1J75A

Crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
NLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system/dna
molecule keywords 5'-D(*TP*CP*GP*CP*GP*CP*G)-3'
publication title Structure of the DLM-1-Z-DNA complex reveals a conserved family of Z-DNA-binding proteins.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j75A00
3TQNA 4HF2A 2RV8A 2EA2A 5D4RA 3JSOA 3K0LA 2O61A 3FWEA 5LLQA 4CO8A 2XAQA 1WQ2A 3T0YA 3HRMA 2ZCWA 4EJVA 2F5FA 4UVAA 2FNPA 4N9IA 1GHCA 3VOEA 5CVRA 3LAPA 3R4KA 2XIGA 3RDIA 1HKQA 4I7HA 3M9AA 4ZYEA 2IRFG 2PMUA 2O3FA 2ZXJA 2RN7A 4G7ZF 3BZ6A 3LA3A 3RPUA 5J6XA 3HSFA 1B9NA 2OZUA 3P9CA 4BQAA 4HQEA 3GZ6A 2J5OA 2NRAC 4KA4A 2NS0A 1FBQA 3WGGA 4AD9A 4G7OF 2HS5A 1IF1A 1FBUA 3R6SA 3ECOA 1BIAA 1W5SA 2VC1A 4WX9A 1FSEA 4CHUA 2PLYA 1USSA 2HYFA 1T38A 4M9SA 5JR3A 4Y17A 1LNWA 1F5TA 5DYMA 3LQQA 4ZYGA 5L3FA 2MH9A 3O3KA 4CZZA 1B9MA 4MTDA 2OU2A 2EV6A 2RKHA 3L09A 3C7JA 3KETA 1SMTA 4UXNA 3T5XA 3DFGA 1K78A 1FYLA 5D5WB 1QO0D 1EH6A 3BJAA 2UZKA 4UVCA 1SFUA 4R1HA 3J7AO 2MLKA 1CF7B 3FHZA 3MZHA 4MTEA 2MD5A 2HEOA 3BPVA 5ILUA 3RYPA 1YO5C 5LRRA 1ON2A 1U8RA 4A0ZA 4ZZDA 2JPCA 4U0VA 4L18B 2FNAA 4XSXF 3ZP5A 3PQKA 4WWCA 3I71A 3M8EA 4OIOF 5JFRA 2F2EA 2EJRA 4RB0A 3WGHA 1S29A 1IN8A 4S04A 5E18F 1XMAA 3ZPLA 3W6JB 4E70A 2VT3A 3B02A 3GFJA 2A68F 1JE8A 1DPRA 1PP7U 4ZH4F 1R36A 2GWRA 1YFHA 1JXSA 5DUIA 1ZRDA 3DQVC 4RB3C 1T6SA 1SD4A 1P4XA 4ESJA 5DCMA 2L4MA 1R1VA 5H6QA 3F22A 4I09A 2VC0A 4I01A 1SD5A 1UB9A 1FX7A 1XB4A 3H3UA 1FOKA 1IAWA 2V1XA 4EVIA 4BYYA 3W6KB 4HF1A 1LVAA 4YFKF 3G73A 3KFWX 3FX3A 4KMUX 3QP6A 3AAFA 3F6VA 2KJBA 4U88A 3BOQA 1IN5A 3RJPA 4BHCA 1KQ9A 3F8BA 3E6BA 5E1XA 2M1BA 2V1DA 2Z3YA 2CSOA 3ZMDA 5BOXA 3J80Z 3TOAA 1HW2A 1V4RA 3BROA 2XASA 1IW7F 2OZ6A 4L5JA 4P96A 4FX0A 1G3SA 3IKVA 4G94A 1SFXA 3K69A 3ABUA 1MJ9A 3S2WA 2D1VA 3QRFF 2VBYA 5DV5A 3RI4A 1W7PD 1U3EM 1FLIA 1K78B 3J80K 5J8CA 1DUXC 2GZWA 3ZMZA 1LEBA 3E6DA 4R8HA 3DPTA 2CW0F 1HSTA 2HWVA 2Z99A 5BS6A 1BI2A 2IVMA 4I02A 1XSVA 4Q5SF 4UHTA 1D3YA 3EETA 2ZFWA 4AIHA 4JK1X 1YIOA 2FBIA 4HV5A 1ZYRF 4G6DA 3TKYA 5E17F 3BJOA 4M9XA 4G7HF 1Z1DA 3R60A 1PP8F 2GAUA 4EMSA 2P7CB 2UXNA 2LSOA 3LQRA 1SAXA 3B73A 1ZG1A 1KYZA 5D5UB 4NQWA 3KCCA 4RB2C 3BJ6A 2CGPA 2H09A 3HSRA 1RZ4A 5ICCA 1FC3A 1S7OA 1FWZA 4OMYA 1ONVA 2PG4A 1R00A 1FY7A 5DCMB 4EJOA 2DPUA 2A6HF 1D5VA 4L9TA 2RVCA 3R0AA 2RNJA 3SQNA 2HQNA 4EJTA 2Y75A 4Z2YA 1S8NA 1KU2A 2ESNA 1EH7A 1YQAA 2CO5A 2JTVA 5HS7A 1HSJA 3LA2A 1UFMA 1ON1A 4XBFA 1IZ1A 2LF7A 3PFIA 1RUNA 3GXOA 2UXXA 4HLXA 4WCGA 3H3ZA 3L9FA 2DQRA 5HLGA 1FYKA 1B59A 3FMRA 1O3TA 2PN6A 1GVJA 1R5GA 1PDNC 2NNYA 2RDPA 2VBXA 3ZN1A 2ZMEA 3EYYA 2E1CA 5KVRA 2C6YA 4IPAA 2QUFA 2EV0A 1P4WA 1K79A 4AIJA 2EK5A 4OIRF 4EM0B 3GF2A 5CYVA 3F8CA 3L00A 2QM3A 1XGOA 3V7SA 1XMKA 5K5RA 3VEPA 2V6CA 4MQVA 3NQOA 2TDXA 3Q9SA 3K1PA 4CDGA 4N9HA 2HOEA 5L3CA 1TW2A 3GWZA 1S7AA 1J59A 1UCRA 1XSDA 1FBSA 2P8TA 3K1MA 4HZFA 4RGXA 4B8XA 5HLIA 1ZRCA 1ZAOA 4IJAA 4ESBA 2P4WA 1BBYA 1P6RA 2ESHA 1U2WA 3ABTA 2M30A 2K4BA 5AIQA 5EEGA 1L0OC 5IT3A 1Z6TA 3E97A 2BE5F 2HR3A 2P6TA 2L02A 5E1ZB 3T1BA 1S3JA 4R79A 3LFKA 4OOIA 4EGYA 1S6LA 5HDGA 3MQ0A 2K27A 3HSEA 5LRSA 3R61A 4MGRA 3EYIA 5JHUA 4KIBA 2XGXA 4EQQA 4L9JA 1LDKB 3GVAA 3R0JA 5AIPA 1EV7A 3FM3A 3E6MA 1YLFA 1KU9A 3BPXA 1DDNA 3N97A 1HW5A 3V8LA 4LK0F 2D1HA 1H9GA 4HA8A 2K86A 2E7XA 4A0XA 3LA7A 1OR7A 1BI1A 4P9UA 1T2KA 5CVIA 4PGGA 3WODF 1J0RA 2P5LC 4DQ2A 2L3DA 3C1DA 1ZGJA 2CFXA 5JVTA 2D2WA 5FD5A 2WC2A 1YG2A 2F5CA 3MWMA 4L0ZB 1FPQA 4P5OA 1O7FA 4I0AA 1B4AA 3HTUA 1W7PA 1ZG5A 1STZA 2XAFA 1HQCA 3GX4X 4M6XA 1QGPA 2ISZA 3MCZA 3WTUC 5HS9A 4L5IA 5FFXA 3CUOA 1ZGAA 1G3WA 1QZZA 3FZVA 3QOPA 1MJAA 2STWA 1YS7A 1Z05A 4YG2F 2ZMEB 5AONA 2ZJ2A 1QBJA 2FEZA 4IRHA 5L3DA 2HTSA 4OIPF 4EGZA 5KK1A 4HV6A 2XROA 4WK8F 1R22A 2STTA 4MEYF 4A2UA 1TTYA 5LHHA 1DPUA 2EWNA 1DP7P 4LB5A 3I0TA 2KIFA 3CTAA 3P9KA 4A5MA 5LGUA 1UHWA 1WRJA 1ZN2A 5K1YA 2EV5A 4EM1A 2RGVA 3K9TA 2EFNA 4Q48A 2RQPA 2JRTA 4LJZF 1NHAA 2EFWA 5CVVA 4Q47A 1I27A 1RNLA 1K7AA 4D0PA 2ZO4A 1J9IA 2A5YB 2R7FA 4ESFA 4FHTA 4HOBA 3RIRA 1B1BA 2DT5A 4FT8A 3WTVC 4JBAA 4KDPA 2FU4A 1G4DA 2M5WA 4L9NA 4LB6B 2OQGA 3PQJA 2XUBA 5DD4A 3F21A 2DBBA 4XLNF 2O6GE 1XCBA 3LAJA 4RGRA 4MEXF 4HX4A 5D8KB 3O2PE 5F64A 5L3EA 2HGCA 2A3SA 2R3SA 3GW2A 4G9YA 2O0YA 5FB2A 1LB2A 3TOBA 1BI3A 2VOPA 5CVJA 2FA5A 4YIFA 4HW0A 6PAXA 3KE2A 1IN7A 3HRUA 4L0YB 2DQLA 3SXYA 1BOAA 2QENA 3QP5A 3KP2A 3KP3A 1MKMA 3SFZA 4K2EA 2Z5UA 2X4HA 2IW5A 2YU3A 3FF5A 3RKXA 3DXJF 1E17A 3VB2A 4HLYA 2ETHA 3ZMUA 3I58A 2K02A 1FNNA 3MEXA 2XAJA 2VN2A 1W7PB 3T8RA 3COAC 3NRVA 2YR2A 3CO7C 1BI0A 3I64A 2HFHA 4CYDA 3TGNA 1B6AA 4QLCU 3ZMVA 4HDVA 1TLHB 1USTA 5BPIA 1MDMA 1ZG3A 4KFCA 3IKTA 2E7WA 1IRFA 2EFQA 1QZYA 4GXOA 2DAOA 3D5LA 1Z6RA 2YSRA 4A6DA 2FQ3A 2MC3A 5L3GA 1TNSA 4RB1A 4TV7A 2ZNZA 1ZH5A 1V3FA 5K5QA 1WWXA 1ULYA 4AIKA 5EEHA 4UNOA 3E5QA 3F8MA 1FP1D 4N0BA 1W5TA 3O6BB 1EH8A 2MLGA 2GQQA 1U5TA 2CG4A 1G3YA 2PQ8A 3IWZA 1J7KA 4ASNA 4XRFA 4G8XA 4KYWA 4GGGA 4P9FA 2OD5A 5HS8A 3EUHA 2QVOA 1XD7A 1RIOH 5FGMA 3EDPA 3KP4A 1RI7A 1XCVA 3F8FA 2JT1A 5LEKA 3KZZA 2QLZA 4M73A 3TDZC 2OBPA 4OU0A 1LEAA 2O8XA 2Y0MA 2OAZA 2QZ8A 2YPRA 1J2XA 1AOYA 1BC8C 1P2FA 2FSWA 2VE9A 5CVUA 1O7LA 2DU9A 5LGNA 2KIMA 5D4SA 4A0YA 1ZLJA 2QQBA 1OYIA 4ZYHA 3IL2A 3WTZA 3P9IA 2W57A 4KIFA 1I5ZA 1O57A 4EJUA 1ODDA 1XN7A 3E5XA 2DI3A 4Q4ZF 3V7RA 4XLPF 3L2CA 3GUDA 3MFKA 1LDJA 4UV8A 5FLXZ 3F72A 5DCFA 5BQTA 2WWYA 4OIQF 2XHKA 2IP2A 2HYGD 1G3TA 3IWFA 4LLLA 1H9TA 3REOA 4DNCA 2DK8A 4U0WA 4UVBA 5JI6A 1ZLKA 2V9VA 3JSPA 1O3SA 1G6NA 1SFEA 3KP7A 1J5YA 4YFXF 3CUQC 2AS5F 1U6GA 1X3UA 4RGUA 4OMZA 4Y13A 5FLXK 2XAGA 1MDMB 1JHHA 3Q9VA 4LK1F 1WI9A 1YYVA 2LNBA 5D5XB 1REPC 1R5HA 3HIFA 4GO1A 4I0BA 1OYYA 4YFNF 4Y15A 2F5EA 1J75A 3E3VA 2H6CA 5J8FA 1T98A 2KIUA 2L54A 3ISPA 4IRGA 3TO6A 5DEQA 1T39A 3NEUA 2IT0A 3CJNA 3WTYC 4A6EA 5FO5A 1KA8A 4LMYA 4HYEA 5DDGA 4WXHA 1O3QA 2CWEA 3JTGA 3RTRA 3LSTA 3ERED 4HAMA 5E1WA 2FOKA 3V8KA 4BHBA 2W84A 1U5TB 3WTSC 3SZPA 5A2QK 3EQLF 1TBXA 4O6JA 2DLLA 3P7NA 2KKOA 2XAHA 4KT5C 4HBLA 5F6FA 3V7CA 3E6CC 3JW4A 4U7DA 2Z33A 2BV6A 1XGNA 2G9WA 2M45A 3KEOA 4LG0A 3BY6A 3GO5A 5HDKA 5HLHA 2ZNYA 1IXCA 1U5TC 4RGSA 3IRQA 1BN5A 3FXRA 4EV0A 4LGWA 3GZ5A 1OYWA 1T0FA 2P7VB 5CJ9A 3CO6C 2FXAA 2HZTA 5LEJA 4M6YA 2Q0OA 1Q1HA 4YIIA 3U2RA 5ILSA 1MZBA 5HDNA 3I59A 1UHMA 3G3ZA 3KEQA 4I2OA 1H0MA 4PCQA 2PBIA 2M87A 1Z91A 4G6QA 4MQ9F 2CQKA 1RUOA 1R1UA 2QQ9A 1U78A 4HX8A 3ZMSA 3GFMA 3U9GA 3HRSA 1BC7C 1Z9CA 5ED4A 2PFBA 4HDUA 4ENNA 2OA4A 1VTNC 4KNYA 1OPCA 4O3MA 1XDUA 3QPTA 5BPDA 3DF8A 2QQAA 1IUYA 2RC4A 2IPQX 3HRTA 3CDHA 1XSXA 1I1GA 2ADUA 4IF4A 2QWWA 5E8GA 2VE8A 1QPMA 2KJCA 1OKRA 3V8JA 1BM9A 3F8NA 2W25A 4ENMA 4L9VA 1L3LA 3I5UA 5K5OA 2HKOA 2IA0A 4GYIA 4KICA 2J5PA 3MAJA 3HHHA 1MGTA 1D8KA 1F4KA 1I1SA 3WGIA 4ZZLA 2BYVE 2V79A 5D6EA 4CICA 5E20A 5ILVA 4F7ZA 2WTEA 4QWQA 4P55A 2P5VA 3WU0A 4MHGA 3K2ZA 4LLNA 5TJJA 3HUGA 2ISYA 4M74A 4B09A 3ULQB 1TQPA 1R1TA 2PEXA 3OOPA 4LG0B 3K1NA 4PZJA 2FMLA 2O03A 3I54A 3KP6A 1ZHFA 2YX7A 2VT2A 4GYGA 2KRFA 5D5VB 4UV9A 3BWGA 1R58A 4RAYA 2DTRA 2V1UA 4EM2A 5H6RA 3KLNA 2Q2EA 5DD8A 5HVQC 2B0LA 1O3RA 1FZPB 4O5VA 5ICFA 2GA1A 1IN4A 1YW7A 4GCVA 4BAYA 5D8LB 3HTSB 3I59B 1F9NA 2ZKZA 3GFIA 1KQ8A 4M9ZA 3TDUC 1ZRFA 2Z9OA 3JAMZ 4KN7X 2LF8A 3TO7A 2H6BA 1YW8A 3FMSA 2P6SA 1MJBA 1KQ0A 4KN4X 2FRHA 4WF2A 2JSCA 3M8FA 2A61A 2DFIA 1LQ1A 2IA2A 3M1EA 3WG9A 4CXFA 2VBWA 2HKXA 1IRGA 3KLOA 3JAMK 4A12A 2UWMA 3I53A 1TQMA 5LHIA 1XGSA 1D8JA 1AWCA 4I98B 3IRRA 2NAZA 2VODA 1IXRC 3HOTA 3BDDA 5L3BA 5ERIA 1ZREA 3CUQA 1HW1A 2HQRA 2VXZA 1GXPA 2HTJA 2JPBA 1PUEE 2VBZA 2X0LA 5FFZA 2IA1A 2P5KA 3V4GA 2R7DA 4OINF 3MZYA 2IJLA 4PGHA 1Z7UA 1CGPA 2NNNA 2YX4A 1P4AA 3JTHA 2MA3A 4ETSA 3ELKA 4KIGA 2LKPA 3SHFA 2VONA 1P92A 1K6OA 3KP5A 4LD5A 5ICGA 4U0YA 4IHTA 3DPLC 1WSUA 5BMZA 3F3XA 2XV4S 4IHSA 2XVCA 2L4AA 2LDUA 3QAHA 1A04A 1WKMA 2A69F 2L01A 3WE3A 1R23A 4IRIA 2PMHA 3ROUA 1FP2A 4U7BA 2EA4A 3KZYA 2QBYA 3RPQA 2M8EA 4RS8A 1KYWA 4WXCA 3TO9A 2EFPA 2NYXA 1TW3A 4WXDA 3OV8A 3I4PA 3F23A 4BH9A 3DEUA 2MH2A 2ACJA 3M7GA 1HKTA 2AXLA 1HXDA 1JGSA 4LFUA 2OQRA 2EB7A 3ZN0A 2CYYA 1FSHA 2HDCA 1TNTA 3WTWC 5LBQA 3GFLA 1Y0UA 3GYHX 1BIBA 2WV0A 1YS6A 1LJ9A 4ON0A 1QNTA 1YW9A 2XKOA 1W4MA 3DP7A 4M71A 1HKSA 3E5UA 3FXUA 4M72A 3J81Z 5IT9Z 1SMYF 4HQMA 1XGMA 2BBYA 4S05A 2Q8KA 2D45A 3LWFA 5FD6A 2GIVA 1I6XA 4UUVA 3CUQB 4EJWA 3VODA 2GA2A 5HOOA 3SZTA 2A07F 2FBHA 3HYIA 3Q5FA 3J81K 3U1DA 5IT9K 1TQIA 1C0WA 3WTXC 3HOSA 2FE3A 4ZYDA 3IC7A 1E2XA 4BHPA 5TRDA 2A6EF 2H27A 4BXUA 2W24A 2GXBA 1BJAA 5DUKA 4KUMA 3IHUA 4MNUA 4BNCA 1OMIA 4ENJA 3GEZA 1KGSA 4PDKA 5E8IA 3WE2A 3C3WA 1ZARA 3QU3A 2K4JA 4FX4A 4NHJA 3VFZA 2DW4A 5A2QZ 5CLSA 1HBXG 3RKWA 4IXAA 1FT9A 3L7WA 5F1RA 3QU6A 2H94A 2XRNA 3BP8A 3GLXA 3F6OA 1R7JA 1MD0A 4IVNA 2MBFA 4AVPA 2Y48A 2QBYB 4ENKA 4XSZF 4JQFA 4RAZA 1F1ZA 2DPDA 4H0EA 2QYOA 2JZYA 2VOOA 3T8TA 3RYRA 1KU3A 2ELHA 2COMA 3FMQA 2GXGA 1LDDA 3FXQA 4AWXB 4A5NA 2FBKA 1KU7A 1QQIA 3ECHA 3DKWA 1SD7A 2DO7A 2FF4A 4KMFA 3DV8A 4LLGF 3C18A 2PJPA 2ZBKA 2XKPA 3HHGA 3ZQ7A 5H20A 1IXSB 3ML6A 3FM5A 1IN6A 1JHFA 1SD6A 3WU1B 3H92A 2G7UA 2FMYA 2EFOA 3WTTC 1YTYA 4NB5A 2DK5A 2F5DA 1CF7A 1FYMA 2PI0A 1GXQA 5ICEA 2BEOA 3N4MA 2G7HA 4HX7A 4CGZA 3RKYA 1XDSA 4HF0A 3D0SA 5D6FA 2K7LA 3QPHA 2BGCA 5LGTA 3CLOA 2E1NA 5LHGA 3ZMTA 2W85A
chains in the Genus database with same CATH superfamily
3TQNA 4HF2A 3BR6A 2RV8A 5IOZA 2JRMA 2WAQA 2EA2A 5D4RA 2M4KA 2CV0A 1G2HA 3JSOA 4UUTA 3K0LA 2O61A 1E0EA 3FWEA 2XF7A 4BXXJ 2Y31A 5LLQA 4CO8A 3RCOA 4B44A 3CCSI 1ZR4A 3WHBA 2XAQA 2XB0X 2WY8Q 4C2MJ 2X9DA 4CA0A 1WQ2A 2IAIA 3TBIA 3VPRA 3T0YA 1EKEA 3PIOF 2XRLA 3HRMA 3A01A 2O7OA 2Y0SN 2ZCWA 4EJVA 1UG0A 1D1AA 1X3WB 2F5FA 4UVAA 2DOEA 2DA3A 2FNPA 1TWHJ 4N9IA 4Y3OA 1GHCA 3VOEA 4AYBN 5CVRA 3LAPA 4IL6C 3R4KA 2VIXA 4A3BJ 2XIGA 4C3JJ 3RDIA 1YX3A 1HKQA 4I7HA 4BE0A 3M9AA 4ZYEA 3M3YJ 3S17J 2CUJA 2IRFG 2PMUA 2WV1A 3H0DA 2X51A 2QEXI 2O3FA 1S5LC 2ZXJA 2RN7A 4G7ZF 1ZGWA 3IUOA 3BZ6A 3LA3A 3RPUA 4PUSA 5J6XA 3PNTA 5EJCA 1X3ZB 3HSFA 2DJNA 2CFOA 1B9NA 3ZQQA 2OZUA 3P9CA 4BQAA 4HQEA 2ECCA 2CU7A 3GZ6A 2WADA 2J5OA 3DTEA 2K85A 2FJ1A 1YOVB 3IH4A 4KA4A 2NRAC 3U1KA 2NS0A 2NVXJ 1FBQA 1B72A 1MBKA 3WGGA 4AD9A 3S3MA 4G7OF 4XORA 2HS5A 4MO7A 3MKLA 1IF1A 1FBUA 4DOZA 3R6SA 3ECOA 1BIAA 1W5SA 2VC1A 4IKFA 1I39A 1U0JA 2KT0A 4WX9A 1A5JA 1FSEA 2LG4A 3K10A 4CHUA 2Y9YA 2YU9J 2PLYA 5HODA 2LYCA 1FIPA 1USSA 2HYFA 1MMSA 1T38A 4M9SA 2DA1A 5JR3A 1Y1WJ 2R0QC 1AU7A 4Y17A 1LNWA 1F5TA 5DYMA 3LQQA 3BG7A 2MSYA 4ZYGA 5L3FA 1Y0NA 2DMPA 2Y30A 2ZMEC 1ZTRA 2R7WA 2MH9A 5GTHC 2CV2A 4BS9A 2HQAA 2NVTJ 1T08B 3O3KA 4M3BA 4BBSJ 4CZZA 4PSXA 4A3KJ 2K9NA 1Y8RB 3OYHA 2IS6A 1B9MA 4MTDA 2OU2A 3CCYA 2EV6A 1NK3P 2RKHA 3L09A 3C7JA 3O8GA 3KETA 1SMTA 3S16J 4PJNA 2E5NA 4UXNA 3T5XA 3DFGA 1K78A 1FYLA 3LSPA 4W97A 5D5WB 1QO0D 1EH6A 3BTIA 3BJAA 2EZIA 2M3AA 4UVCA 1KZHA 2UZKA 4A3CJ 4ZC3A 2M7BA 3A0BC 1SFUA 4R1HA 3J7AO 3ABKH 4E7LA 2MLKA 4AM3A 1LE8B 3HKZA 1CF7B 4BY1J 3FHZA 1PUFB 3CC7I 1LFBA 3MZHA 4MTEA 2LY1A 3OS2A 2MD5A 1R6RA 3SDBA 2HEOA 3PUBA 3BPVA 2HDDA 5ILUA 1OCOH 3OSFA 3RYPA 1YO5C 5LRRA 1ON2A 5EGOA 3DCFA 1SFOJ 1U8RA 2VKEA 4A0ZA 1B8IA 4ZZDA 1AKHB 2R7TA 4DYQA 2JPCA 4U0VA 1V5EA 2LVSA 4L18B 2FNAA 3LSRA 2OF7A 4XSXF 3JCUC 2CUFA 2R7VA 3ZP5A 3PQKA 4WWCA 3I71A 4D9JA 5HLTA 3JRGA 3M8EA 1VQ7I 4OIOF 5JFRA 2F2EA 2EJRA 4RB0A 2V4JC 3WGHA 1UELB 1S29A 2VQCA 3LOCA 1IN8A 1T56A 3VDXA 1XTAA 4MLOA 4S04A 5E18F 2R93J 1XMAA 3ZPLA 4PJLA 3W6JB 4E70A 2VT3A 3B02A 3GFJA 2A68F 1JE8A 4IQJA 1DPRA 1P7JA 1PP7U 4ZH4F 1W36C 1R36A 1WGXA 3A01B 4RM2A 2GWRA 1YFHA 4W1UA 1JXSA 3H35A 1IV6A 5DUIA 1ZRDA 3DQVC 1YITI 4RB3C 3BTLA 4FASD 1T6SA 1SD4A 1P7IA 4AVZA 1P4XA 4S0HB 1OCPA 3IV5A 3ZRGA 4ESJA 4B1RA 5DCMA 2L4MA 2TRTA 1R1VA 5H6QA 3F22A 4I09A 1OJLA 1JT0A 3KYLA 2VC0A 4I01A 3OSGA 4QSHA 2EBIA 1SD5A 3CJRB 1UB9A 3QYFA 1FX7A 1XB4A 3S32A 1WJBA 3H3UA 4BE1A 1FOKA 1IAWA 1OR7C 2JSPA 2V1XA 4EVIA 4NC7A 4BYYA 2VQHA 3W6KB 2JA7J 4HF1A 1XG1A 1LVAA 3SJMA 5EZHA 3GBGA 2B9SA 4YFKF 3G73A 3KFWX 1IO2A 2ELJA 1MBFA 3FX3A 5J4VA 4HNUA 3VSKA 2QKMB 4KMUX 1B72B 3QP6A 3AAFA 4CCOA 3F6VA 2KJBA 5B1AH 3DU6A 4U88A 3HKZN 3BOQA 2BOLA 1IN5A 3FXKA 5C4JJ 4E7IA 3ZQHA 3H3VK 3RJPA 4BHCA 1KQ9A 3BR3A 3F8BA 3E6BA 3LSHA 2M1BA 5E1XA 2V1DA 3Q0VA 4GRIA 4C2UA 2Z3YA 3OL3A 1HF0A 2CSOA 3ZMDA 3HOZJ 1R49A 3CCMI 1VQOI 2WB1A 1MSFC 2Y9ZA 4OAYA 4NNJA 5BOXA 3J80Z 2FQ4A 3TOAA 1AA7A 1V4RA 2F4IA 1HW2A 2AO9A 3BROA 1D1CA 1IW7F 2KISA 2OZ6A 2VQLA 2XASA 3OR1C 4L5JA 4P96A 4FX0A 1G3SA 2I10A 2CMPA 3N05A 3IKVA 4P1WA 4G94A 2YUSA 3ZQCA 2HVQA 4XRSA 1SFXA 3K69A 4XKVA 1RPWA 3ABUA 4PJMA 3EUKL 4E7ZA 3L2UA 1TT5B 1UJ8A 1MJ9A 3S2WA 2D1VA 4XOTA 2E1OA 3QRFF 1SVOA 3CMAI 2VBYA 5DV5A 3RI4A 1RR7A 1W7PD 1U3EM 1FLIA 2W82A 2FUG2 4RAGA 3G6EI 1K78B 4DBQA 2DJIA 4C3IJ 2X1DA 3J80K 4LG3A 3H36A 3TP3A 5J8CA 3JRIA 1DUXC 4NC6A 2GZWA 2JA6J 3ZMZA 2EIJH 4XQFA 1LEBA 4J01A 2X6YA 3S2HJ 3E6DA 3S1NJ 1V55H 2R5ZA 2OCCH 5FLMJ 4R8HA 4C3HJ 3DPTA 4IEJA 4IX7A 2CW0F 1HSTA 2HWVA 2Z99A 3FISA 3BG3A 1FOXA 5BS6A 5F04A 1BI2A 4FISA 2QGUA 2IVMA 3J7YJ 4D5FA 2O9LA 4I02A 1XSVA 5EGOB 4Q5SF 4UHTA 1D3YA 2DOFA 1H88C 1B8IB 4A3GJ 2QA4I 3EETA 2ZFWA 4XLFA 1A31A 2PMZA 4AIHA 3RZOJ 4JK1X 1YIOA 2BHYA 5J1YA 2FBIA 4HV5A 5FRNA 1UHSA 1ZYRF 1LKXA 3ZR8X 4G6DA 3TKYA 2HVSA 3TP0A 5E17F 2BXZA 1BOBA 3BJOA 2XB5A 4M9XA 4G7HF 1WJDA 1Z1DA 3R60A 1PP8F 5B1BH 4IQ4A 1E3HA 3ONQA 2GAUA 4EMSA 2P7CB 2UXNA 2LSOA 3LQRA 5BNGA 4FETA 1SAXA 5K7ZA 2GOXB 2R7UA 3VYRB 2MABA 3VSLA 3B73A 2JVGA 1ZG1A 1KYZA 5D5UB 2L9RA 4AC0A 4NQWA 3KCCA 5J1RA 4RB2C 1I50J 3BJ6A 1QVUA 2CGPA 2ZJQF 2KLOA 2H09A 3HSRA 5E3NA 1RZ4A 2E5ZA 3FXLA 5ICCA 1FC3A 3HPHA 1S7OA 4Y33A 1FWZA 1X1PA 3QPSA 3CP8A 5EZGA 4OMYA 3CCVI 1ONVA 1NH3A 1ENHA 2PG4A 2LY2A 1R00A 1FY7A 5DCMB 4EJOA 2DPUA 2A6HF 3DWLE 4CCLA 1D5VA 4L9TA 2RVCA 3R0AA 2RNJA 3SQNA 1P9QC 2HQNA 4EJTA 3FK6A 2Y75A 2L9VA 1MBEA 1TL8A 9ANTA 4XKWA 4Z2YA 1S8NA 1KU2A 4A3DJ 1VQ4I 2ESNA 3S1MJ 3DKYA 1EH7A 1YQAA 2CO5A 2JTVA 1E3PA 1MBHA 5HS7A 4B47A 4BBRJ 1HSJA 2JQ7A 2JA2A 3BR1A 3PSIA 3LA2A 1T95A 1UFMA 2KQRA 3F9KA 1JI8A 5M3MJ 4RM3A 3LSKA 2MG4A 1ON1A 4XBFA 1W0UA 1IZ1A 2LF7A 3PFIA 1RUNA 3D1NI 3GXOA 3TW6A 2UXXA 4BEHA 1VNDA 4HLXA 3BZKA 5B3SH 5GPCA 2VJ4A 4WCGA 2D5VA 3K4NA 2R4GA 3H3ZA 1QA6A 3L9FA 2DQRA 4H4KC 5HLGA 1FJLA 1X4PA 1G59A 1FYKA 1B59A 3FMRA 3CMMA 3I4NJ 1O3TA 3PSFA 1ZELA 2PN6A 2GIZA 1GVJA 1R5GA 1PDNC 1HC8A 1BJZA 1ERDA 4QPQA 1X19A 2X1EA 2LR8A 2OC6A 2RDPA 1KONA 2VBXA 4PJ0C 3ZN1A 2NNYA 4E7HA 1BW5A 1JJ6C 3HOYJ 5EEAA 2JA5J 2Y2ZA 2XSDC 2ZMEA 2BY0A 3PM1A 3EYYA 2BVMA 5FKNA 3NWSA 4RMNA 2E1CA 5KVRA 2E19A 2C6YA 4IPAA 1Z7LA 3WG7H 2QUFA 2RQQA 1SEUA 2HNHA 2HI3A 2EV0A 1YE9A 1P4WA 4M6VA 3OYKA 1K79A 4AIJA 2EK5A 4OIRF 5DS9A 4EM0B 3HGYA 3GF2A 5CYVA 4AYBA 3F8CA 3L00A 2QM3A 1XGOA 3EUAA 2FD5A 1EF4A 5JLXA 1YX5A 2KDZA 3BQZA 3V7SA 1XMKA 5GAHJ 5K5RA 1EJ9A 1R9TJ 3VEPA 1JTYA 2ID6A 2LLKA 2V6CA 4M3DA 5KHDA 4X0GA 3H1CA 4MQVA 2IEKA 2L9NA 2IS1A 5GTIC 3NQOA 5KCMA 1MBGA 2TDXA 2R5ZB 1UMQA 3IP4B 3Q9SA 3K1PA 4CDGA 2BXYA 2HOEA 4N9HA 3FBIB 5L3CA 1TW2A 2JUCA 3GWZA 1S7AA 1J59A 1UCRA 2X6WA 4AIDA 1XSDA 1FBSA 2P8TA 4BY7J 3K1MA 2XF6A 3GZNB 3JRCA 5IY5H 5FKKA 4LITA 3B6AA 4HZFA 4CCKA 4RGXA 2GXAA 4B8XA 1LFPA 3A1YA 5HLIA 1ZRCA 1ZAOA 4IJAA 1JKOC 4ESBA 4DGWB 2P4WA 2NOJB 1BBYA 1P6RA 2QSFX 2ESHA 3TL4X 1U2WA 3ABTA 2M30A 2K4BA 5AIQA 5EEGA 2VXDA 1L0OC 5IT3A 1Z6TA 2OPTA 1RR8C 3E97A 2BE5F 3M8JA 2HR3A 2P6TA 2L02A 5E1ZB 3T1BA 5EYRA 3W3CA 1S3JA 3WU2C 4R79A 1BL0A 4E7KA 2DA4A 3LFKA 4OOIA 2K9QA 4EGYA 1S6LA 5HDGA 2MYSA 3CF5F 3CESA 3MQ0A 5F08A 2KIQA 2F5VA 2K27A 4HSRA 4NQWB 1S72I 2LOOA 3HSEA 5LRSA 3MKYB 3R61A 3ZXSA 4MGRA 5K7FA 3EYIA 5JHUA 2PJRA 4KIBA 2XGXA 4EQQA 4IZZA 3CQZJ 2Y69H 4L9JA 1LDKB 2DDBA 3GVAA 1X1CA 3MD2A 3R0JA 5AIPA 1EV7A 1NG7A 1VFCA 2WAFA 2H1LA 3FM3A 3E6MA 4NC8A 1YLFA 2ID3A 1H89C 3QYEA 4IO9F 1KU9A 3BPXA 2MFZA 1DDNA 1QZEA 3N97A 3RQIA 2RREA 1HW5A 3V8LA 4LK0F 2E35A 2D1HA 1H9GA 4HA8A 2HOAA 2K86A 2E7XA 4XOPA 2L2OA 4A0XA 3LA7A 1OR7A 3ABLH 1NK2P 4M3EA 4JX5A 1BI1A 2VL8A 4XN0A 5CVIA 4E7SA 4P9UA 3SDGA 1T2KA 2DA5A 1WJ5A 2K3PA 1UG2A 4PGGA 3WODF 1J0RA 2P5LC 1FTTA 4DQ2A 1ZQ3P 4BL0B 3QPLA 2L3DA 4A3MJ 1LVKA 2W48A 3C1DA 1ZGJA 2CFXA 5HNHA 5JVTA 2D2WA 3FHNA 2ZJRF 2CUZA 4BEHB 1RETA 3QWLA 2Z1DA 5FD5A 2WC2A 3HJEA 1S7EA 1LPQA 5IPAA 1YG2A 2F5CA 3MWMA 1IDYA 4L0ZB 1FPQA 1GV2A 4P5OA 1O7FA 4I0AA 1B4AA 3HTUA 1W7PA 4BKXA 2DT7B 1ZG5A 4D7MA 1STZA 3AFHA 2XAFA 1HQCA 3GX4X 4XKBA 4M6XA 3PIPF 1QGPA 2ISZA 3MCZA 3BT9A 3WTUC 4ZDOA 5HS9A 4L5IA 3H9JA 5M3FJ 1K4TA 5FFXA 1Y6IA 3CUOA 1ZGAA 1G3WA 1QZZA 3FZVA 3QOPA 1MJAA 2STWA 1X4OA 1YS7A 1Z05A 2P81A 2QKLB 3CDIA 2ZMEB 4RLFA 5AONA 5J3LA 4YG2F 2ZJ2A 1QBJA 2FEZA 4IRHA 3HM5A 4JX4A 5L3DA 3AG4H 2HTSA 4OIPF 4EGZA 2LREA 5KK1A 2JJ7A 4HV6A 2XROA 4E4HA 4WK8F 1R22A 4A3JJ 1VQ5I 2STTA 3G1LA 4MEYF 4A2UA 4JX6A 1YI2I 2R7RA 1TTYA 5LHHA 1DPUA 2EWNA 4XICA 1K61A 1DP7P 4LB5A 3I0TA 2KIFA 3L2RA 3CTAA 3OL4A 3P9KA 4A5MA 1JKRC 5LGUA 4XN3A 1UHWA 3J7AY 1M1EB 1WRJA 4CYCA 1VF9A 1ZN2A 5K1YA 3DLLF 3HDDA 2EV5A 4DJAA 2XC7A 3S14J 4EM1A 2EZHA 2RGVA 2DFFA 3K9TA 2EFNA 4Q48A 4XLEA 4ZYAA 2F4OB 3G2BA 2RQPA 3BR0A 2JRTA 1WH7A 4LJZF 1NHAA 4YELA 4ZTJA 2EFWA 2AXTC 1WPKA 2HXOA 5CVVA 4Q47A 3MMYB 3GLLA 1I27A 4E6KG 1RNLA 2KMUA 1K7AA 4D0PA 2ZO4A 1MNMC 2KP6A 1J9IA 2KPMA 2A5YB 4HNTA 1V54H 2QCOA 2R7FA 2W7NA 2JA8J 4ESFA 5F0FA 4FHTA 4HOBA 3RIRA 1JJ8C 5GAEJ 1B1BA 3L2VA 2DT5A 4FT8A 3UNGC 3WTVC 4JBAA 4OWRB 4KDPA 5JHFA 3S3NA 2FU4A 1G4DA 4Y52J 2R7ZJ 2M5WA 1WI3A 3IH2A 4YIRX 4L9NA 5E3LA 4FQGA 4QIWN 1FMWA 2R5YA 1APLC 4PK4A 2NS8A 4LB6B 5J47A 1N25A 2LTPA 2OQGA 3S93A 2M9HA 3PQJA 2HXIA 2EZLA 1T0FC 2XUBA 3MN2A 3Q0WA 5DD4A 1AHDP 4Y7NJ 3F21A 4AU7A 2DBBA 4XLNF 2PJRB 2ME0A 3KZIC 2O6GE 1XCBA 2K5CA 2VJIA 3LAJA 4RGRA 3FXMA 5B5EC 4MEXF 4HX4A 3PNVA 3CCQI 5D8KB 3O2PE 5F64A 5L3EA 2HGCA 2A3SA 2R3SA 1Z21A 3GW2A 4RDUA 4G9YA 4L5EA 3AG2H 2O0YA 5FB2A 5M5YJ 3GTKJ 4ITVA 1XS9A 1V5GA 1LB2A 1MNDA 4HG2A 3TOBA 1BI3A 4BGDA 5CVJA 3B6CA 2F6CA 2FA5A 2VOPA 4YIFA 4HW0A 1VQ9I 6PAXA 3KE2A 1D0XA 2A6TA 1BR4A 2LKXA 1IN7A 3HRUA 5CQEA 4L0YB 2QF7A 2DQLA 1Z0XA 3SXYA 5E3OA 1ZR2A 1BOAA 1X1AA 2QENA 3LMMA 1GLNA 1OCZH 3QP5A 3KP2A 2DOAA 2E2HJ 3KP3A 1NTCA 1MKMA 3SFZA 2W4SA 1GUUA 4K2EA 1OCRH 2Z5UA 2X4HA 2IW5A 2YU3A 3FF5A 3RKXA 3AG3H 3DXJF 1E17A 3VB2A 4HLYA 1JKQC 2ETHA 1H8AC 3BG9A 3CMYA 2LC2A 3ZMUA 3CC2I 3I58A 2K02A 1FNNA 3MEXA 2XAJA 2VN2A 3CCEI 1W7PB 2KRHA 3T8RA 3COAC 3NRVA 3SEZA 3PO3J 2LMDA 2YR2A 3CO7C 1BI0A 3I64A 2HFHA 3KEYA 1R4MB 1PJRA 3BCBA 3TW7A 4CYDA 3TGNA 1B6AA 2CUEA 4QPOA 1OQYA 4QLCU 4HEA2 2F4MB 3ZMVA 4HDVA 1TLHB 1USTA 4G12A 1MIJA 3OYAA 5BPIA 3SFIA 1R4NB 3G1MA 3K4BA 1MDMA 1ZG3A 4KFCA 3A0HC 3IKTA 2E7WA 3OOUA 1IRFA 2LRDA 4J00A 1S9HA 2EFQA 1QZYA 4GXOA 1F43A 3OR2C 3CCLI 2EPFA 2DAOA 3OYNA 1ETWA 3D5LA 1Z6RA 2YSRA 2R7OA 3ERMA 4A6DA 2ZXIA 2FQ3A 2K9SA 4BDZA 5KAIC 3HC7A 4MFEA 3BQYA 4IOAF 4A3FJ 2DFEA 1FMVA 4CYCB 2E2IJ 4D5CA 4XK4A 2MC3A 5L3GA 1TNSA 4RB1A 4TV7A 2W1OA 2ZNZA 1ZH5A 3OMYA 1V3FA 5K5QA 3P5JA 1WWXA 1HDDC 2LP0A 1IDZA 2XGCA 2DA7A 1ULYA 2GOMA 5CPRB 4AIKA 5EEHA 2XPUA 4UNOA 2CQNA 3WHCA 2MC4A 1ORKA 5F0HA 3E5QA 3F8MA 2CW8A 2VI6A 2R7XA 1FP1D 1VQNI 3UR3C 1JGGA 2Z16A 5TGTA 4N0BA 3KIOA 1W5TA 3O6BB 5IP6A 2I5UA 3RKQA 1EH8A 4GDFA 2GBYA 2ME6A 2MLGA 1ZKGA 2GQQA 1U5TA 2CG4A 1G3YA 4FCYA 2PQ8A 1SC7A 3IWZA 1J7KA 4ASNA 3RPUD 1R71A 4XRFA 4G8XA 4KYWA 4GGGA 3BZCA 4P9FA 2OD5A 5HS8A 3EUHA 2QVOA 1XD7A 3A4CA 1U9OA 3HGGA 1RIOH 5FGMA 4RA2A 2R5YB 3EDPA 3KP4A 1RI7A 1XCVA 3F8FA 3FKIJ 3LSMA 4F91B 2JT1A 5LEKA 1VQ6I 4C9YA 3KZZA 3ZQFA 4KJZA 2DMNA 2QLZA 5IP7J 4M73A 3TMOA 3K70D 2H8WA 3TDZC 2OBPA 2XSJC 4OU0A 1LEAA 4DBRA 4QTRA 2O8XA 4N4NB 2NXNB 4JP0A 3C2HA 1QRYA 2CRGA 2Y0MA 1IUFA 2OAZA 2QZ8A 3LFUA 3H5AA 2YPRA 4Z6YA 3I9V2 3I55I 3U21A 1J2XA 1AOYA 2NVQJ 1BC8C 3M07A 1P2FA 2HPIA 2FSWA 2Z2SB 2IGNA 2DTZA 5EG0A 3S15J 2VE9A 4DIQA 5CVUA 4A93J 3OIOA 1O7LA 1WJEA 1IG7A 5IYDJ 2DU9A 5LGNA 2XDVA 2KIMA 2A05A 3OIQA 4LIVA 5D4SA 4BQOA 1HA8A 4A0YA 1ZLJA 2QQBA 3D5SC 1OYIA 1BA5A 4ZYHA 1VI0A 3TEDA 2IGMA 2E60A 2YS9A 3PO2J 3IL2A 3WTZA 3P9IA 2W57A 4KIFA 3RSNA 5E3MA 4N4OB 1DGWY 1D1BA 1MH3A 1I5ZA 1QHGA 1O57A 2M4GA 4EJUA 3ZQLA 5JLWA 1ODDA 1XN7A 3E5XA 3A02A 2DI3A 4Q4ZF 3V7RA 4XLPF 1IJWC 2W00A 2AQEA 3GUDA 3L2CA 3MFKA 1LDJA 4NUBA 4UV8A 5FLXZ 3F72A 4KT6A 5DCFA 5F1JA 2DMTA 5BQTA 5CKTA 1MH4A 1RKTA 2WWYA 2M0MA 2BVLA 3OYDA 1EA3A 1N75A 2XHKA 4OIQF 1MMNA 1ETXA 2K9LA 2IP2A 2HYGD 1G3TA 3IWFA 4LLLA 3S8PA 3OY9A 3JREA 4DYCA 4XLAA 2X6OA 5DM6F 1H9TA 1TT0A 3REOA 4BU2A 3OYCA 2O8KA 4DNCA 1K6YA 2DK8A 4U0WA 2LY9A 1JKPC 4UVBA 5JI6A 1FOYA 1ZLKA 3CLQA 3FKJA 3PFYA 4B3XA 2V9VA 3JSPA 2DT6A 1O3SA 3HXLA 1G6NA 1YJNI 1ETQA 1SFEA 3KP7A 2OV7A 1MMGA 3BLYA 4DW6A 2E2JJ 3QODA 1J5YA 2PX9A 3CUQC 4YFXF 2AS5F 1U6GA 1X3UA 2LK2A 4OMZA 4RGUA 3W2WA 4Y13A 2XAGA 2JWTA 3CCRI 5FLXK 4XL9A 1MDMB 1JHHA 2E1MB 2L9SA 3Q9VA 3JRHA 4LK1F 1WI9A 1YYVA 2LNBA 3M4OJ 5D5XB 1REPC 1R5HA 3HIFA 2ECBA 4GO1A 4I0BA 1OYYA 4YFNF 2L7FP 2LH9A 1SVLA 3FDYA 4Y15A 2V9KA 1Y8QB 2KHMA 2F5EA 2R92J 1J75A 4UB8C 3E3VA 2H6CA 2X6XA 1T98A 2KIUA 5J8FA 4BACA 3GTPJ 2L54A 4AUXA 1TP4A 1PVEA 3ISPA 2E1MC 4MIMA 1U8BA 5FKMA 2V6EA 1DGRM 1VQMI 2HQ5A 4IRGA 3TO6A 5DEQA 1T39A 3NEUA 2L5QA 2IT0A 3CJNA 3WTYC 4A6EA 5FO5A 3JRDA 1HLVA 1KA8A 4LMYA 4HYEA 2VPRA 4CSWA 2ELKA 5GPAA 4WXHA 5DDGA 1O3QA 2BW3A 2CWEA 4EATA 3ZCOA 3JTGA 2DA2A 5HNFA 3RTRA 1Z3XA 4J19A 3LSTA 3ERED 2DODA 3KX2A 3GCMA 4HAMA 5E1WA 2FOKA 3E1SA 2DFHA 3V8KA 4UB6C 4XONA 4BHBA 2XPVA 1ETOA 2W84A 2VJJA 1U5TB 3WTSC 3SZPA 5A2QK 3EQLF 1TBXA 4O6JA 2DLLA 3P7NA 2KKOA 2XAHA 4KT5C 1SAUA 1OCTC 4HBLA 5F6FA 3V7CA 3RZDJ 3E6CC 3JW4A 5J1UA 2BZTA 3HOXJ 4U7DA 3DTIA 2Z33A 2BV6A 1XGNA 2G9WA 3NWTA 2CQXA 2WY7Q 2M45A 4F93B 3KEOA 4LG0A 3BY6A 3H5RA 3Q3SA 3GO5A 1I6HJ 2AQFA 2I8DA 1MMAA 5HDKA 5HLHA 2ZNYA 1IXCA 1U5TC 4RGSA 2B63J 3BTCA 3IRQA 5F27A 1BN5A 2EQRA 3FXRA 4EV0A 4LGWA 3GZ5A 1OYWA 3ZGKA 3DEEA 4HPQA 4Y4RA 1T0FA 3EUHC 3W2VA 2P7VB 4F92B 5CJ9A 3CO6C 1DU0A 4F55A 2FXAA 2JMWA 2HZTA 4RLQA 5LEJA 4IHWA 1WFXA 2EIMH 2R7SA 5CQGA 1Y39A 2L7MP 4BQNA 4DZPA 4M6YA 1V5FA 5DTDA 2Q0OA 1Q1HA 4YIIA 4FTHA 2DCEA 2HOTA 3U2RA 5ILSA 5EG0B 3PNYA 1TZLA 1MZBA 2JN6A 5HDNA 3I59A 1WJCA 1UHMA 2ZFUA 3G3ZA 2NOGA 4I6ZA 2LKSA 3CCUI 3KEQA 4I2OA 1H0MA 4PCQA 3OS0A 3PJRA 3HBLA 1WZ2A 2PBIA 3DU5A 2M87A 4HNVA 1GVDA 1Z91A 4G6QA 4MQ9F 3FBNB 5FKOA 2CQKA 3HOVJ 1RUOA 1R1UA 4A3LJ 2KFDA 2QQ9A 2MD0A 5K7HA 2M0CA 2VUMJ 1JUSA 1U78A 4HX8A 2KRCA 3ZMSA 3GFMA 2LFBA 4XLHA 3U9GA 2CW7A 3HRSA 2RNGA 4ZDPA 1BC7C 1Z9CA 1K4SA 2FX0A 5ED4A 4E7JA 2PFBA 4I99C 4HDUA 1FOWA 2CH0A 5GP9A 2N8GA 2OA4A 4ENNA 1VTNC 1W1WE 4KNYA 1OPCA 4O3MA 3SZGA 3S1QJ 1XDUA 1IRXA 3QPTA 5BPDA 3DF8A 3EPZA 2QQAA 3BTJA 1IUYA 2RC4A 2IPQX 3HRTA 3CDHA 3OIPA 2GLOA 2IS2A 1XSXA 1I1GA 2ADUA 4IF4A 4KISA 3K4CA 2QWWA 4BDYA 5E8GA 2VE8A 1QPMA 1JUPA 2DMQA 1X1BA 2KJCA 2KZGA 3RQ4A 4BXFA 1OKRA 1FIAA 1BM9A 3V8JA 2RAEA 2VJ5A 2OCEA 3GMEA 3F8NA 2DYSH 2W25A 3AKZA 4ENMA 1TWAJ 3S2DJ 3GTMJ 4L9VA 1L3LA 2B7EA 2DMUA 3I5UA 5K5OA 2HKOA 1JTXA 2IA0A 2VQGA 3BC8A 4GYIA 4KICA 4C2TA 2J5PA 3MAJA 3HHHA 1ETYA 1TWFJ 1MGTA 1D8KA 4CH7A 1F4KA 3ASOH 3Q0UA 4IHYA 2XF5A 1I1SA 2E36A 4B43A 3WGIA 1TWGJ 4ZZLA 2BYVE 2V79A 5D6EA 3OYLA 1TC3C 4CICA 3BR2A 2Q1ZB 4A3IJ 5E20A 4C30A 2V1NA 2BW3B 2GM4A 3O8HA 3DKXA 5ILVA 2LBFA 4F7ZA 5KAFC 2WTEA 1XC5A 3UKGA 1X2MA 4QWQA 1BW6A 4P55A 4IHXA 2P5VA 3VYSB 2KDOA 4OAZA 3WU0A 3HOUJ 4MHGA 2HPMA 4I76A 3K2ZA 4LLNA 5TJJA 3HUGA 1RRJA 4B4CA 2ISYA 1DP3A 1XPXA 3JRAA 3X2QH 3CDLA 4M74A 1W5CC 1YJ9I 4B09A 2M34A 2BY2A 3ULQB 1TQPA 1R1TA 2PEXA 3OOPA 4LG0B 2KZVA 4PFPA 3K1NA 4PZJA 2AHQA 4CZCA 3CF2A 2X48A 2FMLA 2O03A 2CJJA 3I54A 1RKWA 3KP6A 3L2WA 2WAQN 1ZHFA 2YX7A 2VT2A 4GYGA 2KRFA 2HYJA 4XRSG 5D5VB 2EINH 1MSEC 1N77A 3K4JA 4UV9A 3BWGA 1R58A 4JYKA 4RAYA 2DTRA 4XKCA 2NS7A 1T8IA 3FK7A 2V1UA 2ZXWH 4EM2A 5H6RA 3KLNA 2Q2EA 3FXOA 5DD8A 3DPUA 5GAGJ 2B0LA 5HVQC 2LD5A 1O3RA 2V9PA 1FZPB 3GTOJ 4O5VA 3L1PA 5ICFA 3MKZA 2GA1A 1IN4A 1YW7A 4CUGA 4GCVA 2ZC2A 4BAYA 5D8LB 2HOSA 4PJJA 1IV8A 2V26A 1SVMA 3HTSB 2QQ8A 1F9NA 2ZKZA 3I59B 3GFIA 1GT0C 3DLAA 1KQ8A 3F0CA 1GDTA 4M9ZA 3ZQIA 5FKLA 3LSIA 1N78A 4A69C 3TDUC 2VB6A 3BR5A 3OYIA 1F36A 2WA0A 1ZRFA 3AL0B 1FEXA 4BE2A 4XMYA 2VASA 3LNQA 3KYCB 2Z9OA 3GTQJ 3JAMZ 4KN7X 5LD2C 2LF8A 4D1QA 3TO7A 2P0WA 2H6BA 1YW8A 3FMSA 2P6SA 1MJBA 1KQ0A 4KN4X 3E7LA 2FRHA 3K4MA 4WF2A 2JSCA 5JVGF 1XX5A 5C44J 3M8FA 3HEFA 2A61A 2DFIA 1SANA 2M7AA 1LQ1A 3AL0C 2IA2A 3M1EA 3WG9A 4CCJA 2IGKA 1Z77A 4CXFA 2TCTA 2VBWA 1Z67A 2HKXA 3VYTB 1HOMA 1IRGA 3KLOA 5IP9J 3JAMK 4A12A 2UWMA 1SFKA 3H5NA 3I53A 1TQMA 5LHIA 1XGSA 1D8JA 1AWCA 4I98B 1IC8A 3IRRA 2NAZA 3DBHB 1MNEA 4A3EJ 4UUSA 1IXRC 2VODA 3HOTA 3BDDA 5L3BA 4YEJA 5ERIA 1ZREA 3CUQA 1HW1A 2IS4A 2HQRA 4BUPA 4KITB 3JR9A 1U9NA 2VXZA 1E3OC 1Q1VA 3OYMA 3MVPA 1GXPA 2HTJA 1CQTA 2JPBA 4M3GA 1PUEE 2VBZA 3PL8A 2X0LA 1X2NA 5FFZA 1UAAA 1YHQI 2IA1A 2P5KA 3V4GA 2R7DA 4OINF 3L2QA 3MZYA 1ETKA 1I3QJ 2IJLA 4PSWA 2EILH 4PGHA 1Z7UA 4YRVA 1CGPA 1MBJA 2NNNA 3K2AA 1W36D 5M5WJ 2YX4A 4NDLA 3HL2A 1P4AA 1HCRA 3JTHA 1BR1A 2MA3A 4ETSA 3GTLJ 3ELKA 1POGA 1TWCJ 4KIGA 2LKPA 3SHFA 1K83J 2VKVA 2VONA 4ZDLA 2LBFB 2M2EA 1VQPI 1P92A 4FE4A 4HSTA 1K6OA 3OYGA 3CC4I 2EH3A 4CCNA 1MW7A 3KP5A 3W6VA 4LD5A 2IBDA 5ICGA 3JRBA 4U0YA 4IHTA 1I3AA 3A03A 3DPLC 2CS3A 1WSUA 1ZK8A 5BMZA 3FIWA 1NG6A 3F3XA 3HUGB 1VZ0A 2XV4S 4IHSA 2XVCA 2L4AA 2LDUA 3QAHA 1A04A 2WAEA 2DN0A 4F52A 1WKMA 2A69F 2L01A 4JOMA 3K6GA 3GTJJ 2HDWA 3HOWJ 3WE3A 2DDAA 3C2BA 3K70C 1R23A 3KPHA 3IH3A 4IRIA 3ABMH 3W2AA 1BR2A 3NARA 3S3OA 2PMHA 3ROUA 1ITYA 3LL7A 1FP2A 4U7BA 2CQ7A 2EA4A 1WJAA 3KZYA 2QBYA 5C3EJ 1G8XA 3RPQA 2M8EA 4II3A 4RS8A 4U87A 3ZOBA 4ABZA 4IHVA 1KYWA 4WXCA 3TO9A 1WVRA 1A6QA 2EFPA 1TW3A 2MGQA 2NYXA 3SYTA 4EEFG 1A35A 4WXDA 2Q2EB 3OS1A 3LSJA 3OV8A 2VPLA 2DA6A 1YRNA 3I4PA 3OYFA 1J09A 2L7ZA 3LSGA 3F23A 4BH9A 5DM7F 3DEUA 3DTKA 2MH2A 1D0YA 1X58A 4V19K 2ACJA 4B48A 4ZJZA 3M7GA 1HKTA 1QPIA 3BCAA 4ANJA 3OYBA 2M8GX 2AXLA 3ESWB 3I4MJ 4X1EA 1OCCH 1HXDA 1JGSA 2HU9A 1WJFA 1ACIA 3ZQGA 2QSHX 3CD6I 4PFOA 4LFUA 2OQRA 2JK3A 2EB7A 3ZN0A 2CYYA 2EZKA 1FSHA 2HDCA 3J7ZI 1TNTA 3WTWC 1YJWI 2E71A 5LBQA 3GFLA 1Y0UA 2R7QA 3GYHX 3IAS2 1BIBA 2WV0A 3VWBA 1YS6A 1LJ9A 4ON0A 3PUFA 2CQQA 4BJ5C 1DQUA 1W0TA 1QNTA 1YW9A 2XKOA 4NBQA 2BY3A 1W4MA 3DP7A 4M71A 1HKSA 3E5UA 5M5XJ 5J4YA 1OISA 4XIDA 3FXUA 4M72A 3J81Z 4XNFA 5IT9Z 3H0GJ 1OLTA 2UUZA 1SMYF 4V2FA 4HQMA 2K9MA 1XGMA 3KYDB 2BBYA 4S05A 2Q8KA 2D45A 5B66C 3K7AJ 3LWFA 5FD6A 2GIVA 1VQ8I 2BY1A 2WBMA 1WHUA 1WH5A 2K40A 4LOCA 2O5RA 2WB1N 4UUSB 3ASNH 4BQQA 3I56I 3QOEA 3S1RJ 1I6XA 4UUVA 3CUQB 4EJWA 3VODA 2KL4A 2GA2A 4RBOA 1Y1VJ 1A6IA 2OJED 5HOOA 3SZTA 3OYJA 1XMXA 2QSGX 3DBRB 4V2GA 2A07F 2FBHA 3HYIA 3Q5FA 1FTZA 2G0EA 3IAM2 3U1DA 3J81K 3DBLB 3AG1H 4UY8I 5IT9K 1TQIA 1IRZA 2IXSA 1ETVA 2H1KA 3H9QA 4XRMA 3WTXC 3HOSA 3M1CA 2FE3A 1C0WA 1QVTA 4ZYDA 3IC7A 1E2XA 3HPGA 4BHPA 3CZ6A 2ZXHA 4BJTA 3G71I 5TRDA 1MMDA 2A6EF 4M3FA 1GV5A 5FJ8J 3SEQA 1UZCA 2ZSIB 4BXUA 2H27A 2W24A 2GXBA 1BJAA 5DUKA 2NVYJ 4KUMA 3IHUA 4MNUA 1O4XA 4MFDA 2OTLI 4BNCA 1R5ID 2VLAA 4GFBA 4X6AJ 1OMIA 4ENJA 3GEZA 1KGSA 5F0CA 4PDKA 2L0KA 3D5RC 4G6TB 1JT6A 5E8IA 5EDNA 3WE2A 1RESA 5FLVA 4RAFA 1OFCX 1D5YA 3C3WA 2VKHA 1Z3YA 1ZARA 3QU3A 3QYBA 1QHHD 1T33A 2K4JA 4FX4A 5FROA 5GADJ 2XAUA 2ICWG 2V7FA 3QQAA 4FE7A 4NHJA 3VFZA 5KNLA 2DW4A 5A2QZ 2JUGA 2XPWA 3CJTB 5CLSA 2EIKH 2ZB9A 2H8RA 1HBXG 3RKWA 4IXAA 1FT9A 1LUJB 3L7WA 5F1RA 4B3AA 3HZJA 2PMZN 4CCMA 3QU6A 2MW8A 3JRFA 1YIJI 2H94A 5LFAA 2XRNA 3BP8A 5H2FC 3GLXA 3F6OA 1R7JA 2OTJI 1MD0A 1VQLI 4DYRA 4IVNA 2X85A 5IYCJ 2HZDA 2MBFA 2XGEA 3K4LA 4AVPA 2Y48A 2QBYB 3A2KA 3BG6A 4ENKA 4XSZF 2L7KA 4JQFA 2Y0SA 4RAZA 1F1ZA 5IYBJ 2DPDA 2XGDA 4H0EA 2QYOA 4ZTFA 2JZYA 5FRMA 2VOOA 3T8TA 2JVHA 3RYRA 1D0ZA 3CP2A 2BHZA 4IOCF 1KU3A 2ELHA 3HG9A 4XR6A 2COMA 2DYRH 5J40A 3FMQA 5C4XJ 1YRNB 2GXGA 2UV1A 1LDDA 3MZ8A 3OWTA 3FXQA 2COBA 1IGNA 4AWXB 4A5NA 2FBKA 1KU7A 5EF6A 1WCMJ 2K3FA 1QQIA 1A36A 3ECHA 3DKWA 2X1CA 2OUMA 1SD7A 2DO7A 1RC9A 1X1DA 2CV1A 2A5WA 2FF4A 4KMFA 3DV8A 3CJQB 4LLGF 3C18A 2PJPA 2ZBKA 3GTGJ 3H9GA 2F48A 3OYEA 4LIUA 3V42A 4XLCA 2XKPA 3HHGA 4II2A 3ZQ7A 3G1OA 3K4KA 5H20A 4BJ6C 1IXSB 2IGOA 3ML6A 1JUMA 3FM5A 1IN6A 1JHFA 1SD6A 3WU1B 1DU6A 3NAUA 3H92A 2G7UA 2FMYA 2EFOA 1VQKI 3WTTC 3C2GA 1YTYA 1HDPA 4NB5A 2DK5A 3MKWB 2F5DA 1LE8A 3BG5A 3CMEI 1CF7A 1LFUP 1FYMA 1PUFA 3HB9A 3I3LA 1Y56A 2ZJPF 2FOWA 5E79C 2PI0A 3E0JB 1GXQA 5ICEA 2BEOA 5IOYA 3VYUB 3N4MA 2G7HA 4HRIA 2VKDA 4HX7A 3G4SI 4CGZA 3RKYA 4DZJA 1AKHA 1XDSA 2ZSHB 3D0SA 4HF0A 2K7LA 5D6FA 2NVUB 4D7NA 3FXJA 3QPHA 4XM3A 2BGCA 5TISC 3DEWA 5LGTA 3CLOA 2E34A 2DXIA 1QU3A 2HVRA 2E1NA 4F3QA 5LHGA 1PYVA 3ZMTA 2W85A 3CCJI
chains in the Genus database with same CATH topology
3TQNA 4HF2A 2RV8A 2EA2A 5D4RA 3JSOA 3K0LA 2O61A 3FWEA 5LLQA 4CO8A 2XAQA 1WQ2A 3T0YA 3HRMA 2ZCWA 4EJVA 2F5FA 4UVAA 2FNPA 4N9IA 1GHCA 3VOEA 5CVRA 3LAPA 3R4KA 2XIGA 3RDIA 1HKQA 4I7HA 3M9AA 4ZYEA 2IRFG 2PMUA 2O3FA 2ZXJA 2RN7A 4G7ZF 3BZ6A 3LA3A 3RPUA 5J6XA 3HSFA 1B9NA 2OZUA 3P9CA 4BQAA 4HQEA 3GZ6A 2J5OA 2NRAC 4KA4A 2NS0A 1FBQA 3WGGA 4AD9A 4G7OF 2HS5A 1IF1A 1FBUA 3R6SA 3ECOA 1BIAA 1W5SA 2VC1A 4WX9A 1FSEA 4CHUA 2PLYA 1USSA 2HYFA 1T38A 4M9SA 5JR3A 4Y17A 1LNWA 1F5TA 5DYMA 3LQQA 4ZYGA 5L3FA 2MH9A 3O3KA 4CZZA 1B9MA 4MTDA 2OU2A 2EV6A 2RKHA 3L09A 3C7JA 3KETA 1SMTA 4UXNA 3T5XA 3DFGA 1K78A 1FYLA 5D5WB 1QO0D 1EH6A 3BJAA 2UZKA 4UVCA 1SFUA 4R1HA 3J7AO 2MLKA 1CF7B 3FHZA 3MZHA 4MTEA 2MD5A 2HEOA 3BPVA 5ILUA 3RYPA 1YO5C 5LRRA 1ON2A 1U8RA 4A0ZA 4ZZDA 2JPCA 4U0VA 4L18B 2FNAA 4XSXF 3ZP5A 3PQKA 4WWCA 3I71A 3M8EA 4OIOF 5JFRA 2F2EA 2EJRA 4RB0A 3WGHA 1S29A 1IN8A 4S04A 5E18F 1XMAA 3ZPLA 3W6JB 4E70A 2VT3A 3B02A 3GFJA 2A68F 1JE8A 1DPRA 1PP7U 4ZH4F 1R36A 2GWRA 1YFHA 1JXSA 5DUIA 1ZRDA 3DQVC 4RB3C 1T6SA 1SD4A 1P4XA 4ESJA 5DCMA 2L4MA 1R1VA 5H6QA 3F22A 4I09A 2VC0A 4I01A 1SD5A 1UB9A 1FX7A 1XB4A 3H3UA 1FOKA 1IAWA 2V1XA 4EVIA 4BYYA 3W6KB 4HF1A 1LVAA 4YFKF 3G73A 3KFWX 3FX3A 4KMUX 3QP6A 3AAFA 3F6VA 2KJBA 4U88A 3BOQA 1IN5A 3RJPA 4BHCA 1KQ9A 3F8BA 3E6BA 5E1XA 2M1BA 2V1DA 2Z3YA 2CSOA 3ZMDA 5BOXA 3J80Z 3TOAA 1HW2A 1V4RA 3BROA 2XASA 1IW7F 2OZ6A 4L5JA 4P96A 4FX0A 1G3SA 3IKVA 4G94A 1SFXA 3K69A 3ABUA 1MJ9A 3S2WA 2D1VA 3QRFF 2VBYA 5DV5A 3RI4A 1W7PD 1U3EM 1FLIA 1K78B 3J80K 5J8CA 1DUXC 2GZWA 3ZMZA 1LEBA 3E6DA 4R8HA 3DPTA 2CW0F 1HSTA 2HWVA 2Z99A 5BS6A 1BI2A 2IVMA 4I02A 1XSVA 4Q5SF 4UHTA 1D3YA 3EETA 2ZFWA 4AIHA 4JK1X 1YIOA 2FBIA 4HV5A 1ZYRF 4G6DA 3TKYA 5E17F 3BJOA 4M9XA 4G7HF 1Z1DA 3R60A 1PP8F 2GAUA 4EMSA 2P7CB 2UXNA 2LSOA 3LQRA 1SAXA 3B73A 1ZG1A 1KYZA 5D5UB 4NQWA 3KCCA 4RB2C 3BJ6A 2CGPA 2H09A 3HSRA 1RZ4A 5ICCA 1FC3A 1S7OA 1FWZA 4OMYA 1ONVA 2PG4A 1R00A 1FY7A 5DCMB 4EJOA 2DPUA 2A6HF 1D5VA 4L9TA 2RVCA 3R0AA 2RNJA 3SQNA 2HQNA 4EJTA 2Y75A 4Z2YA 1S8NA 1KU2A 2ESNA 1EH7A 1YQAA 2CO5A 2JTVA 5HS7A 1HSJA 3LA2A 1UFMA 1ON1A 4XBFA 1IZ1A 2LF7A 3PFIA 1RUNA 3GXOA 2UXXA 4HLXA 4WCGA 3H3ZA 3L9FA 2DQRA 5HLGA 1FYKA 1B59A 3FMRA 1O3TA 2PN6A 1GVJA 1R5GA 1PDNC 2NNYA 2RDPA 2VBXA 3ZN1A 2ZMEA 3EYYA 2E1CA 5KVRA 2C6YA 4IPAA 2QUFA 2EV0A 1P4WA 1K79A 4AIJA 2EK5A 4OIRF 4EM0B 3GF2A 5CYVA 3F8CA 3L00A 2QM3A 1XGOA 3V7SA 1XMKA 5K5RA 3VEPA 2V6CA 4MQVA 3NQOA 2TDXA 3Q9SA 3K1PA 4CDGA 4N9HA 2HOEA 5L3CA 1TW2A 3GWZA 1S7AA 1J59A 1UCRA 1XSDA 1FBSA 2P8TA 3K1MA 4HZFA 4RGXA 4B8XA 5HLIA 1ZRCA 1ZAOA 4IJAA 4ESBA 2P4WA 1BBYA 1P6RA 2ESHA 1U2WA 3ABTA 2M30A 2K4BA 5AIQA 5EEGA 1L0OC 5IT3A 1Z6TA 3E97A 2BE5F 2HR3A 2P6TA 2L02A 5E1ZB 3T1BA 1S3JA 4R79A 3LFKA 4OOIA 4EGYA 1S6LA 5HDGA 3MQ0A 2K27A 3HSEA 5LRSA 3R61A 4MGRA 3EYIA 5JHUA 4KIBA 2XGXA 4EQQA 4L9JA 1LDKB 3GVAA 3R0JA 5AIPA 1EV7A 3FM3A 3E6MA 1YLFA 1KU9A 3BPXA 1DDNA 3N97A 1HW5A 3V8LA 4LK0F 2D1HA 1H9GA 4HA8A 2K86A 2E7XA 4A0XA 3LA7A 1OR7A 1BI1A 4P9UA 1T2KA 5CVIA 4PGGA 3WODF 1J0RA 2P5LC 4DQ2A 2L3DA 3C1DA 1ZGJA 2CFXA 5JVTA 2D2WA 5FD5A 2WC2A 1YG2A 2F5CA 3MWMA 4L0ZB 1FPQA 4P5OA 1O7FA 4I0AA 1B4AA 3HTUA 1W7PA 1ZG5A 1STZA 2XAFA 1HQCA 3GX4X 4M6XA 1QGPA 2ISZA 3MCZA 3WTUC 5HS9A 4L5IA 5FFXA 3CUOA 1ZGAA 1G3WA 1QZZA 3FZVA 3QOPA 1MJAA 2STWA 1YS7A 1Z05A 4YG2F 2ZMEB 5AONA 2ZJ2A 1QBJA 2FEZA 4IRHA 5L3DA 2HTSA 4OIPF 4EGZA 5KK1A 4HV6A 2XROA 4WK8F 1R22A 2STTA 4MEYF 4A2UA 1TTYA 5LHHA 1DPUA 2EWNA 1DP7P 4LB5A 3I0TA 2KIFA 3CTAA 3P9KA 4A5MA 5LGUA 1UHWA 1WRJA 1ZN2A 5K1YA 2EV5A 4EM1A 2RGVA 3K9TA 2EFNA 4Q48A 2RQPA 2JRTA 4LJZF 1NHAA 2EFWA 5CVVA 4Q47A 1I27A 1RNLA 1K7AA 4D0PA 2ZO4A 1J9IA 2A5YB 2R7FA 4ESFA 4FHTA 4HOBA 3RIRA 1B1BA 2DT5A 4FT8A 3WTVC 4JBAA 4KDPA 2FU4A 1G4DA 2M5WA 4L9NA 4LB6B 2OQGA 3PQJA 2XUBA 5DD4A 3F21A 2DBBA 4XLNF 2O6GE 1XCBA 3LAJA 4RGRA 4MEXF 4HX4A 5D8KB 3O2PE 5F64A 5L3EA 2HGCA 2A3SA 2R3SA 3GW2A 4G9YA 2O0YA 5FB2A 1LB2A 3TOBA 1BI3A 2VOPA 5CVJA 2FA5A 4YIFA 4HW0A 6PAXA 3KE2A 1IN7A 3HRUA 4L0YB 2DQLA 3SXYA 1BOAA 2QENA 3QP5A 3KP2A 3KP3A 1MKMA 3SFZA 4K2EA 2Z5UA 2X4HA 2IW5A 2YU3A 3FF5A 3RKXA 3DXJF 1E17A 3VB2A 4HLYA 2ETHA 3ZMUA 3I58A 2K02A 1FNNA 3MEXA 2XAJA 2VN2A 1W7PB 3T8RA 3COAC 3NRVA 2YR2A 3CO7C 1BI0A 3I64A 2HFHA 4CYDA 3TGNA 1B6AA 4QLCU 3ZMVA 4HDVA 1TLHB 1USTA 5BPIA 1MDMA 1ZG3A 4KFCA 3IKTA 2E7WA 1IRFA 2EFQA 1QZYA 4GXOA 2DAOA 3D5LA 1Z6RA 2YSRA 4A6DA 2FQ3A 2MC3A 5L3GA 1TNSA 4RB1A 4TV7A 2ZNZA 1ZH5A 1V3FA 5K5QA 1WWXA 1ULYA 4AIKA 5EEHA 4UNOA 3E5QA 3F8MA 1FP1D 4N0BA 1W5TA 3O6BB 1EH8A 2MLGA 2GQQA 1U5TA 2CG4A 1G3YA 2PQ8A 3IWZA 1J7KA 4ASNA 4XRFA 4G8XA 4KYWA 4GGGA 4P9FA 2OD5A 5HS8A 3EUHA 2QVOA 1XD7A 1RIOH 5FGMA 3EDPA 3KP4A 1RI7A 1XCVA 3F8FA 2JT1A 5LEKA 3KZZA 2QLZA 4M73A 3TDZC 2OBPA 4OU0A 1LEAA 2O8XA 2Y0MA 2OAZA 2QZ8A 2YPRA 1J2XA 1AOYA 1BC8C 1P2FA 2FSWA 2VE9A 5CVUA 1O7LA 2DU9A 5LGNA 2KIMA 5D4SA 4A0YA 1ZLJA 2QQBA 1OYIA 4ZYHA 3IL2A 3WTZA 3P9IA 2W57A 4KIFA 1I5ZA 1O57A 4EJUA 1ODDA 1XN7A 3E5XA 2DI3A 4Q4ZF 3V7RA 4XLPF 3L2CA 3GUDA 3MFKA 1LDJA 4UV8A 5FLXZ 3F72A 5DCFA 5BQTA 2WWYA 4OIQF 2XHKA 2IP2A 2HYGD 1G3TA 3IWFA 4LLLA 1H9TA 3REOA 4DNCA 2DK8A 4U0WA 4UVBA 5JI6A 1ZLKA 2V9VA 3JSPA 1O3SA 1G6NA 1SFEA 3KP7A 1J5YA 4YFXF 3CUQC 2AS5F 1U6GA 1X3UA 4RGUA 4OMZA 4Y13A 5FLXK 2XAGA 1MDMB 1JHHA 3Q9VA 4LK1F 1WI9A 1YYVA 2LNBA 5D5XB 1REPC 1R5HA 3HIFA 4GO1A 4I0BA 1OYYA 4YFNF 4Y15A 2F5EA 1J75A 3E3VA 2H6CA 5J8FA 1T98A 2KIUA 2L54A 3ISPA 4IRGA 3TO6A 5DEQA 1T39A 3NEUA 2IT0A 3CJNA 3WTYC 4A6EA 5FO5A 1KA8A 4LMYA 4HYEA 5DDGA 4WXHA 1O3QA 2CWEA 3JTGA 3RTRA 3LSTA 3ERED 4HAMA 5E1WA 2FOKA 3V8KA 4BHBA 2W84A 1U5TB 3WTSC 3SZPA 5A2QK 3EQLF 1TBXA 4O6JA 2DLLA 3P7NA 2KKOA 2XAHA 4KT5C 4HBLA 5F6FA 3V7CA 3E6CC 3JW4A 4U7DA 2Z33A 2BV6A 1XGNA 2G9WA 2M45A 3KEOA 4LG0A 3BY6A 3GO5A 5HDKA 5HLHA 2ZNYA 1IXCA 1U5TC 4RGSA 3IRQA 1BN5A 3FXRA 4EV0A 4LGWA 3GZ5A 1OYWA 1T0FA 2P7VB 5CJ9A 3CO6C 2FXAA 2HZTA 5LEJA 4M6YA 2Q0OA 1Q1HA 4YIIA 3U2RA 5ILSA 1MZBA 5HDNA 3I59A 1UHMA 3G3ZA 3KEQA 4I2OA 1H0MA 4PCQA 2PBIA 2M87A 1Z91A 4G6QA 4MQ9F 2CQKA 1RUOA 1R1UA 2QQ9A 1U78A 4HX8A 3ZMSA 3GFMA 3U9GA 3HRSA 1BC7C 1Z9CA 5ED4A 2PFBA 4HDUA 4ENNA 2OA4A 1VTNC 4KNYA 1OPCA 4O3MA 1XDUA 3QPTA 5BPDA 3DF8A 2QQAA 1IUYA 2RC4A 2IPQX 3HRTA 3CDHA 1XSXA 1I1GA 2ADUA 4IF4A 2QWWA 5E8GA 2VE8A 1QPMA 2KJCA 1OKRA 3V8JA 1BM9A 3F8NA 2W25A 4ENMA 4L9VA 1L3LA 3I5UA 5K5OA 2HKOA 2IA0A 4GYIA 4KICA 2J5PA 3MAJA 3HHHA 1MGTA 1D8KA 1F4KA 1I1SA 3WGIA 4ZZLA 2BYVE 2V79A 5D6EA 4CICA 5E20A 5ILVA 4F7ZA 2WTEA 4QWQA 4P55A 2P5VA 3WU0A 4MHGA 3K2ZA 4LLNA 5TJJA 3HUGA 2ISYA 4M74A 4B09A 3ULQB 1TQPA 1R1TA 2PEXA 3OOPA 4LG0B 3K1NA 4PZJA 2FMLA 2O03A 3I54A 3KP6A 1ZHFA 2YX7A 2VT2A 4GYGA 2KRFA 5D5VB 4UV9A 3BWGA 1R58A 4RAYA 2DTRA 2V1UA 4EM2A 5H6RA 3KLNA 2Q2EA 5DD8A 5HVQC 2B0LA 1O3RA 1FZPB 4O5VA 5ICFA 2GA1A 1IN4A 1YW7A 4GCVA 4BAYA 5D8LB 3HTSB 3I59B 1F9NA 2ZKZA 3GFIA 1KQ8A 4M9ZA 3TDUC 1ZRFA 2Z9OA 3JAMZ 4KN7X 2LF8A 3TO7A 2H6BA 1YW8A 3FMSA 2P6SA 1MJBA 1KQ0A 4KN4X 2FRHA 4WF2A 2JSCA 3M8FA 2A61A 2DFIA 1LQ1A 2IA2A 3M1EA 3WG9A 4CXFA 2VBWA 2HKXA 1IRGA 3KLOA 3JAMK 4A12A 2UWMA 3I53A 1TQMA 5LHIA 1XGSA 1D8JA 1AWCA 4I98B 3IRRA 2NAZA 2VODA 1IXRC 3HOTA 3BDDA 5L3BA 5ERIA 1ZREA 3CUQA 1HW1A 2HQRA 2VXZA 1GXPA 2HTJA 2JPBA 1PUEE 2VBZA 2X0LA 5FFZA 2IA1A 2P5KA 3V4GA 2R7DA 4OINF 3MZYA 2IJLA 4PGHA 1Z7UA 1CGPA 2NNNA 2YX4A 1P4AA 3JTHA 2MA3A 4ETSA 3ELKA 4KIGA 2LKPA 3SHFA 2VONA 1P92A 1K6OA 3KP5A 4LD5A 5ICGA 4U0YA 4IHTA 3DPLC 1WSUA 5BMZA 3F3XA 2XV4S 4IHSA 2XVCA 2L4AA 2LDUA 3QAHA 1A04A 1WKMA 2A69F 2L01A 3WE3A 1R23A 4IRIA 2PMHA 3ROUA 1FP2A 4U7BA 2EA4A 3KZYA 2QBYA 3RPQA 2M8EA 4RS8A 1KYWA 4WXCA 3TO9A 2EFPA 2NYXA 1TW3A 4WXDA 3OV8A 3I4PA 3F23A 4BH9A 3DEUA 2MH2A 2ACJA 3M7GA 1HKTA 2AXLA 1HXDA 1JGSA 4LFUA 2OQRA 2EB7A 3ZN0A 2CYYA 1FSHA 2HDCA 1TNTA 3WTWC 5LBQA 3GFLA 1Y0UA 3GYHX 1BIBA 2WV0A 1YS6A 1LJ9A 4ON0A 1QNTA 1YW9A 2XKOA 1W4MA 3DP7A 4M71A 1HKSA 3E5UA 3FXUA 4M72A 3J81Z 5IT9Z 1SMYF 4HQMA 1XGMA 2BBYA 4S05A 2Q8KA 2D45A 3LWFA 5FD6A 2GIVA 1I6XA 4UUVA 3CUQB 4EJWA 3VODA 2GA2A 5HOOA 3SZTA 2A07F 2FBHA 3HYIA 3Q5FA 3J81K 3U1DA 5IT9K 1TQIA 1C0WA 3WTXC 3HOSA 2FE3A 4ZYDA 3IC7A 1E2XA 4BHPA 5TRDA 2A6EF 2H27A 4BXUA 2W24A 2GXBA 1BJAA 5DUKA 4KUMA 3IHUA 4MNUA 4BNCA 1OMIA 4ENJA 3GEZA 1KGSA 4PDKA 5E8IA 3WE2A 3C3WA 1ZARA 3QU3A 2K4JA 4FX4A 4NHJA 3VFZA 2DW4A 5A2QZ 5CLSA 1HBXG 3RKWA 4IXAA 1FT9A 3L7WA 5F1RA 3QU6A 2H94A 2XRNA 3BP8A 3GLXA 3F6OA 1R7JA 1MD0A 4IVNA 2MBFA 4AVPA 2Y48A 2QBYB 4ENKA 4XSZF 4JQFA 4RAZA 1F1ZA 2DPDA 4H0EA 2QYOA 2JZYA 2VOOA 3T8TA 3RYRA 1KU3A 2ELHA 2COMA 3FMQA 2GXGA 1LDDA 3FXQA 4AWXB 4A5NA 2FBKA 1KU7A 1QQIA 3ECHA 3DKWA 1SD7A 2DO7A 2FF4A 4KMFA 3DV8A 4LLGF 3C18A 2PJPA 2ZBKA 2XKPA 3HHGA 3ZQ7A 5H20A 1IXSB 3ML6A 3FM5A 1IN6A 1JHFA 1SD6A 3WU1B 3H92A 2G7UA 2FMYA 2EFOA 3WTTC 1YTYA 4NB5A 2DK5A 2F5DA 1CF7A 1FYMA 2PI0A 1GXQA 5ICEA 2BEOA 3N4MA 2G7HA 4HX7A 4CGZA 3RKYA 1XDSA 4HF0A 3D0SA 5D6FA 2K7LA 3QPHA 2BGCA 5LGTA 3CLOA 2E1NA 5LHGA 3ZMTA 2W85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQN A;  4HF2 A;  2RV8 A;  2EA2 A;  5D4R A;  3JSO A;  3K0L A;  2O61 A;  3FWE A;  5LLQ A;  4CO8 A;  2XAQ A;  1WQ2 A;  3T0Y A;  3HRM A;  2ZCW A;  4EJV A;  2F5F A;  4UVA A;  2FNP A;  4N9I A;  1GHC A;  3VOE A;  5CVR A;  3LAP A;  3R4K A;  2XIG A;  3RDI A;  1HKQ A;  4I7H A;  3M9A A;  4ZYE A;  2IRF G;  2PMU A;  2O3F A;  2ZXJ A;  2RN7 A;  4G7Z F;  3BZ6 A;  3LA3 A;  3RPU A;  5J6X A;  3HSF A;  1B9N A;  2OZU A;  3P9C A;  4BQA A;  4HQE A;  3GZ6 A;  2J5O A;  2NRA C;  4KA4 A;  2NS0 A;  1FBQ A;  3WGG A;  4AD9 A;  4G7O F;  2HS5 A;  1IF1 A;  1FBU A;  3R6S A;  3ECO A;  1BIA A;  1W5S A;  2VC1 A;  4WX9 A;  1FSE A;  4CHU A;  2PLY A;  1USS A;  2HYF A;  1T38 A;  4M9S A;  5JR3 A;  4Y17 A;  1LNW A;  1F5T A;  5DYM A;  3LQQ A;  4ZYG A;  5L3F A;  2MH9 A;  3O3K A;  4CZZ A;  1B9M A;  4MTD A;  2OU2 A;  2EV6 A;  2RKH A;  3L09 A;  3C7J A;  3KET A;  1SMT A;  4UXN A;  3T5X A;  3DFG A;  1K78 A;  1FYL A;  5D5W B;  1QO0 D;  1EH6 A;  3BJA A;  2UZK A;  4UVC A;  1SFU A;  4R1H A;  3J7A O;  2MLK A;  1CF7 B;  3FHZ A;  3MZH A;  4MTE A;  2MD5 A;  2HEO A;  3BPV A;  5ILU A;  3RYP A;  1YO5 C;  5LRR A;  1ON2 A;  1U8R A;  4A0Z A;  4ZZD A;  2JPC A;  4U0V A;  4L18 B;  2FNA A;  4XSX F;  3ZP5 A;  3PQK A;  4WWC A;  3I71 A;  3M8E A;  4OIO F;  5JFR A;  2F2E A;  2EJR A;  4RB0 A;  3WGH A;  1S29 A;  1IN8 A;  4S04 A;  5E18 F;  1XMA A;  3ZPL A;  3W6J B;  4E70 A;  2VT3 A;  3B02 A;  3GFJ A;  2A68 F;  1JE8 A;  1DPR A;  1PP7 U;  4ZH4 F;  1R36 A;  2GWR A;  1YFH A;  1JXS A;  5DUI A;  1ZRD A;  3DQV C;  4RB3 C;  1T6S A;  1SD4 A;  1P4X A;  4ESJ A;  5DCM A;  2L4M A;  1R1V A;  5H6Q A;  3F22 A;  4I09 A;  2VC0 A;  4I01 A;  1SD5 A;  1UB9 A;  1FX7 A;  1XB4 A;  3H3U A;  1FOK A;  1IAW A;  2V1X A;  4EVI A;  4BYY A;  3W6K B;  4HF1 A;  1LVA A;  4YFK F;  3G73 A;  3KFW X;  3FX3 A;  4KMU X;  3QP6 A;  3AAF A;  3F6V A;  2KJB A;  4U88 A;  3BOQ A;  1IN5 A;  3RJP A;  4BHC A;  1KQ9 A;  3F8B A;  3E6B A;  5E1X A;  2M1B A;  2V1D A;  2Z3Y A;  2CSO A;  3ZMD A;  5BOX A;  3J80 Z;  3TOA A;  1HW2 A;  1V4R A;  3BRO A;  2XAS A;  1IW7 F;  2OZ6 A;  4L5J A;  4P96 A;  4FX0 A;  1G3S A;  3IKV A;  4G94 A;  1SFX A;  3K69 A;  3ABU A;  1MJ9 A;  3S2W A;  2D1V A;  3QRF F;  2VBY A;  5DV5 A;  3RI4 A;  1W7P D;  1U3E M;  1FLI A;  1K78 B;  3J80 K;  5J8C A;  1DUX C;  2GZW A;  3ZMZ A;  1LEB A;  3E6D A;  4R8H A;  3DPT A;  2CW0 F;  1HST A;  2HWV A;  2Z99 A;  5BS6 A;  1BI2 A;  2IVM A;  4I02 A;  1XSV A;  4Q5S F;  4UHT A;  1D3Y A;  3EET A;  2ZFW A;  4AIH A;  4JK1 X;  1YIO A;  2FBI A;  4HV5 A;  1ZYR F;  4G6D A;  3TKY A;  5E17 F;  3BJO A;  4M9X A;  4G7H F;  1Z1D A;  3R60 A;  1PP8 F;  2GAU A;  4EMS A;  2P7C B;  2UXN A;  2LSO A;  3LQR A;  1SAX A;  3B73 A;  1ZG1 A;  1KYZ A;  5D5U B;  4NQW A;  3KCC A;  4RB2 C;  3BJ6 A;  2CGP A;  2H09 A;  3HSR A;  1RZ4 A;  5ICC A;  1FC3 A;  1S7O A;  1FWZ A;  4OMY A;  1ONV A;  2PG4 A;  1R00 A;  1FY7 A;  5DCM B;  4EJO A;  2DPU A;  2A6H F;  1D5V A;  4L9T A;  2RVC A;  3R0A A;  2RNJ A;  3SQN A;  2HQN A;  4EJT A;  2Y75 A;  4Z2Y A;  1S8N A;  1KU2 A;  2ESN A;  1EH7 A;  1YQA A;  2CO5 A;  2JTV A;  5HS7 A;  1HSJ A;  3LA2 A;  1UFM A;  1ON1 A;  4XBF A;  1IZ1 A;  2LF7 A;  3PFI A;  1RUN A;  3GXO A;  2UXX A;  4HLX A;  4WCG A;  3H3Z A;  3L9F A;  2DQR A;  5HLG A;  1FYK A;  1B59 A;  3FMR A;  1O3T A;  2PN6 A;  1GVJ A;  1R5G A;  1PDN C;  2NNY A;  2RDP A;  2VBX A;  3ZN1 A;  2ZME A;  3EYY A;  2E1C A;  5KVR A;  2C6Y A;  4IPA A;  2QUF A;  2EV0 A;  1P4W A;  1K79 A;  4AIJ A;  2EK5 A;  4OIR F;  4EM0 B;  3GF2 A;  5CYV A;  3F8C A;  3L00 A;  2QM3 A;  1XGO A;  3V7S A;  1XMK A;  5K5R A;  3VEP A;  2V6C A;  4MQV A;  3NQO A;  2TDX A;  3Q9S A;  3K1P A;  4CDG A;  4N9H A;  2HOE A;  5L3C A;  1TW2 A;  3GWZ A;  1S7A A;  1J59 A;  1UCR A;  1XSD A;  1FBS A;  2P8T A;  3K1M A;  4HZF A;  4RGX A;  4B8X A;  5HLI A;  1ZRC A;  1ZAO A;  4IJA A;  4ESB A;  2P4W A;  1BBY A;  1P6R A;  2ESH A;  1U2W A;  3ABT A;  2M30 A;  2K4B A;  5AIQ A;  5EEG A;  1L0O C;  5IT3 A;  1Z6T A;  3E97 A;  2BE5 F;  2HR3 A;  2P6T A;  2L02 A;  5E1Z B;  3T1B A;  1S3J A;  4R79 A;  3LFK A;  4OOI A;  4EGY A;  1S6L A;  5HDG A;  3MQ0 A;  2K27 A;  3HSE A;  5LRS A;  3R61 A;  4MGR A;  3EYI A;  5JHU A;  4KIB A;  2XGX A;  4EQQ A;  4L9J A;  1LDK B;  3GVA A;  3R0J A;  5AIP A;  1EV7 A;  3FM3 A;  3E6M A;  1YLF A;  1KU9 A;  3BPX A;  1DDN A;  3N97 A;  1HW5 A;  3V8L A;  4LK0 F;  2D1H A;  1H9G A;  4HA8 A;  2K86 A;  2E7X A;  4A0X A;  3LA7 A;  1OR7 A;  1BI1 A;  4P9U A;  1T2K A;  5CVI A;  4PGG A;  3WOD F;  1J0R A;  2P5L C;  4DQ2 A;  2L3D A;  3C1D A;  1ZGJ A;  2CFX A;  5JVT A;  2D2W A;  5FD5 A;  2WC2 A;  1YG2 A;  2F5C A;  3MWM A;  4L0Z B;  1FPQ A;  4P5O A;  1O7F A;  4I0A A;  1B4A A;  3HTU A;  1W7P A;  1ZG5 A;  1STZ A;  2XAF A;  1HQC A;  3GX4 X;  4M6X A;  1QGP A;  2ISZ A;  3MCZ A;  3WTU C;  5HS9 A;  4L5I A;  5FFX A;  3CUO A;  1ZGA A;  1G3W A;  1QZZ A;  3FZV A;  3QOP A;  1MJA A;  2STW A;  1YS7 A;  1Z05 A;  4YG2 F;  2ZME B;  5AON A;  2ZJ2 A;  1QBJ A;  2FEZ A;  4IRH A;  5L3D A;  2HTS A;  4OIP F;  4EGZ A;  5KK1 A;  4HV6 A;  2XRO A;  4WK8 F;  1R22 A;  2STT A;  4MEY F;  4A2U A;  1TTY A;  5LHH A;  1DPU A;  2EWN A;  1DP7 P;  4LB5 A;  3I0T A;  2KIF A;  3CTA A;  3P9K A;  4A5M A;  5LGU A;  1UHW A;  1WRJ A;  1ZN2 A;  5K1Y A;  2EV5 A;  4EM1 A;  2RGV A;  3K9T A;  2EFN A;  4Q48 A;  2RQP A;  2JRT A;  4LJZ F;  1NHA A;  2EFW A;  5CVV A;  4Q47 A;  1I27 A;  1RNL A;  1K7A A;  4D0P A;  2ZO4 A;  1J9I A;  2A5Y B;  2R7F A;  4ESF A;  4FHT A;  4HOB A;  3RIR A;  1B1B A;  2DT5 A;  4FT8 A;  3WTV C;  4JBA A;  4KDP A;  2FU4 A;  1G4D A;  2M5W A;  4L9N A;  4LB6 B;  2OQG A;  3PQJ A;  2XUB A;  5DD4 A;  3F21 A;  2DBB A;  4XLN F;  2O6G E;  1XCB A;  3LAJ A;  4RGR A;  4MEX F;  4HX4 A;  5D8K B;  3O2P E;  5F64 A;  5L3E A;  2HGC A;  2A3S A;  2R3S A;  3GW2 A;  4G9Y A;  2O0Y A;  5FB2 A;  1LB2 A;  3TOB A;  1BI3 A;  2VOP A;  5CVJ A;  2FA5 A;  4YIF A;  4HW0 A;  6PAX A;  3KE2 A;  1IN7 A;  3HRU A;  4L0Y B;  2DQL A;  3SXY A;  1BOA A;  2QEN A;  3QP5 A;  3KP2 A;  3KP3 A;  1MKM A;  3SFZ A;  4K2E A;  2Z5U A;  2X4H A;  2IW5 A;  2YU3 A;  3FF5 A;  3RKX A;  3DXJ F;  1E17 A;  3VB2 A;  4HLY A;  2ETH A;  3ZMU A;  3I58 A;  2K02 A;  1FNN A;  3MEX A;  2XAJ A;  2VN2 A;  1W7P B;  3T8R A;  3COA C;  3NRV A;  2YR2 A;  3CO7 C;  1BI0 A;  3I64 A;  2HFH A;  4CYD A;  3TGN A;  1B6A A;  4QLC U;  3ZMV A;  4HDV A;  1TLH B;  1UST A;  5BPI A;  1MDM A;  1ZG3 A;  4KFC A;  3IKT A;  2E7W A;  1IRF A;  2EFQ A;  1QZY A;  4GXO A;  2DAO A;  3D5L A;  1Z6R A;  2YSR A;  4A6D A;  2FQ3 A;  2MC3 A;  5L3G A;  1TNS A;  4RB1 A;  4TV7 A;  2ZNZ A;  1ZH5 A;  1V3F A;  5K5Q A;  1WWX A;  1ULY A;  4AIK A;  5EEH A;  4UNO A;  3E5Q A;  3F8M A;  1FP1 D;  4N0B A;  1W5T A;  3O6B B;  1EH8 A;  2MLG A;  2GQQ A;  1U5T A;  2CG4 A;  1G3Y A;  2PQ8 A;  3IWZ A;  1J7K A;  4ASN A;  4XRF A;  4G8X A;  4KYW A;  4GGG A;  4P9F A;  2OD5 A;  5HS8 A;  3EUH A;  2QVO A;  1XD7 A;  1RIO H;  5FGM A;  3EDP A;  3KP4 A;  1RI7 A;  1XCV A;  3F8F A;  2JT1 A;  5LEK A;  3KZZ A;  2QLZ A;  4M73 A;  3TDZ C;  2OBP A;  4OU0 A;  1LEA A;  2O8X A;  2Y0M A;  2OAZ A;  2QZ8 A;  2YPR A;  1J2X A;  1AOY A;  1BC8 C;  1P2F A;  2FSW A;  2VE9 A;  5CVU A;  1O7L A;  2DU9 A;  5LGN A;  2KIM A;  5D4S A;  4A0Y A;  1ZLJ A;  2QQB A;  1OYI A;  4ZYH A;  3IL2 A;  3WTZ A;  3P9I A;  2W57 A;  4KIF A;  1I5Z A;  1O57 A;  4EJU A;  1ODD A;  1XN7 A;  3E5X A;  2DI3 A;  4Q4Z F;  3V7R A;  4XLP F;  3L2C A;  3GUD A;  3MFK A;  1LDJ A;  4UV8 A;  5FLX Z;  3F72 A;  5DCF A;  5BQT A;  2WWY A;  4OIQ F;  2XHK A;  2IP2 A;  2HYG D;  1G3T A;  3IWF A;  4LLL A;  1H9T A;  3REO A;  4DNC A;  2DK8 A;  4U0W A;  4UVB A;  5JI6 A;  1ZLK A;  2V9V A;  3JSP A;  1O3S A;  1G6N A;  1SFE A;  3KP7 A;  1J5Y A;  4YFX F;  3CUQ C;  2AS5 F;  1U6G A;  1X3U A;  4RGU A;  4OMZ A;  4Y13 A;  5FLX K;  2XAG A;  1MDM B;  1JHH A;  3Q9V A;  4LK1 F;  1WI9 A;  1YYV A;  2LNB A;  5D5X B;  1REP C;  1R5H A;  3HIF A;  4GO1 A;  4I0B A;  1OYY A;  4YFN F;  4Y15 A;  2F5E A;  1J75 A;  3E3V A;  2H6C A;  5J8F A;  1T98 A;  2KIU A;  2L54 A;  3ISP A;  4IRG A;  3TO6 A;  5DEQ A;  1T39 A;  3NEU A;  2IT0 A;  3CJN A;  3WTY C;  4A6E A;  5FO5 A;  1KA8 A;  4LMY A;  4HYE A;  5DDG A;  4WXH A;  1O3Q A;  2CWE A;  3JTG A;  3RTR A;  3LST A;  3ERE D;  4HAM A;  5E1W A;  2FOK A;  3V8K A;  4BHB A;  2W84 A;  1U5T B;  3WTS C;  3SZP A;  5A2Q K;  3EQL F;  1TBX A;  4O6J A;  2DLL A;  3P7N A;  2KKO A;  2XAH A;  4KT5 C;  4HBL A;  5F6F A;  3V7C A;  3E6C C;  3JW4 A;  4U7D A;  2Z33 A;  2BV6 A;  1XGN A;  2G9W A;  2M45 A;  3KEO A;  4LG0 A;  3BY6 A;  3GO5 A;  5HDK A;  5HLH A;  2ZNY A;  1IXC A;  1U5T C;  4RGS A;  3IRQ A;  1BN5 A;  3FXR A;  4EV0 A;  4LGW A;  3GZ5 A;  1OYW A;  1T0F A;  2P7V B;  5CJ9 A;  3CO6 C;  2FXA A;  2HZT A;  5LEJ A;  4M6Y A;  2Q0O A;  1Q1H A;  4YII A;  3U2R A;  5ILS A;  1MZB A;  5HDN A;  3I59 A;  1UHM A;  3G3Z A;  3KEQ A;  4I2O A;  1H0M A;  4PCQ A;  2PBI A;  2M87 A;  1Z91 A;  4G6Q A;  4MQ9 F;  2CQK A;  1RUO A;  1R1U A;  2QQ9 A;  1U78 A;  4HX8 A;  3ZMS A;  3GFM A;  3U9G A;  3HRS A;  1BC7 C;  1Z9C A;  5ED4 A;  2PFB A;  4HDU A;  4ENN A;  2OA4 A;  1VTN C;  4KNY A;  1OPC A;  4O3M A;  1XDU A;  3QPT A;  5BPD A;  3DF8 A;  2QQA A;  1IUY A;  2RC4 A;  2IPQ X;  3HRT A;  3CDH A;  1XSX A;  1I1G A;  2ADU A;  4IF4 A;  2QWW A;  5E8G A;  2VE8 A;  1QPM A;  2KJC A;  1OKR A;  3V8J A;  1BM9 A;  3F8N A;  2W25 A;  4ENM A;  4L9V A;  1L3L A;  3I5U A;  5K5O A;  2HKO A;  2IA0 A;  4GYI A;  4KIC A;  2J5P A;  3MAJ A;  3HHH A;  1MGT A;  1D8K A;  1F4K A;  1I1S A;  3WGI A;  4ZZL A;  2BYV E;  2V79 A;  5D6E A;  4CIC A;  5E20 A;  5ILV A;  4F7Z A;  2WTE A;  4QWQ A;  4P55 A;  2P5V A;  3WU0 A;  4MHG A;  3K2Z A;  4LLN A;  5TJJ A;  3HUG A;  2ISY A;  4M74 A;  4B09 A;  3ULQ B;  1TQP A;  1R1T A;  2PEX A;  3OOP A;  4LG0 B;  3K1N A;  4PZJ A;  2FML A;  2O03 A;  3I54 A;  3KP6 A;  1ZHF A;  2YX7 A;  2VT2 A;  4GYG A;  2KRF A;  5D5V B;  4UV9 A;  3BWG A;  1R58 A;  4RAY A;  2DTR A;  2V1U A;  4EM2 A;  5H6R A;  3KLN A;  2Q2E A;  5DD8 A;  5HVQ C;  2B0L A;  1O3R A;  1FZP B;  4O5V A;  5ICF A;  2GA1 A;  1IN4 A;  1YW7 A;  4GCV A;  4BAY A;  5D8L B;  3HTS B;  3I59 B;  1F9N A;  2ZKZ A;  3GFI A;  1KQ8 A;  4M9Z A;  3TDU C;  1ZRF A;  2Z9O A;  3JAM Z;  4KN7 X;  2LF8 A;  3TO7 A;  2H6B A;  1YW8 A;  3FMS A;  2P6S A;  1MJB A;  1KQ0 A;  4KN4 X;  2FRH A;  4WF2 A;  2JSC A;  3M8F A;  2A61 A;  2DFI A;  1LQ1 A;  2IA2 A;  3M1E A;  3WG9 A;  4CXF A;  2VBW A;  2HKX A;  1IRG A;  3KLO A;  3JAM K;  4A12 A;  2UWM A;  3I53 A;  1TQM A;  5LHI A;  1XGS A;  1D8J A;  1AWC A;  4I98 B;  3IRR A;  2NAZ A;  2VOD A;  1IXR C;  3HOT A;  3BDD A;  5L3B A;  5ERI A;  1ZRE A;  3CUQ A;  1HW1 A;  2HQR A;  2VXZ A;  1GXP A;  2HTJ A;  2JPB A;  1PUE E;  2VBZ A;  2X0L A;  5FFZ A;  2IA1 A;  2P5K A;  3V4G A;  2R7D A;  4OIN F;  3MZY A;  2IJL A;  4PGH A;  1Z7U A;  1CGP A;  2NNN A;  2YX4 A;  1P4A A;  3JTH A;  2MA3 A;  4ETS A;  3ELK A;  4KIG A;  2LKP A;  3SHF A;  2VON A;  1P92 A;  1K6O A;  3KP5 A;  4LD5 A;  5ICG A;  4U0Y A;  4IHT A;  3DPL C;  1WSU A;  5BMZ A;  3F3X A;  2XV4 S;  4IHS A;  2XVC A;  2L4A A;  2LDU A;  3QAH A;  1A04 A;  1WKM A;  2A69 F;  2L01 A;  3WE3 A;  1R23 A;  4IRI A;  2PMH A;  3ROU A;  1FP2 A;  4U7B A;  2EA4 A;  3KZY A;  2QBY A;  3RPQ A;  2M8E A;  4RS8 A;  1KYW A;  4WXC A;  3TO9 A;  2EFP A;  2NYX A;  1TW3 A;  4WXD A;  3OV8 A;  3I4P A;  3F23 A;  4BH9 A;  3DEU A;  2MH2 A;  2ACJ A;  3M7G A;  1HKT A;  2AXL A;  1HXD A;  1JGS A;  4LFU A;  2OQR A;  2EB7 A;  3ZN0 A;  2CYY A;  1FSH A;  2HDC A;  1TNT A;  3WTW C;  5LBQ A;  3GFL A;  1Y0U A;  3GYH X;  1BIB A;  2WV0 A;  1YS6 A;  1LJ9 A;  4ON0 A;  1QNT A;  1YW9 A;  2XKO A;  1W4M A;  3DP7 A;  4M71 A;  1HKS A;  3E5U A;  3FXU A;  4M72 A;  3J81 Z;  5IT9 Z;  1SMY F;  4HQM A;  1XGM A;  2BBY A;  4S05 A;  2Q8K A;  2D45 A;  3LWF A;  5FD6 A;  2GIV A;  1I6X A;  4UUV A;  3CUQ B;  4EJW A;  3VOD A;  2GA2 A;  5HOO A;  3SZT A;  2A07 F;  2FBH A;  3HYI A;  3Q5F A;  3J81 K;  3U1D A;  5IT9 K;  1TQI A;  1C0W A;  3WTX C;  3HOS A;  2FE3 A;  4ZYD A;  3IC7 A;  1E2X A;  4BHP A;  5TRD A;  2A6E F;  2H27 A;  4BXU A;  2W24 A;  2GXB A;  1BJA A;  5DUK A;  4KUM A;  3IHU A;  4MNU A;  4BNC A;  1OMI A;  4ENJ A;  3GEZ A;  1KGS A;  4PDK A;  5E8I A;  3WE2 A;  3C3W A;  1ZAR A;  3QU3 A;  2K4J A;  4FX4 A;  4NHJ A;  3VFZ A;  2DW4 A;  5A2Q Z;  5CLS A;  1HBX G;  3RKW A;  4IXA A;  1FT9 A;  3L7W A;  5F1R A;  3QU6 A;  2H94 A;  2XRN A;  3BP8 A;  3GLX A;  3F6O A;  1R7J A;  1MD0 A;  4IVN A;  2MBF A;  4AVP A;  2Y48 A;  2QBY B;  4ENK A;  4XSZ F;  4JQF A;  4RAZ A;  1F1Z A;  2DPD A;  4H0E A;  2QYO A;  2JZY A;  2VOO A;  3T8T A;  3RYR A;  1KU3 A;  2ELH A;  2COM A;  3FMQ A;  2GXG A;  1LDD A;  3FXQ A;  4AWX B;  4A5N A;  2FBK A;  1KU7 A;  1QQI A;  3ECH A;  3DKW A;  1SD7 A;  2DO7 A;  2FF4 A;  4KMF A;  3DV8 A;  4LLG F;  3C18 A;  2PJP A;  2ZBK A;  2XKP A;  3HHG A;  3ZQ7 A;  5H20 A;  1IXS B;  3ML6 A;  3FM5 A;  1IN6 A;  1JHF A;  1SD6 A;  3WU1 B;  3H92 A;  2G7U A;  2FMY A;  2EFO A;  3WTT C;  1YTY A;  4NB5 A;  2DK5 A;  2F5D A;  1CF7 A;  1FYM A;  2PI0 A;  1GXQ A;  5ICE A;  2BEO A;  3N4M A;  2G7H A;  4HX7 A;  4CGZ A;  3RKY A;  1XDS A;  4HF0 A;  3D0S A;  5D6F A;  2K7L A;  3QPH A;  2BGC A;  5LGT A;  3CLO A;  2E1N A;  5LHG A;  3ZMT A;  2W85 A; 
#chains in the Genus database with same CATH topology
 3TQN A;  4HF2 A;  3BR6 A;  2RV8 A;  5IOZ A;  2JRM A;  2WAQ A;  2EA2 A;  5D4R A;  2M4K A;  2CV0 A;  1G2H A;  3JSO A;  4UUT A;  3K0L A;  2O61 A;  1E0E A;  3FWE A;  2XF7 A;  4BXX J;  2Y31 A;  5LLQ A;  4CO8 A;  3RCO A;  4B44 A;  3CCS I;  1ZR4 A;  3WHB A;  2XAQ A;  2XB0 X;  2WY8 Q;  4C2M J;  2X9D A;  4CA0 A;  1WQ2 A;  2IAI A;  3TBI A;  3VPR A;  3T0Y A;  1EKE A;  3PIO F;  2XRL A;  3HRM A;  3A01 A;  2O7O A;  2Y0S N;  2ZCW A;  4EJV A;  1UG0 A;  1D1A A;  1X3W B;  2F5F A;  4UVA A;  2DOE A;  2DA3 A;  2FNP A;  1TWH J;  4N9I A;  4Y3O A;  1GHC A;  3VOE A;  4AYB N;  5CVR A;  3LAP A;  4IL6 C;  3R4K A;  2VIX A;  4A3B J;  2XIG A;  4C3J J;  3RDI A;  1YX3 A;  1HKQ A;  4I7H A;  4BE0 A;  3M9A A;  4ZYE A;  3M3Y J;  3S17 J;  2CUJ A;  2IRF G;  2PMU A;  2WV1 A;  3H0D A;  2X51 A;  2QEX I;  2O3F A;  1S5L C;  2ZXJ A;  2RN7 A;  4G7Z F;  1ZGW A;  3IUO A;  3BZ6 A;  3LA3 A;  3RPU A;  4PUS A;  5J6X A;  3PNT A;  5EJC A;  1X3Z B;  3HSF A;  2DJN A;  2CFO A;  1B9N A;  3ZQQ A;  2OZU A;  3P9C A;  4BQA A;  4HQE A;  2ECC A;  2CU7 A;  3GZ6 A;  2WAD A;  2J5O A;  3DTE A;  2K85 A;  2FJ1 A;  1YOV B;  3IH4 A;  4KA4 A;  2NRA C;  3U1K A;  2NS0 A;  2NVX J;  1FBQ A;  1B72 A;  1MBK A;  3WGG A;  4AD9 A;  3S3M A;  4G7O F;  4XOR A;  2HS5 A;  4MO7 A;  3MKL A;  1IF1 A;  1FBU A;  4DOZ A;  3R6S A;  3ECO A;  1BIA A;  1W5S A;  2VC1 A;  4IKF A;  1I39 A;  1U0J A;  2KT0 A;  4WX9 A;  1A5J A;  1FSE A;  2LG4 A;  3K10 A;  4CHU A;  2Y9Y A;  2YU9 J;  2PLY A;  5HOD A;  2LYC A;  1FIP A;  1USS A;  2HYF A;  1MMS A;  1T38 A;  4M9S A;  2DA1 A;  5JR3 A;  1Y1W J;  2R0Q C;  1AU7 A;  4Y17 A;  1LNW A;  1F5T A;  5DYM A;  3LQQ A;  3BG7 A;  2MSY A;  4ZYG A;  5L3F A;  1Y0N A;  2DMP A;  2Y30 A;  2ZME C;  1ZTR A;  2R7W A;  2MH9 A;  5GTH C;  2CV2 A;  4BS9 A;  2HQA A;  2NVT J;  1T08 B;  3O3K A;  4M3B A;  4BBS J;  4CZZ A;  4PSX A;  4A3K J;  2K9N A;  1Y8R B;  3OYH A;  2IS6 A;  1B9M A;  4MTD A;  2OU2 A;  3CCY A;  2EV6 A;  1NK3 P;  2RKH A;  3L09 A;  3C7J A;  3O8G A;  3KET A;  1SMT A;  3S16 J;  4PJN A;  2E5N A;  4UXN A;  3T5X A;  3DFG A;  1K78 A;  1FYL A;  3LSP A;  4W97 A;  5D5W B;  1QO0 D;  1EH6 A;  3BTI A;  3BJA A;  2EZI A;  2M3A A;  4UVC A;  1KZH A;  2UZK A;  4A3C J;  4ZC3 A;  2M7B A;  3A0B C;  1SFU A;  4R1H A;  3J7A O;  3ABK H;  4E7L A;  2MLK A;  4AM3 A;  1LE8 B;  3HKZ A;  1CF7 B;  4BY1 J;  3FHZ A;  1PUF B;  3CC7 I;  1LFB A;  3MZH A;  4MTE A;  2LY1 A;  3OS2 A;  2MD5 A;  1R6R A;  3SDB A;  2HEO A;  3PUB A;  3BPV A;  2HDD A;  5ILU A;  1OCO H;  3OSF A;  3RYP A;  1YO5 C;  5LRR A;  1ON2 A;  5EGO A;  3DCF A;  1SFO J;  1U8R A;  2VKE A;  4A0Z A;  1B8I A;  4ZZD A;  1AKH B;  2R7T A;  4DYQ A;  2JPC A;  4U0V A;  1V5E A;  2LVS A;  4L18 B;  2FNA A;  3LSR A;  2OF7 A;  4XSX F;  3JCU C;  2CUF A;  2R7V A;  3ZP5 A;  3PQK A;  4WWC A;  3I71 A;  4D9J A;  5HLT A;  3JRG A;  3M8E A;  1VQ7 I;  4OIO F;  5JFR A;  2F2E A;  2EJR A;  4RB0 A;  2V4J C;  3WGH A;  1UEL B;  1S29 A;  2VQC A;  3LOC A;  1IN8 A;  1T56 A;  3VDX A;  1XTA A;  4MLO A;  4S04 A;  5E18 F;  2R93 J;  1XMA A;  3ZPL A;  4PJL A;  3W6J B;  4E70 A;  2VT3 A;  3B02 A;  3GFJ A;  2A68 F;  1JE8 A;  4IQJ A;  1DPR A;  1P7J A;  1PP7 U;  4ZH4 F;  1W36 C;  1R36 A;  1WGX A;  3A01 B;  4RM2 A;  2GWR A;  1YFH A;  4W1U A;  1JXS A;  3H35 A;  1IV6 A;  5DUI A;  1ZRD A;  3DQV C;  1YIT I;  4RB3 C;  3BTL A;  4FAS D;  1T6S A;  1SD4 A;  1P7I A;  4AVZ A;  1P4X A;  4S0H B;  1OCP A;  3IV5 A;  3ZRG A;  4ESJ A;  4B1R A;  5DCM A;  2L4M A;  2TRT A;  1R1V A;  5H6Q A;  3F22 A;  4I09 A;  1OJL A;  1JT0 A;  3KYL A;  2VC0 A;  4I01 A;  3OSG A;  4QSH A;  2EBI A;  1SD5 A;  3CJR B;  1UB9 A;  3QYF A;  1FX7 A;  1XB4 A;  3S32 A;  1WJB A;  3H3U A;  4BE1 A;  1FOK A;  1IAW A;  1OR7 C;  2JSP A;  2V1X A;  4EVI A;  4NC7 A;  4BYY A;  2VQH A;  3W6K B;  2JA7 J;  4HF1 A;  1XG1 A;  1LVA A;  3SJM A;  5EZH A;  3GBG A;  2B9S A;  4YFK F;  3G73 A;  3KFW X;  1IO2 A;  2ELJ A;  1MBF A;  3FX3 A;  5J4V A;  4HNU A;  3VSK A;  2QKM B;  4KMU X;  1B72 B;  3QP6 A;  3AAF A;  4CCO A;  3F6V A;  2KJB A;  5B1A H;  3DU6 A;  4U88 A;  3HKZ N;  3BOQ A;  2BOL A;  1IN5 A;  3FXK A;  5C4J J;  4E7I A;  3ZQH A;  3H3V K;  3RJP A;  4BHC A;  1KQ9 A;  3BR3 A;  3F8B A;  3E6B A;  3LSH A;  2M1B A;  5E1X A;  2V1D A;  3Q0V A;  4GRI A;  4C2U A;  2Z3Y A;  3OL3 A;  1HF0 A;  2CSO A;  3ZMD A;  3HOZ J;  1R49 A;  3CCM I;  1VQO I;  2WB1 A;  1MSF C;  2Y9Z A;  4OAY A;  4NNJ A;  5BOX A;  3J80 Z;  2FQ4 A;  3TOA A;  1AA7 A;  1V4R A;  2F4I A;  1HW2 A;  2AO9 A;  3BRO A;  1D1C A;  1IW7 F;  2KIS A;  2OZ6 A;  2VQL A;  2XAS A;  3OR1 C;  4L5J A;  4P96 A;  4FX0 A;  1G3S A;  2I10 A;  2CMP A;  3N05 A;  3IKV A;  4P1W A;  4G94 A;  2YUS A;  3ZQC A;  2HVQ A;  4XRS A;  1SFX A;  3K69 A;  4XKV A;  1RPW A;  3ABU A;  4PJM A;  3EUK L;  4E7Z A;  3L2U A;  1TT5 B;  1UJ8 A;  1MJ9 A;  3S2W A;  2D1V A;  4XOT A;  2E1O A;  3QRF F;  1SVO A;  3CMA I;  2VBY A;  5DV5 A;  3RI4 A;  1RR7 A;  1W7P D;  1U3E M;  1FLI A;  2W82 A;  2FUG 2;  4RAG A;  3G6E I;  1K78 B;  4DBQ A;  2DJI A;  4C3I J;  2X1D A;  3J80 K;  4LG3 A;  3H36 A;  3TP3 A;  5J8C A;  3JRI A;  1DUX C;  4NC6 A;  2GZW A;  2JA6 J;  3ZMZ A;  2EIJ H;  4XQF A;  1LEB A;  4J01 A;  2X6Y A;  3S2H J;  3E6D A;  3S1N J;  1V55 H;  2R5Z A;  2OCC H;  5FLM J;  4R8H A;  4C3H J;  3DPT A;  4IEJ A;  4IX7 A;  2CW0 F;  1HST A;  2HWV A;  2Z99 A;  3FIS A;  3BG3 A;  1FOX A;  5BS6 A;  5F04 A;  1BI2 A;  4FIS A;  2QGU A;  2IVM A;  3J7Y J;  4D5F A;  2O9L A;  4I02 A;  1XSV A;  5EGO B;  4Q5S F;  4UHT A;  1D3Y A;  2DOF A;  1H88 C;  1B8I B;  4A3G J;  2QA4 I;  3EET A;  2ZFW A;  4XLF A;  1A31 A;  2PMZ A;  4AIH A;  3RZO J;  4JK1 X;  1YIO A;  2BHY A;  5J1Y A;  2FBI A;  4HV5 A;  5FRN A;  1UHS A;  1ZYR F;  1LKX A;  3ZR8 X;  4G6D A;  3TKY A;  2HVS A;  3TP0 A;  5E17 F;  2BXZ A;  1BOB A;  3BJO A;  2XB5 A;  4M9X A;  4G7H F;  1WJD A;  1Z1D A;  3R60 A;  1PP8 F;  5B1B H;  4IQ4 A;  1E3H A;  3ONQ A;  2GAU A;  4EMS A;  2P7C B;  2UXN A;  2LSO A;  3LQR A;  5BNG A;  4FET A;  1SAX A;  5K7Z A;  2GOX B;  2R7U A;  3VYR B;  2MAB A;  3VSL A;  3B73 A;  2JVG A;  1ZG1 A;  1KYZ A;  5D5U B;  2L9R A;  4AC0 A;  4NQW A;  3KCC A;  5J1R A;  4RB2 C;  1I50 J;  3BJ6 A;  1QVU A;  2CGP A;  2ZJQ F;  2KLO A;  2H09 A;  3HSR A;  5E3N A;  1RZ4 A;  2E5Z A;  3FXL A;  5ICC A;  1FC3 A;  3HPH A;  1S7O A;  4Y33 A;  1FWZ A;  1X1P A;  3QPS A;  3CP8 A;  5EZG A;  4OMY A;  3CCV I;  1ONV A;  1NH3 A;  1ENH A;  2PG4 A;  2LY2 A;  1R00 A;  1FY7 A;  5DCM B;  4EJO A;  2DPU A;  2A6H F;  3DWL E;  4CCL A;  1D5V A;  4L9T A;  2RVC A;  3R0A A;  2RNJ A;  3SQN A;  1P9Q C;  2HQN A;  4EJT A;  3FK6 A;  2Y75 A;  2L9V A;  1MBE A;  1TL8 A;  9ANT A;  4XKW A;  4Z2Y A;  1S8N A;  1KU2 A;  4A3D J;  1VQ4 I;  2ESN A;  3S1M J;  3DKY A;  1EH7 A;  1YQA A;  2CO5 A;  2JTV A;  1E3P A;  1MBH A;  5HS7 A;  4B47 A;  4BBR J;  1HSJ A;  2JQ7 A;  2JA2 A;  3BR1 A;  3PSI A;  3LA2 A;  1T95 A;  1UFM A;  2KQR A;  3F9K A;  1JI8 A;  5M3M J;  4RM3 A;  3LSK A;  2MG4 A;  1ON1 A;  4XBF A;  1W0U A;  1IZ1 A;  2LF7 A;  3PFI A;  1RUN A;  3D1N I;  3GXO A;  3TW6 A;  2UXX A;  4BEH A;  1VND A;  4HLX A;  3BZK A;  5B3S H;  5GPC A;  2VJ4 A;  4WCG A;  2D5V A;  3K4N A;  2R4G A;  3H3Z A;  1QA6 A;  3L9F A;  2DQR A;  4H4K C;  5HLG A;  1FJL A;  1X4P A;  1G59 A;  1FYK A;  1B59 A;  3FMR A;  3CMM A;  3I4N J;  1O3T A;  3PSF A;  1ZEL A;  2PN6 A;  2GIZ A;  1GVJ A;  1R5G A;  1PDN C;  1HC8 A;  1BJZ A;  1ERD A;  4QPQ A;  1X19 A;  2X1E A;  2LR8 A;  2OC6 A;  2RDP A;  1KON A;  2VBX A;  4PJ0 C;  3ZN1 A;  2NNY A;  4E7H A;  1BW5 A;  1JJ6 C;  3HOY J;  5EEA A;  2JA5 J;  2Y2Z A;  2XSD C;  2ZME A;  2BY0 A;  3PM1 A;  3EYY A;  2BVM A;  5FKN A;  3NWS A;  4RMN A;  2E1C A;  5KVR A;  2E19 A;  2C6Y A;  4IPA A;  1Z7L A;  3WG7 H;  2QUF A;  2RQQ A;  1SEU A;  2HNH A;  2HI3 A;  2EV0 A;  1YE9 A;  1P4W A;  4M6V A;  3OYK A;  1K79 A;  4AIJ A;  2EK5 A;  4OIR F;  5DS9 A;  4EM0 B;  3HGY A;  3GF2 A;  5CYV A;  4AYB A;  3F8C A;  3L00 A;  2QM3 A;  1XGO A;  3EUA A;  2FD5 A;  1EF4 A;  5JLX A;  1YX5 A;  2KDZ A;  3BQZ A;  3V7S A;  1XMK A;  5GAH J;  5K5R A;  1EJ9 A;  1R9T J;  3VEP A;  1JTY A;  2ID6 A;  2LLK A;  2V6C A;  4M3D A;  5KHD A;  4X0G A;  3H1C A;  4MQV A;  2IEK A;  2L9N A;  2IS1 A;  5GTI C;  3NQO A;  5KCM A;  1MBG A;  2TDX A;  2R5Z B;  1UMQ A;  3IP4 B;  3Q9S A;  3K1P A;  4CDG A;  2BXY A;  2HOE A;  4N9H A;  3FBI B;  5L3C A;  1TW2 A;  2JUC A;  3GWZ A;  1S7A A;  1J59 A;  1UCR A;  2X6W A;  4AID A;  1XSD A;  1FBS A;  2P8T A;  4BY7 J;  3K1M A;  2XF6 A;  3GZN B;  3JRC A;  5IY5 H;  5FKK A;  4LIT A;  3B6A A;  4HZF A;  4CCK A;  4RGX A;  2GXA A;  4B8X A;  1LFP A;  3A1Y A;  5HLI A;  1ZRC A;  1ZAO A;  4IJA A;  1JKO C;  4ESB A;  4DGW B;  2P4W A;  2NOJ B;  1BBY A;  1P6R A;  2QSF X;  2ESH A;  3TL4 X;  1U2W A;  3ABT A;  2M30 A;  2K4B A;  5AIQ A;  5EEG A;  2VXD A;  1L0O C;  5IT3 A;  1Z6T A;  2OPT A;  1RR8 C;  3E97 A;  2BE5 F;  3M8J A;  2HR3 A;  2P6T A;  2L02 A;  5E1Z B;  3T1B A;  5EYR A;  3W3C A;  1S3J A;  3WU2 C;  4R79 A;  1BL0 A;  4E7K A;  2DA4 A;  3LFK A;  4OOI A;  2K9Q A;  4EGY A;  1S6L A;  5HDG A;  2MYS A;  3CF5 F;  3CES A;  3MQ0 A;  5F08 A;  2KIQ A;  2F5V A;  2K27 A;  4HSR A;  4NQW B;  1S72 I;  2LOO A;  3HSE A;  5LRS A;  3MKY B;  3R61 A;  3ZXS A;  4MGR A;  5K7F A;  3EYI A;  5JHU A;  2PJR A;  4KIB A;  2XGX A;  4EQQ A;  4IZZ A;  3CQZ J;  2Y69 H;  4L9J A;  1LDK B;  2DDB A;  3GVA A;  1X1C A;  3MD2 A;  3R0J A;  5AIP A;  1EV7 A;  1NG7 A;  1VFC A;  2WAF A;  2H1L A;  3FM3 A;  3E6M A;  4NC8 A;  1YLF A;  2ID3 A;  1H89 C;  3QYE A;  4IO9 F;  1KU9 A;  3BPX A;  2MFZ A;  1DDN A;  1QZE A;  3N97 A;  3RQI A;  2RRE A;  1HW5 A;  3V8L A;  4LK0 F;  2E35 A;  2D1H A;  1H9G A;  4HA8 A;  2HOA A;  2K86 A;  2E7X A;  4XOP A;  2L2O A;  4A0X A;  3LA7 A;  1OR7 A;  3ABL H;  1NK2 P;  4M3E A;  4JX5 A;  1BI1 A;  2VL8 A;  4XN0 A;  5CVI A;  4E7S A;  4P9U A;  3SDG A;  1T2K A;  2DA5 A;  1WJ5 A;  2K3P A;  1UG2 A;  4PGG A;  3WOD F;  1J0R A;  2P5L C;  1FTT A;  4DQ2 A;  1ZQ3 P;  4BL0 B;  3QPL A;  2L3D A;  4A3M J;  1LVK A;  2W48 A;  3C1D A;  1ZGJ A;  2CFX A;  5HNH A;  5JVT A;  2D2W A;  3FHN A;  2ZJR F;  2CUZ A;  4BEH B;  1RET A;  3QWL A;  2Z1D A;  5FD5 A;  2WC2 A;  3HJE A;  1S7E A;  1LPQ A;  5IPA A;  1YG2 A;  2F5C A;  3MWM A;  1IDY A;  4L0Z B;  1FPQ A;  1GV2 A;  4P5O A;  1O7F A;  4I0A A;  1B4A A;  3HTU A;  1W7P A;  4BKX A;  2DT7 B;  1ZG5 A;  4D7M A;  1STZ A;  3AFH A;  2XAF A;  1HQC A;  3GX4 X;  4XKB A;  4M6X A;  3PIP F;  1QGP A;  2ISZ A;  3MCZ A;  3BT9 A;  3WTU C;  4ZDO A;  5HS9 A;  4L5I A;  3H9J A;  5M3F J;  1K4T A;  5FFX A;  1Y6I A;  3CUO A;  1ZGA A;  1G3W A;  1QZZ A;  3FZV A;  3QOP A;  1MJA A;  2STW A;  1X4O A;  1YS7 A;  1Z05 A;  2P81 A;  2QKL B;  3CDI A;  2ZME B;  4RLF A;  5AON A;  5J3L A;  4YG2 F;  2ZJ2 A;  1QBJ A;  2FEZ A;  4IRH A;  3HM5 A;  4JX4 A;  5L3D A;  3AG4 H;  2HTS A;  4OIP F;  4EGZ A;  2LRE A;  5KK1 A;  2JJ7 A;  4HV6 A;  2XRO A;  4E4H A;  4WK8 F;  1R22 A;  4A3J J;  1VQ5 I;  2STT A;  3G1L A;  4MEY F;  4A2U A;  4JX6 A;  1YI2 I;  2R7R A;  1TTY A;  5LHH A;  1DPU A;  2EWN A;  4XIC A;  1K61 A;  1DP7 P;  4LB5 A;  3I0T A;  2KIF A;  3L2R A;  3CTA A;  3OL4 A;  3P9K A;  4A5M A;  1JKR C;  5LGU A;  4XN3 A;  1UHW A;  3J7A Y;  1M1E B;  1WRJ A;  4CYC A;  1VF9 A;  1ZN2 A;  5K1Y A;  3DLL F;  3HDD A;  2EV5 A;  4DJA A;  2XC7 A;  3S14 J;  4EM1 A;  2EZH A;  2RGV A;  2DFF A;  3K9T A;  2EFN A;  4Q48 A;  4XLE A;  4ZYA A;  2F4O B;  3G2B A;  2RQP A;  3BR0 A;  2JRT A;  1WH7 A;  4LJZ F;  1NHA A;  4YEL A;  4ZTJ A;  2EFW A;  2AXT C;  1WPK A;  2HXO A;  5CVV A;  4Q47 A;  3MMY B;  3GLL A;  1I27 A;  4E6K G;  1RNL A;  2KMU A;  1K7A A;  4D0P A;  2ZO4 A;  1MNM C;  2KP6 A;  1J9I A;  2KPM A;  2A5Y B;  4HNT A;  1V54 H;  2QCO A;  2R7F A;  2W7N A;  2JA8 J;  4ESF A;  5F0F A;  4FHT A;  4HOB A;  3RIR A;  1JJ8 C;  5GAE J;  1B1B A;  3L2V A;  2DT5 A;  4FT8 A;  3UNG C;  3WTV C;  4JBA A;  4OWR B;  4KDP A;  5JHF A;  3S3N A;  2FU4 A;  1G4D A;  4Y52 J;  2R7Z J;  2M5W A;  1WI3 A;  3IH2 A;  4YIR X;  4L9N A;  5E3L A;  4FQG A;  4QIW N;  1FMW A;  2R5Y A;  1APL C;  4PK4 A;  2NS8 A;  4LB6 B;  5J47 A;  1N25 A;  2LTP A;  2OQG A;  3S93 A;  2M9H A;  3PQJ A;  2HXI A;  2EZL A;  1T0F C;  2XUB A;  3MN2 A;  3Q0W A;  5DD4 A;  1AHD P;  4Y7N J;  3F21 A;  4AU7 A;  2DBB A;  4XLN F;  2PJR B;  2ME0 A;  3KZI C;  2O6G E;  1XCB A;  2K5C A;  2VJI A;  3LAJ A;  4RGR A;  3FXM A;  5B5E C;  4MEX F;  4HX4 A;  3PNV A;  3CCQ I;  5D8K B;  3O2P E;  5F64 A;  5L3E A;  2HGC A;  2A3S A;  2R3S A;  1Z21 A;  3GW2 A;  4RDU A;  4G9Y A;  4L5E A;  3AG2 H;  2O0Y A;  5FB2 A;  5M5Y J;  3GTK J;  4ITV A;  1XS9 A;  1V5G A;  1LB2 A;  1MND A;  4HG2 A;  3TOB A;  1BI3 A;  4BGD A;  5CVJ A;  3B6C A;  2F6C A;  2FA5 A;  2VOP A;  4YIF A;  4HW0 A;  1VQ9 I;  6PAX A;  3KE2 A;  1D0X A;  2A6T A;  1BR4 A;  2LKX A;  1IN7 A;  3HRU A;  5CQE A;  4L0Y B;  2QF7 A;  2DQL A;  1Z0X A;  3SXY A;  5E3O A;  1ZR2 A;  1BOA A;  1X1A A;  2QEN A;  3LMM A;  1GLN A;  1OCZ H;  3QP5 A;  3KP2 A;  2DOA A;  2E2H J;  3KP3 A;  1NTC A;  1MKM A;  3SFZ A;  2W4S A;  1GUU A;  4K2E A;  1OCR H;  2Z5U A;  2X4H A;  2IW5 A;  2YU3 A;  3FF5 A;  3RKX A;  3AG3 H;  3DXJ F;  1E17 A;  3VB2 A;  4HLY A;  1JKQ C;  2ETH A;  1H8A C;  3BG9 A;  3CMY A;  2LC2 A;  3ZMU A;  3CC2 I;  3I58 A;  2K02 A;  1FNN A;  3MEX A;  2XAJ A;  2VN2 A;  3CCE I;  1W7P B;  2KRH A;  3T8R A;  3COA C;  3NRV A;  3SEZ A;  3PO3 J;  2LMD A;  2YR2 A;  3CO7 C;  1BI0 A;  3I64 A;  2HFH A;  3KEY A;  1R4M B;  1PJR A;  3BCB A;  3TW7 A;  4CYD A;  3TGN A;  1B6A A;  2CUE A;  4QPO A;  1OQY A;  4QLC U;  4HEA 2;  2F4M B;  3ZMV A;  4HDV A;  1TLH B;  1UST A;  4G12 A;  1MIJ A;  3OYA A;  5BPI A;  3SFI A;  1R4N B;  3G1M A;  3K4B A;  1MDM A;  1ZG3 A;  4KFC A;  3A0H C;  3IKT A;  2E7W A;  3OOU A;  1IRF A;  2LRD A;  4J00 A;  1S9H A;  2EFQ A;  1QZY A;  4GXO A;  1F43 A;  3OR2 C;  3CCL I;  2EPF A;  2DAO A;  3OYN A;  1ETW A;  3D5L A;  1Z6R A;  2YSR A;  2R7O A;  3ERM A;  4A6D A;  2ZXI A;  2FQ3 A;  2K9S A;  4BDZ A;  5KAI C;  3HC7 A;  4MFE A;  3BQY A;  4IOA F;  4A3F J;  2DFE A;  1FMV A;  4CYC B;  2E2I J;  4D5C A;  4XK4 A;  2MC3 A;  5L3G A;  1TNS A;  4RB1 A;  4TV7 A;  2W1O A;  2ZNZ A;  1ZH5 A;  3OMY A;  1V3F A;  5K5Q A;  3P5J A;  1WWX A;  1HDD C;  2LP0 A;  1IDZ A;  2XGC A;  2DA7 A;  1ULY A;  2GOM A;  5CPR B;  4AIK A;  5EEH A;  2XPU A;  4UNO A;  2CQN A;  3WHC A;  2MC4 A;  1ORK A;  5F0H A;  3E5Q A;  3F8M A;  2CW8 A;  2VI6 A;  2R7X A;  1FP1 D;  1VQN I;  3UR3 C;  1JGG A;  2Z16 A;  5TGT A;  4N0B A;  3KIO A;  1W5T A;  3O6B B;  5IP6 A;  2I5U A;  3RKQ A;  1EH8 A;  4GDF A;  2GBY A;  2ME6 A;  2MLG A;  1ZKG A;  2GQQ A;  1U5T A;  2CG4 A;  1G3Y A;  4FCY A;  2PQ8 A;  1SC7 A;  3IWZ A;  1J7K A;  4ASN A;  3RPU D;  1R71 A;  4XRF A;  4G8X A;  4KYW A;  4GGG A;  3BZC A;  4P9F A;  2OD5 A;  5HS8 A;  3EUH A;  2QVO A;  1XD7 A;  3A4C A;  1U9O A;  3HGG A;  1RIO H;  5FGM A;  4RA2 A;  2R5Y B;  3EDP A;  3KP4 A;  1RI7 A;  1XCV A;  3F8F A;  3FKI J;  3LSM A;  4F91 B;  2JT1 A;  5LEK A;  1VQ6 I;  4C9Y A;  3KZZ A;  3ZQF A;  4KJZ A;  2DMN A;  2QLZ A;  5IP7 J;  4M73 A;  3TMO A;  3K70 D;  2H8W A;  3TDZ C;  2OBP A;  2XSJ C;  4OU0 A;  1LEA A;  4DBR A;  4QTR A;  2O8X A;  4N4N B;  2NXN B;  4JP0 A;  3C2H A;  1QRY A;  2CRG A;  2Y0M A;  1IUF A;  2OAZ A;  2QZ8 A;  3LFU A;  3H5A A;  2YPR A;  4Z6Y A;  3I9V 2;  3I55 I;  3U21 A;  1J2X A;  1AOY A;  2NVQ J;  1BC8 C;  3M07 A;  1P2F A;  2HPI A;  2FSW A;  2Z2S B;  2IGN A;  2DTZ A;  5EG0 A;  3S15 J;  2VE9 A;  4DIQ A;  5CVU A;  4A93 J;  3OIO A;  1O7L A;  1WJE A;  1IG7 A;  5IYD J;  2DU9 A;  5LGN A;  2XDV A;  2KIM A;  2A05 A;  3OIQ A;  4LIV A;  5D4S A;  4BQO A;  1HA8 A;  4A0Y A;  1ZLJ A;  2QQB A;  3D5S C;  1OYI A;  1BA5 A;  4ZYH A;  1VI0 A;  3TED A;  2IGM A;  2E60 A;  2YS9 A;  3PO2 J;  3IL2 A;  3WTZ A;  3P9I A;  2W57 A;  4KIF A;  3RSN A;  5E3M A;  4N4O B;  1DGW Y;  1D1B A;  1MH3 A;  1I5Z A;  1QHG A;  1O57 A;  2M4G A;  4EJU A;  3ZQL A;  5JLW A;  1ODD A;  1XN7 A;  3E5X A;  3A02 A;  2DI3 A;  4Q4Z F;  3V7R A;  4XLP F;  1IJW C;  2W00 A;  2AQE A;  3GUD A;  3L2C A;  3MFK A;  1LDJ A;  4NUB A;  4UV8 A;  5FLX Z;  3F72 A;  4KT6 A;  5DCF A;  5F1J A;  2DMT A;  5BQT A;  5CKT A;  1MH4 A;  1RKT A;  2WWY A;  2M0M A;  2BVL A;  3OYD A;  1EA3 A;  1N75 A;  2XHK A;  4OIQ F;  1MMN A;  1ETX A;  2K9L A;  2IP2 A;  2HYG D;  1G3T A;  3IWF A;  4LLL A;  3S8P A;  3OY9 A;  3JRE A;  4DYC A;  4XLA A;  2X6O A;  5DM6 F;  1H9T A;  1TT0 A;  3REO A;  4BU2 A;  3OYC A;  2O8K A;  4DNC A;  1K6Y A;  2DK8 A;  4U0W A;  2LY9 A;  1JKP C;  4UVB A;  5JI6 A;  1FOY A;  1ZLK A;  3CLQ A;  3FKJ A;  3PFY A;  4B3X A;  2V9V A;  3JSP A;  2DT6 A;  1O3S A;  3HXL A;  1G6N A;  1YJN I;  1ETQ A;  1SFE A;  3KP7 A;  2OV7 A;  1MMG A;  3BLY A;  4DW6 A;  2E2J J;  3QOD A;  1J5Y A;  2PX9 A;  3CUQ C;  4YFX F;  2AS5 F;  1U6G A;  1X3U A;  2LK2 A;  4OMZ A;  4RGU A;  3W2W A;  4Y13 A;  2XAG A;  2JWT A;  3CCR I;  5FLX K;  4XL9 A;  1MDM B;  1JHH A;  2E1M B;  2L9S A;  3Q9V A;  3JRH A;  4LK1 F;  1WI9 A;  1YYV A;  2LNB A;  3M4O J;  5D5X B;  1REP C;  1R5H A;  3HIF A;  2ECB A;  4GO1 A;  4I0B A;  1OYY A;  4YFN F;  2L7F P;  2LH9 A;  1SVL A;  3FDY A;  4Y15 A;  2V9K A;  1Y8Q B;  2KHM A;  2F5E A;  2R92 J;  1J75 A;  4UB8 C;  3E3V A;  2H6C A;  2X6X A;  1T98 A;  2KIU A;  5J8F A;  4BAC A;  3GTP J;  2L54 A;  4AUX A;  1TP4 A;  1PVE A;  3ISP A;  2E1M C;  4MIM A;  1U8B A;  5FKM A;  2V6E A;  1DGR M;  1VQM I;  2HQ5 A;  4IRG A;  3TO6 A;  5DEQ A;  1T39 A;  3NEU A;  2L5Q A;  2IT0 A;  3CJN A;  3WTY C;  4A6E A;  5FO5 A;  3JRD A;  1HLV A;  1KA8 A;  4LMY A;  4HYE A;  2VPR A;  4CSW A;  2ELK A;  5GPA A;  4WXH A;  5DDG A;  1O3Q A;  2BW3 A;  2CWE A;  4EAT A;  3ZCO A;  3JTG A;  2DA2 A;  5HNF A;  3RTR A;  1Z3X A;  4J19 A;  3LST A;  3ERE D;  2DOD A;  3KX2 A;  3GCM A;  4HAM A;  5E1W A;  2FOK A;  3E1S A;  2DFH A;  3V8K A;  4UB6 C;  4XON A;  4BHB A;  2XPV A;  1ETO A;  2W84 A;  2VJJ A;  1U5T B;  3WTS C;  3SZP A;  5A2Q K;  3EQL F;  1TBX A;  4O6J A;  2DLL A;  3P7N A;  2KKO A;  2XAH A;  4KT5 C;  1SAU A;  1OCT C;  4HBL A;  5F6F A;  3V7C A;  3RZD J;  3E6C C;  3JW4 A;  5J1U A;  2BZT A;  3HOX J;  4U7D A;  3DTI A;  2Z33 A;  2BV6 A;  1XGN A;  2G9W A;  3NWT A;  2CQX A;  2WY7 Q;  2M45 A;  4F93 B;  3KEO A;  4LG0 A;  3BY6 A;  3H5R A;  3Q3S A;  3GO5 A;  1I6H J;  2AQF A;  2I8D A;  1MMA A;  5HDK A;  5HLH A;  2ZNY A;  1IXC A;  1U5T C;  4RGS A;  2B63 J;  3BTC A;  3IRQ A;  5F27 A;  1BN5 A;  2EQR A;  3FXR A;  4EV0 A;  4LGW A;  3GZ5 A;  1OYW A;  3ZGK A;  3DEE A;  4HPQ A;  4Y4R A;  1T0F A;  3EUH C;  3W2V A;  2P7V B;  4F92 B;  5CJ9 A;  3CO6 C;  1DU0 A;  4F55 A;  2FXA A;  2JMW A;  2HZT A;  4RLQ A;  5LEJ A;  4IHW A;  1WFX A;  2EIM H;  2R7S A;  5CQG A;  1Y39 A;  2L7M P;  4BQN A;  4DZP A;  4M6Y A;  1V5F A;  5DTD A;  2Q0O A;  1Q1H A;  4YII A;  4FTH A;  2DCE A;  2HOT A;  3U2R A;  5ILS A;  5EG0 B;  3PNY A;  1TZL A;  1MZB A;  2JN6 A;  5HDN A;  3I59 A;  1WJC A;  1UHM A;  2ZFU A;  3G3Z A;  2NOG A;  4I6Z A;  2LKS A;  3CCU I;  3KEQ A;  4I2O A;  1H0M A;  4PCQ A;  3OS0 A;  3PJR A;  3HBL A;  1WZ2 A;  2PBI A;  3DU5 A;  2M87 A;  4HNV A;  1GVD A;  1Z91 A;  4G6Q A;  4MQ9 F;  3FBN B;  5FKO A;  2CQK A;  3HOV J;  1RUO A;  1R1U A;  4A3L J;  2KFD A;  2QQ9 A;  2MD0 A;  5K7H A;  2M0C A;  2VUM J;  1JUS A;  1U78 A;  4HX8 A;  2KRC A;  3ZMS A;  3GFM A;  2LFB A;  4XLH A;  3U9G A;  2CW7 A;  3HRS A;  2RNG A;  4ZDP A;  1BC7 C;  1Z9C A;  1K4S A;  2FX0 A;  5ED4 A;  4E7J A;  2PFB A;  4I99 C;  4HDU A;  1FOW A;  2CH0 A;  5GP9 A;  2N8G A;  2OA4 A;  4ENN A;  1VTN C;  1W1W E;  4KNY A;  1OPC A;  4O3M A;  3SZG A;  3S1Q J;  1XDU A;  1IRX A;  3QPT A;  5BPD A;  3DF8 A;  3EPZ A;  2QQA A;  3BTJ A;  1IUY A;  2RC4 A;  2IPQ X;  3HRT A;  3CDH A;  3OIP A;  2GLO A;  2IS2 A;  1XSX A;  1I1G A;  2ADU A;  4IF4 A;  4KIS A;  3K4C A;  2QWW A;  4BDY A;  5E8G A;  2VE8 A;  1QPM A;  1JUP A;  2DMQ A;  1X1B A;  2KJC A;  2KZG A;  3RQ4 A;  4BXF A;  1OKR A;  1FIA A;  1BM9 A;  3V8J A;  2RAE A;  2VJ5 A;  2OCE A;  3GME A;  3F8N A;  2DYS H;  2W25 A;  3AKZ A;  4ENM A;  1TWA J;  3S2D J;  3GTM J;  4L9V A;  1L3L A;  2B7E A;  2DMU A;  3I5U A;  5K5O A;  2HKO A;  1JTX A;  2IA0 A;  2VQG A;  3BC8 A;  4GYI A;  4KIC A;  4C2T A;  2J5P A;  3MAJ A;  3HHH A;  1ETY A;  1TWF J;  1MGT A;  1D8K A;  4CH7 A;  1F4K A;  3ASO H;  3Q0U A;  4IHY A;  2XF5 A;  1I1S A;  2E36 A;  4B43 A;  3WGI A;  1TWG J;  4ZZL A;  2BYV E;  2V79 A;  5D6E A;  3OYL A;  1TC3 C;  4CIC A;  3BR2 A;  2Q1Z B;  4A3I J;  5E20 A;  4C30 A;  2V1N A;  2BW3 B;  2GM4 A;  3O8H A;  3DKX A;  5ILV A;  2LBF A;  4F7Z A;  5KAF C;  2WTE A;  1XC5 A;  3UKG A;  1X2M A;  4QWQ A;  1BW6 A;  4P55 A;  4IHX A;  2P5V A;  3VYS B;  2KDO A;  4OAZ A;  3WU0 A;  3HOU J;  4MHG A;  2HPM A;  4I76 A;  3K2Z A;  4LLN A;  5TJJ A;  3HUG A;  1RRJ A;  4B4C A;  2ISY A;  1DP3 A;  1XPX A;  3JRA A;  3X2Q H;  3CDL A;  4M74 A;  1W5C C;  1YJ9 I;  4B09 A;  2M34 A;  2BY2 A;  3ULQ B;  1TQP A;  1R1T A;  2PEX A;  3OOP A;  4LG0 B;  2KZV A;  4PFP A;  3K1N A;  4PZJ A;  2AHQ A;  4CZC A;  3CF2 A;  2X48 A;  2FML A;  2O03 A;  2CJJ A;  3I54 A;  1RKW A;  3KP6 A;  3L2W A;  2WAQ N;  1ZHF A;  2YX7 A;  2VT2 A;  4GYG A;  2KRF A;  2HYJ A;  4XRS G;  5D5V B;  2EIN H;  1MSE C;  1N77 A;  3K4J A;  4UV9 A;  3BWG A;  1R58 A;  4JYK A;  4RAY A;  2DTR A;  4XKC A;  2NS7 A;  1T8I A;  3FK7 A;  2V1U A;  2ZXW H;  4EM2 A;  5H6R A;  3KLN A;  2Q2E A;  3FXO A;  5DD8 A;  3DPU A;  5GAG J;  2B0L A;  5HVQ C;  2LD5 A;  1O3R A;  2V9P A;  1FZP B;  3GTO J;  4O5V A;  3L1P A;  5ICF A;  3MKZ A;  2GA1 A;  1IN4 A;  1YW7 A;  4CUG A;  4GCV A;  2ZC2 A;  4BAY A;  5D8L B;  2HOS A;  4PJJ A;  1IV8 A;  2V26 A;  1SVM A;  3HTS B;  2QQ8 A;  1F9N A;  2ZKZ A;  3I59 B;  3GFI A;  1GT0 C;  3DLA A;  1KQ8 A;  3F0C A;  1GDT A;  4M9Z A;  3ZQI A;  5FKL A;  3LSI A;  1N78 A;  4A69 C;  3TDU C;  2VB6 A;  3BR5 A;  3OYI A;  1F36 A;  2WA0 A;  1ZRF A;  3AL0 B;  1FEX A;  4BE2 A;  4XMY A;  2VAS A;  3LNQ A;  3KYC B;  2Z9O A;  3GTQ J;  3JAM Z;  4KN7 X;  5LD2 C;  2LF8 A;  4D1Q A;  3TO7 A;  2P0W A;  2H6B A;  1YW8 A;  3FMS A;  2P6S A;  1MJB A;  1KQ0 A;  4KN4 X;  3E7L A;  2FRH A;  3K4M A;  4WF2 A;  2JSC A;  5JVG F;  1XX5 A;  5C44 J;  3M8F A;  3HEF A;  2A61 A;  2DFI A;  1SAN A;  2M7A A;  1LQ1 A;  3AL0 C;  2IA2 A;  3M1E A;  3WG9 A;  4CCJ A;  2IGK A;  1Z77 A;  4CXF A;  2TCT A;  2VBW A;  1Z67 A;  2HKX A;  3VYT B;  1HOM A;  1IRG A;  3KLO A;  5IP9 J;  3JAM K;  4A12 A;  2UWM A;  1SFK A;  3H5N A;  3I53 A;  1TQM A;  5LHI A;  1XGS A;  1D8J A;  1AWC A;  4I98 B;  1IC8 A;  3IRR A;  2NAZ A;  3DBH B;  1MNE A;  4A3E J;  4UUS A;  1IXR C;  2VOD A;  3HOT A;  3BDD A;  5L3B A;  4YEJ A;  5ERI A;  1ZRE A;  3CUQ A;  1HW1 A;  2IS4 A;  2HQR A;  4BUP A;  4KIT B;  3JR9 A;  1U9N A;  2VXZ A;  1E3O C;  1Q1V A;  3OYM A;  3MVP A;  1GXP A;  2HTJ A;  1CQT A;  2JPB A;  4M3G A;  1PUE E;  2VBZ A;  3PL8 A;  2X0L A;  1X2N A;  5FFZ A;  1UAA A;  1YHQ I;  2IA1 A;  2P5K A;  3V4G A;  2R7D A;  4OIN F;  3L2Q A;  3MZY A;  1ETK A;  1I3Q J;  2IJL A;  4PSW A;  2EIL H;  4PGH A;  1Z7U A;  4YRV A;  1CGP A;  1MBJ A;  2NNN A;  3K2A A;  1W36 D;  5M5W J;  2YX4 A;  4NDL A;  3HL2 A;  1P4A A;  1HCR A;  3JTH A;  1BR1 A;  2MA3 A;  4ETS A;  3GTL J;  3ELK A;  1POG A;  1TWC J;  4KIG A;  2LKP A;  3SHF A;  1K83 J;  2VKV A;  2VON A;  4ZDL A;  2LBF B;  2M2E A;  1VQP I;  1P92 A;  4FE4 A;  4HST A;  1K6O A;  3OYG A;  3CC4 I;  2EH3 A;  4CCN A;  1MW7 A;  3KP5 A;  3W6V A;  4LD5 A;  2IBD A;  5ICG A;  3JRB A;  4U0Y A;  4IHT A;  1I3A A;  3A03 A;  3DPL C;  2CS3 A;  1WSU A;  1ZK8 A;  5BMZ A;  3FIW A;  1NG6 A;  3F3X A;  3HUG B;  1VZ0 A;  2XV4 S;  4IHS A;  2XVC A;  2L4A A;  2LDU A;  3QAH A;  1A04 A;  2WAE A;  2DN0 A;  4F52 A;  1WKM A;  2A69 F;  2L01 A;  4JOM A;  3K6G A;  3GTJ J;  2HDW A;  3HOW J;  3WE3 A;  2DDA A;  3C2B A;  3K70 C;  1R23 A;  3KPH A;  3IH3 A;  4IRI A;  3ABM H;  3W2A A;  1BR2 A;  3NAR A;  3S3O A;  2PMH A;  3ROU A;  1ITY A;  3LL7 A;  1FP2 A;  4U7B A;  2CQ7 A;  2EA4 A;  1WJA A;  3KZY A;  2QBY A;  5C3E J;  1G8X A;  3RPQ A;  2M8E A;  4II3 A;  4RS8 A;  4U87 A;  3ZOB A;  4ABZ A;  4IHV A;  1KYW A;  4WXC A;  3TO9 A;  1WVR A;  1A6Q A;  2EFP A;  1TW3 A;  2MGQ A;  2NYX A;  3SYT A;  4EEF G;  1A35 A;  4WXD A;  2Q2E B;  3OS1 A;  3LSJ A;  3OV8 A;  2VPL A;  2DA6 A;  1YRN A;  3I4P A;  3OYF A;  1J09 A;  2L7Z A;  3LSG A;  3F23 A;  4BH9 A;  5DM7 F;  3DEU A;  3DTK A;  2MH2 A;  1D0Y A;  1X58 A;  4V19 K;  2ACJ A;  4B48 A;  4ZJZ A;  3M7G A;  1HKT A;  1QPI A;  3BCA A;  4ANJ A;  3OYB A;  2M8G X;  2AXL A;  3ESW B;  3I4M J;  4X1E A;  1OCC H;  1HXD A;  1JGS A;  2HU9 A;  1WJF A;  1ACI A;  3ZQG A;  2QSH X;  3CD6 I;  4PFO A;  4LFU A;  2OQR A;  2JK3 A;  2EB7 A;  3ZN0 A;  2CYY A;  2EZK A;  1FSH A;  2HDC A;  3J7Z I;  1TNT A;  3WTW C;  1YJW I;  2E71 A;  5LBQ A;  3GFL A;  1Y0U A;  2R7Q A;  3GYH X;  3IAS 2;  1BIB A;  2WV0 A;  3VWB A;  1YS6 A;  1LJ9 A;  4ON0 A;  3PUF A;  2CQQ A;  4BJ5 C;  1DQU A;  1W0T A;  1QNT A;  1YW9 A;  2XKO A;  4NBQ A;  2BY3 A;  1W4M A;  3DP7 A;  4M71 A;  1HKS A;  3E5U A;  5M5X J;  5J4Y A;  1OIS A;  4XID A;  3FXU A;  4M72 A;  3J81 Z;  4XNF A;  5IT9 Z;  3H0G J;  1OLT A;  2UUZ A;  1SMY F;  4V2F A;  4HQM A;  2K9M A;  1XGM A;  3KYD B;  2BBY A;  4S05 A;  2Q8K A;  2D45 A;  5B66 C;  3K7A J;  3LWF A;  5FD6 A;  2GIV A;  1VQ8 I;  2BY1 A;  2WBM A;  1WHU A;  1WH5 A;  2K40 A;  4LOC A;  2O5R A;  2WB1 N;  4UUS B;  3ASN H;  4BQQ A;  3I56 I;  3QOE A;  3S1R J;  1I6X A;  4UUV A;  3CUQ B;  4EJW A;  3VOD A;  2KL4 A;  2GA2 A;  4RBO A;  1Y1V J;  1A6I A;  2OJE D;  5HOO A;  3SZT A;  3OYJ A;  1XMX A;  2QSG X;  3DBR B;  4V2G A;  2A07 F;  2FBH A;  3HYI A;  3Q5F A;  1FTZ A;  2G0E A;  3IAM 2;  3U1D A;  3J81 K;  3DBL B;  3AG1 H;  4UY8 I;  5IT9 K;  1TQI A;  1IRZ A;  2IXS A;  1ETV A;  2H1K A;  3H9Q A;  4XRM A;  3WTX C;  3HOS A;  3M1C A;  2FE3 A;  1C0W A;  1QVT A;  4ZYD A;  3IC7 A;  1E2X A;  3HPG A;  4BHP A;  3CZ6 A;  2ZXH A;  4BJT A;  3G71 I;  5TRD A;  1MMD A;  2A6E F;  4M3F A;  1GV5 A;  5FJ8 J;  3SEQ A;  1UZC A;  2ZSI B;  4BXU A;  2H27 A;  2W24 A;  2GXB A;  1BJA A;  5DUK A;  2NVY J;  4KUM A;  3IHU A;  4MNU A;  1O4X A;  4MFD A;  2OTL I;  4BNC A;  1R5I D;  2VLA A;  4GFB A;  4X6A J;  1OMI A;  4ENJ A;  3GEZ A;  1KGS A;  5F0C A;  4PDK A;  2L0K A;  3D5R C;  4G6T B;  1JT6 A;  5E8I A;  5EDN A;  3WE2 A;  1RES A;  5FLV A;  4RAF A;  1OFC X;  1D5Y A;  3C3W A;  2VKH A;  1Z3Y A;  1ZAR A;  3QU3 A;  3QYB A;  1QHH D;  1T33 A;  2K4J A;  4FX4 A;  5FRO A;  5GAD J;  2XAU A;  2ICW G;  2V7F A;  3QQA A;  4FE7 A;  4NHJ A;  3VFZ A;  5KNL A;  2DW4 A;  5A2Q Z;  2JUG A;  2XPW A;  3CJT B;  5CLS A;  2EIK H;  2ZB9 A;  2H8R A;  1HBX G;  3RKW A;  4IXA A;  1FT9 A;  1LUJ B;  3L7W A;  5F1R A;  4B3A A;  3HZJ A;  2PMZ N;  4CCM A;  3QU6 A;  2MW8 A;  3JRF A;  1YIJ I;  2H94 A;  5LFA A;  2XRN A;  3BP8 A;  5H2F C;  3GLX A;  3F6O A;  1R7J A;  2OTJ I;  1MD0 A;  1VQL I;  4DYR A;  4IVN A;  2X85 A;  5IYC J;  2HZD A;  2MBF A;  2XGE A;  3K4L A;  4AVP A;  2Y48 A;  2QBY B;  3A2K A;  3BG6 A;  4ENK A;  4XSZ F;  2L7K A;  4JQF A;  2Y0S A;  4RAZ A;  1F1Z A;  5IYB J;  2DPD A;  2XGD A;  4H0E A;  2QYO A;  4ZTF A;  2JZY A;  5FRM A;  2VOO A;  3T8T A;  2JVH A;  3RYR A;  1D0Z A;  3CP2 A;  2BHZ A;  4IOC F;  1KU3 A;  2ELH A;  3HG9 A;  4XR6 A;  2COM A;  2DYR H;  5J40 A;  3FMQ A;  5C4X J;  1YRN B;  2GXG A;  2UV1 A;  1LDD A;  3MZ8 A;  3OWT A;  3FXQ A;  2COB A;  1IGN A;  4AWX B;  4A5N A;  2FBK A;  1KU7 A;  5EF6 A;  1WCM J;  2K3F A;  1QQI A;  1A36 A;  3ECH A;  3DKW A;  2X1C A;  2OUM A;  1SD7 A;  2DO7 A;  1RC9 A;  1X1D A;  2CV1 A;  2A5W A;  2FF4 A;  4KMF A;  3DV8 A;  3CJQ B;  4LLG F;  3C18 A;  2PJP A;  2ZBK A;  3GTG J;  3H9G A;  2F48 A;  3OYE A;  4LIU A;  3V42 A;  4XLC A;  2XKP A;  3HHG A;  4II2 A;  3ZQ7 A;  3G1O A;  3K4K A;  5H20 A;  4BJ6 C;  1IXS B;  2IGO A;  3ML6 A;  1JUM A;  3FM5 A;  1IN6 A;  1JHF A;  1SD6 A;  3WU1 B;  1DU6 A;  3NAU A;  3H92 A;  2G7U A;  2FMY A;  2EFO A;  1VQK I;  3WTT C;  3C2G A;  1YTY A;  1HDP A;  4NB5 A;  2DK5 A;  3MKW B;  2F5D A;  1LE8 A;  3BG5 A;  3CME I;  1CF7 A;  1LFU P;  1FYM A;  1PUF A;  3HB9 A;  3I3L A;  1Y56 A;  2ZJP F;  2FOW A;  5E79 C;  2PI0 A;  3E0J B;  1GXQ A;  5ICE A;  2BEO A;  5IOY A;  3VYU B;  3N4M A;  2G7H A;  4HRI A;  2VKD A;  4HX7 A;  3G4S I;  4CGZ A;  3RKY A;  4DZJ A;  1AKH A;  1XDS A;  2ZSH B;  3D0S A;  4HF0 A;  2K7L A;  5D6F A;  2NVU B;  4D7N A;  3FXJ A;  3QPH A;  4XM3 A;  2BGC A;  5TIS C;  3DEW A;  5LGT A;  3CLO A;  2E34 A;  2DXI A;  1QU3 A;  2HVR A;  2E1N A;  4F3Q A;  5LHG A;  1PYV A;  3ZMT A;  2W85 A;  3CCJ I; 
#chains in the Genus database with same CATH homology
 3TQN A;  4HF2 A;  2RV8 A;  2EA2 A;  5D4R A;  3JSO A;  3K0L A;  2O61 A;  3FWE A;  5LLQ A;  4CO8 A;  2XAQ A;  1WQ2 A;  3T0Y A;  3HRM A;  2ZCW A;  4EJV A;  2F5F A;  4UVA A;  2FNP A;  4N9I A;  1GHC A;  3VOE A;  5CVR A;  3LAP A;  3R4K A;  2XIG A;  3RDI A;  1HKQ A;  4I7H A;  3M9A A;  4ZYE A;  2IRF G;  2PMU A;  2O3F A;  2ZXJ A;  2RN7 A;  4G7Z F;  3BZ6 A;  3LA3 A;  3RPU A;  5J6X A;  3HSF A;  1B9N A;  2OZU A;  3P9C A;  4BQA A;  4HQE A;  3GZ6 A;  2J5O A;  2NRA C;  4KA4 A;  2NS0 A;  1FBQ A;  3WGG A;  4AD9 A;  4G7O F;  2HS5 A;  1IF1 A;  1FBU A;  3R6S A;  3ECO A;  1BIA A;  1W5S A;  2VC1 A;  4WX9 A;  1FSE A;  4CHU A;  2PLY A;  1USS A;  2HYF A;  1T38 A;  4M9S A;  5JR3 A;  4Y17 A;  1LNW A;  1F5T A;  5DYM A;  3LQQ A;  4ZYG A;  5L3F A;  2MH9 A;  3O3K A;  4CZZ A;  1B9M A;  4MTD A;  2OU2 A;  2EV6 A;  2RKH A;  3L09 A;  3C7J A;  3KET A;  1SMT A;  4UXN A;  3T5X A;  3DFG A;  1K78 A;  1FYL A;  5D5W B;  1QO0 D;  1EH6 A;  3BJA A;  2UZK A;  4UVC A;  1SFU A;  4R1H A;  3J7A O;  2MLK A;  1CF7 B;  3FHZ A;  3MZH A;  4MTE A;  2MD5 A;  2HEO A;  3BPV A;  5ILU A;  3RYP A;  1YO5 C;  5LRR A;  1ON2 A;  1U8R A;  4A0Z A;  4ZZD A;  2JPC A;  4U0V A;  4L18 B;  2FNA A;  4XSX F;  3ZP5 A;  3PQK A;  4WWC A;  3I71 A;  3M8E A;  4OIO F;  5JFR A;  2F2E A;  2EJR A;  4RB0 A;  3WGH A;  1S29 A;  1IN8 A;  4S04 A;  5E18 F;  1XMA A;  3ZPL A;  3W6J B;  4E70 A;  2VT3 A;  3B02 A;  3GFJ A;  2A68 F;  1JE8 A;  1DPR A;  1PP7 U;  4ZH4 F;  1R36 A;  2GWR A;  1YFH A;  1JXS A;  5DUI A;  1ZRD A;  3DQV C;  4RB3 C;  1T6S A;  1SD4 A;  1P4X A;  4ESJ A;  5DCM A;  2L4M A;  1R1V A;  5H6Q A;  3F22 A;  4I09 A;  2VC0 A;  4I01 A;  1SD5 A;  1UB9 A;  1FX7 A;  1XB4 A;  3H3U A;  1FOK A;  1IAW A;  2V1X A;  4EVI A;  4BYY A;  3W6K B;  4HF1 A;  1LVA A;  4YFK F;  3G73 A;  3KFW X;  3FX3 A;  4KMU X;  3QP6 A;  3AAF A;  3F6V A;  2KJB A;  4U88 A;  3BOQ A;  1IN5 A;  3RJP A;  4BHC A;  1KQ9 A;  3F8B A;  3E6B A;  5E1X A;  2M1B A;  2V1D A;  2Z3Y A;  2CSO A;  3ZMD A;  5BOX A;  3J80 Z;  3TOA A;  1HW2 A;  1V4R A;  3BRO A;  2XAS A;  1IW7 F;  2OZ6 A;  4L5J A;  4P96 A;  4FX0 A;  1G3S A;  3IKV A;  4G94 A;  1SFX A;  3K69 A;  3ABU A;  1MJ9 A;  3S2W A;  2D1V A;  3QRF F;  2VBY A;  5DV5 A;  3RI4 A;  1W7P D;  1U3E M;  1FLI A;  1K78 B;  3J80 K;  5J8C A;  1DUX C;  2GZW A;  3ZMZ A;  1LEB A;  3E6D A;  4R8H A;  3DPT A;  2CW0 F;  1HST A;  2HWV A;  2Z99 A;  5BS6 A;  1BI2 A;  2IVM A;  4I02 A;  1XSV A;  4Q5S F;  4UHT A;  1D3Y A;  3EET A;  2ZFW A;  4AIH A;  4JK1 X;  1YIO A;  2FBI A;  4HV5 A;  1ZYR F;  4G6D A;  3TKY A;  5E17 F;  3BJO A;  4M9X A;  4G7H F;  1Z1D A;  3R60 A;  1PP8 F;  2GAU A;  4EMS A;  2P7C B;  2UXN A;  2LSO A;  3LQR A;  1SAX A;  3B73 A;  1ZG1 A;  1KYZ A;  5D5U B;  4NQW A;  3KCC A;  4RB2 C;  3BJ6 A;  2CGP A;  2H09 A;  3HSR A;  1RZ4 A;  5ICC A;  1FC3 A;  1S7O A;  1FWZ A;  4OMY A;  1ONV A;  2PG4 A;  1R00 A;  1FY7 A;  5DCM B;  4EJO A;  2DPU A;  2A6H F;  1D5V A;  4L9T A;  2RVC A;  3R0A A;  2RNJ A;  3SQN A;  2HQN A;  4EJT A;  2Y75 A;  4Z2Y A;  1S8N A;  1KU2 A;  2ESN A;  1EH7 A;  1YQA A;  2CO5 A;  2JTV A;  5HS7 A;  1HSJ A;  3LA2 A;  1UFM A;  1ON1 A;  4XBF A;  1IZ1 A;  2LF7 A;  3PFI A;  1RUN A;  3GXO A;  2UXX A;  4HLX A;  4WCG A;  3H3Z A;  3L9F A;  2DQR A;  5HLG A;  1FYK A;  1B59 A;  3FMR A;  1O3T A;  2PN6 A;  1GVJ A;  1R5G A;  1PDN C;  2NNY A;  2RDP A;  2VBX A;  3ZN1 A;  2ZME A;  3EYY A;  2E1C A;  5KVR A;  2C6Y A;  4IPA A;  2QUF A;  2EV0 A;  1P4W A;  1K79 A;  4AIJ A;  2EK5 A;  4OIR F;  4EM0 B;  3GF2 A;  5CYV A;  3F8C A;  3L00 A;  2QM3 A;  1XGO A;  3V7S A;  1XMK A;  5K5R A;  3VEP A;  2V6C A;  4MQV A;  3NQO A;  2TDX A;  3Q9S A;  3K1P A;  4CDG A;  4N9H A;  2HOE A;  5L3C A;  1TW2 A;  3GWZ A;  1S7A A;  1J59 A;  1UCR A;  1XSD A;  1FBS A;  2P8T A;  3K1M A;  4HZF A;  4RGX A;  4B8X A;  5HLI A;  1ZRC A;  1ZAO A;  4IJA A;  4ESB A;  2P4W A;  1BBY A;  1P6R A;  2ESH A;  1U2W A;  3ABT A;  2M30 A;  2K4B A;  5AIQ A;  5EEG A;  1L0O C;  5IT3 A;  1Z6T A;  3E97 A;  2BE5 F;  2HR3 A;  2P6T A;  2L02 A;  5E1Z B;  3T1B A;  1S3J A;  4R79 A;  3LFK A;  4OOI A;  4EGY A;  1S6L A;  5HDG A;  3MQ0 A;  2K27 A;  3HSE A;  5LRS A;  3R61 A;  4MGR A;  3EYI A;  5JHU A;  4KIB A;  2XGX A;  4EQQ A;  4L9J A;  1LDK B;  3GVA A;  3R0J A;  5AIP A;  1EV7 A;  3FM3 A;  3E6M A;  1YLF A;  1KU9 A;  3BPX A;  1DDN A;  3N97 A;  1HW5 A;  3V8L A;  4LK0 F;  2D1H A;  1H9G A;  4HA8 A;  2K86 A;  2E7X A;  4A0X A;  3LA7 A;  1OR7 A;  1BI1 A;  4P9U A;  1T2K A;  5CVI A;  4PGG A;  3WOD F;  1J0R A;  2P5L C;  4DQ2 A;  2L3D A;  3C1D A;  1ZGJ A;  2CFX A;  5JVT A;  2D2W A;  5FD5 A;  2WC2 A;  1YG2 A;  2F5C A;  3MWM A;  4L0Z B;  1FPQ A;  4P5O A;  1O7F A;  4I0A A;  1B4A A;  3HTU A;  1W7P A;  1ZG5 A;  1STZ A;  2XAF A;  1HQC A;  3GX4 X;  4M6X A;  1QGP A;  2ISZ A;  3MCZ A;  3WTU C;  5HS9 A;  4L5I A;  5FFX A;  3CUO A;  1ZGA A;  1G3W A;  1QZZ A;  3FZV A;  3QOP A;  1MJA A;  2STW A;  1YS7 A;  1Z05 A;  4YG2 F;  2ZME B;  5AON A;  2ZJ2 A;  1QBJ A;  2FEZ A;  4IRH A;  5L3D A;  2HTS A;  4OIP F;  4EGZ A;  5KK1 A;  4HV6 A;  2XRO A;  4WK8 F;  1R22 A;  2STT A;  4MEY F;  4A2U A;  1TTY A;  5LHH A;  1DPU A;  2EWN A;  1DP7 P;  4LB5 A;  3I0T A;  2KIF A;  3CTA A;  3P9K A;  4A5M A;  5LGU A;  1UHW A;  1WRJ A;  1ZN2 A;  5K1Y A;  2EV5 A;  4EM1 A;  2RGV A;  3K9T A;  2EFN A;  4Q48 A;  2RQP A;  2JRT A;  4LJZ F;  1NHA A;  2EFW A;  5CVV A;  4Q47 A;  1I27 A;  1RNL A;  1K7A A;  4D0P A;  2ZO4 A;  1J9I A;  2A5Y B;  2R7F A;  4ESF A;  4FHT A;  4HOB A;  3RIR A;  1B1B A;  2DT5 A;  4FT8 A;  3WTV C;  4JBA A;  4KDP A;  2FU4 A;  1G4D A;  2M5W A;  4L9N A;  4LB6 B;  2OQG A;  3PQJ A;  2XUB A;  5DD4 A;  3F21 A;  2DBB A;  4XLN F;  2O6G E;  1XCB A;  3LAJ A;  4RGR A;  4MEX F;  4HX4 A;  5D8K B;  3O2P E;  5F64 A;  5L3E A;  2HGC A;  2A3S A;  2R3S A;  3GW2 A;  4G9Y A;  2O0Y A;  5FB2 A;  1LB2 A;  3TOB A;  1BI3 A;  2VOP A;  5CVJ A;  2FA5 A;  4YIF A;  4HW0 A;  6PAX A;  3KE2 A;  1IN7 A;  3HRU A;  4L0Y B;  2DQL A;  3SXY A;  1BOA A;  2QEN A;  3QP5 A;  3KP2 A;  3KP3 A;  1MKM A;  3SFZ A;  4K2E A;  2Z5U A;  2X4H A;  2IW5 A;  2YU3 A;  3FF5 A;  3RKX A;  3DXJ F;  1E17 A;  3VB2 A;  4HLY A;  2ETH A;  3ZMU A;  3I58 A;  2K02 A;  1FNN A;  3MEX A;  2XAJ A;  2VN2 A;  1W7P B;  3T8R A;  3COA C;  3NRV A;  2YR2 A;  3CO7 C;  1BI0 A;  3I64 A;  2HFH A;  4CYD A;  3TGN A;  1B6A A;  4QLC U;  3ZMV A;  4HDV A;  1TLH B;  1UST A;  5BPI A;  1MDM A;  1ZG3 A;  4KFC A;  3IKT A;  2E7W A;  1IRF A;  2EFQ A;  1QZY A;  4GXO A;  2DAO A;  3D5L A;  1Z6R A;  2YSR A;  4A6D A;  2FQ3 A;  2MC3 A;  5L3G A;  1TNS A;  4RB1 A;  4TV7 A;  2ZNZ A;  1ZH5 A;  1V3F A;  5K5Q A;  1WWX A;  1ULY A;  4AIK A;  5EEH A;  4UNO A;  3E5Q A;  3F8M A;  1FP1 D;  4N0B A;  1W5T A;  3O6B B;  1EH8 A;  2MLG A;  2GQQ A;  1U5T A;  2CG4 A;  1G3Y A;  2PQ8 A;  3IWZ A;  1J7K A;  4ASN A;  4XRF A;  4G8X A;  4KYW A;  4GGG A;  4P9F A;  2OD5 A;  5HS8 A;  3EUH A;  2QVO A;  1XD7 A;  1RIO H;  5FGM A;  3EDP A;  3KP4 A;  1RI7 A;  1XCV A;  3F8F A;  2JT1 A;  5LEK A;  3KZZ A;  2QLZ A;  4M73 A;  3TDZ C;  2OBP A;  4OU0 A;  1LEA A;  2O8X A;  2Y0M A;  2OAZ A;  2QZ8 A;  2YPR A;  1J2X A;  1AOY A;  1BC8 C;  1P2F A;  2FSW A;  2VE9 A;  5CVU A;  1O7L A;  2DU9 A;  5LGN A;  2KIM A;  5D4S A;  4A0Y A;  1ZLJ A;  2QQB A;  1OYI A;  4ZYH A;  3IL2 A;  3WTZ A;  3P9I A;  2W57 A;  4KIF A;  1I5Z A;  1O57 A;  4EJU A;  1ODD A;  1XN7 A;  3E5X A;  2DI3 A;  4Q4Z F;  3V7R A;  4XLP F;  3L2C A;  3GUD A;  3MFK A;  1LDJ A;  4UV8 A;  5FLX Z;  3F72 A;  5DCF A;  5BQT A;  2WWY A;  4OIQ F;  2XHK A;  2IP2 A;  2HYG D;  1G3T A;  3IWF A;  4LLL A;  1H9T A;  3REO A;  4DNC A;  2DK8 A;  4U0W A;  4UVB A;  5JI6 A;  1ZLK A;  2V9V A;  3JSP A;  1O3S A;  1G6N A;  1SFE A;  3KP7 A;  1J5Y A;  4YFX F;  3CUQ C;  2AS5 F;  1U6G A;  1X3U A;  4RGU A;  4OMZ A;  4Y13 A;  5FLX K;  2XAG A;  1MDM B;  1JHH A;  3Q9V A;  4LK1 F;  1WI9 A;  1YYV A;  2LNB A;  5D5X B;  1REP C;  1R5H A;  3HIF A;  4GO1 A;  4I0B A;  1OYY A;  4YFN F;  4Y15 A;  2F5E A;  1J75 A;  3E3V A;  2H6C A;  5J8F A;  1T98 A;  2KIU A;  2L54 A;  3ISP A;  4IRG A;  3TO6 A;  5DEQ A;  1T39 A;  3NEU A;  2IT0 A;  3CJN A;  3WTY C;  4A6E A;  5FO5 A;  1KA8 A;  4LMY A;  4HYE A;  5DDG A;  4WXH A;  1O3Q A;  2CWE A;  3JTG A;  3RTR A;  3LST A;  3ERE D;  4HAM A;  5E1W A;  2FOK A;  3V8K A;  4BHB A;  2W84 A;  1U5T B;  3WTS C;  3SZP A;  5A2Q K;  3EQL F;  1TBX A;  4O6J A;  2DLL A;  3P7N A;  2KKO A;  2XAH A;  4KT5 C;  4HBL A;  5F6F A;  3V7C A;  3E6C C;  3JW4 A;  4U7D A;  2Z33 A;  2BV6 A;  1XGN A;  2G9W A;  2M45 A;  3KEO A;  4LG0 A;  3BY6 A;  3GO5 A;  5HDK A;  5HLH A;  2ZNY A;  1IXC A;  1U5T C;  4RGS A;  3IRQ A;  1BN5 A;  3FXR A;  4EV0 A;  4LGW A;  3GZ5 A;  1OYW A;  1T0F A;  2P7V B;  5CJ9 A;  3CO6 C;  2FXA A;  2HZT A;  5LEJ A;  4M6Y A;  2Q0O A;  1Q1H A;  4YII A;  3U2R A;  5ILS A;  1MZB A;  5HDN A;  3I59 A;  1UHM A;  3G3Z A;  3KEQ A;  4I2O A;  1H0M A;  4PCQ A;  2PBI A;  2M87 A;  1Z91 A;  4G6Q A;  4MQ9 F;  2CQK A;  1RUO A;  1R1U A;  2QQ9 A;  1U78 A;  4HX8 A;  3ZMS A;  3GFM A;  3U9G A;  3HRS A;  1BC7 C;  1Z9C A;  5ED4 A;  2PFB A;  4HDU A;  4ENN A;  2OA4 A;  1VTN C;  4KNY A;  1OPC A;  4O3M A;  1XDU A;  3QPT A;  5BPD A;  3DF8 A;  2QQA A;  1IUY A;  2RC4 A;  2IPQ X;  3HRT A;  3CDH A;  1XSX A;  1I1G A;  2ADU A;  4IF4 A;  2QWW A;  5E8G A;  2VE8 A;  1QPM A;  2KJC A;  1OKR A;  3V8J A;  1BM9 A;  3F8N A;  2W25 A;  4ENM A;  4L9V A;  1L3L A;  3I5U A;  5K5O A;  2HKO A;  2IA0 A;  4GYI A;  4KIC A;  2J5P A;  3MAJ A;  3HHH A;  1MGT A;  1D8K A;  1F4K A;  1I1S A;  3WGI A;  4ZZL A;  2BYV E;  2V79 A;  5D6E A;  4CIC A;  5E20 A;  5ILV A;  4F7Z A;  2WTE A;  4QWQ A;  4P55 A;  2P5V A;  3WU0 A;  4MHG A;  3K2Z A;  4LLN A;  5TJJ A;  3HUG A;  2ISY A;  4M74 A;  4B09 A;  3ULQ B;  1TQP A;  1R1T A;  2PEX A;  3OOP A;  4LG0 B;  3K1N A;  4PZJ A;  2FML A;  2O03 A;  3I54 A;  3KP6 A;  1ZHF A;  2YX7 A;  2VT2 A;  4GYG A;  2KRF A;  5D5V B;  4UV9 A;  3BWG A;  1R58 A;  4RAY A;  2DTR A;  2V1U A;  4EM2 A;  5H6R A;  3KLN A;  2Q2E A;  5DD8 A;  5HVQ C;  2B0L A;  1O3R A;  1FZP B;  4O5V A;  5ICF A;  2GA1 A;  1IN4 A;  1YW7 A;  4GCV A;  4BAY A;  5D8L B;  3HTS B;  3I59 B;  1F9N A;  2ZKZ A;  3GFI A;  1KQ8 A;  4M9Z A;  3TDU C;  1ZRF A;  2Z9O A;  3JAM Z;  4KN7 X;  2LF8 A;  3TO7 A;  2H6B A;  1YW8 A;  3FMS A;  2P6S A;  1MJB A;  1KQ0 A;  4KN4 X;  2FRH A;  4WF2 A;  2JSC A;  3M8F A;  2A61 A;  2DFI A;  1LQ1 A;  2IA2 A;  3M1E A;  3WG9 A;  4CXF A;  2VBW A;  2HKX A;  1IRG A;  3KLO A;  3JAM K;  4A12 A;  2UWM A;  3I53 A;  1TQM A;  5LHI A;  1XGS A;  1D8J A;  1AWC A;  4I98 B;  3IRR A;  2NAZ A;  2VOD A;  1IXR C;  3HOT A;  3BDD A;  5L3B A;  5ERI A;  1ZRE A;  3CUQ A;  1HW1 A;  2HQR A;  2VXZ A;  1GXP A;  2HTJ A;  2JPB A;  1PUE E;  2VBZ A;  2X0L A;  5FFZ A;  2IA1 A;  2P5K A;  3V4G A;  2R7D A;  4OIN F;  3MZY A;  2IJL A;  4PGH A;  1Z7U A;  1CGP A;  2NNN A;  2YX4 A;  1P4A A;  3JTH A;  2MA3 A;  4ETS A;  3ELK A;  4KIG A;  2LKP A;  3SHF A;  2VON A;  1P92 A;  1K6O A;  3KP5 A;  4LD5 A;  5ICG A;  4U0Y A;  4IHT A;  3DPL C;  1WSU A;  5BMZ A;  3F3X A;  2XV4 S;  4IHS A;  2XVC A;  2L4A A;  2LDU A;  3QAH A;  1A04 A;  1WKM A;  2A69 F;  2L01 A;  3WE3 A;  1R23 A;  4IRI A;  2PMH A;  3ROU A;  1FP2 A;  4U7B A;  2EA4 A;  3KZY A;  2QBY A;  3RPQ A;  2M8E A;  4RS8 A;  1KYW A;  4WXC A;  3TO9 A;  2EFP A;  2NYX A;  1TW3 A;  4WXD A;  3OV8 A;  3I4P A;  3F23 A;  4BH9 A;  3DEU A;  2MH2 A;  2ACJ A;  3M7G A;  1HKT A;  2AXL A;  1HXD A;  1JGS A;  4LFU A;  2OQR A;  2EB7 A;  3ZN0 A;  2CYY A;  1FSH A;  2HDC A;  1TNT A;  3WTW C;  5LBQ A;  3GFL A;  1Y0U A;  3GYH X;  1BIB A;  2WV0 A;  1YS6 A;  1LJ9 A;  4ON0 A;  1QNT A;  1YW9 A;  2XKO A;  1W4M A;  3DP7 A;  4M71 A;  1HKS A;  3E5U A;  3FXU A;  4M72 A;  3J81 Z;  5IT9 Z;  1SMY F;  4HQM A;  1XGM A;  2BBY A;  4S05 A;  2Q8K A;  2D45 A;  3LWF A;  5FD6 A;  2GIV A;  1I6X A;  4UUV A;  3CUQ B;  4EJW A;  3VOD A;  2GA2 A;  5HOO A;  3SZT A;  2A07 F;  2FBH A;  3HYI A;  3Q5F A;  3J81 K;  3U1D A;  5IT9 K;  1TQI A;  1C0W A;  3WTX C;  3HOS A;  2FE3 A;  4ZYD A;  3IC7 A;  1E2X A;  4BHP A;  5TRD A;  2A6E F;  2H27 A;  4BXU A;  2W24 A;  2GXB A;  1BJA A;  5DUK A;  4KUM A;  3IHU A;  4MNU A;  4BNC A;  1OMI A;  4ENJ A;  3GEZ A;  1KGS A;  4PDK A;  5E8I A;  3WE2 A;  3C3W A;  1ZAR A;  3QU3 A;  2K4J A;  4FX4 A;  4NHJ A;  3VFZ A;  2DW4 A;  5A2Q Z;  5CLS A;  1HBX G;  3RKW A;  4IXA A;  1FT9 A;  3L7W A;  5F1R A;  3QU6 A;  2H94 A;  2XRN A;  3BP8 A;  3GLX A;  3F6O A;  1R7J A;  1MD0 A;  4IVN A;  2MBF A;  4AVP A;  2Y48 A;  2QBY B;  4ENK A;  4XSZ F;  4JQF A;  4RAZ A;  1F1Z A;  2DPD A;  4H0E A;  2QYO A;  2JZY A;  2VOO A;  3T8T A;  3RYR A;  1KU3 A;  2ELH A;  2COM A;  3FMQ A;  2GXG A;  1LDD A;  3FXQ A;  4AWX B;  4A5N A;  2FBK A;  1KU7 A;  1QQI A;  3ECH A;  3DKW A;  1SD7 A;  2DO7 A;  2FF4 A;  4KMF A;  3DV8 A;  4LLG F;  3C18 A;  2PJP A;  2ZBK A;  2XKP A;  3HHG A;  3ZQ7 A;  5H20 A;  1IXS B;  3ML6 A;  3FM5 A;  1IN6 A;  1JHF A;  1SD6 A;  3WU1 B;  3H92 A;  2G7U A;  2FMY A;  2EFO A;  3WTT C;  1YTY A;  4NB5 A;  2DK5 A;  2F5D A;  1CF7 A;  1FYM A;  2PI0 A;  1GXQ A;  5ICE A;  2BEO A;  3N4M A;  2G7H A;  4HX7 A;  4CGZ A;  3RKY A;  1XDS A;  4HF0 A;  3D0S A;  5D6F A;  2K7L A;  3QPH A;  2BGC A;  5LGT A;  3CLO A;  2E1N A;  5LHG A;  3ZMT A;  2W85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...