1J75A

Crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
NLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*CP*GP*CP*GP*CP*G)-3'
publication title Structure of the DLM-1-Z-DNA complex reveals a conserved family of Z-DNA-binding proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/dna
total genus 17
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j75A00
3DV8A 4LB6B 4NQWA 3N4MA 1ON2A 1TTYA 3C18A 4WWCA 1GXQA 1ZGAA 1FBSA 5H6RA 3DKWA 3KEQA 2K02A 1K79A 3WG9A 2VODA 1SAXA 3KCCA 1YQAA 2G9WA 3GUDA 4Y15A 3D0SA 1YO5C 1L3LA 1NHAA 2XKPA 4CXFA 1P2FA 1U3EM 2V79A 1IN8A 1WWXA 1ZAOA 1HKQA 4I7HA 2ZBKA 1XSDA 1TLHB 3ML6A 1IXRC 4M9ZA 2STWA 5LEKA 3HOSA 1FNNA 2VT3A 1U2WA 4IF4A 4EQQA 2M1BA 3GX4X 3OV8A 2RC4A 5ED4A 2K4JA 1LEBA 2C6YA 1QZZA 2F2EA 1TQIA 4YFNF 1YG2A 1IN5A 2MC3A 2VOPA 1FSEA 4G8XA 2FBKA 2XVCA 5CVRA 5AIPA 4PDKA 3V8LA 4Q5SF 2DW4A 1G3WA 3HHGA 1MJAA 1LEAA 4U0YA 3JTGA 2FSWA 2O8XA 5BOXA 3BJOA 3RPQA 4MTEA 3I64A 1J9IA 3SHFA 2X4HA 3B73A 3REOA 2EB7A 3S2WA 4KYWA 1GHCA 1PP8F 2FOKA 3TO6A 4OIPF 3TOAA 2CSOA 4F7ZA 3RI4A 1U5TA 4M74A 1ZGJA 4I01A 1YFHA 3PQKA 3SZTA 1PP7U 1IAWA 4LFUA 4HX4A 5L3CA 3BPVA 1P4XA 1S7AA 1FBUA 3LA3A 2OQGA 4UVCA 3P9KA 2ZMEA 4Q48A 2PEXA 2A69F 4KMUX 1R1VA 2YX4A 1FPQA 3TOBA 2QENA 3CUQC 2V6CA 4KNYA 4K2EA 4M72A 4BAYA 1ZRFA 1LVAA 2ZMEB 3H3UA 3GF2A 1ODDA 3C3WA 2PI0A 2A6EF 2STTA 2ESHA 4MGRA 1E2XA 2M5WA 3KFWX 4EGZA 1OYIA 1ZLJA 2Q0OA 1XGNA 4IRGA 4HV5A 2UXNA 3LAJA 4GO1A 3ECHA 1FY7A 3I53A 4CICA 3K2ZA 1CF7A 1L0OC 4HBLA 4YIFA 4KIBA 3MWMA 2MD5A 3TDUC 3AAFA 1T6SA 1YW8A 2ISYA 3LAPA 4EV0A 1S29A 2CG4A 4OIQF 4NHJA 1USTA 1QGPA 4G6DA 2R3SA 1G3SA 1R00A 2IPQX 2EFQA 4Q47A 4RAZA 1T0FA 5HS8A 2HOEA 2FNPA 5AIQA 4P5OA 3FM5A 5CVUA 5D5WB 1RIOH 2KIMA 3BPXA 1FT9A 3VODA 1ULYA 3HTUA 3KE2A 4CDGA 1I6XA 5HOOA 2EK5A 1XCBA 3IRQA 4MEXF 2PG4A 1EH6A 2AXLA 1Z6RA 3KP4A 2HTSA 3LA2A 3GO5A 4ESBA 1D3YA 3RTRA 3EUHA 4MQVA 1VTNC 2PQ8A 3J80K 2P6TA 2Z3YA 2DK5A 2Q8KA 3L09A 4WXCA 2FA5A 1RNLA 5LBQA 4CHUA 4LD5A 1BBYA 4RGSA 4G7HF 5LHHA 1IRFA 4R1HA 5IT3A 1G3TA 2GAUA 3KLNA 1S6LA 2VE8A 3HRUA 1TQPA 4RGXA 4DNCA 1B9NA 5BS6A 4HZFA 3CJNA 3U9GA 3MEXA 4EMSA 1I1SA 1JXSA 1KU2A 4GXOA 5D4SA 5LRSA 4LMYA 4EJVA 3WU0A 1K6OA 1KA8A 4P55A 4LG0B 5JI6A 3BOQA 1U5TC 4OMZA 2EFNA 3KZYA 2IA0A 1H9GA 1FYMA 4U0VA 1HKSA 5L3DA 2WWYA 5J8CA 4AIKA 3DPLC 5HVQC 1FP2A 1XMAA 2NYXA 3L9FA 1OR7A 3GFJA 3EETA 3JAMK 1O7LA 4IXAA 3BROA 2D45A 2DLLA 1HBXG 1SFXA 1CGPA 3M7GA 1S8NA 5DDGA 2K86A 2FXAA 4M9SA 2L54A 4MNUA 3TO9A 5FO5A 3WE2A 5KK1A 4A6EA 3V7CA 3MZYA 5CVIA 2M30A 2EJRA 1QZYA 3ERED 3I59A 1O3TA 4U0WA 3ZQ7A 4OINF 2ISZA 1RUNA 2HKXA 2NNNA 3TKYA 1XSXA 2ETHA 4R79A 2DTRA 3WTYC 1B9MA 1X3UA 1U8RA 1IRGA 1YLFA 1BOAA 3T0YA 3K0LA 1QBJA 1RI7A 3N97A 1B4AA 3L7WA 1SFEA 3ELKA 4MHGA 1G4DA 2IRFG 5L3GA 4EJWA 1Z9CA 2H6CA 2BGCA 3VOEA 3U1DA 1USSA 3E5QA 3F72A 5DUIA 2VONA 3C1DA 3C7JA 4AIHA 5CVVA 4S05A 2NNYA 1LNWA 3V4GA 3J81K 3DXJF 4EM0B 1Z7UA 5FD5A 4I0BA 3G3ZA 3QU6A 1SFUA 2QWWA 3R0AA 5FLXK 5CJ9A 1MGTA 1MD0A 4HV6A 1Z05A 2QUFA 4H0EA 1P4WA 3HSFA 1YS7A 3CUOA 1HW5A 1DDNA 2MA3A 5D4RA 2FU4A 4AD9A 1B6AA 3ECOA 3TGNA 4EM1A 1IF1A 4UV9A 1YTYA 1ZN2A 1OYWA 3LFKA 3JAMZ 1ZG1A 2FE3A 1KQ8A 1V4RA 3Q9SA 2Z99A 2EA2A 2COMA 5HDKA 1C0WA 3ZN0A 2F5DA 4ESJA 4ZYDA 1BI3A 1KU9A 5ICFA 2VBYA 5F64A 2DAOA 4QLCU 2ADUA 1KU3A 1IW7F 4ZH4F 2XASA 3DFGA 2HGCA 3I71A 4GYIA 1ZH5A 2G7HA 5DD8A 3QOPA 2KJBA 4EGYA 4HA8A 5DYMA 2MH9A 5DCMA 5LGUA 2DQRA 5LGNA 2Y75A 1SMYF 3PFIA 2OBPA 2RVCA 5E17F 3BP8A 5ICGA 4OOIA 1DUXC 2QZ8A 4O5VA 5DCMB 1HW2A 2HQNA 4G94A 4KICA 5LGTA 3CO6C 5D6EA 3L2CA 2VC1A 1EH8A 4KIGA 4MTDA 4XSZF 5D6FA 1QO0D 4BNCA 4G7OF 2FMYA 3COAC 3KP3A 4KFCA 2Y48A 2KIFA 3RKYA 2EA4A 4EVIA 1ONVA 2PLYA 2P7VB 4TV7A 4L9VA 3E97A 2IJLA 3FXQA 3FMSA 4HDVA 3J81Z 1LDKB 4FX0A 1IZ1A 3V7RA 2GIVA 1TNSA 4A0ZA 3WTVC 4XSXF 5JFRA 3F22A 2FMLA 4XLNF 1RUOA 2X0LA 3JSPA 1Y0UA 5ILVA 4HX7A 2QBYA 2CO5A 5FLXZ 2ZO4A 3EYYA 2GXGA 1O3SA 3R60A 1Z91A 2PMUA 3R61A 3WODF 2A6HF 1FSHA 2DU9A 1YS6A 3HRMA 1HXDA 5JHUA 3DF8A 1V3FA 3M9AA 2QBYB 1W5SA 4ZYHA 1MJ9A 3D5LA 2EFOA 3T5XA 4BH9A 4UXNA 3BJAA 3RPUA 2R7DA 3DPTA 5DCFA 3ZMZA 2Y0MA 2LF8A 3LQRA 3IKVA 5FGMA 5CYVA 4HLXA 2O6GE 3V8JA 1XGOA 2HZTA 4WF2A 5LEJA 2L3DA 3IWFA 1P92A 2P5KA 4U88A 3GWZA 5L3EA 5ICEA 2OQRA 4RAYA 2FBHA 2XROA 2IP2A 3I58A 4PCQA 1MDMB 3T8TA 1XN7A 5CVJA 2YX7A 3FX3A 3E6MA 3T1BA 2EV0A 1A04A 3F8CA 3WGHA 5D5UB 3ZMVA 1W7PA 2XKOA 1ZG3A 2QLZA 2XIGA 2HFHA 3K1NA 1KQ9A 5FB2A 3ZN1A 5E18F 3FWEA 1WKMA 2VXZA 3OOPA 1T39A 2A5YB 4ENKA 1W7PB 3H3ZA 2Z9OA 4BYYA 3M8FA 4I09A 1DPUA 2WTEA 2BE5F 4XBFA 1STZA 2D2WA 3I54A 4HOBA 2V9VA 5TRDA 2RDPA 4A5NA 1U78A 1KYZA 1JHHA 4HF2A 1XDUA 2QQBA 4L5IA 3P7NA 3E5UA 3RKXA 2FEZA 5F6FA 4ENMA 4P9UA 2RV8A 4L0YB 2PN6A 2XGXA 4LB5A 3FMQA 2OA4A 4MEYF 1WRJA 1UHWA 3KP6A 4UNOA 1ZARA 1LB2A 4HQEA 2BBYA 2KKOA 2CQKA 2DPDA 4U7BA 4NB5A 1XD7A 2HYGD 3I0TA 2H09A 5DV5A 2V1DA 2BV6A 3ULQB 4LK1F 2LF7A 1FBQA 3ZMDA 2GA1A 2HYFA 5D8LB 5K5OA 5E20A 4O3MA 3CO7C 2ZFWA 4KN4X 4PGGA 3KETA 2V1XA 2OZ6A 3F8FA 2DT5A 3HYIA 5FFZA 1P4AA 5FFXA 1PUEE 4LG0A 3EQLF 1BN5A 1GXPA 2YU3A 3GFLA 5HLHA 1D5VA 2W24A 1LDJA 4EJTA 2RGVA 1KYWA 1T98A 1AOYA 4G7ZF 2NS0A 4P96A 1HQCA 1SD6A 3K1MA 5IT9K 4LLNA 4A0XA 1FZPB 3SXYA 4OIRF 2J5OA 5A2QK 1I1GA 1YIOA 3GFIA 3ZMTA 3KP7A 1I27A 2NRAC 2VN2A 1R23A 2DQLA 2JPBA 3VB2A 2XV4S 1J75A 3QP6A 3IWZA 1F9NA 1FX7A 2OU2A 3M8EA 2QVOA 2Z5UA 4IRHA 4YIIA 2XAJA 5LHIA 1XGSA 2EFWA 4UVAA 3HTSB 4IPAA 1R5GA 2YR2A 1DPRA 1S3JA 5HS7A 2EV6A 3FXUA 2D1VA 3F21A 2CFXA 2LDUA 3TDZC 1Z1DA 1ZRDA 1SD5A 2CW0F 3L00A 2EFPA 2VBWA 4E70A 4EM2A 3E6CC 3MZHA 4Z2YA 4BXUA 2JSCA 2W25A 4L9NA 4R8HA 1RZ4A 2FBIA 1W7PD 3T8RA 4L5JA 3FF5A 4JBAA 2JRTA 3FM3A 1P6RA 1WQ2A 4ENNA 1PDNC 2IW5A 2GA2A 1S7OA 4IVNA 4LLGF 1HSTA 3J80Z 1JHFA 5L3BA 1FOKA 3FHZA 4HF1A 3ABUA 5HLIA 2P5LC 5D5XB 2L01A 3HSEA 5BPDA 2ACJA 3CTAA 4AWXB 2HS5A 4GCVA 4U7DA 1B1BA 3RJPA 5K5RA 4I02A 2PFBA 3IL2A 1T2KA 2GXBA 3CDHA 4M6YA 2W85A 1LDDA 3JW4A 2ZNYA 3GXOA 4YFXF 2W84A 1KU7A 2UWMA 3LA7A 4PZJA 2IVMA 2NAZA 5IT9Z 4XLPF 1XSVA 1TW2A 4I2OA 1BI2A 3B02A 2P4WA 1ZREA 4EJOA 4ZYGA 4Y17A 3WTZA 3QAHA 2F5CA 2XAGA 3BZ6A 2KIUA 5E8GA 3CUQA 3ISPA 2HR3A 2VBZA 2M87A 3F8NA 1R1TA 5LRRA 5HLGA 4M9XA 3E6DA 2ZKZA 1U6GA 4OMYA 3GYHX 2Q2EA 1K78B 5E1WA 3SFZA 3CUQB 2UXXA 4RS8A 2H94A 3Q5FA 1J0RA 1TQMA 1BC8C 4PGHA 5D5VB 5J8FA 1HKTA 5J6XA 1ZYRF 2E7WA 4L0ZB 1GVJA 1XB4A 4M6XA 4P9FA 2O3FA 3WTTC 3Q9VA 4RB0A 2DI3A 2VE9A 6PAXA 4RB3C 1E17A 2MBFA 2QYOA 2DBBA 4UUVA 3MFKA 4UHTA 3WGGA 3HSRA 3TO7A 3FZVA 3H92A 4EJUA 5E8IA 1F1ZA 4A6DA 2BYVE 1HW1A 2RNJA 1R1UA 1O3QA 5FD6A 3JSOA 1YW9A 1KGSA 2IA1A 4M73A 3E3VA 3BY6A 2E1NA 4BQAA 1F5TA 2HTJA 4KN7X 1IN6A 2K27A 1XGMA 4M71A 4MQ9F 4RB1A 2XRNA 3LWFA 5HDNA 1G3YA 3HRSA 1XCVA 2A3SA 1LJ9A 2XAHA 2DK8A 1FC3A 2IT0A 4ESFA 5L3FA 2MLKA 4BHPA 5CLSA 1BJAA 3HHHA 2ESNA 3VEPA 1K7AA 3GW2A 2M8EA 5EEHA 2PBIA 3DEUA 4I98B 3WTXC 4HX8A 4WX9A 3IC7A 4BHBA 5DD4A 4CYDA 2W57A 3ZP5A 4ZZLA 4ZYEA 1IXSB 3IHUA 3W6JB 1LQ1A 4N0BA 5ILSA 2LSOA 2A07F 2M45A 3G73A 3P9IA 4IRIA 2KJCA 4O6JA 1MDMA 3W6KB 5EEGA 4OU0A 1H9TA 3F6VA 2OAZA 4ON0A 1FYKA 4G9YA 1U5TB 3PQJA 1BC7C 3ZPLA 1J5YA 1Z6TA 2A68F 2MH2A 2P6SA 1R58A 2QQ9A 2PMHA 4HAMA 3BWGA 3QRFF 2ZJ2A 1UB9A 4QWQA 4HF0A 1BM9A 4WCGA 2HQRA 3F8BA 2K7LA 2K4BA 4KUMA 1HSJA 4L18B 3GZ6A 5BQTA 3GFMA 4L9TA 1FP1D 4RB2C 5JR3A 1J7KA 5F1RA 2V1UA 3JTHA 3HRTA 2CGPA 3IKTA 2IA2A 3R0JA 4YFKF 3WGIA 1WI9A 3LSTA 1MZBA 4KT5C 1IXCA 5K5QA 1G6NA 1JE8A 3CLOA 3EDPA 1CF7B 4IHSA 4LK0F 1TNTA 2VOOA 4D0PA 5HS9A 5BMZA 5DEQA 1O7FA 4AVPA 1FYLA 2VT2A 3GVAA 4ZZDA 3K9TA 5DUKA 2JPCA 4FT8A 2E1CA 5E1ZB 3VFZA 1O3RA 3HIFA 2XAQA 3FXRA 4B8XA 4ETSA 1T38A 3TQNA 3WU1B 4ENJA 3KZZA 1WSUA 2HDCA 2F5EA 2L02A 5ILUA 4UVBA 5HDGA 1ZG5A 4A0YA 2XUBA 3QPTA 1EV7A 3KLOA 2ELHA 2RQPA 1QQIA 2B0LA 2QQAA 5ERIA 3QPHA 2HWVA 3P9CA 1IN4A 4HW0A 2XAFA 2FQ3A 2YSRA 3U2RA 2L4MA 2UZKA 1OYYA 2CWEA 3DQVC 1XDSA 4DQ2A 2Z33A 2JTVA 2L4AA 1FLIA 3ZMSA 1IN7A 3E5XA 4Q4ZF 2VC0A 1UFMA 3R6SA 1ON1A 3WTUC 4HQMA 3LQQA 1KQ0A 4HYEA 2FRHA 1QNTA 3BDDA 1DP7P 2EWNA 4FX4A 2EV5A 2O03A 1SD4A 4A5MA 2QM3A 2BEOA 3O3KA 1F4KA 3GEZA 4LLLA 2J5PA 1JGSA 1I5ZA 3MQ0A 1R5HA 1TBXA 1D8JA 4ASNA 4S04A 4HLYA 4BHCA 2KRFA 5H6QA 1EH7A 2FF4A 2P5VA 3NEUA 1D8KA 1W5TA 4XRFA 3RDIA 4KMFA 5AONA 1MJBA 1TW3A 3F6OA 3I4PA 3J7AO 1H0MA 1FWZA 1SMTA 3WE3A 2JZYA 3F8MA 2O0YA 2HEOA 3KEOA 5KVRA 2P8TA 4WXHA 2D1HA 3MAJA 1BIAA 1O57A 4RGRA 4A2UA 4KIFA 5LLQA 1OKRA 1J59A 1YW7A 2DO7A 3RIRA 4B09A 5BPIA 4WXDA 2GWRA 4GGGA 2OD5A 5TJJA 4IHTA 4KDPA 3SQNA 4CZZA 3ABTA 3BJ6A 2H27A 3K1PA 4UV8A 2ZXJA 3O2PE 5ICCA 3FMRA 2XHKA 3HUGA 1XMKA 3NQOA 2OZUA 3QP5A 4YG2F 4FHTA 2H6BA 3GZ5A 1YYVA 3DP7A 4LGWA 3I59B 4CGZA 4CO8A 1ZRCA 1R22A 2LNBA 2R7FA 2GQQA 3O6BB 2DPUA 3EYIA 4HDUA 3V8KA 2O61A 3HOTA 1QPMA 2VBXA 5D8KB 4KA4A 3M1EA 2TDXA 2F5FA 2AS5F 2RKHA 3KP2A 2RN7A 4RGUA 3RKWA 2YPRA 1B59A 1UCRA 2ZNZA 1SD7A 4N9IA 3RYPA 1R7JA 2DFIA 3I5UA 3WTWC 3QU3A 3SZPA 1ZLKA 4LJZF 3ROUA 2CYYA 3IRRA 4N9HA 5JVTA 3E6BA 4G6QA 3F3XA 3F23A 2MLGA 5A2QZ 3ZMUA 2FNAA 3MCZA 1OPCA 4WK8F 2PJPA 3GLXA 1J2XA 4GYGA 3RYRA 4L9JA 1BI0A 1K78A 5H20A 1Q1HA 1BIBA 2P7CB 2JT1A 4A12A 4JQFA 3NRVA 4JK1X 2E7XA 4IJAA 5K1YA 2WC2A 4AIJA 3R4KA 2ZCWA 3WTSC 1UHMA 1IUYA 1ZHFA 3KP5A 1OMIA 1REPC 2G7UA 2HKOA 2A61A 2GZWA 1MKMA 4OIOF 2LKPA 5E1XA 5LHGA 1BI1A 4Y13A 1AWCA 1W4MA 2WV0A 3K69A 1R36A 4I0AA 3V7SA
chains in the Genus database with same CATH superfamily
3DV8A 4LB6B 4NQWA 2R0QC 2NOJB 4YEJA 4JOMA 2JRMA 3N4MA 3BQZA 1ON2A 1TTYA 3C18A 4WWCA 1GXQA 2K9SA 4PFOA 1ZGAA 2EINH 3FBIB 3JR9A 4A3IJ 2R7VA 4C2TA 1FBSA 5H6RA 3X2QH 3DKWA 1KZHA 2OF7A 3CMMA 3KEQA 3CP2A 2K02A 2VJ5A 2H8RA 3FISA 4FETA 5HLTA 3WG9A 1K79A 4NQWB 3L1PA 2QGUA 2VODA 1SAXA 3CCYA 3KYCB 3KCCA 1YQAA 2G9WA 3GUDA 4Y15A 3D0SA 1YO5C 1L3LA 1NHAA 2XKPA 4II3A 2IGNA 4CXFA 1P2FA 4AYBN 1U3EM 2V79A 1IN8A 1WWXA 4XKVA 2XRLA 1ZAOA 4XLFA 1HKQA 2O7OA 4FE7A 2Q1ZB 4I7HA 2OV7A 4XICA 2ZBKA 1XSDA 1TLHB 3A0BC 3ML6A 3CESA 1IXRC 1MNDA 1X3WB 4M9ZA 4G6TB 2K3PA 1Y1WJ 2STWA 2M4GA 3C2GA 5LEKA 3HOSA 1FNNA 1V5FA 2VT3A 1U2WA 2Y0SN 3JCUC 3DLLF 1R49A 4IF4A 4EQQA 2M1BA 1V55H 3GX4X 2O9LA 1S5LC 2WAEA 3OV8A 2RC4A 3IP4B 5ED4A 4JYKA 2K4JA 1LEBA 1BR2A 2GOXB 4C30A 2C6YA 1QZZA 2F2EA 3CP8A 1TQIA 1JGGA 4YFNF 2DFEA 1YG2A 1IN5A 1VZ0A 5FKMA 2MC3A 1H8AC 4IOAF 5TGTA 2VOPA 2WB1A 2BY3A 5HODA 2JA7J 1FSEA 2WA0A 2NS8A 4G8XA 1VQKI 3OYHA 1TWGJ 2X85A 3WG7H 3HB9A 2FBKA 2XVCA 5CVRA 2F6CA 4XLHA 5AIPA 4PDKA 3V8LA 1QU3A 4Q5SF 2ZFUA 4EATA 1OCRH 2DW4A 1EKEA 1G3WA 3HHGA 3HOZJ 2KZVA 3LL7A 2V7FA 3IUOA 1EF4A 1MJAA 1LEAA 1WJAA 4U0YA 3JTGA 2FSWA 2O8XA 5B5EC 5BOXA 3BJOA 3RPQA 4MTEA 3I64A 1J9IA 3C2BA 3SHFA 3SZGA 3HPGA 2X4HA 3B73A 3REOA 1TWCJ 2EB7A 3S2WA 3HL2A 4KYWA 1GHCA 3JRAA 1PP8F 1W0TA 2FOKA 3TO6A 4OIPF 3TOAA 2CSOA 4XRSG 4F7ZA 3RI4A 1N77A 1U5TA 4M74A 3SFIA 1ZGJA 4I01A 3QYEA 1WFXA 1YFHA 4QSHA 3PQKA 3SZTA 1PP7U 1IAWA 2R7RA 4B1RA 4PUSA 4LFUA 4HX4A 4RM2A 5L3CA 3BPVA 3SJMA 2LFBA 1P4XA 1S7AA 3BCBA 1FBUA 4RMNA 3LA3A 2DODA 1BW5A 2OQGA 4UVCA 4E7LA 2H1LA 4B48A 3H0GJ 4IEJA 3P9KA 2L5QA 2ZMEA 5E3OA 4Q48A 2PEXA 3DBLB 2A69F 2DMUA 4KMUX 5F0CA 5F27A 5HNFA 2VQLA 4E7ZA 3HKZN 1AA7A 4XOTA 1W36C 3LSPA 3ZQQA 5EJCA 5IP6A 1R1VA 1QPIA 2HDDA 2YX4A 1FPQA 2OC6A 2QENA 3TOBA 1T8IA 3CUQC 1X1CA 2V6CA 2R92J 2HQ5A 4KNYA 2W00A 2VI6A 4K2EA 4M72A 2MW8A 4BAYA 1ZRFA 1PUFB 1HC8A 1LVAA 2ZMEB 1YJNI 3H3UA 1MBHA 3GF2A 1ODDA 3C3WA 2PI0A 2A6EF 1MIJA 2STTA 2ESHA 4BKXA 1IC8A 2ICWG 1JKQC 4MGRA 1E2XA 3TW7A 2DOFA 1ETXA 2CUZA 2M5WA 3KFWX 2XPUA 3CC4I 4EGZA 1OYIA 3VYTB 1ZLJA 2Q0OA 3OS0A 4F55A 1XGNA 4IRGA 4HV5A 3RCOA 2UXNA 3LAJA 1B72B 2CUEA 1RC9A 4GO1A 5TISC 3EUKL 1VQ6I 3ECHA 3K4LA 1FY7A 1SAUA 3LSGA 3MN2A 3I53A 4CICA 3OYLA 3K2ZA 1CF7A 1L0OC 4B3XA 5FJ8J 3LSRA 2QCOA 3IAS2 5KAFC 4HBLA 2VIXA 4YIFA 2XSDC 4KIBA 2CH0A 1WJBA 4CCOA 2B7EA 3MWMA 2XGEA 2MD5A 3TDUC 3AAFA 1T6SA 3GMEA 1YW8A 4IQJA 2ISYA 2ECBA 2V1NA 3LAPA 1SVLA 1S29A 3SDBA 4EV0A 4QPOA 1NK3P 5JLXA 4CCLA 4E7SA 2CG4A 4XORA 2DA1A 4OIQF 3ABLH 2RREA 2WY8Q 4NHJA 1USTA 1QGPA 3FXJA 2R3SA 1G3SA 2LG4A 4G6DA 3CJTB 1GVDA 1R00A 2IPQX 2MGQA 5FRNA 2EFQA 3KX2A 4Q47A 1TZLA 4RAZA 4UB8C 1DP3A 1T0FA 5HS8A 2HOEA 4Y52J 3PJRA 2FNPA 1J09A 5AIQA 5GAHJ 4P5OA 4PFPA 3FM5A 2DJIA 5CVUA 2KDZA 1X58A 1WH5A 5D5WB 1RIOH 2KIMA 3BPXA 1FT9A 3PNVA 4X1EA 3VODA 1ULYA 3HTUA 4F92B 3OY9A 3KE2A 4ANJA 1Z21A 5B1AH 4CDGA 1H89C 1I6XA 3I3LA 2KRHA 2M7AA 4ZDPA 5HOOA 3CCEI 1JKPC 2EK5A 4B47A 4FQGA 1Z67A 1XCBA 3BR3A 4N4OB 4A3JJ 3IRQA 4MEXF 2PG4A 3HOVJ 4E7HA 3OL3A 1BA5A 1EH6A 5FRMA 2AXLA 1Z6RA 3OOUA 3SEZA 3KP4A 2LKXA 2HTSA 3LA2A 3GO5A 4ESBA 1D3YA 3RTRA 3PIOF 2XGDA 4RA2A 4RBOA 3EUHA 1OCZH 4HPQA 4MQVA 3SDGA 1VTNC 3S17J 4PSXA 2PQ8A 3J80K 2EIJH 1N78A 3BR1A 2L9NA 1BJZA 3QQAA 2P6TA 2Z3YA 1HDPA 2DK5A 2MC4A 2Q8KA 2LC2A 2KISA 3L09A 4WXCA 1HLVA 2FA5A 1VQPI 1G59A 1RNLA 5LBQA 4CHUA 4LD5A 4A93J 1BBYA 4RGSA 3IH3A 4G7HF 5LHHA 4DOZA 1IRFA 2GIZA 4DJAA 4R1HA 1UJ8A 5IT3A 3S1NJ 1G3TA 1QZEA 4C3IJ 2GAUA 3KLNA 1S6LA 5C44J 5GPCA 2PMZN 2VE8A 2BY1A 3HRUA 1TQPA 2QSGX 4RGXA 2ZB9A 4DNCA 1B9NA 1A35A 5BS6A 4HZFA 3CJNA 1RKWA 3U9GA 3MEXA 5IYCJ 4EMSA 1I1SA 1JXSA 1KU2A 3LSIA 4GXOA 2KHMA 1NG7A 5F08A 5D4SA 5LRSA 2XPWA 4LMYA 4EJVA 4N4NB 3ASNH 3WU0A 1K6OA 4OAYA 1KA8A 3ZQCA 1YX3A 4P55A 4LG0B 3BG7A 5JI6A 3I56I 3S14J 5CPRB 3BOQA 3CF2A 1U5TC 4OMZA 2EFNA 3KZYA 2IA0A 1ZR2A 1H9GA 3LNQA 1FYMA 4U0VA 1HKSA 5L3DA 2WWYA 5J8CA 4AIKA 3DPLC 4UUSB 5HVQC 1FP2A 1XMAA 2ZMEC 2CV0A 2NYXA 3L9FA 1HA8A 1OR7A 1Y8QB 3GFJA 3EETA 3J7ZI 3RPUD 2HU9A 2E71A 2BHZA 4HNVA 4RLQA 3OS2A 2HOSA 3JAMK 4JP0A 4F52A 1O7LA 3K4KA 1UZCA 4IXAA 3A4CA 3BROA 1WJDA 3TL4X 2D45A 4E6KG 4S0HB 2DLLA 1HBXG 2ELKA 1SFXA 2CRGA 2BVMA 2ZJPF 5B1BH 1CGPA 3M7GA 1S8NA 2DMPA 2CQ7A 5DDGA 2K86A 5KCMA 2FXAA 1BL0A 4M9SA 3DLAA 2L54A 4MNUA 3TO9A 1ETKA 5FO5A 3WE2A 5KK1A 1Y1VJ 2Y9ZA 3CCJI 2KT0A 4A6EA 3V7CA 3MZYA 5CVIA 4XN0A 1X2MA 2M30A 2EJRA 1QZYA 4U87A 3I59A 3ERED 5BNGA 1O3TA 4U0WA 1ERDA 3ZQ7A 3PFYA 4OINF 1UELB 2JN6A 2P81A 5J47A 2ISZA 4XQFA 1E3HA 4XLCA 5EEAA 1RUNA 2DMTA 4RM3A 2HKXA 2E36A 2NNNA 4DW6A 5C4XJ 3TKYA 1XSXA 3DTIA 2ETHA 4R79A 2DFHA 2R7SA 2DTRA 2M9HA 2XF5A 4JX6A 3WTYC 1B8IA 3H9JA 3AG2H 2DN0A 1B9MA 1X3UA 2ZJRF 4IHYA 1D0YA 2VKEA 1NK2P 1U8RA 1Z0XA 2L9RA 3U21A 3CJQB 1MSEC 2X1CA 1IRGA 1YLFA 2D5VA 1HCRA 1BOAA 2DTZA 3T0YA 3K0LA 4C3HJ 1QBJA 1RI7A 3N97A 1XX5A 1T0FC 1B4AA 1B8IB 3L7WA 1SFEA 3ELKA 4MHGA 1G4DA 2L0KA 2IRFG 5IOZA 4A3BJ 1XPXA 3HPHA 5L3GA 3WHBA 1VQLI 2WBMA 2PX9A 5EGOA 1X2NA 5EG0B 1HF0A 4EJWA 1Z9CA 2H6CA 2BGCA 3P5JA 2HVSA 3VOEA 3U1DA 1WJFA 1USSA 3E5QA 1XS9A 4CCNA 1VQ8I 3F72A 2O5RA 5DUIA 2VONA 1WH7A 3C1DA 3C7JA 1GT0C 4AIHA 3OYKA 3BR2A 3OYNA 5CVVA 5J1YA 4S05A 2WADA 2NNYA 1LNWA 3V4GA 4AVZA 5EGOB 4IQ4A 2VQHA 5M3MJ 3J81K 3DXJF 3TP0A 4EM0B 3BLYA 1Z7UA 3OYDA 2X1EA 5FD5A 3BT9A 2CUFA 4I0BA 2IAIA 3G3ZA 5GAGJ 3QU6A 1SFUA 1K83J 3EUHC 2QWWA 4V19K 2E2JJ 1RETA 3R0AA 3GTLJ 5FLXK 3A01A 3CZ6A 1UG0A 5CJ9A 1IRXA 1MGTA 2BOLA 4IZZA 1MD0A 4E7KA 4HV6A 4XMYA 1Z05A 2VLAA 2QUFA 2X6XA 4H0EA 3DBHB 1P4WA 3HSFA 4F93B 1YS7A 4KITB 3CUOA 4CCKA 1HW5A 1DDNA 1ZQ3P 2MA3A 1OCOH 5D4RA 5GTHC 2FU4A 4AD9A 4ZTFA 2GLOA 1B6AA 2CMPA 3ECOA 3S8PA 1RESA 2WAQN 3TGNA 4EM1A 1IF1A 4UV9A 1YTYA 1WGXA 4A3CJ 2W48A 3ABMH 3GZNB 2I5UA 3QODA 3DU5A 1ZN2A 1OYWA 4LG3A 3LFKA 1QHGA 4P1WA 3JAMZ 1E3PA 3OYGA 4BE2A 1ZG1A 2FE3A 4AYBA 2KP6A 1KQ8A 1V4RA 3DWLE 3Q9SA 3LMMA 2VKDA 2Z99A 2EA2A 2LOOA 2COMA 5HDKA 3HOYJ 3BC8A 1C0WA 2AQEA 3ZN0A 1MMGA 3A02A 2F5DA 4ESJA 3UR3C 4ZYDA 1BI3A 1W5CC 1KU9A 2LY2A 3DTEA 5ICFA 2VBYA 4B3AA 5F64A 2DAOA 4QLCU 1H88C 3CCSI 3MKWB 2ADUA 1KU3A 1IW7F 4ZH4F 3CMAI 2XASA 3DFGA 2Y0SA 1RR8C 3GTOJ 2HGCA 2IGMA 3I71A 1LPQA 4GYIA 4IOCF 5B66C 1WPKA 3FHNA 2JJ7A 4C2UA 1ZH5A 2G7HA 5DD8A 3QOPA 2KJBA 2IGKA 4EGYA 4HA8A 5DYMA 2MH9A 2Q2EB 4L5EA 5DCMA 1MBEA 2M3AA 4IO9F 1OR7C 5LGUA 4IL6C 2DQRA 5LGNA 2NOGA 2Y75A 3AFHA 4B4CA 2PJRA 3H1CA 1SMYF 3PFIA 2OBPA 2RVCA 3VYUB 5JVGF 5E17F 3BP8A 5ICGA 4OOIA 1DUXC 4KISA 2DYRH 2QZ8A 1DGWY 1MH3A 2VQCA 4O5VA 2JA8J 5DCMB 1HW2A 2HQNA 2R7XA 3OIQA 3TP3A 4G94A 2DOAA 1YHQI 4Z6YA 4FISA 4LOCA 4KICA 1IV8A 3QYBA 4V2GA 3V42A 5LGTA 1Z3XA 3FXLA 3CO6C 5D6EA 3L2CA 2VC1A 1EH8A 2PJRB 4M3DA 1FOYA 4BBRJ 4KIGA 4MTDA 1PYVA 4XSZF 5EDNA 1LFUP 5D6FA 1QO0D 1NG6A 4BNCA 3K6GA 1X1DA 4G7OF 1ETQA 2BXZA 2FMYA 3G71I 2N8GA 4NC6A 1Y0NA 1TT5B 3G1MA 3LSJA 3G4SI 1LKXA 3COAC 3KP3A 1RRJA 4KFCA 2Y48A 3OSGA 1UHSA 2KIFA 3RKYA 2FJ1A 2EA4A 4PK4A 1ONVA 4EVIA 1Y39A 3ZQGA 2PLYA 2P7VB 2QKLB 4TV7A 4L9VA 3IV5A 4HEA2 3E97A 2IJLA 2K3FA 4BE1A 3FXQA 3FMSA 4HDVA 3D5SC 3ASOH 1NTCA 2CUJA 3WHCA 2E1MC 3J81Z 1GV5A 1LDKB 1FOWA 4FX0A 1IZ1A 3V7RA 2GIVA 4BJTA 1TNSA 4A0ZA 3WTVC 4XSXF 1GLNA 3M07A 4FE4A 5JFRA 3F22A 2FMLA 4XLNF 1RUOA 2X0LA 3JSPA 1Y0UA 3F9KA 3HKZA 5ILVA 1R71A 4HX7A 3GTMJ 4CUGA 2LK2A 2QBYA 4DZJA 2CO5A 1ZKGA 5FLXZ 1FOXA 2ZO4A 1OQYA 3EYYA 3JRHA 3JRIA 2DA7A 2GXGA 4JX4A 1O3SA 1V54H 4NBQA 3R60A 1Z91A 2PMUA 3AG3H 1JI8A 3ZQIA 5FLMJ 2JVHA 3BR0A 3R61A 4DIQA 3WODF 2K85A 4IHXA 2A6HF 4I76A 1FSHA 3K4BA 2DU9A 1YS6A 3HRMA 1HXDA 4HSTA 4XK4A 2CS3A 1I3QJ 1QVUA 5JHUA 2V26A 3TMOA 1UMQA 3DF8A 1V3FA 3M9AA 2QBYB 1W5SA 3PL8A 2ME0A 2TRTA 3A1YA 4ZYHA 2NVQJ 4MLOA 1POGA 3DEEA 3VWBA 2ELJA 1D1AA 3S1MJ 5KHDA 1MJ9A 3D5LA 3Q0VA 2EFOA 4A3FJ 3T5XA 4BH9A 4UXNA 1TC3C 3BJAA 3RPUA 1OJLA 4A3EJ 2R7DA 3DPTA 5DCFA 2DA5A 3ZMZA 2Y0MA 2LF8A 1YIJI 3H5RA 2KPMA 1XMXA 3LQRA 3IKVA 5FGMA 1FMWA 4XRSA 3MKYB 1PUFA 1A6IA 1JJ8C 5CYVA 4HLXA 3M4OJ 4JX5A 2O6GE 3V8JA 4C9YA 2XB0X 1MBJA 1XGOA 1DU0A 3PO3J 2HZTA 1VI0A 4F3QA 4WF2A 3W2VA 5LEJA 2L3DA 5J4VA 3IWFA 1P92A 2P5KA 4M6VA 4U88A 3GWZA 4B44A 1JKRC 2F48A 5L3EA 3K4NA 3NARA 4YRVA 4BBSJ 4Y4RA 5ICEA 1B72A 2OQRA 4RAYA 2FBHA 5E3LA 4DZPA 5FKOA 1WHUA 2XROA 4BXFA 2AHQA 4IX7A 4UUTA 2IP2A 3I58A 4PCQA 2VPLA 1MDMB 1ZELA 3DPUA 3T8TA 1XN7A 5M3FJ 5CVJA 2YX7A 3FX3A 3E6MA 3T1BA 1R4MB 2EV0A 1A04A 2KMUA 3F8CA 2ID6A 3A2KA 3WGHA 5D5UB 4BDYA 3ZMVA 1W7PA 2NXNB 3S2DJ 2XKOA 1ZG3A 2QLZA 1VQ4I 1W36D 1LE8A 2XIGA 2MYSA 2HFHA 1T08B 3K1NA 1OCTC 1KQ9A 5FB2A 3ZN1A 5E18F 4A3MJ 3FWEA 1WKMA 4KJZA 3KEYA 3Q0WA 2VXZA 3OOPA 1T39A 5EF6A 2A5YB 4ENKA 4DYCA 4A3DJ 1W7PB 1UG2A 3H3ZA 2Z9OA 4BYYA 3M8FA 2VKHA 3MZ8A 2QSFX 4ZTJA 4I09A 5FROA 4BQOA 1DPUA 5IY5H 5J1UA 3UKGA 1LE8B 2WTEA 2BE5F 3GTPJ 4XBFA 3JRCA 1STZA 2DDBA 1G2HA 2D2WA 3I54A 4HOBA 2V9VA 2QKMB 1Y56A 2M0MA 4F91B 5TRDA 1EJ9A 4ZDOA 2RDPA 4A5NA 1U78A 1WI3A 1KYZA 3H0DA 1JHHA 4HF2A 1XDUA 1BOBA 2Z1DA 2QQBA 2MG4A 2GBYA 4L5IA 3P7NA 3E5UA 3RKXA 2V6EA 2FEZA 5F6FA 5IPAA 4J01A 2MD0A 2LH9A 4ENMA 4P9UA 2RV8A 4L0YB 2PN6A 3HDDA 2XGXA 4LB5A 3FMQA 1OCCH 3ZRGA 2OA4A 4MEYF 2CQXA 3M1CA 2CQQA 2ZJQF 1WRJA 1UHWA 3KP6A 1KONA 2OTJI 3RSNA 2XDVA 4UNOA 2YUSA 1ZARA 4D9JA 3G2BA 4DBRA 1LB2A 2E2IJ 4HQEA 4J00A 2O8KA 2BBYA 2LVSA 2KKOA 2HPMA 5GPAA 3CD6I 2CQKA 5GADJ 2R7TA 1MMSA 2DPDA 4U7BA 3FXMA 4NB5A 1XD7A 4AM3A 3ZQHA 2HYGD 3I0TA 1LFBA 2H09A 2K9QA 5DV5A 4BQNA 2Y9YA 2V1DA 2BV6A 3ULQB 2NVUB 4LK1F 4HRIA 2Y69H 2LF7A 3K70D 1FBQA 3ZMDA 2HXOA 2GA1A 2FD5A 2HYFA 4BY7J 5D8LB 4HNTA 2BW3A 1X1BA 3PSIA 4DYQA 2DA4A 3AKZA 5K5OA 2EIMH 5E20A 5H2FC 3ZGKA 4O3MA 4Y33A 2VUMJ 3OYCA 3CO7C 2ZFWA 4KN4X 4PGGA 3RQ4A 3PUFA 1LVKA 3KETA 2V1XA 2JA2A 4UY8I 2OZ6A 3F8FA 2DT5A 3QYFA 3HYIA 5FFZA 1SEUA 1P4AA 5FFXA 2AQFA 1PUEE 1LFPA 2BW3B 2XAUA 4LG0A 3EQLF 1BN5A 1GXPA 3EUAA 2YU3A 3GFLA 3OYJA 2E35A 5HLHA 3G6EI 2H8WA 4RAGA 1D5VA 2W24A 1LDJA 4EJTA 1IO2A 2EZLA 2RGVA 3VSLA 1ETYA 1KYWA 1T98A 2XB5A 3DCFA 3NWTA 4FASD 4LIUA 4ZJZA 1N75A 3MKLA 1AOYA 4G7ZF 2NS0A 2ME6A 2FUG2 3H5AA 1WJEA 1A6QA 3CF5F 4UUSA 3L2VA 1A5JA 4PSWA 2R5YB 4P96A 1HQCA 3LSKA 1SD6A 3K1MA 5IT9K 3RQIA 3JRFA 1R5ID 5DS9A 1SVMA 3BG9A 4LLNA 3L2RA 4A0XA 1FZPB 1ETVA 3BG3A 3SXYA 5K7HA 3VYRB 4OIRF 2J5OA 1NH3A 1FIPA 5A2QK 1I1GA 3DTKA 1YIOA 3GFIA 5EZHA 2LREA 4XKWA 3ZMTA 3KP7A 1I27A 3S3OA 4HG2A 1AKHA 1TWHJ 2NRAC 2VN2A 1R23A 1QA6A 4GDFA 2DQLA 2JPBA 1TWAJ 3VB2A 2XV4S 2WV1A 4MFEA 1J75A 5K7ZA 3QP6A 3IWZA 1F9NA 5IP7J 1FX7A 1HOMA 2OU2A 3M8EA 1ZTRA 2QVOA 2Z5UA 3C2HA 4IRHA 4PJNA 1RKTA 4YIIA 2XAJA 3BTIA 1AKHB 1RPWA 3AG4H 5LHIA 1XGSA 4BU2A 2BXYA 4OAZA 2EFWA 4UVAA 3HTSB 4IPAA 1R5GA 2YR2A 2XSJC 1DPRA 3ABKH 2EBIA 2LR8A 1S3JA 4D1QA 3Q0UA 5HS7A 2EV6A 2JUGA 3FXUA 2D1VA 3F21A 1MBFA 2CFXA 2LDUA 2QSHX 1ITYA 1T56A 3TDZC 2ZXHA 4E7JA 1Z1DA 1ZRDA 3K10A 1SD5A 2CW0F 3L00A 2EFPA 2VBWA 2L7KA 2DMNA 3OL4A 4ZC3A 4E70A 5DTDA 4EM2A 1OCPA 3E6CC 3MZHA 3DKXA 4NDLA 2H1KA 5F0FA 4Z2YA 2F4MB 4V2FA 4BXUA 3ZQFA 2JSCA 2E34A 2W25A 4L9NA 3PO2J 4R8HA 1RZ4A 2FBIA 1W7PD 3T8RA 2M4KA 2R7ZJ 4L5JA 3FF5A 4JBAA 2JRTA 3FM3A 1P6RA 1WQ2A 4ENNA 5F0HA 1PDNC 2IW5A 2B63J 3MVPA 4CH7A 1WVRA 5JHFA 5EG0A 4NUBA 2GA2A 2YU9J 2OUMA 1S7OA 2A5WA 1YRNB 4IVNA 3FIWA 4LLGF 1HSTA 3E1SA 3J80Z 1JHFA 2CW7A 5L3BA 1FOKA 3FHZA 3DEWA 1P7IA 4A69C 3LFUA 4HF1A 3ABUA 4PJJA 5HLIA 4GFBA 2P5LC 2DOEA 2JWTA 1JTXA 4MFDA 2GOMA 5D5XB 2L01A 3HSEA 4BS9A 3FKJA 2BHYA 4I6ZA 5BPDA 3SYTA 2ACJA 2XPVA 4HNUA 3CTAA 4AWXB 1MMDA 2HS5A 4GCVA 1Z77A 2EPFA 3PIPF 4U7DA 1B1BA 1TT0A 3OS1A 4I99C 2JUCA 3WU2C 3CMYA 4E7IA 3RJPA 4IKFA 5K5RA 2COBA 1FEXA 2Y2ZA 4I02A 2IS1A 3H35A 4DBQA 3MKZA 2PFBA 5K7FA 3IL2A 4W97A 1T2KA 1S72I 3GTQJ 2GXBA 1S7EA 4X0GA 3CDHA 1R4NB 4M3BA 3GBGA 2NVXJ 2M34A 4M6YA 2W85A 1LDDA 2QF7A 3BG6A 3H5NA 3JW4A 3MMYB 2ZNYA 3GXOA 5B3SH 4YFXF 2W84A 1GV2A 3QWLA 3TEDA 2LRDA 4E4HA 1KU7A 2UWMA 1OFCX 3LA7A 1IGNA 2K9NA 2LBFA 4PZJA 2IVMA 2NAZA 4XOPA 5IT9Z 3BZKA 1VQ7I 4XLPF 1XSVA 3A03A 2RAEA 1JT0A 2NVTJ 3CLQA 5LFAA 3S3MA 4W1UA 1TW2A 4I2OA 4BE0A 3HOWJ 1BI2A 1U9OA 4XONA 2JA5J 3B02A 2P4WA 4A3LJ 1ZREA 4EJOA 1OLTA 4C3JJ 4ZYGA 2DA2A 4Y17A 3WTZA 4ITVA 2DT7B 2LBFB 2OJED 3QAHA 2CV2A 2F5CA 2XAGA 1ETWA 3BZ6A 2KIUA 4RAFA 5E8GA 3KYLA 1MNMC 1APLC 2ZC2A 3CUQA 3ISPA 2CQNA 3L2WA 1SFOJ 3W2WA 1T95A 2IBDA 3H9QA 1TL8A 2HR3A 2VBZA 2TCTA 2M87A 2JSPA 3F8NA 2F5VA 1R1TA 5LRRA 5HLGA 3D1NI 4M9XA 3E6DA 3B6AA 9ANTA 4GRIA 2CFOA 1JUPA 2ZKZA 3TW6A 2FX0A 2I8DA 1U6GA 4OMYA 3GYHX 3AG1H 2Q2EA 3OYAA 2R7OA 1K78B 5E1WA 3SFZA 2W1OA 3CUQB 2UXXA 4RS8A 2H94A 3Q5FA 1J0RA 1TQMA 1BC8C 1JUSA 4PGHA 4BDZA 4UB6C 5D5VB 3HOXJ 1Y8RB 3CCMI 2HPIA 1OISA 3O8HA 5J8FA 3JRBA 2HYJA 2FOWA 1HKTA 2GM4A 2I10A 3OMYA 5J6XA 1D0ZA 3S3NA 1ZYRF 2E7WA 5E3MA 4L0ZB 1GVJA 1XB4A 4M6XA 2OCEA 4P9FA 2O3FA 1IG7A 2HVRA 3HM5A 3Q9VA 5HNHA 3WTTC 2JK3A 2L7ZA 4RB0A 2DI3A 2VE9A 6PAXA 4CSWA 1VNDA 4RB3C 1E17A 2MBFA 2QYOA 2KFDA 2DCEA 2VJJA 4FTHA 2VJIA 2DBBA 4CCJA 3DKYA 3H3VK 2LLKA 1MW7A 4UUVA 4NNJA 3MFKA 3S2HJ 4FCYA 2Y30A 2HI3A 4UHTA 3WGGA 3HSRA 3TO7A 3FZVA 3J7YJ 3H92A 4EJUA 3BCAA 5E8IA 1F1ZA 4A3GJ 2OCCH 3OR1C 4A6DA 3CC7I 1HW1A 1P9QC 2BYVE 2RNJA 1R1UA 1I3AA 2E1OA 2W82A 1O3QA 1V5GA 5KAIC 5FD6A 3OSFA 1G8XA 3JSOA 1YW9A 1KGSA 2IA1A 4M73A 3L2QA 1FJLA 1Z7LA 3E3VA 3BY6A 2E1NA 2EZKA 3W3CA 2X1DA 1K4SA 4BQAA 1PVEA 4D5CA 1F5TA 5IOYA 2DMQA 2HTJA 2X51A 4KN7X 2EIKH 2FQ4A 1DU6A 1IN6A 1U0JA 2LMDA 3JREA 2K27A 3PM1A 1P7JA 3BZCA 1XGMA 3BR6A 1N25A 4M71A 5CQEA 4MQ9F 3AL0B 2DYSH 1X19A 4RB1A 2XRNA 3LWFA 5HDNA 1G3YA 3HRSA 2VQGA 4XIDA 2G0EA 4XLEA 2GXAA 3SEQA 1XCVA 3CMEI 2A3SA 1LJ9A 4XN3A 2K9MA 2XAHA 2DK8A 1FC3A 1ORKA 3LOCA 1F43A 2IT0A 3OWTA 4ESFA 5L3FA 2MLKA 2JVGA 1JKOC 4BHPA 5CLSA 5E3NA 1BJAA 3HHHA 2ESNA 3VEPA 1K7AA 2E60A 4MIMA 3CDIA 4IHVA 3G1OA 3GW2A 2M8EA 5EEHA 1VQOI 2PBIA 3DEUA 4I98B 3WTXC 1GDTA 4HX8A 2F4OB 2ZSHB 4WX9A 1MBGA 2W7NA 1YJ9I 3Q3SA 2ID3A 3IC7A 1ZR4A 2EZHA 3ZXSA 2R7UA 4XKCA 1MSFC 4DGWB 4BACA 4XKBA 1V5EA 3I9V2 5DD4A 4LITA 2BVLA 4BHBA 5M5XJ 2K40A 3CQZJ 5F04A 1W1WE 5IYBJ 4CYDA 2RQQA 2W57A 3ZP5A 1YJWI 4ZZLA 3BTLA 4ZYEA 2XGCA 1IXSB 3IHUA 5DM6F 3W6JB 1LQ1A 4N0BA 1DQUA 5ILSA 1A31A 4RLFA 2LSOA 4RDUA 2IS6A 5M5WJ 2A07F 2K9LA 5J3LA 2M45A 5KNLA 3G73A 1Q1VA 3P9IA 4IRIA 2KJCA 4O6JA 2L2OA 1MDMA 3W6KB 4OU0A 5EEGA 4YIRX 2WB1N 1H9TA 3F6VA 4HSRA 2L7FP 3HZJA 3S1RJ 2OAZA 5J40A 3OYFA 4ON0A 2LYCA 4AU7A 1FYKA 4G9YA 1U5TB 3PQJA 4M3FA 1BC7C 5GP9A 5FKLA 3KIOA 3ZPLA 1YOVB 1J5YA 2VPRA 1Z6TA 2LY1A 3H9GA 2A68F 2MH2A 2P6SA 1R58A 1O4XA 4M3EA 2QQ9A 3NAUA 2PMHA 2ZSIB 3CCLI 4HAMA 1TWFJ 3BWGA 3ZQLA 3M8JA 2OPTA 2ZJ2A 3QRFF 1UB9A 4QWQA 1BR4A 5IYDJ 4HF0A 1BM9A 4WCGA 1JJ6C 3OYIA 2HQRA 4CCMA 3F8BA 2K7LA 1D1BA 3DBRB 1YITI 2K4BA 3BTJA 4CZCA 1GUUA 2DA6A 2HQAA 4KUMA 4DYRA 1HSJA 4ZDLA 3HJEA 3W2AA 4L18B 3GZ6A 5BQTA 3I4MJ 1I50J 3GFMA 3O8GA 4L9TA 1FP1D 2X9DA 4RB2C 5JR3A 1JTYA 1J7KA 5F1RA 2LD5A 2V1UA 2LKSA 2LY9A 4NC7A 3JTHA 3HRTA 2CGPA 3BTCA 1ENHA 3IKTA 3UNGC 1X4OA 3S15J 2IA2A 3R0JA 4YFKF 3WGIA 1SC7A 4BQQA 1AHDP 3CC2I 3VSKA 1WI9A 3LSTA 3K4JA 1QVTA 1EA3A 3OYMA 1MZBA 1M1EB 2Y31A 1WJCA 2KZGA 1AU7A 4KT5C 2E5NA 2XF6A 1IXCA 5K5QA 2ZXWH 2MABA 3FBNB 4IHWA 3D5RC 3OYEA 1I6HJ 1X3ZB 3HEFA 1G6NA 3PSFA 1JE8A 3CLOA 5EZGA 1JUMA 1XG1A 2MFZA 3EDPA 1CF7B 2VL8A 4IHSA 4LK0F 3FK6A 1TNTA 3GLLA 2VOOA 3I4NJ 4D0PA 3G1LA 5HS9A 4KT6A 2R5ZA 5BMZA 5DEQA 1O7FA 4AVPA 3S93A 2PMZA 4J19A 1FYLA 2VT2A 5DM7F 2EH3A 3A0HC 3GVAA 3PUBA 4ZZDA 3K9TA 5DUKA 4XLAA 2JPCA 1WZ2A 3LSHA 4FT8A 2E1CA 2VKVA 5E1ZB 3VFZA 4C2MJ 2EQRA 3K70C 1O3RA 3HIFA 1BW6A 4ZYAA 2XAQA 3FXRA 5J1RA 4B8XA 1IRZA 4ETSA 3S1QJ 1T38A 2R5ZB 3TQNA 4AUXA 5CKTA 3WU1B 4Y3OA 3KZZA 4ENJA 1WSUA 2HDCA 3JRGA 3AL0C 1MBKA 1FTZA 2F5EA 3KYDB 2L02A 5ILUA 2WAFA 4BGDA 4UVBA 2JA6J 2HXIA 5HDGA 4A0YA 1ZG5A 2XUBA 2KL4A 1S9HA 3TBIA 3QPTA 1EV7A 3KLOA 2ELHA 4BJ5C 2RQPA 1QQIA 2B0LA 2QQAA 5ERIA 3QPHA 3U1KA 2HWVA 3P9CA 1X1PA 1IN4A 1FIAA 4HW0A 2XAFA 2AXTC 2E2HJ 2X6WA 2FQ3A 2NS7A 2YSRA 5GTIC 2AO9A 3U2RA 2HOAA 2L4MA 3CDLA 2UZKA 5C4JJ 1D0XA 2IXSA 1OYYA 2CWEA 2K5CA 3DQVC 1XDSA 4DQ2A 2R5YA 2Z33A 3IAM2 1XC5A 3M3YJ 3HC7A 2MSYA 2JTVA 2EZIA 2L4AA 3DU6A 3QPSA 1FLIA 3ZMSA 3HBLA 1IN7A 4B43A 3E5XA 4Q4ZF 2CW8A 4QIWN 2VC0A 1UFMA 3R6SA 1ON1A 3KPHA 3WTUC 1VQ9I 4HQMA 5EYRA 2HOTA 3MD2A 1IDZA 3LQQA 1SANA 3H36A 1KQ0A 4HYEA 4NC8A 3QOEA 3ESWB 2FRHA 4BUPA 1QNTA 3BDDA 1R9TJ 2EWNA 5FKNA 4FX4A 1DP7P 3FXKA 4OWRB 2EV5A 2O03A 3CCVI 4QTRA 1I39A 1SVOA 2JQ7A 1SD4A 4BEHA 4A5MA 2IS2A 1Y6IA 2QM3A 3GTGJ 2BEOA 3O3KA 1F4KA 3GEZA 3GTKJ 2X6OA 4LLLA 2J5PA 3CCRI 3ONQA 3PNTA 1JGSA 1I5ZA 2Z2SB 3ERMA 3MQ0A 1ACIA 4BXXJ 1R5HA 1TBXA 2M7BA 1D8JA 4ASNA 2EILH 4S04A 4HLYA 1TP4A 1QHHD 4BJ6C 4QPQA 1Z3YA 4BEHB 4BHCA 2KRFA 5H6QA 2V4JC 1FTTA 2W4SA 1EH7A 4PJMA 2XC7A 1MMAA 3FKIJ 1E0EA 2R93J 2KQRA 2HVQA 2FF4A 4MO7A 1RR7A 2P5VA 3NEUA 4Y7NJ 1D8KA 1W5TA 2ECCA 3B6CA 4XRFA 3NWSA 5FLVA 3OYBA 1U9NA 4X6AJ 2KRCA 3RDIA 4M3GA 3HXLA 4KMFA 5AONA 1MJBA 3HOUJ 4YELA 2IS4A 1TW3A 3RKQA 3F6OA 1YE9A 4EEFG 2ZXIA 4XRMA 3I4PA 3J7AO 1K6YA 1H0MA 2BY2A 2HDWA 1FWZA 1SFKA 1SMTA 4XR6A 3S16J 3RZDJ 4G12A 3WE3A 2JZYA 2UV1A 3F8MA 2X6YA 3FDYA 2O0YA 1VFCA 2HEOA 3KEOA 5KVRA 3ZCOA 2P8TA 2VJ4A 1YX5A 4WXHA 4CA0A 3BQYA 2D1HA 3MAJA 1BIAA 1O57A 4H4KC 1ETOA 2R7QA 4RGRA 5JLWA 1VQ5I 3QPLA 5C3EJ 4A2UA 2A05A 3CJRB 4XM3A 4KIFA 3W6VA 5LLQA 1OKRA 1J59A 2IGOA 1YW7A 2DO7A 1FMVA 1IJWC 1YRNA 3RIRA 2XF7A 4B09A 4D7NA 5F1JA 3JRDA 2V9KA 1IUFA 1CQTA 5BPIA 4WXDA 3CCQI 1D1CA 3J7AY 2GWRA 4AIDA 4GGGA 2OD5A 5TJJA 2OTLI 2L7MP 4IHTA 4KDPA 3SQNA 4CZZA 3ABTA 3BJ6A 3EPZA 2H27A 2QQ8A 2CU7A 3K1PA 4UV8A 2ZXJA 3O2PE 1U8BA 1JT6A 5ICCA 3FMRA 1QRYA 4A3KJ 2XHKA 3HUGA 1XMKA 3NQOA 2OZUA 3QP5A 4YG2F 4FHTA 3FK7A 2Z16A 4XL9A 2H6BA 4PJLA 3HG9A 3CCUI 3GZ5A 1YYVA 2BY0A 1WJ5A 2DA3A 3DP7A 4LGWA 1E3OC 3I59B 4CGZA 3E0JB 4CO8A 1ZRCA 3IH2A 1R22A 2LNBA 1DGRM 3KZIC 4LIVA 2X48A 1IV6A 3BG5A 1IDYA 2R7FA 2GQQA 3O6BB 2WAQA 2DPUA 3EYIA 3HUGB 2NVYJ 3V8KA 2WY7Q 4HDUA 1YI2I 2O61A 5FKKA 3HOTA 1QPMA 3FXOA 5J4YA 2VBXA 5D8KB 3ZOBA 1LUJB 4KA4A 1K4TA 3OIPA 3M1EA 2TDXA 2E1MB 2F5FA 2AS5F 2RKHA 3KP2A 2RN7A 2LTPA 4RGUA 3RKWA 2M0CA 2DJNA 2YPRA 3PNYA 3GTJJ 2UUZA 1B59A 1UCRA 2ZNZA 1SD7A 4N9IA 3RYPA 2L9VA 2R4GA 1R7JA 4XNFA 2R7WA 1UAAA 2DFIA 2P0WA 3I5UA 1F36A 1VQNI 4II2A 2DXIA 3VPRA 3WTWC 3QU3A 4PJ0C 4BY1J 3SZPA 1ZLKA 4LJZF 3ROUA 2CJJA 2CYYA 3HGYA 1X1AA 3IRRA 2KDOA 3OIOA 4N9HA 2M8GX 5JVTA 1ZGWA 3E6BA 4G6QA 2KLOA 3F3XA 1W0UA 2HZDA 1VF9A 3K4MA 3K2AA 3F23A 2MLGA 3BR5A 5GAEJ 5A2QZ 3ZMUA 2FNAA 4ABZA 3MCZA 2YS9A 3GCMA 2DDAA 2QA4I 3HGGA 5IP9J 2LP0A 1OPCA 2V9PA 3L2UA 1T33A 1BR1A 4D7MA 4WK8F 2PJPA 3GLXA 1J2XA 4GYGA 3RYRA 5E79C 4L9JA 1HDDC 1ZK8A 3ZR8X 3OR2C 2L9SA 2QEXI 3F0CA 1BI0A 1K78A 2VASA 5H20A 4AC0A 1Q1HA 1BIBA 4D5FA 3IH4A 2P7CB 5M5YJ 2JT1A 2JMWA 2BZTA 4A12A 4JQFA 3NRVA 3A01B 4JK1X 4CYCA 3K4CA 3S32A 2E7XA 1MH4A 3I55I 2E5ZA 2IEKA 4IJAA 5K1YA 2VXDA 2WC2A 4AIJA 1A36A 1XTAA 1MMNA 3R4KA 2VB6A 2ZCWA 1WCMJ 2M2EA 3WTSC 1UHMA 1IUYA 2RNGA 5CQGA 1R6RA 1ZHFA 1VQMI 3KP5A 1OMIA 1REPC 2CV1A 3E7LA 3RZOJ 2G7UA 1PJRA 2HKOA 4CYCB 2A61A 2KIQA 2GZWA 2A6TA 1MKMA 3LSMA 4OIOF 2LKPA 3K7AJ 1K61A 3VYSB 2E19A 3N05A 5E1XA 1D5YA 2DFFA 5LHGA 1BI1A 4Y13A 4BL0B 1AWCA 2DT6A 1W4MA 3VDXA 2WV0A 3K69A 2B9SA 2F4IA 2HNHA 1R36A 1X4PA 4I0AA 1MNEA 5LD2C 3V7SA
chains in the Genus database with same CATH topology
3DV8A 4LB6B 4NQWA 3N4MA 1ON2A 1TTYA 3C18A 4WWCA 1GXQA 1ZGAA 1FBSA 5H6RA 3DKWA 3KEQA 2K02A 1K79A 3WG9A 2VODA 1SAXA 3KCCA 1YQAA 2G9WA 3GUDA 4Y15A 3D0SA 1YO5C 1L3LA 1NHAA 2XKPA 4CXFA 1P2FA 1U3EM 2V79A 1IN8A 1WWXA 1ZAOA 1HKQA 4I7HA 2ZBKA 1XSDA 1TLHB 3ML6A 1IXRC 4M9ZA 2STWA 5LEKA 3HOSA 1FNNA 2VT3A 1U2WA 4IF4A 4EQQA 2M1BA 3GX4X 3OV8A 2RC4A 5ED4A 2K4JA 1LEBA 2C6YA 1QZZA 2F2EA 1TQIA 4YFNF 1YG2A 1IN5A 2MC3A 2VOPA 1FSEA 4G8XA 2FBKA 2XVCA 5CVRA 5AIPA 4PDKA 3V8LA 4Q5SF 2DW4A 1G3WA 3HHGA 1MJAA 1LEAA 4U0YA 3JTGA 2FSWA 2O8XA 5BOXA 3BJOA 3RPQA 4MTEA 3I64A 1J9IA 3SHFA 2X4HA 3B73A 3REOA 2EB7A 3S2WA 4KYWA 1GHCA 1PP8F 2FOKA 3TO6A 4OIPF 3TOAA 2CSOA 4F7ZA 3RI4A 1U5TA 4M74A 1ZGJA 4I01A 1YFHA 3PQKA 3SZTA 1PP7U 1IAWA 4LFUA 4HX4A 5L3CA 3BPVA 1P4XA 1S7AA 1FBUA 3LA3A 2OQGA 4UVCA 3P9KA 2ZMEA 4Q48A 2PEXA 2A69F 4KMUX 1R1VA 2YX4A 1FPQA 3TOBA 2QENA 3CUQC 2V6CA 4KNYA 4K2EA 4M72A 4BAYA 1ZRFA 1LVAA 2ZMEB 3H3UA 3GF2A 1ODDA 3C3WA 2PI0A 2A6EF 2STTA 2ESHA 4MGRA 1E2XA 2M5WA 3KFWX 4EGZA 1OYIA 1ZLJA 2Q0OA 1XGNA 4IRGA 4HV5A 2UXNA 3LAJA 4GO1A 3ECHA 1FY7A 3I53A 4CICA 3K2ZA 1CF7A 1L0OC 4HBLA 4YIFA 4KIBA 3MWMA 2MD5A 3TDUC 3AAFA 1T6SA 1YW8A 2ISYA 3LAPA 4EV0A 1S29A 2CG4A 4OIQF 4NHJA 1USTA 1QGPA 4G6DA 2R3SA 1G3SA 1R00A 2IPQX 2EFQA 4Q47A 4RAZA 1T0FA 5HS8A 2HOEA 2FNPA 5AIQA 4P5OA 3FM5A 5CVUA 5D5WB 1RIOH 2KIMA 3BPXA 1FT9A 3VODA 1ULYA 3HTUA 3KE2A 4CDGA 1I6XA 5HOOA 2EK5A 1XCBA 3IRQA 4MEXF 2PG4A 1EH6A 2AXLA 1Z6RA 3KP4A 2HTSA 3LA2A 3GO5A 4ESBA 1D3YA 3RTRA 3EUHA 4MQVA 1VTNC 2PQ8A 3J80K 2P6TA 2Z3YA 2DK5A 2Q8KA 3L09A 4WXCA 2FA5A 1RNLA 5LBQA 4CHUA 4LD5A 1BBYA 4RGSA 4G7HF 5LHHA 1IRFA 4R1HA 5IT3A 1G3TA 2GAUA 3KLNA 1S6LA 2VE8A 3HRUA 1TQPA 4RGXA 4DNCA 1B9NA 5BS6A 4HZFA 3CJNA 3U9GA 3MEXA 4EMSA 1I1SA 1JXSA 1KU2A 4GXOA 5D4SA 5LRSA 4LMYA 4EJVA 3WU0A 1K6OA 1KA8A 4P55A 4LG0B 5JI6A 3BOQA 1U5TC 4OMZA 2EFNA 3KZYA 2IA0A 1H9GA 1FYMA 4U0VA 1HKSA 5L3DA 2WWYA 5J8CA 4AIKA 3DPLC 5HVQC 1FP2A 1XMAA 2NYXA 3L9FA 1OR7A 3GFJA 3EETA 3JAMK 1O7LA 4IXAA 3BROA 2D45A 2DLLA 1HBXG 1SFXA 1CGPA 3M7GA 1S8NA 5DDGA 2K86A 2FXAA 4M9SA 2L54A 4MNUA 3TO9A 5FO5A 3WE2A 5KK1A 4A6EA 3V7CA 3MZYA 5CVIA 2M30A 2EJRA 1QZYA 3ERED 3I59A 1O3TA 4U0WA 3ZQ7A 4OINF 2ISZA 1RUNA 2HKXA 2NNNA 3TKYA 1XSXA 2ETHA 4R79A 2DTRA 3WTYC 1B9MA 1X3UA 1U8RA 1IRGA 1YLFA 1BOAA 3T0YA 3K0LA 1QBJA 1RI7A 3N97A 1B4AA 3L7WA 1SFEA 3ELKA 4MHGA 1G4DA 2IRFG 5L3GA 4EJWA 1Z9CA 2H6CA 2BGCA 3VOEA 3U1DA 1USSA 3E5QA 3F72A 5DUIA 2VONA 3C1DA 3C7JA 4AIHA 5CVVA 4S05A 2NNYA 1LNWA 3V4GA 3J81K 3DXJF 4EM0B 1Z7UA 5FD5A 4I0BA 3G3ZA 3QU6A 1SFUA 2QWWA 3R0AA 5FLXK 5CJ9A 1MGTA 1MD0A 4HV6A 1Z05A 2QUFA 4H0EA 1P4WA 3HSFA 1YS7A 3CUOA 1HW5A 1DDNA 2MA3A 5D4RA 2FU4A 4AD9A 1B6AA 3ECOA 3TGNA 4EM1A 1IF1A 4UV9A 1YTYA 1ZN2A 1OYWA 3LFKA 3JAMZ 1ZG1A 2FE3A 1KQ8A 1V4RA 3Q9SA 2Z99A 2EA2A 2COMA 5HDKA 1C0WA 3ZN0A 2F5DA 4ESJA 4ZYDA 1BI3A 1KU9A 5ICFA 2VBYA 5F64A 2DAOA 4QLCU 2ADUA 1KU3A 1IW7F 4ZH4F 2XASA 3DFGA 2HGCA 3I71A 4GYIA 1ZH5A 2G7HA 5DD8A 3QOPA 2KJBA 4EGYA 4HA8A 5DYMA 2MH9A 5DCMA 5LGUA 2DQRA 5LGNA 2Y75A 1SMYF 3PFIA 2OBPA 2RVCA 5E17F 3BP8A 5ICGA 4OOIA 1DUXC 2QZ8A 4O5VA 5DCMB 1HW2A 2HQNA 4G94A 4KICA 5LGTA 3CO6C 5D6EA 3L2CA 2VC1A 1EH8A 4KIGA 4MTDA 4XSZF 5D6FA 1QO0D 4BNCA 4G7OF 2FMYA 3COAC 3KP3A 4KFCA 2Y48A 2KIFA 3RKYA 2EA4A 4EVIA 1ONVA 2PLYA 2P7VB 4TV7A 4L9VA 3E97A 2IJLA 3FXQA 3FMSA 4HDVA 3J81Z 1LDKB 4FX0A 1IZ1A 3V7RA 2GIVA 1TNSA 4A0ZA 3WTVC 4XSXF 5JFRA 3F22A 2FMLA 4XLNF 1RUOA 2X0LA 3JSPA 1Y0UA 5ILVA 4HX7A 2QBYA 2CO5A 5FLXZ 2ZO4A 3EYYA 2GXGA 1O3SA 3R60A 1Z91A 2PMUA 3R61A 3WODF 2A6HF 1FSHA 2DU9A 1YS6A 3HRMA 1HXDA 5JHUA 3DF8A 1V3FA 3M9AA 2QBYB 1W5SA 4ZYHA 1MJ9A 3D5LA 2EFOA 3T5XA 4BH9A 4UXNA 3BJAA 3RPUA 2R7DA 3DPTA 5DCFA 3ZMZA 2Y0MA 2LF8A 3LQRA 3IKVA 5FGMA 5CYVA 4HLXA 2O6GE 3V8JA 1XGOA 2HZTA 4WF2A 5LEJA 2L3DA 3IWFA 1P92A 2P5KA 4U88A 3GWZA 5L3EA 5ICEA 2OQRA 4RAYA 2FBHA 2XROA 2IP2A 3I58A 4PCQA 1MDMB 3T8TA 1XN7A 5CVJA 2YX7A 3FX3A 3E6MA 3T1BA 2EV0A 1A04A 3F8CA 3WGHA 5D5UB 3ZMVA 1W7PA 2XKOA 1ZG3A 2QLZA 2XIGA 2HFHA 3K1NA 1KQ9A 5FB2A 3ZN1A 5E18F 3FWEA 1WKMA 2VXZA 3OOPA 1T39A 2A5YB 4ENKA 1W7PB 3H3ZA 2Z9OA 4BYYA 3M8FA 4I09A 1DPUA 2WTEA 2BE5F 4XBFA 1STZA 2D2WA 3I54A 4HOBA 2V9VA 5TRDA 2RDPA 4A5NA 1U78A 1KYZA 1JHHA 4HF2A 1XDUA 2QQBA 4L5IA 3P7NA 3E5UA 3RKXA 2FEZA 5F6FA 4ENMA 4P9UA 2RV8A 4L0YB 2PN6A 2XGXA 4LB5A 3FMQA 2OA4A 4MEYF 1WRJA 1UHWA 3KP6A 4UNOA 1ZARA 1LB2A 4HQEA 2BBYA 2KKOA 2CQKA 2DPDA 4U7BA 4NB5A 1XD7A 2HYGD 3I0TA 2H09A 5DV5A 2V1DA 2BV6A 3ULQB 4LK1F 2LF7A 1FBQA 3ZMDA 2GA1A 2HYFA 5D8LB 5K5OA 5E20A 4O3MA 3CO7C 2ZFWA 4KN4X 4PGGA 3KETA 2V1XA 2OZ6A 3F8FA 2DT5A 3HYIA 5FFZA 1P4AA 5FFXA 1PUEE 4LG0A 3EQLF 1BN5A 1GXPA 2YU3A 3GFLA 5HLHA 1D5VA 2W24A 1LDJA 4EJTA 2RGVA 1KYWA 1T98A 1AOYA 4G7ZF 2NS0A 4P96A 1HQCA 1SD6A 3K1MA 5IT9K 4LLNA 4A0XA 1FZPB 3SXYA 4OIRF 2J5OA 5A2QK 1I1GA 1YIOA 3GFIA 3ZMTA 3KP7A 1I27A 2NRAC 2VN2A 1R23A 2DQLA 2JPBA 3VB2A 2XV4S 1J75A 3QP6A 3IWZA 1F9NA 1FX7A 2OU2A 3M8EA 2QVOA 2Z5UA 4IRHA 4YIIA 2XAJA 5LHIA 1XGSA 2EFWA 4UVAA 3HTSB 4IPAA 1R5GA 2YR2A 1DPRA 1S3JA 5HS7A 2EV6A 3FXUA 2D1VA 3F21A 2CFXA 2LDUA 3TDZC 1Z1DA 1ZRDA 1SD5A 2CW0F 3L00A 2EFPA 2VBWA 4E70A 4EM2A 3E6CC 3MZHA 4Z2YA 4BXUA 2JSCA 2W25A 4L9NA 4R8HA 1RZ4A 2FBIA 1W7PD 3T8RA 4L5JA 3FF5A 4JBAA 2JRTA 3FM3A 1P6RA 1WQ2A 4ENNA 1PDNC 2IW5A 2GA2A 1S7OA 4IVNA 4LLGF 1HSTA 3J80Z 1JHFA 5L3BA 1FOKA 3FHZA 4HF1A 3ABUA 5HLIA 2P5LC 5D5XB 2L01A 3HSEA 5BPDA 2ACJA 3CTAA 4AWXB 2HS5A 4GCVA 4U7DA 1B1BA 3RJPA 5K5RA 4I02A 2PFBA 3IL2A 1T2KA 2GXBA 3CDHA 4M6YA 2W85A 1LDDA 3JW4A 2ZNYA 3GXOA 4YFXF 2W84A 1KU7A 2UWMA 3LA7A 4PZJA 2IVMA 2NAZA 5IT9Z 4XLPF 1XSVA 1TW2A 4I2OA 1BI2A 3B02A 2P4WA 1ZREA 4EJOA 4ZYGA 4Y17A 3WTZA 3QAHA 2F5CA 2XAGA 3BZ6A 2KIUA 5E8GA 3CUQA 3ISPA 2HR3A 2VBZA 2M87A 3F8NA 1R1TA 5LRRA 5HLGA 4M9XA 3E6DA 2ZKZA 1U6GA 4OMYA 3GYHX 2Q2EA 1K78B 5E1WA 3SFZA 3CUQB 2UXXA 4RS8A 2H94A 3Q5FA 1J0RA 1TQMA 1BC8C 4PGHA 5D5VB 5J8FA 1HKTA 5J6XA 1ZYRF 2E7WA 4L0ZB 1GVJA 1XB4A 4M6XA 4P9FA 2O3FA 3WTTC 3Q9VA 4RB0A 2DI3A 2VE9A 6PAXA 4RB3C 1E17A 2MBFA 2QYOA 2DBBA 4UUVA 3MFKA 4UHTA 3WGGA 3HSRA 3TO7A 3FZVA 3H92A 4EJUA 5E8IA 1F1ZA 4A6DA 2BYVE 1HW1A 2RNJA 1R1UA 1O3QA 5FD6A 3JSOA 1YW9A 1KGSA 2IA1A 4M73A 3E3VA 3BY6A 2E1NA 4BQAA 1F5TA 2HTJA 4KN7X 1IN6A 2K27A 1XGMA 4M71A 4MQ9F 4RB1A 2XRNA 3LWFA 5HDNA 1G3YA 3HRSA 1XCVA 2A3SA 1LJ9A 2XAHA 2DK8A 1FC3A 2IT0A 4ESFA 5L3FA 2MLKA 4BHPA 5CLSA 1BJAA 3HHHA 2ESNA 3VEPA 1K7AA 3GW2A 2M8EA 5EEHA 2PBIA 3DEUA 4I98B 3WTXC 4HX8A 4WX9A 3IC7A 4BHBA 5DD4A 4CYDA 2W57A 3ZP5A 4ZZLA 4ZYEA 1IXSB 3IHUA 3W6JB 1LQ1A 4N0BA 5ILSA 2LSOA 2A07F 2M45A 3G73A 3P9IA 4IRIA 2KJCA 4O6JA 1MDMA 3W6KB 5EEGA 4OU0A 1H9TA 3F6VA 2OAZA 4ON0A 1FYKA 4G9YA 1U5TB 3PQJA 1BC7C 3ZPLA 1J5YA 1Z6TA 2A68F 2MH2A 2P6SA 1R58A 2QQ9A 2PMHA 4HAMA 3BWGA 3QRFF 2ZJ2A 1UB9A 4QWQA 4HF0A 1BM9A 4WCGA 2HQRA 3F8BA 2K7LA 2K4BA 4KUMA 1HSJA 4L18B 3GZ6A 5BQTA 3GFMA 4L9TA 1FP1D 4RB2C 5JR3A 1J7KA 5F1RA 2V1UA 3JTHA 3HRTA 2CGPA 3IKTA 2IA2A 3R0JA 4YFKF 3WGIA 1WI9A 3LSTA 1MZBA 4KT5C 1IXCA 5K5QA 1G6NA 1JE8A 3CLOA 3EDPA 1CF7B 4IHSA 4LK0F 1TNTA 2VOOA 4D0PA 5HS9A 5BMZA 5DEQA 1O7FA 4AVPA 1FYLA 2VT2A 3GVAA 4ZZDA 3K9TA 5DUKA 2JPCA 4FT8A 2E1CA 5E1ZB 3VFZA 1O3RA 3HIFA 2XAQA 3FXRA 4B8XA 4ETSA 1T38A 3TQNA 3WU1B 4ENJA 3KZZA 1WSUA 2HDCA 2F5EA 2L02A 5ILUA 4UVBA 5HDGA 1ZG5A 4A0YA 2XUBA 3QPTA 1EV7A 3KLOA 2ELHA 2RQPA 1QQIA 2B0LA 2QQAA 5ERIA 3QPHA 2HWVA 3P9CA 1IN4A 4HW0A 2XAFA 2FQ3A 2YSRA 3U2RA 2L4MA 2UZKA 1OYYA 2CWEA 3DQVC 1XDSA 4DQ2A 2Z33A 2JTVA 2L4AA 1FLIA 3ZMSA 1IN7A 3E5XA 4Q4ZF 2VC0A 1UFMA 3R6SA 1ON1A 3WTUC 4HQMA 3LQQA 1KQ0A 4HYEA 2FRHA 1QNTA 3BDDA 1DP7P 2EWNA 4FX4A 2EV5A 2O03A 1SD4A 4A5MA 2QM3A 2BEOA 3O3KA 1F4KA 3GEZA 4LLLA 2J5PA 1JGSA 1I5ZA 3MQ0A 1R5HA 1TBXA 1D8JA 4ASNA 4S04A 4HLYA 4BHCA 2KRFA 5H6QA 1EH7A 2FF4A 2P5VA 3NEUA 1D8KA 1W5TA 4XRFA 3RDIA 4KMFA 5AONA 1MJBA 1TW3A 3F6OA 3I4PA 3J7AO 1H0MA 1FWZA 1SMTA 3WE3A 2JZYA 3F8MA 2O0YA 2HEOA 3KEOA 5KVRA 2P8TA 4WXHA 2D1HA 3MAJA 1BIAA 1O57A 4RGRA 4A2UA 4KIFA 5LLQA 1OKRA 1J59A 1YW7A 2DO7A 3RIRA 4B09A 5BPIA 4WXDA 2GWRA 4GGGA 2OD5A 5TJJA 4IHTA 4KDPA 3SQNA 4CZZA 3ABTA 3BJ6A 2H27A 3K1PA 4UV8A 2ZXJA 3O2PE 5ICCA 3FMRA 2XHKA 3HUGA 1XMKA 3NQOA 2OZUA 3QP5A 4YG2F 4FHTA 2H6BA 3GZ5A 1YYVA 3DP7A 4LGWA 3I59B 4CGZA 4CO8A 1ZRCA 1R22A 2LNBA 2R7FA 2GQQA 3O6BB 2DPUA 3EYIA 4HDUA 3V8KA 2O61A 3HOTA 1QPMA 2VBXA 5D8KB 4KA4A 3M1EA 2TDXA 2F5FA 2AS5F 2RKHA 3KP2A 2RN7A 4RGUA 3RKWA 2YPRA 1B59A 1UCRA 2ZNZA 1SD7A 4N9IA 3RYPA 1R7JA 2DFIA 3I5UA 3WTWC 3QU3A 3SZPA 1ZLKA 4LJZF 3ROUA 2CYYA 3IRRA 4N9HA 5JVTA 3E6BA 4G6QA 3F3XA 3F23A 2MLGA 5A2QZ 3ZMUA 2FNAA 3MCZA 1OPCA 4WK8F 2PJPA 3GLXA 1J2XA 4GYGA 3RYRA 4L9JA 1BI0A 1K78A 5H20A 1Q1HA 1BIBA 2P7CB 2JT1A 4A12A 4JQFA 3NRVA 4JK1X 2E7XA 4IJAA 5K1YA 2WC2A 4AIJA 3R4KA 2ZCWA 3WTSC 1UHMA 1IUYA 1ZHFA 3KP5A 1OMIA 1REPC 2G7UA 2HKOA 2A61A 2GZWA 1MKMA 4OIOF 2LKPA 5E1XA 5LHGA 1BI1A 4Y13A 1AWCA 1W4MA 2WV0A 3K69A 1R36A 4I0AA 3V7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DV8 A;  4LB6 B;  4NQW A;  3N4M A;  1ON2 A;  1TTY A;  3C18 A;  4WWC A;  1GXQ A;  1ZGA A;  1FBS A;  5H6R A;  3DKW A;  3KEQ A;  2K02 A;  1K79 A;  3WG9 A;  2VOD A;  1SAX A;  3KCC A;  1YQA A;  2G9W A;  3GUD A;  4Y15 A;  3D0S A;  1YO5 C;  1L3L A;  1NHA A;  2XKP A;  4CXF A;  1P2F A;  1U3E M;  2V79 A;  1IN8 A;  1WWX A;  1ZAO A;  1HKQ A;  4I7H A;  2ZBK A;  1XSD A;  1TLH B;  3ML6 A;  1IXR C;  4M9Z A;  2STW A;  5LEK A;  3HOS A;  1FNN A;  2VT3 A;  1U2W A;  4IF4 A;  4EQQ A;  2M1B A;  3GX4 X;  3OV8 A;  2RC4 A;  5ED4 A;  2K4J A;  1LEB A;  2C6Y A;  1QZZ A;  2F2E A;  1TQI A;  4YFN F;  1YG2 A;  1IN5 A;  2MC3 A;  2VOP A;  1FSE A;  4G8X A;  2FBK A;  2XVC A;  5CVR A;  5AIP A;  4PDK A;  3V8L A;  4Q5S F;  2DW4 A;  1G3W A;  3HHG A;  1MJA A;  1LEA A;  4U0Y A;  3JTG A;  2FSW A;  2O8X A;  5BOX A;  3BJO A;  3RPQ A;  4MTE A;  3I64 A;  1J9I A;  3SHF A;  2X4H A;  3B73 A;  3REO A;  2EB7 A;  3S2W A;  4KYW A;  1GHC A;  1PP8 F;  2FOK A;  3TO6 A;  4OIP F;  3TOA A;  2CSO A;  4F7Z A;  3RI4 A;  1U5T A;  4M74 A;  1ZGJ A;  4I01 A;  1YFH A;  3PQK A;  3SZT A;  1PP7 U;  1IAW A;  4LFU A;  4HX4 A;  5L3C A;  3BPV A;  1P4X A;  1S7A A;  1FBU A;  3LA3 A;  2OQG A;  4UVC A;  3P9K A;  2ZME A;  4Q48 A;  2PEX A;  2A69 F;  4KMU X;  1R1V A;  2YX4 A;  1FPQ A;  3TOB A;  2QEN A;  3CUQ C;  2V6C A;  4KNY A;  4K2E A;  4M72 A;  4BAY A;  1ZRF A;  1LVA A;  2ZME B;  3H3U A;  3GF2 A;  1ODD A;  3C3W A;  2PI0 A;  2A6E F;  2STT A;  2ESH A;  4MGR A;  1E2X A;  2M5W A;  3KFW X;  4EGZ A;  1OYI A;  1ZLJ A;  2Q0O A;  1XGN A;  4IRG A;  4HV5 A;  2UXN A;  3LAJ A;  4GO1 A;  3ECH A;  1FY7 A;  3I53 A;  4CIC A;  3K2Z A;  1CF7 A;  1L0O C;  4HBL A;  4YIF A;  4KIB A;  3MWM A;  2MD5 A;  3TDU C;  3AAF A;  1T6S A;  1YW8 A;  2ISY A;  3LAP A;  4EV0 A;  1S29 A;  2CG4 A;  4OIQ F;  4NHJ A;  1UST A;  1QGP A;  4G6D A;  2R3S A;  1G3S A;  1R00 A;  2IPQ X;  2EFQ A;  4Q47 A;  4RAZ A;  1T0F A;  5HS8 A;  2HOE A;  2FNP A;  5AIQ A;  4P5O A;  3FM5 A;  5CVU A;  5D5W B;  1RIO H;  2KIM A;  3BPX A;  1FT9 A;  3VOD A;  1ULY A;  3HTU A;  3KE2 A;  4CDG A;  1I6X A;  5HOO A;  2EK5 A;  1XCB A;  3IRQ A;  4MEX F;  2PG4 A;  1EH6 A;  2AXL A;  1Z6R A;  3KP4 A;  2HTS A;  3LA2 A;  3GO5 A;  4ESB A;  1D3Y A;  3RTR A;  3EUH A;  4MQV A;  1VTN C;  2PQ8 A;  3J80 K;  2P6T A;  2Z3Y A;  2DK5 A;  2Q8K A;  3L09 A;  4WXC A;  2FA5 A;  1RNL A;  5LBQ A;  4CHU A;  4LD5 A;  1BBY A;  4RGS A;  4G7H F;  5LHH A;  1IRF A;  4R1H A;  5IT3 A;  1G3T A;  2GAU A;  3KLN A;  1S6L A;  2VE8 A;  3HRU A;  1TQP A;  4RGX A;  4DNC A;  1B9N A;  5BS6 A;  4HZF A;  3CJN A;  3U9G A;  3MEX A;  4EMS A;  1I1S A;  1JXS A;  1KU2 A;  4GXO A;  5D4S A;  5LRS A;  4LMY A;  4EJV A;  3WU0 A;  1K6O A;  1KA8 A;  4P55 A;  4LG0 B;  5JI6 A;  3BOQ A;  1U5T C;  4OMZ A;  2EFN A;  3KZY A;  2IA0 A;  1H9G A;  1FYM A;  4U0V A;  1HKS A;  5L3D A;  2WWY A;  5J8C A;  4AIK A;  3DPL C;  5HVQ C;  1FP2 A;  1XMA A;  2NYX A;  3L9F A;  1OR7 A;  3GFJ A;  3EET A;  3JAM K;  1O7L A;  4IXA A;  3BRO A;  2D45 A;  2DLL A;  1HBX G;  1SFX A;  1CGP A;  3M7G A;  1S8N A;  5DDG A;  2K86 A;  2FXA A;  4M9S A;  2L54 A;  4MNU A;  3TO9 A;  5FO5 A;  3WE2 A;  5KK1 A;  4A6E A;  3V7C A;  3MZY A;  5CVI A;  2M30 A;  2EJR A;  1QZY A;  3ERE D;  3I59 A;  1O3T A;  4U0W A;  3ZQ7 A;  4OIN F;  2ISZ A;  1RUN A;  2HKX A;  2NNN A;  3TKY A;  1XSX A;  2ETH A;  4R79 A;  2DTR A;  3WTY C;  1B9M A;  1X3U A;  1U8R A;  1IRG A;  1YLF A;  1BOA A;  3T0Y A;  3K0L A;  1QBJ A;  1RI7 A;  3N97 A;  1B4A A;  3L7W A;  1SFE A;  3ELK A;  4MHG A;  1G4D A;  2IRF G;  5L3G A;  4EJW A;  1Z9C A;  2H6C A;  2BGC A;  3VOE A;  3U1D A;  1USS A;  3E5Q A;  3F72 A;  5DUI A;  2VON A;  3C1D A;  3C7J A;  4AIH A;  5CVV A;  4S05 A;  2NNY A;  1LNW A;  3V4G A;  3J81 K;  3DXJ F;  4EM0 B;  1Z7U A;  5FD5 A;  4I0B A;  3G3Z A;  3QU6 A;  1SFU A;  2QWW A;  3R0A A;  5FLX K;  5CJ9 A;  1MGT A;  1MD0 A;  4HV6 A;  1Z05 A;  2QUF A;  4H0E A;  1P4W A;  3HSF A;  1YS7 A;  3CUO A;  1HW5 A;  1DDN A;  2MA3 A;  5D4R A;  2FU4 A;  4AD9 A;  1B6A A;  3ECO A;  3TGN A;  4EM1 A;  1IF1 A;  4UV9 A;  1YTY A;  1ZN2 A;  1OYW A;  3LFK A;  3JAM Z;  1ZG1 A;  2FE3 A;  1KQ8 A;  1V4R A;  3Q9S A;  2Z99 A;  2EA2 A;  2COM A;  5HDK A;  1C0W A;  3ZN0 A;  2F5D A;  4ESJ A;  4ZYD A;  1BI3 A;  1KU9 A;  5ICF A;  2VBY A;  5F64 A;  2DAO A;  4QLC U;  2ADU A;  1KU3 A;  1IW7 F;  4ZH4 F;  2XAS A;  3DFG A;  2HGC A;  3I71 A;  4GYI A;  1ZH5 A;  2G7H A;  5DD8 A;  3QOP A;  2KJB A;  4EGY A;  4HA8 A;  5DYM A;  2MH9 A;  5DCM A;  5LGU A;  2DQR A;  5LGN A;  2Y75 A;  1SMY F;  3PFI A;  2OBP A;  2RVC A;  5E17 F;  3BP8 A;  5ICG A;  4OOI A;  1DUX C;  2QZ8 A;  4O5V A;  5DCM B;  1HW2 A;  2HQN A;  4G94 A;  4KIC A;  5LGT A;  3CO6 C;  5D6E A;  3L2C A;  2VC1 A;  1EH8 A;  4KIG A;  4MTD A;  4XSZ F;  5D6F A;  1QO0 D;  4BNC A;  4G7O F;  2FMY A;  3COA C;  3KP3 A;  4KFC A;  2Y48 A;  2KIF A;  3RKY A;  2EA4 A;  4EVI A;  1ONV A;  2PLY A;  2P7V B;  4TV7 A;  4L9V A;  3E97 A;  2IJL A;  3FXQ A;  3FMS A;  4HDV A;  3J81 Z;  1LDK B;  4FX0 A;  1IZ1 A;  3V7R A;  2GIV A;  1TNS A;  4A0Z A;  3WTV C;  4XSX F;  5JFR A;  3F22 A;  2FML A;  4XLN F;  1RUO A;  2X0L A;  3JSP A;  1Y0U A;  5ILV A;  4HX7 A;  2QBY A;  2CO5 A;  5FLX Z;  2ZO4 A;  3EYY A;  2GXG A;  1O3S A;  3R60 A;  1Z91 A;  2PMU A;  3R61 A;  3WOD F;  2A6H F;  1FSH A;  2DU9 A;  1YS6 A;  3HRM A;  1HXD A;  5JHU A;  3DF8 A;  1V3F A;  3M9A A;  2QBY B;  1W5S A;  4ZYH A;  1MJ9 A;  3D5L A;  2EFO A;  3T5X A;  4BH9 A;  4UXN A;  3BJA A;  3RPU A;  2R7D A;  3DPT A;  5DCF A;  3ZMZ A;  2Y0M A;  2LF8 A;  3LQR A;  3IKV A;  5FGM A;  5CYV A;  4HLX A;  2O6G E;  3V8J A;  1XGO A;  2HZT A;  4WF2 A;  5LEJ A;  2L3D A;  3IWF A;  1P92 A;  2P5K A;  4U88 A;  3GWZ A;  5L3E A;  5ICE A;  2OQR A;  4RAY A;  2FBH A;  2XRO A;  2IP2 A;  3I58 A;  4PCQ A;  1MDM B;  3T8T A;  1XN7 A;  5CVJ A;  2YX7 A;  3FX3 A;  3E6M A;  3T1B A;  2EV0 A;  1A04 A;  3F8C A;  3WGH A;  5D5U B;  3ZMV A;  1W7P A;  2XKO A;  1ZG3 A;  2QLZ A;  2XIG A;  2HFH A;  3K1N A;  1KQ9 A;  5FB2 A;  3ZN1 A;  5E18 F;  3FWE A;  1WKM A;  2VXZ A;  3OOP A;  1T39 A;  2A5Y B;  4ENK A;  1W7P B;  3H3Z A;  2Z9O A;  4BYY A;  3M8F A;  4I09 A;  1DPU A;  2WTE A;  2BE5 F;  4XBF A;  1STZ A;  2D2W A;  3I54 A;  4HOB A;  2V9V A;  5TRD A;  2RDP A;  4A5N A;  1U78 A;  1KYZ A;  1JHH A;  4HF2 A;  1XDU A;  2QQB A;  4L5I A;  3P7N A;  3E5U A;  3RKX A;  2FEZ A;  5F6F A;  4ENM A;  4P9U A;  2RV8 A;  4L0Y B;  2PN6 A;  2XGX A;  4LB5 A;  3FMQ A;  2OA4 A;  4MEY F;  1WRJ A;  1UHW A;  3KP6 A;  4UNO A;  1ZAR A;  1LB2 A;  4HQE A;  2BBY A;  2KKO A;  2CQK A;  2DPD A;  4U7B A;  4NB5 A;  1XD7 A;  2HYG D;  3I0T A;  2H09 A;  5DV5 A;  2V1D A;  2BV6 A;  3ULQ B;  4LK1 F;  2LF7 A;  1FBQ A;  3ZMD A;  2GA1 A;  2HYF A;  5D8L B;  5K5O A;  5E20 A;  4O3M A;  3CO7 C;  2ZFW A;  4KN4 X;  4PGG A;  3KET A;  2V1X A;  2OZ6 A;  3F8F A;  2DT5 A;  3HYI A;  5FFZ A;  1P4A A;  5FFX A;  1PUE E;  4LG0 A;  3EQL F;  1BN5 A;  1GXP A;  2YU3 A;  3GFL A;  5HLH A;  1D5V A;  2W24 A;  1LDJ A;  4EJT A;  2RGV A;  1KYW A;  1T98 A;  1AOY A;  4G7Z F;  2NS0 A;  4P96 A;  1HQC A;  1SD6 A;  3K1M A;  5IT9 K;  4LLN A;  4A0X A;  1FZP B;  3SXY A;  4OIR F;  2J5O A;  5A2Q K;  1I1G A;  1YIO A;  3GFI A;  3ZMT A;  3KP7 A;  1I27 A;  2NRA C;  2VN2 A;  1R23 A;  2DQL A;  2JPB A;  3VB2 A;  2XV4 S;  1J75 A;  3QP6 A;  3IWZ A;  1F9N A;  1FX7 A;  2OU2 A;  3M8E A;  2QVO A;  2Z5U A;  4IRH A;  4YII A;  2XAJ A;  5LHI A;  1XGS A;  2EFW A;  4UVA A;  3HTS B;  4IPA A;  1R5G A;  2YR2 A;  1DPR A;  1S3J A;  5HS7 A;  2EV6 A;  3FXU A;  2D1V A;  3F21 A;  2CFX A;  2LDU A;  3TDZ C;  1Z1D A;  1ZRD A;  1SD5 A;  2CW0 F;  3L00 A;  2EFP A;  2VBW A;  4E70 A;  4EM2 A;  3E6C C;  3MZH A;  4Z2Y A;  4BXU A;  2JSC A;  2W25 A;  4L9N A;  4R8H A;  1RZ4 A;  2FBI A;  1W7P D;  3T8R A;  4L5J A;  3FF5 A;  4JBA A;  2JRT A;  3FM3 A;  1P6R A;  1WQ2 A;  4ENN A;  1PDN C;  2IW5 A;  2GA2 A;  1S7O A;  4IVN A;  4LLG F;  1HST A;  3J80 Z;  1JHF A;  5L3B A;  1FOK A;  3FHZ A;  4HF1 A;  3ABU A;  5HLI A;  2P5L C;  5D5X B;  2L01 A;  3HSE A;  5BPD A;  2ACJ A;  3CTA A;  4AWX B;  2HS5 A;  4GCV A;  4U7D A;  1B1B A;  3RJP A;  5K5R A;  4I02 A;  2PFB A;  3IL2 A;  1T2K A;  2GXB A;  3CDH A;  4M6Y A;  2W85 A;  1LDD A;  3JW4 A;  2ZNY A;  3GXO A;  4YFX F;  2W84 A;  1KU7 A;  2UWM A;  3LA7 A;  4PZJ A;  2IVM A;  2NAZ A;  5IT9 Z;  4XLP F;  1XSV A;  1TW2 A;  4I2O A;  1BI2 A;  3B02 A;  2P4W A;  1ZRE A;  4EJO A;  4ZYG A;  4Y17 A;  3WTZ A;  3QAH A;  2F5C A;  2XAG A;  3BZ6 A;  2KIU A;  5E8G A;  3CUQ A;  3ISP A;  2HR3 A;  2VBZ A;  2M87 A;  3F8N A;  1R1T A;  5LRR A;  5HLG A;  4M9X A;  3E6D A;  2ZKZ A;  1U6G A;  4OMY A;  3GYH X;  2Q2E A;  1K78 B;  5E1W A;  3SFZ A;  3CUQ B;  2UXX A;  4RS8 A;  2H94 A;  3Q5F A;  1J0R A;  1TQM A;  1BC8 C;  4PGH A;  5D5V B;  5J8F A;  1HKT A;  5J6X A;  1ZYR F;  2E7W A;  4L0Z B;  1GVJ A;  1XB4 A;  4M6X A;  4P9F A;  2O3F A;  3WTT C;  3Q9V A;  4RB0 A;  2DI3 A;  2VE9 A;  6PAX A;  4RB3 C;  1E17 A;  2MBF A;  2QYO A;  2DBB A;  4UUV A;  3MFK A;  4UHT A;  3WGG A;  3HSR A;  3TO7 A;  3FZV A;  3H92 A;  4EJU A;  5E8I A;  1F1Z A;  4A6D A;  2BYV E;  1HW1 A;  2RNJ A;  1R1U A;  1O3Q A;  5FD6 A;  3JSO A;  1YW9 A;  1KGS A;  2IA1 A;  4M73 A;  3E3V A;  3BY6 A;  2E1N A;  4BQA A;  1F5T A;  2HTJ A;  4KN7 X;  1IN6 A;  2K27 A;  1XGM A;  4M71 A;  4MQ9 F;  4RB1 A;  2XRN A;  3LWF A;  5HDN A;  1G3Y A;  3HRS A;  1XCV A;  2A3S A;  1LJ9 A;  2XAH A;  2DK8 A;  1FC3 A;  2IT0 A;  4ESF A;  5L3F A;  2MLK A;  4BHP A;  5CLS A;  1BJA A;  3HHH A;  2ESN A;  3VEP A;  1K7A A;  3GW2 A;  2M8E A;  5EEH A;  2PBI A;  3DEU A;  4I98 B;  3WTX C;  4HX8 A;  4WX9 A;  3IC7 A;  4BHB A;  5DD4 A;  4CYD A;  2W57 A;  3ZP5 A;  4ZZL A;  4ZYE A;  1IXS B;  3IHU A;  3W6J B;  1LQ1 A;  4N0B A;  5ILS A;  2LSO A;  2A07 F;  2M45 A;  3G73 A;  3P9I A;  4IRI A;  2KJC A;  4O6J A;  1MDM A;  3W6K B;  5EEG A;  4OU0 A;  1H9T A;  3F6V A;  2OAZ A;  4ON0 A;  1FYK A;  4G9Y A;  1U5T B;  3PQJ A;  1BC7 C;  3ZPL A;  1J5Y A;  1Z6T A;  2A68 F;  2MH2 A;  2P6S A;  1R58 A;  2QQ9 A;  2PMH A;  4HAM A;  3BWG A;  3QRF F;  2ZJ2 A;  1UB9 A;  4QWQ A;  4HF0 A;  1BM9 A;  4WCG A;  2HQR A;  3F8B A;  2K7L A;  2K4B A;  4KUM A;  1HSJ A;  4L18 B;  3GZ6 A;  5BQT A;  3GFM A;  4L9T A;  1FP1 D;  4RB2 C;  5JR3 A;  1J7K A;  5F1R A;  2V1U A;  3JTH A;  3HRT A;  2CGP A;  3IKT A;  2IA2 A;  3R0J A;  4YFK F;  3WGI A;  1WI9 A;  3LST A;  1MZB A;  4KT5 C;  1IXC A;  5K5Q A;  1G6N A;  1JE8 A;  3CLO A;  3EDP A;  1CF7 B;  4IHS A;  4LK0 F;  1TNT A;  2VOO A;  4D0P A;  5HS9 A;  5BMZ A;  5DEQ A;  1O7F A;  4AVP A;  1FYL A;  2VT2 A;  3GVA A;  4ZZD A;  3K9T A;  5DUK A;  2JPC A;  4FT8 A;  2E1C A;  5E1Z B;  3VFZ A;  1O3R A;  3HIF A;  2XAQ A;  3FXR A;  4B8X A;  4ETS A;  1T38 A;  3TQN A;  3WU1 B;  4ENJ A;  3KZZ A;  1WSU A;  2HDC A;  2F5E A;  2L02 A;  5ILU A;  4UVB A;  5HDG A;  1ZG5 A;  4A0Y A;  2XUB A;  3QPT A;  1EV7 A;  3KLO A;  2ELH A;  2RQP A;  1QQI A;  2B0L A;  2QQA A;  5ERI A;  3QPH A;  2HWV A;  3P9C A;  1IN4 A;  4HW0 A;  2XAF A;  2FQ3 A;  2YSR A;  3U2R A;  2L4M A;  2UZK A;  1OYY A;  2CWE A;  3DQV C;  1XDS A;  4DQ2 A;  2Z33 A;  2JTV A;  2L4A A;  1FLI A;  3ZMS A;  1IN7 A;  3E5X A;  4Q4Z F;  2VC0 A;  1UFM A;  3R6S A;  1ON1 A;  3WTU C;  4HQM A;  3LQQ A;  1KQ0 A;  4HYE A;  2FRH A;  1QNT A;  3BDD A;  1DP7 P;  2EWN A;  4FX4 A;  2EV5 A;  2O03 A;  1SD4 A;  4A5M A;  2QM3 A;  2BEO A;  3O3K A;  1F4K A;  3GEZ A;  4LLL A;  2J5P A;  1JGS A;  1I5Z A;  3MQ0 A;  1R5H A;  1TBX A;  1D8J A;  4ASN A;  4S04 A;  4HLY A;  4BHC A;  2KRF A;  5H6Q A;  1EH7 A;  2FF4 A;  2P5V A;  3NEU A;  1D8K A;  1W5T A;  4XRF A;  3RDI A;  4KMF A;  5AON A;  1MJB A;  1TW3 A;  3F6O A;  3I4P A;  3J7A O;  1H0M A;  1FWZ A;  1SMT A;  3WE3 A;  2JZY A;  3F8M A;  2O0Y A;  2HEO A;  3KEO A;  5KVR A;  2P8T A;  4WXH A;  2D1H A;  3MAJ A;  1BIA A;  1O57 A;  4RGR A;  4A2U A;  4KIF A;  5LLQ A;  1OKR A;  1J59 A;  1YW7 A;  2DO7 A;  3RIR A;  4B09 A;  5BPI A;  4WXD A;  2GWR A;  4GGG A;  2OD5 A;  5TJJ A;  4IHT A;  4KDP A;  3SQN A;  4CZZ A;  3ABT A;  3BJ6 A;  2H27 A;  3K1P A;  4UV8 A;  2ZXJ A;  3O2P E;  5ICC A;  3FMR A;  2XHK A;  3HUG A;  1XMK A;  3NQO A;  2OZU A;  3QP5 A;  4YG2 F;  4FHT A;  2H6B A;  3GZ5 A;  1YYV A;  3DP7 A;  4LGW A;  3I59 B;  4CGZ A;  4CO8 A;  1ZRC A;  1R22 A;  2LNB A;  2R7F A;  2GQQ A;  3O6B B;  2DPU A;  3EYI A;  4HDU A;  3V8K A;  2O61 A;  3HOT A;  1QPM A;  2VBX A;  5D8K B;  4KA4 A;  3M1E A;  2TDX A;  2F5F A;  2AS5 F;  2RKH A;  3KP2 A;  2RN7 A;  4RGU A;  3RKW A;  2YPR A;  1B59 A;  1UCR A;  2ZNZ A;  1SD7 A;  4N9I A;  3RYP A;  1R7J A;  2DFI A;  3I5U A;  3WTW C;  3QU3 A;  3SZP A;  1ZLK A;  4LJZ F;  3ROU A;  2CYY A;  3IRR A;  4N9H A;  5JVT A;  3E6B A;  4G6Q A;  3F3X A;  3F23 A;  2MLG A;  5A2Q Z;  3ZMU A;  2FNA A;  3MCZ A;  1OPC A;  4WK8 F;  2PJP A;  3GLX A;  1J2X A;  4GYG A;  3RYR A;  4L9J A;  1BI0 A;  1K78 A;  5H20 A;  1Q1H A;  1BIB A;  2P7C B;  2JT1 A;  4A12 A;  4JQF A;  3NRV A;  4JK1 X;  2E7X A;  4IJA A;  5K1Y A;  2WC2 A;  4AIJ A;  3R4K A;  2ZCW A;  3WTS C;  1UHM A;  1IUY A;  1ZHF A;  3KP5 A;  1OMI A;  1REP C;  2G7U A;  2HKO A;  2A61 A;  2GZW A;  1MKM A;  4OIO F;  2LKP A;  5E1X A;  5LHG A;  1BI1 A;  4Y13 A;  1AWC A;  1W4M A;  2WV0 A;  3K69 A;  1R36 A;  4I0A A;  3V7S A; 
#chains in the Genus database with same CATH topology
 3DV8 A;  4LB6 B;  4NQW A;  2R0Q C;  2NOJ B;  4YEJ A;  4JOM A;  2JRM A;  3N4M A;  3BQZ A;  1ON2 A;  1TTY A;  3C18 A;  4WWC A;  1GXQ A;  2K9S A;  4PFO A;  1ZGA A;  2EIN H;  3FBI B;  3JR9 A;  4A3I J;  2R7V A;  4C2T A;  1FBS A;  5H6R A;  3X2Q H;  3DKW A;  1KZH A;  2OF7 A;  3CMM A;  3KEQ A;  3CP2 A;  2K02 A;  2VJ5 A;  2H8R A;  3FIS A;  4FET A;  5HLT A;  3WG9 A;  1K79 A;  4NQW B;  3L1P A;  2QGU A;  2VOD A;  1SAX A;  3CCY A;  3KYC B;  3KCC A;  1YQA A;  2G9W A;  3GUD A;  4Y15 A;  3D0S A;  1YO5 C;  1L3L A;  1NHA A;  2XKP A;  4II3 A;  2IGN A;  4CXF A;  1P2F A;  4AYB N;  1U3E M;  2V79 A;  1IN8 A;  1WWX A;  4XKV A;  2XRL A;  1ZAO A;  4XLF A;  1HKQ A;  2O7O A;  4FE7 A;  2Q1Z B;  4I7H A;  2OV7 A;  4XIC A;  2ZBK A;  1XSD A;  1TLH B;  3A0B C;  3ML6 A;  3CES A;  1IXR C;  1MND A;  1X3W B;  4M9Z A;  4G6T B;  2K3P A;  1Y1W J;  2STW A;  2M4G A;  3C2G A;  5LEK A;  3HOS A;  1FNN A;  1V5F A;  2VT3 A;  1U2W A;  2Y0S N;  3JCU C;  3DLL F;  1R49 A;  4IF4 A;  4EQQ A;  2M1B A;  1V55 H;  3GX4 X;  2O9L A;  1S5L C;  2WAE A;  3OV8 A;  2RC4 A;  3IP4 B;  5ED4 A;  4JYK A;  2K4J A;  1LEB A;  1BR2 A;  2GOX B;  4C30 A;  2C6Y A;  1QZZ A;  2F2E A;  3CP8 A;  1TQI A;  1JGG A;  4YFN F;  2DFE A;  1YG2 A;  1IN5 A;  1VZ0 A;  5FKM A;  2MC3 A;  1H8A C;  4IOA F;  5TGT A;  2VOP A;  2WB1 A;  2BY3 A;  5HOD A;  2JA7 J;  1FSE A;  2WA0 A;  2NS8 A;  4G8X A;  1VQK I;  3OYH A;  1TWG J;  2X85 A;  3WG7 H;  3HB9 A;  2FBK A;  2XVC A;  5CVR A;  2F6C A;  4XLH A;  5AIP A;  4PDK A;  3V8L A;  1QU3 A;  4Q5S F;  2ZFU A;  4EAT A;  1OCR H;  2DW4 A;  1EKE A;  1G3W A;  3HHG A;  3HOZ J;  2KZV A;  3LL7 A;  2V7F A;  3IUO A;  1EF4 A;  1MJA A;  1LEA A;  1WJA A;  4U0Y A;  3JTG A;  2FSW A;  2O8X A;  5B5E C;  5BOX A;  3BJO A;  3RPQ A;  4MTE A;  3I64 A;  1J9I A;  3C2B A;  3SHF A;  3SZG A;  3HPG A;  2X4H A;  3B73 A;  3REO A;  1TWC J;  2EB7 A;  3S2W A;  3HL2 A;  4KYW A;  1GHC A;  3JRA A;  1PP8 F;  1W0T A;  2FOK A;  3TO6 A;  4OIP F;  3TOA A;  2CSO A;  4XRS G;  4F7Z A;  3RI4 A;  1N77 A;  1U5T A;  4M74 A;  3SFI A;  1ZGJ A;  4I01 A;  3QYE A;  1WFX A;  1YFH A;  4QSH A;  3PQK A;  3SZT A;  1PP7 U;  1IAW A;  2R7R A;  4B1R A;  4PUS A;  4LFU A;  4HX4 A;  4RM2 A;  5L3C A;  3BPV A;  3SJM A;  2LFB A;  1P4X A;  1S7A A;  3BCB A;  1FBU A;  4RMN A;  3LA3 A;  2DOD A;  1BW5 A;  2OQG A;  4UVC A;  4E7L A;  2H1L A;  4B48 A;  3H0G J;  4IEJ A;  3P9K A;  2L5Q A;  2ZME A;  5E3O A;  4Q48 A;  2PEX A;  3DBL B;  2A69 F;  2DMU A;  4KMU X;  5F0C A;  5F27 A;  5HNF A;  2VQL A;  4E7Z A;  3HKZ N;  1AA7 A;  4XOT A;  1W36 C;  3LSP A;  3ZQQ A;  5EJC A;  5IP6 A;  1R1V A;  1QPI A;  2HDD A;  2YX4 A;  1FPQ A;  2OC6 A;  2QEN A;  3TOB A;  1T8I A;  3CUQ C;  1X1C A;  2V6C A;  2R92 J;  2HQ5 A;  4KNY A;  2W00 A;  2VI6 A;  4K2E A;  4M72 A;  2MW8 A;  4BAY A;  1ZRF A;  1PUF B;  1HC8 A;  1LVA A;  2ZME B;  1YJN I;  3H3U A;  1MBH A;  3GF2 A;  1ODD A;  3C3W A;  2PI0 A;  2A6E F;  1MIJ A;  2STT A;  2ESH A;  4BKX A;  1IC8 A;  2ICW G;  1JKQ C;  4MGR A;  1E2X A;  3TW7 A;  2DOF A;  1ETX A;  2CUZ A;  2M5W A;  3KFW X;  2XPU A;  3CC4 I;  4EGZ A;  1OYI A;  3VYT B;  1ZLJ A;  2Q0O A;  3OS0 A;  4F55 A;  1XGN A;  4IRG A;  4HV5 A;  3RCO A;  2UXN A;  3LAJ A;  1B72 B;  2CUE A;  1RC9 A;  4GO1 A;  5TIS C;  3EUK L;  1VQ6 I;  3ECH A;  3K4L A;  1FY7 A;  1SAU A;  3LSG A;  3MN2 A;  3I53 A;  4CIC A;  3OYL A;  3K2Z A;  1CF7 A;  1L0O C;  4B3X A;  5FJ8 J;  3LSR A;  2QCO A;  3IAS 2;  5KAF C;  4HBL A;  2VIX A;  4YIF A;  2XSD C;  4KIB A;  2CH0 A;  1WJB A;  4CCO A;  2B7E A;  3MWM A;  2XGE A;  2MD5 A;  3TDU C;  3AAF A;  1T6S A;  3GME A;  1YW8 A;  4IQJ A;  2ISY A;  2ECB A;  2V1N A;  3LAP A;  1SVL A;  1S29 A;  3SDB A;  4EV0 A;  4QPO A;  1NK3 P;  5JLX A;  4CCL A;  4E7S A;  2CG4 A;  4XOR A;  2DA1 A;  4OIQ F;  3ABL H;  2RRE A;  2WY8 Q;  4NHJ A;  1UST A;  1QGP A;  3FXJ A;  2R3S A;  1G3S A;  2LG4 A;  4G6D A;  3CJT B;  1GVD A;  1R00 A;  2IPQ X;  2MGQ A;  5FRN A;  2EFQ A;  3KX2 A;  4Q47 A;  1TZL A;  4RAZ A;  4UB8 C;  1DP3 A;  1T0F A;  5HS8 A;  2HOE A;  4Y52 J;  3PJR A;  2FNP A;  1J09 A;  5AIQ A;  5GAH J;  4P5O A;  4PFP A;  3FM5 A;  2DJI A;  5CVU A;  2KDZ A;  1X58 A;  1WH5 A;  5D5W B;  1RIO H;  2KIM A;  3BPX A;  1FT9 A;  3PNV A;  4X1E A;  3VOD A;  1ULY A;  3HTU A;  4F92 B;  3OY9 A;  3KE2 A;  4ANJ A;  1Z21 A;  5B1A H;  4CDG A;  1H89 C;  1I6X A;  3I3L A;  2KRH A;  2M7A A;  4ZDP A;  5HOO A;  3CCE I;  1JKP C;  2EK5 A;  4B47 A;  4FQG A;  1Z67 A;  1XCB A;  3BR3 A;  4N4O B;  4A3J J;  3IRQ A;  4MEX F;  2PG4 A;  3HOV J;  4E7H A;  3OL3 A;  1BA5 A;  1EH6 A;  5FRM A;  2AXL A;  1Z6R A;  3OOU A;  3SEZ A;  3KP4 A;  2LKX A;  2HTS A;  3LA2 A;  3GO5 A;  4ESB A;  1D3Y A;  3RTR A;  3PIO F;  2XGD A;  4RA2 A;  4RBO A;  3EUH A;  1OCZ H;  4HPQ A;  4MQV A;  3SDG A;  1VTN C;  3S17 J;  4PSX A;  2PQ8 A;  3J80 K;  2EIJ H;  1N78 A;  3BR1 A;  2L9N A;  1BJZ A;  3QQA A;  2P6T A;  2Z3Y A;  1HDP A;  2DK5 A;  2MC4 A;  2Q8K A;  2LC2 A;  2KIS A;  3L09 A;  4WXC A;  1HLV A;  2FA5 A;  1VQP I;  1G59 A;  1RNL A;  5LBQ A;  4CHU A;  4LD5 A;  4A93 J;  1BBY A;  4RGS A;  3IH3 A;  4G7H F;  5LHH A;  4DOZ A;  1IRF A;  2GIZ A;  4DJA A;  4R1H A;  1UJ8 A;  5IT3 A;  3S1N J;  1G3T A;  1QZE A;  4C3I J;  2GAU A;  3KLN A;  1S6L A;  5C44 J;  5GPC A;  2PMZ N;  2VE8 A;  2BY1 A;  3HRU A;  1TQP A;  2QSG X;  4RGX A;  2ZB9 A;  4DNC A;  1B9N A;  1A35 A;  5BS6 A;  4HZF A;  3CJN A;  1RKW A;  3U9G A;  3MEX A;  5IYC J;  4EMS A;  1I1S A;  1JXS A;  1KU2 A;  3LSI A;  4GXO A;  2KHM A;  1NG7 A;  5F08 A;  5D4S A;  5LRS A;  2XPW A;  4LMY A;  4EJV A;  4N4N B;  3ASN H;  3WU0 A;  1K6O A;  4OAY A;  1KA8 A;  3ZQC A;  1YX3 A;  4P55 A;  4LG0 B;  3BG7 A;  5JI6 A;  3I56 I;  3S14 J;  5CPR B;  3BOQ A;  3CF2 A;  1U5T C;  4OMZ A;  2EFN A;  3KZY A;  2IA0 A;  1ZR2 A;  1H9G A;  3LNQ A;  1FYM A;  4U0V A;  1HKS A;  5L3D A;  2WWY A;  5J8C A;  4AIK A;  3DPL C;  4UUS B;  5HVQ C;  1FP2 A;  1XMA A;  2ZME C;  2CV0 A;  2NYX A;  3L9F A;  1HA8 A;  1OR7 A;  1Y8Q B;  3GFJ A;  3EET A;  3J7Z I;  3RPU D;  2HU9 A;  2E71 A;  2BHZ A;  4HNV A;  4RLQ A;  3OS2 A;  2HOS A;  3JAM K;  4JP0 A;  4F52 A;  1O7L A;  3K4K A;  1UZC A;  4IXA A;  3A4C A;  3BRO A;  1WJD A;  3TL4 X;  2D45 A;  4E6K G;  4S0H B;  2DLL A;  1HBX G;  2ELK A;  1SFX A;  2CRG A;  2BVM A;  2ZJP F;  5B1B H;  1CGP A;  3M7G A;  1S8N A;  2DMP A;  2CQ7 A;  5DDG A;  2K86 A;  5KCM A;  2FXA A;  1BL0 A;  4M9S A;  3DLA A;  2L54 A;  4MNU A;  3TO9 A;  1ETK A;  5FO5 A;  3WE2 A;  5KK1 A;  1Y1V J;  2Y9Z A;  3CCJ I;  2KT0 A;  4A6E A;  3V7C A;  3MZY A;  5CVI A;  4XN0 A;  1X2M A;  2M30 A;  2EJR A;  1QZY A;  4U87 A;  3I59 A;  3ERE D;  5BNG A;  1O3T A;  4U0W A;  1ERD A;  3ZQ7 A;  3PFY A;  4OIN F;  1UEL B;  2JN6 A;  2P81 A;  5J47 A;  2ISZ A;  4XQF A;  1E3H A;  4XLC A;  5EEA A;  1RUN A;  2DMT A;  4RM3 A;  2HKX A;  2E36 A;  2NNN A;  4DW6 A;  5C4X J;  3TKY A;  1XSX A;  3DTI A;  2ETH A;  4R79 A;  2DFH A;  2R7S A;  2DTR A;  2M9H A;  2XF5 A;  4JX6 A;  3WTY C;  1B8I A;  3H9J A;  3AG2 H;  2DN0 A;  1B9M A;  1X3U A;  2ZJR F;  4IHY A;  1D0Y A;  2VKE A;  1NK2 P;  1U8R A;  1Z0X A;  2L9R A;  3U21 A;  3CJQ B;  1MSE C;  2X1C A;  1IRG A;  1YLF A;  2D5V A;  1HCR A;  1BOA A;  2DTZ A;  3T0Y A;  3K0L A;  4C3H J;  1QBJ A;  1RI7 A;  3N97 A;  1XX5 A;  1T0F C;  1B4A A;  1B8I B;  3L7W A;  1SFE A;  3ELK A;  4MHG A;  1G4D A;  2L0K A;  2IRF G;  5IOZ A;  4A3B J;  1XPX A;  3HPH A;  5L3G A;  3WHB A;  1VQL I;  2WBM A;  2PX9 A;  5EGO A;  1X2N A;  5EG0 B;  1HF0 A;  4EJW A;  1Z9C A;  2H6C A;  2BGC A;  3P5J A;  2HVS A;  3VOE A;  3U1D A;  1WJF A;  1USS A;  3E5Q A;  1XS9 A;  4CCN A;  1VQ8 I;  3F72 A;  2O5R A;  5DUI A;  2VON A;  1WH7 A;  3C1D A;  3C7J A;  1GT0 C;  4AIH A;  3OYK A;  3BR2 A;  3OYN A;  5CVV A;  5J1Y A;  4S05 A;  2WAD A;  2NNY A;  1LNW A;  3V4G A;  4AVZ A;  5EGO B;  4IQ4 A;  2VQH A;  5M3M J;  3J81 K;  3DXJ F;  3TP0 A;  4EM0 B;  3BLY A;  1Z7U A;  3OYD A;  2X1E A;  5FD5 A;  3BT9 A;  2CUF A;  4I0B A;  2IAI A;  3G3Z A;  5GAG J;  3QU6 A;  1SFU A;  1K83 J;  3EUH C;  2QWW A;  4V19 K;  2E2J J;  1RET A;  3R0A A;  3GTL J;  5FLX K;  3A01 A;  3CZ6 A;  1UG0 A;  5CJ9 A;  1IRX A;  1MGT A;  2BOL A;  4IZZ A;  1MD0 A;  4E7K A;  4HV6 A;  4XMY A;  1Z05 A;  2VLA A;  2QUF A;  2X6X A;  4H0E A;  3DBH B;  1P4W A;  3HSF A;  4F93 B;  1YS7 A;  4KIT B;  3CUO A;  4CCK A;  1HW5 A;  1DDN A;  1ZQ3 P;  2MA3 A;  1OCO H;  5D4R A;  5GTH C;  2FU4 A;  4AD9 A;  4ZTF A;  2GLO A;  1B6A A;  2CMP A;  3ECO A;  3S8P A;  1RES A;  2WAQ N;  3TGN A;  4EM1 A;  1IF1 A;  4UV9 A;  1YTY A;  1WGX A;  4A3C J;  2W48 A;  3ABM H;  3GZN B;  2I5U A;  3QOD A;  3DU5 A;  1ZN2 A;  1OYW A;  4LG3 A;  3LFK A;  1QHG A;  4P1W A;  3JAM Z;  1E3P A;  3OYG A;  4BE2 A;  1ZG1 A;  2FE3 A;  4AYB A;  2KP6 A;  1KQ8 A;  1V4R A;  3DWL E;  3Q9S A;  3LMM A;  2VKD A;  2Z99 A;  2EA2 A;  2LOO A;  2COM A;  5HDK A;  3HOY J;  3BC8 A;  1C0W A;  2AQE A;  3ZN0 A;  1MMG A;  3A02 A;  2F5D A;  4ESJ A;  3UR3 C;  4ZYD A;  1BI3 A;  1W5C C;  1KU9 A;  2LY2 A;  3DTE A;  5ICF A;  2VBY A;  4B3A A;  5F64 A;  2DAO A;  4QLC U;  1H88 C;  3CCS I;  3MKW B;  2ADU A;  1KU3 A;  1IW7 F;  4ZH4 F;  3CMA I;  2XAS A;  3DFG A;  2Y0S A;  1RR8 C;  3GTO J;  2HGC A;  2IGM A;  3I71 A;  1LPQ A;  4GYI A;  4IOC F;  5B66 C;  1WPK A;  3FHN A;  2JJ7 A;  4C2U A;  1ZH5 A;  2G7H A;  5DD8 A;  3QOP A;  2KJB A;  2IGK A;  4EGY A;  4HA8 A;  5DYM A;  2MH9 A;  2Q2E B;  4L5E A;  5DCM A;  1MBE A;  2M3A A;  4IO9 F;  1OR7 C;  5LGU A;  4IL6 C;  2DQR A;  5LGN A;  2NOG A;  2Y75 A;  3AFH A;  4B4C A;  2PJR A;  3H1C A;  1SMY F;  3PFI A;  2OBP A;  2RVC A;  3VYU B;  5JVG F;  5E17 F;  3BP8 A;  5ICG A;  4OOI A;  1DUX C;  4KIS A;  2DYR H;  2QZ8 A;  1DGW Y;  1MH3 A;  2VQC A;  4O5V A;  2JA8 J;  5DCM B;  1HW2 A;  2HQN A;  2R7X A;  3OIQ A;  3TP3 A;  4G94 A;  2DOA A;  1YHQ I;  4Z6Y A;  4FIS A;  4LOC A;  4KIC A;  1IV8 A;  3QYB A;  4V2G A;  3V42 A;  5LGT A;  1Z3X A;  3FXL A;  3CO6 C;  5D6E A;  3L2C A;  2VC1 A;  1EH8 A;  2PJR B;  4M3D A;  1FOY A;  4BBR J;  4KIG A;  4MTD A;  1PYV A;  4XSZ F;  5EDN A;  1LFU P;  5D6F A;  1QO0 D;  1NG6 A;  4BNC A;  3K6G A;  1X1D A;  4G7O F;  1ETQ A;  2BXZ A;  2FMY A;  3G71 I;  2N8G A;  4NC6 A;  1Y0N A;  1TT5 B;  3G1M A;  3LSJ A;  3G4S I;  1LKX A;  3COA C;  3KP3 A;  1RRJ A;  4KFC A;  2Y48 A;  3OSG A;  1UHS A;  2KIF A;  3RKY A;  2FJ1 A;  2EA4 A;  4PK4 A;  1ONV A;  4EVI A;  1Y39 A;  3ZQG A;  2PLY A;  2P7V B;  2QKL B;  4TV7 A;  4L9V A;  3IV5 A;  4HEA 2;  3E97 A;  2IJL A;  2K3F A;  4BE1 A;  3FXQ A;  3FMS A;  4HDV A;  3D5S C;  3ASO H;  1NTC A;  2CUJ A;  3WHC A;  2E1M C;  3J81 Z;  1GV5 A;  1LDK B;  1FOW A;  4FX0 A;  1IZ1 A;  3V7R A;  2GIV A;  4BJT A;  1TNS A;  4A0Z A;  3WTV C;  4XSX F;  1GLN A;  3M07 A;  4FE4 A;  5JFR A;  3F22 A;  2FML A;  4XLN F;  1RUO A;  2X0L A;  3JSP A;  1Y0U A;  3F9K A;  3HKZ A;  5ILV A;  1R71 A;  4HX7 A;  3GTM J;  4CUG A;  2LK2 A;  2QBY A;  4DZJ A;  2CO5 A;  1ZKG A;  5FLX Z;  1FOX A;  2ZO4 A;  1OQY A;  3EYY A;  3JRH A;  3JRI A;  2DA7 A;  2GXG A;  4JX4 A;  1O3S A;  1V54 H;  4NBQ A;  3R60 A;  1Z91 A;  2PMU A;  3AG3 H;  1JI8 A;  3ZQI A;  5FLM J;  2JVH A;  3BR0 A;  3R61 A;  4DIQ A;  3WOD F;  2K85 A;  4IHX A;  2A6H F;  4I76 A;  1FSH A;  3K4B A;  2DU9 A;  1YS6 A;  3HRM A;  1HXD A;  4HST A;  4XK4 A;  2CS3 A;  1I3Q J;  1QVU A;  5JHU A;  2V26 A;  3TMO A;  1UMQ A;  3DF8 A;  1V3F A;  3M9A A;  2QBY B;  1W5S A;  3PL8 A;  2ME0 A;  2TRT A;  3A1Y A;  4ZYH A;  2NVQ J;  4MLO A;  1POG A;  3DEE A;  3VWB A;  2ELJ A;  1D1A A;  3S1M J;  5KHD A;  1MJ9 A;  3D5L A;  3Q0V A;  2EFO A;  4A3F J;  3T5X A;  4BH9 A;  4UXN A;  1TC3 C;  3BJA A;  3RPU A;  1OJL A;  4A3E J;  2R7D A;  3DPT A;  5DCF A;  2DA5 A;  3ZMZ A;  2Y0M A;  2LF8 A;  1YIJ I;  3H5R A;  2KPM A;  1XMX A;  3LQR A;  3IKV A;  5FGM A;  1FMW A;  4XRS A;  3MKY B;  1PUF A;  1A6I A;  1JJ8 C;  5CYV A;  4HLX A;  3M4O J;  4JX5 A;  2O6G E;  3V8J A;  4C9Y A;  2XB0 X;  1MBJ A;  1XGO A;  1DU0 A;  3PO3 J;  2HZT A;  1VI0 A;  4F3Q A;  4WF2 A;  3W2V A;  5LEJ A;  2L3D A;  5J4V A;  3IWF A;  1P92 A;  2P5K A;  4M6V A;  4U88 A;  3GWZ A;  4B44 A;  1JKR C;  2F48 A;  5L3E A;  3K4N A;  3NAR A;  4YRV A;  4BBS J;  4Y4R A;  5ICE A;  1B72 A;  2OQR A;  4RAY A;  2FBH A;  5E3L A;  4DZP A;  5FKO A;  1WHU A;  2XRO A;  4BXF A;  2AHQ A;  4IX7 A;  4UUT A;  2IP2 A;  3I58 A;  4PCQ A;  2VPL A;  1MDM B;  1ZEL A;  3DPU A;  3T8T A;  1XN7 A;  5M3F J;  5CVJ A;  2YX7 A;  3FX3 A;  3E6M A;  3T1B A;  1R4M B;  2EV0 A;  1A04 A;  2KMU A;  3F8C A;  2ID6 A;  3A2K A;  3WGH A;  5D5U B;  4BDY A;  3ZMV A;  1W7P A;  2NXN B;  3S2D J;  2XKO A;  1ZG3 A;  2QLZ A;  1VQ4 I;  1W36 D;  1LE8 A;  2XIG A;  2MYS A;  2HFH A;  1T08 B;  3K1N A;  1OCT C;  1KQ9 A;  5FB2 A;  3ZN1 A;  5E18 F;  4A3M J;  3FWE A;  1WKM A;  4KJZ A;  3KEY A;  3Q0W A;  2VXZ A;  3OOP A;  1T39 A;  5EF6 A;  2A5Y B;  4ENK A;  4DYC A;  4A3D J;  1W7P B;  1UG2 A;  3H3Z A;  2Z9O A;  4BYY A;  3M8F A;  2VKH A;  3MZ8 A;  2QSF X;  4ZTJ A;  4I09 A;  5FRO A;  4BQO A;  1DPU A;  5IY5 H;  5J1U A;  3UKG A;  1LE8 B;  2WTE A;  2BE5 F;  3GTP J;  4XBF A;  3JRC A;  1STZ A;  2DDB A;  1G2H A;  2D2W A;  3I54 A;  4HOB A;  2V9V A;  2QKM B;  1Y56 A;  2M0M A;  4F91 B;  5TRD A;  1EJ9 A;  4ZDO A;  2RDP A;  4A5N A;  1U78 A;  1WI3 A;  1KYZ A;  3H0D A;  1JHH A;  4HF2 A;  1XDU A;  1BOB A;  2Z1D A;  2QQB A;  2MG4 A;  2GBY A;  4L5I A;  3P7N A;  3E5U A;  3RKX A;  2V6E A;  2FEZ A;  5F6F A;  5IPA A;  4J01 A;  2MD0 A;  2LH9 A;  4ENM A;  4P9U A;  2RV8 A;  4L0Y B;  2PN6 A;  3HDD A;  2XGX A;  4LB5 A;  3FMQ A;  1OCC H;  3ZRG A;  2OA4 A;  4MEY F;  2CQX A;  3M1C A;  2CQQ A;  2ZJQ F;  1WRJ A;  1UHW A;  3KP6 A;  1KON A;  2OTJ I;  3RSN A;  2XDV A;  4UNO A;  2YUS A;  1ZAR A;  4D9J A;  3G2B A;  4DBR A;  1LB2 A;  2E2I J;  4HQE A;  4J00 A;  2O8K A;  2BBY A;  2LVS A;  2KKO A;  2HPM A;  5GPA A;  3CD6 I;  2CQK A;  5GAD J;  2R7T A;  1MMS A;  2DPD A;  4U7B A;  3FXM A;  4NB5 A;  1XD7 A;  4AM3 A;  3ZQH A;  2HYG D;  3I0T A;  1LFB A;  2H09 A;  2K9Q A;  5DV5 A;  4BQN A;  2Y9Y A;  2V1D A;  2BV6 A;  3ULQ B;  2NVU B;  4LK1 F;  4HRI A;  2Y69 H;  2LF7 A;  3K70 D;  1FBQ A;  3ZMD A;  2HXO A;  2GA1 A;  2FD5 A;  2HYF A;  4BY7 J;  5D8L B;  4HNT A;  2BW3 A;  1X1B A;  3PSI A;  4DYQ A;  2DA4 A;  3AKZ A;  5K5O A;  2EIM H;  5E20 A;  5H2F C;  3ZGK A;  4O3M A;  4Y33 A;  2VUM J;  3OYC A;  3CO7 C;  2ZFW A;  4KN4 X;  4PGG A;  3RQ4 A;  3PUF A;  1LVK A;  3KET A;  2V1X A;  2JA2 A;  4UY8 I;  2OZ6 A;  3F8F A;  2DT5 A;  3QYF A;  3HYI A;  5FFZ A;  1SEU A;  1P4A A;  5FFX A;  2AQF A;  1PUE E;  1LFP A;  2BW3 B;  2XAU A;  4LG0 A;  3EQL F;  1BN5 A;  1GXP A;  3EUA A;  2YU3 A;  3GFL A;  3OYJ A;  2E35 A;  5HLH A;  3G6E I;  2H8W A;  4RAG A;  1D5V A;  2W24 A;  1LDJ A;  4EJT A;  1IO2 A;  2EZL A;  2RGV A;  3VSL A;  1ETY A;  1KYW A;  1T98 A;  2XB5 A;  3DCF A;  3NWT A;  4FAS D;  4LIU A;  4ZJZ A;  1N75 A;  3MKL A;  1AOY A;  4G7Z F;  2NS0 A;  2ME6 A;  2FUG 2;  3H5A A;  1WJE A;  1A6Q A;  3CF5 F;  4UUS A;  3L2V A;  1A5J A;  4PSW A;  2R5Y B;  4P96 A;  1HQC A;  3LSK A;  1SD6 A;  3K1M A;  5IT9 K;  3RQI A;  3JRF A;  1R5I D;  5DS9 A;  1SVM A;  3BG9 A;  4LLN A;  3L2R A;  4A0X A;  1FZP B;  1ETV A;  3BG3 A;  3SXY A;  5K7H A;  3VYR B;  4OIR F;  2J5O A;  1NH3 A;  1FIP A;  5A2Q K;  1I1G A;  3DTK A;  1YIO A;  3GFI A;  5EZH A;  2LRE A;  4XKW A;  3ZMT A;  3KP7 A;  1I27 A;  3S3O A;  4HG2 A;  1AKH A;  1TWH J;  2NRA C;  2VN2 A;  1R23 A;  1QA6 A;  4GDF A;  2DQL A;  2JPB A;  1TWA J;  3VB2 A;  2XV4 S;  2WV1 A;  4MFE A;  1J75 A;  5K7Z A;  3QP6 A;  3IWZ A;  1F9N A;  5IP7 J;  1FX7 A;  1HOM A;  2OU2 A;  3M8E A;  1ZTR A;  2QVO A;  2Z5U A;  3C2H A;  4IRH A;  4PJN A;  1RKT A;  4YII A;  2XAJ A;  3BTI A;  1AKH B;  1RPW A;  3AG4 H;  5LHI A;  1XGS A;  4BU2 A;  2BXY A;  4OAZ A;  2EFW A;  4UVA A;  3HTS B;  4IPA A;  1R5G A;  2YR2 A;  2XSJ C;  1DPR A;  3ABK H;  2EBI A;  2LR8 A;  1S3J A;  4D1Q A;  3Q0U A;  5HS7 A;  2EV6 A;  2JUG A;  3FXU A;  2D1V A;  3F21 A;  1MBF A;  2CFX A;  2LDU A;  2QSH X;  1ITY A;  1T56 A;  3TDZ C;  2ZXH A;  4E7J A;  1Z1D A;  1ZRD A;  3K10 A;  1SD5 A;  2CW0 F;  3L00 A;  2EFP A;  2VBW A;  2L7K A;  2DMN A;  3OL4 A;  4ZC3 A;  4E70 A;  5DTD A;  4EM2 A;  1OCP A;  3E6C C;  3MZH A;  3DKX A;  4NDL A;  2H1K A;  5F0F A;  4Z2Y A;  2F4M B;  4V2F A;  4BXU A;  3ZQF A;  2JSC A;  2E34 A;  2W25 A;  4L9N A;  3PO2 J;  4R8H A;  1RZ4 A;  2FBI A;  1W7P D;  3T8R A;  2M4K A;  2R7Z J;  4L5J A;  3FF5 A;  4JBA A;  2JRT A;  3FM3 A;  1P6R A;  1WQ2 A;  4ENN A;  5F0H A;  1PDN C;  2IW5 A;  2B63 J;  3MVP A;  4CH7 A;  1WVR A;  5JHF A;  5EG0 A;  4NUB A;  2GA2 A;  2YU9 J;  2OUM A;  1S7O A;  2A5W A;  1YRN B;  4IVN A;  3FIW A;  4LLG F;  1HST A;  3E1S A;  3J80 Z;  1JHF A;  2CW7 A;  5L3B A;  1FOK A;  3FHZ A;  3DEW A;  1P7I A;  4A69 C;  3LFU A;  4HF1 A;  3ABU A;  4PJJ A;  5HLI A;  4GFB A;  2P5L C;  2DOE A;  2JWT A;  1JTX A;  4MFD A;  2GOM A;  5D5X B;  2L01 A;  3HSE A;  4BS9 A;  3FKJ A;  2BHY A;  4I6Z A;  5BPD A;  3SYT A;  2ACJ A;  2XPV A;  4HNU A;  3CTA A;  4AWX B;  1MMD A;  2HS5 A;  4GCV A;  1Z77 A;  2EPF A;  3PIP F;  4U7D A;  1B1B A;  1TT0 A;  3OS1 A;  4I99 C;  2JUC A;  3WU2 C;  3CMY A;  4E7I A;  3RJP A;  4IKF A;  5K5R A;  2COB A;  1FEX A;  2Y2Z A;  4I02 A;  2IS1 A;  3H35 A;  4DBQ A;  3MKZ A;  2PFB A;  5K7F A;  3IL2 A;  4W97 A;  1T2K A;  1S72 I;  3GTQ J;  2GXB A;  1S7E A;  4X0G A;  3CDH A;  1R4N B;  4M3B A;  3GBG A;  2NVX J;  2M34 A;  4M6Y A;  2W85 A;  1LDD A;  2QF7 A;  3BG6 A;  3H5N A;  3JW4 A;  3MMY B;  2ZNY A;  3GXO A;  5B3S H;  4YFX F;  2W84 A;  1GV2 A;  3QWL A;  3TED A;  2LRD A;  4E4H A;  1KU7 A;  2UWM A;  1OFC X;  3LA7 A;  1IGN A;  2K9N A;  2LBF A;  4PZJ A;  2IVM A;  2NAZ A;  4XOP A;  5IT9 Z;  3BZK A;  1VQ7 I;  4XLP F;  1XSV A;  3A03 A;  2RAE A;  1JT0 A;  2NVT J;  3CLQ A;  5LFA A;  3S3M A;  4W1U A;  1TW2 A;  4I2O A;  4BE0 A;  3HOW J;  1BI2 A;  1U9O A;  4XON A;  2JA5 J;  3B02 A;  2P4W A;  4A3L J;  1ZRE A;  4EJO A;  1OLT A;  4C3J J;  4ZYG A;  2DA2 A;  4Y17 A;  3WTZ A;  4ITV A;  2DT7 B;  2LBF B;  2OJE D;  3QAH A;  2CV2 A;  2F5C A;  2XAG A;  1ETW A;  3BZ6 A;  2KIU A;  4RAF A;  5E8G A;  3KYL A;  1MNM C;  1APL C;  2ZC2 A;  3CUQ A;  3ISP A;  2CQN A;  3L2W A;  1SFO J;  3W2W A;  1T95 A;  2IBD A;  3H9Q A;  1TL8 A;  2HR3 A;  2VBZ A;  2TCT A;  2M87 A;  2JSP A;  3F8N A;  2F5V A;  1R1T A;  5LRR A;  5HLG A;  3D1N I;  4M9X A;  3E6D A;  3B6A A;  9ANT A;  4GRI A;  2CFO A;  1JUP A;  2ZKZ A;  3TW6 A;  2FX0 A;  2I8D A;  1U6G A;  4OMY A;  3GYH X;  3AG1 H;  2Q2E A;  3OYA A;  2R7O A;  1K78 B;  5E1W A;  3SFZ A;  2W1O A;  3CUQ B;  2UXX A;  4RS8 A;  2H94 A;  3Q5F A;  1J0R A;  1TQM A;  1BC8 C;  1JUS A;  4PGH A;  4BDZ A;  4UB6 C;  5D5V B;  3HOX J;  1Y8R B;  3CCM I;  2HPI A;  1OIS A;  3O8H A;  5J8F A;  3JRB A;  2HYJ A;  2FOW A;  1HKT A;  2GM4 A;  2I10 A;  3OMY A;  5J6X A;  1D0Z A;  3S3N A;  1ZYR F;  2E7W A;  5E3M A;  4L0Z B;  1GVJ A;  1XB4 A;  4M6X A;  2OCE A;  4P9F A;  2O3F A;  1IG7 A;  2HVR A;  3HM5 A;  3Q9V A;  5HNH A;  3WTT C;  2JK3 A;  2L7Z A;  4RB0 A;  2DI3 A;  2VE9 A;  6PAX A;  4CSW A;  1VND A;  4RB3 C;  1E17 A;  2MBF A;  2QYO A;  2KFD A;  2DCE A;  2VJJ A;  4FTH A;  2VJI A;  2DBB A;  4CCJ A;  3DKY A;  3H3V K;  2LLK A;  1MW7 A;  4UUV A;  4NNJ A;  3MFK A;  3S2H J;  4FCY A;  2Y30 A;  2HI3 A;  4UHT A;  3WGG A;  3HSR A;  3TO7 A;  3FZV A;  3J7Y J;  3H92 A;  4EJU A;  3BCA A;  5E8I A;  1F1Z A;  4A3G J;  2OCC H;  3OR1 C;  4A6D A;  3CC7 I;  1HW1 A;  1P9Q C;  2BYV E;  2RNJ A;  1R1U A;  1I3A A;  2E1O A;  2W82 A;  1O3Q A;  1V5G A;  5KAI C;  5FD6 A;  3OSF A;  1G8X A;  3JSO A;  1YW9 A;  1KGS A;  2IA1 A;  4M73 A;  3L2Q A;  1FJL A;  1Z7L A;  3E3V A;  3BY6 A;  2E1N A;  2EZK A;  3W3C A;  2X1D A;  1K4S A;  4BQA A;  1PVE A;  4D5C A;  1F5T A;  5IOY A;  2DMQ A;  2HTJ A;  2X51 A;  4KN7 X;  2EIK H;  2FQ4 A;  1DU6 A;  1IN6 A;  1U0J A;  2LMD A;  3JRE A;  2K27 A;  3PM1 A;  1P7J A;  3BZC A;  1XGM A;  3BR6 A;  1N25 A;  4M71 A;  5CQE A;  4MQ9 F;  3AL0 B;  2DYS H;  1X19 A;  4RB1 A;  2XRN A;  3LWF A;  5HDN A;  1G3Y A;  3HRS A;  2VQG A;  4XID A;  2G0E A;  4XLE A;  2GXA A;  3SEQ A;  1XCV A;  3CME I;  2A3S A;  1LJ9 A;  4XN3 A;  2K9M A;  2XAH A;  2DK8 A;  1FC3 A;  1ORK A;  3LOC A;  1F43 A;  2IT0 A;  3OWT A;  4ESF A;  5L3F A;  2MLK A;  2JVG A;  1JKO C;  4BHP A;  5CLS A;  5E3N A;  1BJA A;  3HHH A;  2ESN A;  3VEP A;  1K7A A;  2E60 A;  4MIM A;  3CDI A;  4IHV A;  3G1O A;  3GW2 A;  2M8E A;  5EEH A;  1VQO I;  2PBI A;  3DEU A;  4I98 B;  3WTX C;  1GDT A;  4HX8 A;  2F4O B;  2ZSH B;  4WX9 A;  1MBG A;  2W7N A;  1YJ9 I;  3Q3S A;  2ID3 A;  3IC7 A;  1ZR4 A;  2EZH A;  3ZXS A;  2R7U A;  4XKC A;  1MSF C;  4DGW B;  4BAC A;  4XKB A;  1V5E A;  3I9V 2;  5DD4 A;  4LIT A;  2BVL A;  4BHB A;  5M5X J;  2K40 A;  3CQZ J;  5F04 A;  1W1W E;  5IYB J;  4CYD A;  2RQQ A;  2W57 A;  3ZP5 A;  1YJW I;  4ZZL A;  3BTL A;  4ZYE A;  2XGC A;  1IXS B;  3IHU A;  5DM6 F;  3W6J B;  1LQ1 A;  4N0B A;  1DQU A;  5ILS A;  1A31 A;  4RLF A;  2LSO A;  4RDU A;  2IS6 A;  5M5W J;  2A07 F;  2K9L A;  5J3L A;  2M45 A;  5KNL A;  3G73 A;  1Q1V A;  3P9I A;  4IRI A;  2KJC A;  4O6J A;  2L2O A;  1MDM A;  3W6K B;  4OU0 A;  5EEG A;  4YIR X;  2WB1 N;  1H9T A;  3F6V A;  4HSR A;  2L7F P;  3HZJ A;  3S1R J;  2OAZ A;  5J40 A;  3OYF A;  4ON0 A;  2LYC A;  4AU7 A;  1FYK A;  4G9Y A;  1U5T B;  3PQJ A;  4M3F A;  1BC7 C;  5GP9 A;  5FKL A;  3KIO A;  3ZPL A;  1YOV B;  1J5Y A;  2VPR A;  1Z6T A;  2LY1 A;  3H9G A;  2A68 F;  2MH2 A;  2P6S A;  1R58 A;  1O4X A;  4M3E A;  2QQ9 A;  3NAU A;  2PMH A;  2ZSI B;  3CCL I;  4HAM A;  1TWF J;  3BWG A;  3ZQL A;  3M8J A;  2OPT A;  2ZJ2 A;  3QRF F;  1UB9 A;  4QWQ A;  1BR4 A;  5IYD J;  4HF0 A;  1BM9 A;  4WCG A;  1JJ6 C;  3OYI A;  2HQR A;  4CCM A;  3F8B A;  2K7L A;  1D1B A;  3DBR B;  1YIT I;  2K4B A;  3BTJ A;  4CZC A;  1GUU A;  2DA6 A;  2HQA A;  4KUM A;  4DYR A;  1HSJ A;  4ZDL A;  3HJE A;  3W2A A;  4L18 B;  3GZ6 A;  5BQT A;  3I4M J;  1I50 J;  3GFM A;  3O8G A;  4L9T A;  1FP1 D;  2X9D A;  4RB2 C;  5JR3 A;  1JTY A;  1J7K A;  5F1R A;  2LD5 A;  2V1U A;  2LKS A;  2LY9 A;  4NC7 A;  3JTH A;  3HRT A;  2CGP A;  3BTC A;  1ENH A;  3IKT A;  3UNG C;  1X4O A;  3S15 J;  2IA2 A;  3R0J A;  4YFK F;  3WGI A;  1SC7 A;  4BQQ A;  1AHD P;  3CC2 I;  3VSK A;  1WI9 A;  3LST A;  3K4J A;  1QVT A;  1EA3 A;  3OYM A;  1MZB A;  1M1E B;  2Y31 A;  1WJC A;  2KZG A;  1AU7 A;  4KT5 C;  2E5N A;  2XF6 A;  1IXC A;  5K5Q A;  2ZXW H;  2MAB A;  3FBN B;  4IHW A;  3D5R C;  3OYE A;  1I6H J;  1X3Z B;  3HEF A;  1G6N A;  3PSF A;  1JE8 A;  3CLO A;  5EZG A;  1JUM A;  1XG1 A;  2MFZ A;  3EDP A;  1CF7 B;  2VL8 A;  4IHS A;  4LK0 F;  3FK6 A;  1TNT A;  3GLL A;  2VOO A;  3I4N J;  4D0P A;  3G1L A;  5HS9 A;  4KT6 A;  2R5Z A;  5BMZ A;  5DEQ A;  1O7F A;  4AVP A;  3S93 A;  2PMZ A;  4J19 A;  1FYL A;  2VT2 A;  5DM7 F;  2EH3 A;  3A0H C;  3GVA A;  3PUB A;  4ZZD A;  3K9T A;  5DUK A;  4XLA A;  2JPC A;  1WZ2 A;  3LSH A;  4FT8 A;  2E1C A;  2VKV A;  5E1Z B;  3VFZ A;  4C2M J;  2EQR A;  3K70 C;  1O3R A;  3HIF A;  1BW6 A;  4ZYA A;  2XAQ A;  3FXR A;  5J1R A;  4B8X A;  1IRZ A;  4ETS A;  3S1Q J;  1T38 A;  2R5Z B;  3TQN A;  4AUX A;  5CKT A;  3WU1 B;  4Y3O A;  3KZZ A;  4ENJ A;  1WSU A;  2HDC A;  3JRG A;  3AL0 C;  1MBK A;  1FTZ A;  2F5E A;  3KYD B;  2L02 A;  5ILU A;  2WAF A;  4BGD A;  4UVB A;  2JA6 J;  2HXI A;  5HDG A;  4A0Y A;  1ZG5 A;  2XUB A;  2KL4 A;  1S9H A;  3TBI A;  3QPT A;  1EV7 A;  3KLO A;  2ELH A;  4BJ5 C;  2RQP A;  1QQI A;  2B0L A;  2QQA A;  5ERI A;  3QPH A;  3U1K A;  2HWV A;  3P9C A;  1X1P A;  1IN4 A;  1FIA A;  4HW0 A;  2XAF A;  2AXT C;  2E2H J;  2X6W A;  2FQ3 A;  2NS7 A;  2YSR A;  5GTI C;  2AO9 A;  3U2R A;  2HOA A;  2L4M A;  3CDL A;  2UZK A;  5C4J J;  1D0X A;  2IXS A;  1OYY A;  2CWE A;  2K5C A;  3DQV C;  1XDS A;  4DQ2 A;  2R5Y A;  2Z33 A;  3IAM 2;  1XC5 A;  3M3Y J;  3HC7 A;  2MSY A;  2JTV A;  2EZI A;  2L4A A;  3DU6 A;  3QPS A;  1FLI A;  3ZMS A;  3HBL A;  1IN7 A;  4B43 A;  3E5X A;  4Q4Z F;  2CW8 A;  4QIW N;  2VC0 A;  1UFM A;  3R6S A;  1ON1 A;  3KPH A;  3WTU C;  1VQ9 I;  4HQM A;  5EYR A;  2HOT A;  3MD2 A;  1IDZ A;  3LQQ A;  1SAN A;  3H36 A;  1KQ0 A;  4HYE A;  4NC8 A;  3QOE A;  3ESW B;  2FRH A;  4BUP A;  1QNT A;  3BDD A;  1R9T J;  2EWN A;  5FKN A;  4FX4 A;  1DP7 P;  3FXK A;  4OWR B;  2EV5 A;  2O03 A;  3CCV I;  4QTR A;  1I39 A;  1SVO A;  2JQ7 A;  1SD4 A;  4BEH A;  4A5M A;  2IS2 A;  1Y6I A;  2QM3 A;  3GTG J;  2BEO A;  3O3K A;  1F4K A;  3GEZ A;  3GTK J;  2X6O A;  4LLL A;  2J5P A;  3CCR I;  3ONQ A;  3PNT A;  1JGS A;  1I5Z A;  2Z2S B;  3ERM A;  3MQ0 A;  1ACI A;  4BXX J;  1R5H A;  1TBX A;  2M7B A;  1D8J A;  4ASN A;  2EIL H;  4S04 A;  4HLY A;  1TP4 A;  1QHH D;  4BJ6 C;  4QPQ A;  1Z3Y A;  4BEH B;  4BHC A;  2KRF A;  5H6Q A;  2V4J C;  1FTT A;  2W4S A;  1EH7 A;  4PJM A;  2XC7 A;  1MMA A;  3FKI J;  1E0E A;  2R93 J;  2KQR A;  2HVQ A;  2FF4 A;  4MO7 A;  1RR7 A;  2P5V A;  3NEU A;  4Y7N J;  1D8K A;  1W5T A;  2ECC A;  3B6C A;  4XRF A;  3NWS A;  5FLV A;  3OYB A;  1U9N A;  4X6A J;  2KRC A;  3RDI A;  4M3G A;  3HXL A;  4KMF A;  5AON A;  1MJB A;  3HOU J;  4YEL A;  2IS4 A;  1TW3 A;  3RKQ A;  3F6O A;  1YE9 A;  4EEF G;  2ZXI A;  4XRM A;  3I4P A;  3J7A O;  1K6Y A;  1H0M A;  2BY2 A;  2HDW A;  1FWZ A;  1SFK A;  1SMT A;  4XR6 A;  3S16 J;  3RZD J;  4G12 A;  3WE3 A;  2JZY A;  2UV1 A;  3F8M A;  2X6Y A;  3FDY A;  2O0Y A;  1VFC A;  2HEO A;  3KEO A;  5KVR A;  3ZCO A;  2P8T A;  2VJ4 A;  1YX5 A;  4WXH A;  4CA0 A;  3BQY A;  2D1H A;  3MAJ A;  1BIA A;  1O57 A;  4H4K C;  1ETO A;  2R7Q A;  4RGR A;  5JLW A;  1VQ5 I;  3QPL A;  5C3E J;  4A2U A;  2A05 A;  3CJR B;  4XM3 A;  4KIF A;  3W6V A;  5LLQ A;  1OKR A;  1J59 A;  2IGO A;  1YW7 A;  2DO7 A;  1FMV A;  1IJW C;  1YRN A;  3RIR A;  2XF7 A;  4B09 A;  4D7N A;  5F1J A;  3JRD A;  2V9K A;  1IUF A;  1CQT A;  5BPI A;  4WXD A;  3CCQ I;  1D1C A;  3J7A Y;  2GWR A;  4AID A;  4GGG A;  2OD5 A;  5TJJ A;  2OTL I;  2L7M P;  4IHT A;  4KDP A;  3SQN A;  4CZZ A;  3ABT A;  3BJ6 A;  3EPZ A;  2H27 A;  2QQ8 A;  2CU7 A;  3K1P A;  4UV8 A;  2ZXJ A;  3O2P E;  1U8B A;  1JT6 A;  5ICC A;  3FMR A;  1QRY A;  4A3K J;  2XHK A;  3HUG A;  1XMK A;  3NQO A;  2OZU A;  3QP5 A;  4YG2 F;  4FHT A;  3FK7 A;  2Z16 A;  4XL9 A;  2H6B A;  4PJL A;  3HG9 A;  3CCU I;  3GZ5 A;  1YYV A;  2BY0 A;  1WJ5 A;  2DA3 A;  3DP7 A;  4LGW A;  1E3O C;  3I59 B;  4CGZ A;  3E0J B;  4CO8 A;  1ZRC A;  3IH2 A;  1R22 A;  2LNB A;  1DGR M;  3KZI C;  4LIV A;  2X48 A;  1IV6 A;  3BG5 A;  1IDY A;  2R7F A;  2GQQ A;  3O6B B;  2WAQ A;  2DPU A;  3EYI A;  3HUG B;  2NVY J;  3V8K A;  2WY7 Q;  4HDU A;  1YI2 I;  2O61 A;  5FKK A;  3HOT A;  1QPM A;  3FXO A;  5J4Y A;  2VBX A;  5D8K B;  3ZOB A;  1LUJ B;  4KA4 A;  1K4T A;  3OIP A;  3M1E A;  2TDX A;  2E1M B;  2F5F A;  2AS5 F;  2RKH A;  3KP2 A;  2RN7 A;  2LTP A;  4RGU A;  3RKW A;  2M0C A;  2DJN A;  2YPR A;  3PNY A;  3GTJ J;  2UUZ A;  1B59 A;  1UCR A;  2ZNZ A;  1SD7 A;  4N9I A;  3RYP A;  2L9V A;  2R4G A;  1R7J A;  4XNF A;  2R7W A;  1UAA A;  2DFI A;  2P0W A;  3I5U A;  1F36 A;  1VQN I;  4II2 A;  2DXI A;  3VPR A;  3WTW C;  3QU3 A;  4PJ0 C;  4BY1 J;  3SZP A;  1ZLK A;  4LJZ F;  3ROU A;  2CJJ A;  2CYY A;  3HGY A;  1X1A A;  3IRR A;  2KDO A;  3OIO A;  4N9H A;  2M8G X;  5JVT A;  1ZGW A;  3E6B A;  4G6Q A;  2KLO A;  3F3X A;  1W0U A;  2HZD A;  1VF9 A;  3K4M A;  3K2A A;  3F23 A;  2MLG A;  3BR5 A;  5GAE J;  5A2Q Z;  3ZMU A;  2FNA A;  4ABZ A;  3MCZ A;  2YS9 A;  3GCM A;  2DDA A;  2QA4 I;  3HGG A;  5IP9 J;  2LP0 A;  1OPC A;  2V9P A;  3L2U A;  1T33 A;  1BR1 A;  4D7M A;  4WK8 F;  2PJP A;  3GLX A;  1J2X A;  4GYG A;  3RYR A;  5E79 C;  4L9J A;  1HDD C;  1ZK8 A;  3ZR8 X;  3OR2 C;  2L9S A;  2QEX I;  3F0C A;  1BI0 A;  1K78 A;  2VAS A;  5H20 A;  4AC0 A;  1Q1H A;  1BIB A;  4D5F A;  3IH4 A;  2P7C B;  5M5Y J;  2JT1 A;  2JMW A;  2BZT A;  4A12 A;  4JQF A;  3NRV A;  3A01 B;  4JK1 X;  4CYC A;  3K4C A;  3S32 A;  2E7X A;  1MH4 A;  3I55 I;  2E5Z A;  2IEK A;  4IJA A;  5K1Y A;  2VXD A;  2WC2 A;  4AIJ A;  1A36 A;  1XTA A;  1MMN A;  3R4K A;  2VB6 A;  2ZCW A;  1WCM J;  2M2E A;  3WTS C;  1UHM A;  1IUY A;  2RNG A;  5CQG A;  1R6R A;  1ZHF A;  1VQM I;  3KP5 A;  1OMI A;  1REP C;  2CV1 A;  3E7L A;  3RZO J;  2G7U A;  1PJR A;  2HKO A;  4CYC B;  2A61 A;  2KIQ A;  2GZW A;  2A6T A;  1MKM A;  3LSM A;  4OIO F;  2LKP A;  3K7A J;  1K61 A;  3VYS B;  2E19 A;  3N05 A;  5E1X A;  1D5Y A;  2DFF A;  5LHG A;  1BI1 A;  4Y13 A;  4BL0 B;  1AWC A;  2DT6 A;  1W4M A;  3VDX A;  2WV0 A;  3K69 A;  2B9S A;  2F4I A;  2HNH A;  1R36 A;  1X4P A;  4I0A A;  1MNE A;  5LD2 C;  3V7S A; 
#chains in the Genus database with same CATH homology
 3DV8 A;  4LB6 B;  4NQW A;  3N4M A;  1ON2 A;  1TTY A;  3C18 A;  4WWC A;  1GXQ A;  1ZGA A;  1FBS A;  5H6R A;  3DKW A;  3KEQ A;  2K02 A;  1K79 A;  3WG9 A;  2VOD A;  1SAX A;  3KCC A;  1YQA A;  2G9W A;  3GUD A;  4Y15 A;  3D0S A;  1YO5 C;  1L3L A;  1NHA A;  2XKP A;  4CXF A;  1P2F A;  1U3E M;  2V79 A;  1IN8 A;  1WWX A;  1ZAO A;  1HKQ A;  4I7H A;  2ZBK A;  1XSD A;  1TLH B;  3ML6 A;  1IXR C;  4M9Z A;  2STW A;  5LEK A;  3HOS A;  1FNN A;  2VT3 A;  1U2W A;  4IF4 A;  4EQQ A;  2M1B A;  3GX4 X;  3OV8 A;  2RC4 A;  5ED4 A;  2K4J A;  1LEB A;  2C6Y A;  1QZZ A;  2F2E A;  1TQI A;  4YFN F;  1YG2 A;  1IN5 A;  2MC3 A;  2VOP A;  1FSE A;  4G8X A;  2FBK A;  2XVC A;  5CVR A;  5AIP A;  4PDK A;  3V8L A;  4Q5S F;  2DW4 A;  1G3W A;  3HHG A;  1MJA A;  1LEA A;  4U0Y A;  3JTG A;  2FSW A;  2O8X A;  5BOX A;  3BJO A;  3RPQ A;  4MTE A;  3I64 A;  1J9I A;  3SHF A;  2X4H A;  3B73 A;  3REO A;  2EB7 A;  3S2W A;  4KYW A;  1GHC A;  1PP8 F;  2FOK A;  3TO6 A;  4OIP F;  3TOA A;  2CSO A;  4F7Z A;  3RI4 A;  1U5T A;  4M74 A;  1ZGJ A;  4I01 A;  1YFH A;  3PQK A;  3SZT A;  1PP7 U;  1IAW A;  4LFU A;  4HX4 A;  5L3C A;  3BPV A;  1P4X A;  1S7A A;  1FBU A;  3LA3 A;  2OQG A;  4UVC A;  3P9K A;  2ZME A;  4Q48 A;  2PEX A;  2A69 F;  4KMU X;  1R1V A;  2YX4 A;  1FPQ A;  3TOB A;  2QEN A;  3CUQ C;  2V6C A;  4KNY A;  4K2E A;  4M72 A;  4BAY A;  1ZRF A;  1LVA A;  2ZME B;  3H3U A;  3GF2 A;  1ODD A;  3C3W A;  2PI0 A;  2A6E F;  2STT A;  2ESH A;  4MGR A;  1E2X A;  2M5W A;  3KFW X;  4EGZ A;  1OYI A;  1ZLJ A;  2Q0O A;  1XGN A;  4IRG A;  4HV5 A;  2UXN A;  3LAJ A;  4GO1 A;  3ECH A;  1FY7 A;  3I53 A;  4CIC A;  3K2Z A;  1CF7 A;  1L0O C;  4HBL A;  4YIF A;  4KIB A;  3MWM A;  2MD5 A;  3TDU C;  3AAF A;  1T6S A;  1YW8 A;  2ISY A;  3LAP A;  4EV0 A;  1S29 A;  2CG4 A;  4OIQ F;  4NHJ A;  1UST A;  1QGP A;  4G6D A;  2R3S A;  1G3S A;  1R00 A;  2IPQ X;  2EFQ A;  4Q47 A;  4RAZ A;  1T0F A;  5HS8 A;  2HOE A;  2FNP A;  5AIQ A;  4P5O A;  3FM5 A;  5CVU A;  5D5W B;  1RIO H;  2KIM A;  3BPX A;  1FT9 A;  3VOD A;  1ULY A;  3HTU A;  3KE2 A;  4CDG A;  1I6X A;  5HOO A;  2EK5 A;  1XCB A;  3IRQ A;  4MEX F;  2PG4 A;  1EH6 A;  2AXL A;  1Z6R A;  3KP4 A;  2HTS A;  3LA2 A;  3GO5 A;  4ESB A;  1D3Y A;  3RTR A;  3EUH A;  4MQV A;  1VTN C;  2PQ8 A;  3J80 K;  2P6T A;  2Z3Y A;  2DK5 A;  2Q8K A;  3L09 A;  4WXC A;  2FA5 A;  1RNL A;  5LBQ A;  4CHU A;  4LD5 A;  1BBY A;  4RGS A;  4G7H F;  5LHH A;  1IRF A;  4R1H A;  5IT3 A;  1G3T A;  2GAU A;  3KLN A;  1S6L A;  2VE8 A;  3HRU A;  1TQP A;  4RGX A;  4DNC A;  1B9N A;  5BS6 A;  4HZF A;  3CJN A;  3U9G A;  3MEX A;  4EMS A;  1I1S A;  1JXS A;  1KU2 A;  4GXO A;  5D4S A;  5LRS A;  4LMY A;  4EJV A;  3WU0 A;  1K6O A;  1KA8 A;  4P55 A;  4LG0 B;  5JI6 A;  3BOQ A;  1U5T C;  4OMZ A;  2EFN A;  3KZY A;  2IA0 A;  1H9G A;  1FYM A;  4U0V A;  1HKS A;  5L3D A;  2WWY A;  5J8C A;  4AIK A;  3DPL C;  5HVQ C;  1FP2 A;  1XMA A;  2NYX A;  3L9F A;  1OR7 A;  3GFJ A;  3EET A;  3JAM K;  1O7L A;  4IXA A;  3BRO A;  2D45 A;  2DLL A;  1HBX G;  1SFX A;  1CGP A;  3M7G A;  1S8N A;  5DDG A;  2K86 A;  2FXA A;  4M9S A;  2L54 A;  4MNU A;  3TO9 A;  5FO5 A;  3WE2 A;  5KK1 A;  4A6E A;  3V7C A;  3MZY A;  5CVI A;  2M30 A;  2EJR A;  1QZY A;  3ERE D;  3I59 A;  1O3T A;  4U0W A;  3ZQ7 A;  4OIN F;  2ISZ A;  1RUN A;  2HKX A;  2NNN A;  3TKY A;  1XSX A;  2ETH A;  4R79 A;  2DTR A;  3WTY C;  1B9M A;  1X3U A;  1U8R A;  1IRG A;  1YLF A;  1BOA A;  3T0Y A;  3K0L A;  1QBJ A;  1RI7 A;  3N97 A;  1B4A A;  3L7W A;  1SFE A;  3ELK A;  4MHG A;  1G4D A;  2IRF G;  5L3G A;  4EJW A;  1Z9C A;  2H6C A;  2BGC A;  3VOE A;  3U1D A;  1USS A;  3E5Q A;  3F72 A;  5DUI A;  2VON A;  3C1D A;  3C7J A;  4AIH A;  5CVV A;  4S05 A;  2NNY A;  1LNW A;  3V4G A;  3J81 K;  3DXJ F;  4EM0 B;  1Z7U A;  5FD5 A;  4I0B A;  3G3Z A;  3QU6 A;  1SFU A;  2QWW A;  3R0A A;  5FLX K;  5CJ9 A;  1MGT A;  1MD0 A;  4HV6 A;  1Z05 A;  2QUF A;  4H0E A;  1P4W A;  3HSF A;  1YS7 A;  3CUO A;  1HW5 A;  1DDN A;  2MA3 A;  5D4R A;  2FU4 A;  4AD9 A;  1B6A A;  3ECO A;  3TGN A;  4EM1 A;  1IF1 A;  4UV9 A;  1YTY A;  1ZN2 A;  1OYW A;  3LFK A;  3JAM Z;  1ZG1 A;  2FE3 A;  1KQ8 A;  1V4R A;  3Q9S A;  2Z99 A;  2EA2 A;  2COM A;  5HDK A;  1C0W A;  3ZN0 A;  2F5D A;  4ESJ A;  4ZYD A;  1BI3 A;  1KU9 A;  5ICF A;  2VBY A;  5F64 A;  2DAO A;  4QLC U;  2ADU A;  1KU3 A;  1IW7 F;  4ZH4 F;  2XAS A;  3DFG A;  2HGC A;  3I71 A;  4GYI A;  1ZH5 A;  2G7H A;  5DD8 A;  3QOP A;  2KJB A;  4EGY A;  4HA8 A;  5DYM A;  2MH9 A;  5DCM A;  5LGU A;  2DQR A;  5LGN A;  2Y75 A;  1SMY F;  3PFI A;  2OBP A;  2RVC A;  5E17 F;  3BP8 A;  5ICG A;  4OOI A;  1DUX C;  2QZ8 A;  4O5V A;  5DCM B;  1HW2 A;  2HQN A;  4G94 A;  4KIC A;  5LGT A;  3CO6 C;  5D6E A;  3L2C A;  2VC1 A;  1EH8 A;  4KIG A;  4MTD A;  4XSZ F;  5D6F A;  1QO0 D;  4BNC A;  4G7O F;  2FMY A;  3COA C;  3KP3 A;  4KFC A;  2Y48 A;  2KIF A;  3RKY A;  2EA4 A;  4EVI A;  1ONV A;  2PLY A;  2P7V B;  4TV7 A;  4L9V A;  3E97 A;  2IJL A;  3FXQ A;  3FMS A;  4HDV A;  3J81 Z;  1LDK B;  4FX0 A;  1IZ1 A;  3V7R A;  2GIV A;  1TNS A;  4A0Z A;  3WTV C;  4XSX F;  5JFR A;  3F22 A;  2FML A;  4XLN F;  1RUO A;  2X0L A;  3JSP A;  1Y0U A;  5ILV A;  4HX7 A;  2QBY A;  2CO5 A;  5FLX Z;  2ZO4 A;  3EYY A;  2GXG A;  1O3S A;  3R60 A;  1Z91 A;  2PMU A;  3R61 A;  3WOD F;  2A6H F;  1FSH A;  2DU9 A;  1YS6 A;  3HRM A;  1HXD A;  5JHU A;  3DF8 A;  1V3F A;  3M9A A;  2QBY B;  1W5S A;  4ZYH A;  1MJ9 A;  3D5L A;  2EFO A;  3T5X A;  4BH9 A;  4UXN A;  3BJA A;  3RPU A;  2R7D A;  3DPT A;  5DCF A;  3ZMZ A;  2Y0M A;  2LF8 A;  3LQR A;  3IKV A;  5FGM A;  5CYV A;  4HLX A;  2O6G E;  3V8J A;  1XGO A;  2HZT A;  4WF2 A;  5LEJ A;  2L3D A;  3IWF A;  1P92 A;  2P5K A;  4U88 A;  3GWZ A;  5L3E A;  5ICE A;  2OQR A;  4RAY A;  2FBH A;  2XRO A;  2IP2 A;  3I58 A;  4PCQ A;  1MDM B;  3T8T A;  1XN7 A;  5CVJ A;  2YX7 A;  3FX3 A;  3E6M A;  3T1B A;  2EV0 A;  1A04 A;  3F8C A;  3WGH A;  5D5U B;  3ZMV A;  1W7P A;  2XKO A;  1ZG3 A;  2QLZ A;  2XIG A;  2HFH A;  3K1N A;  1KQ9 A;  5FB2 A;  3ZN1 A;  5E18 F;  3FWE A;  1WKM A;  2VXZ A;  3OOP A;  1T39 A;  2A5Y B;  4ENK A;  1W7P B;  3H3Z A;  2Z9O A;  4BYY A;  3M8F A;  4I09 A;  1DPU A;  2WTE A;  2BE5 F;  4XBF A;  1STZ A;  2D2W A;  3I54 A;  4HOB A;  2V9V A;  5TRD A;  2RDP A;  4A5N A;  1U78 A;  1KYZ A;  1JHH A;  4HF2 A;  1XDU A;  2QQB A;  4L5I A;  3P7N A;  3E5U A;  3RKX A;  2FEZ A;  5F6F A;  4ENM A;  4P9U A;  2RV8 A;  4L0Y B;  2PN6 A;  2XGX A;  4LB5 A;  3FMQ A;  2OA4 A;  4MEY F;  1WRJ A;  1UHW A;  3KP6 A;  4UNO A;  1ZAR A;  1LB2 A;  4HQE A;  2BBY A;  2KKO A;  2CQK A;  2DPD A;  4U7B A;  4NB5 A;  1XD7 A;  2HYG D;  3I0T A;  2H09 A;  5DV5 A;  2V1D A;  2BV6 A;  3ULQ B;  4LK1 F;  2LF7 A;  1FBQ A;  3ZMD A;  2GA1 A;  2HYF A;  5D8L B;  5K5O A;  5E20 A;  4O3M A;  3CO7 C;  2ZFW A;  4KN4 X;  4PGG A;  3KET A;  2V1X A;  2OZ6 A;  3F8F A;  2DT5 A;  3HYI A;  5FFZ A;  1P4A A;  5FFX A;  1PUE E;  4LG0 A;  3EQL F;  1BN5 A;  1GXP A;  2YU3 A;  3GFL A;  5HLH A;  1D5V A;  2W24 A;  1LDJ A;  4EJT A;  2RGV A;  1KYW A;  1T98 A;  1AOY A;  4G7Z F;  2NS0 A;  4P96 A;  1HQC A;  1SD6 A;  3K1M A;  5IT9 K;  4LLN A;  4A0X A;  1FZP B;  3SXY A;  4OIR F;  2J5O A;  5A2Q K;  1I1G A;  1YIO A;  3GFI A;  3ZMT A;  3KP7 A;  1I27 A;  2NRA C;  2VN2 A;  1R23 A;  2DQL A;  2JPB A;  3VB2 A;  2XV4 S;  1J75 A;  3QP6 A;  3IWZ A;  1F9N A;  1FX7 A;  2OU2 A;  3M8E A;  2QVO A;  2Z5U A;  4IRH A;  4YII A;  2XAJ A;  5LHI A;  1XGS A;  2EFW A;  4UVA A;  3HTS B;  4IPA A;  1R5G A;  2YR2 A;  1DPR A;  1S3J A;  5HS7 A;  2EV6 A;  3FXU A;  2D1V A;  3F21 A;  2CFX A;  2LDU A;  3TDZ C;  1Z1D A;  1ZRD A;  1SD5 A;  2CW0 F;  3L00 A;  2EFP A;  2VBW A;  4E70 A;  4EM2 A;  3E6C C;  3MZH A;  4Z2Y A;  4BXU A;  2JSC A;  2W25 A;  4L9N A;  4R8H A;  1RZ4 A;  2FBI A;  1W7P D;  3T8R A;  4L5J A;  3FF5 A;  4JBA A;  2JRT A;  3FM3 A;  1P6R A;  1WQ2 A;  4ENN A;  1PDN C;  2IW5 A;  2GA2 A;  1S7O A;  4IVN A;  4LLG F;  1HST A;  3J80 Z;  1JHF A;  5L3B A;  1FOK A;  3FHZ A;  4HF1 A;  3ABU A;  5HLI A;  2P5L C;  5D5X B;  2L01 A;  3HSE A;  5BPD A;  2ACJ A;  3CTA A;  4AWX B;  2HS5 A;  4GCV A;  4U7D A;  1B1B A;  3RJP A;  5K5R A;  4I02 A;  2PFB A;  3IL2 A;  1T2K A;  2GXB A;  3CDH A;  4M6Y A;  2W85 A;  1LDD A;  3JW4 A;  2ZNY A;  3GXO A;  4YFX F;  2W84 A;  1KU7 A;  2UWM A;  3LA7 A;  4PZJ A;  2IVM A;  2NAZ A;  5IT9 Z;  4XLP F;  1XSV A;  1TW2 A;  4I2O A;  1BI2 A;  3B02 A;  2P4W A;  1ZRE A;  4EJO A;  4ZYG A;  4Y17 A;  3WTZ A;  3QAH A;  2F5C A;  2XAG A;  3BZ6 A;  2KIU A;  5E8G A;  3CUQ A;  3ISP A;  2HR3 A;  2VBZ A;  2M87 A;  3F8N A;  1R1T A;  5LRR A;  5HLG A;  4M9X A;  3E6D A;  2ZKZ A;  1U6G A;  4OMY A;  3GYH X;  2Q2E A;  1K78 B;  5E1W A;  3SFZ A;  3CUQ B;  2UXX A;  4RS8 A;  2H94 A;  3Q5F A;  1J0R A;  1TQM A;  1BC8 C;  4PGH A;  5D5V B;  5J8F A;  1HKT A;  5J6X A;  1ZYR F;  2E7W A;  4L0Z B;  1GVJ A;  1XB4 A;  4M6X A;  4P9F A;  2O3F A;  3WTT C;  3Q9V A;  4RB0 A;  2DI3 A;  2VE9 A;  6PAX A;  4RB3 C;  1E17 A;  2MBF A;  2QYO A;  2DBB A;  4UUV A;  3MFK A;  4UHT A;  3WGG A;  3HSR A;  3TO7 A;  3FZV A;  3H92 A;  4EJU A;  5E8I A;  1F1Z A;  4A6D A;  2BYV E;  1HW1 A;  2RNJ A;  1R1U A;  1O3Q A;  5FD6 A;  3JSO A;  1YW9 A;  1KGS A;  2IA1 A;  4M73 A;  3E3V A;  3BY6 A;  2E1N A;  4BQA A;  1F5T A;  2HTJ A;  4KN7 X;  1IN6 A;  2K27 A;  1XGM A;  4M71 A;  4MQ9 F;  4RB1 A;  2XRN A;  3LWF A;  5HDN A;  1G3Y A;  3HRS A;  1XCV A;  2A3S A;  1LJ9 A;  2XAH A;  2DK8 A;  1FC3 A;  2IT0 A;  4ESF A;  5L3F A;  2MLK A;  4BHP A;  5CLS A;  1BJA A;  3HHH A;  2ESN A;  3VEP A;  1K7A A;  3GW2 A;  2M8E A;  5EEH A;  2PBI A;  3DEU A;  4I98 B;  3WTX C;  4HX8 A;  4WX9 A;  3IC7 A;  4BHB A;  5DD4 A;  4CYD A;  2W57 A;  3ZP5 A;  4ZZL A;  4ZYE A;  1IXS B;  3IHU A;  3W6J B;  1LQ1 A;  4N0B A;  5ILS A;  2LSO A;  2A07 F;  2M45 A;  3G73 A;  3P9I A;  4IRI A;  2KJC A;  4O6J A;  1MDM A;  3W6K B;  5EEG A;  4OU0 A;  1H9T A;  3F6V A;  2OAZ A;  4ON0 A;  1FYK A;  4G9Y A;  1U5T B;  3PQJ A;  1BC7 C;  3ZPL A;  1J5Y A;  1Z6T A;  2A68 F;  2MH2 A;  2P6S A;  1R58 A;  2QQ9 A;  2PMH A;  4HAM A;  3BWG A;  3QRF F;  2ZJ2 A;  1UB9 A;  4QWQ A;  4HF0 A;  1BM9 A;  4WCG A;  2HQR A;  3F8B A;  2K7L A;  2K4B A;  4KUM A;  1HSJ A;  4L18 B;  3GZ6 A;  5BQT A;  3GFM A;  4L9T A;  1FP1 D;  4RB2 C;  5JR3 A;  1J7K A;  5F1R A;  2V1U A;  3JTH A;  3HRT A;  2CGP A;  3IKT A;  2IA2 A;  3R0J A;  4YFK F;  3WGI A;  1WI9 A;  3LST A;  1MZB A;  4KT5 C;  1IXC A;  5K5Q A;  1G6N A;  1JE8 A;  3CLO A;  3EDP A;  1CF7 B;  4IHS A;  4LK0 F;  1TNT A;  2VOO A;  4D0P A;  5HS9 A;  5BMZ A;  5DEQ A;  1O7F A;  4AVP A;  1FYL A;  2VT2 A;  3GVA A;  4ZZD A;  3K9T A;  5DUK A;  2JPC A;  4FT8 A;  2E1C A;  5E1Z B;  3VFZ A;  1O3R A;  3HIF A;  2XAQ A;  3FXR A;  4B8X A;  4ETS A;  1T38 A;  3TQN A;  3WU1 B;  4ENJ A;  3KZZ A;  1WSU A;  2HDC A;  2F5E A;  2L02 A;  5ILU A;  4UVB A;  5HDG A;  1ZG5 A;  4A0Y A;  2XUB A;  3QPT A;  1EV7 A;  3KLO A;  2ELH A;  2RQP A;  1QQI A;  2B0L A;  2QQA A;  5ERI A;  3QPH A;  2HWV A;  3P9C A;  1IN4 A;  4HW0 A;  2XAF A;  2FQ3 A;  2YSR A;  3U2R A;  2L4M A;  2UZK A;  1OYY A;  2CWE A;  3DQV C;  1XDS A;  4DQ2 A;  2Z33 A;  2JTV A;  2L4A A;  1FLI A;  3ZMS A;  1IN7 A;  3E5X A;  4Q4Z F;  2VC0 A;  1UFM A;  3R6S A;  1ON1 A;  3WTU C;  4HQM A;  3LQQ A;  1KQ0 A;  4HYE A;  2FRH A;  1QNT A;  3BDD A;  1DP7 P;  2EWN A;  4FX4 A;  2EV5 A;  2O03 A;  1SD4 A;  4A5M A;  2QM3 A;  2BEO A;  3O3K A;  1F4K A;  3GEZ A;  4LLL A;  2J5P A;  1JGS A;  1I5Z A;  3MQ0 A;  1R5H A;  1TBX A;  1D8J A;  4ASN A;  4S04 A;  4HLY A;  4BHC A;  2KRF A;  5H6Q A;  1EH7 A;  2FF4 A;  2P5V A;  3NEU A;  1D8K A;  1W5T A;  4XRF A;  3RDI A;  4KMF A;  5AON A;  1MJB A;  1TW3 A;  3F6O A;  3I4P A;  3J7A O;  1H0M A;  1FWZ A;  1SMT A;  3WE3 A;  2JZY A;  3F8M A;  2O0Y A;  2HEO A;  3KEO A;  5KVR A;  2P8T A;  4WXH A;  2D1H A;  3MAJ A;  1BIA A;  1O57 A;  4RGR A;  4A2U A;  4KIF A;  5LLQ A;  1OKR A;  1J59 A;  1YW7 A;  2DO7 A;  3RIR A;  4B09 A;  5BPI A;  4WXD A;  2GWR A;  4GGG A;  2OD5 A;  5TJJ A;  4IHT A;  4KDP A;  3SQN A;  4CZZ A;  3ABT A;  3BJ6 A;  2H27 A;  3K1P A;  4UV8 A;  2ZXJ A;  3O2P E;  5ICC A;  3FMR A;  2XHK A;  3HUG A;  1XMK A;  3NQO A;  2OZU A;  3QP5 A;  4YG2 F;  4FHT A;  2H6B A;  3GZ5 A;  1YYV A;  3DP7 A;  4LGW A;  3I59 B;  4CGZ A;  4CO8 A;  1ZRC A;  1R22 A;  2LNB A;  2R7F A;  2GQQ A;  3O6B B;  2DPU A;  3EYI A;  4HDU A;  3V8K A;  2O61 A;  3HOT A;  1QPM A;  2VBX A;  5D8K B;  4KA4 A;  3M1E A;  2TDX A;  2F5F A;  2AS5 F;  2RKH A;  3KP2 A;  2RN7 A;  4RGU A;  3RKW A;  2YPR A;  1B59 A;  1UCR A;  2ZNZ A;  1SD7 A;  4N9I A;  3RYP A;  1R7J A;  2DFI A;  3I5U A;  3WTW C;  3QU3 A;  3SZP A;  1ZLK A;  4LJZ F;  3ROU A;  2CYY A;  3IRR A;  4N9H A;  5JVT A;  3E6B A;  4G6Q A;  3F3X A;  3F23 A;  2MLG A;  5A2Q Z;  3ZMU A;  2FNA A;  3MCZ A;  1OPC A;  4WK8 F;  2PJP A;  3GLX A;  1J2X A;  4GYG A;  3RYR A;  4L9J A;  1BI0 A;  1K78 A;  5H20 A;  1Q1H A;  1BIB A;  2P7C B;  2JT1 A;  4A12 A;  4JQF A;  3NRV A;  4JK1 X;  2E7X A;  4IJA A;  5K1Y A;  2WC2 A;  4AIJ A;  3R4K A;  2ZCW A;  3WTS C;  1UHM A;  1IUY A;  1ZHF A;  3KP5 A;  1OMI A;  1REP C;  2G7U A;  2HKO A;  2A61 A;  2GZW A;  1MKM A;  4OIO F;  2LKP A;  5E1X A;  5LHG A;  1BI1 A;  4Y13 A;  1AWC A;  1W4M A;  2WV0 A;  3K69 A;  1R36 A;  4I0A A;  3V7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...