4A5MA

Redox regulator hypr in its oxidized form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
CPVEFTLDVIGGKWKGILFYHMIDGKKRFNEFRRICPSITQRMLTLQLRELEADGIVHREVYHQVPPKVEYSLTEFGRTLEPIVLQMKEWGESNRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL REGULATOR YYBR
publication title Structural Insights Into the Redox-Switch Mechanism of the Marr/Duf24-Type Regulator Hypr
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 27
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a5mA00
3E6MA 4JQFA 4OIPF 5K5QA 3KETA 1FOKA 3NQOA 3WTTC 2OZ6A 3C3WA 4CHUA 5FD6A 4UVCA 4Y13A 3BOQA 3WTSC 2JSCA 4ZZDA 5L3EA 3QU6A 2PG4A 4U0VA 1BIBA 2FBKA 4O3MA 5E1ZB 4EGZA 4UHTA 3ZMZA 1YG2A 4IHSA 3VODA 1FYKA 3JAMZ 4H0EA 5HS9A 3ZQ7A 3IRQA 2HGCA 2ZFWA 5J8CA 2DO7A 3KP5A 4EJWA 3I71A 2FE3A 5CYVA 2JPCA 5DUIA 4CXFA 3HHGA 1OKRA 1MJBA 3DF8A 3HYIA 2CWEA 3I5UA 2EV5A 1MZBA 3HTUA 2W84A 3GW2A 4KIFA 4HF1A 5LRRA 2BE5F 5IT3A 1IUYA 3ULQB 4XSZF 3LSTA 1W4MA 2HKXA 2F2EA 5BQTA 1BJAA 1R23A 2ZCWA 3IKVA 1YQAA 2L02A 1G3YA 2CFXA 5DDGA 2OBPA 2QLZA 3VB2A 1D5VA 2O8XA 5HLIA 3FF5A 3QOPA 5HDGA 5ILSA 1Z6TA 2V1DA 1YS6A 2IT0A 3G73A 2IA0A 2W24A 1USTA 2FOKA 4LG0A 1J9IA 4QLCU 1XSVA 4GCVA 4LB5A 2R7FA 1YO5C 2FRHA 1U8RA 4KN7X 3IC7A 5K1YA 5D6FA 2ESNA 2VONA 4MTDA 3REOA 3CLOA 1TNSA 4UUVA 1WWXA 4U7DA 4KNYA 2NRAC 4XLNF 3E6CC 4GO1A 3EYIA 4IRGA 3WTUC 2OAZA 2E7XA 2W25A 2HTJA 3J80K 2YPRA 3VEPA 4MTEA 5CVJA 2Y48A 3TDZC 1R1VA 2Y0MA 2LF8A 1Y0UA 3LAJA 1LEBA 3I59B 1BBYA 2XIGA 3P9CA 3O2PE 2K02A 5JR3A 2EFNA 1T2KA 3Q9VA 4FX0A 2FBIA 1ON2A 4RS8A 4I98B 3GFLA 4PDKA 4ZH4F 1U5TC 3DQVC 1XMAA 3D0SA 1YYVA 2RN7A 2IP2A 4MGRA 5FLXZ 5ICEA 2H09A 5JVTA 1KYWA 4UVBA 2IA1A 4R79A 2PMUA 1GXQA 4L0ZB 2O61A 2QBYA 5ICGA 1BOAA 1IRGA 2RC4A 1ZARA 1QZYA 4M71A 5LGTA 3LQRA 3TQNA 5D4SA 1JHHA 3NRVA 4KIGA 2ZXJA 5FD5A 3KEQA 3EETA 5LLQA 1X3UA 2G7UA 4YIFA 3QU3A 3MAJA 1FT9A 3P9IA 2CO5A 1ONVA 1KQ0A 1A04A 1CF7B 1HKTA 2FMYA 3ZMTA 3DXJF 2DQLA 4PCQA 2RV8A 1ZGAA 2KIMA 2PMHA 3KEOA 3QP6A 1DUXC 2CQKA 1YLFA 1XB4A 3WE3A 2EFQA 2HQRA 1IXSB 1PUEE 3KCCA 4Q47A 2K86A 4YFXF 2DPDA 2DI3A 1GHCA 2HKOA 1G6NA 1TLHB 2V79A 5BS6A 2RVCA 2VE9A 3WG9A 1FPQA 4WXDA 4IRIA 1BC7C 3R4KA 3ZPLA 1I1GA 2ZKZA 1MJAA 4MEYF 2E1CA 3T5XA 2P6SA 1ZLJA 2RDPA 1BIAA 2L4AA 2HEOA 2EJRA 5ILUA 1UHMA 2DLLA 1I27A 2Z5UA 1FZPB 3SFZA 1K7AA 1WI9A 1HXDA 1JGSA 4D0PA 1USSA 3E3VA 1KU3A 2VE8A 2BGCA 1OYYA 2L3DA 2CGPA 1Q1HA 1WQ2A 5E1WA 4HW0A 2GQQA 3KP7A 1YS7A 5FGMA 1LEAA 4KDPA 1LVAA 5E8GA 1ZGJA 1U78A 3F3XA 2XVCA 2E7WA 3RTRA 1MGTA 4HZFA 1E17A 2M8EA 4ZZLA 4OIQF 4BNCA 3MQ0A 1R1TA 1AWCA 4HLYA 1K6OA 4LB6B 2YR2A 1Z6RA 3E5UA 2QQAA 1S3JA 4CZZA 1ZG3A 2ZMEA 4P5OA 3GZ6A 2PBIA 5D4RA 2M5WA 1DP7P 4FX4A 2WV0A 3C1DA 5AONA 1PP7U 4HF0A 2D1VA 5CVRA 4OIRF 1I1SA 2BBYA 1MDMA 1L0OC 5ERIA 3J7AO 1HSTA 3CTAA 2P6TA 3FMRA 1ODDA 3COAC 1LDJA 5EEHA 1OPCA 1U2WA 4HX8A 5TJJA 1LJ9A 4EM1A 5IT9K 1XSDA 3JTHA 4HAMA 2KRFA 5DD4A 2C6YA 2G9WA 4OIOF 1W7PA 1K79A 5DUKA 5ED4A 3Q9SA 1B59A 5LEJA 4MEXF 1FNNA 1CGPA 3L7WA 1ZG1A 3V7RA 1HBXG 2IRFG 3F8BA 4HQEA 2M1BA 2ZNZA 4KFCA 5CJ9A 1XMKA 4M9XA 4EMSA 2A07F 3K69A 4B8XA 3WGHA 1HKSA 3GFJA 5D5XB 2O0YA 1ZN2A 1KYZA 4LLLA 4L0YB 5HOOA 2Y75A 1JE8A 4L9JA 4ENKA 1XD7A 4UV9A 2TDXA 4LMYA 1CF7A 2HWVA 1HSJA 3JW4A 2XAHA 3MEXA 3JSOA 1B4AA 1OYWA 2HYFA 2Q2EA 2DQRA 3KP6A 2Q0OA 5DCMA 4LLNA 3ABUA 3HHHA 2A3SA 3J80Z 3K2ZA 3HSEA 3B02A 4ESFA 3M8FA 1XN7A 5F6FA 2YX7A 6PAXA 1FYLA 4YIIA 4RGRA 2ETHA 1P4XA 5E20A 3WU0A 1UB9A 2JZYA 5KVRA 2PI0A 3F8CA 4Q5SF 3BPVA 1MJ9A 1O57A 4IVNA 4N9HA 3F23A 1BM9A 1IN6A 1F9NA 2YU3A 5F1RA 4Z2YA 1RI7A 4ENNA 4G7ZF 4CYDA 1O3QA 2ADUA 2EA4A 5FO5A 2DK5A 3CO6C 4EVIA 1RZ4A 5H6RA 3QP5A 5AIQA 4BXUA 4G6DA 4IF4A 2ZBKA 1DPRA 2ISYA 1ZG5A 4RGUA 4I01A 1XDSA 2GA1A 4PGHA 2PFBA 2ESHA 4DNCA 5D5UB 3F6VA 2MLKA 2GAUA 3GO5A 2JRTA 3KE2A 4RB2C 1RIOH 2V6CA 3SQNA 1Z05A 2NNYA 3F8MA 3HSFA 2PQ8A 4S05A 5FFXA 4EJTA 1W5TA 1FP1D 1KGSA 4OINF 3ZP5A 3T8RA 3I0TA 4M72A 1DPUA 3RKYA 2EV6A 3HRSA 4ENMA 3F22A 4WX9A 1IXRC 4EJVA 2PEXA 4LD5A 1GVJA 2XAGA 1UCRA 4BAYA 2E1NA 5E8IA 1RUOA 2X0LA 1ZHFA 1D8KA 1TNTA 3CDHA 2R3SA 3VOEA 2OQRA 2OU2A 4RAZA 1IF1A 4AD9A 3OOPA 4ZYGA 2QYOA 2A61A 2W85A 1GXPA 3U9GA 2V1XA 2HR3A 2A6EF 4KMUX 2STTA 3WGGA 1RUNA 2JTVA 5K5RA 3GF2A 4L5JA 1OR7A 2VN2A 3FMSA 1Z7UA 1O3SA 1SFEA 2EFPA 5LGUA 3GEZA 4G8XA 1U5TB 4UNOA 2P5VA 3KP2A 3ABTA 1KU7A 3IL2A 1R7JA 2LF7A 3ML6A 1C0WA 4A0XA 1EV7A 1S8NA 4KIBA 4ON0A 1T6SA 3CUQB 3R61A 1QPMA 1K78B 2KIFA 4WXCA 1OMIA 3FHZA 2G7HA 2XHKA 2K4BA 3T0YA 3BY6A 3E6BA 2XAQA 3BJOA 4EM2A 1ZREA 3V8KA 5J8FA 1R1UA 1FP2A 3JTGA 4MQ9F 3ZMUA 2FNAA 3H3UA 3H92A 1XCBA 2WTEA 4EM0B 1YW9A 1HKQA 3KFWX 1FSEA 4WCGA 1P4WA 1XGOA 3CUQC 3N4MA 2CG4A 4LLGF 3KLNA 4A6EA 2A6HF 2KJBA 3KP3A 2DAOA 4RB0A 2WC2A 2GWRA 1G3WA 1J2XA 1L3LA 1BI3A 5KK1A 4A2UA 3D5LA 1XGMA 1EH8A 5LRSA 1HW2A 1SD6A 4L9VA 1T38A 3F21A 1Z9CA 3LA2A 3FZVA 2F5FA 3KP4A 4PGGA 3K0LA 4LJZF 4HV5A 4HOBA 2JT1A 1AOYA 2MLGA 3H3ZA 1Z91A 2YSRA 2PLYA 4AIJA 3ECOA 4YFKF 3DKWA 2QM3A 4LGWA 5CLSA 3LAPA 4IJAA 3LQQA 1W7PD 4ZYHA 5ILVA 3SHFA 2H27A 1V4RA 4WWCA 3T1BA 2M30A 4ESBA 2JPBA 1WSUA 2OQGA 4UV8A 4KA4A 2K27A 1SD7A 1BI2A 4KUMA 4KMFA 1D8JA 3GXOA 4AIHA 3U1DA 3L2CA 1BC8C 2D1HA 4IHTA 2RGVA 3TDUC 2UWMA 5DCFA 2A5YB 3N97A 1REPC 2ACJA 4M73A 2FF4A 1YIOA 4BHBA 3LA7A 4IPAA 4A0YA 3P9KA 1ZYRF 2MD5A 2EFWA 3FMQA 5LHHA 4GYGA 2AS5F 1SMYF 1SMTA 2XV4S 4QWQA 2IW5A 4YG2F 3DEUA 3FX3A 1YTYA 5E18F 1KU9A 4A5MA 3U2RA 5H6QA 4S04A 4CO8A 1XGNA 1HW1A 3GFIA 3PFIA 3IWZA 1Z1DA 2NAZA 4XRFA 2EK5A 2QUFA 2M87A 5AIPA 2L01A 1FBSA 1HW5A 1S6LA 2VT2A 3DP7A 1QQIA 2DK8A 2CYYA 3I64A 3KZYA 3W6JB 3HIFA 2BEOA 3HRMA 2H6CA 3SZPA 1TTYA 3F8FA 1QNTA 2QWWA 2VC1A 1H9GA 1TW3A 2FA5A 1F4KA 1T39A 3TOBA 3V7CA 3I59A 3J81K 3L9FA 3EQLF 4LG0B 2XASA 4XLPF 2GIVA 3TOAA 3HSRA 1S7OA 3G3ZA 3W6KB 2W57A 3MCZA 3R60A 3AAFA 4XSXF 2DU9A 5EEGA 3QPHA 5A2QK 1TQPA 4TV7A 1RNLA 2VBZA 2IVMA 4L18B 2VBWA 4XBFA 2Z3YA 4RAYA 4E70A 4OMYA 2L4MA 4I2OA 1IN5A 2GZWA 1R22A 4P9UA 3K1MA 3CUOA 2J5PA 4Y15A 2VBXA 3M8EA 4HDUA 4A0ZA 2D45A 3FXUA 2ELHA 4I09A 2VT3A 1P92A 1XCVA 1WRJA 3C7JA 3M9AA 3WTVC 2EB7A 3ELKA 5J6XA 4U88A 2XRNA 5LHGA 2XUBA 4R1HA 2A68F 3WGIA 2MA3A 2H94A 2AXLA 3HRUA 2LSOA 2Z99A 4HV6A 1TQMA 1QO0D 3P7NA 4M9ZA 5CVVA 3IHUA 2M45A 3T8TA 4MQVA 3HOSA 4WXHA 5F64A 1QGPA 5BPIA 1XSXA 3JSPA 1P6RA 3LA3A 2P7VB 2DFIA 3R6SA 2HDCA 4WF2A 2D2WA 5CVIA 3SXYA 4FT8A 1FSHA 2K4JA 3GLXA 1LB2A 2OA4A 4BYYA 3BZ6A 2O3FA 1G3TA 1B6AA 1S7AA 5HLHA 2QBYB 4YFNF 2Z33A 3M1EA 4Q4ZF 1WKMA 2QQBA 5D8LB 4HF2A 1STZA 2UXNA 1ZRDA 3ZN1A 4EGYA 2XKPA 3DPLC 2ZNYA 3MWMA 3F6OA 2HQNA 4HYEA 1ZRCA 1H0MA 3LFKA 3O3KA 3ZMVA 4M74A 3GYHX 4M9SA 1IZ1A 2P5LC 3I4PA 3IRRA 3BROA 2GA2A 4G9YA 1P2FA 2O03A 1R36A 4UXNA 3DV8A 2NYXA 3RYRA 3TGNA 1J59A 3BPXA 2OD5A 4OU0A 2YX4A 3EUHA 2FQ3A 3FXQA 1LDKB 2X4HA 4AWXB 4HX7A 1UHWA 4R8HA 3RPQA 2CSOA 2QQ9A 3ZMSA 5HS8A 4B09A 5E1XA 3MZHA 3GX4X 1ULYA 2RKHA 2V9VA 4I0AA 3RYPA 2LDUA 5DYMA 3S2WA 2ZO4A 1ON1A 2NNNA 1R58A 3RJPA 3GUDA 3MZYA 4KYWA 5D5VB 4NB5A 3B73A 2XROA 1XGSA 4CDGA 2PJPA 3F8NA 2Z9OA 5FFZA 1QZZA 1J0RA 2ZJ2A 5HDKA 3CJNA 2IA2A 5D5WB 2VC0A 3MFKA 4BQAA 3R0AA 2EV0A 2J5OA 4PZJA 3IKTA 2LNBA 4L5IA 4CGZA 4A6DA 2EFOA 1TBXA 2L54A 2F5CA 4U0YA 4GYIA 3QPTA 2QENA 5LBQA 2KIUA 3ZMDA 2A69F 5HLGA 2HYGD 3ECHA 2H6BA 1BI1A 2ZMEB 3I58A 1O7FA 2UZKA 1UFMA 1F5TA 3F72A 4KT5C 1ZRFA 5JI6A 5DV5A 3FWEA 5DD8A 5ICCA 2RQPA 2VBYA 1SD4A 2P5KA 1MKMA 1FX7A 1VTNC 1BI0A 2STWA 3BDDA 2F5DA 1MDMB 3TO9A 4KICA 4IRHA 4A5NA 2ISZA 1V3FA 3O6BB 5D6EA 3DPTA 4GXOA 5HS7A 4ASNA 1IN4A 3K9TA 1FYMA 1JHFA 3V8LA 5L3CA 4O5VA 1KQ8A 2CW0F 4HBLA 3PQKA 4UVAA 1W7PB 3L00A 3JAMK 1YW7A 4HX4A 3TO7A 3GFMA 4EJUA 1XDUA 1SAXA 2GXBA 2BV6A 5BMZA 2GXGA 5K5OA 2P8TA 4P9FA 1IXCA 1B1BA 1NHAA 3E5XA 4NHJA 4U7BA 1ZH5A 4Q48A 2XGXA 3WTYC 4OMZA 1J75A 3BJ6A 3EDPA 3BP8A 1JXSA 3BWGA 4EJOA 4M6XA 3RPUA 1O3TA 4CICA 3J81Z 3SZTA 5IT9Z 4I0BA 4ZYDA 3BJAA 2VOOA 4ETSA 2HFHA 4AVPA 5CVUA 4OOIA 1FWZA 2XAFA 3HTSB 1P4AA 5A2QZ 2WWYA 3HUGA 2Q8KA 2F5EA 3CO7C 1O7LA 1YFHA 3KZZA 5DCMB 5DEQA 3RIRA 4M6YA 5L3BA 1FLIA 4G7OF 3L09A 4BH9A 3DFGA 2P4WA 3IWFA 4AIKA 3RKWA 5H20A 3I54A 3K1NA 4HA8A 1KQ9A 3R0JA 1IRFA 3GZ5A 1IN8A 3C18A 3WODF 3FM5A 4MHGA 3E6DA 3QRFF 3E97A 3V7SA 4RGSA 1T0FA 2PN6A 2XKOA 4GGGA 4JK1X 3RI4A 3I53A 1S29A 3FM3A 3EYYA 1SD5A 2OZUA 3GWZA 3ERED 3WTWC 5FB2A 4Y17A 2DW4A 3GVAA 5HVQC 5LGNA 4O6JA 3TKYA 3TO6A 3ROUA 4G6QA 2DBBA 1B9MA 4FHTA 2COMA 5BPDA 4F7ZA 1R00A 3V8JA 4K2EA 1TW2A 2VODA 2VOPA 5HDNA 1F1ZA 3K1PA 4BHCA 2FSWA 2HTSA 1HQCA 1IW7F 1R5GA 4HQMA 3RDIA 1J7KA 3M7GA 4IXAA 5LEKA 4EQQA 3WTXC 5FLXK 2NS0A 4ZYEA 4HDVA 1TQIA 4I02A 2V1UA 1R5HA 4LFUA 3FXRA 2IPQX 2B0LA 4L9NA 1E2XA 1U5TA 1W5SA 2VXZA 5L3FA 2KJCA 1FC3A 3V4GA 2IJLA 4WK8F 1BN5A 3HOTA 2RNJA 2XAJA 1D3YA 1J5YA 1T98A 4N9IA 3ZN0A 2K7LA 3CUQA 3NEUA 1SFUA 5JFRA 1K78A 3PQJA 4LK1F 1MD0A 1I6XA 3WE2A 4P96A 1ZLKA 1U3EM 2KKOA 4JBAA 4ESJA 2FNPA 2EWNA 5D8KB 4RB3C 4HLXA 4G94A 3VFZA 1O3RA 4BHPA 1FBUA 4G7HF 2QZ8A 1IAWA 5L3DA 1LDDA 1G4DA 2MH2A 5JHUA 2UXXA 1B9NA 4MNUA 3Q5FA 4KN4X 5LHIA 2FMLA 2HOEA 1PDNC 3HRTA 1YW8A 4RB1A 2BYVE 4L9TA 3E5QA 2LKPA 1IN7A 3RKXA 1KU2A 4RGXA 4ENJA 2DPUA 1KA8A 3LWFA 1FY7A 1H9TA 4I7HA 2DT5A 1G3SA 3WU1B 2FU4A 2HS5A 3ISPA 2FEZA 2QVOA 2MBFA 5L3GA 1U6GA 1QBJA 2DTRA 1EH6A 5E17F 1I5ZA 2O6GE 5TRDA 1LQ1A 2FXAA 5ICFA 4N0BA 2R7DA 2P7CB 1SFXA 1DDNA 2MC3A 2EA2A 3QAHA 4EV0A 5BOXA 1PP8F 2MH9A 4A12A 4NQWA 4P55A 2FBHA 4DQ2A 4U0WA 1LNWA 1FBQA 3OV8A 1ZAOA 1EH7A 1OYIA 4LK0F 3WTZA 2HZTA 3KLOA
chains in the Genus database with same CATH superfamily
3E6MA 4JQFA 4OIPF 1T33A 5K5QA 1XPXA 3KETA 2EH3A 1FOKA 3NQOA 5HNHA 2VQLA 3WTTC 1MH3A 3TBIA 2OZ6A 3C3WA 4CHUA 5FD6A 3H5RA 3CLQA 3AG4H 2E36A 3IAM2 4X0GA 5GPAA 1BW5A 4UVCA 4Y13A 3BOQA 2VQHA 2JSCA 3WTSC 1SVOA 3BLYA 4AIDA 3QU6A 4ZZDA 4Z6YA 5L3EA 2LK2A 2PG4A 4U0VA 3IH2A 2Y0SN 1BIBA 2FBKA 4JYKA 4O3MA 3LSMA 5E1ZB 2WB1A 4EGZA 2CW8A 3HOUJ 4PSWA 4UHTA 2JQ7A 3ZMZA 1YG2A 3OOUA 4IHSA 4XOPA 3U1KA 3VODA 4HRIA 4XORA 1FYKA 3JAMZ 1TWAJ 4H0EA 4C2TA 5HS9A 3ZQ7A 3IRQA 2DDBA 5GAEJ 2EQRA 2EZLA 2ZC2A 1MSEC 2HGCA 2ZFWA 2IS6A 4XMYA 5TISC 2ZSHB 5J8CA 3I56I 5C4JJ 1JKQC 3HOYJ 2X51A 2XGDA 1SANA 2JUGA 3W2VA 2W7NA 2DO7A 4DYCA 3QYFA 4F91B 2VJJA 2DMUA 3KP5A 4EJWA 3I71A 2FE3A 1JGGA 2Y9ZA 3PJRA 4ITVA 5CYVA 4C2UA 2CV1A 2JPCA 2HVRA 5DUIA 4CXFA 4I6ZA 3HHGA 1OCZH 1OKRA 1MJBA 2JA2A 3DF8A 4IHXA 4ZTJA 3HYIA 2CWEA 3I5UA 2EV5A 1MZBA 3HTUA 2W84A 3BR3A 3GW2A 4KIFA 4HF1A 5LRRA 2BE5F 1A5JA 5IT3A 1IUYA 3ULQB 3HZJA 4XSZF 3DKXA 5K7ZA 3LSTA 1WJ5A 1W4MA 2HKXA 2F2EA 5BQTA 3S17J 2WAQN 1BJAA 1R23A 1I6HJ 2ZCWA 4EATA 3IKVA 1RR8C 1YQAA 2L02A 5EZHA 1LVKA 3GTMJ 1G3YA 1XS9A 3M1CA 4C9YA 2CFXA 2IGNA 3RPUD 3BTCA 3SDBA 5DDGA 2OBPA 2QLZA 3VB2A 1D5VA 3FBIB 2VPRA 2Y69H 1W36C 3G2BA 2ME0A 2O8XA 3OWTA 5HLIA 1DU6A 5DM7F 3FF5A 1EA3A 3AG2H 3K10A 3S3OA 3QOPA 5HDGA 5ILSA 5J1YA 1JI8A 1N77A 4IEJA 1Y1WJ 1Z6TA 2CQNA 2P81A 1YS6A 2DA5A 2V1DA 4XLEA 1NK3P 2IT0A 3BCAA 3Q0UA 3G73A 2IA0A 2W24A 2Z2SB 1USTA 2FOKA 2KIQA 2NS8A 4LG0A 4PJ0C 1J9IA 4QLCU 3OIOA 1TWCJ 3ABLH 2DMTA 3MD2A 1Z3YA 1GT0C 1XSVA 4GCVA 4LB5A 2R7FA 1YO5C 2R7XA 2E1MC 2FRHA 3FHNA 1U8RA 4KN7X 1UG2A 3IC7A 1U0JA 5K1YA 5D6FA 2ESNA 4J00A 3CCLI 3SYTA 2VONA 1MIJA 4MTDA 1T0FC 1W36D 1X3ZB 3REOA 3CLOA 1TNSA 3CCUI 5EGOA 1W1WE 4UUTA 1OJLA 2XB5A 3SZGA 4UUVA 2VLAA 1WWXA 2KDOA 4U7DA 1XTAA 4KNYA 2NRAC 4XLNF 3JRHA 3E6CC 4GO1A 3EYIA 4IRGA 2DA3A 2HVSA 3WTUC 1Y0NA 2OAZA 3RSNA 2E7XA 2GOXB 3CJQB 2EZKA 2W25A 2DA7A 1OCRH 2HTJA 1X2NA 4CYCA 3J80K 1IJWC 4MFEA 1SAUA 2YPRA 3VEPA 4DYQA 4MTEA 1RETA 4NBQA 5CVJA 3CC7I 2Y48A 1ETXA 1VQ6I 3TDZC 1R1VA 1P9QC 3JRDA 2EBIA 4FETA 4XICA 2VPLA 4LOCA 2BVLA 2Y0MA 3H5NA 4ZJZA 2ZXHA 2CS3A 5IPAA 1ZQ3P 2LF8A 1K83J 1Y0UA 4AU7A 3LAJA 3C2BA 2ZJPF 4A3DJ 1XC5A 1LEBA 3I59B 1BBYA 1X4OA 4C3HJ 2XIGA 3P9CA 3O2PE 2K02A 5JR3A 3TP3A 2EFNA 2RNGA 2ZJQF 1T2KA 3Q9VA 4FX0A 3QYEA 2FBIA 2L9VA 3KYLA 4F52A 1ON2A 4V2GA 4DOZA 2R7QA 4RS8A 5JVGF 4I98B 4BGDA 3GFLA 4AC0A 3DPUA 3FXLA 3A0HC 4PDKA 3L2RA 4ZH4F 2X85A 3ZRGA 2V1NA 2X6XA 1U5TC 2KMUA 2MW8A 1ORKA 3DQVC 1XMAA 3D0SA 4RMNA 1YYVA 5H2FC 2RN7A 2LY2A 2FD5A 2IP2A 4MGRA 5FLXZ 5ICEA 1TWGJ 2H09A 4AYBA 1NG6A 1KYWA 4HG2A 5JVTA 1NH3A 2GLOA 3CMYA 1YITI 4UVBA 4LIVA 2IA1A 3CC2I 3S1QJ 3DLAA 4R79A 2PMUA 2VKEA 4UB6C 4OWRB 1GXQA 1NK2P 4L0ZB 2F4OB 2O61A 2QBYA 2EPFA 5ICGA 5KHDA 2OTJI 1BOAA 1IRGA 1W0UA 2RC4A 3PSIA 1GVDA 1G8XA 1ZARA 4E6KG 1D1BA 1QZYA 4M71A 2L9SA 5LGTA 3LQRA 3TQNA 5D4SA 1JHHA 4NDLA 1WJAA 3K4KA 1BJZA 1DU0A 3NRVA 4KIGA 4F3QA 4BQQA 3F9KA 2ZXJA 4XKBA 3NARA 1ZKGA 2WAEA 2LVSA 3DBHB 1XG1A 5FD5A 3KEQA 3EETA 3QQAA 2LBFB 5CQEA 5LLQA 3CCVI 1X3UA 2G7UA 5CQGA 4BJTA 1XX5A 4BS9A 3M3YJ 4N4OB 1JTYA 4YIFA 3QU3A 3HGYA 3MAJA 5E3LA 1FT9A 3P9IA 2CO5A 1JUPA 1ONVA 1KQ0A 1LKXA 1A04A 1CF7B 1HKTA 2FMYA 5JLXA 3CCMI 1P7IA 3ZMTA 4V19K 3DXJF 4Y7NJ 3OIQA 2DQLA 2XGCA 1E3OC 4YEJA 1Z3XA 2BVMA 2GOMA 4PCQA 1Y56A 4QTRA 2RV8A 1ZGAA 2KIMA 2N8GA 4AVZA 2PMHA 3FK6A 3KEOA 3CCEI 3QP6A 1YJ9I 1DUXC 1WI3A 2CQKA 2RQQA 1YLFA 3S2DJ 1XB4A 3WE3A 2EFQA 2HQRA 1IXSB 3BTJA 4B4CA 3ZCOA 1GUUA 2M34A 1PUEE 3KCCA 3MMYB 2K86A 4Q47A 3HKZN 2DI3A 4YFXF 2DPDA 3OIPA 3FXJA 1TC3C 4IHVA 1GHCA 2HKOA 1Z0XA 1G6NA 1TLHB 2KL4A 2V79A 5BS6A 3BR2A 3S15J 2RVCA 2VE9A 3GCMA 4IQ4A 3WG9A 1FPQA 2MGQA 4WXDA 4IRIA 1BC7C 2V6EA 3R4KA 4IOAF 3J7ZI 2WY7Q 3ZPLA 4Y3OA 2MABA 1I3AA 1IRXA 1I1GA 2ZKZA 3DWLE 3MKWB 1MJAA 4BY1J 4MEYF 3RQIA 2E1CA 4V2FA 2HZDA 4E7LA 4XKWA 2M0CA 1Y39A 3T5XA 1X4PA 2P6SA 2EZHA 2VQGA 1T56A 1ZLJA 2RDPA 1BIAA 4E7HA 2L4AA 3OL3A 1ETKA 2IAIA 3DLLF 4DBRA 1FTZA 2HEOA 4NC6A 1ETWA 2MD0A 2EJRA 3E0JB 4RM2A 5ILUA 1VNDA 2R5ZB 4P1WA 1UHMA 2DLLA 2L9NA 1IGNA 1I27A 2Z5UA 3CD6I 1FZPB 3SFZA 2Z16A 2CU7A 1K7AA 1ETQA 1WI9A 5EG0A 1HXDA 1JGSA 2L0KA 4D0PA 2EIMH 4PUSA 2VKHA 4BACA 4A3KJ 2XB0X 1YX5A 1P7JA 1USSA 3E3VA 1Y6IA 1KU3A 2VE8A 2BGCA 1OYYA 2L3DA 5F27A 2CGPA 1Q1HA 3OYKA 2LD5A 1ITYA 1WQ2A 2R7OA 3WU2C 1QA6A 5E1WA 4HW0A 4RDUA 2GQQA 3KP7A 2I10A 3NWSA 1YS7A 5FGMA 1LEAA 4KDPA 2B7EA 1LVAA 5E8GA 1ZGJA 2LR8A 2AXTC 3BZCA 1U78A 3F3XA 2XVCA 2E7WA 3RTRA 1MGTA 4HZFA 3UR3C 5LD2C 2DOEA 2HXOA 1E17A 3BTIA 3I3LA 2M8EA 4ZZLA 4OIQF 4BNCA 2ECCA 3H3VK 3MQ0A 1R1TA 1AWCA 4HLYA 4ZDPA 1K6OA 3B6CA 1LE8A 4LB6B 2YR2A 1Z6RA 3E5UA 2QQAA 1S3JA 2OF7A 2UV1A 3BG9A 4CZZA 2DA4A 1ZG3A 3SJMA 2ZMEA 3NAUA 1IDZA 3M4OJ 3HC7A 4P5OA 1VZ0A 2KPMA 1TT5B 3EUHC 1WJDA 1MBHA 3GZ6A 3ZQLA 2PBIA 5D4RA 2M5WA 2XPWA 1DP7P 1JUMA 2X6OA 4G6TB 3HDDA 4FX4A 2WV0A 3C1DA 5AONA 1PP7U 3HXLA 2D1VA 4HF0A 5CVRA 3ABKH 4CZCA 1PUFB 4OIRF 2V26A 1I1SA 2B9SA 2BBYA 4U87A 1MDMA 1L0OC 1GV5A 1MW7A 4PSXA 1AHDP 5ERIA 1MNMC 3J7AO 3PNTA 1HSTA 5JLWA 3CTAA 4W1UA 2K3FA 2P6TA 3FMRA 1ODDA 3COAC 1LDJA 5EEHA 1OPCA 1U2WA 1EKEA 4HX8A 1W0TA 5TJJA 3K4MA 3RCOA 3OS0A 1LJ9A 2BW3B 4EM1A 1UJ8A 5IT9K 2ID3A 1XSDA 1K61A 3RZOJ 2E1OA 3ERMA 3ZR8X 2E2HJ 1R4NB 4BEHA 3JTHA 4HAMA 2KRFA 5DD4A 2CUZA 2JRMA 2C6YA 4XLFA 2G9WA 4OIOF 2X6WA 1ZK8A 2VB6A 2H1LA 1R49A 1W7PA 1R4MB 1K79A 3FDYA 4RAGA 3Q9SA 5DUKA 1X1BA 1B59A 5ED4A 1BA5A 2QKMB 3Q0WA 3V42A 1LPQA 2R7RA 3M8JA 2HPMA 3S1MJ 2XPUA 5LEJA 4MEXF 1FNNA 1A6QA 1CGPA 2R7WA 3KPHA 3L7WA 3PM1A 3GLLA 3V7RA 1ZG1A 2K3PA 3TP0A 1BW6A 1HBXG 2IRFG 2M7AA 3F8BA 4HQEA 1SVLA 2VJ4A 2XF6A 2M1BA 2NVTJ 1MH4A 2TCTA 3S2HJ 2ZNZA 3LOCA 4KFCA 5CJ9A 1XMKA 4M9XA 4EMSA 2A07F 1E3PA 3K69A 4B8XA 2BXYA 1HKSA 3GFJA 3WGHA 5D5XB 2JVGA 5GAHJ 3OYBA 4FTHA 1BOBA 2O0YA 1ZN2A 1KYZA 4LLLA 3HOXJ 3ESWB 5HOOA 4L0YB 2R92J 2Y75A 3RZDJ 1JE8A 4L9JA 2HYJA 4ENKA 3K4JA 1XD7A 2LKSA 5KAIC 2AQFA 4UV9A 1E3HA 2RAEA 3PO2J 1X2MA 2TDXA 4LMYA 3DBLB 2VQCA 1K4TA 2DFHA 1CF7A 2HWVA 3RQ4A 4C2MJ 1Z21A 3HG9A 1HSJA 2CUFA 3JW4A 2XAHA 4B48A 2LY1A 3MEXA 3JSOA 4A3JJ 1B4AA 3TMOA 1OYWA 2HYFA 4HNTA 2Q2EA 1FOXA 3FKIJ 2NVYJ 2DQRA 3H9QA 2KLOA 3KP6A 3MKZA 2Q0OA 5DCMA 3PUBA 2M4KA 4E7KA 3I9V2 3OYEA 4LLNA 3ABUA 3BC8A 4JP0A 1J09A 3HHHA 1WCMJ 2A3SA 2KRCA 3J80Z 2DA6A 3K2ZA 3HSEA 3B02A 4ESFA 1VQ7I 3M8FA 1XN7A 2ZB9A 5F6FA 5FKKA 2JA5J 5IOYA 2YX7A 6PAXA 2OJED 1FYLA 3ZQFA 4RLQA 4FE4A 4YIIA 1NTCA 4RGRA 2BY3A 2CQXA 4ZTFA 2VL8A 2ETHA 1P4XA 2Y0SA 5E20A 2HOTA 3W2AA 5B1AH 3WU0A 1UB9A 2JZYA 5KVRA 2PI0A 4BXFA 2OPTA 5B66C 3F8CA 4Q5SF 3BPVA 5LFAA 5M5YJ 1MJ9A 1O57A 4IVNA 4N9HA 3F23A 1BM9A 1IN6A 3CP2A 4CCLA 1F9NA 2YU3A 5B3SH 1EJ9A 4FQGA 4BQNA 4Z2YA 1RI7A 5F1RA 4IX7A 1Z7LA 4ENNA 1FJLA 2BHZA 4G7ZF 4CYDA 1O3QA 2O5RA 1X1CA 2ADUA 2EA4A 3ABMH 3N05A 1F36A 4DGWB 5IP9J 5FO5A 3CF5F 2DK5A 3HUGB 4IZZA 1OISA 1FOYA 5CPRB 3CO6C 4EVIA 1RZ4A 5H6RA 3QP5A 2CUEA 4DZJA 1FIAA 2EIKH 5AIQA 3E1SA 4BXUA 3CCQI 4G6DA 4IF4A 5IYCJ 4LG3A 2ZBKA 1DPRA 2ISYA 1ZG5A 4RGUA 4ABZA 4I01A 1RESA 1XDSA 2GA1A 4PGHA 2NVQJ 2QF7A 4DJAA 5M5WJ 2PFBA 2ESHA 2I8DA 4DNCA 1YI2I 5B1BH 4D1QA 2L5QA 5D5UB 3F6VA 3H0GJ 3JCUC 2BOLA 2MLKA 4G12A 2GAUA 3GO5A 5HLTA 2JRTA 3EUKL 2EINH 3KE2A 2Y2ZA 3AFHA 5FKNA 3GTOJ 2IS1A 2KQRA 2WAQA 1H8AC 4RB2C 4KJZA 1RIOH 2V6CA 3QWLA 3SQNA 2RREA 1JT0A 4MLOA 3VWBA 3W2WA 1RPWA 2LTPA 1Q1VA 1Z05A 1IG7A 2NNYA 3F8MA 1MMAA 3HSFA 2O9LA 2EILH 2PQ8A 4S05A 2IGKA 3FXOA 2KDZA 4GDFA 5FFXA 4EJTA 4X1EA 1W5TA 4E7IA 2E1MB 1FP1D 1KGSA 3OYAA 4XRMA 3HJEA 3QYBA 4OINF 1WFXA 3CDLA 3ZGKA 3ZP5A 3T8RA 3DKYA 4XK4A 3I0TA 2VXDA 1AKHA 4M72A 1DPUA 3RKYA 3KEYA 2EV6A 1FOWA 3IP4B 3HRSA 3A0BC 2ELJA 5FKLA 4ENMA 1RKTA 3F22A 1B72A 2ZFUA 4BBSJ 4CSWA 1JKOC 4WX9A 1D1CA 5B5EC 3ZQCA 1IXRC 1VQ4I 4EJVA 2PEXA 3OYNA 4LD5A 1GVJA 2XAGA 2LG4A 1UCRA 4BAYA 1ZR4A 4DYRA 2HI3A 2OV7A 2E1NA 5E8IA 1N25A 4D5FA 1LFUP 3Q3SA 3LSHA 3I55I 3OR1C 5E3OA 1RUOA 1HLVA 1WJFA 2X0LA 1ZHFA 4QPQA 2NVXJ 1D8KA 1TNTA 3HPHA 3CDHA 1S5LC 4HNVA 2R3SA 3VOEA 2OQRA 2M7BA 2OU2A 4RAZA 1IF1A 4AD9A 1MMNA 1VI0A 3OOPA 4ZYGA 1B8IA 2QYOA 5J1RA 2A61A 2W85A 4II2A 1GXPA 3U9GA 2V1XA 2HR3A 2DMPA 4Y33A 2A6EF 2CRGA 3GTKJ 4KMUX 2STTA 3WGGA 1QVUA 5EJCA 3VYRB 1RUNA 2JTVA 5K5RA 3A2KA 3GF2A 1K4SA 4L5JA 1OR7A 2CFOA 2VN2A 3FMSA 2DCEA 1QRYA 1JKRC 1Z7UA 2DJNA 1SFEA 2EFPA 5LGUA 2VI6A 1O3SA 1ERDA 4F55A 3GEZA 4G8XA 3ASNH 1W5CC 5EYRA 1HDPA 4AM3A 1U5TB 4UNOA 2P5VA 2IGMA 2BXZA 3ABTA 3KP2A 3OYDA 1KU7A 3IL2A 4RBOA 3S3MA 2E19A 1R7JA 2LF7A 3ML6A 4EEFG 1C0WA 2CV2A 2HU9A 1WJCA 4A0XA 1EV7A 1S8NA 2F6CA 4KIBA 2A05A 4B3AA 4ON0A 1T6SA 3A01B 3CUQB 3R61A 1QPMA 2ZJRF 1H89C 4XONA 1K78B 2KIFA 4WXCA 4B47A 4UB8C 3JRAA 1OMIA 3FHZA 2G7HA 5F1JA 2XHKA 1U9OA 2K4BA 3CJTB 1LFPA 3BG7A 3T0YA 4PJJA 1FMWA 3BY6A 3G71I 3E6BA 2XAQA 2WAFA 3BJOA 2CW7A 4EM2A 2DYSH 1MBGA 2ZMEC 1T08B 4UUSA 1ZREA 3D1NI 4YELA 1DQUA 3V8KA 5J8FA 2BZTA 1R1UA 3LSRA 1FP2A 2GIZA 3JTGA 2DFEA 4MQ9F 5KNLA 3ZMUA 1RR7A 2FNAA 3H3UA 3H92A 1XCBA 2R5YA 2WTEA 4EM0B 1YW9A 1HKQA 2UUZA 1MBKA 3KFWX 1FSEA 4WCGA 3OS1A 1P4WA 1XGOA 3CUQC 4FE7A 3W3CA 3K4NA 3N4MA 2CG4A 3QPLA 4LLGF 5J3LA 5JHFA 1TT0A 2R4GA 3KLNA 3BR1A 2OCEA 3NWTA 4BE1A 4A6EA 2A6HF 4IL6C 2VJIA 2KJBA 2NS7A 1YRNA 5E3NA 3KP3A 3OYLA 1MBJA 2F4MB 3S1NJ 5KAFC 2DAOA 1RRJA 4RB0A 2X1DA 4IHWA 2WC2A 2GWRA 1G3WA 1J2XA 3H9JA 1L3LA 4UY8I 1BI3A 5KK1A 4A2UA 3SEZA 3D5LA 1SEUA 2DN0A 1XGMA 1EH8A 2JA8J 2R7UA 5LRSA 3H9GA 1HW2A 1A36A 1SD6A 4L9VA 3SEQA 1T38A 4RM3A 3GMEA 3F21A 1Z9CA 2XDVA 1S9HA 3FZVA 3LA2A 2F5FA 2JA6J 3IUOA 4CCKA 3KP4A 4ZC3A 4PGGA 3K0LA 4LJZF 2R7SA 3CCJI 2R0QC 2H8WA 4HV5A 4A93J 2JUCA 4HOBA 3VSKA 3BG3A 2JT1A 1AOYA 2ELKA 2MLGA 1V5FA 2PJRB 4BE2A 1QZEA 3H3ZA 4JX6A 1S72I 1Z91A 4LIUA 4M3DA 3LSKA 2YSRA 2PLYA 2DMQA 3OYHA 4AIJA 3OMYA 3ECOA 4YFKF 3DTEA 1VQOI 1MNEA 4X6AJ 3DKWA 4NQWB 2QM3A 4LGWA 5CLSA 3LAPA 4IJAA 3LQQA 3CJRB 4GRIA 1W7PD 2LREA 4ZYHA 5ILVA 3SHFA 1I50J 2H27A 1V4RA 4KISA 4WWCA 1K6YA 2WADA 2HDDA 1HOMA 2HQ5A 3T1BA 2P0WA 1TWFJ 2M30A 2NOJB 1TL8A 2LH9A 4ESBA 4KITB 1YHQI 1Y8RB 3LNQA 1UMQA 2JPBA 1WSUA 2OQGA 4UV8A 4KA4A 4B1RA 2DMNA 4XL9A 2K27A 1SD7A 1BI2A 4KUMA 4XN3A 1MBEA 2PMZN 4KMFA 1D8JA 1MSFC 1VQNI 3GXOA 4AIHA 1PJRA 3U1DA 3VYSB 3L2CA 1BC8C 2D1HA 4CUGA 4IHTA 2RGVA 5EF6A 3TDUC 2MC4A 2UWMA 5DCFA 2A5YB 5CKTA 3C2HA 2VJ5A 3N97A 1IV6A 4PJNA 2WY8Q 1REPC 3BG5A 2OUMA 1A6IA 2ACJA 3C2GA 4M73A 2FF4A 2M3AA 1YIOA 4BHBA 3LA7A 3LSPA 4IPAA 4A0YA 5HODA 3P9KA 1JJ8C 3DU5A 1OFCX 2M4GA 2QKLB 1ZYRF 4M3GA 2MD5A 2EFWA 3IH4A 3FMQA 5LHHA 3GTQJ 4GYGA 2AS5F 4HPQA 2XV4S 1SMYF 1SMTA 1WPKA 1DGWY 3H1CA 2BY2A 3PNYA 4XKCA 2XSDC 4QWQA 1G2HA 5C4XJ 2M0MA 3UKGA 2IW5A 4YG2F 3DEUA 3FX3A 4M3EA 1O4XA 4JOMA 3CCSI 1YTYA 2NOGA 2Z1DA 3LSJA 5E18F 1KU9A 4XKVA 4A5MA 3U2RA 5H6QA 4S04A 4CO8A 1ACIA 1XGNA 5F0CA 1HW1A 3VSLA 3K7AJ 5GAGJ 3LSIA 3GFIA 3ZQQA 1R71A 3PFIA 1QU3A 3IWZA 3F0CA 1Z1DA 3H35A 2R93J 3CESA 4PK4A 2E71A 3JREA 3GZNB 2NAZA 2LRDA 4XRFA 2EK5A 2QUFA 3IV5A 2JA7J 2M87A 3JRGA 2IEKA 5AIPA 4YIRX 2L01A 1FBSA 1HW5A 1S6LA 3OL4A 2V9KA 3OY9A 3MKYB 2VT2A 2CMPA 3G1MA 2B63J 3DP7A 3JRBA 3K2AA 5DM6F 2F4IA 1QQIA 4D7MA 2DK8A 2CYYA 3I64A 3KZYA 3W6JB 3CCRI 3HIFA 3AL0C 2BEOA 2IS4A 1HDDC 3HRMA 3X2QH 5J4YA 4XRSA 2H6CA 3E7LA 3SZPA 1TTYA 3F8FA 1QNTA 2COBA 2QWWA 3FISA 2VC1A 4BY7J 4W97A 1X58A 1H9GA 3TW6A 1TW3A 2CQQA 2FA5A 4BU2A 3BR6A 1F4KA 4HSTA 2CH0A 3VDXA 1VF9A 3OYIA 1T39A 1VQKI 1R5ID 2A5WA 3TOBA 2Y31A 3V7CA 3I59A 4IOCF 3J81K 3L9FA 3EQLF 4LG0B 1OCTC 3HPGA 2BY0A 2XASA 4KT6A 4Y4RA 2OC6A 4XLPF 2GIVA 3TOAA 1WHUA 1S7OA 3HSRA 3G3ZA 2M9HA 3W6KB 3L2QA 3K4CA 2HOAA 3MZ8A 4DBQA 2W57A 3MCZA 1MNDA 1X3WB 3R60A 3AAFA 3HGGA 4XSXF 4BXXJ 2DU9A 2OTLI 2MSYA 1TP4A 2XF7A 5EEGA 2A6TA 3QPHA 4XNFA 3H36A 1IO2A 5A2QK 1TQPA 3CMMA 4TV7A 5EGOB 2W48A 1RNLA 2VBZA 4GFBA 2IVMA 4L18B 3PO3J 1A35A 2VBWA 4XBFA 2Z3YA 1AA7A 1BR2A 3LL7A 4RAYA 4E70A 4OMYA 4OAZA 2L4MA 4I2OA 5J40A 3W6VA 3DCFA 1IN5A 2L2OA 2GZWA 4XLCA 1R22A 1NG7A 4P9UA 3K1MA 1MMGA 3CUOA 4CCNA 2MG4A 2X1EA 2K5CA 5E3MA 2J5PA 4Y15A 3M07A 4CYCB 2VBXA 3M8EA 4NUBA 2E5ZA 4XN0A 2WBMA 3CP8A 4HDUA 4A0ZA 2D45A 3FXUA 3HOZJ 2ELHA 4I09A 2VT3A 1P92A 1XCVA 1IC8A 1WRJA 2DT6A 3C7JA 3M9AA 3WTVC 1LFBA 2EB7A 5BNGA 1YJNI 2DT7B 3A02A 3ELKA 5J6XA 4U88A 2XRNA 5LHGA 2ID6A 2W4SA 2XUBA 4L5EA 2HQAA 1KONA 3ASOH 5DS9A 3QODA 1IRZA 4R1HA 2A68F 1JTXA 3K70C 3FK7A 3TW7A 4AUXA 2FJ1A 4IQJA 3WGIA 2LBFA 2MA3A 4PJMA 5J47A 2H94A 2AXLA 3HRUA 2LSOA 2Z99A 4HV6A 1TQMA 2KP6A 1QO0D 3P7NA 4M9ZA 5CVVA 3IHUA 2M45A 3CQZJ 3L2WA 3T8TA 4MQVA 1OR7C 3HOSA 2ZXIA 4WXHA 5F64A 1QGPA 4BQOA 4CCJA 1XSXA 5BPIA 3JSPA 1P6RA 5J4VA 3LA3A 2P7VB 2Q1ZB 1UG0A 4PFPA 2DFIA 1VQ5I 3R6SA 4BJ5C 1H88C 2HDCA 4WF2A 2D2WA 5CVIA 1BR1A 3SXYA 4FT8A 1FSHA 2K4JA 3GLXA 3L2UA 1Z67A 3I4NJ 1LB2A 2HXIA 2TRTA 2R7TA 2OA4A 2K9MA 4BYYA 5GADJ 1WH7A 2M2EA 3K70D 3FXKA 3BZ6A 2K85A 4FISA 2O3FA 1G3TA 1B6AA 1S7AA 5HLHA 1CQTA 2LLKA 2QBYB 4YFNF 2Z33A 3M1EA 3EUAA 4Q4ZF 2FUG2 1WKMA 2QQBA 4M3FA 2KISA 5FLVA 3KIOA 3K4BA 5D8LB 2X1CA 4HF2A 2V7FA 1T95A 1STZA 2UXNA 1ZRDA 5IYBJ 2KHMA 3PIPF 3ZN1A 1Y8QB 5M5XJ 3TEDA 4EGYA 2XKPA 3DPLC 2ZNYA 4A3BJ 3MWMA 3BG6A 3F6OA 2HQNA 4HYEA 5GTHC 2L7MP 1ZRCA 4B43A 3JRFA 3S8PA 1H0MA 3LFKA 1GDTA 3O3KA 3ZMVA 4M74A 3SFIA 1A31A 3GYHX 3ONQA 1QPIA 4M9SA 4HSRA 3ZXSA 1IZ1A 2R5ZA 2P5LC 2HNHA 2X9DA 2X6YA 3I4PA 3CC4I 3IRRA 3BROA 2GA2A 4G9YA 4BUPA 2DA2A 1PVEA 1P2FA 5C44J 2O03A 1R36A 2K9NA 2L9RA 4UXNA 1E0EA 3DV8A 2NYXA 3RYRA 2KRHA 3TGNA 1J59A 3K4LA 3KYDB 2WB1N 3BPXA 3JRCA 3HBLA 2OD5A 2JWTA 4BL0B 4OU0A 2YX4A 3S93A 1OCOH 3LMMA 1UAAA 2DA1A 3EUHA 5GTIC 3MVPA 5EEAA 2L7FP 1ZELA 2FQ3A 3FXQA 4DIQA 3PFYA 1LDKB 2X4HA 4AWXB 4B3XA 4HX7A 2WA0A 4D7NA 1X1AA 1UHWA 4R8HA 3RPQA 2CSOA 1KZHA 2QQ9A 3ZMSA 5HS8A 1MBFA 3MKLA 4B09A 1HF0A 1ENHA 2L7ZA 3FBNB 5E1XA 3MZHA 2RKHA 1ULYA 3GX4X 4J19A 3CDIA 4A3GJ 2V9VA 4I0AA 1ZTRA 3RYPA 2LDUA 5DYMA 3S2WA 3S1RJ 2ZO4A 1ON1A 2LY9A 2NNNA 5GP9A 1N78A 1R58A 3RJPA 2BY1A 3GUDA 3MZYA 2BHYA 4C3JJ 1JJ6C 5D5VB 2XRLA 4KYWA 4IKFA 4NB5A 3H5AA 5C3EJ 3B73A 2XROA 1XGSA 2HOSA 4IO9F 4CDGA 2PJPA 3F8NA 2Z9OA 5FFZA 5EG0B 3FKJA 1QZZA 1J0RA 4QSHA 2ZJ2A 1UHSA 3G6EI 5HDKA 4QIWN 2H1KA 2Y9YA 3CJNA 1PUFA 1VQMI 1RKWA 4RAFA 4XRSG 1ETYA 2IA2A 3OYJA 5D5WB 3O8HA 1D5YA 2VC0A 3HM5A 3MFKA 4BQAA 2DOAA 3R0AA 2EV0A 2J5OA 1JUSA 3SDGA 4PZJA 3IKTA 1V54H 2LNBA 1HC8A 4L5IA 4YRVA 2BW3A 2E34A 3VYUB 4CGZA 4A3CJ 3D5SC 4A6DA 2EFOA 1TBXA 3JRIA 2QSHX 2L54A 1N75A 2F5CA 4U0YA 2XF5A 4MO7A 4GYIA 2QENA 3QPTA 5LBQA 2QCOA 2KIUA 1JT6A 3ZMDA 1LE8B 4NC7A 4E4HA 2A69F 5HLGA 1XMXA 2HYGD 3ECHA 4MIMA 1V5EA 2H6BA 1BI1A 2ZMEB 3I58A 1O7FA 2UZKA 1UFMA 1F5TA 3F72A 1EF4A 3KYCB 4KT5C 1ZRFA 5JI6A 2DOFA 5DV5A 2DYRH 1OCCH 3FWEA 1I3QJ 1PYVA 5DD8A 5ICCA 3MN2A 2RQPA 2VBYA 1SD4A 2P5KA 1MKMA 1FX7A 2V4JC 1OLTA 3UNGC 1VTNC 4J01A 1BI0A 2W00A 2STWA 2WV1A 3A4CA 3BDDA 4RLFA 2F5DA 5F08A 5F04A 1Y1VJ 1MDMB 1QHHD 3TO9A 1APLC 4XR6A 3JR9A 4KICA 1TWHJ 4IRHA 4II3A 3AG3H 2E60A 4A5NA 2ISZA 1U9NA 1V3FA 2I5UA 3O6BB 5D6EA 3KZIC 3DPTA 2VKVA 4GXOA 2FX0A 1WH5A 4MFDA 1YOVB 3BR5A 5HS7A 4ASNA 2O8KA 1FMVA 1IN4A 1Z77A 2GBYA 3K9TA 1FYMA 2XGEA 1JHFA 3V8LA 5L3CA 3OS2A 4O5VA 2GM4A 2NXNB 5FRMA 1KQ8A 2CW0F 4ZDLA 4BEHB 4HBLA 4XM3A 5K7HA 2XAUA 2K9SA 1MMDA 1HA8A 3PQKA 4BBRJ 3IAS2 4UVAA 1W7PB 3L00A 4N4NB 1YW7A 3JAMK 3LFUA 4HX4A 1ZR2A 3QOEA 3TO7A 1TZLA 3RKQA 3GFMA 1YX3A 3DBRB 4EJUA 1XDUA 1SAXA 2GXBA 3S32A 2V9PA 1DP3A 1WGXA 2K9QA 5EDNA 4A3EJ 1R9TJ 2BV6A 1LUJB 2HDWA 2E5NA 5BMZA 2GXGA 5K5OA 2P8TA 4P9FA 2DODA 4E7ZA 1IXCA 1B1BA 1NHAA 2HVQA 3E5XA 4NHJA 1VQPI 4U7BA 1AU7A 1V5GA 1ZH5A 4AYBN 4Q48A 2LOOA 2XGXA 3GBGA 3WTYC 4OMZA 4F92B 1I39A 1J75A 3BJ6A 2R7VA 3EDPA 3BP8A 1JXSA 2MFZA 3BWGA 4EJOA 4M6XA 3RPUA 3OYMA 1O3TA 5M3FJ 1YJWI 4CICA 2CQ7A 2JN6A 5TGTA 3J81Z 3SZTA 5IT9Z 4I0BA 4ZYDA 3BJAA 2VOOA 2KT0A 4ETSA 2HFHA 5FRNA 2H8RA 2QA4I 3ZQGA 2AHQA 4AVPA 5CVUA 4A69C 3D5RC 4OOIA 3HKZA 1FWZA 2XAFA 3BZKA 5IOZA 3HTSB 1OCPA 4NNJA 1P4AA 5A2QZ 4BJ6C 2JMWA 3LSGA 4XQFA 4CA0A 4ZDOA 2WWYA 1R6RA 4JX4A 2YS9A 3HUGA 3ZQHA 4FASD 2Q8KA 4C30A 3U21A 4E7SA 2F5EA 3CO7C 1O7LA 3PIOF 1YFHA 1F43A 3G1LA 1GV2A 2Q2EB 1HCRA 3KZZA 5DCMB 5DEQA 3RIRA 1U8BA 3AG1H 5F0FA 4XIDA 4M6YA 5L3BA 1ETOA 1FLIA 5KCMA 4G7OF 5IP7J 2PMZA 3L09A 2LYCA 4BH9A 3DFGA 2P4WA 3IWFA 4AIKA 1UZCA 1IDYA 3BT9A 1M1EB 3RKWA 2R7ZJ 5H20A 3S16J 1POGA 3I54A 3I4MJ 3K1NA 3O8GA 4FCYA 4OAYA 1SFKA 2JJ7A 4HA8A 4RA2A 1VQ8I 1KQ9A 3HOWJ 1OQYA 3R0JA 1IRFA 2K9LA 4BKXA 1FIPA 1ZGWA 2W82A 3GTJJ 3BCBA 3GZ5A 1IN8A 1WVRA 3C18A 2KZVA 3WODF 2LP0A 1DGRM 3FM5A 4MHGA 3E6DA 3QRFF 4C3IJ 4HEA2 3E97A 3V7SA 2ZSIB 4RGSA 1UELB 1BR4A 1T0FA 2PN6A 2XKOA 1D1AA 4GGGA 2E2IJ 4JK1X 2EZIA 4XOTA 3OYGA 3RI4A 3I53A 1S29A 3FM3A 5FKOA 2QGUA 4BDYA 2YU9J 4ANJA 3EYYA 1SD5A 2LKXA 4A3MJ 1YIJI 4Y52J 2OZUA 3GWZA 2VIXA 3ERED 3WHCA 3WTWC 4BE0A 1GLNA 5FB2A 1IV8A 4Y17A 4NC8A 1VFCA 4A3LJ 3Q0VA 2DW4A 3GTGJ 2CV0A 3GVAA 2CJJA 2JK3A 1RC9A 4LITA 4O6JA 5HVQC 5LGNA 3TKYA 3DTKA 3TO6A 2W1OA 1FTTA 3ROUA 1X19A 4G6QA 2DBBA 2MYSA 5IP6A 1B9MA 4BDZA 3J7YJ 4FHTA 2COMA 5BPDA 1VQ9I 3KX2A 3AL0B 4F7ZA 1R00A 4XLAA 3V8JA 4K2EA 4PJLA 4XLHA 1TW2A 2LC2A 2IXSA 2VODA 5FKMA 5EZGA 2VOPA 2X48A 3TL4X 5HDNA 3PUFA 2FOWA 2IBDA 1F1ZA 2XPVA 3K1PA 1D0YA 3DEEA 5E79C 3HL2A 1VQLI 4BHCA 2FSWA 2HTSA 1HQCA 1IW7F 1R5GA 4HQMA 3RDIA 1J7KA 1BL0A 1WJBA 9ANTA 4M3BA 2EIJH 3BTLA 2QSGX 4ZYAA 3M7GA 2O7OA 4IXAA 1SFOJ 5LEKA 4EQQA 1X1DA 2ZXWH 3WTXC 3OSFA 5FLXK 2NS0A 3A1YA 4ZYEA 4HDVA 2DXIA 1TQIA 4I02A 2V1UA 1R5HA 4LFUA 1QHGA 3FXRA 3OR2C 4I76A 2QSFX 1G59A 3GTPJ 2F48A 2IPQX 2B0LA 4L9NA 1AKHB 1E2XA 1U5TA 5IYDJ 1W5SA 2VXZA 2VKDA 5HNFA 5L3FA 2KJCA 3CMEI 1FC3A 5J1UA 3DTIA 3V4GA 2IJLA 1B72B 3PNVA 4WK8F 1BN5A 1D0ZA 2AQEA 3HOTA 2RNJA 3L2VA 2XAJA 1D3YA 1J5YA 1T98A 4N9IA 3ZQIA 3ZN0A 4D5CA 5FROA 3P5JA 3A01A 3QPSA 2K7LA 3CUQA 3NEUA 1SFUA 5FJ8J 3CCYA 5JFRA 4F93B 4CH7A 1K78A 3PQJA 4LK1F 1SC7A 1MD0A 3G4SI 1I6XA 3WE2A 3WHBA 4P96A 1ZLKA 1U3EM 2KKOA 4IHYA 5GPCA 4JX5A 2XC7A 1MMSA 4JBAA 4ESJA 2KFDA 2FNPA 1ETVA 4H4KC 2EWNA 3OYCA 3VPRA 5D8KB 1B8IB 4RB3C 2VASA 2GXAA 4HLXA 3A03A 4G94A 4I99C 2LFBA 4CCMA 3VFZA 4HNUA 2QQ8A 1O3RA 3HOVJ 4BHPA 4QPOA 3ZOBA 1YE9A 1FBUA 4G7HF 2VUMJ 2QZ8A 1IAWA 5L3DA 1LDDA 2DJIA 2ECBA 1G4DA 3OYFA 2Y30A 2MH2A 5M3MJ 2ICWG 3PL8A 3CZ6A 5JHUA 2UXXA 1B9NA 1V55H 4MNUA 1QVTA 4PFOA 2IGOA 3BQYA 2DTZA 4CCOA 3Q5FA 4KN4X 3K6GA 5LHIA 2ME6A 2M8GX 2YUSA 1IUFA 2FMLA 2HOEA 2DFFA 1YW8A 3HRTA 4DW6A 1PDNC 1WJEA 4RB1A 2BYVE 3BR0A 4L9TA 3OSGA 4E7JA 4B44A 2E2JJ 5K7FA 1T8IA 3E5QA 2LKPA 1IN7A 3RKXA 2AO9A 3CMAI 1X1PA 2CUJA 3FIWA 5FLMJ 1KU2A 4RGXA 4ENJA 3FXMA 2DPUA 5IY5H 4A3IJ 1S7EA 1KA8A 3LWFA 1FY7A 1H9TA 4I7HA 2IS2A 1JKPC 2DT5A 1G3SA 3GTLJ 3IH3A 3WU1B 2FU4A 3WG7H 2HS5A 3ISPA 3AKZA 2FEZA 3S14J 2QVOA 2MBFA 5L3GA 3PSFA 1U6GA 2QEXI 2KZGA 1WZ2A 4UUSB 2K40A 1QBJA 2DTRA 1EH6A 5E17F 1I5ZA 1D0XA 4M6VA 2O6GE 5F0HA 5TRDA 2PX9A 1LQ1A 2FQ4A 2FXAA 5ICFA 2LMDA 4N0BA 2R7DA 2P7CB 1SFXA 4DZPA 3DU6A 2R5YB 1DDNA 3HEFA 2MC3A 4A3FJ 2F5VA 2EA2A 2PJRA 3QAHA 1FEXA 1SVMA 4EV0A 3H0DA 2JSPA 2JVHA 3B6AA 5BOXA 3VYTB 1PP8F 2NVUB 3J7AY 2L7KA 3G1OA 2MH9A 4A12A 5DTDA 4NQWA 3HB9A 3L1PA 3EPZA 4P55A 2FBHA 4DQ2A 4S0HB 4U0WA 2G0EA 1LNWA 2D5VA 3CF2A 1YRNB 3DEWA 1FBQA 2OCCH 2HPIA 3S3NA 3OV8A 1ZAOA 1EH7A 1OYIA 2E35A 2XSJC 3BQZA 2DDAA 4LK0F 4D9JA 3WTZA 2HZTA 3KLOA
chains in the Genus database with same CATH topology
3E6MA 4JQFA 4OIPF 5K5QA 3KETA 1FOKA 3NQOA 3WTTC 2OZ6A 3C3WA 4CHUA 5FD6A 4UVCA 4Y13A 3BOQA 3WTSC 2JSCA 4ZZDA 5L3EA 3QU6A 2PG4A 4U0VA 1BIBA 2FBKA 4O3MA 5E1ZB 4EGZA 4UHTA 3ZMZA 1YG2A 4IHSA 3VODA 1FYKA 3JAMZ 4H0EA 5HS9A 3ZQ7A 3IRQA 2HGCA 2ZFWA 5J8CA 2DO7A 3KP5A 4EJWA 3I71A 2FE3A 5CYVA 2JPCA 5DUIA 4CXFA 3HHGA 1OKRA 1MJBA 3DF8A 3HYIA 2CWEA 3I5UA 2EV5A 1MZBA 3HTUA 2W84A 3GW2A 4KIFA 4HF1A 5LRRA 2BE5F 5IT3A 1IUYA 3ULQB 4XSZF 3LSTA 1W4MA 2HKXA 2F2EA 5BQTA 1BJAA 1R23A 2ZCWA 3IKVA 1YQAA 2L02A 1G3YA 2CFXA 5DDGA 2OBPA 2QLZA 3VB2A 1D5VA 2O8XA 5HLIA 3FF5A 3QOPA 5HDGA 5ILSA 1Z6TA 2V1DA 1YS6A 2IT0A 3G73A 2IA0A 2W24A 1USTA 2FOKA 4LG0A 1J9IA 4QLCU 1XSVA 4GCVA 4LB5A 2R7FA 1YO5C 2FRHA 1U8RA 4KN7X 3IC7A 5K1YA 5D6FA 2ESNA 2VONA 4MTDA 3REOA 3CLOA 1TNSA 4UUVA 1WWXA 4U7DA 4KNYA 2NRAC 4XLNF 3E6CC 4GO1A 3EYIA 4IRGA 3WTUC 2OAZA 2E7XA 2W25A 2HTJA 3J80K 2YPRA 3VEPA 4MTEA 5CVJA 2Y48A 3TDZC 1R1VA 2Y0MA 2LF8A 1Y0UA 3LAJA 1LEBA 3I59B 1BBYA 2XIGA 3P9CA 3O2PE 2K02A 5JR3A 2EFNA 1T2KA 3Q9VA 4FX0A 2FBIA 1ON2A 4RS8A 4I98B 3GFLA 4PDKA 4ZH4F 1U5TC 3DQVC 1XMAA 3D0SA 1YYVA 2RN7A 2IP2A 4MGRA 5FLXZ 5ICEA 2H09A 5JVTA 1KYWA 4UVBA 2IA1A 4R79A 2PMUA 1GXQA 4L0ZB 2O61A 2QBYA 5ICGA 1BOAA 1IRGA 2RC4A 1ZARA 1QZYA 4M71A 5LGTA 3LQRA 3TQNA 5D4SA 1JHHA 3NRVA 4KIGA 2ZXJA 5FD5A 3KEQA 3EETA 5LLQA 1X3UA 2G7UA 4YIFA 3QU3A 3MAJA 1FT9A 3P9IA 2CO5A 1ONVA 1KQ0A 1A04A 1CF7B 1HKTA 2FMYA 3ZMTA 3DXJF 2DQLA 4PCQA 2RV8A 1ZGAA 2KIMA 2PMHA 3KEOA 3QP6A 1DUXC 2CQKA 1YLFA 1XB4A 3WE3A 2EFQA 2HQRA 1IXSB 1PUEE 3KCCA 4Q47A 2K86A 4YFXF 2DPDA 2DI3A 1GHCA 2HKOA 1G6NA 1TLHB 2V79A 5BS6A 2RVCA 2VE9A 3WG9A 1FPQA 4WXDA 4IRIA 1BC7C 3R4KA 3ZPLA 1I1GA 2ZKZA 1MJAA 4MEYF 2E1CA 3T5XA 2P6SA 1ZLJA 2RDPA 1BIAA 2L4AA 2HEOA 2EJRA 5ILUA 1UHMA 2DLLA 1I27A 2Z5UA 1FZPB 3SFZA 1K7AA 1WI9A 1HXDA 1JGSA 4D0PA 1USSA 3E3VA 1KU3A 2VE8A 2BGCA 1OYYA 2L3DA 2CGPA 1Q1HA 1WQ2A 5E1WA 4HW0A 2GQQA 3KP7A 1YS7A 5FGMA 1LEAA 4KDPA 1LVAA 5E8GA 1ZGJA 1U78A 3F3XA 2XVCA 2E7WA 3RTRA 1MGTA 4HZFA 1E17A 2M8EA 4ZZLA 4OIQF 4BNCA 3MQ0A 1R1TA 1AWCA 4HLYA 1K6OA 4LB6B 2YR2A 1Z6RA 3E5UA 2QQAA 1S3JA 4CZZA 1ZG3A 2ZMEA 4P5OA 3GZ6A 2PBIA 5D4RA 2M5WA 1DP7P 4FX4A 2WV0A 3C1DA 5AONA 1PP7U 4HF0A 2D1VA 5CVRA 4OIRF 1I1SA 2BBYA 1MDMA 1L0OC 5ERIA 3J7AO 1HSTA 3CTAA 2P6TA 3FMRA 1ODDA 3COAC 1LDJA 5EEHA 1OPCA 1U2WA 4HX8A 5TJJA 1LJ9A 4EM1A 5IT9K 1XSDA 3JTHA 4HAMA 2KRFA 5DD4A 2C6YA 2G9WA 4OIOF 1W7PA 1K79A 5DUKA 5ED4A 3Q9SA 1B59A 5LEJA 4MEXF 1FNNA 1CGPA 3L7WA 1ZG1A 3V7RA 1HBXG 2IRFG 3F8BA 4HQEA 2M1BA 2ZNZA 4KFCA 5CJ9A 1XMKA 4M9XA 4EMSA 2A07F 3K69A 4B8XA 3WGHA 1HKSA 3GFJA 5D5XB 2O0YA 1ZN2A 1KYZA 4LLLA 4L0YB 5HOOA 2Y75A 1JE8A 4L9JA 4ENKA 1XD7A 4UV9A 2TDXA 4LMYA 1CF7A 2HWVA 1HSJA 3JW4A 2XAHA 3MEXA 3JSOA 1B4AA 1OYWA 2HYFA 2Q2EA 2DQRA 3KP6A 2Q0OA 5DCMA 4LLNA 3ABUA 3HHHA 2A3SA 3J80Z 3K2ZA 3HSEA 3B02A 4ESFA 3M8FA 1XN7A 5F6FA 2YX7A 6PAXA 1FYLA 4YIIA 4RGRA 2ETHA 1P4XA 5E20A 3WU0A 1UB9A 2JZYA 5KVRA 2PI0A 3F8CA 4Q5SF 3BPVA 1MJ9A 1O57A 4IVNA 4N9HA 3F23A 1BM9A 1IN6A 1F9NA 2YU3A 5F1RA 4Z2YA 1RI7A 4ENNA 4G7ZF 4CYDA 1O3QA 2ADUA 2EA4A 5FO5A 2DK5A 3CO6C 4EVIA 1RZ4A 5H6RA 3QP5A 5AIQA 4BXUA 4G6DA 4IF4A 2ZBKA 1DPRA 2ISYA 1ZG5A 4RGUA 4I01A 1XDSA 2GA1A 4PGHA 2PFBA 2ESHA 4DNCA 5D5UB 3F6VA 2MLKA 2GAUA 3GO5A 2JRTA 3KE2A 4RB2C 1RIOH 2V6CA 3SQNA 1Z05A 2NNYA 3F8MA 3HSFA 2PQ8A 4S05A 5FFXA 4EJTA 1W5TA 1FP1D 1KGSA 4OINF 3ZP5A 3T8RA 3I0TA 4M72A 1DPUA 3RKYA 2EV6A 3HRSA 4ENMA 3F22A 4WX9A 1IXRC 4EJVA 2PEXA 4LD5A 1GVJA 2XAGA 1UCRA 4BAYA 2E1NA 5E8IA 1RUOA 2X0LA 1ZHFA 1D8KA 1TNTA 3CDHA 2R3SA 3VOEA 2OQRA 2OU2A 4RAZA 1IF1A 4AD9A 3OOPA 4ZYGA 2QYOA 2A61A 2W85A 1GXPA 3U9GA 2V1XA 2HR3A 2A6EF 4KMUX 2STTA 3WGGA 1RUNA 2JTVA 5K5RA 3GF2A 4L5JA 1OR7A 2VN2A 3FMSA 1Z7UA 1O3SA 1SFEA 2EFPA 5LGUA 3GEZA 4G8XA 1U5TB 4UNOA 2P5VA 3KP2A 3ABTA 1KU7A 3IL2A 1R7JA 2LF7A 3ML6A 1C0WA 4A0XA 1EV7A 1S8NA 4KIBA 4ON0A 1T6SA 3CUQB 3R61A 1QPMA 1K78B 2KIFA 4WXCA 1OMIA 3FHZA 2G7HA 2XHKA 2K4BA 3T0YA 3BY6A 3E6BA 2XAQA 3BJOA 4EM2A 1ZREA 3V8KA 5J8FA 1R1UA 1FP2A 3JTGA 4MQ9F 3ZMUA 2FNAA 3H3UA 3H92A 1XCBA 2WTEA 4EM0B 1YW9A 1HKQA 3KFWX 1FSEA 4WCGA 1P4WA 1XGOA 3CUQC 3N4MA 2CG4A 4LLGF 3KLNA 4A6EA 2A6HF 2KJBA 3KP3A 2DAOA 4RB0A 2WC2A 2GWRA 1G3WA 1J2XA 1L3LA 1BI3A 5KK1A 4A2UA 3D5LA 1XGMA 1EH8A 5LRSA 1HW2A 1SD6A 4L9VA 1T38A 3F21A 1Z9CA 3LA2A 3FZVA 2F5FA 3KP4A 4PGGA 3K0LA 4LJZF 4HV5A 4HOBA 2JT1A 1AOYA 2MLGA 3H3ZA 1Z91A 2YSRA 2PLYA 4AIJA 3ECOA 4YFKF 3DKWA 2QM3A 4LGWA 5CLSA 3LAPA 4IJAA 3LQQA 1W7PD 4ZYHA 5ILVA 3SHFA 2H27A 1V4RA 4WWCA 3T1BA 2M30A 4ESBA 2JPBA 1WSUA 2OQGA 4UV8A 4KA4A 2K27A 1SD7A 1BI2A 4KUMA 4KMFA 1D8JA 3GXOA 4AIHA 3U1DA 3L2CA 1BC8C 2D1HA 4IHTA 2RGVA 3TDUC 2UWMA 5DCFA 2A5YB 3N97A 1REPC 2ACJA 4M73A 2FF4A 1YIOA 4BHBA 3LA7A 4IPAA 4A0YA 3P9KA 1ZYRF 2MD5A 2EFWA 3FMQA 5LHHA 4GYGA 2AS5F 1SMYF 1SMTA 2XV4S 4QWQA 2IW5A 4YG2F 3DEUA 3FX3A 1YTYA 5E18F 1KU9A 4A5MA 3U2RA 5H6QA 4S04A 4CO8A 1XGNA 1HW1A 3GFIA 3PFIA 3IWZA 1Z1DA 2NAZA 4XRFA 2EK5A 2QUFA 2M87A 5AIPA 2L01A 1FBSA 1HW5A 1S6LA 2VT2A 3DP7A 1QQIA 2DK8A 2CYYA 3I64A 3KZYA 3W6JB 3HIFA 2BEOA 3HRMA 2H6CA 3SZPA 1TTYA 3F8FA 1QNTA 2QWWA 2VC1A 1H9GA 1TW3A 2FA5A 1F4KA 1T39A 3TOBA 3V7CA 3I59A 3J81K 3L9FA 3EQLF 4LG0B 2XASA 4XLPF 2GIVA 3TOAA 3HSRA 1S7OA 3G3ZA 3W6KB 2W57A 3MCZA 3R60A 3AAFA 4XSXF 2DU9A 5EEGA 3QPHA 5A2QK 1TQPA 4TV7A 1RNLA 2VBZA 2IVMA 4L18B 2VBWA 4XBFA 2Z3YA 4RAYA 4E70A 4OMYA 2L4MA 4I2OA 1IN5A 2GZWA 1R22A 4P9UA 3K1MA 3CUOA 2J5PA 4Y15A 2VBXA 3M8EA 4HDUA 4A0ZA 2D45A 3FXUA 2ELHA 4I09A 2VT3A 1P92A 1XCVA 1WRJA 3C7JA 3M9AA 3WTVC 2EB7A 3ELKA 5J6XA 4U88A 2XRNA 5LHGA 2XUBA 4R1HA 2A68F 3WGIA 2MA3A 2H94A 2AXLA 3HRUA 2LSOA 2Z99A 4HV6A 1TQMA 1QO0D 3P7NA 4M9ZA 5CVVA 3IHUA 2M45A 3T8TA 4MQVA 3HOSA 4WXHA 5F64A 1QGPA 5BPIA 1XSXA 3JSPA 1P6RA 3LA3A 2P7VB 2DFIA 3R6SA 2HDCA 4WF2A 2D2WA 5CVIA 3SXYA 4FT8A 1FSHA 2K4JA 3GLXA 1LB2A 2OA4A 4BYYA 3BZ6A 2O3FA 1G3TA 1B6AA 1S7AA 5HLHA 2QBYB 4YFNF 2Z33A 3M1EA 4Q4ZF 1WKMA 2QQBA 5D8LB 4HF2A 1STZA 2UXNA 1ZRDA 3ZN1A 4EGYA 2XKPA 3DPLC 2ZNYA 3MWMA 3F6OA 2HQNA 4HYEA 1ZRCA 1H0MA 3LFKA 3O3KA 3ZMVA 4M74A 3GYHX 4M9SA 1IZ1A 2P5LC 3I4PA 3IRRA 3BROA 2GA2A 4G9YA 1P2FA 2O03A 1R36A 4UXNA 3DV8A 2NYXA 3RYRA 3TGNA 1J59A 3BPXA 2OD5A 4OU0A 2YX4A 3EUHA 2FQ3A 3FXQA 1LDKB 2X4HA 4AWXB 4HX7A 1UHWA 4R8HA 3RPQA 2CSOA 2QQ9A 3ZMSA 5HS8A 4B09A 5E1XA 3MZHA 3GX4X 1ULYA 2RKHA 2V9VA 4I0AA 3RYPA 2LDUA 5DYMA 3S2WA 2ZO4A 1ON1A 2NNNA 1R58A 3RJPA 3GUDA 3MZYA 4KYWA 5D5VB 4NB5A 3B73A 2XROA 1XGSA 4CDGA 2PJPA 3F8NA 2Z9OA 5FFZA 1QZZA 1J0RA 2ZJ2A 5HDKA 3CJNA 2IA2A 5D5WB 2VC0A 3MFKA 4BQAA 3R0AA 2EV0A 2J5OA 4PZJA 3IKTA 2LNBA 4L5IA 4CGZA 4A6DA 2EFOA 1TBXA 2L54A 2F5CA 4U0YA 4GYIA 3QPTA 2QENA 5LBQA 2KIUA 3ZMDA 2A69F 5HLGA 2HYGD 3ECHA 2H6BA 1BI1A 2ZMEB 3I58A 1O7FA 2UZKA 1UFMA 1F5TA 3F72A 4KT5C 1ZRFA 5JI6A 5DV5A 3FWEA 5DD8A 5ICCA 2RQPA 2VBYA 1SD4A 2P5KA 1MKMA 1FX7A 1VTNC 1BI0A 2STWA 3BDDA 2F5DA 1MDMB 3TO9A 4KICA 4IRHA 4A5NA 2ISZA 1V3FA 3O6BB 5D6EA 3DPTA 4GXOA 5HS7A 4ASNA 1IN4A 3K9TA 1FYMA 1JHFA 3V8LA 5L3CA 4O5VA 1KQ8A 2CW0F 4HBLA 3PQKA 4UVAA 1W7PB 3L00A 3JAMK 1YW7A 4HX4A 3TO7A 3GFMA 4EJUA 1XDUA 1SAXA 2GXBA 2BV6A 5BMZA 2GXGA 5K5OA 2P8TA 4P9FA 1IXCA 1B1BA 1NHAA 3E5XA 4NHJA 4U7BA 1ZH5A 4Q48A 2XGXA 3WTYC 4OMZA 1J75A 3BJ6A 3EDPA 3BP8A 1JXSA 3BWGA 4EJOA 4M6XA 3RPUA 1O3TA 4CICA 3J81Z 3SZTA 5IT9Z 4I0BA 4ZYDA 3BJAA 2VOOA 4ETSA 2HFHA 4AVPA 5CVUA 4OOIA 1FWZA 2XAFA 3HTSB 1P4AA 5A2QZ 2WWYA 3HUGA 2Q8KA 2F5EA 3CO7C 1O7LA 1YFHA 3KZZA 5DCMB 5DEQA 3RIRA 4M6YA 5L3BA 1FLIA 4G7OF 3L09A 4BH9A 3DFGA 2P4WA 3IWFA 4AIKA 3RKWA 5H20A 3I54A 3K1NA 4HA8A 1KQ9A 3R0JA 1IRFA 3GZ5A 1IN8A 3C18A 3WODF 3FM5A 4MHGA 3E6DA 3QRFF 3E97A 3V7SA 4RGSA 1T0FA 2PN6A 2XKOA 4GGGA 4JK1X 3RI4A 3I53A 1S29A 3FM3A 3EYYA 1SD5A 2OZUA 3GWZA 3ERED 3WTWC 5FB2A 4Y17A 2DW4A 3GVAA 5HVQC 5LGNA 4O6JA 3TKYA 3TO6A 3ROUA 4G6QA 2DBBA 1B9MA 4FHTA 2COMA 5BPDA 4F7ZA 1R00A 3V8JA 4K2EA 1TW2A 2VODA 2VOPA 5HDNA 1F1ZA 3K1PA 4BHCA 2FSWA 2HTSA 1HQCA 1IW7F 1R5GA 4HQMA 3RDIA 1J7KA 3M7GA 4IXAA 5LEKA 4EQQA 3WTXC 5FLXK 2NS0A 4ZYEA 4HDVA 1TQIA 4I02A 2V1UA 1R5HA 4LFUA 3FXRA 2IPQX 2B0LA 4L9NA 1E2XA 1U5TA 1W5SA 2VXZA 5L3FA 2KJCA 1FC3A 3V4GA 2IJLA 4WK8F 1BN5A 3HOTA 2RNJA 2XAJA 1D3YA 1J5YA 1T98A 4N9IA 3ZN0A 2K7LA 3CUQA 3NEUA 1SFUA 5JFRA 1K78A 3PQJA 4LK1F 1MD0A 1I6XA 3WE2A 4P96A 1ZLKA 1U3EM 2KKOA 4JBAA 4ESJA 2FNPA 2EWNA 5D8KB 4RB3C 4HLXA 4G94A 3VFZA 1O3RA 4BHPA 1FBUA 4G7HF 2QZ8A 1IAWA 5L3DA 1LDDA 1G4DA 2MH2A 5JHUA 2UXXA 1B9NA 4MNUA 3Q5FA 4KN4X 5LHIA 2FMLA 2HOEA 1PDNC 3HRTA 1YW8A 4RB1A 2BYVE 4L9TA 3E5QA 2LKPA 1IN7A 3RKXA 1KU2A 4RGXA 4ENJA 2DPUA 1KA8A 3LWFA 1FY7A 1H9TA 4I7HA 2DT5A 1G3SA 3WU1B 2FU4A 2HS5A 3ISPA 2FEZA 2QVOA 2MBFA 5L3GA 1U6GA 1QBJA 2DTRA 1EH6A 5E17F 1I5ZA 2O6GE 5TRDA 1LQ1A 2FXAA 5ICFA 4N0BA 2R7DA 2P7CB 1SFXA 1DDNA 2MC3A 2EA2A 3QAHA 4EV0A 5BOXA 1PP8F 2MH9A 4A12A 4NQWA 4P55A 2FBHA 4DQ2A 4U0WA 1LNWA 1FBQA 3OV8A 1ZAOA 1EH7A 1OYIA 4LK0F 3WTZA 2HZTA 3KLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6M A;  4JQF A;  4OIP F;  5K5Q A;  3KET A;  1FOK A;  3NQO A;  3WTT C;  2OZ6 A;  3C3W A;  4CHU A;  5FD6 A;  4UVC A;  4Y13 A;  3BOQ A;  3WTS C;  2JSC A;  4ZZD A;  5L3E A;  3QU6 A;  2PG4 A;  4U0V A;  1BIB A;  2FBK A;  4O3M A;  5E1Z B;  4EGZ A;  4UHT A;  3ZMZ A;  1YG2 A;  4IHS A;  3VOD A;  1FYK A;  3JAM Z;  4H0E A;  5HS9 A;  3ZQ7 A;  3IRQ A;  2HGC A;  2ZFW A;  5J8C A;  2DO7 A;  3KP5 A;  4EJW A;  3I71 A;  2FE3 A;  5CYV A;  2JPC A;  5DUI A;  4CXF A;  3HHG A;  1OKR A;  1MJB A;  3DF8 A;  3HYI A;  2CWE A;  3I5U A;  2EV5 A;  1MZB A;  3HTU A;  2W84 A;  3GW2 A;  4KIF A;  4HF1 A;  5LRR A;  2BE5 F;  5IT3 A;  1IUY A;  3ULQ B;  4XSZ F;  3LST A;  1W4M A;  2HKX A;  2F2E A;  5BQT A;  1BJA A;  1R23 A;  2ZCW A;  3IKV A;  1YQA A;  2L02 A;  1G3Y A;  2CFX A;  5DDG A;  2OBP A;  2QLZ A;  3VB2 A;  1D5V A;  2O8X A;  5HLI A;  3FF5 A;  3QOP A;  5HDG A;  5ILS A;  1Z6T A;  2V1D A;  1YS6 A;  2IT0 A;  3G73 A;  2IA0 A;  2W24 A;  1UST A;  2FOK A;  4LG0 A;  1J9I A;  4QLC U;  1XSV A;  4GCV A;  4LB5 A;  2R7F A;  1YO5 C;  2FRH A;  1U8R A;  4KN7 X;  3IC7 A;  5K1Y A;  5D6F A;  2ESN A;  2VON A;  4MTD A;  3REO A;  3CLO A;  1TNS A;  4UUV A;  1WWX A;  4U7D A;  4KNY A;  2NRA C;  4XLN F;  3E6C C;  4GO1 A;  3EYI A;  4IRG A;  3WTU C;  2OAZ A;  2E7X A;  2W25 A;  2HTJ A;  3J80 K;  2YPR A;  3VEP A;  4MTE A;  5CVJ A;  2Y48 A;  3TDZ C;  1R1V A;  2Y0M A;  2LF8 A;  1Y0U A;  3LAJ A;  1LEB A;  3I59 B;  1BBY A;  2XIG A;  3P9C A;  3O2P E;  2K02 A;  5JR3 A;  2EFN A;  1T2K A;  3Q9V A;  4FX0 A;  2FBI A;  1ON2 A;  4RS8 A;  4I98 B;  3GFL A;  4PDK A;  4ZH4 F;  1U5T C;  3DQV C;  1XMA A;  3D0S A;  1YYV A;  2RN7 A;  2IP2 A;  4MGR A;  5FLX Z;  5ICE A;  2H09 A;  5JVT A;  1KYW A;  4UVB A;  2IA1 A;  4R79 A;  2PMU A;  1GXQ A;  4L0Z B;  2O61 A;  2QBY A;  5ICG A;  1BOA A;  1IRG A;  2RC4 A;  1ZAR A;  1QZY A;  4M71 A;  5LGT A;  3LQR A;  3TQN A;  5D4S A;  1JHH A;  3NRV A;  4KIG A;  2ZXJ A;  5FD5 A;  3KEQ A;  3EET A;  5LLQ A;  1X3U A;  2G7U A;  4YIF A;  3QU3 A;  3MAJ A;  1FT9 A;  3P9I A;  2CO5 A;  1ONV A;  1KQ0 A;  1A04 A;  1CF7 B;  1HKT A;  2FMY A;  3ZMT A;  3DXJ F;  2DQL A;  4PCQ A;  2RV8 A;  1ZGA A;  2KIM A;  2PMH A;  3KEO A;  3QP6 A;  1DUX C;  2CQK A;  1YLF A;  1XB4 A;  3WE3 A;  2EFQ A;  2HQR A;  1IXS B;  1PUE E;  3KCC A;  4Q47 A;  2K86 A;  4YFX F;  2DPD A;  2DI3 A;  1GHC A;  2HKO A;  1G6N A;  1TLH B;  2V79 A;  5BS6 A;  2RVC A;  2VE9 A;  3WG9 A;  1FPQ A;  4WXD A;  4IRI A;  1BC7 C;  3R4K A;  3ZPL A;  1I1G A;  2ZKZ A;  1MJA A;  4MEY F;  2E1C A;  3T5X A;  2P6S A;  1ZLJ A;  2RDP A;  1BIA A;  2L4A A;  2HEO A;  2EJR A;  5ILU A;  1UHM A;  2DLL A;  1I27 A;  2Z5U A;  1FZP B;  3SFZ A;  1K7A A;  1WI9 A;  1HXD A;  1JGS A;  4D0P A;  1USS A;  3E3V A;  1KU3 A;  2VE8 A;  2BGC A;  1OYY A;  2L3D A;  2CGP A;  1Q1H A;  1WQ2 A;  5E1W A;  4HW0 A;  2GQQ A;  3KP7 A;  1YS7 A;  5FGM A;  1LEA A;  4KDP A;  1LVA A;  5E8G A;  1ZGJ A;  1U78 A;  3F3X A;  2XVC A;  2E7W A;  3RTR A;  1MGT A;  4HZF A;  1E17 A;  2M8E A;  4ZZL A;  4OIQ F;  4BNC A;  3MQ0 A;  1R1T A;  1AWC A;  4HLY A;  1K6O A;  4LB6 B;  2YR2 A;  1Z6R A;  3E5U A;  2QQA A;  1S3J A;  4CZZ A;  1ZG3 A;  2ZME A;  4P5O A;  3GZ6 A;  2PBI A;  5D4R A;  2M5W A;  1DP7 P;  4FX4 A;  2WV0 A;  3C1D A;  5AON A;  1PP7 U;  4HF0 A;  2D1V A;  5CVR A;  4OIR F;  1I1S A;  2BBY A;  1MDM A;  1L0O C;  5ERI A;  3J7A O;  1HST A;  3CTA A;  2P6T A;  3FMR A;  1ODD A;  3COA C;  1LDJ A;  5EEH A;  1OPC A;  1U2W A;  4HX8 A;  5TJJ A;  1LJ9 A;  4EM1 A;  5IT9 K;  1XSD A;  3JTH A;  4HAM A;  2KRF A;  5DD4 A;  2C6Y A;  2G9W A;  4OIO F;  1W7P A;  1K79 A;  5DUK A;  5ED4 A;  3Q9S A;  1B59 A;  5LEJ A;  4MEX F;  1FNN A;  1CGP A;  3L7W A;  1ZG1 A;  3V7R A;  1HBX G;  2IRF G;  3F8B A;  4HQE A;  2M1B A;  2ZNZ A;  4KFC A;  5CJ9 A;  1XMK A;  4M9X A;  4EMS A;  2A07 F;  3K69 A;  4B8X A;  3WGH A;  1HKS A;  3GFJ A;  5D5X B;  2O0Y A;  1ZN2 A;  1KYZ A;  4LLL A;  4L0Y B;  5HOO A;  2Y75 A;  1JE8 A;  4L9J A;  4ENK A;  1XD7 A;  4UV9 A;  2TDX A;  4LMY A;  1CF7 A;  2HWV A;  1HSJ A;  3JW4 A;  2XAH A;  3MEX A;  3JSO A;  1B4A A;  1OYW A;  2HYF A;  2Q2E A;  2DQR A;  3KP6 A;  2Q0O A;  5DCM A;  4LLN A;  3ABU A;  3HHH A;  2A3S A;  3J80 Z;  3K2Z A;  3HSE A;  3B02 A;  4ESF A;  3M8F A;  1XN7 A;  5F6F A;  2YX7 A;  6PAX A;  1FYL A;  4YII A;  4RGR A;  2ETH A;  1P4X A;  5E20 A;  3WU0 A;  1UB9 A;  2JZY A;  5KVR A;  2PI0 A;  3F8C A;  4Q5S F;  3BPV A;  1MJ9 A;  1O57 A;  4IVN A;  4N9H A;  3F23 A;  1BM9 A;  1IN6 A;  1F9N A;  2YU3 A;  5F1R A;  4Z2Y A;  1RI7 A;  4ENN A;  4G7Z F;  4CYD A;  1O3Q A;  2ADU A;  2EA4 A;  5FO5 A;  2DK5 A;  3CO6 C;  4EVI A;  1RZ4 A;  5H6R A;  3QP5 A;  5AIQ A;  4BXU A;  4G6D A;  4IF4 A;  2ZBK A;  1DPR A;  2ISY A;  1ZG5 A;  4RGU A;  4I01 A;  1XDS A;  2GA1 A;  4PGH A;  2PFB A;  2ESH A;  4DNC A;  5D5U B;  3F6V A;  2MLK A;  2GAU A;  3GO5 A;  2JRT A;  3KE2 A;  4RB2 C;  1RIO H;  2V6C A;  3SQN A;  1Z05 A;  2NNY A;  3F8M A;  3HSF A;  2PQ8 A;  4S05 A;  5FFX A;  4EJT A;  1W5T A;  1FP1 D;  1KGS A;  4OIN F;  3ZP5 A;  3T8R A;  3I0T A;  4M72 A;  1DPU A;  3RKY A;  2EV6 A;  3HRS A;  4ENM A;  3F22 A;  4WX9 A;  1IXR C;  4EJV A;  2PEX A;  4LD5 A;  1GVJ A;  2XAG A;  1UCR A;  4BAY A;  2E1N A;  5E8I A;  1RUO A;  2X0L A;  1ZHF A;  1D8K A;  1TNT A;  3CDH A;  2R3S A;  3VOE A;  2OQR A;  2OU2 A;  4RAZ A;  1IF1 A;  4AD9 A;  3OOP A;  4ZYG A;  2QYO A;  2A61 A;  2W85 A;  1GXP A;  3U9G A;  2V1X A;  2HR3 A;  2A6E F;  4KMU X;  2STT A;  3WGG A;  1RUN A;  2JTV A;  5K5R A;  3GF2 A;  4L5J A;  1OR7 A;  2VN2 A;  3FMS A;  1Z7U A;  1O3S A;  1SFE A;  2EFP A;  5LGU A;  3GEZ A;  4G8X A;  1U5T B;  4UNO A;  2P5V A;  3KP2 A;  3ABT A;  1KU7 A;  3IL2 A;  1R7J A;  2LF7 A;  3ML6 A;  1C0W A;  4A0X A;  1EV7 A;  1S8N A;  4KIB A;  4ON0 A;  1T6S A;  3CUQ B;  3R61 A;  1QPM A;  1K78 B;  2KIF A;  4WXC A;  1OMI A;  3FHZ A;  2G7H A;  2XHK A;  2K4B A;  3T0Y A;  3BY6 A;  3E6B A;  2XAQ A;  3BJO A;  4EM2 A;  1ZRE A;  3V8K A;  5J8F A;  1R1U A;  1FP2 A;  3JTG A;  4MQ9 F;  3ZMU A;  2FNA A;  3H3U A;  3H92 A;  1XCB A;  2WTE A;  4EM0 B;  1YW9 A;  1HKQ A;  3KFW X;  1FSE A;  4WCG A;  1P4W A;  1XGO A;  3CUQ C;  3N4M A;  2CG4 A;  4LLG F;  3KLN A;  4A6E A;  2A6H F;  2KJB A;  3KP3 A;  2DAO A;  4RB0 A;  2WC2 A;  2GWR A;  1G3W A;  1J2X A;  1L3L A;  1BI3 A;  5KK1 A;  4A2U A;  3D5L A;  1XGM A;  1EH8 A;  5LRS A;  1HW2 A;  1SD6 A;  4L9V A;  1T38 A;  3F21 A;  1Z9C A;  3LA2 A;  3FZV A;  2F5F A;  3KP4 A;  4PGG A;  3K0L A;  4LJZ F;  4HV5 A;  4HOB A;  2JT1 A;  1AOY A;  2MLG A;  3H3Z A;  1Z91 A;  2YSR A;  2PLY A;  4AIJ A;  3ECO A;  4YFK F;  3DKW A;  2QM3 A;  4LGW A;  5CLS A;  3LAP A;  4IJA A;  3LQQ A;  1W7P D;  4ZYH A;  5ILV A;  3SHF A;  2H27 A;  1V4R A;  4WWC A;  3T1B A;  2M30 A;  4ESB A;  2JPB A;  1WSU A;  2OQG A;  4UV8 A;  4KA4 A;  2K27 A;  1SD7 A;  1BI2 A;  4KUM A;  4KMF A;  1D8J A;  3GXO A;  4AIH A;  3U1D A;  3L2C A;  1BC8 C;  2D1H A;  4IHT A;  2RGV A;  3TDU C;  2UWM A;  5DCF A;  2A5Y B;  3N97 A;  1REP C;  2ACJ A;  4M73 A;  2FF4 A;  1YIO A;  4BHB A;  3LA7 A;  4IPA A;  4A0Y A;  3P9K A;  1ZYR F;  2MD5 A;  2EFW A;  3FMQ A;  5LHH A;  4GYG A;  2AS5 F;  1SMY F;  1SMT A;  2XV4 S;  4QWQ A;  2IW5 A;  4YG2 F;  3DEU A;  3FX3 A;  1YTY A;  5E18 F;  1KU9 A;  4A5M A;  3U2R A;  5H6Q A;  4S04 A;  4CO8 A;  1XGN A;  1HW1 A;  3GFI A;  3PFI A;  3IWZ A;  1Z1D A;  2NAZ A;  4XRF A;  2EK5 A;  2QUF A;  2M87 A;  5AIP A;  2L01 A;  1FBS A;  1HW5 A;  1S6L A;  2VT2 A;  3DP7 A;  1QQI A;  2DK8 A;  2CYY A;  3I64 A;  3KZY A;  3W6J B;  3HIF A;  2BEO A;  3HRM A;  2H6C A;  3SZP A;  1TTY A;  3F8F A;  1QNT A;  2QWW A;  2VC1 A;  1H9G A;  1TW3 A;  2FA5 A;  1F4K A;  1T39 A;  3TOB A;  3V7C A;  3I59 A;  3J81 K;  3L9F A;  3EQL F;  4LG0 B;  2XAS A;  4XLP F;  2GIV A;  3TOA A;  3HSR A;  1S7O A;  3G3Z A;  3W6K B;  2W57 A;  3MCZ A;  3R60 A;  3AAF A;  4XSX F;  2DU9 A;  5EEG A;  3QPH A;  5A2Q K;  1TQP A;  4TV7 A;  1RNL A;  2VBZ A;  2IVM A;  4L18 B;  2VBW A;  4XBF A;  2Z3Y A;  4RAY A;  4E70 A;  4OMY A;  2L4M A;  4I2O A;  1IN5 A;  2GZW A;  1R22 A;  4P9U A;  3K1M A;  3CUO A;  2J5P A;  4Y15 A;  2VBX A;  3M8E A;  4HDU A;  4A0Z A;  2D45 A;  3FXU A;  2ELH A;  4I09 A;  2VT3 A;  1P92 A;  1XCV A;  1WRJ A;  3C7J A;  3M9A A;  3WTV C;  2EB7 A;  3ELK A;  5J6X A;  4U88 A;  2XRN A;  5LHG A;  2XUB A;  4R1H A;  2A68 F;  3WGI A;  2MA3 A;  2H94 A;  2AXL A;  3HRU A;  2LSO A;  2Z99 A;  4HV6 A;  1TQM A;  1QO0 D;  3P7N A;  4M9Z A;  5CVV A;  3IHU A;  2M45 A;  3T8T A;  4MQV A;  3HOS A;  4WXH A;  5F64 A;  1QGP A;  5BPI A;  1XSX A;  3JSP A;  1P6R A;  3LA3 A;  2P7V B;  2DFI A;  3R6S A;  2HDC A;  4WF2 A;  2D2W A;  5CVI A;  3SXY A;  4FT8 A;  1FSH A;  2K4J A;  3GLX A;  1LB2 A;  2OA4 A;  4BYY A;  3BZ6 A;  2O3F A;  1G3T A;  1B6A A;  1S7A A;  5HLH A;  2QBY B;  4YFN F;  2Z33 A;  3M1E A;  4Q4Z F;  1WKM A;  2QQB A;  5D8L B;  4HF2 A;  1STZ A;  2UXN A;  1ZRD A;  3ZN1 A;  4EGY A;  2XKP A;  3DPL C;  2ZNY A;  3MWM A;  3F6O A;  2HQN A;  4HYE A;  1ZRC A;  1H0M A;  3LFK A;  3O3K A;  3ZMV A;  4M74 A;  3GYH X;  4M9S A;  1IZ1 A;  2P5L C;  3I4P A;  3IRR A;  3BRO A;  2GA2 A;  4G9Y A;  1P2F A;  2O03 A;  1R36 A;  4UXN A;  3DV8 A;  2NYX A;  3RYR A;  3TGN A;  1J59 A;  3BPX A;  2OD5 A;  4OU0 A;  2YX4 A;  3EUH A;  2FQ3 A;  3FXQ A;  1LDK B;  2X4H A;  4AWX B;  4HX7 A;  1UHW A;  4R8H A;  3RPQ A;  2CSO A;  2QQ9 A;  3ZMS A;  5HS8 A;  4B09 A;  5E1X A;  3MZH A;  3GX4 X;  1ULY A;  2RKH A;  2V9V A;  4I0A A;  3RYP A;  2LDU A;  5DYM A;  3S2W A;  2ZO4 A;  1ON1 A;  2NNN A;  1R58 A;  3RJP A;  3GUD A;  3MZY A;  4KYW A;  5D5V B;  4NB5 A;  3B73 A;  2XRO A;  1XGS A;  4CDG A;  2PJP A;  3F8N A;  2Z9O A;  5FFZ A;  1QZZ A;  1J0R A;  2ZJ2 A;  5HDK A;  3CJN A;  2IA2 A;  5D5W B;  2VC0 A;  3MFK A;  4BQA A;  3R0A A;  2EV0 A;  2J5O A;  4PZJ A;  3IKT A;  2LNB A;  4L5I A;  4CGZ A;  4A6D A;  2EFO A;  1TBX A;  2L54 A;  2F5C A;  4U0Y A;  4GYI A;  3QPT A;  2QEN A;  5LBQ A;  2KIU A;  3ZMD A;  2A69 F;  5HLG A;  2HYG D;  3ECH A;  2H6B A;  1BI1 A;  2ZME B;  3I58 A;  1O7F A;  2UZK A;  1UFM A;  1F5T A;  3F72 A;  4KT5 C;  1ZRF A;  5JI6 A;  5DV5 A;  3FWE A;  5DD8 A;  5ICC A;  2RQP A;  2VBY A;  1SD4 A;  2P5K A;  1MKM A;  1FX7 A;  1VTN C;  1BI0 A;  2STW A;  3BDD A;  2F5D A;  1MDM B;  3TO9 A;  4KIC A;  4IRH A;  4A5N A;  2ISZ A;  1V3F A;  3O6B B;  5D6E A;  3DPT A;  4GXO A;  5HS7 A;  4ASN A;  1IN4 A;  3K9T A;  1FYM A;  1JHF A;  3V8L A;  5L3C A;  4O5V A;  1KQ8 A;  2CW0 F;  4HBL A;  3PQK A;  4UVA A;  1W7P B;  3L00 A;  3JAM K;  1YW7 A;  4HX4 A;  3TO7 A;  3GFM A;  4EJU A;  1XDU A;  1SAX A;  2GXB A;  2BV6 A;  5BMZ A;  2GXG A;  5K5O A;  2P8T A;  4P9F A;  1IXC A;  1B1B A;  1NHA A;  3E5X A;  4NHJ A;  4U7B A;  1ZH5 A;  4Q48 A;  2XGX A;  3WTY C;  4OMZ A;  1J75 A;  3BJ6 A;  3EDP A;  3BP8 A;  1JXS A;  3BWG A;  4EJO A;  4M6X A;  3RPU A;  1O3T A;  4CIC A;  3J81 Z;  3SZT A;  5IT9 Z;  4I0B A;  4ZYD A;  3BJA A;  2VOO A;  4ETS A;  2HFH A;  4AVP A;  5CVU A;  4OOI A;  1FWZ A;  2XAF A;  3HTS B;  1P4A A;  5A2Q Z;  2WWY A;  3HUG A;  2Q8K A;  2F5E A;  3CO7 C;  1O7L A;  1YFH A;  3KZZ A;  5DCM B;  5DEQ A;  3RIR A;  4M6Y A;  5L3B A;  1FLI A;  4G7O F;  3L09 A;  4BH9 A;  3DFG A;  2P4W A;  3IWF A;  4AIK A;  3RKW A;  5H20 A;  3I54 A;  3K1N A;  4HA8 A;  1KQ9 A;  3R0J A;  1IRF A;  3GZ5 A;  1IN8 A;  3C18 A;  3WOD F;  3FM5 A;  4MHG A;  3E6D A;  3QRF F;  3E97 A;  3V7S A;  4RGS A;  1T0F A;  2PN6 A;  2XKO A;  4GGG A;  4JK1 X;  3RI4 A;  3I53 A;  1S29 A;  3FM3 A;  3EYY A;  1SD5 A;  2OZU A;  3GWZ A;  3ERE D;  3WTW C;  5FB2 A;  4Y17 A;  2DW4 A;  3GVA A;  5HVQ C;  5LGN A;  4O6J A;  3TKY A;  3TO6 A;  3ROU A;  4G6Q A;  2DBB A;  1B9M A;  4FHT A;  2COM A;  5BPD A;  4F7Z A;  1R00 A;  3V8J A;  4K2E A;  1TW2 A;  2VOD A;  2VOP A;  5HDN A;  1F1Z A;  3K1P A;  4BHC A;  2FSW A;  2HTS A;  1HQC A;  1IW7 F;  1R5G A;  4HQM A;  3RDI A;  1J7K A;  3M7G A;  4IXA A;  5LEK A;  4EQQ A;  3WTX C;  5FLX K;  2NS0 A;  4ZYE A;  4HDV A;  1TQI A;  4I02 A;  2V1U A;  1R5H A;  4LFU A;  3FXR A;  2IPQ X;  2B0L A;  4L9N A;  1E2X A;  1U5T A;  1W5S A;  2VXZ A;  5L3F A;  2KJC A;  1FC3 A;  3V4G A;  2IJL A;  4WK8 F;  1BN5 A;  3HOT A;  2RNJ A;  2XAJ A;  1D3Y A;  1J5Y A;  1T98 A;  4N9I A;  3ZN0 A;  2K7L A;  3CUQ A;  3NEU A;  1SFU A;  5JFR A;  1K78 A;  3PQJ A;  4LK1 F;  1MD0 A;  1I6X A;  3WE2 A;  4P96 A;  1ZLK A;  1U3E M;  2KKO A;  4JBA A;  4ESJ A;  2FNP A;  2EWN A;  5D8K B;  4RB3 C;  4HLX A;  4G94 A;  3VFZ A;  1O3R A;  4BHP A;  1FBU A;  4G7H F;  2QZ8 A;  1IAW A;  5L3D A;  1LDD A;  1G4D A;  2MH2 A;  5JHU A;  2UXX A;  1B9N A;  4MNU A;  3Q5F A;  4KN4 X;  5LHI A;  2FML A;  2HOE A;  1PDN C;  3HRT A;  1YW8 A;  4RB1 A;  2BYV E;  4L9T A;  3E5Q A;  2LKP A;  1IN7 A;  3RKX A;  1KU2 A;  4RGX A;  4ENJ A;  2DPU A;  1KA8 A;  3LWF A;  1FY7 A;  1H9T A;  4I7H A;  2DT5 A;  1G3S A;  3WU1 B;  2FU4 A;  2HS5 A;  3ISP A;  2FEZ A;  2QVO A;  2MBF A;  5L3G A;  1U6G A;  1QBJ A;  2DTR A;  1EH6 A;  5E17 F;  1I5Z A;  2O6G E;  5TRD A;  1LQ1 A;  2FXA A;  5ICF A;  4N0B A;  2R7D A;  2P7C B;  1SFX A;  1DDN A;  2MC3 A;  2EA2 A;  3QAH A;  4EV0 A;  5BOX A;  1PP8 F;  2MH9 A;  4A12 A;  4NQW A;  4P55 A;  2FBH A;  4DQ2 A;  4U0W A;  1LNW A;  1FBQ A;  3OV8 A;  1ZAO A;  1EH7 A;  1OYI A;  4LK0 F;  3WTZ A;  2HZT A;  3KLO A; 
#chains in the Genus database with same CATH topology
 3E6M A;  4JQF A;  4OIP F;  1T33 A;  5K5Q A;  1XPX A;  3KET A;  2EH3 A;  1FOK A;  3NQO A;  5HNH A;  2VQL A;  3WTT C;  1MH3 A;  3TBI A;  2OZ6 A;  3C3W A;  4CHU A;  5FD6 A;  3H5R A;  3CLQ A;  3AG4 H;  2E36 A;  3IAM 2;  4X0G A;  5GPA A;  1BW5 A;  4UVC A;  4Y13 A;  3BOQ A;  2VQH A;  2JSC A;  3WTS C;  1SVO A;  3BLY A;  4AID A;  3QU6 A;  4ZZD A;  4Z6Y A;  5L3E A;  2LK2 A;  2PG4 A;  4U0V A;  3IH2 A;  2Y0S N;  1BIB A;  2FBK A;  4JYK A;  4O3M A;  3LSM A;  5E1Z B;  2WB1 A;  4EGZ A;  2CW8 A;  3HOU J;  4PSW A;  4UHT A;  2JQ7 A;  3ZMZ A;  1YG2 A;  3OOU A;  4IHS A;  4XOP A;  3U1K A;  3VOD A;  4HRI A;  4XOR A;  1FYK A;  3JAM Z;  1TWA J;  4H0E A;  4C2T A;  5HS9 A;  3ZQ7 A;  3IRQ A;  2DDB A;  5GAE J;  2EQR A;  2EZL A;  2ZC2 A;  1MSE C;  2HGC A;  2ZFW A;  2IS6 A;  4XMY A;  5TIS C;  2ZSH B;  5J8C A;  3I56 I;  5C4J J;  1JKQ C;  3HOY J;  2X51 A;  2XGD A;  1SAN A;  2JUG A;  3W2V A;  2W7N A;  2DO7 A;  4DYC A;  3QYF A;  4F91 B;  2VJJ A;  2DMU A;  3KP5 A;  4EJW A;  3I71 A;  2FE3 A;  1JGG A;  2Y9Z A;  3PJR A;  4ITV A;  5CYV A;  4C2U A;  2CV1 A;  2JPC A;  2HVR A;  5DUI A;  4CXF A;  4I6Z A;  3HHG A;  1OCZ H;  1OKR A;  1MJB A;  2JA2 A;  3DF8 A;  4IHX A;  4ZTJ A;  3HYI A;  2CWE A;  3I5U A;  2EV5 A;  1MZB A;  3HTU A;  2W84 A;  3BR3 A;  3GW2 A;  4KIF A;  4HF1 A;  5LRR A;  2BE5 F;  1A5J A;  5IT3 A;  1IUY A;  3ULQ B;  3HZJ A;  4XSZ F;  3DKX A;  5K7Z A;  3LST A;  1WJ5 A;  1W4M A;  2HKX A;  2F2E A;  5BQT A;  3S17 J;  2WAQ N;  1BJA A;  1R23 A;  1I6H J;  2ZCW A;  4EAT A;  3IKV A;  1RR8 C;  1YQA A;  2L02 A;  5EZH A;  1LVK A;  3GTM J;  1G3Y A;  1XS9 A;  3M1C A;  4C9Y A;  2CFX A;  2IGN A;  3RPU D;  3BTC A;  3SDB A;  5DDG A;  2OBP A;  2QLZ A;  3VB2 A;  1D5V A;  3FBI B;  2VPR A;  2Y69 H;  1W36 C;  3G2B A;  2ME0 A;  2O8X A;  3OWT A;  5HLI A;  1DU6 A;  5DM7 F;  3FF5 A;  1EA3 A;  3AG2 H;  3K10 A;  3S3O A;  3QOP A;  5HDG A;  5ILS A;  5J1Y A;  1JI8 A;  1N77 A;  4IEJ A;  1Y1W J;  1Z6T A;  2CQN A;  2P81 A;  1YS6 A;  2DA5 A;  2V1D A;  4XLE A;  1NK3 P;  2IT0 A;  3BCA A;  3Q0U A;  3G73 A;  2IA0 A;  2W24 A;  2Z2S B;  1UST A;  2FOK A;  2KIQ A;  2NS8 A;  4LG0 A;  4PJ0 C;  1J9I A;  4QLC U;  3OIO A;  1TWC J;  3ABL H;  2DMT A;  3MD2 A;  1Z3Y A;  1GT0 C;  1XSV A;  4GCV A;  4LB5 A;  2R7F A;  1YO5 C;  2R7X A;  2E1M C;  2FRH A;  3FHN A;  1U8R A;  4KN7 X;  1UG2 A;  3IC7 A;  1U0J A;  5K1Y A;  5D6F A;  2ESN A;  4J00 A;  3CCL I;  3SYT A;  2VON A;  1MIJ A;  4MTD A;  1T0F C;  1W36 D;  1X3Z B;  3REO A;  3CLO A;  1TNS A;  3CCU I;  5EGO A;  1W1W E;  4UUT A;  1OJL A;  2XB5 A;  3SZG A;  4UUV A;  2VLA A;  1WWX A;  2KDO A;  4U7D A;  1XTA A;  4KNY A;  2NRA C;  4XLN F;  3JRH A;  3E6C C;  4GO1 A;  3EYI A;  4IRG A;  2DA3 A;  2HVS A;  3WTU C;  1Y0N A;  2OAZ A;  3RSN A;  2E7X A;  2GOX B;  3CJQ B;  2EZK A;  2W25 A;  2DA7 A;  1OCR H;  2HTJ A;  1X2N A;  4CYC A;  3J80 K;  1IJW C;  4MFE A;  1SAU A;  2YPR A;  3VEP A;  4DYQ A;  4MTE A;  1RET A;  4NBQ A;  5CVJ A;  3CC7 I;  2Y48 A;  1ETX A;  1VQ6 I;  3TDZ C;  1R1V A;  1P9Q C;  3JRD A;  2EBI A;  4FET A;  4XIC A;  2VPL A;  4LOC A;  2BVL A;  2Y0M A;  3H5N A;  4ZJZ A;  2ZXH A;  2CS3 A;  5IPA A;  1ZQ3 P;  2LF8 A;  1K83 J;  1Y0U A;  4AU7 A;  3LAJ A;  3C2B A;  2ZJP F;  4A3D J;  1XC5 A;  1LEB A;  3I59 B;  1BBY A;  1X4O A;  4C3H J;  2XIG A;  3P9C A;  3O2P E;  2K02 A;  5JR3 A;  3TP3 A;  2EFN A;  2RNG A;  2ZJQ F;  1T2K A;  3Q9V A;  4FX0 A;  3QYE A;  2FBI A;  2L9V A;  3KYL A;  4F52 A;  1ON2 A;  4V2G A;  4DOZ A;  2R7Q A;  4RS8 A;  5JVG F;  4I98 B;  4BGD A;  3GFL A;  4AC0 A;  3DPU A;  3FXL A;  3A0H C;  4PDK A;  3L2R A;  4ZH4 F;  2X85 A;  3ZRG A;  2V1N A;  2X6X A;  1U5T C;  2KMU A;  2MW8 A;  1ORK A;  3DQV C;  1XMA A;  3D0S A;  4RMN A;  1YYV A;  5H2F C;  2RN7 A;  2LY2 A;  2FD5 A;  2IP2 A;  4MGR A;  5FLX Z;  5ICE A;  1TWG J;  2H09 A;  4AYB A;  1NG6 A;  1KYW A;  4HG2 A;  5JVT A;  1NH3 A;  2GLO A;  3CMY A;  1YIT I;  4UVB A;  4LIV A;  2IA1 A;  3CC2 I;  3S1Q J;  3DLA A;  4R79 A;  2PMU A;  2VKE A;  4UB6 C;  4OWR B;  1GXQ A;  1NK2 P;  4L0Z B;  2F4O B;  2O61 A;  2QBY A;  2EPF A;  5ICG A;  5KHD A;  2OTJ I;  1BOA A;  1IRG A;  1W0U A;  2RC4 A;  3PSI A;  1GVD A;  1G8X A;  1ZAR A;  4E6K G;  1D1B A;  1QZY A;  4M71 A;  2L9S A;  5LGT A;  3LQR A;  3TQN A;  5D4S A;  1JHH A;  4NDL A;  1WJA A;  3K4K A;  1BJZ A;  1DU0 A;  3NRV A;  4KIG A;  4F3Q A;  4BQQ A;  3F9K A;  2ZXJ A;  4XKB A;  3NAR A;  1ZKG A;  2WAE A;  2LVS A;  3DBH B;  1XG1 A;  5FD5 A;  3KEQ A;  3EET A;  3QQA A;  2LBF B;  5CQE A;  5LLQ A;  3CCV I;  1X3U A;  2G7U A;  5CQG A;  4BJT A;  1XX5 A;  4BS9 A;  3M3Y J;  4N4O B;  1JTY A;  4YIF A;  3QU3 A;  3HGY A;  3MAJ A;  5E3L A;  1FT9 A;  3P9I A;  2CO5 A;  1JUP A;  1ONV A;  1KQ0 A;  1LKX A;  1A04 A;  1CF7 B;  1HKT A;  2FMY A;  5JLX A;  3CCM I;  1P7I A;  3ZMT A;  4V19 K;  3DXJ F;  4Y7N J;  3OIQ A;  2DQL A;  2XGC A;  1E3O C;  4YEJ A;  1Z3X A;  2BVM A;  2GOM A;  4PCQ A;  1Y56 A;  4QTR A;  2RV8 A;  1ZGA A;  2KIM A;  2N8G A;  4AVZ A;  2PMH A;  3FK6 A;  3KEO A;  3CCE I;  3QP6 A;  1YJ9 I;  1DUX C;  1WI3 A;  2CQK A;  2RQQ A;  1YLF A;  3S2D J;  1XB4 A;  3WE3 A;  2EFQ A;  2HQR A;  1IXS B;  3BTJ A;  4B4C A;  3ZCO A;  1GUU A;  2M34 A;  1PUE E;  3KCC A;  3MMY B;  2K86 A;  4Q47 A;  3HKZ N;  2DI3 A;  4YFX F;  2DPD A;  3OIP A;  3FXJ A;  1TC3 C;  4IHV A;  1GHC A;  2HKO A;  1Z0X A;  1G6N A;  1TLH B;  2KL4 A;  2V79 A;  5BS6 A;  3BR2 A;  3S15 J;  2RVC A;  2VE9 A;  3GCM A;  4IQ4 A;  3WG9 A;  1FPQ A;  2MGQ A;  4WXD A;  4IRI A;  1BC7 C;  2V6E A;  3R4K A;  4IOA F;  3J7Z I;  2WY7 Q;  3ZPL A;  4Y3O A;  2MAB A;  1I3A A;  1IRX A;  1I1G A;  2ZKZ A;  3DWL E;  3MKW B;  1MJA A;  4BY1 J;  4MEY F;  3RQI A;  2E1C A;  4V2F A;  2HZD A;  4E7L A;  4XKW A;  2M0C A;  1Y39 A;  3T5X A;  1X4P A;  2P6S A;  2EZH A;  2VQG A;  1T56 A;  1ZLJ A;  2RDP A;  1BIA A;  4E7H A;  2L4A A;  3OL3 A;  1ETK A;  2IAI A;  3DLL F;  4DBR A;  1FTZ A;  2HEO A;  4NC6 A;  1ETW A;  2MD0 A;  2EJR A;  3E0J B;  4RM2 A;  5ILU A;  1VND A;  2R5Z B;  4P1W A;  1UHM A;  2DLL A;  2L9N A;  1IGN A;  1I27 A;  2Z5U A;  3CD6 I;  1FZP B;  3SFZ A;  2Z16 A;  2CU7 A;  1K7A A;  1ETQ A;  1WI9 A;  5EG0 A;  1HXD A;  1JGS A;  2L0K A;  4D0P A;  2EIM H;  4PUS A;  2VKH A;  4BAC A;  4A3K J;  2XB0 X;  1YX5 A;  1P7J A;  1USS A;  3E3V A;  1Y6I A;  1KU3 A;  2VE8 A;  2BGC A;  1OYY A;  2L3D A;  5F27 A;  2CGP A;  1Q1H A;  3OYK A;  2LD5 A;  1ITY A;  1WQ2 A;  2R7O A;  3WU2 C;  1QA6 A;  5E1W A;  4HW0 A;  4RDU A;  2GQQ A;  3KP7 A;  2I10 A;  3NWS A;  1YS7 A;  5FGM A;  1LEA A;  4KDP A;  2B7E A;  1LVA A;  5E8G A;  1ZGJ A;  2LR8 A;  2AXT C;  3BZC A;  1U78 A;  3F3X A;  2XVC A;  2E7W A;  3RTR A;  1MGT A;  4HZF A;  3UR3 C;  5LD2 C;  2DOE A;  2HXO A;  1E17 A;  3BTI A;  3I3L A;  2M8E A;  4ZZL A;  4OIQ F;  4BNC A;  2ECC A;  3H3V K;  3MQ0 A;  1R1T A;  1AWC A;  4HLY A;  4ZDP A;  1K6O A;  3B6C A;  1LE8 A;  4LB6 B;  2YR2 A;  1Z6R A;  3E5U A;  2QQA A;  1S3J A;  2OF7 A;  2UV1 A;  3BG9 A;  4CZZ A;  2DA4 A;  1ZG3 A;  3SJM A;  2ZME A;  3NAU A;  1IDZ A;  3M4O J;  3HC7 A;  4P5O A;  1VZ0 A;  2KPM A;  1TT5 B;  3EUH C;  1WJD A;  1MBH A;  3GZ6 A;  3ZQL A;  2PBI A;  5D4R A;  2M5W A;  2XPW A;  1DP7 P;  1JUM A;  2X6O A;  4G6T B;  3HDD A;  4FX4 A;  2WV0 A;  3C1D A;  5AON A;  1PP7 U;  3HXL A;  2D1V A;  4HF0 A;  5CVR A;  3ABK H;  4CZC A;  1PUF B;  4OIR F;  2V26 A;  1I1S A;  2B9S A;  2BBY A;  4U87 A;  1MDM A;  1L0O C;  1GV5 A;  1MW7 A;  4PSX A;  1AHD P;  5ERI A;  1MNM C;  3J7A O;  3PNT A;  1HST A;  5JLW A;  3CTA A;  4W1U A;  2K3F A;  2P6T A;  3FMR A;  1ODD A;  3COA C;  1LDJ A;  5EEH A;  1OPC A;  1U2W A;  1EKE A;  4HX8 A;  1W0T A;  5TJJ A;  3K4M A;  3RCO A;  3OS0 A;  1LJ9 A;  2BW3 B;  4EM1 A;  1UJ8 A;  5IT9 K;  2ID3 A;  1XSD A;  1K61 A;  3RZO J;  2E1O A;  3ERM A;  3ZR8 X;  2E2H J;  1R4N B;  4BEH A;  3JTH A;  4HAM A;  2KRF A;  5DD4 A;  2CUZ A;  2JRM A;  2C6Y A;  4XLF A;  2G9W A;  4OIO F;  2X6W A;  1ZK8 A;  2VB6 A;  2H1L A;  1R49 A;  1W7P A;  1R4M B;  1K79 A;  3FDY A;  4RAG A;  3Q9S A;  5DUK A;  1X1B A;  1B59 A;  5ED4 A;  1BA5 A;  2QKM B;  3Q0W A;  3V42 A;  1LPQ A;  2R7R A;  3M8J A;  2HPM A;  3S1M J;  2XPU A;  5LEJ A;  4MEX F;  1FNN A;  1A6Q A;  1CGP A;  2R7W A;  3KPH A;  3L7W A;  3PM1 A;  3GLL A;  3V7R A;  1ZG1 A;  2K3P A;  3TP0 A;  1BW6 A;  1HBX G;  2IRF G;  2M7A A;  3F8B A;  4HQE A;  1SVL A;  2VJ4 A;  2XF6 A;  2M1B A;  2NVT J;  1MH4 A;  2TCT A;  3S2H J;  2ZNZ A;  3LOC A;  4KFC A;  5CJ9 A;  1XMK A;  4M9X A;  4EMS A;  2A07 F;  1E3P A;  3K69 A;  4B8X A;  2BXY A;  1HKS A;  3GFJ A;  3WGH A;  5D5X B;  2JVG A;  5GAH J;  3OYB A;  4FTH A;  1BOB A;  2O0Y A;  1ZN2 A;  1KYZ A;  4LLL A;  3HOX J;  3ESW B;  5HOO A;  4L0Y B;  2R92 J;  2Y75 A;  3RZD J;  1JE8 A;  4L9J A;  2HYJ A;  4ENK A;  3K4J A;  1XD7 A;  2LKS A;  5KAI C;  2AQF A;  4UV9 A;  1E3H A;  2RAE A;  3PO2 J;  1X2M A;  2TDX A;  4LMY A;  3DBL B;  2VQC A;  1K4T A;  2DFH A;  1CF7 A;  2HWV A;  3RQ4 A;  4C2M J;  1Z21 A;  3HG9 A;  1HSJ A;  2CUF A;  3JW4 A;  2XAH A;  4B48 A;  2LY1 A;  3MEX A;  3JSO A;  4A3J J;  1B4A A;  3TMO A;  1OYW A;  2HYF A;  4HNT A;  2Q2E A;  1FOX A;  3FKI J;  2NVY J;  2DQR A;  3H9Q A;  2KLO A;  3KP6 A;  3MKZ A;  2Q0O A;  5DCM A;  3PUB A;  2M4K A;  4E7K A;  3I9V 2;  3OYE A;  4LLN A;  3ABU A;  3BC8 A;  4JP0 A;  1J09 A;  3HHH A;  1WCM J;  2A3S A;  2KRC A;  3J80 Z;  2DA6 A;  3K2Z A;  3HSE A;  3B02 A;  4ESF A;  1VQ7 I;  3M8F A;  1XN7 A;  2ZB9 A;  5F6F A;  5FKK A;  2JA5 J;  5IOY A;  2YX7 A;  6PAX A;  2OJE D;  1FYL A;  3ZQF A;  4RLQ A;  4FE4 A;  4YII A;  1NTC A;  4RGR A;  2BY3 A;  2CQX A;  4ZTF A;  2VL8 A;  2ETH A;  1P4X A;  2Y0S A;  5E20 A;  2HOT A;  3W2A A;  5B1A H;  3WU0 A;  1UB9 A;  2JZY A;  5KVR A;  2PI0 A;  4BXF A;  2OPT A;  5B66 C;  3F8C A;  4Q5S F;  3BPV A;  5LFA A;  5M5Y J;  1MJ9 A;  1O57 A;  4IVN A;  4N9H A;  3F23 A;  1BM9 A;  1IN6 A;  3CP2 A;  4CCL A;  1F9N A;  2YU3 A;  5B3S H;  1EJ9 A;  4FQG A;  4BQN A;  4Z2Y A;  1RI7 A;  5F1R A;  4IX7 A;  1Z7L A;  4ENN A;  1FJL A;  2BHZ A;  4G7Z F;  4CYD A;  1O3Q A;  2O5R A;  1X1C A;  2ADU A;  2EA4 A;  3ABM H;  3N05 A;  1F36 A;  4DGW B;  5IP9 J;  5FO5 A;  3CF5 F;  2DK5 A;  3HUG B;  4IZZ A;  1OIS A;  1FOY A;  5CPR B;  3CO6 C;  4EVI A;  1RZ4 A;  5H6R A;  3QP5 A;  2CUE A;  4DZJ A;  1FIA A;  2EIK H;  5AIQ A;  3E1S A;  4BXU A;  3CCQ I;  4G6D A;  4IF4 A;  5IYC J;  4LG3 A;  2ZBK A;  1DPR A;  2ISY A;  1ZG5 A;  4RGU A;  4ABZ A;  4I01 A;  1RES A;  1XDS A;  2GA1 A;  4PGH A;  2NVQ J;  2QF7 A;  4DJA A;  5M5W J;  2PFB A;  2ESH A;  2I8D A;  4DNC A;  1YI2 I;  5B1B H;  4D1Q A;  2L5Q A;  5D5U B;  3F6V A;  3H0G J;  3JCU C;  2BOL A;  2MLK A;  4G12 A;  2GAU A;  3GO5 A;  5HLT A;  2JRT A;  3EUK L;  2EIN H;  3KE2 A;  2Y2Z A;  3AFH A;  5FKN A;  3GTO J;  2IS1 A;  2KQR A;  2WAQ A;  1H8A C;  4RB2 C;  4KJZ A;  1RIO H;  2V6C A;  3QWL A;  3SQN A;  2RRE A;  1JT0 A;  4MLO A;  3VWB A;  3W2W A;  1RPW A;  2LTP A;  1Q1V A;  1Z05 A;  1IG7 A;  2NNY A;  3F8M A;  1MMA A;  3HSF A;  2O9L A;  2EIL H;  2PQ8 A;  4S05 A;  2IGK A;  3FXO A;  2KDZ A;  4GDF A;  5FFX A;  4EJT A;  4X1E A;  1W5T A;  4E7I A;  2E1M B;  1FP1 D;  1KGS A;  3OYA A;  4XRM A;  3HJE A;  3QYB A;  4OIN F;  1WFX A;  3CDL A;  3ZGK A;  3ZP5 A;  3T8R A;  3DKY A;  4XK4 A;  3I0T A;  2VXD A;  1AKH A;  4M72 A;  1DPU A;  3RKY A;  3KEY A;  2EV6 A;  1FOW A;  3IP4 B;  3HRS A;  3A0B C;  2ELJ A;  5FKL A;  4ENM A;  1RKT A;  3F22 A;  1B72 A;  2ZFU A;  4BBS J;  4CSW A;  1JKO C;  4WX9 A;  1D1C A;  5B5E C;  3ZQC A;  1IXR C;  1VQ4 I;  4EJV A;  2PEX A;  3OYN A;  4LD5 A;  1GVJ A;  2XAG A;  2LG4 A;  1UCR A;  4BAY A;  1ZR4 A;  4DYR A;  2HI3 A;  2OV7 A;  2E1N A;  5E8I A;  1N25 A;  4D5F A;  1LFU P;  3Q3S A;  3LSH A;  3I55 I;  3OR1 C;  5E3O A;  1RUO A;  1HLV A;  1WJF A;  2X0L A;  1ZHF A;  4QPQ A;  2NVX J;  1D8K A;  1TNT A;  3HPH A;  3CDH A;  1S5L C;  4HNV A;  2R3S A;  3VOE A;  2OQR A;  2M7B A;  2OU2 A;  4RAZ A;  1IF1 A;  4AD9 A;  1MMN A;  1VI0 A;  3OOP A;  4ZYG A;  1B8I A;  2QYO A;  5J1R A;  2A61 A;  2W85 A;  4II2 A;  1GXP A;  3U9G A;  2V1X A;  2HR3 A;  2DMP A;  4Y33 A;  2A6E F;  2CRG A;  3GTK J;  4KMU X;  2STT A;  3WGG A;  1QVU A;  5EJC A;  3VYR B;  1RUN A;  2JTV A;  5K5R A;  3A2K A;  3GF2 A;  1K4S A;  4L5J A;  1OR7 A;  2CFO A;  2VN2 A;  3FMS A;  2DCE A;  1QRY A;  1JKR C;  1Z7U A;  2DJN A;  1SFE A;  2EFP A;  5LGU A;  2VI6 A;  1O3S A;  1ERD A;  4F55 A;  3GEZ A;  4G8X A;  3ASN H;  1W5C C;  5EYR A;  1HDP A;  4AM3 A;  1U5T B;  4UNO A;  2P5V A;  2IGM A;  2BXZ A;  3ABT A;  3KP2 A;  3OYD A;  1KU7 A;  3IL2 A;  4RBO A;  3S3M A;  2E19 A;  1R7J A;  2LF7 A;  3ML6 A;  4EEF G;  1C0W A;  2CV2 A;  2HU9 A;  1WJC A;  4A0X A;  1EV7 A;  1S8N A;  2F6C A;  4KIB A;  2A05 A;  4B3A A;  4ON0 A;  1T6S A;  3A01 B;  3CUQ B;  3R61 A;  1QPM A;  2ZJR F;  1H89 C;  4XON A;  1K78 B;  2KIF A;  4WXC A;  4B47 A;  4UB8 C;  3JRA A;  1OMI A;  3FHZ A;  2G7H A;  5F1J A;  2XHK A;  1U9O A;  2K4B A;  3CJT B;  1LFP A;  3BG7 A;  3T0Y A;  4PJJ A;  1FMW A;  3BY6 A;  3G71 I;  3E6B A;  2XAQ A;  2WAF A;  3BJO A;  2CW7 A;  4EM2 A;  2DYS H;  1MBG A;  2ZME C;  1T08 B;  4UUS A;  1ZRE A;  3D1N I;  4YEL A;  1DQU A;  3V8K A;  5J8F A;  2BZT A;  1R1U A;  3LSR A;  1FP2 A;  2GIZ A;  3JTG A;  2DFE A;  4MQ9 F;  5KNL A;  3ZMU A;  1RR7 A;  2FNA A;  3H3U A;  3H92 A;  1XCB A;  2R5Y A;  2WTE A;  4EM0 B;  1YW9 A;  1HKQ A;  2UUZ A;  1MBK A;  3KFW X;  1FSE A;  4WCG A;  3OS1 A;  1P4W A;  1XGO A;  3CUQ C;  4FE7 A;  3W3C A;  3K4N A;  3N4M A;  2CG4 A;  3QPL A;  4LLG F;  5J3L A;  5JHF A;  1TT0 A;  2R4G A;  3KLN A;  3BR1 A;  2OCE A;  3NWT A;  4BE1 A;  4A6E A;  2A6H F;  4IL6 C;  2VJI A;  2KJB A;  2NS7 A;  1YRN A;  5E3N A;  3KP3 A;  3OYL A;  1MBJ A;  2F4M B;  3S1N J;  5KAF C;  2DAO A;  1RRJ A;  4RB0 A;  2X1D A;  4IHW A;  2WC2 A;  2GWR A;  1G3W A;  1J2X A;  3H9J A;  1L3L A;  4UY8 I;  1BI3 A;  5KK1 A;  4A2U A;  3SEZ A;  3D5L A;  1SEU A;  2DN0 A;  1XGM A;  1EH8 A;  2JA8 J;  2R7U A;  5LRS A;  3H9G A;  1HW2 A;  1A36 A;  1SD6 A;  4L9V A;  3SEQ A;  1T38 A;  4RM3 A;  3GME A;  3F21 A;  1Z9C A;  2XDV A;  1S9H A;  3FZV A;  3LA2 A;  2F5F A;  2JA6 J;  3IUO A;  4CCK A;  3KP4 A;  4ZC3 A;  4PGG A;  3K0L A;  4LJZ F;  2R7S A;  3CCJ I;  2R0Q C;  2H8W A;  4HV5 A;  4A93 J;  2JUC A;  4HOB A;  3VSK A;  3BG3 A;  2JT1 A;  1AOY A;  2ELK A;  2MLG A;  1V5F A;  2PJR B;  4BE2 A;  1QZE A;  3H3Z A;  4JX6 A;  1S72 I;  1Z91 A;  4LIU A;  4M3D A;  3LSK A;  2YSR A;  2PLY A;  2DMQ A;  3OYH A;  4AIJ A;  3OMY A;  3ECO A;  4YFK F;  3DTE A;  1VQO I;  1MNE A;  4X6A J;  3DKW A;  4NQW B;  2QM3 A;  4LGW A;  5CLS A;  3LAP A;  4IJA A;  3LQQ A;  3CJR B;  4GRI A;  1W7P D;  2LRE A;  4ZYH A;  5ILV A;  3SHF A;  1I50 J;  2H27 A;  1V4R A;  4KIS A;  4WWC A;  1K6Y A;  2WAD A;  2HDD A;  1HOM A;  2HQ5 A;  3T1B A;  2P0W A;  1TWF J;  2M30 A;  2NOJ B;  1TL8 A;  2LH9 A;  4ESB A;  4KIT B;  1YHQ I;  1Y8R B;  3LNQ A;  1UMQ A;  2JPB A;  1WSU A;  2OQG A;  4UV8 A;  4KA4 A;  4B1R A;  2DMN A;  4XL9 A;  2K27 A;  1SD7 A;  1BI2 A;  4KUM A;  4XN3 A;  1MBE A;  2PMZ N;  4KMF A;  1D8J A;  1MSF C;  1VQN I;  3GXO A;  4AIH A;  1PJR A;  3U1D A;  3VYS B;  3L2C A;  1BC8 C;  2D1H A;  4CUG A;  4IHT A;  2RGV A;  5EF6 A;  3TDU C;  2MC4 A;  2UWM A;  5DCF A;  2A5Y B;  5CKT A;  3C2H A;  2VJ5 A;  3N97 A;  1IV6 A;  4PJN A;  2WY8 Q;  1REP C;  3BG5 A;  2OUM A;  1A6I A;  2ACJ A;  3C2G A;  4M73 A;  2FF4 A;  2M3A A;  1YIO A;  4BHB A;  3LA7 A;  3LSP A;  4IPA A;  4A0Y A;  5HOD A;  3P9K A;  1JJ8 C;  3DU5 A;  1OFC X;  2M4G A;  2QKL B;  1ZYR F;  4M3G A;  2MD5 A;  2EFW A;  3IH4 A;  3FMQ A;  5LHH A;  3GTQ J;  4GYG A;  2AS5 F;  4HPQ A;  2XV4 S;  1SMY F;  1SMT A;  1WPK A;  1DGW Y;  3H1C A;  2BY2 A;  3PNY A;  4XKC A;  2XSD C;  4QWQ A;  1G2H A;  5C4X J;  2M0M A;  3UKG A;  2IW5 A;  4YG2 F;  3DEU A;  3FX3 A;  4M3E A;  1O4X A;  4JOM A;  3CCS I;  1YTY A;  2NOG A;  2Z1D A;  3LSJ A;  5E18 F;  1KU9 A;  4XKV A;  4A5M A;  3U2R A;  5H6Q A;  4S04 A;  4CO8 A;  1ACI A;  1XGN A;  5F0C A;  1HW1 A;  3VSL A;  3K7A J;  5GAG J;  3LSI A;  3GFI A;  3ZQQ A;  1R71 A;  3PFI A;  1QU3 A;  3IWZ A;  3F0C A;  1Z1D A;  3H35 A;  2R93 J;  3CES A;  4PK4 A;  2E71 A;  3JRE A;  3GZN B;  2NAZ A;  2LRD A;  4XRF A;  2EK5 A;  2QUF A;  3IV5 A;  2JA7 J;  2M87 A;  3JRG A;  2IEK A;  5AIP A;  4YIR X;  2L01 A;  1FBS A;  1HW5 A;  1S6L A;  3OL4 A;  2V9K A;  3OY9 A;  3MKY B;  2VT2 A;  2CMP A;  3G1M A;  2B63 J;  3DP7 A;  3JRB A;  3K2A A;  5DM6 F;  2F4I A;  1QQI A;  4D7M A;  2DK8 A;  2CYY A;  3I64 A;  3KZY A;  3W6J B;  3CCR I;  3HIF A;  3AL0 C;  2BEO A;  2IS4 A;  1HDD C;  3HRM A;  3X2Q H;  5J4Y A;  4XRS A;  2H6C A;  3E7L A;  3SZP A;  1TTY A;  3F8F A;  1QNT A;  2COB A;  2QWW A;  3FIS A;  2VC1 A;  4BY7 J;  4W97 A;  1X58 A;  1H9G A;  3TW6 A;  1TW3 A;  2CQQ A;  2FA5 A;  4BU2 A;  3BR6 A;  1F4K A;  4HST A;  2CH0 A;  3VDX A;  1VF9 A;  3OYI A;  1T39 A;  1VQK I;  1R5I D;  2A5W A;  3TOB A;  2Y31 A;  3V7C A;  3I59 A;  4IOC F;  3J81 K;  3L9F A;  3EQL F;  4LG0 B;  1OCT C;  3HPG A;  2BY0 A;  2XAS A;  4KT6 A;  4Y4R A;  2OC6 A;  4XLP F;  2GIV A;  3TOA A;  1WHU A;  1S7O A;  3HSR A;  3G3Z A;  2M9H A;  3W6K B;  3L2Q A;  3K4C A;  2HOA A;  3MZ8 A;  4DBQ A;  2W57 A;  3MCZ A;  1MND A;  1X3W B;  3R60 A;  3AAF A;  3HGG A;  4XSX F;  4BXX J;  2DU9 A;  2OTL I;  2MSY A;  1TP4 A;  2XF7 A;  5EEG A;  2A6T A;  3QPH A;  4XNF A;  3H36 A;  1IO2 A;  5A2Q K;  1TQP A;  3CMM A;  4TV7 A;  5EGO B;  2W48 A;  1RNL A;  2VBZ A;  4GFB A;  2IVM A;  4L18 B;  3PO3 J;  1A35 A;  2VBW A;  4XBF A;  2Z3Y A;  1AA7 A;  1BR2 A;  3LL7 A;  4RAY A;  4E70 A;  4OMY A;  4OAZ A;  2L4M A;  4I2O A;  5J40 A;  3W6V A;  3DCF A;  1IN5 A;  2L2O A;  2GZW A;  4XLC A;  1R22 A;  1NG7 A;  4P9U A;  3K1M A;  1MMG A;  3CUO A;  4CCN A;  2MG4 A;  2X1E A;  2K5C A;  5E3M A;  2J5P A;  4Y15 A;  3M07 A;  4CYC B;  2VBX A;  3M8E A;  4NUB A;  2E5Z A;  4XN0 A;  2WBM A;  3CP8 A;  4HDU A;  4A0Z A;  2D45 A;  3FXU A;  3HOZ J;  2ELH A;  4I09 A;  2VT3 A;  1P92 A;  1XCV A;  1IC8 A;  1WRJ A;  2DT6 A;  3C7J A;  3M9A A;  3WTV C;  1LFB A;  2EB7 A;  5BNG A;  1YJN I;  2DT7 B;  3A02 A;  3ELK A;  5J6X A;  4U88 A;  2XRN A;  5LHG A;  2ID6 A;  2W4S A;  2XUB A;  4L5E A;  2HQA A;  1KON A;  3ASO H;  5DS9 A;  3QOD A;  1IRZ A;  4R1H A;  2A68 F;  1JTX A;  3K70 C;  3FK7 A;  3TW7 A;  4AUX A;  2FJ1 A;  4IQJ A;  3WGI A;  2LBF A;  2MA3 A;  4PJM A;  5J47 A;  2H94 A;  2AXL A;  3HRU A;  2LSO A;  2Z99 A;  4HV6 A;  1TQM A;  2KP6 A;  1QO0 D;  3P7N A;  4M9Z A;  5CVV A;  3IHU A;  2M45 A;  3CQZ J;  3L2W A;  3T8T A;  4MQV A;  1OR7 C;  3HOS A;  2ZXI A;  4WXH A;  5F64 A;  1QGP A;  4BQO A;  4CCJ A;  1XSX A;  5BPI A;  3JSP A;  1P6R A;  5J4V A;  3LA3 A;  2P7V B;  2Q1Z B;  1UG0 A;  4PFP A;  2DFI A;  1VQ5 I;  3R6S A;  4BJ5 C;  1H88 C;  2HDC A;  4WF2 A;  2D2W A;  5CVI A;  1BR1 A;  3SXY A;  4FT8 A;  1FSH A;  2K4J A;  3GLX A;  3L2U A;  1Z67 A;  3I4N J;  1LB2 A;  2HXI A;  2TRT A;  2R7T A;  2OA4 A;  2K9M A;  4BYY A;  5GAD J;  1WH7 A;  2M2E A;  3K70 D;  3FXK A;  3BZ6 A;  2K85 A;  4FIS A;  2O3F A;  1G3T A;  1B6A A;  1S7A A;  5HLH A;  1CQT A;  2LLK A;  2QBY B;  4YFN F;  2Z33 A;  3M1E A;  3EUA A;  4Q4Z F;  2FUG 2;  1WKM A;  2QQB A;  4M3F A;  2KIS A;  5FLV A;  3KIO A;  3K4B A;  5D8L B;  2X1C A;  4HF2 A;  2V7F A;  1T95 A;  1STZ A;  2UXN A;  1ZRD A;  5IYB J;  2KHM A;  3PIP F;  3ZN1 A;  1Y8Q B;  5M5X J;  3TED A;  4EGY A;  2XKP A;  3DPL C;  2ZNY A;  4A3B J;  3MWM A;  3BG6 A;  3F6O A;  2HQN A;  4HYE A;  5GTH C;  2L7M P;  1ZRC A;  4B43 A;  3JRF A;  3S8P A;  1H0M A;  3LFK A;  1GDT A;  3O3K A;  3ZMV A;  4M74 A;  3SFI A;  1A31 A;  3GYH X;  3ONQ A;  1QPI A;  4M9S A;  4HSR A;  3ZXS A;  1IZ1 A;  2R5Z A;  2P5L C;  2HNH A;  2X9D A;  2X6Y A;  3I4P A;  3CC4 I;  3IRR A;  3BRO A;  2GA2 A;  4G9Y A;  4BUP A;  2DA2 A;  1PVE A;  1P2F A;  5C44 J;  2O03 A;  1R36 A;  2K9N A;  2L9R A;  4UXN A;  1E0E A;  3DV8 A;  2NYX A;  3RYR A;  2KRH A;  3TGN A;  1J59 A;  3K4L A;  3KYD B;  2WB1 N;  3BPX A;  3JRC A;  3HBL A;  2OD5 A;  2JWT A;  4BL0 B;  4OU0 A;  2YX4 A;  3S93 A;  1OCO H;  3LMM A;  1UAA A;  2DA1 A;  3EUH A;  5GTI C;  3MVP A;  5EEA A;  2L7F P;  1ZEL A;  2FQ3 A;  3FXQ A;  4DIQ A;  3PFY A;  1LDK B;  2X4H A;  4AWX B;  4B3X A;  4HX7 A;  2WA0 A;  4D7N A;  1X1A A;  1UHW A;  4R8H A;  3RPQ A;  2CSO A;  1KZH A;  2QQ9 A;  3ZMS A;  5HS8 A;  1MBF A;  3MKL A;  4B09 A;  1HF0 A;  1ENH A;  2L7Z A;  3FBN B;  5E1X A;  3MZH A;  2RKH A;  1ULY A;  3GX4 X;  4J19 A;  3CDI A;  4A3G J;  2V9V A;  4I0A A;  1ZTR A;  3RYP A;  2LDU A;  5DYM A;  3S2W A;  3S1R J;  2ZO4 A;  1ON1 A;  2LY9 A;  2NNN A;  5GP9 A;  1N78 A;  1R58 A;  3RJP A;  2BY1 A;  3GUD A;  3MZY A;  2BHY A;  4C3J J;  1JJ6 C;  5D5V B;  2XRL A;  4KYW A;  4IKF A;  4NB5 A;  3H5A A;  5C3E J;  3B73 A;  2XRO A;  1XGS A;  2HOS A;  4IO9 F;  4CDG A;  2PJP A;  3F8N A;  2Z9O A;  5FFZ A;  5EG0 B;  3FKJ A;  1QZZ A;  1J0R A;  4QSH A;  2ZJ2 A;  1UHS A;  3G6E I;  5HDK A;  4QIW N;  2H1K A;  2Y9Y A;  3CJN A;  1PUF A;  1VQM I;  1RKW A;  4RAF A;  4XRS G;  1ETY A;  2IA2 A;  3OYJ A;  5D5W B;  3O8H A;  1D5Y A;  2VC0 A;  3HM5 A;  3MFK A;  4BQA A;  2DOA A;  3R0A A;  2EV0 A;  2J5O A;  1JUS A;  3SDG A;  4PZJ A;  3IKT A;  1V54 H;  2LNB A;  1HC8 A;  4L5I A;  4YRV A;  2BW3 A;  2E34 A;  3VYU B;  4CGZ A;  4A3C J;  3D5S C;  4A6D A;  2EFO A;  1TBX A;  3JRI A;  2QSH X;  2L54 A;  1N75 A;  2F5C A;  4U0Y A;  2XF5 A;  4MO7 A;  4GYI A;  2QEN A;  3QPT A;  5LBQ A;  2QCO A;  2KIU A;  1JT6 A;  3ZMD A;  1LE8 B;  4NC7 A;  4E4H A;  2A69 F;  5HLG A;  1XMX A;  2HYG D;  3ECH A;  4MIM A;  1V5E A;  2H6B A;  1BI1 A;  2ZME B;  3I58 A;  1O7F A;  2UZK A;  1UFM A;  1F5T A;  3F72 A;  1EF4 A;  3KYC B;  4KT5 C;  1ZRF A;  5JI6 A;  2DOF A;  5DV5 A;  2DYR H;  1OCC H;  3FWE A;  1I3Q J;  1PYV A;  5DD8 A;  5ICC A;  3MN2 A;  2RQP A;  2VBY A;  1SD4 A;  2P5K A;  1MKM A;  1FX7 A;  2V4J C;  1OLT A;  3UNG C;  1VTN C;  4J01 A;  1BI0 A;  2W00 A;  2STW A;  2WV1 A;  3A4C A;  3BDD A;  4RLF A;  2F5D A;  5F08 A;  5F04 A;  1Y1V J;  1MDM B;  1QHH D;  3TO9 A;  1APL C;  4XR6 A;  3JR9 A;  4KIC A;  1TWH J;  4IRH A;  4II3 A;  3AG3 H;  2E60 A;  4A5N A;  2ISZ A;  1U9N A;  1V3F A;  2I5U A;  3O6B B;  5D6E A;  3KZI C;  3DPT A;  2VKV A;  4GXO A;  2FX0 A;  1WH5 A;  4MFD A;  1YOV B;  3BR5 A;  5HS7 A;  4ASN A;  2O8K A;  1FMV A;  1IN4 A;  1Z77 A;  2GBY A;  3K9T A;  1FYM A;  2XGE A;  1JHF A;  3V8L A;  5L3C A;  3OS2 A;  4O5V A;  2GM4 A;  2NXN B;  5FRM A;  1KQ8 A;  2CW0 F;  4ZDL A;  4BEH B;  4HBL A;  4XM3 A;  5K7H A;  2XAU A;  2K9S A;  1MMD A;  1HA8 A;  3PQK A;  4BBR J;  3IAS 2;  4UVA A;  1W7P B;  3L00 A;  4N4N B;  1YW7 A;  3JAM K;  3LFU A;  4HX4 A;  1ZR2 A;  3QOE A;  3TO7 A;  1TZL A;  3RKQ A;  3GFM A;  1YX3 A;  3DBR B;  4EJU A;  1XDU A;  1SAX A;  2GXB A;  3S32 A;  2V9P A;  1DP3 A;  1WGX A;  2K9Q A;  5EDN A;  4A3E J;  1R9T J;  2BV6 A;  1LUJ B;  2HDW A;  2E5N A;  5BMZ A;  2GXG A;  5K5O A;  2P8T A;  4P9F A;  2DOD A;  4E7Z A;  1IXC A;  1B1B A;  1NHA A;  2HVQ A;  3E5X A;  4NHJ A;  1VQP I;  4U7B A;  1AU7 A;  1V5G A;  1ZH5 A;  4AYB N;  4Q48 A;  2LOO A;  2XGX A;  3GBG A;  3WTY C;  4OMZ A;  4F92 B;  1I39 A;  1J75 A;  3BJ6 A;  2R7V A;  3EDP A;  3BP8 A;  1JXS A;  2MFZ A;  3BWG A;  4EJO A;  4M6X A;  3RPU A;  3OYM A;  1O3T A;  5M3F J;  1YJW I;  4CIC A;  2CQ7 A;  2JN6 A;  5TGT A;  3J81 Z;  3SZT A;  5IT9 Z;  4I0B A;  4ZYD A;  3BJA A;  2VOO A;  2KT0 A;  4ETS A;  2HFH A;  5FRN A;  2H8R A;  2QA4 I;  3ZQG A;  2AHQ A;  4AVP A;  5CVU A;  4A69 C;  3D5R C;  4OOI A;  3HKZ A;  1FWZ A;  2XAF A;  3BZK A;  5IOZ A;  3HTS B;  1OCP A;  4NNJ A;  1P4A A;  5A2Q Z;  4BJ6 C;  2JMW A;  3LSG A;  4XQF A;  4CA0 A;  4ZDO A;  2WWY A;  1R6R A;  4JX4 A;  2YS9 A;  3HUG A;  3ZQH A;  4FAS D;  2Q8K A;  4C30 A;  3U21 A;  4E7S A;  2F5E A;  3CO7 C;  1O7L A;  3PIO F;  1YFH A;  1F43 A;  3G1L A;  1GV2 A;  2Q2E B;  1HCR A;  3KZZ A;  5DCM B;  5DEQ A;  3RIR A;  1U8B A;  3AG1 H;  5F0F A;  4XID A;  4M6Y A;  5L3B A;  1ETO A;  1FLI A;  5KCM A;  4G7O F;  5IP7 J;  2PMZ A;  3L09 A;  2LYC A;  4BH9 A;  3DFG A;  2P4W A;  3IWF A;  4AIK A;  1UZC A;  1IDY A;  3BT9 A;  1M1E B;  3RKW A;  2R7Z J;  5H20 A;  3S16 J;  1POG A;  3I54 A;  3I4M J;  3K1N A;  3O8G A;  4FCY A;  4OAY A;  1SFK A;  2JJ7 A;  4HA8 A;  4RA2 A;  1VQ8 I;  1KQ9 A;  3HOW J;  1OQY A;  3R0J A;  1IRF A;  2K9L A;  4BKX A;  1FIP A;  1ZGW A;  2W82 A;  3GTJ J;  3BCB A;  3GZ5 A;  1IN8 A;  1WVR A;  3C18 A;  2KZV A;  3WOD F;  2LP0 A;  1DGR M;  3FM5 A;  4MHG A;  3E6D A;  3QRF F;  4C3I J;  4HEA 2;  3E97 A;  3V7S A;  2ZSI B;  4RGS A;  1UEL B;  1BR4 A;  1T0F A;  2PN6 A;  2XKO A;  1D1A A;  4GGG A;  2E2I J;  4JK1 X;  2EZI A;  4XOT A;  3OYG A;  3RI4 A;  3I53 A;  1S29 A;  3FM3 A;  5FKO A;  2QGU A;  4BDY A;  2YU9 J;  4ANJ A;  3EYY A;  1SD5 A;  2LKX A;  4A3M J;  1YIJ I;  4Y52 J;  2OZU A;  3GWZ A;  2VIX A;  3ERE D;  3WHC A;  3WTW C;  4BE0 A;  1GLN A;  5FB2 A;  1IV8 A;  4Y17 A;  4NC8 A;  1VFC A;  4A3L J;  3Q0V A;  2DW4 A;  3GTG J;  2CV0 A;  3GVA A;  2CJJ A;  2JK3 A;  1RC9 A;  4LIT A;  4O6J A;  5HVQ C;  5LGN A;  3TKY A;  3DTK A;  3TO6 A;  2W1O A;  1FTT A;  3ROU A;  1X19 A;  4G6Q A;  2DBB A;  2MYS A;  5IP6 A;  1B9M A;  4BDZ A;  3J7Y J;  4FHT A;  2COM A;  5BPD A;  1VQ9 I;  3KX2 A;  3AL0 B;  4F7Z A;  1R00 A;  4XLA A;  3V8J A;  4K2E A;  4PJL A;  4XLH A;  1TW2 A;  2LC2 A;  2IXS A;  2VOD A;  5FKM A;  5EZG A;  2VOP A;  2X48 A;  3TL4 X;  5HDN A;  3PUF A;  2FOW A;  2IBD A;  1F1Z A;  2XPV A;  3K1P A;  1D0Y A;  3DEE A;  5E79 C;  3HL2 A;  1VQL I;  4BHC A;  2FSW A;  2HTS A;  1HQC A;  1IW7 F;  1R5G A;  4HQM A;  3RDI A;  1J7K A;  1BL0 A;  1WJB A;  9ANT A;  4M3B A;  2EIJ H;  3BTL A;  2QSG X;  4ZYA A;  3M7G A;  2O7O A;  4IXA A;  1SFO J;  5LEK A;  4EQQ A;  1X1D A;  2ZXW H;  3WTX C;  3OSF A;  5FLX K;  2NS0 A;  3A1Y A;  4ZYE A;  4HDV A;  2DXI A;  1TQI A;  4I02 A;  2V1U A;  1R5H A;  4LFU A;  1QHG A;  3FXR A;  3OR2 C;  4I76 A;  2QSF X;  1G59 A;  3GTP J;  2F48 A;  2IPQ X;  2B0L A;  4L9N A;  1AKH B;  1E2X A;  1U5T A;  5IYD J;  1W5S A;  2VXZ A;  2VKD A;  5HNF A;  5L3F A;  2KJC A;  3CME I;  1FC3 A;  5J1U A;  3DTI A;  3V4G A;  2IJL A;  1B72 B;  3PNV A;  4WK8 F;  1BN5 A;  1D0Z A;  2AQE A;  3HOT A;  2RNJ A;  3L2V A;  2XAJ A;  1D3Y A;  1J5Y A;  1T98 A;  4N9I A;  3ZQI A;  3ZN0 A;  4D5C A;  5FRO A;  3P5J A;  3A01 A;  3QPS A;  2K7L A;  3CUQ A;  3NEU A;  1SFU A;  5FJ8 J;  3CCY A;  5JFR A;  4F93 B;  4CH7 A;  1K78 A;  3PQJ A;  4LK1 F;  1SC7 A;  1MD0 A;  3G4S I;  1I6X A;  3WE2 A;  3WHB A;  4P96 A;  1ZLK A;  1U3E M;  2KKO A;  4IHY A;  5GPC A;  4JX5 A;  2XC7 A;  1MMS A;  4JBA A;  4ESJ A;  2KFD A;  2FNP A;  1ETV A;  4H4K C;  2EWN A;  3OYC A;  3VPR A;  5D8K B;  1B8I B;  4RB3 C;  2VAS A;  2GXA A;  4HLX A;  3A03 A;  4G94 A;  4I99 C;  2LFB A;  4CCM A;  3VFZ A;  4HNU A;  2QQ8 A;  1O3R A;  3HOV J;  4BHP A;  4QPO A;  3ZOB A;  1YE9 A;  1FBU A;  4G7H F;  2VUM J;  2QZ8 A;  1IAW A;  5L3D A;  1LDD A;  2DJI A;  2ECB A;  1G4D A;  3OYF A;  2Y30 A;  2MH2 A;  5M3M J;  2ICW G;  3PL8 A;  3CZ6 A;  5JHU A;  2UXX A;  1B9N A;  1V55 H;  4MNU A;  1QVT A;  4PFO A;  2IGO A;  3BQY A;  2DTZ A;  4CCO A;  3Q5F A;  4KN4 X;  3K6G A;  5LHI A;  2ME6 A;  2M8G X;  2YUS A;  1IUF A;  2FML A;  2HOE A;  2DFF A;  1YW8 A;  3HRT A;  4DW6 A;  1PDN C;  1WJE A;  4RB1 A;  2BYV E;  3BR0 A;  4L9T A;  3OSG A;  4E7J A;  4B44 A;  2E2J J;  5K7F A;  1T8I A;  3E5Q A;  2LKP A;  1IN7 A;  3RKX A;  2AO9 A;  3CMA I;  1X1P A;  2CUJ A;  3FIW A;  5FLM J;  1KU2 A;  4RGX A;  4ENJ A;  3FXM A;  2DPU A;  5IY5 H;  4A3I J;  1S7E A;  1KA8 A;  3LWF A;  1FY7 A;  1H9T A;  4I7H A;  2IS2 A;  1JKP C;  2DT5 A;  1G3S A;  3GTL J;  3IH3 A;  3WU1 B;  2FU4 A;  3WG7 H;  2HS5 A;  3ISP A;  3AKZ A;  2FEZ A;  3S14 J;  2QVO A;  2MBF A;  5L3G A;  3PSF A;  1U6G A;  2QEX I;  2KZG A;  1WZ2 A;  4UUS B;  2K40 A;  1QBJ A;  2DTR A;  1EH6 A;  5E17 F;  1I5Z A;  1D0X A;  4M6V A;  2O6G E;  5F0H A;  5TRD A;  2PX9 A;  1LQ1 A;  2FQ4 A;  2FXA A;  5ICF A;  2LMD A;  4N0B A;  2R7D A;  2P7C B;  1SFX A;  4DZP A;  3DU6 A;  2R5Y B;  1DDN A;  3HEF A;  2MC3 A;  4A3F J;  2F5V A;  2EA2 A;  2PJR A;  3QAH A;  1FEX A;  1SVM A;  4EV0 A;  3H0D A;  2JSP A;  2JVH A;  3B6A A;  5BOX A;  3VYT B;  1PP8 F;  2NVU B;  3J7A Y;  2L7K A;  3G1O A;  2MH9 A;  4A12 A;  5DTD A;  4NQW A;  3HB9 A;  3L1P A;  3EPZ A;  4P55 A;  2FBH A;  4DQ2 A;  4S0H B;  4U0W A;  2G0E A;  1LNW A;  2D5V A;  3CF2 A;  1YRN B;  3DEW A;  1FBQ A;  2OCC H;  2HPI A;  3S3N A;  3OV8 A;  1ZAO A;  1EH7 A;  1OYI A;  2E35 A;  2XSJ C;  3BQZ A;  2DDA A;  4LK0 F;  4D9J A;  3WTZ A;  2HZT A;  3KLO A; 
#chains in the Genus database with same CATH homology
 3E6M A;  4JQF A;  4OIP F;  5K5Q A;  3KET A;  1FOK A;  3NQO A;  3WTT C;  2OZ6 A;  3C3W A;  4CHU A;  5FD6 A;  4UVC A;  4Y13 A;  3BOQ A;  3WTS C;  2JSC A;  4ZZD A;  5L3E A;  3QU6 A;  2PG4 A;  4U0V A;  1BIB A;  2FBK A;  4O3M A;  5E1Z B;  4EGZ A;  4UHT A;  3ZMZ A;  1YG2 A;  4IHS A;  3VOD A;  1FYK A;  3JAM Z;  4H0E A;  5HS9 A;  3ZQ7 A;  3IRQ A;  2HGC A;  2ZFW A;  5J8C A;  2DO7 A;  3KP5 A;  4EJW A;  3I71 A;  2FE3 A;  5CYV A;  2JPC A;  5DUI A;  4CXF A;  3HHG A;  1OKR A;  1MJB A;  3DF8 A;  3HYI A;  2CWE A;  3I5U A;  2EV5 A;  1MZB A;  3HTU A;  2W84 A;  3GW2 A;  4KIF A;  4HF1 A;  5LRR A;  2BE5 F;  5IT3 A;  1IUY A;  3ULQ B;  4XSZ F;  3LST A;  1W4M A;  2HKX A;  2F2E A;  5BQT A;  1BJA A;  1R23 A;  2ZCW A;  3IKV A;  1YQA A;  2L02 A;  1G3Y A;  2CFX A;  5DDG A;  2OBP A;  2QLZ A;  3VB2 A;  1D5V A;  2O8X A;  5HLI A;  3FF5 A;  3QOP A;  5HDG A;  5ILS A;  1Z6T A;  2V1D A;  1YS6 A;  2IT0 A;  3G73 A;  2IA0 A;  2W24 A;  1UST A;  2FOK A;  4LG0 A;  1J9I A;  4QLC U;  1XSV A;  4GCV A;  4LB5 A;  2R7F A;  1YO5 C;  2FRH A;  1U8R A;  4KN7 X;  3IC7 A;  5K1Y A;  5D6F A;  2ESN A;  2VON A;  4MTD A;  3REO A;  3CLO A;  1TNS A;  4UUV A;  1WWX A;  4U7D A;  4KNY A;  2NRA C;  4XLN F;  3E6C C;  4GO1 A;  3EYI A;  4IRG A;  3WTU C;  2OAZ A;  2E7X A;  2W25 A;  2HTJ A;  3J80 K;  2YPR A;  3VEP A;  4MTE A;  5CVJ A;  2Y48 A;  3TDZ C;  1R1V A;  2Y0M A;  2LF8 A;  1Y0U A;  3LAJ A;  1LEB A;  3I59 B;  1BBY A;  2XIG A;  3P9C A;  3O2P E;  2K02 A;  5JR3 A;  2EFN A;  1T2K A;  3Q9V A;  4FX0 A;  2FBI A;  1ON2 A;  4RS8 A;  4I98 B;  3GFL A;  4PDK A;  4ZH4 F;  1U5T C;  3DQV C;  1XMA A;  3D0S A;  1YYV A;  2RN7 A;  2IP2 A;  4MGR A;  5FLX Z;  5ICE A;  2H09 A;  5JVT A;  1KYW A;  4UVB A;  2IA1 A;  4R79 A;  2PMU A;  1GXQ A;  4L0Z B;  2O61 A;  2QBY A;  5ICG A;  1BOA A;  1IRG A;  2RC4 A;  1ZAR A;  1QZY A;  4M71 A;  5LGT A;  3LQR A;  3TQN A;  5D4S A;  1JHH A;  3NRV A;  4KIG A;  2ZXJ A;  5FD5 A;  3KEQ A;  3EET A;  5LLQ A;  1X3U A;  2G7U A;  4YIF A;  3QU3 A;  3MAJ A;  1FT9 A;  3P9I A;  2CO5 A;  1ONV A;  1KQ0 A;  1A04 A;  1CF7 B;  1HKT A;  2FMY A;  3ZMT A;  3DXJ F;  2DQL A;  4PCQ A;  2RV8 A;  1ZGA A;  2KIM A;  2PMH A;  3KEO A;  3QP6 A;  1DUX C;  2CQK A;  1YLF A;  1XB4 A;  3WE3 A;  2EFQ A;  2HQR A;  1IXS B;  1PUE E;  3KCC A;  4Q47 A;  2K86 A;  4YFX F;  2DPD A;  2DI3 A;  1GHC A;  2HKO A;  1G6N A;  1TLH B;  2V79 A;  5BS6 A;  2RVC A;  2VE9 A;  3WG9 A;  1FPQ A;  4WXD A;  4IRI A;  1BC7 C;  3R4K A;  3ZPL A;  1I1G A;  2ZKZ A;  1MJA A;  4MEY F;  2E1C A;  3T5X A;  2P6S A;  1ZLJ A;  2RDP A;  1BIA A;  2L4A A;  2HEO A;  2EJR A;  5ILU A;  1UHM A;  2DLL A;  1I27 A;  2Z5U A;  1FZP B;  3SFZ A;  1K7A A;  1WI9 A;  1HXD A;  1JGS A;  4D0P A;  1USS A;  3E3V A;  1KU3 A;  2VE8 A;  2BGC A;  1OYY A;  2L3D A;  2CGP A;  1Q1H A;  1WQ2 A;  5E1W A;  4HW0 A;  2GQQ A;  3KP7 A;  1YS7 A;  5FGM A;  1LEA A;  4KDP A;  1LVA A;  5E8G A;  1ZGJ A;  1U78 A;  3F3X A;  2XVC A;  2E7W A;  3RTR A;  1MGT A;  4HZF A;  1E17 A;  2M8E A;  4ZZL A;  4OIQ F;  4BNC A;  3MQ0 A;  1R1T A;  1AWC A;  4HLY A;  1K6O A;  4LB6 B;  2YR2 A;  1Z6R A;  3E5U A;  2QQA A;  1S3J A;  4CZZ A;  1ZG3 A;  2ZME A;  4P5O A;  3GZ6 A;  2PBI A;  5D4R A;  2M5W A;  1DP7 P;  4FX4 A;  2WV0 A;  3C1D A;  5AON A;  1PP7 U;  4HF0 A;  2D1V A;  5CVR A;  4OIR F;  1I1S A;  2BBY A;  1MDM A;  1L0O C;  5ERI A;  3J7A O;  1HST A;  3CTA A;  2P6T A;  3FMR A;  1ODD A;  3COA C;  1LDJ A;  5EEH A;  1OPC A;  1U2W A;  4HX8 A;  5TJJ A;  1LJ9 A;  4EM1 A;  5IT9 K;  1XSD A;  3JTH A;  4HAM A;  2KRF A;  5DD4 A;  2C6Y A;  2G9W A;  4OIO F;  1W7P A;  1K79 A;  5DUK A;  5ED4 A;  3Q9S A;  1B59 A;  5LEJ A;  4MEX F;  1FNN A;  1CGP A;  3L7W A;  1ZG1 A;  3V7R A;  1HBX G;  2IRF G;  3F8B A;  4HQE A;  2M1B A;  2ZNZ A;  4KFC A;  5CJ9 A;  1XMK A;  4M9X A;  4EMS A;  2A07 F;  3K69 A;  4B8X A;  3WGH A;  1HKS A;  3GFJ A;  5D5X B;  2O0Y A;  1ZN2 A;  1KYZ A;  4LLL A;  4L0Y B;  5HOO A;  2Y75 A;  1JE8 A;  4L9J A;  4ENK A;  1XD7 A;  4UV9 A;  2TDX A;  4LMY A;  1CF7 A;  2HWV A;  1HSJ A;  3JW4 A;  2XAH A;  3MEX A;  3JSO A;  1B4A A;  1OYW A;  2HYF A;  2Q2E A;  2DQR A;  3KP6 A;  2Q0O A;  5DCM A;  4LLN A;  3ABU A;  3HHH A;  2A3S A;  3J80 Z;  3K2Z A;  3HSE A;  3B02 A;  4ESF A;  3M8F A;  1XN7 A;  5F6F A;  2YX7 A;  6PAX A;  1FYL A;  4YII A;  4RGR A;  2ETH A;  1P4X A;  5E20 A;  3WU0 A;  1UB9 A;  2JZY A;  5KVR A;  2PI0 A;  3F8C A;  4Q5S F;  3BPV A;  1MJ9 A;  1O57 A;  4IVN A;  4N9H A;  3F23 A;  1BM9 A;  1IN6 A;  1F9N A;  2YU3 A;  5F1R A;  4Z2Y A;  1RI7 A;  4ENN A;  4G7Z F;  4CYD A;  1O3Q A;  2ADU A;  2EA4 A;  5FO5 A;  2DK5 A;  3CO6 C;  4EVI A;  1RZ4 A;  5H6R A;  3QP5 A;  5AIQ A;  4BXU A;  4G6D A;  4IF4 A;  2ZBK A;  1DPR A;  2ISY A;  1ZG5 A;  4RGU A;  4I01 A;  1XDS A;  2GA1 A;  4PGH A;  2PFB A;  2ESH A;  4DNC A;  5D5U B;  3F6V A;  2MLK A;  2GAU A;  3GO5 A;  2JRT A;  3KE2 A;  4RB2 C;  1RIO H;  2V6C A;  3SQN A;  1Z05 A;  2NNY A;  3F8M A;  3HSF A;  2PQ8 A;  4S05 A;  5FFX A;  4EJT A;  1W5T A;  1FP1 D;  1KGS A;  4OIN F;  3ZP5 A;  3T8R A;  3I0T A;  4M72 A;  1DPU A;  3RKY A;  2EV6 A;  3HRS A;  4ENM A;  3F22 A;  4WX9 A;  1IXR C;  4EJV A;  2PEX A;  4LD5 A;  1GVJ A;  2XAG A;  1UCR A;  4BAY A;  2E1N A;  5E8I A;  1RUO A;  2X0L A;  1ZHF A;  1D8K A;  1TNT A;  3CDH A;  2R3S A;  3VOE A;  2OQR A;  2OU2 A;  4RAZ A;  1IF1 A;  4AD9 A;  3OOP A;  4ZYG A;  2QYO A;  2A61 A;  2W85 A;  1GXP A;  3U9G A;  2V1X A;  2HR3 A;  2A6E F;  4KMU X;  2STT A;  3WGG A;  1RUN A;  2JTV A;  5K5R A;  3GF2 A;  4L5J A;  1OR7 A;  2VN2 A;  3FMS A;  1Z7U A;  1O3S A;  1SFE A;  2EFP A;  5LGU A;  3GEZ A;  4G8X A;  1U5T B;  4UNO A;  2P5V A;  3KP2 A;  3ABT A;  1KU7 A;  3IL2 A;  1R7J A;  2LF7 A;  3ML6 A;  1C0W A;  4A0X A;  1EV7 A;  1S8N A;  4KIB A;  4ON0 A;  1T6S A;  3CUQ B;  3R61 A;  1QPM A;  1K78 B;  2KIF A;  4WXC A;  1OMI A;  3FHZ A;  2G7H A;  2XHK A;  2K4B A;  3T0Y A;  3BY6 A;  3E6B A;  2XAQ A;  3BJO A;  4EM2 A;  1ZRE A;  3V8K A;  5J8F A;  1R1U A;  1FP2 A;  3JTG A;  4MQ9 F;  3ZMU A;  2FNA A;  3H3U A;  3H92 A;  1XCB A;  2WTE A;  4EM0 B;  1YW9 A;  1HKQ A;  3KFW X;  1FSE A;  4WCG A;  1P4W A;  1XGO A;  3CUQ C;  3N4M A;  2CG4 A;  4LLG F;  3KLN A;  4A6E A;  2A6H F;  2KJB A;  3KP3 A;  2DAO A;  4RB0 A;  2WC2 A;  2GWR A;  1G3W A;  1J2X A;  1L3L A;  1BI3 A;  5KK1 A;  4A2U A;  3D5L A;  1XGM A;  1EH8 A;  5LRS A;  1HW2 A;  1SD6 A;  4L9V A;  1T38 A;  3F21 A;  1Z9C A;  3LA2 A;  3FZV A;  2F5F A;  3KP4 A;  4PGG A;  3K0L A;  4LJZ F;  4HV5 A;  4HOB A;  2JT1 A;  1AOY A;  2MLG A;  3H3Z A;  1Z91 A;  2YSR A;  2PLY A;  4AIJ A;  3ECO A;  4YFK F;  3DKW A;  2QM3 A;  4LGW A;  5CLS A;  3LAP A;  4IJA A;  3LQQ A;  1W7P D;  4ZYH A;  5ILV A;  3SHF A;  2H27 A;  1V4R A;  4WWC A;  3T1B A;  2M30 A;  4ESB A;  2JPB A;  1WSU A;  2OQG A;  4UV8 A;  4KA4 A;  2K27 A;  1SD7 A;  1BI2 A;  4KUM A;  4KMF A;  1D8J A;  3GXO A;  4AIH A;  3U1D A;  3L2C A;  1BC8 C;  2D1H A;  4IHT A;  2RGV A;  3TDU C;  2UWM A;  5DCF A;  2A5Y B;  3N97 A;  1REP C;  2ACJ A;  4M73 A;  2FF4 A;  1YIO A;  4BHB A;  3LA7 A;  4IPA A;  4A0Y A;  3P9K A;  1ZYR F;  2MD5 A;  2EFW A;  3FMQ A;  5LHH A;  4GYG A;  2AS5 F;  1SMY F;  1SMT A;  2XV4 S;  4QWQ A;  2IW5 A;  4YG2 F;  3DEU A;  3FX3 A;  1YTY A;  5E18 F;  1KU9 A;  4A5M A;  3U2R A;  5H6Q A;  4S04 A;  4CO8 A;  1XGN A;  1HW1 A;  3GFI A;  3PFI A;  3IWZ A;  1Z1D A;  2NAZ A;  4XRF A;  2EK5 A;  2QUF A;  2M87 A;  5AIP A;  2L01 A;  1FBS A;  1HW5 A;  1S6L A;  2VT2 A;  3DP7 A;  1QQI A;  2DK8 A;  2CYY A;  3I64 A;  3KZY A;  3W6J B;  3HIF A;  2BEO A;  3HRM A;  2H6C A;  3SZP A;  1TTY A;  3F8F A;  1QNT A;  2QWW A;  2VC1 A;  1H9G A;  1TW3 A;  2FA5 A;  1F4K A;  1T39 A;  3TOB A;  3V7C A;  3I59 A;  3J81 K;  3L9F A;  3EQL F;  4LG0 B;  2XAS A;  4XLP F;  2GIV A;  3TOA A;  3HSR A;  1S7O A;  3G3Z A;  3W6K B;  2W57 A;  3MCZ A;  3R60 A;  3AAF A;  4XSX F;  2DU9 A;  5EEG A;  3QPH A;  5A2Q K;  1TQP A;  4TV7 A;  1RNL A;  2VBZ A;  2IVM A;  4L18 B;  2VBW A;  4XBF A;  2Z3Y A;  4RAY A;  4E70 A;  4OMY A;  2L4M A;  4I2O A;  1IN5 A;  2GZW A;  1R22 A;  4P9U A;  3K1M A;  3CUO A;  2J5P A;  4Y15 A;  2VBX A;  3M8E A;  4HDU A;  4A0Z A;  2D45 A;  3FXU A;  2ELH A;  4I09 A;  2VT3 A;  1P92 A;  1XCV A;  1WRJ A;  3C7J A;  3M9A A;  3WTV C;  2EB7 A;  3ELK A;  5J6X A;  4U88 A;  2XRN A;  5LHG A;  2XUB A;  4R1H A;  2A68 F;  3WGI A;  2MA3 A;  2H94 A;  2AXL A;  3HRU A;  2LSO A;  2Z99 A;  4HV6 A;  1TQM A;  1QO0 D;  3P7N A;  4M9Z A;  5CVV A;  3IHU A;  2M45 A;  3T8T A;  4MQV A;  3HOS A;  4WXH A;  5F64 A;  1QGP A;  5BPI A;  1XSX A;  3JSP A;  1P6R A;  3LA3 A;  2P7V B;  2DFI A;  3R6S A;  2HDC A;  4WF2 A;  2D2W A;  5CVI A;  3SXY A;  4FT8 A;  1FSH A;  2K4J A;  3GLX A;  1LB2 A;  2OA4 A;  4BYY A;  3BZ6 A;  2O3F A;  1G3T A;  1B6A A;  1S7A A;  5HLH A;  2QBY B;  4YFN F;  2Z33 A;  3M1E A;  4Q4Z F;  1WKM A;  2QQB A;  5D8L B;  4HF2 A;  1STZ A;  2UXN A;  1ZRD A;  3ZN1 A;  4EGY A;  2XKP A;  3DPL C;  2ZNY A;  3MWM A;  3F6O A;  2HQN A;  4HYE A;  1ZRC A;  1H0M A;  3LFK A;  3O3K A;  3ZMV A;  4M74 A;  3GYH X;  4M9S A;  1IZ1 A;  2P5L C;  3I4P A;  3IRR A;  3BRO A;  2GA2 A;  4G9Y A;  1P2F A;  2O03 A;  1R36 A;  4UXN A;  3DV8 A;  2NYX A;  3RYR A;  3TGN A;  1J59 A;  3BPX A;  2OD5 A;  4OU0 A;  2YX4 A;  3EUH A;  2FQ3 A;  3FXQ A;  1LDK B;  2X4H A;  4AWX B;  4HX7 A;  1UHW A;  4R8H A;  3RPQ A;  2CSO A;  2QQ9 A;  3ZMS A;  5HS8 A;  4B09 A;  5E1X A;  3MZH A;  3GX4 X;  1ULY A;  2RKH A;  2V9V A;  4I0A A;  3RYP A;  2LDU A;  5DYM A;  3S2W A;  2ZO4 A;  1ON1 A;  2NNN A;  1R58 A;  3RJP A;  3GUD A;  3MZY A;  4KYW A;  5D5V B;  4NB5 A;  3B73 A;  2XRO A;  1XGS A;  4CDG A;  2PJP A;  3F8N A;  2Z9O A;  5FFZ A;  1QZZ A;  1J0R A;  2ZJ2 A;  5HDK A;  3CJN A;  2IA2 A;  5D5W B;  2VC0 A;  3MFK A;  4BQA A;  3R0A A;  2EV0 A;  2J5O A;  4PZJ A;  3IKT A;  2LNB A;  4L5I A;  4CGZ A;  4A6D A;  2EFO A;  1TBX A;  2L54 A;  2F5C A;  4U0Y A;  4GYI A;  3QPT A;  2QEN A;  5LBQ A;  2KIU A;  3ZMD A;  2A69 F;  5HLG A;  2HYG D;  3ECH A;  2H6B A;  1BI1 A;  2ZME B;  3I58 A;  1O7F A;  2UZK A;  1UFM A;  1F5T A;  3F72 A;  4KT5 C;  1ZRF A;  5JI6 A;  5DV5 A;  3FWE A;  5DD8 A;  5ICC A;  2RQP A;  2VBY A;  1SD4 A;  2P5K A;  1MKM A;  1FX7 A;  1VTN C;  1BI0 A;  2STW A;  3BDD A;  2F5D A;  1MDM B;  3TO9 A;  4KIC A;  4IRH A;  4A5N A;  2ISZ A;  1V3F A;  3O6B B;  5D6E A;  3DPT A;  4GXO A;  5HS7 A;  4ASN A;  1IN4 A;  3K9T A;  1FYM A;  1JHF A;  3V8L A;  5L3C A;  4O5V A;  1KQ8 A;  2CW0 F;  4HBL A;  3PQK A;  4UVA A;  1W7P B;  3L00 A;  3JAM K;  1YW7 A;  4HX4 A;  3TO7 A;  3GFM A;  4EJU A;  1XDU A;  1SAX A;  2GXB A;  2BV6 A;  5BMZ A;  2GXG A;  5K5O A;  2P8T A;  4P9F A;  1IXC A;  1B1B A;  1NHA A;  3E5X A;  4NHJ A;  4U7B A;  1ZH5 A;  4Q48 A;  2XGX A;  3WTY C;  4OMZ A;  1J75 A;  3BJ6 A;  3EDP A;  3BP8 A;  1JXS A;  3BWG A;  4EJO A;  4M6X A;  3RPU A;  1O3T A;  4CIC A;  3J81 Z;  3SZT A;  5IT9 Z;  4I0B A;  4ZYD A;  3BJA A;  2VOO A;  4ETS A;  2HFH A;  4AVP A;  5CVU A;  4OOI A;  1FWZ A;  2XAF A;  3HTS B;  1P4A A;  5A2Q Z;  2WWY A;  3HUG A;  2Q8K A;  2F5E A;  3CO7 C;  1O7L A;  1YFH A;  3KZZ A;  5DCM B;  5DEQ A;  3RIR A;  4M6Y A;  5L3B A;  1FLI A;  4G7O F;  3L09 A;  4BH9 A;  3DFG A;  2P4W A;  3IWF A;  4AIK A;  3RKW A;  5H20 A;  3I54 A;  3K1N A;  4HA8 A;  1KQ9 A;  3R0J A;  1IRF A;  3GZ5 A;  1IN8 A;  3C18 A;  3WOD F;  3FM5 A;  4MHG A;  3E6D A;  3QRF F;  3E97 A;  3V7S A;  4RGS A;  1T0F A;  2PN6 A;  2XKO A;  4GGG A;  4JK1 X;  3RI4 A;  3I53 A;  1S29 A;  3FM3 A;  3EYY A;  1SD5 A;  2OZU A;  3GWZ A;  3ERE D;  3WTW C;  5FB2 A;  4Y17 A;  2DW4 A;  3GVA A;  5HVQ C;  5LGN A;  4O6J A;  3TKY A;  3TO6 A;  3ROU A;  4G6Q A;  2DBB A;  1B9M A;  4FHT A;  2COM A;  5BPD A;  4F7Z A;  1R00 A;  3V8J A;  4K2E A;  1TW2 A;  2VOD A;  2VOP A;  5HDN A;  1F1Z A;  3K1P A;  4BHC A;  2FSW A;  2HTS A;  1HQC A;  1IW7 F;  1R5G A;  4HQM A;  3RDI A;  1J7K A;  3M7G A;  4IXA A;  5LEK A;  4EQQ A;  3WTX C;  5FLX K;  2NS0 A;  4ZYE A;  4HDV A;  1TQI A;  4I02 A;  2V1U A;  1R5H A;  4LFU A;  3FXR A;  2IPQ X;  2B0L A;  4L9N A;  1E2X A;  1U5T A;  1W5S A;  2VXZ A;  5L3F A;  2KJC A;  1FC3 A;  3V4G A;  2IJL A;  4WK8 F;  1BN5 A;  3HOT A;  2RNJ A;  2XAJ A;  1D3Y A;  1J5Y A;  1T98 A;  4N9I A;  3ZN0 A;  2K7L A;  3CUQ A;  3NEU A;  1SFU A;  5JFR A;  1K78 A;  3PQJ A;  4LK1 F;  1MD0 A;  1I6X A;  3WE2 A;  4P96 A;  1ZLK A;  1U3E M;  2KKO A;  4JBA A;  4ESJ A;  2FNP A;  2EWN A;  5D8K B;  4RB3 C;  4HLX A;  4G94 A;  3VFZ A;  1O3R A;  4BHP A;  1FBU A;  4G7H F;  2QZ8 A;  1IAW A;  5L3D A;  1LDD A;  1G4D A;  2MH2 A;  5JHU A;  2UXX A;  1B9N A;  4MNU A;  3Q5F A;  4KN4 X;  5LHI A;  2FML A;  2HOE A;  1PDN C;  3HRT A;  1YW8 A;  4RB1 A;  2BYV E;  4L9T A;  3E5Q A;  2LKP A;  1IN7 A;  3RKX A;  1KU2 A;  4RGX A;  4ENJ A;  2DPU A;  1KA8 A;  3LWF A;  1FY7 A;  1H9T A;  4I7H A;  2DT5 A;  1G3S A;  3WU1 B;  2FU4 A;  2HS5 A;  3ISP A;  2FEZ A;  2QVO A;  2MBF A;  5L3G A;  1U6G A;  1QBJ A;  2DTR A;  1EH6 A;  5E17 F;  1I5Z A;  2O6G E;  5TRD A;  1LQ1 A;  2FXA A;  5ICF A;  4N0B A;  2R7D A;  2P7C B;  1SFX A;  1DDN A;  2MC3 A;  2EA2 A;  3QAH A;  4EV0 A;  5BOX A;  1PP8 F;  2MH9 A;  4A12 A;  4NQW A;  4P55 A;  2FBH A;  4DQ2 A;  4U0W A;  1LNW A;  1FBQ A;  3OV8 A;  1ZAO A;  1EH7 A;  1OYI A;  4LK0 F;  3WTZ A;  2HZT A;  3KLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...