5FD6A 4AIJA 1FZPB 1ZRDA 1RZ4A 2PX9A 4RLQA 2DA6A 2F48A 1MMNA 2YPRA 2K86A 4D1QA 1IV8A 4HEA2 5FROA 3FXRA 4PSXA 4XBFA 3U21A 3WTWC 5GPCA 1FT9A 1ON2A 1HBXG 1O3QA 1SFUA 1BR4A 4V19K 3I58A 1HKTA 4DZJA 2LY9A 3S1QJ 1MBJA 3S1RJ 2DFIA 4YIIA 4D5FA 1HDPA 4Q5SF 2EIMH 2L9NA 4BU2A 4EATA 1MBKA 2VI6A 4JOMA 2VASA 2HFHA 1D5VA 2V9PA 2LTPA 3NWSA 3AAFA 2HI3A 3DTKA 3LSKA 3WTYC 1MMDA 3OMYA 3OYLA 4MNUA 3TOBA 1H9GA 1J0RA 5DD4A 3M9AA 5F64A 2BOLA 3CCRI 1BJAA 1I6HJ 5LGNA 4E7HA 2C6YA 1VQ4I 1PDNC 4YFXF 4MQVA 5FLXK 2VC0A 2RREA 2RV8A 1HSJA 1D0XA 2IPQX 4ANJA 4OIQF 1DP7P 2LK2A 2KIUA 1N77A 5TGTA 1UJ8A 1VQ8I 2I8DA 2CQKA 5LD2C 1MBGA 4Y15A 2A07F 2P5KA 4PJ0C 2VT3A 2QSHX 2M7BA 4NB5A 3FM3A 2XF6A 2F5VA 3BG3A 5GAEJ 3OIPA 4DZPA 3ZMVA 2COMA 4O5VA 1BIBA 2X1EA 1TT0A 2A5YB 3W6KB 1OCRH 3TQNA 3CJTB 4EVIA 3MZYA 3U1KA 4BE2A 2M2EA 1A5JA 2R93J 3K9TA 3JRGA 1BN5A 4XLEA 5JLXA 2VE9A 4A0ZA 2OV7A 2Z9OA 3QP6A 2Z99A 3BR0A 4X6AJ 3I3LA 2Q8KA 3ABTA 1S8NA 2ELKA 1FYMA 1WJAA 2A68F 4UXNA 4E7KA 2O8XA 3EUHA 4CUGA 1TT5B 1FOYA 2ZXIA 3W2VA 1MH3A 5DEQA 1T0FC 1R36A 3UR3C 3KFWX 5LHGA 3WODF 1ZRFA 4RGXA 4D7NA 3QU3A 4LB6B 4WWCA 2EZIA 4G6DA 2HOTA 3HOYJ 5BOXA 3GMEA 4X1EA 3ERED 3TP3A 1IRXA 2FQ4A 2OBPA 5FKMA 1REPC 1O57A 4JK1X 1U0JA 3M3YJ 1XGSA 1R9TJ 4GYIA 3CC2I 1Y0UA 3RKWA 3EPZA 4LFUA 2X1CA 2ZFWA 2WC2A 2E7XA 2VBZA 2DBBA 2R3SA 2L5QA 1F9NA 4HG2A 3KP4A 5B66C 1MSFC 1WJFA 2QENA 2XPUA 3FXQA 4UVCA 2IS1A 4BQAA 1TP4A 3I9V2 2XRLA 4RM3A 4FT8A 1VQLI 1WQ2A 2JJ7A 3RYRA 2DO7A 5FFZA 1ZKGA 2DYRH 1D0ZA 3ZGKA 2RQQA 3WTTC 4HA8A 3L2QA 2QQAA 3CLOA 5E1WA 1YTYA 5B3SH 4XLAA 3N97A 3K70C 1YX5A 2RNGA 2BW3B 4YFNF 1JE8A 1U5TA 3A1YA 4GCVA 3L2WA 1JHFA 5EF6A 3T1BA 4RB3C 3GX4X 1BR1A 4M71A 2TCTA 1GHCA 2ADUA 3L09A 2H94A 2JMWA 3ABLH 3HSRA 3EDPA 1N78A 2BHZA 2NVUB 4IRHA 2CS3A 2ZSHB 2O3FA 2R7XA 2JRMA 1WZ2A 2BYVE 5D6EA 4KT5C 1T8IA 1VQ6I 1ZAOA 3FMQA 4EJVA 1OR7C 2GBYA 1W0TA 5D8KB 3K4KA 3V8JA 4HQEA 2K9MA 3K4LA 1RR7A 1K6YA 3F3XA 4F92B 5FD5A 4I01A 3ASOH 2HVRA 1FP1D 2R7RA 4A3IJ 1LPQA 1R1UA 4XKVA 1ZR4A 2EJRA 2KRCA 1M1EB 2VPLA 2K40A 3DBLB 3CDIA 3O3KA 1RESA 1SD4A 1F1ZA 2IXSA 4Q4ZF 1X3WB 2BW3A 1UAAA 1YLFA 4PJNA 3L00A 1LDJA 1IF1A 3DKXA 3SHFA 4WX9A 1ZTRA 2IT0A 2DQLA 4U7BA 1J7KA 2LR8A 4HX4A 2YR2A 4QSHA 2P5LC 3LMMA 1P2FA 3CCYA 1WJBA 3PQKA 2R92J 1FTTA 3PIPF 4UVAA 2AQFA 2M87A 3FM5A 4B3AA 4EM2A 1JI8A 1X2MA 3EETA 1IV6A 1TQPA 3P7NA 1OFCX 3L2CA 4EV0A 2XC7A 2CUEA 1R4NB 3QRFF 2LY1A 1T38A 5M3MJ 1D3YA 5E1ZB 4KNYA 3ZCOA 1IW7F 1IG7A 5EGOB 4H0EA 4IXAA 2UZKA 1ZH5A 2R7DA 3DQVC 3AG1H 2DOFA 1IO2A 2VKEA 2Y48A 3IRQA 1HLVA 4G7HF 2O8KA 2JTVA 1DQUA 3E1SA 1LNWA 3H0DA 3RQIA 2J5PA 1QRYA 2ZXWH 4WF2A 1HW1A 2FNAA 3PSFA 4AYBN 5ERIA 1KQ9A 2M0MA 2LBFB 5HNFA 1QHGA 2ZCWA 1IN6A 3X2QH 3HHHA 1O3SA 3ASNH 4FX4A 2P4WA 2Z1DA 2KIMA 5D8LB 4IL6C 3JSOA 2ZJRF 1ULYA 2P7CB 2X6WA 5H6RA 2PMHA 1U3EM 3COAC 2FJ1A 3FISA 3P9KA 5FKNA 3VYUB 4N9HA 2FE3A 3IH3A 3BCAA 4Z2YA 1F43A 1OKRA 2Y0MA 1K79A
chains in the Genus database with same CATH topology
2BV6A 4KYWA 1C0WA 4HQMA 1OYWA 4KICA 4S04A 2ZMEB 1TQIA 1Z1DA 1P4WA 4L5JA 3ZMUA 3Q5FA 4UV9A 1IAWA 2VBYA 2QBYA 1R00A 4G94A 3C18A 1YW8A 3IWZA 2QZ8A 3RKYA 5H6QA 4LLGF 3GZ5A 4WCGA 3V8LA 2JZYA 4M9ZA 4AIHA 4ESJA 4M72A 1O3TA 1HSTA 2W85A 2L54A 4UNOA 5A2QZ 2OAZA 4LG0A 4ZYDA 2DPUA 4XSZF 4EJWA 4I98B 2L02A 2ESNA 4KIGA 2HKOA 5TJJA 4ZYGA 3BPVA 1SFXA 2OD5A 5DD8A 1FYKA 3IRRA 3FX3A 3LA3A 3VOEA 3GXOA 2QWWA 3HRUA 4BYYA 4YG2F 4AIKA 1P6RA 2M1BA 3ML6A 2LNBA 2STWA 3WTVC 3V7RA 2V1DA 3WU1B 1HW2A 2VODA 2VXZA 3BJOA 3KLNA 4A12A 3BROA 4G8XA 2J5OA 1CF7B 4KFCA 2WWYA 2VE8A 5E20A 1U78A 3HRTA 1TLHB 3OOPA 2O03A 3ROUA 2XKPA 2OQRA 3P9CA 2IVMA 3QOPA 5FO5A 4ENJA 2XIGA 3L9FA 5ED4A 3KCCA 3I0TA 2KJCA 4ZYHA 4RS8A 5F6FA 3DV8A 4UUVA 1FY7A 2HKXA 3TDZC 3DPTA 1H9TA 2RN7A 2YU3A 5BQTA 4O6JA 4FHTA 4KMUX 1V4RA 1TNSA 1YIOA 3TOAA 3GF2A 2EA4A 4G9YA 2VN2A 1W7PA 4HF1A 1EH6A 4HBLA 4ZZLA 3VB2A 2KJBA 2ISYA 4IVNA 1BBYA 1KU7A 2PQ8A 5LLQA 2LF8A 2V9VA 3F6OA 2LKPA 1I5ZA 4L18B 4RGRA 3V8KA 3BZ6A 2LF7A 3C1DA 4A6DA 2F5CA 4LK0F 2ACJA 1KYWA 1IN4A 1BI1A 4LLLA 2ZJ2A 5D5UB 5LHIA 3ZN1A 2M5WA 1RI7A 4ESBA 3KZZA 2L3DA 4BHBA 4KIBA 1BIAA 1BI2A 2HR3A 1ZGAA 4M74A 1XMKA 1BC8C 1P4XA 2FBKA 4OOIA 1OYYA 5JVTA 4L9JA 1XSVA 5ICFA 2YX7A 4HF2A 4EQQA 1E17A 1G3SA 4HDVA 4AVPA 3I4PA 3DKWA 3F8BA 4D0PA 4XLNF 1ZYRF 2GZWA 2EB7A 3LFKA 5HS8A 2HTSA 3LQRA 3ZMZA 3VEPA 2X0LA 2FOKA 1MKMA 2NNYA 2VONA 3TO7A 5HDKA 2O6GE 2V1UA 2EV0A 3U1DA 4P96A 2Z5UA 1IRFA 2RNJA 2CWEA 1O7FA 1KYZA 5IT9K 3HTSB 5ILSA 3W6JB 5FLXZ 4RB1A 1K78B 5L3BA 1Z7UA 5D4RA 4XLPF 1XDUA 3QP5A 3RI4A 5JFRA 4DQ2A 3ULQB 3TGNA 2HZTA 2IW5A 2WTEA 2FBIA 3HUGA 5HVQC 2IP2A 3EYIA 1YS7A 3HIFA 1LQ1A 5E8GA 1T2KA 5LEKA 3SZTA 1F5TA 1K78A 1D8JA 4EGYA 2QYOA 1Z6TA 4FX0A 5DDGA 3LA7A 3MAJA 2FU4A 2XHKA 2F5FA 4B09A 5K5RA 2CW0F 4A0XA 3KP7A 1IRGA 2FEZA 2GIVA 1FX7A 3ELKA 1LDDA 4ZYEA 4HV5A 3G3ZA 3C3WA 2ZBKA 1IUYA 3K0LA 5CVRA 1FP2A 2QQ9A 2QQBA 2MA3A 3KP6A 3JTHA 1Z91A 1R58A 1R1TA 3OV8A 4LK1F 2WV0A 3WGHA 3LAJA 3ZMSA 3SXYA 1T39A 2K02A 3HRSA 1Z05A 2YX4A 4UHTA 3K2ZA 1DUXC 5JR3A 1FBSA 4U88A 2UXNA 3B73A 3HTUA 3E3VA 4BXUA 1U5TB 1IXSB 3RIRA 3U2RA 2MBFA 1G3WA 3VFZA 1YS6A 1YG2A 4CDGA 4ETSA 2O0YA 2JPCA 5DCFA 1FYLA 1O3RA 3DXJF 2CGPA 1S7OA 3CJNA 4F7ZA 1OPCA 3H3ZA 4GO1A 2EA2A 4HLXA 2L01A 5CVJA 2VT2A 2EWNA 1QGPA 3F72A 4U0YA 2RGVA 3LWFA 1H0MA 4MEXF 3T8TA 1ZG3A 1KQ0A 2NS0A 4L9TA 4PGHA 4AD9A 4OMYA 2XGXA 2FXAA 1LEAA 1SMYF 1P4AA 4ON0A 2P6SA 4IHSA 1KU2A 3R6SA 2XASA 5E17F 3I53A 3M7GA 2IA0A 1XN7A 3KLOA 4IHTA 1SMTA 2ZKZA 4A5MA 2ELHA 1O7LA 1FLIA 3F8CA 2PG4A 1JGSA 1T98A 3S2WA 4G7OF 1WKMA 4JBAA 1FPQA 2X4HA 3BWGA 2BGCA 5DCMB 2IRFG 2D1VA 4I09A 4ENKA 2W25A 2A6HF 1LB2A 5D5XB 2HEOA 4A2UA 4DNCA 1QQIA 1WI9A 1LJ9A 5ICCA 1U2WA 4RB0A 3E5QA 2FSWA 1B4AA 1SD7A 4ZH4F 3RDIA 3SQNA 1IXCA 2H6BA 3K1PA 2W84A 3DP7A 4K2EA 4YFKF 2XV4S 2IA2A 3QAHA 1RUOA 1BM9A 1R5HA 1XD7A 4M6XA 1J59A 2K7LA 3KP2A 3WE3A 1K6OA 3E6DA 2HWVA 5D5WB 1IXRC 5DCMA 2D45A 2QBYB 1XMAA 4G7ZF 3GWZA 3LA2A 4HAMA 4LGWA 2K4BA 1JHHA 4KUMA 3T0YA 3FMSA 4RAYA 3JW4A 2OU2A 2R7FA 1T6SA 3N4MA 4G6QA 2DK5A 4LG0B 3BY6A 2Y75A 1ZGJA 2VOOA 6PAXA 3CUQB 2OQGA 4HOBA 5D4SA 2EV6A 4N0BA 2HQNA 3E6BA 3WTSC 1ZHFA 1J9IA 4MHGA 4OIOF 2CG4A 3ZPLA 2VC1A 3F8MA 3E6CC 3F21A 2PLYA 1SAXA 4MGRA 2G9WA 1J2XA 4QWQA 1MJAA 2FQ3A 4NHJA 3I64A 1D8KA 3NRVA 1HXDA 2DK8A 4RB2C 5BPDA 3D0SA 4Y13A 3D5LA 5HDNA 3QPTA 3CUQA 3GZ6A 1ONVA 3FMRA 4M9XA 4LB5A 2BEOA 3E5XA 2E7WA 3HRMA 2P5VA 1S29A 1Z9CA 4A5NA 1G6NA 2A69F 1UFMA 3MEXA 3RTRA 4A0YA 4O3MA 4I7HA 5ILVA 5E1XA 4CHUA 4I0AA 1W7PB 3I59B 1QPMA 5ICEA 1KU9A 3CO6C 3KEQA 2UXXA 1SFEA 4MTDA 5HDGA 5JI6A 1SD6A 1IZ1A 3Q9VA 5J8CA 3GFIA 3GLXA 5AIPA 4R8HA 3SFZA 1U5TC 3GFJA 4E70A 3RPUA 1E2XA 5FGMA 3R0AA 2DLLA 2CFXA 4EJOA 2DW4A 2QM3A 2PMUA 3U9GA 2A61A 3EYYA 1HQCA 4L0YB 3F8FA 2HYGD 4PZJA 2DI3A 2NNNA 3PFIA 1UCRA 5L3FA 3C7JA 1B59A 2L4MA 1R5GA 3I59A 1FNNA 4ENMA 3V7SA 1MGTA 1IN8A 2PEXA 3ZP5A 1YW9A 1ZLKA 1OMIA 3J81K 4KMFA 1LEBA 2HTJA 4KN4X 5LRSA 1TQMA 3BJAA 1T0FA 4HYEA 2OZUA 5IT9Z 5LBQA 4B8XA 3J80K 1BOAA 5H20A 4NQWA 3F22A 2E1CA 1B9MA 1MD0A 3HOTA 5HOOA 1MJ9A 2VBWA 2NRAC 3WU0A 4U0VA 1W7PD 4WXHA 5D5VB 4S05A 1W5TA 4HZFA 2KKOA 3F6VA 3I5UA 2NYXA 3FHZA 2Q2EA 4AWXB 2VOPA 1YQAA 3DEUA 2L4AA 2RQPA 1V3FA 4L0ZB 3GFMA 3E5UA 2FBHA 2QVOA 1WSUA 2JPBA 3FXUA 3TO6A 1XCVA 2RVCA 5ILUA 3MWMA 4XSXF 1YW7A 1J5YA 2EFQA 2P6TA 5JHUA 2HOEA 3I54A 3LAPA 5HLGA 1OR7A 5HLHA 3CDHA 3SZPA 2DU9A 3LQQA 1I27A 2KRFA 5L3GA 4LLNA 4WXCA 2D1HA 1R1VA 5F1RA 1KGSA 3RKXA 2EFNA 2A3SA 1JXSA 4WXDA 4MQ9F 1IN5A 2YSRA 3ISPA 2GAUA 1G3YA 4CGZA 3ZN0A 3M1EA 4BAYA 4Y17A 3TO9A 2HQRA 4HW0A 2MH9A 4GXOA 1YYVA 4L9VA 4CICA 2RDPA 2XAJA 2V1XA 1ZG5A 2QLZA 2HGCA 3T5XA 1HW5A 1F4KA 1UB9A 4ASNA 5AONA 1ZLJA 2F2EA 4IRIA 1XGMA 3L7WA 2FF4A 2XAFA 1FWZA 1XSXA 1ZG1A 1PUEE 4CXFA 2FNPA 3KP5A 2XAGA 2XKOA 3RPQA 3JAMK 1U8RA 2UWMA 5L3EA 5K1YA 2HYFA 2CO5A 2MH2A 4KIFA 1XCBA 3H92A 2BE5F 1CGPA 1ON1A 1I6XA 2KIFA 3DFGA 4HX8A 1XB4A 5LEJA 1P92A 3EQLF 3IHUA 4P9FA 2ISZA 2ZNZA 2B0LA 2H27A 1TBXA 4R79A 2Z3YA 4I0BA 2ESHA 2FRHA 3V7CA 4LD5A 5E18F 1DPRA 4TV7A 5J8FA 2H09A 1DPUA 4ENNA 2ZNYA 3NEUA 1TW3A 1L3LA 4PGGA 2A6EF 3J7AO 4RGSA 1AWCA 5LHHA 1HKSA 3WTXC 2BBYA 3WGIA 2JSCA 3P9IA 4ESFA 2GA2A 1XGOA 3TDUC 4U0WA 3HOSA 3HYIA 5L3CA 4ZZDA 5E8IA 1SD5A 1AOYA 1NHAA 1YO5C 3KZYA 4QLCU 2NAZA 4EJTA 3MQ0A 4PCQA 3E97A 2P8TA 3K1MA 3GYHX 1FSEA 1QZZA 3IL2A 5HS7A 3PQJA 3WTUC 1STZA 5EEHA 1UHMA 1IN7A 1L0OC 2PBIA 4GYGA 1ZARA 3IKTA 2IA1A 3I71A 4HV6A 1X3UA 2E1NA 2XAQA 1FSHA 2RKHA 5KK1A 3GO5A 3R4KA 3IWFA 4XRFA 5IT3A 2LDUA 3DPLC 2Q0OA 1PP7U 1KA8A 3K69A 1OYIA 1RUNA 3KETA 3MCZA 2G7UA 4P55A 5TRDA 2PN6A 1RIOH 4LJZF 2F5EA 2K27A 1ZN2A 3MFKA 1USTA 3MZHA 1USSA 5DV5A 1MDMB 1LVAA 2M30A 3KE2A 3M8FA 3ZMTA 2DTRA 5BMZA 1EV7A 3T8RA 1ODDA 1DDNA 4LMYA 2CYYA 1GXQA 3Q9SA 4A6EA 1R22A 2MLKA 1R23A 3GVAA 2CSOA 3WE2A 1GXPA 4CYDA 2AXLA 3BDDA 1EH7A 3GW2A 3FZVA 2Z33A 1FOKA 2XROA 3KP3A 3CTAA 4OU0A 2IJLA 4HF0A 5CYVA 1MDMA 3JSPA 1J75A 5FFXA 3QPHA 2GQQA 2EV5A 2GXBA 2JRTA 2ZO4A 3F23A 1B9NA 3HSEA 4EMSA 4R1HA 2MC3A 4U7DA 2RC4A 1XGNA 2MLGA 3IKVA 3BPXA 3BJ6A 2XRNA 1S7AA 3BP8A 4P9UA 1UHWA 1GVJA 2H6CA 2OA4A 5CVUA 3H3UA 3O6BB 4BHPA 4IPAA 4N9IA 3BOQA 2O61A 2JT1A 3RJPA 4OIPF 1R7JA 4YIFA 1QO0D 1I1GA 5BS6A 3GFLA 2DT5A 4RGUA 3HSFA 1QZYA 3RYPA 1QNTA 1S6LA 2W57A 3R61A 2HS5A 1TW2A 2ZMEA 4CZZA 3WG9A 1S3JA 4EM0B 4EJUA 3K1NA 2VBXA 3J81Z 3JTGA 2D2WA 4IRGA 3CO7C 4P5OA 4IF4A 1PP8F 2GWRA 4L9NA 3NQOA 1BI3A 3QU6A 3GUDA 4MEYF 3J80Z 2ETHA 4WK8F 1G4DA 4GGGA 4RAZA 5HLIA 2XVCA 5K5QA 1K7AA 4MTEA 2EFOA 3O2PE 1W4MA 3ECHA 3E6MA 2LSOA 4I2OA 2GA1A 1MZBA 2DAOA 1KU3A 5LGUA 1WWXA 1QBJA 5CJ9A 1I1SA 2OZ6A 3R60A 1MJBA 3WTZA 5A2QK 2P7VB 3WGGA 4UVBA 1RNLA 5AIQA 3GEZA 1B6AA 4BH9A 2XUBA 4EM1A 3R0JA 1G3TA 2G7HA 1WRJA 5DUKA 5DYMA 2W24A 1CF7A 1EH8A 4KN7X 3IC7A 3TKYA 2F5DA 5CVVA 1VTNC 2FA5A 3ZQ7A 3ABUA 4M6YA 4HDUA 2AS5F 2XAHA 2ZXJA 2PJPA 1KQ8A 1XDSA 1TTYA 4KA4A 2PI0A 2PFBA 4UV8A 4HLYA 5KVRA 3DF8A 4KDPA 3CUOA 3M8EA 3VODA 5FB2A 3B02A 3FF5A 3ZMDA 5EEGA 1Z6RA 3LSTA 2MD5A 1YFHA 1XSDA 5CVIA 5ICGA 2GXGA 3F8NA 4I02A 2STTA 1B1BA 3FWEA 1BI0A 1U6GA 4CO8A 1LDKB 3HHGA 4L5IA 4OMZA 4M9SA 2M8EA 2HDCA 4OIRF 4Q48A 3V4GA 3G73A 5BPIA 1FBUA 5HS9A 2FMLA 1Q1HA 2K4JA 1W5SA 3ECOA 4Q47A 4JQFA 4BHCA 5D6FA 2V6CA 4M73A 4BNCA 2EFPA 5L3DA 1FBQA 5LGTA 2FMYA 3JAMZ 2EFWA 4PDKA 5DUIA 1A04A 2M45A 2TDXA 4HX7A 2EK5A 4IJAA 1BC7C 1HKQA 1ZREA 5CLSA 5J6XA 5LRRA 3CUQC 2DPDA 3KEOA 2V79A 5K5OA 4EGZA 1FC3A 2QUFA 3REOA 1ZRCA 4OINF 2DQRA 1TNTA 4AIJA 5FD6A 1FZPB 1ZRDA 1RZ4A 2YPRA 2K86A 3FXRA 4XBFA 3WTWC 1FT9A 1ON2A 1HBXG 1O3QA 1SFUA 3I58A 1HKTA 2DFIA 4YIIA 4Q5SF 1D5VA 2HFHA 3AAFA 3WTYC 4MNUA 3TOBA 1H9GA 1J0RA 5DD4A 3M9AA 5F64A 1BJAA 5LGNA 2C6YA 1PDNC 4YFXF 4MQVA 5FLXK 2VC0A 2RV8A 1HSJA 2IPQX 4OIQF 1DP7P 2KIUA 2CQKA 2A07F 4Y15A 2P5KA 2VT3A 4NB5A 3FM3A 3ZMVA 2COMA 4O5VA 1BIBA 2A5YB 3W6KB 3TQNA 4EVIA 3MZYA 3K9TA 1BN5A 2VE9A 4A0ZA 2Z9OA 3QP6A 2Z99A 2Q8KA 3ABTA 1S8NA 1FYMA 2A68F 4UXNA 2O8XA 3EUHA 5DEQA 1R36A 3KFWX 5LHGA 3WODF 1ZRFA 4RGXA 3QU3A 4LB6B 4WWCA 4G6DA 5BOXA 3ERED 2OBPA 1REPC 1O57A 4JK1X 1XGSA 4GYIA 1Y0UA 3RKWA 4LFUA 2ZFWA 2WC2A 2E7XA 2VBZA 2DBBA 2R3SA 1F9NA 3KP4A 2QENA 3FXQA 4UVCA 4BQAA 4FT8A 1WQ2A 3RYRA 2DO7A 5FFZA 3WTTC 4HA8A 2QQAA 3CLOA 5E1WA 1YTYA 3N97A 4YFNF 1JE8A 1U5TA 4GCVA 1JHFA 3T1BA 4RB3C 3GX4X 4M71A 1GHCA 2ADUA 3L09A 2H94A 3HSRA 3EDPA 4IRHA 2O3FA 2BYVE 5D6EA 4KT5C 1ZAOA 3FMQA 4EJVA 5D8KB 3V8JA 4HQEA 3F3XA 5FD5A 4I01A 1FP1D 1R1UA 2EJRA 3O3KA 1SD4A 1F1ZA 4Q4ZF 1YLFA 3L00A 1LDJA 1IF1A 3SHFA 4WX9A 2IT0A 2DQLA 4U7BA 1J7KA 2P5LC 4HX4A 2YR2A 1P2FA 3PQKA 4UVAA 2M87A 3FM5A 4EM2A 3EETA 1TQPA 3P7NA 3L2CA 4EV0A 3QRFF 1T38A 1D3YA 5E1ZB 4KNYA 1IW7F 4H0EA 4IXAA 2UZKA 1ZH5A 2R7DA 3DQVC 2Y48A 3IRQA 4G7HF 2JTVA 1LNWA 2J5PA 4WF2A 1HW1A 2FNAA 5ERIA 1KQ9A 2ZCWA 1IN6A 3HHHA 1O3SA 4FX4A 2P4WA 3JSOA 2KIMA 5D8LB 2P7CB 1ULYA 5H6RA 2PMHA 1U3EM 3COAC 3P9KA 4N9HA 2FE3A 4Z2YA 1OKRA 2Y0MA 1K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BV6 A;  4KYW A;  1C0W A;  4HQM A;  1OYW A;  4KIC A;  4S04 A;  2ZME B;  1TQI A;  1Z1D A;  1P4W A;  4L5J A;  3ZMU A;  3Q5F A;  4UV9 A;  1IAW A;  2VBY A;  2QBY A;  1R00 A;  4G94 A;  3C18 A;  1YW8 A;  3IWZ A;  2QZ8 A;  3RKY A;  5H6Q A;  4LLG F;  3GZ5 A;  4WCG A;  3V8L A;  2JZY A;  4M9Z A;  4AIH A;  4ESJ A;  4M72 A;  1O3T A;  1HST A;  2W85 A;  2L54 A;  4UNO A;  5A2Q Z;  2OAZ A;  4LG0 A;  4ZYD A;  2DPU A;  4XSZ F;  4EJW A;  4I98 B;  2L02 A;  2ESN A;  4KIG A;  2HKO A;  5TJJ A;  4ZYG A;  3BPV A;  1SFX A;  2OD5 A;  5DD8 A;  1FYK A;  3IRR A;  3FX3 A;  3LA3 A;  3VOE A;  3GXO A;  2QWW A;  3HRU A;  4BYY A;  4YG2 F;  4AIK A;  1P6R A;  2M1B A;  3ML6 A;  2LNB A;  2STW A;  3WTV C;  3V7R A;  2V1D A;  3WU1 B;  1HW2 A;  2VOD A;  2VXZ A;  3BJO A;  3KLN A;  4A12 A;  3BRO A;  4G8X A;  2J5O A;  1CF7 B;  4KFC A;  2WWY A;  2VE8 A;  5E20 A;  1U78 A;  3HRT A;  1TLH B;  3OOP A;  2O03 A;  3ROU A;  2XKP A;  2OQR A;  3P9C A;  2IVM A;  3QOP A;  5FO5 A;  4ENJ A;  2XIG A;  3L9F A;  5ED4 A;  3KCC A;  3I0T A;  2KJC A;  4ZYH A;  4RS8 A;  5F6F A;  3DV8 A;  4UUV A;  1FY7 A;  2HKX A;  3TDZ C;  3DPT A;  1H9T A;  2RN7 A;  2YU3 A;  5BQT A;  4O6J A;  4FHT A;  4KMU X;  1V4R A;  1TNS A;  1YIO A;  3TOA A;  3GF2 A;  2EA4 A;  4G9Y A;  2VN2 A;  1W7P A;  4HF1 A;  1EH6 A;  4HBL A;  4ZZL A;  3VB2 A;  2KJB A;  2ISY A;  4IVN A;  1BBY A;  1KU7 A;  2PQ8 A;  5LLQ A;  2LF8 A;  2V9V A;  3F6O A;  2LKP A;  1I5Z A;  4L18 B;  4RGR A;  3V8K A;  3BZ6 A;  2LF7 A;  3C1D A;  4A6D A;  2F5C A;  4LK0 F;  2ACJ A;  1KYW A;  1IN4 A;  1BI1 A;  4LLL A;  2ZJ2 A;  5D5U B;  5LHI A;  3ZN1 A;  2M5W A;  1RI7 A;  4ESB A;  3KZZ A;  2L3D A;  4BHB A;  4KIB A;  1BIA A;  1BI2 A;  2HR3 A;  1ZGA A;  4M74 A;  1XMK A;  1BC8 C;  1P4X A;  2FBK A;  4OOI A;  1OYY A;  5JVT A;  4L9J A;  1XSV A;  5ICF A;  2YX7 A;  4HF2 A;  4EQQ A;  1E17 A;  1G3S A;  4HDV A;  4AVP A;  3I4P A;  3DKW A;  3F8B A;  4D0P A;  4XLN F;  1ZYR F;  2GZW A;  2EB7 A;  3LFK A;  5HS8 A;  2HTS A;  3LQR A;  3ZMZ A;  3VEP A;  2X0L A;  2FOK A;  1MKM A;  2NNY A;  2VON A;  3TO7 A;  5HDK A;  2O6G E;  2V1U A;  2EV0 A;  3U1D A;  4P96 A;  2Z5U A;  1IRF A;  2RNJ A;  2CWE A;  1O7F A;  1KYZ A;  5IT9 K;  3HTS B;  5ILS A;  3W6J B;  5FLX Z;  4RB1 A;  1K78 B;  5L3B A;  1Z7U A;  5D4R A;  4XLP F;  1XDU A;  3QP5 A;  3RI4 A;  5JFR A;  4DQ2 A;  3ULQ B;  3TGN A;  2HZT A;  2IW5 A;  2WTE A;  2FBI A;  3HUG A;  5HVQ C;  2IP2 A;  3EYI A;  1YS7 A;  3HIF A;  1LQ1 A;  5E8G A;  1T2K A;  5LEK A;  3SZT A;  1F5T A;  1K78 A;  1D8J A;  4EGY A;  2QYO A;  1Z6T A;  4FX0 A;  5DDG A;  3LA7 A;  3MAJ A;  2FU4 A;  2XHK A;  2F5F A;  4B09 A;  5K5R A;  2CW0 F;  4A0X A;  3KP7 A;  1IRG A;  2FEZ A;  2GIV A;  1FX7 A;  3ELK A;  1LDD A;  4ZYE A;  4HV5 A;  3G3Z A;  3C3W A;  2ZBK A;  1IUY A;  3K0L A;  5CVR A;  1FP2 A;  2QQ9 A;  2QQB A;  2MA3 A;  3KP6 A;  3JTH A;  1Z91 A;  1R58 A;  1R1T A;  3OV8 A;  4LK1 F;  2WV0 A;  3WGH A;  3LAJ A;  3ZMS A;  3SXY A;  1T39 A;  2K02 A;  3HRS A;  1Z05 A;  2YX4 A;  4UHT A;  3K2Z A;  1DUX C;  5JR3 A;  1FBS A;  4U88 A;  2UXN A;  3B73 A;  3HTU A;  3E3V A;  4BXU A;  1U5T B;  1IXS B;  3RIR A;  3U2R A;  2MBF A;  1G3W A;  3VFZ A;  1YS6 A;  1YG2 A;  4CDG A;  4ETS A;  2O0Y A;  2JPC A;  5DCF A;  1FYL A;  1O3R A;  3DXJ F;  2CGP A;  1S7O A;  3CJN A;  4F7Z A;  1OPC A;  3H3Z A;  4GO1 A;  2EA2 A;  4HLX A;  2L01 A;  5CVJ A;  2VT2 A;  2EWN A;  1QGP A;  3F72 A;  4U0Y A;  2RGV A;  3LWF A;  1H0M A;  4MEX F;  3T8T A;  1ZG3 A;  1KQ0 A;  2NS0 A;  4L9T A;  4PGH A;  4AD9 A;  4OMY A;  2XGX A;  2FXA A;  1LEA A;  1SMY F;  1P4A A;  4ON0 A;  2P6S A;  4IHS A;  1KU2 A;  3R6S A;  2XAS A;  5E17 F;  3I53 A;  3M7G A;  2IA0 A;  1XN7 A;  3KLO A;  4IHT A;  1SMT A;  2ZKZ A;  4A5M A;  2ELH A;  1O7L A;  1FLI A;  3F8C A;  2PG4 A;  1JGS A;  1T98 A;  3S2W A;  4G7O F;  1WKM A;  4JBA A;  1FPQ A;  2X4H A;  3BWG A;  2BGC A;  5DCM B;  2IRF G;  2D1V A;  4I09 A;  4ENK A;  2W25 A;  2A6H F;  1LB2 A;  5D5X B;  2HEO A;  4A2U A;  4DNC A;  1QQI A;  1WI9 A;  1LJ9 A;  5ICC A;  1U2W A;  4RB0 A;  3E5Q A;  2FSW A;  1B4A A;  1SD7 A;  4ZH4 F;  3RDI A;  3SQN A;  1IXC A;  2H6B A;  3K1P A;  2W84 A;  3DP7 A;  4K2E A;  4YFK F;  2XV4 S;  2IA2 A;  3QAH A;  1RUO A;  1BM9 A;  1R5H A;  1XD7 A;  4M6X A;  1J59 A;  2K7L A;  3KP2 A;  3WE3 A;  1K6O A;  3E6D A;  2HWV A;  5D5W B;  1IXR C;  5DCM A;  2D45 A;  2QBY B;  1XMA A;  4G7Z F;  3GWZ A;  3LA2 A;  4HAM A;  4LGW A;  2K4B A;  1JHH A;  4KUM A;  3T0Y A;  3FMS A;  4RAY A;  3JW4 A;  2OU2 A;  2R7F A;  1T6S A;  3N4M A;  4G6Q A;  2DK5 A;  4LG0 B;  3BY6 A;  2Y75 A;  1ZGJ A;  2VOO A;  6PAX A;  3CUQ B;  2OQG A;  4HOB A;  5D4S A;  2EV6 A;  4N0B A;  2HQN A;  3E6B A;  3WTS C;  1ZHF A;  1J9I A;  4MHG A;  4OIO F;  2CG4 A;  3ZPL A;  2VC1 A;  3F8M A;  3E6C C;  3F21 A;  2PLY A;  1SAX A;  4MGR A;  2G9W A;  1J2X A;  4QWQ A;  1MJA A;  2FQ3 A;  4NHJ A;  3I64 A;  1D8K A;  3NRV A;  1HXD A;  2DK8 A;  4RB2 C;  5BPD A;  3D0S A;  4Y13 A;  3D5L A;  5HDN A;  3QPT A;  3CUQ A;  3GZ6 A;  1ONV A;  3FMR A;  4M9X A;  4LB5 A;  2BEO A;  3E5X A;  2E7W A;  3HRM A;  2P5V A;  1S29 A;  1Z9C A;  4A5N A;  1G6N A;  2A69 F;  1UFM A;  3MEX A;  3RTR A;  4A0Y A;  4O3M A;  4I7H A;  5ILV A;  5E1X A;  4CHU A;  4I0A A;  1W7P B;  3I59 B;  1QPM A;  5ICE A;  1KU9 A;  3CO6 C;  3KEQ A;  2UXX A;  1SFE A;  4MTD A;  5HDG A;  5JI6 A;  1SD6 A;  1IZ1 A;  3Q9V A;  5J8C A;  3GFI A;  3GLX A;  5AIP A;  4R8H A;  3SFZ A;  1U5T C;  3GFJ A;  4E70 A;  3RPU A;  1E2X A;  5FGM A;  3R0A A;  2DLL A;  2CFX A;  4EJO A;  2DW4 A;  2QM3 A;  2PMU A;  3U9G A;  2A61 A;  3EYY A;  1HQC A;  4L0Y B;  3F8F A;  2HYG D;  4PZJ A;  2DI3 A;  2NNN A;  3PFI A;  1UCR A;  5L3F A;  3C7J A;  1B59 A;  2L4M A;  1R5G A;  3I59 A;  1FNN A;  4ENM A;  3V7S A;  1MGT A;  1IN8 A;  2PEX A;  3ZP5 A;  1YW9 A;  1ZLK A;  1OMI A;  3J81 K;  4KMF A;  1LEB A;  2HTJ A;  4KN4 X;  5LRS A;  1TQM A;  3BJA A;  1T0F A;  4HYE A;  2OZU A;  5IT9 Z;  5LBQ A;  4B8X A;  3J80 K;  1BOA A;  5H20 A;  4NQW A;  3F22 A;  2E1C A;  1B9M A;  1MD0 A;  3HOT A;  5HOO A;  1MJ9 A;  2VBW A;  2NRA C;  3WU0 A;  4U0V A;  1W7P D;  4WXH A;  5D5V B;  4S05 A;  1W5T A;  4HZF A;  2KKO A;  3F6V A;  3I5U A;  2NYX A;  3FHZ A;  2Q2E A;  4AWX B;  2VOP A;  1YQA A;  3DEU A;  2L4A A;  2RQP A;  1V3F A;  4L0Z B;  3GFM A;  3E5U A;  2FBH A;  2QVO A;  1WSU A;  2JPB A;  3FXU A;  3TO6 A;  1XCV A;  2RVC A;  5ILU A;  3MWM A;  4XSX F;  1YW7 A;  1J5Y A;  2EFQ A;  2P6T A;  5JHU A;  2HOE A;  3I54 A;  3LAP A;  5HLG A;  1OR7 A;  5HLH A;  3CDH A;  3SZP A;  2DU9 A;  3LQQ A;  1I27 A;  2KRF A;  5L3G A;  4LLN A;  4WXC A;  2D1H A;  1R1V A;  5F1R A;  1KGS A;  3RKX A;  2EFN A;  2A3S A;  1JXS A;  4WXD A;  4MQ9 F;  1IN5 A;  2YSR A;  3ISP A;  2GAU A;  1G3Y A;  4CGZ A;  3ZN0 A;  3M1E A;  4BAY A;  4Y17 A;  3TO9 A;  2HQR A;  4HW0 A;  2MH9 A;  4GXO A;  1YYV A;  4L9V A;  4CIC A;  2RDP A;  2XAJ A;  2V1X A;  1ZG5 A;  2QLZ A;  2HGC A;  3T5X A;  1HW5 A;  1F4K A;  1UB9 A;  4ASN A;  5AON A;  1ZLJ A;  2F2E A;  4IRI A;  1XGM A;  3L7W A;  2FF4 A;  2XAF A;  1FWZ A;  1XSX A;  1ZG1 A;  1PUE E;  4CXF A;  2FNP A;  3KP5 A;  2XAG A;  2XKO A;  3RPQ A;  3JAM K;  1U8R A;  2UWM A;  5L3E A;  5K1Y A;  2HYF A;  2CO5 A;  2MH2 A;  4KIF A;  1XCB A;  3H92 A;  2BE5 F;  1CGP A;  1ON1 A;  1I6X A;  2KIF A;  3DFG A;  4HX8 A;  1XB4 A;  5LEJ A;  1P92 A;  3EQL F;  3IHU A;  4P9F A;  2ISZ A;  2ZNZ A;  2B0L A;  2H27 A;  1TBX A;  4R79 A;  2Z3Y A;  4I0B A;  2ESH A;  2FRH A;  3V7C A;  4LD5 A;  5E18 F;  1DPR A;  4TV7 A;  5J8F A;  2H09 A;  1DPU A;  4ENN A;  2ZNY A;  3NEU A;  1TW3 A;  1L3L A;  4PGG A;  2A6E F;  3J7A O;  4RGS A;  1AWC A;  5LHH A;  1HKS A;  3WTX C;  2BBY A;  3WGI A;  2JSC A;  3P9I A;  4ESF A;  2GA2 A;  1XGO A;  3TDU C;  4U0W A;  3HOS A;  3HYI A;  5L3C A;  4ZZD A;  5E8I A;  1SD5 A;  1AOY A;  1NHA A;  1YO5 C;  3KZY A;  4QLC U;  2NAZ A;  4EJT A;  3MQ0 A;  4PCQ A;  3E97 A;  2P8T A;  3K1M A;  3GYH X;  1FSE A;  1QZZ A;  3IL2 A;  5HS7 A;  3PQJ A;  3WTU C;  1STZ A;  5EEH A;  1UHM A;  1IN7 A;  1L0O C;  2PBI A;  4GYG A;  1ZAR A;  3IKT A;  2IA1 A;  3I71 A;  4HV6 A;  1X3U A;  2E1N A;  2XAQ A;  1FSH A;  2RKH A;  5KK1 A;  3GO5 A;  3R4K A;  3IWF A;  4XRF A;  5IT3 A;  2LDU A;  3DPL C;  2Q0O A;  1PP7 U;  1KA8 A;  3K69 A;  1OYI A;  1RUN A;  3KET A;  3MCZ A;  2G7U A;  4P55 A;  5TRD A;  2PN6 A;  1RIO H;  4LJZ F;  2F5E A;  2K27 A;  1ZN2 A;  3MFK A;  1UST A;  3MZH A;  1USS A;  5DV5 A;  1MDM B;  1LVA A;  2M30 A;  3KE2 A;  3M8F A;  3ZMT A;  2DTR A;  5BMZ A;  1EV7 A;  3T8R A;  1ODD A;  1DDN A;  4LMY A;  2CYY A;  1GXQ A;  3Q9S A;  4A6E A;  1R22 A;  2MLK A;  1R23 A;  3GVA A;  2CSO A;  3WE2 A;  1GXP A;  4CYD A;  2AXL A;  3BDD A;  1EH7 A;  3GW2 A;  3FZV A;  2Z33 A;  1FOK A;  2XRO A;  3KP3 A;  3CTA A;  4OU0 A;  2IJL A;  4HF0 A;  5CYV A;  1MDM A;  3JSP A;  1J75 A;  5FFX A;  3QPH A;  2GQQ A;  2EV5 A;  2GXB A;  2JRT A;  2ZO4 A;  3F23 A;  1B9N A;  3HSE A;  4EMS A;  4R1H A;  2MC3 A;  4U7D A;  2RC4 A;  1XGN A;  2MLG A;  3IKV A;  3BPX A;  3BJ6 A;  2XRN A;  1S7A A;  3BP8 A;  4P9U A;  1UHW A;  1GVJ A;  2H6C A;  2OA4 A;  5CVU A;  3H3U A;  3O6B B;  4BHP A;  4IPA A;  4N9I A;  3BOQ A;  2O61 A;  2JT1 A;  3RJP A;  4OIP F;  1R7J A;  4YIF A;  1QO0 D;  1I1G A;  5BS6 A;  3GFL A;  2DT5 A;  4RGU A;  3HSF A;  1QZY A;  3RYP A;  1QNT A;  1S6L A;  2W57 A;  3R61 A;  2HS5 A;  1TW2 A;  2ZME A;  4CZZ A;  3WG9 A;  1S3J A;  4EM0 B;  4EJU A;  3K1N A;  2VBX A;  3J81 Z;  3JTG A;  2D2W A;  4IRG A;  3CO7 C;  4P5O A;  4IF4 A;  1PP8 F;  2GWR A;  4L9N A;  3NQO A;  1BI3 A;  3QU6 A;  3GUD A;  4MEY F;  3J80 Z;  2ETH A;  4WK8 F;  1G4D A;  4GGG A;  4RAZ A;  5HLI A;  2XVC A;  5K5Q A;  1K7A A;  4MTE A;  2EFO A;  3O2P E;  1W4M A;  3ECH A;  3E6M A;  2LSO A;  4I2O A;  2GA1 A;  1MZB A;  2DAO A;  1KU3 A;  5LGU A;  1WWX A;  1QBJ A;  5CJ9 A;  1I1S A;  2OZ6 A;  3R60 A;  1MJB A;  3WTZ A;  5A2Q K;  2P7V B;  3WGG A;  4UVB A;  1RNL A;  5AIQ A;  3GEZ A;  1B6A A;  4BH9 A;  2XUB A;  4EM1 A;  3R0J A;  1G3T A;  2G7H A;  1WRJ A;  5DUK A;  5DYM A;  2W24 A;  1CF7 A;  1EH8 A;  4KN7 X;  3IC7 A;  3TKY A;  2F5D A;  5CVV A;  1VTN C;  2FA5 A;  3ZQ7 A;  3ABU A;  4M6Y A;  4HDU A;  2AS5 F;  2XAH A;  2ZXJ A;  2PJP A;  1KQ8 A;  1XDS A;  1TTY A;  4KA4 A;  2PI0 A;  2PFB A;  4UV8 A;  4HLY A;  5KVR A;  3DF8 A;  4KDP A;  3CUO A;  3M8E A;  3VOD A;  5FB2 A;  3B02 A;  3FF5 A;  3ZMD A;  5EEG A;  1Z6R A;  3LST A;  2MD5 A;  1YFH A;  1XSD A;  5CVI A;  5ICG A;  2GXG A;  3F8N A;  4I02 A;  2STT A;  1B1B A;  3FWE A;  1BI0 A;  1U6G A;  4CO8 A;  1LDK B;  3HHG A;  4L5I A;  4OMZ A;  4M9S A;  2M8E A;  2HDC A;  4OIR F;  4Q48 A;  3V4G A;  3G73 A;  5BPI A;  1FBU A;  5HS9 A;  2FML A;  1Q1H A;  2K4J A;  1W5S A;  3ECO A;  4Q47 A;  4JQF A;  4BHC A;  5D6F A;  2V6C A;  4M73 A;  4BNC A;  2EFP A;  5L3D A;  1FBQ A;  5LGT A;  2FMY A;  3JAM Z;  2EFW A;  4PDK A;  5DUI A;  1A04 A;  2M45 A;  2TDX A;  4HX7 A;  2EK5 A;  4IJA A;  1BC7 C;  1HKQ A;  1ZRE A;  5CLS A;  5J6X A;  5LRR A;  3CUQ C;  2DPD A;  3KEO A;  2V79 A;  5K5O A;  4EGZ A;  1FC3 A;  2QUF A;  3REO A;  1ZRC A;  4OIN F;  2DQR A;  1TNT A;  4AIJ A;  5FD6 A;  1FZP B;  1ZRD A;  1RZ4 A;  2YPR A;  2K86 A;  3FXR A;  4XBF A;  3WTW C;  1FT9 A;  1ON2 A;  1HBX G;  1O3Q A;  1SFU A;  3I58 A;  1HKT A;  2DFI A;  4YII A;  4Q5S F;  1D5V A;  2HFH A;  3AAF A;  3WTY C;  4MNU A;  3TOB A;  1H9G A;  1J0R A;  5DD4 A;  3M9A A;  5F64 A;  1BJA A;  5LGN A;  2C6Y A;  1PDN C;  4YFX F;  4MQV A;  5FLX K;  2VC0 A;  2RV8 A;  1HSJ A;  2IPQ X;  4OIQ F;  1DP7 P;  2KIU A;  2CQK A;  2A07 F;  4Y15 A;  2P5K A;  2VT3 A;  4NB5 A;  3FM3 A;  3ZMV A;  2COM A;  4O5V A;  1BIB A;  2A5Y B;  3W6K B;  3TQN A;  4EVI A;  3MZY A;  3K9T A;  1BN5 A;  2VE9 A;  4A0Z A;  2Z9O A;  3QP6 A;  2Z99 A;  2Q8K A;  3ABT A;  1S8N A;  1FYM A;  2A68 F;  4UXN A;  2O8X A;  3EUH A;  5DEQ A;  1R36 A;  3KFW X;  5LHG A;  3WOD F;  1ZRF A;  4RGX A;  3QU3 A;  4LB6 B;  4WWC A;  4G6D A;  5BOX A;  3ERE D;  2OBP A;  1REP C;  1O57 A;  4JK1 X;  1XGS A;  4GYI A;  1Y0U A;  3RKW A;  4LFU A;  2ZFW A;  2WC2 A;  2E7X A;  2VBZ A;  2DBB A;  2R3S A;  1F9N A;  3KP4 A;  2QEN A;  3FXQ A;  4UVC A;  4BQA A;  4FT8 A;  1WQ2 A;  3RYR A;  2DO7 A;  5FFZ A;  3WTT C;  4HA8 A;  2QQA A;  3CLO A;  5E1W A;  1YTY A;  3N97 A;  4YFN F;  1JE8 A;  1U5T A;  4GCV A;  1JHF A;  3T1B A;  4RB3 C;  3GX4 X;  4M71 A;  1GHC A;  2ADU A;  3L09 A;  2H94 A;  3HSR A;  3EDP A;  4IRH A;  2O3F A;  2BYV E;  5D6E A;  4KT5 C;  1ZAO A;  3FMQ A;  4EJV A;  5D8K B;  3V8J A;  4HQE A;  3F3X A;  5FD5 A;  4I01 A;  1FP1 D;  1R1U A;  2EJR A;  3O3K A;  1SD4 A;  1F1Z A;  4Q4Z F;  1YLF A;  3L00 A;  1LDJ A;  1IF1 A;  3SHF A;  4WX9 A;  2IT0 A;  2DQL A;  4U7B A;  1J7K A;  2P5L C;  4HX4 A;  2YR2 A;  1P2F A;  3PQK A;  4UVA A;  2M87 A;  3FM5 A;  4EM2 A;  3EET A;  1TQP A;  3P7N A;  3L2C A;  4EV0 A;  3QRF F;  1T38 A;  1D3Y A;  5E1Z B;  4KNY A;  1IW7 F;  4H0E A;  4IXA A;  2UZK A;  1ZH5 A;  2R7D A;  3DQV C;  2Y48 A;  3IRQ A;  4G7H F;  2JTV A;  1LNW A;  2J5P A;  4WF2 A;  1HW1 A;  2FNA A;  5ERI A;  1KQ9 A;  2ZCW A;  1IN6 A;  3HHH A;  1O3S A;  4FX4 A;  2P4W A;  3JSO A;  2KIM A;  5D8L B;  2P7C B;  1ULY A;  5H6R A;  2PMH A;  1U3E M;  3COA C;  3P9K A;  4N9H A;  2FE3 A;  4Z2Y A;  1OKR A;  2Y0M A;  1K79 A; 
#chains in the Genus database with same CATH topology
 2BV6 A;  3DTE A;  5E3M A;  4KYW A;  2ME0 A;  1C0W A;  4HQM A;  1OYW A;  2XGD A;  1IDZ A;  3CCU I;  4KIC A;  1R49 A;  4S04 A;  4GDF A;  2DJI A;  3HJE A;  2ZME B;  1TQI A;  1Z1D A;  4ZTF A;  1BL0 A;  1P4W A;  4L5J A;  4XR6 A;  4J00 A;  5C4X J;  2XAU A;  1JJ8 C;  3ZMU A;  3Q5F A;  2E2J J;  1JT6 A;  2LC2 A;  4UV9 A;  1IAW A;  2HQA A;  3HPH A;  4MO7 A;  2HXO A;  2VBY A;  2ID6 A;  3HEF A;  1MNE A;  2DMT A;  2QBY A;  1R00 A;  4G94 A;  2ID3 A;  1YW8 A;  3C18 A;  3CJR B;  3IWZ A;  3K4J A;  2QZ8 A;  3RKY A;  3OSF A;  2M9H A;  5H6Q A;  1Z67 A;  4LLG F;  3GZ5 A;  4A3B J;  5HOD A;  4RAF A;  1SVL A;  4WCG A;  3V8L A;  2XF5 A;  4QTR A;  2JZY A;  4M9Z A;  4AIH A;  4ESJ A;  5E3N A;  1IUF A;  1K4S A;  4M72 A;  2M0C A;  2MAB A;  1O3T A;  1HST A;  5M5W J;  2JQ7 A;  5DM6 F;  2JUC A;  4UB6 C;  4BE1 A;  2W85 A;  2L54 A;  5FKO A;  4UNO A;  4Y7N J;  4PFO A;  5A2Q Z;  2OAZ A;  4LG0 A;  4ZYD A;  3OYA A;  4XSZ F;  4EJW A;  2DPU A;  4I98 B;  3OS2 A;  5JLW A;  2X48 A;  3CC7 I;  2L02 A;  2ESN A;  4PSW A;  1H88 C;  4KIG A;  2HKO A;  5TJJ A;  1Y56 A;  5FKK A;  1EJ9 A;  4CH7 A;  4MFE A;  4ZYG A;  3BPV A;  1MND A;  4B47 A;  1SFX A;  2E1O A;  2OD5 A;  1GLN A;  5DD8 A;  5IPA A;  5FJ8 J;  2XSD C;  2VQL A;  1FYK A;  1WGX A;  3IRR A;  1IC8 A;  2IGN A;  3FX3 A;  3LA3 A;  1TWA J;  4BJ6 C;  3VOE A;  1W1W E;  4BJT A;  3GXO A;  5J1Y A;  2QWW A;  3HRU A;  2CRG A;  4BYY A;  1X4P A;  5GP9 A;  4YG2 F;  4AIK A;  2JVH A;  1ETV A;  2DDB A;  1P6R A;  3H9Q A;  3NWT A;  5C4J J;  1FIP A;  2M1B A;  1S7E A;  3ML6 A;  1LUJ B;  1HOM A;  2LNB A;  2STW A;  3WTV C;  2ZJQ F;  1WJ5 A;  3V7R A;  2V1D A;  5FLM J;  3WU1 B;  1AHD P;  1HW2 A;  2VOD A;  2VXZ A;  3BJO A;  3KLN A;  4A12 A;  3TP0 A;  3BRO A;  3I4M J;  4G8X A;  4A93 J;  2J5O A;  1CF7 B;  4KFC A;  2E1M B;  2WWY A;  3C2G A;  3S1N J;  1FEX A;  2VE8 A;  2LFB A;  5E20 A;  1JT0 A;  1U78 A;  3HRT A;  1TLH B;  1NK3 P;  1BA5 A;  3OOP A;  4BY7 J;  4M6V A;  3ONQ A;  1BOB A;  3OYK A;  2O03 A;  3ROU A;  4IKF A;  2XKP A;  2OQR A;  2M3A A;  2X51 A;  1Y1W J;  2OTJ I;  1XMX A;  3P9C A;  4C30 A;  2IVM A;  3VWB A;  1ENH A;  2V6E A;  2HOA A;  3QOP A;  5FO5 A;  4ENJ A;  2XIG A;  1I39 A;  3L9F A;  5ED4 A;  3KCC A;  3I0T A;  2KJC A;  3ABK H;  4ZYH A;  4RS8 A;  5F6F A;  2WY7 Q;  3DV8 A;  4UUV A;  2DCE A;  1FY7 A;  1S72 I;  2HKX A;  4Y3O A;  3TDZ C;  3DPT A;  3SEZ A;  1H9T A;  2M7A A;  2RN7 A;  1H89 C;  2YU3 A;  5KNL A;  5BQT A;  4O6J A;  4FHT A;  4KMU X;  1V4R A;  2L9S A;  4I6Z A;  2HZD A;  3VYR B;  1TNS A;  1YIO A;  3RQ4 A;  2X9D A;  3TOA A;  1B8I B;  3GF2 A;  4XLC A;  4RA2 A;  2EA4 A;  2WAD A;  4G9Y A;  3H9G A;  1Z77 A;  4LIT A;  1W5C C;  2VN2 A;  4ITV A;  4A3G J;  3CQZ J;  1W7P A;  4HF1 A;  1VZ0 A;  5IY5 H;  1EH6 A;  4HBL A;  2DMN A;  2X6X A;  3DWL E;  4ZZL A;  3RZD J;  2QGU A;  3VB2 A;  2KJB A;  5M3F J;  2ISY A;  4IVN A;  4D5C A;  3CCE I;  1BBY A;  1KU7 A;  5B5E C;  2PQ8 A;  5LLQ A;  2LF8 A;  2MW8 A;  1MSE C;  2V9V A;  2Y0S A;  3F6O A;  1TWH J;  3RZO J;  1ZK8 A;  5B1A H;  4BE0 A;  4XRM A;  2LKP A;  1I5Z A;  2UUZ A;  4L18 B;  4RGR A;  1ETQ A;  3H3V K;  4PJL A;  3V8K A;  1UHS A;  1A31 A;  1U9O A;  3BZ6 A;  2LF7 A;  2KDO A;  3PNT A;  4QIW N;  3C1D A;  4A6D A;  1JJ6 C;  2F5C A;  4ABZ A;  4LK0 F;  2ACJ A;  1PJR A;  1KYW A;  5JHF A;  1IN4 A;  1BI1 A;  4LLL A;  4IO9 F;  2ZJ2 A;  1LKX A;  5D5U B;  1WVR A;  2D5V A;  5LHI A;  3ZN1 A;  2M5W A;  1RI7 A;  3P5J A;  4ESB A;  3KZZ A;  2L3D A;  4BHB A;  4KIB A;  1BIA A;  1WH7 A;  1BI2 A;  2HR3 A;  1ZGA A;  4M74 A;  3AFH A;  3J7A Y;  4B48 A;  1XMK A;  1BC8 C;  2P81 A;  3GTJ J;  1P4X A;  2FBK A;  4OOI A;  3BR6 A;  5HNH A;  2VXD A;  1VI0 A;  1OYY A;  5JVT A;  2FX0 A;  2IGK A;  4L9J A;  1PUF A;  3Q0U A;  4XIC A;  4XNF A;  3S3N A;  1XSV A;  2IS4 A;  5ICF A;  2YX7 A;  3HKZ A;  4HF2 A;  4EQQ A;  2GXA A;  2LH9 A;  3BR5 A;  1E17 A;  4FAS D;  1G3S A;  2E71 A;  4L5E A;  1AA7 A;  3ZR8 X;  3G4S I;  4HDV A;  3W6V A;  4AVP A;  3I4P A;  3DKW A;  3F8B A;  4D0P A;  2LP0 A;  4XLN F;  1ZYR F;  2GZW A;  2DA5 A;  2BVL A;  2EB7 A;  3LFK A;  5HS8 A;  2HTS A;  3LQR A;  2CQN A;  2KL4 A;  3VEP A;  3ZMZ A;  4FIS A;  4BXX J;  2X0L A;  4DYR A;  1A36 A;  2FOK A;  1MKM A;  2MGQ A;  2NNY A;  1TZL A;  2VON A;  1BJZ A;  3JRH A;  3TO7 A;  4IHV A;  1JKQ C;  3CCS I;  5HDK A;  2O6G E;  1TL8 A;  2E2I J;  2V1U A;  4QPO A;  1OCO H;  1QU3 A;  2X6O A;  3HUG B;  2BXZ A;  2EV0 A;  4DBQ A;  4HRI A;  4A3L J;  1DP3 A;  3D1N I;  3U1D A;  1X1A A;  2Z5U A;  1PVE A;  2Y9Y A;  4P96 A;  4MLO A;  1VQ9 I;  1IRF A;  2RNJ A;  1HDD C;  2CWE A;  3OSG A;  1O7F A;  1DU0 A;  3A0H C;  3OIO A;  1KYZ A;  1MW7 A;  2ZB9 A;  2E35 A;  3LSG A;  5IT9 K;  2CW7 A;  2LKS A;  3HTS B;  3F0C A;  5ILS A;  3W6J B;  4FET A;  4A3C J;  5FLX Z;  4RB1 A;  1K78 B;  2OJE D;  3HGG A;  2HVQ A;  2K9Q A;  5L3B A;  1Z7U A;  5CKT A;  4ZDL A;  1X1C A;  5GAG J;  5D4R A;  4XLP F;  1YIJ I;  1XDU A;  1D5Y A;  3QP5 A;  4M3E A;  3RI4 A;  2L9R A;  4B4C A;  2MG4 A;  5JFR A;  4DQ2 A;  3ULQ B;  2OPT A;  3FK7 A;  3A02 A;  4E7S A;  5E79 C;  2KZV A;  2ZME C;  3RCO A;  3TGN A;  2HZT A;  2Y30 A;  2IW5 A;  2WTE A;  2FBI A;  3HUG A;  5HVQ C;  1SVM A;  1YJ9 I;  2IP2 A;  3EYI A;  2IS2 A;  3UKG A;  1JUS A;  4M3B A;  1YS7 A;  3HIF A;  1LQ1 A;  1JTY A;  1JGG A;  2HXI A;  4JX6 A;  4XOT A;  3HXL A;  5E8G A;  1T2K A;  2L7M P;  1BR2 A;  2K85 A;  5LEK A;  3SFI A;  3SZT A;  2EIK H;  3E0J B;  1F5T A;  5EEA A;  1E3P A;  2KZG A;  3CMM A;  1K78 A;  3K7A J;  2E2H J;  1D8J A;  3KPH A;  4A3M J;  4EGY A;  2QYO A;  3OR1 C;  3A01 A;  1Z6T A;  4FX0 A;  5DDG A;  1FOX A;  3LA7 A;  3MAJ A;  1Y1V J;  2FU4 A;  2XHK A;  1HC8 A;  2F5F A;  4B09 A;  5K5R A;  3SZG A;  2VKV A;  3CF2 A;  2CW0 F;  4LOC A;  5H2F C;  4A0X A;  1E0E A;  2M4K A;  3KP7 A;  1IRG A;  2FEZ A;  4P1W A;  2GIV A;  4F55 A;  5HLT A;  1FX7 A;  2ZFU A;  3ELK A;  4CYC A;  2X6Y A;  1LDD A;  5JVG F;  3S2D J;  2QKL B;  4ZYE A;  4HV5 A;  3G3Z A;  3L2U A;  4CZC A;  1P7J A;  3PFY A;  3C3W A;  1D1A A;  1OCC H;  2ZBK A;  3BTJ A;  3TL4 X;  2R7Q A;  1IUY A;  4CSW A;  3K0L A;  5CVR A;  3S16 J;  1WHU A;  1FP2 A;  1MMG A;  2QQ9 A;  2QSF X;  2CU7 A;  2QQB A;  4C2T A;  2MA3 A;  1JKP C;  3KP6 A;  3JTH A;  3OYD A;  1Z91 A;  4JP0 A;  4BJ5 C;  3PUF A;  1R58 A;  1ETY A;  3GTK J;  1R1T A;  3OV8 A;  3L1P A;  3Q0V A;  4LK1 F;  3LNQ A;  2WV0 A;  4FE7 A;  3WGH A;  3LAJ A;  3ZMS A;  5IP6 A;  3SXY A;  1T39 A;  2K02 A;  3HRS A;  3CJQ B;  1Z05 A;  2YX4 A;  2DOD A;  2MFZ A;  4UHT A;  3LSP A;  2W00 A;  3ZQI A;  3K2Z A;  1DUX C;  5JR3 A;  1FBS A;  4U88 A;  2UXN A;  3B73 A;  2KT0 A;  2E1M C;  3S8P A;  3HTU A;  1HA8 A;  3E3V A;  2HNH A;  2GLO A;  4BXU A;  2GOM A;  1U5T B;  3WHC A;  3Q3S A;  1IXS B;  2B7E A;  3RIR A;  4IHW A;  2WAQ A;  3K4C A;  1GT0 C;  3U2R A;  2MBF A;  1NG7 A;  1G3W A;  2RAE A;  2ZJP F;  1ZQ3 P;  1NTC A;  5F27 A;  3HL2 A;  2EPF A;  1X4O A;  3L2V A;  3PNV A;  3O8H A;  3VFZ A;  3KEY A;  2R5Y A;  1YS6 A;  1YG2 A;  1K61 A;  4CDG A;  4ETS A;  2IBD A;  2O0Y A;  2BY1 A;  2JPC A;  1QHH D;  3IP4 B;  5DCF A;  1FYL A;  1O3R A;  3DXJ F;  3G6E I;  2CGP A;  1S7O A;  2VPR A;  3CJN A;  4F7Z A;  1RKT A;  3H35 A;  1OJL A;  1OPC A;  3VSL A;  3H3Z A;  4GO1 A;  2EA2 A;  4HLX A;  2L01 A;  4PK4 A;  3CP8 A;  2K9S A;  4NC7 A;  5F0H A;  5F0F A;  1YHQ I;  2EH3 A;  5CVJ A;  2VT2 A;  2EWN A;  1QGP A;  3F72 A;  4U0Y A;  2CMP A;  3K6G A;  2RGV A;  1AU7 A;  5IP9 J;  3LWF A;  3VYT B;  3OS1 A;  1H0M A;  1XG1 A;  1VQO I;  4MEX F;  3H5A A;  1Z3X A;  3PM1 A;  3T8T A;  1ACI A;  1ZG3 A;  4IEJ A;  1KQ0 A;  2NS0 A;  5J4V A;  1YJW I;  4L9T A;  3RSN A;  2R5Z A;  4PGH A;  4AD9 A;  3S3M A;  4OMY A;  2XGX A;  2FXA A;  3IH2 A;  1LEA A;  1SMY F;  1P4A A;  4ON0 A;  2P6S A;  1E3H A;  2L7K A;  1KU2 A;  3IUO A;  4IHS A;  2L0K A;  2CQQ A;  3R6S A;  2XAS A;  5E17 F;  2R7T A;  3FXJ A;  3QWL A;  2VQC A;  2ECB A;  3I53 A;  1A35 A;  3M7G A;  4KIS A;  1E3O C;  2IA0 A;  1XN7 A;  3SYT A;  3KLO A;  4IHT A;  1SMT A;  1Z0X A;  2ZKZ A;  4A5M A;  3O8G A;  3S2H J;  2ELH A;  1O7L A;  1WJE A;  1FLI A;  3F8C A;  3JRB A;  2PG4 A;  3OS0 A;  2VKD A;  4E4H A;  1JGS A;  1T98 A;  3S2W A;  5EG0 A;  4G7O F;  1A6Q A;  1WKM A;  1Z21 A;  1GUU A;  4JBA A;  1FPQ A;  1MMA A;  2F6C A;  2X4H A;  1BW5 A;  3BWG A;  2BGC A;  2LMD A;  5DCM B;  2IRF G;  2D1V A;  3QPL A;  1OLT A;  3DTI A;  3IAS 2;  4I09 A;  4ENK A;  2W25 A;  2A6H F;  1LB2 A;  2KLO A;  5D5X B;  2YS9 A;  4A2U A;  5KAI C;  2HEO A;  5FKL A;  3MVP A;  4XOR A;  3OYG A;  4DNC A;  1TWG J;  2L9V A;  1QQI A;  1WI9 A;  1LJ9 A;  3FXO A;  2EIL H;  5B1B H;  5ICC A;  1U2W A;  2K5C A;  4HST A;  4UUT A;  4RB0 A;  2CJJ A;  3E5Q A;  1WPK A;  2FSW A;  1B4A A;  1SD7 A;  4ZH4 F;  3M8J A;  3S3O A;  3BT9 A;  3RDI A;  3SQN A;  4N4O B;  2Y31 A;  2ICW G;  4BQN A;  1IJW C;  1IXC A;  4XN0 A;  2DTZ A;  4BY1 J;  3C2H A;  2H6B A;  3DKY A;  3GLL A;  3K1P A;  2W84 A;  1S9H A;  2KQR A;  1T95 A;  1UG0 A;  1NK2 P;  1PYV A;  4KJZ A;  2DFH A;  3DP7 A;  5IYB J;  4K2E A;  3CES A;  4YFK F;  2XV4 S;  2IA2 A;  3QAH A;  1RUO A;  5FLV A;  1BM9 A;  2LLK A;  2H1L A;  1R5H A;  1XD7 A;  3M1C A;  4M6X A;  4RAG A;  1J59 A;  2K7L A;  1LVK A;  2W82 A;  2HOS A;  4BEH A;  1EKE A;  2DMP A;  4DJA A;  3KP2 A;  5TIS C;  3WE3 A;  3L2R A;  1RRJ A;  1K6O A;  3E6D A;  2HWV A;  2R0Q C;  5D5W B;  2JA7 J;  4HSR A;  1IXR C;  5DCM A;  1KZH A;  2COB A;  3I56 I;  2D45 A;  2KFD A;  5K7F A;  2QBY B;  3WU2 C;  1MBF A;  1XMA A;  2QF7 A;  3BQY A;  4G7Z F;  2NVX J;  3GWZ A;  3LA2 A;  4HAM A;  3HOW J;  4LGW A;  2K4B A;  1JHH A;  2CW8 A;  3H1C A;  3DU6 A;  1W36 D;  4KUM A;  3T0Y A;  2CQ7 A;  3OYI A;  2Y69 H;  3VPR A;  1QZE A;  1HF0 A;  3FMS A;  4RAY A;  3JW4 A;  4NDL A;  1V55 H;  4G6T B;  3LOC A;  2OU2 A;  2R7F A;  1T6S A;  1Y8R B;  3N4M A;  1ETX A;  2DK5 A;  2HDW A;  4G6Q A;  4A3E J;  4LG0 B;  3BY6 A;  2DDA A;  2Y75 A;  5E3O A;  1ZGJ A;  2VOO A;  4CCK A;  6PAX A;  3CUQ B;  1SFO J;  2DMQ A;  2OQG A;  4HOB A;  4FE4 A;  2JN6 A;  5D4S A;  2DT7 B;  2EV6 A;  4A3J J;  2EZH A;  4N0B A;  1TC3 C;  2HQN A;  1YRN A;  3E6B A;  1V54 H;  1OIS A;  3OY9 A;  2MYS A;  2XPV A;  3LSI A;  3WTS C;  3OYE A;  1ZHF A;  1J9I A;  4MHG A;  4OIO F;  1MNM C;  2CG4 A;  4Y33 A;  4JX5 A;  3ZPL A;  1AKH A;  2VC1 A;  1LFB A;  3NAU A;  2VJJ A;  3F8M A;  3A2K A;  1G2H A;  3E6C C;  5KCM A;  3F21 A;  2PLY A;  2B63 J;  3VDX A;  4AU7 A;  2O9L A;  3CCJ I;  1SAX A;  4F3Q A;  4Y52 J;  4MGR A;  2G9W A;  1O4X A;  4XKB A;  4AM3 A;  1J2X A;  2CFO A;  3FKJ A;  1MJA A;  4QWQ A;  5J1U A;  2FQ3 A;  5GTH C;  4NHJ A;  3I64 A;  1D8K A;  4XMY A;  2FD5 A;  2Y9Z A;  3NRV A;  1HXD A;  2DK8 A;  4RB2 C;  5BPD A;  3D0S A;  1POG A;  4NNJ A;  3CCV I;  4Y13 A;  4ZJZ A;  3EUH C;  1Y8Q B;  3D5L A;  5HDN A;  5GTI C;  3JRF A;  3QPT A;  3LSR A;  3CUQ A;  4PJM A;  2XGE A;  3BTL A;  3GZ6 A;  5J1R A;  2M4G A;  1ONV A;  3FMR A;  2X85 A;  4M9X A;  3CMY A;  4LB5 A;  5J47 A;  1LFU P;  2BEO A;  3E5X A;  2E7W A;  3H5N A;  3HRM A;  2P5V A;  3ZQC A;  1X1D A;  1S29 A;  1Z9C A;  4A5N A;  1G6N A;  2A69 F;  1DGR M;  1UFM A;  3AG3 H;  3MEX A;  2ZSI B;  2ME6 A;  3RTR A;  2JWT A;  4A0Y A;  3GTQ J;  4O3M A;  1VQN I;  4I7H A;  5ILV A;  4RMN A;  4ZDO A;  3S1M J;  3GZN B;  5E1X A;  3MZ8 A;  4CHU A;  2JA2 A;  5F1J A;  2VUM J;  4I0A A;  2R7S A;  1W7P B;  4XQF A;  1R4M B;  2F4I A;  3FDY A;  3I59 B;  1QPM A;  3DCF A;  5ICE A;  2EZK A;  1KU9 A;  4XID A;  3CO6 C;  2R7V A;  3KEQ A;  2UXX A;  3JCU C;  1SFE A;  3K4N A;  2LD5 A;  4MTD A;  3A0B C;  5HDG A;  5JI6 A;  1R6R A;  1SD6 A;  1IZ1 A;  3Q9V A;  5J8C A;  2BY2 A;  1UEL B;  3GLX A;  5AIP A;  3JRD A;  3GFI A;  2R7W A;  2JA8 J;  4R8H A;  2AO9 A;  3SFZ A;  1U5T C;  2OTL I;  3TMO A;  1JTX A;  4XKW A;  3GFJ A;  1FJL A;  3ABM H;  3A4C A;  1VFC A;  4E70 A;  3RPU A;  2KRH A;  1E2X A;  5FGM A;  3R0A A;  2DLL A;  2CFX A;  1TWC J;  4EJO A;  5C44 J;  2DW4 A;  2QM3 A;  2NS7 A;  2PMU A;  4XLH A;  2I10 A;  4NQW B;  3U9G A;  4CCJ A;  2A61 A;  3EYY A;  4UUS A;  1HQC A;  1WJC A;  3CZ6 A;  4L0Y B;  3F8F A;  4X0G A;  2HYG D;  2R4G A;  4PZJ A;  5FRM A;  5F08 A;  4D9J A;  2DI3 A;  3OL3 A;  1RC9 A;  2NNN A;  3PFI A;  1UCR A;  5L3F A;  3C7J A;  3OL4 A;  4G12 A;  1B59 A;  2L4M A;  1R5G A;  3I59 A;  3WG7 H;  4GFB A;  4N4N B;  1FNN A;  1PUF B;  1GV2 A;  4ENM A;  2VKH A;  3V7S A;  2Y2Z A;  1MGT A;  3QYE A;  5EZH A;  1IN8 A;  4PJJ A;  2PEX A;  3ZP5 A;  1YW9 A;  1HCR A;  1ZLK A;  1OMI A;  3J81 K;  1W36 C;  4KMF A;  2KIS A;  1LEB A;  1ERD A;  2HTJ A;  4KN4 X;  4CA0 A;  5LRS A;  1X1B A;  3ERM A;  3M07 A;  1YE9 A;  1TQM A;  3CME I;  1B72 A;  2QSG X;  3MKZ A;  3BJA A;  2VL8 A;  3IH4 A;  3OYM A;  1T0F A;  4HYE A;  2PJR B;  2OZU A;  5IT9 Z;  5LBQ A;  4B8X A;  3J80 K;  1BOA A;  5H20 A;  4NQW A;  3F22 A;  1JKR C;  2W48 A;  3WHB A;  3G1L A;  2E1C A;  1B9M A;  3MKL A;  4QPQ A;  1MD0 A;  4XON A;  3HOT A;  2JA5 J;  5HOO A;  3OYF A;  1MJ9 A;  3CDL A;  2VBW A;  2NRA C;  1MH4 A;  2JSP A;  1X1P A;  3HBL A;  3WU0 A;  2LRD A;  4U0V A;  2IGO A;  2Y0S N;  1W7P D;  3LL7 A;  2VLA A;  1Q1V A;  4WXH A;  5M5Y J;  5D5V B;  2XGC A;  4S05 A;  2WB1 A;  1W5T A;  3JRC A;  2DFF A;  4CCL A;  3K10 A;  3D5S C;  2PMZ A;  4HZF A;  2OUM A;  2WA0 A;  2KKO A;  1FOW A;  3F6V A;  3I5U A;  1N25 A;  3GTM J;  2NYX A;  3FHZ A;  2Q2E A;  4AWX B;  2VOP A;  3EUA A;  2VIX A;  1YQA A;  3DEU A;  2L4A A;  2RQP A;  1V3F A;  3SEQ A;  4L0Z B;  3D5R C;  1RR8 C;  2E5Z A;  3GFM A;  3E5U A;  2FBH A;  2QVO A;  2PJR A;  3BR3 A;  4CCO A;  1WSU A;  1EF4 A;  2JPB A;  1BW6 A;  3MKY B;  3FXU A;  2CUJ A;  3TO6 A;  1XCV A;  2RVC A;  4J19 A;  1VQ5 I;  5KAF C;  5DS9 A;  2E5N A;  5ILU A;  4M3F A;  3MWM A;  2AQE A;  4B3X A;  1SVO A;  2E34 A;  4CCN A;  3G2B A;  1K83 J;  4XSX F;  1YW7 A;  1J5Y A;  1MBE A;  2HQ5 A;  2EFQ A;  2P6T A;  5JHU A;  2HOE A;  3BG6 A;  3PL8 A;  3W2A A;  3I54 A;  3HKZ N;  3LAP A;  3H0G J;  3LFU A;  5HLG A;  1OR7 A;  5HLH A;  1GVD A;  2M8G X;  3CDH A;  1TWF J;  2L7F P;  3SZP A;  2MC4 A;  4IQJ A;  2NOG A;  2DU9 A;  2F4O B;  3LQQ A;  1I27 A;  2A5W A;  2KRF A;  2V1N A;  4XKC A;  4E7Z A;  5L3G A;  1P7I A;  4LLN A;  4GRI A;  4NUB A;  4ZDP A;  4WXC A;  2D1H A;  4H4K C;  1R1V A;  3A01 B;  5F1R A;  1KGS A;  3TBI A;  4BS9 A;  3RKX A;  4OAY A;  3CCM I;  4BUP A;  3MMY B;  4BQO A;  4HNV A;  3HOV J;  4DBR A;  2EFN A;  1XX5 A;  2A3S A;  1ETK A;  2CV1 A;  1KON A;  1GDT A;  1JXS A;  4WXD A;  2VB6 A;  4MQ9 F;  2YSR A;  1IN5 A;  4CYC B;  2WAF A;  3ISP A;  2GAU A;  1G3Y A;  5J4Y A;  4CGZ A;  3ZN0 A;  2DOE A;  3GBG A;  3M1E A;  4BAY A;  4Y17 A;  2V9K A;  3TO9 A;  2KDZ A;  3HOZ J;  2HQR A;  2NVQ J;  3IV5 A;  4YIR X;  4HW0 A;  2K3P A;  1ZR2 A;  2MH9 A;  4GXO A;  1YYV A;  4L9V A;  4CIC A;  4UY8 I;  3PO3 J;  3KYC B;  2RDP A;  2XAJ A;  3G1M A;  2V1X A;  1ZG5 A;  2QLZ A;  2HGC A;  4IHX A;  1G8X A;  3T5X A;  2LYC A;  3LSJ A;  1HW5 A;  5DM7 F;  4OAZ A;  1F4K A;  3H36 A;  1UB9 A;  4ASN A;  3AG2 H;  2O5R A;  1UG2 A;  1R71 A;  2OC6 A;  5AON A;  3W3C A;  1ZLJ A;  4E7L A;  2QKM B;  3PNY A;  5CQG A;  2F2E A;  3QYF A;  3LSM A;  1W0U A;  4DYQ A;  4IRI A;  1V5F A;  1XGM A;  2NVT J;  2OCE A;  3L7W A;  1XS9 A;  3M4O J;  4AVZ A;  2FF4 A;  2OCC H;  2XAF A;  3OYB A;  1FWZ A;  1XSX A;  1ZG1 A;  1PUE E;  5E3L A;  1QVU A;  4AUX A;  4CXF A;  3FIW A;  4PFP A;  2FNP A;  3KP5 A;  2XAG A;  1OCT C;  2XKO A;  1FMW A;  4XM3 A;  4BBS J;  3RPQ A;  3JAM K;  1Z3Y A;  1U8R A;  2UWM A;  5L3E A;  5K1Y A;  2HYF A;  3DLL F;  2CO5 A;  3BCB A;  2MH2 A;  4KIF A;  2R5Y B;  4LIU A;  1LFP A;  1XCB A;  1T08 B;  2VJ4 A;  3H92 A;  2WBM A;  2BE5 F;  1CGP A;  1ON1 A;  1I6X A;  2LVS A;  2KIF A;  4RDU A;  2NVY J;  1XTA A;  3DFG A;  3G71 I;  2DA1 A;  4HX8 A;  1QA6 A;  1IRZ A;  2IAI A;  3E7L A;  1VQP I;  1XB4 A;  5LEJ A;  1P92 A;  2L2O A;  2HYJ A;  3EQL F;  3IHU A;  2DFE A;  2CQX A;  4BAC A;  4P9F A;  2BVM A;  2ISZ A;  2ZNZ A;  2B0L A;  2H27 A;  1TBX A;  1U8B A;  3GTL J;  4R79 A;  1ETW A;  2Z3Y A;  4I0B A;  4XLF A;  2MD0 A;  2ESH A;  2FRH A;  3DEW A;  3V7C A;  4HNT A;  4LD5 A;  5E18 F;  1DPR A;  4TV7 A;  5CQE A;  5J3L A;  2R5Z B;  2R7Z J;  5J8F A;  1F36 A;  2H1K A;  5F0C A;  2H09 A;  3N05 A;  3W2W A;  3ZQG A;  1DPU A;  3DEE A;  4V2F A;  2OF7 A;  3DBR B;  4BQQ A;  1QPI A;  3CCQ I;  4ENN A;  2ZNY A;  3NEU A;  1TW3 A;  1L3L A;  4PGG A;  4MFD A;  4PUS A;  2A6E F;  3J7A O;  4U87 A;  4RGS A;  2IEK A;  4IX7 A;  1Y6I A;  4JX4 A;  4V2G A;  5LHH A;  1AWC A;  3KYL A;  1IGN A;  2KMU A;  1HKS A;  1ORK A;  3WTX C;  3BR2 A;  3CCL I;  2BBY A;  3CC4 I;  4A3D J;  3S93 A;  3S17 J;  3WGI A;  4E7I A;  2JSC A;  2XB0 X;  3P9I A;  4ESF A;  5CPR B;  2GA2 A;  5EG0 B;  2CV2 A;  3QQA A;  1XGO A;  1SFK A;  3TDU C;  4DIQ A;  4U0W A;  3HOS A;  3HYI A;  3H9J A;  5L3C A;  2E60 A;  4ZZD A;  3ZOB A;  2WAQ N;  5E8I A;  1SD5 A;  1AOY A;  1NHA A;  1YO5 C;  1NG6 A;  3KZY A;  4QLC U;  2NAZ A;  2VJ5 A;  3MQ0 A;  3OYC A;  4EJT A;  2XB5 A;  4PCQ A;  3E97 A;  2BZT A;  2P8T A;  4EEF G;  4A3K J;  2AXT C;  2IGM A;  3BR1 A;  3K1M A;  2ELJ A;  3HG9 A;  3GYH X;  1FSE A;  1QZZ A;  4ZTJ A;  3IL2 A;  5HS7 A;  3CD6 I;  3PQJ A;  3WTU C;  2F4M B;  1STZ A;  5EEH A;  3J7Y J;  1UHM A;  1IN7 A;  1L0O C;  2PBI A;  4GYG A;  1ZAR A;  4Z6Y A;  2IA1 A;  3IKT A;  3GCM A;  3AL0 B;  3FBI B;  4HPQ A;  3K4M A;  3BLY A;  3I71 A;  4HV6 A;  1X3U A;  4XN3 A;  4XRS A;  2E1N A;  2XAQ A;  1FSH A;  2RKH A;  5KK1 A;  3GO5 A;  2FOW A;  4W1U A;  3R4K A;  3IWF A;  1OCP A;  4XRF A;  3MKW B;  3HC7 A;  3ZQQ A;  2NS8 A;  3FXK A;  4LIV A;  1ETO A;  4BEH B;  5IT3 A;  4D7M A;  1IDY A;  2LDU A;  4XL9 A;  4UB8 C;  3S32 A;  3HOX J;  4XK4 A;  3DPL C;  3I55 I;  2LKX A;  4F91 B;  2Z2S B;  2Q0O A;  1PP7 U;  4A69 C;  4C3H J;  4BDZ A;  1KA8 A;  2AHQ A;  2KP6 A;  3K69 A;  1OYI A;  2XF7 A;  3PJR A;  1RUN A;  3BG5 A;  1DU6 A;  3RKQ A;  3KET A;  3MCZ A;  2G7U A;  3ZXS A;  4C9Y A;  4P55 A;  4BKX A;  2EIJ H;  1DGW Y;  4IOC F;  5TRD A;  2N8G A;  2PN6 A;  2NXN B;  3PUB A;  5IYC J;  1RIO H;  4LJZ F;  2F5E A;  1D1B A;  2K27 A;  3SDG A;  1ZN2 A;  3MFK A;  1UST A;  3MZH A;  1USS A;  5DV5 A;  1MDM B;  1LVA A;  4FQG A;  2M30 A;  3KE2 A;  3OYH A;  4KIT B;  2DYS H;  3M8F A;  1MBH A;  1RPW A;  3ZMT A;  2DTR A;  5BMZ A;  1EV7 A;  1ZEL A;  3T8R A;  1ODD A;  4AYB A;  1DDN A;  4C3J J;  4LMY A;  3GTG J;  2CYY A;  2KPM A;  3BZC A;  1X3Z B;  1H8A C;  1Y0N A;  3HOU J;  2ZC2 A;  1Y39 A;  5K7H A;  1GXQ A;  3Q9S A;  2GM4 A;  2CV0 A;  3FXM A;  1YRN B;  3DPU A;  4A6E A;  3BTC A;  1R22 A;  2MLK A;  1R23 A;  2A05 A;  1V5E A;  3GVA A;  2CSO A;  2A6T A;  3WE2 A;  1JUP A;  1GXP A;  4CYD A;  3CMA I;  1AKH B;  1YI2 I;  2AXL A;  1WFX A;  3BDD A;  1EH7 A;  4DOZ A;  3GW2 A;  2HU9 A;  3FBN B;  3FZV A;  2Z33 A;  4KT6 A;  1K4T A;  1OCZ H;  1FOK A;  2E36 A;  2XRO A;  2QCO A;  3KP3 A;  2I5U A;  5IOZ A;  3CTA A;  4OU0 A;  3VSK A;  1V5G A;  2LRE A;  4NC8 A;  2HPI A;  2IJL A;  2CUZ A;  5BNG A;  4II2 A;  1CQT A;  4HF0 A;  5CYV A;  2BY3 A;  1MDM A;  3JSP A;  3BG9 A;  1J75 A;  5FFX A;  2GIZ A;  4S0H B;  3I4N J;  4M3G A;  3QPH A;  2GQQ A;  5J40 A;  2EV5 A;  4B43 A;  1P9Q C;  2HPM A;  2GXB A;  1WCM J;  2BHY A;  3SJM A;  4C2M J;  2JRT A;  2ZO4 A;  5EJC A;  3F23 A;  2X1D A;  2V26 A;  1B9N A;  1APL C;  4HNU A;  2G0E A;  1N75 A;  4IQ4 A;  3HSE A;  2DJN A;  4JYK A;  4RM2 A;  4EMS A;  1YX3 A;  2DA4 A;  4R1H A;  2MC3 A;  4U7D A;  2RC4 A;  3V42 A;  1XGN A;  4FTH A;  2MLG A;  2MSY A;  3IKV A;  3BPX A;  3BJ6 A;  2XRN A;  3AKZ A;  5EDN A;  1S7A A;  2YUS A;  3BP8 A;  4IOA F;  2CUF A;  2LY2 A;  2EBI A;  5EZG A;  2VQH A;  4IHY A;  5EGO A;  4Y4R A;  4P9U A;  1UHW A;  1GVJ A;  2H6C A;  2OA4 A;  3QYB A;  3G1O A;  2VQG A;  5CVU A;  3H3U A;  3O6B B;  2DMU A;  4BHP A;  4IPA A;  3HZJ A;  4N9I A;  3BOQ A;  1MIJ A;  3OIQ A;  2O61 A;  2JT1 A;  3RJP A;  3OR2 C;  4OIP F;  1WH5 A;  1WJD A;  1R7J A;  2LBF A;  3B6A A;  4NBQ A;  1SEU A;  4YIF A;  1Z7L A;  1FTZ A;  1QO0 D;  1I1G A;  2DA3 A;  2DT6 A;  3CP2 A;  5BS6 A;  3GFL A;  1EA3 A;  3OOU A;  2DT5 A;  1A6I A;  4E7J A;  3GTP J;  4RGU A;  1MMS A;  3UNG C;  3HSF A;  5M5X J;  1QZY A;  1GV5 A;  3RYP A;  9ANT A;  3PSI A;  2KHM A;  1QNT A;  1S6L A;  3FKI J;  2W1O A;  1YIT I;  2W57 A;  3R61 A;  3ESW B;  3HM5 A;  2HS5 A;  1VND A;  3S14 J;  2R7O A;  1TW2 A;  2ZME A;  1VQK I;  4CZZ A;  1I50 J;  3WG9 A;  1S3J A;  2L7Z A;  4E6K G;  4M3D A;  4RLF A;  4UUS B;  4EM0 B;  4EJU A;  3FHN A;  3K1N A;  1X19 A;  2VBX A;  3J81 Z;  2YU9 J;  1OQY A;  3BG7 A;  3JTG A;  2D2W A;  1QVT A;  4BGD A;  4IRG A;  3CO7 C;  3TW6 A;  2WAE A;  1G59 A;  4P5O A;  4IF4 A;  1SAU A;  1PP8 F;  1I3A A;  2GWR A;  4L9N A;  3K2A A;  2IS6 A;  2EQR A;  2FUG 2;  3NQO A;  1BI3 A;  3QU6 A;  3GUD A;  4MEY F;  3J80 Z;  2V7F A;  5F04 A;  2ETH A;  2NOJ B;  4WK8 F;  4W97 A;  3PO2 J;  5EYR A;  1G4D A;  4GGG A;  4IZZ A;  1JUM A;  4ZYA A;  4RAZ A;  3HDD A;  5HLI A;  3BC8 A;  4J01 A;  1XC5 A;  2XVC A;  4FCY A;  5K5Q A;  1K7A A;  1B72 B;  3C2B A;  4MTE A;  5FRN A;  2B9S A;  2QQ8 A;  2EFO A;  3O2P E;  1W4M A;  3ZRG A;  3QPS A;  3JRA A;  3ECH A;  4DW6 A;  5GAH J;  5LFA A;  2XDV A;  2HVS A;  3KX2 A;  2M34 A;  3E6M A;  1RKW A;  3EUK L;  1X58 A;  4DYC A;  2LSO A;  2DN0 A;  4I2O A;  2GA1 A;  2GOX B;  3ZQH A;  5GPA A;  1MZB A;  4DGW B;  2EIN H;  5K7Z A;  2DAO A;  1KU3 A;  5LGU A;  1WWX A;  1QBJ A;  5CJ9 A;  1I1S A;  2OZ6 A;  3R60 A;  3MN2 A;  3DBH B;  1MJB A;  2O7O A;  3PIO F;  1RET A;  3WTZ A;  5A2Q K;  2P7V B;  1UMQ A;  3WGG A;  4AID A;  2DA7 A;  4UVB A;  1RNL A;  5AIQ A;  3GEZ A;  1B6A A;  4BH9 A;  1UZC A;  4I76 A;  2XUB A;  4EM1 A;  3R0J A;  1G3T A;  2G7H A;  1WRJ A;  3IAM 2;  3OYJ A;  3GTO J;  2DXI A;  5DUK A;  1D1C A;  3DLA A;  3QOE A;  4MIM A;  4XOP A;  1R5I D;  4F93 B;  1LE8 B;  2JA6 J;  5DYM A;  2BY0 A;  2W24 A;  1X2N A;  3B6C A;  3JR9 A;  1U9N A;  2Q2E B;  4CCM A;  3ZQL A;  1CF7 A;  1EH8 A;  2WY8 Q;  2ECC A;  3BTI A;  4KN7 X;  1FMV A;  3IC7 A;  2K3F A;  3TKY A;  2F5D A;  3KZI C;  3CF5 F;  5CVV A;  1VTN C;  2FA5 A;  1T56 A;  2ZXH A;  4XRS G;  3AL0 C;  3ZQ7 A;  3RPU D;  2JK3 A;  4RBO A;  3ABU A;  3OWT A;  4M6Y A;  4HDU A;  2AS5 F;  3ZQF A;  2XAH A;  3BQZ A;  1FIA A;  2ZXJ A;  1ITY A;  2PJP A;  1VQ7 I;  3SDB A;  1KQ8 A;  1J09 A;  3KIO A;  1XDS A;  3HPG A;  1YOV B;  1TTY A;  4KA4 A;  1NH3 A;  1YJN I;  1ZGW A;  2PI0 A;  2JUG A;  2PFB A;  3H5R A;  4UV8 A;  4HLY A;  5KVR A;  3DF8 A;  5DTD A;  4KDP A;  3CUO A;  3M8E A;  3VOD A;  5FB2 A;  1VF9 A;  3B02 A;  3FF5 A;  1VQM I;  3ZMD A;  5EEG A;  3F9K A;  4BBR J;  3KYD B;  1Z6R A;  3LST A;  2MD5 A;  2TRT A;  2UV1 A;  1S5L C;  2Z16 A;  1YFH A;  1LE8 A;  1B8I A;  3Q0W A;  5C3E J;  1XSD A;  4YEJ A;  5CVI A;  3VYS B;  5ICG A;  5IP7 J;  2GXG A;  3F8N A;  4I02 A;  4AC0 A;  1B1B A;  2STT A;  3S15 J;  3FWE A;  1BI0 A;  3DU5 A;  2QEX I;  4BDY A;  3QOD A;  1SC7 A;  1U6G A;  4CO8 A;  1LDK B;  3AG4 H;  3HHG A;  4L5I A;  4OMZ A;  2QA4 I;  4M9S A;  2VJI A;  2M8E A;  2WV1 A;  2HDC A;  4OIR F;  5IOY A;  2K9L A;  2DA2 A;  4LG3 A;  1WI3 A;  4Q48 A;  1T33 A;  3V4G A;  2H8R A;  4BL0 B;  3G73 A;  5BPI A;  2WB1 N;  3FK6 A;  1FBU A;  2LOO A;  4OWR B;  1I3Q J;  5HS9 A;  2PMZ N;  3A03 A;  2FML A;  4YEL A;  1Q1H A;  2K4J A;  3MD2 A;  2R7U A;  3K4B A;  3TED A;  4BXF A;  1W5S A;  1SAN A;  3ECO A;  2V4J C;  2H8W A;  4Q47 A;  4JQF A;  4BHC A;  5D6F A;  2V6C A;  2Q1Z B;  2W7N A;  4M73 A;  3JRE A;  2EFP A;  5L3D A;  1JKO C;  4BNC A;  4NC6 A;  1XPX A;  2DOA A;  1FBQ A;  3OYN A;  5LGT A;  2BXY A;  3HB9 A;  4II3 A;  4I99 C;  2CH0 A;  2FMY A;  3NAR A;  3JAM Z;  2W4S A;  2HDD A;  2EFW A;  2P0W A;  5KHD A;  4PDK A;  5DUI A;  2LG4 A;  4B1R A;  1A04 A;  2XSJ C;  2M45 A;  4F52 A;  3JRI A;  2TDX A;  3BZK A;  3CLQ A;  3FXL A;  4HX7 A;  3K70 D;  2EK5 A;  2K9N A;  4IJA A;  1BC7 C;  5IYD J;  2EZL A;  1HKQ A;  1ZRE A;  3J7Z I;  4A3F J;  2E19 A;  5CLS A;  5J6X A;  1D0Y A;  5LRR A;  4ZC3 A;  3CUQ C;  3HGY A;  2DPD A;  4C3I J;  3KEO A;  2V79 A;  5K5O A;  4EGZ A;  1FC3 A;  2JVG A;  2QUF A;  4B44 A;  3TW7 A;  3REO A;  4YRV A;  1ZRC A;  4C2U A;  2XPW A;  4OIN F;  5GAD J;  2DQR A;  1TNT A;  2KIQ A;  3LSH A;  5FD6 A;  4AIJ A;  1FZP B;  1ZRD A;  1RZ4 A;  2PX9 A;  4RLQ A;  2DA6 A;  2F48 A;  1MMN A;  2YPR A;  2K86 A;  4D1Q A;  1IV8 A;  4HEA 2;  5FRO A;  3FXR A;  4PSX A;  4XBF A;  3U21 A;  3WTW C;  5GPC A;  1FT9 A;  1ON2 A;  1HBX G;  1O3Q A;  1SFU A;  1BR4 A;  4V19 K;  3I58 A;  1HKT A;  4DZJ A;  2LY9 A;  3S1Q J;  1MBJ A;  3S1R J;  2DFI A;  4YII A;  4D5F A;  1HDP A;  4Q5S F;  2EIM H;  2L9N A;  4BU2 A;  4EAT A;  1MBK A;  2VI6 A;  4JOM A;  2VAS A;  2HFH A;  1D5V A;  2V9P A;  2LTP A;  3NWS A;  3AAF A;  2HI3 A;  3DTK A;  3LSK A;  3WTY C;  1MMD A;  3OMY A;  3OYL A;  4MNU A;  3TOB A;  1H9G A;  1J0R A;  5DD4 A;  3M9A A;  5F64 A;  2BOL A;  3CCR I;  1BJA A;  1I6H J;  5LGN A;  4E7H A;  2C6Y A;  1VQ4 I;  1PDN C;  4YFX F;  4MQV A;  5FLX K;  2VC0 A;  2RRE A;  2RV8 A;  1HSJ A;  1D0X A;  2IPQ X;  4ANJ A;  4OIQ F;  1DP7 P;  2LK2 A;  2KIU A;  1N77 A;  5TGT A;  1UJ8 A;  1VQ8 I;  2I8D A;  2CQK A;  5LD2 C;  1MBG A;  4Y15 A;  2A07 F;  2P5K A;  4PJ0 C;  2VT3 A;  2QSH X;  2M7B A;  4NB5 A;  3FM3 A;  2XF6 A;  2F5V A;  3BG3 A;  5GAE J;  3OIP A;  4DZP A;  3ZMV A;  2COM A;  4O5V A;  1BIB A;  2X1E A;  1TT0 A;  2A5Y B;  3W6K B;  1OCR H;  3TQN A;  3CJT B;  4EVI A;  3MZY A;  3U1K A;  4BE2 A;  2M2E A;  1A5J A;  2R93 J;  3K9T A;  3JRG A;  1BN5 A;  4XLE A;  5JLX A;  2VE9 A;  4A0Z A;  2OV7 A;  2Z9O A;  3QP6 A;  2Z99 A;  3BR0 A;  4X6A J;  3I3L A;  2Q8K A;  3ABT A;  1S8N A;  2ELK A;  1FYM A;  1WJA A;  2A68 F;  4UXN A;  4E7K A;  2O8X A;  3EUH A;  4CUG A;  1TT5 B;  1FOY A;  2ZXI A;  3W2V A;  1MH3 A;  5DEQ A;  1T0F C;  1R36 A;  3UR3 C;  3KFW X;  5LHG A;  3WOD F;  1ZRF A;  4RGX A;  4D7N A;  3QU3 A;  4LB6 B;  4WWC A;  2EZI A;  4G6D A;  2HOT A;  3HOY J;  5BOX A;  3GME A;  4X1E A;  3ERE D;  3TP3 A;  1IRX A;  2FQ4 A;  2OBP A;  5FKM A;  1REP C;  1O57 A;  4JK1 X;  1U0J A;  3M3Y J;  1XGS A;  1R9T J;  4GYI A;  3CC2 I;  1Y0U A;  3RKW A;  3EPZ A;  4LFU A;  2X1C A;  2ZFW A;  2WC2 A;  2E7X A;  2VBZ A;  2DBB A;  2R3S A;  2L5Q A;  1F9N A;  4HG2 A;  3KP4 A;  5B66 C;  1MSF C;  1WJF A;  2QEN A;  2XPU A;  3FXQ A;  4UVC A;  2IS1 A;  4BQA A;  1TP4 A;  3I9V 2;  2XRL A;  4RM3 A;  4FT8 A;  1VQL I;  1WQ2 A;  2JJ7 A;  3RYR A;  2DO7 A;  5FFZ A;  1ZKG A;  2DYR H;  1D0Z A;  3ZGK A;  2RQQ A;  3WTT C;  4HA8 A;  3L2Q A;  2QQA A;  3CLO A;  5E1W A;  1YTY A;  5B3S H;  4XLA A;  3N97 A;  3K70 C;  1YX5 A;  2RNG A;  2BW3 B;  4YFN F;  1JE8 A;  1U5T A;  3A1Y A;  4GCV A;  3L2W A;  1JHF A;  5EF6 A;  3T1B A;  4RB3 C;  3GX4 X;  1BR1 A;  4M71 A;  2TCT A;  1GHC A;  2ADU A;  3L09 A;  2H94 A;  2JMW A;  3ABL H;  3HSR A;  3EDP A;  1N78 A;  2BHZ A;  2NVU B;  4IRH A;  2CS3 A;  2ZSH B;  2O3F A;  2R7X A;  2JRM A;  1WZ2 A;  2BYV E;  5D6E A;  4KT5 C;  1T8I A;  1VQ6 I;  1ZAO A;  3FMQ A;  4EJV A;  1OR7 C;  2GBY A;  1W0T A;  5D8K B;  3K4K A;  3V8J A;  4HQE A;  2K9M A;  3K4L A;  1RR7 A;  1K6Y A;  3F3X A;  4F92 B;  5FD5 A;  4I01 A;  3ASO H;  2HVR A;  1FP1 D;  2R7R A;  4A3I J;  1LPQ A;  1R1U A;  4XKV A;  1ZR4 A;  2EJR A;  2KRC A;  1M1E B;  2VPL A;  2K40 A;  3DBL B;  3CDI A;  3O3K A;  1RES A;  1SD4 A;  1F1Z A;  2IXS A;  4Q4Z F;  1X3W B;  2BW3 A;  1UAA A;  1YLF A;  4PJN A;  3L00 A;  1LDJ A;  1IF1 A;  3DKX A;  3SHF A;  4WX9 A;  1ZTR A;  2IT0 A;  2DQL A;  4U7B A;  1J7K A;  2LR8 A;  4HX4 A;  2YR2 A;  4QSH A;  2P5L C;  3LMM A;  1P2F A;  3CCY A;  1WJB A;  3PQK A;  2R92 J;  1FTT A;  3PIP F;  4UVA A;  2AQF A;  2M87 A;  3FM5 A;  4B3A A;  4EM2 A;  1JI8 A;  1X2M A;  3EET A;  1IV6 A;  1TQP A;  3P7N A;  1OFC X;  3L2C A;  4EV0 A;  2XC7 A;  2CUE A;  1R4N B;  3QRF F;  2LY1 A;  1T38 A;  5M3M J;  1D3Y A;  5E1Z B;  4KNY A;  3ZCO A;  1IW7 F;  1IG7 A;  5EGO B;  4H0E A;  4IXA A;  2UZK A;  1ZH5 A;  2R7D A;  3DQV C;  3AG1 H;  2DOF A;  1IO2 A;  2VKE A;  2Y48 A;  3IRQ A;  1HLV A;  4G7H F;  2O8K A;  2JTV A;  1DQU A;  3E1S A;  1LNW A;  3H0D A;  3RQI A;  2J5P A;  1QRY A;  2ZXW H;  4WF2 A;  1HW1 A;  2FNA A;  3PSF A;  4AYB N;  5ERI A;  1KQ9 A;  2M0M A;  2LBF B;  5HNF A;  1QHG A;  2ZCW A;  1IN6 A;  3X2Q H;  3HHH A;  1O3S A;  3ASN H;  4FX4 A;  2P4W A;  2Z1D A;  2KIM A;  5D8L B;  4IL6 C;  3JSO A;  2ZJR F;  1ULY A;  2P7C B;  2X6W A;  5H6R A;  2PMH A;  1U3E M;  3COA C;  2FJ1 A;  3FIS A;  3P9K A;  5FKN A;  3VYU B;  4N9H A;  2FE3 A;  3IH3 A;  3BCA A;  4Z2Y A;  1F43 A;  1OKR A;  2Y0M A;  1K79 A; 
#chains in the Genus database with same CATH homology
 2BV6 A;  4KYW A;  1C0W A;  4HQM A;  1OYW A;  4KIC A;  4S04 A;  2ZME B;  1TQI A;  1Z1D A;  1P4W A;  4L5J A;  3ZMU A;  3Q5F A;  4UV9 A;  1IAW A;  2VBY A;  2QBY A;  1R00 A;  4G94 A;  3C18 A;  1YW8 A;  3IWZ A;  2QZ8 A;  3RKY A;  5H6Q A;  4LLG F;  3GZ5 A;  4WCG A;  3V8L A;  2JZY A;  4M9Z A;  4AIH A;  4ESJ A;  4M72 A;  1O3T A;  1HST A;  2W85 A;  2L54 A;  4UNO A;  5A2Q Z;  2OAZ A;  4LG0 A;  4ZYD A;  2DPU A;  4XSZ F;  4EJW A;  4I98 B;  2L02 A;  2ESN A;  4KIG A;  2HKO A;  5TJJ A;  4ZYG A;  3BPV A;  1SFX A;  2OD5 A;  5DD8 A;  1FYK A;  3IRR A;  3FX3 A;  3LA3 A;  3VOE A;  3GXO A;  2QWW A;  3HRU A;  4BYY A;  4YG2 F;  4AIK A;  1P6R A;  2M1B A;  3ML6 A;  2LNB A;  2STW A;  3WTV C;  3V7R A;  2V1D A;  3WU1 B;  1HW2 A;  2VOD A;  2VXZ A;  3BJO A;  3KLN A;  4A12 A;  3BRO A;  4G8X A;  2J5O A;  1CF7 B;  4KFC A;  2WWY A;  2VE8 A;  5E20 A;  1U78 A;  3HRT A;  1TLH B;  3OOP A;  2O03 A;  3ROU A;  2XKP A;  2OQR A;  3P9C A;  2IVM A;  3QOP A;  5FO5 A;  4ENJ A;  2XIG A;  3L9F A;  5ED4 A;  3KCC A;  3I0T A;  2KJC A;  4ZYH A;  4RS8 A;  5F6F A;  3DV8 A;  4UUV A;  1FY7 A;  2HKX A;  3TDZ C;  3DPT A;  1H9T A;  2RN7 A;  2YU3 A;  5BQT A;  4O6J A;  4FHT A;  4KMU X;  1V4R A;  1TNS A;  1YIO A;  3TOA A;  3GF2 A;  2EA4 A;  4G9Y A;  2VN2 A;  1W7P A;  4HF1 A;  1EH6 A;  4HBL A;  4ZZL A;  3VB2 A;  2KJB A;  2ISY A;  4IVN A;  1BBY A;  1KU7 A;  2PQ8 A;  5LLQ A;  2LF8 A;  2V9V A;  3F6O A;  2LKP A;  1I5Z A;  4L18 B;  4RGR A;  3V8K A;  3BZ6 A;  2LF7 A;  3C1D A;  4A6D A;  2F5C A;  4LK0 F;  2ACJ A;  1KYW A;  1IN4 A;  1BI1 A;  4LLL A;  2ZJ2 A;  5D5U B;  5LHI A;  3ZN1 A;  2M5W A;  1RI7 A;  4ESB A;  3KZZ A;  2L3D A;  4BHB A;  4KIB A;  1BIA A;  1BI2 A;  2HR3 A;  1ZGA A;  4M74 A;  1XMK A;  1BC8 C;  1P4X A;  2FBK A;  4OOI A;  1OYY A;  5JVT A;  4L9J A;  1XSV A;  5ICF A;  2YX7 A;  4HF2 A;  4EQQ A;  1E17 A;  1G3S A;  4HDV A;  4AVP A;  3I4P A;  3DKW A;  3F8B A;  4D0P A;  4XLN F;  1ZYR F;  2GZW A;  2EB7 A;  3LFK A;  5HS8 A;  2HTS A;  3LQR A;  3ZMZ A;  3VEP A;  2X0L A;  2FOK A;  1MKM A;  2NNY A;  2VON A;  3TO7 A;  5HDK A;  2O6G E;  2V1U A;  2EV0 A;  3U1D A;  4P96 A;  2Z5U A;  1IRF A;  2RNJ A;  2CWE A;  1O7F A;  1KYZ A;  5IT9 K;  3HTS B;  5ILS A;  3W6J B;  5FLX Z;  4RB1 A;  1K78 B;  5L3B A;  1Z7U A;  5D4R A;  4XLP F;  1XDU A;  3QP5 A;  3RI4 A;  5JFR A;  4DQ2 A;  3ULQ B;  3TGN A;  2HZT A;  2IW5 A;  2WTE A;  2FBI A;  3HUG A;  5HVQ C;  2IP2 A;  3EYI A;  1YS7 A;  3HIF A;  1LQ1 A;  5E8G A;  1T2K A;  5LEK A;  3SZT A;  1F5T A;  1K78 A;  1D8J A;  4EGY A;  2QYO A;  1Z6T A;  4FX0 A;  5DDG A;  3LA7 A;  3MAJ A;  2FU4 A;  2XHK A;  2F5F A;  4B09 A;  5K5R A;  2CW0 F;  4A0X A;  3KP7 A;  1IRG A;  2FEZ A;  2GIV A;  1FX7 A;  3ELK A;  1LDD A;  4ZYE A;  4HV5 A;  3G3Z A;  3C3W A;  2ZBK A;  1IUY A;  3K0L A;  5CVR A;  1FP2 A;  2QQ9 A;  2QQB A;  2MA3 A;  3KP6 A;  3JTH A;  1Z91 A;  1R58 A;  1R1T A;  3OV8 A;  4LK1 F;  2WV0 A;  3WGH A;  3LAJ A;  3ZMS A;  3SXY A;  1T39 A;  2K02 A;  3HRS A;  1Z05 A;  2YX4 A;  4UHT A;  3K2Z A;  1DUX C;  5JR3 A;  1FBS A;  4U88 A;  2UXN A;  3B73 A;  3HTU A;  3E3V A;  4BXU A;  1U5T B;  1IXS B;  3RIR A;  3U2R A;  2MBF A;  1G3W A;  3VFZ A;  1YS6 A;  1YG2 A;  4CDG A;  4ETS A;  2O0Y A;  2JPC A;  5DCF A;  1FYL A;  1O3R A;  3DXJ F;  2CGP A;  1S7O A;  3CJN A;  4F7Z A;  1OPC A;  3H3Z A;  4GO1 A;  2EA2 A;  4HLX A;  2L01 A;  5CVJ A;  2VT2 A;  2EWN A;  1QGP A;  3F72 A;  4U0Y A;  2RGV A;  3LWF A;  1H0M A;  4MEX F;  3T8T A;  1ZG3 A;  1KQ0 A;  2NS0 A;  4L9T A;  4PGH A;  4AD9 A;  4OMY A;  2XGX A;  2FXA A;  1LEA A;  1SMY F;  1P4A A;  4ON0 A;  2P6S A;  4IHS A;  1KU2 A;  3R6S A;  2XAS A;  5E17 F;  3I53 A;  3M7G A;  2IA0 A;  1XN7 A;  3KLO A;  4IHT A;  1SMT A;  2ZKZ A;  4A5M A;  2ELH A;  1O7L A;  1FLI A;  3F8C A;  2PG4 A;  1JGS A;  1T98 A;  3S2W A;  4G7O F;  1WKM A;  4JBA A;  1FPQ A;  2X4H A;  3BWG A;  2BGC A;  5DCM B;  2IRF G;  2D1V A;  4I09 A;  4ENK A;  2W25 A;  2A6H F;  1LB2 A;  5D5X B;  2HEO A;  4A2U A;  4DNC A;  1QQI A;  1WI9 A;  1LJ9 A;  5ICC A;  1U2W A;  4RB0 A;  3E5Q A;  2FSW A;  1B4A A;  1SD7 A;  4ZH4 F;  3RDI A;  3SQN A;  1IXC A;  2H6B A;  3K1P A;  2W84 A;  3DP7 A;  4K2E A;  4YFK F;  2XV4 S;  2IA2 A;  3QAH A;  1RUO A;  1BM9 A;  1R5H A;  1XD7 A;  4M6X A;  1J59 A;  2K7L A;  3KP2 A;  3WE3 A;  1K6O A;  3E6D A;  2HWV A;  5D5W B;  1IXR C;  5DCM A;  2D45 A;  2QBY B;  1XMA A;  4G7Z F;  3GWZ A;  3LA2 A;  4HAM A;  4LGW A;  2K4B A;  1JHH A;  4KUM A;  3T0Y A;  3FMS A;  4RAY A;  3JW4 A;  2OU2 A;  2R7F A;  1T6S A;  3N4M A;  4G6Q A;  2DK5 A;  4LG0 B;  3BY6 A;  2Y75 A;  1ZGJ A;  2VOO A;  6PAX A;  3CUQ B;  2OQG A;  4HOB A;  5D4S A;  2EV6 A;  4N0B A;  2HQN A;  3E6B A;  3WTS C;  1ZHF A;  1J9I A;  4MHG A;  4OIO F;  2CG4 A;  3ZPL A;  2VC1 A;  3F8M A;  3E6C C;  3F21 A;  2PLY A;  1SAX A;  4MGR A;  2G9W A;  1J2X A;  4QWQ A;  1MJA A;  2FQ3 A;  4NHJ A;  3I64 A;  1D8K A;  3NRV A;  1HXD A;  2DK8 A;  4RB2 C;  5BPD A;  3D0S A;  4Y13 A;  3D5L A;  5HDN A;  3QPT A;  3CUQ A;  3GZ6 A;  1ONV A;  3FMR A;  4M9X A;  4LB5 A;  2BEO A;  3E5X A;  2E7W A;  3HRM A;  2P5V A;  1S29 A;  1Z9C A;  4A5N A;  1G6N A;  2A69 F;  1UFM A;  3MEX A;  3RTR A;  4A0Y A;  4O3M A;  4I7H A;  5ILV A;  5E1X A;  4CHU A;  4I0A A;  1W7P B;  3I59 B;  1QPM A;  5ICE A;  1KU9 A;  3CO6 C;  3KEQ A;  2UXX A;  1SFE A;  4MTD A;  5HDG A;  5JI6 A;  1SD6 A;  1IZ1 A;  3Q9V A;  5J8C A;  3GFI A;  3GLX A;  5AIP A;  4R8H A;  3SFZ A;  1U5T C;  3GFJ A;  4E70 A;  3RPU A;  1E2X A;  5FGM A;  3R0A A;  2DLL A;  2CFX A;  4EJO A;  2DW4 A;  2QM3 A;  2PMU A;  3U9G A;  2A61 A;  3EYY A;  1HQC A;  4L0Y B;  3F8F A;  2HYG D;  4PZJ A;  2DI3 A;  2NNN A;  3PFI A;  1UCR A;  5L3F A;  3C7J A;  1B59 A;  2L4M A;  1R5G A;  3I59 A;  1FNN A;  4ENM A;  3V7S A;  1MGT A;  1IN8 A;  2PEX A;  3ZP5 A;  1YW9 A;  1ZLK A;  1OMI A;  3J81 K;  4KMF A;  1LEB A;  2HTJ A;  4KN4 X;  5LRS A;  1TQM A;  3BJA A;  1T0F A;  4HYE A;  2OZU A;  5IT9 Z;  5LBQ A;  4B8X A;  3J80 K;  1BOA A;  5H20 A;  4NQW A;  3F22 A;  2E1C A;  1B9M A;  1MD0 A;  3HOT A;  5HOO A;  1MJ9 A;  2VBW A;  2NRA C;  3WU0 A;  4U0V A;  1W7P D;  4WXH A;  5D5V B;  4S05 A;  1W5T A;  4HZF A;  2KKO A;  3F6V A;  3I5U A;  2NYX A;  3FHZ A;  2Q2E A;  4AWX B;  2VOP A;  1YQA A;  3DEU A;  2L4A A;  2RQP A;  1V3F A;  4L0Z B;  3GFM A;  3E5U A;  2FBH A;  2QVO A;  1WSU A;  2JPB A;  3FXU A;  3TO6 A;  1XCV A;  2RVC A;  5ILU A;  3MWM A;  4XSX F;  1YW7 A;  1J5Y A;  2EFQ A;  2P6T A;  5JHU A;  2HOE A;  3I54 A;  3LAP A;  5HLG A;  1OR7 A;  5HLH A;  3CDH A;  3SZP A;  2DU9 A;  3LQQ A;  1I27 A;  2KRF A;  5L3G A;  4LLN A;  4WXC A;  2D1H A;  1R1V A;  5F1R A;  1KGS A;  3RKX A;  2EFN A;  2A3S A;  1JXS A;  4WXD A;  4MQ9 F;  1IN5 A;  2YSR A;  3ISP A;  2GAU A;  1G3Y A;  4CGZ A;  3ZN0 A;  3M1E A;  4BAY A;  4Y17 A;  3TO9 A;  2HQR A;  4HW0 A;  2MH9 A;  4GXO A;  1YYV A;  4L9V A;  4CIC A;  2RDP A;  2XAJ A;  2V1X A;  1ZG5 A;  2QLZ A;  2HGC A;  3T5X A;  1HW5 A;  1F4K A;  1UB9 A;  4ASN A;  5AON A;  1ZLJ A;  2F2E A;  4IRI A;  1XGM A;  3L7W A;  2FF4 A;  2XAF A;  1FWZ A;  1XSX A;  1ZG1 A;  1PUE E;  4CXF A;  2FNP A;  3KP5 A;  2XAG A;  2XKO A;  3RPQ A;  3JAM K;  1U8R A;  2UWM A;  5L3E A;  5K1Y A;  2HYF A;  2CO5 A;  2MH2 A;  4KIF A;  1XCB A;  3H92 A;  2BE5 F;  1CGP A;  1ON1 A;  1I6X A;  2KIF A;  3DFG A;  4HX8 A;  1XB4 A;  5LEJ A;  1P92 A;  3EQL F;  3IHU A;  4P9F A;  2ISZ A;  2ZNZ A;  2B0L A;  2H27 A;  1TBX A;  4R79 A;  2Z3Y A;  4I0B A;  2ESH A;  2FRH A;  3V7C A;  4LD5 A;  5E18 F;  1DPR A;  4TV7 A;  5J8F A;  2H09 A;  1DPU A;  4ENN A;  2ZNY A;  3NEU A;  1TW3 A;  1L3L A;  4PGG A;  2A6E F;  3J7A O;  4RGS A;  1AWC A;  5LHH A;  1HKS A;  3WTX C;  2BBY A;  3WGI A;  2JSC A;  3P9I A;  4ESF A;  2GA2 A;  1XGO A;  3TDU C;  4U0W A;  3HOS A;  3HYI A;  5L3C A;  4ZZD A;  5E8I A;  1SD5 A;  1AOY A;  1NHA A;  1YO5 C;  3KZY A;  4QLC U;  2NAZ A;  4EJT A;  3MQ0 A;  4PCQ A;  3E97 A;  2P8T A;  3K1M A;  3GYH X;  1FSE A;  1QZZ A;  3IL2 A;  5HS7 A;  3PQJ A;  3WTU C;  1STZ A;  5EEH A;  1UHM A;  1IN7 A;  1L0O C;  2PBI A;  4GYG A;  1ZAR A;  3IKT A;  2IA1 A;  3I71 A;  4HV6 A;  1X3U A;  2E1N A;  2XAQ A;  1FSH A;  2RKH A;  5KK1 A;  3GO5 A;  3R4K A;  3IWF A;  4XRF A;  5IT3 A;  2LDU A;  3DPL C;  2Q0O A;  1PP7 U;  1KA8 A;  3K69 A;  1OYI A;  1RUN A;  3KET A;  3MCZ A;  2G7U A;  4P55 A;  5TRD A;  2PN6 A;  1RIO H;  4LJZ F;  2F5E A;  2K27 A;  1ZN2 A;  3MFK A;  1UST A;  3MZH A;  1USS A;  5DV5 A;  1MDM B;  1LVA A;  2M30 A;  3KE2 A;  3M8F A;  3ZMT A;  2DTR A;  5BMZ A;  1EV7 A;  3T8R A;  1ODD A;  1DDN A;  4LMY A;  2CYY A;  1GXQ A;  3Q9S A;  4A6E A;  1R22 A;  2MLK A;  1R23 A;  3GVA A;  2CSO A;  3WE2 A;  1GXP A;  4CYD A;  2AXL A;  3BDD A;  1EH7 A;  3GW2 A;  3FZV A;  2Z33 A;  1FOK A;  2XRO A;  3KP3 A;  3CTA A;  4OU0 A;  2IJL A;  4HF0 A;  5CYV A;  1MDM A;  3JSP A;  1J75 A;  5FFX A;  3QPH A;  2GQQ A;  2EV5 A;  2GXB A;  2JRT A;  2ZO4 A;  3F23 A;  1B9N A;  3HSE A;  4EMS A;  4R1H A;  2MC3 A;  4U7D A;  2RC4 A;  1XGN A;  2MLG A;  3IKV A;  3BPX A;  3BJ6 A;  2XRN A;  1S7A A;  3BP8 A;  4P9U A;  1UHW A;  1GVJ A;  2H6C A;  2OA4 A;  5CVU A;  3H3U A;  3O6B B;  4BHP A;  4IPA A;  4N9I A;  3BOQ A;  2O61 A;  2JT1 A;  3RJP A;  4OIP F;  1R7J A;  4YIF A;  1QO0 D;  1I1G A;  5BS6 A;  3GFL A;  2DT5 A;  4RGU A;  3HSF A;  1QZY A;  3RYP A;  1QNT A;  1S6L A;  2W57 A;  3R61 A;  2HS5 A;  1TW2 A;  2ZME A;  4CZZ A;  3WG9 A;  1S3J A;  4EM0 B;  4EJU A;  3K1N A;  2VBX A;  3J81 Z;  3JTG A;  2D2W A;  4IRG A;  3CO7 C;  4P5O A;  4IF4 A;  1PP8 F;  2GWR A;  4L9N A;  3NQO A;  1BI3 A;  3QU6 A;  3GUD A;  4MEY F;  3J80 Z;  2ETH A;  4WK8 F;  1G4D A;  4GGG A;  4RAZ A;  5HLI A;  2XVC A;  5K5Q A;  1K7A A;  4MTE A;  2EFO A;  3O2P E;  1W4M A;  3ECH A;  3E6M A;  2LSO A;  4I2O A;  2GA1 A;  1MZB A;  2DAO A;  1KU3 A;  5LGU A;  1WWX A;  1QBJ A;  5CJ9 A;  1I1S A;  2OZ6 A;  3R60 A;  1MJB A;  3WTZ A;  5A2Q K;  2P7V B;  3WGG A;  4UVB A;  1RNL A;  5AIQ A;  3GEZ A;  1B6A A;  4BH9 A;  2XUB A;  4EM1 A;  3R0J A;  1G3T A;  2G7H A;  1WRJ A;  5DUK A;  5DYM A;  2W24 A;  1CF7 A;  1EH8 A;  4KN7 X;  3IC7 A;  3TKY A;  2F5D A;  5CVV A;  1VTN C;  2FA5 A;  3ZQ7 A;  3ABU A;  4M6Y A;  4HDU A;  2AS5 F;  2XAH A;  2ZXJ A;  2PJP A;  1KQ8 A;  1XDS A;  1TTY A;  4KA4 A;  2PI0 A;  2PFB A;  4UV8 A;  4HLY A;  5KVR A;  3DF8 A;  4KDP A;  3CUO A;  3M8E A;  3VOD A;  5FB2 A;  3B02 A;  3FF5 A;  3ZMD A;  5EEG A;  1Z6R A;  3LST A;  2MD5 A;  1YFH A;  1XSD A;  5CVI A;  5ICG A;  2GXG A;  3F8N A;  4I02 A;  2STT A;  1B1B A;  3FWE A;  1BI0 A;  1U6G A;  4CO8 A;  1LDK B;  3HHG A;  4L5I A;  4OMZ A;  4M9S A;  2M8E A;  2HDC A;  4OIR F;  4Q48 A;  3V4G A;  3G73 A;  5BPI A;  1FBU A;  5HS9 A;  2FML A;  1Q1H A;  2K4J A;  1W5S A;  3ECO A;  4Q47 A;  4JQF A;  4BHC A;  5D6F A;  2V6C A;  4M73 A;  4BNC A;  2EFP A;  5L3D A;  1FBQ A;  5LGT A;  2FMY A;  3JAM Z;  2EFW A;  4PDK A;  5DUI A;  1A04 A;  2M45 A;  2TDX A;  4HX7 A;  2EK5 A;  4IJA A;  1BC7 C;  1HKQ A;  1ZRE A;  5CLS A;  5J6X A;  5LRR A;  3CUQ C;  2DPD A;  3KEO A;  2V79 A;  5K5O A;  4EGZ A;  1FC3 A;  2QUF A;  3REO A;  1ZRC A;  4OIN F;  2DQR A;  1TNT A;  4AIJ A;  5FD6 A;  1FZP B;  1ZRD A;  1RZ4 A;  2YPR A;  2K86 A;  3FXR A;  4XBF A;  3WTW C;  1FT9 A;  1ON2 A;  1HBX G;  1O3Q A;  1SFU A;  3I58 A;  1HKT A;  2DFI A;  4YII A;  4Q5S F;  1D5V A;  2HFH A;  3AAF A;  3WTY C;  4MNU A;  3TOB A;  1H9G A;  1J0R A;  5DD4 A;  3M9A A;  5F64 A;  1BJA A;  5LGN A;  2C6Y A;  1PDN C;  4YFX F;  4MQV A;  5FLX K;  2VC0 A;  2RV8 A;  1HSJ A;  2IPQ X;  4OIQ F;  1DP7 P;  2KIU A;  2CQK A;  2A07 F;  4Y15 A;  2P5K A;  2VT3 A;  4NB5 A;  3FM3 A;  3ZMV A;  2COM A;  4O5V A;  1BIB A;  2A5Y B;  3W6K B;  3TQN A;  4EVI A;  3MZY A;  3K9T A;  1BN5 A;  2VE9 A;  4A0Z A;  2Z9O A;  3QP6 A;  2Z99 A;  2Q8K A;  3ABT A;  1S8N A;  1FYM A;  2A68 F;  4UXN A;  2O8X A;  3EUH A;  5DEQ A;  1R36 A;  3KFW X;  5LHG A;  3WOD F;  1ZRF A;  4RGX A;  3QU3 A;  4LB6 B;  4WWC A;  4G6D A;  5BOX A;  3ERE D;  2OBP A;  1REP C;  1O57 A;  4JK1 X;  1XGS A;  4GYI A;  1Y0U A;  3RKW A;  4LFU A;  2ZFW A;  2WC2 A;  2E7X A;  2VBZ A;  2DBB A;  2R3S A;  1F9N A;  3KP4 A;  2QEN A;  3FXQ A;  4UVC A;  4BQA A;  4FT8 A;  1WQ2 A;  3RYR A;  2DO7 A;  5FFZ A;  3WTT C;  4HA8 A;  2QQA A;  3CLO A;  5E1W A;  1YTY A;  3N97 A;  4YFN F;  1JE8 A;  1U5T A;  4GCV A;  1JHF A;  3T1B A;  4RB3 C;  3GX4 X;  4M71 A;  1GHC A;  2ADU A;  3L09 A;  2H94 A;  3HSR A;  3EDP A;  4IRH A;  2O3F A;  2BYV E;  5D6E A;  4KT5 C;  1ZAO A;  3FMQ A;  4EJV A;  5D8K B;  3V8J A;  4HQE A;  3F3X A;  5FD5 A;  4I01 A;  1FP1 D;  1R1U A;  2EJR A;  3O3K A;  1SD4 A;  1F1Z A;  4Q4Z F;  1YLF A;  3L00 A;  1LDJ A;  1IF1 A;  3SHF A;  4WX9 A;  2IT0 A;  2DQL A;  4U7B A;  1J7K A;  2P5L C;  4HX4 A;  2YR2 A;  1P2F A;  3PQK A;  4UVA A;  2M87 A;  3FM5 A;  4EM2 A;  3EET A;  1TQP A;  3P7N A;  3L2C A;  4EV0 A;  3QRF F;  1T38 A;  1D3Y A;  5E1Z B;  4KNY A;  1IW7 F;  4H0E A;  4IXA A;  2UZK A;  1ZH5 A;  2R7D A;  3DQV C;  2Y48 A;  3IRQ A;  4G7H F;  2JTV A;  1LNW A;  2J5P A;  4WF2 A;  1HW1 A;  2FNA A;  5ERI A;  1KQ9 A;  2ZCW A;  1IN6 A;  3HHH A;  1O3S A;  4FX4 A;  2P4W A;  3JSO A;  2KIM A;  5D8L B;  2P7C B;  1ULY A;  5H6R A;  2PMH A;  1U3E M;  3COA C;  3P9K A;  4N9H A;  2FE3 A;  4Z2Y A;  1OKR A;  2Y0M A;  1K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...