4A5MA

Redox regulator hypr in its oxidized form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
CPVEFTLDVIGGKWKGILFYHMIDGKKRFNEFRRICPSITQRMLTLQLRELEADGIVHREVYHQVPPKVEYSLTEFGRTLEPIVLQMKEWGESNRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Redox-Switch Mechanism of the Marr/Duf24-Type Regulator Hypr
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL REGULATOR YYBR
total genus 27
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a5mA00
2VXZA 2GA2A 2P6SA 3TO9A 2CG4A 1T39A 3JSOA 3LSTA 4I98B 2RGVA 3LA7A 2RNJA 1HSJA 2DQLA 3IC7A 3G3ZA 5HS8A 3V4GA 3U9GA 3H3UA 3I64A 4M9ZA 2STWA 4OOIA 1R1VA 3H92A 1SD4A 1BOAA 3MWMA 1FSHA 4HW0A 1FOKA 4OMZA 1TLHB 4RAYA 5BPIA 1B6AA 2D45A 3FWEA 3DFGA 3U1DA 3M7GA 3COAC 5AIQA 1IXRC 1XDUA 4GCVA 1QQIA 2X0LA 2Y0MA 5HLHA 3B73A 1K79A 2EV6A 1FLIA 4A6DA 3HYIA 4QWQA 5ICFA 1HW2A 3BP8A 2FU4A 1O57A 3CTAA 5D8LB 4AWXB 3HRTA 2HDCA 3BJAA 1YG2A 2RVCA 4BQAA 2XKPA 4I09A 4YFXF 2DPUA 3K1MA 2QYOA 5LGNA 1XDSA 3BOQA 4RGRA 1MDMB 1BI3A 5LGTA 4OIOF 3M9AA 1Z9CA 2DLLA 4RGSA 5J6XA 2EA2A 3K0LA 2BGCA 3RI4A 2O6GE 3GUDA 2JT1A 3DKWA 4ON0A 3J80Z 2KKOA 3BROA 2LF8A 4RGUA 2GQQA 5E17F 3FMRA 2GAUA 1XCBA 5CYVA 1BIAA 2FNAA 2M8EA 3CDHA 1J5YA 5HS9A 3GWZA 2EA4A 4XLNF 2K7LA 2R7DA 2ISZA 1FYKA 1I1SA 3CO6C 4P9FA 3K2ZA 3V8KA 5K5OA 3PQJA 4XRFA 4L9VA 1WRJA 4LK0F 3N4MA 1IN4A 2ZCWA 2PI0A 6PAXA 1L3LA 1HQCA 1R1TA 1O7LA 4AIKA 2ADUA 4EVIA 1V4RA 2FXAA 2EK5A 3EDPA 4EJVA 2FNPA 4HX8A 4HA8A 4EGYA 2ZXJA 1D3YA 2ZMEB 1ONVA 1GXPA 4PGGA 2ESNA 4HDVA 3BJ6A 2EFOA 4L0ZB 2EFWA 5LLQA 1LEBA 3F8BA 2DU9A 4BAYA 2XAFA 1YS7A 1HW5A 2H27A 3EYYA 1MGTA 4H0EA 1E2XA 3AAFA 1QO0D 2KJBA 5L3FA 2W85A 3ZMDA 1D8KA 2XAGA 4KDPA 4Q48A 1T2KA 4R79A 1BI2A 4N0BA 2A07F 3KCCA 1CF7A 4RS8A 3C3WA 3R0JA 3V7RA 2E1NA 1FBUA 2NYXA 5J8FA 3HRMA 5E8GA 3JSPA 4NHJA 1R5HA 5TRDA 2P7CB 3CO7C 2F2EA 2YX4A 3TDUC 1OPCA 1KQ0A 4G6DA 1RUOA 2VE8A 1QZYA 3ZP5A 2XASA 3ABTA 1DPUA 3ROUA 1D5VA 3TDZC 2F5FA 2K4BA 2IVMA 2L54A 4PGHA 1LJ9A 2R7FA 2ESHA 5BOXA 2BE5F 3I0TA 3ZMZA 4MNUA 2XHKA 2DPDA 5FGMA 4YFKF 1XGSA 2Q8KA 2W84A 1J0RA 3ECHA 1MJBA 3TOBA 4KA4A 3HOTA 5FFXA 5DDGA 4IHSA 3J7AO 4IVNA 3IWZA 3VOEA 2CW0F 4RGXA 1R00A 3E6MA 1TQMA 3SZTA 1SMTA 1BBYA 2O3FA 2P7VB 1W7PA 2HYGD 2P8TA 3GLXA 5ERIA 4EM2A 2A3SA 4A0YA 1U5TC 1T98A 1XSVA 2V9VA 3C1DA 1ZRDA 2LF7A 2K02A 1YTYA 4GO1A 3F72A 2LKPA 5H6RA 2HKOA 1B4AA 3KP6A 1TW3A 2HKXA 1KGSA 4EJOA 4RB1A 1U8RA 2H09A 4BHBA 2EFPA 3ZN1A 4I01A 2UWMA 2GA1A 2NNNA 4G7ZF 3IHUA 3GXOA 2EB7A 3P9IA 5EEHA 4WK8F 4R8HA 2FMLA 4O3MA 4CO8A 2M1BA 2JTVA 4RB2C 3ZMTA 1Q1HA 1B9MA 2XAHA 3WGIA 4KT5C 1P6RA 3DPLC 1PDNC 1DP7P 3QPHA 5HLGA 1HKSA 2FQ3A 2BEOA 3BDDA 2FA5A 4JQFA 1TBXA 3CUQA 1QZZA 2HR3A 3JW4A 4N9HA 3K69A 2BV6A 1CGPA 4HAMA 4YIFA 2L02A 2XGXA 4HX7A 2MA3A 1JHHA 1WI9A 3GFLA 4Q47A 1SFUA 5BQTA 3KP5A 2STTA 1LDDA 2DQRA 1MJ9A 5AONA 3TKYA 3MZYA 2AXLA 4I0BA 3JTGA 1G6NA 1OYWA 1KA8A 1IW7F 5HOOA 3FXUA 3RPUA 5DV5A 3KP7A 1W5TA 3JAMZ 5LHHA 1FYMA 3F8MA 1G3WA 2A6HF 1TW2A 2IRFG 3TGNA 3P9KA 1KU3A 3TO7A 2CYYA 2XUBA 5D5WB 1I5ZA 5LBQA 4OU0A 3FXQA 2R3SA 3B02A 3F8CA 3WGGA 3RDIA 1YW9A 3F22A 2EFNA 3BZ6A 1JE8A 1K78B 1KQ9A 3F3XA 5ILSA 1YLFA 4CXFA 3J80K 3R6SA 3P9CA 2VE9A 1I1GA 2L3DA 3GYHX 3K1PA 2Q0OA 4HF1A 5F6FA 1FT9A 5LHIA 5D5XB 2COMA 2O03A 4A5NA 4ENJA 4UHTA 4HV6A 1XB4A 4LK1F 1FYLA 1OR7A 2LSOA 1V3FA 3R4KA 2G9WA 3I53A 4UVAA 3CJNA 2LNBA 1QNTA 2XIGA 2CQKA 3FX3A 5LRRA 4U0YA 2RC4A 3M8FA 3DV8A 2V1UA 5DCMB 4HLYA 2OZ6A 3OV8A 4M72A 5BPDA 3ZMSA 1YO5C 3VEPA 4WXHA 1DUXC 5E1WA 3WGHA 3DQVC 2M87A 1TNSA 3BY6A 3T8TA 2HZTA 2QM3A 2P6TA 4JK1X 4B8XA 3FF5A 1J7KA 3D0SA 1A04A 1YW7A 2FMYA 4L9JA 1W7PB 1XD7A 1L0OC 4XSXF 5HVQC 2VBYA 3KLNA 4BYYA 3SZPA 1R36A 4LLLA 1B1BA 3DEUA 2M45A 3KP3A 5E18F 2XAQA 4E70A 4ZYHA 1QBJA 2UXXA 1KU9A 5D4RA 4G94A 2P5VA 2K27A 3BPXA 1SD6A 3KP4A 1R5GA 1USTA 2D1VA 5JI6A 1HKTA 4GYGA 2QZ8A 4EJTA 3KEOA 4IJAA 5L3CA 3MAJA 4L18B 2PQ8A 3Q9VA 4EJUA 3GX4X 3LFKA 4OIQF 1P4WA 2FBHA 3MEXA 2VOPA 1G3SA 4BH9A 2A6EF 1S7AA 3HHGA 2QLZA 2YX7A 1HW1A 5D6EA 4NB5A 3IKTA 3HTSB 1FSEA 4AVPA 2BBYA 3MFKA 1U5TA 3RPQA 2GXBA 2OA4A 1LEAA 5A2QZ 4U0WA 1TQPA 2XV4S 3CUQB 3QOPA 4R1HA 1FP2A 5FD6A 1YIOA 2FF4A 3K9TA 3ULQB 1FPQA 3VFZA 3JTHA 1P92A 5HS7A 4Q4ZF 1RI7A 1LDKB 4MHGA 2PG4A 3F6VA 4IF4A 1PUEE 3E6DA 5H6QA 1RNLA 4BHPA 2H6BA 3LA3A 4ETSA 3SXYA 2CFXA 1S29A 2D2WA 3L00A 1GVJA 4IRIA 3WU1B 3NQOA 2BYVE 3KFWX 1J9IA 5DCMA 1W5SA 4Z2YA 2HQNA 4L9NA 3MCZA 3EYIA 3RYPA 3GF2A 4N9IA 2J5OA 4P55A 3F6OA 3ISPA 4K2EA 2Y48A 4MEYF 5CLSA 3T8RA 1HXDA 4LB5A 1WSUA 3WODF 4LD5A 3I58A 1IF1A 3KZYA 2V79A 4B09A 4ESJA 2FOKA 3WTZA 2IA1A 2VONA 3WTSC 3LQRA 4HF0A 4G7OF 2H94A 1FY7A 4U7DA 4FHTA 1O3TA 3FXRA 3R60A 4KUMA 3E6BA 2JPCA 5EEGA 4LGWA 1IRGA 2OQRA 1BN5A 2FEZA 2MD5A 1Z91A 3J81K 2HEOA 1ZGAA 1ZHFA 2MC3A 1YS6A 1OYIA 4IRGA 4ENKA 1CF7B 5LEKA 1ZH5A 5DD8A 3E5XA 1BC8C 4RB0A 1K78A 1H9GA 3WTUC 2P4WA 3G73A 4UUVA 3N97A 1G3YA 5BS6A 3IKVA 3ABUA 4OINF 2FBIA 3ZMUA 2RKHA 1H9TA 4M71A 3HHHA 4QLCU 2Q2EA 2D1HA 3HSFA 2FSWA 3R61A 3QP6A 4UVBA 3RKYA 1I6XA 1XGOA 3T1BA 2G7HA 4I7HA 2E7WA 3JAMK 2QBYA 1T0FA 3BWGA 1B59A 2HTSA 3REOA 3TQNA 4U7BA 3HSRA 4EGZA 1H0MA 1W7PD 4RAZA 1F4KA 5FLXZ 4HLXA 4LJZF 4LFUA 5F1RA 3K1NA 2NS0A 5D6FA 1ULYA 5DUKA 2ELHA 1R7JA 3GFIA 2X4HA 4ZZLA 5HDNA 4I0AA 5F64A 4A2UA 1X3UA 5K1YA 3L09A 3V7SA 4CYDA 5DCFA 3CUQC 5CVVA 1E17A 5E20A 3WG9A 4IXAA 2ACJA 3F23A 1KQ8A 1GHCA 2V1DA 1IRFA 1K6OA 2PLYA 3ZQ7A 2QVOA 3O2PE 2MLGA 2EV0A 1S6LA 2Z33A 4I2OA 3I4PA 5L3BA 4MTEA 4IPAA 3HTUA 2LDUA 2AS5F 3L2CA 2WV0A 4L5IA 2FBKA 3I71A 5JHUA 5JR3A 2QQBA 2KIMA 1LDJA 5DEQA 1YFHA 4LLGF 2ZNYA 2L4AA 1Z7UA 3BJOA 1FBQA 1AWCA 4P9UA 4A6EA 2QBYB 3IRQA 1SMYF 2GIVA 4YG2F 1IN6A 2QUFA 1IN8A 4CZZA 1LVAA 2XAJA 1WQ2A 4CICA 4WXCA 2Y75A 4HX4A 4MQ9F 1XGMA 2DK8A 5TJJA 3GVAA 3GFMA 5KVRA 4S04A 2IT0A 5HLIA 2VC1A 4KN7X 3QRFF 1J75A 4KYWA 2RV8A 4D0PA 3S2WA 2GWRA 5D5UB 1R22A 3RJPA 5IT3A 3MZHA 5JVTA 4WF2A 1HKQA 4WXDA 2GXGA 3WE2A 2VBZA 2Z5UA 1UFMA 2OZUA 2XKOA 3WTTC 3KP2A 3WU0A 1LQ1A 2HGCA 3SHFA 1G4DA 2KRFA 4CDGA 2PBIA 2IW5A 3LA2A 1RZ4A 3F8NA 5ICEA 5CVIA 1IN5A 4Y13A 2CO5A 1KYZA 3DF8A 2VBWA 2QQAA 2JZYA 5BMZA 3ZMVA 1QGPA 2WTEA 2G7UA 2NAZA 1TQIA 4KN4X 5J8CA 4F7ZA 1BC7C 1O7FA 4PCQA 3Q5FA 2K86A 4XLPF 5FD5A 1MDMA 2DK5A 4UNOA 4U0VA 4KMUX 1ZG5A 4LG0B 2ZMEA 4AD9A 1HSTA 5L3EA 5L3DA 4MQVA 3LAJA 3OOPA 5L3GA 1P2FA 2VOOA 1T6SA 1SD5A 1KU7A 3RTRA 3HUGA 2ZFWA 4ZYDA 3DP7A 1F5TA 4L5JA 2IJLA 1ZG1A 1EH7A 3WTWC 1WKMA 3FHZA 1Z1DA 2DT5A 4CHUA 1U2WA 2ZO4A 5FO5A 1IN7A 1S8NA 4HBLA 1OKRA 1REPC 4BNCA 5D4SA 2QENA 2VBXA 1R58A 4ESBA 1SAXA 1SFXA 3W6KB 5D8KB 2CSOA 2O8XA 4G6QA 2OD5A 1XN7A 3E97A 4DNCA 1PP7U 2VT3A 4M6YA 1F1ZA 2A68F 4HV5A 1D8JA 1UHMA 2IA2A 3DXJF 4KIBA 1ON2A 3ERED 2CWEA 2XRNA 2RQPA 1K7AA 4ENNA 3SQNA 3WTVC 2Z3YA 2PFBA 3VODA 3DPTA 3QAHA 1FP1D 3LAPA 4HYEA 2MH9A 2YSRA 1RIOH 2ETHA 2DI3A 4PZJA 2B0LA 4Y15A 5LGUA 1W4MA 2HQRA 4G8XA 4HQMA 2YU3A 3LQQA 2ISYA 5DYMA 5FLXK 2J5PA 1XGNA 2EFQA 4UV8A 1IUYA 4G9YA 2HYFA 1ZLKA 1USSA 4WWCA 4ENMA 2YPRA 3T5XA 1WWXA 4YIIA 1P4XA 1JGSA 3P7NA 4UV9A 3FMSA 2KJCA 5CJ9A 2NRAC 4PDKA 2O61A 1ZGJA 3KEQA 4HF2A 2IP2A 3E5UA 4FX0A 1T38A 1YQAA 1KU2A 2UZKA 2FE3A 3ZPLA 4BHCA 5E8IA 2W57A 1FC3A 2EJRA 2IPQX 2RN7A 3RKWA 4O5VA 1IXCA 3PQKA 2MLKA 1Z6RA 4LMYA 4M73A 1UHWA 5ILUA 1ODDA 2HTJA 4CGZA 2RDPA 4FX4A 3ZN0A 5E1ZB 2V1XA 2WWYA 1NHAA 5A2QK 1XCVA 4EMSA 4JBAA 2KIFA 1IAWA 2OQGA 3C18A 1XMKA 3GZ5A 3KZZA 1C0WA 2VODA 1EV7A 2JPBA 2DFIA 3WTYC 2V6CA 4MGRA 1BJAA 4Y17A 5ILVA 1IXSB 1OMIA 2A69F 1UB9A 4DQ2A 4M6XA 2F5EA 3M1EA 3WTXC 1DPRA 2O0YA 2OBPA 3V7CA 2PMUA 3SFZA 1BI0A 1ZN2A 3BPVA 3TOAA 2M5WA 3FMQA 4UXNA 2YR2A 2NNYA 1YW8A 4S05A 1PP8F 2VC0A 2K4JA 1O3SA 1SD7A 3IL2A 3HOSA 4P5OA 3T0YA 2E7XA 4EV0A 4O6JA 1P4AA 4L0YB 2JRTA 1LB2A 4LG0A 1QPMA 4KNYA 4EM1A 1Z05A 1GXQA 2P5KA 4P96A 5IT9K 3V8LA 1ZRFA 5ED4A 3QP5A 1FWZA 3KETA 3PFIA 2QQ9A 2W25A 4M9SA 1U78A 1KYWA 4AIHA 4NQWA 3C7JA 3U2RA 5HDKA 4FT8A 2IA0A 1UCRA 3R0AA 2CGPA 4A0ZA 4OIRF 2MBFA 2Z9OA 2DW4A 3I59A 3E6CC 1FZPB 1U6GA 4LLNA 2DAOA 1XMAA 3GEZA 2L4MA 1U3EM 1TTYA 2XROA 4ZH4F 3I5UA 4ESFA 3E3VA 3RIRA 2HOEA 4A0XA 4EQQA 1R1UA 5D5VB 1ZYRF 3F21A 1G3TA 3ECOA 5CVJA 3EUHA 3M8EA 3O3KA 3I59B 2XVCA 2F5DA 2MH2A 4WX9A 1BM9A 1IZ1A 4KICA 2L01A 2M30A 1Z6TA 2HFHA 1I27A 1S3JA 2PMHA 1O3RA 4KIFA 5DUIA 4MEXF 4KIGA 1ZARA 2A5YB 3NRVA 4MTDA 4EM0B 4GYIA 3EETA 2C6YA 4UVCA 4EJWA 2OAZA 5LEJA 3RKXA 3GFJA 4ASNA 2GZWA 2W24A 5LRSA 3HIFA 2UXNA 1STZA 1S7OA 2OU2A 4HDUA 1DDNA 4G7HF 4KMFA 1ZAOA 1ZG3A 1AOYA 3GW2A 3J81Z 3CLOA 4YFNF 1YYVA 1ZLJA 3I54A 2A61A 4HQEA 1XSXA 2H6CA 1FNNA 3GO5A 3Q9SA 1MKMA 3F8FA 2ZKZA 1MD0A 5K5RA 3EQLF 1R23A 3ELKA 3D5LA 4OMYA 4WCGA 2FRHA 4TV7A 2JSCA 1TNTA 1HBXG 1FX7A 2WC2A 2PEXA 2QWWA 2VT2A 5ICGA 3O6BB 1JHFA 2DTRA 3L7WA 3FZVA 1MJAA 1VTNC 3WE3A 2TDXA 3IWFA 3TO6A 4ZYEA 5LHGA 1EH8A 3QU3A 3MQ0A 4GXOA 3QPTA 3W6JB 1FBSA 1ZREA 5CVRA 4XBFA 5DD4A 5IT9Z 2ZBKA 2KIUA 4A12A 5E1XA 4XSZF 4M9XA 5H20A 1Y0UA 4GGGA 3H3ZA 2DBBA 1EH6A 1LNWA 3NEUA 1JXSA 3LWFA 4HOBA 3RYRA 3ML6A 3GZ6A 1O3QA 2VN2A 2Z99A 2ZJ2A 3IRRA 2EWNA 3HRSA 1J2XA 3VB2A 2P5LC 2HS5A 3HRUA 5ICCA 1J59A 2DO7A 4KFCA 4L9TA 2E1CA 3KE2A 5AIPA 2F5CA 3E5QA 1RUNA 5CVUA 1B9NA 4Q5SF 4IRHA 5K5QA 4U88A 2ZNZA 5KK1A 4OIPF 4AIJA 1ZRCA 4ZYGA 1SFEA 3CUOA 1ON1A 5JFRA 4IHTA 3L9FA 2PJPA 2EV5A 2HWVA 4LB6B 4M74A 5FFZA 4RB3C 3QU6A 5FB2A 4I02A 1BIBA 3FM3A 1BI1A 2PN6A 4HZFA 3FM5A 1MZBA 5HDGA 3HSEA 1F9NA 3KLOA 1XSDA 4ZZDA 4BXUA 3V8JA 4A5MA 1U5TB 1OYYA
chains in the Genus database with same CATH superfamily
5IP7J 2VXZA 1ZR2A 4IHWA 2GA2A 2P6SA 3TO9A 2OF7A 2CG4A 2YUSA 1T39A 3HOXJ 1JTXA 1P9QC 1AKHA 1U9OA 3JSOA 3CCMI 1ZGWA 3LSTA 2BY3A 3QODA 4I98B 3VSKA 2RGVA 1YIJI 3LA7A 3JREA 3VSLA 2VQHA 4JX4A 2RNJA 1HSJA 2DQLA 3IC7A 2EZKA 3G3ZA 4RM3A 5HS8A 2M4GA 3CCRI 3O8GA 3V4GA 4XRMA 3U9GA 3H3UA 3I64A 4M9ZA 2STWA 4OOIA 1R1VA 3U1KA 3H92A 2BHZA 3OYFA 1SD4A 4XRSG 3UNGC 1GV5A 1BOAA 3JRDA 4X1EA 5DM6F 3AG4H 3MWMA 1FSHA 2XPUA 4HW0A 3DLLF 1FOKA 1HA8A 5KCMA 4OMZA 1TLHB 2FD5A 1Y0NA 4RAYA 2M0MA 5BPIA 1B6AA 2CUJA 3BG6A 3CCEI 4F3QA 1B8IB 2JA2A 1F36A 4BDZA 2D45A 3FWEA 3DBHB 4IOCF 3DFGA 1TWFJ 3U1DA 2Y9ZA 4X6AJ 3M7GA 3CCJI 3CCYA 4YIRX 3COAC 5AIQA 2CV0A 2M7BA 1U9NA 3PO3J 1IXRC 1XDUA 4GCVA 1FOYA 4A93J 1QQIA 5HNFA 1FJLA 2X0LA 2Y0MA 5HLHA 3B73A 1K79A 2JVGA 3FXLA 2EV6A 1FLIA 1PVEA 4A6DA 3HYIA 4QWQA 2EZLA 1OLTA 9ANTA 2V4JC 5ICFA 4W97A 5JLXA 1HW2A 3BP8A 2FU4A 1O57A 3CTAA 5D8LB 4AWXB 1Z67A 2JUCA 4DIQA 1Y1WJ 3HRTA 2HDCA 1KONA 3BJAA 1YG2A 1LKXA 2RVCA 3ABLH 2G0EA 2NVYJ 4BQAA 2XKPA 1TL8A 5E3MA 2HOAA 4PJNA 3JRGA 4I09A 4YFXF 1FIPA 2DPUA 3K1MA 4GFBA 1MMAA 3BTLA 3MKYB 1BR4A 2EZHA 4JYKA 2QYOA 5LGNA 1MMGA 2VASA 1XDSA 3LMMA 3BOQA 4BL0B 4Y4RA 4RGRA 1MDMB 1BI3A 2JMWA 5LGTA 1K61A 1SFOJ 5FKOA 4OIOF 3M9AA 1Z9CA 3S1QJ 1ACIA 1WVRA 2DLLA 2VQCA 4MFDA 5E3OA 2GBYA 4RGSA 3ZOBA 5J6XA 2H1LA 3A2KA 2EA2A 1A36A 4UUSA 2HQ5A 2R7UA 1KZHA 3K0LA 2BGCA 3RI4A 2O6GE 3GUDA 4BJ6C 2JT1A 3FXMA 3QOEA 3DKWA 1WI3A 4ON0A 1WHUA 3J80Z 2KKOA 2KDOA 3BROA 2VJIA 2HQAA 3CDLA 2LF8A 1QA6A 4NUBA 4RGUA 2GQQA 3S1NJ 5E17F 3FMRA 3L2WA 4ZJZA 4NC7A 2GAUA 1XCBA 3KYDB 1BIAA 5CYVA 4RMNA 2FNAA 2M8EA 3K4MA 4MFEA 2KDZA 3CDHA 1J5YA 4NDLA 1MMSA 5HS9A 3GWZA 4C2UA 2EA4A 1BW5A 1GLNA 4XLNF 2K7LA 1TP4A 2X6OA 2W1OA 2R7DA 5J4YA 4F91B 2ISZA 1FYKA 2CW8A 1SVLA 5BNGA 1I1SA 2EZIA 3GTLJ 3CO6C 1BR2A 4P9FA 3K2ZA 3V8KA 5M5XJ 5K5OA 3PQJA 1U0JA 4XRFA 4L9VA 3H9GA 1S72I 3ABKH 1ERDA 1WRJA 4LK0F 3KYCB 3N4MA 1BL0A 3S8PA 1IN4A 2KQRA 2ZCWA 5CQGA 1N78A 4UUTA 2VPRA 3HPHA 1A5JA 2UV1A 2PI0A 6PAXA 1L3LA 1HQCA 1P7JA 3G2BA 1R1TA 1O7LA 4AIKA 3IP4B 2ADUA 2K9MA 3D5SC 1PJRA 4EVIA 1V4RA 2FXAA 2M3AA 3FXOA 2R5ZB 2EK5A 1VQ9I 4A3LJ 2LD5A 3EDPA 4EJVA 2FNPA 1QPIA 4HX8A 1ETKA 4HA8A 4EGYA 2ZXJA 3QYFA 1LFBA 2ZMEB 1D3YA 1ONVA 1GXPA 3PL8A 4PGGA 3GCMA 2ESNA 4LG3A 4HDVA 3BJ6A 4CZCA 3M07A 5EF6A 4XK4A 2JQ7A 2EFOA 3OY9A 2W7NA 1GV2A 4L0ZB 3MKZA 3DU5A 2JRMA 3SYTA 2EFWA 2I8DA 5LLQA 1LEBA 3F8BA 2DU9A 4BAYA 2R7XA 2XAFA 1YS7A 1DGRM 1YHQI 4YRVA 1HW5A 2KFDA 2WB1N 1W1WE 4CYCA 3DCFA 2H27A 1ETQA 3EYYA 2LH9A 3LSHA 1MGTA 4H0EA 1E2XA 3AAFA 1QO0D 2KJBA 5L3FA 5KNLA 2W85A 5HLTA 2HPIA 4N4NB 3ZMDA 2ZXIA 2LC2A 4AYBA 3G1LA 4BE0A 1D8KA 2XAGA 4E7HA 3G1MA 3AG3H 4C9YA 4KDPA 2DT7B 4Q48A 3OL3A 1U8BA 2GXAA 3JRIA 1T2KA 4R79A 1BI2A 4N0BA 2A07F 3KCCA 1CF7A 2BW3B 2Y0SN 2TRTA 4RS8A 3C3WA 3R0JA 3BR5A 3V7RA 2VKVA 2E1NA 1FBUA 3H36A 1A31A 2NYXA 5J8FA 4BQNA 1MNMC 1X2MA 2LBFA 2QKLB 3HRMA 5E8GA 2QF7A 3LSMA 3ZQQA 4BS9A 3ASNH 2KISA 5CKTA 3JSPA 2R7VA 2VJJA 4NHJA 3EUAA 3JRBA 2DA1A 4EEFG 2JA5J 2JSPA 2BW3A 1R5HA 5TRDA 2P7CB 3OYAA 4CCNA 1OCRH 3CO7C 2F2EA 2YX4A 4XLEA 2CH0A 1XC5A 3TDUC 3I56I 1OPCA 2Y30A 1KQ0A 4G6DA 4BEHA 1RUOA 2VE8A 1QZYA 3ZP5A 2XASA 3ABTA 1DPUA 3K7AJ 4L5EA 1X1BA 3ROUA 1D5VA 1HDPA 3TDZC 2WA0A 2F5FA 2ECCA 4BUPA 1Y6IA 2K4BA 2FOWA 1K4TA 2A6TA 1UZCA 2IVMA 2L54A 3GTGJ 2LTPA 2XAUA 2BXZA 4PGHA 1LJ9A 2R7FA 2ESHA 5BOXA 2DMTA 2MC4A 5GTIC 2BE5F 2L7KA 3I0TA 4HSRA 3ZMZA 4MNUA 1V54H 3ZQLA 4XRSA 2XHKA 1JKQC 3JR9A 2DPDA 5FGMA 4YFKF 1XGSA 2Q8KA 2W84A 4CCMA 2K9LA 1J0RA 3ECHA 1MJBA 3QYEA 3TOBA 4KA4A 3HOTA 4IX7A 5HNHA 1SEUA 5FFXA 5DDGA 5J1RA 4IHSA 3J7AO 4IVNA 3OYBA 3IWZA 3VOEA 1FTTA 3GTMJ 2CW0F 4RGXA 4CUGA 1R00A 5HODA 3E6MA 1TQMA 2IS4A 4GDFA 1PYVA 3SZTA 4HPQA 5DTDA 1SMTA 1BBYA 2O3FA 2P7VB 2PJRA 2KL4A 4J00A 1W7PA 2HYGD 2P8TA 3GLXA 5ERIA 4EM2A 2A3SA 4A0YA 1U5TC 3OSGA 1T98A 3PIPF 1XSVA 2DDBA 2HDDA 2V9VA 3C1DA 2LF7A 1ZRDA 2K02A 1YTYA 2OV7A 2R5YA 4GO1A 3F72A 3HZJA 4UB6C 2X85A 2LKPA 1HF0A 2AQEA 5H6RA 1BJZA 4B43A 2HKOA 1B4AA 3KP6A 1TW3A 1MH4A 4RA2A 5FKKA 2OTJI 2HKXA 1KGSA 2GM4A 4E7LA 4EJOA 1VNDA 3CMYA 1I39A 4RB1A 1Y56A 2H09A 1U8RA 4BHBA 1LFUP 2ZSIB 2HXIA 2EFPA 1X1CA 3ZN1A 4I01A 3LSJA 3VYTB 3K70C 2UWMA 2GA1A 2NNNA 4XORA 4G7ZF 3IHUA 3BTJA 1IRXA 3GXOA 1Z3YA 3BLYA 1IC8A 2EB7A 3P9IA 5EEHA 4WK8F 2AXTC 4R8HA 3A02A 1O4XA 1I3QJ 2FMLA 4O3MA 4CO8A 2M1BA 1MBEA 4BJTA 2JTVA 4B44A 1NK2P 2JA6J 2HNHA 4RB2C 3ZMTA 1Q1HA 1B9MA 2OPTA 2XAHA 4B1RA 3WGIA 2WAQN 4HRIA 1POGA 2DJNA 1ZK8A 4HSTA 1P6RA 4KT5C 5K7FA 3DPLC 2PMZN 1PDNC 1DP7P 3W2VA 1V55H 3PSFA 4D9JA 2LFBA 1QRYA 2E71A 2V26A 1LFPA 3FKIJ 2W82A 3QPHA 5KAIC 4A3JJ 5HLGA 5TGTA 1HKSA 1YE9A 2FQ3A 2BEOA 3SEZA 3BDDA 3TEDA 2FA5A 4HEA2 2KHMA 4JQFA 1TBXA 2ICWG 3OYIA 2WAEA 3CUQA 1FTZA 2E5ZA 4ZC3A 1QZZA 2HR3A 2BHYA 3JW4A 1VQ4I 4N9HA 3K69A 2BV6A 2HYJA 3K4CA 1CGPA 4HAMA 1CQTA 1AA7A 4YIFA 2XB5A 1S9HA 3PSIA 2L02A 2XGXA 1MH3A 4HX7A 2MA3A 1JHHA 1IDZA 3PFYA 2L0KA 1WI9A 1WCMJ 3GFLA 4Q47A 1SFUA 3TW7A 3LOCA 5BQTA 3KP5A 4GRIA 2L7FP 1T8IA 2STTA 4CCOA 2YU9J 4ZDOA 4XR6A 1LDDA 3W2AA 2DQRA 1MJ9A 5AONA 3TKYA 3MZYA 2AXLA 1LE8B 4I0BA 3JTGA 1G6NA 1OYWA 2O5RA 3DBLB 1KA8A 5GP9A 1IW7F 2R7RA 3CCSI 2GOMA 5HOOA 2O8KA 4KT6A 3FXUA 3RPUA 5DV5A 3KP7A 2QA4I 2QSHX 1W5TA 3JAMZ 5LHHA 1FYMA 3F8MA 1G3WA 1G59A 2A6HF 2DOFA 3K6GA 2KMUA 1TW2A 2IRFG 1W0UA 2VPLA 3S3NA 3BR2A 3ZQGA 3C2HA 3TGNA 2XPVA 1KU3A 3P9KA 3TO7A 2CYYA 2XF7A 2XUBA 5IY5H 3KIOA 3FIWA 1TWAJ 5D5WB 2CV2A 1I5ZA 1RPWA 3BG9A 5E3LA 1R71A 2V6EA 4AC0A 2ID3A 4JP0A 5LBQA 4OU0A 3DWLE 3FXQA 3BG7A 2R3SA 1FIAA 3B02A 3F8CA 3VYUB 3WGGA 1NTCA 3RDIA 1YW9A 3F22A 2EFNA 1X4OA 2DN0A 4FE4A 3BZ6A 5EZHA 3GTJJ 1JE8A 2E1OA 2L9NA 1K78B 1KQ9A 3F3XA 5ILSA 1I3AA 4IHYA 1YLFA 2DFFA 3SEQA 4CXFA 3J80K 3R6SA 3P9CA 2VE9A 1I1GA 2E36A 2L3DA 3GYHX 2Y9YA 5M5YJ 3K1PA 3HKZN 2VQLA 3B6CA 2Q0OA 4HF1A 2X1CA 3H5AA 2H1KA 2VJ5A 5F6FA 2DA3A 1FT9A 5LHIA 2V9KA 5D5XB 2COMA 1JUMA 2O03A 4A5NA 2MG4A 4ENJA 5GAHJ 4UHTA 3CJTB 1XB4A 4HV6A 4LK1F 1OR7A 5F27A 1FYLA 1IV8A 2MABA 2LSOA 1DU6A 1V3FA 3R4KA 4QPOA 2ZMEC 2G9WA 2HVRA 3I53A 4UVAA 4XLCA 3CJNA 2LNBA 1QNTA 2XIGA 3A03A 4C3HJ 2CQKA 3FX3A 5LRRA 4U0YA 2RC4A 3M8FA 3DV8A 3FXJA 2V1UA 2COBA 5DCMB 4HLYA 2OZ6A 4ITVA 1N25A 3BG3A 3OV8A 4M72A 3CJRB 5BPDA 3S2DJ 2RREA 3ZMSA 3C2BA 3ZQFA 1YO5C 3VEPA 2DMPA 2QKMB 3A1YA 1EF4A 4BY7J 3TP0A 1WPKA 4WXHA 1DUXC 5E1WA 3WGHA 3CZ6A 4BU2A 3DQVC 2M87A 1TNSA 5C44J 3BY6A 3SZGA 1WJFA 3T8TA 1LVKA 2HZTA 1H88C 2LVSA 1IUFA 3LSGA 1RC9A 4XLHA 4DW6A 2PMZA 2QM3A 4Y33A 4CCKA 3CLQA 2P6TA 4JK1X 1OCOH 3Q0VA 1YOVB 4DYRA 2XDVA 4BEHB 1FOXA 3K4KA 4B8XA 3CDIA 3BG5A 1MW7A 3FF5A 2HDWA 2P0WA 3E1SA 4KJZA 1J7KA 4H4KC 3D0SA 4RLFA 1A04A 1YW7A 2DFHA 3HJEA 2FMYA 4L9JA 2WY8Q 2KLOA 1W7PB 1XD7A 4IQ4A 4J19A 1L0OC 5M3FJ 4XSXF 2EH3A 2IGMA 2WBMA 1GDTA 3CCQI 5HVQC 2Z1DA 3FBIB 2VBYA 2VIXA 3KLNA 4LIUA 2K40A 4BYYA 3SZPA 1ETVA 1SVMA 1R36A 4LLLA 1B1BA 3DEUA 2M45A 2F4OB 3KP3A 2K9NA 5FROA 5E18F 2LBFB 4PUSA 2XAQA 4E70A 4ZYHA 1QBJA 1X1DA 2X51A 3RPUD 2E34A 2V7FA 4NC8A 1Z0XA 2UXXA 1M1EB 1WJBA 1KU9A 2K9QA 4DYQA 2OUMA 5D4RA 1AU7A 4G94A 2P5VA 3H3VK 2R7OA 2K27A 4BDYA 3BPXA 1SD6A 4B3XA 3KP4A 1R5GA 1USTA 2D1VA 2DA4A 2ZC2A 3CP8A 5JI6A 5EG0B 4GYGA 1HKTA 2QZ8A 3N05A 4C30A 2LYCA 4XKBA 2WAFA 2K9SA 2ID6A 5IPAA 2I5UA 4EJTA 4V19K 1YI2I 2R92J 3HM5A 3KEOA 4IJAA 5L3CA 3AG2H 2CW7A 3MAJA 4L18B 3DTKA 4BE1A 2F48A 2I10A 2PQ8A 3Q9VA 3AKZA 1XX5A 4B4CA 1D1AA 4EJUA 3E0JB 3GX4X 4ZTFA 3S3OA 3LFKA 4OIQF 1P4WA 2FBHA 3MEXA 3WG7H 2VOPA 1G3SA 4BH9A 1HOMA 1AKHB 2A6EF 3OYCA 1S7AA 2VI6A 3HHGA 2QLZA 1Y1VJ 1HW1A 2YX7A 5D6EA 4MIMA 4NB5A 3IKTA 3HTSB 1FSEA 2R4GA 3OMYA 4AVPA 1PUFA 5E79C 2K5CA 3FDYA 2BBYA 3MFKA 5F0HA 3HUGB 1YJWI 1VQ8I 1XS9A 1U5TA 3RPQA 2GXBA 2OA4A 1LEAA 4PJ0C 3WHCA 5A2QZ 2HPMA 2CJJA 4U0WA 3CMMA 3RKQA 1TQPA 2XV4S 3CUQB 3QOPA 4R1HA 4G12A 3ZRGA 5EDNA 3JRCA 1FP2A 2MD0A 5FD6A 1YIOA 2FF4A 3S15J 3K9TA 1BR1A 2L9VA 4A3IJ 3ULQB 1FPQA 3VFZA 1E3PA 3M3YJ 3JTHA 1P92A 5HS7A 4Q4ZF 5EJCA 2WV1A 1RI7A 1LDKB 4MHGA 2CV1A 4A3MJ 2PG4A 3F6VA 4E7SA 2LY9A 4PSXA 4IF4A 3E6DA 1PUEE 5H6QA 1RNLA 3S1RJ 4BHPA 2X1EA 2H6BA 3G1OA 3SDBA 3LA3A 2IEKA 4ETSA 3SXYA 4S0HB 4F93B 2CFXA 1S29A 2XF6A 2D2WA 3HEFA 1K6YA 5LD2C 3MZ8A 3L00A 1GVJA 4IRIA 3MVPA 3L1PA 1E0EA 4IOAF 1B72B 3WU1B 3NQOA 2BYVE 3KFWX 1B72A 1J9IA 5DCMA 1W5SA 4PFPA 4Z2YA 2HQNA 1ZQ3P 3K4NA 3LSIA 3MCZA 4L9NA 5FKLA 3EYIA 4JX5A 3GF2A 3RYPA 3A01A 4N9IA 1YJ9I 2J5OA 4M3FA 4P55A 2E2HJ 3FXKA 5J1YA 3F6OA 1MIJA 4JX6A 2CS3A 3ISPA 2BY2A 4DOZA 4K2EA 5FKNA 4HNVA 2Y48A 4MEYF 3CCUI 5CLSA 3S1MJ 3T8RA 3RCOA 2R5ZA 4LITA 1HXDA 2TCTA 2VKHA 3QQAA 4LB5A 2CFOA 3CCLI 1WSUA 3WODF 2VLAA 4LD5A 3I58A 2E2IJ 1R5ID 1IF1A 3KZYA 2V79A 2R5YB 1Z21A 2DA2A 4B09A 5E3NA 4ESJA 2FOKA 3WTZA 1T08B 1HCRA 3CESA 2IA1A 4LIVA 2VONA 3CF2A 3WTSC 1W36C 3LQRA 4HF0A 4G7OF 2H94A 1T95A 3K4JA 1FY7A 4U7DA 1UMQA 4FHTA 1O3TA 3FXRA 2F5VA 3R60A 4KUMA 3E6BA 1VF9A 5GAEJ 3FKJA 2JPCA 1ZTRA 5EEGA 3JRHA 3I4NJ 4LGWA 3DTEA 1IRGA 2OQRA 1BN5A 2CQ7A 2HU9A 2FEZA 2MD5A 5IOZA 1IGNA 2HVQA 3AL0B 2M8GX 2ZB9A 1Z91A 3J81K 2HEOA 1MBHA 1ZGAA 2OJED 2HXOA 3CC4I 2HZDA 3DBRB 3AL0C 2XGDA 3OIOA 3IV5A 1ZHFA 2MC3A 1ZR4A 1YS6A 1OYIA 4IRGA 3AFHA 4ENKA 1CF7B 4IZZA 5LEKA 1ZH5A 5DD8A 3E5XA 1APLC 1BC8C 4RB0A 1K78A 1HC8A 1H9GA 3WTUC 1UJ8A 2LRDA 2CQQA 2P4WA 2XGEA 4D7NA 3G73A 4UUVA 3BTCA 3W6VA 3N97A 2Y31A 1G3YA 5BS6A 3ABMH 3IKVA 4Y7NJ 3ABUA 1ITYA 4OINF 2Y0SA 3GLLA 3ZCOA 2IGNA 4IHXA 2FBIA 3ZMUA 2RKHA 2DOAA 1H9TA 5GAGJ 3PNVA 4AUXA 4M71A 3HHHA 4QLCU 2Q2EA 3LNQA 1IJWC 1W0TA 2D1HA 3HSFA 5EZGA 2BVMA 3OYGA 2FSWA 2X9DA 3R61A 4HNUA 3QP6A 4UVBA 4C3IJ 2MGQA 3RKYA 2QCOA 1I6XA 1XGOA 2B7EA 3T1BA 2LY2A 2Z16A 3JRAA 2G7HA 4DYCA 4I7HA 2E7WA 3JAMK 2QBYA 1T0FA 3BWGA 1B59A 2M0CA 2HTSA 3EPZA 2E1MC 2IXSA 3REOA 3TQNA 2VKDA 2XRLA 4U7BA 4XLFA 3HSRA 4EGZA 4DZPA 1W7PD 1SC7A 2ZSHB 1H0MA 1A35A 4AU7A 4XIDA 4OWRB 4BQQA 1R9TJ 4RAZA 1F4KA 1QVUA 2M4KA 3H1CA 5FLXZ 3S16J 4HLXA 4LJZF 1X2NA 4LFUA 3HPGA 5F1RA 1ETYA 3K1NA 4PK4A 2DCEA 2NS0A 5D6FA 1ULYA 4XMYA 3J7YJ 5DUKA 1D1CA 2ELHA 2V1NA 3W2WA 1OCPA 1R7JA 3ZQIA 3GFIA 1FMWA 3A0HC 2X4HA 4ZZLA 3DKXA 1JKPC 5HDNA 4I0AA 5F64A 3PM1A 4A2UA 2NVXJ 1ETWA 1X3UA 5K1YA 4D1QA 3L09A 4A3GJ 3V7SA 4CYDA 3EUHC 3HOVJ 5DCFA 1ZELA 3CUQC 3OYDA 5CVVA 1D0ZA 2DOEA 2IAIA 5EEAA 1Y8RB 1E17A 1SFKA 5E20A 4QTRA 3WG9A 3FK7A 4IXAA 1PUFB 2ACJA 3F23A 3FISA 4FASD 1KQ8A 1GHCA 1TT0A 2V1DA 5FLMJ 3M1CA 1IRFA 1K6OA 2PLYA 5FLVA 2CRGA 3ZQ7A 2Y2ZA 2LK2A 2QVOA 4II2A 1LPQA 3O2PE 4CSWA 3ZQHA 2MLGA 2EV0A 1S6LA 2Z33A 4I2OA 1GUUA 2MYSA 4OAZA 3I4PA 5L3BA 1VQPI 3NWTA 5LFAA 2KPMA 4QIWN 4MTEA 1VQOI 4IPAA 4M3BA 4I76A 3HTUA 2LDUA 3HG9A 3L2CA 2AS5F 2R7TA 2WV0A 4L5IA 4RAFA 2FBKA 2VJ4A 3I71A 5JHUA 5EGOB 5JR3A 1LUJB 3L2RA 2QQBA 2NOGA 2KIMA 1LDJA 5DEQA 1YFHA 4LLGF 3HKZA 2ZNYA 1R4NB 2L4AA 2GIZA 1Z7UA 3BJOA 1I50J 3S3MA 1FBQA 1QVTA 1AWCA 4P9UA 1XPXA 5EYRA 2L7MP 1MBGA 4A6EA 2QBYB 5M5WJ 3IRQA 2EIMH 1DP3A 1SMYF 4E7KA 2A5WA 4A69C 2GIVA 4YG2F 3AG1H 1UELB 1IN6A 2QUFA 1IN8A 4N4OB 1WZ2A 3H5NA 2K3PA 4CZZA 1LVAA 2XAJA 1WJEA 1WQ2A 4CICA 1IG7A 4II3A 4WXCA 2BVLA 2Y75A 1YJNI 1SVOA 4HX4A 4XICA 4MQ9F 1XGMA 3CQZJ 3DEWA 4CCJA 2DK8A 4XL9A 2R7WA 3HGYA 5TJJA 1MMDA 3GTKJ 1JT0A 3GVAA 3GFMA 2JK3A 3KX2A 3QPLA 3G4SI 3H9QA 2MSYA 3K4LA 5KVRA 2ZJPF 3CF5F 4S04A 1HLVA 1H8AC 2IT0A 5HLIA 3PUFA 2VC1A 1ETOA 2JUGA 4KN7X 3QRFF 1J75A 3HGGA 2RQQA 2FJ1A 4KYWA 3DU6A 1AHDP 2RV8A 3TBIA 4BBRJ 3EUKL 4RAGA 4D0PA 1EKEA 1HDDC 2R7ZJ 3S2WA 2M34A 4A3KJ 2GWRA 5D5UB 1R22A 1R4MB 3RJPA 5IT3A 1GVDA 1X1AA 3MZHA 1MBJA 3SFIA 1D5YA 2X6YA 3PJRA 5JVTA 4WF2A 3BQYA 1HKQA 1F43A 4V2GA 4WXDA 3ASOH 1SAUA 3HOUJ 2WADA 2LKXA 3OSFA 2VQGA 2GXGA 3WE2A 2VBZA 2XPWA 2Z5UA 1UFMA 4IQJA 2OZUA 2XKOA 3WTTC 3KP2A 3WU0A 1LQ1A 1IO2A 4U87A 2HGCA 2KIQA 1XMXA 5IP9J 1TWHJ 3SHFA 3HC7A 3BR0A 1G4DA 1RKWA 1FEXA 2KRFA 4CDGA 4NNJA 2PBIA 2QSFX 2IW5A 3LA2A 1TWGJ 1RZ4A 2BXYA 2ME0A 4A3FJ 3F8NA 1W36D 5ICEA 5CVIA 1IN5A 4Y13A 2CO5A 3DF8A 1KYZA 3BR6A 4E7JA 2VBWA 2QQAA 2JZYA 5J3LA 5BMZA 3ZMVA 1QGPA 3PNTA 2O7OA 2LOOA 1RKTA 2KRCA 2WTEA 2XSDC 2MW8A 2ZXHA 2G7UA 1IDYA 4EATA 2NAZA 2LMDA 1MSEC 1IV6A 1TQIA 4KN4X 1JKOC 5J8CA 4XQFA 4F7ZA 3OL4A 1JKRC 2B63J 3ONQA 1BC7C 1O7FA 1X4PA 2WAQA 4PCQA 1X3ZB 3Q5FA 1WJCA 4BBSJ 2K86A 3IUOA 1EJ9A 4CYCB 4XONA 4UUSB 2LR8A 3BQZA 3VPRA 4XLPF 2LLKA 1WH5A 5FD5A 2ZJQF 1MDMA 2BY1A 2DA6A 2DK5A 3BCAA 4UNOA 1WJDA 4U0VA 4KMUX 1ZG5A 4HG2A 4LG0B 3I9V2 4ZDPA 2EIJH 1G2HA 3DEEA 2ZMEA 5B66C 4AD9A 3ZXSA 1HSTA 4M3DA 1XG1A 1QHGA 5L3EA 2E5NA 4PJLA 5GPAA 5L3DA 4F52A 3OWTA 4MQVA 3LAJA 2BOLA 2OC6A 3OOPA 2NVQJ 5L3GA 5IYBJ 2JA8J 2ECBA 3OIPA 1DU0A 1WJAA 4BQOA 1Z7LA 3A0BC 1P2FA 2VOOA 4M6VA 1A6IA 1T6SA 1QZEA 3OS1A 1SD5A 1KU7A 5B5EC 3RTRA 1EA3A 4A3EJ 3HUGA 2ZFWA 2F4IA 3FHNA 1ETXA 4ZYDA 2QGUA 3DP7A 1F5TA 4L5JA 2IJLA 1ZG1A 4C2MJ 1EH7A 3A01B 3OR2C 1YITI 1JJ8C 3TMOA 3PUBA 1Z77A 3WTWC 3SJMA 3D1NI 2QSGX 1WKMA 3FHZA 1Z1DA 1JUSA 2DT5A 2JN6A 4CHUA 2MFZA 2E35A 1NG7A 1N77A 1U2WA 3KZIC 2ZO4A 3OYHA 5GPCA 1RESA 2XB0X 5FO5A 3JRFA 2IS1A 1IN7A 1S8NA 3PO2J 4HBLA 5FRNA 3H35A 3OR1C 3QWLA 1OKRA 2XC7A 1REPC 4BNCA 3GZNB 1D0YA 5D4SA 3VYRB 1X19A 2QENA 2VBXA 1R58A 4ESBA 1SAXA 1SFXA 3W6KB 5D8KB 3BT9A 3S17J 2CSOA 3LSKA 2O8XA 3KEYA 5GTHC 5IOYA 4QSHA 4G6QA 2OD5A 1XN7A 4DBRA 3E97A 4DNCA 1A6QA 1PP7U 4C3JJ 2VT3A 2DODA 2EIKH 4M6YA 2IBDA 2CUFA 1OQYA 2WB1A 1F1ZA 3PIOF 2A68F 4HV5A 1WH7A 4BGDA 1D8JA 1UHMA 3K10A 4D5CA 2VXDA 5EGOA 3GTPJ 2IA2A 1VQMI 3DXJF 3HB9A 4KIBA 4I99C 1ON2A 3BCBA 3ERED 2CWEA 2XRNA 2E19A 2RQPA 2DYRH 2X6WA 4ENNA 1OISA 1K7AA 3SQNA 3WTVC 2Z3YA 3VDXA 4BY1J 3LSRA 1T56A 2PFBA 1OCTC 3I4MJ 1MMNA 3TP3A 3VODA 3CMAI 2QQ8A 3DPTA 3QAHA 1FP1D 3M4OJ 2E1MB 3L2QA 3CJQB 2XGCA 3LAPA 4HYEA 2MH9A 2YSRA 1RIOH 2ETHA 1RETA 4A3CJ 2DI3A 3S32A 4PZJA 2CQNA 2B0LA 5JVGF 2CU7A 3QYBA 4Y15A 5LGUA 4MO7A 3H0DA 1W4MA 2HQRA 2ELKA 4G8XA 5B1AH 4HQMA 2YU3A 2NVUB 4MLOA 1RRJA 3TL4X 3LQQA 2ISYA 5DYMA 5FLXK 2J5PA 4DZJA 1XGNA 2EFQA 2HI3A 1WFXA 3MMYB 4RLQA 4UV8A 3ESWB 4G9YA 4HNTA 1IUYA 2HYFA 5B3SH 1FMVA 1USSA 2RNGA 4XKCA 1ZLKA 3TW6A 1NK3P 3DPUA 2JA7J 2X1DA 4WWCA 2NS8A 3C2GA 5FJ8J 2H8WA 4ENMA 3PNYA 2YPRA 1V5GA 3T5XA 1WWXA 5CQEA 4YIIA 1P4XA 1JGSA 3P7NA 4UV9A 3JCUC 5C3EJ 3FMSA 2JJ7A 2GLOA 2KJCA 3FBNB 5CJ9A 2NRAC 4PDKA 2O61A 4E6KG 5J1UA 1NG6A 2JVHA 1ZGJA 3KEQA 4HF2A 2IP2A 3E5UA 3VWBA 3GTQJ 4ZDLA 4FX0A 4PJJA 1T38A 5GADJ 1YQAA 1KU2A 1Q1VA 2KT0A 3Q3SA 3HOZJ 2UZKA 2FE3A 4BXFA 3BZKA 4BHCA 3ZPLA 2R0QC 5C4JJ 3FK6A 5E8IA 2A05A 2W57A 2O9LA 4IHVA 1FC3A 2EJRA 3CP2A 4OAYA 2IPQX 2M7AA 2RN7A 3RKWA 4O5VA 1IXCA 1WJ5A 2MLKA 3PQKA 1Z6RA 2E2JJ 4IO9F 4LMYA 3CC7I 4M73A 1S5LC 1UHWA 2ZFUA 3V42A 4E4HA 5ILUA 1JUPA 1ODDA 1VQ5I 2HTJA 3CCVI 1BA5A 4FTHA 4CGZA 1T33A 3NWSA 3BTIA 3VYSB 2NOJB 2RDPA 3HL2A 4FX4A 3ZN0A 1SANA 3KYLA 5K7HA 5E1ZB 2V1XA 2E60A 1JGGA 4IKFA 1IRZA 2WWYA 1J09A 1NHAA 2XF5A 3M8JA 5IYCJ 2W00A 5A2QK 1XCVA 4EMSA 4JBAA 2KIFA 3S93A 4LOCA 3W3CA 3LL7A 1IAWA 4FISA 2OQGA 3C18A 3NAUA 1XMKA 4E7IA 3GZ5A 3KZZA 1C0WA 1VQLI 1UG0A 3OS2A 2VODA 1EV7A 2JPBA 3B6AA 2DFIA 3WTYC 2ZJRF 2V6CA 4MGRA 1BJAA 4Y17A 5ILVA 1IXSB 4J01A 1OMIA 2A69F 4QPQA 1N75A 2K85A 5F04A 1JT6A 2EBIA 3I3LA 3MKWB 3HBLA 1UB9A 4DQ2A 4M6XA 2CUZA 2F5EA 3M1EA 3OOUA 1RR7A 3WTXC 4I6ZA 1DPRA 2O0YA 1VQKI 4UY8I 2OBPA 5KAFC 1YRNA 4Y3OA 3V7CA 2PMUA 2W4SA 1OFCX 4P1WA 3SFZA 1BI0A 1K4SA 3L2VA 2LKSA 3OYJA 1ZN2A 3BPVA 3TOAA 2M5WA 3FMQA 4AVZA 1YX5A 4UXNA 2YR2A 3LSPA 2L9SA 4FE7A 3ZGKA 2NNYA 1YW8A 3GTOJ 4S05A 1PP8F 2VC0A 5F1JA 2DDAA 1TWCJ 2K4JA 2PX9A 3X2QH 1O3SA 3O8HA 2DMUA 1SD7A 2X6XA 3IL2A 1NH3A 3BC8A 1MSFC 3HOSA 2L5QA 4P5OA 5CPRB 5KHDA 4XN0A 3T0YA 4FETA 3CC2I 2NVTJ 4DJAA 2DA7A 2OTLI 2KZGA 2E7XA 4EV0A 4O6JA 1P4AA 4L0YB 2JRTA 1QU3A 4M3GA 1LB2A 5M3MJ 4LG0A 1QPMA 4D5FA 5J4VA 5JHFA 1K83J 2M9HA 1JJ6C 4KNYA 4EM1A 3HOWJ 1Z05A 1GXQA 2P5KA 4P96A 5IT9K 3IH2A 3V8LA 1ZRFA 5ED4A 1Y39A 1R49A 3BR3A 2P81A 3ZQCA 2F6CA 4FQGA 4NC6A 3QP5A 2LY1A 2IGKA 1FWZA 3KETA 3PFIA 3OYMA 2QQ9A 2JWTA 2W25A 2UUZA 3S14J 5IP6A 2R7QA 4M9SA 4RBOA 2LG4A 1U78A 1KYWA 4A3BJ 4AIHA 2LP0A 2ME6A 1VZ0A 4NQWA 3C7JA 2XSJC 3U2RA 5HDKA 4FT8A 2IA0A 1UCRA 2KP6A 2ZXWH 3OYKA 2DJIA 3R0AA 4PJMA 1ZKGA 3IH4A 4A0ZA 2CGPA 3CMEI 5JLWA 3IAM2 4OIRF 2MBFA 2K3FA 1BOBA 2Z9OA 2HOTA 2DW4A 3I59A 3E6CC 1FZPB 1U6GA 4LLNA 2DAOA 1E3HA 1XMAA 2DMQA 2GOXB 2RAEA 1OCCH 2IS6A 3G6EI 3GEZA 2L4MA 2NS7A 5DS9A 1JI8A 1OR7C 3IAS2 1OJLA 4Y52J 1U3EM 1TTYA 2XROA 4ZH4F 3RZDJ 1GT0C 3I5UA 1RR8C 4YELA 4B3AA 2CUEA 2DTZA 4ESFA 5H2FC 2AHQA 3E3VA 3RIRA 2HOEA 2WY7Q 2EQRA 4PSWA 4A0XA 4XOPA 1QHHD 4YEJA 2DT6A 5F08A 1R1UA 4EQQA 4B47A 5D5VB 1ZYRF 4Z6YA 2Q2EB 2L7ZA 2VL8A 3F21A 1G3TA 3ECOA 3IH3A 5CVJA 2M2EA 4IL6C 3EUHA 4E7ZA 3M8EA 3O3KA 1X58A 3I59B 2DXIA 1X1PA 2XVCA 2F5DA 3A4CA 2MH2A 3H5RA 4PFOA 1BM9A 4KICA 1IZ1A 4BJ5C 2OCCH 4WX9A 2L01A 2M30A 3UKGA 1UHSA 1Z6TA 2HFHA 1I27A 1S3JA 1YX3A 2PMHA 1O3RA 4KIFA 2NXNB 4UB8C 3F9KA 3F0CA 5DUIA 4KISA 3RZOJ 2LREA 4KITB 4MEXF 4KIGA 1ENHA 3KPHA 1ZARA 3QPSA 2A5YB 3GBGA 4X0GA 3NRVA 1D0XA 1X3WB 4MTDA 3K2AA 4EM0B 4XOTA 4GYIA 3EETA 4XM3A 2C6YA 3GMEA 4UVCA 4EJWA 2CMPA 4F55A 2OAZA 5LEJA 3RKXA 2QEXI 1TZLA 3H0GJ 1VQNI 3GFJA 2HOSA 1VQ6I 4ASNA 2GZWA 2W24A 5LRSA 1TT5B 4D7MA 3HIFA 1G8XA 4XKVA 2UXNA 1STZA 2DYSH 1S7OA 1E3OC 2OU2A 4HDUA 5TISC 1DDNA 4G7HF 4KMFA 1ZAOA 1ZG3A 1AOYA 1UG2A 1VI0A 3GW2A 3J81Z 3MD2A 4G6TB 3CLOA 2DFEA 4W1UA 4F92B 2BZTA 3MN2A 3P5JA 4YFNF 3S2HJ 2FUG2 1YYVA 1ZLJA 5K7ZA 3I54A 2A61A 4HQEA 1W5CC 3WHBA 2PJRB 3DKYA 1XSXA 2H6CA 3RQIA 1FNNA 4M3EA 1UAAA 3GO5A 3G71I 4BACA 3MKLA 4NQWB 3Q9SA 4AIDA 1MKMA 3F8FA 1T0FC 3HOYJ 2ZKZA 4DGWB 4ABZA 1MD0A 5K5RA 2Z2SB 3EQLF 1R23A 3ELKA 3D5LA 4OMYA 4XLAA 4WCGA 2W48A 4XNFA 2FRHA 3DLAA 4TV7A 3L2UA 2JSCA 1TNTA 3OYLA 1HBXG 4ZTJA 1FX7A 2WC2A 3BZCA 3OIQA 2PEXA 2QWWA 2N8GA 5FRMA 2VT2A 5ICGA 1V5FA 3O6BB 1JHFA 2EPFA 4CA0A 2DTRA 5FKMA 2V9PA 3L7WA 3FZVA 5EG0A 1TC3C 1MJAA 5IYDJ 1VFCA 1VTNC 1ORKA 4AM3A 3WE3A 1H89C 2TDXA 3UR3C 3IWFA 3DTIA 3TO6A 4NBQA 4ZYEA 2L2OA 5LHGA 1EH8A 3QU3A 5DM7F 3MQ0A 4GXOA 3QPTA 3U21A 3W6JB 1FBSA 4RDUA 4XKWA 2YS9A 1ZREA 5CVRA 4XBFA 3LFUA 1MNEA 2R7SA 3WU2C 5DD4A 2X48A 5C4XJ 5IT9Z 1VQ7I 2DA5A 2ZBKA 2KIUA 4A12A 1WGXA 5E1XA 1MBFA 2AO9A 4XSZF 4V2FA 4M9XA 5H20A 1YRNB 1Y0UA 4GGGA 3H3ZA 2DBBA 1EH6A 2ELJA 1Y8QB 1LNWA 3NEUA 4BE2A 3HDDA 3RSNA 4XN3A 3K4BA 2KZVA 4ANJA 1JXSA 3LWFA 4HOBA 3SDGA 3RYRA 2DMNA 3ML6A 3GZ6A 1O3QA 2VN2A 2VB6A 2KRHA 2Z99A 2ZJ2A 2VKEA 3IRRA 4B48A 2EWNA 2FX0A 3HRSA 1DGWY 3NARA 2VUMJ 1J2XA 3J7ZI 4ZYAA 3VB2A 5J47A 4BXXJ 3HXLA 2P5LC 2HS5A 3ZR8X 4C2TA 3HRUA 4BKXA 3K70D 1Z3XA 2IGOA 3BR1A 5ICCA 1J59A 2DO7A 1FOWA 4KFCA 4L9TA 2E1CA 3OS0A 3I55I 3KE2A 3Q0WA 3Q0UA 5AIPA 3OYEA 2F5CA 3E5QA 4RM2A 1RUNA 2BY0A 1B9NA 5CVUA 4DBQA 1B8IA 5J40A 4Q5SF 4IEJA 4IRHA 4CCLA 2FQ4A 1MNDA 4CH7A 5F0CA 5K5QA 3J7AY 2AQFA 1R6RA 2IS2A 4U88A 2ZNZA 5KK1A 4OIPF 4AIJA 3E7LA 1ZRCA 2HVSA 4ZYGA 1SFEA 2Y69H 3CUOA 1ON1A 5JFRA 4A3DJ 4IHTA 1D1BA 3L9FA 2F4MB 2L9RA 2OCEA 3D5RC 5B1BH 2PJPA 2EV5A 1S7EA 2HWVA 4LB6B 3CD6I 4M74A 5FFZA 2CQXA 5F0FA 4RB3C 1MBKA 1JTYA 4FCYA 3QU6A 5FB2A 2EINH 1BIBA 4I02A 3H9JA 1I6HJ 3FM3A 1BI1A 2PN6A 2Q1ZB 4HZFA 1LE8A 1DQUA 1MZBA 3FM5A 1V5EA 3OYNA 2D5VA 5HDGA 3HSEA 2B9SA 1F9NA 3ERMA 2R93J 1OCZH 3KLOA 1XSDA 2H8RA 3RQ4A 2EILH 3V8JA 4BXUA 4ZZDA 4A5MA 4JOMA 1BW6A 1P7IA 1U5TB 1XTAA 1OYYA 4AYBN
chains in the Genus database with same CATH topology
2VXZA 2GA2A 2P6SA 3TO9A 2CG4A 1T39A 3JSOA 3LSTA 4I98B 2RGVA 3LA7A 2RNJA 1HSJA 2DQLA 3IC7A 3G3ZA 5HS8A 3V4GA 3U9GA 3H3UA 3I64A 4M9ZA 2STWA 4OOIA 1R1VA 3H92A 1SD4A 1BOAA 3MWMA 1FSHA 4HW0A 1FOKA 4OMZA 1TLHB 4RAYA 5BPIA 1B6AA 2D45A 3FWEA 3DFGA 3U1DA 3M7GA 3COAC 5AIQA 1IXRC 1XDUA 4GCVA 1QQIA 2X0LA 2Y0MA 5HLHA 3B73A 1K79A 2EV6A 1FLIA 4A6DA 3HYIA 4QWQA 5ICFA 1HW2A 3BP8A 2FU4A 1O57A 3CTAA 5D8LB 4AWXB 3HRTA 2HDCA 3BJAA 1YG2A 2RVCA 4BQAA 2XKPA 4I09A 4YFXF 2DPUA 3K1MA 2QYOA 5LGNA 1XDSA 3BOQA 4RGRA 1MDMB 1BI3A 5LGTA 4OIOF 3M9AA 1Z9CA 2DLLA 4RGSA 5J6XA 2EA2A 3K0LA 2BGCA 3RI4A 2O6GE 3GUDA 2JT1A 3DKWA 4ON0A 3J80Z 2KKOA 3BROA 2LF8A 4RGUA 2GQQA 5E17F 3FMRA 2GAUA 1XCBA 5CYVA 1BIAA 2FNAA 2M8EA 3CDHA 1J5YA 5HS9A 3GWZA 2EA4A 4XLNF 2K7LA 2R7DA 2ISZA 1FYKA 1I1SA 3CO6C 4P9FA 3K2ZA 3V8KA 5K5OA 3PQJA 4XRFA 4L9VA 1WRJA 4LK0F 3N4MA 1IN4A 2ZCWA 2PI0A 6PAXA 1L3LA 1HQCA 1R1TA 1O7LA 4AIKA 2ADUA 4EVIA 1V4RA 2FXAA 2EK5A 3EDPA 4EJVA 2FNPA 4HX8A 4HA8A 4EGYA 2ZXJA 1D3YA 2ZMEB 1ONVA 1GXPA 4PGGA 2ESNA 4HDVA 3BJ6A 2EFOA 4L0ZB 2EFWA 5LLQA 1LEBA 3F8BA 2DU9A 4BAYA 2XAFA 1YS7A 1HW5A 2H27A 3EYYA 1MGTA 4H0EA 1E2XA 3AAFA 1QO0D 2KJBA 5L3FA 2W85A 3ZMDA 1D8KA 2XAGA 4KDPA 4Q48A 1T2KA 4R79A 1BI2A 4N0BA 2A07F 3KCCA 1CF7A 4RS8A 3C3WA 3R0JA 3V7RA 2E1NA 1FBUA 2NYXA 5J8FA 3HRMA 5E8GA 3JSPA 4NHJA 1R5HA 5TRDA 2P7CB 3CO7C 2F2EA 2YX4A 3TDUC 1OPCA 1KQ0A 4G6DA 1RUOA 2VE8A 1QZYA 3ZP5A 2XASA 3ABTA 1DPUA 3ROUA 1D5VA 3TDZC 2F5FA 2K4BA 2IVMA 2L54A 4PGHA 1LJ9A 2R7FA 2ESHA 5BOXA 2BE5F 3I0TA 3ZMZA 4MNUA 2XHKA 2DPDA 5FGMA 4YFKF 1XGSA 2Q8KA 2W84A 1J0RA 3ECHA 1MJBA 3TOBA 4KA4A 3HOTA 5FFXA 5DDGA 4IHSA 3J7AO 4IVNA 3IWZA 3VOEA 2CW0F 4RGXA 1R00A 3E6MA 1TQMA 3SZTA 1SMTA 1BBYA 2O3FA 2P7VB 1W7PA 2HYGD 2P8TA 3GLXA 5ERIA 4EM2A 2A3SA 4A0YA 1U5TC 1T98A 1XSVA 2V9VA 3C1DA 1ZRDA 2LF7A 2K02A 1YTYA 4GO1A 3F72A 2LKPA 5H6RA 2HKOA 1B4AA 3KP6A 1TW3A 2HKXA 1KGSA 4EJOA 4RB1A 1U8RA 2H09A 4BHBA 2EFPA 3ZN1A 4I01A 2UWMA 2GA1A 2NNNA 4G7ZF 3IHUA 3GXOA 2EB7A 3P9IA 5EEHA 4WK8F 4R8HA 2FMLA 4O3MA 4CO8A 2M1BA 2JTVA 4RB2C 3ZMTA 1Q1HA 1B9MA 2XAHA 3WGIA 4KT5C 1P6RA 3DPLC 1PDNC 1DP7P 3QPHA 5HLGA 1HKSA 2FQ3A 2BEOA 3BDDA 2FA5A 4JQFA 1TBXA 3CUQA 1QZZA 2HR3A 3JW4A 4N9HA 3K69A 2BV6A 1CGPA 4HAMA 4YIFA 2L02A 2XGXA 4HX7A 2MA3A 1JHHA 1WI9A 3GFLA 4Q47A 1SFUA 5BQTA 3KP5A 2STTA 1LDDA 2DQRA 1MJ9A 5AONA 3TKYA 3MZYA 2AXLA 4I0BA 3JTGA 1G6NA 1OYWA 1KA8A 1IW7F 5HOOA 3FXUA 3RPUA 5DV5A 3KP7A 1W5TA 3JAMZ 5LHHA 1FYMA 3F8MA 1G3WA 2A6HF 1TW2A 2IRFG 3TGNA 3P9KA 1KU3A 3TO7A 2CYYA 2XUBA 5D5WB 1I5ZA 5LBQA 4OU0A 3FXQA 2R3SA 3B02A 3F8CA 3WGGA 3RDIA 1YW9A 3F22A 2EFNA 3BZ6A 1JE8A 1K78B 1KQ9A 3F3XA 5ILSA 1YLFA 4CXFA 3J80K 3R6SA 3P9CA 2VE9A 1I1GA 2L3DA 3GYHX 3K1PA 2Q0OA 4HF1A 5F6FA 1FT9A 5LHIA 5D5XB 2COMA 2O03A 4A5NA 4ENJA 4UHTA 4HV6A 1XB4A 4LK1F 1FYLA 1OR7A 2LSOA 1V3FA 3R4KA 2G9WA 3I53A 4UVAA 3CJNA 2LNBA 1QNTA 2XIGA 2CQKA 3FX3A 5LRRA 4U0YA 2RC4A 3M8FA 3DV8A 2V1UA 5DCMB 4HLYA 2OZ6A 3OV8A 4M72A 5BPDA 3ZMSA 1YO5C 3VEPA 4WXHA 1DUXC 5E1WA 3WGHA 3DQVC 2M87A 1TNSA 3BY6A 3T8TA 2HZTA 2QM3A 2P6TA 4JK1X 4B8XA 3FF5A 1J7KA 3D0SA 1A04A 1YW7A 2FMYA 4L9JA 1W7PB 1XD7A 1L0OC 4XSXF 5HVQC 2VBYA 3KLNA 4BYYA 3SZPA 1R36A 4LLLA 1B1BA 3DEUA 2M45A 3KP3A 5E18F 2XAQA 4E70A 4ZYHA 1QBJA 2UXXA 1KU9A 5D4RA 4G94A 2P5VA 2K27A 3BPXA 1SD6A 3KP4A 1R5GA 1USTA 2D1VA 5JI6A 1HKTA 4GYGA 2QZ8A 4EJTA 3KEOA 4IJAA 5L3CA 3MAJA 4L18B 2PQ8A 3Q9VA 4EJUA 3GX4X 3LFKA 4OIQF 1P4WA 2FBHA 3MEXA 2VOPA 1G3SA 4BH9A 2A6EF 1S7AA 3HHGA 2QLZA 2YX7A 1HW1A 5D6EA 4NB5A 3IKTA 3HTSB 1FSEA 4AVPA 2BBYA 3MFKA 1U5TA 3RPQA 2GXBA 2OA4A 1LEAA 5A2QZ 4U0WA 1TQPA 2XV4S 3CUQB 3QOPA 4R1HA 1FP2A 5FD6A 1YIOA 2FF4A 3K9TA 3ULQB 1FPQA 3VFZA 3JTHA 1P92A 5HS7A 4Q4ZF 1RI7A 1LDKB 4MHGA 2PG4A 3F6VA 4IF4A 1PUEE 3E6DA 5H6QA 1RNLA 4BHPA 2H6BA 3LA3A 4ETSA 3SXYA 2CFXA 1S29A 2D2WA 3L00A 1GVJA 4IRIA 3WU1B 3NQOA 2BYVE 3KFWX 1J9IA 5DCMA 1W5SA 4Z2YA 2HQNA 4L9NA 3MCZA 3EYIA 3RYPA 3GF2A 4N9IA 2J5OA 4P55A 3F6OA 3ISPA 4K2EA 2Y48A 4MEYF 5CLSA 3T8RA 1HXDA 4LB5A 1WSUA 3WODF 4LD5A 3I58A 1IF1A 3KZYA 2V79A 4B09A 4ESJA 2FOKA 3WTZA 2IA1A 2VONA 3WTSC 3LQRA 4HF0A 4G7OF 2H94A 1FY7A 4U7DA 4FHTA 1O3TA 3FXRA 3R60A 4KUMA 3E6BA 2JPCA 5EEGA 4LGWA 1IRGA 2OQRA 1BN5A 2FEZA 2MD5A 1Z91A 3J81K 2HEOA 1ZGAA 1ZHFA 2MC3A 1YS6A 1OYIA 4IRGA 4ENKA 1CF7B 5LEKA 1ZH5A 5DD8A 3E5XA 1BC8C 4RB0A 1K78A 1H9GA 3WTUC 2P4WA 3G73A 4UUVA 3N97A 1G3YA 5BS6A 3IKVA 3ABUA 4OINF 2FBIA 3ZMUA 2RKHA 1H9TA 4M71A 3HHHA 4QLCU 2Q2EA 2D1HA 3HSFA 2FSWA 3R61A 3QP6A 4UVBA 3RKYA 1I6XA 1XGOA 3T1BA 2G7HA 4I7HA 2E7WA 3JAMK 2QBYA 1T0FA 3BWGA 1B59A 2HTSA 3REOA 3TQNA 4U7BA 3HSRA 4EGZA 1H0MA 1W7PD 4RAZA 1F4KA 5FLXZ 4HLXA 4LJZF 4LFUA 5F1RA 3K1NA 2NS0A 5D6FA 1ULYA 5DUKA 2ELHA 1R7JA 3GFIA 2X4HA 4ZZLA 5HDNA 4I0AA 5F64A 4A2UA 1X3UA 5K1YA 3L09A 3V7SA 4CYDA 5DCFA 3CUQC 5CVVA 1E17A 5E20A 3WG9A 4IXAA 2ACJA 3F23A 1KQ8A 1GHCA 2V1DA 1IRFA 1K6OA 2PLYA 3ZQ7A 2QVOA 3O2PE 2MLGA 2EV0A 1S6LA 2Z33A 4I2OA 3I4PA 5L3BA 4MTEA 4IPAA 3HTUA 2LDUA 2AS5F 3L2CA 2WV0A 4L5IA 2FBKA 3I71A 5JHUA 5JR3A 2QQBA 2KIMA 1LDJA 5DEQA 1YFHA 4LLGF 2ZNYA 2L4AA 1Z7UA 3BJOA 1FBQA 1AWCA 4P9UA 4A6EA 2QBYB 3IRQA 1SMYF 2GIVA 4YG2F 1IN6A 2QUFA 1IN8A 4CZZA 1LVAA 2XAJA 1WQ2A 4CICA 4WXCA 2Y75A 4HX4A 4MQ9F 1XGMA 2DK8A 5TJJA 3GVAA 3GFMA 5KVRA 4S04A 2IT0A 5HLIA 2VC1A 4KN7X 3QRFF 1J75A 4KYWA 2RV8A 4D0PA 3S2WA 2GWRA 5D5UB 1R22A 3RJPA 5IT3A 3MZHA 5JVTA 4WF2A 1HKQA 4WXDA 2GXGA 3WE2A 2VBZA 2Z5UA 1UFMA 2OZUA 2XKOA 3WTTC 3KP2A 3WU0A 1LQ1A 2HGCA 3SHFA 1G4DA 2KRFA 4CDGA 2PBIA 2IW5A 3LA2A 1RZ4A 3F8NA 5ICEA 5CVIA 1IN5A 4Y13A 2CO5A 1KYZA 3DF8A 2VBWA 2QQAA 2JZYA 5BMZA 3ZMVA 1QGPA 2WTEA 2G7UA 2NAZA 1TQIA 4KN4X 5J8CA 4F7ZA 1BC7C 1O7FA 4PCQA 3Q5FA 2K86A 4XLPF 5FD5A 1MDMA 2DK5A 4UNOA 4U0VA 4KMUX 1ZG5A 4LG0B 2ZMEA 4AD9A 1HSTA 5L3EA 5L3DA 4MQVA 3LAJA 3OOPA 5L3GA 1P2FA 2VOOA 1T6SA 1SD5A 1KU7A 3RTRA 3HUGA 2ZFWA 4ZYDA 3DP7A 1F5TA 4L5JA 2IJLA 1ZG1A 1EH7A 3WTWC 1WKMA 3FHZA 1Z1DA 2DT5A 4CHUA 1U2WA 2ZO4A 5FO5A 1IN7A 1S8NA 4HBLA 1OKRA 1REPC 4BNCA 5D4SA 2QENA 2VBXA 1R58A 4ESBA 1SAXA 1SFXA 3W6KB 5D8KB 2CSOA 2O8XA 4G6QA 2OD5A 1XN7A 3E97A 4DNCA 1PP7U 2VT3A 4M6YA 1F1ZA 2A68F 4HV5A 1D8JA 1UHMA 2IA2A 3DXJF 4KIBA 1ON2A 3ERED 2CWEA 2XRNA 2RQPA 1K7AA 4ENNA 3SQNA 3WTVC 2Z3YA 2PFBA 3VODA 3DPTA 3QAHA 1FP1D 3LAPA 4HYEA 2MH9A 2YSRA 1RIOH 2ETHA 2DI3A 4PZJA 2B0LA 4Y15A 5LGUA 1W4MA 2HQRA 4G8XA 4HQMA 2YU3A 3LQQA 2ISYA 5DYMA 5FLXK 2J5PA 1XGNA 2EFQA 4UV8A 1IUYA 4G9YA 2HYFA 1ZLKA 1USSA 4WWCA 4ENMA 2YPRA 3T5XA 1WWXA 4YIIA 1P4XA 1JGSA 3P7NA 4UV9A 3FMSA 2KJCA 5CJ9A 2NRAC 4PDKA 2O61A 1ZGJA 3KEQA 4HF2A 2IP2A 3E5UA 4FX0A 1T38A 1YQAA 1KU2A 2UZKA 2FE3A 3ZPLA 4BHCA 5E8IA 2W57A 1FC3A 2EJRA 2IPQX 2RN7A 3RKWA 4O5VA 1IXCA 3PQKA 2MLKA 1Z6RA 4LMYA 4M73A 1UHWA 5ILUA 1ODDA 2HTJA 4CGZA 2RDPA 4FX4A 3ZN0A 5E1ZB 2V1XA 2WWYA 1NHAA 5A2QK 1XCVA 4EMSA 4JBAA 2KIFA 1IAWA 2OQGA 3C18A 1XMKA 3GZ5A 3KZZA 1C0WA 2VODA 1EV7A 2JPBA 2DFIA 3WTYC 2V6CA 4MGRA 1BJAA 4Y17A 5ILVA 1IXSB 1OMIA 2A69F 1UB9A 4DQ2A 4M6XA 2F5EA 3M1EA 3WTXC 1DPRA 2O0YA 2OBPA 3V7CA 2PMUA 3SFZA 1BI0A 1ZN2A 3BPVA 3TOAA 2M5WA 3FMQA 4UXNA 2YR2A 2NNYA 1YW8A 4S05A 1PP8F 2VC0A 2K4JA 1O3SA 1SD7A 3IL2A 3HOSA 4P5OA 3T0YA 2E7XA 4EV0A 4O6JA 1P4AA 4L0YB 2JRTA 1LB2A 4LG0A 1QPMA 4KNYA 4EM1A 1Z05A 1GXQA 2P5KA 4P96A 5IT9K 3V8LA 1ZRFA 5ED4A 3QP5A 1FWZA 3KETA 3PFIA 2QQ9A 2W25A 4M9SA 1U78A 1KYWA 4AIHA 4NQWA 3C7JA 3U2RA 5HDKA 4FT8A 2IA0A 1UCRA 3R0AA 2CGPA 4A0ZA 4OIRF 2MBFA 2Z9OA 2DW4A 3I59A 3E6CC 1FZPB 1U6GA 4LLNA 2DAOA 1XMAA 3GEZA 2L4MA 1U3EM 1TTYA 2XROA 4ZH4F 3I5UA 4ESFA 3E3VA 3RIRA 2HOEA 4A0XA 4EQQA 1R1UA 5D5VB 1ZYRF 3F21A 1G3TA 3ECOA 5CVJA 3EUHA 3M8EA 3O3KA 3I59B 2XVCA 2F5DA 2MH2A 4WX9A 1BM9A 1IZ1A 4KICA 2L01A 2M30A 1Z6TA 2HFHA 1I27A 1S3JA 2PMHA 1O3RA 4KIFA 5DUIA 4MEXF 4KIGA 1ZARA 2A5YB 3NRVA 4MTDA 4EM0B 4GYIA 3EETA 2C6YA 4UVCA 4EJWA 2OAZA 5LEJA 3RKXA 3GFJA 4ASNA 2GZWA 2W24A 5LRSA 3HIFA 2UXNA 1STZA 1S7OA 2OU2A 4HDUA 1DDNA 4G7HF 4KMFA 1ZAOA 1ZG3A 1AOYA 3GW2A 3J81Z 3CLOA 4YFNF 1YYVA 1ZLJA 3I54A 2A61A 4HQEA 1XSXA 2H6CA 1FNNA 3GO5A 3Q9SA 1MKMA 3F8FA 2ZKZA 1MD0A 5K5RA 3EQLF 1R23A 3ELKA 3D5LA 4OMYA 4WCGA 2FRHA 4TV7A 2JSCA 1TNTA 1HBXG 1FX7A 2WC2A 2PEXA 2QWWA 2VT2A 5ICGA 3O6BB 1JHFA 2DTRA 3L7WA 3FZVA 1MJAA 1VTNC 3WE3A 2TDXA 3IWFA 3TO6A 4ZYEA 5LHGA 1EH8A 3QU3A 3MQ0A 4GXOA 3QPTA 3W6JB 1FBSA 1ZREA 5CVRA 4XBFA 5DD4A 5IT9Z 2ZBKA 2KIUA 4A12A 5E1XA 4XSZF 4M9XA 5H20A 1Y0UA 4GGGA 3H3ZA 2DBBA 1EH6A 1LNWA 3NEUA 1JXSA 3LWFA 4HOBA 3RYRA 3ML6A 3GZ6A 1O3QA 2VN2A 2Z99A 2ZJ2A 3IRRA 2EWNA 3HRSA 1J2XA 3VB2A 2P5LC 2HS5A 3HRUA 5ICCA 1J59A 2DO7A 4KFCA 4L9TA 2E1CA 3KE2A 5AIPA 2F5CA 3E5QA 1RUNA 5CVUA 1B9NA 4Q5SF 4IRHA 5K5QA 4U88A 2ZNZA 5KK1A 4OIPF 4AIJA 1ZRCA 4ZYGA 1SFEA 3CUOA 1ON1A 5JFRA 4IHTA 3L9FA 2PJPA 2EV5A 2HWVA 4LB6B 4M74A 5FFZA 4RB3C 3QU6A 5FB2A 4I02A 1BIBA 3FM3A 1BI1A 2PN6A 4HZFA 3FM5A 1MZBA 5HDGA 3HSEA 1F9NA 3KLOA 1XSDA 4ZZDA 4BXUA 3V8JA 4A5MA 1U5TB 1OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXZ A;  2GA2 A;  2P6S A;  3TO9 A;  2CG4 A;  1T39 A;  3JSO A;  3LST A;  4I98 B;  2RGV A;  3LA7 A;  2RNJ A;  1HSJ A;  2DQL A;  3IC7 A;  3G3Z A;  5HS8 A;  3V4G A;  3U9G A;  3H3U A;  3I64 A;  4M9Z A;  2STW A;  4OOI A;  1R1V A;  3H92 A;  1SD4 A;  1BOA A;  3MWM A;  1FSH A;  4HW0 A;  1FOK A;  4OMZ A;  1TLH B;  4RAY A;  5BPI A;  1B6A A;  2D45 A;  3FWE A;  3DFG A;  3U1D A;  3M7G A;  3COA C;  5AIQ A;  1IXR C;  1XDU A;  4GCV A;  1QQI A;  2X0L A;  2Y0M A;  5HLH A;  3B73 A;  1K79 A;  2EV6 A;  1FLI A;  4A6D A;  3HYI A;  4QWQ A;  5ICF A;  1HW2 A;  3BP8 A;  2FU4 A;  1O57 A;  3CTA A;  5D8L B;  4AWX B;  3HRT A;  2HDC A;  3BJA A;  1YG2 A;  2RVC A;  4BQA A;  2XKP A;  4I09 A;  4YFX F;  2DPU A;  3K1M A;  2QYO A;  5LGN A;  1XDS A;  3BOQ A;  4RGR A;  1MDM B;  1BI3 A;  5LGT A;  4OIO F;  3M9A A;  1Z9C A;  2DLL A;  4RGS A;  5J6X A;  2EA2 A;  3K0L A;  2BGC A;  3RI4 A;  2O6G E;  3GUD A;  2JT1 A;  3DKW A;  4ON0 A;  3J80 Z;  2KKO A;  3BRO A;  2LF8 A;  4RGU A;  2GQQ A;  5E17 F;  3FMR A;  2GAU A;  1XCB A;  5CYV A;  1BIA A;  2FNA A;  2M8E A;  3CDH A;  1J5Y A;  5HS9 A;  3GWZ A;  2EA4 A;  4XLN F;  2K7L A;  2R7D A;  2ISZ A;  1FYK A;  1I1S A;  3CO6 C;  4P9F A;  3K2Z A;  3V8K A;  5K5O A;  3PQJ A;  4XRF A;  4L9V A;  1WRJ A;  4LK0 F;  3N4M A;  1IN4 A;  2ZCW A;  2PI0 A;  6PAX A;  1L3L A;  1HQC A;  1R1T A;  1O7L A;  4AIK A;  2ADU A;  4EVI A;  1V4R A;  2FXA A;  2EK5 A;  3EDP A;  4EJV A;  2FNP A;  4HX8 A;  4HA8 A;  4EGY A;  2ZXJ A;  1D3Y A;  2ZME B;  1ONV A;  1GXP A;  4PGG A;  2ESN A;  4HDV A;  3BJ6 A;  2EFO A;  4L0Z B;  2EFW A;  5LLQ A;  1LEB A;  3F8B A;  2DU9 A;  4BAY A;  2XAF A;  1YS7 A;  1HW5 A;  2H27 A;  3EYY A;  1MGT A;  4H0E A;  1E2X A;  3AAF A;  1QO0 D;  2KJB A;  5L3F A;  2W85 A;  3ZMD A;  1D8K A;  2XAG A;  4KDP A;  4Q48 A;  1T2K A;  4R79 A;  1BI2 A;  4N0B A;  2A07 F;  3KCC A;  1CF7 A;  4RS8 A;  3C3W A;  3R0J A;  3V7R A;  2E1N A;  1FBU A;  2NYX A;  5J8F A;  3HRM A;  5E8G A;  3JSP A;  4NHJ A;  1R5H A;  5TRD A;  2P7C B;  3CO7 C;  2F2E A;  2YX4 A;  3TDU C;  1OPC A;  1KQ0 A;  4G6D A;  1RUO A;  2VE8 A;  1QZY A;  3ZP5 A;  2XAS A;  3ABT A;  1DPU A;  3ROU A;  1D5V A;  3TDZ C;  2F5F A;  2K4B A;  2IVM A;  2L54 A;  4PGH A;  1LJ9 A;  2R7F A;  2ESH A;  5BOX A;  2BE5 F;  3I0T A;  3ZMZ A;  4MNU A;  2XHK A;  2DPD A;  5FGM A;  4YFK F;  1XGS A;  2Q8K A;  2W84 A;  1J0R A;  3ECH A;  1MJB A;  3TOB A;  4KA4 A;  3HOT A;  5FFX A;  5DDG A;  4IHS A;  3J7A O;  4IVN A;  3IWZ A;  3VOE A;  2CW0 F;  4RGX A;  1R00 A;  3E6M A;  1TQM A;  3SZT A;  1SMT A;  1BBY A;  2O3F A;  2P7V B;  1W7P A;  2HYG D;  2P8T A;  3GLX A;  5ERI A;  4EM2 A;  2A3S A;  4A0Y A;  1U5T C;  1T98 A;  1XSV A;  2V9V A;  3C1D A;  1ZRD A;  2LF7 A;  2K02 A;  1YTY A;  4GO1 A;  3F72 A;  2LKP A;  5H6R A;  2HKO A;  1B4A A;  3KP6 A;  1TW3 A;  2HKX A;  1KGS A;  4EJO A;  4RB1 A;  1U8R A;  2H09 A;  4BHB A;  2EFP A;  3ZN1 A;  4I01 A;  2UWM A;  2GA1 A;  2NNN A;  4G7Z F;  3IHU A;  3GXO A;  2EB7 A;  3P9I A;  5EEH A;  4WK8 F;  4R8H A;  2FML A;  4O3M A;  4CO8 A;  2M1B A;  2JTV A;  4RB2 C;  3ZMT A;  1Q1H A;  1B9M A;  2XAH A;  3WGI A;  4KT5 C;  1P6R A;  3DPL C;  1PDN C;  1DP7 P;  3QPH A;  5HLG A;  1HKS A;  2FQ3 A;  2BEO A;  3BDD A;  2FA5 A;  4JQF A;  1TBX A;  3CUQ A;  1QZZ A;  2HR3 A;  3JW4 A;  4N9H A;  3K69 A;  2BV6 A;  1CGP A;  4HAM A;  4YIF A;  2L02 A;  2XGX A;  4HX7 A;  2MA3 A;  1JHH A;  1WI9 A;  3GFL A;  4Q47 A;  1SFU A;  5BQT A;  3KP5 A;  2STT A;  1LDD A;  2DQR A;  1MJ9 A;  5AON A;  3TKY A;  3MZY A;  2AXL A;  4I0B A;  3JTG A;  1G6N A;  1OYW A;  1KA8 A;  1IW7 F;  5HOO A;  3FXU A;  3RPU A;  5DV5 A;  3KP7 A;  1W5T A;  3JAM Z;  5LHH A;  1FYM A;  3F8M A;  1G3W A;  2A6H F;  1TW2 A;  2IRF G;  3TGN A;  3P9K A;  1KU3 A;  3TO7 A;  2CYY A;  2XUB A;  5D5W B;  1I5Z A;  5LBQ A;  4OU0 A;  3FXQ A;  2R3S A;  3B02 A;  3F8C A;  3WGG A;  3RDI A;  1YW9 A;  3F22 A;  2EFN A;  3BZ6 A;  1JE8 A;  1K78 B;  1KQ9 A;  3F3X A;  5ILS A;  1YLF A;  4CXF A;  3J80 K;  3R6S A;  3P9C A;  2VE9 A;  1I1G A;  2L3D A;  3GYH X;  3K1P A;  2Q0O A;  4HF1 A;  5F6F A;  1FT9 A;  5LHI A;  5D5X B;  2COM A;  2O03 A;  4A5N A;  4ENJ A;  4UHT A;  4HV6 A;  1XB4 A;  4LK1 F;  1FYL A;  1OR7 A;  2LSO A;  1V3F A;  3R4K A;  2G9W A;  3I53 A;  4UVA A;  3CJN A;  2LNB A;  1QNT A;  2XIG A;  2CQK A;  3FX3 A;  5LRR A;  4U0Y A;  2RC4 A;  3M8F A;  3DV8 A;  2V1U A;  5DCM B;  4HLY A;  2OZ6 A;  3OV8 A;  4M72 A;  5BPD A;  3ZMS A;  1YO5 C;  3VEP A;  4WXH A;  1DUX C;  5E1W A;  3WGH A;  3DQV C;  2M87 A;  1TNS A;  3BY6 A;  3T8T A;  2HZT A;  2QM3 A;  2P6T A;  4JK1 X;  4B8X A;  3FF5 A;  1J7K A;  3D0S A;  1A04 A;  1YW7 A;  2FMY A;  4L9J A;  1W7P B;  1XD7 A;  1L0O C;  4XSX F;  5HVQ C;  2VBY A;  3KLN A;  4BYY A;  3SZP A;  1R36 A;  4LLL A;  1B1B A;  3DEU A;  2M45 A;  3KP3 A;  5E18 F;  2XAQ A;  4E70 A;  4ZYH A;  1QBJ A;  2UXX A;  1KU9 A;  5D4R A;  4G94 A;  2P5V A;  2K27 A;  3BPX A;  1SD6 A;  3KP4 A;  1R5G A;  1UST A;  2D1V A;  5JI6 A;  1HKT A;  4GYG A;  2QZ8 A;  4EJT A;  3KEO A;  4IJA A;  5L3C A;  3MAJ A;  4L18 B;  2PQ8 A;  3Q9V A;  4EJU A;  3GX4 X;  3LFK A;  4OIQ F;  1P4W A;  2FBH A;  3MEX A;  2VOP A;  1G3S A;  4BH9 A;  2A6E F;  1S7A A;  3HHG A;  2QLZ A;  2YX7 A;  1HW1 A;  5D6E A;  4NB5 A;  3IKT A;  3HTS B;  1FSE A;  4AVP A;  2BBY A;  3MFK A;  1U5T A;  3RPQ A;  2GXB A;  2OA4 A;  1LEA A;  5A2Q Z;  4U0W A;  1TQP A;  2XV4 S;  3CUQ B;  3QOP A;  4R1H A;  1FP2 A;  5FD6 A;  1YIO A;  2FF4 A;  3K9T A;  3ULQ B;  1FPQ A;  3VFZ A;  3JTH A;  1P92 A;  5HS7 A;  4Q4Z F;  1RI7 A;  1LDK B;  4MHG A;  2PG4 A;  3F6V A;  4IF4 A;  1PUE E;  3E6D A;  5H6Q A;  1RNL A;  4BHP A;  2H6B A;  3LA3 A;  4ETS A;  3SXY A;  2CFX A;  1S29 A;  2D2W A;  3L00 A;  1GVJ A;  4IRI A;  3WU1 B;  3NQO A;  2BYV E;  3KFW X;  1J9I A;  5DCM A;  1W5S A;  4Z2Y A;  2HQN A;  4L9N A;  3MCZ A;  3EYI A;  3RYP A;  3GF2 A;  4N9I A;  2J5O A;  4P55 A;  3F6O A;  3ISP A;  4K2E A;  2Y48 A;  4MEY F;  5CLS A;  3T8R A;  1HXD A;  4LB5 A;  1WSU A;  3WOD F;  4LD5 A;  3I58 A;  1IF1 A;  3KZY A;  2V79 A;  4B09 A;  4ESJ A;  2FOK A;  3WTZ A;  2IA1 A;  2VON A;  3WTS C;  3LQR A;  4HF0 A;  4G7O F;  2H94 A;  1FY7 A;  4U7D A;  4FHT A;  1O3T A;  3FXR A;  3R60 A;  4KUM A;  3E6B A;  2JPC A;  5EEG A;  4LGW A;  1IRG A;  2OQR A;  1BN5 A;  2FEZ A;  2MD5 A;  1Z91 A;  3J81 K;  2HEO A;  1ZGA A;  1ZHF A;  2MC3 A;  1YS6 A;  1OYI A;  4IRG A;  4ENK A;  1CF7 B;  5LEK A;  1ZH5 A;  5DD8 A;  3E5X A;  1BC8 C;  4RB0 A;  1K78 A;  1H9G A;  3WTU C;  2P4W A;  3G73 A;  4UUV A;  3N97 A;  1G3Y A;  5BS6 A;  3IKV A;  3ABU A;  4OIN F;  2FBI A;  3ZMU A;  2RKH A;  1H9T A;  4M71 A;  3HHH A;  4QLC U;  2Q2E A;  2D1H A;  3HSF A;  2FSW A;  3R61 A;  3QP6 A;  4UVB A;  3RKY A;  1I6X A;  1XGO A;  3T1B A;  2G7H A;  4I7H A;  2E7W A;  3JAM K;  2QBY A;  1T0F A;  3BWG A;  1B59 A;  2HTS A;  3REO A;  3TQN A;  4U7B A;  3HSR A;  4EGZ A;  1H0M A;  1W7P D;  4RAZ A;  1F4K A;  5FLX Z;  4HLX A;  4LJZ F;  4LFU A;  5F1R A;  3K1N A;  2NS0 A;  5D6F A;  1ULY A;  5DUK A;  2ELH A;  1R7J A;  3GFI A;  2X4H A;  4ZZL A;  5HDN A;  4I0A A;  5F64 A;  4A2U A;  1X3U A;  5K1Y A;  3L09 A;  3V7S A;  4CYD A;  5DCF A;  3CUQ C;  5CVV A;  1E17 A;  5E20 A;  3WG9 A;  4IXA A;  2ACJ A;  3F23 A;  1KQ8 A;  1GHC A;  2V1D A;  1IRF A;  1K6O A;  2PLY A;  3ZQ7 A;  2QVO A;  3O2P E;  2MLG A;  2EV0 A;  1S6L A;  2Z33 A;  4I2O A;  3I4P A;  5L3B A;  4MTE A;  4IPA A;  3HTU A;  2LDU A;  2AS5 F;  3L2C A;  2WV0 A;  4L5I A;  2FBK A;  3I71 A;  5JHU A;  5JR3 A;  2QQB A;  2KIM A;  1LDJ A;  5DEQ A;  1YFH A;  4LLG F;  2ZNY A;  2L4A A;  1Z7U A;  3BJO A;  1FBQ A;  1AWC A;  4P9U A;  4A6E A;  2QBY B;  3IRQ A;  1SMY F;  2GIV A;  4YG2 F;  1IN6 A;  2QUF A;  1IN8 A;  4CZZ A;  1LVA A;  2XAJ A;  1WQ2 A;  4CIC A;  4WXC A;  2Y75 A;  4HX4 A;  4MQ9 F;  1XGM A;  2DK8 A;  5TJJ A;  3GVA A;  3GFM A;  5KVR A;  4S04 A;  2IT0 A;  5HLI A;  2VC1 A;  4KN7 X;  3QRF F;  1J75 A;  4KYW A;  2RV8 A;  4D0P A;  3S2W A;  2GWR A;  5D5U B;  1R22 A;  3RJP A;  5IT3 A;  3MZH A;  5JVT A;  4WF2 A;  1HKQ A;  4WXD A;  2GXG A;  3WE2 A;  2VBZ A;  2Z5U A;  1UFM A;  2OZU A;  2XKO A;  3WTT C;  3KP2 A;  3WU0 A;  1LQ1 A;  2HGC A;  3SHF A;  1G4D A;  2KRF A;  4CDG A;  2PBI A;  2IW5 A;  3LA2 A;  1RZ4 A;  3F8N A;  5ICE A;  5CVI A;  1IN5 A;  4Y13 A;  2CO5 A;  1KYZ A;  3DF8 A;  2VBW A;  2QQA A;  2JZY A;  5BMZ A;  3ZMV A;  1QGP A;  2WTE A;  2G7U A;  2NAZ A;  1TQI A;  4KN4 X;  5J8C A;  4F7Z A;  1BC7 C;  1O7F A;  4PCQ A;  3Q5F A;  2K86 A;  4XLP F;  5FD5 A;  1MDM A;  2DK5 A;  4UNO A;  4U0V A;  4KMU X;  1ZG5 A;  4LG0 B;  2ZME A;  4AD9 A;  1HST A;  5L3E A;  5L3D A;  4MQV A;  3LAJ A;  3OOP A;  5L3G A;  1P2F A;  2VOO A;  1T6S A;  1SD5 A;  1KU7 A;  3RTR A;  3HUG A;  2ZFW A;  4ZYD A;  3DP7 A;  1F5T A;  4L5J A;  2IJL A;  1ZG1 A;  1EH7 A;  3WTW C;  1WKM A;  3FHZ A;  1Z1D A;  2DT5 A;  4CHU A;  1U2W A;  2ZO4 A;  5FO5 A;  1IN7 A;  1S8N A;  4HBL A;  1OKR A;  1REP C;  4BNC A;  5D4S A;  2QEN A;  2VBX A;  1R58 A;  4ESB A;  1SAX A;  1SFX A;  3W6K B;  5D8K B;  2CSO A;  2O8X A;  4G6Q A;  2OD5 A;  1XN7 A;  3E97 A;  4DNC A;  1PP7 U;  2VT3 A;  4M6Y A;  1F1Z A;  2A68 F;  4HV5 A;  1D8J A;  1UHM A;  2IA2 A;  3DXJ F;  4KIB A;  1ON2 A;  3ERE D;  2CWE A;  2XRN A;  2RQP A;  1K7A A;  4ENN A;  3SQN A;  3WTV C;  2Z3Y A;  2PFB A;  3VOD A;  3DPT A;  3QAH A;  1FP1 D;  3LAP A;  4HYE A;  2MH9 A;  2YSR A;  1RIO H;  2ETH A;  2DI3 A;  4PZJ A;  2B0L A;  4Y15 A;  5LGU A;  1W4M A;  2HQR A;  4G8X A;  4HQM A;  2YU3 A;  3LQQ A;  2ISY A;  5DYM A;  5FLX K;  2J5P A;  1XGN A;  2EFQ A;  4UV8 A;  1IUY A;  4G9Y A;  2HYF A;  1ZLK A;  1USS A;  4WWC A;  4ENM A;  2YPR A;  3T5X A;  1WWX A;  4YII A;  1P4X A;  1JGS A;  3P7N A;  4UV9 A;  3FMS A;  2KJC A;  5CJ9 A;  2NRA C;  4PDK A;  2O61 A;  1ZGJ A;  3KEQ A;  4HF2 A;  2IP2 A;  3E5U A;  4FX0 A;  1T38 A;  1YQA A;  1KU2 A;  2UZK A;  2FE3 A;  3ZPL A;  4BHC A;  5E8I A;  2W57 A;  1FC3 A;  2EJR A;  2IPQ X;  2RN7 A;  3RKW A;  4O5V A;  1IXC A;  3PQK A;  2MLK A;  1Z6R A;  4LMY A;  4M73 A;  1UHW A;  5ILU A;  1ODD A;  2HTJ A;  4CGZ A;  2RDP A;  4FX4 A;  3ZN0 A;  5E1Z B;  2V1X A;  2WWY A;  1NHA A;  5A2Q K;  1XCV A;  4EMS A;  4JBA A;  2KIF A;  1IAW A;  2OQG A;  3C18 A;  1XMK A;  3GZ5 A;  3KZZ A;  1C0W A;  2VOD A;  1EV7 A;  2JPB A;  2DFI A;  3WTY C;  2V6C A;  4MGR A;  1BJA A;  4Y17 A;  5ILV A;  1IXS B;  1OMI A;  2A69 F;  1UB9 A;  4DQ2 A;  4M6X A;  2F5E A;  3M1E A;  3WTX C;  1DPR A;  2O0Y A;  2OBP A;  3V7C A;  2PMU A;  3SFZ A;  1BI0 A;  1ZN2 A;  3BPV A;  3TOA A;  2M5W A;  3FMQ A;  4UXN A;  2YR2 A;  2NNY A;  1YW8 A;  4S05 A;  1PP8 F;  2VC0 A;  2K4J A;  1O3S A;  1SD7 A;  3IL2 A;  3HOS A;  4P5O A;  3T0Y A;  2E7X A;  4EV0 A;  4O6J A;  1P4A A;  4L0Y B;  2JRT A;  1LB2 A;  4LG0 A;  1QPM A;  4KNY A;  4EM1 A;  1Z05 A;  1GXQ A;  2P5K A;  4P96 A;  5IT9 K;  3V8L A;  1ZRF A;  5ED4 A;  3QP5 A;  1FWZ A;  3KET A;  3PFI A;  2QQ9 A;  2W25 A;  4M9S A;  1U78 A;  1KYW A;  4AIH A;  4NQW A;  3C7J A;  3U2R A;  5HDK A;  4FT8 A;  2IA0 A;  1UCR A;  3R0A A;  2CGP A;  4A0Z A;  4OIR F;  2MBF A;  2Z9O A;  2DW4 A;  3I59 A;  3E6C C;  1FZP B;  1U6G A;  4LLN A;  2DAO A;  1XMA A;  3GEZ A;  2L4M A;  1U3E M;  1TTY A;  2XRO A;  4ZH4 F;  3I5U A;  4ESF A;  3E3V A;  3RIR A;  2HOE A;  4A0X A;  4EQQ A;  1R1U A;  5D5V B;  1ZYR F;  3F21 A;  1G3T A;  3ECO A;  5CVJ A;  3EUH A;  3M8E A;  3O3K A;  3I59 B;  2XVC A;  2F5D A;  2MH2 A;  4WX9 A;  1BM9 A;  1IZ1 A;  4KIC A;  2L01 A;  2M30 A;  1Z6T A;  2HFH A;  1I27 A;  1S3J A;  2PMH A;  1O3R A;  4KIF A;  5DUI A;  4MEX F;  4KIG A;  1ZAR A;  2A5Y B;  3NRV A;  4MTD A;  4EM0 B;  4GYI A;  3EET A;  2C6Y A;  4UVC A;  4EJW A;  2OAZ A;  5LEJ A;  3RKX A;  3GFJ A;  4ASN A;  2GZW A;  2W24 A;  5LRS A;  3HIF A;  2UXN A;  1STZ A;  1S7O A;  2OU2 A;  4HDU A;  1DDN A;  4G7H F;  4KMF A;  1ZAO A;  1ZG3 A;  1AOY A;  3GW2 A;  3J81 Z;  3CLO A;  4YFN F;  1YYV A;  1ZLJ A;  3I54 A;  2A61 A;  4HQE A;  1XSX A;  2H6C A;  1FNN A;  3GO5 A;  3Q9S A;  1MKM A;  3F8F A;  2ZKZ A;  1MD0 A;  5K5R A;  3EQL F;  1R23 A;  3ELK A;  3D5L A;  4OMY A;  4WCG A;  2FRH A;  4TV7 A;  2JSC A;  1TNT A;  1HBX G;  1FX7 A;  2WC2 A;  2PEX A;  2QWW A;  2VT2 A;  5ICG A;  3O6B B;  1JHF A;  2DTR A;  3L7W A;  3FZV A;  1MJA A;  1VTN C;  3WE3 A;  2TDX A;  3IWF A;  3TO6 A;  4ZYE A;  5LHG A;  1EH8 A;  3QU3 A;  3MQ0 A;  4GXO A;  3QPT A;  3W6J B;  1FBS A;  1ZRE A;  5CVR A;  4XBF A;  5DD4 A;  5IT9 Z;  2ZBK A;  2KIU A;  4A12 A;  5E1X A;  4XSZ F;  4M9X A;  5H20 A;  1Y0U A;  4GGG A;  3H3Z A;  2DBB A;  1EH6 A;  1LNW A;  3NEU A;  1JXS A;  3LWF A;  4HOB A;  3RYR A;  3ML6 A;  3GZ6 A;  1O3Q A;  2VN2 A;  2Z99 A;  2ZJ2 A;  3IRR A;  2EWN A;  3HRS A;  1J2X A;  3VB2 A;  2P5L C;  2HS5 A;  3HRU A;  5ICC A;  1J59 A;  2DO7 A;  4KFC A;  4L9T A;  2E1C A;  3KE2 A;  5AIP A;  2F5C A;  3E5Q A;  1RUN A;  5CVU A;  1B9N A;  4Q5S F;  4IRH A;  5K5Q A;  4U88 A;  2ZNZ A;  5KK1 A;  4OIP F;  4AIJ A;  1ZRC A;  4ZYG A;  1SFE A;  3CUO A;  1ON1 A;  5JFR A;  4IHT A;  3L9F A;  2PJP A;  2EV5 A;  2HWV A;  4LB6 B;  4M74 A;  5FFZ A;  4RB3 C;  3QU6 A;  5FB2 A;  4I02 A;  1BIB A;  3FM3 A;  1BI1 A;  2PN6 A;  4HZF A;  3FM5 A;  1MZB A;  5HDG A;  3HSE A;  1F9N A;  3KLO A;  1XSD A;  4ZZD A;  4BXU A;  3V8J A;  4A5M A;  1U5T B;  1OYY A; 
#chains in the Genus database with same CATH topology
 5IP7 J;  2VXZ A;  1ZR2 A;  4IHW A;  2GA2 A;  2P6S A;  3TO9 A;  2OF7 A;  2CG4 A;  2YUS A;  1T39 A;  3HOX J;  1JTX A;  1P9Q C;  1AKH A;  1U9O A;  3JSO A;  3CCM I;  1ZGW A;  3LST A;  2BY3 A;  3QOD A;  4I98 B;  3VSK A;  2RGV A;  1YIJ I;  3LA7 A;  3JRE A;  3VSL A;  2VQH A;  4JX4 A;  2RNJ A;  1HSJ A;  2DQL A;  3IC7 A;  2EZK A;  3G3Z A;  4RM3 A;  5HS8 A;  2M4G A;  3CCR I;  3O8G A;  3V4G A;  4XRM A;  3U9G A;  3H3U A;  3I64 A;  4M9Z A;  2STW A;  4OOI A;  1R1V A;  3U1K A;  3H92 A;  2BHZ A;  3OYF A;  1SD4 A;  4XRS G;  3UNG C;  1GV5 A;  1BOA A;  3JRD A;  4X1E A;  5DM6 F;  3AG4 H;  3MWM A;  1FSH A;  2XPU A;  4HW0 A;  3DLL F;  1FOK A;  1HA8 A;  5KCM A;  4OMZ A;  1TLH B;  2FD5 A;  1Y0N A;  4RAY A;  2M0M A;  5BPI A;  1B6A A;  2CUJ A;  3BG6 A;  3CCE I;  4F3Q A;  1B8I B;  2JA2 A;  1F36 A;  4BDZ A;  2D45 A;  3FWE A;  3DBH B;  4IOC F;  3DFG A;  1TWF J;  3U1D A;  2Y9Z A;  4X6A J;  3M7G A;  3CCJ I;  3CCY A;  4YIR X;  3COA C;  5AIQ A;  2CV0 A;  2M7B A;  1U9N A;  3PO3 J;  1IXR C;  1XDU A;  4GCV A;  1FOY A;  4A93 J;  1QQI A;  5HNF A;  1FJL A;  2X0L A;  2Y0M A;  5HLH A;  3B73 A;  1K79 A;  2JVG A;  3FXL A;  2EV6 A;  1FLI A;  1PVE A;  4A6D A;  3HYI A;  4QWQ A;  2EZL A;  1OLT A;  9ANT A;  2V4J C;  5ICF A;  4W97 A;  5JLX A;  1HW2 A;  3BP8 A;  2FU4 A;  1O57 A;  3CTA A;  5D8L B;  4AWX B;  1Z67 A;  2JUC A;  4DIQ A;  1Y1W J;  3HRT A;  2HDC A;  1KON A;  3BJA A;  1YG2 A;  1LKX A;  2RVC A;  3ABL H;  2G0E A;  2NVY J;  4BQA A;  2XKP A;  1TL8 A;  5E3M A;  2HOA A;  4PJN A;  3JRG A;  4I09 A;  4YFX F;  1FIP A;  2DPU A;  3K1M A;  4GFB A;  1MMA A;  3BTL A;  3MKY B;  1BR4 A;  2EZH A;  4JYK A;  2QYO A;  5LGN A;  1MMG A;  2VAS A;  1XDS A;  3LMM A;  3BOQ A;  4BL0 B;  4Y4R A;  4RGR A;  1MDM B;  1BI3 A;  2JMW A;  5LGT A;  1K61 A;  1SFO J;  5FKO A;  4OIO F;  3M9A A;  1Z9C A;  3S1Q J;  1ACI A;  1WVR A;  2DLL A;  2VQC A;  4MFD A;  5E3O A;  2GBY A;  4RGS A;  3ZOB A;  5J6X A;  2H1L A;  3A2K A;  2EA2 A;  1A36 A;  4UUS A;  2HQ5 A;  2R7U A;  1KZH A;  3K0L A;  2BGC A;  3RI4 A;  2O6G E;  3GUD A;  4BJ6 C;  2JT1 A;  3FXM A;  3QOE A;  3DKW A;  1WI3 A;  4ON0 A;  1WHU A;  3J80 Z;  2KKO A;  2KDO A;  3BRO A;  2VJI A;  2HQA A;  3CDL A;  2LF8 A;  1QA6 A;  4NUB A;  4RGU A;  2GQQ A;  3S1N J;  5E17 F;  3FMR A;  3L2W A;  4ZJZ A;  4NC7 A;  2GAU A;  1XCB A;  3KYD B;  1BIA A;  5CYV A;  4RMN A;  2FNA A;  2M8E A;  3K4M A;  4MFE A;  2KDZ A;  3CDH A;  1J5Y A;  4NDL A;  1MMS A;  5HS9 A;  3GWZ A;  4C2U A;  2EA4 A;  1BW5 A;  1GLN A;  4XLN F;  2K7L A;  1TP4 A;  2X6O A;  2W1O A;  2R7D A;  5J4Y A;  4F91 B;  2ISZ A;  1FYK A;  2CW8 A;  1SVL A;  5BNG A;  1I1S A;  2EZI A;  3GTL J;  3CO6 C;  1BR2 A;  4P9F A;  3K2Z A;  3V8K A;  5M5X J;  5K5O A;  3PQJ A;  1U0J A;  4XRF A;  4L9V A;  3H9G A;  1S72 I;  3ABK H;  1ERD A;  1WRJ A;  4LK0 F;  3KYC B;  3N4M A;  1BL0 A;  3S8P A;  1IN4 A;  2KQR A;  2ZCW A;  5CQG A;  1N78 A;  4UUT A;  2VPR A;  3HPH A;  1A5J A;  2UV1 A;  2PI0 A;  6PAX A;  1L3L A;  1HQC A;  1P7J A;  3G2B A;  1R1T A;  1O7L A;  4AIK A;  3IP4 B;  2ADU A;  2K9M A;  3D5S C;  1PJR A;  4EVI A;  1V4R A;  2FXA A;  2M3A A;  3FXO A;  2R5Z B;  2EK5 A;  1VQ9 I;  4A3L J;  2LD5 A;  3EDP A;  4EJV A;  2FNP A;  1QPI A;  4HX8 A;  1ETK A;  4HA8 A;  4EGY A;  2ZXJ A;  3QYF A;  1LFB A;  2ZME B;  1D3Y A;  1ONV A;  1GXP A;  3PL8 A;  4PGG A;  3GCM A;  2ESN A;  4LG3 A;  4HDV A;  3BJ6 A;  4CZC A;  3M07 A;  5EF6 A;  4XK4 A;  2JQ7 A;  2EFO A;  3OY9 A;  2W7N A;  1GV2 A;  4L0Z B;  3MKZ A;  3DU5 A;  2JRM A;  3SYT A;  2EFW A;  2I8D A;  5LLQ A;  1LEB A;  3F8B A;  2DU9 A;  4BAY A;  2R7X A;  2XAF A;  1YS7 A;  1DGR M;  1YHQ I;  4YRV A;  1HW5 A;  2KFD A;  2WB1 N;  1W1W E;  4CYC A;  3DCF A;  2H27 A;  1ETQ A;  3EYY A;  2LH9 A;  3LSH A;  1MGT A;  4H0E A;  1E2X A;  3AAF A;  1QO0 D;  2KJB A;  5L3F A;  5KNL A;  2W85 A;  5HLT A;  2HPI A;  4N4N B;  3ZMD A;  2ZXI A;  2LC2 A;  4AYB A;  3G1L A;  4BE0 A;  1D8K A;  2XAG A;  4E7H A;  3G1M A;  3AG3 H;  4C9Y A;  4KDP A;  2DT7 B;  4Q48 A;  3OL3 A;  1U8B A;  2GXA A;  3JRI A;  1T2K A;  4R79 A;  1BI2 A;  4N0B A;  2A07 F;  3KCC A;  1CF7 A;  2BW3 B;  2Y0S N;  2TRT A;  4RS8 A;  3C3W A;  3R0J A;  3BR5 A;  3V7R A;  2VKV A;  2E1N A;  1FBU A;  3H36 A;  1A31 A;  2NYX A;  5J8F A;  4BQN A;  1MNM C;  1X2M A;  2LBF A;  2QKL B;  3HRM A;  5E8G A;  2QF7 A;  3LSM A;  3ZQQ A;  4BS9 A;  3ASN H;  2KIS A;  5CKT A;  3JSP A;  2R7V A;  2VJJ A;  4NHJ A;  3EUA A;  3JRB A;  2DA1 A;  4EEF G;  2JA5 J;  2JSP A;  2BW3 A;  1R5H A;  5TRD A;  2P7C B;  3OYA A;  4CCN A;  1OCR H;  3CO7 C;  2F2E A;  2YX4 A;  4XLE A;  2CH0 A;  1XC5 A;  3TDU C;  3I56 I;  1OPC A;  2Y30 A;  1KQ0 A;  4G6D A;  4BEH A;  1RUO A;  2VE8 A;  1QZY A;  3ZP5 A;  2XAS A;  3ABT A;  1DPU A;  3K7A J;  4L5E A;  1X1B A;  3ROU A;  1D5V A;  1HDP A;  3TDZ C;  2WA0 A;  2F5F A;  2ECC A;  4BUP A;  1Y6I A;  2K4B A;  2FOW A;  1K4T A;  2A6T A;  1UZC A;  2IVM A;  2L54 A;  3GTG J;  2LTP A;  2XAU A;  2BXZ A;  4PGH A;  1LJ9 A;  2R7F A;  2ESH A;  5BOX A;  2DMT A;  2MC4 A;  5GTI C;  2BE5 F;  2L7K A;  3I0T A;  4HSR A;  3ZMZ A;  4MNU A;  1V54 H;  3ZQL A;  4XRS A;  2XHK A;  1JKQ C;  3JR9 A;  2DPD A;  5FGM A;  4YFK F;  1XGS A;  2Q8K A;  2W84 A;  4CCM A;  2K9L A;  1J0R A;  3ECH A;  1MJB A;  3QYE A;  3TOB A;  4KA4 A;  3HOT A;  4IX7 A;  5HNH A;  1SEU A;  5FFX A;  5DDG A;  5J1R A;  4IHS A;  3J7A O;  4IVN A;  3OYB A;  3IWZ A;  3VOE A;  1FTT A;  3GTM J;  2CW0 F;  4RGX A;  4CUG A;  1R00 A;  5HOD A;  3E6M A;  1TQM A;  2IS4 A;  4GDF A;  1PYV A;  3SZT A;  4HPQ A;  5DTD A;  1SMT A;  1BBY A;  2O3F A;  2P7V B;  2PJR A;  2KL4 A;  4J00 A;  1W7P A;  2HYG D;  2P8T A;  3GLX A;  5ERI A;  4EM2 A;  2A3S A;  4A0Y A;  1U5T C;  3OSG A;  1T98 A;  3PIP F;  1XSV A;  2DDB A;  2HDD A;  2V9V A;  3C1D A;  2LF7 A;  1ZRD A;  2K02 A;  1YTY A;  2OV7 A;  2R5Y A;  4GO1 A;  3F72 A;  3HZJ A;  4UB6 C;  2X85 A;  2LKP A;  1HF0 A;  2AQE A;  5H6R A;  1BJZ A;  4B43 A;  2HKO A;  1B4A A;  3KP6 A;  1TW3 A;  1MH4 A;  4RA2 A;  5FKK A;  2OTJ I;  2HKX A;  1KGS A;  2GM4 A;  4E7L A;  4EJO A;  1VND A;  3CMY A;  1I39 A;  4RB1 A;  1Y56 A;  2H09 A;  1U8R A;  4BHB A;  1LFU P;  2ZSI B;  2HXI A;  2EFP A;  1X1C A;  3ZN1 A;  4I01 A;  3LSJ A;  3VYT B;  3K70 C;  2UWM A;  2GA1 A;  2NNN A;  4XOR A;  4G7Z F;  3IHU A;  3BTJ A;  1IRX A;  3GXO A;  1Z3Y A;  3BLY A;  1IC8 A;  2EB7 A;  3P9I A;  5EEH A;  4WK8 F;  2AXT C;  4R8H A;  3A02 A;  1O4X A;  1I3Q J;  2FML A;  4O3M A;  4CO8 A;  2M1B A;  1MBE A;  4BJT A;  2JTV A;  4B44 A;  1NK2 P;  2JA6 J;  2HNH A;  4RB2 C;  3ZMT A;  1Q1H A;  1B9M A;  2OPT A;  2XAH A;  4B1R A;  3WGI A;  2WAQ N;  4HRI A;  1POG A;  2DJN A;  1ZK8 A;  4HST A;  1P6R A;  4KT5 C;  5K7F A;  3DPL C;  2PMZ N;  1PDN C;  1DP7 P;  3W2V A;  1V55 H;  3PSF A;  4D9J A;  2LFB A;  1QRY A;  2E71 A;  2V26 A;  1LFP A;  3FKI J;  2W82 A;  3QPH A;  5KAI C;  4A3J J;  5HLG A;  5TGT A;  1HKS A;  1YE9 A;  2FQ3 A;  2BEO A;  3SEZ A;  3BDD A;  3TED A;  2FA5 A;  4HEA 2;  2KHM A;  4JQF A;  1TBX A;  2ICW G;  3OYI A;  2WAE A;  3CUQ A;  1FTZ A;  2E5Z A;  4ZC3 A;  1QZZ A;  2HR3 A;  2BHY A;  3JW4 A;  1VQ4 I;  4N9H A;  3K69 A;  2BV6 A;  2HYJ A;  3K4C A;  1CGP A;  4HAM A;  1CQT A;  1AA7 A;  4YIF A;  2XB5 A;  1S9H A;  3PSI A;  2L02 A;  2XGX A;  1MH3 A;  4HX7 A;  2MA3 A;  1JHH A;  1IDZ A;  3PFY A;  2L0K A;  1WI9 A;  1WCM J;  3GFL A;  4Q47 A;  1SFU A;  3TW7 A;  3LOC A;  5BQT A;  3KP5 A;  4GRI A;  2L7F P;  1T8I A;  2STT A;  4CCO A;  2YU9 J;  4ZDO A;  4XR6 A;  1LDD A;  3W2A A;  2DQR A;  1MJ9 A;  5AON A;  3TKY A;  3MZY A;  2AXL A;  1LE8 B;  4I0B A;  3JTG A;  1G6N A;  1OYW A;  2O5R A;  3DBL B;  1KA8 A;  5GP9 A;  1IW7 F;  2R7R A;  3CCS I;  2GOM A;  5HOO A;  2O8K A;  4KT6 A;  3FXU A;  3RPU A;  5DV5 A;  3KP7 A;  2QA4 I;  2QSH X;  1W5T A;  3JAM Z;  5LHH A;  1FYM A;  3F8M A;  1G3W A;  1G59 A;  2A6H F;  2DOF A;  3K6G A;  2KMU A;  1TW2 A;  2IRF G;  1W0U A;  2VPL A;  3S3N A;  3BR2 A;  3ZQG A;  3C2H A;  3TGN A;  2XPV A;  1KU3 A;  3P9K A;  3TO7 A;  2CYY A;  2XF7 A;  2XUB A;  5IY5 H;  3KIO A;  3FIW A;  1TWA J;  5D5W B;  2CV2 A;  1I5Z A;  1RPW A;  3BG9 A;  5E3L A;  1R71 A;  2V6E A;  4AC0 A;  2ID3 A;  4JP0 A;  5LBQ A;  4OU0 A;  3DWL E;  3FXQ A;  3BG7 A;  2R3S A;  1FIA A;  3B02 A;  3F8C A;  3VYU B;  3WGG A;  1NTC A;  3RDI A;  1YW9 A;  3F22 A;  2EFN A;  1X4O A;  2DN0 A;  4FE4 A;  3BZ6 A;  5EZH A;  3GTJ J;  1JE8 A;  2E1O A;  2L9N A;  1K78 B;  1KQ9 A;  3F3X A;  5ILS A;  1I3A A;  4IHY A;  1YLF A;  2DFF A;  3SEQ A;  4CXF A;  3J80 K;  3R6S A;  3P9C A;  2VE9 A;  1I1G A;  2E36 A;  2L3D A;  3GYH X;  2Y9Y A;  5M5Y J;  3K1P A;  3HKZ N;  2VQL A;  3B6C A;  2Q0O A;  4HF1 A;  2X1C A;  3H5A A;  2H1K A;  2VJ5 A;  5F6F A;  2DA3 A;  1FT9 A;  5LHI A;  2V9K A;  5D5X B;  2COM A;  1JUM A;  2O03 A;  4A5N A;  2MG4 A;  4ENJ A;  5GAH J;  4UHT A;  3CJT B;  1XB4 A;  4HV6 A;  4LK1 F;  1OR7 A;  5F27 A;  1FYL A;  1IV8 A;  2MAB A;  2LSO A;  1DU6 A;  1V3F A;  3R4K A;  4QPO A;  2ZME C;  2G9W A;  2HVR A;  3I53 A;  4UVA A;  4XLC A;  3CJN A;  2LNB A;  1QNT A;  2XIG A;  3A03 A;  4C3H J;  2CQK A;  3FX3 A;  5LRR A;  4U0Y A;  2RC4 A;  3M8F A;  3DV8 A;  3FXJ A;  2V1U A;  2COB A;  5DCM B;  4HLY A;  2OZ6 A;  4ITV A;  1N25 A;  3BG3 A;  3OV8 A;  4M72 A;  3CJR B;  5BPD A;  3S2D J;  2RRE A;  3ZMS A;  3C2B A;  3ZQF A;  1YO5 C;  3VEP A;  2DMP A;  2QKM B;  3A1Y A;  1EF4 A;  4BY7 J;  3TP0 A;  1WPK A;  4WXH A;  1DUX C;  5E1W A;  3WGH A;  3CZ6 A;  4BU2 A;  3DQV C;  2M87 A;  1TNS A;  5C44 J;  3BY6 A;  3SZG A;  1WJF A;  3T8T A;  1LVK A;  2HZT A;  1H88 C;  2LVS A;  1IUF A;  3LSG A;  1RC9 A;  4XLH A;  4DW6 A;  2PMZ A;  2QM3 A;  4Y33 A;  4CCK A;  3CLQ A;  2P6T A;  4JK1 X;  1OCO H;  3Q0V A;  1YOV B;  4DYR A;  2XDV A;  4BEH B;  1FOX A;  3K4K A;  4B8X A;  3CDI A;  3BG5 A;  1MW7 A;  3FF5 A;  2HDW A;  2P0W A;  3E1S A;  4KJZ A;  1J7K A;  4H4K C;  3D0S A;  4RLF A;  1A04 A;  1YW7 A;  2DFH A;  3HJE A;  2FMY A;  4L9J A;  2WY8 Q;  2KLO A;  1W7P B;  1XD7 A;  4IQ4 A;  4J19 A;  1L0O C;  5M3F J;  4XSX F;  2EH3 A;  2IGM A;  2WBM A;  1GDT A;  3CCQ I;  5HVQ C;  2Z1D A;  3FBI B;  2VBY A;  2VIX A;  3KLN A;  4LIU A;  2K40 A;  4BYY A;  3SZP A;  1ETV A;  1SVM A;  1R36 A;  4LLL A;  1B1B A;  3DEU A;  2M45 A;  2F4O B;  3KP3 A;  2K9N A;  5FRO A;  5E18 F;  2LBF B;  4PUS A;  2XAQ A;  4E70 A;  4ZYH A;  1QBJ A;  1X1D A;  2X51 A;  3RPU D;  2E34 A;  2V7F A;  4NC8 A;  1Z0X A;  2UXX A;  1M1E B;  1WJB A;  1KU9 A;  2K9Q A;  4DYQ A;  2OUM A;  5D4R A;  1AU7 A;  4G94 A;  2P5V A;  3H3V K;  2R7O A;  2K27 A;  4BDY A;  3BPX A;  1SD6 A;  4B3X A;  3KP4 A;  1R5G A;  1UST A;  2D1V A;  2DA4 A;  2ZC2 A;  3CP8 A;  5JI6 A;  5EG0 B;  4GYG A;  1HKT A;  2QZ8 A;  3N05 A;  4C30 A;  2LYC A;  4XKB A;  2WAF A;  2K9S A;  2ID6 A;  5IPA A;  2I5U A;  4EJT A;  4V19 K;  1YI2 I;  2R92 J;  3HM5 A;  3KEO A;  4IJA A;  5L3C A;  3AG2 H;  2CW7 A;  3MAJ A;  4L18 B;  3DTK A;  4BE1 A;  2F48 A;  2I10 A;  2PQ8 A;  3Q9V A;  3AKZ A;  1XX5 A;  4B4C A;  1D1A A;  4EJU A;  3E0J B;  3GX4 X;  4ZTF A;  3S3O A;  3LFK A;  4OIQ F;  1P4W A;  2FBH A;  3MEX A;  3WG7 H;  2VOP A;  1G3S A;  4BH9 A;  1HOM A;  1AKH B;  2A6E F;  3OYC A;  1S7A A;  2VI6 A;  3HHG A;  2QLZ A;  1Y1V J;  1HW1 A;  2YX7 A;  5D6E A;  4MIM A;  4NB5 A;  3IKT A;  3HTS B;  1FSE A;  2R4G A;  3OMY A;  4AVP A;  1PUF A;  5E79 C;  2K5C A;  3FDY A;  2BBY A;  3MFK A;  5F0H A;  3HUG B;  1YJW I;  1VQ8 I;  1XS9 A;  1U5T A;  3RPQ A;  2GXB A;  2OA4 A;  1LEA A;  4PJ0 C;  3WHC A;  5A2Q Z;  2HPM A;  2CJJ A;  4U0W A;  3CMM A;  3RKQ A;  1TQP A;  2XV4 S;  3CUQ B;  3QOP A;  4R1H A;  4G12 A;  3ZRG A;  5EDN A;  3JRC A;  1FP2 A;  2MD0 A;  5FD6 A;  1YIO A;  2FF4 A;  3S15 J;  3K9T A;  1BR1 A;  2L9V A;  4A3I J;  3ULQ B;  1FPQ A;  3VFZ A;  1E3P A;  3M3Y J;  3JTH A;  1P92 A;  5HS7 A;  4Q4Z F;  5EJC A;  2WV1 A;  1RI7 A;  1LDK B;  4MHG A;  2CV1 A;  4A3M J;  2PG4 A;  3F6V A;  4E7S A;  2LY9 A;  4PSX A;  4IF4 A;  3E6D A;  1PUE E;  5H6Q A;  1RNL A;  3S1R J;  4BHP A;  2X1E A;  2H6B A;  3G1O A;  3SDB A;  3LA3 A;  2IEK A;  4ETS A;  3SXY A;  4S0H B;  4F93 B;  2CFX A;  1S29 A;  2XF6 A;  2D2W A;  3HEF A;  1K6Y A;  5LD2 C;  3MZ8 A;  3L00 A;  1GVJ A;  4IRI A;  3MVP A;  3L1P A;  1E0E A;  4IOA F;  1B72 B;  3WU1 B;  3NQO A;  2BYV E;  3KFW X;  1B72 A;  1J9I A;  5DCM A;  1W5S A;  4PFP A;  4Z2Y A;  2HQN A;  1ZQ3 P;  3K4N A;  3LSI A;  3MCZ A;  4L9N A;  5FKL A;  3EYI A;  4JX5 A;  3GF2 A;  3RYP A;  3A01 A;  4N9I A;  1YJ9 I;  2J5O A;  4M3F A;  4P55 A;  2E2H J;  3FXK A;  5J1Y A;  3F6O A;  1MIJ A;  4JX6 A;  2CS3 A;  3ISP A;  2BY2 A;  4DOZ A;  4K2E A;  5FKN A;  4HNV A;  2Y48 A;  4MEY F;  3CCU I;  5CLS A;  3S1M J;  3T8R A;  3RCO A;  2R5Z A;  4LIT A;  1HXD A;  2TCT A;  2VKH A;  3QQA A;  4LB5 A;  2CFO A;  3CCL I;  1WSU A;  3WOD F;  2VLA A;  4LD5 A;  3I58 A;  2E2I J;  1R5I D;  1IF1 A;  3KZY A;  2V79 A;  2R5Y B;  1Z21 A;  2DA2 A;  4B09 A;  5E3N A;  4ESJ A;  2FOK A;  3WTZ A;  1T08 B;  1HCR A;  3CES A;  2IA1 A;  4LIV A;  2VON A;  3CF2 A;  3WTS C;  1W36 C;  3LQR A;  4HF0 A;  4G7O F;  2H94 A;  1T95 A;  3K4J A;  1FY7 A;  4U7D A;  1UMQ A;  4FHT A;  1O3T A;  3FXR A;  2F5V A;  3R60 A;  4KUM A;  3E6B A;  1VF9 A;  5GAE J;  3FKJ A;  2JPC A;  1ZTR A;  5EEG A;  3JRH A;  3I4N J;  4LGW A;  3DTE A;  1IRG A;  2OQR A;  1BN5 A;  2CQ7 A;  2HU9 A;  2FEZ A;  2MD5 A;  5IOZ A;  1IGN A;  2HVQ A;  3AL0 B;  2M8G X;  2ZB9 A;  1Z91 A;  3J81 K;  2HEO A;  1MBH A;  1ZGA A;  2OJE D;  2HXO A;  3CC4 I;  2HZD A;  3DBR B;  3AL0 C;  2XGD A;  3OIO A;  3IV5 A;  1ZHF A;  2MC3 A;  1ZR4 A;  1YS6 A;  1OYI A;  4IRG A;  3AFH A;  4ENK A;  1CF7 B;  4IZZ A;  5LEK A;  1ZH5 A;  5DD8 A;  3E5X A;  1APL C;  1BC8 C;  4RB0 A;  1K78 A;  1HC8 A;  1H9G A;  3WTU C;  1UJ8 A;  2LRD A;  2CQQ A;  2P4W A;  2XGE A;  4D7N A;  3G73 A;  4UUV A;  3BTC A;  3W6V A;  3N97 A;  2Y31 A;  1G3Y A;  5BS6 A;  3ABM H;  3IKV A;  4Y7N J;  3ABU A;  1ITY A;  4OIN F;  2Y0S A;  3GLL A;  3ZCO A;  2IGN A;  4IHX A;  2FBI A;  3ZMU A;  2RKH A;  2DOA A;  1H9T A;  5GAG J;  3PNV A;  4AUX A;  4M71 A;  3HHH A;  4QLC U;  2Q2E A;  3LNQ A;  1IJW C;  1W0T A;  2D1H A;  3HSF A;  5EZG A;  2BVM A;  3OYG A;  2FSW A;  2X9D A;  3R61 A;  4HNU A;  3QP6 A;  4UVB A;  4C3I J;  2MGQ A;  3RKY A;  2QCO A;  1I6X A;  1XGO A;  2B7E A;  3T1B A;  2LY2 A;  2Z16 A;  3JRA A;  2G7H A;  4DYC A;  4I7H A;  2E7W A;  3JAM K;  2QBY A;  1T0F A;  3BWG A;  1B59 A;  2M0C A;  2HTS A;  3EPZ A;  2E1M C;  2IXS A;  3REO A;  3TQN A;  2VKD A;  2XRL A;  4U7B A;  4XLF A;  3HSR A;  4EGZ A;  4DZP A;  1W7P D;  1SC7 A;  2ZSH B;  1H0M A;  1A35 A;  4AU7 A;  4XID A;  4OWR B;  4BQQ A;  1R9T J;  4RAZ A;  1F4K A;  1QVU A;  2M4K A;  3H1C A;  5FLX Z;  3S16 J;  4HLX A;  4LJZ F;  1X2N A;  4LFU A;  3HPG A;  5F1R A;  1ETY A;  3K1N A;  4PK4 A;  2DCE A;  2NS0 A;  5D6F A;  1ULY A;  4XMY A;  3J7Y J;  5DUK A;  1D1C A;  2ELH A;  2V1N A;  3W2W A;  1OCP A;  1R7J A;  3ZQI A;  3GFI A;  1FMW A;  3A0H C;  2X4H A;  4ZZL A;  3DKX A;  1JKP C;  5HDN A;  4I0A A;  5F64 A;  3PM1 A;  4A2U A;  2NVX J;  1ETW A;  1X3U A;  5K1Y A;  4D1Q A;  3L09 A;  4A3G J;  3V7S A;  4CYD A;  3EUH C;  3HOV J;  5DCF A;  1ZEL A;  3CUQ C;  3OYD A;  5CVV A;  1D0Z A;  2DOE A;  2IAI A;  5EEA A;  1Y8R B;  1E17 A;  1SFK A;  5E20 A;  4QTR A;  3WG9 A;  3FK7 A;  4IXA A;  1PUF B;  2ACJ A;  3F23 A;  3FIS A;  4FAS D;  1KQ8 A;  1GHC A;  1TT0 A;  2V1D A;  5FLM J;  3M1C A;  1IRF A;  1K6O A;  2PLY A;  5FLV A;  2CRG A;  3ZQ7 A;  2Y2Z A;  2LK2 A;  2QVO A;  4II2 A;  1LPQ A;  3O2P E;  4CSW A;  3ZQH A;  2MLG A;  2EV0 A;  1S6L A;  2Z33 A;  4I2O A;  1GUU A;  2MYS A;  4OAZ A;  3I4P A;  5L3B A;  1VQP I;  3NWT A;  5LFA A;  2KPM A;  4QIW N;  4MTE A;  1VQO I;  4IPA A;  4M3B A;  4I76 A;  3HTU A;  2LDU A;  3HG9 A;  3L2C A;  2AS5 F;  2R7T A;  2WV0 A;  4L5I A;  4RAF A;  2FBK A;  2VJ4 A;  3I71 A;  5JHU A;  5EGO B;  5JR3 A;  1LUJ B;  3L2R A;  2QQB A;  2NOG A;  2KIM A;  1LDJ A;  5DEQ A;  1YFH A;  4LLG F;  3HKZ A;  2ZNY A;  1R4N B;  2L4A A;  2GIZ A;  1Z7U A;  3BJO A;  1I50 J;  3S3M A;  1FBQ A;  1QVT A;  1AWC A;  4P9U A;  1XPX A;  5EYR A;  2L7M P;  1MBG A;  4A6E A;  2QBY B;  5M5W J;  3IRQ A;  2EIM H;  1DP3 A;  1SMY F;  4E7K A;  2A5W A;  4A69 C;  2GIV A;  4YG2 F;  3AG1 H;  1UEL B;  1IN6 A;  2QUF A;  1IN8 A;  4N4O B;  1WZ2 A;  3H5N A;  2K3P A;  4CZZ A;  1LVA A;  2XAJ A;  1WJE A;  1WQ2 A;  4CIC A;  1IG7 A;  4II3 A;  4WXC A;  2BVL A;  2Y75 A;  1YJN I;  1SVO A;  4HX4 A;  4XIC A;  4MQ9 F;  1XGM A;  3CQZ J;  3DEW A;  4CCJ A;  2DK8 A;  4XL9 A;  2R7W A;  3HGY A;  5TJJ A;  1MMD A;  3GTK J;  1JT0 A;  3GVA A;  3GFM A;  2JK3 A;  3KX2 A;  3QPL A;  3G4S I;  3H9Q A;  2MSY A;  3K4L A;  5KVR A;  2ZJP F;  3CF5 F;  4S04 A;  1HLV A;  1H8A C;  2IT0 A;  5HLI A;  3PUF A;  2VC1 A;  1ETO A;  2JUG A;  4KN7 X;  3QRF F;  1J75 A;  3HGG A;  2RQQ A;  2FJ1 A;  4KYW A;  3DU6 A;  1AHD P;  2RV8 A;  3TBI A;  4BBR J;  3EUK L;  4RAG A;  4D0P A;  1EKE A;  1HDD C;  2R7Z J;  3S2W A;  2M34 A;  4A3K J;  2GWR A;  5D5U B;  1R22 A;  1R4M B;  3RJP A;  5IT3 A;  1GVD A;  1X1A A;  3MZH A;  1MBJ A;  3SFI A;  1D5Y A;  2X6Y A;  3PJR A;  5JVT A;  4WF2 A;  3BQY A;  1HKQ A;  1F43 A;  4V2G A;  4WXD A;  3ASO H;  1SAU A;  3HOU J;  2WAD A;  2LKX A;  3OSF A;  2VQG A;  2GXG A;  3WE2 A;  2VBZ A;  2XPW A;  2Z5U A;  1UFM A;  4IQJ A;  2OZU A;  2XKO A;  3WTT C;  3KP2 A;  3WU0 A;  1LQ1 A;  1IO2 A;  4U87 A;  2HGC A;  2KIQ A;  1XMX A;  5IP9 J;  1TWH J;  3SHF A;  3HC7 A;  3BR0 A;  1G4D A;  1RKW A;  1FEX A;  2KRF A;  4CDG A;  4NNJ A;  2PBI A;  2QSF X;  2IW5 A;  3LA2 A;  1TWG J;  1RZ4 A;  2BXY A;  2ME0 A;  4A3F J;  3F8N A;  1W36 D;  5ICE A;  5CVI A;  1IN5 A;  4Y13 A;  2CO5 A;  3DF8 A;  1KYZ A;  3BR6 A;  4E7J A;  2VBW A;  2QQA A;  2JZY A;  5J3L A;  5BMZ A;  3ZMV A;  1QGP A;  3PNT A;  2O7O A;  2LOO A;  1RKT A;  2KRC A;  2WTE A;  2XSD C;  2MW8 A;  2ZXH A;  2G7U A;  1IDY A;  4EAT A;  2NAZ A;  2LMD A;  1MSE C;  1IV6 A;  1TQI A;  4KN4 X;  1JKO C;  5J8C A;  4XQF A;  4F7Z A;  3OL4 A;  1JKR C;  2B63 J;  3ONQ A;  1BC7 C;  1O7F A;  1X4P A;  2WAQ A;  4PCQ A;  1X3Z B;  3Q5F A;  1WJC A;  4BBS J;  2K86 A;  3IUO A;  1EJ9 A;  4CYC B;  4XON A;  4UUS B;  2LR8 A;  3BQZ A;  3VPR A;  4XLP F;  2LLK A;  1WH5 A;  5FD5 A;  2ZJQ F;  1MDM A;  2BY1 A;  2DA6 A;  2DK5 A;  3BCA A;  4UNO A;  1WJD A;  4U0V A;  4KMU X;  1ZG5 A;  4HG2 A;  4LG0 B;  3I9V 2;  4ZDP A;  2EIJ H;  1G2H A;  3DEE A;  2ZME A;  5B66 C;  4AD9 A;  3ZXS A;  1HST A;  4M3D A;  1XG1 A;  1QHG A;  5L3E A;  2E5N A;  4PJL A;  5GPA A;  5L3D A;  4F52 A;  3OWT A;  4MQV A;  3LAJ A;  2BOL A;  2OC6 A;  3OOP A;  2NVQ J;  5L3G A;  5IYB J;  2JA8 J;  2ECB A;  3OIP A;  1DU0 A;  1WJA A;  4BQO A;  1Z7L A;  3A0B C;  1P2F A;  2VOO A;  4M6V A;  1A6I A;  1T6S A;  1QZE A;  3OS1 A;  1SD5 A;  1KU7 A;  5B5E C;  3RTR A;  1EA3 A;  4A3E J;  3HUG A;  2ZFW A;  2F4I A;  3FHN A;  1ETX A;  4ZYD A;  2QGU A;  3DP7 A;  1F5T A;  4L5J A;  2IJL A;  1ZG1 A;  4C2M J;  1EH7 A;  3A01 B;  3OR2 C;  1YIT I;  1JJ8 C;  3TMO A;  3PUB A;  1Z77 A;  3WTW C;  3SJM A;  3D1N I;  2QSG X;  1WKM A;  3FHZ A;  1Z1D A;  1JUS A;  2DT5 A;  2JN6 A;  4CHU A;  2MFZ A;  2E35 A;  1NG7 A;  1N77 A;  1U2W A;  3KZI C;  2ZO4 A;  3OYH A;  5GPC A;  1RES A;  2XB0 X;  5FO5 A;  3JRF A;  2IS1 A;  1IN7 A;  1S8N A;  3PO2 J;  4HBL A;  5FRN A;  3H35 A;  3OR1 C;  3QWL A;  1OKR A;  2XC7 A;  1REP C;  4BNC A;  3GZN B;  1D0Y A;  5D4S A;  3VYR B;  1X19 A;  2QEN A;  2VBX A;  1R58 A;  4ESB A;  1SAX A;  1SFX A;  3W6K B;  5D8K B;  3BT9 A;  3S17 J;  2CSO A;  3LSK A;  2O8X A;  3KEY A;  5GTH C;  5IOY A;  4QSH A;  4G6Q A;  2OD5 A;  1XN7 A;  4DBR A;  3E97 A;  4DNC A;  1A6Q A;  1PP7 U;  4C3J J;  2VT3 A;  2DOD A;  2EIK H;  4M6Y A;  2IBD A;  2CUF A;  1OQY A;  2WB1 A;  1F1Z A;  3PIO F;  2A68 F;  4HV5 A;  1WH7 A;  4BGD A;  1D8J A;  1UHM A;  3K10 A;  4D5C A;  2VXD A;  5EGO A;  3GTP J;  2IA2 A;  1VQM I;  3DXJ F;  3HB9 A;  4KIB A;  4I99 C;  1ON2 A;  3BCB A;  3ERE D;  2CWE A;  2XRN A;  2E19 A;  2RQP A;  2DYR H;  2X6W A;  4ENN A;  1OIS A;  1K7A A;  3SQN A;  3WTV C;  2Z3Y A;  3VDX A;  4BY1 J;  3LSR A;  1T56 A;  2PFB A;  1OCT C;  3I4M J;  1MMN A;  3TP3 A;  3VOD A;  3CMA I;  2QQ8 A;  3DPT A;  3QAH A;  1FP1 D;  3M4O J;  2E1M B;  3L2Q A;  3CJQ B;  2XGC A;  3LAP A;  4HYE A;  2MH9 A;  2YSR A;  1RIO H;  2ETH A;  1RET A;  4A3C J;  2DI3 A;  3S32 A;  4PZJ A;  2CQN A;  2B0L A;  5JVG F;  2CU7 A;  3QYB A;  4Y15 A;  5LGU A;  4MO7 A;  3H0D A;  1W4M A;  2HQR A;  2ELK A;  4G8X A;  5B1A H;  4HQM A;  2YU3 A;  2NVU B;  4MLO A;  1RRJ A;  3TL4 X;  3LQQ A;  2ISY A;  5DYM A;  5FLX K;  2J5P A;  4DZJ A;  1XGN A;  2EFQ A;  2HI3 A;  1WFX A;  3MMY B;  4RLQ A;  4UV8 A;  3ESW B;  4G9Y A;  4HNT A;  1IUY A;  2HYF A;  5B3S H;  1FMV A;  1USS A;  2RNG A;  4XKC A;  1ZLK A;  3TW6 A;  1NK3 P;  3DPU A;  2JA7 J;  2X1D A;  4WWC A;  2NS8 A;  3C2G A;  5FJ8 J;  2H8W A;  4ENM A;  3PNY A;  2YPR A;  1V5G A;  3T5X A;  1WWX A;  5CQE A;  4YII A;  1P4X A;  1JGS A;  3P7N A;  4UV9 A;  3JCU C;  5C3E J;  3FMS A;  2JJ7 A;  2GLO A;  2KJC A;  3FBN B;  5CJ9 A;  2NRA C;  4PDK A;  2O61 A;  4E6K G;  5J1U A;  1NG6 A;  2JVH A;  1ZGJ A;  3KEQ A;  4HF2 A;  2IP2 A;  3E5U A;  3VWB A;  3GTQ J;  4ZDL A;  4FX0 A;  4PJJ A;  1T38 A;  5GAD J;  1YQA A;  1KU2 A;  1Q1V A;  2KT0 A;  3Q3S A;  3HOZ J;  2UZK A;  2FE3 A;  4BXF A;  3BZK A;  4BHC A;  3ZPL A;  2R0Q C;  5C4J J;  3FK6 A;  5E8I A;  2A05 A;  2W57 A;  2O9L A;  4IHV A;  1FC3 A;  2EJR A;  3CP2 A;  4OAY A;  2IPQ X;  2M7A A;  2RN7 A;  3RKW A;  4O5V A;  1IXC A;  1WJ5 A;  2MLK A;  3PQK A;  1Z6R A;  2E2J J;  4IO9 F;  4LMY A;  3CC7 I;  4M73 A;  1S5L C;  1UHW A;  2ZFU A;  3V42 A;  4E4H A;  5ILU A;  1JUP A;  1ODD A;  1VQ5 I;  2HTJ A;  3CCV I;  1BA5 A;  4FTH A;  4CGZ A;  1T33 A;  3NWS A;  3BTI A;  3VYS B;  2NOJ B;  2RDP A;  3HL2 A;  4FX4 A;  3ZN0 A;  1SAN A;  3KYL A;  5K7H A;  5E1Z B;  2V1X A;  2E60 A;  1JGG A;  4IKF A;  1IRZ A;  2WWY A;  1J09 A;  1NHA A;  2XF5 A;  3M8J A;  5IYC J;  2W00 A;  5A2Q K;  1XCV A;  4EMS A;  4JBA A;  2KIF A;  3S93 A;  4LOC A;  3W3C A;  3LL7 A;  1IAW A;  4FIS A;  2OQG A;  3C18 A;  3NAU A;  1XMK A;  4E7I A;  3GZ5 A;  3KZZ A;  1C0W A;  1VQL I;  1UG0 A;  3OS2 A;  2VOD A;  1EV7 A;  2JPB A;  3B6A A;  2DFI A;  3WTY C;  2ZJR F;  2V6C A;  4MGR A;  1BJA A;  4Y17 A;  5ILV A;  1IXS B;  4J01 A;  1OMI A;  2A69 F;  4QPQ A;  1N75 A;  2K85 A;  5F04 A;  1JT6 A;  2EBI A;  3I3L A;  3MKW B;  3HBL A;  1UB9 A;  4DQ2 A;  4M6X A;  2CUZ A;  2F5E A;  3M1E A;  3OOU A;  1RR7 A;  3WTX C;  4I6Z A;  1DPR A;  2O0Y A;  1VQK I;  4UY8 I;  2OBP A;  5KAF C;  1YRN A;  4Y3O A;  3V7C A;  2PMU A;  2W4S A;  1OFC X;  4P1W A;  3SFZ A;  1BI0 A;  1K4S A;  3L2V A;  2LKS A;  3OYJ A;  1ZN2 A;  3BPV A;  3TOA A;  2M5W A;  3FMQ A;  4AVZ A;  1YX5 A;  4UXN A;  2YR2 A;  3LSP A;  2L9S A;  4FE7 A;  3ZGK A;  2NNY A;  1YW8 A;  3GTO J;  4S05 A;  1PP8 F;  2VC0 A;  5F1J A;  2DDA A;  1TWC J;  2K4J A;  2PX9 A;  3X2Q H;  1O3S A;  3O8H A;  2DMU A;  1SD7 A;  2X6X A;  3IL2 A;  1NH3 A;  3BC8 A;  1MSF C;  3HOS A;  2L5Q A;  4P5O A;  5CPR B;  5KHD A;  4XN0 A;  3T0Y A;  4FET A;  3CC2 I;  2NVT J;  4DJA A;  2DA7 A;  2OTL I;  2KZG A;  2E7X A;  4EV0 A;  4O6J A;  1P4A A;  4L0Y B;  2JRT A;  1QU3 A;  4M3G A;  1LB2 A;  5M3M J;  4LG0 A;  1QPM A;  4D5F A;  5J4V A;  5JHF A;  1K83 J;  2M9H A;  1JJ6 C;  4KNY A;  4EM1 A;  3HOW J;  1Z05 A;  1GXQ A;  2P5K A;  4P96 A;  5IT9 K;  3IH2 A;  3V8L A;  1ZRF A;  5ED4 A;  1Y39 A;  1R49 A;  3BR3 A;  2P81 A;  3ZQC A;  2F6C A;  4FQG A;  4NC6 A;  3QP5 A;  2LY1 A;  2IGK A;  1FWZ A;  3KET A;  3PFI A;  3OYM A;  2QQ9 A;  2JWT A;  2W25 A;  2UUZ A;  3S14 J;  5IP6 A;  2R7Q A;  4M9S A;  4RBO A;  2LG4 A;  1U78 A;  1KYW A;  4A3B J;  4AIH A;  2LP0 A;  2ME6 A;  1VZ0 A;  4NQW A;  3C7J A;  2XSJ C;  3U2R A;  5HDK A;  4FT8 A;  2IA0 A;  1UCR A;  2KP6 A;  2ZXW H;  3OYK A;  2DJI A;  3R0A A;  4PJM A;  1ZKG A;  3IH4 A;  4A0Z A;  2CGP A;  3CME I;  5JLW A;  3IAM 2;  4OIR F;  2MBF A;  2K3F A;  1BOB A;  2Z9O A;  2HOT A;  2DW4 A;  3I59 A;  3E6C C;  1FZP B;  1U6G A;  4LLN A;  2DAO A;  1E3H A;  1XMA A;  2DMQ A;  2GOX B;  2RAE A;  1OCC H;  2IS6 A;  3G6E I;  3GEZ A;  2L4M A;  2NS7 A;  5DS9 A;  1JI8 A;  1OR7 C;  3IAS 2;  1OJL A;  4Y52 J;  1U3E M;  1TTY A;  2XRO A;  4ZH4 F;  3RZD J;  1GT0 C;  3I5U A;  1RR8 C;  4YEL A;  4B3A A;  2CUE A;  2DTZ A;  4ESF A;  5H2F C;  2AHQ A;  3E3V A;  3RIR A;  2HOE A;  2WY7 Q;  2EQR A;  4PSW A;  4A0X A;  4XOP A;  1QHH D;  4YEJ A;  2DT6 A;  5F08 A;  1R1U A;  4EQQ A;  4B47 A;  5D5V B;  1ZYR F;  4Z6Y A;  2Q2E B;  2L7Z A;  2VL8 A;  3F21 A;  1G3T A;  3ECO A;  3IH3 A;  5CVJ A;  2M2E A;  4IL6 C;  3EUH A;  4E7Z A;  3M8E A;  3O3K A;  1X58 A;  3I59 B;  2DXI A;  1X1P A;  2XVC A;  2F5D A;  3A4C A;  2MH2 A;  3H5R A;  4PFO A;  1BM9 A;  4KIC A;  1IZ1 A;  4BJ5 C;  2OCC H;  4WX9 A;  2L01 A;  2M30 A;  3UKG A;  1UHS A;  1Z6T A;  2HFH A;  1I27 A;  1S3J A;  1YX3 A;  2PMH A;  1O3R A;  4KIF A;  2NXN B;  4UB8 C;  3F9K A;  3F0C A;  5DUI A;  4KIS A;  3RZO J;  2LRE A;  4KIT B;  4MEX F;  4KIG A;  1ENH A;  3KPH A;  1ZAR A;  3QPS A;  2A5Y B;  3GBG A;  4X0G A;  3NRV A;  1D0X A;  1X3W B;  4MTD A;  3K2A A;  4EM0 B;  4XOT A;  4GYI A;  3EET A;  4XM3 A;  2C6Y A;  3GME A;  4UVC A;  4EJW A;  2CMP A;  4F55 A;  2OAZ A;  5LEJ A;  3RKX A;  2QEX I;  1TZL A;  3H0G J;  1VQN I;  3GFJ A;  2HOS A;  1VQ6 I;  4ASN A;  2GZW A;  2W24 A;  5LRS A;  1TT5 B;  4D7M A;  3HIF A;  1G8X A;  4XKV A;  2UXN A;  1STZ A;  2DYS H;  1S7O A;  1E3O C;  2OU2 A;  4HDU A;  5TIS C;  1DDN A;  4G7H F;  4KMF A;  1ZAO A;  1ZG3 A;  1AOY A;  1UG2 A;  1VI0 A;  3GW2 A;  3J81 Z;  3MD2 A;  4G6T B;  3CLO A;  2DFE A;  4W1U A;  4F92 B;  2BZT A;  3MN2 A;  3P5J A;  4YFN F;  3S2H J;  2FUG 2;  1YYV A;  1ZLJ A;  5K7Z A;  3I54 A;  2A61 A;  4HQE A;  1W5C C;  3WHB A;  2PJR B;  3DKY A;  1XSX A;  2H6C A;  3RQI A;  1FNN A;  4M3E A;  1UAA A;  3GO5 A;  3G71 I;  4BAC A;  3MKL A;  4NQW B;  3Q9S A;  4AID A;  1MKM A;  3F8F A;  1T0F C;  3HOY J;  2ZKZ A;  4DGW B;  4ABZ A;  1MD0 A;  5K5R A;  2Z2S B;  3EQL F;  1R23 A;  3ELK A;  3D5L A;  4OMY A;  4XLA A;  4WCG A;  2W48 A;  4XNF A;  2FRH A;  3DLA A;  4TV7 A;  3L2U A;  2JSC A;  1TNT A;  3OYL A;  1HBX G;  4ZTJ A;  1FX7 A;  2WC2 A;  3BZC A;  3OIQ A;  2PEX A;  2QWW A;  2N8G A;  5FRM A;  2VT2 A;  5ICG A;  1V5F A;  3O6B B;  1JHF A;  2EPF A;  4CA0 A;  2DTR A;  5FKM A;  2V9P A;  3L7W A;  3FZV A;  5EG0 A;  1TC3 C;  1MJA A;  5IYD J;  1VFC A;  1VTN C;  1ORK A;  4AM3 A;  3WE3 A;  1H89 C;  2TDX A;  3UR3 C;  3IWF A;  3DTI A;  3TO6 A;  4NBQ A;  4ZYE A;  2L2O A;  5LHG A;  1EH8 A;  3QU3 A;  5DM7 F;  3MQ0 A;  4GXO A;  3QPT A;  3U21 A;  3W6J B;  1FBS A;  4RDU A;  4XKW A;  2YS9 A;  1ZRE A;  5CVR A;  4XBF A;  3LFU A;  1MNE A;  2R7S A;  3WU2 C;  5DD4 A;  2X48 A;  5C4X J;  5IT9 Z;  1VQ7 I;  2DA5 A;  2ZBK A;  2KIU A;  4A12 A;  1WGX A;  5E1X A;  1MBF A;  2AO9 A;  4XSZ F;  4V2F A;  4M9X A;  5H20 A;  1YRN B;  1Y0U A;  4GGG A;  3H3Z A;  2DBB A;  1EH6 A;  2ELJ A;  1Y8Q B;  1LNW A;  3NEU A;  4BE2 A;  3HDD A;  3RSN A;  4XN3 A;  3K4B A;  2KZV A;  4ANJ A;  1JXS A;  3LWF A;  4HOB A;  3SDG A;  3RYR A;  2DMN A;  3ML6 A;  3GZ6 A;  1O3Q A;  2VN2 A;  2VB6 A;  2KRH A;  2Z99 A;  2ZJ2 A;  2VKE A;  3IRR A;  4B48 A;  2EWN A;  2FX0 A;  3HRS A;  1DGW Y;  3NAR A;  2VUM J;  1J2X A;  3J7Z I;  4ZYA A;  3VB2 A;  5J47 A;  4BXX J;  3HXL A;  2P5L C;  2HS5 A;  3ZR8 X;  4C2T A;  3HRU A;  4BKX A;  3K70 D;  1Z3X A;  2IGO A;  3BR1 A;  5ICC A;  1J59 A;  2DO7 A;  1FOW A;  4KFC A;  4L9T A;  2E1C A;  3OS0 A;  3I55 I;  3KE2 A;  3Q0W A;  3Q0U A;  5AIP A;  3OYE A;  2F5C A;  3E5Q A;  4RM2 A;  1RUN A;  2BY0 A;  1B9N A;  5CVU A;  4DBQ A;  1B8I A;  5J40 A;  4Q5S F;  4IEJ A;  4IRH A;  4CCL A;  2FQ4 A;  1MND A;  4CH7 A;  5F0C A;  5K5Q A;  3J7A Y;  2AQF A;  1R6R A;  2IS2 A;  4U88 A;  2ZNZ A;  5KK1 A;  4OIP F;  4AIJ A;  3E7L A;  1ZRC A;  2HVS A;  4ZYG A;  1SFE A;  2Y69 H;  3CUO A;  1ON1 A;  5JFR A;  4A3D J;  4IHT A;  1D1B A;  3L9F A;  2F4M B;  2L9R A;  2OCE A;  3D5R C;  5B1B H;  2PJP A;  2EV5 A;  1S7E A;  2HWV A;  4LB6 B;  3CD6 I;  4M74 A;  5FFZ A;  2CQX A;  5F0F A;  4RB3 C;  1MBK A;  1JTY A;  4FCY A;  3QU6 A;  5FB2 A;  2EIN H;  1BIB A;  4I02 A;  3H9J A;  1I6H J;  3FM3 A;  1BI1 A;  2PN6 A;  2Q1Z B;  4HZF A;  1LE8 A;  1DQU A;  1MZB A;  3FM5 A;  1V5E A;  3OYN A;  2D5V A;  5HDG A;  3HSE A;  2B9S A;  1F9N A;  3ERM A;  2R93 J;  1OCZ H;  3KLO A;  1XSD A;  2H8R A;  3RQ4 A;  2EIL H;  3V8J A;  4BXU A;  4ZZD A;  4A5M A;  4JOM A;  1BW6 A;  1P7I A;  1U5T B;  1XTA A;  1OYY A;  4AYB N; 
#chains in the Genus database with same CATH homology
 2VXZ A;  2GA2 A;  2P6S A;  3TO9 A;  2CG4 A;  1T39 A;  3JSO A;  3LST A;  4I98 B;  2RGV A;  3LA7 A;  2RNJ A;  1HSJ A;  2DQL A;  3IC7 A;  3G3Z A;  5HS8 A;  3V4G A;  3U9G A;  3H3U A;  3I64 A;  4M9Z A;  2STW A;  4OOI A;  1R1V A;  3H92 A;  1SD4 A;  1BOA A;  3MWM A;  1FSH A;  4HW0 A;  1FOK A;  4OMZ A;  1TLH B;  4RAY A;  5BPI A;  1B6A A;  2D45 A;  3FWE A;  3DFG A;  3U1D A;  3M7G A;  3COA C;  5AIQ A;  1IXR C;  1XDU A;  4GCV A;  1QQI A;  2X0L A;  2Y0M A;  5HLH A;  3B73 A;  1K79 A;  2EV6 A;  1FLI A;  4A6D A;  3HYI A;  4QWQ A;  5ICF A;  1HW2 A;  3BP8 A;  2FU4 A;  1O57 A;  3CTA A;  5D8L B;  4AWX B;  3HRT A;  2HDC A;  3BJA A;  1YG2 A;  2RVC A;  4BQA A;  2XKP A;  4I09 A;  4YFX F;  2DPU A;  3K1M A;  2QYO A;  5LGN A;  1XDS A;  3BOQ A;  4RGR A;  1MDM B;  1BI3 A;  5LGT A;  4OIO F;  3M9A A;  1Z9C A;  2DLL A;  4RGS A;  5J6X A;  2EA2 A;  3K0L A;  2BGC A;  3RI4 A;  2O6G E;  3GUD A;  2JT1 A;  3DKW A;  4ON0 A;  3J80 Z;  2KKO A;  3BRO A;  2LF8 A;  4RGU A;  2GQQ A;  5E17 F;  3FMR A;  2GAU A;  1XCB A;  5CYV A;  1BIA A;  2FNA A;  2M8E A;  3CDH A;  1J5Y A;  5HS9 A;  3GWZ A;  2EA4 A;  4XLN F;  2K7L A;  2R7D A;  2ISZ A;  1FYK A;  1I1S A;  3CO6 C;  4P9F A;  3K2Z A;  3V8K A;  5K5O A;  3PQJ A;  4XRF A;  4L9V A;  1WRJ A;  4LK0 F;  3N4M A;  1IN4 A;  2ZCW A;  2PI0 A;  6PAX A;  1L3L A;  1HQC A;  1R1T A;  1O7L A;  4AIK A;  2ADU A;  4EVI A;  1V4R A;  2FXA A;  2EK5 A;  3EDP A;  4EJV A;  2FNP A;  4HX8 A;  4HA8 A;  4EGY A;  2ZXJ A;  1D3Y A;  2ZME B;  1ONV A;  1GXP A;  4PGG A;  2ESN A;  4HDV A;  3BJ6 A;  2EFO A;  4L0Z B;  2EFW A;  5LLQ A;  1LEB A;  3F8B A;  2DU9 A;  4BAY A;  2XAF A;  1YS7 A;  1HW5 A;  2H27 A;  3EYY A;  1MGT A;  4H0E A;  1E2X A;  3AAF A;  1QO0 D;  2KJB A;  5L3F A;  2W85 A;  3ZMD A;  1D8K A;  2XAG A;  4KDP A;  4Q48 A;  1T2K A;  4R79 A;  1BI2 A;  4N0B A;  2A07 F;  3KCC A;  1CF7 A;  4RS8 A;  3C3W A;  3R0J A;  3V7R A;  2E1N A;  1FBU A;  2NYX A;  5J8F A;  3HRM A;  5E8G A;  3JSP A;  4NHJ A;  1R5H A;  5TRD A;  2P7C B;  3CO7 C;  2F2E A;  2YX4 A;  3TDU C;  1OPC A;  1KQ0 A;  4G6D A;  1RUO A;  2VE8 A;  1QZY A;  3ZP5 A;  2XAS A;  3ABT A;  1DPU A;  3ROU A;  1D5V A;  3TDZ C;  2F5F A;  2K4B A;  2IVM A;  2L54 A;  4PGH A;  1LJ9 A;  2R7F A;  2ESH A;  5BOX A;  2BE5 F;  3I0T A;  3ZMZ A;  4MNU A;  2XHK A;  2DPD A;  5FGM A;  4YFK F;  1XGS A;  2Q8K A;  2W84 A;  1J0R A;  3ECH A;  1MJB A;  3TOB A;  4KA4 A;  3HOT A;  5FFX A;  5DDG A;  4IHS A;  3J7A O;  4IVN A;  3IWZ A;  3VOE A;  2CW0 F;  4RGX A;  1R00 A;  3E6M A;  1TQM A;  3SZT A;  1SMT A;  1BBY A;  2O3F A;  2P7V B;  1W7P A;  2HYG D;  2P8T A;  3GLX A;  5ERI A;  4EM2 A;  2A3S A;  4A0Y A;  1U5T C;  1T98 A;  1XSV A;  2V9V A;  3C1D A;  1ZRD A;  2LF7 A;  2K02 A;  1YTY A;  4GO1 A;  3F72 A;  2LKP A;  5H6R A;  2HKO A;  1B4A A;  3KP6 A;  1TW3 A;  2HKX A;  1KGS A;  4EJO A;  4RB1 A;  1U8R A;  2H09 A;  4BHB A;  2EFP A;  3ZN1 A;  4I01 A;  2UWM A;  2GA1 A;  2NNN A;  4G7Z F;  3IHU A;  3GXO A;  2EB7 A;  3P9I A;  5EEH A;  4WK8 F;  4R8H A;  2FML A;  4O3M A;  4CO8 A;  2M1B A;  2JTV A;  4RB2 C;  3ZMT A;  1Q1H A;  1B9M A;  2XAH A;  3WGI A;  4KT5 C;  1P6R A;  3DPL C;  1PDN C;  1DP7 P;  3QPH A;  5HLG A;  1HKS A;  2FQ3 A;  2BEO A;  3BDD A;  2FA5 A;  4JQF A;  1TBX A;  3CUQ A;  1QZZ A;  2HR3 A;  3JW4 A;  4N9H A;  3K69 A;  2BV6 A;  1CGP A;  4HAM A;  4YIF A;  2L02 A;  2XGX A;  4HX7 A;  2MA3 A;  1JHH A;  1WI9 A;  3GFL A;  4Q47 A;  1SFU A;  5BQT A;  3KP5 A;  2STT A;  1LDD A;  2DQR A;  1MJ9 A;  5AON A;  3TKY A;  3MZY A;  2AXL A;  4I0B A;  3JTG A;  1G6N A;  1OYW A;  1KA8 A;  1IW7 F;  5HOO A;  3FXU A;  3RPU A;  5DV5 A;  3KP7 A;  1W5T A;  3JAM Z;  5LHH A;  1FYM A;  3F8M A;  1G3W A;  2A6H F;  1TW2 A;  2IRF G;  3TGN A;  3P9K A;  1KU3 A;  3TO7 A;  2CYY A;  2XUB A;  5D5W B;  1I5Z A;  5LBQ A;  4OU0 A;  3FXQ A;  2R3S A;  3B02 A;  3F8C A;  3WGG A;  3RDI A;  1YW9 A;  3F22 A;  2EFN A;  3BZ6 A;  1JE8 A;  1K78 B;  1KQ9 A;  3F3X A;  5ILS A;  1YLF A;  4CXF A;  3J80 K;  3R6S A;  3P9C A;  2VE9 A;  1I1G A;  2L3D A;  3GYH X;  3K1P A;  2Q0O A;  4HF1 A;  5F6F A;  1FT9 A;  5LHI A;  5D5X B;  2COM A;  2O03 A;  4A5N A;  4ENJ A;  4UHT A;  4HV6 A;  1XB4 A;  4LK1 F;  1FYL A;  1OR7 A;  2LSO A;  1V3F A;  3R4K A;  2G9W A;  3I53 A;  4UVA A;  3CJN A;  2LNB A;  1QNT A;  2XIG A;  2CQK A;  3FX3 A;  5LRR A;  4U0Y A;  2RC4 A;  3M8F A;  3DV8 A;  2V1U A;  5DCM B;  4HLY A;  2OZ6 A;  3OV8 A;  4M72 A;  5BPD A;  3ZMS A;  1YO5 C;  3VEP A;  4WXH A;  1DUX C;  5E1W A;  3WGH A;  3DQV C;  2M87 A;  1TNS A;  3BY6 A;  3T8T A;  2HZT A;  2QM3 A;  2P6T A;  4JK1 X;  4B8X A;  3FF5 A;  1J7K A;  3D0S A;  1A04 A;  1YW7 A;  2FMY A;  4L9J A;  1W7P B;  1XD7 A;  1L0O C;  4XSX F;  5HVQ C;  2VBY A;  3KLN A;  4BYY A;  3SZP A;  1R36 A;  4LLL A;  1B1B A;  3DEU A;  2M45 A;  3KP3 A;  5E18 F;  2XAQ A;  4E70 A;  4ZYH A;  1QBJ A;  2UXX A;  1KU9 A;  5D4R A;  4G94 A;  2P5V A;  2K27 A;  3BPX A;  1SD6 A;  3KP4 A;  1R5G A;  1UST A;  2D1V A;  5JI6 A;  1HKT A;  4GYG A;  2QZ8 A;  4EJT A;  3KEO A;  4IJA A;  5L3C A;  3MAJ A;  4L18 B;  2PQ8 A;  3Q9V A;  4EJU A;  3GX4 X;  3LFK A;  4OIQ F;  1P4W A;  2FBH A;  3MEX A;  2VOP A;  1G3S A;  4BH9 A;  2A6E F;  1S7A A;  3HHG A;  2QLZ A;  2YX7 A;  1HW1 A;  5D6E A;  4NB5 A;  3IKT A;  3HTS B;  1FSE A;  4AVP A;  2BBY A;  3MFK A;  1U5T A;  3RPQ A;  2GXB A;  2OA4 A;  1LEA A;  5A2Q Z;  4U0W A;  1TQP A;  2XV4 S;  3CUQ B;  3QOP A;  4R1H A;  1FP2 A;  5FD6 A;  1YIO A;  2FF4 A;  3K9T A;  3ULQ B;  1FPQ A;  3VFZ A;  3JTH A;  1P92 A;  5HS7 A;  4Q4Z F;  1RI7 A;  1LDK B;  4MHG A;  2PG4 A;  3F6V A;  4IF4 A;  1PUE E;  3E6D A;  5H6Q A;  1RNL A;  4BHP A;  2H6B A;  3LA3 A;  4ETS A;  3SXY A;  2CFX A;  1S29 A;  2D2W A;  3L00 A;  1GVJ A;  4IRI A;  3WU1 B;  3NQO A;  2BYV E;  3KFW X;  1J9I A;  5DCM A;  1W5S A;  4Z2Y A;  2HQN A;  4L9N A;  3MCZ A;  3EYI A;  3RYP A;  3GF2 A;  4N9I A;  2J5O A;  4P55 A;  3F6O A;  3ISP A;  4K2E A;  2Y48 A;  4MEY F;  5CLS A;  3T8R A;  1HXD A;  4LB5 A;  1WSU A;  3WOD F;  4LD5 A;  3I58 A;  1IF1 A;  3KZY A;  2V79 A;  4B09 A;  4ESJ A;  2FOK A;  3WTZ A;  2IA1 A;  2VON A;  3WTS C;  3LQR A;  4HF0 A;  4G7O F;  2H94 A;  1FY7 A;  4U7D A;  4FHT A;  1O3T A;  3FXR A;  3R60 A;  4KUM A;  3E6B A;  2JPC A;  5EEG A;  4LGW A;  1IRG A;  2OQR A;  1BN5 A;  2FEZ A;  2MD5 A;  1Z91 A;  3J81 K;  2HEO A;  1ZGA A;  1ZHF A;  2MC3 A;  1YS6 A;  1OYI A;  4IRG A;  4ENK A;  1CF7 B;  5LEK A;  1ZH5 A;  5DD8 A;  3E5X A;  1BC8 C;  4RB0 A;  1K78 A;  1H9G A;  3WTU C;  2P4W A;  3G73 A;  4UUV A;  3N97 A;  1G3Y A;  5BS6 A;  3IKV A;  3ABU A;  4OIN F;  2FBI A;  3ZMU A;  2RKH A;  1H9T A;  4M71 A;  3HHH A;  4QLC U;  2Q2E A;  2D1H A;  3HSF A;  2FSW A;  3R61 A;  3QP6 A;  4UVB A;  3RKY A;  1I6X A;  1XGO A;  3T1B A;  2G7H A;  4I7H A;  2E7W A;  3JAM K;  2QBY A;  1T0F A;  3BWG A;  1B59 A;  2HTS A;  3REO A;  3TQN A;  4U7B A;  3HSR A;  4EGZ A;  1H0M A;  1W7P D;  4RAZ A;  1F4K A;  5FLX Z;  4HLX A;  4LJZ F;  4LFU A;  5F1R A;  3K1N A;  2NS0 A;  5D6F A;  1ULY A;  5DUK A;  2ELH A;  1R7J A;  3GFI A;  2X4H A;  4ZZL A;  5HDN A;  4I0A A;  5F64 A;  4A2U A;  1X3U A;  5K1Y A;  3L09 A;  3V7S A;  4CYD A;  5DCF A;  3CUQ C;  5CVV A;  1E17 A;  5E20 A;  3WG9 A;  4IXA A;  2ACJ A;  3F23 A;  1KQ8 A;  1GHC A;  2V1D A;  1IRF A;  1K6O A;  2PLY A;  3ZQ7 A;  2QVO A;  3O2P E;  2MLG A;  2EV0 A;  1S6L A;  2Z33 A;  4I2O A;  3I4P A;  5L3B A;  4MTE A;  4IPA A;  3HTU A;  2LDU A;  2AS5 F;  3L2C A;  2WV0 A;  4L5I A;  2FBK A;  3I71 A;  5JHU A;  5JR3 A;  2QQB A;  2KIM A;  1LDJ A;  5DEQ A;  1YFH A;  4LLG F;  2ZNY A;  2L4A A;  1Z7U A;  3BJO A;  1FBQ A;  1AWC A;  4P9U A;  4A6E A;  2QBY B;  3IRQ A;  1SMY F;  2GIV A;  4YG2 F;  1IN6 A;  2QUF A;  1IN8 A;  4CZZ A;  1LVA A;  2XAJ A;  1WQ2 A;  4CIC A;  4WXC A;  2Y75 A;  4HX4 A;  4MQ9 F;  1XGM A;  2DK8 A;  5TJJ A;  3GVA A;  3GFM A;  5KVR A;  4S04 A;  2IT0 A;  5HLI A;  2VC1 A;  4KN7 X;  3QRF F;  1J75 A;  4KYW A;  2RV8 A;  4D0P A;  3S2W A;  2GWR A;  5D5U B;  1R22 A;  3RJP A;  5IT3 A;  3MZH A;  5JVT A;  4WF2 A;  1HKQ A;  4WXD A;  2GXG A;  3WE2 A;  2VBZ A;  2Z5U A;  1UFM A;  2OZU A;  2XKO A;  3WTT C;  3KP2 A;  3WU0 A;  1LQ1 A;  2HGC A;  3SHF A;  1G4D A;  2KRF A;  4CDG A;  2PBI A;  2IW5 A;  3LA2 A;  1RZ4 A;  3F8N A;  5ICE A;  5CVI A;  1IN5 A;  4Y13 A;  2CO5 A;  1KYZ A;  3DF8 A;  2VBW A;  2QQA A;  2JZY A;  5BMZ A;  3ZMV A;  1QGP A;  2WTE A;  2G7U A;  2NAZ A;  1TQI A;  4KN4 X;  5J8C A;  4F7Z A;  1BC7 C;  1O7F A;  4PCQ A;  3Q5F A;  2K86 A;  4XLP F;  5FD5 A;  1MDM A;  2DK5 A;  4UNO A;  4U0V A;  4KMU X;  1ZG5 A;  4LG0 B;  2ZME A;  4AD9 A;  1HST A;  5L3E A;  5L3D A;  4MQV A;  3LAJ A;  3OOP A;  5L3G A;  1P2F A;  2VOO A;  1T6S A;  1SD5 A;  1KU7 A;  3RTR A;  3HUG A;  2ZFW A;  4ZYD A;  3DP7 A;  1F5T A;  4L5J A;  2IJL A;  1ZG1 A;  1EH7 A;  3WTW C;  1WKM A;  3FHZ A;  1Z1D A;  2DT5 A;  4CHU A;  1U2W A;  2ZO4 A;  5FO5 A;  1IN7 A;  1S8N A;  4HBL A;  1OKR A;  1REP C;  4BNC A;  5D4S A;  2QEN A;  2VBX A;  1R58 A;  4ESB A;  1SAX A;  1SFX A;  3W6K B;  5D8K B;  2CSO A;  2O8X A;  4G6Q A;  2OD5 A;  1XN7 A;  3E97 A;  4DNC A;  1PP7 U;  2VT3 A;  4M6Y A;  1F1Z A;  2A68 F;  4HV5 A;  1D8J A;  1UHM A;  2IA2 A;  3DXJ F;  4KIB A;  1ON2 A;  3ERE D;  2CWE A;  2XRN A;  2RQP A;  1K7A A;  4ENN A;  3SQN A;  3WTV C;  2Z3Y A;  2PFB A;  3VOD A;  3DPT A;  3QAH A;  1FP1 D;  3LAP A;  4HYE A;  2MH9 A;  2YSR A;  1RIO H;  2ETH A;  2DI3 A;  4PZJ A;  2B0L A;  4Y15 A;  5LGU A;  1W4M A;  2HQR A;  4G8X A;  4HQM A;  2YU3 A;  3LQQ A;  2ISY A;  5DYM A;  5FLX K;  2J5P A;  1XGN A;  2EFQ A;  4UV8 A;  1IUY A;  4G9Y A;  2HYF A;  1ZLK A;  1USS A;  4WWC A;  4ENM A;  2YPR A;  3T5X A;  1WWX A;  4YII A;  1P4X A;  1JGS A;  3P7N A;  4UV9 A;  3FMS A;  2KJC A;  5CJ9 A;  2NRA C;  4PDK A;  2O61 A;  1ZGJ A;  3KEQ A;  4HF2 A;  2IP2 A;  3E5U A;  4FX0 A;  1T38 A;  1YQA A;  1KU2 A;  2UZK A;  2FE3 A;  3ZPL A;  4BHC A;  5E8I A;  2W57 A;  1FC3 A;  2EJR A;  2IPQ X;  2RN7 A;  3RKW A;  4O5V A;  1IXC A;  3PQK A;  2MLK A;  1Z6R A;  4LMY A;  4M73 A;  1UHW A;  5ILU A;  1ODD A;  2HTJ A;  4CGZ A;  2RDP A;  4FX4 A;  3ZN0 A;  5E1Z B;  2V1X A;  2WWY A;  1NHA A;  5A2Q K;  1XCV A;  4EMS A;  4JBA A;  2KIF A;  1IAW A;  2OQG A;  3C18 A;  1XMK A;  3GZ5 A;  3KZZ A;  1C0W A;  2VOD A;  1EV7 A;  2JPB A;  2DFI A;  3WTY C;  2V6C A;  4MGR A;  1BJA A;  4Y17 A;  5ILV A;  1IXS B;  1OMI A;  2A69 F;  1UB9 A;  4DQ2 A;  4M6X A;  2F5E A;  3M1E A;  3WTX C;  1DPR A;  2O0Y A;  2OBP A;  3V7C A;  2PMU A;  3SFZ A;  1BI0 A;  1ZN2 A;  3BPV A;  3TOA A;  2M5W A;  3FMQ A;  4UXN A;  2YR2 A;  2NNY A;  1YW8 A;  4S05 A;  1PP8 F;  2VC0 A;  2K4J A;  1O3S A;  1SD7 A;  3IL2 A;  3HOS A;  4P5O A;  3T0Y A;  2E7X A;  4EV0 A;  4O6J A;  1P4A A;  4L0Y B;  2JRT A;  1LB2 A;  4LG0 A;  1QPM A;  4KNY A;  4EM1 A;  1Z05 A;  1GXQ A;  2P5K A;  4P96 A;  5IT9 K;  3V8L A;  1ZRF A;  5ED4 A;  3QP5 A;  1FWZ A;  3KET A;  3PFI A;  2QQ9 A;  2W25 A;  4M9S A;  1U78 A;  1KYW A;  4AIH A;  4NQW A;  3C7J A;  3U2R A;  5HDK A;  4FT8 A;  2IA0 A;  1UCR A;  3R0A A;  2CGP A;  4A0Z A;  4OIR F;  2MBF A;  2Z9O A;  2DW4 A;  3I59 A;  3E6C C;  1FZP B;  1U6G A;  4LLN A;  2DAO A;  1XMA A;  3GEZ A;  2L4M A;  1U3E M;  1TTY A;  2XRO A;  4ZH4 F;  3I5U A;  4ESF A;  3E3V A;  3RIR A;  2HOE A;  4A0X A;  4EQQ A;  1R1U A;  5D5V B;  1ZYR F;  3F21 A;  1G3T A;  3ECO A;  5CVJ A;  3EUH A;  3M8E A;  3O3K A;  3I59 B;  2XVC A;  2F5D A;  2MH2 A;  4WX9 A;  1BM9 A;  1IZ1 A;  4KIC A;  2L01 A;  2M30 A;  1Z6T A;  2HFH A;  1I27 A;  1S3J A;  2PMH A;  1O3R A;  4KIF A;  5DUI A;  4MEX F;  4KIG A;  1ZAR A;  2A5Y B;  3NRV A;  4MTD A;  4EM0 B;  4GYI A;  3EET A;  2C6Y A;  4UVC A;  4EJW A;  2OAZ A;  5LEJ A;  3RKX A;  3GFJ A;  4ASN A;  2GZW A;  2W24 A;  5LRS A;  3HIF A;  2UXN A;  1STZ A;  1S7O A;  2OU2 A;  4HDU A;  1DDN A;  4G7H F;  4KMF A;  1ZAO A;  1ZG3 A;  1AOY A;  3GW2 A;  3J81 Z;  3CLO A;  4YFN F;  1YYV A;  1ZLJ A;  3I54 A;  2A61 A;  4HQE A;  1XSX A;  2H6C A;  1FNN A;  3GO5 A;  3Q9S A;  1MKM A;  3F8F A;  2ZKZ A;  1MD0 A;  5K5R A;  3EQL F;  1R23 A;  3ELK A;  3D5L A;  4OMY A;  4WCG A;  2FRH A;  4TV7 A;  2JSC A;  1TNT A;  1HBX G;  1FX7 A;  2WC2 A;  2PEX A;  2QWW A;  2VT2 A;  5ICG A;  3O6B B;  1JHF A;  2DTR A;  3L7W A;  3FZV A;  1MJA A;  1VTN C;  3WE3 A;  2TDX A;  3IWF A;  3TO6 A;  4ZYE A;  5LHG A;  1EH8 A;  3QU3 A;  3MQ0 A;  4GXO A;  3QPT A;  3W6J B;  1FBS A;  1ZRE A;  5CVR A;  4XBF A;  5DD4 A;  5IT9 Z;  2ZBK A;  2KIU A;  4A12 A;  5E1X A;  4XSZ F;  4M9X A;  5H20 A;  1Y0U A;  4GGG A;  3H3Z A;  2DBB A;  1EH6 A;  1LNW A;  3NEU A;  1JXS A;  3LWF A;  4HOB A;  3RYR A;  3ML6 A;  3GZ6 A;  1O3Q A;  2VN2 A;  2Z99 A;  2ZJ2 A;  3IRR A;  2EWN A;  3HRS A;  1J2X A;  3VB2 A;  2P5L C;  2HS5 A;  3HRU A;  5ICC A;  1J59 A;  2DO7 A;  4KFC A;  4L9T A;  2E1C A;  3KE2 A;  5AIP A;  2F5C A;  3E5Q A;  1RUN A;  5CVU A;  1B9N A;  4Q5S F;  4IRH A;  5K5Q A;  4U88 A;  2ZNZ A;  5KK1 A;  4OIP F;  4AIJ A;  1ZRC A;  4ZYG A;  1SFE A;  3CUO A;  1ON1 A;  5JFR A;  4IHT A;  3L9F A;  2PJP A;  2EV5 A;  2HWV A;  4LB6 B;  4M74 A;  5FFZ A;  4RB3 C;  3QU6 A;  5FB2 A;  4I02 A;  1BIB A;  3FM3 A;  1BI1 A;  2PN6 A;  4HZF A;  3FM5 A;  1MZB A;  5HDG A;  3HSE A;  1F9N A;  3KLO A;  1XSD A;  4ZZD A;  4BXU A;  3V8J A;  4A5M A;  1U5T B;  1OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...